1P8LA

New crystal structure of chlorella virus dna ligase-adenylate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
296
structure length
276
Chain Sequence
b'AITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNFGYEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIRHEED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PBCV-1 DNA ligase
publication title Analysis of the DNA Joining Repertoire of Chlorella Virus DNA ligase and a New Crystal Structure of the Ligase-Adenylate Intermediate
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase
total genus 64
structure length 276
sequence length 296
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1p8lA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1p8lA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1p8lA01
1CSPA 2IHEA 4ALPA 2GVBA 5M3MG 2EIFA 1EYGA 1PH3A 2E8GA 4AQYL 5AJ3L 3DM3A 1PH5A 3FKIH 2QA4A 1EOVA 2UUAL 2VUGA 3KYHC 4YWKA 1KRSA 1CKMA 2GVAA 2KCMA 3KF8B 3S1NH 4LF7Q 3S2DH 4KHPL 2ZM6L 1D7QA 2PMZE 2Y0SG 4C3HH 1N32L 1J6QA 4A3JH 4IFDJ 1PH4A 5GQOA 3UE0A 4FDBA 2JEAI 4WJ3M 3L0OA 4A3BG 2Z0SA 3TRZA 3KDFB 2PI2A 4DAMA 5C3EG 1GM5A 4JI6L 4DV5Q 3UDGA 4A3GG 3HOUG 1LM0A 2CWAA 4NXNQ 3GD7A 4E6NA 1K9MC 1X65A 4R4OA 3ULLA 5IP7G 1OXTA 2JA5H 1PYSB 2EQSA 2VY3A 2WP8J 2UU9L 4A3FH 1T9HA 2ZTDA 4IPGA 2ZTEA 4YWLA 3I55A 1U0LA 3K8AA 2IY5B 4C2MH 3K7UC 4A3MG 5FPRA 5HY6A 3CQZH 3L7ZC 4GN4B 1SN8A 3S16H 2ES2A 2E5LL 1FGUA 5M5XH 3F2DA 4L5SA 3I2ZA 4UCUA 4LF9Q 4A4IA 2C35B 4A3DG 5IYDH 4BBRH 3CD6A 4JV5Q 2I0QA 4HIOA 1CUKA 1TWAH 4TVAB 2Y0SE 2VUMG 3OTOQ 3M4OH 1OXUA 4JYAQ 4O2DA 2VW9A 3H3VH 1VQ8A 3HOWG 4NB3A 4HIMA 4JI3L 1K0RA 4NXMQ 2R7ZH 5K36G 5IYCG 5FPOA 2HHHQ 1Q12A 4JBJA 2ZJRA 1I94Q 2UXDL 1VQKA 2QEXA 4LW1A 2MFIA 4PMWA 4YCUA 1OXSC 2R6GA 2PQAB 3GDEA 4MZ9A 3J80c 4GOPB 2VS1A 4GOPA 2JA6H 4P72A 2RCNA 4A93G 4YHHL 1QVGA 1GVPA 1Y1VH 3CC2A 4DR1L 2OCEA 2MNAA 4A75A 1PYBA 3GTJH 2I5LX 1XPUA 1EIFA 1S3OA 2K50A 2RHSB 5IY0A 3PUYA 1J5EL 4DV7L 4B3RQ 1DGSA 3CW2C 4DV0L 3J81c 3LGJA 2CKZB 1HR0Q 1JT8A 1X3FA 1HR0W 4L5RC 2WFWA 2UUBQ 1HNXQ 2YU9H 4DV6Q 1L1OB 2CFMA 3W1GA 5HGQA 4BBSH 4GKKL 3CMAA 4POFA 1SFOH 2ATWA 5FLXc 1VQBA 3E9IA 5C0XG 5M3FH 3J80i 5C0XI 1PH9A 1XDNA 4DR4Q 4JOIA 3AQQA 3S17H 1XK5A 4GLAC 1OXXK 4B3SQ 4LF5L 4LF6Q 4LFAQ 1MIUA 2JA7H 3U50C 4BY7H 4LF8Q 4B3TL 2LSSA 1UWVA 1R9TH 2CQOA 2AHOB 5D1PA 1SE8A 5C4JH 3H3VI 3BABA 1X55A 4CC5A 2NVTH 4LUZA 4CC6A 4X65Q 3M3YH 1YNXA 4DV1L 1IXRA 1CKOA 1X54A 3GTGH 3T1HQ 2YTYA 2XGTA 4HJ7A 3W5OA 2HT1A 1VQMA 3PUZA 4DR6L 4UP9A 2MO1A 2Z6KC 2F52A 3I4MG 1JE5A 1LUZA 2K4KA 3GTKH 4JI1L 4DNIA 4YY3L 3BU2A 4A3KG 3PO2G 2F4VL 5GAHC 5IP9H 1KAWA 1N8RC 3KLWA 1XNQL 4DUYQ 2JE6I 1M90C 4JI2L 4QY7A 3S2HH 4DAYB 2VL6A 4OWTB 1FL0A 4UCTA 3I7FA 1KC8C 1V9PA 4BY1G 3CCSA 3TS0A 2N3SA 2UUAQ 3J7A5 1TAEA 5JEAG 2YTXA 2NVQH 2B63H 4A3EG 4LH7A 1YHAA 1YZ6A 4KHPQ 2K5HA 1CSQA 4RG1A 1E22A 2B3GA 2N49A 3JC66 2NVYH 1U5KA 2FXQA 2VNUD 4UCVA 2EXDA 3NBHB 3TQYA 3NENA 3W1BA 1QVCA 3NELA 1WCMH 1HH2P 2KBNA 1YEZA 2JQOA 1JMCA 2HVSA 1C9OA 1PVOA 1JJCB 1A8VA 2F3IA 4DR3L 4B3ML 3NC0B 2K5VA 4NPSA 2AWNA 5D1OB 2JEBI 4HJ8A 2UU9Q 5D1OA 4A3LH 3I4OA 4X62Q 1N34L 1VQNA 1KQSA 3UQ8A 4LUVA 1FJGQ 1HZAA 4RMFA 1E1OA 1PFSA 4DK6C 4IOCA 2E5LQ 3HOZH 2D0OA 2K5NA 2UXBL 4OX9L 4R4CA 1KIXA 1G6PA 3U4VA 4A3CH 2CWPA 2WAQE 3WWVA 1NMFA 1EIYB 2IX1A 3OW2A 3BA8A 3GTQH 1VQFA 3FHWA 4PG3A 2OTJA 3TY5A 4K0KL 2R92G 5LMUL 2R7DA 3GTPH 5IWAL 2YV5A 1YJ9A 1PH6A 3A74A 1KXLA 1K3RA 3JAMi 3PIPA 3KDFA 4JI3Q 1Y1WG 5C44G 4Y52H 4IFDG 1KD1C 4P73A 2R7FA 2UUCL 3I4NH 4IFDI 2VQEL 4MTNA 3PCOB 1KHIA 4DV4Q 1PH8A 3Q8DA 1Z47A 2UXDQ 1YBYA 1EFWA 2DGYA 1VQ6A 4H02A 4EQ5A 1C0AA 3M4QA 3PO3H 4YHHQ 3T1YL 1XMQQ 3HOYH 4DR1Q 1NE3A 4BA1I 5IYBG 4JI0L 1L2FA 3QWUA 3STBC 4JBMA 1J5EQ 4JI4Q 1N33L 5JJKA 4DV7Q 1KL9A 3STBD 2HVRA 2ZJPA 1YVCA 2V1CC 4R4QA 3MXNB 1LTLA 2KENA 1I50H 5FJ8G 4DV0Q 4JG2A 1XMOL 1IBKL 3RN5A 1S72A 1VQ5A 3JSLA 4DRFA 3E0EA 1Q82C 3FP9A 2VQFQ 1GO3E 3M4PA 4GKKQ 3H0GH 4DV3L 1E7ZA 1UEBA 1SLJA 3FKIG 3RZDH 3GTOH 3RZOH 4DPGA 3K80C 4AIMA 4BA2I 4EFEA 3J7ZC 4UCSA 3M9BA 3CPWA 1XNRL 4DKAC 4ME3A 3D31A 4UPAA 4XIGS 4A3JG 1YHQA 1JJGA 5GAEC 3S1MH 4LF5Q 4JC0A 4GOPC 2UXCL 3BA9A 4L5QA 4B3TQ 3TREA 5C4XH 4GKJQ 3GJXB 5GAGC 2PQAA 1K8GA 1CKNB 4P71A 3K0XA 1CKNA 2K52A 1KRTA 1OTCA 5LMNL 4DV1Q 4POGA 4DR6Q 1B70B 2ZTCA 3CAMA 1C7YA 2IT1A 5E7NA 4GS3A 2JA5G 2NVXH 4GLXA 4R4TA 4A3FG 4JBKA 4JI1Q 3CCUA 3S24A 3S15H 4DV2L 1L1OC 2F4VQ 1ASZA 1WYDA 2A19A 2K75A 3ZJYC 3F1ZA 4YWMA 3F2CA 1XNQQ 3HOVH 4LFBQ 4OWXB 4LUOA 1L1OA 4IJLA 4JOIC 5FLMH 2CCZA 1XPRA 1IBLL 3L2PA 1S68A 3BAAA 4P75A 5IYDG 3GO5A 4DR5L 4BBRG 2E2IH 1QZGA 4LFCL 2JA8H 3A0JA 1TWCH 4HJ9A 3HKSA 4DR7L 4O0AA 5DLQE 4LF9L 1HNWQ 2L15A 3H0GG 1VQLA 1TWFH 4EFBA 1X9NA 1PH1A 4L5TA 4GNXB 1YJNA 1PHJA 1UE6A 4X66L 4GNXA 3HKZE 3U58A 3TY8A 1NBWA 4Y7NH 3BJUA 2R7ZG 4BXXH 1VQIA 2JJQA 3CCMA 1SR3A 4HJ5A 3CCEA 3CCVA 4LF4Q 4R1JA 1WFQA 2JA6G 1VQAA 4B3MQ 3CXCA 3VDYA 1Q7YC 4NXML 1N34Q 4GN3B 3E9HA 1Y1VG 3B6YA 4A3IH 4IPCA 3VNNA 2WB1E 1YITA 3GTMH 1FVIA 4PZ7A 4AQYQ 5AJ3Q 2D62A 4JBWA 4J15A 4OONA 2NZHA 2Q2TA 2WAQG 3M85A 5GADC 3PF5A 4LNQA 3AFPA 1D8LA 2ZM6Q 2YYZA 4IOAA 5M3MH 4BBSG 1N32Q 1N36L 3PGZA 1B8AA 2HQLA 1MJEA 4OXPA 5M3FG 4DUZL 3M7NA 3ULPA 1HNZL 2RHQB 1IBML 5IWAQ 1HR0L 3PUVA 4JI5L 4JI8L 5IE8A 4X6AH 2N8NA 4JI6Q 1XJVA 3PV0A 1HNXL 3NEMA 1Q46A 3G4SA 4C3IH 1BKBA 1W3SA 2JA7G 4BY7G 3UE1A 4DK3C 4JCVE 4UP8A 2VQEQ 2OTLA 1E1TA 1OXVA 1X6OA 2XTIA 4X64L 1VQ7A 1L0WA 1HZBA 2A8VA 4A3BH 3GTLH 3JAMc 3AEVA 1EQQA 5C3EH 3RLNA 5DISC 2Q2UA 1Q86C 4BXXG 3HOUH 3TY9A 1VQDA 1V43A 3S14H 1V1QA 5IP7H 3DLLA 1VQGA 4JI0Q 2Q2IA 2MQHA 3CCRA 1GD7A 3MEFA 4IPHA 2YTVA 1PH2A 5IP9G 2OQKA 1P8LA 4P74A 3K81C 5BR8L 2Q2HA 3T1HL 4A3MH 1XMOQ 1G291 1WOCA 4LWCA 2IHFA 2LXJA 3F2BA 4WJ4A 1Q1EA 1HZCA 2E2JH 1ASYA 1BVSA 4DV3Q 1PH7A 1VQPA 4A3DH 4R4IA 2KHJA 1JJ2A 4DR2L 2B63G 1H95A 4LH6A 3OYYA 4KI0A 3RTXA 1QZHA 1W2BA 2VUMH 2I5MX 4EEQA 1TXYA 4AYBE 1WI5A 1EUJA 4OWWB 2UXCQ 2IX0A 1EQRA 2D0PA 1P16A 1Y14B 4QJFA 4UY8C 3HOWH 4IO9A 3EIVA 3JSNA 1B04A 1I3QH 1RL2A 2OQ0A 1UE1A 4UCOA 2RF4A 4QL5A 1AE3A 3A5ZB 1XTDA 1VQEA 2K14A 5IYCH 1JB7A 1WCMG 3BZCA 5LMNQ 2VZAA 3UDFA 1X3EA 3IRBA 5GROA 5LMNW 2HIXA 1VQJA 1X56A 1SMXA 4A3LG 2BA0A 3A5UA 1HZ9A 3CCQA 5M5WH 4A93H 5JJLA 4DV2Q 1HJPA 2H5XA 3HOXH 1BBWA 4JI7L 3HOZG 3CP0A 3CPFA 3K7AH 3UDXA 1A63A 1IBLQ 4A3CG 3NBZB 1EWIA 1NY4A 1UE7A 4X62L 4DR5Q 2ZJQA 1TWHH 2ASBA 4LFCQ 5IT9c 1FJGL 3PN1A 5H1SE 4KLKA 5J3BA 3ICEA 4DR7Q 5ELNA 4YCWA 3KOJA 4HIDA 3GB8B 3KJPA 1MJCA 3S1QH 3RLOA 4XTCS 1BBUA 3HFZB 3D0FA 3TS2A 2AKWB 1TWGH 3HKZG 1I6HH 3UDIA 4LF7L 1B7YB 4X66Q 4IPDA 3EN2A 2OWOA 1RIPA 3I4NG 2B29A 3I56A 1G51A 1YIJA 1E3PA 4KHZA 1SROA 1VQHA 4YY3Q 1NMGA 2NN6G 4DV5L 1A0IA 2NN6I 2A1AA 2PNHA 4NXNL 1Q1BA 3RR5A 4QGUA 2WB1G 3PO3G 2JK8A 3HOYG 3PF4A 1AH9A 3RN2A 1AE2A 4JI2Q 1K8AC 1VQCA 4DV4L 2JA9A 4YCVA 3CMEA 1YJWA 3I4MH 1VCIA 1YHBA 2DUDA 3RLFA 3U4ZA 3CC4A 2R93H 1TA8A 1N9WA 5EAYA 4APVA 4A3KH 3PO2H 4OO1G 4OO1I 1YI2A 1XMQL 4UCRA 1VS0A 3HOXG 3PSIA 4GNXC 1I5FA 3ERSX 4JI4L 2ALYB 1N36Q 5C0XJ 4BY1H 4DUZQ 1HNZQ 4JV5L 1IBMQ 1Q81C 2BA1A 4JI8Q 1K73C 4JI5Q 3BZKA 4A3EH 1Z9FA 3OTOL 4PZ6A 2VQFL 3NBYB 4QIWE 2ID0A 4JYAL 1LYLA 1VQ4A 2HVQA 1IL2A 3G48A 2AWOA 5C4XG 4DR3Q 4X64Q 2HIVA 3KF6B 1A62A 4PZ8A 2QGQA 3F8TA 3KF6A 4MNOA 3ULJA 2HHHL 1I94L 2KCTA 4UP7A 1WJJA 1PA6A 5ELOA 4EX5A 1NJIC 1NTGA 4GKJL 2UXBQ 5M5YH 3AYHB 1VQ9A 3H15A 4OX9Q 1O7IA 2KHIA 3J81i 1Q8KA 4GN5A 3CC7A 3CF5A 1S40A 4AH6A 5BR8Q 3KJOA 3HOVG 4B3RL 5FLMG 1IYJB 2BH8A 4K0KQ 5LMUQ 3ER0A 1E24A 3PIOA 2JA8G 4HJAA 2R93G 3TEHB 3CCLA 2Z6KA 3SGIA 5JEAJ 4IJHA 1MKHA 3J81j 4QQBX 2UUBL 4DR2Q 1IZ6A 4GLVB 4DV6L 4LFBL 4AYBG 1K83H 2UUCQ 4HIKA 1VQOA 3CCJA 2MO0A 2GN5A 1PV4A 2R92H 3EBEA 4DR4L 2LXKA 2I5HA 4C3JH 4B3SL 4A3GH 1GKHA 4LF6L 1QUQB 4LFAL 1Y1WH 1UE5A 5C44H 4UFZA 1QUQA 3T1YQ 4A76A 4LF8L 1HNWL 1QVFA 1X3GA 2AMCB 1N33Q 5JJIA 1M1KC 4X65L 2BH2A 3G71A 3S1RH 1IBKQ 2NZOA 3G6EA 2E2HH 4A3IG 3PUWA 1XPOA 4TQUS 4JI7Q 5IYBH 4LF4L 2N78A 3PUXA 2PI2E 3KFUA 5FJ8H 1XNRQ 3RNUA 4DUYL 3AFQA 1SRUA
chains in the Genus database with same CATH superfamily
1CSPA 4O4HF 2GVBA 3SE0A 2EIFA 4MV6A 2E8GA 1VDZA 2AUKA 1B6RA 4ECSA 2YS6A 2QA4A 2C9OA 2M05A 3V4ZA 2FK1A 4HMIA 3S2DH 2GQRA 4Z9CB 2EYLA 2ZM6L 1EQVA 3HOVB 4C3HH 2IWHA 5JAVA 4E4TA 5ELEA 5GQOA 3UE0A 4JI0H 2R93B 2PI2A 2ZXPA 4JI6L 3QG1A 5JVDF 4DV5Q 4JXUA 4EVOA 2IPKD 3DWPA 5LL6X 3HOUG 2DPIA 1XMOH 4KK7A 4R4OA 5IP7G 3Q8QB 2R8KA 3NQIA 4YIJA 2QW7A 1T9HA 4IPGA 3I55A 1U0LA 3GLKA 2J6TA 3K8AA 4A3EB 3NUAA 4C2MH 3H09A 3K7UC 2OT2A 4I65A 4GN4B 1SN8A 3S16H 5JVLA 1C4QA 3F2DA 4UCUA 2XC9A 5C0XH 4A3DG 2F0EA 4C1NI 1UAPA 1J8IA 2A73B 3PW7A 1TWAH 2VUMG 4O4IF 5DG8A 4QWDA 3RUZA 3OTOQ 3M4OH 5LMNH 4JYAQ 3I72A 5M5YB 2G5DA 4EGVA 3DM1A 2BCOA 5CBEE 5CV7A 2VW9A 1VQ8A 1PZKD 4ZQIA 4R7RA 5HURA 2ZXOA 4NXMQ 3WNZA 3GIKA 2I07B 3FPUB 5IYCG 5FPOA 2HHHQ 3NE5B 1Y69U 1I94Q 3IN5A 1VQKA 2QEXA 1RJTA 1G6ZA 1OXSC 2R6GA 3J80c 2JA6H 1IBLH 4DQNA 1LTBD 2EXZA 1KNEA 3D8GA 1Y1VH 2KCCA 2ODTX 3DTGA 2MNAA 1PYBA 1T94A 2I5LX 2Z1CA 1B9NA 3QO2A 4EBCA 2R7KA 1A3GA 4RNMA 5C3EB 5IIFA 1BCPB 4C3JB 3J81c 1ZAUA 5DG7A 4A3GB 4X66H 4I50F 1X3FA 1Y1WB 2K01A 1E4EA 5A35A 5KFRA 2AGQA 1L1OB 5HGQA 2KSWA 3RIZA 3CMAA 5FLXc 5C0XG 5M3FH 3J80i 1PH9A 2SNMA 1AFPA 3VR2A 4JOIA 3S17H 3FEWX 3RB3A 4HTHA 4KY6A 4LF8Q 4B3TL 3TQTA 2LSSA 2AHOB 4CC5A 4WBNF 3SK6A 4X65Q 2A74C 1YNXA 4ZLTF 4FU0A 1TKWB 5BWVA 4DL5A 2R8JA 1BOSA 5IGEA 4RWSC 4HJ7A 4DR6L 3W5OA 2VUMA 3JZIA 1TVXA 1CFMA 2Z4HA 2F52A 1JE5A 2I8CA 1YNND 3HOWB 2I80A 4YY3L 2QB5A 4BWSC 3BU2A 3S1NB 4J9OA 1PTOB 1LTAD 2F4VL 5IP9H 3M7GA 4JI5H 1XNQL 4JI8H 4A3JB 2QYZA 1M90C 3FVQA 4ME6A 3S2HH 4DAYB 2AQ4A 4YQWA 5DQHA 2V4RA 2EY6A 1KC8C 2W9BB 4BY1G 3SK4A 4RUCA 2N3SA 4FXDA 4DAVA 3DHQA 1TAEA 1RTNA 1YHAA 4KHPQ 2CW0D 2K5HA 3OSOA 4YAJB 3WO0A 1JIHA 2O03A 3RB6A 1WTXA 1Z7TA 3MJFA 4HNUA 2NVYH 1U5KA 4NMZA 3KLSA 2R85A 5G3LF 3T54A 3SHLA 3J7AF 4F4ZA 1GGOA 3IAYA 1QVCA 1HH2P 2XGPA 1YEZA 2HVSA 1JMCA 1I6HB 2R87A 3NC0B 5EWEA 2E2DC 2K5VA 4NPSA 2AWNA 3A7AB 5C3XA 2JEBI 5BWRA 1TWGA 3I4OA 2EYHA 1VQNA 5J2TF 2NZ1D 1FJGQ 5I4DA 1EIHA 5D65A 4H7BA 1JB3A 1G6PA 4K5VA 1SEIA 5EPJA 4H13C 3U4VA 3OHXC 1SYXB 2NUAB 1VQFA 2DAAA 1EY6A 1B33N 3T1YH 1WR2A 1I7NA 4DAAA 3C1EA 3HT5A 1LTTD 2VB3X 1PH6A 1ESFA 3OW7A 1LTSD 4IUUA 1IOVA 3PIPA 2CNUA 3KDFA 5J22A 5C4HA 1ZHQA 4TSSA 2F0QA 1IBKH 1QILA 3G7LA 5C44G 3GTJB 5EJWA 1KD1C 2WACA 4P73A 2R7FA 4IFDI 4IUTA 3I4NH 1TQOA 2VQEL 5C1PA 1OWTA 1PH8A 1S4ZA 1Z47A 1YBYA 1RK6A 2RBMA 1VQ6A 3MFGA 4H02A 5BN5A 1B3AA 3OHBA 5DM63 3M4QA 2YU9B 4BBSB 4MV3A 3HXLA 1WTHA 4YR0A 1SFOB 1N33L 3DF7A 4DV7Q 