3W1BA

Crystal structure of human dna ligase iv-artemis complex (mercury derivative)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
600
structure length
589
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords DNA ligase 4
total genus 178
structure length 589
sequence length 600
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1bA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1bA02
1LYLA 3HOXH 2JK8A 4L5QA 2GVAA 1EIFA 2Z6KA 5M3FG 4DV5Q 2R7DA 1E24A 1S40A 4BXXG 4DR5L 3I7FA 2B29A 2QGQA 2KCTA 3HOXG 1QVGA 4B3ML 1PVOA 2UXBQ 1XNRQ 2K4KA 5IYDG 2UUAQ 1X6OA 1LTLA 4PZ7A 4UP9A 2UUAL 1UEBA 3RZDH 2NVQH 4UPAA 1K73C 1HJPA 2JQOA 1K8AC 1I94L 4CC5A 4TVAB 4JI1L 1Z47A 2F4VQ 4JI4Q 3W1GA 4EQ5A 2PQAB 4KI0A 3EBEA 4X65L 3K7AH 4IJHA 3CCUA 1IBKQ 3AFPA 1IBLL 4HJ9A 4JI3Q 2ZJQA 3RNUA 1VQFA 2DUDA 4B3SL 2MQHA 3CQZH 1KRSA 4GS3A 2ALYB 1TWFH 5C3EH 2HT1A 4X66Q 2UXDQ 4WJ4A 2B63H 4DV0L 3M4OH 3GDEA 1M1KC 4JI0L 4B3RL 1N32Q 3PIPA 3ULJA 1J5EQ 1QUQB 1MJEA 2FXQA 3G48A 1HR0Q 4B3RQ 1G6PA 1Q8KA 1MJCA 3DLLA 1XPRA 5DLQE 4L5RC 4OWWB 1XNQQ 4OWXB 5LMUQ 4DUZQ 3S15H 2E5LL 1VS0A 1CKNA 3BJUA 3I56A 4BY7H 2K5HA 2JJQA 3GTJH 3PUZA 1N8RC 1DGSA 3CW2C 4GKKQ 2ID0A 2YTXA 1KC8C 1H95A 1RIPA 3CPWA 1QZHA 3JSLA 4EEQA 2CFMA 3GTPH 4LF9L 3K81C 4LF5L 1PA6A 4X65Q 3CAMA 3F1ZA 4GKJL 3T1YL 2VQFQ 4DR1Q 1MKHA 5LMUL 4XIGS 1PH4A 1N9WA 2Q2HA 1FL0A 1AE2A 1WI5A 2CWPA 4PMWA 1LM0A 4POFA 5IYCH 4DUYQ 1VQOA 1EIYB 4LH7A 4UCVA 1A62A 1B8AA 3KJOA 1OXVA 4HIOA 4DR2L 1N34Q 3CP0A 3RLOA 4GOPB 4P72A 2HHHQ 1UE1A 3I4MG 4A3BG 5FLMG 4LFCL 1GD7A 3CC4A 4DAYB 1JT8A 3AYHB 2D0OA 2OTLA 5M3MH 4MNOA 3A5ZB 3JAMc 4BBSH 1U5KA 2ZJRA 4IO9A 4JI6L 3S24A 2R7ZG 4IFDI 4WJ3M 3VDYA 3PCOB 5M3MG 4A3DH 4LF4L 1HNWQ 4IJLA 2F4VL 4IPGA 1YVCA 3M85A 4P75A 2PI2E 4R4OA 1XTDA 1X3FA 4LF6L 1N33Q 4HTPA 3CCRA 1VQDA 1CSPA 3HOUG 5IP9H 1S3OA 4DV3Q 4GNXC 1J6QA 1EYGA 4HJ5A 3I55A 1XPUA 4C2MH 4BY1G 1KL9A 3STBD 3BAAA 2BA0A 3KDFB 1B04A 4LFAQ 1PYBA 4JBMA 1X55A 4GNXB 3RTXA 2YYZA 3ERSX 4LNQA 3NBHB 3GTGH 4K0KQ 1GVPA 4OWTB 1IZ6A 1CKOA 4DPGA 3A5UA 4JI8Q 2YV5A 4GLAC 4A3KG 4A3GH 2BH8A 4R4IA 1HZBA 3K0XA 3H3VI 2HIXA 5C4XH 1A0IA 1EUJA 1X3GA 2OQKA 3PGZA 3OTOL 4A3GG 4YHHL 5IT9c 5JJLA 4A3LG 5C4XG 3MXNB 2IT1A 5GROA 3UE0A 5C4JH 2JA6H 3HKZE 4K0KL 3NBZB 3S1NH 1BBUA 3NEMA 4JI7L 1CUKA 4DR4L 2HVRA 2YU9H 2NVTH 3T1HQ 3I4NG 1IBLQ 2JA6G 2HIVA 4ALPA 1CSQA 4JI3L 4JI4L 1SFOH 1VQNA 4A3EH 5LMNW 2ZM6Q 5LMNL 2DGYA 2NN6I 4QY7A 3CXCA 5IYDH 3GTQH 4YWLA 3I4NH 3E0EA 4UY8C 2IX0A 3RZOH 4A3EG 4A3IG 3H3VH 1OXSC 2JE6I 4HIDA 4DV6L 1YJ9A 1N36L 5J3BA 4CC6A 1L1OC 5GAGC 4KHZA 4A3IH 3TS2A 4DV0Q 2VQEQ 4QQBX 2E2HH 4B3MQ 2MFIA 1TWCH 4LFBL 3W5OA 2K5VA 3EN2A 4A93G 4A3CG 2VUGA 1VQEA 1EOVA 2ZTCA 3JC66 3KOJA 3L2PA 4EX5A 3A0JA 1AH9A 1P16A 4DV7L 3CMAA 5EAYA 4H02A 2I5HA 1L0WA 2VZAA 3ULPA 2BH2A 4IOCA 2CCZA 5IWAQ 1I6HH 1I94Q 1QVCA 2EXDA 1PFSA 2EQSA 4GN4B 4GOPA 2IHFA 2AWNA 1HNXQ 4BY7G 4DV4L 4P73A 3RLNA 3LGJA 4A76A 3H15A 1XDNA 1EQRA 5IY0A 3T1YQ 1QVFA 1KQSA 1UE5A 2I5LX 4LF4Q 3BZCA 1FVIA 1Q7YC 5C0XI 4NXNL 3WWVA 1VQHA 2LXJA 1B70B 1SROA 1Y1VH 2Q2UA 2C35B 3MEFA 4GKKL 1K8GA 4NPSA 1Y1VG 3G6EA 5D1OA 1CKMA 1FGUA 2VW9A 4A3JH 4HJ8A 4UCUA 1BVSA 4JI0Q 4AYBG 4MZ9A 1E1TA 1JE5A 5FLMH 4DV1Q 1XMQQ 3PO3H 3S2DH 1V43A 1NE3A 4A3JG 2PQAA 3PO3G 1OXTA 2K50A 2NN6G 2AMCB 3PSIA 4BBRH 1Z9FA 4LF7Q 4LFAL 2ASBA 1VQPA 3AEVA 5JJKA 1K0RA 3KF6B 2A1AA 2IX1A 3PF5A 1BBWA 2NVYH 1YNXA 1WFQA 2QEXA 4BBRG 1A63A 1XK5A 1Q46A 2Y0SG 4DV3L 2B3GA 5M5WH 2Y0SE 1YJNA 4JI1Q 1XMOL 3JAMi 1VQ5A 1GM5A 3HOUH 2OTJA 2RHQB 4GN3B 1PH8A 1XNQL 2F52A 4BY1H 3S2HH 1HZ9A 2R6GA 2VNUD 4JC0A 3CMEA 1HNXL 3CCSA 1KD1C 3RR5A 3CCMA 2Z6KC 1IBMQ 4X66L 4JI6Q 1JJCB 3HOVH 1O7IA 3K7UC 4A3KH 4JYAL 1Q12A 1YIJA 5JEAG 2PI2A 3UDGA 1UWVA 1R9TH 4JI5L 1TA8A 3L0OA 1IBKL 2ZTEA 4LFCQ 4IFDG 1K9MC 5JEAJ 1X54A 5BR8Q 3OYYA 3HOYG 3H0GG 3BZKA 2MO0A 1P8LA 3TY8A 5C44G 1HR0W 4HJAA 4X62L 4OO1G 4A3MG 3DM3A 1V1QA 3W1BA 1LUZA 4KHPQ 3TS0A 2LSSA 2A8VA 1NY4A 3HOYH 3UDIA 2ZM6L 5LMNQ 1L1OB 2R92G 1X65A 2VQFL 2KHIA 4A3MH 2Z0SA 3ICEA 3NENA 3S16H 1I50H 5E7NA 4LF9Q 4QL5A 2R92H 2I5MX 1L2FA 2GN5A 4X64Q 3KDFA 3M4QA 1FJGL 4OX9Q 3KFUA 5DISC 2Q2IA 2F3IA 2JEAI 4IFDJ 4ME3A 3ZJYC 5IYBH 4OXPA 4DR6Q 1Y14B 4PZ6A 2RCNA 2K52A 1S68A 5IWAL 5IYBG 1CKNB 3KJPA 1ASZA 1TAEA 2VL6A 1VQGA 1HH2P 4AQYL 3HKZG 4A93H 4A3CH 1SRUA 4R4CA 1WCMG 3RN2A 3I4OA 4TQUS 1VQMA 3U4ZA 1NJIC 3S17H 1PH2A 1VQ8A 2VUMH 1VQ4A 1WCMH 4R4QA 3U50C 4B3SQ 4DNIA 1L1OA 4LUZA 2UXCQ 1YEZA 4YWMA 3M9BA 2VQEL 2CWAA 3TREA 4NXML 4KHPL 4DR7Q 1RL2A 3G4SA 1VQCA 1PH1A 2OWOA 1IXRA 3S1QH 5IP7G 3F2BA 1W3SA 4MTNA 1SE8A 4X6AH 1GKHA 2N8NA 1VQJA 5IP7H 1Q81C 4DV5L 4DRFA 1K83H 1VQ7A 3STBC 3T1HL 2WB1E 1JJ2A 4OO1I 2KHJA 4HIKA 2UU9Q 3PUVA 3GTLH 2WFWA 2BA1A 4GLVB 5FJ8G 3BA8A 1OXXK 2UUCQ 1PYSB 3M7NA 4YCWA 1U0LA 1W2BA 3HFZB 1AE3A 4O0AA 4AQYQ 1QZGA 2IY5B 1YHQA 1C9OA 3AQQA 2E8GA 4PG3A 3J81j 1M90C 4LF8L 3J7ZC 1EWIA 4UCTA 4JI8L 4A3FH 4L5TA 1SMXA 4DR6L 2HQLA 2WB1G 4DKAC 3ER0A 5M5XH 4A4IA 4GNXA 3UDFA 1SN8A 3HOWG 1WYDA 4DR1L 1KAWA 3J81i 4LH6A 4DK3C 4B3TL 2HVSA 2H5XA 1VCIA 2QA4A 5AJ3L 4JCVE 3B6YA 4IOAA 4QIWE 3HOWH 4JBWA 1YZ6A 4DAMA 3BA9A 3F8TA 1VQ6A 2GVBA 1BKBA 4YY3Q 1TWHH 1D8LA 2ZJPA 1E3PA 2K5NA 5GAEC 4YHHQ 5FPRA 3FHWA 5HGQA 3G71A 4DUZL 1N33L 3D31A 4QGUA 5C0XJ 1E7ZA 2VS1A 2AHOB 3HOZH 1SLJA 1E1OA 4LW1A 4L5SA 3I2ZA 1PH7A 3KF6A 3HOVG 2MNAA 3F2DA 2AWOA 1KIXA 5GADC 3J80c 3GTKH 4PZ8A 4UCOA 2CKZB 4GLXA 4RMFA 1VQ9A 3GTOH 4AYBE 4X64L 3GO5A 3GJXB 1C0AA 3GB8B 4HTOA 3TY5A 1YBYA 4HIMA 4UCSA 1XJVA 4LFBQ 4JV5L 1KXLA 3H0GH 3RLFA 3VNNA 2OQ0A 4JOIC 5C44H 3KF8B 1I5FA 4JI2L 4DV4Q 2IHEA 5ELNA 2UUBQ 4DUYL 1HNZL 1S72A 1G291 3CCVA 1SR3A 1PH9A 1HNZQ 2JA8G 3BU2A 1TWGH 2UXBL 3TQYA 4EFEA 2JA9A 1K3RA 3U58A 4GKJQ 1KRTA 3UE1A 1XNRL 2NZOA 2JA8H 2R93G 4JBKA 4NXMQ 4C3JH 2N49A 3PF4A 3PO2G 4IPHA 4DV2Q 4DV7Q 1Q1EA 1OTCA 1PH6A 1I3QH 1PH5A 4DR4Q 4APVA 1EFWA 1A8VA 4R1JA 5C0XG 3KYHC 3UDXA 1YHAA 2V1CC 4UCRA 2WP8J 1QUQA 3M3YH 3NC0B 1PH3A 5M3FH 1N36Q 4BXXH 1PHJA 1X56A 3NBYB 2MO1A 5GAHC 4DV6Q 4LUVA 2K75A 4DR7L 1GO3E 3M4PA 2VUMG 1JJGA 1IYJB 1XPOA 4BA2I 4OX9L 5GQOA 3AFQA 4AIMA 1Q1BA 2PNHA 3PUXA 4LF5Q 3U4VA 1FJGQ 1VQIA 1VQAA 1UE7A 2N78A 2JEBI 2XTIA 4JG2A 4JOIA 4B3TQ 3FKIH 2KBNA 3RN5A 1NTGA 2KENA 3FP9A 4QJFA 4R4TA 2D62A 5IE8A 1G51A 3FKIG 1E22A 4HJ7A 2R7FA 5C3EG 3OTOQ 3OW2A 2L15A 2B63G 4IPCA 4DR3Q 3PN1A 1X3EA 2OCEA 3A74A 3PUYA 4LWCA 2RF4A 2PMZE 3ULLA 4P71A 4YY3L 5HY6A 5FJ8H 2NVXH 4JYAQ 1VQBA 1B7YB 4NXNQ 1D7QA 2ES2A 1IL2A 1KHIA 4P74A 4C3IH 3CCLA 2ATWA 2WAQG 4IPDA 3TRZA 1IBML 2EIFA 3CC7A 5AJ3Q 3K8AA 5FLXc 4DV2L 3S14H 4E6NA 2HHHL 1YITA 1TXYA 3CCQA 4YCUA 1NBWA 3Q8DA 3SGIA 4A3FG 1TWAH 1HZAA 4EFBA 3GD7A 3J80i 4JI2Q 3E9IA 4UP7A 3GTMH 1WJJA 2UUBL 4C3HH 5IYCG 1PV4A 4LF6Q 4XTCS 3IRBA 1T9HA 4KLKA 1X9NA 3E9HA 4OONA 5BR8L 4GOPC 1JB7A 1VQKA 3PUWA 1HZCA 4DR5Q 3D0FA 3S1RH 2JA7G 1HNWL 4A75A 4LUOA 2E2IH 3NELA 1YI2A 2UUCL 1Q82C 4JI5Q 2XGTA 4RG1A 3I4MH 4A3BH 4JV5Q 3KLWA 2JA7H 2UXCL 1UE6A 5D1OB 3CCEA 2AKWB 2VY3A 4JI7Q 3L7ZC 4DK6C 2D0PA 2JA5H 4JBJA 2E5LQ 1Y1WG 2A19A 3K80C 4BBSG 1NMGA 2R7ZH 3HOZG 4UP8A 3CCJA 4A3DG 3J7A5 3J81c 2JA5G 2WAQE 1JMCA 1NMFA 2I0QA 4DR2Q 1N34L 1WOCA 2ZTDA 1Y1WH 2YTVA 4Y52H 3BABA 4AH6A 4DR3L 4J15A 3QWUA 2YTYA 3S1MH 5K36G 1Q86C 1C7YA 5FPOA 2RHSB 4NB3A 4GN5A 1YHBA 4YWKA 2LXKA 5JJIA 1XMOQ 5IP9G 4POGA 1ASYA 3CF5A 2KCMA 2K14A 1YJWA 3F2CA 3JSNA 3HKSA 4UFZA 1EQQA 3CPFA 5H1SE 4LF7L 3TY9A 4BA1I 4Y7NH 4LF8Q 5ELOA 1J5EL 4YCVA 3TEHB 1VQLA 3EIVA 4X62Q 2CQOA 4DV1L 1XMQL 1HR0L 5D1PA 1N32L 1OXUA 3PO2H 1MIUA 2N3SA 4FDBA 3PV0A 2UXDL 3UQ8A 1V9PA 2NZHA 3PIOA 3CD6A 3CC2A 5M5YH 4O2DA 2E2JH 2R93H 2UU9L 2HVQA 4A3LH 2Q2TA
chains in the Genus database with same CATH superfamily
1LYLA 2R7KA 4HCSA 1RKNA 4E4TA 5CA0F 3I7FA 2QGQA 3FKIB 3HOXG 4A3BB 5ELCA 2UXBQ 1XNRQ 2K4KA 5IYDG 5H80A 1X6OA 2UUAL 3HZXA 2SDFA 1XYIA 2W6PA 5ELFA 5EPKA 4OEMB 5IIFA 1HJPA 4YBZB 3WO0A 4CC5A 1EZ1A 4JI1L 3W1GA 4KI0A 2X69A 3TY5A 1IKLA 4JPBW 2WAQB 1NR2A 1B1ZA 2B39A 2ZJQA 2W6NA 2XRSD 3J81E 1KRSA 3T9EA 1GHJA 2HT1A 4X66Q 5J22A 4JI0L 3D4WA 1Y8PB 1J5EQ 1N32Q 3BVMA 1MJEA 2FXQA 1RODA 1G6PA 3TP7A 4MTKA 2ID0A 2F3VA 1JR0D 3CPWA 2QDLA 1QZHA 3JSLA 1I6VC 4KY7A 4LF9L 3K81C 4LF5L 2QB5A 3FVQA 3CAMA 3BDLA 1Y8OB 2VQFQ 1I1MA 1KDBA 5IYCH 2CWPA 4LH7A 4UCVA 3VOTA 2HGWA 3KJOA 4DR2L 1WR2A 1HA5A 3C1EA 1UE1A 4CJ1B 2SCUB 2VB2X 1KTKA 2XN9C 3CC4A 1JT8A 3HOZB 1TWCB 4MNOA 3JAMc 1TVXA 1QILA 2R7ZG 4A3DH 5M3MG 4LF4L 2D5DA 4ZKCB 2IPKD 5K2MA 3SHLA 3HO8A 1LT3D 2PI2E 4DLKA 4R4OA 3ERQA 2PN1A 1X3FA 1DOMA 1W96A 3KF8A 1S3OA 1IW7C 3MFGA 4DV3Q 1EYGA 3AW8A 3V2TA 2EY2A 1KL9A 1O7LA 4C2MH 3NWTA 4XQQA 3KDFB 4O42A 5C44B 2GPWA 2Z9HA 3R8BA 2YYZA 3ERSX 4LNQA 2HGSA 1E0BA 3NUCA 4K0KQ 4I4TF 1LTAD 1E4EA 2YV5A 3MEHA 2BH8A 4R4IA 1HZBA 2HIXA 3T51B 4KN7C 5C4XH 1EUJA 1X3GA 3R5XA 4YHHL 2Z02A 5C4XG 1B4OA 2CHBD 3MXNB 5FLXL 5C4JH 3LQSA 4IUUA 1BBUA 3NEMA 4Q4DA 4DR4L 2HHFB 3MAQA 3IKJA 1HQRD 3T1HQ 2HIVA 4ALPA 1CSQA 5KKNB 4JI3L 1VQNA 1Q90A 3I12A 4ILWA 3BS1A 4YWLA 1SE4A 3GTQH 4UY8C 3RZOH 3MXPA 3T56B 1KDCA 3E6ZX 4KD4A 1R4PB 2PW5A 2B2YA 5GAGC 3TS2A 3S1NB 5C3WA 2E2HH 4B3MQ 1IKMA 2MFIA 1TWCH 4A93B 1B2TA 1HXYD 1M4VA 3O13A 3NXWA 4A3CG 2XVSA 4XXEA 1VQEA 2AUKA 1EOVA 3JC66 3S9WA 1EWHA 3KK7A 2I5HA 2CNVA 2BH2A 1I6HH 4IOCA 1JDBB 1HNXQ 3TZDA 1U9RA 2EYOA 4YJ3F 1D1KA 5L37A 3LGJA 3J81L 1PTOF 4HN2A 3T1YQ 1A2UA 1QVFA 4UAIA 1VBHA 1EUDB 2YYAA 2B2UA 5ISRA 3BZCA 1FVIA 3S15B 3VA7A 2LXJA 1BCPB 1NAPA 2IWHA 3UZOA 4XYLB 4WRDA 3CEBA 2B63B 2K32A 3GP7A 3D3RA 1BVSA 4AYBG 4MZ9A 3PO3H 4HSPA 2XWBB 2PQAA 3HB9A 5K5PA 3U9OA 3PO3G 4NDXA 2AMCB 1Z2NX 5JJKA 1Z9FA 4C5AA 3E5NA 4DNTB 5CMDA 2A1AA 2IX1A 4O4IF 1YNXA 3KLRA 3E3XA 4KHVA 2Y0SG 4QCLA 3OUUA 2B3GA 4KD3A 2R92B 2F03A 4KJOA 1GM5A 2RHQB 4GN3B 1CZGA 3EJIA 4C1NK 1ESFA 1A3VA 3MZ5A 1D2BA 1HZ9A 3R93A 1HNXL 3CCSA 3BDCA 4JI6Q 4FF1A 3DF7A 3TW7A 1JJCB 4Y8VB 4DXGA 2F0OA 4KV6A 2M2LA 3GV3A 2PI2A 1ZAUA 3WDNA 3L0OA 2ZTEA 2TMPA 3J7AF 3TP8A 4Y7NB 3OYYA 4UUGA 2MO0A 1HR0W 5EPLA 5ELEA 4OO1G 4A3MG 3DM3A 1LUZA 3W1BA 4KHPQ 3HOYH 1STNA 2WKDA 2FPGB 1CE8A 2YRWA 1K0SA 3D6WA 4A3MH 2KHIA 1ICFB 1XXGA 1LACA 3HOUB 1EY7A 2R92H 2GN5A 2F3WA 3KDFA 3M4QA 5KYLA 5EBDA 1H9SB 4OX9Q 5DISC 2F3IA 4ME3A 1I7LA 4FYDA 3QG1A 2RCNA 1ENAA 1CKNB 2FHTA 5J1ZA 2VL6A 1VQGA 4O7SA 3NE5B 1HH2P 3HKZG 4ZRZA 1SRUA 3PO3B 4TQUS 3U4ZA 2VUMH 1KJJA 1VQ4A 5J2TF 2UXCQ 1YEZA 1KNAA 3EQLC 2VQEL 3J80L 4BS9A 1A3UA 5CA1F 5FLXE 3H3VC 1IXRA 2A69C 1RD9D 3L9AX 1SE8A 2PW7A 1K83H 3WOEA 2WB1E 4H0LC 3MHBA 4KKUA 4ODGA 2UU9Q 5CR3A 1Y1WB 4IUNA 1DYQA 2UUCQ 1U0LA 2QW7A 3HFZB 4AQYQ 3J81j 5BWVA 1EWIA 2E2HB 3PIO3 1SMXA 5GONF 4QIWB 4DKAC 5M5XH 