3W1BA

Crystal structure of human dna ligase iv-artemis complex (mercury derivative)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
600
structure length
589
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
total genus 178
structure length 589
sequence length 600
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1bA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1bA02
1RL2A 4WJ4A 1SFOH 3UDIA 4JOIC 4IOCA 2NVXH 4JYAL 4GKJL 2VQFL 1HZAA 4YWMA 1I3QH 3J7A5 1PH5A 2K75A 1VQDA 2JK8A 3S24A 1YEZA 3F2BA 3TQYA 1V1QA 2E5LL 2Q2UA 4DR2L 4JCVE 3J80c 2ZTDA 4DR6Q 4DAMA 4JOIA 3S15H 3HOWH 1P8LA 3AQQA 4C3HH 2K5VA 5LMUQ 2WB1E 5IYDG 2KCMA 4DUYL 1GVPA 1XNQL 5M3MH 5M5WH 3SGIA 4OONA 2UUBL 3GTGH 2UUCQ 4QJFA 3G71A 1N36Q 4LF4L 2BH2A 1TAEA 1XPRA 2ZJRA 1VQ7A 1HNXQ 3CCQA 1LM0A 3ULPA 2VL6A 4HIKA 5JJIA 1G6PA 2OQKA 3OTOQ 1KQSA 4UCOA 2DUDA 1E24A 3Q8DA 3M4QA 3KJOA 3RNUA 4BY1H 4LF6L 1UE7A 4NPSA 5ELNA 5DLQE 3H3VH 1TA8A 3S14H 3M4OH 5C44G 1YJ9A 3JSNA 4PZ6A 5BR8Q 1S40A 1FJGL 2B63G 1SE8A 4GN5A 1E3PA 4A3FH 2BA1A 5C3EG 3CMEA 1HJPA 2GVBA 1XMQL 1M90C 3G48A 3HOXH 3ULLA 1B04A 1EIFA 4BY7H 4E6NA 2CWPA 2PMZE 1SR3A 1YHAA 3PUWA 4GS3A 5IYCG 1C7YA 2UUCL 4A3JG 1PYSB 1VCIA 1HNXL 4BXXH 4DV1Q 1IZ6A 4JBMA 3KDFA 1Q7YC 2CCZA 3L2PA 4LH6A 2I5MX 3OTOL 1VQ5A 2N8NA 2UXBQ 3DLLA 1TWCH 1KHIA 2NZHA 3A5ZB 4JI7Q 2RHQB 4BBRH 1B70B 1XNRQ 1NTGA 1Q1EA 4B3SQ 3QWUA 4GNXC 3HOWG 3FKIH 4AIMA 5FLMG 1VQIA 1X65A 2F52A 1XMOQ 4DR3Q 4A93H 3FP9A 3PF4A 1TWHH 4P71A 4A3IG 1J6QA 3MEFA 1KIXA 4H02A 2AHOB 1YIJA 1LUZA 3I7FA 1KRSA 4GNXA 3PUYA 4DR5Q 3TS0A 3KF6A 3CPFA 3GTPH 1W3SA 3CCVA 3STBC 5IP7H 1WI5A 2UUAL 5D1OA 2WAQG 4BY1G 4DV5Q 2YTXA 2UXBL 3I56A 4AQYL 4QQBX 3OYYA 2WP8J 1U5KA 1PH3A 4A3GH 2MFIA 3CCJA 1XNRL 3RLOA 2PNHA 3CPWA 4DKAC 5IP9H 3S1RH 1QVCA 2JA8H 1C0AA 5D1PA 4A3FG 4MZ9A 4JI0L 1FL0A 1XMOL 1B8AA 2D0PA 4LUOA 1N9WA 4DV0Q 4A3KH 4DR3L 3HOXG 2MNAA 2WFWA 1TXYA 2E8GA 1HNWQ 1CSQA 2YU9H 3D31A 3RTXA 1LYLA 1BKBA 1E7ZA 1VQBA 4IO9A 1WFQA 4IPCA 1YITA 2PQAA 2NVQH 3GTOH 3NBYB 2R7FA 4JG2A 4GLVB 1W2BA 3ULJA 3ICEA 3PGZA 4DV5L 1YHQA 1L0WA 1K8AC 3CXCA 3RN2A 4CC5A 5GAGC 3CCRA 2E2IH 3HOYH 4JI8Q 3GD7A 4HJ8A 3FKIG 3OW2A 3CQZH 2K52A 4DK6C 1G51A 5FJ8H 2ZTCA 3J81i 1WOCA 4B3MQ 1L2FA 3K81C 5M5YH 1AE3A 1VQ6A 1HNWL 1KC8C 1Q12A 2JE6I 1J5EL 1Z47A 3J7ZC 4A3MH 4HTPA 1X3EA 4BA1I 3RZDH 1EYGA 3KYHC 4YWKA 3FHWA 3NEMA 5IP7G 5JJKA 4PZ7A 3HOVH 4DV2Q 2KENA 4RMFA 3PIPA 1PH2A 1HNZQ 1N32Q 1Q46A 2WB1G 2Z6KC 3S2HH 1VQNA 2YTYA 3LGJA 1D8LA 4TVAB 2IHEA 5IP9G 2JA8G 4JI8L 3H15A 4PMWA 1K0RA 3L0OA 4GN3B 1UE5A 4X65Q 2JA7G 2UXDQ 4A3KG 2AMCB 4JBWA 2Z6KA 1GKHA 2KHIA 1N34L 3VNNA 4P72A 1EFWA 2ZM6L 3CCSA 3ZJYC 4GOPC 1ASZA 3PUVA 4MTNA 4HJ7A 4A3DH 4DPGA 1EUJA 1CKOA 2Z0SA 1CSPA 3GTJH 3CMAA 1YI2A 1QVGA 2RHSB 3K80C 4KHZA 1T9HA 4UP7A 5LMNQ 1AH9A 2EXDA 3GJXB 4GOPA 4A3LG 1GM5A 1N32L 1E1TA 4ME3A 2AWOA 2CKZB 3KDFB 5AJ3L 2LXJA 1PH7A 5H1SE 1Y1VG 4C2MH 4Y7NH 2HIVA 3VDYA 4DV7Q 1RIPA 2D62A 2VQEQ 1VQKA 1KXLA 3UQ8A 1MIUA 4P73A 3KJPA 4DV3Q 1HZ9A 3PCOB 1V9PA 2KCTA 1X6OA 2MO0A 2CQOA 1O7IA 3B6YA 3JC66 1PH1A 1TWAH 3G4SA 4A3MG 4JI4Q 2QGQA 4LFBQ 5GADC 1MKHA 4ALPA 4DK3C 4EQ5A 4YHHQ 3CC2A 3JAMc 3TY8A 5LMNL 3NELA 4GNXB 5JJLA 2XGTA 5IYBH 3PO2H 3KF6B 1CKNA 1XDNA 1L1OC 4TQUS 4DR6L 4DR7Q 2LSSA 1NMFA 4AYBE 5D1OB 5LMUL 4R4CA 4EFBA 2ASBA 4JI2Q 1X9NA 1PFSA 4DV7L 1GD7A 3T1HQ 1IXRA 3S17H 5HY6A 1H95A 2K50A 1N36L 4DR4Q 3PUZA 1L1OA 4A3DG 1QZHA 5ELOA 3TREA 3K7AH 2OQ0A 4LFBL 1OXTA 4JI4L 3HFZB 3S16H 2C35B 1XTDA 3MXNB 4YCVA 3BA8A 4L5SA 3GB8B 5FPRA 4LFCQ 3RLNA 1NY4A 1VQ8A 2A8VA 4P74A 4DR1Q 2NN6G 4KI0A 3S2DH 3RR5A 1IBLQ 2YV5A 4OO1G 2NN6I 3ERSX 1S72A 1XK5A 4OO1I 4LH7A 1YHBA 3NENA 1IBMQ 5BR8L 2JEAI 1XPOA 4L5RC 2PQAB 3KOJA 4LF7Q 4X66Q 5M3MG 1PH4A 1VQFA 1CKMA 4LWCA 3BAAA 4PG3A 2E2JH 4JI2L 4GKKQ 3T1HL 4B3RQ 3M85A 2UU9Q 2KBNA 2NZOA 4DAYB 4R4IA 1JB7A 3W1BA 4QL5A 2JA5H 4O2DA 1NE3A 4DV1L 2R92H 2QEXA 1VQMA 3HOZH 1K83H 4LW1A 2ES2A 4LF9Q 5GAEC 3I4OA 1A0IA 4MNOA 4PZ8A 1QZGA 1SN8A 5FLXc 2UXCQ 3H0GH 3H3VI 2JEBI 4JI7L 2ZJQA 1JE5A 2K5NA 4DR1L 1K73C 1IBLL 3U58A 1PVOA 4B3SL 2AKWB 1IBML 4UCSA 1PHJA 2FXQA 1VQLA 2HVRA 1IBKQ 2OCEA 2Y0SE 4OWXB 2VY3A 1JJ2A 1SRUA 4LF7L 2N3SA 1EWIA 2RF4A 4IPGA 2JA6H 5J3BA 4BY7G 2OTJA 1Z9FA 4WJ3M 4LFAQ 4UP9A 4LUZA 2UU9L 1KAWA 3BJUA 4A3CH 3ER0A 1HR0W 4BXXG 3BABA 4DR5L 1Y14B 4POGA 4JBJA 3PUXA 4R1JA 2H5XA 2ATWA 1KL9A 3A5UA 4LF9L 2MO1A 4BBRG 2UXCL 3CAMA 2A19A 1EOVA 3CCLA 1A63A 2HVQA 1LTLA 1EQRA 2ALYB 2DGYA 2PI2A 1A8VA 2RCNA 1YNXA 5GQOA 1KRTA 3E9HA 5M3FH 2VUMH 4A93G 1IBKL 4DV0L 1WJJA 1QUQA 4DV4Q 1VQ4A 4OX9Q 4GOPB 3PIOA 1YZ6A 2HQLA 3I2ZA 5IWAQ 1X55A 2KHJA 1TWGH 4JI1Q 3I4NH 4HIMA 4JI6Q 3UE0A 4IOAA 3TY5A 2YYZA 1NJIC 2R92G 3HOZG 3L7ZC 1K8GA 4EX5A 3CC4A 4K0KL 3AYHB 1JJCB 2NVTH 1PH8A 4YWLA 4NXNQ 3S1MH 3H0GG 3U50C 4A3GG 1JT8A 2IY5B 2AWNA 1Q1BA 4K0KQ 3BU2A 3T1YQ 5EAYA 4HJ9A 2K4KA 2R7DA 2V1CC 3EN2A 3J80i 3F2DA 3RN5A 3NBHB 2D0OA 2JA6G 3HOUH 4OX9L 4DV4L 4B3ML 2F3IA 2E2HH 4LUVA 1FVIA 5IWAL 1CKNB 1HH2P 4A3CG 1IYJB 3STBD 1I50H 4BBSH 4JI1L 4JI6L 1N33Q 5DISC 4A3EH 4EEQA 4DV2L 2E5LQ 4AYBG 4NXNL 1Q82C 1HNZL 1JMCA 4UFZA 2B3GA 5IY0A 4A75A 4LNQA 2XTIA 3D0FA 1L1OB 3F1ZA 2B63H 3HOYG 1SMXA 4QIWE 3J81c 1HR0Q 1XNQQ 1XPUA 1P16A 5M3FG 3KFUA 1MJCA 2VUMG 4X64Q 5C3EH 1UWVA 2ZJPA 3BZKA 2Q2TA 4DNIA 3M4PA 5FJ8G 5GAHC 4LF4Q 2JA9A 2BA0A 4X65L 4P75A 2UXDL 3DM3A 1PV4A 5IT9c 2LXKA 5HGQA 3UE1A 2R7ZH 3GTKH 3I4NG 2HVSA 4XTCS 1DGSA 4IFDG 1VQCA 3KLWA 4YCUA 4LF6Q 4IPDA 5C0XG 4IFDI 4UPAA 3M3YH 4HIDA 5C0XI 5K36G 3HOVG 1N33L 5C4XH 4IJLA 3E0EA 4UCRA 2EQSA 4HJ5A 4R4TA 1FJGQ 5GROA 1SLJA 3KF8B 4YY3Q 3CCMA 4A4IA 4DUZQ 2R93H 2IX1A 4IJHA 1X3GA 5FLMH 3HKZE 2GN5A 1XMQQ 1HR0L 1JJGA 3A74A 2YTVA 2CWAA 3PV0A 4X64L 4OWWB 4A3IH 2R6GA 1I94Q 1UEBA 2VQEL 3HOUG 2NVYH 2OWOA 3TY9A 2MQHA 1EIYB 2I5HA 4HTOA 2A1AA 3U4VA 4LF5Q 1VQEA 4KHPQ 1Y1WH 5M5XH 4DV3L 3NC0B 3UDXA 1S3OA 1K3RA 4BBSG 4FDBA 3K7UC 4IFDJ 4DRFA 2HT1A 3CC7A 5C0XJ 1PH6A 1UE1A 2VUGA 2K5HA 3IRBA 4A3EG 4YHHL 1K9MC 2GVAA 4L5QA 2JJQA 2N49A 2Y0SG 3GO5A 4CC6A 2BH8A 4RG1A 4YY3L 4DUZL 1OXVA 1VQPA 2IHFA 3PN1A 4A3BH 4DR7L 2B29A 4C3JH 4R4QA 4B3TQ 2F4VQ 3GTMH 4LF8Q 3CP0A 4UCVA 3A0JA 2EIFA 1I94L 3S1NH 4BA2I 2CFMA 4UCUA 2N78A 2R7ZG 3PO3H 1OXXK 4LF5L 4DR4L 4KHPL 5JEAG 3W1GA 3F8TA 4HJAA 4AQYQ 3M7NA 1QUQB 5C4XG 1XJVA 4NXMQ 3CD6A 3I4MH 4LFCL 1QVFA 4Y52H 1VQHA 3AFPA 2OTLA 3PO2G 5IYBG 4UP8A 2R93G 1I6HH 5FPOA 2ZTEA 1OXUA 3PF5A 2I0QA 1OTCA 4JI0Q 2Q2HA 4JV5Q 4OWTB 4X62Q 4X66L 3TRZA 3RLFA 2F4VL 4B3TL 4LF8L 1WCMH 4GKKL 1MJEA 4B3RL 1Q8KA 1YVCA 4EFEA 5E7NA 1Y1WG 4GN4B 4JBKA 1BVSA 2ID0A 1HZCA 5JEAJ 1UE6A 1NBWA 1D7QA 4OXPA 4KLKA 1VQ9A 2PI2E 4GLXA 1PA6A 1X56A 3CCEA 1CUKA 4NXML 2JQOA 3JSLA 3K8AA 2QA4A 4JC0A 3GTQH 1Q86C 1U0LA 3U4ZA 1Q81C 2VW9A 1GO3E 4A3BG 4JI5Q 4JV5L 2VNUD 2JA7H 5LMNW 4X62L 3RZOH 3BA9A 4C3IH 3CF5A 1AE2A 3J81j 5IE8A 1A62A 1J5EQ 4LFAL 1PYBA 1SROA 3CW2C 3PO3G 4UCTA 4NB3A 1I5FA 1FGUA 2HHHQ 1VQGA 4O0AA 2JA5G 4JI3Q 1NMGA 2IX0A 1R9TH 1G291 4QGUA 1C9OA 4HIOA 3I4MG 1YBYA 1TWFH 4A3LH 1OXSC 3GTLH 2WAQE 2HIXA 4AH6A 1Y1VH 5IYDH 1BBWA 2L15A 3PSIA 1V43A 3I55A 3AFQA 1VS0A 4JI5L 3UDFA 4POFA 2ZM6Q 4X6AH 3E9IA 5C4JH 4J15A 1X3FA 2UUAQ 3TS2A 3AEVA 1N34Q 1WCMG 4DV6Q 4L5TA 1YJNA 3UDGA 1E22A 4QY7A 1ASYA 4JYAQ 2K14A 4GKJQ 2VQFQ 2HHHL 1KD1C 2Q2IA 3K0XA 1HZBA 4JI3L 1X54A 2IT1A 4A76A 3G6EA 3GDEA 1N8RC 3HKZG 4DR2Q 1VQJA 4XIGS 5C44H 3EBEA 1VQOA 1IL2A 1BBUA 3HKSA 5AJ3Q 3S1QH 4R4OA 3JAMi 4UY8C 4GLAC 1M1KC 4DUYQ 3CCUA 3W5OA 3T1YL 1EQQA 3WWVA 2UUBQ 3NBZB 3BZCA 2I5LX 3M9BA 4YCWA 1WYDA 2VS1A 1S68A 1VQAA 4IPHA 1YJWA 3TEHB 5IYCH 3F2CA 1E1OA 3EIVA 4APVA 1PH9A 1B7YB 4A3JH 2VZAA 4DV6L
chains in the Genus database with same CATH superfamily
3MXGA 4WJ4A 4JOIC 4IOCA 2NVXH 2YU9B 4ZLTF 3DAAA 2ZDGA 3KLSA 1GUTA 2K5DA 4N8X1 1UC8A 2JK8A 4CDCC 1YEZA 4CHIA 2E5LL 4DR2L 4JCVE 3NP8A 2OT2A 4C3HH 5CBAE 1BXRA 1XNQL 2WB1E 2SNMA 1EU4A 1JR0D 5M5WH 1I2KA 4OONA 2UUBL 5DMXA 5H80A 2UUCQ 4QJFA 3G71A 1N36Q 1S4ZA 2JP1A 1LT6D 5JOBA 1VQ7A 3A7AB 2VL6A 3OMCA 3OTOQ 1KQSA 4UCOA 1LTID 4OL7A 5IIFA 4A3MB 1TA8A 3S14H 1EL0A 3I4LA 2B2YA 5C44G 2H1EA 1YJ9A 1I1LA 4ME6A 2EJ2A 5HNEA 1SE8A 1DYQA 1QILA 1ZXTA 3NUCA 1HJPA 4KJNA 1M90C 3G48A 1PTOH 3G6JB 3ULLA 1EIFA 2PMZE 3PUWA 1SR3A 1C7YA 5IYCG 2HCCA 3G7LA 3TN2A 2L4NA 1HNXL 1SCUB 1Z2OX 3D8GA 1KJ8A 3T9FA 1I4RA 4A3DB 2EYLA 3T56B 5CV7A 1VQ5A 2UXBQ 5D3IB 2N8NA 2RVLA 1G91A 1MHWC 4DU9A 1KHIA 2NZHA 3RV3A 4BBRH 4R9WA 2B2TA 3Q22A 3CEBA 1IKMA 4ODGA 2RSNA 3TP7A 3FKIH 1XMOQ 3KAKA 1X65A 4DR3Q 3MEFA 4H02A 2AHOB 4HCSA 1Z2NX 4DR5Q 3TS0A 1W3SA 2QB5A 1LV9A 1STHA 4QUCA 5IGDA 4AQYL 4TRDA 2XRSD 3R3OA 4FF4A 2K04A 2MFIA 4X3SA 3M4OB 5D1PA 4DKAC 2JA8H 3EA6A 4E6IA 2HCIA 1WTWA 4JI0L 3MXNA 2A6EC 2WFWA 1TXYA 2E8GA 3TSSA 2W6NA 3LNNA 5I9OA 3D31A 3OPOA 4LK1C 3UFXB 1LTRD 4IO9A 2EY1A 1E7ZA 4CDFC 2R7LA 2EYHA 1YITA 3KAJA 3QQMA 1PK8A 5I60A 5KX5F 1W2BA 3ICEA 1EZ8A 2B2WC 3PGZA 4DV5L 2W6ZA 4I4TF 2IWHA 2HQEA 3CXCA 5GAGC 3HOYH 1SNCA 4IUPA 4DAYA 1BXTA 3NBIA 3GD7A 2HJWA 1SXTA 5I5WA 1KC7A 5D14A 2K52A 1WOCA 3J7AF 2A74C 1VQ6A 1HNWL 4ZKBB 1Q12A 2N88A 1Z47A 1S5ED 1EYGA 5IP7G 3FHWA 5CR5A 1KLGD 4PZ7A 2VXWA 1W93A 2HHFB 1HNZQ 1K83B 2WB1G 3S2HH 3JRXA 1VQNA 5I5VA 4OGQC 4O7YA 3TZUA 4TVAB 1FNVA 3H15A 2KVMA 4GN3B 3S1RB 1UE5A 3AX6A 2F0TA 3MEHA 4P72A 1EFWA 2R86A 3CCSA 1B44D 3WWIA 1CS0A 4MTNA 5DEHA 4DPGA 1EUJA 1CSPA 4O42A 1WTVA 3HG9A 1YI2A 1QVGA 4UP7A 2NN6H 2EXDA 4IZOA 3QB3A 1GM5A 1N32L 3DTGA 4WRDA 4HCEA 2E2IB 1RODA 4Y7NH 1F9QA 2IPKD 1RIPA 3WOEA 1KXLA 2W6OA 2VUMB 3UQ8A 1M0WA 4CMDA 1MIUA 4P73A 3KJPA 1HZ9A 1X6OA 3B6YA 1AUXA 4LFBQ 4IWYA 5I5TA 2QGQA 1LABA 2K7VA 5GADC 1E4EB 1IYDA 4EQ5A 2P5ZX 1CQIB 1D1KA 1JCKB 1Z2PX 4IHJF 1UUPA 2NVTB 5JJLA 1AZQA 3KF6B 1CKNA 3J7YW 5ELFA 1NMFA 3DWPA 4AYBE 3VOTA 3DHQA 4EFBA 1DM0B 4DV7L 1EY4A 2IL8A 3S17H 2H4OA 1A9XA 3SEBA 1M4VA 1PTOD 2K50A 4DR4Q 1HQMC 2RCFA 2OQ0A 4JI4L 3C1FA 3S16H 5FPRA 1EQTA 1K0SA 4LFCQ 1FYCA 5JVDF 3S2DH 4NZMA 4A3EB 1EY6A 2YV5A 2FPIB 1S72A 3MWEA 1YHBA 2Y0SB 3NENA 2ZDHA 3R5HA 1DOMA 2MPMA 5FO8B 3J81E 4LF7Q 1PH4A 3FPPA 2YWVA 2E2JH 3T1HL 2EJMA 4L8JA 3NPPA 5FO7B 3Q0AA 1D5MC 2ZT9C 1Y8PB 4M0JA 5L37A 2R7ZB 1SE2A 2QEXA 1VQMA 4H13C 3GP7A 4MN3A 2XIWA 2UXCQ 1DV2A 1SN8A 5FLXc 2X0SA 3H0GH 4QCLA 1GUGA 2JEBI 5CV8A 3MTSA 2L0CA 1K73C 4WORA 3U58A 1PVOA 4B3SL 2R93B 2JSOA 5C6AA 1GJXA 1EUDB 3JZIA 2HVRA 2OCEA 4XQJA 2OTJA 4LFAQ 4LUZA 1EIHA 1TY2A 1Z7TA 5IGCA 4WBNF 3ER0A 1PTOF 1HXYD 1Y14B 2FJ2A 4JBJA 2OEOA 4RCOA 1QJOA 2ATWA 4KN4C 2MO1A 2Q7DA 4BBRG 4FFNA 4DLKA 3BACA 1ICWA 2ALYB 2PI2A 1KRTA 1A8VA 1SNPA 1YNXA 3OHXC 5E3FA 3E9HA 5M3FH 3WOFA 5BN4A 1WJJA 4OX9Q 1AUVA 3K5NA 1YZ6A 1I7NA 