1P8LA

New crystal structure of chlorella virus dna ligase-adenylate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
296
structure length
276
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNFGYEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIRHEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords PBCV-1 DNA ligase
publication title Analysis of the DNA Joining Repertoire of Chlorella Virus DNA ligase and a New Crystal Structure of the Ligase-Adenylate Intermediate
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
total genus 64
structure length 276
sequence length 296
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1p8lA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1p8lA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1p8lA01
1XPRA 1E7ZA 3CCRA 3S16H 2R7ZH 3KF6A 4O0AA 3TQYA 4AH6A 1IBKL 1NTGA 4JBKA 4EEQA 5IYCH 1L1OA 3JSNA 1N9WA 3OTOQ 3ULPA 2UXDL 4YY3L 3RZOH 4A93G 3S14H 3CQZH 4LH6A 4DK3C 1UE7A 3EIVA 1K83H 1TAEA 1GD7A 4YHHQ 4GOPC 3HOUG 1ASYA 2ZM6Q 1YJWA 1HNWL 5BR8L 1KAWA 1OXXK 1WFQA 2ZJPA 5GROA 2F4VQ 1X65A 2VY3A 2YU9H 3LGJA 1VQFA 4GN5A 3VNNA 1VQ9A 2IHFA 3RTXA 3T1YL 3AYHB 4X65Q 1N32L 3FHWA 4A3IH 1JJGA 5DISC 4IPDA 3NBYB 3CCMA 4LF9L 4DR7L 2B29A 1WOCA 2K5HA 2PI2A 4DR3L 1A63A 2JEBI 3HOWH 1EQRA 2R93H 4A76A 3RNUA 4OX9Q 3H15A 5IYBH 4X66Q 3J81c 4NXML 3M4QA 3JAMi 1P16A 1PH5A 2EQSA 3W1GA 5LMNQ 1Q8KA 4DV0L 2VNUD 1GKHA 4FDBA 3U4ZA 1RL2A 4J15A 1AE2A 5IP7G 1FVIA 5GAHC 5C3EH 4DR1Q 2QGQA 4X62L 1M90C 4H02A 2CWAA 2D62A 2JK8A 2VW9A 3S17H 1HJPA 5IWAL 4A3GH 2NZOA 4DV4L 2ZTCA 4LF7L 1I6HH 2OTLA 4POGA 2WAQE 1FJGL 1XNRL 2K52A 1CKOA 1NMFA 1PHJA 3NC0B 5C0XG 1X6OA 4BBSH 4JI6Q 4A3LH 2XGTA 4EQ5A 4DV6Q 1YI2A 1VQMA 3TREA 1GM5A 4B3TQ 2VUMH 2F3IA 4AIMA 1TWCH 4DV3L 3TEHB 2NN6I 1TWGH 2F52A 4ME3A 3F2CA 3PN1A 4A3JG 4DKAC 2V1CC 1MJCA 1WCMG 3HOWG 3E9IA 4JI8Q 1BBUA 3E0EA 5M5WH 2UUBL 5FLXc 4DUZL 4RG1A 4LFCQ 4R4OA 1PYBA 4LH7A 2D0PA 4AQYQ 4CC5A 4PZ8A 2E5LL 3M4OH 3KF6B 4LFBQ 4Y7NH 3CP0A 3E9HA 3K81C 3I4NH 3HOVH 3L0OA 1L1OB 4GNXC 1KD1C 1KXLA 5IYDG 4TQUS 1OXUA 4A3BG 3PUWA 1C7YA 4A3MH 3K7UC 4NXNL 3K0XA 3HOYG 5J3BA 4JOIC 4A3GG 4A3CH 4LF5Q 4YWKA 1U0LA 1TWFH 2Y0SG 2JA6G 1UE6A 1VQOA 3CF5A 3ER0A 3M4PA 1EUJA 5D1OA 3PCOB 3K80C 5M3MG 3QWUA 2YTXA 1VQKA 1N33L 4A3LG 2UXBQ 1A8VA 1W2BA 4WJ4A 5HGQA 3G4SA 3J80i 5M3FH 2JA9A 4JBJA 1K8GA 2UUCL 2VUMG 1V9PA 4TVAB 2BA1A 4L5RC 4JYAQ 1C9OA 4AYBE 2UU9L 1VQ4A 3D31A 4LUZA 2DUDA 4Y52H 4OO1I 4RMFA 3W5OA 1I50H 1E24A 3CC7A 3PO3G 1QZHA 4A3DH 4BBRG 3CW2C 2K14A 3RN2A 1CKNA 3MEFA 3G71A 4UY8C 4P75A 4LF6L 4BY7G 1V1QA 2ZTEA 4A3MG 1YJNA 1HNXQ 2PQAA 1BKBA 3KOJA 4DR5L 3PV0A 1XNQL 2OQKA 3SGIA 2JA7G 2KHIA 5M5YH 4JI5L 2HIVA 4LUVA 1HZ9A 4HIMA 1CUKA 1Q46A 4HJ5A 1W3SA 2HHHQ 1B8AA 1NBWA 1NJIC 3STBD 4DV2Q 4LFAL 3S24A 1NE3A 2CWPA 1K8AC 3KJOA 2OWOA 3S1MH 4APVA 4KHPQ 2Z6KA 4QY7A 4CC6A 2VQEL 2XTIA 2OTJA 1A0IA 4JI1Q 2QA4A 4HIOA 1ASZA 5FPOA 2DGYA 1PH4A 2ASBA 2R92H 2K4KA 3KDFA 4BY1H 1VQAA 2D0OA 2CKZB 3CCJA 4DV1Q 2K5NA 3DLLA 4KHZA 3DM3A 1TWAH 1VQHA 4PG3A 1IBLQ 4JV5Q 4JI0L 1XPOA 3S2HH 1XDNA 4EFEA 3KJPA 3KF8B 4UCSA 4LF8L 3ERSX 4MNOA 4JI3Q 4OWTB 4R1JA 2R7DA 4HIDA 1OTCA 4JI4L 3S1QH 3T1HL 2K75A 3TY9A 4DV5Q 5EAYA 3AEVA 3D0FA 2WAQG 3MXNB 5FJ8G 1IBKQ 5D1OB 4ALPA 1HZAA 4YWLA 4C2MH 3VDYA 3H0GH 2GN5A 1K73C 2UXDQ 4UFZA 4YY3Q 1Y1WH 1HNZL 1G51A 3IRBA 4DRFA 3S1NH 3CAMA 3UDXA 2YTYA 4YCVA 3F8TA 1Q1BA 3UQ8A 2JA5H 5LMUL 3RLNA 3NEMA 5M5XH 1HNWQ 5BR8Q 1NY4A 4UCOA 3PUZA 2AKWB 4LW1A 1I94L 4JI2L 5JEAJ 1YVCA 1LTLA 2I5MX 1KL9A 3BU2A 3UE1A 2YTVA 4IO9A 1CKNB 3K8AA 4A3KH 2ZTDA 3GD7A 5C44G 3T1YQ 4A3FG 2I5HA 1EWIA 1N32Q 1UE5A 1Y1VH 3GTOH 4LUOA 1YHAA 1VQDA 2HIXA 2MO1A 3PSIA 4LF9Q 2R7ZG 4DR7Q 1T9HA 5AJ3L 2PQAB 3GTMH 1VS0A 4DR3Q 1XMQQ 1VQNA 1XPUA 5D1PA 5IYCG 4IJLA 4A3EH 4L5TA 1YHBA 4NXMQ 2HT1A 4IPCA 1KRSA 1G6PA 3HOXH 2KHJA 3H0GG 4DV0Q 1X3GA 4OXPA 1FGUA 1IBML 1MKHA 4X62Q 1PYSB 1SLJA 4AYBG 2Z0SA 3G48A 3OYYA 5C4XH 2QEXA 5ELOA 3PIOA 2AWOA 3CPWA 4DR4L 4GKKL 2N49A 3GDEA 5IWAQ 2HVRA 1SR3A 1LUZA 3J80c 3G6EA 1IL2A 4JG2A 1E3PA 4DV4Q 4LF7Q 3HKZE 1PH6A 1FJGQ 3KDFB 3PUVA 1XNRQ 2JA8H 4QL5A 4A3IG 1PH8A 4L5SA 3F2BA 1GVPA 3UDFA 3HOZH 2KCMA 2N78A 4P71A 3BA9A 1XJVA 4EFBA 4JI7L 4UCRA 1EFWA 1VQIA 2Q2TA 1XTDA 4YWMA 1PV4A 4LNQA 1DGSA 2R93G 3B6YA 3BZKA 1GO3E 2VQFL 4O2DA 4DV3Q 5IYBG 1QVFA 5GQOA 4IFDJ 4UPAA 4A3EG 4MTNA 2UUBQ 1XK5A 4DUZQ 4JBWA 2ID0A 4BXXH 5C3EG 4KLKA 1Z47A 1J5EL 4HJ8A 1OXTA 1C0AA 2E5LQ 4C3IH 2ATWA 3J7A5 5JJKA 1VQ5A 5C4JH 2IT1A 1S72A 4DUYL 1SRUA 2ZJRA 2NVQH 3FP9A 4UCVA 2AMCB 4NXNQ 5GAEC 4YCUA 5C0XJ 2VL6A 4DK6C 3GTJH 1X55A 2MQHA 4B3SL 4PMWA 3BA8A 1TWHH 1J6QA 2JJQA 4BBSG 2LXJA 4A4IA 3KLWA 1X9NA 1LM0A 5IP9H 4DAMA 3JC66 4LF4L 3HFZB 3TS2A 1OXSC 1QUQA 3RLOA 1XMOL 1N33Q 1AH9A 2VUGA 3K7AH 3EBEA 1WI5A 4PZ7A 2UUCQ 4BA1I 1EYGA 3I4MH 4HIKA 4X64L 4JC0A 2UU9Q 1SE8A 1AE3A 2E2HH 1Y14B 3GTQH 1HR0W 3I55A 3I4NG 1EOVA 1VCIA 2CQOA 3RR5A 3J81j 1N34L 4DV7L 3HOVG 2AHOB 2HVQA 4DR2L 1VQ8A 4K0KL 1BVSA 2WFWA 4YCWA 1UWVA 1KQSA 1E1OA 2RHQB 2L15A 3NBZB 4R4CA 4DPGA 1VQPA 4A3CG 4LF6Q 1YHQA 1KIXA 1S40A 2IX0A 1KC8C 2AWNA 1YIJA 4POFA 4DR5Q 2CCZA 1XNQQ 3I56A 2RHSB 1PH2A 1L1OC 1TA8A 4JI5Q 3TY5A 2C35B 4BA2I 2UXCL 3I2ZA 3PGZA 5IP9G 5M3FG 3A74A 3ZJYC 2YYZA 3CCQA 1KHIA 2K50A 3S15H 2ES2A 4IOCA 2ALYB 3AFPA 4GNXA 2NN6G 4LFAQ 4UP7A 2UUAL 2IHEA 2VZAA 4DR6L 4A3DG 4A3FH 3PF4A 3J7ZC 5IY0A 4GN3B 2VQEQ 1S68A 4R4TA 4JOIA 4LWCA 2E8GA 2B63H 1NMGA 2Q2IA 4IPHA 1RIPA 3L7ZC 1WJJA 4HJ9A 2GVBA 1VQEA 2WP8J 3NBHB 4HJAA 1HR0L 4IFDI 1Q81C 4IOAA 