4A4IA 3JRXA 4RGOS 4XT3B 5IODA 1KAWA 2DJGC 2FFKB 4LH6A 2H5XA 2QA4A 3RZOB 2DAAA 2ZDHA 4KTAA 4Q5VA 1CZWA 3F8TA 4KMUC 3FEWX 1A0GA 1ZXTA 5I5UA 4YY3Q 2ZJPA 4YHHQ 1I4XA 3A8JE 3BYYB 3HOVG 3P1HA 1A48A 1IW7D 3MXUA 4C56C 3J80c 3GTKH 4IN3A 2NBFA 4RMFA 3X3NA 1G91A 4AYBE 3GO5A 5KNDA 1C0AA 2YW2A 4FU0A 5T1GA 4IFDH 3DWPA 4HIMA 4UCSA 1KXLA 4EQNA 4IUQA 2OQ0A 5C44H 4DV4Q 2HVQA 2COIA 5FOBB 3TZUA 1SR3A 2JA8G 4K14A 2UXBL 2CNUA 4RGTA 2VB3X 1K3RA 2OXPA 2JA8H 2ICEC 4JBKA 1C8CA 1A3GA 2A74C 1T36A 2DIKA 3BYTB 3OSOA 4KJNA 3TBIB 5A35A 1A8VA 4LK1C 4CKBA 3K59A 3K5HA 3R5FA 2EY6A 3P75A 1Y8NB 3PIP3 1LTRD 5C8YF 1PH3A 5M3MB 1BQQT 1PHJA 1KTAA 1QWYA 2MO1A 3E5SA 1BNCA 1GSAA 5BYBA 5GQOA 3AFQA 3PUXA 2X5RA 1FJGQ 2XTIA 5KIXA 4JOIA 4B3TQ 2KENA 4QJFA 5D8DA 1EKFA 4R4TA 4IHJF 5IE8A 2K7VA 1G51A 5JJZA 3HBLA 3H0GB 4ZYSA 3LWBA 4ZUJA 4IPCA 4K6LA 1ENCA 4DR3Q 2YZLA 1YNJD 4O7ZA 1W6JA 3WOFA 5IGDA 2PMZE 4O7VA 4YY3L 5FJ8H 5JVLA 4IIJF 4F88A 2NVXH 1CHPD 3DTGA 2ES2A 1IL2A 1KHIA 4DIMA 2PO4A 4CMDA 5BWWA 3Q0AA 1S5ED 1YITA 1TXYA 2BE5D 2XWJB 4A3FG 2DLNA 3GD7A 3J80i 4IZOA 2UUBL 4XTCS 1T9HA 1X9NA 1JB7A 2JA7G 4DR5Q 1HZCA 3K5IA 3S1MB 5LYJF 4LUOA 2FB9A 2XGTA 4OL7A 1S5CD 1UE6A 4DK6C 1GUSA 2E5LQ 5BN3A 1ILQA 3F2UA 2R7ZH 2K28A 3J81c 4MV8A 4DR2Q 4Y52H 1WOCA 1Y1WH 2YTVA 4LJZC 4DR3L 3S1MH 2J7ZA 1C7YA 5FPOA 2F0EA 1I4HA 4GN5A 2WV6D 3S16B 2LXKA 5JJIA 3A7LA 1JWSD 2XNAC 4ZQ3A 1EYDA 4ZK9B 3AU7A 2N55A 4K8IA 1EQQA 4NYEA 3G7LA 4UFZA 4KKSA 3R3OA 2D9UA 3S14B 1PLFA 3VPDA 4HNVA 1J9OA 3TEHB 2PNRC 1BXRA 3G6JB 2EYPA 3C46A 3Q2OA 4V190 3PO2H 1JE4A 3OPOA 2UXDL 4OHJA 2NZHA 3DEPA 2JN4A 1CT1D 3CC2A 2COGA 3KALA 1EZ8A 4G57A 3U9SA 4WJWA 5M3FG 1EIFA 2Z6KA 2RVLA 4BY1B 1E24A 4DR5L 2SNSA 4B3ML 2KCTA 2C00A 1PVOA 2MHVA 3NBHA 1XWEA 4OIKA 2NVQH 2L9HA 4UPAA 5I60A 2PCFB 1D1IA 1Z47A 4XQNA 4CHTB 3OMCA 2PQAB 4X65L 3HOYB 4JI3Q 4HJ9A 3RNUA 1VQFA 2DUDA 2MQHA 3CQZH 3S2DB 4L1KA 2HHFA 1MBYA 4WJ4A 3AB9A 1SJED 4B9XA 2RA4A 4HAEA 2I07B 1PRTD 4B3RL 2KCNA 4X3KA 3ULJA 3D4DA 1SCUB 5EZYF 4L5RC 3OIQA 4IZ8A 4OWXB 5LMUQ 2E5LL 1VS0A 3BJUA 5I2XA 1DGSA 1SEBD 1JOOA 3CW2C 2YTXA 1KC8C 1H95A 5J39A 1PZID 1PRTC 4XYQA 2CFMA 3JAML 1PA6A 4GKJL 1MKHA 1D6EC 5M5WB 1N9WA 1WI5A 4DUYQ 4KK7A 3VR5A 1EIYB 3D8GA 3I70A 4IWXA 4MV1A 1F9PA 5E25A 1OXVA 3DAAA 4P72A 1VKZA 3UZBA 2W6ZA 3RMHA 4DAYB 3AYHB 3SK4A 3J7AV 3A5ZB 2CVRA 4JI6L 4IO9A 4A3IB 1J8IA 4WJ3M 1GXDC 5DM63 1HNWQ 3VYSA 1YVCA 4P75A 5K36H 4LF6L 1N33Q 4CDCC 3HOUG 1KJIA 5IP9H 4EGQA 1JOKA 1J6QA 1EQTA 5M5XB 3ONAB 2R82A 3BAAA 2MJ8A 2EJ2A 1PYBA 3LWUA 2WYOA 1EFID 1WVLA 4M0JA 3RTXA 4DAYA 1RCVD 3GTGH 2KCCA 1FYCA 1GVPA 1CKOA 4DPGA 5A2QE 1HCZA 3N6RA 3LX0A 4JI8Q 5IGFA 4A3GH 5JVG3 1EY4A 4H7BA 2KEEA 2OQKA 3PGZA 2KECA 3URYA 4FFOA 5CV5A 5IT9c 3TMEA 1Z7TA 4A3LG 1F2LA 2IT1A 3UE0A 4K0KL 2JA6H 3NBZB 2HVRA 1TR5A 5AFWA 2NVTH 1DV2A 3I4NG 4MV6A 4A3EH 5LMNW 2ZM6Q 5LMNL 4N8X1 5IYDH 3I4NH 3E0EA 2B8FA 2IX0A 5I6YA 4TSSA 1CS0A 1NR4A 1IYUA 1BNZA 1OXSC 2ODTX 2VUMB 5EPJA 1N36L 5C4ZA 4XYMB 1STEA 4JW0A 4EGVA 2VQEQ 4CHIA 1KJ9A 1FR3A 3EN2A 1HUMA 4QUFA 3N8DA 4EX5A 2J9GA 3DEOA 4H02A 4KY6A 3GTLB 5LA6F 1I94Q 1QVCA 2L4NA 1PFSA 2EQSA 4BY7G 1TU2B 3RLNA 1QCBD 4FE2A 2XIWA 1KQSA 4OGQC 5C0XI 4O83A 1VF5C 1B70B 1Y1VH 1TS5A 2C35B 5BMVF 4X3SA 1K8GA 2EPBA 4K6DA 3G6EA 1LT6D 5D1OA 1U4RA 1FGUA 4A3JH 2LFNA 3S2DH 4DV1Q 4HNTA 2W71A 2Q8IB 4IQZA 2K50A 2NN6G 3PSIA 3CHBD 4MAMA 3CU7A 3KF6B 1KUTA 1E4EB 3PF5A 2NN6H 1VMCA 1A63A 1XK5A 1Q46A 1UNSA 1YJNA 2I46A 4JI1Q 3JAMi 1H9SA 1VQ5A 3D4RA 1I50B 2F52A 3S2HH 3K3PA 1CA6A 1UC9A 4GZYC 2R6GA 4L6TB 1WTPA 2R86A 3RR5A 3UI2A 4I50F 2Z6KC 4X66L 5JEAH 4BY7B 3HOVH 1O7IA 2Z4IA 2QF7A 3K7UC 2NUAB 1Q12A 3N52A 1SNOA 3UDGA 1SYBA 5HV6A 4JI5L 1EY5A 4NZNA 4IFDG 1Q8IA 3DXJC 3H0GG 1P8LA 2JYOA 5C44G 5I5WA 4HJAA 1KJQA 1ESRA 2ABJA 1IHZA 4NZMA 1SYGA 1NY4A 2IJ0A 3K7AB 3TINA 2AQ1B 2CZGA 1L1OB 2VQFL 1AZPA 2Z0SA 3ICEA 1DAAA 1AUXA 2H1EA 2EJ0A 4HR7A 4LF9Q 4QL5A 3FRPB 1TT2A 1CA5A 1SNCA 1FJGL 4O7NA 1I6HB 2Z8LA 2Q2IA 3LP8A 5IYBH 4OXPA 2C9OA 4DF7A 2LY7A 2PYKA 1K8OA 2W6OA 3HOXB 1HA6A 3KJPA 1ASZA 4DGZA 3SK6A 3RN2A 4DA2A 4MV9A 1VQMA 2E2IB 2O4XA 1ET0A 4K2KA 4DNIA 1KAAA 2F0HA 5CC4A 3OUZA 4YWMA 3M9BA 4XZ3B 2W6MA 2XRQD 1STGA 3MA2B 2F0QA 4NXML 1VF7A 4KHPL 2F0PA 2F0KA 1FD7D 3MWYW 3WWJA 1ULZA 4X3TA 1EEID 2OWOA 1RHPA 2BDNA 5IP7G 1QB5D 1W3SA 4MTNA 3I90A 1MD2D 4X6AH 1GKHA 3C2PA 2N8NA 1Q81C 3QO2A 4TVIA 3H91A 4HSVA 1AW7A 1VQ7A 3T1HL 1SMYC 4OO1I 3QB3A 4HIKA 1RF2D 3PUVA 2EYHA 3GTLH 2BA1A 5T1IA 2EZVA 5FJ8G 3BA8A 4MA5A 1OXXK 4CJ2C 1Q3LA 1W2BA 1QZGA 5LXTF 1T5EA 1C9OA 4RWSC 2E8GA 1DM0B 3QOJA 4PG3A 2GQRA 3T54A 3DHQA 4JI8L 5CM0A 2O5IC 1DV1A 2YZMA 2WB1G 3VYTA 2NZ1D 3I4LA 1WD1A 3UDFA 1SN8A 3HOWG 2F0IA 1WYDA 4F8MA 4DR1L 1QE6A 5JQGF 4L63B 4JCVE 4IOAA 1OBGA 4IURA 3HOWH 3GV6A 1PFNA 1Y69U 4JBWA 3RUPA 4DAMA 4ZHQF 4A3EB 3BG3A 2NVTB 3QOLA 5GAEC 5FPRA 4DUZL 1N33L 4QGUA 5EKLA 3P20A 3K57A 3HOZH 4LW1A 5CV6A 1PH7A 3G8DA 2AWOA 3D6CA 5EBCA 3U9TA 1E2WA 2WINB 2EE1A 4GLXA 3GTOH 3GJXB 2K04A 4HTOA 3WNZA 2F0SA 2EYLA 1YBYA 2CW0C 2G9DA 4RA8A 1XJVA 3GTGB 1FNUA 3RLFA 2F1MA 3Q24A 4K5WA 5IGCA 3VNNA 4UDUC 1I2KA 1HNZL 1S72A 1G291 5DMXA 3WWIA 5IOCA 1O7YA 1X32A 1PTOB 1EY9A 1KRTA 1XNRL 2KHSA 4NXMQ 4C3JH 4IPHA 2Y0SB 4DV2Q 1OTCA 2CH4A 1I3QH 5KEEA 1EKPA 1EFWA 3Q6SA 4C3JG 4R1JA 5C0XG 3RV3A 3KYHC 3UDXA 2V1CC 3PMFA 4UCRA 1C30A 2L5TA 1QUQA 5IGEA 4FVMA 1N36Q 4K8JA 3AX6A 3NBYB 1V1PA 2K75A 1ZKOA 4FXGC 1GO3E 3M4PA 2VUMG 5HBRB 5IGBA 3A55A 3K6OA 4LF5Q 2J4XA 2RBMA 2N78A 1TWGB 2VQDA 3MXNA 4CKEA 4DAVA 3FKIH 3RN5A 3FP9A 3TP5A 5JH7F 3V4ZA 2QCPX 3FKIG 1X3PA 4DN4M 1V1OA 5FK9C 5C3EG 3OTOQ 3OW2A 1CQVA 2L15A 4DK1A 5LOVF 2A5HA 1EZ6A 2P0AA 3A8KE 4XYOA 1BCPF 2NYZD 3PUYA 4LWCA 2RDFA 3ULLA 4O7LA 2DJFC 2Z6BA 4PV1C 5BPFA 4HN7A 1IOWA 4I55F 4KN4C 4MHEA 5AJ3Q 4DV2L 1WTWA 4E6NA 3S1QB 3CCQA 2L1BA 4YCUA 3Q8DA 3SGIA 3NQTA 3E9IA 4UP7A 1HUNA 1KNEA 1QNKA 1WJJA 1PV4A 4LF6Q 2E74C 4KLKA 1WCMB 2F0LA 4GOPC 2EDGA 1HNWL 3PUWA 3S1RH 2XSCA 5F2DA 4JI5Q 1Q82C 4JV5Q 2UXCL 4A3FB 2F0GA 2V59A 5D1OB 4JI7Q 1GSOA 1PK8A 5CGKA 1M6VA 4FXKC 4JBJA 2A19A 1NMGA 4WORA 3GLKA 3SVMA 3AEVA 2I0QA 1NMFA 3BABA 4F7XA 2ZTDA 1A15A 1AFPA 1KLGD 4RGNA 4J15A 2R7LA 5K36G 4NB3A 2K05A 4V0BA 1EYAA 5LL6S 1TS3A 4YWKA 1ENFA 4DK0A 2KCMA 1NSNS 2FMMA 1SNPA 5FKAC 4FF3A 4LF7L 1MGSA 1B53A 3TY9A 5E4WC 2G5DA 3RD4A 2Z1CA 4CGYB 3Q1KA 5ELOA 2F0MA 1W6KA 1XMQL 1HR0L 1R9TB 2XD4A 1MIUA 2N3SA 4DAPA 1V9PA 5FR9A 1AN8A 5M5YH 2E2JH 2UU9L 1QJOA 2ICIA 5JPNC 1X3QA 3HOXH 2JK8A 4L5QA 2GVAA 3QFFA 1S40A 1BXTA 5LP6F 2R7DA 1A9XA 3C3LA 3JAME 2B29A 1ML0D 1LTLA 4UP9A 5LL6X 2OLSA 2JQOA 4RKLA 1K8AC 1HTLD 4TVAB 5CV4A 5KS8A 5BWXA 3M4YA 3L3OC 4IUTA 3CCUA 3K7AH 1IBKQ 2NTSA 3NQIA 3ITPA 1LTGD 4B3SL 1PYWD 3MXGA 1TWFH 3VR2A 2UXDQ 2B63H 1EKVA 2I80A 5DAAA 2DWCA 3M4OH 3GDEA 2HD3A 3PIPA 4B3RQ 3G48A 4MV7A 1MJCA 1XNQQ 1XPRA 4OWWB 3S15H 3LNNA 4DUZQ 4BY7H 1WTQA 3I56A 2Z4HA 2JJQA 3GTJH 3PUZA 5HURA 3GTPH 4GLWA 1B9NA 4DQNA 3T1YL 2JP1A 4O7WA 2PZWA 4DR1Q 5LMUL 4XIGS 3T53B 1PH4A 1CQIB 1FL0A 2Q2HA 1VQOA 4POFA 1LM0A 1SNMA 2NVYB 1A62A 4LAAA 1DONA 3J7YW 3KLSX 4HIOA 3PQIA 4GOPB 2ZXPA 4BBRB 2NU6B 4O7RA 4A3BG 1EIGA 4LFCL 2OTLA 2D0OA 5M3MH 5JQWA 1U5KA 3S24A 4IFDI 4B9WA 4A3JB 2AQ2B 4IPGA 2PZTA 3M85A 3HOWB 2F4IA 3GTQB 3ND9A 1Y1VB 4QF4A 3CCRA 3BG5A 1VQDA 1CSPA 2Y4RA 4ZI7F 4HJ5A 4BY1G 3STBD 1LT5D 3WWHA 1B04A 1HTPA 5I5VA 2D2CC 1X55A 4GNXB 1U4LA 2L12A 3SNOA 5C4XB 2X6GA 4OWTB 1IZ6A 3A5UA 3LWEA 3A54A 3K0XA 1FNVA 1CI3M 4HMJA 1EY0A 1O80A 4ME6A 1JQYD 4C1NI 3HKZB 2YWVA 1SAPA 1H9MA 1DCZA 1CUKA 3NWSA 4DFAA 2YU9H 1T5XD 2TSSA 1LTTD 1IBLQ 4JI4L 2EYJA 2NN6I 2P5ZX 3EVQA 3I4NB 1SYCA 1PRTB 2ZXOA 2IW3A 2IX3A 1VDZA 2JE6I 2F0NA 4HIDA 1YJ9A 2AUJD 5J3BA 1PFMA 2B8GA 3KUPA 4CC6A 4DV0Q 2MP1A 2JA6B 1DJRD 4LFBL 3W5OA 3JZFA 4A93G 1ZYRC 2L0CA 3TIGA 5CBAE 3V4SA 2NTTA 2B2WC 4Z9CB 1M0WA 1TY0A 2BDOA 1XTCD 1P16A 4DV7L 3CMAA 3VR3A 3GIDA 2NU9B 1SNQA 4CBVA 3ULPA 2CCZA 5I5YA 2RCFA 4R8IA 2Z04A 2EXDA 4LMQD 2EJFC 3K5OA 3OW7A 2IHFA 2YZNA 1K83B 3WO1A 1L0XB 5I5TA 4A76A 2F0JA 2EYMA 1IL8A 1PX2A 1XDNA 1EQRA 4FXDA 3SDZA 1WTOA 1UE5A 3E0JA 2I5LX 3OOCA 1LTBD 2CH4W 4RGMA 4NXNL 3WWVA 4F87A 2FP4B 1SROA 2A6HC 2Q2UA 5JVH3 3MEFA 4GKKL 1M0TA 1STYA 4NPSA 1II3A 1H9JA 2E76C 1CKMA 1SNDA 3DWAA 3K5MA 4HJ8A 1BCPC 1CM9A 3K5LA 5FLMH 4JI0Q 1E1TA 1JE5A 3FPPA 4BBSB 3BZDB 1V43A 4QMGA 5I5SA 1OXTA 3MWDA 3S2HB 4LF7Q 1VQPA 4L8JA 1K0RA 5BWRA 2XCLA 3T9DA 2B2VC 2QEXA 3SEBA 4DV3L 5M5WH 2KA7A 5IYZF 3HOUH 4MA0A 1MHWC 1D5MC 4OELB 1LTSD 5CE8A 3T4AC 2K1BA 4JC0A 3CMEA 1KD1C 5CORA 3HEJA 3CCMA 1IBMQ 4DNRB 1DXMA 4A3KH 4JYAL 3HGBA 1ZEQX 1YNND 4QSHA 1UWVA 2HQEA 1R9TH 1IBKL 2K03A 4ZUIA 1CFMA 4YIJA 1K9MC 1OBDA 1X54A 5BR8Q 2FJ2A 3CQZB 1QOHA 3HOYG 4O4LF 2DY8A 3TY8A 4X62L 3TS0A 2A8VA 4FNFA 1YNNC 2GA4B 2B2TC 2R92G 3JRWA 1AP0A 1I2LA 5KYIA 2NVQB 2I5MX 4X64Q 2HDKA 3SXHA 5I4DA 2JEAI 2E75C 4IFDJ 5G3LF 3ZJYC 2QK4A 1Y14B 5FO9B 3PFFA 1S68A 5IWAL 2WIIB 2B2WA 2R93B 4MIUA 1WCMG 4G4KA 4R4CA 1MI2A 1K8MA 2X0SA 1PH2A 1VQ8A 3PO2B 1WCMH 4R4QA 3U50C 4B3SQ 3HS0C 4M1UB 1L1OA 4CE5A 4LUZA 2ZDQA 2F0WA 2EY1A 4FGRA 3TREA 1H9RA 1SFOB 1GLVA 1RL2A 3G4SA 1PH1A 1HFGA 3S1QH 5G3LD 1BO0A 3R2TA 2VR1A 4M9UA 1HPCA 3F2BA 3T16A 2KUMA 2CW0D 1DZ1A 2QKIC 1EOTA 4K5VA 1VQJA 1JB3A 4DV5L 3STBC 3KAKA 2NU8B 2KHJA 1STBA 3T99A 5EKIA 1IYDA 3TP6A 5DNFA 1S4ZA 1WTRA 1BUVT 1TS2A 2R7ZB 4YCWA 2RSNA 4C3IG 5I2YA 2IY5B 3UFXB 1I4RA 3AQQA 3FPUB 1M90C 4LF8L 1B9MA 2EJGC 2YL2A 1KLUD 3ER0A 4GNXA 4DK3C 2HVSA 4WBNF 4FFNA 5AJ3L 3ORRA 1PZJD 3B6YA 4QIWE 3BA9A 1EU3A 1VQ6A 2ZXRA 2GVBA 1F9SA 4YAKB 1BKBA 1VBGA 5M3FB 5C6AA 1E3PA 1PXUA 4I65A 3G71A 1ONLA 3D31A 1EYZA 5C0XJ 3TQTA 1E7ZA 2VS1A 5C4JB 2AHOB 4O1NA 2OT2A 1SLJA 1JOQA 3I2ZA 3KF6A 4AYBB 2NVXB 2MNAA 3F2DA 1KIXA 4UCOA 4NW2A 2CKZB 4X64L 3GB8B 1I7NA 4O2BF 4LFBQ 4JV5L 1IYVA 1DOLA 3H0GH 1ILPA 4HTHA 4C5BA 1HHVA 4JI2L 4YB8B 2IHEA 1U4MA 1PH9A 3CCVA 1HNZQ 1DD2A 1ET9A 1GOZA 4ZAIA 4C2MB 3FDTA 1G2WA 1WTXA 4PMBA 4EFEA 2JA9A 4P2CB 3TEKA 3GTOB 3BVGA 4DV7Q 1Q1EA 1EWCA 1PH5A 1W93A 2A73B 4ZOLF 4A3DB 5DGIA 1A3TA 1PMRA 1YHAA 3CSWA 3M3YH 3NC0B 4QUCA 2K6AA 5EQ0A 1G8ZD 1RTOA 3IL8A 3V05A 4DV6Q 2PBZA 1B3AA 4CMFA 4DR7L 1IYJB 2WB1B 4BA2I 4OX9L 3ND8A 3RZDB 3ETHA 3U4VA 1BOSA 1VQIA 1VQAA 2WACA 2JEBI 4JG2A 2A68C 3I91A 4MV4A 3U55A 2KBNA 2EJ3A 5C4HA 3T13A 3VYRA 2RKSA 3H09A 2D62A 3GTPB 1B6RA 4FFRA 4TRDA 2RDGA 4HJ7A 3JZIA 1JWMD 3OIPA 4O4HF 2B63G 1UUPA 2HDLA 2YRXA 3EFXD 1ICWA 1E2ZA 3GTKB 5HY6A 3M4OB 1DIKA 1SMYD 1VQBA 5C3XA 4NXNQ 3TRZA 1TWFB 4P74A 3CCLA 2WAQG 4CJ0B 1IBML 2EIFA 2F0VA 4RAUC 2A6HD 3S14H 3EA6A 4N9TA 1BBXC 2YZGA 1RDPD 5IT9L 1NBWA 2AQ3B 3H94A 1HZAA 1I4QA 2PZUA 4EVOA 3MTSA 2ENBA 2N88A 5IYCG 2A1HA 5KNBA 