1P8LA

New crystal structure of chlorella virus dna ligase-adenylate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
296
structure length
276
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNFGYEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIRHEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the DNA Joining Repertoire of Chlorella Virus DNA ligase and a New Crystal Structure of the Ligase-Adenylate Intermediate
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase
molecule keywords PBCV-1 DNA ligase
total genus 64
structure length 276
sequence length 296
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1p8lA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1p8lA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1p8lA01
4IPGA 2EXDA 2OTJA 1EQQA 4OO1I 4LF6Q 4QQBX 4BA1I 3CCSA 5LMUQ 3M85A 4HJ5A 4X65Q 3S1MH 1EIYB 1CKNA 2E2IH 1W3SA 4EQ5A 1A62A 4R1JA 5C3EH 4R4IA 4YCVA 2EIFA 2MO1A 4KHPL 2NVXH 2K52A 1TWHH 5GADC 4QY7A 1X65A 4A3BG 3S15H 1E1TA 4IO9A 2ZJQA 4JYAL 2HIXA 2LXKA 2OCEA 2UUAL 1K83H 1N33Q 4JV5Q 5GAHC 4LF6L 4GN4B 2RCNA 1FJGL 1AH9A 3NC0B 1CUKA 2QEXA 5C44H 4DV5Q 4QGUA 1Y1VH 1XMQL 3RZOH 4JC0A 1PH6A 5M3FG 1K3RA 3M7NA 4IOCA 1YEZA 2IX1A 5FJ8G 4KHPQ 2N3SA 1FGUA 2ZTCA 3HOVG 3GTKH 1J5EL 1MJCA 4H02A 4R4OA 4R4QA 2Q2TA 1OXTA 1J5EQ 1BBUA 2HIVA 2N78A 4B3MQ 4HIKA 4QJFA 4KHZA 1A8VA 3TQYA 3CCRA 1UE7A 3OYYA 4OXPA 2CCZA 2YTYA 2UXBL 3BJUA 3U50C 4DK6C 1XNRL 1IBML 2UUBQ 4POGA 4LH6A 1JJ2A 4DAMA 2F3IA 3CCJA 2CFMA 4L5QA 4UPAA 4JI5Q 1HNWQ 3NBYB 5BR8Q 5C0XG 4OO1G 4AYBE 4A75A 3TRZA 3M4QA 1UEBA 3RZDH 1SFOH 1Q12A 2YTXA 1JJGA 1XNRQ 1VQCA 3H3VH 3CMEA 3TY9A 1PH1A 2JEAI 5C3EG 4JI0Q 3PUXA 1VQMA 4DUZQ 4JI5L 3UDXA 1HNWL 4LUZA 4JI1Q 3PO2H 3CCVA 4DUZL 1WI5A 1NJIC 3HOWG 4A3EG 3VDYA 2LXJA 5J3BA 5H1SE 3RLOA 4DV4Q 4DV2L 4LF4L 4X66L 1X3FA 1SE8A 1YVCA 1B8AA 4YWKA 1PHJA 4JOIC 4X6AH 2PI2A 1BBWA 3U4ZA 1GO3E 1XPRA 2JA8H 3S16H 3BZKA 4UP7A 3F2BA 2JA6H 3TY5A 1PH8A 4BY7G 4P75A 1A63A 4DR1L 4C2MH 1EFWA 2OQ0A 4BBSH 1SLJA 5IP7G 5BR8L 4A3FG 4LFCL 3F2CA 4Y7NH 4A3IH 2ALYB 3PO3H 2WAQG 2D0PA 1VQJA 3M9BA 4BBRH 4C3JH 1HNZQ 4A3LG 1QVFA 1GD7A 1BKBA 3ERSX 3F1ZA 1YHBA 5C4JH 2B63H 1SRUA 3MEFA 3CC7A 4DR1Q 1Q7YC 1VQDA 2OTLA 4UY8C 1OXSC 1N33L 3HOYG 4JV5L 2A1AA 4JI1L 1X9NA 1N36L 2K5VA 4AIMA 1XPUA 1V9PA 2KHJA 3S2DH 1CKMA 2R7ZG 4YCWA 2ES2A 2AWOA 3GDEA 3CCLA 1XMQQ 2PNHA 3HFZB 5D1OB 2QA4A 2UU9L 3TY8A 3J80i 3EN2A 5D1OA 1VS0A 3GJXB 4DV0Q 2XGTA 1EWIA 3U58A 3S14H 4B3RQ 3KJPA 1LTLA 4XTCS 4GLXA 3T1HL 2E8GA 3AFQA 1I6HH 4X65L 3HOWH 1JMCA 2Y0SG 4ME3A 2R92H 2MFIA 1C7YA 3PIOA 4DV0L 4P71A 2EQSA 2ATWA 3K0XA 3OW2A 1X56A 1KD1C 2WP8J 2JA5H 1XTDA 1OXXK 4A3KH 3BABA 2AHOB 1MIUA 4LNQA 1PH2A 2ASBA 4BBSG 2ZJRA 2UXBQ 3BAAA 2JK8A 2NN6G 4DV7Q 1QVGA 4A4IA 1TAEA 3EIVA 4HIMA 2BA1A 2I0QA 4B3SQ 3H0GG 2UXCL 2HVRA 3NBHB 4JI8L 3HOXG 1L1OC 4O0AA 4DR4L 4GS3A 2VNUD 1XMOL 4GN3B 1PYSB 1YJWA 4EFBA 1OXUA 3KF6A 3CPWA 1X3GA 1SR3A 3UDIA 3H3VI 2CKZB 3J7ZC 3BZCA 4JI3Q 1VQAA 4XIGS 2VQFQ 2UXCQ 4E6NA 1VQNA 2OQKA 4UCTA 3J7A5 1NTGA 2DUDA 4HJAA 3CPFA 1B70B 1VQOA 2PMZE 1JE5A 3CAMA 4P74A 2I5HA 3J81c 4HIDA 3GTOH 2UXDQ 4AQYQ 4B3TL 1PH5A 4NXNQ 2RHSB 2KCTA 5LMNW 4DK3C 5IYBG 2R93H 2B3GA 3OTOQ 3HKSA 3HOZG 1O7IA 3ULLA 2NZHA 2JEBI 4X64L 1GVPA 3TEHB 3G71A 3NELA 4BY7H 1K0RA 2K50A 3UDGA 3RLFA 4DV4L 2B29A 4LF4Q 5IY0A 2VUMH 3BA8A 1HNZL 1NE3A 2V1CC 4EFEA 1HNXL 2HHHL 4JG2A 3RNUA 4GOPA 4PZ7A 3RTXA 3L7ZC 4DV1Q 2K5HA 4BBRG 1M1KC 4A3LH 4JI0L 1TA8A 3UE1A 4WJ4A 4QL5A 3K8AA 4JI4Q 3U4VA 1YBYA 3HOXH 1UE6A 4DV6Q 4UCVA 3NBZB 1EUJA 2AKWB 1V43A 4POFA 5M3MH 3CQZH 3GTQH 4GKJL 2JE6I 4FDBA 2YU9H 1B7YB 4DV2Q 3CF5A 1K73C 4LFCQ 4NXNL 1EYGA 3ULJA 3K81C 3RN5A 1HH2P 1Y1VG 2UUCQ 3L2PA 5FPRA 1IBLQ 1AE3A 3OTOL 1VQGA 4MZ9A 3AEVA 4DV6L 3HOVH 2Y0SE 3PF4A 1MJEA 3RN2A 3J81j 5IYDG 5ELOA 1TWGH 2LSSA 3MXNB 1KAWA 3KLWA 1UWVA 1Z47A 1L2FA 4MNOA 5AJ3L 3LGJA 2VZAA 3STBC 5K36G 2KENA 1CKOA 4A3CG 4PMWA 1IXRA 2RHQB 2R93G 5JJLA 5DISC 4C3IH 2ID0A 1L0WA 2JA7G 4TQUS 3IRBA 2HVSA 1BVSA 2WFWA 1TWFH 1X3EA 1PH4A 1JB7A 4A93G 3TREA 1KHIA 4A3KG 2ZM6Q 4B3SL 3SGIA 4LH7A 4L5SA 2JQOA 1YJNA 4DKAC 3KFUA 1G291 3A5ZB 4DV3L 3HOUH 3J81i 5EAYA 1RIPA 4HIOA 4AYBG 3S1QH 3DLLA 1A0IA 2A8VA 2K14A 1YNXA 1Q81C 2BA0A 3PN1A 1XNQQ 4B3RL 3CP0A 1WCMG 4CC5A 4OWWB 3I4MH 2ZM6L 1XNQL 3VNNA 4DV7L 3T1YL 2VW9A 1KXLA 5C0XJ 4P73A 1NY4A 1AE2A 5AJ3Q 3KJOA 1S40A 1VQIA 1FL0A 3G6EA 5M3FH 5JEAG 3T1YQ 4R4TA 4LF9Q 4UCSA 1KL9A 4QIWE 3STBD 2E5LQ 1XMOQ 1GKHA 2JA6G 4J15A 1WJJA 2E5LL 5FPOA 3I7FA 5GAEC 4AQYL 2YYZA 2AWNA 1Q1EA 3E9IA 5JEAJ 2PI2E 2E2HH 4B3TQ 4HJ7A 4IFDG 1NBWA 1S72A 3JSLA 1R9TH 3ER0A 2K4KA 3PO3G 2WB1E 4EX5A 2D62A 5M5WH 4IFDJ 1HR0Q 3CC4A 3S24A 4BY1H 3S17H 3GO5A 4JI4L 3G4SA 1NMFA 2D0OA 1W2BA 3CC2A 1T9HA 3PSIA 3I2ZA 4DR6L 3L0OA 4PZ8A 1VQKA 2HT1A 3QWUA 1HNXQ 2HHHQ 4A3DG 1U0LA 2I5LX 4GOPB 4JI3L 2OWOA 1P8LA 2ZJPA 3WWVA 2F52A 2PQAB 3JAMc 1V1QA 1IBLL 2AMCB 5IYCG 1N32L 4JBMA 1Y1WG 3RR5A 3H15A 2H5XA 3A0JA 1S68A 5M3MG 1KRTA 1RL2A 2NVYH 2IX0A 4NXMQ 1SROA 2NZOA 4LFAL 1E7ZA 1N9WA 3KOJA 5GROA 4P72A 3PUYA 3CXCA 4IFDI 4LFAQ 4DV1L 3RLNA 1EIFA 3JC66 1C0AA 3F2DA 2Z0SA 2JA8G 5C44G 1N34L 4X64Q 1XJVA 1G6PA 2L15A 4DR7L 1N36Q 2JA5G 1JJCB 3UDFA 5M5XH 3ULPA 3W5OA 1YITA 1JT8A 1E3PA 3KYHC 5IP7H 3EBEA 1M90C 4DR6Q 4A3IG 3UE0A 1XPOA 5LMNQ 1I3QH 3FHWA 4LW1A 4YY3Q 1UE5A 1VQPA 4UFZA 2MNAA 3H0GH 4YWLA 5C0XI 4DUYQ 3K80C 3KF6B 2WAQE 4A76A 3TS2A 5ELNA 4BY1G 1VQ4A 3T1HQ 2JA7H 4HJ9A 1IBKL 2R7ZH 4A93H 1L1OA 1I94Q 1SN8A 1YZ6A 4A3DH 1L1OB 5DLQE 4RMFA 1I94L 4LWCA 2JJQA 1CSPA 4A3MH 4DR3Q 4AH6A 1VQ8A 3JSNA 4JI6Q 3AQQA 5JJKA 1VQ7A 5IWAQ 4X62L 3TS0A 1OXVA 1LUZA 1VQFA 4A3BH 2IY5B 3PUVA 3JAMi 4HJ8A 3BU2A 3CCEA 1YHAA 4WJ3M 5GAGC 5LMNL 1C9OA 2IT1A 4JI8Q 4LF5L 4A3EH 4BXXG 4DR3L 1K8AC 2KCMA 4NB3A 4CC6A 3FP9A 3UQ8A 1Q46A 3D0FA 3I56A 1QUQA 4IJLA 2YV5A 1HZCA 3D31A 2VQFL 4DRFA 1VQHA 4UP9A 1PH3A 1HR0L 4LFBL 1S3OA 2C35B 2VY3A 3E9HA 1EQRA 3PV0A 4DV3Q 3FKIH 1WOCA 2GVAA 5FLMG 4GNXB 2Q2UA 2F4VQ 1QZHA 3NENA 4A3FH 2MO0A 1PYBA 2F4VL 4DR5L 4OX9Q 3CCQA 4X66Q 1PH9A 1ASYA 4UCOA 4C3HH 4KI0A 4GOPC 4GKKL 2BH8A 4LF7Q 3GTMH 4KLKA 2B63G 5IWAL 5HGQA 3HOYH 3I4NG 4A3GG 3E0EA 1UE1A 2QGQA 4ALPA 4GLVB 4LF5Q 2ZTEA 1YI2A 1Q1BA 4L5TA 1N8RC 2GN5A 1HR0W 4YHHQ 1E24A 1VCIA 2R7DA 4DNIA 1LM0A 1PFSA 3M4OH 1KQSA 2NVTH 2BH2A 1KIXA 3I4NH 3GTJH 2DGYA 3PF5A 1QZGA 4LUVA 3PO2G 1MKHA 4JOIA 1X6OA 1HZ9A 1N34Q 1X55A 2YTVA 4Y52H 3G48A 4DAYB 3BA9A 4BXXH 1D7QA 4DPGA 3ZJYC 1H95A 2VL6A 5C4XH 2CWAA 3KDFB 3KF8B 3PUWA 4IPHA 2UU9Q 4R4CA 5IE8A 4EEQA 2GVBA 1IBKQ 1D8LA 4LF7L 4LF8Q 2VUMG 4JYAQ 4LUOA 3DM3A 4L5RC 3A74A 3HOUG 1FJGQ 4B3ML 2VS1A 3NEMA 1EOVA 2KHIA 4GNXA 1FVIA 1CSQA 3GD7A 1PH7A 1N32Q 2WB1G 2A19A 1VQLA 1WFQA 1Q8KA 1LYLA 1X54A 4DV5L 3PUZA 1VQBA 1J6QA 5LMUL 2K5NA 4IPDA 1HJPA 2I5MX 1B04A 3I4MG 2NVQH 3B6YA 5GQOA 1QVCA 3PIPA 1OTCA 4IJHA 3CMAA 4UCUA 1IZ6A 4K0KQ 4YY3L 4A3JG 2MQHA 4UCRA 2N8NA 4OWTB 4A3GH 3Q8DA 2CQOA 3AYHB 2IHEA 4JBJA 1GM5A 2HVQA 4A3MG 3I4OA 1U5KA 4X62Q 4BA2I 4DR7Q 3K7AH 5IYDH 2N49A 1TWAH 4IPCA 1TXYA 1E22A 1TWCH 2R7FA 3HKZG 4DR4Q 3PGZA 1I5FA 2VQEQ 1XDNA 1Q86C 3GB8B 1IYJB 4DUYL 3J80c 5FLXc 3HKZE 2R92G 1HZAA 1YHQA 3HOZH 4PZ6A 4GKKQ 5IP9G 4LFBQ 4OWXB 2E2JH 1YJ9A 1CKNB 1Z9FA 4UP8A 2Q2HA 4GNXC 4LF9L 3GTPH 4TVAB 1IBMQ 1VQ9A 2UUBL 5IT9c 4APVA 4JBKA 3I55A 3AFPA 1I50H 3FKIG 5FLMH 5IYCH 3M3YH 2IHFA 4JCVE 2UXDL 4YHHL 1Y1WH 4NPSA 4JI6L 2Z6KC 1G51A 2FXQA 2XTIA 1VQEA 1WCMH 5E7NA 4OONA 3K7UC 1PV4A 3S2HH 2R6GA 2Z6KA 4DR2L 4JI2L 1XK5A 1PA6A 3A5UA 4JI2Q 4GN5A 4DR2Q 3GTLH 1K8GA 2ZTDA 5JJIA 2K75A 1PVOA 2VUGA 4A3JH 1QUQB 1WYDA 4JBWA 2VQEL 1VQ5A 4YWMA 4DR5Q 4PG3A 4YCUA 3CCMA 4OX9L 1VQ6A 5FJ8H 1P16A 5HY6A 3W1BA 4JI7Q 4IOAA 2NN6I 2RF4A 3KDFA 2UUAQ 1IL2A 1HZBA 1E1OA 4MTNA 3W1GA 5D1PA 1KC8C 1YIJA 3S1RH 1Y14B 5M5YH 3CCUA 1ASZA 3CD6A 2PQAA 1KRSA 2Q2IA 2JA9A 3M4PA 1DGSA 2KBNA 4O2DA 4GKJQ 3F8TA 5IYBH 3CW2C 1K9MC 4LF8L 4GLAC 3PCOB 1SMXA 1NMGA 4RG1A 2UUCL 4JI7L 3S1NH 5C4XG 4A3CH 1Q82C 4NXML 3ICEA 2HQLA 3GTGH 2CWPA 5IP9H 4K0KL
chains in the Genus database with same CATH superfamily
2EXDA 1EQQA 2K01A 4O3SA 4J6HA 4QQBX 2UVVA 2K5QA 5LMUQ 2RDHA 1H9SB 1CKNA 2E2IH 2VOBA 1A62A 1DYQA 5C3EH 4B3SH 3E5NA 3VYUA 5KYLA 4KHPL 2EY2A 2NVXH 5GADC 3K5MA 4PDBA 3J7AV 4IO9A 3NC0B 2LXKA 1SFOA 1K83H 1WD0A 2COJA 4J9KA 3E3XA 4FE2A 1CK1A 1WTVA 4FM9A 3GTPB 3NUAA 4O3PA 2YYAA 1HA6A 4IOCA 4KHPQ 1FGUA 2ZTCA 3HOVG 1J5EL 3KBXA 1CT1D 4TV8F 4B3MQ 4IFDH 4HIKA 4ECZA 4KHZA 5LL6b 3OSNA 3OYYA 2UUAH 1S5CD 5KFMA 2CCZA 2HCCA 3I3CA 1LACA 3TN2A 2UUBQ 1A0GA 1JJ2A 4MV1A 4L5QA 4UPAA 3H6MA 5I9OA 2N88A 4ZHQF 4A75A 1DAAA 3M4QA 5IIFA 2R93B 1UEBA 4DR4H 4DA2A 3S16B 4CKBA 4ZRZA 2H4OA 3CMEA 2R8KA 3DAAA 5C3EG 2BOSA 3PUXA 1K0SA 2F4IA 2Y4RA 2A6ED 3D4WA 3A7AB 4XT1B 4JI1Q 3UDXA 4LF6H 3IN5A 4DV2L 1YVCA 4JPBW 3TDQA 4J1MA 4JI3H 2XVSA 4X6AH 5CORA 3D4DA 1OBDA 2PI2A 1BBWA 4C5AA 4CE5A 3S16H 3F2BA 3G7LA 4BY7G 2F03A 3LNNA 4RNMA 4U673 4C2MH 5KT7A 1KJIA 1PXUA 5IP7G 1EKFA 4O2BF 4A3FG 4LFCL 3GTLA 4Y7NH 1E0BA 2UXBH 4BBRH 1SAPA 1HNZQ 2NYZD 1BKBA 4FS2A 4FFPA 1YHBA 4X65H 3RMHA 2B63H 1EQTA 2COGA 3MEFA 3OMCA 4JV5L 1ZETA 1OXSC 3TSSA 2A1AA 4MV8A 4AIMA 1S0MA 5H80A 2G9DA 2ZGIA 1V1PA 1XMQQ 2OH2A 1W6KA 1ILPA 3KAJA 2KJXA 4DV0Q 4GKJH 5EWEA 1JX4A 1ESFA 3S14H 3SK4A 3MXNA 5CBEE 3EPIA 3CRKC 4GLXA 4TM5A 4MIUA 3AFQA 3QIAA 4JUZA 1STNA 2L1BA 2NZ1D 4ME3A 4K2KA 1CI3M 3SHLA 5EKIA 2FKLA 3PIOA 1D1IA 4DV0L 1G6ZA 5CA1F 5J2UF 5FKAC 3K0XA 3OW2A 5KFSA 2K32A 1OXXK 4A3KH 2AHOB 3V6HA 1MIUA 2V9WA 1T3NA 1QVGA 3BQ2A 3GLKA 3EIVA 4HIMA 1RF2D 1C8CA 4MV3A 2EJ2A 1QE6A 4ODGA 1XMOL 1PYSB 4EFBA 5I5VA 1VMPA 1X3GA 4LMYA 2V59A 5C0XH 4LAAA 3V05A 4Q8FA 2OQKA 1G8ZD 3N41B 4KJNA 5KFEA 1NTGA 3RB3A 4O86A 1JDEA 2WB1A 1VQOA 2O5IC 2ASDA 1TU2B 2WINB 3CAMA 2IBKA 3J81c 3RD4A 4EBEA 1VKZA 2CQAA 4K5XA 2RHSB 4ZYSA 5IYBG 1T94A 3HKSA 3VYTA 3JAML 2NZHA 4NMZA 1ZYRD 2F3WA 3TEHB 2QILA 3UDGA 2VUMB 1A15A 1BR9A 2K33A 2HHHL 2R7KA 2A6HC 4DR6H 3Q1KA 2K5HA 4HEDA 4A3LH 1TA8A 1FD7D 3VPBA 2HHFA 3UE1A 4APMA 4QL5A 2PBZA 1EUJA 2AKWB 5C6AA 4POFA 1TKWB 5E3FA 5I47A 2XIGA 2JE6I 4FDBA 2YU9H 1B7YB 4DV2Q 2EOTA 4PBCA 3T53B 5FLXE 4NXNL 4F4ZA 3RN5A 1HH2P 4ECUA 2F0WA 1G2WA 5FPRA 2CVRA 2F3VA 4MZ9A 3AEVA 5KKNB 4DV6L 1OWTA 4JVZA 3RN2A 3JZIA 3QOJA 1Z47A 3HP3A 4MNOA 5AJ3L 2V4QA 4RU9A 3BQ1A 3STBC 5K36G 2RSNA 3RFCA 2KENA 5LMUH 2PW7A 1CKOA 2IWHA 3VA7A 3SE7A 1DCZA 3HGBA 3A55A 4C3IH 5DGBA 2HVSA 1SMYC 3IRBA 3PR5B 2WFWA 1SE2A 4R9WA 5ELBA 4HYKA 2ZM6Q 5KG6A 3SGIA 1M4VA 1GUSA 3A5ZB 4DV3L 2JA5B 5JOBA 3ERQA 1LTRD 1I1KA 1RIPA 3IFDA 4O7WA 4X66H 1RYSA 3DLLA 3D4RA 2BDNA 1Q81C 3T4AC 1FJGH 3W3AA 1XNQQ 4O84A 