1P8LA

New crystal structure of chlorella virus dna ligase-adenylate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
296
structure length
276
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNFGYEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIRHEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the DNA Joining Repertoire of Chlorella Virus DNA ligase and a New Crystal Structure of the Ligase-Adenylate Intermediate
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase
molecule keywords PBCV-1 DNA ligase
total genus 64
structure length 276
sequence length 296
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1p8lA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1p8lA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1p8lA01
4E6NA 1J5EL 4DR7L 2ALYB 1KHIA 3RN2A 1Z9FA 4B3ML 1OXTA 4HJAA 2JEBI 4H02A 3S16H 3A5ZB 4A4IA 2V1CC 1JJGA 3CCUA 1E7ZA 4HIKA 1SMXA 1YHBA 4P72A 1D7QA 2IT1A 2FXQA 4FDBA 4LUOA 4UP8A 5BR8Q 1QZHA 1K73C 1JJ2A 3GTQH 4HJ8A 1PH6A 2VW9A 4EX5A 1CUKA 4YCWA 1JE5A 1L2FA 3JC66 2Q2UA 2UXBQ 1JT8A 3K7AH 2K5HA 4LF5Q 1PH1A 2B29A 3F2CA 1E3PA 4JI2L 3CCLA 2VQEL 3ULJA 3HKSA 2AMCB 2I5HA 1HNZQ 4X66L 3HOVG 4X66Q 1HNZL 4DR2L 1N8RC 4LUVA 1PA6A 4JI7Q 5C3EG 2VQEQ 4JI6Q 4DR6Q 4JI2Q 4GOPB 4P73A 4LFBL 1VQOA 1U5KA 2QEXA 2IX1A 1SRUA 4K0KQ 1UE7A 2JEAI 2LXKA 2ZTDA 4UPAA 4OX9Q 2N78A 4UCVA 3TS0A 2Z6KA 1XPRA 1EWIA 5BR8L 5LMNQ 2E2HH 4JBKA 4A3GG 1EIFA 1WOCA 1V43A 4DR1Q 4L5TA 2CWAA 1X9NA 3HKZG 1X3FA 1ASZA 1YBYA 4JI3Q 3RZDH 4R1JA 1W3SA 5LMNL 1AE2A 1YJWA 2ASBA 2K5VA 1IBLL 2K5NA 4HIMA 5E7NA 3JAMi 4B3MQ 4KLKA 3W5OA 1WJJA 1KD1C 1NMFA 5M5XH 4WJ4A 3RTXA 2UXCQ 5GADC 2N49A 2K52A 4HJ9A 1PH3A 4BY1G 5M3MG 4DUZQ 1UEBA 1VQJA 3KLWA 3TQYA 4DV2Q 2CCZA 2NVTH 2VNUD 3PO2G 1IL2A 4DV1Q 3FP9A 2VY3A 5C3EH 4YHHL 3GTMH 3BA8A 3RR5A 3HOVH 3KF6B 5GQOA 2VS1A 3RN5A 4BBSH 2EIFA 3E9IA 2UXBL 5JJLA 2B63H 3CP0A 4DRFA 3GTGH 3U50C 1KC8C 4B3SQ 4DR5L 2HHHL 2MQHA 1QUQB 2JA6G 3FKIG 2DUDA 2UXDQ 3M4QA 3G6EA 1ASYA 1AE3A 2UUCQ 4X64L 1N32Q 2PNHA 2H5XA 4QJFA 1XDNA 4EQ5A 5EAYA 1J6QA 2Q2HA 4UP7A 4IFDI 1VQBA 3EBEA 4OXPA 4JBJA 1LTLA 1IBKL 4Y7NH 1KRSA 1SR3A 4JYAQ 3AQQA 5GAGC 4NXNL 3RLNA 3DLLA 4L5SA 4J15A 1TWAH 4R4QA 4AH6A 3CD6A 1IXRA 5DLQE 2YV5A 3H0GG 4IFDJ 4A93G 2RHQB 1BVSA 5GROA 1GO3E 3A0JA 2KBNA 3G71A 3M4OH 3HOXG 4RMFA 3M9BA 4DV3L 4IOCA 4AQYQ 2CQOA 2N8NA 3ERSX 5GAEC 4C3IH 5AJ3Q 1QVFA 2R7DA 3HOUH 3I4NG 4YY3Q 1P16A 3F1ZA 2IY5B 1Z47A 3CCSA 3K81C 4KHPL 2AWOA 1A0IA 3CC4A 2ID0A 4XIGS 1IBMQ 1XPOA 1VQGA 2E5LL 1G51A 1WCMH 3CCVA 1VQAA 1U0LA 4A3FH 3T1YQ 4XTCS 1NTGA 3NBHB 3KJOA 3U4ZA 2JE6I 5IE8A 3CXCA 1EIYB 1UE5A 1VQ5A 4IPDA 5ELNA 5FJ8H 1XJVA 1YZ6A 3HOZH 4O2DA 4OWWB 3I4OA 4A3MH 4LF7L 4LFAL 1T9HA 3G4SA 4DV7Q 4A3CH 3BJUA 3F2DA 2KHJA 1JMCA 3K8AA 2VQFQ 4DKAC 4DV5Q 2OQ0A 3WWVA 4GKJL 2EQSA 4YWLA 1K8GA 3I4MH 4GKJQ 1YJ9A 1E1OA 5J3BA 4AIMA 1HZBA 5IYBH 5IYCG 2E2IH 2HVRA 1E1TA 3ER0A 1A63A 3JSLA 2BA0A 5IWAL 3KDFA 2JQOA 1EYGA 1TXYA 2WP8J 3T1YL 1VQ4A 3KOJA 4PZ6A 2R93H 4AYBG 1SFOH 4UCSA 4LWCA 4HIOA 4DV4Q 3STBD 1PH5A 1IBML 2UU9Q 1MIUA 5IYDG 3UQ8A 1PVOA 1N34L 2Z0SA 2JA8H 2VUMG 3M7NA 4WJ3M 1Y1WH 4JCVE 4BXXG 5M5WH 4A3GH 4AQYL 1MJCA 5IP9G 1OXSC 5C0XI 1XMQL 4APVA 1LYLA 5M3FG 3BABA 2K75A 1MKHA 4PG3A 2OCEA 3PO3H 1UWVA 2WFWA 3CAMA 4A3KG 1JB7A 1HH2P 3BU2A 2BH8A 4POFA 5C4XH 1RL2A 2D0PA 1IBKQ 3E0EA 4BA2I 3S1QH 3M3YH 3HOWG 2R7ZH 3OTOL 4JI0L 2YYZA 3L7ZC 3M85A 4BBRG 4BA1I 4JI4L 5C44G 1C7YA 3GDEA 4Y52H 4OWTB 2JA7G 1FL0A 1L1OB 2E8GA 3CMAA 4X64Q 4LF8L 2UUCL 4X62Q 1XNQL 1N36L 4A3IH 3KF8B 4JI8Q 4LNQA 2JA9A 1XK5A 2A1AA 5IP7H 4B3TL 4A3EG 4DR5Q 2F52A 1B7YB 4JBMA 4MZ9A 1EUJA 3AYHB 3TEHB 3NC0B 2UU9L 3L2PA 4HJ7A 4GS3A 1HZCA 4PZ7A 5FLMH 3AFQA 4JOIC 2EXDA 1Q1BA 1SLJA 1X3GA 2AWNA 4UCUA 1CKNB 1Q12A 2B3GA 2RHSB 3S1MH 4JBWA 5IWAQ 4MNOA 1Y1VG 2JK8A 4UP9A 3ULLA 3ZJYC 5IY0A 2L15A 5GAHC 4DV2L 4JI5Q 5C4JH 4L5RC 2PI2E 5D1OB 2UXCL 1QUQA 2AKWB 1FJGL 2R92G 4R4TA 2ZTEA 1XNRQ 1L1OA 2HT1A 3UDGA 1IBLQ 1LM0A 2N3SA 4A3DG 4OO1I 5C0XG 4DV5L 1N33Q 1YVCA 1VQ7A 3A74A 2HVQA 4NXML 3SGIA 5FLXc 3EIVA 3W1GA 4EFEA 1PHJA 5D1PA 3KF6A 4DV6Q 3RLFA 1TWGH 1E22A 2A19A 1QZGA 4DAYB 4BY7H 4DUYL 1HNWQ 4GLXA 2E5LQ 2KCTA 3BZCA 2YU9H 2MNAA 5H1SE 4IJLA 1X3EA 4LF9L 3HOYG 4KHZA 4KI0A 1UE1A 1XMOQ 2WB1G 4YY3L 4DR6L 4DR4Q 4DR2Q 2RF4A 4A3LG 1S3OA 2IHFA 2R6GA 3CCJA 5HGQA 4LW1A 1H95A 1L0WA 2ZM6L 4TVAB 4GNXC 4OWXB 2YTXA 1VQPA 1PH9A 4LF5L 1X6OA 3CCEA 1CKNA 2ZTCA 2YTVA 1YITA 1B8AA 3NEMA 4LF4Q 3J7A5 4IFDG 1HR0Q 2MO1A 4NXNQ 4LH7A 2HIXA 5LMUQ 3BAAA 1HZ9A 2KCMA 2ZJQA 1S72A 4QL5A 3J80i 3STBC 1KXLA 2CWPA 2NVXH 2JA5H 3H3VI 2Y0SE 1EFWA 2I5LX 1GKHA 2Z6KC 5JEAJ 3PN1A 3PV0A 4DNIA 4IJHA 4NB3A 4LF6Q 5JEAG 1GM5A 4GKKL 4B3RQ 3K7UC 4NPSA 4QGUA 4GOPC 1K0RA 1KRTA 2JA5G 4A3JG 4LF6L 1N32L 4DK3C 4A3BG 2QGQA 1B04A 3S2HH 2AHOB 3I2ZA 2HHHQ 2R7FA 3U4VA 1JJCB 5LMUL 1C0AA 3PGZA 1HR0L 3PSIA 1PH2A 2NZOA 1FVIA 1YIJA 4AYBE 3S1RH 2A8VA 3K0XA 1VQ8A 5HY6A 3RNUA 1K9MC 1VQHA 4A3LH 2ZM6Q 3DM3A 3L0OA 5JJIA 1PV4A 4UY8C 3TY5A 1V1QA 3E9HA 2Q2IA 4YHHQ 2OTJA 1TAEA 3J81j 3CPWA 3H3VH 2VUGA 1VQEA 1A8VA 4DR4L 2HVSA 1TWHH 3JSNA 1XMOL 4DUZL 4GOPA 4QQBX 3TS2A 3J81c 4BY7G 1HJPA 2F4VQ 3ICEA 4JC0A 1DGSA 1K3RA 4DUYQ 1X65A 2GN5A 3CCQA 5DISC 1QVCA 3KDFB 3K80C 3CC7A 3PUYA 4A3BH 2LSSA 4GKKQ 4B3RL 3UDIA 4A3JH 1Q1EA 1K83H 4LUZA 3PUXA 4DV6L 4JI3L 1VQNA 3S17H 1S68A 1UE6A 3CCMA 3CW2C 4QY7A 4DR1L 3CMEA 4A3DH 4C3JH 4DV0L 3GJXB 1I6HH 1N33L 1C9OA 2R92H 1Q7YC 4C2MH 1YHQA 5JJKA 3F8TA 3HFZB 4GLAC 1VQ6A 1Y14B 4OX9L 1X55A 1SROA 4LF4L 3NBZB 1I94L 1WFQA 3I56A 1HZAA 3I55A 1Q8KA 4P75A 1KQSA 4K0KL 2K14A 4YCUA 3JAMc 4JI6L 4LFBQ 3W1BA 5C0XJ 4JI7L 3CPFA 5FLMG 1LUZA 3CC2A 4L5QA 1CKMA 2K50A 4R4IA 1EQQA 2UUBL 1KIXA 2GVAA 1NJIC 3S1NH 1Q82C 2IX0A 2YTYA 2MFIA 4LF9Q 2LXJA 4X6AH 3HOYH 1VQ9A 4R4OA 1HNWL 4A3EH 1PFSA 2C35B 2NZHA 4JV5L 3F2BA 2I5MX 5IP7G 3A5UA 2I0QA 1CKOA 4YWMA 4A3IG 1VQLA 4B3TQ 2VZAA 3BA9A 2KHIA 1YJNA 4JI8L 1I50H 1XNQQ 4R4CA 3H15A 5C44H 4X65L 4BBRH 4NXMQ 4EFBA 4A75A 2HQLA 2XGTA 1BBWA 3PUWA 3UE1A 4JI4Q 3HOWH 2R7ZG 1BBUA 4UCRA 1TWCH 4IPHA 4UFZA 2JJQA 1XNRL 3OTOQ 1TA8A 3T1HQ 1FJGQ 1J5EQ 4PZ8A 4DR7Q 3EN2A 4A3KH 1M1KC 3MXNB 2KENA 3TREA 3S14H 4JI5L 3PF4A 2E2JH 3NELA 5M3FH 3CQZH 3BZKA 1R9TH 1E24A 2F3IA 3PCOB 1VQIA 1Y1VH 1KAWA 4JI1Q 5IP9H 2UUAL 1YI2A 4LFCQ 3TRZA 3NENA 4IO9A 1QVGA 1Q81C 1X56A 3CF5A 1MJEA 1I5FA 1OXUA 2ATWA 1IZ6A 1HNXL 4DR3Q 2VUMH 2JA8G 1TWFH 3GD7A 5FPOA 2QA4A 2PQAA 3RLOA 1N34Q 3ULPA 3I7FA 4DR3L 3D0FA 3J7ZC 3GTKH 2R93G 4HIDA 3OW2A 4GNXB 1N36Q 4X62L 2BH2A 3PIPA 1NY4A 4LFCL 4LF8Q 2D62A 2ES2A 1OXVA 4JYAL 1WYDA 3HKZE 1A62A 3S24A 1SE8A 1YNXA 5IYCH 5IYBG 1PH4A 5LMNW 2JA7H 3PIOA 3VDYA 1CSPA 3QWUA 1VQCA 1O7IA 2CKZB 3B6YA 4A76A 4JI0Q 4CC5A 3I4MG 3LGJA 3T1HL 1S40A 2OTLA 3TY9A 1EOVA 3S2DH 1VQFA 1OTCA 5C4XG 3KJPA 4C3HH 2VQFL 2HIVA 3RZOH 4DPGA 1PYSB 3MEFA 4X65Q 3IRBA 4MTNA 1VQMA 3GO5A 4P71A 4LFAQ 1XMQQ 3HOZG 3PO3G 3UE0A 3GTJH 4DAMA 1FGUA 4GN5A 1AH9A 1GVPA 1I3QH 2Y0SG 1WCMG 5FPRA 4JV5Q 3TY8A 4BXXH 4IPGA 1BKBA 1P8LA 3AFPA 1Y1WG 4POGA 1KL9A 2PI2A 4UCOA 4JOIA 1WI5A 4LH6A 4ALPA 4IOAA 4DV4L 4KHPQ 1RIPA 1HR0W 5IYDH 3NBYB 3PUVA 2Q2TA 4RG1A 1G6PA 4JG2A 4GN4B 2UUBQ 3HOXH 2IHEA 5K36G 1CSQA 1OXXK 3OYYA 1NE3A 1VQKA 4UCTA 4DV3Q 1PH7A 2PQAB 3H0GH 5IT9c 4GNXA 1V9PA 1YHAA 4YWKA 3PF5A 2D0OA 3M4PA 1PH8A 2NVQH 3KFUA 2MO0A 3UDXA 2WB1E 3PUZA 2RCNA 3GTOH 1I94Q 2DGYA 1M90C 1X54A 4GN3B 3J80c 4CC6A 4DV0Q 2WAQG 1YEZA 3D31A 3VNNA 4DV7L 1VCIA 2NN6I 4LF7Q 5M5YH 1VQDA 1NMGA 2BA1A 1VS0A 4QIWE 4A3CG 4DK6C 3G48A 4GLVB 4A3MG 1GD7A 3FKIH 4HJ5A 2JA6H 5FJ8G 3KYHC 3GTLH 2UXDL 1PYBA 1N9WA 3GTPH 4IPCA 4A3FG 3AEVA 2XTIA 2F4VL 2B63G 4OONA 4B3SL 1XPUA 3FHWA 2VL6A 1NBWA 3CCRA 1G291 2PMZE 4EEQA 1B70B 4P74A 2GVBA 2OWOA 4BBSG 1K8AC 1EQRA 5D1OA 5AJ3L 5ELOA 4PMWA 1HNXQ 1W2BA 3S15H 2OQKA 4ME3A 2K4KA 3HOUG 3I4NH 3GB8B 1IYJB 2NN6G 1XTDA 2ZJRA 3PO2H 2ZJPA 2UUAQ 1D8LA 1Q46A 4TQUS 4JI1L 2NVYH 5M3MH 2CFMA 4DV1L 3Q8DA 1Q86C 4BY1H 4YCVA 4OO1G 1SN8A 3U58A 4A93H 2WAQE 1L1OC 3UDFA 3J81i 4O0AA
chains in the Genus database with same CATH superfamily
1PTOC 4E6NA 3E5SA 1QNKA 4DIMA 2KOLA 1OXTA 4B3ML 2ZGIA 3TW7A 5BPHA 4J1MA 2JEBI 1YNND 3T56B 3QFFA 4KKTA 3TMEA 3BQ0A 1HTLD 3ND8A 1CQJB 3ETHA 3PZPA 1Y1WA 4ID6A 3ORRA 1K73C 2FLPA 1G2TA 1PH6A 3R23A 4YCWA 1BBXC 1S0NA 4O3QA 3OSPA 2PO4A 4FFRA 4DR4H 3DWQA 1FR3A 2EY1A 4ED8A 3SEBA 3HKSA 1HNZQ 4QWCA 1ZEQX 1TQOA 1SJHD 2W6MA 4LUVA 2P0AA 2W7OA 4LFBL 4O7ZA 4P73A 2D2CC 4EVOA 4QW8A 2QEXA 3MWEA 3NP8A 2ZTDA 3MZ5A 4DAAA 4DUYH 3GV3A 4Q4DA 2VA2A 2KJXA 1WOCA 1V43A 2F0MA 2EOTA 4DR1Q 4JI3Q 2EJGC 3C46A 3RZDH 4R8UB 2ICEC 2A6ED 3BVGA 5EKLA 2ZXRA 2RCFA 2ASBA 4A3GH 4HIMA 3W5OA 1KD1C 3N8DA 2AU0A 1CHPD 2N49A 3TP7A 3X3MA 3JAME 5M3MG 1UNSA 5ELDA 5H80A 3IN5A 1IL2A 1G8ZD 1I1MA 4HMIA 1A6XA 3BQ2A 4HSPA 3KF6B 3TQ1A 4O83A 1EYDA 4C56C 4BBSH 5L37A 3HZXA 4YB8B 2R92A 3MVVA 3H20A 4IWYA 2RDJA 5LL6b 4DR5L 1I4HA 2WTFA 2W6ZA 1TWGA 4I7ZC 2NU8B 1Y1VB 5BWUA 3G6EA 3JRXA 2VB2X 2F0DA 2RA4A 2H5XA 1F2ZA 1XDNA 3PW4A 4HTHA 3KHRA 2F3VA 4UP7A 1PMRA 2QYZA 4JBJA 3TZDA 4DF7A 1K83B 1SR3A 5GAGC 4NXNL 3DLLA 2B8FA 1TWAH 4R4QA 4AH6A 5KFYA 1IXRA 3H0GG 4IFDJ 4OO1H 1W96A 3D6WA 3PR5B 3C0FB 3A0JA 3M4OH 4UAIA 2E2HB 4DV3L 4IOCA 2CQOA 1GUTA 1RTNA 5GAEC 1QVFA 3GIKA 4ECQA 4HCSA 2R7DA 1STBA 1EFID 5E4WC 3E6ZX 5C1PA 3K81C 2AWOA 2HG8A 2XCPA 4ED0A 2ID0A 1H9SB 4TRDA 1IBMQ 2VXWA 1YNNC 3RV3A 2UXBH 1WCMH 1R4PB 4ZK9B 4A3FH 3H09A 4XTCS 2FPIB 1I1LA 5J2TF 4LF4H 5IE8A 4ZQ3A 1VQ5A 2VOBA 3HOZH 3RB6A 2EJ3A 5K5PA 4DV5Q 2OQ0A 1KJ9A 1C8CA 2KCNA 3I4MH 4A3EB 4YJ2F 1L2ZA 4AIMA 3OPOA 3CRKC 1M4VA 1E1TA 3ER0A 1F2YA 1LT6D 1A63A 1I4GA 2PN1A 2F0LA 1CE8A 4XZ3B 3M9NB 3KDFA 2I46A 2JQOA 4RZQA 5DG7A 1RHPA 3M4IA 2Y0SA 1I4RA 1VQ4A 3GIJA 2R93H 1KT8A 4A3DB 4LWCA 2A68D 1PYWD 4A3MB 3UZBA 2A74C 4DXGA 4OHJA 2UU9Q 3UQ8A 1Y8NB 4N8FA 3M7NA 2L5TA 3KREA 4NYEA 1HXYD 1K28A 1WCMB 1XMQL 5M3FG 4DU9A 1TT2A 2B2WC 3T9AA 1KLUD 5I4DA 2X5RA 2E2IA 1D1IA 1FD7D 5JAVA 3U54A 1A48A 3I4NB 3D8GA 3S1QH 5JVG3 5J39A 1L0YB 4JI0L 4MA5A 4CE5A 4JI4L 2BQRA 1C7YA 3GDEA 5KG2A 1FL0A 2E8GA 3CMAA 3KUPA 4X64Q 3G8DA 2NVYB 1N36L 2CNVA 1EEID 3KF8B 1SXTA 3WOEA 4EQOA 3A7AB 4O3OA 1NR4A 1B7YB 2EDGA 4MZ9A 4LJZC 4JBMA 1KDAA 3TEHB 5ISRA 2V5AA 3WNZA 3NTIA 2YU9A 4Q5VA 4S3SA 2NUAB 4K6NA 4NDXA 3H3VC 5EOYA 4X66H 3O13A 4PZ7A 4A3JB 4YHHH 5FLMH 1W6KA 4CGYB 4DAPA 2SCUB 4JOIC 5KFBA 5DGHA 5DGAA 2CVRA 2RHSB 5CV6A 1KC7A 4AQYH 3W2DA 3ULLA 3VYSA 4JI5Q 3I70A 4RKBA 1C3OA 2EJ2A 1F9SA 3AX6A 1KDCA 2AKWB 1FJGL 2IMWP 4R4TA 1A2UA 2HT1A 3RBDA 1ET0A 3UDGA 1LM0A 3T53B 1C30A 1QB5D 5C0XG 2J6TA 1YVCA 2A69D 3GTQA 2PMZB 3BZDB 4NXML 5KNCA 