4O83A

Saicar synthetase (type-1) in complex with adp/amp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with ADP/AMP
rcsb
source organism Pyrococcus horikoshii
total genus 70
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o83A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o83A02
3QF9A 4KABA 5FDPA 3NNXA 3TIIA 4FV5A 3LFAA 2ITUA 2OJIA 3QQGA 3ETJA 1M7QA 3R00A 4U5JA 2BZIB 4O7RA 3ZONA 4FKLA 5ANGA 3CGFA 1GSAA 2OH0E 1WVWA 4FT7A 5CVHA 5L6OA 3R7OA 5CXHA 5JZJA 5JK3A 5AMNA 1OIRA 3KXHA 4FKRA 4O38A 4XOYA 3T9IA 2YZLA 3AG9A 4BTJA 1XBBA 2J7TA 1H1PA 5LA6F 3UIBA 1O6KA 4FX3A 2UW7A 4NJ3A 4QTDA 3QCXA 4KIPA 3SOAA 3LJ1A 3DXQA 3DBDA 3PPKA 3PZHA 1Z2OX 5EQEA 3DK6A 3KB7A 3LHJA 3MA6A 3R0TA 2W1CA 5EW8A 5A4CA 3TUDA 4EOPA 4ASZA 5H80A 4AGDA 3QD0A 4IIRA 4C37A 3L9LA 3ZXZA 2C69A 3MGYA 3AMAA 4BGGA 2FO0A 1JDEA 3KMWA 1BYGA 4QMPA 1NA7A 3UG2A 1Y8GA 3UP7A 4ZOGA 3R83A 4D4YA 3AOXA 3DAJA 3VRYA 4WRSA 3H0YA 4FZ7A 1Y91A 3VF9A 2JDRA 3CBLA 4BVUA 1E1VA 5KMKA 3R5HA 5J87A 3LM0A 5A4QA 1FMOE 5KNJA 5HE0A 4FYNA 3DPKA 4APPA 4EUUA 3JS2A 3HKOA 3AT3A 5BVWA 1Q62A 2YAAA 1H26A 2GTMA 3DTCA 2HJWA 2OFVA 4E4TA 2X2LA 5BVFA 2RFNA 3I0OA 4YBKA 3O50A 2HWPA 2R2PA 2BZHB 2OICA 3U51A 4JBOA 5G6VA 3GFEA 3NZ0A 4DG3E 4HW7A 2RG5A 4V01A 1PXPA 1PXMA 4V0GB 2WMTA 5BUJA 5JMSA 4E8AA 3MPTA 2WQOA 4S2ZA 2PVMA 4CT1A 1AD5A 3CSVA 4PX6A 1JPAA 3G33A 3QQHA 3MH3A 3GU6A 4O7WA 4W8EA 2PMIA 5CEMA 4DCEA 1TQPA 1H24A 3EH9A 2OO8X 5AM7A 5BVOA 3SW7A 4RIOA 4L68A 4UXQA 4FYOA 4KKHA 4ZSGA 3MWUA 4R5SA 4QMYA 4KIQA 3R21A 3VF8A 2JKOA 2BRMA 3RPOA 4C33A 4LOQA 3R73A 4ZJIA 3TZMA 1JWHA 2GS6A 3P79A 4CFWA 4DIMA 2VTAA 2X7GA 4YGAA 1UVRA 2XNNA 5FBNC 4C58A 3FMLA 2JDTA 1XJDA 4FU0A 3MVJA 1SNUA 1WBPA 2GU8A 4X21A 3UNJA 5IA3A 2BRNA 5IEYA 4OTRA 1LR4A 3IOKA 2DZDA 3QCSA 2ZDQA 3BQRA 2YHVA 2PVYA 2ITVA 2QG7A 3QXPA 1KJIA 2B1PA 3VUGA 4E26A 3MBLA 5LVOA 3CXWA 3OWJA 3UOJA 3VIDA 4YHFA 5CAUA 1EUCB 2WTIA 3KULB 4HCTA 1K3AA 5IQAA 4CFUA 2W1HA 5J95A 1XKKA 4UV0A 2X9FA 5F20A 3HECA 2ZV9A 3MFSA 3DF7A 4R7BA 3ZUTA 3DKOA 4FTJA 4BZOA 5HIBA 3UDBA 2QF7A 3K3PA 3KXMA 1PK8A 3GB2A 3QRUA 4UZHA 4F7LA 3IDCA 3ZLSA 4K77A 2P0CA 4PTGA 5M51A 4TV9F 3TJDA 4RVMA 5T6KA 5DWRA 4XG4A 2X7FA 4EOJA 5A6OA 3I5NA 3LCKA 5I9UA 3G0EA 3VUKA 2PZRA 4D55A 1GGOA 4RWLA 4FSYA 3MFUA 4Q9ZA 3BLHA 3ANQA 3Q5ZA 5H8BA 4Z16A 2WTDA 4TRLA 4G6OA 1R3CA 4JAJA 3ZUVA 5HG8A 4YC6A 2UW9A 4I4EA 2VO0A 4JQEA 2ZDTA 3E92A 2BILB 3HRFA 3ZLYA 4CMTA 3IK3A 5CNOA 4QO9A 2GPWA 4H1JA 2OKRA 2XD4A 4FTKA 3SLSA 3HUBA 4JIAA 2ITYA 2PVLA 4IVBA 4AT4A 2VWWA 2EXMA 4JT3A 1W83A 4USFA 3P7CA 3NX8A 2J9GA 4I24A 3W18A 4DH8A 5LXMA 2JBPA 3UJGA 3R9NA 2XB7A 2R7IA 3CCNA 1KV1A 2CSNA 2QU6A 4U43A 5DI1A 3UOKA 4D58A 3WOWA 4C4GA 5FP6A 2OIDA 3LFCA 1Q61A 3NCZA 3L1SA 3IPHA 2ESMA 4EGJA 3RNIA 2PZIA 5IQBA 3LJ2A 4QMOA 4I92A 3L9MA 4FL3A 3CPCA 4RRVA 4EUTA 5C4LA 4EHGA 4YO4A 3P7AA 5B2LA 3WNZA 5CLPA 3VRZA 3MWEA 4G1WA 5M44A 3F2RA 3BWJA 4ZTSA 3KVXA 4R5YA 3ROCA 3NIEA 2WELA 2BAQA 4BHZA 3KREA 1FQ1B 1YHVA 3LXPA 4K18A 3BHTA 3ORXA 4QP2A 5E8ZA 2YDIA 2IP4A 1CKJA 3ZBXA 4IVAA 4JL9A 4I0RA 3ZO2A 2YM6A 4XP0A 1M14A 3FL4A 2A0CX 3WZDA 2YN8A 3QLGA 3KA0A 4P5ZA 4FKOA 4ZZMA 1P5EA 4HNUA 2RF9A 5FEEA 3QA0A 3OF0A 4L43A 3EFKA 2QOFA 1F3MC 2JLDA 5CQWA 3UOHA 4ZSJA 4E5WA 3KQ7A 4Z55A 3M1SA 4IWPA 1CQIB 5CB4F 4HZSA 1KC7A 4I1ZA 2ZV7A 4FSRA 4XNEA 5LQFA 2PVFA 3ODYX 2GFCA 3MTLA 4MWIA 4HNTA 1KE7A 5JFXA 5CF8A 4FZDB 3DDQA 4MTAA 4PV0A 4U0IA 2XNOA 4DT8A 4Z7GA 4ZAUA 5HD4A 2C6IA 3PJ1A 4C5BA 3B8QA 5AP6A 5CENA 3CP9A 4P7EA 5AADA 4JR3A 5CF6A 3MW1A 4EQCA 3MSSA 4ALWA 2R3OA 3IDBA 5LMBA 5GJFA 1R1WA 1VYZA 3TN8A 5CXZA 5DFPA 3R01A 4DEBA 5IEXA 4K33A 2OI4X 4H1MA 4RLLA 3MVLA 1MQBA 4X3FB 2GMXA 2XYNA 4KD1A 5C27A 5M56A 4L6QA 3NNUA 1TKIA 2J0IA 4ANBA 2WTKB 3MYGA 4DH1A 1GZOA 3QKLA 4RJ3A 4ZTNA 4A4LA 1O6YA 4DFXE 1JSVA 5AV3A 2RG6A 3EQPA 3O7LD 2VV9A 2UZBA 3U87A 4YZMA 3FZTA 2WMQA 4BCQA 4DLJA 4YZCA 3LCTA 1H0WA 3M2WA 4HYIA 5FD2A 3R9OA 4O0VA 5DYJA 3PA4A 2NPQA 4QOXA 5E8SA 4AW5A 4B8MA 3GU7A 2ERZE 4FL2A 4FTOA 4C36A 4C4EA 4RZWA 2C6KA 3E3PA 5L2TA 3GU5A 4YTFA 3VJNA 4ZZOA 3MH1A 4FEUA 4RIWB 4E4NA 3TUCA 2W1ZA 3OOMA 3QLFA 2R0UA 4MD7E 4EYJA 5FEQA 4I6HA 5CAEB 3ZEWA 2BDFA 4BI2A 4I50F 2O8YA 4J97A 3P23A 2R0IA 3DB6A 2QOLA 4IWOA 3LAUA 4IZ5A 4UB7A 3QAME 2GNIA 4HNFA 4FSTA 4LRJA 4X3JA 4HGSA 4IAYA 4FT9A 2R86A 3SW4A 5G1XA 3PLAE 3A60A 4G9RA 4GH2A 4IAAA 4OGRA 5FRIA 2OZOA 1OECA 5LMAA 4ASXA 3PRIA 3VS5A 4GKHA 5KMJA 3FKOA 3FE3A 3FMHA 3HP2A 3MY5A 4FTQA 1OMWA 4S31A 4WO5A 4D1XA 2YIYA 4RC3A 2JGZA 4FV0A 1Q99A 4O6EA 3RMFA 4N6YA 2GSFA 3TI1A 5DT0A 3AT2A 3K5UA 3POZA 4I5PA 2UZVA 3PA3A 4ZTQA 5KKRC 3Q2JA 5AEPA 4O96A 1GSHA 1OL6A 3K3JA 2CJMA 4AW2A 3RKBA 2IVVA 4DFNA 4JI9A 3FY0A 3FDNA 4ACGA 2C6OA 2FVDA 3EYGA 3WF6A 3VS4A 3BWFA 4J53A 4ITJA 1UA2A 2BRBA 4MF1A 3QALE 4MCVA 3C4FA 3HZTA 5CSXA 2CCIA 4O21A 4RPVA 4Z3VA 3UTOA 4FL1A 4MH7A 5HI2A 2IN6A 5M57A 5M08A 3FMNA 3Q4UA 4IW0A 3QX4A 4BDCA 4M3QA 5AA8A 4ZLYA 4ZQIA 3PVGA 3NDMA 5CANA 2PWLA 1A9XA 2VTQA 4QNAA 4YJQA 1J91A 2X81A 3QQKA 1GAGA 2E9OA 1B6CB 3WARA 4ANSA 4FNZA 4E4LA 4YBJA 4HVGA 1QL6A 4X2NA 4XG3A 3Q2MA 4QRCA 4WNOA 