3W1BA

Crystal structure of human dna ligase iv-artemis complex (mercury derivative)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
600
structure length
589
Chain Sequence
b'TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 178
structure length 589
sequence length 600
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1bA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1bA02
2Z6KA 1PYSB 1PH3A 4R1JA 1C0AA 1XPUA 4DR7Q 3HKZE 4APVA 1XPOA 5IWAL 3HKSA 1X54A 4JI5L 2OTLA 3RN5A 1TWGH 3UQ8A 1R9TH 4LF7L 3PO3G 1M1KC 1TAEA 1VQBA 5GROA 4DR6L 3A0JA 3E9HA 1QVFA 1TXYA 4DV4L 2UU9Q 2K50A 3I2ZA 4B3ML 1I6HH 2HT1A 2E2JH 4JI4Q 5M5XH 3K8AA 4UP8A 3W1GA 4A3IH 5E7NA 2VS1A 2UXDL 4OO1G 1TWCH 4BXXG 2I0QA 3PN1A 3KOJA 3RLNA 4X66L 2QA4A 3F8TA 1XMOL 5JEAG 3GDEA 4FDBA 1QZGA 1VQGA 3PUWA 1K83H 2LXKA 3PGZA 1B70B 3E0EA 2ZTCA 5C3EG 1XDNA 4LF4Q 1PHJA 4GOPC 1K8AC 1HZAA 3JAMi 3PUXA 5GAGC 1QVGA 3S2HH 4P75A 1K3RA 5C4XG 2HVQA 4LH6A 3ULLA 5ELOA 4QJFA 3CD6A 4BBRG 4A3BH 1Y1WG 1QVCA 1VQ6A 2B63G 1N33L 1E1OA 4YCWA 2VQEL 1IXRA 2MFIA 1PH9A 2JA5H 5IYCG 2OTJA 1IZ6A 3M4PA 4DV2L 3D0FA 2JA7H 5M3FG 4HJ5A 5LMNW 2VY3A 3PIPA 4JV5L 3WWVA 1PA6A 4LUZA 2Z6KC 3HOWG 3J81j 2K75A 1S40A 4JBJA 1WCMH 1YJ9A 1I94Q 1CSPA 3I4MG 4X64L 3K7AH 1ASYA 2KHJA 2KCTA 3NBHB 3CCMA 3I7FA 3UDIA 2UUAL 4AYBG 4QQBX 4X6AH 3KFUA 3HOZG 5M3MG 2N49A 1N32L 1EIYB 4KHPQ 2RHQB 4K0KL 3U4VA 3PO2H 5D1OB 3OTOQ 2K5NA 3TY5A 4JI0Q 4NXNQ 4A3CH 4KHZA 4ME3A 4LUOA 1ASZA 2JA6G 4DV3L 2HVRA 2F4VL 3M3YH 1E1TA 1M90C 2YTXA 4GS3A 4R4IA 4BBSG 3CPFA 1CSQA 4NB3A 4P74A 1BBUA 1WOCA 4LF6L 1NY4A 4A3JG 2HHHL 1HZBA 4OX9Q 3AYHB 3FKIH 4BA1I 4LFCL 1EQRA 1PFSA 3VNNA 1SMXA 2IX1A 2JEBI 2VQFQ 3KDFA 2ZJPA 5FJ8G 3CXCA 3CCSA 4JOIC 3B6YA 3JAMc 1U5KA 4AQYQ 1IBLL 2B29A 1N8RC 3TY9A 1XK5A 4DR2L 2L15A 3FHWA 2YTVA 4UCVA 1VQIA 5IE8A 1EQQA 5C0XG 5AJ3Q 4DV7L 5FLMG 2N3SA 3RR5A 4MNOA 2HIXA 2QEXA 4B3TL 1TA8A 4QY7A 3LGJA 4DV0L 3STBC 1JE5A 1LTLA 1PV4A 2JA8H 4B3RQ 2E5LL 3ICEA 3JSLA 1MJCA 3G48A 4DR7L 4IPDA 1I3QH 5JJLA 2GN5A 2E8GA 3PO3H 4IJHA 1N36Q 2D0PA 4P72A 4DV5L 1AH9A 4JI2Q 4LWCA 1Q7YC 4B3SQ 3S14H 4LF8Q 3H3VI 3RZDH 2UU9L 1S72A 3GTOH 1X3EA 3NEMA 5DLQE 1OXTA 3HOVG 4LF9L 4L5QA 4GKKQ 2C35B 4A76A 2KBNA 4YCUA 1G51A 1L2FA 4PMWA 2VW9A 2CFMA 1L1OB 4BXXH 1C7YA 1PH7A 3AQQA 1GD7A 4LFBQ 4DRFA 2AKWB 5FPOA 1TWHH 3GTQH 5C4JH 3EIVA 1NMGA 4GNXB 5HY6A 4LF5L 1Q1BA 1CKNB 4PZ6A 4GLVB 3CMAA 3U4ZA 5C3EH 4L5RC 3CCLA 2Q2UA 4IFDG 2PQAB 1EYGA 3T1HL 4ALPA 4AH6A 1HR0Q 4HTPA 4XTCS 2D62A 2IX0A 1N34Q 1QUQB 3PUYA 3BJUA 1Q46A 4JC0A 1E7ZA 4O0AA 1FVIA 4KI0A 4BBRH 4X65Q 4A3FG 1Y1WH 2Q2TA 2B63H 1HNWQ 1HNZL 1LYLA 1HZCA 1VQFA 2WB1G 3CC4A 3S2DH 5IYCH 1VQNA 2I5HA 5EAYA 4AYBE 1IBMQ 5M3FH 1I5FA 2QGQA 3MXNB 3HOWH 4DR3Q 1A8VA 1JB7A 3JC66 2PI2E 3PIOA 1QZHA 2I5MX 3I4MH 4C3HH 4BY7G 3HFZB 4OO1I 5FLXc 4JI8Q 3U50C 1JMCA 3IRBA 4CC5A 2RF4A 4DV6Q 2VUGA 1VQDA 1YNXA 5LMNQ 2F52A 1XPRA 2N8NA 3F1ZA 3HOZH 1PVOA 5M3MH 1UWVA 1CKMA 1SR3A 2ES2A 4DPGA 4KHPL 1NJIC 1HR0W 3HOUG 3H0GG 2AWNA 2R93G 3EBEA 5LMUQ 4DR5Q 4JI0L 1L1OA 4NXNL 4IOAA 3CCEA 1Z9FA 3D31A 3G71A 3GTGH 2N78A 2AHOB 2CKZB 3BU2A 4GN4B 4DAYB 4LNQA 2JA6H 3HOXG 1XNQL 1CKNA 2PMZE 4IPHA 3GTMH 2E2HH 3S1QH 1EUJA 4YY3Q 1EFWA 1NE3A 2DGYA 4A3JH 1YI2A 1K73C 2PQAA 1D7QA 4A3EG 1YHAA 3K0XA 4JOIA 4IO9A 4X62Q 3NC0B 1HJPA 4DR4Q 4JYAQ 1QUQA 3S17H 3K81C 3Q8DA 4YWKA 4GN3B 1MJEA 2VQFL 3S24A 3A5UA 4JI7Q 4JCVE 2VUMG 3S1RH 3K7UC 5FJ8H 1P16A 2ZM6Q 4HJAA 1J5EQ 3J80i 2NVQH 1X3FA 5GAEC 4AQYL 5JJIA 2ALYB 1KRSA 1Q8KA 1Q12A 1PH1A 3KF6B 1RL2A 2K52A 1CUKA 4TVAB 3U58A 2EIFA 4MTNA 4GN5A 4NXMQ 1XNRQ 3NBYB 5AJ3L 5FLMH 5IYBG 4JI6Q 4A3LG 1G291 4BY1G 1WI5A 3A5ZB 1A62A 2UUCQ 4JI1L 1FJGL 1VQ4A 4DV5Q 1BKBA 4UFZA 3I4NG 1VQPA 1T9HA 3HOYG 1V43A 2R7FA 1LM0A 1YEZA 4R4OA 3ER0A 5IWAQ 4E6NA 1IBKQ 3CCUA 4DV1L 4HIDA 1WYDA 2ZJQA 3TQYA 4B3SL 3BZCA 1L1OC 4DV4Q 3F2DA 1XTDA 2UXCL 1NBWA 1VQEA 3AFQA 3K80C 2CWPA 1O7IA 5K36G 4GNXC 1OXSC 4GLXA 1YJNA 3HOVH 2MNAA 3A74A 3CW2C 3H3VH 1GKHA 3UDFA 4HIOA 1SRUA 3GTPH 1B8AA 2UXDQ 1YITA 1YVCA 4C2MH 1YIJA 1X9NA 4A93G 5C0XI 2UUBL 1VQCA 1KQSA 4JI3Q 1Q86C 1HZ9A 2WFWA 2WB1E 4YHHL 5H1SE 4DUYQ 3RNUA 1UEBA 1GO3E 1HH2P 1K0RA 4PZ8A 5IP7G 3UDGA 2PNHA 4Y7NH 4L5SA 2PI2A 3ZJYC 4UCRA 3BZKA 3E9IA 3KF6A 4H02A 5IYDG 1L0WA 1X3GA 2JE6I 2VZAA 1FL0A 1YBYA 4A3FH 5JEAJ 5IP9G 3J80c 4X65L 2E2IH 4UCUA 1KD1C 1HNWL 3T1YQ 1N33Q 2GVBA 1CKOA 2OQKA 2VQEQ 2JA9A 3NBZB 2OQ0A 2Q2HA 4QIWE 4HIKA 4A3KG 4DV2Q 5D1OA 3TS2A 4JV5Q 3J7ZC 1PH5A 1U0LA 2IT1A 2K4KA 1PH8A 3PUZA 2WAQG 1VQ9A 1G6PA 4BY7H 2YV5A 4MZ9A 1MIUA 2JK8A 3ULJA 4A4IA 2AWOA 2H5XA 4JI4L 4DV6L 3OW2A 1Y1VG 4A3DG 1OXUA 4L5TA 1UE6A 3G4SA 1VQ8A 4IOCA 2ZJRA 1VQMA 3CP0A 1N32Q 4KLKA 1HNXQ 2R6GA 3HOUH 3H0GH 5HGQA 2R93H 2EXDA 4DR5L 2IY5B 4IFDI 4POGA 3F2CA 5GADC 3ERSX 4A75A 1EWIA 1E22A 3HOXH 1FGUA 1N9WA 4DV3Q 3RN2A 4LF4L 2F4VQ 3DM3A 4C3JH 3H15A 4EFEA 3QWUA 3CC7A 4YY3L 4LF6Q 5D1PA 3CC2A 2R7ZG 4RMFA 4DAMA 3RTXA 1SROA 3RZOH 2BA0A 4A3EH 4LFCQ 2V1CC 1JJGA 4DR4L 1AE2A 1C9OA 3I55A 4A3GG 5JJKA 2VUMH 3GO5A 1J5EL 4EFBA 3BAAA 4DUZQ 1IBLQ 1PYBA 2IHFA 4GLAC 4OWXB 1K9MC 1I94L 1UE1A 4DR2Q 2BH8A 2LSSA 5GAHC 2A8VA 2ASBA 3NENA 1JJ2A 1PH6A 5IYBH 3G6EA 4DV7Q 4HJ9A 4A3LH 1P8LA 3KLWA 4DV0Q 4BY1H 1VQAA 2VNUD 3KJPA 1JJCB 2UUCL 3CMEA 1NMFA 2NVTH 1H95A 1Q82C 1YJWA 2NZHA 2E5LQ 4QGUA 2ID0A 2R92G 3OTOL 3GTKH 4YCVA 3I4NH 1Y14B 1W2BA 3W1BA 3HOYH 4DR1Q 5C0XJ 2K14A 2ATWA 1IBKL 1BBWA 4AIMA 5C44G 4GNXA 3UE1A 3M4OH 3JSNA 3PCOB 1PH4A 3M85A 3KJOA 2HQLA 1XMQQ 4BBSH 4UP7A 3SGIA 4POFA 2HIVA 5BR8Q 1VQOA 2OWOA 4OX9L 2YU9H 1B04A 3I56A 4LF9Q 3TY8A 1A63A 3AFPA 4R4QA 3GTLH 4PG3A 3PF4A 5M5YH 2VL6A 1Q81C 4A3MG 2YYZA 4A93H 4GKJQ 1OTCA 2MQHA 1UE5A 2RCNA 3L2PA 5ELNA 1GVPA 4JI3L 4O2DA 4LW1A 3GTJH 2UXBQ 4DUYL 5C4XH 4OXPA 4LF5Q 2ZTDA 4UCTA 5IP7H 2Y0SG 2R7DA 4HIMA 4YWLA 1VQ5A 4UCOA 5FPRA 4CC6A 4DKAC 1Q1EA 4LFAQ 5IYDH 1WFQA 3T1HQ 1LUZA 1Z47A 1B7YB 1JT8A 2WAQE 4JBMA 1J6QA 4B3RL 2WP8J 5J3BA 5IP9H 3BA8A 3CF5A 3L0OA 3KDFB 1D8LA 4IPCA 3T1YL 1HNZQ 2B3GA 1TWAH 1X55A 4A3KH 2CCZA 3PV0A 3KYHC 4C3IH 1EIFA 1IYJB 1E24A 2YTYA 4JI5Q 2LXJA 4IFDJ 2XTIA 4LF7Q 1N36L 3GJXB 4DR6Q 4JI2L 3CAMA 2JJQA 4LF8L 4HTOA 1GM5A 1KIXA 2CQOA 3STBD 4LH7A 3AEVA 2ZTEA 4JBWA 4B3MQ 4JBKA 4A3DH 1Y1VH 3HKZG 1OXXK 1E3PA 1SE8A 1AE3A 1KRTA 1X65A 4QL5A 4DNIA 4A3IG 4GKKL 1SN8A 4PZ7A 1I50H 3J81i 3PF5A 1S68A 1KHIA 3TS0A 2BA1A 4X66Q 1XMOQ 3L7ZC 4EX5A 2MO0A 1HNXL 2NN6I 3CQZH 4UY8C 1NTGA 3FP9A 5M5WH 1VQLA 1YZ6A 5DISC 2JQOA 4UP9A 3BABA 3NELA 2NN6G 2D0OA 4IJLA 4OWTB 1XNQQ 2NZOA 3OYYA 3RLOA 1YHQA 1VQHA 3UE0A 1HR0L 1N34L 4TQUS 2R7ZH 4EEQA 3CCRA 4A3BG 4J15A 3ULPA 2EQSA 1S3OA 2NVXH 3S1NH 1SLJA 2JA5G 4JG2A 4A3GH 1V1QA 3CCJA 2JA7G 4LUVA 4NPSA 1IBML 2NVYH 4GOPB 3CCQA 2KENA 3CCVA 2BH2A 3KF8B 3W5OA 1WJJA 4DR3L 3S1MH 2KHIA 4DUZL 1TWFH 3PSIA 3F2BA 1WCMG 4HJ8A 4XIGS 4Y52H 4X64Q 2A1AA 2A19A 3EN2A 3MEFA 4JI8L 3UDXA 2Q2IA 4R4CA 4UPAA 4DK6C 1KAWA 4DK3C 2UUAQ 1IL2A 2JEAI 5LMNL 1BVSA 1VS0A 3RLFA 2F3IA 4P71A 5GQOA 1MKHA 1YHBA 4JI1Q 4OONA 3PUVA 1FJGQ 2R92H 4K0KQ 3PO2G 3M7NA 2OCEA 2Z0SA 5LMUL 4OWWB 1UE7A 3DLLA 2K5HA 4DR1L 3VDYA 4A3CG 3J7A5 1VQJA 2CWAA 3M9BA 3S15H 4YWMA 4EQ5A 3S16H 4UCSA 5C44H 4RG1A 4DV1Q 1A0IA 2DUDA 1KC8C 1RIPA 1XMQL 2I5LX 3GD7A 3J81c 1DGSA 2UXCQ 5IT9c 2K5VA 3I4OA 4IPGA 2HHHQ 5BR8L 2Y0SE 3FKIG 1W3SA 4X62L 3BA9A 4JYAL 2KCMA 4JI7L 1SFOH 1K8GA 4LFBL 4WJ4A 2AMCB 1VQ7A 4A3MH 2ZM6L 2RHSB 4GKJL 1VQKA 1V9PA 2UUBQ 4GOPA 3TRZA 2FXQA 3TREA 2UXBL 4YHHQ 4BA2I 2HVSA 4HJ7A 1PH2A 3M4QA 4NXML 3GB8B 1XNRL 1KL9A 1KXLA 4P73A 4B3TQ 4JI6L 1X6OA 1XJVA 4LFAL 1X56A 2XGTA 1VCIA 3CPWA 2GVAA 4R4TA 2IHEA 5IY0A 4WJ3M 2JA8G 3TEHB 1OXVA 2MO1A 1EOVA
chains in the Genus database with same CATH superfamily
4R1JA 4DR7Q 1B4OA 2H1EA 2LFNA 1DONA 1JDBB 1SDFA 5CV8A 1PK8A 4LF7L 3PO3G 2R86A 2Z04A 1IYDA 2RSNA 4IURA 5C1OA 1TXYA 1TWHB 2NYZD 1AUVA 1KJ8A 3T9FA 2JP1A 4B3ML 5JVLA 1Q3LA 2HT1A 1EY6A 5M5XH 2L12A 3W1GA 2V59A 1HQRD 2UXDL 4BXXG 5J39A 2I0QA 5DGHA 1JOQA 2FP4B 3A8IE 4DNTB 3K5LA 3E3XA 2W6QA 1K83H 1A48A 2LXKA 4LF4Q 2F0TA 4C3JG 1HZAA 3JAMi 3PUXA 4H0LC 1QVGA 3S2HH 4P75A 1Z2OX 2RQXA 4K2LA 2D5DA 4BBRG 1QVCA 4DFAA 4CMFA 5ELDA 2JA5H 1EQTA 1UC9A 3PMFA 2Z6KC 1KBLA 2F0SA 2DN8A 1PMRA 2A74C 3K7AH 3U0GA 2RA4A 3TBIB 3Q24A 1DOKA 3ND9A 4L8JA 2N49A 4KHVA 2RHQB 1AP0A 2FPPB 2EIYA 4ME3A 4LUOA 3S1RB 3URYA 4FF1A 2HVRA 3M3YH 1E1TA 1VDZA 2EJGC 2WIIB 4GS3A 4R4IA 3T51B 1RODA 4NB3A 2O4XA 1BBUA 4P74A 1B50A 4A3JG 1IYEA 1CQJB 3R5HA 2G9DA 4IUUA 4DAPA 4C56C 2JEBI 2EYJA 2VQFQ 2ZXPA 3CXCA 3CCSA 2YWVA 1KTAA 1CZGA 2B29A 4IN3A 4UCVA 1BCPF 5IE8A 1EQQA 4B3TL 3RR5A 4MNOA 4QY7A 3I4LA 4UAIA 2F1MA 2HGWA 2JA8H 3SE0A 4MAMA 1B3QA 2ABJA 4CDFC 2CNQA 3MXUA 3MEHA 5EPLA 5A35A 4B3SQ 2B2TA 2QKIC 3J81L 1QNKA 3RZDH 3H3VI 5H80A 3BDCA 2F0VA 1DJRD 2EVBA 1OXTA 3M7GA 4KV6A 4GKKQ 2C35B 3QWUA 2KBNA 2HDLA 1G51A 5COYA 1C7YA 4HCSA 3VR3A 4LFBQ 4DU9A 2B8GA 1TWHH 1TS3A 2PO4A 5EJWA 4MN3A 4GNXB 3KF8A 4EGJA 1Q1BA 2F0LA 1GUOA 1NUCA 4GLVB 3CMAA 1JWSD 2A69D 5C3EH 5JVG3 3VYRA 1SAPA 1EYGA 1O7YA 1FGBD 1WTPA 2D62A 4TV9F 1QUQB 1S5ED 1Q46A 1K8MA 2QILA 1LYLA 1HZCA 1Y8NB 1VQNA 1MHWC 1MSHA 3HZXA 3HOWH 4R9WA 2Q7DA 3HOUB 2R93B 1SNQA 1CK1A 1LTRD 2L5TA 5E4XA 2RF4A 4DV6Q 2Q8TA 1CT1D 5LMNQ 1XPRA 2NZ1D 1EY4A 2N8NA 3VOTA 5BWRA 2LY7A 1KJIA 5I2YA 1NJIC 1HR0W 3EBEA 4O86A 4IOAA 3E5SA 5D65A 3CCEA 1Z9FA 3HP3A 1MBYA 3G71A 3NUAA 3SK5A 2AHOB 2CKZB 4DAYB 4GN4B 3VR6A 4CDEC 1XNQL 2PMZE 4YAKB 2R7NA 4FXKC 4YY3Q 1K73C 4EGVA 2PQAA 2B2YC 4A3EG 4O4IF 4X62Q 1HJPA 3SK4A 3Q8DA 3NWTA 3S24A 3DEPA 2IL8A 5KRUA 3S1RH 1CZWA 4HJAA 1J5EQ 2VUMG 2NVTB 1IHZA 2A1HA 3J80i 1G2WA 1X3FA 2ALYB 2P0AA 4HCEA 3HOYB 5FK9C 5BN5A 1CUKA 4MTNA 3X3NA 1W6JA 1VBHA 1F2MA 4KKSA 2W6OA 3M4OB 4BY1G 3TIGA 1A62A 2E2HB 5J1ZA 1FJGL 2GQRA 2ENBA 1BKBA 4UFZA 4C1NI 5TSSA 2W6NA 3ETHA 1B6RA 1K0SA 1B1ZA 2QB5A 3S17B 2R7FA 1LM0A 5IWAQ 3T54A 1GUNA 1A15A 4ZKCB 2PMZB 3TQYA 5BWTA 3HRZC 1M4VA 4LMQD 1VQEA 3K80C 2CWPA 5K36G 4GNXC 1YJNA 2MNAA 4TKOB 1H9MA 1B8AA 4C2MH 4RGOS 1Z7TA 5I60A 3I90A 5FLXE 4JI3Q 1KQSA 4YHHL 1ET0A 1TWAB 5H1SE 2K5WA 4A3KB 1GO3E 4C3IB 4L5SA 1A6XA 3WNZA 1EQVA 5EPKA 2PI2A 3RUZA 3BZKA 4H02A 2MHVA 5BPFA 1XTCD 1X3GA 4DK1A 3ORRA 1EYDA 3NBHA 4UCUA 3QOLA 1KD1C 2B8FA 3R2TA 1S4ZA 3T1YQ 2HD3A 2JA9A 3HOVB 3NBZB 3ZYYX 2OQ0A 4QIWE 5D1OA 4GZYC 4JV5Q 1EUCB 1PH5A 4RFBA 1U0LA 2K4KA 2RKSA 5IOCA 1VQ9A 4KK7A 2TSSA 4V190 1G6PA 1TU2B 4HSPA 1RD9D 2BOSA 3AW8A 3OW2A 1XYIA 4CKCA 4X3SA 1G6ZA 2COGA 1VQ8A 3G4SA 5I9OA 1VQMA 3TP8A 3ERQA 2R7ZB 1HNXQ 2G5DA 5FO9B 3H0GH 4A3FB 3HOUH 2E2IB 3DWAA 2EXDA 2R93H 4YB8B 1XX8A 4POGA 2Y4RA 3F2CA 2W70A 1RJTA 3W2DA 1H9KA 1SE2A 1SE4A 2CHBD 2KVMA 