3W1BA

Crystal structure of human dna ligase iv-artemis complex (mercury derivative)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
600
structure length
589
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 178
structure length 589
sequence length 600
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1bA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1bA02
3M3YH 4ME3A 1KL9A 3MEFA 1N36Q 1N34Q 4GKKL 2CCZA 4DNIA 3RZOH 5C4XH 1EIFA 3L2PA 3KDFB 3J81i 1VS0A 1YJ9A 1YJWA 1K9MC 4JI5L 2K52A 2OQKA 1UEBA 3HOYH 3U4VA 4C2MH 1KXLA 2ALYB 2AHOB 5IY0A 4AQYQ 4UCSA 3CPWA 1Z9FA 1D8LA 4YWMA 1YIJA 1IBLL 1JJ2A 4L5SA 2XTIA 4YY3Q 1X54A 1P16A 3RLFA 3TY8A 4IPCA 1YJNA 1M90C 4JI4L 1QZHA 4FDBA 3KYHC 2VZAA 3NELA 4BY1G 4DV7Q 2HVSA 4BY7H 5IE8A 3PO2H 3NEMA 1WI5A 2F52A 4PZ6A 4IOCA 1JE5A 2PI2E 5C3EG 1NMFA 3CC7A 4K0KL 1ASYA 2HHHL 2B63G 3S1MH 4LF7Q 2R93G 1VQAA 5GAHC 4OO1I 2E2IH 4OX9L 2LXKA 5FJ8G 4JV5Q 4BXXG 1S68A 1MJCA 1CKNB 1S3OA 4DUZQ 4O0AA 5FLMG 5GQOA 2I0QA 4A3CG 1VQKA 4IO9A 1X3FA 2UUCQ 2I5LX 2A19A 1FJGQ 3S15H 4LFBQ 1TAEA 3I4NG 1I3QH 4XTCS 1X9NA 1AH9A 3GTKH 4AH6A 2JA5H 3JSNA 4DUYL 1A0IA 4R4QA 3E9HA 4DV1Q 1LM0A 2CKZB 2F4VQ 5C44H 2K75A 4JI8Q 4RG1A 2F3IA 1NTGA 5C4XG 5IP7G 4GKJL 1SN8A 2K4KA 2YYZA 1Y14B 3I56A 4DV4L 2AWNA 1R9TH 1CUKA 1PH5A 2VW9A 4A3EH 4A3MH 4JI5Q 4DR5Q 4BBSG 4JBMA 3K8AA 5HGQA 2MFIA 1IBKQ 3S14H 4C3JH 5ELOA 4HIMA 4JBWA 3ZJYC 1N8RC 2UUBQ 1HZBA 1HNZL 1IL2A 3M7NA 4DV6Q 3H0GH 3RTXA 2HVRA 1GD7A 1WYDA 1KAWA 3E0EA 2KENA 3PUWA 4AYBE 5M5WH 4DV0L 1XMOQ 3CD6A 4IJLA 4POGA 1L0WA 1O7IA 1VQ4A 1YITA 2HQLA 3HOVH 1J6QA 1PYSB 1WOCA 4B3ML 1V9PA 4X65L 2WB1E 4QGUA 5LMUL 1XDNA 4X6AH 4K0KQ 3G6EA 3PUXA 2HHHQ 5JJKA 3S16H 3MXNB 3FHWA 1VQPA 4H02A 4NXNL 3RR5A 1SROA 5JEAG 4GLXA 2VUMG 3BZCA 3H3VH 3ULPA 1SE8A 1Z47A 1I6HH 3BABA 1VQMA 2E2JH 2UXCQ 3NC0B 1HZCA 3CXCA 4DR4Q 3AYHB 5J3BA 3HKZE 4UCOA 1HNXQ 1L1OB 2D0PA 2JA6H 1VQDA 4LH7A 2Z6KC 5AJ3Q 2D62A 5M3MH 2IY5B 5IYBH 1X65A 1EWIA 2FXQA 1LTLA 3TQYA 1VQ7A 1YHQA 4YCVA 3K7AH 2PI2A 2WAQG 5FPRA 4OXPA 1N9WA 2B3GA 2BH8A 2RF4A 3D0FA 4KHZA 4KLKA 5C0XG 3L7ZC 2R7DA 5M3FH 2D0OA 1PH3A 1G51A 2EXDA 4WJ3M 4IOAA 2LXJA 2YTYA 4A3IH 4A3DG 3FP9A 4X62L 4DV4Q 3CCRA 1JT8A 4A3EG 3HOXH 3KFUA 2UXBQ 2MO0A 4X66Q 2RCNA 1S72A 4DV2L 3BAAA 4HJ5A 3GB8B 3ICEA 3KF8B 4DAMA 3T1HL 1VCIA 1MJEA 2H5XA 1E1OA 1EOVA 3K0XA 4A3GG 1Y1VG 2PMZE 5H1SE 3KJOA 4A93H 3GDEA 1E1TA 3PO3G 1UWVA 4DV0Q 1E24A 3AEVA 4DAYB 1N33L 2HVQA 5HY6A 1KHIA 3BJUA 2IHFA 1UE1A 4O2DA 3SGIA 5D1OA 3RNUA 4B3SL 3S17H 1CKOA 4B3TQ 5JJIA 1X3GA 5LMUQ 3PF5A 1XPOA 4A3KG 2N78A 1VQFA 3UQ8A 1TWAH 1I94L 2EQSA 1HZ9A 2VL6A 1HR0Q 4LFAL 3GTOH 4DV5Q 3TEHB 5IYDH 1JJGA 3ER0A 1TWCH 3DLLA 5EAYA 3K7UC 1CSPA 1WFQA 3CMEA 3J81j 4NXMQ 2VY3A 4IFDG 3AFPA 3EBEA 4BA2I 4JI1L 4DV3L 1XPUA 1J5EL 1K83H 1EIYB 2PQAA 3RN5A 5FLXc 4QIWE 3CMAA 5IYCH 4KHPL 4R4CA 2E2HH 2YTXA 2JA8H 1IXRA 3U50C 4DR6L 3W1GA 2QEXA 4A75A 4PZ7A 4GOPC 3TS0A 4A3IG 2UU9L 3G48A 1YHBA 3NBHB 4DR2L 1XJVA 1VQ5A 3RN2A 3GTJH 1C7YA 1JMCA 1PH6A 4GNXB 4DRFA 4GN5A 4DR1L 4LF8L 4DR7L 1C9OA 3I2ZA 3T1HQ 1AE3A 3VNNA 1LYLA 2JQOA 3M9BA 4GOPA 1VQBA 4QL5A 4PMWA 3PF4A 2BA0A 3LGJA 3S1QH 4MNOA 2GVAA 1N33Q 2NZOA 2CWAA 4YHHL 3HOWG 1GKHA 3KF6B 3F2BA 1AE2A 3UE1A 1FVIA 4IPHA 4P73A 2NN6I 4B3SQ 4GLVB 3I4MH 5IP9H 4A3LH 1Y1WG 2MO1A 1QVCA 1TWHH 3A74A 3KOJA 4A3BH 4R4OA 3TRZA 3S2DH 4JBKA 4LF9L 3GD7A 3OTOQ 2ASBA 3FKIH 3CCQA 2VQEL 4GN3B 3CCMA 3KDFA 4C3IH 2VQFL 2ZJPA 4GKKQ 4HJ8A 3CC4A 4B3RL 3HFZB 3T1YL 1VQ8A 2LSSA 3HOYG 2UXDL 5IWAL 1I50H 3A5UA 4DV3Q 1MIUA 3S24A 3TREA 3BU2A 4GNXC 1J5EQ 2HT1A 3TY9A 2DGYA 1WCMH 3UDGA 4A3JH 2NVYH 1GVPA 3F8TA 4APVA 1B70B 4AIMA 1IBLQ 1X6OA 4JOIC 4HIDA 2R92H 4JG2A 4JI4Q 2N8NA 4LUZA 1H95A 2Y0SE 4LF4L 2JK8A 3GTGH 4BY7G 3Q8DA 3PO2G 3D31A 1CKMA 4DR1Q 1NBWA 4L5QA 2GVBA 4LF8Q 3CCLA 3HOUH 4TQUS 5GADC 3RZDH 4J15A 2AMCB 1PH9A 2AKWB 4UP9A 1HNWL 3BA9A 1PH8A 1BBWA 4OX9Q 3KLWA 1CKNA 2Q2IA 1Q8KA 4UP8A 2KHJA 3AQQA 4HTOA 4YHHQ 1KQSA 1WJJA 2ATWA 4P72A 5GAEC 2MQHA 3CW2C 1YI2A 2NVQH 3PUZA 4BBRH 4IPDA 5D1PA 2L15A 1FGUA 2OWOA 1XNQL 3VDYA 3I4OA 1PH4A 1M1KC 1NE3A 4X64L 1EQRA 1HZAA 4LUVA 2R7ZH 4WJ4A 1TWGH 1QUQB 2JA5G 4DUYQ 4JI2L 4JI0L 3M85A 4P74A 3TS2A 3U58A 2Z0SA 4XIGS 2JA7H 3UDIA 2JJQA 5C44G 2IX0A 2Z6KA 3DM3A 2JA9A 3CCVA 1VQ9A 1D7QA 1XMQL 4GN4B 3S1RH 1X55A 1XPRA 4GKJQ 2QGQA 2RHSB 3CQZH 1VQGA 4KI0A 1XK5A 1U5KA 2UUAL 4A3MG 1VQOA 3T1YQ 2UXDQ 1KRSA 3W1BA 2JEBI 4JBJA 5GROA 1N34L 1E3PA 1N36L 4Y52H 5JEAJ 5M5XH 1K0RA 3W5OA 5E7NA 4PZ8A 3JAMc 5C4JH 1HNZQ 2E5LL 1Q12A 3H0GG 4LF6L 4QJFA 3GTPH 3WWVA 4P75A 3UDFA 3STBC 2EIFA 1ASZA 2CQOA 3HOVG 4AQYL 1VQHA 3PUVA 3CPFA 4B3MQ 2CFMA 4UCUA 2YTVA 2CWPA 4X65Q 1EQQA 1PHJA 5DISC 1L1OC 3HOUG 2NVXH 2JE6I 5C0XJ 2K5NA 1BVSA 4L5TA 3M4OH 1P8LA 1EYGA 1K73C 3A5ZB 3UE0A 4AYBG 4DV7L 4BY1H 4NXNQ 4R4IA 4YWKA 2AWOA 1UE7A 5C3EH 2N3SA 4CC6A 2KHIA 4LW1A 1L1OA 1GO3E 3F2CA 1VQIA 2B63H 1OXVA 1T9HA 1N32L 2R93H 2WB1G 3CCJA 2JA6G 2VS1A 2OTJA 1XNQQ 5M3MG 5FPOA 4UY8C 5IYBG 1SLJA 3IRBA 5FJ8H 4X64Q 5IT9c 2YU9H 4BXXH 1PH1A 4A3CH 5FLMH 2UUCL 2BA1A 3B6YA 2C35B 1FJGL 4LFBL 1BKBA 3K81C 2KCTA 3I7FA 4DK3C 5M3FG 1VQLA 3I4NH 2KCMA 4HJ7A 1I5FA 2ZTDA 4X62Q 4OWXB 4EQ5A 3G71A 4DV1L 4JYAL 2UUAQ 5DLQE 2R6GA 3HOXG 2F4VL 1DGSA 2IT1A 2B29A 3PUYA 2ZTCA 4JI8L 4DV2Q 4IFDI 5JJLA 2ZM6L 5IP7H 4LF6Q 2N49A 2E5LQ 3CC2A 4BBSH 2I5HA 4A93G 4DR5L 4GS3A 4UCTA 3ULJA 1CSQA 1IBKL 1TXYA 3PV0A 5M5YH 2UUBL 3OW2A 4IFDJ 3EIVA 2YV5A 1VQ6A 4DV6L 1EUJA 1PA6A 4JI6L 1XNRL 3HOZH 4OO1G 4UFZA 2K5VA 1Q1EA 3AFQA 3I55A 1XMOL 1Q86C 1PV4A 4R1JA 1EFWA 4DPGA 2K5HA 1SFOH 4TVAB 3F2DA 2NN6G 3J80c 4LFCL 3KJPA 1YVCA 1IYJB 1I94Q 4DK6C 4HIOA 1SMXA 4LFAQ 4EEQA 5IYDG 3J81c 1N32Q 2VNUD 5ELNA 4HJ9A 1OXTA 4JC0A 1VQJA 2Q2HA 2WAQE 3F1ZA 2VUMH 1JJCB 3OYYA 3J7A5 4LUOA 4JI1Q 1K3RA 5BR8L 3H15A 4DR4L 2UXCL 1YNXA 1X56A 4C3HH 1HH2P 2K50A 1HNXL 2A8VA 5AJ3L 4OWTB 4MTNA 1A62A 2GN5A 2Q2TA 3HKSA 3U4ZA 5IYCG 4KHPQ 4LH6A 2JA8G 4DR6Q 4UCVA 3JC66 3S2HH 4LF5L 2UU9Q 3GTLH 1VQNA 3BA8A 4DR2Q 3RLNA 4JYAQ 4E6NA 4GNXA 1X3EA 1V1QA 3PN1A 3PIOA 3G4SA 3ERSX 3QWUA 2XGTA 2ZM6Q 4JOIA 4A3FG 4DR7Q 3NBZB 1OTCA 3ULLA 3E9IA 4A3DH 2VUGA 4OWWB 3GTMH 4QY7A 1IBML 2UXBL 2A1AA 4JI7L 4X66L 2R7FA 1B7YB 4DKAC 1GM5A 1RIPA 1UE5A 3KF6A 1Q81C 1C0AA 3CCUA 1SRUA 4RMFA 2HIVA 3BZKA 4A3GH 4JI6Q 3A0JA 2OTLA 3HOZG 3JAMi 1Y1VH 1XNRQ 2Q2UA 4JI3L 2IHEA 2RHQB 4IJHA 4YCWA 2ZJRA 2ES2A 3PO3H 1L2FA 1OXXK 3CF5A 2IX1A 1E22A 1VQCA 4LWCA 3I4MG 5IP9G 3CCSA 4A3LG 4EFEA 1K8AC 3STBD 5LMNL 4LFCQ 1PFSA 2DUDA 4A3BG 2QA4A 1W3SA 1PH2A 4B3TL 3M4QA 4UP7A 4LF9Q 5D1OB 4HTPA 1HJPA 3FKIG 2VQEQ 3L0OA 3NBYB 4HIKA 1IZ6A 4A3KH 2VQFQ 1B04A 1SR3A 1UE6A 1YBYA 3S1NH 4DR3L 4B3RQ 2K14A 1HR0L 3PGZA 2WP8J 3M4PA 4A3FH 3UDXA 1Q82C 3GO5A 4R4TA 5IWAQ 5BR8Q 2HIXA 4UPAA 4POFA 1NY4A 4DV5L 2KBNA 4L5RC 2BH2A 1QZGA 2JEAI 3JSLA 1WCMG 4A3JG 4JCVE 2R92G 1K8GA 4NXML 1VQEA 3RLOA 5C0XI 4UCRA 2ZTEA 1E7ZA 3TY5A 4LF5Q 1G291 3CP0A 5GAGC 4LF4Q 4EFBA 2MNAA 4ALPA 2ID0A 2PQAB 4CC5A 3CCEA 2I5MX 2V1CC 3PSIA 4YY3L 1NJIC 1XTDA 1KC8C 3PIPA 3GTQH 4YCUA 3GJXB 3K80C 1Q46A 4LNQA 4GLAC 1HNWQ 1V43A 3PCOB 1IBMQ 2OQ0A 4YWLA 4JI7Q 1YEZA 2WFWA 1Q7YC 1S40A 2NVTH 2Y0SG 1TA8A 4MZ9A 4NPSA 1KIXA 3EN2A 1PVOA 2OCEA 4Y7NH 4BBRG 4JI3Q 4LF7L 5LMNW 1G6PA 1NMGA 1U0LA 4EX5A 4GOPB 5K36G 1FL0A 4HJAA 1PYBA 1OXSC 3HOWH 4OONA 1OXUA 2NZHA 1QUQA 4JV5L 1KRTA 4A4IA 5LMNQ 4DUZL 2R7ZG 1KD1C 1JB7A 1MKHA 1YZ6A 1Q1BA 3CAMA 4PG3A 4JI2Q 3J7ZC 4JI0Q 4IPGA 4NB3A 4P71A 2ZJQA 1QVGA 2PNHA 1BBUA 1RL2A 2JA7G 1QVFA 4A76A 1Y1WH 1HR0W 1LUZA 3H3VI 2E8GA 3HKZG 4QQBX 1XMQQ 4DR3Q 3J80i 1W2BA 3NENA 1B8AA 4BA1I 1A8VA 1YHAA 1TWFH 1A63A 1PH7A 3OTOL
chains in the Genus database with same CATH superfamily
4WJWA 1M0WA 2L11A 3I3CA 1KL9A 4ME3A 2X5RA 1N34Q 4GKKL 5C4XH 3J81i 4QF4A 1U4PA 4K6DA 1YJWA 1K9MC 1TU2B 3WDNA 4C2MH 4CMDA 1UC9A 2ALYB 1JOQA 5IY0A 4UCSA 1YIJA 1MBYA 5BWXA 1JJ2A 1EQVA 1D5MC 4JI4L 1YJNA 1C4QA 1K83B 3J7AF 3KYHC 2VZAA 1WI5A 2EY5A 2HHHL 4LF7Q 5IGEA 1ZAUA 1R4PB 4OX9L 4O4JF 4TKOB 5FJ8G 4BXXG 4O0AA 2KVMA 5DAUA 5GQOA 1TT2A 3S1QB 1TAEA 2PBZA 3I4NG 4XTCS 1X9NA 3URYA 5BWWA 1C30A 4AH6A 4L6TB 4X3KA 4NZMA 3WNZA 5KYLA 2F4VQ 4JI8Q 1RODA 1TWHB 2F3IA 4X3UA 1KDAA 2K4KA 2YYZA 3I56A 4DV4L 4A3BB 4BBSG 1GHJA 4A3EH 1KJ8A 3I12A 3FKIB 4MTKA 5HGQA 2R7MA 1IBKQ 4C3JH 1JCKB 2KCCA 5COYA 5K3WA 3GP7A 1ILQA 3IAYA 4ZOLF 3OMCA 1WYDA 2KENA 4XQNA 3PIO3 1XMOQ 4POGA 1IYDA 2C00A 3AW8A 4C1NK 3NUAA 3BG5A 2CZGA 1KDBA 1IW7C 2JYOA 2R92B 2YZLA 2R84A 2WB1E 3WOEA 2EJFC 4HNUA 1XDNA 4X6AH 4K0KQ 3MWEA 5CV5A 3PUXA 3D8GA 4C1NI 1EWCA 3K3PA 4KKSA 3DEOA 3S16H 3EROA 4N8FA 1QNUA 2TMPA 3D4RA 1B9NA 4CDDC 4ZUJA 3HOUB 3R2TA 1SCUB 5E3FA 1CK1A 4AYBB 4KJNA 2D62A 4K5VA 4UAIA 2K01A 2FXQA 2K05A 2Z1CA 3IFTA 3TQYA 3VYRA 1VQ7A 2EJ0A 2PI2A 3V4ZA 2RF4A 4F88A 5C0XG 3L7ZC 4RZQA 1SDFA 3JRWA 2EXDA 1DV1A 2LXJA 5EBCA 3FP9A 4X62L 4BWGB 1GSAA 2HUGA 2Z8LA 3ZYYX 5I6WA 5JVH3 5C3XA 2YW2A 3VR5A 1VCIA 3S1RB 4UDUC 3JRXA 1JWUD 5H1SE 4A93H 3GDEA 5FLXL 4QUFA 1UWVA 1Q3LA 4DV0Q 1E24A 5HNEA 2YZMA 4M0JA 5C4ZA 1RDPD 1FNUA 4GZYC 1HTPA 1WR2A 2F1MA 5JJIA 2NU9B 5JPNC 2W71A 4ZKCB 2N78A 2E74C 4MV7A 2V4DA 1TWAH 2RSOA 1IYEA 1LTSD 1K0SA 2YWVA 2OXPA 4LFAL 2ICIA 5J22A 3M4OB 5IYDH 2CNVA 3Q23A 3K7UC 4TUYF 1DAAA 3FRPB 4FF2A 3AFPA 5C3EB 2AUJD 1EIYB 3RN5A 4ZK9B 1JOKA 1TWCB 2R93B 3CMAA 5IYCH 2JA8H 3U50C 3W1GA 2UU9L 2AQ1B 4HNTA 1ENAA 2A74C 2D2CC 2QK4A 5CA1F 3CRLC 1JMCA 2EYFA 4DRFA 1DYQA 4GN5A 3T1HQ 3I2ZA 5CR5A 3DTGA 2MJ8A 2RCFA 4GOPA 1VQBA 5LA6F 5H80A 2LMCB 4ILWA 3FVQA 1GKHA 1QJOA 2Q7DA 2KEDA 1DONA 3UE1A 1W6JA 1FVIA 1A15A 4RAUC 4B3SQ 1QNKA 1I7NA 1QVCA 3A74A 4ME5A 1KABA 4R4OA 3TRZA 4XX0B 3BVZA 2VQEL 4C3IH 2VQFL 4GKKQ 1AN8A 1UEAB 4DAPA 1BCPC 4HJ8A 4B3RL 3R3OA 4MIUA 2UXDL 5IWAL 1CS0A 2F3VA 1J5EQ 3BU2A 3D4WA 5IOCA 4A3JH 1AUXA 1HFNA 4AIMA 1X6OA 2BDOA 5KS8A 1FNVA 5FKAC 4JI4Q 3BDCA 4YJ3F 5EKKA 2N8NA 1H95A 4LF4L 5DMXA 4EQOA 1IYVA 2YRXA 3Q8DA 1KAAA 1PFBA 3D31A 1A6XA 3CCLA 1ZXTA 4XQJA 3RZDH 5LL6S 4J15A 3GTLB 4CJ1B 3BA9A 1ESRA 2QF7A 1PH8A 3GTGB 3LWEA 1BBWA 4OX9Q 1A3TA 2KHJA 2ATWA 2N88A 5GAEC 4A3DB 3TINA 3HG9A 4BBRH 3GTMB 2L15A 2FP4B 5I5TA 2G9DA 4FE2A 5K36H 1XNQL 3I4OA 2R7ZH 3MXGA 1EFID 1TWGH 4ZUIA 5G3LF 3M85A 5KX5F 3ITPA 1EKVA 1STNA 4G4KA 2QEJC 4XIGS 4MV3A 1EKFA 1BNZA 1D7QA 3DM3A 4N9TA 2WV6D 5CC4A 3ERQA 1XMQL 1X55A 2RHSB 2GPWA 3T1YQ 3K5OA 2VXWA 1N36L 4ODGA 5JEAJ 5E7NA 3W5OA 4KV6A 4WBNF 4LK1C 1G2SA 3SXHA 3BVMA 4HEDA 3WWVA 1MSHA 2KUMA 3UDFA 3OWEB 4AQYL 3I73A 2CFMA 3HOUG 3EQLC 1IYUA 2NVXH 3SE0A 1DCZA 2MGSA 1EYGA 4AYBG 1S5CD 2L5TA 3R5FA 1CT1D 3X3MA 5D14A 4YBZB 5IGCA 3OOCA 1IOVA 2N3SA 1D1IA 1L1OA 1Y8NB 3F2CA 2D9UA 2FJ2A 2JA6G 