4O83A

Saicar synthetase (type-1) in complex with adp/amp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with ADP/AMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o83A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o83A02
3NVMB 2GTMA 5E7RA 3W2QA 2ITYA 2UZVA 2XIKA 4BDFA 2AUHA 3ZFYA 3PDTA 4GIHA 3VPCA 2XIYA 3BV3A 4JRVA 3QGWA 4DTKA 2BRBA 2J6MA 4E4XA 5J2TF 4YLKA 2JFLA 4A07A 4EYMA 3F7WA 1SVGA 4UV0A 4WIHA 1KE7A 1YWVA 1OL7A 3DKCA 3B8QA 4V04A 3E8NA 4ZLZA 2XCKA 5LVNA 4TT7A 1OIQA 3RJCA 2VD5A 1J1CA 5CAVA 2C6LA 4CT1A 2R3GA 4ITIA 4FK3A 2R85A 5EKNA 5H2UA 3ZC6A 4RJ3A 3DKOA 2W6MA 5BNJA 2GS7A 4Y46A 4D4RA 3DTWA 4U45A 4EH4A 3LJ2A 4G9CA 2BAJA 3IG7A 2YWVA 4J8NA 4FZ7A 3UOLA 3CPBA 4YURA 3KFAA 5IH5A 4AZVA 4X2JA 3SV0A 3POZA 2Z7RA 1WCCA 2GNFA 5CI6A 3K3JA 2W6ZA 3KN5A 2QQ7A 3DBQA 3HRFA 3T8OA 2IZUA 1EUDB 2NU6B 2PZYA 3K3IA 4F9AA 1ULZA 5CNNA 5CAOA 4DH5A 2YAKA 2FP4B 3SE7A 4MF1A 2G9XA 3RTPA 3VN9A 3KXGA 4ZK5A 4GCJA 5HG7A 1KUTA 4YHFA 2R0IA 3BLQA 2X6EA 2VWXA 3IW6A 3COHA 4U5JA 4TYEA 3BU3A 3QZIA 4JIKA 5A46A 4FNYA 3EN4A 4F70A 4O4JF 4C58A 1CS0A 5C8KA 4USEA 2GLTA 3EFWA 4FKIA 3KK9A 2J0JA 2P3GX 3Q4CA 2WAJA 5FNVF 4XJ0A 4ZLOA 4UX9A 3PRIA 3AGMA 5J9ZA 2H9VA 3MBLA 4BVUA 2A0CX 1WBNA 2R4BA 2XD4A 3LCDA 3LW0A 3NLBA 4BTJA 4DEAA 3GEQA 3KRXA 3I4BA 2QU6A 4RJ5A 2J5FA 1NVRA 3NUSA 3P5KA 4FFMA 4DLKA 3RHKA 4AGCA 5HNGA 4BBEA 4R7IA 3VRYA 2UV2A 4JQ7A 2GQSA 4I6HA 3UZPA 4CFWA 4YZCA 1VBGA 2PUUA 4WRGA 4EOIA 2IWIA 4M8TA 5EG3A 4I93A 1HCLA 4QP2A 1KE8A 5CAPA 3TUCA 3K5VA 4O6LA 4S2ZA 3W16A 3LHJA 4YJQA 4CFXA 5JGDA 2VTQA 2SCUB 5JQGF 5M56A 1WZYA 4ITHA 1ZOHA 3QA8A 4M3QA 3QALE 3SW7A 3A7GA 2XP2A 5H3QA 4PTCA 3DY7A 2B4SB 4G3EA 4WT6A 5C26A 3ELJA 2VNYA 4KRDA 4I22A 3DJ7A 3TNQB 1OKWA 5F20A 5E90A 4ZY5A 1UWHA 4FTMA 3AQVA 3FHRA 4HZSA 3BYOA 2GNGA 2PTKA 1SVHA 3NS9A 1PW2A 2HGSA 4C5BA 4EUTA 3MGYA 4E6DA 4OTFA 2R3HA 5HV6A 1Y8GA 3LFDA 4IE9A 5LMBA 1ERKA 3NMUF 3DKGA 4GG7A 3UYSA 5BPYA 1RQQA 4TTHB 4F7NA 5CU0A 5I9VA 4O22A 2IPXA 2YIQA 1STCE 4I21A 4ZS0A 3NNXA 2BKKA 1FVVA 3FKLA 4IVAA 4BCGA 5DRDA 4BTKA 4HW7A 2VX3A 4JXFA 5HI2A 4MV3A 2WQOA 4WNPA 2YIRA 5AX9A 2OJIA 3Q32A 4RZVA 5JT2A 4IAZA 3ORTA 2VV9A 4QTCA 4EHEA 5EW3A 5GNKA 3TV6A 4ZP5A 5HTBA 3P4KA 2G1TA 2HZIA 4XRLA 3CQUA 2W70A 3VW8A 3BE9A 4MQ1A 3PWDA 4BGGA 3KB7A 3ZUUA 5ICPA 3HP2A 2PVNA 4FV0A 2HXQA 4EH5A 5BVDA 3IGOA 2G2FA 4GU9A 3R01A 3TN8A 1YHVA 3BYMA 4EOLA 4MEDA 2HIWA 4O0TA 3JVRA 3KVWA 2EUFB 4QP9A 4NM0A 1QPDA 3R6XA 2C47A 4XRJA 1IOWA 3AC5A 1QL6A 2BKZA 5KBRA 2QOBA 1YWNA 3QLGA 3KXHA 4HJOA 3Q5ZA 4XLVA 5L2TA 4BCQA 3SLSA 4Y5QA 4N70A 4QOXA 4ASDA 5HE3A 4NM3A 5L3AA 1IOVA 4L68A 4IM3A 3PZEA 3QYZA 2BFYA 2CJMA 5K5NA 4AZFA 4NIFB 4FIGA 4LM5A 4M84A 3PVBA 2JD5A 4X7QA 4FFNA 1XJDA 4FR4A 4DH7A 4YC8A 1O6LA 3A2CA 4CFUA 1A9XA 4KBAA 3WI6A 1CKIA 4RX7A 3ORIA 3REPA 3MY0A 3PLSA 3DDPA 5M4CA 3PJ2A 3GUBA 4NW5A 4K77A 4AZTA 3VHEA 4F9YA 2IO6A 2WMSA 3GU4A 3Q53A 4QTBA 2R84A 3SDJA 4BCPA 5KMNA 3RFCA 2YCQA 2ZM3A 1PX2A 3IS5A 4RIOA 3IECA 3Q2OA 4O27B 4BR3A 3R1NA 5BQ0A 4CXAA 2J0KA 2YM4A 1GSHA 1KV1A 2P55A 2CGVA 4ANSA 3PXFA 5M57A 2XVDA 4QMVA 1R39A 2OIDA 5DG5A 5AP2A 4ZY4A 1J3HA 3VULA 1W96A 4F7JA 4FTKA 1TVOA 2KULA 2X7OA 2XNMA 4TWOA 5KUPA 1I09A 3NW7A 4I4TF 4FEUA 4ENYA 1WBVA 4QMNA 5IYZF 3KCKA 3HV7A 2PZIA 5FBNC 2VWZA 1FVRA 1PXKA 2C5NA 2PU8A 2R3LA 3QUEA 4FV2A 3TT0A 2E9UA 5HESA 5FDXA 3BGPA 5FEQA 2WB8A 2NRYA 4L67A 4G34A 2O5KA 2CHLA 5EYMA 3ZM4A 5H8EA 2DLNA 5LP6F 2I0HA 4FL3A 1QPCA 3ALOA 3DNEA 2OGVA 2ITVA 5EHLA 1EH4A 4BBFA 4FTAA 5E8ZA 1H26A 1KV2A 5EQEA 4DGNA 4IX5A 4YMJA 3EH9A 3D4QA 3OWPA 2YM5A 2OJGA 3WYXA 5CENA 5T6KA 3L9PA 3R63A 2B9HA 2GTNA 5AIRA 5JMSA 2WQNA 1H27A 4FTIA 1P14A 1XH6A 1APME 2QVSE 4FA2A 4XV1A 1PRYA 5KHXA 2CKEA 1SNUA 3Q9XA 2PZPA 3UP2A 3EMGA 4B6LA 4BHNA 2C0IA 3ZM9A 4IZYA 4IH8A 1PMEA 2YITA 3GENA 4FFRA 3U4WA 1NXKA 2OFVA 4KSPA 4WBBB 2FPGB 3G6GA 2OZOA 4CMUA 3FMMA 3QTUA 4HGTA 4QNAA 5IF1A 5E8WA 2BRNA 4ZEGA 4WG5A 4DEEA 3T3UA 4IX6A 2P0AA 1WAKA 1BI8A 4TYHA 5AAFA 5HE0A 3PA4A 3UODA 2CLXA 1A48A 2OSCA 1OPLA 3BG5A 3D5VA 4C7TA 3DLZA 3H3CA 3QC4A 3ROCA 3F3ZA 3TCPA 4ACCA 5FP5A 3HMNA 2XUUA 4NTTA 2Y4IC 5HD7A 2PSQA 4DN5A 3RKBA 3E63A 4J1RA 4WHZA 1OL5A 1WMKA 3PSDA 1Q5KA 2V5AA 2YN8A 4HCTA 3Q96A 4DEHA 3WZDA 1MUOA 3OMVA 1FQ1B 5HKMA 1R78A 1YOJA 5DYJA 4RG0A 5FM3A 2YFXA 3FZPA 5LMAA 3F66A 3LQ5A 5L8LA 4E7WA 4GRBA 2VX1A 2FSMX 2IW6A 3IONA 3HMIA 4EKLA 4FBXA 3FLQA 4GIIA 4L00A 4LOQA 3UBDA 3HV5A 3BHYA 3P9JA 3QA0A 4YPDA 3GC7A 5M4IA 3M1SA 3D5XA 2R7NA 3A61A 2XKDA 5LXTF 2DS1A 3PG3A 3U87A 2B9FA 5JN2A 5HIDA 1GZ8A 4IAIA 3ZSIA 4ZZOA 3DFCB 3QGYA 3N4UA 2CKPA 2ITXA 2QG5A 2IVTA 2QHNA 3E5AA 3G2FA 2WIPA 4TRLA 5JH6A 1PKGA 3EKNA 1SCUB 3FL4A 5TKDA 4YJRA 4L53A 5KMLA 5HLNA 4CZUA 2Y0AA 3QD0A 3L1SA 1A9UA 4RT7A 5JKGA 4XOYA 2UW7A 2YWPA 4FIEA 3TIYA 4BYIA 5KMKA 4XMOA 5AUTA 3SC1A 4TV9F 3HMPA 4LUDA 2XK9A 4AGDA 4J8MA 3E87A 4EOMA 3NSZA 3P7BA 4U79A 3R28A 4V0GA 5CZIA 1YOLA 3EZRA 3G9LX 5HG5A 4V01A 4Q5HA 4O0RA 4S34A 3SKCA 3UIBA 2A27A 3AC8A 4I94A 3VPBA 2Y9QA 3JRWA 3DAKA 4FKPA 1U5RA 3F5UA 5CAQA 3GU6A 1ZYCA 5AP4A 5A54A 4DBXA 4D9TA 2QONA 3RPSA 5CI7A 