4G9CA 3F5GA 4Y83A 2HZ0A 4PP9A 2F2UA 3I12A 4TWNA 1ERKA 2C4GA 1L3RE 3H9FA 3PTGA 4QMXA 2BUJA 4I20A 4XG8A 4F6UA 3R71A 2VWYA 3PPZA 4PRJA 5EOLA 5GIOE 1H0VA 1ZMWA 2PU8A 2IG7A 3WBLA 1PHKA 3LMHA 4APCA 4DG0E 4JXFA 2HGSA 1GY3A 3FMEA 4R3RA 5KMIA 3ROYA 2WQEA 4YU2A 1BUHA 5IH5A 2O2UA 1H1RA 2GNLA 5CAQA 1JKJB 2WMBA 3R2BA 3AC1A 4GUEA 4DITA 4GK2A 3GU8A 3ZBFA 2PL0A 4EK8A 4FTNA 3RPRA 2EUFB 5BNJA 4HNVA 3PG1A 5F4NA 2E9PA 5AP5A 2HWOA 3DDPA 3D5XA 2W1IA 2J50A 3LKMA 4FSMA 4FUYA 2XK9A 3PIZA 4UN0C 3SOCA 4XV1A 1LUFA 4I5CA 4ZTMA 5LMKA 3DQWA 4FFRA 3OY1A 4GUBA 4B7TA 4IIJF 4G2FA 2O64A 4BGQA 1AQ1A 2OWBA 3OCGA 4FFNA 1A9UA 3K54A 3SXSA 5IUGA 1ULZA 3PYYA 4MNFA 3MB6A 5HLNA 2XNGA 4FT0A 3BHYA 4QYYA 4YAKB 1YHSA 5LMKC 3COMA 4GJ2A 4G16A 4BDIA 3GQIA 2ZMCA 2HZIA 2GHGA 4TWOA 3QRJA 3Q60A 4W4YA 4DTBA 3W8LA 2YZMA 3GOPA 2YDKA 2DQ7X 2XS0A 4UYAA 1SM2A 5EZYF 2X6EA 5H8EA 3U9NA 3PWYA 4B99A 4YJOA 1GLVA 2XNMA 3DQXA 2XKEA 2EVAA 4YJPA 4PDOA 4XP2A 3W2QA 2IVSA 5FTOA 2VO6A 5L3AA 3VUMA 4HNIA 5AIRA 2UZLA 4O81A 3TZ9A 4ERKA 4A06A 4RJ4A 2WGJA 3O51A 5JKGA 3MJFA 4D2RA 4JIKA 5AX3A 1Z5MA 4IVDA 3TZ8A 4OW8A 4JAIA 5HV6A 4TZRA 5DE2A 3JYAA 4RT7A 4EZ7A 1EZ1A 3JPVA 2OU7A 2YEXA 3LJ0A 2GNJA 3DJ5A 3DNDA 4BIEA 2PZYA 2R5TA 2UVYA 3LCOA 2WQMA 4Y85A 3Q4ZA 3QXOA 1PMEA 4S30A 4TYJA 5CU2A 2OGVA 1SYKA 4RFMA 4ZOLF 4AN2A 3TV4A 4C2VA 1KE5A 5HQ0A 4DGGA 1XH7A 3KXXA 4GVJA 2V62A 4LV5A 3IW6A 3D4QA 4F0IA 2XRWA 5HE1A 1Q4LA 4MHAA 4XV9A 3N4TA 4PP7A 2WU6A 3GCVA 4G3EA 4DINA 5HTCA 1J3HA 3QTUA 2X0SA 4QQCA 4Q2AA 3D15A 4A4XA 1YOLA 3GXLA 4BZDA 5EW9A 3MS9A 2PVJA 3U6JA 5AM6A 1PMNA 3ZSHA 4YTCA 3GLKA 1DAWA 3UVPA 5E91A 5FXQA 1Y8YA 3SG8A 5JFSA 2A27A 3PXRA 4FV2A 4XV2A 3PP0A 5IU2A 1P14A 3BI6A 4KKEA 4AU8A 3K5IA 2PVRA 1GSOA 3O8UA 4YPDA 4C3FA 1S9JA 3AC8A 2BAKA 2QO7A 4S34A 4TT7A 3RK5A 4K9YA 4MXOA 3PSCA 5CF5A 4MA0A 2J0LA 2XIRA 3HEGA 4QMMA 4O2AF 2OH4A 4GCJA 3I60A 3R04A 4N6ZA 4ZJJA 3E8EA 3C13A 2CGWA 5KO1A 4QTEA 3QTSA 2VO3A 3QTWA 3ZTXA 2HW7A 5T3QA 4HCVA 2ZOQA 4IAZA 4O0TA 3SG9A 4ITIA 4QMSA 3MH2A 4XRJA 4QSHA 2QO9A 2CKOA 2QVSE 2VX0A 5ANEA 1OVEA 4JG7A 4V04A 3FZ1A 3I4BA 4FEXA 1JLLB 1H4LA 3MESA 1FBNA 1VYWA 4HPUE 3RV3A 4IJ9A 3VBVA 1I7NA 1GIIA 2VAGA 4FKUA 3O17A 4NFNA 1AUXA 2ETKA 2WPAA 3MVMA 5DBXA 1F0QA 3IW8A 1YWNA 3DCVA 2ITPA 3HDNA 3OMVA 3V5JA 3BGZA 3JY0A 1PJKA 3CTQA 5E7RA 4ENYA 3RK7A 2YWVA 1WBSA 3R7UA 3KAJA 4QMVA 5HCYA 5ACBC 3BYSA 3BHUA 2W5HA 1PXJA 1KJJA 4XX0B 4XG9A 4OBQA 5HE2A 5HHWA 1O9UA 4UZDA 5EI2A 4FIIA 1QPEA 4HCUA 4QP1A 3TIZA 4C62A 2OK1A 4F64A 4TW9A 1ZYDA 5EYMA 4HGEA 1JDBB 3OZ6A 5HX8A 5BYYA 4AFEA 4AZSA 4H58A 4FBXA 4HYSA 5CI7A 3D2IA 3WILA 5HCZA 1OUKA 2Q0BA 3R23A 3HMMA 2ITXA 2W70A 4R77A 2XNPA 3CPBA 4BTMA 4W8DA 5GHVA 2GNGA 3HX4A 3RFCA 5D12A 4YTHA 4AWIA 5H9BA 1B6RA 3Q53A 4YJUA 4TYIA 4FFLA 2WIPA 5CA0F 4PTCA 3KXNA 1JKLA 4R6VA 3TEIA 3UOLA 3SE7A 4J98A 4JDIA 2PVHA 3R22A 2W1DA 4WT6A 3S4QA 3EB0A 5ANOA 5AUYA 1WBNA 1KOBA 4AA0A 1ZRZA 4JQ8A 4DC2A 4X2FA 5LOVF 4O0UA 3F3TA 4V05A 4FSWA 4CFNA 2YACA 2CNVA 2I7QA 5B7VA 2VRXA 4IAIA 3ODZX 5CU6A 4FOBA 2V5QA 4Y95A 4IVCA 5C1QB 2HYYA 2OJ9A 4L7FA 4DEIA 3F3VA 3GCSA 1KWPA 2REIA 2X8EA 1GIHA 4U97A 5CAOA 5JZNA 3NYOA 3U6IA 1B38A 1ZYSA 1NT2A 3P9JA 3NSZA 3SC1A 5CZHA 4PNKA 3TV7A 4CKRA 5L2SA 1IRKA 4CMOA 2WTCA 4YO6A 4XOZA 5BX0A 3CD3A 5L6WL 3UPZA 1U59A 1VEBA 3KALA 3VS1A 3NWWA 3PE1A 3GI3A 4G5JA 3QZIA 2QU5A 4MNEA 4IX4A 2QOIA 4D2SA 4O7YA 4CMUA 1OITA 2DYLA 3DGKA 3C4XA 5M09A 1G5SA 3LCDA 3KAKA 2PMOX 5I4NA 2R3LA 3A61A 4E73A 5CTPA 3S2PA 4AGUA 2FA2A 3Q5IA 3RAWA 3QUPA 4RA4A 5FUTA 5KMMA 2C00A 2XP2A 2LAVA 4BCIA 3GT8A 5BUEA 1EHIA 1URCA 4HR7A 5AP2A 3DAEA 1MRYA 5ANDA 3V5PA 1Q8UA 4MKCA 2V5AA 4L3JA 4DBNA 4ZS4A 2XKCA 3QGYA 3CY2A 5AIKA 4BY9E 2EB3A 2KTYA 3L8VA 4MAOA 4D0XA 4QQ5A 1SMHA 3ERKA 3IQ7A 1ZARA 5DPVA 2UW8A 3R8LA 1W93A 3RP9A 2XBAA 1PX2A 5HG5A 3F7WA 3ULIA 2QCSA 4ANLA 4O82A 3RINA 2OIQA 2W17A 2QOCA 3GC7A 5EG3A 1FMKA 2FSLX 2C0IA 2YIRA 3QHRA 3EWHA 4CFXA 2A19B 3ZOSA 1XR1A 3VAPA 4AW0A 3PUPA 2NRYA 2P33A 2GS7A 4ZIMA 3PY1A 4E5BA 2RIOA 4NFMA 4YBZB 1IA8A 1C3OA 3OG7A 1XBAA 5KZIA 1YXTA 3LPBA 4EH2A 4JG6A 4U41A 2JFLA 1ZYCA 3CTJA 4BCNA 2RFDA 5D9HA 4M15A 5EM6A 2JKQA 5A3XA 5A6NA 1FPUA 4MXZA 1CSNA 1REJA 4E20A 4QMNA 4YSMA 5AX9A 5HO7A 4BDDA 2WHBA 1KSWA 5ITAA 3SX9A 2PYWA 3UZPA 5JVLA 3DZQA 3QGWA 4XH6A 3WF7A 4QP7A 4XLIA 3ZUUA 3NUYA 3R8VA 5IDNA 2VPQA 3BG5A 2PZPA 4FKIA 5FP5A 1CKIA 4IFCA 2VTPA 3U9CA 3FHRA 2W9FB 3RM6A 2VTMA 2O63A 1DAYA 4CV9A 2PUIA 3T8OA 1J7LA 4RVLA 4O4LF 4GFGA 4JOAA 3Q2OA 3TIYA 2J90A 3O96A 2JC6A 4ZY6A 4ZTRA 4B9DA 5CT7A 5HU3A 5KUPA 3QZHA 3QQFA 5HD7A 3TW6A 4AZFA 3ZLXA 3KK9A 4CLJA 2DUVA 4BDEA 3TNQB 2JFMA 4RX8A 4EH7A 2WO6A 1BMKA 4JDHA 5EDPA 4YSJA 2R7KA 3U9TA 4RSSA 4ZZNA 2C5XA 1P4OA 1EYZA 2PUUA 3LQ3A 3TNHA 3EFWA 1BKXA 1AGWA 3DTWA 3OEZA 2IW8A 3U4UA 4E7WA 3ETHA 1DIKA 3R9HA 3VUHA 5CY3A 4AOTA 4NIFB 4QPSA 5CEQA 4MD8E 2X4ZA 4PF4A 4YJRA 5DR2A 3UO5A 4FFPA 1PMVA 4MEDA 4Y5HA 4Y5QA 1SNXA 4ZLZA 3U54A 1ZMUA 4H05A 4DTAA 1IA9A 1E1XA 2OSCA 3NIZA 4P90A 4F9BA 3ORZA 5FG8A 5HIEA 5KKRB 1CQJB 5D8DA 4KSQA 3TQTA 5JVDF 4J7BA 3CLYA 4WD5A 4IWDA 4TWPA 4FG7A 4QP3A 4RJ7A 