1EZ8A 1RK6A 3BZDB 3T1YL 1LT4D 3PMFA 1NY4A 1S40A 2E2JB 1E4GT 1FL0A 3ZYYX 5JEAG 4R4TA 4UCSA 4M7EA 2W6ZA 2D9UA 3SR1A 5L1KA 5M5XB 2E5LL 5FPOA 1EYCA 1KEEA 1WTPA 3NHHA 2FMAA 4HJ7A 2PN1A 1NBWA 3S2HB 4Q44A 2X0SA 2K4KA 2X69A 3PO3G 2R92B 5M5WH 3R5FA 4PQXA 3WNZA 4A3EB 4IFDJ 1AN8A 1X3PA 5KX5F 1I4RA 1W2BA 5FOBB 3D6WA 5HV6A 2FLLA 2EY6A 1K1SA 2HHHQ 3HOZB 4A3DG 1EKPA 4JI3L 1TWAA 2W9BA 2YS7A 4YP3A 2SNMA 2B8GA 1Y69U 1TWGA 5HURA 4RAYA 3ONAB 1N32L 2FE3A 1V8QA 1Y1WG 1EWHA 1TWCA 1GSAA 1S68A 4CDCC 3R2TA 1Z2PX 1RL2A 5DGHA 1VAJA 1N9WA 3KOJA 1QB5D 3G6XA 3JC66 1C0AA 3F2DA 2Z0SA 2I8CA 2JA8G 4O4HF 1X3QA 1PTOD 1N34L 1G6PA 2L15A 4DR7L 3MFHA 2JA5G 3HOXB 3W5OA 1JT8A 4DR6Q 1ILQA 1B2TA 1I3QH 4H0LC 3LWEA 4LW1A 3MFGA 2DWCA 3GTOA 5IYZF 5EWGA 3A8IE 3MR6A 2F0PA 3K80C 2WAQE 3Q8RB 4ME5A 2JEJA 4N9TA 5ELNA 4NYEA 3OHAA 4KTAA 4E6IA 2JA7H 2SOBA 3P1HA 4BY7B 3R5HA 4ME6A 1TS5A 2XRSD 4DNRB 1IBKL 1ZKOA 1YZ6A 3LP8A 4XQNA 1EZ6A 1I94L 4LWCA 2JJQA 3LMLA 2EYPA 2W70A 3KHRA 2BQUA 3T9FA 2A1HA 3JSNA 4FFRA 4JI6Q 3AQQA 3DEOA 1KLGD 1LTTD 3A54A 5IWAQ 1AEXA 2W6OA 1D5ZC 2CQYA 1VQFA 2IY5B 5IWAH 4DL3A 3PUVA 3FRPB 3BU2A 3VOTA 1O7ZA 4LF5L 5LMNL 1C9OA 2IT1A 2CW0D 4A3EH 5CYUA 3QOLA 4DR3L 3N6XA 1K8AC 5DG9A 2KCMA 2ZDGA 4CC6A 2A69D 1E4FT 4EQNA 3D0FA 3FVQA 5C1PA 4V190 5JVG3 1TWAB 4DXGA 1LABA 4DRFA 3T1HH 1VQHA 1HR0L 4LFBL 2NB0A 2VY3A 4DV3Q 2IW3A 5IT9E 4BS9A 5DG8A 4O7NA 2IPKD 1QZHA 1S5FD 2EIYA 1BXTA 2JA5A 5HNEA 2XGPA 4IN3A 4OX9Q 4IUNA 3SXHA 2UVUA 1TWHB 1Y1VA 5EGTA 1J8IA 2RDIA 1TS2A 3HOYH 3I4NG 3HBLA 4A3GG 3MTSA 1LT3D 4ALPA 2KVMA 4L5TA 3I4LA 1N8RC 4IALA 2PO4A 2OF1A 2FPPB 3GTKA 3V4SA 4K6DA 4RGTA 4RZQA 4TKOB 2DGYA 2G9HD 3PO2G 2DNEA 5EPKA 4BBSB 1HZ9A 4Y52H 3G48A 4DPGA 5CM0A 2LKVA 3RZOB 1EZ1A 4F4XA 2J6TA 5IE8A 3MWEA 1HNXH 2R7ZA 4O1NA 3J81L 1O7YA 2COIA 4QW9A 2Z4IA 4LUOA 4F4WA 3A74A 3HOUG 1B44D 4GNXA 1DD2A 4OELB 1PH7A 1VQLA 3OW7A 1Q8KA 4JK1C 3M7GA 1X54A 4IRCA 3PUZA 1VQBA 1I3QB 3KUPA 2K5NA 4NKLA 2I5MX 1B33N 4O82A 4HR7A 3B6YA 4UCUA 4I7ZC 4JXUA 3X3MA 2B2WA 5KRUA 1XMOH 4YR3A 4A3GH 2CQOA 2RA4A 3PW4A 3AYHB 2HVQA 5KIXA 4A3MG 1M7JA 1PFNA 4IAJA 3L4JA 1E2VA 2KOLA 2W6QA 4YJ3F 3MZ5A 4G3IA 3TQ1A 2ASJA 2EVBA 2JYOA 3HKZG 3S1QB 5EBCA 1I5FA 3IFTA 5BWXA 1R4PB 4C3HB 3J80c 4DUYL 3G8CA 5D3IB 3QZ8A 2XNAC 4BBRB 1O75A 3HOZH 4HMJA 3TP7A 2JXMB 2E2JH 2FK1A 1Z7TA 5KFLA 4LF9L 1F9PA 1JDBB 1IBMQ 1S97A 2B8FA 5IT9c 4A3MB 3G6YA 4KMUC 3S15B 1GUTA 1JWUD 4JCVE 3S1RB 3UI2A 2UXDL 1KJ8A 3WWHA 1ZHQA 4DV1H 3K5IA 4JI6L 1M0WA 1G51A 2JP1A 3H0GA 4JI0H 1VQEA 1WCMH 4OONA 2B2WC 3K7UC 3T9CA 1KC7A 4KHPH 2Z6KA 4NDXA 5T1GA 4JI2L 2M05A 5KFAA 2O4XA 4B3TH 3L4KA 3A5UA 2FPIB 4GN5A 4DQNA 3MR3A 2M2LA 2VPQA 2VUGA 2E5LH 2K75A 2PNRC 1PVOA 1B50A 1CQJB 1VQ5A 1V51A 4DR5Q 4DR2H 4ECRA 5A35A 3J7YW 3PIP3 4FFOA 5K5PA 3W1BA 2NU9B 3MHBA 2W9CA 5C5MA 3SK6A 1SJED 4MTNA 1ICFB 3W1GA 3URYA 4K6LA 1SXTA 2JA9A 4RH6A 3NTKA 5BWUA 5CV4A 1C4QA 4O83A 1PZID 1IBMH 5IYBH 3S1NH 1NMGA 4JI7L 4HSPA 2VQFH 1B1ZA 3T9EA 1Q82C 3S14B 5M3FB 3EFXD 4X3SA 5DEHA 4IPGA 3I72A 2WKCA 2YL2A 1W96A 4C2MA 2FB9A 2QKIC 4LF6Q 4BA1I 3S1MH 3M85A 4CHIA 1KDCA 2VXWA 2AQ3B 1U9RA 4FO2A 5KFTA 2K52A 3GTMB 1XWEA 4JYAL 2OCEA 2UUAL 1N33Q 5KFVA 1WSCA 5EZYF 4LF6L 3OIQA 1AH9A 3FDTA 4MV4A 3DWQA 1XMQL 4IUPA 4JC0A 1MGSA 2EYFA 1SYDA 2E2IB 2RGVA 4F88A 1GOZA 3WO1A 1MJCA 3T5JA 3V2TA 1J5EQ 1BBUA 3RAQA 2N78A 3QB3A 3R9RA 4FF3A 3I4NB 3GTJA 2FMCA 4JI7H 1CA5A 3BJUA 2K5WA 1I3QA 4EGVA 1IBML 3N52A 4LH6A 5J22A 4O7ZA 4HQ6A 2F3IA 3CCJA 3V4ZA 5KNBA 4JI5Q 1HNWQ 5KG0A 1A3VA 3TQTA 4ECWA 4DR1H 5BR8Q 4OO1G 4X3KA 2NVXA 5E1FA 4ABNA 4HN7A 3C3LA 3TRZA 2EYLA 4ZCKA 5CMDA 1SCUB 2ABJA 2R6FA 1Q12A 3K5LA 4ED7A 3R2IA 2NVYA 3IAYA 1VQCA 3H3VH 2J9GA 3TIGA 2RDJA 2JEAI 4YJ2F 4Q5VA 2NU8B 1RDPD 1VQMA 4NLGA 4JI5L 1HNWL 4EG0A 3CCVA 1NJIC 1MBYA 2A68C 3TMEA 4ECSA 4YR2A 1YNJC 5H1SE 4J8QA 5EPJA 1C30A 4X66L 1N48A 2V5AA 1XMQH 5EDWA 3S2DB 1SMYD 4LFBH 3FMCA 5F9NA 3U4ZA 1GO3E 4G7HC 3TY5A 1LTAD 3SE0A 2JA6H 1PH8A 5T1IA 1A63A 2B2UC 3V96A 2DN8A 4O7RA 4CKCA 1L0XB 4QF4A 4A3IH 2QCPX 3HEJA 4AYBB 2D0PA 4A3LG 2RBMA 1GD7A 3F1ZA 1R4QB 3M4IA 3MXGA 1SRUA 3CC7A 2OTLA 2YRWA 4TQRA 1I4QA 1X9NA 3S2DH 2KHJA 2D5DA 3H4BA 1EY7A 4ED3A 3KTMA 3HFZB 1BO0A 2A6EC 3TY8A 3J80i 1LTBD 1S0OA 1ET0A 3GJXB 2WB1B 2XGTA 1EYDA 1EWIA 3U58A 1I4HA 4B3RQ 3HG9A 4XTCS 4ZUJA 5BYBA 2E8GA 5HBRB 4OGQC 3HOWH 2F0JA 1JMCA 1DV1A 5DM63 5I4DA 1L0YB 4A93B 5KFPA 2MPMA 2SDFA 1CZWA 4P71A 2NUAB 1X56A 4DK1A 4NZNA 2FHTA 2NWGA 4K14A 3NBHA 3ITPA 4JV5H 3BABA 1EIHA 2R8IA 5I2YA 3SDZA 4TV9F 2ZJRA 3BAAA 2NN6G 4DV7Q 4WD3A 4A4IA 3DTGA 4Y7NB 1WTOA 5BYAA 4ECTA 4EQOA 1L1OC 3CKIB 1FNWA 4GS3A 2HDLA 4GN3B 4I7AA 1YJWA 4X64H 1OXUA 2JA6B 1LV9A 3H3VI 3ORRA 3K57A 5M9OA 5IT9L 1VQAA 2FFKB 2EYOA 4XIGS 2PQEA 3JRXA 1AP0A 2RSOA 1IOWA 5KFYA 2F0EA 1U4LA 4FNFA 4F7XA 3J7A5 3CQZA 3GTQA 2PMZE 2Q7DA 2Z04A 4P74A 2F4VH 2I5HA 5L9XA 2F0IA 3KXYT 3VR3A 4AQYQ 1PH5A 2KHSA 3SVMA 2GA4B 3RBEA 2Y0SB 4DL5A 2EPBA 4DK3C 2EE1A 2R93H 4IUTA 4C3IG 3ULLA 2JEBI 1ZHSA 1VDZA 5A2QW 3Q2OA 3G71A 3NELA 4DIMA 3F8NA 2DLNA 1WTWA 3K3PA 2B29A 3MWYW 2VUMH 4R8UA 2F0SA 1HNZL 3H20A 2V1CC 2MUYA 4JG2A 2ATLA 4GOPA 4PZ7A 3RTXA 3M9OB 4DV1Q 2UVRA 4DL7A 1LO5D 4JI4Q 1Q90A 2E2HB 3U4VA 4DV6Q 4UCVA 3HOWB 1ICWA 1V43A 2RQXA 1MZBA 1QNKA 4GKJL 1AW7A 2QK4A 4YQWA 5L1LA 2IA6A 4A3BB 4XQJA 4LF8H 1IHZA 3DMUA 5I5TA 1Y1VG 5EBDA 3MXPA 3OTOL 1VQGA 4DK0A 3L9AX 2W8LA 5KT6A 4V0BA 2DIKA 3J81j 3VR5A 5ELOA 2EDGA 3NSWA 2LSSA 1GUGA 1KAWA 2F0MA 3MA2B 1L2FA 3MJFA 5I2XA 1SDFA 5DGIA 4TSSA 4DR7H 3LGJA 1RODA 3X3NA 4PMWA 2RHQB 2R93G 5KFNA 1L0WA 5KG1A 1PZKD 4WBNF 1BVSA 1STBA 4ED2A 3KLSX 4RKBA 1HCZA 1JB7A 3MR2A 3TREA 3HOUH 2HD3A 3S1QH 2NTSA 3K3VA 4JI6H 1N32H 1TWGB 2K14A 1YNXA 3C46A 2BA0A 4YR0A 3JZFA 4OWWB 1L2ZA 4JYAH 3BVZA 3HOUB 5DAUA 5KFIA 4J9LA 4DV7L 1KXLA 4P73A 4RUAA 2X6LA 3G6EA 2WYOA 3NTHA 5CC4A 2ZXOA 4Q4DA 3GV7B 1KL9A 4QIWE 2DZDA 1HUMA 3T9DA 3Q24A 4WRDA 4AQYL 3E9IA 3FPUB 1A48A 2OEOA 1S72A 3JSLA 2R87A 5D65A 1R9TH 3T13A 3ER0A 5LHY1 1F2LA 5KEEA 4RB2C 3J7AK 5BN3A 1AZQA 4IUQA 2NVYB 1V4YA 4ID6A 3N43B 2FJZA 1DIKA 4M9UA 3G4SA 1NMFA 3D6CA 5CV6A 1T9HA 3PSIA 2HHFB 4DR6L 3QWUA 1I4XA 2HT1A 1PFMA 2HDKA 4Q0YA 3BS1A 3K5NA 2K28A 3MWDA 2OWOA 2ZJPA 2F0HA 4K8JA 3GV8B 1IBLL 1CHPD 2JA7A 2AMCB 1HTPA 1Z6HA 5IYCG 1O7LA 3FEWX 3KLRA 1ESRA 5KGUA 4O42A 5CR3A 5IGEA 3UFXB 1QCBD 1HRJA 3A0JA 2NZOA 4MV9A 5L37A 4IFDI 4AYBA 4P72A 3PUYA 4LFAQ 4DV1L 1EQVA 1EIFA 1HQRD 2FMMA 1JWMD 5LP6F 3J80E 4O3NA 4CBVA 2K03A 2IX3A 4Q43A 3HRZC 1N36Q 2YZNA 1F9QA 1JJCB 3UDFA 1YITA 2W9CB 1JR0D 1I1LA 5K2MA 5IP7H 3OWFA 3P75A 1XPOA 5LMNQ 5BWTA 3FHWA 5KG4A 2NU6B 3KF8A 2B2UA 2MNAA 3CVZA 3H0GH 5C0XI 3KF6B 3DWPA 3K7AB 2KEEA 2VB2X 4KKTA 2OXPA 3QJYA 4HJ9A 2A73B 2R7ZH 4A93H 1SN8A 1ONLA 5DLQE 4RMFA 3KHLA 1UNSA 1CSPA 4A3MH 1SE3A 4DR3Q 3DWAA 3CU7A 2K1BA 1NR4A 2IL8A 4AH6A 5KT5A 5KFOA 2LY7A 4N9PA 5HGTA 5JJKA 2RKSA 1H9SA 4X62L 5IGCA 3TS0A 1OXVA 1GXDC 1PTOC 3K58A 5KG7A 2UXCH 2EYMA 3G6JB 3CCEA 4M0JA 4JI8Q 4ED6A 3LWBA 2V4DA 3UQ8A 2C2RA 5CR5A 1I94H 4IJLA 4FBTA 2EYJA 2YV5A 4OIKA 1A3TA 3T51B 4GNXB 3GTJB 2F4VQ 2MO0A 1JLLB 1PYBA 3EVQA 4DR5L 1LLRD 1GLVA 3BG3A 3K6OA 3E6ZX 1EYAA 4G57A 3I4MB 2C28A 3GTMH 3V6KA 4KJOA 1KNAA 2QDBA 5HGQA 2B63G 4FXDA 1JIHA 1MSHA 3BYTB 4ULLA 3E0EA 1UE1A 2QGQA 1F2MA 4DV4H 1YI2A 1Q1BA 1YNNC 2BR0A 1HR0W 1VCIA 3BDCA 3TP5A 1KQSA 2WV6D 1KIXA 3PO3B 2XN9C 5C4XB 1M0TA 4ZQIA 1QZGA 2XCLA 4JOIA 3LWUA 1K28A 2FP4B 1N34Q 3SNOA 2YTVA 4RUCA 3Q8PB 5IODA 2F0GA 3GTOB 1CQVA 4I7HA 2WKDA 4HTHA 1I6UA 5FNVF 5C4XH 1DM0B 1Y1VB 3KDFB 1TWHA 4IPHA 5FR9A 1ET6A 3I70A 1JWSD 4KY7A 1T5XD 4LF7L 1IW7C 4JYAQ 4Q4CA 2EJ0A 3OSPA 2R93A 3DM3A 2DY7A 1FJGQ 4WHXA 3NEMA 5M5WB 2KHIA 5JVH3 1CSQA 5J2TF 1N32Q 2WB1G 4QW8A 4RB1A 1XX8A 1HJPA 4N8X1 2L12A 1B04A 3I4MG 1DONA 3CSWA 1OTCA 1WH2A 3CMAA 1IZ6A 5IGDA 2MQHA 2N8NA 4OWTB 5C44B 4FFNA 1TWCB 1ENCA 1NAPA 2EJGC 5L1IA 5KS8A 4JBJA 4FXGC 1QNUA 4Q45A 3I4OA 1U5KA 2K04A 2LFNA 3H91A 4CDFC 5I6WA 4DR7Q 2R7MA 2EY1A 4MTEA 1PTOB 4J9NA 3N44B 1V1OA 2K6AA 1EY0A 1M6VA 2LMCB 3GIQA 4OHJA 4O4IF 5KT2A 1SNPA 1LT5D 4XYOA 5GONF 5T14A 4C3JB 1DOLA 3BYYB 3HO8A 4RB0A 4GKKQ 2ICEC 5E4XA 4LFBQ 1YJ9A 5E4WC 4ECYA 1Z9FA 2O2LD 2Q2HA 3TP6A 3SEBA 1FKAH 2I87A 4OO1H 4C2MB 2FJ2A 2B2VC 2HQEA 4XYQA 4ZQ3A 3H09A 3NWSA 4ZKCB 5FLMH 4JI1H 2IHFA 1CA6A 2YCHA 3A7LA 3S2HH 5E7NA 4IZOA 2UVWA 1T36A 1S0NA 2R6GA 4DV7H 2X6GA 4IWXA 2KECA 2PZWA 2W57A 4JI2Q 1S5ED 1K8GA 2ZTDA 1JOKA 2OT2A 4PWQA 2XCPA 1PLFA 3FKIA 4PG3A 4KY6A 2YU9B 2R86A 1CM9A 3DUZA 2DPIA 5DMXA 2PMZA 2UUBH 1P16A 2C22A 2PMZB 4JI7Q 4AQYH 2YZGA 4HR7B 2RDFA 5FO7B 4JV1A 3S1RH 3HOYB 3CCUA 2Q2IA 2CNUA 3VMMA 3RGZA 4HCEA 1F2ZA 1CQIB 4QMGA 1K9MC 3EYYA 4GLAC 1SMXA 1SNDA 1RJPA 4A3CH 2YW2A 3QWNA 2HQLA 1QJOA 3NPPA 4K0KL 2QB5A 3DM1A 5IOCA 2OTJA 3QR8A 2C2DA 1QOHA 2PVPA 3N8DA 3Q0AA 1Y8NB 3CCSA 3OTOH 1EIYB 4LJZC 1W3SA 1BXRA 1CS0A 4N8FA 4QIWA 2HGXA 2VPSA 4YCVA 1D6EC 4S3SA 2MO1A 2UXDH 1E2WA 1TWHH 1BF4A 4QY7A 5IGFA 3S15H 2ZJQA 2HIXA 4JV5Q 3SK8A 5GAHC 1FJGL 4GN4B 4ECQA 1TS3A 1CUKA 4I65A 1TWFB 5C44H 1Q8IA 2QEXA 1RYRA 4DLKA 2R8GA 2DABA 2XCAA 4QGUA 1VBHA 2ASLA 2UUCH 3GTMA 3M7NA 5M3FG 1K3RA 1YEZA 1B53A 2IX1A 3OHBA 1B9NA 4QSHA 2N3SA 2KSWA 3GTKH 5FO8B 4H02A 4R4OA 2Q2TA 4QCLA 4GC6A 4GZYC 1OXTA 2HIVA 3KK7A 5I5XA 2DNCA 4QJFA 1A8VA 3TQYA 3CCRA 2KUMA 5K36H 3OSOA 4OXPA 3U50C 4H44C 4DK6C 4M8AA 1XNRL 4DAMA 5DNFA 1D2BA 1CE8A 2CFMA 1BCPD 3AB9A 1JCKB 1JICA 3CQZB 5C0XG 3GTQB 4FFMA 3FDSA 4AYBE 1DZ1A 4XDXA 1FGBD 4O81A 2G5DA 3MXUA 4NXNH 1XNRQ 1EEFD 1PH1A 4JI0Q 3NQIA 5BMVF 1S5BD 1U4MA 3N40P 4P2CB 4DUZQ 3MC0B 3OIPA 4LUZA 1ZAUA 1J5EH 4DNTB 3HOWG 4A3EG 2LXJA 1RTNA 5J3BA 4B9XA 3RLOA 4LF5H 1G2TA 2JEIA 1X3FA 1SE8A 3RBDA 1B8AA 5DM73 4YWKA 4F87A 1IKMA 5EOYA 1B4OA 2JA8H 1XPRA 3I12A 2DJGC 1KUTA 3GIDA 4P75A 3GTKB 1HQMC 4FVMA 1SBBB 2EJFC 4DR1L 2R82A 3OUZA 1EFWA 4RGMA 5C4ZA 1AUVA 3TEKA 1SEIA 2VQEH 1SLJA 2XWBB 1GHJA 4IURA 3QG1A 2ALYB 4X3TA 3PO3H 1RTOA 3T5KA 3F2UA 5C4JH 5CAEB 4B08A 5EKLA 1SYGA 2F0UA 1IW7D 4DR1Q 1Q7YC 3HOYG 3I4NH 4IR1A 2MGSA 2Z1CA 1E2ZA 2K5VA 1KLUD 4EBDA 4Q8EA 4O3QA 4C5CA 1CKMA 4XT3B 1I50B 4O3OA 2FINB 2CW7A 2PNHA 1PRTB 1MSGA 2QA4A 2CHBD 5CV9A 2UU9L 5D1OB 1EY8A 1LTGD 5D1OA 4RAUC 2R8HA 2IMWP 5DLFA 3LX0A 1WVLA 5L1JA 2PYKA 3KJPA 2PCFB 1LTLA 1FYCA 1RK5A 3T1HL 3S17B 1EY5A 1I6HH 3WWJA 5BPFA 2FLPA 3HT5A 2Y0SG 4MHEA 1E4EB 3R23A 2R92H 4CHTB 2HGSA 3I8ZA 1RJTA 1B9MA 3U9SA 2ZDQA 5COYA 1EU3A 3NE5B 1JQYD 1C7YA 3K5HA 5JVLA 1S03G 2KCNA 2EQSA 2JA5H 3T99A 1XTDA 1N33H 2HDMA 4O4LF 5F9LA 3PO2B 1PH2A 4MTDA 1JKJB 2ASBA 2JN4A 3VYSA 4BBSG 1EKVA 1K83A 4RA8A 5FO9B 1TAEA 5J1ZA 2I0QA 1BDOA 1PYWD 3H0GG 2HVRA 1K8MA 3NBHB 2BCOA 1LT6D 4QIWB 3TBIB 5EJWA 