1BNCA 3MEHA 1BF4A 2G5DA 1SLJA 3IRBA 5FJ8H 4X64Q 2YU9H 4BXXH 2NVTB 1PH1A 4IUVA 3NWTA 3OW7A 5M3FG 2XVSA 3I4NH 1JOOA 3LWBA 2R82A 2R85A 2ZTDA 4X62Q 3OSOA 4DV1L 3TBIB 2IT1A 3PUYA 2ZTCA 2A5HA 1Y1WB 5JJLA 3FDTA 4LF6Q 2E5LQ 4HN2A 3FMCA 4BBSH 3RUZA 4DR5L 3QOLA 2R7LA 3ULJA 3T9CA 3RZOB 5M5YH 2B8GA 3OW2A 2UUBL 2YV5A 1VQ6A 4OO1G 4UFZA 3HOZH 3TQTA 1RTNA 3HOYB 1Q86C 2K28A 5BPHA 1PXUA 4DK1A 5E25A 1TY0A 4V0BA 2NN6G 2L4NA 5LL6X 3VR3A 1IYJB 4DK6C 2YL2A 4LFAQ 2COJA 3SEBA 3VOTA 4LJZC 3J81c 1AZQA 1N32Q 2VNUD 5EQ0A 4HJ9A 3MC0B 3WWIA 2O4XA 2Q2HA 3MHBA 2F0GA 1JDEA 1I6VC 1NUCA 1X56A 2A8VA 3P1HA 1GGOA 2EPBA 4IUTA 4O4LF 2GN5A 3HEJA 1DD2A 3NQIA 4UCVA 1LT6D 2LKVA 2UU9Q 1GUOA 1I4PA 5BWTA 3BYYB 5C0XH 1X3EA 2F0FA 2QDBA 1GUTA 2EYOA 3PMFA 1W96A 2YZNA 3ERSX 2ZM6Q 3GTKB 1OTCA 2JA5B 2DZDA 2R7NA 3TSSA 2ODTX 3JAML 5KNCA 1SMYC 1B7YB 5C44B 3KF6A 1OBGA 4FFNA 1SRUA 3T9AA 1ICFB 1PMRA 3KLRA 2OTLA 3ETHA 3JAMi 5JOBA 1R9TB 4A3MB 2ES2A 4EQNA 1EYCA 5IGDA 5IP9G 1K8AC 3C1FA 4I4TF 3R9RA 4NMZA 3H0GB 2XCLA 2EYPA 2QA4A 2IX3A 5JJZA 2R61A 4Q4DA 1DV2A 1Z2NX 4CGYB 3DM1A 2VQEQ 3NBYB 4HIKA 1IZ6A 2DY8A 2VQFQ 3HOVB 1G2TA 2DLNA 4B3RQ 2K14A 1JE4A 3VYUA 3PGZA 3K59A 3GO5A 5IWAQ 2J0TD 4G7OC 5BR8Q 1NY4A 4ZQ3A 3JSLA 5BWRA 3OHXC 1WCMG 4QUCA 3OUUA 3LNNA 1EZ1A 2GPSA 1K8GA 4NXML 3OIPA 5ELEA 1E7ZA 1B6SA 1I6HB 3TY5A 1ET9A 4KD3A 4LF4Q 4U68A 4EFBA 2MNAA 4CC5A 3HRZC 5M3MB 3CCEA 3PSIA 2AQ2B 2V1CC 4XT1B 3R5XA 3DMUA 5J2UF 1XTDA 1WTHA 3K80C 2B2UC 3GQBA 2K7VA 1V43A 2B2WC 5KRUA 1ENFA 4R8NA 3EN2A 3T7AA 3Q22A 1I4QA 2B2YC 5KYIA 4JI3Q 4LF7L 3MVVA 4O7LA 2L12A 1QCBD 1WTWA 4O2AF 1OXSC 1KRTA 1MHWC 3J81E 3CAMA 1CQIB 1Q1BA 4Y7NB 2W6OA 3S9WA 2ZJQA 3T9BA 5C1OA 1R4QB 3H3VI 4XT3B 4ZCKA 1CZWA 5JAVA 1XMQQ 4QQBX 5I60A 3J80i 1GLVA 2F0KA 2F0OA 4TM5A 2R86A 2HCIA 3MEFA 1N36Q 1VDZA 5EKLA 2RA4A 3L2PA 4KHVA 1VS0A 2EIYA 1WTQA 1UEBA 2Z9HA 1KXLA 5CV6A 4XYOA 4AQYQ 4FXDA 1D8LA 4L5SA 2J4XA 1TY2A 1O7YA 1X54A 4KTAA 3RLFA 3K58A 1BBXC 3TY8A 4IPCA 4ZHQF 4ULLA 1QZHA 1A3UA 2HVSA 4BY1G 4HTHA 1EY0A 5IE8A 3IL8A 4PZ6A 1TS4A 3E3XA 4MN3A 4K0KL 1ASYA 2H1EA 3S1MH 4WRDA 2PZUA 2PVPA 1VQAA 4OO1I 2E2IH 2ZXPA 4F87A 3QB3A 4A3CG 5FLMG 1EY7A 5KEEA 1PLFA 1UC8A 4IO9A 1X3FA 2A19A 3IKJA 1S4ZA 1SXTA 1QWYA 3FEWX 2IJ0A 3KBXA 2W6NA 4EGJA 3E9HA 4IUUA 1ZYRC 4DV1Q 2FPPB 3S15B 1LM0A 2CKZB 4KY7A 3I4MB 4KY5A 3EFXD 3BDOA 4RG1A 2PYKA 2HDMA 5IP7G 3TMEA 4GKJL 3DEPA 1PH5A 1CUKA 1EYDA 4HSVA 5E4XA 3TP6A 2VW9A 4DR5Q 3PFFA 3K8AA 2MFIA 2I46A 1N8RC 2UUBQ 1HNZL 2EYMA 2R3ZA 4RFBA 2HVRA 3PUWA 4DV0L 3CD6A 5JH7F 1L0WA 1O7IA 2HQLA 4K2LA 1PYSB 1FNWA 1VMPA 5JVLA 4KN4C 4QSHA 3NHHA 4QGUA 1NAPA 3MXNB 4H02A 2HJWA 1SROA 1V1OA 2VUMG 3BZCA 3H3VH 3ULPA 1SE8A 3TDQA 5J39A 2E2JH 3CXCA 4UCOA 3E5SA 5J3BA 3HKZE 2JA6H 2D0PA 2KQ3A 3K0YA 1KTAA 1VBGA 3L9AX 2EDGA 4CDEC 1LTLA 2JSOA 1O7LA 2NYZD 1YHQA 5FPRA 3K7AH 3SR1A 4DA2A 2ZGIA 4OXPA 3D0FA 2WB1B 5JQWA 4KHZA 2P5ZX 2I07B 5M3FH 5LP6F 3E5NA 3TIIA 1EZ8A 1MGSA 3Q2OA 4JPBW 4IOAA 2A6HC 1WRVA 2XWJB 2B8FA 4A3IH 4OIJA 2A69D 1LT4D 4NDXA 4DNTB 1JT8A 2MO0A 3NSWA 2HHFB 4DU9A 3BAAA 4HJ5A 2K5DA 3KF8B 1VF7A 3T1HL 1MJEA 3ORRA 2H5XA 1EOVA 3K0XA 5HV6A 1F2YA 2PMZE 2RBMA 1EEID 3ND8A 4DAYB 3MXPA 3PIP3 2HVQA 4CDFC 5G3LD 1KHIA 2IHFA 5C4JB 1UE1A 4OO1H 1HA6A 3SGIA 1KJJA 3RNUA 4B3SL 3S17H 1CKOA 2FFKB 2B2YA 1X3GA 2XWBB 1CA6A 1XPOA 4FF4A 4FGRA 4YJ2F 2NUAB 4A3KG 1CE8A 3OPOA 3H3VC 5JQGF 3UQ8A 2EJ3A 2MPMA 4IWYA 2VL6A 2K33A 1TS3A 1RJTA 3GTOH 3BG3A 3TEHB 3ER0A 1TWCH 2F0LA 5DNFA 4IFDG 4O84A 4NXMQ 1VKZA 2J9GA 3U9TA 3EBEA 1X3QA 3O13A 2B63B 1J5EL 4H0LC 4RGNA 2E2HH 5A35A 1F9RA 2QEXA 4PZ7A 1M4VA 3Q6SA 4GOPC 3TS0A 3SE7A 1YHBA 3NBHB 3RN2A 1CI3M 3GTJH 2EJ2A 3M4YA 2ABJA 2RDFA 4XDXA 1LABA 3KF8A 4GNXB 1B50A 1AE3A 5IGFA 2JQOA 4QL5A 4PMWA 3LGJA 1LACA 2NZOA 3H91A 3AU7A 5D8DA 1FGBD 2J7ZA 4P73A 1A9XA 1BDOA 1LV9A 5IP9H 3TP8A 5LXTF 5HGTA 3C1EA 2D5DA 3S2DH 2O2LD 1PTOF 4GN3B 1EL0A 2ZJPA 4IALA 3T1YL 5BWVA 1GUGA 2SNMA 1I50H 3A5UA 4TV9F 3QJYA 2HT1A 3TY9A 4IUNA 1WCMH 1CHPD 2NVYH 4RGOS 3F8TA 1B70B 1EY9A 4L1KA 4JG2A 1UNSA 2RQXA 2Y0SE 4C3HB 1EQTA 2JK8A 3GTGH 5C1PA 4BY7G 2K5QA 3PO2G 1CKMA 3UZBA 4DR1Q 4L5QA 3T56B 4TQUS 2WAQB 1SNDA 2EY6A 4M1UB 4EGQA 1STHA 3KLWA 1HQRD 1Q8KA 1X32A 4X3SA 5FNVF 1ULZA 3K5IA 5KNDA 2V5AA 1PTOB 4FXKC 2MQHA 1E4EB 2NVQH 3PUZA 2Q8TA 1V8QA 1EOTA 2OWOA 2K5WA 3VDYA 4M9UA 5GONF 3MXUA 4X64L 3L3OC 4HCSA 5C3WA 4LUVA 1QUQB 4F7XA 1DM0B 3PO3B 3U58A 2Z0SA 1F2ZA 2JJQA 1EY8A 2JA9A 4FVMA 4DF7A 1XPRA 1XYIA 4O86A 4GKJQ 1YNNC 2QGQA 3CQZH 1DOMA 4K14A 1K28A 1VQOA 1X3PA 3KALA 1IL8A 1NNXA 4Y52H 3W1BA 5GROA 1FYCA 3A8IE 5I2XA 5M5XH 1K0RA 4LF6L 3JAMc 1HNZQ 2E5LL 2PN1A 1CM9A 3GTPH 5I5XA 4A3FB 2OF1A 3Q0AA 5I9PA 4Q5VA 1SYGA 5M9OA 4LAAA 3QFFA 1JLLB 1Z2PX 1EQQA 4C5AA 5BN3A 2EZVA 2F03A 1L1OC 4H44C 1EZ6A 4BS9A 1CTMA 1I2KA 3LQSA 1WD1A 2JE6I 5C0XJ 1GUSA 1BVSA 5A2QL 1P8LA 5ELFA 1K73C 4BY1H 4DV7L 1EEFD 1B2TA 4Q0FA 1Q8IA 4R4IA 4YWKA 5I5YA 1E4EA 1SNQA 2E2DC 3GTQB 3A54A 2B2TC 1OXVA 1N32L 2WB1G 2VS1A 1KBLA 2OTJA 3C46A 3DWAA 4A3CH 5BYAA 5FLMH 2C35B 4FO2A 1FJGL 4LFBL 1BKBA 2KCTA 3I7FA 4OHJA 3LP8A 5T1GA 3HOWB 1Y69U 5ELCA 5DLQE 2R6GA 3RD4A 3HOXG 4IFDI 2ZT9C 2ZM6L 5IP7H 2N49A 1M0TA 3I8ZA 1LTBD 1TIID 1TWFB 2PZWA 4GS3A 2CNQA 1A2TA 1U4MA 3PV0A 3MFYA 1QG7A 5C4XB 3EIVA 1PA6A 3K6OA 1EFWA 4C2MB 1SFOH 1ESFA 3QOJA 3NWSA 2I8CA 3J80c 2A68D 3KJPA 3KREA 3NK9A 1GHKA 4HIOA 4O83A 1PFMA 1XXGA 3MWYW 4JK1C 4PQXA 1OXTA 1EU3A 1VQJA 2WAQE 2VUMH 3J7A5 5BR8L 2UXCL 2YS7A 3MFGA 1HH2P 3MAQA 4OWTB 1A62A 4LH6A 4RGMA 1C48A 3N6RA 1KJIA 1B44D 1JB3A 2V58A 4L63B 1T5XD 1VQNA 3BA8A 3JAME 4NP5A 3PN1A 3PIOA 1EHIA 2EJMA 5CB4F 4RCNA 1NSNS 3CKIB 3GLKA 1XTCD 3MZ5A 1Q81C 1C0AA 1SYBA 2RDGA 3CCUA 1BOSA 2CHBD 2HIVA 1XNRQ 4JI3L 2RHQB 1L0XB 3U9OA 4A3EB 3MWDA 3A8KE 4MV1A 1L2FA 2KEEA 1YNJD 2B2VA 5AFWA 2XSCA 3CF5A 4K8IA 1EYZA 2I80A 4A3LG 4O7TA 4C3JB 3STBD 4LFCQ 4A3GB 3T4AC 1Y1VB 4A3BG 1H9MA 1PH2A 4B3TL 4UP7A 5D1OB 3FKIG 1RHPA 4IIJF 3I90A 4A3KH 3VR4A 1SR3A 3S1NH 4N9PA 2F0DA 2Z02A 3T9EA 1D6EC 2MHVA 2F0MA 3VR2A 1Q82C 5CBEE 4UPAA 4DV5L 3R5HA 3HB9A 3S16B 1QZGA 1E2VA 4QMGA 4IFDH 4JCVE 2R92G 1K8MA 1ONLA 3A55A 2M00A 2ZTEA 5C0XI 4LF5Q 1G291 2IPKD 3U54A 3T13A 2PQAB 3A56A 3K57A 2I5MX 3OIQA 1H9SB 2NZ1D 2BE5D 3NTKA 4KKUA 4YCUA 2FMCA 3PCOB 1G2WA 1SNCA 1DXMA 2F4IA 2OQ0A 4YWLA 5IIFA 3UYYA 1Q7YC 1J8IA 4MZ9A 1PVOA 1GJXA 4TRDA 4YIJA 2M2LA 1AUVA 2OCEA 1F9PA 4Y7NH 3J80E 5LMNW 2CW0D 2PPBC 1G6PA 4CBVA 2ZDQA 1BCPF 2FINB 1JDBB 1PYBA 4DLKA 4CMFA 4OONA 1OXUA 2NZHA 5LMNQ 2JN4A 1MKHA 2R87A 4A93B 4L8JA 2HDKA 4NB3A 2B2TA 2PNHA 3VA7A 1HR0W 4R9WA 1LUZA 1UUPA 2EVBA 4DR3Q 5EPJA 3NENA 1LTGD 1F9QA 1VMCA 1CQFA 4A3FG 3M3YH 5EGTA 5NUCA 1LTAD 3TW6A 1D5ZC 1EIFA 3KDFB 1TWAB 1HUNA 5C4HA 3K5LA 2SDFA 4CKEA 2BCOA 3HP3A 4EGVA 3E6ZX 3CPWA 1Z9FA 1BUVT 4YWMA 1IBLL 2EE1A 2XTIA 3N52A 4CHTB 1GUWA 3N8DA 3T54A 1P16A 1AP0A 2XN9C 1M90C 4YB8B 3NELA 4DV7Q 4OL7A 4U673 4BY7H 3PO2H 4X3TA 1EY6A 4IOCA 2JA8B 5I5UA 1JE5A 3NBIA 3W2DA 5C3EG 1NMFA 3M7GA 2SEBD 4Z9CB 2ENBA 2R93G 1PK8A 4RHRA 5GAHC 1PZJD 1DIKA 4JV5Q 1Z2OX 2F0VA 1S68A 3WO0A 1CKNB 1S3OA 4DUZQ 1TKWB 3HT5A 1M8AA 2VQDA 1FJGQ 3S15H 4LFBQ 5FO7B 1I3QH 2XRQD 3AMUA 1AH9A 3DUZA 3ETJA 4DUYL 1A0IA 2VB2X 2K75A 3I72A 3NQTA 4RCOA 5IGBA 1NTGA 5C4XG 2YRWA 1SN8A 1Y14B 4JI5Q 2AWNA 3V05A 4JBMA 4O7SA 2Z04A 4NYEA 2K32A 1O7ZA 1TVXA 3VA5A 4C3IB 3S14H 4WJ4A 1IL2A 1KNEA 1K3BC 1GD7A 1HFGA 5M5WH 1KAWA 3E0EA 1SEBD 1RKNA 1AW7A 2CQAA 4IJLA 4OELB 3TW7A 1VQ4A 1YITA 3AX6A 1J6QA 4A3JB 1JQYD 1V9PA 5E1FA 4X65L 1PTOD 2F0HA 4O7YA 2A6ED 2PQEA 4V190 2Q8RE 2NBFA 4PBCA 5JJKA 3FHWA 4EVOA 2FHTA 2F0SA 3OUZA 3U9SA 3HS0C 2WKCA 2A73B 3G8CA 4IWXA 3OWFA 1Z47A 3RZDB 1VQMA 2UXCQ 3NC0B 3AYHB 3MA2B 1STYA 1E2ZA 2QKIC 4LH7A 1VQDA 3BDLA 4RWSC 3VPDA 1B53A 1X65A 4IQZA 5CMDA 4YCVA 1UAPA 1CZGA 5D3DA 4BBRB 2COIA 2AQ3B 2BH8A 4KLKA 4MAMA 4DAAA 4NKLA 2R7DA 4I7ZC 5ELBA 2X0SA 2BDNA 4HMJA 4FU0A 3TP7A 2R7ZB 3D6WA 1I7LA 4G7ZC 1TWGB 4A3DG 3KAJA 3CCRA 1KLGD 1B9MA 4A3EG 3HOXH 1PFNA 5L37A 2K03A 4DV2L 3ICEA 4C3JG 3HKZB 1J9OA 3RV3A 3JZIA 1II3A 4A3GG 3T53B 1Y1VG 2W6QA 3KJOA 1YNJC 1E1TA 1GOZA 1OO9B 2L1BA 5HY6A 4B9WA 3BJUA 3WWJA 4DIMA 5CV7A 3TZDA 4O2DA 1CQJB 4IN3A 2F0IA 4B3TQ 5LMUQ 1ENCA 5IYZF 3DWQA 2EQSA 1HZ9A 4J1MA 4Q4CA 2NVXB 4YAKB 1GSOA 1LT5D 2PMZB 4ZAIA 4DV5Q 1NR2A 3DLLA 5EAYA 3CMEA 3J81j 2HQEA 2EJGC 3QG1A 4JI1L 1PX2A 1XPUA 1K83H 1A0GA 2RSNA 5FLXc 4EQPA 5DM73 4I7AA 4QIWE 3NUCA 4KHPL 5KNBA 5CR3A 4A75A 1FD7D 1EU4A 2JXMB 3G48A 1VBHA 4DR2L 1VQ5A 4DGZA 3I4NB 4FFOA 4DR1L 1C9OA 2Y4RA 3PF4A 1G91A 3S1QH 2KHSA 1N33Q 4O7VA 1HHVA 3G6JB 1WD0A 1AE2A 4HAEA 4BBSB 2HDLA 2NN6I 4CKCA 4A3LH 4K8JA 1Y1WG 1TWHH 2K1BA 5M5YB 1W6KA 3SK6A 3HOZB 4A3BH 1T5EA 1IW7D 4M8AA 4UHVA 4G57A 3GD7A 4LF9L 3VR6A 3FKIH 3RMHA 1PZKD 3CCQA 2SOBA 3CSWA 3I4LA 1I1MA 1I4RA 3D3RA 3HFZB 5I47A 4KD4A 1LTTD 3UI2A 1VQ8A 2LSSA 3HOYG 4S3SA 2X6LA 4J6HA 4DV3Q 1MIUA 4GNXC 2XNAC 3QIAA 1S5ED 3JZFA 2DGYA 3UDGA 2Q8IB 1IBLQ 2R92H 4JOIC 3EJIA 1QB5D 2PW7A 3LWUA 4FFPA 4LF8Q 1ILPA 2FMMA 3HOUH 5GADC 1V1PB 4UP9A 2AUKA 1HNWL 1QOHA 3FPUB 4O4IF 1L0YB 4UP8A 4YHHQ 4HTOA 1BR9A 1LO5D 1RCVD 1WJJA 1NR4A 1YI2A 4HR7B 3KUPA 4IPDA 1IHZA 3P75A 4O2BF 4C5CA 2B39A 2Y0SB 1EQRA 1HZAA 2JA5G 4JI2L 4DUYQ 4JI0L 3AB9A 4MV6A 2L55A 1PRTF 2H4OA 4G7HC 1CQVA 1SE2A 5C44G 2IX0A 3CCVA 3S1RH 3D4DA 5ELDA 3UZOA 2X6GA 1XK5A 3OMGA 5FLXE 1U5KA 1F77A 4A3MG 3ND9A 2JA7B 5CORA 1KRSA 2JEBI 3GV6A 1E3PA 3R2IA 3RV4A 2EYJA 1D2BA 4IZOA 3H0GG 5EZYF 4ZYSA 3NXWA 2VPQA 5CM0A 2EIFA 1KNAA 4TSSA 4ZLTF 3HOVG 1VQHA 3PUVA 4EG0A 1TS5A 2CVRA 1NCVA 2CWPA 4X65Q 4K6NA 1PHJA 2MUYA 1CA5A 5DISC 3MXNA 1BQQT 4L5TA 3M4OH 2LY7A 1JKJB 2NN6H 3UE0A 1UE7A 1PRTB 3MTSA 5C3EH 4CC6A 1QILA 1PDQA 2KHIA 4LW1A 5DAAA 1VQIA 3Q24A 2VR1A 1T9HA 2R93H 5KKNB 3DWPA 4K2KA 5M3MG 3H09A 5IYBG 2UUCL 2BA1A 1BXTA 3B6YA 2PCFB 5D65A 3K81C 2DNCA 4DK3C 1VQLA 2F0NA 2KCMA 2RVLA 4MV4A 1EUCB 4O7RA 2HGXA 4MV9A 1I5FA 5EPLA 3MJFA 3G71A 4O81A 3T9FA 3DF7A 2HHFA 3T99A 2UUAQ 1MI2A 5CE8A 2F3WA 1DGSA 4DV2Q 2P0AA 3CHBD 3LULA 4I50F 4H7BA 4QB4A 1TR5A 4O7ZA 1BCPD 1A3GA 4DAYA 5CA0F 4UCTA 1K8OA 2F0EA 4IFDJ 4DV6L 1SNOA 1JR0D 1XNRL 5LOVF 1Q1EA 3AFQA 2DJGC 5EPKA 4R1JA 1I1KA 2QDLA 3SHLA 4DPGA 4QCLA 2K04A 1I4GA 3KLSX 3F2DA 4LFCL 1H9KA 3EA6A 2K6AA 1YVCA 4NZOA 1A48A 3SVMA 3VYTA 2W70A 3QR8A 3K5NA 3X3NA 1Z7TA 1JJCB 3OYYA 4CKBA 3WOFA 2F0WA 1A2UA 5I4DA 4JI1Q 1K3RA 3S1MB 4DR4L 5FR9A 1HNXL 2VB3X 2K50A 1HA5A 1S5BD 5AJ3L 1XWEA 2E2IB 3HKSA 2C9OA 3U4ZA 1PZID 4RHSA 4KHPQ 5DGHA 1LLRD 3U0GA 3NBHA 5I9OA 1G8ZD 3JC66 1EY4A 4LF5L 3GTLH 5JVDF 4DR2Q 4KK7A 3RLNA 4JYAQ 4RA8A 4GNXA 3NPPA 3WO1A 4FFMA 5I5VA 3G4SA 3QWUA 2XGTA 4JOIA 1JICA 4A3DH 3S2HB 3EVQA 2VUGA 