1I3QH 1B70B 2K5VA 3L2PA 4P73A 4QGUA 3JAMc 3A5UA 4JI0Q 4MZ9A 2KENA 4LF8Q 4A93H 1Q1EA 2I0QA 2N8NA 3CC4A 4JI4Q 3T1HQ 4XTCS 3U58A 3PO2H 1N36L 5H1SE 3HKZG 1R9TH 3EN2A 1VQ6A 4NB3A 4QJFA 2ZJQA 3AFQA 2JE6I 4B3ML 1IYJB 4E6NA 5C0XI 5FLMH 3OW2A 1Q86C 4B3RL 4P72A 4QQBX 4GKJL 1QUQB 3A5ZB 4X6AH 3GB8B 1HZBA 1HNZQ 2H5XA 2PNHA 1E1TA 1QVCA 2R92G 3BAAA 3GTKH 4BY1G 4OO1G 2BH8A 3TY8A 2B63G 2RF4A 5LMUQ 3CCVA 3U50C 3OTOL 3CCUA 4OWXB 4JI2Q 1I94Q 1X3EA 3F1ZA 1SMXA 4DNIA 4GN4B 4R4QA 3PF5A 5IP7H 2BH2A 1Q12A 3GTGH 2NVXH 4YHHL 4OWWB 4IJHA 1S3OA 2RCNA 2ZM6L 1G291 2LSSA 4UP8A 3GTPH 3PO2G 3HKSA 4P74A 3RN5A 5AJ3Q 2F4VL 4JCVE 1D8LA 3S2DH 1JT8A 1VQLA 1FL0A 3RLFA 3GTLH 1Y1WG 5FLMG 4X65L 1JE5A 3KYHC 1P8LA 1X3FA 1Q7YC 2CFMA 1PH7A 2OCEA 4HJ7A 5K36G 1K0RA 1CSPA 1YITA 1SROA 1X54A 5E7NA 5GAGC 1IBMQ 2JA5G 1U5KA 4GNXB 2Q2UA 4OX9L 4DR4Q 1HH2P 1TXYA 4X66L 3CXCA 3CCSA 1XMQL 1QVGA 4GKKQ 4A3JH 1WCMH 5LMNL 3CMAA 1EQQA 3FKIH 4UCTA 2E2IH 3I4OA 4A3KG 3JSLA 3PUYA 4DR1L 1SFOH 2NVYH 4XIGS 1Y1VG 1YBYA 1Z9FA 3CPFA 4IFDG 1M1KC 4JI7Q 1PFSA 4C3JH 3UDIA 2Q2HA 1E22A 1PH1A 4A3BH 5IYDH 1N8RC 4A75A 2VQFQ 2E2JH 2BA0A 4GOPA 1SN8A 1JB7A 1EIYB 3HOYH 1YEZA 3HOXG 3W1BA 3TS0A 2A8VA 2JA6H 5IT9c 4JI6L 2MO0A 3AQQA 1A62A 4R4IA 5DLQE 4DV6L 4GLXA 1J5EQ 1D7QA 4B3TL 1IZ6A 5C4XG 5M3MH 2YV5A 1KRTA 3TRZA 4DUYQ 5JJIA 4PZ6A 1OXVA 4JI8L 1VQ7A 4UCUA 4LFCL 2LXKA 3I7FA 4UP9A 2EXDA 4AQYL 2JA8G 3FKIG 4GLVB 4B3SQ 4LFBL 4DAYB 2WB1G 1L0WA 3HOZG 1YZ6A 3PO3H 4BBRH 3PIPA 3M85A 4LF4Q 2IY5B 3UDGA 5IE8A 2R7FA 2Z6KC 3J81i 1XMOQ 1VQCA 3NENA 3M3YH 2B3GA 2JQOA 1WYDA 1UE1A 4JBMA 4BY7H 3ULJA 4LF5L 4WJ3M 2PI2E 4NPSA 1PH3A 4BXXG 4X64Q 1B7YB 3F2DA 1VQJA 2JA7H 3KFUA 2UXBL 2EIFA 3BABA 5FPRA 1N34Q 4DV7Q 2A1AA 4DR2Q 3BZCA 3ICEA 4K0KQ 4JYAL 1H95A 5HY6A 1V43A 1EIFA 2MFIA 5JJLA 3H3VI 2NVTH 2JEAI 3GO5A 3A0JA 2OQ0A 1CSQA 3CCLA 3Q8DA 3ULLA 2HVSA 2UXCQ 3U4VA 2FXQA 4GLAC 2I5LX 1HNXL 3I4MG 2A19A 1VQGA 1JJ2A 1IXRA 4EX5A 3WWVA 3CMEA 3CC2A 2UUAQ 1JMCA 4KI0A 1PVOA 1I5FA 1YNXA 1YJ9A 4DR6Q 3GJXB 2WB1E 3S1RH 1LYLA 5ELNA 4GOPB 2KBNA 2R6GA 1QZGA 2HHHL 1B04A 1Q82C 3PUXA 4DV2L 4C3HH 1HR0Q 3UE0A 5FJ8H 1K9MC 4GS3A 4KHPL 1MIUA 4OONA 4JI1L 5GADC 3NELA 1O7IA 3M7NA 3HOUH 2PMZE 3H3VH 2VS1A 3CCEA 2Y0SE 4IPGA 1L2FA 1MJEA 1HZCA 4DV1L 1BBWA 1N36Q 2MNAA 1VQBA 3BJUA 2NZHA 1X56A 1IBLL 2IX1A 2N3SA 1PH9A 4B3MQ 3STBC 4QIWE 2GVAA 1PA6A 4JV5L 4B3RQ 4JI3L 3M9BA 1CKMA 1K3RA 1JJCB 1UEBA 2KCTA 4L5QA 5JEAG 3CD6A 4GKJQ 4DV5L 5LMNW 5C44H 2HQLA 3RZDH
chains in the Genus database with same CATH superfamily
2B63A 2K1BA 4ZYSA 1ET9A 1XPRA 1HUNA 2C22A 3N42B 4J8QA 4YAJB 4AH6A 4FYDA 4ED8A 1L1OA 3OHAA 2NU8B 2YS6A 4LF4H 2YZGA 3WDNA 5KT6A 2DNCA 5T14A 5L1KA 1A6XA 1K83H 2K5WA 5KG2A 1GD7A 4GOPC 3J80E 4G7ZC 2FK2A 5DQIA 5C6AA 2C2EA 2MUYA 3TN2A 1BQQT 1FNWA 4JXUA 2B63B 4GN5A 5KFYA 3RTXA 4KY5A 3T1YL 5I5VA 4X65Q 1N32L 3I4MB 5IYZF 1T5XD 5ELBA 4IPDA 5KRUA 4DR7L 2PI2A 4DR3L 3HO8A 3KAJA 3HOWH 2R93H 2DLNA 2R84A 3WO0A 3RNUA 3IAYA 4OX9Q 3J81c 1LTGD 4NXML 3VPBA 3M4QA 2WE6A 1VDZA 4HSVA 3EPGA 4J9KA 4QF4A 2UXCH 4O42A 2V4DA 1RODA 1B44D 4J15A 1FVIA 2H1EA 2HGWA 1E4GT 1CQVA 5C5JA 4RUCA 2JK8A 2VW9A 4CGYB 4NZOA 1F9RA 3DAAA 2NZOA 1STAA 4RAZA 2J0TD 1BR9A 1M0TA 5C4ZA 1PHJA 3NC0B 3HXLA 2K7VA 3S15B 3MEHA 1X6OA 5C0XG 2DJGC 1JWSD 4BBSH 3GIJA 4EQ5A 4FXKC 2E2DC 1CTMA 2Z9HA 2F3IA 4AIMA 3BYTB 4P2CB 3TEHB 4DV3L 1TWGH 2NN6I 3D6CA 4KN4C 2XSCA 2CH4A 4ZUIA 3NGDA 2RDIA 2PQEA 2WB1A 5KFDA 4LH7A 4AQYQ 1SFOA 1HFNA 1D6EC 3KF6B 1LT3D 1I3QB 4I7AA 4GNXC 3JAMW 3OUUA 3G6VA 5EPJA 5DGIA 1JIHA 4TQUS 1OXUA 2MCTA 3PUWA 4TQRA 5J3BA 1T5EA 2A68C 2R8IA 4LF5Q 4RB2C 1TWFH 2XNAC 1PFBA 3CF5A 1I4QA 4IAJA 2W9BB 3K80C 1STGA 2DPIA 3OTOH 2R85A 1LO5D 1K1QA 2K32A 1S0NA 4WJ4A 3PIP3 2VUMG 4JBJA 1EEID 2PO4A 4TVAB 3TW6A 2CW7A 1F9PA 5FD6A 1U9RA 1VQ4A 4WJWA 4LUZA 1PFNA 2RA4A 3V96A 2RDHA 5CV9A 1AZPA 3PW5A 1E24A 4BBRG 4OELB 3I73A 1IYEA 2LS01 1DXMA 1TKWB 1IBMH 3GTGB 4TM5A 4M9UA 1YJNA 5FR9A 3DWAA 4CMFA 3KOJA 4DR5L 3Q0AA 5FD5A 2W6OA 3K0YA 4IUPA 4LUVA 1W3SA 2G9HD 3OWEB 1UUPA 1OBGA 4DV2Q 1NSNS 5KFRA 2UVRA 3TZUA 1NE3A 2CWPA 2OWOA 3J80W 4APVA 2A6HC 2MHVA 1QG7A 4K6NA 3T9FA 3GIQA 4HIOA 1ASZA 3FKIB 1SE3A 2NUCA 3CCJA 4DV1Q 1KUTA 2NBFA 2EJFC 4JI4H 1TWAH 1VQHA 3MTSA 4JV5Q 5EOYA 3S2HH 4XYLB 2FB9A 4JI3Q 4A3BB 4JI4L 2K75A 5KFLA 3A55A 3HOYB 4JI8H 3MVVA 5EAYA 1TVXA 3TZDA 4LFCH 2WAQA 2WAQG 1RTOA 2COGA 1D5XC 3G8DA 4DU9A 5DMXA 5D1OB 1WTOA 2PYKA 4ALPA 4ETSA 1HZAA 4YWLA 1L0XB 2WKCA 2GPWA 2F0OA 3S1NH 3UDXA 1EKFA 2AQ2B 2PCFB 2PBZA 4EYHB 1B1ZA 3UQ8A 1YNNC 2DNEA 3TP6A 4MV4A 4PBCA 4WRDA 3C2PA 4APMA 1MSGA 4UCOA 4JI2L 1I94L 4J9RA 1YVCA 4IUUA 3UE1A 2UXBH 4IO9A 1CKNB 3CKIB 5J22A 2E2HA 4A3KH 2ZTDA 4F87A 4Q8FA 3T1YQ 3S9WA 3H4DA 1EWIA 1N32Q 4JYAH 2DN8A 1Y1VH 4BY7B 2V58A 4JVZA 5CC4A 2R7ZA 2R7ZG 4DR7Q 4TQSA 5D1PA 4DR3Q 5K3WA 2JA7B 4YQWA 4IJLA 4A3EH 3L3OC 1IW7D 4NXMQ 1G6PA 1B9NA 4I50F 4GC6A 4RAYA 1B2TA 5AFWA 1FGUA 1IBML 1MKHA 4IRKA 2NVTB 5C4XH 1I2LA 3G48A 3WO1A 3PIOA 2PN1A 3GDEA 1K28A 3N6XA 4UDUC 3OUZA 5BWTA 1LUZA 2R3ZA 2WKDA 4U673 3HKZE 2ICEC 1PH6A 3QWNA 4ZRZA 5I47A 4QL5A 2BQUA 2HHHH 1VF7A 3VPDA 5CA1F 3Q1KA 4Q4DA 4RKLA 2Q2TA 1FNUA 1PV4A 2RSOA 2NUAB 4DV3Q 2VQFL 5IYBG 2JEJA 1KJ9A 3G6XA 3S1RB 4JI1H 1ULZA 2R86A 1XK5A 4BXXH 2VPSA 2HD3A 2ID0A 2DY7A 4HJ8A 1OXTA 2KCNA 4C3HB 2X0SA 5EWEA 2W71A 1IBLH 4F88A 2IT1A 1I1LA 3VYUA 4DUYL 1DZ1A 3HB9A 2P5ZX 5LA6F 1B50A 4IUVA 4KD4A 3HOUB 4DK6C 2SEBD 1OO9B 4IR9A 1TWHH 1J6QA 1BCPD 2LXJA 4A4IA 3M4YA 4DAMA 5IODA 2AQ4A 4QB4A 4ABNA 2UXDH 5J2TF 3FEWX 4PZ7A 4A3FB 1JC7A 4YHHH 1EL0A 