4O83A

Saicar synthetase (type-1) in complex with adp/amp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with ADP/AMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o83A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o83A02
4BZNA 4MWHA 4D55A 5K4JA 5BPFA 3QLGA 3LE6A 5AP6A 4PMPA 5IA1A 4R5SA 4BDGA 4IAYA 1YDTE 2PUUA 1ZWSA 4BBEA 4YJUA 4FE2A 2JKKA 4BB4A 3QTUA 5HEZA 4XX9A 2IZUA 1DAWA 2YDIA 4UY9A 2VPQA 5JKGA 3HV7A 2F4JA 3ZLWA 3CEKA 1X8BA 2P3GX 4D2SA 4YTHA 4BVUA 5HE1A 3IKAA 3FZPA 3VW6A 3E8EA 2W1ZA 2WTWA 4L45A 2XBJA 2QF7A 1XH4A 4EHZA 2ZYBA 4QMUA 4EQUA 2R82A 3NUYA 3MH0A 4UYNA 3HVCA 5C01A 2PZRA 2GQRA 1Q24A 3UMWA 3CCNA 2R3GA 3ZBFA 4I24A 5EM7A 1HCLA 3BV3A 1JSUA 1QPCA 5KHWA 4U97A 4EH6A 1CKJA 4F7NA 1HOWA 4AZTA 3S00A 2R3FA 5DRBA 2KTYA 5CS6A 1GNGA 1ZOHA 3PZHA 2ZVAA 5L8LA 2UW6A 3HO8A 3KQ7A 4U81A 2OH0E 3PP1A 3FMJA 2BHEA 3NYNA 1H08A 5L2WA 4MWIA 3D7ZA 5CEOA 4ITJA 4X7QA 1FGIA 5A4CA 4IWDA 4QYFA 3VHEA 3E92A 1W7HA 4DLKA 3EZVA 2JIVA 3COKA 4O27B 3RPRA 3EYGA 3UE4A 3PJ3A 2R3KA 3VS4A 1RJBA 3QGYA 2GS6A 3KK9A 4Z9LA 2UW7A 2XNGA 3FMLA 3QUEA 3UOHA 2R85A 2XMYA 3LKMA 5HZNA 3HMPA 3R83A 2O64A 3V5JA 4F70A 2W96B 1DAYA 3AGMA 3M11A 5I4NA 2BUJA 3BHTA 5ITAA 3I12A 4Z7HA 2R7IA 4U8ZA 3PP0A 3RWQA 3THBA 3MVMA 4E5BA 3FSFA 2NU6B 4ZLOA 5CAEB 1LEWA 4RIWB 5EK7A 5EHYA 3A7JA 2GS2A 2VTPA 3EFLA 4I55F 1JNKA 3BCEA 4FUXA 4QMYA 4K8AA 3Q2OA 1OVEA 2JKQA 4HR7A 1UU3A 4EGJA 5HD4A 5JH7F 1IA9A 4MQ2A 1UNLA 4FTMA 4JT3A 4O7ZA 4O4IF 2R3LA 3JUHA 3UP7A 5CVGA 1MQ4A 3DFCB 3FMDA 1G8SA 4U5JA 4JIKA 4LV8A 3TI1A 2YIQA 3H4JA 5IEXA 4QMXA 4G9CA 1ZRZA 3AD6A 2ITPA 3DJ6A 1MUOA 2XIYA 3FMMA 3QD4A 5F20A 4YTCA 3VUDA 2XCHA 4DGGA 3ORQA 4Y8VB 1VZOA 1XH9A 2YW2A 1SNUA 4FODA 3FZOA 5A6OA 4FKSA 2UW0A 3HRBA 3QTWA 4RA4A 4CQEA 2WKMA 3OY3A 2IP4A 1OUKA 2YHVA 1IASA 4RRVA 3CE3A 4JG8A 4HPUE 3R8ZA 1FVVA 2GHGA 3W1FA 1OL1A 1SVHA 3R8VA 3RAIA 5CF4A 3NDMA 4HGTA 3M2WA 1KWPA 4M12A 3BE9A 2YZAA 2QOCA 4XG2A 4CKIA 4FOCA 3ZC5A 3Q4CA 5DG5A 3ZFMA 4O86A 2B9HA 2WMVA 4Z55A 5KZIA 4MXXA 1KOAA 4FFMA 3OXTA 4J53A 3E5NA 2JKMA 5AP4A 4H3PA 3D2IA 5DR6A 2R87A 2RF9A 2VWYA 4I5CA 5HE2A 3QQLA 4DGNA 2GNIA 5CENA 2AC5A 5H80A 4GG7A 1YKRA 4X3FB 4AZSA 4I4FA 1OL6A 3HECA 4FVQA 5LARA 3VWAA 3VBXA 2W1EA 4ANQA 4C4GA 3FLQA 4MXYA 5FTGA 4ZIMA 5C03A 3EHAA 1L3RE 3NW7A 3CSVA 4FG9A 3W8LA 4DF3A 1Z2PX 4KBAA 4DT9A 3LP8A 5IA4A 4W4YA 5E90A 2F2UA 4DEHA 5CTPA 5IUGA 2ITVA 3Q5IA 3MTFA 4XG9A 3V6SA 5TKDA 4F9YA 5CSWA 4P90A 2R7BA 2PU8A 4JR3A 5T3QA 4V01A 5I9WA 3AG9A 5AP2A 3PUPA 1J3HA 4F6WA 4W4VA 4O4LF 1U54A 3FBVA 5AV0A 3FMKA 2R3PA 4MKCA 2IVTA 3QTIA 3PE2A 3QCSA 3R0TA 4KKGA 5HCZA 2HELA 3AQVA 2W5BA 4X2GA 2PSQA 3IW5A 3NX8A 2R3MA 4RJ7A 1EHIA 4BIDA 1RQQA 1ZOEA 2C0TA 3K2LA 3F2AA 4X2NA 4AZVA 3TZMA 3FY2A 1PX2A 4DLIA 3W2CA 1UWHA 3ERKA 4NJ3A 2ITQA 3KU2A 2V22A 5LCKA 4FFRA 1WBVA 1O9UA 5EH0A 3FE3A 4MBJA 4GFOA 4ID7A 3H0ZA 1QCFA 4O7TA 1Y8YA 2BRBA 3K3PA 5HG7A 5HG5A 4I5PA 3PYYA 3DK7A 3HA8A 4FIHA 4GIHA 4AN3A 2XYUA 3F5PA 4IZ7A 2YZMA 1Q99A 5CQWA 2YM4A 4FI1A 4Y85A 3GGFA 3L8XA 5A4EA 2C5VA 3QKLA 4PMTA 2CLQA 4EI4A 3GB2A 3RUPA 3W2QA 1FQ1B 4FTLA 2VWZA 4TTHB 2PZ5A 2QOOA 2CKOA 2XF0A 5L8KA 3TUDA 5I5ZA 3F3VA 4IZOA 4TXCA 2W99B 3DB6A 5IEYA 4HYHA 2CN8A 1WVWA 4MK0A 4ACCA 4PDSA 1Y91A 3FXZA 1JDEA 3RV4A 3KGAA 3UIBA 2JAVA 2HZ0A 4EOPA 1WVYA 5I9ZA 3DNDA 4PF4A 5EHOA 3FZTA 4LOQA 5GJDA 4F64A 3POZA 4FSWA 5ETFA 2PUPA 5HQ0A 4XG7A 2V62A 2W1HA 3P1AA 5FBNC 1Q8UA 3HA6A 2X2LA 1ZYSA 3VN9A 5CEPA 4CFVA 1URWA 3FYJX 4B8LA 3PIZA 5ANOA 2OLSA 3TV4A 4PNKA 4RQVA 4CRSA 1OKYA 3HLLA 4C5CA 1IAJA 1QMZA 2C6IA 4TNDA 3RALA 3MS9A 2J5FA 5EQPA 4D9TA 4USFA 4O96A 1PXOA 5M4UA 5EYDA 3BI6A 2OI4X 2JD5A 5CSVA 4ZJIA 3ZTXA 4DEGA 5LVPA 2NU8B 3VBQA 4AOJA 4KINA 2WMBA 3G51A 5JZJA 3BU5A 3VAPA 5BX0A 4E4MA 3RAKA 3SGCA 3LCOA 5FNVF 2H8HA 3QA8A 3UVPA 5M4CA 2UW8A 3UQGA 1YRPA 4DGLC 4G6LA 4BCPA 3JVRA 3LFFA 4Q9ZA 4E8AA 3EQPA 5H9BA 3OF0A 4J7BA 3TT0A 2H34A 3KREA 2Y4IC 4XEYA 4DLJA 2OSCA 4XYFA 1Y6AA 2P2HA 5JGDA 1PKGA 2WQMA 5GIPE 5HVYA 5LA6F 2F49A 3Q52A 3FHIA 5CWZA 3V01A 3ZU7A 4EQCA 2QLUA 3FXWA 2OXYA 2C6KA 4A9SA 5HCYA 3VUIA 3L8PA 1VBGA 4QYEA 4C38A 3UYTA 2F7EE 3GOKA 2RFSA 5L6OA 3TUBA 3ENMA 4FTRA 4F9AA 1GSHA 1PRYA 4GMYA 3CP9A 2FH9A 3MIAA 3WE8A 2PN1A 5DWRA 1ZZLA 4O2PA 4JIAA 4FL2A 4PTGA 3ZSGA 4YAKB 5HORA 3VHKA 4P4CA 3LJ2A 4FEWA 3N4VA 4Q5EA 3EQFA 2C69A 2BAKA 1OM1A 1PMNA 3Q32A 4D1SA 4UX9A 4TYJA 4O0TA 2W4KA 3A7FA 3AMBA 1MRVA 2GNHA 4CZTA 4IVCA 2NRYA 2G2FA 3E8DA 1J7IA 2XNEA 3DAEA 4ITIA 4NM7A 3ZXZA 3LQ5A 4MA0A 3NIZA 5D11A 2C30A 2R3HA 4I0SA 4CFMA 5FEEA 1ZXEA 4HCVA 2G1TA 2WTDA 2XKEA 2H6DA 4N6YA 3ZRKA 3MDYA 4KB8A 3VBWA 4YGAA 2R86A 5KMMA 2X1NA 4DFUA 4IWOA 5E8SA 4EORA 2PK9A 3HUBA 4C2WA 4RPVA 3ACJA 4KS7A 3VUMA 4E7WA 2FP4B 4IFCA 1OECA 4F99A 2RFEA 4ACMA 4O7RA 5AV4A 4YJ3F 2B9FA 4RX5A 3DS6A 3AC5A 2FSOX 2XYNA 3TV6A 3WF8A 1IOWA 3AC2A 3GCQA 1YOJA 2Z60A 4TWNA 1ZLTA 3NVKI 4KIOA 3NZ0A 5JSMA 3DJ7A 4QP3A 4B99A 4K77A 2BPMA 3LCDA 3BGZA 3R9OA 4DBNA 3IDBA 5J2UF 3R2YA 4DFBA 2XM9A 4RX9A 4PUZA 4XOYA 2OO8X 5HD7A 5CXZA 3ZO3A 4C3FA 3R7EA 3HMIA 1PXLA 1PY5A 5IZFA 3UZRA 2RGPA 2XNPA 4FKVA 