2YRXA 1B33N 3A56A 1PHJA 5D1PA 3KF6A 5M5WB 1F9RA 5EPLA 3RV4A 1IBLH 3HGBA 4DV7H 5D3DA 3TP8A 4RUAA 3I3CA 3HOYB 3KLRA 4BY7H 4GLXA 1QG7A 3DUZA 4R9WA 1X3EA 3OSNA 3HOYG 4H0LC 4C3HB 1PZID 2WB1G 4O86A 1BCPD 5DQHA 4DR2Q 1GSOA 3P20A 2R6GA 2IHFA 1Z7TA 4LW1A 5HGQA 2ZM6L 4TVAB 4OWXB 4ILWA 1DOLA 1CKNA 1PZKD 2ZTCA 1YITA 4LF4Q 3NEMA 5COYA 1EY5A 1A3UA 5CR3A 1HR0Q 3OUZA 3EVQA 1HZ9A 4QL5A 1JOQA 2NVXH 2JA5H 2BOSA 3L3OC 4DV6H 1EFWA 2W70A 4C3JG 3LMLA 3GV8B 1VF7A 3GQBA 1K8OA 4IJHA 3DEOA 2W9AA 3A54A 4DV5H 4KKSA 1GM5A 4GKKL 4IRDA 4B3RQ 4NPSA 4GOPC 1K0RA 1N32L 1I4QA 3PQIA 5EGTA 1O7LA 4QMGA 4CMDA 1GYFA 3S2HH 2ABJA 2AHOB 1FGBD 1SJED 2XVSA 3DHQA 2HHHQ 1SE4A 3Q22A 2JEFA 4J6HA 4Q4CA 1JJCB 1C0AA 3PGZA 4WD3A 1HR0L 4DL6A 3NBHA 4FXKC 2NZOA 4K5WA 3S1RH 2R8IA 4A3LH 3RNUA 3MFGA 2F0TA 2OTJA 1TAEA 1ENAA 1PTOD 3H3VH 2HVSA 4DR4L 1XMOL 3KXYT 3F2UA 5D14A 3ORQA 1LTTD 3J81c 5C44B 1HJPA 4JC0A 2B2UC 3CU7A 3RB0A 1X65A 3V05A 4YR2A 1M0TA 4O7SA 1DXMA 1BXTA 1Y1WB 5I47A 3KDFB 2F0VA 2EYHA 2LSSA 4L6TB 4MIUA 1Q1EA 4Y8VB 2RBMA 1NAPA 1K83H 4DV6L 5CA0F 1S9FA 3T9DA 2W6OA 3T54A 4DR1L 3K5NA 2B2VA 3CMEA 4HN2A 4JV0A 4C3JH 4DV0L 1Y8PB 1C9OA 5JJKA 1YHQA 5EQ0A 3K58A 2ATLA 3I56A 1CA6A 5ELCA 1HZAA 3NTHA 1Q8KA 3I55A 4QWDA 1WTVA 3JAMc 4YCUA 4LFBQ 3LWEA 2X69A 3W1BA 3CPFA 1LUZA 1D5ZC 4L5QA 4C2MB 4XX0B 5FD5A 4TM5A 2ENBA 4ULLA 4JI1H 3VYRA 4LFBH 3H91A 4O7VA 4X6AH 1QE6A 2HD3A 3M4YA 1WTHA 3BVZA 2UUAH 2Q7DA 5IP7G 2I80A 4YWMA 5I5VA 4B3TQ 1OBDA 1BJTA 5LMUH 3T16A 1Y69U 2VZAA 3GTLA 5KNDA 1S5ED 1YJNA 4RB0A 1I50H 3QR8A 3HOXB 4WFN3 2ALZA 4X65L 4XQNA 1RJPA 2XCAA 5KFCA 4Q8FA 3TIGA 3DWAA 3PUWA 3UE1A 4JI4Q 4HMJA 4LK1C 2R7ZG 2SNMA 3TEKA 2F0QA 5GONF 4M7EA 1XNRL 4RAZA 4F4WA 3S2HB 4LFCH 1M7JA 4A3KH 1TY0A 2HGSA 3GIMA 5IYZF 2G5DA 3EPGA 3BZKA 1R9TH 4L63B 1VQIA 4QQBX 5IP9H 1EZ6A 1PTOH 1J8IA 1Q81C 2DWCA 4B3RH 5JPNC 4Q44A 4PV1C 1IZ6A 5BN5A 5A2QW 3J81E 1BCPB 1U4MA 1ZHQA 5FPOA 2COIA 4WHXA 2UU9H 2PZTA 2QA4A 3RLOA 4IUNA 2EJ0A 3N40P 1U4PA 4ECUA 3J7ZC 1N56A 1M8AA 2UVUA 3G6VA 4IUUA 3GTGB 2D62A 2ES2A 3TIIA 4FE2A 2FK3A 3T13A 5IYBG 1PH4A 5LMNW 3PIOA 1WVLA 3RD4A 3QWUA 5BWRA 2CKZB 4O4HF 3PR4A 5FD6A 1EEFD 3TY9A 1VQFA 4BWGB 5ELEA 1O80A 2IPKD 4HR7B 5FLXL 4PQXA 1WD1A 3MEFA 3GTJH 4ECVA 2Z6BA 1GVPA 5FPRA 4JK1C 1JQYD 2KHSA 2JYOA 4PDBA 5JVH3 1KL9A 3HT5A 2PI2A 4V0BA 5CORA 4FF3A 4UCOA 1WI5A 4U6PA 4KKUA 4IOAA 4DV4L 4ED3A 3SR1A 2A73B 1DV1A 2HDLA 5IYDH 1LABA 2Q2TA 1TWAB 4B9WA 3X3NA 4GN4B 2UUBQ 3FDSA 1CSQA 5K2MA 5BYAA 3NXWA 3SK8A 2JA8B 3TINA 3GILA 2FHTA 4DV3Q 2W9CB 1EQTA 2PQAB 3VYUA 1PH8A 3U9SA 1V9PA 1YHAA 4YWKA 3UYYA 3M4PA 5KFVA 3FDTA 4I55F 4QUFA 4O2AF 4K8JA 5CB4F 4NXMH 1X54A 2QCPX 4ZRZA 5BN3A 1SYBA 1DONA 1A3VA 2DY7A 3J7AF 1LT5D 3VNNA 4DV7L 1DD2A 5M5YH 1VQDA 1B53A 2EZVA 4DK6C 3G48A 1IW7D 2QK4A 2R8JA 3DAAA 4HJ5A 1IOWA 1H9KA 2HCCA 4L8JA 5CA1F 4JI4H 1N9WA 3GTPH 4A3FG 1PRTD 2F4VL 1PRTC 1XPUA 2EYFA 2BE5C 2JN4A 4CBVA 2R3ZA 4A3FB 3S15H 2J9GA 1B44D 3OWFA 3SVMA 4C3IG 5C4XB 1IYJB 3TP5A 1XTDA 3ZYYX 5LMNH 3PO2H 1AUVA 1D8LA 5L1IA 1BO0A 2NVYH 4BY1H 2B2WA 1PRTB 4OO1G 3LWBA 3U58A 4A93H 1L1OC 3EFXD 1EY9A 5CAEB 1GSAA 4DR7L 2ALYB 3HKZA 4HJAA 1WRVA 2FPPB 3NSWA 2V1CC 4A4IA 1G91A 4HIKA 1SMXA 3TSSA 2DZDA 3QJYA 5J2UF 2FXQA 4LUOA 4UP8A 1MSHA 5BR8Q 3OIPA 1JJ2A 3GTQH 3L4JA 2E5LH 2JEGA 2VW9A 4EX5A 2C9OA 5C1OA 4XT1B 1CUKA 2Q2UA 1JE5A 2QF7A 3K7AH 2K5HA 2B29A 4ME6A 3N41B 3K57A 1E3PA 4JI2L 2VQEL 1QNUA 3IG0A 4MV4A 1S4ZA 2WAQB 3VR2A 4X66L 3MXPA 4X66Q 5FK9C 1HNZL 5F2DA 3HOVG 4ZUIA 1N8RC 1PA6A 4DR6Q 5C3EG 2VQEQ 1Z2NX 2VPSA 4JI2Q 1WTRA 3CVZA 3N44B 2FLLA 1UE7A 1IYEA 1E4GT 4A93B 1EKVA 1SCUB 3H4BA 4UCVA 3Q2OA 2Z6KA 1XPRA 1EWIA 2OXPA 5BR8L 5LMNQ 4C2MA 1EIFA 2EJMA 2Y0SB 1KJJA 4DV0H 5C5MA 1XWEA 5CE8A 1X3FA 1YBYA 4F88A 4U7CA 2F0FA 4KN4C 4CKEA 1ZQ7A 4UHVA 1AE2A 4CJ2C 3ETJA 1IBLL 4B3MQ 3GIIA 2SNSA 5KG4A 4KLKA 4MAMA 5M3FB 4FGRA 2F0HA 5M5XH 1E4EB 2R7ZB 5KFRA 2V59A 1SMYD 4DV2Q 1UEBA 2P5ZX 2EYMA 2CCZA 1V4YA 4F50A 3PO2G 4DV1Q 3FP9A 4YHHL 3GTMH 3BA8A 2W8LA 4EGQA 1HNXH 4Y7NB 5GQOA 2VS1A 3WOFA 3RN5A 4QSHA 2EIFA 3E9IA 4UUGA 2UXBL 5JJLA 1JIHA 4FBTA 3N43B 2B63H 4IRKA 4LF5H 3CP0A 3U50C 3V4ZA 2MPMA 2HHHL 2DUDA 2DNEA 3CKIB 5KNBA 5I5XA 4FP5D 4X3KA 5C3WA 5LL6S 1ASYA 1AE3A 4MHEA 1N32Q 3OWEB 1XNQH 4F8MA 4G7ZC 2KEEA 2R7ZA 2Q2HA 3E3XA 2VUMB 3CQZA 4RCOA 1LTAD 4RAYA 1LTLA 3TBIB 4QW9A 1HUMA 5I6WA 1B4OA 5KYIA 5KFJA 2XRQD 5KG7A 1KRSA 4AYBB 2EYLA 5JPMC 3SK6A 1LT3D 4J15A 1BF4A 3J81W 3L4KA 2YV5A 1EYZA 5CMDA 2RHQB 3AB9A 1KTKA 2FPGB 5GROA 1I4PA 4CHIA 2KBNA 3G71A 2HDKA 4RMFA 1DIKA 1IYDA 2JA7A 5AJ3Q 1CK1A 2ZM6H 4EYIB 4YY3Q 1P16A 2IY5B 4G7OC 4B3SH 3CQZB 2DLNA 2K5WA 4FO2A 1I2LA 2VUMA 1A0IA 1CA5A 5LOVF 1JX4A 2B63A 1TU2B 4ZOLF 3BACA 1CQVA 1G51A 4WJWA 1VQAA 2R8KA 4JW0A 1NTGA 2N88A 3BYYB 2UVVA 2ZXPA 5ELNA 5FJ8H 1XJVA 3GTMA 1YZ6A 2LMCB 2MUYA 3I4OA 4FBUA 1JE4A 2K05A 5C4JB 4MTEA 2FINB 4JI3H 3BJUA 3F2DA 3K8AA 4CDEC 1JORA 4K2KA 4YWLA 1K8GA 4GKJQ 2NVYA 1E1OA 2I8CA 2F0OA 5IYBH 3CHBD 5IYCG 3Q8PB 3JSLA 1WH2A 4DV2H 2YW2A 2E74C 1TXYA 3R8BA 1HHVA 3T1YL 4PZ6A 1TS5A 4NLGA 2W9BB 4HIOA 1PH5A 3WDNA 1XMOH 1PTOB 1PVOA 4ZCKA 2JA8H 3SDZA 4O1NA 4CKCA 1Y1WH 4JCVE 4Q0FA 4BXXG 3KLSA 4DA2A 4AQYL 2FMAA 5IP9G 4O7YA 1OXSC 1EIHA 3UFXB 5EKKA 1LT4D 5KFKA 1AN8A 2O5JC 3BABA 2RDHA 1MKHA 1L0XB 2OCEA 2DPJA 5EKIA 5KFMA 3VMMA 5IOCA 2W9BA 1HH2P 3BU2A 2YCHA 1TKWB 1IBKQ 2ASJA 2NU7B 3OTOL 5D65A 3S15B 2LKVA 3K5LA 1T5EA 3WWHA 4BA1I 5C44G 4M9UA 1EZ8A 1K1QA 4TSSA 4DK1A 2JA7G 2NWGA 2CW0C 4LF8L 2UUCL 1II3A 3AMUA 1A0GA 5BWXA 2A1AA 4A2BA 4J9MA 2JA7B 1XTCD 4CKBA 4B3TL 4MV7A 4FVMA 2F52A 3RAXA 3AYHB 2F03A 2C00A 1CM9A 5JQGF 4DL2A 2UU9L 4DAVA 3GV6A 1JWSD 1SYXB 3JZIA 1HZCA 3DWPA 2PPBC 1DYQA 1SNMA 4IALA 3AFQA 1Q1BA 1X3GA 1RJTA 5FNVF 1SE2A 5KFQA 3KHGA 1Q12A 4ZLTF 2RKSA 5IWAQ 2JK8A 5GAHC 4L5RC 2M2LA 5C4JH 2PI2E 2WIIB 3VOTA 2UXCL 1QUQA 1ICFB 2PZWA 4MV3A 2NVXB 2ICIA 1EKFA 2ZTEA 2FLNA 5E25A 4J9LA 4A3DG 2N3SA 1GOZA 4DV5L 2F0NA 3I4LA 3T5LA 3A74A 4MV8A 3EIVA 4YBZB 3OTOH 3N6XA 2YU9B 2VR1A 1DCZA 2XRSD 4DV6Q 4C1NI 3V6HA 1TY2A 3HOUB 2R87A 1E22A 2Z4IA 4DAYB 2XNAC 1HNWQ 2E5LQ 3HO8A 2G9HD 3PO2B 1RCVD 2Q8RE 3BZCA 4GKJH 5H1SE 2K28A 4LF9L 2ODTX 4KHZA 1XMOQ 5BMVF 2DJFC 1LTID 2HHFA 4DR4Q 3OSOA 4K8IA 2ZDHA 4A3LG 2OLSA 3CCJA 2OF1A 1H95A 1HRJA 1TIID 3JZFA 2YTXA 1PH9A 4LF5L 4HNTA 4IR9A 2MO1A 4NXNQ 1BOSA 4LH7A 2HIXA 4RB1A 1C4QA 1KXLA 4IHJF 2CWPA 5EPKA 2A68C 2Y0SE 1JCKB 3PN1A 1SYGA 3PV0A 4J9SA 4DR1H 4NB3A 3KBXA 4MV1A 2EE1A 1AN7A 3K7UC 5IGBA 5A35A 4A3JG 4NZMA 4DK3C 3DF7A 4A3BG 4TV8F 2QGQA 5EBCA 1B04A 4EBCA 2B2UA 3MR5A 1Q90A 3OHAA 1FYCA 1O75A 4A3BB 4KMUC 5LYJF 1KNEA 2PQEA 4Q0YA 3NTKA 2F1MA 1YIJA 3LQSA 3G8CA 2NUCA 4U68A 5HY6A 5JJIA 2ZM6Q 3DM3A 5IGCA 4UY8C 1V1QA 2VUGA 3BDCA 4KTAA 1VQEA 3T9FA 2XCLA 3JSNA 3V6KA 4K0KH 4HAEA 3FMCA 2J0TD 3TS2A 4BY7G 4JI5H 4R8NA 3ICEA 2WAQA 3S1QB 2JA6A 5DGBA 2KECA 1E4FT 2GN5A 1J9OA 4DR7H 3UZOA 1QVCA 3K80C 1ESFA 4QB4A 4QF4A 3CC7A 4A3BH 2WV6D 2PBZA 1KABA 3UDIA 3K3PA 1IKMA 3PUXA 2FKLA 4JI3L 4R8IA 1S68A 1UE6A 2XWJB 3CCMA 4ZKCB 3MJFA 4XYLB 3FKIB 2YRWA 3BG5A 2E2HA 3HFZB 4GLAC 4OX9L 1X55A 4NP5A 3T9CA 1EY6A 2N55A 1WFQA 5FR9A 5J1ZA 3LX0A 4JI6L 5JVDF 4HN7A 2C2EA 1GHKA 1CKMA 4R4IA 1EQQA 3EA6A 1EYCA 1KIXA 1MD2D 2R61A 1NJIC 4CDDC 5CV8A 1PDQA 1PRTF 2MFIA 5NUCA 5FLXE 2QDBA 5JJZA 4LF9Q 4ZYSA 4R4OA 1GLVA 1Z6HA 2C35B 2NZHA 3VYTA 2I5MX 3EYYA 3A5UA 4C5CA 1VQLA 1A2TA 2L55A 4J9OA 4ZKBB 5C4HA 2KHIA 3IFTA 2IW3A 1XNQQ 1TVXA 4I7HA 4R4CA 4XYMB 1TR5A 2HUGA 3VA5A 4DK0A 4EFBA 4GC6A 2L12A 2XGTA 5JQWA 2YS6A 4RHSA 1HR0H 2F4VH 1UNNC 4R7RA 1TWCH 4UFZA 1KAAA 3M4OB 1J5EQ 4PZ8A 3BG3A 4IZ8A 5T1GA 3D4WA 3MXNB 1KJIA 3PF4A 2HGWA 4L1KA 2E2JH 5M3FH 1A15A 1MHWC 4TUYF 2BE5D 4IUPA 4RKLA 4ECWA 1E24A 1V1PB 2F3IA 3SK5A 5HNEA 4JI1Q 5KT6A 1EYAA 2UUAL 1YI2A 4LFCQ 3TRZA 3Q8RB 1X56A 5G3LF 3CF5A 5I60A 3T99A 2Z1CA 3I72A 1I50B 1HNXL 3SHLA 4DR3Q 3KAJA 3V96A 2VUMH 5JUMA 1TWFH 4DV4H 2V9WA 3HG9A 4RGTA 2PQAA 4RNMA 4DR3L 3GTKH 1CFMA 2R93G 1GHJA 2A6EC 2BCOA 4LSXA 2ASDA 1B9NA 4GNXB 5HURA 1HQMC 4X62L 2BH2A 4LFCL 3K5HA 1XX8A 2EY2A 1AZPA 1WYDA 3I4MB 3P7JA 2E2JB 4DL5A 3K59A 1HQRD 2JA7H 1CSPA 1VQCA 1O7IA 4HYKA 4DV3H 3I4MG 3LGJA 4DL4A 1S40A 3K7AB 1EOVA 2WACA 1OTCA 3MR3A 3VPBA 4IWXA 2HIVA 1YNJD 2EYPA 2Z02A 1PYSB 2RSOA 4RGMA 5C8YF 1VQMA 3HOZG 4P71A 2EPBA 3GTOB 3V6JA 5I5UA 4DAMA 4YR3A 2QKIC 3QO2A 3HBLA 1SNQA 1IKLA 1I3QH 2MP1A 1WCMG 2Y0SG 1EWHA 2NVXA 2JA5A 4JV5Q 3TY8A 4IPGA 2RGVA 1P8LA 2WE6A 5G3LD 4KHPQ 4XYQA 1EY7A 1RIPA 3VR6A 3P1HA 5IGGA 3NBYB 4J9PA 4JG2A 4XQQA 1I2KA 3AU7A 3PVXA 2IHEA 2Z4HA 1VQKA 5BYBA 1C48A 1H9RA 2B2VC 4YAJB 2CNUA 3GV7B 3PF5A 4GNXA 1ENFA 2NVQH 4K5VA 1BQQT 3GTOH 4LF7H 3S1NB 1BCPC 3IFDA 4RNNA 2K7VA 1OWTA 3RB4A 2K04A 5C4ZA 2M05A 2C2RA 5TSSA 3U9TA 3D31A 2Z8LA 2EYOA 2CNQA 3Q1KA 3KHLA 2NN6I 3BQ1A 4LF7Q 2C28A 2PYKA 2BA1A 1VS0A 1VDZA 2ZT9C 4QIWE 4A3CG 4EGJA 4RZRA 2F0PA 4JYAH 3V4SA 3MFIA 4FU0A 3PIO3 2JEJA 4FYDA 2WYOA 3NUAA 1EY4A 5DG9A 4OONA 4B3SL 5DMXA 5IIFA 3N42B 4FS2A 1B70B 3PO3B 2GVBA 4BBSG 1PK8A 5D1OA 3NK9A 5ELFA 5AJ3L 5ELOA 2H1EA 5KFOA 1W2BA 3RB3A 2OQKA 2K4KA 3I4NH 3GB8B 2ZJRA 2L4NA 1RDPD 1CT1D 4ZUJA 3T9EA 4YQWA 3A55A 1S5DD 4MV9A 1FNVA 4O84A 4C5BA 4LF8H 2RDGA 1S10A 4ETSA 3K0YA 2AQ3B 2WAQE 2VPQA 1WTPA 4O0AA 3R5FA 4J9QA 3MHBA 1IYUA 1CZWA 2C5CA 2GPSA 1KJ8A 4RCNA 1QILA 4F7XA 1BUVT 3K5OA 2HDMA 3S16H 3A5ZB 1ICWA 1PXUA 3HOWB 2VA3A 4P72A 3GTKA 4NZNA 1D7QA 4FFNA 4PBCA 1V8QA 4TQSA 2R8GA 2JA6B 5D3IB 4ED7A 3HS0C 3T9BA 1JT8A 2R84A 4JI6H 1PH1A 1VBHA 2F0GA 3RMHA 3F2CA 1ENCA 3CCLA 4JXUA 1SNOA 2AUJD 4CDCC 2D5DA 3RFCA 3NUCA 3GTQB 4LF9H 3PFFA 1D5MC 3FPUB 2CW8A 4N9TA 1VQOA 4MA0A 1U5KA 4K0KQ 3GTPA 4WRDA 2JEAI 2LXKA 1PLFA 2GPWA 2CQYA 3IAYA 2N78A 1F2LA 1CQFA 2A1HA 5DLGA 2GA4B 3G6XA 2R93A 5LA6F 4JBKA 5EWGA 4JI0H 1JKJB 2FMMA 2CWAA 1SE3A 3HKZG 1I7LA 1QWYA 1M6VA 2W6QA 4N9PA 2VQDA 5CBEE 5LMNL 5KT3A 4MN3A 1HA6A 1YJWA 4F4ZA 2K5VA 4Q43A 2K5NA 2DIKA 4KJNA 3JAMi 4IIJF 4DV1H 1ULZA 4I4TF 3VPDA 4WJ4A 3RTXA 4X64H 2DJGC 5GADC 5KT2A 2K52A 3R93A 2NTTA 1PH3A 2PVPA 3KLWA 3TQYA 3VPCA 2FK2A 1EOTA 4QIWA 1VBGA 4RNOA 2NN6H 3JAML 5C3EH 5DQIA 3J80E 4X3SA 1RTOA 4KY7A 1NSNS 3HOVH 4C5AA 5IODA 2KA7A 2H4OA 3FPPA 3MXNA 1BDOA 4H7BA 2AQ2B 2F0WA 4DRFA 2UXDQ 2UUCQ 3R5HA 2PZUA 4QJFA 2MHVA 3D3RA 4O7NA 2B63B 1J6QA 1ML0D 5IGEA 3JRWA 4OXPA 3GV5B 3GTJA 3GTGA 1IBKL 4Y7NH 2TMPA 2M9VA 1O78A 2XIWA 1DOKA 1K8MA 2UVWA 3AQQA 4K6DA 4L5SA 3DTGA 3M9MB 3MR2A 5DLQE 1LV9A 3EPIA 4A93G 3VA7A 1GO3E 4AYBA 5M5XB 1SNPA 3M9BA 4IN3A 4DR5H 1DM0B 4C3IH 3T5HA 3PMFA 3F1ZA 5I5SA 1Z47A 4EYHB 5FLXW 4JI7H 1IOVA 3LWUA 4XIGS 1VQGA 3R2TA 3CCVA 1K3BC 3BS1A 1U0LA 1WR2A 3CSWA 2CQAA 5KFAA 2JEIA 3KJOA 3NBHB 