3DM3A 4WJWA 2HQEA 5D1PA 4IUVA 4BY7B 3MC0B 3RZOH 3VR2A 4LFCQ 2V1CC 1SMYC 1PX2A 4QIWB 2CH4W 2P5ZX 1CHQD 5JJKA 3GO5A 3BAAA 1W96A 1I94L 4DR2Q 5CA1F 1EFID 3S15B 5IGGA 1SYDA 1JJ2A 5IYBH 3JZIA 3UZOA 3KLWA 1BNZA 3HOXB 2VNUD 3KJPA 1BR9A 3MFGA 1T5EA 2UUCL 2NVTH 1YJWA 2E5LQ 2ID0A 1T5XD 2R92G 2K01A 2D2CC 2M2LA 3W1BA 5J22A 4DR1Q 3HOYH 1I7NA 1CQIB 2ATWA 1IBKL 4AIMA 1BNCA 3ETJA 4O84A 3M4OH 3M85A 3KJOA 1XMQQ 4O7WA 1HUNA 4WBNF 1FNVA 1EY7A 4K14A 1RDPD 1LTSD 4POFA 5BR8Q 1VQOA 3T56B 2BDOA 2YU9H 2QF7A 1SYBA 4R4QA 2F0KA 2OF1A 1TT2A 2VL6A 4A3MG 2YYZA 4A93H 2MQHA 4OIKA 1GJXA 2YS7A 1GVPA 1ET9A 2H4OA 4O2DA 3I4NB 3BYTB 4OHJA 5IP7H 1VQ5A 4HIMA 2NU9B 3DTFA 4LJZC 4CC6A 2R61A 2DNCA 1ZAUA 4FO2A 3T1HQ 1Z47A 4MA5A 1EY8A 1PZKD 1SXTA 4HAEA 4O7SA 3L0OA 3U9OA 3DXJC 2SCUB 1TWAH 4A3KH 4C3IH 2YTYA 2XTIA 3GJXB 5IT9E 1I4RA 4G7ZC 2NTSA 3CAMA 4IWYA 5C8YF 4FF3A 2RCFA 1GM5A 1KIXA 1J8IA 3OWEB 4RCNA 2ZTEA 3AEVA 5BWVA 1OXXK 1KRTA 4A3IG 1S68A 5I5WA 2YYAA 3L7ZC 2F3VA 3QB3A 1WTOA 2NN6I 3CQZH 4G7OC 1C30A 1NTGA 1SSOA 4UUGA 1VQLA 4I65A 5I47A 2F0DA 1E2WA 4UP9A 2SNMA 2JA7B 4RZQA 3K58A 1MGSA 3BVGA 2D0OA 3SR1A 4IIJF 5DAUA 4YBZB 2NZOA 4TUYF 2F0EA 1YHQA 3A7AB 1HR0L 1WCMB 1GXDC 2R7ZH 4NYEA 4EEQA 3CCRA 4A3BG 2EQSA 3UI2A 2IX3A 1CA5A 4HEDA 1R4QB 4LUVA 4NPSA 3IFDA 2D9UA 3CCVA 4GOPB 1I50B 1V8QA 2QK4A 4DUZL 2PCFB 3F2BA 3I3CA 4XIGS 2A19A 1ZEQX 3EN2A 3MEFA 4QF4A 3UDXA 1F77A 1KAWA 4DK3C 2UUAQ 3RLFA 2F3IA 5GQOA 1LACA 4NKLA 3PUVA 2Z4HA 5C5LA 5LMUL 4OWWB 4XQQA 1RTOA 3DLLA 1QJOA 3S1NB 2CWAA 3M9BA 4A3GB 3S15H 4YWMA 4EQ5A 5C44H 4RG1A 4DV1Q 2DUDA 1RIPA 2FB9A 1NR4A 3GD7A 3NHHA 2K28A 1EIGA 3VYUA 2VR1A 4IPGA 2Y0SE 1WTXA 3FKIG 1W3SA 1SYEA 3BA9A 3OIPA 1SFOH 1E4EB 2ZM6L 2UUBQ 2FXQA 3M4YA 1I4QA 4BA2I 3MVVA 1PH2A 4HTHA 2V4DA 4FVMA 4K5VA 1XNRL 4EG0A 1KXLA 4RGMA 4JI6L 4LFAL 1KLUD 1U4MA 5L37A 2GVAA 4R4TA 4KKTA 2EDGA 2IHEA 4WJ3M 2DLNA 4NZMA 4XQJA 1R9TH 2MO1A 2Z6KA 3OSOA 1C0AA 4MV6A 1XPUA 5BN3A 3KLSX 3HKSA 1X54A 2OTLA 3RN5A 1TWGH 1TAEA 2MUYA 4DR6L 3E9HA 1QVFA 4DV4L 5DMXA 1Y8PB 5C1PA 2OT2A 2K50A 1UUPA 1CQVA 1JOKA 2Y0SB 3J7AF 1HFGA 1KDBA 4YJ2F 2VS1A 3JAME 3VYSA 4ZK9B 1EWHA 3RLNA 4IQZA 4X66L 1XMOL 3TP6A 3WWJA 4QUCA 3S2DB 3C1FA 5BMVF 5M3FB 2ZTCA 1XDNA 2F0GA 1JICA 4GOPC 1K8AC 3E5NA 4QB4A 5CBEE 1K3RA 5JJZA 5ELOA 4QJFA 1F2ZA 2BCOA 3R9RA 3SVMA 3BDLA 1XWEA 1VQ6A 2B63G 1N33L 4YCWA 2VQEL 5BPHA 4I7AA 2OTJA 2JA7H 4HJ5A 5LMNW 2VY3A 4KMUC 4RHRA 2RDFA 2K75A 1S40A 1BCPB 2L1BA 4JXUA 1WCMH 4Y8VB 4HQ6A 1CSPA 3I4MG 3G8DA 4X64L 4O7YA 2KHJA 4NZOA 4O7NA 2QW7A 2KCTA 3I70A 3UDIA 2JA6B 1SE3A 4X6AH 3GQBA 3HOZG 1W6KA 3QOJA 4QUFA 1EIYB 4X3TA 3MA2B 2OLSA 3U4VA 5FKAC 5KGUA 3TY5A 4JI0Q 4NXNQ 5ELCA 3FRPB 4A3CH 4KHZA 3E0JA 2QCPX 2F4VL 1M90C 1CSQA 1WOCA 4PNYA 4OX9Q 3VNNA 3TEKA 2I87A 2IX1A 4ZUIA 2EJMA 1STAA 4CJ1B 1CHPD 1SYFA 2MP1A 4H13C 3T16A 2L4NA 1A3TA 4DF7A 3Q22A 1XK5A 3BG3A 1VQIA 4DV7L 5JAVA 5E25A 2HIXA 3LGJA 4DV0L 1LTGD 3STBC 1LT6D 1PV4A 4B3RQ 2PN1A 1YNND 3ICEA 3G48A 4DR7L 4IPDA 3SK8A 1I3QH 2MPMA 2KEDA 5JJLA 3DF7A 4E4TA 4KD4A 2E8GA 4CKBA 4IJHA 1N36Q 1C48A 5D8DA 4ZCKA 4JI2Q 2K33A 4CJ0B 1RCVD 4LF8Q 4DAAA 3R23A 2B39A 1AEXA 1DAAA 3IFTA 3HOVG 4O83A 2QDLA 3JZFA 1WTRA 4L5QA 4OO1H 1B2TA 1L2FA 2KA7A 1PH7A 2AKWB 3GTQH 1F2LA 1B9MA 5JEAH 1NMGA 3KREA 5HY6A 4LF5L 1S5FD 3KLRA 2B2YA 3U4ZA 3WOEA 2Q2UA 4IFDG 3FPPA 4AH6A 4DAVA 2ZXOA 3HO8A 1N34Q 3PUYA 3RZDB 4O0AA 4A3FG 1Y1WH 3TINA 1VKZA 1HNWQ 3MXPA 1IW7D 1HNZL 3CC4A 3S2DH 5IYCH 2I5HA 1MI2A 1LT3D 2YRWA 5M3FH 2EY5A 3MXNB 2EYFA 2SEBD 4O1NA 1A0GA 1JB7A 3OIQA 3PIOA 2I5MX 4C3HH 4BY7G 5J2TF 4OO1I 5FLXc 4JI8Q 2NUAB 3IRBA 1VQDA 5C3EB 1DOLA 2AUJD 5EBDA 3V96A 5LHY1 4FFPA 4RH6A 1PVOA 5M3MH 1UWVA 2ES2A 1Z6HA 1AZPA 2AWNA 4HN2A 4N9PA 1WTQA 1DIKA 3TSSA 5CA0F 1KLGD 1I2KA 2ZDHA 2JA6H 3HOXG 3HOWB 5CB4F 1PXUA 2A6HD 5CV5A 1QE6A 1D7QA 1Y8OB 2YZGA 1CFMA 4JOIA 4IO9A 2VPQA 3ORQA 4DR4Q 4JYAQ 1QUQA 2WACA 3K81C 4JI7Q 4YWKA 4EQOA 2VQFL 5FJ8H 5GAEC 5JJIA 4I4TF 2QDBA 1Q8KA 1Q12A 1PH1A 3KF6B 1IL8A 4TVAB 4EQNA 3U58A 4NXMQ 3NBYB 5C0XH 3FPUB 5FLMH 1M0TA 3H3VC 1G291 2HCIA 2EYPA 3LX0A 3NWSA 1PTOD 1TQOA 4DV5Q 3D6CA 2ZT9C 3I4NG 4CBVA 2K7VA 2NU8B 4B08A 4X3KA 4FF2A 2GQSA 1YEZA 4E6NA 2F0NA 4Q0FA 1A9XA 1SYGA 3MZ5A 5DNFA 1BOSA 4WFN3 2X69A 2VQDA 4B3SL 2FPGB 4DAYA 3R93A 2UXCL 1F9PA 3QJYA 3HS0C 5C4XB 4M9UA 3H3VH 2UXDQ 3PFFA 1YVCA 1X9NA 3J7YW 5C0XI 2A73B 4U673 1VQCA 5FO8B 3JAML 2EZVA 2WFWA 5ELBA 2WB1E 1K0RA 5G3LF 3NXWA 4Y7NH 1X3QA 4NMZA 4ILWA 3E9IA 5IYDG 1L0WA 1NAPA 2LMCB 2KQ3A 5CV6A 4ZOLF 1E2ZA 2JE6I 2WAQB 1WD1A 4Q4CA 5HNEA 2GVBA 3T9AA 4RAUC 4MV7A 5CMDA 5EBCA 3J7ZC 1DM0B 4C2MB 1I4PA 4ODGA 3EROA 3U9SA 5C3WA 3ULJA 1MIUA 2JK8A 1BO0A 1EYZA 2C00A 4JI4L 4DV6L 1Y1VG 1S5BD 2QEJC 2R84A 3QWNA 5ELEA 1GUSA 4KLKA 1BXTA 2EJFC 4ABNA 5HGQA 2IY5B 3KUPA 2PQEA 4ZYSA 2WB1B 3KALA 3KBGA 1TS4A 2YL2A 5DEHA 1E22A 4YAJB 1FGUA 2ZDQA 3S1MB 4JW0A 2F0FA 4YY3L 1HUMA 5J2UF 5JH7F 4RMFA 3JZ6A 4DAMA 1UAPA 1JJGA 3OWFA 2F0IA 2IW3A 4A3GG 1II3A 2ICEC 1J5EL 5D14A 5NUCA 3H0GB 4GLAC 1TS5A 2A8VA 4A3LH 1U9RA 1V1PA 1P8LA 1H95A 3A7LA 2Z6BA 3OTOL 3RZOB 1Y14B 1W2BA 3TN2A 4YJ3F 2CZGA 1JORA 2SOBA 4IUNA 3JSNA 3PCOB 3IKJA 5BWUA 2HQLA 4UP7A 2A69C 3F2UA 4E6IA 1K3BC 2CNUA 4PBCA 2V5AA 1A2UA 2B2VC 2FJ2A 4KY7A 4OELB 4PG3A 1Z2PX 3MWYW 3TQTA 1F9RA 2PZUA 1OTCA 1TY2A 1UE5A 3H6MA 5ELNA 1SEBD 4JI3L 4LW1A 5IODA 5C4XH 4OXPA 2BE5D 2A68D 2Y0SG 2SNSA 4UCOA 4K2KA 1Q1EA 3OPOA 5CR3A 1HA5A 3VPDA 1LUZA 1HHVA 3NQTA 4B9XA 1LV9A 5J3BA 5IP9H 4BS9A 4CMDA 3BA8A 1V1OA 4IZ8A 3T1YL 2YU9B 4IALA 3OW7A 3GV3A 5A2QL 2CCZA 1STGA 4FE2A 4LAAA 1EIFA 1IYJB 1E24A 2NTTA 2PZWA 4JI5Q 1HTLD 2B2WA 1ZYRD 2LXJA 3LWEA 4IFDJ 3K5IA 5CE8A 4A93B 1GSOA 2L9HA 2EXZA 2JJQA 2OXPA 2HGXA 3VPBA 2A6ED 4JBWA 4A3DH 1SE8A 1AE3A 2VB2X 3PF5A 4PZ7A 2BA1A 1HNXL 1QWYA 1KAAA 3BYYB 2K32A 1AUXA 3VR4A 1HQMC 2JQOA 3Q6SA 3BABA 4I50F 3NELA 1XNQQ 3KAKA 4L1KA 1FD7D 4TQUS 4NZNA 3RFCA 1D1KA 1DOMA 3J80L 3ULPA 1S3OA 1PFBA 2JA5G 1IBML 2FMMA 3CCQA 2KENA 1QCBD 2C9OA 1VF7A 3KF8B 3W5OA 1H9JA 1WTHA 4XXEA 4DR3L 2PYKA 3S1MH 1M0WA 1TWFH 2EY6A 3PSIA 3CQZB 4DIMA 2K1BA 3U9TA 2A1AA 4MV8A 3G7LA 5FOBB 3KAJA 2EJ2A 4P71A 2YZMA 3Q1KA 2CNVA 1FJGQ 2AQ2B 4K0KQ 1H9RA 4KJNA 2OCEA 2Z0SA 1JR0D 1G91A 4DR1L 4O7RA 4PQXA 2BDNA 4L6TB 1XMQL 4H7BA 3J81c 3LWUA 3GIDA 2ODTX 4KTAA 2WKDA 2HHHQ 1FR3A 5BR8L 4K5WA 4EGQA 5I5YA 1RF2D 4WJ4A 3VA7A 1VQ7A 3C46A 1V9PA 2FHTA 4GOPA 3TRZA 4YIJA 4J6HA 4YHHQ 3OUUA 1IYVA 4O4JF 4HJ7A 5KNDA 3M4QA 3GB8B 2X5RA 3MWDA 3NUCA 5C44B 1XJVA 3DHQA 3FMCA 3Q0AA 1EIHA 2JA8G 2XVSA 4MHEA 1PYSB 3EJIA 1PH3A 4JPBW 3HKZE 3VPCA 1XPOA 1SFOB 5IGDA 3RD4A 5GROA 3A0JA 2F0HA 2WKCA 4XDXA 1AW7A 3IAYA 2DWCA 2R82A 2UU9Q 3MJFA 1E0BA 1YNJD 2E2JH 3AB9A 2ZDGA 2XD4A 3D4WA 4UP8A 2B2TC 2Z4IA 1H9SA 5E7NA 1F2YA 3PN1A 3KOJA 2QA4A 4O82A 3PIO3 1R9TB 1E4EA 1C4QA 1QZGA 2NWGA 3K3PA 1VQGA 1L0XB 3PUWA 4FYDA 3PGZA 1TWGB 1O78A 2NN6H 5C3EG 2Q8RE 1EKVA 4HMIA 3C3LA 2HJWA 1D5ZC 4LH6A 3ULLA 3LNNA 1VF5C 1AN8A 2K6AA 2RBMA 1PH9A 1IXRA 3HKZB 3M4PA 4DV2L 3D0FA 2K05A 2R85A 3WWVA 1PA6A 4LUZA 3HOWG 3J81j 4WRDA 3ND8A 4JBJA 2WYOA 1YJ9A 1I94Q 4KN4C 1SBBB 1LTAD 4V0BA 1ASYA 3GTGB 2J9GA 5CR5A 3AX6A 3NBHB 2UUAL 3CCMA 2JSOA 3I7FA 3I72A 1SNDA 3KFUA 3S1QB 1U4LA 1N32L 4KHPQ 3DM1A 5D1OB 3PO2H 2K5NA 3H94A 5IGEA 1D5XC 1WD0A 2I8CA 2EYOA 2DABA 4IZOA 2R87A 1ASZA 4DV3L 2YTXA 4UDUC 4LF6L 1NY4A 3HT5A 1HZBA 1G2SA 4ZQIA 2I07B 4BA1I 1PFSA 2EYMA 1SMXA 1FNWA 4QCLA 1MD2D 4FNFA 3KDFA 2ZJPA 4RGTA 1U5KA 4AQYQ 1IBLL 4N8FA 1N8RC 3TY9A 5LOVF 3N52A 2XRSD 2YTVA 5E4WC 5AJ3Q 2N3SA 3PQIA 3TW7A 2QEXA 1TA8A 1GOZA 3L3OC 3BZDB 3AMUA 1EWCA 5K3WA 2HHFA 1BUVT 1CI3M 2GN5A 1M8AA 5E1FA 1KJQA 1ET6A 3PO3H 2D0PA 4LWCA 1QILA 1PZJD 5EQ0A 3CHBD 5FO7B 2DAAA 1S72A 4OL7A 4F8MA 1X3EA 2E76C 5DLQE 4LF9L 1EZ8A 3LQSA 4A76A 1RHPA 4BXXH 3T4AC 1L1OB 3AQQA 1GD7A 1TR5A 4RHSA 3N6RA 3V4ZA 3K0YA 1I3QB 1CKNB 2CW0D 2YRXA 4L5RC 3OUZA 4MV9A 5D3IB 3CCLA 2KJXA 3BS1A 4ALPA 1GLVA 1HR0Q 1ULZA 3KBXA 4HTPA 2J7ZA 2TMPA 4JC0A 4BBRH 3BJUA 1E7ZA 4IWXA 4X65Q 2Q2TA 1ENAA 2WB1G 1WTWA 4AYBE 2QGQA 4J8QA 1EU4A 1A8VA 1Q90A 3GTQB 4ZI7F 1QZHA 4MIUA 2W6PA 3U50C 3V05A 2VUGA 2F52A 2A5HA 3F1ZA 2F0WA 2PNRC 3NE5B 2Z8LA 1EEID 4HN7A 1A3GA 3HOUG 3H0GG 1Y1WB 2R93G 4A3EB 5LMUQ 4DR5Q 4JI0L 4NXNL 1L0YB 3A8KE 2EYLA 3RUPA 2G9HD 5AFWA 3GTGH 3BU2A 2VUMB 4KN7C 1PZID 3GTMH 3SE7A 3CEBA 3S1QH 3SDZA 2DGYA 4A3JH 1YI2A 3IL8A 3P1HA 4C3HB 4FXDA 1YHAA 3K0XA 1KUTA 4AYBB 3EA6A 4BY1B 3K7UC 2ZM6Q 5M3MB 4TV8F 2NVQH 2FFKB 3T9CA 3QG1A 2CVRA 3WOFA 3MWEA 2EIFA 1XNRQ 1GHJA 3DUZA 3FEWX 5IYBG 4JI6Q 5KX5F 4BBSB 2F3WA 1A3UA 3TP5A 2GLTA 4JI1L 1VQ4A 2HUGA 1ESFA 4ZAIA 2B2UC 3T9BA 5D3DA 4Z9CB 1T9HA 3HOYG 4HSVA 4RKBA 1PRTB 3ER0A 3NPPA 1GHKA 1I2LA 1K8OA 4HIDA 1WYDA 2ZJQA 4CKEA 5IGCA 3DTGA 3BZCA 1L1OC 2HDKA 3QFFA 4DV4Q 1HRJA 3F2DA 1XTDA 3GTJB 1KDCA 3AFQA 2F0QA 1OXSC 4DN4M 4GLXA 1IOWA 4ULLA 3CW2C 4XZ3B 2KHSA 1SRUA 4CHIA 1YITA 1YIJA 3H09A 4A93G 4KY5A 4JVZA 4MA0A 3DWQA 4DUYQ 3RNUA 5CV4A 1I4GA 1UEBA 1HH2P 1Q8IA 5IP7G 4UCRA 3UDGA 5CGKA 3KF6A 1S5DD 4DLKA 2VZAA 4ZLTF 1HNWL 3R5FA 2PW5A 1N33Q 2VQEQ 2OQKA 4FFLA 3CKIB 4A3KG 3G6JB 4C3IG 5IGBA 1ILPA 3TS2A 1KABA 4N9TA 2JYOA 2X0SA 1PLFA 4Q5VA 2IT1A 1EY0A 3PUZA 1KNAA 1WRVA 2F0UA 3JRXA 1GUWA 2RSOA 5KYIA 4A4IA 2H5XA 4Y7NB 5JQGF 1BCPD 2KUMA 1JOOA 1OXUA 2XN9C 1JWMD 3CP0A 2R6GA 2OEOA 2KCCA 4XYLB 3R8BA 1VBGA 1ZXTA 4OGQC 2NVXB 5GADC 2NVYB 3ERSX 2K5DA 3J7AV 2L11A 4HNTA 3NTIA 3RN2A 4LF4L 4KD3A 2F4VQ 4EFEA 1LTID 3H15A 3CC7A 5A2QE 2R7ZG 2ICIA 2PVPA 1SROA 4A3EH 1PFNA 4DR4L 1C9OA 5C3XA 3I55A 3T7AA 2AQ1B 4ZHQF 3V2TA 4R8IA 1YNNC 2VUMH 1D5MC 4EFBA 1GSHA 1B3AA 2R92B 5DM73 4I7ZC 3R5XA 1K9MC 4IUPA 4OEMB 1UE1A 3LWBA 2BH8A 2I46A 4O42A 2LSSA 1IOVA 3LULA 3NENA 3G6EA 4DV7Q 1PRTC 4DV0Q 4BY1H 2NU6B 3K5MA 5CM0A 1JJCB 1T36A 2GPSA 1GUGA 4QGUA 1PDQA 1U4RA 1I1MA 3WDNA 2LS01 1LTBD 3A55A 1EZ6A 1KTKA 2K14A 1SNMA 1BBWA 4G4KA 5C44G 4GNXA 1PFMA 1SNCA 3UE1A 4G7HC 4A3MB 4BBSH 1NR2A 3J80E 4J1MA 1HA6A 3SGIA 2JN4A 5HBRB 2HIVA 4DA2A 2OWOA 5K36H 3LP8A 3I56A 3BVMA 1PYWD 2ZXRA 3AFPA 3GTLH 3EFXD 1WTVA 1M6VA 2XWJB 5M5YH 4O81A 4GKJQ 1IW7C 2EYHA 3G8CA 4HR7B 2RCNA 4ZQ3A 1CS0A 3Q2OA 4XT1B 4P2CB 3GTJH 4WORA 2UXBQ 1W93A 4LF5Q 4NP5A 4UCTA 5FPRA 2XSCA 2L0CA 4YWLA 2DY8A 4UHVA 4DKAC 1BXRA 1A3VA 1B7YB 1X32A 2K03A 2WAQE 3T99A 1J6QA 5IIFA 1U4PA 1I6HB 1D8LA 5EKLA 1HNZQ 1X55A 1R4PB 3KYHC 4A3IB 5KNCA 5LYJF 1TWCB 4LF7Q 1KDAA 1C8CA 4KY6A 4HTOA 2CQOA 4O2BF 2RDGA 2C5CA 4B3MQ 1ICWA 3OMGA 2A6HC 2F0JA 1ZKOA 3HKZG 4FXGC 1E3PA 3R2IA 2COJA 4QL5A 4DNIA 4GKKL 1SN8A 3J81i 3UFXB 3O13A 1KHIA 4LFBL 3MHBA 4JK1C 4A3BB 1CQFA 3K6OA 3FP9A 5M5WH 2NBFA 3X3MA 5T1IA 4IJLA 3P7JA 5E3FA 3UE0A 4F7XA 2W6MA 1LT4D 2HGSA 4J15A 