5IA0A 2OU7A 3GU6A 4GK4A 3MVJA 1J1CA 2PE0A 5E8ZA 2RFNA 1Y57A 2WMSA 3I7BA 2X8DA 5CANA 4F7SA 2GCDA 4RC4A 3IS5A 1YWNA 3W55A 4MV1A 4RIWA 4EWQA 3Q6UA 3ETHA 3OEZA 2UZTA 1XH5A 3O51A 2JBPA 5AX9A 2YABA 5DNRA 1OKVA 1KJIA 4S31A 3QRTA 4ZSEA 4CMTA 3FZRA 4F09A 2WEVA 2XNBA 4NM3A 4RVKA 1C30A 3MVLA 4QOXA 3W16A 4KSQA 4BIEA 1M7NA 4UBAA 2B1PA 2OFVA 1H27A 3C9WA 3COMA 4ZTRA 5LMAA 5LP6F 3F3WA 3JY0A 3Q4UA 2C6LA 4WO5A 3VF8A 1I7NA 3VBYA 2W71A 4TUYF 4WOVA 2W0JA 3OP5A 3G0FA 3D7TB 4L43A 4G3GA 3R7VA 1GIJA 1Q3WA 1O6KA 1YI6A 2H9VA 4GVJA 3ZUTA 3LXNA 4ZZNA 2HK5A 2BHHA 4H1JA 3TXOA 4IM0A 4JQ8A 1ZMWA 1YXXA 3A7GA 3OWJA 3BGPA 2R3RA 1FPUA 1ZAOA 3ZCLA 3TWJA 4L3LA 4PY1A 2J2IB 5KMIA 4K11A 4C35A 3U6IA 2QQ7A 4USEA 3HEGA 3EKNA 2WQBA 1OMWA 3DKGA 1GJOA 4IAIA 4ZOGA 3TN8A 4BCQA 4IWPA 4JAIA 4KWPA 3KAJA 3KRRA 5IQAA 5HE0A 5FXSA 1BMKA 4ANBA 5J95A 2FPPB 3F88A 1KEEA 3CJGA 2ITUA 1YQJA 2XK7A 4FEUA 5BVEA 3E88A 4LG4A 3MV5A 5G1XA 4GT5A 4AT3A 2XB7A 4Q2AA 3BZ3A 3R7OA 5LVNA 4PV0A 3MIYA 4G34A 4ASDA 3TTIA 5D10A 3W2RA 1ZZ2A 1CTPE 2ZDTA 4A06A 3EH9A 2CKQA 2UZVA 2ZB0A 3BHVA 3UQCA 2OBJA 5DOSA 1XQZA 4ITHA 5HTBA 4O4HF 3K5UA 4X3FA 3RM7A 4HCUA 4JQEA 4PWNA 2FO0A 2E9PA 2QCSA 3FLZA 4N4SA 1XKKA 3DQWA 3QX4A 2WYOA 4O21A 5I9YA 4XX0B 4XP3A 5ANEA 4U9AA 4GT4A 3HZTA 4ENYA 1UNGA 5HNGA 2DWBA 5ANGA 3GU8A 3L8VA 3MH1A 3PXRA 4QPSA 3VBVA 1UNHA 3LM5A 4JR7A 4BCGA 3SOAA 4JAJA 3I0OA 4YC8A 1A06A 2WNTA 3KXGA 1YOLA 4KBKA 2WOTA 2QOBA 4FL3A 4EOSA 2F2CB 2VD5A 4CKJA 1T45A 4I3ZA 4EK4A 2PUNA 4FSMA 1U5RA 5DEYA 5KKRB 4C5AA 4LRJA 5CAOA 1WVXA 5E8VA 1OBGA 1JPAA 2Z7LA 5ANDA 5J7HA 4XMOA 2CGWA 2QOIA 4C3PA 3L1SA 5IQEA 3JS2A 1CE8A 3QTXA 3FKLA 4QP4A 3LJ0A 1U46A 4NTTA 4IEBA 2Z8CA 4XLIA 4O0SA 3CS9A 4F7LA 2ZV2A 4HYSA 3VPBA 1E9HA 4IZYA 1RW8A 2PMLX 3RPVA 3P7CA 3HMNA 5EYCA 4QO9A 4I41A 3JVSA 3IONA 3R2BA 2UVZA 4RJ5A 5L6WL 3I1AA 1FOTA 4FFLA 4QMOA 2OXDA 5DH3A 4ZXTA 5E8WA 1ZYJA 3DQXA 3VC4A 4F0FA 1A9XA 1KE5A 4I23A 3PA3A 4FVPA 4CT2A 2YWVA 5FUTA 2C68A 2W9FB 4NKAA 4DT8A 4H05A 3PXQA 4HW7A 2Z04A 3C5UA 3R9HA 3R8PA 4PTEA 3PY1A 3RJCA 3KF7A 2OJJA 4RJ4A 3KCKA 4XHKB 1W93A 5CF6A 4R3CA 4CV9A 3U9CA 2YS7A 2UVXA 3E3PA 3FLNC 4LM5A 4AW0A 4YAJB 4MEDA 2XCKA 4D4VA 5JK3A 2BDFA 1PKDA 4QMSA 1E1VA 2VX1A 2QO7A 3RK9A 3ZC6A 1XO2B 3OZ6A 4M3QA 4BICA 2PVMA 1B6SA 4J1RA 5EM8A 3FC2A 4FIFA 3ZBXA 4E26A 4WA9A 1EUDB 5TT7A 2NU7B 5HHWA 3QZHA 3VRZA 2YACA 3T9TA 3NCZA 4TYHB 4DYMA 3ORLA 3S0OA 3ATSA 3PVGA 1YDSE 4FIIA 4I1ZA 4EKLA 4EOKA 4OTHA 2C6DA 4XP0A 1DI8A 3AC4A 3FC1X 3ZFYA 3ZZEA 4DFXE 1M14A 3CBLA 4EHVA 4RIXA 2I80A 4FKRA 2ERZE 4C36A 3KN6A 4EUUA 4FV4A 3RAWA 1P4OA 5HLWA 4FZFB 3BEAA 3DFAA 5H3QA 1SM2A 3HV5A 4PNIA 3DK6A 3CTHA 5HVKA 3ZHPC 3II5A 2QNJA 3N51A 4DHFA 3MFUA 5HKMA 4H39A 4EH7A 4D2RA 4E4LA 3QQHA 1Q8TA 3A7IA 3KK8A 5M09A 4PMMA 2DQ7X 4AA0A 2GFSA 3NUSA 1MQBA 1CS0A 4CFUA 3NIEA 4DCAA 3C13A 3AW8A 2WIPA 2A19B 2X4FA 3KMMA 3DXQA 3RWPA 4BDKA 4CFFA 3QRIA 3BYSA 4AZWA 1VYWA 4RC2A 5CYIA 2PY3A 2QI8A 4EH2A 3EFWA 2QONA 4CSVA 4GV1A 5J9ZA 2BKZA 4F9CA 2ZAZA 3QAME 2WD1A 1BXRA 3UYSA 3Q9YA 3UPXA 3BYVA 4CZUA 4AT5A 3CD3A 3HDNA 3UZTA 2R84A 3FJQE 4KIQA 3TG1A 5A6NA 4O82A 1M17A 5M08A 5DBXA 1EYZA 5AUXA 4FKTA 3I4BA 3R9RA 1S9IA 4PQNA 3KY2A 5IYZF 5KO1A 4MD9E 2YFXA 4DN5A 5M57A 4IJ9A 3QRUA 4MV7A 2NU9B 3F5GA 2V55A 2XKDA 4KNBA 5DMXA 2BZIB 4I92A 3U6HA 5ANIA 2R5TA 4KA3A 4TPTA 2CCIA 3E7VA 3PXYA 4UWBA 5HIDA 4XCUA 2J0JA 4DEDA 3TNHA 2VZ6A 2C3JA 4MQ1A 3ZS5A 4JLCA 3VULA 1M2RA 5EM6A 1KC7A 2FSMX 4HYIA 3PSDA 4QT1A 4JBQA 5FG8A 4YMJA 1Q8WA 1GOLA 3PWDA 5DFPA 1JQHA 4HGEA 2UW9A 2QODA 4QNYA 3WZDA 2OWBA 4MH7A 4RZVA 4U7ZA 1OPLA 3E8CA 1V0OA 3EKKA 4FV2A 2FSTX 2HOGA 3FEGA 1H01A 3AT3A 4YJSA 4P5QA 4WHZA 3TKIA 5JMSA 1Q4LA 3AC1A 4EOMA 4GVAA 4I4EA 4ZLYA 2YM7A 3H9FA 2IG7A 2IW9A 3UNKA 5GIOE 3QQJA 5BVOA 2EB2A 1PMUA 4MF1A 4EJNA 3FL4A 4M0ZA 3ENHA 3KCFA 4QYHA 4XYMB 5E8YA 4B7TA 4ACGA 5D41A 5BVWA 4BCNA 3U6JA 4CVAA 1Y8GA 4ZOLF 2EU9A 3QXPA 2X6DA 5KMJA 4U0IA 3WNZA 2W1IA 4ZTQA 3FWQA 1H1QA 5AUTA 5E92A 5AP3A 4ZZMA 2CGXA 2WMRA 5HESA 5C27A 3RI1A 3G9LX 1OI9A 3DLSA 4NYEA 4BDIA 4R3RA 2Y0AA 3ELJA 1B6CB 3BYUA 3JXWA 4DEIA 1J91A 3KVXA 3WARA 3V4SA 2XM8A 5ACKA 4LUDA 3OOMA 1JBPE 4JDHA 3REPA 3ZO4A 5CEQA 2F7XE 3K3JA 4BIBA 4M67A 4RT7A 2W4JA 4XRLA 2PVJA 4TWCA 4ERKA 4WG3A 4IH8A 2QU6A 2OGVA 1ZOGA 2P4IA 5IA3A 2C1AA 3IPHA 3LM0A 4F9WA 5E9EA 1KE8A 2IO6A 4LQMA 1H24A 1WCCA 4G3EA 4L8MA 4YHFA 2GMXA 4YSMA 5TOZA 3HL7A 2VO3A 4TYIA 2PHKA 4YJOA 4FSNA 3OS3A 4O2BF 1FVTA 3BHUA 3NUAA 4X0MA 4TZRA 3EN7A 4G3FA 1A48A 5AUVA 3MPMA 3BG5A 3D2KA 4D0XA 3U51A 4FX3A 3QTZA 3H9OA 1M2PA 4NT4A 2AUHA 2V58A 3FI3A 3Q9XA 4C33A 4J8NA 3GC0A 4ASXA 3QQFA 5AP0A 5DT4A 5E1SA 4U40A 2PVLA 2VTNA 3O17A 3RINA 2V0DA 4LGHA 1JKSA 3D7TA 1IRKA 3EZRA 2YIRA 4EK3A 5KMKA 5L2IA 2CZGA 2QR8A 3IK3A 3VS1A 4Q9SA 4YJ2F 4AS0A 3ULZA 3GC9A 4J52A 4YZBA 4W8DA 3ETJA 2HY0A 2QKWB 5AIRA 4RJ8A 3EWHA 4QP8A 2O5KA 3BLQA 4YZ9A 2ZV8A 3IOPA 3R1SA 4GK2A 1AQ1A 3DY7A 3TM0A 4CFNA 4EOQA 4EOLA 2XUUA 5FBOA 3PIXA 2BROA 4DH1A 1J1BA 5AUZA 3G8DA 2OZOA 1DS5A 4N6ZA 1KOBA 2YAKA 4K0YA 1OL2A 2XNMA 3MJ2A 2UZNA 4ZTHA 2WO6A 4QP7A 1GZNA 1W82A 4BDFA 