1X55A 1AZPA 1WD0A 4MV6A 3TY5A 3UE0A 4IFDH 3V4ZA 5C0XH 3HOZG 4DAVA 3PO3B 1CZWA 1B3AA 3AYHB 3MA2B 5K36H 4PQXA 4NXNQ 2F0LA 4RKLA 1JT8A 2YS7A 1STEA 4U68A 3BU2A 1FR3A 5EAYA 1I6HB 1PFBA 2V1CC 3J80i 3PQIA 4DXFA 2JA6G 3HOUH 1WRVA 4O7TA 2B2VC 4B3ML 2E2HH 1FVIA 4A3CG 1PTOC 1IYJB 4JI6L 1AP0A 2E5LQ 4AYBG 1Q82C 2QF7A 5T1IA 4RZQA 3HKZB 3F1ZA 2EPBA 2JXMB 3HOYG 4EGVA 1XNQQ 1XPUA 1QNKA 4K0KL 1EYZA 1UWVA 3BZKA 2Q2TA 3JZ6A 2YS6A 2K33A 1TVXA 3FRPB 1I1KA 1ENAA 3OWFA 2LXKA 4XYOA 5JEAH 1DGSA 3N52A 2GQRA 1VQCA 3KLWA 3X3MA 3CRKC 4B08A 1N33L 5DAAA 3U9SA 1TS4A 5BMVF 1TY0A 2D2CC 2MJ8A 1R9TB 4R4TA 5GROA 4YY3Q 4A4IA 4L63B 2A5HA 2GN5A 1JJGA 3A74A 3L3OC 4A3IH 1I94Q 4NW2A 2VQEL 1EIYB 3RV4A 3FVQA 2A1AA 5HGTA 4LF5Q 4KHPQ 5M5XH 4KMUC 1S3OA 1K3RA 4BBSG 2R87A 5BWVA 4RKBA 1HUMA 3VR4A 2K5HA 2JN4A 2XWJB 5CC4A 1ET0A 4CC6A 2WACA 1A2UA 1DV1A 4DN4M 4DUZL 2IHFA 2Y4RA 2B29A 4Z9CB 4R4QA 1O7ZA 2L1BA 1JOQA 2NU6B 1S5FD 3A0JA 2EIFA 1K28A 4HSVA 3S1NH 4BA2I 2RKSA 4DF7A 2EXZA 4A3JB 4YB8B 3DWAA 4HJAA 4AQYQ 3T99A 2NVXB 1QUQB 5C4XG 1XJVA 3CD6A 4JW0A 1V1PB 2PO4A 5E25A 3Q6SA 1ILPA 2OTLA 4RWSC 4DQNA 1OTCA 4JI0Q 5KYIA 4OWTB 4C3HB 3K6OA 2TSSA 3RLFA 3QR8A 4B3TL 2F4VL 1SMYD 2FMCA 3FEWX 3OIQA 2NYZD 1HZCA 1UE6A 1NBWA 4V190 2SOBA 4OXPA 3HZXA 1D7QA 1QB5D 4GLXA 1PA6A 1CTMA 2FPGB 2O5JC 3CCEA 1TS2A 1LO5D 3S14B 5C8YF 1GO3E 5CGKA 4A3BG 2VNUD 1SYCA 2F0JA 3A8JE 3RZOH 2Z9HA 3T9CA 4C3IH 4C3JB 2XRQD 3J81j 1PTOB 5IE8A 3ITPA 1QCBD 1SROA 2R82A 1I5FA 1IOVA 4QB4A 1LTSD 1ESFA 2A73B 3I4MG 1O80A 1YBYA 4MV7A 2CNVA 3GTLH 1UEAB 1SYBA 4FU0A 1H9SB 2WAQE 2HIXA 4AH6A 1Y1VH 2K32A 1BBWA 2NWGA 2L15A 3PSIA 1V43A 3FKIB 5IOCA 2F0VA 2MHVA 4J15A 1X3FA 5G3LD 1EY0A 1I1MA 1T36A 5FR9A 3R5XA 4L5TA 4XQNA 1YJNA 1ENFA 3HB9A 2HHHL 4RGTA 2Q2IA 3K0XA 1HZBA 4IQZA 4JI3L 4O7WA 3G6EA 4MV8A 4CJ1B 4XIGS 2R3ZA 5C44H 3PIP3 1IL2A 5I4DA 1BBUA 1B6SA 2DIKA 1EY7A 1U4MA 4FNFA 4GLAC 4UY8C 1DD2A 4O7NA 3W5OA 3MFYA 4HEDA 4RHRA 3WWVA 4FF1A 2I5LX 2JA8B 1H9KA 3M9BA 5KNCA 5IYCH 1NR4A 4P2CB 4CGYB 5BPHA 2XN9C 1I3QH 1PH5A 5KGUA 1EY8A 3S24A 4DXGA 3TQYA 1V1QA 2Q2UA 2Z02A 1IOWA 2C00A 2O4XA 4XXEA 4DAMA 3S15H 1V1OA 1KT8A 1P8LA 4R8NA 1KNAA 2RDHA 4DUYL 1GVPA 2YW2A 5M3MH 1QG7A 4X3TA 3K5HA 5FK9C 2B2YC 1MSGA 3ULPA 4K2LA 1SMYC 4O2BF 2DUDA 1E24A 3Q8DA 4KKTA 1S5CD 5DLQE 1EQVA 4IWXA 3JSNA 5CBEE 3AW8A 4PZ6A 1QE6A 1S40A 3S2HB 4ZUIA 4WHXA 4GN5A 1E3PA 2HGSA 1GUSA 3CHBD 2BA1A 3D6WA 3CMEA 1NUCA 1XMQL 3K57A 4BY7H 4NYEA 1K8OA 4GS3A 1YHAA 3ORQA 5LHY1 3K5LA 1VCIA 4JBMA 2C5CA 2CCZA 1TWCH 1VDZA 5EKKA 1NR2A 3TEKA 3A5ZB 1TQOA 1VF7A 2RHQB 4MV4A 1B70B 5C5LA 3CU7A 1Q1EA 1SEBD 4B3SQ 1SYEA 1IYVA 4HN7A 3HOWG 3PMFA 4O7ZA 1VQIA 4F7XA 3WDNA 4A93H 3FP9A 4UHVA 3VPDA 3PF4A 2DY8A 4P71A 4Y7NB 4A3IG 3GTGB 1WTQA 1I4GA 3CPFA 3GTPH 1EKVA 3STBC 5IP7H 2WAQG 2YTXA 2IJ0A 3I56A 1JWUD 1U5KA 3HRZC 1MD2D 1XNRL 3CPWA 1BNCA 4A3FG 2PNRC 1FL0A 3I90A 4LUOA 1UC9A 5CA0F 1IKLA 2MNAA 1CSQA 4ZHQF 3SE7A 1BKBA 1VQBA 3GTOH 1II3A 1WFQA 2R7FA 2V58A 3BDOA 1RDPD 3S16B 1I2LA 4KY6A 1YHQA 1KJJA 1VBHA 4CC5A 5JQGF 4ULLA 4HJ8A 1WTPA 5BN5A 3CQZH 2GPSA 1YNND 1KDBA 3NQTA 4DK6C 4DNRB 2VR1A 4MAMA 3J81i 4B3MQ 3CRLC 1EKPA 5M5YH 1DIKA 1AE3A 1JLLB 2E2JB 4I65A 2J0TD 2F4IA 1J5EL 4YIJA 3J7ZC 4HTPA 4BA1I 1EY9A 1XYIA 4N8FA 5LA6F 5T1GA 5CYUA 4YWKA 2MP1A 3PIPA 3JAML 1Q46A 1TR5A 4LJZC 5A35A 2YTYA 3H0GB 2PYKA 4A3GB 1Y8NB 2AQ3B 2IHEA 4RH6A 4JI8L 4O81A 2AMCB 3T53B 2Z6KA 1GKHA 3VNNA 3VYRA 1LTGD 5C1PA 3PUVA 4HJ7A 1JQYD 3HP3A 3QJYA 4OEMB 1BQQT 1L0YB 2F0OA 4XDXA 1T9HA 5LMNQ 2NVQB 1AH9A 3A7LA 2A68D 5IGGA 1E1TA 2I8CA 4OIKA 4DAAA 3NHHA 5AJ3L 3U9TA 1ONLA 1Y1VG 2HIVA 5M3FB 2YYAA 2VQEQ 5I6WA 5JVLA 2KCTA 3JC66 4CKBA 4CDEC 3OOCA 3VA5A 4ALPA 3TY8A 2Q8TA 3HOVB 4FFMA 3NELA 2YRWA 3PO2H 3SVMA 5IYBH 4IUNA 3TP6A 2CQAA 4EQNA 4DR6L 2KCCA 4UDUC 3MAQA 1EY5A 1BCPF 5LMUL 4R4CA 2ASBA 1X9NA 2VQDA 4EQOA 2RDFA 4IUUA 2ENBA 2F0QA 2HD3A 3D4RA 3HOUB 1DXMA 2VPQA 2M00A 1F2ZA 5ELOA 3M4YA 2E2HB 4RFBA 3K7AH 3E0JA 2KOLA 2O5IC 1XTDA 3MXNB 3BA8A 3GB8B 1NY4A 1DAAA 1AN8A 3K5IA 1TS3A 2X6LA 1MSHA 1IBLQ 4KJOA 1IBMQ 1ZEQX 4L5RC 5JH7F 2RQXA 3WNZA 5M3MG 1VQFA 4I55F 2PZTA 4JI2L 1EWCA 4IALA 4DAYB 2G9HD 3W1BA 2LY7A 1NNXA 1Q8IA 3HOZH 4FFRA 2EIYA 2NTTA 5EZYF 3I4OA 1A0IA 1QZGA 2QKIC 4PZ8A 1TKWB 4HQ6A 4JI7L 2ZJQA 4DR1L 1JKJB 4UCSA 1VQLA 4FF2A 3D3RA 5C3XA 1EWIA 2JA6H 4BY7G 3CSWA 5J3BA 4WJ3M 1GUWA 1U4RA 2PCFB 2UU9L 4A3CH 1HR0W 5K5PA 5M5XB 2LS01 4FGRA 2E76C 3NSWA 2I80A 4LF9L 4G7HC 4KK7A 2TMPA 2A68C 3CCLA 1A63A 3R23A 3WO1A 2HVQA 1EQRA 4G4KA 4A93G 4TV9F 1B6RA 2AQ2B 4KY7A 5EPLA 1IBKL 4DV0L 4TV8F 4DV4Q 1VQ4A 1S5DD 3PIOA 3I2ZA 5IWAQ 2KHJA 5DGHA 1TWGH 3EJIA 3S1NB 4XT1B 1Y69U 2R92G 2G5DA 1K8GA 4EX5A 2JA5B 1BBXC 1JJCB 3DMUA 3S1MH 4QIWB 3G8CA 4YBZB 2AWNA 1Q1BA 2XSCA 1KUTA 4HJ9A 1EUCB 4U673 3F2DA 5E4XA 4LUVA 2DWCA 1CKNB 3P1HA 3IAYA 2F0NA 4BBSH 4JI1L 2WV6D 3HS0C 1KJIA 4HR7A 1SYGA 4DV2L 4K6DA 1KJ9A 4O4IF 2BCOA 3Q23A 1KDAA 4Y8VB 4A75A 4JPBW 2B63H 3UI2A 5BYBA 4BWGB 4IUQA 1CHQD 1MJCA 1RCVD 5C3EH 2W6QA 1JC7A 5CV9A 5IT9c 3U54A 1XX8A 4Q4CA 3T51B 2F0GA 4C3IB 3UE1A 5KNBA 3GTKH 3I4NG 4YCUA 4IPDA 3TIIA 4HIDA 2R7MA 1Q90A 5J22A 5ELCA 2HDMA 5JQWA 4ZQIA 3F2UA 3SE0A 5C4XH 1RF2D 1SLJA 3C46A 2FB9A 1KNEA 1PRTD 1C48A 3I3CA 2IX1A 4C1NK 3GTLB 4IJHA 2FPPB 1X3GA 2PW7A 5FLMH 3K5OA 1HR0L 1KABA 1XMQQ 1A3GA 1CA6A 4X64L 3TY9A 2R6GA 1UEBA 5JVG3 3U4VA 5I2YA 1FGBD 1A6XA 2BDNA 3NC0B 4HSPA 3UDXA 2COGA 4IFDJ 3E3XA 2HT1A 3KBXA 5C0XJ 1UE1A 1CK1A 1PH6A 4YHHL 2N49A 5TSSA 1SNQA 1MGSA 4FXGC 5C44B 4WJWA 1BCPB 2HGXA 4A3BH 4DR7L 1B3QA 3GTMH 2F0EA 3K59A 1HUNA 4UCUA 1FNUA 1M6VA 1MI2A 4I7ZC 1LT5D 2J7ZA 4NP5A 3I4MH 1SAPA 1A0GA 4ZI7F 3DUZA 5CV4A 1GSHA 3PO2G 5IYBG 3PF5A 1C30A 1PRTF 2I0QA 3PFFA 1UAPA 1EWHA 3MFGA 3S15B 3LWUA 4G57A 4K5VA 4MV1A 1NAPA 5JPNC 4LF8L 4B3RL 2BDOA 3C3LA 1Q8KA 1YVCA 1JWMD 2NVYB 2RBMA 1Y1WG 5A2QE 1KEEA 2DABA 4FP5D 5JEAJ 4KLKA 2SCUB 4NXML 2JQOA 3R93A 3K8AA 3GTQH 1Q86C 1U0LA 3DEOA 4FXKC 1Q81C 4JV5L 2JA7H 5LMNW 4YJ3F 2Z1CA 4X62L 3D4DA 1AE2A 1J5EQ 5IT9L 1PYBA 2J4XA 4NB3A 1VQGA 3OIPA 1NMGA 5BWUA 1Z6HA 3DXJC 2R61A 2VB3X 1CQFA 1BNZA 5JPMC 4A3LH 1TWCB 5DM63 3LQSA 2QEJC 3ZYYX 1TIID 5COYA 1PYWD 5IGFA 3J80L 1WTXA 1PRTC 4O2AF 2XVSA 2FINB 3I55A 4O4JF 2F1MA 4JI5L 4FVMA 4POFA 3E9IA 3I8ZA 2B2UA 1WCMG 4ZK9B 4RCNA 3UDGA 2EYJA 1F2LA 3IL8A 1KD1C 2F0UA 2NU7B 2X69A 1JOKA 1BR9A 4DR2Q 2EYOA 5IGEA 3I91A 3R8BA 2WB1B 2QK4A 4HMJA 5E4WC 5AJ3Q 3HT5A 4R8IA 4Q0FA 3R2IA 1M1KC 2L55A 3CCUA 3T1YL 1EQQA 2UUBQ 4K8IA 1B9MA 1X3QA 1SNOA 1QOHA 1A48A 1S68A 1VQAA 4IPHA 4EG0A 1E1OA 3EIVA 5LL6S 4APVA 2UUAL 2VZAA 1L0XB 4DV6L 1N34L 1RL2A 1WTRA 5ISRA 1SFOH 1ET9A 3UDIA 4JYAL 4GKJL 4K8JA 2VQFL 4YWMA 2YL2A 3BVMA 2K75A 3GTOB 2DJGC 4K6NA 2JYOA 4H44C 2KECA 4ZKCB 4OO1H 2D5DA 2ZTDA 3R5FA 4DR6Q 5BYAA 3HOWH 1JE4A 3AQQA 3ERQA 1H9JA 2K5VA 2PMZB 5LMUQ 4G7OC 3BS1A 4MA0A 2QCPX 2DZDA 1EEFD 3MHBA 2L12A 3CQZB 2BH2A 5BWXA 2NU8B 1XPRA 1EKFA 1HNXQ 5JJIA 5C4JB 3QOLA 4V0BA 1IHZA 5M5YB 1G6PA 2OQKA 3WWHA 5LP6F 4LF6L 4TM5A 1UE7A 1OO9B 4NPSA 5ELNA 3RUPA 4KD4A 3H3VH 3QO2A 2F3VA 2NTSA 4GLWA 2PZWA 3M4OH 5GONF 1BO0A 1QNUA 2B63G 4FXDA 5ELDA 1I4PA 4KKUA 1X3PA 4A3FH 5C3EG 2COJA 1B04A 4E6NA 4C5CA 1W6JA 4O86A 5I2XA 2UUCL 3R9RA 5M9OA 4DIMA 2DNEA 1K8MA 3HO8A 1H9MA 1IZ6A 3TQTA 3KDFA 4DAPA 3H09A 3OTOL 1I4HA 1SJED 4JI7Q 3MWYW 3C2PA 1NTGA 3TZDA 5FOBB 4BS9A 2PQEA 2BE5D 4AIMA 1ZKOA 5FLMG 2KEDA 2Z04A 3VR6A 3T9EA 1E2VA 3C1EA 1XWEA 2Q8RE 1KIXA 1J6QA 5M5WB 4PMBA 1YIJA 4JVZA 4K5XA 3I7FA 1LT3D 4GNXA 3PUYA 3RUZA 4CJ2C 3WO0A 1WI5A 5D1OA 4BY1G 4DV5Q 2UXBL 3URYA 4QQBX 4EVOA 3OYYA 1PH3A 2FHTA 3TDQA 4E4TA 1PRTB 4C5BA 3S1RH 1QVCA 1F9SA 1U9RA 4MZ9A 1XMOL 1B8AA 4DV0Q 1N9WA 4DR3L 3TP5A 2X6GA 3HOXG 1HNWQ 3CKIB 5FO9B 1BDOA 4TUYF 1CQVA 3U9OA 4LAAA 2W6PA 4FE2A 3RTXA 3NBYB 4IPCA 2PQAA 2QDBA 1GSOA 4WFN3 4JG2A 3K7AB 3ULJA 3V05A 3JZFA 3FPUB 3NWSA 1K8AC 4RA8A 1R4QB 3DEPA 2E2IH 4BBRB 2F0HA 2KUMA 1EOTA 3EQLC 2CNQA 5KS8A 4EGQA 1G51A 3KLSX 2ZTCA 5FJ8H 1L2FA 1PX2A 3K81C 3VPBA 3SK8A 1EZ1A 3VR5A 1KC8C 3LULA 3RZDH 1X3EA 4N9TA 3KYHC 3NEMA 4IUTA 4DV2Q 4RMFA 3HOZB 1N32Q 2Z6KC 3LGJA 5HBRB 1D8LA 3KREA 5IP9G 3N6RA 4JXUA 3A54A 1K0RA 1RKNA 1SDFA 1VMPA 3MWDA 2JA7G 4A3KG 5I5XA 4JBWA 2KHIA 2ZM6L 3ZJYC 2JA6B 2IX3A 1ASZA 5I6YA 1CKOA 2Z0SA 3GTJH 3CMAA 2ZXRA 4ZAIA 2RHSB 3K80C 4KHZA 5C5MA 3SHLA 2D9UA 3BG5A 4GOPA 2AUJD 4A3LG 4AYBB 5LL6X 2YZLA 2AWOA 2Q8IB 1F2YA 2CKZB 4FO2A 3QG1A 3HOYB 2L5TA 1PH7A 5H1SE 4C2MH 3M7GA 2WKDA 3ONAB 4DV7Q 3VMMA 2BE5C 3G8DA 4RGOS 2DLNA 3PCOB 2MO0A 1O7IA 4JI4Q 1TWAH 2XWBB 3G4SA 4A3MG 5I47A 1TWGB 3GQBA 4YHHQ 3CC2A 3JAMc 3NBHA 3S1MB 4NKLA 3W3AA 1PXUA 4C5AA 4TQUS 2WKCA 4DR7Q 4O7SA 1PFSA 3T1HQ 1GD7A 1IXRA 1H95A 5HY6A 2FMMA 3Q24A 2Z4IA 1KAAA 2OF1A 2B2TC 2W71A 3PUZA 3JRWA 1L1OA 4A3DG 3LWBA 3TREA 2W6MA 1HTPA 3DF7A 4LFBL 3H91A 4YCVA 4BBSB 4L5SA 2O2LD 2A8VA 1VQ8A 3GV6A 4P74A 3ND8A 4KI0A 3RR5A 4OO1G 2BOSA 1G2TA 1XK5A 2HDKA 4OO1I 4LH7A 5BWRA 5BR8L 3MVVA 4X3KA 4HNTA 3KOJA 1OBDA 1CKMA 3BAAA 2F0IA 4H0LC 4PG3A 4CKCA 4B3RQ 2DAAA 3M85A 1BOSA 2KBNA 2I87A 1O78A 1STBA 3KF8A 2K01A 4R4IA 1JB7A 2E2DC 3U55A 1JOOA 5IT9E 4MHEA 4DV1L 2R92H 1S5BD 3GTKB 2IP4A 4MNOA 1LLRD 3ND9A 3H3VI 2ZDQA 5C4XB 1JDBB 2K5NA 3I72A 2SDFA 2EYFA 2ZGIA 1E0BA 1ENCA 2AKWB 3NWTA 3J80E 1PHJA 4OWXB 2Y0SE 1JJ2A 5HV6A 4LF7L 1R4PB 3QFFA 2N3SA 3S17B 1A3VA 3BABA 2CH4A 4POGA 3PUXA 5J39A 4G7ZC 4R1JA 4O1NA 1KLUD 2H5XA 3OWEB 5ELEA 1KL9A 1SBBB 2UXCL 3A8KE 5I5YA 2A19A 1EOVA 1EU3A 3S2DB 1AW7A 3J81L 4LH6A 2RCNA 2HUGA 4KKSA 2DN8A 2NBFA 4X3UA 4A3BB 1AEXA 1VMCA 5KEEA 3PIO3 1CHPD 4FF3A 3I4NH 2XCLA 4HIMA 3A55A 2F3WA 4JI6Q 1HA5A 2YYZA 4XYLB 1EYDA 3KLRA 1PZJD 3L7ZC 4B9XA 3CC4A 1ICFB 1PDQA 3I4MB 1LTAD 1I4QA 1EHIA 4K0KQ 1BCPD 3T1YQ 2R7DA 4OHJA 4CKEA 5KNDA 3RN5A 2K1BA 3SK5A 1GHJA 1E2WA 2ICIA 4OX9L 2F3IA 1RTOA 3UZOA 1HH2P 2CZGA 5CB4F 1CM9A 1JORA 1I50H 2EJ0A 2LMCB 5JAVA 1G6ZA 1N33Q 4FFLA 1B9NA 4EEQA 1DOLA 4NXNL 4UFZA 3K5MA 2B3GA 5IY0A 2XTIA 3D0FA 1SMXA 2ZXPA 4O84A 3AU7A 3GTQB 5DGIA 3RD4A 2VUMG 2ZJPA 4N9PA 4DNIA 5FJ8G 5GAHC 2JA9A 4X65L 2UXDL 1PV4A 1HFNA 1F2MA 2XNAC 1TU2B 5HGQA 3I70A 4LF6Q 1EYAA 1LTTD 2EYMA 2NUCA 3M3YH 3AB9A 2KQ3A 4KN7C 2EQSA 3LX0A 4HJ5A 3I73A 1BF4A 3CCMA 1CI3M 5EBCA 4DUZQ 4ZQ3A 3OW7A 3T13A 3HKZE 2YRXA 3WWJA 2SNSA 3PV0A 1RJTA 2WIIB 1CQJB 3H94A 2MQHA 5J1ZA 2I5HA 1GUNA 3S9WA 4ZCKA 1Y1WH 4DV3L 4GZYC 4K5WA 4DRFA 3K7UC 2DY7A 5D65A 1PZKD 2FP4B 1KDCA 2VUGA 4A3EG 3BDCA 1K9MC 4M9UA 1B53A 2GVAA 4L5QA 2JJQA 2Z6BA 2Y0SG 1SE3A 4YY3L 2WYOA 2R7KA 1OXVA 3GIDA 2K5QA 2DJFC 1VQPA 3PN1A 3DTFA 3RMHA 1ML0D 2EYPA 4C3JH 2F4VQ 4B3TQ 1YNNC 4ID6A 1D5ZC 3CP0A 1I94L 4UUGA 2CFMA 2N78A 2R7ZG 4LF5L 4KHPL 1IYUA 3F8TA 3V96A 1SFOB 4XZ3B 