1P8LA

New crystal structure of chlorella virus dna ligase-adenylate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
296
structure length
276
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNFGYEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIRHEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PBCV-1 DNA ligase
publication title Analysis of the DNA Joining Repertoire of Chlorella Virus DNA ligase and a New Crystal Structure of the Ligase-Adenylate Intermediate
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase
total genus 64
structure length 276
sequence length 296
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1p8lA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1p8lA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1p8lA01
2A19A 3ULJA 4DV4Q 2VZAA 5FJ8G 1QVCA 2KBNA 4AYBE 5GADC 3EN2A 3G48A 3STBD 2JE6I 4BA2I 1VCIA 4YCVA 2HVQA 4HJ9A 3U4ZA 3JSNA 1UE1A 4KHPQ 1TWCH 2B63G 3K7UC 2E8GA 4UPAA 3EBEA 3H3VH 1E3PA 4PZ7A 3NBHB 4X62Q 4YWKA 4HJ7A 4DAMA 4KLKA 3PIOA 3J81c 4TVAB 1LTLA 4AYBG 3CCRA 4LWCA 4A76A 5ELOA 5LMNW 4GNXA 2AKWB 2ZM6L 1KL9A 3GB8B 5LMUQ 1N32L 4R4IA 1S3OA 5D1PA 4R4QA 2NVXH 4A93G 1WI5A 1N33Q 4A3BH 1JJCB 2PI2A 4GKJL 2AWOA 1BBWA 1Q8KA 1X3EA 3L7ZC 3PUVA 1VQ9A 2PMZE 4LF9Q 4R1JA 4JI3L 1P8LA 3TEHB 1GD7A 3EIVA 1X6OA 2B29A 3U58A 1B70B 1GO3E 1U0LA 1X3FA 5IT9c 5ELNA 3CCQA 2L15A 5IE8A 3W1BA 1VQKA 3TREA 2Y0SE 4IFDJ 1L1OB 3KDFB 2E5LL 2JA5G 4JBMA 3CPWA 4GOPB 3ICEA 3NC0B 1VQPA 2XTIA 3HKZG 4HJ8A 4DR1Q 3PO2G 1K8AC 1NTGA 1XNQQ 4LF8Q 1PH5A 4YWLA 1PFSA 4DV3Q 3T1HQ 1KHIA 3KJPA 4A3IG 1YIJA 1PH4A 4LF4Q 4UCTA 3S17H 2HT1A 4A3GG 4EQ5A 3CC7A 3RLFA 4JI5Q 2CQOA 2OWOA 1HR0L 3BU2A 2IY5B 4P71A 4DV5Q 4HIOA 3S24A 4L5TA 5E7NA 4LFCL 2N78A 1HNWL 4J15A 1KIXA 3BA8A 4C3JH 2IX1A 1OXUA 4DR2L 3OW2A 1QVFA 4HJ5A 3I4NH 3S1MH 1PH6A 1Q7YC 1L1OA 1BKBA 2CWPA 3KDFA 1YEZA 4GOPA 3TY9A 4B3SL 2R7DA 4OONA 3OTOQ 1VQEA 2BA0A 4A3EH 2VUGA 2UXBQ 2I5HA 3F8TA 1VS0A 5FLMH 3J81j 1N34Q 3TY8A 1IYJB 4YHHQ 4DR7Q 1CSPA 1SE8A 3JAMc 4YY3L 1WJJA 2VQEL 1NE3A 5C4XG 4GS3A 5IP7H 3KLWA 4YWMA 1EFWA 1QZHA 1LYLA 2UXDL 2UUAL 3GTOH 1SRUA 2ZJRA 4DR4Q 2NN6G 1WCMH 1PYBA 1NBWA 1XNRL 1IL2A 2K5HA 3AQQA 3RN5A 4WJ3M 2YTXA 4DKAC 3TS2A 3PSIA 3NEMA 3UDFA 4EX5A 1KQSA 1G51A 3RLNA 1X56A 1A62A 3PO2H 1EUJA 1I50H 4NXNL 1Q46A 4A3KG 1A63A 1P16A 1RL2A 2AMCB 2CKZB 3I7FA 3JSLA 1S68A 1W2BA 4DV2Q 4P72A 4A3IH 1XMQL 3GO5A 2R93H 1JJGA 3HOUH 3CCUA 1X54A 4A3GH 1E1TA 1XTDA 1G291 4GN5A 4OO1G 3D31A 1VQFA 4JI4Q 1VQ4A 4IPGA 3T1YQ 1IBMQ 3RTXA 1H95A 2R7FA 1SN8A 4NXMQ 2IHEA 3CCSA 3U4VA 3VDYA 3TS0A 1PH2A 4TQUS 3ZJYC 2N49A 1M90C 2BH2A 3I4MG 4X62L 1E7ZA 3STBC 5AJ3L 3F2BA 2YU9H 1K3RA 3RN2A 1MJCA 1K83H 3E9IA 5JJKA 2D0OA 1X65A 3GTKH 1CKNB 1CKMA 4ALPA 3CCMA 3M4QA 1HZ9A 5IYBH 5LMUL 4UY8C 1VQHA 4LFAQ 5D1OA 4JBJA 5C0XI 1KRTA 2JA9A 1TWHH 5FPOA 4EEQA 3RNUA 1VQJA 3KOJA 3A5UA 4H02A 1YHQA 1OTCA 3LGJA 1J5EQ 4LF9L 1HZAA 2KENA 2KHIA 3NENA 4DPGA 5M5YH 4QJFA 2HQLA 4DV6Q 1PH8A 1EIFA 2EXDA 3AYHB 1JB7A 1J6QA 4HIMA 3HOZG 4PMWA 4UCSA 1VQ7A 1FVIA 3J7ZC 1T9HA 4JI6L 2HIVA 4MNOA 2PQAA 2A8VA 4GLAC 4DRFA 2ATWA 4JCVE 4POFA 3OYYA 2ALYB 4BBRH 3I55A 1KD1C 1CKNA 3K80C 3J7A5 1D8LA 1FGUA 3I56A 3BABA 1C0AA 4DV3L 3T1HL 1G6PA 4R4OA 4DR3L 4DR6Q 5C44H 3RR5A 1X3GA 1N36Q 3J80i 1HR0W 3UDXA 3M4PA 4BY7G 1AE2A 4JI5L 2JK8A 3U50C 4C3HH 4LF5Q 4GN3B 4DV5L 1YHBA 4KI0A 4BY1H 4A3FG 3GTLH 1B04A 1UE5A 1C9OA 2F4VQ 1K8GA 3A0JA 4IPHA 2UUBL 1FJGQ 1VQDA 4IPCA 3F1ZA 4GN4B 1V43A 1Z47A 2WFWA 4OWTB 1HZCA 1NMFA 3A74A 1I5FA 2WB1E 3KF6B 4PG3A 2ASBA 3NBYB 3PN1A 1NMGA 5M3MG 2IX0A 1KRSA 2EIFA 3S1NH 4BBSG 2UXBL 3ERSX 1WFQA 4X64Q 3HKZE 1HZBA 2JEAI 1N34L 2R92H 4YHHL 4DR7L 5IYDG 5GAHC 3GTGH 4DUZL 1YI2A 1OXVA 4A4IA 3AEVA 1GM5A 3L0OA 1OXSC 1A0IA 3G4SA 1N9WA 1PH9A 4DR4L 2QA4A 2I5LX 4JI7L 2KCMA 1PYSB 3ULPA 3B6YA 2WB1G 1IBKQ 3H3VI 3HOWG 4BXXG 1I94Q 2K5VA 2RF4A 3CXCA 2MFIA 4LFBQ 2ZTCA 4XIGS 2VUMG 3GTPH 1JMCA 1XPOA 5M5WH 5FJ8H 1YJWA 1A8VA 4KHZA 5JEAG 2UXCQ 4WJ4A 3E0EA 2I0QA 2ZJQA 2CCZA 4LF6Q 4L5RC 4LUZA 5M3FG 2B63H 1VQLA 4LF7Q 3G6EA 4K0KQ 2RHSB 4JI4L 1IBML 3T1YL 1EYGA 1HH2P 5GQOA 4RMFA 4B3RQ 1XK5A 4A3FH 1K9MC 4OXPA 4DUYQ 3CQZH 4IFDI 3MEFA 3K81C 1Q81C 1IBLQ 2OQKA 5BR8L 1UE6A 4JYAL 1SLJA 5M3MH 2UUCQ 4UCVA 2WAQE 1D7QA 2V1CC 4FDBA 4LH7A 1V1QA 4JI1L 1XPRA 3PV0A 2UU9Q 4A93H 2PNHA 4JV5Q 1YZ6A 4ME3A 5IYCG 2RCNA 4OX9Q 1YBYA 4DV0L 2N3SA 1Q86C 4JI8L 4LFAL 4A3CG 2D62A 3PUXA 2IHFA 1L0WA 3RLOA 3IRBA 5GAEC 3HOYG 4A3LG 4QGUA 2NVQH 1HNXQ 3I4OA 2VQFL 2NVTH 3HOWH 3CCLA 1QUQB 3CAMA 4BXXH 2Z6KC 2WAQG 5J3BA 3UDIA 3UDGA 2K75A 2JA5H 4GKKQ 1X55A 1BVSA 2K14A 3CMEA 4DV6L 4JI0Q 3AFPA 3S2HH 3PUWA 5DISC 3A5ZB 2ZM6Q 2LXKA 2MNAA 3H0GG 2LXJA 1KC8C 1VQ6A 4HIDA 2JA8G 2IT1A 3KJOA 4DV4L 5JEAJ 4HIKA 4A3MG 4LUOA 3CD6A 4DV1Q 3FKIG 1BBUA 3GDEA 1MKHA 4LW1A 1N8RC 1VQ5A 2VNUD 1VQOA 4KHPL 4JI3Q 1SFOH 4UP7A 2MO1A 1KAWA 2YTVA 3FP9A 2YV5A 2DUDA 1NJIC 1N36L 4JI7Q 2BH8A 2K5NA 4DV7Q 3ER0A 3I2ZA 4POGA 1OXTA 1EOVA 4DR5Q 1EIYB 4L5SA 2NZHA 4A3DG 1QUQA 3CCVA 2F4VL 4JC0A 2XGTA 5DLQE 1EQRA 4PZ8A 2VW9A 1FJGL 2E2IH 2NZOA 2K50A 5GROA 1Y14B 3J80c 1XMOQ 1ASZA 1Y1WG 1TWFH 2ZTDA 2KCTA 3KF8B 3RZOH 5C4XH 5IYCH 4X64L 1I6HH 1O7IA 4A3CH 4PZ6A 3GJXB 1N33L 2HIXA 1HR0Q 2LSSA 2HVSA 2E2HH 3UQ8A 1SMXA 2JEBI 3M85A 2YTYA 5FPRA 1X9NA 1TAEA 1SR3A 1VQBA 3CF5A 1LUZA 4L5QA 4CC5A 2QEXA 1ASYA 4EFBA 2GVAA 2C35B 3H0GH 4A3KH 1UE7A 5C3EG 5LMNQ 4JBKA 4LFBL 2HVRA 1E22A 1AE3A 4DR1L 1EWIA 2JA8H 2FXQA 4E6NA 1U5KA 4IJLA 4A3MH 1IZ6A 3SGIA 2VY3A 3DLLA 4LF8L 3CW2C 2YYZA 1XNQL 1CSQA 3MXNB 3FKIH 5HGQA 2UXCL 4JG2A 2MQHA 2Q2IA 4LF4L 4LF7L 4K0KL 3CPFA 1Q1BA 1Q1EA 2WP8J 5FLXc 2NVYH 1XNRQ 4P75A 4A3DH 1PH3A 3HOVG 2NN6I 3I4MH 1PHJA 2N8NA 3KYHC 4B3MQ 1HJPA 4DUYL 1TWGH 3BZCA 2CFMA 4LUVA 5JJLA 3PIPA 2HHHQ 4NPSA 1LM0A 1IBLL 4NXNQ 3HFZB 3UE0A 4IO9A 4IOAA 4JBWA 3GTQH 4UP9A 2OCEA 3OTOL 1XMQQ 1WYDA 1HNZQ 3M4OH 4B3TQ 1YVCA 4QY7A 2OTLA 1YJ9A 2UU9L 3F2CA 5M5XH 4UP8A 4JV5L 1GVPA 4DK6C 1TXYA 4OX9L 4O2DA 4OO1I 1B8AA 3BJUA 2JA6G 2B3GA 2F3IA 3CP0A 3S1RH 1HNXL 4YCWA 5AJ3Q 4AH6A 3PUYA 3HOZH 3DM3A 3PF5A 4GKKL 1DGSA 2VL6A 1K73C 3I4NG 1JE5A 4O0AA 3W5OA 5C3EH 2AWNA 4JI0L 1MIUA 1W3SA 4X65Q 4UCUA 3UE1A 4Y7NH 1S72A 4LH6A 3BA9A 3KF6A 3VNNA 3HKSA 4YCUA 4A3EG 4DAYB 4AIMA 2QGQA 1OXXK 5FLMG 2Q2UA 3PF4A 1XPUA 4DV2L 4AQYQ 1CKOA 3WWVA 1QVGA 1KXLA 3S15H 2F52A 4OWXB 5IP7G 4DV1L 4IOCA 4BY7H 2JJQA 3HOVH 2AHOB 1SROA 4B3RL 2GN5A 4NXML 1WOCA 1WCMG 4JOIC 4DV7L 4LNQA 4DR5L 3K7AH 5IWAQ 4C2MH 4HJAA 2R7ZG 4JI2Q 1NY4A 1YHAA 4APVA 4R4CA 4X66Q 4JI6Q 2KHJA 1VQMA 4DK3C 2VS1A 2Q2TA 1XMOL 1UWVA 1B7YB 2CWAA 1C7YA 3KFUA 1PA6A 4BBSH 4C3IH 2MO0A 3Q8DA 5C0XG 1E1OA 5IYDH 1TA8A 4DR3Q 5IY0A 2R93G 4GLXA 1VQGA 3HOUG 3K8AA 2OQ0A 3J81i 1VQCA 3H15A 3M7NA 2OTJA 2JA6H 2Y0SG 3S16H 1L2FA 3HOXG 2DGYA 4BA1I 1PV4A 1J5EL 2UUBQ 4Y52H 4NB3A 4MTNA 5HY6A 1XDNA 3AFQA 5IP9G 4A75A 1YJNA 4QIWE 2VUMH 3BAAA 1I3QH 5LMNL 2EQSA 1N32Q 4UFZA 2PI2E 1K0RA 1Y1VG 3L2PA 5M3FH 2BA1A 3PGZA 4DUZQ 4A3JG 1QZGA 5IYBG 1Z9FA 4GKJQ 2K4KA 1RIPA 4QL5A 1CUKA 2ES2A 3M3YH 2K52A 4DR6L 1AH9A 2RHQB 1VQ8A 3NELA 1Q12A 3TQYA 4IJHA 4LF5L 3GTMH 1M1KC 1VQNA 1EQQA 2R6GA 2R7ZH 2JQOA 2E5LQ 4B3ML 1YITA 1VQIA 2JA7G 5EAYA 2HHHL 5JJIA 3JC66 3RZDH 1E24A 3NBZB 4P73A 3PO3G 4GNXC 1HNZL 4IPDA 4P74A 3GTJH 4B3TL 4BBRG 2ZJPA 5D1OB 4CC6A 1TWAH 5C0XJ 4XTCS 3CCJA 3D0FA 5C44G 3HOYH 1YNXA 4A3LH 3E9HA 4DNIA 4LFCQ 3HOXH 4JOIA 4UCRA 1HNWQ 1UEBA 1FL0A 2A1AA 3JAMi 3ULLA 4UCOA 4BY1G 5IP9H 3K0XA 4DR2Q 2ZTEA 3BZKA 5H1SE 4R4TA 1IBKL 3CC2A 1JT8A 2Q2HA 5BR8Q 3S14H 2I5MX 4JYAQ 1XJVA 2D0PA 1I94L 3QWUA 4B3SQ 3TY5A 1Q82C 4OWWB 2PQAB 2GVBA 3W1GA 2Z0SA 4X65L 4RG1A 4JI1Q 1V9PA 3F2DA 3GD7A 3CCEA 1Y1VH 2ID0A 4A3JH 4YY3Q 2E2JH 2VQEQ 4GLVB 1S40A 3S1QH 1VQAA 4X6AH 3PUZA 4DV0Q 2R92G 3PCOB 4JI8Q 4EFEA 4LF6L 4AQYL 1MJEA 1PH7A 4A3BG 3S2DH 2UUAQ 2UXDQ 5GAGC 1R9TH 3M9BA 1GKHA 3CMAA 1PH1A 2VQFQ 2H5XA 2Z6KA 3FHWA 1IXRA 4IFDG 4QQBX 3CC4A 1JJ2A 1PVOA 2JA7H 5K36G 5IWAL 3TRZA 4JI2L 5C4JH 3G71A 4GNXB 1L1OC 4X66L 1Y1WH 4MZ9A 4GOPC 2UUCL 3PO3H
chains in the Genus database with same CATH superfamily
3C46A 3ULJA 1EWCA 2NB0A 2KBNA 3NSWA 4GLWA 1XMQH 4BA2I 4NMZA 4YP3A 2H4OA 2K04A 5C4JB 3KTMA 2B63G 1JOQA 3NGDA 2E8GA 2FFKB 3EBEA 1K83A 3ERQA 3MR6A 4BBRB 1SYGA 1Y1VA 1GOZA 5CORA 5BWXA 5JVDF 5KS8A 3NBIA 4GZYC 4PZ7A 5CYUA 5EBCA 3C2PA 4KLKA 2YZLA 1EY5A 4C3HB 1L2ZA 4A76A 2GQSA 4R8UA 3IAYA 4MTEA 4X65H 4ED0A 2HCIA 3DEPA 1S3OA 2M9VA 5I60A 4A3BH 2JA7A 1VKZA 2K5QA 4AQYH 4QCLA 1BBWA 1X3EA 1EYCA 1VQ9A 5KFEA 4LF9Q 5L1IA 5L1KA 4NLGA 4JI7L 1X6OA 1B70B 1VAJA 5EWEA 5T1IA 5K36H 3R2TA 1L1OB 4IZOA 4JBMA 4GOPB 3TMEA 1DONA 3M9NB 3HKZG 3UI2A 5IWAH 4M8AA 4I7AA 4DR1Q 2FPPB 1W6KA 5FOBB 4LF8Q 2N55A 3T5LA 1ZHSA 4LF4Q 4DL3A 2B2YC 4A3GG 4EQ5A 3CC7A 3GTPB 2YWVA 2YZNA 4DR3H 4JI5Q 1RYSA 2R8KA 3T9AA 4P71A 4NKLA 2CNUA 4HIOA 2A5HA 5L1JA 3BG5A 4C3JH 3GTGA 5KFBA 1Q7YC 4IHJF 3SK8A 4DAAA 2WYOA 4A3EH 3FPPA 1DM0B 2BA0A 2UXBQ 1QNUA 1VS0A 3F8TA 3MFYA 4QWAA 3CQZB 1H9SB 4YHHQ 3NP8A 4MIUA 1CSPA 1SE8A 5ELCA 3JAMc 2UXBH 3A7AB 4YY3L 5C4XG 4YHHH 1RODA 3I4LA 1EFWA 1KDAA 4Q5VA 4DUZH 4ED1A 1BCPC 2UUAL 2ZJRA 4R8NA 1B3AA 3W3AA 2A6HD 5FKAC 4A93B 4WJ3M 3RN5A 2EYOA 1YNJD 2B63A 1KQSA 1B6SA 1O7ZA 5EPJA 5DM73 1DV2A 3U55A 1Q46A 2WB1B 2CKZB 2XC9A 3I7FA 3HRZC 1DOKA 4P72A 4TV8F 3S2HB 5KFGA 2JEGA 1UC9A 1X54A 4A3GH 1KAAA 4GN5A 2Y4RA 5BYBA 1VQFA 4FM9A 1VQ4A 4IPGA 1IBMQ 3D8GA 1C30A 1SN8A 1IBMH 5JVG3 4A3IB 5CE8A 5JUMA 4J8QA 3KXYT 1FGBD 5BWUA 1PH2A 4TQUS 1F9RA 2RKSA 4HN2A 5AJ3L 1I1MA 2YU9H 1LACA 2K6AA 3E0JA 4JYAH 3RN2A 2RDJA 3E9IA 1F9QA 5JJKA 2RQXA 1K0SA 5KFZA 4EBDA 3K6OA 4ALPA 3CCMA 3NXWA 3R5HA 5IYBH 3RAXA 4UY8C 2E2IB 4JBJA 3HKZA 5C0XI 4XYMB 4IUPA 1CT1D 1VQJA 3OOCA 3A5UA 5E4WC 1HCZA 4H13C 5D8DA 5CM0A 1I2LA 2Q7DA 3GQBA 2KHIA 3FMCA 1FR3A 2DWCA 3NE5B 4EEYA 5I5XA 4QJFA 4DV6Q 1MSHA 4K5WA 2F0PA 2EE1A 4PMWA 4RHSA 1VQ7A 4DV6H 3KAJA 1T9HA 1O7LA 2A8VA 3WO1A 2PQAA 2WAQB 1QJOA 1GHKA 1S5CD 3OYYA 2ALYB 2R8HA 5LL6b 1PXUA 1K8MA 4RB0A 5DLFA 3BABA 3E3XA 4DV3L 3T1HL 3W2DA 4DR6Q 2WKCA 4QUFA 1AUXA 4BY7G 1L0YB 4L1KA 4QWEA 1EZ8A 4A3MB 4ZQ3A 1YHBA 3H94A 4BY1H 1A3UA 4A3FG 3GTLH 2AUKA 1EY6A 1FJGQ 3SK4A 1HUMA 4GN4B 3NHHA 4HQ6A 3OPOA 1CQIB 1KJQA 4PG3A 1JR0D 3Q0AA 2W6OA 1KRSA 2EIFA 3NQTA 1TWGB 1PTOF 4Q4DA 5KFNA 3HKZE 1N34L 5K3WA 1YI2A 4HNTA 1OXVA 1LTSD 1OXSC 1N33H 3GTQB 2K28A 3D4RA 3G4SA 3BQ0A 2HGWA 3K57A 3ULPA 3C3LA 2AUJD 3K5OA 1PTOD 5G3LF 1SNDA 2K5VA 3L4KA 1K28A 4XIGS 5FJ8H 1YJWA 1A8VA 4KHZA 4DFAA 4WJ4A 3E0EA 2I0QA 2ZJQA 2CCZA 4LF6Q 5C3EB 3G6EA 1U4PA 3T1HH 2RHSB 1UNSA 3T1YL 5BPHA 4RZRA 5I5TA 4RMFA 1XK5A 4ED7A 4A3FH 1K9MC 1G91A 