3PZPA 4Q5VA 2ZJPA 3U9SA 4JG2A 3MXNA 1S72A 4LF7H 1Q82C 2VQFQ 3E6ZX 3M4PA 1R9TB 4GKKQ 3K5HA 4Q8FA 4DV3L 1JWMD 2P5ZX 4DPGA 1KJ9A 4OGQC 3M3YB 2GLTA 1XNRL 4UCSA 3M9NB 4ED3A 2BQRA 4NXNH 5JH7F 2IW3A 5GAEC 2UXCL 3MXPA 1E4FT 4KHVA 3TREA 5C4XH 3T51B 2EOTA 2Y4RA 3RB0A 2PQAA 5CYUA 5EDWA 2W7OA 1K83B 3UYYA 2IT1A 2F0IA 1MHWC 2F0FA 3ERQA 1IYDA 2CH4A 3CCUA 2EZVA 1EKFA 4QW9A 4IRDA 4JV5H 1ASZA 2K75A 5KG5A 1SE3A 3R3OA 3F2CA 2FPGB 3HOVH 4LFBQ 4LUOA 4JOIC 4ZUJA 5KFSA 5J2UF 4O1NA 4P75A 4TM5A 4BBRG 1BR9A 1QZGA 4LFCL 4HJ9A 2E2HA 3OIPA 3CHBD 1PRTD 1B2TA 4LF9L 2L15A 1KNAA 4DFAA 3MVVA 1X9NA 4L5TA 3HP3A 1UE6A 4Y7NH 2R7ZG 2K33A 2R61A 4BXXH 1VQIA 3QB3A 3D3RA 5JPMC 2RSOA 1FYCA 1VQAA 4B3MQ 5FD6A 1QNKA 1ESRA 1S5DD 1W6KA 4UAIA 3VDYA 1PZJD 3VNNA 4J9RA 2XRSD 2HDLA 1HNXH 4KN4C 4DV6H 4LFBH 4UDUC 3GTPB 2D62A 4JBWA 4OONA 4FM9A 3H4DA 5GADC 2ABJA 4DR4H 3VYRA 1SCUB 3PF5A 4NDXA 2ZM6Q 3WOFA 2VA2A 4MV8A 1MGSA 2EJ3A 4LF6H 4LFAH 2L55A 3H91A 4A3FB 5BWTA 4FS1A 5IWAQ 1HR0L 4C5AA 5IE8A 5I5YA 4JI6Q 3V6KA 1XJVA 3PV0A 1Q46A 3X3MA 3HOYB 1I6VC 4BY7G 4DK3C 4LMQD 2WTFA 4JCVE 3IG0A 4FO2A 3SI8A 3PW5A 2A8VA 2XTIA 4IRKA 3GTLH 3JAMc 1I50B 5C3EH 5DISC 3N40P 2Q2UA 2PW5A 4BXXG 3AB9A 1EYZA 3DXJC 3TY9A 4O3OA 2DJGC 3DLLA 1VQGA 1UNSA 3RZDB 3MFIA 1GD7A 2XIGA 2YTVA 5KFGA 1P8LA 2EJGC 2CNQA 2R7ZA 5I5UA 4OIJA 4G7HC 3S1MB 4EG0A 1WTVA 5KG7A 4WJ4A 4E6IA 1IW7D 1HZCA 2E2JH 1ASYA 1BVSA 1O80A 5F2DA 4HNTA 5LL6b 2ZJTA 3N6RA 5EBDA 2B63G 4IHJF 3OYYA 2WINB 2V5AA 4EEQA 4O7RA 4IUPA 2YW2A 1GUGA 2YL2A 4Q43A 3IFTA 1EQRA 3T9BA 3F2UA 1Y14B 5IYZF 5KFBA 3HOWH 1L2ZA 3EIVA 1B04A 3HBLA 1RL2A 1PTOH 4X62H 3FDTA 1AE3A 1XTDA 2CNVA 1F9RA 2FK2A 3BZCA 3SDZA 2B8GA 4NKLA 5BYAA 3GV7B 2JA8B 1ET6A 1SMXA 5K36H 1ILPA 4OO1H 2AUJD 1KEEA 5KFKA 2ASLA 4HN7A 4HCSA 4A93H 4BWGB 1Y8NB 3ORQA 4JI7L 1Q3LA 4FP5D 1M8AA 4CJ0B 2XVSA 3K7AH 1A63A 3NBZB 1S9FA 1N48A 1ET9A 4GLWA 5IT9c 3H40A 4ID6A 4O7ZA 3GTGA 3RV3A 1FNUA 4U68A 5EKIA 1ZKOA 3RLOA 1JICA 1BBUA 3GTKA 1JOKA 2AKWB 1I6HH 4DV4H 2EY1A 1T5XD 4IPDA 5C4ZA 3EN2A 1HA5A 2B29A 3R8BA 1XMQH 2O5JC 3TP5A 2PCFB 4J8QA 1CS0A 4YY3Q 4DV5L 2NN6I 2B63A 1Q1BA 4QGUA 3G8DA 2WB1G 2F0UA 3BYTB 3PF4A 1SNCA 5FKAC 1AE2A 1E2ZA 3K58A 3BG5A 2JA9A 3CMEA 4R8UA 2OF1A 3OIQA 3GIDA 4CKBA 5KT6A 3CC4A 1G2TA 4OO1G 3OMCA 3T7AA 4CMDA 4ED1A 5KYIA 2VPSA 5L1LA 3PSIA 1I5FA 3MR5A 4IUVA 3VA7A 4B3TH 1STHA 1HNZQ 4M7EA 1IBMQ 2BA1A 1K73C 4X3TA 3T5KA 3HOUB 1E4EB 4WHXA 2W9CA 5J1ZA 3OTOL 1HQMC 4JYAL 4DR6H 1D1IA 1TS4A 3Q8PB 2FP4B 4X64Q 2HIVA 2XSCA 2J6SA 4Q4DA 3KF6A 4MNOA 2YZNA 2F4VH 1BBXC 3GTQA 2HHHL 3A7LA 1I94L 2KCTA 1XNQH 3A55A 1PA6A 2XRQD 1KLGD 3AYHB 4DA2A 1V1PA 3H15A 1O7IA 2K5WA 1KTKA 2KHIA 2N88A 4Q0YA 2A68C 3HEJA 3CF5A 1S40A 3I73A 1WVLA 2VUMB 4O86A 2A68D 4QIWA 1WTOA 2A6EC 1IYJB 1KJQA 3LMLA 1E24A 2A6ED 5KFAA 3LULA 3TEHB 2FMMA 2Z6KA 3J81j 4IJHA 4QQBX 1KDBA 5FR9A 2HHFB 4DR2Q 3K3VA 1JXLA 2WB1A 4GLVB 4AYBG 1K83H 4PMBA 1VF5C 3H4BA 4HIKA 3CCJA 1PV4A 5DNFA 1RCVD 5C6AA 2B2UA 2IMWP 5M5WB 5C5JA 1R4QB 2QKIC 1QUQB 3HOXB 2FE3A 2KHSA 3A54A 4LF8L 1HNWL 4WFN3 2AGOA 1X3GA 1N33Q 4R9WA 4X65L 1QJOA 5C5MA 3S1RH 3PQIA 3G6EA 4O82A 1EEID 5I5SA 1VMCA 3S1QB 5LP6F 1N32H 3KHLA 5L1KA 2OXPA 1Z2NX 1H9RA 4RU9A 3NHHA 4ED7A 1EKPA 1XNRQ 3AFQA 4DL6A 2IHEA 5C1OA 4ALPA 1PH3A 4AQYL 2NTSA 5CE8A 1IHZA 2NVXA 3FKIH 2VQEH 5EBCA 4WD3A 2K03A 1KRSA 1CKMA 2KCMA 3VYUA 4KHPL 1IKMA 4ECZA 1I1MA 2PMZE 1KJ8A 1DCZA 1A2UA 1PH4A 2COJA 3DEOA 2JEAI 3NTHA 2Z0SA 1TWCB 4B9WA 4Y8VB 3KDFB 1GM5A 1G8ZD 2CWAA 1IYVA 4AYBA 3D6WA 3OWEB 2JA5H 3D4DA 1PYSB 2EQSA 2EYMA 2VY3A 3P75A 4BY1B 1TWFA 4A3FH 4DV3H 1EYAA 2ZTDA 2ZTEA 5IGCA 4RUAA 1LT6D 2ICIA 3M9MB 2A6HC 2J0TD 3CQZH 2COGA 4FFNA 1V4YA 5I2YA 3U9TA 4L5SA 4Q8EA 4DNTB 3T53B 3V2TA 1O7LA 4LF9Q 4FFRA 2EJMA 5DGHA 2UXCH 4K2LA 3N41B 5IYDH 3GIJA 5COYA 1SJED 1NR4A 1N56A 1CUKA 1JCKB 4K6DA 4ZYSA 3Q22A 3GTMB 5CA0F 3U9OA 4IUQA 5I60A 3NXWA 4O2DA 2HD3A 2FFKB 3H3VH 1HUNA 4NP5A 4ODGA 1CZGA 4ZUIA 1I4XA 4NB3A 5BYBA 2MCTA 3Q8RB 4LSAA 1K0RA 1LO5D 1O7YA 1S0NA 2EDGA 2ZJRA 5HV6A 2Q8TA 1KUTA 2PQAB 5KEEA 1Q90A 2VS1A 4GOPA 5KX5F 4P72A 1SNPA 1TS5A 2TMPA 2Y0SB 4LFCH 4C3IB 1GVPA 4A75A 3D6CA 3MFYA 1XPUA 1F9QA 1R4PB 1S3OA 2K50A 2RHSB 1NR2A 1EIGA 4OELB 4DV7L 3GV3A 2RDJA 4A3BB 3CW2C 2VQDA 1BCPD 5CORA 1HR0Q 4KKTA 4WRDA 1JT8A 1HR0W 3S14B 4DXGA 4GKKL 4J1MA 3W1GA 4CMFA 1S5ED 4OIKA 2ATWA 4JK1C 2R7LA 1LT3D 1XDNA 5C0XI 1QOHA 4R8NA 2E2HB 1VF7A 3AQQA 3VYTA 4IRCA 1A3VA 4GLAC 2DNCA 3UI2A 5A2QW 1SE8A 3TSSA 2OH2A 5KNBA 4LUZA 1PZID 4CC6A 4ZCKA 1GJXA 5JJZA 2YTYA 2HT1A 1VQMA 2Z6KC 3I4MG 4ZOLF 2HDKA 1DYQA 1S5BD 3P20A 4A3KG 1PTOD 2YZLA 4IWXA 5FO8B 2JE6I 4JI2L 4QY7A 3C3LA 2VL6A 1I4GA 4OWTB 4UCTA 2WKDA 2JP1A 4O2AF 4DR3H 1BNZA 2UUAQ 4DNRB 3R2IA 5JEAG 5CV5A 3J7AK 1IOWA 1GOZA 4DL2A 2RSNA 1NSNS 4O7WA 3OUZA 1KABA 1BF4A 5DLFA 2FXQA 2EXDA 5KFPA 1AUXA 3NBHA 3W1BA 5DQGA 5CBAE 1C9OA 2F3IA 4B3ML 1JORA 2ZXRA 5D1OB 4BBRB 5LMUH 4HJ8A 2UU9Q 4A3LH 1OO9B 4RNOA 3PIO3 1KQSA 2YS7A 4LUVA 4DF7A 3H6MA 1S0OA 2AU0A 1E1OA 5T14A 2UXBL 2E5LQ 3HRZC 4OX9L 4R4CA 1KIXA 1K8OA 2KUMA 3SNOA 3WWVA 1NMFA 1SYBA 4N9TA 1Y8OB 1GLVA 1IYUA 4L8JA 3QFFA 4FFMA 4K0KL 4O3RA 1LLRD 3MEHA 2R7DA 2R92G 5IWAL 2YV5A 3PO2B 5DMXA 3AW8A 1VBHA 5D3DA 4EYIB 3ORRA 5CV8A 2FLLA 1B1ZA 3PR5B 1EZ6A 2UUCL 4YP3A 2FLNA 3ONAB 4NW2A 2X6GA 2MPMA 1KHIA 2VOBA 2UXDQ 4JI7H 3ND9A 2I87A 3GV8B 4KD4A 2PMZB 2JXMB 4EEYA 2IJ0A 3PO3H 4YHHQ 3QWUA 3VR4A 4O7SA 2HG8A 3STBC 3CVZA 1J5EQ 3MAQA 1EY4A 4J0MA 1KL9A 3STBD 2IL8A 4O42A 3PMFA 4FF2A 5DGAA 4DV0Q 5FJ8G 4IR9A 3JSLA 3RN5A 1VQ5A 1SYGA 3LNNA 1GO3E 4BY7B 4ZRZA 2DABA 2B39A 1SBBB 3FMCA 3K59A 5LXTF 3K80C 1K1SA 1NNXA 3KBXA 3GTGB 4DV5H 3NTKA 4RFBA 3D31A 4C3HG 4XIGS 1C30A 4U6PA 3Q6SA 4JC0A 4GOPC 4LF5Q 3I8ZA 3GTKB 2KEEA 5DGBA 1XWEA 1VAJA 5KFUA 3K0XA 1CKNA 4ECVA 4DV1Q 5C3WA 2E75C 4F8MA 3N8DA 3MFHA 5F9LA 2R92A 3NSWA 1GHJA 1DD2A 2H1EA 4JBKA 3WO1A 5KFJA 3S15H 2PQEA 2M2LA 4H0LC 1WYDA 2KOLA 3ZJYC 3TIIA 3OTOH 3T5LA 2CCZA 1S68A 3C1FA 4CDFC 1XPRA 4JYAH 1SE4A 3GO5A 3EPIA 2E2IH 2RDIA 3CSWA 1TWCH 3Q2OA 1K0SA 1MI2A 4MAMA 2W70A 2FJ2A 4NXMH 1ICWA 4K5XA 2HHHH 1HNWQ 2NB0A 1I94H 1VQLA 4EFBA 1PH1A 1RHPA 1PHJA 4GNXA 3OSPA 3EVQA 3BJUA 2DZDA 5JQGF 1H9JA 5EWGA 4HJ5A 1WTRA 1YNNC 3RMHA 2R84A 4ZHQF 2HCIA 4R1JA 2JA6G 1SNQA 2E76C 3CXCA 2CH4W 5M9OA 1N34Q 3GTQB 3QIAA 3CEBA 1Y1VG 4RZQA 4I55F 4C1NK 1YITA 3GTMH 4RB2C 5AFWA 3X3NA 1QE6A 4AQYQ 2Q2TA 5CAEB 1V1PB 4J15A 2WAQG 2CW0C 1JWUD 4LNQA 2V4DA 3RB4A 4O7TA 2YYZA 1WD0A 1JR0D 5M3MH 3V96A 1EEFD 3PGZA 1MJEA 4LF8H 5M3FG 1HNZL 4DAPA 3VR3A 1IBML 3PUVA 5DG9A 2J6UA 1SSOA 2JEFA 4HR7A 2N8NA 4X65H 4C2MA 2DJFC 4HEDA 4EQPA 1RYSA 4C3IH 3JAML 5M5XB 2BR0A 1F2MA 3WWIA 5HGTA 4UP8A 2OTLA 1E1TA 4X64L 1HZBA 2PZUA 4A3BH 1MZBA 2DY8A 4ECRA 3AEVA 1KDAA 3SE7A 1Q86C 1EY9A 1GUOA 2K28A 1TWAA 5D14A 3H3VC 1S0MA 1VQDA 1V43A 3S14H 3H0GB 5CV6A 3QR8A 5C5LA 2Q8IB 2C2EA 3RZOB 1PMRA 3CCRA 1ENFA 4IPHA 1EQTA 2HQEA 2A69D 2OQKA 5IP9G 1AZQA 1EZ8A 1U4RA 4A3MH 1SYEA 3T1HL 5T1IA 4KHPH 4TQRA 1WOCA 2HCCA 4LWCA 5JPNC 2NU6B 2LXJA 3PW4A 1PH7A 1QNUA 2JA6A 1M6VA 1VQPA 2XGQA 5KFZA 2MJ8A 1XXGA 4GZYC 1DOKA 1CTMA 2KHJA 4DR2L 1JJ2A 1JOQA 1H95A 5EOYA 1Y1VA 2A1HA 1TXYA 3VYSA 4HNVA 1EUJA 2NVXB 4Q44A 2IX0A 1U4MA 5E4XA 2D0PA 1P16A 3IFDA 4L63B 4RHSA 4ZQ3A 2WAQA 3L4KA 2RGRA 4IO9A 1UE1A 5FNVF 5I6YA 2RF4A 3KBGA 1DM0B 1FJGH 3BVZA 3D4WA 2XD4A 2VZAA 2XIWA 3TW7A 3J81W 3E5SA 4XX0B 1TT2A 4FE2A 2HUGA 5TSSA 2F1MA 1EWHA 2F0OA 4DV2Q 4YBZB 2H5XA 2JA7B 1ML0D 5FLXW 2R8IA 4HMJA 4IZOA 4ME5A 3CP0A 5IGFA 2WKCA 3T16A 2NVTB 3Q1KA 1S97A 1NY4A 2ZJQA 4DR5Q 1EL0A 4MTKA 1TWHH 1C3OA 2ASBA 3PN1A 3EQLC 3T9FA 2PNRC 3I70A 4MN3A 1DOMA 3ICEA 5ELNA 4DR7Q 3JZFA 2Z8LA 5A2QE 3KJPA 3NBYB 4XZ3B 5KFQA 2IA6A 4QB4A 2RDFA 3HKZG 3UDIA 3TZDA 3RV4A 3BZDB 3ITPA 4PQXA 1QWYA 2DPJA 1RIPA 3I4NG 1GSHA 1YIJA 2L1BA 1SROA 3LWUA 4RB3C 4DV7H 3U55A 2IX3A 2A1AA 3EFXD 1EKVA 1A3UA 3KUPA 5IOCA 5T1GA 3RFCA 2SCUB 1RODA 4ETSA 1BDOA 2K32A 3RN2A 1PDQA 4JI2Q 3KHGA 2VQFH 4DL7A 1YJWA 4GKKH 1IL8A 1ONLA 1VCIA 2DUDA 3RLFA 3U4ZA 2NVYA 2CVRA 2R93H 4IQZA 3PO2H 1PRTC 1SYFA 4OL7A 4OO1I 5D8DA 1CQVA 5ELCA 1WCMB 1VS0A 4QWAA 4GNXC 3OWFA 1CZWA 4JI4L 4QWEA 1N36Q 1M0WA 4DUZQ 1ET0A 2XWBB 1Q81C 3QOJA 4CHIA 3MA2B 4A3EH 4BS9A 1Z9FA 4PZ6A 2ICEC 5KT3A 3HOZB 2FK3A 1BO0A 2B2YA 1CM9A 5C4XG 1WD1A 2X6LA 4O3QA 5KT5A 4PZ8A 3MWYW 1AN7A 2SNSA 1HHVA 2K5DA 4UP7A 5ELOA 4RGOS 4O4LF 1NJIC 4GKJL 2UXBQ 5M5YH 1ZEQX 1VQ9A 4OX9Q 3F8NA 2EJ2A 3HKZA 3WWHA 4GN5A 2ZGIA 4EGJA 1AZPA 4AH6A 1EOTA 5BR8Q 3KJOA 1B9MA 2NYZD 3HOVG 5DAAA 3FDSA 3NGDA 5G3LD 4EYHB 4YB8B 4K0KQ 4UUGA 2R93G 1I3QB 3CCLA 1CK1A 5CMDA 1I2LA 2FPIB 5JUMA 2X5RA 2UUCQ 2MO0A 4M1UB 4HQ6A 2LS01 2DN8A 1I6UA 4B3MH 4C3JH 1SMYD 3KXYT 5KG4A 1SYDA 2OEOA 4A3GH 1GKHA 3MC0B 5A2QL 3DTFA 5KS8A 1Y1WH 2B8FA 5EPKA 2F3VA 4IFDH 4MA0A 1UUPA 5NUCA 1WSCA 3G6VA 3GTOB 1QVFA 1WH2A 1TY0A 2BH2A 4EGQA 4K5WA 5I2XA 2EIYA 4K8IA 3Q0AA 1TWHA 1TS3A 2KEDA 1IW7C 2OLSA 2RCFA 2ZM6H 2WE6A 5IYBH 4LF4L 4QF4A 5L1IA 2W8LA 5IWAH 4CKEA 3KFUA 1JKJB 3RNUA 1II3A 1SRUA 1EYDA 4QWBA 4JI6H 1EYGA 2XCLA 5KG0A 1QCBD 3V6HA 1PFMA 2BQ3A 3DM3A 1PH5A 2UUAL 3KYHC 3RD4A 4PMCA 3UZOA 3S1NH 1CI3M 2A5HA 1OBDA 5C8YF 1D7QA 4YAKB 1RKNA 1B3QA 4A3JH 4IFDJ 3I4LA 2L12A 3I4MB 3H20A 4WJ3M 3P1HA 4A3KB 3TRZA 5KNDA 5C3EG 1HA6A 2R93A 4C3JG 1U9RA 4A3GG 1LM0A 1ZYRD 1EYCA 3GD7A 3ULLA 4M9UA 1DOLA 1OXTA 2RDGA 1HTLD 2WP8J 5CV9A 2UU9L 1HFNA 5I5WA 3NBIA 4K14A 4YWLA 2FKLA 1XYIA 3N42B 5HY6A 1FGBD 2ES2A 2G9DA 2E5LL 5M5XH 3LQSA 5I5VA 1BJTA 3I2ZA 4XDXA 4A4IA 4F88A 1I4RA 3NP8A 4ZKCB 3RUPA 4IALA 4O3PA 3TBIB 4LSXA 3K5LA 3DUZA 3C2PA 1VMPA 2C5CA 3CD6A 5BWXA 4A3IB 2YRXA 2I0QA 4HIOA 3QQMA 2F03A 3E5NA 4TVAB 2F0GA 2Y0SE 2KVMA 3U0GA 1OXUA 1KJIA 2KCNA 3HOWG 4HIMA 3KREA 1SDFA 2SDFA 2C2DA 1WTQA 4WORA 2W9AA 3PW0A 2ASJA 2UXDL 4LW1A 4RKLA 4PMWA 2ALZA 5K36G 1V8QA 4DU9A 3ETHA 2RCNA 4A93G 2B2VA 4YHHL 1QVGA 3CC2A 3VR6A 2Z9HA 2OCEA 4MV4A 5I47A 4J9MA 3GTJH 3BA9A 1EIFA 4FNFA 2QEJC 1J5EL 5IY0A 3PUYA 2Q8RE 4B3RQ 2R92B 4JV0A 4DV0L 1D1KA 1HQRD 3GTLA 2B2YC 2RDHA 4L5RC 3K3PA 2WFWA 3L9AX 2UUBQ 1KT8A 2YU9H 4BBSH 1KDCA 4TKOB 2R7MA 1SFOH 3JAMW 4JUZA 1VQBA 3E9IA 2WYOA 4RB1A 1F9SA 1TS2A 2KQ3A 3TDQA 4YY3H 1T5EA 4XXEA 2HGSA 3EJIA 4B3SQ 2R6FA 5JVG3 3M4YA 4LF5L 3OUUA 4L6TB 2W6ZA 2JA7H 2P0AA 3U50C 4IIJF 1R9TH 2CQOA 2BOSA 3AX6A 4A3DB 1JDBB 3H3VI 3W3AA 1X55A 1F2YA 2NVTH 5DGIA 4ECXA 3M3YH 1W93A 4DV1L 3K5OA 1IXRA 1CKOA 5L37A 3URYA 4JPBW 3T1HQ 4HSVA 2IBKA 3PUZA 4FF1A 1HNZH 3S2DB 1IBMH 1N8RC 4C3HB 4DUYQ 2FMCA 4KV6A 4DAYA 1FL0A 3TP8A 5LYJF 3CCSA 4F7XA 1DJRD 5GONF 4X64H 2DWCA 4X3SA 3MHBA 3NWSA 2V58A 5CV4A 2DNEA 1KAAA 4LMYA 4FVMA 1CSQA 4RG1A 2D2CC 3J81E 1E22A 3R93A 3JC66 2PYKA 