5EPKA 3TW6A 1QVFA 1VQHA 2R93G 4UP8A 5BWWA 5FPOA 2ZTEA 1OXUA 1Q3LA 4OIJA 5KYLA 2EE1A 2Q2HA 3IKJA 1D1IA 2M9VA 1BCPC 2B8GA 4JK1C 3HOWB 1PMRA 2KA7A 4ZOLF 2HGWA 4X66L 3TRZA 4OELB 1U4LA 1WCMH 4GKKL 4HN2A 4A3IB 4MV9A 4EGJA 4EFEA 3BVZA 4JBKA 5FNVF 1HA6A 3TW7A 5EGTA 2CHBD 1VQ9A 4HNUA 1NCVA 1X56A 2WAQB 3JSLA 2F0PA 1K3BC 2YZMA 1T5EA 4JC0A 4J6HA 3D6CA 3NTIA 4XQQA 2VW9A 1WTOA 4HR7B 3R2TA 4A3FB 4Q4DA 1IW7D 5EQ0A 1DJRD 1A3UA 3O13A 3PO3G 4UCTA 2HHHQ 1FGUA 2EJFC 4I7AA 1J9OA 4O0AA 4JI3Q 4S3SA 2IX0A 1G291 4QGUA 1C9OA 4HIOA 1TWFH 1ZAUA 2Z4HA 2B2UC 1OXSC 2FFKB 1STGA 3ORRA 2QILA 2C9OA 1ILQA 4K2KA 1F77A 3MC0B 1TT2A 2K6AA 4F88A 3AFQA 1VS0A 4X6AH 2ZM6Q 3AEVA 2RDGA 3H6MA 3BVGA 1Y8OB 3T4AC 3EVQA 1X54A 2IT1A 4A76A 1AFPA 3HKZG 3KALA 1VQJA 3SR1A 4QSHA 1I4XA 3EBEA 1VQOA 3S1QH 4R4OA 4DUYQ 2KHSA 4XYQA 1B50A 3QOJA 1JB3A 5D3DA 1WVLA 3NBZB 3IFDA 4HMIA 1WYDA 1C4QA 1A15A 1YJWA 1PH9A 2PBZA 3F2CA 3T54A 1B7YB 3RZOB 2CW0D 1G2SA 4TVIA 5CR3A 5CM0A 5C3WA 1HZAA 5CV6A 1VQDA 2EOTA 3F2BA 3J80c 4JOIA 1SYFA 3SXHA 5BWTA 5IYDG 2KCMA 4NMZA 3TIGA 3SGIA 4K6LA 1Y1VB 3GTGH 2HHFA 4LF4L 4J8QA 1TAEA 2PVPA 2NUAB 3T16A 2ZJRA 3CCQA 1LM0A 4FFPA 4HIKA 4CMFA 5KKNB 1STYA 1HCZA 3GLKA 3RZDB 3M4QA 3KJOA 3RNUA 4BY1H 2AQ1B 3VR2A 3HEJA 1FJGL 3QIAA 5BR8Q 3QWNA 1LTBD 2MUYA 3A8IE 1STAA 4NZOA 2ICEC 3KK7A 1VF5C 4O7VA 3V2TA 2GVBA 3HOXH 4XT3B 1CFMA 2CWPA 1TS5A 1IW7C 4A3JG 4L1KA 1PYSB 3BYTB 4BXXH 1RTNA 4DV1Q 4TSSA 1Q7YC 4NDXA 3L2PA 1EFID 2I5MX 2N55A 3DLLA 1BUVT 4M1UB 3OSOA 4B9WA 3GTJB 1I3QB 3X3NA 1XNRQ 4IZ8A 3QWUA 4GNXC 4M8AA 1RHPA 4C3HG 2F52A 1E4EA 3UYYA 4C2MB 1TWHH 1ULZA 3LP8A 5M3MB 1LUZA 3KBGA 1KRSA 3KF6A 2EY2A 3CCVA 2V4DA 5EKIA 3D4WA 2NU9B 4RAUC 1TWAB 4C56C 5KRUA 2L9HA 3DM1A 2EZVA 3SNOA 2A69D 4IURA 2WP8J 5IODA 4A3GH 5LYJF 3JAME 4DK1A 3CCJA 1M0TA 3RLOA 2PNHA 5IP9H 1C0AA 4O83A 2D0PA 3TP8A 4C3JG 4A3KH 3NTKA 3W2DA 3UZBA 4DFAA 5DAUA 4MIUA 4BY7B 4MV3A 1DZ1A 1VBGA 2YU9H 1LYLA 2CW0C 2NVQH 5EKLA 3SK6A 4GLVB 1CA5A 2F0DA 1L0WA 3RN2A 3CCRA 4JI8Q 1WR2A 3FKIG 3OW2A 2B2WA 2V59A 4PNYA 4A93B 4RGNA 4RHSA 4CDDC 2PZUA 5K2MA 2JE6I 1C8CA 4A3MH 2R84A 3V4SA 4ZYSA 5JJKA 3GTPB 3HOVH 2KENA 4F8MA 2R92B 1PH2A 5CAEB 1LACA 3DWQA 2JA8G 1H9RA 4PMWA 2KEEA 2YZNA 3L0OA 5F2DA 4X65Q 2UXDQ 2EJ3A 3BG3A 3KUPA 1OBGA 1NSNS 3VR3A 4GOPC 2OLSA 1XXGA 5IGBA 4A3DH 2F0FA 4F87A 3ETJA 1SYDA 3GJXB 1KJQA 4ME3A 5BN3A 3TINA 5CE8A 3KDFB 1F9PA 2LXJA 3VYUA 4L6TB 3AMUA 2NB0A 3VDYA 2V5AA 2D62A 1VQKA 2EY5A 1G2WA 4DV3Q 1V9PA 5J2TF 2CQOA 1PH1A 2E75C 3I4NB 1EEID 3T7AA 1MKHA 4DK3C 4CJ0B 5I5UA 1UNSA 1O7YA 1D2BA 5FLXL 5LMNL 2W70A 2A69C 4GNXB 2XGTA 1STNA 3OUZA 1YNJD 2A1HA 1XDNA 5EPJA 1L1OC 4QF4A 2LSSA 5D1OB 3P75A 2CVRA 2K05A 4JI2Q 1T5XD 3HBLA 1N36L 5IYZF 1QZHA 1FD7D 2B8FA 4O82A 4EQPA 4O4HF 1OXTA 3HFZB 1SJHD 2C35B 1I50B 1V8QA 4KTAA 3RFCA 3RLNA 3E5NA 5CORA 3ETHA 2M2LA 2NN6G 4DR1Q 4I50F 3MXPA 2NN6I 3ERSX 2EVBA 2JEAI 1XPOA 3MXUA 2PQAB 3VYTA 4IN3A 4X66Q 1DCZA 4LWCA 3VPCA 4GKKQ 5AFWA 1WTHA 2UU9Q 3NXWA 3P7JA 2A6HD 2NZOA 2PW5A 2ODTX 4MA5A 4ME5A 2R7NA 2JA5H 4J1MA 4QL5A 5DNFA 4O2DA 1NE3A 1J8IA 4YAKB 1K83H 4LW1A 2ES2A 4LF9Q 5GAEC 3BDLA 3M3YB 4MTKA 2F03A 1EZ6A 1JE5A 3J7AV 1IBLL 3PO2B 1IBML 4TKOB 2F0WA 2FXQA 4ILWA 3BYYB 1M8AA 1IBKQ 2ABJA 2VY3A 4RGMA 1SRUA 2QDLA 2RF4A 1B4OA 4IPGA 1Z9FA 4UP9A 5C4ZA 1GUOA 1HRJA 2RA4A 3K3PA 1KAWA 3BJUA 4BXXG 4DGZA 4DR5L 5BPFA 1HFGA 1Y1WB 2GQSA 2LKVA 4Q5VA 3L9AX 1PLFA 1I6VC 5ELBA 2YZGA 1GOZA 4DK0A 3A5UA 1JICA 4YJ2F 3CAMA 1LTLA 2DGYA 1GLVA 2I46A 5GQOA 2VUMH 4K14A 1IL8A 1QUQA 2OXPA 4GOPB 4HNVA 2HQLA 5LOVF 1V1PA 4FYDA 3U0GA 4CHTB 1EIGA 4YAJB 4JI1Q 4CE5A 4IOAA 1ET6A 4H7BA 2R85A 2DNCA 1NJIC 5J2UF 5C1OA 1CE8A 5JVH3 2NVTH 1PH8A 4YWLA 1DONA 1O7LA 3H0GG 3U50C 4FFOA 4A3GG 2IY5B 1JDEA 2G9DA 5LXTF 1W96A 1YNJC 2K4KA 1JWSD 3SDZA 3EN2A 3NBHB 2D0OA 4DV4L 2J9GA 1SE4A 1WD1A 1GHKA 1HTLD 2EDGA 3Q2OA 5IWAL 1E2ZA 1WCMB 3STBD 5D8DA 5DISC 4A3EH 2B2VA 2EY6A 1JMCA 2Z8LA 1HNZL 4PBCA 4LNQA 3J7A5 1L1OB 5C4HA 3J81c 4QIWE 4QUFA 2GLTA 1HR0Q 1XTCD 1P16A 5M3FG 3KFUA 4X64Q 3N8DA 2COIA 2VB2X 3M4PA 1B2TA 3MJFA 4LF4Q 1DOKA 2B39A 2BA0A 2K03A 4P75A 3DM3A 1D5XC 2R7ZH 2HVSA 2A6HC 4XTCS 1H9SA 4IFDG 1W6KA 3BZDB 1HPCA 5C0XG 4IFDI 1VKZA 1GXDC 1LT4D 4UPAA 5C0XI 5K36G 3HOVG 4IJLA 3E0EA 4KD3A 4UCRA 1FJGQ 3KF8B 1TWFB 2R93H 1MBYA 2HDLA 5CMDA 4O4LF 1HQRD 1CZGA 1GSAA 5CA1F 2WINB 2YTVA 2CWAA 3I12A 4OWWB 3HOUG 2NVYH 2OWOA 4HTOA 1VQEA 5G3LF 1KTKA 2CH4W 2IW3A 4FDBA 3NK9A 3CC7A 3TBIB 3NUAA 2LFNA 2F0SA 3IRBA 1HHVA 5JJZA 3IFTA 5DM73 4KY5A 1G8ZD 3E5SA 1ZYRD 5HURA 3GO5A 3K0YA 2BH8A 4RG1A 4XX0B 3K58A 2RSOA 5I9PA 3P20A 2I07B 2B63B 3S1QB 4HTHA 5FKAC 3VA7A 5C3EB 3VYSA 4LF8Q 1SSOA 4UCVA 3A56A 3NTHA 2QW7A 4ZRZA 3PO3H 1OXXK 4DR4L 5JEAG 5CV5A 1CT1D 4KHVA 3W1GA 3M7NA 5K3WA 4NXMQ 4PMCA 4LFCL 4Y52H 3AFPA 4XYMB 3FMCA 1I6HH 2K28A 1EYCA 3FDTA 4JV5Q 2NZ1D 1SNMA 4X62Q 4ABNA 3SK4A 3EROA 1B1ZA 1QWYA 1MJEA 3T9AA 5E7NA 1ESRA 4GN4B 2PN1A 1BVSA 2ID0A 2PI2E 4KV6A 5NUCA 4PV1C 1PZID 4BY1B 1CUKA 2KCNA 5EJWA 4HAEA 2QA4A 2L11A 2AUKA 1X32A 3U4ZA 1D6EC 3HGBA 5EBDA 2KJXA 4JI5Q 3E6ZX 1KTAA 1C3OA 1KBLA 3NQIA 3MZ5A 3BA9A 4QMGA 3CF5A 3HOXB 1PFMA 3GTMB 1A62A 4LFAL 3CW2C 1GGOA 1IYEA 2JA5G 2GA4B 1U4PA 4C1NI 4DA2A 1SNDA 1R9TH 5KIXA 4IIJF 2K5WA 1RD9D 2XD4A 1I7LA 3T9DA 2F0KA 3H3VC 4IUVA 5IYDH 4NZNA 2EJGC 3UDFA 2PPBC 3EFXD 5C4JH 2UUAQ 3TS2A 2ZXOA 5A2QL 4DV6Q 1N34Q 1TWHB 4O7RA 4UAIA 1ASYA 1A3TA 1E22A 1PFNA 4QY7A 3OUUA 4JYAQ 2K14A 4GKJQ 4DNTB 2VQFQ 5E1FA 4ZUJA 3Q1KA 3GDEA 1N8RC 2HG8A 4O7LA 3T9BA 2CNUA 2GPWA 2P0AA 3LWEA 3HKSA 5FLXE 2MGSA 1ZYRC 3JAMi 4CBVA 1A2TA 3NE5B 2F0MA 1F9RA 2A6ED 2SEBD 3BZCA 3GV3A 4YCWA 2X5RA 2VS1A 4LMQD 3TMEA 1FNWA 4C3IG 2JA7B 3TEHB 4A3KB 5I5SA 2E74C 3OMGA 4A3JH
chains in the Genus database with same CATH topology
1RL2A 4WJ4A 1SFOH 3UDIA 4JOIC 4IOCA 2NVXH 4JYAL 4GKJL 2VQFL 1HZAA 4YWMA 1I3QH 3J7A5 1PH5A 2K75A 1VQDA 2JK8A 3S24A 1YEZA 3F2BA 3TQYA 1V1QA 2E5LL 2Q2UA 4DR2L 4JCVE 3J80c 2ZTDA 4DR6Q 4DAMA 4JOIA 3S15H 3HOWH 1P8LA 3AQQA 4C3HH 2K5VA 5LMUQ 2WB1E 5IYDG 2KCMA 4DUYL 1GVPA 1XNQL 5M3MH 5M5WH 3SGIA 4OONA 2UUBL 3GTGH 2UUCQ 4QJFA 3G71A 1N36Q 4LF4L 2BH2A 1TAEA 1XPRA 2ZJRA 1VQ7A 1HNXQ 3CCQA 1LM0A 3ULPA 2VL6A 4HIKA 5JJIA 1G6PA 2OQKA 3OTOQ 1KQSA 4UCOA 2DUDA 1E24A 3Q8DA 3M4QA 3KJOA 3RNUA 4BY1H 4LF6L 1UE7A 4NPSA 5ELNA 5DLQE 3H3VH 1TA8A 3S14H 3M4OH 5C44G 1YJ9A 3JSNA 4PZ6A 5BR8Q 1S40A 1FJGL 2B63G 1SE8A 4GN5A 1E3PA 4A3FH 2BA1A 5C3EG 3CMEA 1HJPA 2GVBA 1XMQL 1M90C 3G48A 3HOXH 3ULLA 1B04A 1EIFA 4BY7H 4E6NA 2CWPA 2PMZE 1SR3A 1YHAA 3PUWA 4GS3A 5IYCG 1C7YA 2UUCL 4A3JG 1PYSB 1VCIA 1HNXL 4BXXH 4DV1Q 1IZ6A 4JBMA 3KDFA 1Q7YC 2CCZA 3L2PA 4LH6A 2I5MX 3OTOL 1VQ5A 2N8NA 2UXBQ 3DLLA 1TWCH 1KHIA 2NZHA 3A5ZB 4JI7Q 2RHQB 4BBRH 1B70B 1XNRQ 1NTGA 1Q1EA 4B3SQ 3QWUA 4GNXC 3HOWG 3FKIH 4AIMA 5FLMG 1VQIA 1X65A 2F52A 1XMOQ 4DR3Q 4A93H 3FP9A 3PF4A 1TWHH 4P71A 4A3IG 1J6QA 3MEFA 1KIXA 4H02A 2AHOB 1YIJA 1LUZA 3I7FA 1KRSA 4GNXA 3PUYA 4DR5Q 3TS0A 3KF6A 3CPFA 3GTPH 1W3SA 3CCVA 3STBC 5IP7H 1WI5A 2UUAL 5D1OA 2WAQG 4BY1G 4DV5Q 2YTXA 2UXBL 3I56A 4AQYL 4QQBX 3OYYA 2WP8J 1U5KA 1PH3A 4A3GH 2MFIA 3CCJA 1XNRL 3RLOA 2PNHA 3CPWA 4DKAC 5IP9H 3S1RH 1QVCA 2JA8H 1C0AA 5D1PA 4A3FG 4MZ9A 4JI0L 1FL0A 1XMOL 1B8AA 2D0PA 4LUOA 1N9WA 4DV0Q 4A3KH 4DR3L 3HOXG 2MNAA 2WFWA 1TXYA 2E8GA 1HNWQ 1CSQA 2YU9H 3D31A 3RTXA 1LYLA 1BKBA 1E7ZA 1VQBA 4IO9A 1WFQA 4IPCA 1YITA 2PQAA 2NVQH 3GTOH 3NBYB 2R7FA 4JG2A 4GLVB 1W2BA 3ULJA 3ICEA 3PGZA 4DV5L 1YHQA 1L0WA 1K8AC 3CXCA 3RN2A 4CC5A 5GAGC 3CCRA 2E2IH 3HOYH 4JI8Q 3GD7A 4HJ8A 3FKIG 3OW2A 3CQZH 2K52A 4DK6C 1G51A 5FJ8H 2ZTCA 3J81i 1WOCA 4B3MQ 1L2FA 3K81C 5M5YH 1AE3A 1VQ6A 1HNWL 1KC8C 1Q12A 2JE6I 1J5EL 1Z47A 3J7ZC 4A3MH 4HTPA 1X3EA 4BA1I 3RZDH 1EYGA 3KYHC 4YWKA 3FHWA 3NEMA 5IP7G 5JJKA 4PZ7A 3HOVH 4DV2Q 2KENA 4RMFA 3PIPA 1PH2A 1HNZQ 1N32Q 1Q46A 2WB1G 2Z6KC 3S2HH 1VQNA 2YTYA 3LGJA 1D8LA 4TVAB 2IHEA 5IP9G 2JA8G 4JI8L 3H15A 4PMWA 1K0RA 3L0OA 4GN3B 1UE5A 4X65Q 2JA7G 2UXDQ 4A3KG 2AMCB 4JBWA 2Z6KA 1GKHA 2KHIA 1N34L 3VNNA 4P72A 1EFWA 2ZM6L 3CCSA 3ZJYC 4GOPC 1ASZA 3PUVA 4MTNA 4HJ7A 4A3DH 4DPGA 1EUJA 1CKOA 2Z0SA 1CSPA 3GTJH 3CMAA 1YI2A 1QVGA 2RHSB 3K80C 4KHZA 1T9HA 4UP7A 5LMNQ 1AH9A 2EXDA 3GJXB 4GOPA 4A3LG 1GM5A 1N32L 1E1TA 4ME3A 2AWOA 2CKZB 3KDFB 5AJ3L 2LXJA 1PH7A 5H1SE 1Y1VG 4C2MH 4Y7NH 2HIVA 3VDYA 4DV7Q 1RIPA 2D62A 2VQEQ 1VQKA 1KXLA 3UQ8A 1MIUA 4P73A 3KJPA 4DV3Q 1HZ9A 3PCOB 1V9PA 2KCTA 1X6OA 2MO0A 2CQOA 1O7IA 3B6YA 3JC66 1PH1A 1TWAH 3G4SA 4A3MG 4JI4Q 2QGQA 4LFBQ 5GADC 1MKHA 4ALPA 4DK3C 4EQ5A 4YHHQ 3CC2A 3JAMc 3TY8A 5LMNL 3NELA 4GNXB 5JJLA 2XGTA 5IYBH 3PO2H 3KF6B 1CKNA 1XDNA 1L1OC 4TQUS 4DR6L 4DR7Q 2LSSA 1NMFA 4AYBE 5D1OB 5LMUL 4R4CA 4EFBA 2ASBA 4JI2Q 1X9NA 1PFSA 4DV7L 1GD7A 3T1HQ 1IXRA 3S17H 5HY6A 1H95A 2K50A 1N36L 4DR4Q 3PUZA 1L1OA 4A3DG 1QZHA 5ELOA 3TREA 3K7AH 2OQ0A 4LFBL 1OXTA 4JI4L 3HFZB 3S16H 2C35B 1XTDA 3MXNB 4YCVA 3BA8A 4L5SA 3GB8B 5FPRA 4LFCQ 3RLNA 1NY4A 1VQ8A 2A8VA 4P74A 4DR1Q 2NN6G 4KI0A 3S2DH 3RR5A 1IBLQ 2YV5A 4OO1G 2NN6I 3ERSX 1S72A 1XK5A 4OO1I 4LH7A 1YHBA 3NENA 1IBMQ 5BR8L 2JEAI 1XPOA 4L5RC 2PQAB 3KOJA 4LF7Q 4X66Q 5M3MG 1PH4A 1VQFA 1CKMA 4LWCA 3BAAA 4PG3A 2E2JH 4JI2L 4GKKQ 3T1HL 4B3RQ 3M85A 2UU9Q 2KBNA 2NZOA 4DAYB 4R4IA 1JB7A 3W1BA 4QL5A 2JA5H 4O2DA 1NE3A 4DV1L 2R92H 2QEXA 1VQMA 3HOZH 1K83H 4LW1A 2ES2A 4LF9Q 5GAEC 3I4OA 1A0IA 4MNOA 4PZ8A 1QZGA 1SN8A 5FLXc 2UXCQ 3H0GH 3H3VI 2JEBI 4JI7L 2ZJQA 1JE5A 2K5NA 4DR1L 1K73C 1IBLL 3U58A 1PVOA 4B3SL 2AKWB 1IBML 4UCSA 1PHJA 2FXQA 1VQLA 2HVRA 1IBKQ 2OCEA 2Y0SE 4OWXB 2VY3A 1JJ2A 1SRUA 4LF7L 2N3SA 1EWIA 2RF4A 4IPGA 2JA6H 5J3BA 4BY7G 2OTJA 1Z9FA 4WJ3M 4LFAQ 4UP9A 4LUZA 2UU9L 1KAWA 3BJUA 4A3CH 3ER0A 1HR0W 4BXXG 3BABA 4DR5L 1Y14B 4POGA 4JBJA 3PUXA 4R1JA 2H5XA 2ATWA 1KL9A 3A5UA 4LF9L 2MO1A 4BBRG 2UXCL 3CAMA 2A19A 1EOVA 3CCLA 1A63A 2HVQA 1LTLA 1EQRA 2ALYB 2DGYA 2PI2A 1A8VA 2RCNA 1YNXA 5GQOA 1KRTA 3E9HA 5M3FH 2VUMH 4A93G 1IBKL 4DV0L 1WJJA 1QUQA 4DV4Q 1VQ4A 4OX9Q 4GOPB 3PIOA 1YZ6A 2HQLA 3I2ZA 5IWAQ 1X55A 2KHJA 1TWGH 4JI1Q 3I4NH 4HIMA 4JI6Q 3UE0A 4IOAA 3TY5A 2YYZA 1NJIC 2R92G 3HOZG 3L7ZC 1K8GA 4EX5A 3CC4A 4K0KL 3AYHB 1JJCB 2NVTH 1PH8A 4YWLA 4NXNQ 3S1MH 3H0GG 3U50C 4A3GG 1JT8A 2IY5B 2AWNA 1Q1BA 4K0KQ 3BU2A 3T1YQ 5EAYA 4HJ9A 2K4KA 2R7DA 2V1CC 3EN2A 3J80i 3F2DA 3RN5A 3NBHB 2D0OA 2JA6G 3HOUH 4OX9L 4DV4L 4B3ML 2F3IA 2E2HH 4LUVA 1FVIA 5IWAL 1CKNB 1HH2P 4A3CG 1IYJB 3STBD 1I50H 4BBSH 4JI1L 4JI6L 1N33Q 5DISC 4A3EH 4EEQA 4DV2L 2E5LQ 4AYBG 4NXNL 1Q82C 1HNZL 1JMCA 4UFZA 2B3GA 5IY0A 4A75A 4LNQA 2XTIA 3D0FA 1L1OB 3F1ZA 2B63H 3HOYG 1SMXA 4QIWE 3J81c 1HR0Q 1XNQQ 1XPUA 1P16A 5M3FG 3KFUA 1MJCA 2VUMG 4X64Q 5C3EH 1UWVA 2ZJPA 