2XD4A 2CSNA 4G6NA 4ZS0A 3G0EA 3IGOA 1XH7A 2BZHB 4ZHQF 4FFPA 2RKUA 3PDTA 4R78A 4CMOA 5BMSA 1CKPA 4Z7GA 3NSZA 3I5NA 3G2FA 3LFBA 4XV2A 3SVVA 4C7TA 5CSXA 2CNVA 5K9IA 3PVBA 4JRVA 3AOXA 4FUYA 1UVRA 2A2AA 3L8SA 3UIMA 2XK6A 4CV8A 1LR4A 3VS3A 2G01A 4EHEA 5J1WA 2QK4A 1QPEA 1GZ8A 3OWLA 4EQMA 3TNQB 4TV9F 3A8WA 3UJGA 4BCIA 3C4WA 3CGFA 2I0EA 3F61A 2WEIA 3DK3A 2NO3A 1CM8A 2RFDA 4WKQA 4ZP5A 3MESA 1GLVA 3RV3A 3SG9A 1BYGA 1PHKA 4BCHA 3RZBA 4MBLA 4GK3A 4DTKA 4XP2A 3QCXA 3U9SA 5A54A 5CZIA 4RC3A 3I79A 1H07A 4E4XA 2B52A 4MAOA 1G3NA 5M56A 1WMKA 5DIAA 4DINA 5LQFA 3PJ2A 2J0IA 2J90A 2WQOA 2CLXA 2JFMA 2B7AA 3EN4A 4EH5A 4IADA 5IA5A 3UO4A 1TQPA 2BFYA 3T9IA 4CEGA 3VO3A 5FEQA 2B4SB 4BYIA 3FPMA 4U44A 4XG4A 4FEVA 3TUCA 3SX9A 4ZSJA 4IIJF 4AACA 4BCFA 3MYGA 3MFSA 2XBAA 4KS8A 4J99A 4EZ5A 3PTGA 4FC0A 4QMVA 5KHXA 2ITOA 5IQHA 4KRDA 4X6RA 1ND4A 2IJMA 1WBSA 3E62A 2OICA 4S30A 2YDKA 2Y4PA 5D9HA 1NVRA 2VO0A 3PPJA 5H8BA 3MA6A 4EOIA 4XOZA 1UWJA 4ENXA 5AA8A 2HWPA 3FMHA 2A4LA 4FTAA 4PMSA 1P5EA 2BKKA 4FNYA 4QTCA 1OPKA 4EG0A 1BI8A 3HKOA 4DTAA 3ORZA 1U4DA 3D94A 3SLSA 4R5YA 4Y95A 4ACHA 4NKSA 4OT6A 2QOKA 3CY3A 3F5XA 3HDMA 5JQWA 5HLNA 4MNEB 3PY0A 5CVFA 2PYWA 2W17A 4FV5A 3LMIA 4MD8E 2FPIB 3MB6A 3NRMA 1TQIA 1G8AA 4GCJA 4ARKA 5B2MA 4WT6A 2YWPA 3OROA 5T6KA 2PE1A 3EL8A 3P7BA 3WZKA 4C59A 5L6PA 3ZONA 1OL5A 2JIUA 4B0GA 4DH8A 4S32A 4HGLA 5HU9A 4MV3A 5CEMA 1H8FA 3H30A 4M7IA 5AAEA 4G3DA 3C4EA 3LWBA 2YCFA 2Q0BA 3ATTA 3PRIA 1S9JA 4GH2A 4UWCA 4QP1A 1O6LA 4C0TA 4YZNA 4TYHA 5IG1A 1KJ9A 3DCVA 4WIHA 4YHTA 3TDWA 2HAKA 5IUHA 4FT0A 2NPQA 3BELA 3QQGA 4ACDA 4UN0C 5EW8A 4QQTA 4MXZA 2VWUA 3DXNA 5C8NA 1GIHA 4U45A 3NR9A 4AU8A 1VYZA 3QQKA 3KULB 5D7VA 3OUZA 1U59A 2ETRA 1YI3A 4XJ0A 4WUNA 2JIIA 3MY0A 3OFMA 3RMFA 4AFEA 1OIQA 3EN9A 3U87A 3VNTA 4E73A 3SXRA 4RWJA 4JOAA 4XBRA 3DTWA 1Z2OX 1XH6A 2WTKC 2ITNA 4YSJA 3BQCA 3SXFA 1AGWA 2HJWA 2ZOQA 3TKUA 2IW6A 1REKA 4FV0A 4OR5A 4BZOA 3T3UA 2ZDHA 1R39A 4FGBA 4YBJA 1STCE 3S95A 3MSSA 5EOLA 3TACA 2BAQA 2PZIA 2UZLA 3R00A 3TKHA 4O0VA 3F69A 3GBZA 5AM7A 5AP7A 4UV0A 2VWIA 3I6UA 4HNIA 3FLSA 4AGDA 1M2QA 5DVRA 2C3IB 3DPKA 4FYOA 5KE0A 5HNBA 3SXSA 4M84A 4I6QA 1WAKA 4K6ZA 4NH1A 4W8EA 5HIEA 3WO1A 2GLTA 1URCA 2HZIA 2YN8A 3R23A 4HPTE 5HO7A 2ETMA 4YJRA 4MVFA 1B39A 2W1CA 2E2BA 4FA2A 4IB0A 4BDEA 4O38A 3GU5A 4L46A 5CT0A 3I60A 1F3MC 3M1SA 3PA5A 4BCKA 3K3IA 3ORXA 4IC8A 5A3XA 3GCVA 3TZ9A 4AE6A 3L9NA 4FEXA 3SRVB 4EGQA 2Y7JA 2O3PA 4UALA 2P0CA 2OJFE 5BUIA 3FAAA 2QOHA 4RIXB 3EYHA 4PL5A 4F0GA 4LOOA 4ZTNA 3ODZX 4DH5A 3NUUA 4GJ2A 2QU5A 3MPAA 1EUCB 4BDJA 2VTRA 3UDBA 3PXKA 2IPXA 3GUBA 2EXMA 5FXQA 1PXPA 4FU0A 1JSVA 4NM0A 2OIQA 2PWLA 3NYOA 5JFSA 3OCTA 3AMAA 3OMVA 2JDOA 4X21A 5H8EA 3UP2A 4G5JA 1UU8A 4EC9A 5JQGF 4X2FA 4IFGA 3TIIA 2W7XA 2QKRA 3HGKA 3PFQA 2QO9A 3CPCA 4PDOA 1OKZA 3C1XA 2ONLA 2BMCA 1PK8A 3V51A 3QRKA 3KC3A 4ZJJA 3FQSA 4FT3A 3TTJA 4NFMA 1I7LA 2P55A 3SV0A 2G15A 2VTSA 2J7TA 3EFKA 4E1ZA 4GG5A 2GTMA 1XHAA 4ZSAA 1IG1A 3OC1A 4XV9A 3C4FA 4YZMA 4D4RA 5KNJA 4FFOA 3OBJA 4UYAA 4UXQA 5HBRB 1BUHA 5JRQA 5CALA 2YA9A 5LMBA 1YHVA 4FTNA 5EG3A 2YAAA 1XBCA 4BN1A 5M51A 4CMUA 1V0BA 3GVUA 1JSTA 3W8QA 4KBCA 2JBOA 4IB5A 4NIFB 4YLJA 3LMHA 5DHJA 4MTAA 4WNKA 3A60A 3MA3A 4L53A 1KSWA 2A0CX 4UXLA 4AQCA 3O71A 4CLIA 3R02A 4RLLA 2J4ZA 4E4NA 3JYAA 3ZOSA 4CD0A 3H10A 4FZAB 4ZZOA 4OUCA 2GNJA 2HYYA 4KRCA 3R5XA 5BYZA 3UTOA 4F1OA 4QQ5A 4O7VA 5FDPA 5LMKA 4QQCA 4WNPA 5F9EA 1XH8A 2PMOX 1FINA 2J51A 2QO2A 5AMNA 3CC6A 3Q9ZA 4ME6A 2XJ2A 4AT4A 1R78A 3HMOA 3LXLA 2AYPA 3ORMA 2UZBA 4M9UA 3QC9A 3FKOA 3G6GA 5AV1A 5CB4F 1WFCA 2Y4IB 4NCTC 2E9VA 3HV6A 4YU2A 2HZ4A 4BCOA 4FT5A 3K5VA 3ZLSA 4E93A 4C4HA 2JLDA 3P78A 3MY1A 4EOOA 5LWNA 1Q8YA 3ORPA 2A27A 3RCDA 2WTJA 3NWWA 2ZM4A 4RIOA 5LOHA 2PBZA 1Q97A 2YZGA 3I0QA 3MPTA 2BR1A 5J9LA 2R64A 3LAUA 4FFNA 4MA5A 4YC3A 4ZS4A 3R8MA 3FSKA 2OZAA 3ZEPA 5F4NA 5BPYA 4XV3A 3C0IA 3QRJA 5DI1A 4A07A 4DFNA 1ZY4A 2DWCA 3UQFA 3KB7A 2ZJWA 5H2UA 5HCXA 4XZ3B 3K54A 3QHWA 4BDAA 3K5IA 5L3AA 1XR1A 3QCYA 4AW2A 3KKVA 3QXOA 3V6RA 1M0WA 5D7AA 5KMLA 1DV1A 2FB9A 4L3JA 4FTJA 5GINE 2W9ZB 4DFYA 5EQYA 4APCA 1TVOA 2CGVA 4WRGA 4U3YA 3RK7A 1Q62A 1IEPA 4IAFA 3AT4A 3ORIA 4OGRA 5BVDA 1GSAA 3BLRA 5ANJA 2WMWA 4K2RA 3LFAA 5E8UA 4TYGA 3FXXA 3LMGA 2PUIA 2XK4A 4K9YA 5CEIA 1SZMA 5DGZA 1BLXA 3FLYA 2FSLX 3EQGA 5IQIA 3LJ1A 2OF4A 1W8CA 4MV6A 2OK1A 5DRDA 3FZSA 4G1WA 2RG5A 2ZDGA 3R30A 1APME 3ORNA 4TW9A 3VS6A 4AW1A 3R73A 3VIDA 3QWJA 3FI4A 5ETCA 3V5QA 3VS2A 3WO0A 2HY81 4ONAA 3DKCA 3TEIA 3TIGA 2X2KA 5IH5A 4BTKA 1H28A 1CSNA 2J50A 5GJFA 3EOCA 4PTCA 3QKMA 1EZ1A 3R21A 4BBFA 4HNVA 2YZLA 1YW2A 5CAQA 2XEZA 3O8TA 3PJCA 1EH4A 4LUEA 3FDNA 2FPGB 2A1AB 3BX5A 1PMVA 2WFYA 5CSPA 5E8TA 3WF7A 1ERKA 4FEQA 3HBLA 1OPJA 3G8CA 4DEBA 4FVRA 4OBOA 4JBPA 3RM6A 3ROYA 4HVSA 4R1VA 2VO7A 4ZY5A 3GLKA 2UZWE 3QD0A 2CN5A 4JBOA 3DV3A 4JQ7A 2Z7QA 4BI2A 3TNIA 4MXOA 2IZRA 3A62A 5JGAA 4J71A 2W6OA 2VNYA 3PZEA 1H0WA 4IDTA 4JDIA 2WELA 4YURA 2NUAB 2YISA 2W6ZA 2ITYA 1Y6BA 3KXHA 3UFXB 4AUAA 4IZ5A 3DLZA 3GCPA 3LCKA 3QTQA 3RPSA 4A9TA 5DPVA 2Z02A 2PULA 1UA2A 3NNVA 4FG8A 4WSYA 1F0QA 