3W1BA

Crystal structure of human dna ligase iv-artemis complex (mercury derivative)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
600
structure length
589
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords DNA ligase 4
total genus 178
structure length 589
sequence length 600
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1bA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1bA02
1YHBA 5D1OA 4JYAL 4UCOA 2JA9A 4DV6L 3LGJA 3E9IA 3K0XA 4JOIA 2N78A 1PH8A 3G48A 3S15H 4R4OA 4JI7Q 3J7ZC 1KAWA 3PF5A 2Q2TA 3I4NH 2NN6I 1MKHA 3M3YH 5IYDH 3F2DA 4LF8L 3HKZE 1G291 4DR7L 3G71A 4DUYL 4A3DH 1PH4A 2N3SA 1XMQQ 3E9HA 2ZTCA 1PH9A 1XMOQ 3EIVA 1WJJA 3KDFA 1X6OA 4QJFA 4OWTB 2E2JH 4HJAA 4IFDG 2QGQA 2IY5B 3J80c 3EN2A 4KHPQ 4DKAC 4A3CG 1HR0Q 1XMQL 4DR6Q 1BBUA 2BA1A 3Q8DA 4MZ9A 4A4IA 3CCUA 3HOYH 1N34Q 2JA5H 3KF6A 3AEVA 3HOWG 1N8RC 1WI5A 4B3MQ 4KLKA 1C0AA 4LUZA 4KI0A 3J81i 1Q8KA 1VQ7A 3FKIH 2VQFQ 3S17H 2MNAA 3I4NG 2K5VA 2AWNA 5LMNW 1XPOA 1KQSA 4NXML 4LW1A 5IYDG 3CC2A 1PH6A 4DV5Q 1I50H 1BKBA 1VQEA 1S3OA 2EIFA 4BBRH 1V9PA 4HJ9A 2OTLA 4A3DG 4IFDI 4BY1H 1NMGA 2HHHQ 1N32Q 3VNNA 3M4OH 4JI1L 1MJEA 4JI3L 1K73C 2WAQG 1LM0A 3AFPA 2RHQB 2ZM6L 4LF6L 2JQOA 3HOVG 1HNWL 3GB8B 1U0LA 3JC66 4BA2I 2DUDA 3S1NH 5C0XJ 4A3GH 3TY9A 5GAGC 3ZJYC 3RN2A 2K5NA 1J6QA 5IYCG 3HOUG 4LH7A 1C7YA 4X6AH 3S1QH 4JC0A 3KOJA 2CFMA 2JK8A 3HOXG 4PZ8A 3HOVH 2ZTDA 1Q81C 3ICEA 3T1HQ 3I2ZA 2JEBI 3KF6B 3M4PA 4JCVE 3U4VA 3PIPA 4LF6Q 3HOZH 2JEAI 4BBRG 4C3HH 3CF5A 2BH2A 2CCZA 5AJ3Q 4QQBX 1ASYA 3CMEA 1UE5A 2I5HA 3SGIA 2CWPA 2ES2A 1GD7A 1GO3E 3CPFA 3F8TA 5IE8A 3CC4A 1X3GA 1RIPA 2LXKA 2HT1A 4B3SL 4B3TL 1VS0A 1I3QH 2XGTA 3M9BA 1WOCA 2R7ZH 4WJ3M 1KRSA 3D31A 3NENA 3GTOH 2E5LQ 1OXXK 4X64Q 4DV4Q 4Y7NH 3GTLH 1YJ9A 4XTCS 1VQ8A 4A76A 3BA8A 4DR4L 1Y14B 5IP7G 5M5WH 2VQEL 1HJPA 1TWGH 1V43A 5EAYA 4GLVB 5JEAG 4DR1L 1XNRQ 2RHSB 2VY3A 4C2MH 4LFBL 3FKIG 2A8VA 2HVSA 4OWWB 4DV1Q 4ME3A 4JBMA 1TWCH 2IHFA 2NVYH 3K7UC 2GN5A 4P73A 1L1OA 3OTOQ 4A3JH 1N36Q 4A3LH 4E6NA 1JT8A 3PCOB 3L0OA 4PG3A 3PO3G 1EIFA 1YITA 4IOAA 3I4OA 4JI8Q 1LYLA 2NZHA 2F52A 4DR5Q 1M1KC 1HNZQ 2JA8H 4X62Q 3CXCA 3J81j 4DUZQ 2JA6H 2R92G 2YV5A 3CC7A 4DR3L 4EQ5A 2FXQA 3U58A 4JI8L 5GAHC 1YHAA 1WYDA 1A0IA 3CQZH 1XJVA 3MXNB 2VS1A 1VQFA 5IT9c 4BXXH 2UUCQ 2UUAQ 4EEQA 1N9WA 3IRBA 2MO0A 4YHHQ 1NJIC 1EYGA 5IP9H 4A3MG 3JAMi 4UCUA 5M5XH 2DGYA 2D0PA 3W1BA 4DV2L 4LF4L 5JJKA 5M5YH 4A3JG 1ASZA 4PMWA 1XNQL 2R7ZG 4B3RL 4KHZA 4ALPA 2AHOB 2A1AA 3PO3H 3CPWA 1IBML 1KL9A 1IYJB 1PFSA 3KF8B 4X65Q 4RMFA 3K80C 3KDFB 2R92H 4YCVA 1TAEA 3JSLA 1J5EQ 1SMXA 4PZ6A 5HY6A 4LUVA 2B63H 4A3BH 5JJIA 4IJHA 2UUCL 1BBWA 5GADC 1L0WA 4POGA 2UXDQ 1HH2P 2Z0SA 4DPGA 2OWOA 2K75A 1VQDA 1HZAA 2PI2A 3B6YA 3KYHC 1A62A 3T1YL 1L1OC 3OW2A 4K0KQ 4TVAB 3NBYB 3KJOA 3EBEA 3F2CA 4X62L 4HIKA 1M90C 1C9OA 2K50A 4HTOA 2KHJA 4OO1G 5D1OB 4YY3Q 1SR3A 4GNXC 3BAAA 4IPHA 2ASBA 2JE6I 3RR5A 1Y1VG 3ULPA 3PUVA 3HOYG 4JBJA 1OXUA 3KFUA 2PNHA 4TQUS 4HIDA 3UDIA 4R4QA 3GTKH 4L5TA 2ZM6Q 1PH5A 3H3VH 3UQ8A 1I94L 4DR1Q 5IP9G 3NBZB 2K4KA 4A75A 3PV0A 3S1MH 1FL0A 3D0FA 3U50C 1K8GA 3GJXB 4EFBA 3PSIA 4LF8Q 3PUXA 1VQLA 1G51A 5IYCH 1T9HA 4UP9A 3BZCA 4H02A 1Q1BA 2WFWA 4JI3Q 4BXXG 2KBNA 4JI0L 4X64L 4DV4L 4QL5A 1E22A 4JI1Q 2B63G 1PYBA 2Z6KC 1PH1A 3RZOH 1Q7YC 4GOPB 1Q82C 5GAEC 4B3TQ 5JJLA 4DV5L 4JI2Q 1SLJA 1Q12A 2R93G 2RF4A 1YEZA 4A3IH 3CCSA 3M85A 3I4MG 4GNXB 2BA0A 3CCEA 4LF9L 2ZJPA 3F1ZA 2VQFL 3CCQA 1QZHA 4DV0L 1PH2A 2WP8J 5K36G 4LF7Q 2F4VQ 3G4SA 3HOZG 4HJ8A 1I94Q 4A3LG 2WB1E 2F4VL 4DV3Q 3TREA 1FJGL 1QVCA 1RL2A 5C0XI 4MNOA 1PH3A 2WAQE 4A3BG 3S16H 3TS2A 4XIGS 1HNXL 1B70B 3TEHB 1Z9FA 1HNXQ 5D1PA 4X66L 3PGZA 3UE0A 1XPRA 3K7AH 3RLFA 4DV0Q 3S2DH 5FPOA 4YY3L 1CKNB 4GLXA 3PF4A 1VQHA 4AYBG 3T1YQ 3TRZA 3S1RH 1S72A 5J3BA 3L2PA 2GVBA 3NEMA 1PV4A 2UXDL 2UU9L 2CQOA 2HQLA 2NZOA 1X65A 4AH6A 2MO1A 3K81C 4GS3A 1AE2A 5C3EG 1EFWA 1VCIA 3S24A 3CCVA 4WJ4A 3TS0A 1EQQA 2UUBQ 2HVRA 2UXBL 2VZAA 4PZ7A 2JA6G 4JYAQ 4J15A 4NXMQ 1K0RA 1FVIA 1OXTA 4R4CA 4LFAQ 5BR8Q 1PH7A 4MTNA 5C3EH 3UDGA 2LSSA 4Y52H 1BVSA 4A3FG 2WB1G 3PUYA 3HOWH 2CWAA 1U5KA 1EIYB 2ZJQA 2K14A 1XPUA 4GKKL 4A3KH 1B7YB 3K8AA 4JI6Q 2QA4A 2Z6KA 2UUAL 4DNIA 2E8GA 1O7IA 4JBKA 4LF4Q 3J80i 2JA8G 1YNXA 1A63A 5FPRA 2YU9H 3W1GA 4L5QA 4R4TA 4LNQA 4UCRA 3ULLA 1YIJA 5JEAJ 1Q1EA 2K52A 3F2BA 1YBYA 1YHQA 2Q2UA 3TY5A 2D62A 2YTYA 3I7FA 4OONA 4DUZL 1YJNA 4DUYQ 4UY8C 1P8LA 3RZDH 4JI2L 3KLWA 3I4MH 3UDXA 1KXLA 2NVTH 1YZ6A 5M3FG 1CSQA 3AYHB 5FLXc 1E7ZA 4A3MH 5GQOA 1Y1VH 2IX1A 4IPCA 3L7ZC 3UE1A 4DAYB 3HFZB 4IPDA 3H0GH 1E24A 1CKNA 1SROA 4DK6C 4JI7L 3TY8A 2CKZB 1B8AA 1FGUA 1EOVA 3UDFA 1WFQA 3CW2C 4A3KG 3HOXH 2QEXA 4C3IH 5FLMH 1MIUA 1VQIA 3NELA 4GN3B 4POFA 4X65L 3PIOA 4NPSA 2KHIA 2H5XA 1VQNA 2E5LL 4NXNQ 1CSPA 5LMNQ 1GM5A 4YCWA 1IBMQ 1E1OA 2B3GA 5IYBG 2A19A 3E0EA 3DLLA 3GO5A 1QZGA 1H95A 4DR2L 3JAMc 1PHJA 4P71A 5IWAQ 1QUQB 4LF5Q 1PVOA 4A93G 1VQKA 4UPAA 1HR0W 3OYYA 2E2IH 2MQHA 1Z47A 5IYBH 1JMCA 1VQOA 2UXCL 1K3RA 1QUQA 2JA5G 1UEBA 4AYBE 5ELOA 5FLMG 2I5MX 4LH6A 3RTXA 3A0JA 3CP0A 2D0OA 5HGQA 3ERSX 5LMUL 1JJGA 3PN1A 1Q86C 3AQQA 1KRTA 5DISC 1K83H 5M3FH 2VL6A 2AKWB 1X3EA 4HJ5A 2RCNA 3BZKA 4JOIC 2LXJA 3RLNA 3TQYA 4HJ7A 1KIXA 4OX9L 3CD6A 1UE7A 1NMFA 4GKJQ 1DGSA 4FDBA 1TXYA 4A3IG 1XDNA 3BA9A 1JE5A 2JA7H 4DV3L 1FJGQ 4DR4Q 1VQMA 1QVGA 4BY7H 4IO9A 1JJCB 2I0QA 1S40A 2F3IA 1NTGA 1TWFH 1TA8A 2JJQA 2AMCB 3CAMA 3H15A 4O0AA 5FJ8G 2UUBL 4BBSG 4JBWA 1X55A 3CCRA 2B29A 3RLOA 2VUMH 1MJCA 4C3JH 1G6PA 2OQ0A 2HHHL 1N32L 2R93H 4YWKA 1NE3A 4QIWE 4GNXA 4GOPC 1VQBA 4B3SQ 3GTGH 1E3PA 2PQAB 2XTIA 1VQGA 4HTPA 4GOPA 3VDYA 4UCSA 2PQAA 4P72A 3W5OA 2N8NA 4O2DA 5IY0A 5AJ3L 3RN5A 1KC8C 1AE3A 4HIOA 1N34L 3GTMH 4L5SA 1KD1C 1OXVA 4JG2A 3T1HL 2VUGA 4DV7L 1A8VA 1YVCA 4IJLA 3FP9A 4IOCA 4LFCQ 4DV7Q 3FHWA 3CMAA 2R7FA 5ELNA 4JI6L 4GN5A 4YWMA 4A93H 1K8AC 2HVQA 1XNRL 2BH8A 1IBLL 3QWUA 1WCMG 4L5RC 3A5ZB 4UCTA 2R7DA 2Q2HA 5IP7H 1GKHA 1TWAH 3CCMA 4JI4L 4APVA 1SFOH 1X9NA 4UCVA 4LF7L 4EX5A 1K9MC 1UWVA 4JV5Q 1D8LA 1I5FA 3H0GG 5C4XH 1WCMH 2ZJRA 2IHEA 1SE8A 2YTXA 4BBSH 1SN8A 1KHIA 1IXRA 2KCTA 4DAMA 3I55A 4IFDJ 4AQYL 1SRUA 3HKSA 1VQJA 2UU9Q 4B3ML 1LUZA 4AQYQ 4A3EH 1S68A 4JV5L 3GTJH 4JI0Q 4GLAC 1HR0L 1Y1WH 2ID0A 3J81c 1VQAA 4LWCA 4BA1I 1VQ6A 3HKZG 4LUOA 3M7NA 5FJ8H 4X66Q 4UP8A 4JI4Q 2KENA 2OCEA 5H1SE 1IBLQ 4A3EG 3I56A 3NC0B 1XNQQ 3H3VI 1VQ5A 4DK3C 4OWXB 1AH9A 4DV2Q 1B04A 1Y1WG 1QVFA 2HIVA 4DR6L 2OQKA 4LFCL 2AWOA 1YI2A 4DR7Q 5C4XG 1YJWA 2V1CC 4YHHL 4KHPL 2EQSA 4RG1A 3PUWA 1HNWQ 3ULJA 1IBKQ 1W3SA 4YWLA 3CCLA 4GKJL 5C0XG 2VNUD 3PO2G 4A3CH 5LMUQ 3GTQH 1VQ4A 2GVAA 4BY1G 4EFEA 5C4JH 3CCJA 3S2HH 1XK5A 3M4QA 2MFIA 2Q2IA 4NB3A 1W2BA 2PMZE 5IWAL 1PYSB 4DR2Q 3DM3A 1XTDA 4K0KL 1HZ9A 2YTVA 2UXCQ 1UE1A 3MEFA 2JA7G 2L15A 1EUJA 1Q46A 5DLQE 3HOUH 1CKMA 3ER0A 1N33L 2R6GA 4QGUA 4JI5Q 3J7A5 4AIMA 4LF5L 2YYZA 4IPGA 3G6EA 2KCMA 4YCUA 1X54A 4NXNL 1J5EL 4R1JA 4JI5L 1X3FA 5LMNL 3PO2H 3JSNA 2NVQH 3GDEA 4CC5A 1CUKA 3STBC 3STBD 1PA6A 3BABA 1XMOL 5GROA 4A3GG 1R9TH 3AFQA 1NBWA 1NY4A 2UXBQ 4OX9Q 4DR3Q 1JJ2A 1HZBA 3NBHB 4UFZA 5C44H 1TWHH 4R4IA 1L1OB 3KJPA 4OXPA 4DR5L 2VUMG 3GTPH 2Y0SE 2IX0A 1X56A 1L2FA 4A3FH 1GVPA 4DV6Q 1P16A 2C35B 3OTOL 1IZ6A 4BY7G 1IBKL 1E1TA 2I5LX 3A5UA 4DV1L 1HNZL 3BU2A 3RNUA 1VQ9A 1VQCA 4GKKQ 2EXDA 4GN4B 1LTLA 2HIXA 2N49A 2NN6G 2Y0SG 5M3MH 2E2HH 4CC6A 2IT1A 1EQRA 2K5HA 1VQPA 1JB7A 3S14H 4OO1I 4HIMA 1N36L 2OTJA 1UE6A 1I6HH 1HZCA 1CKOA 2ZTEA 5E7NA 1OTCA 3A74A 1IL2A 2ALYB 4B3RQ 5C44G 2NVXH 4QY7A 4LFBQ 4LF9Q 3PUZA 3WWVA 1OXSC 3U4ZA 5BR8L 4P75A 5M3MG 1V1QA 4LFAL 2VQEQ 1N33Q 2ATWA 4UP7A 4DRFA 2PI2E 2VW9A 3BJUA 3GD7A 1EWIA 4P74A 1D7QA
chains in the Genus database with same CATH superfamily
4XQJA 4UCOA 1PH8A 3E3XA 4DV6L 3E9IA 1PZJD 3NE5B 3T9DA 2DN8A 3S15H 2XRSD 1PK8A 1O7ZA 3A8KE 1SNQA 3CU7A 1EZ6A 2PZUA 1ZKOA 2R85A 1Y1WB 1Y8OB 1AEXA 4DUYL 4O7RA 1XMQQ 3E9HA 1G2WA 2R82A 2ZGIA 1EEID 1LT3D 1TU2B 4DGZA 1XMOQ 4O86A 2GLTA 5I60A 2EYPA 1XWEA 4B9XA 1BBUA 4ZQIA 2GQSA 3FMCA 4QUCA 3AEVA 1WI5A 1K8MA 5CR3A 3J81i 2W6MA 4ZOLF 1Q8KA 2R3ZA 2VQFQ 1S5BD 2MNAA 2K5VA 1H9MA 1XPOA 4J1MA 1CQJB 2QILA 4CDDC 5I4DA 4DV5Q 3OW7A 4TM5A 2EIFA 1BKBA 2MUYA 1S3OA 5G3LD 2NB0A 4IFDI 5IGGA 2WKCA 3TDQA 3M4OH 3CEBA 1SMYD 3H09A 4JI3L 1K73C 1SYGA 2JQOA 5GONF 3X3MA 1PFBA 5LXTF 3S1NH 3SK8A 1JDBB 3S1QH 2CFMA 2JK8A 3ZYYX 1B1ZA 1FR3A 3T53B 2ZTDA 3HOVH 3T1HQ 5HV6A 5KIXA 2MHVA 4C3HH 3CF5A 5AJ3Q 4QQBX 5JAVA 2QDLA 1WTOA 3DMUA 1GO3E 5IE8A 1RIPA 2F3VA 1EU3A 4B3TL 1VS0A 1I3QH 3T9CA 3OPOA 1WOCA 4WJ3M 2JXMB 3NENA 4A3IB 3GTOH 4Y7NH 1VQ8A 4A76A 2H4OA 4YBZB 5E1FA 4MIUA 5IP7G 2VQEL 1HJPA 1DV1A 2FMMA 4DR1L 3GV6A 2RHSB 4C2MH 2EOTA 2A8VA 1H9KA 4OWWB 3S16B 2NU9B 1C30A 2FMCA 4A3LH 4E6NA 2O4XA 2F03A 4I55F 3DWAA 3I4OA 1LYLA 1ESFA 5CBAE 4DR5Q 5LOVF 3CXCA 2I80A 2EY5A 2A68C 2PMZB 5E25A 3U58A 4JI8L 3BZDB 5GAHC 3VOTA 1WYDA 4Y8VB 1A0IA 1XJVA 1GUTA 2F0GA 1MHWC 2L5TA 3AMUA 1F77A 3T56B 3D4RA 2F0TA 4C1NI 1UC8A 4R8NA 5CMDA 5M5XH 2DGYA 3W1BA 5C3EB 2J7ZA 4OL7A 3I12A 3K58A 3HOWB 3U54A 5CB4F 2A1AA 3H6MA 3H3VC 2DLNA 3VR6A 3VA7A 4X65Q 2F0KA 3KLRA 3K80C 1J9OA 4YCVA 3JSLA 4LUVA 4ZQ3A 4POGA 2LFNA 5C1OA 1LV9A 4WJWA 5I5UA 3I4MB 1VQDA 3B6YA 4UCSA 5CAEB 1L1OC 1JICA 4TVAB 5JVLA 4ILWA 3EBEA 3F2CA 5JEAH 1LT4D 4HTOA 3HT5A 2O5JC 1E2ZA 2ASBA 1G8ZD 3HOXB 3UDIA 3LWEA 4L5TA 1IL8A 1JQYD 5IP9G 3VPCA 2B2UC 1FL0A 3D0FA 1K8GA 1SYDA 4IUUA 1BCPD 4QSHA 2I07B 4UP9A 3BZCA 1S5CD 4KJNA 2EE1A 4BXXG 2F4IA 5J39A 1E22A 2A6EC 1PYBA 4AYBB 4H13C 2COJA 4B3TQ 5JJLA 2TMPA 4KY5A 1SLJA 3I4MG 5I5TA 2BA0A 3CCEA 4CMFA 2ZJPA 5M3FB 3CCQA 1HA6A 3TEKA 3GV3A 2EYHA 2QF7A 4A3LG 1Z2NX 4F87A 3TREA 1BR9A 3MWEA 5FNVF 1SBBB 3ND9A 1HNXQ 4X66L 3D6CA 1STYA 3S2DH 4UDUC 3HKZB 3SEBA 2W6OA 1VQHA 1A3UA 1B53A 1S72A 2KEEA 4ZYSA 3L2PA 2CQOA 3MWYW 3KALA 1C48A 1X65A 5HBRB 3NTIA 5I47A 4HN7A 3C46A 3K5IA 2B2VC 4NKLA 4RGOS 3TS0A 2VQDA 2UUBQ 2VZAA 4PZ7A 4JYAQ 4L6TB 1FVIA 1PH7A 2DJGC 2LSSA 5M5YB 1BVSA 4MTKA 2XCLA 3PO3B 5C3WA 4C5AA 2CWAA 4O1NA 1II3A 1EIYB 4HSVA 4A3KH 1DZ1A 2DIKA 1PRTB 3G8DA 5CE8A 2E8GA 1O7IA 4A93B 1YNXA 4PQXA 3SR1A 1QG7A 5I5YA 4F7XA 2YU9H 1OO9B 4L5QA 1U4LA 2KEDA 5JEAJ 3F2BA 1YBYA 2F0LA 3TY5A 2D62A 3I7FA 4OONA 2LS01 1YJNA 2L55A 4DUYQ 1EKFA 3RZDH 3KLWA 5C4XB 2HD3A 3UDXA 3Q24A 5BYAA 1YZ6A 1CSQA 4XYOA 1GSAA 5GQOA 2R7MA 2BE5C 2X5RA 2CH4W 3OUUA 4IPDA 3HFZB 1STAA 1B8AA 1FGUA 1EOVA 3NXWA 4A3EB 2L9HA 1JORA 3GTJB 2QEXA 4C3IH 3VYRA 3MEHA 4POFA 1KJIA 2B2VA 1ULZA 1E2VA 1XTCD 4FU0A 4YCWA 4HSPA 2B3GA 1SJED 1H95A 2KUMA 4DR2L 2RDHA 4P71A 2RVLA 3F2UA 4A93G 4DXGA 1LT6D 3DWPA 1SYBA 3SK6A 5C4JB 1EKPA 1JCKB 1K3RA 2JA5G 1UEBA 3ORRA 3I73A 