1GUSA 3FDSA 3PW2A 4WD3A 3ONAB 1H9JA 5JOBA 2NWGA 4MAMA 2CQOA 1VCIA 3RR5A 3J81j 1N34L 4ME5A 4KN7C 4K2LA 1B6SA 1VQ8A 3SE7A 1U4PA 2XVSA 1KQSA 2QKIC 5DG9A 5LHY1 1K83B 5HBRB 2H4OA 1YHQA 4ZKBB 4AYBB 1S40A 1KC8C 1KIXA 3S2DB 5DQGA 2KJXA 5KG0A 1YIJA 2CNVA 4DR5Q 2CCZA 5LMNH 4LMYA 2C35B 4BA2I 4O7RA 5IP9G 5M3FG 4DV0H 3VA5A 4EGVA 1KHIA 1IYUA 3I12A 3TMEA 4X62H 5KFQA 2CNUA 4UP7A 2NYZD 3HOWB 2R93B 1I6UA 4DR6L 3J7ZC 3MWDA 4LWCA 2E8GA 2WACA 4LF7H 1NMGA 2Q2IA 4IPHA 1WJJA 5EBCA 1HR0L 5IIFA 1Q81C 4IOAA 1B70B 4FBTA 4QGUA 1GOZA 1STYA 5E4WC 4DL7A 5DG7A 4A93H 3CC4A 2SOBA 4JI4Q 4QWAA 4H0LC 4XTCS 4EFEA 5H1SE 4DUZH 1R9TH 3EN2A 4NB3A 4BBSB 2A73B 3K5MA 1CQJB 4B3RL 3L4KA 4GKJL 1TWGB 3AW8A 3GB8B 3OMGA 3CU7A 5K36H 4QWEA 3CEBA 5LP6F 4NXNH 3BAAA 3C0FB 4IWXA 5JPMC 1RHPA 2BH8A 3QO2A 3TY8A 4OIJA 2RF4A 1A3UA 3LNNA 3TIIA 3VOTA 5K5PA 2YW2A 3CCUA 4OWXB 4JI2Q 1I94Q 1LACA 2XCLA 1HRJA 1GXDC 3T5HA 5NUCA 2UUCH 1Q12A 4U6PA 2NVXH 4YHHL 4OWWB 2F0TA 4IJHA 3R9RA 2UU9H 4B9XA 1TWFB 3EFXD 2LSSA 4HMIA 3GTPH 4MTEA 1HHVA 3KLSX 4X3SA 2F4VL 2W8LA 2F3VA 1JT8A 1VQLA 1BBXC 3H0GA 4C2MA 3GTLH 1SE2A 4RNOA 1JE5A 3KYHC 2EYJA 1X3FA 1JORA 4OEMB 3W3AA 1PH7A 3UYYA 2K04A 1IBMQ 1SROA 1G2TA 3T9BA 2Q2UA 1U5KA 4GNXB 3FVQA 4ED0A 4I55F 5FLXE 3Q8SB 3L4JA 1QVGA 4MV1A 2JSOA 4JI5H 1H9KA 1WCMH 1OWTA 5LMNL 4DK1A 2E2IH 2JXMB 1JDBB 1O75A 3JSLA 4R7RA 3RD4A 1SYBA 4NDXA 4XIGS 3WOFA 2OLSA 3KXYT 4IFDG 5C8YF 1PFSA 4LFAH 3UDIA 5I4DA 1E22A 4ECYA 1MI2A 1N8RC 4A75A 2VQFQ 1EY7A 3R2IA 2BA0A 3Q8PB 1SN8A 1JB7A 2VQEH 3BJYA 2HGSA 3MFIA 4C56C 2JA6H 1JR0D 1EEFD 1A62A 5DLQE 3MA2B 3A8KE 1B4OA 5M3MH 1K3BC 3Q24A 2E76C 1N48A 4DUYQ 4LF8H 1RD9D 4O3OA 4PZ6A 1OXVA 3U9OA 1EU4A 3NTHA 3I7FA 4RA8A 2EXDA 2F0DA 4C1NI 1X32A 4FNFA 2JA8G 3FKIG 4GLVB 4LFBL 1S5BD 2D2CC 1L0WA 5LOVF 1TWAB 5DQHA 5IGEA 5T1GA 4YY3H 4RGNA 3PO3H 3S2HB 2R87A 5L1LA 4EBCA 1GYFA 3M3YH 2Z6KC 3J81i 1VQCA 2F0HA 4K14A 4JBMA 1KTKA 5BWRA 3NK9A 3ULJA 4WJ3M 3HP3A 3BACA 2PI2E 4RHSA 2KQ3A 4YR3A 1S5ED 5BYBA 4FM9A 4C3IG 3KFUA 2B2YA 2ZDQA 2VB2X 2EIFA 3BABA 1N34Q 1S97A 2ZGIA 1MBYA 3S1NB 2RBMA 4MV7A 3GTJA 3TIGA 3E3XA 3H3VI 5KS8A 2PZUA 2HCIA 2DIKA 2OQ0A 1GUTA 4EVOA 4NKLA 2BDNA 3NXWA 3OPOA 1FNVA 3G8CA 2R61A 2KUMA 4A3KB 4I65A 3U4VA 1S0MA 3H3VC 1Y1VB 4RFBA 1WTVA 2OEOA 4DL3A 4FFMA 4J0MA 4O4IF 3GTQA 4RGMA 1K8MA 4FF4A 4IZOA 2R82A 4A3EB 4DR6Q 1F9QA 2WB1E 2VA2A 1LYLA 3NE5B 2V59A 5L9XA 1XNRH 2B2VA 5J1ZA 4Y8VB 1RF2D 1HR0Q 3I4LA 5C4XB 4KHPL 5BPFA 4LMQD 5GADC 2FKLA 1CQIB 3M7NA 4O3PA 2QB5A 3H3VH 4ECQA 1HZCA 1TT2A 3I91A 1VQBA 5T1IA 1J5EH 2IX1A 4K5VA 2FPPB 3HBLA 2GVAA 5FKAC 4B3RQ 3HZXA 2F0FA 2W6MA 4GKJQ 1RDPD 1PRTC 5FLXW 2NZ1D 1SYCA 4EQNA 1NR2A 3J81L 2O2LD 1FGBD 4O0AA 1IBKL 4H7BA 4O7WA 2Z02A 4JBKA 5CYUA 3PR5B 4C3HG 3ULPA 3K3VA 4YY3L 5KNBA 5BWWA 5CV8A 1XMOH 1H9RA 5DG8A 1Z2OX 4DK3C 1UE7A 3EIVA 4F8MA 1IYDA 2HJWA 3N40P 5KT2A 4YHHQ 3HOUG 1UNSA 4EBEA 1TWHB 1HNWL 4F4WA 1IOVA 1S10A 1WFQA 2ZJPA 5GROA 3J80L 2F4VQ 1X65A 2ASDA 3LGJA 5CMDA 1IHZA 4DV7H 3VNNA 1PTOH 4RH6A 1VQ9A 1QWYA 2HCCA 4K0KH 4A3IH 1JJGA 3GTKA 5CE8A 4TV9F 2B29A 2K5HA 4YR0A 4DNRB 4FXGC 1EQRA 1CHQD 5KT4A 2C9OA 5D3IB 1JCKB 1I4HA 2EJ3A 1KNAA 5JAVA 2EQSA 5LMNQ 2MGSA 5C3EH 4PNYA 2FLNA 4J9PA 2CWAA 2AUKA 2D62A 5IWAL 1I4PA 3TQ1A 1MGSA 4A3GH 5I6YA 2ZTCA 2B2WC 4Q43A 5CORA 2WAQE 1FJGL 2KVMA 1XNRL 3LMLA 2D5DA 2K52A 1NMFA 4O82A 4S3SA 4O4HF 3DTGA 2F0LA 4JV0A 1ZQ7A 1PZID 2XGTA 2KA7A 2F0IA 1YI2A 4FF2A 1T36A 2G9DA 4CKCA 2F52A 3F2CA 1EIHA 4RB3C 1EZ1A 3H40A 2FP4B 4A3JG 4KMUC 4DKAC 3HOWG 2E75C 1EFID 3RV3A 4RG1A 1L2ZA 1AUVA 4CC5A 2NVYA 3R5HA 3M4OH 4LFBQ 1Y69U 4Y7NH 3E9HA 3I4NH 3HOVH 3K5LA 1BJTA 4C3JG 4CMDA 2IJ0A 3U9SA 5IYDG 1Z7TA 2ATLA 1XXGA 4A93B 1M4VA 3MWYW 1C7YA 2CH4W 1D5MC 2V4QA 4K5XA 4A3CH 2ZXOA 1HUMA 1R9TB 3GV7B 1PXUA 4MV8A 3M4PA 3PCOB 3QWUA 1KJ8A 1A8VA 1VAJA 1W2BA 5HGQA 5CV6A 3G4SA 2JA9A 1K8GA 1IL8A 2BA1A 1EY8A 3OHBA 2RDJA 2GPSA 2F0EA 2ZM6H 2NTTA 4RMFA 1I50H 5A35A 3Q8RB 3CC7A 1H9SA 1WR2A 2X6GA 5I5WA 3RN2A 2BCOA 2DABA 2IMWP 2B2UA 1K0SA 1A9XA 2NVXB 5C5LA 5E3FA 3ORRA 1BKBA 2PQAA 3GTPB 4FP5D 4RGTA 2FK3A 3PV0A 5A2QE 3SGIA 1HCZA 2DPJA 1SEBD 2HIVA 4X66H 3KLRA 1RJQA 2WDTA 3CSWA 3GTLB 2MPMA 1HZ9A 4HIMA 1CUKA 1Q46A 4L8JA 4IUNA 4HJ5A 1KDCA 3GP7A 2N88A 1K8AC 2EJ2A 2HG8A 4O3QA 3NP8A 4KHPQ 4QY7A 5BMVF 4FBUA 1WCMB 4FF1A 2DGYA 2CQYA 1B9MA 1VMPA 2R92H 2K4KA 1WTPA 3KDFA 4FXDA 2E2IB 5JH7F 5DLFA 3T54A 5J2UF 4ED6A 4OIKA 4GC7A 1RCVD 3DM3A 4RZRA 3ERQA 5BYAA 4JI0L 1DOMA 1RK6A 3KJPA 3KF8B 4B3TH 3ERSX 2R7DA 4V190 1GUOA 4ODGA 4UAIA 1CQFA 3QR8A 3GQCA 2PMZB 3MXNB 2LMCB 2Y0SB 1TY0A 2JA6B 3IG0A 1DYQA 4O7LA 2B8FA 1HFGA 5FJ8G 1IBKQ 5M3MB 1S5CD 2Z4IA 3EJIA 3HRZC 2GN5A 4QIWB 3NPPA 1A3TA 4YY3Q 1G51A 3BQ2A 4X64H 4YCVA 3F8TA 3MJFA 3UFXB 1QILA 2FPGB 2JA5H 5LMUL 3RLNA 2DZDA 2IBKA 4O2BF 1HNWQ 4R8UA 1DJRD 5KFKA 1ZKOA 3PO3B 1GHKA 2I5MX 1KL9A 3M3YB 3K8AA 5C44G 1UE5A 3ETHA 4LUOA 2MO1A 1EUDB 3A7LA 3PSIA 4G4KA 2W9CA 3HS0C 1T9HA 1HA6A 1VQNA 1XMQQ 5IYCG 5TSSA 4L5TA 4IQZA 4IPCA 1KRSA 3CQZA 3HOXH 1RTNA 5KFCA 3BZDB 5EQ0A 1EY4A 1HNXH 1E4EB 1BNZA 2F0NA 2IX3A 4DR4L 2QEXA 5ELOA 3CPWA 2AWOA 4K5WA 4GKKL 1WTRA 5IWAQ 4Q5VA 3UZBA 2ZDHA 1IW7C 3J80c 1IL2A 2YU9A 4JG2A 1E3PA 3SNOA 5CA0F 4OHJA 3EROA 1FJGQ 1XNRQ 1KT8A 1WH2A 3L9AX 3UDFA 5EPKA 4E4TA 4P71A 4EFBA 3RB4A 3SE0A 4JI7L 4IIJF 1EFWA 4IRCA 5ELCA 1VQIA 1XTDA 1EY6A 3M9NB 3SK4A 1G91A 1V1PA 3DWQA 4FVMA 1ENFA 3EA6A 4UPAA 3T9DA 4A3EG 4MTNA 1JXLA 1PDQA 5JJZA 4JBWA 3U9TA 4E6IA 3NBHA 4KLKA 1EYAA 5DEHA 1C0AA 2B2UC 2PVPA 5JJKA 1VQ5A 1S72A 1K8OA 4DLKA 5CBEE 4UCVA 3JRXA 2PW7A 5A2QW 2N55A 