4I5HA 4ERKA 3LWBA 1KSWA 4RWIA 4XP0A 4RX5A 1Z2OX 2UZNA 4G16A 5IA3A 1XH9A 1AD5A 3PJ8A 3FI4A 5FLFA 3OD6X 3PJ1A 2R7LA 2QOLA 4OTWA 2W05A 3ZO4A 3CGFA 2YZNA 4EHZA 4L9IA 3R1YA 5CSVA 4QMTA 3G6HA 2BRHA 5ACBC 3HMMA 3RWQA 2OKRA 4Q9SA 2WMTA 3HKOA 3G8DA 2QURA 4Y95A 5K3YA 3GOKA 3NUAA 4FV5A 5EK7A 3HB9A 1JSUA 4YTFA 4KINA 4J52A 3OUKA 2XJ2A 3RVGA 4PWNA 3E8DA 2XBJA 5CQUA 4HZRA 2O3PA 1M14A 4FKJA 1WBSA 2ZM1A 3WF8A 4AZEA 3WYYA 4IB3A 3ZO3A 3QCXA 2CPKE 3EJ1A 3VOTA 1YW2A 2E9NA 4LMUA 3MA3A 2C5YA 2IJMA 3QWJA 4FSTA 2ERZE 4MX9A 5CWZA 4FVQA 4FTQA 5H8BA 4AT4A 4BDEA 4DTBA 4EEVA 2W1CA 4G6LA 1Z5MA 5BX0A 5IDPA 1IA8A 4GS6A 2PMIA 3F9NA 3VVHA 1ZYJA 2V22A 4MXOA 2W6QA 1CMKE 1JKTA 4FL1A 2V7OA 4GSBA 4XS2A 4EOQA 5J1WA 5FUTA 1NVSA 1BX6A 3FPMA 2OK1A 3KL8A 4EYJA 2X2LA 3DK3A 5JVDF 4PNIA 3ZFXA 4AS0A 1H0WA 4F1OA 3CLYA 4WKQA 3PJCA 3HRCA 3PG1A 2YS6A 3WO0A 4RJ6A 2XRUA 4S30A 2JDVA 2OH4A 3DQWA 5HLWA 3WF6A 4C4HA 1GAGA 4AACA 3K3PA 2GU8A 1OITA 1LEWA 3LFCA 5B2MA 3HBLA 3FJQE 3EL7A 2PVJA 3ZEPA 2WTDA 2YS7A 2F2UA 3VWAA 1A06A 2PVKA 4U44A 2DUVA 5A3XA 1G3NA 3I6UA 3EQFA 5M4FA 4KKEA 4IIRA 2B53A 4M97A 3OY1A 2ETMA 3GQLA 2QLQA 1U59A 2JDTA 1PXPA 3OUNB 1LPUA 1VYZA 4JJRA 3VQUA 2X7FA 2XYUA 3L9NA 5LCKA 5LYJF 2BUJA 2FGIA 4BZOA 4AN9A 3RAKA 3PXKA 3FAAA 3E5NA 1CKJA 2HZ0A 3KEXA 5C8NA 3LLAA 3MVLA 3OVVA 4JLCA 3ZO2A 4MKCA 3KULB 2VTOA 4XG2A 2C5XA 3ORXA 2IZTA 2XNBA 4QMZA 3SG8A 5CTPA 4ZOLF 1ZAOA 4MAOA 3R1SA 5CA1F 1WBPA 3EZVA 2PMNX 3FXZA 4M9UA 3BIZA 5CNOA 4PUZA 5JRSA 5HVYA 4IQ6A 5CT0A 3GC0A 5IZFA 4IC7A 2Z60A 4FKWA 4H3QA 4XV3A 4C33A 1JDEA 3OCTA 2X2MA 3G5DA 2VTHA 3QQHA 4GMYA 3UC4A 5E8UA 3GOPA 3NUYA 4YO4A 3I0QA 2X6DA 3MWDA 2Q83A 2E9VA 3MH3A 4XOZA 3CQEA 4J71A 4MBLA 4A9TA 2G2IA 2R7BA 2W1ZA 1U5QA 2PYWA 5CAEB 2ZDQA 3NNVA 2J0MB 2E9PA 3JPVA 3C5UA 3L9LA 3R2YA 4N6ZA 4D0WA 3OC1A 4RIYB 5IQFA 3N6RA 3SRVA 1JWHA 2EB3A 5D41A 1Q8TA 3GNIB 4HQ6A 1TKIA 5DH3A 4E5WA 4FV9A 1YWRA 1REJA 3IW8A 4U43A 4I55F 3Q2MA 4F99A 3EB0A 2C3JA 4YJUA 3FKNA 2J50A 2XK7A 5IA0A 3KY2A 5CU6A 1H07A 3QRTA 5DT4A 4RIXA 5JQ8A 4IANA 2WTCA 2NU7B 1JKJB 5DN3A 5CVGA 2XM9A 4GKIA 2XK3A 2WD1A 3IGGA 3ACJA 4BZDA 3I79A 4KSQA 2OH0E 4BDHA 4G3FA 5E4HA 4OLIA 3NGAA 3SXRA 3VUHA 4AA5A 4IX4A 3MJ1A 4OBPA 2CMWA 4FC0A 3FLNC 4ZSAA 1GNGA 3KXXA 2XCLA 4B99A 4CTCA 2GPWA 5HX8A 2BCJA 4KS8A 3IDCA 4O7LA 4QPSA 1ZOGA 5J87A 3SGCA 2YDJA 3SXSA 1NY3A 3ZXZA 3UNJA 3LXNA 4BZNA 2ITPA 5FBOA 5AUZA 2R3IA 2FSLX 3FHIA 2QI8A 4O2ZA 1I44A 1PMUA 3DCVA 1PKDA 2DQ7X 3FMHA 3Q4ZA 2SRCA 4MHAA 5DA3A 5E8YA 5EI2A 3R8LA 2VPQA 4U8ZA 4H1MA 4L3PA 2WMWA 3R02A 2HAKA 3EQRA 1YOMA 2R3MA 4G17A 5L6WL 3VS5A 5L2WA 4MAMA 4LYNA 2FH9A 4NYEA 3GFWA 5LWMA 3VHKA 3UMWA 3U9NA 2QOQA 5E92A 5CSPA 5DIAA 1OIYA 4FSMA 3TWJA 3V8WA 4HVHA 5IUGA 5LJJA 3W2RA 2WMAA 2QNJA 4I92A 3MI9A 3R00A 2W0JA 2NU9B 3QQUA 3QQKA 3R2BA 4L43A 3BLHA 4Y73A 5FQDC 3ODYX 3KXMA 3W2OA 1PF8A 3ANQA 2VUWA 4IWQA 4N0SA 3MSSA 4BCIA 3R7EA 2WTKB 4J96A 4QPAA 2RFEA 3R0TA 4EG0A 5D9HA 1TQIA 1ZXEA 2RIOA 2UW5A 5EYDA 3VBYA 4EQUA 5J9LA 2OF4A 3OY3A 4C37A 3A99A 3QZGA 3BHVA 4O0VA 5CASA 4YHTA 3K54A 4QMMA 4YZMA 3NYXA 3COKA 3OOMA 5J9YA 1OM1A 4AFEA 4A4OA 1H01A 5AIKA 5KMJA 4IVBA 2YJSA 4HVIA 1DAWA 4E4NA 4FKTA 1UNLA 3ULIA 3VC4A 1SVEA 5AV0A 3EIDA 1V0BA 4RC4A 3VBVA 2ZMCA 3G9NA 2C30A 4FV3A 3TZ7A 2R5TA 5G6VA 4KS7A 4HGLA 4O91A 4Y8DA 4ACDA 1BNCA 4K18A 3LP8A 4PL3A 2NRUA 2O63A 2ZDTA 4CT2A 3KN6A 4WBOA 3QTRA 3AC3A 4AT3A 3U6JA 4LQMA 1BXRA 4C5CA 5A9UA 3GLKA 1CKPA 2PMOX 4IHPA 1T36A 2JKOA 2B0QA 3V51A 5GJGA 3B8RA 4IWDA 2ZAZA 5BPFA 2P4IA 3T9IA 3IKAA 1OMWA 3Q2JA 3UO6A 4QQ5A 5C1PA 5F94A 4BTMA 5JSMA 1OZ1A 2B54A 3PYYA 5A4TA 1W7HA 4O6EA 3WIGA 3HNGA 4A9RA 4PQNA 4EC9A 5GJFA 4PDPA 3GT8A 4MXZA 4QYHA 3FXXA 4Z9LA 5EW9A 4F09A 2C00A 5M08A 3QZFA 1EYZA 3BPRA 3ZMMA 2ITNA 3DNDA 1PMVA 5HNBA 4FFPA 1XH5A 2I40A 1ATPE 5DPVA 5CQWA 3QL8A 3NUNA 2PY3A 3Q5IA 4IX3A 4MBJA 3KU2A 4MD8E 4E6CA 1ND4A 2XNNA 3MJFA 3A62A 4TZRA 4OTRA 5HG9A 3V5WA 2PZ5A 4U81A 1XBBA 2EWAA 4QP6A 2GNIA 4PNKA 4HGEA 4G9RA 1OIRA 1OUKA 1URCA 4JBOA 2PZRA 2V7AA 3JR1A 2YZGA 3I60A 3UOJA 1Q8WA 2AC3A 2J7TA 4RMZA 5LXMA 4FSUA 4DHFA 1OECA 1CSNA 3DQXA 4LRJA 1BL7A 3R8ZA 3UOKA 5CEKA 4PMPA 2ZDUA 4XG9A 5M4UA 1M0TA 4IACA 3SX9A 3PE2A 1KC7A 3HLLA 3FZTA 3LE6A 5DLSA 4F64A 3R1QA 3QRKA 2PVLA 1ZY5A 2WQEA 4O7SA 2C3KA 2OJJA 4IBMA 4BY9E 5JGBA 4Y85A 3EFKA 2XS0A 1ZMUA 5BVEA 2YCSA 4J7BA 5AA8A 4K6ZA 1B6CB 3PA3A 3IDBA 4C4EA 5HO7A 5KNJA 2HW7A 3VS2A 4H3PA 4MXAA 4PV0A 1NT2A 3FQEA 3WILA 3WOWA 2WMQA 4TPTA 4YJOA 2QLUA 2X9EA 3FZSA 3NUUA 4RLLA 1Q99A 1WVXA 4FT9A 2Q0NA 3HRBA 3KRWA 5IQAA 3FDNA 3Q60A 2YM6A 3NR9A 4FTTA 3G33A 3ZH8A 2XNOA 3BZ3A 3AT4A 2HZ4A 4RX9A 4CKIA 2W1GA 2BVAA 5CVFA 4O21A 3W33A 3ZONA 5HCXA 2YRWA 1ZYDA 3R73A 2C3IB 3OS3A 4EZ3A 4ZTQA 2I6LA 3R9DA 4DG2E 2XKCA 1GY3A 2BRGA 5DNRA 1PXNA 3DPKA 1PYEA 2C6MA 3EFLA 3HMOA 1YQJA 3ZUVA 4I4EA 4M7IA 3PSBA 5L2SA 3NRMA 3ZRMA 2FPPB 2OJFE 2BILB 2HCKA 4YSMA 4ZHQF 4IAKA 5EQYA 4I1ZA 3R9RA 4BGQA 1XO2B 3QCSA 3PPKA 4TWCA 2BR1A 3OBGA 4K1BA 3A7JA 2YAAA 2VTNA 4H39A 2W1FA 4RVMA 2IZRA 3MJ2A 3OZ6A 4CTBA 1JSTA 1NA7A 4Z3VA 2YRXA 4CKRA 4QP3A 3F88A 2WMUA 3MY1A 