4UWCA 4UEUA 5CZIA 4DF3A 2B52A 3JY9A 5CWZA 5E8VA 3UZRA 3T3VA 1YWVA 5JEBA 1OBGA 4NU1A 4O4HF 4L01A 3EQCA 4WUAA 4LQMA 3UO4A 4DE4A 3RAHA 1PXLA 3R7YA 2B54A 4MV7A 1M17A 3FQSA 4XEYA 4E5AX 2VTOA 2B9FA 5IQGA 3DFCB 5BMMA 2J5FA 5IA0A 4G5PA 2F7XE 4BCGA 2E2BA 4IB0A 4I6BA 4F09A 4J1RA 4QMTA 2WZJA 3AGMA 2PVKA 3E88A 1J7UA 2SRCA 5E8WA 3EL8A 2UW6A 4EK6A 5HU9A 3CIKA 2C1AA 3MFTA 5E8UA 5KE0A 3F6XA 1YDSE 4FKWA 1YWRA 1XH4A 2CLXA 2VGPA 3HV6A 4OBPA 3UNZA 1OL5A 4P2KA 4PMMA 4TYHA 4NM0A 2C6TA 4M67A 2AC3A 3TKIA 4E4MA 3TTJA 3DAKA 5D7VA 1A48A 4CCUA 5IYZF 1PXKA 4JDJA 3KCFA 2VWBA 4L44A 5E4HA 3W2PA 3NMUF 3DOGA 2WMSA 2YAKA 2ITQA 2NO3A 4DH3A 3CEKA 2C3LA 5D7AA 5FM3A 2R64A 4AX8A 1YHWA 2UZEA 4RVKA 4I4TF 3R9RA 4QP8A 4DFUA 4NUSA 1OL1A 5J5SA 4YAJB 2PPQA 2F7EE 4G34A 1H1WA 3SQQA 5HBHA 2HXLA 3KXGA 3NS9A 5I9ZA 4LMUA 3KF4A 3IOPA 4OT6A 4FT5A 1ZOGA 5CSWA 3FJQE 1H08A 2Y9QA 4FTUA 4L9IA 4IB5A 3GQLA 5E8XA 3TUBA 3NGAA 3L9PA 5AAEA 5I9XA 3NLBA 4XV3A 5ETCA 4EBWA 3FC1X 3RWQA 3O7LB 4PL3A 3TWJA 2BIYA 4TNDA 4EKKA 3NW5A 2KULA 4FEVA 4GT5A 4IBMA 3LFBA 2HIWA 3A62A 5LOHA 3GGFA 3IW5A 4DEHA 3CE3A 4I0SA 4GFOA 2XM9A 4RG0A 4AP7A 5KX5F 4YMJA 4H3PA 2GQRA 2W6MA 3WZEA 5L8LA 4R1YA 2EU9A 3RCJA 3ANRA 4ACHA 4BZNA 2QLQA 1V0PA 2GTNA 3VW8A 4G17A 5M07A 3ORQA 5BPHA 3VQHA 5T68A 1VKZA 4FV9A 2YRXA 2YITA 3E5NA 3H9OA 3THBA 4E6CA 4CG9A 4RIXA 3KCKA 4LRMA 3F7ZA 3ZXTA 3FI4A 3MDYA 3R7EA 2F7ZE 2E9UA 3QRIA 5A4EA 4NTSA 5EDQA 5HORA 2YZGA 3NUAA 1RQQA 3EQBA 4EKLA 4PDSA 5KMOA 5IA5A 3D2KA 2CZGA 2F4JA 5GNKA 4JNWA 1CE8A 1UWJA 2Z02A 2BDJA 2ITTA 3OCSA 2BZKB 1KJ8A 1EH4A 2E9NA 4AW1A 3PJ2A 4EYMA 1HCLA 1WMKA 3SDJA 3SD0A 4FA2A 2YM4A 4HGLA 4WNPA 3E3BX 5FXSA 3KVWA 4MV4A 2R3MA 2R3KA 2JKMA 3PZEA 4OLIA 1OPKA 2BHEA 2XH5A 3FLSA 2OXXA 2QHNA 5M55A 3MV5A 3V5LA 2R4BA 4O7VA 2WEVA 2XJ2A 4LOPA 4C4JA 4AGCA 3RJCA 1Q8TA 4DLKA 2GQSA 2XNEA 3PIXA 5HNIX 2Z60A 1UNHA 3C51A 4FICA 4L53A 4O0XA 3KRRA 4QTCA 4LGHA 2PTKA 4G3GA 4AT5A 3DNEA 3U8WA 4QNYA 4XYFA 4QMZA 2GPHA 5A54A 3EKKA 4TWCA 3UNKA 2I1MA 1KE6A 4C61A 3TINA 4ASEA 1DI9A 3CD8A 3RWPA 2XEYA 2WMAA 2JKKA 3KN6A 3LLAA 5J1VA 2FH9A 2ITZA 1XBCA 3F61A 3OW3A 4PMTA 3ZC6A 2Z7QA 4ITHA 3ZSGA 3CS9A 1VR2A 3NNWA 4I94A 3IECA 4XCUA 2WMUA 4F4PA 4CKJA 4N57A 4C3PA 2BRGA 2VTTA 4GK4A 3QD3A 2I8CA 3FZRA 4XHKB 4EH5A 5IUIA 5GIPE 5GONF 4DHFA 2E9VA 2X1NA 3BX5A 5B0XA 3BCEA 2ZM1A 5AP4A 3AD5A 1YVJA 3G8CA 4U40A 4ID7A 3W10A 3ENMA 3VUIA 1FINA 4OTQA 3E8CA 3FMDA 3NPCA 1GZKA 4IZ7A 1TQIA 3TDVA 2Z7LA 1VBHA 4C35A 1OBDA 2OXYA 3RAKA 5L8JA 4D4SA 2YS6A 3AMBA 3QQLA 4HJOA 4FK3A 2VD5A 3R7IA 4I55F 3BEAA 2P3GX 3N6RA 3OS3A 1R0EA 4BYIA 1Y6BA 2BFXA 2XIYA 3FYJX 4AE6A 2VNWA 3QTIA 1S9IA 2R3RA 1M7NA 1OGUA 4WG4A 3ZO3A 5CEOA 3O71A 2IZSA 3A4OX 4YPSA 5EYKA 4EOKA 1UWHA 2WYOA 5J2UF 1UNLA 3TNWA 4WOVA 3SXFA 3SGCA 4O7TA 5IG1A 1YI6A 2I6LA 3EOCA 5EYDA 3ATSA 5DNRA 1Q3WA 3OT3A 4KIOA 3KY2A 4ZEGA 4O4IF 2HK5A 4U9AA 2OBJA 2ZVAA 3HRCA 2XYUA 3QYZA 2WTWA 1OM1A 5LCKA 4BICA 1XH6A 2BIKB 2W4KA 4IC8A 5JH7F 3L8SA 3N9XA 2CKQA 2Y4PA 4FTCA 2G2HA 3GU4A 4Y8DA 3W2OA 4EGQA 3ORIA 2JBOA 3BYVA 4RZVA 1XHAA 4JQ7A 3IG7A 3OWKA 3HV4A 4FODA 4MWHA 5ANJA 4RVTA 5FXRA 3RPYA 4GSBA 3I6WA 4FVRA 1M2RA 3O8TA 4TUYF 4EK5A 3D14A 5JGBA 4RQKA 3UVRA 1UKHA 2YYAA 4LOOA 3EFJA 5DN3A 3BZ3A 3LIJA 4W4XA 2J5EA 3H3CA 1JLUE 5B2MA 4U3YA 4LGGA 5CEPA 4DBXA 3Q1KA 4JG8A 5EI6A 3LXLA 4FGRA 5JFWA 3AW8A 3ACJA 3F82A 4FZFB 4F1OA 4MBLA 4PL5A 3QTQA 4WBBB 3K5HA 1Q8YA 2XBJA 4ACDA 3AC4A 3W55A 5IDPA 3EQRA 1PXOA 5EQYA 1JKSA 4EEVA 4QQTA 5L8KA 3RV4A 3JUHA 4F0FA 3V04A 4RMZA 2CGVA 5BYLA 4MV6A 5DVRA 4Z7HA 2AYPA 4EK3A 4FIGA 2G15A 2QOHA 1WBWA 3N8DA 2BHHA 3OUUA 4Y8VB 2CN5A 4IADA 1U5RA 3SRVA 4F9WA 4WNKA 2CNUA 1WR2A 1OKWA 1P4FA 3FZOA 3PXZA 5ETIA 3HV7A 2BZJA 3EN4A 4AN3A 2WAJA 1OUYA 3ZYAA 5KMNA 3EIDA 4MD9E 3VHKA 5K4JA 3OY3A 4A9RA 4I22A 1LEWA 3ET7A 4FKQA 3ZDUA 2F9GA 3BEGA 2GQGA 3BYOA 2G9XA 1WAKA 4CRSA 5J8IA 1A06A 3JRWA 3MIAA 1EUDB 4A9SA 4FV4A 2W6NA 5LVNA 3FKNA 5E8TA 1UKIA 3CC6A 3W8QA 2FSOX 2VTNA 4MNEB 3F66A 5HLPA 5HLWA 3S00A 4FV8A 3UG1A 1DM2A 2EB2A 3MVHA 4ZY4A 2WQBA 3H9RA 3QC9A 4O2ZA 2AC5A 3E93A 3KRXA 4CFFA 1R78A 4NKSA 1MRUA 5C4KA 3LW0A 5TF9A 4O83A 5F95A 3TNIA 3GOKA 3P4KA 1U5QA 5CSVA 2W1FA 5HTBA 4NT4A 3ORPA 5CX9A 4IFGA 4OTIA 2XK3A 4C4FA 3PLSA 3HO8A 4R7HA 4EONA 4GKIA 4U79A 3UMWA 1KV2A 1PXIA 1OKYA 1UV5A 3DV3A 2Z7RA 4EH8A 4Q5HA 2X7OA 4WG3A 1YOJA 3FL5A 3EQIA 4NYEA 2F2CB 5ANIA 5FTGA 2WMXA 4AGWA 2Z2WA 1GZNA 4OTWA 4DGNA 5C03A 4BRXA 4LI5A 4NM7A 4PMPA 2CMWA 3JVRA 1YDRE 2B55A 2IJMA 2UUEA 3OTVA 2FPIB 2NU8B 3R9DA 3RZBA 3I0QA 3WYYA 3ENHA 4FKSA 4XMOA 2W0JA 4GJ3A 2JIIA 1FVVA 3FYKX 4YJNA 5BUIA 3UFXB 4BHNA 1LEZA 3H30A 4DFYA 5HKMA 4FG8A 4RWKA 3RK9A 5KZ0A 3U55A 2IO6A 5JQ8A 4O7SA 5JQWA 4CNHA 2ITWA 5HESA 3DS6A 3MN3A 4GIIA 4X2GA 3UIUA 2IZTA 3QU0A 1E9HA 1Q8WA 4HOKA 3O8PA 3UIXA 1Y57A 4FR4A 3WZKA 5KHWA 4A9TA 2VNYA 1ZY5A 5DRDA 2RFSA 1QPJA 1OPLA 3PWDA 1OPJA 3I81A 5CNNA 3IGGA 5GJGA 2I0EA 3PSBA 3WIKA 2PE1A 3LZBA 5LWMA 2OFUA 4AG8A 3QWKA 5FEDA 4JR7A 4BDBA 4HVSA 5CYIA 2YCFA 1RJBA 3PDTA 3C4CA 2Y4IC 3DBEA 4GVAA 3DK7A 3WO1A 2XK6A 3ZZWA 3BV2A 3FEGA 4BIBA 3NAXA 4YB8B 3RHKA 