4O83A

Saicar synthetase (type-1) in complex with adp/amp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
227
Chain Sequence
b'AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with ADP/AMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o83A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o83A02
5LQFA 2YM4A 3SC1A 4G17A 3CBLA 3ZC6A 4DTKA 4LYNA 2FVDA 1DV2A 3AD5A 3K2LA 4XX9A 4FV2A 5KZ0A 3DFAA 4C0TA 3DGKA 3KK8A 1U5QA 2HXLA 3VBXA 2XIXA 3CR0A 3ORMA 3FWQA 4FC0A 1H0WA 3TINA 2C3IB 4RA4A 3EN9A 2W6QA 2QG5A 2Y4IC 3GP0A 3VMMA 2C47A 3MV5A 4PTEA 3V8WA 1J1CA 1FVVA 4ACMA 2FA2A 4BIEA 4FKGA 2HWPA 1A06A 4Y85A 4CLIA 2NU8B 5DBXA 4A4OA 2ESMA 3HYHA 5IQBA 4ASZA 2A19B 2XM8A 4UXQA 1QPEA 1UNLA 5HE0A 4BDIA 4DT8A 4EH7A 5M09A 4AW1A 2IW9A 4TKSA 4FG9A 5KX8A 3E8NA 3FMLA 2F4JA 1F0QA 3HV3A 4XNEA 4O4IF 1CKJA 3MY1A 4UYNA 4O7RA 4CNHA 2V55A 2X2MA 5JMSA 4FTJA 4U0IA 3NVMB 3U9TA 3HECA 2WQNA 5GIPE 5BUIA 4FTUA 4C34A 3P23A 2PUPA 2O63A 2OFUA 3F5PA 4IB0A 2GHMA 2P4IA 4HGEA 1Q61A 4I24A 3QXPA 4MD7E 2H96A 4IAYA 3U4WA 4LRJA 2R0IA 3HA8A 3KAJA 2JIIA 3A62A 5DHJA 4DEGA 2ITZA 2XJ0A 2BDJA 3LP8A 1OKYA 4MVFA 1UVRA 4A7CA 1VEBA 4PL3A 2OJ9A 3VW8A 3QTWA 4K2RA 4YZCA 2CSNA 4ANLA 4FNXA 4WOVA 3RAIA 5FDPA 3P5KA 3I6UA 4D58A 2QU6A 4FG8A 1MP8A 3MY0A 3GU8A 4A4XA 2WIHA 4M9UA 3VS0A 1UU8A 4EOPA 3F7ZA 3NUYA 3A7JA 4ME6A 4IAAA 2H6DA 3PWDA 3H0ZA 2BPMA 5KKRC 4PMMA 4L1KA 4R7IA 4JBQA 4DLKA 4H05A 5LXMA 2KTYA 4AFJA 4FV6A 4EOJA 5I9ZA 4L43A 3TNHA 3ODZX 3GC0A 5BVFA 3QZFA 2I1MA 3CTQA 4O0WA 1IAJA 3R01A 2W4JA 4HYUA 4LMUA 4GFGA 2IPXA 1TQMA 4R6VA 1M2PA 2RKUA 3U9SA 2QOBA 4UEUA 3IO7A 2YW2A 2G9XA 3VRZA 3TCPA 1WVXA 2PE0A 4I5PA 2W17A 4J8NA 4CFWA 3FZPA 3ORXA 3HRBA 4J96A 2YRXA 3HMMA 4FNZA 3CTJA 2GLTA 4YO4A 3EQHA 1APME 4USEA 4M7IA 3NUXA 2HK5A 5CALA 3C4FA 4L3JA 4K33A 2R3FA 5E8ZA 3WYXA 3HDMA 3DQXA 5J8IA 2I40A 3SG8A 2XNEA 1WMKA 3BE9A 2UZEA 3P78A 4F9YA 2DQ7X 4G5PA 1REKA 4AX8A 3BE2A 3A7FA 3ZMMA 3F5UA 3ZU7A 5TO8A 1Z57A 4N4SA 5DT0A 4NW5A 2PPQA 3R7VA 4FV1A 4XG7A 3LLAA 3EL8A 2G01A 2GFCA 4EYJA 1AQ1A 2WTIA 4DC2A 3COHA 4X2FA 1LEZA 3C13A 1WBWA 4XEYA 3S00A 3WILA 3D9VA 2HIWA 4Y95A 2WOTA 4I22A 4O7YA 3IONA 4FOBA 3II5A 4D9UA 3HB9A 4KSQA 2BUJA 5GONF 3HMOA 4M84A 2WQOA 4BTFA 3V4SA 1C30A 4FV9A 3AT3A 4FZDB 4EGQA 2B7AA 2R3JA 4D0XA 4D2RA 1CSNA 3LJ1A 3VAPA 3R83A 4MWIA 3AG9A 1IAHA 4O0RA 4BR3A 3F3VA 3EFWA 5CSWA 3G9NA 2IWIA 3V5QA 4CFNA 1PW2A 2ZDTA 2UW4A 2ZDHA 3GUBA 3U4UA 3R7IA 1AGWA 3SGCA 3R00A 5IQDA 3E64A 1JKTA 3RALA 2X9FA 3BEGA 4CKRA 4RRVA 3F9NA 3JY0A 3W1FA 5HU3A 1H00A 4W4YA 2XK7A 3KXXA 5M07A 2ITXA 4FV0A 1OBDA 3SLSA 3ZCLA 2YCQA 4D5HA 5KHXA 4F6WA 4ZK5A 4DEAA 2BR1A 5M06A 2P2IA 4J8MA 3ZDIA 3LOKA 4MV6A 4MEDA 4WRSA 5L6PA 2P2HA 5E7RA 1OL7A 3UVQA 4V04A 2B9JA 2VV9A 3KXHA 4BCKA 4LV5A 4YSJA 4PTGA 2VTJA 2E2BA 3VRYA 4GKIA 4IE9A 4HZSA 4Q5HA 4UWCA 5JGDA 3ZLWA 5CEPA 1OUKA 4KIPA 5E1EA 4TYEA 2XYNA 3VBYA 4AZSA 4QMUA 2P55A 3L1SA 4A4LA 2NU6B 4F08A 2H34A 4G6OA 1AD5A 3R7EA 1KJJA 4PF4A 3SXFA 2BRHA 3UMXA 1K9AA 4FSWA 4EG0A 2WMWA 1U46A 3LMGA 3W8QA 3D15A 5J1WA 4O2AF 2IZRA 2A27A 5IYZF 4F9AA 2R3RA 2PULA 2UZVA 4C4IA 3JY9A 3QALE 4TWOA 3NLBA 3IDBA 4EJNA 1IEPA 3LM5A 3NUPA 4NUSA 4QMNA 3DPKA 4UN0C 2GNIA 2WMRA 4YZMA 3R0TA 4EUUA 3OG7A 2C1AA 2C5OA 5HNBA 2YWPA 2VPQA 3FMNA 4F7SA 4BGQA 4XH6A 5AV0A 4CRSA 4EONA 4EZ5A 3VBWA 3TT0A 1J7IA 3ITZA 4IQ6A 3OWLA 1O6KA 3ZDUA 4EBVA 4C4GA 4FV7A 2BDFA 2VO6A 4GYIA 5EOLA 5K3YA 2V0DA 1MRVA 4IFCA 1LEWA 4MQ2A 3ZZEA 2QOOA 3W2CA 3E3BX 3I5NA 4NTTA 4QNAA 1H8FA 3DKGA 4WA9A 3ROYA 1I44A 3GGFA 4I6QA 4RIXB 2C5VA 3S4QA 4W4XA 2YACA 5IH6A 5HIDA 1MUOA 2G1TA 3GEQA 3QWKA 3B8RA 2VWXA 3NMUF 5C8YF 1KE9A 3FLQA 4H1MA 4WKQA 2OO8X 3KEXA 5ACBC 3PY0A 4M12A 3KRJA 4F0FA 2HOGA 2V5AA 5E8UA 2VO3A 3FUPA 4GL9A 5JH7F 3FKOA 1IG1A 4NYEA 5FP6A 3HLLA 5HBHA 4L00A 4YMJA 3JZFA 4QYGA 4H1JA 4AN2A 4BDCA 1BL7A 4GUBA 1PXIA 2ZV2A 5HVYA 2CGVA 2XP2A 2R3GA 1OECA 4DF3A 5CAOA 3DJ7A 3TM0A 2YWVA 5L8JA 4K0YA 1K2PA 3H30A 3E8CA 2WQMA 5I0BA 3KRXA 1RW8A 5CSVA 4CSVA 3PFQA 2WPAA 1ATPE 3PJ8A 4GIHA 4RMZA 4IFGA 4YZNA 3BHHA 1EZ1A 4O0XA 4DH7A 5ANGA 3UP2A 5JGAA 5CAPA 3LKMA 4RLLA 3HUBA 4C38A 3EQIA 3OS3A 2JKOA 4JRVA 3DAEA 3HDNA 5L6WL 4I50F 2UZDA 5DT3A 2UW0A 5D41A 3SD0A 2RFNA 3GVUA 4BN1A 3BV3A 3QQHA 2ITVA 3MWEA 4AT4A 2IJMA 4JAIA 3VULA 4CZTA 3QA8A 1M0TA 4PDOA 4YB8B 5A14A 2R3QA 4F4PA 5M51A 4AGWA 3T8OA 5DFPA 1GZOA 2QLUA 2X8EA 4FKJA 4ZJIA 2QLQA 2BAJA 2VAGA 3PLSA 4X21A 3AD4A 1A9XA 2WB8A 3RVGA 2X6EA 5C1PA 1Y6AA 1YDRE 2E9NA 1OPLA 4GS6A 3ATTA 3V01A 5I9XA 2HZIA 3SX9A 4TZRA 2ITTA 4CMOA 3NX8A 1WBPA 3EN6A 3SV0A 5CY3A 2XKEA 3NDMA 2EXMA 5CEQA 5CS6A 5I4NA 2VTOA 3QFFA 4PQNA 2FSLX 3VBTA 3G90X 5M57A 4P90A 5J95A 3LFAA 3MB7A 2XIRA 4DGLC 2XCHA 3H9RA 3ZLXA 4AQCA 3KALA 3FL4A 3UZPA 4C59A 1VZOA 4IVAA 5C27A 4E4NA 4IM3A 3U6HA 4RJ7A 3R8UA 2J9MA 4ZJJA 5T3QA 4FZ6A 3FL5A 4DH8A 4DH1A 4M0ZA 1GZKA 3NSZA 4I6HA 3BIZA 4DH3A 4F6SA 2PK9A 4DFBA 3LLTA 3ZC5A 2OK1A 1YHVA 2W1HA 4ENXA 1PXNA 4ARKA 4KS7A 5CXHA 4I6BA 4BCGA 3R02A 4F64A 3MH2A 2DWBA 4ZMEA 2H9VA 2XKDA 2ZYBA 5IH4A 4EOIA 4EHGA 3SVVA 1B6SA 1TQIA 4FNYA 1H1SA 3QD0A 4KIQA 