4A3DB 1JLLB 4C5CA 2NVXH 4JG2A 3CCJA 3S9WA 2JA7G 1PTOC 2NVYH 2BH2A 5JVH3 1F9SA 1WJJA 1PRTF 2KHIA 3EQLC 1TVXA 2Z9HA 2DIKA 2I80A 2R7MA 1WCMG 4HJ8A 5JQWA 4XX0B 4PV1C 2Q2IA 1LLRD 4DK6C 3VA5A 4CE5A 2JEAI 1CTMA 4F87A 5LMNL 1BVSA 1VS0A 3QR8A 5I5VA 1YHBA 4K8IA 1VMCA 5I6WA 2R92H 1ICFB 1UNSA 3FKIB 5EPJA 3BDOA 1UE7A 3VDYA 4A3CG 3J7A5 1XXGA 2IP4A 3S16H 1PTOH 4DXFA 4UCSA 4HNUA 4K6NA 1ONLA 4EVOA 4G57A 5KEEA 1I4HA 1KC8C 4DQNA 1TWFB 5K5PA 2UXCQ 5IT9c 3I4OA 3MXGA 4IHJF 2EY1A 5JPMC 3WO0A 1EKPA 4X62L 5LXTF 1OO9B 1G2TA 2KCMA 1MSGA 1IKMA 3KK7A 1AFPA 3A54A 3HGBA 4C5AA 1STHA 3TZDA 4A3MH 2RHSB 4FFMA 1VQKA 1IKLA 2ZGIA 2MJ8A 3NP8A 3D8GA 3TREA 4FP5D 1BQQT 1X3PA 3BACA 1S5CD 3HBLA 1ML0D 5C4HA 1B6SA 4P73A 4B3TQ 1X6OA 2EE1A 1LT5D 2XGTA 3CPWA 2VXWA 1KT8A 4O7TA 4TRDA 5IY0A 3S14B 1EYCA 4L63B 3L9AX 1OXVA 2NU7B 1EOVA 3GTOB 1GGOA 5EKKA 4XYQA 4APVA 5IWAL 3UQ8A 4JI5L 4O2AF 1M1KC 1KEEA 3I8ZA 1VQBA 4XT3B 4K6DA 3K5OA 5FNVF 5ISRA 2N55A 5C4JB 5DAAA 2M00A 4F88A 2HCCA 3I2ZA 1DV1A 2GA4B 5CYUA 1I6HH 4JI4Q 3K8AA 1DV2A 4MV1A 3RV3A 4A3IH 4OO1G 1TWCH 4ID6A 4TM5A 3F8TA 5JEAG 3GDEA 2B63B 4FDBA 3NQIA 2LKVA 4KJOA 1A2TA 2EJ0A 1B70B 2DJFC 3E0EA 3DAAA 3H91A 1PHJA 4MV4A 3OMCA 5GAGC 1FNUA 4OIJA 1PTOF 2HVQA 2DJGC 3T13A 3CD6A 1NCVA 3I4MB 1Y1WG 4A3BH 1SJED 1E1OA 2E2JB 2MFIA 3DMUA 5IYCG 1IZ6A 5FR9A 5M3FG 1CM9A 4JV5L 3PIPA 3HOZB 2XNAC 2XCLA 1EY5A 2M9VA 2YZNA 4ZRZA 2DY7A 3C1EA 4C3HG 1DD2A 5I2XA 3D4RA 3D4DA 3T9EA 4QMGA 5EGTA 3K57A 4QQBX 4AYBG 1CA6A 1ESRA 5M3MG 4BWGB 4K0KL 1JWUD 3OTOQ 2F0PA 3CRKC 2COIA 2X6GA 2CH4A 4N8X1 2F0OA 2O2LD 2JA6G 3TDQA 4BBSG 1NSNS 4RWSC 2BE5C 3WWIA 4ME5A 2A68C 3CPFA 4NW2A 2HHHL 3C2PA 2AUKA 3AYHB 3FKIH 4LFCL 1EQRA 3RV4A 1B53A 1QG7A 5FJ8G 3E6ZX 3VYTA 4JOIC 3B6YA 3JAMc 4O7VA 3PO2B 1STBA 1ZYRC 4DR2L 2L15A 3FHWA 5LL6X 1G8ZD 5C0XG 1ENCA 1O7LA 4HMJA 5FLMG 2RVLA 3A56A 1SMYD 2A6EC 1JE5A 3VR5A 1BF4A 1LTLA 1ENFA 2E5LL 3JSLA 1MJCA 4O7LA 2IJ0A 1VMPA 2XIWA 5JOBA 2EPBA 3GTPB 1SJHD 3GV6A 2IPKD 3CRLC 4P72A 5IYZF 1AH9A 2R3ZA 1SNOA 1Q7YC 3S14H 1V1PB 5C5MA 2UU9L 4U68A 3GTOH 3NEMA 1JQYD 2F0MA 2FINB 2PW7A 4YCUA 4PMWA 2VW9A 5BWWA 2CFMA 3NTHA 3QQMA 4RKLA 4DRFA 5FPOA 5BYBA 3FVQA 5C4JH 1KJ9A 3EIVA 3D6WA 4ZKBB 1IYUA 2NUCA 3KLSA 4PZ6A 4X3UA 4XYOA 4MV3A 2XWBB 3PO3B 1B9NA 4CHTB 5LL6S 1STNA 2PQAB 3T1HL 1D1IA 3WO1A 4XTCS 2IX0A 1FVIA 4KI0A 3I73A 2B63H 1VQFA 5EAYA 1IBMQ 3SXHA 1I5FA 2JXMB 4WHXA 5HURA 4DR3Q 2Q8IB 3GLKA 3JC66 2PI2E 2X6LA 5BYAA 3I4MH 3HFZB 1DYQA 4MTKA 4C1NK 4FU0A 4CC5A 1JMCA 5CV9A 2E74C 2B2UA 1YNXA 4C3JB 2KCNA 1DCZA 3HOZH 3U55A 1CKMA 1SR3A 4DPGA 3GP7A 4BBRB 4KHPL 1L1OA 4XQNA 3D31A 3OHXC 2N78A 3ONAB 4IUTA 4H44C 4HNVA 4LNQA 3U54A 1CKNA 4IPHA 4CJ2C 1KC7A 2E2HH 1EUJA 3ITPA 1EFWA 1NE3A 3CSWA 3A8JE 3P20A 1JCKB 3NC0B 2F4IA 3S17H 5K2MA 5JVDF 1MJEA 4GN3B 3A5UA 2HG8A 4JCVE 1P16A 3N8DA 2VB3X 5KKNB 4PMBA 3NSWA 3T53B 4AQYL 3GTKB 2DNEA 1KRSA 4RGNA 1KNEA 1RL2A 2K52A 1CE8A 4GN5A 2Z1CA 5AJ3L 4A3LG 3TZUA 3MFYA 4C5BA 3P75A 5HV6A 1WI5A 3A5ZB 3GTMB 2R7LA 2UUCQ 4CDCC 2J0TD 5KIXA 1YNJC 1O80A 4A3JB 1D2BA 1VQPA 1HPCA 1QNUA 1V43A 4R4OA 1IBKQ 3WWHA 3CCUA 4DV1L 2CQAA 1HXYD 1O7ZA 2NVQB 5I9PA 1NBWA 4NDXA 5CV7A 4ZUJA 4I55F 1O7IA 1JDEA 3HOVH 3R3OA 1OBDA 3A74A 4FGRA 1GKHA 3UDFA 4HIOA 1DZ1A 3GTPH 3I12A 4O4HF 2Z02A 4EQPA 3I91A 3NBIA 3DEOA 2UUBL 1I7LA 1Q86C 1HZ9A 5I5SA 4UY8C 5C4XG 1UC8A 2EOTA 2DZDA 4PZ8A 5M9OA 2WINB 4K5XA 2PNHA 5DM63 1F9QA 3ZJYC 1SCUB 4RCOA 4IFDH 4GLWA 3V4SA 3TIIA 1JB3A 2N88A 2NB0A 1FL0A 5CC4A 1YBYA 4A3FH 5JEAJ 1B44D 5IP9G 3J80c 4X65L 3W3AA 2E2IH 5DGIA 3T9DA 1CKOA 2AQ3B 1Y1VB 1JE4A 2Q2HA 4HIKA 2HDMA 4DV2Q 1RKNA 1TIID 4DGZA 2YS6A 3UYYA 1K28A 5LA6F 1LTTD 1PH8A 1QB5D 2WAQG 4BY7H 2YV5A 2B2WC 4MZ9A 2PZTA 4A3DG 2AWOA 3SHLA 3HEJA 2MGSA 4L5TA 1UE6A 1EOTA 4IOCA 2ZJRA 5I6YA 1N32Q 1EYAA 1EZ1A 4TSSA 4DR5L 5KNBA 4IFDI 2O5IC 3TW6A 1NNXA 4CGYB 4A75A 1EWIA 1HCZA 4R8NA 3QIAA 1N9WA 3HOXH 3MAQA 4DV3Q 3OOCA 4C3JH 5HGTA 1RTNA 1STEA 4LF6Q 1SYCA 3CC2A 4Q4DA 3HG9A 3RTXA 4DNRB 1H9SB 2BA0A 1AE2A 1EEFD 2J4XA 4CDDC 5I4DA 2EY2A 4O4LF 3SK6A 5EKIA 2IWHA 5BWXA 5LP6F 1LO5D 2PPBC 1Z2NX 4DUZQ 4M8AA 1IBLQ 1PYBA 2IHFA 2KOLA 4PMCA 4OWXB 1KJJA 1BDOA 3TMEA 5GAHC 4IUQA 5FLXL 2ASBA 3QO2A 2YW2A 1PH6A 4HJ9A 1VQAA 3CMEA 1NMFA 3D3RA 1OBGA 1Q82C 1LABA 5EZYF 5KYLA 2NZHA 1UEAB 4TVIA 3I4NH 3GTKH 4YCVA 4FFRA 5IGFA 5C0XJ 1I6VC 1EHIA 2E2DC 2FPIB 3NTKA 3Q23A 1PH4A 1EUDB 2PBZA 2O5JC 2CW0C 4OX9L 3BG5A 1B04A 4LF9Q 3TY8A 1A63A 1TY0A 3PF4A 1Q81C 2GPWA 3L2PA 1EKFA 1WR2A 3AU7A 3BVZA 3MXNA 5ELFA 4DUYL 1JC7A 2ZTDA 5BN4A 2R7DA 5C6AA 1EL0A 2L55A 2KECA 4LFAQ 5IYDH 3UZBA 1WFQA 3SNOA 5KS8A 3DWPA 4M1UB 4O7ZA 3TP7A 1Y69U 1JT8A 1GSAA 4FFOA 1AZQA 4JBMA 3K5HA 4B3RL 2WP8J 3EVQA 1ILQA 3CF5A 5I5UA 3KDFB 4IPCA 2EJ3A 5M5XB 2B3GA 3PV0A 2FMCA 3GTLB 3J81E 1N36L 3CU7A 5M5YB 1QOHA 3K59A 4DR6Q 4JI2L 4DXGA 4ME6A 4LF8L 4QSHA 5F2DA 4XYMB 3STBD 4LH7A 2RDHA 1E2VA 1BBXC 4JBKA 1K83B 4KKUA 1Y1VH 1TS2A 5I5XA 1X65A 4K8JA 3PIP3 2F03A 2W6ZA 3S2HB 1I50H 2K5QA 4B9WA 2HHFB 3TS0A 4DK0A 4X66Q 1XMOQ 4EX5A 2MO0A 2R7KA 2YZLA 4M0JA 2JA5B 4HR7A 1YZ6A 5DISC 3HB9A 1WVLA 2NN6G 4OWTB 3RLOA 3OYYA 1VQHA 1N34L 1DXMA 3K7AB 1FYCA 4RA8A 4A3GH 2KEEA 1SLJA 3S1NH 1J9OA 2WV6D 1I4XA 1V1QA 3NK9A 5CAEB 5CORA 5JPNC 5M5WB 4Y52H 4X64Q 4FFNA 3VMMA 4JI8L 5I5TA 2E75C 4R4CA 5G3LD 4UPAA 2XRQD 1IL2A 5T1GA 5GONF 1I1LA 3M3YB 3K5NA 1MKHA 4JI1Q 4OONA 2V58A 5C4ZA 3PO2G 3M7NA 3SEBA 2K5HA 4LK1C 1VQJA 1GUTA 1A0IA 2I5LX 2B2VA 1PRTD 1DGSA 1C3OA 3RMHA 2K5VA 5IT9L 5CBAE 4JYAL 1D6EC 1EU3A 4JI7L 1K8GA 4S3SA 2AMCB 4FF4A 3FDTA 4GKJL 2JA8B 2K04A 2W71A 2UXBL 2HVSA 1HFNA 1TKWB 2SDFA 4NXML 1I1KA 3MTSA 1KL9A 3JRWA 3S16B 1PTOB 1SNPA 4K6LA 1JKJB 1X56A 1VCIA 1HTPA 1EY9A 1STYA 3TEHB 1BCPC 4DV5L
chains in the Genus database with same CATH topology
2Z6KA 1PYSB 1PH3A 4R1JA 1C0AA 1XPUA 4DR7Q 3HKZE 4APVA 1XPOA 5IWAL 3HKSA 1X54A 4JI5L 2OTLA 3RN5A 1TWGH 3UQ8A 1R9TH 4LF7L 3PO3G 1M1KC 1TAEA 1VQBA 5GROA 4DR6L 3A0JA 3E9HA 1QVFA 1TXYA 4DV4L 2UU9Q 2K50A 3I2ZA 4B3ML 1I6HH 2HT1A 2E2JH 4JI4Q 5M5XH 3K8AA 4UP8A 3W1GA 4A3IH 5E7NA 2VS1A 2UXDL 4OO1G 1TWCH 4BXXG 2I0QA 3PN1A 3KOJA 3RLNA 4X66L 2QA4A 3F8TA 1XMOL 5JEAG 3GDEA 4FDBA 1QZGA 1VQGA 3PUWA 1K83H 2LXKA 3PGZA 1B70B 3E0EA 2ZTCA 5C3EG 1XDNA 4LF4Q 1PHJA 4GOPC 1K8AC 1HZAA 3JAMi 3PUXA 5GAGC 1QVGA 3S2HH 4P75A 1K3RA 5C4XG 2HVQA 4LH6A 3ULLA 5ELOA 4QJFA 3CD6A 4BBRG 4A3BH 1Y1WG 1QVCA 1VQ6A 2B63G 1N33L 1E1OA 4YCWA 2VQEL 1IXRA 2MFIA 1PH9A 2JA5H 5IYCG 2OTJA 1IZ6A 3M4PA 4DV2L 3D0FA 2JA7H 5M3FG 4HJ5A 5LMNW 2VY3A 3PIPA 4JV5L 3WWVA 1PA6A 4LUZA 2Z6KC 3HOWG 3J81j 2K75A 1S40A 4JBJA 1WCMH 1YJ9A 1I94Q 1CSPA 3I4MG 4X64L 3K7AH 1ASYA 2KHJA 2KCTA 3NBHB 3CCMA 3I7FA 3UDIA 2UUAL 4AYBG 4QQBX 4X6AH 3KFUA 3HOZG 5M3MG 2N49A 1N32L 1EIYB 4KHPQ 2RHQB 4K0KL 3U4VA 3PO2H 5D1OB 3OTOQ 2K5NA 3TY5A 4JI0Q 4NXNQ 4A3CH 4KHZA 4ME3A 4LUOA 1ASZA 2JA6G 4DV3L 2HVRA 2F4VL 3M3YH 1E1TA 1M90C 2YTXA 4GS3A 4R4IA 4BBSG 3CPFA 1CSQA 4NB3A 4P74A 1BBUA 1WOCA 4LF6L 1NY4A 4A3JG 2HHHL 1HZBA 4OX9Q 3AYHB 3FKIH 4BA1I 4LFCL 1EQRA 1PFSA 3VNNA 1SMXA 2IX1A 2JEBI 2VQFQ 3KDFA 2ZJPA 5FJ8G 3CXCA 3CCSA 4JOIC 3B6YA 3JAMc 1U5KA 4AQYQ 1IBLL 2B29A 1N8RC 3TY9A 1XK5A 4DR2L 2L15A 3FHWA 2YTVA 4UCVA 1VQIA 5IE8A 1EQQA 5C0XG 5AJ3Q 4DV7L 5FLMG 2N3SA 3RR5A 4MNOA 2HIXA 2QEXA 4B3TL 1TA8A 4QY7A 3LGJA 4DV0L 3STBC 1JE5A 1LTLA 1PV4A 2JA8H 4B3RQ 2E5LL 3ICEA 3JSLA 1MJCA 3G48A 4DR7L 4IPDA 1I3QH 5JJLA 2GN5A 2E8GA 3PO3H 4IJHA 1N36Q 2D0PA 4P72A 4DV5L 1AH9A 4JI2Q 4LWCA 1Q7YC 4B3SQ 3S14H 4LF8Q 3H3VI 3RZDH 2UU9L 1S72A 3GTOH 1X3EA 3NEMA 5DLQE 1OXTA 3HOVG 4LF9L 4L5QA 4GKKQ 2C35B 4A76A 2KBNA 4YCUA 1G51A 1L2FA 4PMWA 2VW9A 2CFMA 1L1OB 4BXXH 1C7YA 1PH7A 3AQQA 1GD7A 4LFBQ 4DRFA 2AKWB 5FPOA 1TWHH 3GTQH 5C4JH 3EIVA 1NMGA 4GNXB 5HY6A 4LF5L 1Q1BA 1CKNB 4PZ6A 4GLVB 3CMAA 3U4ZA 5C3EH 4L5RC 3CCLA 2Q2UA 4IFDG 2PQAB 1EYGA 3T1HL 4ALPA 4AH6A 1HR0Q 4HTPA 4XTCS 2D62A 2IX0A 1N34Q 1QUQB 3PUYA 3BJUA 1Q46A 4JC0A 1E7ZA 4O0AA 1FVIA 4KI0A 4BBRH 4X65Q 4A3FG 1Y1WH 2Q2TA 2B63H 1HNWQ 1HNZL 1LYLA 1HZCA 1VQFA 2WB1G 3CC4A 3S2DH 5IYCH 1VQNA 2I5HA 5EAYA 4AYBE 1IBMQ 5M3FH 1I5FA 2QGQA 3MXNB 3HOWH 4DR3Q 1A8VA 1JB7A 3JC66 2PI2E 3PIOA 1QZHA 2I5MX 3I4MH 4C3HH 4BY7G 3HFZB 4OO1I 5FLXc 4JI8Q 3U50C 1JMCA 3IRBA 4CC5A 2RF4A 4DV6Q 2VUGA 1VQDA 1YNXA 5LMNQ 2F52A 1XPRA 2N8NA 3F1ZA 3HOZH 1PVOA 5M3MH 1UWVA 1CKMA 1SR3A 2ES2A 4DPGA 4KHPL 1NJIC 1HR0W 3HOUG 3H0GG 2AWNA 2R93G 3EBEA 5LMUQ 4DR5Q 4JI0L 1L1OA 4NXNL 4IOAA 3CCEA 1Z9FA 3D31A 3G71A 3GTGH 2N78A 2AHOB 2CKZB 3BU2A 4GN4B 4DAYB 4LNQA 2JA6H 3HOXG 1XNQL 1CKNA 2PMZE 4IPHA 3GTMH 2E2HH 3S1QH 1EUJA 4YY3Q 1EFWA 1NE3A 2DGYA 4A3JH 1YI2A 1K73C 2PQAA 1D7QA 4A3EG 1YHAA 3K0XA 4JOIA 4IO9A 4X62Q 3NC0B 1HJPA 4DR4Q 4JYAQ 1QUQA 3S17H 3K81C 3Q8DA 4YWKA 4GN3B 1MJEA 2VQFL 3S24A 3A5UA 4JI7Q 4JCVE 2VUMG 3S1RH 3K7UC 5FJ8H 1P16A 2ZM6Q 4HJAA 1J5EQ 3J80i 2NVQH 1X3FA 5GAEC 4AQYL 5JJIA 2ALYB 1KRSA 1Q8KA 1Q12A 1PH1A 3KF6B 1RL2A 2K52A 1CUKA 4TVAB 3U58A 2EIFA 4MTNA 4GN5A 4NXMQ 1XNRQ 3NBYB 5AJ3L 5FLMH 5IYBG 4JI6Q 4A3LG 1G291 4BY1G 1WI5A 3A5ZB 1A62A 2UUCQ 4JI1L 1FJGL 1VQ4A 4DV5Q 1BKBA 4UFZA 3I4NG 1VQPA 1T9HA 3HOYG 1V43A 2R7FA 1LM0A 1YEZA 4R4OA 3ER0A 5IWAQ 4E6NA 1IBKQ 3CCUA 4DV1L 4HIDA 1WYDA 2ZJQA 3TQYA 4B3SL 3BZCA 1L1OC 4DV4Q 3F2DA 1XTDA 2UXCL 1NBWA 1VQEA 3AFQA 3K80C 2CWPA 1O7IA 5K36G 4GNXC 1OXSC 4GLXA 1YJNA 3HOVH 2MNAA 3A74A 3CW2C 3H3VH 1GKHA 3UDFA 4HIOA 1SRUA 3GTPH 1B8AA 2UXDQ 1YITA 1YVCA 4C2MH 1YIJA 1X9NA 4A93G 5C0XI 2UUBL 1VQCA 1KQSA 4JI3Q 1Q86C 1HZ9A 2WFWA 2WB1E 4YHHL 5H1SE 4DUYQ 3RNUA 1UEBA 1GO3E 1HH2P 1K0RA 4PZ8A 5IP7G 3UDGA 2PNHA 4Y7NH 4L5SA 2PI2A 3ZJYC 4UCRA 3BZKA 3E9IA 3KF6A 4H02A 5IYDG 1L0WA 1X3GA 2JE6I 2VZAA 1FL0A 1YBYA 4A3FH 5JEAJ 5IP9G 3J80c 4X65L 2E2IH 4UCUA 1KD1C 1HNWL 3T1YQ 1N33Q 2GVBA 1CKOA 2OQKA 2VQEQ 2JA9A 3NBZB 2OQ0A 2Q2HA 4QIWE 4HIKA 4A3KG 4DV2Q 5D1OA 3TS2A 4JV5Q 3J7ZC 1PH5A 1U0LA 2IT1A 2K4KA 1PH8A 3PUZA 2WAQG 1VQ9A 1G6PA 4BY7H 2YV5A 4MZ9A 1MIUA 2JK8A 3ULJA 4A4IA 2AWOA 2H5XA 4JI4L 4DV6L 3OW2A 1Y1VG 4A3DG 1OXUA 4L5TA 1UE6A 3G4SA 1VQ8A 4IOCA 2ZJRA 1VQMA 3CP0A 1N32Q 4KLKA 1HNXQ 2R6GA 3HOUH 3H0GH 5HGQA 2R93H 2EXDA 4DR5L 2IY5B 4IFDI 4POGA 3F2CA 5GADC 3ERSX 4A75A 1EWIA 1E22A 3HOXH 1FGUA 1N9WA 4DV3Q 3RN2A 4LF4L 2F4VQ 3DM3A 4C3JH 3H15A 4EFEA 3QWUA 3CC7A 4YY3L 4LF6Q 5D1PA 3CC2A 2R7ZG 4RMFA 4DAMA 3RTXA 1SROA 3RZOH 2BA0A 4A3EH 4LFCQ 2V1CC 1JJGA 4DR4L 1AE2A 1C9OA 3I55A 4A3GG 5JJKA 2VUMH 3GO5A 1J5EL 4EFBA 3BAAA 4DUZQ 1IBLQ 1PYBA 2IHFA 4GLAC 4OWXB 1K9MC 1I94L 1UE1A 4DR2Q 2BH8A 2LSSA 5GAHC 2A8VA 2ASBA 3NENA 1JJ2A 1PH6A 5IYBH 3G6EA 4DV7Q 4HJ9A 4A3LH 1P8LA 3KLWA 4DV0Q 4BY1H 1VQAA 2VNUD 3KJPA 1JJCB 2UUCL 3CMEA 1NMFA 2NVTH 1H95A 1Q82C 