3ORMA 3Q6WA 3O7LD 4M13A 4F0IA 3QTWA 2WYOA 1K2PA 3UPZA 4K2RA 5BUEA 2YA9A 4WD5A 3WF5A 1BI7A 3LOKA 4X3JA 3JRXA 2JIUA 1PXLA 3FI3A 3LXPA 5HICA 5A6OA 5HO8A 2XA4A 3NYVA 3KAKA 4GT3A 4JDJA 4ZZNA 2YIWA 2HY81 3ACKA 3EL8A 2V62A 3AX6A 2ACXA 4CFMA 4FG9A 5IQCA 4FSNA 3MW1A 1OBDA 4U0IA 4DBNA 4JT3A 1J7LA 4FZDB 3PTGA 3KVXA 2HZNA 5ANIA 4XYMB 4MQ2A 5ETIA 4CRLA 3NW5A 5CEOA 4OT5A 4OUCA 1H00A 5HLPA 3NNWA 3VBTA 4D5KA 2B9IA 1Y6BA 2DWCA 3ITZA 4NFMA 4QYGA 4QTAA 4S32A 3RV4A 3WNZA 2VWVA 3VUDA 4HNTA 3E7VA 3RALA 3E8CA 3F5XA 5EZYF 4UZDA 2CKQA 2J0LA 3KF7A 2R9SA 4L52A 4CVAA 3EHAA 5T68A 4C2VA 5I5ZA 1DV2A 4U80A 4TXCA 4YJPA 3QHRA 4RA5A 5EDPA 3TNWA 4F6WA 2I87A 4H3BA 3NNUA 3D83A 4FV4A 5TF9A 3PVWA 4DLIA 4NK9A 4E8AA 4EQCA 4EOSA 1BLXA 4MD7E 2PVPA 4FKVA 3QBNA 3ORZA 2J4ZA 1F0QA 3O71A 4NSTA 4RSSA 4DFXE 4JQ8A 2I0YA 1M52A 4YLLA 2Z04A 4FT7A 4RQVA 5B0XA 4FIFA 2O2UA 4IVDA 5A4QA 5HBJA 5HTCA 5M51A 2EVAA 2PK9A 4L7SA 3KREA 4EK6A 2BDWA 4L01A 2BDFA 1GIIA 3DB6A 5CXHA 3VF8A 4PX6A 5GINE 3DZOA 3A60A 4IB0A 4FODA 5KZ0A 4XBRA 4M12A 3RP9A 3GGFA 2X39A 4USDA 4F7LA 3VF9A 5AMNA 5IMXA 3CJFA 4GUEA 4PF4A 4QMWA 3NCZA 3V5LA 2C5OA 3R7IA 2X2KA 4OT6A 4JOAA 2R3FA 2OXYA 2JKKA 4AGWA 4G2FA 4LI5A 3N4TA 3BYUA 4I5PA 2V58A 2GNLA 4AFJA 1JOWB 3PPJA 4IWOA 3VS4A 2C3LA 3UG1A 1JVPP 3VAPA 1O6KA 3BBTB 1XQZA 4NH1A 1R1WA 1GSAA 5FEEA 3M42A 3F2NA 5LQFA 4Y8VB 4QMPA 1CM8A 3RNIA 3AW8A 5CSWA 4DT9A 2QODA 1C30A 1R3CA 4BKJA 4L44A 4EH9A 3DXPA 1QPEA 4O0UA 4W4WA 4F65A 3BCEA 4EZ7A 4ZTMA 4RVTA 4ZQIA 3CD3A 5IA2A 5JFVA 2YZAA 3C4CA 3HEGA 5TT7A 4AT5A 4B4LA 5CF8A 2UW4A 3I6WA 3ZS5A 3KMUA 3HV6A 1QCFA 4C59A 4E4TA 2BAKA 3ZOSA 2XIXA 3F3WA 5D10A 2W9ZB 2P33A 4FEVA 5D7AA 3QFVA 3I12A 3VBQA 2Y6MA 4D55A 2I1MA 1QPJA 1B38A 4IZ5A 3A8XA 4RJ8A 5D7VA 1YHSA 3ID6C 5EDQA 1F3MC 4ERWA 3SQQA 4CFNA 2RF9A 4ZJJA 2JDRA 1H28A 4KUJA 3TUDA 1KBLA 3F61A 3G0EA 1AGWA 4PTEA 5KKRB 2OIQA 2QR7A 4XZ3B 3TNPC 5J95A 3GCPA 5BVKA 1XH4A 4O7ZA 4PP9A 3FYKX 4F1TA 5AA9A 3LFSA 4FSRA 4K0YA 2HYYA 3MTFA 4BTFA 4YSJA 4ALUA 4I6FA 2JKMA 4YGAA 3ZU7A 3RCDA 5M06A 3V8TA 3FLYA 4GU6A 1CDKA 2OICA 4MH7A 5EKOA 4TYIA 2J51A 4FK6A 4M68A 1IEPA 4YP8A 1JLUE 3BX5A 3H9RA 2A4LA 5HGIA 5DHJA 3EQGA 3PY1A 5EM5A 3HECA 3LKMA 3FZRA 3R7OA 3WO1A 4ACGA 2WOTA 3HVCA 4K11A 2XCHA 1YDSE 4S31A 4FTUA 5C1QB 4ZIMA 4BN1A 4PMMA 1MRYA 2V59A 5EI8A 5KHWA 4I3ZA 3VO3A 2BTSA 3RK5A 4CFVA 2W4OA 5DR2A 3R8MA 4DH3A 1VJYA 4HYSA 4FOBA 4DH1A 3R8UA 3BBWA 3C4XA 4AXAA 2WMVA 4Q5EA 3W55A 3ZO1A 2B9JA 4PL4A 4BIBA 3P0MA 2XKFA 3BU6A 3QX4A 1JLLB 4FEWA 3M2WA 2YM3A 1MRUA 3U4UA 3H0ZA 1Y57A 3D5WA 4J95A 5I9YA 4BICA 1DIKA 2F9GA 3D14A 1M7QA 3R9NA 4WO5A 4BDGA 5DT3A 2XNPA 2ZV2A 3SXFA 4FT0A 4XP2A 3I81A 3LFFA 3U8WA 3ZHPC 4D1SA 2VAGA 4O7TA 4C3RA 3OOGA 4YTCA 5BVFA 1MP8A 4ZSJA 2BRMA 4PMTA 2GQGA 2KTYA 4YNOA 2XB7A 3MVMA 2XZSA 4O7RA 5CVHA 4KABA 1UWJA 3MPMA 3MS9A 3HAMA 4JR3A 4XV2A 4BI0A 2WTVA 3C4EA 3EOCA 4LUEA 3KRJA 4DEBA 4XNEA 4TL0A 1JQHA 2RG5A 3I5NA 1Q8ZA 4OTQA 4EC8A 4RFZA 2W96B 4TYJA 4UWBA 2IN6A 4D4SA 2GFSA 4XV9A 5AV2A 4XG8A 4ZTHA 3PVGA 5HE2A 2X1NA 2JBPA 4U7ZA 4MYGA 2IVVA 3EQPA 2XF0A 3A7FA 4MXXA 3U51A 2UW8A 1Q8UA 2FVDA 1XH7A 2BHEA 2YISA 4O7WA 3N51A 4ANBA 3JUHA 3OWKA 3QZHA 2W5BA 3HDMA 1M17A 4Y83A 3EQHA 3PY0A 4UWYA 2WO6A 4GK3A 3VBXA 4EQMA 5D12A 2C6KA 5L6OA 4B8LA 3QQFA 1GSOA 2XJ1A 5IMEA 4IM2A 3VJNA 4DEGA 4LL5A 2GPHA 1CTPE 3O50A 4AN3A 2R64A 3ATTA 3FY0A 3TV7A 5L8KA 5B2LA 5IQIA 2R82A 3GP0A 4YAKB 5AUVA 1DAYA 3ZTXA 4AU8A 4YAJB 4QT1A 4I24A 3PA5A 3C51A 5M07A 1CQJB 3FXWA 3MA6A 2X7GA 4ZJVA 4P5QA 4JDKA 2VWBA 3Q9YA 4O4LF 3IW5A 2O65A 5KBQA 2UZEA 4YBZB 5IISA 3DDQA 4HR7A 3R71A 5CZHA 2NPQA 1M6VA 3AMAA 3HYHA 4GVAA 1Z2PX 4G5PA 2ITQA 1P5EA 1PK8A 3OUZA 2ZYBA 3LCTA 3O7LB 3RK9A 3EN9A 4ASXA 4BDKA 2GQRA 2PUNA 4PTGA 2QO7A 2X0GA 4EHVA 3OCGA 1XBCA 3ORLA 5CEMA 4IDVA 4AAAA 3NZ0A 4C4GA 2YW2A 5AADA 2WGJA 4JL9A 5HBHA 4E6AA 4A9SA 2EB2A 1U54B 2OBJA 3MDYA 5F1ZA 1YXUA 3FLZA 3FUPA 2C5VA 5IQDA 4FVPA 4XG7A 5CEQA 4C3PA 4B9DA 2ERKA 3KA0A 1YI3A 4Z16A 5IA1A 3ORPA 4IFCA 2WIHA 4O83A 4X3FB 3RINA 2DIKA 2R3QA 5CU2A 1U4DA 4D9UA 1ZLTA 5A14A 5I4NA 4WBNF 3QCQA 3R23A 2YCFA 5C1OA 3HX4A 3SW4A 1MRVA 4U3YA 4U6RA 4E5AX 3DA6A 2VTIA 4WNKA 4AW5A 3F5GA 3EN6A 4FKOA 3GCUA 2F7XE 5KZIA 4CMOA 4E20A 5I9WA 2H96A 3H9OA 4XCUA 5LA6F 2R7IA 2ZMDA 4E4MA 3D0EA 3UP7A 3FQSA 3KKVA 1WVWA 3PY3A 4NCTA 3ZEWA 3DF7A 5JFWA 4EBVA 3V4SA 1JNKA 3C0GA 3VS0A 3UTOA 2FA2A 2VR1A 2VGOA 4FUYA 3I5ZA 1ZRZA 2JDOA 5FTOA 3UMXA 3F82A 1UU3A 5EOBA 1W93A 3OWLA 4LOPA 5BYYA 4FV6A 3FZ1A 4MVFA 4D0XA 3TJDA 2CCIA 3VA7A 4UBAA 3QTQA 3R9HA 3EYGA 3Q4UA 4XG3A 4CRSA 2C0TA 1VBHA 3H10A 3LIJA 3QTXA 4L42A 3L8PA 1PXIA 3FLWA 3AD5A 2IP4A 4GFOA 5EM7A 4MK0A 4QTDA 1UKHA 4JRNA 3QRJA 4WUAA 4QMOA 3V3VA 1DS5A 2IZSA 2WQMA 3OTVA 4X6QC 3VQHA 4WOVA 4NUSA 5L8JA 3R5XA 2WMRA 3OTUA 4FKRA 1L3RE 2RFNA 3LXLA 1GIJA 4OTDA 4QMSA 4FV1A 3ZZWA 4FZFB 4AOTA 3FSKA 1YXTA 3C5IA 3L8VA 5JZNA 4BCMA 2NO3A 5J8IA 4R7BA 4RX8A 3FKOA 2GHGA 3MESA 2Y6OA 3FMNA 2JIVA 1Z9XA 3PXZA 4JIAA 4JVGA 4O0SA 3E7OA 3PXQA 2NP8A 4EJNA 2WHBA 4MBIA 3RPVA 3F2RA 5C27A 3I1AA 3OBJA 3TKHA 3TZMA 4X0MA 3BQRA 4K9YA 4KAOA 