5JVLA 5CU3A 4EEVA 4ZTLA 2CNQA 4IVDA 4K18A 2DS1A 4LL0A 1NT2A 2QG7A 3D5XA 3G33A 3QZFA 4DH3A 5IH4A 2GDOA 2PTKA 4BDDA 3N9XA 4ASEA 4CGAA 4DFZE 4MNEA 4AAAA 4A9UA 4IE9A 3FZ1A 2BDWA 4QYYA 2GPHA 2QOQA 4G9RA 4EH9A 2XCLA 2VWWA 1ATPE 4O83A 3EN6A 5AADA 3OWKA 2QOFA 3P86A 2G2IA 4P2KA 3HNGA 2SRCA 1M52A 3O2MA 4Y8DA 5DT3A 5ACBC 4DEEA 4F1MA 3C0HA 4BI1A 3V5WA 1PW2A 3R1NA 5EM5A 1DV2A 4Y72A 3VUKA 5BUJA 5DN3A 3IGGA 4W4WA 2WZJA 5EI6A 5EI8A 2VWVA 3OTVA 2Q0NA 2R0UA 4DA5A 3BWJA 1PXKA 2C4GA 3LZBA 3JR1A 2YM3A 3QBNA 1NXKA 4D1XA 3NW6A 3N8DA 4C4FA 4ZAUA 3KRJA 3LFEA 3RTPA 3R5HA 3UGCA 4FOBA 4FTUA 3GOPA 4IX6A 1VR2A 4YO6A 5J87A 4LI5A 2CCHA 2X81A 4G3CA 1IAHA 2ZV7A 4ALUA 3KULA 1WZYA 2C3LA 3ROCA 2W1GA 1UKIA 4AG8A 3OUUA 1LPUA 2YIWA 4QTEA 2WQEA 5CX9A 4BRXA 3W2PA 4M13A 5IQGA 1YHWA 1L8TA 2GSFA 2W5AA 3R9DA 4DCEA 3AC8A 3Q04A 2WAJA 4MNFA 4Y46A 4YJTA 4EH8A 2XZSA 1H00A 2NP8A 2WU6A 3ACKA 2ZB1A 4UB7A 3CXWA 5FP5A 3ZRLA 2ITWA 2OLCA 1R0PA 4ZY6A 2VV9A 2QHMA 2J9GA 1WBPA 2WMAA 3ALNA 4XG3A 5EQEA 1Q3DA 1W0XC 3U9NA 2P2IA 4FKGA 4DAWA 5DLSA 4EZ3A 3D5WA 2W4OA 2ZDUA 3CQEA 1SNXA 4WG4A 4YPDA 5CZHA 5JZNA 2BRHA 5CSHA 5HX6A 3DJ5A 3WILA 2B9IA 3EQDA 3ZM9A 2F57A 1Z5MA 2I7QA 4FZ7A 3DAKA 4LYNA 3AD4A 5HO8A 2W6PA 2WTIA 3FI8A 3PPZA 4U80A 1JAMA 3DA6A 1P4FA 4AGWA 4MV9A 4X3JA 1LEZA 3R1QA 4RX8A 2ZM1A 3A4OX 3C0GA 4O0RA 4GUBA 2BILB 5FTQA 4BI0A 4KKHA 2YJSA 4RA5A 4AN9A 3D0EA 3MN3A 3LCTA 3DB8A 3A2CA 4UZDA 3SRVA 2P0AA 4FK6A 3O0GA 3QU0A 2BIKB 5GJGA 3NLBA 3KFAA 3IDCA 4AZEA 1K3AA 2BDJA 1OKWA 3GU7A 4O2ZA 4RJ3A 4RWKA 3FY0A 3TDVA 4AX8A 2YRXA 1J7UA 2PVYA 2Y6OA 3ORKA 4M15A 4ASZA 2W05A 4BBMA 4TRLA 1AUVA 3O50A 3PLSA 2X9FA 1U5QA 3E87A 4DFLA 3DDQA 2VN9A 3R28A 3QUDA 5AWMA 3NPCA 5C9CA 3SOCA 3U55A 5K3YA 4RIYA 2UZEA 3UNJA 3ZUVA 5M4IA 5J2TF 5CA0F 4GU6A 2ZV9A 4G5PA 1JVPP 1MP8A 3V8SA 5K5NA 1H1WA 3FPQA 1B38A 3ZDIA 5I9VA 4YR8A 2XK9A 3R7IA 3C50A 3GFWA 4O7NA 1KE9A 4XS2A 5L2TA 3BIZA 4FIEA 3P79A 4HCTA 3LLAA 4IX4A 4E6DA 2YCQA 4APPA 2DUVA 2VWBA 2OW3A 2ESMA 2UZDA 4FGRA 3C4ZA 2ETKA 5FP6A 3UC3A 3IECA 2VTOA 4YBZB 4IB1A 4NK9A 4UEUA 4LFIA 1H4LA 4QMMA 4B4LA 2I0VA 4HGSA 1DIKA 4QSHA 4RMZA 4DTBA 2R0IA 3BYOA 4QNAA 5IMEA 5EI2A 4FR4A 5AAGA 3S2PA 3F82A 2Y9QA 4J97A 4LGGA 4CT1A 4NTSA 5EDRA 1PXNA 4E4TA 5HTCA 1NVQA 3EL7A 5BYYA 5CAUA 5TO8A 5IPJA 2J6MA 3ET7A 2YM6A 3I81A 4FICA 3ZZWA 4I5MA 3QFFA 2PVNA 1BNCA 2X8EA 3DT1A 4IB3A 2HGSA 5CF5A 2PL0A 2ZDQA 1J7LA 1YXSA 5M55A 4EL9A 4BGGA 2E9UA 4RVLA 5A9UA 4CCBA 3I6WA 4JG7A 4YJPA 1ZYCA 3QYWA 3L9LA 2BCJA 4II5A 5GHVA 3U4WA 3G90X 3M42A 4ZK5A 5IDPA 4RVTA 4L9IA 1QPDA 3K5HA 2YERA 3S1HA 2QOLA 5LXTF 5JVDF 5IH6A 4BTJA 5HU3A 4S33A 3JPVA 1WBOA 4I6BA 4AGUA 4D1ZA 5EW3A 3F3UA 3EQBA 2VUWA 2EXCX 3GCUA 1H1RA 3TW6A 1JKKA 3GEQA 5AP1A 3RCJA 1JKLA 4CG9A 2IVVA 2GS7A 4BTFA 2LAVA 2XVDA 4G2FA 5EYKA 2QLQA 5CU6A 3GQLA 5EFQA 3SW7A 2YITA 5IDNA 1GGOA 3ZYAA 1KV2A 4O0XA 4BDBA 3DDPA 2XK8A 3IW4A 3BHHA 5B0XA 5JQ8A 4C58A 5HI2A 4EBVA 3CGOA 3VPCA 4GEOA 4DGOA 2IWIA 1SCUB 3TZ8A 4C34A 3LIJA 3C7QA 2YEXA 1ZY5A 5J1VA 2BTSA 2HZNA 4EJ7A 4MV8A 2IVSA 3WYXA 2PPQA 2C5OA 2VTIA 4FV8A 2VTJA 3DNEA 3Q9WA 3R1YA 4RG0A 4F9BA 4YPSA 1F5QA 4TY1A 5F95A 3ZUUA 2OJGA 3OUKA 3FHRA 5LXMA 4V0GB 4YJVA 2O65A 4WUAA 4FV6A 2PVKA 5JGBA 2X2MA 3UIXA 4Y73A 1GZOA 5E7RA 3KN5A 3OXIA 4E6QA 3GP0A 2FVDA 3UPZA 3W33A 4DIMA 3UO6A 1W96A 3BEGA 3ALOA 3KXZA 3LQ8A 2C5XA 3VS7A 2XRUA 4NJDA 4EONA 4QMNA 5IF1A 4DH7A 3PPKA 1YVJA 4C62A 2H96A 3POOA 3TJCA 4O0YA 4YZDA 4AP7A 4FNZA 4FSYA 3QGWA 4KAOA 1JLLB 4I50F 1DM2A 4F08A 4M0YA 3FMNA 3NGAA 3O7LB 4IZAA 2WGJA 5CQUA 1OITA 4MCVA 3ZRMA 4H3QA 4AGCA 2C1BA 3FLWA 3HP2A 3F3ZA 3OW3A 2HW7A 5HICA 3GC8A 2DZDA 2YS6A 3MWUA 5FRIA 3V8TA 5G6VA 4OTWA 5M4FA 2BAJA 2WMTA 4Z16A 3OD6X 4DEAA 1E1XA 2YL2A 2I87A 3R7YA 3O8UA 2YZNA 4EK8A 2J0KA 3TL8A 2Z7RA 3SAYA 4BY9E 5LOVF 4FNXA 3P5KA 3AMYA 3MJ1A 3VUGA 4C4JA 4A9RA 5IQBA 4YTIA 5AJQA 5HLPA 2AC3A 1R3CA 1FMOE 4NWMA 3O23A 3VW8A 1UKHA 2YM5A 3QUPA 4HNFA 5AP5A 3WBLA 3LCSA 4GL9A 3GT8A 4XRJA 4FSRA 3G15A 2I0YA 2OZAB 1YWVA 4S2ZA 1W98A 4TNBA 4NFNA 3Q4TA 2C6OA 2YYAA 4R77A 2XIZA 2WMQA 1KE7A 2WQNA 5J9YA 4NM5A 4G31A 3A7HA 2BTRA 3VQUA 2JGZA 2O63A 5J5SA 4C5BA 1NW1A 2W6MA 4QQJA 3SKCA 3H9RA 3H3CA 4FKIA 5AAFA 4QP9A 2BZKB 3NAYA 4TT7A 4F65A 3PWYA 2OFUA 2IZTA 1UV5A 3ZLXA 5C4KA 4L01A 2QC6A 4JX7A 3N4UA 3JRXA 5HG9A 1WBNA 5HNIX 2JC6A 3QD3A 3ZO2A 5LVOA 3JRWA 4FIGA 2C3KA 4OTGA 3MWEA 4XLVA 4JL9A 2BRNA 1T36A 3BHYA 3P4KA 2GPWA 4R6VA 1O6YA 4C02A 4YP8A 5CEKA 4FT9A 1PMEA 1ZARA 5AIKA 1FMKA 4HZRA 3SE7A 4FTKA 5LWMA 4AA5A 3IW7A 4O0WA 2VR1A 4YZCA 5L2SA 1FVRA 5LVMA 2UZOA 2GU8A 3SG8A 3NMUF 4FSUA 2IVUA 3B2WA 3EQIA 4KSPA 4V05A 1Z57A 5M06A 4BCMA 4OTRA 3PG1A 2C5YA 2XKCA 5TR6A 5DT0A 1VJYA 3RFCA 1CMKE 2CDZA 3MI9A 4LRKA 3AD5A 4H1MA 3C51A 5EYMA 5M07A 2W70A 3EJ1A 3EMGA 5BVKA 5AM6A 4CCUA 2RIOA 1LUFA 2PMNX 2EVAA 4QRCA 2X8IA 3T3VA 2R4BA 4D5HA 5IQCA 5IMXA 3CJFA 4HJOA 3GU4A 5AUWA 3NNUA 5I9UA 5ANKA 4X3FC 2WMXA 3G6HA 5CY3A 4ZTSA 4A4XA 5LJJA 4MV4A 4RFZA 4XUFA 2W6QA 1ZMVA 4JBVA 4N57A 2BRGA 3FMEA 4R3PA 5BYLA 3V5LA 4GUEA 2UV2A 4CNHA 2X6EA 4YC6A 4WNMA 4F6UA 1RDQE 1WR2A 3NYVA 