3GV5B 2AGQA 3MC0B 1M8AA 4X3SA 2IX3A 2EY1A 5BR8L 5KG4A 3UZOA 4MV9A 2F0EA 2L4NA 3AU7A 1D7QA 2V1CC 4LH7A 1RK5A 4FVMA 4XQQA 5KIXA 1XPRA 4O2AF 3J7AK 4EQOA 4JV5Q 4LFAL 4JV5H 5FO7B 3BVGA 2EJ3A 3KHLA 1IYUA 4J9NA 3CAMA 2Z6KC 4GKKQ 5TSSA 1RJTA 2WKDA 2JA5H 2EPBA 4E6IA 1BVSA 1EQVA 3CMEA 2JA6B 1IYEA 3A5ZB 4B9XA 1JC7A 4ECRA 2ASJA 3P1HA 3H0GG 5KG5A 3J80W 4CBVA 2NVTB 1VQ6A 5A2QE 1JORA 2IT1A 1LT3D 4WBNF 3BG3A 5FD5A 4N9TA 4LUOA 3CD6A 4DV1Q 3N40P 3GDEA 1N8RC 1MKHA 4GC6A 2C2EA 4KHPL 4JI3Q 1N36L 3P75A 4DV1H 3FP9A 3ZYYX 2YV5A 2DUDA 5BYAA 2BH8A 4DV7Q 3I2ZA 5M3FB 2NUAB 2MJ8A 4JV1A 5EWGA 1QCBD 1QUQA 1QILA 2F4VL 4DV7H 2XGTA 4DL2A 1EQRA 3OIPA 2K05A 2W6PA 4P2CB 1XMOQ 4TSSA 3Q22A 5KFHA 1TWFH 1UUPA 1BXTA 4N8FA 3K3VA 4HEDA 3V6HA 5KFJA 4DA2A 5J2UF 4ECVA 1WTVA 1HPCA 3V4SA 2HIXA 2LSSA 3WOEA 5IIFA 2RCFA 1I3QA 3M85A 1X9NA 1O7YA 4CC5A 4DXGA 1KLUD 2BDOA 3VR6A 2C35B 2PO4A 3K5IA 3H0GH 1CQVA 1UE7A 5LMNQ 3I12A 5L9XA 5LL6X 2UVRA 1SNOA 1AN7A 4EYHB 1QB5D 3Q8PB 4E6NA 2EOTA 5LMNH 4FF4A 1U5KA 2AQ2B 3KF8A 3CW2C 2YYZA 2QK4A 1CSQA 4IIJF 4O42A 1S0MA 3RB0A 2BQUA 5F2DA 4JG2A 4RGMA 5HGTA 3VPDA 4K0KL 3J80E 1Q1EA 2WP8J 2WTFA 4A3JB 1TWFA 5DQGA 1N36H 4DNTB 3QB3A 3TZUA 1PH3A 2OXPA 3BZCA 4E4TA 2CFMA 2F0LA 3RF2A 1IBLL 2DN8A 3SDZA 2HDMA 1ZYRD 4DL7A 3OTOL 2FJ2A 4QWBA 4B3TQ 4G7HC 2SNMA 4MHEA 5FO8B 4UUGA 4UP8A 2F3WA 1O78A 3H0GA 2EYHA 2KCNA 3EQLC 1JKJB 2MHVA 4ODGA 2RGRA 4QF4A 3S1RH 1HNXL 2KVMA 3D4WA 4YCWA 2PNRC 4MV3A 4O83A 4YAJB 3I4NG 2AWNA 1MIUA 4DL6A 4Y7NH 2B39A 1S72A 1CA5A 4LH6A 3KF6A 3HKSA 2Q2UA 3PF4A 1OXXK 4KN7C 2GPSA 3BACA 4U6PA 4XYQA 2TSSA 1PTOB 5FK9C 4DV2L 1QVGA 4IUTA 3S15H 1AZPA 2XCAA 1PZJD 5KG0A 2F0UA 2W57A 1F2YA 1SROA 4IRDA 2GN5A 2C9OA 1HHVA 1WOCA 1WCMG 5M9OA 2NVXB 4CDDC 5BWWA 4RWSC 4C2MH 1NY4A 1YHAA 4X3KA 4JI6Q 3J81L 2CNQA 2R85A 4DL5A 1MBYA 2Q2TA 4BBSH 3KFUA 2W9CA 2UUCH 5ELEA 4C3IH 1EOTA 5KFXA 4LAAA 4ZYSA 4RAUC 3Q8DA 5NUCA 4O3QA 4K5VA 2A6EC 3U9OA 2R93G 3HOUG 3M7NA 1VMPA 1VQCA 3VYRA 3T5KA 4ECYA 4FF2A 1JB3A 2Y0SG 4Q4CA 1H9RA 2DGYA 1PV4A 3P7JA 2Q8IB 1J5EL 4Y52H 4FO2A 1WTQA 4ED2A 4MTNA 1EIHA 2Q8TA 2HDLA 1KNEA 5IP9G 1HNXH 5JPMC 1YJNA 1JOOA 4NW2A 3BAAA 4MA5A 1V51A 2K5WA 5JEAH 4IALA 2ABJA 2ZM6H 4ID6A 3T9FA 2BA1A 4C2MA 2K4KA 4QL5A 5DQIA 1CUKA 2A69C 2K52A 1XWEA 3QOLA 4G7ZC 3TW6A 1Q12A 4LF5L 1AUVA 5DG7A 4O2BF 4RCOA 5CMDA 2B2VC 4QWDA 3H4BA 3KAKA 1HUNA 4HCSA 4K2KA 3K59A 1E24A 4P73A 5I5WA 1HNZL 5D1OB 4P74A 4PMBA 4ZOLF 4BBRG 4YQWA 2XVSA 1TWAH 3FDTA 1DIKA 4J0MA 1EY0A 1STGA 4DK0A 5KFTA 1ENCA 3HOYH 2DPIA 1Z7TA 1SAPA 4IUQA 2FKLA 4KTAA 4C3HG 5DLGA 2YRWA 5IP9H 3V4ZA 2ZTEA 4LJZC 2FB9A 1BCPD 3S14H 4CGYB 3EROA 4J9QA 1I94L 3QWUA 2G5DA 2Z1CA 5CB4F 4RG1A 2VB2X 4JI1Q 1WCMA 3GD7A 2E2JH 4O7RA 2VQEQ 4DV0Q 4JI8Q 5HBRB 4EFEA 1MJEA 2UXDQ 1E4FT 3QJYA 1B6RA 2AU0A 2FMCA 2UXDH 5KGUA 4KKSA 3GTKB 2O2LD 2KUMA 1S10A 2CH4A 2PN1A 4IFDG 2PMZA 3WO0A 2R93A 5DMXA 2PBZA 1TWHB 1JJ2A 5LL6S 3HB9A 2Y0SA 3J81W 3HGBA 5C4JH 1GUSA 3G71A 4JI2L 1Y1WH 4X66L 1F2ZA 5EKKA 5M5YB 2A19A 3T7AA 4DV4Q 5KFKA 2VZAA 2L11A 4AYBE 5GADC 3G48A 1STYA 1HNZH 2DNEA 2RSOA 2JE6I 1VCIA 1YNNC 4YCVA 4M9UA 2R84A 1UE1A 1TWCH 1GSHA 3PO3B 4UPAA 2KHSA 2WV6D 2E2DC 4RGNA 1LLRD 3NBHB 3DTGA 4Q0YA 2R8JA 3MAQA 3PIOA 1HA5A 3FRPB 4LWCA 4QIWA 4GNXA 4TQRA 4JXUA 1KL9A 1N32L 4HTHA 4A93G 5EBDA 2JYOA 2PI2A 5KFIA 1SYFA 4GKJL 1Q8KA 4JVZA 2F0VA 2PMZE 3S1NB 4XYOA 4PDBA 5E4XA 3TEHB 1GD7A 2R92B 1B1ZA 4DK1A 3PFFA 2EJFC 5IT9c 3T4AC 1JCKB 4CJ1B 5IE8A 2FMMA 3VA7A 3CVZA 2Y0SE 3PW4A 3CPWA 1TWCA 4HJ8A 3H20A 2QKIC 4KV6A 2Z8LA 4RB1A 4IURA 1XNQQ 3HZXA 2K1BA 2PW5A 5BMVF 3QG1A 1PFSA 4A3IG 2B2UA 1PH4A 4FFRA 5AFWA 3S17H 5KG2A 1DOLA 1STNA 3RLFA 5GONF 2OWOA 1HR0L 3BU2A 3TP6A 5M5WB 4DV5Q 4LFCL 3TSSA 2N78A 3N41B 4DV5H 5JVLA 3BA8A 4DR2L 3S1MH 2UUBH 1QVFA 1L1OA 1BKBA 1S5BD 2CWPA 3L9AX 4GOPA 4H44C 3TY9A 3GIPA 3BQ1A 4B3SL 2R7DA 4XDXA 2VUGA 1VQEA 2SCUB 4L63B 3J81j 5ELFA 2XIGA 2SOBA 4I7ZC 4KK7A 5KEEA 4DR7Q 4XX0B 4DR7H 3KLWA 4YWMA 4RAYA 1QZHA 4DR4Q 1SRUA 3GTPA 5KFWA 3AW8A 5I5UA 5C3XA 1XNRL 3TP5A 2K5HA 3AQQA 2RGVA 4EVOA 3TS2A 3PSIA 3GV7B 4EX5A 5ISRA 5KNBA 2R8IA 1K1SA 3MR3A 4ECTA 1EKFA 3KHGA 4ECWA 1PLFA 4NXNL 2NVQB 1A63A 2DAAA 5T14A 1RL2A 2AMCB 4O86A 1JXLA 3VR4A 3X3NA 5C0XH 4HMIA 4A3IH 1XMQL 3T16A 4HN7A 1SCUB 3CQZA 1JJGA 1Z2PX 1EU4A 3CCUA 1E1TA 1G291 1I50B 2B8FA 3ITPA 3RTXA 2LKVA 2R7FA 2IPKD 2NWGA 4NXMQ 2IHEA 3BQ2A 4MV4A 3U4VA 4LFCH 3TS0A 1U9RA 1D5XC 1V1PB 2V4DA 4Q8EA 2N49A 4XQJA 1ESRA 4FFNA 3STBC 5J22A 4DR2H 3D6CA 3EA6A 1K3RA 4OEMB 1SFOB 2D5DA 3QFFA 1UC8A 3R2IA 2O5JC 1U4RA 1MJCA 1K83H 2QILA 2ODTX 4MV1A 4CJ2C 1T3NA 2D0OA 1X65A 1GUOA 1CKNB 3SNOA 3M4QA 3TIIA 1HZ9A 1VQHA 1BCPB 2O4XA 2P0AA 3T54A 3N6XA 4TV9F 2MGSA 4G7OC 2FMAA 4FF3A 5FPOA 3VR3A 3KOJA 1H9JA 1KABA 4EQNA 3IN5A 2P5ZX 4LF9L 4HSPA 1HZAA 2KENA 3A8JE 2F0HA 4LMQD 2VQFH 1CK1A 3ND9A 2EXDA 2LS01 1SEIA 2EYPA 3J7ZC 1EKVA 1EL0A 3KHHA 1SYBA 1N48A 4MNOA 4DRFA 2HG8A 3OSNA 2ATWA 4JCVE 4C56C 1A3VA 4CMDA 2K5DA 3K80C 1D8LA 1C3OA 3R5FA 4DR3L 4A3KB 2E2IA 5C44H 2RA4A 1HR0W 2JA8B 4JI5L 3KLRA 3I3CA 1PK8A 3CKIB 4NDXA 2RVLA 1UE5A 2F0WA 3A0JA 5I9PA 3K5MA 2Z02A 3KLSA 3VOTA 5KT2A 2KA7A 5KFAA 2B8GA 2NVYB 2WB1E 2ASBA 1NMGA 2E76C 5M3MG 3I4MB 5BWVA 2J7ZA 3N6RA 2UXBL 4X64Q 1HZBA 4YHHL 2EZVA 2Z6BA 1KT8A 3GTGH 1LT5D 4DUZL 3AEVA 3L0OA 1A0IA 2VXWA 2XCLA 1W6JA 2FP4B 3T9DA 1N9WA 3M4OB 5K2MA 1PMRA 2I5LX 4ULLA 2HCCA 2F0OA 5ELBA 5FLXL 2QA4A 2YL2A 4LF9H 1HTLD 5M5XB 2UVWA 1IBKQ 3HOWG 3U54A 2F4IA 3RJ0A 4K5XA 3DWPA 2V9WA 2D2CC 4LFBQ 3TIGA 1SYXB 3SI8A 4IRCA 1DOMA 4LFBH 3VR5A 4DR1H 2UXCQ 3HOZB 4F4YA 4LF8H 5KFPA 5M3FG 2B63H 1VQLA 4OELB 3M7GA 4LF7Q 3L4JA 1S0NA 4LF4H 1IBML 3GTQA 1EYGA 5GQOA 4BS9A 3WNZA 4JI5H 4DUYQ 4HAEA 3N52A 1X32A 1BQQT 4IFDI 2MUYA 5IGEA 3K81C 4DXFA 1Q81C 3F8NA 4JYAL 1SLJA 5M3MH 2WAQE 2F0JA 2R7KA 2CW7A 4YR3A 2VQDA 4RNMA 5KT5A 5IYCG 2RCNA 4OX9Q 2N3SA 2I8CA 2ASLA 4OX9H 2FHTA 3PUXA 3R5XA 4RA8A 5GAEC 4A3LG 3BDCA 4QGUA 3K3PA 5DNFA 4CKEA 3HOWH 2AQ1B 2NVTH 3K5HA 4O4LF 5J3BA 3T53B 3UDIA 5IT9L 5JJZA 5IGFA 4DV6L 2K14A 4JI0Q 2W9BB 1GUTA 2VB3X 2WIIB 4CHTB 3S16B 1AZQA 1LTRD 4JI0H 2LXJA 2Z9HA 5CAEB 3U9SA 2YRXA 5CV7A 5JEAJ 2B2WA 1SBBB 5IGCA 4HIKA 1WTHA 2VUMB 2NU8B 3FKIG 3QR8A 4LW1A 1VQ5A 1RCVD 5JPNC 4TVIA 2W6QA 1BDOA 2L0CA 5DG9A 4UP7A 2MO1A 4JI7Q 2L1BA 4V0BA 2XIWA 4IAJA 2K5NA 4O82A 2AQ4A 2OT2A 3WWIA 1H9MA 1FJGL 3BJYA 1HQMC 2K50A 1AFPA 2KEDA 1KTAA 2CNVA 2ZTDA 2LMCB 5I6WA 1G2SA 1E0BA 4X3UA 3RZOH 1I2KA 2WE6A 5C4XH 5IYCH 1BNZA 4PV1C 1I6HH 1O7IA 5I6YA 3GJXB 1N33L 5FD6A 5E1FA 3J7AV 2HVSA 3RB4A 2E2HH 1SMXA 2JEBI 1G2WA 5FLXW 1TR5A 3LX0A 5FPRA 3GTJB 1TAEA 3VPBA 1NSNS 1EY4A 1LUZA 1CS0A 4O3RA 5LYJF 1Q8IA 5I4DA 1ASYA 3BS1A 2GVAA 2J6UA 4JBKA 2FK1A 2HVRA 4OGQC 4J9OA 4FXDA 1HA6A 1EWIA 2FXQA 3V96A 4C5BA 2XWJB 1MD2D 5HGQA 3FKIH 2COGA 4ZUJA 1RF2D 3MR2A 4ZKBB 2KCCA 2K01A 1Q1BA 2W70A 4DR6H 3TN2A 3L3OC 1SDFA 3S1QB 4P75A 4WJWA 3HOVG 2V5AA 2VPQA 1Y8PB 2O03A 2N8NA 1HQRD 3S2DB 2EYMA 5LHY1 4LUVA 3PIPA 2HHHQ 5KFYA 1A2UA 2ZDHA 1FJGH 2E2HA 4IOAA 4JBWA 4MV8A 5EZYF 2KEEA 2F0TA 3RFCA 1S97A 1LT4D 3EVQA 5I5SA 3KUPA 2F3VA 4QY7A 2OTLA 4ED6A 5BWRA 4JV5L 2RSNA 4EBEA 1TXYA 5I9OA 4FFPA 1A3TA 5F9NA 2MCTA 4RB2C 4PNYA 2F3IA 3CP0A 4EGQA 5CV5A 4KMUC 4PWQA 5IT9W 3BYTB 3FKIA 5AJ3Q 2XGPA 3PUYA 5C4HA 4GKKL 2VL6A 2KOLA 1K73C 4O7LA 1JE5A 3CRLC 3T99A 5EOYA 1W3SA 2NU6B 1JQYD 3I91A 3UE1A 2HHFA 4DQNA 3PVXA 2EXZA 1WTOA 3GV8B 5FLMG 2L12A 4NZOA 1XPUA 1GUWA 3WWVA 3Q2OA 4M0JA 1IW7C 1ET6A 4LF6H 4Z9CB 5IP7G 4DV1L 4BY7H 1N56A 5DAUA 3N42B 1CE8A 5G3LD 1BXRA 3HOVH 5KFQA 5LOVF 1ET9A 3N44B 4JOIC 4DV7L 1YNND 4A3BB 2C5CA 2F0KA 1M6VA 5DGIA 3PW7A 4APVA 1JWMD 4RZQA 1B2TA 1M7JA 1VQMA 4DK3C 2VS1A 1XMOL 2VOBA 1B7YB 2CWAA 2C22A 1PA6A 3K7AB 2MO0A 3NQIA 4J1MA 3RGXA 4GLXA 4XT3B 1VQGA 1CI3M 4JK1C 4CMFA 2IJ0A 3PW5A 1Y69U 3DF7A 2EJMA 4RAZA 1ZETA 4FFOA 1KC7A 3SE7A 3NPPA 4YIJA 2NVXA 4EBCA 5HY6A 2M00A 3BVZA 1GJXA 4GKKH 1HXYD 1GSAA 4MV7A 1I3QH 1T36A 3CEBA 5LMNL 3R23A 2EQSA 4Q44A 3P20A 3UYYA 4C3JB 1K0RA 1QZGA 2J6TA 4IWXA 4KY5A 1RIPA 2JSOA 5KFOA 3M3YH 4EQPA 4A3EB 1PZID 2ES2A 2RDHA 1GYFA 2CVRA 3GTMH 4IJHA 4JI3H 1EYAA 1Z2NX 4NP5A 1EQQA 2DPJA 2HQEA 2E5LQ 3H91A 1A6XA 1NNXA 1VQIA 2E5LH 4FP5D 4L6TB 2JN4A 2WDTA 1KEEA 3QZ8A 1NUCA 3WDNA 3RZDH 2EIYA 3NBZB 1CQJB 2R7ZB 3PO3G 1XMOH 2XN9C 4B3TL 3JAML 1LT6D 5C0XJ 1WR2A 2KJXA 3CCJA 3LP8A 2IL8A 3D0FA 1GLVA 1YNXA 4J9MA 5IGGA 3E9HA 5C1OA 2I87A 1HNWQ 1UEBA 1FL0A 2A1AA 2EVBA 1DXMA 5DGBA 1E4EA 4A3GB 4UCOA 3MWYW 3K0XA 5H1SE 1RJRA 1JT8A 5BR8Q 2I5MX 3IFTA 4K8JA 1Q82C 3HOXB 2PQAB 4CKCA 3V6KA 3GTMA 3A7LA 1V9PA 5EQ0A 1SYDA 4MTKA 4KD3A 3F2DA 3CCEA 2ID0A 4K6DA 1PZKD 5KG6A 4GLVB 4X6AH 4QW8A 1VQAA 4APMA 2OH2A 2YU9B 2W71A 2MPMA 3PCOB 2R92G 1E2ZA 1PH7A 3BZDB 1CHPD 5EKIA 4KKTA 1PDQA 1T94A 3I72A 3OSOA 1ZAUA 1TS2A 1S9FA 3CC4A 1V1OA 1RK6A 3M4YA 1ILPA 1CM9A 1R9TB 3TRZA 5D3IB 4F87A 1A0GA 5KFCA 2UUCL 3PO3H 1A48A 4G4KA 4KJNA 2R87A 4O3OA 5EWFA 3HO8A 1QVCA 4Q8FA 1AP0A 2W9AA 3STBD 4B3TH 3MXNA 2HVQA 3U4ZA 4CE5A 4KHPQ 4HNVA 2UVUA 4RU9A 1AN8A 2RDFA 3H3VH 1EYZA 2AGPA 3GTKA 2QDLA 4FS2A 3QZ7A 4X62Q 4YWKA 4K14A 1EKPA 4ECUA 1TWHA 1NAPA 4X62H 2YS7A 4TVAB 4AYBG 1KJJA 1PFNA 3CCRA 5ELOA 5LMNW 4BY1B 2FJZA 2ZM6L 3GTLB 1DV1A 5E25A 3GB8B 4XZ3B 1SMYD 5LMUQ 2EY6A 2COIA 5D1PA 1WI5A 1FNWA 2WACA 2B2WC 3L7ZC 1CZGA 4R1JA 4UDUC 2YS6A 1P8LA 2F0IA 2TMPA 3U58A 3EIVA 2B29A 4YB8B 1U0LA 1X3FA 3GILA 5ELNA 4ECXA 3TREA 1GHJA 3NBHA 3KDFB 3ICEA 5KT7A 3PW0A 1VDZA 2XTIA 5J39A 1VQPA 5LXTF 4HNUA 5HV6A 5JQWA 3PO2G 1K8AC 3GV3A 1NTGA 4JI6H 4ECSA 1UAPA 2FLNA 1PH5A 4ZKCB 5JH7F 4YWLA 4DAYA 3JAMW 3KJPA 1G6ZA 2HT1A 1YNJC 3CRKC 1Q90A 3LNNA 2IY5B 2CQOA 1ESFA 2VPSA 3PW2A 2BQ3A 4RNNA 4L5TA 4F4WA 1TVXA 5KFLA 1RYRA 1EUCB 2R92A 2ICIA 4IUUA 1KIXA 3I4NH 1M0WA 3TZDA 3OW2A 5I5YA 5CGKA 4YJ2F 1ENFA 2OF1A 4A3FB 3OTOQ 1S5FD 2I5HA 2C2DA 4ZUIA 3DAAA 3TY8A 1MI2A 1OO9B 3M4IA 1STBA 2VQEL 3K0YA 4GS3A 2DIKA 5KT4A 3H09A 4I50F 1KTKA 2V59A 2UXDL 4MN3A 3GTOH 2CW8A 1S4ZA 2NN6G 3I73A 4FU0A 1WCMH 3SEBA 3NWTA 2ZXRA 4EGVA 4OHJA 2VR1A 4DKAC 5JVH3 5KFRA 3MZ5A 5KT3A 1G51A 5KNCA 1GGOA 2I46A 1SNQA 4RH6A 1EUJA 1I50H 1E2VA 2EYLA 2Z4IA 3PO2H 4A3KG 4YAKB 5C6AA 5KKNB 1UEAB 5EPLA 1W2BA 4DV2Q 2JA5B 2R93H 1RTOA 3VYSA 3R3OA 2QEJC 3HOUH 2Z4HA 4NZNA 3IG0A 4AYBA 2ZGIA 4JI4Q 4GC7A 4JI4H 4IN3A 1FNVA 3HEJA 3PZPA 2NYZD 2YZMA 3QOJA 1M90C 1II3A 3ZJYC 3I4MG 2BH2A 3KALA 3F2BA 2L55A 3GTOA 1PRTC 1H9KA 3V2TA 4JI1H 2B2YA 4WRDA 4O7NA 1M0TA 2NUCA 2VQEH 3RAQA 4EEQA 1I50A 4DV0H 4JI8H 5EGTA 3TBIB 4RUCA 1TWFB 1HFNA 1B53A 1TY2A 1J5EQ 3SR1A 4DPGA 2HQLA 2LY7A 5KYLA 1V1PA 2F0QA 3GLKA 1JB7A 2EDGA 4HIMA 3HOZG 4XT1B 4UCSA 3Q8RB 3T9EA 1SFOA 4GLAC 4POFA 1A15A 