2ODTX 5C0XJ 2EZVA 1X55A 4ECRA 1JDEA 1CA6A 3N41B 2A6ED 2HHFB 5I5TA 2VUMA 4LF4L 1TWCA 4HEDA 1OXSC 1QUQA 3RLOA 3T4AC 1WI5A 2R7MA 3Q23A 5CR3A 2C28A 4BA1I 3ND8A 4N8FA 2K6AA 2NN6H 3TP7A 4X64L 2F0SA 4HIKA 2CNQA 1BCPC 3FDTA 5G3LD 3N6RA 5CB4F 4HR7B 2JYOA 5BR8H 1RYRA 4HYKA 1EY9A 5C3WA 5LXTF 1TY2A 4K6DA 1E1OA 4PWQA 1VBGA 4R4CA 1WSCA 4DPGA 4NLGA 2YZLA 1WRVA 3OSOA 5IGGA 2IX0A 3K59A 1HTPA 3C46A 1DCZA 1F2LA 4POFA 3QOLA 3KBGA 1GUGA 1PRTB 3IFTA 1L1OC 3I56A 1TA8A 1FKAH 2UXCL 2RKSA 1PTOB 2GLTA 1VKZA 4F4YA 4DR1H 3BG3A 5HV6A 3KK7A 1QNUA 2VOBA 1ML0D 4A3IB 2YYZA 1ESRA 1KDBA 1SYGA 1WVLA 4IOCA 2ALYB 2ES2A 1I1KA 4U68A 3VR3A 4O3SA 2EOTA 2IHEA 3G6JB 2VZAA 4A3DG 4A3FH 1ONLA 3PF4A 1U4MA 5IY0A 4GN3B 4JOIA 4DV4H 2B63H 4JI6H 4KKTA 5C3EB 4XQJA 1UNNC 2K01A 4QUFA 3L2PA 4IURA 1CS0A 4KJNA 3A5UA 1Q8IA 1R4PB 4JI0Q 1GUWA 5KFPA 2O5IC 2I0QA 2N8NA 4IN3A 4A3GB 2QF7A 5H80A 3A56A 4Q44A 4YP3A 2PNRC 4HMJA 2ZJQA 3AFQA 2JE6I 2E5LH 1PRTF 1CZWA 3VYSA 5C0XI 2ZXPA 5FLMH 3Q22A 4O7YA 4QQBX 1PTOF 2F0QA 5M9OA 5BPHA 4X6AH 2QW7A 3RJ0A 2H5XA 2PNHA 3T51B 2A1HA 2VPQA 1F2ZA 3SEBA 4BY1G 4OO1G 2WV6D 3M4OB 5LMUQ 1S03G 2W6ZA 4Y7NB 1I7NA 4ZI7F 3U50C 3BQ1A 3I4NB 1VMCA 3MFGA 3OTOL 3HOVB 4YJ2F 4KHVA 4DNTB 4R4QA 4DAPA 2BH2A 2K03A 1AN8A 1G2SA 2Z8LA 2KSWA 1WD0A 1S3OA 3NWTA 1G291 4RB0A 1NNXA 3HKSA 1EYZA 5LL6X 5DGHA 4JCVE 1GLVA 1A3GA 2ZXRA 2MP1A 1Y1WG 1Y1WA 2NTSA 2PZTA 2M05A 1D1IA 1O78A 2CFMA 2OCEA 4HJ7A 2EY2A 5K36G 4RNMA 5GAGC 4LF6H 1EKPA 2EPBA 4DR4Q 1X3QA 1I50B 5DGAA 4GKKQ 1XNQH 4Q8EA 4KKSA 1HQMC 1OBDA 2WIIB 4J9NA 4QWCA 4GZYC 2R6FA 4DL2A 4DR1L 2K33A 1SFOH 2YZNA 3GTOA 1YBYA 4WFN3 2BR0A 1STBA 1Z9FA 5CV4A 4RU9A 1CT1D 4JI7Q 3GTMA 5KFSA 1BO0A 4CJ1B 1C30A 2E2JH 1EIYB 4WORA 1JB3A 3AX6A 2XD4A 3W1BA 3HKZB 4PMBA 2A8VA 4JI6L 3FMCA 2YV5A 2FMMA 4MIUA 5EDWA 1G2WA 4JI8L 4UCUA 1VQ7A 2B8GA 4YAKB 3MXGA 4LFCL 1XYIA 1CA5A 2R92B 2M2LA 1DONA 4DAYB 5IGFA 1E2VA 3HOZG 2EIYA 2WTFA 1PK8A 1JOOA 3H94A 4BBRH 3M85A 4LF4Q 2IY5B 2FMAA 5EWGA 3BDLA 3H91A 4KJOA 1HNZH 3I3CA 3MZ5A 1B3AA 1LTTD 1UE1A 3RMHA 2OF1A 1ILPA 1MSHA 4X64Q 3KHHA 3F2DA 1QB5D 1VQJA 3TSSA 2AQ1B 1JICA 2UXBL 2IPKD 2HQEA 2J9GA 2QEJC 3ICEA 2XWBB 4MN3A 4JYAL 1H95A 2CW0D 4FF3A 1V43A 4LF9H 1EIFA 2FJ2A 2MFIA 5JJLA 2JA5B 1SMYD 3U0GA 3VPCA 2FE3A 5KFZA 5KT7A 1CSQA 3TBIB 5JVG3 2B2TA 3GV8B 4Q4CA 2VR1A 2HVSA 2UXCQ 4ECZA 5C5MA 2I5LX 3IL8A 3I4MG 2A19A 3JZIA 1VQGA 1B33N 1JJ2A 2DJFC 3WWVA 3CC2A 1I5FA 3GJXB 4MV3A 4GOPB 4DIMA 1T94A 2R6GA 3HOXB 1ZEQX 3BVMA 2HHHL 2Q8TA 3QZ8A 3PUXA 4O7NA 3C1FA 5C1PA 3KUPA 1MIUA 3BQ0A 2ASJA 4OONA 4JI1L 2XC9A 4J9QA 2XRSD 1O7IA 1GSOA 1Z6HA 1C8CA 1JX4A 4BWGB 1SJHD 3I90A 3T5JA 3RIZA 1X3PA 1X56A 1IBLL 2N3SA 3BDOA 4ZCKA 3STBC 1PA6A 4N9TA 1ZYRD 1CKMA 5I2XA 1JJCB 2DAAA 5JEAG 2E2HH 1AUXA 2HQLA 3RZDH 1C4QA 2GQSA 2W8KA 1STHA 1WTQA 4L1KA 3URYA 2R7ZH 4B3SH 4N8X1 3KF6A 4EEQA 3TQYA 3R3OA 4CE5A 2SCUB 1I3QA 2L0CA 3JSNA 1N9WA 3OTOQ 2UXDL 4MV6A 1SYFA 3S14H 2PW5A 4ILWA 3CVZA 5DM73 4G7HC 1YJWA 1KAWA 1CZGA 3FMAA 3PR4A 2UVWA 2W9BA 5BN4A 3JZ6A 2VY3A 4CKEA 2K28A 2Q8IB 5KGUA 4DR2H 1TS2A 3FHWA 4LF9L 4JV1A 4ED2A 1A63A 5EKKA 2JEBI 3KHRA 3NHHA 4FGRA 5IYBH 5KG5A 3JAMi 3W1GA 2XWJB 1Q8KA 4DV0L 3GIPA 1GKHA 4FDBA 4NZMA 1RL2A 2BQ3A 1AE2A 5IP7G 3GTGA 4DR1Q 2QK4A 4FFOA 2QGQA 4X62L 1M90C 4H02A 1HPCA 1LT4D 2R8GA 3DWPA 2YS7A 2AGPA 1BOSA 4LF7L 1EZ6A 2OTLA 4POGA 3H20A 1SNMA 4QCLA 5KFGA 4RHRA 3A8IE 4JI6Q 4A3LH 1JOKA 4K6LA 1GM5A 4JW0A 2EDGA 4K8IA 5I5UA 4ME3A 3PN1A 4CHIA 1TS3A 3FKIA 4JI8Q 1BBUA 1QJOA 4MHEA 4EQPA 5M5WH 2B2TC 5FLXc 4DUZL 4R4OA 4LFCQ 1PYBA 2KOLA 2D0PA 5KFWA 3QJYA 3RAXA 1N36H 4O81A 1FD7D 3MWEA 3CP0A 4X3UA 3V05A 1D5ZC 4B3MH 3L0OA 1L1OB 4M0JA 4A3BG 3KTMA 4A3MH 4NXNL 2UVVA 3K0XA 3HOYG 3GILA 3PFFA 4A3GG 1PLFA 3F8NA 4YWKA 2IP4A 5KG4A 1O7ZA 1I7LA 5I5XA 1RJRA 1EUJA 5D1OA 3RUPA 2YTXA 4XYOA 1VQKA 2UXBQ 5IGBA 4O4JF 3GIMA 3J80i 5M3FH 2UUCL 1HTLD 4LSXA 1V9PA 4JYAQ 3D8GA 1C9OA 3SDZA 2UU9L 4DAVA 1CE8A 3D31A 2DUDA 4Y52H 4H13C 5EGTA 2AGQA 3CW2C 1CKNA 2HUGA 3E5NA 3MEFA 5L37A 3G71A 4UY8C 3A54A 1DD2A 4X65H 4O7VA 4BY7G 2ZTEA 3JAML 5D8DA 3QOJA 4HNUA 3RBDA 2LY7A 2JA7A 2JA7G 2OQKA 4PV1C 2F0VA 5M5YH 4JI5L 4O3NA 4OX9H 5KFAA 3RGZA 3GIKA 5KIXA 2B39A 3K58A 3MR5A 3DM1A 2M9VA 2HHHQ 1B8AA 2VA3A 2EYPA 1NBWA 1NJIC 4QUCA 3STBD 4XX0B 3E5SA 4LFAL 3DTFA 1SNDA 1QCBD 3KJOA 1VF5C 3S1MH 2VQEL 2XTIA 2OTJA 1A0IA 4O7SA 4JI1Q 3M7GA 5FPOA 2ASBA 3P1HA 2WB1B 3WNZA 1VQAA 5D3DA 1SFOB 1ZAUA 4KHZA 5JPNC 1IBLQ 2L11A 4H44C 4O3RA 4LF8L 4XQQA 4R1JA 4HIDA 3TY9A 1OTCA 2E2JB 3RFCA 3AEVA 4AQYH 2W7OA 3T56B 1I1MA 4BS9A 5JQWA 2V5AA 1F77A 4C2MH 3H0GH 1V8QA 3VDYA 1K73C 2UXDQ 1JQYD 2Z1CA 1EY0A 3JZFA 4DRFA 3KHGA 4FS1A 2YTYA 3PMFA 4XT3B 4LF5H 4C5AA 3NSWA 1NAPA 3NEMA 5M5XH 1S9FA 2O4XA 3OOCA 3VR5A 1NY4A 4A2BA 3PUZA 2AKWB 4NW2A 4LJZC 3A8JE 4BBRB 2G5DA 1LTLA 3BU2A 1YNJD 2XIWA 3QQMA 4IHJF 2AUJD 3GD7A 4A3FG 2I5HA 4CHTB 3RAQA 1SAPA 1YHAA 1GGOA 5FO9B 4LF9Q 5AJ3L 4XT1B 1XPUA 1DAAA 1HA5A 4IZ8A 4FO2A 5IT9E 1YHBA 2O5JC 4C5BA 4RZQA 5E4XA 2NU9B 4G7OC 5KX5F 5I6WA 4DV0Q 2L1BA 3GV5B 2R8JA 5DLGA 4OXPA 1K83A 4X3KA 2EYOA 4X62Q 4AYBA 1PYSB 3NTIA 4AYBG 1KTAA 2N49A 2B2YC 2O03A 2HVRA 3NUCA 1SR3A 3T53B 3G6EA 1TS4A 2GA4B 1BXTA 3F2UA 5I2YA 2XCAA 4LF7Q 5EJWA 2JA8H 3DXJC 1PH8A 4L5SA 4DAAA 3F2BA 1GVPA 2COJA 2N78A 4O1NA 3WWIA 5KFXA 3PZPA 2F0PA 4DQNA 4YWMA 2R93A 2R93G 1DGSA 2KHSA 3B6YA 1GO3E 1QVFA 3Q8QB 3P20A 5EKIA 2P0AA 3D4RA 5LL6b 2I80A 3H6MA 2NB0A 2WAQB 4DUZQ 3BVZA 1J5EL 1Z47A 2F03A 4YR2A 4DV1H 4XDXA 1ZHSA 4C3IH 3J7A5 4XYMB 3OW7A 5C4JH 4JV5H 2BE5D 4IWYA 4JI3H 1LTID 2NVQH 2AMCB 