3GTMH 2B2VC 4QY7A 3T51B 2UXBL 2A1AA 5CV4A 4X66L 2R7FA 1GM5A 1STAA 2ZXRA 1RIPA 1UE5A 1WTXA 1JC7A 2DWCA 2R7KA 4C56C 4RMFA 1RTOA 3BZKA 4A3GH 4JI6Q 3A0JA 3HOZG 2F0JA 1Y1VH 2Q2UA 2IHEA 4IJHA 2BOSA 5FO8B 1OXXK 1ET6A 3K5HA 1E22A 1VQCA 2NUCA 4LWCA 3I4MG 4EFEA 2E75C 5I5WA 4MV8A 5LMNL 1KTKA 2DUDA 3DXJC 3H6MA 4LF9Q 4HTPA 3L0OA 2QCPX 5T1IA 1HRJA 1I4XA 3NTHA 4IZ8A 4DR3L 1E2WA 4PMCA 3I70A 1HR0L 3M4PA 4XYQA 4DK0A 2HIXA 4POFA 4L5RC 5IT9L 2KBNA 2W6PA 1CFMA 2V59A 5J2TF 2L0CA 2E2JB 2XIWA 2QB5A 3CP0A 2JA6B 2CH4W 2ID0A 3NE5B 2NTSA 3GV3A 3PIPA 4XXEA 1IOWA 1HTLD 3K7AB 3GJXB 2OT2A 1SAPA 4GLAC 1HNWQ 1KEEA 1IBMQ 5M3FB 4JI7Q 1SYFA 2M9VA 4B9XA 1GXDC 2JP1A 2Y0SG 1S40A 4OIKA 1C8CA 2NVTH 4A3IB 1C3OA 1U0LA 4GOPB 2IW3A 3TIGA 4JV5L 4HMIA 1QUQA 4A4IA 4DUZL 3KBGA 1JB7A 1YZ6A 4JI2Q 3A7LA 4JI0Q 4MA5A 4P71A 3R8BA 1QVGA 1B6RA 2JA7G 4A76A 1A3VA 1Y1WH 2ZDGA 2X69A 1WTVA 2A69C 3PQIA 1B8AA 1A8VA 1D5XC 1YHAA 3HZXA 2IWHA 3R23A 3S17B 1KC7A 3P7JA 1PH7A 3OTOL 4DFAA 2CCZA 4DNIA 3RZOH 1D1KA 4K6LA 1YJ9A 4FNFA 4JI5L 2XRSD 2K52A 2OQKA 3V2TA 3HOYH 1SSOA 3U4VA 4IUQA 3GTOB 1SYDA 4GLWA 2AHOB 5BN5A 4P2CB 2Z4IA 5EBDA 2FB9A 2SCUB 4YY3Q 3TP5A 4K5WA 4FDBA 1SYCA 3NEMA 4ZI7F 2F52A 1U4LA 2NWGA 2E2HB 3RFCA 1ICWA 2DN8A 2PI2E 3CC7A 2B63G 3J7YW 3GTJB 5LHY1 2EYLA 2DIKA 1ZEQX 2LXKA 1SMYD 2Z4HA 5C6AA 1MJCA 3KLSA 2NU6B 2I0QA 1VQKA 2UUCQ 2I5LX 1OBDA 1ET0A 1HUMA 4ABNA 1KT8A 3GTKH 2FPGB 5HURA 2JA5H 3JSNA 4R4QA 3VMMA 1O78A 2F0QA 2L9HA 5C44H 2F0UA 4J8QA 1SBBB 1R9TH 4A3MH 3S2DB 2GQSA 2W6MA 5ELOA 4HIMA 4JBWA 3ZJYC 3GIDA 2YZGA 1HZBA 5FO9B 3M7NA 4DV6Q 3H94A 3H0GH 4ME6A 3RTXA 2WKDA 4O7WA 4AYBE 1SE4A 3RUPA 3BS1A 1Y8OB 1I50B 1VF5C 4DNRB 3HOVH 3DAAA 5K2MA 1QE6A 1WCMB 1WOCA 3CEBA 4B3ML 4YAJB 2NVYB 2I87A 2HCCA 1I4HA 1SJHD 5LMUL 3G6EA 2HHHQ 1B3QA 4XZ3B 1Y8PB 5EKIA 1VQPA 2A1HA 4NXNL 3RR5A 5CV8A 4FF3A 5JEAG 4GLXA 5C8YF 1I6HH 2HGWA 2GA4B 3BABA 1HZCA 4DR4Q 1DOLA 4C3HG 1L1OB 2QILA 4CJ2C 1HNXQ 2Z6KC 5AJ3Q 5M3MH 2IY5B 5IYBH 1EWIA 2NVQB 2WAQG 1N9WA 2B3GA 4N8X1 1PH3A 2D0OA 1G51A 3A7AB 4WJ3M 2G9HD 2YTYA 2O5JC 4DV4Q 3TN2A 4CHIA 5CBAE 2N55A 3KFUA 4NW2A 2UXBQ 4X66Q 2RCNA 1S72A 4K5XA 3SK5A 3GB8B 4DAMA 1EYAA 1E1OA 3CQZB 2PO4A 2CH4A 5ISRA 4IHJF 3PO3G 2CNUA 3T16A 3AEVA 5C5LA 1N33L 4FXGC 1XX8A 5M5XB 4E6IA 1PRTD 5FOBB 3KK7A 5D1OA 3GTPB 1MD2D 2MP1A 5IODA 3PF5A 2DABA 1U9RA 2ICEC 1VQFA 3ORQA 3SDZA 4WFN3 4MA0A 1PYWD 1I94L 1HR0Q 4I55F 1JJGA 4BY1B 3R93A 1CSPA 1WFQA 1W93A 1F2LA 2VY3A 3VYSA 2IP4A 4KKTA 4BA2I 4DV3L 3IFDA 2PQAA 2LFNA 5E4WC 1H9SA 4R4CA 1JORA 2YTXA 4DR6L 1IXRA 1BCPB 1KLUD 1U4RA 4A3IG 1M6VA 4IURA 1XJVA 2F0TA 1IKLA 5CYUA 1C7YA 1ZYRD 1PH6A 4F8MA 2RKSA 1Z6HA 2HD3A 3C2PA 4LF8L 1EY5A 4DR7L 2ZDHA 2DNEA 3VNNA 1LYLA 3M9BA 2BA0A 1EWHA 4MNOA 5I5SA 5BYBA 2GVAA 1GSHA 2CWAA 4YHHL 1ML0D 3HOWG 3V4SA 3KF6B 3F2BA 4QIWB 4FYDA 3QO2A 4WHXA 4IPHA 2ZXOA 5FK9C 1HCZA 1TS2A 3NP8A 4GLVB 3I4MH 2MO1A 5I2YA 3KOJA 2EOTA 2NU7B 2OLSA 5F2DA 2W6ZA 2KECA 1B4OA 4JBKA 3OTOQ 2ASBA 3CCMA 3KDFA 1SFOB 3CC4A 4RKLA 2Z6BA 4KY6A 3S24A 3TREA 4APVA 1GVPA 3QWNA 2HG8A 4HIDA 2VUMB 5I6YA 3DHQA 2HGSA 4DQNA 4LUZA 2A68C 3CU7A 3T9DA 4OEMB 4O42A 1NBWA 2GVBA 4MHEA 2AMCB 2A6HD 1PH9A 2AKWB 3V96A 2E76C 4HSPA 1CKNA 2Q2IA 3W3AA 4CJ0B 5DEHA 4FFLA 3AQQA 1KQSA 5DGIA 4ZRZA 4P72A 3CW2C 1AZPA 5D1PA 1B3AA 1FGUA 1HPCA 1WVLA 1PH4A 1M1KC 1NE3A 1S5DD 5KIXA 3VPCA 1F2MA 4O4HF 1H9RA 1H9JA 4P74A 3TS2A 5TSSA 1JWMD 3K5MA 2DJFC 5D3IB 3UDIA 2JA7H 1VQ9A 4ZQIA 2Z6KA 5LYJF 3TZUA 3I91A 4GN4B 4R8IA 5BPFA 4UUGA 4KI0A 1VQGA 5J1ZA 2UUAL 1SYEA 2UXDQ 4KN7C 4JBJA 1N34L 4A3KB 3S1NB 2GLTA 2NTTA 5C4JH 4PZ8A 3BVGA 3TEKA 1I2LA 1Q12A 4HQ6A 4QJFA 4P75A 1JWSD 3STBC 4DXGA 1ASZA 2CQOA 1KDCA 3CPFA 1SNPA 3FPPA 4B3MQ 5EJWA 4UCUA 2YTVA 4ZKBB 4RGTA 5BWUA 2K5NA 3LX0A 3J7AV 3A5ZB 1WTRA 4NXNQ 2PW5A 1EIGA 3C3LA 1F9SA 2AWOA 4PV1C 5CAEB 1SJED 2YS6A 2YYAA 1GO3E 2B63H 1LTID 1RF2D 2KCNA 3CCJA 3BZDB 1XNQQ 5FPOA 4UY8C 5IT9c 4TV8F 4O1NA 4TVIA 2WINB 1AEXA 3J80L 4XYLB 2YU9B 2BE5C 4HJ7A 3WWHA 2SNSA 4DAVA 1S5FD 4IUPA 4OWXB 4EQ5A 2EY2A 5CGKA 4JYAL 2EY1A 3ONAB 2F4VL 2IL8A 2B29A 4CDCC 4DXFA 2F0PA 4JI8L 1B1ZA 2C5CA 4RKBA 1BO0A 1RD9D 3CC2A 3QQMA 5JPMC 5JVG3 2CW0C 2I5HA 4A93G 3G8DA 3M3YB 1Q90A 2WIIB 3HBLA 1CSQA 2NB0A 4WORA 1IBKL 1TXYA 3JZ6A 1PRTC 4FP5D 4JI6L 1EUJA 3VPBA 1GUNA 2K5VA 1HXYD 3E0JA 3CRKC 3I55A 1XMOL 1PV4A 2WYOA 3Q1KA 2K5HA 4TVAB 4B08A 4FFRA 4JVZA 1O80A 3U55A 4XYMB 1I94Q 1SMXA 1FR3A 3KAKA 4H13C 1SNMA 1HQMC 4EEQA 5CV9A 2PNRC 5IYDG 5ELNA 4BY7B 4JC0A 3F1ZA 3PO2B 2WACA 5JEAH 1TQOA 2DAAA 4LUOA 3H15A 1YNXA 4C3HH 2EYHA 1BXRA 4MTNA 2Q2TA 5IYCG 1WTPA 4JW0A 2FPIB 2JA8G 4DR6Q 4NZNA 3S2HH 4HCEA 4E6NA 4E4TA 2XD4A 4FF1A 1MSGA 1V1QA 1DJRD 1CHQD 3A8JE 1I3QB 2PZTA 4DR7Q 1PTOH 3NBZB 3ULLA 3E9IA 3SNOA 4OWWB 1YNND 1WTOA 3HO8A 1IBML 4JI7L 4DKAC 1STBA 1IKMA 3HGBA 1G6ZA 3PO3H 4YCWA 2ZJRA 2IX1A 4RH6A 3CCSA 2RDHA 5DM63 3F2UA 3S14B 5IGGA 4XQQA 5KGUA 1PFSA 2COGA 4O82A 3SK4A 1W3SA 5M5WB 1DOKA 4PNYA 3M4QA 1STEA 1HJPA 5IT9E 4LMQD 1B04A 4C3IG 1YBYA 1UE6A 1KJ9A 4OGQC 4I65A 2DY7A 2WP8J 4A3FH 3UDXA 1AFPA 4R4TA 2KA7A 5K5PA 4KMUC 5BN4A 2TSSA 2BH2A 2JEAI 4O7NA 4A3JG 1KUTA 3UFXB 1VQEA 3RLOA 4UCRA 5A2QE 2LS01 1EUDB 5GAGC 4C5BA 4CE5A 3NTIA 4ALPA 1EKPA 1PTOC 4HNVA 2A6EC 2EXZA 3SK8A 2NU8B 4YY3L 1NJIC 1V1PA 1KC8C 3GTQH 4HN7A 1Q46A 4LNQA 4PMBA 2KJXA 2GQRA 1DZ1A 1YEZA 1ZKOA 2WFWA 2O5IC 1I1LA 3P20A 1TA8A 4HR7A 4NPSA 1KIXA 4Y8VB 4BBRG 2B2UA 1NMGA 4DN4M 1SE3A 4EX5A 3HOXB 5K36G 4JXUA 1FL0A 3BYTB 4HJAA 3BACA 3HOWH 4ID6A 2B2WA 2R7ZG 1LT3D 1KD1C 4PG3A 3D6CA 3J7ZC 1STGA 1LTRD 3G7LA 4IPGA 1BBUA 1RL2A 2KOLA 1QVFA 5C5MA 3DTFA 5BMVF 1KJQA 2E8GA 3HKZG 1T36A 1W2BA 5HBRB 4BA1I 3J81L 1EIHA 2QW7A 4KJOA 1TWFH 1A63A 1E0BA 2OEOA
chains in the Genus database with same CATH topology
3M3YH 4ME3A 1KL9A 3MEFA 1N36Q 1N34Q 4GKKL 2CCZA 4DNIA 3RZOH 5C4XH 1EIFA 3L2PA 3KDFB 3J81i 1VS0A 1YJ9A 1YJWA 1K9MC 4JI5L 2K52A 2OQKA 1UEBA 3HOYH 3U4VA 4C2MH 1KXLA 2ALYB 2AHOB 5IY0A 4AQYQ 4UCSA 3CPWA 1Z9FA 1D8LA 4YWMA 1YIJA 1IBLL 1JJ2A 4L5SA 2XTIA 4YY3Q 1X54A 1P16A 3RLFA 3TY8A 4IPCA 1YJNA 1M90C 4JI4L 1QZHA 4FDBA 3KYHC 2VZAA 3NELA 4BY1G 4DV7Q 2HVSA 4BY7H 5IE8A 3PO2H 3NEMA 1WI5A 2F52A 4PZ6A 4IOCA 1JE5A 2PI2E 5C3EG 1NMFA 3CC7A 4K0KL 1ASYA 2HHHL 2B63G 3S1MH 4LF7Q 2R93G 1VQAA 5GAHC 4OO1I 2E2IH 4OX9L 2LXKA 5FJ8G 4JV5Q 4BXXG 1S68A 1MJCA 1CKNB 1S3OA 4DUZQ 4O0AA 5FLMG 5GQOA 2I0QA 4A3CG 1VQKA 4IO9A 1X3FA 2UUCQ 2I5LX 2A19A 1FJGQ 3S15H 4LFBQ 1TAEA 3I4NG 1I3QH 4XTCS 1X9NA 1AH9A 3GTKH 4AH6A 2JA5H 3JSNA 4DUYL 1A0IA 4R4QA 3E9HA 4DV1Q 1LM0A 2CKZB 2F4VQ 5C44H 2K75A 4JI8Q 4RG1A 2F3IA 1NTGA 5C4XG 5IP7G 4GKJL 1SN8A 2K4KA 2YYZA 1Y14B 3I56A 4DV4L 2AWNA 1R9TH 1CUKA 1PH5A 2VW9A 4A3EH 4A3MH 4JI5Q 4DR5Q 4BBSG 4JBMA 3K8AA 5HGQA 2MFIA 1IBKQ 3S14H 4C3JH 5ELOA 4HIMA 4JBWA 3ZJYC 1N8RC 2UUBQ 1HZBA 1HNZL 1IL2A 3M7NA 4DV6Q 3H0GH 3RTXA 2HVRA 1GD7A 1WYDA 1KAWA 3E0EA 2KENA 3PUWA 4AYBE 5M5WH 4DV0L 1XMOQ 3CD6A 4IJLA 4POGA 1L0WA 1O7IA 1VQ4A 1YITA 2HQLA 3HOVH 1J6QA 1PYSB 1WOCA 4B3ML 1V9PA 4X65L 2WB1E 4QGUA 5LMUL 1XDNA 4X6AH 4K0KQ 3G6EA 3PUXA 2HHHQ 5JJKA 3S16H 3MXNB 3FHWA 1VQPA 4H02A 4NXNL 3RR5A 1SROA 5JEAG 4GLXA 2VUMG 3BZCA 3H3VH 3ULPA 1SE8A 1Z47A 1I6HH 3BABA 1VQMA 2E2JH 2UXCQ 3NC0B 1HZCA 3CXCA 4DR4Q 3AYHB 5J3BA 3HKZE 4UCOA 1HNXQ 1L1OB 2D0PA 2JA6H 1VQDA 4LH7A 2Z6KC 5AJ3Q 2D62A 5M3MH 2IY5B 5IYBH 1X65A 1EWIA 2FXQA 1LTLA 3TQYA 1VQ7A 1YHQA 4YCVA 3K7AH 2PI2A 2WAQG 5FPRA 4OXPA 1N9WA 2B3GA 2BH8A 2RF4A 3D0FA 4KHZA 4KLKA 5C0XG 3L7ZC 2R7DA 5M3FH 2D0OA 1PH3A 1G51A 2EXDA 4WJ3M 4IOAA 2LXJA 2YTYA 4A3IH 4A3DG 3FP9A 4X62L 4DV4Q 3CCRA 1JT8A 4A3EG 3HOXH 3KFUA 2UXBQ 2MO0A 4X66Q 2RCNA 1S72A 4DV2L 3BAAA 4HJ5A 3GB8B 3ICEA 3KF8B 4DAMA 3T1HL 1VCIA 1MJEA 2H5XA 1E1OA 1EOVA 3K0XA 4A3GG 1Y1VG 2PMZE 5H1SE 3KJOA 4A93H 3GDEA 1E1TA 3PO3G 1UWVA 4DV0Q 1E24A 3AEVA 4DAYB 1N33L 2HVQA 5HY6A 1KHIA 3BJUA 2IHFA 1UE1A 4O2DA 3SGIA 5D1OA 3RNUA 4B3SL 3S17H 1CKOA 4B3TQ 5JJIA 1X3GA 5LMUQ 3PF5A 1XPOA 4A3KG 2N78A 1VQFA 3UQ8A 1TWAH 1I94L 2EQSA 1HZ9A 2VL6A 1HR0Q 4LFAL 3GTOH 4DV5Q 3TEHB 5IYDH 1JJGA 3ER0A 1TWCH 3DLLA 5EAYA 3K7UC 1CSPA 1WFQA 3CMEA 3J81j 4NXMQ 2VY3A 4IFDG 3AFPA 3EBEA 4BA2I 4JI1L 4DV3L 1XPUA 1J5EL 1K83H 1EIYB 2PQAA 3RN5A 5FLXc 4QIWE 3CMAA 5IYCH 4KHPL 4R4CA 2E2HH 2YTXA 2JA8H 1IXRA 3U50C 4DR6L 3W1GA 2QEXA 4A75A 4PZ7A 4GOPC 3TS0A 4A3IG 2UU9L 3G48A 1YHBA 3NBHB 4DR2L 1XJVA 1VQ5A 3RN2A 3GTJH 1C7YA 1JMCA 1PH6A 4GNXB 4DRFA 4GN5A 4DR1L 4LF8L 4DR7L 1C9OA 3I2ZA 3T1HQ 1AE3A 3VNNA 1LYLA 2JQOA 3M9BA 4GOPA 1VQBA 4QL5A 4PMWA 3PF4A 2BA0A 3LGJA 3S1QH 4MNOA 2GVAA 1N33Q 2NZOA 2CWAA 4YHHL 3HOWG 1GKHA 3KF6B 3F2BA 1AE2A 3UE1A 1FVIA 4IPHA 4P73A 2NN6I 4B3SQ 4GLVB 3I4MH 5IP9H 4A3LH 1Y1WG 2MO1A 1QVCA 1TWHH 3A74A 3KOJA 4A3BH 4R4OA 3TRZA 3S2DH 4JBKA 4LF9L 3GD7A 3OTOQ 2ASBA 3FKIH 3CCQA 2VQEL 4GN3B 3CCMA 3KDFA 4C3IH 2VQFL 2ZJPA 4GKKQ 4HJ8A 3CC4A 4B3RL 3HFZB 3T1YL 1VQ8A 2LSSA 3HOYG 2UXDL 5IWAL 1I50H 3A5UA 4DV3Q 1MIUA 3S24A 3TREA 3BU2A 4GNXC 1J5EQ 2HT1A 3TY9A 2DGYA 1WCMH 3UDGA 4A3JH 2NVYH 1GVPA 3F8TA 4APVA 1B70B 4AIMA 1IBLQ 1X6OA 4JOIC 4HIDA 2R92H 4JG2A 4JI4Q 2N8NA 4LUZA 1H95A 2Y0SE 4LF4L 2JK8A 3GTGH 4BY7G 3Q8DA 3PO2G 3D31A 1CKMA 4DR1Q 1NBWA 4L5QA 2GVBA 4LF8Q 3CCLA 3HOUH 4TQUS 5GADC 3RZDH 4J15A 2AMCB 1PH9A 2AKWB 4UP9A 1HNWL 3BA9A 1PH8A 1BBWA 4OX9Q 3KLWA 1CKNA 2Q2IA 1Q8KA 4UP8A 2KHJA 3AQQA 4HTOA 4YHHQ 1KQSA 1WJJA 2ATWA 4P72A 5GAEC 2MQHA 3CW2C 1YI2A 2NVQH 3PUZA 4BBRH 4IPDA 5D1PA 2L15A 1FGUA 2OWOA 1XNQL 3VDYA 3I4OA 1PH4A 1M1KC 1NE3A 4X64L 1EQRA 1HZAA 4LUVA 2R7ZH 4WJ4A 1TWGH 1QUQB 2JA5G 4DUYQ 4JI2L 4JI0L 3M85A 4P74A 3TS2A 3U58A 2Z0SA 4XIGS 2JA7H 3UDIA 2JJQA 5C44G 2IX0A 2Z6KA 3DM3A 2JA9A 3CCVA 1VQ9A 1D7QA 1XMQL 4GN4B 3S1RH 1X55A 1XPRA 4GKJQ 2QGQA 2RHSB 3CQZH 1VQGA 4KI0A 1XK5A 1U5KA 2UUAL 4A3MG 1VQOA 3T1YQ 2UXDQ 1KRSA 3W1BA 2JEBI 4JBJA 5GROA 1N34L 1E3PA 1N36L 4Y52H 5JEAJ 5M5XH 1K0RA 3W5OA 5E7NA 4PZ8A 3JAMc 5C4JH 1HNZQ 2E5LL 1Q12A 3H0GG 4LF6L 4QJFA 3GTPH 3WWVA 4P75A 3UDFA 3STBC 2EIFA 1ASZA 2CQOA 3HOVG 4AQYL 1VQHA 3PUVA 3CPFA 4B3MQ 2CFMA 4UCUA 2YTVA 2CWPA 4X65Q 1EQQA 1PHJA 5DISC 1L1OC 3HOUG 2NVXH 2JE6I 5C0XJ 2K5NA 1BVSA 4L5TA 3M4OH 1P8LA 1EYGA 1K73C 3A5ZB 3UE0A 4AYBG 4DV7L 4BY1H 4NXNQ 4R4IA 4YWKA 2AWOA 1UE7A 5C3EH 2N3SA 4CC6A 2KHIA 4LW1A 1L1OA 1GO3E 3F2CA 1VQIA 2B63H 1OXVA 1T9HA 1N32L 2R93H 2WB1G 3CCJA 2JA6G 2VS1A 2OTJA 1XNQQ 5M3MG 5FPOA 4UY8C 5IYBG 1SLJA 3IRBA 5FJ8H 4X64Q 5IT9c 2YU9H 4BXXH 1PH1A 4A3CH 5FLMH 2UUCL 2BA1A 3B6YA 2C35B 1FJGL 4LFBL 1BKBA 3K81C 2KCTA 3I7FA 4DK3C 5M3FG 1VQLA 3I4NH 2KCMA 4HJ7A 1I5FA 2ZTDA 4X62Q 4OWXB 4EQ5A 3G71A 4DV1L 4JYAL 2UUAQ 5DLQE 2R6GA 3HOXG 2F4VL 1DGSA 2IT1A 2B29A 3PUYA 2ZTCA 4JI8L 4DV2Q 