3OWFA 4BBRH 3I55A 1KD1C 1CKNA 2IWHA 5C5MA 4XQNA 3J7A5 2R7NA 4DIMA 4DV4H 3RIZA 3H0GB 1NR4A 5CC4A 3RR5A 1X3GA 2IMWP 3J80i 3UDXA 3WOFA 1AE2A 2NTSA 4LF5Q 3V05A 4C3HH 2O5IC 4GN3B 3KREA 2EJ0A 4DV5L 5KT6A 4KI0A 5D3DA 5EJWA 3OHXC 4RCNA 1B04A 5T1GA 1C9OA 4G57A 2ZXPA 4CDCC 2UUBL 4IPHA 2QB5A 5ELDA 4IPCA 4F7XA 3F1ZA 3TQ1A 3VR2A 1V43A 1Z47A 3MR5A 1NMFA 1JWUD 3A74A 3A54A 1JDEA 3KF6B 1SE2A 1PX2A 1JDBB 3NBYB 1D5ZC 3ERSX 1WFQA 3VPCA 2JEAI 5CBEE 5JQGF 4DR7L 2F0MA 4KHVA 5IYDG 3DEOA 3DHQA 1A3GA 1VBHA 3MFGA 4KN4C 4F4XA 4DR4L 1PH9A 4IFDH 1EY8A 2C00A 2KCMA 5LP6F 5CV9A 3B6YA 4QB4A 2WB1G 4O7SA 3H3VI 4BXXG 3TDQA 1I94Q 1IKLA 4ZCKA 5DGHA 1HTPA 4K6NA 1QOHA 2ZTCA 2VUMG 3GTPH 4DF7A 2W9CB 1S5ED 2NVYA 1XPOA 3S1RB 4FBUA 1T5XD 1R4PB 3RB3A 1XNQH 1Z2OX 4O7ZA 1ICFB 3J81E 4Y7NB 4JV2A 3C1EA 3PQIA 1B50A 3TQTA 1PYWD 3CQZH 3S15B 4JW0A 4OIKA 1MSGA 2AGOA 2XCPA 2YW2A 1S03G 2R3ZA 1SYCA 1D1IA 5JAVA 3HG9A 4FDBA 3JZIA 1V1QA 3BVMA 3A56A 3FPUB 2UU9Q 4A93H 4C2MB 4ME3A 1YBYA 2UU9H 2X69A 2QF7A 2F0GA 4BBSB 2IHFA 2CQAA 1L0WA 3RLOA 5EKLA 4C3IB 3I70A 1WTRA 4DR4H 3G7LA 2VQFL 4ZRZA 5IGDA 1SJED 4BXXH 4DLKA 3UDGA 2WAQG 2K75A 2FINB 3G6XA 1X55A 3S2HH 1IOVA 5KFUA 5DISC 3HBLA 3U9TA 2LXKA 1KC8C 3PR4A 5C5LA 3O13A 2V4QA 5A35A 3I90A 4HIDA 2OLSA 3OMGA 3KJOA 2PQEA 1H9SA 4A3MG 5KFMA 1DCZA 1I1KA 2PVPA 1BBUA 5D65A 1VQOA 4YBZB 2YTVA 1KAWA 4B3RQ 3HXLA 2A68C 4POGA 4B3RH 1EOVA 4DR5Q 1GXDC 1EIYB 4JUZA 4NXMH 4FFLA 1IOWA 3CCVA 4DR5H 3HT5A 2VW9A 4DNRB 2E2IH 4V190 5GROA 1Y14B 3J80c 1ASZA 2W9BA 2R8GA 2G9HD 3CHBD 2QDBA 2WB1A 2KCTA 1KDCA 3QO2A 3DUZA 3RMHA 4X64L 3T13A 1D1KA 3CU7A 4PZ6A 2XGQA 4TM5A 1V8QA 5KRUA 1HR0Q 2VUMA 4U68A 1I4XA 3UQ8A 4O7WA 3KK7A 2FLPA 3RUZA 4EGJA 3KLSX 4EG0A 2PZTA 1SR3A 1VQBA 1Z6HA 1ZYRC 3NUCA 3CF5A 4L5QA 1TWAB 3FDSA 3LULA 2JXMB 5DQHA 3HOYB 4EFBA 5C3EG 4LFBL 1RDPD 1IYDA 3EFXD 4HR7B 4DR1L 1WVLA 4O81A 3PIP3 3H3VC 4IJLA 4A3MH 1RJQA 1B4OA 4LF8L 2UXCL 3S14B 2KECA 5DEHA 3JZFA 2Q2IA 4ZAIA 4LF4L 3MWEA 4LF7L 3WWHA 4QWCA 3CPFA 4WHXA 3GQCA 4WFN3 2E2JB 2BE5C 1XNRQ 1F2LA 2NN6I 1PHJA 1TS3A 3KYHC 4B3MQ 1HJPA 3GTJA 4DUYL 1TWGH 2AQ3B 2L5TA 3A8IE 2NZ1D 4IR1A 1RTNA 1F2MA 4B3MH 5H80A 4NXNQ 3MXPA 3HFZB 4QIWB 3UE0A 5C5JA 1AW7A 4A3DB 3GTQH 2MP1A 4KD4A 4LSXA 4UP9A 1XMQQ 2WAQA 2BCOA 4KJOA 1BUVT 1YJ9A 3F2CA 4X64H 2B2TA 4ILWA 1GVPA 4N8X1 4DN4M 1WD1A 1SNMA 1Y1WB 4OX9L 3RGZA 1B8AA 3BJUA 2JA6G 2B3GA 1WTPA 1XXGA 2R7MA 3RV3A 1BOSA 4FXKC 1DYQA 4AH6A 1TWCB 3DM3A 4N9PA 3PF5A 4C3JG 1IBKH 4O0AA 3W5OA 5C3EH 4JI0L 5FR9A 4X65Q 4UCUA 3BA9A 3OW7A 4A3EG 3VNNA 3NUAA 1TWGA 3UFXB 5DM63 4AQYQ 5IODA 2UXCH 2F52A 2CZGA 1VF5C 2HGXA 4OWXB 4LF7H 1PFMA 1TS5A 2CW0C 4J6HA 2AHOB 4S3SA 4O3SA 1JE4A 2PYKA 3MTSA 2HJWA 4LNQA 2PZWA 4LK1C 3K7AH 5IWAQ 2R7ZG 4DUYH 4R4CA 4B08A 2KHJA 3ONAB 3N8DA 4ME5A 4MAMA 4U7CA 1C7YA 3T51B 1XX8A 1EY7A 4DR3Q 1C8CA 5IY0A 1SXTA 2OQ0A 3J81i 2OTJA 2ZXOA 4FBTA 3Q8QB 4QW9A 2JA6H 1EY9A 2W6NA 2FE3A 1L2FA 3HOXG 1CFMA 2R86A 3S17B 1DJRD 2ICEC 2RBMA 1XDNA 4A75A 2PW7A 1KNAA 2ZDQA 4FNFA 3IKJA 4O4IF 1ML0D 3LWEA 3T9BA 4UFZA 3C1FA 2OEOA 3S1MB 4A3JG 3L2PA 5M3FH 4DUZQ 1I6VC 5IYBG 1Z9FA 1T5EA 4DR6L 3GIJA 4FYDA 2RHQB 4LMYA 3M9OB 1TIID 1M4VA 2A6ED 1VQNA 4JI7H 2BDNA 2R6GA 5A2QL 2R7ZH 2A1HA 3ORRA 1YITA 2J4XA 1ULZA 2E74C 2JA6A 5EAYA 2HHHL 3VA5A 4ZQIA 4Y8VB 3HS0C 1VBGA 4GNXC 2NBFA 3H40A 5BPFA 3AMUA 3RV4A 5IYZF 5COYA 3K5LA 4QSHA 2ALZA 2IBKA 4HYKA 4A3LH 4DNIA 3OSPA 5J2TF 3HOXH 2R61A 2K33A 2YZGA 4UCRA 3H6MA 1SE4A 5BN3A 3OIQA 4I4TF 4PMCA 4O84A 1O80A 4BY1G 5DAAA 3FVQA 3BZKA 2ZJTA 2A69D 2Q2HA 4JYAQ 2IP4A 2D0PA 2Z04A 3TY5A 1I6UA 1R4QB 2GVBA 4IWYA 2DY7A 3A55A 4RHRA 4A3JH 3JSLA 4YY3Q 2R7ZA 4FS1A 1S40A 1DD2A 2IW3A 4LF6L 4YY3H 2BR0A 2B2UC 2UUAQ 1K83B 4OL7A 4IUNA 4J9PA 2XSCA 1R9TH 3M9BA 3NTIA 1GKHA 1I4GA 1J8IA 1KLGD 1Y1VB 2WINB 1PH1A 2H5XA 2UUAH 3G8DA 1IXRA 4QQBX 4NYEA 3NK9A 3RBEA 3KHRA 1PRTF 1PVOA 3Q1KA 2Q8RE 1WRVA 4R9WA 5KFVA 3EYYA 1L1OC 4R8UB 2HHHH 3J80L 4GOPC 1TS4A 3BYYB 5LA6F 5CV6A 5FJ8G 2ENBA 2JA7B 4I65A 3EN2A 3LWUA 1EFID 4I7HA 5CBAE 3JSNA 4HJ9A 2YU9A 2PPBC 1WD0A 1TU2B 3K7UC 1PRTD 3T5HA 3H4DA 1BR9A 2JEFA 1E3PA 5D14A 2B2VA 1ZXTA 1VMCA 5C44B 4HJ7A 3N43B 4DAMA 1PTOH 3J81c 4ABNA 2L9HA 5I2XA 1LTLA 3DWAA 1KBLA 3G6JB 1R9TA 5FLXE 2AKWB 1KJIA 3TP8A 3SHLA 4R4IA 1FD7D 4C1NK 4R4QA 2NVXH 1N33Q 3IFDA 1STEA 4CJ0B 1JJCB 1D5MC 2AWOA 1XTCD 3PUVA 3U0GA 2DNCA 3OHAA 4JI3L 1X3PA 2YYAA 1GO3E 1SEBD 5A2QW 3EPIA 3CCQA 1KDBA 2L15A 3GTGB 3W1BA 1VQKA 4IFDJ 3Q24A 2W6MA 2E5LL 2JA5G 3NC0B 4RNOA 1FNUA 3FEWX 2V58A 4BWSC 3M9MB 3V6JA 1CZWA 1JOKA 3GTLA 4HMJA 4IUVA 2JP1A 4DV3Q 3T1HQ 1YIJA 1KHIA 1JWSD 1A2TA 4UCTA 3R8BA 3C0FB 4DV3H 5KG1A 1ICWA 1EIGA 4WD3A 3HP3A 3LMLA 3S24A 5E7NA 2W8KA 3J7AF 2SDFA 3MJFA 3MVVA 1CQFA 1HNWL 4J15A 2B63B 3SE0A 2R7LA 1LO5D 1OXUA 2IX1A 4R8IA 3QQMA 4HJ5A 3NTKA 4DAPA 1PH6A 3KDFA 1CTMA 1YEZA 5IOCA 2H1EA 4OONA 1C48A 3ORQA 4MA0A 5FLMH 3GIDA 1N34Q 5I5VA 1IYJB 5IT9E 3GIIA 3Q8SB 1WJJA 2GA4B 1NE3A 1N34H 1QG7A 5IP7H 1B44D 5M3MB 1ZQ7A 1LYLA 3DWQA 2EJ2A 3SK6A 5F9LA 1PYBA 1NBWA 1Y8OB 1IL2A 4KY7A 5KFSA 5KFFA 2YTXA 2ZDGA 3NEMA 3UDFA 4ED3A 2XNAC 4ED8A 3RLNA 1X56A 1A62A 1C4QA 2M2LA 2KQ3A 4FXGC 5KNDA 1EEID 2FK3A 4O3NA 4F4ZA 5CA0F 1P16A 3HOWB 4UAIA 2XD4A 4O1NA 1S68A 1BBXC 3OMCA 2COJA 1F9PA 2HUGA 2FPGB 3GO5A 1EU3A 3HKZB 3T56B 4J9SA 1XTDA 4OO1G 3ETHA 3D31A 4U673 3T1YQ 2B2TC 1OBDA 1DZ1A 1I7LA 2QYZA 3T1YH 3CCSA 5JOBA 3OUUA 5E3FA 3VDYA 1K8OA 4L8JA 1HNWH 3K5NA 5KX5F 1SYEA 2QW7A 1E7ZA 4X62L 2KSWA 4IRKA 4TKOB 5CV4A 5BR8H 1BO0A 3JRXA 1TT2A 4XXEA 3K58A 4HSVA 3GTKH 1CKMA 4QUCA 1SSOA 4QMGA 5LMUL 2JA5A 4JPBW 4LFAQ 5D1OA 2DY8A 2ASDA 1I7NA 2I07B 2JA9A 1KRTA 1TWHH 3ND8A 1GUNA 4ZLTF 3RNUA 3X3MA 4LFAH 1OBGA 4H02A 5BN4A 1YHQA 1OTCA 3LGJA 3Q23A 3RZOB 1EZ1A 5KG7A 2X6GA 1I4RA 1LABA 5C4XB 3JRWA 3NENA 5M5YH 1I6HB 2NU9B 1NCVA 1PH8A 1EIFA 3AYHB 2HGSA 2W7OA 1J6QA 2E2HB 3RB6A 1FVIA 2NTTA 4JI6L 2HIVA 1I1LA 2A68D 5KFDA 3KBXA 1CHQD 3SXHA 3PIO3 1B33N 5C8YF 1DAAA 1FGUA 3I56A 4OO1H 1OWTA 1C0AA 1WH2A 1G6PA 4R4OA 3OUZA 5HNEA 2IA6A 1N36Q 4CDEC 1EUDB 2XRQD 3M4PA 1MZBA 3U50C 4KHPH 2JK8A 4X3TA 2F1MA 1ZKOA 2CQYA 3PR5B 5HURA 3FKIB 1U4MA 4RGTA 2F4VQ 1K8GA 1STHA 1VQDA 2J0TD 4B9WA 1PRTB 4EYIB 2F4VH 1ZEQX 1EYDA 2WFWA 4OWTB 2HHFB 1HZCA 5CA1F 1I5FA 3PN1A 4M1UB 4YR2A 2IX0A 2X6LA 1IYVA 3S1NH 4BBSG 3OHBA 4J9KA 3D3RA 2R92H 5KG3A 4C3IG 2R82A 1E4GT 5CV8A 5LMUH 5GAHC 3RUPA 1SNPA 2EYFA 4A4IA 2R6FA 4ETSA 1GM5A 2E75C 3OWEB 1LTGD 2J6SA 1B3QA 2LFNA 4RKLA 2EY2A 2JEJA 1PYSB 2W6ZA 2DJFC 4O3PA 2RF4A 3G8CA 4TRDA 3CXCA 2MFIA 2BE5D 1JMCA 3AX6A 5M5WH 2XWBB 1S5DD 5JEAG 2A6HC 4O7VA 4L5RC 4LUZA 3GIQA 4K0KQ 4ECZA 4JI4L 1I4HA 2RDGA 4C1NI 1RD9D 1GSOA 1HH2P 2GLTA 3WWJA 4K0KH 3CSWA 2DABA 4OXPA 3MHBA 3T9CA 3JZ6A 4RKBA 2GQRA 3TEKA 3MEFA 3NTHA 5FNVF 4BY7B 1IBLQ 3LQSA 2W8LA 2OQKA 1UE6A 3HOVB 2UUCQ 1IBLH 4UCVA 1W96A 2EYJA 1IL8A 4I55F 2K7VA 1STAA 1CA6A 4JI1L 4J9RA 3OTOH 4KKUA 4F88A 3PV0A 5EPKA 2PNHA 5I2YA 1YZ6A 4K8IA 4DV0L 1Q86C 4JI8L 1TY0A 4A3CG 3TINA 3T5JA 1ILQA 2D62A 3BDLA 4K6LA 4BWGB 3S9WA 1F77A 1KJ8A 1ZHQA 3IRBA 3HOYG 2NVQH 1HFGA 2W7PA 3G6YA 1HNXQ 3I4OA 3GIMA 3CCLA 3UZBA 1QUQB 3DM1A 2FLLA 5BN5A 1I4PA 4ECQA 1QWYA 3AFPA 3PUWA 4RB3C 2CW0D 4DGZA 2ZM6Q 2MNAA 2YCHA 3DMUA 2HDKA 1ET0A 3RBDA 2JA8G 4DV4L 4IZ8A 3QWNA 3LWBA 3SVMA 1E2WA 1JICA 1NR2A 2ZT9C 4A2AA 4DV2H 1I3QB 2VNUD 4KY6A 5C3WA 1SJHD 1TKWB 4A2BA 1SFOH 3EPGA 1NJIC 5FO9B 1E4EB 3ER0A 1OXTA 3E5SA 2G9DA 3JAME 4L5SA 2NZHA 4A3DG 4JC0A 2F0NA 5DLQE 3M3YB 2NU7B 4PZ8A 5DGAA 4YJ3F 2NZOA 3GTMB 4FFMA 1Y1WG 1FYCA 3KF8B 1BCPF 3DXJC 3D6WA 3MWDA 3RD4A 4A3CH 2V4RA 4DAVA 1MHWC 1GUGA 4CDFC 3RZDB 2D9UA 2NN6H 1BGWA 1IHZA 2J9GA 4R7RA 2YTYA 1U4LA 2C2RA 2VA2A 1J5EH 1RKNA 3MFHA 2QEXA 2ATLA 2JEIA 3VYTA 4ZHQF 4A3KH 4FF1A 1E22A 2FK2A 1JX4A 2CH4W 1AE3A 4TQSA 4DL4A 3SK5A 2JA8H 4ZK9B 1IZ6A 3SGIA 2HD3A 2VY3A 5KYIA 3DLLA 1EWHA 1XNQL 1D2BA 3MXNB 5BWTA 4MTDA 1B9NA 2MQHA 1EHIA 1PTOC 1LTBD 1MGSA 2XRSD 1G8ZD 1XYIA 5FLXc 4C5AA 5C1PA 3PMFA 4O7TA 2NVYH 4A3DH 1JIHA 3I4MH 4LF5H 1EQTA 1PFBA 1TWAA 2SNSA 2VA3A 2PCFB 5JJLA 4NZMA 2M05A 4NPSA 1LM0A 3VYUA 3F2UA 2PZUA 3MEHA 4IO9A 3I8ZA 2OCEA 1HNZQ 1WYDA 2A74C 4HR7A 3M4OH 1YVCA 4H0LC 2K03A 2UU9L 3GIKA 5M5XH 4CKBA 4DK6C 3G6VA 3EJIA 4O2DA 4OO1I 2F03A 1G2TA 5CR5A 1BF4A 2F0FA 1JLLB 4Q43A 2C28A 1HRJA 3HOZH 1DGSA 3IL8A 1QNKA 3MWMA 2QCPX 1I94H 2F0DA 4RGOS 5C4ZA 4YCUA 4DAYB 4AIMA 2QGQA 4Q45A 1W93A 1ENAA 1ONLA 1D6EC 4CHIA 1CKOA 1RJPA 1KXLA 2EY5A 2BQRA 1Q3LA 4IOCA 1Y1WA 1EZ6A 4G3IA 2JJQA 5I47A 2EJGC 4K2LA 3TP7A 4PBCA 4B3RL 4XYLB 4NXML 4DR5L 4OIJA 4HJAA 4WORA 5L37A 1QE6A 4JI2Q 3NWSA 4M7EA 4X66Q 3D4DA 1LTAD 4JI2H 4YR0A 4X66H 1UWVA 2A73B 1AEXA 4DU9A 4PQXA 1A9XA 4F50A 3QIAA 3ETJA 5C0XG 1E1OA 1F9SA 5IYDH 1WTWA 1TA8A 3R93A 3K8AA 3H15A 3MXUA 2GPWA 5IGBA 1BNCA 4Q0FA 3A8KE 4LSAA 5DG8A 1LV9A 3S16H 5L1LA 2BOSA 4BA1I 2UUBQ 4NB3A 1IW7D 3AFQA 3DTFA 3MA2B 4QIWE 3GP7A 4O7YA 1S0OA 2VUMH 4J9LA 1WSCA 3GV6A 1BJTA 1LTTD 2CHBD 1N32Q 3I4NB 2PI2E 1Y1VG 4AYBB 3PGZA 2X0SA 1N32H 1K1QA 4GKJQ 1AH9A 4GKJH 1VQ8A 3NELA 3TQYA 1IKMA 4O4HF 3VMMA 1B9MA 4HCEA 4UHVA 1M1KC 2FPIB 4ZI7F 2JQOA 3TW7A 4B3ML 1VF7A 3MFIA 1KJ9A 3Q6SA 2JA7G 3KBGA 1J9OA 3GTOB 2DZDA 4FE2A 1K3BC 1WCMB 5JJIA 2X5RA 2DJGC 3JC66 1V4YA 3BDOA 4O4JF 1LTID 4IPDA 4IQZA 3GTJH 4CC6A 2ZJPA 1EEFD 1SE3A 2F0SA 3PO2B 1O75A 4IR9A 4XTCS 4JV0A 2N88A 5C44G 1UNNC 4LFCQ 1HR0H 4JOIA 2PMZB 2R93B 2SEBD 3JAMi 3HOUB 3ULLA 3FMAA 4DR2Q 1SNCA 4R4TA 1IBKL 5CR3A 3CC2A 5EDWA 2Y0SB 3MXGA 1XJVA 1RHPA 2RDIA 4B3SQ 4OWWB 4FGRA 2UVVA 3W1GA 2K32A 2Z0SA 4X65L 4C5CA 4B3SH 1KUTA 2DLNA 4F8MA 4RUAA 1Y1VH 3S1QH 3PUZA 5K5PA 4H7BA 4AQYL 5J1ZA 4A3BG 3S2DH 2I80A 1TQOA 5GAGC 1WTXA 3R9RA 1FKAH 3CMAA 2VQFQ 4ME6A 1Y8NB 2Z6KA 3E6ZX 3FHWA 4RFBA 3E5NA 1SMYC 1XNRH 3URYA 1X3QA 3AB9A 2JA7H 5K36G 5IWAL 4MV6A 4GNXB 3J7YW 4MZ9A 4TUYF 1H95A 4NXNH 1L0XB 1I4QA
chains in the Genus database with same CATH topology