4ZY6A 5FXRA 5BPHA 3AD6A 2W4JA 4CFFA 5BMVF 3TDVA 4LG4A 4CV8A 3UIUA 3U6IA 4K8AA 1M0WA 3VIDA 4ARKA 3ULZA 2WOUA 4D1XA 2QR8A 3RM7A 5HCZA 1SMHA 2VO7A 4N6YA 5D1JA 1DI9A 1I7LA 3AOXA 4ACHA 5E8VA 4BBMA 5C4LA 2JEDA 2XKEA 3VNTA 1TQPA 2B7AA 3G8CA 3CQWA 5LOVF 4RIWB 1W98A 3HP5A 5HHWA 2O64A 4W4XA 2JITA 4TKSA 1YXVA 2R3RA 3DGKA 5EQPA 4Z7HA 2ETKA 4RVKA 5FGKA 3DJ6A 2OI4X 4OBOA 4JDHA 4F6UA 4R1YA 5J1VA 3ET7A 5C4KA 4OTIA 4DINA 2Z2WA 3C4WA 3L8XA 4PMSA 3COMA 4ZMEA 4TY1A 5HE1A 1YRPA 3LXKA 3RAWA 4NZWB 2EXCX 4AW2A 4ZI7F 3II5A 3WF9A 3CEKA 4NM5A 4PDOA 3U9TA 2PE1A 4GH2A 2RGPA 3DU8A 5F95A 5JQWA 3QU0A 2ITWA 4L6QA 3V5QA 1Q61A 4YZ9A 4TNDA 3E93A 2W5AA 3SD0A 4EH6A 3MWEA 5FRIA 2HENA 2Z02A 2Z8CA 4FZAB 5KMMA 4NKAA 3P7CA 4HVSA 2PVFA 4KA3A 4RFYA 3S95A 2GFCA 3QKMA 5FP6A 4EH8A 2RL5A 4ZTSA 4B7TA 1J1BA 4JG7A 4B8MA 1OKYA 4LGGA 5BVNA 4BDCA 2ZM4A 2P2HA 4OTGA 5AUXA 4DITA 3U6HA 5DFPA 5C8MA 4I0RA 5JQ5A 1S9JA 3LQ8A 4JBQA 4EJ7A 4IZAA 4QYFA 4MXYA 1ZOEA 2QKWB 3EQCA 4FSZA 2CNVA 5E8XA 4HNFA 4DH8A 5HVKA 4CQEA 4ZTNA 5L2IA 4FNZA 5D8DA 2C6TA 4FFOA 3MY5A 3QXOA 3CGOA 1WBWA 2WMXA 4DAWA 2QOCA 3RAHA 1H8FA 3VBWA 4DFLA 4AOIA 4DCEA 4MA5A 4CMTA 2BPMA 3ZBFA 3ZYAA 5DVRA 3HUCA 2OG8A 5DOSA 3TEIA 3CY3A 1FGIA 2BFXA 4G31A 2PE0A 2UZUE 2WTKC 3R7UA 4A9YA 3SA0A 3OUUA 5H9BA 3PZHA 3TDWA 4U97A 4YC3A 4KBCA 4P4CA 1Q3WA 1PXMA 4R6VA 2XIRA 3FEGA 4HYIA 3KK8A 2WNTA 5LMKA 2PVYA 1OGUA 2QHMA 4RFMA 2W1IA 4D58A 4EK5A 1Q8YA 4FMQA 5ETCA 2XIZA 1H1QA 4YZDA 2XYNA 1ZMVA 4IWPA 4LL0A 3TKIA 3BKBA 1O6YA 5CU3A 3K2LA 4QQTA 4AQCA 4O4IF 5AP5A 3IPHA 4WG4A 2RKUA 4DE4A 3TJCA 1YDTE 3PFQA 4F4PA 2V0DA 3FPQA 3UVQA 3ENHA 1OPKA 4S33A 3UG2A 3WIKA 1FVTA 3B2TA 5AAEA 5H80A 1OUYA 1NVQA 3TQTA 2VGPA 3QUDA 2PVHA 4ZJIA 3KF4A 3FWQA 3LCSA 3F6XA 4JG6A 3ZUTA 3GU7A 4BHZA 4KNBA 1BYGA 5AFVA 4C3FA 5A4EA 4CG9A 3W8QA 2UZDA 4M67A 1OKZA 3L9MA 2VWUA 4CEGA 5B7VA 2C0OA 4NKSA 1VR2A 2UVYA 4GK4A 1GZOA 5TR6A 3V5TA 4EL9A 1E1VA 3BGZA 4JR7A 2WTJA 2ZDHA 4YLJA 4BIDA 3KULA 3OXZA 4RIWA 5HEZA 3WZEA 1OI9A 2PUIA 3MN3A 3TM0A 2C4GA 5KMOA 2YABA 3ETHA 1YXXA 1J7UA 5JK3A 4DF3A 5HIEA 5KO1A 4FTOA 5AM6A 4G5JA 3OEFX 2QF7A 4GK2A 5IH6A 5KCVA 3S00A 2BTRA 4YPSA 3R30A 5GIOE 2X4ZA 1XR1A 3LFQA 3CD8A 1OIUA 2ZV8A 2PHKA 3NIEA 4O0YA 5BYLA 4PP7A 4DFNA 4JS8A 3DZQA 3DAJA 3DK6A 1FBNA 3GQIA 3QUPA 4F9BA 3FYJX 3ORNA 3R22A 2C6EA 2VTAA 2YCRA 3UGCA 5CF4A 3QTZA 4DFYA 2C68A 2YERA 4KWPA 4AZWA 3U54A 2NUAB 4RIYA 4GFGA 3AMYA 5ANJA 1IAJA 2HW6A 3O2MA 4BCHA 4FNXA 4RZQA 3OHTA 1UV5A 5K9IA 2A19B 2I7QA 2JC6A 3Q4TA 4QMUA 4QYEA 4BI2A 2QOHA 1UA2A 5CT7A 4FSYA 5DEWA 5EM6A 3SHEA 3QQJA 3V04A 3P23A 5BYZA 3O17A 4CLJA 1M2QA 3ETAA 2BIKB 4IFGA 2XEZA 4TN6A 2BZJA 3C4FA 5ANKA 3H9FA 4ORKA 4X21A 4BYJA 4U41A 1KJJA 1KE6A 1SZMA 5EI6A 3E8EA 3R8PA 3A4PA 2C1AA 5BUJA 2VZ6A 4ANLA 3HAVA 5IDNA 3LMGA 2QU5A 5M53A 2NNWB 3PSCA 4GG5A 4WUNA 4YZNA 4CG8A 4ZS4A 2FSOX 2YZMA 4XG4A 3P7AA 3PP1A 4IAAA 3W2SA 4M0YA 1OPJA 3ZRLA 4D4YA 2PPQA 3G15A 2Z7QA 3RI1A 2JLDA 3IO7A 2W7XA 5FM2A 4DA5A 2GS2A 2RFDA 2XH5A 3JS2A 1XBAA 3OXIA 1IASA 1UKIA 3EFJA 4ITJA 3POOA 3IK3A 3MH0A 3JYAA 3OT8A 5LVMA 5LWNA 4XX0B 4KD1A 4DEDA 1FMOE 4EGQA 4O7VA 2GNHA 2VU3A 1KOBA 4FIHA 1IRKA 4AG8A 4DFBA 4IJ9A 3KMWA 4KBKA 1NW1A 3ORKA 3RPRA 4AW1A 4IAFA 1EZ1A 4HNVA 3ETJA 3DJ5A 4QYYA 2CN5A 3BE2A 3LQ3A 4X2NA 2FB8A 2FB9A 1BKXA 2XMYA 4LFIA 4EGJA 4UWCA 4B0GA 3GCVA 4ZSLA 4FTNA 4ASZA 1H1SA 3TNHA 2Z7LA 3PRFA 4W4VA 1J7IA 5DMXA 5T3QA 3ZSHA 4I5MA 5ACKA 1Q62A 3H0YA 5M55A 1BL6A 3TW6A 5BVWA 4RWLA 1S9IA 2CSNA 5CYIA 3ZZEA 4CZTA 4F9CA 2WMBA 4I23A 3E64A 3MFUA 2B52A 3CTQA 3OROA 4EZ5A 4JG8A 4E73A 4MWHA 3F3UA 3VUIA 5LVPA 3NUPA 2UW6A 3QRIA 3GVUA 3NPCA 4FE2A 4NWMA 2W1HA 2A2AA 4JNWA 3CBLA 1LUFA 3RUPA 4M14A 2BHHA 3S4QA 3MIAA 4O2AF 4D28A 3WBLA 4FIJA 5JRQA 1LEZA 3UOHA 3C7QA 4N57A 4IIJF 4MV1A 4CLIA 3Q52A 2WU7A 4GJ3A 4E5BA 1L8TA 3FMLA 3NAXA 4V05A 5HCYA 5AP6A 2VQDA 3NUXA 5DRBA 3D7TB 4UB7A 4IC8A 1HCKA 2ITOA 2UVXA 4FTRA 4O96A 4DCAA 3CTJA 4R3RA 4YU2A 4XLIA 3QFFA 2UW3A 1C3OA 3E3PA 4RLKA 5GHVA 4IZOA 4TUYF 3T9TA 3CKXA 4EBWA 4FICA 2C1BA 4W4YA 3TTIA 2Z7SA 3HV4A 4RVLA 5CALA 2VN9A 3QKKA 4PY1A 3ENMA 1VEBA 3KCFA 3PIZA 4L3JA 3AG9A 3E92A 3QCYA 4DYMA 4H1JA 3HL7A 3QC9A 4I41A 4RC3A 5F4NA 4BDJA 1GGOA 3OP5A 4EOPA 1YHWA 5E9EA 3CSVA 1JKSA 4MA0A 1AQ1A 3TTJA 1KJIA 1H1RA 4JAIA 3PP0A 1PXOA 2QOOA 4F7SA 2PN1A 4RQKA 5AAGA 4AE6A 3DS6A 3D94A 5CLPA 5E8SA 3UIXA 2X0SA 3E3BX 2YYAA 5EHOA 3LJ0A 4C36A 4OGRA 2OW3A 4RWKA 1YDRE 4FYOA 2W17A 3FMKA 5AUWA 4EK3A 2J9MA 5H8GA 1E4EB 2J90A 3R83A 2QK4A 5LOHA 1BUHA 1V0OA 3U55A 5BVOA 5AUYA 1MQBA 5I0BA 2YJRA 1PJKA 3E88A 3IW4A 3R5FA 3WF7A 2BMCA 2VTLA 2WQBA 4O0WA 2GPSA 2I8CA 4MXCA 4FV8A 5JGAA 4USFA 3UQCA 2H34A 3KXZA 4AA0A 3JXWA 1YI6A 3R5HA 2X81A 2ZOQA 4MV4A 5IA5A 3R8VA 3DV3A 3E62A 3FC2A 4NT4A 2ITTA 3RCJA 4CNHA 3CXWA 1ZY4A 3MTLA 3D2IA 1Q24A 2J0IA 3RK7A 1K9AA 2UZBA 3CP9A 3DAEA 3JY9A 2F4JA 3BHTA 3KMMA 4NU1A 3LM5A 5CSXA 4HPTE 2O8YA 2WEVA 4TWPA 2WELA 3TV4A 5CF6A 3U9SA 2R2PA 3TIZA 2FYSA 3MYGA 2FSTX 1K3AA 5AP0A 4QMXA 3ZSGA 3SOAA 5DE2A 2JKQA 2J9GA 5HU9A 4IDTA 5I9UA 3BWFA 5K5XA 2I0EA 4MD9E 4ID7A 4XG6A 3QD4A 4XUFA 