5KFEA 5KT2A 4KMUC 1STYA 2VNUD 3OSNA 3TQYA 1CHPD 3S16B 3BDOA 5FLXE 2FINB 1WCMH 2KBNA 2JQOA 3T9DA 2BQUA 4MV1A 1PVOA 3MZ5A 1JJCB 1TWGB 2HGXA 5IT9W 1RJRA 3N43B 1N34L 1DV2A 3QJYA 5E4WC 1JE4A 1HZAA 2N55A 3J7YW 3SVMA 3M4OB 4DR2H 2NUCA 3KHRA 3HOZH 4DK6C 1D2BA 4B9XA 2D0OA 1JOOA 4H44C 5KFNA 4JV1A 4A3CH 2CWPA 3HS0C 1Z2PX 2IX1A 1HTPA 3KF8A 1SNOA 3A8KE 4PG3A 4MHEA 2OTJA 3TP7A 4ZI7F 4IWYA 3GTPH 4LAAA 2C22A 3P7JA 1YJ9A 1EY7A 1N33H 1K3RA 4HSPA 1LV9A 1Y1VB 2LY7A 3BVMA 1LACA 4PV1C 4XQNA 4JI3Q 2VPQA 1QG7A 4C56C 4FF4A 5E25A 3WDNA 2ZDQA 1TU2B 4MTNA 1EU3A 4ED8A 3Q8DA 2WAQB 1RJPA 4MIUA 1EFWA 2JEJA 2J4XA 4EQ5A 2W6QA 3GQBA 5KFWA 3MR2A 1Q8IA 1M0TA 1XNRH 3T1YL 2AQ3B 2GA4B 5KT7A 3HOYH 4RGMA 1NE3A 4BA1I 4DR1Q 3I12A 2VA3A 4JI4Q 2VXWA 1SFOA 4MV9A 3M4IA 2HVRA 3QZ8A 4R4QA 1IBKL 3MXNB 1LTLA 2KENA 1I50H 3S17B 3KLSX 4RCOA 2AQ1B 3Q23A 4YR3A 4HAEA 1UEAB 3FP9A 4X3KA 2SEBD 1SEBD 1E7ZA 4FXKC 1SLJA 2KJXA 3FKIG 3RZDH 3GTOH 3A8JE 4AIMA 1L0YB 3J7ZC 3CPWA 4DKAC 3J80L 4UPAA 4J9LA 1JJGA 3S1MH 4A2AA 1XTCD 2B2VC 4GKJQ 4O83A 3JRXA 1K8GA 4KY7A 4FGRA 3BQ2A 2L4NA 2K52A 4G4KA 4JVZA 1KRTA 5KRUA 5KNCA 3J81L 2R3ZA 1K83A 2ZTCA 1C7YA 2JA5G 1BCPC 3BDCA 2Z04A 4GLXA 4LF9H 4A3FG 5KFYA 4JI1Q 4M8AA 3S24A 5FLXL 1EUDB 4DV2L 4K8JA 1L1OC 5BN3A 5C44B 3MXUA 4CGYB 3F1ZA 4YWMA 3TIGA 4OWXB 4IJLA 5FLMH 1B50A 2COIA 4NZNA 2NVYB 4FFOA 5EGTA 5IYDG 4DR5L 2JA8H 2EY5A 2C28A 3KLRA 4DR7L 4TUYF 4O0AA 5DLQE 1VKZA 1YJNA 3U58A 2V4QA 4L1KA 2FHTA 3LP8A 3EPGA 3AMUA 3BQ0A 3CCEA 4QMGA 3CCVA 3GIIA 4KKUA 1PTOC 2WV6D 4X3UA 4LF4Q 2RA4A 3FKIA 3RAQA 3K5MA 1G2WA 3G6XA 3DWAA 1Q7YC 4FYDA 1HR0H 4GN3B 5D3IB 3B6YA 4A3IH 4IPCA 1AUVA 2WB1E 2W6PA 1DZ1A 2MP1A 3MTSA 1FVIA 2AQ2B 4K2KA 3HKZB 4GC6A 3M85A 3VA5A 4MTEA 2QILA 4RZRA 4MTDA 1Y8PB 4QUFA 5I5XA 4V0BA 3RAXA 2NWGA 4IOAA 5CR3A 3I4NB 4ILWA 5KFIA 1B6SA 1N36L 4I4TF 2JA5A 5HNEA 2I46A 4DUZL 3ULPA 2RHQB 4RCNA 4FFPA 1HNXL 3CQZA 5K5PA 3G4SA 1I1LA 4UHVA 3UE1A 1I4PA 1OXVA 1X6OA 3ND8A 3SEBA 1L0WA 4N8FA 3J7AV 2IP4A 3HOUH 2DIKA 4A2BA 1V1QA 5IP7H 1SNDA 3PW2A 4CHTB 4JI0Q 1IKLA 4ED6A 2MQHA 5KYLA 5ELBA 4PDBA 2Z4IA 1LT5D 2UUAH 2BDNA 2R7ZB 4P74A 5DM73 3K81C 5BR8L 1CA5A 2FB9A 2Q2HA 1XMOQ 3U54A 3N52A 1HRJA 1G291 3UZBA 2IHFA 3OMGA 5F9NA 2XNAC 1EHIA 3RGXA 1Q1EA 1CT1D 3KAJA 4A3DH 4N8X1 5EZYF 1HPCA 1TY2A 3T99A 1QZHA 1W2BA 2VUMH 5CR5A 2RQXA 4AYBE 4OWWB 3RGZA 2NBFA 1WTPA 4QJFA 4UY8C 2UVWA 1CQJB 1PX2A 2UU9H 2PVPA 5KFXA 4QL5A 3A5ZB 2K14A 5IYCH 1JB7A 5LMNQ 3L3OC 5CM0A 1VBGA 3UDFA 2F4IA 3NWTA 3IRBA 5GROA 5LMNW 2E5LH 4A3LG 3A5UA 2F3WA 5M5WH 4KD3A 3HOXH 1ULZA 4MA5A 3JAME 3W2DA 4DK1A 5C4JB 2BE5C 1IBLQ 4CDCC 5K3WA 2M9VA 4X62L 1E2WA 4Y7NB 2BE5D 1W6JA 3PIP3 2NU7B 5H80A 5J3BA 2O2LD 2VB2X 3S1QH 1E0BA 3K5IA 1EFID 4XTCS 3D0FA 1D5ZC 3TS2A 2UXDH 1TWGH 4GC7A 3SR1A 5CGKA 4X66Q 2Q7DA 2ASDA 2OWOA 5JQWA 1H9MA 2GPSA 4YHHH 2D9UA 4RGTA 2EPBA 1G51A 3HZXA 1DAAA 1J5EH 4CJ2C 4QUCA 5JOBA 3LWBA 2NVQB 2B63B 4RH6A 3RBEA 2PNHA 3RR5A 4DV0H 1A6XA 3PO3G 4U673 1K8AC 4R8UB 1VQCA 4DV4L 4YCVA 3PFFA 2YCHA 2EYFA 1BXRA 4RAZA 1TA8A 1RD9D 3GQCA 4K6LA 1YI2A 2F0TA 1XMQL 4ABNA 5KFOA 5BN4A 3HOXG 4F4YA 4LF5H 1SXTA 1E4GT 3T56B 1V51A 5C0XJ 1BUVT 4BY1H 1Z2OX 3GTLB 1ENCA 2YZMA 3TQ1A 5JVH3 4JI8Q 4JI5Q 2W9CB 3BZKA 3S9WA 5DAUA 1FD7D 4DV1H 2ID0A 5ISRA 4J9KA 1T36A 3G48A 2AWOA 3H94A 5IT9E 4KTAA 4QWCA 1D6EC 2CQAA 3KF6B 2F0VA 2EYOA 2QGQA 5L9XA 1BXTA 1HXYD 1GSAA 2YYAA 3ETJA 4XYLB 3M9OB 2HDMA 4I7AA 1WJJA 5KFTA 1CHQD 1GUNA 1C48A 1NTGA 4EX5A 2E2JB 4TVIA 5E1FA 1FR3A 1PRTF 3J81i 5ELDA 4RNNA 4QIWB 2ZT9C 4XYMB 1QB5D 1DV1A 2B2TC 4B3RL 1DIKA 3AU7A 4TV9F 1HNWH 2BH8A 3PIOA 4APMA 2F0SA 3SGIA 1MKHA 2WB1B 4ZAIA 2UUBL 1IZ6A 4O81A 4QSHA 2GQSA 2HHFA 1GSOA 1UC9A 1PLFA 4M0JA 4I7HA 4KY5A 5FO9B 1ZQ7A 1PFBA 1VQOA 2TSSA 2L9HA 3R2TA 1WRVA 2XN9C 1STAA 3EBEA 2LXKA 4DK0A 2I5HA 4RAYA 2HGWA 4B3SL 4A93B 1BQQT 4DGZA 1N34H 3ZYYX 1UE5A 5C44H 1QUQA 3T1YQ 2F0WA 4DN4M 3TW6A 3K7AB 1M4VA 2AMCB 4AQYH 2A69C 4RHRA 4LK1C 4I7ZC 3Q8SB 1A2TA 5KKNB 3G71A 2RVLA 2NZOA 1IBKQ 2E2HH 4F4XA 5KGUA 4N9PA 3PUWA 3BVGA 1H9SA 1HUMA 4TQUS 3TMEA 3R9RA 2J7ZA 4DL3A 1BGWA 2PI2E 1O7ZA 1A3TA 4NLGA 5KFHA 4JV2A 4DUYL 1STGA 4NZMA 5M3MG 5KFVA 3IL8A 3J80W 5AJ3L 5BMVF 2PPBC 3K57A 4O7NA 2VUGA 1EOVA 4V190 4XQJA 4YWKA 3BDLA 2GVAA 2X0SA 3KF8B 4LF7Q 2Y0SG 4RA8A 4C3IG 1N32L 1J6QA 3BACA 4OEMB 1I4HA 1LABA 3EA6A 2W71A 5CA1F 4FDBA 3L0OA 4A3BG 2E2IA 5IODA 4DAMA 2MUYA 1IYEA 3VMMA 1TWCA 2Z02A 3UDGA 4NXNQ 4E6NA 4AYBB 1K9MC 3DAAA 1X65A 1CQIB 5IT9L 3R23A 1TWFB 2JN4A 4ECTA 1B44D 2QDLA 4KN7C 2W7PA 2KECA 2RKSA 2IY5B 4A3MG 3T9AA 5FPRA 2QCPX 3L7ZC 1AN8A 1PXUA 4EBEA 1FGUA 4TV8F 3V6JA 4G7OC 2K05A 2C35B 2D5DA 5KFDA 1EWCA 4BBRH 4JV5Q 2EJFC 3DWQA 3K6OA 3GTMA 3NQTA 3CKIB 2LMCB 1L0XB 5EKKA 1FNWA 1TR5A 4HCEA 1X3QA 5E3FA 2L11A 4TRDA 4JI3L 3TEKA 4IN3A 1SYCA 2R7ZH 1RF2D 4DV2H 1SAPA 1Q12A 4JBJA 2MFIA 4YCUA 3GDEA 4GOPB 1G91A 4MZ9A 3BG3A 1D5XC 4J9NA 3K5NA 4CDEC 1EUCB 3GV6A 1X32A 4DR5H 4DR1L 4F87A 2Y0SA 3GP7A 3BJYA 4DR7H 4KJOA 3OHAA 4O4JF 5KG2A 1DGSA 4XYQA 3LGJA 2CKZB 1HNXQ 5DEHA 4DV6Q 2CFMA 1GUSA 1JC7A 4C5CA 4POFA 4O2BF 4DR4Q 3S1RB 1XK5A 5K2MA 1OXXK 3HO8A 4LF6Q 2YWVA 4LFAQ 2YZGA 1MIUA 2LKVA 2YRWA 4BY7H 4JI2H 4XT3B 1UWVA 5D1PA 5C4JH 3BABA 3DEPA 1LTGD 3HB9A 1WTWA 1X54A 3O13A 2PW7A 5BWWA 3GTGH 2XGTA 1GUTA 4CKCA 4UP9A 2MO1A 2O5IC 3FKIB 1K28A 1LUZA 2K4KA 3GTKH 1W96A 4ECWA 4JI1L 4DNIA 1N36H 4DUZH 3PO2G 2RGVA 5GAHC 4EBDA 4PWQA 5I9OA 3E3XA 1KAWA 3KLWA 4ECQA 4IZ8A 1AEXA 3I7FA 1V9PA 1SMYC 3TS0A 1LTID 1G2SA 3OOCA 2MHVA 3T13A 3J7A5 4QW8A 1F9PA 2YTXA 2NVQH 2B63H 4A3EG 4QCLA 4LH7A 3MWMA 1YZ6A 4O7LA 3NUCA 2F0JA 1V1OA 2JA5B 3MR6A 3NPPA 1F77A 2MGSA 1A48A 2B3GA 2N49A 3EYYA 4J9QA 2UXBH 4NZOA 4OX9H 1MD2D 4UCVA 4FBUA 1UC8A 3NBHB 3CQZB 3NENA 5EQ0A 5BR8H 3NELA 5CC4A 1DONA 1LTRD 2PZWA 2KA7A 2K5QA 1A8VA 4DR3L 1CA6A 4K0KH 1T3NA 5D1OA 1ENAA 2AGPA 4X62Q 4G57A 3UQ8A 2R82A 5FK9C 3MWDA 1K1QA 1ZETA 2XWJB 1U4LA 4RMFA 3RBDA 1PFSA 4IOCA 2UUCH 2K5NA 1F2ZA 3PR4A 4PNYA 3R5XA 2WAQE 1EIYB 2F0PA 3OW2A 2JYOA 3GTQH 3BA8A 5KFFA 4TQSA 3BYYB 3FHWA 3GV5B 2Z6BA 3TY5A 1F2LA 5LMUL 1KC7A 4HN2A 3A74A 2X69A 1KXLA 2CZGA 1ZYRC 3JAMi 1K8MA 3T5HA 1HCZA 1S5CD 3CRKC 1Y1WG 3TN2A 4Y52H 4IFDG 2ENBA 2PZTA 3WWJA 1DXMA 3TZUA 3PCOB 4ECYA 4DV4Q 1A15A 1M7JA 1NCVA 2DGYA 2F0LA 1C0AA 2PMZA 1I7LA 4CE5A 2CW8A 1XMQQ 5IGBA 4ECUA 5IYBG 4JI0L 1L2FA 3KHHA 4JBMA 5JJKA 4RB0A 2B2WA 2M00A 3EROA 1YVCA 2V1CC 3BQ1A 1XMOL 1MSHA 4DRFA 4Q0FA 2QDBA 3E0EA 3HGBA 1S03G 3FMAA 2FMAA 3H0GH 5BPFA 3RZOH 1UEBA 2K1BA 3MWEA 2UVUA 4BA2I 4EFEA 2CQYA 3DMUA 1JWSD 3M9BA 4XT1B 2O4XA 4ME3A 4A3JG 1YHQA 2QK4A 1HFGA 5ELFA 3TP6A 3KTMA 2EE1A 4L5QA 4B3TQ 3GJXB 1Z6HA 5GAGC 1RTOA 1CKNB 4ZK9B 4P71A 4POGA 1OTCA 1GXDC 5LMNL 3D4RA 4YJ3F 4DR6Q 1B70B 3CAMA 1I4QA 2E74C 5E7NA 4GS3A 5FOBB 5IGDA 2NVXH 1ZXTA 4R4TA 3VPCA 4YR2A 3FPPA 2F0MA 2F4VQ 1YNJC 2A19A 2SOBA 3MR3A 1K3BC 1XNQQ 1Y1WA 2XCPA 1YNJD 1L1OA 3BAAA 3KALA 3NK9A 1IBLL 3L2PA 4O7YA 1MSGA 5HBRB 3A0JA 4B08A 2ZDHA 4J9PA 3HKSA 3C0FB 1PRTB 3QOLA 3LWEA 4KJNA 2FJZA 3H0GG 1TWFH 4GNXB 4X66L 3HKZE 3TY8A 3CRLC 1NBWA 2V59A 3JZ6A 3GIPA 1PFNA 5KFLA 4IR1A 2JJQA 3CCMA 1BCPF 1SR3A 4Q45A 4DXFA 3GIMA 4B3RH 2R7NA 1WFQA 4IUNA 2WDTA 4NXML 1STNA 1XX8A 5EWFA 1EZ1A 3E9HA 1EY0A 3JRWA 2UUBH 3J80E 2NU9B 4PZ7A 3N6XA 2EVBA 5AJ3Q 2NZHA 2W9BA 4S3SA 4FBTA 4ZKBB 1BNCA 2NTTA 1CQFA 3AFPA 1D8LA 5LL6S 4B3SH 2ZDGA 4BBSG 1N32Q 1E2VA 1MBYA 1B8AA 2HQLA 4OXPA 3M7NA 4R8IA 4MV7A 4C5BA 3RJ0A 4HR7B 4JI5L 4JI8L 4C2MB 4X6AH 5I9PA 4JW0A 3PO3B 2R8GA 3NEMA 1BKBA 1W3SA 2JA7G 1PTOF 3T1HH 3VPDA 1KJJA 2VQEQ 1I2KA 3QZ7A 1VQ7A 4G7ZC 3GIQA 1EQQA 3UFXB 3RLNA 1TWAB 4DUYH 4O84A 1S5FD 4RGNA 4WJWA 5FO7B 3H0GA 2Q2IA 1ILQA 1NAPA 5BPHA 3MEFA 5EPLA 2JSOA 4OHJA 4FS2A 1PH2A 3L4JA 4O3SA 5KG6A 2L5TA 3V4SA 1H9SB 4EQNA 3F2BA 5KG3A 2JA6B 4G3IA 4DV3Q 1ZHSA 2R8HA 2WIIB 3Q24A 2F0KA 4R4IA 1CE8A 2CHBD 3RF2A 3OPOA 2LFNA 4LH6A 4O7VA 4KI0A 4P2CB 3RTXA 2F0HA 4U7CA 2I5MX 3GTJA 3TINA 1GYFA 1ICFB 1WI5A 2UXCQ 4CBVA 4IAJA 3I90A 4KKSA 3KK7A 1AW7A 2J9GA 1FKAH 3S15B 3JSNA 2NN6H 4F50A 4Q4CA 1I3QH 1NUCA 2OQ0A 4UCOA 1EU4A 1VQEA 2B2WC 4IURA 4XQQA 1WCMG 2W6MA 2FLPA 2UVRA 2YU9A 2C00A 4HYKA 5M3FB 1X3EA 2HIXA 2E2IB 1VQJA 1X56A 1I1KA 2BA0A 4J6HA 1HZ9A 3CCQA 1FNVA 2JEGA 5JJLA 4NYEA 1UNNC 1HJPA 4ED0A 1BBWA 4FF3A 2JA7A 3HOZG 1JDEA 1H9KA 3CPFA 3UDXA 4RKBA 3G6YA 1R9TA 1GHKA 4A3CG 1EWIA 1UE7A 2CW7A 4LFCQ 1FJGL 5LOVF 3VPBA 4JI3H 5H1SE 4KLKA 1EY8A 4YCWA 3KOJA 2A6HD 1PYWD 4HIDA 1MJCA 2PN1A 3GB8B 3HFZB 1EY5A 5LA6F 3T4AC 2VR1A 4LF7L 1B7YB 1U4PA 1RDPD 2H4OA 2C2RA 2K7VA 3S2HB 3I3CA 3A8IE 3I56A 4DR1H 1RK5A 3PVXA 1E3PA 4KHZA 4F4WA 4JI4H 2F0NA 3GILA 2PO4A 1VQHA 3IKJA 1NMGA 2NN6G 1A0IA 4NXNL 1OBGA 5I5TA 1KBLA 5M3MB 2JK8A 3HOYG 1AH9A 1A9XA 3T5JA 1J9OA 1B4OA 3I4MH 3E0JA 3KAKA 1YHBA 3VOTA 1PK8A 1N9WA 5EAYA 4APVA 4A3KH 1KTAA 3K0YA 4DIMA 2QF7A 1B53A 4LJZC 4CJ1B 1STBA 2F0DA 2GPWA 4UCRA 3VR5A 1O78A 2EJ0A 2W8KA 3LX0A 1WCMA 4J9SA 3ERSX 2EYPA 2XCAA 5L1JA 1RJQA 2ALYB 3HG9A 3G8CA 2W57A 4GKJH 4JV5L 4K6NA 3T9CA 5JEAH 1RYRA 5KG1A 4ULLA 2VQFL 2EY2A 1C8CA 4QIWE 3SXHA 1LYLA 1VQ4A 2HVQA 4YJ2F 1IL2A 2EYJA 5KIXA 3V05A 4DR3Q 1JLLB 2UVVA 2DY7A 1A62A 3R5FA 5FD5A 4JI1H 1GUWA 3ULJA 3F8TA 4A3MB 3C46A 1S10A 2JEIA 3SK5A 3QWNA 2DLNA 5DLGA 3GTPA 2G9HD 2PBZA 2L0CA 1LT4D 1Q8KA 3T9EA 3CC7A 1JQYD 3CU7A 4FXGC 4DLKA 2BDOA 5FLMG 2V9WA 1SNMA 1X3PA 5LMUQ 2B2TA 2HJWA 3ER0A 4CDDC 4HJAA 2JA8G 4ED2A 2K04A 5JEAJ 5BWUA 1I3QA 2ATLA 3MXGA 5KFMA 4DV6L 4LFBL 5I6WA 1SJHD 2B2UC 4PBCA 2K6AA 2GN5A 2R92H 5EKLA 4LF4H 4DR4L 1O75A 5DQIA 1JX4A 3BS1A 2FPPB 3R5HA 1I50A 5KFCA 4LF6L 3G6JB 1D5MC 5J39A 4LFAL 4FFLA 4XYOA 2W6NA 4UFZA 4A76A 4O3NA 3N44B 5JJIA 3GTOA 1M1KC 3NTIA 4EQOA 5LHY1 2R86A 1TWHB 3I91A 5IGGA 4A3IG 2W6OA 4DL4A 5CB4F 2NU8B 1TIID 1XPOA 1KLUD 3A56A 4JI7Q 5C4XB 2N78A 1STEA 3PUXA 4RAUC 1AP0A 3WOEA 3FRPB 1A0GA 1SE2A 5KT4A 5FJ8H 3SK8A
chains in the Genus database with same CATH topology