3ULJA 2KBNA 1XMQH 4BA2I 2B63G 2E8GA 3EBEA 4PZ7A 4KLKA 1L2ZA 4A76A 4X65H 4MTEA 1S3OA 4A3BH 4AQYH 1BBWA 1X3EA 1VQ9A 4LF9Q 4JI7L 1X6OA 1B70B 1L1OB 4JBMA 4GOPB 3HKZG 5IWAH 4DR1Q 4LF8Q 1ZHSA 4LF4Q 4A3GG 4EQ5A 3CC7A 4DR3H 4JI5Q 4P71A 4HIOA 4C3JH 1Q7YC 2WYOA 4A3EH 2BA0A 2UXBQ 3F8TA 1VS0A 4YHHQ 1CSPA 1SE8A 3JAMc 2UXBH 4YY3L 5C4XG 4YHHH 1EFWA 4DUZH 2UUAL 2ZJRA 4WJ3M 3RN5A 1KQSA 1Q46A 2CKZB 3I7FA 4P72A 1X54A 4A3GH 4GN5A 1VQFA 4FM9A 1VQ4A 4IPGA 1IBMQ 1SN8A 1IBMH 3KXYT 1PH2A 4TQUS 5AJ3L 2YU9H 4JYAH 3RN2A 3E9IA 5JJKA 4ALPA 3CCMA 5IYBH 4UY8C 4JBJA 5C0XI 1VQJA 3A5UA 2KHIA 4QJFA 4DV6Q 4PMWA 1VQ7A 4DV6H 3KAJA 1T9HA 2A8VA 2PQAA 3OYYA 2ALYB 5LL6b 4RB0A 3BABA 4DV3L 3T1HL 4DR6Q 4BY7G 1YHBA 4BY1H 4A3FG 3GTLH 1FJGQ 4GN4B 4PG3A 1KRSA 2EIFA 3HKZE 1N34L 1YI2A 1OXVA 1OXSC 1N33H 3G4SA 3ULPA 2K5VA 3L4KA 4XIGS 5FJ8H 1YJWA 1A8VA 4KHZA 4WJ4A 3E0EA 2I0QA 2ZJQA 2CCZA 4LF6Q 3G6EA 3T1HH 2RHSB 3T1YL 4RMFA 1XK5A 4A3FH 1K9MC 5BR8L 4MV9A 1D7QA 2V1CC 4LH7A 1XPRA 3J7AK 4JV5Q 4LFAL 4JV5H 3CAMA 2Z6KC 4GKKQ 2JA5H 1BVSA 3CMEA 3A5ZB 3J80W 3H0GG 1VQ6A 2IT1A 5FD5A 4LUOA 3CD6A 4DV1Q 3N40P 3GDEA 1N8RC 1MKHA 4KHPL 4JI3Q 1N36L 4DV1H 3FP9A 2YV5A 2DUDA 2BH8A 4DV7Q 3I2ZA 4DV7H 1QUQA 2F4VL 2XGTA 1EQRA 1XMOQ 1TWFH 3K3VA 2HIXA 2LSSA 3M85A 1X9NA 4CC5A 2C35B 3H0GH 1UE7A 5LMNQ 1AN7A 5LMNH 4E6NA 1U5KA 3CW2C 2YYZA 1CSQA 4JG2A 4K0KL 1Q1EA 2WP8J 1N36H 1PH3A 3BZCA 2CFMA 3RF2A 1IBLL 3OTOL 4B3TQ 4UP8A 2RGRA 3S1RH 1HNXL 4YCWA 3I4NG 2AWNA 1MIUA 4Y7NH 1S72A 4LH6A 3KF6A 3HKSA 2Q2UA 3PF4A 1OXXK 4DV2L 1QVGA 3S15H 2W57A 1SROA 2GN5A 1WOCA 1WCMG 4C2MH 1NY4A 1YHAA 4JI6Q 2Q2TA 4BBSH 3KFUA 2UUCH 4C3IH 3Q8DA 2R93G 3HOUG 3M7NA 1VQCA 2Y0SG 2DGYA 1PV4A 4Y52H 1J5EL 4MTNA 1HNXH 5IP9G 1YJNA 3BAAA 2ZM6H 2BA1A 2K4KA 4QL5A 1CUKA 2K52A 1Q12A 4LF5L 3KAKA 1E24A 4P73A 1HNZL 5D1OB 4P74A 4BBRG 1TWAH 4J0MA 3HOYH 5IP9H 2ZTEA 3S14H 1I94L 3QWUA 4RG1A 4JI1Q 3GD7A 2E2JH 2VQEQ 4DV0Q 4JI8Q 4EFEA 1MJEA 2UXDQ 1E4FT 2UXDH 4IFDG 1JJ2A 3J81W 4JI2L 5C4JH 3G71A 1Y1WH 4X66L 2A19A 4DV4Q 2VZAA 4AYBE 5GADC 3G48A 1HNZH 2JE6I 1VCIA 4YCVA 1UE1A 1TWCH 4UPAA 3NBHB 4Q0YA 3PIOA 4LWCA 4GNXA 1KL9A 1N32L 4A93G 2PI2A 4GKJL 1Q8KA 2PMZE 4PDBA 3TEHB 1GD7A 5IT9c 5IE8A 3CVZA 2Y0SE 3CPWA 4HJ8A 3H20A 4RB1A 1XNQQ 1PFSA 4A3IG 1PH4A 3S17H 3RLFA 2OWOA 1HR0L 3BU2A 4DV5Q 4LFCL 2N78A 3N41B 4DV5H 3BA8A 4DR2L 3S1MH 2UUBH 1QVFA 1L1OA 1BKBA 2CWPA 4GOPA 3TY9A 4B3SL 2R7DA 2VUGA 1VQEA 3J81j 2XIGA 4DR7Q 4DR7H 3KLWA 4YWMA 4RAYA 1QZHA 4DR4Q 1SRUA 1XNRL 2RGVA 2K5HA 3AQQA 3TS2A 3PSIA 4EX5A 4NXNL 1A63A 1RL2A 2AMCB 4A3IH 1XMQL 1JJGA 1Z2PX 3CCUA 1E1TA 1G291 3RTXA 2R7FA 4NXMQ 2IHEA 3U4VA 4LFCH 3TS0A 2N49A 3STBC 4DR2H 1K3RA 1MJCA 1K83H 2D0OA 1X65A 1CKNB 3M4QA 1HZ9A 1VQHA 3N6XA 5FPOA 3KOJA 4LF9L 1HZAA 2KENA 2VQFH 2EXDA 1SEIA 3J7ZC 4MNOA 4DRFA 2ATWA 4JCVE 3K80C 1D8LA 4DR3L 5C44H 1HR0W 4JI5L 1UE5A 3A0JA 2WB1E 2ASBA 1NMGA 5M3MG 2UXBL 4X64Q 1HZBA 4YHHL 3GTGH 4DUZL 3AEVA 3L0OA 1A0IA 1N9WA 2QA4A 2I5LX 4LF9H 1IBKQ 3HOWG 3RJ0A 4LFBQ 1SYXB 4LFBH 4DR1H 2UXCQ 4LF8H 5M3FG 2B63H 1VQLA 4LF7Q 3L4JA 4LF4H 1IBML 1EYGA 5GQOA 4JI5H 4DUYQ 4IFDI 3K81C 1Q81C 3F8NA 4JYAL 1SLJA 5M3MH 2WAQE 2CW7A 5IYCG 2RCNA 4OX9Q 2N3SA 4OX9H 3PUXA 5GAEC 4A3LG 4QGUA 3HOWH 2NVTH 5J3BA 3UDIA 4DV6L 2K14A 4JI0Q 4JI0H 2LXJA 5JEAJ 4HIKA 3FKIG 4LW1A 1VQ5A 4UP7A 2MO1A 4JI7Q 4IAJA 2K5NA 1FJGL 2K50A 2ZTDA 3RZOH 2WE6A 5C4XH 5IYCH 1I6HH 1O7IA 3GJXB 1N33L 5FD6A 2HVSA 2E2HH 1SMXA 2JEBI 5FLXW 5FPRA 1TAEA 1LUZA 1ASYA 2GVAA 4JBKA 2HVRA 1EWIA 2FXQA 5HGQA 3FKIH 1Q1BA 4DR6H 4P75A 3HOVG 2O03A 2N8NA 4LUVA 3PIPA 2HHHQ 1FJGH 4IOAA 4JBWA 4QY7A 2OTLA 4JV5L 1TXYA 2MCTA 4RB2C 2F3IA 3CP0A 5IT9W 5AJ3Q 3PUYA 4GKKL 2VL6A 5EOYA 1K73C 1JE5A 1W3SA 3UE1A 5FLMG 1XPUA 3WWVA 4LF6H 5IP7G 4DV1L 4BY7H 3N42B 3HOVH 3N44B 4JOIC 4DV7L 4APVA 4RZQA 1VQMA 4DK3C 2VS1A 1XMOL 2VOBA 1B7YB 2CWAA 1PA6A 2MO0A 3RGXA 4GLXA 1VQGA 3DF7A 4RAZA 5HY6A 4GKKH 4MV7A 1I3QH 5LMNL 2EQSA 1K0RA 1QZGA 1RIPA 3M3YH 2ES2A 1GYFA 3GTMH 4IJHA 4JI3H 1Z2NX 1EQQA 2E5LQ 1VQIA 2E5LH 2WDTA 3RZDH 3NBZB 1XMOH 3PO3G 4B3TL 5C0XJ 3CCJA 3D0FA 1YNXA 3E9HA 1HNWQ 1UEBA 1FL0A 2A1AA 4UCOA 3K0XA 5H1SE 1JT8A 5BR8Q 2I5MX 1Q82C 2PQAB 1V9PA 3F2DA 3CCEA 2ID0A 4GLVB 4X6AH 4APMA 1VQAA 2R92G 3PCOB 1PH7A 3CC4A 3TRZA 2UUCL 3PO3H 1QVCA 3STBD 4B3TH 2HVQA 3U4ZA 4KHPQ 3H3VH 4X62Q 4YWKA 4X62H 4TVAB 4AYBG 3CCRA 5ELOA 5LMNW 2ZM6L 3GB8B 5LMUQ 5D1PA 1WI5A 3L7ZC 4R1JA 1P8LA 3U58A 3EIVA 2B29A 1U0LA 1X3FA 5ELNA 3TREA 3KDFB 3ICEA 1VQPA 2XTIA 3PO2G 1K8AC 1NTGA 4JI6H 1PH5A 4YWLA 3JAMW 3KJPA 2HT1A 2IY5B 2CQOA 2VPSA 4L5TA 1KIXA 3I4NH 1M0WA 3OW2A 3OTOQ 2I5HA 3TY8A 3M4IA 2VQEL 4GS3A 2UXDL 3GTOH 2CW8A 2NN6G 1WCMH 4DKAC 1G51A 3PO2H 1EUJA 1I50H 4A3KG 1W2BA 4DV2Q 2R93H 3HOUH 3IG0A 4JI4Q 4JI4H 1M90C 3ZJYC 3I4MG 2BH2A 3KALA 3F2BA 4JI1H 1M0TA 2VQEH 4EEQA 4DV0H 4JI8H 1J5EQ 4DPGA 2HQLA 1JB7A 4UCSA 4HIMA 3HOZG 4GLAC 4POFA 4BBRH 3I55A 1KD1C 1CKNA 3J7A5 4DV4H 3RIZA 3RR5A 1X3GA 3J80i 3UDXA 1AE2A 4LF5Q 4C3HH 4GN3B 4DV5L 4KI0A 1B04A 1C9OA 2UUBL 4IPHA 4IPCA 3F1ZA 1V43A 1Z47A 1NMFA 3A74A 3NBYB 3KF6B 3ERSX 1WFQA 2JEAI 4DR7L 5IYDG 4DR4L 1PH9A 2KCMA 3B6YA 2WB1G 3H3VI 4BXXG 1I94Q 2ZTCA 2VUMG 3GTPH 1XPOA 1XNQH 1Z2OX 3CQZH 1S03G 4FDBA 1V1QA 2UU9Q 4A93H 4ME3A 1YBYA 2UU9H 2IHFA 1L0WA 3RLOA 4DR4H 2VQFL 4BXXH 3UDGA 2WAQG 2K75A 1X55A 3S2HH 5DISC 2LXKA 1KC8C 4HIDA 3KJOA 4A3MG 1BBUA 1VQOA 2YTVA 4B3RQ 1KAWA 3HXLA 4POGA 4B3RH 1EOVA 4DR5Q 1EIYB 4NXMH 3CCVA 4DR5H 2VW9A 2E2IH 5GROA 1Y14B 3J80c 1ASZA 2KCTA 4X64L 4PZ6A 1HR0Q 3UQ8A 1SR3A 1VQBA 3CF5A 4L5QA 4EFBA 5C3EG 4LFBL 4DR1L 4IJLA 4A3MH 4LF8L 2UXCL 2Q2IA 4LF4L 4LF7L 3CPFA 1XNRQ 2NN6I 1PHJA 3KYHC 4B3MQ 1HJPA 4DUYL 1TWGH 4B3MH 4NXNQ 3HFZB 3UE0A 3GTQH 4LSXA 4UP9A 1XMQQ 1YJ9A 3F2CA 4X64H 1GVPA 3RGZA 4OX9L 1B8AA 3BJUA 2JA6G 2B3GA 4AH6A 3DM3A 3PF5A 1IBKH 4O0AA 3W5OA 5C3EH 4JI0L 4X65Q 4UCUA 3BA9A 3VNNA 4A3EG 4AQYQ 2UXCH 2F52A 4OWXB 4LF7H 2AHOB 4LNQA 3K7AH 5IWAQ 2R7ZG 4DUYH 4R4CA 2KHJA 1C7YA 4DR3Q 5IY0A 2OTJA 2OQ0A 3J81i 2JA6H 2FE3A 1L2FA 3HOXG 1XDNA 4A75A 4UFZA 4A3JG 3L2PA 5M3FH 4DUZQ 5IYBG 1Z9FA 4DR6L 2RHQB 4LMYA 1VQNA 4JI7H 2R6GA 2R7ZH 1YITA 5EAYA 2HHHL 4GNXC 4A3LH 4DNIA 3HOXH 4UCRA 4BY1G 3BZKA 2ZJTA 2Q2HA 4JYAQ 2D0PA 3TY5A 1I6UA 2GVBA 3JSLA 4A3JH 4YY3Q 1S40A 4LF6L 4YY3H 2UUAQ 1R9TH 3M9BA 2UUAH 1GKHA 1PH1A 2H5XA 1IXRA 4QQBX 1PVOA 3EYYA 1L1OC 2HHHH 4GOPC 5FJ8G 3EN2A 4I7HA 3JSNA 4HJ9A 3K7UC 1E3PA 4HJ7A 3N43B 4DAMA 3J81c 1LTLA 2AKWB 4R4IA 4R4QA 2NVXH 1N33Q 1JJCB 2AWOA 3PUVA 4JI3L 1GO3E 5A2QW 3CCQA 2L15A 4IFDJ 3W1BA 1VQKA 2E5LL 2JA5G 3NC0B 4BWSC 4DV3Q 1YIJA 3T1HQ 1KHIA 4UCTA 3C0FB 4DV3H 3LMLA 3S24A 5E7NA 1HNWL 4J15A 2IX1A 1OXUA 4HJ5A 1PH6A 3KDFA 1YEZA 4OONA 5FLMH 1N34Q 1IYJB 1WJJA 1NE3A 1N34H 5IP7H 1LYLA 1PYBA 1NBWA 1IL2A 2YTXA 3NEMA 3UDFA 3RLNA 1X56A 1A62A 1P16A 1S68A 3GO5A 1XTDA 4OO1G 3D31A 3T1YQ 3T1YH 3CCSA 3VDYA 1HNWH 4X62L 1E7ZA 2KSWA 5BR8H 3GTKH 1CKMA 5LMUL 4LFAQ 5D1OA 1KRTA 2JA9A 1TWHH 3RNUA 4LFAH 4H02A 1YHQA 1OTCA 3LGJA 3NENA 5M5YH 1PH8A 1EIFA 3AYHB 2HGSA 1J6QA 1FVIA 4JI6L 2HIVA 1FGUA 3I56A 1WH2A 1C0AA 1G6PA 4R4OA 1N36Q 1MZBA 3M4PA 3U50C 4KHPH 2JK8A 2F4VQ 1K8GA 1VQDA 2F4VH 2WFWA 4OWTB 1HZCA 1I5FA 3PN1A 2IX0A 3S1NH 4BBSG 2R92H 1E4GT 5LMUH 5GAHC 4A4IA 4ETSA 1GM5A 1PYSB 2RF4A 3CXCA 2MFIA 1JMCA 5M5WH 5JEAG 4L5RC 4LUZA 4K0KQ 4JI4L 4K0KH 1HH2P 4OXPA 3MEFA 1IBLQ 2OQKA 1UE6A 2UUCQ 1IBLH 4UCVA 4JI1L 3OTOH 3PV0A 2PNHA 1YZ6A 4DV0L 1Q86C 4JI8L 4A3CG 2D62A 1ZHQA 3IRBA 3HOYG 2NVQH 1HNXQ 3I4OA 3CCLA 1QUQB 3AFPA 4RB3C 3PUWA 2ZM6Q 2MNAA 2YCHA 2JA8G 4DV4L 4A2AA 4DV2H 2VNUD 4A2BA 1SFOH 1NJIC 3ER0A 1OXTA 4L5SA 4A3DG 2NZHA 4JC0A 5DLQE 4PZ8A 2NZOA 1Y1WG 3KF8B 4A3CH 1BGWA 4R7RA 2YTYA 1J5EH 2QEXA 4A3KH 1E22A 1AE3A 2JA8H 1IZ6A 3SGIA 2VY3A 3DLLA 1XNQL 3MXNB 4MTDA 2MQHA 5FLXc 2NVYH 4A3DH 3I4MH 4LF5H 5JJLA 4NPSA 1LM0A 4IO9A 2OCEA 1HNZQ 1WYDA 3M4OH 1YVCA 2UU9L 5M5XH 4DK6C 4O2DA 4OO1I 3HOZH 1DGSA 3MWMA 1I94H 4YCUA 4DAYB 4AIMA 2QGQA 1CKOA 1KXLA 4IOCA 2JJQA 4B3RL 4NXML 4DR5L 4HJAA 4JI2Q 4M7EA 4X66Q 4JI2H 4X66H 1UWVA 5C0XG 1E1OA 5IYDH 1TA8A 3K8AA 3H15A 4LSAA 3S16H 4BA1I 2UUBQ 4NB3A 3AFQA 4QIWE 2VUMH 1BJTA 1N32Q 2PI2E 1Y1VG 1N32H 3PGZA 4GKJQ 1AH9A 4GKJH 1VQ8A 3NELA 3TQYA 1M1KC 2JQOA 4B3ML 2JA7G 5JJIA 3JC66 4IPDA 3GTJH 4CC6A 2ZJPA 1O75A 4XTCS 5C44G 4LFCQ 1HR0H 4JOIA 3FMAA 3JAMi 3ULLA 4DR2Q 4R4TA 1IBKL 3CC2A 1XJVA 4B3SQ 4OWWB 3W1GA 2Z0SA 4X65L 4B3SH 1Y1VH 3S1QH 3PUZA 4AQYL 4A3BG 3S2DH 5GAGC 1FKAH 3CMAA 2VQFQ 2Z6KA 3FHWA 1XNRH 2JA7H 5K36G 5IWAL 4GNXB 4MZ9A 1H95A 4NXNH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A19 A;  3ULJ A;  4DV4 Q;  2VZA A;  5FJ8 G;  1QVC A;  2KBN A;  4AYB E;  5GAD C;  3EN2 A;  3G48 A;  3STB D;  2JE6 I;  4BA2 I;  1VCI A;  4YCV A;  2HVQ A;  4HJ9 A;  3U4Z A;  3JSN A;  1UE1 A;  4KHP Q;  1TWC H;  2B63 G;  3K7U C;  2E8G A;  4UPA A;  3EBE A;  3H3V H;  1E3P A;  4PZ7 A;  3NBH B;  4X62 Q;  4YWK A;  4HJ7 A;  4DAM A;  4KLK A;  3PIO A;  3J81 c;  4TVA B;  1LTL A;  4AYB G;  3CCR A;  4LWC A;  4A76 A;  5ELO A;  5LMN W;  4GNX A;  2AKW B;  2ZM6 L;  1KL9 A;  3GB8 B;  5LMU Q;  1N32 L;  4R4I A;  1S3O A;  5D1P A;  4R4Q A;  2NVX H;  4A93 G;  1WI5 A;  1N33 Q;  4A3B H;  1JJC B;  2PI2 A;  4GKJ L;  2AWO A;  1BBW A;  1Q8K A;  1X3E A;  3L7Z C;  3PUV A;  1VQ9 A;  2PMZ E;  4LF9 Q;  4R1J A;  4JI3 L;  1P8L A;  3TEH B;  1GD7 A;  3EIV A;  1X6O A;  2B29 A;  3U58 A;  1B70 B;  1GO3 E;  1U0L A;  1X3F A;  5IT9 c;  5ELN A;  3CCQ A;  2L15 A;  5IE8 A;  3W1B A;  1VQK A;  3TRE A;  2Y0S E;  4IFD J;  1L1O B;  3KDF B;  2E5L L;  2JA5 G;  4JBM A;  3CPW A;  4GOP B;  3ICE A;  3NC0 B;  1VQP A;  2XTI A;  3HKZ G;  4HJ8 A;  4DR1 Q;  3PO2 G;  1K8A C;  1NTG A;  1XNQ Q;  4LF8 Q;  1PH5 A;  4YWL A;  1PFS A;  4DV3 Q;  3T1H Q;  1KHI A;  3KJP A;  4A3I G;  1YIJ A;  1PH4 A;  4LF4 Q;  4UCT A;  3S17 H;  2HT1 A;  4A3G G;  4EQ5 A;  3CC7 A;  3RLF A;  4JI5 Q;  2CQO A;  2OWO A;  1HR0 L;  3BU2 A;  2IY5 B;  4P71 A;  4DV5 Q;  4HIO A;  3S24 A;  4L5T A;  5E7N A;  4LFC L;  2N78 A;  1HNW L;  4J15 A;  1KIX A;  3BA8 A;  4C3J H;  2IX1 A;  1OXU A;  4DR2 L;  3OW2 A;  1QVF A;  4HJ5 A;  3I4N H;  3S1M H;  1PH6 A;  1Q7Y C;  1L1O A;  1BKB A;  2CWP A;  3KDF A;  1YEZ A;  4GOP A;  3TY9 A;  4B3S L;  2R7D A;  4OON A;  3OTO Q;  1VQE A;  2BA0 A;  4A3E H;  2VUG A;  2UXB Q;  2I5H A;  3F8T A;  1VS0 A;  5FLM H;  3J81 j;  1N34 Q;  3TY8 A;  1IYJ B;  4YHH Q;  4DR7 Q;  1CSP A;  1SE8 A;  3JAM c;  4YY3 L;  1WJJ A;  2VQE L;  1NE3 A;  5C4X G;  4GS3 A;  5IP7 H;  3KLW A;  4YWM A;  1EFW A;  1QZH A;  1LYL A;  2UXD L;  2UUA L;  3GTO H;  1SRU A;  2ZJR A;  4DR4 Q;  2NN6 G;  1WCM H;  1PYB A;  1NBW A;  1XNR L;  1IL2 A;  2K5H A;  3AQQ A;  3RN5 A;  4WJ3 M;  2YTX A;  4DKA C;  3TS2 A;  3PSI A;  3NEM A;  3UDF A;  4EX5 A;  1KQS A;  1G51 A;  3RLN A;  1X56 A;  1A62 A;  3PO2 H;  1EUJ A;  1I50 H;  4NXN L;  1Q46 A;  4A3K G;  1A63 A;  1P16 A;  1RL2 A;  2AMC B;  2CKZ B;  3I7F A;  3JSL A;  1S68 A;  1W2B A;  4DV2 Q;  4P72 A;  4A3I H;  1XMQ L;  3GO5 A;  2R93 H;  1JJG A;  3HOU H;  3CCU A;  1X54 A;  4A3G H;  1E1T A;  1XTD A;  1G29 1;  4GN5 A;  4OO1 G;  3D31 A;  1VQF A;  4JI4 Q;  1VQ4 A;  4IPG A;  3T1Y Q;  1IBM Q;  3RTX A;  1H95 A;  2R7F A;  1SN8 A;  4NXM Q;  2IHE A;  3CCS A;  3U4V A;  3VDY A;  3TS0 A;  1PH2 A;  4TQU S;  3ZJY C;  2N49 A;  1M90 C;  2BH2 A;  3I4M G;  4X62 L;  1E7Z A;  3STB C;  5AJ3 L;  3F2B A;  2YU9 H;  1K3R A;  