5BR8L 4OONA 3E9HA 2HJWA 4RZQA 1VQKA 1SSOA 4X3UA 2E2IH 3NELA 4IALA 1YI2A 2UUCL 5KGUA 2DNCA 4A3BH 1EIHA 3KLWA 2JA7H 1PTOC 4DU9A 2AKWB 3W2DA 4ZKBB 2L55A 2JA5H 2FPIB 1Y1WG 3T9FA 2JA5B 3OWFA 1KC7A 5FO8B 3HOZG 3CCJA 4A3DG 1G2SA 2WAQE 1JMCA 2JA5G 2E2JB 1EYCA 3QWUA 1PTOD 2O5JC 4CDFC 2RHSB 4R8NA 2EY5A 5CR5A 2M00A 3RV4A 2FPPB 1XMOQ 3CKIB 2A69D 2K14A 2F0UA 2I87A 2EXZA 3F2CA 2R7MA 5I9PA 3HKSA 3TN2A 3JSNA 5KNCA 4RCNA 1KEEA 3EROA 2V58A 1S5FD 1O7ZA 2EYFA 1I4GA 1G2TA 5FO7B 3MVVA 3W3AA 1J5EL 3NUAA 4DXFA 4I7ZC 4X62Q 5D1PA 5I47A 5HGTA 1MSHA 3UQ8A 1KDAA 2NUCA 4E6IA 3PIOA 1GUOA 3HOVB 3NTIA 4O2DA 5C0XH 2R93H 5DEHA 4NKLA 4KY5A 3DM1A 4DV5Q 2R93G 4BXXG 3HRZC 2W6QA 4ABNA 1ET6A 1F2YA 3I8ZA 1QVGA 4XDXA 1BR9A 3I4MB 3QJYA 2UUAQ 4PZ7A 1UEBA 3RZDH 4U673 4FFMA 1JDEA 1K73C 1IOVA 1I94L 4ZCKA 2F4VQ 1KT8A 3TDQA 4JI4Q 3GTMB 3DWQA 4EQ5A 2B2VA 1IBLL 3EBEA 1PDQA 4IJHA 3VR4A 3R23A 3AFPA 4TUYF 3SE0A 4O4JF 3QWNA 3ORQA 2LKVA 4GS3A 1EY8A 2ALYB 5C3EH 2R84A 4O86A 2HCCA 1D5XC 4DV0L 3KBGA 4IUVA 1M1KC 3PN1A 1QUQB 1HR0Q 3NP8A 1Q8KA 5CV7A 3DLLA 3VMMA 5DLQE 2NB0A 3R9RA 1H9KA 4FFLA 5FNVF 1EY6A 5JOBA 1CQJB 1CKNA 3K0YA 4GKKQ 2K5HA 5CBEE 1N8RC 1C3OA 1RIPA 3SK8A 4EEQA 4X65Q 3F1ZA 4N9PA 2IP4A 1HQMC 1Z2OX 1JLLB 4Q4CA 4PMWA 1AE2A 4C3HG 5BWUA 2EOTA 4PMCA 1RJTA 1B8AA 1TQOA 2ZT9C 1UC8A 3C1FA 5CV9A 2RDHA 1N34Q 3CP0A 3RLOA 2HHHQ 3I4MG 1K28A 4O81A 2H4OA 4G7HC 5FLMG 1JCKB 1GD7A 2R7NA 2FMCA 2E2DC 2K33A 4BBSH 2ZJRA 4O2AF 2ZGIA 3VDYA 4HR7B 3PCOB 3Q22A 4IJLA 1AUVA 2F4VL 1SYEA 3VPCA 4RKBA 5NUCA 2A6EC 2COJA 1I3QB 5IGGA 2B2UC 1XTDA 4HTPA 3CRKC 2KQ3A 2Q8TA 4GNXC 3I55A 1XPUA 3ZYYX 1IYEA 3I73A 5J2UF 2BA0A 4J6HA 2MPMA 5D3DA 2LS01 1JKJB 4QB4A 4LFAQ 4JBMA 3T9BA 4B08A 2O2LD 3BDOA 1C48A 3NBHB 3HP3A 3DMUA 4A3KG 4GLAC 3NSWA 4A3GB 3H3VI 1OO9B 2BOSA 1F2ZA 1XX8A 4O82A 1A0IA 4EQPA 3OTOL 4A3GG 1LT4D 3A8IE 4TV9F 1LLRD 5JJLA 3BVZA 1GJXA 3NBIA 5GROA 4OO1H 3HKZE 3UYYA 3K5NA 2DABA 1AZQA 3S1NH 4JI7L 4G7OC 3SK5A 5D3IB 2JA6G 3K58A 1BCPD 4IUPA 1SFOH 1EUCB 1GGOA 3HT5A 1TS4A 2DGYA 3KLSA 4QY7A 3CXCA 4IWYA 4A3EG 4A3IG 3H3VH 5BPHA 5A2QL 4DV6L 4PBCA 2DY7A 2BCOA 1L1OC 5CYUA 4A3IH 4KHZA 2W70A 3MJFA 1LABA 2RQXA 4QQBX 2K5VA 2C5CA 2VUGA 2IL8A 2ZTCA 3KOJA 4CKCA 3L2PA 3A0JA 1AH9A 5EAYA 4H13C 1L0WA 2VZAA 5IWAQ 2Q7DA 4FO2A 2NU7B 1TY2A 1Z6HA 4GN4B 4ULLA 5LHY1 4GOPA 2AWNA 4DV4L 3X3MA 4DAAA 4P73A 3R2IA 4RFBA 4JK1C 2JSOA 5D14A 1M8AA 3H15A 3VR6A 5IY0A 4KKTA 5BWTA 1JWUD 1V1PB 3MFYA 5EGTA 3I3CA 4LF4Q 1Q7YC 1SYDA 1VQHA 1UEAB 1TKWB 3MC0B 4G7ZC 4MV3A 1Y1VG 4A3KB 2R61A 2DN8A 2VW9A 3S17B 4UCUA 3RUZA 1XMQQ 3NTKA 1NE3A 4A3JG 4BBRH 2ASBA 4LFAL 5E4XA 2I8CA 1BBWA 2NVYH 1WFQA 4BBRG 2V5AA 1XMOL 2Y0SE 1I1KA 3T7AA 4U68A 2DNEA 2OTJA 3HG9A 2EVBA 3IFDA 1PH8A 1XNQL 3TSSA 4BY1H 1GUNA 2OEOA 3QR8A 3V96A 3ETJA 2VNUD 5KRUA 1EQVA 1K3BC 1A2TA 5D65A 2J0TD 1JC7A 2EIYA 4ME5A 1CTMA 3KREA 2PVPA 3CRLC 1F77A 2SNMA 1YIJA 1JICA 5JEAG 3R5HA 3U54A 3KBXA 1TA8A 4FF4A 4LFCQ 1SE3A 4ZLTF 5JEAJ 4WHXA 2ZDGA 4EQOA 4XX0B 1S5BD 1SYFA 3BZKA 2R87A 3DTFA 1V1QA 2LSSA 5I5XA 5JVDF 3UDIA 3VA5A 2ZM6L 5LMNQ 1X65A 3IFTA 1CHQD 1B50A 3NENA 4O7YA 4M8AA 3S16H 1I50H 5E7NA 1BF4A 2K5WA 1EHIA 1L2FA 2MUYA 3QIAA 2GPSA 4O7TA 3T9CA 3KFUA 5I9OA 1KABA 5CB4F 4DR6Q 2X6LA 4PZ6A 2K52A 4HEDA 2JXMB 2F0DA 2A68D 4R9WA 5IYBG 1TAEA 2KOLA 2HGXA 4AQYL 4A93H 2JA7B 4A3CH 3QQMA 1O78A 3I4OA 4RHSA 1NJIC 3S17H 4XQJA 2Q8RE 1EEFD 2CWAA 3OMGA 3AMUA 1WTHA 2NWGA 2PQEA 5E1FA 4DR7Q 2HG8A 4TV8F 2YU9B 1VQCA 2K01A 2VXWA 3LULA 4NZOA 5IP7H 4DRFA 1UAPA 2HDMA 2G9HD 1JJ2A 3H6MA 5COYA 5BYAA 1L0YB 2WFWA 4GLVB 2R85A 2BE5C 3U0GA 3A7AB 1PYSB 3M7NA 1QG7A 3NHHA 2RSOA 1AE3A 4O0AA 2WKCA 1YHQA 3OHXC 3NK9A 2YS6A 3J7ZC 1SBBB 1SJHD 4UCTA 1PZKD 4A3FH 4L5TA 3NTHA 4DR6L 1C4QA 2HQLA 4YJ2F 1GUTA 1F9QA 4PNYA 3SE7A 3J81i 4B3TL 4RH6A 1VCIA 3OWEB 4C3HB 1R4QB 2SOBA 5BN5A 2CNQA 5ELBA 4WFN3 1YZ6A 1TWAB 3A56A 4HCEA 1LO5D 5KX5F 1TWHH 3Q23A 1PRTF 1D8LA 2K5NA 4H44C 2A6ED 3M3YB 3FHWA 5HGQA 2HCIA 1SDFA 1HFNA 4K2LA 1D5ZC 5I6WA 4FFPA 1KJ8A 1AEXA 2F0TA 1E1OA 1STAA 5JAVA 1NCVA 4L5SA 3SR1A 4C5CA 4YAJB 5GADC 2GLTA 4PZ8A 3JZ6A 2CQAA 3VYUA 1TIID 3KAJA 1VQ9A 2JA8B 1EU4A 4NMZA 4HMIA 4FF2A 3MWEA 1STHA 4N8FA 5DM73 1NUCA 3G8CA 4JOIC 3KF8B 2K5QA 1I5FA 5HNEA 1B6SA 1LV9A 1B3QA 5ELNA 4DUYL 2QEJC 2UUBQ 4EG0A 1Z2PX 2KJXA 1TWGH 3BU2A 2M9VA 3TQYA 3GTJB 4RCOA 3U58A 4GKJQ 1GUGA 5C5MA 3UE1A 2QILA 2NZOA 1KBLA 2N49A 3PF4A 5M9OA 4S3SA 3PO2G 4OIJA 2YS7A 1PH6A 2SEBD 2MGSA 4DR4Q 4APVA 4FP5D 1G6ZA 3IAYA 1FGBD 1SE2A 2WP8J 5M3FH 1I4PA 4BXXH 5TSSA 1X56A 5JPMC 1BDOA 5GAHC 4LUVA 2PPBC 1A6XA 2VPQA 4NP5A 1JJGA 4K5XA 4C3JB 1XPOA 1HRJA 1E2VA 4AIMA 1Q1BA 2PNHA 1PTOH 1WTVA 4ZQIA 2LMCB 1UE7A 5ELDA 4Q0FA 1S5DD 1NTGA 4K6NA 1MSGA 5K3WA 4TKOB 3DUZA 4TM5A 1E22A 2HUGA 1CQFA 2QDBA 2R7FA 2F0FA 3VPBA 1JORA 5M5YB 1X3EA 2OCEA 3A74A 2R3ZA 2RF4A 3GQBA 4P71A 4MN3A 5BN4A 1F2MA 4JYAQ 2L11A 1B7YB 1D7QA 4EGJA 5C3EB 4JVZA 4C3IH 1B44D 1RTNA 1SXTA 1DOKA 4IPDA 4RHRA 3CC7A 4UHVA 2ATWA 2B2YC 3K8AA 5FLXc 2EJMA 5EKKA 1TWHB 2HHHL 1EL0A 5E3FA 1GHKA 3TW6A 4PQXA 1FNWA 3NPPA 1TWAH 4EFBA 4JI2Q 3GTMH 5DGHA 5CAEB 5C1PA 4C3HH 3IRBA 5C1OA 2GQSA 1I1LA 3D0FA 3TIIA 4A75A 1WRVA 4CDEC 3I4MH 4RG1A 2K5DA 4J8QA 3CCEA 2VY3A 5DAUA 3P7JA 3L7ZC 2D0PA 3RFCA 3I72A 3K80C 4BBSG 4UP8A 3J7A5 1WD0A 4JXUA 4I7AA 1N34L 3BACA 1F9RA 1ZYRD 3J80E 4AH6A 5IT9E 2YTYA 1VMPA 1Q86C 5C5LA 4CDDC 3S1RB 4BWGB 5EJWA 2OF1A 1YHBA 3M7GA 5IP9G 2PMZB 4A3MB 1ASYA 3CF5A 4POGA 1YJWA 2FINB 4HQ6A 3FMCA 1YNJC 3CPFA 5H1SE 2B2TA 1U4PA 1V8QA 4BA1I 1PFBA 4Y7NH 4C3IB 4LF8Q 1GSHA 4YCVA 1VQLA 3EIVA 4O84A 2CQOA 4DV1L 4XT1B 1QNUA 1LTID 1N32L 1OXUA 2KEDA 4FDBA 3PV0A 4J1MA 5CV8A 3CD6A 2DZDA 4HNUA 1NNXA 2V4DA 3T9AA 2KVMA 4A3LH 4ID6A 2Q2TA 1CK1A 1GUWA
chains in the Genus database with same CATH topology
1LYLA 3HOXH 2JK8A 4L5QA 2GVAA 1EIFA 2Z6KA 5M3FG 4DV5Q 2R7DA 1E24A 1S40A 4BXXG 4DR5L 3I7FA 2B29A 2QGQA 2KCTA 3HOXG 1QVGA 4B3ML 1PVOA 2UXBQ 1XNRQ 2K4KA 5IYDG 2UUAQ 1X6OA 1LTLA 4PZ7A 4UP9A 2UUAL 1UEBA 3RZDH 2NVQH 4UPAA 1K73C 1HJPA 2JQOA 1K8AC 1I94L 4CC5A 4TVAB 4JI1L 1Z47A 2F4VQ 4JI4Q 3W1GA 4EQ5A 2PQAB 4KI0A 3EBEA 4X65L 3K7AH 4IJHA 3CCUA 1IBKQ 3AFPA 1IBLL 4HJ9A 4JI3Q 2ZJQA 3RNUA 1VQFA 2DUDA 4B3SL 2MQHA 3CQZH 1KRSA 4GS3A 2ALYB 1TWFH 5C3EH 2HT1A 4X66Q 2UXDQ 4WJ4A 2B63H 4DV0L 3M4OH 3GDEA 1M1KC 4JI0L 4B3RL 1N32Q 3PIPA 3ULJA 1J5EQ 1QUQB 1MJEA 2FXQA 3G48A 1HR0Q 4B3RQ 1G6PA 1Q8KA 1MJCA 3DLLA 1XPRA 5DLQE 4L5RC 4OWWB 1XNQQ 4OWXB 5LMUQ 4DUZQ 3S15H 2E5LL 1VS0A 1CKNA 3BJUA 3I56A 4BY7H 2K5HA 2JJQA 3GTJH 3PUZA 1N8RC 1DGSA 3CW2C 4GKKQ 2ID0A 2YTXA 1KC8C 1H95A 1RIPA 3CPWA 1QZHA 3JSLA 4EEQA 2CFMA 3GTPH 4LF9L 3K81C 4LF5L 1PA6A 4X65Q 3CAMA 3F1ZA 4GKJL 3T1YL 2VQFQ 4DR1Q 1MKHA 5LMUL 4XIGS 1PH4A 1N9WA 2Q2HA 1FL0A 1AE2A 1WI5A 2CWPA 4PMWA 1LM0A 4POFA 5IYCH 4DUYQ 1VQOA 1EIYB 4LH7A 4UCVA 1A62A 1B8AA 3KJOA 1OXVA 4HIOA 4DR2L 1N34Q 3CP0A 3RLOA 4GOPB 4P72A 2HHHQ 1UE1A 3I4MG 4A3BG 5FLMG 4LFCL 1GD7A 3CC4A 4DAYB 1JT8A 3AYHB 2D0OA 2OTLA 5M3MH 4MNOA 3A5ZB 3JAMc 4BBSH 1U5KA 2ZJRA 4IO9A 4JI6L 3S24A 2R7ZG 4IFDI 4WJ3M 3VDYA 3PCOB 5M3MG 4A3DH 4LF4L 1HNWQ 4IJLA 2F4VL 4IPGA 1YVCA 3M85A 4P75A 2PI2E 4R4OA 1XTDA 1X3FA 4LF6L 1N33Q 4HTPA 3CCRA 1VQDA 1CSPA 3HOUG 5IP9H 1S3OA 4DV3Q 4GNXC 1J6QA 1EYGA 4HJ5A 3I55A 1XPUA 4C2MH 4BY1G 1KL9A 3STBD 3BAAA 2BA0A 3KDFB 1B04A 4LFAQ 1PYBA 4JBMA 1X55A 4GNXB 3RTXA 2YYZA 3ERSX 4LNQA 3NBHB 3GTGH 4K0KQ 1GVPA 4OWTB 1IZ6A 1CKOA 4DPGA 3A5UA 4JI8Q 2YV5A 4GLAC 4A3KG 4A3GH 2BH8A 4R4IA 1HZBA 3K0XA 3H3VI 2HIXA 5C4XH 1A0IA 1EUJA 1X3GA 2OQKA 3PGZA 3OTOL 4A3GG 4YHHL 5IT9c 5JJLA 4A3LG 5C4XG 3MXNB 2IT1A 5GROA 3UE0A 5C4JH 2JA6H 3HKZE 4K0KL 3NBZB 3S1NH 1BBUA 3NEMA 4JI7L 1CUKA 4DR4L 2HVRA 2YU9H 2NVTH 3T1HQ 3I4NG 1IBLQ 2JA6G 2HIVA 4ALPA 1CSQA 4JI3L 4JI4L 1SFOH 1VQNA 4A3EH 5LMNW 2ZM6Q 5LMNL 2DGYA 2NN6I 4QY7A 3CXCA 5IYDH 3GTQH 4YWLA 3I4NH 3E0EA 4UY8C 2IX0A 3RZOH 4A3EG 4A3IG 3H3VH 1OXSC 2JE6I 4HIDA 4DV6L 1YJ9A 1N36L 5J3BA 4CC6A 1L1OC 5GAGC 4KHZA 4A3IH 3TS2A 4DV0Q 2VQEQ 4QQBX 2E2HH 4B3MQ 2MFIA 1TWCH 4LFBL 3W5OA 2K5VA 3EN2A 4A93G 4A3CG 2VUGA 1VQEA 1EOVA 2ZTCA 3JC66 3KOJA 3L2PA 4EX5A 3A0JA 1AH9A 1P16A 4DV7L 3CMAA 5EAYA 4H02A 2I5HA 1L0WA 2VZAA 3ULPA 2BH2A 4IOCA 2CCZA 5IWAQ 1I6HH 1I94Q 1QVCA 2EXDA 1PFSA 2EQSA 4GN4B 4GOPA 2IHFA 2AWNA 1HNXQ 4BY7G 4DV4L 4P73A 3RLNA 3LGJA 4A76A 3H15A 1XDNA 1EQRA 5IY0A 3T1YQ 1QVFA 1KQSA 1UE5A 2I5LX 4LF4Q 3BZCA 1FVIA 1Q7YC 5C0XI 4NXNL 3WWVA 1VQHA 2LXJA 1B70B 1SROA 1Y1VH 2Q2UA 2C35B 3MEFA 4GKKL 1K8GA 4NPSA 1Y1VG 3G6EA 5D1OA 1CKMA 1FGUA 2VW9A 4A3JH 4HJ8A 4UCUA 1BVSA 4JI0Q 4AYBG 4MZ9A 1E1TA 1JE5A 5FLMH 4DV1Q 1XMQQ 3PO3H 3S2DH 1V43A 1NE3A 4A3JG 2PQAA 3PO3G 1OXTA 2K50A 2NN6G 2AMCB 3PSIA 4BBRH 1Z9FA 4LF7Q 4LFAL 2ASBA 1VQPA 3AEVA 5JJKA 1K0RA 3KF6B 2A1AA 2IX1A 3PF5A 1BBWA 2NVYH 1YNXA 1WFQA 2QEXA 4BBRG 1A63A 1XK5A 1Q46A 2Y0SG 4DV3L 2B3GA 5M5WH 2Y0SE 1YJNA 4JI1Q 1XMOL 3JAMi 1VQ5A 1GM5A 3HOUH 2OTJA 2RHQB 4GN3B 1PH8A 1XNQL 2F52A 4BY1H 3S2HH 1HZ9A 2R6GA 2VNUD 4JC0A 3CMEA 1HNXL 3CCSA 1KD1C 3RR5A 3CCMA 2Z6KC 1IBMQ 4X66L 4JI6Q 1JJCB 3HOVH 1O7IA 3K7UC 4A3KH 4JYAL 1Q12A 1YIJA 5JEAG 2PI2A 3UDGA 1UWVA 1R9TH 4JI5L 1TA8A 3L0OA 1IBKL 2ZTEA 4LFCQ 4IFDG 1K9MC 5JEAJ 1X54A 5BR8Q 3OYYA 3HOYG 3H0GG 3BZKA 2MO0A 1P8LA 3TY8A 5C44G 1HR0W 4HJAA 4X62L 4OO1G 4A3MG 3DM3A 1V1QA 3W1BA 1LUZA 4KHPQ 3TS0A 2LSSA 2A8VA 1NY4A 3HOYH 3UDIA 2ZM6L 5LMNQ 1L1OB 2R92G 1X65A 2VQFL 2KHIA 4A3MH 2Z0SA 3ICEA 3NENA 3S16H 1I50H 5E7NA 4LF9Q 4QL5A 2R92H 2I5MX 1L2FA 2GN5A 4X64Q 3KDFA 3M4QA 1FJGL 4OX9Q 3KFUA 5DISC 2Q2IA 2F3IA 2JEAI 4IFDJ 4ME3A 3ZJYC 5IYBH 4OXPA 4DR6Q 1Y14B 4PZ6A 2RCNA 2K52A 1S68A 5IWAL 5IYBG 1CKNB 3KJPA 1ASZA 1TAEA 2VL6A 1VQGA 1HH2P 4AQYL 3HKZG 4A93H 4A3CH 1SRUA 4R4CA 1WCMG 3RN2A 3I4OA 4TQUS 1VQMA 3U4ZA 1NJIC 3S17H 1PH2A 1VQ8A 2VUMH 1VQ4A 1WCMH 4R4QA 3U50C 4B3SQ 4DNIA 1L1OA 4LUZA 2UXCQ 1YEZA 4YWMA 3M9BA 2VQEL 2CWAA 3TREA 4NXML 4KHPL 4DR7Q 1RL2A 3G4SA 1VQCA 1PH1A 2OWOA 1IXRA 3S1QH 5IP7G 3F2BA 1W3SA 4MTNA 1SE8A 4X6AH 1GKHA 2N8NA 1VQJA 5IP7H 1Q81C 4DV5L 4DRFA 1K83H 1VQ7A 3STBC 3T1HL 2WB1E 1JJ2A 4OO1I 2KHJA 4HIKA 2UU9Q 3PUVA 3GTLH 2WFWA 2BA1A 4GLVB 5FJ8G 3BA8A 1OXXK 2UUCQ 1PYSB 3M7NA 4YCWA 1U0LA 1W2BA 3HFZB 1AE3A 4O0AA 4AQYQ 1QZGA 2IY5B 1YHQA 1C9OA 3AQQA 2E8GA 4PG3A 3J81j 1M90C 4LF8L 3J7ZC 1EWIA 4UCTA 4JI8L 4A3FH 4L5TA 1SMXA 4DR6L 2HQLA 2WB1G 4DKAC 3ER0A 5M5XH 4A4IA 4GNXA 3UDFA 1SN8A 3HOWG 1WYDA 4DR1L 1KAWA 3J81i 4LH6A 4DK3C 4B3TL 2HVSA 2H5XA 1VCIA 2QA4A 5AJ3L 4JCVE 3B6YA 4IOAA 4QIWE 3HOWH 4JBWA 1YZ6A 4DAMA 3BA9A 3F8TA 1VQ6A 2GVBA 1BKBA 4YY3Q 1TWHH 1D8LA 2ZJPA 1E3PA 2K5NA 5GAEC 4YHHQ 5FPRA 3FHWA 5HGQA 3G71A 4DUZL 1N33L 3D31A 4QGUA 5C0XJ 1E7ZA 2VS1A 