1CSPA 2GVBA 2EIFA 2E8GA 2QA4A 3S2DH 2ZM6L 4C3HH 5GQOA 3UE0A 4JI0H 2PI2A 4JI6L 4DV5Q 3HOUG 1XMOH 4R4OA 5IP7G 1T9HA 4IPGA 3I55A 1U0LA 3K8AA 4C2MH 3K7UC 4GN4B 1SN8A 3S16H 3F2DA 4UCUA 4A3DG 1TWAH 2VUMG 3OTOQ 3M4OH 5LMNH 4JYAQ 2VW9A 1VQ8A 4R7RA 4NXMQ 5IYCG 5FPOA 2HHHQ 1I94Q 1VQKA 2QEXA 1OXSC 2R6GA 3J80c 2JA6H 1IBLH 1Y1VH 2MNAA 1PYBA 2I5LX 3J81c 4X66H 1X3FA 1L1OB 5HGQA 2KSWA 3RIZA 3CMAA 5FLXc 5C0XG 5M3FH 3J80i 1PH9A 4JOIA 3S17H 4LF8Q 4B3TL 2LSSA 2AHOB 4CC5A 4X65Q 1YNXA 4DR6L 4HJ7A 3W5OA 2F52A 1JE5A 4BWSC 4YY3L 3BU2A 2F4VL 5IP9H 4JI5H 4JI8H 1XNQL 1M90C 3S2HH 4DAYB 1KC8C 4BY1G 2N3SA 1TAEA 1YHAA 4KHPQ 2K5HA 2O03A 2NVYH 1U5KA 1QVCA 1HH2P 1YEZA 2HVSA 1JMCA 3NC0B 2K5VA 4NPSA 2AWNA 2JEBI 3I4OA 1VQNA 1FJGQ 1G6PA 1SEIA 3U4VA 1SYXB 1VQFA 3T1YH 1PH6A 3PIPA 3KDFA 1IBKH 1ZHQA 5C44G 1KD1C 4P73A 2R7FA 4IFDI 3I4NH 2VQEL 1PH8A 1Z47A 1YBYA 1VQ6A 4H02A 3M4QA 3HXLA 1N33L 3DF7A 4DV7Q 2ZJPA 4JG2A 1S72A 4LF7H 1Q82C 2VQFQ 3M4PA 4GKKQ 4DV3L 4DPGA 4UCSA 1XNRL 4NXNH 5GAEC 2UXCL 1E4FT 3TREA 5C4XH 2PQAA 2IT1A 3CCUA 4JV5H 1ASZA 2K75A 3F2CA 3HOVH 4LFBQ 4LUOA 4JOIC 4P75A 4BBRG 1QZGA 4LFCL 4HJ9A 4LF9L 2L15A 1X9NA 4L5TA 1UE6A 4Y7NH 2R7ZG 4BXXH 1VQIA 1VQAA 4B3MQ 5FD6A 3VDYA 3VNNA 1HNXH 4DV6H 4LFBH 2D62A 4JBWA 4OONA 4FM9A 5GADC 4DR4H 3PF5A 2ZM6Q 4LF6H 4LFAH 5IWAQ 1HR0L 5IE8A 4JI6Q 1XJVA 3PV0A 1Q46A 4BY7G 4DK3C 4JCVE 3IG0A 2A8VA 2XTIA 3GTLH 3JAMc 5C3EH 5DISC 3N40P 2Q2UA 4BXXG 3TY9A 3DLLA 1VQGA 1GD7A 2XIGA 2YTVA 1P8LA 4WJ4A 1HZCA 2E2JH 1ASYA 1BVSA 5LL6b 2ZJTA 2B63G 3OYYA 4EEQA 1EQRA 1Y14B 3HOWH 1L2ZA 3EIVA 1B04A 1RL2A 4X62H 1AE3A 1XTDA 3BZCA 1SMXA 4A93H 4JI7L 3K7AH 1A63A 3NBZB 5IT9c 3RLOA 1BBUA 1I6HH 2AKWB 4DV4H 4IPDA 3EN2A 2B29A 1XMQH 4YY3Q 4DV5L 2NN6I 1Q1BA 4QGUA 2WB1G 3PF4A 1AE2A 2JA9A 3CMEA 3CC4A 4OO1G 2VPSA 3PSIA 1I5FA 4B3TH 1HNZQ 4M7EA 1IBMQ 2BA1A 1K73C 3OTOL 4JYAL 4DR6H 4X64Q 2HIVA 3KF6A 4MNOA 2F4VH 2HHHL 1I94L 2KCTA 1XNQH 1PA6A 3AYHB 3H15A 1O7IA 2KHIA 4Q0YA 3CF5A 1S40A 1IYJB 3LMLA 1E24A 3TEHB 2Z6KA 3J81j 4IJHA 4QQBX 3K3VA 4DR2Q 4GLVB 4AYBG 1K83H 4HIKA 3CCJA 1PV4A 1QUQB 2FE3A 4LF8L 1HNWL 1X3GA 1N33Q 4X65L 3S1RH 3G6EA 1N32H 1Z2NX 1XNRQ 3AFQA 2IHEA 4ALPA 1PH3A 4AQYL 3FKIH 2VQEH 1KRSA 1CKMA 2KCMA 4KHPL 2PMZE 1PH4A 2JEAI 2Z0SA 3KDFB 1GM5A 2CWAA 2JA5H 1PYSB 2EQSA 2VY3A 4A3FH 4DV3H 2ZTDA 2ZTEA 3CQZH 4L5SA 4LF9Q 2UXCH 3N41B 5IYDH 1CUKA 4O2DA 3H3VH 4NB3A 2MCTA 4LSAA 1K0RA 2ZJRA 2PQAB 2VS1A 4GOPA 4P72A 4LFCH 1GVPA 4A75A 1XPUA 1S3OA 2K50A 2RHSB 4DV7L 3CW2C 1HR0Q 1JT8A 1HR0W 4GKKL 3W1GA 2ATWA 1XDNA 5C0XI 3AQQA 4GLAC 5A2QW 1SE8A 4LUZA 4CC6A 2YTYA 2HT1A 1VQMA 2Z6KC 3I4MG 4A3KG 2JE6I 4JI2L 4QY7A 2VL6A 4OWTB 4UCTA 4DR3H 2UUAQ 5JEAG 3J7AK 2FXQA 2EXDA 3W1BA 1C9OA 2F3IA 4B3ML 5D1OB 5LMUH 4HJ8A 2UU9Q 4A3LH 1KQSA 4LUVA 1E1OA 2UXBL 2E5LQ 4OX9L 4R4CA 1KIXA 3WWVA 1NMFA 4K0KL 2R92G 2R7DA 5IWAL 2YV5A 2UUCL 2VOBA 4JI7H 1KHIA 2UXDQ 3PO3H 4YHHQ 3QWUA 3STBC 3CVZA 1J5EQ 4J0MA 1KL9A 3STBD 4DV0Q 5FJ8G 3JSLA 3RN5A 1VQ5A 1GO3E 3K80C 4DV5H 3D31A 4XIGS 4LF5Q 4JC0A 4GOPC 3K0XA 1CKNA 4DV1Q 4JBKA 3S15H 1WYDA 3ZJYC 3OTOH 2CCZA 1S68A 1XPRA 4JYAH 3GO5A 2E2IH 1TWCH 4NXMH 2HHHH 1HNWQ 1I94H 1VQLA 4EFBA 1PH1A 1PHJA 4GNXA 3BJUA 4HJ5A 4R1JA 2JA6G 3CXCA 1N34Q 1Y1VG 4RZQA 4RB2C 1YITA 3GTMH 4AQYQ 2Q2TA 4J15A 2WAQG 4LNQA 2YYZA 5M3MH 3PGZA 1MJEA 4LF8H 5M3FG 1HNZL 1IBML 3PUVA 2N8NA 4X65H 4C3IH 4UP8A 2OTLA 1E1TA 4X64L 1HZBA 4A3BH 1MZBA 3AEVA 1Q86C 1VQDA 1V43A 3S14H 3CCRA 4IPHA 5IP9G 2OQKA 4A3MH 3T1HL 4KHPH 1WOCA 4LWCA 2LXJA 1PH7A 1VQPA 1JJ2A 2KHJA 5EOYA 4DR2L 1H95A 1TXYA 1EUJA 2IX0A 2D0PA 1P16A 3L4KA 2RGRA 4IO9A 1UE1A 2RF4A 1FJGH 2VZAA 3J81W 4DV2Q 2H5XA 5FLXW 3CP0A 1NY4A 2ZJQA 4DR5Q 1TWHH 2ASBA 3PN1A 3ICEA 4DR7Q 5ELNA 3NBYB 3KJPA 3HKZG 3UDIA 1RIPA 3I4NG 1YIJA 1SROA 4RB3C 4DV7H 2A1AA 4ETSA 3RN2A 4JI2Q 2VQFH 1YJWA 4GKKH 1VCIA 2DUDA 3RLFA 3U4ZA 2R93H 3PO2H 4OO1I 1VS0A 4GNXC 4JI4L 1N36Q 1M0WA 4DUZQ 1Q81C 4A3EH 1Z9FA 4PZ6A 5C4XG 4PZ8A 1AN7A 4UP7A 5ELOA 1NJIC 4GKJL 2UXBQ 5M5YH 1VQ9A 4OX9Q 3F8NA 4GN5A 4AH6A 5BR8Q 3KJOA 3HOVG 4K0KQ 2R93G 3CCLA 2UUCQ 2MO0A 1I6UA 4B3MH 4C3JH 3KXYT 4A3GH 1GKHA 1Y1WH 1QVFA 1WH2A 2BH2A 2ZM6H 2WE6A 5IYBH 4LF4L 5IWAH 3KFUA 3RNUA 4JI6H 1SRUA 1EYGA 3DM3A 1PH5A 2UUAL 3KYHC 3S1NH 1D7QA 4A3JH 4IFDJ 3H20A 4WJ3M 3TRZA 5C3EG 4A3GG 1LM0A 3GD7A 3ULLA 1OXTA 2WP8J 2UU9L 4YWLA 3N42B 5HY6A 2ES2A 2E5LL 5M5XH 1BJTA 3I2ZA 4A4IA 4LSXA 3CD6A 2I0QA 4HIOA 4TVAB 2Y0SE 1OXUA 3HOWG 4HIMA 2UXDL 4LW1A 4PMWA 5K36G 2RCNA 4A93G 4YHHL 1QVGA 3CC2A 2OCEA 3GTJH 3BA9A 1EIFA 1J5EL 5IY0A 3PUYA 4B3RQ 4DV0L 4L5RC 2WFWA 2UUBQ 2YU9H 4BBSH 1SFOH 3JAMW 1VQBA 3E9IA 2WYOA 4RB1A 4YY3H 2HGSA 4B3SQ 4LF5L 2JA7H 3U50C 1R9TH 2CQOA 3H3VI 1X55A 2NVTH 3M3YH 4DV1L 1IXRA 1CKOA 3T1HQ 3PUZA 1HNZH 1IBMH 1N8RC 4DUYQ 1FL0A 3CCSA 4X64H 4LMYA 1CSQA 4RG1A 1E22A 3JC66 2VNUD 3TQYA 1WCMH 2KBNA 2JQOA 1PVOA 1JJCB 5IT9W 3N43B 1N34L 1HZAA 4DR2H 3HOZH 4DK6C 2D0OA 4A3CH 2CWPA 1Z2PX 2IX1A 4PG3A 2OTJA 3GTPH 1N33H 1YJ9A 1K3RA 4JI3Q 4MTNA 3Q8DA 1EFWA 4EQ5A 1M0TA 1XNRH 3T1YL 3HOYH 4DR1Q 1NE3A 4BA1I 4JI4Q 4MV9A 3M4IA 2HVRA 4R4QA 1IBKL 3MXNB 1LTLA 2KENA 1I50H 3FP9A 1E7ZA 3FKIG 1SLJA 3GTOH 3RZDH 4AIMA 3J7ZC 3CPWA 4DKAC 4UPAA 1JJGA 3S1MH 4A2AA 4GKJQ 1K8GA 2K52A 1KRTA 2ZTCA 1C7YA 2JA5G 4GLXA 4LF9H 4A3FG 4JI1Q 3S24A 4DV2L 1L1OC 3F1ZA 4YWMA 4OWXB 4IJLA 5FLMH 5IYDG 4DR5L 2JA8H 4DR7L 4O0AA 5DLQE 1YJNA 3U58A 3CCEA 3CCVA 4LF4Q 1Q7YC 1HR0H 4GN3B 3B6YA 4A3IH 4IPCA 2WB1E 1FVIA 3M85A 4MTEA 4MTDA 4IOAA 1N36L 4DUZL 3ULPA 2RHQB 1HNXL 3G4SA 3UE1A 1OXVA 1X6OA 1L0WA 3HOUH 4A2BA 1V1QA 5IP7H 4JI0Q 2MQHA 4PDBA 2UUAH 4P74A 5BR8L 3K81C 2Q2HA 1XMOQ 1G291 2IHFA 3RGXA 1Q1EA 3KAJA 4A3DH 1QZHA 1W2BA 2VUMH 4AYBE 4OWWB 3RGZA 4QJFA 4UY8C 2UU9H 4QL5A 3A5ZB 2K14A 5IYCH 1JB7A 5LMNQ 3UDFA 3IRBA 5GROA 5LMNW 2E5LH 4A3LG 3A5UA 5M5WH 3HOXH 1IBLQ 4X62L 5J3BA 3S1QH 4XTCS 3D0FA 3TS2A 2UXDH 1TWGH 4X66Q 2OWOA 4YHHH 1G51A 1J5EH 2PNHA 3RR5A 4DV0H 3PO3G 1K8AC 1VQCA 4DV4L 4YCVA 2YCHA 4RAZA 1TA8A 1YI2A 1XMQL 3HOXG 4LF5H 1E4GT 5C0XJ 4BY1H 1Z2OX 4JI8Q 4JI5Q 3BZKA 4DV1H 2ID0A 3G48A 2AWOA 3KF6B 2QGQA 1WJJA 4EX5A 1NTGA 3J81i 4B3RL 1HNWH 2BH8A 3PIOA 4APMA 3SGIA 1MKHA 2UUBL 1IZ6A 4I7HA 1VQOA 3EBEA 2LXKA 4RAYA 2I5HA 4B3SL 1N34H 1UE5A 5C44H 1QUQA 3T1YQ 2AMCB 4AQYH 3G71A 1IBKQ 2NZOA 2E2HH 3PUWA 4TQUS 1BGWA 2PI2E 4DUYL 5M3MG 3J80W 5AJ3L 2VUGA 1EOVA 4YWKA 2GVAA 3KF8B 4LF7Q 2Y0SG 1N32L 1J6QA 4FDBA 3L0OA 4A3BG 4DAMA 3UDGA 4NXNQ 4E6NA 1K9MC 1X65A 2IY5B 4A3MG 5FPRA 3L7ZC 1FGUA 2C35B 4BBRH 4JV5Q 4JI3L 2R7ZH 4DV2H 1Q12A 4JBJA 2MFIA 4YCUA 3GDEA 4GOPB 4MZ9A 4DR5H 4DR1L 4DR7H 1DGSA 3LGJA 2CKZB 1HNXQ 4DV6Q 2CFMA 4POFA 4DR4Q 1XK5A 1OXXK 4LF6Q 4LFAQ 1MIUA 4BY7H 4JI2H 1UWVA 5D1PA 5C4JH 3BABA 1X54A 3GTGH 2XGTA 4UP9A 2MO1A 1LUZA 2K4KA 3GTKH 1N36H 4JI1L 4DNIA 4DUZH 3PO2G 2RGVA 5GAHC 1KAWA 3KLWA 3I7FA 1V9PA 3TS0A 3J7A5 3MWMA 2YTXA 2NVQH 2B63H 4A3EG 4LH7A 1YZ6A 2B3GA 2N49A 3EYYA 2UXBH 4OX9H 4UCVA 3NBHB 3NENA 5BR8H 3NELA 1A8VA 4DR3L 4K0KH 5D1OA 4X62Q 3UQ8A 4RMFA 1PFSA 4IOCA 2UUCH 2K5NA 2WAQE 1EIYB 3OW2A 3BA8A 3GTQH 3FHWA 3TY5A 5LMUL 3A74A 1KXLA 3JAMi 1Y1WG 4Y52H 4IFDG 3PCOB 4DV4Q 2DGYA 1C0AA 2CW8A 1XMQQ 5IYBG 4JI0L 1L2FA 4JBMA 4RB0A 5JJKA 1YVCA 2V1CC 1XMOL 4DRFA 3E0EA 1S03G 3FMAA 3H0GH 3RZOH 1UEBA 4BA2I 4EFEA 3M9BA 4ME3A 4A3JG 1YHQA 4L5QA 4B3TQ 3GJXB 5GAGC 1CKNB 4P71A 4POGA 1OTCA 5LMNL 4DR6Q 1B70B 3CAMA 5E7NA 4GS3A 2NVXH 4R4TA 2F4VQ 2A19A 1XNQQ 1L1OA 3BAAA 3KALA 1IBLL 3L2PA 3A0JA 3HKSA 3C0FB 3H0GG 1TWFH 4GNXB 4X66L 3HKZE 3TY8A 1NBWA 2JJQA 3CCMA 1SR3A 4B3RH 1WFQA 2WDTA 4NXML 3E9HA 2UUBH 3N6XA 4PZ7A 5AJ3Q 2NZHA 3AFPA 1D8LA 4B3SH 4BBSG 1N32Q 1B8AA 2HQLA 4OXPA 3M7NA 4MV7A 3RJ0A 4JI5L 4JI8L 4X6AH 3NEMA 1BKBA 1W3SA 2JA7G 3T1HH 2VQEQ 1VQ7A 1EQQA 3RLNA 4DUYH 2Q2IA 3MEFA 1PH2A 3L4JA 3F2BA 4DV3Q 1ZHSA 4R4IA 3RF2A 4LH6A 4KI0A 3RTXA 2I5MX 1GYFA 1WI5A 2UXCQ 4IAJA 1FKAH 3JSNA 1I3QH 2OQ0A 4UCOA 1VQEA 1WCMG 1X3EA 2HIXA 1VQJA 1X56A 2BA0A 1HZ9A 3CCQA 5JJLA 1HJPA 1BBWA 3HOZG 3CPFA 3UDXA 4A3CG 1EWIA 1UE7A 2CW7A 4LFCQ 1FJGL 4JI3H 5H1SE 4KLKA 4YCWA 3KOJA 4HIDA 3GB8B 1MJCA 3HFZB 4LF7L 1B7YB 3I56A 4DR1H 4JI4H 1E3PA 4KHZA 1VQHA 1NMGA 2NN6G 1A0IA 4NXNL 2JK8A 3HOYG 1AH9A 3I4MH 3KAKA 1YHBA 1N9WA 5EAYA 4APVA 4A3KH 4UCRA 3ERSX 2ALYB 4GKJH 2W57A 4JV5L 2VQFL 4QIWE 1LYLA 1VQ4A 2HVQA 1IL2A 4DR3Q 1A62A 5FD5A 4JI1H 3ULJA 3F8TA 1Q8KA 3CC7A 5FLMG 5LMUQ 3ER0A 2JA8G 4HJAA 5JEAJ 4DV6L 4LFBL 2R92H 2GN5A 4LF4H 4DR4L 1O75A 4LF6L 4LFAL 4UFZA 4A76A 3N44B 5JJIA 1M1KC 4A3IG 1XPOA 4JI7Q 2N78A 3PUXA 5FJ8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSP A;  2IHE A;  4ALP A;  2GVB A;  5M3M G;  2EIF A;  1EYG A;  1PH3 A;  2E8G A;  4AQY L;  5AJ3 L;  3DM3 A;  1PH5 A;  3FKI H;  2QA4 A;  1EOV A;  2UUA L;  2VUG A;  3KYH C;  4YWK A;  1KRS A;  1CKM A;  2GVA A;  2KCM A;  3KF8 B;  3S1N H;  4LF7 Q;  3S2D H;  4KHP L;  2ZM6 L;  1D7Q A;  2PMZ E;  2Y0S G;  4C3H H;  1N32 L;  1J6Q A;  4A3J H;  4IFD J;  1PH4 A;  5GQO A;  3UE0 A;  4FDB A;  2JEA I;  4WJ3 M;  3L0O A;  4A3B G;  2Z0S A;  3TRZ A;  3KDF B;  2PI2 A;  4DAM A;  5C3E G;  1GM5 A;  4JI6 L;  4DV5 Q;  3UDG A;  4A3G G;  3HOU G;  1LM0 A;  2CWA A;  4NXN Q;  3GD7 A;  4E6N A;  1K9M C;  1X65 A;  4R4O A;  3ULL A;  5IP7 G;  1OXT A;  2JA5 H;  1PYS B;  2EQS A;  2VY3 A;  2WP8 J;  2UU9 L;  4A3F H;  1T9H A;  2ZTD A;  4IPG A;  2ZTE A;  4YWL A;  3I55 A;  1U0L A;  3K8A A;  2IY5 B;  4C2M H;  3K7U C;  4A3M G;  5FPR A;  5HY6 A;  3CQZ H;  3L7Z C;  4GN4 B;  1SN8 A;  3S16 H;  2ES2 A;  2E5L L;  1FGU A;  5M5X H;  3F2D A;  4L5S A;  3I2Z A;  4UCU A;  4LF9 Q;  4A4I A;  2C35 B;  4A3D G;  5IYD H;  4BBR H;  3CD6 A;  4JV5 Q;  2I0Q A;  4HIO A;  1CUK A;  1TWA H;  4TVA B;  2Y0S E;  2VUM G;  3OTO Q;  3M4O H;  1OXU A;  4JYA Q;  4O2D A;  2VW9 A;  3H3V H;  1VQ8 A;  3HOW G;  4NB3 A;  4HIM A;  4JI3 L;  1K0R A;  4NXM Q;  2R7Z H;  5K36 G;  5IYC G;  5FPO A;  2HHH Q;  1Q12 A;  4JBJ A;  2ZJR A;  1I94 Q;  2UXD L;  1VQK A;  2QEX A;  4LW1 A;  2MFI A;  4PMW A;  4YCU A;  1OXS C;  2R6G A;  2PQA B;  3GDE A;  4MZ9 A;  3J80 c;  4GOP B;  2VS1 A;  4GOP A;  2JA6 H;  4P72 A;  2RCN A;  4A93 G;  4YHH L;  1QVG A;  1GVP A;  1Y1V H;  3CC2 A;  4DR1 L;  2OCE A;  2MNA A;  4A75 A;  1PYB A;  3GTJ H;  2I5L X;  1XPU A;  1EIF A;  1S3O A;  2K50 A;  2RHS B;  5IY0 A;  3PUY A;  1J5E L;  4DV7 L;  4B3R Q;  1DGS A;  3CW2 C;  4DV0 L;  3J81 c;  3LGJ A;  2CKZ B;  1HR0 Q;  1JT8 A;  1X3F A;  1HR0 W;  4L5R C;  2WFW A;  2UUB Q;  1HNX Q;  2YU9 H;  4DV6 Q;  1L1O B;  2CFM A;  3W1G A;  5HGQ A;  4BBS H;  4GKK L;  3CMA A;  4POF A;  1SFO H;  2ATW A;  5FLX c;  1VQB A;  3E9I A;  5C0X G;  5M3F H;  3J80 i;  5C0X I;  1PH9 A;  1XDN A;  4DR4 Q;  4JOI A;  3AQQ A;  3S17 H;  1XK5 A;  4GLA C;  1OXX K;  4B3S Q;  4LF5 L;  4LF6 Q;  4LFA Q;  1MIU A;  2JA7 H;  3U50 C;  4BY7 H;  4LF8 Q;  4B3T L;  2LSS A;  1UWV A;  1R9T H;  2CQO A;  2AHO B;  5D1P A;  1SE8 A;  5C4J H;  3H3V I;  3BAB A;  1X55 A;  4CC5 A;  2NVT H;  4LUZ A;  4CC6 A;  4X65 Q;  3M3Y H;  1YNX A;  4DV1 L;  1IXR A;  1CKO A;  1X54 A;  3GTG H;  3T1H Q;  2YTY A;  2XGT A;  4HJ7 A;  3W5O A;  2HT1 A;  1VQM A;  3PUZ A;  4DR6 L;  4UP9 A;  2MO1 A;  2Z6K C;  2F52 A;  3I4M G;  1JE5 A;  1LUZ A;  2K4K A;  3GTK H;  4JI1 L;  4DNI A;  4YY3 L;  3BU2 A;  4A3K G;  3PO2 G;  2F4V L;  5GAH C;  5IP9 H;  1KAW A;  1N8R C;  3KLW A;  1XNQ L;  4DUY Q;  2JE6 I;  1M90 C;  4JI2 L;  4QY7 