1YJWA 2NZHA 2E5LQ 4QGUA 2ID0A 2R92G 3OTOL 3GTKH 4YCVA 3I4NH 1Y14B 1W2BA 3W1BA 3HOYH 4DR1Q 5C0XJ 2K14A 2ATWA 1IBKL 1BBWA 4AIMA 5C44G 4GNXA 3UE1A 3M4OH 3JSNA 3PCOB 1PH4A 3M85A 3KJOA 2HQLA 1XMQQ 4BBSH 4UP7A 3SGIA 4POFA 2HIVA 5BR8Q 1VQOA 2OWOA 4OX9L 2YU9H 1B04A 3I56A 4LF9Q 3TY8A 1A63A 3AFPA 4R4QA 3GTLH 4PG3A 3PF4A 5M5YH 2VL6A 1Q81C 4A3MG 2YYZA 4A93H 4GKJQ 1OTCA 2MQHA 1UE5A 2RCNA 3L2PA 5ELNA 1GVPA 4JI3L 4O2DA 4LW1A 3GTJH 2UXBQ 4DUYL 5C4XH 4OXPA 4LF5Q 2ZTDA 4UCTA 5IP7H 2Y0SG 2R7DA 4HIMA 4YWLA 1VQ5A 4UCOA 5FPRA 4CC6A 4DKAC 1Q1EA 4LFAQ 5IYDH 1WFQA 3T1HQ 1LUZA 1Z47A 1B7YB 1JT8A 2WAQE 4JBMA 1J6QA 4B3RL 2WP8J 5J3BA 5IP9H 3BA8A 3CF5A 3L0OA 3KDFB 1D8LA 4IPCA 3T1YL 1HNZQ 2B3GA 1TWAH 1X55A 4A3KH 2CCZA 3PV0A 3KYHC 4C3IH 1EIFA 1IYJB 1E24A 2YTYA 4JI5Q 2LXJA 4IFDJ 2XTIA 4LF7Q 1N36L 3GJXB 4DR6Q 4JI2L 3CAMA 2JJQA 4LF8L 4HTOA 1GM5A 1KIXA 2CQOA 3STBD 4LH7A 3AEVA 2ZTEA 4JBWA 4B3MQ 4JBKA 4A3DH 1Y1VH 3HKZG 1OXXK 1E3PA 1SE8A 1AE3A 1KRTA 1X65A 4QL5A 4DNIA 4A3IG 4GKKL 1SN8A 4PZ7A 1I50H 3J81i 3PF5A 1S68A 1KHIA 3TS0A 2BA1A 4X66Q 1XMOQ 3L7ZC 4EX5A 2MO0A 1HNXL 2NN6I 3CQZH 4UY8C 1NTGA 3FP9A 5M5WH 1VQLA 1YZ6A 5DISC 2JQOA 4UP9A 3BABA 3NELA 2NN6G 2D0OA 4IJLA 4OWTB 1XNQQ 2NZOA 3OYYA 3RLOA 1YHQA 1VQHA 3UE0A 1HR0L 1N34L 4TQUS 2R7ZH 4EEQA 3CCRA 4A3BG 4J15A 3ULPA 2EQSA 1S3OA 2NVXH 3S1NH 1SLJA 2JA5G 4JG2A 4A3GH 1V1QA 3CCJA 2JA7G 4LUVA 4NPSA 1IBML 2NVYH 4GOPB 3CCQA 2KENA 3CCVA 2BH2A 3KF8B 3W5OA 1WJJA 4DR3L 3S1MH 2KHIA 4DUZL 1TWFH 3PSIA 3F2BA 1WCMG 4HJ8A 4XIGS 4Y52H 4X64Q 2A1AA 2A19A 3EN2A 3MEFA 4JI8L 3UDXA 2Q2IA 4R4CA 4UPAA 4DK6C 1KAWA 4DK3C 2UUAQ 1IL2A 2JEAI 5LMNL 1BVSA 1VS0A 3RLFA 2F3IA 4P71A 5GQOA 1MKHA 1YHBA 4JI1Q 4OONA 3PUVA 1FJGQ 2R92H 4K0KQ 3PO2G 3M7NA 2OCEA 2Z0SA 5LMUL 4OWWB 1UE7A 3DLLA 2K5HA 4DR1L 3VDYA 4A3CG 3J7A5 1VQJA 2CWAA 3M9BA 3S15H 4YWMA 4EQ5A 3S16H 4UCSA 5C44H 4RG1A 4DV1Q 1A0IA 2DUDA 1KC8C 1RIPA 1XMQL 2I5LX 3GD7A 3J81c 1DGSA 2UXCQ 5IT9c 2K5VA 3I4OA 4IPGA 2HHHQ 5BR8L 2Y0SE 3FKIG 1W3SA 4X62L 3BA9A 4JYAL 2KCMA 4JI7L 1SFOH 1K8GA 4LFBL 4WJ4A 2AMCB 1VQ7A 4A3MH 2ZM6L 2RHSB 4GKJL 1VQKA 1V9PA 2UUBQ 4GOPA 3TRZA 2FXQA 3TREA 2UXBL 4YHHQ 4BA2I 2HVSA 4HJ7A 1PH2A 3M4QA 4NXML 3GB8B 1XNRL 1KL9A 1KXLA 4P73A 4B3TQ 4JI6L 1X6OA 1XJVA 4LFAL 1X56A 2XGTA 1VCIA 3CPWA 2GVAA 4R4TA 2IHEA 5IY0A 4WJ3M 2JA8G 3TEHB 1OXVA 2MO1A 1EOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6K A;  1PYS B;  1PH3 A;  4R1J A;  1C0A A;  1XPU A;  4DR7 Q;  3HKZ E;  4APV A;  1XPO A;  5IWA L;  3HKS A;  1X54 A;  4JI5 L;  2OTL A;  3RN5 A;  1TWG H;  3UQ8 A;  1R9T H;  4LF7 L;  3PO3 G;  1M1K C;  1TAE A;  1VQB A;  5GRO A;  4DR6 L;  3A0J A;  3E9H A;  1QVF A;  1TXY A;  4DV4 L;  2UU9 Q;  2K50 A;  3I2Z A;  4B3M L;  1I6H H;  2HT1 A;  2E2J H;  4JI4 Q;  5M5X H;  3K8A A;  4UP8 A;  3W1G A;  4A3I H;  5E7N A;  2VS1 A;  2UXD L;  4OO1 G;  1TWC H;  4BXX G;  2I0Q A;  3PN1 A;  3KOJ A;  3RLN A;  4X66 L;  2QA4 A;  3F8T A;  1XMO L;  5JEA G;  3GDE A;  4FDB A;  1QZG A;  1VQG A;  3PUW A;  1K83 H;  2LXK A;  3PGZ A;  1B70 B;  3E0E A;  2ZTC A;  5C3E G;  1XDN A;  4LF4 Q;  1PHJ A;  4GOP C;  1K8A C;  1HZA A;  3JAM i;  3PUX A;  5GAG C;  1QVG A;  3S2H H;  4P75 A;  1K3R A;  5C4X G;  2HVQ A;  4LH6 A;  3ULL A;  5ELO A;  4QJF A;  3CD6 A;  4BBR G;  4A3B H;  1Y1W G;  1QVC A;  1VQ6 A;  2B63 G;  1N33 L;  1E1O A;  4YCW A;  2VQE L;  1IXR A;  2MFI A;  1PH9 A;  2JA5 H;  5IYC G;  2OTJ A;  1IZ6 A;  3M4P A;  4DV2 L;  3D0F A;  2JA7 H;  5M3F G;  4HJ5 A;  5LMN W;  2VY3 A;  3PIP A;  4JV5 L;  3WWV A;  1PA6 A;  4LUZ A;  2Z6K C;  3HOW G;  3J81 j;  2K75 A;  1S40 A;  4JBJ A;  1WCM H;  1YJ9 A;  1I94 Q;  1CSP A;  3I4M G;  4X64 L;  3K7A H;  1ASY A;  2KHJ A;  2KCT A;  3NBH B;  3CCM A;  3I7F A;  3UDI A;  2UUA L;  4AYB G;  4QQB X;  4X6A H;  3KFU A;  3HOZ G;  5M3M G;  2N49 A;  1N32 L;  1EIY B;  4KHP Q;  2RHQ B;  4K0K L;  3U4V A;  3PO2 H;  5D1O B;  3OTO Q;  2K5N A;  3TY5 A;  4JI0 Q;  4NXN Q;  4A3C H;  4KHZ A;  4ME3 A;  4LUO A;  1ASZ A;  2JA6 G;  4DV3 L;  2HVR A;  2F4V L;  3M3Y H;  1E1T A;  1M90 C;  2YTX A;  4GS3 A;  4R4I A;  4BBS G;  3CPF A;  1CSQ A;  4NB3 A;  4P74 A;  1BBU A;  1WOC A;  4LF6 L;  1NY4 A;  4A3J G;  2HHH L;  1HZB A;  4OX9 Q;  3AYH B;  3FKI H;  4BA1 I;  4LFC L;  1EQR A;  1PFS A;  3VNN A;  1SMX A;  2IX1 A;  2JEB I;  2VQF Q;  3KDF A;  2ZJP A;  5FJ8 G;  3CXC A;  3CCS A;  4JOI C;  3B6Y A;  3JAM c;  1U5K A;  4AQY Q;  1IBL L;  2B29 A;  1N8R C;  3TY9 A;  1XK5 A;  4DR2 L;  2L15 A;  3FHW A;  2YTV A;  4UCV A;  1VQI A;  5IE8 A;  1EQQ A;  5C0X G;  5AJ3 Q;  4DV7 L;  5FLM G;  2N3S A;  3RR5 A;  4MNO A;  2HIX A;  2QEX A;  4B3T L;  1TA8 A;  4QY7 A;  3LGJ A;  4DV0 L;  3STB C;  1JE5 A;  1LTL A;  1PV4 A;  2JA8 H;  4B3R Q;  2E5L L;  3ICE A;  3JSL A;  1MJC A;  3G48 A;  4DR7 L;  4IPD A;  1I3Q H;  5JJL A;  2GN5 A;  2E8G A;  3PO3 H;  4IJH A;  1N36 Q;  2D0P A;  4P72 A;  4DV5 L;  1AH9 A;  4JI2 Q;  4LWC A;  1Q7Y C;  4B3S Q;  3S14 H;  4LF8 Q;  3H3V I;  3RZD H;  2UU9 L;  1S72 A;  3GTO H;  1X3E A;  3NEM A;  5DLQ E;  1OXT A;  3HOV G;  4LF9 L;  4L5Q A;  4GKK Q;  2C35 B;  4A76 A;  2KBN A;  4YCU A;  1G51 A;  1L2F A;  4PMW A;  2VW9 A;  2CFM A;  1L1O B;  4BXX H;  1C7Y A;  1PH7 A;  3AQQ A;  1GD7 A;  4LFB Q;  4DRF A;  2AKW B;  5FPO A;  1TWH H;  3GTQ H;  5C4J H;  3EIV A;  1NMG A;  4GNX B;  5HY6 A;  4LF5 L;  1Q1B A;  1CKN B;  4PZ6 A;  4GLV B;  3CMA A;  3U4Z A;  5C3E H;  4L5R C;  3CCL A;  2Q2U A;  4IFD G;  2PQA B;  1EYG A;  3T1H L;  4ALP A;  4AH6 A;  1HR0 Q;  4HTP A;  4XTC S;  2D62 A;  2IX0 A;  1N34 Q;  1QUQ B;  3PUY A;  3BJU A;  1Q46 A;  4JC0 A;  1E7Z A;  4O0A A;  1FVI A;  4KI0 A;  4BBR H;  4X65 Q;  4A3F G;  1Y1W H;  2Q2T A;  2B63 H;  1HNW Q;  1HNZ L;  1LYL A;  1HZC A;  1VQF A;  2WB1 G;  3CC4 A;  3S2D H;  5IYC H;  1VQN A;  2I5H A;  5EAY A;  4AYB E;  1IBM Q;  5M3F H;  1I5F A;  2QGQ A;  3MXN B;  3HOW H;  4DR3 Q;  1A8V A;  1JB7 A;  3JC6 6;  2PI2 E;  3PIO A;  1QZH A;  2I5M X;  3I4M H;  4C3H H;  4BY7 G;  3HFZ B;  4OO1 I;  5FLX c;  4JI8 Q;  3U50 C;  1JMC A;  3IRB A;  4CC5 A;  2RF4 A;  4DV6 Q;  2VUG A;  1VQD A;  1YNX A;  5LMN Q;  2F52 A;  1XPR A;  2N8N A;  3F1Z A;  3HOZ H;  1PVO A;  5M3M H;  1UWV A;  1CKM A;  1SR3 A;  2ES2 A;  4DPG A;  4KHP L;  1NJI C;  1HR0 W;  3HOU G;  3H0G G;  2AWN A;  2R93 G;  3EBE A;  5LMU Q;  4DR5 Q;  4JI0 L;  1L1O A;  4NXN L;  4IOA A;  3CCE A;  1Z9F A;  3D31 A;  3G71 A;  3GTG H;  2N78 A;  2AHO B;  2CKZ B;  3BU2 A;  4GN4 B;  4DAY B;  4LNQ A;  2JA6 H;  3HOX G;  1XNQ L;  1CKN A;  2PMZ E;  4IPH A;  3GTM H;  2E2H H;  3S1Q H;  1EUJ A;  4YY3 Q;  1EFW A;  1NE3 A;  2DGY A;  4A3J H;  1YI2 A;  1K73 C;  2PQA A;  1D7Q A;  4A3E G;  1YHA A;  3K0X A;  4JOI A;  4IO9 A;  4X62 Q;  3NC0 B;  1HJP A;  4DR4 Q;  4JYA Q;  1QUQ A;  3S17 H;  3K81 C;  3Q8D A;  4YWK A;  4GN3 B;  1MJE A;  2VQF L;  3S24 A;  3A5U A;  4JI7 Q;  4JCV E;  2VUM G;  3S1R H;  3K7U C;  5FJ8 H;  1P16 A;  2ZM6 Q;  4HJA A;  1J5E Q;  3J80 i;  2NVQ H;  1X3F A;  5GAE C;  4AQY L;  5JJI A;  2ALY B;  1KRS A;  1Q8K A;  1Q12 A;  1PH1 A;  3KF6 B;  1RL2 A;  2K52 A;  1CUK A;  4TVA B;  3U58 A;  2EIF A;  4MTN A;  4GN5 A;  4NXM Q;  1XNR Q;  3NBY B;  5AJ3 L;  5FLM H;  5IYB G;  4JI6 Q;  4A3L G;  1G29 1;  4BY1 G;  1WI5 A;  3A5Z B;  1A62 A;  2UUC Q;  4JI1 L;  1FJG L;  1VQ4 A;  4DV5 Q;  1BKB A;  4UFZ A;  3I4N G;  1VQP A;  1T9H A;  3HOY G;  1V43 A;  2R7F A;  1LM0 A;  1YEZ A;  4R4O A;  3ER0 A;  5IWA Q;  4E6N A;  1IBK Q;  3CCU A;  4DV1 L;  4HID A;  1WYD A;  2ZJQ A;  3TQY A;  4B3S L;  3BZC A;  1L1O C;  4DV4 Q;  3F2D A;  1XTD A;  2UXC L;  1NBW A;  1VQE A;  3AFQ A;  3K80 C;  2CWP A;  1O7I A;  5K36 G;  4GNX C;  1OXS C;  4GLX A;  1YJN A;  3HOV H;  2MNA A;  3A74 A;  3CW2 C;  3H3V H;  1GKH A;  3UDF A;  4HIO A;  1SRU A;  3GTP H;  1B8A A;  2UXD Q;  1YIT A;  1YVC A;  4C2M H;  1YIJ A;  1X9N A;  4A93 G;  5C0X I;  2UUB L;  1VQC A;  1KQS A;  4JI3 Q;  1Q86 C;  1HZ9 A;  2WFW A;  2WB1 E;  4YHH L;  5H1S E;  4DUY Q;  3RNU A;  1UEB A;  1GO3 E;  1HH2 P;  1K0R A;  4PZ8 A;  5IP7 G;  3UDG A;  2PNH A;  4Y7N H;  4L5S A;  2PI2 A;  3ZJY C;  4UCR A;  3BZK A;  3E9I A;  3KF6 A;  4H02 A;  5IYD G;  1L0W A;  1X3G A;  2JE6 I;  2VZA A;  1FL0 A;  1YBY A;  4A3F H;  5JEA J;  5IP9 G;  3J80 c;  4X65 L;  2E2I H;  4UCU A;  1KD1 C;  1HNW L;  3T1Y Q;  1N33 Q;  2GVB A;  1CKO A;  2OQK A;  2VQE Q;  2JA9 A;  3NBZ B;  2OQ0 A;  2Q2H A;  4QIW E;  4HIK A;  4A3K G;  4DV2 Q;  5D1O A;  3TS2 A;  4JV5 Q;  3J7Z C;  1PH5 A;  1U0L A;  2IT1 A;  2K4K A;  1PH8 A;  3PUZ A;  2WAQ G;  1VQ9 A;  1G6P A;  4BY7 H;  2YV5 A;  4MZ9 A;  1MIU A;  2JK8 A;  3ULJ A;  4A4I A;  2AWO A;  2H5X A;  4JI4 L;  4DV6 L;  3OW2 A;  1Y1V G;  4A3D G;  1OXU A;  4L5T A;  1UE6 A;  3G4S A;  1VQ8 A;  4IOC A;  2ZJR A;  1VQM A;  3CP0 A;  1N32 Q;  4KLK A;  1HNX Q;  2R6G A;  3HOU H;  3H0G H;  5HGQ A;  2R93 H;  2EXD A;  4DR5 L;  2IY5 B;  4IFD I;  4POG A;  3F2C A;  5GAD C;  3ERS X;  4A75 A;  1EWI A;  1E22 A;  3HOX H;  1FGU A;  1N9W A;  4DV3 Q;  3RN2 A;  4LF4 L;  2F4V Q;  3DM3 A;  4C3J H;  3H15 A;  4EFE A;  3QWU A;  3CC7 A;  4YY3 L;  4LF6 Q;  5D1P A;  3CC2 A;  2R7Z G;  4RMF A;  4DAM A;  3RTX A;  1SRO A;  3RZO H;  2BA0 A;  4A3E H;  4LFC Q;  2V1C C;  1JJG A;  4DR4 L;  1AE2 A;  1C9O A;  3I55 A;  4A3G G;  5JJK A;  2VUM H;  3GO5 A;  1J5E L;  4EFB A;  3BAA A;  4DUZ Q;  1IBL Q;  1PYB A;  2IHF A;  4GLA C;  4OWX B;  1K9M C;  1I94 L;  1UE1 A;  4DR2 Q;  2BH8 A;  2LSS A;  5GAH C;  2A8V A;  2ASB A;  3NEN A;  1JJ2 A;  1PH6 A;  5IYB H;  3G6E A;  4DV7 Q;  4HJ9 A;  4A3L H;  1P8L A;  3KLW A;  4DV0 Q;  4BY1 H;  1VQA A;  2VNU D;  3KJP A;  1JJC B;  2UUC L;  3CME A;  1NMF A;  2NVT H;  1H95 A;  1Q82 C;  1YJW A;  2NZH A;  2E5L Q;  4QGU A;  2ID0 A;  2R92 G;  3OTO L;  3GTK H;  4YCV A;  3I4N H;  1Y14 B;  1W2B A;  3W1B A;  3HOY H;  4DR1 Q;  5C0X J;  2K14 A;  2ATW A;  1IBK L;  1BBW A;  4AIM A;  5C44 G;  4GNX A;  3UE1 A;  3M4O H;  3JSN A;  3PCO B;  1PH4 A;  3M85 A;  3KJO A;  2HQL A;  1XMQ Q;  4BBS H;  4UP7 A;  3SGI A;  4POF A;  2HIV A;  5BR8 Q;  1VQO A;  2OWO A;  4OX9 L;  2YU9 H;  1B04 A;  3I56 A;  4LF9 Q;  3TY8 A;  1A63 A;  3AFP A;  4R4Q A;  3GTL H;  4PG3 A;  3PF4 A;  5M5Y H;  2VL6 A;  1Q81 C;  4A3M G;  2YYZ A;  4A93 H;  4GKJ Q;  1OTC A;  2MQH A;  1UE5 A;  2RCN A;  3L2P A;  5ELN A;  1GVP A;  4JI3 L;  4O2D A;  4LW1 A;  3GTJ H;  2UXB Q;  4DUY L;  5C4X H;  4OXP A;  4LF5 Q;  2ZTD A;  4UCT A;  5IP7 H;  2Y0S G;  2R7D A;  4HIM A;  4YWL A;  1VQ5 A;  4UCO A;  5FPR A;  4CC6 A;  4DKA C;  1Q1E A;  4LFA Q;  5IYD H;  1WFQ A;  3T1H Q;  1LUZ A;  1Z47 A;  1B7Y B;  1JT8 