2AHOB 3HOZH 1SLJA 1E1OA 4LW1A 4L5SA 3I2ZA 1PH7A 3KF6A 3HOVG 2MNAA 3F2DA 2AWOA 1KIXA 5GADC 3J80c 3GTKH 4PZ8A 4UCOA 2CKZB 4GLXA 4RMFA 1VQ9A 3GTOH 4AYBE 4X64L 3GO5A 3GJXB 1C0AA 3GB8B 4HTOA 3TY5A 1YBYA 4HIMA 4UCSA 1XJVA 4LFBQ 4JV5L 1KXLA 3H0GH 3RLFA 3VNNA 2OQ0A 4JOIC 5C44H 3KF8B 1I5FA 4JI2L 4DV4Q 2IHEA 5ELNA 2UUBQ 4DUYL 1HNZL 1S72A 1G291 3CCVA 1SR3A 1PH9A 1HNZQ 2JA8G 3BU2A 1TWGH 2UXBL 3TQYA 4EFEA 2JA9A 1K3RA 3U58A 4GKJQ 1KRTA 3UE1A 1XNRL 2NZOA 2JA8H 2R93G 4JBKA 4NXMQ 4C3JH 2N49A 3PF4A 3PO2G 4IPHA 4DV2Q 4DV7Q 1Q1EA 1OTCA 1PH6A 1I3QH 1PH5A 4DR4Q 4APVA 1EFWA 1A8VA 4R1JA 5C0XG 3KYHC 3UDXA 1YHAA 2V1CC 4UCRA 2WP8J 1QUQA 3M3YH 3NC0B 1PH3A 5M3FH 1N36Q 4BXXH 1PHJA 1X56A 3NBYB 2MO1A 5GAHC 4DV6Q 4LUVA 2K75A 4DR7L 1GO3E 3M4PA 2VUMG 1JJGA 1IYJB 1XPOA 4BA2I 4OX9L 5GQOA 3AFQA 4AIMA 1Q1BA 2PNHA 3PUXA 4LF5Q 3U4VA 1FJGQ 1VQIA 1VQAA 1UE7A 2N78A 2JEBI 2XTIA 4JG2A 4JOIA 4B3TQ 3FKIH 2KBNA 3RN5A 1NTGA 2KENA 3FP9A 4QJFA 4R4TA 2D62A 5IE8A 1G51A 3FKIG 1E22A 4HJ7A 2R7FA 5C3EG 3OTOQ 3OW2A 2L15A 2B63G 4IPCA 4DR3Q 3PN1A 1X3EA 2OCEA 3A74A 3PUYA 4LWCA 2RF4A 2PMZE 3ULLA 4P71A 4YY3L 5HY6A 5FJ8H 2NVXH 4JYAQ 1VQBA 1B7YB 4NXNQ 1D7QA 2ES2A 1IL2A 1KHIA 4P74A 4C3IH 3CCLA 2ATWA 2WAQG 4IPDA 3TRZA 1IBML 2EIFA 3CC7A 5AJ3Q 3K8AA 5FLXc 4DV2L 3S14H 4E6NA 2HHHL 1YITA 1TXYA 3CCQA 4YCUA 1NBWA 3Q8DA 3SGIA 4A3FG 1TWAH 1HZAA 4EFBA 3GD7A 3J80i 4JI2Q 3E9IA 4UP7A 3GTMH 1WJJA 2UUBL 4C3HH 5IYCG 1PV4A 4LF6Q 4XTCS 3IRBA 1T9HA 4KLKA 1X9NA 3E9HA 4OONA 5BR8L 4GOPC 1JB7A 1VQKA 3PUWA 1HZCA 4DR5Q 3D0FA 3S1RH 2JA7G 1HNWL 4A75A 4LUOA 2E2IH 3NELA 1YI2A 2UUCL 1Q82C 4JI5Q 2XGTA 4RG1A 3I4MH 4A3BH 4JV5Q 3KLWA 2JA7H 2UXCL 1UE6A 5D1OB 3CCEA 2AKWB 2VY3A 4JI7Q 3L7ZC 4DK6C 2D0PA 2JA5H 4JBJA 2E5LQ 1Y1WG 2A19A 3K80C 4BBSG 1NMGA 2R7ZH 3HOZG 4UP8A 3CCJA 4A3DG 3J7A5 3J81c 2JA5G 2WAQE 1JMCA 1NMFA 2I0QA 4DR2Q 1N34L 1WOCA 2ZTDA 1Y1WH 2YTVA 4Y52H 3BABA 4AH6A 4DR3L 4J15A 3QWUA 2YTYA 3S1MH 5K36G 1Q86C 1C7YA 5FPOA 2RHSB 4NB3A 4GN5A 1YHBA 4YWKA 2LXKA 5JJIA 1XMOQ 5IP9G 4POGA 1ASYA 3CF5A 2KCMA 2K14A 1YJWA 3F2CA 3JSNA 3HKSA 4UFZA 1EQQA 3CPFA 5H1SE 4LF7L 3TY9A 4BA1I 4Y7NH 4LF8Q 5ELOA 1J5EL 4YCVA 3TEHB 1VQLA 3EIVA 4X62Q 2CQOA 4DV1L 1XMQL 1HR0L 5D1PA 1N32L 1OXUA 3PO2H 1MIUA 2N3SA 4FDBA 3PV0A 2UXDL 3UQ8A 1V9PA 2NZHA 3PIOA 3CD6A 3CC2A 5M5YH 4O2DA 2E2JH 2R93H 2UU9L 2HVQA 4A3LH 2Q2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LYL A;  3HOX H;  2JK8 A;  4L5Q A;  2GVA A;  1EIF A;  2Z6K A;  5M3F G;  4DV5 Q;  2R7D A;  1E24 A;  1S40 A;  4BXX G;  4DR5 L;  3I7F A;  2B29 A;  2QGQ A;  2KCT A;  3HOX G;  1QVG A;  4B3M L;  1PVO A;  2UXB Q;  1XNR Q;  2K4K A;  5IYD G;  2UUA Q;  1X6O A;  1LTL A;  4PZ7 A;  4UP9 A;  2UUA L;  1UEB A;  3RZD H;  2NVQ H;  4UPA A;  1K73 C;  1HJP A;  2JQO A;  1K8A C;  1I94 L;  4CC5 A;  4TVA B;  4JI1 L;  1Z47 A;  2F4V Q;  4JI4 Q;  3W1G A;  4EQ5 A;  2PQA B;  4KI0 A;  3EBE A;  4X65 L;  3K7A H;  4IJH A;  3CCU A;  1IBK Q;  3AFP A;  1IBL L;  4HJ9 A;  4JI3 Q;  2ZJQ A;  3RNU A;  1VQF A;  2DUD A;  4B3S L;  2MQH A;  3CQZ H;  1KRS A;  4GS3 A;  2ALY B;  1TWF H;  5C3E H;  2HT1 A;  4X66 Q;  2UXD Q;  4WJ4 A;  2B63 H;  4DV0 L;  3M4O H;  3GDE A;  1M1K C;  4JI0 L;  4B3R L;  1N32 Q;  3PIP A;  3ULJ A;  1J5E Q;  1QUQ B;  1MJE A;  2FXQ A;  3G48 A;  1HR0 Q;  4B3R Q;  1G6P A;  1Q8K A;  1MJC A;  3DLL A;  1XPR A;  5DLQ E;  4L5R C;  4OWW B;  1XNQ Q;  4OWX B;  5LMU Q;  4DUZ Q;  3S15 H;  2E5L L;  1VS0 A;  1CKN A;  3BJU A;  3I56 A;  4BY7 H;  2K5H A;  2JJQ A;  3GTJ H;  3PUZ A;  1N8R C;  1DGS A;  3CW2 C;  4GKK Q;  2ID0 A;  2YTX A;  1KC8 C;  1H95 A;  1RIP A;  3CPW A;  1QZH A;  3JSL A;  4EEQ A;  2CFM A;  3GTP H;  4LF9 L;  3K81 C;  4LF5 L;  1PA6 A;  4X65 Q;  3CAM A;  3F1Z A;  4GKJ L;  3T1Y L;  2VQF Q;  4DR1 Q;  1MKH A;  5LMU L;  4XIG S;  1PH4 A;  1N9W A;  2Q2H A;  1FL0 A;  1AE2 A;  1WI5 A;  2CWP A;  4PMW A;  1LM0 A;  4POF A;  5IYC H;  4DUY Q;  1VQO A;  1EIY B;  4LH7 A;  4UCV A;  1A62 A;  1B8A A;  3KJO A;  1OXV A;  4HIO A;  4DR2 L;  1N34 Q;  3CP0 A;  3RLO A;  4GOP B;  4P72 A;  2HHH Q;  1UE1 A;  3I4M G;  4A3B G;  5FLM G;  4LFC L;  1GD7 A;  3CC4 A;  4DAY B;  1JT8 A;  3AYH B;  2D0O A;  2OTL A;  5M3M H;  4MNO A;  3A5Z B;  3JAM c;  4BBS H;  1U5K A;  2ZJR A;  4IO9 A;  4JI6 L;  3S24 A;  2R7Z G;  4IFD I;  4WJ3 M;  3VDY A;  3PCO B;  5M3M G;  4A3D H;  4LF4 L;  1HNW Q;  4IJL A;  2F4V L;  4IPG A;  1YVC A;  3M85 A;  4P75 A;  2PI2 E;  4R4O A;  1XTD A;  1X3F A;  4LF6 L;  1N33 Q;  4HTP A;  3CCR A;  1VQD A;  1CSP A;  3HOU G;  5IP9 H;  1S3O A;  4DV3 Q;  4GNX C;  1J6Q A;  1EYG A;  4HJ5 A;  3I55 A;  1XPU A;  4C2M H;  4BY1 G;  1KL9 A;  3STB D;  3BAA A;  2BA0 A;  3KDF B;  1B04 A;  4LFA Q;  1PYB A;  4JBM A;  1X55 A;  4GNX B;  3RTX A;  2YYZ A;  3ERS X;  4LNQ A;  3NBH B;  3GTG H;  4K0K Q;  1GVP A;  4OWT B;  1IZ6 A;  1CKO A;  4DPG A;  3A5U A;  4JI8 Q;  2YV5 A;  4GLA C;  4A3K G;  4A3G H;  2BH8 A;  4R4I A;  1HZB A;  3K0X A;  3H3V I;  2HIX A;  5C4X H;  1A0I A;  1EUJ A;  1X3G A;  2OQK A;  3PGZ A;  3OTO L;  4A3G G;  4YHH L;  5IT9 c;  5JJL A;  4A3L G;  5C4X G;  3MXN B;  2IT1 A;  5GRO A;  3UE0 A;  5C4J H;  2JA6 H;  3HKZ E;  4K0K L;  3NBZ B;  3S1N H;  1BBU A;  3NEM A;  4JI7 L;  1CUK A;  4DR4 L;  2HVR A;  2YU9 H;  2NVT H;  3T1H Q;  3I4N G;  1IBL Q;  2JA6 G;  2HIV A;  4ALP A;  1CSQ A;  4JI3 L;  4JI4 L;  1SFO H;  1VQN A;  4A3E H;  5LMN W;  2ZM6 Q;  5LMN L;  2DGY A;  2NN6 I;  4QY7 A;  3CXC A;  5IYD H;  3GTQ H;  4YWL A;  3I4N H;  3E0E A;  4UY8 C;  2IX0 A;  3RZO H;  4A3E G;  4A3I G;  3H3V H;  1OXS C;  2JE6 I;  4HID A;  4DV6 L;  1YJ9 A;  1N36 L;  5J3B A;  4CC6 A;  1L1O C;  5GAG C;  4KHZ A;  4A3I H;  3TS2 A;  4DV0 Q;  2VQE Q;  4QQB X;  2E2H H;  4B3M Q;  2MFI A;  1TWC H;  4LFB L;  3W5O A;  2K5V A;  3EN2 A;  4A93 G;  4A3C G;  2VUG A;  1VQE A;  1EOV A;  2ZTC A;  3JC6 6;  3KOJ A;  3L2P A;  4EX5 A;  3A0J A;  1AH9 A;  1P16 A;  4DV7 L;  3CMA A;  5EAY A;  4H02 A;  2I5H A;  1L0W A;  2VZA A;  3ULP A;  2BH2 A;  4IOC A;  2CCZ A;  5IWA Q;  1I6H H;  1I94 Q;  1QVC A;  2EXD A;  1PFS A;  2EQS A;  4GN4 B;  4GOP A;  2IHF A;  2AWN A;  1HNX Q;  4BY7 G;  4DV4 L;  4P73 A;  3RLN A;  3LGJ A;  4A76 A;  3H15 A;  1XDN A;  1EQR A;  5IY0 A;  3T1Y Q;  1QVF A;  1KQS A;  1UE5 A;  2I5L X;  4LF4 Q;  3BZC A;  1FVI A;  1Q7Y C;  5C0X I;  4NXN L;  3WWV A;  1VQH A;  2LXJ A;  1B70 B;  1SRO A;  1Y1V H;  2Q2U A;  2C35 B;  3MEF A;  4GKK L;  1K8G A;  4NPS A;  1Y1V G;  3G6E A;  5D1O A;  1CKM A;  1FGU A;  2VW9 A;  4A3J H;  4HJ8 A;  4UCU A;  1BVS A;  4JI0 Q;  4AYB G;  4MZ9 A;  1E1T A;  1JE5 A;  5FLM H;  4DV1 Q;  1XMQ Q;  3PO3 H;  3S2D H;  1V43 A;  1NE3 A;  4A3J G;  2PQA A;  3PO3 G;  1OXT A;  2K50 A;  2NN6 G;  2AMC B;  3PSI A;  4BBR H;  1Z9F A;  4LF7 Q;  4LFA L;  2ASB A;  1VQP A;  3AEV A;  5JJK A;  1K0R A;  3KF6 B;  2A1A A;  2IX1 A;  3PF5 A;  1BBW A;  2NVY H;  1YNX A;  1WFQ A;  2QEX A;  4BBR G;  1A63 A;  1XK5 A;  1Q46 A;  2Y0S G;  4DV3 L;  2B3G A;  5M5W H;  2Y0S E;  1YJN A;  4JI1 Q;  1XMO L;  3JAM i;  1VQ5 A;  1GM5 A;  3HOU H;  2OTJ A;  2RHQ B;  4GN3 B;  1PH8 A;  1XNQ L;  2F52 A;  4BY1 H;  3S2H H;  1HZ9 A;  2R6G A;  2VNU D;  4JC0 A;  3CME A;  1HNX L;  3CCS A;  1KD1 C;  3RR5 A;  3CCM A;  2Z6K C;  1IBM Q;  4X66 L;  4JI6 Q;  1JJC B;  3HOV H;  1O7I A;  3K7U C;  4A3K H;  4JYA L;  1Q12 A;  1YIJ A;  5JEA G;  2PI2 A;  3UDG A;  1UWV A;  1R9T H;  4JI5 L;  1TA8 A;  3L0O A;  1IBK L;  2ZTE A;  4LFC Q;  4IFD G;  1K9M C;  5JEA J;  1X54 A;  5BR8 Q;  3OYY A;  3HOY G;  3H0G G;  3BZK A;  2MO0 A;  1P8L A;  3TY8 A;  5C44 G;  1HR0 W;  4HJA A;  4X62 L;  4OO1 G;  4A3M G;  3DM3 A;  1V1Q A;  3W1B A;  1LUZ A;  4KHP Q;  3TS0 A;  2LSS A;  2A8V A;  1NY4 A;  3HOY H;  3UDI A;  2ZM6 L;  5LMN Q;  1L1O B;  2R92 G;  1X65 A;  2VQF L;  2KHI A;  4A3M H;  2Z0S A;  3ICE A;  3NEN A;  3S16 H;  1I50 H;  5E7N A;  4LF9 Q;  4QL5 A;  2R92 H;  2I5M X;  1L2F A;  2GN5 A;  4X64 Q;  3KDF A;  3M4Q A;  1FJG L;  4OX9 Q;  3KFU A;  5DIS C;  2Q2I A;  2F3I A;  2JEA I;  4IFD J;  4ME3 A;  3ZJY C;  5IYB H;  4OXP A;  4DR6 Q;  1Y14 B;  4PZ6 A;  2RCN A;  2K52 A;  1S68 A;  5IWA L;  5IYB G;  1CKN B;  3KJP A;  1ASZ A;  1TAE A;  2VL6 A;  1VQG A;  1HH2 P;  4AQY L;  3HKZ G;  4A93 H;  4A3C H;  1SRU A;  4R4C A;  1WCM G;  3RN2 A;  3I4O A;  4TQU S;  1VQM A;  3U4Z A;  1NJI C;  3S17 H;  1PH2 A;  1VQ8 A;  2VUM H;  1VQ4 A;  1WCM H;  4R4Q A;  3U50 C;  4B3S Q;  4DNI A;  1L1O A;  4LUZ A;  2UXC Q;  1YEZ A;  4YWM A;  3M9B A;  2VQE L;  2CWA A;  3TRE A;  4NXM L;  4KHP L;  4DR7 Q;  1RL2 A;  3G4S A;  1VQC A;  1PH1 A;  2OWO A;  1IXR A;  3S1Q H;  5IP7 G;  3F2B A;  1W3S A;  4MTN A;  1SE8 A;  4X6A H;  1GKH A;  2N8N A;  1VQJ A;  5IP7 H;  1Q81 C;  4DV5 L;  4DRF A;  1K83 H;  1VQ7 A;  3STB C;  3T1H L;  2WB1 E;  1JJ2 A;  4OO1 I;  2KHJ A;  4HIK A;  2UU9 Q;  3PUV A;  3GTL H;  2WFW A;  2BA1 A;  4GLV B;  5FJ8 G;  3BA8 A;  1OXX K;  2UUC Q;  1PYS B;  3M7N A;  4YCW A;  1U0L A;  1W2B A;  3HFZ B;  1AE3 A;  4O0A A;  4AQY Q;  1QZG A;  2IY5 B;  1YHQ A;  1C9O A;  3AQQ A;  2E8G A;  4PG3 A;  3J81 j;  1M90 C;  4LF8 L;  3J7Z C;  1EWI A;  4UCT A;  4JI8 L;  4A3F H;  4L5T A;  1SMX A;  4DR6 L;  2HQL A;  2WB1 G;  4DKA C;  3ER0 A;  5M5X H;  4A4I A;  4GNX A;  3UDF A;  1SN8 A;  3HOW G;  1WYD A;  4DR1 L;  1KAW A;  3J81 i;  4LH6 A;  4DK3 C;  4B3T L;  2HVS A;  2H5X A;  1VCI A;  2QA4 A;  5AJ3 L;  4JCV E;  3B6Y A;  4IOA A;  4QIW E;  3HOW H;  4JBW A;  1YZ6 A;  4DAM A;  3BA9 A;  3F8T A;  1VQ6 A;  2GVB A;  1BKB A;  4YY3 Q;  1TWH H;  1D8L A;  2ZJP A;  1E3P A;  2K5N A;  5GAE C;  4YHH Q;  5FPR A;  3FHW A;  5HGQ A;  3G71 A;  4DUZ L;  1N33 L;  3D31 A;  4QGU A;  5C0X J;  1E7Z A;  2VS1 A;  2AHO B;  3HOZ H;  1SLJ A;  1E1O A;  4LW1 A;  4L5S A;  3I2Z A;  1PH7 A;  3KF6 A;  3HOV G;  2MNA A;  3F2D A;  2AWO A;  1KIX A;  5GAD C;  3J80 c;  3GTK H;  4PZ8 A;  4UCO A;  2CKZ B;  4GLX A;  4RMF A;  1VQ9 A;  3GTO H;  4AYB E;  4X64 L;  3GO5 A;  3GJX B;  1C0A A;  3GB8 B;  4HTO A;  3TY5 A;  1YBY A;  4HIM A;  4UCS A;  1XJV A;  4LFB Q;  4JV5 L;  1KXL A;  3H0G H;  3RLF A;  3VNN A;  2OQ0 A;  4JOI C;  5C44 H;  3KF8 B;  1I5F A;  4JI2 L;  4DV4 Q;  2IHE A;  5ELN A;  2UUB Q;  4DUY L;  1HNZ L;  1S72 A;  1G29 1;  3CCV A;  1SR3 A;  1PH9 A;  1HNZ Q;  2JA8 G;  3BU2 A;  1TWG H;  2UXB L;  3TQY A;  4EFE A;  2JA9 A;  1K3R A;  3U58 A;  4GKJ Q;  1KRT A;  3UE1 A;  1XNR L;  2NZO A;  2JA8 H;  2R93 G;  4JBK A;  4NXM Q;  4C3J H;  2N49 A;  3PF4 A;  3PO2 G;  4IPH A;  4DV2 Q;  4DV7 Q;  1Q1E A;  1OTC A;  1PH6 A;  1I3Q H;  1PH5 A;  4DR4 Q;  4APV A;  1EFW A;  1A8V A;  4R1J A;  5C0X G;  