1F9RA 4DR4L 5JH7F 3C0FB 4O7VA 3W2DA 4ZAIA 2D2CC 1SR3A 3UDIA 5KFBA 2CKZB 3BZCA 1J9OA 1EU4A 2VQFQ 3P20A 3RB4A 1SYXB 1I4PA 1VQNA 3GIKA 4UCTA 3C1FA 4A3KB 2J7ZA 2DUDA 4HJAA 3SI8A 2KCCA 1B70B 3CPFA 1JE5A 1VF5C 3GQCA 1EIGA 4HIDA 3EROA 4B3TL 2PZUA 4NXNQ 5M3MB 2KCTA 4HSVA 5D3DA 5JJZA 2B3GA 3OTOQ 3GQBA 1LTSD 4CKEA 3PW7A 2R7ZB 4JI5H 3BJYA 1HNWH 2YWVA 4TVIA 2AU0A 4KY5A 2JA7B 2Y0SA 2K50A 1KJJA 1JB3A 1STEA 3RLFA 2YRXA 1JOOA 5IY0A 3MEHA 4EVOA 1NE3A 3BA8A 1I2KA 1BCPB 2FLNA 4WFN3 2CZGA 4C3JG 1GSHA 4JI0L 1GHKA 4WJ4A 4BWSC 3K8AA 4HNVA 3MWMA 3VA5A 1TS4A 1RJQA 3M4YA 1BBXC 1A2TA 3CQZH 3GTQH 3E0JA 3RJ0A 2B2YA 1K73C 4FF1A 5KFUA 2UUCQ 3K81C 4NXMH 4LF7H 5CE8A 4RZRA 1W93A 2R8JA 1WD1A 2B39A 4RCOA 3HOVH 3PF4A 1EY4A 1RKNA 1MJEA 4J9OA 5KG5A 1JE4A 5IYDG 1TWGH 3Q8QB 3MXNB 1T5EA 3ORQA 1R9TB 5JPMC 3K0YA 1UC8A 1UEAB 5KFZA 2W6MA 2VA2A 3NP8A 2K7VA 3OUUA 4XYLB 2VZAA 1IXRA 5C3XA 5DISC 2PW5A 2JEFA 1F9SA 1LTID 2ID0A 3BDOA 4TQUS 5CV7A 3O13A 2JA7G 1RD9D 1X3EA 3R5XA 1YNJD 1PH4A 1FR3A 1SNMA 3ND8A 1KHIA 1TR5A 2QDLA 1UC9A 4LH7A 1XTCD 3GIIA 4L5SA 2JQOA 4ED0A 4GKKH 3KFUA 5CV5A 2EXZA 1ET9A 1FNVA 3D3RA 2IP4A 1XYIA 2R7LA 3A56A 2RVLA 5ELEA 2O5JC 4B3RL 3CP0A 1WCMG 4KD4A 4DV3H 3AW8A 1XNQL 4QB4A 3VNNA 3NXWA 1WTRA 1IOVA 2VW9A 1EOTA 4EYIB 5C0XJ 2UU9H 5KNCA 4LF9Q 1VQIA 3EQLC 3T1YQ 3GTGB 4FS1A 1SE4A 4MV6A 1GUOA 4G4KA 5EQ0A 2MHVA 3STBD 1IYDA 1EL0A 1WJJA 5DG7A 3GB8B 4B3TQ 2E2HH 2AWNA 1Q1EA 4RKLA 1OBGA 3RGXA 3JZ6A 3NUCA 4IFDG 5DGAA 4CGYB 1A3UA 3DXJC 5EKKA 5IGBA 3JAMW 5KFQA 2WB1E 4EX5A 4DXFA 3CC4A 3S24A 4BY1H 4O4JF 1K83B 3T16A 4QWCA 3CC2A 2R84A 2F0NA 1U0LA 4ZLTF 1IL8A 5KFXA 1P8LA 3QZ7A 3WWVA 1Z2NX 2F52A 3NTIA 3AMUA 1I1MA 1ENFA 4JBMA 4K5WA 3RR5A 2Z9HA 5ELCA 3ETHA 2H5XA 5JVDF 1S10A 5M3MG 3S1NB 1KRTA 4NXMQ 4GLWA 1SROA 4O2AF 1E7ZA 5GROA 2ZM6H 1PMRA 3CXCA 2AQ1B 2W9BB 1SJHD 3RLNA 4FGRA 3WWIA 4L8JA 3UZOA 1K3BC 5KT4A 3IKJA 4LFAH 2BQ3A 3GTPA 3ULPA 2E76C 4CDDC 2AUKA 2BE5D 1M90C 5JUMA 4F50A 2I80A 4A3IG 3UE0A 1UNNC 1VQPA 1IYUA 4UFZA 2VR1A 4YWLA 3GTLB 4C3HG 4BY1G 5KYIA 1OO9B 4XZ3B 5C3WA 4UUGA 2F0KA 1UAPA 3FPPA 2ICIA 4LFCH 4PV1C 1I7LA 1KJ9A 2E2HA 3HB9A 1N34H 4KN7C 4ED8A 1VQ8A 1QILA 1RCVD 2E74C 3DTFA 1VQ7A 2WTFA 1NR2A 4HJ8A 3BG5A 2M9VA 1YHAA 4EGJA 4EBCA 3OMGA 3NWTA 4NB3A 3FP9A 3A8KE 1IYEA 2NU7B 5BPHA 1SNCA 2W7OA 1SYCA 2R3ZA 5KFKA 1HZCA 3D31A 3U54A 4CMDA 2C35B 3PV0A 5FD5A 4HMIA 3M9MB 2Q2UA 1FNUA 1WOCA 1NCVA 2GVAA 3MFYA 5FLMG 5IT9W 1PZJD 2WACA 3MFIA 4A3FH 2F4VL 3AX6A 3CCQA 4XXEA 4X66Q 1ASYA 4UCOA 5LMNH 4C3HH 4GOPC 1GGOA 4KLKA 5IWAL 3WO0A 3J80W 5G3LD 2Z6BA 1AFPA 2N55A 4J9PA 4LF5Q 1EUCB 2M00A 4YB8B 1O80A 2GN5A 4JI8H 1E24A 2B2YC 2R7DA 4B9WA 1LM0A 1PFSA 3GTGA 4O7LA 3GTJH 2WDTA 4LUVA 1CHQD 3OPOA 4DR3H 1BNCA 1JORA 1BGWA 3BA9A 3GV6A 1EEID 1D7QA 2XRQD 3T9AA 2CWAA 3KF8B 3PUWA 4GC7A 4R4CA 1PK8A 1XXGA 4EEQA 2GVBA 4LF8Q 1D8LA 1I4GA 4ZOLF 1EUDB 3GIMA 4DN4M 5JPNC 4RAZA 4L5RC 5KG2A 4B3ML 2VS1A 1NSNS 1EOVA 1FVIA 4JI4H 3GD7A 4FFLA 3K59A 1WFQA 3QFFA 4C3IB 4KHVA 2BDOA 3PZPA 1J6QA 5LMUL 2L9HA 2L11A 3BACA 3A8JE 2PPBC 1STGA 4J9QA 2NVQH 4QUCA 1QVCA 1YNND 5K3WA 4IJHA 1R9TA 3G8DA 1G2SA 4K0KQ 3T54A 4YY3L 4A3JG 2W9AA 1RJRA 2PZTA 3FKIB 3Q23A 1CZGA 1GM5A 3VPDA 4IR9A 4ED1A 4X62Q 3I91A 4J9MA 1H9MA 1SYBA 3K7AH 2L5TA 2N49A 1TWAH 5I5UA 1XNRH 1E22A 1D5XC 2SEBD 1Q86C 1STHA 5LL6X 5J39A 1I6HB 5FLXc 2R61A 1QWYA 2Z4HA 3HKZE 4H13C 2R92G 2H1EA 1HA5A 4I55F 3NK9A 1YHQA 3H3VC 1ULZA 4XX0B 4MN3A 4PZ6A 4OWXB 4RHSA 4UP8A 2B2VA 1STYA 4TVAB 3HKZA 3AFPA 1I50H 2IJ0A 3FKIG 5I60A 3M3YH 1F77A 4KKSA 4YHHL 2F0TA 4NZOA 4L6TB 1JXLA 1STAA 2FXQA 1WRVA 4IRDA 1Y8OB 5KFJA 2TSSA 3Q6SA 3RIZA 4DR2L 4RGOS 1JOQA 2FK2A 3D8GA 3DEPA 1PA6A 4FYDA 1MD2D 3H4DA 4XQQA 4TRDA 2W6NA 1S9FA 2E75C 4Y8VB 4A3JH 1HUNA 1QUQB 4IUUA 2VQEL 2VB3X 3CCMA 4FF2A 4JI2H 4TQSA 1M8AA 5HY6A 2EZVA 1ZEQX 2GLTA 5LXTF 2WAQA 4IOAA 3KDFA 1WCMB 2UUAQ 2ZT9C 1HZBA 2L0CA 1IL2A 1E1OA 4J9RA 1XNQH 5D1PA 4JV0A 5KFFA 1SYEA 3H94A 3CD6A 1Y14B 5M5YH 1ASZA 1EHIA 2SNSA 1KRSA 3EA6A 2KBNA 1A9XA 2HG8A 4J9SA 4O2DA 3F8TA 3CW2C 2CNQA 4LF8L 4RG1A 2AGOA 3ICEA 2FPGB 3QO2A 3OWEB 1QG7A 5A2QE 3GTGH 2NVTB 5IP9H 4DV5H 3IG0A 3K5OA 1AUXA 3RUZA 3KBGA 4OO1I 3UYYA 1DOKA 4R8IA 2XIWA 4Q0FA 2V4RA 4HJ5A 2EJ3A 4X65Q 2Q8TA 4EQ5A 4H7BA 4R1JA 5JQGF 4I4TF 5KFDA 4R4IA 2EIFA 2K5DA 2DAAA 1X65A 4A3BG 3PW0A 1E1TA 3HXLA 1O78A 2RCNA 2F0FA 5TSSA 1GSOA 4FU0A 2BQRA 5CGKA 4A3GB 5EPLA 5DAAA 1ML0D 4PMBA 4G7OC 4DV5Q 1KTAA 1Y1VH 3RZOH 3DF7A 3AU7A 1PH6A 5JEAH 5KFHA 5FJ8G 1C3OA 1B3AA 5E25A 2MP1A 1HHVA 4O7YA 4R8UB 5C5JA 2MJ8A 3HS0C 3VPCA 4R4QA 1H9KA 2RDGA 4X3UA 4DL4A 2KQ3A 1KT8A 4MV7A 1HFNA 5A2QL 3RB6A 1CTMA 1UE7A 2F0VA 5FD6A 2YTYA 2UXBL 4DFAA 3IL8A 2JEGA 4POGA 4ETSA 2OLSA 2E2IA 1K1QA 1X32A 1C48A 5BN5A 3NBYB 4MA5A 5KFWA 1NNXA 4DAVA 3S1MB 3TP8A 3RZDH 4UDUC 1SFOH 2WAQB 2YTXA 3CHBD 3BVMA 1JJGA 1TT2A 3TY9A 2QYZA 1KABA 1ENAA 3T9BA 1BNZA 1MI2A 3PO2H 4DUZL 1WI5A 3BDLA 4QWDA 1WR2A 1SSOA 3VDYA 2ZDHA 3H40A 3OOCA 4DV4Q 1AZPA 1TY2A 4LF4L 3KALA 2ZJTA 2F0DA 4O3RA 1PHJA 4JOIC 3BZKA 4UP7A 2KA7A 4ECVA 1ZXTA 4OEMB 1PRTD 5NUCA 2OQ0A 4BBSH 4EQPA 4I50F 1GJXA 1IKLA 2EYHA 5BR8L 3F2CA 1II3A 4YAJB 4JW0A 2WAQG 1VQJA 2HJWA 3M9BA 4C3JH 1BCPC 2DY8A 1QVFA 3ERSX 4CDEC 4BY1B 4UY8C 1VQDA 1N33L 2JA8B 1Z2OX 4O7TA 4JI1L 1XPUA 1N36L 5FLXW 1V9PA 4IIJF 2R7ZG 4YCWA 1DV2A 2ES2A 2A68D 2AWOA 3GDEA 3CCLA 2SCUB 3GIPA 4OL7A 2A5HA 4ZI7F 1Y8PB 3EN2A 4C56C 3VYRA 1VS0A 4UAIA 3PW2A 1Y1WA 4IUVA 5LYJF 4KKUA 1TWFA 5DQIA 4B3MH 3JAME 3PR4A 4NW2A 3I90A 1BJTA 4DUZH 4DV0H 5I9PA 2LS01 5BN4A 4A2BA 4X65L 4HCSA 2XC9A 4WJWA 1B6SA 2YU9A 2I46A 1IBKH 4QWEA 1PX2A 5I5SA 1HFGA 2MFIA 2ATWA 2P0AA 3R93A 3VR4A 1KD1C 2WP8J 3RUPA 4K2LA 4U68A 2CNVA 3TIIA 4LNQA 1D1KA 2VQDA 1KJQA 2UXBQ 4MA0A 2JK8A 1BOSA 4B3SQ 5KFCA 2BA1A 2UXCL 4JI8L 5CBAE 3RV3A 2C5CA 3HOXG 4O0AA 4CJ1B 4X62H 4PMCA 3CRLC 2VNUD 2W71A 4C1NI 1PTOF 1A6XA 3KF6A 3CPWA 1JC7A 1DXMA 1H9JA 2K05A 3I73A 3J7ZC 4JI3Q 5C1OA 2UXCQ 4E6NA 3J81W 2AGQA 3KHGA 2ODTX 2KEDA 1S4ZA 2B2TC 3Q22A 3TZUA 4G7ZC 3VR6A 4RNNA 2DPJA 3J7AF 2F0OA 5FLXL 2B2TA 3J80L 3U0GA 3GTOH 2Q8IB 2UXDQ 5LMNW 1K8OA 2WE6A 3HOZG 1O7IA 5BWVA 1WTHA 5BR8H 3J81E 1KNEA 1TVXA 4JV2A 4X64L 1GVPA 4BY7H 1K0RA 2L4NA 2A74C 3HOVB 1Q3LA 4DV4L 3VR2A 4LF4Q 2AQ4A 5LOVF 2QW7A 3EJIA 2AGPA 3P7JA 4EFEA 2XGQA 1HNXL 3RNUA 4WORA 3L7ZC 3QQMA 1G91A 4BBRG 1M1KC 4HNTA 1U4RA 4LK1C 3PIO3 4MTKA 3Q8SB 1YBYA 3HOXH 1KTKA 1UE6A 3NBZB 5M3MH 3PVXA 1W6JA 2YS6A 2W8KA 4LFCQ 4XYMB 1PRTC 3CF5A 3T1YH 2R92A 1EYGA 2A69C 3ULJA 4DL6A 2HCIA 4ZKBB 4DU9A 3L2PA 4DR5H 1IBLQ 4DGZA 1AE3A 5I6YA 4QUFA 4HAEA 3R3OA 2GQSA 1BCPF 2Y0SE 1PDQA 3T5HA 1EY9A 1B6RA 3KLWA 4K6NA 1UWVA 5G3LF 2DJFC 1A3GA 3KLSA 4A3CG 4YHHH 3PW5A 5JJLA 2GPSA 4EEYA 4U6PA 3RAXA 1GYFA 4A3JB 1TWFH 5FK9C 2Z02A 4K0KH 4A93G 4B3SL 4A3KG 3N42B 3FMAA 4NP5A 3TZDA 4PNYA 3RF2A 1YJNA 4ILWA 2NTTA 4DKAC 1G291 1KDAA 3T5LA 5CA0F 3J81i 5KFRA 5EAYA 4HIOA 4AYBG 3TINA 4OX9H 4RNOA 4HN2A 1A0IA 2XSCA 2A8VA 4NZMA 3V6JA 4IQZA 3PN1A 1UUPA 1CFMA 4CC5A 5LA6F 3I4MH 2ZM6L 1WTXA 3HZXA 2AQ2B 3H0GB 3NQTA 4LSXA 1AE2A 5AJ3Q 3KJOA 2EJMA 5CV8A 5M3FH 1HTLD 2J0TD 4C5BA 2E5LQ 2ZXRA 4KV6A 1XMOQ 1GKHA 4FXKC 4J15A 2JA6G 2L55A 3I7FA 5GAEC 2X5RA 2YYZA 3DHQA 5JEAJ 3UZBA 3CEBA 2PI2E 2J6SA 5C8YF 3KAKA 4O7SA 1KAAA 1E4EA 2D62A 1HR0Q 1EWCA 5C4JB 3S17H 4CMFA 2BE5C 3JRWA 3GO5A 3WOFA 4JI4L 3BQ0A 2D0OA 1EYZA 2TMPA 1TY0A 3I2ZA 5CB4F 3L0OA 4PZ8A 1VQKA 4RHRA 2RGRA 4IWYA 1ZQ7A 1B3QA 1HNXQ 2I5LX 2XWJB 4GOPB 2GQRA 4LMQD 2PQAB 3JAMc 1V1QA 4F4YA 1D5MC 2W7PA 4TUYF 3H15A 2EY5A 4MAMA 5ISRA 1AN7A 5ELFA 3M9NB 4IRKA 2NVYH 2IX0A 1H95A 4LFAL 3EPGA 1ZYRC 4DV2H 3LQSA 1EFID 4OIJA 5C44G 3OHXC 4C1NK 1I50A 4X64Q 1XJVA 3GV5B 4YBZB 5M5XH 2JSOA 3TW7A 1WCMA 1E3PA 3KYHC 3MAQA 3EBEA 4A3DB 4YY3Q 1UE5A 5EWFA 4RWSC 2GPWA 4DUYQ 4L1KA 4DL2A 4CJ0B 4U7CA 4KK7A 4A76A 4DF7A 3TS2A 1VF7A 4DAYA 4RCNA 2XD4A 1VQ4A 3T1HQ 4FF4A 4RB3C 2C2EA 2R7NA 4QWAA 4K5VA 1L1OA 1I94Q 4R8NA 4A3DH 2P5ZX 1L1OB 5D14A 3SK5A 3T7AA 5JQWA 1KDBA 3HKZB 5I5YA 5JAVA 1HR0H 4YY3H 2Z8LA 2CH4A 4A3IB 2Q8RE 2J6UA 1LUZA 2ZXPA 4A3BH 3JAMi 5LL6S 4L63B 5GAGC 2A6HD 4WJ3M 4BXXG 1EY6A 4LF4H 3WDNA 5BWWA 3PFFA 1Q46A 1IYVA 3E5SA 3GIJA 3I56A 3U9OA 1QUQA 4YIJA 5ELDA 3U9TA 1NUCA 3LULA 2ENBA 4ZUIA 2VQFL 1TQOA 2NN6H 4UP9A 1PH3A 3C2PA 1BUVT 1S3OA 4KN4C 3E9HA 1EQRA 3FKIH 2YZLA 1SNQA 4A3FB 4KD3A 3N6RA 1WTQA 3NENA 5KNDA 5BWRA 1I2LA 1I6VC 3TW6A 1PH9A 2NVQB 4KI0A 4GKKL 2BH8A 4LF7Q 5KG3A 2CH4W 1VMCA 1A2UA 5M5YB 1N36H 3L3OC 4FBUA 4ZK9B 4GLVB 1HXYD 2MCTA 2ZTEA 1BQQT 2W6PA 4YHHQ 4A2AA 4DNIA 2RCFA 3M4OH 2NVTH 2BH2A 4R7RA 4M1UB 4Z9CB 1CQFA 1HPCA 3G6VA 3PF5A 2HUGA 2HGWA 1MKHA 2R85A 1X6OA 1N56A 1X55A 1U4PA 4DAYB 4BXXH 3T56B 3ZJYC 5DQHA 1S5DD 2VL6A 4F8MA 2ALZA 4LF9H 2UU9Q 2HHHH 3M3YB 1HNZH 1IBKQ 2B63B 3M4OB 3NBIA 5C4HA 2VUMG 1DJRD 2F0QA 4DUYH 2NVXB 4EGQA 1KBLA 2VA3A 2A19A 5KFGA 1LYLA 5C3EB 4K8IA 4CJ2C 4DV5L 1I7NA 1V1PB 4LSAA 4IPDA 2VUMA 1F2YA 5GQOA 3PIPA 3ND9A 1H9RA 4FP5D 2CW0C 2NUCA 4RFBA 2QF7A 4UCRA 1SEBD 3Q8DA 1PRTF 3MVVA 1RHPA 2IHEA 2F1MA 4BA2I 2JA6A 1GUWA 4IZ8A 5IYDH 1DOMA 3MR5A 4IPCA 1TXYA 2R7FA 1TWCH 1VBGA 4QWBA 4UHVA 4DR4Q 4ECXA 2NBFA 3PGZA 2VQEQ 1XDNA 5I5WA 2CW8A 1IYJB 3RZDB 1SFOB 2C9OA 5DLGA 3NGDA 1IBLH 5D8DA 2YZMA 1HZAA 3RV4A 5IGGA 5IP9G 5DQGA 3U55A 3RB0A 1CKNB 4E4TA 1GUNA 1PTOH 4GNXC 3R8BA 3KHHA 3GTPH 4IHJF 2UUBL 1VQ9A 4APVA 4JBKA 3I55A 2F0LA 5C5LA 4B3RH 5IYCH 2J4XA 1Y1WH 4NPSA 4BWGB 2Z6KC 2XTIA 5F2DA 1PV4A 4YAKB 2E2DC 2QEJC 2O03A 4DAPA 1XK5A 4DR2Q 3GTLH 5JJIA 1MHWC 1WYDA 3GV3A 4JBWA 4HNUA 4YWMA 4OX9L 3BVGA 4YCUA 1VQ6A 3GILA 5FJ8H 2V58A 2B63A 3PQIA 5AFWA 2NN6I 2RF4A 1PFBA 2AUJD 3WOEA 2C00A 3ETJA 4DV6H 1KC8C 1YIJA 1Y1WB 1SNOA 4RGNA 4EYHB 2PQAA 3M4PA 1DGSA 4DAAA 4GKJQ 1TIID 5KT3A 3PCOB 2UUCL 4J0MA 2WIIB 5C4XG 1SYFA 2FK3A 3S9WA 3GP7A 2I07B 4NXML 3KREA 2CWPA 3C1EA
chains in the Genus database with same CATH topology