3IW5A 2YS7A 2OXYA 3LFDA 3ODYX 5FM2A 4I21A 4DA5A 1SM2A 2WMVA 1Q8TA 3QTXA 4FKTA 4U42A 4PUZA 3PJ1A 2BRMA 3NUAA 3UFXB 3HV4A 4O7VA 1Q41A 2QOIA 4AOTA 4BYJA 2J6MA 4BZDA 3EQCA 3ZHPC 3AD6A 3QX2A 1XJDA 3DK6A 3G5DA 4OW8A 1BLXA 4Z3VA 3QQGA 5L2SA 3HP2A 5AUUA 1H24A 2OXXA 2UUEA 4OTWA 4JR3A 3VJOA 3HV6A 4NM5A 3UQCA 4GJ2A 2GHLA 4FTMA 2OXDA 4FZFB 4IHPA 1W82A 4EQUA 4LOOA 4EH3A 3Q2OA 4BF2A 5BUJA 3C4WA 3FLSA 3PXZA 4FEWA 3ETJA 4NL0A 4BCMA 4R3PA 4RG0A 3HMPA 4YTFA 3GU7A 4H3QA 2QNJA 3OOGA 3LXKA 4ALVA 3PZEA 4L42A 3U9CA 3E87A 3GCPA 4MH7A 5BUEA 3FQHA 5IMEA 5ANOA 4G5JA 4I92A 3MH3A 4NSTA 2O8YA 4BGHA 3NAXA 5EZYF 4AZWA 4ZY5A 4YBJA 3VQUA 2VTQA 4EK4A 4O7NA 4YZ9A 4I0RA 3FMKA 3Q1KA 5HX6A 3OWPA 4U3ZA 1M2QA 3KU2A 3RWPA 3PLAE 3V04A 3O7LB 3G15A 5EM6A 1PYEA 1URWA 3MA6A 4FIHA 4WG4A 3VS2A 3ZUVA 1BNCA 3WOWA 3TNIA 2YCFA 4DT9A 4GMYA 3DBFA 4JQEA 2DWCA 3UVPA 3VS6A 3RKBA 4HPUE 4O7SA 4EL9A 5JVLA 5IMXA 4FFRA 3FHRA 5HZNA 2FPGB 1H0VA 3PZHA 4DG3E 1YOJA 4JBOA 4X3FB 3V8SA 2PVNA 5HU9A 3R5HA 1UNHA 1VYZA 1ZZ2A 3F2NA 2O5KA 3NCZA 3BGPA 4WUNA 1E4EB 3JRXA 3D94A 3W2PA 1KE5A 2J0JA 4KUJA 3ALNA 4XBUA 4F9BA 5IA4A 3QBNA 3W33A 5FEQA 2WMXA 3H0YA 4YTHA 1PXOA 2PMOX 2Z2WA 5HGIA 5HORA 1WAKA 1WVWA 4XV3A 3ZTXA 4C4HA 5C4KA 2XEZA 3LXNA 3PG1A 1JWHA 4IMYA 1WVYA 3OW3A 2W5AA 2W71A 3TN8A 3DXQA 3MPTA 3TZ8A 2PTKA 3CP9A 3FI4A 5A46A 4C7TA 1PF8A 4NKAA 3BQRA 3N4VA 4EJ7A 1DM2A 3AMBA 1GZ8A 2BHEA 2WU7A 5AUTA 5CEKA 3AW8A 3TACA 3EYGA 2XBJA 4KINA 1FPUA 4AWIA 5CAVA 5AP1A 3S1HA 4ZMFA 3Q60A 2HXQA 3EKNA 4CFFA 2NO3A 4YTIA 1Y6BA 2ITQA 3BU3A 3GCUA 3WF5A 4D1ZA 5EG3A 1CQJB 4FSNA 2XNGA 1IA9A 1ZY4A 2RFSA 3W2OA 4TL0A 2ETRA 3H3CA 4KRCA 1WZYA 2YCSA 4BDJA 2ERZE 4QP8A 1QPCA 3BBTB 4FODA 4EK3A 3UO5A 2BCJA 3ULZA 3UOJA 3V5TA 3MFRA 3ZRMA 3NUSA 4IX6A 4NTSA 3DNEA 4O22A 3RM6A 2CPKE 4J1RA 1WR2A 2XYUA 3W8LA 4EHEA 2CNUA 4G3EA 3D5VA 3DAKA 4M67A 2WQBA 5H9BA 4CFXA 4E20A 3KQ7A 5EW9A 3SW7A 4RVKA 1SCUB 1BI7A 3FY2A 3TKUA 4A9SA 4B8MA 4QMSA 4U81A 3PA3A 4CQEA 5L2IA 1BYGA 5AX3A 4C36A 2BROA 2VX1A 4JAJA 4QTAA 5AP5A 3UZRA 1H1WA 4AA4A 2YL2A 4XZ3B 4PMTA 4RJ3A 2XJ2A 2QURA 3BGZA 4G1WA 3RHXA 2R86A 4NWMA 2X7OA 4TRLA 4TYGA 2PVKA 4TWNA 5L6OA 3PE1A 2ZMDA 4XS2A 3Q53A 5E91A 5DGZA 4AGCA 4FFLA 5E8XA 2HY0A 4FSQA 4WIHA 5J5SA 5BYYA 2IVTA 1JKJB 1SNXA 2BZHB 1VBGA 3BYUA 4RIWA 5HG8A 4FUYA 3ATSA 1H28A 2E9PA 4B4LA 5A4CA 3ORKA 5M4CA 5CF8A 1UU3A 2WELA 5AV4A 1VJYA 2OU7A 2XK6A 3D2KA 5JN2A 5EKNA 1STCE 4U45A 2JAVA 3R8VA 3QD2B 5BMVF 5I5ZA 1CDKA 2DZDA 5A4QA 5EI6A 1KE7A 4XJ0A 4ZSJA 4B9DA 4EHZA 4DIMA 4QMZA 1OL1A 1KV2A 3OCBA 4APPA 4I4TF 2GCDA 3UG2A 4Q9SA 1OPKA 3TIGA 5IZFA 1R0PA 3POOA 3IW6A 2JAMA 4BYIA 4BI2A 4YPDA 2R4BA 4HR7A 4D4VA 3OOMA 3PSDA 4UB7A 5HVJA 1SVGA 3RV4A 3FMJA 5AA8A 2GPHA 3I1AA 3ZZWA 5M4FA 2YEXA 4HQ6A 3RPVA 2YM3A 4QO9A 4FL3A 2XD4A 2QO9A 3CQUA 5EQYA 3SDJA 5CA1F 1FVRA 4MF1A 4MWHA 4MD9E 4TYJA 5EQEA 4BZNA 4PMSA 2R82A 4DEBA 1FMKA 2QONA 1FMOE 4BIBA 1W83A 4N6ZA 1BI8A 3QHWA 4PMPA 2J4ZA 4P5ZA 5HHWA 1B6CB 5M55A 4EOOA 5L2TA 3IKAA 3PXKA 2EXCX 4YLJA 3BGQA 4RQKA 1ZOHA 2R3OA 3T9IA 5BPYA 4WO5A 2R87A 2VO0A 1OITA 3ETAA 2EUFB 2B9IA 3PXFA 2VTSA 3I79A 5HKMA 3EL7A 5GINE 1ND4A 1KJIA 5J9ZA 5HCZA 3BWJA 1VKZA 3K5HA 3UQFA 1KUTA 4O21A 3GU6A 4UWYA 4EC9A 3UPZA 4IB1A 2VWWA 4D28A 3PJ2A 5JT2A 4HVSA 2BZIB 4KSPA 4YPSA 2QVSE 4QMXA 3WZJA 2WXVA 2WTJA 3OUUA 5FBOA 4XOZA 2HY81 2YIQA 4YJOA 3E88A 2PUNA 4QOXA 4IZYA 4FTLA 2W1ZA 1ZYCA 2WTCA 4XG8A 4JDHA 3PG3A 5E8YA 4JLCA 5CAQA 2RG6A 3LZBA 3FQEA 3L9LA 2F49A 4H39A 3WIKA 1P2AA 2YISA 3RCJA 4AW0A 5IA2A 1YRPA 5AIRA 5AMNA 2JDSA 5LMAA 3S2PA 2GSFA 2G2FA 3QUEA 1XH8A 2W6ZA 4O38A 5FNVF 1CQIB 3RK9A 3MJ1A 3TNPC 1X8BA 1FINA 2R0UA 5BX0A 4L6QA 4UALA 2J0MB 5DPVA 3DBDA 1XH9A 1H01A 2ERKA 1UU9A 4YSMA 3NYXA 4U5JA 2AYPA 5J7HA 5JQ8A 4TV8F 4PRJA 4MNEB 2VTLA 1MRUA 5IA0A 5CVFA 3BU6A 3PP0A 3KA0A 1OMWA 1BX6A 5AUYA 5IH5A 4FFPA 3EHAA 3R63A 4NM0A 1Q8WA 3AMAA 3KVWA 4TV9F 3A4PA 4AG8A 3LQ5A 1PY5A 3UIBA 4H36A 4LFIA 4XYFA 3ZO1A 3WO0A 3KULB 5FQDC 5KZIA 3Q2JA 3ORZA 4RZVA 3BYVA 5DRDA 3KY2A 3VS1A 4I55F 2X9EA 4BDHA 1TKIA 4CKIA 3DZQA 1BUHA 1UWHA 4IC8A 4OT5A 2FPPB 5CU4A 4BICA 4HNUA 3RAHA 3FE3A 4FTQA 1Q97A 5H80A 3FZ1A 5DR6A 4QYYA 2C68A 3RNIA 4TYIA 5JQ5A 3FYJX 3O8UA 4QMQA 3W55A 2HW7A 1UKIA 4A9YA 2C6MA 4NW6A 3EOCA 4RQVA 4G2FA 4FBXA 2IZTA 4L52A 2BAQA 2OW3A 4L7FA 4FU0A 1W0XC 1W96A 1G8AA 4FTTA 5EI2A 3NR9A 1S9JA 4Q2AA 2WMAA 4RWJA 3HP5A 2Y6MA 3TZMA 2J5EA 1O9UA 2F2UA 2SRCA 1V0OA 4U40A 5CWZA 2JBPA 4RFZA 4YJNA 1XH6A 5BMMA 4AS0A 2VRXA 2C5YA 2FB9A 4USFA 2A4LA 4W8DA 4XG3A 4YC8A 4G9RA 1H26A 2XIKA 3UTOA 4E73A 5DE2A 4MD8E 1LP4A 3E92A 4AU8A 4BIDA 3D7ZA 5IUHA 5GJFA 1QL6A 1R3CA 4EYMA 2V5QA 4ZIMA 3ALOA 5IDPA 2RF9A 3KREA 2WTKC 3R8PA 5I9YA 4OTIA 3HGKA 3AC3A 2OLCA 2VTMA 3ORPA 4QMTA 5BMSA 3GENA 3IG7A 2ITPA 3QQJA 3LFNA 4WNPA 3QRTA 1R39A 3CXWA 4J98A 2VTTA 5IA3A 5EDRA 4FFOA 3PPZA 2WD1A 3D0EA 4JRNA 2PMIA 4YJSA 2V22A 4AXAA 4B99A 2BKZA 3C4EA 3F88A 2ZV9A 4H58A 3BX5A 2VR1A 4BDGA 3SXSA 4AZEA 5TKDA 4FMQA 4S32A 3K5VA 4V0GB 5F94A 4PNKA 3E7VA 1KSWA 3AXWA 4RX5A 2QC6A 3BELA 3TUBA 3DLZA 3DXNA 4C37A 1XR1A 2W1GA 3OXIA 4TPTA 3CPCA 2LGCA 