2I5MX 1R4QB 2B8GA 2F0UA 4HAEA 3CP0A 4WBNF 3ERSX 4IZOA 2Y0SB 4XYQA 5DISC 4EQOA 2VL6A 4ME6A 1X3EA 3SNOA 1IW7D 3DXJC 2RCNA 3BZKA 3TBIB 2LXJA 4HJ7A 1KIXA 1EL0A 4O7SA 4GKJQ 3N8DA 4FDBA 2CVRA 1JWMD 1RTOA 3WOEA 4DV3L 4DR4Q 1DOMA 4IO9A 1JJCB 1QOHA 3NUAA 2F3IA 4CGYB 5I5WA 3K7AB 1TT2A 5D3IB 3H15A 4DA2A 3CCRA 2VUMH 3RLOA 1MJCA 1I2KA 1KJJA 3KAKA 2M9VA 1L0XB 2HHHL 2IWHA 4YWKA 1NE3A 4QIWE 4O7NA 2PQAB 4TKOB 3R9RA 1FYCA 2HG8A 1EFID 1KC8C 4HIOA 1CZGA 2IJ0A 2EYJA 1D5ZC 3J7YW 1PTOD 4IOCA 3FP9A 4KY7A 4LFCQ 1I4RA 4DV7Q 2F0SA 1G2TA 1E0BA 4RA8A 3K3PA 4JI6L 4YJ3F 1KLGD 2Z9HA 2BH8A 2O2LD 2XD4A 1WCMG 3OUZA 3QWUA 3EVQA 3OMGA 5IGBA 3CCMA 1SFOH 1X3PA 1F2ZA 1KNEA 1UWVA 4TSSA 3V96A 2IHEA 1SE8A 4FFMA 1IXRA 3I55A 4CKBA 2IPKD 2UU9Q 4B3ML 1T5XD 4EQNA 1LUZA 2O5IC 5BYBA 4Q4CA 1EUDB 1YNJC 4IZ8A 1Y1WH 2ID0A 1VQAA 1HQRD 1DXMA 2P5ZX 3M7NA 2RKSA 2P0AA 1SEBD 1RDPD 3I56A 3NC0B 2F0NA 1AH9A 4HNTA 3EJIA 4DV2Q 1B04A 3E0JA 1QB5D 4LFCL 1IKLA 2GPSA 1YJWA 4YHHL 3OMCA 3AX6A 4MV1A 1IBKQ 2VNUD 3CCLA 1B44D 2F3WA 3PO2G 1PDQA 4IUQA 2XIWA 3GTQH 3RUPA 3RMHA 4L63B 3M4QA 1DV2A 2MFIA 3LQSA 2DZDA 1GOZA 4MAMA 2L15A 3M4OB 5ELBA 2DY7A 3ER0A 2I8CA 2K5DA 4IPGA 2JYOA 1HXYD 4M8AA 4R1JA 5DGIA 3S1NB 2PYKA 5IOCA 5C0XH 3MWDA 3JSNA 3ETHA 1EY9A 2K01A 3S1QB 1J8IA 3STBC 3E6ZX 4C1NK 1PA6A 1XMOL 2N88A 2KVMA 3A54A 2PBZA 4OX9Q 4O4JF 3D4WA 4DR3Q 5FR9A 3C3LA 3NBHB 4N9TA 2NU8B 5LYJF 1L1OB 4KN4C 2DY8A 4IN3A 2Y0SE 4A3FH 1GVPA 4DV6Q 3A7LA 2PPBC 3UYYA 1IZ6A 1I3QB 4MV7A 2HUGA 3GTOB 2K5QA 1SYEA 2EXZA 2NN6G 5KNCA 2E2HH 3SK5A 1EQRA 1B6SA 3E5SA 1UE6A 2XRQD 2NU6B 4JK1C 2Z1CA 1JOOA 2FPGB 1HZCA 1OTCA 2SDFA 4XZ3B 2WAQB 1IL2A 3ETJA 1TS4A 1TWAB 3PUZA 4KMUC 5M3MG 1V1QA 3NK9A 5K2MA 1LTRD 2G9HD 2LKVA 2VQEQ 3HB9A 5CV8A 4O42A 2PI2E 2VW9A 3U9SA 1I2LA 3MXGA 4NZOA 2YS7A 1D7QA 2JA9A 3LGJA 1O78A 3K0XA 4JOIA 3G48A 2BDNA 4JI7Q 2ABJA 1MKHA 4B08A 3F2DA 1ZAUA 1G291 2X0SA 3G71A 4OELB 5NUCA 5I9PA 5LP6F 4KN7C 4XT3B 1JDEA 2ZTCA 3I91A 2V5AA 4C56C 3EIVA 5M5XB 4QJFA 1X6OA 1M8AA 4EGJA 1HUNA 2QGQA 3AB9A 3J80c 2E75C 4ZHQF 4DR6Q 5I2XA 4MZ9A 1CQFA 4CHTB 1LLRD 1N34Q 4CJ2C 3OIQA 4B3MQ 1PFNA 3IL8A 3T51B 2B2UA 4RH6A 5JOBA 4KK7A 1KQSA 3JRWA 4O7TA 1KBLA 5EKIA 3K0YA 1U4PA 4C3HG 2XVSA 1W93A 1F2MA 1V9PA 3GP7A 3QR8A 2V4DA 4QUFA 1ENCA 3HOUB 5DGHA 1M0TA 1EQVA 3U9OA 4NYEA 1GJXA 1LM0A 2RHQB 4ME5A 4LF6L 3JC66 4MV6A 1BCPF 1EYCA 2K5NA 1J6QA 5A35A 3RN2A 1STEA 1ZXTA 3HOUG 2NVQB 1G6ZA 5K3WA 3T54A 4YAKB 2OLSA 1HTPA 1EIGA 1TIID 4RFBA 3M4PA 5FOBB 3HOZH 3NWSA 2R7NA 2JEAI 2LMCB 2AQ3B 4RGTA 4BBRG 2BH2A 5IGFA 1VMCA 3BACA 3U0GA 2ES2A 4FFRA 3WWHA 2K1BA 2PNRC 1X32A 1UEAB 4B3SL 3A55A 2HHFB 2R7ZH 1U4MA 5FLXL 1KRSA 3D31A 4HNVA 1YJ9A 3PIO3 2IX3A 1LTGD 3BA8A 4DR4L 1Y14B 2Z4HA 3S14B 1V43A 4GLVB 5KEEA 5JEAG 3Q23A 1Y8PB 1E4EA 1FNWA 3FKIG 2HVSA 1RD9D 4ME3A 1YNNC 4JBMA 3AW8A 3K7UC 2EY2A 5C8YF 3OTOQ 1N36Q 1JT8A 3HBLA 4PG3A 1EIFA 3S2DB 4IOAA 1LACA 1XX8A 1DD2A 1M1KC 2F52A 1G2SA 4B9WA 1HNZQ 4OIKA 3KLSX 2COGA 2A68D 1PLFA 4EQ5A 5JH7F 3KLSA 4KKSA 5IT9L 3M3YB 1ILPA 2VS1A 1VQFA 3DM1A 4BXXH 3DUZA 2UUAQ 1N9WA 3IRBA 4YHHQ 1TS5A 3ND8A 4DV2L 5M5YH 4B3RL 2B2TC 4KHZA 1KT8A 3PO3H 3CPWA 1IBML 3TZDA 1PFSA 4A3KB 1A15A 3HOYB 1BBXC 1UUPA 4WHXA 3KDFB 3RD4A 2YU9B 2YZNA 2B63H 4PZ6A 5HY6A 1I1LA 3FKIB 3MTSA 4IJHA 5IGEA 1BBWA 1L0WA 5IT9E 2UXDQ 1A0GA 4DPGA 2Z0SA 4K8JA 2SEBD 1CA5A 2K75A 3RZDB 4BBRB 3NWTA 4K0KQ 1Y69U 3KJOA 3PFFA 2TSSA 2DNCA 4FYDA 5D1OB 2KHJA 3KREA 4YY3Q 4NMZA 4X3TA 4GNXC 2W6PA 3BAAA 3RR5A 3HP3A 4ODGA 3ULPA 5T1GA 5I5VA 1OXUA 3DTFA 1ENAA 3KFUA 3PMFA 2PNHA 3GTKH 4ZRZA 1LTID 4OO1H 4DR1Q 5CA1F 2K4KA 4HR7B 4KKTA 1S4ZA 1BCPC 2NZ1D 3FVQA 1VQLA 3KAJA 5IYCH 2RSOA 5TSSA 4CDEC 4UUGA 1VBGA 4JI0L 4X64L 4RKLA 4QL5A 4DV4L 4JI1Q 4O2BF 5K36H 3WDNA 1Q7YC 2ZXRA 1WTXA 2R93G 2A74C 1YEZA 3CCSA 3RV4A 3SXHA 4LF9L 2WP8J 2ZDHA 1KLUD 3G4SA 3HOZG 1I94Q 4DV3Q 5KNBA 4BS9A 4IUTA 5C3XA 5DM63 5C0XI 5FK9C 4A3BG 4O2AF 1CZWA 5EPLA 4FFLA 1D6EC 4QF4A 3K7AH 3RLFA 4DV0Q 3PF4A 1SXTA 2B8FA 4AYBG 5ELDA 1O80A 4DNRB 3T1YQ 4X3UA 2JA8B 5E4WC 3P1HA 3NEMA 2HQLA 2NZOA 1PFMA 3J81L 4MV4A 4GS3A 1EFWA 5C3EG 1SE2A 1GSOA 3CCVA 2R87A 4V190 2JSOA 1EQQA 3RUZA 2UXBL 1IYEA 5ISRA 2JA6G 1ICWA 3Q2OA 4NXMQ 1K0RA 3MXPA 1OXTA 4LFAQ 3TP6A 5BR8Q 5ELEA 3QQMA 5G3LF 4Y52H 4G57A 2YL2A 2WB1G 4ZAIA 2GPWA 1B7YB 2F1MA 2Z6KA 4JBKA 4DNIA 4LF4Q 3V4SA 3MA2B 3DEOA 2R92B 1RJTA 4R4TA 1EWCA 5A2QL 4I65A 1JLLB 1GGOA 2HGXA 3R5HA 1B6RA 4M0JA 2Q2UA 4TV9F 3G6JB 3NPPA 4DUZL 1SNPA 1P8LA 3BS1A 4KD4A 2NVTH 1EZ1A 5M3FG 5FLXc 2M2LA 2ZXPA 4HR7A 2PW7A 1K3BC 3SHLA 4DAYB 4QIWB 3UDFA 1AUVA 1PTOF 2JN4A 2IW3A 4CJ1B 2HDLA 3NELA 2HJWA 4I7AA 3UFXB 3OWEB 3K5OA 3T9EA 1X3QA 3ORQA 2KHIA 1IOVA 2E5LL 5LMNQ 1GM5A 2EDGA 2WB1B 2F0IA 3DLLA 3QIAA 2A19A 3E0EA 1QZGA 1IBMQ 4CMDA 5K5PA 1B9MA 3JAMc 1PHJA 2VXWA 4N8X1 4LF5Q 1EZ8A 4PMBA 1VQKA 3GTQB 3R2IA 1IYDA 1QE6A 2EPBA 1LO5D 5IYBH 1VQOA 1JB3A 1NUCA 1LABA 2F0MA 5ELOA 1EIHA 3R3OA 4E4TA 5LMUL 1Q86C 1Z2PX 3GLKA 1BQQT 1GHJA 1BXTA 1IW7C 4HJ5A 3TQYA 3UZBA 1CS0A 1XXGA 1TXYA 1XDNA 3BA9A 4I50F 2PVPA 3L3OC 3QWNA 1VQMA 2DJFC 3J81E 1S40A 4S3SA 1TA8A 1BDOA 4FFOA 2I87A 2AMCB 4JBWA 2B29A 4PNYA 1G6PA 1N32L 2R93H 1R4PB 2OEOA 4K8IA 1I4QA 5EKKA 1Z2OX 4GOPC 1JWUD 2AUKA 1VQGA 4DLKA 5CC4A 3BG3A 2ZDGA 2MPMA 4FFNA 3VDYA 2EJ2A 4A3FB 3A8JE 1MGSA 4O2DA 5IY0A 1GUSA 2FINB 4DV7L 4IJLA 5FLXE 3CRLC 2E2HB 3CMAA 1PXUA 4LK1C 4WORA 5ELNA 4GN5A 1B4OA 3LX0A 4K14A 1K8AC 5ELFA 1XNRL 3DWQA 1SCUB 1DCZA 1KJ8A 5D3DA 1AFPA 2R7DA 3NTHA 1TWAH 1EU4A 2RQXA 4JI4L 1SYFA 3MVVA 4JV5Q 1C3OA 1CK1A 4CHIA 4BBSH 1Y1VB 2KCTA 4DAMA 4AQYL 4U673 2HGWA 3PQIA 1KABA 1S68A 1KTKA 1YNJD 1QWYA 5JVG3 3J7AF 4BWGB 3ITPA 4GLWA 4PV1C 3FDTA 4BA1I 1EWHA 1VQ6A 4LUOA 1GUWA 2H1EA 2YYAA 1IBLQ 4UAIA 3VYSA 4A3EG 2WKDA 3KUPA 4FF1A 3WO1A 4OWXB 5JPNC 4DR6L 1QVFA 2J9GA 4OEMB 4IUNA 1A48A 4HN2A 2MGSA 1Y8NB 1I4XA 1D2BA 1I7LA 5EPKA 5C0XG 4O84A 2E2IB 1VQ4A 2KCNA 1BO0A 1K0SA 4NB3A 1PYSB 1CTMA 4DR2Q 2NWGA 3DM3A 3HO8A 2YS6A 1STGA 2QDBA 1GXDC 1EUJA 1EEFD 5DLQE 1ESRA 1CKMA 3HOUH 1KAAA 1EY7A 3QB3A 3Q0AA 4JI5Q 3J7A5 1PYWD 4LF5L 3G6EA 4K5WA 2B2YA 4OHJA 2JA7B 1J5EL 5DNFA 4BY7B 3NSWA 3OHXC 1DM0B 2HCIA 2HDKA 1WTHA 5CV4A 5LMNL 4HMIA 1TWFB 2NVQH 1CUKA 3STBD 3BABA 4NDXA 1VKZA 5BWTA 2QKIC 5GROA 4M9UA 1R9TH 3AFQA 1NBWA 3HOZB 4I7ZC 2KOLA 1IKMA 3J80E 2RA4A 1TWHH 1F9RA 5I2YA 3GTGB 1ENFA 4OXPA 1KEEA 1W6JA 2VPQA 1IYVA 2L12A 3RV3A 1SDFA 4UHVA 2C35B 3SK4A 5EGTA 2R7ZB 4DV1L 3BU2A 1KJ9A 3RNUA 1TVXA 1O7YA 4O7LA 1LTLA 2HIXA 1UNSA 2Y0SG 3RFCA 2IT1A 4IHJF 2K5HA 5D14A 1JB7A 3S14H 3QOLA 4KHVA 4QMGA 2NUAB 4O7VA 2ZTEA 3VR2A 4B3RQ 5C44G 4IURA 4LFBQ 4P75A 5DM73 5C1PA 2ATWA 1WCMB 3DTGA 3GTPH 2K05A 3N6RA 5D1OA 2YRWA 4TVIA 3R2TA 2N78A 1FGBD 1JOKA 3KK7A 4R4OA 2XSCA 3J7ZC 1KAWA 2B2WC 3BVMA 3PF5A 2NTSA 5JVDF 4TV8F 1TY0A 2Q2TA 2NN6I 3FPUB 3M3YH 3TSSA 3A7AB 1DJRD 4LF8L 4DR7L 2WINB 1AUXA 5EBCA 4FP5D 1NR2A 2N3SA 1PRTC 3TQTA 1WJJA 3KDFA 5EJWA 4HJAA 3EN2A 5D8DA 4DKAC 4FF3A 2K03A 1HTLD 1XMQL 1ET9A 4RHSA 1HR0Q 3CCUA 3HOYH 2JA5H 3HOWG 2D2CC 1N8RC 2XNAC 4KLKA 1C0AA 1CT1D 4KI0A 2B63B 5I5XA 1ET6A 1EYDA 1VQ7A 3FKIH 3S17H 3I4NG 2IL8A 2Z02A 3DAAA 4YJ2F 5IYDG 4G4KA 1PH6A 1KDCA 4BBRH 4A3DG 4HJ9A 2EVBA 1N32Q 3VNNA 4JI1L 1MJEA 1UC9A 4MV8A 1TS3A 3JZIA 4L1KA 1KDAA 2WAQG 4JW0A 3HOVG 1HNWL 1F9PA 1BNCA 1U0LA 2CH4A 4BA2I 1Z6HA 5GAGC 3ZJYC 4KJOA 1EYAA 1SNMA 2B39A 5IYCG 3GTKB 1C7YA 4X6AH 1KTAA 4P2CB 1I7NA 1B3AA 4F88A 3URYA 2EYFA 5LL6X 4PZ8A 3HOXG 1E4EB 3ICEA 3JRXA 4K2KA 4JCVE 3KF6B 3PIPA 4LF6Q 2Z8LA 5C44B 1ASYA 4Q4DA 4J8QA 4PMCA 2I5HA 3SGIA 2OT2A 1GD7A 2X69A 2RCFA 3CPFA 4IQZA 2LXKA 4M1UB 2HT1A 2SNMA 2ODTX 3ONAB 4IWYA 3QFFA 4DU9A 2ICEC 2HGSA 1OXXK 3NQTA 1H9RA 5DEHA 2L4NA 5LL6S 1RKNA 2EZVA 1A2UA 2VR1A 2VY3A 4ZUIA 4K5VA 1PTOB 4DV1Q 1YNND 1TWCH 2NVYH 4G7OC 3MFYA 4RCNA 2KHSA 3PCOB 3NQIA 3PO3G 3TP5A 1NR4A 4JI8Q 3L9AX 3TW7A 2NZHA 2JA8H 3J81j 2JA6H 2GQRA 2YV5A 3CC7A 5BN4A 1JKJB 4C5CA 1YHAA 2A5HA 3CQZH 5DMXA 3MXNB 5HURA 3D4DA 2UUCQ 4EEQA 4A3DB 1MSHA 1NJIC 4CDFC 5IP9H 4A3MG 1JE4A 2D0PA 5C6AA 4LF4L 4A3JG 1ASZA 1GUNA 4PMWA 2QW7A 5AFWA 4ALPA 2AHOB 3BDLA 4MHEA 1A9XA 2WV6D 3KF8B 2FJ2A 4RMFA 3ERQA 3H94A 2R92H 1TAEA 2ZXOA 2B2WA 4A3BH 5JJIA 1GUGA 2FPPB 2QB5A 4MA5A 3IAYA 4EGQA 2OWOA 1I50B 2PI2A 4CDCC 3KYHC 2NVTB 3OW2A 4FNFA 1D5XC 4X62L 4O7YA 1W6KA 3I3CA 3O13A 1FNVA 1SR3A 4EVOA 2R7LA 1S5ED 1Y1VG 3PUVA 3HOYG 4ZUJA 4A3GB 1SE4A 2Z6BA 4HIDA 1HFGA 4K2LA 3A56A 1M4VA 1KDBA 4XYMB 4O82A 1I94L 3NUCA 3NBZB 3M7GA 3GJXB 4EFBA 4LF8Q 3TMEA 5CV7A 3R5XA 2SCUB 1T9HA 5CYUA 4H02A 1Q8IA 5HGTA 2R86A 3MC0B 1A6XA 3VR5A 2Z6KC 1PH1A 3RZOH 4GOPB 1Q82C 1KUTA 4JI2Q 4XT1B 3SDZA 2EJFC 4RHRA 4GNXB 3GTLB 3K5LA 3F1ZA 4DV0L 1PH2A 4LF7Q 1I4PA 2VB2X 2CQAA 4HJ8A 2WB1E 3Q6SA 3K5MA 2F4VL 1QVCA 1RL2A 4MNOA 3WO0A 1HNXL 2EY6A 1B70B 1Z9FA 4A3JB 2L0CA 3PGZA 5D65A 5I9OA 1XPRA 5FPOA 4WFN3 4YY3L 1STBA 4GLXA 3K5HA 4MV3A 1PZID 1TY2A 5J3BA 2R93B 3NP8A 2UU9L 1RTNA 1EY4A 2FPIB 3K81C 1AE2A 3GQBA 1VCIA 2Q8TA 5KRUA 3HG9A 2HVRA 4MN3A 4XDXA 2K6AA 4MTNA 3D6WA 3UDGA 3PUYA 1WTVA 5CV9A 4YIJA 3FRPB 4FF4A 1U5KA 3QJYA 5KNDA 1KC7A 3K8AA 2K5WA 4JI6Q 2HVQA 4FGRA 2QA4A 1T5EA 2A6HD 1A63A 4HTHA 2JA8G 2CW0D 3J80i 5FPRA 2R84A 3K57A 3K6OA 3R8BA 2JP1A 1VBHA 3VPBA 4CKEA 1DIKA 3HRZC 1YIJA 1ET0A 5BMVF 1Q1EA 2K52A 2L1BA 3VYTA 4ZKBB 1YHQA 2YTYA 4JI2L 2OXPA 3K59A 2AQ1B 4BBSB 3I8ZA 4A3MH 1Y1VH 2IX1A 2F0FA 4IPCA 3L7ZC 3TY8A 1VDZA 3H0GH 1E24A 1CKNA 5T1IA 4NP5A 4DK6C 5COYA 1I4GA 4QB4A 3CW2C 1GHKA 3MAQA 3BG5A 2V58A 1VQIA 4O83A 3TW6A 1DAAA 4GN3B 4CJ0B 5FKAC 3V2TA 2WYOA 1HPCA 1EY5A 2H5XA 2AUJD 3S1MB 4NXNQ 1CSPA 2K33A 1Q90A 3FEWX 2G5DA 5C5LA 3R23A 3C1EA 5KYIA 4CBVA 5IWAQ 5KKNB 1ZYRC 4UPAA 1HR0W 3OYYA 2E2IH 4DN4M 2MQHA 2F0DA 2M00A 2COIA 2K32A 3SE0A 5FLMG 2YWVA 3GIDA 2C9OA 3U9TA 3A0JA 4IALA 2D0OA 5HGQA 1JJGA 3E5NA 3PN1A 3K5NA 3AQQA 1KRTA 1K83H 4FXKC 3SE7A 4EQPA 2AKWB 5IYZF 3CD6A 1UE7A 3QG1A 4A3IG 2V59A 2AQ2B 2JA7H 1FJGQ 5CV5A 5CBEE 4BY7H 4C3IG 5M9OA 4F8MA 1HUMA 1TWFH 5H80A 4U68A 3P20A 4FO2A 3N52A 5BPHA 1R9TB 4C5BA 3S1RB 3TINA 1CFMA 3HGBA 5IGCA 1TWHB 4B3SQ 3GTGH 4K6LA 2EJ3A 2XTIA 3KBGA 1G91A 1VF7A 5IIFA 4XYLB 4E6IA 3W5OA 1F9QA 2ICIA 5EPJA 4ZLTF 1N34L 2W70A 3GTMH 1EOTA 2EJMA 1KD1C 1OXVA 2EYLA 1A8VA 1LTBD 1JC7A 3FHWA 1PZKD 2R7FA 4YWMA 4DAPA 3EA6A 1V8QA 1HA5A 4KV6A 1A3VA 2Q2HA 5IP7H 1GKHA 1K28A 3T16A 4LF7L 1M0WA 4EX5A 1K9MC 1KJQA 1D8LA 1IYUA 2E2DC 3H0GG 3J7AV 1WCMH 1RF2D 1EKVA 3GTPB 1F2LA 1KHIA 2K7VA 1SSOA 2KA7A 5JVH3 4IFDJ 5I5SA 1SRUA 3HKSA 1B9NA 4AQYQ 2A69C 4XQNA 1O7LA 2NBFA 1HFNA 1T36A 2CNUA 3HKZG 1WD1A 1BUVT 5FJ8H 4X66Q 4JI4Q 3TN2A 5H1SE 1MD2D 4FF2A 1XNQQ 1VQ5A 2F0VA 4DK3C 1PMRA 1Y1WG 1YI2A 2KECA 2AWOA 2F0EA 