4D4RA 2W71A 5JSMA 3NCGA 2EWAA 5CVGA 1IOVA 5IF1A 1PYEA 3P0MA 5M4FA 2W6ZA 5AP7A 2HCKA 5ACKA 2QOOA 5J7HA 3QCQA 1I09A 2CNQA 4BKJA 3M42A 2PMNX 4KWPA 2FB9A 2PZ5A 1JKKA 3TJCA 1YKRA 3VBWA 4IAKA 4JBQA 5LVPA 1E4EA 2GNHA 1PMUA 4IM2A 3F3WA 5DHJA 3AQVA 3NUUA 4EBVA 2XCHA 3IONA 3RPSA 3TKHA 4AZVA 5C1PA 4AOJA 2YCSA 3IW4A 4ZS0A 3ACKA 5EW3A 3RPVA 1H1SA 4BDKA 2OW3A 3MB7A 4QTAA 3FMMA 4DTKA 5IMEA 3DLSA 4XG7A 2ZYBA 4C0TA 4J8NA 2XNBA 4C34A 2ZDGA 2ETRA 4P4CA 4CFVA 4WIHA 5L2WA 4TPTA 1M2QA 2QD9A 4O86A 4GRBA 2JDOA 3GEQA 2W05A 3WF5A 3F5UA 4FNXA 3HA8A 5FLFA 4AZWA 4D9TA 1T46A 4RFZA 4RLKA 4UY9A 2X4FA 3BGQA 1YDTE 4BBFA 3NUXA 4L00A 2BMCA 4F1MA 3OUNB 4UBAA 3U9SA 1H00A 1Z9XA 2I0HA 3E64A 3GCUA 4LM5A 4RJ8A 3ZO1A 5DEWA 3R1NA 2HELA 4E4XA 2AUHA 3NNVA 4LFIA 2RL5A 5BYZA 1Z2NX 3FI2A 4F0GA 4U42A 5BPFA 4TYHB 4BI1A 3D7ZA 3HRBA 3AC5A 4OT5A 4QT1A 3FZPA 5HVKA 3LXNA 3UC4A 4ZMEA 3VPBA 1PRYA 2PHKA 5K9IA 4IE9A 2J0MB 4GS6A 4OTDA 4GYIA 3IS5A 2BROA 4XG6A 3FPMA 3NEWA 5LCJA 4WBOA 1JBPE 4O7NA 2QK4A 1LPUA 3IDPA 4U3ZA 3VNTA 1CMKE 3OUZA 3DJ7A 4C5CA 1IR3A 3V51A 3OOGA 1H8FA 4BIDA 5AWMA 5IMXA 3MJ2A 3V5TA 5CSPA 4ACMA 3QYWA 2FB8A 1CTPE 4FTLA 4BCKA 2WU7A 3HMIA 2BTSA 4DA5A 4RWIA 2QR7A 3DBQA 4XRLA 3ZS5A 4EOLA 1CM8A 4R78A 1IAHA 4C38A 1SCUB 4M9UA 4BN1A 4DYMA 3BU5A 3G90X 4EOIA 5H8GA 5J9ZA 5D10A 4YJVA 3DKCA 3MPMA 3BBTB 3VWAA 1OIYA 1F5QA 3OTUA 3VVHA 4DG2E 4II5A 2WMWA 2IW9A 4F7NA 3G2FA 3MY1A 4KKGA 3RVGA 1URWA 2WTVA 3Q9WA 4FV6A 3PY0A 4K2RA 5JT2A 1V1KA 1PW2A 2BKKA 3W32A 2R3GA 3QBNA 3V6RA 4U7ZA 1SVHA 2QODA 3CKXA 5HG9A 1PF8A 4L52A 2UW5A 1ND4A 4FE2A 3UODA 4CQEA 3RHXA 1GOLA 2ERKA 4AT3A 2PVPA 2JIVA 4GG5A 4JX7A 1CDKA 1AUVA 3HP5A 2VTHA 3CQWA 2QLUA 3HLLA 4YC8A 2R7LA 2PE2A 4HVHA 4RIXB 5DT4A 4NSTA 1BL6A 3PVBA 4DGLC 2X8IA 5IZFA 3H10A 4EJ7A 4G31A 3PJCA 3OXIA 4GV1A 1Q41A 4ZY5A 3E8NA 5DRBA 3L8PA 3MJ1A 4J99A 2QG5A 4FV3A 3F9NA 1VBGA 4BCFA 3BLRA 3JXWA 3MIYA 2C5OA 3R1QA 2BCJA 5J9YA 1HCKA 3GC8A 5E1EA 3R8ZA 5JQ5A 3NUSA 3VS7A 3OC1A 3UO6A 1DV1A 4R3CA 2HENA 3COKA 5FQDC 1YQJA 2F49A 3PFQA 2B0QA 2W9ZB 4MVFA 4TYGA 2C30A 1TQMA 3TACA 5C1OA 4KRCA 4B6LA 2EXCX 4WHZA 4YJTA 4GFMA 1JKTA 4YNEA 4ACCA 5BPYA 4AN9A 5BVDA 4FEQA 4CTBA 4NW5A 2B4SB 5TOZA 4AACA 2JD5A 2WIHA 2W4JA 3BLQA 3FLQA 4KBCA 4QMUA 4F9AA 1NW1A 4FSZA 4GEOA 3O0GA 3VUDA 3UBDA 3E62A 1RE8A 4Z9LA 3ELJA 2WQNA 5JRQA 2W5AA 2NU9B 3GUBA 3D9VA 1QCFA 3EQFA 4FUXA 3TG1A 3V8SA 5F1ZA 2VWZA 3JVSA 4BDJA 3FZSA 2P4IA 5FGKA 2ZV8A 2YM7A 2XUUA 3BELA 3PXYA 3D83A 1OIQA 1ZOEA 3OXZA 3H4JA 3R8UA 3E8DA 4C59A 5DGZA 4WSYA 4FTMA 4QQJA 4KAOA 3G15A 4XJ0A 4ALUA 4IANA 2OZAA 4F9YA 4PQNA 2XKFA 4MX9A 2Y6OA 4MV9A 2UV2A 3V3VA 3ORMA 2RGPA 3Q32A 3MI9A 2OJGA 2ZM3A 2X2MA 3AT4A 3HYHA 4L42A 4YP8A 4KSPA 2LGCA 2QURA 4DAWA 4DN5A 5AUWA 1Z57A 3C7QA 4EOOA 4F9CA 2PBZA 4KS7A 4BDHA 4B0GA 4FC0A 3VC4A 1FGIA 3FC2A 2ZDHA 3Q6UA 4FSUA 2W5BA 3EYHA 4AXAA 3B2WA 1BL7A 2CHLA 2GS2A 2A2AA 2CLQA 2J4ZA 2PVNA 3F2NA 1ZYJA 2Y8OA 3NAYA 5AP3A 3VBXA 2JDVA 5HX6A 2W6QA 3JZIA 3DLZA 1HOWA 4J52A 2YRWA 4TKSA 3HMPA 5AP1A 4YHJA 4CCBA 2YISA 4GU9A 3A7FA 1V0BA 3LCSA 4O2PA 2ZB0A 4M13A 1UNGA 2W4OA 5JN2A 4MA5A 3VS0A 4ZP5A 4GIHA 2IZRA 3LOKA 4ZLOA 4O4JF 4IQ6A 4QYHA 4XLVA 5FBOA 4C3RA 5IQIA 4PDYA 5HBRB 4EOMA 3GC0A 4FKPA 4DFZE 3PG3A 1RW8A 1NY3A 5HICA 4KBKA 2QO2A 5IEVA 4EQUA 1ZLTA 3W2SA 4NM3A 1MP8A 2PSQA 2UW0A 3SKCA 4D0WA 2X9EA 3BKBA 3ZHPC 1M0WA 4FNWA 3F5XA 4DFBA 2J0KA 5C8MA 3FI3A 2VTRA 2G2FA 4ZI7F 2VTIA 3C0IA 3TKUA 4XX9A 4EOQA 2P55A 3TL8A 2BFYA 1M2PA 4HVIA 5AUVA 4ORKA 2YS7A 3FAAA 1ZOHA 4S33A 4O27B 5BVKA 2UZNA 4FFOA 4RFYA 4QYGA 4YURA 2ONLA 3Q3BA 1C30A 4IZOA 4X6QC 2PK9A 4MV3A 2VUWA 2VWVA 4EHEA 4MBIA 3B8RA 1UU9A 1FVRA 2C68A 5J1WA 4YZNA 2OF2A 4KRDA 2UW3A 5IQHA 2C5YA 2R3HA 2B7AA 4KB8A 1U54A 4U6RA 3UC3A 4RZQA 2ONLC 4EL9A 1IEPA 4GT4A 3UQCA 5EH0A 3SV0A 2C0TA 2Q83A 5I5ZA 3PE2A 3FXWA 2Z8CA 4F99A 1XH8A 2X8DA 3A7JA 1W7HA 2UZTA 2QHMA 3FMKA 3PPJA 1ATPE 1OI9A 1OKVA 4J8MA 4IM0A 4DEDA 5AV2A 4GMYA 5M06A 1YXVA 4BBEA 4FIFA 2NU6B 4YZ9A 4CG8A 4BDAA 1IG1A 4QYEA 2QOQA 2NNWB 2X6DA 5TR6A 2H8HA 5HVYA 3SHEA 4EC8A 1XH5A 2GNFA 3K5VA 3NYXA 3Q6WA 4FV7A 1UU8A 3FLYA 4IDTA 2VU3A 3O23A 3SRVB 4CVAA 4JBPA 3UVQA 4CFMA 3G8DA 2C1BA 2QNJA 3LLTA 3Q52A 4FI1A 1CS0A 2V22A 2FSTX 3I1AA 5LVMA 3DBFA 4FSQA 3R8PA 4NM5A 3IW7A 3ULZA 4UALA 1APME 5CI6A 4YZDA 4IWQA 4BDFA 1JSTA 1YXXA 3FPQA 4Q9SA 4UWYA 3C5UA 4AFJA 5JRSA 3DKGA 5A14A 3EZVA 4K6ZA 1Y6AA 3PA5A 4HVDA 2ZDUA 5GJDA 4EC9A 2J6MA 2W1EA 4UX9A 1M52A 2XF0A 3UMXA 1MUOA 2VZ6A 3KKVA 4I5MA 1NVSA 3ORLA 2VTLA 4IB3A 2ZB1A 4ASDA 2BPMA 3BQCA 4N4SA 4AE9A 1R0PA 2YWPA 4I5HA 4WA9A 5FDXA 1H1QA 1KBLA 2RFEA 3KMMA 3N4UA 3L9NA 5E9EA 2QR8A 2YM3A 5BVEA 5K5NA 5JGDA 5HCXA 4Y72A 2VGOA 1DV2A 1M6VA 1WBTA 5LVLA 2OXDA 4GL9A 4WG5A 3WZUA 3QFVA 2YCRA 5CSHA 3ID6C 5CU0A 2O3PA 4M68A 3ZM4A 1KE9A 5K4IA 2CKPA 2PUPA 3QKKA 4UWBA 2ETMA 3HBLA 2YERA 3QTZA 3LFEA 4NTTA 4C7TA 4G3FA 1Q97A 2QQ7A 2B9JA 3BE9A 3QZGA 2C6DA 3OVVA 2BALA 4FOCA 1QMZA 3COHA 2OF4A 4FZ6A 3HA6A 4M8TA 3ZRLA 2FPPB 2CGXA 2PULA 1BI8A 4EORA 2C6MA 1W0XC 3OEFX 4I4FA 4M7IA 4U8ZA 4NCTA 5AV0A 4RIYA 5CEKA 3AC3A 2XA4A 3ORRA 3PVWA 