4NXNQ 2ZJTA 5GAEC 4YCUA 2EYMA 3GTJH 2B2VC 1SEIA 3BA8A 4PMWA 3KHLA 2SDFA 4BBSG 1LLRD 4IUTA 3JC66 3TS2A 3HFZB 2RGVA 1XMOL 1TWGA 1MD2D 3K7AH 5L1JA 3ZYYX 2E2HB 1HQRD 3RZDB 2UUCQ 1Y8PB 2BQRA 1EYGA 4J9MA 3V6KA 4ID6A 4JC0A 2UU9Q 1R4QB 5DNFA 2A6EC 2R7ZB 3A7AB 4FFLA 1Y14B 3GTQH 1HR0W 3I55A 3M9OB 1EOVA 2ENBA 2XRQD 4DV7L 3RB0A 2AHOB 2HVQA 3RF2A 1G8ZD 3K5OA 3N52A 4K0KL 3S14B 2RHQB 3T1YH 3NBZB 1N32H 1ET0A 3TDQA 5LL6S 1TWFA 4HCSA 3G6YA 2IA6A 4DR7H 2AWNA 3NTKA 2BOSA 4YBZB 5KG3A 4J1MA 5KNCA 2RHSB 3QG1A 3U54A 1PX2A 4JI5Q 2J7ZA 4ED7A 1ESFA 3I2ZA 4M7EA 4NXMH 3A74A 4J9LA 2KCCA 2K50A 4HAEA 5KYLA 5KFMA 3AFPA 4GNXA 2NN6G 4LFAQ 3K5NA 5KEEA 1V51A 5E1FA 5CV5A 1LTBD 2VQEQ 1A48A 4R4TA 1LTRD 1RIPA 3L7ZC 3RUZA 5J39A 3FRPB 3SXHA 2WP8J 4DV6H 1CI3M 1O7YA 4HJAA 4EYIB 1KNEA 2W6NA 1O80A 4L6TB 3JAMc 1ENCA 1SNPA 4MZ9A 2IWHA 3X3MA 4CJ2C 4LF8Q 4C1NK 4DV3H 2ZDGA 2R8KA 5FK9C 1EYCA 1EYDA 2PZWA 1Y8NB 3U58A 3PO2H 5ISRA 2RVLA 3IN5A 3V6JA 5IT9W 1WTWA 3E6ZX 4ME6A 4E6NA 1LT5D 2I46A 3OW2A 1N56A 1KLUD 1J8IA 1B53A 1HZBA 1SXTA 3MR6A 1ICWA 1QVCA 5M5WB 3GTKH 3J81E 3R5FA 2B63G 1TWAA 2QYZA 1Q90A 2K5DA 3TQTA 4JPBW 1X3EA 3F1ZA 1SMXA 2W9AA 4RGOS 3PF5A 4A3MB 1SBBB 4HQ6A 2A69D 2I07B 4Q0FA 3WOEA 2AGOA 3I72A 2FFKB 3OMCA 1EOTA 2ZM6L 1CHPD 4RCNA 2TMPA 3RN5A 5AJ3Q 4IUQA 3S2DH 1BXRA 3OIPA 2QCPX 1FL0A 2XGPA 4ED1A 5FLMG 4NZNA 5M3FB 1SYXB 1P8LA 5KT3A 1Q7YC 3MR3A 1K0RA 1YITA 1IOWA 1X54A 5E7NA 3TEKA 4ZAIA 1S5FD 1IKLA 1II3A 3BVGA 1D2BA 1BNCA 5L1IA 1HH2P 4DR5H 4OL7A 3VYRA 4X66L 4A3JH 2X69A 1RKNA 1VBHA 3CMAA 4UCTA 3I4OA 4A3KG 3DHQA 3PUYA 2NVYH 1Y1VA 1Y1VG 3CPFA 2EJGC 3R93A 1M1KC 4C3JH 3IKJA 4MTKA 5IYDH 2AU0A 4CDDC 5M5YB 1I2KA 2F0GA 5DAUA 1DV2A 1EWCA 3P7JA 1YEZA 4FS2A 3EVQA 1DV1A 3AMUA 1XTCD 2MO0A 4R4IA 1J5EQ 1G6ZA 4DV6L 1D7QA 4GLXA 3P75A 1IZ6A 4B3TL 1A2UA 5C4XG 1KRTA 3S1MB 4DXFA 4DV5H 2R7KA 5JVDF 4RAUC 1LABA 4UP9A 1UAPA 3DMUA 1C48A 2WB1G 1YZ6A 5DGBA 3PW0A 1U4RA 3PQIA 3PIPA 2MJ8A 3J7YW 1XMOQ 1SNQA 3NENA 1AEXA 3K5IA 2B3GA 1XX8A 2JQOA 1WYDA 2L5TA 2OT2A 4C5CA 5JQGF 3EQLC 3OHXC 2FHTA 2JN4A 1CK1A 3V2TA 4BXXG 2YL2A 3T9AA 5KFJA 1B7YB 5KNDA 2RDFA 4UHVA 4M1UB 1V4YA 4ECTA 5FPRA 1IKMA 4JI2H 1I94H 4C2MB 3H0GB 4DV7Q 5CM0A 1W96A 2A1AA 4HTHA 5ELEA 4ECSA 4K0KQ 2Z4HA 2JEAI 1TWHA 3GO5A 4NMZA 1FR3A 2KEEA 5M5XB 1AZQA 3T5KA 1M7JA 3HT5A 3ULLA 2CW0C 2FXQA 1KJIA 2EYLA 1HNXL 1SMYC 2FMCA 1ZETA 2PPBC 3K57A 1IXRA 5HNEA 3CMEA 1C3OA 3R5XA 3J81W 1JMCA 1YNXA 3LX0A 1YJ9A 5KFTA 1MZBA 4TV8F 1V1OA 1QZGA 2SNMA 3DEPA 1Q82C 3MXUA 3UE0A 5FJ8H 1DM0B 1QOHA 4K8JA 1K9MC 2CQAA 5KYIA 3GV3A 5D65A 3QZ7A 2VQFH 3SVMA 5F9NA 2UUBH 2F4IA 1L2FA 2JA8B 1B6RA 3RGXA 2F0JA 4KK7A 3AB9A 1PH9A 3DUZA 3M9MB 4RCOA 2ALZA 3SHLA 2W70A 4Z9CB 1DIKA 1K3RA 4DUYH 2KCTA 3CD6A 4DV5L 2QDLA 5C44H 3BS1A 2K5QA 2HGXA 3H4BA 4KY6A 1QE6A 1E7ZA 3ITPA 3CCRA 3S16H 4DF7A 4ECXA 3LWUA 4I7ZC 4YJ3F 1PMRA 2RCFA 1NTGA 4C3IB 5KT5A 1N33H 1ZYRC 4G57A 1LTSD 5IYCH 5C4JB 4JUZA 5BN5A 3RZOH 2NVQB 1TIID 4A93G 3CQZH 4LH6A 2YRWA 2YRXA 5JVH3 1TAEA 3GTJB 1M6VA 3R8BA 2RQXA 1R9TA 1ASYA 2ZM6Q 5BR8L 1OXXK 3DEOA 4U7CA 1EZ8A 2YU9H 4IALA 1N34H 1VQFA 2IHFA 3K7AB 2IL8A 4ZOLF 5C0XH 3AYHB 2XN9C 5DISC 3V4SA 4RWSC 3NBYB 3CCMA 5KKNB 4BWSC 1PFMA 1WOCA 4DL5A 1BUVT 3GTQB 4A76A 2VB3X 5HGTA 5FLXL 2F1MA 4B08A 3H15A 4X66Q 5EWFA 1KJQA 1P16A 1PH5A 3M4IA 5KFUA 4QW9A 2QDBA 2VNUD 5GAHC 3U4ZA 1L0YB 4FE2A 2OH2A 2FJZA 2NVXA 1KDAA 1GUNA 5FO7B 5CBAE 3CRLC 3GTPA 3PIO3 3S17H 1HJPA 1ZXTA 4ZLTF 1U4LA 3LP8A 4DR6H 3VR6A 4DV4L 1I6HH 3GTLA 3QFFA 2RDGA 3HGBA 3C3LA 1CKOA 3T9CA 1I4XA 4RUAA 5BWUA 4JV2A 5CAEB 1HR0H 2NU6B 5KFOA 1SYDA 4DV6Q 1VQMA 1SSOA 3TREA 4B3TQ 2VUMH 3BG5A 3PW7A 1TWCH 4UUGA 2F0UA 3T1HH 1WCMA 2V1CC 1MJCA 1WCMG 1SCUB 3E9IA 4RB1A 2E2IA 3E0EA 1W6JA 2UUBL 1JOQA 2A68D 4KY7A 4PZ8A 2E5LL 4F50A 3K81C 1ILQA 2AQ3B 1KXLA 3KF8A 4CDEC 1KD1C 4B3RH 5JVLA 4GKJH 3K7UC 4JOIC 4ZKCB 3PO2B 1M0WA 2PMZA 3MXNA 1DOLA 4FFPA 1QNKA 1U0LA 2Y0SG 2Y0SA 2JA6G 1UE6A 1VQOA 1AFPA 2UVUA 2JA6A 3ER0A 4TKOB 3HEJA 2GQRA 2L55A 3I70A 1UEAB 5M3MG 3KLSA 1N33L 4A3LG 4QIWA 4R8IA 3KREA 4HSPA 4FU0A 1PYWD 3SK5A 4L5RC 2FK1A 4MA5A 3WWHA 4AYBE 3GTKB 2J6SA 4OO1I 1W93A 3W5OA 1Z2NX 4A3DH 2F4VH 3PO3G 1QZHA 4O83A 4TSSA 2HDMA 2K14A 3MC0B 3K3PA 1H9MA 3HG9A 1NUCA 5G3LF 4O4LF 4LSAA 3ND9A 1XWEA 5CR5A 1CM9A 4P75A 4LF6L 4FFRA 1V1QA 4A3MG 1HNXQ 3OSPA 4FFNA 1KBLA 3KBXA 1CFMA 3D4WA 1UC8A 3ORQA 1GHJA 5CGKA 2D9UA 1XNQL 5KG6A 5KFHA 2KHIA 2RSNA 5KFIA 5C1OA 2A6HD 3GV6A 4ZUJA 1LT6D 1BGWA 4WHXA 1STNA 3VR4A 2YWVA 1A2TA 2A74C 4MTDA 4M8AA 5EKLA 1E4EA 2W7PA 2L4NA 3S24A 1KAAA 3EPIA 4K2KA 2L12A 2Z6KA 4CC6A 4A3JB 2QA4A 2SNSA 1PH4A 2CHBD 3D4DA 1WTXA 3AU7A 4BY1H 1GSHA 3MR2A 2D0OA 2CKZB 1TR5A 4OO1H 2NVYB 2FLLA 2K5NA 3DLLA 4ED3A 4PG3A 3TW7A 4PDBA 1JE4A 1AW7A 1XPOA 3R2TA 4C3JB 1STEA 1A0GA 1JLLB 1XDNA 4I4TF 4UCSA 4MNOA 4OWTB 3S1QH 1EQVA 4ZK9B 1A3VA 3T1HL 3OIQA 4DV5Q 3LQSA 2I87A 3J7AV 1RYSA 2BDOA 3D0FA 2M00A 3R23A 2R7LA 1TU2B 2EE1A 1BDOA 4LFBH 1YNND 4CJ0B 4EGJA 5GONF 2J4XA 4CDCC 4EQOA 4UFZA 4DL6A 1Y1WH 1HNZL 3IRBA 1RK5A 2EY1A 3I8ZA 4HNVA 3BDCA 3CAMA 2L9HA 1M8AA 3X3NA 3SK6A 1F9SA 1Q1BA 1HXYD 2HHFA 1W6KA 5BR8Q 4LW1A 5JEAJ 1H9SB 4L63B 1Z2PX 5F2DA 2YTVA 3VMMA 4F7XA 5LYJF 2CW8A 4QMGA 5C3XA 1EKVA 3GTOH 1VQDA 2HIXA 5EBDA 3GTMH 2PQAB 1VS0A 4HR7A 1GSAA 4O7TA 2R8HA 1YNJC 3NWSA 4IRDA 2HT1A 2DWCA 3SK8A 4GLWA 5KFBA 2KHJA 3H0GG 4ECUA 5IT9L 1EWHA 3VR2A 1X3GA 1DOKA 2UUAH 1SLJA 2TSSA 2Z0SA 3OYYA 4QWDA 4TVIA 1LTAD 3IFDA 3MFHA 5BWVA 1F2YA 4X3TA 2Y4RA 4DV4Q 1BCPB 1EU3A 2VXWA 3GIDA 3KDFB 3PUVA 4NP5A 4A3IG 1SDFA 4JK1C 3BA9A 3HOZH 3U55A 