3BZKA 2Q2TA 4DNIA 3M4PA 5FJ8G 5GAHC 4LF4Q 2JA9A 2BA0A 4X65L 4P75A 2UXDL 3DM3A 1PV4A 5IT9c 2LXKA 5HGQA 3UE1A 2R7ZH 3GTKH 3I4NG 2HVSA 4XTCS 1DGSA 4IFDG 1VQCA 3KLWA 4YCUA 4LF6Q 4IPDA 5C0XG 4IFDI 4UPAA 3M3YH 4HIDA 5C0XI 5K36G 3HOVG 1N33L 5C4XH 4IJLA 3E0EA 4UCRA 2EQSA 4HJ5A 4R4TA 1FJGQ 5GROA 1SLJA 3KF8B 4YY3Q 3CCMA 4A4IA 4DUZQ 2R93H 2IX1A 4IJHA 1X3GA 5FLMH 3HKZE 2GN5A 1XMQQ 1HR0L 1JJGA 3A74A 2YTVA 2CWAA 3PV0A 4X64L 4OWWB 4A3IH 2R6GA 1I94Q 1UEBA 2VQEL 3HOUG 2NVYH 2OWOA 3TY9A 2MQHA 1EIYB 2I5HA 4HTOA 2A1AA 3U4VA 4LF5Q 1VQEA 4KHPQ 1Y1WH 5M5XH 4DV3L 3NC0B 3UDXA 1S3OA 1K3RA 4BBSG 4FDBA 3K7UC 4IFDJ 4DRFA 2HT1A 3CC7A 5C0XJ 1PH6A 1UE1A 2VUGA 2K5HA 3IRBA 4A3EG 4YHHL 1K9MC 2GVAA 4L5QA 2JJQA 2N49A 2Y0SG 3GO5A 4CC6A 2BH8A 4RG1A 4YY3L 4DUZL 1OXVA 1VQPA 2IHFA 3PN1A 4A3BH 4DR7L 2B29A 4C3JH 4R4QA 4B3TQ 2F4VQ 3GTMH 4LF8Q 3CP0A 4UCVA 3A0JA 2EIFA 1I94L 3S1NH 4BA2I 2CFMA 4UCUA 2N78A 2R7ZG 3PO3H 1OXXK 4LF5L 4DR4L 4KHPL 5JEAG 3W1GA 3F8TA 4HJAA 4AQYQ 3M7NA 1QUQB 5C4XG 1XJVA 4NXMQ 3CD6A 3I4MH 4LFCL 1QVFA 4Y52H 1VQHA 3AFPA 2OTLA 3PO2G 5IYBG 4UP8A 2R93G 1I6HH 5FPOA 2ZTEA 1OXUA 3PF5A 2I0QA 1OTCA 4JI0Q 2Q2HA 4JV5Q 4OWTB 4X62Q 4X66L 3TRZA 3RLFA 2F4VL 4B3TL 4LF8L 1WCMH 4GKKL 1MJEA 4B3RL 1Q8KA 1YVCA 4EFEA 5E7NA 1Y1WG 4GN4B 4JBKA 1BVSA 2ID0A 1HZCA 5JEAJ 1UE6A 1NBWA 1D7QA 4OXPA 4KLKA 1VQ9A 2PI2E 4GLXA 1PA6A 1X56A 3CCEA 1CUKA 4NXML 2JQOA 3JSLA 3K8AA 2QA4A 4JC0A 3GTQH 1Q86C 1U0LA 3U4ZA 1Q81C 2VW9A 1GO3E 4A3BG 4JI5Q 4JV5L 2VNUD 2JA7H 5LMNW 4X62L 3RZOH 3BA9A 4C3IH 3CF5A 1AE2A 3J81j 5IE8A 1A62A 1J5EQ 4LFAL 1PYBA 1SROA 3CW2C 3PO3G 4UCTA 4NB3A 1I5FA 1FGUA 2HHHQ 1VQGA 4O0AA 2JA5G 4JI3Q 1NMGA 2IX0A 1R9TH 1G291 4QGUA 1C9OA 4HIOA 3I4MG 1YBYA 1TWFH 4A3LH 1OXSC 3GTLH 2WAQE 2HIXA 4AH6A 1Y1VH 5IYDH 1BBWA 2L15A 3PSIA 1V43A 3I55A 3AFQA 1VS0A 4JI5L 3UDFA 4POFA 2ZM6Q 4X6AH 3E9IA 5C4JH 4J15A 1X3FA 2UUAQ 3TS2A 3AEVA 1N34Q 1WCMG 4DV6Q 4L5TA 1YJNA 3UDGA 1E22A 4QY7A 1ASYA 4JYAQ 2K14A 4GKJQ 2VQFQ 2HHHL 1KD1C 2Q2IA 3K0XA 1HZBA 4JI3L 1X54A 2IT1A 4A76A 3G6EA 3GDEA 1N8RC 3HKZG 4DR2Q 1VQJA 4XIGS 5C44H 3EBEA 1VQOA 1IL2A 1BBUA 3HKSA 5AJ3Q 3S1QH 4R4OA 3JAMi 4UY8C 4GLAC 1M1KC 4DUYQ 3CCUA 3W5OA 3T1YL 1EQQA 3WWVA 2UUBQ 3NBZB 3BZCA 2I5LX 3M9BA 4YCWA 1WYDA 2VS1A 1S68A 1VQAA 4IPHA 1YJWA 3TEHB 5IYCH 3F2CA 1E1OA 3EIVA 4APVA 1PH9A 1B7YB 4A3JH 2VZAA 4DV6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL2 A;  4WJ4 A;  1SFO H;  3UDI A;  4JOI C;  4IOC A;  2NVX H;  4JYA L;  4GKJ L;  2VQF L;  1HZA A;  4YWM A;  1I3Q H;  3J7A 5;  1PH5 A;  2K75 A;  1VQD A;  2JK8 A;  3S24 A;  1YEZ A;  3F2B A;  3TQY A;  1V1Q A;  2E5L L;  2Q2U A;  4DR2 L;  4JCV E;  3J80 c;  2ZTD A;  4DR6 Q;  4DAM A;  4JOI A;  3S15 H;  3HOW H;  1P8L A;  3AQQ A;  4C3H H;  2K5V A;  5LMU Q;  2WB1 E;  5IYD G;  2KCM A;  4DUY L;  1GVP A;  1XNQ L;  5M3M H;  5M5W H;  3SGI A;  4OON A;  2UUB L;  3GTG H;  2UUC Q;  4QJF A;  3G71 A;  1N36 Q;  4LF4 L;  2BH2 A;  1TAE A;  1XPR A;  2ZJR A;  1VQ7 A;  1HNX Q;  3CCQ A;  1LM0 A;  3ULP A;  2VL6 A;  4HIK A;  5JJI A;  1G6P A;  2OQK A;  3OTO Q;  1KQS A;  4UCO A;  2DUD A;  1E24 A;  3Q8D A;  3M4Q A;  3KJO A;  3RNU A;  4BY1 H;  4LF6 L;  1UE7 A;  4NPS A;  5ELN A;  5DLQ E;  3H3V H;  1TA8 A;  3S14 H;  3M4O H;  5C44 G;  1YJ9 A;  3JSN A;  4PZ6 A;  5BR8 Q;  1S40 A;  1FJG L;  2B63 G;  1SE8 A;  4GN5 A;  1E3P A;  4A3F H;  2BA1 A;  5C3E G;  3CME A;  1HJP A;  2GVB A;  1XMQ L;  1M90 C;  3G48 A;  3HOX H;  3ULL A;  1B04 A;  1EIF A;  4BY7 H;  4E6N A;  2CWP A;  2PMZ E;  1SR3 A;  1YHA A;  3PUW A;  4GS3 A;  5IYC G;  1C7Y A;  2UUC L;  4A3J G;  1PYS B;  1VCI A;  1HNX L;  4BXX H;  4DV1 Q;  1IZ6 A;  4JBM A;  3KDF A;  1Q7Y C;  2CCZ A;  3L2P A;  4LH6 A;  2I5M X;  3OTO L;  1VQ5 A;  2N8N A;  2UXB Q;  3DLL A;  1TWC H;  1KHI A;  2NZH A;  3A5Z B;  4JI7 Q;  2RHQ B;  4BBR H;  1B70 B;  1XNR Q;  1NTG A;  1Q1E A;  4B3S Q;  3QWU A;  4GNX C;  3HOW G;  3FKI H;  4AIM A;  5FLM G;  1VQI A;  1X65 A;  2F52 A;  1XMO Q;  4DR3 Q;  4A93 H;  3FP9 A;  3PF4 A;  1TWH H;  4P71 A;  4A3I G;  1J6Q A;  3MEF A;  1KIX A;  4H02 A;  2AHO B;  1YIJ A;  1LUZ A;  3I7F A;  1KRS A;  4GNX A;  3PUY A;  4DR5 Q;  3TS0 A;  3KF6 A;  3CPF A;  3GTP H;  1W3S A;  3CCV A;  3STB C;  5IP7 H;  1WI5 A;  2UUA L;  5D1O A;  2WAQ G;  4BY1 G;  4DV5 Q;  2YTX A;  2UXB L;  3I56 A;  4AQY L;  4QQB X;  3OYY A;  2WP8 J;  1U5K A;  1PH3 A;  4A3G H;  2MFI A;  3CCJ A;  1XNR L;  3RLO A;  2PNH A;  3CPW A;  4DKA C;  5IP9 H;  3S1R H;  1QVC A;  2JA8 H;  1C0A A;  5D1P A;  4A3F G;  4MZ9 A;  4JI0 L;  1FL0 A;  1XMO L;  1B8A A;  2D0P A;  4LUO A;  1N9W A;  4DV0 Q;  4A3K H;  4DR3 L;  3HOX G;  2MNA A;  2WFW A;  1TXY A;  2E8G A;  1HNW Q;  1CSQ A;  2YU9 H;  3D31 A;  3RTX A;  1LYL A;  1BKB A;  1E7Z A;  1VQB A;  4IO9 A;  1WFQ A;  4IPC A;  1YIT A;  2PQA A;  2NVQ H;  3GTO H;  3NBY B;  2R7F A;  4JG2 A;  4GLV B;  1W2B A;  3ULJ A;  3ICE A;  3PGZ A;  4DV5 L;  1YHQ A;  1L0W A;  1K8A C;  3CXC A;  3RN2 A;  4CC5 A;  5GAG C;  3CCR A;  2E2I H;  3HOY H;  4JI8 Q;  3GD7 A;  4HJ8 A;  3FKI G;  3OW2 A;  3CQZ H;  2K52 A;  4DK6 C;  1G51 A;  5FJ8 H;  2ZTC A;  3J81 i;  1WOC A;  4B3M Q;  1L2F A;  3K81 C;  5M5Y H;  1AE3 A;  1VQ6 A;  1HNW L;  1KC8 C;  1Q12 A;  2JE6 I;  1J5E L;  1Z47 A;  3J7Z C;  4A3M H;  4HTP A;  1X3E A;  4BA1 I;  3RZD H;  1EYG A;  3KYH C;  4YWK A;  3FHW A;  3NEM A;  5IP7 G;  5JJK A;  4PZ7 A;  3HOV H;  4DV2 Q;  2KEN A;  4RMF A;  3PIP A;  1PH2 A;  1HNZ Q;  1N32 Q;  1Q46 A;  2WB1 G;  2Z6K C;  3S2H H;  1VQN A;  2YTY A;  3LGJ A;  1D8L A;  4TVA B;  2IHE A;  5IP9 G;  2JA8 G;  4JI8 L;  3H15 A;  4PMW A;  1K0R A;  3L0O A;  4GN3 B;  1UE5 A;  4X65 Q;  2JA7 G;  2UXD Q;  4A3K G;  2AMC B;  4JBW A;  2Z6K A;  1GKH A;  2KHI A;  1N34 L;  3VNN A;  4P72 A;  1EFW A;  2ZM6 L;  3CCS A;  3ZJY C;  4GOP C;  1ASZ A;  3PUV A;  4MTN A;  4HJ7 A;  4A3D H;  4DPG A;  1EUJ A;  1CKO A;  2Z0S A;  1CSP A;  3GTJ H;  3CMA A;  1YI2 A;  1QVG A;  2RHS B;  3K80 C;  4KHZ A;  1T9H A;  4UP7 A;  5LMN Q;  1AH9 A;  2EXD A;  3GJX B;  4GOP A;  4A3L G;  1GM5 A;  1N32 L;  1E1T A;  4ME3 A;  2AWO A;  2CKZ B;  3KDF B;  5AJ3 L;  2LXJ A;  1PH7 A;  5H1S E;  1Y1V G;  4C2M H;  4Y7N H;  2HIV A;  3VDY A;  4DV7 Q;  1RIP A;  2D62 A;  2VQE Q;  1VQK A;  1KXL A;  3UQ8 A;  1MIU A;  4P73 A;  3KJP A;  4DV3 Q;  1HZ9 A;  3PCO B;  1V9P A;  2KCT A;  1X6O A;  2MO0 A;  2CQO A;  1O7I A;  3B6Y A;  3JC6 6;  1PH1 A;  1TWA H;  3G4S A;  4A3M G;  4JI4 Q;  2QGQ A;  4LFB Q;  5GAD C;  1MKH A;  4ALP A;  4DK3 C;  4EQ5 A;  4YHH Q;  3CC2 A;  3JAM c;  3TY8 A;  5LMN L;  3NEL A;  4GNX B;  5JJL A;  2XGT A;  5IYB H;  3PO2 H;  3KF6 B;  1CKN A;  1XDN A;  1L1O C;  4TQU S;  4DR6 L;  4DR7 Q;  2LSS A;  1NMF A;  4AYB E;  5D1O B;  5LMU L;  4R4C A;  4EFB A;  2ASB A;  4JI2 Q;  1X9N A;  1PFS A;  4DV7 L;  1GD7 A;  3T1H Q;  1IXR A;  3S17 H;  5HY6 A;  1H95 A;  2K50 A;  1N36 L;  4DR4 Q;  3PUZ A;  1L1O A;  4A3D G;  1QZH A;  5ELO A;  3TRE A;  3K7A H;  2OQ0 A;  4LFB L;  1OXT A;  4JI4 L;  3HFZ B;  3S16 H;  2C35 B;  1XTD A;  3MXN B;  4YCV A;  3BA8 A;  4L5S A;  3GB8 B;  5FPR A;  4LFC Q;  3RLN A;  1NY4 A;  1VQ8 A;  2A8V A;  4P74 A;  4DR1 Q;  2NN6 G;  4KI0 A;  3S2D H;  3RR5 A;  1IBL Q;  2YV5 A;  4OO1 G;  2NN6 I;  3ERS X;  1S72 A;  1XK5 A;  4OO1 I;  4LH7 A;  1YHB A;  3NEN A;  1IBM Q;  5BR8 L;  2JEA I;  1XPO A;  4L5R C;  2PQA B;  3KOJ A;  4LF7 Q;  4X66 Q;  5M3M G;  1PH4 A;  1VQF A;  1CKM A;  4LWC A;  3BAA A;  4PG3 A;  2E2J H;  4JI2 L;  4GKK Q;  3T1H L;  4B3R Q;  3M85 A;  2UU9 Q;  2KBN A;  2NZO A;  4DAY B;  4R4I A;  1JB7 A;  3W1B A;  4QL5 A;  2JA5 H;  4O2D A;  1NE3 A;  4DV1 L;  2R92 H;  2QEX A;  1VQM A;  3HOZ H;  1K83 H;  4LW1 A;  2ES2 A;  4LF9 Q;  5GAE C;  3I4O A;  1A0I A;  4MNO A;  4PZ8 A;  1QZG A;  1SN8 A;  5FLX c;  2UXC Q;  3H0G H;  3H3V I;  2JEB I;  4JI7 L;  2ZJQ A;  1JE5 A;  2K5N A;  4DR1 L;  1K73 C;  1IBL L;  3U58 A;  1PVO A;  4B3S L;  2AKW B;  1IBM L;  4UCS A;  1PHJ A;  2FXQ A;  1VQL A;  2HVR A;  1IBK Q;  2OCE A;  2Y0S E;  4OWX B;  2VY3 A;  1JJ2 A;  1SRU A;  4LF7 L;  2N3S A;  1EWI A;  2RF4 A;  4IPG A;  2JA6 H;  5J3B A;  4BY7 G;  2OTJ A;  1Z9F A;  4WJ3 M;  4LFA Q;  4UP9 A;  4LUZ A;  2UU9 L;  1KAW A;  3BJU A;  4A3C H;  3ER0 A;  1HR0 W;  4BXX G;  3BAB A;  4DR5 L;  1Y14 B;  4POG A;  4JBJ A;  3PUX A;  4R1J A;  2H5X A;  2ATW A;  1KL9 A;  3A5U A;  4LF9 L;  2MO1 A;  4BBR G;  2UXC L;  3CAM A;  2A19 A;  1EOV A;  3CCL A;  1A63 A;  2HVQ A;  1LTL A;  1EQR A;  2ALY B;  2DGY A;  2PI2 A;  1A8V A;  2RCN A;  1YNX A;  5GQO A;  1KRT A;  3E9H A;  5M3F H;  2VUM H;  4A93 G;  1IBK L;  4DV0 L;  1WJJ A;  1QUQ A;  4DV4 Q;  1VQ4 A;  4OX9 Q;  4GOP B;  3PIO A;  1YZ6 A;  2HQL A;  3I2Z A;  5IWA Q;  1X55 A;  2KHJ A;  1TWG H;  4JI1 Q;  3I4N H;  4HIM A;  4JI6 Q;  3UE0 A;  4IOA A;  3TY5 A;  2YYZ A;  1NJI C;  2R92 G;  3HOZ G;  3L7Z C;  1K8G A;  4EX5 A;  3CC4 A;  4K0K L;  3AYH B;  1JJC B;  2NVT H;  1PH8 A;  4YWL A;  4NXN Q;  3S1M H;  3H0G G;  3U50 C;  4A3G G;  1JT8 A;  2IY5 B;  2AWN A;  1Q1B A;  4K0K Q;  3BU2 A;  3T1Y Q;  5EAY A;  4HJ9 A;  2K4K A;  2R7D A;  2V1C C;  3EN2 A;  3J80 i;  3F2D A;  3RN5 A;  3NBH B;  2D0O A;  2JA6 G;  3HOU H;  4OX9 L;  4DV4 L;  4B3M L;  2F3I A;  2E2H H;  4LUV A;  1FVI A;  5IWA L;  1CKN B;  1HH2 P;  4A3C G;  1IYJ B;  3STB D;  1I50 H;  4BBS H;  4JI1 L;  4JI6 L;  1N33 Q;  5DIS C;  4A3E H;  4EEQ A;  4DV2 L;  2E5L Q;  4AYB G;  4NXN L;  1Q82 C;  1HNZ L;  1JMC A;  4UFZ A;  2B3G A;  5IY0 A;  4A75 A;  4LNQ A;  2XTI A;  3D0F A;  1L1O B;  3F1Z A;  2B63 H;  3HOY G;  1SMX A;  4QIW E;  3J81 c;  1HR0 Q;  1XNQ Q;  1XPU A;  1P16 A;  5M3F G;  3KFU A;  1MJC A;  2VUM G;  4X64 Q;  5C3E H;  1UWV A;  2ZJP A;  3BZK A;  2Q2T A;  4DNI A;  3M4P A;  5FJ8 G;  5GAH C;  4LF4 Q;  2JA9 A;  2BA0 A;  4X65 L;  4P75 A;  2UXD L;  3DM3 A;  1PV4 A;  5IT9 c;  2LXK A;  5HGQ A;  3UE1 A;  2R7Z H;  3GTK H;  3I4N G;  2HVS A;  4XTC S;  1DGS A;  4IFD G;  1VQC A;  3KLW A;  4YCU A;  4LF6 Q;  4IPD A;  5C0X G;  4IFD I;  4UPA A;  3M3Y H;  4HID A;  5C0X I;  5K36 G;  3HOV G;  1N33 L;  5C4X H;  4IJL A;  3E0E A;  4UCR A;  2EQS A;  4HJ5 A;  4R4T A;  1FJG Q;  5GRO A;  1SLJ A;  3KF8 B;  4YY3 Q;  3CCM A;  4A4I A;  4DUZ Q;  2R93 H;  2IX1 A;  4IJH A;  1X3G A;  5FLM H;  3HKZ E;  2GN5 A;  1XMQ Q;  1HR0 L;  1JJG A;  3A74 A;  2YTV A;  2CWA A;  3PV0 A;  4X64 L;  4OWW B;  4A3I H;  2R6G A;  1I94 Q;  1UEB A;  2VQE L;  3HOU G;  2NVY H;  2OWO A;  3TY9 A;  2MQH A;  1EIY B;  2I5H A;  4HTO A;  2A1A A;  3U4V A;  4LF5 Q;  1VQE A;  4KHP Q;  1Y1W H;  5M5X H;  4DV3 L;  3NC0 B;  3UDX A;  1S3O A;  1K3R A;  4BBS G;  