2YZNA 3AXWA 3G5DA 2Q0NA 5KCVA 1FOTA 4WBNF 4H3BA 4PTEA 5ETAA 5DOSA 3KL8A 3NW6A 3REPA 5AUTA 3EJ1A 3FBVA 1MRVA 2H9VA 3FQEA 4XUFA 3LQ8A 3K3IA 3ZDIA 2VWUA 4X0MA 1BI7A 1KE8A 4NCTC 2C0OA 5FNVF 5M4UA 3WF8A 3FMJA 4GK3A 5D41A 1REKA 3R63A 1T45A 3G9NA 4ANMA 5CQUA 2JAVA 4EHVA 2DIKA 4K0YA 2OIBA 3OFMA 4EH3A 2RKUA 3HAVA 2BR1A 2V58A 4W4WA 3LQ5A 4R7IA 2XCLA 4NW6A 5LXTF 5M4IA 1KUTA 5IA4A 4YLJA 4I41A 2Y4IB 1Q5KA 4RJ6A 2WMRA 4EWHA 3ZLWA 1OIUA 3RALA 5FM2A 3ZFXA 3EN5A 3FQHA 3L8XA 3MH0A 3PJ8A 4O22A 3PP1A 5C8KA 4C4IA 4LMNA 4F08A 2V55A 3DBCA 2VTSA 3H0ZA 2A1AB 3Q96A 4FV1A 3OROA 4DFLA 2NUAB 1XO2B 4RC2A 5AUXA 5HVJA 3KFAA 4BCHA 3UYTA 2J2IB 5ICPA 4OUCA 4AZTA 2VQDA 1H27A 3K2LA 2B9HA 4NZWB 5EI8A 4E1ZA 2VO7A 1W96A 4FKGA 4EQMA 4RBLA 5KKNB 5EHOA 4MK0A 5EFQA 3SXRA 5KBQA 4FIEA 4IM3A 1M0TA 3QQJA 2FUMA 4RC4A 5E90A 2XM8A 1ZY4A 4KA3A 2XMYA 4CEGA 4GG7A 3PIYA 3PXQA 3Q04A 4D28A 4BF2A 3U6HA 5EKNA 5HBJA 1UU3A 1IASA 2BDWA 4NH1A 3DFAA 3FSKA 4EK4A 2OJJA 4PDPA 1H01A 4NWMA 5LWNA 4A9UA 2VX1A 2ITOA 4UXLA 3BHHA 2PN1A 2R3FA 4E6AA 1BLXA 2C3IB 1P2AA 1E4EB 3E7VA 5AV1A 2DWBA 3VS3A 3GC9A 2QKRA 3HAMA 1K9AA 4HGTA 3QRTA 2B53A 3CTHA 5D1JA 4FGBA 2XK4A 3GCQA 1KJQA 3C4ZA 3A8XA 3LFQA 3VW6A 4EOSA 3F88A 4ZJVA 4XZ3B 2I87A 4K8AA 3S3IA 1WVYA 2X2KA 5JFVA 3V4ZA 3AGLA 4EZ3A 2P2IA 4JRNA 2O0UA 2XK8A 3C1XA 3TCPA 4BTKA 4DEAA 1NXKA 1SZMA 3BU6A 4ZSAA 2UZDA 3HVCA 2C3KA 2WKMA 4RX9A 1ZWSA 3PY3A 4BCOA 3S95A 3UYSA 1WFCA 3VMMA 4O6LA 3MA3A 4JX3A 3C9WA 2XEZA 3BV3A 3GIDA 5K5XA 4O2BF 2XRUA 3EQGA 4M69B 3T9TA 3KRJA 2XIZA 4G6LA 4YJ3F 4WUNA 5LARA 5TO8A 3OD6X 3RUPA 1U46A 4JJRA 4CRLA 5LP6F 4OBOA 3UIMA 3QL8A 1R39A 5HZNA 5I9YA 1KEEA 3D7TA 3II5A 4IACA 3VS2A 2CDZA 4QP9A 3QTXA 4FTIA 3BE2A 3KGAA 3C5IA 3GFWA 4FMQA 3DT1A 4A4OA 5F94A 1BXRA 2W06A 5E8YA 2R84A 3WYXA 3BRBA 1WCCA 3V8TA 4A07A 3SVVA 2VWXA 3CJFA 3WIGA 2VX3A 3QD2B 4L1KA 2PE0A 1RDQE 4KINA 3V8WA 3G51A 4J71A 2J0JA 2FGIA 4F63A 4O7LA 1X8BA 3A8WA 4BGHA 2HZNA 2I0VA 3NVMB 3ORKA 4I3ZA 4HQ6A 3PVUA 5H2UA 5LYJF 2R3IA 4DLIA 3A7HA 3VQUA 4EG0A 5A4LA 2YDJA 4LL0A 3TTIA 4D1SA 5C9CA 2CPKE 3F69A 3WI6A 2ZJWA 1YXUA 4K11A 4N0SA 5EHYA 4MXCA 2QI8A 2YL2A 4XYLB 3EL7A 3ETAA 1SVGA 4JLCA 2R7MA 2XJ1A 3BBWA 4FKVA 4WNMA 5L6PA 3R6XA 3V6SA 1W84A 4YUQA 3KU2A 4ALVA 3FY2A 3MFRA 4M12A 3ZH8A 4TXCA 2VWIA 2UZUE 5DG5A 4RWJA 3QQUA 4BBMA 1YW2A 2PMLX 1NVRA 3CKWA 3SAYA 1GIJA 3VBTA 2G2IA 3Q9YA 1Q8ZA 3EN9A 3AD6A 4FK6A 4IEBA 4JVGA 5HGIA 4TTHB 3RI1A 2I80A 4MBJA 4ANQA 4BCPA 4I93A 4O91A 3ZFMA 1FVTA 3TV6A 1GZ8A 4IZAA 4O0YA 2FP4B 1STCE 2YIQA 2W6PA 3AX6A 5A46A 1LP4A 2WB8A 3I5ZA 3QHWA 3KXZA 2Y7JA 5DLSA 5IPJA 3AMYA 4G6NA 4EI4A 4FTAA 3JRXA 2HOGA 1FGKA 1QPDA 1ZZ2A 1YOMA 2IVUA 3I79A 4GYGA 2GPSA 2IZUA 4R3PA 2Y6MA 2NP8A 1OB3A 4AF3A 1GNGA 2A4LA 3AD4A 3F2AA 3DXPA 3KF7A 4ZMFA 3F5PA 3GENA 4J95A 4FG9A 3QD4A 2UW4A 4XBRA 4KNBA 4RX5A 3KRWA 5DIAA 3UPXA 3C4WA 3E5AA 1DS5A 3OCTA 4RJ5A 4FKJA 4U45A 4DH7A 3PJ3A 2BVAA 4MV8A 3EN7A 2UZWE 4GT3A 2BKZA 1MQ4A 2WOUA 3POOA 4PL4A 4D5KA 4LYNA 4QMLA 3OUKA 3SA0A 2PY3A 3LFFA 4M0ZA 4LV8A 3VHEA 4DCAA 4XS2A 2R3NA 4OR5A 4F6WA 3FLZA 4YZBA 2X0GA 3NVKI 3F3UA 3Q4TA 5BMSA 3LVPA 3EFLA 3NUPA 5DR9A 4FKTA 4IJPA 4I0TA 4E6QA 5GINE 2HZ4A 4IMYA 4KUJA 4HYUA 3VS6A 2C5NA 3IO7A 4H39A 3KMUA 4MYGA 4V0GA 5EHLA 3OBJA 2NU7B 2VN9A 4P5QA 3DKFA 5DMXA 4ZSEA 2W99B 3QFFA 4YJ2F 2GLTA 2I40A 3EN6A 3FKLA 4M0YA 4CT2A 4DEEA 3B2TA 1JOWB 1JVPP 3UQGA 1PYXA 3VBQA 2BRHA 3LFSA 3QZFA 4ZTLA 1I7LA 1YRPA 2R82A 3BGPA 4EZ5A 1NVQA 4XBUA 3G0FA 2QKWB 2FSMX 3HUCA 1W82A 2H6DA 2WD1A 5AV4A 5BVNA 4AOIA 5JQGF 4ZTHA 3VULA 2CKEA 3DZOA 4O84A 5EM8A 1KJ9A 1WBVA 3BPRA 2OZAB 4ZSLA 2UVZA 4K1BA 5CU3A 2ITNA 3PXKA 5DT3A 5IQCA 1L8TA 2YZAA 3DA6A 4L3LA 3R7VA 4M14A 4CD0A 1J7IA 1H28A 5CEIA 3UQFA 4QP4A 3Q9ZA 4C2WA 5CA1F 4L46A 2DWCA 1PY5A 4BCJA 1YXSA 1K2PA 4O0RA 2JITA 5HNGA 5HIDA 4CTCA 4RX7A 3FI8A 3KEXA 2IVTA 1YI4A 3KULA 4LUDA 3OWPA 2R3JA 4MQ2A 4D1ZA 4F7SA 3Q9XA 5CVFA 3C0HA 3E7OA 2ZMDA 4IDVA 3CJGA 4M84A 4IHPA 2C6LA 5IA1A 4QYFA 5AUUA 3QRKA 3OCBA 4CZUA 5HO8A 2GHMA 5IQDA 3FSFA 3R02A 3HNGA 4ONAA 4CZTA 4F7JA 2V59A 4FSNA 2FPGB 4O0SA 1BX6A 2C6EA 2QOBA 2Y0AA 3I7BA 4TY1A 4Y46A 5HG7A 1Q24A 4YHTA 3DXNA 3A99A 4MQ1A 4BCMA 1Z2PX 3FV8A 2YM5A 3FXXA 3R1SA 4PNIA 1CKPA 1W8CA 3BU3A 5E1SA 5I0BA 1JNKA 2QONA 3UP2A 4EWQA 5D11A 3MY0A 4W4VA 3M11A 3WE4A 5KHXA 3RGFA 2W96B 2XJ0A 2IPXA 3RM7A 4F1TA 3ALOA 1B6SA 4KBAA 4OTHA 1PKGA 4YJSA 3ZO4A 5IH6A 1IOWA 3VJOA 2OLSA 1OL2A 4DGOA 4L8MA 1ZZLA 4BC6A 3C0GA 2Z04A 3VOTA 4E93A 4OTGA 4XP3A 2YJSA 3WO0A 5EKOA 3FUPA 2FYSA 2HY0A 3EQHA 4X6RA 2R85A 3LFNA 4BB4A 5KBRA 3ZFYA 2F57A 3KC3A 4AZEA 2XIKA 3P86A 2Z7SA 1GJOA 4HYHA 4YTIA 4B4LA 2JDSA 3OBGA 3EMGA 1B39A 1JQHA 1ZXEA 2R87A 5CALA 5IISA 5M4CA 2DLNA 2UZOA 3TZ7A 5C26A 4FZAB 4L3PA 4YR8A 4IH8A 4YLLA 3D94A 1T36A 4PWNA 3UZTA 2R7NA 2C3JA 4C5AA 1U54B 3EQDA 4LG4A 1PXNA 4EH4A 4FFMA 4G3DA 2CCHA 4FT3A 5EDRA 3KRLA 3HB9A 2J9MA 4LUEA 4X2JA 4YNOA 5AUZA 3E63A 4FTTA 3ZEPA 1VJYA 4BR3A 3EKNA 3FLNC 4H36A 5IA2A 3I7CA 1KOAA 3FXZA 3HDMA 4EHZA 3T3UA 4DGMA 2XKDA 4FVPA 3DK3A 5CF4A 4IB1A 4D4VA 4WKQA 5JGAA 4ZHQF 2GCDA 3CR0A 3LMGA 5TKDA 2G01A 