A;  3S2H H;  4DAY B;  2VL6 A;  4OWT B;  1FL0 A;  4UCT A;  3I7F A;  1KC8 C;  1V9P A;  4BY1 G;  3CCS A;  3TS0 A;  2N3S A;  2UUA Q;  3J7A 5;  1TAE A;  5JEA G;  2YTX A;  2NVQ H;  2B63 H;  4A3E G;  4LH7 A;  1YHA A;  1YZ6 A;  4KHP Q;  2K5H A;  1CSQ A;  4RG1 A;  1E22 A;  2B3G A;  2N49 A;  3JC6 6;  2NVY H;  1U5K A;  2FXQ A;  2VNU D;  4UCV A;  2EXD A;  3NBH B;  3TQY A;  3NEN A;  3W1B A;  1QVC A;  3NEL A;  1WCM H;  1HH2 P;  2KBN A;  1YEZ A;  2JQO A;  1JMC A;  2HVS A;  1C9O A;  1PVO A;  1JJC B;  1A8V A;  2F3I A;  4DR3 L;  4B3M L;  3NC0 B;  2K5V A;  4NPS A;  2AWN A;  5D1O B;  2JEB I;  4HJ8 A;  2UU9 Q;  5D1O A;  4A3L H;  3I4O A;  4X62 Q;  1N34 L;  1VQN A;  1KQS A;  3UQ8 A;  4LUV A;  1FJG Q;  1HZA A;  4RMF A;  1E1O A;  1PFS A;  4DK6 C;  4IOC A;  2E5L Q;  3HOZ H;  2D0O A;  2K5N A;  2UXB L;  4OX9 L;  4R4C A;  1KIX A;  1G6P A;  3U4V A;  4A3C H;  2CWP A;  2WAQ E;  3WWV A;  1NMF A;  1EIY B;  2IX1 A;  3OW2 A;  3BA8 A;  3GTQ H;  1VQF A;  3FHW A;  4PG3 A;  2OTJ A;  3TY5 A;  4K0K L;  2R92 G;  5LMU L;  2R7D A;  3GTP H;  5IWA L;  2YV5 A;  1YJ9 A;  1PH6 A;  3A74 A;  1KXL A;  1K3R A;  3JAM i;  3PIP A;  3KDF A;  4JI3 Q;  1Y1W G;  5C44 G;  4Y52 H;  4IFD G;  1KD1 C;  4P73 A;  2R7F A;  2UUC L;  3I4N H;  4IFD I;  2VQE L;  4MTN A;  3PCO B;  1KHI A;  4DV4 Q;  1PH8 A;  3Q8D A;  1Z47 A;  2UXD Q;  1YBY A;  1EFW A;  2DGY A;  1VQ6 A;  4H02 A;  4EQ5 A;  1C0A A;  3M4Q A;  3PO3 H;  4YHH Q;  3T1Y L;  1XMQ Q;  3HOY H;  4DR1 Q;  1NE3 A;  4BA1 I;  5IYB G;  4JI0 L;  1L2F A;  3QWU A;  3STB C;  4JBM A;  1J5E Q;  4JI4 Q;  1N33 L;  5JJK A;  4DV7 Q;  1KL9 A;  3STB D;  2HVR A;  2ZJP A;  1YVC A;  2V1C C;  4R4Q A;  3MXN B;  1LTL A;  2KEN A;  1I50 H;  5FJ8 G;  4DV0 Q;  4JG2 A;  1XMO L;  1IBK L;  3RN5 A;  1S72 A;  1VQ5 A;  3JSL A;  4DRF A;  3E0E A;  1Q82 C;  3FP9 A;  2VQF Q;  1GO3 E;  3M4P A;  4GKK Q;  3H0G H;  4DV3 L;  1E7Z A;  1UEB A;  1SLJ A;  3FKI G;  3RZD H;  3GTO H;  3RZO H;  4DPG A;  3K80 C;  4AIM A;  4BA2 I;  4EFE A;  3J7Z C;  4UCS A;  3M9B A;  3CPW A;  1XNR L;  4DKA C;  4ME3 A;  3D31 A;  4UPA A;  4XIG S;  4A3J G;  1YHQ A;  1JJG A;  5GAE C;  3S1M H;  4LF5 Q;  4JC0 A;  4GOP C;  2UXC L;  3BA9 A;  4L5Q A;  4B3T Q;  3TRE A;  5C4X H;  4GKJ Q;  3GJX B;  5GAG C;  2PQA A;  1K8G A;  1CKN B;  4P71 A;  3K0X A;  1CKN A;  2K52 A;  1KRT A;  1OTC A;  5LMN L;  4DV1 Q;  4POG A;  4DR6 Q;  1B70 B;  2ZTC A;  3CAM A;  1C7Y A;  2IT1 A;  5E7N A;  4GS3 A;  2JA5 G;  2NVX H;  4GLX A;  4R4T A;  4A3F G;  4JBK A;  4JI1 Q;  3CCU A;  3S24 A;  3S15 H;  4DV2 L;  1L1O C;  2F4V Q;  1ASZ A;  1WYD A;  2A19 A;  2K75 A;  3ZJY C;  3F1Z A;  4YWM A;  3F2C A;  1XNQ Q;  3HOV H;  4LFB Q;  4OWX B;  4LUO A;  1L1O A;  4IJL A;  4JOI C;  5FLM H;  2CCZ A;  1XPR A;  1IBL L;  3L2P A;  1S68 A;  3BAA A;  4P75 A;  5IYD G;  3GO5 A;  4DR5 L;  4BBR G;  2E2I H;  1QZG A;  4LFC L;  2JA8 H;  3A0J A;  1TWC H;  4HJ9 A;  3HKS A;  4DR7 L;  4O0A A;  5DLQ E;  4LF9 L;  1HNW Q;  2L15 A;  3H0G G;  1VQL A;  1TWF H;  4EFB A;  1X9N A;  1PH1 A;  4L5T A;  4GNX B;  1YJN A;  1PHJ A;  1UE6 A;  4X66 L;  4GNX A;  3HKZ E;  3U58 A;  3TY8 A;  1NBW A;  4Y7N H;  3BJU A;  2R7Z G;  4BXX H;  1VQI A;  2JJQ A;  3CCM A;  1SR3 A;  4HJ5 A;  3CCE A;  3CCV A;  4LF4 Q;  4R1J A;  1WFQ A;  2JA6 G;  1VQA A;  4B3M Q;  3CXC A;  3VDY A;  1Q7Y C;  4NXM L;  1N34 Q;  4GN3 B;  3E9H A;  1Y1V G;  3B6Y A;  4A3I H;  4IPC A;  3VNN A;  2WB1 E;  1YIT A;  3GTM H;  1FVI A;  4PZ7 A;  4AQY Q;  5AJ3 Q;  2D62 A;  4JBW A;  4J15 A;  4OON A;  2NZH A;  2Q2T A;  2WAQ G;  3M85 A;  5GAD C;  3PF5 A;  4LNQ A;  3AFP A;  1D8L A;  2ZM6 Q;  2YYZ A;  4IOA A;  5M3M H;  4BBS G;  1N32 Q;  1N36 L;  3PGZ A;  1B8A A;  2HQL A;  1MJE A;  4OXP A;  5M3F G;  4DUZ L;  3M7N A;  3ULP A;  1HNZ L;  2RHQ B;  1IBM L;  5IWA Q;  1HR0 L;  3PUV A;  4JI5 L;  4JI8 L;  5IE8 A;  4X6A H;  2N8N A;  4JI6 Q;  1XJV A;  3PV0 A;  1HNX L;  3NEM A;  1Q46 A;  3G4S A;  4C3I H;  1BKB A;  1W3S A;  2JA7 G;  4BY7 G;  3UE1 A;  4DK3 C;  4JCV E;  4UP8 A;  2VQE Q;  2OTL A;  1E1T A;  1OXV A;  1X6O A;  2XTI A;  4X64 L;  1VQ7 A;  1L0W A;  1HZB A;  2A8V A;  4A3B H;  3GTL H;  3JAM c;  3AEV A;  1EQQ A;  5C3E H;  3RLN A;  5DIS C;  2Q2U A;  1Q86 C;  4BXX G;  3HOU H;  3TY9 A;  1VQD A;  1V43 A;  3S14 H;  1V1Q A;  5IP7 H;  3DLL A;  1VQG A;  4JI0 Q;  2Q2I A;  2MQH A;  3CCR A;  1GD7 A;  3MEF A;  4IPH A;  2YTV A;  1PH2 A;  5IP9 G;  2OQK A;  1P8L A;  4P74 A;  3K81 C;  5BR8 L;  2Q2H A;  3T1H L;  4A3M H;  1XMO Q;  1G29 1;  1WOC A;  4LWC A;  2IHF A;  2LXJ A;  3F2B A;  4WJ4 A;  1Q1E A;  1HZC A;  2E2J H;  1ASY A;  1BVS A;  4DV3 Q;  1PH7 A;  1VQP A;  4A3D H;  4R4I A;  2KHJ A;  1JJ2 A;  4DR2 L;  2B63 G;  1H95 A;  4LH6 A;  3OYY A;  4KI0 A;  3RTX A;  1QZH A;  1W2B A;  2VUM H;  2I5M X;  4EEQ A;  1TXY A;  4AYB E;  1WI5 A;  1EUJ A;  4OWW B;  2UXC Q;  2IX0 A;  1EQR A;  2D0P A;  1P16 A;  1Y14 B;  4QJF A;  4UY8 C;  3HOW H;  4IO9 A;  3EIV A;  3JSN A;  1B04 A;  1I3Q H;  1RL2 A;  2OQ0 A;  1UE1 A;  4UCO A;  2RF4 A;  4QL5 A;  1AE3 A;  3A5Z B;  1XTD A;  1VQE A;  2K14 A;  5IYC H;  1JB7 A;  1WCM G;  3BZC A;  5LMN Q;  2VZA A;  3UDF A;  1X3E A;  3IRB A;  5GRO A;  5LMN W;  2HIX A;  1VQJ A;  1X56 A;  1SMX A;  4A3L G;  2BA0 A;  3A5U A;  1HZ9 A;  3CCQ A;  5M5W H;  4A93 H;  5JJL A;  4DV2 Q;  1HJP A;  2H5X A;  3HOX H;  1BBW A;  4JI7 L;  3HOZ G;  3CP0 A;  3CPF A;  3K7A H;  3UDX A;  1A63 A;  1IBL Q;  4A3C G;  3NBZ B;  1EWI A;  1NY4 A;  1UE7 A;  4X62 L;  4DR5 Q;  2ZJQ A;  1TWH H;  2ASB A;  4LFC Q;  5IT9 c;  1FJG L;  3PN1 A;  5H1S E;  4KLK A;  5J3B A;  3ICE A;  4DR7 Q;  5ELN A;  4YCW A;  3KOJ A;  4HID A;  3GB8 B;  3KJP A;  1MJC A;  3S1Q H;  3RLO A;  4XTC S;  1BBU A;  3HFZ B;  3D0F A;  3TS2 A;  2AKW B;  1TWG H;  3HKZ G;  1I6H H;  3UDI A;  4LF7 L;  1B7Y B;  4X66 Q;  4IPD A;  3EN2 A;  2OWO A;  1RIP A;  3I4N G;  2B29 A;  3I56 A;  1G51 A;  1YIJ A;  1E3P A;  4KHZ A;  1SRO A;  1VQH A;  4YY3 Q;  1NMG A;  2NN6 G;  4DV5 L;  1A0I A;  2NN6 I;  2A1A A;  2PNH A;  4NXN L;  1Q1B A;  3RR5 A;  4QGU A;  2WB1 G;  3PO3 G;  2JK8 A;  3HOY G;  3PF4 A;  1AH9 A;  3RN2 A;  1AE2 A;  4JI2 Q;  1K8A C;  1VQC A;  4DV4 L;  2JA9 A;  4YCV A;  3CME A;  1YJW A;  3I4M H;  1VCI A;  1YHB A;  2DUD A;  3RLF A;  3U4Z A;  3CC4 A;  2R93 H;  1TA8 A;  1N9W A;  5EAY A;  4APV A;  4A3K H;  3PO2 H;  4OO1 G;  4OO1 I;  1YI2 A;  1XMQ L;  4UCR A;  1VS0 A;  3HOX G;  3PSI A;  4GNX C;  1I5F A;  3ERS X;  4JI4 L;  2ALY B;  1N36 Q;  5C0X J;  4BY1 H;  4DUZ Q;  1HNZ Q;  4JV5 L;  1IBM Q;  1Q81 C;  2BA1 A;  4JI8 Q;  1K73 C;  4JI5 Q;  3BZK A;  4A3E H;  1Z9F A;  3OTO L;  4PZ6 A;  2VQF L;  3NBY B;  4QIW E;  2ID0 A;  4JYA L;  1LYL A;  1VQ4 A;  2HVQ A;  1IL2 A;  3G48 A;  2AWO A;  5C4X G;  4DR3 Q;  4X64 Q;  2HIV A;  3KF6 B;  1A62 A;  4PZ8 A;  2QGQ A;  3F8T A;  3KF6 A;  4MNO A;  3ULJ A;  2HHH L;  1I94 L;  2KCT A;  4UP7 A;  1WJJ A;  1PA6 A;  5ELO A;  4EX5 A;  1NJI C;  1NTG A;  4GKJ L;  2UXB Q;  5M5Y H;  3AYH B;  1VQ9 A;  3H15 A;  4OX9 Q;  1O7I A;  2KHI A;  3J81 i;  1Q8K A;  4GN5 A;  3CC7 A;  3CF5 A;  1S40 A;  4AH6 A;  5BR8 Q;  3KJO A;  3HOV G;  4B3R L;  5FLM G;  1IYJ B;  2BH8 A;  4K0K Q;  5LMU Q;  3ER0 A;  1E24 A;  3PIO A;  2JA8 G;  4HJA A;  2R93 G;  3TEH B;  3CCL A;  2Z6K A;  3SGI A;  5JEA J;  4IJH A;  1MKH A;  3J81 j;  4QQB X;  2UUB L;  4DR2 Q;  1IZ6 A;  4GLV B;  4DV6 L;  4LFB L;  4AYB G;  1K83 H;  2UUC Q;  4HIK A;  1VQO A;  3CCJ A;  2MO0 A;  2GN5 A;  1PV4 A;  2R92 H;  3EBE A;  4DR4 L;  2LXK A;  2I5H A;  4C3J H;  4B3S L;  4A3G H;  1GKH A;  4LF6 L;  1QUQ B;  4LFA L;  1Y1W H;  1UE5 A;  5C44 H;  4UFZ A;  1QUQ A;  3T1Y Q;  4A76 A;  4LF8 L;  1HNW L;  1QVF A;  1X3G A;  2AMC B;  1N33 Q;  5JJI A;  1M1K C;  4X65 L;  2BH2 A;  3G71 A;  3S1R H;  1IBK Q;  2NZO A;  3G6E A;  2E2H H;  4A3I G;  3PUW A;  1XPO A;  4TQU S;  4JI7 Q;  5IYB H;  4LF4 L;  2N78 A;  3PUX A;  2PI2 E;  3KFU A;  5FJ8 H;  1XNR Q;  3RNU A;  4DUY L;  3AFQ A;  1SRU A; 
#chains in the Genus database with same CATH topology
 1CSP A;  4O4H F;  2GVB A;  3SE0 A;  2EIF A;  4MV6 A;  2E8G A;  1VDZ A;  2AUK A;  1B6R A;  4ECS A;  2YS6 A;  2QA4 A;  2C9O A;  2M05 A;  3V4Z A;  2FK1 A;  4HMI A;  3S2D H;  2GQR A;  4Z9C B;  2EYL A;  2ZM6 L;  1EQV A;  3HOV B;  4C3H H;  2IWH A;  5JAV A;  4E4T A;  5ELE A;  5GQO A;  3UE0 A;  4JI0 H;  2R93 B;  2PI2 A;  2ZXP A;  4JI6 L;  3QG1 A;  5JVD F;  4DV5 Q;  4JXU A;  4EVO A;  2IPK D;  3DWP A;  5LL6 X;  3HOU G;  2DPI A;  1XMO H;  4KK7 A;  4R4O A;  5IP7 G;  3Q8Q B;  2R8K A;  3NQI A;  4YIJ A;  2QW7 A;  1T9H A;  4IPG A;  3I55 A;  1U0L A;  3GLK A;  2J6T A;  3K8A A;  4A3E B;  3NUA A;  4C2M H;  3H09 A;  3K7U C;  2OT2 A;  4I65 A;  4GN4 B;  1SN8 A;  3S16 H;  5JVL A;  1C4Q A;  3F2D A;  4UCU A;  2XC9 A;  5C0X H;  4A3D G;  2F0E A;  4C1N I;  1UAP A;  1J8I A;  2A73 B;  3PW7 A;  1TWA H;  2VUM G;  4O4I F;  5DG8 A;  4QWD A;  3RUZ A;  3OTO Q;  3M4O H;  5LMN H;  4JYA Q;  3I72 A;  5M5Y B;  2G5D A;  4EGV A;  3DM1 A;  2BCO A;  5CBE E;  5CV7 A;  2VW9 A;  1VQ8 A;  1PZK D;  4ZQI A;  4R7R A;  5HUR A;  2ZXO A;  4NXM Q;  3WNZ A;  3GIK A;  2I07 B;  3FPU B;  5IYC G;  5FPO A;  2HHH Q;  3NE5 B;  1Y69 U;  1I94 Q;  3IN5 A;  1VQK A;  2QEX A;  1RJT A;  1G6Z A;  1OXS C;  2R6G A;  3J80 c;  2JA6 H;  1IBL H;  4DQN A;  1LTB D;  2EXZ A;  1KNE A;  3D8G A;  1Y1V H;  2KCC A;  2ODT X;  3DTG A;  2MNA A;  1PYB A;  1T94 A;  2I5L X;  2Z1C A;  1B9N A;  3QO2 A;  4EBC A;  2R7K A;  1A3G A;  4RNM A;  5C3E B;  5IIF A;  1BCP B;  4C3J B;  3J81 c;  1ZAU A;  5DG7 A;  4A3G B;  4X66 H;  4I50 F;  1X3F A;  1Y1W B;  2K01 A;  1E4E A;  5A35 A;  5KFR A;  2AGQ A;  1L1O B;  5HGQ A;  2KSW A;  3RIZ A;  3CMA A;  5FLX c;  5C0X G;  5M3F H;  3J80 i;  1PH9 A;  2SNM A;  1AFP A;  3VR2 A;  4JOI A;  3S17 H;  3FEW X;  3RB3 A;  4HTH A;  4KY6 A;  4LF8 Q;  4B3T L;  3TQT A;  2LSS A;  2AHO B;  4CC5 A;  4WBN F;  3SK6 A;  4X65 Q;  2A74 C;  1YNX A;  4ZLT F;  4FU0 A;  1TKW B;  5BWV A;  4DL5 A;  2R8J A;  1BOS A;  5IGE A;  4RWS C;  4HJ7 A;  4DR6 L;  3W5O A;  2VUM A;  3JZI A;  1TVX A;  1CFM A;  2Z4H A;  2F52 A;  1JE5 A;  2I8C A;  1YNN D;  3HOW B;  2I80 A;  4YY3 L;  2QB5 A;  4BWS C;  3BU2 A;  3S1N B;  4J9O A;  1PTO B;  1LTA D;  2F4V L;  5IP9 H;  3M7G A;  4JI5 H;  1XNQ L;  4JI8 H;  4A3J B;  2QYZ A;  1M90 C;  3FVQ A;  4ME6 A;  3S2H H;  4DAY B;  2AQ4 A;  4YQW A;  5DQH A;  2V4R A;  2EY6 A;  1KC8 C;  2W9B B;  4BY1 G;  3SK4 A;  4RUC A;  2N3S A;  4FXD A;  4DAV A;  3DHQ A;  1TAE A;  1RTN A;  1YHA A;  4KHP Q;  2CW0 D;  2K5H A;  3OSO A;  4YAJ B;  3WO0 A;  1JIH