2VUWA 1JKLA 2OIDA 2UW6A 2UZTA 3G2FA 4FOCA 3HUCA 4RJ8A 4KB8A 4Y46A 4PNIA 4CFVA 4HZRA 3QAME 1CKPA 3L9MA 3MSSA 1JDEA 2R3PA 5DN3A 3VHKA 4FYOA 5E8VA 3MB6A 1PX2A 1QPDA 2YM8A 1NVQA 4E6QA 1KC7A 4YJPA 4R1VA 5BQ0A 1U59A 4QYEA 3FBVA 3LFEA 1ZRZA 3VJNA 3F66A 1PRYA 5EFQA 2AC5A 5KUPA 1YWVA 2C6IA 4E6CA 4M68A 4JIAA 5LVLA 3E93A 3LFQA 4CRLA 5G1XA 3WO1A 2QD9A 5AV1A 5C01A 5CVHA 2O64A 3BLHA 4QQCA 5D7AA 3AC8A 3DDPA 2X8IA 2XK4A 4PP9A 3DBEA 4ZP5A 2FSTX 4CG8A 2OI4X 1B39A 4RC4A 3TW6A 2JDTA 4E1ZA 2Z60A 3ETHA 2YCRA 3CQEA 3PE2A 4JOAA 4F0GA 2J9GA 2B4SB 4UY9A 2XNOA 3NYOA 1SNUA 1Q3DA 4KBCA 4I93A 3BHVA 1C3OA 5EK7A 4K77A 2I7QA 3AC4A 3DY7A 4IZAA 4DH5A 3QTUA 1JKKA 4Y73A 4YZDA 5JH6A 4IZOA 5J2TF 3G0EA 4WUAA 2R85A 3QZGA 1GSOA 4HGSA 4YJUA 3PSBA 4IH8A 3ZONA 2FSMX 2YS6A 1ZMWA 4NIFB 2YJRA 5K5NA 1QPJA 3VHEA 1KV1A 3R21A 2J0LA 3ZLYA 4BC6A 4DG0E 4XRLA 4UX9A 3BYSA 3L9NA 5JQWA 5D12A 5KMMA 1ZOEA 2X6DA 2OH0E 3TIIA 5AV3A 4QP9A 3OUNB 3OVVA 4DLIA 4K9YA 3NWWA 3M1SA 1A48A 4HW7A 5LYJF 4ITIA 2NNWB 1WBTA 5F1ZA 1UWJA 4BCPA 4XP3A 2JDVA 3DF7A 5CF4A 3H10A 3GQLA 4ZZNA 2OZAA 1KE8A 4OUCA 4ACCA 4BZOA 4RIXA 2JKQA 5FBNC 5ITAA 2CNQA 3MFSA 4QT1A 3AGMA 4MBLA 1KE6A 3GOPA 2YIRA 3OTVA 5E8WA 4XG6A 4DFLA 1T46A 3DXPA 3VC4A 4CTBA 5BVDA 4IAIA 4RFMA 4I20A 4ACGA 4OTHA 2J0KA 3WZDA 3DNDA 2PZPA 4FK3A 4YNEA 3BG5A 4JG8A 4EOLA 2BMCA 4O96A 4B0GA 5CYIA 4MXZA 4RA5A 3FDNA 3TDWA 5LWMA 4GV1A 3IECA 2ONLA 3U51A 4F6UA 1YXUA 4LUEA 4QP6A 4E4TA 4BI0A 3R9DA 3E3PA 4L53A 4F7NA 5HIBA 3BHTA 4FEUA 2W1DA 3MH0A 2QF7A 5DWRA 2UV2A 5LOVF 3C7QA 3MJFA 4AUAA 3COIA 4RWLA 5TT7A 3PPKA 3OEFX 5LVNA 3W10A 2F7XE 3HAMA 3QQKA 2VWYA 2XNPA 3BI6A 5T68A 4NH1A 3POZA 2ETMA 3PYYA 5FXRA 2E9VA 1ZMUA 5CLPA 1W7HA 4RVLA 4XMOA 4KS8A 4K6ZA 5G6VA 4G6NA 1IASA 4TNBA 4KNBA 3COMA 4B6LA 4IDTA 4C2WA 1O6YA 4F99A 4CFMA 3C4XA 2R7LA 2QKWB 2ETKA 1JVPP 3MVLA 5JRSA 3TUDA 4RZQA 2WEIA 4RIYB 2NU9B 3NW5A 2VD5A 4YO6A 4FTKA 3QKLA 4I5MA 2C3JA 2REIA 3F2RA 2R3KA 1PKDA 4O7ZA 4AN3A 1GIJA 3ZSGA 3FSFA 3KFAA 5EW8A 5C8KA 3RK5A 4CG9A 2YZGA 4IX5A 3R2BA 1VYWA 3QLGA 2C1BA 4ID7A 1JKSA 3IS5A 3R9NA 4HVDA 4MV4A 2PL0A 1ZYJA 3MGYA 4FSUA 2RFEA 5CVGA 4B7TA 4DBXA 3LFSA 3ZH8A 1I7NA 3IGGA 3R30A 3A8XA 4BBFA 4HNTA 5CI7A 4Q9ZA 5KHWA 1XH7A 3HMNA 5JFWA 3LXPA 4YHJA 1B38A 2QCSA 1BMKA 2Z02A 3CKWA 3ID6C 5EDPA 4E4LA 4EOKA 3EKKA 3GNIB 4I94A 2BTRA 4IWOA 4TXCA 3V5WA 2I80A 1HOWA 3KRLA 4FKOA 3SRVB 2PSQA 4QSHA 3EZRA 3O7LD 3Q5ZA 3ZEWA 2XJ1A 1UV5A 4LI5A 4QTEA 4QMWA 2VWBA 2ZM3A 3E8EA 4X6QC 2UZWE 5AUXA 5AADA 5JFVA 4E93A 2JFLA 1DI9A 1GAGA 1YDSE 3FPMA 2IW6A 3HAVA 4M8TA 4E6AA 4WBBB 2C6LA 1XBAA 3KCFA 3I0QA 5I9UA 4D5KA 4C4EA 3BPRA 4HYIA 4ZS0A 4DFYA 4APCA 1PK8A 3UYTA 1DI8A 1IRKA 4FGRA 2Y0AA 2Y4IB 4OT6A 4U79A 4YC3A 4QTBA 4L3PA 2GDOA 3EJ1A 3PJ3A 5C03A 2ZDGA 4C5BA 3DJ6A 4I0TA 2YN8A 3CJFA 1NT2A 5H3QA 1ZMVA 3FI2A 1VBHA 2VWIA 4C02A 4G6LA 4BDFA 3NW6A 3OXZA 4YAJB 5DI1A 1XH5A 3F3WA 4BRXA 2WMTA 3BZ3A 4JVGA 3DTWA 3SG9A 4IBMA 4G34A 4EH4A 4OR5A 3P86A 1O6LA 4NM7A 1YOMA 4QP3A 4BI1A 2XIYA 1UNGA 5CU2A 5E4HA 1URCA 3PA5A 2BZKB 3QKMA 1JSTA 3L8XA 2BAKA 4PDSA 1XWSA 4PX6A 1L8TA 1V0PA 3FLZA 3MI9A 1V1KA 3G51A 3LVPA 5EHOA 4D9TA 5IUIA 3QD3A 2B53A 2OJGA 4FT0A 2P0AA 1YHSA 5IQIA 3C4ZA 2R7MA 1H1PA 5CEMA 4HNVA 5HE3A 1G8SA 2XCKA 4R1YA 3H4JA 5ICPA 3TUCA 4DHFA 2RL5A 1VR2A 3R7YA 2BFYA 4RJ4A 2UW3A 1RJBA 1Z2OX 2X0GA 3FY0A 3VPCA 3QKKA 3I5ZA 5C1OA 3Q6UA 3ENHA 1Q8YA 4HOKA 1M7NA 2O3PA 4O6EA 4RZWA 3QQFA 4AAAA 4OTDA 3EQPA 3R7OA 5KKRB 5M4UA 3R9RA 4Z7HA 2FP4B 2VTPA 2GNFA 2XNBA 1J7LA 1XBBA 4FEQA 4X2GA 3QZIA 1NVRA 2YM7A 5DR9A 4X3FA 5KMLA 3QXOA 4FSZA 1ZWSA 1E4EA 5KMNA 3TIYA 2NP8A 4E4MA 3E5NA 1Z2PX 4IWPA 5EM5A 2W6OA 4JBPA 3U9NA 3R5FA 5HG7A 4O4JF 5CA0F 4BDKA 1RE8A 4EK8A 4EH2A 3BLRA 5LMKA 3F3ZA 5J9YA 4D1SA 2W1CA 2PWLA 3DLSA 3O50A 5FD2A 4ZAUA 4MYGA 5KMKA 4IIJF 5BVOA 3HO8A 3UC3A 3OFMA 1T45A 3S95A 2AC3A 4WD5A 1M7QA 4EOMA 2EB2A 4JL9A 4LM5A 3D14A 3M2WA 3NIZA 5TR6A 3KKVA 3ZRKA 4WG5A 3P4KA 3TTIA 4N70A 4FV3A 2OH4A 4E5WA 2IO6A 2OF2A 2XS0A 2PVHA 2C3KA 4QMVA 4QP2A 4RX9A 5EOBA 4IM2A 4OTFA 3Q96A 3BCEA 3RK7A 3MH1A 2GQGA 3QUPA 4D0WA 4BCJA 4YJ3F 4AT3A 2JFMA 5AFVA 2PN1A 3OT3A 4GT5A 1Z2NX 5FTGA 3C50A 3OEZA 4ZEGA 4CT1A 3QTSA 3VS7A 3FC2A 5CF5A 1M52A 3R8MA 4F70A 5ETIA 3HBLA 2C6KA 3ZLSA 3DQWA 3WZKA 4AOIA 2I0HA 2O2UA 5HEZA 4QQJA 2R3MA 5H8EA 3R2YA 4XG4A 3TEIA 1H08A 4EORA 1Y8GA 2BKKA 4ZY6A 2Y8OA 4AE6A 5HVKA 4QP7A 4ZSAA 4L45A 2O65A 3VUGA 2QG7A 3UPXA 1TQPA 3A99A 4I0SA 4Y5HA 3QWJA 3QC9A 1A9UA 4CFUA 1PKGA 4V01A 3WF8A 2OG8A 4DEIA 4DFXE 5CI6A 2JKMA 3DB8A 2WMQA 3WF6A 4AE9A 2CKPA 3VVHA 3Q9YA 1OIUA 5C4LA 5HBJA 3RJCA 2WZJA 3EN5A 3N51A 4HCUA 1CE8A 4XYLB 3R23A 2W1EA 5AP2A 2EU9A 3FXXA 3VN9A 4TWPA 3OWKA 4JI9A 1EHIA 5HQ0A 4UBAA 2RG5A 5HG5A 3KVXA 4F7LA 3P08A 1XHAA 4EKLA 1JAMA 2R9SA 3DKOA 3FKLA 2NRUA 4OGRA 5C26A 2Y4PA 3QLFA 3JRWA 4IB3A 4NT4A 4RVMA 4WT6A 3FI8A 1OKZA 4FKQA 4BB4A 1M2RA 5TOZA 2B0QA 4ANBA 3AGLA 4M97A 4XG9A 4J52A 3AT2A 3ZRLA 3ZXZA 4KABA 2CLXA 2CNVA 4NCTA 5HCXA 4EHVA 3IQ7A 2VTAA 3FAAA 2VWVA 4MV9A 1YWRA 4FKWA 4AFEA 3Q9ZA 5C8MA 3GC7A 3TWJA 3DTCA 2GTNA 4L3LA 4MNFA 4QMYA 5KNJA 2G2IA 4MHAA 