3NYNA 3JR1A 4FVQA 2SCUB 2R7BA 3V5QA 5H3QA 1VZOA 1WVXA 3UGCA 5J2TF 2YW2A 2OG8A 5CU4A 1OZ1A 2ACXA 3G6GA 4CGAA 5BQ0A 3WE8A 3HV3A 3ZMMA 5ANKA 4AA5A 1G3NA 4X2KA 2CN8A 3OHTA 5C01A 4L7SA 2X39A 3QUDA 2B9IA 1YI3A 2C5VA 2XCKA 5IQEA 5C8NA 3IKAA 4JDKA 4CV8A 2YCQA 2ZV2A 3ITZA 3O2MA 4LL5A 1G8SA 2V0DA 2I0YA 2YJRA 4PY1A 3MPAA 3QWJA 3LP8A 4EH6A 3NRMA 2YIXA 2HW6A 2YFXA 2V7OA 3LM5A 4O0WA 2H96A 4G3CA 3P08A 4X3FA 4A7CA 4TNBA 3DY7A 4ARKA 2WXVA 4IX5A 2XIXA 3FWQA 4O7ZA 5B2KA 3TM0A 3UE4A 3V5WA 2P0AA 3HV5A 3OT8A 3VN9A 4AA4A 2YM8A 3OWLA 1XQZA 3GP0A 3R28A 5L2IA 4Q5EA 4I6QA 4U80A 5CT0A 1SVEA 4C02A 4QPAA 3A4PA 1XWSA 2YA9A 4L45A 4QMQA 4X3FC 3COIA 3VBYA 3EHAA 3ZCLA 3QCYA 4CXAA 1H07A 3VPCA 3G6HA 3LMIA 2WTKC 3R1YA 3LWBA 2WMVA 3QTRA 3G9LX 1OKZA 3A7IA 3MTFA 4QTBA 5EM5A 3VA7A 4PMSA 3OXTA 3ZU7A 3CQUA 4RIYB 1I44A 5AJQA 4RIWA 1JAMA 3AC2A 4WRGA 5DR6A 2W7XA 4RA5A 5HNBA 5M53A 4D9UA 3LE6A 1O6LA 3V4SA 4USDA 4XYMB 4CLIA 1J1BA 3FLWA 4L67A 5E92A 3NUNA 3QC4A 3E87A 4FTRA 2WTJA 3W16A 1WBOA 1TVOA 3ATTA 2OJFE 2H34A 4DH5A 5KMLA 5J9LA 3KN5A 4JS8A 2PUNA 4UYNA 4MAMA 2GFSA 4JBVA 5CAVA 4QMWA 5CASA 4LRKA 1UU7A 4IAFA 2R3PA 4MXXA 2O65A 5LJJA 3OW4A 3R5FA 4IZYA 4EJNA 3P1AA 4AAAA 4Y73A 5CAPA 3NYVA 4C4HA 3QA8A 4GU6A 3JZFA 2XZSA 4TN6A 4GW8A 2XVDA 5HEZA 4OTFA 2VR1A 4PUZA 4FIHA 5AP0A 2JEDA 3CY3A 1DI8A 3N4VA 3GNIB 3OP5A 4MXAA 2CGUA 2NRUA 4N70A 1QPCA 5EYCA 4R1VA 3GVUA 4NL0A 3D5VA 3LXKA 2V7AA 3VO3A 3CGOA 3TT0A 2WEIA 3R8MA 5BMVF 2ZAZA 1V0OA 4ZXTA 3U4WA 3WF9A 5AAFA 5JH6A 3TDWA 2JIUA 3TXOA 5DH3A 1G8AA 2XK7A 4CSVA 1OL7A 5TT7A 4QP6A 5DEYA 1W98A 4YC3A 2GDOA 2R9SA 4AQCA 4F6SA 3P78A 4FNYA 3P5KA 4ERWA 3Q4CA 4F70A 2UVXA 4TYEA 5I9VA 2P2HA 2W1GA 4IX3A 3ZM9A 4FIJA 4X7QA 2WFYA 3DB8A 4CKIA 3EZRA 3ORNA 5I9WA 3BHVA 4KS8A 5ETFA 3IGOA 3GCPA 3W2RA 4TL0A 5HBEA 3BIZA 2G1TA 3R30A 4DEGA 1H25A 5F9EA 3I6UA 4RQVA 3W1FA 3KK8A 4D5HA 4DT9A 5KX8A 4NK9A 4ENXA 4S32A 4TV8F 5EM7A 4M97A 4H3QA 2BTRA 2HAKA 2HY81 4J96A 4YLKA 4BI0A 3C50A 5CS6A 2OLCA 4IHJF 3TIGA 3NR9A 2JAMA 2IW6A 5A4TA 2QOKA 2BAJA 4BYJA 2ZM4A 2C47A 3HMOA 3BYMA 3HGKA 3C4EA 2GHLA 3N51A 4NKAA 3R5XA 4IC7A 5A9UA 3ORTA 5HE3A 3TNPC 4BTFA 3F3ZA 4NJDA 1PKDA 1BNCA 3ZZEA 3DU8A 3HMNA 4E6DA 4B8LA 4I23A 5K3YA 5EOBA 4I6FA 3HL7A 3A7GA 1J1CA 2YIWA 4USEA 1U4DA 3P7BA 4U44A 5DA3A 3S1HA 3MWDA 3ZRMA 4ME6A 1Q3DA 3D0EA 3PRFA 4HZRA 4XG2A 4BDGA 5IQFA 3D7TB 1ZMVA 3A2CA 2R3QA 2WOTA 3PXFA 3RAIA 4I21A 3ZC5A 4AS0A 3V01A 3DJ6A 4RGJA 3ALNA 3LFDA 3WZJA 1XH9A 1JSUA 1IAJA 3QX2A 2W6OA 3ZRKA 2WNTA 1WZYA 2VTJA 4AUAA 5IH4A 5EK7A 5EQPA 3R2YA 3W33A 4JRVA 2HXQA 3ZSIA 3S0OA 2QC6A 4HPTE 4IX6A 4MXYA 5AFVA 3BYUA 5IUHA 4MV1A 2YABA 3D5UA 5FTQA 5C8YF 2O5KA 3D5WA 2IWIA 3CQEA 3FHIA 3NW7A 4F65A 5AA9A 5AAGA 3PSDA 3W2CA 4FEWA 4EH9A 1ZAOA 3RTPA 4ZK5A 2DS1A 3RCDA 4U81A 2J51A 4A9YA 3GBZA 3QUEA 3QKMA
chains in the Genus database with same CATH superfamily
3QF9A 4KABA 5FDPA 3NNXA 3TIIA 4FV5A 3LFAA 2ITUA 2OJIA 1ET0A 3QQGA 3ETJA 1M7QA 3R00A 4U5JA 2BZIB 4O7RA 3ZONA 4FKLA 5ANGA 3CGFA 1GSAA 2OH0E 1WVWA 4FT7A 5CVHA 5L6OA 3R7OA 5CXHA 5JZJA 5JK3A 5AMNA 1OIRA 3KXHA 4FKRA 4O38A 4XOYA 3T9IA 4E6NA 2YZLA 3AG9A 4BTJA 1XBBA 2J7TA 1H1PA 5LA6F 3UIBA 1O6KA 4FX3A 2UW7A 4NJ3A 4QTDA 3QCXA 4KIPA 3SOAA 3LJ1A 3DXQA 3DBDA 3PPKA 3PZHA 4MUQA 1Z2OX 5EQEA 3DK6A 3KB7A 3LHJA 3MA6A 3R0TA 2W1CA 5EW8A 3RNYA 5A4CA 3TUDA 1CKMA 4EOPA 4ASZA 5H80A 4AGDA 3QD0A 4IIRA 4C37A 3L9LA 3ZXZA 2C69A 3MGYA 3AMAA 4BGGA 2FO0A 1JDEA 3KMWA 1BYGA 4QMPA 1NA7A 3UG2A 1Y8GA 3UP7A 4CC5A 4ZOGA 3R83A 4D4YA 2HHFA 3AOXA 3DAJA 3VRYA 4WRSA 3H0YA 4FZ7A 4NZMA 1Y91A 3VF9A 2JDRA 3CBLA 4BVUA 1E1VA 5KMKA 3R5HA 5J87A 4PZ7A 3LM0A 5A4QA 1FMOE 1WRVA 5KNJA 5HE0A 4FYNA 3DPKA 4APPA 4EUUA 3JS2A 3HKOA 3AT3A 5BVWA 1Q62A 2YAAA 1H26A 2GTMA 3DTCA 2HJWA 2OFVA 4E4TA 2X2LA 5BVFA 2RFNA 3I0OA 4YBKA 3O50A 2HWPA 2R2PA 2BZHB 2OICA 3U51A 4JBOA 5G6VA 3GFEA 3NZ0A 4DG3E 4HW7A 2RG5A 4V01A 1PXPA 1PXMA 4V0GB 2WMTA 5BUJA 5JMSA 4E8AA 3MPTA 2WQOA 4S2ZA 2PVMA 4CT1A 1AD5A 3CSVA 4PX6A 1JPAA 3G33A 3QQHA 3MH3A 3GU6A 4O7WA 4W8EA 2PMIA 5CEMA 4DCEA 1TQPA 1H24A 3EH9A 2OO8X 5AM7A 5BVOA 3SW7A 4RIOA 4L68A 4UXQA 4FYOA 4KKHA 4ZSGA 3MWUA 4R5SA 4QMYA 4KIQA 3R21A 3VF8A 2JKOA 2BRMA 3RPOA 4C33A 4LOQA 3R73A 4ZJIA 4AAYA 3TZMA 1JWHA 2GS6A 3P79A 4CFWA 4DIMA 2VTAA 2X7GA 4YGAA 1UVRA 2XNNA 5FBNC 4C58A 3FMLA 2JDTA 1XJDA 3BL9A 4FU0A 3MVJA 1SNUA 1WBPA 2GU8A 4X21A 3UNJA 5IA3A 2BRNA 5IEYA 4OTRA 1LR4A 3IOKA 2DZDA 3QCSA 2ZDQA 3BQRA 2YHVA 2PVYA 2ITVA 2QG7A 3QXPA 1KJIA 2B1PA 3VUGA 4E26A 3MBLA 5LVOA 3CXWA 3OWJA 3UOJA 3VIDA 4YHFA 5CAUA 3W1BA 3W1GA 1EUCB 2WTIA 3KULB 4HCTA 1K3AA 5IQAA 4CFUA 2W1HA 5J95A 1XKKA 4UV0A 2X9FA 5F20A 3HECA 2ZV9A 3MFSA 3DF7A 4UCUA 4R7BA 3ZUTA 3DKOA 4FTJA 4BZOA 5HIBA 3UDBA 2QF7A 3K3PA 3KXMA 1PK8A 3GB2A 3QRUA 4UZHA 4F7LA 3T9BA 3IDCA 3ZLSA 4K77A 2P0CA 4PTGA 5M51A 4TV9F 3TJDA 4I6LA 4RVMA 5T6KA 5DWRA 3JSNA 4XG4A 2X7FA 4EOJA 5A6OA 3I5NA 3LCKA 5I9UA 3G0EA 3VUKA 2PZRA 3PUFC 4D55A 1GGOA 4RWLA 4FSYA 3MFUA 4Q9ZA 3BLHA 3ANQA 4UCRA 3Q5ZA 5H8BA 4Z16A 2WTDA 4TRLA 4G6OA 1R3CA 4JAJA 3ZUVA 5HG8A 4YC6A 2UW9A 4I4EA 2VO0A 4JQEA 2ZDTA 