3RN2 A;  1MJC A;  1K83 H;  3E9I A;  5JJK A;  2D0O A;  1X65 A;  3GTK H;  1CKN B;  1CKM A;  4ALP A;  3CCM A;  3M4Q A;  1HZ9 A;  5IYB H;  5LMU L;  4UY8 C;  1VQH A;  4LFA Q;  5D1O A;  4JBJ A;  5C0X I;  1KRT A;  2JA9 A;  1TWH H;  5FPO A;  4EEQ A;  3RNU A;  1VQJ A;  3KOJ A;  3A5U A;  4H02 A;  1YHQ A;  1OTC A;  3LGJ A;  1J5E Q;  4LF9 L;  1HZA A;  2KEN A;  2KHI A;  3NEN A;  4DPG A;  5M5Y H;  4QJF A;  2HQL A;  4DV6 Q;  1PH8 A;  1EIF A;  2EXD A;  3AYH B;  1JB7 A;  1J6Q A;  4HIM A;  3HOZ G;  4PMW A;  4UCS A;  1VQ7 A;  1FVI A;  3J7Z C;  1T9H A;  4JI6 L;  2HIV A;  4MNO A;  2PQA A;  2A8V A;  4GLA C;  4DRF A;  2ATW A;  4JCV E;  4POF A;  3OYY A;  2ALY B;  4BBR H;  3I55 A;  1KD1 C;  1CKN A;  3K80 C;  3J7A 5;  1D8L A;  1FGU A;  3I56 A;  3BAB A;  1C0A A;  4DV3 L;  3T1H L;  1G6P A;  4R4O A;  4DR3 L;  4DR6 Q;  5C44 H;  3RR5 A;  1X3G A;  1N36 Q;  3J80 i;  1HR0 W;  3UDX A;  3M4P A;  4BY7 G;  1AE2 A;  4JI5 L;  2JK8 A;  3U50 C;  4C3H H;  4LF5 Q;  4GN3 B;  4DV5 L;  1YHB A;  4KI0 A;  4BY1 H;  4A3F G;  3GTL H;  1B04 A;  1UE5 A;  1C9O A;  2F4V Q;  1K8G A;  3A0J A;  4IPH A;  2UUB L;  1FJG Q;  1VQD A;  4IPC A;  3F1Z A;  4GN4 B;  1V43 A;  1Z47 A;  2WFW A;  4OWT B;  1HZC A;  1NMF A;  3A74 A;  1I5F A;  2WB1 E;  3KF6 B;  4PG3 A;  2ASB A;  3NBY B;  3PN1 A;  1NMG A;  5M3M G;  2IX0 A;  1KRS A;  2EIF A;  3S1N H;  4BBS G;  2UXB L;  3ERS X;  1WFQ A;  4X64 Q;  3HKZ E;  1HZB A;  2JEA I;  1N34 L;  2R92 H;  4YHH L;  4DR7 L;  5IYD G;  5GAH C;  3GTG H;  4DUZ L;  1YI2 A;  1OXV A;  4A4I A;  3AEV A;  1GM5 A;  3L0O A;  1OXS C;  1A0I A;  3G4S A;  1N9W A;  1PH9 A;  4DR4 L;  2QA4 A;  2I5L X;  4JI7 L;  2KCM A;  1PYS B;  3ULP A;  3B6Y A;  2WB1 G;  1IBK Q;  3H3V I;  3HOW G;  4BXX G;  1I94 Q;  2K5V A;  2RF4 A;  3CXC A;  2MFI A;  4LFB Q;  2ZTC A;  4XIG S;  2VUM G;  3GTP H;  1JMC A;  1XPO A;  5M5W H;  5FJ8 H;  1YJW A;  1A8V A;  4KHZ A;  5JEA G;  2UXC Q;  4WJ4 A;  3E0E A;  2I0Q A;  2ZJQ A;  2CCZ A;  4LF6 Q;  4L5R C;  4LUZ A;  5M3F G;  2B63 H;  1VQL A;  4LF7 Q;  3G6E A;  4K0K Q;  2RHS B;  4JI4 L;  1IBM L;  3T1Y L;  1EYG A;  1HH2 P;  5GQO A;  4RMF A;  4B3R Q;  1XK5 A;  4A3F H;  1K9M C;  4OXP A;  4DUY Q;  3CQZ H;  4IFD I;  3MEF A;  3K81 C;  1Q81 C;  1IBL Q;  2OQK A;  5BR8 L;  1UE6 A;  4JYA L;  1SLJ A;  5M3M H;  2UUC Q;  4UCV A;  2WAQ E;  1D7Q A;  2V1C C;  4FDB A;  4LH7 A;  1V1Q A;  4JI1 L;  1XPR A;  3PV0 A;  2UU9 Q;  4A93 H;  2PNH A;  4JV5 Q;  1YZ6 A;  4ME3 A;  5IYC G;  2RCN A;  4OX9 Q;  1YBY A;  4DV0 L;  2N3S A;  1Q86 C;  4JI8 L;  4LFA L;  4A3C G;  2D62 A;  3PUX A;  2IHF A;  1L0W A;  3RLO A;  3IRB A;  5GAE C;  3HOY G;  4A3L G;  4QGU A;  2NVQ H;  1HNX Q;  3I4O A;  2VQF L;  2NVT H;  3HOW H;  3CCL A;  1QUQ B;  3CAM A;  4BXX H;  2Z6K C;  2WAQ G;  5J3B A;  3UDI A;  3UDG A;  2K75 A;  2JA5 H;  4GKK Q;  1X55 A;  1BVS A;  2K14 A;  3CME A;  4DV6 L;  4JI0 Q;  3AFP A;  3S2H H;  3PUW A;  5DIS C;  3A5Z B;  2ZM6 Q;  2LXK A;  2MNA A;  3H0G G;  2LXJ A;  1KC8 C;  1VQ6 A;  4HID A;  2JA8 G;  2IT1 A;  3KJO A;  4DV4 L;  5JEA J;  4HIK A;  4A3M G;  4LUO A;  3CD6 A;  4DV1 Q;  3FKI G;  1BBU A;  3GDE A;  1MKH A;  4LW1 A;  1N8R C;  1VQ5 A;  2VNU D;  1VQO A;  4KHP L;  4JI3 Q;  1SFO H;  4UP7 A;  2MO1 A;  1KAW A;  2YTV A;  3FP9 A;  2YV5 A;  2DUD A;  1NJI C;  1N36 L;  4JI7 Q;  2BH8 A;  2K5N A;  4DV7 Q;  3ER0 A;  3I2Z A;  4POG A;  1OXT A;  1EOV A;  4DR5 Q;  1EIY B;  4L5S A;  2NZH A;  4A3D G;  1QUQ A;  3CCV A;  2F4V L;  4JC0 A;  2XGT A;  5DLQ E;  1EQR A;  4PZ8 A;  2VW9 A;  1FJG L;  2E2I H;  2NZO A;  2K50 A;  5GRO A;  1Y14 B;  3J80 c;  1XMO Q;  1ASZ A;  1Y1W G;  1TWF H;  2ZTD A;  2KCT A;  3KF8 B;  3RZO H;  5C4X H;  5IYC H;  4X64 L;  1I6H H;  1O7I A;  4A3C H;  4PZ6 A;  3GJX B;  1N33 L;  2HIX A;  1HR0 Q;  2LSS A;  2HVS A;  2E2H H;  3UQ8 A;  1SMX A;  2JEB I;  3M85 A;  2YTY A;  5FPR A;  1X9N A;  1TAE A;  1SR3 A;  1VQB A;  3CF5 A;  1LUZ A;  4L5Q A;  4CC5 A;  2QEX A;  1ASY A;  4EFB A;  2GVA A;  2C35 B;  3H0G H;  4A3K H;  1UE7 A;  5C3E G;  5LMN Q;  4JBK A;  4LFB L;  2HVR A;  1E22 A;  1AE3 A;  4DR1 L;  1EWI A;  2JA8 H;  2FXQ A;  4E6N A;  1U5K A;  4IJL A;  4A3M H;  1IZ6 A;  3SGI A;  2VY3 A;  3DLL A;  4LF8 L;  3CW2 C;  2YYZ A;  1XNQ L;  1CSQ A;  3MXN B;  3FKI H;  5HGQ A;  2UXC L;  4JG2 A;  2MQH A;  2Q2I A;  4LF4 L;  4LF7 L;  4K0K L;  3CPF A;  1Q1B A;  1Q1E A;  2WP8 J;  5FLX c;  2NVY H;  1XNR Q;  4P75 A;  4A3D H;  1PH3 A;  3HOV G;  2NN6 I;  3I4M H;  1PHJ A;  2N8N A;  3KYH C;  4B3M Q;  1HJP A;  4DUY L;  1TWG H;  3BZC A;  2CFM A;  4LUV A;  5JJL A;  3PIP A;  2HHH Q;  4NPS A;  1LM0 A;  1IBL L;  4NXN Q;  3HFZ B;  3UE0 A;  4IO9 A;  4IOA A;  4JBW A;  3GTQ H;  4UP9 A;  2OCE A;  3OTO L;  1XMQ Q;  1WYD A;  1HNZ Q;  3M4O H;  4B3T Q;  1YVC A;  4QY7 A;  2OTL A;  1YJ9 A;  2UU9 L;  3F2C A;  5M5X H;  4UP8 A;  4JV5 L;  1GVP A;  4DK6 C;  1TXY A;  4OX9 L;  4O2D A;  4OO1 I;  1B8A A;  3BJU A;  2JA6 G;  2B3G A;  2F3I A;  3CP0 A;  3S1R H;  1HNX L;  4YCW A;  5AJ3 Q;  4AH6 A;  3PUY A;  3HOZ H;  3DM3 A;  3PF5 A;  4GKK L;  1DGS A;  2VL6 A;  1K73 C;  3I4N G;  1JE5 A;  4O0A A;  3W5O A;  5C3E H;  2AWN A;  4JI0 L;  1MIU A;  1W3S A;  4X65 Q;  4UCU A;  3UE1 A;  4Y7N H;  1S72 A;  4LH6 A;  3BA9 A;  3KF6 A;  3VNN A;  3HKS A;  4YCU A;  4A3E G;  4DAY B;  4AIM A;  2QGQ A;  1OXX K;  5FLM G;  2Q2U A;  3PF4 A;  1XPU A;  4DV2 L;  4AQY Q;  1CKO A;  3WWV A;  1QVG A;  1KXL A;  3S15 H;  2F52 A;  4OWX B;  5IP7 G;  4DV1 L;  4IOC A;  4BY7 H;  2JJQ A;  3HOV H;  2AHO B;  1SRO A;  4B3R L;  2GN5 A;  4NXM L;  1WOC A;  1WCM G;  4JOI C;  4DV7 L;  4LNQ A;  4DR5 L;  3K7A H;  5IWA Q;  4C2M H;  4HJA A;  2R7Z G;  4JI2 Q;  1NY4 A;  1YHA A;  4APV A;  4R4C A;  4X66 Q;  4JI6 Q;  2KHJ A;  1VQM A;  4DK3 C;  2VS1 A;  2Q2T A;  1XMO L;  1UWV A;  1B7Y B;  2CWA A;  1C7Y A;  3KFU A;  1PA6 A;  4BBS H;  4C3I H;  2MO0 A;  3Q8D A;  5C0X G;  1E1O A;  5IYD H;  1TA8 A;  4DR3 Q;  5IY0 A;  2R93 G;  4GLX A;  1VQG A;  3HOU G;  3K8A A;  2OQ0 A;  3J81 i;  1VQC A;  3H15 A;  3M7N A;  2OTJ A;  2JA6 H;  2Y0S G;  3S16 H;  1L2F A;  3HOX G;  2DGY A;  4BA1 I;  1PV4 A;  1J5E L;  2UUB Q;  4Y52 H;  4NB3 A;  4MTN A;  5HY6 A;  1XDN A;  3AFQ A;  5IP9 G;  4A75 A;  1YJN A;  4QIW E;  2VUM H;  3BAA A;  1I3Q H;  5LMN L;  2EQS A;  1N32 Q;  4UFZ A;  2PI2 E;  1K0R A;  1Y1V G;  3L2P A;  5M3F H;  2BA1 A;  3PGZ A;  4DUZ Q;  4A3J G;  1QZG A;  5IYB G;  1Z9F A;  4GKJ Q;  2K4K A;  1RIP A;  4QL5 A;  1CUK A;  2ES2 A;  3M3Y H;  2K52 A;  4DR6 L;  1AH9 A;  2RHQ B;  1VQ8 A;  3NEL A;  1Q12 A;  3TQY A;  4IJH A;  4LF5 L;  3GTM H;  1M1K C;  1VQN A;  1EQQ A;  2R6G A;  2R7Z H;  2JQO A;  2E5L Q;  4B3M L;  1YIT A;  1VQI A;  2JA7 G;  5EAY A;  2HHH L;  5JJI A;  3JC6 6;  3RZD H;  1E24 A;  3NBZ B;  4P73 A;  3PO3 G;  4GNX C;  1HNZ L;  4IPD A;  4P74 A;  3GTJ H;  4B3T L;  4BBR G;  2ZJP A;  5D1O B;  4CC6 A;  1TWA H;  5C0X J;  4XTC S;  3CCJ A;  3D0F A;  5C44 G;  3HOY H;  1YNX A;  4A3L H;  3E9H A;  4DNI A;  4LFC Q;  3HOX H;  4JOI A;  4UCR A;  1HNW Q;  1UEB A;  1FL0 A;  2A1A A;  3JAM i;  3ULL A;  4UCO A;  4BY1 G;  5IP9 H;  3K0X A;  4DR2 Q;  2ZTE A;  3BZK A;  5H1S E;  4R4T A;  1IBK L;  3CC2 A;  1JT8 A;  2Q2H A;  5BR8 Q;  3S14 H;  2I5M X;  4JYA Q;  1XJV A;  2D0P A;  1I94 L;  3QWU A;  4B3S Q;  3TY5 A;  1Q82 C;  4OWW B;  2PQA B;  2GVB A;  3W1G A;  2Z0S A;  4X65 L;  4RG1 A;  4JI1 Q;  1V9P A;  3F2D A;  3GD7 A;  3CCE A;  1Y1V H;  2ID0 A;  4A3J H;  4YY3 Q;  2E2J H;  2VQE Q;  4GLV B;  1S40 A;  3S1Q H;  1VQA A;  4X6A H;  3PUZ A;  4DV0 Q;  2R92 G;  3PCO B;  4JI8 Q;  4EFE A;  4LF6 L;  4AQY L;  1MJE A;  1PH7 A;  4A3B G;  3S2D H;  2UUA Q;  2UXD Q;  5GAG C;  1R9T H;  3M9B A;  1GKH A;  3CMA A;  1PH1 A;  2VQF Q;  2H5X A;  2Z6K A;  3FHW A;  1IXR A;  4IFD G;  4QQB X;  3CC4 A;  1JJ2 A;  1PVO A;  2JA7 H;  5K36 G;  5IWA L;  3TRZ A;  4JI2 L;  5C4J H;  3G71 A;  4GNX B;  1L1O C;  4X66 L;  1Y1W H;  4MZ9 A;  4GOP C;  2UUC L;  3PO3 H; 
#chains in the Genus database with same CATH topology
 3C46 A;  3ULJ A;  1EWC A;  2NB0 A;  2KBN A;  3NSW A;  4GLW A;  1XMQ H;  4BA2 I;  4NMZ A;  4YP3 A;  2H4O A;  2K04 A;  5C4J B;  3KTM A;  2B63 G;  1JOQ A;  3NGD A;  2E8G A;  2FFK B;  3EBE A;  1K83 A;  3ERQ A;  3MR6 A;  4BBR B;  1SYG A;  1Y1V A;  1GOZ A;  5COR A;  5BWX A;  5JVD F;  5KS8 A;  3NBI A;  4GZY C;  4PZ7 A;  5CYU A;  5EBC A;  3C2P A;  4KLK A;  2YZL A;  1EY5 A;  4C3H B;  1L2Z A;  4A76 A;  2GQS A;  4R8U A;  3IAY A;  4MTE A;  4X65 H;  4ED0 A;  2HCI A;  3DEP A;  1S3O A;  2M9V A;  5I60 A;  4A3B H;  2JA7 A;  1VKZ A;  2K5Q A;  4AQY H;  4QCL A;  1BBW A;  1X3E A;  1EYC A;  1VQ9 A;  5KFE A;  4LF9 Q;  5L1I A;  5L1K A;  4NLG A;  4JI7 L;  1X6O A;  1B70 B;  1VAJ A;  5EWE A;  5T1I A;  5K36 H;  3R2T A;  1L1O B;  4IZO A;  4JBM A;  4GOP B;  3TME A;  1DON A;  3M9N B;  3HKZ G;  3UI2 A;  5IWA H;  4M8A A;  4I7A A;  4DR1 Q;  2FPP B;  1W6K A;  5FOB B;  4LF8 Q;  2N55 A;  3T5L A;  1ZHS A;  4LF4 Q;  4DL3 A;  2B2Y C;  4A3G G;  4EQ5 A;  3CC7 A;  3GTP B;  2YWV A;  2YZN A;  4DR3 H;  4JI5 Q;  1RYS A;  2R8K A;  3T9A A;  4P71 A;  4NKL A;  2CNU A;  4HIO A;  2A5H A;  5L1J A;  3BG5 A;  4C3J H;  3GTG A;  5KFB A;  1Q7Y C;  4IHJ F;  3SK8 A;  4DAA A;  2WYO A;  4A3E H;  3FPP A;  1DM0 B;  2BA0 A;  2UXB Q;  1QNU A;  1VS0 A;  3F8T A;  3MFY A;  4QWA A;  3CQZ B;  1H9S B;  4YHH Q;  3NP8 A;  4MIU A;  1CSP A;  1SE8 A;  5ELC A;  3JAM c;  2UXB H;  3A7A B;  4YY3 L;  5C4X G;  4YHH H;  1ROD A;  3I4L A;  1EFW A;  1KDA A;  4Q5V A;  4DUZ H;  4ED1 A;  1BCP C;  2UUA L;  2ZJR A;  4R8N A;  1B3A A;  3W3A A;  2A6H D;  5FKA C;  4A93 B;  4WJ3 M;  3RN5 A;  2EYO A;  1YNJ D;  2B63 A;  1KQS A;  1B6S A;  1O7Z A;  5EPJ A;  5DM7 3;  1DV2 A;  3U55 A;  1Q46 A;  2WB1 B;  2CKZ B;  2XC9 A;  3I7F A;  3HRZ C;  1DOK A;  4P72 A;  4TV8 F;  3S2H B;  5KFG A;  2JEG A;  1UC9 A;  1X54 A;  4A3G H;  1KAA A;  4GN5 A;  2Y4R A;  5BYB A;  1VQF A;  4FM9 A;  1VQ4 A;  4IPG A;  1IBM Q;  3D8G A;  1C30 A;  1SN8 A;  1IBM H;  5JVG 3;  4A3I B;  5CE8 A;  5JUM A;  4J8Q A;  3KXY T;  1FGB D;  5BWU A;  1PH2 A;  4TQU S;  1F9R A;  2RKS A;  4HN2 A;  5AJ3 L;  1I1M A;  2YU9 H;  1LAC A;  2K6A A;  3E0J A;  4JYA H;  3RN2 A;  2RDJ A;  3E9I A;  1F9Q A;  5JJK A;  2RQX A;  1K0S A;  5KFZ A;  4EBD A;  3K6O A;  4ALP A;  3CCM A;  3NXW A;  3R5H A;  5IYB H;  3RAX A;  4UY8 C;  2E2I B;  4JBJ A;  3HKZ A;  5C0X I;  4XYM B;  4IUP A;  1CT1 D;  1VQJ A;  3OOC A;  3A5U A;  5E4W C;  1HCZ A;  4H13 C;  5D8D A;  5CM0 A;  1I2L A;  2Q7D A;  3GQB A;  2KHI A;  3FMC A;  1FR3 A;  2DWC A;  3NE5 B;  4EEY A;  