4IFDI 5JJLA 2ZM6L 5IP7H 4LF6Q 2N49A 2E5LQ 3CC2A 4BBSH 2I5HA 4A93G 4DR5L 4GS3A 4UCTA 3ULJA 1CSQA 1IBKL 1TXYA 3PV0A 5M5YH 2UUBL 3OW2A 4IFDJ 3EIVA 2YV5A 1VQ6A 4DV6L 1EUJA 1PA6A 4JI6L 1XNRL 3HOZH 4OO1G 4UFZA 2K5VA 1Q1EA 3AFQA 3I55A 1XMOL 1Q86C 1PV4A 4R1JA 1EFWA 4DPGA 2K5HA 1SFOH 4TVAB 3F2DA 2NN6G 3J80c 4LFCL 3KJPA 1YVCA 1IYJB 1I94Q 4DK6C 4HIOA 1SMXA 4LFAQ 4EEQA 5IYDG 3J81c 1N32Q 2VNUD 5ELNA 4HJ9A 1OXTA 4JC0A 1VQJA 2Q2HA 2WAQE 3F1ZA 2VUMH 1JJCB 3OYYA 3J7A5 4LUOA 4JI1Q 1K3RA 5BR8L 3H15A 4DR4L 2UXCL 1YNXA 1X56A 4C3HH 1HH2P 2K50A 1HNXL 2A8VA 5AJ3L 4OWTB 4MTNA 1A62A 2GN5A 2Q2TA 3HKSA 3U4ZA 5IYCG 4KHPQ 4LH6A 2JA8G 4DR6Q 4UCVA 3JC66 3S2HH 4LF5L 2UU9Q 3GTLH 1VQNA 3BA8A 4DR2Q 3RLNA 4JYAQ 4E6NA 4GNXA 1X3EA 1V1QA 3PN1A 3PIOA 3G4SA 3ERSX 3QWUA 2XGTA 2ZM6Q 4JOIA 4A3FG 4DR7Q 3NBZB 1OTCA 3ULLA 3E9IA 4A3DH 2VUGA 4OWWB 3GTMH 4QY7A 1IBML 2UXBL 2A1AA 4JI7L 4X66L 2R7FA 1B7YB 4DKAC 1GM5A 1RIPA 1UE5A 3KF6A 1Q81C 1C0AA 3CCUA 1SRUA 4RMFA 2HIVA 3BZKA 4A3GH 4JI6Q 3A0JA 2OTLA 3HOZG 3JAMi 1Y1VH 1XNRQ 2Q2UA 4JI3L 2IHEA 2RHQB 4IJHA 4YCWA 2ZJRA 2ES2A 3PO3H 1L2FA 1OXXK 3CF5A 2IX1A 1E22A 1VQCA 4LWCA 3I4MG 5IP9G 3CCSA 4A3LG 4EFEA 1K8AC 3STBD 5LMNL 4LFCQ 1PFSA 2DUDA 4A3BG 2QA4A 1W3SA 1PH2A 4B3TL 3M4QA 4UP7A 4LF9Q 5D1OB 4HTPA 1HJPA 3FKIG 2VQEQ 3L0OA 3NBYB 4HIKA 1IZ6A 4A3KH 2VQFQ 1B04A 1SR3A 1UE6A 1YBYA 3S1NH 4DR3L 4B3RQ 2K14A 1HR0L 3PGZA 2WP8J 3M4PA 4A3FH 3UDXA 1Q82C 3GO5A 4R4TA 5IWAQ 5BR8Q 2HIXA 4UPAA 4POFA 1NY4A 4DV5L 2KBNA 4L5RC 2BH2A 1QZGA 2JEAI 3JSLA 1WCMG 4A3JG 4JCVE 2R92G 1K8GA 4NXML 1VQEA 3RLOA 5C0XI 4UCRA 2ZTEA 1E7ZA 3TY5A 4LF5Q 1G291 3CP0A 5GAGC 4LF4Q 4EFBA 2MNAA 4ALPA 2ID0A 2PQAB 4CC5A 3CCEA 2I5MX 2V1CC 3PSIA 4YY3L 1NJIC 1XTDA 1KC8C 3PIPA 3GTQH 4YCUA 3GJXB 3K80C 1Q46A 4LNQA 4GLAC 1HNWQ 1V43A 3PCOB 1IBMQ 2OQ0A 4YWLA 4JI7Q 1YEZA 2WFWA 1Q7YC 1S40A 2NVTH 2Y0SG 1TA8A 4MZ9A 4NPSA 1KIXA 3EN2A 1PVOA 2OCEA 4Y7NH 4BBRG 4JI3Q 4LF7L 5LMNW 1G6PA 1NMGA 1U0LA 4EX5A 4GOPB 5K36G 1FL0A 4HJAA 1PYBA 1OXSC 3HOWH 4OONA 1OXUA 2NZHA 1QUQA 4JV5L 1KRTA 4A4IA 5LMNQ 4DUZL 2R7ZG 1KD1C 1JB7A 1MKHA 1YZ6A 1Q1BA 3CAMA 4PG3A 4JI2Q 3J7ZC 4JI0Q 4IPGA 4NB3A 4P71A 2ZJQA 1QVGA 2PNHA 1BBUA 1RL2A 2JA7G 1QVFA 4A76A 1Y1WH 1HR0W 1LUZA 3H3VI 2E8GA 3HKZG 4QQBX 1XMQQ 4DR3Q 3J80i 1W2BA 3NENA 1B8AA 4BA1I 1A8VA 1YHAA 1TWFH 1A63A 1PH7A 3OTOL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y H;  4ME3 A;  1KL9 A;  3MEF A;  1N36 Q;  1N34 Q;  4GKK L;  2CCZ A;  4DNI A;  3RZO H;  5C4X H;  1EIF A;  3L2P A;  3KDF B;  3J81 i;  1VS0 A;  1YJ9 A;  1YJW A;  1K9M C;  4JI5 L;  2K52 A;  2OQK A;  1UEB A;  3HOY H;  3U4V A;  4C2M H;  1KXL A;  2ALY B;  2AHO B;  5IY0 A;  4AQY Q;  4UCS A;  3CPW A;  1Z9F A;  1D8L A;  4YWM A;  1YIJ A;  1IBL L;  1JJ2 A;  4L5S A;  2XTI A;  4YY3 Q;  1X54 A;  1P16 A;  3RLF A;  3TY8 A;  4IPC A;  1YJN A;  1M90 C;  4JI4 L;  1QZH A;  4FDB A;  3KYH C;  2VZA A;  3NEL A;  4BY1 G;  4DV7 Q;  2HVS A;  4BY7 H;  5IE8 A;  3PO2 H;  3NEM A;  1WI5 A;  2F52 A;  4PZ6 A;  4IOC A;  1JE5 A;  2PI2 E;  5C3E G;  1NMF A;  3CC7 A;  4K0K L;  1ASY A;  2HHH L;  2B63 G;  3S1M H;  4LF7 Q;  2R93 G;  1VQA A;  5GAH C;  4OO1 I;  2E2I H;  4OX9 L;  2LXK A;  5FJ8 G;  4JV5 Q;  4BXX G;  1S68 A;  1MJC A;  1CKN B;  1S3O A;  4DUZ Q;  4O0A A;  5FLM G;  5GQO A;  2I0Q A;  4A3C G;  1VQK A;  4IO9 A;  1X3F A;  2UUC Q;  2I5L X;  2A19 A;  1FJG Q;  3S15 H;  4LFB Q;  1TAE A;  3I4N G;  1I3Q H;  4XTC S;  1X9N A;  1AH9 A;  3GTK H;  4AH6 A;  2JA5 H;  3JSN A;  4DUY L;  1A0I A;  4R4Q A;  3E9H A;  4DV1 Q;  1LM0 A;  2CKZ B;  2F4V Q;  5C44 H;  2K75 A;  4JI8 Q;  4RG1 A;  2F3I A;  1NTG A;  5C4X G;  5IP7 G;  4GKJ L;  1SN8 A;  2K4K A;  2YYZ A;  1Y14 B;  3I56 A;  4DV4 L;  2AWN A;  1R9T H;  1CUK A;  1PH5 A;  2VW9 A;  4A3E H;  4A3M H;  4JI5 Q;  4DR5 Q;  4BBS G;  4JBM A;  3K8A A;  5HGQ A;  2MFI A;  1IBK Q;  3S14 H;  4C3J H;  5ELO A;  4HIM A;  4JBW A;  3ZJY C;  1N8R C;  2UUB Q;  1HZB A;  1HNZ L;  1IL2 A;  3M7N A;  4DV6 Q;  3H0G H;  3RTX A;  2HVR A;  1GD7 A;  1WYD A;  1KAW A;  3E0E A;  2KEN A;  3PUW A;  4AYB E;  5M5W H;  4DV0 L;  1XMO Q;  3CD6 A;  4IJL A;  4POG A;  1L0W A;  1O7I A;  1VQ4 A;  1YIT A;  2HQL A;  3HOV H;  1J6Q A;  1PYS B;  1WOC A;  4B3M L;  1V9P A;  4X65 L;  2WB1 E;  4QGU A;  5LMU L;  1XDN A;  4X6A H;  4K0K Q;  3G6E A;  3PUX A;  2HHH Q;  5JJK A;  3S16 H;  3MXN B;  3FHW A;  1VQP A;  4H02 A;  4NXN L;  3RR5 A;  1SRO A;  5JEA G;  4GLX A;  2VUM G;  3BZC A;  3H3V H;  3ULP A;  1SE8 A;  1Z47 A;  1I6H H;  3BAB A;  1VQM A;  2E2J H;  2UXC Q;  3NC0 B;  1HZC A;  3CXC A;  4DR4 Q;  3AYH B;  5J3B A;  3HKZ E;  4UCO A;  1HNX Q;  1L1O B;  2D0P A;  2JA6 H;  1VQD A;  4LH7 A;  2Z6K C;  5AJ3 Q;  2D62 A;  5M3M H;  2IY5 B;  5IYB H;  1X65 A;  1EWI A;  2FXQ A;  1LTL A;  3TQY A;  1VQ7 A;  1YHQ A;  4YCV A;  3K7A H;  2PI2 A;  2WAQ G;  5FPR A;  4OXP A;  1N9W A;  2B3G A;  2BH8 A;  2RF4 A;  3D0F A;  4KHZ A;  4KLK A;  5C0X G;  3L7Z C;  2R7D A;  5M3F H;  2D0O A;  1PH3 A;  1G51 A;  2EXD A;  4WJ3 M;  4IOA A;  2LXJ A;  2YTY A;  4A3I H;  4A3D G;  3FP9 A;  4X62 L;  4DV4 Q;  3CCR A;  1JT8 A;  4A3E G;  3HOX H;  3KFU A;  2UXB Q;  2MO0 A;  4X66 Q;  2RCN A;  1S72 A;  4DV2 L;  3BAA A;  4HJ5 A;  3GB8 B;  3ICE A;  3KF8 B;  4DAM A;  3T1H L;  1VCI A;  1MJE A;  2H5X A;  1E1O A;  1EOV A;  3K0X A;  4A3G G;  1Y1V G;  2PMZ E;  5H1S E;  3KJO A;  4A93 H;  3GDE A;  1E1T A;  3PO3 G;  1UWV A;  4DV0 Q;  1E24 A;  3AEV A;  4DAY B;  1N33 L;  2HVQ A;  5HY6 A;  1KHI A;  3BJU A;  2IHF A;  1UE1 A;  4O2D A;  3SGI A;  5D1O A;  3RNU A;  4B3S L;  3S17 H;  1CKO A;  4B3T Q;  5JJI A;  1X3G A;  5LMU Q;  3PF5 A;  1XPO A;  4A3K G;  2N78 A;  1VQF A;  3UQ8 A;  1TWA H;  1I94 L;  2EQS A;  1HZ9 A;  2VL6 A;  1HR0 Q;  4LFA L;  3GTO H;  4DV5 Q;  3TEH B;  5IYD H;  1JJG A;  3ER0 A;  1TWC H;  3DLL A;  5EAY A;  3K7U C;  1CSP A;  1WFQ A;  3CME A;  3J81 j;  4NXM Q;  2VY3 A;  4IFD G;  3AFP A;  3EBE A;  4BA2 I;  4JI1 L;  4DV3 L;  1XPU A;  1J5E L;  1K83 H;  1EIY B;  2PQA A;  3RN5 A;  5FLX c;  4QIW E;  3CMA A;  5IYC H;  4KHP L;  4R4C A;  2E2H H;  2YTX A;  2JA8 H;  1IXR A;  3U50 C;  4DR6 L;  3W1G A;  2QEX A;  4A75 A;  4PZ7 A;  4GOP C;  3TS0 A;  4A3I G;  2UU9 L;  3G48 A;  1YHB A;  3NBH B;  4DR2 L;  1XJV A;  1VQ5 A;  3RN2 A;  3GTJ H;  1C7Y A;  1JMC A;  1PH6 A;  4GNX B;  4DRF A;  4GN5 A;  4DR1 L;  4LF8 L;  4DR7 L;  1C9O A;  3I2Z A;  3T1H Q;  1AE3 A;  3VNN A;  1LYL A;  2JQO A;  3M9B A;  4GOP A;  1VQB A;  4QL5 A;  4PMW A;  3PF4 A;  2BA0 A;  3LGJ A;  3S1Q H;  4MNO A;  2GVA A;  1N33 Q;  2NZO A;  2CWA A;  4YHH L;  3HOW G;  1GKH A;  3KF6 B;  3F2B A;  1AE2 A;  3UE1 A;  1FVI A;  4IPH A;  4P73 A;  2NN6 I;  4B3S Q;  4GLV B;  3I4M H;  5IP9 H;  4A3L H;  1Y1W G;  2MO1 A;  1QVC A;  1TWH H;  3A74 A;  3KOJ A;  4A3B H;  4R4O A;  3TRZ A;  3S2D H;  4JBK A;  4LF9 L;  3GD7 A;  3OTO Q;  2ASB A;  3FKI H;  3CCQ A;  2VQE L;  4GN3 B;  3CCM A;  3KDF A;  4C3I H;  2VQF L;  2ZJP A;  4GKK Q;  4HJ8 A;  3CC4 A;  4B3R L;  3HFZ B;  3T1Y L;  1VQ8 A;  2LSS A;  3HOY G;  2UXD L;  5IWA L;  1I50 H;  3A5U A;  4DV3 Q;  1MIU A;  3S24 A;  3TRE A;  3BU2 A;  4GNX C;  1J5E Q;  2HT1 A;  3TY9 A;  2DGY A;  1WCM H;  3UDG A;  4A3J H;  2NVY H;  1GVP A;  3F8T A;  4APV A;  1B70 B;  4AIM A;  1IBL Q;  1X6O A;  4JOI C;  4HID A;  2R92 H;  4JG2 A;  4JI4 Q;  2N8N A;  4LUZ A;  1H95 A;  2Y0S E;  4LF4 L;  2JK8 A;  3GTG H;  4BY7 G;  3Q8D A;  3PO2 G;  3D31 A;  1CKM A;  4DR1 Q;  1NBW A;  4L5Q A;  2GVB A;  4LF8 Q;  3CCL A;  3HOU H;  4TQU S;  5GAD C;  3RZD H;  4J15 A;  2AMC B;  1PH9 A;  2AKW B;  4UP9 A;  1HNW L;  3BA9 A;  1PH8 A;  1BBW A;  4OX9 Q;  3KLW A;  1CKN A;  2Q2I A;  1Q8K A;  4UP8 A;  2KHJ A;  3AQQ A;  4HTO A;  4YHH Q;  1KQS A;  1WJJ A;  2ATW A;  4P72 A;  5GAE C;  2MQH A;  3CW2 C;  1YI2 A;  2NVQ H;  3PUZ A;  4BBR H;  4IPD A;  5D1P A;  2L15 A;  1FGU A;  2OWO A;  1XNQ L;  3VDY A;  3I4O A;  1PH4 A;  1M1K C;  1NE3 A;  4X64 L;  1EQR A;  1HZA A;  4LUV A;  2R7Z H;  4WJ4 A;  1TWG H;  1QUQ B;  2JA5 G;  4DUY Q;  4JI2 L;  4JI0 L;  3M85 A;  4P74 A;  3TS2 A;  3U58 A;  2Z0S A;  4XIG S;  2JA7 H;  3UDI A;  2JJQ A;  5C44 G;  2IX0 A;  2Z6K A;  3DM3 A;  2JA9 A;  3CCV A;  1VQ9 A;  1D7Q A;  1XMQ L;  4GN4 B;  3S1R H;  1X55 A;  1XPR A;  4GKJ Q;  2QGQ A;  2RHS B;  3CQZ H;  1VQG A;  4KI0 A;  1XK5 A;  1U5K A;  2UUA L;  4A3M G;  1VQO A;  3T1Y Q;  2UXD Q;  1KRS A;  3W1B A;  2JEB I;  4JBJ A;  5GRO A;  1N34 L;  1E3P A;  1N36 L;  4Y52 H;  5JEA J;  5M5X H;  1K0R A;  3W5O A;  5E7N A;  4PZ8 A;  3JAM c;  5C4J H;  1HNZ Q;  2E5L L;  1Q12 A;  3H0G G;  4LF6 L;  4QJF A;  3GTP H;  3WWV A;  4P75 A;  3UDF A;  3STB C;  2EIF A;  1ASZ A;  2CQO A;  3HOV G;  4AQY L;  1VQH A;  3PUV A;  3CPF A;  4B3M Q;  2CFM A;  4UCU A;  2YTV A;  2CWP A;  4X65 Q;  1EQQ A;  1PHJ A;  5DIS C;  1L1O C;  3HOU G;  2NVX H;  2JE6 I;  5C0X J;  2K5N A;  1BVS A;  4L5T A;  3M4O H;  1P8L A;  1EYG A;  1K73 C;  3A5Z B;  3UE0 A;  4AYB G;  4DV7 L;  4BY1 H;  4NXN Q;  4R4I A;  4YWK A;  2AWO A;  1UE7 A;  5C3E H;  2N3S A;  4CC6 A;  2KHI A;  4LW1 A;  1L1O A;  1GO3 E;  3F2C A;  1VQI A;  2B63 H;  1OXV A;  1T9H A;  1N32 L;  2R93 H;  2WB1 G;  3CCJ A;  2JA6 G;  2VS1 A;  2OTJ A;  1XNQ Q;  5M3M G;  5FPO A;  4UY8 C;  5IYB G;  1SLJ A;  3IRB A;  5FJ8 H;  4X64 Q;  5IT9 c;  2YU9 H;  4BXX H;  1PH1 A;  4A3C H;  5FLM H;  2UUC L;  2BA1 A;  3B6Y A;  2C35 B;  1FJG L;  4LFB L;  1BKB A;  3K81 C;  2KCT A;  3I7F A;  4DK3 C;  5M3F G;  1VQL A;  3I4N H;  2KCM A;  4HJ7 A;  1I5F A;  2ZTD A;  4X62 Q;  4OWX B;  4EQ5 A;  3G71 A;  4DV1 L;  4JYA L;  2UUA Q;  5DLQ E;  2R6G A;  3HOX G;  2F4V L;  1DGS A;  2IT1 A;  2B29 A;  3PUY A;  2ZTC A;  4JI8 L;  4DV2 Q;  4IFD I;  5JJL A;  2ZM6 L;  5IP7 H;  4LF6 Q;  2N49 A;  2E5L Q;  3CC2 A;  4BBS H;  2I5H A;  4A93 G;  4DR5 L;  4GS3 A;  4UCT A;  3ULJ A;  1CSQ A;  1IBK L;  1TXY A;  3PV0 A;  5M5Y H;  2UUB L;  3OW2 A;  4IFD J;  3EIV A;  2YV5 A;  1VQ6 A;  4DV6 L;  1EUJ A;  1PA6 A;  4JI6 L;  1XNR L;  3HOZ H;  4OO1 G;  4UFZ A;  2K5V A;  1Q1E A;  3AFQ A;  3I55 A;  1XMO L;  1Q86 C;  1PV4 A;  4R1J A;  1EFW A;  4DPG A;  2K5H A;  1SFO H;  4TVA B;  3F2D A;  2NN6 G;  3J80 c;  4LFC L;  3KJP A;  1YVC A;  1IYJ B;  1I94 Q;  4DK6 C;  4HIO A;  1SMX A;  4LFA Q;  4EEQ A;  5IYD G;  3J81 c;  1N32 Q;  2VNU D;  5ELN A;  4HJ9 A;  1OXT A;  4JC0 A;  1VQJ A;  2Q2H A;  2WAQ E;  3F1Z A;  2VUM H;  1JJC B;  3OYY A;  3J7A 5;  4LUO A;  4JI1 Q;  1K3R A;  5BR8 L;  3H15 A;  4DR4 L;  2UXC L;  1YNX A;  1X56 A;  4C3H H;  1HH2 P;  2K50 A;  1HNX L;  2A8V A;  5AJ3 L;  4OWT B;  4MTN A;  1A62 A;  2GN5 