2KCMA 1XJVA 1SYEA 3O13A 4UCRA 3NUAA 2W6QA 4LNQA 4O2AF 3BZKA 5E25A 4KHPH 4O2DA 5GQOA 3T16A 4IFDJ 1SE4A 5CV7A 3Q6SA 2F0WA 2UUBQ 3SI8A 4XQNA 4EGQA 5C3EG 2W6PA 3PW4A 3MAQA 2E5LQ 2ATWA 4HNTA 2V4RA 1S5DD 1SRUA 5JUMA 2YCHA 3RBEA 2ZJRA 3FP9A 2Q8RE 2ABJA 2VL6A 1JWMD 2MQHA 4B3SL 3N43B 2JJQA 2C00A 1A15A 4Q45A 3KLWA 1X9NA 2BE5C 1LM0A 4R8UB 1IBKH 5IP9H 1BCPF 3SR1A 2F0MA 1N33Q 1AH9A 2VUGA 4EBDA 3EBEA 3UI2A 2EXZA 3G7LA 4PQXA 5C44B 4DGZA 3RB6A 2C2DA 3I4MH 2KECA 4J6HA 2XIGA 1E2WA 3S16B 4ECWA 1KLGD 1SE8A 2W9CB 1AE3A 2QILA 2YYAA 2KEDA 1BF4A 1HNWH 3I4NG 3V6HA 3HOVG 2C2RA 2B2WA 4XXEA 3RZOB 4DR2L 5FNVF 5KG7A 1BVSA 2WFWA 3CQZB 4YCWA 1UWVA 5EPLA 2L15A 2ASLA 1KJJA 3KALA 1B3QA 3NBIA 1VQPA 4LF6Q 4A3CG 1KC7A 2J6TA 3T7AA 4DA2A 1XMQH 4KTAA 4ULLA 5A2QL 1XNQQ 1PH2A 3MXPA 4QSHA 5K2MA 2YU9B 3TY5A 3TINA 2Z04A 3RB3A 2JEGA 3PGZA 4A2AA 1WTHA 3GQBA 4HN7A 3BYYB 3ZJYC 2EVBA 2IW3A 1EIGA 3CCQA 3S15H 1AP0A 2FPIB 1I6VC 3NQIA 2UUAL 3QB3A 2CZGA 3LWBA 1I50A 2V9WA 1V1PB 3NQTA 5JEAH 5IWAH 2XGQA 2X5RA 5KG1A 1EY5A 1S68A 4RNNA 4RKBA 4R9WA 1Y8OB 3V4ZA 3K6OA 2WINB 2F3WA 3W2DA 4YB8B 1FJGH 4HJ9A 2GVBA 1VQEA 3NBHB 3CHBD 4CKBA 1IYVA 4IFDI 2EY5A 1GJXA 1I3QH 2Q7DA 2K5VA 3MWMA 4P73A 1F2MA 3J7AK 3S17B 4NYEA 2KENA 4CDFC 1KEEA 1Q1EA 5HURA 5DM63 1I6HB 2OXPA 3T1HQ 4TUYF 2K05A 4DL4A 1N36L 3HKZA 3HKZG 2EYFA 1VQ6A 4QJFA 4B3ML 1IYJB 1FYCA 2EJ0A 1Q86C 2VUMB 4P72A 5ELFA 1TWCB 4R8NA 1QUQB 3A5ZB 4EG0A 3CRKC 2W57A 1HNZQ 1E1TA 2I8CA 2R92A 2R92G 4TRDA 1E0BA 1PZKD 1I4RA 1PTOC 1RJPA 4DAYA 1J9OA 3ETJA 4EEYA 3CCVA 1EUCB 1E4FT 2WYOA 4DNIA 4GN4B 1Q3LA 5KFEA 4IFDH 5IP7H 3GTGH 4DK0A 2HDLA 5KFNA 2R7NA 2XCPA 2RCNA 4HCEA 5BN3A 4UP8A 3PO2G 4P74A 5IOCA 2JEIA 4N9PA 1D8LA 5FOBB 4HN2A 4MV9A 1PZJD 3RLFA 1ENAA 2J6UA 3DF7A 4X65L 2A69C 2C5CA 2EJMA 1O7LA 3UZOA 1K1SA 3EYYA 1CSPA 2DY8A 3PVXA 4DXGA 2JA5A 2JA5G 4QW8A 4CBVA 4ECVA 1TS5A 2EY6A 4OX9L 1TXYA 3CXCA 2COIA 2A5HA 2ZT9C 3CCSA 1XMQL 4A3DB 5EZYF 2JEFA 1EQQA 3FKIH 2LFNA 3N8DA 4DV2H 2VQDA 1EQTA 2X6LA 2Q2HA 1PH1A 4A3BH 1I4GA 1UC9A 1ICFB 1SNCA 4DFAA 4GOPA 3HOYH 4ZHQF 1AN7A 5IGDA 3HOXG 1S4ZA 4XZ3B 5FO8B 5KFVA 3TS0A 4F4XA 4F4ZA 5IT9c 4WBNF 1E2ZA 3AQQA 2E74C 2RGRA 4Q0YA 5KFFA 3H09A 3OWFA 1LV9A 3TP8A 4JI0H 3TRZA 3T5LA 5DAAA 5JJIA 3KAKA 2LKVA 1SNOA 1JWUD 5IGCA 2YZMA 3T13A 3J7AF 2LXKA 4AQYL 4BY1B 4O84A 4B3SQ 2FINB 3C1EA 1RJTA 4G3IA 3T99A 4J9OA 3UDGA 5IE8A 2R7FA 4KKUA 3S1QB 3Q2OA 1T3NA 1ET6A 3GIIA 4BY7H 4LF5L 3QIAA 4NPSA 4DN4M 1PH3A 5F9LA 5LMUH 5D14A 4ZQ3A 2JA7H 3MFYA 2EYHA 3FPPA 4XYQA 1Y1WB 4DR2Q 3BZCA 5HY6A 4DR3H 1SJED 1TQOA 2NVTH 3RV4A 1NR4A 4LK1C 3A0JA 2JP1A 3VA7A 2CVRA 2F0KA 3T9EA 4QWBA 3CCLA 3Q8DA 5I60A 3LWEA 4B9WA 4GLAC 3GLKA 3LULA 3GTOB 3JAME 4J9SA 2ICIA 3VYTA 3GTMB 4EX5A 1NCVA 1EHIA 4DR4H 4KV6A 2UUAQ 1PVOA 4KI0A 1JKJB 4GKKH 3S1RH 5ELNA 4KD3A 3WWJA 1WD1A 2KBNA 3E0JA 4V0BA 1B04A 4DV2L 5ELDA 3TP5A 4C3HH 2Z6BA 2HDKA 1D1KA 2NU7B 1S0OA 4I7HA 4JI7H 4MA0A 3FPUB 4GS3A 1KABA 4OGQC 3NELA 5I9PA 3HOUH 1PRTD 3K5HA 2PMZE 2VS1A 3D3RA 3CCEA 2Y0SE 4O7ZA 5I5SA 4IPGA 1MHWC 1PTOD 4DV1L 1MJEA 4IR1A 1BBWA 4LAAA 5COYA 5I9OA 2MNAA 1N36Q 3HOZB 3BJUA 4ZQIA 2NZHA 5BWXA 5C4HA 4JV5L 2FLPA 4B3MQ 1ZHQA 3OSNA 4QIWE 5I5YA 4YIJA 4JI3L 3M9BA 4O86A 3JRWA 3MHBA 1UEBA 3N44B 4L5QA 3D6WA 5LMNW 4PMCA
chains in the Genus database with same CATH topology
1XPRA 3N42B 4AH6A 1L1OA 4LF4H 1K83H 1GD7A 4GOPC 4GN5A 3RTXA 3T1YL 4X65Q 1N32L 4IPDA 4DR7L 2PI2A 4DR3L 3KAJA 3HOWH 2R93H 3RNUA 4OX9Q 3J81c 4NXML 2WE6A 3M4QA 2UXCH 4J15A 1FVIA 1E4GT 2JK8A 2VW9A 2NZOA 4RAZA 1M0TA 1PHJA 3NC0B 3HXLA 5C0XG 1X6OA 4BBSH 4EQ5A 2F3IA 4AIMA 4DV3L 4JI4H 3TEHB 2NN6I 1TWGH 4LH7A 4AQYQ 3KF6B 4GNXC 3JAMW 4TQUS 1OXUA 2MCTA 3PUWA 5J3BA 4LF5Q 4RB2C 1TWFH 3CF5A 4IAJA 3K80C 3OTOH 4WJ4A 2VUMG 4JBJA 4TVAB 2CW7A 5FD6A 1VQ4A 4LUZA 1E24A 4BBRG 1IBMH 1YJNA 3KOJA 4DR5L 5FD5A 4LUVA 1W3SA 4DV2Q 1NE3A 2CWPA 2OWOA 3J80W 4APVA 4HIOA 1ASZA 3CCJA 4DV1Q 1TWAH 1VQHA 4JV5Q 5EOYA 3S2HH 4JI3Q 4JI4L 2K75A 4JI8H 5EAYA 4LFCH 2WAQG 5D1OB 4ALPA 4ETSA 1HZAA 4YWLA 3S1NH 3UDXA 4APMA 4UCOA 4JI2L 1I94L 1YVCA 3UE1A 2UXBH 4IO9A 1CKNB 4A3KH 2ZTDA 3T1YQ 1EWIA 1N32Q 4JYAH 1Y1VH 2R7ZG 4DR7Q 5D1PA 4DR3Q 4IJLA 4A3EH 4NXMQ 1G6PA 4RAYA 1FGUA 1IBML 1MKHA 5C4XH 3G48A 3PIOA 3N6XA 3GDEA 1LUZA 3HKZE 1PH6A 4QL5A 2HHHH 2Q2TA 1PV4A 4DV3Q 2VQFL 5IYBG 4JI1H 1XK5A 2VPSA 4BXXH 2ID0A 4HJ8A 1OXTA 1IBLH 2IT1A 4DUYL 4DK6C 1TWHH 1J6QA 2LXJA 4A4IA 4DAMA 2UXDH 4PZ7A 4YHHH 2CQOA 1VCIA 3RR5A 3J81j 1N34L 1VQ8A 1KQSA 1YHQA 1KIXA 1S40A 1KC8C 1YIJA 4DR5Q 2CCZA 5LMNH 4LMYA 2C35B 4BA2I 5IP9G 5M3FG 4DV0H 1KHIA 4X62H 4UP7A 1I6UA 4DR6L 3J7ZC 4LWCA 2E8GA 4LF7H 1NMGA 2Q2IA 4IPHA 1WJJA 1HR0L 1Q81C 4IOAA 1B70B 4QGUA 4A93H 3CC4A 4JI4Q 4XTCS 5H1SE 4DUZH 1R9TH 3EN2A 4NB3A 4B3RL 3L4KA 4GKJL 3GB8B 4NXNH 3BAAA 3C0FB 2BH8A 3TY8A 2RF4A 3CCUA 4OWXB 4JI2Q 1I94Q 2UUCH 1Q12A 2NVXH 4YHHL 4OWWB 4IJHA 2UU9H 2LSSA 3GTPH 4MTEA 2F4VL 1JT8A 1VQLA 3GTLH 1JE5A 3KYHC 1X3FA 1PH7A 1IBMQ 1SROA 2Q2UA 1U5KA 4GNXB 3L4JA 1QVGA 4JI5H 1WCMH 5LMNL 2E2IH 1O75A 3JSLA 4R7RA 4XIGS 3KXYT 4IFDG 1PFSA 4LFAH 3UDIA 1E22A 1N8RC 4A75A 2VQFQ 2BA0A 2VQEH 1SN8A 1JB7A 2HGSA 2JA6H 1A62A 5DLQE 5M3MH 4DUYQ 4LF8H 4PZ6A 1OXVA 3I7FA 2EXDA 2JA8G 3FKIG 4GLVB 4LFBL 1L0WA 4YY3H 3PO3H 1GYFA 3M3YH 2Z6KC 3J81i 1VQCA 4JBMA 3ULJA 4WJ3M 2PI2E 4FM9A 3KFUA 2EIFA 3BABA 1N34Q 4MV7A 3H3VI 2OQ0A 3U4VA 4J0MA 4DR6Q 2WB1E 1XNRH 1LYLA 1HR0Q 4KHPL 5GADC 3M7NA 3H3VH 1HZCA 1VQBA 1J5EH 2IX1A 2GVAA 4B3RQ 4GKJQ 5FLXW 4O0AA 1IBKL 4JBKA 3ULPA 3K3VA 4YY3L 1XMOH 1Z2OX 4DK3C 1UE7A 3EIVA 3N40P 4YHHQ 3HOUG 