5I5X A;  4QJF A;  4DV6 Q;  1MSH A;  4K5W A;  2F0P A;  2EE1 A;  4PMW A;  4RHS A;  1VQ7 A;  4DV6 H;  3KAJ A;  1T9H A;  1O7L A;  2A8V A;  3WO1 A;  2PQA A;  2WAQ B;  1QJO A;  1GHK A;  1S5C D;  3OYY A;  2ALY B;  2R8H A;  5LL6 b;  1PXU A;  1K8M A;  4RB0 A;  5DLF A;  3BAB A;  3E3X A;  4DV3 L;  3T1H L;  3W2D A;  4DR6 Q;  2WKC A;  4QUF A;  1AUX A;  4BY7 G;  1L0Y B;  4L1K A;  4QWE A;  1EZ8 A;  4A3M B;  4ZQ3 A;  1YHB A;  3H94 A;  4BY1 H;  1A3U A;  4A3F G;  3GTL H;  2AUK A;  1EY6 A;  1FJG Q;  3SK4 A;  1HUM A;  4GN4 B;  3NHH A;  4HQ6 A;  3OPO A;  1CQI B;  1KJQ A;  4PG3 A;  1JR0 D;  3Q0A A;  2W6O A;  1KRS A;  2EIF A;  3NQT A;  1TWG B;  1PTO F;  4Q4D A;  5KFN A;  3HKZ E;  1N34 L;  5K3W A;  1YI2 A;  4HNT A;  1OXV A;  1LTS D;  1OXS C;  1N33 H;  3GTQ B;  2K28 A;  3D4R A;  3G4S A;  3BQ0 A;  2HGW A;  3K57 A;  3ULP A;  3C3L A;  2AUJ D;  3K5O A;  1PTO D;  5G3L F;  1SND A;  2K5V A;  3L4K A;  1K28 A;  4XIG S;  5FJ8 H;  1YJW A;  1A8V A;  4KHZ A;  4DFA A;  4WJ4 A;  3E0E A;  2I0Q A;  2ZJQ A;  2CCZ A;  4LF6 Q;  5C3E B;  3G6E A;  1U4P A;  3T1H H;  2RHS B;  1UNS A;  3T1Y L;  5BPH A;  4RZR A;  5I5T A;  4RMF A;  1XK5 A;  4ED7 A;  4A3F H;  1K9M C;  1G91 A;  3GV5 B;  2AGQ A;  3MC0 B;  1M8A A;  4X3S A;  2IX3 A;  2EY1 A;  5BR8 L;  5KG4 A;  3UZO A;  4MV9 A;  2F0E A;  2L4N A;  3AU7 A;  1D7Q A;  2V1C C;  4LH7 A;  1RK5 A;  4FVM A;  4XQQ A;  5KIX A;  1XPR A;  4O2A F;  3J7A K;  4EQO A;  4JV5 Q;  4LFA L;  4JV5 H;  5FO7 B;  3BVG A;  2EJ3 A;  3KHL A;  1IYU A;  4J9N A;  3CAM A;  2Z6K C;  4GKK Q;  5TSS A;  1RJT A;  2WKD A;  2JA5 H;  2EPB A;  4E6I A;  1BVS A;  1EQV A;  3CME A;  2JA6 B;  1IYE A;  3A5Z B;  4B9X A;  1JC7 A;  4ECR A;  2ASJ A;  3P1H A;  3H0G G;  5KG5 A;  3J80 W;  4CBV A;  2NVT B;  1VQ6 A;  5A2Q E;  1JOR A;  2IT1 A;  1LT3 D;  4WBN F;  3BG3 A;  5FD5 A;  4N9T A;  4LUO A;  3CD6 A;  4DV1 Q;  3N40 P;  3GDE A;  1N8R C;  1MKH A;  4GC6 A;  2C2E A;  4KHP L;  4JI3 Q;  1N36 L;  3P75 A;  4DV1 H;  3FP9 A;  3ZYY X;  2YV5 A;  2DUD A;  5BYA A;  2BH8 A;  4DV7 Q;  3I2Z A;  5M3F B;  2NUA B;  2MJ8 A;  4JV1 A;  5EWG A;  1QCB D;  1QUQ A;  1QIL A;  2F4V L;  4DV7 H;  2XGT A;  4DL2 A;  1EQR A;  3OIP A;  2K05 A;  2W6P A;  4P2C B;  1XMO Q;  4TSS A;  3Q22 A;  5KFH A;  1TWF H;  1UUP A;  1BXT A;  4N8F A;  3K3V A;  4HED A;  3V6H A;  5KFJ A;  4DA2 A;  5J2U F;  4ECV A;  1WTV A;  1HPC A;  3V4S A;  2HIX A;  2LSS A;  3WOE A;  5IIF A;  2RCF A;  1I3Q A;  3M85 A;  1X9N A;  1O7Y A;  4CC5 A;  4DXG A;  1KLU D;  2BDO A;  3VR6 A;  2C35 B;  2PO4 A;  3K5I A;  3H0G H;  1CQV A;  1UE7 A;  5LMN Q;  3I12 A;  5L9X A;  5LL6 X;  2UVR A;  1SNO A;  1AN7 A;  4EYH B;  1QB5 D;  3Q8P B;  4E6N A;  2EOT A;  5LMN H;  4FF4 A;  1U5K A;  2AQ2 B;  3KF8 A;  3CW2 C;  2YYZ A;  2QK4 A;  1CSQ A;  4IIJ F;  4O42 A;  1S0M A;  3RB0 A;  2BQU A;  5F2D A;  4JG2 A;  4RGM A;  5HGT A;  3VPD A;  4K0K L;  3J80 E;  1Q1E A;  2WP8 J;  2WTF A;  4A3J B;  1TWF A;  5DQG A;  1N36 H;  4DNT B;  3QB3 A;  3TZU A;  1PH3 A;  2OXP A;  3BZC A;  4E4T A;  2CFM A;  2F0L A;  3RF2 A;  1IBL L;  2DN8 A;  3SDZ A;  2HDM A;  1ZYR D;  4DL7 A;  3OTO L;  2FJ2 A;  4QWB A;  4B3T Q;  4G7H C;  2SNM A;  4MHE A;  5FO8 B;  4UUG A;  4UP8 A;  2F3W A;  1O78 A;  3H0G A;  2EYH A;  2KCN A;  3EQL C;  1JKJ B;  2MHV A;  4ODG A;  2RGR A;  4QF4 A;  3S1R H;  1HNX L;  2KVM A;  3D4W A;  4YCW A;  2PNR C;  4MV3 A;  4O83 A;  4YAJ B;  3I4N G;  2AWN A;  1MIU A;  4DL6 A;  4Y7N H;  2B39 A;  1S72 A;  1CA5 A;  4LH6 A;  3KF6 A;  3HKS A;  2Q2U A;  3PF4 A;  1OXX K;  4KN7 C;  2GPS A;  3BAC A;  4U6P A;  4XYQ A;  2TSS A;  1PTO B;  5FK9 C;  4DV2 L;  1QVG A;  4IUT A;  3S15 H;  1AZP A;  2XCA A;  1PZJ D;  5KG0 A;  2F0U A;  2W57 A;  1F2Y A;  1SRO A;  4IRD A;  2GN5 A;  2C9O A;  1HHV A;  1WOC A;  1WCM G;  5M9O A;  2NVX B;  4CDD C;  5BWW A;  4RWS C;  4C2M H;  1NY4 A;  1YHA A;  4X3K A;  4JI6 Q;  3J81 L;  2CNQ A;  2R85 A;  4DL5 A;  1MBY A;  2Q2T A;  4BBS H;  3KFU A;  2W9C A;  2UUC H;  5ELE A;  4C3I H;  1EOT A;  5KFX A;  4LAA A;  4ZYS A;  4RAU C;  3Q8D A;  5NUC A;  4O3Q A;  4K5V A;  2A6E C;  3U9O A;  2R93 G;  3HOU G;  3M7N A;  1VMP A;  1VQC A;  3VYR A;  3T5K A;  4ECY A;  4FF2 A;  1JB3 A;  2Y0S G;  4Q4C A;  1H9R A;  2DGY A;  1PV4 A;  3P7J A;  2Q8I B;  1J5E L;  4Y52 H;  4FO2 A;  1WTQ A;  4ED2 A;  4MTN A;  1EIH A;  2Q8T A;  2HDL A;  1KNE A;  5IP9 G;  1HNX H;  5JPM C;  1YJN A;  1JOO A;  4NW2 A;  3BAA A;  4MA5 A;  1V51 A;  2K5W A;  5JEA H;  4IAL A;  2ABJ A;  2ZM6 H;  4ID6 A;  3T9F A;  2BA1 A;  4C2M A;  2K4K A;  4QL5 A;  5DQI A;  1CUK A;  2A69 C;  2K52 A;  1XWE A;  3QOL A;  4G7Z C;  3TW6 A;  1Q12 A;  4LF5 L;  1AUV A;  5DG7 A;  4O2B F;  4RCO A;  5CMD A;  2B2V C;  4QWD A;  3H4B A;  3KAK A;  1HUN A;  4HCS A;  4K2K A;  3K59 A;  1E24 A;  4P73 A;  5I5W A;  1HNZ L;  5D1O B;  4P74 A;  4PMB A;  4ZOL F;  4BBR G;  4YQW A;  2XVS A;  1TWA H;  3FDT A;  1DIK A;  4J0M A;  1EY0 A;  1STG A;  4DK0 A;  5KFT A;  1ENC A;  3HOY H;  2DPI A;  1Z7T A;  1SAP A;  4IUQ A;  2FKL A;  4KTA A;  4C3H G;  5DLG A;  2YRW A;  5IP9 H;  3V4Z A;  2ZTE A;  4LJZ C;  2FB9 A;  1BCP D;  3S14 H;  4CGY B;  3ERO A;  4J9Q A;  1I94 L;  3QWU A;  2G5D A;  2Z1C A;  5CB4 F;  4RG1 A;  2VB2 X;  4JI1 Q;  1WCM A;  3GD7 A;  2E2J H;  4O7R A;  2VQE Q;  4DV0 Q;  4JI8 Q;  5HBR B;  4EFE A;  1MJE A;  2UXD Q;  1E4F T;  3QJY A;  1B6R A;  2AU0 A;  2FMC A;  2UXD H;  5KGU A;  4KKS A;  3GTK B;  2O2L D;  2KUM A;  1S10 A;  2CH4 A;  2PN1 A;  4IFD G;  2PMZ A;  3WO0 A;  2R93 A;  5DMX A;  2PBZ A;  1TWH B;  1JJ2 A;  5LL6 S;  3HB9 A;  2Y0S A;  3J81 W;  3HGB A;  5C4J H;  1GUS A;  3G71 A;  4JI2 L;  1Y1W H;  4X66 L;  1F2Z A;  5EKK A;  5M5Y B;  2A19 A;  3T7A A;  4DV4 Q;  5KFK A;  2VZA A;  2L11 A;  4AYB E;  5GAD C;  3G48 A;  1STY A;  1HNZ H;  2DNE A;  2RSO A;  2JE6 I;  1VCI A;  1YNN C;  4YCV A;  4M9U A;  2R84 A;  1UE1 A;  1TWC H;  1GSH A;  3PO3 B;  4UPA A;  2KHS A;  2WV6 D;  2E2D C;  4RGN A;  1LLR D;  3NBH B;  3DTG A;  4Q0Y A;  2R8J A;  3MAQ A;  3PIO A;  1HA5 A;  3FRP B;  4LWC A;  4QIW A;  4GNX A;  4TQR A;  4JXU A;  1KL9 A;  1N32 L;  4HTH A;  4A93 G;  5EBD A;  2JYO A;  2PI2 A;  5KFI A;  1SYF A;  4GKJ L;  1Q8K A;  4JVZ A;  2F0V A;  2PMZ E;  3S1N B;  4XYO A;  4PDB A;  5E4X A;  3TEH B;  1GD7 A;  2R92 B;  1B1Z A;  4DK1 A;  3PFF A;  2EJF C;  5IT9 c;  3T4A C;  1JCK B;  4CJ1 B;  5IE8 A;  2FMM A;  3VA7 A;  3CVZ A;  2Y0S E;  3PW4 A;  3CPW A;  1TWC A;  4HJ8 A;  3H20 A;  2QKI C;  4KV6 A;  2Z8L A;  4RB1 A;  4IUR A;  1XNQ Q;  3HZX A;  2K1B A;  2PW5 A;  5BMV F;  3QG1 A;  1PFS A;  4A3I G;  2B2U A;  1PH4 A;  4FFR A;  5AFW A;  3S17 H;  5KG2 A;  1DOL A;  1STN A;  3RLF A;  5GON F;  2OWO A;  1HR0 L;  3BU2 A;  3TP6 A;  5M5W B;  4DV5 Q;  4LFC L;  3TSS A;  2N78 A;  3N41 B;  4DV5 H;  5JVL A;  3BA8 A;  4DR2 L;  3S1M H;  2UUB H;  1QVF A;  1L1O A;  1BKB A;  1S5B D;  2CWP A;  3L9A X;  4GOP A;  4H44 C;  3TY9 A;  3GIP A;  3BQ1 A;  4B3S L;  2R7D A;  4XDX A;  2VUG A;  1VQE A;  2SCU B;  4L63 B;  3J81 j;  5ELF A;  2XIG A;  2SOB A;  4I7Z C;  4KK7 A;  5KEE A;  4DR7 Q;  4XX0 B;  4DR7 H;  3KLW A;  4YWM A;  4RAY A;  1QZH A;  4DR4 Q;  1SRU A;  3GTP A;  5KFW A;  3AW8 A;  5I5U A;  5C3X A;  1XNR L;  3TP5 A;  2K5H A;  3AQQ A;  2RGV A;  4EVO A;  3TS2 A;  3PSI A;  3GV7 B;  4EX5 A;  5ISR A;  5KNB A;  2R8I A;  1K1S A;  3MR3 A;  4ECT A;  1EKF A;  3KHG A;  4ECW A;  1PLF A;  4NXN L;  2NVQ B;  1A63 A;  2DAA A;  5T14 A;  1RL2 A;  2AMC B;  4O86 A;  1JXL A;  3VR4 A;  3X3N A;  5C0X H;  4HMI A;  4A3I H;  1XMQ L;  3T16 A;  4HN7 A;  1SCU B;  3CQZ A;  1JJG A;  1Z2P X;  1EU4 A;  3CCU A;  1E1T A;  1G29 1;  1I50 B;  2B8F A;  3ITP A;  3RTX A;  2LKV A;  2R7F A;  2IPK D;  2NWG A;  4NXM Q;  2IHE A;  3BQ2 A;  4MV4 A;  3U4V A;  4LFC H;  3TS0 A;  1U9R A;  1D5X C;  1V1P B;  2V4D A;  4Q8E A;  2N49 A;  4XQJ A;  1ESR A;  4FFN A;  3STB C;  5J22 A;  4DR2 H;  3D6C A;  3EA6 A;  1K3R A;  4OEM B;  1SFO B;  2D5D A;  3QFF A;  1UC8 A;  3R2I A;  2O5J C;  1U4R A;  1MJC A;  1K83 H;  2QIL A;  2ODT X;  4MV1 A;  4CJ2 C;  1T3N A;  2D0O A;  1X65 A;  1GUO A;  1CKN B;  3SNO A;  3M4Q A;  3TII A;  1HZ9 A;  1VQH A;  1BCP B;  2O4X A;  2P0A A;  3T54 A;  3N6X A;  4TV9 F;  2MGS A;  4G7O C;  2FMA A;  4FF3 A;  5FPO A;  3VR3 A;  3KOJ A;  1H9J A;  1KAB A;  4EQN A;  3IN5 A;  2P5Z X;  4LF9 L;  4HSP A;  1HZA A;  2KEN A;  3A8J E;  2F0H A;  4LMQ D;  2VQF H;  1CK1 A;  3ND9 A;  2EXD A;  2LS0 1;  1SEI A;  2EYP A;  3J7Z C;  1EKV A;  1EL0 A;  3KHH A;  1SYB A;  1N48 A;  4MNO A;  4DRF A;  2HG8 A;  3OSN A;  2ATW A;  4JCV E;  4C56 C;  1A3V A;  4CMD A;  2K5D A;  3K80 C;  1D8L A;  1C3O A;  3R5F A;  4DR3 L;  4A3K B;  2E2I A;  5C44 H;  2RA4 A;  1HR0 W;  2JA8 B;  4JI5 L;  3KLR A;  3I3C A;  1PK8 A;  3CKI B;  4NDX A;  2RVL A;  1UE5 A;  2F0W A;  3A0J A;  5I9P A;  3K5M A;  2Z02 A;  3KLS A;  3VOT A;  5KT2 A;  2KA7 A;  5KFA A;  2B8G A;  2NVY B;  2WB1 E;  2ASB A;  1NMG A;  2E76 C;  5M3M G;  3I4M B;  5BWV A;  2J7Z A;  3N6R A;  2UXB L;  4X64 Q;  1HZB A;  4YHH L;  2EZV A;  2Z6B A;  1KT8 A;  3GTG H;  1LT5 D;  4DUZ L;  3AEV A;  3L0O A;  1A0I A;  2VXW A;  2XCL A;  1W6J A;  2FP4 B;  3T9D A;  1N9W A;  3M4O B;  5K2M A;  1PMR A;  2I5L X;  4ULL A;  2HCC A;  2F0O A;  5ELB A;  5FLX L;  2QA4 A;  2YL2 A;  4LF9 H;  1HTL D;  5M5X B;  2UVW A;  1IBK Q;  3HOW G;  3U54 A;  2F4I A;  3RJ0 A;  4K5X A;  3DWP A;  2V9W A;  2D2C C;  4LFB Q;  3TIG A;  1SYX B;  3SI8 A;  4IRC A;  1DOM A;  4LFB H;  3VR5 A;  4DR1 H;  2UXC Q;  3HOZ B;  4F4Y A;  4LF8 H;  5KFP A;  5M3F G;  2B63 H;  1VQL A;  4OEL B;  3M7G A;  4LF7 Q;  3L4J A;  1S0N A;  4LF4 H;  1IBM L;  3GTQ A;  1EYG A;  5GQO A;  4BS9 A;  3WNZ A;  4JI5 H;  4DUY Q;  4HAE A;  3N52 A;  1X32 A;  1BQQ T;  4IFD I;  2MUY A;  5IGE A;  3K81 C;  4DXF A;  1Q81 C;  3F8N A;  4JYA L;  1SLJ A;  5M3M H;  2WAQ E;  2F0J A;  2R7K A;  2CW7 A;  4YR3 A;  2VQD A;  4RNM A;  5KT5 A;  5IYC G;  2RCN A;  4OX9 Q;  2N3S A;  2I8C A;  2ASL A;  4OX9 H;  2FHT A;  3PUX A;  3R5X A;  4RA8 A;  5GAE C;  4A3L G;  3BDC A;  4QGU A;  3K3P A;  5DNF A;  4CKE A;  3HOW H;  2AQ1 B;  2NVT H;  3K5H A;  4O4L F;  5J3B A;  3T53 B;  3UDI A;  5IT9 L;  5JJZ A;  5IGF A;  4DV6 L;  2K14 A;  4JI0 Q;  2W9B B;  1GUT A;  2VB3 X;  2WII B;  4CHT B;  3S16 B;  1AZQ A;  1LTR D;  4JI0 H;  2LXJ A;  2Z9H A;  5CAE B;  3U9S A;  2YRX A;  5CV7 A;  5JEA J;  2B2W A;  1SBB B;  5IGC A;  4HIK A;  1WTH A;  2VUM B;  2NU8 B;  3FKI G;  3QR8 A;  4LW1 A;  1VQ5 A;  1RCV D;  5JPN C;  4TVI A;  2W6Q A;  1BDO A;  2L0C A;  5DG9 A;  4UP7 A;  2MO1 A;  4JI7 Q;  2L1B A;  4V0B