A;  2O03 A;  3RB6 A;  1WTX A;  1Z7T A;  3MJF A;  4HNU A;  2NVY H;  1U5K A;  4NMZ A;  3KLS A;  2R85 A;  5G3L F;  3T54 A;  3SHL A;  3J7A F;  4F4Z A;  1GGO A;  3IAY A;  1QVC A;  1HH2 P;  2XGP A;  1YEZ A;  2HVS A;  1JMC A;  1I6H B;  2R87 A;  3NC0 B;  5EWE A;  2E2D C;  2K5V A;  4NPS A;  2AWN A;  3A7A B;  5C3X A;  2JEB I;  5BWR A;  1TWG A;  3I4O A;  2EYH A;  1VQN A;  5J2T F;  2NZ1 D;  1FJG Q;  5I4D A;  1EIH A;  5D65 A;  4H7B A;  1JB3 A;  1G6P A;  4K5V A;  1SEI A;  5EPJ A;  4H13 C;  3U4V A;  3OHX C;  1SYX B;  2NUA B;  1VQF A;  2DAA A;  1EY6 A;  1B33 N;  3T1Y H;  1WR2 A;  1I7N A;  4DAA A;  3C1E A;  3HT5 A;  1LTT D;  2VB3 X;  1PH6 A;  1ESF A;  3OW7 A;  1LTS D;  4IUU A;  1IOV A;  3PIP A;  2CNU A;  3KDF A;  5J22 A;  5C4H A;  1ZHQ A;  4TSS A;  2F0Q A;  1IBK H;  1QIL A;  3G7L A;  5C44 G;  3GTJ B;  5EJW A;  1KD1 C;  2WAC A;  4P73 A;  2R7F A;  4IFD I;  4IUT A;  3I4N H;  1TQO A;  2VQE L;  5C1P A;  1OWT A;  1PH8 A;  1S4Z A;  1Z47 A;  1YBY A;  1RK6 A;  2RBM A;  1VQ6 A;  3MFG A;  4H02 A;  5BN5 A;  1B3A A;  3OHB A;  5DM6 3;  3M4Q A;  2YU9 B;  4BBS B;  4MV3 A;  3HXL A;  1WTH A;  4YR0 A;  1SFO B;  1N33 L;  3DF7 A;  4DV7 Q;  3PZP A;  4Q5V A;  2ZJP A;  3U9S A;  4JG2 A;  3MXN A;  1S72 A;  4LF7 H;  1Q82 C;  2VQF Q;  3E6Z X;  3M4P A;  1R9T B;  4GKK Q;  3K5H A;  4Q8F A;  4DV3 L;  1JWM D;  2P5Z X;  4DPG A;  1KJ9 A;  4OGQ C;  3M3Y B;  2GLT A;  1XNR L;  4UCS A;  3M9N B;  4ED3 A;  2BQR A;  4NXN H;  5JH7 F;  2IW3 A;  5GAE C;  2UXC L;  3MXP A;  1E4F T;  4KHV A;  3TRE A;  5C4X H;  3T51 B;  2EOT A;  2Y4R A;  3RB0 A;  2PQA A;  5CYU A;  5EDW A;  2W7O A;  1K83 B;  3UYY A;  2IT1 A;  2F0I A;  1MHW C;  2F0F A;  3ERQ A;  1IYD A;  2CH4 A;  3CCU A;  2EZV A;  1EKF A;  4QW9 A;  4IRD A;  4JV5 H;  1ASZ A;  2K75 A;  5KG5 A;  1SE3 A;  3R3O A;  3F2C A;  2FPG B;  3HOV H;  4LFB Q;  4LUO A;  4JOI C;  4ZUJ A;  5KFS A;  5J2U F;  4O1N A;  4P75 A;  4TM5 A;  4BBR G;  1BR9 A;  1QZG A;  4LFC L;  4HJ9 A;  2E2H A;  3OIP A;  3CHB D;  1PRT D;  1B2T A;  4LF9 L;  2L15 A;  1KNA A;  4DFA A;  3MVV A;  1X9N A;  4L5T A;  3HP3 A;  1UE6 A;  4Y7N H;  2R7Z G;  2K33 A;  2R61 A;  4BXX H;  1VQI A;  3QB3 A;  3D3R A;  5JPM C;  2RSO A;  1FYC A;  1VQA A;  4B3M Q;  5FD6 A;  1QNK A;  1ESR A;  1S5D D;  1W6K A;  4UAI A;  3VDY A;  1PZJ D;  3VNN A;  4J9R A;  2XRS D;  2HDL A;  1HNX H;  4KN4 C;  4DV6 H;  4LFB H;  4UDU C;  3GTP B;  2D62 A;  4JBW A;  4OON A;  4FM9 A;  3H4D A;  5GAD C;  2ABJ A;  4DR4 H;  3VYR A;  1SCU B;  3PF5 A;  4NDX A;  2ZM6 Q;  3WOF A;  2VA2 A;  4MV8 A;  1MGS A;  2EJ3 A;  4LF6 H;  4LFA H;  2L55 A;  3H91 A;  4A3F B;  5BWT A;  4FS1 A;  5IWA Q;  1HR0 L;  4C5A A;  5IE8 A;  5I5Y A;  4JI6 Q;  3V6K A;  1XJV A;  3PV0 A;  1Q46 A;  3X3M A;  3HOY B;  1I6V C;  4BY7 G;  4DK3 C;  4LMQ D;  2WTF A;  4JCV E;  3IG0 A;  4FO2 A;  3SI8 A;  3PW5 A;  2A8V A;  2XTI A;  4IRK A;  3GTL H;  3JAM c;  1I50 B;  5C3E H;  5DIS C;  3N40 P;  2Q2U A;  2PW5 A;  4BXX G;  3AB9 A;  1EYZ A;  3DXJ C;  3TY9 A;  4O3O A;  2DJG C;  3DLL A;  1VQG A;  1UNS A;  3RZD B;  3MFI A;  1GD7 A;  2XIG A;  2YTV A;  5KFG A;  1P8L A;  2EJG C;  2CNQ A;  2R7Z A;  5I5U A;  4OIJ A;  4G7H C;  3S1M B;  4EG0 A;  1WTV A;  5KG7 A;  4WJ4 A;  4E6I A;  1IW7 D;  1HZC A;  2E2J H;  1ASY A;  1BVS A;  1O80 A;  5F2D A;  4HNT A;  5LL6 b;  2ZJT A;  3N6R A;  5EBD A;  2B63 G;  4IHJ F;  3OYY A;  2WIN B;  2V5A A;  4EEQ A;  4O7R A;  4IUP A;  2YW2 A;  1GUG A;  2YL2 A;  4Q43 A;  3IFT A;  1EQR A;  3T9B A;  3F2U A;  1Y14 B;  5IYZ F;  5KFB A;  3HOW H;  1L2Z A;  3EIV A;  1B04 A;  3HBL A;  1RL2 A;  1PTO H;  4X62 H;  3FDT A;  1AE3 A;  1XTD A;  2CNV A;  1F9R A;  2FK2 A;  3BZC A;  3SDZ A;  2B8G A;  4NKL A;  5BYA A;  3GV7 B;  2JA8 B;  1ET6 A;  1SMX A;  5K36 H;  1ILP A;  4OO1 H;  2AUJ D;  1KEE A;  5KFK A;  2ASL A;  4HN7 A;  4HCS A;  4A93 H;  4BWG B;  1Y8N B;  3ORQ A;  4JI7 L;  1Q3L A;  4FP5 D;  1M8A A;  4CJ0 B;  2XVS A;  3K7A H;  1A63 A;  3NBZ B;  1S9F A;  1N48 A;  1ET9 A;  4GLW A;  5IT9 c;  3H40 A;  4ID6 A;  4O7Z A;  3GTG A;  3RV3 A;  1FNU A;  4U68 A;  5EKI A;  1ZKO A;  3RLO A;  1JIC A;  1BBU A;  3GTK A;  1JOK A;  2AKW B;  1I6H H;  4DV4 H;  2EY1 A;  1T5X D;  4IPD A;  5C4Z A;  3EN2 A;  1HA5 A;  2B29 A;  3R8B A;  1XMQ H;  2O5J C;  3TP5 A;  2PCF B;  4J8Q A;  1CS0 A;  4YY3 Q;  4DV5 L;  2NN6 I;  2B63 A;  1Q1B A;  4QGU A;  3G8D A;  2WB1 G;  2F0U A;  3BYT B;  3PF4 A;  1SNC A;  5FKA C;  1AE2 A;  1E2Z A;  3K58 A;  3BG5 A;  2JA9 A;  3CME A;  4R8U A;  2OF1 A;  3OIQ A;  3GID A;  4CKB A;  5KT6 A;  3CC4 A;  1G2T A;  4OO1 G;  3OMC A;  3T7A A;  4CMD A;  4ED1 A;  5KYI A;  2VPS A;  5L1L A;  3PSI A;  1I5F A;  3MR5 A;  4IUV A;  3VA7 A;  4B3T H;  1STH A;  1HNZ Q;  4M7E A;  1IBM Q;  2BA1 A;  1K73 C;  4X3T A;  3T5K A;  3HOU B;  1E4E B;  4WHX A;  2W9C A;  5J1Z A;  3OTO L;  1HQM C;  4JYA L;  4DR6 H;  1D1I A;  1TS4 A;  3Q8P B;  2FP4 B;  4X64 Q;  2HIV A;  2XSC A;  2J6S A;  4Q4D A;  3KF6 A;  4MNO A;  2YZN A;  2F4V H;  1BBX C;  3GTQ A;  2HHH L;  3A7L A;  1I94 L;  2KCT A;  1XNQ H;  3A55 A;  1PA6 A;  2XRQ D;  1KLG D;  3AYH B;  4DA2 A;  1V1P A;  3H15 A;  1O7I A;  2K5W A;  1KTK A;  2KHI A;  2N88 A;  4Q0Y A;  2A68 C;  3HEJ A;  3CF5 A;  1S40 A;  3I73 A;  1WVL A;  2VUM B;  4O86 A;  2A68 D;  4QIW A;  1WTO A;  2A6E C;  1IYJ B;  1KJQ A;  3LML A;  1E24 A;  2A6E D;  5KFA A;  3LUL A;  3TEH B;  2FMM A;  2Z6K A;  3J81 j;  4IJH A;  4QQB X;  1KDB A;  5FR9 A;  2HHF B;  4DR2 Q;  3K3V A;  1JXL A;  2WB1 A;  4GLV B;  4AYB G;  1K83 H;  4PMB A;  1VF5 C;  3H4B A;  4HIK A;  3CCJ A;  1PV4 A;  5DNF A;  1RCV D;  5C6A A;  2B2U A;  2IMW P;  5M5W B;  5C5J A;  1R4Q B;  2QKI C;  1QUQ B;  3HOX B;  2FE3 A;  2KHS A;  3A54 A;  4LF8 L;  1HNW L;  4WFN 3;  2AGO A;  1X3G A;  1N33 Q;  4R9W A;  4X65 L;  1QJO A;  5C5M A;  3S1R H;  3PQI A;  3G6E A;  4O82 A;  1EEI D;  5I5S A;  1VMC A;  3S1Q B;  5LP6 F;  1N32 H;  3KHL A;  5L1K A;  2OXP A;  1Z2N X;  1H9R A;  4RU9 A;  3NHH A;  4ED7 A;  1EKP A;  1XNR Q;  3AFQ A;  4DL6 A;  2IHE A;  5C1O A;  4ALP A;  1PH3 A;  4AQY L;  2NTS A;  5CE8 A;  1IHZ A;  2NVX A;  3FKI H;  2VQE H;  5EBC A;  4WD3 A;  2K03 A;  1KRS A;  1CKM A;  2KCM A;  3VYU A;  4KHP L;  1IKM A;  4ECZ A;  1I1M A;  2PMZ E;  1KJ8 A;  1DCZ A;  1A2U A;  1PH4 A;  2COJ A;  3DEO A;  2JEA I;  3NTH A;  2Z0S A;  1TWC B;  4B9W A;  4Y8V B;  3KDF B;  1GM5 A;  1G8Z D;  2CWA A;  1IYV A;  4AYB A;  3D6W A;  3OWE B;  2JA5 H;  3D4D A;  1PYS B;  2EQS A;  2EYM A;  2VY3 A;  3P75 A;  4BY1 B;  1TWF A;  4A3F H;  4DV3 H;  1EYA A;  2ZTD A;  2ZTE A;  5IGC A;  4RUA A;  1LT6 D;  2ICI A;  3M9M B;  2A6H C;  2J0T D;  3CQZ H;  2COG A;  4FFN A;  1V4Y A;  5I2Y A;  3U9T A;  4L5S A;  4Q8E A;  4DNT B;  3T53 B;  3V2T A;  1O7L A;  4LF9 Q;  4FFR A;  2EJM A;  5DGH A;  2UXC H;  4K2L A;  3N41 B;  5IYD H;  3GIJ A;  5COY A;  1SJE D;  1NR4 A;  1N56 A;  1CUK A;  1JCK B;  4K6D A;  4ZYS A;  3Q22 A;  3GTM B;  5CA0 F;  3U9O A;  4IUQ A;  5I60 A;  3NXW A;  4O2D A;  2HD3 A;  2FFK B;  3H3V H;  1HUN A;  4NP5 A;  4ODG A;  1CZG A;  4ZUI A;  1I4X A;  4NB3 A;  5BYB A;  2MCT A;  3Q8R B;  4LSA A;  1K0R A;  1LO5 D;  1O7Y A;  1S0N A;  2EDG A;  2ZJR A;  5HV6 A;  2Q8T A;  1KUT A;  2PQA B;  5KEE A;  1Q90 A;  2VS1 A;  4GOP A;  5KX5 F;  4P72 A;  1SNP A;  1TS5 A;  2TMP A;  2Y0S B;  4LFC H;  4C3I B;  1GVP A;  4A75 A;  3D6C A;  3MFY A;  1XPU A;  1F9Q A;  1R4P B;  1S3O A;  2K50 A;  2RHS B;  1NR2 A;  1EIG A;  4OEL B;  4DV7 L;  3GV3 A;  2RDJ A;  4A3B B;  3CW2 C;  2VQD A;  1BCP D;  5COR A;  1HR0 Q;  4KKT A;  4WRD A;  1JT8 A;  1HR0 W;  3S14 B;  4DXG A;  4GKK L;  4J1M A;  3W1G A;  4CMF A;  1S5E D;  4OIK A;  2ATW A;  4JK1 C;  2R7L A;  1LT3 D;  1XDN A;  5C0X I;  1QOH A;  4R8N A;  2E2H B;  1VF7 A;  3AQQ A;  3VYT A;  4IRC A;  1A3V A;  4GLA C;  2DNC A;  3UI2 A;  5A2Q W;  1SE8 A;  3TSS A;  2OH2 A;  5KNB A;  4LUZ A;  1PZI D;  4CC6 A;  4ZCK A;  1GJX A;  5JJZ A;  2YTY A;  2HT1 A;  1VQM A;  2Z6K C;  3I4M G;  4ZOL F;  2HDK A;  1DYQ A;  1S5B D;  3P20 A;  4A3K G;  1PTO D;  2YZL A;  4IWX A;  5FO8 B;  2JE6 I;  4JI2 L;  4QY7 A;  3C3L A;  2VL6 A;  1I4G A;  4OWT B;  4UCT A;  2WKD A;  2JP1 A;  4O2A F;  4DR3 H;  1BNZ A;  2UUA Q;  4DNR B;  3R2I A;  5JEA G;  5CV5 A;  3J7A K;  1IOW A;  1GOZ A;  4DL2 A;  2RSN A;  1NSN S;  4O7W A;  3OUZ A;  1KAB A;  1BF4 A;  5DLF A;  2FXQ A;  2EXD A;  5KFP A;  1AUX A;  3NBH A;  3W1B A;  5DQG A;  5CBA E;  1C9O A;  2F3I A;  4B3M L;  1JOR A;  2ZXR A;  5D1O B;  4BBR B;  5LMU H;  4HJ8 A;  2UU9 Q;  4A3L H;  1OO9 B;  4RNO A;  3PIO 3;  1KQS A;  2YS7 A;  4LUV A;  4DF7 A;  3H6M A;  1S0O A;  2AU0 A;  1E1O A;  5T14 A;  2UXB L;  2E5L Q;  3HRZ C;  4OX9 L;  4R4C A;  1KIX A;  1K8O A;  2KUM A;  3SNO A;  3WWV A;  1NMF A;  1SYB A;  4N9T A;  1Y8O B;  1GLV A;  1IYU A;  4L8J A;  3QFF A;  4FFM A;  4K0K L;  4O3R A;  1LLR D;  3MEH A;  2R7D A;  2R92 G;  5IWA L;  2YV5 A;  3PO2 B;  5DMX A;  3AW8 A;  1VBH A;  5D3D A;  4EYI B;  3ORR A;  5CV8 A;  2FLL A;  1B1Z A;  3PR5 B;  1EZ6 A;  2UUC L;  4YP3 A;  2FLN A;  3ONA B;  4NW2 A;  2X6G A;  2MPM A;  1KHI A;  2VOB A;  2UXD Q;  4JI7 H;  3ND9 A;  2I87 A;  3GV8 B;  4KD4 A;  2PMZ B;  2JXM B;  4EEY A;  2IJ0 A;  3PO3 H;  4YHH Q;  3QWU A;  3VR4 A;  4O7S A;  2HG8 A;  3STB C;  3CVZ A;  1J5E Q;  3MAQ A;  1EY4 A;  4J0M A;  1KL9 A;  3STB D;  2IL8 A;  4O42 A;  3PMF A;  4FF2 A;  5DGA A;  4DV0 Q;  5FJ8 G;  4IR9 A;  3JSL A;  3RN5 A;  1VQ5 A;  1SYG A;  3LNN A;  1GO3 E;  4BY7 B;  4ZRZ A;  2DAB A;  2B39 A;  1SBB B;  3FMC A;  3K59 A;  5LXT F;  3K80 C;  1K1S A;  1NNX A;  3KBX A;  3GTG B;  4DV5 H;  3NTK A;  4RFB A;  3D31 A;  4C3H G;  4XIG S;  1C30 A;  4U6P A;  3Q6S A;  4JC0 A;  4GOP C;  4LF5 Q;  3I8Z A;  3GTK B;  2KEE A;  5DGB A;  1XWE A;  1VAJ A;  5KFU A;  3K0X A;  1CKN A;  4ECV A;  4DV1 Q;  5C3W A;  2E75 C;  4F8M A;  3N8D A;  3MFH A;  5F9L A;  2R92 A;  3NSW A;  1GHJ A;  1DD2 A;  2H1E A;  4JBK A;  3WO1 A;  5KFJ A;  3S15 H;  2PQE A;  2M2L A;  4H0L C;  1WYD A;  2KOL A;  3ZJY C;  3TII A;  3OTO H;  3T5L A;  2CCZ A;  1S68 A;  3C1F A;  4CDF C;  1XPR A;  4JYA H;  1SE4 A;  3GO5 A;  3EPI A;  2E2I H;  2RDI A;  3CSW A;  1TWC H;  3Q2O A;  1K0S A;  1MI2 A;  4MAM A;  2W70 A;  2FJ2 A;  4NXM H;  1ICW A;  4K5X A;  2HHH H;  1HNW Q;  2NB0 A;  1I94 H;  1VQL A;  4EFB A;  1PH1 A;  1RHP A;  1PHJ A;  4GNX A;  3OSP A;  3EVQ A;  3BJU A;  2DZD A;  5JQG F;  1H9J A;  5EWG A;  4HJ5 A;  1WTR A;  1YNN C;  3RMH A;  2R84 A;  4ZHQ F;  2HCI A;  4R1J A;  2JA6 G;  1SNQ A;  2E76 C;  3CXC A;  2CH4 W;  5M9O A;  1N34 Q;  3GTQ B;  3QIA A;  3CEB A;  