4FT9A 4OTGA 3FXZA 3SOAA 3RAWA 4K1BA 5CSXA 3T3UA 2P33A 3NS9A 1V0BA 2C0OA 3U87A 4D4SA 3OP5A 4ZXTA 2YERA 4IAZA 1Q8ZA 3NUUA 3NPCA 3PIYA 3VIDA 1KJ9A 4WNOA 4H3PA 4D4YA 3CE3A 4FKSA 4HNIA 5HNIX 2QO7A 2Y9QA 5HBEA 2X0SA 2VGPA 4DEHA 4EC8A 3QQUA 4CLJA 4O4LF 4M0YA 2WIPA 3PXRA 3R1QA 4YGAA 1R1WA 2QOLA 5LCKA 3D83A 3RV3A 3EFLA 3JXWA 4AZTA 3QRIA 4O4HF 2VX3A 4PP7A 3PUPA 5EM8A 4HGLA 1F3MC 1L3RE 3VS4A 4C4FA 1NXKA 2CKOA 4BBEA 1XBCA 2VWUA 4YJVA 1MQBA 3RAKA 2V62A 4NJ3A 5EYMA 5M53A 3JVSA 5JQGF 3UOHA 2NU7B 4LMNA 5EH0A 3DOGA 4RIOA 2NPQA 4O0UA 4EUTA 4D1XA 4XUFA 4CVAA 2GS6A 1GOLA 1GLVA 2IVUA 5CB4F 2E9OA 3ULIA 3REPA 3RPSA 1UU7A 1YXXA 5D9HA 3TG1A 4YUQA 2EWAA 3VS3A 2QOHA 5EDQA 2X81A 3WZEA 3RMFA 5AAGA 5DT4A 4V05A 2OJFE 2V7AA 4WNKA 4GFMA 4BHZA 2B52A 3UIMA 3MWDA 3FEGA 3LFBA 3GBZA 3WE4A 4OBQA 2I0EA 1DIKA 4C4JA 4YLLA 4LOQA 2XNNA 4AW2A 5CU0A 2QHMA 4BDBA 2C5XA 4CEGA 2WNTA 3FZOA 5AA9A 2VU3A 4ENYA 3K5IA 4NU1A 4ZTHA 1JSUA 3MW1A 3KF7A 4XP2A 2J51A 4MXXA 4E6DA 5HTBA 2CN5A 3F7WA 5M4IA 2XZSA 5F20A 5B0XA 2ZMCA 3R9OA 3W32A 1U54B 3I4BA 4QMPA 4XRJA 5EI8A 1H07A 1E1XA 2W0JA 4O7TA 5M44A 2W6NA 3C5IA 3QRKA 5AX9A 4MV8A 2CJMA 3UODA 4NK9A 2J90A 1Q5KA 2VNYA 2JD5A 3VUHA 3U6IA 4D2SA 3LIJA 3SAYA 4BTKA 3PA4A 4FE2A 3ORLA 3ACKA 5M08A 2NRYA 4MV7A 3CC6A 4KKGA 5HG9A 3TJDA 2PVPA 4MNEA 4CCBA 3B2TA 5F4NA 2JGZA 3EQGA 3ZUUA 3UIXA 2GQRA 5F95A 4Y72A 1P4OA 3N4TA 3TZ9A 5E8TA 2BDWA 2CGUA 2OKRA 5CXZA 4F63A 3DS6A 4O2PA 3UNZA 4I41A 4ASEA 4L44A 4XLIA 4UWBA 4QP4A 3TKHA 3KULA 3LCTA 4X3JA 2CN8A 2YAKA 2HCKA 3QQLA 4FKPA 4GH2A 4PL5A 3GC9A 4FVQA 3PIXA 5AP4A 3OY1A 5K5XA 3VW6A 3A7IA 1OL6A 4C61A 5K4IA 3ZSIA 4QNYA 4AA5A 3TL8A 1QMZA 4FSYA 4FIFA 4TTHB 4FGBA 3GCSA 2FGIA 2DLNA 4I3ZA 3CPBA 3VS5A 3ZFXA 3R22A 5LVPA 5J87A 4BDEA 2VX0A 3AC5A 3DKCA 1WBSA 2VO7A 3EQFA 4FSRA 4FX3A 4GJ3A 4XYMB 3BYMA 2XUUA 2ZVAA 3AQVA 4JS8A 3MS9A 3FZRA 4FT3A 4WG3A 5AV2A 2B1PA 3NYNA 3ZFYA 5IA5A 3AMYA 1OUYA 3HL7A 4ASDA 5LVOA 3OT8A 5ANEA 3VUMA 3ZBXA 4L67A 2IVSA 2VN9A 4DITA 4QQTA 2CDZA 2OJIA 2HAKA 3CS9A 4F0IA 1HCKA 5C9CA 4Z16A 4XX0B 5H8GA 2FSOX 3CKXA 2XKFA 1SVEA 2UW8A 3GIDA 4NFNA 2XBAA 5AP3A 3VOTA 1NVSA 2UVYA 3AT4A 3CY3A 2V58A 2WMBA 4PL4A 4LRMA 1R78A 5CSPA 4OLIA 4HVIA 2C0IA 1OI9A 4U80A 3EB0A 3UO4A 3N6RA 4HPTE 4O81A 1OIRA 4EGJA 4NJDA 5EYKA 1YXVA 3Q4UA 2CCHA 4FKIA 2XNMA 4FKVA 4M15A 3U54A 5C8NA 3LCKA 4WHZA 4IAFA 5L2WA 3K3PA 2G2HA 2R7IA 2WGJA 4FNWA 3IW8A 4LGGA 2W99B 4MA0A 4TT7A 3IOKA 4IAKA 3QZHA 3K3IA 3N4UA 3UE4A 1T36A 1JNKA 3NIEA 3O0GA 4S30A 4QMLA 3WBLA 4DAWA 2C69A 2ITNA 1E1VA 3FMDA 4HCTA 4JXFA 3SHEA 3U55A 4FTCA 1EUDB 2YIXA 5AUZA 1Y8YA 1R0EA 1WBOA 2F57A 2PVLA 5HESA 4MK0A 4R3RA 1MQ4A 1WBNA 4ZTNA 2X7FA 4AW5A 3S0OA 3BRBA 4JNWA 2CKQA 4FUXA 4LL5A 5ANDA 5E92A 2OLSA 2FYSA 2J2IB 2XK8A 3ROCA 4JDJA 4LRKA 4R7HA 5CU3A 4V0GA 1YDTE 5JZJA 5AWMA 3F2AA 4R7BA 4LGHA 3AC2A 2ITYA 5H2UA 3D5UA 3GFWA 4O91A 3BHUA 4UZDA 3VUIA 4OBPA 3KMUA 5AJQA 3KB7A 3TXOA 2YDIA 3G6HA 1RDQE 3NGAA 3MVHA 4G3GA 3PRFA 4QYFA 5LP6F 3GC8A 5D1JA 5HE1A 3NVKI 2UW7A 4FIIA 3C1XA 3V5LA 3EQDA 3QYWA 4RLKA 4MAOA 4ERKA 4AZVA 4ZSGA 1G5SA 2Z8CA 3PXQA 5HV6A 3RPYA 3JVRA 2I0YA 4YJTA 4FTOA 1GIIA 4FTNA 3I6WA 1PMNA 2A0CX 4EQMA 4ALWA 5JFSA 3UDBA 2W70A 2OBJA 2C6DA 3VNTA 3R28A 4U6RA 5JFXA 3NEWA 3QX4A 4OTRA 2WEVA 2PU8A 5FLFA 4EK5A 3BEAA 2QODA 2PE2A 4C33A 3QL8A 4GVJA 5CANA 3G8DA 3R1NA 3C51A 4QPAA 5J9LA 3ANQA 2YZLA 1RQQA 4GCJA 3UBDA 4YHTA 3DT1A 5CQWA 3BBWA 4ZLZA 4EOSA 4RBLA 2IZSA 1KOBA 4TN6A 4JG7A 3WYYA 1REJA 2X7GA 2GNHA 2ZDUA 5B2LA 5IU2A 3MYGA 4F09A 3QD4A 2QO2A 1IR3A 1W8CA 3CSVA 2I6LA 4QPSA 5DH3A 1EH4A 2V59A 1FBNA 4PV0A 3R7UA 2C0TA 3O23A 4S31A 4DINA 1OL2A 3ZEPA 4GT4A 4X2JA 5IEVA 4GFOA 2Q0BA 4KA3A 3Q4CA 4UZHA 3CGFA 3W16A 3EN7A 3KL8A 4QRCA 4II5A 5EM7A 3MBLA 3R04A 2QR7A 4ANMA 3DBQA 4G3CA 4RPVA 4CCUA 4FR4A 1Q4LA 3IOPA 3LQ8A 4IANA 5GJDA 3PRIA 4GUEA 4IEBA 4P2KA 1Z9XA 3MFTA 2ITUA 4LV8A 4M14A 4EZ3A 2BZJA 5GJGA 4ZJVA 1ERKA 2PVMA 3DCVA 2YM5A 4YTCA 4JT3A 4FL1A 2DYLA 1OBGA 3NYVA 3QU0A 4C3FA 2YFXA 2Z7QA 4I5HA 2IG7A 3L9PA 3UC4A 4CMUA 4G31A 1PMVA 5IQEA 5ETCA 2R64A 4ONAA 3W2RA 4GKHA 2ONLC 4C62A 5CU6A 2BRNA 2KULA 1XH4A 5FEDA 3UG1A 4DCEA 4I1ZA 3UQGA 3Q6WA 2BILB 1M14A 3LCSA 4TYHB 3TKIA 3ZO2A 5KMOA 3DU8A 4I5CA 1JOWB 4ANQA 2WYOA 4WBNF 4G3FA 4GK2A 3B2WA 2W6MA 2JEDA 2XK3A 3OCSA 2XB7A 4RSSA 3E8DA 4QP1A 4MKCA 3D7TB 2HJWA 4FVRA 3KMWA 3EH9A 4L01A 2OFVA 5D7VA 4BTMA 4MCVA 4A07A 1PXPA 2X1NA 4FSTA 4S2ZA 3R6XA 4HNFA 4XCUA 3I60A 3TQTA 4ASXA 3P7CA 2XK9A 3DV3A 4U97A 5L8KA 1JDBB 3RP9A 4BCFA 3GU4A 5HTCA 4K11A 1GSAA 1OPJA 1EUCB 3CLYA 2Z7LA 3V5JA 3RPOA 3C0HA 4GU9A 4KBKA 4AOJA 4X2KA 4CKJA 5IEXA 4FFNA 5HD4A 2Q0NA 4JQ7A 5HD7A 4DG2E 3CGOA 2PMLX 4MXCA 3V8TA 4YJ2F 4ALUA 4AP7A 4KIOA 4DEEA 3F3UA 3P79A 4W4WA 3T3VA 4EWHA 3O96A 2F9GA 1CS0A 4IJ9A 4R5SA 5JZNA 5CEIA 2YITA 3CY2A 1YOLA 4IW0A 3VBQA 3VF9A 3FZSA 3JUHA 4RIYA 4A9UA 3R9HA 1UA2A 3QGYA 4ORKA 4RVTA 2WTDA 1Q24A 5L8LA 1EYZA 2CGXA 1NW1A 3LW0A 2W5BA 3E7OA 5KO1A 2C6EA 5HE2A 4J53A 4DGGA 4ZS4A 1GNGA 3SXRA 4GRBA 4RFYA 5IQCA 3M42A 5DMXA 3EQRA 4F9WA 2C00A 4N6YA 3SQQA 2VTNA 2X39A 5CASA 4E7WA 2F7ZE 5CEOA 5CENA 