1HNWL 1WFQA 2ZJPA 5GROA 2F4VQ 1X65A 3LGJA 4DV7H 3VNNA 1VQ9A 4K0KH 4A3IH 1JJGA 2B29A 2K5HA 1EQRA 2EQSA 5LMNQ 5C3EH 2CWAA 2D62A 5IWAL 4A3GH 2ZTCA 2WAQE 1FJGL 1XNRL 3LMLA 2K52A 1NMFA 2XGTA 1YI2A 2F52A 3F2CA 4RB3C 4A3JG 4DKAC 3HOWG 4RG1A 1L2ZA 4CC5A 3M4OH 4LFBQ 4Y7NH 3E9HA 3I4NH 3HOVH 1BJTA 5IYDG 1C7YA 4A3CH 3M4PA 3PCOB 3QWUA 1A8VA 1W2BA 5HGQA 3G4SA 2JA9A 1K8GA 2BA1A 2ZM6H 4RMFA 1I50H 3CC7A 3RN2A 2PQAA 1BKBA 3PV0A 3SGIA 2HIVA 4X66H 2WDTA 1HZ9A 4HIMA 1CUKA 1Q46A 4HJ5A 1K8AC 4KHPQ 4QY7A 2DGYA 2R92H 2K4KA 3KDFA 3DM3A 4JI0L 4B3TH 3KJPA 3KF8B 3ERSX 2R7DA 3MXNB 3IG0A 5FJ8G 1IBKQ 2GN5A 4YY3Q 1G51A 4X64H 4YCVA 3F8TA 2JA5H 5LMUL 3RLNA 1HNWQ 2I5MX 1KL9A 3K8AA 5C44G 1UE5A 4LUOA 2MO1A 3PSIA 1T9HA 1VQNA 1XMQQ 5IYCG 4L5TA 4IPCA 1KRSA 3HOXH 1HNXH 4DR4L 2QEXA 5ELOA 3CPWA 2AWOA 4GKKL 5IWAQ 3J80c 1IL2A 4JG2A 1E3PA 1FJGQ 1XNRQ 1WH2A 3UDFA 4EFBA 4P71A 4JI7L 1EFWA 1VQIA 1XTDA 4UPAA 4A3EG 4MTNA 4JBWA 4KLKA 1C0AA 5JJKA 1VQ5A 1S72A 4UCVA 5A2QW 5C0XJ 1X55A 3N41B 4LF4L 1OXSC 1QUQA 3RLOA 1WI5A 4BA1I 4HIKA 4X64L 5BR8H 1E1OA 4R4CA 4DPGA 2IX0A 4POFA 3I56A 1TA8A 1L1OC 1FKAH 2UXCL 4DR1H 2VOBA 2YYZA 2ES2A 4IOCA 2ALYB 2IHEA 2VZAA 4A3DG 4A3FH 3PF4A 5IY0A 4GN3B 4JOIA 4DV4H 2B63H 4JI6H 3L2PA 3A5UA 4JI0Q 2I0QA 2N8NA 2ZJQA 3AFQA 2JE6I 2E5LH 5C0XI 5FLMH 4QQBX 4X6AH 3RJ0A 2H5XA 2PNHA 4BY1G 4OO1G 1S03G 5LMUQ 3U50C 3OTOL 4R4QA 2BH2A 2KSWA 1S3OA 4RB0A 1G291 3HKSA 4JCVE 1Y1WG 2CFMA 2OCEA 4HJ7A 5K36G 4LF6H 5GAGC 4DR4Q 4GKKQ 1XNQH 4DR1L 1SFOH 1YBYA 1Z9FA 4JI7Q 2E2JH 1EIYB 3W1BA 2A8VA 4JI6L 2YV5A 4JI8L 4UCUA 1VQ7A 4LFCL 4DAYB 3HOZG 4BBRH 3M85A 4LF4Q 2IY5B 1HNZH 1UE1A 4X64Q 3F2DA 1VQJA 2UXBL 3ICEA 4JYAL 1H95A 1V43A 4LF9H 1EIFA 2MFIA 5JJLA 2FE3A 1CSQA 2HVSA 2UXCQ 2I5LX 3I4MG 2A19A 1VQGA 1JJ2A 3WWVA 3CC2A 1I5FA 3GJXB 4GOPB 2R6GA 2HHHL 3PUXA 1MIUA 4OONA 4JI1L 1O7IA 3RIZA 1X56A 1IBLL 2N3SA 3STBC 1PA6A 1CKMA 1JJCB 5JEAG 2E2HH 2HQLA 3RZDH 2R7ZH 4B3SH 3KF6A 4EEQA 3TQYA 3JSNA 1N9WA 3OTOQ 2UXDL 3S14H 3CVZA 1YJWA 1KAWA 3FMAA 2VY3A 4DR2H 3FHWA 4LF9L 1A63A 2JEBI 5IYBH 3JAMi 3W1GA 1Q8KA 4DV0L 1GKHA 4FDBA 1RL2A 1AE2A 5IP7G 4DR1Q 2QGQA 4X62L 1M90C 4H02A 4LF7L 2OTLA 4POGA 3H20A 4A3LH 4JI6Q 1GM5A 4ME3A 3PN1A 4JI8Q 1BBUA 5M5WH 5FLXc 4DUZL 4LFCQ 4R4OA 1PYBA 2D0PA 1N36H 3CP0A 4B3MH 3L0OA 1L1OB 4A3BG 4A3MH 4NXNL 3K0XA 3HOYG 4A3GG 3F8NA 4YWKA 1EUJA 5D1OA 2YTXA 1VQKA 2UXBQ 3J80i 5M3FH 2UUCL 4LSXA 1V9PA 4JYAQ 1C9OA 2UU9L 3D31A 2DUDA 4Y52H 3CW2C 1CKNA 3MEFA 3G71A 4UY8C 4X65H 4BY7G 2ZTEA 2JA7G 2OQKA 4OX9H 5M5YH 4JI5L 3RGZA 2HHHQ 1B8AA 1NBWA 1NJIC 3STBD 4LFAL 3KJOA 3S1MH 2VQEL 2XTIA 2OTJA 1A0IA 4JI1Q 5FPOA 2ASBA 1VQAA 4KHZA 1IBLQ 4LF8L 4R1JA 4HIDA 3TY9A 1OTCA 3AEVA 4AQYH 4C2MH 3VDYA 3H0GH 1K73C 2UXDQ 4DRFA 2YTYA 4LF5H 3NEMA 5M5XH 4A2BA 1NY4A 3PUZA 2AKWB 1LTLA 3BU2A 3GD7A 4A3FG 2I5HA 1YHAA 4LF9Q 5AJ3L 1XPUA 1YHBA 4RZQA 4DV0Q 4OXPA 4X62Q 1PYSB 4AYBG 2N49A 2O03A 2HVRA 1SR3A 3G6EA 4LF7Q 2JA8H 1PH8A 4L5SA 3F2BA 1GVPA 2N78A 4YWMA 2R93G 1DGSA 3B6YA 1GO3E 1QVFA 5LL6b 4DUZQ 1J5EL 1Z47A 4DV1H 1ZHSA 4C3IH 3J7A5 4JV5H 5C4JH 4JI3H 2NVQH 2AMCB 4NXNQ 2ZJTA 5GAEC 4YCUA 3GTJH 1SEIA 3BA8A 4PMWA 4BBSG 3JC66 3TS2A 3HFZB 2RGVA 1XMOL 3K7AH 2UUCQ 1EYGA 4JC0A 2UU9Q 1Y14B 3GTQH 1HR0W 3I55A 1EOVA 4DV7L 2AHOB 2HVQA 3RF2A 4K0KL 2RHQB 3T1YH 3NBZB 1N32H 4DR7H 2AWNA 2RHSB 4JI5Q 3I2ZA 4M7EA 4NXMH 3A74A 2K50A 3AFPA 4GNXA 2NN6G 4LFAQ 2VQEQ 4R4TA 1RIPA 3L7ZC 2WP8J 4DV6H 4HJAA 3JAMc 4MZ9A 4LF8Q 4DV3H 3U58A 3PO2H 5IT9W 4E6NA 3OW2A 1HZBA 1QVCA 3GTKH 2B63G 1X3EA 3F1ZA 1SMXA 3PF5A 2ZM6L 3RN5A 5AJ3Q 3S2DH 1FL0A 5FLMG 1SYXB 1P8LA 1Q7YC 1K0RA 1YITA 1X54A 5E7NA 1HH2P 4DR5H 4X66L 4A3JH 3CMAA 4UCTA 3I4OA 4A3KG 3PUYA 2NVYH 1Y1VG 3CPFA 1M1KC 4C3JH 5IYDH 1YEZA 2MO0A 4R4IA 1J5EQ 4DV6L 1D7QA 4GLXA 4B3TL 1IZ6A 5C4XG 1KRTA 4DV5H 4UP9A 2WB1G 1YZ6A 3PIPA 1XMOQ 3NENA 2B3GA 2JQOA 1WYDA 4BXXG 1B7YB 5FPRA 4JI2H 1I94H 4DV7Q 2A1AA 4K0KQ 2JEAI 3GO5A 3ULLA 2FXQA 1HNXL 1IXRA 3CMEA 3J81W 1JMCA 1YNXA 1YJ9A 1MZBA 1QZGA 1Q82C 3UE0A 5FJ8H 1K9MC 2VQFH 2UUBH 1L2FA 3RGXA 1PH9A 1K3RA 4DUYH 2KCTA 3CD6A 4DV5L 5C44H 3S16H 1E7ZA 3CCRA 1NTGA 1N33H 5IYCH 3RZOH 4A93G 4LH6A 3CQZH 1TAEA 1ASYA 2ZM6Q 5BR8L 1OXXK 2YU9H 1N34H 1VQFA 2IHFA 3AYHB 5DISC 3NBYB 3CCMA 4BWSC 1WOCA 4A76A 3H15A 4X66Q 1P16A 1PH5A 3M4IA 2VNUD 5GAHC 3U4ZA 3S17H 1HJPA 4DR6H 1I6HH 4DV4L 1CKOA 1HR0H 1VQMA 4DV6Q 3TREA 4B3TQ 2VUMH 1TWCH 3T1HH 2V1CC 1MJCA 1WCMG 4RB1A 3E9IA 3E0EA 2UUBL 4PZ8A 2E5LL 3K81C 1KXLA 1KD1C 4B3RH 4GKJH 3K7UC 4JOIC 1M0WA 1U0LA 2Y0SG 2JA6G 1UE6A 1VQOA 3ER0A 5M3MG 1N33L 4A3LG 4L5RC 4AYBE 4OO1I 3W5OA 1Z2NX 4A3DH 2F4VH 3PO3G 1QZHA 2K14A 4LSAA 4P75A 4LF6L 1V1QA 4A3MG 1HNXQ 1XNQL 2KHIA 1BGWA 4MTDA 3S24A 2Z6KA 4CC6A 2QA4A 1PH4A 4BY1H 2D0OA 2CKZB 2K5NA 3DLLA 4PG3A 4PDBA 1XPOA 4EFEA 1XDNA 4UCSA 4MNOA 4OWTB 3S1QH 3T1HL 4DV5Q 3D0FA 4LFBH 4UFZA 1Y1WH 1HNZL 3IRBA 3CAMA 1Q1BA 5BR8Q 4LW1A 5JEAJ 1Z2PX 2YTVA 2CW8A 3GTOH 1VQDA 2HIXA 3GTMH 2PQAB 1VS0A 2HT1A 2KHJA 3H0GG 1X3GA 2UUAH 1SLJA 2Z0SA 3OYYA 4DV4Q 3KDFB 3PUVA 4A3IG 3BA9A 3HOZH 2KCMA 1XJVA 4UCRA 4LNQA 3BZKA 4KHPH 4O2DA 5GQOA 4IFDJ 2UUBQ 5C3EG 2E5LQ 2ATWA 1SRUA 2YCHA 2ZJRA 3FP9A 2VL6A 2MQHA 4B3SL 3N43B 2JJQA 3KLWA 1X9NA 1IBKH 1LM0A 5IP9H 1N33Q 1AH9A 2VUGA 3EBEA 3I4MH 2XIGA 1SE8A 1AE3A 1HNWH 3I4NG 3HOVG 4DR2L 1BVSA 2WFWA 4YCWA 1UWVA 2L15A 3KALA 1VQPA 4A3CG 4LF6Q 1XMQH 1XNQQ 1PH2A 3TY5A 3PGZA 4A2AA 3ZJYC 3CCQA 3S15H 2UUAL 5IWAH 1S68A 1FJGH 4HJ9A 2GVBA 1VQEA 3NBHB 3MWMA 4IFDI 1I3QH 2K5VA 4P73A 3J7AK 2KENA 1Q1EA 3T1HQ 1N36L 3HKZG 1VQ6A 4QJFA 4B3ML 1IYJB 1Q86C 