3E92A 2BILB 3HRFA 3ZLYA 4CMTA 3IK3A 5CNOA 4QO9A 2GPWA 1VLRA 4H1JA 2OKRA 2XD4A 4FTKA 3SLSA 3HUBA 4JIAA 2ITYA 2PVLA 4IVBA 4AT4A 2VWWA 2EXMA 4JT3A 1W83A 4USFA 3P7CA 3NX8A 2J9GA 4I24A 3W18A 4DH8A 5LXMA 2JBPA 3UJGA 2X5RA 3R9NA 2XB7A 2R7IA 3CCNA 1KV1A 2CSNA 2QU6A 4U43A 5DI1A 3UOKA 4D58A 3WOWA 4C4GA 5FP6A 2OIDA 3LFCA 1Q61A 3NCZA 3L1SA 3IPHA 2ESMA 4EGJA 3RNIA 2PZIA 3NFGB 3LJ2A 4QMOA 4I92A 3L9MA 4FL3A 3CPCA 4RRVA 5IQBA 4EUTA 5C4LA 4EHGA 1XMMA 4YO4A 3P7AA 5B2LA 3WNZA 5CLPA 3VRZA 3MWEA 3NBZB 4G1WA 5M44A 3PN1A 3F2RA 3BWJA 4ZTSA 3KVXA 4R5YA 3ROCA 2HGXA 3DTFA 3NIEA 2WELA 2BAQA 4BHZA 3KREA 1FQ1B 1YHVA 3LXPA 4K18A 3BHTA 3ORXA 4QP2A 5E8ZA 2YDIA 1CKNA 2IP4A 1CKJA 3ZBXA 4IVAA 4JL9A 4I0RA 3ZO2A 2YM6A 4XP0A 1M14A 4LH7A 3FL4A 2A0CX 3WZDA 2YN8A 3QLGA 3KA0A 4P5ZA 4FKOA 4ZZMA 1P5EA 4HNUA 2RF9A 5FEEA 1DGSA 3QA0A 3OF0A 4L43A 3EFKA 2QOFA 1F3MC 2JLDA 5CQWA 3UOHA 4ZSJA 4E5WA 3T54A 3KQ7A 4Z55A 3M1SA 4IWPA 1CQIB 5CB4F 4HZSA 1KC7A 4I1ZA 2ZV7A 4FSRA 4XNEA 5LQFA 2PVFA 3ODYX 2GFCA 3MTLA 4MWIA 4HNTA 1KE7A 5JFXA 5CF8A 4FZDB 3DDQA 4MTAA 4PV0A 4U0IA 2XNOA 4DT8A 4Z7GA 4ZAUA 5HD4A 2C6IA 3PJ1A 1KT8A 4C5BA 3B8QA 5AP6A 5CENA 3CP9A 4P7EA 5AADA 4JR3A 5CF6A 3MW1A 4EQCA 3MSSA 4ALWA 2R3OA 3IDBA 5LMBA 5GJFA 1R1WA 1VYZA 3TN8A 1XK5A 5CXZA 5DFPA 3R01A 4DEBA 5IEXA 4K33A 2V59A 4UCOA 2OI4X 4H1MA 5I5VA 4RLLA 3MVLA 1MQBA 4X3FB 2GMXA 2XYNA 4KD1A 5C27A 5M56A 4L6QA 3NNUA 1TKIA 2J0IA 4ANBA 2WTKB 3MYGA 4DH1A 1GZOA 3QKLA 4RJ3A 4ZTNA 4A4LA 3UQ8A 1O6YA 4DFXE 1JSVA 4RCNA 5AV3A 2RG6A 3EQPA 3O7LD 2VV9A 2UZBA 3U87A 4YZMA 3FZTA 2WMQA 4BCQA 4DLJA 4YZCA 1VS0A 3LCTA 1H0WA 3M2WA 4HYIA 5FD2A 3R9OA 4O0VA 5DYJA 3PA4A 2NPQA 4QOXA 5E8SA 4AW5A 4B8MA 3GU7A 2ERZE 4FL2A 4FTOA 4C36A 4C4EA 3P5JC 4RZWA 2COIA 2C6KA 3E3PA 5L2TA 3GU5A 4YTFA 3VJNA 4ZZOA 3MH1A 4FEUA 4RIWB 4E4NA 3TUCA 2W1ZA 3OOMA 2XAMA 3QLFA 2R0UA 4MD7E 4EYJA 5FEQA 4I6HA 5CAEB 3ZEWA 2BDFA 4BI2A 3NC0B 4I50F 2O8YA 4J97A 4CMFA 3P23A 2R0IA 3DB6A 2QOLA 4IWOA 3LAUA 4IZ5A 4UB7A 3QAME 2GNIA 4HNFA 4FSTA 4LRJA 4X3JA 4HGSA 4IAYA 4FT9A 2R86A 3SW4A 5G1XA 3PLAE 3A60A 4G9RA 4GH2A 4IAAA 4OGRA 5FRIA 2OZOA 1OECA 5LMAA 4ASXA 3PRIA 3VS5A 4GKHA 5KMJA 3FKOA 3FE3A 3FMHA 3HP2A 3MY5A 4FTQA 1OMWA 4S31A 4WO5A 4D1XA 2YIYA 4RC3A 2JGZA 4FV0A 1Q99A 4O6EA 3RMFA 4N6YA 2GSFA 3TI1A 5DT0A 3AT2A 3K5UA 3POZA 4I5PA 2UZVA 3PA3A 4ZTQA 5KKRC 4CKBA 2XARA 3Q2JA 4O96A 5AEPA 1GSHA 1OL6A 4DRFA 3K3JA 2CJMA 4AW2A 3RKBA 2IVVA 4DFNA 4JI9A 3FY0A 3FDNA 4QEBA 4ACGA 2C6OA 2FVDA 3EYGA 3WF6A 3LQSA 3VS4A 3BWFA 4J53A 4ITJA 1UA2A 2BRBA 4MF1A 3QALE 4MCVA 3S24A 3C4FA 3HZTA 5CSXA 2CCIA 4O21A 4RPVA 4Z3VA 3PFYA 3UTOA 4FL1A 4MH7A 5HI2A 2IN6A 5M57A 5M08A 3FMNA 3Q4UA 4IW0A 3QX4A 4BDCA 4M3QA 5AA8A 4ZLYA 4ZQIA 3PVGA 3NDMA 5CANA 2PWLA 1A9XA 2VTQA 4QNAA 4YJQA 1J91A 2X81A 3QQKA 1GAGA 2E9OA 1B6CB 3WARA 4ANSA 4FNZA 4E4LA 4YBJA 4HVGA 1QL6A 4X2NA 4XG3A 3Q2MA 4QRCA 4WNOA 4G9CA 3F5GA 4Y83A 2HZ0A 4PP9A 2F2UA 3I12A 4TWNA 1ERKA 2C4GA 3UZOA 1L3RE 3H9FA 3PTGA 4QMXA 2BUJA 4I20A 4XG8A 4F6UA 5E25A 3R71A 4EQ5A 2VWYA 3PPZA 4PRJA 5EOLA 5GIOE 1H0VA 1ZMWA 2PU8A 2IG7A 3WBLA 1PHKA 3LMHA 4APCA 4DG0E 4JXFA 2HGSA 1GY3A 3FMEA 4R3RA 5KMIA 3ROYA 2WQEA 4YU2A 1V9PA 1BUHA 5IH5A 2O2UA 1H1RA 2GNLA 5CAQA 1JKJB 2WMBA 3R2BA 3AC1A 4GUEA 3T9DA 4DITA 4GK2A 3GU8A 3ZBFA 2PL0A 4EK8A 4FTNA 3RPRA 2EUFB 5BNJA 4HNVA 3PG1A 5F4NA 2E9PA 5AP5A 2HWOA 3DDPA 3D5XA 2W1IA 1UC9A 2J50A 3LKMA 4FSMA 4FUYA 2XK9A 3PIZA 4UN0C 5I60A 3SOCA 4XV1A 1LUFA 4I5CA 4ZTMA 5LMKA 3DQWA 4FFRA 3OY1A 4GUBA 4B7TA 4IIJF 4G2FA 2O64A 4BGQA 1AQ1A 3TEKA 2OWBA 3OCGA 4FFNA 1A9UA 3K54A 3SXSA 5IUGA 1ULZA 3PYYA 4MNFA 3MB6A 5HLNA 2XNGA 4FT0A 3BHYA 3BABA 4QYYA 3SGIA 4YAKB 2NYAA 1YHSA 5LMKC 3COMA 4GJ2A 4G16A 4BDIA 3GQIA 2ZMCA 2HZIA 2GHGA 4TWOA 3QRJA 3Q60A 4W4YA 4DTBA 3W8LA 2YZMA 3GOPA 2YDKA 2DQ7X 2XS0A 4UYAA 1SM2A 5EZYF 2X6EA 5H8EA 3U9NA 3VONA 3PWYA 4B99A 4YJOA 1GLVA 2XNMA 3DQXA 2XKEA 2EVAA 4YJPA 4PDOA 4XP2A 3W2QA 2IVSA 5FTOA 2VO6A 5L3AA 3VUMA 4HNIA 5AIRA 2UZLA 4O81A 3TZ9A 4ERKA 4A06A 4RJ4A 2WGJA 3O51A 5JKGA 3MJFA 4D2RA 4JIKA 5AX3A 1Z5MA 4IVDA 3TZ8A 4OW8A 4JAIA 5HV6A 4TZRA 5DE2A 3JYAA 4RT7A 4EZ7A 1EZ1A 3JPVA 2OU7A 2YEXA 3LJ0A 2GNJA 3DJ5A 3DNDA 4BIEA 2PZYA 2R5TA 2UVYA 3LCOA 2WQMA 4Y85A 3Q4ZA 3QXOA 1PMEA 4S30A 4TYJA 5CU2A 2OGVA 1SYKA 4RFMA 4ZOLF 4AN2A 3TV4A 4C2VA 1KE5A 5HQ0A 4DGGA 1XH7A 3KXXA 4GVJA 2V62A 4LV5A 3IW6A 3D4QA 5I5SA 4F0IA 2XRWA 5HE1A 1Q4LA 4MHAA 4XV9A 3N4TA 4PP7A 2WU6A 3GCVA 4G3EA 4DINA 5HTCA 1J3HA 3QTUA 2X0SA 4QQCA 4Q2AA 3D15A 1CKOA 4A4XA 1YOLA 3GXLA 4BZDA 5EW9A 3MS9A 2PVJA 3U6JA 5AM6A 1PMNA 3ZSHA 4YTCA 3GLKA 1DAWA 3UVPA 5E91A 5FXQA 1Y8YA 3SG8A 5JFSA 2A27A 3PXRA 4FV2A 4XV2A 2HHFB 3PP0A 5IU2A 1P14A 3BI6A 4KKEA 4AU8A 3K5IA 2PVRA 1GSOA 3O8UA 4YPDA 4C3FA 1S9JA 3AC8A 2BAKA 2QO7A 4S34A 4TT7A 3RK5A 4K9YA 4MXOA 3PSCA 5CF5A 4MA0A 1XMLA 2J0LA 2XIRA 3HEGA 4QMMA 4O2AF 2OH4A 4GCJA 3I60A 3R04A 4N6ZA 4ZJJA 3E8EA 3C13A 2CGWA 5KO1A 4QTEA 3QTSA 2VO3A 3QTWA 3ZTXA 2HW7A 5T3QA 3GJXB 4HCVA 2ZOQA 4IAZA 3WWJA 4O0TA 1Z2PX 3SG9A 4ITIA 4QMSA 3MH2A 4XRJA 4QSHA 2QO9A 2CKOA 2QVSE 2VX0A 5ANEA 1OVEA 