4FDB A;  3K7U C;  4IFD J;  4DRF A;  2HT1 A;  3CC7 A;  5C0X J;  1PH6 A;  1UE1 A;  2VUG A;  2K5H A;  3IRB A;  4A3E G;  4YHH L;  1K9M C;  2GVA A;  4L5Q A;  2JJQ A;  2N49 A;  2Y0S G;  3GO5 A;  4CC6 A;  2BH8 A;  4RG1 A;  4YY3 L;  4DUZ L;  1OXV A;  1VQP A;  2IHF A;  3PN1 A;  4A3B H;  4DR7 L;  2B29 A;  4C3J H;  4R4Q A;  4B3T Q;  2F4V Q;  3GTM H;  4LF8 Q;  3CP0 A;  4UCV A;  3A0J A;  2EIF A;  1I94 L;  3S1N H;  4BA2 I;  2CFM A;  4UCU A;  2N78 A;  2R7Z G;  3PO3 H;  1OXX K;  4LF5 L;  4DR4 L;  4KHP L;  5JEA G;  3W1G A;  3F8T A;  4HJA A;  4AQY Q;  3M7N A;  1QUQ B;  5C4X G;  1XJV A;  4NXM Q;  3CD6 A;  3I4M H;  4LFC L;  1QVF A;  4Y52 H;  1VQH A;  3AFP A;  2OTL A;  3PO2 G;  5IYB G;  4UP8 A;  2R93 G;  1I6H H;  5FPO A;  2ZTE A;  1OXU A;  3PF5 A;  2I0Q A;  1OTC A;  4JI0 Q;  2Q2H A;  4JV5 Q;  4OWT B;  4X62 Q;  4X66 L;  3TRZ A;  3RLF A;  2F4V L;  4B3T L;  4LF8 L;  1WCM H;  4GKK L;  1MJE A;  4B3R L;  1Q8K A;  1YVC A;  4EFE A;  5E7N A;  1Y1W G;  4GN4 B;  4JBK A;  1BVS A;  2ID0 A;  1HZC A;  5JEA J;  1UE6 A;  1NBW A;  1D7Q A;  4OXP A;  4KLK A;  1VQ9 A;  2PI2 E;  4GLX A;  1PA6 A;  1X56 A;  3CCE A;  1CUK A;  4NXM L;  2JQO A;  3JSL A;  3K8A A;  2QA4 A;  4JC0 A;  3GTQ H;  1Q86 C;  1U0L A;  3U4Z A;  1Q81 C;  2VW9 A;  1GO3 E;  4A3B G;  4JI5 Q;  4JV5 L;  2VNU D;  2JA7 H;  5LMN W;  4X62 L;  3RZO H;  3BA9 A;  4C3I H;  3CF5 A;  1AE2 A;  3J81 j;  5IE8 A;  1A62 A;  1J5E Q;  4LFA L;  1PYB A;  1SRO A;  3CW2 C;  3PO3 G;  4UCT A;  4NB3 A;  1I5F A;  1FGU A;  2HHH Q;  1VQG A;  4O0A A;  2JA5 G;  4JI3 Q;  1NMG A;  2IX0 A;  1R9T H;  1G29 1;  4QGU A;  1C9O A;  4HIO A;  3I4M G;  1YBY A;  1TWF H;  4A3L H;  1OXS C;  3GTL H;  2WAQ E;  2HIX A;  4AH6 A;  1Y1V H;  5IYD H;  1BBW A;  2L15 A;  3PSI A;  1V43 A;  3I55 A;  3AFQ A;  1VS0 A;  4JI5 L;  3UDF A;  4POF A;  2ZM6 Q;  4X6A H;  3E9I A;  5C4J H;  4J15 A;  1X3F A;  2UUA Q;  3TS2 A;  3AEV A;  1N34 Q;  1WCM G;  4DV6 Q;  4L5T A;  1YJN A;  3UDG A;  1E22 A;  4QY7 A;  1ASY A;  4JYA Q;  2K14 A;  4GKJ Q;  2VQF Q;  2HHH L;  1KD1 C;  2Q2I A;  3K0X A;  1HZB A;  4JI3 L;  1X54 A;  2IT1 A;  4A76 A;  3G6E A;  3GDE A;  1N8R C;  3HKZ G;  4DR2 Q;  1VQJ A;  4XIG S;  5C44 H;  3EBE A;  1VQO A;  1IL2 A;  1BBU A;  3HKS A;  5AJ3 Q;  3S1Q H;  4R4O A;  3JAM i;  4UY8 C;  4GLA C;  1M1K C;  4DUY Q;  3CCU A;  3W5O A;  3T1Y L;  1EQQ A;  3WWV A;  2UUB Q;  3NBZ B;  3BZC A;  2I5L X;  3M9B A;  4YCW A;  1WYD A;  2VS1 A;  1S68 A;  1VQA A;  4IPH A;  1YJW A;  3TEH B;  5IYC H;  3F2C A;  1E1O A;  3EIV A;  4APV A;  1PH9 A;  1B7Y B;  4A3J H;  2VZA A;  4DV6 L; 
#chains in the Genus database with same CATH topology
 3MXG A;  4WJ4 A;  4JOI C;  4IOC A;  2NVX H;  2YU9 B;  4ZLT F;  3DAA A;  2ZDG A;  3KLS A;  1GUT A;  2K5D A;  4N8X 1;  1UC8 A;  2JK8 A;  4CDC C;  1YEZ A;  4CHI A;  2E5L L;  4DR2 L;  4JCV E;  3NP8 A;  2OT2 A;  4C3H H;  5CBA E;  1BXR A;  1XNQ L;  2WB1 E;  2SNM A;  1EU4 A;  1JR0 D;  5M5W H;  1I2K A;  4OON A;  2UUB L;  5DMX A;  5H80 A;  2UUC Q;  4QJF A;  3G71 A;  1N36 Q;  1S4Z A;  2JP1 A;  1LT6 D;  5JOB A;  1VQ7 A;  3A7A B;  2VL6 A;  3OMC A;  3OTO Q;  1KQS A;  4UCO A;  1LTI D;  4OL7 A;  5IIF A;  4A3M B;  1TA8 A;  3S14 H;  1EL0 A;  3I4L A;  2B2Y A;  5C44 G;  2H1E A;  1YJ9 A;  1I1L A;  4ME6 A;  2EJ2 A;  5HNE A;  1SE8 A;  1DYQ A;  1QIL A;  1ZXT A;  3NUC A;  1HJP A;  4KJN A;  1M90 C;  3G48 A;  1PTO H;  3G6J B;  3ULL A;  1EIF A;  2PMZ E;  3PUW A;  1SR3 A;  1C7Y A;  5IYC G;  2HCC A;  3G7L A;  3TN2 A;  2L4N A;  1HNX L;  1SCU B;  1Z2O X;  3D8G A;  1KJ8 A;  3T9F A;  1I4R A;  4A3D B;  2EYL A;  3T56 B;  5CV7 A;  1VQ5 A;  2UXB Q;  5D3I B;  2N8N A;  2RVL A;  1G91 A;  1MHW C;  4DU9 A;  1KHI A;  2NZH A;  3RV3 A;  4BBR H;  4R9W A;  2B2T A;  3Q22 A;  3CEB A;  1IKM A;  4ODG A;  2RSN A;  3TP7 A;  3FKI H;  1XMO Q;  3KAK A;  1X65 A;  4DR3 Q;  3MEF A;  4H02 A;  2AHO B;  4HCS A;  1Z2N X;  4DR5 Q;  3TS0 A;  1W3S A;  2QB5 A;  1LV9 A;  1STH A;  4QUC A;  5IGD A;  4AQY L;  4TRD A;  2XRS D;  3R3O A;  4FF4 A;  2K04 A;  2MFI A;  4X3S A;  3M4O B;  5D1P A;  4DKA C;  2JA8 H;  3EA6 A;  4E6I A;  2HCI A;  1WTW A;  4JI0 L;  3MXN A;  2A6E C;  2WFW A;  1TXY A;  2E8G A;  3TSS A;  2W6N A;  3LNN A;  5I9O A;  3D31 A;  3OPO A;  4LK1 C;  3UFX B;  1LTR D;  4IO9 A;  2EY1 A;  1E7Z A;  4CDF C;  2R7L A;  2EYH A;  1YIT A;  3KAJ A;  3QQM A;  1PK8 A;  5I60 A;  5KX5 F;  1W2B A;  3ICE A;  1EZ8 A;  2B2W C;  3PGZ A;  4DV5 L;  2W6Z A;  4I4T F;  2IWH A;  2HQE A;  3CXC A;  5GAG C;  3HOY H;  1SNC A;  4IUP A;  4DAY A;  1BXT A;  3NBI A;  3GD7 A;  2HJW A;  1SXT A;  5I5W A;  1KC7 A;  5D14 A;  2K52 A;  1WOC A;  3J7A F;  2A74 C;  1VQ6 A;  1HNW L;  4ZKB B;  1Q12 A;  2N88 A;  1Z47 A;  1S5E D;  1EYG A;  5IP7 G;  3FHW A;  5CR5 A;  1KLG D;  4PZ7 A;  2VXW A;  1W93 A;  2HHF B;  1HNZ Q;  1K83 B;  2WB1 G;  3S2H H;  3JRX A;  1VQN A;  5I5V A;  4OGQ C;  4O7Y A;  3TZU A;  4TVA B;  1FNV A;  3H15 A;  2KVM A;  4GN3 B;  3S1R B;  1UE5 A;  3AX6 A;  2F0T A;  3MEH A;  4P72 A;  1EFW A;  2R86 A;  3CCS A;  1B44 D;  3WWI A;  1CS0 A;  4MTN A;  5DEH A;  4DPG A;  1EUJ A;  1CSP A;  4O42 A;  1WTV A;  3HG9 A;  1YI2 A;  1QVG A;  4UP7 A;  2NN6 H;  2EXD A;  4IZO A;  3QB3 A;  1GM5 A;  1N32 L;  3DTG A;  4WRD A;  4HCE A;  2E2I B;  1ROD A;  4Y7N H;  1F9Q A;  2IPK D;  1RIP A;  3WOE A;  1KXL A;  2W6O A;  2VUM B;  3UQ8 A;  1M0W A;  4CMD A;  1MIU A;  4P73 A;  3KJP A;  1HZ9 A;  1X6O A;  3B6Y A;  1AUX A;  4LFB Q;  4IWY A;  5I5T A;  2QGQ A;  1LAB A;  2K7V A;  5GAD C;  1E4E B;  1IYD A;  4EQ5 A;  2P5Z X;  1CQI B;  1D1K A;  1JCK B;  1Z2P X;  4IHJ F;  1UUP A;  2NVT B;  5JJL A;  1AZQ A;  3KF6 B;  1CKN A;  3J7Y W;  5ELF A;  1NMF A;  3DWP A;  4AYB E;  3VOT A;  3DHQ A;  4EFB A;  1DM0 B;  4DV7 L;  1EY4 A;  2IL8 A;  3S17 H;  2H4O A;  1A9X A;  3SEB A;  1M4V A;  1PTO D;  2K50 A;  4DR4 Q;  1HQM C;  2RCF A;  2OQ0 A;  4JI4 L;  3C1F A;  3S16 H;  5FPR A;  1EQT A;  1K0S A;  4LFC Q;  1FYC A;  5JVD F;  3S2D H;  4NZM A;  4A3E B;  1EY6 A;  2YV5 A;  2FPI B;  1S72 A;  3MWE A;  1YHB A;  2Y0S B;  3NEN A;  2ZDH A;  3R5H A;  1DOM A;  2MPM A;  5FO8 B;  3J81 E;  4LF7 Q;  1PH4 A;  3FPP A;  2YWV A;  2E2J H;  3T1H L;  2EJM A;  4L8J A;  3NPP A;  5FO7 B;  3Q0A A;  1D5M C;  2ZT9 C;  1Y8P B;  4M0J A;  5L37 A;  2R7Z B;  1SE2 A;  2QEX A;  1VQM A;  4H13 C;  3GP7 A;  4MN3 A;  2XIW A;  2UXC Q;  1DV2 A;  1SN8 A;  5FLX c;  2X0S A;  3H0G H;  4QCL A;  1GUG A;  2JEB I;  5CV8 A;  3MTS A;  2L0C A;  1K73 C;  4WOR A;  3U58 A;  1PVO A;  4B3S L;  2R93 B;  2JSO A;  5C6A A;  1GJX A;  1EUD B;  3JZI A;  2HVR A;  2OCE A;  4XQJ A;  2OTJ A;  4LFA Q;  4LUZ A;  1EIH A;  1TY2 A;  1Z7T A;  5IGC A;  4WBN F;  3ER0 A;  1PTO F;  1HXY D;  1Y14 B;  2FJ2 A;  4JBJ A;  2OEO A;  4RCO A;  1QJO A;  2ATW A;  4KN4 C;  2MO1 A;  2Q7D A;  4BBR G;  4FFN A;  4DLK A;  3BAC A;  1ICW A;  2ALY B;  2PI2 A;  1KRT A;  1A8V A;  1SNP A;  1YNX A;  3OHX C;  5E3F A;  3E9H A;  5M3F H;  3WOF A;  5BN4 A;  1WJJ A;  4OX9 Q;  1AUV A;  3K5N A;  1YZ6 A;  1I7N A;  1X55 A;  1AZP A;  1WD0 A;  4MV6 A;  3TY5 A;  3UE0 A;  4IFD H;  3V4Z A;  5C0X H;  3HOZ G;  4DAV A;  3PO3 B;  1CZW A;  1B3A A;  3AYH B;  3MA2 B;  5K36 H;  4PQX A;  4NXN Q;  2F0L A;  4RKL A;  1JT8 A;  2YS7 A;  1STE A;  4U68 A;  3BU2 A;  1FR3 A;  5EAY A;  1I6H B;  1PFB A;  2V1C C;  3J80 i;  3PQI A;  4DXF A;  2JA6 G;  3HOU H;  1WRV A;  4O7T A;  2B2V C;  4B3M L;  2E2H H;  1FVI A;  4A3C G;  1PTO C;  1IYJ B;  4JI6 L;  1AP0 A;  2E5L Q;  4AYB G;  1Q82 C;  2QF7 A;  5T1I A;  4RZQ A;  3HKZ B;  3F1Z A;  2EPB A;  2JXM B;  3HOY G;  4EGV A;  1XNQ Q;  1XPU A;  1QNK A;  4K0K L;  1EYZ A;  1UWV A;  3BZK A;  2Q2T A;  3JZ6 A;  2YS6 A;  2K33 A;  1TVX A;  3FRP B;  1I1K A;  1ENA A;  3OWF A;  2LXK A;  4XYO A;  5JEA H;  1DGS A;  3N52 A;  2GQR A;  1VQC A;  3KLW A;  3X3M A;  3CRK C;  4B08 A;  1N33 L;  5DAA A;  3U9S A;  1TS4 A;  5BMV F;  1TY0 A;  2D2C C;  2MJ8 A;  1R9T B;  4R4T A;  5GRO A;  4YY3 Q;  4A4I A;  4L63 B;  2A5H A;  2GN5 A;  1JJG A;  3A74 A;  3L3O C;  4A3I H;  1I94 Q;  4NW2 A;  2VQE L;  1EIY B;  3RV4 A;  3FVQ A;  2A1A A;  5HGT A;  4LF5 Q;  4KHP Q;  5M5X H;  4KMU C;  1S3O A;  1K3R A;  4BBS G;  2R87 A;  5BWV A;  4RKB A;  1HUM A;  3VR4 A;  2K5H A;  2JN4 A;  2XWJ B;  5CC4 A;  1ET0 A;  4CC6 A;  2WAC A;  1A2U A;  1DV1 A;  4DN4 M;  4DUZ L;  2IHF A;  2Y4R A;  2B29 A;  4Z9C B;  4R4Q A;  1O7Z A;  2L1B A;  1JOQ A;  2NU6 B;  1S5F D;  3A0J A;  2EIF A;  1K28 A;  4HSV A;  3S1N H;  4BA2 I;  2RKS A;  4DF7 A;  2EXZ A;  4A3J B;  4YB8 B;  3DWA A;  4HJA A;  4AQY Q;  3T99 A;  2NVX B;  1QUQ B;  5C4X G;  1XJV A;  3CD6 A;  4JW0 A;  1V1P B;  2PO4 A;  5E25 A;  3Q6S A;  1ILP A;  2OTL A;  4RWS C;  4DQN A;  1OTC A;  4JI0 Q;  5KYI A;  4OWT B;  4C3H B;  3K6O A;  2TSS A;  3RLF A;  3QR8 A;  4B3T L;  2F4V L;  1SMY D;  2FMC A;  3FEW X;  3OIQ A;  2NYZ D;  1HZC A;  1UE6 A;  1NBW A;  4V19 0;  2SOB A;  4OXP A;  3HZX A;  1D7Q A;  1QB5 D;  4GLX A;  1PA6 A;  1CTM A;  2FPG B;  2O5J C;  3CCE A;  1TS2 A;  1LO5 D;  3S14 B;  5C8Y F;  1GO3 E;  5CGK A;  4A3B G;  2VNU D;  1SYC A;  2F0J A;  3A8J E;  3RZO H;  2Z9H A;  3T9C A;  4C3I H;  4C3J B;  2XRQ D;  3J81 j;  1PTO B;  5IE8 A;  3ITP A;  1QCB D;  1SRO A;  2R82 A;  1I5F A;  1IOV A;  4QB4 A;  1LTS D;  1ESF A;  2A73 B;  3I4M G;  1O80 A;  1YBY A;  4MV7 A;  2CNV A;  3GTL H;  1UEA B;  1SYB A;  4FU0 A;  1H9S B;  2WAQ E;  2HIX A;  4AH6 A;  1Y1V H;  2K32 A;  1BBW A;  2NWG A;  2L15 A;  3PSI A;  1V43 A;  3FKI B;  5IOC A;  2F0V A;  2MHV A;  4J15 A;  1X3F A;  5G3L D;  1EY0 A;  1I1M A;  1T36 A;  5FR9 A;  3R5X A;  4L5T A;  4XQN A;  1YJN A;  1ENF A;  3HB9 A;  2HHH L;  4RGT A;  2Q2I A;  3K0X A;  1HZB A;  4IQZ A;  4JI3 L;  4O7W A;  3G6E A;  4MV8 A;  4CJ1 B;  4XIG S;  2R3Z A;  5C44 H;  3PIP 3;  1IL2 A;  5I4D A;  1BBU A;  1B6S A;  2DIK A;  1EY7 A;  1U4M A;  4FNF A;  4GLA C;  4UY8 C;  1DD2 A;  4O7N A;  3W5O A;  3MFY A;  4HED A;  4RHR A;  3WWV A;  4FF1 A;  2I5L X;  2JA8 B;  1H9K A;  3M9B A;  5KNC A;  5IYC H;  1NR4 A;  4P2C B;  4CGY B;  5BPH A;  2XN9 C;  1I3Q H;  1PH5 A;  5KGU A;  1EY8 A;  3S24 A;  4DXG A;  3TQY A;  1V1Q A;  2Q2U A;  2Z02 A;  1IOW A;  2C00 A;  2O4X A;  4XXE A;  4DAM A;  3S15 H;  1V1O A;  1KT8 A;  1P8L A;  4R8N A;  1KNA A;  2RDH A;  4DUY L;  1GVP A;  2YW2 A;  5M3M H;  1QG7 A;  4X3T A;  3K5H A;  5FK9 C;  2B2Y C;  1MSG A;  3ULP A;  4K2L A;  1SMY C;  4O2B F;  2DUD A;  1E24 A;  3Q8D A;  4KKT A;  1S5C D;  5DLQ E;  1EQV A;  4IWX A;  3JSN A;  5CBE E;  3AW8 A;  4PZ6 A;  1QE6 A;  1S40 A;  3S2H B;  4ZUI A;  4WHX A;  4GN5 