3KLSX 4NKLA 3U4ZA 1HTPA 3CXCA 3C2PA 1UE5A 4O2DA 1K83A 1H9MA 2E2IB 4LF7L 3G4SA 5E4XA 1U4LA 2R7LA 2XGPA 5KFLA 4DKAC 4MV6A 4JI8H 4GKJL 2L9HA 1SYCA 1EIGA 1YJ9A 2DABA 2Z9HA 3J80W 5J3BA 1HZBA 4HEDA 2NU9B 4F4YA 1MSGA 4UDUC 1K1SA 5DEHA 1EYGA 1A3TA 3V2TA 2I87A 2EVBA 4DV4Q 2CW0D 2YL2A 2F0IA 3STBD 1K0SA 3RIZA 2J4XA 4DNTB 5IYDG 4A3GB 1VMCA 4DNRB 2VUMG 4RB3C 4WJ3M 4LMYA 3N52A 4O42A 5M5WH 3Q0AA 1CI3M 2IWHA 1IYVA 1SEIA 5D8DA 2K32A 5JH7F 1Y1VA 2XN9C 1LYLA 4PG3A 1UWVA 5EBDA 2WFWA 3CAMA 3GLKA 1VF5C 2F3WA 1JB7A 2BH8A 2M00A 4POFA 4MTKA 1AEXA 3BDLA 1RL2A 1F9QA 3E0EA 4BA2I 4IQZA 3M3YH 3HOWG 3S1RB 2YYZA 4TV9F 3S1MB 3M85A 2V4RA 4BY7B 5C3XA 4I7AA 1ZHSA 1VKZA 4X62Q 5KRUA 3M9OB 1TS2A 2C2DA 3CRLC 4J9NA 2HHFB 2MCTA 4RH6A 4A3EG 2MGSA 3HEJA 4BS9A 4ECSA 5KT4A 3J7AV 3NC0B 4J8QA 3L2PA 3VR4A 4O3NA 1LLRD 1U9RA 1B6RA 2O03A 4GS3A 4IAJA 1LTSD 1STYA 5KT5A 2W8KA 1V1OA 4RAUC 1SLJA 2AWNA 4UCUA 1CKNB 3S1MH 2B3GA 2QDLA 1E2WA 4C3JB 4MNOA 3ZJYC 4UP9A 5IY0A 4DV2L 3OW2A 2L15A 5KIXA 4FM9A 1D5XC 1HFGA 2R92G 1GUOA 2RSNA 1ESRA 2X6LA 4ABNA 1XNRQ 4PNYA 3MWDA 4ECYA 4OO1I 4E4TA 1N33Q 3QOLA 1VQ7A 4ECTA 3SGIA 5FLXc 2L0CA 2JXMB 1OBGA 3W1GA 5DG8A 5KG3A 2DN8A 4DAYA 4EFEA 3DXJC 2R85A 2IBKA 1G2SA 3BDOA 3H40A 2HQEA 3I91A 2Q8TA 4DUYL 5DGIA 4O7TA 2KCTA 2YU9H 2O5IC 2MNAA 4PMBA 4IJLA 4OL7A 3C1EA 4DR6L 4EQPA 3R9RA 1LTRD 3URYA 2RF4A 5I5TA 1S3OA 4DGZA 1NR2A 1S5FD 1L0WA 3GIDA 1QJOA 4GNXC 4QWAA 2HVRA 2E75C 3H6MA 1DJRD 3A8IE 2YZMA 3BVMA 1X6OA 2BDNA 1A3GA 1N36H 2YTVA 2R93B 4IFDG 1S97A 1XNRH 1KDBA 4O3RA 3I12A 5LMUQ 2RQXA 3BAAA 4B3TH 2KCMA 1NUCA 1S72A 3UI2A 1WTWA 2EJFC 1GKHA 5JEAJ 3J7YW 4DNIA 5JEAG 3DEPA 4K5XA 4QGUA 4LF6L 2K5DA 1G6ZA 1RJRA 1RK6A 5CV5A 2F0SA 1UC9A 1KJQA 2YZGA 3I2ZA 1TS4A 1B6SA 1HUNA 1TWGB 2O2LD 5LMUL 1SMYC 3PSIA 1PH2A 2FJZA 2EXZA 3HXLA 4AYBE 2B39A 1MBYA 1VQ8A 4YIJA 4O3SA 4B9XA 4G3IA 1EKPA 4O2BF 3TY5A 3QOJA 3F8NA 2Q2IA 5FOBB 1A8VA 2IX3A 3OHBA 1TWHH 1IBMH 4RU9A 3R2IA 4DUZL 3J81L 1CS0A 5EPJA 4HNVA 5F9NA 5KFPA 4DUYQ 3SK4A 3CCQA 3TZUA 3HRZC 4B3RL 3KK7A 5LXTF 4LFAH 1PX2A 2NZ1D 1VQNA 5ELBA 5JEAH 4K2LA 4OEMB 1GXDC 4A3DH 3GJXB 1X3PA 1N33L 2B2TA 3K5IA 4K14A 1XXGA 3F8TA 3LULA 1VQ6A 1Y14B 4DL7A 2L1BA 2WB1A 4IRCA 1SROA 4LF4L 2DNCA 1I6VC 4KV6A 2YWVA 2COGA 4P75A 4K0KL 5L1KA 4IFDH 1TS3A 2A6HD 2X6GA 1D6EC 4JI7L 1RK5A 5HBRB 2K50A 1TWFB 2UUBL 3S1NH 1Q82C 2YTYA 2JSOA 3NWSA 2LXJA 2AQ1B 2AUKA 1KTAA 2R82A 3E5NA 3HOYH 1SNCA 1TWHB 4C1NK 1VQ9A 2SDFA 1HNWL 3Q8SB 1PFSA 1O7ZA 3QQMA 4JV5L 5IWAH 2L11A 2I0QA 1CKOA 4A3IG 3KHHA 3FKIA 1B3QA 5DQGA 4JI8L 3H15A 5C44H 2BR0A 4BBRH 4NXMQ 2WDTA 4A75A 4E6IA 1WD0A 4PWQA 2O4XA 5IGDA 4UCRA 5C0XH 3GTJB 1FJGQ 1CHQD 4F4XA 2J6SA 1DZ1A 3EN2A 2W71A 2YYAA 2KENA 5KX5F 3DMUA 4V190 5KFIA 1PFBA 3CQZH 3PCOB 3OMGA 4RA8A 5EWFA 3MAQA 3NENA 3TDQA 4IO9A 1QVGA 1N34H 1AFPA 5HV6A 1OXUA 2ATWA 1I6UA 2JA8G 2V58A 4N8X1 2UVRA 4EEYA 3IL8A 1N34Q 3DM1A 5IT9L 4J9RA 4HIDA 2JA5B 1N36Q 4LSAA 3PIPA 1MI2A 4KK7A 1NY4A 3W3AA 4LF8Q 3JAMW 1LACA 4RWSC 1A62A 3NQIA 1SE8A 3A8JE 5IYCH 3Q8QB 3M3YB 4DFAA 4A76A 3B6YA 4JI0Q 5M5YB 2W9CA 2K5QA 5DLFA 4EG0A 2OTLA 1IBKH 1TWAA 3K5MA 2XWBB 4P2CB 2NB0A 3KJPA 2VQFL 1E4EA 3RZOH 4DPGA 1EY0A 2DPIA 4X65Q 3IRBA 4MTNA 1XMQQ 1WSCA 4LFAQ 4GKKH 1HNZH 1FGUA 4GN5A 3TN2A 1BCPF 4M0JA 5CV9A 1FKAH 3S17B 2XC9A 3GTMB 4B08A 3AFPA 2JP1A 4POGA 4JOIA 4CDFC 4LH6A 1BXRA 1FNUA 4QUCA 2HCIA 1HPCA 1HR0W 4XQJA 3OW7A 1I94H 5KFTA 3HOXH 3T7AA 3TW6A 4XT3B 1OXXK 3OYYA 1B9MA 1NE3A 5K36G 1SYFA 4UCTA 5C6AA 3G6JB 5IT9c 3KFUA 4APMA 3OOCA 2D0OA 1TWHA 2WB1E 3PUZA 2RCNA 1SFOB 4O3PA 1EHIA 4DN4M 1EUCB 1M90C 3HB9A 2QILA 4GN3B 4QWEA 1UAPA 4GC7A 3KF8A 3U55A 4DV0Q 4HNUA 4M8AA 4F87A 5AFWA 3KAKA 1DAAA 1IL8A 2F0EA 2NU6B 1NMGA 4QCLA 3MTSA 2XD4A 4GLVB 4RGNA 5EZYF 1GUGA 4X62H 4KD3A 4DQNA 3FKIH 5IT9W 2JA6H 2HGXA 4EBEA 3MXUA 3GTLH 2DY8A 1PYBA 1JXLA 1BNZA 4DR6H 1D1KA 2XTIA 1EY8A 2B63G 1F77A 3FHWA 1W6JA 2PMZE 2TSSA 2OT2A 3FEWX 2PW7A 1EQRA 3WO0A 3KTMA 4QWBA 2CH4W 3GP7A 3S14B 1IW7C 1I7NA 1TWFA 4ME3A 1N32H 2WKDA 1JWMD 5BPFA 3MC0B 3U0GA 2ZJPA 2UUAQ 1Q46A 4JI1L 4JPBW 4IR1A 4FFMA 3HOZB 1AW7A 1SEBD 1SN8A 5FO7B 4J0MA 5T14A 3UDFA 2B2TC 2WB1B 2VQEH 2OH2A 3GTLB 1J5EL 1NCVA 2KSWA 1KHIA 1RYSA 3N6RA 3RN2A 4A3KB 3QZ7A 1Z9FA 1GJXA 4TQRA 4CJ1B 4DL3A 5KFHA 1TWCA 4H02A 4ME5A 2F0UA 4JVZA 3CCUA 5HGTA 1E7ZA 1YHBA 3BJYA 2K01A 2IT1A 1S0MA 2EYJA 1QOHA 4FDBA 1QZHA 2FB9A 1ZXTA 3MXGA 2HHHH 1I1KA 4HJ8A 1KEEA 2YS7A 2MJ8A 5I9PA 3R5XA 2UXBQ 2FJ2A 1CZGA 1L2FA 2PCFB 3JC66 2W6NA 2K6AA 3NHHA 4LF5Q 1B2TA 4ZQIA 3GTPB 3ULJA 3GIPA 2W57A 2AMCB 2I5HA 3OHXC 4DR2L 4JI7Q 3H4DA 2R7KA 4JI6Q 4GOPB 1JB3A 2IX1A 1SRUA 5CV7A 2NVQB 1ZYRC 2D9UA 2C22A 4UPAA 4XXEA 4OX9Q 3NBIA 1BGWA 2AQ4A 5KFDA 3TS0A 2XIGA 2E2HH 4A3GG 2K33A 3EJIA 2QEJC 1V51A 4L5TA 3RF2A 1N33H 1X9NA 1ASZA 4BBSB 5M9OA 3KALA 1PFNA 5KG0A 2YZLA 4O7RA 4R1JA 1W3SA 1EU3A 2UUCH 3PW7A 2J6UA 2B2YC 4G57A 2ZDGA 1STAA 5E7NA 4BY1B 1WJJA 1NMFA 2UXCQ 4X3TA 2ASLA 4HJ9A 4FF1A 4BY1G 4DUZQ 2VNUD 3ONAB 1VQJA 1D2BA 2NVTH 1RODA 4RB2C 4O4LF 2F4IA 3FVQA 2VY3A 3RAQA 3Q23A 3RR5A 3Q24A 2BDOA 2YZNA 4G4KA 3GTGH 1KC8C 4ECXA 4B3SQ 2MQHA 1QUQB 1RJQA 2JA6G 1ZAUA 3FKIG 5KFFA 4ECRA 2RVLA 4FXGC 3M4QA 3QZ8A 4X64L 1RYRA 3S9WA 2IJ0A 2PNHA 3GIQA 5I5YA 4EQ5A 2F0JA 1H9SA 5EAYA 2FP4B 2R6FA 2EIYA 2A6HC 1BR9A 5L1JA 4IFDI 1VQBA 3EBEA 3T51B 4FF2A 4OELB 2FFKB 2K1BA 5LHY1 2CHBD 1JLLB 3Q6SA 3RLNA 3CD6A 1YNJC 2R92B 1JDEA 1BVSA 3TQTA 5I2XA 5K36H 3HOXG 4AQYQ 4BWSC 4O82A 2G9DA 2N8NA 3ERSX 3I4NG 3HOUH 1EUDB 2ZDQA 5E3FA 1RF2D 2NYZD 3BYTB 4KN7C 3CCSA 2A5HA 3PW5A 4KHPL 3CC4A 3TP6A 2PMZA 1XPOA 2UUBH 2E5LL 5KYLA 3RZOB 4ZHQF 3T1YQ 4OX9H 1EIYB 2JE6I 4EGVA 1ILPA 1PFMA 4IPDA 2XGQA 4XDXA 4OWWB 4A3MH 1SYEA 4LFAL 2BQUA 1I4XA 1T9HA 4DV7Q 4A3CH 1UC8A 3G6YA 2W6PA 3RJ0A 2KHJA 1JMCA 2VQFQ 3WWVA 1S0OA 2EQSA 4TKOB 5BN4A 1SDFA 4B3MH 3IKJA 2GLTA 1E2ZA 2E2IH 2LFNA 3RUZA 2EY5A 5BR8H 2BA0A 4KHVA 5IWAL 4WBNF 2NVTB 1RKNA 4NZOA 3QIAA 4EQNA 4O7WA 3H0GA 2WP8J 5I5WA 2KUMA 3KOJA 4UCSA 4AYBG 1SFOH 3MWMA 3FRPB 3D4RA 5T1IA 1IBML 1MIUA 5CR5A 1N34L 1HFNA 2Z0SA 2ZJTA 4KHPH 1EQVA 1O7YA 2NTSA 3QWNA 4JI2H 3AW8A 5JVLA 4ED6A 1MJCA 5FO8B 1JC7A 4LF6H 5C0XI 4APVA 2V4DA 3WO1A 2K75A 1N48A 3PO3H 4GLWA 1SNDA 3LP8A 4A3KG 2QW7A 2AGOA 1MGSA 4C3HG 4BBRB 4HSVA 4Q8EA 1ZYRD 5C4XH 2D0PA 4OIJA 5BWWA 2K03A 3QG1A 2R7ZH 5KFZA 3L7ZC 2R86A 4BBRG 3T5KA 2UXDH 2R7MA 3G7LA 4Y52H 4OWTB 5KGUA 4H44C 1L1OB 4CMFA 2BQ3A 1CTMA 2CH4A 4EBDA 5M3MB 2FE3A 1XNQL 5DM73 4A3IH 3OMCA 4JI8Q 3NQTA 2JA9A 4LNQA 5IP7H 1XK5A 4DUZH 3MEHA 4DR5Q 1E0BA 1EUJA 4OGQC 1GUWA 1Y8OB 1HNWH 2B8GA 1HCZA 3HP3A 2F0KA 3LNNA 4HJ7A 2KCCA 4I65A 5CGKA 4CJ0B 2EXDA 1BNCA 5K3WA 2IL8A 1JOOA 4JBWA 4ODGA 5FKAC 3J80L 3JZ6A 1Q3LA 1Y1VG 3E0JA 5D1OB 1LTBD 4A3IB 4JV1A 2E2DC 5L9XA 4Q45A 1L1OA 1I3QB 1SYDA 3I73A 1IBLQ 2QB5A 3RZDB 4O4IF 4NW2A 3M7GA 5EJWA 2HVQA 3SE7A 4HQ6A 4ZI7F 2COJA 4YR0A 5IGFA 2LY7A 1T94A 3H0GB 3RLFA 2CW7A 5KEEA 1TWGH 4RUCA 4WORA 2A19A 1QZGA 1R4QB 3RGXA 2PW5A 3NPPA 1A9XA 5E1FA 1EU4A 4X65H 4JV5H 5KKNB 4FFLA 1QCBD 4KI0A 1UE1A 1I3QA 4DR3H 3T5JA 4YY3L 4A2AA 1B3AA 1MZBA 1ONLA 1S03G 2KQ3A 3QB3A 1NNXA 1SBBB 1Z2OX 4FF4A 1VQPA 1JJGA 1GUNA 3CCEA 3T1YH 3J7A5 4X3UA 4YAKB 1B8AA 1G2WA 1ET6A 3MA2B 1HA5A 1SSOA 2ZJQA 4O4JF 4MTDA 3STBC 3J80i 1AUXA 3HOVB 4K6LA 3RBEA 3H3VI 1IHZA 1F9PA 2I5LX 1U4RA 2VQFH 2Z6KC 1XYIA 4OIKA 3SE0A 4R8UA 2DAAA 4LF6Q 3OUUA 5KS8A 5L1LA 5EDWA 5KG6A 2FK1A 1I6HB 1KRTA 2JA5G 1WCMA 2V4QA 2RDIA 3OIQA 3FMAA 2Y4RA 4FS1A 4KJOA 2R7FA 2AGPA 4J9KA 3GTKB 2IA6A 3U4VA 1OO9B 2EY6A 1B50A 5EWEA 3CEBA 5KFUA 3C1FA 1FVIA 1V1PA 4O7LA 5I6YA 2A8VA 3K0XA 4LAAA 1K9MC 1VQHA 1WTOA 5BWVA 3L0OA 4YY3H 4JUZA 1LTGD 1PV4A 5KFGA 3E9HA 4YHHQ 2LS01 3J81j 3CPWA 4GZYC 2WINB 1EWCA 4IURA 4TVIA 3HKZB 1JWUD 2SOBA 4GOPA 1Z2PX 2PNRC 3KBGA 2F4VQ 1DGSA 4CHTB 1K3RA 2FMCA 3J7AK 4ECZA 2WKCA 5DISC 3GQCA 1J5EH 3PUYA 4GKKQ 1XMQH 5C5LA 4A3JH 2R8HA 4LUZA 2OEOA 2RDFA 2SEBD 3S17H 5CV4A 4JV2A 3CW2C 4QY7A 4NXNH 1GGOA 1I6HH 5F9LA 2KVMA 2ZXOA 1Q7YC 4C2MH 2R92H 1VMPA 3VR3A 2UXCH 4ED1A 4I50F 3NBZB 1DV2A 1I94L 2NBFA 1KQSA 2K14A 3S16B 5C0XJ 2E76C 5FLMG 3CC2A 4YJ3F 1T36A 2R7NA 5KFSA 2GVAA 4FFPA 1DOMA 1AP0A 1VAJA 2IX0A 2IP4A 4HCEA 3D6CA 3SI8A 4YP3A 3A7LA 1KLGD 1ZETA 4A3EH 5DNFA 1R9TB 3F2BA 2GQSA 3MWYW 3BA9A 3RUPA 4FXDA 4H13C 3SNOA 4ED2A 2HQLA 1BBWA 3HOWH 1X32A 1BBUA 2B2YA 5JOBA 4IPHA 1JDBB 1ILQA 2JJQA 4O81A 3D4DA 3OTOQ 1B1ZA 3VR5A 3T1HQ 1TA8A 3NGDA 4DR7Q 1GSHA 1M1KC 5BWTA 4FNFA 3TREA 3S14H 4RHRA 4JI5L 3GTOA 3NELA 2KEDA 4IZOA 2XSCA 1STEA 1Y1VH 4JYAQ 1KAWA 2J7ZA 5KFWA 4IUVA 4KD4A 4U673 5CM0A 1MJEA 1I5FA 1T3NA 3ERQA 3A8KE 1S5BD 1SAPA 3GD7A 1RD9D 5CC4A 1STHA 1AZQA 3ND9A 2GQRA 3ULPA 1H9JA 3I7FA 2W7PA 3D0FA 4KY5A 1W93A 1X3QA 3T4AC 5A2QL 5IT9E 2VB3X 1PTOF 1OXVA 4JYAL 3HKZE 3I8ZA 3S24A 3WWIA 1YNXA 3R3OA 4M1UB 3MFYA 5CBAE 5LL6X 3VDYA 2Z04A 5DAAA 4CC5A 4DXFA 4NMZA 4DLKA 4IUQA 1CQIB 1KBLA 4XYOA 3T1HL 5C5JA 3PW2A 5CYUA 3S2DH 4C3IB 5C4XG 3EROA 1M0WA 4C3HH 3EQLC 3U9OA 1KNAA 1I50A 3L9AX 3GO5A 3PO3G 3UE0A 4FFOA 3NWTA 5I9OA 1AH9A 4HR7A 3S2DB 1FJGH 4BXXH 1BKBA 1JOKA 3H94A 1Y1WG 2X0SA 4IUTA 4ALPA 2AGQA 5KG1A 3PW0A 3PUVA 2I07B 1ET9A 4RG1A 1WTQA 1G6PA 3K3VA 4LMQD 1SFOA 4Z9CB 2CZGA 1PH7A 3H0GH 1WTXA 4PMCA 1STNA 2MO0A 3UDXA 1GUSA 1I94Q 2DGYA 5DM63 2RGRA 1UUPA 3J80c 4CC6A 5KFNA 2WAQG 1YEZA 3T1HH 2HJWA 1VCIA 1T5XD 1EL0A 5C3EB 4KY6A 3MR6A 1LO5D 3RGZA 3DTFA 5KG5A 4A3MG 1GD7A 1EZ1A 5LP6F 1S5CD 1FNWA 5FJ8G 3KYHC 3NE5B 5DAUA 1STGA 2UXDL 3MFHA 1JR0D 4IPCA 3AEVA 3K6OA 2A69C 1PZJD 1TWCB 1JICA 4EEQA 2VL6A 1NBWA 3CCRA 1G291 3PIP3 3I90A 1E2VA 4P74A 2OWOA 3WWJA 1K8AC 4QIWB 4RFBA 4PMWA 5A2QE 1HNXQ 4G7HC 4DR2H 5J22A 4RGOS 3HOUG 1UEAB 1KUTA 2NN6G 2Q8IB 4ZAIA 5KFEA 1Q8IA 3ITPA 1ZKOA 4TQUS 1F2MA 5M3MH 2CFMA 4DV1L 3Q8DA 5I2YA 1Q86C 3C3LA 4YCVA 1R9TA 5KT7A 3P75A 5FO9B 3J81i 3SXHA 5KFXA
chains in the Genus database with same CATH topology