1WTPA 5C4XG 1K8OA 2EQSA 4WRDA 1HNWQ 4LH7A 4X3SA 1SNDA 1W3SA 4YWLA 4GKJL 1ICFB 1BOSA 2JA5B 4A3CH 2GVAA 4EFEA 3CCJA 3S2HH 3S17B 1W2BA 1S5DD 5KX5F 2DAAA 5FO9B 3NBIA 5JJZA 3V05A 3BVGA 1HZ9A 3MEFA 3HEJA 2JA7G 3LNNA 2R6GA 4AIMA 2YYZA 4DK0A 1I1KA 3AU7A 3LP8A 4NXNL 1ONLA 3BDOA 4DAAA 4JI5L 4CC5A 4JXUA 2R7KA 3P75A 4A3GG 4C3JB 1NY4A 2XN9C 2UXBQ 4RKBA 1JJ2A 3TP7A 1HZBA 1QILA 1C4QA 5C44H 4UFZA 4RWSC 4R4IA 3UI2A 4ZKCB 4RCOA 1H9JA 1DYQA 1HCZA 1X56A 1HRJA 4Q0FA 4FXDA 3OTOL 4BY7G 2QEJC 3DF7A 1IBKL 1E1TA 2I5LX 3H91A 3A5UA 2FFKB 2GA4B 1VQ9A 3HS0C 4GKKQ 2BOSA 4GN4B 4O4IF 2N49A 5M3MH 3OOCA 1LTAD 3TZUA 3VR3A 1TS2A 3X3NA 3WWIA 3MXUA 1SNOA 5JQWA 1PTOH 1H9SB 2BCOA 4LF9Q 1TWCB 2L11A 2NVYB 5DAUA 1OXSC 5BWXA 5BWVA 1EUCB 5L37A 4UP7A 4XXEA 3BJUA 3GD7A 3C1FA 1EWIA 1LTTD 1YHBA 4HCSA 1QCBD 4JYAL 5C5MA 2JA6B 1W96A 4ABNA 4ID6A 1DONA 4O4LF 3D3RA 5IGDA 3I4NH 1NAPA 4DF7A 3CQZB 5IYDH 4O4HF 1NSNS 4HMJA 3MJFA 3JZ6A 3HKZE 3BVZA 3KBXA 4A3DH 1PH4A 1PRTD 4DFAA 1PH9A 1CHPD 2YRXA 1UAPA 4OWTB 2E2JH 4IFDG 5CORA 2IY5B 5HNEA 4KHPQ 4A3CG 3LULA 2BA1A 2NN6H 3Q8DA 2DWCA 4A4IA 4DK1A 1STNA 2SNSA 3KF6A 3VYUA 4ULLA 4LUZA 3JZFA 4YB8B 1ILQA 1TKWB 3R93A 1WRVA 4A3BB 2AWNA 5LMNW 4NXML 4LW1A 3CC2A 5BN3A 1LT5D 1A3GA 2Y4RA 1I50H 1VQEA 2X6GA 1STHA 2OTLA 4BY1H 1NMGA 2HHHQ 3VA5A 5KYLA 1SMYC 2DABA 5J22A 4RZQA 1WTWA 4O7ZA 2X6LA 3AFPA 2ZM6L 3M4YA 3GB8B 3TIGA 1Z7TA 1BF4A 2DUDA 5C0XJ 4A3GH 2PN1A 3PO2B 1L0YB 4JC0A 3KOJA 1EY6A 1EY0A 3TP8A 1Q81C 3I2ZA 2JEBI 1VF5C 3OSOA 3U4VA 1GSHA 2A1HA 4JVZA 3FPPA 4KTAA 4CKCA 1AZQA 2CCZA 1U9RA 3CMEA 1UE5A 3I72A 2CWPA 5A2QE 4MV9A 3F8TA 3CC4A 1X3GA 4J6HA 3RZOB 2C00A 2XGTA 3M9BA 4JPBW 1PX2A 2BDOA 2E5LQ 4X64Q 4DV4Q 1OBGA 2WACA 4ZCKA 4LAAA 3GTLH 4XTCS 3UZOA 4K6DA 5M5WH 1TWGH 4DAVA 5EAYA 1I6HB 4IUPA 1B50A 1XNRQ 4LFBL 2NVXB 3PIP3 1IHZA 2IHFA 4P73A 2GN5A 1L1OA 4A3JH 1BNZA 3NBHA 3L0OA 1YITA 2A73B 1BCPB 2FHTA 4X62Q 4DUZQ 2R92G 3BDCA 4DR3L 3S15B 2FXQA 1VMPA 4CE5A 3G7LA 5C4ZA 3DHQA 3LWBA 5IT9c 1PRTF 2FP4B 2MJ8A 3CHBD 1EYGA 2MO0A 2F0WA 2SOBA 3T9BA 3JAMi 4I4TF 4UCUA 3CRKC 5JJKA 1XNQL 2R7ZG 2OF1A 5JQGF 1KL9A 1IYJB 3OIPA 4LMQD 3MZ5A 4EGVA 3OWFA 1J5EQ 1SMXA 2QK4A 4XX0B 4YAJB 4KY6A 2UUCL 5GADC 3P7JA 1HH2P 1NCVA 3EFXD 1HZAA 1A62A 3T1YL 3NBYB 4HEDA 1SE3A 4A3MB 1F9SA 4L8JA 4LJZC 4HIKA 1M90C 2ENBA 2Q8IB 4IFDH 1C9OA 2RDFA 3H0GB 2K50A 4OO1G 2KCCA 4IPHA 2JE6I 2EY1A 3T99A 3IFTA 4JBJA 4O81A 5LHY1 4TQUS 4R4QA 4MA0A 2ZM6Q 1PH5A 3H3VH 3UQ8A 1B2TA 3HOVB 4A75A 3PV0A 3S1MH 2NUCA 3U50C 3PSIA 3PUXA 4C3HB 1G51A 1AZPA 3C2PA 1WTRA 2J4XA 2B2TA 4DIMA 3WOFA 1Q1BA 2WFWA 3NTKA 5FO8B 4JI3Q 2KBNA 2F0QA 2D5DA 2PCFB 3WNZA 2A6ED 2B63G 1CI3M 5IODA 2W6NA 5GAEC 4DV5L 4KD3A 1Q12A 2RF4A 4A3IH 3W3AA 1WR2A 4HNUA 3M85A 2W71A 1EQTA 2DNEA 4Y7NB 1F2YA 1K83B 2VQFL 1D1IA 1QZHA 3J80L 5K36G 5BPFA 2F4VQ 1A3TA 1FNUA 5BWRA 3JAML 4C2MB 1GUOA 1FJGL 3TY9A 2PO4A 2K04A 1PH3A 1KNAA 2WAQE 4RGMA 3S16H 3TS2A 2HHFA 4XIGS 3TEHB 3BYYB 5D1PA 1CQVA 3UE0A 1CKNB 4DXFA 1MSGA 3TRZA 1AW7A 5JPMC 5FO7B 3S1RH 5EQ0A 5CR5A 2GVBA 4DNTB 1NNXA 1PV4A 2UXDL 4AH6A 3T9FA 2MO1A 2MP1A 4XQQA 3T9AA 3S24A 4WJ4A 2RDGA 1ZEQX 4J15A 1TR5A 4R4CA 3TIIA 3GTMB 2E76C 5C3EH 1AP0A 1S5FD 3HOWH 4A3FG 4TUYF 1U4RA 2E74C 2ZJQA 1XPUA 2K14A 1HHVA 4GKKL 2RSNA 3CSWA 2A6HC 2UUAL 3NHHA 2K28A 4IIJF 4O7WA 5J2TF 2CW0C 3W1GA 2B2YC 4LNQA 4QCLA 4UCRA 3ULLA 5CM0A 5CGKA 2EJ0A 4UY8C 1SJHD 3I4MH 1HQMC 4G7HC 1KXLA 3IKJA 2CZGA 3AYHB 1E7ZA 3KF8A 2BE5D 4FXGC 3T13A 3UE1A 1I4HA 4JI7L 1SROA 3QO2A 2D9UA 2CKZB 4R8IA 2IP4A 1V1PA 2PQEA 1WFQA 4A3KG 3HOXH 2N55A 5FLMH 1MIUA 1JWSD 4X65L 3PIOA 4NPSA 1VQNA 5ELCA 4NW2A 1E1OA 5IYBG 2PZWA 3GO5A 3S9WA 4GZYC 1QUQB 4HCEA 1PVOA 2XWBB 1ZYRD 4K5XA 2EIYA 3S2HB 1Z47A 1JMCA 2UXCL 1QUQA 2HQEA 1I1MA 4AYBE 3RTXA 2YZMA 5J2UF 1DOKA 4LH6A 2YW2A 4K6NA 5M3FH 1A2TA 4DAYA 1B3QA 3VR4A 4JOIC 4H44C 3RLNA 4OX9L 2KQ3A 1NMFA 1DGSA 2I46A 3T7AA 1JE5A 3U55A 2W6ZA 2VB3X 1QVGA 2Q7DA 3Q22A 1DOLA 2HDMA 3IFDA 3HZXA 2I0QA 5DAAA 5E4XA 2RBMA 1E2WA 1NTGA 5I6WA 1V1PB 2Z04A 5BWWA 2JJQA 3CAMA 4BBSG 4O0AA 5FJ8G 2UUBL 1X55A 2CHBD 2PZTA 1RODA 3Q1KA 4C3JH 5C4HA 2OQ0A 4Q5VA 1CQIB 4GNXA 1VQBA 3WWJA 1D5MC 1E3PA 4G7ZC 2NTTA 4HTPA 4KKUA 4NZMA 4GOPA 4ZI7F 2PQAA 4P72A 2N8NA 3RN5A 5AJ3L 1JR0D 1AE3A 5BWUA 5J1ZA 4HQ6A 4N9PA 4L5SA 3QOJA 4JG2A 3T1HL 1PTOC 2Z4IA 3T4AC 1SYCA 1YVCA 2VUGA 2YZLA 2CNVA 5M3MB 1WVLA 4FE2A 1EY8A 1QNUA 4X3KA 4A93H 2EJGC 1IBLL 4L5RC 1SNCA 2QCPX 3A5ZB 4FFPA 3MXNA 4DQNA 4UCTA 4APVA 1X9NA 4UCVA 1CHQD 1I5FA 4N8FA 5C4XH 4RAUC 4OIJA 2ZJRA 2YTXA 5EKLA 2FB9A 1SN8A 1LTSD 2F0PA 3EROA 2F0JA 1AN8A 1VQJA 2A69D 4A3EH 3I4NB 2XWJB 4JV5L 1BXRA 3GTJH 3VPDA 4Z9CB 4C3IB 4JI0Q 5CV6A 4GLAC 1HR0L 4NZNA 3J81c 1SAPA 1XYIA 4LWCA 1FD7D 4UP8A 2KENA 2OCEA 3SVMA 2YZGA 5F2DA 3H3VI 2E2JB 1D1KA 1OBDA 4DR7Q 2HIVA 2OQKA 1CE8A 4FVMA 4KHPL 2V1CC 1CA6A 2F0OA 4RG1A 2WIIB 5E3FA 3PUWA 3ULJA 1EYZA 2PW5A 3MHBA 5LMUQ 4H0LC 4BY1G 1EHIA 5C4JH 1XK5A 1M6VA 2NU7B 2Q2IA 2NYZD 2PMZE 1RCVD 5IWAL 2KJXA 3I90A 1XTDA 3JAME 5KS8A 4K0KL 2YTVA 2G9DA 4TRDA 4BY1B 2UXCQ 1UE1A 3G8CA 1Q46A 5LA6F 1N33L 4QGUA 3LWUA 1GLVA 4ZK9B 1TQOA 3D8GA 2KCMA 4YCUA 5CA0F 1X54A 2R61A 1MI2A 4IWXA 1X3FA 3PO2H 3GDEA 1V1OA 1WD0A 5BN5A 2CNQA 3EQLC 2VUMB 1Q3LA 3R5FA 3A8IE 2HCCA 2EYMA 1RHPA 4R9WA 2C5CA 4OGQC 2EYOA 3CKIB 2F0HA 5EBDA 2LY7A 5EZYF 3KJPA 4DR5L 5KGUA 1C8CA 2VUMG 2ZDQA 1H9SA 2IX0A 2J0TD 1L2FA 4V0BA 3I4LA 1P16A 4EG0A 1I6VC 1JOQA 1WTQA 4IUVA 1HNZL 1VQCA 2ZT9C 2EXDA 1CM9A 3W2DA 5I6YA 2W6QA 4CC6A 4H7BA 1QNKA 1VQPA 5M5WB 4OO1I 1TWGB 4C3JG 4HIMA 1N36L 2OTJA 1IOWA 1I6HH 4PBCA 1CKOA 1QJOA 5E7NA 3A74A 2ALYB 2NVXH 4QY7A 3I70A 3WWVA 3U4ZA 3VMMA 1MBYA 5BR8L 2Q8RE 1SFOB 4LFAL 1N33Q 3DEPA 4DRFA 3MFGA 3V4ZA 1ML0D 4RGNA 4P74A 3BYTB
chains in the Genus database with same CATH topology
1YHBA 5D1OA 4JYAL 4UCOA 2JA9A 4DV6L 3LGJA 3E9IA 3K0XA 4JOIA 2N78A 1PH8A 3G48A 3S15H 4R4OA 4JI7Q 3J7ZC 1KAWA 3PF5A 2Q2TA 3I4NH 2NN6I 1MKHA 3M3YH 5IYDH 3F2DA 4LF8L 3HKZE 1G291 4DR7L 3G71A 4DUYL 4A3DH 1PH4A 2N3SA 1XMQQ 3E9HA 2ZTCA 1PH9A 1XMOQ 3EIVA 1WJJA 3KDFA 1X6OA 4QJFA 4OWTB 2E2JH 4HJAA 4IFDG 2QGQA 2IY5B 3J80c 3EN2A 4KHPQ 4DKAC 4A3CG 1HR0Q 1XMQL 4DR6Q 1BBUA 2BA1A 3Q8DA 4MZ9A 4A4IA 3CCUA 3HOYH 1N34Q 2JA5H 3KF6A 3AEVA 3HOWG 1N8RC 1WI5A 4B3MQ 4KLKA 1C0AA 4LUZA 4KI0A 3J81i 1Q8KA 1VQ7A 3FKIH 2VQFQ 3S17H 2MNAA 3I4NG 2K5VA 2AWNA 5LMNW 1XPOA 1KQSA 4NXML 4LW1A 5IYDG 3CC2A 1PH6A 4DV5Q 1I50H 1BKBA 1VQEA 1S3OA 2EIFA 4BBRH 1V9PA 4HJ9A 2OTLA 4A3DG 4IFDI 4BY1H 1NMGA 2HHHQ 1N32Q 3VNNA 3M4OH 4JI1L 1MJEA 4JI3L 1K73C 2WAQG 1LM0A 3AFPA 2RHQB 2ZM6L 4LF6L 2JQOA 3HOVG 1HNWL 3GB8B 1U0LA 3JC66 4BA2I 2DUDA 3S1NH 5C0XJ 4A3GH 3TY9A 5GAGC 3ZJYC 3RN2A 2K5NA 1J6QA 5IYCG 3HOUG 4LH7A 1C7YA 4X6AH 3S1QH 4JC0A 3KOJA 2CFMA 2JK8A 3HOXG 4PZ8A 3HOVH 2ZTDA 1Q81C 3ICEA 3T1HQ 3I2ZA 2JEBI 3KF6B 3M4PA 4JCVE 3U4VA 3PIPA 4LF6Q 3HOZH 2JEAI 4BBRG 4C3HH 3CF5A 2BH2A 2CCZA 5AJ3Q 4QQBX 1ASYA 3CMEA 1UE5A 2I5HA 3SGIA 2CWPA 2ES2A 1GD7A 1GO3E 3CPFA 3F8TA 5IE8A 3CC4A 1X3GA 1RIPA 2LXKA 2HT1A 4B3SL 4B3TL 1VS0A 1I3QH 2XGTA 3M9BA 1WOCA 2R7ZH 4WJ3M 1KRSA 3D31A 3NENA 3GTOH 2E5LQ 1OXXK 4X64Q 4DV4Q 4Y7NH 3GTLH 1YJ9A 4XTCS 1VQ8A 4A76A 3BA8A 4DR4L 1Y14B 5IP7G 5M5WH 2VQEL 1HJPA 1TWGH 1V43A 5EAYA 4GLVB 5JEAG 4DR1L 1XNRQ 2RHSB 2VY3A 4C2MH 4LFBL 3FKIG 2A8VA 2HVSA 4OWWB 4DV1Q 4ME3A 4JBMA 1TWCH 2IHFA 2NVYH 3K7UC 2GN5A 4P73A 1L1OA 3OTOQ 4A3JH 1N36Q 4A3LH 4E6NA 1JT8A 3PCOB 3L0OA 4PG3A 3PO3G 1EIFA 1YITA 4IOAA 3I4OA 4JI8Q 1LYLA 2NZHA 2F52A 4DR5Q 1M1KC 1HNZQ 2JA8H 4X62Q 3CXCA 3J81j 4DUZQ 2JA6H 2R92G 2YV5A 3CC7A 4DR3L 4EQ5A 2FXQA 3U58A 4JI8L 5GAHC 1YHAA 1WYDA 1A0IA 3CQZH 1XJVA 3MXNB 2VS1A 1VQFA 5IT9c 4BXXH 2UUCQ 2UUAQ 4EEQA 1N9WA 3IRBA 2MO0A 4YHHQ 1NJIC 1EYGA 5IP9H 4A3MG 3JAMi 4UCUA 5M5XH 2DGYA 2D0PA 3W1BA 4DV2L 4LF4L 5JJKA 5M5YH 4A3JG 1ASZA 4PMWA 1XNQL 2R7ZG 4B3RL 4KHZA 4ALPA 2AHOB 2A1AA 3PO3H 3CPWA 1IBML 1KL9A 1IYJB 1PFSA 3KF8B 4X65Q 4RMFA 3K80C 3KDFB 2R92H 4YCVA 1TAEA 3JSLA 1J5EQ 1SMXA 4PZ6A 5HY6A 4LUVA 2B63H 4A3BH 5JJIA 4IJHA 2UUCL 1BBWA 5GADC 1L0WA 4POGA 2UXDQ 1HH2P 2Z0SA 4DPGA 2OWOA 2K75A 1VQDA 1HZAA 2PI2A 3B6YA 3KYHC 1A62A 3T1YL 1L1OC 3OW2A 4K0KQ 4TVAB 3NBYB 3KJOA 3EBEA 3F2CA 4X62L 4HIKA 1M90C 1C9OA 2K50A 4HTOA 2KHJA 4OO1G 5D1OB 4YY3Q 1SR3A 4GNXC 3BAAA 4IPHA 2ASBA 2JE6I 3RR5A 1Y1VG 3ULPA 3PUVA 3HOYG 4JBJA 1OXUA 3KFUA 2PNHA 4TQUS 4HIDA 3UDIA 4R4QA 3GTKH 4L5TA 2ZM6Q 1PH5A 3H3VH 3UQ8A 1I94L 4DR1Q 5IP9G 3NBZB 2K4KA 4A75A 3PV0A 3S1MH 1FL0A 3D0FA 3U50C 1K8GA 3GJXB 4EFBA 3PSIA 4LF8Q 3PUXA 1VQLA 1G51A 5IYCH 1T9HA 4UP9A 3BZCA 4H02A 1Q1BA 2WFWA 4JI3Q 4BXXG 2KBNA 4JI0L 4X64L 4DV4L 4QL5A 1E22A 4JI1Q 2B63G 1PYBA 2Z6KC 1PH1A 3RZOH 1Q7YC 4GOPB 1Q82C 5GAEC 4B3TQ 5JJLA 4DV5L 4JI2Q 1SLJA 1Q12A 2R93G 2RF4A 1YEZA 4A3IH 3CCSA 3M85A 3I4MG 4GNXB 2BA0A 3CCEA 4LF9L 2ZJPA 3F1ZA 2VQFL 3CCQA 1QZHA 4DV0L 1PH2A 2WP8J 5K36G 4LF7Q 2F4VQ 3G4SA 3HOZG 4HJ8A 1I94Q 4A3LG 2WB1E 2F4VL 4DV3Q 3TREA 1FJGL 1QVCA 1RL2A 5C0XI 4MNOA 1PH3A 2WAQE 4A3BG 3S16H 3TS2A 4XIGS 1HNXL 1B70B 3TEHB 1Z9FA 1HNXQ 5D1PA 4X66L 3PGZA 3UE0A 1XPRA 3K7AH 3RLFA 4DV0Q 3S2DH 5FPOA 4YY3L 1CKNB 4GLXA 3PF4A 1VQHA 4AYBG 3T1YQ 3TRZA 3S1RH 1S72A 5J3BA 3L2PA 2GVBA 3NEMA 1PV4A 2UXDL 2UU9L 2CQOA 2HQLA 2NZOA 1X65A 4AH6A 2MO1A 3K81C 4GS3A 1AE2A 5C3EG 1EFWA 1VCIA 3S24A 3CCVA 4WJ4A 3TS0A 1EQQA 2UUBQ 2HVRA 2UXBL 2VZAA 4PZ7A 2JA6G 4JYAQ 4J15A 4NXMQ 1K0RA 1FVIA 1OXTA 4R4CA 4LFAQ 5BR8Q 1PH7A 4MTNA 5C3EH 3UDGA 2LSSA 4Y52H 1BVSA 4A3FG 2WB1G 3PUYA 3HOWH 2CWAA 1U5KA 1EIYB 2ZJQA 2K14A 1XPUA 4GKKL 4A3KH 1B7YB 3K8AA 4JI6Q 2QA4A 2Z6KA 2UUAL 4DNIA 2E8GA 1O7IA 4JBKA 4LF4Q 3J80i 2JA8G 1YNXA 1A63A 5FPRA 2YU9H 3W1GA 4L5QA 4R4TA 4LNQA 4UCRA 3ULLA 1YIJA 5JEAJ 1Q1EA 2K52A 3F2BA 1YBYA 1YHQA 2Q2UA 3TY5A 2D62A 2YTYA 3I7FA 4OONA 4DUZL 1YJNA 4DUYQ 4UY8C 1P8LA 3RZDH 4JI2L 3KLWA 3I4MH 3UDXA 1KXLA 2NVTH 1YZ6A 5M3FG 1CSQA 3AYHB 5FLXc 1E7ZA 4A3MH 5GQOA 1Y1VH 2IX1A 4IPCA 3L7ZC 3UE1A 4DAYB 3HFZB 4IPDA 3H0GH 1E24A 1CKNA 1SROA 4DK6C 4JI7L 3TY8A 2CKZB 1B8AA 1FGUA 1EOVA 3UDFA 1WFQA 3CW2C 4A3KG 3HOXH 2QEXA 4C3IH 5FLMH 1MIUA 1VQIA 3NELA 4GN3B 4POFA 4X65L 3PIOA 4NPSA 2KHIA 2H5XA 1VQNA 2E5LL 4NXNQ 1CSPA 5LMNQ 1GM5A 4YCWA 1IBMQ 1E1OA 2B3GA 5IYBG 2A19A 3E0EA 3DLLA 3GO5A 1QZGA 1H95A 4DR2L 3JAMc 1PHJA 4P71A 5IWAQ 1QUQB 4LF5Q 1PVOA 4A93G 1VQKA 4UPAA 1HR0W 3OYYA 2E2IH 2MQHA 1Z47A 5IYBH 1JMCA 1VQOA 2UXCL 1K3RA 1QUQA 2JA5G 1UEBA 4AYBE 5ELOA 5FLMG 2I5MX 4LH6A 3RTXA 3A0JA 3CP0A 2D0OA 5HGQA 3ERSX 5LMUL 1JJGA 3PN1A 1Q86C 3AQQA 1KRTA 5DISC 1K83H 5M3FH 2VL6A 2AKWB 1X3EA 4HJ5A 2RCNA 3BZKA 4JOIC 2LXJA 3RLNA 3TQYA 4HJ7A 1KIXA 4OX9L 3CD6A 1UE7A 1NMFA 4GKJQ 1DGSA 4FDBA 1TXYA 4A3IG 1XDNA 3BA9A 