A;  1E3P A;  2HGS A;  1GUS A;  3CHB D;  2BA1 A;  3D6W A;  3CME A;  1NUC A;  1XMQ L;  3K57 A;  4BY7 H;  4NYE A;  1K8O A;  4GS3 A;  1YHA A;  3ORQ A;  5LHY 1;  3K5L A;  1VCI A;  4JBM A;  2C5C A;  2CCZ A;  1TWC H;  1VDZ A;  5EKK A;  1NR2 A;  3TEK A;  3A5Z B;  1TQO A;  1VF7 A;  2RHQ B;  4MV4 A;  1B70 B;  5C5L A;  3CU7 A;  1Q1E A;  1SEB D;  4B3S Q;  1SYE A;  1IYV A;  4HN7 A;  3HOW G;  3PMF A;  4O7Z A;  1VQI A;  4F7X A;  3WDN A;  4A93 H;  3FP9 A;  4UHV A;  3VPD A;  3PF4 A;  2DY8 A;  4P71 A;  4Y7N B;  4A3I G;  3GTG B;  1WTQ A;  1I4G A;  3CPF A;  3GTP H;  1EKV A;  3STB C;  5IP7 H;  2WAQ G;  2YTX A;  2IJ0 A;  3I56 A;  1JWU D;  1U5K A;  3HRZ C;  1MD2 D;  1XNR L;  3CPW A;  1BNC A;  4A3F G;  2PNR C;  1FL0 A;  3I90 A;  4LUO A;  1UC9 A;  5CA0 F;  1IKL A;  2MNA A;  1CSQ A;  4ZHQ F;  3SE7 A;  1BKB A;  1VQB A;  3GTO H;  1II3 A;  1WFQ A;  2R7F A;  2V58 A;  3BDO A;  1RDP D;  3S16 B;  1I2L A;  4KY6 A;  1YHQ A;  1KJJ A;  1VBH A;  4CC5 A;  5JQG F;  4ULL A;  4HJ8 A;  1WTP A;  5BN5 A;  3CQZ H;  2GPS A;  1YNN D;  1KDB A;  3NQT A;  4DK6 C;  4DNR B;  2VR1 A;  4MAM A;  3J81 i;  4B3M Q;  3CRL C;  1EKP A;  5M5Y H;  1DIK A;  1AE3 A;  1JLL B;  2E2J B;  4I65 A;  2J0T D;  2F4I A;  1J5E L;  4YIJ A;  3J7Z C;  4HTP A;  4BA1 I;  1EY9 A;  1XYI A;  4N8F A;  5LA6 F;  5T1G A;  5CYU A;  4YWK A;  2MP1 A;  3PIP A;  3JAM L;  1Q46 A;  1TR5 A;  4LJZ C;  5A35 A;  2YTY A;  3H0G B;  2PYK A;  4A3G B;  1Y8N B;  2AQ3 B;  2IHE A;  4RH6 A;  4JI8 L;  4O81 A;  2AMC B;  3T53 B;  2Z6K A;  1GKH A;  3VNN A;  3VYR A;  1LTG D;  5C1P A;  3PUV A;  4HJ7 A;  1JQY D;  3HP3 A;  3QJY A;  4OEM B;  1BQQ T;  1L0Y B;  2F0O A;  4XDX A;  1T9H A;  5LMN Q;  2NVQ B;  1AH9 A;  3A7L A;  2A68 D;  5IGG A;  1E1T A;  2I8C A;  4OIK A;  4DAA A;  3NHH A;  5AJ3 L;  3U9T A;  1ONL A;  1Y1V G;  2HIV A;  5M3F B;  2YYA A;  2VQE Q;  5I6W A;  5JVL A;  2KCT A;  3JC6 6;  4CKB A;  4CDE C;  3OOC A;  3VA5 A;  4ALP A;  3TY8 A;  2Q8T A;  3HOV B;  4FFM A;  3NEL A;  2YRW A;  3PO2 H;  3SVM A;  5IYB H;  4IUN A;  3TP6 A;  2CQA A;  4EQN A;  4DR6 L;  2KCC A;  4UDU C;  3MAQ A;  1EY5 A;  1BCP F;  5LMU L;  4R4C A;  2ASB A;  1X9N A;  2VQD A;  4EQO A;  2RDF A;  4IUU A;  2ENB A;  2F0Q A;  2HD3 A;  3D4R A;  3HOU B;  1DXM A;  2VPQ A;  2M00 A;  1F2Z A;  5ELO A;  3M4Y A;  2E2H B;  4RFB A;  3K7A H;  3E0J A;  2KOL A;  2O5I C;  1XTD A;  3MXN B;  3BA8 A;  3GB8 B;  1NY4 A;  1DAA A;  1AN8 A;  3K5I A;  1TS3 A;  2X6L A;  1MSH A;  1IBL Q;  4KJO A;  1IBM Q;  1ZEQ X;  4L5R C;  5JH7 F;  2RQX A;  3WNZ A;  5M3M G;  1VQF A;  4I55 F;  2PZT A;  4JI2 L;  1EWC A;  4IAL A;  4DAY B;  2G9H D;  3W1B A;  2LY7 A;  1NNX A;  1Q8I A;  3HOZ H;  4FFR A;  2EIY A;  2NTT A;  5EZY F;  3I4O A;  1A0I A;  1QZG A;  2QKI C;  4PZ8 A;  1TKW B;  4HQ6 A;  4JI7 L;  2ZJQ A;  4DR1 L;  1JKJ B;  4UCS A;  1VQL A;  4FF2 A;  3D3R A;  5C3X A;  1EWI A;  2JA6 H;  4BY7 G;  3CSW A;  5J3B A;  4WJ3 M;  1GUW A;  1U4R A;  2PCF B;  2UU9 L;  4A3C H;  1HR0 W;  5K5P A;  5M5X B;  2LS0 1;  4FGR A;  2E76 C;  3NSW A;  2I80 A;  4LF9 L;  4G7H C;  4KK7 A;  2TMP A;  2A68 C;  3CCL A;  1A63 A;  3R23 A;  3WO1 A;  2HVQ A;  1EQR A;  4G4K A;  4A93 G;  4TV9 F;  1B6R A;  2AQ2 B;  4KY7 A;  5EPL A;  1IBK L;  4DV0 L;  4TV8 F;  4DV4 Q;  1VQ4 A;  1S5D D;  3PIO A;  3I2Z A;  5IWA Q;  2KHJ A;  5DGH A;  1TWG H;  3EJI A;  3S1N B;  4XT1 B;  1Y69 U;  2R92 G;  2G5D A;  1K8G A;  4EX5 A;  2JA5 B;  1BBX C;  1JJC B;  3DMU A;  3S1M H;  4QIW B;  3G8C A;  4YBZ B;  2AWN A;  1Q1B A;  2XSC A;  1KUT A;  4HJ9 A;  1EUC B;  4U67 3;  3F2D A;  5E4X A;  4LUV A;  2DWC A;  1CKN B;  3P1H A;  3IAY A;  2F0N A;  4BBS H;  4JI1 L;  2WV6 D;  3HS0 C;  1KJI A;  4HR7 A;  1SYG A;  4DV2 L;  4K6D A;  1KJ9 A;  4O4I F;  2BCO A;  3Q23 A;  1KDA A;  4Y8V B;  4A75 A;  4JPB W;  2B63 H;  3UI2 A;  5BYB A;  4BWG B;  4IUQ A;  1CHQ D;  1MJC A;  1RCV D;  5C3E H;  2W6Q A;  1JC7 A;  5CV9 A;  5IT9 c;  3U54 A;  1XX8 A;  4Q4C A;  3T51 B;  2F0G A;  4C3I B;  3UE1 A;  5KNB A;  3GTK H;  3I4N G;  4YCU A;  4IPD A;  3TII A;  4HID A;  2R7M A;  1Q90 A;  5J22 A;  5ELC A;  2HDM A;  5JQW A;  4ZQI A;  3F2U A;  3SE0 A;  5C4X H;  1RF2 D;  1SLJ A;  3C46 A;  2FB9 A;  1KNE A;  1PRT D;  1C48 A;  3I3C A;  2IX1 A;  4C1N K;  3GTL B;  4IJH A;  2FPP B;  1X3G A;  2PW7 A;  5FLM H;  3K5O A;  1HR0 L;  1KAB A;  1XMQ Q;  1A3G A;  1CA6 A;  4X64 L;  3TY9 A;  2R6G A;  1UEB A;  5JVG 3;  3U4V A;  5I2Y A;  1FGB D;  1A6X A;  2BDN A;  3NC0 B;  4HSP A;  3UDX A;  2COG A;  4IFD J;  3E3X A;  2HT1 A;  3KBX A;  5C0X J;  1UE1 A;  1CK1 A;  1PH6 A;  4YHH L;  2N49 A;  5TSS A;  1SNQ A;  1MGS A;  4FXG C;  5C44 B;  4WJW A;  1BCP B;  2HGX A;  4A3B H;  4DR7 L;  1B3Q A;  3GTM H;  2F0E A;  3K59 A;  1HUN A;  4UCU A;  1FNU A;  1M6V A;  1MI2 A;  4I7Z C;  1LT5 D;  2J7Z A;  4NP5 A;  3I4M H;  1SAP A;  1A0G A;  4ZI7 F;  3DUZ A;  5CV4 A;  1GSH A;  3PO2 G;  5IYB G;  3PF5 A;  1C30 A;  1PRT F;  2I0Q A;  3PFF A;  1UAP A;  1EWH A;  3MFG A;  3S15 B;  3LWU A;  4G57 A;  4K5V A;  4MV1 A;  1NAP A;  5JPN C;  4LF8 L;  4B3R L;  2BDO A;  3C3L A;  1Q8K A;  1YVC A;  1JWM D;  2NVY B;  2RBM A;  1Y1W G;  5A2Q E;  1KEE A;  2DAB A;  4FP5 D;  5JEA J;  4KLK A;  2SCU B;  4NXM L;  2JQO A;  3R93 A;  3K8A A;  3GTQ H;  1Q86 C;  1U0L A;  3DEO A;  4FXK C;  1Q81 C;  4JV5 L;  2JA7 H;  5LMN W;  4YJ3 F;  2Z1C A;  4X62 L;  3D4D A;  1AE2 A;  1J5E Q;  5IT9 L;  1PYB A;  2J4X A;  4NB3 A;  1VQG A;  3OIP A;  1NMG A;  5BWU A;  1Z6H A;  3DXJ C;  2R61 A;  2VB3 X;  1CQF A;  1BNZ A;  5JPM C;  4A3L H;  1TWC B;  5DM6 3;  3LQS A;  2QEJ C;  3ZYY X;  1TII D;  5COY A;  1PYW D;  5IGF A;  3J80 L;  1WTX A;  1PRT C;  4O2A F;  2XVS A;  2FIN B;  3I55 A;  4O4J F;  2F1M A;  4JI5 L;  4FVM A;  4POF A;  3E9I A;  3I8Z A;  2B2U A;  1WCM G;  4ZK9 B;  4RCN A;  3UDG A;  2EYJ A;  1F2L A;  3IL8 A;  1KD1 C;  2F0U A;  2NU7 B;  2X69 A;  1JOK A;  1BR9 A;  4DR2 Q;  2EYO A;  5IGE A;  3I91 A;  3R8B A;  2WB1 B;  2QK4 A;  4HMJ A;  5E4W C;  5AJ3 Q;  3HT5 A;  4R8I A;  4Q0F A;  3R2I A;  1M1K C;  2L55 A;  3CCU A;  3T1Y L;  1EQQ A;  2UUB Q;  4K8I A;  1B9M A;  1X3Q A;  1SNO A;  1QOH A;  1A48 A;  1S68 A;  1VQA A;  4IPH A;  4EG0 A;  1E1O A;  3EIV A;  5LL6 S;  4APV A;  2UUA L;  2VZA A;  1L0X B;  4DV6 L;  1N34 L;  1RL2 A;  1WTR A;  5ISR A;  1SFO H;  1ET9 A;  3UDI A;  4JYA L;  4GKJ L;  4K8J A;  2VQF L;  4YWM A;  2YL2 A;  3BVM A;  2K75 A;  3GTO B;  2DJG C;  4K6N A;  2JYO A;  4H44 C;  2KEC A;  4ZKC B;  4OO1 H;  2D5D A;  2ZTD A;  3R5F A;  4DR6 Q;  5BYA A;  3HOW H;  1JE4 A;  3AQQ A;  3ERQ A;  1H9J A;  2K5V A;  2PMZ B;  5LMU Q;  4G7O C;  3BS1 A;  4MA0 A;  2QCP X;  2DZD A;  1EEF D;  3MHB A;  2L12 A;  3CQZ B;  2BH2 A;  5BWX A;  2NU8 B;  1XPR A;  1EKF A;  1HNX Q;  5JJI A;  5C4J B;  3QOL A;  4V0B A;  1IHZ A;  5M5Y B;  1G6P A;  2OQK A;  3WWH A;  5LP6 F;  4LF6 L;  4TM5 A;  1UE7 A;  1OO9 B;  4NPS A;  5ELN A;  3RUP A;  4KD4 A;  3H3V H;  3QO2 A;  2F3V A;  2NTS A;  4GLW A;  2PZW A;  3M4O H;  5GON F;  1BO0 A;  1QNU A;  2B63 G;  4FXD A;  5ELD A;  1I4P A;  4KKU A;  1X3P A;  4A3F H;  5C3E G;  2COJ A;  1B04 A;  4E6N A;  4C5C A;  1W6J A;  4O86 A;  5I2X A;  2UUC L;  3R9R A;  5M9O A;  4DIM A;  2DNE A;  1K8M A;  3HO8 A;  1H9M A;  1IZ6 A;  3TQT A;  3KDF A;  4DAP A;  3H09 A;  3OTO L;  1I4H A;  1SJE D;  4JI7 Q;  3MWY W;  3C2P A;  1NTG A;  3TZD A;  5FOB B;  4BS9 A;  2PQE A;  2BE5 D;  4AIM A;  1ZKO A;  5FLM G;  2KED A;  2Z04 A;  3VR6 A;  3T9E A;  1E2V A;  3C1E A;  1XWE A;  2Q8R E;  1KIX A;  1J6Q A;  5M5W B;  4PMB A;  1YIJ A;  4JVZ A;  4K5X A;  3I7F A;  1LT3 D;  4GNX A;  3PUY A;  3RUZ A;  4CJ2 C;  3WO0 A;  1WI5 A;  5D1O A;  4BY1 G;  4DV5 Q;  2UXB L;  3URY A;  4QQB X;  4EVO A;  3OYY A;  1PH3 A;  2FHT A;  3TDQ A;  4E4T A;  1PRT B;  4C5B A;  3S1R H;  1QVC A;  1F9S A;  1U9R A;  4MZ9 A;  1XMO L;  1B8A A;  4DV0 Q;  1N9W A;  4DR3 L;  3TP5 A;  2X6G A;  3HOX G;  1HNW Q;  3CKI B;  5FO9 B;  1BDO A;  4TUY F;  1CQV A;  3U9O A;  4LAA A;  2W6P A;  4FE2 A;  3RTX A;  3NBY B;  4IPC A;  2PQA A;  2QDB A;  1GSO A;  4WFN 3;  4JG2 A;  3K7A B;  3ULJ A;  3V05 A;  3JZF A;  3FPU B;  3NWS A;  1K8A C;  4RA8 A;  1R4Q B;  3DEP A;  2E2I H;  4BBR B;  2F0H A;  2KUM A;  1EOT A;  3EQL C;  2CNQ A;  5KS8 A;  4EGQ A;  1G51 A;  3KLS X;  2ZTC A;  5FJ8 H;  1L2F A;  1PX2 A;  3K81 C;  3VPB A;  3SK8 A;  1EZ1 A;  3VR5 A;  1KC8 C;  3LUL A;  3RZD H;  1X3E A;  4N9T A;  3KYH C;  3NEM A;  4IUT A;  4DV2 Q;  4RMF A;  3HOZ B;  1N32 Q;  2Z6K C;  3LGJ A;  5HBR B;  1D8L A;  3KRE A;  5IP9 G;  3N6R A;  4JXU A;  3A54 A;  1K0R A;  1RKN A;  1SDF A;  1VMP A;  3MWD A;  2JA7 G;  4A3K G;  5I5X A;  4JBW A;  2KHI A;  2ZM6 L;  3ZJY C;  2JA6 B;  2IX3 A;  1ASZ A;  5I6Y A;  1CKO A;  2Z0S A;  3GTJ H;  3CMA A;  2ZXR A;  4ZAI A;  2RHS B;  3K80 C;  4KHZ A;  5C5M A;  3SHL A;  2D9U A;  3BG5 A;  4GOP A;  2AUJ D;  4A3L G;  4AYB B;  5LL6 X;  2YZL A;  2AWO A;  2Q8I B;  1F2Y A;  2CKZ B;  4FO2 A;  3QG1 A;  3HOY B;  2L5T A;  1PH7 A;  5H1S E;  4C2M H;  3M7G A;  2WKD A;  3ONA B;  4DV7 Q;  3VMM A;  2BE5 C;  3G8D A;  4RGO S;  2DLN A;  3PCO B;  2MO0 A;  1O7I A;  4JI4 Q;  1TWA H;  2XWB B;  3G4S A;  4A3M G;  5I47 A;  1TWG B;  3GQB A;  4YHH Q;  3CC2 A;  3JAM c;  3NBH A;  3S1M B;  4NKL A;  3W3A A;  1PXU A;  4C5A A;  4TQU S;  2WKC A;  4DR7 Q;  4O7S A;  1PFS A;  3T1H Q;  1GD7 A;  1IXR A;  1H95 A;  5HY6 A;  2FMM A;  3Q24 A;  2Z4I A;  1KAA A;  2OF1 A;  2B2T C;  2W71 A;  3PUZ A;  3JRW A;  1L1O A;  4A3D G;  3LWB A;  3TRE A;  2W6M A;  1HTP A;  3DF7 A;  4LFB L;  3H91 A;  4YCV A;  4BBS B;  4L5S A;  2O2L D;  2A8V A;  1VQ8 A;  3GV6 A;  4P74 A;  3ND8 A;  4KI0 A;  3RR5 A;  4OO1 G;  2BOS A;  1G2T A;  1XK5 A;  2HDK A;  4OO1 I;  4LH7 A;  5BWR A;  5BR8 L;  3MVV A;  4X3K A;  4HNT A;  3KOJ A;  1OBD A;  1CKM A;  3BAA A;  2F0I A;  4H0L C;  4PG3 A;  4CKC A;  4B3R Q;  2DAA A;  3M85 A;  1BOS A;  2KBN A;  2I87 A;  1O78 A;  1STB A;  3KF8 A;  2K01 A;  4R4I A;  1JB7 A;  2E2D C;  3U55 A;  1JOO A;  5IT9 E;  4MHE A;  4DV1 L;  2R92 H;  1S5B D;  3GTK B;  2IP4 A;  4MNO A;  1LLR D;  3ND9 A;  3H3V I;  2ZDQ A;  5C4X B;  1JDB B;  2K5N A;  3I72 A;  2SDF A;  2EYF A;  2ZGI A;  1E0B A;  1ENC A;  2AKW B;  3NWT A;  3J80 E;  1PHJ A;  4OWX B;  2Y0S E;  1JJ2 A;  5HV6 A;  4LF7 L;  1R4P B;  3QFF A;  2N3S A;  3S17 B;  1A3V A;  3BAB A;  2CH4 A;  4POG A;  3PUX A;  5J39 A;  4G7Z C;  4R1J A;  4O1N A;  1KLU D;  2H5X A;  3OWE B;  5ELE A;  1KL9 A;  1SBB B;  2UXC L;  3A8K E;  5I5Y A;  2A19 A;  1EOV A;  1EU3 A;  3S2D B;  1AW7 A;  3J81 L;  4LH6 A;  2RCN A;  2HUG A;  4KKS A;  2DN8 