4IPGA 2EXDA 2OTJA 3IG0A 1EQQA 4OO1I 4LF6Q 4QQBX 4BA1I 3CCSA 5LMUQ 3M85A 4HJ5A 4X65Q 3S1MH 3OTOH 1EIYB 1CKNA 2E2IH 1W3SA 4EQ5A 2VOBA 1A62A 4R1JA 5C3EH 4B3SH 2VPSA 4R4IA 4YCVA 2UXDH 2EIFA 2MO1A 4KHPL 2NVXH 2K52A 1TWHH 5GADC 4QY7A 4PDBA 1X65A 4A3BG 3S15H 1E1TA 4IO9A 2ZJQA 4JYAL 2HIXA 2LXKA 2OCEA 2UUAL 1K83H 1N33Q 4JV5Q 5GAHC 4LF6L 4GN4B 2RCNA 1FJGL 1AH9A 3NC0B 4FM9A 1CUKA 2QEXA 5C44H 4DV5Q 4QGUA 1Y1VH 2UUCH 1XMQL 3RZOH 3DF7A 4JC0A 1PH6A 5M3FG 1K3RA 3M7NA 4IOCA 1YEZA 2IX1A 5FJ8G 4KHPQ 2RGVA 2N3SA 1FGUA 2KSWA 2ZTCA 3HOVG 3GTKH 1J5EL 1MJCA 4H02A 4R4OA 4R4QA 2Q2TA 1OXTA 1J5EQ 1BBUA 2HIVA 2N78A 4B3MQ 4HIKA 4MV7A 4QJFA 4KHZA 5LL6b 1A8VA 3TQYA 3CCRA 1UE7A 3OYYA 2UUAH 4OXPA 2CCZA 2YTYA 2UXBL 3BJUA 4JI7H 3U50C 4DK6C 1XNRL 1IBML 2UUBQ 4POGA 4ETSA 4LH6A 1JJ2A 4DAMA 2F3IA 3CCJA 2CFMA 4L5QA 4UPAA 4JI5Q 1HNWQ 3NBYB 4DR1H 5BR8Q 5C0XG 4OO1G 4AYBE 4A75A 3TRZA 3M4QA 1UEBA 4MV9A 3RZDH 1SFOH 4DR4H 1Q12A 2YTXA 1JJGA 1XNRQ 1VQCA 3H3VH 3CMEA 3TY9A 4NXNH 1PH1A 2JEAI 5C3EG 4JI0Q 3PUXA 1VQMA 4DUZQ 3N40P 4JI5L 3UDXA 1HNWL 4LUZA 4JI1Q 3PO2H 1J5EH 3CCVA 4DUZL 1WI5A 1NJIC 3HOWG 4LF6H 4A3EG 3VDYA 2LXJA 5J3BA 5H1SE 3RLOA 4DV4Q 4DV2L 4LF4L 4X66L 3KALA 1X3FA 1SE8A 2ZJTA 4LF5H 1YVCA 1B8AA 1XMQH 4YWKA 1PHJA 4JOIC 4X6AH 5EOYA 4JI0H 2PI2A 1BBWA 3U4ZA 1GO3E 1XPRA 2JA8H 3S16H 3BZKA 4UP7A 3F2BA 2JA6H 3TY5A 4LF8H 1PH8A 4BY7G 4P75A 1A63A 4DR1L 1SEIA 4C2MH 1EFWA 2OQ0A 4BBSH 2VQEH 1SLJA 5IP7G 5BR8L 4A3FG 4LFCL 3F2CA 4Y7NH 4A3IH 2ALYB 3PO3H 2WAQG 2D0PA 1VQJA 2UXBH 3M9BA 4BBRH 4C3JH 1HNZQ 4A3LG 1QVFA 1GD7A 1BKBA 3ERSX 3F1ZA 1YHBA 5C4JH 2B63H 4X65H 3M4IA 1SRUA 3MEFA 3CC7A 4DR1Q 1Q7YC 1VQDA 2OTLA 4UY8C 1OXSC 1N33L 3HOYG 4JV5L 1Z2OX 2A1AA 4JI1L 1X9NA 1N36L 2K5VA 4AIMA 1XPUA 1V9PA 2KHJA 3S2DH 4LSXA 1CKMA 2R7ZG 4YCWA 2ES2A 2AWOA 3GDEA 3CCLA 2CW7A 1XMQQ 2PNHA 3HFZB 5D1OB 2QA4A 2UU9L 3TY8A 3J80i 3EN2A 5D1OA 3KAJA 1VS0A 3GJXB 4GKJH 4DV0Q 2XGTA 4B3MH 1EWIA 3U58A 3S14H 4B3RQ 1BJTA 4DUZH 3KJPA 4DV0H 1LTLA 4XTCS 4GLXA 3T1HL 2E8GA 3AFQA 1I6HH 4X65L 3HOWH 1JMCA 2Y0SG 4ME3A 2R92H 1IBKH 2HGSA 4JI3H 2MFIA 1C7YA 3PIOA 1S03G 4DV0L 4P71A 2EQSA 2ATWA 3K0XA 3OW2A 1X56A 1KD1C 2WP8J 2JA5H 1XTDA 1OXXK 4A3KH 3BABA 2AHOB 4MTDA 1MIUA 4LNQA 1PH2A 4JV5H 2ASBA 4BBSG 2ZJRA 2UXBQ 3BAAA 2JK8A 2NN6G 4DV7Q 1QVGA 4A4IA 1TAEA 3EIVA 4HIMA 2BA1A 2I0QA 4B3SQ 3H0GG 2UXCL 2HVRA 3NBHB 4JI8L 3HOXG 1L1OC 4O0AA 4X62H 4DR4L 4GS3A 2VNUD 1XMOL 4GN3B 1PYSB 1YJWA 4EFBA 4X64H 1OXUA 3C0FB 3KF6A 3CPWA 1X3GA 1SR3A 3UDIA 3H3VI 2CKZB 4LMYA 3J7ZC 3BZCA 4JI3Q 1VQAA 4XIGS 2VQFQ 1SYXB 2UXCQ 4E6NA 3J81W 1VQNA 2OQKA 4UCTA 3J7A5 3N41B 1NTGA 2DUDA 4HJAA 3CPFA 1B70B 1VQOA 2PMZE 1JE5A 3CAMA 4P74A 2F4VH 2I5HA 3J81c 4HIDA 3GTOH 2UXDQ 3KXYT 4AQYQ 4B3TL 1PH5A 4NXNQ 2RHSB 2KCTA 5LMNW 5FLXW 4DK3C 5IYBG 2R93H 2WE6A 2B3GA 3OTOQ 3HKSA 3HOZG 1O7IA 3ULLA 2NZHA 2JEBI 5BR8H 1ZHSA 4JI5H 1HNWH 4X64L 5A2QW 1GVPA 3TEHB 3G71A 3NELA 4BY7H 1K0RA 3F8NA 2K50A 3UDGA 3RLFA 1E4GT 4DV4L 2B29A 4LF4Q 5IY0A 2VUMH 1N33H 3BA8A 1HNZL 1NE3A 3H20A 2V1CC 4EFEA 1HNXL 2HHHL 4JG2A 3RNUA 4GOPA 4PZ7A 3RTXA 3L7ZC 4DV1Q 4DR6H 2K5HA 4BBRG 1M1KC 4A3LH 4JI0L 1TA8A 4APMA 3UE1A 4WJ4A 4QL5A 3K8AA 4JI4Q 4BWSC 3U4VA 1YBYA 3HOXH 1UE6A 4DV6Q 4UCVA 3NBZB 3MWMA 1EUJA 2AKWB 1V43A 4POFA 5M3MH 1MZBA 3CQZH 3GTQH 4GKJL 2XIGA 3RJ0A 2JE6I 4FDBA 2YU9H 1B7YB 4DV2Q 3CF5A 1K73C 4LFCQ 3T1YH 4NXNL 1EYGA 3ULJA 3K81C 3RN5A 1HH2P 1Y1VG 2UUCQ 3L2PA 4DR5H 5FPRA 4LF7H 1IBLQ 4NXMH 1AE3A 3OTOL 1VQGA 4MZ9A 3AEVA 4DV6L 3HOVH 2Y0SE 3PF4A 1MJEA 3RN2A 3J81j 5IYDG 5ELOA 1TWGH 2LSSA 3MXNB 1KAWA 3KLWA 1UWVA 1Z47A 1L2FA 4MNOA 5AJ3L 4DR7H 3LGJA 2VZAA 3STBC 5K36G 5LMUH 2KENA 1CKOA 4A3CG 4YHHH 4PMWA 1IXRA 2RHQB 2R93G 5JJLA 5DISC 4C3IH 2ID0A 1L0WA 2JA7G 4TQUS 3IRBA 2HVSA 1GYFA 1BVSA 2WFWA 1TWFH 1X3EA 5FD6A 4K0KH 1PH4A 1JB7A 4A93G 3TREA 1KHIA 4A3KG 2ZM6Q 4B3SL 3SGIA 4LH7A 3FMAA 4L5SA 2JQOA 1YJNA 3RF2A 4DKAC 3KFUA 4GKKH 1G291 3A5ZB 4DV3L 3HOUH 3J81i 5EAYA 4X66H 1RIPA 4HIOA 4AYBG 3S1QH 4OX9H 3DLLA 3K3VA 1A0IA 4JI6H 2A8VA 1N32H 2K14A 1YNXA 1Q81C 1FJGH 2BA0A 3PN1A 1XNQQ 4B3RL 3CP0A 1WCMG 4CC5A 4OWWB 3I4MH 4DV3H 4JYAH 2ZM6L 1L2ZA 1XNQL 3VNNA 4DV7L 3T1YL 2VW9A 1KXLA 2UU9H 5C0XJ 4P73A 1NY4A 1AE2A 5AJ3Q 3KJOA 1S40A 1VQIA 1FL0A 3G6EA 5M3FH 5JEAG 3T1YQ 4R4TA 4LF9Q 2WYOA 4UCSA 1KL9A 4QIWE 3STBD 2E5LQ 4M7EA 1XMOQ 1GKHA 2JA6G 4J15A 1WJJA 2E5LL 5FPOA 3I7FA 5GAEC 4AQYL 2YYZA 2AWNA 1Q1EA 3E9IA 5JEAJ 2PI2E 2E2HH 4B3TQ 3RGXA 4HJ7A 4IFDG 1NBWA 3KAKA 1S72A 3JSLA 3JAMW 1R9TH 3ER0A 2K4KA 3PO3G 2WB1E 4EX5A 2D62A 5M5WH 4RB2C 3J7AK 4IFDJ 1HR0Q 3CC4A 3S24A 4BY1H 3S17H 3N43B 3GO5A 4JI4L 3G4SA 1NMFA 2D0OA 1W2BA 3CC2A 1T9HA 3PSIA 3I2ZA 4DR6L 3L0OA 4PZ8A 1VQKA 2HT1A 3QWUA 4Q0YA 2RGRA 1HNXQ 2HHHQ 4A3DG 1U0LA 2I5LX 4GOPB 4JI3L 2OWOA 1P8LA 2ZJPA 3WWVA 1Z2NX 2F52A 2PQAB 3JAMc 1V1QA 1IBLL 4RAYA 2AMCB 5IYCG 1N32L 2FE3A 4JBMA 1Y1WG 3RR5A 3H15A 2H5XA 1AN7A 3A0JA 1S68A 1Z2PX 5M3MG 1KRTA 1RL2A 2NVYH 2IX0A 4NXMQ 1SROA 2NZOA 4LFAL 1E7ZA 1N9WA 3KOJA 5GROA 4P72A 3PUYA 3CXCA 4IFDI 2ZM6H 4LFAQ 4DV1L 3RLNA 1EIFA 3JC66 1C0AA 3F2DA 2Z0SA 2JA8G 5C44G 1N34L 4X64Q 1XJVA 1G6PA 2L15A 4DR7L 4LFAH 1N36Q 2JA5G 1JJCB 3UDFA 5M5XH 3ULPA 3W5OA 1YITA 1JT8A 1E3PA 3KYHC 5IP7H 3EBEA 1M90C 4DR6Q 4A3IG 3UE0A 1XPOA 5LMNQ 1I3QH 3FHWA 4LW1A 4YY3Q 1UE5A 1VQPA 4UFZA 2MNAA 3CVZA 3H0GH 4YWLA 5C0XI 4DUYQ 3K80C 3KF6B 2WAQE 4A76A 3HXLA 3TS2A 5ELNA 4BY1G 1VQ4A 3T1HQ 2JA7H 4RB3C 4HJ9A 1IBKL 2R7ZH 4A93H 1L1OA 1I94Q 1SN8A 1YZ6A 4A3DH 4LFCH 1L1OB 5DLQE 4RMFA 1I94L 4LWCA 2JJQA 1CSPA 4A3MH 3LMLA 4DR3Q 1N34H 4AH6A 1VQ8A 3JSNA 1HR0H 4JI6Q 3AQQA 4YY3H 5JJKA 1VQ7A 5IWAQ 4X62L 3TS0A 1OXVA 5IWAH 1LUZA 1VQFA 4A3BH 2IY5B 3PUVA 3JAMi 2UXCH 4HJ8A 3BU2A 3CCEA 1YHAA 4WJ3M 5GAGC 5LMNL 1C9OA 2IT1A 4JI8Q 4LF5L 4A3EH 4BXXG 3N6XA 4DR3L 1K8AC 2KCMA 4NB3A 4DV2H 4CC6A 3FP9A 3UQ8A 1Q46A 1E4FT 3D0FA 3I56A 1QUQA 1I94H 4IJLA 2YV5A 1HZCA 3D31A 2VQFL 4DRFA 3T1HH 1VQHA 4UP9A 1PH3A 1HR0L 4LFBL 1S3OA 2C35B 2VY3A 3E9HA 1EQRA 3PV0A 4DV3Q 3FKIH 1WOCA 2GVAA 5FLMG 4GNXB 2Q2UA 5IT9W 2F4VQ 1QZHA 3NENA 4A3FH 2MO0A 1PYBA 2F4VL 4DR5L 4OX9Q 3CCQA 4X66Q 1PH9A 1ASYA 4UCOA 5LMNH 4C3HH 4KI0A 4GOPC 4GKKL 2BH8A 4LF7Q 3GTMH 4KLKA 2B63G 5IWAL 5HGQA 3HOYH 3I4NG 3J80W 4A3GG 1N36H 3E0EA 1UE1A 2QGQA 4ALPA 4GLVB 4LF5Q 2MCTA 2ZTEA 1YI2A 1Q1BA 4DV4H 4L5TA 1N8RC 2GN5A 4JI8H 1HR0W 4YHHQ 1E24A 1VCIA 4A2AA 2R7DA 4DNIA 1LM0A 1PFSA 3M4OH 1KQSA 2NVTH 2BH2A 1KIXA 3I4NH 4R7RA 3GTJH 4RZQA 1M0TA 2WDTA 2DGYA 3PF5A 1QZGA 4LUVA 3PO2G 4LFBH 1MKHA 4JOIA 1X6OA 1HZ9A 1N34Q 1X55A 2YTVA 4Y52H 4DR3H 3G48A 4DAYB 3BA9A 1BGWA 4BXXH 1D7QA 4DPGA 4I7HA 3ZJYC 1I6UA 1H95A 2VL6A 5C4XH 2CWAA 3KDFB 5FD5A 4LF9H 3KF8B 3PUWA 4IPHA 2UU9Q 4R4CA 5IE8A 1HNXH 4EEQA 2HHHH 1HNZH 2GVBA 1IBKQ 1D8LA 4LF7L 4LF8Q 2VUMG 4JYAQ 4RAZA 4LUOA 3DM3A 4L5RC 3A74A 3HOUG 1FJGQ 4B3ML 2VS1A 3NEMA 1EOVA 2KHIA 4GNXA 4DUYH 1FVIA 1CSQA 3GD7A 1PH7A 1N32Q 2WB1G 2A19A 1VQLA 4JI4H 1WFQA 1Q8KA 1LYLA 1X54A 4DV5L 3PUZA 1VQBA 1J6QA 5LMUL 4LSAA 4RB1A 2K5NA 4IPDA 1HJPA 2I5MX 1B04A 3I4MG 2NVQH 3B6YA 5GQOA 1QVCA 3PIPA 1OTCA 4IJHA 3CMAA 4UCUA 1IZ6A 4K0KQ 1WH2A 4YY3L 4A3JG 1XMOH 2MQHA 4UCRA 2N8NA 4OWTB 4A3GH 3Q8DA 2CQOA 3AYHB 2IHEA 4JBJA 1GM5A 2HVQA 4A3MG 3I4OA 1U5KA 4X62Q 4BA2I 4IAJA 3L4JA 4DR7Q 3K7AH 5IYDH 4MTEA 2N49A 1TWAH 4IPCA 3N44B 1XNRH 1TXYA 1E22A 1TWCH 2R7FA 3HKZG 4DR4Q 3PGZA 1I5FA 2VQEQ 1XDNA 1Q86C 3GB8B 2CW8A 3N42B 1IYJB 4DUYL 3J80c 5FLXc 3HKZE 2R92G 1IBLH 1HZAA 1YHQA 4RB0A 1O75A 3HOZH 4PZ6A 4GKKQ 5IP9G 4LFBQ 4OWXB 2E2JH 1YJ9A 1CKNB 1Z9FA 4UP8A 2Q2HA 4GNXC 4LF9L 1FKAH 3GTPH 4TVAB 1IBMQ 1VQ9A 2UUBL 5IT9c 4APVA 4JBKA 3I55A 3AFPA 4B3RH 1I50H 3FKIG 5FLMH 5IYCH 4JI1H 3M3YH 2IHFA 4JCVE 2UXDL 4YHHL 1Y1WH 2YCHA 4DV1H 1ZHQA 4LF4H 4NPSA 4JI6L 1M0WA 2Z6KC 1G51A 2FXQA 2XTIA 1VQEA 1WCMH 5E7NA 4OONA 3K7UC 1PV4A 3S2HH 2R6GA 4DV7H 3RIZA 4KHPH 2Z6KA 2O03A 4DR2L 4JI2L 4B3TH 1XK5A 1PA6A 3L4KA 3A5UA 4JI2Q 4GN5A 4DR2Q 2W57A 3GTLH 1K8GA 2ZTDA 5JJIA 2K75A 1PVOA 2VUGA 4A3JH 2E5LH 1QUQB 1WYDA 4JBWA 2VQEL 1VQ5A 4YWMA 4DR5Q 4PG3A 4YCUA 3CCMA 4OX9L 1VQ6A 4JI2H 5FJ8H 4DR2H 2UUBH 1P16A 5HY6A 4DV5H 3W1BA 4JI7Q 4IOAA 2NN6I 2RF4A 4AQYH 3KDFA 2UUAQ 1IL2A 1XNQH 1HZBA 1E1OA 4MTNA 3W1GA 5D1PA 1KC8C 1YIJA 4DV6H 3S1RH 1Y14B 5M5YH 3CCUA 1ASZA 3CD6A 2PQAA 1KRSA 2Q2IA 2JA9A 3M4PA 1DGSA 2KBNA 4O2DA 4GKJQ 3RGZA 3F8TA 1IBMH 5IYBH 3CW2C 1K9MC 3EYYA 4LF8L 4GLAC 3PCOB 1SMXA 1NMGA 4RG1A 2UUCL 4JI7L 3S1NH 5C4XG 4A3CH 4J0MA 2VQFH 1Q82C 4NXML 3ICEA 2HQLA 4A2BA 3GTGH 2CWPA 5IP9H 4K0KL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPG A;  2EXD A;  2OTJ A;  1EQQ A;  4OO1 I;  4LF6 Q;  4QQB X;  4BA1 I;  3CCS A;  5LMU Q;  3M85 A;  4HJ5 A;  4X65 Q;  3S1M H;  1EIY B;  1CKN A;  2E2I H;  1W3S A;  4EQ5 A;  1A62 A;  4R1J A;  5C3E H;  4R4I A;  4YCV A;  2EIF A;  2MO1 A;  4KHP L;  2NVX H;  2K52 A;  1TWH H;  5GAD C;  4QY7 A;  1X65 A;  4A3B G;  3S15 H;  1E1T A;  4IO9 A;  2ZJQ A;  4JYA L;  2HIX A;  2LXK A;  2OCE A;  2UUA L;  1K83 H;  1N33 Q;  4JV5 Q;  5GAH C;  4LF6 L;  4GN4 B;  2RCN A;  1FJG L;  1AH9 A;  3NC0 B;  1CUK A;  2QEX A;  5C44 H;  4DV5 Q;  4QGU A;  1Y1V H;  1XMQ L;  3RZO H;  4JC0 A;  1PH6 A;  5M3F G;  1K3R A;  3M7N A;  4IOC A;  1YEZ A;  2IX1 A;  5FJ8 G;  4KHP Q;  2N3S A;  1FGU A;  2ZTC A;  3HOV G;  3GTK H;  1J5E L;  1MJC A;  4H02 A;  4R4O A;  4R4Q A;  2Q2T A;  1OXT A;  1J5E Q;  1BBU A;  2HIV A;  2N78 A;  4B3M Q;  4HIK A;  4QJF A;  4KHZ A;  1A8V A;  3TQY A;  3CCR A;  1UE7 A;  3OYY A;  4OXP A;  2CCZ A;  2YTY A;  2UXB L;  3BJU A;  3U50 C;  4DK6 C;  1XNR L;  1IBM L;  2UUB Q;  4POG A;  4LH6 A;  1JJ2 A;  4DAM A;  2F3I A;  3CCJ A;  2CFM A;  4L5Q A;  4UPA A;  4JI5 Q;  1HNW Q;  3NBY B;  5BR8 Q;  5C0X G;  4OO1 G;  4AYB E;  4A75 A;  3TRZ A;  3M4Q A;  1UEB A;  3RZD H;  1SFO H;  1Q12 A;  2YTX A;  1JJG A;  1XNR Q;  1VQC A;  3H3V H;  3CME A;  3TY9 A;  1PH1 A;  2JEA I;  5C3E G;  4JI0 Q;  3PUX A;  1VQM A;  4DUZ Q;  4JI5 L;  3UDX A;  1HNW L;  4LUZ A;  4JI1 Q;  3PO2 H;  3CCV A;  4DUZ L;  1WI5 A;  1NJI C;  3HOW G;  4A3E G;  3VDY A;  2LXJ A;  5J3B A;  5H1S E;  3RLO A;  4DV4 Q;  4DV2 L;  4LF4 L;  4X66 L;  1X3F A;  1SE8 A;  1YVC A;  1B8A A;  4YWK A;  1PHJ A;  4JOI C;  4X6A H;  2PI2 A;  1BBW A;  3U4Z A;  1GO3 E;  1XPR A;  2JA8 H;  3S16 H;  3BZK A;  4UP7 A;  3F2B A;  2JA6 H;  3TY5 A;  1PH8 A;  4BY7 G;  4P75 A;  1A63 A;  4DR1 L;  4C2M H;  1EFW A;  2OQ0 A;  4BBS H;  1SLJ A;  5IP7 G;  5BR8 L;  4A3F G;  4LFC L;  3F2C A;  4Y7N H;  4A3I H;  2ALY B;  3PO3 H;  2WAQ G;  2D0P A;  1VQJ A;  3M9B A;  4BBR H;  4C3J H;  1HNZ Q;  4A3L G;  1QVF A;  1GD7 A;  1BKB A;  3ERS X;  3F1Z A;  1YHB A;  5C4J H;  2B63 H;  1SRU A;  3MEF A;  3CC7 A;  4DR1 Q;  1Q7Y C;  1VQD A;  2OTL A;  4UY8 C;  1OXS C;  1N33 L;  3HOY G;  4JV5 L;  2A1A A;  4JI1 L;  1X9N A;  1N36 L;  2K5V A;  4AIM A;  1XPU A;  1V9P A;  2KHJ A;  3S2D H;  1CKM A;  2R7Z G;  4YCW A;  2ES2 A;  2AWO A;  3GDE A;  3CCL A;  1XMQ Q;  2PNH A;  3HFZ B;  5D1O B;  2QA4 A;  2UU9 L;  3TY8 A;  3J80 i;  3EN2 A;  5D1O A;  1VS0 A;  3GJX B;  4DV0 Q;  2XGT A;  1EWI A;  3U58 A;  3S14 H;  4B3R Q;  3KJP A;  1LTL A;  4XTC S;  4GLX A;  3T1H L;  2E8G A;  3AFQ A;  1I6H H;  4X65 L;  3HOW H;  1JMC A;  2Y0S G;  4ME3 A;  2R92 H;  2MFI A;  1C7Y A;  3PIO A;  4DV0 L;  4P71 A;  2EQS A;  2ATW A;  3K0X A;  3OW2 A;  1X56 A;  1KD1 C;  2WP8 J;  2JA5 H;  1XTD A;  1OXX K;  4A3K H;  3BAB A;  2AHO