4HJOA 2W1IA 5EYDA 2GU8A 2VTHA 3P0MA 4YC6A 3HZTA 4C5CA 2JKKA 4HCVA 4YAKB 1OVEA 2R5TA 3F82A 2ZM4A 5IQAA 4BBMA 2YM6A 3Q4ZA 2QK4A 2Y6OA 4MXOA 4F7JA 4M69B 2FH9A 4NKSA 4XV2A 3A7HA 2SCUB 3IW7A 2Z7SA 3SRVA 5CF6A 3R5XA 1SVHA 1OB3A 3Q9XA 4FZAB 4I6FA 5ETFA 5BPFA 4NFMA 3G6GA 5DR2A 3RWQA 5BNJA 2OF4A 1OL5A 4FKRA 3ZXTA 3OHTA 4QMOA 2HZ4A 3O51A 2R3NA 3FYKX 3OUKA 2VZ6A 3EQBA 3PPJA 3DFCB 3Q52A 2CGWA 3HNGA 4Y5QA 4W8EA 3ORRA 3P1AA 4KKEA 3ZM4A 3THBA 2QOFA 4DE4A 5B2MA 1M0WA 3QCQA 2QOQA 3E5AA 3CD8A 5ETAA 3ZM9A 1PYXA 3HA6A 3EYHA 5DEWA 1KJQA 1U5RA 4X2NA 3LQ3A 4ZOLF 1DS5A 3A60A 4Z7GA 4IJPA 1ZXEA 2YDJA 4JG6A 2X4FA 4EBWA 2IW8A 5AP0A 1OIQA 2UZNA 1P4FA 3U6JA 2E9UA 5HI2A 4IVDA 3UO6A 1OM1A 4ZI7F 5HBRB 5HCYA 1KWPA 2UVXA 5IPJA 1KOAA 4KRDA 4DN5A 2J7TA 4FEVA 4R78A 4HVHA 3PY3A 3SA0A 2ZJWA 5T6KA 2I87A 5DEYA 3HRFA 5DVRA 4X0MA 4UV0A 4CV9A 4PTCA 5A4TA 4E8AA 4KD1A 4YNOA 2WMSA 3P7BA 4QYHA 1U4DA 4EH5A 5JEBA 1H1RA 2XRWA 3ZUTA 4Y8VB 3EN4A 4BDDA 3I7BA 5FM3A 4GW8A 2VQDA 3TNQB 4M13A 2F7EE 1DAWA 2OWBA 2BVAA 3PY1A 3OROA 3P9JA 3ORQA 4BVUA 2XRUA 3VQHA 3PVUA 3G33A 4DBNA 3C5UA 2X2LA 2GPWA 3OCTA 4CV8A 3D5XA 4X3FC 5E1SA 3OCGA 3CD3A 4BCHA 4TNDA 1YI3A 2WTVA 1PXLA 3OW4A 3IW4A 2FB8A 2J5FA 3F69A 5EHYA 4CD0A 3RUPA 4FV5A 2PMNX 2YJSA 4RJ5A 3K54A 3S3IA 3VUKA 1Z5MA 2HGSA 5E9EA 3QTIA 5K9IA 1Q99A 3CCNA 2C4GA 5LMKC 3ZFMA 2GHGA 4ZLOA 1YW2A 4X6RA 4IADA 5FG8A 4GK3A 1JPAA 4FT5A 4R3CA 2ZV7A 4MXYA 2QQ7A 3ZBFA 4DEDA 3D2IA 4JX3A 5I9VA 5IQGA 2WFYA 4TWCA 2OGVA 4BKJA 2BTSA 1FGKA 3RZBA 2ZOQA 5J2UF 3ACJA 1Q8UA 3RCDA 5KCVA 2JLDA 3MVMA 4ZTLA 1BKXA 3FMMA 4I4EA 4ZTQA 3RI1A 3V4ZA 2RGPA 2GNLA 3SOCA 4S34A 4N0SA 1YWNA 5AUWA 2XCLA 3NNUA 5CQUA 1W98A 2HYYA 4O6LA 3KN6A 5B7VA 3QGWA 2WMUA 5IDNA 4CGAA 1YI4A 4AZFA 4C35A 4FZ7A 2WTKB 2OZAB 4ZY4A 4FT7A 3A61A 1ZAOA 2JDOA 1OZ1A 4XP0A 4YZBA 4DYMA 4YR8A 3FHIA 1FQ1B 2W4OA 5CZIA 3WE8A 4G16A 5DRBA 1GSHA 3Q32A 4LG4A 1CTPE 2UZUE 4MQ1A 2PUIA 5HLPA 1ZARA 1OKWA 5FGKA 3BU5A 2GNJA 4AA0A 3JZIA 3PVWA 2JBOA 4P5QA 2YRWA 4ZTRA 3QTQA 5KX5F 5LVMA 4CZUA 3FV8A 3NUNA 3RPRA 3KXNA 4MXAA 5BVKA 2NUAB 4IWDA 1XKKA 4D55A 4O82A 3IK3A 3MIAA 2OZOA 3KGAA 2XH5A 3HV5A 2OIQA 3GFEA 3V6RA 2GPSA 4MX9A 3R71A 4IACA 4YBKA 5KKNB 2YZMA 4RT7A 5DYJA 3V5PA 2V7OA 5CSHA 4IB5A 1MRYA 3PXYA 3QHRA 1Y57A 5AIKA 2PVRA 3C0IA 3UZTA 4O7WA 2XF0A 5IEYA 3GOKA 3WNZA 4NM3A 3QRUA 3TJCA 1UKHA 1DV1A 3MJ2A 4DGNA 3ZSHA 2VTRA 1GZNA 2G15A 2CLQA 1ZYDA 4KWPA 2GQSA 5A6OA 3EWHA 3N8DA 4NCTC 5DLSA 5CNNA 2Z04A 5JVDF 3L8VA 4MV3A 5EYCA 1LR4A 3EIDA 2W9FB 4GIIA 4M3QA 4EQCA 4ZQIA 2R3IA 5HLWA 3TI1A 5KBQA 3RGFA 4MBIA 3LCDA 4G9CA 5IUGA 5IQHA 3AX6A 4ZLYA 2YDKA 3Q9WA 1H27A 4CT2A 3D4QA 3TDVA 3TV6A 2UZBA 2ZB1A 4JJRA 4YP8A 3BWFA 5CT7A 5LJJA 3GI3A 4IDVA 3I12A 2B9FA 3KMMA 2H8HA 1YQJA 1P14A 1OIYA 1W84A 3F6XA 3NCGA 4GSBA 3GT8A 4DFUA 1HCLA 3MFUA 3M11A 2PZ5A 4XLVA 5GNKA 3TNWA 3PVBA 2R3HA 1P5EA 2XMYA 4U9AA 4GT3A 3KCKA 2YYAA 4GU6A 4Y83A 5CT0A 1W93A 5FUTA 3MVJA 2BHHA 4FK6A 4LQMA 4O7LA 2O0UA 3IDCA 3JR1A 1GGOA 4IWQA 4FIJA 4MTAA 5ACKA 1KEEA 3OWJA 3CJGA 4IVCA 4FVPA 4N57A 2W96B 2AUHA 2QHNA 3DK3A 2PZYA 4J7BA 5FTOA 4Z55A 2DUVA 2R84A 3UNKA 4ANSA 4XV1A 5LXTF 5DA3A 2OICA 2P3GX 2QU5A 3MTFA 1FGIA 3ZO3A 5KMIA 4IZ5A 3B8QA 2GFSA 1H4LA 1WBVA 1GIHA 2XVDA 3ZO4A 5BYLA 3WARA 5A54A 4FV8A 3LPBA 1ZLTA 5CX9A 2PZIA 3OY3A 5EHLA 1JSVA 2B54A 2F2CB 5FDXA 3LXLA 4ERWA 2W5HA 3DZOA 2JITA 4Y8DA 4AF3A 3FI3A 2HWOA 3G9LX 1PJKA 3MTLA 3MY5A 1LPUA 3FPQA 4F1TA 2R7BA 2YA9A 3CQWA 3D5WA 2ZM1A 4HGTA 4GG7A 4PY1A 3OC1A 3O8PA 4WRGA 5AP6A 3TTJA 3TZ7A 1JQHA 3FLYA 2A2AA 4ACDA 3JPVA 3UMWA 4EH8A 4U44A 5HICA 3WF9A 4JIKA 4TW9A 1BXRA 1QCFA 4YJRA 4U3YA 4LOPA 1H1QA 4AN9A 3F5XA 3GQIA 2YZNA 4XG2A 2EVAA 5FXSA 2C6TA 3PSCA 3KN5A 4DGOA 4EEVA 3BLQA 3CEKA 3A8WA 4LL0A 4IVBA 4FA2A 3LJ0A 4KAOA 4DCAA 4O86A 3OD6X 3MESA 3UIUA 3TV4A 3VA7A 2PZRA 1SYKA 5EKOA 4QTDA 4L9IA 2W9ZB 5D11A 4BCNA 5I9WA 1U54A 2RIOA 2R7NA 5GIOE 3QCXA 4L7SA 4B8LA 4J97A 2BFXA 1ZOGA 4ZHQF 3O17A 3AC1A 3WF7A 5EQPA 2OSCA 3GLKA 2FPIB 5CAUA 1K3AA 2WO6A 4FL2A 4FSMA 3R8ZA 3ET7A 3KXZA 2OJJA 5A9UA 1IOVA 2C30A 5A6NA 2J0IA 1YVJA 4AACA 4XOYA 5JK3A 3QA0A 2IZUA 3DK7A 4TUYF 3QRJA 1TVOA 3SE7A 2P0CA 4BCQA 2YZAA 4YBZB 4IC7A 5CNOA 5FEEA 2CKEA 2W6PA 4FEXA 4GEOA 4WBOA 4O83A 3A4OX 5JGBA 2QKRA 1IOWA 3QUDA 5HNGA 3MWUA 3LM0A 4KKHA 4O27B 2OIBA 3Q2MA 4S33A 3EMGA 5ANIA 3JYAA 4O0TA 5LWNA 4MA5A 3NRMA 5LA6F 3KK9A 1FOTA 4TY1A 5HX8A 3HX4A 2IN6A 3FLNC 4ZZOA 5L3AA 4A06A 4A9TA 4JQ8A 1ZZLA 4ZZMA 3R8LA 1KBLA 3LFFA 3QCYA 2EB3A 4PWNA 2X4ZA 3FZTA 2W7XA 4AGUA 1IA8A 1ULZA 4DLJA 1GJOA 3JS2A 4F9CA 4USDA 3IGOA 5KMJA 4EH9A 2PYWA 4FICA 2YIYA 1JLLB 2CCIA 3V3VA 2BRGA 3BQCA 3BYOA 5IA1A 3GCQA 2ACXA 4O2ZA 4J71A 3NW7A 4EK6A 3LHJA 3A2CA 2VWZA 2YAAA 4AGDA 4FI1A 4RWKA 5M56A 2IP4A 3RM7A 2DS1A 4O84A 4AT5A 3FLWA 3V6SA 4OBOA 2R2PA 3CIKA 4FKLA 4J99A 3UGCA 4YJQA 3WIGA 3DDQA 4C2VA 1PMUA 3ZS5A 2C5NA 4L46A 5DIAA 3LWBA 1J3HA 3GXLA 1LUFA 1F5QA 4Q5EA 3UNJA 2BIKB 4L8MA 3SW4A 3E62A 4CMTA 2JIVA 3QF9A 4DFNA 2I8CA 4MV1A 1CMKE 2J50A 5BVEA 4EZ7A 3L8SA 2FO0A 3HVCA 5JSMA 5BVWA 5LOHA 3IDPA 4BCIA 5C1QB 1YHWA 2JC6A 3A7GA 3P7AA 4FIEA 