1YXSA 3A7IA 1IAHA 3LZBA 5IUIA 3TI1A 1PXJA 3AMBA 1H1WA 2OXDA 2VTMA 3VW6A 1IA9A 1RDQE 2ITZA 3AT3A 3KC3A 4C34A 5M09A 4KKHA 4BDBA 5KKRC 4W8DA 4QTEA 3ALNA 4KIQA 5DBXA 1KJ8A 4HNIA 2YL2A 4XH6A 4C62A 5TOZA 2HXLA 3DXNA 3Q9WA 5AJQA 3TIGA 3CY2A 3ZLWA 1FINA 1Y8YA 4IEBA 1OL1A 5FG8A 4J99A 1UNHA 3NW6A 4EOKA 4Z7GA 3Q3BA 3FI2A 2ONLA 4R3CA 3MH2A 3H30A 1GIHA 2HWPA 3MB6A 4Q2AA 3UC3A 4JI9A 3FE3A 4KIOA 5AV3A 3K5UA 2W99B 3QAME 3N4VA 3DXQA 3UQGA 4F0FA 3K5HA 4R77A 2QO9A 5IEVA 4LGHA 4DGLC 4DLJA 3CTHA 4IB5A 4MNEB 4FEXA 3V5PA 1JDBB 3QKLA 2XK4A 3MVJA 3LJ1A 2FPIB 3RZBA 2QC6A 4TYHB 3D7TA 2YDKA 2OIBA 4D2SA 2X4FA 1AUVA 3ZXTA 3UO4A 1G8AA 1E1XA 1VZOA 4O86A 2FUMA 2UVZA 3QQGA 3W1FA 2PMLX 4M69B 3M11A 1U46A 2XRWA 3QXPA 4GJ2A 2PULA 4WRSA 3VUKA 4EWQA 4FG7A 2OWBA 4J98A 3WZJA 4C61A 4HYHA 4E6QA 3FLSA 2OF2A 3C0IA 4G3GA 1P2AA 4NFNA 2B1PA 3KQ7A 4ACMA 1Q97A 2VTTA 1G5SA 4D5HA 2UZWE 4LMNA 1WR2A 2G15A 4QP8A 2JIIA 2JDSA 4PDYA 2XM8A 4L1KA 1Q3DA 1WBTA 3RWPA 4DTAA 1SNXA 4EK4A 4NCTC 2ETRA 1M2RA 2Y7JA 2YHVA 5CU4A 5DEYA 4G6NA 1CE8A 4GW8A 3VUMA 3DT1A 2GSFA 3KGAA 2QOFA 4XYLB 2X8EA 2XBAA 1ZZLA 3EQIA 4MTAA 2WTWA 4QP4A 5LVLA 4E93A 4YUQA 5AV4A 5IH4A 4RGJA 4DG0E 2PL0A 3K5IA 4AN2A 2W6OA 5AP3A 3F7ZA 4PDSA 4DIMA 3ZRKA 2P0CA 1E4EA 3AC2A 3QF9A 4R5SA 4AX8A 3G0FA 5DR6A 3F5PA 3I7CA 4ANQA 4ASEA 3VS6A 4HVGA 2OLSA 4O2BF 3FI8A 4DC2A 1DI8A 2J2IB 5FD2A 4GEOA 2CKOA 3W18A 3W32A 1FMKA 2R0UA 1H25A 3RHXA 3UJGA 3BQCA 1ZARA 3DBFA 4GL9A 2GHMA 2VO3A 1DV1A 3PIXA 5HU3A 1V1KA 5CA0F 2LAVA 1AUXA 4H36A 2BROA 2YM7A 5AEPA 4V0GB 3VS1A 4F0GA 4FKSA 1JKKA 2WEIA 3W2CA 5HVJA 3DK7A 1EUCB 4O81A 4ZSEA 4XBUA 3HV3A 2OFUA 3MWUA 4NJDA 5AV1A 5C9CA 3BYVA 2I0VA 3WE8A 3IOKA 2QG7A 4ENXA 4RBLA 3C4ZA 4ZTLA 4AE9A 1BMKA 4MV8A 2VTSA 3FSFA 5E1SA 4CKJA 1W82A 4DG3E 2R87A 4I0TA 3O96A 4FKGA 4WNMA 4EUUA 2CGWA 1J91A 1Z57A 5HIBA 2PWLA 2W71A 3CPCA 4E26A 5J5SA 4YJSA 4QRCA 4EH7A 2WXVA 2WPAA 2EU9A 3SOCA 3LM0A 4LRMA 4AW0A 2Q0BA 3UZRA 2XNGA 3FBVA 4ZZMA 3F3TA 2CGUA 4RPVA 1M7NA 3IOPA 3DKFA 4YC6A 2ZV7A 4FEQA 4FKLA 4A06A 4ZMFA 2CZGA 4ME6A 3UIMA 4NL0A 3ZBXA 1ZZ2A 3MV5A 2VWWA 4EI4A 4QSHA 3A4OX 3P79A 4YZBA 4QO9A 4F6SA 3SVVA 4U3ZA 3MFRA 2HK5A 2X9FA 3FY2A 5JZJA 1XKKA 3D15A 4YBJA 2FO0A 5EOLA 2AYPA 1YVJA 4YJTA 4AGUA 5CXZA 3CJGA 2PBZA 2E2BA 2GCDA 3BHUA 3Q9ZA 4MNEA 1F5QA 3QTIA 5LVOA 4FG8A 4A7CA 4IMYA 4XX9A 3O8TA 5CSHA 3RPYA 2Y4PA 4GT4A 3L8SA 4HVDA 1KJ9A 4UN0C 5GIPE 5ANEA 2F7EE 3I7BA 4X3FC 5K4JA 1GOLA 3U9CA 3C13A 2C69A 4JDIA 5ANGA 3W8LA 4RJ4A 3ODZX 4H05A 4C02A 5IPJA 4HCUA 4I50F 4D2RA 3UZTA 3N8DA 4C0TA 5C8YF 3AGLA 2PVRA 2ZDGA 4UXQA 4R5YA 4FI1A 4BI1A 4I0SA 4IM0A 1SM2A 2IVUA 3LFNA 4U9AA 4WG3A 3GB2A 2JGZA 2YEXA 2OO8X 4BCNA 3N9XA 1VYWA 4L45A 2OJ9A 2UW9A 4LV5A 3DFAA 4LV8A 4I6QA 5ANOA 4FTCA 4YR8A 4TYGA 3CCNA 3KXNA 4EK8A 4GV1A 2YIYA 3PWYA 3WZUA 5IEYA 2H8HA 3QLFA 2OU7A 2Y8OA 2ZJWA 5AUUA 3JVSA 2CDZA 3PVUA 4ANMA 1I7NA 3PLAE 2PUPA 2WKMA 4X6RA 1LR4A 1V0PA 5IQEA 2UZLA 4CV9A 4M15A 4AOJA 3PIYA 4P2KA 2P2IA 3EQBA 3UVRA 2EXMA 3WE4A 3W2PA 1OBGA 4ZTRA 4YB8B 2QOKA 1FPUA 3ZLXA 4O82A 3OW3A 4FU0A 5J2UF 4FSQA 1VKZA 3OFMA 1W83A 1XWSA 2WU6A 4CGAA 1H0VA 2GMXA 3HDNA 3BYSA 4AWIA 4QQCA 2PVMA 4O4HF 3R21A 5CX9A 2HELA 4BDIA 4MWIA 2YZLA 2Y4IB 1KEEA 2V55A 2CNUA 4H58A 5FTGA 1B39A 2X8IA 5LMKC 4UYNA 3C1XA 5JVLA 5IQHA 1CQIB 4MV9A 1Q41A 3AXWA 4I6BA 5E91A 3MFTA 3S3IA 5FTQA 4AUAA 3QWKA 4FNWA 4L8MA 4O2PA 1O9UA 3LLTA 4C4FA 3LFEA 4EWHA 3FZOA 4JAJA 3MIYA 4DGMA 3TZ9A 4II5A 1R0EA 4O38A 3G90X 2VX0A 4FGBA 2VWIA 3CIKA 2C6OA 4ZAUA 1H4LA 3NDMA 3UO5A 5HX6A 1WVYA 3OWJA 3V5JA 5HBEA 3EKKA 3S0OA 4O84A 4HGSA 4I20A 4BDDA 3SRVB 3ZLYA 4YJVA 2QO2A 1OVEA 3QTSA 3VS7A 1WBOA 4GT5A 4YJNA 1JBPE 2VO6A 3MPAA 1W0XC 2QOIA 2HY0A 2JFMA 5ETAA 5TO8A 3NVKI 4GYGA 5HD4A 3F69A 3GU5A 4PRJA 3BWJA 5CAUA 5AM7A 1W8CA 3DBDA 4F63A 4RIXB 4E4LA 5BUIA 5A6NA 3KRRA 4JX7A 3ZDUA 4DFUA 4M0ZA 4QMYA 1JSVA 4FYNA 3MFSA 2CCHA 1PYXA 5EFQA 4BIEA 2W5HA 4GYIA 3Q04A 1KE5A 4HYUA 2OZAB 3SAYA 4JX3A 2IG7A 4I5CA 4APPA 4DGGA 4AF3A 1JAMA 3V4ZA 4X2GA 3KRLA 5IEXA 2BDJA 3OCSA 4MV6A 3C0HA 1ZWSA 1Y6AA 1Z2NX 1IG1A 2VNWA 4IW0A 2R3OA 3EN5A 2OXXA 4P90A 4Y72A 4ZOGA 3QD3A 4ALWA 4ONAA 4NW6A 1OL6A 4RWJA 5BMMA 3MVHA 3EYHA 3RPOA 2W4KA 5FEDA 3BEAA 3QX2A 4CD0A 3VMMA 3GBZA 2R3NA 4PL5A 4UZHA 4YNEA 4FFLA 5C01A 3R7YA 3GIDA 1X8BA 2VO0A 4QQJA 3MPTA 5EDRA 4BCKA 1UVRA 4JBVA 4L46A 1KE9A 2QD9A 4G6OA 4I4FA 3FC1X 4IVCA 2XNEA 4BCJA 4BRXA 4RJ7A 4FKQA 4F1MA 2ITUA 2GHLA 4KRCA 4D1ZA 4TWNA 4BF2A 5GONF 4G3CA 3PUPA 4FT3A 4GKHA 4MNFA 3V6RA 3NIZA 2JBOA 3TNIA 4KIPA 3GCQA 4JBPA 5CY3A 3ROYA 2W06A 4Q9ZA 2UZTA 3ATSA 2ZVAA 3CR0A 3GI3A 5J7HA 5HZNA 5HG8A 3UPXA 2LGCA 3TUBA 4UALA 3VS3A 4IZ7A 4EKKA 1Y91A 3ZCLA 4C35A 1U54A 2RFSA 3F2AA 5GJDA 3HO8A 3I0OA 3NWWA 1Q4LA 3CS9A 3O0GA 3W10A 3C50A 4IADA 4C4IA 2C6IA 3WZKA 5D11A 2DWBA 4X3FA 5HBRB 1H08A 3TZ8A 5A4CA 1ZMWA 4R78A 4EOOA 4RRVA 4E1ZA 5C03A 4UXLA 3UYTA 1E9HA 4HNUA 3EWHA 3ZDIA 3MB7A 3P08A 2BZHB 4APCA 1IR3A 2GDOA 1JPAA 3LMIA 2WZJA 1TQMA 2XK8A 3RV3A 1YKRA 2J5EA 1UU9A 3OT3A 4IHJF 3GC9A 2F7ZE 3IW7A 1H1PA 4OBQA 4XYFA 2ZB1A 3PXRA 4A4LA 4EORA 4FT5A 4OTHA 