B;  1MIU A;  4LNQ A;  1PH2 A;  2ASB A;  4BBS G;  2ZJR A;  2UXB Q;  3BAA A;  2JK8 A;  2NN6 G;  4DV7 Q;  1QVG A;  4A4I A;  1TAE A;  3EIV A;  4HIM A;  2BA1 A;  2I0Q A;  4B3S Q;  3H0G G;  2UXC L;  2HVR A;  3NBH B;  4JI8 L;  3HOX G;  1L1O C;  4O0A A;  4DR4 L;  4GS3 A;  2VNU D;  1XMO L;  4GN3 B;  1PYS B;  1YJW A;  4EFB A;  1OXU A;  3KF6 A;  3CPW A;  1X3G A;  1SR3 A;  3UDI A;  3H3V I;  2CKZ B;  3J7Z C;  3BZC A;  4JI3 Q;  1VQA A;  4XIG S;  2VQF Q;  2UXC Q;  4E6N A;  1VQN A;  2OQK A;  4UCT A;  3J7A 5;  1NTG A;  2DUD A;  4HJA A;  3CPF A;  1B70 B;  1VQO A;  2PMZ E;  1JE5 A;  3CAM A;  4P74 A;  2I5H A;  3J81 c;  4HID A;  3GTO H;  2UXD Q;  4AQY Q;  4B3T L;  1PH5 A;  4NXN Q;  2RHS B;  2KCT A;  5LMN W;  4DK3 C;  5IYB G;  2R93 H;  2B3G A;  3OTO Q;  3HKS A;  3HOZ G;  1O7I A;  3ULL A;  2NZH A;  2JEB I;  4X64 L;  1GVP A;  3TEH B;  3G71 A;  3NEL A;  4BY7 H;  1K0R A;  2K50 A;  3UDG A;  3RLF A;  4DV4 L;  2B29 A;  4LF4 Q;  5IY0 A;  2VUM H;  3BA8 A;  1HNZ L;  1NE3 A;  2V1C C;  4EFE A;  1HNX L;  2HHH L;  4JG2 A;  3RNU A;  4GOP A;  4PZ7 A;  3RTX A;  3L7Z C;  4DV1 Q;  2K5H A;  4BBR G;  1M1K C;  4A3L H;  4JI0 L;  1TA8 A;  3UE1 A;  4WJ4 A;  4QL5 A;  3K8A A;  4JI4 Q;  3U4V A;  1YBY A;  3HOX H;  1UE6 A;  4DV6 Q;  4UCV A;  3NBZ B;  1EUJ A;  2AKW B;  1V43 A;  4POF A;  5M3M H;  3CQZ H;  3GTQ H;  4GKJ L;  2JE6 I;  4FDB A;  2YU9 H;  1B7Y B;  4DV2 Q;  3CF5 A;  1K73 C;  4LFC Q;  4NXN L;  1EYG A;  3ULJ A;  3K81 C;  3RN5 A;  1HH2 P;  1Y1V G;  2UUC Q;  3L2P A;  5FPR A;  1IBL Q;  1AE3 A;  3OTO L;  1VQG A;  4MZ9 A;  3AEV A;  4DV6 L;  3HOV H;  2Y0S E;  3PF4 A;  1MJE A;  3RN2 A;  3J81 j;  5IYD G;  5ELO A;  1TWG H;  2LSS A;  3MXN B;  1KAW A;  3KLW A;  1UWV A;  1Z47 A;  1L2F A;  4MNO A;  5AJ3 L;  3LGJ A;  2VZA A;  3STB C;  5K36 G;  2KEN A;  1CKO A;  4A3C G;  4PMW A;  1IXR A;  2RHQ B;  2R93 G;  5JJL A;  5DIS C;  4C3I H;  2ID0 A;  1L0W A;  2JA7 G;  4TQU S;  3IRB A;  2HVS A;  1BVS A;  2WFW A;  1TWF H;  1X3E A;  1PH4 A;  1JB7 A;  4A93 G;  3TRE A;  1KHI A;  4A3K G;  2ZM6 Q;  4B3S L;  3SGI A;  4LH7 A;  4L5S A;  2JQO A;  1YJN A;  4DKA C;  3KFU A;  1G29 1;  3A5Z B;  4DV3 L;  3HOU H;  3J81 i;  5EAY A;  1RIP A;  4HIO A;  4AYB G;  3S1Q H;  3DLL A;  1A0I A;  2A8V A;  2K14 A;  1YNX A;  1Q81 C;  2BA0 A;  3PN1 A;  1XNQ Q;  4B3R L;  3CP0 A;  1WCM G;  4CC5 A;  4OWW B;  3I4M H;  2ZM6 L;  1XNQ L;  3VNN A;  4DV7 L;  3T1Y L;  2VW9 A;  1KXL A;  5C0X J;  4P73 A;  1NY4 A;  1AE2 A;  5AJ3 Q;  3KJO A;  1S40 A;  1VQI A;  1FL0 A;  3G6E A;  5M3F H;  5JEA G;  3T1Y Q;  4R4T A;  4LF9 Q;  4UCS A;  1KL9 A;  4QIW E;  3STB D;  2E5L Q;  1XMO Q;  1GKH A;  2JA6 G;  4J15 A;  1WJJ A;  2E5L L;  5FPO A;  3I7F A;  5GAE C;  4AQY L;  2YYZ A;  2AWN A;  1Q1E A;  3E9I A;  5JEA J;  2PI2 E;  2E2H H;  4B3T Q;  4HJ7 A;  4IFD G;  1NBW A;  1S72 A;  3JSL A;  1R9T H;  3ER0 A;  2K4K A;  3PO3 G;  2WB1 E;  4EX5 A;  2D62 A;  5M5W H;  4IFD J;  1HR0 Q;  3CC4 A;  3S24 A;  4BY1 H;  3S17 H;  3GO5 A;  4JI4 L;  3G4S A;  1NMF A;  2D0O A;  1W2B A;  3CC2 A;  1T9H A;  3PSI A;  3I2Z A;  4DR6 L;  3L0O A;  4PZ8 A;  1VQK A;  2HT1 A;  3QWU A;  1HNX Q;  2HHH Q;  4A3D G;  1U0L A;  2I5L X;  4GOP B;  4JI3 L;  2OWO A;  1P8L A;  2ZJP A;  3WWV A;  2F52 A;  2PQA B;  3JAM c;  1V1Q A;  1IBL L;  2AMC B;  5IYC G;  1N32 L;  4JBM A;  1Y1W G;  3RR5 A;  3H15 A;  2H5X A;  3A0J A;  1S68 A;  5M3M G;  1KRT A;  1RL2 A;  2NVY H;  2IX0 A;  4NXM Q;  1SRO A;  2NZO A;  4LFA L;  1E7Z A;  1N9W A;  3KOJ A;  5GRO A;  4P72 A;  3PUY A;  3CXC A;  4IFD I;  4LFA Q;  4DV1 L;  3RLN A;  1EIF A;  3JC6 6;  1C0A A;  3F2D A;  2Z0S A;  2JA8 G;  5C44 G;  1N34 L;  4X64 Q;  1XJV A;  1G6P A;  2L15 A;  4DR7 L;  1N36 Q;  2JA5 G;  1JJC B;  3UDF A;  5M5X H;  3ULP A;  3W5O A;  1YIT A;  1JT8 A;  1E3P A;  3KYH C;  5IP7 H;  3EBE A;  1M90 C;  4DR6 Q;  4A3I G;  3UE0 A;  1XPO A;  5LMN Q;  1I3Q H;  3FHW A;  4LW1 A;  4YY3 Q;  1UE5 A;  1VQP A;  4UFZ A;  2MNA A;  3H0G H;  4YWL A;  5C0X I;  4DUY Q;  3K80 C;  3KF6 B;  2WAQ E;  4A76 A;  3TS2 A;  5ELN A;  4BY1 G;  1VQ4 A;  3T1H Q;  2JA7 H;  4HJ9 A;  1IBK L;  2R7Z H;  4A93 H;  1L1O A;  1I94 Q;  1SN8 A;  1YZ6 A;  4A3D H;  1L1O B;  5DLQ E;  4RMF A;  1I94 L;  4LWC A;  2JJQ A;  1CSP A;  4A3M H;  4DR3 Q;  4AH6 A;  1VQ8 A;  3JSN A;  4JI6 Q;  3AQQ A;  5JJK A;  1VQ7 A;  5IWA Q;  4X62 L;  3TS0 A;  1OXV A;  1LUZ A;  1VQF A;  4A3B H;  2IY5 B;  3PUV A;  3JAM i;  4HJ8 A;  3BU2 A;  3CCE A;  1YHA A;  4WJ3 M;  5GAG C;  5LMN L;  1C9O A;  2IT1 A;  4JI8 Q;  4LF5 L;  4A3E H;  4BXX G;  4DR3 L;  1K8A C;  2KCM A;  4NB3 A;  4CC6 A;  3FP9 A;  3UQ8 A;  1Q46 A;  3D0F A;  3I56 A;  1QUQ A;  4IJL A;  2YV5 A;  1HZC A;  3D31 A;  2VQF L;  4DRF A;  1VQH A;  4UP9 A;  1PH3 A;  1HR0 L;  4LFB L;  1S3O A;  2C35 B;  2VY3 A;  3E9H A;  1EQR A;  3PV0 A;  4DV3 Q;  3FKI H;  1WOC A;  2GVA A;  5FLM G;  4GNX B;  2Q2U A;  2F4V Q;  1QZH A;  3NEN A;  4A3F H;  2MO0 A;  1PYB A;  2F4V L;  4DR5 L;  4OX9 Q;  3CCQ A;  4X66 Q;  1PH9 A;  1ASY A;  4UCO A;  4C3H H;  4KI0 A;  4GOP C;  4GKK L;  2BH8 A;  4LF7 Q;  3GTM H;  4KLK A;  2B63 G;  5IWA L;  5HGQ A;  3HOY H;  3I4N G;  4A3G G;  3E0E A;  1UE1 A;  2QGQ A;  4ALP A;  4GLV B;  4LF5 Q;  2ZTE A;  1YI2 A;  1Q1B A;  4L5T A;  1N8R C;  2GN5 A;  1HR0 W;  4YHH Q;  1E24 A;  1VCI A;  2R7D A;  4DNI A;  1LM0 A;  1PFS A;  3M4O H;  1KQS A;  2NVT H;  2BH2 A;  1KIX A;  3I4N H;  3GTJ H;  2DGY A;  3PF5 A;  1QZG A;  4LUV A;  3PO2 G;  1MKH A;  4JOI A;  1X6O A;  1HZ9 A;  1N34 Q;  1X55 A;  2YTV A;  4Y52 H;  3G48 A;  4DAY B;  3BA9 A;  4BXX H;  1D7Q A;  4DPG A;  3ZJY C;  1H95 A;  2VL6 A;  5C4X H;  2CWA A;  3KDF B;  3KF8 B;  3PUW A;  4IPH A;  2UU9 Q;  4R4C A;  5IE8 A;  4EEQ A;  2GVB A;  1IBK Q;  1D8L A;  4LF7 L;  4LF8 Q;  2VUM G;  4JYA Q;  4LUO A;  3DM3 A;  4L5R C;  3A74 A;  3HOU G;  1FJG Q;  4B3M L;  2VS1 A;  3NEM A;  1EOV A;  2KHI A;  4GNX A;  1FVI A;  1CSQ A;  3GD7 A;  1PH7 A;  1N32 Q;  2WB1 G;  2A19 A;  1VQL A;  1WFQ A;  1Q8K A;  1LYL A;  1X54 A;  4DV5 L;  3PUZ A;  1VQB A;  1J6Q A;  5LMU L;  2K5N A;  4IPD A;  1HJP A;  2I5M X;  1B04 A;  3I4M G;  2NVQ H;  3B6Y A;  5GQO A;  1QVC A;  3PIP A;  1OTC A;  4IJH A;  3CMA A;  4UCU A;  1IZ6 A;  4K0K Q;  4YY3 L;  4A3J G;  2MQH A;  4UCR A;  2N8N A;  4OWT B;  4A3G H;  3Q8D A;  2CQO A;  3AYH B;  2IHE A;  4JBJ A;  1GM5 A;  2HVQ A;  4A3M G;  3I4O A;  1U5K A;  4X62 Q;  4BA2 I;  4DR7 Q;  3K7A H;  5IYD H;  2N49 A;  1TWA H;  4IPC A;  1TXY A;  1E22 A;  1TWC H;  2R7F A;  3HKZ G;  4DR4 Q;  3PGZ A;  1I5F A;  2VQE Q;  1XDN A;  1Q86 C;  3GB8 B;  1IYJ B;  4DUY L;  3J80 c;  5FLX c;  3HKZ E;  2R92 G;  1HZA A;  1YHQ A;  3HOZ H;  4PZ6 A;  4GKK Q;  5IP9 G;  4LFB Q;  4OWX B;  2E2J H;  1YJ9 A;  1CKN B;  1Z9F A;  4UP8 A;  2Q2H A;  4GNX C;  4LF9 L;  3GTP H;  4TVA B;  1IBM Q;  1VQ9 A;  2UUB L;  5IT9 c;  4APV A;  4JBK A;  3I55 A;  3AFP A;  1I50 H;  3FKI G;  5FLM H;  5IYC H;  3M3Y H;  2IHF A;  4JCV E;  2UXD L;  4YHH L;  1Y1W H;  4NPS A;  4JI6 L;  2Z6K C;  1G51 A;  2FXQ A;  2XTI A;  1VQE A;  1WCM H;  5E7N A;  4OON A;  3K7U C;  1PV4 A;  3S2H H;  2R6G A;  2Z6K A;  4DR2 L;  4JI2 L;  1XK5 A;  1PA6 A;  3A5U A;  4JI2 Q;  4GN5 A;  4DR2 Q;  3GTL H;  1K8G A;  2ZTD A;  5JJI A;  2K75 A;  1PVO A;  2VUG A;  4A3J H;  1QUQ B;  1WYD A;  4JBW A;  2VQE L;  1VQ5 A;  4YWM A;  4DR5 Q;  4PG3 A;  4YCU A;  3CCM A;  4OX9 L;  1VQ6 A;  5FJ8 H;  1P16 A;  5HY6 A;  3W1B A;  4JI7 Q;  4IOA A;  2NN6 I;  2RF4 A;  3KDF A;  2UUA Q;  1IL2 A;  1HZB A;  1E1O A;  4MTN A;  3W1G A;  5D1P A;  1KC8 C;  1YIJ A;  3S1R H;  1Y14 B;  5M5Y H;  3CCU A;  1ASZ A;  3CD6 A;  2PQA A;  1KRS A;  2Q2I A;  2JA9 A;  3M4P A;  1DGS A;  2KBN A;  4O2D A;  4GKJ Q;  3F8T A;  5IYB H;  3CW2 C;  1K9M C;  4LF8 L;  4GLA C;  3PCO B;  1SMX A;  1NMG A;  4RG1 A;  2UUC L;  4JI7 L;  3S1N H;  5C4X G;  4A3C H;  1Q82 C;  4NXM L;  3ICE A;  2HQL A;  3GTG H;  2CWP A;  5IP9 H;  4K0K L; 
#chains in the Genus database with same CATH topology
 2EXD A;  1EQQ A;  2K01 A;  4O3S A;  4J6H A;  4QQB X;  2UVV A;  2K5Q A;  5LMU Q;  2RDH A;  1H9S B;  1CKN A;  2E2I H;  2VOB A;  1A62 A;  1DYQ A;  5C3E H;  4B3S H;  3E5N A;  3VYU A;  5KYL A;  4KHP L;  2EY2 A;  2NVX H;  5GAD C;  3K5M A;  4PDB A;  3J7A V;  4IO9 A;  3NC0 B;  2LXK A;  1SFO A;  1K83 H;  1WD0 A;  2COJ A;  4J9K A;  3E3X A;  4FE2 A;  1CK1 A;  1WTV A;  4FM9 A;  3GTP B;  3NUA A;  4O3P A;  2YYA A;  1HA6 A;  4IOC A;  4KHP Q;  1FGU A;  2ZTC A;  3HOV G;  1J5E L;  3KBX A;  1CT1 D;  4TV8 F;  4B3M Q;  4IFD H;  4HIK A;  4ECZ A;  4KHZ A;  5LL6 b;  3OSN A;  3OYY A;  2UUA H;  1S5C D;  5KFM A;  2CCZ A;  2HCC A;  3I3C A;  1LAC A;  3TN2 A;  2UUB Q;  1A0G A;  1JJ2 A;  4MV1 A;  4L5Q A;  4UPA A;  3H6M A;  5I9O A;  2N88 A;  4ZHQ F;  4A75 A;  1DAA A;  3M4Q A;  5IIF A;  2R93 B;  1UEB A;  4DR4 H;  4DA2 A;  3S16 B;  4CKB A;  4ZRZ A;  2H4O A;  3CME A;  2R8K A;  3DAA A;  5C3E G;  2BOS A;  3PUX A;  1K0S A;  2F4I A;  2Y4R A;  2A6E D;  3D4W A;  3A7A B;  4XT1 B;  4JI1 Q;  3UDX A;  4LF6 H;  3IN5 A;  4DV2 L;  1YVC A;  4JPB W;  3TDQ A;  4J1M A;  4JI3 H;  2XVS A;  4X6A H;  5COR A;  3D4D A;  1OBD A;  2PI2 A;  1BBW A;  4C5A A;  4CE5 A;  3S16 H;  3F2B A;  3G7L A;  4BY7 G;  2F03 A;  3LNN A;  4RNM A;  4U67 3;  4C2M H;  5KT7 A;  1KJI A;  1PXU A;  5IP7 G;  1EKF A;  4O2B F;  4A3F G;  4LFC L;  3GTL A;  4Y7N H;  1E0B A;  2UXB H;  4BBR H;  1SAP A;  1HNZ Q;  2NYZ D;  1BKB A;  4FS2 A;  4FFP A;  1YHB A;  4X65 H;  3RMH A;  2B63 H;  1EQT A;  2COG A;  3MEF A;  3OMC A;  4JV5 L;  1ZET A;  1OXS C;  3TSS A;  2A1A A;  4MV8 A;  4AIM A;  1S0M A;  5H80 A;  2G9D A;  2ZGI A;  1V1P A;  1XMQ Q;  2OH2 A;  1W6K A;  1ILP A;  3KAJ A;  2KJX A;  4DV0 Q;  4GKJ H;  5EWE A;  1JX4 A;  1ESF A;  3S14 H;  3SK4 A;  3MXN A;  5CBE E;  3EPI A;  3CRK C;  4GLX A;  4TM5 A;  4MIU A;  3AFQ A;  3QIA A;  4JUZ A;  1STN A;  2L1B A;  2NZ1 D;  4ME3 A;  4K2K A;  1CI3 M;  3SHL A;  5EKI A;  2FKL A;  3PIO A;  1D1I A;  4DV0 L;  1G6Z A;  5CA1 F;  5J2U F;  5FKA C;  3K0X A;  3OW2 A;  5KFS A;  2K32 A;  1OXX K;  4A3K H;  2AHO B;  3V6H A;  1MIU A;  2V9W A;  1T3N A;  1QVG A;  3BQ2 A;  3GLK A;  3EIV A;  4HIM A;  1RF2 D;  1C8C A;  4MV3 A;  2EJ2 A;  1QE6 A;  4ODG A;  1XMO L;  1PYS B;  4EFB A;  5I5V A;  1VMP A;  1X3G A;  4LMY A;  2V59 A;  5C0X H;  4LAA A;  3V05 A;  4Q8F A;  2OQK A;  1G8Z D;  3N41 B;  4KJN A;  5KFE A;  1NTG A;  3RB3 A;  4O86 A;  1JDE A;  2WB1 A;  1VQO A;  2O5I C;  2ASD A;  1TU2 B;  2WIN B;  3CAM A;  2IBK A;  3J81 c;  3RD4 A;  4EBE A;  1VKZ A;  2CQA A;  4K5X A;  2RHS B;  4ZYS A;  