1Y1V G;  4RZQ A;  4I55 F;  4C1N K;  1YIT A;  3GTM H;  4RB2 C;  5AFW A;  3X3N A;  1QE6 A;  4AQY Q;  2Q2T A;  5CAE B;  1V1P B;  4J15 A;  2WAQ G;  2CW0 C;  1JWU D;  4LNQ A;  2V4D A;  3RB4 A;  4O7T A;  2YYZ A;  1WD0 A;  1JR0 D;  5M3M H;  3V96 A;  1EEF D;  3PGZ A;  1MJE A;  4LF8 H;  5M3F G;  1HNZ L;  4DAP A;  3VR3 A;  1IBM L;  3PUV A;  5DG9 A;  2J6U A;  1SSO A;  2JEF A;  4HR7 A;  2N8N A;  4X65 H;  4C2M A;  2DJF C;  4HED A;  4EQP A;  1RYS A;  4C3I H;  3JAM L;  5M5X B;  2BR0 A;  1F2M A;  3WWI A;  5HGT A;  4UP8 A;  2OTL A;  1E1T A;  4X64 L;  1HZB A;  2PZU A;  4A3B H;  1MZB A;  2DY8 A;  4ECR A;  3AEV A;  1KDA A;  3SE7 A;  1Q86 C;  1EY9 A;  1GUO A;  2K28 A;  1TWA A;  5D14 A;  3H3V C;  1S0M A;  1VQD A;  1V43 A;  3S14 H;  3H0G B;  5CV6 A;  3QR8 A;  5C5L A;  2Q8I B;  2C2E A;  3RZO B;  1PMR A;  3CCR A;  1ENF A;  4IPH A;  1EQT A;  2HQE A;  2A69 D;  2OQK A;  5IP9 G;  1AZQ A;  1EZ8 A;  1U4R A;  4A3M H;  1SYE A;  3T1H L;  5T1I A;  4KHP H;  4TQR A;  1WOC A;  2HCC A;  4LWC A;  5JPN C;  2NU6 B;  2LXJ A;  3PW4 A;  1PH7 A;  1QNU A;  2JA6 A;  1M6V A;  1VQP A;  2XGQ A;  5KFZ A;  2MJ8 A;  1XXG A;  4GZY C;  1DOK A;  1CTM A;  2KHJ A;  4DR2 L;  1JJ2 A;  1JOQ A;  1H95 A;  5EOY A;  1Y1V A;  2A1H A;  1TXY A;  3VYS A;  4HNV A;  1EUJ A;  2NVX B;  4Q44 A;  2IX0 A;  1U4M A;  5E4X A;  2D0P A;  1P16 A;  3IFD A;  4L63 B;  4RHS A;  4ZQ3 A;  2WAQ A;  3L4K A;  2RGR A;  4IO9 A;  1UE1 A;  5FNV F;  5I6Y A;  2RF4 A;  3KBG A;  1DM0 B;  1FJG H;  3BVZ A;  3D4W A;  2XD4 A;  2VZA A;  2XIW A;  3TW7 A;  3J81 W;  3E5S A;  4XX0 B;  1TT2 A;  4FE2 A;  2HUG A;  5TSS A;  2F1M A;  1EWH A;  2F0O A;  4DV2 Q;  4YBZ B;  2H5X A;  2JA7 B;  1ML0 D;  5FLX W;  2R8I A;  4HMJ A;  4IZO A;  4ME5 A;  3CP0 A;  5IGF A;  2WKC A;  3T16 A;  2NVT B;  3Q1K A;  1S97 A;  1NY4 A;  2ZJQ A;  4DR5 Q;  1EL0 A;  4MTK A;  1TWH H;  1C3O A;  2ASB A;  3PN1 A;  3EQL C;  3T9F A;  2PNR C;  3I70 A;  4MN3 A;  1DOM A;  3ICE A;  5ELN A;  4DR7 Q;  3JZF A;  2Z8L A;  5A2Q E;  3KJP A;  3NBY B;  4XZ3 B;  5KFQ A;  2IA6 A;  4QB4 A;  2RDF A;  3HKZ G;  3UDI A;  3TZD A;  3RV4 A;  3BZD B;  3ITP A;  4PQX A;  1QWY A;  2DPJ A;  1RIP A;  3I4N G;  1GSH A;  1YIJ A;  2L1B A;  1SRO A;  3LWU A;  4RB3 C;  4DV7 H;  3U55 A;  2IX3 A;  2A1A A;  3EFX D;  1EKV A;  1A3U A;  3KUP A;  5IOC A;  5T1G A;  3RFC A;  2SCU B;  1ROD A;  4ETS A;  1BDO A;  2K32 A;  3RN2 A;  1PDQ A;  4JI2 Q;  3KHG A;  2VQF H;  4DL7 A;  1YJW A;  4GKK H;  1IL8 A;  1ONL A;  1VCI A;  2DUD A;  3RLF A;  3U4Z A;  2NVY A;  2CVR A;  2R93 H;  4IQZ A;  3PO2 H;  1PRT C;  1SYF A;  4OL7 A;  4OO1 I;  5D8D A;  1CQV A;  5ELC A;  1WCM B;  1VS0 A;  4QWA A;  4GNX C;  3OWF A;  1CZW A;  4JI4 L;  4QWE A;  1N36 Q;  1M0W A;  4DUZ Q;  1ET0 A;  2XWB B;  1Q81 C;  3QOJ A;  4CHI A;  3MA2 B;  4A3E H;  4BS9 A;  1Z9F A;  4PZ6 A;  2ICE C;  5KT3 A;  3HOZ B;  2FK3 A;  1BO0 A;  2B2Y A;  1CM9 A;  5C4X G;  1WD1 A;  2X6L A;  4O3Q A;  5KT5 A;  4PZ8 A;  3MWY W;  1AN7 A;  2SNS A;  1HHV A;  2K5D A;  4UP7 A;  5ELO A;  4RGO S;  4O4L F;  1NJI C;  4GKJ L;  2UXB Q;  5M5Y H;  1ZEQ X;  1VQ9 A;  4OX9 Q;  3F8N A;  2EJ2 A;  3HKZ A;  3WWH A;  4GN5 A;  2ZGI A;  4EGJ A;  1AZP A;  4AH6 A;  1EOT A;  5BR8 Q;  3KJO A;  1B9M A;  2NYZ D;  3HOV G;  5DAA A;  3FDS A;  3NGD A;  5G3L D;  4EYH B;  4YB8 B;  4K0K Q;  4UUG A;  2R93 G;  1I3Q B;  3CCL A;  1CK1 A;  5CMD A;  1I2L A;  2FPI B;  5JUM A;  2X5R A;  2UUC Q;  2MO0 A;  4M1U B;  4HQ6 A;  2LS0 1;  2DN8 A;  1I6U A;  4B3M H;  4C3J H;  1SMY D;  3KXY T;  5KG4 A;  1SYD A;  2OEO A;  4A3G H;  1GKH A;  3MC0 B;  5A2Q L;  3DTF A;  5KS8 A;  1Y1W H;  2B8F A;  5EPK A;  2F3V A;  4IFD H;  4MA0 A;  1UUP A;  5NUC A;  1WSC A;  3G6V A;  3GTO B;  1QVF A;  1WH2 A;  1TY0 A;  2BH2 A;  4EGQ A;  4K5W A;  5I2X A;  2EIY A;  4K8I A;  3Q0A A;  1TWH A;  1TS3 A;  2KED A;  1IW7 C;  2OLS A;  2RCF A;  2ZM6 H;  2WE6 A;  5IYB H;  4LF4 L;  4QF4 A;  5L1I A;  2W8L A;  5IWA H;  4CKE A;  3KFU A;  1JKJ B;  3RNU A;  1II3 A;  1SRU A;  1EYD A;  4QWB A;  4JI6 H;  1EYG A;  2XCL A;  5KG0 A;  1QCB D;  3V6H A;  1PFM A;  2BQ3 A;  3DM3 A;  1PH5 A;  2UUA L;  3KYH C;  3RD4 A;  4PMC A;  3UZO A;  3S1N H;  1CI3 M;  2A5H A;  1OBD A;  5C8Y F;  1D7Q A;  4YAK B;  1RKN A;  1B3Q A;  4A3J H;  4IFD J;  3I4L A;  2L12 A;  3I4M B;  3H20 A;  4WJ3 M;  3P1H A;  4A3K B;  3TRZ A;  5KND A;  5C3E G;  1HA6 A;  2R93 A;  4C3J G;  1U9R A;  4A3G G;  1LM0 A;  1ZYR D;  1EYC A;  3GD7 A;  3ULL A;  4M9U A;  1DOL A;  1OXT A;  2RDG A;  1HTL D;  2WP8 J;  5CV9 A;  2UU9 L;  1HFN A;  5I5W A;  3NBI A;  4K14 A;  4YWL A;  2FKL A;  1XYI A;  3N42 B;  5HY6 A;  1FGB D;  2ES2 A;  2G9D A;  2E5L L;  5M5X H;  3LQS A;  5I5V A;  1BJT A;  3I2Z A;  4XDX A;  4A4I A;  4F88 A;  1I4R A;  3NP8 A;  4ZKC B;  3RUP A;  4IAL A;  4O3P A;  3TBI B;  4LSX A;  3K5L A;  3DUZ A;  3C2P A;  1VMP A;  2C5C A;  3CD6 A;  5BWX A;  4A3I B;  2YRX A;  2I0Q A;  4HIO A;  3QQM A;  2F03 A;  3E5N A;  4TVA B;  2F0G A;  2Y0S E;  2KVM A;  3U0G A;  1OXU A;  1KJI A;  2KCN A;  3HOW G;  4HIM A;  3KRE A;  1SDF A;  2SDF A;  2C2D A;  1WTQ A;  4WOR A;  2W9A A;  3PW0 A;  2ASJ A;  2UXD L;  4LW1 A;  4RKL A;  4PMW A;  2ALZ A;  5K36 G;  1V8Q A;  4DU9 A;  3ETH A;  2RCN A;  4A93 G;  2B2V A;  4YHH L;  1QVG A;  3CC2 A;  3VR6 A;  2Z9H A;  2OCE A;  4MV4 A;  5I47 A;  4J9M A;  3GTJ H;  3BA9 A;  1EIF A;  4FNF A;  2QEJ C;  1J5E L;  5IY0 A;  3PUY A;  2Q8R E;  4B3R Q;  2R92 B;  4JV0 A;  4DV0 L;  1D1K A;  1HQR D;  3GTL A;  2B2Y C;  2RDH A;  4L5R C;  3K3P A;  2WFW A;  3L9A X;  2UUB Q;  1KT8 A;  2YU9 H;  4BBS H;  1KDC A;  4TKO B;  2R7M A;  1SFO H;  3JAM W;  4JUZ A;  1VQB A;  3E9I A;  2WYO A;  4RB1 A;  1F9S A;  1TS2 A;  2KQ3 A;  3TDQ A;  4YY3 H;  1T5E A;  4XXE A;  2HGS A;  3EJI A;  4B3S Q;  2R6F A;  5JVG 3;  3M4Y A;  4LF5 L;  3OUU A;  4L6T B;  2W6Z A;  2JA7 H;  2P0A A;  3U50 C;  4IIJ F;  1R9T H;  2CQO A;  2BOS A;  3AX6 A;  4A3D B;  1JDB B;  3H3V I;  3W3A A;  1X55 A;  1F2Y A;  2NVT H;  5DGI A;  4ECX A;  3M3Y H;  1W93 A;  4DV1 L;  3K5O A;  1IXR A;  1CKO A;  5L37 A;  3URY A;  4JPB W;  3T1H Q;  4HSV A;  2IBK A;  3PUZ A;  4FF1 A;  1HNZ H;  3S2D B;  1IBM H;  1N8R C;  4C3H B;  4DUY Q;  2FMC A;  4KV6 A;  4DAY A;  1FL0 A;  3TP8 A;  5LYJ F;  3CCS A;  4F7X A;  1DJR D;  5GON F;  4X64 H;  2DWC A;  4X3S A;  3MHB A;  3NWS A;  2V58 A;  5CV4 A;  2DNE A;  1KAA A;  4LMY A;  4FVM A;  1CSQ A;  4RG1 A;  2D2C C;  3J81 E;  1E22 A;  3R93 A;  3JC6 6;  2PYK A;  5KFE A;  5KT2 A;  4KMU C;  1STY A;  2VNU D;  3OSN A;  3TQY A;  1CHP D;  3S16 B;  3BDO A;  5FLX E;  2FIN B;  1WCM H;  2KBN A;  2JQO A;  3T9D A;  2BQU A;  4MV1 A;  1PVO A;  3MZ5 A;  1JJC B;  1TWG B;  2HGX A;  5IT9 W;  1RJR A;  3N43 B;  1N34 L;  1DV2 A;  3QJY A;  5E4W C;  1JE4 A;  1HZA A;  2N55 A;  3J7Y W;  3SVM A;  3M4O B;  4DR2 H;  2NUC A;  3KHR A;  3HOZ H;  4DK6 C;  1D2B A;  4B9X A;  2D0O A;  1JOO A;  4H44 C;  5KFN A;  4JV1 A;  4A3C H;  2CWP A;  3HS0 C;  1Z2P X;  2IX1 A;  1HTP A;  3KF8 A;  1SNO A;  3A8K E;  4PG3 A;  4MHE A;  2OTJ A;  3TP7 A;  4ZI7 F;  4IWY A;  3GTP H;  4LAA A;  2C22 A;  3P7J A;  1YJ9 A;  1EY7 A;  1N33 H;  1K3R A;  4HSP A;  1LV9 A;  1Y1V B;  2LY7 A;  3BVM A;  1LAC A;  4PV1 C;  4XQN A;  4JI3 Q;  2VPQ A;  1QG7 A;  4C56 C;  4FF4 A;  5E25 A;  3WDN A;  2ZDQ A;  1TU2 B;  4MTN A;  1EU3 A;  4ED8 A;  3Q8D A;  2WAQ B;  1RJP A;  4MIU A;  1EFW A;  2JEJ A;  2J4X A;  4EQ5 A;  2W6Q A;  3GQB A;  5KFW A;  3MR2 A;  1Q8I A;  1M0T A;  1XNR H;  3T1Y L;  2AQ3 B;  2GA4 B;  5KT7 A;  3HOY H;  4RGM A;  1NE3 A;  4BA1 I;  4DR1 Q;  3I12 A;  2VA3 A;  4JI4 Q;  2VXW A;  1SFO A;  4MV9 A;  3M4I A;  2HVR A;  3QZ8 A;  4R4Q A;  1IBK L;  3MXN B;  1LTL A;  2KEN A;  1I50 H;  3S17 B;  3KLS X;  4RCO A;  2AQ1 B;  3Q23 A;  4YR3 A;  4HAE A;  1UEA B;  3FP9 A;  4X3K A;  2SEB D;  1SEB D;  1E7Z A;  4FXK C;  1SLJ A;  2KJX A;  3FKI G;  3RZD H;  3GTO H;  3A8J E;  4AIM A;  1L0Y B;  3J7Z C;  3CPW A;  4DKA C;  3J80 L;  4UPA A;  4J9L A;  1JJG A;  3S1M H;  4A2A A;  1XTC D;  2B2V C;  4GKJ Q;  4O83 A;  3JRX A;  1K8G A;  4KY7 A;  4FGR A;  3BQ2 A;  2L4N A;  2K52 A;  4G4K A;  4JVZ A;  1KRT A;  5KRU A;  5KNC A;  3J81 L;  2R3Z A;  1K83 A;  2ZTC A;  1C7Y A;  2JA5 G;  1BCP C;  3BDC A;  2Z04 A;  4GLX A;  4LF9 H;  4A3F G;  5KFY A;  4JI1 Q;  4M8A A;  3S24 A;  5FLX L;  1EUD B;  4DV2 L;  4K8J A;  1L1O C;  5BN3 A;  5C44 B;  3MXU A;  4CGY B;  3F1Z A;  4YWM A;  3TIG A;  4OWX B;  4IJL A;  5FLM H;  1B50 A;  2COI A;  4NZN A;  2NVY B;  4FFO A;  5EGT A;  5IYD G;  4DR5 L;  2JA8 H;  2EY5 A;  2C28 A;  3KLR A;  4DR7 L;  4TUY F;  4O0A A;  5DLQ E;  1VKZ A;  1YJN A;  3U58 A;  2V4Q A;  4L1K A;  2FHT A;  3LP8 A;  3EPG A;  3AMU A;  3BQ0 A;  3CCE A;  4QMG A;  3CCV A;  3GII A;  4KKU A;  1PTO C;  2WV6 D;  4X3U A;  4LF4 Q;  2RA4 A;  3FKI A;  3RAQ A;  3K5M A;  1G2W A;  3G6X A;  3DWA A;  1Q7Y C;  4FYD A;  1HR0 H;  4GN3 B;  5D3I B;  3B6Y A;  4A3I H;  4IPC A;  1AUV A;  2WB1 E;  2W6P A;  1DZ1 A;  2MP1 A;  3MTS A;  1FVI A;  2AQ2 B;  4K2K A;  3HKZ B;  4GC6 A;  3M85 A;  3VA5 A;  4MTE A;  2QIL A;  4RZR A;  4MTD A;  1Y8P B;  4QUF A;  5I5X A;  4V0B A;  3RAX A;  2NWG A;  4IOA A;  5CR3 A;  3I4N B;  4ILW A;  5KFI A;  1B6S A;  1N36 L;  4I4T F;  2JA5 A;  5HNE A;  2I46 A;  4DUZ L;  3ULP A;  2RHQ B;  4RCN A;  4FFP A;  1HNX L;  3CQZ A;  5K5P A;  3G4S A;  1I1L A;  4UHV A;  3UE1 A;  1I4P A;  1OXV A;  1X6O A;  3ND8 A;  3SEB A;  1L0W A;  4N8F A;  3J7A V;  2IP4 A;  3HOU H;  2DIK A;  4A2B A;  1V1Q A;  5IP7 H;  1SND A;  3PW2 A;  4CHT B;  4JI0 Q;  1IKL A;  4ED6 A;  2MQH A;  5KYL A;  5ELB A;  4PDB A;  2Z4I A;  1LT5 D;  2UUA H;  2BDN A;  2R7Z B;  4P74 A;  5DM7 3;  3K81 C;  5BR8 L;  1CA5 A;  2FB9 A;  2Q2H A;  1XMO Q;  3U54 A;  3N52 A;  1HRJ A;  1G29 1;  3UZB A;  2IHF A;  3OMG A;  5F9N A;  2XNA C;  1EHI A;  3RGX A;  1Q1E A;  1CT1 D;  3KAJ A;  4A3D H;  4N8X 1;  5EZY F;  1HPC A;  1TY2 A;  3T99 A;  1QZH A;  1W2B A;  2VUM H;  5CR5 A;  2RQX A;  4AYB E;  4OWW B;  3RGZ A;  2NBF A;  1WTP A;  4QJF A;  4UY8 C;  2UVW A;  1CQJ B;  1PX2 A;  2UU9 H;  2PVP A;  5KFX A;  4QL5 A;  3A5Z B;  2K14 A;  5IYC H;  1JB7 A;  5LMN Q;  3L3O C;  5CM0 A;  1VBG A;  3UDF A;  2F4I A;  3NWT A;  3IRB A;  5GRO A;  5LMN W;  2E5L H;  4A3L G;  3A5U A;  2F3W A;  5M5W H;  4KD3 A;  3HOX H;  1ULZ A;  4MA5 A;  3JAM E;  3W2D A;  4DK1 A;  5C4J B;  2BE5 C;  1IBL Q;  4CDC C;  5K3W A;  2M9V A;  4X62 L;  1E2W A;  4Y7N B;  2BE5 D;  1W6J A;  3PIP 3;  2NU7 B;  5H80 A;  5J3B A;  2O2L D;  2VB2 X;  3S1Q H;  1E0B A;  3K5I A;  1EFI D;  4XTC S;  3D0F A;  