3KYH C;  3UDX A;  1YHA A;  2V1C C;  4UCR A;  2WP8 J;  1QUQ A;  3M3Y H;  3NC0 B;  1PH3 A;  5M3F H;  1N36 Q;  4BXX H;  1PHJ A;  1X56 A;  3NBY B;  2MO1 A;  5GAH C;  4DV6 Q;  4LUV A;  2K75 A;  4DR7 L;  1GO3 E;  3M4P A;  2VUM G;  1JJG A;  1IYJ B;  1XPO A;  4BA2 I;  4OX9 L;  5GQO A;  3AFQ A;  4AIM A;  1Q1B A;  2PNH A;  3PUX A;  4LF5 Q;  3U4V A;  1FJG Q;  1VQI A;  1VQA A;  1UE7 A;  2N78 A;  2JEB I;  2XTI A;  4JG2 A;  4JOI A;  4B3T Q;  3FKI H;  2KBN A;  3RN5 A;  1NTG A;  2KEN A;  3FP9 A;  4QJF A;  4R4T A;  2D62 A;  5IE8 A;  1G51 A;  3FKI G;  1E22 A;  4HJ7 A;  2R7F A;  5C3E G;  3OTO Q;  3OW2 A;  2L15 A;  2B63 G;  4IPC A;  4DR3 Q;  3PN1 A;  1X3E A;  2OCE A;  3A74 A;  3PUY A;  4LWC A;  2RF4 A;  2PMZ E;  3ULL A;  4P71 A;  4YY3 L;  5HY6 A;  5FJ8 H;  2NVX H;  4JYA Q;  1VQB A;  1B7Y B;  4NXN Q;  1D7Q A;  2ES2 A;  1IL2 A;  1KHI A;  4P74 A;  4C3I H;  3CCL A;  2ATW A;  2WAQ G;  4IPD A;  3TRZ A;  1IBM L;  2EIF A;  3CC7 A;  5AJ3 Q;  3K8A A;  5FLX c;  4DV2 L;  3S14 H;  4E6N A;  2HHH L;  1YIT A;  1TXY A;  3CCQ A;  4YCU A;  1NBW A;  3Q8D A;  3SGI A;  4A3F G;  1TWA H;  1HZA A;  4EFB A;  3GD7 A;  3J80 i;  4JI2 Q;  3E9I A;  4UP7 A;  3GTM H;  1WJJ A;  2UUB L;  4C3H H;  5IYC G;  1PV4 A;  4LF6 Q;  4XTC S;  3IRB A;  1T9H A;  4KLK A;  1X9N A;  3E9H A;  4OON A;  5BR8 L;  4GOP C;  1JB7 A;  1VQK A;  3PUW A;  1HZC A;  4DR5 Q;  3D0F A;  3S1R H;  2JA7 G;  1HNW L;  4A75 A;  4LUO A;  2E2I H;  3NEL A;  1YI2 A;  2UUC L;  1Q82 C;  4JI5 Q;  2XGT A;  4RG1 A;  3I4M H;  4A3B H;  4JV5 Q;  3KLW A;  2JA7 H;  2UXC L;  1UE6 A;  5D1O B;  3CCE A;  2AKW B;  2VY3 A;  4JI7 Q;  3L7Z C;  4DK6 C;  2D0P A;  2JA5 H;  4JBJ A;  2E5L Q;  1Y1W G;  2A19 A;  3K80 C;  4BBS G;  1NMG A;  2R7Z H;  3HOZ G;  4UP8 A;  3CCJ A;  4A3D G;  3J7A 5;  3J81 c;  2JA5 G;  2WAQ E;  1JMC A;  1NMF A;  2I0Q A;  4DR2 Q;  1N34 L;  1WOC A;  2ZTD A;  1Y1W H;  2YTV A;  4Y52 H;  3BAB A;  4AH6 A;  4DR3 L;  4J15 A;  3QWU A;  2YTY A;  3S1M H;  5K36 G;  1Q86 C;  1C7Y A;  5FPO A;  2RHS B;  4NB3 A;  4GN5 A;  1YHB A;  4YWK A;  2LXK A;  5JJI A;  1XMO Q;  5IP9 G;  4POG A;  1ASY A;  3CF5 A;  2KCM A;  2K14 A;  1YJW A;  3F2C A;  3JSN A;  3HKS A;  4UFZ A;  1EQQ A;  3CPF A;  5H1S E;  4LF7 L;  3TY9 A;  4BA1 I;  4Y7N H;  4LF8 Q;  5ELO A;  1J5E L;  4YCV A;  3TEH B;  1VQL A;  3EIV A;  4X62 Q;  2CQO A;  4DV1 L;  1XMQ L;  1HR0 L;  5D1P A;  1N32 L;  1OXU A;  3PO2 H;  1MIU A;  2N3S A;  4FDB A;  3PV0 A;  2UXD L;  3UQ8 A;  1V9P A;  2NZH A;  3PIO A;  3CD6 A;  3CC2 A;  5M5Y H;  4O2D A;  2E2J H;  2R93 H;  2UU9 L;  2HVQ A;  4A3L H;  2Q2T A; 
#chains in the Genus database with same CATH topology
 1LYL A;  2R7K A;  4HCS A;  1RKN A;  4E4T A;  5CA0 F;  3I7F A;  2QGQ A;  3FKI B;  3HOX G;  4A3B B;  5ELC A;  2UXB Q;  1XNR Q;  2K4K A;  5IYD G;  5H80 A;  1X6O A;  2UUA L;  3HZX A;  2SDF A;  1XYI A;  2W6P A;  5ELF A;  5EPK A;  4OEM B;  5IIF A;  1HJP A;  4YBZ B;  3WO0 A;  4CC5 A;  1EZ1 A;  4JI1 L;  3W1G A;  4KI0 A;  2X69 A;  3TY5 A;  1IKL A;  4JPB W;  2WAQ B;  1NR2 A;  1B1Z A;  2B39 A;  2ZJQ A;  2W6N A;  2XRS D;  3J81 E;  1KRS A;  3T9E A;  1GHJ A;  2HT1 A;  4X66 Q;  5J22 A;  4JI0 L;  3D4W A;  1Y8P B;  1J5E Q;  1N32 Q;  3BVM A;  1MJE A;  2FXQ A;  1ROD A;  1G6P A;  3TP7 A;  4MTK A;  2ID0 A;  2F3V A;  1JR0 D;  3CPW A;  2QDL A;  1QZH A;  3JSL A;  1I6V C;  4KY7 A;  4LF9 L;  3K81 C;  4LF5 L;  2QB5 A;  3FVQ A;  3CAM A;  3BDL A;  1Y8O B;  2VQF Q;  1I1M A;  1KDB A;  5IYC H;  2CWP A;  4LH7 A;  4UCV A;  3VOT A;  2HGW A;  3KJO A;  4DR2 L;  1WR2 A;  1HA5 A;  3C1E A;  1UE1 A;  4CJ1 B;  2SCU B;  2VB2 X;  1KTK A;  2XN9 C;  3CC4 A;  1JT8 A;  3HOZ B;  1TWC B;  4MNO A;  3JAM c;  1TVX A;  1QIL A;  2R7Z G;  4A3D H;  5M3M G;  4LF4 L;  2D5D A;  4ZKC B;  2IPK D;  5K2M A;  3SHL A;  3HO8 A;  1LT3 D;  2PI2 E;  4DLK A;  4R4O A;  3ERQ A;  2PN1 A;  1X3F A;  1DOM A;  1W96 A;  3KF8 A;  1S3O A;  1IW7 C;  3MFG A;  4DV3 Q;  1EYG A;  3AW8 A;  3V2T A;  2EY2 A;  1KL9 A;  1O7L A;  4C2M H;  3NWT A;  4XQQ A;  3KDF B;  4O42 A;  5C44 B;  2GPW A;  2Z9H A;  3R8B A;  2YYZ A;  3ERS X;  4LNQ A;  2HGS A;  1E0B A;  3NUC A;  4K0K Q;  4I4T F;  1LTA D;  1E4E A;  2YV5 A;  3MEH A;  2BH8 A;  4R4I A;  1HZB A;  2HIX A;  3T51 B;  4KN7 C;  5C4X H;  1EUJ A;  1X3G A;  3R5X A;  4YHH L;  2Z02 A;  5C4X G;  1B4O A;  2CHB D;  3MXN B;  5FLX L;  5C4J H;  3LQS A;  4IUU A;  1BBU A;  3NEM A;  4Q4D A;  4DR4 L;  2HHF B;  3MAQ A;  3IKJ A;  1HQR D;  3T1H Q;  2HIV A;  4ALP A;  1CSQ A;  5KKN B;  4JI3 L;  1VQN A;  1Q90 A;  3I12 A;  4ILW A;  3BS1 A;  4YWL A;  1SE4 A;  3GTQ H;  4UY8 C;  3RZO H;  3MXP A;  3T56 B;  1KDC A;  3E6Z X;  4KD4 A;  1R4P B;  2PW5 A;  2B2Y A;  5GAG C;  3TS2 A;  3S1N B;  5C3W A;  2E2H H;  4B3M Q;  1IKM A;  2MFI A;  1TWC H;  4A93 B;  1B2T A;  1HXY D;  1M4V A;  3O13 A;  3NXW A;  4A3C G;  2XVS A;  4XXE A;  1VQE A;  2AUK A;  1EOV A;  3JC6 6;  3S9W A;  1EWH A;  3KK7 A;  2I5H A;  2CNV A;  2BH2 A;  1I6H H;  4IOC A;  1JDB B;  1HNX Q;  3TZD A;  1U9R A;  2EYO A;  4YJ3 F;  1D1K A;  5L37 A;  3LGJ A;  3J81 L;  1PTO F;  4HN2 A;  3T1Y Q;  1A2U A;  1QVF A;  4UAI A;  1VBH A;  1EUD B;  2YYA A;  2B2U A;  5ISR A;  3BZC A;  1FVI A;  3S15 B;  3VA7 A;  2LXJ A;  1BCP B;  1NAP A;  2IWH A;  3UZO A;  4XYL B;  4WRD A;  3CEB A;  2B63 B;  2K32 A;  3GP7 A;  3D3R A;  1BVS A;  4AYB G;  4MZ9 A;  3PO3 H;  4HSP A;  2XWB B;  2PQA A;  3HB9 A;  5K5P A;  3U9O A;  3PO3 G;  4NDX A;  2AMC B;  1Z2N X;  5JJK A;  1Z9F A;  4C5A A;  3E5N A;  4DNT B;  5CMD A;  2A1A A;  2IX1 A;  4O4I F;  1YNX A;  3KLR A;  3E3X A;  4KHV A;  2Y0S G;  4QCL A;  3OUU A;  2B3G A;  4KD3 A;  2R92 B;  2F03 A;  4KJO A;  1GM5 A;  2RHQ B;  4GN3 B;  1CZG A;  3EJI A;  4C1N K;  1ESF A;  1A3V A;  3MZ5 A;  1D2B A;  1HZ9 A;  3R93 A;  1HNX L;  3CCS A;  3BDC A;  4JI6 Q;  4FF1 A;  3DF7 A;  3TW7 A;  1JJC B;  4Y8V B;  4DXG A;  2F0O A;  4KV6 A;  2M2L A;  3GV3 A;  2PI2 A;  1ZAU A;  3WDN A;  3L0O A;  2ZTE A;  2TMP A;  3J7A F;  3TP8 A;  4Y7N B;  3OYY A;  4UUG A;  2MO0 A;  1HR0 W;  5EPL A;  5ELE A;  4OO1 G;  4A3M G;  3DM3 A;  1LUZ A;  3W1B A;  4KHP Q;  3HOY H;  1STN A;  2WKD A;  2FPG B;  1CE8 A;  2YRW A;  1K0S A;  3D6W A;  4A3M H;  2KHI A;  1ICF B;  1XXG A;  1LAC A;  3HOU B;  1EY7 A;  2R92 H;  2GN5 A;  2F3W A;  3KDF A;  3M4Q A;  5KYL A;  5EBD A;  1H9S B;  4OX9 Q;  5DIS C;  2F3I A;  4ME3 A;  1I7L A;  4FYD A;  3QG1 A;  2RCN A;  1ENA A;  1CKN B;  2FHT A;  5J1Z A;  2VL6 A;  1VQG A;  4O7S A;  3NE5 B;  1HH2 P;  3HKZ G;  4ZRZ A;  1SRU A;  3PO3 B;  4TQU S;  3U4Z A;  2VUM H;  1KJJ A;  1VQ4 A;  5J2T F;  2UXC Q;  1YEZ A;  1KNA A;  3EQL C;  2VQE L;  3J80 L;  4BS9 A;  1A3U A;  5CA1 F;  5FLX E;  3H3V C;  1IXR A;  2A69 C;  1RD9 D;  3L9A X;  1SE8 A;  2PW7 A;  1K83 H;  3WOE A;  2WB1 E;  4H0L C;  3MHB A;  4KKU A;  4ODG A;  2UU9 Q;  5CR3 A;  1Y1W B;  4IUN A;  1DYQ A;  2UUC Q;  1U0L A;  2QW7 A;  3HFZ B;  4AQY Q;  3J81 j;  5BWV A;  1EWI A;  2E2H B;  3PIO 3;  1SMX A;  5GON F;  4QIW B;  4DKA C;  5M5X H;  4A4I A;  3JRX A;  4RGO S;  4XT3 B;  5IOD A;  1KAW A;  2DJG C;  2FFK B;  4LH6 A;  2H5X A;  2QA4 A;  3RZO B;  2DAA A;  2ZDH A;  4KTA A;  4Q5V A;  1CZW A;  3F8T A;  4KMU C;  3FEW X;  1A0G A;  1ZXT A;  5I5U A;  4YY3 Q;  2ZJP A;  4YHH Q;  1I4X A;  3A8J E;  3BYY B;  3HOV G;  3P1H A;  1A48 A;  1IW7 D;  3MXU A;  4C56 C;  3J80 c;  3GTK H;  4IN3 A;  2NBF A;  4RMF A;  3X3N A;  1G91 A;  4AYB E;  3GO5 A;  5KND A;  1C0A A;  2YW2 A;  4FU0 A;  5T1G A;  4IFD H;  3DWP A;  4HIM A;  4UCS A;  1KXL A;  4EQN A;  4IUQ A;  2OQ0 A;  5C44 H;  4DV4 Q;  2HVQ A;  2COI A;  5FOB B;  3TZU A;  1SR3 A;  2JA8 G;  4K14 A;  2UXB L;  2CNU A;  4RGT A;  2VB3 X;  1K3R A;  2OXP A;  2JA8 H;  2ICE C;  4JBK A;  1C8C A;  1A3G A;  2A74 C;  1T36 A;  2DIK A;  3BYT B;  3OSO A;  4KJN A;  3TBI B;  5A35 A;  1A8V A;  4LK1 C;  4CKB A;  3K59 A;  3K5H A;  3R5F A;  2EY6 A;  3P75 A;  1Y8N B;  3PIP 3;  1LTR D;  5C8Y F;  1PH3 A;  5M3M B;  1BQQ T;  1PHJ A;  1KTA A;  1QWY A;  2MO1 A;  3E5S A;  1BNC A;  1GSA A;  5BYB A;  5GQO A;  3AFQ A;  3PUX A;  2X5R A;  1FJG Q;  2XTI A;  5KIX A;  4JOI A;  4B3T Q;  2KEN A;  4QJF A;  5D8D A;  1EKF A;  4R4T A;  4IHJ F;  5IE8 A;  2K7V A;  1G51 A;  5JJZ A;  3HBL A;  3H0G B;  4ZYS A;  3LWB A;  4ZUJ A;  4IPC A;  4K6L A;  1ENC A;  4DR3 Q;  2YZL A;  1YNJ D;  4O7Z A;  1W6J A;  3WOF A;  5IGD A;  2PMZ E;  4O7V A;  4YY3 L;  5FJ8 H;  5JVL A;  4IIJ F;  4F88 A;  2NVX H;  1CHP D;  3DTG A;  2ES2 A;  1IL2 A;  1KHI A;  4DIM A;  2PO4 A;  4CMD A;  5BWW A;  3Q0A A;  1S5E D;  1YIT A;  1TXY A;  2BE5 D;  2XWJ B;  4A3F G;  2DLN A;  3GD7 A;  3J80 i;  4IZO A;  2UUB L;  4XTC S;  1T9H A;  1X9N A;  1JB7 A;  2JA7 G;  4DR5 Q;  1HZC A;  3K5I A;  3S1M B;  5LYJ F;  4LUO A;  2FB9 A;  2XGT A;  4OL7 A;  1S5C D;  1UE6 A;  4DK6 C;  1GUS A;  2E5L Q;  5BN3 A;  1ILQ A;  3F2U A;  2R7Z H;  2K28 A;  3J81 c;  4MV8 A;  4DR2 Q;  4Y52 H;  1WOC A;  1Y1W H;  2YTV A;  4LJZ C;  4DR3 L;  3S1M H;  2J7Z A;  1C7Y A;  5FPO A;  2F0E A;  1I4H A;  4GN5 A;  2WV6 D;  3S16 B;  2LXK A;  5JJI A;  3A7L A;  1JWS D;  2XNA C;  4ZQ3 A;  1EYD A;  4ZK9 B;  3AU7 A;  2N55 A;  4K8I A;  1EQQ A;  4NYE A;  3G7L A;  4UFZ A;  4KKS A;  3R3O A;  2D9U A;  3S14 B;  1PLF A;  3VPD A;  4HNV A;  1J9O A;  3TEH B;  2PNR C;  1BXR A;  3G6J B;  2EYP A;  3C46 A;  3Q2O A;  4V19 0;  3PO2 H;  1JE4 A;  3OPO A;  2UXD L;  4OHJ A;  2NZH A;  3DEP A;  2JN4 A;  1CT1 D;  3CC2 A;  2COG A;  3KAL A;  1EZ8 A;  4G57 A;  3U9S A;  4WJW A;  5M3F G;  1EIF A;  2Z6K A;  2RVL A;  4BY1 B;  1E24 A;  4DR5 L;  2SNS A;  4B3M L;  2KCT A;  2C00 A;  1PVO A;  2MHV A;  3NBH A;  1XWE A;  4OIK A;  2NVQ H;  2L9H A;  4UPA A;  5I60 A;  2PCF B;  1D1I A;  1Z47 A;  4XQN A;  4CHT B;  3OMC A;  2PQA B;  4X65 L;  3HOY B;  4JI3 Q;  4HJ9 A;  3RNU A;  1VQF A;  2DUD A;  2MQH A;  3CQZ H;  3S2D B;  4L1K A;  2HHF A;  1MBY A;  4WJ4 A;  3AB9 A;  1SJE D;  4B9X A;  2RA4 A;  4HAE A;  2I07 B;  1PRT D;  4B3R L;  2KCN A;  4X3K A;  3ULJ A;  3D4D A;  1SCU B;  5EZY F;  4L5R C;  3OIQ A;  4IZ8 A;  4OWX B;  5LMU Q;  2E5L L;  1VS0 A;  3BJU A;  5I2X A;  1DGS A;  1SEB D;  1JOO A;  3CW2 C;  2YTX A;  1KC8 C;  1H95 A;  5J39 A;  1PZI D;  1PRT C;  4XYQ A;  2CFM A;  3JAM L;  1PA6 A;  4GKJ L;  1MKH A;  1D6E C;  5M5W B;  1N9W A;  1WI5 A;  4DUY Q;  4KK7 A;  3VR5 A;  1EIY B;  3D8G A;  3I70 A;  4IWX A;  4MV1 A;  1F9P A;  5E25 A;  1OXV A;  3DAA A;  4P72 A;  1VKZ A;  3UZB A;  2W6Z A;  3RMH A;  4DAY B;  3AYH B;  3SK4 A;  3J7A V;  3A5Z B;  2CVR A;  4JI6 L;  4IO9 A;  4A3I B;  1J8I A;  4WJ3 M;  1GXD C;  