A;  2Q2T A;  3HKS A;  3U4Z A;  5IYC G;  4KHP Q;  4LH6 A;  2JA8 G;  4DR6 Q;  4UCV A;  3JC6 6;  3S2H H;  4LF5 L;  2UU9 Q;  3GTL H;  1VQN A;  3BA8 A;  4DR2 Q;  3RLN A;  4JYA Q;  4E6N A;  4GNX A;  1X3E A;  1V1Q A;  3PN1 A;  3PIO A;  3G4S A;  3ERS X;  3QWU A;  2XGT A;  2ZM6 Q;  4JOI A;  4A3F G;  4DR7 Q;  3NBZ B;  1OTC A;  3ULL A;  3E9I A;  4A3D H;  2VUG A;  4OWW B;  3GTM H;  4QY7 A;  1IBM L;  2UXB L;  2A1A A;  4JI7 L;  4X66 L;  2R7F A;  1B7Y B;  4DKA C;  1GM5 A;  1RIP A;  1UE5 A;  3KF6 A;  1Q81 C;  1C0A A;  3CCU A;  1SRU A;  4RMF A;  2HIV A;  3BZK A;  4A3G H;  4JI6 Q;  3A0J A;  2OTL A;  3HOZ G;  3JAM i;  1Y1V H;  1XNR Q;  2Q2U A;  4JI3 L;  2IHE A;  2RHQ B;  4IJH A;  4YCW A;  2ZJR A;  2ES2 A;  3PO3 H;  1L2F A;  1OXX K;  3CF5 A;  2IX1 A;  1E22 A;  1VQC A;  4LWC A;  3I4M G;  5IP9 G;  3CCS A;  4A3L G;  4EFE A;  1K8A C;  3STB D;  5LMN L;  4LFC Q;  1PFS A;  2DUD A;  4A3B G;  2QA4 A;  1W3S A;  1PH2 A;  4B3T L;  3M4Q A;  4UP7 A;  4LF9 Q;  5D1O B;  4HTP A;  1HJP A;  3FKI G;  2VQE Q;  3L0O A;  3NBY B;  4HIK A;  1IZ6 A;  4A3K H;  2VQF Q;  1B04 A;  1SR3 A;  1UE6 A;  1YBY A;  3S1N H;  4DR3 L;  4B3R Q;  2K14 A;  1HR0 L;  3PGZ A;  2WP8 J;  3M4P A;  4A3F H;  3UDX A;  1Q82 C;  3GO5 A;  4R4T A;  5IWA Q;  5BR8 Q;  2HIX A;  4UPA A;  4POF A;  1NY4 A;  4DV5 L;  2KBN A;  4L5R C;  2BH2 A;  1QZG A;  2JEA I;  3JSL A;  1WCM G;  4A3J G;  4JCV E;  2R92 G;  1K8G A;  4NXM L;  1VQE A;  3RLO A;  5C0X I;  4UCR A;  2ZTE A;  1E7Z A;  3TY5 A;  4LF5 Q;  1G29 1;  3CP0 A;  5GAG C;  4LF4 Q;  4EFB A;  2MNA A;  4ALP A;  2ID0 A;  2PQA B;  4CC5 A;  3CCE A;  2I5M X;  2V1C C;  3PSI A;  4YY3 L;  1NJI C;  1XTD A;  1KC8 C;  3PIP A;  3GTQ H;  4YCU A;  3GJX B;  3K80 C;  1Q46 A;  4LNQ A;  4GLA C;  1HNW Q;  1V43 A;  3PCO B;  1IBM Q;  2OQ0 A;  4YWL A;  4JI7 Q;  1YEZ A;  2WFW A;  1Q7Y C;  1S40 A;  2NVT H;  2Y0S G;  1TA8 A;  4MZ9 A;  4NPS A;  1KIX A;  3EN2 A;  1PVO A;  2OCE A;  4Y7N H;  4BBR G;  4JI3 Q;  4LF7 L;  5LMN W;  1G6P A;  1NMG A;  1U0L A;  4EX5 A;  4GOP B;  5K36 G;  1FL0 A;  4HJA A;  1PYB A;  1OXS C;  3HOW H;  4OON A;  1OXU A;  2NZH A;  1QUQ A;  4JV5 L;  1KRT A;  4A4I A;  5LMN Q;  4DUZ L;  2R7Z G;  1KD1 C;  1JB7 A;  1MKH A;  1YZ6 A;  1Q1B A;  3CAM A;  4PG3 A;  4JI2 Q;  3J7Z C;  4JI0 Q;  4IPG A;  4NB3 A;  4P71 A;  2ZJQ A;  1QVG A;  2PNH A;  1BBU A;  1RL2 A;  2JA7 G;  1QVF A;  4A76 A;  1Y1W H;  1HR0 W;  1LUZ A;  3H3V I;  2E8G A;  3HKZ G;  4QQB X;  1XMQ Q;  4DR3 Q;  3J80 i;  1W2B A;  3NEN A;  1B8A A;  4BA1 I;  1A8V A;  1YHA A;  1TWF H;  1A63 A;  1PH7 A;  3OTO L; 
#chains in the Genus database with same CATH topology
 4WJW A;  1M0W A;  2L11 A;  3I3C A;  1KL9 A;  4ME3 A;  2X5R A;  1N34 Q;  4GKK L;  5C4X H;  3J81 i;  4QF4 A;  1U4P A;  4K6D A;  1YJW A;  1K9M C;  1TU2 B;  3WDN A;  4C2M H;  4CMD A;  1UC9 A;  2ALY B;  1JOQ A;  5IY0 A;  4UCS A;  1YIJ A;  1MBY A;  5BWX A;  1JJ2 A;  1EQV A;  1D5M C;  4JI4 L;  1YJN A;  1C4Q A;  1K83 B;  3J7A F;  3KYH C;  2VZA A;  1WI5 A;  2EY5 A;  2HHH L;  4LF7 Q;  5IGE A;  1ZAU A;  1R4P B;  4OX9 L;  4O4J F;  4TKO B;  5FJ8 G;  4BXX G;  4O0A A;  2KVM A;  5DAU A;  5GQO A;  1TT2 A;  3S1Q B;  1TAE A;  2PBZ A;  3I4N G;  4XTC S;  1X9N A;  3URY A;  5BWW A;  1C30 A;  4AH6 A;  4L6T B;  4X3K A;  4NZM A;  3WNZ A;  5KYL A;  2F4V Q;  4JI8 Q;  1ROD A;  1TWH B;  2F3I A;  4X3U A;  1KDA A;  2K4K A;  2YYZ A;  3I56 A;  4DV4 L;  4A3B B;  4BBS G;  1GHJ A;  4A3E H;  1KJ8 A;  3I12 A;  3FKI B;  4MTK A;  5HGQ A;  2R7M A;  1IBK Q;  4C3J H;  1JCK B;  2KCC A;  5COY A;  5K3W A;  3GP7 A;  1ILQ A;  3IAY A;  4ZOL F;  3OMC A;  1WYD A;  2KEN A;  4XQN A;  3PIO 3;  1XMO Q;  4POG A;  1IYD A;  2C00 A;  3AW8 A;  4C1N K;  3NUA A;  3BG5 A;  2CZG A;  1KDB A;  1IW7 C;  2JYO A;  2R92 B;  2YZL A;  2R84 A;  2WB1 E;  3WOE A;  2EJF C;  4HNU A;  1XDN A;  4X6A H;  4K0K Q;  3MWE A;  5CV5 A;  3PUX A;  3D8G A;  4C1N I;  1EWC A;  3K3P A;  4KKS A;  3DEO A;  3S16 H;  3ERO A;  4N8F A;  1QNU A;  2TMP A;  3D4R A;  1B9N A;  4CDD C;  4ZUJ A;  3HOU B;  3R2T A;  1SCU B;  5E3F A;  1CK1 A;  4AYB B;  4KJN A;  2D62 A;  4K5V A;  4UAI A;  2K01 A;  2FXQ A;  2K05 A;  2Z1C A;  3IFT A;  3TQY A;  3VYR A;  1VQ7 A;  2EJ0 A;  2PI2 A;  3V4Z A;  2RF4 A;  4F88 A;  5C0X G;  3L7Z C;  4RZQ A;  1SDF A;  3JRW A;  2EXD A;  1DV1 A;  2LXJ A;  5EBC A;  3FP9 A;  4X62 L;  4BWG B;  1GSA A;  2HUG A;  2Z8L A;  3ZYY X;  5I6W A;  5JVH 3;  5C3X A;  2YW2 A;  3VR5 A;  1VCI A;  3S1R B;  4UDU C;  3JRX A;  1JWU D;  5H1S E;  4A93 H;  3GDE A;  5FLX L;  4QUF A;  1UWV A;  1Q3L A;  4DV0 Q;  1E24 A;  5HNE A;  2YZM A;  4M0J A;  5C4Z A;  1RDP D;  1FNU A;  4GZY C;  1HTP A;  1WR2 A;  2F1M A;  5JJI A;  2NU9 B;  5JPN C;  2W71 A;  4ZKC B;  2N78 A;  2E74 C;  4MV7 A;  2V4D A;  1TWA H;  2RSO A;  1IYE A;  1LTS D;  1K0S A;  2YWV A;  2OXP A;  4LFA L;  2ICI A;  5J22 A;  3M4O B;  5IYD H;  2CNV A;  3Q23 A;  3K7U C;  4TUY F;  1DAA A;  3FRP B;  4FF2 A;  3AFP A;  5C3E B;  2AUJ D;  1EIY B;  3RN5 A;  4ZK9 B;  1JOK A;  1TWC B;  2R93 B;  3CMA A;  5IYC H;  2JA8 H;  3U50 C;  3W1G A;  2UU9 L;  2AQ1 B;  4HNT A;  1ENA A;  2A74 C;  2D2C C;  2QK4 A;  5CA1 F;  3CRL C;  1JMC A;  2EYF A;  4DRF A;  1DYQ A;  4GN5 A;  3T1H Q;  3I2Z A;  5CR5 A;  3DTG A;  2MJ8 A;  2RCF A;  4GOP A;  1VQB A;  5LA6 F;  5H80 A;  2LMC B;  4ILW A;  3FVQ A;  1GKH A;  1QJO A;  2Q7D A;  2KED A;  1DON A;  3UE1 A;  1W6J A;  1FVI A;  1A15 A;  4RAU C;  4B3S Q;  1QNK A;  1I7N A;  1QVC A;  3A74 A;  4ME5 A;  1KAB A;  4R4O A;  3TRZ A;  4XX0 B;  3BVZ A;  2VQE L;  4C3I H;  2VQF L;  4GKK Q;  1AN8 A;  1UEA B;  4DAP A;  1BCP C;  4HJ8 A;  4B3R L;  3R3O A;  4MIU A;  2UXD L;  5IWA L;  1CS0 A;  2F3V A;  1J5E Q;  3BU2 A;  3D4W A;  5IOC A;  4A3J H;  1AUX A;  1HFN A;  4AIM A;  1X6O A;  2BDO A;  5KS8 A;  1FNV A;  5FKA C;  4JI4 Q;  3BDC A;  4YJ3 F;  5EKK A;  2N8N A;  1H95 A;  4LF4 L;  5DMX A;  4EQO A;  1IYV A;  2YRX A;  3Q8D A;  1KAA A;  1PFB A;  3D31 A;  1A6X A;  3CCL A;  1ZXT A;  4XQJ A;  3RZD H;  5LL6 S;  4J15 A;  3GTL B;  4CJ1 B;  3BA9 A;  1ESR A;  2QF7 A;  1PH8 A;  3GTG B;  3LWE A;  1BBW A;  4OX9 Q;  1A3T A;  2KHJ A;  2ATW A;  2N88 A;  5GAE C;  4A3D B;  3TIN A;  3HG9 A;  4BBR H;  3GTM B;  2L15 A;  2FP4 B;  5I5T A;  2G9D A;  4FE2 A;  5K36 H;  1XNQ L;  3I4O A;  2R7Z H;  3MXG A;  1EFI D;  1TWG H;  4ZUI A;  5G3L F;  3M85 A;  5KX5 F;  3ITP A;  1EKV A;  1STN A;  4G4K A;  2QEJ C;  4XIG S;  4MV3 A;  1EKF A;  1BNZ A;  1D7Q A;  3DM3 A;  4N9T A;  2WV6 D;  5CC4 A;  3ERQ A;  1XMQ L;  1X55 A;  2RHS B;  2GPW A;  3T1Y Q;  3K5O A;  2VXW A;  1N36 L;  4ODG A;  5JEA J;  5E7N A;  3W5O A;  4KV6 A;  4WBN F;  4LK1 C;  1G2S A;  3SXH A;  3BVM A;  4HED A;  3WWV A;  1MSH A;  2KUM A;  3UDF A;  3OWE B;  4AQY L;  3I73 A;  2CFM A;  3HOU G;  3EQL C;  1IYU A;  2NVX H;  3SE0 A;  1DCZ A;  2MGS A;  1EYG A;  4AYB G;  1S5C D;  2L5T A;  3R5F A;  1CT1 D;  3X3M A;  5D14 A;  4YBZ B;  5IGC A;  3OOC A;  1IOV A;  2N3S A;  1D1I A;  1L1O A;  1Y8N B;  3F2C A;  2D9U A;  2FJ2 A;  2JA6 G;  1BNC A;  3MEH A;  1BF4 A;  2G5D A;  1SLJ A;  3IRB A;  5FJ8 H;  4X64 Q;  2YU9 H;  4BXX H;  2NVT B;  1PH1 A;  4IUV A;  3NWT A;  3OW7 A;  5M3F G;  2XVS A;  3I4N H;  1JOO A;  3LWB A;  2R82 A;  2R85 A;  2ZTD A;  4X62 Q;  3OSO A;  4DV1 L;  3TBI B;  2IT1 A;  3PUY A;  2ZTC A;  2A5H A;  1Y1W B;  5JJL A;  3FDT A;  4LF6 Q;  2E5L Q;  4HN2 A;  3FMC A;  4BBS H;  3RUZ A;  4DR5 L;  3QOL A;  2R7L A;  3ULJ A;  3T9C A;  3RZO B;  5M5Y H;  2B8G A;  3OW2 A;  2UUB L;  2YV5 A;  1VQ6 A;  4OO1 G;  4UFZ A;  3HOZ H;  3TQT A;  1RTN A;  3HOY B;  1Q86 C;  2K28 A;  5BPH A;  1PXU A;  4DK1 A;  5E25 A;  1TY0 A;  4V0B A;  2NN6 G;  2L4N A;  5LL6 X;  3VR3 A;  1IYJ B;  4DK6 C;  2YL2 A;  4LFA Q;  2COJ A;  3SEB A;  3VOT A;  4LJZ C;  3J81 c;  1AZQ A;  1N32 Q;  2VNU D;  5EQ0 A;  4HJ9 A;  3MC0 B;  3WWI A;  2O4X A;  2Q2H A;  3MHB A;  2F0G A;  1JDE A;  1I6V C;  1NUC A;  1X56 A;  2A8V A;  3P1H A;  1GGO A;  2EPB A;  4IUT A;  4O4L F;  2GN5 A;  3HEJ A;  1DD2 A;  3NQI A;  4UCV A;  1LT6 D;  2LKV A;  2UU9 Q;  1GUO A;  1I4P A;  5BWT A;  3BYY B;  5C0X H;  1X3E A;  2F0F A;  2QDB A;  1GUT A;  2EYO A;  3PMF A;  1W96 A;  2YZN A;  3ERS X;  2ZM6 Q;  3GTK B;  1OTC A;  2JA5 B;  2DZD A;  2R7N A;  3TSS A;  2ODT X;  3JAM L;  5KNC A;  1SMY C;  1B7Y B;  5C44 B;  3KF6 A;  1OBG A;  4FFN A;  1SRU A;  3T9A A;  1ICF B;  1PMR A;  3KLR A;  2OTL A;  3ETH A;  3JAM i;  5JOB A;  1R9T B;  4A3M B;  2ES2 A;  4EQN A;  1EYC A;  5IGD A;  5IP9 G;  1K8A C;  3C1F A;  4I4T F;  3R9R A;  4NMZ A;  3H0G B;  2XCL A;  2EYP A;  2QA4 A;  2IX3 A;  5JJZ A;  2R61 A;  4Q4D A;  1DV2 A;  1Z2N X;  4CGY B;  3DM1 A;  2VQE Q;  3NBY B;  4HIK A;  1IZ6 A;  2DY8 A;  2VQF Q;  3HOV B;  1G2T A;  2DLN A;  4B3R Q;  2K14 A;  1JE4 A;  3VYU A;  3PGZ A;  3K59 A;  3GO5 A;  5IWA Q;  2J0T D;  4G7O C;  5BR8 Q;  1NY4 A;  4ZQ3 A;  3JSL A;  5BWR A;  3OHX C;  1WCM G;  4QUC A;  3OUU A;  3LNN A;  1EZ1 A;  2GPS A;  1K8G A;  4NXM L;  3OIP A;  5ELE A;  1E7Z A;  1B6S A;  1I6H B;  3TY5 A;  1ET9 A;  4KD3 A;  4LF4 Q;  4U68 A;  4EFB A;  2MNA A;  4CC5 A;  3HRZ C;  5M3M B;  3CCE A;  3PSI A;  2AQ2 B;  2V1C C;  4XT1 B;  3R5X A;  3DMU A;  5J2U F;  1XTD A;  1WTH A;  3K80 C;  2B2U C;  3GQB A;  2K7V A;  1V43 A;  2B2W C;  5KRU A;  1ENF A;  4R8N A;  3EN2 A;  3T7A A;  3Q22 A;  1I4Q A;  2B2Y C;  5KYI A;  4JI3 Q;  4LF7 L;  3MVV A;  4O7L A;  2L12 A;  1QCB D;  1WTW A;  4O2A F;  1OXS C;  1KRT A;  1MHW C;  3J81 E;  3CAM A;  1CQI B;  1Q1B A;  4Y7N B;  2W6O A;  3S9W A;  2ZJQ A;  3T9B A;  5C1O A;  1R4Q B;  3H3V I;  4XT3 B;  4ZCK A;  1CZW A;  5JAV A;  1XMQ Q;  4QQB X;  5I60 A;  3J80 i;  1GLV A;  2F0K A;  2F0O A;  4TM5 A;  2R86 A;  2HCI A;  3MEF A;  1N36 Q;  1VDZ A;  5EKL A;  2RA4 A;  3L2P A;  4KHV A;  1VS0 A;  2EIY A;  1WTQ A;  1UEB A;  2Z9H A;  1KXL A;  5CV6 A;  4XYO A;  4AQY Q;  4FXD A;  1D8L A;  4L5S A;  2J4X A;  1TY2 A;  1O7Y A;  1X54 A;  4KTA A;  3RLF A;  3K58 A;  1BBX C;  3TY8 A;  4IPC A;  4ZHQ F;  4ULL A;  1QZH A;  1A3U A;  2HVS A;  4BY1 G;  4HTH A;  1EY0 A;  5IE8 A;  3IL8 A;  4PZ6 A;  1TS4 A;  3E3X A;  4MN3 A;  4K0K L;  1ASY A;  2H1E A;  3S1M H;  4WRD A;  2PZU A;  2PVP A;  1VQA A;  4OO1 I;  2E2I H;  2ZXP A;  4F87 A;  3QB3 A;  4A3C G;  5FLM G;  1EY7 A;  5KEE A;  1PLF A;  1UC8 A;  4IO9 A;  1X3F A;  2A19 A;  3IKJ A;  1S4Z A;  1SXT A;  1QWY A;  3FEW X;  2IJ0 A;  3KBX A;  2W6N A;  4EGJ A;  3E9H A;  4IUU A;  1ZYR C;  4DV1 Q;  2FPP B;  3S15 B;  1LM0 A;  2CKZ B;  4KY7 A;  3I4M B;  4KY5 A;  3EFX D;  3BDO A;  4RG1 A;  2PYK A;  2HDM