A;  2NBF A;  4X3U A;  4A3B B;  1AEX A;  1VMC A;  5KEE A;  3PIO 3;  1CHP D;  4FF3 A;  3I4N H;  2XCL A;  4HIM A;  3A55 A;  2F3W A;  4JI6 Q;  1HA5 A;  2YYZ A;  4XYL B;  1EYD A;  3KLR A;  1PZJ D;  3L7Z C;  4B9X A;  3CC4 A;  1ICF B;  1PDQ A;  3I4M B;  1LTA D;  1I4Q A;  1EHI A;  4K0K Q;  1BCP D;  3T1Y Q;  2R7D A;  4OHJ A;  4CKE A;  5KND A;  3RN5 A;  2K1B A;  3SK5 A;  1GHJ A;  1E2W A;  2ICI A;  4OX9 L;  2F3I A;  1RTO A;  3UZO A;  1HH2 P;  2CZG A;  5CB4 F;  1CM9 A;  1JOR A;  1I50 H;  2EJ0 A;  2LMC B;  5JAV A;  1G6Z A;  1N33 Q;  4FFL A;  1B9N A;  4EEQ A;  1DOL A;  4NXN L;  4UFZ A;  3K5M A;  2B3G A;  5IY0 A;  2XTI A;  3D0F A;  1SMX A;  2ZXP A;  4O84 A;  3AU7 A;  3GTQ B;  5DGI A;  3RD4 A;  2VUM G;  2ZJP A;  4N9P A;  4DNI A;  5FJ8 G;  5GAH C;  2JA9 A;  4X65 L;  2UXD L;  1PV4 A;  1HFN A;  1F2M A;  2XNA C;  1TU2 B;  5HGQ A;  3I70 A;  4LF6 Q;  1EYA A;  1LTT D;  2EYM A;  2NUC A;  3M3Y H;  3AB9 A;  2KQ3 A;  4KN7 C;  2EQS A;  3LX0 A;  4HJ5 A;  3I73 A;  1BF4 A;  3CCM A;  1CI3 M;  5EBC A;  4DUZ Q;  4ZQ3 A;  3OW7 A;  3T13 A;  3HKZ E;  2YRX A;  3WWJ A;  2SNS A;  3PV0 A;  1RJT A;  2WII B;  1CQJ B;  3H94 A;  2MQH A;  5J1Z A;  2I5H A;  1GUN A;  3S9W A;  4ZCK A;  1Y1W H;  4DV3 L;  4GZY C;  4K5W A;  4DRF A;  3K7U C;  2DY7 A;  5D65 A;  1PZK D;  2FP4 B;  1KDC A;  2VUG A;  4A3E G;  3BDC A;  1K9M C;  4M9U A;  1B53 A;  2GVA A;  4L5Q A;  2JJQ A;  2Z6B A;  2Y0S G;  1SE3 A;  4YY3 L;  2WYO A;  2R7K A;  1OXV A;  3GID A;  2K5Q A;  2DJF C;  1VQP A;  3PN1 A;  3DTF A;  3RMH A;  1ML0 D;  2EYP A;  4C3J H;  2F4V Q;  4B3T Q;  1YNN C;  4ID6 A;  1D5Z C;  3CP0 A;  1I94 L;  4UUG A;  2CFM A;  2N78 A;  2R7Z G;  4LF5 L;  4KHP L;  1IYU A;  3F8T A;  3V96 A;  1SFO B;  4XZ3 B;  5EPK A;  3TW6 A;  1QVF A;  1VQH A;  2R93 G;  4UP8 A;  5BWW A;  5FPO A;  2ZTE A;  1OXU A;  1Q3L A;  4OIJ A;  5KYL A;  2EE1 A;  2Q2H A;  3IKJ A;  1D1I A;  2M9V A;  1BCP C;  2B8G A;  4JK1 C;  3HOW B;  1PMR A;  2KA7 A;  4ZOL F;  2HGW A;  4X66 L;  3TRZ A;  4OEL B;  1U4L A;  1WCM H;  4GKK L;  4HN2 A;  4A3I B;  4MV9 A;  4EGJ A;  4EFE A;  3BVZ A;  4JBK A;  5FNV F;  1HA6 A;  3TW7 A;  5EGT A;  2CHB D;  1VQ9 A;  4HNU A;  1NCV A;  1X56 A;  2WAQ B;  3JSL A;  2F0P A;  1K3B C;  2YZM A;  1T5E A;  4JC0 A;  4J6H A;  3D6C A;  3NTI A;  4XQQ A;  2VW9 A;  1WTO A;  4HR7 B;  3R2T A;  4A3F B;  4Q4D A;  1IW7 D;  5EQ0 A;  1DJR D;  1A3U A;  3O13 A;  3PO3 G;  4UCT A;  2HHH Q;  1FGU A;  2EJF C;  4I7A A;  1J9O A;  4O0A A;  4JI3 Q;  4S3S A;  2IX0 A;  1G29 1;  4QGU A;  1C9O A;  4HIO A;  1TWF H;  1ZAU A;  2Z4H A;  2B2U C;  1OXS C;  2FFK B;  1STG A;  3ORR A;  2QIL A;  2C9O A;  1ILQ A;  4K2K A;  1F77 A;  3MC0 B;  1TT2 A;  2K6A A;  4F88 A;  3AFQ A;  1VS0 A;  4X6A H;  2ZM6 Q;  3AEV A;  2RDG A;  3H6M A;  3BVG A;  1Y8O B;  3T4A C;  3EVQ A;  1X54 A;  2IT1 A;  4A76 A;  1AFP A;  3HKZ G;  3KAL A;  1VQJ A;  3SR1 A;  4QSH A;  1I4X A;  3EBE A;  1VQO A;  3S1Q H;  4R4O A;  4DUY Q;  2KHS A;  4XYQ A;  1B50 A;  3QOJ A;  1JB3 A;  5D3D A;  1WVL A;  3NBZ B;  3IFD A;  4HMI A;  1WYD A;  1C4Q A;  1A15 A;  1YJW A;  1PH9 A;  2PBZ A;  3F2C A;  3T54 A;  1B7Y B;  3RZO B;  2CW0 D;  1G2S A;  4TVI A;  5CR3 A;  5CM0 A;  5C3W A;  1HZA A;  5CV6 A;  1VQD A;  2EOT A;  3F2B A;  3J80 c;  4JOI A;  1SYF A;  3SXH A;  5BWT A;  5IYD G;  2KCM A;  4NMZ A;  3TIG A;  3SGI A;  4K6L A;  1Y1V B;  3GTG H;  2HHF A;  4LF4 L;  4J8Q A;  1TAE A;  2PVP A;  2NUA B;  3T16 A;  2ZJR A;  3CCQ A;  1LM0 A;  4FFP A;  4HIK A;  4CMF A;  5KKN B;  1STY A;  1HCZ A;  3GLK A;  3RZD B;  3M4Q A;  3KJO A;  3RNU A;  4BY1 H;  2AQ1 B;  3VR2 A;  3HEJ A;  1FJG L;  3QIA A;  5BR8 Q;  3QWN A;  1LTB D;  2MUY A;  3A8I E;  1STA A;  4NZO A;  2ICE C;  3KK7 A;  1VF5 C;  4O7V A;  3V2T A;  2GVB A;  3HOX H;  4XT3 B;  1CFM A;  2CWP A;  1TS5 A;  1IW7 C;  4A3J G;  4L1K A;  1PYS B;  3BYT B;  4BXX H;  1RTN A;  4DV1 Q;  4TSS A;  1Q7Y C;  4NDX A;  3L2P A;  1EFI D;  2I5M X;  2N55 A;  3DLL A;  1BUV T;  4M1U B;  3OSO A;  4B9W A;  3GTJ B;  1I3Q B;  3X3N A;  1XNR Q;  4IZ8 A;  3QWU A;  4GNX C;  4M8A A;  1RHP A;  4C3H G;  2F52 A;  1E4E A;  3UYY A;  4C2M B;  1TWH H;  1ULZ A;  3LP8 A;  5M3M B;  1LUZ A;  3KBG A;  1KRS A;  3KF6 A;  2EY2 A;  3CCV A;  2V4D A;  5EKI A;  3D4W A;  2NU9 B;  4RAU C;  1TWA B;  4C56 C;  5KRU A;  2L9H A;  3DM1 A;  2EZV A;  3SNO A;  2A69 D;  4IUR A;  2WP8 J;  5IOD A;  4A3G H;  5LYJ F;  3JAM E;  4DK1 A;  3CCJ A;  1M0T A;  3RLO A;  2PNH A;  5IP9 H;  1C0A A;  4O83 A;  2D0P A;  3TP8 A;  4C3J G;  4A3K H;  3NTK A;  3W2D A;  3UZB A;  4DFA A;  5DAU A;  4MIU A;  4BY7 B;  4MV3 A;  1DZ1 A;  1VBG A;  2YU9 H;  1LYL A;  2CW0 C;  2NVQ H;  5EKL A;  3SK6 A;  4GLV B;  1CA5 A;  2F0D A;  1L0W A;  3RN2 A;  3CCR A;  4JI8 Q;  1WR2 A;  3FKI G;  3OW2 A;  2B2W A;  2V59 A;  4PNY A;  4A93 B;  4RGN A;  4RHS A;  4CDD C;  2PZU A;  5K2M A;  2JE6 I;  1C8C A;  4A3M H;  2R84 A;  3V4S A;  4ZYS A;  5JJK A;  3GTP B;  3HOV H;  2KEN A;  4F8M A;  2R92 B;  1PH2 A;  5CAE B;  1LAC A;  3DWQ A;  2JA8 G;  1H9R A;  4PMW A;  2KEE A;  2YZN A;  3L0O A;  5F2D A;  4X65 Q;  2UXD Q;  2EJ3 A;  3BG3 A;  3KUP A;  1OBG A;  1NSN S;  3VR3 A;  4GOP C;  2OLS A;  1XXG A;  5IGB A;  4A3D H;  2F0F A;  4F87 A;  3ETJ A;  1SYD A;  3GJX B;  1KJQ A;  4ME3 A;  5BN3 A;  3TIN A;  5CE8 A;  3KDF B;  1F9P A;  2LXJ A;  3VYU A;  4L6T B;  3AMU A;  2NB0 A;  3VDY A;  2V5A A;  2D62 A;  1VQK A;  2EY5 A;  1G2W A;  4DV3 Q;  1V9P A;  5J2T F;  2CQO A;  1PH1 A;  2E75 C;  3I4N B;  1EEI D;  3T7A A;  1MKH A;  4DK3 C;  4CJ0 B;  5I5U A;  1UNS A;  1O7Y A;  1D2B A;  5FLX L;  5LMN L;  2W70 A;  2A69 C;  4GNX B;  2XGT A;  1STN A;  3OUZ A;  1YNJ D;  2A1H A;  1XDN A;  5EPJ A;  1L1O C;  4QF4 A;  2LSS A;  5D1O B;  3P75 A;  2CVR A;  2K05 A;  4JI2 Q;  1T5X D;  3HBL A;  1N36 L;  5IYZ F;  1QZH A;  1FD7 D;  2B8F A;  4O82 A;  4EQP A;  4O4H F;  1OXT A;  3HFZ B;  1SJH D;  2C35 B;  1I50 B;  1V8Q A;  4KTA A;  3RFC A;  3RLN A;  3E5N A;  5COR A;  3ETH A;  2M2L A;  2NN6 G;  4DR1 Q;  4I50 F;  3MXP A;  2NN6 I;  3ERS X;  2EVB A;  2JEA I;  1XPO A;  3MXU A;  2PQA B;  3VYT A;  4IN3 A;  4X66 Q;  1DCZ A;  4LWC A;  3VPC A;  4GKK Q;  5AFW A;  1WTH A;  2UU9 Q;  3NXW A;  3P7J A;  2A6H D;  2NZO A;  2PW5 A;  2ODT X;  4MA5 A;  4ME5 A;  2R7N A;  2JA5 H;  4J1M A;  4QL5 A;  5DNF A;  4O2D A;  1NE3 A;  1J8I A;  4YAK B;  1K83 H;  4LW1 A;  2ES2 A;  4LF9 Q;  5GAE C;  3BDL A;  3M3Y B;  4MTK A;  2F03 A;  1EZ6 A;  1JE5 A;  3J7A V;  1IBL L;  3PO2 B;  1IBM L;  4TKO B;  2F0W A;  2FXQ A;  4ILW A;  3BYY B;  1M8A A;  1IBK Q;  2ABJ A;  2VY3 A;  4RGM A;  1SRU A;  2QDL A;  2RF4 A;  1B4O A;  4IPG A;  1Z9F A;  4UP9 A;  5C4Z A;  1GUO A;  1HRJ A;  2RA4 A;  3K3P A;  1KAW A;  3BJU A;  4BXX G;  4DGZ A;  4DR5 L;  5BPF A;  1HFG A;  1Y1W B;  2GQS A;  2LKV A;  4Q5V A;  3L9A X;  1PLF A;  1I6V C;  5ELB A;  2YZG A;  1GOZ A;  4DK0 A;  3A5U A;  1JIC A;  4YJ2 F;  3CAM A;  1LTL A;  2DGY A;  1GLV A;  2I46 A;  5GQO A;  2VUM H;  4K14 A;  1IL8 A;  1QUQ A;  2OXP A;  4GOP B;  4HNV A;  2HQL A;  5LOV F;  1V1P A;  4FYD A;  3U0G A;  4CHT B;  1EIG A;  4YAJ B;  4JI1 Q;  4CE5 A;  4IOA A;  1ET6 A;  4H7B A;  2R85 A;  2DNC A;  1NJI C;  5J2U F;  5C1O A;  1CE8 A;  5JVH 3;  2NVT H;  1PH8 A;  4YWL A;  1DON A;  1O7L A;  3H0G G;  3U50 C;  4FFO A;  4A3G G;  2IY5 B;  1JDE A;  2G9D A;  5LXT F;  1W96 A;  1YNJ C;  2K4K A;  1JWS D;  3SDZ A;  3EN2 A;  3NBH B;  2D0O A;  4DV4 L;  2J9G A;  1SE4 A;  1WD1 A;  1GHK A;  1HTL D;  2EDG A;  3Q2O A;  5IWA L;  1E2Z A;  1WCM B;  3STB D;  5D8D A;  5DIS C;  4A3E H;  2B2V A;  2EY6 A;  1JMC A;  2Z8L A;  1HNZ L;  4PBC A;  4LNQ A;  3J7A 5;  1L1O B;  5C4H A;  3J81 c;  4QIW E;  4QUF A;  2GLT A;  1HR0 Q;  1XTC D;  1P16 A;  5M3F G;  3KFU A;  4X64 Q;  3N8D A;  2COI A;  2VB2 X;  3M4P A;  1B2T A;  3MJF A;  4LF4 Q;  1DOK A;  2B39 A;  2BA0 A;  2K03 A;  4P75 A;  3DM3 A;  1D5X C;  2R7Z H;  2HVS A;  2A6H C;  4XTC S;  1H9S A;  4IFD G;  1W6K A;  3BZD B;  1HPC A;  5C0X G;  4IFD I;  1VKZ A;  1GXD C;  1LT4 D;  4UPA A;  5C0X I;  5K36 G;  3HOV G;  4IJL A;  3E0E A;  4KD3 A;  4UCR A;  1FJG Q;  3KF8 B;  1TWF B;  2R93 H;  1MBY A;  2HDL A;  5CMD A;  4O4L F;  1HQR D;  1CZG A;  1GSA A;  5CA1 F;  2WIN B;  2YTV A;  2CWA A;  3I12 A;  4OWW B;  3HOU G;  2NVY H;  2OWO A;  4HTO A;  1VQE A;  5G3L F;  1KTK A;  2CH4 W;  2IW3 A;  4FDB A;  3NK9 A;  3CC7 A;  3TBI B;  3NUA A;  2LFN A;  2F0S A;  3IRB A;  1HHV A;  5JJZ A;  3IFT A;  5DM7 3;  4KY5 A;  1G8Z D;  3E5S A;  1ZYR D;  5HUR A;  3GO5 A;  3K0Y A;  2BH8 A;  4RG1 A;  4XX0 B;  3K58 A;  2RSO A;  5I9P A;  3P20 A;  2I07 B;  2B63 B;  3S1Q B;  4HTH A;  5FKA C;  3VA7 A;  5C3E B;  3VYS A;  4LF8 Q;  1SSO A;  4UCV A;  3A56 A;  3NTH A;  2QW7 A;  4ZRZ A;  3PO3 H;  1OXX K;  4DR4 L;  5JEA G;  5CV5 A;  1CT1 D;  4KHV A;  3W1G A;  3M7N A;  5K3W A;  4NXM Q;  4PMC A;  4LFC L;  4Y52 H;  3AFP A;  4XYM B;  3FMC A;  1I6H H;  2K28 A;  1EYC A;  3FDT A;  4JV5 Q;  2NZ1 D;  1SNM A;  4X62 Q;  4ABN A;  3SK4 A;  3ERO A;  1B1Z A;  1QWY A;  1MJE A;  3T9A A;  5E7N A;  1ESR A;  4GN4 B;  2PN1 A;  1BVS A;  2ID0 A;  2PI2 E;  4KV6 A;  5NUC A;  4PV1 C;  1PZI D;  4BY1 B;  1CUK A;  2KCN A;  5EJW A;  4HAE A;  2QA4 A;  2L11 A;  2AUK A;  1X32 A;  3U4Z A;  1D6E C;  3HGB A;  5EBD A;  2KJX A;  4JI5 Q;  3E6Z X;  1KTA A;  1C3O A;  1KBL A;  3NQI A;  3MZ5 A;  3BA9 A;  4QMG A;  3CF5 A;  3HOX B;  1PFM A;  3GTM B;  1A62 A;  4LFA L;  3CW2 C;  1GGO A;  1IYE A;  2JA5 G;  2GA4 B;  1U4P A;  4C1N I;  4DA2 A;  1SND A;  1R9T H;  5KIX A;  4IIJ F;  2K5W A;  1RD9 D;  2XD4 A;  1I7L A;  3T9D A;  2F0K A;  3H3V C;  4IUV A;  5IYD H;  4NZN A;  2EJG C;  3UDF A;  2PPB C;  3EFX D;  5C4J H;  2UUA Q;  3TS2 A;  2ZXO A;  5A2Q L;  4DV6 Q;  1N34 Q;  1TWH B;  4O7R A;  4UAI A;  1ASY A;  1A3T A;  1E22 A;  1PFN A;  4QY7 A;  3OUU A;  4JYA Q;  2K14 A;  4GKJ Q;  4DNT B;  2VQF Q;  5E1F A;  4ZUJ A;  3Q1K A;  3GDE A;  1N8R C;  2HG8 A;  4O7L A;  3T9B A;  2CNU A;  2GPW A;  2P0A A;  3LWE A;  3HKS A;  5FLX E;  2MGS A;  1ZYR C;  3JAM i;  4CBV A;  1A2T A;  3NE5 B;  2F0M A;  1F9R A;  2A6E D;  2SEB D;  3BZC A;  3GV3 A;  4YCW A;  2X5R A;  2VS1 A;  4LMQ D;  3TME A;  1FNW A;  4C3I G;  2JA7 B;  3TEH B;  4A3K B;  5I5S A;  2E74 C;  3OMG A;  4A3J H; 
#chains in the Genus database with same CATH homology