5IYB G;  1T94 A;  3HKS A;  3VYT A;  3JAM L;  2NZH A;  4NMZ A;  1ZYR D;  2F3W A;  3TEH B;  2QIL A;  3UDG A;  2VUM B;  1A15 A;  1BR9 A;  2K33 A;  2HHH L;  2R7K A;  2A6H C;  4DR6 H;  3Q1K A;  2K5H A;  4HED A;  4A3L H;  1TA8 A;  1FD7 D;  3VPB A;  2HHF A;  3UE1 A;  4APM A;  4QL5 A;  2PBZ A;  1EUJ A;  2AKW B;  5C6A A;  4POF A;  1TKW B;  5E3F A;  5I47 A;  2XIG A;  2JE6 I;  4FDB A;  2YU9 H;  1B7Y B;  4DV2 Q;  2EOT A;  4PBC A;  3T53 B;  5FLX E;  4NXN L;  4F4Z A;  3RN5 A;  1HH2 P;  4ECU A;  2F0W A;  1G2W A;  5FPR A;  2CVR A;  2F3V A;  4MZ9 A;  3AEV A;  5KKN B;  4DV6 L;  1OWT A;  4JVZ A;  3RN2 A;  3JZI A;  3QOJ A;  1Z47 A;  3HP3 A;  4MNO A;  5AJ3 L;  2V4Q A;  4RU9 A;  3BQ1 A;  3STB C;  5K36 G;  2RSN A;  3RFC A;  2KEN A;  5LMU H;  2PW7 A;  1CKO A;  2IWH A;  3VA7 A;  3SE7 A;  1DCZ A;  3HGB A;  3A55 A;  4C3I H;  5DGB A;  2HVS A;  1SMY C;  3IRB A;  3PR5 B;  2WFW A;  1SE2 A;  4R9W A;  5ELB A;  4HYK A;  2ZM6 Q;  5KG6 A;  3SGI A;  1M4V A;  1GUS A;  3A5Z B;  4DV3 L;  2JA5 B;  5JOB A;  3ERQ A;  1LTR D;  1I1K A;  1RIP A;  3IFD A;  4O7W A;  4X66 H;  1RYS A;  3DLL A;  3D4R A;  2BDN A;  1Q81 C;  3T4A C;  1FJG H;  3W3A A;  1XNQ Q;  4O84 A;  1EZ8 A;  1RK6 A;  3BZD B;  3T1Y L;  1LT4 D;  3PMF A;  1NY4 A;  1S40 A;  2E2J B;  1E4G T;  1FL0 A;  3ZYY X;  5JEA G;  4R4T A;  4UCS A;  4M7E A;  2W6Z A;  2D9U A;  3SR1 A;  5L1K A;  5M5X B;  2E5L L;  5FPO A;  1EYC A;  1KEE A;  1WTP A;  3NHH A;  2FMA A;  4HJ7 A;  2PN1 A;  1NBW A;  3S2H B;  4Q44 A;  2X0S A;  2K4K A;  2X69 A;  3PO3 G;  2R92 B;  5M5W H;  3R5F A;  4PQX A;  3WNZ A;  4A3E B;  4IFD J;  1AN8 A;  1X3P A;  5KX5 F;  1I4R A;  1W2B A;  5FOB B;  3D6W A;  5HV6 A;  2FLL A;  2EY6 A;  1K1S A;  2HHH Q;  3HOZ B;  4A3D G;  1EKP A;  4JI3 L;  1TWA A;  2W9B A;  2YS7 A;  4YP3 A;  2SNM A;  2B8G A;  1Y69 U;  1TWG A;  5HUR A;  4RAY A;  3ONA B;  1N32 L;  2FE3 A;  1V8Q A;  1Y1W G;  1EWH A;  1TWC A;  1GSA A;  1S68 A;  4CDC C;  3R2T A;  1Z2P X;  1RL2 A;  5DGH A;  1VAJ A;  1N9W A;  3KOJ A;  1QB5 D;  3G6X A;  3JC6 6;  1C0A A;  3F2D A;  2Z0S A;  2I8C A;  2JA8 G;  4O4H F;  1X3Q A;  1PTO D;  1N34 L;  1G6P A;  2L15 A;  4DR7 L;  3MFH A;  2JA5 G;  3HOX B;  3W5O A;  1JT8 A;  4DR6 Q;  1ILQ A;  1B2T A;  1I3Q H;  4H0L C;  3LWE A;  4LW1 A;  3MFG A;  2DWC A;  3GTO A;  5IYZ F;  5EWG A;  3A8I E;  3MR6 A;  2F0P A;  3K80 C;  2WAQ E;  3Q8R B;  4ME5 A;  2JEJ A;  4N9T A;  5ELN A;  4NYE A;  3OHA A;  4KTA A;  4E6I A;  2JA7 H;  2SOB A;  3P1H A;  4BY7 B;  3R5H A;  4ME6 A;  1TS5 A;  2XRS D;  4DNR B;  1IBK L;  1ZKO A;  1YZ6 A;  3LP8 A;  4XQN A;  1EZ6 A;  1I94 L;  4LWC A;  2JJQ A;  3LML A;  2EYP A;  2W70 A;  3KHR A;  2BQU A;  3T9F A;  2A1H A;  3JSN A;  4FFR A;  4JI6 Q;  3AQQ A;  3DEO A;  1KLG D;  1LTT D;  3A54 A;  5IWA Q;  1AEX A;  2W6O A;  1D5Z C;  2CQY A;  1VQF A;  2IY5 B;  5IWA H;  4DL3 A;  3PUV A;  3FRP B;  3BU2 A;  3VOT A;  1O7Z A;  4LF5 L;  5LMN L;  1C9O A;  2IT1 A;  2CW0 D;  4A3E H;  5CYU A;  3QOL A;  4DR3 L;  3N6X A;  1K8A C;  5DG9 A;  2KCM A;  2ZDG A;  4CC6 A;  2A69 D;  1E4F T;  4EQN A;  3D0F A;  3FVQ A;  5C1P A;  4V19 0;  5JVG 3;  1TWA B;  4DXG A;  1LAB A;  4DRF A;  3T1H H;  1VQH A;  1HR0 L;  4LFB L;  2NB0 A;  2VY3 A;  4DV3 Q;  2IW3 A;  5IT9 E;  4BS9 A;  5DG8 A;  4O7N A;  2IPK D;  1QZH A;  1S5F D;  2EIY A;  1BXT A;  2JA5 A;  5HNE A;  2XGP A;  4IN3 A;  4OX9 Q;  4IUN A;  3SXH A;  2UVU A;  1TWH B;  1Y1V A;  5EGT A;  1J8I A;  2RDI A;  1TS2 A;  3HOY H;  3I4N G;  3HBL A;  4A3G G;  3MTS A;  1LT3 D;  4ALP A;  2KVM A;  4L5T A;  3I4L A;  1N8R C;  4IAL A;  2PO4 A;  2OF1 A;  2FPP B;  3GTK A;  3V4S A;  4K6D A;  4RGT A;  4RZQ A;  4TKO B;  2DGY A;  2G9H D;  3PO2 G;  2DNE A;  5EPK A;  4BBS B;  1HZ9 A;  4Y52 H;  3G48 A;  4DPG A;  5CM0 A;  2LKV A;  3RZO B;  1EZ1 A;  4F4X A;  2J6T A;  5IE8 A;  3MWE A;  1HNX H;  2R7Z A;  4O1N A;  3J81 L;  1O7Y A;  2COI A;  4QW9 A;  2Z4I A;  4LUO A;  4F4W A;  3A74 A;  3HOU G;  1B44 D;  4GNX A;  1DD2 A;  4OEL B;  1PH7 A;  1VQL A;  3OW7 A;  1Q8K A;  4JK1 C;  3M7G A;  1X54 A;  4IRC A;  3PUZ A;  1VQB A;  1I3Q B;  3KUP A;  2K5N A;  4NKL A;  2I5M X;  1B33 N;  4O82 A;  4HR7 A;  3B6Y A;  4UCU A;  4I7Z C;  4JXU A;  3X3M A;  2B2W A;  5KRU A;  1XMO H;  4YR3 A;  4A3G H;  2CQO A;  2RA4 A;  3PW4 A;  3AYH B;  2HVQ A;  5KIX A;  4A3M G;  1M7J A;  1PFN A;  4IAJ A;  3L4J A;  1E2V A;  2KOL A;  2W6Q A;  4YJ3 F;  3MZ5 A;  4G3I A;  3TQ1 A;  2ASJ A;  2EVB A;  2JYO A;  3HKZ G;  3S1Q B;  5EBC A;  1I5F A;  3IFT A;  5BWX A;  1R4P B;  4C3H B;  3J80 c;  4DUY L;  3G8C A;  5D3I B;  3QZ8 A;  2XNA C;  4BBR B;  1O75 A;  3HOZ H;  4HMJ A;  3TP7 A;  2JXM B;  2E2J H;  2FK1 A;  1Z7T A;  5KFL A;  4LF9 L;  1F9P A;  1JDB B;  1IBM Q;  1S97 A;  2B8F A;  5IT9 c;  4A3M B;  3G6Y A;  4KMU C;  3S15 B;  1GUT A;  1JWU D;  4JCV E;  3S1R B;  3UI2 A;  2UXD L;  1KJ8 A;  3WWH A;  1ZHQ A;  4DV1 H;  3K5I A;  4JI6 L;  1M0W A;  1G51 A;  2JP1 A;  3H0G A;  4JI0 H;  1VQE A;  1WCM H;  4OON A;  2B2W C;  3K7U C;  3T9C A;  1KC7 A;  4KHP H;  2Z6K A;  4NDX A;  5T1G A;  4JI2 L;  2M05 A;  5KFA A;  2O4X A;  4B3T H;  3L4K A;  3A5U A;  2FPI B;  4GN5 A;  4DQN A;  3MR3 A;  2M2L A;  2VPQ A;  2VUG A;  2E5L H;  2K75 A;  2PNR C;  1PVO A;  1B50 A;  1CQJ B;  1VQ5 A;  1V51 A;  4DR5 Q;  4DR2 H;  4ECR A;  5A35 A;  3J7Y W;  3PIP 3;  4FFO A;  5K5P A;  3W1B A;  2NU9 B;  3MHB A;  2W9C A;  5C5M A;  3SK6 A;  1SJE D;  4MTN A;  1ICF B;  3W1G A;  3URY A;  4K6L A;  1SXT A;  2JA9 A;  4RH6 A;  3NTK A;  5BWU A;  5CV4 A;  1C4Q A;  4O83 A;  1PZI D;  1IBM H;  5IYB H;  3S1N H;  1NMG A;  4JI7 L;  4HSP A;  2VQF H;  1B1Z A;  3T9E A;  1Q82 C;  3S14 B;  5M3F B;  3EFX D;  4X3S A;  5DEH A;  4IPG A;  3I72 A;  2WKC A;  2YL2 A;  1W96 A;  4C2M A;  2FB9 A;  2QKI C;  4LF6 Q;  4BA1 I;  3S1M H;  3M85 A;  4CHI A;  1KDC A;  2VXW A;  2AQ3 B;  1U9R A;  4FO2 A;  5KFT A;  2K52 A;  3GTM B;  1XWE A;  4JYA L;  2OCE A;  2UUA L;  1N33 Q;  5KFV A;  1WSC A;  5EZY F;  4LF6 L;  3OIQ A;  1AH9 A;  3FDT A;  4MV4 A;  3DWQ A;  1XMQ L;  4IUP A;  4JC0 A;  1MGS A;  2EYF A;  1SYD A;  2E2I B;  2RGV A;  4F88 A;  1GOZ A;  3WO1 A;  1MJC A;  3T5J A;  3V2T A;  1J5E Q;  1BBU A;  3RAQ A;  2N78 A;  3QB3 A;  3R9R A;  4FF3 A;  3I4N B;  3GTJ A;  2FMC A;  4JI7 H;  1CA5 A;  3BJU A;  2K5W A;  1I3Q A;  4EGV A;  1IBM L;  3N52 A;  4LH6 A;  5J22 A;  4O7Z A;  4HQ6 A;  2F3I A;  3CCJ A;  3V4Z A;  5KNB A;  4JI5 Q;  1HNW Q;  5KG0 A;  1A3V A;  3TQT A;  4ECW A;  4DR1 H;  5BR8 Q;  4OO1 G;  4X3K A;  2NVX A;  5E1F A;  4ABN A;  4HN7 A;  3C3L A;  3TRZ A;  2EYL A;  4ZCK A;  5CMD A;  1SCU B;  2ABJ A;  2R6F A;  1Q12 A;  3K5L A;  4ED7 A;  3R2I A;  2NVY A;  3IAY A;  1VQC A;  3H3V H;  2J9G A;  3TIG A;  2RDJ A;  2JEA I;  4YJ2 F;  4Q5V A;  2NU8 B;  1RDP D;  1VQM A;  4NLG A;  4JI5 L;  1HNW L;  4EG0 A;  3CCV A;  1NJI C;  1MBY A;  2A68 C;  3TME A;  4ECS A;  4YR2 A;  1YNJ C;  5H1S E;  4J8Q A;  5EPJ A;  1C30 A;  4X66 L;  1N48 A;  2V5A A;  1XMQ H;  5EDW A;  3S2D B;  1SMY D;  4LFB H;  3FMC A;  5F9N A;  3U4Z A;  1GO3 E;  4G7H C;  3TY5 A;  1LTA D;  3SE0 A;  2JA6 H;  1PH8 A;  5T1I A;  1A63 A;  2B2U C;  3V96 A;  2DN8 A;  4O7R A;  4CKC A;  1L0X B;  4QF4 A;  4A3I H;  2QCP X;  3HEJ A;  4AYB B;  2D0P A;  4A3L G;  2RBM A;  1GD7 A;  3F1Z A;  1R4Q B;  3M4I A;  3MXG A;  1SRU A;  3CC7 A;  2OTL A;  2YRW A;  4TQR A;  1I4Q A;  1X9N A;  3S2D H;  2KHJ A;  2D5D A;  3H4B A;  1EY7 A;  4ED3 A;  3KTM A;  3HFZ B;  1BO0 A;  2A6E C;  3TY8 A;  3J80 i;  1LTB D;  1S0O A;  1ET0 A;  3GJX B;  2WB1 B;  2XGT A;  1EYD A;  1EWI A;  3U58 A;  1I4H A;  4B3R Q;  3HG9 A;  4XTC S;  4ZUJ A;  5BYB A;  2E8G A;  5HBR B;  4OGQ C;  3HOW H;  2F0J A;  1JMC A;  1DV1 A;  5DM6 3;  5I4D A;  1L0Y B;  4A93 B;  5KFP A;  2MPM A;  2SDF A;  1CZW A;  4P71 A;  2NUA B;  1X56 A;  4DK1 A;  4NZN A;  2FHT A;  2NWG A;  4K14 A;  3NBH A;  3ITP A;  4JV5 H;  3BAB A;  1EIH A;  2R8I A;  5I2Y A;  3SDZ A;  4TV9 F;  2ZJR A;  3BAA A;  2NN6 G;  4DV7 Q;  4WD3 A;  4A4I A;  3DTG A;  4Y7N B;  1WTO A;  5BYA A;  4ECT A;  4EQO A;  1L1O C;  3CKI B;  1FNW A;  4GS3 A;  2HDL A;  4GN3 B;  4I7A A;  1YJW A;  4X64 H;  1OXU A;  2JA6 B;  1LV9 A;  3H3V I;  3ORR A;  3K57 A;  5M9O A;  5IT9 L;  1VQA A;  2FFK B;  2EYO A;  4XIG S;  2PQE A;  3JRX A;  1AP0 A;  2RSO A;  1IOW A;  5KFY A;  2F0E A;  1U4L A;  4FNF A;  4F7X A;  3J7A 5;  3CQZ A;  3GTQ A;  2PMZ E;  2Q7D A;  2Z04 A;  4P74 A;  2F4V H;  2I5H A;  5L9X A;  2F0I A;  3KXY T;  3VR3 A;  4AQY Q;  1PH5 A;  2KHS A;  3SVM A;  2GA4 B;  3RBE A;  2Y0S B;  4DL5 A;  2EPB A;  4DK3 C;  2EE1 A;  2R93 H;  4IUT A;  4C3I G;  3ULL A;  2JEB I;  1ZHS A;  1VDZ A;  5A2Q W;  3Q2O A;  3G71 A;  3NEL A;  4DIM A;  3F8N A;  2DLN A;  1WTW A;  3K3P A;  2B29 A;  3MWY W;  2VUM H;  4R8U A;  2F0S A;  1HNZ L;  3H20 A;  2V1C C;  2MUY A;  4JG2 A;  2ATL A;  4GOP A;  4PZ7 A;  3RTX A;  3M9O B;  4DV1 Q;  2UVR A;  4DL7 A;  1LO5 D;  4JI4 Q;  1Q90 A;  2E2H B;  3U4V A;  4DV6 Q;  4UCV A;  3HOW B;  1ICW A;  1V43 A;  2RQX A;  1MZB A;  1QNK A;  4GKJ L;  1AW7 A;  2QK4 A;  4YQW A;  5L1L A;  2IA6 A;  4A3B B;  4XQJ A;  4LF8 H;  1IHZ A;  3DMU A;  5I5T A;  1Y1V G;  5EBD A;  3MXP A;  3OTO L;  1VQG A;  4DK0 A;  3L9A X;  2W8L A;  5KT6 A;  4V0B A;  2DIK A;  3J81 j;  3VR5 A;  5ELO A;  2EDG A;  3NSW A;  2LSS A;  1GUG A;  1KAW A;  2F0M A;  3MA2 B;  1L2F A;  3MJF A;  5I2X A;  1SDF A;  5DGI A;  4TSS A;  4DR7 H;  3LGJ A;  1ROD A;  3X3N A;  4PMW A;  2RHQ B;  2R93 G;  5KFN A;  1L0W A;  5KG1 A;  1PZK D;  4WBN F;  1BVS A;  1STB A;  4ED2 A;  3KLS X;  4RKB A;  1HCZ A;  1JB7 A;  3MR2 A;  3TRE A;  3HOU H;  2HD3 A;  3S1Q H;  2NTS A;  3K3V A;  4JI6 H;  1N32 H;  1TWG B;  2K14 A;  1YNX A;  3C46 A;  2BA0 A;  4YR0 A;  3JZF A;  4OWW B;  1L2Z A;  4JYA H;  3BVZ A;  3HOU B;  5DAU A;  5KFI A;  4J9L A;  4DV7 L;  1KXL A;  4P73 A;  4RUA A;  2X6L A;  3G6E A;  2WYO A;  3NTH A;  5CC4 A;  2ZXO A;  4Q4D A;  3GV7 B;  1KL9 A;  4QIW E;  2DZD A;  1HUM A;  3T9D A;  3Q24 A;  4WRD A;  4AQY L;  3E9I A;  3FPU B;  1A48 A;  2OEO A;  1S72 A;  3JSL A;  2R87 A;  5D65 A;  1R9T H;  3T13 A;  3ER0 A;  5LHY 1;  1F2L A;  5KEE A;  4RB2 C;  3J7A K;  5BN3 A;  1AZQ A;  4IUQ A;  2NVY B;  1V4Y A;  4ID6 A;  3N43 B;  2FJZ A;  1DIK A;  4M9U A;  3G4S A;  1NMF A;  3D6C A;  5CV6 A;  1T9H A;  3PSI A;  2HHF B;  4DR6 L;  3QWU A;  1I4X A;  2HT1 A;  1PFM A;  2HDK A;  4Q0Y A;  3BS1 A;  3K5N A;  2K28 A;  3MWD A;  2OWO A;  2ZJP A;  2F0H A;  4K8J A;  3GV8 B;  1IBL L;  1CHP D;  2JA7 A;  2AMC B;  1HTP A;  1Z6H A;  5IYC G;  1O7L A;  3FEW X;  3KLR A;  1ESR A;  