1D5Z C;  3TS2 A;  2UXD H;  1TWG H;  4GC7 A;  3SR1 A;  5CGK A;  4X66 Q;  2Q7D A;  2ASD A;  2OWO A;  5JQW A;  1H9M A;  2GPS A;  4YHH H;  2D9U A;  4RGT A;  2EPB A;  1G51 A;  3HZX A;  1DAA A;  1J5E H;  4CJ2 C;  4QUC A;  5JOB A;  3LWB A;  2NVQ B;  2B63 B;  4RH6 A;  3RBE A;  2PNH A;  3RR5 A;  4DV0 H;  1A6X A;  3PO3 G;  4U67 3;  1K8A C;  4R8U B;  1VQC A;  4DV4 L;  4YCV A;  3PFF A;  2YCH A;  2EYF A;  1BXR A;  4RAZ A;  1TA8 A;  1RD9 D;  3GQC A;  4K6L A;  1YI2 A;  2F0T A;  1XMQ L;  4ABN A;  5KFO A;  5BN4 A;  3HOX G;  4F4Y A;  4LF5 H;  1SXT A;  1E4G T;  3T56 B;  1V51 A;  5C0X J;  1BUV T;  4BY1 H;  1Z2O X;  3GTL B;  1ENC A;  2YZM A;  3TQ1 A;  5JVH 3;  4JI8 Q;  4JI5 Q;  2W9C B;  3BZK A;  3S9W A;  5DAU A;  1FD7 D;  4DV1 H;  2ID0 A;  5ISR A;  4J9K A;  1T36 A;  3G48 A;  2AWO A;  3H94 A;  5IT9 E;  4KTA A;  4QWC A;  1D6E C;  2CQA A;  3KF6 B;  2F0V A;  2EYO A;  2QGQ A;  5L9X A;  1BXT A;  1HXY D;  1GSA A;  2YYA A;  3ETJ A;  4XYL B;  3M9O B;  2HDM A;  4I7A A;  1WJJ A;  5KFT A;  1CHQ D;  1GUN A;  1C48 A;  1NTG A;  4EX5 A;  2E2J B;  4TVI A;  5E1F A;  1FR3 A;  1PRT F;  3J81 i;  5ELD A;  4RNN A;  4QIW B;  2ZT9 C;  4XYM B;  1QB5 D;  1DV1 A;  2B2T C;  4B3R L;  1DIK A;  3AU7 A;  4TV9 F;  1HNW H;  2BH8 A;  3PIO A;  4APM A;  2F0S A;  3SGI A;  1MKH A;  2WB1 B;  4ZAI A;  2UUB L;  1IZ6 A;  4O81 A;  4QSH A;  2GQS A;  2HHF A;  1GSO A;  1UC9 A;  1PLF A;  4M0J A;  4I7H A;  4KY5 A;  5FO9 B;  1ZQ7 A;  1PFB A;  1VQO A;  2TSS A;  2L9H A;  3R2T A;  1WRV A;  2XN9 C;  1STA A;  3EBE A;  2LXK A;  4DK0 A;  2I5H A;  4RAY A;  2HGW A;  4B3S L;  4A93 B;  1BQQ T;  4DGZ A;  1N34 H;  3ZYY X;  1UE5 A;  5C44 H;  1QUQ A;  3T1Y Q;  2F0W A;  4DN4 M;  3TW6 A;  3K7A B;  1M4V A;  2AMC B;  4AQY H;  2A69 C;  4RHR A;  4LK1 C;  4I7Z C;  3Q8S B;  1A2T A;  5KKN B;  3G71 A;  2RVL A;  2NZO A;  1IBK Q;  2E2H H;  4F4X A;  5KGU A;  4N9P A;  3PUW A;  3BVG A;  1H9S A;  1HUM A;  4TQU S;  3TME A;  3R9R A;  2J7Z A;  4DL3 A;  1BGW A;  2PI2 E;  1O7Z A;  1A3T A;  4NLG A;  5KFH A;  4JV2 A;  4DUY L;  1STG A;  4NZM A;  5M3M G;  5KFV A;  3IL8 A;  3J80 W;  5AJ3 L;  5BMV F;  2PPB C;  3K57 A;  4O7N A;  2VUG A;  1EOV A;  4V19 0;  4XQJ A;  4YWK A;  3BDL A;  2GVA A;  2X0S A;  3KF8 B;  4LF7 Q;  2Y0S G;  4RA8 A;  4C3I G;  1N32 L;  1J6Q A;  3BAC A;  4OEM B;  1I4H A;  1LAB A;  3EA6 A;  2W71 A;  5CA1 F;  4FDB A;  3L0O A;  4A3B G;  2E2I A;  5IOD A;  4DAM A;  2MUY A;  1IYE A;  3VMM A;  1TWC A;  2Z02 A;  3UDG A;  4NXN Q;  4E6N A;  4AYB B;  1K9M C;  3DAA A;  1X65 A;  1CQI B;  5IT9 L;  3R23 A;  1TWF B;  2JN4 A;  4ECT A;  1B44 D;  2QDL A;  4KN7 C;  2W7P A;  2KEC A;  2RKS A;  2IY5 B;  4A3M G;  3T9A A;  5FPR A;  2QCP X;  3L7Z C;  1AN8 A;  1PXU A;  4EBE A;  1FGU A;  4TV8 F;  3V6J A;  4G7O C;  2K05 A;  2C35 B;  2D5D A;  5KFD A;  1EWC A;  4BBR H;  4JV5 Q;  2EJF C;  3DWQ A;  3K6O A;  3GTM A;  3NQT A;  3CKI B;  2LMC B;  1L0X B;  5EKK A;  1FNW A;  1TR5 A;  4HCE A;  1X3Q A;  5E3F A;  2L11 A;  4TRD A;  4JI3 L;  3TEK A;  4IN3 A;  1SYC A;  2R7Z H;  1RF2 D;  4DV2 H;  1SAP A;  1Q12 A;  4JBJ A;  2MFI A;  4YCU A;  3GDE A;  4GOP B;  1G91 A;  4MZ9 A;  3BG3 A;  1D5X C;  4J9N A;  3K5N A;  4CDE C;  1EUC B;  3GV6 A;  1X32 A;  4DR5 H;  4DR1 L;  4F87 A;  2Y0S A;  3GP7 A;  3BJY A;  4DR7 H;  4KJO A;  3OHA A;  4O4J F;  5KG2 A;  1DGS A;  4XYQ A;  3LGJ A;  2CKZ B;  1HNX Q;  5DEH A;  4DV6 Q;  2CFM A;  1GUS A;  1JC7 A;  4C5C A;  4POF A;  4O2B F;  4DR4 Q;  3S1R B;  1XK5 A;  5K2M A;  1OXX K;  3HO8 A;  4LF6 Q;  2YWV A;  4LFA Q;  2YZG A;  1MIU A;  2LKV A;  2YRW A;  4BY7 H;  4JI2 H;  4XT3 B;  1UWV A;  5D1P A;  5C4J H;  3BAB A;  3DEP A;  1LTG D;  3HB9 A;  1WTW A;  1X54 A;  3O13 A;  2PW7 A;  5BWW A;  3GTG H;  2XGT A;  1GUT A;  4CKC A;  4UP9 A;  2MO1 A;  2O5I C;  3FKI B;  1K28 A;  1LUZ A;  2K4K A;  3GTK H;  1W96 A;  4ECW A;  4JI1 L;  4DNI A;  1N36 H;  4DUZ H;  3PO2 G;  2RGV A;  5GAH C;  4EBD A;  4PWQ A;  5I9O A;  3E3X A;  1KAW A;  3KLW A;  4ECQ A;  4IZ8 A;  1AEX A;  3I7F A;  1V9P A;  1SMY C;  3TS0 A;  1LTI D;  1G2S A;  3OOC A;  2MHV A;  3T13 A;  3J7A 5;  4QW8 A;  1F9P A;  2YTX A;  2NVQ H;  2B63 H;  4A3E G;  4QCL A;  4LH7 A;  3MWM A;  1YZ6 A;  4O7L A;  3NUC A;  2F0J A;  1V1O A;  2JA5 B;  3MR6 A;  3NPP A;  1F77 A;  2MGS A;  1A48 A;  2B3G A;  2N49 A;  3EYY A;  4J9Q A;  2UXB H;  4NZO A;  4OX9 H;  1MD2 D;  4UCV A;  4FBU A;  1UC8 A;  3NBH B;  3CQZ B;  3NEN A;  5EQ0 A;  5BR8 H;  3NEL A;  5CC4 A;  1DON A;  1LTR D;  2PZW A;  2KA7 A;  2K5Q A;  1A8V A;  4DR3 L;  1CA6 A;  4K0K H;  1T3N A;  5D1O A;  1ENA A;  2AGP A;  4X62 Q;  4G57 A;  3UQ8 A;  2R82 A;  5FK9 C;  3MWD A;  1K1Q A;  1ZET A;  2XWJ B;  1U4L A;  4RMF A;  3RBD A;  1PFS A;  4IOC A;  2UUC H;  2K5N A;  1F2Z A;  3PR4 A;  4PNY A;  3R5X A;  2WAQ E;  1EIY B;  2F0P A;  3OW2 A;  2JYO A;  3GTQ H;  3BA8 A;  5KFF A;  4TQS A;  3BYY B;  3FHW A;  3GV5 B;  2Z6B A;  3TY5 A;  1F2L A;  5LMU L;  1KC7 A;  4HN2 A;  3A74 A;  2X69 A;  1KXL A;  2CZG A;  1ZYR C;  3JAM i;  1K8M A;  3T5H A;  1HCZ A;  1S5C D;  3CRK C;  1Y1W G;  3TN2 A;  4Y52 H;  4IFD G;  2ENB A;  2PZT A;  3WWJ A;  1DXM A;  3TZU A;  3PCO B;  4ECY A;  4DV4 Q;  1A15 A;  1M7J A;  1NCV A;  2DGY A;  2F0L A;  1C0A A;  2PMZ A;  1I7L A;  4CE5 A;  2CW8 A;  1XMQ Q;  5IGB A;  4ECU A;  5IYB G;  4JI0 L;  1L2F A;  3KHH A;  4JBM A;  5JJK A;  4RB0 A;  2B2W A;  2M00 A;  3ERO A;  1YVC A;  2V1C C;  3BQ1 A;  1XMO L;  1MSH A;  4DRF A;  4Q0F A;  2QDB A;  3E0E A;  3HGB A;  1S03 G;  3FMA A;  2FMA A;  3H0G H;  5BPF A;  3RZO H;  1UEB A;  2K1B A;  3MWE A;  2UVU A;  4BA2 I;  4EFE A;  2CQY A;  3DMU A;  1JWS D;  3M9B A;  4XT1 B;  2O4X A;  4ME3 A;  4A3J G;  1YHQ A;  2QK4 A;  1HFG A;  5ELF A;  3TP6 A;  3KTM A;  2EE1 A;  4L5Q A;  4B3T Q;  3GJX B;  1Z6H A;  5GAG C;  1RTO A;  1CKN B;  4ZK9 B;  4P71 A;  4POG A;  1OTC A;  1GXD C;  5LMN L;  3D4R A;  4YJ3 F;  4DR6 Q;  1B70 B;  3CAM A;  1I4Q A;  2E74 C;  5E7N A;  4GS3 A;  5FOB B;  5IGD A;  2NVX H;  1ZXT A;  4R4T A;  3VPC A;  4YR2 A;  3FPP A;  2F0M A;  2F4V Q;  1YNJ C;  2A19 A;  2SOB A;  3MR3 A;  1K3B C;  1XNQ Q;  1Y1W A;  2XCP A;  1YNJ D;  1L1O A;  3BAA A;  3KAL A;  3NK9 A;  1IBL L;  3L2P A;  4O7Y A;  1MSG A;  5HBR B;  3A0J A;  4B08 A;  2ZDH A;  4J9P A;  3HKS A;  3C0F B;  1PRT B;  3QOL A;  3LWE A;  4KJN A;  2FJZ A;  3H0G G;  1TWF H;  4GNX B;  4X66 L;  3HKZ E;  3TY8 A;  3CRL C;  1NBW A;  2V59 A;  3JZ6 A;  3GIP A;  1PFN A;  5KFL A;  4IR1 A;  2JJQ A;  3CCM A;  1BCP F;  1SR3 A;  4Q45 A;  4DXF A;  3GIM A;  4B3R H;  2R7N A;  1WFQ A;  4IUN A;  2WDT A;  4NXM L;  1STN A;  1XX8 A;  5EWF A;  1EZ1 A;  3E9H A;  1EY0 A;  3JRW A;  2UUB H;  3J80 E;  2NU9 B;  4PZ7 A;  3N6X A;  2EVB A;  5AJ3 Q;  2NZH A;  2W9B A;  4S3S A;  4FBT A;  4ZKB B;  1BNC A;  2NTT A;  1CQF A;  3AFP A;  1D8L A;  5LL6 S;  4B3S H;  2ZDG A;  4BBS G;  1N32 Q;  1E2V A;  1MBY A;  1B8A A;  2HQL A;  4OXP A;  3M7N A;  4R8I A;  4MV7 A;  4C5B A;  3RJ0 A;  4HR7 B;  4JI5 L;  4JI8 L;  4C2M B;  4X6A H;  5I9P A;  4JW0 A;  3PO3 B;  2R8G A;  3NEM A;  1BKB A;  1W3S A;  2JA7 G;  1PTO F;  3T1H H;  3VPD A;  1KJJ A;  2VQE Q;  1I2K A;  3QZ7 A;  1VQ7 A;  4G7Z C;  3GIQ A;  1EQQ A;  3UFX B;  3RLN A;  1TWA B;  4DUY H;  4O84 A;  1S5F D;  4RGN A;  4WJW A;  5FO7 B;  3H0G A;  2Q2I A;  1ILQ A;  1NAP A;  5BPH A;  3MEF A;  5EPL A;  2JSO A;  4OHJ A;  4FS2 A;  1PH2 A;  3L4J A;  4O3S A;  5KG6 A;  2L5T A;  3V4S A;  1H9S B;  4EQN A;  3F2B A;  5KG3 A;  2JA6 B;  4G3I A;  4DV3 Q;  1ZHS A;  2R8H A;  2WII B;  3Q24 A;  2F0K A;  4R4I A;  1CE8 A;  2CHB D;  3RF2 A;  3OPO A;  2LFN A;  4LH6 A;  4O7V A;  4KI0 A;  4P2C B;  3RTX A;  2F0H A;  4U7C A;  2I5M X;  3GTJ A;  3TIN A;  1GYF A;  1ICF B;  1WI5 A;  2UXC Q;  4CBV A;  4IAJ A;  3I90 A;  4KKS A;  3KK7 A;  1AW7 A;  2J9G A;  1FKA H;  3S15 B;  3JSN A;  2NN6 H;  4F50 A;  4Q4C A;  1I3Q H;  1NUC A;  2OQ0 A;  4UCO A;  1EU4 A;  1VQE A;  2B2W C;  4IUR A;  4XQQ A;  1WCM G;  2W6M A;  2FLP A;  2UVR A;  2YU9 A;  2C00 A;  4HYK A;  5M3F B;  1X3E A;  2HIX A;  2E2I B;  1VQJ A;  1X56 A;  1I1K A;  2BA0 A;  4J6H A;  1HZ9 A;  3CCQ A;  1FNV A;  2JEG A;  5JJL A;  4NYE A;  1UNN C;  1HJP A;  4ED0 A;  1BBW A;  4FF3 A;  2JA7 A;  3HOZ G;  1JDE A;  1H9K A;  3CPF A;  3UDX A;  4RKB A;  3G6Y A;  1R9T A;  1GHK A;  4A3C G;  1EWI A;  1UE7 A;  2CW7 A;  4LFC Q;  1FJG L;  5LOV F;  3VPB A;  4JI3 H;  5H1S E;  4KLK A;  1EY8 A;  4YCW A;  3KOJ A;  2A6H D;  1PYW D;  4HID A;  1MJC A;  2PN1 A;  3GB8 B;  3HFZ B;  1EY5 A;  5LA6 F;  3T4A C;  2VR1 A;  4LF7 L;  1B7Y B;  1U4P A;  1RDP D;  2H4O A;  2C2R A;  2K7V A;  3S2H B;  3I3C A;  3A8I E;  3I56 A;  4DR1 H;  1RK5 A;  3PVX A;  1E3P A;  4KHZ A;  4F4W A;  4JI4 H;  2F0N A;  3GIL A;  2PO4 A;  1VQH A;  3IKJ A;  1NMG A;  2NN6 G;  1A0I A;  4NXN L;  1OBG A;  5I5T A;  1KBL A;  5M3M B;  2JK8 A;  3HOY G;  1AH9 A;  1A9X A;  3T5J A;  1J9O A;  1B4O A;  3I4M H;  3E0J A;  3KAK A;  1YHB A;  3VOT A;  1PK8 A;  1N9W A;  5EAY A;  4APV A;  4A3K H;  1KTA A;  3K0Y A;  4DIM A;  2QF7 A;  1B53 A;  4LJZ C;  4CJ1 B;  1STB A;  2F0D A;  2GPW A;  4UCR A;  3VR5 A;  1O78 A;  2EJ0 A;  2W8K A;  3LX0 A;  1WCM A;  4J9S A;  3ERS X;  2EYP A;  2XCA A;  5L1J A;  1RJQ A;  2ALY B;  3HG9 A;  3G8C A;  2W57 A;  4GKJ H;  4JV5 L;  4K6N A;  3T9C A;  5JEA H;  1RYR A;  5KG1 A;  4ULL A;  2VQF L;  2EY2 A;  1C8C A;  4QIW E;  3SXH A;  1LYL A;  1VQ4 A;  2HVQ A;  4YJ2 F;  1IL2 A;  2EYJ A;  5KIX A;  3V05 A;  4DR3 Q;  1JLL B;  2UVV A;  2DY7 A;  1A62 A;  3R5F A;  5FD5 A;  4JI1 H;  1GUW A;  3ULJ A;  3F8T A;  4A3M B;  3C46 A;  1S10 A;  2JEI A;  3SK5 A;  3QWN A;  2DLN A;  5DLG A;  3GTP A;  2G9H D;  2PBZ A;  2L0C A;  1LT4 D;  1Q8K A;  3T9E A;  3CC7 A;  1JQY D;  3CU7 A;  4FXG C;  4DLK A;  2BDO A;  5FLM G;  2V9W A;  1SNM A;  1X3P A;  5LMU Q;  2B2T A;  2HJW A;  3ER0 A;  4CDD C;  4HJA A;  2JA8 G;  4ED2 A;  2K04 A;  5JEA J;  5BWU A;  1I3Q A;  2ATL A;  3MXG A;  5KFM A;  4DV6 L;  4LFB L;  5I6W A;  1SJH D;  2B2U C;  4PBC A;  2K6A A;  2GN5 A;  2R92 H;  5EKL A;  4LF4 H;  4DR4 L;  1O75 A;  5DQI A;  1JX4 A;  3BS1 A;  2FPP B;  3R5H A;  1I50 A;  5KFC A;  4LF6 L;  3G6J B;  1D5M C;  5J39 A;  4LFA L;  4FFL A;  4XYO A;  2W6N A;  4UFZ A;  4A76 A;  4O3N A;  3N44 B;  5JJI A;  3GTO A;  1M1K C;  3NTI A;  4EQO A;  5LHY 1;  2R86 A;  1TWH B;  3I91 A;  5IGG A;  4A3I G;  2W6O A;  4DL4 A;  5CB4 F;  2NU8 B;  1TII D;  1XPO A;  1KLU D;  3A56 A;  4JI7 Q;  5C4X B;  2N78 A;  1STE A;  3PUX A;  4RAU C;  1AP0 A;  3WOE A;  3FRP B;  1A0G A;  1SE2 A;  5KT4 A;  5FJ8 H;  3SK8 A; 
#ch