5DM6 3;  1HNW Q;  3VYS A;  1YVC A;  4P75 A;  5K36 H;  4LF6 L;  1N33 Q;  4CDC C;  3HOU G;  1KJI A;  5IP9 H;  4EGQ A;  1JOK A;  1J6Q A;  1EQT A;  5M5X B;  3ONA B;  2R82 A;  3BAA A;  2MJ8 A;  2EJ2 A;  1PYB A;  3LWU A;  2WYO A;  1EFI D;  1WVL A;  4M0J A;  3RTX A;  4DAY A;  1RCV D;  3GTG H;  2KCC A;  1FYC A;  1GVP A;  1CKO A;  4DPG A;  5A2Q E;  1HCZ A;  3N6R A;  3LX0 A;  4JI8 Q;  5IGF A;  4A3G H;  5JVG 3;  1EY4 A;  4H7B A;  2KEE A;  2OQK A;  3PGZ A;  2KEC A;  3URY A;  4FFO A;  5CV5 A;  5IT9 c;  3TME A;  1Z7T A;  4A3L G;  1F2L A;  2IT1 A;  3UE0 A;  4K0K L;  2JA6 H;  3NBZ B;  2HVR A;  1TR5 A;  5AFW A;  2NVT H;  1DV2 A;  3I4N G;  4MV6 A;  4A3E H;  5LMN W;  2ZM6 Q;  5LMN L;  4N8X 1;  5IYD H;  3I4N H;  3E0E A;  2B8F A;  2IX0 A;  5I6Y A;  4TSS A;  1CS0 A;  1NR4 A;  1IYU A;  1BNZ A;  1OXS C;  2ODT X;  2VUM B;  5EPJ A;  1N36 L;  5C4Z A;  4XYM B;  1STE A;  4JW0 A;  4EGV A;  2VQE Q;  4CHI A;  1KJ9 A;  1FR3 A;  3EN2 A;  1HUM A;  4QUF A;  3N8D A;  4EX5 A;  2J9G A;  3DEO A;  4H02 A;  4KY6 A;  3GTL B;  5LA6 F;  1I94 Q;  1QVC A;  2L4N A;  1PFS A;  2EQS A;  4BY7 G;  1TU2 B;  3RLN A;  1QCB D;  4FE2 A;  2XIW A;  1KQS A;  4OGQ C;  5C0X I;  4O83 A;  1VF5 C;  1B70 B;  1Y1V H;  1TS5 A;  2C35 B;  5BMV F;  4X3S A;  1K8G A;  2EPB A;  4K6D A;  3G6E A;  1LT6 D;  5D1O A;  1U4R A;  1FGU A;  4A3J H;  2LFN A;  3S2D H;  4DV1 Q;  4HNT A;  2W71 A;  2Q8I B;  4IQZ A;  2K50 A;  2NN6 G;  3PSI A;  3CHB D;  4MAM A;  3CU7 A;  3KF6 B;  1KUT A;  1E4E B;  3PF5 A;  2NN6 H;  1VMC A;  1A63 A;  1XK5 A;  1Q46 A;  1UNS A;  1YJN A;  2I46 A;  4JI1 Q;  3JAM i;  1H9S A;  1VQ5 A;  3D4R A;  1I50 B;  2F52 A;  3S2H H;  3K3P A;  1CA6 A;  1UC9 A;  4GZY C;  2R6G A;  4L6T B;  1WTP A;  2R86 A;  3RR5 A;  3UI2 A;  4I50 F;  2Z6K C;  4X66 L;  5JEA H;  4BY7 B;  3HOV H;  1O7I A;  2Z4I A;  2QF7 A;  3K7U C;  2NUA B;  1Q12 A;  3N52 A;  1SNO A;  3UDG A;  1SYB A;  5HV6 A;  4JI5 L;  1EY5 A;  4NZN A;  4IFD G;  1Q8I A;  3DXJ C;  3H0G G;  1P8L A;  2JYO A;  5C44 G;  5I5W A;  4HJA A;  1KJQ A;  1ESR A;  2ABJ A;  1IHZ A;  4NZM A;  1SYG A;  1NY4 A;  2IJ0 A;  3K7A B;  3TIN A;  2AQ1 B;  2CZG A;  1L1O B;  2VQF L;  1AZP A;  2Z0S A;  3ICE A;  1DAA A;  1AUX A;  2H1E A;  2EJ0 A;  4HR7 A;  4LF9 Q;  4QL5 A;  3FRP B;  1TT2 A;  1CA5 A;  1SNC A;  1FJG L;  4O7N A;  1I6H B;  2Z8L A;  2Q2I A;  3LP8 A;  5IYB H;  4OXP A;  2C9O A;  4DF7 A;  2LY7 A;  2PYK A;  1K8O A;  2W6O A;  3HOX B;  1HA6 A;  3KJP A;  1ASZ A;  4DGZ A;  3SK6 A;  3RN2 A;  4DA2 A;  4MV9 A;  1VQM A;  2E2I B;  2O4X A;  1ET0 A;  4K2K A;  4DNI A;  1KAA A;  2F0H A;  5CC4 A;  3OUZ A;  4YWM A;  3M9B A;  4XZ3 B;  2W6M A;  2XRQ D;  1STG A;  3MA2 B;  2F0Q A;  4NXM L;  1VF7 A;  4KHP L;  2F0P A;  2F0K A;  1FD7 D;  3MWY W;  3WWJ A;  1ULZ A;  4X3T A;  1EEI D;  2OWO A;  1RHP A;  2BDN A;  5IP7 G;  1QB5 D;  1W3S A;  4MTN A;  3I90 A;  1MD2 D;  4X6A H;  1GKH A;  3C2P A;  2N8N A;  1Q81 C;  3QO2 A;  4TVI A;  3H91 A;  4HSV A;  1AW7 A;  1VQ7 A;  3T1H L;  1SMY C;  4OO1 I;  3QB3 A;  4HIK A;  1RF2 D;  3PUV A;  2EYH A;  3GTL H;  2BA1 A;  5T1I A;  2EZV A;  5FJ8 G;  3BA8 A;  4MA5 A;  1OXX K;  4CJ2 C;  1Q3L A;  1W2B A;  1QZG A;  5LXT F;  1T5E A;  1C9O A;  4RWS C;  2E8G A;  1DM0 B;  3QOJ A;  4PG3 A;  2GQR A;  3T54 A;  3DHQ A;  4JI8 L;  5CM0 A;  2O5I C;  1DV1 A;  2YZM A;  2WB1 G;  3VYT A;  2NZ1 D;  3I4L A;  1WD1 A;  3UDF A;  1SN8 A;  3HOW G;  2F0I A;  1WYD A;  4F8M A;  4DR1 L;  1QE6 A;  5JQG F;  4L63 B;  4JCV E;  4IOA A;  1OBG A;  4IUR A;  3HOW H;  3GV6 A;  1PFN A;  1Y69 U;  4JBW A;  3RUP A;  4DAM A;  4ZHQ F;  4A3E B;  3BG3 A;  2NVT B;  3QOL A;  5GAE C;  5FPR A;  4DUZ L;  1N33 L;  4QGU A;  5EKL A;  3P20 A;  3K57 A;  3HOZ H;  4LW1 A;  5CV6 A;  1PH7 A;  3G8D A;  2AWO A;  3D6C A;  5EBC A;  3U9T A;  1E2W A;  2WIN B;  2EE1 A;  4GLX A;  3GTO H;  3GJX B;  2K04 A;  4HTO A;  3WNZ A;  2F0S A;  2EYL A;  1YBY A;  2CW0 C;  2G9D A;  4RA8 A;  1XJV A;  3GTG B;  1FNU A;  3RLF A;  2F1M A;  3Q24 A;  4K5W A;  5IGC A;  3VNN A;  4UDU C;  1I2K A;  1HNZ L;  1S72 A;  1G29 1;  5DMX A;  3WWI A;  5IOC A;  1O7Y A;  1X32 A;  1PTO B;  1EY9 A;  1KRT A;  1XNR L;  2KHS A;  4NXM Q;  4C3J H;  4IPH A;  2Y0S B;  4DV2 Q;  1OTC A;  2CH4 A;  1I3Q H;  5KEE A;  1EKP A;  1EFW A;  3Q6S A;  4C3J G;  4R1J A;  5C0X G;  3RV3 A;  3KYH C;  3UDX A;  2V1C C;  3PMF A;  4UCR A;  1C30 A;  2L5T A;  1QUQ A;  5IGE A;  4FVM A;  1N36 Q;  4K8J A;  3AX6 A;  3NBY B;  1V1P A;  2K75 A;  1ZKO A;  4FXG C;  1GO3 E;  3M4P A;  2VUM G;  5HBR B;  5IGB A;  3A55 A;  3K6O A;  4LF5 Q;  2J4X A;  2RBM A;  2N78 A;  1TWG B;  2VQD A;  3MXN A;  4CKE A;  4DAV A;  3FKI H;  3RN5 A;  3FP9 A;  3TP5 A;  5JH7 F;  3V4Z A;  2QCP X;  3FKI G;  1X3P A;  4DN4 M;  1V1O A;  5FK9 C;  5C3E G;  3OTO Q;  3OW2 A;  1CQV A;  2L15 A;  4DK1 A;  5LOV F;  2A5H A;  1EZ6 A;  2P0A A;  3A8K E;  4XYO A;  1BCP F;  2NYZ D;  3PUY A;  4LWC A;  2RDF A;  3ULL A;  4O7L A;  2DJF C;  2Z6B A;  4PV1 C;  5BPF A;  4HN7 A;  1IOW A;  4I55 F;  4KN4 C;  4MHE A;  5AJ3 Q;  4DV2 L;  1WTW A;  4E6N A;  3S1Q B;  3CCQ A;  2L1B A;  4YCU A;  3Q8D A;  3SGI A;  3NQT A;  3E9I A;  4UP7 A;  1HUN A;  1KNE A;  1QNK A;  1WJJ A;  1PV4 A;  4LF6 Q;  2E74 C;  4KLK A;  1WCM B;  2F0L A;  4GOP C;  2EDG A;  1HNW L;  3PUW A;  3S1R H;  2XSC A;  5F2D A;  4JI5 Q;  1Q82 C;  4JV5 Q;  2UXC L;  4A3F B;  2F0G A;  2V59 A;  5D1O B;  4JI7 Q;  1GSO A;  1PK8 A;  5CGK A;  1M6V A;  4FXK C;  4JBJ A;  2A19 A;  1NMG A;  4WOR A;  3GLK A;  3SVM A;  3AEV A;  2I0Q A;  1NMF A;  3BAB A;  4F7X A;  2ZTD A;  1A15 A;  1AFP A;  1KLG D;  4RGN A;  4J15 A;  2R7L A;  5K36 G;  4NB3 A;  2K05 A;  4V0B A;  1EYA A;  5LL6 S;  1TS3 A;  4YWK A;  1ENF A;  4DK0 A;  2KCM A;  1NSN S;  2FMM A;  1SNP A;  5FKA C;  4FF3 A;  4LF7 L;  1MGS A;  1B53 A;  3TY9 A;  5E4W C;  2G5D A;  3RD4 A;  2Z1C A;  4CGY B;  3Q1K A;  5ELO A;  2F0M A;  1W6K A;  1XMQ L;  1HR0 L;  1R9T B;  2XD4 A;  1MIU A;  2N3S A;  4DAP A;  1V9P A;  5FR9 A;  1AN8 A;  5M5Y H;  2E2J H;  2UU9 L;  1QJO A;  2ICI A;  5JPN C;  1X3Q A;  3HOX H;  2JK8 A;  4L5Q A;  2GVA A;  3QFF A;  1S40 A;  1BXT A;  5LP6 F;  2R7D A;  1A9X A;  3C3L A;  3JAM E;  2B29 A;  1ML0 D;  1LTL A;  4UP9 A;  5LL6 X;  2OLS A;  2JQO A;  4RKL A;  1K8A C;  1HTL D;  4TVA B;  5CV4 A;  5KS8 A;  5BWX A;  3M4Y A;  3L3O C;  4IUT A;  3CCU A;  3K7A H;  1IBK Q;  2NTS A;  3NQI A;  3ITP A;  1LTG D;  4B3S L;  1PYW D;  3MXG A;  1TWF H;  3VR2 A;  2UXD Q;  2B63 H;  1EKV A;  2I80 A;  5DAA A;  2DWC A;  3M4O H;  3GDE A;  2HD3 A;  3PIP A;  4B3R Q;  3G48 A;  4MV7 A;  1MJC A;  1XNQ Q;  1XPR A;  4OWW B;  3S15 H;  3LNN A;  4DUZ Q;  4BY7 H;  1WTQ A;  3I56 A;  2Z4H A;  2JJQ A;  3GTJ H;  3PUZ A;  5HUR A;  3GTP H;  4GLW A;  1B9N A;  4DQN A;  3T1Y L;  2JP1 A;  4O7W A;  2PZW A;  4DR1 Q;  5LMU L;  4XIG S;  3T53 B;  1PH4 A;  1CQI B;  1FL0 A;  2Q2H A;  1VQO A;  4POF A;  1LM0 A;  1SNM A;  2NVY B;  1A62 A;  4LAA A;  1DON A;  3J7Y W;  3KLS X;  4HIO A;  3PQI A;  4GOP B;  2ZXP A;  4BBR B;  2NU6 B;  4O7R A;  4A3B G;  1EIG A;  4LFC L;  2OTL A;  2D0O A;  5M3M H;  5JQW A;  1U5K A;  3S24 A;  4IFD I;  4B9W A;  4A3J B;  2AQ2 B;  4IPG A;  2PZT A;  3M85 A;  3HOW B;  2F4I A;  3GTQ B;  3ND9 A;  1Y1V B;  4QF4 A;  3CCR A;  3BG5 A;  1VQD A;  1CSP A;  2Y4R A;  4ZI7 F;  4HJ5 A;  4BY1 G;  3STB D;  1LT5 D;  3WWH A;  1B04 A;  1HTP A;  5I5V A;  2D2C C;  1X55 A;  4GNX B;  1U4L A;  2L12 A;  3SNO A;  5C4X B;  2X6G A;  4OWT B;  1IZ6 A;  3A5U A;  3LWE A;  3A54 A;  3K0X A;  1FNV A;  1CI3 M;  4HMJ A;  1EY0 A;  1O80 A;  4ME6 A;  1JQY D;  4C1N I;  3HKZ B;  2YWV A;  1SAP A;  1H9M A;  1DCZ A;  1CUK A;  3NWS A;  4DFA A;  2YU9 H;  1T5X D;  2TSS A;  1LTT D;  1IBL Q;  4JI4 L;  2EYJ A;  2NN6 I;  2P5Z X;  3EVQ A;  3I4N B;  1SYC A;  1PRT B;  2ZXO A;  2IW3 A;  2IX3 A;  1VDZ A;  2JE6 I;  2F0N A;  4HID A;  1YJ9 A;  2AUJ D;  5J3B A;  1PFM A;  2B8G A;  3KUP A;  4CC6 A;  4DV0 Q;  2MP1 A;  2JA6 B;  1DJR D;  4LFB L;  3W5O A;  3JZF A;  4A93 G;  1ZYR C;  2L0C A;  3TIG A;  5CBA E;  3V4S A;  2NTT A;  2B2W C;  4Z9C B;  1M0W A;  1TY0 A;  2BDO A;  1XTC D;  1P16 A;  4DV7 L;  3CMA A;  3VR3 A;  3GID A;  2NU9 B;  1SNQ A;  4CBV A;  3ULP A;  2CCZ A;  5I5Y A;  2RCF A;  4R8I A;  2Z04 A;  2EXD A;  4LMQ D;  2EJF C;  3K5O A;  3OW7 A;  2IHF A;  2YZN A;  1K83 B;  3WO1 A;  1L0X B;  5I5T A;  4A76 A;  2F0J A;  2EYM A;  1IL8 A;  1PX2 A;  1XDN A;  1EQR A;  4FXD A;  3SDZ A;  1WTO A;  1UE5 A;  3E0J A;  2I5L X;  3OOC A;  1LTB D;  2CH4 W;  4RGM A;  4NXN L;  3WWV A;  4F87 A;  2FP4 B;  1SRO A;  2A6H C;  2Q2U A;  5JVH 3;  3MEF A;  4GKK L;  1M0T A;  1STY A;  4NPS A;  1II3 A;  1H9J A;  2E76 C;  1CKM A;  1SND A;  3DWA A;  3K5M A;  4HJ8 A;  1BCP C;  1CM9 A;  3K5L A;  5FLM H;  4JI0 Q;  1E1T A;  1JE5 A;  3FPP A;  4BBS B;  3BZD B;  1V43 A;  4QMG A;  5I5S A;  1OXT A;  3MWD A;  3S2H B;  4LF7 Q;  1VQP A;  4L8J A;  1K0R A;  5BWR A;  2XCL A;  3T9D A;  2B2V C;  2QEX A;  3SEB A;  4DV3 L;  5M5W H;  2KA7 A;  5IYZ F;  3HOU H;  4MA0 A;  1MHW C;  1D5M C;  4OEL B;  1LTS D;  5CE8 A;  3T4A C;  2K1B A;  4JC0 A;  3CME A;  1KD1 C;  5COR A;  3HEJ A;  3CCM A;  1IBM Q;  4DNR B;  1DXM A;  4A3K H;  4JYA L;  3HGB A;  1ZEQ X;  1YNN D;  4QSH A;  1UWV A;  2HQE A;  1R9T H;  1IBK L;  2K03 A;  4ZUI A;  1CFM A;  4YIJ A;  1K9M C;  1OBD A;  1X54 A;  5BR8 Q;  2FJ2 A;  3CQZ B;  1QOH A;  3HOY G;  4O4L F;  2DY8 A;  3TY8 A;  4X62 L;  3TS0 A;  2A8V A;  4FNF A;  1YNN C;  2GA4 B;  2B2T C;  2R92 G;  3JRW A;  1AP0 A;  1I2L A;  5KYI A;  2NVQ B;  2I5M X;  4X64 Q;  2HDK A;  3SXH A;  5I4D A;  2JEA I;  2E75 C;  4IFD J;  5G3L F;  3ZJY C;  2QK4 A;  1Y14 B;  5FO9 B;  3PFF A;  1S68 A;  5IWA L;  2WII B;  2B2W A;  2R93 B;  4MIU A;  1WCM G;  4G4K A;  4R4C A;  1MI2 A;  1K8M A;  2X0S A;  1PH2 A;  1VQ8 A;  3PO2 B;  1WCM H;  4R4Q A;  3U50 C;  4B3S Q;  3HS0 C;  4M1U B;  1L1O A;  4CE5 A;  4LUZ A;  2ZDQ A;  2F0W A;  2EY1 A;  4FGR A;  3TRE A;  1H9R A;  1SFO B;  1GLV A;  1RL2 A;  3G4S A;  1PH1 A;  1HFG A;  3S1Q H;  5G3L D;  1BO0 A;  3R2T A;  2VR1 A;  4M9U A;  1HPC A;  3F2B A;  3T16 A;  2KUM A;  2CW0 D;  1DZ1 A;  2QKI C;  1EOT A;  4K5V A;  1VQJ A;  1JB3 A;  4DV5 L;  3STB C;  3KAK A;  2NU8 B;  2KHJ A;  1STB A;  3T99 A;  5EKI A;  1IYD A;  3TP6 A;  5DNF A;  1S4Z A;  1WTR A;  1BUV T;  1TS2 A;  2R7Z B;  4YCW A;  2RSN A;  4C3I G;  5I2Y A;  2IY5 B;  3UFX B;  1I4R A;  3AQQ A;  3FPU B;  1M90 C;  4LF8 L;  1B9M A;  2EJG C;  2YL2 A;  1KLU D;  3ER0 A;  4GNX A;  4DK3 C;  2HVS A;  4WBN F;  4FFN A;  5AJ3 L;  3ORR A;  1PZJ D;  3B6Y A;  4QIW E;  