1JE5A 2JA7H 4DV3L 1FJGQ 4DR4Q 1VQMA 1QVGA 4BY7H 4IO9A 1JJCB 2I0QA 1S40A 2F3IA 1NTGA 1TWFH 1TA8A 2JJQA 2AMCB 3CAMA 3H15A 4O0AA 5FJ8G 2UUBL 4BBSG 4JBWA 1X55A 3CCRA 2B29A 3RLOA 2VUMH 1MJCA 4C3JH 1G6PA 2OQ0A 2HHHL 1N32L 2R93H 4YWKA 1NE3A 4QIWE 4GNXA 4GOPC 1VQBA 4B3SQ 3GTGH 1E3PA 2PQAB 2XTIA 1VQGA 4HTPA 4GOPA 3VDYA 4UCSA 2PQAA 4P72A 3W5OA 2N8NA 4O2DA 5IY0A 5AJ3L 3RN5A 1KC8C 1AE3A 4HIOA 1N34L 3GTMH 4L5SA 1KD1C 1OXVA 4JG2A 3T1HL 2VUGA 4DV7L 1A8VA 1YVCA 4IJLA 3FP9A 4IOCA 4LFCQ 4DV7Q 3FHWA 3CMAA 2R7FA 5ELNA 4JI6L 4GN5A 4YWMA 4A93H 1K8AC 2HVQA 1XNRL 2BH8A 1IBLL 3QWUA 1WCMG 4L5RC 3A5ZB 4UCTA 2R7DA 2Q2HA 5IP7H 1GKHA 1TWAH 3CCMA 4JI4L 4APVA 1SFOH 1X9NA 4UCVA 4LF7L 4EX5A 1K9MC 1UWVA 4JV5Q 1D8LA 1I5FA 3H0GG 5C4XH 1WCMH 2ZJRA 2IHEA 1SE8A 2YTXA 4BBSH 1SN8A 1KHIA 1IXRA 2KCTA 4DAMA 3I55A 4IFDJ 4AQYL 1SRUA 3HKSA 1VQJA 2UU9Q 4B3ML 1LUZA 4AQYQ 4A3EH 1S68A 4JV5L 3GTJH 4JI0Q 4GLAC 1HR0L 1Y1WH 2ID0A 3J81c 1VQAA 4LWCA 4BA1I 1VQ6A 3HKZG 4LUOA 3M7NA 5FJ8H 4X66Q 4UP8A 4JI4Q 2KENA 2OCEA 5H1SE 1IBLQ 4A3EG 3I56A 3NC0B 1XNQQ 3H3VI 1VQ5A 4DK3C 4OWXB 1AH9A 4DV2Q 1B04A 1Y1WG 1QVFA 2HIVA 4DR6L 2OQKA 4LFCL 2AWOA 1YI2A 4DR7Q 5C4XG 1YJWA 2V1CC 4YHHL 4KHPL 2EQSA 4RG1A 3PUWA 1HNWQ 3ULJA 1IBKQ 1W3SA 4YWLA 3CCLA 4GKJL 5C0XG 2VNUD 3PO2G 4A3CH 5LMUQ 3GTQH 1VQ4A 2GVAA 4BY1G 4EFEA 5C4JH 3CCJA 3S2HH 1XK5A 3M4QA 2MFIA 2Q2IA 4NB3A 1W2BA 2PMZE 5IWAL 1PYSB 4DR2Q 3DM3A 1XTDA 4K0KL 1HZ9A 2YTVA 2UXCQ 1UE1A 3MEFA 2JA7G 2L15A 1EUJA 1Q46A 5DLQE 3HOUH 1CKMA 3ER0A 1N33L 2R6GA 4QGUA 4JI5Q 3J7A5 4AIMA 4LF5L 2YYZA 4IPGA 3G6EA 2KCMA 4YCUA 1X54A 4NXNL 1J5EL 4R1JA 4JI5L 1X3FA 5LMNL 3PO2H 3JSNA 2NVQH 3GDEA 4CC5A 1CUKA 3STBC 3STBD 1PA6A 3BABA 1XMOL 5GROA 4A3GG 1R9TH 3AFQA 1NBWA 1NY4A 2UXBQ 4OX9Q 4DR3Q 1JJ2A 1HZBA 3NBHB 4UFZA 5C44H 1TWHH 4R4IA 1L1OB 3KJPA 4OXPA 4DR5L 2VUMG 3GTPH 2Y0SE 2IX0A 1X56A 1L2FA 4A3FH 1GVPA 4DV6Q 1P16A 2C35B 3OTOL 1IZ6A 4BY7G 1IBKL 1E1TA 2I5LX 3A5UA 4DV1L 1HNZL 3BU2A 3RNUA 1VQ9A 1VQCA 4GKKQ 2EXDA 4GN4B 1LTLA 2HIXA 2N49A 2NN6G 2Y0SG 5M3MH 2E2HH 4CC6A 2IT1A 1EQRA 2K5HA 1VQPA 1JB7A 3S14H 4OO1I 4HIMA 1N36L 2OTJA 1UE6A 1I6HH 1HZCA 1CKOA 2ZTEA 5E7NA 1OTCA 3A74A 1IL2A 2ALYB 4B3RQ 5C44G 2NVXH 4QY7A 4LFBQ 4LF9Q 3PUZA 3WWVA 1OXSC 3U4ZA 5BR8L 4P75A 5M3MG 1V1QA 4LFAL 2VQEQ 1N33Q 2ATWA 4UP7A 4DRFA 2PI2E 2VW9A 3BJUA 3GD7A 1EWIA 4P74A 1D7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHB A;  5D1O A;  4JYA L;  4UCO A;  2JA9 A;  4DV6 L;  3LGJ A;  3E9I A;  3K0X A;  4JOI A;  2N78 A;  1PH8 A;  3G48 A;  3S15 H;  4R4O A;  4JI7 Q;  3J7Z C;  1KAW A;  3PF5 A;  2Q2T A;  3I4N H;  2NN6 I;  1MKH A;  3M3Y H;  5IYD H;  3F2D A;  4LF8 L;  3HKZ E;  1G29 1;  4DR7 L;  3G71 A;  4DUY L;  4A3D H;  1PH4 A;  2N3S A;  1XMQ Q;  3E9H A;  2ZTC A;  1PH9 A;  1XMO Q;  3EIV A;  1WJJ A;  3KDF A;  1X6O A;  4QJF A;  4OWT B;  2E2J H;  4HJA A;  4IFD G;  2QGQ A;  2IY5 B;  3J80 c;  3EN2 A;  4KHP Q;  4DKA C;  4A3C G;  1HR0 Q;  1XMQ L;  4DR6 Q;  1BBU A;  2BA1 A;  3Q8D A;  4MZ9 A;  4A4I A;  3CCU A;  3HOY H;  1N34 Q;  2JA5 H;  3KF6 A;  3AEV A;  3HOW G;  1N8R C;  1WI5 A;  4B3M Q;  4KLK A;  1C0A A;  4LUZ A;  4KI0 A;  3J81 i;  1Q8K A;  1VQ7 A;  3FKI H;  2VQF Q;  3S17 H;  2MNA A;  3I4N G;  2K5V A;  2AWN A;  5LMN W;  1XPO A;  1KQS A;  4NXM L;  4LW1 A;  5IYD G;  3CC2 A;  1PH6 A;  4DV5 Q;  1I50 H;  1BKB A;  1VQE A;  1S3O A;  2EIF A;  4BBR H;  1V9P A;  4HJ9 A;  2OTL A;  4A3D G;  4IFD I;  4BY1 H;  1NMG A;  2HHH Q;  1N32 Q;  3VNN A;  3M4O H;  4JI1 L;  1MJE A;  4JI3 L;  1K73 C;  2WAQ G;  1LM0 A;  3AFP A;  2RHQ B;  2ZM6 L;  4LF6 L;  2JQO A;  3HOV G;  1HNW L;  3GB8 B;  1U0L A;  3JC6 6;  4BA2 I;  2DUD A;  3S1N H;  5C0X J;  4A3G H;  3TY9 A;  5GAG C;  3ZJY C;  3RN2 A;  2K5N A;  1J6Q A;  5IYC G;  3HOU G;  4LH7 A;  1C7Y A;  4X6A H;  3S1Q H;  4JC0 A;  3KOJ A;  2CFM A;  2JK8 A;  3HOX G;  4PZ8 A;  3HOV H;  2ZTD A;  1Q81 C;  3ICE A;  3T1H Q;  3I2Z A;  2JEB I;  3KF6 B;  3M4P A;  4JCV E;  3U4V A;  3PIP A;  4LF6 Q;  3HOZ H;  2JEA I;  4BBR G;  4C3H H;  3CF5 A;  2BH2 A;  2CCZ A;  5AJ3 Q;  4QQB X;  1ASY A;  3CME A;  1UE5 A;  2I5H A;  3SGI A;  2CWP A;  2ES2 A;  1GD7 A;  1GO3 E;  3CPF A;  3F8T A;  5IE8 A;  3CC4 A;  1X3G A;  1RIP A;  2LXK A;  2HT1 A;  4B3S L;  4B3T L;  1VS0 A;  1I3Q H;  2XGT A;  3M9B A;  1WOC A;  2R7Z H;  4WJ3 M;  1KRS A;  3D31 A;  3NEN A;  3GTO H;  2E5L Q;  1OXX K;  4X64 Q;  4DV4 Q;  4Y7N H;  3GTL H;  1YJ9 A;  4XTC S;  1VQ8 A;  4A76 A;  3BA8 A;  4DR4 L;  1Y14 B;  5IP7 G;  5M5W H;  2VQE L;  1HJP A;  1TWG H;  1V43 A;  5EAY A;  4GLV B;  5JEA G;  4DR1 L;  1XNR Q;  2RHS B;  2VY3 A;  4C2M H;  4LFB L;  3FKI G;  2A8V A;  2HVS A;  4OWW B;  4DV1 Q;  4ME3 A;  4JBM A;  1TWC H;  2IHF A;  2NVY H;  3K7U C;  2GN5 A;  4P73 A;  1L1O A;  3OTO Q;  4A3J H;  1N36 Q;  4A3L H;  4E6N A;  1JT8 A;  3PCO B;  3L0O A;  4PG3 A;  3PO3 G;  1EIF A;  1YIT A;  4IOA A;  3I4O A;  4JI8 Q;  1LYL A;  2NZH A;  2F52 A;  4DR5 Q;  1M1K C;  1HNZ Q;  2JA8 H;  4X62 Q;  3CXC A;  3J81 j;  4DUZ Q;  2JA6 H;  2R92 G;  2YV5 A;  3CC7 A;  4DR3 L;  4EQ5 A;  2FXQ A;  3U58 A;  4JI8 L;  5GAH C;  1YHA A;  1WYD A;  1A0I A;  3CQZ H;  1XJV A;  3MXN B;  2VS1 A;  1VQF A;  5IT9 c;  4BXX H;  2UUC Q;  2UUA Q;  4EEQ A;  1N9W A;  3IRB A;  2MO0 A;  4YHH Q;  1NJI C;  1EYG A;  5IP9 H;  4A3M G;  3JAM i;  4UCU A;  5M5X H;  2DGY A;  2D0P A;  3W1B A;  4DV2 L;  4LF4 L;  5JJK A;  5M5Y H;  4A3J G;  1ASZ A;  4PMW A;  1XNQ L;  2R7Z G;  4B3R L;  4KHZ A;  4ALP A;  2AHO B;  2A1A A;  3PO3 H;  3CPW A;  1IBM L;  1KL9 A;  1IYJ B;  1PFS A;  3KF8 B;  4X65 Q;  4RMF A;  3K80 C;  3KDF B;  2R92 H;  4YCV A;  1TAE A;  3JSL A;  1J5E Q;  1SMX A;  4PZ6 A;  5HY6 A;  4LUV A;  2B63 H;  4A3B H;  5JJI A;  4IJH A;  2UUC L;  1BBW A;  5GAD C;  1L0W A;  4POG A;  2UXD Q;  1HH2 P;  2Z0S A;  4DPG A;  2OWO A;  2K75 A;  1VQD A;  1HZA A;  2PI2 A;  3B6Y A;  3KYH C;  1A62 A;  3T1Y L;  1L1O C;  3OW2 A;  4K0K Q;  4TVA B;  3NBY B;  3KJO A;  3EBE A;  3F2C A;  4X62 L;  4HIK A;  1M90 C;  1C9O A;  2K50 A;  4HTO A;  2KHJ A;  4OO1 G;  5D1O B;  4YY3 Q;  1SR3 A;  4GNX C;  3BAA A;  4IPH A;  2ASB A;  2JE6 I;  3RR5 A;  1Y1V G;  3ULP A;  3PUV A;  3HOY G;  4JBJ A;  1OXU A;  3KFU A;  2PNH A;  4TQU S;  4HID A;  3UDI A;  4R4Q A;  3GTK H;  4L5T A;  2ZM6 Q;  1PH5 A;  3H3V H;  3UQ8 A;  1I94 L;  4DR1 Q;  5IP9 G;  3NBZ B;  2K4K A;  4A75 A;  3PV0 A;  3S1M H;  1FL0 A;  3D0F A;  3U50 C;  1K8G A;  3GJX B;  4EFB A;  3PSI A;  4LF8 Q;  3PUX A;  1VQL A;  1G51 A;  5IYC H;  1T9H A;  4UP9 A;  3BZC A;  4H02 A;  1Q1B A;  2WFW A;  4JI3 Q;  4BXX G;  2KBN A;  4JI0 L;  4X64 L;  4DV4 L;  4QL5 A;  1E22 A;  4JI1 Q;  2B63 G;  1PYB A;  2Z6K C;  1PH1 A;  3RZO H;  1Q7Y C;  4GOP B;  1Q82 C;  5GAE C;  4B3T Q;  5JJL A;  4DV5 L;  4JI2 Q;  1SLJ A;  1Q12 A;  2R93 G;  2RF4 A;  1YEZ A;  4A3I H;  3CCS A;  3M85 A;  3I4M G;  4GNX B;  2BA0 A;  3CCE A;  4LF9 L;  2ZJP A;  3F1Z A;  2VQF L;  3CCQ A;  1QZH A;  4DV0 L;  1PH2 A;  2WP8 J;  5K36 G;  4LF7 Q;  2F4V Q;  3G4S A;  3HOZ G;  4HJ8 A;  1I94 Q;  4A3L G;  2WB1 E;  2F4V L;  4DV3 Q;  3TRE A;  1FJG L;  1QVC A;  1RL2 A;  5C0X I;  4MNO A;  1PH3 A;  2WAQ E;  4A3B G;  3S16 H;  3TS2 A;  4XIG S;  1HNX L;  1B70 B;  3TEH B;  1Z9F A;  1HNX Q;  5D1P A;  4X66 L;  3PGZ A;  3UE0 A;  1XPR A;  3K7A H;  3RLF A;  4DV0 Q;  3S2D H;  5FPO A;  4YY3 L;  1CKN B;  4GLX A;  3PF4 A;  1VQH A;  4AYB G;  3T1Y Q;  3TRZ A;  3S1R H;  1S72 A;  5J3B A;  3L2P A;  2GVB A;  3NEM A;  1PV4 A;  2UXD L;  2UU9 L;  2CQO A;  2HQL A;  2NZO A;  1X65 A;  4AH6 A;  2MO1 A;  3K81 C;  4GS3 A;  1AE2 A;  5C3E G;  1EFW A;  1VCI A;  3S24 A;  3CCV A;  4WJ4 A;  3TS0 A;  1EQQ A;  2UUB Q;  2HVR A;  2UXB L;  2VZA A;  4PZ7 A;  2JA6 G;  4JYA Q;  4J15 A;  4NXM Q;  1K0R A;  1FVI A;  1OXT A;  4R4C A;  4LFA Q;  5BR8 Q;  1PH7 A;  4MTN A;  5C3E H;  3UDG A;  2LSS A;  4Y52 H;  1BVS A;  4A3F G;  2WB1 G;  3PUY A;  3HOW H;  2CWA A;  1U5K A;  1EIY B;  2ZJQ A;  2K14 A;  1XPU A;  4GKK L;  4A3K H;  1B7Y B;  3K8A A;  4JI6 Q;  2QA4 A;  2Z6K A;  2UUA L;  4DNI A;  2E8G A;  1O7I A;  4JBK A;  4LF4 Q;  3J80 i;  2JA8 G;  1YNX A;  1A63 A;  5FPR A;  2YU9 H;  3W1G A;  4L5Q A;  4R4T A;  4LNQ A;  4UCR A;  3ULL A;  1YIJ A;  5JEA J;  1Q1E A;  2K52 A;  3F2B A;  1YBY A;  1YHQ A;  2Q2U A;  3TY5 A;  2D62 A;  2YTY A;  3I7F A;  4OON A;  4DUZ L;  1YJN A;  4DUY Q;  4UY8 C;  1P8L A;  3RZD H;  4JI2 L;  3KLW A;  3I4M H;  3UDX A;  1KXL A;  2NVT H;  1YZ6 A;  5M3F G;  1CSQ A;  3AYH B;  5FLX c;  1E7Z A;  4A3M H;  5GQO A;  1Y1V H;  2IX1 A;  4IPC A;  3L7Z C;  3UE1 A;  4DAY B;  3HFZ B;  4IPD A;  3H0G H;  1E24 A;  1CKN A;  1SRO A;  4DK6 C;  4JI7 L;  3TY8 A;  2CKZ B;  1B8A A;  1FGU A;  1EOV A;  3UDF A;  1WFQ A;  3CW2 C;  4A3K G;  3HOX H;  2QEX A;  4C3I H;  5FLM H;  1MIU A;  1VQI A;  3NEL A;  4GN3 B;  4POF A;  4X65 L;  3PIO A;  4NPS A;  2KHI A;  2H5X A;  1VQN A;  2E5L L;  4NXN Q;  1CSP A;  5LMN Q;  1GM5 A;  4YCW A;  1IBM Q;  1E1O A;  2B3G A;  5IYB G;  2A19 A;  3E0E A;  3DLL A;  3GO5 A;  1QZG A;  1H95 A;  4DR2 L;  3JAM c;  1PHJ A;  4P71 A;  5IWA Q;  1QUQ B;  4LF5 Q;  1PVO A;  4A93 G;  1VQK A;  4UPA A;  1HR0 W;  3OYY A;  2E2I H;  2MQH A;  1Z47 A;  5IYB H;  1JMC A;  1VQO A;  2UXC L;  1K3R A;  1QUQ A;  2JA5 G;  1UEB A;  4AYB E;  5ELO A;  5FLM G;  2I5M X;  4LH6 A;  3RTX A;  3A0J A;  3CP0 A;  2D0O A;  5HGQ A;  3ERS X;  5LMU L;  1JJG A;  3PN1 A;  1Q86 C;  3AQQ A;  1KRT A;  5DIS C;  1K83 H;  5M3F H;  2VL6 A;  2AKW B;  1X3E A;  4HJ5 A;  2RCN A;  3BZK A;  4JOI C;  2LXJ A;  3RLN A;  3TQY A;  4HJ7 A;  1KIX A;  4OX9 L;  3CD6 A;  1UE7 A;  1NMF A;  4GKJ Q;  1DGS A;  4FDB A;  1TXY A;  4A3I G;  1XDN A;  3BA9 A;  1JE5 A;  2JA7 H;  4DV3 L;  1FJG Q;  4DR4 Q;  1VQM A;  1QVG A;  4BY7 H;  4IO9 A;  1JJC B;  2I0Q A;  1S40 A;  2F3I A;  1NTG A;  1TWF H;  1TA8 A;  2JJQ A;  2AMC B;  3CAM A;  3H15 A;  4O0A A;  5FJ8 G;  2UUB L;  4BBS G;  4JBW A;  1X55 A;  3CCR A;  2B29 A;  3RLO A;  2VUM H;  1MJC A;  4C3J H;  1G6P A;  2OQ0 A;  2HHH L;  1N32 L;  2R93 H;  4YWK A;  1NE3 A;  4QIW E;  4GNX A;  4GOP C;  1VQB A;  4B3S Q;  3GTG H;  1E3P A;  2PQA B;  2XTI A;  1VQG A;  4HTP A;  4GOP A;  3VDY A;  4UCS A;  2PQA A;  4P72 A;  3W5O A;  2N8N A;  4O2D A;  5IY0 A;  5AJ3 L;  3RN5 A;  1KC8 C;  1AE3 A;  4HIO A;  1N34 L;  3GTM H;  4L5S A;  1KD1 C;  1OXV A;  4JG2 A;  3T1H L;  2VUG A;  4DV7 L;  1A8V A;  1YVC A;  4IJL A;  3FP9 A;  4IOC A;  4LFC Q;  4DV7 Q;  3FHW A;  3CMA A;  2R7F A;  5ELN A;  4JI6 L;  4GN5 A;  4YWM A;  4A93 H;  1K8A C;  2HVQ A;  1XNR L;  2BH8 A;  1IBL L;  3QWU A;  1WCM G;  4L5R C;  