3EFJA 1I09A 2V7AA 3A8XA 3I7CA 1T46A 4ZSGA 4ZEGA 2F7ZE 4FK3A 2VAGA 3OT3A 2QR7A 3QCQA 4FKJA 2OXXA 3PJ8A 4HOKA 3R04A 3KF4A 3DBQA 4J95A 4RLKA 4AE9A 4I94A 1OIRA 3R5FA 5CASA 4IQ6A 3TQTA 2UW3A 2ZM3A 1ZMUA 2RL5A 3L9MA 3QX2A 4GYGA 2J5EA 4EH4A 4JI9A 5BVNA 2XKFA 3MB7A 3F7ZA 4XBUA 2NNWB 4XV1A 4B8MA 3RVGA 1YHSA 4Q5HA 2SCUB 5C1PA 5FDXA 2JDTA 2VTTA 4BGQA 2YM8A 4GT3A 1XBAA 5FTOA 1YWRA 3F66A 4PDYA 4O7SA 4S34A 3UBDA 3HYHA 3KRWA 3UC4A 3ITZA 1OB3A 3OUNB 4A4LA 3Q3BA 4CXAA 4O81A 3CKXA 5IU2A 1E4EA 2XIXA 3LHJA 3BGQA 3R01A 4RWIA 4ZY4A 3UO5A 3OVVA 4MXAA 3W2OA 3KXNA 5HBJA 4R7BA 5HV6A 2Z2WA 4UWYA 1YXTA 3D83A 3ZO1A 1K2PA 5HGIA 5C8YF 5CNOA 5AV2A 1YOMA 4IACA 4IMYA 1Q41A 2HIWA 2F9GA 3BE2A 3DKOA 3NAXA 4FSZA 4NL0A 2HWOA 3DTCA 3LXPA 4XNEA 5B2KA 4YTFA 2Q83A 5IUIA 4EBWA 3D5UA 4FYNA 3LW0A 3VQHA 5J8IA 4WNOA 2R7MA 3FL5A 4I20A 3PG3A 4L3PA 4I22A 5C1OA 2GPSA 1K9AA 1KUTA 4G6OA 2V5QA 4O22A 3G9NA 2VTMA 3IO7A 3E5AA 1BL7A 1LP4A 3SW4A 4K33A 4L00A 3DAJA 1OIUA 4O6EA 3P7AA 4IHJF 1A9UA 2XP2A 4C61A 1KJ8A 4AFJA 4F7JA 1CQJB 1VBHA 5IEVA 4F6SA 4PL3A 3KL8A 4JJRA 5EDQA 3QF9A 3BQRA 3H0YA 4QMZA 4ANSA 4GIIA 4D9UA 3AC3A 3BV2A 3BBTB 3KXXA 3DGKA 5JN2A 4M97A 3MW1A 2IZSA 3RHKA 3PXFA 5CU0A 4DBXA 4ZMEA 3KRLA 4FTIA 4IAZA 4CLJA 2ZMDA 5CI6A 4L7SA 2PZYA 3HAMA 4C4IA 4HQ6A 3WF9A 2XA4A 4MX9A 4EKKA 2XNOA 3U4UA 3F2NA 3BYMA 4B9DA 3PXZA 5KBQA 2O8YA 1WBTA 4ZSLA 3ZXTA 4L1KA 3IW8A 2OG8A 5KZ0A 2I1MA 3OEFX 1BX6A 1REJA 3ZDUA 3OCGA 5JH6A 1Q5KA 5HIBA 2C6MA 1G5SA 2UUEA 3U9TA 3IW6A 3SQQA 3CY2A 1UU9A 4H36A 3F5UA 5M44A 4W4XA 3NUNA 4D4SA 4MBIA 4YJNA 4WBBB 4Z3VA 2WPAA 3COIA 3PVUA 4JXFA 5B7VA 3VUHA 5DYJA 4TV8F 3OBGA 3HX4A 3BLHA 5CVHA 3BPRA 2X39A 4PP9A 4QMWA 4RFYA 4YHJA 3VOTA 2WTKB 4RIYB 3Q2MA 4YNEA 4GFMA 4NU1A 2CGUA 4IVAA 3LLTA 3DXPA 1CQIB 2EUFB 3V5PA 3ZEWA 2E9OA 2Y8OA 4OBPA 3CQUA 4GSBA 4USDA 2PVFA 5HE3A 3V3VA 4D5KA 3KAKA 2C00A 2CJMA 2PVRA 3DBFA 2W6NA 2RG6A 4YB8B 4JVGA 4HVIA 2PMIA 4YBKA 4LMUA 1OUYA 2HW6A 2XK3A 1UU7A 4O91A 4P5ZA 4FTQA 4FZ6A 4O7WA 4U42A 4TL0A 4E6CA 4A4OA 4RVMA 3KXMA 3UG2A 3Q60A 5A14A 3B8RA 5JRSA 4V0GA 3QWKA 3RNIA 3Q5ZA 3NW5A 1PXJA 4FKUA 3OG7A 4IBMA 5JT2A 5I0BA 4ZMFA 3QD2B 2XS0A 4J98A 3W2SA 5KX8A 2FYSA 4HNUA 3R7UA 1P2AA 5KMOA 3VJOA 4A9YA 4M69B 4F1TA 5BVFA 4FG7A 4FTTA 5A4LA 4ORKA 2J0MB 4FSTA 4OTFA 2ERKA 1PXIA 2BIYA 2QHNA 4RQKA 3Q6WA 4EK5A 3EQCA 4FV3A 4QPAA 3UNZA 4ANLA 3UOLA 2R3IA 1TKIA 4FKOA 4RJ6A 3W10A 4BR3A 4AOIA 4HZSA 4H3BA 2GHMA 4PP7A 4U41A 4OLIA 4BTMA 4MD7E 2WHBA 3HB9A 3IDPA 3GENA 4JDKA 5CA1F 2VRXA 5FXRA 4RZWA 3PIYA 3U54A 3ID6C 3HRCA 4X2JA 3UODA 4AN2A 4BZDA 3BRBA 5JEBA 2XIRA 5E8XA 3QTRA 4ZLZA 3MH3A 3DU8A 2OKRA 1MRUA 1NA7A 2C6EA 2FB8A 3AGLA 3WZJA 4BF2A 3GIDA 1JLUE 4BGHA 4WG5A 4BCJA 4O2AF 2JITA 3HAVA 1I44A 4FKQA 4OW8A 1H1SA 5A4TA 3OXZA 2LGCA 3OTUA 4PRJA 5JFVA 4PX6A 5FD2A 4FKWA 4EC8A 5BUEA 4CKRA 4IJPA 3EN5A 4ZQIA 3KALA 5ICPA 1CKIA 3WIGA 2O0UA 5A46A 1DI9A 2R3OA 3UIUA 5AX3A 1PXMA 3QL8A 2UW5A 1CDKA 4IAKA 1V0PA 4V04A 4PL4A 4ANMA 4BDCA 2QG5A 3QHRA 3HV3A 2ITXA 3CIKA 2WIHA 3R63A 4LV5A 4NZWB 4WBOA 4XG6A 4ALWA 5GONF 5FM3A 5HBEA 1IOVA 2OF2A 1FBNA 4FIJA 5HVJA 1XJDA 2R3NA 3E8NA 3LQ3A 4U79A 4G16A 3WE4A 3QLFA 4DG2E 4HVHA 2XRWA 3ANRA 2GNLA 2VNWA 4LRMA 3RAHA 3LFQA 3MGYA 2CPKE 3LFNA 5AUYA 4QP6A 4AOTA 3HP5A 2WXVA 2PVPA 3PSCA 4XYLB 3TINA 2V7OA 3O7LD 3I5ZA 2W1FA 3P23A 2W1DA 2B53A 4JDJA 3U8WA 4QTAA 4FV7A 1ULZA 2CNUA 4RX7A 3RK5A 4KABA 4NUSA 4E5WA 4IW0A 2JEDA 1OGUA 3Q2JA 4GJ3A 2E9NA 4I0TA 4D58A 2X0SA 4F0IA 3AX6A 4DG0E 3V8WA 4O4JF 3SD0A 5IISA 4XG8A 5C8KA 5KUPA 1AD5A 4BKJA 2VX3A 2VGPA 3PJ1A 5JQ5A 3NS9A 4RZQA 2EWAA 4IM2A 2C0OA 2XIKA 3SA0A 1JKJB 4X6QC 4NW5A 3SC1A 1YDRE 1Q61A 2O2UA 2V59A 3LFDA 1GIIA 3QQUA 2XH5A 4QMQA 2YIYA 4NSTA 2W5HA 3A99A 3COHA 5CU2A 5AV3A 3R8LA 3S3IA 4MHAA 4CTBA 4PDPA 2R7NA 4ALVA 4BDHA 4MAMA 3ZLYA 2J9MA 1Z9XA 1YXVA 2WTCA 3ZSIA 3DBEA 2ITTA 3QALE 4TWPA 3OWPA 4I6FA 4AW5A 5AUUA 2OIBA 5DE2A 5HG8A 3QTSA 1SVEA 4AWIA 5B2LA 5AA9A 4MYGA 1M6VA 5BMVF 4L68A 1RE8A 4FBXA 1XWSA 2FGIA 5JFWA 3EQHA 3WOWA 4YO4A 5GNKA 3HV4A 4LOPA 5D1JA 5CXHA 3E7OA 3LOKA 4OT5A 4R7IA 4E6AA 1HCKA 3IOKA 4RWLA 2C6TA 2WOUA 3MH2A 5K5XA 1QPJA 4I21A 3QYZA 3HUCA 3ANQA 3BWFA 4D28A 2BZJA 5TF9A 3A61A 3EQRA 4AA4A 4YUQA 4I5HA 2Z7SA 2JAMA 4FV9A 1R1WA 5FM2A 4FKPA 5CF8A 3MY5A 3ORTA 2W06A 3TJDA 5CT7A 3KMUA 2VQDA 3QKKA 4TYEA 5KKRC 4FL1A 5KCVA 2YCRA 4EYMA 2WMUA 3KMWA 3MTLA 2UVYA 3AXWA 3VMMA 4CRLA 1IR3A 1Q8ZA 2ZMCA 3OW4A 1JKTA 4IHPA 4O0UA 2X4ZA 3OCBA 1Z2NX 4ZJVA 3E63A 1SVGA 3P9JA 3DBDA 4FKLA 1VEBA 3IQ7A 3ODYX 4MXCA 4KUJA 2JKOA 3CLYA 1B6RA 2JDRA 4QP2A 1GZKA 4AZFA 2OIDA 3UZPA 5EZYF 2B9JA 3C4XA 4GRBA 5FEDA 4OBQA 5BQ0A 5CAPA 4DITA 5KBRA 4K1BA 3P0MA 4QMPA 4IANA 4XH6A 5BPHA 2B0QA 2DYLA 3LFSA 4GFGA 3WYYA 4C2VA 3WF6A 3PVWA 5DR9A 2PE2A 3FUPA 1JDBB 2EB3A 1GY3A 3T8OA 5C4LA 3ZFXA 3Q1KA 3VVHA 3D5VA 4GS6A 3ETAA 2VO6A 4QTBA 2C47A 3E93A 3LFCA 4UZHA 1OIYA 4WD5A 5AFVA 5T68A 3ZH8A 3DKFA 5E1EA 4GKHA 2V5AA 2XJ0A 3DOGA 4DE4A 2R9SA 2XEYA 3B2TA 4I4TF 4OTDA 3UOJA 5D12A 3KA0A 2IW8A 3S4QA 3VF9A 2YIXA 2VX0A 3QZIA 2IN6A 4EHGA 3D15A 1GAGA 5C26A 3TCPA 4EK6A 3ZMMA 