A;  5IP7 G;  3TME A;  4GKJ L;  3DEP A;  1PH5 A;  1CUK A;  1EYD A;  4HSV A;  5E4X A;  3TP6 A;  2VW9 A;  4DR5 Q;  3PFF A;  3K8A A;  2MFI A;  2I46 A;  1N8R C;  2UUB Q;  1HNZ L;  2EYM A;  2R3Z A;  4RFB A;  2HVR A;  3PUW A;  4DV0 L;  3CD6 A;  5JH7 F;  1L0W A;  1O7I A;  2HQL A;  4K2L A;  1PYS B;  1FNW A;  1VMP A;  5JVL A;  4KN4 C;  4QSH A;  3NHH A;  4QGU A;  1NAP A;  3MXN B;  4H02 A;  2HJW A;  1SRO A;  1V1O A;  2VUM G;  3BZC A;  3H3V H;  3ULP A;  1SE8 A;  3TDQ A;  5J39 A;  2E2J H;  3CXC A;  4UCO A;  3E5S A;  5J3B A;  3HKZ E;  2JA6 H;  2D0P A;  2KQ3 A;  3K0Y A;  1KTA A;  1VBG A;  3L9A X;  2EDG A;  4CDE C;  1LTL A;  2JSO A;  1O7L A;  2NYZ D;  1YHQ A;  5FPR A;  3K7A H;  3SR1 A;  4DA2 A;  2ZGI A;  4OXP A;  3D0F A;  2WB1 B;  5JQW A;  4KHZ A;  2P5Z X;  2I07 B;  5M3F H;  5LP6 F;  3E5N A;  3TII A;  1EZ8 A;  1MGS A;  3Q2O A;  4JPB W;  4IOA A;  2A6H C;  1WRV A;  2XWJ B;  2B8F A;  4A3I H;  4OIJ A;  2A69 D;  1LT4 D;  4NDX A;  4DNT B;  1JT8 A;  2MO0 A;  3NSW A;  2HHF B;  4DU9 A;  3BAA A;  4HJ5 A;  2K5D A;  3KF8 B;  1VF7 A;  3T1H L;  1MJE A;  3ORR A;  2H5X A;  1EOV A;  3K0X A;  5HV6 A;  1F2Y A;  2PMZ E;  2RBM A;  1EEI D;  3ND8 A;  4DAY B;  3MXP A;  3PIP 3;  2HVQ A;  4CDF C;  5G3L D;  1KHI A;  2IHF A;  5C4J B;  1UE1 A;  4OO1 H;  1HA6 A;  3SGI A;  1KJJ A;  3RNU A;  4B3S L;  3S17 H;  1CKO A;  2FFK B;  2B2Y A;  1X3G A;  2XWB B;  1CA6 A;  1XPO A;  4FF4 A;  4FGR A;  4YJ2 F;  2NUA B;  4A3K G;  1CE8 A;  3OPO A;  3H3V C;  5JQG F;  3UQ8 A;  2EJ3 A;  2MPM A;  4IWY A;  2VL6 A;  2K33 A;  1TS3 A;  1RJT A;  3GTO H;  3BG3 A;  3TEH B;  3ER0 A;  1TWC H;  2F0L A;  5DNF A;  4IFD G;  4O84 A;  4NXM Q;  1VKZ A;  2J9G A;  3U9T A;  3EBE A;  1X3Q A;  3O13 A;  2B63 B;  1J5E L;  4H0L C;  4RGN A;  2E2H H;  5A35 A;  1F9R A;  2QEX A;  4PZ7 A;  1M4V A;  3Q6S A;  4GOP C;  3TS0 A;  3SE7 A;  1YHB A;  3NBH B;  3RN2 A;  1CI3 M;  3GTJ H;  2EJ2 A;  3M4Y A;  2ABJ A;  2RDF A;  4XDX A;  1LAB A;  3KF8 A;  4GNX B;  1B50 A;  1AE3 A;  5IGF A;  2JQO A;  4QL5 A;  4PMW A;  3LGJ A;  1LAC A;  2NZO A;  3H91 A;  3AU7 A;  5D8D A;  1FGB D;  2J7Z A;  4P73 A;  1A9X A;  1BDO A;  1LV9 A;  5IP9 H;  3TP8 A;  5LXT F;  5HGT A;  3C1E A;  2D5D A;  3S2D H;  2O2L D;  1PTO F;  4GN3 B;  1EL0 A;  2ZJP A;  4IAL A;  3T1Y L;  5BWV A;  1GUG A;  2SNM A;  1I50 H;  3A5U A;  4TV9 F;  3QJY A;  2HT1 A;  3TY9 A;  4IUN A;  1WCM H;  1CHP D;  2NVY H;  4RGO S;  3F8T A;  1B70 B;  1EY9 A;  4L1K A;  4JG2 A;  1UNS A;  2RQX A;  2Y0S E;  4C3H B;  1EQT A;  2JK8 A;  3GTG H;  5C1P A;  4BY7 G;  2K5Q A;  3PO2 G;  1CKM A;  3UZB A;  4DR1 Q;  4L5Q A;  3T56 B;  4TQU S;  2WAQ B;  1SND A;  2EY6 A;  4M1U B;  4EGQ A;  1STH A;  3KLW A;  1HQR D;  1Q8K A;  1X32 A;  4X3S A;  5FNV F;  1ULZ A;  3K5I A;  5KND A;  2V5A A;  1PTO B;  4FXK C;  2MQH A;  1E4E B;  2NVQ H;  3PUZ A;  2Q8T A;  1V8Q A;  1EOT A;  2OWO A;  2K5W A;  3VDY A;  4M9U A;  5GON F;  3MXU A;  4X64 L;  3L3O C;  4HCS A;  5C3W A;  4LUV A;  1QUQ B;  4F7X A;  1DM0 B;  3PO3 B;  3U58 A;  2Z0S A;  1F2Z A;  2JJQ A;  1EY8 A;  2JA9 A;  4FVM A;  4DF7 A;  1XPR A;  1XYI A;  4O86 A;  4GKJ Q;  1YNN C;  2QGQ A;  3CQZ H;  1DOM A;  4K14 A;  1K28 A;  1VQO A;  1X3P A;  3KAL A;  1IL8 A;  1NNX A;  4Y52 H;  3W1B A;  5GRO A;  1FYC A;  3A8I E;  5I2X A;  5M5X H;  1K0R A;  4LF6 L;  3JAM c;  1HNZ Q;  2E5L L;  2PN1 A;  1CM9 A;  3GTP H;  5I5X A;  4A3F B;  2OF1 A;  3Q0A A;  5I9P A;  4Q5V A;  1SYG A;  5M9O A;  4LAA A;  3QFF A;  1JLL B;  1Z2P X;  1EQQ A;  4C5A A;  5BN3 A;  2EZV A;  2F03 A;  1L1O C;  4H44 C;  1EZ6 A;  4BS9 A;  1CTM A;  1I2K A;  3LQS A;  1WD1 A;  2JE6 I;  5C0X J;  1GUS A;  1BVS A;  5A2Q L;  1P8L A;  5ELF A;  1K73 C;  4BY1 H;  4DV7 L;  1EEF D;  1B2T A;  4Q0F A;  1Q8I A;  4R4I A;  4YWK A;  5I5Y A;  1E4E A;  1SNQ A;  2E2D C;  3GTQ B;  3A54 A;  2B2T C;  1OXV A;  1N32 L;  2WB1 G;  2VS1 A;  1KBL A;  2OTJ A;  3C46 A;  3DWA A;  4A3C H;  5BYA A;  5FLM H;  2C35 B;  4FO2 A;  1FJG L;  4LFB L;  1BKB A;  2KCT A;  3I7F A;  4OHJ A;  3LP8 A;  5T1G A;  3HOW B;  1Y69 U;  5ELC A;  5DLQ E;  2R6G A;  3RD4 A;  3HOX G;  4IFD I;  2ZT9 C;  2ZM6 L;  5IP7 H;  2N49 A;  1M0T A;  3I8Z A;  1LTB D;  1TII D;  1TWF B;  2PZW A;  4GS3 A;  2CNQ A;  1A2T A;  1U4M A;  3PV0 A;  3MFY A;  1QG7 A;  5C4X B;  3EIV A;  1PA6 A;  3K6O A;  1EFW A;  4C2M B;  1SFO H;  1ESF A;  3QOJ A;  3NWS A;  2I8C A;  3J80 c;  2A68 D;  3KJP A;  3KRE A;  3NK9 A;  1GHK A;  4HIO A;  4O83 A;  1PFM A;  1XXG A;  3MWY W;  4JK1 C;  4PQX A;  1OXT A;  1EU3 A;  1VQJ A;  2WAQ E;  2VUM H;  3J7A 5;  5BR8 L;  2UXC L;  2YS7 A;  3MFG A;  1HH2 P;  3MAQ A;  4OWT B;  1A62 A;  4LH6 A;  4RGM A;  1C48 A;  3N6R A;  1KJI A;  1B44 D;  1JB3 A;  2V58 A;  4L63 B;  1T5X D;  1VQN A;  3BA8 A;  3JAM E;  4NP5 A;  3PN1 A;  3PIO A;  1EHI A;  2EJM A;  5CB4 F;  4RCN A;  1NSN S;  3CKI B;  3GLK A;  1XTC D;  3MZ5 A;  1Q81 C;  1C0A A;  1SYB A;  2RDG A;  3CCU A;  1BOS A;  2CHB D;  2HIV A;  1XNR Q;  4JI3 L;  2RHQ B;  1L0X B;  3U9O A;  4A3E B;  3MWD A;  3A8K E;  4MV1 A;  1L2F A;  2KEE A;  1YNJ D;  2B2V A;  5AFW A;  2XSC A;  3CF5 A;  4K8I A;  1EYZ A;  2I80 A;  4A3L G;  4O7T A;  4C3J B;  3STB D;  4LFC Q;  4A3G B;  3T4A C;  1Y1V B;  4A3B G;  1H9M A;  1PH2 A;  4B3T L;  4UP7 A;  5D1O B;  3FKI G;  1RHP A;  4IIJ F;  3I90 A;  4A3K H;  3VR4 A;  1SR3 A;  3S1N H;  4N9P A;  2F0D A;  2Z02 A;  3T9E A;  1D6E C;  2MHV A;  2F0M A;  3VR2 A;  1Q82 C;  5CBE E;  4UPA A;  4DV5 L;  3R5H A;  3HB9 A;  3S16 B;  1QZG A;  1E2V A;  4QMG A;  4IFD H;  4JCV E;  2R92 G;  1K8M A;  1ONL A;  3A55 A;  2M00 A;  2ZTE A;  5C0X I;  4LF5 Q;  1G29 1;  2IPK D;  3U54 A;  3T13 A;  2PQA B;  3A56 A;  3K57 A;  2I5M X;  3OIQ A;  1H9S B;  2NZ1 D;  2BE5 D;  3NTK A;  4KKU A;  4YCU A;  2FMC A;  3PCO B;  1G2W A;  1SNC A;  1DXM A;  2F4I A;  2OQ0 A;  4YWL A;  5IIF A;  3UYY A;  1Q7Y C;  1J8I A;  4MZ9 A;  1PVO A;  1GJX A;  4TRD A;  4YIJ A;  2M2L A;  1AUV A;  2OCE A;  1F9P A;  4Y7N H;  3J80 E;  5LMN W;  2CW0 D;  2PPB C;  1G6P A;  4CBV A;  2ZDQ A;  1BCP F;  2FIN B;  1JDB B;  1PYB A;  4DLK A;  4CMF A;  4OON A;  1OXU A;  2NZH A;  5LMN Q;  2JN4 A;  1MKH A;  2R87 A;  4A93 B;  4L8J A;  2HDK A;  4NB3 A;  2B2T A;  2PNH A;  3VA7 A;  1HR0 W;  4R9W A;  1LUZ A;  1UUP A;  2EVB A;  4DR3 Q;  5EPJ A;  3NEN A;  1LTG D;  1F9Q A;  1VMC A;  1CQF A;  4A3F G;  3M3Y H;  5EGT A;  5NUC A;  1LTA D;  3TW6 A;  1D5Z C;  1EIF A;  3KDF B;  1TWA B;  1HUN A;  5C4H A;  3K5L A;  2SDF A;  4CKE A;  2BCO A;  3HP3 A;  4EGV A;  3E6Z X;  3CPW A;  1Z9F A;  1BUV T;  4YWM A;  1IBL L;  2EE1 A;  2XTI A;  3N52 A;  4CHT B;  1GUW A;  3N8D A;  3T54 A;  1P16 A;  1AP0 A;  2XN9 C;  1M90 C;  4YB8 B;  3NEL A;  4DV7 Q;  4OL7 A;  4U67 3;  4BY7 H;  3PO2 H;  4X3T A;  1EY6 A;  4IOC A;  2JA8 B;  5I5U A;  1JE5 A;  3NBI A;  3W2D A;  5C3E G;  1NMF A;  3M7G A;  2SEB D;  4Z9C B;  2ENB A;  2R93 G;  1PK8 A;  4RHR A;  5GAH C;  1PZJ D;  1DIK A;  4JV5 Q;  1Z2O X;  2F0V A;  1S68 A;  3WO0 A;  1CKN B;  1S3O A;  4DUZ Q;  1TKW B;  3HT5 A;  1M8A A;  2VQD A;  1FJG Q;  3S15 H;  4LFB Q;  5FO7 B;  1I3Q H;  2XRQ D;  3AMU A;  1AH9 A;  3DUZ A;  3ETJ A;  4DUY L;  1A0I A;  2VB2 X;  2K75 A;  3I72 A;  3NQT A;  4RCO A;  5IGB A;  1NTG A;  5C4X G;  2YRW A;  1SN8 A;  1Y14 B;  4JI5 Q;  2AWN A;  3V05 A;  4JBM A;  4O7S A;  2Z04 A;  4NYE A;  2K32 A;  1O7Z A;  1TVX A;  3VA5 A;  4C3I B;  3S14 H;  4WJ4 A;  1IL2 A;  1KNE A;  1K3B C;  1GD7 A;  1HFG A;  5M5W H;  1KAW A;  3E0E A;  1SEB D;  1RKN A;  1AW7 A;  2CQA A;  4IJL A;  4OEL B;  3TW7 A;  1VQ4 A;  1YIT A;  3AX6 A;  1J6Q A;  4A3J B;  1JQY D;  1V9P A;  5E1F A;  4X65 L;  1PTO D;  2F0H A;  4O7Y A;  2A6E D;  2PQE A;  4V19 0;  2Q8R E;  2NBF A;  4PBC A;  5JJK A;  3FHW A;  4EVO A;  2FHT A;  2F0S A;  3OUZ A;  3U9S A;  3HS0 C;  2WKC A;  2A73 B;  3G8C A;  4IWX A;  3OWF A;  1Z47 A;  3RZD B;  1VQM A;  2UXC Q;  3NC0 B;  3AYH B;  3MA2 B;  1STY A;  1E2Z A;  2QKI C;  4LH7 A;  1VQD A;  3BDL A;  4RWS C;  3VPD A;  1B53 A;  1X65 A;  4IQZ A;  5CMD A;  4YCV A;  1UAP A;  1CZG A;  5D3D A;  4BBR B;  2COI A;  2AQ3 B;  2BH8 A;  4KLK A;  4MAM A;  4DAA A;  4NKL A;  2R7D A;  4I7Z C;  5ELB A;  2X0S A;  2BDN A;  4HMJ A;  4FU0 A;  3TP7 A;  2R7Z B;  3D6W A;  1I7L A;  4G7Z C;  1TWG B;  4A3D G;  3KAJ A;  3CCR A;  1KLG D;  1B9M A;  4A3E G;  3HOX H;  1PFN A;  5L37 A;  2K03 A;  4DV2 L;  3ICE A;  4C3J G;  3HKZ B;  1J9O A;  3RV3 A;  3JZI A;  1II3 A;  4A3G G;  3T53 B;  1Y1V G;  2W6Q A;  3KJO A;  1YNJ C;  1E1T A;  1GOZ A;  1OO9 B;  2L1B A;  5HY6 A;  4B9W A;  3BJU A;  3WWJ A;  4DIM A;  5CV7 A;  3TZD A;  4O2D A;  1CQJ B;  4IN3 A;  2F0I A;  4B3T Q;  5LMU Q;  1ENC A;  5IYZ F;  3DWQ A;  2EQS A;  1HZ9 A;  4J1M A;  4Q4C A;  2NVX B;  4YAK B;  1GSO A;  1LT5 D;  2PMZ B;  4ZAI A;  4DV5 Q;  1NR2 A;  3DLL A;  5EAY A;  3CME A;  3J81 j;  2HQE A;  2EJG C;  3QG1 A;  4JI1 L;  1PX2 A;  1XPU A;  1K83 H;  1A0G A;  2RSN A;  5FLX c;  4EQP A;  5DM7 3;  4I7A A;  4QIW E;  3NUC A;  4KHP L;  5KNB A;  5CR3 A;  4A75 A;  1FD7 D;  1EU4 A;  2JXM B;  3G48 A;  1VBH A;  4DR2 L;  1VQ5 A;  4DGZ A;  3I4N B;  4FFO A;  4DR1 L;  1C9O A;  2Y4R A;  3PF4 A;  1G91 A;  3S1Q H;  2KHS A;  1N33 Q;  4O7V A;  1HHV A;  3G6J B;  1WD0 A;  1AE2 A;  4HAE A;  4BBS B;  2HDL A;  2NN6 I;  4CKC A;  4A3L H;  4K8J A;  1Y1W G;  1TWH H;  2K1B A;  5M5Y B;  1W6K A;  3SK6 A;  3HOZ B;  4A3B H;  1T5E A;  1IW7 D;  4M8A A;  4UHV A;  4G57 A;  3GD7 A;  4LF9 L;  3VR6 A;  3FKI H;  3RMH A;  1PZK D;  3CCQ A;  2SOB A;  3CSW A;  3I4L A;  1I1M A;  1I4R A;  3D3R A;  3HFZ B;  5I47 A;  4KD4 A;  1LTT D;  3UI2 A;  1VQ8 A;  2LSS A;  3HOY G;  4S3S A;  2X6L A;  4J6H A;  4DV3 Q;  1MIU A;  4GNX C;  2XNA C;  3QIA A;  1S5E D;  3JZF A;  2DGY A;  3UDG A;  2Q8I B;  1IBL Q;  2R92 H;  4JOI C;  3EJI A;  1QB5 D;  2PW7 A;  3LWU A;  4FFP A;  4LF8 Q;  1ILP A;  2FMM A;  3HOU H;  5GAD C;  1V1P B;  4UP9 A;  2AUK A;  1HNW L;  1QOH A;  3FPU B;  4O4I F;  1L0Y B;  4UP8 A;  4YHH Q;  4HTO A;  1BR9 A;  1LO5 D;  1RCV D;  1WJJ A;  1NR4 A;  1YI2 A;  4HR7 B;  3KUP A;  4IPD A;  1IHZ A;  3P75 A;  4O2B F;  4C5C A;  2B39 A;  2Y0S B;  1EQR A;  1HZA A;  2JA5 G;  4JI2 L;  4DUY Q;  4JI0 L;  3AB9 A;  4MV6 A;  2L55 A;  1PRT F;  2H4O A;  4G7H C;  1CQV A;  1SE2 A;  5C44 G;  2IX0 A;  3CCV A;  3S1R H;  3D4D A;  5ELD A;  3UZO A;  2X6G A;  1XK5 A;  3OMG A;  5FLX E;  1U5K A;  1F77 A;  4A3M G;  3ND9 A;  2JA7 B;  5COR A;  1KRS A;  2JEB I;  3GV6 A;  1E3P A;  3R2I A;  3RV4 A;  2EYJ A;  1D2B A;  4IZO A;  3H0G G;  5EZY F;  4ZYS A;  3NXW A;  2VPQ A;  5CM0 A;  2EIF A;  