A;  2WAQ E;  4JBM A;  1J6Q A;  4B3R L;  2WP8 J;  5J3B A;  5IP9 H;  3BA8 A;  3CF5 A;  3L0O A;  3KDF B;  1D8L A;  4IPC A;  3T1Y L;  1HNZ Q;  2B3G A;  1TWA H;  1X55 A;  4A3K H;  2CCZ A;  3PV0 A;  3KYH C;  4C3I H;  1EIF A;  1IYJ B;  1E24 A;  2YTY A;  4JI5 Q;  2LXJ A;  4IFD J;  2XTI A;  4LF7 Q;  1N36 L;  3GJX B;  4DR6 Q;  4JI2 L;  3CAM A;  2JJQ A;  4LF8 L;  4HTO A;  1GM5 A;  1KIX A;  2CQO A;  3STB D;  4LH7 A;  3AEV A;  2ZTE A;  4JBW A;  4B3M Q;  4JBK A;  4A3D H;  1Y1V H;  3HKZ G;  1OXX K;  1E3P A;  1SE8 A;  1AE3 A;  1KRT A;  1X65 A;  4QL5 A;  4DNI A;  4A3I G;  4GKK L;  1SN8 A;  4PZ7 A;  1I50 H;  3J81 i;  3PF5 A;  1S68 A;  1KHI A;  3TS0 A;  2BA1 A;  4X66 Q;  1XMO Q;  3L7Z C;  4EX5 A;  2MO0 A;  1HNX L;  2NN6 I;  3CQZ H;  4UY8 C;  1NTG A;  3FP9 A;  5M5W H;  1VQL A;  1YZ6 A;  5DIS C;  2JQO A;  4UP9 A;  3BAB A;  3NEL A;  2NN6 G;  2D0O A;  4IJL A;  4OWT B;  1XNQ Q;  2NZO A;  3OYY A;  3RLO A;  1YHQ A;  1VQH A;  3UE0 A;  1HR0 L;  1N34 L;  4TQU S;  2R7Z H;  4EEQ A;  3CCR A;  4A3B G;  4J15 A;  3ULP A;  2EQS A;  1S3O A;  2NVX H;  3S1N H;  1SLJ A;  2JA5 G;  4JG2 A;  4A3G H;  1V1Q A;  3CCJ A;  2JA7 G;  4LUV A;  4NPS A;  1IBM L;  2NVY H;  4GOP B;  3CCQ A;  2KEN A;  3CCV A;  2BH2 A;  3KF8 B;  3W5O A;  1WJJ A;  4DR3 L;  3S1M H;  2KHI A;  4DUZ L;  1TWF H;  3PSI A;  3F2B A;  1WCM G;  4HJ8 A;  4XIG S;  4Y52 H;  4X64 Q;  2A1A A;  2A19 A;  3EN2 A;  3MEF A;  4JI8 L;  3UDX A;  2Q2I A;  4R4C A;  4UPA A;  4DK6 C;  1KAW A;  4DK3 C;  2UUA Q;  1IL2 A;  2JEA I;  5LMN L;  1BVS A;  1VS0 A;  3RLF A;  2F3I A;  4P71 A;  5GQO A;  1MKH A;  1YHB A;  4JI1 Q;  4OON A;  3PUV A;  1FJG Q;  2R92 H;  4K0K Q;  3PO2 G;  3M7N A;  2OCE A;  2Z0S A;  5LMU L;  4OWW B;  1UE7 A;  3DLL A;  2K5H A;  4DR1 L;  3VDY A;  4A3C G;  3J7A 5;  1VQJ A;  2CWA A;  3M9B A;  3S15 H;  4YWM A;  4EQ5 A;  3S16 H;  4UCS A;  5C44 H;  4RG1 A;  4DV1 Q;  1A0I A;  2DUD A;  1KC8 C;  1RIP A;  1XMQ L;  2I5L X;  3GD7 A;  3J81 c;  1DGS A;  2UXC Q;  5IT9 c;  2K5V A;  3I4O A;  4IPG A;  2HHH Q;  5BR8 L;  2Y0S E;  3FKI G;  1W3S A;  4X62 L;  3BA9 A;  4JYA L;  2KCM A;  4JI7 L;  1SFO H;  1K8G A;  4LFB L;  4WJ4 A;  2AMC B;  1VQ7 A;  4A3M H;  2ZM6 L;  2RHS B;  4GKJ L;  1VQK A;  1V9P A;  2UUB Q;  4GOP A;  3TRZ A;  2FXQ A;  3TRE A;  2UXB L;  4YHH Q;  4BA2 I;  2HVS A;  4HJ7 A;  1PH2 A;  3M4Q A;  4NXM L;  3GB8 B;  1XNR L;  1KL9 A;  1KXL A;  4P73 A;  4B3T Q;  4JI6 L;  1X6O A;  1XJV A;  4LFA L;  1X56 A;  2XGT A;  1VCI A;  3CPW A;  2GVA A;  4R4T A;  2IHE A;  5IY0 A;  4WJ3 M;  2JA8 G;  3TEH B;  1OXV A;  2MO1 A;  1EOV A; 
#chains in the Genus database with same CATH topology
 4R1J A;  4DR7 Q;  1B4O A;  2H1E A;  2LFN A;  1DON A;  1JDB B;  1SDF A;  5CV8 A;  1PK8 A;  4LF7 L;  3PO3 G;  2R86 A;  2Z04 A;  1IYD A;  2RSN A;  4IUR A;  5C1O A;  1TXY A;  1TWH B;  2NYZ D;  1AUV A;  1KJ8 A;  3T9F A;  2JP1 A;  4B3M L;  5JVL A;  1Q3L A;  2HT1 A;  1EY6 A;  5M5X H;  2L12 A;  3W1G A;  2V59 A;  1HQR D;  2UXD L;  4BXX G;  5J39 A;  2I0Q A;  5DGH A;  1JOQ A;  2FP4 B;  3A8I E;  4DNT B;  3K5L A;  3E3X A;  2W6Q A;  1K83 H;  1A48 A;  2LXK A;  4LF4 Q;  2F0T A;  4C3J G;  1HZA A;  3JAM i;  3PUX A;  4H0L C;  1QVG A;  3S2H H;  4P75 A;  1Z2O X;  2RQX A;  4K2L A;  2D5D A;  4BBR G;  1QVC A;  4DFA A;  4CMF A;  5ELD A;  2JA5 H;  1EQT A;  1UC9 A;  3PMF A;  2Z6K C;  1KBL A;  2F0S A;  2DN8 A;  1PMR A;  2A74 C;  3K7A H;  3U0G A;  2RA4 A;  3TBI B;  3Q24 A;  1DOK A;  3ND9 A;  4L8J A;  2N49 A;  4KHV A;  2RHQ B;  1AP0 A;  2FPP B;  2EIY A;  4ME3 A;  4LUO A;  3S1R B;  3URY A;  4FF1 A;  2HVR A;  3M3Y H;  1E1T A;  1VDZ A;  2EJG C;  2WII B;  4GS3 A;  4R4I A;  3T51 B;  1ROD A;  4NB3 A;  2O4X A;  1BBU A;  4P74 A;  1B50 A;  4A3J G;  1IYE A;  1CQJ B;  3R5H A;  2G9D A;  4IUU A;  4DAP A;  4C56 C;  2JEB I;  2EYJ A;  2VQF Q;  2ZXP A;  3CXC A;  3CCS A;  2YWV A;  1KTA A;  1CZG A;  2B29 A;  4IN3 A;  4UCV A;  1BCP F;  5IE8 A;  1EQQ A;  4B3T L;  3RR5 A;  4MNO A;  4QY7 A;  3I4L A;  4UAI A;  2F1M A;  2HGW A;  2JA8 H;  3SE0 A;  4MAM A;  1B3Q A;  2ABJ A;  4CDF C;  2CNQ A;  3MXU A;  3MEH A;  5EPL A;  5A35 A;  4B3S Q;  2B2T A;  2QKI C;  3J81 L;  1QNK A;  3RZD H;  3H3V I;  5H80 A;  3BDC A;  2F0V A;  1DJR D;  2EVB A;  1OXT A;  3M7G A;  4KV6 A;  4GKK Q;  2C35 B;  3QWU A;  2KBN A;  2HDL A;  1G51 A;  5COY A;  1C7Y A;  4HCS A;  3VR3 A;  4LFB Q;  4DU9 A;  2B8G A;  1TWH H;  1TS3 A;  2PO4 A;  5EJW A;  4MN3 A;  4GNX B;  3KF8 A;  4EGJ A;  1Q1B A;  2F0L A;  1GUO A;  1NUC A;  4GLV B;  3CMA A;  1JWS D;  2A69 D;  5C3E H;  5JVG 3;  3VYR A;  1SAP A;  1EYG A;  1O7Y A;  1FGB D;  1WTP A;  2D62 A;  4TV9 F;  1QUQ B;  1S5E D;  1Q46 A;  1K8M A;  2QIL A;  1LYL A;  1HZC A;  1Y8N B;  1VQN A;  1MHW C;  1MSH A;  3HZX A;  3HOW H;  4R9W A;  2Q7D A;  3HOU B;  2R93 B;  1SNQ A;  1CK1 A;  1LTR D;  2L5T A;  5E4X A;  2RF4 A;  4DV6 Q;  2Q8T A;  1CT1 D;  5LMN Q;  1XPR A;  2NZ1 D;  1EY4 A;  2N8N A;  3VOT A;  5BWR A;  2LY7 A;  1KJI A;  5I2Y A;  1NJI C;  1HR0 W;  3EBE A;  4O86 A;  4IOA A;  3E5S A;  5D65 A;  3CCE A;  1Z9F A;  3HP3 A;  1MBY A;  3G71 A;  3NUA A;  3SK5 A;  2AHO B;  2CKZ B;  4DAY B;  4GN4 B;  3VR6 A;  4CDE C;  1XNQ L;  2PMZ E;  4YAK B;  2R7N A;  4FXK C;  4YY3 Q;  1K73 C;  4EGV A;  2PQA A;  2B2Y C;  4A3E G;  4O4I F;  4X62 Q;  1HJP A;  3SK4 A;  3Q8D A;  3NWT A;  3S24 A;  3DEP A;  2IL8 A;  5KRU A;  3S1R H;  1CZW A;  4HJA A;  1J5E Q;  2VUM G;  2NVT B;  1IHZ A;  2A1H A;  3J80 i;  1G2W A;  1X3F A;  2ALY B;  2P0A A;  4HCE A;  3HOY B;  5FK9 C;  5BN5 A;  1CUK A;  4MTN A;  3X3N A;  1W6J A;  1VBH A;  1F2M A;  4KKS A;  2W6O A;  3M4O B;  4BY1 G;  3TIG A;  1A62 A;  2E2H B;  5J1Z A;  1FJG L;  2GQR A;  2ENB A;  1BKB A;  4UFZ A;  4C1N I;  5TSS A;  2W6N A;  3ETH A;  1B6R A;  1K0S A;  1B1Z A;  2QB5 A;  3S17 B;  2R7F A;  1LM0 A;  5IWA Q;  3T54 A;  1GUN A;  1A15 A;  4ZKC B;  2PMZ B;  3TQY A;  5BWT A;  3HRZ C;  1M4V A;  4LMQ D;  1VQE A;  3K80 C;  2CWP A;  5K36 G;  4GNX C;  1YJN A;  2MNA A;  4TKO B;  1H9M A;  1B8A A;  4C2M H;  4RGO S;  1Z7T A;  5I60 A;  3I90 A;  5FLX E;  4JI3 Q;  1KQS A;  4YHH L;  1ET0 A;  1TWA B;  5H1S E;  2K5W A;  4A3K B;  1GO3 E;  4C3I B;  4L5S A;  1A6X A;  3WNZ A;  1EQV A;  5EPK A;  2PI2 A;  3RUZ A;  3BZK A;  4H02 A;  2MHV A;  5BPF A;  1XTC D;  1X3G A;  4DK1 A;  3ORR A;  1EYD A;  3NBH A;  4UCU A;  3QOL A;  1KD1 C;  2B8F A;  3R2T A;  1S4Z A;  3T1Y Q;  2HD3 A;  2JA9 A;  3HOV B;  3NBZ B;  3ZYY X;  2OQ0 A;  4QIW E;  5D1O A;  4GZY C;  4JV5 Q;  1EUC B;  1PH5 A;  4RFB A;  1U0L A;  2K4K A;  2RKS A;  5IOC A;  1VQ9 A;  4KK7 A;  2TSS A;  4V19 0;  1G6P A;  1TU2 B;  4HSP A;  1RD9 D;  2BOS A;  3AW8 A;  3OW2 A;  1XYI A;  4CKC A;  4X3S A;  1G6Z A;  2COG A;  1VQ8 A;  3G4S A;  5I9O A;  1VQM A;  3TP8 A;  3ERQ A;  2R7Z B;  1HNX Q;  2G5D A;  5FO9 B;  3H0G H;  4A3F B;  3HOU H;  2E2I B;  3DWA A;  2EXD A;  2R93 H;  4YB8 B;  1XX8 A;  4POG A;  2Y4R A;  3F2C A;  2W70 A;  1RJT A;  3W2D A;  1H9K A;  1SE2 A;  1SE4 A;  2CHB D;  2KVM A;  3DM3 A;  4WJW A;  2HQE A;  5D1P A;  4IUV A;  4BY7 B;  3MC0 B;  3RZO H;  3VR2 A;  4LFC Q;  2V1C C;  1SMY C;  1PX2 A;  4QIW B;  2CH4 W;  2P5Z X;  1CHQ D;  5JJK A;  3GO5 A;  3BAA A;  1W96 A;  1I94 L;  4DR2 Q;  5CA1 F;  1EFI D;  3S15 B;  5IGG A;  1SYD A;  1JJ2 A;  5IYB H;  3JZI A;  3UZO A;  3KLW A;  1BNZ A;  3HOX B;  2VNU D;  3KJP A;  1BR9 A;  3MFG A;  1T5E A;  2UUC L;  2NVT H;  1YJW A;  2E5L Q;  2ID0 A;  1T5X D;  2R92 G;  2K01 A;  2D2C C;  2M2L A;  3W1B A;  5J22 A;  4DR1 Q;  3HOY H;  1I7N A;  1CQI B;  2ATW A;  1IBK L;  4AIM A;  1BNC A;  3ETJ A;  4O84 A;  3M4O H;  3M85 A;  3KJO A;  1XMQ Q;  4O7W A;  1HUN A;  4WBN F;  1FNV A;  1EY7 A;  4K14 A;  1RDP D;  1LTS D;  4POF A;  5BR8 Q;  1VQO A;  3T56 B;  2BDO A;  2YU9 H;  2QF7 A;  1SYB A;  4R4Q A;  2F0K A;  2OF1 A;  1TT2 A;  2VL6 A;  4A3M G;  2YYZ A;  4A93 H;  2MQH A;  4OIK A;  1GJX A;  2YS7 A;  1GVP A;  1ET9 A;  2H4O A;  4O2D A;  3I4N B;  3BYT B;  4OHJ A;  5IP7 H;  1VQ5 A;  4HIM A;  2NU9 B;  3DTF A;  4LJZ C;  4CC6 A;  2R61 A;  2DNC A;  1ZAU A;  4FO2 A;  3T1H Q;  1Z47 A;  4MA5 A;  1EY8 A;  1PZK D;  1SXT A;  4HAE A;  4O7S A;  3L0O A;  3U9O A;  3DXJ C;  2SCU B;  1TWA H;  4A3K H;  4C3I H;  2YTY A;  2XTI A;  3GJX B;  5IT9 E;  1I4R A;  4G7Z C;  2NTS A;  3CAM A;  4IWY A;  5C8Y F;  4FF3 A;  2RCF A;  1GM5 A;  1KIX A;  1J8I A;  3OWE B;  4RCN A;  2ZTE A;  3AEV A;  5BWV A;  1OXX K;  1KRT A;  4A3I G;  1S68 A;  5I5W A;  2YYA A;  3L7Z C;  2F3V A;  3QB3 A;  1WTO A;  2NN6 I;  3CQZ H;  4G7O C;  1C30 A;  1NTG A;  1SSO A;  4UUG A;  1VQL A;  4I65 A;  5I47 A;  2F0D A;  1E2W A;  4UP9 A;  2SNM A;  2JA7 B;  4RZQ A;  3K58 A;  1MGS A;  3BVG A;  2D0O A;  3SR1 A;  4IIJ F;  5DAU A;  4YBZ B;  2NZO A;  4TUY F;  2F0E A;  1YHQ A;  3A7A B;  1HR0 L;  1WCM B;  1GXD C;  2R7Z H;  4NYE A;  4EEQ A;  3CCR A;  4A3B G;  2EQS A;  3UI2 A;  2IX3 A;  1CA5 A;  4HED A;  1R4Q B;  4LUV A;  4NPS A;  3IFD A;  2D9U A;  3CCV A;  4GOP B;  1I50 B;  1V8Q A;  2QK4 A;  4DUZ L;  2PCF B;  3F2B A;  3I3C A;  4XIG S;  2A19 A;  1ZEQ X;  3EN2 A;  3MEF A;  4QF4 A;  3UDX A;  1F77 A;  1KAW A;  4DK3 C;  2UUA Q;  3RLF A;  2F3I A;  5GQO A;  1LAC A;  4NKL A;  3PUV A;  2Z4H A;  5C5L A;  5LMU L;  4OWW B;  4XQQ A;  1RTO A;  3DLL A;  1QJO A;  3S1N B;  2CWA A;  3M9B A;  4A3G B;  3S15 H;  4YWM A;  4EQ5 A;  5C44 H;  4RG1 A;  4DV1 Q;  2DUD A;  1RIP A;  2FB9 A;  1NR4 A;  3GD7 A;  3NHH A;  2K28 A;  1EIG A;  3VYU A;  2VR1 A;  4IPG A;  2Y0S E;  1WTX A;  3FKI G;  1W3S A;  1SYE A;  3BA9 A;  3OIP A;  1SFO H;  1E4E B;  2ZM6 L;  2UUB Q;  2FXQ A;  3M4Y A;  1I4Q A;  4BA2 I;  3MVV A;  1PH2 A;  4HTH A;  2V4D A;  4FVM A;  4K5V A;  1XNR L;  4EG0 A;  1KXL A;  4RGM A;  4JI6 L;  4LFA L;  1KLU D;  1U4M A;  5L37 A;  2GVA A;  4R4T A;  4KKT A;  2EDG A;  2IHE A;  4WJ3 M;  2DLN A;  4NZM A;  4XQJ A;  1R9T H;  2MO1 A;  2Z6K A;  3OSO A;  1C0A A;  4MV6 A;  1XPU A;  5BN3 A;  3KLS X;  3HKS A;  1X54 A;  2OTL A;  3RN5 A;  1TWG H;  1TAE A;  2MUY A;  4DR6 L;  3E9H A;  1QVF A;  4DV4 L;  5DMX A;  1Y8P B;  5C1P A;  2OT2 A;  2K50 A;  1UUP A;  1CQV A;  1JOK A;  2Y0S B;  3J7A F;  1HFG A;  1KDB A;  4YJ2 F;  2VS1 A;  3JAM E;  3VYS A;  4ZK9 B;  1EWH A;  3RLN A;  4IQZ A;  4X66 L;  1XMO L;  3TP6 A;  3WWJ A;  4QUC A;  3S2D B;  3C1F A;  5BMV F;  5M3F B;  2ZTC A;  1XDN A;  2F0G A;  1JIC A;  4GOP C;  1K8A C;  3E5N A;  4QB4 A;  5CBE E;  1K3R A;  5JJZ A;  5ELO A;  4QJF A;  1F2Z A;  2BCO A;  3R9R A;  3SVM A;  3BDL A;  1XWE A;  1VQ6 A;  2B63 G;  1N33 L;  4YCW A;  2VQE L;  5BPH A;  4I7A