 1RL2 A;  4WJ4 A;  1SFO H;  3UDI A;  4JOI C;  4IOC A;  2NVX H;  4JYA L;  4GKJ L;  2VQF L;  1HZA A;  4YWM A;  1I3Q H;  3J7A 5;  1PH5 A;  2K75 A;  1VQD A;  2JK8 A;  3S24 A;  1YEZ A;  3F2B A;  3TQY A;  1V1Q A;  2E5L L;  2Q2U A;  4DR2 L;  4JCV E;  3J80 c;  2ZTD A;  4DR6 Q;  4DAM A;  4JOI A;  3S15 H;  3HOW H;  1P8L A;  3AQQ A;  4C3H H;  2K5V A;  5LMU Q;  2WB1 E;  5IYD G;  2KCM A;  4DUY L;  1GVP A;  1XNQ L;  5M3M H;  5M5W H;  3SGI A;  4OON A;  2UUB L;  3GTG H;  2UUC Q;  4QJF A;  3G71 A;  1N36 Q;  4LF4 L;  2BH2 A;  1TAE A;  1XPR A;  2ZJR A;  1VQ7 A;  1HNX Q;  3CCQ A;  1LM0 A;  3ULP A;  2VL6 A;  4HIK A;  5JJI A;  1G6P A;  2OQK A;  3OTO Q;  1KQS A;  4UCO A;  2DUD A;  1E24 A;  3Q8D A;  3M4Q A;  3KJO A;  3RNU A;  4BY1 H;  4LF6 L;  1UE7 A;  4NPS A;  5ELN A;  5DLQ E;  3H3V H;  1TA8 A;  3S14 H;  3M4O H;  5C44 G;  1YJ9 A;  3JSN A;  4PZ6 A;  5BR8 Q;  1S40 A;  1FJG L;  2B63 G;  1SE8 A;  4GN5 A;  1E3P A;  4A3F H;  2BA1 A;  5C3E G;  3CME A;  1HJP A;  2GVB A;  1XMQ L;  1M90 C;  3G48 A;  3HOX H;  3ULL A;  1B04 A;  1EIF A;  4BY7 H;  4E6N A;  2CWP A;  2PMZ E;  1SR3 A;  1YHA A;  3PUW A;  4GS3 A;  5IYC G;  1C7Y A;  2UUC L;  4A3J G;  1PYS B;  1VCI A;  1HNX L;  4BXX H;  4DV1 Q;  1IZ6 A;  4JBM A;  3KDF A;  1Q7Y C;  2CCZ A;  3L2P A;  4LH6 A;  2I5M X;  3OTO L;  1VQ5 A;  2N8N A;  2UXB Q;  3DLL A;  1TWC H;  1KHI A;  2NZH A;  3A5Z B;  4JI7 Q;  2RHQ B;  4BBR H;  1B70 B;  1XNR Q;  1NTG A;  1Q1E A;  4B3S Q;  3QWU A;  4GNX C;  3HOW G;  3FKI H;  4AIM A;  5FLM G;  1VQI A;  1X65 A;  2F52 A;  1XMO Q;  4DR3 Q;  4A93 H;  3FP9 A;  3PF4 A;  1TWH H;  4P71 A;  4A3I G;  1J6Q A;  3MEF A;  1KIX A;  4H02 A;  2AHO B;  1YIJ A;  1LUZ A;  3I7F A;  1KRS A;  4GNX A;  3PUY A;  4DR5 Q;  3TS0 A;  3KF6 A;  3CPF A;  3GTP H;  1W3S A;  3CCV A;  3STB C;  5IP7 H;  1WI5 A;  2UUA L;  5D1O A;  2WAQ G;  4BY1 G;  4DV5 Q;  2YTX A;  2UXB L;  3I56 A;  4AQY L;  4QQB X;  3OYY A;  2WP8 J;  1U5K A;  1PH3 A;  4A3G H;  2MFI A;  3CCJ A;  1XNR L;  3RLO A;  2PNH A;  3CPW A;  4DKA C;  5IP9 H;  3S1R H;  1QVC A;  2JA8 H;  1C0A A;  5D1P A;  4A3F G;  4MZ9 A;  4JI0 L;  1FL0 A;  1XMO L;  1B8A A;  2D0P A;  4LUO A;  1N9W A;  4DV0 Q;  4A3K H;  4DR3 L;  3HOX G;  2MNA A;  2WFW A;  1TXY A;  2E8G A;  1HNW Q;  1CSQ A;  2YU9 H;  3D31 A;  3RTX A;  1LYL A;  1BKB A;  1E7Z A;  1VQB A;  4IO9 A;  1WFQ A;  4IPC A;  1YIT A;  2PQA A;  2NVQ H;  3GTO H;  3NBY B;  2R7F A;  4JG2 A;  4GLV B;  1W2B A;  3ULJ A;  3ICE A;  3PGZ A;  4DV5 L;  1YHQ A;  1L0W A;  1K8A C;  3CXC A;  3RN2 A;  4CC5 A;  5GAG C;  3CCR A;  2E2I H;  3HOY H;  4JI8 Q;  3GD7 A;  4HJ8 A;  3FKI G;  3OW2 A;  3CQZ H;  2K52 A;  4DK6 C;  1G51 A;  5FJ8 H;  2ZTC A;  3J81 i;  1WOC A;  4B3M Q;  1L2F A;  3K81 C;  5M5Y H;  1AE3 A;  1VQ6 A;  1HNW L;  1KC8 C;  1Q12 A;  2JE6 I;  1J5E L;  1Z47 A;  3J7Z C;  4A3M H;  4HTP A;  1X3E A;  4BA1 I;  3RZD H;  1EYG A;  3KYH C;  4YWK A;  3FHW A;  3NEM A;  5IP7 G;  5JJK A;  4PZ7 A;  3HOV H;  4DV2 Q;  2KEN A;  4RMF A;  3PIP A;  1PH2 A;  1HNZ Q;  1N32 Q;  1Q46 A;  2WB1 G;  2Z6K C;  3S2H H;  1VQN A;  2YTY A;  3LGJ A;  1D8L A;  4TVA B;  2IHE A;  5IP9 G;  2JA8 G;  4JI8 L;  3H15 A;  4PMW A;  1K0R A;  3L0O A;  4GN3 B;  1UE5 A;  4X65 Q;  2JA7 G;  2UXD Q;  4A3K G;  2AMC B;  4JBW A;  2Z6K A;  1GKH A;  2KHI A;  1N34 L;  3VNN A;  4P72 A;  1EFW A;  2ZM6 L;  3CCS A;  3ZJY C;  4GOP C;  1ASZ A;  3PUV A;  4MTN A;  4HJ7 A;  4A3D H;  4DPG A;  1EUJ A;  1CKO A;  2Z0S A;  1CSP A;  3GTJ H;  3CMA A;  1YI2 A;  1QVG A;  2RHS B;  3K80 C;  4KHZ A;  1T9H A;  4UP7 A;  5LMN Q;  1AH9 A;  2EXD A;  3GJX B;  4GOP A;  4A3L G;  1GM5 A;  1N32 L;  1E1T A;  4ME3 A;  2AWO A;  2CKZ B;  3KDF B;  5AJ3 L;  2LXJ A;  1PH7 A;  5H1S E;  1Y1V G;  4C2M H;  4Y7N H;  2HIV A;  3VDY A;  4DV7 Q;  1RIP A;  2D62 A;  2VQE Q;  1VQK A;  1KXL A;  3UQ8 A;  1MIU A;  4P73 A;  3KJP A;  4DV3 Q;  1HZ9 A;  3PCO B;  1V9P A;  2KCT A;  1X6O A;  2MO0 A;  2CQO A;  1O7I A;  3B6Y A;  3JC6 6;  1PH1 A;  1TWA H;  3G4S A;  4A3M G;  4JI4 Q;  2QGQ A;  4LFB Q;  5GAD C;  1MKH A;  4ALP A;  4DK3 C;  4EQ5 A;  4YHH Q;  3CC2 A;  3JAM c;  3TY8 A;  5LMN L;  3NEL A;  4GNX B;  5JJL A;  2XGT A;  5IYB H;  3PO2 H;  3KF6 B;  1CKN A;  1XDN A;  1L1O C;  4TQU S;  4DR6 L;  4DR7 Q;  2LSS A;  1NMF A;  4AYB E;  5D1O B;  5LMU L;  4R4C A;  4EFB A;  2ASB A;  4JI2 Q;  1X9N A;  1PFS A;  4DV7 L;  1GD7 A;  3T1H Q;  1IXR A;  3S17 H;  5HY6 A;  1H95 A;  2K50 A;  1N36 L;  4DR4 Q;  3PUZ A;  1L1O A;  4A3D G;  1QZH A;  5ELO A;  3TRE A;  3K7A H;  2OQ0 A;  4LFB L;  1OXT A;  4JI4 L;  3HFZ B;  3S16 H;  2C35 B;  1XTD A;  3MXN B;  4YCV A;  3BA8 A;  4L5S A;  3GB8 B;  5FPR A;  4LFC Q;  3RLN A;  1NY4 A;  1VQ8 A;  2A8V A;  4P74 A;  4DR1 Q;  2NN6 G;  4KI0 A;  3S2D H;  3RR5 A;  1IBL Q;  2YV5 A;  4OO1 G;  2NN6 I;  3ERS X;  1S72 A;  1XK5 A;  4OO1 I;  4LH7 A;  1YHB A;  3NEN A;  1IBM Q;  5BR8 L;  2JEA I;  1XPO A;  4L5R C;  2PQA B;  3KOJ A;  4LF7 Q;  4X66 Q;  5M3M G;  1PH4 A;  1VQF A;  1CKM A;  4LWC A;  3BAA A;  4PG3 A;  2E2J H;  4JI2 L;  4GKK Q;  3T1H L;  4B3R Q;  3M85 A;  2UU9 Q;  2KBN A;  2NZO A;  4DAY B;  4R4I A;  1JB7 A;  3W1B A;  4QL5 A;  2JA5 H;  4O2D A;  1NE3 A;  4DV1 L;  2R92 H;  2QEX A;  1VQM A;  3HOZ H;  1K83 H;  4LW1 A;  2ES2 A;  4LF9 Q;  5GAE C;  3I4O A;  1A0I A;  4MNO A;  4PZ8 A;  1QZG A;  1SN8 A;  5FLX c;  2UXC Q;  3H0G H;  3H3V I;  2JEB I;  4JI7 L;  2ZJQ A;  1JE5 A;  2K5N A;  4DR1 L;  1K73 C;  1IBL L;  3U58 A;  1PVO A;  4B3S L;  2AKW B;  1IBM L;  4UCS A;  1PHJ A;  2FXQ A;  1VQL A;  2HVR A;  1IBK Q;  2OCE A;  2Y0S E;  4OWX B;  2VY3 A;  1JJ2 A;  1SRU A;  4LF7 L;  2N3S A;  1EWI A;  2RF4 A;  4IPG A;  2JA6 H;  5J3B A;  4BY7 G;  2OTJ A;  1Z9F A;  4WJ3 M;  4LFA Q;  4UP9 A;  4LUZ A;  2UU9 L;  1KAW A;  3BJU A;  4A3C H;  3ER0 A;  1HR0 W;  4BXX G;  3BAB A;  4DR5 L;  1Y14 B;  4POG A;  4JBJ A;  3PUX A;  4R1J A;  2H5X A;  2ATW A;  1KL9 A;  3A5U A;  4LF9 L;  2MO1 A;  4BBR G;  2UXC L;  3CAM A;  2A19 A;  1EOV A;  3CCL A;  1A63 A;  2HVQ A;  1LTL A;  1EQR A;  2ALY B;  2DGY A;  2PI2 A;  1A8V A;  2RCN A;  1YNX A;  5GQO A;  1KRT A;  3E9H A;  5M3F H;  2VUM H;  4A93 G;  1IBK L;  4DV0 L;  1WJJ A;  1QUQ A;  4DV4 Q;  1VQ4 A;  4OX9 Q;  4GOP B;  3PIO A;  1YZ6 A;  2HQL A;  3I2Z A;  5IWA Q;  1X55 A;  2KHJ A;  1TWG H;  4JI1 Q;  3I4N H;  4HIM A;  4JI6 Q;  3UE0 A;  4IOA A;  3TY5 A;  2YYZ A;  1NJI C;  2R92 G;  3HOZ G;  3L7Z C;  1K8G A;  4EX5 A;  3CC4 A;  4K0K L;  3AYH B;  1JJC B;  2NVT H;  1PH8 A;  4YWL A;  4NXN Q;  3S1M H;  3H0G G;  3U50 C;  4A3G G;  1JT8 A;  2IY5 B;  2AWN A;  1Q1B A;  4K0K Q;  3BU2 A;  3T1Y Q;  5EAY A;  4HJ9 A;  2K4K A;  2R7D A;  2V1C C;  3EN2 A;  3J80 i;  3F2D A;  3RN5 A;  3NBH B;  2D0O A;  2JA6 G;  3HOU H;  4OX9 L;  4DV4 L;  4B3M L;  2F3I A;  2E2H H;  4LUV A;  1FVI A;  5IWA L;  1CKN B;  1HH2 P;  4A3C G;  1IYJ B;  3STB D;  1I50 H;  4BBS H;  4JI1 L;  4JI6 L;  1N33 Q;  5DIS C;  4A3E H;  4EEQ A;  4DV2 L;  2E5L Q;  4AYB G;  4NXN L;  1Q82 C;  1HNZ L;  1JMC A;  4UFZ A;  2B3G A;  5IY0 A;  4A75 A;  4LNQ A;  2XTI A;  3D0F A;  1L1O B;  3F1Z A;  2B63 H;  3HOY G;  1SMX A;  4QIW E;  3J81 c;  1HR0 Q;  1XNQ Q;  1XPU A;  1P16 A;  5M3F G;  3KFU A;  1MJC A;  2VUM G;  4X64 Q;  5C3E H;  1UWV A;  2ZJP A;  3BZK A;  2Q2T A;  4DNI A;  3M4P A;  5FJ8 G;  5GAH C;  4LF4 Q;  2JA9 A;  2BA0 A;  4X65 L;  4P75 A;  2UXD L;  3DM3 A;  1PV4 A;  5IT9 c;  2LXK A;  5HGQ A;  3UE1 A;  2R7Z H;  3GTK H;  3I4N G;  2HVS A;  4XTC S;  1DGS A;  4IFD G;  1VQC A;  3KLW A;  4YCU A;  4LF6 Q;  4IPD A;  5C0X G;  4IFD I;  4UPA A;  3M3Y H;  4HID A;  5C0X I;  5K36 G;  3HOV G;  1N33 L;  5C4X H;  4IJL A;  3E0E A;  4UCR A;  2EQS A;  4HJ5 A;  4R4T A;  1FJG Q;  5GRO A;  1SLJ A;  3KF8 B;  4YY3 Q;  3CCM A;  4A4I A;  4DUZ Q;  2R93 H;  2IX1 A;  4IJH A;  1X3G A;  5FLM H;  3HKZ E;  2GN5 A;  1XMQ Q;  1HR0 L;  1JJG A;  3A74 A;  2YTV A;  2CWA A;  3PV0 A;  4X64 L;  4OWW B;  4A3I H;  2R6G A;  1I94 Q;  1UEB A;  2VQE L;  3HOU G;  2NVY H;  2OWO A;  3TY9 A;  2MQH A;  1EIY B;  2I5H A;  4HTO A;  2A1A A;  3U4V A;  4LF5 Q;  1VQE A;  4KHP Q;  1Y1W H;  5M5X H;  4DV3 L;  3NC0 B;  3UDX A;  1S3O A;  1K3R A;  4BBS G;  4FDB A;  3K7U C;  4IFD J;  4DRF A;  2HT1 A;  3CC7 A;  5C0X J;  1PH6 A;  1UE1 A;  2VUG A;  2K5H A;  3IRB A;  4A3E G;  4YHH L;  1K9M C;  2GVA A;  4L5Q A;  2JJQ A;  2N49 A;  2Y0S G;  3GO5 A;  4CC6 A;  2BH8 A;  4RG1 A;  4YY3 L;  4DUZ L;  1OXV A;  1VQP A;  2IHF A;  3PN1 A;  4A3B H;  4DR7 L;  2B29 A;  4C3J H;  4R4Q A;  4B3T Q;  2F4V Q;  3GTM H;  4LF8 Q;  3CP0 A;  4UCV A;  3A0J A;  2EIF A;  1I94 L;  3S1N H;  4BA2 I;  2CFM A;  4UCU A;  2N78 A;  2R7Z G;  3PO3 H;  1OXX K;  4LF5 L;  4DR4 L;  4KHP L;  5JEA G;  3W1G A;  3F8T A;  4HJA A;  4AQY Q;  3M7N A;  1QUQ B;  5C4X G;  1XJV A;  4NXM Q;  3CD6 A;  3I4M H;  4LFC L;  1QVF A;  4Y52 H;  1VQH A;  3AFP A;  2OTL A;  3PO2 G;  5IYB G;  4UP8 A;  2R93 G;  1I6H H;  5FPO A;  2ZTE A;  1OXU A;  3PF5 A;  2I0Q A;  1OTC A;  4JI0 Q;  2Q2H A;  4JV5 Q;  4OWT B;  4X62 Q;  4X66 L;  3TRZ A;  3RLF A;  2F4V L;  4B3T L;  4LF8 L;  1WCM H;  4GKK L;  1MJE A;  4B3R L;  1Q8K A;  1YVC A;  4EFE A;  5E7N A;  1Y1W G;  4GN4 B;  4JBK A;  1BVS A;  2ID0 A;  1HZC A;  5JEA J;  1UE6 A;  1NBW A;  1D7Q A;  4OXP A;  4KLK A;  1VQ9 A;  2PI2 E;  4GLX A;  1PA6 A;  1X56 A;  3CCE A;  1CUK A;  4NXM L;  2JQO A;  3JSL A;  3K8A A;  2QA4 A;  4JC0 A;  3GTQ H;  1Q86 C;  1U0L A;  3U4Z A;  1Q81 C;  2VW9 A;  1GO3 E;  4A3B G;  4JI5 Q;  4JV5 L;  2VNU D;  2JA7 H;  5LMN W;  4X62 L;  3RZO H;  3BA9 A;  4C3I H;  3CF5 A;  1AE2 A;  3J81 j;  5IE8 A;  1A62 A;  1J5E Q;  4LFA L;  1PYB A;  1SRO A;  3CW2 C;  3PO3 G;  4UCT A;  4NB3 A;  1I5F A;  1FGU A;  2HHH Q;  1VQG A;  4O0A A;  2JA5 G;  4JI3 Q;  1NMG A;  2IX0 A;  1R9T H;  1G29 1;  4QGU A;  1C9O A;  4HIO A;  3I4M G;  1YBY A;  1TWF H;  4A3L H;  1OXS C;  3GTL H;  2WAQ E;  2HIX A;  4AH6 A;  1Y1V H;  5IYD H;  1BBW A;  2L15 A;  3PSI A;  1V43 A;  3I55 A;  3AFQ A;  1VS0 A;  4JI5 L;  3UDF A;  4POF A;  2ZM6 Q;  4X6A H;  3E9I A;  5C4J H;  4J15 A;  1X3F A;  2UUA Q;  3TS2 A;  3AEV A;  1N34 Q;  1WCM G;  4DV6 Q;  4L5T A;  1YJN A;  3UDG A;  1E22 A;  4QY7 A;  1ASY A;  4JYA Q;  2K14 A;  4GKJ Q;  2VQF Q;  2HHH L;  1KD1 C;  2Q2I A;  3K0X A;  1HZB A;  4JI3 L;  1X54 A;  2IT1 A;  4A76 A;  3G6E A;  3GDE A;  1N8R C;  3HKZ G;  4DR2 Q;  1VQJ A;  4XIG S;  5C44 H;  3EBE A;  1VQO A;  1IL2 A;  1BBU A;  3HKS A;  5AJ3 Q;  3S1Q H;  4R4O A;  3JAM i;  4UY8 C;  4GLA C;  1M1K C;  4DUY Q;  3CCU A;  3W5O A;  3T1Y L;  1EQQ A;  3WWV A;  2UUB Q;  3NBZ B;  3BZC A;  2I5L X;  3M9B A;  4YCW A;  1WYD A;  2VS1 A;  1S68 A;  1VQA A;  4IPH A;  1YJW A;  3TEH B;  5IYC H;  3F2C A;  1E1O A;  3EIV A;  4APV A;  1PH9 A;  1B7Y B;  4A3J H;  2VZA A;  4DV6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...