4E6NA 1J5EL 4DR7L 2ALYB 1KHIA 2KSWA 3RN2A 1Z9FA 4B3ML 1OXTA 4HJAA 2JEBI 4H02A 3S16H 3A5ZB 4A4IA 2V1CC 1JJGA 3CCUA 1E7ZA 4HIKA 1SMXA 1YHBA 4P72A 1D7QA 2IT1A 2FXQA 4FDBA 4LUOA 4UP8A 5BR8Q 1QZHA 1K73C 1JJ2A 3GTQH 2HHHH 3L4JA 4HJ8A 1PH6A 2VW9A 4EX5A 2E5LH 1CUKA 4YCWA 1JE5A 1L2FA 3JC66 2Q2UA 2UXBQ 1JT8A 3K7AH 2K5HA 4LF5Q 1PH1A 4JI6H 2B29A 4DR4H 3F2CA 3N41B 1E3PA 4JI2L 3CCLA 2VQEL 3ULJA 3HKSA 2W57A 2AMCB 2I5HA 1HNZQ 4X66L 3HOVG 3IG0A 4X66Q 4LF9H 1HNZL 4DR2L 1N8RC 4LUVA 1PA6A 4JI7Q 5C3EG 2VQEQ 4JI6Q 4DR6Q 4JI2Q 4GOPB 4P73A 4LFBL 1VQOA 2CW8A 1U5KA 2QEXA 2IX1A 1SRUA 4K0KQ 1UE7A 2JEAI 2LXKA 2ZTDA 1E4GT 4UPAA 4OX9Q 1BGWA 2N78A 4UCVA 3TS0A 2Z6KA 2XIGA 4DUYH 1XPRA 1EWIA 5BR8L 5LMNQ 2E2HH 4JBKA 4A3GG 4JI0H 1EIFA 1WOCA 4APMA 1V43A 4DR1Q 3RF2A 4L5TA 2CWAA 4DV0H 1X9NA 3HKZG 1X3FA 1ASZA 1YBYA 4JI3Q 3KALA 3RZDH 4R1JA 1W3SA 2UUCH 5LMNL 1AE2A 1YJWA 2ASBA 2K5VA 1IBLL 2K5NA 4HIMA 5E7NA 3JAMi 4B3MQ 4KLKA 3W5OA 1WJJA 4DV1H 1KD1C 1NMFA 5M5XH 4WJ4A 3RTXA 4X64H 2UXCQ 5GADC 2N49A 2K52A 4HJ9A 1PH3A 4BY1G 5M3MG 4DUZQ 1UEBA 1VQJA 3KLWA 3TQYA 4DV2Q 2CCZA 2NVTH 2VNUD 2VPSA 3PO2G 4RB2C 1IL2A 4DV1Q 3FP9A 2VY3A 5C3EH 4YHHL 3GTMH 3BA8A 1HNXH 3RR5A 3HOVH 3KF6B 5GQOA 2VS1A 3RN5A 4BBSH 2EIFA 3E9IA 2UXBL 5JJLA 3N43B 2B63H 4LF5H 3H20A 3CP0A 4DRFA 3GTGH 3U50C 1KC8C 4B3SQ 4DR5L 5LL6b 2HHHL 2MQHA 1QUQB 2JA6G 3FKIG 2DUDA 2UXDQ 3M4QA 3G6EA 1ASYA 1AE3A 2UUCQ 4X64L 1N32Q 2PNHA 2H5XA 4QJFA 1XNQH 1XDNA 4EQ5A 5EAYA 1J6QA 2Q2HA 4UP7A 4IFDI 1VQBA 3EBEA 4OXPA 4RAYA 4JBJA 1LTLA 1IBKL 4Y7NH 1KRSA 1SR3A 4JYAQ 3AQQA 5GAGC 4NXNL 3RLNA 3DLLA 4L5SA 4J15A 1TWAH 4R4QA 4AH6A 3CD6A 3J81W 1IXRA 5DLQE 2YV5A 3H0GG 4IFDJ 4A93G 2RHQB 3L4KA 1BVSA 5GROA 3C0FB 1GO3E 3A0JA 2KBNA 3G71A 3M4OH 3HOXG 4RMFA 3M9BA 4DV3L 4IOCA 4AQYQ 4BWSC 2CQOA 4DR5H 2N8NA 3ERSX 5GAEC 4C3IH 5AJ3Q 1QVFA 2R7DA 3HOUH 3I4NG 2ZM6H 4YY3Q 1P16A 3F1ZA 2IY5B 1Z47A 3CCSA 4B3SH 5FLXW 4JI7H 3K81C 4KHPL 2AWOA 1A0IA 3CC4A 2ID0A 4XIGS 1IBMQ 1XPOA 1VQGA 2E5LL 2UUBH 2UXBH 1G51A 1WCMH 3CCVA 1VQAA 1U0LA 4A3FH 3T1YQ 4OX9H 4XTCS 1NTGA 3NBHB 3KJOA 3U4ZA 2JE6I 5IE8A 3CXCA 1EIYB 4LF4H 1UE5A 1VQ5A 4IPDA 5ELNA 5FJ8H 1XJVA 1YZ6A 3HOZH 4O2DA 2VOBA 4OWWB 3I4OA 4A3MH 4LF7L 4LFAL 1T9HA 3G4SA 4DV7Q 4A3CH 1N33H 4MTEA 4JI3H 3BJUA 3F2DA 2KHJA 1JMCA 3K8AA 2VQFQ 3RJ0A 4DKAC 4JI8H 4DV5Q 2OQ0A 3WWVA 4GKJL 2EQSA 4YWLA 1K8GA 3I4MH 4GKJQ 1YJ9A 1E1OA 4B3MH 3J80W 1L2ZA 5J3BA 4AIMA 1HZBA 5IYBH 5IYCG 2E2IH 2HVRA 1E1TA 3ER0A 1A63A 3JSLA 5BR8H 2BA0A 5IWAL 1WH2A 3KDFA 2JQOA 1EYGA 4RZQA 4DV2H 1TXYA 2WP8J 3M4IA 3T1YL 1VQ4A 3KOJA 4PZ6A 2R93H 4AYBG 1SFOH 4UCSA 3MWMA 4LWCA 4HIOA 4DV4Q 3STBD 1PH5A 1IBML 2UU9Q 1MIUA 5IYDG 3UQ8A 1PVOA 1N34L 3RIZA 1XMOH 2Z0SA 2JA8H 2VUMG 3M7NA 4RB3C 2ZJTA 4WJ3M 4KHPH 4LMYA 1Y1WH 4JCVE 4JI2H 4BXXG 5M5WH 1SEIA 4A3GH 4AQYL 1MJCA 5IP9G 1OXSC 4LF6H 5C0XI 1XMQL 4APVA 1LYLA 5M3FG 3BABA 2K75A 1MKHA 4PG3A 2OCEA 3PO3H 1UWVA 2WFWA 3CAMA 4A3KG 1JB7A 1HH2P 3BU2A 2YCHA 2BH8A 4POFA 1Z2NX 5C4XH 1RL2A 2D0PA 1IBKQ 3E0EA 4BA2I 3S1QH 3M3YH 1N36H 3HOWG 2R7ZH 3OTOL 4JI0L 2YYZA 3L7ZC 3M85A 4BBRG 4BA1I 4JI4L 5C44G 2UXDH 1C7YA 3GDEA 4Y52H 1ZHSA 4OWTB 2JA7G 1FL0A 1L1OB 2E8GA 3CMAA 4X64Q 4LF8L 2UUCL 4X62Q 2FE3A 1XNQL 1N36L 4A3IH 3KF8B 4JI8Q 4LNQA 2JA9A 1XK5A 2A1AA 5IP7H 4DUZH 4A2BA 2MCTA 4B3TL 4A3EG 4DR5Q 4MV7A 2F52A 1B7YB 4JBMA 4MZ9A 1EUJA 3AYHB 3TEHB 3NC0B 2UU9L 1HNWH 3L2PA 4HJ7A 1SYXB 2O03A 4GS3A 1HZCA 4PZ7A 4IAJA 5EOYA 4X66H 4YHHH 5FLMH 3AFQA 4JOIC 2EXDA 1Q1BA 1SLJA 1X3GA 2AWNA 4UCUA 1CKNB 1Q12A 2B3GA 2RHSB 3S1MH 4AQYH 4JBWA 5IWAQ 4MNOA 1Y1VG 2JK8A 4UP9A 3ULLA 3ZJYC 5IY0A 2L15A 5GAHC 4DV2L 4JI5Q 5C4JH 4L5RC 2PI2E 5D1OB 4FM9A 2UXCL 1QUQA 2AKWB 1FJGL 2R92G 4R4TA 2ZTEA 1XNRQ 1L1OA 2HT1A 3UDGA 1IBLQ 1LM0A 2N3SA 4A3DG 4OO1I 5C0XG 4DV5L 1N33Q 1YVCA 1VQ7A 3A74A 2HVQA 4NXML 3SGIA 5FLXc 3EIVA 3OTOH 3W1GA 3N6XA 4EFEA 1PHJA 5D1PA 3KF6A 4DV6Q 1IBLH 4DV7H 3RLFA 2CW7A 1TWGH 1E22A 2A19A 1QZGA 4DAYB 4BY7H 4DUYL 1HNWQ 4GLXA 2E5LQ 3RGXA 4JV5H 2KCTA 3BZCA 2YU9H 2MNAA 4GKJH 5H1SE 4PDBA 4IJLA 1X3EA 4LF9L 3HOYG 4KHZA 4KI0A 1UE1A 1XMOQ 2WB1G 4DR3H 4YY3L 4DR6L 4DR4Q 4DR2Q 2RF4A 4A2AA 4A3LG 1S3OA 2IHFA 2R6GA 3CCJA 1MZBA 5HGQA 4LW1A 1H95A 1L0WA 2ZM6L 1S03G 4TVAB 4GNXC 4OWXB 1Z2OX 2YTXA 1VQPA 1PH9A 4LF5L 1X6OA 3CCEA 1CKNA 2ZTCA 2YTVA 1YITA 1B8AA 3NEMA 4LF4Q 3J7A5 4IFDG 1HR0Q 2MO1A 4NXNQ 4LH7A 2HIXA 5IWAH 5LMUQ 4B3TH 3BAAA 4RB1A 1HZ9A 2KCMA 2ZJQA 1S72A 4MTDA 4QL5A 3J80i 3STBC 1KXLA 2CWPA 2NVXH 2JA5H 3H3VI 4DV6H 2Y0SE 1EFWA 2I5LX 3LMLA 2VQFH 1GKHA 2Z6KC 5JEAJ 3PN1A 4DV5H 3PV0A 4DNIA 4IJHA 4DR1H 4NB3A 4LF6Q 1AN7A 5JEAG 1GM5A 4GKKL 4B3RQ 3K7UC 4NPSA 4QGUA 4GOPC 1K0RA 1KRTA 2JA5G 4A3JG 4LF6L 1N32L 3FMAA 4DK3C 3DF7A 4A3BG 2QGQA 1B04A 1GYFA 3S2HH 2AHOB 3I2ZA 2HHHQ 2R7FA 1O75A 3U4VA 1JJCB 5LMUL 1C0AA 3PGZA 1HR0L 3PSIA 1PH2A 4Q0YA 2NZOA 1FVIA 1YIJA 4AYBE 3HXLA 3S1RH 2A8VA 3K0XA 1VQ8A 5HY6A 3RNUA 1K9MC 1VQHA 4A3LH 2ZM6Q 3DM3A 3L0OA 5JJIA 4YY3H 1PV4A 4UY8C 3TY5A 1V1QA 3E9HA 2Q2IA 4YHHQ 2OTJA 1TAEA 3J81j 3CPWA 3H3VH 2VUGA 1VQEA 1A8VA 4DR4L 2HVSA 1TWHH 3JSNA 1IBMH 4K0KH 1XMOL 4DUZL 4GOPA 4QQBX 3TS2A 1Z2PX 3KXYT 3J81c 4BY7G 4JI5H 1HJPA 2F4VQ 3ICEA 4JC0A 1DGSA 1K3RA 4DUYQ 1X65A 3J7AK 1E4FT 2GN5A 3CCQA 5DISC 1M0TA 1J5EH 4DR7H 1QVCA 3N44B 3KDFB 3K80C 3CVZA 3CC7A 3PUYA 4A3BH 2LSSA 4GKKQ 4B3RL 4X65H 3UDIA 4A3JH 1Q1EA 1XMQH 4LFAH 1K83H 4LUZA 3PUXA 4DV6L 4JI3L 1VQNA 3S17H 1S68A 1UE6A 3CCMA 3CW2C 4QY7A 4DR1L 3T1YH 4NXNH 3CMEA 4A3DH 4C3JH 4DV0L 3GJXB 1I6HH 1N33L 1C9OA 2R92H 1Q7YC 4C2MH 1YHQA 5JJKA 3F8TA 3HFZB 4GLAC 1VQ6A 1Y14B 2UXCH 4OX9L 1X55A 1SROA 4LF4L 3NBZB 1I94L 1WFQA 3I56A 1HZAA 3I55A 1Q8KA 4P75A 1KQSA 4K0KL 2K14A 4YCUA 3JAMc 4JI6L 4LFBQ 3W1BA 5C0XJ 4JI7L 3CPFA 5FLMG 1LUZA 3CC2A 4L5QA 5FD5A 1CKMA 2K50A 4R4IA 1EQQA 2UUBL 1KIXA 2GVAA 1NJIC 3S1NH 1Q82C 4JI1H 2IX0A 2YTYA 2MFIA 4LF9Q 2LXJA 4LFBH 4X6AH 3HOYH 1VQ9A 4R4OA 1HNWL 4A3EH 1PFSA 2VQEH 2UUAH 2C35B 2NZHA 4JV5L 3F2BA 2I5MX 5IP7G 3EYYA 3A5UA 2I0QA 1CKOA 4YWMA 4A3IG 1VQLA 4B3TQ 1BJTA 5LMUH 2VZAA 3BA9A 2KHIA 1YJNA 4JI8L 4RB0A 1I50H 1XNQQ 4I7HA 4R4CA 3H15A 5C44H 4X65L 4BBRH 4NXMQ 4EFBA 2WDTA 4A75A 2HQLA 2XGTA 1BBWA 3PUWA 3UE1A 4JI4Q 3HOWH 2R7ZG 1BBUA 4UCRA 4R7RA 1TWCH 4IPHA 2F4VH 4UFZA 2JJQA 4M7EA 1XNRL 3OTOQ 4RAZA 1TA8A 3T1HQ 1FJGQ 4LFCH 3F8NA 1J5EQ 4PZ8A 4DR7Q 3EN2A 4A3KH 1M1KC 3MXNB 2KENA 3TREA 3S14H 2HGSA 4JI5L 3PF4A 2E2JH 3NELA 5M3FH 3CQZH 3BZKA 1R9TH 1E24A 2F3IA 3PCOB 1VQIA 1Y1VH 1KAWA 4JI1Q 5IP9H 2UUAL 1YI2A 4LFCQ 3TRZA 3NENA 4IO9A 1QVGA 1Q81C 1X56A 3CF5A 1N34H 1MJEA 1I5FA 4B3RH 1OXUA 2ATWA 1IZ6A 1I6UA 5A2QW 1HNXL 3KAJA 4DR3Q 2VUMH 2JA8G 1ZHQA 1TWFH 3GD7A 4DV4H 5FPOA 2UU9H 2QA4A 2PQAA 3RLOA 1N34Q 3N40P 3ULPA 3I7FA 4DR3L 3D0FA 3J7ZC 3GTKH 2R93G 4HIDA 4LSXA 3OW2A 4GNXB 1N36Q 4X62L 2BH2A 3PIPA 4LSAA 1NY4A 4LFCL 4LF8Q 2D62A 2ES2A 1OXVA 4JYAL 1WYDA 3HKZE 3JAMW 1A62A 3S24A 1SE8A 1YNXA 5IYCH 5IYBG 1PH4A 5LMNW 2JA7H 3PIOA 3VDYA 1CSPA 3QWUA 1VQCA 1O7IA 2CKZB 3B6YA 4A76A 4JI0Q 4CC5A 4DV3H 5FD6A 3I4MG 3LGJA 3T1HL 1S40A 2OTLA 3TY9A 1EOVA 3S2DH 1VQFA 1OTCA 5C4XG 1IBKH 1M0WA 3KJPA 4C3HH 2VQFL 2HIVA 3RZOH 4DPGA 4GKKH 1PYSB 3MEFA 4X65Q 3IRBA 4MTNA 1VQMA 3GO5A 4P71A 4LFAQ 1XMQQ 3HOZG 3PO3G 3UE0A 3GTJH 4DAMA 1FGUA 1HNZH 4GN5A 1AH9A 1GVPA 1FKAH 1I3QH 2Y0SG 1WCMG 1FJGH 5FPRA 4JV5Q 3TY8A 4BXXH 4IPGA 1BKBA 1P8LA 3AFPA 2RGVA 1Y1WG 4POGA 1KL9A 2WE6A 2PI2A 1XNRH 4UCOA 4JOIA 1WI5A 4LH6A 4ALPA 4IOAA 4DV4L 4KHPQ 1RIPA 1HR0W 5IYDH 3NBYB 3PUVA 2Q2TA 4RG1A 1G6PA 3K3VA 4JG2A 4GN4B 2UUBQ 1I94H 3HOXH 2IHEA 5K36G 1CSQA 1OXXK 3OYYA 1NE3A 1VQKA 4UCTA 4DV3Q 1PH7A 2PQAB 3H0GH 5IT9c 4GNXA 1V9PA 1YHAA 4YWKA 3PF5A 2D0OA 3M4PA 1PH8A 2NVQH 3KFUA 2MO0A 3UDXA 2WB1E 3PUZA 2RCNA 3GTOH 1I94Q 2DGYA 4LF7H 4NXMH 1M90C 1X54A 4GN3B 2RGRA 3J80c 4CC6A 4DV0Q 2WAQG 1YEZA 3T1HH 3D31A 3VNNA 4DV7L 1VCIA 3KAKA 2NN6I 4LF7Q 5M5YH 1VQDA 3RGZA 1NMGA 2BA1A 1VS0A 4QIWE 4A3CG 4DK6C 3G48A 4GLVB 4A3MG 1GD7A 4X62H 3FKIH 4HJ5A 2JA6H 5FJ8G 5IT9W 4JYAH 3KYHC 3GTLH 2UXDL 4JI4H 1PYBA 1N9WA 2WYOA 3GTPH 4IPCA 4A3FG 3AEVA 2XTIA 4DR6H 2F4VL 2B63G 4OONA 4B3SL 1XPUA 3FHWA 2VL6A 1NBWA 3CCRA 1G291 2PMZE 4EEQA 3N42B 1B70B 4P74A 2GVBA 2OWOA 4BBSG 1K8AC 1EQRA 5D1OA 5AJ3L 5ELOA 4PMWA 1HNXQ 1W2BA 3S15H 2OQKA 4ME3A 4DR2H 1N32H 2K4KA 3HOUG 3I4NH 3GB8B 1IYJB 2NN6G 1XTDA 2ZJRA 5LMNH 3PO2H 2ZJPA 2UUAQ 1D8LA 1Q46A 4TQUS 4JI1L 4MV9A 2NVYH 5M3MH 2CFMA 4DV1L 3Q8DA 1Q86C 4BY1H 4LF8H 4YCVA 4OO1G 1SN8A 3U58A 4A93H 4ETSA 4J0MA 2WAQE 1L1OC 3UDFA 3J81i 1HR0H 4O0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6N A;  1J5E L;  4DR7 L;  2ALY B;  1KHI A;  3RN2 A;  1Z9F A;  4B3M L;  1OXT A;  4HJA A;  2JEB I;  4H02 A;  3S16 H;  3A5Z B;  4A4I A;  2V1C C;  1JJG A;  3CCU A;  1E7Z A;  4HIK A;  1SMX A;  1YHB A;  4P72 A;  1D7Q A;  2IT1 A;  2FXQ A;  4FDB A;  4LUO A;  4UP8 A;  5BR8 Q;  1QZH A;  1K73 C;  1JJ2 A;  3GTQ H;  4HJ8 A;  1PH6 A;  2VW9 A;  4EX5 A;  1CUK A;  4YCW A;  1JE5 A;  1L2F A;  3JC6 6;  2Q2U A;  2UXB Q;  1JT8 A;  3K7A H;  2K5H A;  4LF5 Q;  1PH1 A;  2B29 A;  3F2C A;  1E3P A;  4JI2 L;  3CCL A;  2VQE L;  3ULJ A;  3HKS A;  2AMC B;  2I5H A;  1HNZ Q;  4X66 L;  3HOV G;  4X66 Q;  1HNZ L;  4DR2 L;  1N8R C;  4LUV A;  1PA6 A;  4JI7 Q;  5C3E G;  2VQE Q;  4JI6 Q;  4DR6 Q;  4JI2 Q;  4GOP B;  4P73 A;  4LFB L;  1VQO A;  1U5K A;  2QEX A;  2IX1 A;  1SRU A;  4K0K Q;  1UE7 A;  2JEA I;  2LXK A;  2ZTD A;  4UPA A;  4OX9 Q;  2N78 A;  4UCV A;  3TS0 A;  2Z6K A;  1XPR A;  1EWI A;  5BR8 L;  5LMN Q;  2E2H H;  4JBK A;  4A3G G;  1EIF A;  1WOC A;  1V43 A;  4DR1 Q;  4L5T A;  2CWA A;  1X9N A;  3HKZ G;  1X3F A;  1ASZ A;  1YBY A;  4JI3 Q;  3RZD H;  4R1J A;  1W3S A;  5LMN L;  1AE2 A;  1YJW A;  2ASB A;  2K5V A;  1IBL L;  2K5N A;  4HIM A;  5E7N A;  3JAM i;  4B3M Q;  4KLK A;  3W5O A;  1WJJ A;  1KD1 C;  1NMF A;  5M5X H;  4WJ4 A;  3RTX A;  2UXC Q;  5GAD C;  2N49 A;  2K52 A;  4HJ9 A;  1PH3 A;  4BY1 G;  5M3M G;  4DUZ Q;  1UEB A;  1VQJ A;  3KLW A;  3TQY A;  4DV2 Q;  2CCZ A;  2NVT H;  2VNU D;  3PO2 G;  1IL2 A;  4DV1 Q;  3FP9 A;  2VY3 A;  5C3E H;  4YHH L;  3GTM H;  3BA8 A;  3RR5 A;  3HOV H;  3KF6 B;  5GQO A;  2VS1 A;  3RN5 A;  4BBS H;  2EIF A;  3E9I A;  2UXB L;  5JJL A;  2B63 H;  3CP0 A;  4DRF A;  3GTG H;  3U50 C;  1KC8 C;  4B3S Q;  4DR5 L;  2HHH L;  2MQH A;  1QUQ B;  2JA6 G;  3FKI G;  2DUD A;  2UXD Q;  3M4Q A;  3G6E A;  1ASY A;  1AE3 A;  2UUC Q;  4X64 L;  1N32 Q;  2PNH A;  2H5X A;  4QJF A;  1XDN A;  4EQ5 A;  5EAY A;  1J6Q A;  2Q2H A;  4UP7 A;  4IFD I;  1VQB A;  3EBE A;  4OXP A;  4JBJ A;  1LTL A;  1IBK L;  4Y7N H;  1KRS A;  1SR3 A;  4JYA Q;  3AQQ A;  5GAG C;  4NXN L;  3RLN A;  3DLL A;  4L5S A;  4J15 A;  1TWA H;  4R4Q A;  4AH6 A;  3CD6 A;  1IXR A;  5DLQ E;  2YV5 A;  3H0G G;  4IFD J;  4A93 G;  2RHQ B;  1BVS A;  5GRO A;  1GO3 E;  3A0J A;  2KBN A;  3G71 A;  3M4O H;  3HOX G;  4RMF A;  3M9B A;  4DV3 L;  4IOC A;  4AQY Q;  2CQO A;  2N8N A;  3ERS X;  5GAE C;  4C3I H;  5AJ3 Q;  1QVF A;  2R7D A;  3HOU H;  3I4N G;  4YY3 Q;  1P16 A;  3F1Z A;  2IY5 B;  1Z47 A;  3CCS A;  3K81 C;  4KHP L;  2AWO A;  1A0I A;  3CC4 A;  2ID0 A;  4XIG S;  1IBM Q;  1XPO A;  1VQG A;  2E5L L;  1G51 A;  1WCM H;  3CCV A;  1VQA A;  1U0L A;  4A3F H;  3T1Y Q;  4XTC S;  1NTG A;  3NBH B;  3KJO A;  3U4Z A;  2JE6 I;  5IE8 A;  3CXC A;  1EIY B;  1UE5 A;  1VQ5 A;  4IPD A;  5ELN A;  5FJ8 H;  1XJV A;  1YZ6 A;  3HOZ H;  4O2D A;  4OWW