A;  2XIW A;  4IAJ A;  2K5N A;  4O82 A;  2AQ4 A;  2OT2 A;  3WWI A;  1H9M A;  1FJG L;  3BJY A;  1HQM C;  2K50 A;  1AFP A;  2KED A;  1KTA A;  2CNV A;  2ZTD A;  2LMC B;  5I6W A;  1G2S A;  1E0B A;  4X3U A;  3RZO H;  1I2K A;  2WE6 A;  5C4X H;  5IYC H;  1BNZ A;  4PV1 C;  1I6H H;  1O7I A;  5I6Y A;  3GJX B;  1N33 L;  5FD6 A;  5E1F A;  3J7A V;  2HVS A;  3RB4 A;  2E2H H;  1SMX A;  2JEB I;  1G2W A;  5FLX W;  1TR5 A;  3LX0 A;  5FPR A;  3GTJ B;  1TAE A;  3VPB A;  1NSN S;  1EY4 A;  1LUZ A;  1CS0 A;  4O3R A;  5LYJ F;  1Q8I A;  5I4D A;  1ASY A;  3BS1 A;  2GVA A;  2J6U A;  4JBK A;  2FK1 A;  2HVR A;  4OGQ C;  4J9O A;  4FXD A;  1HA6 A;  1EWI A;  2FXQ A;  3V96 A;  4C5B A;  2XWJ B;  1MD2 D;  5HGQ A;  3FKI H;  2COG A;  4ZUJ A;  1RF2 D;  3MR2 A;  4ZKB B;  2KCC A;  2K01 A;  1Q1B A;  2W70 A;  4DR6 H;  3TN2 A;  3L3O C;  1SDF A;  3S1Q B;  4P75 A;  4WJW A;  3HOV G;  2V5A A;  2VPQ A;  1Y8P B;  2O03 A;  2N8N A;  1HQR D;  3S2D B;  2EYM A;  5LHY 1;  4LUV A;  3PIP A;  2HHH Q;  5KFY A;  1A2U A;  2ZDH A;  1FJG H;  2E2H A;  4IOA A;  4JBW A;  4MV8 A;  5EZY F;  2KEE A;  2F0T A;  3RFC A;  1S97 A;  1LT4 D;  3EVQ A;  5I5S A;  3KUP A;  2F3V A;  4QY7 A;  2OTL A;  4ED6 A;  5BWR A;  4JV5 L;  2RSN A;  4EBE A;  1TXY A;  5I9O A;  4FFP A;  1A3T A;  5F9N A;  2MCT A;  4RB2 C;  4PNY A;  2F3I A;  3CP0 A;  4EGQ A;  5CV5 A;  4KMU C;  4PWQ A;  5IT9 W;  3BYT B;  3FKI A;  5AJ3 Q;  2XGP A;  3PUY A;  5C4H A;  4GKK L;  2VL6 A;  2KOL A;  1K73 C;  4O7L A;  1JE5 A;  3CRL C;  3T99 A;  5EOY A;  1W3S A;  2NU6 B;  1JQY D;  3I91 A;  3UE1 A;  2HHF A;  4DQN A;  3PVX A;  2EXZ A;  1WTO A;  3GV8 B;  5FLM G;  2L12 A;  4NZO A;  1XPU A;  1GUW A;  3WWV A;  3Q2O A;  4M0J A;  1IW7 C;  1ET6 A;  4LF6 H;  4Z9C B;  5IP7 G;  4DV1 L;  4BY7 H;  1N56 A;  5DAU A;  3N42 B;  1CE8 A;  5G3L D;  1BXR A;  3HOV H;  5KFQ A;  5LOV F;  1ET9 A;  3N44 B;  4JOI C;  4DV7 L;  1YNN D;  4A3B B;  2C5C A;  2F0K A;  1M6V A;  5DGI A;  3PW7 A;  4APV A;  1JWM D;  4RZQ A;  1B2T A;  1M7J A;  1VQM A;  4DK3 C;  2VS1 A;  1XMO L;  2VOB A;  1B7Y B;  2CWA A;  2C22 A;  1PA6 A;  3K7A B;  2MO0 A;  3NQI A;  4J1M A;  3RGX A;  4GLX A;  4XT3 B;  1VQG A;  1CI3 M;  4JK1 C;  4CMF A;  2IJ0 A;  3PW5 A;  1Y69 U;  3DF7 A;  2EJM A;  4RAZ A;  1ZET A;  4FFO A;  1KC7 A;  3SE7 A;  3NPP A;  4YIJ A;  2NVX A;  4EBC A;  5HY6 A;  2M00 A;  3BVZ A;  1GJX A;  4GKK H;  1HXY D;  1GSA A;  4MV7 A;  1I3Q H;  1T36 A;  3CEB A;  5LMN L;  3R23 A;  2EQS A;  4Q44 A;  3P20 A;  3UYY A;  4C3J B;  1K0R A;  1QZG A;  2J6T A;  4IWX A;  4KY5 A;  1RIP A;  2JSO A;  5KFO A;  3M3Y H;  4EQP A;  4A3E B;  1PZI D;  2ES2 A;  2RDH A;  1GYF A;  2CVR A;  3GTM H;  4IJH A;  4JI3 H;  1EYA A;  1Z2N X;  4NP5 A;  1EQQ A;  2DPJ A;  2HQE A;  2E5L Q;  3H91 A;  1A6X A;  1NNX A;  1VQI A;  2E5L H;  4FP5 D;  4L6T B;  2JN4 A;  2WDT A;  1KEE A;  3QZ8 A;  1NUC A;  3WDN A;  3RZD H;  2EIY A;  3NBZ B;  1CQJ B;  2R7Z B;  3PO3 G;  1XMO H;  2XN9 C;  4B3T L;  3JAM L;  1LT6 D;  5C0X J;  1WR2 A;  2KJX A;  3CCJ A;  3LP8 A;  2IL8 A;  3D0F A;  1GLV A;  1YNX A;  4J9M A;  5IGG A;  3E9H A;  5C1O A;  2I87 A;  1HNW Q;  1UEB A;  1FL0 A;  2A1A A;  2EVB A;  1DXM A;  5DGB A;  1E4E A;  4A3G B;  4UCO A;  3MWY W;  3K0X A;  5H1S E;  1RJR A;  1JT8 A;  5BR8 Q;  2I5M X;  3IFT A;  4K8J A;  1Q82 C;  3HOX B;  2PQA B;  4CKC A;  3V6K A;  3GTM A;  3A7L A;  1V9P A;  5EQ0 A;  1SYD A;  4MTK A;  4KD3 A;  3F2D A;  3CCE A;  2ID0 A;  4K6D A;  1PZK D;  5KG6 A;  4GLV B;  4X6A H;  4QW8 A;  1VQA A;  4APM A;  2OH2 A;  2YU9 B;  2W71 A;  2MPM A;  3PCO B;  2R92 G;  1E2Z A;  1PH7 A;  3BZD B;  1CHP D;  5EKI A;  4KKT A;  1PDQ A;  1T94 A;  3I72 A;  3OSO A;  1ZAU A;  1TS2 A;  1S9F A;  3CC4 A;  1V1O A;  1RK6 A;  3M4Y A;  1ILP A;  1CM9 A;  1R9T B;  3TRZ A;  5D3I B;  4F87 A;  1A0G A;  5KFC A;  2UUC L;  3PO3 H;  1A48 A;  4G4K A;  4KJN A;  2R87 A;  4O3O A;  5EWF A;  3HO8 A;  1QVC A;  4Q8F A;  1AP0 A;  2W9A A;  3STB D;  4B3T H;  3MXN A;  2HVQ A;  3U4Z A;  4CE5 A;  4KHP Q;  4HNV A;  2UVU A;  4RU9 A;  1AN8 A;  2RDF A;  3H3V H;  1EYZ A;  2AGP A;  3GTK A;  2QDL A;  4FS2 A;  3QZ7 A;  4X62 Q;  4YWK A;  4K14 A;  1EKP A;  4ECU A;  1TWH A;  1NAP A;  4X62 H;  2YS7 A;  4TVA B;  4AYB G;  1KJJ A;  1PFN A;  3CCR A;  5ELO A;  5LMN W;  4BY1 B;  2FJZ A;  2ZM6 L;  3GTL B;  1DV1 A;  5E25 A;  3GB8 B;  4XZ3 B;  1SMY D;  5LMU Q;  2EY6 A;  2COI A;  5D1P A;  1WI5 A;  1FNW A;  2WAC A;  2B2W C;  3L7Z C;  1CZG A;  4R1J A;  4UDU C;  2YS6 A;  1P8L A;  2F0I A;  2TMP A;  3U58 A;  3EIV A;  2B29 A;  4YB8 B;  1U0L A;  1X3F A;  3GIL A;  5ELN A;  4ECX A;  3TRE A;  1GHJ A;  3NBH A;  3KDF B;  3ICE A;  5KT7 A;  3PW0 A;  1VDZ A;  2XTI A;  5J39 A;  1VQP A;  5LXT F;  4HNU A;  5HV6 A;  5JQW A;  3PO2 G;  1K8A C;  3GV3 A;  1NTG A;  4JI6 H;  4ECS A;  1UAP A;  2FLN A;  1PH5 A;  4ZKC B;  5JH7 F;  4YWL A;  4DAY A;  3JAM W;  3KJP A;  1G6Z A;  2HT1 A;  1YNJ C;  3CRK C;  1Q90 A;  3LNN A;  2IY5 B;  2CQO A;  1ESF A;  2VPS A;  3PW2 A;  2BQ3 A;  4RNN A;  4L5T A;  4F4W A;  1TVX A;  5KFL A;  1RYR A;  1EUC B;  2R92 A;  2ICI A;  4IUU A;  1KIX A;  3I4N H;  1M0W A;  3TZD A;  3OW2 A;  5I5Y A;  5CGK A;  4YJ2 F;  1ENF A;  2OF1 A;  4A3F B;  3OTO Q;  1S5F D;  2I5H A;  2C2D A;  4ZUI A;  3DAA A;  3TY8 A;  1MI2 A;  1OO9 B;  3M4I A;  1STB A;  2VQE L;  3K0Y A;  4GS3 A;  2DIK A;  5KT4 A;  3H09 A;  4I50 F;  1KTK A;  2V59 A;  2UXD L;  4MN3 A;  3GTO H;  2CW8 A;  1S4Z A;  2NN6 G;  3I73 A;  4FU0 A;  1WCM H;  3SEB A;  3NWT A;  2ZXR A;  4EGV A;  4OHJ A;  2VR1 A;  4DKA C;  5JVH 3;  5KFR A;  3MZ5 A;  5KT3 A;  1G51 A;  5KNC A;  1GGO A;  2I46 A;  1SNQ A;  4RH6 A;  1EUJ A;  1I50 H;  1E2V A;  2EYL A;  2Z4I A;  3PO2 H;  4A3K G;  4YAK B;  5C6A A;  5KKN B;  1UEA B;  5EPL A;  1W2B A;  4DV2 Q;  2JA5 B;  2R93 H;  1RTO A;  3VYS A;  3R3O A;  2QEJ C;  3HOU H;  2Z4H A;  4NZN A;  3IG0 A;  4AYB A;  2ZGI A;  4JI4 Q;  4GC7 A;  4JI4 H;  4IN3 A;  1FNV A;  3HEJ A;  3PZP A;  2NYZ D;  2YZM A;  3QOJ A;  1M90 C;  1II3 A;  3ZJY C;  3I4M G;  2BH2 A;  3KAL A;  3F2B A;  2L55 A;  3GTO A;  1PRT C;  1H9K A;  3V2T A;  4JI1 H;  2B2Y A;  4WRD A;  4O7N A;  1M0T A;  2NUC A;  2VQE H;  3RAQ A;  4EEQ A;  1I50 A;  4DV0 H;  4JI8 H;  5EGT A;  3TBI B;  4RUC A;  1TWF B;  1HFN A;  1B53 A;  1TY2 A;  1J5E Q;  3SR1 A;  4DPG A;  2HQL A;  2LY7 A;  5KYL A;  1V1P A;  2F0Q A;  3GLK A;  1JB7 A;  2EDG A;  4HIM A;  3HOZ G;  4XT1 B;  4UCS A;  3Q8R B;  3T9E A;  1SFO A;  4GLA C;  4POF A;  1A15 A;  3OWF A;  4BBR H;  3I55 A;  1KD1 C;  1CKN A;  2IWH A;  5C5M A;  4XQN A;  3J7A 5;  2R7N A;  4DIM A;  4DV4 H;  3RIZ A;  3H0G B;  1NR4 A;  5CC4 A;  3RR5 A;  1X3G A;  2IMW P;  3J80 i;  3UDX A;  3WOF A;  1AE2 A;  2NTS A;  4LF5 Q;  3V05 A;  4C3H H;  2O5I C;  4GN3 B;  3KRE A;  2EJ0 A;  4DV5 L;  5KT6 A;  4KI0 A;  5D3D A;  5EJW A;  3OHX C;  4RCN A;  1B04 A;  5T1G A;  1C9O A;  4G57 A;  2ZXP A;  4CDC C;  2UUB L;  4IPH A;  2QB5 A;  5ELD A;  4IPC A;  4F7X A;  3F1Z A;  3TQ1 A;  3VR2 A;  1V43 A;  1Z47 A;  3MR5 A;  1NMF A;  1JWU D;  3A74 A;  3A54 A;  1JDE A;  3KF6 B;  1SE2 A;  1PX2 A;  1JDB B;  3NBY B;  1D5Z C;  3ERS X;  1WFQ A;  3VPC A;  2JEA I;  5CBE E;  5JQG F;  4DR7 L;  2F0M A;  4KHV A;  5IYD G;  3DEO A;  3DHQ A;  1A3G A;  1VBH A;  3MFG A;  4KN4 C;  4F4X A;  4DR4 L;  1PH9 A;  4IFD H;  1EY8 A;  2C00 A;  2KCM A;  5LP6 F;  5CV9 A;  3B6Y A;  4QB4 A;  2WB1 G;  4O7S A;  3H3V I;  4BXX G;  3TDQ A;  1I94 Q;  1IKL A;  4ZCK A;  5DGH A;  1HTP A;  4K6N A;  1QOH A;  2ZTC A;  2VUM G;  3GTP H;  4DF7 A;  2W9C B;  1S5E D;  2NVY A;  1XPO A;  3S1R B;  4FBU A;  1T5X D;  1R4P B;  3RB3 A;  1XNQ H;  1Z2O X;  4O7Z A;  1ICF B;  3J81 E;  4Y7N B;  4JV2 A;  3C1E A;  3PQI A;  1B50 A;  3TQT A;  1PYW D;  3CQZ H;  3S15 B;  4JW0 A;  4OIK A;  1MSG A;  2AGO A;  2XCP A;  2YW2 A;  1S03 G;  2R3Z A;  1SYC A;  1D1I A;  5JAV A;  3HG9 A;  4FDB A;  3JZI A;  1V1Q A;  3BVM A;  3A56 A;  3FPU B;  2UU9 Q;  4A93 H;  4C2M B;  4ME3 A;  1YBY A;  2UU9 H;  2X69 A;  2QF7 A;  2F0G A;  4BBS B;  2IHF A;  2CQA A;  1L0W A;  3RLO A;  5EKL A;  4C3I B;  3I70 A;  1WTR A;  4DR4 H;  3G7L A;  2VQF L;  4ZRZ A;  5IGD A;  1SJE D;  4BXX H;  4DLK A;  3UDG A;  2WAQ G;  2K75 A;  2FIN B;  3G6X A;  1X55 A;  3S2H H;  1IOV A;  5KFU A;  5DIS C;  3HBL A;  3U9T A;  2LXK A;  1KC8 C;  3PR4 A;  5C5L A;  3O13 A;  2V4Q A;  5A35 A;  3I90 A;  4HID A;  2OLS A;  3OMG A;  3KJO A;  2PQE A;  1H9S A;  4A3M G;  5KFM A;  1DCZ A;  1I1K A;  2PVP A;  1BBU A;  5D65 A;  1VQO A;  4YBZ B;  2YTV A;  1KAW A;  4B3R Q;  3HXL A;  2A68 C;  4POG A;  4B3R H;  1EOV A;  4DR5 Q;  1GXD C;  1EIY B;  4JUZ A;  4NXM H;  4FFL A;  1IOW A;  3CCV A;  4DR5 H;  3HT5 A;  2VW9 A;  4DNR B;  2E2I H;  4V19 0;  5GRO A;  1Y14 B;  3J80 c;  1ASZ A;  2W9B A;  2R8G A;  2G9H D;  3CHB D;  2QDB A;  2WB1 A;  2KCT A;  1KDC A;  3QO2 A;  3DUZ A;  3RMH A;  4X64 L;  3T13 A;  1D1K A;  3CU7 A;  4PZ6 A;  2XGQ A;  4TM5 A;  1V8Q A;  5KRU A;  1HR0 Q;  2VUM A;  4U68 A;  1I4X A;  3UQ8 A;  4O7W A;  3KK7 A;  2FLP A;  3RUZ A;  4EGJ A;  3KLS X;  4EG0 A;  2PZT A;  1SR3 A;  1VQB A;  1Z6H A;  1ZYR C;  3NUC A;  3CF5 A;  4L5Q A;  1TWA B;  3FDS A;  3LUL A;  2JXM B;  5DQH A;  3HOY B;  4EFB A;  5C3E G;  4LFB L;  1RDP D;  1IYD A;  3EFX D;  4HR7 B;  4DR1 L;  1WVL A;  4O81 A;  3PIP 3;  3H3V C;  4IJL A;  4A3M H;  1RJQ A;  1B4O A;  4LF8 L;  2UXC L;  3S14 B;  2KEC A;  5DEH A;  3JZF A;  2Q2I A;  4ZAI A;  4LF4 L;  3MWE A;  4LF7 L;  3WWH A;  4QWC A;  3CPF A;  4WHX A;  3GQC A;  4WFN 3;  2E2J B;  2BE5 C;  1XNR Q;  1F2L A;  2NN6 I;  1PHJ A;  1TS3 A;  3KYH C;  4B3M Q;  1HJP A;  3GTJ A;  4DUY L;  1TWG H;  2AQ3 B;  2L5T A;  3A8I E;  2NZ1 D;  4IR1 A;  1RTN A;  1F2M A;  4B3M H;  5H80 A;  4NXN Q;  3MXP A;  3HFZ B;  4QIW B;  3UE0 A;  5C5J A;  1AW7 A;  4A3D B;  3GTQ H;  2MP1 A;  4KD4 A;  4LSX A;  4UP9 A;  1XMQ Q;  2WAQ A;  2BCO A;  4KJO A;  1BUV T;  1YJ9 A;  3F2C A;  4X64 H;  2B2T A;  4ILW A;  1GVP A;  4N8X 1;  4DN4 M;  1WD1 A;  1SNM A;  1Y1W B;  4OX9 L;  3RGZ A;  1B8A A;  3BJU A;  2JA6 G;  2B3G A;  1WTP A;  1XXG A;  2R7M A;  3RV3 A;  1BOS A;  4FXK C;  1DYQ A;  4AH6 A;  1TWC B;  3DM3 A;  4N9P A;  3PF5 A;  4C3J G;  1IBK H;  4O0A A;  3W5O A;  5C3E H;  4JI0 L;  5FR9 A;  4X65 Q;  4UCU A;  3BA9 A;  3OW7 A;  4A3E G;  3VNN A;  3NUA A;  1TWG A;  3UFX B;  5DM6 3;  4AQY Q;  5IOD A;  2UXC H;  2F52 A;  2CZG A;  1VF5 C;  2HGX A;  4OWX B;  4LF7 H;  1PFM A;  1TS5 A;  2CW0 C;  4J6H A;  2AHO B;  4S3S A;  4O3S A;  1JE4 A;  2PYK A;  3MTS A;  2HJW A;  4LNQ A;  2PZW A;  4LK1 C;  3K7A H;  5IWA