A;  2OTJ A;  2JA7 H;  4HJ5 A;  5LMN W;  2VY3 A;  4KMU C;  4RHR A;  2RDF A;  2K75 A;  1S40 A;  1BCP B;  2L1B A;  4JXU A;  1WCM H;  4Y8V B;  4HQ6 A;  1CSP A;  3I4M G;  3G8D A;  4X64 L;  4O7Y A;  2KHJ A;  4NZO A;  4O7N A;  2QW7 A;  2KCT A;  3I70 A;  3UDI A;  2JA6 B;  1SE3 A;  4X6A H;  3GQB A;  3HOZ G;  1W6K A;  3QOJ A;  4QUF A;  1EIY B;  4X3T A;  3MA2 B;  2OLS A;  3U4V A;  5FKA C;  5KGU A;  3TY5 A;  4JI0 Q;  4NXN Q;  5ELC A;  3FRP B;  4A3C H;  4KHZ A;  3E0J A;  2QCP X;  2F4V L;  1M90 C;  1CSQ A;  1WOC A;  4PNY A;  4OX9 Q;  3VNN A;  3TEK A;  2I87 A;  2IX1 A;  4ZUI A;  2EJM A;  1STA A;  4CJ1 B;  1CHP D;  1SYF A;  2MP1 A;  4H13 C;  3T16 A;  2L4N A;  1A3T A;  4DF7 A;  3Q22 A;  1XK5 A;  3BG3 A;  1VQI A;  4DV7 L;  5JAV A;  5E25 A;  2HIX A;  3LGJ A;  4DV0 L;  1LTG D;  3STB C;  1LT6 D;  1PV4 A;  4B3R Q;  2PN1 A;  1YNN D;  3ICE A;  3G48 A;  4DR7 L;  4IPD A;  3SK8 A;  1I3Q H;  2MPM A;  2KED A;  5JJL A;  3DF7 A;  4E4T A;  4KD4 A;  2E8G A;  4CKB A;  4IJH A;  1N36 Q;  1C48 A;  5D8D A;  4ZCK A;  4JI2 Q;  2K33 A;  4CJ0 B;  1RCV D;  4LF8 Q;  4DAA A;  3R23 A;  2B39 A;  1AEX A;  1DAA A;  3IFT A;  3HOV G;  4O83 A;  2QDL A;  3JZF A;  1WTR A;  4L5Q A;  4OO1 H;  1B2T A;  1L2F A;  2KA7 A;  1PH7 A;  2AKW B;  3GTQ H;  1F2L A;  1B9M A;  5JEA H;  1NMG A;  3KRE A;  5HY6 A;  4LF5 L;  1S5F D;  3KLR A;  2B2Y A;  3U4Z A;  3WOE A;  2Q2U A;  4IFD G;  3FPP A;  4AH6 A;  4DAV A;  2ZXO A;  3HO8 A;  1N34 Q;  3PUY A;  3RZD B;  4O0A A;  4A3F G;  1Y1W H;  3TIN A;  1VKZ A;  1HNW Q;  3MXP A;  1IW7 D;  1HNZ L;  3CC4 A;  3S2D H;  5IYC H;  2I5H A;  1MI2 A;  1LT3 D;  2YRW A;  5M3F H;  2EY5 A;  3MXN B;  2EYF A;  2SEB D;  4O1N A;  1A0G A;  1JB7 A;  3OIQ A;  3PIO A;  2I5M X;  4C3H H;  4BY7 G;  5J2T F;  4OO1 I;  5FLX c;  4JI8 Q;  2NUA B;  3IRB A;  1VQD A;  5C3E B;  1DOL A;  2AUJ D;  5EBD A;  3V96 A;  5LHY 1;  4FFP A;  4RH6 A;  1PVO A;  5M3M H;  1UWV A;  2ES2 A;  1Z6H A;  1AZP A;  2AWN A;  4HN2 A;  4N9P A;  1WTQ A;  1DIK A;  3TSS A;  5CA0 F;  1KLG D;  1I2K A;  2ZDH A;  2JA6 H;  3HOX G;  3HOW B;  5CB4 F;  1PXU A;  2A6H D;  5CV5 A;  1QE6 A;  1D7Q A;  1Y8O B;  2YZG A;  1CFM A;  4JOI A;  4IO9 A;  2VPQ A;  3ORQ A;  4DR4 Q;  4JYA Q;  1QUQ A;  2WAC A;  3K81 C;  4JI7 Q;  4YWK A;  4EQO A;  2VQF L;  5FJ8 H;  5GAE C;  5JJI A;  4I4T F;  2QDB A;  1Q8K A;  1Q12 A;  1PH1 A;  3KF6 B;  1IL8 A;  4TVA B;  4EQN A;  3U58 A;  4NXM Q;  3NBY B;  5C0X H;  3FPU B;  5FLM H;  1M0T A;  3H3V C;  1G29 1;  2HCI A;  2EYP A;  3LX0 A;  3NWS A;  1PTO D;  1TQO A;  4DV5 Q;  3D6C A;  2ZT9 C;  3I4N G;  4CBV A;  2K7V A;  2NU8 B;  4B08 A;  4X3K A;  4FF2 A;  2GQS A;  1YEZ A;  4E6N A;  2F0N A;  4Q0F A;  1A9X A;  1SYG A;  3MZ5 A;  5DNF A;  1BOS A;  4WFN 3;  2X69 A;  2VQD A;  4B3S L;  2FPG B;  4DAY A;  3R93 A;  2UXC L;  1F9P A;  3QJY A;  3HS0 C;  5C4X B;  4M9U A;  3H3V H;  2UXD Q;  3PFF A;  1YVC A;  1X9N A;  3J7Y W;  5C0X I;  2A73 B;  4U67 3;  1VQC A;  5FO8 B;  3JAM L;  2EZV A;  2WFW A;  5ELB A;  2WB1 E;  1K0R A;  5G3L F;  3NXW A;  4Y7N H;  1X3Q A;  4NMZ A;  4ILW A;  3E9I A;  5IYD G;  1L0W A;  1NAP A;  2LMC B;  2KQ3 A;  5CV6 A;  4ZOL F;  1E2Z A;  2JE6 I;  2WAQ B;  1WD1 A;  4Q4C A;  5HNE A;  2GVB A;  3T9A A;  4RAU C;  4MV7 A;  5CMD A;  5EBC A;  3J7Z C;  1DM0 B;  4C2M B;  1I4P A;  4ODG A;  3ERO A;  3U9S A;  5C3W A;  3ULJ A;  1MIU A;  2JK8 A;  1BO0 A;  1EYZ A;  2C00 A;  4JI4 L;  4DV6 L;  1Y1V G;  1S5B D;  2QEJ C;  2R84 A;  3QWN A;  5ELE A;  1GUS A;  4KLK A;  1BXT A;  2EJF C;  4ABN A;  5HGQ A;  2IY5 B;  3KUP A;  2PQE A;  4ZYS A;  2WB1 B;  3KAL A;  3KBG A;  1TS4 A;  2YL2 A;  5DEH A;  1E22 A;  4YAJ B;  1FGU A;  2ZDQ A;  3S1M B;  4JW0 A;  2F0F A;  4YY3 L;  1HUM A;  5J2U F;  5JH7 F;  4RMF A;  3JZ6 A;  4DAM A;  1UAP A;  1JJG A;  3OWF A;  2F0I A;  2IW3 A;  4A3G G;  1II3 A;  2ICE C;  1J5E L;  5D14 A;  5NUC A;  3H0G B;  4GLA C;  1TS5 A;  2A8V A;  4A3L H;  1U9R A;  1V1P A;  1P8L A;  1H95 A;  3A7L A;  2Z6B A;  3OTO L;  3RZO B;  1Y14 B;  1W2B A;  3TN2 A;  4YJ3 F;  2CZG A;  1JOR A;  2SOB A;  4IUN A;  3JSN A;  3PCO B;  3IKJ A;  5BWU A;  2HQL A;  4UP7 A;  2A69 C;  3F2U A;  4E6I A;  1K3B C;  2CNU A;  4PBC A;  2V5A A;  1A2U A;  2B2V C;  2FJ2 A;  4KY7 A;  4OEL B;  4PG3 A;  1Z2P X;  3MWY W;  3TQT A;  1F9R A;  2PZU A;  1OTC A;  1TY2 A;  1UE5 A;  3H6M A;  5ELN A;  1SEB D;  4JI3 L;  4LW1 A;  5IOD A;  5C4X H;  4OXP A;  2BE5 D;  2A68 D;  2Y0S G;  2SNS A;  4UCO A;  4K2K A;  1Q1E A;  3OPO A;  5CR3 A;  1HA5 A;  3VPD A;  1LUZ A;  1HHV A;  3NQT A;  4B9X A;  1LV9 A;  5J3B A;  5IP9 H;  4BS9 A;  4CMD A;  3BA8 A;  1V1O A;  4IZ8 A;  3T1Y L;  2YU9 B;  4IAL A;  3OW7 A;  3GV3 A;  5A2Q L;  2CCZ A;  1STG A;  4FE2 A;  4LAA A;  1EIF A;  1IYJ B;  1E24 A;  2NTT A;  2PZW A;  4JI5 Q;  1HTL D;  2B2W A;  1ZYR D;  2LXJ A;  3LWE A;  4IFD J;  3K5I A;  5CE8 A;  4A93 B;  1GSO A;  2L9H A;  2EXZ A;  2JJQ A;  2OXP A;  2HGX A;  3VPB A;  2A6E D;  4JBW A;  4A3D H;  1SE8 A;  1AE3 A;  2VB2 X;  3PF5 A;  4PZ7 A;  2BA1 A;  1HNX L;  1QWY A;  1KAA A;  3BYY B;  2K32 A;  1AUX A;  3VR4 A;  1HQM C;  2JQO A;  3Q6S A;  3BAB A;  4I50 F;  3NEL A;  1XNQ Q;  3KAK A;  4L1K A;  1FD7 D;  4TQU S;  4NZN A;  3RFC A;  1D1K A;  1DOM A;  3J80 L;  3ULP A;  1S3O A;  1PFB A;  2JA5 G;  1IBM L;  2FMM A;  3CCQ A;  2KEN A;  1QCB D;  2C9O A;  1VF7 A;  3KF8 B;  3W5O A;  1H9J A;  1WTH A;  4XXE A;  4DR3 L;  2PYK A;  3S1M H;  1M0W A;  1TWF H;  2EY6 A;  3PSI A;  3CQZ B;  4DIM A;  2K1B A;  3U9T A;  2A1A A;  4MV8 A;  3G7L A;  5FOB B;  3KAJ A;  2EJ2 A;  4P71 A;  2YZM A;  3Q1K A;  2CNV A;  1FJG Q;  2AQ2 B;  4K0K Q;  1H9R A;  4KJN A;  2OCE A;  2Z0S A;  1JR0 D;  1G91 A;  4DR1 L;  4O7R A;  4PQX A;  2BDN A;  4L6T B;  1XMQ L;  4H7B A;  3J81 c;  3LWU A;  3GID A;  2ODT X;  4KTA A;  2WKD A;  2HHH Q;  1FR3 A;  5BR8 L;  4K5W A;  4EGQ A;  5I5Y A;  1RF2 D;  4WJ4 A;  3VA7 A;  1VQ7 A;  3C46 A;  1V9P A;  2FHT A;  4GOP A;  3TRZ A;  4YIJ A;  4J6H A;  4YHH Q;  3OUU A;  1IYV A;  4O4J F;  4HJ7 A;  5KND A;  3M4Q A;  3GB8 B;  2X5R A;  3MWD A;  3NUC A;  5C44 B;  1XJV A;  3DHQ A;  3FMC A;  3Q0A A;  1EIH A;  2JA8 G;  2XVS A;  4MHE A;  1PYS B;  3EJI A;  1PH3 A;  4JPB W;  3HKZ E;  3VPC A;  1XPO A;  1SFO B;  5IGD A;  3RD4 A;  5GRO A;  3A0J A;  2F0H A;  2WKC A;  4XDX A;  1AW7 A;  3IAY A;  2DWC A;  2R82 A;  2UU9 Q;  3MJF A;  1E0B A;  1YNJ D;  2E2J H;  3AB9 A;  2ZDG A;  2XD4 A;  3D4W A;  4UP8 A;  2B2T C;  2Z4I A;  1H9S A;  5E7N A;  1F2Y A;  3PN1 A;  3KOJ A;  2QA4 A;  4O82 A;  3PIO 3;  1R9T B;  1E4E A;  1C4Q A;  1QZG A;  2NWG A;  3K3P A;  1VQG A;  1L0X B;  3PUW A;  4FYD A;  3PGZ A;  1TWG B;  1O78 A;  2NN6 H;  5C3E G;  2Q8R E;  1EKV A;  4HMI A;  3C3L A;  2HJW A;  1D5Z C;  4LH6 A;  3ULL A;  3LNN A;  1VF5 C;  1AN8 A;  2K6A A;  2RBM A;  1PH9 A;  1IXR A;  3HKZ B;  3M4P A;  4DV2 L;  3D0F A;  2K05 A;  2R85 A;  3WWV A;  1PA6 A;  4LUZ A;  3HOW G;  3J81 j;  4WRD A;  3ND8 A;  4JBJ A;  2WYO A;  1YJ9 A;  1I94 Q;  4KN4 C;  1SBB B;  1LTA D;  4V0B A;  1ASY A;  3GTG B;  2J9G A;  5CR5 A;  3AX6 A;  3NBH B;  2UUA L;  3CCM A;  2JSO A;  3I7F A;  3I72 A;  1SND A;  3KFU A;  3S1Q B;  1U4L A;  1N32 L;  4KHP Q;  3DM1 A;  5D1O B;  3PO2 H;  2K5N A;  3H94 A;  5IGE A;  1D5X C;  1WD0 A;  2I8C A;  2EYO A;  2DAB A;  4IZO A;  2R87 A;  1ASZ A;  4DV3 L;  2YTX A;  4UDU C;  4LF6 L;  1NY4 A;  3HT5 A;  1HZB A;  1G2S A;  4ZQI A;  2I07 B;  4BA1 I;  1PFS A;  2EYM A;  1SMX A;  1FNW A;  4QCL A;  1MD2 D;  4FNF A;  3KDF A;  2ZJP A;  4RGT A;  1U5K A;  4AQY Q;  1IBL L;  4N8F A;  1N8R C;  3TY9 A;  5LOV F;  3N52 A;  2XRS D;  2YTV A;  5E4W C;  5AJ3 Q;  2N3S A;  3PQI A;  3TW7 A;  2QEX A;  1TA8 A;  1GOZ A;  3L3O C;  3BZD B;  3AMU A;  1EWC A;  5K3W A;  2HHF A;  1BUV T;  1CI3 M;  2GN5 A;  1M8A A;  5E1F A;  1KJQ A;  1ET6 A;  3PO3 H;  2D0P A;  4LWC A;  1QIL A;  1PZJ D;  5EQ0 A;  3CHB D;  5FO7 B;  2DAA A;  1S72 A;  4OL7 A;  4F8M A;  1X3E A;  2E76 C;  5DLQ E;  4LF9 L;  1EZ8 A;  3LQS A;  4A76 A;  1RHP A;  4BXX H;  3T4A C;  1L1O B;  3AQQ A;  1GD7 A;  1TR5 A;  4RHS A;  3N6R A;  3V4Z A;  3K0Y A;  1I3Q B;  1CKN B;  2CW0 D;  2YRX A;  4L5R C;  3OUZ A;  4MV9 A;  5D3I B;  3CCL A;  2KJX A;  3BS1 A;  4ALP A;  1GLV A;  1HR0 Q;  1ULZ A;  3KBX A;  4HTP A;  2J7Z A;  2TMP A;  4JC0 A;  4BBR H;  3BJU A;  1E7Z A;  4IWX A;  4X65 Q;  2Q2T A;  1ENA A;  2WB1 G;  1WTW A;  4AYB E;  2QGQ A;  4J8Q A;  1EU4 A;  1A8V A;  1Q90 A;  3GTQ B;  4ZI7 F;  1QZH A;  4MIU A;  2W6P A;  3U50 C;  3V05 A;  2VUG A;  2F52 A;  2A5H A;  3F1Z A;  2F0W A;  2PNR C;  3NE5 B;  2Z8L A;  1EEI D;  4HN7 A;  1A3G A;  3HOU G;  3H0G G;  1Y1W B;  2R93 G;  4A3E B;  5LMU Q;  4DR5 Q;  4JI0 L;  4NXN L;  1L0Y B;  3A8K E;  2EYL A;  3RUP A;  2G9H D;  5AFW A;  3GTG H;  3BU2 A;  2VUM B;  4KN7 C;  1PZI D;  3GTM H;  3SE7 A;  3CEB A;  3S1Q H;  3SDZ A;  2DGY A;  4A3J H;  1YI2 A;  3IL8 A;  3P1H A;  4C3H B;  4FXD A;  1YHA A;  3K0X A;  1KUT A;  4AYB B;  3EA6 A;  4BY1 B;  3K7U C;  2ZM6 Q;  5M3M B;  4TV8 F;  2NVQ H;  2FFK B;  3T9C A;  3QG1 A;  2CVR A;  3WOF A;  3MWE A;  2EIF A;  1XNR Q;  1GHJ A;  3DUZ A;  3FEW X;  5IYB G;  4JI6 Q;  5KX5 F;  4BBS B;  2F3W A;  1A3U A;  3TP5 A;  2GLT A;  4JI1 L;  1VQ4 A;  2HUG A;  1ESF A;  4ZAI A;  2B2U C;  3T9B A;  5D3D A;  4Z9C B;  1T9H A;  3HOY G;  4HSV A;  4RKB A;  1PRT B;  3ER0 A;  3NPP A;  1GHK A;  1I2L A;  1K8O A;  4HID A;  1WYD A;  2ZJQ A;  4CKE A;  5IGC A;  3DTG A;  3BZC A;  1L1O C;  2HDK A;  3QFF A;  4DV4 Q;  1HRJ A;  3F2D A;  1XTD A;  3GTJ B;  1KDC A;  3AFQ A;  2F0Q A;  1OXS C;  4DN4 M;  4GLX A;  1IOW A;  4ULL A;  3CW2 C;  4XZ3 B;  2KHS A;  1SRU A;  4CHI A;  1YIT A;  1YIJ A;  3H09 A;  4A93 G;  4KY5 A;  4JVZ A;  4MA0 A;  3DWQ A;  4DUY Q;  3RNU A;  5CV4 A;  1I4G A;  1UEB A;  1HH2 P;  1Q8I A;  5IP7 G;  4UCR A;  3UDG A;  5CGK A;  3KF6 A;  1S5D D;  4DLK A;  2VZA A;  4ZLT F;  1HNW L;  3R5F A;  2PW5 A;  1N33 Q;  2VQE Q;  2OQK A;  4FFL A;  3CKI B;  4A3K G;  3G6J B;  4C3I G;  5IGB A;  1ILP A;  3TS2 A;  1KAB A;  4N9T A;  2JYO A;  2X0S A;  1PLF A;  4Q5V A;  2IT1 A;  1EY0 A;  3PUZ A;  1KNA A;  1WRV A;  2F0U A;  3JRX A;  1GUW A;  2RSO A;  5KYI A;  4A4I A;  2H5X A;  4Y7N B;  5JQG F;  1BCP D;  2KUM A;  1JOO A;  1OXU A;  2XN9 C;  1JWM D;  3CP0 A;  2R6G A;  2OEO A;  2KCC A;  4XYL B;  3R8B A;  1VBG A;  1ZXT A;  4OGQ C;  2NVX B;  5GAD C;  2NVY B;  3ERS X;  2K5D A;  3J7A V;  2L11 A;  4HNT A;  3NTI A;  3RN2 A;  4LF4 L;  4KD3 A;  2F4V Q;  4EFE A;  1LTI D;  3H15 A;  3CC7 A;  5A2Q E;  2R7Z G;  2ICI A;  2PVP A;  1SRO A;  4A3E H;  1PFN A;  4DR4 