3AD4A 1GLVA 3RAIA 3FV8A 4Z55A 4IAYA 3KAJA 1KWPA 5FXSA 1UU8A 2UZOA 3AT2A 3DLSA 1RW8A 5EH0A 5FDPA 1UU7A 4EH3A 2F2CB 2DYLA 4DEIA 5CEPA 5JEBA 3UNZA 3GU8A 3O8PA 4K33A 3AC4A 3OG7A 5G1XA 4EOJA 5EYKA 5EM8A 2A1AB 5IG1A 3HGKA 1DM2A 4QNYA 2BALA 5E1EA 3JZIA 1UNGA 3OCBA 3A7HA 4U40A 4WNOA 3NYNA 3BV2A 4FGRA 2VRXA 4FV7A 5KE0A 5ETFA 5LARA 3T3VA 4A4XA 5IQGA 2W6NA 4FX3A 4WA9A 4AZSA 4R7HA 2GNJA 2OLCA 4EHGA 5AWMA 5ITAA 4TV8F 3DB8A 2R86A 5CANA 4BGHA 3UNKA 5KX5F 4EH2A 1KOAA 5LCJA 1B6RA 5EW8A 5CF5A 5AX3A 1H24A 3JY0A 3UDBA 3QRUA 5JH7F 4KB8A 2C6DA 1OKVA 3HUBA 2ZB0A 4GUBA 3R7VA 2OZAA 2RG6A 4IJPA 4BB4A 2YACA 2YM8A 2IW8A 4YO6A 3ZLSA 3P1AA 3TXOA 4C4JA 4OR5A 4CSVA 5EHYA 2ZV9A 2AC5A 4GFMA 5JFSA 5I9ZA 3D5UA 1SYKA 3DBCA 4DFZE 3C9WA 1FGKA 1GZKA 1WFCA 3PJ3A 4HPUE 4QP1A 4NM7A 2W9FB 4G3DA 1W84A 3B2WA 2VTPA 4FOCA 2YIXA 3D9VA 4GVJA 4BCOA 3AC1A 3P78A 2VWYA 3FMJA 5L6PA 1ZYSA 1OB3A 5KKNB 5KX8A 4DGOA 5CS6A 4P7EA 4W8EA 4MV7A 1LP4A 2VTRA 3UE4A 4KKGA 5IA4A 2NU8B 3LAUA 3Q1KA 4RZWA 5A4LA 1URWA 4P5ZA 2CN8A 2BIYA 5M44A 3BELA 3S2PA 4N4SA 3SG9A 3UVPA 2YDIA 5DWRA 3ORRA 3V01A 2ESMA 1G8SA 3EQDA 3R04A 2XK6A 4J97A 4HOKA 3BGQA 4FZ6A 2CNQA 3P86A 3V8SA 4AP7A 2W6PA 3GFEA 4X2FA 3V6SA 3RM6A 2XEYA 5BMSA 2UUEA 2IW9A 3IQ7A 1HOWA 5IU2A 1XHAA 2HWOA 5DI1A 4TNBA 3BEGA 3ORQA 5HNIX 4F08A 4EONA 4O7NA 1PHKA 1P4OA 3S1HA 2V5QA 5AP1A 3CC6A 3BHHA 4WSYA 4BCFA 3GCSA 4C38A 3CKWA 4O0XA 4QP7A 5IUHA 5KMIA 2WFYA 4ZXTA 3JZFA 4J53A 4LOOA 3BI6A 2R3JA 4X2KA 3TL8A 3DOGA 4BDAA 2WTIA 5I9XA 3TINA 4FIIA 2H6DA 1REKA 2QCSA 2W1EA 4IB1A 4UEUA 4UY9A 1P4FA 3OXTA 3F3VA 5EYCA 3RMFA 3BU5A 2W1DA 2UW0A 2DZDA 3UQFA 4R3PA 4R1VA 4C2WA 3QHWA 4NTSA 3TG1A 4CCUA 3UFXB 3LFAA 4YTIA 4YBKA 4L7FA 3TKUA 5CEIA 3O8UA 3FL5A 4RA4A 3ZFMA 5B2KA 3NX8A 3LCOA 3PXYA 3QYWA 4FL2A 4DT8A 2B55A 2R3PA 1EHIA 2CGXA 2HOGA 3LMHA 3TACA 3O51A 4ZSGA 2X8DA 2VTJA 3HZTA 3D2KA 3LFBA 3PE1A 3FMEA 3COIA 4YHJA 3DBEA 1RJBA 2I80A 3HA8A 3Q6UA 4QMQA 1T45A 2HJWA 3THBA 3DTCA 1GJOA 2BZKB 3PPZA 5K4IA 4O7YA 3OW4A 1R0PA 4C5AA 2G2HA 2GS6A 2REIA 4ZLYA 3OF0A 5IQBA 2R7MA 4XHKB 5E8TA 2BAQA 3RGFA 4MCVA 3FQHA 1RE8A 1MQ4A 4LRKA 4AA4A 4U42A 5DGZA 3VRZA 3LPBA 5CB4F 3VUGA 2JAVA 4XP3A 4ALVA 4D4VA 2O0UA 4YJ2F 4XEYA 4OW8A 2QKRA 2PE2A 3OEZA 4QMLA 4FSWA 3FMDA 3NCGA 2F57A 3LCKA 4BC6A 3KALA 2E9OA 2JAMA 3BRBA 4FKUA 5FXQA 3VJOA 2ONLC 5ANDA 1JKLA 4RC2A 5DR9A 3TIIA 4FUXA 2R3KA 3NYOA 4UYAA 2R7KA 1XH8A 1PMNA 3BLRA 1FOTA 1GZNA 2IVSA 3LVPA 2XJ0A 5AP7A 3ZC5A 5HQ0A 4Y5HA 3NAYA 1YI4A 5DT0A 1T46A 2G01A 3A8WA 4JQEA 3WARA 3D7ZA 3O23A 3ANRA 3ERKA 5JFXA 3IDPA 4FTJA 4FVRA 4HCVA 3G51A 4L3LA 3H4JA 4YJ3F 1QMZA 1M2PA 4TW9A 2BZIB 3MH1A 1B6SA 4G1WA 4A9UA 3GC8A 3GXLA 4NJ3A 4YTHA 5F9EA 1KJQA 1PY5A 4CCBA 3NEWA 3CE3A 5HORA 2CLQA 3QD2B 3HA6A 3R9OA 3EN7A 3QQLA 4FTLA 4F9WA 1OL2A 2F49A
chains in the Genus database with same CATH superfamily
3NVMB 2GTMA 5E7RA 3W2QA 2ITYA 2UZVA 2XIKA 4BDFA 2AUHA 3ZFYA 3PDTA 4GIHA 3VPCA 2XIYA 3BV3A 4JRVA 3QGWA 4DTKA 2BRBA 2J6MA 4E4XA 5J2TF 4YLKA 2JFLA 4A07A 5I47A 4EYMA 3F7WA 1SVGA 4UV0A 4WIHA 1KE7A 1YWVA 1OL7A 3DKCA 3B8QA 4V04A 3E8NA 4ZLZA 2XCKA 5LVNA 4TT7A 1OIQA 3RJCA 2VD5A 1J1CA 5CAVA 2C6LA 4CT1A 2R3GA 4ITIA 4FK3A 2R85A 4AXEA 5H2UA 3ZC6A 5EKNA 4RJ3A 3DKOA 2W6MA 5BNJA 5KS8A 2GS7A 4Y46A 4D4RA 3DTWA 4U45A 4EH4A 3LJ2A 4G9CA 2BAJA 3IG7A 2YWVA 4J8NA 4FZ7A 3UOLA 3CPBA 4YURA 3KFAA 5IH5A 4AZVA 4X2JA 3SV0A 3POZA 2Z7RA 1WCCA 2GNFA 5CI6A 3K3JA 3RNYA 3KN5A 2W6ZA 2QQ7A 3DBQA 3HRFA 3T8OA 2IZUA 1EUDB 2NU6B 2PZYA 3K3IA 4F9AA 1ULZA 1XMLA 5CNNA 5CAOA 4DH5A 2YAKA 2FP4B 3SE7A 4MF1A 2G9XA 3RTPA 3VN9A 3KXGA 4ZK5A 4GCJA 5HG7A 1KUTA 4YHFA 2R0IA 3BLQA 2X6EA 2VWXA 3IW6A 3COHA 4U5JA 4TYEA 3BU3A 3QZIA 4QDEA 4JIKA 5A46A 4FNYA 3EN4A 4Q4CA 4F70A 4O4JF 4C58A 1CS0A 5C8KA 4USEA 2GLTA 3EFWA 4FKIA 3KK9A 4EEQA 2J0JA 2P3GX 3Q4CA 2WAJA 5FNVF 1WRVA 4XJ0A 4ZLOA 4UX9A 3PRIA 3AGMA 5J9ZA 2H9VA 3MBLA 4BVUA 2A0CX 1WBNA 2R4BA 2XD4A 3LCDA 3LW0A 3NLBA 4BTJA 4DEAA 3GEQA 4CMFA 3KRXA 3I4BA 2QU6A 4RJ5A 3SGIA 2J5FA 1NVRA 3NUSA 3P5KA 4FFMA 4DLKA 3RHKA 4AGCA 5HNGA 4BBEA 4R7IA 2EJ0A 2QB5A 3VRYA 2UV2A 4JQ7A 2GQSA 4I6HA 3UZPA 4CFWA 4YZCA 1VBGA 2PUUA 1XDNA 4WRGA 4EOIA 2IWIA 4M8TA 5EG3A 4I93A 1HCLA 4QP2A 1KE8A 5CAPA 3TUCA 3K5VA 4O6LA 4S2ZA 3W16A 3LHJA 4YJQA 4CFXA 5JGDA 2VTQA 2SCUB 5JQGF 5M56A 1WZYA 4ITHA 1ZOHA 3QA8A 4M3QA 3QALE 3SW7A 3A7GA 2XP2A 5H3QA 4PTCA 3DY7A 2B4SB 4G3EA 4WT6A 5C26A 3W0SA 5BWUA 3ELJA 2VNYA 4KRDA 4I22A 3DJ7A 3TNQB 1OKWA 5F20A 3LQSA 3BL9A 5E90A 4ZY5A 1UWHA 4FTMA 3AQVA 3FHRA 4HZSA 3BYOA 2GNGA 2PTKA 1SVHA 3NS9A 1PW2A 2HGSA 4C5BA 4EUTA 3MGYA 4E6DA 4OTFA 2R3HA 5HV6A 1Y8GA 3LFDA 4IE9A 5LMBA 1ERKA 3NMUF 3AKLA 3DKGA 4GG7A 3UYSA 5BPYA 1RQQA 4TTHB 4F7NA 5CU0A 5I9VA 2DABA 4O22A 2IPXA 2YIQA 1STCE 4I21A 4ZS0A 3NNXA 2BKKA 1FVVA 3FKLA 4IVAA 4BCGA 5DRDA 4BTKA 4HW7A 3NBYB 2VX3A 4JXFA 5HI2A 4MV3A 2WQOA 4WNPA 2YIRA 5AX9A 5FR9A 2OJIA 3Q32A 4RZVA 5JT2A 4IAZA 3ORTA 2VV9A 4QTCA 4EHEA 5EW3A 5GNKA 3TV6A 4ZP5A 5HTBA 3P4KA 2G1TA 2HZIA 4XRLA 3CQUA 2W70A 3VW8A 3BE9A 4MQ1A 3PWDA 4BGGA 3KB7A 3ZUUA 5ICPA 3HP2A 2PVNA 4FV0A 2HXQA 4EH5A 