B;  3I4O A;  4A3M H;  4LF7 L;  4LFA L;  1T9H A;  3G4S A;  4DV7 Q;  4A3C H;  3BJU A;  3F2D A;  2KHJ A;  1JMC A;  3K8A A;  2VQF Q;  4DKA C;  4DV5 Q;  2OQ0 A;  3WWV A;  4GKJ L;  2EQS A;  4YWL A;  1K8G A;  3I4M H;  4GKJ Q;  1YJ9 A;  1E1O A;  5J3B A;  4AIM A;  1HZB A;  5IYB H;  5IYC G;  2E2I H;  2HVR A;  1E1T A;  3ER0 A;  1A63 A;  3JSL A;  2BA0 A;  5IWA L;  3KDF A;  2JQO A;  1EYG A;  1TXY A;  2WP8 J;  3T1Y L;  1VQ4 A;  3KOJ A;  4PZ6 A;  2R93 H;  4AYB G;  1SFO H;  4UCS A;  4LWC A;  4HIO A;  4DV4 Q;  3STB D;  1PH5 A;  1IBM L;  2UU9 Q;  1MIU A;  5IYD G;  3UQ8 A;  1PVO A;  1N34 L;  2Z0S A;  2JA8 H;  2VUM G;  3M7N A;  4WJ3 M;  1Y1W H;  4JCV E;  4BXX G;  5M5W H;  4A3G H;  4AQY L;  1MJC A;  5IP9 G;  1OXS C;  5C0X I;  1XMQ L;  4APV A;  1LYL A;  5M3F G;  3BAB A;  2K75 A;  1MKH A;  4PG3 A;  2OCE A;  3PO3 H;  1UWV A;  2WFW A;  3CAM A;  4A3K G;  1JB7 A;  1HH2 P;  3BU2 A;  2BH8 A;  4POF A;  5C4X H;  1RL2 A;  2D0P A;  1IBK Q;  3E0E A;  4BA2 I;  3S1Q H;  3M3Y H;  3HOW G;  2R7Z H;  3OTO L;  4JI0 L;  2YYZ A;  3L7Z C;  3M85 A;  4BBR G;  4BA1 I;  4JI4 L;  5C44 G;  1C7Y A;  3GDE A;  4Y52 H;  4OWT B;  2JA7 G;  1FL0 A;  1L1O B;  2E8G A;  3CMA A;  4X64 Q;  4LF8 L;  2UUC L;  4X62 Q;  1XNQ L;  1N36 L;  4A3I H;  3KF8 B;  4JI8 Q;  4LNQ A;  2JA9 A;  1XK5 A;  2A1A A;  5IP7 H;  4B3T L;  4A3E G;  4DR5 Q;  2F52 A;  1B7Y B;  4JBM A;  4MZ9 A;  1EUJ A;  3AYH B;  3TEH B;  3NC0 B;  2UU9 L;  3L2P A;  4HJ7 A;  4GS3 A;  1HZC A;  4PZ7 A;  5FLM H;  3AFQ A;  4JOI C;  2EXD A;  1Q1B A;  1SLJ A;  1X3G A;  2AWN A;  4UCU A;  1CKN B;  1Q12 A;  2B3G A;  2RHS B;  3S1M H;  4JBW A;  5IWA Q;  4MNO A;  1Y1V G;  2JK8 A;  4UP9 A;  3ULL A;  3ZJY C;  5IY0 A;  2L15 A;  5GAH C;  4DV2 L;  4JI5 Q;  5C4J H;  4L5R C;  2PI2 E;  5D1O B;  2UXC L;  1QUQ A;  2AKW B;  1FJG L;  2R92 G;  4R4T A;  2ZTE A;  1XNR Q;  1L1O A;  2HT1 A;  3UDG A;  1IBL Q;  1LM0 A;  2N3S A;  4A3D G;  4OO1 I;  5C0X G;  4DV5 L;  1N33 Q;  1YVC A;  1VQ7 A;  3A74 A;  2HVQ A;  4NXM L;  3SGI A;  5FLX c;  3EIV A;  3W1G A;  4EFE A;  1PHJ A;  5D1P A;  3KF6 A;  4DV6 Q;  3RLF A;  1TWG H;  1E22 A;  2A19 A;  1QZG A;  4DAY B;  4BY7 H;  4DUY L;  1HNW Q;  4GLX A;  2E5L Q;  2KCT A;  3BZC A;  2YU9 H;  2MNA A;  5H1S E;  4IJL A;  1X3E A;  4LF9 L;  3HOY G;  4KHZ A;  4KI0 A;  1UE1 A;  1XMO Q;  2WB1 G;  4YY3 L;  4DR6 L;  4DR4 Q;  4DR2 Q;  2RF4 A;  4A3L G;  1S3O A;  2IHF A;  2R6G A;  3CCJ A;  5HGQ A;  4LW1 A;  1H95 A;  1L0W A;  2ZM6 L;  4TVA B;  4GNX C;  4OWX B;  2YTX A;  1VQP A;  1PH9 A;  4LF5 L;  1X6O A;  3CCE A;  1CKN A;  2ZTC A;  2YTV A;  1YIT A;  1B8A A;  3NEM A;  4LF4 Q;  3J7A 5;  4IFD G;  1HR0 Q;  2MO1 A;  4NXN Q;  4LH7 A;  2HIX A;  5LMU Q;  3BAA A;  1HZ9 A;  2KCM A;  2ZJQ A;  1S72 A;  4QL5 A;  3J80 i;  3STB C;  1KXL A;  2CWP A;  2NVX H;  2JA5 H;  3H3V I;  2Y0S E;  1EFW A;  2I5L X;  1GKH A;  2Z6K C;  5JEA J;  3PN1 A;  3PV0 A;  4DNI A;  4IJH A;  4NB3 A;  4LF6 Q;  5JEA G;  1GM5 A;  4GKK L;  4B3R Q;  3K7U C;  4NPS A;  4QGU A;  4GOP C;  1K0R A;  1KRT A;  2JA5 G;  4A3J G;  4LF6 L;  1N32 L;  4DK3 C;  4A3B G;  2QGQ A;  1B04 A;  3S2H H;  2AHO B;  3I2Z A;  2HHH Q;  2R7F A;  3U4V A;  1JJC B;  5LMU L;  1C0A A;  3PGZ A;  1HR0 L;  3PSI A;  1PH2 A;  2NZO A;  1FVI A;  1YIJ A;  4AYB E;  3S1R H;  2A8V A;  3K0X A;  1VQ8 A;  5HY6 A;  3RNU A;  1K9M C;  1VQH A;  4A3L H;  2ZM6 Q;  3DM3 A;  3L0O A;  5JJI A;  1PV4 A;  4UY8 C;  3TY5 A;  1V1Q A;  3E9H A;  2Q2I A;  4YHH Q;  2OTJ A;  1TAE A;  3J81 j;  3CPW A;  3H3V H;  2VUG A;  1VQE A;  1A8V A;  4DR4 L;  2HVS A;  1TWH H;  3JSN A;  1XMO L;  4DUZ L;  4GOP A;  4QQB X;  3TS2 A;  3J81 c;  4BY7 G;  1HJP A;  2F4V Q;  3ICE A;  4JC0 A;  1DGS A;  1K3R A;  4DUY Q;  1X65 A;  2GN5 A;  3CCQ A;  5DIS C;  1QVC A;  3KDF B;  3K80 C;  3CC7 A;  3PUY A;  4A3B H;  2LSS A;  4GKK Q;  4B3R L;  3UDI A;  4A3J H;  1Q1E A;  1K83 H;  4LUZ A;  3PUX A;  4DV6 L;  4JI3 L;  1VQN A;  3S17 H;  1S68 A;  1UE6 A;  3CCM A;  3CW2 C;  4QY7 A;  4DR1 L;  3CME A;  4A3D H;  4C3J H;  4DV0 L;  3GJX B;  1I6H H;  1N33 L;  1C9O A;  2R92 H;  1Q7Y C;  4C2M H;  1YHQ A;  5JJK A;  3F8T A;  3HFZ B;  4GLA C;  1VQ6 A;  1Y14 B;  4OX9 L;  1X55 A;  1SRO A;  4LF4 L;  3NBZ B;  1I94 L;  1WFQ A;  3I56 A;  1HZA A;  3I55 A;  1Q8K A;  4P75 A;  1KQS A;  4K0K L;  2K14 A;  4YCU A;  3JAM c;  4JI6 L;  4LFB Q;  3W1B A;  5C0X J;  4JI7 L;  3CPF A;  5FLM G;  1LUZ A;  3CC2 A;  4L5Q A;  1CKM A;  2K50 A;  4R4I A;  1EQQ A;  2UUB L;  1KIX A;  2GVA A;  1NJI C;  3S1N H;  1Q82 C;  2IX0 A;  2YTY A;  2MFI A;  4LF9 Q;  2LXJ A;  4X6A H;  3HOY H;  1VQ9 A;  4R4O A;  1HNW L;  4A3E H;  1PFS A;  2C35 B;  2NZH A;  4JV5 L;  3F2B A;  2I5M X;  5IP7 G;  3A5U A;  2I0Q A;  1CKO A;  4YWM A;  4A3I G;  1VQL A;  4B3T Q;  2VZA A;  3BA9 A;  2KHI A;  1YJN A;  4JI8 L;  1I50 H;  1XNQ Q;  4R4C A;  3H15 A;  5C44 H;  4X65 L;  4BBR H;  4NXM Q;  4EFB A;  4A75 A;  2HQL A;  2XGT A;  1BBW A;  3PUW A;  3UE1 A;  4JI4 Q;  3HOW H;  2R7Z G;  1BBU A;  4UCR A;  1TWC H;  4IPH A;  4UFZ A;  2JJQ A;  1XNR L;  3OTO Q;  1TA8 A;  3T1H Q;  1FJG Q;  1J5E Q;  4PZ8 A;  4DR7 Q;  3EN2 A;  4A3K H;  1M1K C;  3MXN B;  2KEN A;  3TRE A;  3S14 H;  4JI5 L;  3PF4 A;  2E2J H;  3NEL A;  5M3F H;  3CQZ H;  3BZK A;  1R9T H;  1E24 A;  2F3I A;  3PCO B;  1VQI A;  1Y1V H;  1KAW A;  4JI1 Q;  5IP9 H;  2UUA L;  1YI2 A;  4LFC Q;  3TRZ A;  3NEN A;  4IO9 A;  1QVG A;  1Q81 C;  1X56 A;  3CF5 A;  1MJE A;  1I5F A;  1OXU A;  2ATW A;  1IZ6 A;  1HNX L;  4DR3 Q;  2VUM H;  2JA8 G;  1TWF H;  3GD7 A;  5FPO A;  2QA4 A;  2PQA A;  3RLO A;  1N34 Q;  3ULP A;  3I7F A;  4DR3 L;  3D0F A;  3J7Z C;  3GTK H;  2R93 G;  4HID A;  3OW2 A;  4GNX B;  1N36 Q;  4X62 L;  2BH2 A;  3PIP A;  1NY4 A;  4LFC L;  4LF8 Q;  2D62 A;  2ES2 A;  1OXV A;  4JYA L;  1WYD A;  3HKZ E;  1A62 A;  3S24 A;  1SE8 A;  1YNX A;  5IYC H;  5IYB G;  1PH4 A;  5LMN W;  2JA7 H;  3PIO A;  3VDY A;  1CSP A;  3QWU A;  1VQC A;  1O7I A;  2CKZ B;  3B6Y A;  4A76 A;  4JI0 Q;  4CC5 A;  3I4M G;  3LGJ A;  3T1H L;  1S40 A;  2OTL A;  3TY9 A;  1EOV A;  3S2D H;  1VQF A;  1OTC A;  5C4X G;  3KJP A;  4C3H H;  2VQF L;  2HIV A;  3RZO H;  4DPG A;  1PYS B;  3MEF A;  4X65 Q;  3IRB A;  4MTN A;  1VQM A;  3GO5 A;  4P71 A;  4LFA Q;  1XMQ Q;  3HOZ G;  3PO3 G;  3UE0 A;  3GTJ H;  4DAM A;  1FGU A;  4GN5 A;  1AH9 A;  1GVP A;  1I3Q H;  2Y0S G;  1WCM G;  5FPR A;  4JV5 Q;  3TY8 A;  4BXX H;  4IPG A;  1BKB A;  1P8L A;  3AFP A;  1Y1W G;  4POG A;  1KL9 A;  2PI2 A;  4UCO A;  4JOI A;  1WI5 A;  4LH6 A;  4ALP A;  4IOA A;  4DV4 L;  4KHP Q;  1RIP A;  1HR0 W;  5IYD H;  3NBY B;  3PUV A;  2Q2T A;  4RG1 A;  1G6P A;  4JG2 A;  4GN4 B;  2UUB Q;  3HOX H;  2IHE A;  5K36 G;  1CSQ A;  1OXX K;  3OYY A;  1NE3 A;  1VQK A;  4UCT A;  4DV3 Q;  1PH7 A;  2PQA B;  3H0G H;  5IT9 c;  4GNX A;  1V9P A;  1YHA A;  4YWK A;  3PF5 A;  2D0O A;  3M4P A;  1PH8 A;  2NVQ H;  3KFU A;  2MO0 A;  3UDX A;  2WB1 E;  3PUZ A;  2RCN A;  3GTO H;  1I94 Q;  2DGY A;  1M90 C;  1X54 A;  4GN3 B;  3J80 c;  4CC6 A;  4DV0 Q;  2WAQ G;  1YEZ A;  3D31 A;  3VNN A;  4DV7 L;  1VCI A;  2NN6 I;  4LF7 Q;  5M5Y H;  1VQD A;  1NMG A;  2BA1 A;  1VS0 A;  4QIW E;  4A3C G;  4DK6 C;  3G48 A;  4GLV B;  4A3M G;  1GD7 A;  3FKI H;  4HJ5 A;  2JA6 H;  5FJ8 G;  3KYH C;  3GTL H;  2UXD L;  1PYB A;  1N9W A;  3GTP H;  4IPC A;  4A3F G;  3AEV A;  2XTI A;  2F4V L;  2B63 G;  4OON A;  4B3S L;  1XPU A;  3FHW A;  2VL6 A;  1NBW A;  3CCR A;  1G29 1;  2PMZ E;  4EEQ A;  1B70 B;  4P74 A;  2GVB A;  2OWO A;  4BBS G;  1K8A C;  1EQR A;  5D1O A;  5AJ3 L;  5ELO A;  4PMW A;  1HNX Q;  1W2B A;  3S15 H;  2OQK A;  4ME3 A;  2K4K A;  3HOU G;  3I4N H;  3GB8 B;  1IYJ B;  2NN6 G;  1XTD A;  2ZJR A;  3PO2 H;  2ZJP A;  2UUA Q;  1D8L A;  1Q46 A;  4TQU S;  4JI1 L;  2NVY H;  5M3M H;  2CFM A;  4DV1 L;  3Q8D A;  1Q86 C;  4BY1 H;  4YCV A;  4OO1 G;  1SN8 A;  3U58 A;  4A93 H;  2WAQ E;  1L1O C;  3UDF A;  3J81 i;  4O0A A; 
#chains in the Genus database with same CATH topology
 1PTO C;  4E6N A;  3E5S A;  1QNK A;  4DIM A;  2KOL A;  1OXT A;  4B3M L;  2ZGI A;  3TW7 A;  5BPH A;  4J1M A;  2JEB I;  1YNN D;  3T56 B;  3QFF A;  4KKT A;  3TME A;  3BQ0 A;  1HTL D;  3ND8 A;  1CQJ B;  3ETH A;  3PZP A;  1Y1W A;  4ID6 A;  3ORR A;  1K73 C;  2FLP A;  1G2T A;  1PH6 A;  3R23 A;  4YCW A;  1BBX C;  1S0N A;  4O3Q A;  3OSP A;  2PO4 A;  4FFR A;  4DR4 H;  3DWQ A;  1FR3 A;  2EY1 A;  4ED8 A;  3SEB A;  3HKS A;  1HNZ Q;  4QWC A;  1ZEQ X;  1TQO A;  1SJH D;  2W6M A;  4LUV A;  2P0A A;  2W7O A;  4LFB L;  4O7Z A;  4P73 A;  2D2C C;  4EVO A;  4QW8 A;  2QEX A;  3MWE A;  3NP8 A;  2ZTD A;  3MZ5 A;  4DAA A;  4DUY H;  3GV3 A;  4Q4D A;  2VA2 A;  2KJX A;  1WOC A;  1V43 A;  2F0M A;  2EOT A;  4DR1 Q;  4JI3 Q;  2EJG C;  3C46 A;  3RZD H;  4R8U B;  2ICE C;  2A6E D;  3BVG A;  5EKL A;  2ZXR A;  2RCF A;  2ASB A;  4A3G H;  4HIM A;  3W5O A;  1KD1 C;  3N8D A;  2AU0 A;  1CHP D;  2N49 A;  3TP7 A;  3X3M A;  3JAM E;  5M3M G;  1UNS A;  5ELD A;  5H80 A;  3IN5 A;  1IL2 A;  1G8Z D;  1I1M A;  4HMI A;  1A6X A;  3BQ2 A;  4HSP A;  3KF6 B;  3TQ1 A;  4O83 A;  1EYD A;  4C56 C;  4BBS H;  5L37 A;  3HZX A;  4YB8 B;  2R92 A;  3MVV A;  3H20 A;  4IWY A;  2RDJ A;  5LL6 b;  4DR5 L;  1I4H A;  2WTF A;  2W6Z A;  1TWG A;  4I7Z C;  2NU8 B;  1Y1V B;  5BWU A;  3G6E A;  3JRX A;  2VB2 X;  2F0D A;  2RA4 A;  2H5X A;  1F2Z A;  1XDN A;  3PW4 A;  4HTH A;  3KHR A;  2F3V A;  4UP7 A;  1PMR A;  2QYZ A;  4JBJ A;  3TZD A;  4DF7 A;  1K83 B;  1SR3 A;  5GAG C;  4NXN L;  3DLL A;  2B8F A;  1TWA H;  4R4Q A;  4AH6 A;  5KFY A;  1IXR A;  3H0G G;  4IFD J;  4OO1 H;  1W96 A;  3D6W A;  3PR5 B;  3C0F B;  3A0J A;  3M4O H;  4UAI A;  2E2H B;  4DV3 L;  4IOC A;  2CQO A;  1GUT A;  1RTN A;  5GAE C;  1QVF A;  3GIK A;  4ECQ A;  4HCS A;  2R7D A;  1STB A;  1EFI D;  5E4W C;  3E6Z X;  5C1P A;  3K81 C;  2AWO A;  2HG8 A;  2XCP A;  4ED0 A;  2ID0 A;  1H9S B;  4TRD A;  1IBM Q;  2VXW A;  1YNN C;  3RV3 A;  2UXB H;  1WCM H;  1R4P B;  4ZK9 B;  4A3F H;  3H09 A;  4XTC S;  2FPI B;  1I1L A;  5J2T F;  4LF4 H;  5IE8 A;  4ZQ3 A;  1VQ5 A;  2VOB A;  3HOZ H;  3RB6 A;  2EJ3 A;  5K5P A;  4DV5 Q;  2OQ0 A;  1KJ9 A;  1C8C A;  2KCN A;  3I4M H;  4A3E B;  4YJ2 F;  1L2Z A;  4AIM A;  3OPO A;  3CRK C;  1M4V A;  1E1T A;  3ER0 A;  1F2Y A;  1LT6 D;  1A63 A;  1I4G A;  2PN1 A;  2F0L A;  1CE8 A;  4XZ3 B;  3M9N B;  3KDF A;  2I46 A;  2JQO A;  4RZQ A;  5DG7 A;  1RHP A;  3M4I A;  2Y0S A;  1I4R A;  1VQ4 A;  3GIJ A;  2R93 H;  1KT8 A;  4A3D B;  4LWC A;  2A68 D;  1PYW D;  4A3M B;  3UZB A;  2A74 C;  4DXG A;  4OHJ A;  2UU9 Q;  3UQ8 A;  