4ZI7F 3NYXA 2XJ1A 2CHLA 3GQIA 4F63A 5K4IA 3PA4A 3QFVA 4FV1A 5DR2A 5F1ZA 4H58A 3NCGA 2JDVA 3OHTA 2VTLA 5C1QB 3PSBA 1JWHA 3Q53A 3CD8A 4EH3A 3N6RA 1MRYA 2GNGA 3F3TA 4N70A 4AF3A 5EDPA 4IC7A 4Y5HA 3R71A 4HNTA 4AXAA 1P14A 3D9VA 3OOGA 4YLLA 4EOJA 1V1KA 3JY9A 4CG8A 4KD1A 4QMTA 3GXLA 1PYXA 3W18A 3NEWA 3F2RA 3GI3A 1KJQA 4YNOA 3RKBA 3W32A 2B55A 1H1PA 3IG7A 3LVPA 3TNWA 5IQDA 4P7EA 2I8CA 1PF8A 4L44A 3VS0A 4JNWA 4HVGA 3F9NA 4EZ7A 4J96A 3QZGA 2B54A 3TIYA 3GFEA 5EW9A 4YLKA 2OJIA 3BBWA 1E4EB 1M0TA 2I0HA 4E5AX 1NY3A 3RP9A 3EIDA 4HYUA 3RGFA 4HVDA 4IM3A 5CAVA 3V4ZA 3ORRA 3G5DA 3NNWA 4DG3E 2J0LA 3N4TA 2R7KA 1JOWB 1NVSA 1YXUA 4O7LA 5A4QA 2JFLA 3CTQA 4I6HA 3PE1A 4NW6A 4LL5A 3FI2A 5M53A 3O96A 4L42A 4X2KA 3WIKA 4FSQA 2VTQA 3O8PA 2X9EA 4C3RA 3E64A 4ERWA 3SHEA 1TQMA 2GFCA 3F7WA 2XNNA 1H26A 5ETAA 3PRFA 1W83A 5EOBA 1BL6A 1VKZA 3KEXA 1PJKA 4I93A 2YRWA 4OTQA 4O7YA 2I40A 1AUXA 1U54B 4TWOA 3VA7A 2X7FA 5I9XA 2ITZA 5D8DA 3VS5A 3OY1A 2CMWA 3R8UA 1SYKA 2PZPA 3CTJA 4C4EA 3JZFA 3MVHA 3TZ7A 2GHLA 5JFXA 3GCSA 3V5TA 4O84A 1GSOA 1KJJA 2PVHA 3RHXA 3FYKX 4JX3A 5FLFA 4F4PA 5L8JA 5CU4A 5DEWA 2VU3A 4A7CA 4U3ZA 2FA2A 3R9NA 3B8QA 4RSSA 3P08A 4LMNA 3V04A 4ZTMA 4JRNA 2QD9A 5DA3A 2NRUA 2YCSA 1SMHA 3MFTA 2GTNA 4BYJA 3A4PA 4EUTA 2UW4A 5ETIA 4M14A 1OBDA 1YI4A 3NNXA 4L6QA 4EYJA 4M8TA 3FKNA 4I0RA 2WTVA 4FTOA 3TNPC 1QL6A 2DLNA 4FTCA 3BKBA 3DZQA 3TV7A 4C37A 3QC4A 2JDSA 4E20A 4GYIA 4U43A 5EKNA 2ONLC 4IWQA 2REIA 4DGMA 4R1YA 5E4HA 2X7OA 3AT2A 3UOKA 5BMMA 4L67A 4M68A 5H8GA 3R22A 5CLPA 2HXLA 3OCSA 5EHLA 2BALA 4IAAA 4U6RA 4IVBA 1BKXA 4J8MA 4O6LA 4BC6A 1OZ1A 4BHZA 1ZYDA 3BU6A 2FUMA 3WF5A 2UZUE 4R7HA 4L7FA 4TN6A 2QVSE 3D14A 4D0WA 2CKEA 3C4CA 3QA0A 2X7GA 3UVQA 4IX3A 3DF7A 3MWDA 4IDVA 3EB0A 3VRYA 4CTCA 4YJQA 1KE6A 2YDJA 3FV8A 3PY3A 4EWHA 5KMNA 1H25A 3LPBA 2BVAA 4B6LA 4GW8A 2P33A 1KBLA 3SDJA 3KRXA 4WRSA 5HBHA 5HX8A 2GQSA 2ACXA 4IX5A 3CQWA 2Y6MA 4OTIA 3UVRA 2R3JA 3PLAE 1R0EA 1C3OA 5E91A 1BI7A 5AEPA 4DC2A 4Y83A 1PYEA 3L9PA 4TKSA 5CNNA 3Q4ZA 3UG1A 2R3QA 1W84A 4CFXA 5CI7A 3GC7A 5LMKC 2BRMA 4FNWA 5FQDC 1FGKA 2BFXA 4QYGA 2G2HA 2OH4A 3DZOA 2GNFA 3NUXA 4L52A 4N0SA 4RBLA 5F94A 3F6XA 2KULA 5LYJF 4WBNF 5EKOA 1M7QA 4BHNA 3DBCA 5LCJA 4QTDA 3LXKA 4FZDB 3C5IA 4IIRA 2I6LA 4KKEA 4FMQA 5FGKA 2C0IA 3TIZA 3CPBA 5KKNB 2G9XA 3ZM4A 3BU3A 5IQFA 3GNIB 1WBWA 4GU9A 1KV1A 2VTHA 3D4QA 2GQGA 3CR0A 3RPYA 4CFWA 2CKPA 2R2PA 3E3BX 2VWXA 1OL7A 3NUPA 3NVMB 4G17A 3WZEA 2HXQA 1XBBA 2YJRA 3FQEA 3KVWA 4JS8A 4QMLA 4RGJA 5BNJA 3ZSHA 3MJFA 4RFMA 3VBTA 5LVLA 3CKWA 5KX5F 4JG6A 3MFRA 3VJNA 3JZIA 2WB8A 4Y5QA 3WI6A 5IA2A 2HENA 2VGOA 4GKIA 4KIPA 3RPOA 3UMXA 3MBLA 4D4YA 1IA8A 3R6XA 3WZUA 2X0GA 2WU7A 2VTAA 2HCKA 2OJ9A 2R7LA 4NCTA 4FT7A 2QURA 2C5NA 3OT8A 3HMMA 3FQHA 5C8MA 2DIKA 3Q96A 3ULIA 3HRFA 1H0VA
chains in the Genus database with same CATH superfamily
4BZNA 4MWHA 4D55A 5K4JA 5BPFA 3QLGA 3LE6A 5AP6A 4PMPA 5IA1A 4R5SA 4BDGA 4IAYA 1YDTE 2PUUA 1ZWSA 4BBEA 4YJUA 4FE2A 2JKKA 4BB4A 3QTUA 3UQ8A 5HEZA 4XX9A 2IZUA 1DAWA 2YDIA 4UY9A 2VPQA 5JKGA 3HV7A 2F4JA 3ZLWA 3CEKA 1X8BA 2P3GX 4D2SA 4YTHA 4BVUA 5HE1A 3IKAA 3FZPA 3VW6A 3E8EA 2W1ZA 2WTWA 3VONA 3T99A 4L45A 2XBJA 2QF7A 1XH4A 4EHZA 2ZYBA 4QMUA 4EQUA 2R82A 3NUYA 3MH0A 4UYNA 3HVCA 5C01A 2PZRA 2GQRA 1Q24A 3UMWA 3CCNA 2R3GA 3ZBFA 4I24A 5EM7A 1HCLA 3BV3A 1ZYLA 1JSUA 1QPCA 5KHWA 4U97A 4EH6A 1CKJA 4F7NA 1HOWA 4AZTA 3S00A 2R3FA 5DRBA 2KTYA 5CS6A 4UCRA 1GNGA 1ZOHA 3PZHA 2ZVAA 5L8LA 2UW6A 3HO8A 3KQ7A 4U81A 2OH0E 3PP1A 3FMJA 2BHEA 3NYNA 1H08A 5L2WA 4MWIA 3D7ZA 5CEOA 4ITJA 4X7QA 1FGIA 5A4CA 4IWDA 4QYFA 3VHEA 3E92A 1W7HA 4DLKA 3EZVA 2JIVA 3COKA 4O27B 3RPRA 3EYGA 3UE4A 3PJ3A 2R3KA 3VS4A 1RJBA 3QGYA 2GS6A 3KK9A 4Z9LA 2UW7A 2XNGA 3FMLA 3QUEA 3UOHA 2R85A 2XMYA 3LKMA 5HZNA 3HMPA 3R83A 2O64A 3V5JA 4F70A 2W96B 1DAYA 3AGMA 3M11A 5I4NA 2BUJA 3BHTA 5ITAA 3I12A 4Z7HA 2R7IA 4U8ZA 3PP0A 3RWQA 3THBA 3MVMA 4E5BA 3FSFA 2NU6B 4ZLOA 5CAEB 1LEWA 4RIWB 5EK7A 3WWIA 5EHYA 3A7JA 2GS2A 2VTPA 3EFLA 4I55F 1JNKA 3BCEA 4FUXA 4QMYA 4K8AA 3Q2OA 1OVEA 2JKQA 4HR7A 1UU3A 4EGJA 5HD4A 5JH7F 1IA9A 4MQ2A 1UNLA 4FTMA 4JT3A 4O7ZA 4O4IF 2R3LA 3JUHA 2EIYA 3UP7A 5CVGA 1MQ4A 3DFCB 3FMDA 4CHIA 4QEBA 1G8SA 4U5JA 4JIKA 4LV8A 1VS0A 3TI1A 2YIQA 3H4JA 5IEXA 4QMXA 4G9CA 1WRVA 1ZRZA 3AD6A 2ITPA 3DJ6A 1MUOA 2XIYA 3FMMA 3QD4A 5F20A 4YTCA 5KS8A 3VUDA 2XCHA 4DGGA 3ORQA 4Y8VB 1VZOA 5BWTA 1XH9A 2YW2A 1SNUA 4FODA 3FZOA 5A6OA 4FKSA 2UW0A 3HRBA 3QTWA 4RA4A 4CQEA 2WKMA 3OY3A 2IP4A 1OUKA 2YHVA 1IASA 4RRVA 3CE3A 4JG8A 4HPUE 3R8ZA 1FVVA 2GHGA 3W1FA 1OL1A 1SVHA 3R8VA 3RAIA 5CF4A 3NDMA 4HGTA 3M2WA 1KWPA 2OWOA 4M12A 3BE9A 2YZAA 3VPDA 2QOCA 4XG2A 4CKIA 4FOCA 3ZC5A 3Q4CA 5DG5A 3ZFMA 4O86A 4CKEA 2B9HA 2WMVA 4Z55A 5KZIA 4MXXA 1KOAA 4FFMA 3OXTA 4J53A 3E5NA 2JKMA 5AP4A 4H3PA 3D2IA 5DR6A 2R87A 2RF9A 2VWYA 4I5CA 5HE2A 3QQLA 4DGNA 2GNIA 5CENA 2AC5A 5HNEA 5H80A 4GG7A 1YKRA 4X3FB 4AZSA 4I4FA 1OL6A 3HECA 4FVQA 5LARA 3VWAA 3VBXA 2W1EA 4ANQA 4C4GA 3FLQA 4DHIB 4MXYA 5FTGA 4ZIMA 5C03A 3EHAA 1L3RE 3NW7A 3CSVA 4FG9A 3W8LA 4DF3A 1Z2PX 4KBAA 4DT9A 3LP8A 5IA4A 4W4YA 