3A5Z B;  4UCT A;  2R7D A;  2Q2H A;  5IP7 H;  1GKH A;  1TWA H;  3CCM A;  4JI4 L;  4APV A;  1SFO H;  1X9N A;  4UCV A;  4LF7 L;  4EX5 A;  1K9M C;  1UWV A;  4JV5 Q;  1D8L A;  1I5F A;  3H0G G;  5C4X H;  1WCM H;  2ZJR A;  2IHE A;  1SE8 A;  2YTX A;  4BBS H;  1SN8 A;  1KHI A;  1IXR A;  2KCT A;  4DAM A;  3I55 A;  4IFD J;  4AQY L;  1SRU A;  3HKS A;  1VQJ A;  2UU9 Q;  4B3M L;  1LUZ A;  4AQY Q;  4A3E H;  1S68 A;  4JV5 L;  3GTJ H;  4JI0 Q;  4GLA C;  1HR0 L;  1Y1W H;  2ID0 A;  3J81 c;  1VQA A;  4LWC A;  4BA1 I;  1VQ6 A;  3HKZ G;  4LUO A;  3M7N A;  5FJ8 H;  4X66 Q;  4UP8 A;  4JI4 Q;  2KEN A;  2OCE A;  5H1S E;  1IBL Q;  4A3E G;  3I56 A;  3NC0 B;  1XNQ Q;  3H3V I;  1VQ5 A;  4DK3 C;  4OWX B;  1AH9 A;  4DV2 Q;  1B04 A;  1Y1W G;  1QVF A;  2HIV A;  4DR6 L;  2OQK A;  4LFC L;  2AWO A;  1YI2 A;  4DR7 Q;  5C4X G;  1YJW A;  2V1C C;  4YHH L;  4KHP L;  2EQS A;  4RG1 A;  3PUW A;  1HNW Q;  3ULJ A;  1IBK Q;  1W3S A;  4YWL A;  3CCL A;  4GKJ L;  5C0X G;  2VNU D;  3PO2 G;  4A3C H;  5LMU Q;  3GTQ H;  1VQ4 A;  2GVA A;  4BY1 G;  4EFE A;  5C4J H;  3CCJ A;  3S2H H;  1XK5 A;  3M4Q A;  2MFI A;  2Q2I A;  4NB3 A;  1W2B A;  2PMZ E;  5IWA L;  1PYS B;  4DR2 Q;  3DM3 A;  1XTD A;  4K0K L;  1HZ9 A;  2YTV A;  2UXC Q;  1UE1 A;  3MEF A;  2JA7 G;  2L15 A;  1EUJ A;  1Q46 A;  5DLQ E;  3HOU H;  1CKM A;  3ER0 A;  1N33 L;  2R6G A;  4QGU A;  4JI5 Q;  3J7A 5;  4AIM A;  4LF5 L;  2YYZ A;  4IPG A;  3G6E A;  2KCM A;  4YCU A;  1X54 A;  4NXN L;  1J5E L;  4R1J A;  4JI5 L;  1X3F A;  5LMN L;  3PO2 H;  3JSN A;  2NVQ H;  3GDE A;  4CC5 A;  1CUK A;  3STB C;  3STB D;  1PA6 A;  3BAB A;  1XMO L;  5GRO A;  4A3G G;  1R9T H;  3AFQ A;  1NBW A;  1NY4 A;  2UXB Q;  4OX9 Q;  4DR3 Q;  1JJ2 A;  1HZB A;  3NBH B;  4UFZ A;  5C44 H;  1TWH H;  4R4I A;  1L1O B;  3KJP A;  4OXP A;  4DR5 L;  2VUM G;  3GTP H;  2Y0S E;  2IX0 A;  1X56 A;  1L2F A;  4A3F H;  1GVP A;  4DV6 Q;  1P16 A;  2C35 B;  3OTO L;  1IZ6 A;  4BY7 G;  1IBK L;  1E1T A;  2I5L X;  3A5U A;  4DV1 L;  1HNZ L;  3BU2 A;  3RNU A;  1VQ9 A;  1VQC A;  4GKK Q;  2EXD A;  4GN4 B;  1LTL A;  2HIX A;  2N49 A;  2NN6 G;  2Y0S G;  5M3M H;  2E2H H;  4CC6 A;  2IT1 A;  1EQR A;  2K5H A;  1VQP A;  1JB7 A;  3S14 H;  4OO1 I;  4HIM A;  1N36 L;  2OTJ A;  1UE6 A;  1I6H H;  1HZC A;  1CKO A;  2ZTE A;  5E7N A;  1OTC A;  3A74 A;  1IL2 A;  2ALY B;  4B3R Q;  5C44 G;  2NVX H;  4QY7 A;  4LFB Q;  4LF9 Q;  3PUZ A;  3WWV A;  1OXS C;  3U4Z A;  5BR8 L;  4P75 A;  5M3M G;  1V1Q A;  4LFA L;  2VQE Q;  1N33 Q;  2ATW A;  4UP7 A;  4DRF A;  2PI2 E;  2VW9 A;  3BJU A;  3GD7 A;  1EWI A;  4P74 A;  1D7Q A; 
#chains in the Genus database with same CATH topology
 4XQJ A;  4UCO A;  1PH8 A;  3E3X A;  4DV6 L;  3E9I A;  1PZJ D;  3NE5 B;  3T9D A;  2DN8 A;  3S15 H;  2XRS D;  1PK8 A;  1O7Z A;  3A8K E;  1SNQ A;  3CU7 A;  1EZ6 A;  2PZU A;  1ZKO A;  2R85 A;  1Y1W B;  1Y8O B;  1AEX A;  4DUY L;  4O7R A;  1XMQ Q;  3E9H A;  1G2W A;  2R82 A;  2ZGI A;  1EEI D;  1LT3 D;  1TU2 B;  4DGZ A;  1XMO Q;  4O86 A;  2GLT A;  5I60 A;  2EYP A;  1XWE A;  4B9X A;  1BBU A;  4ZQI A;  2GQS A;  3FMC A;  4QUC A;  3AEV A;  1WI5 A;  1K8M A;  5CR3 A;  3J81 i;  2W6M A;  4ZOL F;  1Q8K A;  2R3Z A;  2VQF Q;  1S5B D;  2MNA A;  2K5V A;  1H9M A;  1XPO A;  4J1M A;  1CQJ B;  2QIL A;  4CDD C;  5I4D A;  4DV5 Q;  3OW7 A;  4TM5 A;  2EIF A;  1BKB A;  2MUY A;  1S3O A;  5G3L D;  2NB0 A;  4IFD I;  5IGG A;  2WKC A;  3TDQ A;  3M4O H;  3CEB A;  1SMY D;  3H09 A;  4JI3 L;  1K73 C;  1SYG A;  2JQO A;  5GON F;  3X3M A;  1PFB A;  5LXT F;  3S1N H;  3SK8 A;  1JDB B;  3S1Q H;  2CFM A;  2JK8 A;  3ZYY X;  1B1Z A;  1FR3 A;  3T53 B;  2ZTD A;  3HOV H;  3T1H Q;  5HV6 A;  5KIX A;  2MHV A;  4C3H H;  3CF5 A;  5AJ3 Q;  4QQB X;  5JAV A;  2QDL A;  1WTO A;  3DMU A;  1GO3 E;  5IE8 A;  1RIP A;  2F3V A;  1EU3 A;  4B3T L;  1VS0 A;  1I3Q H;  3T9C A;  3OPO A;  1WOC A;  4WJ3 M;  2JXM B;  3NEN A;  4A3I B;  3GTO H;  4Y7N H;  1VQ8 A;  4A76 A;  2H4O A;  4YBZ B;  5E1F A;  4MIU A;  5IP7 G;  2VQE L;  1HJP A;  1DV1 A;  2FMM A;  4DR1 L;  3GV6 A;  2RHS B;  4C2M H;  2EOT A;  2A8V A;  1H9K A;  4OWW B;  3S16 B;  2NU9 B;  1C30 A;  2FMC A;  4A3L H;  4E6N A;  2O4X A;  2F03 A;  4I55 F;  3DWA A;  3I4O A;  1LYL A;  1ESF A;  5CBA E;  4DR5 Q;  5LOV F;  3CXC A;  2I80 A;  2EY5 A;  2A68 C;  2PMZ B;  5E25 A;  3U58 A;  4JI8 L;  3BZD B;  5GAH C;  3VOT A;  1WYD A;  4Y8V B;  1A0I A;  1XJV A;  1GUT A;  2F0G A;  1MHW C;  2L5T A;  3AMU A;  1F77 A;  3T56 B;  3D4R A;  2F0T A;  4C1N I;  1UC8 A;  4R8N A;  5CMD A;  5M5X H;  2DGY A;  3W1B A;  5C3E B;  2J7Z A;  4OL7 A;  3I12 A;  3K58 A;  3HOW B;  3U54 A;  5CB4 F;  2A1A A;  3H6M A;  3H3V C;  2DLN A;  3VR6 A;  3VA7 A;  4X65 Q;  2F0K A;  3KLR A;  3K80 C;  1J9O A;  4YCV A;  3JSL A;  4LUV A;  4ZQ3 A;  4POG A;  2LFN A;  5C1O A;  1LV9 A;  4WJW A;  5I5U A;  3I4M B;  1VQD A;  3B6Y A;  4UCS A;  5CAE B;  1L1O C;  1JIC A;  4TVA B;  5JVL A;  4ILW A;  3EBE A;  3F2C A;  5JEA H;  1LT4 D;  4HTO A;  3HT5 A;  2O5J C;  1E2Z A;  2ASB A;  1G8Z D;  3HOX B;  3UDI A;  3LWE A;  4L5T A;  1IL8 A;  1JQY D;  5IP9 G;  3VPC A;  2B2U C;  1FL0 A;  3D0F A;  1K8G A;  1SYD A;  4IUU A;  1BCP D;  4QSH A;  2I07 B;  4UP9 A;  3BZC A;  1S5C D;  4KJN A;  2EE1 A;  4BXX G;  2F4I A;  5J39 A;  1E22 A;  2A6E C;  1PYB A;  4AYB B;  4H13 C;  2COJ A;  4B3T Q;  5JJL A;  2TMP A;  4KY5 A;  1SLJ A;  3I4M G;  5I5T A;  2BA0 A;  3CCE A;  4CMF A;  2ZJP A;  5M3F B;  3CCQ A;  1HA6 A;  3TEK A;  3GV3 A;  2EYH A;  2QF7 A;  4A3L G;  1Z2N X;  4F87 A;  3TRE A;  1BR9 A;  3MWE A;  5FNV F;  1SBB B;  3ND9 A;  1HNX Q;  4X66 L;  3D6C A;  1STY A;  3S2D H;  4UDU C;  3HKZ B;  3SEB A;  2W6O A;  1VQH A;  1A3U A;  1B53 A;  1S72 A;  2KEE A;  4ZYS A;  3L2P A;  2CQO A;  3MWY W;  3KAL A;  1C48 A;  1X65 A;  5HBR B;  3NTI A;  5I47 A;  4HN7 A;  3C46 A;  3K5I A;  2B2V C;  4NKL A;  4RGO S;  3TS0 A;  2VQD A;  2UUB Q;  2VZA A;  4PZ7 A;  4JYA Q;  4L6T B;  1FVI A;  1PH7 A;  2DJG C;  2LSS A;  5M5Y B;  1BVS A;  4MTK A;  2XCL A;  3PO3 B;  5C3W A;  4C5A A;  2CWA A;  4O1N A;  1II3 A;  1EIY B;  4HSV A;  4A3K H;  1DZ1 A;  2DIK A;  1PRT B;  3G8D A;  5CE8 A;  2E8G A;  1O7I A;  4A93 B;  1YNX A;  4PQX A;  3SR1 A;  1QG7 A;  5I5Y A;  4F7X A;  2YU9 H;  1OO9 B;  4L5Q A;  1U4L A;  2KED A;  5JEA J;  3F2B A;  1YBY A;  2F0L A;  3TY5 A;  2D62 A;  3I7F A;  4OON A;  2LS0 1;  1YJN A;  2L55 A;  4DUY Q;  1EKF A;  3RZD H;  3KLW A;  5C4X B;  2HD3 A;  3UDX A;  3Q24 A;  5BYA A;  1YZ6 A;  1CSQ A;  4XYO A;  1GSA A;  5GQO A;  2R7M A;  2BE5 C;  2X5R A;  2CH4 W;  3OUU A;  4IPD A;  3HFZ B;  1STA A;  1B8A A;  1FGU A;  1EOV A;  3NXW A;  4A3E B;  2L9H A;  1JOR A;  3GTJ B;  2QEX A;  4C3I H;  3VYR A;  3MEH A;  4POF A;  1KJI A;  2B2V A;  1ULZ A;  1E2V A;  1XTC D;  4FU0 A;  4YCW A;  4HSP A;  2B3G A;  1SJE D;  1H95 A;  2KUM A;  4DR2 L;  2RDH A;  4P71 A;  2RVL A;  3F2U A;  4A93 G;  4DXG A;  1LT6 D;  3DWP A;  1SYB A;  3SK6 A;  5C4J B;  1EKP A;  1JCK B;  1K3R A;  2JA5 G;  1UEB A;  3ORR A;  3I73 A;  2I5M X;  1R4Q B;  2B8G A;  2F0U A;  4HAE A;  3CP0 A;  4WBN F;  3ERS X;  4IZO A;  2Y0S B;  4XYQ A;  5DIS C;  4EQO A;  2VL6 A;  4ME6 A;  1X3E A;  3SNO A;  1IW7 D;  3DXJ C;  2RCN A;  3BZK A;  3TBI B;  2LXJ A;  4HJ7 A;  1KIX A;  1EL0 A;  4O7S A;  4GKJ Q;  3N8D A;  4FDB A;  2CVR A;  1JWM D;  1RTO A;  3WOE A;  4DV3 L;  4DR4 Q;  1DOM A;  4IO9 A;  1JJC B;  1QOH A;  3NUA A;  2F3I A;  4CGY B;  5I5W A;  3K7A B;  1TT2 A;  5D3I B;  3H15 A;  4DA2 A;  3CCR A;  2VUM H;  3RLO A;  1MJC A;  1I2K A;  1KJJ A;  3KAK A;  2M9V A;  1L0X B;  2HHH L;  2IWH A;  4YWK A;  1NE3 A;  4QIW E;  4O7N A;  2PQA B;  4TKO B;  3R9R A;  1FYC A;  2HG8 A;  1EFI D;  1KC8 C;  4HIO A;  1CZG A;  2IJ0 A;  2EYJ A;  1D5Z C;  3J7Y W;  1PTO D;  4IOC A;  3FP9 A;  4KY7 A;  4LFC Q;  1I4R A;  4DV7 Q;  2F0S A;  1G2T A;  1E0B A;  4RA8 A;  3K3P A;  4JI6 L;  4YJ3 F;  1KLG D;  2Z9H A;  2BH8 A;  2O2L D;  2XD4 A;  1WCM G;  3OUZ A;  3QWU A;  3EVQ A;  3OMG A;  5IGB A;  3CCM A;  1SFO H;  1X3P A;  1F2Z A;  1KNE A;  1UWV A;  4TSS A;  3V96 A;  2IHE A;  1SE8 A;  4FFM A;  1IXR A;  3I55 A;  4CKB A;  2IPK D;  2UU9 Q;  4B3M L;  1T5X D;  4EQN A;  1LUZ A;  2O5I C;  5BYB A;  4Q4C A;  1EUD B;  1YNJ C;  4IZ8 A;  1Y1W H;  2ID0 A;  1VQA A;  1HQR D;  1DXM A;  2P5Z X;  3M7N A;  2RKS A;  2P0A A;  1SEB D;  1RDP D;  3I56 A;  3NC0 B;  2F0N A;  1AH9 A;  4HNT A;  3EJI A;  4DV2 Q;  1B04 A;  3E0J A;  1QB5 D;  4LFC L;  1IKL A;  2GPS A;  1YJW A;  4YHH L;  3OMC A;  3AX6 A;  4MV1 A;  1IBK Q;  2VNU D;  3CCL A;  1B44 D;  2F3W A;  3PO2 G;  1PDQ A;  4IUQ A;  2XIW A;  3GTQ H;  3RUP A;  3RMH A;  4L63 B;  3M4Q A;  1DV2 A;  2MFI A;  3LQS A;  2DZD A;  1GOZ A;  4MAM A;  2L15 A;  3M4O B;  5ELB A;  2DY7 A;  3ER0 A;  2I8C A;  2K5D A;  4IPG A;  2JYO A;  1HXY D;  4M8A A;  4R1J A;  5DGI A;  3S1N B;  2PYK A;  5IOC A;  5C0X H;  3MWD A;  3JSN A;  3ETH A;  1EY9 A;  2K01 A;  3S1Q B;  1J8I A;  3STB C;  3E6Z X;  4C1N K;  1PA6 A;  1XMO L;  2N88 A;  2KVM A;  3A54 A;  2PBZ A;  4OX9 Q;  4O4J F;  3D4W A;  4DR3 Q;  5FR9 A;  3C3L A;  3NBH B;  4N9T A;  2NU8 B;  5LYJ F;  1L1O B;  4KN4 C;  2DY8 A;  4IN3 A;  2Y0S E;  4A3F H;  1GVP A;  4DV6 Q;  3A7L A;  2PPB C;  3UYY A;  1IZ6 A;  1I3Q B;  4MV7 A;  2HUG A;  3GTO B;  2K5Q A;  1SYE A;  2EXZ A;  2NN6 G;  5KNC A;  2E2H H;  3SK5 A;  1EQR A;  1B6S A;  3E5S A;  1UE6 A;  2XRQ D;  2NU6 B;  4JK1 C;  2Z1C A;  1JOO A;  2FPG B;  1HZC A;  1OTC A;  2SDF A;  4XZ3 B;  2WAQ B;  1IL2 A;  3ETJ A;  1TS4 A;  1TWA B;  3PUZ A;  4KMU C;  5M3M G;  1V1Q A;  3NK9 A;  5K2M A;  1LTR D;  2G9H D;  2LKV A;  2VQE Q;  3HB9 A;  5CV8 A;  4O42 A;  2PI2 E;  2VW9 A;  3U9S A;  1I2L A;  3MXG A;  4NZO A;  2YS7 A;  1D7Q A;  2JA9 A;  3LGJ A;  1O78 A;  3K0X A;  4JOI A;  3G48 A;  2BDN A;  4JI7 Q;  2ABJ A;  1MKH A;  4B08 A;  3F2D A;  1ZAU A;  1G29 1;  2X0S A;  3G71 A;  4OEL B;  5NUC A;  5I9P A;  5LP6 F;  4KN7 C;  4XT3 B;  1JDE A;  2ZTC A;  3I91 A;  2V5A A;  4C56 C;  3EIV A;  5M5X B;  4QJF A;  1X6O A;  1M8A A;  4EGJ A;  1HUN A;  2QGQ A;  3AB9 A;  3J80 c;  2E75 C;  4ZHQ F;  4DR6 Q;  5I2X A;  4MZ9 A;  1CQF A;  4CHT B;  1LLR D;  1N34 Q;  4CJ2 C;  3OIQ A;  4B3M Q;  1PFN A;  3IL8 A;  3T51 B;  2B2U A;  4RH6 A;  5JOB A;  4KK7 A;  1KQS A;  3JRW A;  4O7T A;  1KBL A;  5EKI A;  3K0Y A;  1U4P A;  4C3H G;  2XVS A;  1W93 A;  1F2M A;  1V9P A;  3GP7 A;  3QR8 A;  2V4D A;  4QUF A;  1ENC A;  3HOU B;  5DGH A;  1M0T A;  1EQV A;  3U9O A;  4NYE A;  1GJX A;  1LM0 A;  2RHQ B;  4ME5 A;  4LF6 L;  3JC6 6;  4MV6 A;  1BCP F;  1EYC A;  2K5N A;  1J6Q A;  