1KNA A;  4TSS A;  4ZLT F;  3HOV G;  1VQH A;  3PUV A;  4EG0 A;  1TS5 A;  2CVR A;  1NCV A;  2CWP A;  4X65 Q;  4K6N A;  1PHJ A;  2MUY A;  1CA5 A;  5DIS C;  3MXN A;  1BQQ T;  4L5T A;  3M4O H;  2LY7 A;  1JKJ B;  2NN6 H;  3UE0 A;  1UE7 A;  1PRT B;  3MTS A;  5C3E H;  4CC6 A;  1QIL A;  1PDQ A;  2KHI A;  4LW1 A;  5DAA A;  1VQI A;  3Q24 A;  2VR1 A;  1T9H A;  2R93 H;  5KKN B;  3DWP A;  4K2K A;  5M3M G;  3H09 A;  5IYB G;  2UUC L;  2BA1 A;  1BXT A;  3B6Y A;  2PCF B;  5D65 A;  3K81 C;  2DNC A;  4DK3 C;  1VQL A;  2F0N A;  2KCM A;  2RVL A;  4MV4 A;  1EUC B;  4O7R A;  2HGX A;  4MV9 A;  1I5F A;  5EPL A;  3MJF A;  3G71 A;  4O81 A;  3T9F A;  3DF7 A;  2HHF A;  3T99 A;  2UUA Q;  1MI2 A;  5CE8 A;  2F3W A;  1DGS A;  4DV2 Q;  2P0A A;  3CHB D;  3LUL A;  4I50 F;  4H7B A;  4QB4 A;  1TR5 A;  4O7Z A;  1BCP D;  1A3G A;  4DAY A;  5CA0 F;  4UCT A;  1K8O A;  2F0E A;  4IFD J;  4DV6 L;  1SNO A;  1JR0 D;  1XNR L;  5LOV F;  1Q1E A;  3AFQ A;  2DJG C;  5EPK A;  4R1J A;  1I1K A;  2QDL A;  3SHL A;  4DPG A;  4QCL A;  2K04 A;  1I4G A;  3KLS X;  3F2D A;  4LFC L;  1H9K A;  3EA6 A;  2K6A A;  1YVC A;  4NZO A;  1A48 A;  3SVM A;  3VYT A;  2W70 A;  3QR8 A;  3K5N A;  3X3N A;  1Z7T A;  1JJC B;  3OYY A;  4CKB A;  3WOF A;  2F0W A;  1A2U A;  5I4D A;  4JI1 Q;  1K3R A;  3S1M B;  4DR4 L;  5FR9 A;  1HNX L;  2VB3 X;  2K50 A;  1HA5 A;  1S5B D;  5AJ3 L;  1XWE A;  2E2I B;  3HKS A;  2C9O A;  3U4Z A;  1PZI D;  4RHS A;  4KHP Q;  5DGH A;  1LLR D;  3U0G A;  3NBH A;  5I9O A;  1G8Z D;  3JC6 6;  1EY4 A;  4LF5 L;  3GTL H;  5JVD F;  4DR2 Q;  4KK7 A;  3RLN A;  4JYA Q;  4RA8 A;  4GNX A;  3NPP A;  3WO1 A;  4FFM A;  5I5V A;  3G4S A;  3QWU A;  2XGT A;  4JOI A;  1JIC A;  4A3D H;  3S2H B;  3EVQ A;  2VUG A;  3GTM H;  2B2V C;  4QY7 A;  3T51 B;  2UXB L;  2A1A A;  5CV4 A;  4X66 L;  2R7F A;  1GM5 A;  1STA A;  2ZXR A;  1RIP A;  1UE5 A;  1WTX A;  1JC7 A;  2DWC A;  2R7K A;  4C56 C;  4RMF A;  1RTO A;  3BZK A;  4A3G H;  4JI6 Q;  3A0J A;  3HOZ G;  2F0J A;  1Y1V H;  2Q2U A;  2IHE A;  4IJH A;  2BOS A;  5FO8 B;  1OXX K;  1ET6 A;  3K5H A;  1E22 A;  1VQC A;  2NUC A;  4LWC A;  3I4M G;  4EFE A;  2E75 C;  5I5W A;  4MV8 A;  5LMN L;  1KTK A;  2DUD A;  3DXJ C;  3H6M A;  4LF9 Q;  4HTP A;  3L0O A;  2QCP X;  5T1I A;  1HRJ A;  1I4X A;  3NTH A;  4IZ8 A;  4DR3 L;  1E2W A;  4PMC A;  3I70 A;  1HR0 L;  3M4P A;  4XYQ A;  4DK0 A;  2HIX A;  4POF A;  4L5R C;  5IT9 L;  2KBN A;  2W6P A;  1CFM A;  2V59 A;  5J2T F;  2L0C A;  2E2J B;  2XIW A;  2QB5 A;  3CP0 A;  2JA6 B;  2CH4 W;  2ID0 A;  3NE5 B;  2NTS A;  3GV3 A;  3PIP A;  4XXE A;  1IOW A;  1HTL D;  3K7A B;  3GJX B;  2OT2 A;  1SAP A;  4GLA C;  1HNW Q;  1KEE A;  1IBM Q;  5M3F B;  4JI7 Q;  1SYF A;  2M9V A;  4B9X A;  1GXD C;  2JP1 A;  2Y0S G;  1S40 A;  4OIK A;  1C8C A;  2NVT H;  4A3I B;  1C3O A;  1U0L A;  4GOP B;  2IW3 A;  3TIG A;  4JV5 L;  4HMI A;  1QUQ A;  4A4I A;  4DUZ L;  3KBG A;  1JB7 A;  1YZ6 A;  4JI2 Q;  3A7L A;  4JI0 Q;  4MA5 A;  4P71 A;  3R8B A;  1QVG A;  1B6R A;  2JA7 G;  4A76 A;  1A3V A;  1Y1W H;  2ZDG A;  2X69 A;  1WTV A;  2A69 C;  3PQI A;  1B8A A;  1A8V A;  1D5X C;  1YHA A;  3HZX A;  2IWH A;  3R23 A;  3S17 B;  1KC7 A;  3P7J A;  1PH7 A;  3OTO L;  4DFA A;  2CCZ A;  4DNI A;  3RZO H;  1D1K A;  4K6L A;  1YJ9 A;  4FNF A;  4JI5 L;  2XRS D;  2K52 A;  2OQK A;  3V2T A;  3HOY H;  1SSO A;  3U4V A;  4IUQ A;  3GTO B;  1SYD A;  4GLW A;  2AHO B;  5BN5 A;  4P2C B;  2Z4I A;  5EBD A;  2FB9 A;  2SCU B;  4YY3 Q;  3TP5 A;  4K5W A;  4FDB A;  1SYC A;  3NEM A;  4ZI7 F;  2F52 A;  1U4L A;  2NWG A;  2E2H B;  3RFC A;  1ICW A;  2DN8 A;  2PI2 E;  3CC7 A;  2B63 G;  3J7Y W;  3GTJ B;  5LHY 1;  2EYL A;  2DIK A;  1ZEQ X;  2LXK A;  1SMY D;  2Z4H A;  5C6A A;  1MJC A;  3KLS A;  2NU6 B;  2I0Q A;  1VQK A;  2UUC Q;  2I5L X;  1OBD A;  1ET0 A;  1HUM A;  4ABN A;  1KT8 A;  3GTK H;  2FPG B;  5HUR A;  2JA5 H;  3JSN A;  4R4Q A;  3VMM A;  1O78 A;  2F0Q A;  2L9H A;  5C44 H;  2F0U A;  4J8Q A;  1SBB B;  1R9T H;  4A3M H;  3S2D B;  2GQS A;  2W6M A;  5ELO A;  4HIM A;  4JBW A;  3ZJY C;  3GID A;  2YZG A;  1HZB A;  5FO9 B;  3M7N A;  4DV6 Q;  3H94 A;  3H0G H;  4ME6 A;  3RTX A;  2WKD A;  4O7W A;  4AYB E;  1SE4 A;  3RUP A;  3BS1 A;  1Y8O B;  1I50 B;  1VF5 C;  4DNR B;  3HOV H;  3DAA A;  5K2M A;  1QE6 A;  1WCM B;  1WOC A;  3CEB A;  4B3M L;  4YAJ B;  2NVY B;  2I87 A;  2HCC A;  1I4H A;  1SJH D;  5LMU L;  3G6E A;  2HHH Q;  1B3Q A;  4XZ3 B;  1Y8P B;  5EKI A;  1VQP A;  2A1H A;  4NXN L;  3RR5 A;  5CV8 A;  4FF3 A;  5JEA G;  4GLX A;  5C8Y F;  1I6H H;  2HGW A;  2GA4 B;  3BAB A;  1HZC A;  4DR4 Q;  1DOL A;  4C3H G;  1L1O B;  2QIL A;  4CJ2 C;  1HNX Q;  2Z6K C;  5AJ3 Q;  5M3M H;  2IY5 B;  5IYB H;  1EWI A;  2NVQ B;  2WAQ G;  1N9W A;  2B3G A;  4N8X 1;  1PH3 A;  2D0O A;  1G51 A;  3A7A B;  4WJ3 M;  2G9H D;  2YTY A;  2O5J C;  4DV4 Q;  3TN2 A;  4CHI A;  5CBA E;  2N55 A;  3KFU A;  4NW2 A;  2UXB Q;  4X66 Q;  2RCN A;  1S72 A;  4K5X A;  3SK5 A;  3GB8 B;  4DAM A;  1EYA A;  1E1O A;  3CQZ B;  2PO4 A;  2CH4 A;  5ISR A;  4IHJ F;  3PO3 G;  2CNU A;  3T16 A;  3AEV A;  5C5L A;  1N33 L;  4FXG C;  1XX8 A;  5M5X B;  4E6I A;  1PRT D;  5FOB B;  3KK7 A;  5D1O A;  3GTP B;  1MD2 D;  2MP1 A;  5IOD A;  3PF5 A;  2DAB A;  1U9R A;  2ICE C;  1VQF A;  3ORQ A;  3SDZ A;  4WFN 3;  4MA0 A;  1PYW D;  1I94 L;  1HR0 Q;  4I55 F;  1JJG A;  4BY1 B;  3R93 A;  1CSP A;  1WFQ A;  1W93 A;  1F2L A;  2VY3 A;  3VYS A;  2IP4 A;  4KKT A;  4BA2 I;  4DV3 L;  3IFD A;  2PQA A;  2LFN A;  5E4W C;  1H9S A;  4R4C A;  1JOR A;  2YTX A;  4DR6 L;  1IXR A;  1BCP B;  1KLU D;  1U4R A;  4A3I G;  1M6V A;  4IUR A;  1XJV A;  2F0T A;  1IKL A;  5CYU A;  1C7Y A;  1ZYR D;  1PH6 A;  4F8M A;  2RKS A;  1Z6H A;  2HD3 A;  3C2P A;  4LF8 L;  1EY5 A;  4DR7 L;  2ZDH A;  2DNE A;  3VNN A;  1LYL A;  3M9B A;  2BA0 A;  1EWH A;  4MNO A;  5I5S A;  5BYB A;  2GVA A;  1GSH A;  2CWA A;  4YHH L;  1ML0 D;  3HOW G;  3V4S A;  3KF6 B;  3F2B A;  4QIW B;  4FYD A;  3QO2 A;  4WHX A;  4IPH A;  2ZXO A;  5FK9 C;  1HCZ A;  1TS2 A;  3NP8 A;  4GLV B;  3I4M H;  2MO1 A;  5I2Y A;  3KOJ A;  2EOT A;  2NU7 B;  2OLS A;  5F2D A;  2W6Z A;  2KEC A;  1B4O A;  4JBK A;  3OTO Q;  2ASB A;  3CCM A;  3KDF A;  1SFO B;  3CC4 A;  4RKL A;  2Z6B A;  4KY6 A;  3S24 A;  3TRE A;  4APV A;  1GVP A;  3QWN A;  2HG8 A;  4HID A;  2VUM B;  5I6Y A;  3DHQ A;  2HGS A;  4DQN A;  4LUZ A;  2A68 C;  3CU7 A;  3T9D A;  4OEM B;  4O42 A;  1NBW A;  2GVB A;  4MHE A;  2AMC B;  2A6H D;  1PH9 A;  2AKW B;  3V96 A;  2E76 C;  4HSP A;  1CKN A;  2Q2I A;  3W3A A;  4CJ0 B;  5DEH A;  4FFL A;  3AQQ A;  1KQS A;  5DGI A;  4ZRZ A;  4P72 A;  3CW2 C;  1AZP A;  5D1P A;  1B3A A;  1FGU A;  1HPC A;  1WVL A;  1PH4 A;  1M1K C;  1NE3 A;  1S5D D;  5KIX A;  3VPC A;  1F2M A;  4O4H F;  1H9R A;  1H9J A;  4P74 A;  3TS2 A;  5TSS A;  1JWM D;  3K5M A;  2DJF C;  5D3I B;  3UDI A;  2JA7 H;  1VQ9 A;  4ZQI A;  2Z6K A;  5LYJ F;  3TZU A;  3I91 A;  4GN4 B;  4R8I A;  5BPF A;  4UUG A;  4KI0 A;  1VQG A;  5J1Z A;  2UUA L;  1SYE A;  2UXD Q;  4KN7 C;  4JBJ A;  1N34 L;  4A3K B;  3S1N B;  2GLT A;  2NTT A;  5C4J H;  4PZ8 A;  3BVG A;  3TEK A;  1I2L A;  1Q12 A;  4HQ6 A;  4QJF A;  4P75 A;  1JWS D;  3STB C;  4DXG A;  1ASZ A;  2CQO A;  1KDC A;  3CPF A;  1SNP A;  3FPP A;  4B3M Q;  5EJW A;  4UCU A;  2YTV A;  4ZKB B;  4RGT A;  5BWU A;  2K5N A;  3LX0 A;  3J7A V;  3A5Z B;  1WTR A;  4NXN Q;  2PW5 A;  1EIG A;  3C3L A;  1F9S A;  2AWO A;  4PV1 C;  5CAE B;  1SJE D;  2YS6 A;  2YYA A;  1GO3 E;  2B63 H;  1LTI D;  1RF2 D;  2KCN A;  3CCJ A;  3BZD B;  1XNQ Q;  5FPO A;  4UY8 C;  5IT9 c;  4TV8 F;  4O1N A;  4TVI A;  2WIN B;  1AEX A;  3J80 L;  4XYL B;  2YU9 B;  2BE5 C;  4HJ7 A;  3WWH A;  2SNS A;  4DAV A;  1S5F D;  4IUP A;  4OWX B;  4EQ5 A;  2EY2 A;  5CGK A;  4JYA L;  2EY1 A;  3ONA B;  2F4V L;  2IL8 A;  2B29 A;  4CDC C;  4DXF A;  2F0P A;  4JI8 L;  1B1Z A;  2C5C A;  4RKB A;  1BO0 A;  1RD9 D;  3CC2 A;  3QQM A;  5JPM C;  5JVG 3;  2CW0 C;  2I5H A;  4A93 G;  3G8D A;  3M3Y B;  1Q90 A;  2WII B;  3HBL A;  1CSQ A;  2NB0 A;  4WOR A;  1IBK L;  1TXY A;  3JZ6 A;  1PRT C;  4FP5 D;  4JI6 L;  1EUJ A;  3VPB A;  1GUN A;  2K5V A;  1HXY D;  3E0J A;  3CRK C;  3I55 A;  1XMO L;  1PV4 A;  2WYO A;  3Q1K A;  2K5H A;  4TVA B;  4B08 A;  4FFR A;  4JVZ A;  1O80 A;  3U55 A;  4XYM B;  1I94 Q;  1SMX A;  1FR3 A;  3KAK A;  4H13 C;  1SNM A;  1HQM C;  4EEQ A;  5CV9 A;  2PNR C;  5IYD G;  5ELN A;  4BY7 B;  4JC0 A;  3F1Z A;  3PO2 B;  2WAC A;  5JEA H;  1TQO A;  2DAA A;  4LUO A;  3H15 A;  1YNX A;  4C3H H;  2EYH A;  1BXR A;  4MTN A;  2Q2T A;  5IYC G;  1WTP A;  4JW0 A;  2FPI B;  2JA8 G;  4DR6 Q;  4NZN A;  3S2H H;  4HCE A;  4E6N A;  4E4T A;  2XD4 A;  4FF1 A;  1MSG A;  1V1Q A;  1DJR D;  1CHQ D;  3A8J E;  1I3Q B;  2PZT A;  4DR7 Q;  1PTO H;  3NBZ B;  3ULL A;  3E9I A;  3SNO A;  4OWW B;  1YNN D;  1WTO A;  3HO8 A;  1IBM L;  4JI7 L;  4DKA C;  1STB A;  1IKM A;  3HGB A;  1G6Z A;  3PO3 H;  4YCW A;  2ZJR A;  2IX1 A;  4RH6 A;  3CCS A;  2RDH A;  5DM6 3;  3F2U A;  3S14 B;  5IGG A;  4XQQ A;  5KGU A;  1PFS A;  2COG A;  4O82 A;  3SK4 A;  1W3S A;  5M5W B;  1DOK A;  4PNY A;  3M4Q A;  1STE A;  1HJP A;  5IT9 E;  4LMQ D;  1B04 A;  4C3I G;  1YBY A;  1UE6 A;  1KJ9 A;  4OGQ C;  4I65 A;  2DY7 A;  2WP8 J;  4A3F H;  3UDX A;  1AFP A;  4R4T A;  2KA7 A;  5K5P A;  4KMU C;  5BN4 A;  2TSS A;  2BH2 A;  2JEA I;  4O7N A;  4A3J G;  1KUT A;  3UFX B;  1VQE A;  3RLO A;  4UCR A;  5A2Q E;  2LS0 1;  1EUD B;  5GAG C;  4C5B A;  4CE5 A;  3NTI A;  4ALP A;  1EKP A;  1PTO C;  4HNV A;  2A6E C;  2EXZ A;  3SK8 A;  2NU8 B;  4YY3 L;  1NJI C;  1V1P A;  1KC8 C;  3GTQ H;  4HN7 A;  1Q46 A;  4LNQ A;  4PMB A;  2KJX A;  2GQR A;  1DZ1 A;  1YEZ A;  1ZKO A;  2WFW A;  2O5I C;  1I1L A;  3P20 A;  1TA8 A;  4HR7 A;  4NPS A;  1KIX A;  4Y8V B;  4BBR G;  2B2U A;  1NMG A;  4DN4 M;  1SE3 A;  4EX5 A;  3HOX B;  5K36 G;  4JXU A;  1FL0 A;  3BYT B;  4HJA A;  3BAC A;  3HOW H;  4ID6 A;  2B2W A;  2R7Z G;  1LT3 D;  1KD1 C;  4PG3 A;  3D6C A;  3J7Z C;  1STG A;  1LTR D;  3G7L A;  4IPG A;  1BBU A;  1RL2 A;  2KOL A;  1QVF A;  5C5M A;  3DTF A;  5BMV F;  1KJQ A;  2E8G A;  3HKZ G;  1T36 A;  1W2B A;  5HBR B;  4BA1 I;  3J81 L;  1EIH A;  2QW7 A;  4KJO A;  1TWF H;  1A63 A;  1E0B A;  2OEO A; 
#chains in the Genus database with same CATH homology