4IX4A 4RX7A 3C0GA 5BVNA 3C9WA 4FFMA 2PVFA 4OTQA 1PHKA 3ORNA 4YU2A 1YXSA 4C58A 1XO2B 4O0SA 4GYGA 2XA4A 2C3LA 3H9FA 2W06A 2VNWA 3NAYA 4IIRA 2WOUA 4ACHA 2ZDQA 3FMHA 3PJCA 3T9TA 3UOKA 3U8WA 1WFCA 3KC3A 2JIUA 1NY3A 3PP1A 1BL6A 3VUDA 2ITOA 2PHKA 2WU6A 3OMVA 2UW5A 3FSKA 3KRRA 4P4CA 2BRBA 2PY3A 5DOSA 1SMHA 5FRIA 4RJ6A 3AOXA 3UJGA 3BKBA 5TF9A 4CXAA 2X2KA 2HW6A 3HEGA 3I0OA 3Q3BA 2YHVA 3QFVA 2I0VA 4P7EA 4U43A 3HKOA 4UYAA 1AUVA 4DTBA 4JDKA 4FTAA 3NNXA 2XIZA 3OZ6A 2A1AB 3H9OA 4FIGA 4BDAA 5H8BA 4HYHA 3VO3A 1AUXA 3HV7A 1JLUE 3O71A 5BPHA 4F65A 4G3DA 2ZAZA 4IX3A 1SZMA 4E4XA 3PTGA 4L68A 3EFKA 3QC4A 5LARA 3O2MA 5HO7A 4JX7A 1GY3A 4IM0A 3NNWA 3SKCA 3LE6A 1Q3WA 1PXMA 4EOQA 2PBZA 4ITJA 2X8DA 2LAVA 2Q83A 4I23A 4F1MA 2WTWA 2UVZA 3UYSA 3QTZA 3ORTA 2HZ0A 2CZGA 3L8PA 4QQ5A 4IZ7A 2WAJA 4ZTMA 5D8DA 2ZV8A 4DFZE 1H25A 4EKKA 3Q4TA 4K8AA 4ITHA 1Q62A 3I81A 4RWIA 2CMWA 3FJQE 4JBVA 4R77A 4FTRA 4DTAA 4C3RA 3MPAA 1B6RA 5FP5A 4BTJA 1G3NA 3ENMA 4PDYA 4HYSA 4CTCA 5HO8A 5LCJA 1J1BA 4X7QA 3V51A 3W18A 2Z7RA 3UOLA 1CKIA 5HIEA 3OTUA 3MA3A 4RC2A 3MIYA 3PVGA 3ZYAA 1YI6A 2XM9A 2HENA 4R5YA 4FTIA 5JRQA 2QI8A 3UVRA 4JR7A 1KJ8A 2VTIA 3MDYA 1J7UA 4H3BA 4ZOGA 4I4FA 5KBRA 3DBCA 2W4KA 3LMHA 5AAEA 3PDTA 2ITWA 4WNMA 5ANKA 3COKA 5GHVA 1XQZA 3GU5A 3ZOSA 2GNGA 5K4JA 3ELJA 4XHKB 3W2QA 4E5AX 3MPMA 2UW9A 3OBJA 4ZSEA 2PUUA 5DNRA 3IPHA 4MAMA 4ZTSA 4QTCA 4YURA 3EZVA 4RGJA 5FXQA 2UZLA 2XKCA 3FKNA 3I7CA 3K3JA 3WI6A 2R7KA 2GS2A 3RFCA 3VPBA 2QOKA 4Z9LA 3ANRA 4O2BF 3DB6A 3MN3A 2W1FA 3EFJA 3FC1X 3HMIA 4BGGA 5F9EA 4A9RA 3CTHA 3HRCA 5CZHA 3R73A 4ZSLA 3RHKA 3OBGA 4MBJA 3ORIA 1S9IA 3LJ2A 4FV4A 4HVGA 1PXKA 3W2SA 3R1YA 4KBAA 5EW3A 4BY9E 2QOCA 1ZY5A 4LUDA 3F61A 4C3PA 3KF4A 2Y7JA 5FTQA 1PXJA 4GG5A 3FXWA 3FMEA 3O8TA 2DIKA 4QMMA 4BCOA 5IF1A 4RIWB 4GK4A 3NZ0A 3WZUA 2CHLA 2JDRA 2C6OA 3DKFA 3K5UA 2WKMA 3OXTA 1DAYA 2FUMA 3TIZA 1JBPE 2B9HA 2UZOA 2RFDA 3DA6A 5KE0A 4F1OA 3KXGA 1OKVA 4TYHA 1CM8A 3UP7A 4JDIA 5A4LA 4E5BA 4FYNA 4O0YA 4EI4A 3F5GA 5CTPA 3LAUA 1M6VA 3VBVA 4BHNA 3KXMA 2BALA 3QCSA 2PE1A 2ZB0A 2WQEA 5E8SA 3D7TA 3RTPA 3RINA 5JKGA 1WCCA 4GVAA 3QTRA 3F3TA 4D4RA 5HLNA 5A3XA 3KAKA 4UXLA 2YABA 2IVVA 3C4CA 3PIZA 5AM6A 4O0VA 3LFCA 4XBRA 4YHFA 1M17A 4RC3A 2HZNA 2QR8A 3FQSA 4U8ZA 5AM7A 3VWAA 5LMBA 2VGOA 3G8CA 1NA7A 5AP7A 1ZYSA 5AEPA 1I7LA 5A4EA 1OGUA 2GTMA 2PVJA 5J1VA 5ANJA 3TV7A 3Q04A 5BYZA 1J91A 5IQFA 3G0FA 4XV9A 2WHBA 4FG7A 3GB2A 2XEYA 3BHYA 5IG1A 2HELA 4U41A 5E90A 1E9HA 3OF0A 3Q5IA 4U7ZA 3NNVA 4FKUA 5AAFA 2YIWA 3DJ5A 3BV2A 3N9XA 3E63A 4C5AA 1I09A 1FVTA 4NZWB 5AUVA 1Y91A 4YLKA 1YKRA 3GCVA 3KRWA 3ERKA 4DGMA 3DAJA 5B2KA 1PMEA 3R1SA 3VF8A 4PDPA 4IHJF 2B55A 3PWYA 5DG5A 3LMIA 4EH6A 4RX8A 4W4VA 3QYZA 5CAEB 4E26A 4EWQA 5D10A 5IISA 4J95A 2PVYA 1YXTA 2W05A 2GS7A 3LCOA 4K18A 2GMXA 2R3LA 2BIYA 3OUZA 4WSYA
chains in the Genus database with same CATH superfamily
5LQFA 3GDEA 2YM4A 3SC1A 4G17A 3CBLA 3ZC6A 4DTKA 4LYNA 2FVDA 1DV2A 4BJJB 3AD5A 3K2LA 1EKPA 4XX9A 4FV2A 5KZ0A 3DFAA 4C0TA 3DGKA 3KK8A 1U5QA 2HXLA 3VBXA 2XIXA 3CR0A 3ORMA 3FWQA 4FC0A 1H0WA 5BWWA 3TINA 3W0PA 2C3IB 4RA4A 3EN9A 2W6QA 3BACA 2QG5A 2Y4IC 4RCNA 3GP0A 3VMMA 2C47A 1XMLA 3MV5A 4PTEA 1J1CA 1FVVA 3V8WA 2FA2A 4ACMA 4FKGA 2HWPA 1A06A 4Y85A 4CLIA 2NU8B 5DBXA 4A4OA 2ESMA 3HYHA 5IQBA 4ASZA 2A19B 2XM8A 4UXQA 1QPEA 1UNLA 5HE0A 4BDIA 4DT8A 4EH7A 5M09A 4AW1A 2IW9A 4TKSA 4FG9A 5KX8A 3DAAA 3E8NA 3FMLA 2F4JA 1F0QA 3HV3A 4XNEA 4O4IF 1CKJA 3MY1A 4UYNA 4O7RA 4CNHA 2V55A 5BYBA 2X2MA 5JMSA 4FTJA 4U0IA 3NVMB 3U9TA 3HECA 2WQNA 5GIPE 5BUIA 4FTUA 4C34A 5D1PA 3P23A 2PUPA 2O63A 2OFUA 3F5PA 4IB0A 2GHMA 2P4IA 4HGEA 1Q61A 4I24A 3QXPA 4MD7E 2H96A 4IAYA 3U4WA 4LRJA 2R0IA 3HA8A 3KAJA 2JIIA 3A62A 1CKNA 5DHJA 4DEGA 2ITZA 2XJ0A 2BDJA 3LP8A 1OKYA 4MVFA 1UVRA 4A7CA 1VEBA 4PL3A 2OJ9A 3VW8A 3QTWA 4K2RA 4YZCA 2CSNA 4ANLA 4FNXA 4WOVA 3RAIA 5FDPA 3P5KA 3I6UA 4D58A 2QU6A 4FG8A 1MP8A 3MY0A 3GU8A 4A4XA 2WIHA 4M9UA 3VS0A 1UU8A 4EOPA 3F7ZA 3NUYA 3A7JA 5I47A 4ME6A 4IAAA 2H6DA 3PWDA 3H0ZA 2BPMA 5KKRC 4PMMA 4L1KA 4R7IA 4JBQA 4DLKA 4H05A 4DDGA 3QWUA 5LXMA 2KTYA 4AFJA 4FV6A 4EOJA 5I9ZA 5DAAA 4L43A 3TNHA 3ODZX 3GC0A 5BVFA 3QZFA 2I1MA 3CTQA 4O0WA 1IAJA 3R01A 2W4JA 4HYUA 4LMUA 4GFGA 2IPXA 1TQMA 4R6VA 1M2PA 2RKUA 3U9SA 2QOBA 4UEUA 3IO7A 2YW2A 1ST4A 2G9XA 3TCPA 3VRZA 3W5OA 1WVXA 2PE0A 4I5PA 2W17A 4J8NA 4CFWA 3FZPA 3ORXA 1FVIA 3HRBA 4J96A 2YRXA 3HMMA 4FNZA 3CTJA 2GLTA 4YO4A 3EQHA 1APME 4USEA 4M7IA 3NUXA 2HK5A 5CALA 3C4FA 4L3JA 3DTFA 4K33A 2R3FA 5E8ZA 3WYXA 3HDMA 3DQXA 5J8IA 2I40A 3SG8A 2XNEA 1WMKA 3BE9A 2UZEA 3P78A 4F9YA 2DQ7X 4G5PA 1REKA 3AKJA 4AX8A 3BE2A 3A7FA 3ZMMA 3F5UA 3ZU7A 5TO8A 1Z57A 4N4SA 5DT0A 4NW5A 2PPQA 3R7VA 4FV1A 4XG7A 3LLAA 3EL8A 2G01A 2GFCA 4EYJA 1AQ1A 2WTIA 4DC2A 3COHA 4X2FA 1LEZA 3C13A 1WBWA 4XEYA 3S00A 3WILA 3D9VA 2HIWA 4Y95A 2WOTA 4I22A 4O7YA 3IONA 4FOBA 3II5A 3UDSA 4D9UA 3HB9A 4KSQA 2BUJA 5GONF 3HMOA 4M84A 2WQOA 3TMOA 4BTFA 3V4SA 1C30A 4FV9A 3AT3A 4FZDB 4EGQA 2B7AA 2R3JA 4D0XA 4D2RA 1CSNA 3LJ1A 4UFZA 3VAPA 3R83A 4MWIA 3AG9A 1IAHA 4O0RA 4BR3A 3F3VA 3EFWA 5CSWA 3G9NA 2IWIA 