5KGU A;  4O42 A;  5CR3 A;  5IGE A;  3UFX B;  1QCB D;  1HRJ A;  3A0J A;  2NZO A;  4MV9 A;  5L37 A;  4IFD I;  4AYB A;  4P72 A;  3PUY A;  4LFA Q;  4DV1 L;  1EQV A;  1EIF A;  1HQR D;  2FMM A;  1JWM D;  5LP6 F;  3J80 E;  4O3N A;  4CBV A;  2K03 A;  2IX3 A;  4Q43 A;  3HRZ C;  1N36 Q;  2YZN A;  1F9Q A;  1JJC B;  3UDF A;  1YIT A;  2W9C B;  1JR0 D;  1I1L A;  5K2M A;  5IP7 H;  3OWF A;  3P75 A;  1XPO A;  5LMN Q;  5BWT A;  3FHW A;  5KG4 A;  2NU6 B;  3KF8 A;  2B2U A;  2MNA A;  3CVZ A;  3H0G H;  5C0X I;  3KF6 B;  3DWP A;  3K7A B;  2KEE A;  2VB2 X;  4KKT A;  2OXP A;  3QJY A;  4HJ9 A;  2A73 B;  2R7Z H;  4A93 H;  1SN8 A;  1ONL A;  5DLQ E;  4RMF A;  3KHL A;  1UNS A;  1CSP A;  4A3M H;  1SE3 A;  4DR3 Q;  3DWA A;  3CU7 A;  2K1B A;  1NR4 A;  2IL8 A;  4AH6 A;  5KT5 A;  5KFO A;  2LY7 A;  4N9P A;  5HGT A;  5JJK A;  2RKS A;  1H9S A;  4X62 L;  5IGC A;  3TS0 A;  1OXV A;  1GXD C;  1PTO C;  3K58 A;  5KG7 A;  2UXC H;  2EYM A;  3G6J B;  3CCE A;  4M0J A;  4JI8 Q;  4ED6 A;  3LWB A;  2V4D A;  3UQ8 A;  2C2R A;  5CR5 A;  1I94 H;  4IJL A;  4FBT A;  2EYJ A;  2YV5 A;  4OIK A;  1A3T A;  3T51 B;  4GNX B;  3GTJ B;  2F4V Q;  2MO0 A;  1JLL B;  1PYB A;  3EVQ A;  4DR5 L;  1LLR D;  1GLV A;  3BG3 A;  3K6O A;  3E6Z X;  1EYA A;  4G57 A;  3I4M B;  2C28 A;  3GTM H;  3V6K A;  4KJO A;  1KNA A;  2QDB A;  5HGQ A;  2B63 G;  4FXD A;  1JIH A;  1MSH A;  3BYT B;  4ULL A;  3E0E A;  1UE1 A;  2QGQ A;  1F2M A;  4DV4 H;  1YI2 A;  1Q1B A;  1YNN C;  2BR0 A;  1HR0 W;  1VCI A;  3BDC A;  3TP5 A;  1KQS A;  2WV6 D;  1KIX A;  3PO3 B;  2XN9 C;  5C4X B;  1M0T A;  4ZQI A;  1QZG A;  2XCL A;  4JOI A;  3LWU A;  1K28 A;  2FP4 B;  1N34 Q;  3SNO A;  2YTV A;  4RUC A;  3Q8P B;  5IOD A;  2F0G A;  3GTO B;  1CQV A;  4I7H A;  2WKD A;  4HTH A;  1I6U A;  5FNV F;  5C4X H;  1DM0 B;  1Y1V B;  3KDF B;  1TWH A;  4IPH A;  5FR9 A;  1ET6 A;  3I70 A;  1JWS D;  4KY7 A;  1T5X D;  4LF7 L;  1IW7 C;  4JYA Q;  4Q4C A;  2EJ0 A;  3OSP A;  2R93 A;  3DM3 A;  2DY7 A;  1FJG Q;  4WHX A;  3NEM A;  5M5W B;  2KHI A;  5JVH 3;  1CSQ A;  5J2T F;  1N32 Q;  2WB1 G;  4QW8 A;  4RB1 A;  1XX8 A;  1HJP A;  4N8X 1;  2L12 A;  1B04 A;  3I4M G;  1DON A;  3CSW A;  1OTC A;  1WH2 A;  3CMA A;  1IZ6 A;  5IGD A;  2MQH A;  2N8N A;  4OWT B;  5C44 B;  4FFN A;  1TWC B;  1ENC A;  1NAP A;  2EJG C;  5L1I A;  5KS8 A;  4JBJ A;  4FXG C;  1QNU A;  4Q45 A;  3I4O A;  1U5K A;  2K04 A;  2LFN A;  3H91 A;  4CDF C;  5I6W A;  4DR7 Q;  2R7M A;  2EY1 A;  4MTE A;  1PTO B;  4J9N A;  3N44 B;  1V1O A;  2K6A A;  1EY0 A;  1M6V A;  2LMC B;  3GIQ A;  4OHJ A;  4O4I F;  5KT2 A;  1SNP A;  1LT5 D;  4XYO A;  5GON F;  5T14 A;  4C3J B;  1DOL A;  3BYY B;  3HO8 A;  4RB0 A;  4GKK Q;  2ICE C;  5E4X A;  4LFB Q;  1YJ9 A;  5E4W C;  4ECY A;  1Z9F A;  2O2L D;  2Q2H A;  3TP6 A;  3SEB A;  1FKA H;  2I87 A;  4OO1 H;  4C2M B;  2FJ2 A;  2B2V C;  2HQE A;  4XYQ A;  4ZQ3 A;  3H09 A;  3NWS A;  4ZKC B;  5FLM H;  4JI1 H;  2IHF A;  1CA6 A;  2YCH A;  3A7L A;  3S2H H;  5E7N A;  4IZO A;  2UVW A;  1T36 A;  1S0N A;  2R6G A;  4DV7 H;  2X6G A;  4IWX A;  2KEC A;  2PZW A;  2W57 A;  4JI2 Q;  1S5E D;  1K8G A;  2ZTD A;  1JOK A;  2OT2 A;  4PWQ A;  2XCP A;  1PLF A;  3FKI A;  4PG3 A;  4KY6 A;  2YU9 B;  2R86 A;  1CM9 A;  3DUZ A;  2DPI A;  5DMX A;  2PMZ A;  2UUB H;  1P16 A;  2C22 A;  2PMZ B;  4JI7 Q;  4AQY H;  2YZG A;  4HR7 B;  2RDF A;  5FO7 B;  4JV1 A;  3S1R H;  3HOY B;  3CCU A;  2Q2I A;  2CNU A;  3VMM A;  3RGZ A;  4HCE A;  1F2Z A;  1CQI B;  4QMG A;  1K9M C;  3EYY A;  4GLA C;  1SMX A;  1SND A;  1RJP A;  4A3C H;  2YW2 A;  3QWN A;  2HQL A;  1QJO A;  3NPP A;  4K0K L;  2QB5 A;  3DM1 A;  5IOC A;  2OTJ A;  3QR8 A;  2C2D A;  1QOH A;  2PVP A;  3N8D A;  3Q0A A;  1Y8N B;  3CCS A;  3OTO H;  1EIY B;  4LJZ C;  1W3S A;  1BXR A;  1CS0 A;  4N8F A;  4QIW A;  2HGX A;  2VPS A;  4YCV A;  1D6E C;  4S3S A;  2MO1 A;  2UXD H;  1E2W A;  1TWH H;  1BF4 A;  4QY7 A;  5IGF A;  3S15 H;  2ZJQ A;  2HIX A;  4JV5 Q;  3SK8 A;  5GAH C;  1FJG L;  4GN4 B;  4ECQ A;  1TS3 A;  1CUK A;  4I65 A;  1TWF B;  5C44 H;  1Q8I A;  2QEX A;  1RYR A;  4DLK A;  2R8G A;  2DAB A;  2XCA A;  4QGU A;  1VBH A;  2ASL A;  2UUC H;  3GTM A;  3M7N A;  5M3F G;  1K3R A;  1YEZ A;  1B53 A;  2IX1 A;  3OHB A;  1B9N A;  4QSH A;  2N3S A;  2KSW A;  3GTK H;  5FO8 B;  4H02 A;  4R4O A;  2Q2T A;  4QCL A;  4GC6 A;  4GZY C;  1OXT A;  2HIV A;  3KK7 A;  5I5X A;  2DNC A;  4QJF A;  1A8V A;  3TQY A;  3CCR A;  2KUM A;  5K36 H;  3OSO A;  4OXP A;  3U50 C;  4H44 C;  4DK6 C;  4M8A A;  1XNR L;  4DAM A;  5DNF A;  1D2B A;  1CE8 A;  2CFM A;  1BCP D;  3AB9 A;  1JCK B;  1JIC A;  3CQZ B;  5C0X G;  3GTQ B;  4FFM A;  3FDS A;  4AYB E;  1DZ1 A;  4XDX A;  1FGB D;  4O81 A;  2G5D A;  3MXU A;  4NXN H;  1XNR Q;  1EEF D;  1PH1 A;  4JI0 Q;  3NQI A;  5BMV F;  1S5B D;  1U4M A;  3N40 P;  4P2C B;  4DUZ Q;  3MC0 B;  3OIP A;  4LUZ A;  1ZAU A;  1J5E H;  4DNT B;  3HOW G;  4A3E G;  2LXJ A;  1RTN A;  5J3B A;  4B9X A;  3RLO A;  4LF5 H;  1G2T A;  2JEI A;  1X3F A;  1SE8 A;  3RBD A;  1B8A A;  5DM7 3;  4YWK A;  4F87 A;  1IKM A;  5EOY A;  1B4O A;  2JA8 H;  1XPR A;  3I12 A;  2DJG C;  1KUT A;  3GID A;  4P75 A;  3GTK B;  1HQM C;  4FVM A;  1SBB B;  2EJF C;  4DR1 L;  2R82 A;  3OUZ A;  1EFW A;  4RGM A;  5C4Z A;  1AUV A;  3TEK A;  1SEI A;  2VQE H;  1SLJ A;  2XWB B;  1GHJ A;  4IUR A;  3QG1 A;  2ALY B;  4X3T A;  3PO3 H;  1RTO A;  3T5K A;  3F2U A;  5C4J H;  5CAE B;  4B08 A;  5EKL A;  1SYG A;  2F0U A;  1IW7 D;  4DR1 Q;  1Q7Y C;  3HOY G;  3I4N H;  4IR1 A;  2MGS A;  2Z1C A;  1E2Z A;  2K5V A;  1KLU D;  4EBD A;  4Q8E A;  4O3Q A;  4C5C A;  1CKM A;  4XT3 B;  1I50 B;  4O3O A;  2FIN B;  2CW7 A;  2PNH A;  1PRT B;  1MSG A;  2QA4 A;  2CHB D;  5CV9 A;  2UU9 L;  5D1O B;  1EY8 A;  1LTG D;  5D1O A;  4RAU C;  2R8H A;  2IMW P;  5DLF A;  3LX0 A;  1WVL A;  5L1J A;  2PYK A;  3KJP A;  2PCF B;  1LTL A;  1FYC A;  1RK5 A;  3T1H L;  3S17 B;  1EY5 A;  1I6H H;  3WWJ A;  5BPF A;  2FLP A;  3HT5 A;  2Y0S G;  4MHE A;  1E4E B;  3R23 A;  2R92 H;  4CHT B;  2HGS A;  3I8Z A;  1RJT A;  1B9M A;  3U9S A;  2ZDQ A;  5COY A;  1EU3 A;  3NE5 B;  1JQY D;  1C7Y A;  3K5H A;  5JVL A;  1S03 G;  2KCN A;  2EQS A;  2JA5 H;  3T99 A;  1XTD A;  1N33 H;  2HDM A;  4O4L F;  5F9L A;  3PO2 B;  1PH2 A;  4MTD A;  1JKJ B;  2ASB A;  2JN4 A;  3VYS A;  4BBS G;  1EKV A;  1K83 A;  4RA8 A;  5FO9 B;  1TAE A;  5J1Z A;  2I0Q A;  1BDO A;  1PYW D;  3H0G G;  2HVR A;  1K8M A;  3NBH B;  2BCO A;  1LT6 D;  4QIW B;  3TBI B;  5EJW A;  1F9R A;  4DR4 L;  5JH7 F;  3C0F B;  4O7V A;  3W2D A;  4ZAI A;  2D2C C;  1SR3 A;  3UDI A;  5KFB A;  2CKZ B;  3BZC A;  1J9O A;  1EU4 A;  2VQF Q;  3P20 A;  3RB4 A;  1SYX B;  1I4P A;  1VQN A;  3GIK A;  4UCT A;  3C1F A;  4A3K B;  2J7Z A;  2DUD A;  4HJA A;  3SI8 A;  2KCC A;  1B70 B;  3CPF A;  1JE5 A;  1VF5 C;  3GQC A;  1EIG A;  4HID A;  3ERO A;  4B3T L;  2PZU A;  4NXN Q;  5M3M B;  2KCT A;  4HSV A;  5D3D A;  5JJZ A;  2B3G A;  3OTO Q;  3GQB A;  1LTS D;  4CKE A;  3PW7 A;  2R7Z B;  4JI5 H;  3BJY A;  1HNW H;  2YWV A;  4TVI A;  2AU0 A;  4KY5 A;  2JA7 B;  2Y0S A;  2K50 A;  1KJJ A;  1JB3 A;  1STE A;  3RLF A;  2YRX A;  1JOO A;  5IY0 A;  3MEH A;  4EVO A;  1NE3 A;  3BA8 A;  1I2K A;  1BCP B;  2FLN A;  4WFN 3;  2CZG A;  4C3J G;  1GSH A;  4JI0 L;  1GHK A;  4WJ4 A;  4BWS C;  3K8A A;  4HNV A;  3MWM A;  3VA5 A;  1TS4 A;  1RJQ A;  3M4Y A;  1BBX C;  1A2T A;  3CQZ H;  3GTQ H;  3E0J A;  3RJ0 A;  2B2Y A;  1K73 C;  4FF1 A;  5KFU A;  2UUC Q;  3K81 C;  4NXM H;  4LF7 H;  5CE8 A;  4RZR A;  1W93 A;  2R8J A;  1WD1 A;  2B39 A;  4RCO A;  3HOV H;  3PF4 A;  1EY4 A;  1RKN A;  1MJE A;  4J9O A;  5KG5 A;  1JE4 A;  5IYD G;  1TWG H;  3Q8Q B;  3MXN B;  1T5E A;  3ORQ A;  1R9T B;  5JPM C;  3K0Y A;  1UC8 A;  1UEA B;  5KFZ A;  2W6M A;  2VA2 A;  3NP8 A;  2K7V A;  3OUU A;  4XYL B;  2VZA A;  1IXR A;  5C3X A;  5DIS C;  2PW5 A;  2JEF A;  1F9S A;  1LTI D;  2ID0 A;  3BDO A;  4TQU S;  5CV7 A;  3O13 A;  2JA7 G;  1RD9 D;  1X3E A;  3R5X A;  1YNJ D;  1PH4 A;  1FR3 A;  1SNM A;  3ND8 A;  1KHI A;  1TR5 A;  2QDL A;  1UC9 A;  4LH7 A;  1XTC D;  3GII A;  4L5S A;  2JQO A;  4ED0 A;  4GKK H;  3KFU A;  5CV5 A;  2EXZ A;  1ET9 A;  1FNV A;  3D3R A;  2IP4 A;  1XYI A;  2R7L A;  3A56 A;  2RVL A;  5ELE A;  2O5J C;  4B3R L;  3CP0 A;  1WCM G;  4KD4 A;  4DV3 H;  3AW8 A;  1XNQ L;  4QB4 A;  3VNN A;  3NXW A;  1WTR A;  1IOV A;  2VW9 A;  1EOT A;  4EYI B;  5C0X J;  2UU9 H;  5KNC A;  4LF9 Q;  1VQI A;  3EQL C;  3T1Y Q;  3GTG B;  4FS1 A;  1SE4 A;  4MV6 A;  1GUO A;  4G4K A;  5EQ0 A;  2MHV A;  3STB D;  1IYD A;  1EL0 A;  1WJJ A;  5DG7 A;  3GB8 B;  4B3T Q;  2E2H H;  2AWN A;  1Q1E A;  4RKL A;  1OBG A;  3RGX A;  3JZ6 A;  3NUC A;  4IFD G;  5DGA A;  4CGY B;  1A3U A;  3DXJ C;  5EKK A;  5IGB A;  3JAM W;  5KFQ A;  2WB1 E;  4EX5 A;  4DXF A;  3CC4 A;  3S24 A;  4BY1 H;  4O4J F;  1K83 B;  3T16 A;  4QWC A;  3CC2 A;  2R84 A;  2F0N A;  1U0L A;  4ZLT F;  1IL8 A;  5KFX A;  1P8L A;  3QZ7 A;  3WWV A;  1Z2N X;  2F52 A;  3NTI A;  3AMU A;  1I1M A;  1ENF A;  4JBM A;  4K5W A;  3RR5 A;  2Z9H A;  5ELC A;  3ETH A;  2H5X A;  5JVD F;  1S10 A;  5M3M G;  3S1N B;  1KRT A;  4NXM Q;  4GLW A;  1SRO A;  4O2A F;  1E7Z A;  5GRO A;  2ZM6 H;  1PMR A;  3CXC A;  2AQ1 B;  2W9B B;  1SJH D;  3RLN A;  4FGR A;  3WWI A;  4L8J A;  3UZO A;  1K3B C;  5KT4 A;  3IKJ A;  4LFA H;  2BQ3 A;  3GTP A;  3ULP A;  2E76 C;  4CDD C;  2AUK A;  2BE5 D;  1M90 C;  5JUM A;  4F50 A;  2I80 A;  4A3I G;  3UE0 A;  1UNN C;  1VQP A;  1IYU A;  4UFZ A;  2VR1 A;  4YWL A;  3GTL B;  4C3H G;  4BY1 G;  5KYI A;  1OO9 B;  4XZ3 B;  5C3W A;  4UUG A;  2F0K A;  1UAP A;  3FPP A;  2ICI A;  4LFC H;  4PV1 C;  1I7L A;  1KJ9 A;  2E2H A;  3HB9 A;  1N34 H;  4KN7 C;  4ED8 A;  1VQ8 A;  1QIL A;  1RCV D;  2E74 C;  3DTF A;  1VQ7 A;  2WTF A;  1NR2 A;  4HJ8 A;  3BG5 A;  2M9V A;  1YHA A;  4EGJ A;  4EBC A;  3OMG A;  3NWT A;  4NB3 A;  3FP9 A;  3A8K E;  1IYE A;  2NU7 B;  5BPH A;  1SNC A;  2W7O A;  1SYC A;  2R3Z A;  5KFK A;  1HZC A;  3D31 A;  3U54 A;  4CMD A;  2C35 B;  3PV0 A;  5FD5 A;  4HMI A;  3M9M B;  2Q2U A;  1FNU A;  1WOC A;  1NCV A;  2GVA A;  3MFY A;  5FLM G;  5IT9 W;  1PZJ D;  2WAC A;  3MFI A;  4A3F H;  2F4V L;  3AX6 A;  3CCQ A;  4XXE A;  4X66 Q;  1ASY A;  4UCO A;  5LMN H;  4C3H H;  4GOP C;  1GGO A;  4KLK A;  5IWA L;  3WO0 A;  3J80 W;  5G3L D;  2Z6B A;  1AFP A;  2N55 A;  4J9P A;  4LF5 Q;  1EUC B;  2M00 A;  4YB8 B;  1O80 A;  2GN5 A;  4JI8 H;  1E24 A;  2B2Y C;  2R7D A;  4B9W A;  1LM0 A;  1PFS A;  3GTG A;  4O7L A;  3GTJ H;  2WDT A;  4LUV A;  1CHQ D;  3OPO A;  4DR3 H;  1BNC