1Y8N B;  4N8F A;  3M7N A;  2L5T A;  3KRE A;  4NYE A;  1HXY D;  1K28 A;  1WCM B;  1XMQ L;  5M3F G;  4DU9 A;  1TT2 A;  2B2W C;  3T9A A;  1KLU D;  5I4D A;  2X5R A;  2E2I A;  1D1I A;  1FD7 D;  5JAV A;  3U54 A;  1A48 A;  3I4N B;  3D8G A;  3S1Q H;  5JVG 3;  5J39 A;  1L0Y B;  4JI0 L;  4MA5 A;  4CE5 A;  4JI4 L;  2BQR A;  1C7Y A;  3GDE A;  5KG2 A;  1FL0 A;  2E8G A;  3CMA A;  3KUP A;  4X64 Q;  3G8D A;  2NVY B;  1N36 L;  2CNV A;  1EEI D;  3KF8 B;  1SXT A;  3WOE A;  4EQO A;  3A7A B;  4O3O A;  1NR4 A;  1B7Y B;  2EDG A;  4MZ9 A;  4LJZ C;  4JBM A;  1KDA A;  3TEH B;  5ISR A;  2V5A A;  3WNZ A;  3NTI A;  2YU9 A;  4Q5V A;  4S3S A;  2NUA B;  4K6N A;  4NDX A;  3H3V C;  5EOY A;  4X66 H;  3O13 A;  4PZ7 A;  4A3J B;  4YHH H;  5FLM H;  1W6K A;  4CGY B;  4DAP A;  2SCU B;  4JOI C;  5KFB A;  5DGH A;  5DGA A;  2CVR A;  2RHS B;  5CV6 A;  1KC7 A;  4AQY H;  3W2D A;  3ULL A;  3VYS A;  4JI5 Q;  3I70 A;  4RKB A;  1C3O A;  2EJ2 A;  1F9S A;  3AX6 A;  1KDC A;  2AKW B;  1FJG L;  2IMW P;  4R4T A;  1A2U A;  2HT1 A;  3RBD A;  1ET0 A;  3UDG A;  1LM0 A;  3T53 B;  1C30 A;  1QB5 D;  5C0X G;  2J6T A;  1YVC A;  2A69 D;  3GTQ A;  2PMZ B;  3BZD B;  4NXM L;  5KNC A;  2YRX A;  1B33 N;  3A56 A;  1PHJ A;  5D1P A;  3KF6 A;  5M5W B;  1F9R A;  5EPL A;  3RV4 A;  1IBL H;  3HGB A;  4DV7 H;  5D3D A;  3TP8 A;  4RUA A;  3I3C A;  3HOY B;  3KLR A;  4BY7 H;  4GLX A;  1QG7 A;  3DUZ A;  4R9W A;  1X3E A;  3OSN A;  3HOY G;  4H0L C;  4C3H B;  1PZI D;  2WB1 G;  4O86 A;  1BCP D;  5DQH A;  4DR2 Q;  1GSO A;  3P20 A;  2R6G A;  2IHF A;  1Z7T A;  4LW1 A;  5HGQ A;  2ZM6 L;  4TVA B;  4OWX B;  4ILW A;  1DOL A;  1CKN A;  1PZK D;  2ZTC A;  1YIT A;  4LF4 Q;  3NEM A;  5COY A;  1EY5 A;  1A3U A;  5CR3 A;  1HR0 Q;  3OUZ A;  3EVQ A;  1HZ9 A;  4QL5 A;  1JOQ A;  2NVX H;  2JA5 H;  2BOS A;  3L3O C;  4DV6 H;  1EFW A;  2W70 A;  4C3J G;  3LML A;  3GV8 B;  1VF7 A;  3GQB A;  1K8O A;  4IJH A;  3DEO A;  2W9A A;  3A54 A;  4DV5 H;  4KKS A;  1GM5 A;  4GKK L;  4IRD A;  4B3R Q;  4NPS A;  4GOP C;  1K0R A;  1N32 L;  1I4Q A;  3PQI A;  5EGT A;  1O7L A;  4QMG A;  4CMD A;  1GYF A;  3S2H H;  2ABJ A;  2AHO B;  1FGB D;  1SJE D;  2XVS A;  3DHQ A;  2HHH Q;  1SE4 A;  3Q22 A;  2JEF A;  4J6H A;  4Q4C A;  1JJC B;  1C0A A;  3PGZ A;  4WD3 A;  1HR0 L;  4DL6 A;  3NBH A;  4FXK C;  2NZO A;  4K5W A;  3S1R H;  2R8I A;  4A3L H;  3RNU A;  3MFG A;  2F0T A;  2OTJ A;  1TAE A;  1ENA A;  1PTO D;  3H3V H;  2HVS A;  4DR4 L;  1XMO L;  3KXY T;  3F2U A;  5D14 A;  3ORQ A;  1LTT D;  3J81 c;  5C44 B;  1HJP A;  4JC0 A;  2B2U C;  3CU7 A;  3RB0 A;  1X65 A;  3V05 A;  4YR2 A;  1M0T A;  4O7S A;  1DXM A;  1BXT A;  1Y1W B;  5I47 A;  3KDF B;  2F0V A;  2EYH A;  2LSS A;  4L6T B;  4MIU A;  1Q1E A;  4Y8V B;  2RBM A;  1NAP A;  1K83 H;  4DV6 L;  5CA0 F;  1S9F A;  3T9D A;  2W6O A;  3T54 A;  4DR1 L;  3K5N A;  2B2V A;  3CME A;  4HN2 A;  4JV0 A;  4C3J H;  4DV0 L;  1Y8P B;  1C9O A;  5JJK A;  1YHQ A;  5EQ0 A;  3K58 A;  2ATL A;  3I56 A;  1CA6 A;  5ELC A;  1HZA A;  3NTH A;  1Q8K A;  3I55 A;  4QWD A;  1WTV A;  3JAM c;  4YCU A;  4LFB Q;  3LWE A;  2X69 A;  3W1B A;  3CPF A;  1LUZ A;  1D5Z C;  4L5Q A;  4C2M B;  4XX0 B;  5FD5 A;  4TM5 A;  2ENB A;  4ULL A;  4JI1 H;  3VYR A;  4LFB H;  3H91 A;  4O7V A;  4X6A H;  1QE6 A;  2HD3 A;  3M4Y A;  1WTH A;  3BVZ A;  2UUA H;  2Q7D A;  5IP7 G;  2I80 A;  4YWM A;  5I5V A;  4B3T Q;  1OBD A;  1BJT A;  5LMU H;  3T16 A;  1Y69 U;  2VZA A;  3GTL A;  5KND A;  1S5E D;  1YJN A;  4RB0 A;  1I50 H;  3QR8 A;  3HOX B;  4WFN 3;  2ALZ A;  4X65 L;  4XQN A;  1RJP A;  2XCA A;  5KFC A;  4Q8F A;  3TIG A;  3DWA A;  3PUW A;  3UE1 A;  4JI4 Q;  4HMJ A;  4LK1 C;  2R7Z G;  2SNM A;  3TEK A;  2F0Q A;  5GON F;  4M7E A;  1XNR L;  4RAZ A;  4F4W A;  3S2H B;  4LFC H;  1M7J A;  4A3K H;  1TY0 A;  2HGS A;  3GIM A;  5IYZ F;  2G5D A;  3EPG A;  3BZK A;  1R9T H;  4L63 B;  1VQI A;  4QQB X;  5IP9 H;  1EZ6 A;  1PTO H;  1J8I A;  1Q81 C;  2DWC A;  4B3R H;  5JPN C;  4Q44 A;  4PV1 C;  1IZ6 A;  5BN5 A;  5A2Q W;  3J81 E;  1BCP B;  1U4M A;  1ZHQ A;  5FPO A;  2COI A;  4WHX A;  2UU9 H;  2PZT A;  2QA4 A;  3RLO A;  4IUN A;  2EJ0 A;  3N40 P;  1U4P A;  4ECU A;  3J7Z C;  1N56 A;  1M8A A;  2UVU A;  3G6V A;  4IUU A;  3GTG B;  2D62 A;  2ES2 A;  3TII A;  4FE2 A;  2FK3 A;  3T13 A;  5IYB G;  1PH4 A;  5LMN W;  3PIO A;  1WVL A;  3RD4 A;  3QWU A;  5BWR A;  2CKZ B;  4O4H F;  3PR4 A;  5FD6 A;  1EEF D;  3TY9 A;  1VQF A;  4BWG B;  5ELE A;  1O80 A;  2IPK D;  4HR7 B;  5FLX L;  4PQX A;  1WD1 A;  3MEF A;  3GTJ H;  4ECV A;  2Z6B A;  1GVP A;  5FPR A;  4JK1 C;  1JQY D;  2KHS A;  2JYO A;  4PDB A;  5JVH 3;  1KL9 A;  3HT5 A;  2PI2 A;  4V0B A;  5COR A;  4FF3 A;  4UCO A;  1WI5 A;  4U6P A;  4KKU A;  4IOA A;  4DV4 L;  4ED3 A;  3SR1 A;  2A73 B;  1DV1 A;  2HDL A;  5IYD H;  1LAB A;  2Q2T A;  1TWA B;  4B9W A;  3X3N A;  4GN4 B;  2UUB Q;  3FDS A;  1CSQ A;  5K2M A;  5BYA A;  3NXW A;  3SK8 A;  2JA8 B;  3TIN A;  3GIL A;  2FHT A;  4DV3 Q;  2W9C B;  1EQT A;  2PQA B;  3VYU A;  1PH8 A;  3U9S A;  1V9P A;  1YHA A;  4YWK A;  3UYY A;  3M4P A;  5KFV A;  3FDT A;  4I55 F;  4QUF A;  4O2A F;  4K8J A;  5CB4 F;  4NXM H;  1X54 A;  2QCP X;  4ZRZ A;  5BN3 A;  1SYB A;  1DON A;  1A3V A;  2DY7 A;  3J7A F;  1LT5 D;  3VNN A;  4DV7 L;  1DD2 A;  5M5Y H;  1VQD A;  1B53 A;  2EZV A;  4DK6 C;  3G48 A;  1IW7 D;  2QK4 A;  2R8J A;  3DAA A;  4HJ5 A;  1IOW A;  1H9K A;  2HCC A;  4L8J A;  5CA1 F;  4JI4 H;  1N9W A;  3GTP H;  4A3F G;  1PRT D;  2F4V L;  1PRT C;  1XPU A;  2EYF A;  2BE5 C;  2JN4 A;  4CBV A;  2R3Z A;  4A3F B;  3S15 H;  2J9G A;  1B44 D;  3OWF A;  3SVM A;  4C3I G;  5C4X B;  1IYJ B;  3TP5 A;  1XTD A;  3ZYY X;  5LMN H;  3PO2 H;  1AUV A;  1D8L A;  5L1I A;  1BO0 A;  2NVY H;  4BY1 H;  2B2W A;  1PRT B;  4OO1 G;  3LWB A;  3U58 A;  4A93 H;  1L1O C;  3EFX D;  1EY9 A;  5CAE B;  1GSA A;  4DR7 L;  2ALY B;  3HKZ A;  4HJA A;  1WRV A;  2FPP B;  3NSW A;  2V1C C;  4A4I A;  1G91 A;  4HIK A;  1SMX A;  3TSS A;  2DZD A;  3QJY A;  5J2U F;  2FXQ A;  4LUO A;  4UP8 A;  1MSH A;  5BR8 Q;  3OIP A;  1JJ2 A;  3GTQ H;  3L4J A;  2E5L H;  2JEG A;  2VW9 A;  4EX5 A;  2C9O A;  5C1O A;  4XT1 B;  1CUK A;  2Q2U A;  1JE5 A;  2QF7 A;  3K7A H;  2K5H A;  2B29 A;  4ME6 A;  3N41 B;  3K57 A;  1E3P A;  4JI2 L;  2VQE L;  1QNU A;  3IG0 A;  4MV4 A;  1S4Z A;  2WAQ B;  3VR2 A;  4X66 L;  3MXP A;  4X66 Q;  5FK9 C;  1HNZ L;  5F2D A;  3HOV G;  4ZUI A;  1N8R C;  1PA6 A;  4DR6 Q;  5C3E G;  2VQE Q;  1Z2N X;  2VPS A;  4JI2 Q;  1WTR A;  3CVZ A;  3N44 B;  2FLL A;  1UE7 A;  1IYE A;  1E4G T;  4A93 B;  1EKV A;  1SCU B;  3H4B A;  4UCV A;  3Q2O A;  2Z6K A;  1XPR A;  1EWI A;  2OXP A;  5BR8 L;  5LMN Q;  4C2M A;  1EIF A;  2EJM A;  2Y0S B;  1KJJ A;  4DV0 H;  5C5M A;  1XWE A;  5CE8 A;  1X3F A;  1YBY A;  4F88 A;  4U7C A;  2F0F A;  4KN4 C;  4CKE A;  1ZQ7 A;  4UHV A;  1AE2 A;  4CJ2 C;  3ETJ A;  1IBL L;  4B3M Q;  3GII A;  2SNS A;  5KG4 A;  4KLK A;  4MAM A;  5M3F B;  4FGR A;  2F0H A;  5M5X H;  1E4E B;  2R7Z B;  5KFR A;  2V59 A;  1SMY D;  4DV2 Q;  1UEB A;  2P5Z X;  2EYM A;  2CCZ A;  1V4Y A;  4F50 A;  3PO2 G;  4DV1 Q;  3FP9 A;  4YHH L;  3GTM H;  3BA8 A;  2W8L A;  4EGQ A;  1HNX H;  4Y7N B;  5GQO A;  2VS1 A;  3WOF A;  3RN5 A;  4QSH A;  2EIF A;  3E9I A;  4UUG A;  2UXB L;  5JJL A;  1JIH A;  4FBT A;  3N43 B;  2B63 H;  4IRK A;  4LF5 H;  3CP0 A;  3U50 C;  3V4Z A;  2MPM A;  2HHH L;  2DUD A;  2DNE A;  3CKI B;  5KNB A;  5I5X A;  4FP5 D;  4X3K A;  5C3W A;  5LL6 S;  1ASY A;  1AE3 A;  4MHE A;  1N32 Q;  3OWE B;  1XNQ H;  4F8M A;  4G7Z C;  2KEE A;  2R7Z A;  2Q2H A;  3E3X A;  2VUM B;  3CQZ A;  4RCO A;  1LTA D;  4RAY A;  1LTL A;  3TBI B;  4QW9 A;  1HUM A;  5I6W A;  1B4O A;  5KYI A;  5KFJ A;  2XRQ D;  5KG7 A;  1KRS A;  4AYB B;  2EYL A;  5JPM C;  3SK6 A;  1LT3 D;  4J15 A;  1BF4 A;  3J81 W;  3L4K A;  2YV5 A;  1EYZ A;  5CMD A;  2RHQ B;  3AB9 A;  1KTK A;  2FPG B;  5GRO A;  1I4P A;  4CHI A;  2KBN A;  3G71 A;  2HDK A;  4RMF A;  1DIK A;  1IYD A;  2JA7 A;  5AJ3 Q;  1CK1 A;  2ZM6 H;  4EYI B;  4YY3 Q;  1P16 A;  2IY5 B;  4G7O C;  4B3S H;  3CQZ B;  2DLN A;  2K5W A;  4FO2 A;  1I2L A;  2VUM A;  1A0I A;  1CA5 A;  5LOV F;  1JX4 A;  2B63 A;  1TU2 B;  4ZOL F;  3BAC A;  1CQV A;  1G51 A;  4WJW A;  1VQA A;  2R8K A;  4JW0 A;  1NTG A;  2N88 A;  3BYY B;  2UVV A;  2ZXP A;  5ELN A;  5FJ8 H;  1XJV A;  3GTM A;  1YZ6 A;  2LMC B;  2MUY A;  3I4O A;  4FBU A;  1JE4 A;  2K05 A;  5C4J B;  4MTE A;  2FIN B;  4JI3 H;  3BJU A;  3F2D A;  3K8A A;  4CDE C;  1JOR A;  4K2K A;  4YWL A;  1K8G A;  4GKJ Q;  2NVY A;  1E1O A;  2I8C A;  2F0O A;  5IYB H;  3CHB D;  5IYC G;  3Q8P B;  3JSL A;  1WH2 A;  4DV2 H;  2YW2 A;  2E74 C;  1TXY A;  3R8B A;  1HHV A;  3T1Y L;  4PZ6 A;  1TS5 A;  4NLG A;  2W9B B;  4HIO A;  1PH5 A;  3WDN A;  1XMO H;  1PTO B;  1PVO A;  4ZCK A;  2JA8 H;  3SDZ A;  4O1N A;  4CKC A;  1Y1W H;  4JCV E;  4Q0F A;  4BXX G;  3KLS A;  4DA2 A;  4AQY L;  2FMA A;  5IP9 G;  4O7Y A;  1OXS C;  1EIH A;  3UFX B;  5EKK A;  1LT4 D;  5KFK A;  1AN8 A;  2O5J C;  3BAB A;  2RDH A;  1MKH A;  1L0X B;  2OCE A;  2DPJ A;  5EKI A;  5KFM A;  3VMM A;  5IOC A;  2W9B A;  1HH2 P;  3BU2 A;  2YCH A;  1TKW B;  1IBK Q;  2ASJ A;  2NU7 B;  3OTO L;  5D65 A;  3S15 B;  2LKV A;  3K5L A;  1T5E A;  3WWH A;  4BA1 I;  5C44 G;  4M9U A;  1EZ8 A;  1K1Q A;  4TSS A;  4DK1 A;  2JA7 G;  2NWG A;  2CW0 C;  4LF8 L;  2UUC L;  1II3 A;  3AMU A;  1A0G A;  5BWX A;  2A1A A;  4A2B A;  4J9M A;  2JA7 B;  1XTC D;  4CKB A;  4B3T L;  4MV7 A;  4FVM A;  2F52 A;  3RAX A;  3AYH B;  2F03 A;  2C00 A;  1CM9 A;  5JQG F;  4DL2 A;  2UU9 L;  4DAV A;  3GV6 A;  1JWS D;  1SYX B;  3JZI A;  1HZC A;  3DWP A;  2PPB C;  1DYQ A;  1SNM A;  4IAL A;  3AFQ A;  1Q1B A;  1X3G A;  1RJT A;  5FNV F;  1SE2 A;  5KFQ A;  3KHG A;  1Q12 A;  4ZLT F;  2RKS A;  5IWA Q;  2JK8 A;  5GAH C;  4L5R C;  2M2L A;  5C4J H;  2PI2 E;  2WII B;  3VOT A;  2UXC L;  1QUQ A;  1ICF B;  2PZW A;  4MV3 A;  2NVX B;  2ICI A;  1EKF A;  2ZTE A;  2FLN A;  5E25 A;  4J9L A;  4A3D G;  2N3S A;  1GOZ A;  4DV5 L;  2F0N A;  3I4L A;  3T5L A;  3A74 A;  4MV8 A;  3EIV A;  4YBZ B;  3OTO H;  3N6X A;  2YU9 B;  2VR1 A;  1DCZ A;  2XRS D;  4DV6 Q;  4C1N I;  3V6H A;  1TY2 A;  3HOU B;  2R87 A;  1E22 A;  2Z4I A;  4DAY B;  2XNA C;  1HNW Q;  2E5L Q;  3HO8 A;  2G9H D;  3PO2 B;  1RCV D;  2Q8R E;  3BZC A;  4GKJ H;  5H1S E;  2K28 A;  4LF9 L;  2ODT X;  4KHZ A;  1XMO Q;  5BMV F;  2DJF C;  1LTI D;  2HHF A;  4DR4 Q;  3OSO A;  4K8I A;  2ZDH A;  4A3L G;  2OLS A;  3CCJ A;  2OF1 A;  1H95 A;  1HRJ A;  1TII D;  3JZF A;  2YTX A;  1PH9 A;  