3BA9 A;  1EU3 A;  1VQ6 A;  2ZXR A;  2GVB A;  1F9S A;  4YAK B;  1BKB A;  1VBG A;  5M3F B;  5C6A A;  1E3P A;  1PXU A;  4I65 A;  3G71 A;  1ONL A;  3D31 A;  1EYZ A;  5C0X J;  3TQT A;  1E7Z A;  2VS1 A;  5C4J B;  2AHO B;  4O1N A;  2OT2 A;  1SLJ A;  1JOQ A;  3I2Z A;  3KF6 A;  4AYB B;  2NVX B;  2MNA A;  3F2D A;  1KIX A;  4UCO A;  4NW2 A;  2CKZ B;  4X64 L;  3GB8 B;  1I7N A;  4O2B F;  4LFB Q;  4JV5 L;  1IYV A;  1DOL A;  3H0G H;  1ILP A;  4HTH A;  4C5B A;  1HHV A;  4JI2 L;  4YB8 B;  2IHE A;  1U4M A;  1PH9 A;  3CCV A;  1HNZ Q;  1DD2 A;  1ET9 A;  1GOZ A;  4ZAI A;  4C2M B;  3FDT A;  1G2W A;  1WTX A;  4PMB A;  4EFE A;  2JA9 A;  4P2C B;  3TEK A;  3GTO B;  3BVG A;  4DV7 Q;  1Q1E A;  1EWC A;  1PH5 A;  1W93 A;  2A73 B;  4ZOL F;  4A3D B;  5DGI A;  1A3T A;  1PMR A;  1YHA A;  3CSW A;  3M3Y H;  3NC0 B;  4QUC A;  2K6A A;  5EQ0 A;  1G8Z D;  1RTO A;  3IL8 A;  3V05 A;  4DV6 Q;  2PBZ A;  1B3A A;  4CMF A;  4DR7 L;  1IYJ B;  2WB1 B;  4BA2 I;  4OX9 L;  3ND8 A;  3RZD B;  3ETH A;  3U4V A;  1BOS A;  1VQI A;  1VQA A;  2WAC A;  2JEB I;  4JG2 A;  2A68 C;  3I91 A;  4MV4 A;  3U55 A;  2KBN A;  2EJ3 A;  5C4H A;  3T13 A;  3VYR A;  2RKS A;  3H09 A;  2D62 A;  3GTP B;  1B6R A;  4FFR A;  4TRD A;  2RDG A;  4HJ7 A;  3JZI A;  1JWM D;  3OIP A;  4O4H F;  2B63 G;  1UUP A;  2HDL A;  2YRX A;  3EFX D;  1ICW A;  1E2Z A;  3GTK B;  5HY6 A;  3M4O B;  1DIK A;  1SMY D;  1VQB A;  5C3X A;  4NXN Q;  3TRZ A;  1TWF B;  4P74 A;  3CCL A;  2WAQ G;  4CJ0 B;  1IBM L;  2EIF A;  2F0V A;  4RAU C;  2A6H D;  3S14 H;  3EA6 A;  4N9T A;  1BBX C;  2YZG A;  1RDP D;  5IT9 L;  1NBW A;  2AQ3 B;  3H94 A;  1HZA A;  1I4Q A;  2PZU A;  4EVO A;  3MTS A;  2ENB A;  2N88 A;  5IYC G;  2A1H A;  5KNB A;  5BR8 L;  4OON A;  3E9H A;  2HJW A;  4RZQ A;  1VQK A;  1SSO A;  4X3U A;  2E2I H;  3NEL A;  4IAL A;  1YI2 A;  2UUC L;  5KGU A;  2DNC A;  4A3B H;  1EIH A;  3KLW A;  2JA7 H;  1PTO C;  4DU9 A;  2AKW B;  3W2D A;  4ZKB B;  2L55 A;  2JA5 H;  2FPI B;  1Y1W G;  3T9F A;  2JA5 B;  3OWF A;  1KC7 A;  5FO8 B;  3HOZ G;  3CCJ A;  4A3D G;  1G2S A;  2WAQ E;  1JMC A;  2JA5 G;  2E2J B;  1EYC A;  3QWU A;  1PTO D;  2O5J C;  4CDF C;  2RHS B;  4R8N A;  2EY5 A;  5CR5 A;  2M00 A;  3RV4 A;  2FPP B;  1XMO Q;  3CKI B;  2A69 D;  2K14 A;  2F0U A;  2I87 A;  2EXZ A;  3F2C A;  2R7M A;  5I9P A;  3HKS A;  3TN2 A;  3JSN A;  5KNC A;  4RCN A;  1KEE A;  3ERO A;  2V58 A;  1S5F D;  1O7Z A;  2EYF A;  1I4G A;  1G2T A;  5FO7 B;  3MVV A;  3W3A A;  1J5E L;  3NUA A;  4DXF A;  4I7Z C;  4X62 Q;  5D1P A;  5I47 A;  5HGT A;  1MSH A;  3UQ8 A;  1KDA A;  2NUC A;  4E6I A;  3PIO A;  1GUO A;  3HOV B;  3NTI A;  4O2D A;  5C0X H;  2R93 H;  5DEH A;  4NKL A;  4KY5 A;  3DM1 A;  4DV5 Q;  2R93 G;  4BXX G;  3HRZ C;  2W6Q A;  4ABN A;  1ET6 A;  1F2Y A;  3I8Z A;  1QVG A;  4XDX A;  1BR9 A;  3I4M B;  3QJY A;  2UUA Q;  4PZ7 A;  1UEB A;  3RZD H;  4U67 3;  4FFM A;  1JDE A;  1K73 C;  1IOV A;  1I94 L;  4ZCK A;  2F4V Q;  1KT8 A;  3TDQ A;  4JI4 Q;  3GTM B;  3DWQ A;  4EQ5 A;  2B2V A;  1IBL L;  3EBE A;  1PDQ A;  4IJH A;  3VR4 A;  3R23 A;  3AFP A;  4TUY F;  3SE0 A;  4O4J F;  3QWN A;  3ORQ A;  2LKV A;  4GS3 A;  1EY8 A;  2ALY B;  5C3E H;  2R84 A;  4O86 A;  2HCC A;  1D5X C;  4DV0 L;  3KBG A;  4IUV A;  1M1K C;  3PN1 A;  1QUQ B;  1HR0 Q;  3NP8 A;  1Q8K A;  5CV7 A;  3DLL A;  3VMM A;  5DLQ E;  2NB0 A;  3R9R A;  1H9K A;  4FFL A;  5FNV F;  1EY6 A;  5JOB A;  1CQJ B;  1CKN A;  3K0Y A;  4GKK Q;  2K5H A;  5CBE E;  1N8R C;  1C3O A;  1RIP A;  3SK8 A;  4EEQ A;  4X65 Q;  3F1Z A;  4N9P A;  2IP4 A;  1HQM C;  1Z2O X;  1JLL B;  4Q4C A;  4PMW A;  1AE2 A;  4C3H G;  5BWU A;  2EOT A;  4PMC A;  1RJT A;  1B8A A;  1TQO A;  2ZT9 C;  1UC8 A;  3C1F A;  5CV9 A;  2RDH A;  1N34 Q;  3CP0 A;  3RLO A;  2HHH Q;  3I4M G;  1K28 A;  4O81 A;  2H4O A;  4G7H C;  5FLM G;  1JCK B;  1GD7 A;  2R7N A;  2FMC A;  2E2D C;  2K33 A;  4BBS H;  2ZJR A;  4O2A F;  2ZGI A;  3VDY A;  4HR7 B;  3PCO B;  3Q22 A;  4IJL A;  1AUV A;  2F4V L;  1SYE A;  3VPC A;  4RKB A;  5NUC A;  2A6E C;  2COJ A;  1I3Q B;  5IGG A;  2B2U C;  1XTD A;  4HTP A;  3CRK C;  2KQ3 A;  2Q8T A;  4GNX C;  3I55 A;  1XPU A;  3ZYY X;  1IYE A;  3I73 A;  5J2U F;  2BA0 A;  4J6H A;  2MPM A;  5D3D A;  2LS0 1;  1JKJ B;  4QB4 A;  4LFA Q;  4JBM A;  3T9B A;  4B08 A;  2O2L D;  3BDO A;  1C48 A;  3NBH B;  3HP3 A;  3DMU A;  4A3K G;  4GLA C;  3NSW A;  4A3G B;  3H3V I;  1OO9 B;  2BOS A;  1F2Z A;  1XX8 A;  4O82 A;  1A0I A;  4EQP A;  3OTO L;  4A3G G;  1LT4 D;  3A8I E;  4TV9 F;  1LLR D;  5JJL A;  3BVZ A;  1GJX A;  3NBI A;  5GRO A;  4OO1 H;  3HKZ E;  3UYY A;  3K5N A;  2DAB A;  1AZQ A;  3S1N H;  4JI7 L;  4G7O C;  3SK5 A;  5D3I B;  2JA6 G;  3K58 A;  1BCP D;  4IUP A;  1SFO H;  1EUC B;  1GGO A;  3HT5 A;  1TS4 A;  2DGY A;  3KLS A;  4QY7 A;  3CXC A;  4IWY A;  4A3E G;  4A3I G;  3H3V H;  5BPH A;  5A2Q L;  4DV6 L;  4PBC A;  2DY7 A;  2BCO A;  1L1O C;  5CYU A;  4A3I H;  4KHZ A;  2W70 A;  3MJF A;  1LAB A;  2RQX A;  4QQB X;  2K5V A;  2C5C A;  2VUG A;  2IL8 A;  2ZTC A;  3KOJ A;  4CKC A;  3L2P A;  3A0J A;  1AH9 A;  5EAY A;  4H13 C;  1L0W A;  2VZA A;  5IWA Q;  2Q7D A;  4FO2 A;  2NU7 B;  1TY2 A;  1Z6H A;  4GN4 B;  4ULL A;  5LHY 1;  4GOP A;  2AWN A;  4DV4 L;  3X3M A;  4DAA A;  4P73 A;  3R2I A;  4RFB A;  4JK1 C;  2JSO A;  5D14 A;  1M8A A;  3H15 A;  3VR6 A;  5IY0 A;  4KKT A;  5BWT A;  1JWU D;  1V1P B;  3MFY A;  5EGT A;  3I3C A;  4LF4 Q;  1Q7Y C;  1SYD A;  1VQH A;  1UEA B;  1TKW B;  3MC0 B;  4G7Z C;  4MV3 A;  1Y1V G;  4A3K B;  2R61 A;  2DN8 A;  2VW9 A;  3S17 B;  4UCU A;  3RUZ A;  1XMQ Q;  3NTK A;  1NE3 A;  4A3J G;  4BBR H;  2ASB A;  4LFA L;  5E4X A;  2I8C A;  1BBW A;  2NVY H;  1WFQ A;  4BBR G;  2V5A A;  1XMO L;  2Y0S E;  1I1K A;  3T7A A;  4U68 A;  2DNE A;  2OTJ A;  3HG9 A;  2EVB A;  3IFD A;  1PH8 A;  1XNQ L;  3TSS A;  4BY1 H;  1GUN A;  2OEO A;  3QR8 A;  3V96 A;  3ETJ A;  2VNU D;  5KRU A;  1EQV A;  1K3B C;  1A2T A;  5D65 A;  2J0T D;  1JC7 A;  2EIY A;  4ME5 A;  1CTM A;  3KRE A;  2PVP A;  3CRL C;  1F77 A;  2SNM A;  1YIJ A;  1JIC A;  5JEA G;  3R5H A;  3U54 A;  3KBX A;  1TA8 A;  4FF4 A;  4LFC Q;  1SE3 A;  4ZLT F;  5JEA J;  4WHX A;  2ZDG A;  4EQO A;  4XX0 B;  1S5B D;  1SYF A;  3BZK A;  2R87 A;  3DTF A;  1V1Q A;  2LSS A;  5I5X A;  5JVD F;  3UDI A;  3VA5 A;  2ZM6 L;  5LMN Q;  1X65 A;  3IFT A;  1CHQ D;  1B50 A;  3NEN A;  4O7Y A;  4M8A A;  3S16 H;  1I50 H;  5E7N A;  1BF4 A;  2K5W A;  1EHI A;  1L2F A;  2MUY A;  3QIA A;  2GPS A;  4O7T A;  3T9C A;  3KFU A;  5I9O A;  1KAB A;  5CB4 F;  4DR6 Q;  2X6L A;  4PZ6 A;  2K52 A;  4HED A;  2JXM B;  2F0D A;  2A68 D;  4R9W A;  5IYB G;  1TAE A;  2KOL A;  2HGX A;  4AQY L;  4A93 H;  2JA7 B;  4A3C H;  3QQM A;  1O78 A;  3I4O A;  4RHS A;  1NJI C;  3S17 H;  4XQJ A;  2Q8R E;  1EEF D;  2CWA A;  3OMG A;  3AMU A;  1WTH A;  2NWG A;  2PQE A;  5E1F A;  4DR7 Q;  2HG8 A;  4TV8 F;  2YU9 B;  1VQC A;  2K01 A;  2VXW A;  3LUL A;  4NZO A;  5IP7 H;  4DRF A;  1UAP A;  2HDM A;  2G9H D;  1JJ2 A;  3H6M A;  5COY A;  5BYA A;  1L0Y B;  2WFW A;  4GLV B;  2R85 A;  2BE5 C;  3U0G A;  3A7A B;  1PYS B;  3M7N A;  1QG7 A;  3NHH A;  2RSO A;  1AE3 A;  4O0A A;  2WKC A;  1YHQ A;  3OHX C;  3NK9 A;  2YS6 A;  3J7Z C;  1SBB B;  1SJH D;  4UCT A;  1PZK D;  4A3F H;  4L5T A;  3NTH A;  4DR6 L;  1C4Q A;  2HQL A;  4YJ2 F;  1GUT A;  1F9Q A;  4PNY A;  3SE7 A;  3J81 i;  4B3T L;  4RH6 A;  1VCI A;  3OWE B;  4C3H B;  1R4Q B;  2SOB A;  5BN5 A;  2CNQ A;  5ELB A;  4WFN 3;  1YZ6 A;  1TWA B;  3A56 A;  4HCE A;  1LO5 D;  5KX5 F;  1TWH H;  3Q23 A;  1PRT F;  1D8L A;  2K5N A;  4H44 C;  2A6E D;  3M3Y B;  3FHW A;  5HGQ A;  2HCI A;  1SDF A;  1HFN A;  4K2L A;  1D5Z C;  5I6W A;  4FFP A;  1KJ8 A;  1AEX A;  2F0T A;  1E1O A;  1STA A;  5JAV A;  1NCV A;  4L5S A;  3SR1 A;  4C5C A;  4YAJ B;  5GAD C;  2GLT A;  4PZ8 A;  3JZ6 A;  2CQA A;  3VYU A;  1TII D;  3KAJ A;  1VQ9 A;  2JA8 B;  1EU4 A;  4NMZ A;  4HMI A;  4FF2 A;  3MWE A;  1STH A;  4N8F A;  5DM7 3;  1NUC A;  3G8C A;  4JOI C;  3KF8 B;  2K5Q A;  1I5F A;  5HNE A;  1B6S A;  1LV9 A;  1B3Q A;  5ELN A;  4DUY L;  2QEJ C;  2UUB Q;  4EG0 A;  1Z2P X;  2KJX A;  1TWG H;  3BU2 A;  2M9V A;  3TQY A;  3GTJ B;  4RCO A;  3U58 A;  4GKJ Q;  1GUG A;  5C5M A;  3UE1 A;  2QIL A;  2NZO A;  1KBL A;  2N49 A;  3PF4 A;  5M9O A;  4S3S A;  3PO2 G;  4OIJ A;  2YS7 A;  1PH6 A;  2SEB D;  2MGS A;  4DR4 Q;  4APV A;  4FP5 D;  1G6Z A;  3IAY A;  1FGB D;  1SE2 A;  2WP8 J;  5M3F H;  1I4P A;  4BXX H;  5TSS A;  1X56 A;  5JPM C;  1BDO A;  5GAH C;  4LUV A;  2PPB C;  1A6X A;  2VPQ A;  4NP5 A;  1JJG A;  4K5X A;  4C3J B;  1XPO A;  1HRJ A;  1E2V A;  4AIM A;  1Q1B A;  2PNH A;  1PTO H;  1WTV A;  4ZQI A;  2LMC B;  1UE7 A;  5ELD A;  4Q0F A;  1S5D D;  1NTG A;  4K6N A;  1MSG A;  5K3W A;  4TKO B;  3DUZ A;  4TM5 A;  1E22 A;  2HUG A;  1CQF A;  2QDB A;  2R7F A;  2F0F A;  3VPB A;  1JOR A;  5M5Y B;  1X3E A;  2OCE A;  3A74 A;  2R3Z A;  2RF4 A;  3GQB A;  4P71 A;  4MN3 A;  5BN4 A;  1F2M A;  4JYA Q;  2L11 A;  1B7Y B;  1D7Q A;  4EGJ A;  5C3E B;  4JVZ A;  4C3I H;  1B44 D;  1RTN A;  1SXT A;  1DOK A;  4IPD A;  4RHR A;  3CC7 A;  4UHV A;  2ATW A;  2B2Y C;  3K8A A;  5FLX c;  2EJM A;  5EKK A;  1TWH B;  2HHH L;  1EL0 A;  5E3F A;  1GHK A;  3TW6 A;  4PQX A;  1FNW A;  3NPP A;  1TWA H;  4EFB A;  4JI2 Q;  3GTM H;  5DGH A;  5CAE B;  5C1P A;  4C3H H;  3IRB A;  5C1O A;  2GQS A;  1I1L A;  3D0F A;  3TII A;  4A75 A;  1WRV A;  4CDE C;  3I4M H;  4RG1 A;  2K5D A;  4J8Q A;  3CCE A;  2VY3 A;  5DAU A;  3P7J A;  3L7Z C;  2D0P A;  3RFC A;  3I72 A;  3K80 C;  4BBS G;  4UP8 A;  3J7A 5;  1WD0 A;  4JXU A;  4I7A A;  1N34 L;  3BAC A;  1F9R A;  1ZYR D;  3J80 E;  4AH6 A;  5IT9 E;  2YTY A;  1VMP A;  1Q86 C;  5C5L A;  4CDD C;  3S1R B;  4BWG B;  5EJW A;  2OF1 A;  1YHB A;  3M7G A;  5IP9 G;  2PMZ B;  4A3M B;  1ASY A;  3CF5 A;  4POG A;  1YJW A;  2FIN B;  4HQ6 A;  3FMC A;  1YNJ C;  3CPF A;  5H1S E;  2B2T A;  1U4P A;  1V8Q A;  4BA1 I;  1PFB A;  4Y7N H;  4C3I B;  4LF8 Q;  1GSH A;  4YCV A;  1VQL A;  3EIV A;  4O84 A;  2CQO A;  4DV1 L;  4XT1 B;  1QNU A;  1LTI D;  1N32 L;  1OXU A;  2KED A;  4FDB A;  3PV0 A;  4J1M A;  5CV8 A;  3CD6 A;  2DZD A;  4HNU A;  1NNX A;  2V4D A;  3T9A A;  2KVM A;  4A3L H;  4ID6 A;  2Q2T A;  1CK1 A;  1GUW A; 
#chains in the Genus database with same CATH homology