3V5QA 4CFNA 1PW2A 2ZDTA 2UW4A 2ZDHA 3GUBA 3U4UA 3R7IA 1AGWA 3SGCA 3R00A 5IQDA 3E64A 1JKTA 3RALA 2X9FA 3BEGA 1VLRA 4CKRA 4RRVA 3F9NA 3JY0A 3W1FA 5HU3A 1H00A 4W4YA 2XK7A 3KXXA 5M07A 2ITXA 4FV0A 1OBDA 3SLSA 3ZCLA 2YCQA 4D5HA 5KHXA 4F6WA 4ZK5A 4DEAA 2BR1A 5M06A 2P2IA 4J8MA 3ZDIA 3LOKA 4MV6A 4MEDA 4WRSA 5L6PA 2P2HA 5E7RA 5I5YA 1OL7A 3UVQA 4V04A 2B9JA 2VV9A 3KXHA 4BCKA 4LV5A 4YSJA 4PTGA 5D1OA 2VTJA 3WWIA 2E2BA 3VRYA 4GKIA 4IE9A 3TEKA 4HZSA 4Q5HA 4UWCA 5JGDA 3ZLWA 5CEPA 1OUKA 4KIPA 5E1EA 4TYEA 2XYNA 3VBYA 4AZSA 4QMUA 2P55A 3L1SA 4A4LA 2NU6B 4F08A 2H34A 4G6OA 1AD5A 3R7EA 1KJJA 4PF4A 3SXFA 2BRHA 3UMXA 3T9EA 1K9AA 4FSWA 4IWYA 4EG0A 2WMWA 1U46A 3LMGA 3W8QA 3D15A 5J1WA 4O2AF 2IZRA 2A27A 5IYZF 4F9AA 2R3RA 2PULA 2UZVA 4C4IA 3JY9A 3QALE 4TWOA 3NLBA 3IDBA 4EJNA 1IEPA 3LM5A 3NUPA 4NUSA 4QMNA 3DPKA 4UN0C 2GNIA 2WMRA 4YZMA 3R0TA 4EUUA 3OG7A 2C1AA 2C5OA 5HNBA 2YWPA 2VPQA 3FMNA 4F7SA 4BGQA 3BA8A 4XH6A 5AV0A 4CRSA 4EONA 4EZ5A 3VBWA 3TT0A 1J7IA 3ITZA 4IQ6A 3OWLA 1O6KA 3ZDUA 4EBVA 4C4GA 4FV7A 2BDFA 2VO6A 4GYIA 5EOLA 5K3YA 2V0DA 1MRVA 4IFCA 1LEWA 4MQ2A 3ZZEA 2QOOA 2XARA 3W2CA 3E3BX 3I5NA 4NTTA 4QNAA 1H8FA 3DKGA 4WA9A 3ROYA 1I44A 3GGFA 4I6QA 4RIXB 2C5VA 3S4QA 4W4XA 2YACA 5IH6A 4JXUA 5HIDA 1MUOA 2G1TA 3GEQA 3QWKA 4DHIB 3B8RA 2VWXA 3NMUF 5C8YF 1KE9A 3FLQA 4H1MA 4WKQA 2OO8X 3KEXA 5ACBC 3PY0A 4M12A 3KRJA 4F0FA 2HOGA 2V5AA 5E8UA 2VO3A 3FUPA 4GL9A 5JH7F 3FKOA 1IG1A 4NYEA 5FP6A 3HLLA 5HBHA 4L00A 4YMJA 3JZFA 2Q2UA 4QYGA 4H1JA 5FR9A 4AN2A 4BDCA 1BL7A 4GUBA 1PXIA 5CR5A 2ZV2A 5HVYA 2CGVA 2XP2A 2R3GA 1OECA 4DF3A 5CAOA 3DJ7A 3TM0A 2YWVA 5L8JA 4K0YA 1K2PA 3H30A 3E8CA 2WQMA 5I0BA 3KRXA 1RW8A 3GJXB 5CSVA 4CSVA 2COGA 3PFQA 2WPAA 1ATPE 3PJ8A 4GIHA 4RMZA 4IFGA 4YZNA 3BHHA 1EZ1A 4O0XA 4DH7A 5ANGA 3UP2A 5JGAA 5CAPA 3LKMA 4RLLA 3HUBA 4C38A 3EQIA 3OS3A 2JKOA 4JRVA 3DAEA 3HDNA 5L6WL 4I50F 2UZDA 5DT3A 2UW0A 5D41A 3SD0A 2RFNA 3GVUA 4BN1A 3BV3A 3QQHA 2ITVA 3MWEA 4AT4A 2IJMA 4JAIA 1X9NA 3VULA 4CZTA 3QA8A 1M0TA 4PDOA 4YB8B 5A14A 2R3QA 4F4PA 5M51A 4AGWA 3T8OA 5DFPA 1GZOA 2QLUA 2X8EA 4FKJA 4ZJIA 2QLQA 2BAJA 1TA8A 2VAGA 3PLSA 4X21A 3AD4A 1A9XA 2WB8A 3RVGA 2X6EA 5C1PA 1Y6AA 1YDRE 2E9NA 1OPLA 5BWVA 4GS6A 3ATTA 3V01A 5I9XA 2HZIA 3SX9A 4TZRA 3TYKA 2ITTA 4CMOA 3NX8A 1WBPA 3EN6A 3SV0A 5CY3A 2XKEA 3NDMA 2EXMA 5CEQA 5CS6A 5I4NA 2VTOA 3QFFA 4PQNA 2FSLX 3VBTA 3G90X 5M57A 4P90A 5J95A 3LFAA 3MB7A 1KT8A 2XIRA 4DGLC 2XCHA 3H9RA 3ZLXA 4AQCA 3KALA 3FL4A 3UZPA 1IYEA 4C59A 1VZOA 4IVAA 5C27A 4E4NA 4IM3A 3U6HA 4RJ7A 3R8UA 2J9MA 4ZJJA 5T3QA 4FZ6A 3FL5A 4DH8A 4DH1A 4M0ZA 1GZKA 3NSZA 4I6HA 3BIZA 4DH3A 4F6SA 2PK9A 4DFBA 3LLTA 3ZC5A 2OK1A 1YHVA 1I1MA 2W1HA 4ENXA 1PXNA 4ARKA 4MUQA 4KS7A 3CSWA 5CXHA 4I6BA 3T9BA 4BCGA 1S68A 3R02A 4F64A 3MH2A 2DWBA 4ZMEA 2H9VA 2XKDA 2ZYBA 5IH4A 4EOIA 4EHGA 3SVVA 1B6SA 1TQIA 4FNYA 1H1SA 3QD0A 4KIQA 3IW5A 2YS7A 2OXYA 3LFDA 3ODYX 5FM2A 4I21A 4DA5A 1SM2A 2WMVA 1Q8TA 3QTXA 4FKTA 4U42A 4PUZA 3PJ1A 2BRMA 3NUAA 3UFXB 3HV4A 4O7VA 1Q41A 2QOIA 4AOTA 4BYJA 2J6MA 4BZDA 1UC8A 3EQCA 3ZHPC 3AD6A 3QX2A 1XJDA 3DK6A 4CKBA 3G5DA 4OW8A 1BLXA 4Z3VA 3QQGA 5L2SA 3HP2A 5AUUA 1H24A 2OXXA 2UUEA 4OTWA 4JR3A 3VJOA 3HV6A 4NM5A 3UQCA 2COJA 4GJ2A 2GHLA 4FTMA 2OXDA 4FZFB 4IHPA 1W82A 4EQUA 4LOOA 4EH3A 3Q2OA 4BF2A 5BUJA 3C4WA 3FLSA 3PXZA 4FEWA 3ETJA 4NL0A 4BCMA 4R3PA 4RG0A 3HMPA 4YTFA 3GU7A 4H3QA 2QNJA 3OOGA 3LXKA 4ALVA 3PZEA 4L42A 3U9CA 3E87A 3GCPA 4MH7A 5BUEA 3FQHA 5IMEA 5ANOA 4G5JA 4I92A 3MH3A 4NSTA 2O8YA 4BGHA 3NAXA 5EZYF 4AZWA 4ZY5A 4YBJA 3VQUA 2VTQA 4EK4A 4O7NA 4YZ9A 4I0RA 3FMKA 3Q1KA 5HX6A 3OWPA 4U3ZA 1M2QA 3KU2A 3RWPA 3PLAE 3V04A 3O7LB 3G15A 4IWXA 5EM6A 1PYEA 3W0RA 1URWA 3MA6A 4FIHA 3BL9A 4WG4A 3VS2A 3ZUVA 1BNCA 3WOWA 3TNIA 2YCFA 4DT9A 4GMYA 3DBFA 4JQEA 2DWCA 3UVPA 3VS6A 3RKBA 4HPUE 4O7SA 4EL9A 5JVLA 5IMXA 4FFRA 3FHRA 5HZNA 2FPGB 1H0VA 3PZHA 2HGWA 4DG3E 1YOJA 4JBOA 4X3FB 3V8SA 2PVNA 5HU9A 3R5HA 1UNHA 1VYZA 1ZZ2A 3F2NA 2O5KA 3NCZA 3BGPA 4WUNA 1E4EB 3JRXA 3D94A 3W2PA 1KE5A 2J0JA 4KUJA 3ALNA 4XBUA 4F9BA 5IA4A 3QBNA 3W33A 5FEQA 2WMXA 3H0YA 4YTHA 1PXOA 2PMOX 2Z2WA 5HGIA 5HORA 1WAKA 1WVWA 4XV3A 3ZTXA 4C4HA 5C4KA 2XEZA 3LXNA 3PG1A 1JWHA 4IMYA 1WVYA 3OW3A 2W5AA 2W71A 3TN8A 3DXQA 3MPTA 3TZ8A 2PTKA 3CP9A 3FI4A 5A46A 4C7TA 1PF8A 4NKAA 3BQRA 3N4VA 4EJ7A 1DM2A 3AMBA 1GZ8A 2BHEA 2WU7A 5AUTA 5CEKA 3AW8A 3TACA 3EYGA 2XBJA 4KINA 1FPUA 4AWIA 5CAVA 5AP1A 3S1HA 4ZMFA 3Q60A 2HXQA 3EKNA 4CFFA 2NO3A 4YTIA 1Y6BA 2ITQA 3BU3A 3GCUA 3WF5A 4D1ZA 5EG3A 1CQJB 4FSNA 2XNGA 1IA9A 1ZY4A 2XAOA 2RFSA 3W2OA 4TL0A 2ETRA 3H3CA 4KRCA 1WZYA 2YCSA 4BDJA 2ERZE 4QP8A 1QPCA 3BBTB 4FODA 4EK3A 2HHFA 3UO5A 2BCJA 3ULZA 3UOJA 3V5TA 3MFRA 3ZRMA 3NUSA 4IX6A 4NTSA 3DNEA 4O22A 3RM6A 2CPKE 4J1RA 1WR2A 2XYUA 3W8LA 4EHEA 2CNUA 4G3EA 1DAAA 3D5VA 3DAKA 4M67A 2WQBA 5H9BA 4CFXA 4E20A 3KQ7A 5EW9A 3SW7A 4RVKA 1SCUB 1BI7A 3FY2A 3TKUA 4A9SA 4B8MA 1XDNA 3NFFB 4QMSA 4U81A 3PA3A 4CQEA 5L2IA 1BYGA 5AX3A 4C36A 2BROA 2VX1A 4JAJA 4QTAA 5AP5A 3UZRA 1H1WA 4AA4A 2YL2A 4XZ3B 4PMTA 5DGIA 4RJ3A 2XJ2A 2QURA 3BGZA 4G1WA 3RHXA 2R86A 4NWMA 2X7OA 4TRLA 4TYGA 