Q;  2R7Z G;  4DUY H;  4R4C A;  4B08 A;  2KHJ A;  3ONA B;  3N8D A;  4ME5 A;  4MAM A;  4U7C A;  1C7Y A;  3T51 B;  1XX8 A;  1EY7 A;  4DR3 Q;  1C8C A;  5IY0 A;  1SXT A;  2OQ0 A;  3J81 i;  2OTJ A;  2ZXO A;  4FBT A;  3Q8Q B;  4QW9 A;  2JA6 H;  1EY9 A;  2W6N A;  2FE3 A;  1L2F A;  3HOX G;  1CFM A;  2R86 A;  3S17 B;  1DJR D;  2ICE C;  2RBM A;  1XDN A;  4A75 A;  2PW7 A;  1KNA A;  2ZDQ A;  4FNF A;  3IKJ A;  4O4I F;  1ML0 D;  3LWE A;  3T9B A;  4UFZ A;  3C1F A;  2OEO A;  3S1M B;  4A3J G;  3L2P A;  5M3F H;  4DUZ Q;  1I6V C;  5IYB G;  1Z9F A;  1T5E A;  4DR6 L;  3GIJ A;  4FYD A;  2RHQ B;  4LMY A;  3M9O B;  1TII D;  1M4V A;  2A6E D;  1VQN A;  4JI7 H;  2BDN A;  2R6G A;  5A2Q L;  2R7Z H;  2A1H A;  3ORR A;  1YIT A;  2J4X A;  1ULZ A;  2E74 C;  2JA6 A;  5EAY A;  2HHH L;  3VA5 A;  4ZQI A;  4Y8V B;  3HS0 C;  1VBG A;  4GNX C;  2NBF A;  3H40 A;  5BPF A;  3AMU A;  3RV4 A;  5IYZ F;  5COY A;  3K5L A;  4QSH A;  2ALZ A;  2IBK A;  4HYK A;  4A3L H;  4DNI A;  3OSP A;  5J2T F;  3HOX H;  2R61 A;  2K33 A;  2YZG A;  4UCR A;  3H6M A;  1SE4 A;  5BN3 A;  3OIQ A;  4I4T F;  4PMC A;  4O84 A;  1O80 A;  4BY1 G;  5DAA A;  3FVQ A;  3BZK A;  2ZJT A;  2A69 D;  2Q2H A;  4JYA Q;  2IP4 A;  2D0P A;  2Z04 A;  3TY5 A;  1I6U A;  1R4Q B;  2GVB A;  4IWY A;  2DY7 A;  3A55 A;  4RHR A;  4A3J H;  3JSL A;  4YY3 Q;  2R7Z A;  4FS1 A;  1S40 A;  1DD2 A;  2IW3 A;  4LF6 L;  4YY3 H;  2BR0 A;  2B2U C;  2UUA Q;  1K83 B;  4OL7 A;  4IUN A;  4J9P A;  2XSC A;  1R9T H;  3M9B A;  3NTI A;  1GKH A;  1I4G A;  1J8I A;  1KLG D;  1Y1V B;  2WIN B;  1PH1 A;  2H5X A;  2UUA H;  3G8D A;  1IXR A;  4QQB X;  4NYE A;  3NK9 A;  3RBE A;  3KHR A;  1PRT F;  1PVO A;  3Q1K A;  2Q8R E;  1WRV A;  4R9W A;  5KFV A;  3EYY A;  1L1O C;  4R8U B;  2HHH H;  3J80 L;  4GOP C;  1TS4 A;  3BYY B;  5LA6 F;  5CV6 A;  5FJ8 G;  2ENB A;  2JA7 B;  4I65 A;  3EN2 A;  3LWU A;  1EFI D;  4I7H A;  5CBA E;  3JSN A;  4HJ9 A;  2YU9 A;  2PPB C;  1WD0 A;  1TU2 B;  3K7U C;  1PRT D;  3T5H A;  3H4D A;  1BR9 A;  2JEF A;  1E3P A;  5D14 A;  2B2V A;  1ZXT A;  1VMC A;  5C44 B;  4HJ7 A;  3N43 B;  4DAM A;  1PTO H;  3J81 c;  4ABN A;  2L9H A;  5I2X A;  1LTL A;  3DWA A;  1KBL A;  3G6J B;  1R9T A;  5FLX E;  2AKW B;  1KJI A;  3TP8 A;  3SHL A;  4R4I A;  1FD7 D;  4C1N K;  4R4Q A;  2NVX H;  1N33 Q;  3IFD A;  1STE A;  4CJ0 B;  1JJC B;  1D5M C;  2AWO A;  1XTC D;  3PUV A;  3U0G A;  2DNC A;  3OHA A;  4JI3 L;  1X3P A;  2YYA A;  1GO3 E;  1SEB D;  5A2Q W;  3EPI A;  3CCQ A;  1KDB A;  2L15 A;  3GTG B;  3W1B A;  1VQK A;  4IFD J;  3Q24 A;  2W6M A;  2E5L L;  2JA5 G;  3NC0 B;  4RNO A;  1FNU A;  3FEW X;  2V58 A;  4BWS C;  3M9M B;  3V6J A;  1CZW A;  1JOK A;  3GTL A;  4HMJ A;  4IUV A;  2JP1 A;  4DV3 Q;  3T1H Q;  1YIJ A;  1KHI A;  1JWS D;  1A2T A;  4UCT A;  3R8B A;  3C0F B;  4DV3 H;  5KG1 A;  1ICW A;  1EIG A;  4WD3 A;  3HP3 A;  3LML A;  3S24 A;  5E7N A;  2W8K A;  3J7A F;  2SDF A;  3MJF A;  3MVV A;  1CQF A;  1HNW L;  4J15 A;  2B63 B;  3SE0 A;  2R7L A;  1LO5 D;  1OXU A;  2IX1 A;  4R8I A;  3QQM A;  4HJ5 A;  3NTK A;  4DAP A;  1PH6 A;  3KDF A;  1CTM A;  1YEZ A;  5IOC A;  2H1E A;  4OON A;  1C48 A;  3ORQ A;  4MA0 A;  5FLM H;  3GID A;  1N34 Q;  5I5V A;  1IYJ B;  5IT9 E;  3GII A;  3Q8S B;  1WJJ A;  2GA4 B;  1NE3 A;  1N34 H;  1QG7 A;  5IP7 H;  1B44 D;  5M3M B;  1ZQ7 A;  1LYL A;  3DWQ A;  2EJ2 A;  3SK6 A;  5F9L A;  1PYB A;  1NBW A;  1Y8O B;  1IL2 A;  4KY7 A;  5KFS A;  5KFF A;  2YTX A;  2ZDG A;  3NEM A;  3UDF A;  4ED3 A;  2XNA C;  4ED8 A;  3RLN A;  1X56 A;  1A62 A;  1C4Q A;  2M2L A;  2KQ3 A;  4FXG C;  5KND A;  1EEI D;  2FK3 A;  4O3N A;  4F4Z A;  5CA0 F;  1P16 A;  3HOW B;  4UAI A;  2XD4 A;  4O1N A;  1S68 A;  1BBX C;  3OMC A;  2COJ A;  1F9P A;  2HUG A;  2FPG B;  3GO5 A;  1EU3 A;  3HKZ B;  3T56 B;  4J9S A;  1XTD A;  4OO1 G;  3ETH A;  3D31 A;  4U67 3;  3T1Y Q;  2B2T C;  1OBD A;  1DZ1 A;  1I7L A;  2QYZ A;  3T1Y H;  3CCS A;  5JOB A;  3OUU A;  5E3F A;  3VDY A;  1K8O A;  4L8J A;  1HNW H;  3K5N A;  5KX5 F;  1SYE A;  2QW7 A;  1E7Z A;  4X62 L;  2KSW A;  4IRK A;  4TKO B;  5CV4 A;  5BR8 H;  1BO0 A;  3JRX A;  1TT2 A;  4XXE A;  3K58 A;  4HSV A;  3GTK H;  1CKM A;  4QUC A;  1SSO A;  4QMG A;  5LMU L;  2JA5 A;  4JPB W;  4LFA Q;  5D1O A;  2DY8 A;  2ASD A;  1I7N A;  2I07 B;  2JA9 A;  1KRT A;  1TWH H;  3ND8 A;  1GUN A;  4ZLT F;  3RNU A;  3X3M A;  4LFA H;  1OBG A;  4H02 A;  5BN4 A;  1YHQ A;  1OTC A;  3LGJ A;  3Q23 A;  3RZO B;  1EZ1 A;  5KG7 A;  2X6G A;  1I4R A;  1LAB A;  5C4X B;  3JRW A;  3NEN A;  5M5Y H;  1I6H B;  2NU9 B;  1NCV A;  1PH8 A;  1EIF A;  3AYH B;  2HGS A;  2W7O A;  1J6Q A;  2E2H B;  3RB6 A;  1FVI A;  2NTT A;  4JI6 L;  2HIV A;  1I1L A;  2A68 D;  5KFD A;  3KBX A;  1CHQ D;  3SXH A;  3PIO 3;  1B33 N;  5C8Y F;  1DAA A;  1FGU A;  3I56 A;  4OO1 H;  1OWT A;  1C0A A;  1WH2 A;  1G6P A;  4R4O A;  3OUZ A;  5HNE A;  2IA6 A;  1N36 Q;  4CDE C;  1EUD B;  2XRQ D;  3M4P A;  1MZB A;  3U50 C;  4KHP H;  2JK8 A;  4X3T A;  2F1M A;  1ZKO A;  2CQY A;  3PR5 B;  5HUR A;  3FKI B;  1U4M A;  4RGT A;  2F4V Q;  1K8G A;  1STH A;  1VQD A;  2J0T D;  4B9W A;  1PRT B;  4EYI B;  2F4V H;  1ZEQ X;  1EYD A;  2WFW A;  4OWT B;  2HHF B;  1HZC A;  5CA1 F;  1I5F A;  3PN1 A;  4M1U B;  4YR2 A;  2IX0 A;  2X6L A;  1IYV A;  3S1N H;  4BBS G;  3OHB A;  4J9K A;  3D3R A;  2R92 H;  5KG3 A;  4C3I G;  2R82 A;  1E4G T;  5CV8 A;  5LMU H;  5GAH C;  3RUP A;  1SNP A;  2EYF A;  4A4I A;  2R6F A;  4ETS A;  1GM5 A;  2E75 C;  3OWE B;  1LTG D;  2J6S A;  1B3Q A;  2LFN A;  4RKL A;  2EY2 A;  2JEJ A;  1PYS B;  2W6Z A;  2DJF C;  4O3P A;  2RF4 A;  3G8C A;  4TRD A;  3CXC A;  2MFI A;  2BE5 D;  1JMC A;  3AX6 A;  5M5W H;  2XWB B;  1S5D D;  5JEA G;  2A6H C;  4O7V A;  4L5R C;  4LUZ A;  3GIQ A;  4K0K Q;  4ECZ A;  4JI4 L;  1I4H A;  2RDG A;  4C1N I;  1RD9 D;  1GSO A;  1HH2 P;  2GLT A;  3WWJ A;  4K0K H;  3CSW A;  2DAB A;  4OXP A;  3MHB A;  3T9C A;  3JZ6 A;  4RKB A;  2GQR A;  3TEK A;  3MEF A;  3NTH A;  5FNV F;  4BY7 B;  1IBL Q;  3LQS A;  2W8L A;  2OQK A;  1UE6 A;  3HOV B;  2UUC Q;  1IBL H;  4UCV A;  1W96 A;  2EYJ A;  1IL8 A;  4I55 F;  2K7V A;  1STA A;  1CA6 A;  4JI1 L;  4J9R A;  3OTO H;  4KKU A;  4F88 A;  3PV0 A;  5EPK A;  2PNH A;  5I2Y A;  1YZ6 A;  4K8I A;  4DV0 L;  1Q86 C;  4JI8 L;  1TY0 A;  4A3C G;  3TIN A;  3T5J A;  1ILQ A;  2D62 A;  3BDL A;  4K6L A;  4BWG B;  3S9W A;  1F77 A;  1KJ8 A;  1ZHQ A;  3IRB A;  3HOY G;  2NVQ H;  1HFG A;  2W7P A;  3G6Y A;  1HNX Q;  3I4O A;  3GIM A;  3CCL A;  3UZB A;  1QUQ B;  3DM1 A;  2FLL A;  5BN5 A;  1I4P A;  4ECQ A;  1QWY A;  3AFP A;  3PUW A;  4RB3 C;  2CW0 D;  4DGZ A;  2ZM6 Q;  2MNA A;  2YCH A;  3DMU A;  2HDK A;  1ET0 A;  3RBD A;  2JA8 G;  4DV4 L;  4IZ8 A;  3QWN A;  3LWB A;  3SVM A;  1E2W A;  1JIC A;  1NR2 A;  2ZT9 C;  4A2A A;  4DV2 H;  1I3Q B;  2VNU D;  4KY6 A;  5C3W A;  1SJH D;  1TKW B;  4A2B A;  1SFO H;  3EPG A;  1NJI C;  5FO9 B;  1E4E B;  3ER0 A;  1OXT A;  3E5S A;  2G9D A;  3JAM E;  4L5S A;  2NZH A;  4A3D G;  4JC0 A;  2F0N A;  5DLQ E;  3M3Y B;  2NU7 B;  4PZ8 A;  5DGA A;  4YJ3 F;  2NZO A;  3GTM B;  4FFM A;  1Y1W G;  1FYC A;  3KF8 B;  1BCP F;  3DXJ C;  3D6W A;  3MWD A;  3RD4 A;  4A3C H;  2V4R A;  4DAV A;  1MHW C;  1GUG A;  4CDF C;  3RZD B;  2D9U A;  2NN6 H;  1BGW A;  1IHZ A;  2J9G A;  4R7R A;  2YTY A;  1U4L A;  2C2R A;  2VA2 A;  1J5E H;  1RKN A;  3MFH A;  2QEX A;  2ATL A;  2JEI A;  3VYT A;  4ZHQ F;  4A3K H;  4FF1 A;  1E22 A;  2FK2 A;  1JX4 A;  2CH4 W;  1AE3 A;  4TQS A;  4DL4 A;  3SK5 A;  2JA8 H;  4ZK9 B;  1IZ6 A;  3SGI A;  2HD3 A;  2VY3 A;  5KYI A;  3DLL A;  1EWH A;  1XNQ L;  1D2B A;  3MXN B;  5BWT A;  4MTD A;  1B9N A;  2MQH A;  1EHI A;  1PTO C;  1LTB D;  1MGS A;  2XRS D;  1G8Z D;  1XYI A;  5FLX c;  4C5A A;  5C1P A;  3PMF A;  4O7T A;  2NVY H;  4A3D H;  1JIH A;  3I4M H;  4LF5 H;  1EQT A;  1PFB A;  1TWA A;  2SNS A;  2VA3 A;  2PCF B;  5JJL A;  4NZM A;  2M05 A;  4NPS A;  1LM0 A;  3VYU A;  3F2U A;  2PZU A;  3MEH A;  4IO9 A;  3I8Z A;  2OCE A;  1HNZ Q;  1WYD A;  2A74 C;  4HR7 A;  3M4O H;  1YVC A;  4H0L C;  2K03 A;  2UU9 L;  3GIK A;  5M5X H;  4CKB A;  4DK6 C;  3G6V A;  3EJI A;  4O2D A;  4OO1 I;  2F03 A;  1G2T A;  5CR5 A;  1BF4 A;  2F0F A;  1JLL B;  4Q43 A;  2C28 A;  1HRJ A;  3HOZ H;  1DGS A;  3IL8 A;  1QNK A;  3MWM A;  2QCP X;  1I94 H;  2F0D A;  4RGO S;  5C4Z A;  4YCU A;  4DAY B;  4AIM A;  2QGQ A;  4Q45 A;  1W93 A;  1ENA A;  1ONL A;  1D6E C;  4CHI A;  1CKO A;  1RJP A;  1KXL A;  2EY5 A;  2BQR A;  1Q3L A;  4IOC A;  1Y1W A;  1EZ6 A;  4G3I A;  2JJQ A;  5I47 A;  2EJG C;  4K2L A;  3TP7 A;  4PBC A;  4B3R L;  4XYL B;  4NXM L;  4DR5 L;  4OIJ A;  4HJA A;  4WOR A;  5L37 A;  1QE6 A;  4JI2 Q;  3NWS A;  4M7E A;  4X66 Q;  3D4D A;  1LTA D;  4JI2 H;  4YR0 A;  4X66 H;  1UWV A;  2A73 B;  1AEX A;  4DU9 A;  4PQX A;  1A9X A;  4F50 A;  3QIA A;  3ETJ A;  5C0X G;  1E1O A;  1F9S A;  5IYD H;  1WTW A;  1TA8 A;  3R93 A;  3K8A A;  3H15 A;  3MXU A;  2GPW A;  5IGB A;  1BNC A;  4Q0F A;  3A8K E;  4LSA A;  5DG8 A;  1LV9 A;  3S16 H;  5L1L A;  2BOS A;  4BA1 I;  2UUB Q;  4NB3 A;  1IW7 D;  3AFQ A;  3DTF A;  3MA2 B;  4QIW E;  3GP7 A;  4O7Y A;  1S0O A;  2VUM H;  4J9L A;  1WSC A;  3GV6 A;  1BJT A;  1LTT D;  2CHB D;  1N32 Q;  3I4N B;  2PI2 E;  1Y1V G;  4AYB B;  3PGZ A;  2X0S A;  1N32 H;  1K1Q A;  4GKJ Q;  1AH9 A;  4GKJ H;  1VQ8 A;  3NEL A;  3TQY A;  1IKM A;  4O4H F;  3VMM A;  1B9M A;  4HCE A;  4UHV A;  1M1K C;  2FPI B;  4ZI7 F;  2JQO A;  3TW7 A;  4B3M L;  1VF7 A;  3MFI A;  1KJ9 A;  3Q6S A;  2JA7 G;  3KBG A;  1J9O A;  3GTO B;  2DZD A;  4FE2 A;  1K3B C;  1WCM B;  5JJI A;  2X5R A;  2DJG C;  3JC6 6;  1V4Y A;  3BDO A;  4O4J F;  1LTI D;  4IPD A;  4IQZ A;  3GTJ H;  4CC6 A;  2ZJP A;  1EEF D;  1SE3 A;  2F0S A;  3PO2 B;  1O75 A;  4IR9 A;  4XTC S;  4JV0 A;  2N88 A;  5C44 G;  1UNN C;  4LFC Q;  1HR0 H;  4JOI A;  2PMZ B;  2R93 B;  2SEB D;  3JAM i;  3HOU B;  3ULL A;  3FMA A;  4DR2 Q;  1SNC A;  4R4T A;  1IBK L;  5CR3 A;  3CC2 A;  5EDW A;  2Y0S B;  3MXG A;  1XJV A;  1RHP A;  2RDI A;  4B3S Q;  4OWW B;  4FGR A;  2UVV A;  3W1G A;  2K32 A;  2Z0S A;  4X65 L;  4C5C A;  4B3S H;  1KUT A;  2DLN A;  4F8M A;  4RUA A;  1Y1V H;  3S1Q H;  3PUZ A;  5K5P A;  4H7B A;  4AQY L;  5J1Z A;  4A3B G;  3S2D H;  2I80 A;  1TQO A;  5GAG C;  1WTX A;  3R9R A;  1FKA H;  3CMA A;  2VQF Q;  4ME6 A;  1Y8N B;  2Z6K A;  3E6Z X;  3FHW A;  4RFB A;  3E5N A;  1SMY C;  1XNR H;  3URY A;  1X3Q A;  3AB9 A;  2JA7 H;  5K36 G;  5IWA L;  4MV6 A;  4GNX B;  3J7Y W;  4MZ9 A;  4TUY F;  1H95 A;  4NXN H;  1L0X B;  1I4Q A; 
#chains in the