 3M3Y H;  4ME3 A;  1KL9 A;  3MEF A;  1N36 Q;  1N34 Q;  4GKK L;  2CCZ A;  4DNI A;  3RZO H;  5C4X H;  1EIF A;  3L2P A;  3KDF B;  3J81 i;  1VS0 A;  1YJ9 A;  1YJW A;  1K9M C;  4JI5 L;  2K52 A;  2OQK A;  1UEB A;  3HOY H;  3U4V A;  4C2M H;  1KXL A;  2ALY B;  2AHO B;  5IY0 A;  4AQY Q;  4UCS A;  3CPW A;  1Z9F A;  1D8L A;  4YWM A;  1YIJ A;  1IBL L;  1JJ2 A;  4L5S A;  2XTI A;  4YY3 Q;  1X54 A;  1P16 A;  3RLF A;  3TY8 A;  4IPC A;  1YJN A;  1M90 C;  4JI4 L;  1QZH A;  4FDB A;  3KYH C;  2VZA A;  3NEL A;  4BY1 G;  4DV7 Q;  2HVS A;  4BY7 H;  5IE8 A;  3PO2 H;  3NEM A;  1WI5 A;  2F52 A;  4PZ6 A;  4IOC A;  1JE5 A;  2PI2 E;  5C3E G;  1NMF A;  3CC7 A;  4K0K L;  1ASY A;  2HHH L;  2B63 G;  3S1M H;  4LF7 Q;  2R93 G;  1VQA A;  5GAH C;  4OO1 I;  2E2I H;  4OX9 L;  2LXK A;  5FJ8 G;  4JV5 Q;  4BXX G;  1S68 A;  1MJC A;  1CKN B;  1S3O A;  4DUZ Q;  4O0A A;  5FLM G;  5GQO A;  2I0Q A;  4A3C G;  1VQK A;  4IO9 A;  1X3F A;  2UUC Q;  2I5L X;  2A19 A;  1FJG Q;  3S15 H;  4LFB Q;  1TAE A;  3I4N G;  1I3Q H;  4XTC S;  1X9N A;  1AH9 A;  3GTK H;  4AH6 A;  2JA5 H;  3JSN A;  4DUY L;  1A0I A;  4R4Q A;  3E9H A;  4DV1 Q;  1LM0 A;  2CKZ B;  2F4V Q;  5C44 H;  2K75 A;  4JI8 Q;  4RG1 A;  2F3I A;  1NTG A;  5C4X G;  5IP7 G;  4GKJ L;  1SN8 A;  2K4K A;  2YYZ A;  1Y14 B;  3I56 A;  4DV4 L;  2AWN A;  1R9T H;  1CUK A;  1PH5 A;  2VW9 A;  4A3E H;  4A3M H;  4JI5 Q;  4DR5 Q;  4BBS G;  4JBM A;  3K8A A;  5HGQ A;  2MFI A;  1IBK Q;  3S14 H;  4C3J H;  5ELO A;  4HIM A;  4JBW A;  3ZJY C;  1N8R C;  2UUB Q;  1HZB A;  1HNZ L;  1IL2 A;  3M7N A;  4DV6 Q;  3H0G H;  3RTX A;  2HVR A;  1GD7 A;  1WYD A;  1KAW A;  3E0E A;  2KEN A;  3PUW A;  4AYB E;  5M5W H;  4DV0 L;  1XMO Q;  3CD6 A;  4IJL A;  4POG A;  1L0W A;  1O7I A;  1VQ4 A;  1YIT A;  2HQL A;  3HOV H;  1J6Q A;  1PYS B;  1WOC A;  4B3M L;  1V9P A;  4X65 L;  2WB1 E;  4QGU A;  5LMU L;  1XDN A;  4X6A H;  4K0K Q;  3G6E A;  3PUX A;  2HHH Q;  5JJK A;  3S16 H;  3MXN B;  3FHW A;  1VQP A;  4H02 A;  4NXN L;  3RR5 A;  1SRO A;  5JEA G;  4GLX A;  2VUM G;  3BZC A;  3H3V H;  3ULP A;  1SE8 A;  1Z47 A;  1I6H H;  3BAB A;  1VQM A;  2E2J H;  2UXC Q;  3NC0 B;  1HZC A;  3CXC A;  4DR4 Q;  3AYH B;  5J3B A;  3HKZ E;  4UCO A;  1HNX Q;  1L1O B;  2D0P A;  2JA6 H;  1VQD A;  4LH7 A;  2Z6K C;  5AJ3 Q;  2D62 A;  5M3M H;  2IY5 B;  5IYB H;  1X65 A;  1EWI A;  2FXQ A;  1LTL A;  3TQY A;  1VQ7 A;  1YHQ A;  4YCV A;  3K7A H;  2PI2 A;  2WAQ G;  5FPR A;  4OXP A;  1N9W A;  2B3G A;  2BH8 A;  2RF4 A;  3D0F A;  4KHZ A;  4KLK A;  5C0X G;  3L7Z C;  2R7D A;  5M3F H;  2D0O A;  1PH3 A;  1G51 A;  2EXD A;  4WJ3 M;  4IOA A;  2LXJ A;  2YTY A;  4A3I H;  4A3D G;  3FP9 A;  4X62 L;  4DV4 Q;  3CCR A;  1JT8 A;  4A3E G;  3HOX H;  3KFU A;  2UXB Q;  2MO0 A;  4X66 Q;  2RCN A;  1S72 A;  4DV2 L;  3BAA A;  4HJ5 A;  3GB8 B;  3ICE A;  3KF8 B;  4DAM A;  3T1H L;  1VCI A;  1MJE A;  2H5X A;  1E1O A;  1EOV A;  3K0X A;  4A3G G;  1Y1V G;  2PMZ E;  5H1S E;  3KJO A;  4A93 H;  3GDE A;  1E1T A;  3PO3 G;  1UWV A;  4DV0 Q;  1E24 A;  3AEV A;  4DAY B;  1N33 L;  2HVQ A;  5HY6 A;  1KHI A;  3BJU A;  2IHF A;  1UE1 A;  4O2D A;  3SGI A;  5D1O A;  3RNU A;  4B3S L;  3S17 H;  1CKO A;  4B3T Q;  5JJI A;  1X3G A;  5LMU Q;  3PF5 A;  1XPO A;  4A3K G;  2N78 A;  1VQF A;  3UQ8 A;  1TWA H;  1I94 L;  2EQS A;  1HZ9 A;  2VL6 A;  1HR0 Q;  4LFA L;  3GTO H;  4DV5 Q;  3TEH B;  5IYD H;  1JJG A;  3ER0 A;  1TWC H;  3DLL A;  5EAY A;  3K7U C;  1CSP A;  1WFQ A;  3CME A;  3J81 j;  4NXM Q;  2VY3 A;  4IFD G;  3AFP A;  3EBE A;  4BA2 I;  4JI1 L;  4DV3 L;  1XPU A;  1J5E L;  1K83 H;  1EIY B;  2PQA A;  3RN5 A;  5FLX c;  4QIW E;  3CMA A;  5IYC H;  4KHP L;  4R4C A;  2E2H H;  2YTX A;  2JA8 H;  1IXR A;  3U50 C;  4DR6 L;  3W1G A;  2QEX A;  4A75 A;  4PZ7 A;  4GOP C;  3TS0 A;  4A3I G;  2UU9 L;  3G48 A;  1YHB A;  3NBH B;  4DR2 L;  1XJV A;  1VQ5 A;  3RN2 A;  3GTJ H;  1C7Y A;  1JMC A;  1PH6 A;  4GNX B;  4DRF A;  4GN5 A;  4DR1 L;  4LF8 L;  4DR7 L;  1C9O A;  3I2Z A;  3T1H Q;  1AE3 A;  3VNN A;  1LYL A;  2JQO A;  3M9B A;  4GOP A;  1VQB A;  4QL5 A;  4PMW A;  3PF4 A;  2BA0 A;  3LGJ A;  3S1Q H;  4MNO A;  2GVA A;  1N33 Q;  2NZO A;  2CWA A;  4YHH L;  3HOW G;  1GKH A;  3KF6 B;  3F2B A;  1AE2 A;  3UE1 A;  1FVI A;  4IPH A;  4P73 A;  2NN6 I;  4B3S Q;  4GLV B;  3I4M H;  5IP9 H;  4A3L H;  1Y1W G;  2MO1 A;  1QVC A;  1TWH H;  3A74 A;  3KOJ A;  4A3B H;  4R4O A;  3TRZ A;  3S2D H;  4JBK A;  4LF9 L;  3GD7 A;  3OTO Q;  2ASB A;  3FKI H;  3CCQ A;  2VQE L;  4GN3 B;  3CCM A;  3KDF A;  4C3I H;  2VQF L;  2ZJP A;  4GKK Q;  4HJ8 A;  3CC4 A;  4B3R L;  3HFZ B;  3T1Y L;  1VQ8 A;  2LSS A;  3HOY G;  2UXD L;  5IWA L;  1I50 H;  3A5U A;  4DV3 Q;  1MIU A;  3S24 A;  3TRE A;  3BU2 A;  4GNX C;  1J5E Q;  2HT1 A;  3TY9 A;  2DGY A;  1WCM H;  3UDG A;  4A3J H;  2NVY H;  1GVP A;  3F8T A;  4APV A;  1B70 B;  4AIM A;  1IBL Q;  1X6O A;  4JOI C;  4HID A;  2R92 H;  4JG2 A;  4JI4 Q;  2N8N A;  4LUZ A;  1H95 A;  2Y0S E;  4LF4 L;  2JK8 A;  3GTG H;  4BY7 G;  3Q8D A;  3PO2 G;  3D31 A;  1CKM A;  4DR1 Q;  1NBW A;  4L5Q A;  2GVB A;  4LF8 Q;  3CCL A;  3HOU H;  4TQU S;  5GAD C;  3RZD H;  4J15 A;  2AMC B;  1PH9 A;  2AKW B;  4UP9 A;  1HNW L;  3BA9 A;  1PH8 A;  1BBW A;  4OX9 Q;  3KLW A;  1CKN A;  2Q2I A;  1Q8K A;  4UP8 A;  2KHJ A;  3AQQ A;  4HTO A;  4YHH Q;  1KQS A;  1WJJ A;  2ATW A;  4P72 A;  5GAE C;  2MQH A;  3CW2 C;  1YI2 A;  2NVQ H;  3PUZ A;  4BBR H;  4IPD A;  5D1P A;  2L15 A;  1FGU A;  2OWO A;  1XNQ L;  3VDY A;  3I4O A;  1PH4 A;  1M1K C;  1NE3 A;  4X64 L;  1EQR A;  1HZA A;  4LUV A;  2R7Z H;  4WJ4 A;  1TWG H;  1QUQ B;  2JA5 G;  4DUY Q;  4JI2 L;  4JI0 L;  3M85 A;  4P74 A;  3TS2 A;  3U58 A;  2Z0S A;  4XIG S;  2JA7 H;  3UDI A;  2JJQ A;  5C44 G;  2IX0 A;  2Z6K A;  3DM3 A;  2JA9 A;  3CCV A;  1VQ9 A;  1D7Q A;  1XMQ L;  4GN4 B;  3S1R H;  1X55 A;  1XPR A;  4GKJ Q;  2QGQ A;  2RHS B;  3CQZ H;  1VQG A;  4KI0 A;  1XK5 A;  1U5K A;  2UUA L;  4A3M G;  1VQO A;  3T1Y Q;  2UXD Q;  1KRS A;  3W1B A;  2JEB I;  4JBJ A;  5GRO A;  1N34 L;  1E3P A;  1N36 L;  4Y52 H;  5JEA J;  5M5X H;  1K0R A;  3W5O A;  5E7N A;  4PZ8 A;  3JAM c;  5C4J H;  1HNZ Q;  2E5L L;  1Q12 A;  3H0G G;  4LF6 L;  4QJF A;  3GTP H;  3WWV A;  4P75 A;  3UDF A;  3STB C;  2EIF A;  1ASZ A;  2CQO A;  3HOV G;  4AQY L;  1VQH A;  3PUV A;  3CPF A;  4B3M Q;  2CFM A;  4UCU A;  2YTV A;  2CWP A;  4X65 Q;  1EQQ A;  1PHJ A;  5DIS C;  1L1O C;  3HOU G;  2NVX H;  2JE6 I;  5C0X J;  2K5N A;  1BVS A;  4L5T A;  3M4O H;  1P8L A;  1EYG A;  1K73 C;  3A5Z B;  3UE0 A;  4AYB G;  4DV7 L;  4BY1 H;  4NXN Q;  4R4I A;  4YWK A;  2AWO A;  1UE7 A;  5C3E H;  2N3S A;  4CC6 A;  2KHI A;  4LW1 A;  1L1O A;  1GO3 E;  3F2C A;  1VQI A;  2B63 H;  1OXV A;  1T9H A;  1N32 L;  2R93 H;  2WB1 G;  3CCJ A;  2JA6 G;  2VS1 A;  2OTJ A;  1XNQ Q;  5M3M G;  5FPO A;  4UY8 C;  5IYB G;  1SLJ A;  3IRB A;  5FJ8 H;  4X64 Q;  5IT9 c;  2YU9 H;  4BXX H;  1PH1 A;  4A3C H;  5FLM H;  2UUC L;  2BA1 A;  3B6Y A;  2C35 B;  1FJG L;  4LFB L;  1BKB A;  3K81 C;  2KCT A;  3I7F A;  4DK3 C;  5M3F G;  1VQL A;  3I4N H;  2KCM A;  4HJ7 A;  1I5F A;  2ZTD A;  4X62 Q;  4OWX B;  4EQ5 A;  3G71 A;  4DV1 L;  4JYA L;  2UUA Q;  5DLQ E;  2R6G A;  3HOX G;  2F4V L;  1DGS A;  2IT1 A;  2B29 A;  3PUY A;  2ZTC A;  4JI8 L;  4DV2 Q;  4IFD I;  5JJL A;  2ZM6 L;  5IP7 H;  4LF6 Q;  2N49 A;  2E5L Q;  3CC2 A;  4BBS H;  2I5H A;  4A93 G;  4DR5 L;  4GS3 A;  4UCT A;  3ULJ A;  1CSQ A;  1IBK L;  1TXY A;  3PV0 A;  5M5Y H;  2UUB L;  3OW2 A;  4IFD J;  3EIV A;  2YV5 A;  1VQ6 A;  4DV6 L;  1EUJ A;  1PA6 A;  4JI6 L;  1XNR L;  3HOZ H;  4OO1 G;  4UFZ A;  2K5V A;  1Q1E A;  3AFQ A;  3I55 A;  1XMO L;  1Q86 C;  1PV4 A;  4R1J A;  1EFW A;  4DPG A;  2K5H A;  1SFO H;  4TVA B;  3F2D A;  2NN6 G;  3J80 c;  4LFC L;  3KJP A;  1YVC A;  1IYJ B;  1I94 Q;  4DK6 C;  4HIO A;  1SMX A;  4LFA Q;  4EEQ A;  5IYD G;  3J81 c;  1N32 Q;  2VNU D;  5ELN A;  4HJ9 A;  1OXT A;  4JC0 A;  1VQJ A;  2Q2H A;  2WAQ E;  3F1Z A;  2VUM H;  1JJC B;  3OYY A;  3J7A 5;  4LUO A;  4JI1 Q;  1K3R A;  5BR8 L;  3H15 A;  4DR4 L;  2UXC L;  1YNX A;  1X56 A;  4C3H H;  1HH2 P;  2K50 A;  1HNX L;  2A8V A;  5AJ3 L;  4OWT B;  4MTN A;  1A62 A;  2GN5 A;  2Q2T A;  3HKS A;  3U4Z A;  5IYC G;  4KHP Q;  4LH6 A;  2JA8 G;  4DR6 Q;  4UCV A;  3JC6 6;  3S2H H;  4LF5 L;  2UU9 Q;  3GTL H;  1VQN A;  3BA8 A;  4DR2 Q;  3RLN A;  4JYA Q;  4E6N A;  4GNX A;  1X3E A;  1V1Q A;  3PN1 A;  3PIO A;  3G4S A;  3ERS X;  3QWU A;  2XGT A;  2ZM6 Q;  4JOI A;  4A3F G;  4DR7 Q;  3NBZ B;  1OTC A;  3ULL A;  3E9I A;  4A3D H;  2VUG A;  4OWW B;  3GTM H;  4QY7 A;  1IBM L;  2UXB L;  2A1A A;  4JI7 L;  4X66 L;  2R7F A;  1B7Y B;  4DKA C;  1GM5 A;  1RIP A;  1UE5 A;  3KF6 A;  1Q81 C;  1C0A A;  3CCU A;  1SRU A;  4RMF A;  2HIV A;  3BZK A;  4A3G H;  4JI6 Q;  3A0J A;  2OTL A;  3HOZ G;  3JAM i;  1Y1V H;  1XNR Q;  2Q2U A;  4JI3 L;  2IHE A;  2RHQ B;  4IJH A;  4YCW A;  2ZJR A;  2ES2 A;  3PO3 H;  1L2F A;  1OXX K;  3CF5 A;  2IX1 A;  1E22 A;  1VQC A;  4LWC A;  3I4M G;  5IP9 G;  3CCS A;  4A3L G;  4EFE A;  1K8A C;  3STB D;  5LMN L;  4LFC Q;  1PFS A;  2DUD A;  4A3B G;  2QA4 A;  1W3S A;  1PH2 A;  4B3T L;  3M4Q A;  4UP7 A;  4LF9 Q;  5D1O B;  4HTP A;  1HJP A;  3FKI G;  2VQE Q;  3L0O A;  3NBY B;  4HIK A;  1IZ6 A;  4A3K H;  2VQF Q;  1B04 A;  1SR3 A;  1UE6 A;  1YBY A;  3S1N H;  4DR3 L;  4B3R Q;  2K14 A;  1HR0 L;  3PGZ A;  2WP8 J;  3M4P A;  4A3F H;  3UDX A;  1Q82 C;  3GO5 A;  4R4T A;  5IWA Q;  5BR8 Q;  2HIX A;  4UPA A;  4POF A;  1NY4 A;  4DV5 L;  2KBN A;  4L5R C;  2BH2 A;  1QZG A;  2JEA I;  3JSL A;  1WCM G;  4A3J G;  4JCV E;  2R92 G;  1K8G A;  4NXM L;  1VQE A;  3RLO A;  5C0X I;  4UCR A;  2ZTE A;  1E7Z A;  3TY5 A;  4LF5 Q;  1G29 1;  3CP0 A;  5GAG C;  4LF4 Q;  4EFB A;  2MNA A;  4ALP A;  2ID0 A;  2PQA B;  4CC5 A;  3CCE A;  2I5M X;  2V1C C;  3PSI A;  4YY3 L;  1NJI C;  1XTD A;  1KC8 C;  3PIP A;  3GTQ H;  4YCU A;  3GJX B;  3K80 C;  1Q46 A;  4LNQ A;  4GLA C;  1HNW Q;  1V43 A;  3PCO B;  1IBM Q;  2OQ0 A;  4YWL A;  4JI7 Q;  1YEZ A;  2WFW A;  1Q7Y C;  1S40 A;  2NVT H;  2Y0S G;  1TA8 A;  4MZ9 A;  4NPS A;  1KIX A;  3EN2 A;  1PVO A;  2OCE A;  4Y7N H;  4BBR G;  4JI3 Q;  4LF7 L;  5LMN W;  1G6P A;  1NMG A;  1U0L A;  4EX5 A;  4GOP B;  5K36 G;  1FL0 A;  4HJA A;  1PYB A;  1OXS C;  3HOW H;  4OON A;  1OXU A;  2NZH A;  1QUQ A;  4JV5 L;  1KRT A;  4A4I A;  5LMN Q;  4DUZ L;  2R7Z G;  1KD1 C;  1JB7 A;  1MKH A;  1YZ6 A;  1Q1B A;  3CAM A;  4PG3 A;  4JI2 Q;  3J7Z C;  4JI0 Q;  4IPG A;  4NB3 A;  4P71 A;  2ZJQ A;  1QVG A;  2PNH A;  1BBU A;  1RL2 A;  2JA7 G;  1QVF A;  4A76 A;  1Y1W H;  1HR0 W;  1LUZ A;  3H3V I;  2E8G A;  3HKZ G;  4QQB X;  1XMQ Q;  4DR3 Q;  3J80 i;  1W2B A;  3NEN A;  1B8A A;  4BA1 I;  1A8V A;  1YHA A;  1TWF H;  1A63 A;  1PH7 A;  3OTO L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...