4JG7A 4V04A 3FZ1A 3I4BA 4FEXA 1S68A 1JLLB 1H4LA 3MESA 1FBNA 1VYWA 4HPUE 3RV3A 4IJ9A 3VBVA 1I7NA 1GIIA 2VAGA 4FKUA 3O17A 4NFNA 1AUXA 2ETKA 4TVIA 2WPAA 3MVMA 5BWWA 5DBXA 1F0QA 3IW8A 1YWNA 3DCVA 2ITPA 3HDNA 3OMVA 3V5JA 3BGZA 3JY0A 1PJKA 3CTQA 5E7RA 4ENYA 3RK7A 2YWVA 1WBSA 3R7UA 3KAJA 4QMVA 5HCYA 5ACBC 3BYSA 3BHUA 2W5HA 1PXJA 1KJJA 4XX0B 4XG9A 4OBQA 3VPDA 5HE2A 5HHWA 1O9UA 3DTGA 4UZDA 5EI2A 4FIIA 1QPEA 4HCUA 4QP1A 3TIZA 4C62A 2OK1A 4F64A 4TW9A 1ZYDA 5EYMA 4HGEA 1JDBB 3OZ6A 5HX8A 5BYYA 4AFEA 4AZSA 4H58A 4FBXA 4HYSA 5CI7A 3D2IA 3WILA 5HCZA 1OUKA 2Q0BA 3R23A 3HMMA 2ITXA 2W70A 4R77A 2XNPA 3CPBA 4BTMA 4W8DA 5GHVA 2GNGA 3HX4A 3RFCA 5D12A 4YTHA 4AWIA 5H9BA 1B6RA 3Q53A 4YJUA 4TYIA 4FFLA 1ZYLA 2WIPA 5CA0F 4PTCA 3KXNA 1JKLA 4R6VA 3TEIA 3UOLA 3SE7A 4J98A 4JDIA 2PVHA 3R22A 2W1DA 4WT6A 5DGHA 3S4QA 3EB0A 5ANOA 5AUYA 1WBNA 1KOBA 4AA0A 3O5AA 1ZRZA 4JQ8A 4DC2A 4X2FA 5LOVF 4O0UA 3F3TA 4V05A 4FSWA 4CFNA 2YACA 2CNVA 2I7QA 5B7VA 2VRXA 4IAIA 3ODZX 5CU6A 4FOBA 2V5QA 4Y95A 4IVCA 5C1QB 2OWOA 2HYYA 2OJ9A 4L7FA 4DEIA 3F3VA 3GCSA 1KWPA 2REIA 2X8EA 1GIHA 4U97A 3TYKA 5JZNA 5CAOA 3NYOA 3U6IA 1B38A 4UFZA 1ZYSA 1NT2A 1UC8A 3P9JA 3NSZA 3SC1A 5CZHA 3W0QA 4PNKA 3TV7A 4CKRA 5L2SA 1IRKA 4CMOA 2WTCA 4YO6A 4XOZA 5BX0A 3CD3A 5L6WL 3UPZA 1U59A 1VEBA 3KALA 3TW7A 3VS1A 3NWWA 2Y4RA 3PE1A 3GI3A 4G5JA 3QZIA 2QU5A 4MNEA 4IX4A 2QOIA 4D2SA 4O7YA 4CMUA 1OITA 2DYLA 3DGKA 3C4XA 5M09A 1G5SA 3LCDA 4DQNA 3KAKA 2PMOX 5I4NA 2R3LA 3A61A 2VUGA 4E73A 5CTPA 3S2PA 4AGUA 2FA2A 3Q5IA 3RAWA 3QUPA 4RA4A 5FUTA 5KMMA 2C00A 2XP2A 2LAVA 4BCIA 3GT8A 5BUEA 1EHIA 1URCA 4HR7A 1CKNB 5AP2A 3DAEA 1MRYA 5ANDA 3V5PA 1Q8UA 4MKCA 2V5AA 4L3JA 4DBNA 4ZS4A 2XKCA 3QGYA 3CY2A 5AIKA 4BY9E 3HT5A 2EB3A 2KTYA 3L8VA 4MAOA 4D0XA 4QQ5A 4LV7A 1SMHA 3ERKA 3IQ7A 1ZARA 5DPVA 2UW8A 3R8LA 1IYEA 1W93A 3RP9A 2XBAA 1PX2A 5HG5A 3F7WA 3ULIA 2QCSA 4ANLA 3JZ6A 4O82A 3RINA 2OIQA 2W17A 2QOCA 3GC7A 5EG3A 1FMKA 2FSLX 2C0IA 2YIRA 3QHRA 3EWHA 4CFXA 2A19B 3ZOSA 1XR1A 3VAPA 4AW0A 3PUPA 2NRYA 2P33A 2GS7A 4ZIMA 3PY1A 4E5BA 2RIOA 4NFMA 3AKKA 4YBZB 1IA8A 1C3OA 3OG7A 1XBAA 5KZIA 1YXTA 3LPBA 4EH2A 4JG6A 4U41A 2JFLA 1ZYCA 3CTJA 4BCNA 2RFDA 5D9HA 4M15A 5EM6A 2JKQA 5A3XA 5A6NA 1FPUA 4MXZA 1CSNA 1REJA 4E20A 4QMNA 4YSMA 5AX9A 5HO7A 4BDDA 2WHBA 1KSWA 5ITAA 3SX9A 2PYWA 3UZPA 2QB5A 5JVLA 3DZQA 3QGWA 4XH6A 3WF7A 4QP7A 4XLIA 3ZUUA 3NUYA 3R8VA 5IDNA 2VPQA 3BG5A 2Q2UA 2PZPA 4FKIA 3BA8A 5FP5A 1CKIA 4IFCA 2VTPA 1A0IA 3U9CA 3FHRA 2W9FB 2HIXA 3RM6A 2VTMA 2O63A 1DAYA 4CV9A 2PUIA 3T8OA 1J7LA 4RVLA 4O4LF 4GFGA 4JOAA 3Q2OA 2HVQA 3TIYA 2J90A 3O96A 2JC6A 4ZY6A 4ZTRA 4B9DA 4AQKA 1TA8A 5CT7A 5HU3A 5KUPA 3QZHA 3QQFA 5HD7A 3TW6A 3NBYB 4AZFA 3ZLXA 3BAAA 3KK9A 4CLJA 2DUVA 4BDEA 3TNQB 2JFMA 4RX8A 4EH7A 2WO6A 1BMKA 4JDHA 5EDPA 4YSJA 2R7KA 3U9TA 4RSSA 4ZZNA 2C5XA 1P4OA 1EYZA 2PUUA 3LQ3A 3TNHA 3EFWA 1BKXA 1AGWA 3DTWA 3OEZA 2IW8A 3U4UA 4E7WA 3ETHA 1DIKA 3R9HA 3VUHA 5CY3A 4AOTA 4NIFB 4QPSA 5CEQA 4MD8E 2X4ZA 4PF4A 4YJRA 5DR2A 3UO5A 2HG8A 1PMVA 4MEDA 4Y5HA 4Y5QA 1SNXA 4ZLZA 4FFPA 4QDVA 3U54A 1ZMUA 4H05A 4DTAA 1IA9A 1E1XA 2OSCA 3NIZA 4P90A 4F9BA 3ORZA 5FG8A 5HIEA 5KKRB 1CQJB 5D8DA 4KSQA 3TQTA 5JVDF 4J7BA 3CLYA 4WD5A 4IWDA 4TWPA 4FG7A 4QP3A 4RJ7A 2ODTX 3PFFA 4UWCA 2AEGA 4UEUA 5CZIA 4DF3A 2B52A 3JY9A 5CWZA 5E8VA 3UZRA 3T3VA 1YWVA 5JEBA 3SNOA 1OBGA 4NU1A 4O4HF 4L01A 3EQCA 4WUAA 4LQMA 3UO4A 4DE4A 3RAHA 1PXLA 3R7YA 2B54A 4MV7A 1M17A 3FQSA 4XEYA 4E5AX 2VTOA 2B9FA 5IQGA 3DFCB 5BMMA 2J5FA 1TFFA 4G5PA 5IA0A 2F7XE 4BCGA 4Q4DA 2E2BA 4IB0A 4I6BA 4F09A 4J1RA 4QMTA 4UCVA 2WZJA 3AGMA 2PVKA 3E88A 1J7UA 2SRCA 5E8WA 3EL8A 2UW6A 4EK6A 5HU9A 3CIKA 2C1AA 3MFTA 5E8UA 5KE0A 3F6XA 1YDSE 4FKWA 1YWRA 1XH4A 2CLXA 2VGPA 3HV6A 4OBPA 3UNZA 1OL5A 4P2KA 4PMMA 4TYHA 4NM0A 4PZ8A 2C6TA 4M67A 2AC3A 3TKIA 4E4MA 3TTJA 3DAKA 5D7VA 1A48A 4CCUA 4DAAA 5IYZF 1PXKA 4JDJA 3KCFA 2VWBA 4L44A 5E4HA 3W2PA 3NMUF 3DOGA 2WMSA 2YAKA 2ITQA 2NO3A 4DH3A 3CEKA 4K6NA 2C3LA 5D7AA 5FM3A 2R64A 4AX8A 1YHWA 2UZEA 4RVKA 4I4TF 3R9RA 4QP8A 4DFUA 4NUSA 1OL1A 5J5SA 4YAJB 2PPQA 2F7EE 4G34A 1H1WA 3SQQA 5HBHA 2HXLA 3KXGA 3NS9A 5I9ZA 4LMUA 3L2PA 3KF4A 3IOPA 4OT6A 1TAEA 4FT5A 1ZOGA 5CSWA 3FJQE 1H08A 2Y9QA 4FTUA 4L9IA 4IB5A 3GQLA 5E8XA 3TUBA 3NGAA 3L9PA 5AAEA 5I9XA 3NLBA 4XV3A 5BWVA 5ETCA 4EBWA 3FC1X 3RWQA 3O7LB 4PL3A 3TWJA 2BIYA 4TNDA 4EKKA 3NW5A 2KULA 4FEVA 4GT5A 4IBMA 3LFBA 2HIWA 3A62A 5LOHA 3GGFA 3IW5A 4DEHA 3CE3A 4I0SA 1XDNA 4GFOA 2XM9A 4RG0A 4AP7A 5KX5F 4YMJA 4H3PA 2GQRA 2W6MA 3WZEA 5L8LA 4R1YA 2EU9A 3RCJA 3ANRA 4ACHA 4BZNA 2QLQA 1V0PA 2GTNA 3VW8A 4G17A 5M07A 3ORQA 5BPHA 3VQHA 5T68A 1VKZA 4FV9A 2YRXA 2YITA 3E5NA 3H9OA 3THBA 4E6CA 4CG9A 4RIXA 3KCKA 4LRMA 3F7ZA 3ZXTA 3FI4A 3TY8A 3MDYA 3R7EA 2F7ZE 2E9UA 3QRIA 5A4EA 4NTSA 5EDQA 5HORA 2YZGA 3NUAA 1RQQA 4AXCA 3EQBA 4EKLA 4PDSA 5KMOA 3UDSA 5IA5A 3D2KA 2CZGA 2F4JA 5GNKA 4JNWA 1CE8A 1UWJA 2Z02A 2BDJA 2ITTA 3OCSA 2BZKB 1KJ8A 1EH4A 2E9NA 4AW1A 3PJ2A 4EYMA 1HCLA 1WMKA 3SDJA 3SD0A 4FA2A 2YM4A 4HGLA 4WNPA 3E3BX 5FXSA 3VNNA 3KVWA 4MV4A 2R3MA 2R3KA 2JKMA 3PZEA 4OLIA 1OPKA 2BHEA 2XH5A 3FLSA