5A35 A;  3RN2 A;  1STE A;  1ZXT A;  3HOU G;  2NVQ B;  1G6Z A;  5K3W A;  3T54 A;  4YAK B;  2OLS A;  1HTP A;  1EIG A;  1TII D;  4RFB A;  3M4P A;  5FOB B;  3HOZ H;  3NWS A;  2R7N A;  2JEA I;  2LMC B;  2AQ3 B;  4RGT A;  4BBR G;  2BH2 A;  5IGF A;  1VMC A;  3BAC A;  3U0G A;  2ES2 A;  4FFR A;  3WWH A;  2K1B A;  2PNR C;  1X32 A;  1UEA B;  4B3S L;  3A55 A;  2HHF B;  2R7Z H;  1U4M A;  5FLX L;  1KRS A;  3D31 A;  4HNV A;  1YJ9 A;  3PIO 3;  2IX3 A;  1LTG D;  3BA8 A;  4DR4 L;  1Y14 B;  2Z4H A;  3S14 B;  1V43 A;  4GLV B;  5KEE A;  5JEA G;  3Q23 A;  1Y8P B;  1E4E A;  1FNW A;  3FKI G;  2HVS A;  1RD9 D;  4ME3 A;  1YNN C;  4JBM A;  3AW8 A;  3K7U C;  2EY2 A;  5C8Y F;  3OTO Q;  1N36 Q;  1JT8 A;  3HBL A;  4PG3 A;  1EIF A;  3S2D B;  4IOA A;  1LAC A;  1XX8 A;  1DD2 A;  1M1K C;  2F52 A;  1G2S A;  4B9W A;  1HNZ Q;  4OIK A;  3KLS X;  2COG A;  2A68 D;  1PLF A;  4EQ5 A;  5JH7 F;  3KLS A;  4KKS A;  5IT9 L;  3M3Y B;  1ILP A;  2VS1 A;  1VQF A;  3DM1 A;  4BXX H;  3DUZ A;  2UUA Q;  1N9W A;  3IRB A;  4YHH Q;  1TS5 A;  3ND8 A;  4DV2 L;  5M5Y H;  4B3R L;  2B2T C;  4KHZ A;  1KT8 A;  3PO3 H;  3CPW A;  1IBM L;  3TZD A;  1PFS A;  4A3K B;  1A15 A;  3HOY B;  1BBX C;  1UUP A;  4WHX A;  3KDF B;  3RD4 A;  2YU9 B;  2YZN A;  2B63 H;  4PZ6 A;  5HY6 A;  1I1L A;  3FKI B;  3MTS A;  4IJH A;  5IGE A;  1BBW A;  1L0W A;  5IT9 E;  2UXD Q;  1A0G A;  4DPG A;  2Z0S A;  4K8J A;  2SEB D;  1CA5 A;  2K75 A;  3RZD B;  4BBR B;  3NWT A;  4K0K Q;  1Y69 U;  3KJO A;  3PFF A;  2TSS A;  2DNC A;  4FYD A;  5D1O B;  2KHJ A;  3KRE A;  4YY3 Q;  4NMZ A;  4X3T A;  4GNX C;  2W6P A;  3BAA A;  3RR5 A;  3HP3 A;  4ODG A;  3ULP A;  5T1G A;  5I5V A;  1OXU A;  3DTF A;  1ENA A;  3KFU A;  3PMF A;  2PNH A;  3GTK H;  4ZRZ A;  1LTI D;  4OO1 H;  4DR1 Q;  5CA1 F;  2K4K A;  4HR7 B;  4KKT A;  1S4Z A;  1BCP C;  2NZ1 D;  3FVQ A;  1VQL A;  3KAJ A;  5IYC H;  2RSO A;  5TSS A;  4CDE C;  4UUG A;  1VBG A;  4JI0 L;  4X64 L;  4RKL A;  4QL5 A;  4DV4 L;  4JI1 Q;  4O2B F;  5K36 H;  3WDN A;  1Q7Y C;  2ZXR A;  1WTX A;  2R93 G;  2A74 C;  1YEZ A;  3CCS A;  3RV4 A;  3SXH A;  4LF9 L;  2WP8 J;  2ZDH A;  1KLU D;  3G4S A;  3HOZ G;  1I94 Q;  4DV3 Q;  5KNB A;  4BS9 A;  4IUT A;  5C3X A;  5DM6 3;  5C0X I;  5FK9 C;  4A3B G;  4O2A F;  1CZW A;  5EPL A;  4FFL A;  1D6E C;  4QF4 A;  3K7A H;  3RLF A;  4DV0 Q;  3PF4 A;  1SXT A;  2B8F A;  4AYB G;  5ELD A;  1O80 A;  4DNR B;  3T1Y Q;  4X3U A;  2JA8 B;  5E4W C;  3P1H A;  3NEM A;  2HQL A;  2NZO A;  1PFM A;  3J81 L;  4MV4 A;  4GS3 A;  1EFW A;  5C3E G;  1SE2 A;  1GSO A;  3CCV A;  2R87 A;  4V19 0;  2JSO A;  1EQQ A;  3RUZ A;  2UXB L;  1IYE A;  5ISR A;  2JA6 G;  1ICW A;  3Q2O A;  4NXM Q;  1K0R A;  3MXP A;  1OXT A;  4LFA Q;  3TP6 A;  5BR8 Q;  5ELE A;  3QQM A;  5G3L F;  4Y52 H;  4G57 A;  2YL2 A;  2WB1 G;  4ZAI A;  2GPW A;  1B7Y B;  2F1M A;  2Z6K A;  4JBK A;  4DNI A;  4LF4 Q;  3V4S A;  3MA2 B;  3DEO A;  2R92 B;  1RJT A;  4R4T A;  1EWC A;  5A2Q L;  4I65 A;  1JLL B;  1GGO A;  2HGX A;  3R5H A;  1B6R A;  4M0J A;  2Q2U A;  4TV9 F;  3G6J B;  3NPP A;  4DUZ L;  1SNP A;  1P8L A;  3BS1 A;  4KD4 A;  2NVT H;  1EZ1 A;  5M3F G;  5FLX c;  2M2L A;  2ZXP A;  4HR7 A;  2PW7 A;  1K3B C;  3SHL A;  4DAY B;  4QIW B;  3UDF A;  1AUV A;  1PTO F;  2JN4 A;  2IW3 A;  4CJ1 B;  2HDL A;  3NEL A;  2HJW A;  4I7A A;  3UFX B;  3OWE B;  3K5O A;  3T9E A;  1X3Q A;  3ORQ A;  2KHI A;  1IOV A;  2E5L L;  5LMN Q;  1GM5 A;  2EDG A;  2WB1 B;  2F0I A;  3DLL A;  3QIA A;  2A19 A;  3E0E A;  1QZG A;  1IBM Q;  4CMD A;  5K5P A;  1B9M A;  3JAM c;  1PHJ A;  2VXW A;  4N8X 1;  4LF5 Q;  1EZ8 A;  4PMB A;  1VQK A;  3GTQ B;  3R2I A;  1IYD A;  1QE6 A;  2EPB A;  1LO5 D;  5IYB H;  1VQO A;  1JB3 A;  1NUC A;  1LAB A;  2F0M A;  5ELO A;  1EIH A;  3R3O A;  4E4T A;  5LMU L;  1Q86 C;  1Z2P X;  3GLK A;  1BQQ T;  1GHJ A;  1BXT A;  1IW7 C;  4HJ5 A;  3TQY A;  3UZB A;  1CS0 A;  1XXG A;  1TXY A;  1XDN A;  3BA9 A;  4I50 F;  2PVP A;  3L3O C;  3QWN A;  1VQM A;  2DJF C;  3J81 E;  1S40 A;  4S3S A;  1TA8 A;  1BDO A;  4FFO A;  2I87 A;  2AMC B;  4JBW A;  2B29 A;  4PNY A;  1G6P A;  1N32 L;  2R93 H;  1R4P B;  2OEO A;  4K8I A;  1I4Q A;  5EKK A;  1Z2O X;  4GOP C;  1JWU D;  2AUK A;  1VQG A;  4DLK A;  5CC4 A;  3BG3 A;  2ZDG A;  2MPM A;  4FFN A;  3VDY A;  2EJ2 A;  4A3F B;  3A8J E;  1MGS A;  4O2D A;  5IY0 A;  1GUS A;  2FIN B;  4DV7 L;  4IJL A;  5FLX E;  3CRL C;  2E2H B;  3CMA A;  1PXU A;  4LK1 C;  4WOR A;  5ELN A;  4GN5 A;  1B4O A;  3LX0 A;  4K14 A;  1K8A C;  5ELF A;  1XNR L;  3DWQ A;  1SCU B;  1DCZ A;  1KJ8 A;  5D3D A;  1AFP A;  2R7D A;  3NTH A;  1TWA H;  1EU4 A;  2RQX A;  4JI4 L;  1SYF A;  3MVV A;  4JV5 Q;  1C3O A;  1CK1 A;  4CHI A;  4BBS H;  1Y1V B;  2KCT A;  4DAM A;  4AQY L;  4U67 3;  2HGW A;  3PQI A;  1KAB A;  1S68 A;  1KTK A;  1YNJ D;  1QWY A;  5JVG 3;  3J7A F;  4BWG B;  3ITP A;  4GLW A;  4PV1 C;  3FDT A;  4BA1 I;  1EWH A;  1VQ6 A;  4LUO A;  1GUW A;  2H1E A;  2YYA A;  1IBL Q;  4UAI A;  3VYS A;  4A3E G;  2WKD A;  3KUP A;  4FF1 A;  3WO1 A;  4OWX B;  5JPN C;  4DR6 L;  1QVF A;  2J9G A;  4OEM B;  4IUN A;  1A48 A;  4HN2 A;  2MGS A;  1Y8N B;  1I4X A;  1D2B A;  1I7L A;  5EPK A;  5C0X G;  4O84 A;  2E2I B;  1VQ4 A;  2KCN A;  1BO0 A;  1K0S A;  4NB3 A;  1PYS B;  1CTM A;  4DR2 Q;  2NWG A;  3DM3 A;  3HO8 A;  2YS6 A;  1STG A;  2QDB A;  1GXD C;  1EUJ A;  1EEF D;  5DLQ E;  1ESR A;  1CKM A;  3HOU H;  1KAA A;  1EY7 A;  3QB3 A;  3Q0A A;  4JI5 Q;  3J7A 5;  1PYW D;  4LF5 L;  3G6E A;  4K5W A;  2B2Y A;  4OHJ A;  2JA7 B;  1J5E L;  5DNF A;  4BY7 B;  3NSW A;  3OHX C;  1DM0 B;  2HCI A;  2HDK A;  1WTH A;  5CV4 A;  5LMN L;  4HMI A;  1TWF B;  2NVQ H;  1CUK A;  3STB D;  3BAB A;  4NDX A;  1VKZ A;  5BWT A;  2QKI C;  5GRO A;  4M9U A;  1R9T H;  3AFQ A;  1NBW A;  3HOZ B;  4I7Z C;  2KOL A;  1IKM A;  3J80 E;  2RA4 A;  1TWH H;  1F9R A;  5I2Y A;  3GTG B;  1ENF A;  4OXP A;  1KEE A;  1W6J A;  2VPQ A;  1IYV A;  2L12 A;  3RV3 A;  1SDF A;  4UHV A;  2C35 B;  3SK4 A;  5EGT A;  2R7Z B;  4DV1 L;  3BU2 A;  1KJ9 A;  3RNU A;  1TVX A;  1O7Y A;  4O7L A;  1LTL A;  2HIX A;  1UNS A;  2Y0S G;  3RFC A;  2IT1 A;  4IHJ F;  2K5H A;  5D14 A;  1JB7 A;  3S14 H;  3QOL A;  4KHV A;  4QMG A;  2NUA B;  4O7V A;  2ZTE A;  3VR2 A;  4B3R Q;  5C44 G;  4IUR A;  4LFB Q;  4P75 A;  5DM7 3;  5C1P A;  2ATW A;  1WCM B;  3DTG A;  3GTP H;  2K05 A;  3N6R A;  5D1O A;  2YRW A;  4TVI A;  3R2T A;  2N78 A;  1FGB D;  1JOK A;  3KK7 A;  4R4O A;  2XSC A;  3J7Z C;  1KAW A;  2B2W C;  3BVM A;  3PF5 A;  2NTS A;  5JVD F;  4TV8 F;  1TY0 A;  2Q2T A;  2NN6 I;  3FPU B;  3M3Y H;  3TSS A;  3A7A B;  1DJR D;  4LF8 L;  4DR7 L;  2WIN B;  1AUX A;  5EBC A;  4FP5 D;  1NR2 A;  2N3S A;  1PRT C;  3TQT A;  1WJJ A;  3KDF A;  5EJW A;  4HJA A;  3EN2 A;  5D8D A;  4DKA C;  4FF3 A;  2K03 A;  1HTL D;  1XMQ L;  1ET9 A;  4RHS A;  1HR0 Q;  3CCU A;  3HOY H;  2JA5 H;  3HOW G;  2D2C C;  1N8R C;  2XNA C;  4KLK A;  1C0A A;  1CT1 D;  4KI0 A;  2B63 B;  5I5X A;  1ET6 A;  1EYD A;  1VQ7 A;  3FKI H;  3S17 H;  3I4N G;  2IL8 A;  2Z02 A;  3DAA A;  4YJ2 F;  5IYD G;  4G4K A;  1PH6 A;  1KDC A;  4BBR H;  4A3D G;  4HJ9 A;  2EVB A;  1N32 Q;  3VNN A;  4JI1 L;  1MJE A;  1UC9 A;  4MV8 A;  1TS3 A;  3JZI A;  4L1K A;  1KDA A;  2WAQ G;  4JW0 A;  3HOV G;  1HNW L;  1F9P A;  1BNC A;  1U0L A;  2CH4 A;  4BA2 I;  1Z6H A;  5GAG C;  3ZJY C;  4KJO A;  1EYA A;  1SNM A;  2B39 A;  5IYC G;  3GTK B;  1C7Y A;  4X6A H;  1KTA A;  4P2C B;  1I7N A;  1B3A A;  4F88 A;  3URY A;  2EYF A;  5LL6 X;  4PZ8 A;  3HOX G;  1E4E B;  3ICE A;  3JRX A;  4K2K A;  4JCV E;  3KF6 B;  3PIP A;  4LF6 Q;  2Z8L A;  5C44 B;  1ASY A;  4Q4D A;  4J8Q A;  4PMC A;  2I5H A;  3SGI A;  2OT2 A;  1GD7 A;  2X69 A;  2RCF A;  3CPF A;  4IQZ A;  2LXK A;  4M1U B;  2HT1 A;  2SNM A;  2ODT X;  3ONA B;  4IWY A;  3QFF A;  4DU9 A;  2ICE C;  2HGS A;  1OXX K;  3NQT A;  1H9R A;  5DEH A;  2L4N A;  5LL6 S;  1RKN A;  2EZV A;  1A2U A;  2VR1 A;  2VY3 A;  4ZUI A;  4K5V A;  1PTO B;  4DV1 Q;  1YNN D;  1TWC H;  2NVY H;  4G7O C;  3MFY A;  4RCN A;  2KHS A;  3PCO B;  3NQI A;  3PO3 G;  3TP5 A;  1NR4 A;  4JI8 Q;  3L9A X;  3TW7 A;  2NZH A;  2JA8 H;  3J81 j;  2JA6 H;  2GQR A;  2YV5 A;  3CC7 A;  5BN4 A;  1JKJ B;  4C5C A;  1YHA A;  2A5H A;  3CQZ H;  5DMX A;  3MXN B;  5HUR A;  3D4D A;  2UUC Q;  4EEQ A;  4A3D B;  1MSH A;  1NJI C;  4CDF C;  5IP9 H;  4A3M G;  1JE4 A;  2D0P A;  5C6A A;  4LF4 L;  4A3J G;  1ASZ A;  1GUN A;  4PMW A;  2QW7 A;  5AFW A;  4ALP A;  2AHO B;  3BDL A;  4MHE A;  1A9X A;  2WV6 D;  3KF8 B;  2FJ2 A;  4RMF A;  3ERQ A;  3H94 A;  2R92 H;  1TAE A;  2ZXO A;  2B2W A;  4A3B H;  5JJI A;  1GUG A;  2FPP B;  2QB5 A;  4MA5 A;  3IAY A;  4EGQ A;  2OWO A;  1I50 B;  2PI2 A;  4CDC C;  3KYH C;  2NVT B;  3OW2 A;  4FNF A;  1D5X C;  4X62 L;  4O7Y A;  1W6K A;  3I3C A;  3O13 A;  1FNV A;  1SR3 A;  4EVO A;  2R7L A;  1S5E D;  1Y1V G;  3PUV A;  3HOY G;  4ZUJ A;  4A3G B;  1SE4 A;  2Z6B A;  4HID A;  1HFG A;  4K2L A;  3A56 A;  1M4V A;  1KDB A;  4XYM B;  4O82 A;  1I94 L;  3NUC A;  3NBZ B;  3M7G A;  3GJX B;  4EFB A;  4LF8 Q;  3TME A;  5CV7 A;  3R5X A;  2SCU B;  1T9H A;  5CYU A;  4H02 A;  1Q8I A;  5HGT A;  2R86 A;  3MC0 B;  1A6X A;  3VR5 A;  2Z6K C;  1PH1 A;  3RZO H;  4GOP B;  1Q82 C;  1KUT A;  4JI2 Q;  4XT1 B;  3SDZ A;  2EJF C;  4RHR A;  4GNX B;  3GTL B;  3K5L A;  3F1Z A;  4DV0 L;  1PH2 A;  4LF7 Q;  1I4P A;  2VB2 X;  2CQA A;  4HJ8 A;  2WB1 E;  3Q6S A;  3K5M A;  2F4V L;  1QVC A;  1RL2 A;  4MNO A;  3WO0 A;  1HNX L;  2EY6 A;  1B70 B;  1Z9F A;  4A3J B;  2L0C A;  3PGZ A;  5D65 A;  5I9O A;  1XPR A;  5FPO A;  4WFN 3;  4YY3 L;  1STB A;  4GLX A;  3K5H A;  4MV3 A;  1PZI D;  1TY2 A;  5J3B A;  2R93 B;  3NP8 A;  2UU9 L;  1RTN A;  1EY4 A;  2FPI B;  3K81 C;  1AE2 A;  3GQB A;  1VCI A;  2Q8T A;  5KRU A;  3HG9 A;  2HVR A;  4MN3 A;  4XDX A;  2K6A A;  4MTN A;  3D6W A;  3UDG A;  3PUY A;  1WTV A;  5CV9 A;  4YIJ A;  3FRP B;  4FF4 A;  1U5K A;  3QJY A;  5KND A;  1KC7 A;  3K8A A;  2K5W A;  4JI6 Q;  2HVQ A;  4FGR A;  2QA4 A;  1T5E A;  2A6H D;  1A63 A;  4HTH A;  2JA8 G;  2CW0 D;  3J80 i;  5FPR A;  2R84 A;  3K57 A;  3K6O A;  3R8B A;  2JP1 A;  1VBH A;  3VPB A;  4CKE A;  1DIK A;  3HRZ C;  1YIJ A;  1ET0 A;  5BMV F;  1Q1E A;  2K52 A;  2L1B A;  3VYT A;  4ZKB B;  1YHQ A;  2YTY A;  4JI2 L;  2OXP A;  3K59 A;  2AQ1 B;  4BBS B;  3I8Z A;  4A3M H;  1Y1V H;  2IX1 A;  2F0F A;  4IPC A;  3L7Z C;  3TY8 A;  1VDZ A;  3H0G H;  1E24 A;  1CKN A;  5T1I A;  4NP5 A;  4DK6 C;  5COY A;  1I4G A;  4QB4 A;  3CW2 C;  1GHK A;  3MAQ A;  3BG5 A;  2V58 A;  1VQI A;  4O83 A;  3TW6 A;  