5E90A 2F2UA 4DEHA 5CTPA 5IUGA 3VNNA 2ITVA 3Q5IA 3MTFA 4XG9A 3V6SA 5TKDA 3GDEA 4F9YA 5CSWA 4P90A 2R7BA 2PU8A 4JR3A 5T3QA 4V01A 5I9WA 3AG9A 5AP2A 1I1KA 3PUPA 1J3HA 4F6WA 4W4VA 4O4LF 1U54A 3FBVA 5AV0A 1G8KA 2R3PA 3FMKA 4MKCA 2IVTA 3QTIA 3PE2A 3QCSA 3R0TA 4KKGA 5HCZA 2HELA 3AQVA 2W5BA 4X2GA 2PSQA 3IW5A 3NX8A 2R3MA 4RJ7A 1EHIA 4BIDA 1RQQA 1ZOEA 2C0TA 3K2LA 3F2AA 4X2NA 4AZVA 3TZMA 3FY2A 1PX2A 4DLIA 3W2CA 1UWHA 3ERKA 4NJ3A 2ITQA 3KU2A 2V22A 5LCKA 4FFRA 1WBVA 1O9UA 5EH0A 3FE3A 4MBJA 4GFOA 4ID7A 3H0ZA 1QCFA 4O7TA 1Y8YA 2BRBA 3K3PA 5HG7A 5HG5A 4K6NA 4I5PA 3PYYA 3DK7A 3HA8A 4FIHA 4GIHA 4AN3A 2XYUA 3F5PA 4IZ7A 2YZMA 1Q99A 5CQWA 2YM4A 4FI1A 4Y85A 3GGFA 3L8XA 5A4EA 2C5VA 3QKLA 4PMTA 2CLQA 4EI4A 3QQMA 3GB2A 3RUPA 3W2QA 1FQ1B 4FTLA 4Q4DA 2VWZA 4TTHB 4JXUA 2PZ5A 2QOOA 2CKOA 2XF0A 5L8KA 3TUDA 5I5ZA 3F3VA 1DAAA 4TXCA 2W99B 3DB6A 5IEYA 4IZOA 4HYHA 2CN8A 2ODTX 1WVWA 4MK0A 3T54A 4ACCA 4PDSA 1Y91A 3FXZA 1JDEA 3RV4A 3KGAA 3UIBA 2JAVA 2HZ0A 4EOPA 1WVYA 4IWYA 5I9ZA 3DNDA 4PF4A 5EHOA 3FZTA 4I6LA 4LOQA 5GJDA 4F64A 4CMFA 3POZA 4FSWA 5ETFA 2PUPA 5HQ0A 3TY5A 4XG7A 2V62A 2W1HA 3P1AA 5FBNC 1Q8UA 3HA6A 2X2LA 1ZYSA 3VN9A 5CEPA 4CFVA 4CKCA 1URWA 3FYJX 4B8LA 3PIZA 5ANOA 2OLSA 3TV4A 4PNKA 4RQVA 4CRSA 1TFFA 1OKYA 1I1MA 5I47A 3HLLA 4C5CA 1IAJA 1QMZA 2C6IA 4TNDA 3RALA 3MS9A 2J5FA 5EQPA 4D9TA 4USFA 4O96A 1PXOA 5M4UA 5EYDA 3BI6A 2OI4X 2JD5A 5CSVA 4ZJIA 3ZTXA 4DEGA 5LVPA 2NU8B 3VBQA 4AOJA 4KINA 2WMBA 3G51A 5JZJA 3BU5A 5CR5A 3VAPA 5BX0A 4E4MA 3RAKA 3SGCA 3LCOA 2DAAA 5FNVF 2H8HA 4LDTA 3QA8A 3UVPA 5M4CA 2UW8A 5BYBA 3UQGA 1YRPA 4DGLC 4G6LA 4BCPA 3JVRA 3LFFA 5I5WA 4Q9ZA 4E8AA 3EQPA 5H9BA 3OF0A 4J7BA 3TT0A 3T9AA 2H34A 3KREA 2Y4IC 4XEYA 4DLJA 2OSCA 2V5AA 4XYFA 1Y6AA 2P2HA 5JGDA 1PKGA 2WQMA 4E6NA 5GIPE 5HVYA 5LA6F 2F49A 3Q52A 3FHIA 5CWZA 3V01A 3ZU7A 4AQKA 4EQCA 2QLUA 3FXWA 2OXYA 2C6KA 4A9SA 5HCYA 3VUIA 3L8PA 1VBGA 4QYEA 4C38A 3UYTA 2F7EE 3GOKA 2RFSA 5L6OA 3TUBA 3ENMA 4FTRA 4F9AA 1GSHA 1PRYA 4GMYA 3CP9A 2FH9A 3MIAA 3WE8A 2PN1A 5DWRA 1ZZLA 4O2PA 4JIAA 4FL2A 4PTGA 3ZSGA 4YAKB 5HORA 3VHKA 4P4CA 3LJ2A 4FEWA 3N4VA 4Q5EA 3EQFA 2C69A 2BAKA 1OM1A 1PMNA 3Q32A 4D1SA 4UX9A 4TYJA 4O0TA 2W4KA 3A7FA 3AMBA 1MRVA 2GNHA 3T7AA 4CZTA 4IVCA 2NRYA 2G2FA 3E8DA 1J7IA 2XNEA 3DAEA 4ITIA 4NM7A 3ZXZA 3LQ5A 4MA0A 3NIZA 5D11A 2C30A 2R3HA 4I0SA 4CFMA 5FEEA 1ZXEA 4HCVA 2G1TA 4TVIA 5BWVA 2WTDA 2XKEA 2H6DA 4N6YA 3ZRKA 3MDYA 4EEQA 4KB8A 3VBWA 4YGAA 2R86A 5KMMA 2X1NA 4DFUA 4IWOA 5FPOA 5E8SA 4EORA 2PK9A 3HUBA 4C2WA 4RPVA 3ACJA 4KS7A 3VUMA 4E7WA 2FP4B 4IFCA 1OECA 4F99A 2RFEA 4ACMA 4O7RA 5AV4A 4YJ3F 2B9FA 4RX5A 3DS6A 3AC5A 2FSOX 2XYNA 3TV6A 3WF8A 1IOWA 3AC2A 3GCQA 1YOJA 2Z60A 4TWNA 1ZLTA 3NVKI 2DABA 2HHFB 4KIOA 3NZ0A 5JSMA 3DJ7A 4QP3A 4B99A 4K77A 2BPMA 3LCDA 3BGZA 3R9OA 4DBNA 3IDBA 4DHZA 5J2UF 3R2YA 4DFBA 2XM9A 4RX9A 4PUZA 4XOYA 2OO8X 5HD7A 5FR9A 5CXZA 3ZO3A 4C3FA 3R7EA 3HMIA 1PXLA 1PY5A 5IZFA 4EQ5A 3UZRA 2RGPA 2XNPA 4FKVA 5IA0A 2OU7A 3GU6A 4GK4A 3MVJA 4AXCA 1J1CA 3BACA 2PE0A 5E8ZA 2RFNA 1Y57A 2WMSA 3I7BA 4CMDA 2X8DA 5CANA 4F7SA 2GCDA 4RC4A 3IS5A 1YWNA 3W55A 4MV1A 4RIWA 4EWQA 3Q6UA 3ETHA 3OEZA 2UZTA 1XH5A 3O51A 2JBPA 5AX9A 2YABA 5DNRA 1OKVA 1KJIA 4S31A 3QRTA 4ZSEA 4PZ6A 4CMTA 3FZRA 4F09A 2WEVA 2XNBA 4NM3A 4RVKA 1C30A 3MVLA 4QOXA 3W16A 4KSQA 4BIEA 1M7NA 4UBAA 2B1PA 2OFVA 1H27A 3C9WA 3COMA 4ZTRA 5LMAA 5LP6F 3F3WA 3JY0A 3Q4UA 2C6LA 4WO5A 3VF8A 1I7NA 3VBYA 2W71A 4TUYF 4WOVA 2W0JA 2Q2UA 3OP5A 3G0FA 3D7TB 4L43A 4CC5A 4G3GA 3R7VA 1GIJA 1Q3WA 1O6KA 1YI6A 2H9VA 4GVJA 3ZUTA 3LXNA 4ZZNA 2HK5A 2BHHA 4H1JA 3TXOA 1EKFA 4IM0A 4JQ8A 1ZMWA 1YXXA 3A7GA 3OWJA 3BGPA 2R3RA 1FPUA 1ZAOA 3ZCLA 3TWJA 4L3LA 4PY1A 2J2IB 5KMIA 4K11A 4C35A 3U6IA 2QQ7A 4USEA 3HEGA 3EKNA 2WQBA 2A1HA 1OMWA 3DKGA 1GJOA 4IAIA 4ZOGA 3TN8A 4BCQA 4IWPA 4JAIA 2AEGA 4KWPA 3KAJA 4LH6A 3KRRA 5IQAA 5HE0A 5FXSA 1BMKA 4ANBA 5J95A 2FPPB 3F88A 1KEEA 3CJGA 2ITUA 1YQJA 2XK7A 4FEUA 5BVEA 3E88A 4LG4A 3MV5A 5G1XA 4GT5A 4AT3A 2XB7A 4Q2AA 3BZ3A 3R7OA 5LVNA 4PV0A 3TY8A 3MIYA 4G34A 4ASDA 3TTIA 5D10A 3W2RA 1ZZ2A 1CTPE 2ZDTA 4A06A 3EH9A 2CKQA 2UZVA 2ZB0A 3BHVA 3UQCA 2OBJA 5DOSA 3RTXA 1XQZA 4ITHA 5HTBA 4O4HF 3K5UA 3PFYA 4X3FA 3RM7A 4HCUA 4JQEA 4PWNA 2FO0A 2E9PA 2QCSA 3FLZA 4N4SA 1XKKA 3DQWA 3QX4A 2WYOA 4O21A 5I9YA 4XX0B 4XP3A 3ZH8A 3NBZB 5ANEA 4U9AA 4GT4A 3HZTA 4ENYA 1UNGA 5HNGA 2DWBA 5ANGA 3GU8A 3L8VA 3MH1A 3PXRA 4QPSA 3VBVA 1UNHA 3LM5A 4JR7A 4BCGA 3SOAA 4JAJA 4M0JA 3I0OA 4YC8A 1A06A 2WNTA 3KXGA 1YOLA 4KBKA 2WOTA 2QOBA 4FL3A 4EOSA 4DAAA 2F2CB 2VD5A 4CKJA 1T45A 4I3ZA 4EK4A 2PUNA 4FSMA 1U5RA 5DEYA 5KKRB 2COIA 4LRJA 5CAOA 4C5AA 1WVXA 5E8VA 1OBGA 1JPAA 2Z7LA 5ANDA 5J7HA 4XMOA 2CGWA 2QOIA 4C3PA 3L1SA 5IQEA 3JS2A 4DHJA 3QTXA 3FKLA 4QP4A 1CE8A 3LJ0A 1U46A 4NTTA 1G8JA 4IEBA 2Z8CA 4XLIA 4O0SA 3PFFA 3CS9A 4F7LA 2ZV2A 4HYSA 3VPBA 1E9HA 4IZYA 1RW8A 2PMLX 3RPVA 3P7CA 3HMNA 5EYCA 4QO9A 4I41A 4CC6A 3JVSA 3IONA 3R2BA 2UVZA 4RJ5A 5L6WL 3I1AA 1FOTA 4FFLA 4QMOA 2OXDA 5D1OA 5DH3A 4ZXTA 5E8WA 1ZYJA 3DQXA 3VC4A 4F0FA 5I5VA 1A9XA 1KE5A 4FJVA 3PA3A 4I23A 4FVPA 2Q2TA 4CT2A 3UDZA 