4LF5 L;  4HNT A;  4IR9 A;  2MO1 A;  4NXN Q;  1BOS A;  4LH7 A;  2HIX A;  4RB1 A;  1C4Q A;  1KXL A;  4IHJ F;  2CWP A;  5EPK A;  2A68 C;  2Y0S E;  1JCK B;  3PN1 A;  1SYG A;  3PV0 A;  4J9S A;  4DR1 H;  4NB3 A;  3KBX A;  4MV1 A;  2EE1 A;  1AN7 A;  3K7U C;  5IGB A;  5A35 A;  4A3J G;  4NZM A;  4DK3 C;  3DF7 A;  4A3B G;  4TV8 F;  2QGQ A;  5EBC A;  1B04 A;  4EBC A;  2B2U A;  3MR5 A;  1Q90 A;  3OHA A;  1FYC A;  1O75 A;  4A3B B;  4KMU C;  5LYJ F;  1KNE A;  2PQE A;  4Q0Y A;  3NTK A;  2F1M A;  1YIJ A;  3LQS A;  3G8C A;  2NUC A;  4U68 A;  5HY6 A;  5JJI A;  2ZM6 Q;  3DM3 A;  5IGC A;  4UY8 C;  1V1Q A;  2VUG A;  3BDC A;  4KTA A;  1VQE A;  3T9F A;  2XCL A;  3JSN A;  3V6K A;  4K0K H;  4HAE A;  3FMC A;  2J0T D;  3TS2 A;  4BY7 G;  4JI5 H;  4R8N A;  3ICE A;  2WAQ A;  3S1Q B;  2JA6 A;  5DGB A;  2KEC A;  1E4F T;  2GN5 A;  1J9O A;  4DR7 H;  3UZO A;  1QVC A;  3K80 C;  1ESF A;  4QB4 A;  4QF4 A;  3CC7 A;  4A3B H;  2WV6 D;  2PBZ A;  1KAB A;  3UDI A;  3K3P A;  1IKM A;  3PUX A;  2FKL A;  4JI3 L;  4R8I A;  1S68 A;  1UE6 A;  2XWJ B;  3CCM A;  4ZKC B;  3MJF A;  4XYL B;  3FKI B;  2YRW A;  3BG5 A;  2E2H A;  3HFZ B;  4GLA C;  4OX9 L;  1X55 A;  4NP5 A;  3T9C A;  1EY6 A;  2N55 A;  1WFQ A;  5FR9 A;  5J1Z A;  3LX0 A;  4JI6 L;  5JVD F;  4HN7 A;  2C2E A;  1GHK A;  1CKM A;  4R4I A;  1EQQ A;  3EA6 A;  1EYC A;  1KIX A;  1MD2 D;  2R61 A;  1NJI C;  4CDD C;  5CV8 A;  1PDQ A;  1PRT F;  2MFI A;  5NUC A;  5FLX E;  2QDB A;  5JJZ A;  4LF9 Q;  4ZYS A;  4R4O A;  1GLV A;  1Z6H A;  2C35 B;  2NZH A;  3VYT A;  2I5M X;  3EYY A;  3A5U A;  4C5C A;  1VQL A;  1A2T A;  2L55 A;  4J9O A;  4ZKB B;  5C4H A;  2KHI A;  3IFT A;  2IW3 A;  1XNQ Q;  1TVX A;  4I7H A;  4R4C A;  4XYM B;  1TR5 A;  2HUG A;  3VA5 A;  4DK0 A;  4EFB A;  4GC6 A;  2L12 A;  2XGT A;  5JQW A;  2YS6 A;  4RHS A;  1HR0 H;  2F4V H;  1UNN C;  4R7R A;  1TWC H;  4UFZ A;  1KAA A;  3M4O B;  1J5E Q;  4PZ8 A;  3BG3 A;  4IZ8 A;  5T1G A;  3D4W A;  3MXN B;  1KJI A;  3PF4 A;  2HGW A;  4L1K A;  2E2J H;  5M3F H;  1A15 A;  1MHW C;  4TUY F;  2BE5 D;  4IUP A;  4RKL A;  4ECW A;  1E24 A;  1V1P B;  2F3I A;  3SK5 A;  5HNE A;  4JI1 Q;  5KT6 A;  1EYA A;  2UUA L;  1YI2 A;  4LFC Q;  3TRZ A;  3Q8R B;  1X56 A;  5G3L F;  3CF5 A;  5I60 A;  3T99 A;  2Z1C A;  3I72 A;  1I50 B;  1HNX L;  3SHL A;  4DR3 Q;  3KAJ A;  3V96 A;  2VUM H;  5JUM A;  1TWF H;  4DV4 H;  2V9W A;  3HG9 A;  4RGT A;  2PQA A;  4RNM A;  4DR3 L;  3GTK H;  1CFM A;  2R93 G;  1GHJ A;  2A6E C;  2BCO A;  4LSX A;  2ASD A;  1B9N A;  4GNX B;  5HUR A;  1HQM C;  4X62 L;  2BH2 A;  4LFC L;  3K5H A;  1XX8 A;  2EY2 A;  1AZP A;  1WYD A;  3I4M B;  3P7J A;  2E2J B;  4DL5 A;  3K59 A;  1HQR D;  2JA7 H;  1CSP A;  1VQC A;  1O7I A;  4HYK A;  4DV3 H;  3I4M G;  3LGJ A;  4DL4 A;  1S40 A;  3K7A B;  1EOV A;  2WAC A;  1OTC A;  3MR3 A;  3VPB A;  4IWX A;  2HIV A;  1YNJ D;  2EYP A;  2Z02 A;  1PYS B;  2RSO A;  4RGM A;  5C8Y F;  1VQM A;  3HOZ G;  4P71 A;  2EPB A;  3GTO B;  3V6J A;  5I5U A;  4DAM A;  4YR3 A;  2QKI C;  3QO2 A;  3HBL A;  1SNQ A;  1IKL A;  1I3Q H;  2MP1 A;  1WCM G;  2Y0S G;  1EWH A;  2NVX A;  2JA5 A;  4JV5 Q;  3TY8 A;  4IPG A;  2RGV A;  1P8L A;  2WE6 A;  5G3L D;  4KHP Q;  4XYQ A;  1EY7 A;  1RIP A;  3VR6 A;  3P1H A;  5IGG A;  3NBY B;  4J9P A;  4JG2 A;  4XQQ A;  1I2K A;  3AU7 A;  3PVX A;  2IHE A;  2Z4H A;  1VQK A;  5BYB A;  1C48 A;  1H9R A;  2B2V C;  4YAJ B;  2CNU A;  3GV7 B;  3PF5 A;  4GNX A;  1ENF A;  2NVQ H;  4K5V A;  1BQQ T;  3GTO H;  4LF7 H;  3S1N B;  1BCP C;  3IFD A;  4RNN A;  2K7V A;  1OWT A;  3RB4 A;  2K04 A;  5C4Z A;  2M05 A;  2C2R A;  5TSS A;  3U9T A;  3D31 A;  2Z8L A;  2EYO A;  2CNQ A;  3Q1K A;  3KHL A;  2NN6 I;  3BQ1 A;  4LF7 Q;  2C28 A;  2PYK A;  2BA1 A;  1VS0 A;  1VDZ A;  2ZT9 C;  4QIW E;  4A3C G;  4EGJ A;  4RZR A;  2F0P A;  4JYA H;  3V4S A;  3MFI A;  4FU0 A;  3PIO 3;  2JEJ A;  4FYD A;  2WYO A;  3NUA A;  1EY4 A;  5DG9 A;  4OON A;  4B3S L;  5DMX A;  5IIF A;  3N42 B;  4FS2 A;  1B70 B;  3PO3 B;  2GVB A;  4BBS G;  1PK8 A;  5D1O A;  3NK9 A;  5ELF A;  5AJ3 L;  5ELO A;  2H1E A;  5KFO A;  1W2B A;  3RB3 A;  2OQK A;  2K4K A;  3I4N H;  3GB8 B;  2ZJR A;  2L4N A;  1RDP D;  1CT1 D;  4ZUJ A;  3T9E A;  4YQW A;  3A55 A;  1S5D D;  4MV9 A;  1FNV A;  4O84 A;  4C5B A;  4LF8 H;  2RDG A;  1S10 A;  4ETS A;  3K0Y A;  2AQ3 B;  2WAQ E;  2VPQ A;  1WTP A;  4O0A A;  3R5F A;  4J9Q A;  3MHB A;  1IYU A;  1CZW A;  2C5C A;  2GPS A;  1KJ8 A;  4RCN A;  1QIL A;  4F7X A;  1BUV T;  3K5O A;  2HDM A;  3S16 H;  3A5Z B;  1ICW A;  1PXU A;  3HOW B;  2VA3 A;  4P72 A;  3GTK A;  4NZN A;  1D7Q A;  4FFN A;  4PBC A;  1V8Q A;  4TQS A;  2R8G A;  2JA6 B;  5D3I B;  4ED7 A;  3HS0 C;  3T9B A;  1JT8 A;  2R84 A;  4JI6 H;  1PH1 A;  1VBH A;  2F0G A;  3RMH A;  3F2C A;  1ENC A;  3CCL A;  4JXU A;  1SNO A;  2AUJ D;  4CDC C;  2D5D A;  3RFC A;  3NUC A;  3GTQ B;  4LF9 H;  3PFF A;  1D5M C;  3FPU B;  2CW8 A;  4N9T A;  1VQO A;  4MA0 A;  1U5K A;  4K0K Q;  3GTP A;  4WRD A;  2JEA I;  2LXK A;  1PLF A;  2GPW A;  2CQY A;  3IAY A;  2N78 A;  1F2L A;  1CQF A;  2A1H A;  5DLG A;  2GA4 B;  3G6X A;  2R93 A;  5LA6 F;  4JBK A;  5EWG A;  4JI0 H;  1JKJ B;  2FMM A;  2CWA A;  1SE3 A;  3HKZ G;  1I7L A;  1QWY A;  1M6V A;  2W6Q A;  4N9P A;  2VQD A;  5CBE E;  5LMN L;  5KT3 A;  4MN3 A;  1HA6 A;  1YJW A;  4F4Z A;  2K5V A;  4Q43 A;  2K5N A;  2DIK A;  4KJN A;  3JAM i;  4IIJ F;  4DV1 H;  1ULZ A;  4I4T F;  3VPD A;  4WJ4 A;  3RTX A;  4X64 H;  2DJG C;  5GAD C;  5KT2 A;  2K52 A;  3R93 A;  2NTT A;  1PH3 A;  2PVP A;  3KLW A;  3TQY A;  3VPC A;  2FK2 A;  1EOT A;  4QIW A;  1VBG A;  4RNO A;  2NN6 H;  3JAM L;  5C3E H;  5DQI A;  3J80 E;  4X3S A;  1RTO A;  4KY7 A;  1NSN S;  3HOV H;  4C5A A;  5IOD A;  2KA7 A;  2H4O A;  3FPP A;  3MXN A;  1BDO A;  4H7B A;  2AQ2 B;  2F0W A;  4DRF A;  2UXD Q;  2UUC Q;  3R5H A;  2PZU A;  4QJF A;  2MHV A;  3D3R A;  4O7N A;  2B63 B;  1J6Q A;  1ML0 D;  5IGE A;  3JRW A;  4OXP A;  3GV5 B;  3GTJ A;  3GTG A;  1IBK L;  4Y7N H;  2TMP A;  2M9V A;  1O78 A;  2XIW A;  1DOK A;  1K8M A;  2UVW A;  3AQQ A;  4K6D A;  4L5S A;  3DTG A;  3M9M B;  3MR2 A;  5DLQ E;  1LV9 A;  3EPI A;  4A93 G;  3VA7 A;  1GO3 E;  4AYB A;  5M5X B;  1SNP A;  3M9B A;  4IN3 A;  4DR5 H;  1DM0 B;  4C3I H;  3T5H A;  3PMF A;  3F1Z A;  5I5S A;  1Z47 A;  4EYH B;  5FLX W;  4JI7 H;  1IOV A;  3LWU A;  4XIG S;  1VQG A;  3R2T A;  3CCV A;  1K3B C;  3BS1 A;  1U0L A;  1WR2 A;  3CSW A;  2CQA A;  5KFA A;  2JEI A;  3KJO A;  3NBH B;  3KLS X;  4NKL A;  3U4Z A;  1HTP A;  3CXC A;  3C2P A;  1UE5 A;  4O2D A;  1K83 A;  1H9M A;  2E2I B;  4LF7 L;  3G4S A;  5E4X A;  1U4L A;  2R7L A;  2XGP A;  5KFL A;  4DKA C;  4MV6 A;  4JI8 H;  4GKJ L;  2L9H A;  1SYC A;  1EIG A;  1YJ9 A;  2DAB A;  2Z9H A;  3J80 W;  5J3B A;  1HZB A;  4HED A;  2NU9 B;  4F4Y A;  1MSG A;  4UDU C;  1K1S A;  5DEH A;  1EYG A;  1A3T A;  3V2T A;  2I87 A;  2EVB A;  4DV4 Q;  2CW0 D;  2YL2 A;  2F0I A;  3STB D;  1K0S A;  3RIZ A;  2J4X A;  4DNT B;  5IYD G;  4A3G B;  1VMC A;  4DNR B;  2VUM G;  4RB3 C;  4WJ3 M;  4LMY A;  3N52 A;  4O42 A;  5M5W H;  3Q0A A;  1CI3 M;  2IWH A;  1IYV A;  1SEI A;  5D8D A;  2K32 A;  5JH7 F;  1Y1V A;  2XN9 C;  1LYL A;  4PG3 A;  1UWV A;  5EBD A;  2WFW A;  3CAM A;  3GLK A;  1VF5 C;  2F3W A;  1JB7 A;  2BH8 A;  2M00 A;  4POF A;  4MTK A;  1AEX A;  3BDL A;  1RL2 A;  1F9Q A;  3E0E A;  4BA2 I;  4IQZ A;  3M3Y H;  3HOW G;  3S1R B;  2YYZ A;  4TV9 F;  3S1M B;  3M85 A;  2V4R A;  4BY7 B;  5C3X A;  4I7A A;  1ZHS A;  1VKZ A;  4X62 Q;  5KRU A;  3M9O B;  1TS2 A;  2C2D A;  3CRL C;  4J9N A;  2HHF B;  2MCT A;  4RH6 A;  4A3E G;  2MGS A;  3HEJ A;  4BS9 A;  4ECS A;  5KT4 A;  3J7A V;  3NC0 B;  4J8Q A;  3L2P A;  3VR4 A;  4O3N A;  1LLR D;  1U9R A;  1B6R A;  2O03 A;  4GS3 A;  4IAJ A;  1LTS D;  1STY A;  5KT5 A;  2W8K A;  1V1O A;  4RAU C;  1SLJ A;  2AWN A;  4UCU A;  1CKN B;  3S1M H;  2B3G A;  2QDL A;  1E2W A;  4C3J B;  4MNO A;  3ZJY C;  4UP9 A;  5IY0 A;  4DV2 L;  3OW2 A;  2L15 A;  5KIX A;  4FM9 A;  1D5X C;  1HFG A;  2R92 G;  1GUO A;  2RSN A;  1ESR A;  2X6L A;  4ABN A;  1XNR Q;  4PNY A;  3MWD A;  4ECY A;  4OO1 I;  4E4T A;  1N33 Q;  3QOL A;  1VQ7 A;  4ECT A;  3SGI A;  5FLX c;  2L0C A;  2JXM B;  1OBG A;  3W1G A;  5DG8 A;  5KG3 A;  2DN8 A;  4DAY A;  4EFE A;  3DXJ C;  2R85 A;  2IBK A;  1G2S A;  3BDO A;  3H40 A;  2HQE A;  3I91 A;  2Q8T A;  4DUY L;  5DGI A;  4O7T A;  2KCT A;  2YU9 H;  2O5I C;  2MNA A;  4PMB A;  4IJL A;  4OL7 A;  3C1E A;  4DR6 L;  4EQP A;  3R9R A;  1LTR D;  3URY A;  2RF4 A;  5I5T A;  1S3O A;  4DGZ A;  1NR2 A;  1S5F D;  1L0W A;  3GID A;  1QJO A;  4GNX C;  4QWA A;  2HVR A;  2E75 C;  3H6M A;  1DJR D;  3A8I E;  2YZM A;  3BVM A;  1X6O A;  2BDN A;  1A3G A;  1N36 H;  2YTV A;  2R93 B;  4IFD G;  1S97 A;  1XNR H;  1KDB A;  4O3R A;  3I12 A;  5LMU Q;  2RQX A;  3BAA A;  4B3T H;  2KCM A;  1NUC A;  1S72 A;  3UI2 A;  1WTW A;  2EJF C;  1GKH A;  5JEA J;  3J7Y W;  4DNI A;  5JEA G;  3DEP A;  4K5X A;  4QGU A;  4LF6 L;  2K5D A;  1G6Z A;  1RJR A;  1RK6 A;  5CV5 A;  2F0S A;  1UC9 A;  1KJQ A;  2YZG A;  3I2Z A;  1TS4 A;  1B6S A;  1HUN A;  1TWG B;  2O2L D;  5LMU L;  1SMY C;  3PSI A;  1PH2 A;  2FJZ A;  2EXZ A;  3HXL A;  4AYB E;  2B39 A;  1MBY A;  1VQ8 A;  4YIJ A;  4O3S A;  4B9X A;  4G3I A;  1EKP A;  4O2B F;  3TY5 A;  3QOJ A;  3F8N A;  2Q2I A;  5FOB B;  1A8V A;  2IX3 A;  3OHB A;  1TWH H;  1IBM H;  4RU9 A;  3R2I A;  4DUZ L;  3J81 L;  1CS0 A;  5EPJ A;  4HNV A;  5F9N A;  5KFP A;  4DUY Q;  3SK4 A;  3CCQ A;  3TZU A;  3HRZ C;  4B3R L;  3KK7 A;  5LXT F;  4LFA H;  1PX2 A;  2NZ1 D;  1VQN A;  5ELB A;  5JEA H;  4K2L A;  4OEM B;  1GXD C;  4A3D H;  3GJX B;  1X3P A;  1N33 L;  2B2T A;  3K5I A;  4K14 A;  1XXG A;  3F8T A;  3LUL A;  1VQ6 A;  1Y14 B;  4DL7 A;  2L1B A;  2WB1 A;  4IRC A;  1SRO A;  4LF4 L;  2DNC A;  1I6V C;  4KV6 A;  2YWV A;  2COG A;  4P75 A;  4K0K L;  5L1K A;  4IFD H;  1TS3 A;  2A6H D;  2X6G A;  1D6E C;  4JI7 L;  1RK5 A;  5HBR B;  2K50 A;  1TWF B;  2UUB L;  3S1N H;  1Q82 C;  2YTY A;  2JSO A;  3NWS A;  2LXJ A;  2AQ1 B;  2AUK A;  1KTA A;  2R82 A;  3E5N A;  3HOY H;  1SNC A;  1TWH B;  4C1N K;  1VQ9 A;  2SDF A;  1HNW L;  3Q8S B;  1PFS A;  1O7Z A;  3QQM A;  4JV5 L;  5IWA H;  2L11 A;  2I0Q A;  1CKO A;  4A3I G;  3KHH A;  3FKI A;  1B3Q A;  5DQG A;  4JI8 L;  3H15 A;  5C44 H;  2BR0 A;  4BBR H;  4NXM Q;  2WDT A;  4A75 A;  4E6I A;  1WD0 A;  4PWQ A;  2O4X A;  5IGD A;  4UCR A;  5C0X H;  3GTJ B;  1FJG Q;  1CHQ D;  4F4X A;  2J6S A;  1DZ1 A;  3EN2 A;  2W71 A;  2YYA A;  2KEN A;  5KX5 F;  3DMU A;  4V19 0;  5KFI A;  1PFB