1DAA A;  4GN3 B;  4CJ0 B;  5FKA C;  3V2T A;  2WYO A;  1HPC A;  1EY5 A;  2H5X A;  2AUJ D;  3S1M B;  4NXN Q;  1CSP A;  2K33 A;  1Q90 A;  3FEW X;  2G5D A;  5C5L A;  3R23 A;  3C1E A;  5KYI A;  4CBV A;  5IWA Q;  5KKN B;  1ZYR C;  4UPA A;  1HR0 W;  3OYY A;  2E2I H;  4DN4 M;  2MQH A;  2F0D A;  2M00 A;  2COI A;  2K32 A;  3SE0 A;  5FLM G;  2YWV A;  3GID A;  2C9O A;  3U9T A;  3A0J A;  4IAL A;  2D0O A;  5HGQ A;  1JJG A;  3E5N A;  3PN1 A;  3K5N A;  3AQQ A;  1KRT A;  1K83 H;  4FXK C;  3SE7 A;  4EQP A;  2AKW B;  5IYZ F;  3CD6 A;  1UE7 A;  3QG1 A;  4A3I G;  2V59 A;  2AQ2 B;  2JA7 H;  1FJG Q;  5CV5 A;  5CBE E;  4BY7 H;  4C3I G;  5M9O A;  4F8M A;  1HUM A;  1TWF H;  5H80 A;  4U68 A;  3P20 A;  4FO2 A;  3N52 A;  5BPH A;  1R9T B;  4C5B A;  3S1R B;  3TIN A;  1CFM A;  3HGB A;  5IGC A;  1TWH B;  4B3S Q;  3GTG H;  4K6L A;  2EJ3 A;  2XTI A;  3KBG A;  1G91 A;  1VF7 A;  5IIF A;  4XYL B;  4E6I A;  3W5O A;  1F9Q A;  2ICI A;  5EPJ A;  4ZLT F;  1N34 L;  2W70 A;  3GTM H;  1EOT A;  2EJM A;  1KD1 C;  1OXV A;  2EYL A;  1A8V A;  1LTB D;  1JC7 A;  3FHW A;  1PZK D;  2R7F A;  4YWM A;  4DAP A;  3EA6 A;  1V8Q A;  1HA5 A;  4KV6 A;  1A3V A;  2Q2H A;  5IP7 H;  1GKH A;  1K28 A;  3T16 A;  4LF7 L;  1M0W A;  4EX5 A;  1K9M C;  1KJQ A;  1D8L A;  1IYU A;  2E2D C;  3H0G G;  3J7A V;  1WCM H;  1RF2 D;  1EKV A;  3GTP B;  1F2L A;  1KHI A;  2K7V A;  1SSO A;  2KA7 A;  5JVH 3;  4IFD J;  5I5S A;  1SRU A;  3HKS A;  1B9N A;  4AQY Q;  2A69 C;  4XQN A;  1O7L A;  2NBF A;  1HFN A;  1T36 A;  2CNU A;  3HKZ G;  1WD1 A;  1BUV T;  5FJ8 H;  4X66 Q;  4JI4 Q;  3TN2 A;  5H1S E;  1MD2 D;  4FF2 A;  1XNQ Q;  1VQ5 A;  2F0V A;  4DK3 C;  1PMR A;  1Y1W G;  1YI2 A;  2KEC A;  2AWO A;  2F0E A;  1WTP A;  5C4X G;  1K8O A;  2EQS A;  4WRD A;  1HNW Q;  4LH7 A;  4X3S A;  1SND A;  1W3S A;  4YWL A;  4GKJ L;  1ICF B;  1BOS A;  2JA5 B;  4A3C H;  2GVA A;  4EFE A;  3CCJ A;  3S2H H;  3S17 B;  1W2B A;  1S5D D;  5KX5 F;  2DAA A;  5FO9 B;  3NBI A;  5JJZ A;  3V05 A;  3BVG A;  1HZ9 A;  3MEF A;  3HEJ A;  2JA7 G;  3LNN A;  2R6G A;  4AIM A;  2YYZ A;  4DK0 A;  1I1K A;  3AU7 A;  3LP8 A;  4NXN L;  1ONL A;  3BDO A;  4DAA A;  4JI5 L;  4CC5 A;  4JXU A;  2R7K A;  3P75 A;  4A3G G;  4C3J B;  1NY4 A;  2XN9 C;  2UXB Q;  4RKB A;  1JJ2 A;  3TP7 A;  1HZB A;  1QIL A;  1C4Q A;  5C44 H;  4UFZ A;  4RWS C;  4R4I A;  3UI2 A;  4ZKC B;  4RCO A;  1H9J A;  1DYQ A;  1HCZ A;  1X56 A;  1HRJ A;  4Q0F A;  4FXD A;  3OTO L;  4BY7 G;  2QEJ C;  3DF7 A;  1IBK L;  1E1T A;  2I5L X;  3H91 A;  3A5U A;  2FFK B;  2GA4 B;  1VQ9 A;  3HS0 C;  4GKK Q;  2BOS A;  4GN4 B;  4O4I F;  2N49 A;  5M3M H;  3OOC A;  1LTA D;  3TZU A;  3VR3 A;  1TS2 A;  3X3N A;  3WWI A;  3MXU A;  1SNO A;  5JQW A;  1PTO H;  1H9S B;  2BCO A;  4LF9 Q;  1TWC B;  2L11 A;  2NVY B;  5DAU A;  1OXS C;  5BWX A;  5BWV A;  1EUC B;  5L37 A;  4UP7 A;  4XXE A;  3BJU A;  3GD7 A;  3C1F A;  1EWI A;  1LTT D;  1YHB A;  4HCS A;  1QCB D;  4JYA L;  5C5M A;  2JA6 B;  1W96 A;  4ABN A;  4ID6 A;  1DON A;  4O4L F;  3D3R A;  5IGD A;  3I4N H;  1NAP A;  4DF7 A;  3CQZ B;  5IYD H;  4O4H F;  1NSN S;  4HMJ A;  3MJF A;  3JZ6 A;  3HKZ E;  3BVZ A;  3KBX A;  4A3D H;  1PH4 A;  1PRT D;  4DFA A;  1PH9 A;  1CHP D;  2YRX A;  1UAP A;  4OWT B;  2E2J H;  4IFD G;  5COR A;  2IY5 B;  5HNE A;  4KHP Q;  4A3C G;  3LUL A;  2BA1 A;  2NN6 H;  3Q8D A;  2DWC A;  4A4I A;  4DK1 A;  1STN A;  2SNS A;  3KF6 A;  3VYU A;  4ULL A;  4LUZ A;  3JZF A;  4YB8 B;  1ILQ A;  1TKW B;  3R93 A;  1WRV A;  4A3B B;  2AWN A;  5LMN W;  4NXM L;  4LW1 A;  3CC2 A;  5BN3 A;  1LT5 D;  1A3G A;  2Y4R A;  1I50 H;  1VQE A;  2X6G A;  1STH A;  2OTL A;  4BY1 H;  1NMG A;  2HHH Q;  3VA5 A;  5KYL A;  1SMY C;  2DAB A;  5J22 A;  4RZQ A;  1WTW A;  4O7Z A;  2X6L A;  3AFP A;  2ZM6 L;  3M4Y A;  3GB8 B;  3TIG A;  1Z7T A;  1BF4 A;  2DUD A;  5C0X J;  4A3G H;  2PN1 A;  3PO2 B;  1L0Y B;  4JC0 A;  3KOJ A;  1EY6 A;  1EY0 A;  3TP8 A;  1Q81 C;  3I2Z A;  2JEB I;  1VF5 C;  3OSO A;  3U4V A;  1GSH A;  2A1H A;  4JVZ A;  3FPP A;  4KTA A;  4CKC A;  1AZQ A;  2CCZ A;  1U9R A;  3CME A;  1UE5 A;  3I72 A;  2CWP A;  5A2Q E;  4MV9 A;  3F8T A;  3CC4 A;  1X3G A;  4J6H A;  3RZO B;  2C00 A;  2XGT A;  3M9B A;  4JPB W;  1PX2 A;  2BDO A;  2E5L Q;  4X64 Q;  4DV4 Q;  1OBG A;  2WAC A;  4ZCK A;  4LAA A;  3GTL H;  4XTC S;  3UZO A;  4K6D A;  5M5W H;  1TWG H;  4DAV A;  5EAY A;  1I6H B;  4IUP A;  1B50 A;  1XNR Q;  4LFB L;  2NVX B;  3PIP 3;  1IHZ A;  2IHF A;  4P73 A;  2GN5 A;  1L1O A;  4A3J H;  1BNZ A;  3NBH A;  3L0O A;  1YIT A;  2A73 B;  1BCP B;  2FHT A;  4X62 Q;  4DUZ Q;  2R92 G;  3BDC A;  4DR3 L;  3S15 B;  2FXQ A;  1VMP A;  4CE5 A;  3G7L A;  5C4Z A;  3DHQ A;  3LWB A;  5IT9 c;  1PRT F;  2FP4 B;  2MJ8 A;  3CHB D;  1EYG A;  2MO0 A;  2F0W A;  2SOB A;  3T9B A;  3JAM i;  4I4T F;  4UCU A;  3CRK C;  5JJK A;  1XNQ L;  2R7Z G;  2OF1 A;  5JQG F;  1KL9 A;  1IYJ B;  3OIP A;  4LMQ D;  3MZ5 A;  4EGV A;  3OWF A;  1J5E Q;  1SMX A;  2QK4 A;  4XX0 B;  4YAJ B;  4KY6 A;  2UUC L;  5GAD C;  3P7J A;  1HH2 P;  1NCV A;  3EFX D;  1HZA A;  1A62 A;  3T1Y L;  3NBY B;  4HED A;  1SE3 A;  4A3M B;  1F9S A;  4L8J A;  4LJZ C;  4HIK A;  1M90 C;  2ENB A;  2Q8I B;  4IFD H;  1C9O A;  2RDF A;  3H0G B;  2K50 A;  4OO1 G;  2KCC A;  4IPH A;  2JE6 I;  2EY1 A;  3T99 A;  3IFT A;  4JBJ A;  4O81 A;  5LHY 1;  4TQU S;  4R4Q A;  4MA0 A;  2ZM6 Q;  1PH5 A;  3H3V H;  3UQ8 A;  1B2T A;  3HOV B;  4A75 A;  3PV0 A;  3S1M H;  2NUC A;  3U50 C;  3PSI A;  3PUX A;  4C3H B;  1G51 A;  1AZP A;  3C2P A;  1WTR A;  2J4X A;  2B2T A;  4DIM A;  3WOF A;  1Q1B A;  2WFW A;  3NTK A;  5FO8 B;  4JI3 Q;  2KBN A;  2F0Q A;  2D5D A;  2PCF B;  3WNZ A;  2A6E D;  2B63 G;  1CI3 M;  5IOD A;  2W6N A;  5GAE C;  4DV5 L;  4KD3 A;  1Q12 A;  2RF4 A;  4A3I H;  3W3A A;  1WR2 A;  4HNU A;  3M85 A;  2W71 A;  1EQT A;  2DNE A;  4Y7N B;  1F2Y A;  1K83 B;  2VQF L;  1D1I A;  1QZH A;  3J80 L;  5K36 G;  5BPF A;  2F4V Q;  1A3T A;  1FNU A;  5BWR A;  3JAM L;  4C2M B;  1GUO A;  1FJG L;  3TY9 A;  2PO4 A;  2K04 A;  1PH3 A;  1KNA A;  2WAQ E;  4RGM A;  3S16 H;  3TS2 A;  2HHF A;  4XIG S;  3TEH B;  3BYY B;  5D1P A;  1CQV A;  3UE0 A;  1CKN B;  4DXF A;  1MSG A;  3TRZ A;  1AW7 A;  5JPM C;  5FO7 B;  3S1R H;  5EQ0 A;  5CR5 A;  2GVB A;  4DNT B;  1NNX A;  1PV4 A;  2UXD L;  4AH6 A;  3T9F A;  2MO1 A;  2MP1 A;  4XQQ A;  3T9A A;  3S24 A;  4WJ4 A;  2RDG A;  1ZEQ X;  4J15 A;  1TR5 A;  4R4C A;  3TII A;  3GTM B;  2E76 C;  5C3E H;  1AP0 A;  1S5F D;  3HOW H;  4A3F G;  4TUY F;  1U4R A;  2E74 C;  2ZJQ A;  1XPU A;  2K14 A;  1HHV A;  4GKK L;  2RSN A;  3CSW A;  2A6H C;  2UUA L;  3NHH A;  2K28 A;  4IIJ F;  4O7W A;  5J2T F;  2CW0 C;  3W1G A;  2B2Y C;  4LNQ A;  4QCL A;  4UCR A;  3ULL A;  5CM0 A;  5CGK A;  2EJ0 A;  4UY8 C;  1SJH D;  3I4M H;  1HQM C;  4G7H C;  1KXL A;  3IKJ A;  2CZG A;  3AYH B;  1E7Z A;  3KF8 A;  2BE5 D;  4FXG C;  3T13 A;  3UE1 A;  1I4H A;  4JI7 L;  1SRO A;  3QO2 A;  2D9U A;  2CKZ B;  4R8I A;  2IP4 A;  1V1P A;  2PQE A;  1WFQ A;  4A3K G;  3HOX H;  2N55 A;  5FLM H;  1MIU A;  1JWS D;  4X65 L;  3PIO A;  4NPS A;  1VQN A;  5ELC A;  4NW2 A;  1E1O A;  5IYB G;  2PZW A;  3GO5 A;  3S9W A;  4GZY C;  1QUQ B;  4HCE A;  1PVO A;  2XWB B;  1ZYR D;  4K5X A;  2EIY A;  3S2H B;  1Z47 A;  1JMC A;  2UXC L;  1QUQ A;  2HQE A;  1I1M A;  4AYB E;  3RTX A;  2YZM A;  5J2U F;  1DOK A;  4LH6 A;  2YW2 A;  4K6N A;  5M3F H;  1A2T A;  4DAY A;  1B3Q A;  3VR4 A;  4JOI C;  4H44 C;  3RLN A;  4OX9 L;  2KQ3 A;  1NMF A;  1DGS A;  2I46 A;  3T7A A;  1JE5 A;  3U55 A;  2W6Z A;  2VB3 X;  1QVG A;  2Q7D A;  3Q22 A;  1DOL A;  2HDM A;  3IFD A;  3HZX A;  2I0Q A;  5DAA A;  5E4X A;  2RBM A;  1E2W A;  1NTG A;  5I6W A;  1V1P B;  2Z04 A;  5BWW A;  2JJQ A;  3CAM A;  4BBS G;  4O0A A;  5FJ8 G;  2UUB L;  1X55 A;  2CHB D;  2PZT A;  1ROD A;  3Q1K A;  4C3J H;  5C4H A;  2OQ0 A;  4Q5V A;  1CQI B;  4GNX A;  1VQB A;  3WWJ A;  1D5M C;  1E3P A;  4G7Z C;  2NTT A;  4HTP A;  4KKU A;  4NZM A;  4GOP A;  4ZI7 F;  2PQA A;  4P72 A;  2N8N A;  3RN5 A;  5AJ3 L;  1JR0 D;  1AE3 A;  5BWU A;  5J1Z A;  4HQ6 A;  4N9P A;  4L5S A;  3QOJ A;  4JG2 A;  3T1H L;  1PTO C;  2Z4I A;  3T4A C;  1SYC A;  1YVC A;  2VUG A;  2YZL A;  2CNV A;  5M3M B;  1WVL A;  4FE2 A;  1EY8 A;  1QNU A;  4X3K A;  4A93 H;  2EJG C;  1IBL L;  4L5R C;  1SNC A;  2QCP X;  3A5Z B;  4FFP A;  3MXN A;  4DQN A;  4UCT A;  4APV A;  1X9N A;  4UCV A;  1CHQ D;  1I5F A;  4N8F A;  5C4X H;  4RAU C;  4OIJ A;  2ZJR A;  2YTX A;  5EKL A;  2FB9 A;  1SN8 A;  1LTS D;  2F0P A;  3ERO A;  2F0J A;  1AN8 A;  1VQJ A;  2A69 D;  4A3E H;  3I4N B;  2XWJ B;  4JV5 L;  1BXR A;  3GTJ H;  3VPD A;  4Z9C B;  4C3I B;  4JI0 Q;  5CV6 A;  4GLA C;  1HR0 L;  4NZN A;  3J81 c;  1SAP A;  1XYI A;  4LWC A;  1FD7 D;  4UP8 A;  2KEN A;  2OCE A;  3SVM A;  2YZG A;  5F2D A;  3H3V I;  2E2J B;  1D1K A;  1OBD A;  4DR7 Q;  2HIV A;  2OQK A;  1CE8 A;  4FVM A;  4KHP L;  2V1C C;  1CA6 A;  2F0O A;  4RG1 A;  2WII B;  5E3F A;  3PUW A;  3ULJ A;  1EYZ A;  2PW5 A;  3MHB A;  5LMU Q;  4H0L C;  4BY1 G;  1EHI A;  5C4J H;  1XK5 A;  1M6V A;  2NU7 B;  2Q2I A;  2NYZ D;  2PMZ E;  1RCV D;  5IWA L;  2KJX A;  3I90 A;  1XTD A;  3JAM E;  5KS8 A;  4K0K L;  2YTV A;  2G9D A;  4TRD A;  4BY1 B;  2UXC Q;  1UE1 A;  3G8C A;  1Q46 A;  5LA6 F;  1N33 L;  4QGU A;  3LWU A;  1GLV A;  4ZK9 B;  1TQO A;  3D8G A;  2KCM A;  4YCU A;  5CA0 F;  1X54 A;  2R61 A;  1MI2 A;  4IWX A;  1X3F A;  3PO2 H;  3GDE A;  1V1O A;  1WD0 A;  5BN5 A;  2CNQ A;  3EQL C;  2VUM B;  1Q3L A;  3R5F A;  3A8I E;  2HCC A;  2EYM A;  1RHP A;  4R9W A;  2C5C A;  4OGQ C;  2EYO A;  3CKI B;  2F0H A;  5EBD A;  2LY7 A;  5EZY F;  3KJP A;  4DR5 L;  5KGU A;  1C8C A;  2VUM G;  2ZDQ A;  1H9S A;  2IX0 A;  2J0T D;  1L2F A;  4V0B A;  3I4L A;  1P16 A;  4EG0 A;  1I6V C;  1JOQ A;  1WTQ A;  4IUV A;  1HNZ L;  1VQC A;  2ZT9 C;  2EXD A;  1CM9 A;  3W2D A;  5I6Y A;  2W6Q A;  4CC6 A;  4H7B A;  1QNK A;  1VQP A;  5M5W B;  4OO1 I;  1TWG B;  4C3J G;  4HIM A;  1N36 L;  2OTJ A;  1IOW A;  1I6H H;  4PBC A;  1CKO A;  1QJO A;  5E7N A;  3A74 A;  2ALY B;  2NVX H;  4QY7 A;  3I70 A;  3WWV A;  3U4Z A;  3VMM A;  1MBY A;  5BR8 L;  2Q8R E;  1SFO B;  4LFA L;  1N33 Q;  3DEP A;  4DRF A;  3MFG A;  3V4Z A;  1ML0 D;  4RGN A;  4P74 A;  3BYT B; 
#chains in the Genus database with same CATH homology