L;  1C9O A;  5C3X A;  3I55 A;  3T7A A;  2AQ1 B;  4ZHQ F;  3V2T A;  4R8I A;  1YNN C;  2VUM H;  1D5M C;  4EFB A;  1GSH A;  1B3A A;  2R92 B;  5DM7 3;  4I7Z C;  3R5X A;  1K9M C;  4IUP A;  4OEM B;  1UE1 A;  3LWB A;  2BH8 A;  2I46 A;  4O42 A;  2LSS A;  1IOV A;  3LUL A;  3NEN A;  3G6E A;  4DV7 Q;  1PRT C;  4DV0 Q;  4BY1 H;  2NU6 B;  3K5M A;  5CM0 A;  1JJC B;  1T36 A;  2GPS A;  1GUG A;  4QGU A;  1PDQ A;  1U4R A;  1I1M A;  3WDN A;  2LS0 1;  1LTB D;  3A55 A;  1EZ6 A;  1KTK A;  2K14 A;  1SNM A;  1BBW A;  4G4K A;  5C44 G;  4GNX A;  1PFM A;  1SNC A;  3UE1 A;  4G7H C;  4A3M B;  4BBS H;  1NR2 A;  3J80 E;  4J1M A;  1HA6 A;  3SGI A;  2JN4 A;  5HBR B;  2HIV A;  4DA2 A;  2OWO A;  5K36 H;  3LP8 A;  3I56 A;  3BVM A;  1PYW D;  2ZXR A;  3AFP A;  3GTL H;  3EFX D;  1WTV A;  1M6V A;  2XWJ B;  5M5Y H;  4O81 A;  4GKJ Q;  1IW7 C;  2EYH A;  3G8C A;  4HR7 B;  2RCN A;  4ZQ3 A;  1CS0 A;  3Q2O A;  4XT1 B;  4P2C B;  3GTJ H;  4WOR A;  2UXB Q;  1W93 A;  4LF5 Q;  4NP5 A;  4UCT A;  5FPR A;  2XSC A;  2L0C A;  4YWL A;  2DY8 A;  4UHV A;  4DKA C;  1BXR A;  1A3V A;  1B7Y B;  1X32 A;  2K03 A;  2WAQ E;  3T99 A;  1J6Q A;  5IIF A;  1U4P A;  1I6H B;  1D8L A;  5EKL A;  1HNZ Q;  1X55 A;  1R4P B;  3KYH C;  4A3I B;  5KNC A;  5LYJ F;  1TWC B;  4LF7 Q;  1KDA A;  1C8C A;  4KY6 A;  4HTO A;  2CQO A;  4O2B F;  2RDG A;  2C5C A;  4B3M Q;  1ICW A;  3OMG A;  2A6H C;  2F0J A;  1ZKO A;  3HKZ G;  4FXG C;  1E3P A;  3R2I A;  2COJ A;  4QL5 A;  4DNI A;  4GKK L;  1SN8 A;  3J81 i;  3UFX B;  3O13 A;  1KHI A;  4LFB L;  3MHB A;  4JK1 C;  4A3B B;  1CQF A;  3K6O A;  3FP9 A;  5M5W H;  2NBF A;  3X3M A;  5T1I A;  4IJL A;  3P7J A;  5E3F A;  3UE0 A;  4F7X A;  2W6M A;  1LT4 D;  2HGS A;  4J15 A;  4A3D B;  1JLL B;  4C5C A;  2NVX H;  4JG2 A;  3CCJ A;  3S9W A;  2JA7 G;  1PTO C;  2NVY H;  2BH2 A;  5JVH 3;  1F9S A;  1WJJ A;  1PRT F;  2KHI A;  3EQL C;  1TVX A;  2Z9H A;  2DIK A;  2I80 A;  2R7M A;  1WCM G;  4HJ8 A;  5JQW A;  4XX0 B;  4PV1 C;  2Q2I A;  1LLR D;  4DK6 C;  3VA5 A;  4CE5 A;  2JEA I;  1CTM A;  4F87 A;  5LMN L;  1BVS A;  1VS0 A;  3QR8 A;  5I5V A;  1YHB A;  4K8I A;  1VMC A;  5I6W A;  2R92 H;  1ICF B;  1UNS A;  3FKI B;  5EPJ A;  3BDO A;  1UE7 A;  3VDY A;  4A3C G;  3J7A 5;  1XXG A;  2IP4 A;  3S16 H;  1PTO H;  4DXF A;  4UCS A;  4HNU A;  4K6N A;  1ONL A;  4EVO A;  4G57 A;  5KEE A;  1I4H A;  1KC8 C;  4DQN A;  1TWF B;  5K5P A;  2UXC Q;  5IT9 c;  3I4O A;  3MXG A;  4IHJ F;  2EY1 A;  5JPM C;  3WO0 A;  1EKP A;  4X62 L;  5LXT F;  1OO9 B;  1G2T A;  2KCM A;  1MSG A;  1IKM A;  3KK7 A;  1AFP A;  3A54 A;  3HGB A;  4C5A A;  1STH A;  3TZD A;  4A3M H;  2RHS B;  4FFM A;  1VQK A;  1IKL A;  2ZGI A;  2MJ8 A;  3NP8 A;  3D8G A;  3TRE A;  4FP5 D;  1BQQ T;  1X3P A;  3BAC A;  1S5C D;  3HBL A;  1ML0 D;  5C4H A;  1B6S A;  4P73 A;  4B3T Q;  1X6O A;  2EE1 A;  1LT5 D;  2XGT A;  3CPW A;  2VXW A;  1KT8 A;  4O7T A;  4TRD A;  5IY0 A;  3S14 B;  1EYC A;  4L63 B;  3L9A X;  1OXV A;  2NU7 B;  1EOV A;  3GTO B;  1GGO A;  5EKK A;  4XYQ A;  4APV A;  5IWA L;  3UQ8 A;  4JI5 L;  4O2A F;  1M1K C;  1KEE A;  3I8Z A;  1VQB A;  4XT3 B;  4K6D A;  3K5O A;  5FNV F;  5ISR A;  2N55 A;  5C4J B;  5DAA A;  2M00 A;  4F88 A;  2HCC A;  3I2Z A;  1DV1 A;  2GA4 B;  5CYU A;  1I6H H;  4JI4 Q;  3K8A A;  1DV2 A;  4MV1 A;  3RV3 A;  4A3I H;  4OO1 G;  1TWC H;  4ID6 A;  4TM5 A;  3F8T A;  5JEA G;  3GDE A;  2B63 B;  4FDB A;  3NQI A;  2LKV A;  4KJO A;  1A2T A;  2EJ0 A;  1B70 B;  2DJF C;  3E0E A;  3DAA A;  3H91 A;  1PHJ A;  4MV4 A;  3OMC A;  5GAG C;  1FNU A;  4OIJ A;  1PTO F;  2HVQ A;  2DJG C;  3T13 A;  3CD6 A;  1NCV A;  3I4M B;  1Y1W G;  4A3B H;  1SJE D;  1E1O A;  2E2J B;  2MFI A;  3DMU A;  5IYC G;  1IZ6 A;  5FR9 A;  5M3F G;  1CM9 A;  4JV5 L;  3PIP A;  3HOZ B;  2XNA C;  2XCL A;  1EY5 A;  2M9V A;  2YZN A;  4ZRZ A;  2DY7 A;  3C1E A;  4C3H G;  1DD2 A;  5I2X A;  3D4R A;  3D4D A;  3T9E A;  4QMG A;  5EGT A;  3K57 A;  4QQB X;  4AYB G;  1CA6 A;  1ESR A;  5M3M G;  4BWG B;  4K0K L;  1JWU D;  3OTO Q;  2F0P A;  3CRK C;  2COI A;  2X6G A;  2CH4 A;  4N8X 1;  2F0O A;  2O2L D;  2JA6 G;  3TDQ A;  4BBS G;  1NSN S;  4RWS C;  2BE5 C;  3WWI A;  4ME5 A;  2A68 C;  3CPF A;  4NW2 A;  2HHH L;  3C2P A;  2AUK A;  3AYH B;  3FKI H;  4LFC L;  1EQR A;  3RV4 A;  1B53 A;  1QG7 A;  5FJ8 G;  3E6Z X;  3VYT A;  4JOI C;  3B6Y A;  3JAM c;  4O7V A;  3PO2 B;  1STB A;  1ZYR C;  4DR2 L;  2L15 A;  3FHW A;  5LL6 X;  1G8Z D;  5C0X G;  1ENC A;  1O7L A;  4HMJ A;  5FLM G;  2RVL A;  3A56 A;  1SMY D;  2A6E C;  1JE5 A;  3VR5 A;  1BF4 A;  1LTL A;  1ENF A;  2E5L L;  3JSL A;  1MJC A;  4O7L A;  2IJ0 A;  1VMP A;  2XIW A;  5JOB A;  2EPB A;  3GTP B;  1SJH D;  3GV6 A;  2IPK D;  3CRL C;  4P72 A;  5IYZ F;  1AH9 A;  2R3Z A;  1SNO A;  1Q7Y C;  3S14 H;  1V1P B;  5C5M A;  2UU9 L;  4U68 A;  3GTO H;  3NEM A;  1JQY D;  2F0M A;  2FIN B;  2PW7 A;  4YCU A;  4PMW A;  2VW9 A;  5BWW A;  2CFM A;  3NTH A;  3QQM A;  4RKL A;  4DRF A;  5FPO A;  5BYB A;  3FVQ A;  5C4J H;  1KJ9 A;  3EIV A;  3D6W A;  4ZKB B;  1IYU A;  2NUC A;  3KLS A;  4PZ6 A;  4X3U A;  4XYO A;  4MV3 A;  2XWB B;  3PO3 B;  1B9N A;  4CHT B;  5LL6 S;  1STN A;  2PQA B;  3T1H L;  1D1I A;  3WO1 A;  4XTC S;  2IX0 A;  1FVI A;  4KI0 A;  3I73 A;  2B63 H;  1VQF A;  5EAY A;  1IBM Q;  3SXH A;  1I5F A;  2JXM B;  4WHX A;  5HUR A;  4DR3 Q;  2Q8I B;  3GLK A;  3JC6 6;  2PI2 E;  2X6L A;  5BYA A;  3I4M H;  3HFZ B;  1DYQ A;  4MTK A;  4C1N K;  4FU0 A;  4CC5 A;  1JMC A;  5CV9 A;  2E74 C;  2B2U A;  1YNX A;  4C3J B;  2KCN A;  1DCZ A;  3HOZ H;  3U55 A;  1CKM A;  1SR3 A;  4DPG A;  3GP7 A;  4BBR B;  4KHP L;  1L1O A;  4XQN A;  3D31 A;  3OHX C;  2N78 A;  3ONA B;  4IUT A;  4H44 C;  4HNV A;  4LNQ A;  3U54 A;  1CKN A;  4IPH A;  4CJ2 C;  1KC7 A;  2E2H H;  1EUJ A;  3ITP A;  1EFW A;  1NE3 A;  3CSW A;  3A8J E;  3P20 A;  1JCK B;  3NC0 B;  2F4I A;  3S17 H;  5K2M A;  5JVD F;  1MJE A;  4GN3 B;  3A5U A;  2HG8 A;  4JCV E;  1P16 A;  3N8D A;  2VB3 X;  5KKN B;  4PMB A;  3NSW A;  3T53 B;  4AQY L;  3GTK B;  2DNE A;  1KRS A;  4RGN A;  1KNE A;  1RL2 A;  2K52 A;  1CE8 A;  4GN5 A;  2Z1C A;  5AJ3 L;  4A3L G;  3TZU A;  3MFY A;  4C5B A;  3P75 A;  5HV6 A;  1WI5 A;  3A5Z B;  3GTM B;  2R7L A;  2UUC Q;  4CDC C;  2J0T D;  5KIX A;  1YNJ C;  1O80 A;  4A3J B;  1D2B A;  1VQP A;  1HPC A;  1QNU A;  1V43 A;  4R4O A;  1IBK Q;  3WWH A;  3CCU A;  4DV1 L;  2CQA A;  1HXY D;  1O7Z A;  2NVQ B;  5I9P A;  1NBW A;  4NDX A;  5CV7 A;  4ZUJ A;  4I55 F;  1O7I A;  1JDE A;  3HOV H;  3R3O A;  1OBD A;  3A74 A;  4FGR A;  1GKH A;  3UDF A;  4HIO A;  1DZ1 A;  3GTP H;  3I12 A;  4O4H F;  2Z02 A;  4EQP A;  3I91 A;  3NBI A;  3DEO A;  2UUB L;  1I7L A;  1Q86 C;  1HZ9 A;  5I5S A;  4UY8 C;  5C4X G;  1UC8 A;  2EOT A;  2DZD A;  4PZ8 A;  5M9O A;  2WIN B;  4K5X A;  2PNH A;  5DM6 3;  1F9Q A;  3ZJY C;  1SCU B;  4RCO A;  4IFD H;  4GLW A;  3V4S A;  3TII A;  1JB3 A;  2N88 A;  2NB0 A;  1FL0 A;  5CC4 A;  1YBY A;  4A3F H;  5JEA J;  1B44 D;  5IP9 G;  3J80 c;  4X65 L;  3W3A A;  2E2I H;  5DGI A;  3T9D A;  1CKO A;  2AQ3 B;  1Y1V B;  1JE4 A;  2Q2H A;  4HIK A;  2HDM A;  4DV2 Q;  1RKN A;  1TII D;  4DGZ A;  2YS6 A;  3UYY A;  1K28 A;  5LA6 F;  1LTT D;  1PH8 A;  1QB5 D;  2WAQ G;  4BY7 H;  2YV5 A;  2B2W C;  4MZ9 A;  2PZT A;  4A3D G;  2AWO A;  3SHL A;  3HEJ A;  2MGS A;  4L5T A;  1UE6 A;  1EOT A;  4IOC A;  2ZJR A;  5I6Y A;  1N32 Q;  1EYA A;  1EZ1 A;  4TSS A;  4DR5 L;  5KNB A;  4IFD I;  2O5I C;  3TW6 A;  1NNX A;  4CGY B;  4A75 A;  1EWI A;  1HCZ A;  4R8N A;  3QIA A;  1N9W A;  3HOX H;  3MAQ A;  4DV3 Q;  3OOC A;  4C3J H;  5HGT A;  1RTN A;  1STE A;  4LF6 Q;  1SYC A;  3CC2 A;  4Q4D A;  3HG9 A;  3RTX A;  4DNR B;  1H9S B;  2BA0 A;  1AE2 A;  1EEF D;  2J4X A;  4CDD C;  5I4D A;  2EY2 A;  4O4L F;  3SK6 A;  5EKI A;  2IWH A;  5BWX A;  5LP6 F;  1LO5 D;  2PPB C;  1Z2N X;  4DUZ Q;  4M8A A;  1IBL Q;  1PYB A;  2IHF A;  2KOL A;  4PMC A;  4OWX B;  1KJJ A;  1BDO A;  3TME A;  5GAH C;  4IUQ A;  5FLX L;  2ASB A;  3QO2 A;  2YW2 A;  1PH6 A;  4HJ9 A;  1VQA A;  3CME A;  1NMF A;  3D3R A;  1OBG A;  1Q82 C;  1LAB A;  5EZY F;  5KYL A;  2NZH A;  1UEA B;  4TVI A;  3I4N H;  3GTK H;  4YCV A;  4FFR A;  5IGF A;  5C0X J;  1I6V C;  1EHI A;  2E2D C;  2FPI B;  3NTK A;  3Q23 A;  1PH4 A;  1EUD B;  2PBZ A;  2O5J C;  2CW0 C;  4OX9 L;  3BG5 A;  1B04 A;  4LF9 Q;  3TY8 A;  1A63 A;  1TY0 A;  3PF4 A;  1Q81 C;  2GPW A;  3L2P A;  1EKF A;  1WR2 A;  3AU7 A;  3BVZ A;  3MXN A;  5ELF A;  4DUY L;  1JC7 A;  2ZTD A;  5BN4 A;  2R7D A;  5C6A A;  1EL0 A;  2L55 A;  2KEC A;  4LFA Q;  5IYD H;  3UZB A;  1WFQ A;  3SNO A;  5KS8 A;  3DWP A;  4M1U B;  4O7Z A;  3TP7 A;  1Y69 U;  1JT8 A;  1GSA A;  4FFO A;  1AZQ A;  4JBM A;  3K5H A;  4B3R L;  2WP8 J;  3EVQ A;  1ILQ A;  3CF5 A;  5I5U A;  3KDF B;  4IPC A;  2EJ3 A;  5M5X B;  2B3G A;  3PV0 A;  2FMC A;  3GTL B;  3J81 E;  1N36 L;  3CU7 A;  5M5Y B;  1QOH A;  3K59 A;  4DR6 Q;  4JI2 L;  4DXG A;  4ME6 A;  4LF8 L;  4QSH A;  5F2D A;  4XYM B;  3STB D;  4LH7 A;  2RDH A;  1E2V A;  1BBX C;  4JBK A;  1K83 B;  4KKU A;  1Y1V H;  1TS2 A;  5I5X A;  1X65 A;  4K8J A;  3PIP 3;  2F03 A;  2W6Z A;  3S2H B;  1I50 H;  2K5Q A;  4B9W A;  2HHF B;  3TS0 A;  4DK0 A;  4X66 Q;  1XMO Q;  4EX5 A;  2MO0 A;  2R7K A;  2YZL A;  4M0J A;  2JA5 B;  4HR7 A;  1YZ6 A;  5DIS C;  3HB9 A;  1WVL A;  2NN6 G;  4OWT B;  3RLO A;  3OYY A;  1VQH A;  1N34 L;  1DXM A;  3K7A B;  1FYC A;  4RA8 A;  4A3G H;  2KEE A;  1SLJ A;  3S1N H;  1J9O A;  2WV6 D;  1I4X A;  1V1Q A;  3NK9 A;  5CAE B;  5COR A;  5JPN C;  5M5W B;  4Y52 H;  4X64 Q;  4FFN A;  3VMM A;  4JI8 L;  5I5T A;  2E75 C;  4R4C A;  5G3L D;  4UPA A;  2XRQ D;  1IL2 A;  5T1G A;  5GON F;  1I1L A;  3M3Y B;  3K5N A;  1MKH A;  4JI1 Q;  4OON A;  2V58 A;  5C4Z A;  3PO2 G;  3M7N A;  3SEB A;  2K5H A;  4LK1 C;  1VQJ A;  1GUT A;  1A0I A;  2I5L X;  2B2V A;  1PRT D;  1DGS A;  1C3O A;  3RMH A;  2K5V A;  5IT9 L;  5CBA E;  4JYA L;  1D6E C;  1EU3 A;  4JI7 L;  1K8G A;  4S3S A;  2AMC B;  4FF4 A;  3FDT A;  4GKJ L;  2JA8 B;  2K04 A;  2W71 A;  2UXB L;  2HVS A;  1HFN A;  1TKW B;  2SDF A;  4NXM L;  1I1K A;  3MTS A;  1KL9 A;  3JRW A;  3S16 B;  1PTO B;  1SNP A;  4K6L A;  1JKJ B;  1X56 A;  1VCI A;  1HTP A;  1EY9 A;  1STY A;  3TEH B;  1BCP C;  4DV5 L; 
#chains in the Genus database with same CATH homology