A;  3CQZ H;  3PCO B;  3OMG A;  4RA8 A;  5EWF A;  3MAQ A;  3NEN A;  3TDQ A;  4IO9 A;  1QVG A;  1N34 H;  1AFP A;  5HV6 A;  1OXU A;  2ATW A;  1I6U A;  2JA8 G;  2V58 A;  4N8X 1;  2UVR A;  4EEY A;  3IL8 A;  1N34 Q;  3DM1 A;  5IT9 L;  4J9R A;  4HID A;  2JA5 B;  1N36 Q;  4LSA A;  3PIP A;  1MI2 A;  4KK7 A;  1NY4 A;  3W3A A;  4LF8 Q;  3JAM W;  1LAC A;  4RWS C;  1A62 A;  3NQI A;  1SE8 A;  3A8J E;  5IYC H;  3Q8Q B;  3M3Y B;  4DFA A;  4A76 A;  3B6Y A;  4JI0 Q;  5M5Y B;  2W9C A;  2K5Q A;  5DLF A;  4EG0 A;  2OTL A;  1IBK H;  1TWA A;  3K5M A;  2XWB B;  4P2C B;  2NB0 A;  3KJP A;  2VQF L;  1E4E A;  3RZO H;  4DPG A;  1EY0 A;  2DPI A;  4X65 Q;  3IRB A;  4MTN A;  1XMQ Q;  1WSC A;  4LFA Q;  4GKK H;  1HNZ H;  1FGU A;  4GN5 A;  3TN2 A;  1BCP F;  4M0J A;  5CV9 A;  1FKA H;  3S17 B;  2XC9 A;  3GTM B;  4B08 A;  3AFP A;  2JP1 A;  4POG A;  4JOI A;  4CDF C;  4LH6 A;  1BXR A;  1FNU A;  4QUC A;  2HCI A;  1HPC A;  1HR0 W;  4XQJ A;  3OW7 A;  1I94 H;  5KFT A;  3HOX H;  3T7A A;  3TW6 A;  4XT3 B;  1OXX K;  3OYY A;  1B9M A;  1NE3 A;  5K36 G;  1SYF A;  4UCT A;  5C6A A;  3G6J B;  5IT9 c;  3KFU A;  4APM A;  3OOC A;  2D0O A;  1TWH A;  2WB1 E;  3PUZ A;  2RCN A;  1SFO B;  4O3P A;  1EHI A;  4DN4 M;  1EUC B;  1M90 C;  3HB9 A;  2QIL A;  4GN3 B;  4QWE A;  1UAP A;  4GC7 A;  3KF8 A;  3U55 A;  4DV0 Q;  4HNU A;  4M8A A;  4F87 A;  5AFW A;  3KAK A;  1DAA A;  1IL8 A;  2F0E A;  2NU6 B;  1NMG A;  4QCL A;  3MTS A;  2XD4 A;  4GLV B;  4RGN A;  5EZY F;  1GUG A;  4X62 H;  4KD3 A;  4DQN A;  3FKI H;  5IT9 W;  2JA6 H;  2HGX A;  4EBE A;  3MXU A;  3GTL H;  2DY8 A;  1PYB A;  1JXL A;  1BNZ A;  4DR6 H;  1D1K A;  2XTI A;  1EY8 A;  2B63 G;  1F77 A;  3FHW A;  1W6J A;  2PMZ E;  2TSS A;  2OT2 A;  3FEW X;  2PW7 A;  1EQR A;  3WO0 A;  3KTM A;  4QWB A;  2CH4 W;  3GP7 A;  3S14 B;  1IW7 C;  1I7N A;  1TWF A;  4ME3 A;  1N32 H;  2WKD A;  1JWM D;  5BPF A;  3MC0 B;  3U0G A;  2ZJP A;  2UUA Q;  1Q46 A;  4JI1 L;  4JPB W;  4IR1 A;  4FFM A;  3HOZ B;  1AW7 A;  1SEB D;  1SN8 A;  5FO7 B;  4J0M A;  5T14 A;  3UDF A;  2B2T C;  2WB1 B;  2VQE H;  2OH2 A;  3GTL B;  1J5E L;  1NCV A;  2KSW A;  1KHI A;  1RYS A;  3N6R A;  3RN2 A;  4A3K B;  3QZ7 A;  1Z9F A;  1GJX A;  4TQR A;  4CJ1 B;  4DL3 A;  5KFH A;  1TWC A;  4H02 A;  4ME5 A;  2F0U A;  4JVZ A;  3CCU A;  5HGT A;  1E7Z A;  1YHB A;  3BJY A;  2K01 A;  2IT1 A;  1S0M A;  2EYJ A;  1QOH A;  4FDB A;  1QZH A;  2FB9 A;  1ZXT A;  3MXG A;  2HHH H;  1I1K A;  4HJ8 A;  1KEE A;  2YS7 A;  2MJ8 A;  5I9P A;  3R5X A;  2UXB Q;  2FJ2 A;  1CZG A;  1L2F A;  2PCF B;  3JC6 6;  2W6N A;  2K6A A;  3NHH A;  4LF5 Q;  1B2T A;  4ZQI A;  3GTP B;  3ULJ A;  3GIP A;  2W57 A;  2AMC B;  2I5H A;  3OHX C;  4DR2 L;  4JI7 Q;  3H4D A;  2R7K A;  4JI6 Q;  4GOP B;  1JB3 A;  2IX1 A;  1SRU A;  5CV7 A;  2NVQ B;  1ZYR C;  2D9U A;  2C22 A;  4UPA A;  4XXE A;  4OX9 Q;  3NBI A;  1BGW A;  2AQ4 A;  5KFD A;  3TS0 A;  2XIG A;  2E2H H;  4A3G G;  2K33 A;  3EJI A;  2QEJ C;  1V51 A;  4L5T A;  3RF2 A;  1N33 H;  1X9N A;  1ASZ A;  4BBS B;  5M9O A;  3KAL A;  1PFN A;  5KG0 A;  2YZL A;  4O7R A;  4R1J A;  1W3S A;  1EU3 A;  2UUC H;  3PW7 A;  2J6U A;  2B2Y C;  4G57 A;  2ZDG A;  1STA A;  5E7N A;  4BY1 B;  1WJJ A;  1NMF A;  2UXC Q;  4X3T A;  2ASL A;  4HJ9 A;  4FF1 A;  4BY1 G;  4DUZ Q;  2VNU D;  3ONA B;  1VQJ A;  1D2B A;  2NVT H;  1ROD A;  4RB2 C;  4O4L F;  2F4I A;  3FVQ A;  2VY3 A;  3RAQ A;  3Q23 A;  3RR5 A;  3Q24 A;  2BDO A;  2YZN A;  4G4K A;  3GTG H;  1KC8 C;  4ECX A;  4B3S Q;  2MQH A;  1QUQ B;  1RJQ A;  2JA6 G;  1ZAU A;  3FKI G;  5KFF A;  4ECR A;  2RVL A;  4FXG C;  3M4Q A;  3QZ8 A;  4X64 L;  1RYR A;  3S9W A;  2IJ0 A;  2PNH A;  3GIQ A;  5I5Y A;  4EQ5 A;  2F0J A;  1H9S A;  5EAY A;  2FP4 B;  2R6F A;  2EIY A;  2A6H C;  1BR9 A;  5L1J A;  4IFD I;  1VQB A;  3EBE A;  3T51 B;  4FF2 A;  4OEL B;  2FFK B;  2K1B A;  5LHY 1;  2CHB D;  1JLL B;  3Q6S A;  3RLN A;  3CD6 A;  1YNJ C;  2R92 B;  1JDE A;  1BVS A;  3TQT A;  5I2X A;  5K36 H;  3HOX G;  4AQY Q;  4BWS C;  4O82 A;  2G9D A;  2N8N A;  3ERS X;  3I4N G;  3HOU H;  1EUD B;  2ZDQ A;  5E3F A;  1RF2 D;  2NYZ D;  3BYT B;  4KN7 C;  3CCS A;  2A5H A;  3PW5 A;  4KHP L;  3CC4 A;  3TP6 A;  2PMZ A;  1XPO A;  2UUB H;  2E5L L;  5KYL A;  3RZO B;  4ZHQ F;  3T1Y Q;  4OX9 H;  1EIY B;  2JE6 I;  4EGV A;  1ILP A;  1PFM A;  4IPD A;  2XGQ A;  4XDX A;  4OWW B;  4A3M H;  1SYE A;  4LFA L;  2BQU A;  1I4X A;  1T9H A;  4DV7 Q;  4A3C H;  1UC8 A;  3G6Y A;  2W6P A;  3RJ0 A;  2KHJ A;  1JMC A;  2VQF Q;  3WWV A;  1S0O A;  2EQS A;  4TKO B;  5BN4 A;  1SDF A;  4B3M H;  3IKJ A;  2GLT A;  1E2Z A;  2E2I H;  2LFN A;  3RUZ A;  2EY5 A;  5BR8 H;  2BA0 A;  4KHV A;  5IWA L;  4WBN F;  2NVT B;  1RKN A;  4NZO A;  3QIA A;  4EQN A;  4O7W A;  3H0G A;  2WP8 J;  5I5W A;  2KUM A;  3KOJ A;  4UCS A;  4AYB G;  1SFO H;  3MWM A;  3FRP B;  3D4R A;  5T1I A;  1IBM L;  1MIU A;  5CR5 A;  1N34 L;  1HFN A;  2Z0S A;  2ZJT A;  4KHP H;  1EQV A;  1O7Y A;  2NTS A;  3QWN A;  4JI2 H;  3AW8 A;  5JVL A;  4ED6 A;  1MJC A;  5FO8 B;  1JC7 A;  4LF6 H;  5C0X I;  4APV A;  2V4D A;  3WO1 A;  2K75 A;  1N48 A;  3PO3 H;  4GLW A;  1SND A;  3LP8 A;  4A3K G;  2QW7 A;  2AGO A;  1MGS A;  4C3H G;  4BBR B;  4HSV A;  4Q8E A;  1ZYR D;  5C4X H;  2D0P A;  4OIJ A;  5BWW A;  2K03 A;  3QG1 A;  2R7Z H;  5KFZ A;  3L7Z C;  2R86 A;  4BBR G;  3T5K A;  2UXD H;  2R7M A;  3G7L A;  4Y52 H;  4OWT B;  5KGU A;  4H44 C;  1L1O B;  4CMF A;  2BQ3 A;  1CTM A;  2CH4 A;  4EBD A;  5M3M B;  2FE3 A;  1XNQ L;  5DM7 3;  4A3I H;  3OMC A;  4JI8 Q;  3NQT A;  2JA9 A;  4LNQ A;  5IP7 H;  1XK5 A;  4DUZ H;  3MEH A;  4DR5 Q;  1E0B A;  1EUJ A;  4OGQ C;  1GUW A;  1Y8O B;  1HNW H;  2B8G A;  1HCZ A;  3HP3 A;  2F0K A;  3LNN A;  4HJ7 A;  2KCC A;  4I65 A;  5CGK A;  4CJ0 B;  2EXD A;  1BNC A;  5K3W A;  2IL8 A;  1JOO A;  4JBW A;  4ODG A;  5FKA C;  3J80 L;  3JZ6 A;  1Q3L A;  1Y1V G;  3E0J A;  5D1O B;  1LTB D;  4A3I B;  4JV1 A;  2E2D C;  5L9X A;  4Q45 A;  1L1O A;  1I3Q B;  1SYD A;  3I73 A;  1IBL Q;  2QB5 A;  3RZD B;  4O4I F;  4NW2 A;  3M7G A;  5EJW A;  2HVQ A;  3SE7 A;  4HQ6 A;  4ZI7 F;  2COJ A;  4YR0 A;  5IGF A;  2LY7 A;  1T94 A;  3H0G B;  3RLF A;  2CW7 A;  5KEE A;  1TWG H;  4RUC A;  4WOR A;  2A19 A;  1QZG A;  1R4Q B;  3RGX A;  2PW5 A;  3NPP A;  1A9X A;  5E1F A;  1EU4 A;  4X65 H;  4JV5 H;  5KKN B;  4FFL A;  1QCB D;  4KI0 A;  1UE1 A;  1I3Q A;  4DR3 H;  3T5J A;  4YY3 L;  4A2A A;  1B3A A;  1MZB A;  1ONL A;  1S03 G;  2KQ3 A;  3QB3 A;  1NNX A;  1SBB B;  1Z2O X;  4FF4 A;  1VQP A;  1JJG A;  1GUN A;  3CCE A;  3T1Y H;  3J7A 5;  4X3U A;  4YAK B;  1B8A A;  1G2W A;  1ET6 A;  3MA2 B;  1HA5 A;  1SSO A;  2ZJQ A;  4O4J F;  4MTD A;  3STB C;  3J80 i;  1AUX A;  3HOV B;  4K6L A;  3RBE A;  3H3V I;  1IHZ A;  1F9P A;  2I5L X;  1U4R A;  2VQF H;  2Z6K C;  1XYI A;  4OIK A;  3SE0 A;  4R8U A;  2DAA A;  4LF6 Q;  3OUU A;  5KS8 A;  5L1L A;  5EDW A;  5KG6 A;  2FK1 A;  1I6H B;  1KRT A;  2JA5 G;  1WCM A;  2V4Q A;  2RDI A;  3OIQ A;  3FMA A;  2Y4R A;  4FS1 A;  4KJO A;  2R7F A;  2AGP A;  4J9K A;  3GTK B;  2IA6 A;  3U4V A;  1OO9 B;  2EY6 A;  1B50 A;  5EWE A;  3CEB A;  5KFU A;  3C1F A;  1FVI A;  1V1P A;  4O7L A;  5I6Y A;  2A8V A;  3K0X A;  4LAA A;  1K9M C;  1VQH A;  1WTO A;  5BWV A;  3L0O A;  4YY3 H;  4JUZ A;  1LTG D;  1PV4 A;  5KFG A;  3E9H A;  4YHH Q;  2LS0 1;  3J81 j;  3CPW A;  4GZY C;  2WIN B;  1EWC A;  4IUR A;  4TVI A;  3HKZ B;  1JWU D;  2SOB A;  4GOP A;  1Z2P X;  2PNR C;  3KBG A;  2F4V Q;  1DGS A;  4CHT B;  1K3R A;  2FMC A;  3J7A K;  4ECZ A;  2WKC A;  5DIS C;  3GQC A;  1J5E H;  3PUY A;  4GKK Q;  1XMQ H;  5C5L A;  4A3J H;  2R8H A;  4LUZ A;  2OEO A;  2RDF A;  2SEB D;  3S17 H;  5CV4 A;  4JV2 A;  3CW2 C;  4QY7 A;  4NXN H;  1GGO A;  1I6H H;  5F9L A;  2KVM A;  2ZXO A;  1Q7Y C;  4C2M H;  2R92 H;  1VMP A;  3VR3 A;  2UXC H;  4ED1 A;  4I50 F;  3NBZ B;  1DV2 A;  1I94 L;  2NBF A;  1KQS A;  2K14 A;  3S16 B;  5C0X J;  2E76 C;  5FLM G;  3CC2 A;  4YJ3 F;  1T36 A;  2R7N A;  5KFS A;  2GVA A;  4FFP A;  1DOM A;  1AP0 A;  1VAJ A;  2IX0 A;  2IP4 A;  4HCE A;  3D6C A;  3SI8 A;  4YP3 A;  3A7L A;  1KLG D;  1ZET A;  4A3E H;  5DNF A;  1R9T B;  3F2B A;  2GQS A;  3MWY W;  3BA9 A;  3RUP A;  4FXD A;  4H13 C;  3SNO A;  4ED2 A;  2HQL A;  1BBW A;  3HOW H;  1X32 A;  1BBU A;  2B2Y A;  5JOB A;  4IPH A;  1JDB B;  1ILQ A;  2JJQ A;  4O81 A;  3D4D A;  3OTO Q;  1B1Z A;  3VR5 A;  3T1H Q;  1TA8 A;  3NGD A;  4DR7 Q;  1GSH A;  1M1K C;  5BWT A;  4FNF A;  3TRE A;  3S14 H;  4RHR A;  4JI5 L;  3GTO A;  3NEL A;  2KED A;  4IZO A;  2XSC A;  1STE A;  1Y1V H;  4JYA Q;  1KAW A;  2J7Z A;  5KFW A;  4IUV A;  4KD4 A;  4U67 3;  5CM0 A;  1MJE A;  1I5F A;  1T3N A;  3ERQ A;  3A8K E;  1S5B D;  1SAP A;  3GD7 A;  1RD9 D;  5CC4 A;  1STH A;  1AZQ A;  3ND9 A;  2GQR A;  3ULP A;  1H9J A;  3I7F A;  2W7P A;  3D0F A;  4KY5 A;  1W93 A;  1X3Q A;  3T4A C;  5A2Q L;  5IT9 E;  2VB3 X;  1PTO F;  1OXV A;  4JYA L;  3HKZ E;  3I8Z A;  3S24 A;  3WWI A;  1YNX A;  3R3O A;  4M1U B;  3MFY A;  5CBA E;  5LL6 X;  3VDY A;  2Z04 A;  5DAA A;  4CC5 A;  4DXF A;  4NMZ A;  4DLK A;  4IUQ A;  1CQI B;  1KBL A;  4XYO A;  3T1H L;  5C5J A;  3PW2 A;  5CYU A;  3S2D H;  4C3I B;  5C4X G;  3ERO A;  1M0W A;  4C3H H;  3EQL C;  3U9O A;  1KNA A;  1I50 A;  3L9A X;  3GO5 A;  3PO3 G;  3UE0 A;  4FFO A;  3NWT A;  5I9O A;  1AH9 A;  4HR7 A;  3S2D B;  1FJG H;  4BXX H;  1BKB A;  1JOK A;  3H94 A;  1Y1W G;  2X0S A;  4IUT A;  4ALP A;  2AGQ A;  5KG1 A;  3PW0 A;  3PUV A;  2I07 B;  1ET9 A;  4RG1 A;  1WTQ A;  1G6P A;  3K3V A;  4LMQ D;  1SFO A;  4Z9C B;  2CZG A;  1PH7 A;  3H0G H;  1WTX A;  4PMC A;  1STN A;  2MO0 A;  3UDX A;  1GUS A;  1I94 Q;  2DGY A;  5DM6 3;  2RGR A;  1UUP A;  3J80 c;  4CC6 A;  5KFN A;  2WAQ G;  1YEZ A;  3T1H H;  2HJW A;  1VCI A;  1T5X D;  1EL0 A;  5C3E B;  4KY6 A;  3MR6 A;  1LO5 D;  3RGZ A;  3DTF A;  5KG5 A;  4A3M G;  1GD7 A;  1EZ1 A;  5LP6 F;  1S5C D;  1FNW A;  5FJ8 G;  3KYH C;  3NE5 B;  5DAU A;  1STG A;  2UXD L;  3MFH A;  1JR0 D;  4IPC A;  3AEV A;  3K6O A;  2A69 C;  1PZJ D;  1TWC B;  1JIC A;  4EEQ A;  2VL6 A;  1NBW A;  3CCR A;  1G29 1;  3PIP 3;  3I90 A;  1E2V A;  4P74 A;  2OWO A;  3WWJ A;  1K8A C;  4QIW B;  4RFB A;  4PMW A;  5A2Q E;  1HNX Q;  4G7H C;  4DR2 H;  5J22 A;  4RGO S;  3HOU G;  1UEA B;  1KUT A;  2NN6 G;  2Q8I B;  4ZAI A;  5KFE A;  1Q8I A;  3ITP A;  1ZKO A;  4TQU S;  1F2M A;  5M3M H;  2CFM A;  4DV1 L;  3Q8D A;  5I2Y A;  1Q86 C;  3C3L A;  4YCV A;  1R9T A;  5KT7 A;  3P75 A;  5FO9 B;  3J81 i;  3SXH A;  5KFX A; 
#chains in the Genus database with same CATH