 1LYL A;  3HOX H;  2JK8 A;  4L5Q A;  2GVA A;  1EIF A;  2Z6K A;  5M3F G;  4DV5 Q;  2R7D A;  1E24 A;  1S40 A;  4BXX G;  4DR5 L;  3I7F A;  2B29 A;  2QGQ A;  2KCT A;  3HOX G;  1QVG A;  4B3M L;  1PVO A;  2UXB Q;  1XNR Q;  2K4K A;  5IYD G;  2UUA Q;  1X6O A;  1LTL A;  4PZ7 A;  4UP9 A;  2UUA L;  1UEB A;  3RZD H;  2NVQ H;  4UPA A;  1K73 C;  1HJP A;  2JQO A;  1K8A C;  1I94 L;  4CC5 A;  4TVA B;  4JI1 L;  1Z47 A;  2F4V Q;  4JI4 Q;  3W1G A;  4EQ5 A;  2PQA B;  4KI0 A;  3EBE A;  4X65 L;  3K7A H;  4IJH A;  3CCU A;  1IBK Q;  3AFP A;  1IBL L;  4HJ9 A;  4JI3 Q;  2ZJQ A;  3RNU A;  1VQF A;  2DUD A;  4B3S L;  2MQH A;  3CQZ H;  1KRS A;  4GS3 A;  2ALY B;  1TWF H;  5C3E H;  2HT1 A;  4X66 Q;  2UXD Q;  4WJ4 A;  2B63 H;  4DV0 L;  3M4O H;  3GDE A;  1M1K C;  4JI0 L;  4B3R L;  1N32 Q;  3PIP A;  3ULJ A;  1J5E Q;  1QUQ B;  1MJE A;  2FXQ A;  3G48 A;  1HR0 Q;  4B3R Q;  1G6P A;  1Q8K A;  1MJC A;  3DLL A;  1XPR A;  5DLQ E;  4L5R C;  4OWW B;  1XNQ Q;  4OWX B;  5LMU Q;  4DUZ Q;  3S15 H;  2E5L L;  1VS0 A;  1CKN A;  3BJU A;  3I56 A;  4BY7 H;  2K5H A;  2JJQ A;  3GTJ H;  3PUZ A;  1N8R C;  1DGS A;  3CW2 C;  4GKK Q;  2ID0 A;  2YTX A;  1KC8 C;  1H95 A;  1RIP A;  3CPW A;  1QZH A;  3JSL A;  4EEQ A;  2CFM A;  3GTP H;  4LF9 L;  3K81 C;  4LF5 L;  1PA6 A;  4X65 Q;  3CAM A;  3F1Z A;  4GKJ L;  3T1Y L;  2VQF Q;  4DR1 Q;  1MKH A;  5LMU L;  4XIG S;  1PH4 A;  1N9W A;  2Q2H A;  1FL0 A;  1AE2 A;  1WI5 A;  2CWP A;  4PMW A;  1LM0 A;  4POF A;  5IYC H;  4DUY Q;  1VQO A;  1EIY B;  4LH7 A;  4UCV A;  1A62 A;  1B8A A;  3KJO A;  1OXV A;  4HIO A;  4DR2 L;  1N34 Q;  3CP0 A;  3RLO A;  4GOP B;  4P72 A;  2HHH Q;  1UE1 A;  3I4M G;  4A3B G;  5FLM G;  4LFC L;  1GD7 A;  3CC4 A;  4DAY B;  1JT8 A;  3AYH B;  2D0O A;  2OTL A;  5M3M H;  4MNO A;  3A5Z B;  3JAM c;  4BBS H;  1U5K A;  2ZJR A;  4IO9 A;  4JI6 L;  3S24 A;  2R7Z G;  4IFD I;  4WJ3 M;  3VDY A;  3PCO B;  5M3M G;  4A3D H;  4LF4 L;  1HNW Q;  4IJL A;  2F4V L;  4IPG A;  1YVC A;  3M85 A;  4P75 A;  2PI2 E;  4R4O A;  1XTD A;  1X3F A;  4LF6 L;  1N33 Q;  4HTP A;  3CCR A;  1VQD A;  1CSP A;  3HOU G;  5IP9 H;  1S3O A;  4DV3 Q;  4GNX C;  1J6Q A;  1EYG A;  4HJ5 A;  3I55 A;  1XPU A;  4C2M H;  4BY1 G;  1KL9 A;  3STB D;  3BAA A;  2BA0 A;  3KDF B;  1B04 A;  4LFA Q;  1PYB A;  4JBM A;  1X55 A;  4GNX B;  3RTX A;  2YYZ A;  3ERS X;  4LNQ A;  3NBH B;  3GTG H;  4K0K Q;  1GVP A;  4OWT B;  1IZ6 A;  1CKO A;  4DPG A;  3A5U A;  4JI8 Q;  2YV5 A;  4GLA C;  4A3K G;  4A3G H;  2BH8 A;  4R4I A;  1HZB A;  3K0X A;  3H3V I;  2HIX A;  5C4X H;  1A0I A;  1EUJ A;  1X3G A;  2OQK A;  3PGZ A;  3OTO L;  4A3G G;  4YHH L;  5IT9 c;  5JJL A;  4A3L G;  5C4X G;  3MXN B;  2IT1 A;  5GRO A;  3UE0 A;  5C4J H;  2JA6 H;  3HKZ E;  4K0K L;  3NBZ B;  3S1N H;  1BBU A;  3NEM A;  4JI7 L;  1CUK A;  4DR4 L;  2HVR A;  2YU9 H;  2NVT H;  3T1H Q;  3I4N G;  1IBL Q;  2JA6 G;  2HIV A;  4ALP A;  1CSQ A;  4JI3 L;  4JI4 L;  1SFO H;  1VQN A;  4A3E H;  5LMN W;  2ZM6 Q;  5LMN L;  2DGY A;  2NN6 I;  4QY7 A;  3CXC A;  5IYD H;  3GTQ H;  4YWL A;  3I4N H;  3E0E A;  4UY8 C;  2IX0 A;  3RZO H;  4A3E G;  4A3I G;  3H3V H;  1OXS C;  2JE6 I;  4HID A;  4DV6 L;  1YJ9 A;  1N36 L;  5J3B A;  4CC6 A;  1L1O C;  5GAG C;  4KHZ A;  4A3I H;  3TS2 A;  4DV0 Q;  2VQE Q;  4QQB X;  2E2H H;  4B3M Q;  2MFI A;  1TWC H;  4LFB L;  3W5O A;  2K5V A;  3EN2 A;  4A93 G;  4A3C G;  2VUG A;  1VQE A;  1EOV A;  2ZTC A;  3JC6 6;  3KOJ A;  3L2P A;  4EX5 A;  3A0J A;  1AH9 A;  1P16 A;  4DV7 L;  3CMA A;  5EAY A;  4H02 A;  2I5H A;  1L0W A;  2VZA A;  3ULP A;  2BH2 A;  4IOC A;  2CCZ A;  5IWA Q;  1I6H H;  1I94 Q;  1QVC A;  2EXD A;  1PFS A;  2EQS A;  4GN4 B;  4GOP A;  2IHF A;  2AWN A;  1HNX Q;  4BY7 G;  4DV4 L;  4P73 A;  3RLN A;  3LGJ A;  4A76 A;  3H15 A;  1XDN A;  1EQR A;  5IY0 A;  3T1Y Q;  1QVF A;  1KQS A;  1UE5 A;  2I5L X;  4LF4 Q;  3BZC A;  1FVI A;  1Q7Y C;  5C0X I;  4NXN L;  3WWV A;  1VQH A;  2LXJ A;  1B70 B;  1SRO A;  1Y1V H;  2Q2U A;  2C35 B;  3MEF A;  4GKK L;  1K8G A;  4NPS A;  1Y1V G;  3G6E A;  5D1O A;  1CKM A;  1FGU A;  2VW9 A;  4A3J H;  4HJ8 A;  4UCU A;  1BVS A;  4JI0 Q;  4AYB G;  4MZ9 A;  1E1T A;  1JE5 A;  5FLM H;  4DV1 Q;  1XMQ Q;  3PO3 H;  3S2D H;  1V43 A;  1NE3 A;  4A3J G;  2PQA A;  3PO3 G;  1OXT A;  2K50 A;  2NN6 G;  2AMC B;  3PSI A;  4BBR H;  1Z9F A;  4LF7 Q;  4LFA L;  2ASB A;  1VQP A;  3AEV A;  5JJK A;  1K0R A;  3KF6 B;  2A1A A;  2IX1 A;  3PF5 A;  1BBW A;  2NVY H;  1YNX A;  1WFQ A;  2QEX A;  4BBR G;  1A63 A;  1XK5 A;  1Q46 A;  2Y0S G;  4DV3 L;  2B3G A;  5M5W H;  2Y0S E;  1YJN A;  4JI1 Q;  1XMO L;  3JAM i;  1VQ5 A;  1GM5 A;  3HOU H;  2OTJ A;  2RHQ B;  4GN3 B;  1PH8 A;  1XNQ L;  2F52 A;  4BY1 H;  3S2H H;  1HZ9 A;  2R6G A;  2VNU D;  4JC0 A;  3CME A;  1HNX L;  3CCS A;  1KD1 C;  3RR5 A;  3CCM A;  2Z6K C;  1IBM Q;  4X66 L;  4JI6 Q;  1JJC B;  3HOV H;  1O7I A;  3K7U C;  4A3K H;  4JYA L;  1Q12 A;  1YIJ A;  5JEA G;  2PI2 A;  3UDG A;  1UWV A;  1R9T H;  4JI5 L;  1TA8 A;  3L0O A;  1IBK L;  2ZTE A;  4LFC Q;  4IFD G;  1K9M C;  5JEA J;  1X54 A;  5BR8 Q;  3OYY A;  3HOY G;  3H0G G;  3BZK A;  2MO0 A;  1P8L A;  3TY8 A;  5C44 G;  1HR0 W;  4HJA A;  4X62 L;  4OO1 G;  4A3M G;  3DM3 A;  1V1Q A;  3W1B A;  1LUZ A;  4KHP Q;  3TS0 A;  2LSS A;  2A8V A;  1NY4 A;  3HOY H;  3UDI A;  2ZM6 L;  5LMN Q;  1L1O B;  2R92 G;  1X65 A;  2VQF L;  2KHI A;  4A3M H;  2Z0S A;  3ICE A;  3NEN A;  3S16 H;  1I50 H;  5E7N A;  4LF9 Q;  4QL5 A;  2R92 H;  2I5M X;  1L2F A;  2GN5 A;  4X64 Q;  3KDF A;  3M4Q A;  1FJG L;  4OX9 Q;  3KFU A;  5DIS C;  2Q2I A;  2F3I A;  2JEA I;  4IFD J;  4ME3 A;  3ZJY C;  5IYB H;  4OXP A;  4DR6 Q;  1Y14 B;  4PZ6 A;  2RCN A;  2K52 A;  1S68 A;  5IWA L;  5IYB G;  1CKN B;  3KJP A;  1ASZ A;  1TAE A;  2VL6 A;  1VQG A;  1HH2 P;  4AQY L;  3HKZ G;  4A93 H;  4A3C H;  1SRU A;  4R4C A;  1WCM G;  3RN2 A;  3I4O A;  4TQU S;  1VQM A;  3U4Z A;  1NJI C;  3S17 H;  1PH2 A;  1VQ8 A;  2VUM H;  1VQ4 A;  1WCM H;  4R4Q A;  3U50 C;  4B3S Q;  4DNI A;  1L1O A;  4LUZ A;  2UXC Q;  1YEZ A;  4YWM A;  3M9B A;  2VQE L;  2CWA A;  3TRE A;  4NXM L;  4KHP L;  4DR7 Q;  1RL2 A;  3G4S A;  1VQC A;  1PH1 A;  2OWO A;  1IXR A;  3S1Q H;  5IP7 G;  3F2B A;  1W3S A;  4MTN A;  1SE8 A;  4X6A H;  1GKH A;  2N8N A;  1VQJ A;  5IP7 H;  1Q81 C;  4DV5 L;  4DRF A;  1K83 H;  1VQ7 A;  3STB C;  3T1H L;  2WB1 E;  1JJ2 A;  4OO1 I;  2KHJ A;  4HIK A;  2UU9 Q;  3PUV A;  3GTL H;  2WFW A;  2BA1 A;  4GLV B;  5FJ8 G;  3BA8 A;  1OXX K;  2UUC Q;  1PYS B;  3M7N A;  4YCW A;  1U0L A;  1W2B A;  3HFZ B;  1AE3 A;  4O0A A;  4AQY Q;  1QZG A;  2IY5 B;  1YHQ A;  1C9O A;  3AQQ A;  2E8G A;  4PG3 A;  3J81 j;  1M90 C;  4LF8 L;  3J7Z C;  1EWI A;  4UCT A;  4JI8 L;  4A3F H;  4L5T A;  1SMX A;  4DR6 L;  2HQL A;  2WB1 G;  4DKA C;  3ER0 A;  5M5X H;  4A4I A;  4GNX A;  3UDF A;  1SN8 A;  3HOW G;  1WYD A;  4DR1 L;  1KAW A;  3J81 i;  4LH6 A;  4DK3 C;  4B3T L;  2HVS A;  2H5X A;  1VCI A;  2QA4 A;  5AJ3 L;  4JCV E;  3B6Y A;  4IOA A;  4QIW E;  3HOW H;  4JBW A;  1YZ6 A;  4DAM A;  3BA9 A;  3F8T A;  1VQ6 A;  2GVB A;  1BKB A;  4YY3 Q;  1TWH H;  1D8L A;  2ZJP A;  1E3P A;  2K5N A;  5GAE C;  4YHH Q;  5FPR A;  3FHW A;  5HGQ A;  3G71 A;  4DUZ L;  1N33 L;  3D31 A;  4QGU A;  5C0X J;  1E7Z A;  2VS1 A;  2AHO B;  3HOZ H;  1SLJ A;  1E1O A;  4LW1 A;  4L5S A;  3I2Z A;  1PH7 A;  3KF6 A;  3HOV G;  2MNA A;  3F2D A;  2AWO A;  1KIX A;  5GAD C;  3J80 c;  3GTK H;  4PZ8 A;  4UCO A;  2CKZ B;  4GLX A;  4RMF A;  1VQ9 A;  3GTO H;  4AYB E;  4X64 L;  3GO5 A;  3GJX B;  1C0A A;  3GB8 B;  4HTO A;  3TY5 A;  1YBY A;  4HIM A;  4UCS A;  1XJV A;  4LFB Q;  4JV5 L;  1KXL A;  3H0G H;  3RLF A;  3VNN A;  2OQ0 A;  4JOI C;  5C44 H;  3KF8 B;  1I5F A;  4JI2 L;  4DV4 Q;  2IHE A;  5ELN A;  2UUB Q;  4DUY L;  1HNZ L;  1S72 A;  1G29 1;  3CCV A;  1SR3 A;  1PH9 A;  1HNZ Q;  2JA8 G;  3BU2 A;  1TWG H;  2UXB L;  3TQY A;  4EFE A;  2JA9 A;  1K3R A;  3U58 A;  4GKJ Q;  1KRT A;  3UE1 A;  1XNR L;  2NZO A;  2JA8 H;  2R93 G;  4JBK A;  4NXM Q;  4C3J H;  2N49 A;  3PF4 A;  3PO2 G;  4IPH A;  4DV2 Q;  4DV7 Q;  1Q1E A;  1OTC A;  1PH6 A;  1I3Q H;  1PH5 A;  4DR4 Q;  4APV A;  1EFW A;  1A8V A;  4R1J A;  5C0X G;  3KYH C;  3UDX A;  1YHA A;  2V1C C;  4UCR A;  2WP8 J;  1QUQ A;  3M3Y H;  3NC0 B;  1PH3 A;  5M3F H;  1N36 Q;  4BXX H;  1PHJ A;  1X56 A;  3NBY B;  2MO1 A;  5GAH C;  4DV6 Q;  4LUV A;  2K75 A;  4DR7 L;  1GO3 E;  3M4P A;  2VUM G;  1JJG A;  1IYJ B;  1XPO A;  4BA2 I;  4OX9 L;  5GQO A;  3AFQ A;  4AIM A;  1Q1B A;  2PNH A;  3PUX A;  4LF5 Q;  3U4V A;  1FJG Q;  1VQI A;  1VQA A;  1UE7 A;  2N78 A;  2JEB I;  2XTI A;  4JG2 A;  4JOI A;  4B3T Q;  3FKI H;  2KBN A;  3RN5 A;  1NTG A;  2KEN A;  3FP9 A;  4QJF A;  4R4T A;  2D62 A;  5IE8 A;  1G51 A;  3FKI G;  1E22 A;  4HJ7 A;  2R7F A;  5C3E G;  3OTO Q;  3OW2 A;  2L15 A;  2B63 G;  4IPC A;  4DR3 Q;  3PN1 A;  1X3E A;  2OCE A;  3A74 A;  3PUY A;  4LWC A;  2RF4 A;  2PMZ E;  3ULL A;  4P71 A;  4YY3 L;  5HY6 A;  5FJ8 H;  2NVX H;  4JYA Q;  1VQB A;  1B7Y B;  4NXN Q;  1D7Q A;  2ES2 A;  1IL2 A;  1KHI A;  4P74 A;  4C3I H;  3CCL A;  2ATW A;  2WAQ G;  4IPD A;  3TRZ A;  1IBM L;  2EIF A;  3CC7 A;  5AJ3 Q;  3K8A A;  5FLX c;  4DV2 L;  3S14 H;  4E6N A;  2HHH L;  1YIT A;  1TXY A;  3CCQ A;  4YCU A;  1NBW A;  3Q8D A;  3SGI A;  4A3F G;  1TWA H;  1HZA A;  4EFB A;  3GD7 A;  3J80 i;  4JI2 Q;  3E9I A;  4UP7 A;  3GTM H;  1WJJ A;  2UUB L;  4C3H H;  5IYC G;  1PV4 A;  4LF6 Q;  4XTC S;  3IRB A;  1T9H A;  4KLK A;  1X9N A;  3E9H A;  4OON A;  5BR8 L;  4GOP C;  1JB7 A;  1VQK A;  3PUW A;  1HZC A;  4DR5 Q;  3D0F A;  3S1R H;  2JA7 G;  1HNW L;  4A75 A;  4LUO A;  2E2I H;  3NEL A;  1YI2 A;  2UUC L;  1Q82 C;  4JI5 Q;  2XGT A;  4RG1 A;  3I4M H;  4A3B H;  4JV5 Q;  3KLW A;  2JA7 H;  2UXC L;  1UE6 A;  5D1O B;  3CCE A;  2AKW B;  2VY3 A;  4JI7 Q;  3L7Z C;  4DK6 C;  2D0P A;  2JA5 H;  4JBJ A;  2E5L Q;  1Y1W G;  2A19 A;  3K80 C;  4BBS G;  1NMG A;  2R7Z H;  3HOZ G;  4UP8 A;  3CCJ A;  4A3D G;  3J7A 5;  3J81 c;  2JA5 G;  2WAQ E;  1JMC A;  1NMF A;  2I0Q A;  4DR2 Q;  1N34 L;  1WOC A;  2ZTD A;  1Y1W H;  2YTV A;  4Y52 H;  3BAB A;  4AH6 A;  4DR3 L;  4J15 A;  3QWU A;  2YTY A;  3S1M H;  5K36 G;  1Q86 C;  1C7Y A;  5FPO A;  2RHS B;  4NB3 A;  4GN5 A;  1YHB A;  4YWK A;  2LXK A;  5JJI A;  1XMO Q;  5IP9 G;  4POG A;  1ASY A;  3CF5 A;  2KCM A;  2K14 A;  1YJW A;  3F2C A;  3JSN A;  3HKS A;  4UFZ A;  1EQQ A;  3CPF A;  5H1S E;  4LF7 L;  3TY9 A;  4BA1 I;  4Y7N H;  4LF8 Q;  5ELO A;  1J5E L;  4YCV A;  3TEH B;  1VQL A;  3EIV A;  4X62 Q;  2CQO A;  4DV1 L;  1XMQ L;  1HR0 L;  5D1P A;  1N32 L;  1OXU A;  3PO2 H;  1MIU A;  2N3S A;  4FDB A;  3PV0 A;  2UXD L;  3UQ8 A;  1V9P A;  2NZH A;  3PIO A;  3CD6 A;  3CC2 A;  5M5Y H;  4O2D A;  2E2J H;  2R93 H;  2UU9 L;  2HVQ A;  4A3L H;  2Q2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...