2PVKA 4TWNA 5L6OA 3PE1A 2ZMDA 4XS2A 3Q53A 5E91A 5DGZA 4AGCA 4FFLA 5E8XA 5BWXA 2HY0A 4FSQA 4WIHA 5J5SA 5BYYA 4AXFA 2IVTA 1JKJB 1SNXA 2BZHB 1VBGA 3BYUA 4RIWA 5HG8A 4FUYA 3ATSA 1H28A 2E9PA 4B4LA 5A4CA 3ORKA 5M4CA 5CF8A 1UU3A 2WELA 5AV4A 1VJYA 2OU7A 2XK6A 3D2KA 5JN2A 5EKNA 1STCE 4U45A 2NYAA 2JAVA 3R8VA 3QD2B 5BMVF 5I5ZA 1CDKA 2DZDA 4TM5A 1A0GA 5A4QA 5EI6A 1KE7A 4XJ0A 4ZSJA 4B9DA 4EHZA 4DIMA 4QMZA 1OL1A 1KV2A 3OCBA 4APPA 4I4TF 2GCDA 3UG2A 4Q9SA 1OPKA 3TIGA 5IZFA 1R0PA 3POOA 3IW6A 2JAMA 4BYIA 4BI2A 5CM0A 4YPDA 2R4BA 4HR7A 4D4VA 3OOMA 3PSDA 4UB7A 5HVJA 1SVGA 3RV4A 3FMJA 5AA8A 2GPHA 3I1AA 3ZZWA 5M4FA 2YEXA 4HQ6A 3RPVA 2YM3A 4QO9A 4FL3A 2XD4A 5DGHA 2QO9A 3CQUA 5EQYA 3SDJA 5CA1F 2EJ3A 3W0OA 2Y4RA 1FVRA 4MF1A 4MWHA 4MD9E 4TYJA 5EQEA 4BZNA 4PMSA 2CFMA 2R82A 2DABA 4DEBA 1FMKA 2Q2TA 2QONA 1FMOE 4BIBA 4UCOA 1W83A 4N6ZA 1BI8A 3QHWA 4PMPA 2J4ZA 4P5ZA 5HHWA 1B6CB 5M55A 4EOOA 5L2TA 3IKAA 3PXKA 2EXCX 2OWOA 4YLJA 3BGQA 4RQKA 1ZOHA 2R3OA 3T9IA 5BPYA 4WO5A 2R87A 2VO0A 1OITA 3ETAA 2EUFB 2B9IA 3PXFA 2VTSA 3I79A 5HKMA 3EL7A 5GINE 1ND4A 1KJIA 5J9ZA 5HCZA 3BWJA 1VKZA 4DHJA 3K5HA 3UQFA 1KUTA 4O21A 3GU6A 4UWYA 4EC9A 3UPZA 1ZYLA 4IB1A 2VWWA 4D28A 3PJ2A 5JT2A 4HVSA 2BZIB 4KSPA 4YPSA 2QVSE 4QMXA 3WZJA 2WXVA 4BJJA 2WTJA 3OUUA 5FBOA 4XOZA 2HY81 2YIQA 4YJOA 3E88A 2PUNA 4QOXA 4IZYA 4FTLA 2W1ZA 1ZYCA 2WTCA 4XG8A 4CC6A 4JDHA 3PG3A 5E8YA 4JLCA 5CAQA 2RG6A 3LZBA 3FQEA 3L9LA 2F49A 4H39A 3WIKA 1P2AA 2YISA 3RCJA 4AW0A 5IA2A 1YRPA 4LH7A 4HN2A 5AIRA 5AMNA 2JDSA 5LMAA 3S2PA 2GSFA 2G2FA 3QUEA 1XH8A 2W6ZA 4O38A 5FNVF 1CQIB 3AKLA 3MJ1A 3RK9A 3TNPC 1X8BA 1FINA 2R0UA 5BX0A 4L6QA 4UALA 2J0MB 5DPVA 3DBDA 1XH9A 1H01A 2ERKA 1UU9A 4YSMA 3NYXA 4U5JA 2AYPA 5J7HA 5JQ8A 4TV8F 4PRJA 4MNEB 2VTLA 1MRUA 5IA0A 5CVFA 3BU6A 3PP0A 3KA0A 1OMWA 4CKCA 1BX6A 5AUYA 5IH5A 4FFPA 3EHAA 3R63A 4NM0A 1Q8WA 3AMAA 3KVWA 4TV9F 3A4PA 4AG8A 3LQ5A 1PY5A 3UIBA 4H36A 4LFIA 4UUGA 4XYFA 3ZO1A 3WO0A 3KULB 5FQDC 5KZIA 3Q2JA 3ORZA 4RZVA 3BYVA 5DRDA 3KY2A 3VS1A 3BA9A 4I55F 2X9EA 4BDHA 1TKIA 3BL7A 4CKIA 3DZQA 1BUHA 1UWHA 4IC8A 4OT5A 2FPPB 5CU4A 4BICA 5K2MA 4HNUA 3RAHA 3FE3A 4FTQA 1Q97A 5H80A 4WHXA 3FZ1A 5DR6A 4QYYA 2C68A 3RNIA 4TYIA 5JQ5A 3FYJX 3O8UA 4QMQA 3W55A 2HW7A 1UKIA 4A9YA 2C6MA 4NW6A 3EOCA 4RQVA 4G2FA 4FBXA 2IZTA 4L52A 4M0JA 3BAAA 2BAQA 2OW3A 4L7FA 1EKFA 4FU0A 1W0XC 1W96A 1G8AA 4FTTA 5EI2A 3NR9A 1S9JA 4Q2AA 2WMAA 4RWJA 3HP5A 2Y6MA 3TZMA 2J5EA 5CE8A 3PFFA 1O9UA 2F2UA 2SRCA 1V0OA 4U40A 5CWZA 2JBPA 4RFZA 4YJNA 1XH6A 5BMMA 4AS0A 2VRXA 2C5YA 2FB9A 4USFA 2A4LA 4W8DA 4XG3A 4YC8A 4G9RA 1H26A 2XIKA 3UTOA 4E73A 5DE2A 4MD8E 1LP4A 3E92A 4AU8A 4BIDA 3D7ZA 5IUHA 5GJFA 1QL6A 1R3CA 4EYMA 2V5QA 4ZIMA 3ALOA 5IDPA 2RF9A 3KREA 2WTKC 3R8PA 4TVIA 5I9YA 4OTIA 3HGKA 3AC3A 2OLCA 2VTMA 3ORPA 4QMTA 5BMSA 3GENA 3IG7A 2ITPA 3QQJA 3LFNA 3T9CA 4WNPA 3QRTA 1R39A 3CXWA 4J98A 2VTTA 5IA3A 5EDRA 4FFOA 3PPZA 2WD1A 3D0EA 4JRNA 2PMIA 4YJSA 2V22A 4AXAA 4PBCA 4B99A 2BKZA 3C4EA 3F88A 2ZV9A 4H58A 3BX5A 2VR1A 4BDGA 3SXSA 4AZEA 5TKDA 4FMQA 4S32A 3K5VA 4V0GB 5F94A 4PNKA 3E7VA 4AAYA 2VUGA 1KSWA 3AXWA 4RX5A 2QC6A 3BELA 3TUBA 3DLZA 3DXNA 4C37A 1XR1A 2W1GA 3OXIA 4TPTA 3CPCA 2LGCA 2VUWA 1JKLA 2OIDA 2UW6A 2UZTA 3G2FA 4FOCA 3HUCA 4RJ8A 4KB8A 4Y46A 4PNIA 4CFVA 4HZRA 3QAME 1CKPA 3L9MA 3MSSA 1JDEA 2R3PA 5DN3A 3VHKA 4FYOA 5E8VA 3MB6A 1PX2A 1QPDA 2YM8A 1NVQA 4E6QA 1KC7A 4YJPA 4R1VA 5BQ0A 1U59A 4QYEA 3FBVA 3LFEA 1ZRZA 3VJNA 3F66A 1PRYA 5EFQA 2AC5A 5KUPA 1YWVA 2C6IA 4E6CA 4M68A 2COIA 4JIAA 5LVLA 3E93A 3LFQA 4CRLA 5G1XA 3WO1A 2QD9A 5AV1A 5C01A 5CVHA 4CC5A 2O64A 3BLHA 4QQCA 5D7AA 3AC8A 3DDPA 2X8IA 2XK4A 4PP9A 3DBEA 4ZP5A 2FSTX 4CG8A 2OI4X 1B39A 4RC4A 3TW6A 2JDTA 4E1ZA 2Z60A 3PUFC 3ETHA 2YCRA 3CQEA 3PE2A 4JOAA 4QDVA 4F0GA 2B4SB 2J9GA 4UY9A 3W1BA 2XNOA 3NYOA 1SNUA 1Q3DA 4KBCA 4I93A 3BHVA 1C3OA 5EK7A 4K77A 2I7QA 3AC4A 3DY7A 4IZAA 3BLAA 3QTUA 1JKKA 4Y73A 4YZDA 4DH5A 5JH6A 4IZOA 3G0EA 4WUAA 5J2TF 2R85A 3QZGA 1GSOA 4HGSA 4YJUA 3PSBA 4IH8A 3ZONA 2FSMX 2YS6A 1ZMWA 4NIFB 2YJRA 5K5NA 1QPJA 3VHEA 1KV1A 3R21A 2J0LA 3ZLYA 4BC6A 4DG0E 4XRLA 4UX9A 3BYSA 3L9NA 5JQWA 5D12A 5KMMA 1ZOEA 2X6DA 2OH0E 3TIIA 5AV3A 4QP9A 3OUNB 3OVVA 4DLIA 4K9YA 3NWWA 3M1SA 3T54A 1A48A 4HW7A 5LYJF 4ITIA 2NNWB 1WBTA 5F1ZA 1UWJA 4BCPA 4XP3A 2JDVA 3DF7A 5CF4A 3H10A 3GQLA 4ZZNA 2OZAA 1KE8A 4OUCA 4ACCA 2X5RA 4BZOA 4RIXA 2JKQA 5FBNC 5ITAA 2CNQA 3MFSA 4QT1A 3AGMA 3NFGB 4MBLA 1KE6A 3GOPA 2YIRA 3OTVA 4I6LA 5E8WA 4XG6A 4DFLA 1T46A 3DXPA 3VC4A 4CTBA 5BVDA 4IAIA 4RFMA 4I20A 4ACGA 4OTHA 2J0KA 3WZDA 3DNDA 2PZPA 4FK3A 4YNEA 3BG5A 4JG8A 4EOLA 2BMCA 2ODTX 4O96A 4B0GA 5CYIA 4MXZA 4RA5A 3FDNA 3TDWA 5LWMA 4GV1A 1CKMA 3IECA 2ONLA 3U51A 4F6UA 1YXUA 4LUEA 4QP6A 4E4TA 4BI0A 3R9DA 3E3PA 4L53A 4F7NA 5HIBA 3BHTA 4FEUA 2W1DA 3MH0A 2QF7A 5DWRA 2UV2A 5BV3A 3C7QA 5LOVF 3T9DA 4CMDA 3MJFA 4AUAA 3COIA 4RWLA 5TT7A 3PPKA 3OEFX 5LVNA 3W10A 2F7XE 3HAMA 3QQKA 2VWYA 2XNPA 3BI6A 5T68A 4NH1A 3W0QA 3POZA 2ETMA 3PYYA 5FXRA 2E9VA 1ZMUA 5CLPA 1W7HA 4RVLA 4XMOA 4KS8A 4K6ZA 5G6VA 4G6NA 1IASA 4TNBA 4KNBA 3COMA 4B6LA 4IDTA 4C2WA 1O6YA