5BVDA 3IGOA 2G2FA 4GU9A 2COJA 3R01A 3TN8A 4CE5A 1YHVA 3BYMA 4EOLA 3AKKA 4MEDA 2HIWA 4O0TA 1CKMA 3JVRA 3KVWA 2EUFB 4QP9A 4NM0A 1QPDA 3R6XA 2C47A 4XRJA 1IOWA 3AC5A 1QL6A 2BKZA 5KBRA 2Q7DA 3W5OA 2QOBA 1YWNA 3QLGA 3KXHA 4HJOA 3Q5ZA 4XLVA 5L2TA 4BCQA 2AEGA 3SLSA 4Y5QA 3T54A 4N70A 4QOXA 4ASDA 5HE3A 4NM3A 5L3AA 1IOVA 4L68A 4IM3A 3PZEA 3QYZA 2BFYA 2CJMA 5K5NA 4AZFA 4NIFB 4FIGA 4LM5A 4M84A 3PVBA 2JD5A 4X7QA 4FFNA 1XJDA 4FR4A 4JXUA 4DH7A 4YC8A 1O6LA 3A2CA 4CFUA 1A9XA 4KBAA 3WI6A 1CKIA 3P5JC 4RX7A 3ORIA 3REPA 3MY0A 3PLSA 3DDPA 5M4CA 3PJ2A 3GUBA 4NW5A 4K77A 4AZTA 3VHEA 4F9YA 2IO6A 2WMSA 3GU4A 3Q53A 4QTBA 2R84A 2X5RA 3SDJA 4BCPA 5KMNA 3RFCA 2YCQA 2ZM3A 1PX2A 3IS5A 4RIOA 3IECA 3Q2OA 5CM0A 4O27B 4BR3A 3R1NA 5BQ0A 3VONA 4CXAA 2J0KA 2YM4A 1GSHA 1KV1A 3GB8B 4IWYA 2P55A 2CGVA 4ANSA 3PXFA 5M57A 2XVDA 4QMVA 1R39A 2OIDA 5DG5A 5AP2A 4ZY4A 1J3HA 3VULA 1W96A 4F7JA 4FTKA 1TVOA 2KULA 2X7OA 2XNMA 4TWOA 5KUPA 1I09A 3NW7A 4I4TF 4FEUA 4ENYA 1WBVA 4QMNA 5IYZF 3KCKA 3HV7A 2PZIA 5FBNC 2VWZA 1FVRA 1PXKA 2C5NA 2PU8A 2R3LA 3QUEA 4FV2A 3TT0A 2E9UA 5HESA 5FDXA 4GLXA 3BGPA 5FEQA 2WB8A 2NRYA 4L67A 4G34A 2O5KA 2CHLA 5EYMA 3ZM4A 5H8EA 2DLNA 1FVIA 2I0HA 4FL3A 1QPCA 5I5VA 3ALOA 3DNEA 2OGVA 2ITVA 5EHLA 1EH4A 4BBFA 4AAYA 4FTAA 5E8ZA 1H26A 1KV2A 5EQEA 4DGNA 4IX5A 4YMJA 3EH9A 3D4QA 3OWPA 2YM5A 2OJGA 3WYXA 5D1PA 5CENA 5T6KA 3L9PA 3R63A 2B9HA 2GTNA 5AIRA 5JMSA 2WQNA 1H27A 4FTIA 1P14A 1XH6A 1APME 2QVSE 4FA2A 4XV1A 1PRYA 5KHXA 2CKEA 1SNUA 3Q9XA 4DDIA 2PZPA 3UP2A 3EMGA 4B6LA 4BHNA 2C0IA 3ZM9A 4IZYA 4IH8A 1PMEA 2YITA 3GENA 4DHIB 4FFRA 3TMOA 3U4WA 1NXKA 2OFVA 4KSPA 4WBBB 2FPGB 3G6GA 2OZOA 4CMUA 3FMMA 3QTUA 4HGTA 4QNAA 5IF1A 5E8WA 2BRNA 4ZEGA 4WG5A 4DEEA 1P8LA 3T3UA 4IX6A 2P0AA 1WAKA 1BI8A 4TYHA 5AAFA 5HE0A 3PA4A 3UODA 2CLXA 1A48A 2OSCA 3TEKA 1OPLA 2HVRA 3BG5A 3D5VA 4C7TA 3DLZA 3H3CA 3QC4A 3ROCA 3F3ZA 3TCPA 4ACCA 5FP5A 3HMNA 2XUUA 4NTTA 2Y4IC 5HD7A 2PSQA 4DN5A 3RKBA 3E63A 4J1RA 4WHZA 1OL5A 1WMKA 3PSDA 1Q5KA 2V5AA 2YN8A 4HCTA 3Q96A 4DEHA 3WZDA 1MUOA 3OMVA 1FQ1B 5HKMA 1R78A 1YOJA 5DYJA 4RG0A 5FM3A 2YFXA 3FZPA 1A3GA 5LMAA 3F66A 3LQ5A 5L8LA 4E7WA 4GRBA 2VX1A 2HG8A 2FSMX 2IW6A 3IONA 3HMIA 4EKLA 4FBXA 3FLQA 4GIIA 4L00A 4LOQA 3UBDA 3HV5A 3BHYA 3P9JA 3QA0A 4YPDA 3GC7A 5M4IA 3M1SA 3BA9A 3D5XA 2R7NA 3A61A 2XKDA 5LXTF 2DS1A 3BLAA 3PG3A 2B9FA 3U87A 5HIDA 5JN2A 1GZ8A 4IAIA 3ZSIA 4ZZOA 3DFCB 3QGYA 4MUQA 3N4UA 3CEBA 2CKPA 2ITXA 2QG5A 2IVTA 2QHNA 3E5AA 3G2FA 2WIPA 4TRLA 5JH6A 1PKGA 4EQ5A 3EKNA 4CKBA 1SCUB 3FL4A 5TKDA 3BA8A 4YJRA 4L53A 5KMLA 5HLNA 4CZUA 2Y0AA 4UCOA 3QD0A 3L1SA 1A9UA 4RT7A 5JKGA 4XOYA 2UW7A 2YWPA 4FIEA 3TIYA 4BYIA 5KMKA 4XMOA 5AUTA 3SC1A 4TV9F 3HMPA 4LUDA 2XK9A 4AGDA 4J8MA 3E87A 4EOMA 3NSZA 3P7BA 4U79A 3R28A 4V0GA 5CZIA 1YOLA 3EZRA 3G9LX 5HG5A 4V01A 4Q5HA 4O0RA 4S34A 3SKCA 3UIBA 1TAEA 2A27A 3AC8A 4I94A 4F78A 3VPBA 2Y9QA 3CSWA 3JRWA 3DAKA 4FKPA 1U5RA 3F5UA 5CAQA 3GU6A 1ZYCA 5AP4A 5I5YA 5A54A 4DBXA 4D9TA 2QONA 3BAAA 3RPSA 5CI7A 4I5HA 4ERKA 3LWBA 1KSWA 4RWIA 4XP0A 4RX5A 1Z2OX 2UZNA 4G16A 5IA3A 1XH9A 1AD5A 3PJ8A 3FI4A 5FLFA 3OD6X 3PJ1A 2R7LA 2QOLA 4OTWA 2W05A 3ZO4A 3CGFA 2YZNA 4EHZA 4L9IA 3R1YA 5CSVA 4QMTA 3G6HA 2BRHA 5ACBC 3HMMA 5BYAA 3U0GA 3RWQA 2OKRA 4Q9SA 2WMTA 3HKOA 3G8DA 2QURA 4Y95A 5K3YA 3GOKA 3NUAA 4FV5A 5EK7A 4EFBA 3HB9A 1JSUA 4YTFA 4KINA 4J52A 3OUKA 2XJ2A 3RVGA 4PWNA 3E8DA 2XBJA 5CQUA 4HZRA 2O3PA 1M14A 4FKJA 1WBSA 2ZM1A 3WF8A 4AZEA 3WYYA 4IB3A 3ZO3A 3T9CA 3QCXA 2CPKE 3EJ1A 3VOTA 1YW2A 2E9NA 4LMUA 3MA3A 2C5YA 2IJMA 3QWJA 4FSTA 2ERZE 4MX9A 5CWZA 4FVQA 4FTQA 5H8BA 4AT4A 4BDEA 4DTBA 4EEVA 2W1CA 4G6LA 1Z5MA 5BX0A 5IDPA 1IA8A 4GS6A 2PMIA 3F9NA 3VVHA 1ZYJA 2V22A 4MXOA 2W6QA 3NC0B 1CMKE 1JKTA 4FL1A 2V7OA 4GSBA 4XS2A 4EOQA 5J1WA 5K2MA 5FUTA 1NVSA 1BX6A 3FPMA 2OK1A 3KL8A 4EYJA 2X2LA 3DK3A 5JVDF 4PNIA 3ZFXA 4AS0A 3GJXB 1H0WA 4F1OA 3CLYA 4WKQA 3PJCA 3HRCA 3PG1A 2YS6A 3WO0A 1I1LA 4RJ6A 2XRUA 4S30A 2JDVA 2OH4A 3DQWA 5HLWA 3WF6A 4C4HA 3RTXA 1GAGA 4AACA 2OWOA 3K3PA 2GU8A 1OITA 1LEWA 3LFCA 5B2MA 3HBLA 3FJQE 3EL7A 2PVJA 3ZEPA 2WTDA 2YS7A 2F2UA 3VWAA 1A06A 2PVKA 4U44A 2DUVA 5A3XA 1G3NA 3I6UA 3EQFA 5M4FA 4KKEA 4IIRA 2B53A 4M97A 3OY1A 2ETMA 3GQLA 2QLQA 1U59A 2JDTA 1PXPA 3OUNB 1LPUA 1VYZA 4JJRA 3VQUA 2X7FA 2XYUA 3L9NA 5LCKA 5LYJF 2BUJA 2FGIA 4BZOA 4AN9A 3RAKA 3PXKA 3FAAA 3E5NA 1CKJA 2HZ0A 3KEXA 5C8NA 3LLAA 3MVLA 3OVVA 4JLCA 3GDEA 3ZO2A 4MKCA 3KULB 2VTOA 4XG2A 2HVQA 2C5XA 3ORXA 2IZTA 2XNBA 4QMZA 1G2WA 3SG8A 5CTPA 4ZOLF 4NZMA 1ZAOA 4MAOA 3R1SA 5CA1F 1WBPA 3EZVA 2PMNX 3FXZA 4M9UA 3BIZA 5CNOA 4PUZA 5DGHA 5JRSA 5HVYA 4IQ6A 5CT0A 3GC0A 5IZFA 4IC7A 2Z60A 4FKWA 4H3QA 4XV3A 4C33A 1JDEA 3OCTA 1ST4A 2X2MA 3G5DA 2VTHA 3QQHA 4GMYA 3UC4A 5E8UA 3GOPA 1TA8A 3NUYA 4YO4A 3I0QA 1TFFA 2X6DA 3MWDA 2Q83A 2E9VA 3MH3A 4XOZA 3CQEA 4J71A 4MBLA 4A9TA 2G2IA 2R7BA 2W1ZA 1U5QA 2PYWA 5CAEB 2ZDQA 3NNVA 2J0MB 2E9PA 3JPVA 3C5UA 3L9LA 3R2YA 4N6ZA 4D0WA 3OC1A 4RIYB 5IQFA 3N6RA 3SRVA 1JWHA 2EB3A 5D41A 4TVIA 1Q8TA 3GNIB 4HQ6A 1TKIA 5DH3A 4E5WA 4FV9A 3TW7A 1YWRA 1REJA 3IW8A 4U43A 4I55F 3Q2MA 4F99A 3EB0A 