A;  1JOR A;  1BGW A;  3BA9 A;  3GV6 A;  1EEI D;  1D7Q A;  2XRQ D;  3T9A A;  2CWA A;  3KF8 B;  3PUW A;  4GC7 A;  4R4C A;  1PK8 A;  1XXG A;  4EEQ A;  2GVB A;  4LF8 Q;  1D8L A;  1I4G A;  4ZOL F;  1EUD B;  3GIM A;  4DN4 M;  5JPN C;  4RAZ A;  4L5R C;  5KG2 A;  4B3M L;  2VS1 A;  1NSN S;  1EOV A;  1FVI A;  4JI4 H;  3GD7 A;  4FFL A;  3K59 A;  1WFQ A;  3QFF A;  4C3I B;  4KHV A;  2BDO A;  3PZP A;  1J6Q A;  5LMU L;  2L9H A;  2L11 A;  3BAC A;  3A8J E;  2PPB C;  1STG A;  4J9Q A;  2NVQ H;  4QUC A;  1QVC A;  1YNN D;  5K3W A;  4IJH A;  1R9T A;  3G8D A;  1G2S A;  4K0K Q;  3T54 A;  4YY3 L;  4A3J G;  2W9A A;  1RJR A;  2PZT A;  3FKI B;  3Q23 A;  1CZG A;  1GM5 A;  3VPD A;  4IR9 A;  4ED1 A;  4X62 Q;  3I91 A;  4J9M A;  1H9M A;  1SYB A;  3K7A H;  2L5T A;  2N49 A;  1TWA H;  5I5U A;  1XNR H;  1E22 A;  1D5X C;  2SEB D;  1Q86 C;  1STH A;  5LL6 X;  5J39 A;  1I6H B;  5FLX c;  2R61 A;  1QWY A;  2Z4H A;  3HKZ E;  4H13 C;  2R92 G;  2H1E A;  1HA5 A;  4I55 F;  3NK9 A;  1YHQ A;  3H3V C;  1ULZ A;  4XX0 B;  4MN3 A;  4PZ6 A;  4OWX B;  4RHS A;  4UP8 A;  2B2V A;  1STY A;  4TVA B;  3HKZ A;  3AFP A;  1I50 H;  2IJ0 A;  3FKI G;  5I60 A;  3M3Y H;  1F77 A;  4KKS A;  4YHH L;  2F0T A;  4NZO A;  4L6T B;  1JXL A;  1STA A;  2FXQ A;  1WRV A;  4IRD A;  1Y8O B;  5KFJ A;  2TSS A;  3Q6S A;  3RIZ A;  4DR2 L;  4RGO S;  1JOQ A;  2FK2 A;  3D8G A;  3DEP A;  1PA6 A;  4FYD A;  1MD2 D;  3H4D A;  4XQQ A;  4TRD A;  2W6N A;  1S9F A;  2E75 C;  4Y8V B;  4A3J H;  1HUN A;  1QUQ B;  4IUU A;  2VQE L;  2VB3 X;  3CCM A;  4FF2 A;  4JI2 H;  4TQS A;  1M8A A;  5HY6 A;  2EZV A;  1ZEQ X;  2GLT A;  5LXT F;  2WAQ A;  4IOA A;  3KDF A;  1WCM B;  2UUA Q;  2ZT9 C;  1HZB A;  2L0C A;  1IL2 A;  1E1O A;  4J9R A;  1XNQ H;  5D1P A;  4JV0 A;  5KFF A;  1SYE A;  3H94 A;  3CD6 A;  1Y14 B;  5M5Y H;  1ASZ A;  1EHI A;  2SNS A;  1KRS A;  3EA6 A;  2KBN A;  1A9X A;  2HG8 A;  4J9S A;  4O2D A;  3F8T A;  3CW2 C;  2CNQ A;  4LF8 L;  4RG1 A;  2AGO A;  3ICE A;  2FPG B;  3QO2 A;  3OWE B;  1QG7 A;  5A2Q E;  3GTG H;  2NVT B;  5IP9 H;  4DV5 H;  3IG0 A;  3K5O A;  1AUX A;  3RUZ A;  3KBG A;  4OO1 I;  3UYY A;  1DOK A;  4R8I A;  2XIW A;  4Q0F A;  2V4R A;  4HJ5 A;  2EJ3 A;  4X65 Q;  2Q8T A;  4EQ5 A;  4H7B A;  4R1J A;  5JQG F;  4I4T F;  5KFD A;  4R4I A;  2EIF A;  2K5D A;  2DAA A;  1X65 A;  4A3B G;  3PW0 A;  1E1T A;  3HXL A;  1O78 A;  2RCN A;  2F0F A;  5TSS A;  1GSO A;  4FU0 A;  2BQR A;  5CGK A;  4A3G B;  5EPL A;  5DAA A;  1ML0 D;  4PMB A;  4G7O C;  4DV5 Q;  1KTA A;  1Y1V H;  3RZO H;  3DF7 A;  3AU7 A;  1PH6 A;  5JEA H;  5KFH A;  5FJ8 G;  1C3O A;  1B3A A;  5E25 A;  2MP1 A;  1HHV A;  4O7Y A;  4R8U B;  5C5J A;  2MJ8 A;  3HS0 C;  3VPC A;  4R4Q A;  1H9K A;  2RDG A;  4X3U A;  4DL4 A;  2KQ3 A;  1KT8 A;  4MV7 A;  1HFN A;  5A2Q L;  3RB6 A;  1CTM A;  1UE7 A;  2F0V A;  5FD6 A;  2YTY A;  2UXB L;  4DFA A;  3IL8 A;  2JEG A;  4POG A;  4ETS A;  2OLS A;  2E2I A;  1K1Q A;  1X32 A;  1C48 A;  5BN5 A;  3NBY B;  4MA5 A;  5KFW A;  1NNX A;  4DAV A;  3S1M B;  3TP8 A;  3RZD H;  4UDU C;  1SFO H;  2WAQ B;  2YTX A;  3CHB D;  3BVM A;  1JJG A;  1TT2 A;  3TY9 A;  2QYZ A;  1KAB A;  1ENA A;  3T9B A;  1BNZ A;  1MI2 A;  3PO2 H;  4DUZ L;  1WI5 A;  3BDL A;  4QWD A;  1WR2 A;  1SSO A;  3VDY A;  2ZDH A;  3H40 A;  3OOC A;  4DV4 Q;  1AZP A;  1TY2 A;  4LF4 L;  3KAL A;  2ZJT A;  2F0D A;  4O3R A;  1PHJ A;  4JOI C;  3BZK A;  4UP7 A;  2KA7 A;  4ECV A;  1ZXT A;  4OEM B;  1PRT D;  5NUC A;  2OQ0 A;  4BBS H;  4EQP A;  4I50 F;  1GJX A;  1IKL A;  2EYH A;  5BR8 L;  3F2C A;  1II3 A;  4YAJ B;  4JW0 A;  2WAQ G;  1VQJ A;  2HJW A;  3M9B A;  4C3J H;  1BCP C;  2DY8 A;  1QVF A;  3ERS X;  4CDE C;  4BY1 B;  4UY8 C;  1VQD A;  1N33 L;  2JA8 B;  1Z2O X;  4O7T A;  4JI1 L;  1XPU A;  1N36 L;  5FLX W;  1V9P A;  4IIJ F;  2R7Z G;  4YCW A;  1DV2 A;  2ES2 A;  2A68 D;  2AWO A;  3GDE A;  3CCL A;  2SCU B;  3GIP A;  4OL7 A;  2A5H A;  4ZI7 F;  1Y8P B;  3EN2 A;  4C56 C;  3VYR A;  1VS0 A;  4UAI A;  3PW2 A;  1Y1W A;  4IUV A;  5LYJ F;  4KKU A;  1TWF A;  5DQI A;  4B3M H;  3JAM E;  3PR4 A;  4NW2 A;  3I90 A;  1BJT A;  4DUZ H;  4DV0 H;  5I9P A;  2LS0 1;  5BN4 A;  4A2B A;  4X65 L;  4HCS A;  2XC9 A;  4WJW A;  1B6S A;  2YU9 A;  2I46 A;  1IBK H;  4QWE A;  1PX2 A;  5I5S A;  1HFG A;  2MFI A;  2ATW A;  2P0A A;  3R93 A;  3VR4 A;  1KD1 C;  2WP8 J;  3RUP A;  4K2L A;  4U68 A;  2CNV A;  3TII A;  4LNQ A;  1D1K A;  2VQD A;  1KJQ A;  2UXB Q;  4MA0 A;  2JK8 A;  1BOS A;  4B3S Q;  5KFC A;  2BA1 A;  2UXC L;  4JI8 L;  5CBA E;  3RV3 A;  2C5C A;  3HOX G;  4O0A A;  4CJ1 B;  4X62 H;  4PMC A;  3CRL C;  2VNU D;  2W71 A;  4C1N I;  1PTO F;  1A6X A;  3KF6 A;  3CPW A;  1JC7 A;  1DXM A;  1H9J A;  2K05 A;  3I73 A;  3J7Z C;  4JI3 Q;  5C1O A;  2UXC Q;  4E6N A;  3J81 W;  2AGQ A;  3KHG A;  2ODT X;  2KED A;  1S4Z A;  2B2T C;  3Q22 A;  3TZU A;  4G7Z C;  3VR6 A;  4RNN A;  2DPJ A;  3J7A F;  2F0O A;  5FLX L;  2B2T A;  3J80 L;  3U0G A;  3GTO H;  2Q8I B;  2UXD Q;  5LMN W;  1K8O A;  2WE6 A;  3HOZ G;  1O7I A;  5BWV A;  1WTH A;  5BR8 H;  3J81 E;  1KNE A;  1TVX A;  4JV2 A;  4X64 L;  1GVP A;  4BY7 H;  1K0R A;  2L4N A;  2A74 C;  3HOV B;  1Q3L A;  4DV4 L;  3VR2 A;  4LF4 Q;  2AQ4 A;  5LOV F;  2QW7 A;  3EJI A;  2AGP A;  3P7J A;  4EFE A;  2XGQ A;  1HNX L;  3RNU A;  4WOR A;  3L7Z C;  3QQM A;  1G91 A;  4BBR G;  1M1K C;  4HNT A;  1U4R A;  4LK1 C;  3PIO 3;  4MTK A;  3Q8S B;  1YBY A;  3HOX H;  1KTK A;  1UE6 A;  3NBZ B;  5M3M H;  3PVX A;  1W6J A;  2YS6 A;  2W8K A;  4LFC Q;  4XYM B;  1PRT C;  3CF5 A;  3T1Y H;  2R92 A;  1EYG A;  2A69 C;  3ULJ A;  4DL6 A;  2HCI A;  4ZKB B;  4DU9 A;  3L2P A;  4DR5 H;  1IBL Q;  4DGZ A;  1AE3 A;  5I6Y A;  4QUF A;  4HAE A;  3R3O A;  2GQS A;  1BCP F;  2Y0S E;  1PDQ A;  3T5H A;  1EY9 A;  1B6R A;  3KLW A;  4K6N A;  1UWV A;  5G3L F;  2DJF C;  1A3G A;  3KLS A;  4A3C G;  4YHH H;  3PW5 A;  5JJL A;  2GPS A;  4EEY A;  4U6P A;  3RAX A;  1GYF A;  4A3J B;  1TWF H;  5FK9 C;  2Z02 A;  4K0K H;  4A93 G;  4B3S L;  4A3K G;  3N42 B;  3FMA A;  4NP5 A;  3TZD A;  4PNY A;  3RF2 A;  1YJN A;  4ILW A;  2NTT A;  4DKA C;  1G29 1;  1KDA A;  3T5L A;  5CA0 F;  3J81 i;  5KFR A;  5EAY A;  4HIO A;  4AYB G;  3TIN A;  4OX9 H;  4RNO A;  4HN2 A;  1A0I A;  2XSC A;  2A8V A;  4NZM A;  3V6J A;  4IQZ A;  3PN1 A;  1UUP A;  1CFM A;  4CC5 A;  5LA6 F;  3I4M H;  2ZM6 L;  1WTX A;  3HZX A;  2AQ2 B;  3H0G B;  3NQT A;  4LSX A;  1AE2 A;  5AJ3 Q;  3KJO A;  2EJM A;  5CV8 A;  5M3F H;  1HTL D;  2J0T D;  4C5B A;  2E5L Q;  2ZXR A;  4KV6 A;  1XMO Q;  1GKH A;  4FXK C;  4J15 A;  2JA6 G;  2L55 A;  3I7F A;  5GAE C;  2X5R A;  2YYZ A;  3DHQ A;  5JEA J;  3UZB A;  3CEB A;  2PI2 E;  2J6S A;  5C8Y F;  3KAK A;  4O7S A;  1KAA A;  1E4E A;  2D62 A;  1HR0 Q;  1EWC A;  5C4J B;  3S17 H;  4CMF A;  2BE5 C;  3JRW A;  3GO5 A;  3WOF A;  4JI4 L;  3BQ0 A;  2D0O A;  1EYZ A;  2TMP A;  1TY0 A;  3I2Z A;  5CB4 F;  3L0O A;  4PZ8 A;  1VQK A;  4RHR A;  2RGR A;  4IWY A;  1ZQ7 A;  1B3Q A;  1HNX Q;  2I5L X;  2XWJ B;  4GOP B;  2GQR A;  4LMQ D;  2PQA B;  3JAM c;  1V1Q A;  4F4Y A;  1D5M C;  2W7P A;  4TUY F;  3H15 A;  2EY5 A;  4MAM A;  5ISR A;  1AN7 A;  5ELF A;  3M9N B;  4IRK A;  2NVY H;  2IX0 A;  1H95 A;  4LFA L;  3EPG A;  1ZYR C;  4DV2 H;  3LQS A;  1EFI D;  4OIJ A;  5C44 G;  3OHX C;  4C1N K;  1I50 A;  4X64 Q;  1XJV A;  3GV5 B;  4YBZ B;  5M5X H;  2JSO A;  3TW7 A;  1WCM A;  1E3P A;  3KYH C;  3MAQ A;  3EBE A;  4A3D B;  4YY3 Q;  1UE5 A;  5EWF A;  4RWS C;  2GPW A;  4DUY Q;  4L1K A;  4DL2 A;  4CJ0 B;  4U7C A;  4KK7 A;  4A76 A;  4DF7 A;  3TS2 A;  1VF7 A;  4DAY A;  4RCN A;  2XD4 A;  1VQ4 A;  3T1H Q;  4FF4 A;  4RB3 C;  2C2E A;  2R7N A;  4QWA A;  4K5V A;  1L1O A;  1I94 Q;  4R8N A;  4A3D H;  2P5Z X;  1L1O B;  5D14 A;  3SK5 A;  3T7A A;  5JQW A;  1KDB A;  3HKZ B;  5I5Y A;  5JAV A;  1HR0 H;  4YY3 H;  2Z8L A;  2CH4 A;  4A3I B;  2Q8R E;  2J6U A;  1LUZ A;  2ZXP A;  4A3B H;  3JAM i;  5LL6 S;  4L63 B;  5GAG C;  2A6H D;  4WJ3 M;  4BXX G;  1EY6 A;  4LF4 H;  3WDN A;  5BWW A;  3PFF A;  1Q46 A;  1IYV A;  3E5S A;  3GIJ A;  3I56 A;  3U9O A;  1QUQ A;  4YIJ A;  5ELD A;  3U9T A;  1NUC A;  3LUL A;  2ENB A;  4ZUI A;  2VQF L;  1TQO A;  2NN6 H;  4UP9 A;  1PH3 A;  3C2P A;  1BUV T;  1S3O A;  4KN4 C;  3E9H A;  1EQR A;  3FKI H;  2YZL A;  1SNQ A;  4A3F B;  4KD3 A;  3N6R A;  1WTQ A;  3NEN A;  5KND A;  5BWR A;  1I2L A;  1I6V C;  3TW6 A;  1PH9 A;  2NVQ B;  4KI0 A;  4GKK L;  2BH8 A;  4LF7 Q;  5KG3 A;  2CH4 W;  1VMC A;  1A2U A;  5M5Y B;  1N36 H;  3L3O C;  4FBU A;  4ZK9 B;  4GLV B;  1HXY D;  2MCT A;  2ZTE A;  1BQQ T;  2W6P A;  4YHH Q;  4A2A A;  4DNI A;  2RCF A;  3M4O H;  2NVT H;  2BH2 A;  4R7R A;  4M1U B;  4Z9C B;  1CQF A;  1HPC A;  3G6V A;  3PF5 A;  2HUG A;  2HGW A;  1MKH A;  2R85 A;  1X6O A;  1N56 A;  1X55 A;  1U4P A;  4DAY B;  4BXX H;  3T56 B;  3ZJY C;  5DQH A;  1S5D D;  2VL6 A;  4F8M A;  2ALZ A;  4LF9 H;  2UU9 Q;  2HHH H;  3M3Y B;  1HNZ H;  1IBK Q;  2B63 B;  3M4O B;  3NBI A;  5C4H A;  2VUM G;  1DJR D;  2F0Q A;  4DUY H;  2NVX B;  4EGQ A;  1KBL A;  2VA3 A;  2A19 A;  5KFG A;  1LYL A;  5C3E B;  4K8I A;  4CJ2 C;  4DV5 L;  1I7N A;  1V1P B;  4LSA A;  4IPD A;  2VUM A;  1F2Y A;  5GQO A;  3PIP A;  3ND9 A;  1H9R A;  4FP5 D;  2CW0 C;  2NUC A;  4RFB A;  2QF7 A;  4UCR A;  1SEB D;  3Q8D A;  1PRT F;  3MVV A;  1RHP A;  2IHE A;  2F1M A;  4BA2 I;  2JA6 A;  1GUW A;  4IZ8 A;  5IYD H;  1DOM A;  3MR5 A;  4IPC A;  1TXY A;  2R7F A;  1TWC H;  1VBG A;  4QWB A;  4UHV A;  4DR4 Q;  4ECX A;  2NBF A;  3PGZ A;  2VQE Q;  1XDN A;  5I5W A;  2CW8 A;  1IYJ B;  3RZD B;  1SFO B;  2C9O A;  5DLG A;  3NGD A;  1IBL H;  5D8D A;  2YZM A;  1HZA A;  3RV4 A;  5IGG A;  5IP9 G;  5DQG A;  3U55 A;  3RB0 A;  1CKN B;  4E4T A;  1GUN A;  1PTO H;  4GNX C;  3R8B A;  3KHH A;  3GTP H;  4IHJ F;  2UUB L;  1VQ9 A;  4APV A;  4JBK A;  3I55 A;  2F0L A;  5C5L A;  4B3R H;  5IYC H;  2J4X A;  1Y1W H;  4NPS A;  4BWG B;  2Z6K C;  2XTI A;  5F2D A;  1PV4 A;  4YAK B;  2E2D C;  2QEJ C;  2O03 A;  4DAP A;  1XK5 A;  4DR2 Q;  3GTL H;  5JJI A;  1MHW C;  1WYD A;  3GV3 A;  4JBW A;  4HNU A;  4YWM A;  4OX9 L;  3BVG A;  4YCU A;  1VQ6 A;  3GIL A;  5FJ8 H;  2V58 A;  2B63 A;  3PQI A;  5AFW A;  2NN6 I;  2RF4 A;  1PFB A;  2AUJ D;  3WOE A;  2C00 A;  3ETJ A;  4DV6 H;  1KC8 C;  1YIJ A;  1Y1W B;  1SNO A;  4RGN A;  4EYH B;  2PQA A;  3M4P A;  1DGS A;  4DAA A;  4GKJ Q;  1TII D;  5KT3 A;  3PCO B;  2UUC L;  4J0M A;  2WII B;  5C4X G;  1SYF A;  2FK3 A;  3S9W A;  3GP7 A;  2I07 B;  4NXM L;  3KRE A;  2CWP A;  3C1E A; 
#chains in the Genus database with same CATH