 2Z6K A;  1PYS B;  1PH3 A;  4R1J A;  1C0A A;  1XPU A;  4DR7 Q;  3HKZ E;  4APV A;  1XPO A;  5IWA L;  3HKS A;  1X54 A;  4JI5 L;  2OTL A;  3RN5 A;  1TWG H;  3UQ8 A;  1R9T H;  4LF7 L;  3PO3 G;  1M1K C;  1TAE A;  1VQB A;  5GRO A;  4DR6 L;  3A0J A;  3E9H A;  1QVF A;  1TXY A;  4DV4 L;  2UU9 Q;  2K50 A;  3I2Z A;  4B3M L;  1I6H H;  2HT1 A;  2E2J H;  4JI4 Q;  5M5X H;  3K8A A;  4UP8 A;  3W1G A;  4A3I H;  5E7N A;  2VS1 A;  2UXD L;  4OO1 G;  1TWC H;  4BXX G;  2I0Q A;  3PN1 A;  3KOJ A;  3RLN A;  4X66 L;  2QA4 A;  3F8T A;  1XMO L;  5JEA G;  3GDE A;  4FDB A;  1QZG A;  1VQG A;  3PUW A;  1K83 H;  2LXK A;  3PGZ A;  1B70 B;  3E0E A;  2ZTC A;  5C3E G;  1XDN A;  4LF4 Q;  1PHJ A;  4GOP C;  1K8A C;  1HZA A;  3JAM i;  3PUX A;  5GAG C;  1QVG A;  3S2H H;  4P75 A;  1K3R A;  5C4X G;  2HVQ A;  4LH6 A;  3ULL A;  5ELO A;  4QJF A;  3CD6 A;  4BBR G;  4A3B H;  1Y1W G;  1QVC A;  1VQ6 A;  2B63 G;  1N33 L;  1E1O A;  4YCW A;  2VQE L;  1IXR A;  2MFI A;  1PH9 A;  2JA5 H;  5IYC G;  2OTJ A;  1IZ6 A;  3M4P A;  4DV2 L;  3D0F A;  2JA7 H;  5M3F G;  4HJ5 A;  5LMN W;  2VY3 A;  3PIP A;  4JV5 L;  3WWV A;  1PA6 A;  4LUZ A;  2Z6K C;  3HOW G;  3J81 j;  2K75 A;  1S40 A;  4JBJ A;  1WCM H;  1YJ9 A;  1I94 Q;  1CSP A;  3I4M G;  4X64 L;  3K7A H;  1ASY A;  2KHJ A;  2KCT A;  3NBH B;  3CCM A;  3I7F A;  3UDI A;  2UUA L;  4AYB G;  4QQB X;  4X6A H;  3KFU A;  3HOZ G;  5M3M G;  2N49 A;  1N32 L;  1EIY B;  4KHP Q;  2RHQ B;  4K0K L;  3U4V A;  3PO2 H;  5D1O B;  3OTO Q;  2K5N A;  3TY5 A;  4JI0 Q;  4NXN Q;  4A3C H;  4KHZ A;  4ME3 A;  4LUO A;  1ASZ A;  2JA6 G;  4DV3 L;  2HVR A;  2F4V L;  3M3Y H;  1E1T A;  1M90 C;  2YTX A;  4GS3 A;  4R4I A;  4BBS G;  3CPF A;  1CSQ A;  4NB3 A;  4P74 A;  1BBU A;  1WOC A;  4LF6 L;  1NY4 A;  4A3J G;  2HHH L;  1HZB A;  4OX9 Q;  3AYH B;  3FKI H;  4BA1 I;  4LFC L;  1EQR A;  1PFS A;  3VNN A;  1SMX A;  2IX1 A;  2JEB I;  2VQF Q;  3KDF A;  2ZJP A;  5FJ8 G;  3CXC A;  3CCS A;  4JOI C;  3B6Y A;  3JAM c;  1U5K A;  4AQY Q;  1IBL L;  2B29 A;  1N8R C;  3TY9 A;  1XK5 A;  4DR2 L;  2L15 A;  3FHW A;  2YTV A;  4UCV A;  1VQI A;  5IE8 A;  1EQQ A;  5C0X G;  5AJ3 Q;  4DV7 L;  5FLM G;  2N3S A;  3RR5 A;  4MNO A;  2HIX A;  2QEX A;  4B3T L;  1TA8 A;  4QY7 A;  3LGJ A;  4DV0 L;  3STB C;  1JE5 A;  1LTL A;  1PV4 A;  2JA8 H;  4B3R Q;  2E5L L;  3ICE A;  3JSL A;  1MJC A;  3G48 A;  4DR7 L;  4IPD A;  1I3Q H;  5JJL A;  2GN5 A;  2E8G A;  3PO3 H;  4IJH A;  1N36 Q;  2D0P A;  4P72 A;  4DV5 L;  1AH9 A;  4JI2 Q;  4LWC A;  1Q7Y C;  4B3S Q;  3S14 H;  4LF8 Q;  3H3V I;  3RZD H;  2UU9 L;  1S72 A;  3GTO H;  1X3E A;  3NEM A;  5DLQ E;  1OXT A;  3HOV G;  4LF9 L;  4L5Q A;  4GKK Q;  2C35 B;  4A76 A;  2KBN A;  4YCU A;  1G51 A;  1L2F A;  4PMW A;  2VW9 A;  2CFM A;  1L1O B;  4BXX H;  1C7Y A;  1PH7 A;  3AQQ A;  1GD7 A;  4LFB Q;  4DRF A;  2AKW B;  5FPO A;  1TWH H;  3GTQ H;  5C4J H;  3EIV A;  1NMG A;  4GNX B;  5HY6 A;  4LF5 L;  1Q1B A;  1CKN B;  4PZ6 A;  4GLV B;  3CMA A;  3U4Z A;  5C3E H;  4L5R C;  3CCL A;  2Q2U A;  4IFD G;  2PQA B;  1EYG A;  3T1H L;  4ALP A;  4AH6 A;  1HR0 Q;  4HTP A;  4XTC S;  2D62 A;  2IX0 A;  1N34 Q;  1QUQ B;  3PUY A;  3BJU A;  1Q46 A;  4JC0 A;  1E7Z A;  4O0A A;  1FVI A;  4KI0 A;  4BBR H;  4X65 Q;  4A3F G;  1Y1W H;  2Q2T A;  2B63 H;  1HNW Q;  1HNZ L;  1LYL A;  1HZC A;  1VQF A;  2WB1 G;  3CC4 A;  3S2D H;  5IYC H;  1VQN A;  2I5H A;  5EAY A;  4AYB E;  1IBM Q;  5M3F H;  1I5F A;  2QGQ A;  3MXN B;  3HOW H;  4DR3 Q;  1A8V A;  1JB7 A;  3JC6 6;  2PI2 E;  3PIO A;  1QZH A;  2I5M X;  3I4M H;  4C3H H;  4BY7 G;  3HFZ B;  4OO1 I;  5FLX c;  4JI8 Q;  3U50 C;  1JMC A;  3IRB A;  4CC5 A;  2RF4 A;  4DV6 Q;  2VUG A;  1VQD A;  1YNX A;  5LMN Q;  2F52 A;  1XPR A;  2N8N A;  3F1Z A;  3HOZ H;  1PVO A;  5M3M H;  1UWV A;  1CKM A;  1SR3 A;  2ES2 A;  4DPG A;  4KHP L;  1NJI C;  1HR0 W;  3HOU G;  3H0G G;  2AWN A;  2R93 G;  3EBE A;  5LMU Q;  4DR5 Q;  4JI0 L;  1L1O A;  4NXN L;  4IOA A;  3CCE A;  1Z9F A;  3D31 A;  3G71 A;  3GTG H;  2N78 A;  2AHO B;  2CKZ B;  3BU2 A;  4GN4 B;  4DAY B;  4LNQ A;  2JA6 H;  3HOX G;  1XNQ L;  1CKN A;  2PMZ E;  4IPH A;  3GTM H;  2E2H H;  3S1Q H;  1EUJ A;  4YY3 Q;  1EFW A;  1NE3 A;  2DGY A;  4A3J H;  1YI2 A;  1K73 C;  2PQA A;  1D7Q A;  4A3E G;  1YHA A;  3K0X A;  4JOI A;  4IO9 A;  4X62 Q;  3NC0 B;  1HJP A;  4DR4 Q;  4JYA Q;  1QUQ A;  3S17 H;  3K81 C;  3Q8D A;  4YWK A;  4GN3 B;  1MJE A;  2VQF L;  3S24 A;  3A5U A;  4JI7 Q;  4JCV E;  2VUM G;  3S1R H;  3K7U C;  5FJ8 H;  1P16 A;  2ZM6 Q;  4HJA A;  1J5E Q;  3J80 i;  2NVQ H;  1X3F A;  5GAE C;  4AQY L;  5JJI A;  2ALY B;  1KRS A;  1Q8K A;  1Q12 A;  1PH1 A;  3KF6 B;  1RL2 A;  2K52 A;  1CUK A;  4TVA B;  3U58 A;  2EIF A;  4MTN A;  4GN5 A;  4NXM Q;  1XNR Q;  3NBY B;  5AJ3 L;  5FLM H;  5IYB G;  4JI6 Q;  4A3L G;  1G29 1;  4BY1 G;  1WI5 A;  3A5Z B;  1A62 A;  2UUC Q;  4JI1 L;  1FJG L;  1VQ4 A;  4DV5 Q;  1BKB A;  4UFZ A;  3I4N G;  1VQP A;  1T9H A;  3HOY G;  1V43 A;  2R7F A;  1LM0 A;  1YEZ A;  4R4O A;  3ER0 A;  5IWA Q;  4E6N A;  1IBK Q;  3CCU A;  4DV1 L;  4HID A;  1WYD A;  2ZJQ A;  3TQY A;  4B3S L;  3BZC A;  1L1O C;  4DV4 Q;  3F2D A;  1XTD A;  2UXC L;  1NBW A;  1VQE A;  3AFQ A;  3K80 C;  2CWP A;  1O7I A;  5K36 G;  4GNX C;  1OXS C;  4GLX A;  1YJN A;  3HOV H;  2MNA A;  3A74 A;  3CW2 C;  3H3V H;  1GKH A;  3UDF A;  4HIO A;  1SRU A;  3GTP H;  1B8A A;  2UXD Q;  1YIT A;  1YVC A;  4C2M H;  1YIJ A;  1X9N A;  4A93 G;  5C0X I;  2UUB L;  1VQC A;  1KQS A;  4JI3 Q;  1Q86 C;  1HZ9 A;  2WFW A;  2WB1 E;  4YHH L;  5H1S E;  4DUY Q;  3RNU A;  1UEB A;  1GO3 E;  1HH2 P;  1K0R A;  4PZ8 A;  5IP7 G;  3UDG A;  2PNH A;  4Y7N H;  4L5S A;  2PI2 A;  3ZJY C;  4UCR A;  3BZK A;  3E9I A;  3KF6 A;  4H02 A;  5IYD G;  1L0W A;  1X3G A;  2JE6 I;  2VZA A;  1FL0 A;  1YBY A;  4A3F H;  5JEA J;  5IP9 G;  3J80 c;  4X65 L;  2E2I H;  4UCU A;  1KD1 C;  1HNW L;  3T1Y Q;  1N33 Q;  2GVB A;  1CKO A;  2OQK A;  2VQE Q;  2JA9 A;  3NBZ B;  2OQ0 A;  2Q2H A;  4QIW E;  4HIK A;  4A3K G;  4DV2 Q;  5D1O A;  3TS2 A;  4JV5 Q;  3J7Z C;  1PH5 A;  1U0L A;  2IT1 A;  2K4K A;  1PH8 A;  3PUZ A;  2WAQ G;  1VQ9 A;  1G6P A;  4BY7 H;  2YV5 A;  4MZ9 A;  1MIU A;  2JK8 A;  3ULJ A;  4A4I A;  2AWO A;  2H5X A;  4JI4 L;  4DV6 L;  3OW2 A;  1Y1V G;  4A3D G;  1OXU A;  4L5T A;  1UE6 A;  3G4S A;  1VQ8 A;  4IOC A;  2ZJR A;  1VQM A;  3CP0 A;  1N32 Q;  4KLK A;  1HNX Q;  2R6G A;  3HOU H;  3H0G H;  5HGQ A;  2R93 H;  2EXD A;  4DR5 L;  2IY5 B;  4IFD I;  4POG A;  3F2C A;  5GAD C;  3ERS X;  4A75 A;  1EWI A;  1E22 A;  3HOX H;  1FGU A;  1N9W A;  4DV3 Q;  3RN2 A;  4LF4 L;  2F4V Q;  3DM3 A;  4C3J H;  3H15 A;  4EFE A;  3QWU A;  3CC7 A;  4YY3 L;  4LF6 Q;  5D1P A;  3CC2 A;  2R7Z G;  4RMF A;  4DAM A;  3RTX A;  1SRO A;  3RZO H;  2BA0 A;  4A3E H;  4LFC Q;  2V1C C;  1JJG A;  4DR4 L;  1AE2 A;  1C9O A;  3I55 A;  4A3G G;  5JJK A;  2VUM H;  3GO5 A;  1J5E L;  4EFB A;  3BAA A;  4DUZ Q;  1IBL Q;  1PYB A;  2IHF A;  4GLA C;  4OWX B;  1K9M C;  1I94 L;  1UE1 A;  4DR2 Q;  2BH8 A;  2LSS A;  5GAH C;  2A8V A;  2ASB A;  3NEN A;  1JJ2 A;  1PH6 A;  5IYB H;  3G6E A;  4DV7 Q;  4HJ9 A;  4A3L H;  1P8L A;  3KLW A;  4DV0 Q;  4BY1 H;  1VQA A;  2VNU D;  3KJP A;  1JJC B;  2UUC L;  3CME A;  1NMF A;  2NVT H;  1H95 A;  1Q82 C;  1YJW A;  2NZH A;  2E5L Q;  4QGU A;  2ID0 A;  2R92 G;  3OTO L;  3GTK H;  4YCV A;  3I4N H;  1Y14 B;  1W2B A;  3W1B A;  3HOY H;  4DR1 Q;  5C0X J;  2K14 A;  2ATW A;  1IBK L;  1BBW A;  4AIM A;  5C44 G;  4GNX A;  3UE1 A;  3M4O H;  3JSN A;  3PCO B;  1PH4 A;  3M85 A;  3KJO A;  2HQL A;  1XMQ Q;  4BBS H;  4UP7 A;  3SGI A;  4POF A;  2HIV A;  5BR8 Q;  1VQO A;  2OWO A;  4OX9 L;  2YU9 H;  1B04 A;  3I56 A;  4LF9 Q;  3TY8 A;  1A63 A;  3AFP A;  4R4Q A;  3GTL H;  4PG3 A;  3PF4 A;  5M5Y H;  2VL6 A;  1Q81 C;  4A3M G;  2YYZ A;  4A93 H;  4GKJ Q;  1OTC A;  2MQH A;  1UE5 A;  2RCN A;  3L2P A;  5ELN A;  1GVP A;  4JI3 L;  4O2D A;  4LW1 A;  3GTJ H;  2UXB Q;  4DUY L;  5C4X H;  4OXP A;  4LF5 Q;  2ZTD A;  4UCT A;  5IP7 H;  2Y0S G;  2R7D A;  4HIM A;  4YWL A;  1VQ5 A;  4UCO A;  5FPR A;  4CC6 A;  4DKA C;  1Q1E A;  4LFA Q;  5IYD H;  1WFQ A;  3T1H Q;  1LUZ A;  1Z47 A;  1B7Y B;  1JT8 A;  2WAQ E;  4JBM A;  1J6Q A;  4B3R L;  2WP8 J;  5J3B A;  5IP9 H;  3BA8 A;  3CF5 A;  3L0O A;  3KDF B;  1D8L A;  4IPC A;  3T1Y L;  1HNZ Q;  2B3G A;  1TWA H;  1X55 A;  4A3K H;  2CCZ A;  3PV0 A;  3KYH C;  4C3I H;  1EIF A;  1IYJ B;  1E24 A;  2YTY A;  4JI5 Q;  2LXJ A;  4IFD J;  2XTI A;  4LF7 Q;  1N36 L;  3GJX B;  4DR6 Q;  4JI2 L;  3CAM A;  2JJQ A;  4LF8 L;  4HTO A;  1GM5 A;  1KIX A;  2CQO A;  3STB D;  4LH7 A;  3AEV A;  2ZTE A;  4JBW A;  4B3M Q;  4JBK A;  4A3D H;  1Y1V H;  3HKZ G;  1OXX K;  1E3P A;  1SE8 A;  1AE3 A;  1KRT A;  1X65 A;  4QL5 A;  4DNI A;  4A3I G;  4GKK L;  1SN8 A;  4PZ7 A;  1I50 H;  3J81 i;  3PF5 A;  1S68 A;  1KHI A;  3TS0 A;  2BA1 A;  4X66 Q;  1XMO Q;  3L7Z C;  4EX5 A;  2MO0 A;  1HNX L;  2NN6 I;  3CQZ H;  4UY8 C;  1NTG A;  3FP9 A;  5M5W H;  1VQL A;  1YZ6 A;  5DIS C;  2JQO A;  4UP9 A;  3BAB A;  3NEL A;  2NN6 G;  2D0O A;  4IJL A;  4OWT B;  1XNQ Q;  2NZO A;  3OYY A;  3RLO A;  1YHQ A;  1VQH A;  3UE0 A;  1HR0 L;  1N34 L;  4TQU S;  2R7Z H;  4EEQ A;  3CCR A;  4A3B G;  4J15 A;  3ULP A;  2EQS A;  1S3O A;  2NVX H;  3S1N H;  1SLJ A;  2JA5 G;  4JG2 A;  4A3G H;  1V1Q A;  3CCJ A;  2JA7 G;  4LUV A;  4NPS A;  1IBM L;  2NVY H;  4GOP B;  3CCQ A;  2KEN A;  3CCV A;  2BH2 A;  3KF8 B;  3W5O A;  1WJJ A;  4DR3 L;  3S1M H;  2KHI A;  4DUZ L;  1TWF H;  3PSI A;  3F2B A;  1WCM G;  4HJ8 A;  4XIG S;  4Y52 H;  4X64 Q;  2A1A A;  2A19 A;  3EN2 A;  3MEF A;  4JI8 L;  3UDX A;  2Q2I A;  4R4C A;  4UPA A;  4DK6 C;  1KAW A;  4DK3 C;  2UUA Q;  1IL2 A;  2JEA I;  5LMN L;  1BVS A;  1VS0 A;  3RLF A;  2F3I A;  4P71 A;  5GQO A;  1MKH A;  1YHB A;  4JI1 Q;  4OON A;  3PUV A;  1FJG Q;  2R92 H;  4K0K Q;  3PO2 G;  3M7N A;  2OCE A;  2Z0S A;  5LMU L;  4OWW B;  1UE7 A;  3DLL A;  2K5H A;  4DR1 L;  3VDY A;  4A3C G;  3J7A 5;  1VQJ A;  2CWA A;  3M9B A;  3S15 H;  4YWM A;  4EQ5 A;  3S16 H;  4UCS A;  5C44 H;  4RG1 A;  4DV1 Q;  1A0I A;  2DUD A;  1KC8 C;  1RIP A;  1XMQ L;  2I5L X;  3GD7 A;  3J81 c;  1DGS A;  2UXC Q;  5IT9 c;  2K5V A;  3I4O A;  4IPG A;  2HHH Q;  5BR8 L;  2Y0S E;  3FKI G;  1W3S A;  4X62 L;  3BA9 A;  4JYA L;  2KCM A;  4JI7 L;  1SFO H;  1K8G A;  4LFB L;  4WJ4 A;  2AMC B;  1VQ7 A;  4A3M H;  2ZM6 L;  2RHS B;  4GKJ L;  1VQK A;  1V9P A;  2UUB Q;  4GOP A;  3TRZ A;  2FXQ A;  3TRE A;  2UXB L;  4YHH Q;  4BA2 I;  2HVS A;  4HJ7 A;  1PH2 A;  3M4Q A;  4NXM L;  3GB8 B;  1XNR L;  1KL9 A;  1KXL A;  4P73 A;  4B3T Q;  4JI6 L;  1X6O A;  1XJV A;  4LFA L;  1X56 A;  2XGT A;  1VCI A;  3CPW A;  2GVA A;  4R4T A;  2IHE A;  5IY0 A;  4WJ3 M;  2JA8 G;  3TEH B;  1OXV A;  2MO1 A;  1EOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...