2C3JA 4YJUA 3FKNA 2J50A 2XK7A 5IA0A 3KY2A 5CU6A 1H07A 3QRTA 5DT4A 4UCUA 5BWRA 4RIXA 5JQ8A 4IANA 2WTCA 2NU7B 1JKJB 5DN3A 5CVGA 3W1GA 3W0OA 2XM9A 4GKIA 2XK3A 2WD1A 3IGGA 3ACJA 1EKPA 4BZDA 4DHJA 2HIVA 5BWXA 3I79A 4KSQA 2OH0E 4BDHA 5CR5A 4G3FA 5E4HA 4OLIA 3NGAA 3SXRA 3VUHA 4AA5A 4IX4A 3MJ1A 4OBPA 2CMWA 4FC0A 3FLNC 4ZSAA 1GNGA 3KXXA 2HDKA 4B99A 4CTCA 2GPWA 2XCLA 5HX8A 2BCJA 3QQMA 4KS8A 3IDCA 4O7LA 4QPSA 1ZOGA 5J87A 3SGCA 2YDJA 3SXSA 1NY3A 3ZXZA 3UNJA 3LXNA 4BZNA 2ITPA 5FBOA 5AUZA 2R3IA 2FSLX 3FHIA 2QI8A 4O2ZA 1I44A 1PMUA 3DCVA 1PKDA 2DQ7X 3FMHA 3Q4ZA 2SRCA 4MHAA 5DA3A 5E8YA 5EI2A 3R8LA 2VPQA 4U8ZA 4H1MA 4L3PA 2WMWA 3R02A 2HAKA 3EQRA 1YOMA 2R3MA 4G17A 2XAMA 5L6WL 3VS5A 5L2WA 4MAMA 4LYNA 2FH9A 4NYEA 5LP6F 3GFWA 5LWMA 3VHKA 3UMWA 3U9NA 2QOQA 5E92A 5CSPA 5DIAA 1OIYA 4FSMA 3TWJA 3V8WA 4HVHA 5IUGA 5LJJA 3W2RA 2WMAA 2QNJA 4I92A 5BV3A 3MI9A 3R00A 2W0JA 2NU9B 3QQUA 3QQKA 3R2BA 4L43A 3BLHA 4Y73A 5FQDC 3ODYX 3KXMA 3W2OA 1PF8A 3ANQA 2VUWA 4IWQA 4N0SA 3MSSA 4BCIA 3R7EA 2WTKB 4J96A 4QPAA 2RFEA 3R0TA 3TY5A 5D9HA 4EG0A 1TQIA 1ZXEA 2RIOA 2UW5A 5EYDA 3VBYA 4EQUA 5J9LA 2OF4A 3OY3A 4C37A 3A99A 3QZGA 3BHVA 4O0VA 5CASA 4YHTA 3K54A 4QMMA 4YZMA 3NYXA 3COKA 3OOMA 5J9YA 1OM1A 4AFEA 4A4OA 1H01A 5AIKA 5KMJA 4IVBA 2YJSA 4HVIA 1DAWA 4E4NA 4FKTA 1UNLA 3ULIA 3VC4A 1I1KA 1SVEA 5AV0A 3EIDA 1V0BA 4RC4A 3VBVA 2ZMCA 3G9NA 2C30A 4FV3A 3TZ7A 2R5TA 5G6VA 4KS7A 4HGLA 4O91A 4Y8DA 4ACDA 1BNCA 4K18A 3LP8A 4PL3A 2NRUA 2O63A 2ZDTA 4CT2A 3KN6A 4WBOA 3QTRA 3AC3A 4AT3A 1P16A 3U6JA 4LQMA 1BXRA 4C5CA 5A9UA 3BABA 3GLKA 1CKPA 2PMOX 4IHPA 1T36A 2JKOA 2B0QA 3V51A 5GJGA 3B8RA 4IWDA 2ZAZA 3S24A 5BPFA 2P4IA 3T9IA 3IKAA 1OMWA 3Q2JA 3UO6A 4QQ5A 5C1PA 5F94A 4BTMA 4I6LA 1OZ1A 2B54A 3PYYA 5A4TA 1W7HA 5JSMA 4O6EA 3WIGA 3HNGA 4A9RA 4PQNA 4EC9A 5HNEA 5GJFA 4PDPA 3GT8A 4MXZA 4QYHA 3FXXA 4Z9LA 5EW9A 4F09A 2C00A 5M08A 3QZFA 1EYZA 3BPRA 3ZMMA 2ITNA 3DNDA 1PMVA 5HNBA 4FFPA 1XH5A 2I40A 1ATPE 5DPVA 4UCVA 5CQWA 3QL8A 3NUNA 2PY3A 3Q5IA 4IX3A 4MBJA 3KU2A 4MD8E 4E6CA 1ND4A 2XNNA 3MJFA 3A62A 4TZRA 4OTRA 5HG9A 3V5WA 2PZ5A 4U81A 1XBBA 2EWAA 4QP6A 2GNIA 4PNKA 4HGEA 4G9RA 1OIRA 1OUKA 1URCA 4JBOA 2PZRA 2V7AA 3JR1A 2YZGA 3DAAA 3I60A 3UOJA 1Q8WA 2AC3A 2J7TA 4RMZA 5LXMA 4FSUA 4DHFA 1OECA 1CSNA 3DQXA 4LRJA 1BL7A 3R8ZA 3UOKA 5CEKA 4PMPA 2ZDUA 4XG9A 5M4UA 1M0TA 4IACA 3SX9A 3PE2A 1KC7A 3HLLA 4CC5A 3FZTA 3LE6A 5DLSA 4F64A 3R1QA 3QRKA 2PVLA 1ZY5A 2WQEA 4O7SA 2C3KA 2OJJA 4IBMA 4BY9E 5JGBA 4Y85A 3EFKA 2XS0A 1ZMUA 5BVEA 2YCSA 4J7BA 5AA8A 4K6ZA 1B6CB 3PA3A 3IDBA 4C4EA 5HO7A 5KNJA 2HW7A 3VS2A 4H3PA 4MXAA 4PV0A 1NT2A 3FQEA 3WILA 3WOWA 2WMQA 4TPTA 4YJOA 2QLUA 2X9EA 3FZSA 3NUUA 4RLLA 1Q99A 1WVXA 4FT9A 2Q0NA 3HRBA 3T9AA 3KRWA 5IQAA 3UZOA 3FDNA 3Q60A 2YM6A 3TY8A 3NR9A 4FTTA 3G33A 3ZH8A 2XNOA 2HZ4A 3AT4A 3BZ3A 4RX9A 4CKIA 2W1GA 2BVAA 5CVFA 4O21A 3W33A 3ZONA 5HCXA 2YRWA 1ZYDA 3R73A 2C3IB 3OS3A 4EZ3A 4ZTQA 2I6LA 3R9DA 4DG2E 2XKCA 1GY3A 2BRGA 5DNRA 1PXNA 3DPKA 1PYEA 2C6MA 3EFLA 3HMOA 1YQJA 3ZUVA 4I4EA 4M7IA 3PSBA 5L2SA 3NRMA 3JSLA 3ZRMA 2FPPB 2OJFE 2BILB 2HCKA 4YSMA 5BWTA 4ZHQF 4IAKA 5EQYA 4I1ZA 3R9RA 4BGQA 1XO2B 3QCSA 3PPKA 4TWCA 2BR1A 3OBGA 4K1BA 3A7JA 2YAAA 2VTNA 4H39A 1ST0A 2W1FA 4RVMA 2IZRA 3MJ2A 3OZ6A 4CTBA 1JSTA 1NA7A 4Z3VA 2YRXA 4CKRA 4QP3A 3F88A 2WMUA 3MY1A 3ORMA 3Q6WA 3O7LD 4M13A 4F0IA 3QTWA 2WYOA 1K2PA 3UPZA 4K2RA 5BUEA 2YA9A 4WD5A 3WF5A 1BI7A 3LOKA 4X3JA 3JRXA 2JIUA 1PXLA 3FI3A 3LXPA 5HICA 5A6OA 5HO8A 2XA4A 3NYVA 3KAKA 4GT3A 4JDJA 4ZZNA 2YIWA 2HY81 3ACKA 3TY9A 3EL8A 2V62A 3AX6A 2ACXA 4CFMA 4FG9A 5IQCA 4FSNA 3MW1A 1OBDA 4U0IA 4DBNA 4JT3A 1J7LA 4FZDB 3PTGA 3KVXA 2HZNA 4LDTA 5ANIA 4XYMB 4MQ2A 5ETIA 4CRLA 3NW5A 5CEOA 4OT5A 4OUCA 1H00A 5HLPA 3NNWA 3VBTA 4D5KA 2B9IA 1Y6BA 2DWCA 3ITZA 4NFMA 4QYGA 4QTAA 4S32A 3RV4A 3WNZA 2VWVA 3VUDA 4HNTA 1G8JA 3E7VA 3RALA 3E8CA 3F5XA 5EZYF 4UZDA 3UDZA 2CKQA 2J0LA 3KF7A 2R9SA 4L52A 4CVAA 3EHAA 5T68A 4C2VA 5I5ZA 1DV2A 4U80A 4TXCA 4YJPA 3QHRA 4RA5A 5EDPA 3TNWA 4F6WA 2I87A 4H3BA 4PZ7A 3NNUA 3D83A 4FV4A 5TF9A 3PVWA 3NFFB 4DLIA 4NK9A 4E8AA 4EQCA 4EOSA 1BLXA 4MD7E 2PVPA 4FKVA 3QBNA 3ORZA 2J4ZA 1F0QA 3O71A 4NSTA 4RSSA 4DFXE 4JQ8A 2I0YA 1M52A 4YLLA 2Z04A 4FT7A 4RQVA 5B0XA 4FIFA 2O2UA 4IVDA 5A4QA 5HBJA 5HTCA 5M51A 2EVAA 3PN1A 2PK9A 4L7SA 3KREA 4EK6A 2BDWA 4L01A 2BDFA 1GIIA 3DB6A 5CXHA 3VF8A 4PX6A 5GINE 3DZOA 3A60A 4IB0A 4FODA 5KZ0A 4XBRA 4M12A 3RP9A 3GGFA 2X39A 4USDA 4F7LA 3VF9A 5AMNA 5IMXA 3CJFA 4GUEA 4PF4A 4QMWA 3NCZA 3V5LA 2C5OA 3R7IA 2X2KA 4OT6A 4JOAA 2R3FA 2OXYA 2JKKA 3W0PA 4AGWA 4G2FA 4LI5A 3N4TA 3BYUA 4I5PA 2V58A 1IYDA 2GNLA 2COGA 4AFJA 1JOWB 3PPJA 4IWOA 3VS4A 2C3LA 3UG1A 1JVPP 3VAPA 3WWIA 1O6KA 3BBTB 1XQZA 4NH1A 1R1WA 1GSAA 5FEEA 3M42A 3F2NA 5LQFA 4Y8VB 4QMPA 5I5SA 1CM8A 3RNIA 3AW8A 5CSWA 4DT9A 4LH7A 2QODA 1C30A 1R3CA 4BKJA 4L44A 4EH9A 3DXPA 1QPEA 4O0UA 4W4WA 3UDSA 4F65A 3BCEA 4EZ7A 4ZTMA 4RVTA 4LH6A 4ZQIA 3CD3A 5IA2A 5JFVA 2YZAA 3C4CA 3HEGA 5TT7A 4AT5A 4B4LA 5CF8A 2UW4A 3I6WA 3ZS5A 3KMUA 3HV6A 1QCFA 4C59A 4E4TA 2BAKA 3ZOSA 2XIXA 3F3WA 5D10A 4UFZA 2W9ZB 2P33A