 1YHB A;  5D1O A;  4JYA L;  4UCO A;  2JA9 A;  4DV6 L;  3LGJ A;  3E9I A;  3K0X A;  4JOI A;  2N78 A;  1PH8 A;  3G48 A;  3S15 H;  4R4O A;  4JI7 Q;  3J7Z C;  1KAW A;  3PF5 A;  2Q2T A;  3I4N H;  2NN6 I;  1MKH A;  3M3Y H;  5IYD H;  3F2D A;  4LF8 L;  3HKZ E;  1G29 1;  4DR7 L;  3G71 A;  4DUY L;  4A3D H;  1PH4 A;  2N3S A;  1XMQ Q;  3E9H A;  2ZTC A;  1PH9 A;  1XMO Q;  3EIV A;  1WJJ A;  3KDF A;  1X6O A;  4QJF A;  4OWT B;  2E2J H;  4HJA A;  4IFD G;  2QGQ A;  2IY5 B;  3J80 c;  3EN2 A;  4KHP Q;  4DKA C;  4A3C G;  1HR0 Q;  1XMQ L;  4DR6 Q;  1BBU A;  2BA1 A;  3Q8D A;  4MZ9 A;  4A4I A;  3CCU A;  3HOY H;  1N34 Q;  2JA5 H;  3KF6 A;  3AEV A;  3HOW G;  1N8R C;  1WI5 A;  4B3M Q;  4KLK A;  1C0A A;  4LUZ A;  4KI0 A;  3J81 i;  1Q8K A;  1VQ7 A;  3FKI H;  2VQF Q;  3S17 H;  2MNA A;  3I4N G;  2K5V A;  2AWN A;  5LMN W;  1XPO A;  1KQS A;  4NXM L;  4LW1 A;  5IYD G;  3CC2 A;  1PH6 A;  4DV5 Q;  1I50 H;  1BKB A;  1VQE A;  1S3O A;  2EIF A;  4BBR H;  1V9P A;  4HJ9 A;  2OTL A;  4A3D G;  4IFD I;  4BY1 H;  1NMG A;  2HHH Q;  1N32 Q;  3VNN A;  3M4O H;  4JI1 L;  1MJE A;  4JI3 L;  1K73 C;  2WAQ G;  1LM0 A;  3AFP A;  2RHQ B;  2ZM6 L;  4LF6 L;  2JQO A;  3HOV G;  1HNW L;  3GB8 B;  1U0L A;  3JC6 6;  4BA2 I;  2DUD A;  3S1N H;  5C0X J;  4A3G H;  3TY9 A;  5GAG C;  3ZJY C;  3RN2 A;  2K5N A;  1J6Q A;  5IYC G;  3HOU G;  4LH7 A;  1C7Y A;  4X6A H;  3S1Q H;  4JC0 A;  3KOJ A;  2CFM A;  2JK8 A;  3HOX G;  4PZ8 A;  3HOV H;  2ZTD A;  1Q81 C;  3ICE A;  3T1H Q;  3I2Z A;  2JEB I;  3KF6 B;  3M4P A;  4JCV E;  3U4V A;  3PIP A;  4LF6 Q;  3HOZ H;  2JEA I;  4BBR G;  4C3H H;  3CF5 A;  2BH2 A;  2CCZ A;  5AJ3 Q;  4QQB X;  1ASY A;  3CME A;  1UE5 A;  2I5H A;  3SGI A;  2CWP A;  2ES2 A;  1GD7 A;  1GO3 E;  3CPF A;  3F8T A;  5IE8 A;  3CC4 A;  1X3G A;  1RIP A;  2LXK A;  2HT1 A;  4B3S L;  4B3T L;  1VS0 A;  1I3Q H;  2XGT A;  3M9B A;  1WOC A;  2R7Z H;  4WJ3 M;  1KRS A;  3D31 A;  3NEN A;  3GTO H;  2E5L Q;  1OXX K;  4X64 Q;  4DV4 Q;  4Y7N H;  3GTL H;  1YJ9 A;  4XTC S;  1VQ8 A;  4A76 A;  3BA8 A;  4DR4 L;  1Y14 B;  5IP7 G;  5M5W H;  2VQE L;  1HJP A;  1TWG H;  1V43 A;  5EAY A;  4GLV B;  5JEA G;  4DR1 L;  1XNR Q;  2RHS B;  2VY3 A;  4C2M H;  4LFB L;  3FKI G;  2A8V A;  2HVS A;  4OWW B;  4DV1 Q;  4ME3 A;  4JBM A;  1TWC H;  2IHF A;  2NVY H;  3K7U C;  2GN5 A;  4P73 A;  1L1O A;  3OTO Q;  4A3J H;  1N36 Q;  4A3L H;  4E6N A;  1JT8 A;  3PCO B;  3L0O A;  4PG3 A;  3PO3 G;  1EIF A;  1YIT A;  4IOA A;  3I4O A;  4JI8 Q;  1LYL A;  2NZH A;  2F52 A;  4DR5 Q;  1M1K C;  1HNZ Q;  2JA8 H;  4X62 Q;  3CXC A;  3J81 j;  4DUZ Q;  2JA6 H;  2R92 G;  2YV5 A;  3CC7 A;  4DR3 L;  4EQ5 A;  2FXQ A;  3U58 A;  4JI8 L;  5GAH C;  1YHA A;  1WYD A;  1A0I A;  3CQZ H;  1XJV A;  3MXN B;  2VS1 A;  1VQF A;  5IT9 c;  4BXX H;  2UUC Q;  2UUA Q;  4EEQ A;  1N9W A;  3IRB A;  2MO0 A;  4YHH Q;  1NJI C;  1EYG A;  5IP9 H;  4A3M G;  3JAM i;  4UCU A;  5M5X H;  2DGY A;  2D0P A;  3W1B A;  4DV2 L;  4LF4 L;  5JJK A;  5M5Y H;  4A3J G;  1ASZ A;  4PMW A;  1XNQ L;  2R7Z G;  4B3R L;  4KHZ A;  4ALP A;  2AHO B;  2A1A A;  3PO3 H;  3CPW A;  1IBM L;  1KL9 A;  1IYJ B;  1PFS A;  3KF8 B;  4X65 Q;  4RMF A;  3K80 C;  3KDF B;  2R92 H;  4YCV A;  1TAE A;  3JSL A;  1J5E Q;  1SMX A;  4PZ6 A;  5HY6 A;  4LUV A;  2B63 H;  4A3B H;  5JJI A;  4IJH A;  2UUC L;  1BBW A;  5GAD C;  1L0W A;  4POG A;  2UXD Q;  1HH2 P;  2Z0S A;  4DPG A;  2OWO A;  2K75 A;  1VQD A;  1HZA A;  2PI2 A;  3B6Y A;  3KYH C;  1A62 A;  3T1Y L;  1L1O C;  3OW2 A;  4K0K Q;  4TVA B;  3NBY B;  3KJO A;  3EBE A;  3F2C A;  4X62 L;  4HIK A;  1M90 C;  1C9O A;  2K50 A;  4HTO A;  2KHJ A;  4OO1 G;  5D1O B;  4YY3 Q;  1SR3 A;  4GNX C;  3BAA A;  4IPH A;  2ASB A;  2JE6 I;  3RR5 A;  1Y1V G;  3ULP A;  3PUV A;  3HOY G;  4JBJ A;  1OXU A;  3KFU A;  2PNH A;  4TQU S;  4HID A;  3UDI A;  4R4Q A;  3GTK H;  4L5T A;  2ZM6 Q;  1PH5 A;  3H3V H;  3UQ8 A;  1I94 L;  4DR1 Q;  5IP9 G;  3NBZ B;  2K4K A;  4A75 A;  3PV0 A;  3S1M H;  1FL0 A;  3D0F A;  3U50 C;  1K8G A;  3GJX B;  4EFB A;  3PSI A;  4LF8 Q;  3PUX A;  1VQL A;  1G51 A;  5IYC H;  1T9H A;  4UP9 A;  3BZC A;  4H02 A;  1Q1B A;  2WFW A;  4JI3 Q;  4BXX G;  2KBN A;  4JI0 L;  4X64 L;  4DV4 L;  4QL5 A;  1E22 A;  4JI1 Q;  2B63 G;  1PYB A;  2Z6K C;  1PH1 A;  3RZO H;  1Q7Y C;  4GOP B;  1Q82 C;  5GAE C;  4B3T Q;  5JJL A;  4DV5 L;  4JI2 Q;  1SLJ A;  1Q12 A;  2R93 G;  2RF4 A;  1YEZ A;  4A3I H;  3CCS A;  3M85 A;  3I4M G;  4GNX B;  2BA0 A;  3CCE A;  4LF9 L;  2ZJP A;  3F1Z A;  2VQF L;  3CCQ A;  1QZH A;  4DV0 L;  1PH2 A;  2WP8 J;  5K36 G;  4LF7 Q;  2F4V Q;  3G4S A;  3HOZ G;  4HJ8 A;  1I94 Q;  4A3L G;  2WB1 E;  2F4V L;  4DV3 Q;  3TRE A;  1FJG L;  1QVC A;  1RL2 A;  5C0X I;  4MNO A;  1PH3 A;  2WAQ E;  4A3B G;  3S16 H;  3TS2 A;  4XIG S;  1HNX L;  1B70 B;  3TEH B;  1Z9F A;  1HNX Q;  5D1P A;  4X66 L;  3PGZ A;  3UE0 A;  1XPR A;  3K7A H;  3RLF A;  4DV0 Q;  3S2D H;  5FPO A;  4YY3 L;  1CKN B;  4GLX A;  3PF4 A;  1VQH A;  4AYB G;  3T1Y Q;  3TRZ A;  3S1R H;  1S72 A;  5J3B A;  3L2P A;  2GVB A;  3NEM A;  1PV4 A;  2UXD L;  2UU9 L;  2CQO A;  2HQL A;  2NZO A;  1X65 A;  4AH6 A;  2MO1 A;  3K81 C;  4GS3 A;  1AE2 A;  5C3E G;  1EFW A;  1VCI A;  3S24 A;  3CCV A;  4WJ4 A;  3TS0 A;  1EQQ A;  2UUB Q;  2HVR A;  2UXB L;  2VZA A;  4PZ7 A;  2JA6 G;  4JYA Q;  4J15 A;  4NXM Q;  1K0R A;  1FVI A;  1OXT A;  4R4C A;  4LFA Q;  5BR8 Q;  1PH7 A;  4MTN A;  5C3E H;  3UDG A;  2LSS A;  4Y52 H;  1BVS A;  4A3F G;  2WB1 G;  3PUY A;  3HOW H;  2CWA A;  1U5K A;  1EIY B;  2ZJQ A;  2K14 A;  1XPU A;  4GKK L;  4A3K H;  1B7Y B;  3K8A A;  4JI6 Q;  2QA4 A;  2Z6K A;  2UUA L;  4DNI A;  2E8G A;  1O7I A;  4JBK A;  4LF4 Q;  3J80 i;  2JA8 G;  1YNX A;  1A63 A;  5FPR A;  2YU9 H;  3W1G A;  4L5Q A;  4R4T A;  4LNQ A;  4UCR A;  3ULL A;  1YIJ A;  5JEA J;  1Q1E A;  2K52 A;  3F2B A;  1YBY A;  1YHQ A;  2Q2U A;  3TY5 A;  2D62 A;  2YTY A;  3I7F A;  4OON A;  4DUZ L;  1YJN A;  4DUY Q;  4UY8 C;  1P8L A;  3RZD H;  4JI2 L;  3KLW A;  3I4M H;  3UDX A;  1KXL A;  2NVT H;  1YZ6 A;  5M3F G;  1CSQ A;  3AYH B;  5FLX c;  1E7Z A;  4A3M H;  5GQO A;  1Y1V H;  2IX1 A;  4IPC A;  3L7Z C;  3UE1 A;  4DAY B;  3HFZ B;  4IPD A;  3H0G H;  1E24 A;  1CKN A;  1SRO A;  4DK6 C;  4JI7 L;  3TY8 A;  2CKZ B;  1B8A A;  1FGU A;  1EOV A;  3UDF A;  1WFQ A;  3CW2 C;  4A3K G;  3HOX H;  2QEX A;  4C3I H;  5FLM H;  1MIU A;  1VQI A;  3NEL A;  4GN3 B;  4POF A;  4X65 L;  3PIO A;  4NPS A;  2KHI A;  2H5X A;  1VQN A;  2E5L L;  4NXN Q;  1CSP A;  5LMN Q;  1GM5 A;  4YCW A;  1IBM Q;  1E1O A;  2B3G A;  5IYB G;  2A19 A;  3E0E A;  3DLL A;  3GO5 A;  1QZG A;  1H95 A;  4DR2 L;  3JAM c;  1PHJ A;  4P71 A;  5IWA Q;  1QUQ B;  4LF5 Q;  1PVO A;  4A93 G;  1VQK A;  4UPA A;  1HR0 W;  3OYY A;  2E2I H;  2MQH A;  1Z47 A;  5IYB H;  1JMC A;  1VQO A;  2UXC L;  1K3R A;  1QUQ A;  2JA5 G;  1UEB A;  4AYB E;  5ELO A;  5FLM G;  2I5M X;  4LH6 A;  3RTX A;  3A0J A;  3CP0 A;  2D0O A;  5HGQ A;  3ERS X;  5LMU L;  1JJG A;  3PN1 A;  1Q86 C;  3AQQ A;  1KRT A;  5DIS C;  1K83 H;  5M3F H;  2VL6 A;  2AKW B;  1X3E A;  4HJ5 A;  2RCN A;  3BZK A;  4JOI C;  2LXJ A;  3RLN A;  3TQY A;  4HJ7 A;  1KIX A;  4OX9 L;  3CD6 A;  1UE7 A;  1NMF A;  4GKJ Q;  1DGS A;  4FDB A;  1TXY A;  4A3I G;  1XDN A;  3BA9 A;  1JE5 A;  2JA7 H;  4DV3 L;  1FJG Q;  4DR4 Q;  1VQM A;  1QVG A;  4BY7 H;  4IO9 A;  1JJC B;  2I0Q A;  1S40 A;  2F3I A;  1NTG A;  1TWF H;  1TA8 A;  2JJQ A;  2AMC B;  3CAM A;  3H15 A;  4O0A A;  5FJ8 G;  2UUB L;  4BBS G;  4JBW A;  1X55 A;  3CCR A;  2B29 A;  3RLO A;  2VUM H;  1MJC A;  4C3J H;  1G6P A;  2OQ0 A;  2HHH L;  1N32 L;  2R93 H;  4YWK A;  1NE3 A;  4QIW E;  4GNX A;  4GOP C;  1VQB A;  4B3S Q;  3GTG H;  1E3P A;  2PQA B;  2XTI A;  1VQG A;  4HTP A;  4GOP A;  3VDY A;  4UCS A;  2PQA A;  4P72 A;  3W5O A;  2N8N A;  4O2D A;  5IY0 A;  5AJ3 L;  3RN5 A;  1KC8 C;  1AE3 A;  4HIO A;  1N34 L;  3GTM H;  4L5S A;  1KD1 C;  1OXV A;  4JG2 A;  3T1H L;  2VUG A;  4DV7 L;  1A8V A;  1YVC A;  4IJL A;  3FP9 A;  4IOC A;  4LFC Q;  4DV7 Q;  3FHW A;  3CMA A;  2R7F A;  5ELN A;  4JI6 L;  4GN5 A;  4YWM A;  4A93 H;  1K8A C;  2HVQ A;  1XNR L;  2BH8 A;  1IBL L;  3QWU A;  1WCM G;  4L5R C;  3A5Z B;  4UCT A;  2R7D A;  2Q2H A;  5IP7 H;  1GKH A;  1TWA H;  3CCM A;  4JI4 L;  4APV A;  1SFO H;  1X9N A;  4UCV A;  4LF7 L;  4EX5 A;  1K9M C;  1UWV A;  4JV5 Q;  1D8L A;  1I5F A;  3H0G G;  5C4X H;  1WCM H;  2ZJR A;  2IHE A;  1SE8 A;  2YTX A;  4BBS H;  1SN8 A;  1KHI A;  1IXR A;  2KCT A;  4DAM A;  3I55 A;  4IFD J;  4AQY L;  1SRU A;  3HKS A;  1VQJ A;  2UU9 Q;  4B3M L;  1LUZ A;  4AQY Q;  4A3E H;  1S68 A;  4JV5 L;  3GTJ H;  4JI0 Q;  4GLA C;  1HR0 L;  1Y1W H;  2ID0 A;  3J81 c;  1VQA A;  4LWC A;  4BA1 I;  1VQ6 A;  3HKZ G;  4LUO A;  3M7N A;  5FJ8 H;  4X66 Q;  4UP8 A;  4JI4 Q;  2KEN A;  2OCE A;  5H1S E;  1IBL Q;  4A3E G;  3I56 A;  3NC0 B;  1XNQ Q;  3H3V I;  1VQ5 A;  4DK3 C;  4OWX B;  1AH9 A;  4DV2 Q;  1B04 A;  1Y1W G;  1QVF A;  2HIV A;  4DR6 L;  2OQK A;  4LFC L;  2AWO A;  1YI2 A;  4DR7 Q;  5C4X G;  1YJW A;  2V1C C;  4YHH L;  4KHP L;  2EQS A;  4RG1 A;  3PUW A;  1HNW Q;  3ULJ A;  1IBK Q;  1W3S A;  4YWL A;  3CCL A;  4GKJ L;  5C0X G;  2VNU D;  3PO2 G;  4A3C H;  5LMU Q;  3GTQ H;  1VQ4 A;  2GVA A;  4BY1 G;  4EFE A;  5C4J H;  3CCJ A;  3S2H H;  1XK5 A;  3M4Q A;  2MFI A;  2Q2I A;  4NB3 A;  1W2B A;  2PMZ E;  5IWA L;  1PYS B;  4DR2 Q;  3DM3 A;  1XTD A;  4K0K L;  1HZ9 A;  2YTV A;  2UXC Q;  1UE1 A;  3MEF A;  2JA7 G;  2L15 A;  1EUJ A;  1Q46 A;  5DLQ E;  3HOU H;  1CKM A;  3ER0 A;  1N33 L;  2R6G A;  4QGU A;  4JI5 Q;  3J7A 5;  4AIM A;  4LF5 L;  2YYZ A;  4IPG A;  3G6E A;  2KCM A;  4YCU A;  1X54 A;  4NXN L;  1J5E L;  4R1J A;  4JI5 L;  1X3F A;  5LMN L;  3PO2 H;  3JSN A;  2NVQ H;  3GDE A;  4CC5 A;  1CUK A;  3STB C;  3STB D;  1PA6 A;  3BAB A;  1XMO L;  5GRO A;  4A3G G;  1R9T H;  3AFQ A;  1NBW A;  1NY4 A;  2UXB Q;  4OX9 Q;  4DR3 Q;  1JJ2 A;  1HZB A;  3NBH B;  4UFZ A;  5C44 H;  1TWH H;  4R4I A;  1L1O B;  3KJP A;  4OXP A;  4DR5 L;  2VUM G;  3GTP H;  2Y0S E;  2IX0 A;  1X56 A;  1L2F A;  4A3F H;  1GVP A;  4DV6 Q;  1P16 A;  2C35 B;  3OTO L;  1IZ6 A;  4BY7 G;  1IBK L;  1E1T A;  2I5L X;  3A5U A;  4DV1 L;  1HNZ L;  3BU2 A;  3RNU A;  1VQ9 A;  1VQC A;  4GKK Q;  2EXD A;  4GN4 B;  1LTL A;  2HIX A;  2N49 A;  2NN6 G;  2Y0S G;  5M3M H;  2E2H H;  4CC6 A;  2IT1 A;  1EQR A;  2K5H A;  1VQP A;  1JB7 A;  3S14 H;  4OO1 I;  4HIM A;  1N36 L;  2OTJ A;  1UE6 A;  1I6H H;  1HZC A;  1CKO A;  2ZTE A;  5E7N A;  1OTC A;  3A74 A;  1IL2 A;  2ALY B;  4B3R Q;  5C44 G;  2NVX H;  4QY7 A;  4LFB Q;  4LF9 Q;  3PUZ A;  3WWV A;  1OXS C;  3U4Z A;  5BR8 L;  4P75 A;  5M3M G;  1V1Q A;  4LFA L;  2VQE Q;  1N33 Q;  2ATW A;  4UP7 A;  4DRF A;  2PI2 E;  2VW9 A;  3BJU A;  3GD7 A;  1EWI A;  4P74 A;  1D7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...