2YWVA 5FUTA 2C68A 2W9FB 4NKAA 4DT8A 4F78A 4H05A 3PXQA 4HW7A 5I5XA 2Z04A 3C5UA 3R9HA 3R8PA 4PTEA 3PY1A 3RJCA 3KF7A 2OJJA 4RJ4A 3KCKA 4XHKB 1W93A 5CF6A 4R3CA 4CV9A 3U9CA 2YS7A 2UVXA 3E3PA 3BLAA 3FLNC 4LM5A 4AW0A 4MEDA 2XCKA 1XDNA 4YAJB 4D4VA 5JK3A 2BDFA 1PKDA 4QMSA 1E1VA 2VX1A 2QO7A 3RK9A 3ZC6A 1XO2B 3OZ6A 4M3QA 4BICA 2PVMA 1B6SA 4J1RA 5EM8A 3FC2A 4FIFA 3ZBXA 4E26A 4WA9A 1EUDB 5TT7A 2NU7B 5HHWA 3QZHA 3VRZA 2YACA 3T9TA 3NCZA 4TYHB 4DYMA 3ORLA 3S0OA 3ATSA 3PVGA 1YDSE 4FIIA 4I1ZA 4EKLA 4EOKA 4OTHA 2C6DA 4XP0A 1DI8A 3AC4A 3FC1X 3ZFYA 3ZZEA 4DFXE 1M14A 3CBLA 4EHVA 4RIXA 2I80A 2QB5A 4FKRA 2ERZE 4C36A 3KN6A 4EUUA 4FV4A 3RAWA 1P4OA 5HLWA 4FZFB 3BEAA 3DFAA 4HN2A 5H3QA 1SM2A 3HV5A 4PNIA 3DK6A 3CTHA 5HVKA 3ZHPC 3II5A 2QNJA 3N51A 4DHFA 3MFUA 5HKMA 4H39A 4EH7A 4D2RA 4E4LA 3QQHA 1Q8TA 3A7IA 3KK8A 5M09A 4PMMA 2DQ7X 4AA0A 2GFSA 3NUSA 1MQBA 1CS0A 4CFUA 3NIEA 4DCAA 3C13A 3AW8A 2WIPA 2A19B 2X4FA 3KMMA 3DXQA 3RWPA 4BDKA 4CFFA 3QRIA 3BYSA 4AXFA 4AZWA 1VYWA 4RC2A 5CYIA 2PY3A 2QI8A 4EH2A 3EFWA 2QONA 4CSVA 4GV1A 5J9ZA 2BKZA 4F9CA 2ZAZA 3QAME 2WD1A 1BXRA 3UYSA 3Q9YA 3UPXA 3BYVA 4CZUA 4AT5A 3CD3A 3HDNA 3UZTA 2R84A 3FJQE 4KIQA 3TG1A 5A6NA 4O82A 1M17A 5M08A 5DBXA 1EYZA 5AUXA 4FKTA 3I4BA 3R9RA 1S9IA 4PQNA 3KY2A 5IYZF 5KO1A 4MD9E 2YFXA 4DN5A 5M57A 4IJ9A 3QRUA 4MV7A 2NU9B 3F5GA 2V55A 2XKDA 4KNBA 5DMXA 2BZIB 4I92A 3U6HA 5ANIA 2R5TA 4KA3A 4TPTA 2CCIA 3E7VA 3PXYA 4UWBA 5HIDA 4XCUA 2J0JA 4DEDA 3TNHA 2VZ6A 2C3JA 4MQ1A 3ZS5A 1B04A 4JLCA 3VULA 1M2RA 5EM6A 1KC7A 2FSMX 4HYIA 3PSDA 4QT1A 4JBQA 5FG8A 4YMJA 1Q8WA 1GOLA 3PWDA 5DFPA 1JQHA 4HGEA 3T9EA 2UW9A 2QODA 3TYKA 4QNYA 3WZDA 2OWBA 4MH7A 4RZVA 4U7ZA 1OPLA 3E8CA 1V0OA 3EKKA 4FV2A 2FSTX 2HOGA 3FEGA 1H01A 3KIOC 3AT3A 4YJSA 4P5QA 4WHZA 3TKIA 5JMSA 1Q4LA 1V9PA 3AC1A 4EOMA 4GVAA 4I4EA 4ZLYA 2YM7A 3H9FA 2IG7A 2IW9A 3UNKA 5GIOE 3QQJA 5BVOA 2EB2A 3HT5A 1PMUA 4MF1A 4EJNA 3FL4A 4M0ZA 3ENHA 3KCFA 4QYHA 4XYMB 5E8YA 4B7TA 4ACGA 5D41A 5BVWA 4BCNA 3U6JA 4CVAA 1Y8GA 4ZOLF 2EU9A 3QXPA 2X6DA 5KMJA 4U0IA 2Q7DA 3WNZA 2W1IA 4ZTQA 3FWQA 5BWXA 1H1QA 5AUTA 5E92A 5AP3A 4ZZMA 2CGXA 2WMRA 5HESA 5C27A 3RI1A 1I2LA 4UCVA 3G9LX 1OI9A 3DLSA 4NYEA 4BDIA 4R3RA 2Y0AA 3ELJA 1B6CB 3BYUA 3JXWA 4DEIA 1J91A 3KVXA 3WARA 3V4SA 2XM8A 5ACKA 4LUDA 3OOMA 1JBPE 4JDHA 3REPA 3ZO4A 5CEQA 2F7XE 3K3JA 4BIBA 4M67A 4RT7A 2W4JA 4DRFA 4XRLA 2PVJA 4TWCA 4ERKA 4WG3A 4IH8A 2QU6A 2OGVA 1ZOGA 2P4IA 5IA3A 2C1AA 3IPHA 3LM0A 4F9WA 5E9EA 1KE8A 2IO6A 4LQMA 1H24A 1WCCA 4G3EA 4L8MA 4YHFA 2GMXA 4YSMA 5TOZA 1UC8A 3HL7A 2VO3A 4TYIA 2PHKA 4YJOA 4FSNA 3OS3A 4O2BF 1FVTA 3BHUA 3NUAA 4X0MA 4TZRA 3EN7A 4G3FA 1A48A 5AUVA 3MPMA 3BG5A 3D2KA 4D0XA 3U51A 4FX3A 3QTZA 3H9OA 1M2PA 4NT4A 4UCUA 2AUHA 2V58A 3FI3A 3Q9XA 4C33A 4J8NA 3GC0A 4ASXA 3QQFA 5AP0A 5DT4A 5E1SA 4U40A 2PVLA 2VTNA 3O17A 3RINA 2V0DA 4LGHA 1JKSA 3D7TA 1IRKA 3EZRA 2YIRA 4EK3A 5KMKA 5L2IA 2CZGA 2QR8A 3IK3A 3VS1A 4Q9SA 4YJ2F 4AS0A 3ULZA 3GC9A 4J52A 4YZBA 4W8DA 2COGA 3ETJA 2HY0A 2QKWB 5AIRA 4RJ8A 3EWHA 4QP8A 2O5KA 3BLQA 4YZ9A 2ZV8A 3IOPA 3R1SA 4GK2A 1AQ1A 3DY7A 3TM0A 4CFNA 4EOQA 4EOLA 2XUUA 5FBOA 3PIXA 2BROA 4DH1A 1J1BA 5AUZA 3G8DA 2OZOA 1DS5A 4N6ZA 1KOBA 2YAKA 4K0YA 5FPRA 1OL2A 2XNMA 3MJ2A 2UZNA 4ZTHA 2WO6A 4QP7A 1GZNA 1W82A 3ML1A 4BDFA 2CSNA 4G6NA 4ZS0A 3G0EA 3IGOA 1XH7A 2BZHB 4ZHQF 4FFPA 2RKUA 3PDTA 4R78A 4CMOA 5BMSA 1CKPA 4Z7GA 3NSZA 3I5NA 3G2FA 3LFBA 4XV2A 3SVVA 4C7TA 5CSXA 2CNVA 5K9IA 3PVBA 4JRVA 3AOXA 4FUYA 1UVRA 2A2AA 3L8SA 3UIMA 2XK6A 4CV8A 1LR4A 3VS3A 2G01A 4EHEA 5J1WA 2QK4A 1QPEA 1GZ8A 3OWLA 4EQMA 3TNQB 4TV9F 3A8WA 3UJGA 4BCIA 3C4WA 3CGFA 2I0EA 3F61A 2WEIA 1IYDA 3DK3A 2NO3A 1CM8A 2RFDA 4WKQA 4ZP5A 3MESA 1GLVA 3RV3A 3SG9A 1BYGA 1PHKA 4BCHA 3RZBA 4MBLA 4GK3A 3T9DA 4DTKA 4XP2A 3QCXA 3U9SA 5A54A 5CZIA 4RC3A 3I79A 1H07A 4E4XA 2B52A 4MAOA 4QDVA 1G3NA 5M56A 1WMKA 5DIAA 4DINA 5LQFA 3PJ2A 2J0IA 2J90A 2WQOA 2CLXA 2JFMA 2B7AA 3EN4A 4EH5A 4IADA 5IA5A 3UO4A 1TQPA 2BFYA 3T9IA 4CEGA 3VO3A 5FEQA 2B4SB 4BYIA 3FPMA 4U44A 4XG4A 4FEVA 3TUCA 3SX9A 5I5YA 4ZSJA 4IIJF 4AACA 4BCFA 3MYGA 3MFSA 2XBAA 4KS8A 4J99A 4EZ5A 3PTGA 4FC0A 4QMVA 5KHXA 2ITOA 5IQHA 4KRDA 4X6RA 1ND4A 2IJMA 1WBSA 3E62A 2OICA 4S30A 2YDKA 2Y4PA 5D9HA 1NVRA 2VO0A 3PPJA 5H8BA 3MA6A 4EOIA 4XOZA 1UWJA 4ENXA 5AA8A 2HWPA 3FMHA 3UYYA 2A4LA 4FTAA 4PMSA 1P5EA 2BKKA 4FNYA 4QTCA 4DQNA 1OPKA 4EG0A 1BI8A 3HKOA 4DTAA 3ORZA 1U4DA 3D94A 3SLSA 4R5YA 4Y95A 4ACHA 4NKSA 4OT6A 2QOKA 3CY3A 3F5XA 3HDMA 5JQWA 5HLNA 4MNEB 3PY0A 5CVFA 2PYWA 2W17A 4FV5A 3LMIA 4MD8E 2FPIB 3MB6A 3NRMA 1TQIA 1G8AA 4GCJA 4ARKA 5B2MA 4WT6A 2YWPA 3OROA 5T6KA 2PE1A 3EL8A 3P7BA 3WZKA 4C59A 5L6PA 1IYEA 3ZONA 1OL5A 2JIUA 4B0GA 4DH8A 4S32A 4HGLA 5HU9A 4MV3A 5CEMA 4PBCA 1H8FA 3H30A 4M7IA 5BWRA 5AAEA 2XANA 3C4EA 4G3DA 3LWBA 2YCFA 2Q0BA 3ATTA 3PRIA 1S9JA 4GH2A 4UWCA 4QP1A 1O6LA 5BWWA 4C0TA 4YZNA 4TYHA 5IG1A 1KJ9A 3DCVA 4WIHA 4YHTA 4AXEA 3TDWA 2HAKA 4NZOA 5IUHA 4FT0A 2NPQA 3BELA 3QQGA 4ACDA 4UN0C 5EW8A 1VLRA 4QQTA 4MXZA 2VWUA 3DXNA 5C8NA 1GIHA 4U45A 3NR9A 4AU8A 1ZAUA 3BA9A 1VYZA 3AKLA 3QQKA 3KULB 5D7VA 3OUZA