4P72A 1QUQB 3A5ZB 2W57A 1HNZQ 1E1TA 2R92G 3CCVA 1E4FT 2WYOA 4DNIA 4GN4B 5IP7H 3GTGH 2RCNA 4UP8A 3PO2G 4P74A 1D8LA 4MV9A 3RLFA 3DF7A 4X65L 3EYYA 1CSPA 2JA5G 4OX9L 1TXYA 3CXCA 3CCSA 1XMQL 1EQQA 3FKIH 4DV2H 2Q2HA 1PH1A 4A3BH 4GOPA 3HOYH 1AN7A 3HOXG 3TS0A 5IT9c 3AQQA 2RGRA 4Q0YA 4JI0H 3TRZA 5JJIA 3KAKA 2LXKA 4AQYL 4B3SQ 3UDGA 5IE8A 2R7FA 4BY7H 4LF5L 4NPSA 1PH3A 5LMUH 2JA7H 4DR2Q 3BZCA 5HY6A 4DR3H 2NVTH 3A0JA 3CCLA 3Q8DA 4GLAC 4EX5A 4DR4H 2UUAQ 1PVOA 4KI0A 4GKKH 3S1RH 5ELNA 2KBNA 1B04A 4DV2L 4C3HH 4I7HA 4JI7H 4GS3A 3NELA 3HOUH 2PMZE 2VS1A 3CCEA 2Y0SE 4IPGA 1MJEA 4DV1L 1BBWA 1N36Q 2MNAA 3BJUA 2NZHA 4JV5L 4B3MQ 1ZHQA 4QIWE 4JI3L 3M9BA 1UEBA 3N44B 4L5QA 5LMNW 3UQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPR A;  1E7Z A;  3CCR A;  3S16 H;  2R7Z H;  3KF6 A;  4O0A A;  3TQY A;  4AH6 A;  1IBK L;  1NTG A;  4JBK A;  4EEQ A;  5IYC H;  1L1O A;  3JSN A;  1N9W A;  3OTO Q;  3ULP A;  2UXD L;  4YY3 L;  3RZO H;  4A93 G;  3S14 H;  3CQZ H;  4LH6 A;  4DK3 C;  1UE7 A;  3EIV A;  1K83 H;  1TAE A;  1GD7 A;  4YHH Q;  4GOP C;  3HOU G;  1ASY A;  2ZM6 Q;  1YJW A;  1HNW L;  5BR8 L;  1KAW A;  1OXX K;  1WFQ A;  2ZJP A;  5GRO A;  2F4V Q;  1X65 A;  2VY3 A;  2YU9 H;  3LGJ A;  1VQF A;  4GN5 A;  3VNN A;  1VQ9 A;  2IHF A;  3RTX A;  3T1Y L;  3AYH B;  4X65 Q;  1N32 L;  3FHW A;  4A3I H;  1JJG A;  5DIS C;  4IPD A;  3NBY B;  3CCM A;  4LF9 L;  4DR7 L;  2B29 A;  1WOC A;  2K5H A;  2PI2 A;  4DR3 L;  1A63 A;  2JEB I;  3HOW H;  1EQR A;  2R93 H;  4A76 A;  3RNU A;  4OX9 Q;  3H15 A;  5IYB H;  4X66 Q;  3J81 c;  4NXM L;  3M4Q A;  3JAM i;  1P16 A;  1PH5 A;  2EQS A;  3W1G A;  5LMN Q;  1Q8K A;  4DV0 L;  2VNU D;  1GKH A;  4FDB A;  3U4Z A;  1RL2 A;  4J15 A;  1AE2 A;  5IP7 G;  1FVI A;  5GAH C;  5C3E H;  4DR1 Q;  2QGQ A;  4X62 L;  1M90 C;  4H02 A;  2CWA A;  2D62 A;  2JK8 A;  2VW9 A;  3S17 H;  1HJP A;  5IWA L;  4A3G H;  2NZO A;  4DV4 L;  2ZTC A;  4LF7 L;  1I6H H;  2OTL A;  4POG A;  2WAQ E;  1FJG L;  1XNR L;  2K52 A;  1CKO A;  1NMF A;  1PHJ A;  3NC0 B;  5C0X G;  1X6O A;  4BBS H;  4JI6 Q;  4A3L H;  2XGT A;  4EQ5 A;  4DV6 Q;  1YI2 A;  1VQM A;  3TRE A;  1GM5 A;  4B3T Q;  2VUM H;  2F3I A;  4AIM A;  1TWC H;  4DV3 L;  3TEH B;  2NN6 I;  1TWG H;  2F52 A;  4ME3 A;  3F2C A;  3PN1 A;  4A3J G;  4DKA C;  2V1C C;  1MJC A;  1WCM G;  3HOW G;  3E9I A;  4JI8 Q;  1BBU A;  3E0E A;  5M5W H;  2UUB L;  5FLX c;  4DUZ L;  4RG1 A;  4LFC Q;  4R4O A;  1PYB A;  4LH7 A;  2D0P A;  4AQY Q;  4CC5 A;  4PZ8 A;  2E5L L;  3M4O H;  3KF6 B;  4LFB Q;  4Y7N H;  3CP0 A;  3E9H A;  3K81 C;  3I4N H;  3HOV H;  3L0O A;  1L1O B;  4GNX C;  1KD1 C;  1KXL A;  5IYD G;  4TQU S;  1OXU A;  4A3B G;  3PUW A;  1C7Y A;  4A3M H;  3K7U C;  4NXN L;  3K0X A;  3HOY G;  5J3B A;  4JOI C;  4A3G G;  4A3C H;  4LF5 Q;  4YWK A;  1U0L A;  1TWF H;  2Y0S G;  2JA6 G;  1UE6 A;  1VQO A;  3CF5 A;  3ER0 A;  3M4P A;  1EUJ A;  5D1O A;  3PCO B;  3K80 C;  5M3M G;  3QWU A;  2YTX A;  1VQK A;  1N33 L;  4A3L G;  2UXB Q;  1A8V A;  1W2B A;  4WJ4 A;  5HGQ A;  3G4S A;  3J80 i;  5M3F H;  2JA9 A;  4JBJ A;  1K8G A;  2UUC L;  2VUM G;  1V9P A;  4TVA B;  2BA1 A;  4L5R C;  4JYA Q;  1C9O A;  4AYB E;  2UU9 L;  1VQ4 A;  3D31 A;  4LUZ A;  2DUD A;  4Y52 H;  4OO1 I;  4RMF A;  3W5O A;  1I50 H;  1E24 A;  3CC7 A;  3PO3 G;  1QZH A;  4A3D H;  4BBR G;  3CW2 C;  2K14 A;  3RN2 A;  1CKN A;  3MEF A;  3G71 A;  4UY8 C;  4P75 A;  4LF6 L;  4BY7 G;  1V1Q A;  2ZTE A;  4A3M G;  1YJN A;  1HNX Q;  2PQA A;  1BKB A;  3KOJ A;  4DR5 L;  3PV0 A;  1XNQ L;  2OQK A;  3SGI A;  2JA7 G;  2KHI A;  5M5Y H;  4JI5 L;  2HIV A;  4LUV A;  1HZ9 A;  4HIM A;  1CUK A;  1Q46 A;  4HJ5 A;  1W3S A;  2HHH Q;  1B8A A;  1NBW A;  1NJI C;  3STB D;  4DV2 Q;  4LFA L;  3S24 A;  1NE3 A;  2CWP A;  1K8A C;  3KJO A;  2OWO A;  3S1M H;  4APV A;  4KHP Q;  2Z6K A;  4QY7 A;  4CC6 A;  2VQE L;  2XTI A;  2OTJ A;  1A0I A;  4JI1 Q;  2QA4 A;  4HIO A;  1ASZ A;  5FPO A;  2DGY A;  1PH4 A;  2ASB A;  2R92 H;  2K4K A;  3KDF A;  4BY1 H;  1VQA A;  2D0O A;  2CKZ B;  3CCJ A;  4DV1 Q;  2K5N A;  3DLL A;  4KHZ A;  3DM3 A;  1TWA H;  1VQH A;  4PG3 A;  1IBL Q;  4JV5 Q;  4JI0 L;  1XPO A;  3S2H H;  1XDN A;  4EFE A;  3KJP A;  3KF8 B;  4UCS A;  4LF8 L;  3ERS X;  4MNO A;  4JI3 Q;  4OWT B;  4R1J A;  2R7D A;  4HID A;  1OTC A;  4JI4 L;  3S1Q H;  3T1H L;  2K75 A;  3TY9 A;  4DV5 Q;  5EAY A;  3AEV A;  3D0F A;  2WAQ G;  3MXN B;  5FJ8 G;  1IBK Q;  5D1O B;  4ALP A;  1HZA A;  4YWL A;  4C2M H;  3VDY A;  3H0G H;  2GN5 A;  1K73 C;  2UXD Q;  4UFZ A;  4YY3 Q;  1Y1W H;  1HNZ L;  1G51 A;  3IRB A;  4DRF A;  3S1N H;  3CAM A;  3UDX A;  2YTY A;  4YCV A;  3F8T A;  1Q1B A;  3UQ8 A;  2JA5 H;  5LMU L;  3RLN A;  3NEM A;  5M5X H;  1HNW Q;  5BR8 Q;  1NY4 A;  4UCO A;  3PUZ A;  2AKW B;  4LW1 A;  1I94 L;  4JI2 L;  5JEA J;  1YVC A;  1LTL A;  2I5M X;  1KL9 A;  3BU2 A;  3UE1 A;  2YTV A;  4IO9 A;  1CKN B;  3K8A A;  4A3K H;  2ZTD A;  3GD7 A;  5C44 G;  3T1Y Q;  4A3F G;  2I5H A;  1EWI A;  1N32 Q;  1UE5 A;  1Y1V H;  3GTO H;  4LUO A;  1YHA A;  1VQD A;  2HIX A;  2MO1 A;  3PSI A;  4LF9 Q;  2R7Z G;  4DR7 Q;  1T9H A;  5AJ3 L;  2PQA B;  3GTM H;  1VS0 A;  4DR3 Q;  1XMQ Q;  1VQN A;  1XPU A;  5D1P A;  5IYC G;  4IJL A;  4A3E H;  4L5T A;  1YHB A;  4NXM Q;  2HT1 A;  4IPC A;  1KRS A;  1G6P A;  3HOX H;  2KHJ A;  3H0G G;  4DV0 Q;  1X3G A;  4OXP A;  1FGU A;  1IBM L;  1MKH A;  4X62 Q;  1PYS B;  1SLJ A;  4AYB G;  2Z0S A;  3G48 A;  3OYY A;  5C4X H;  2QEX A;  5ELO A;  3PIO A;  2AWO A;  3CPW A;  4DR4 L;  4GKK L;  2N49 A;  3GDE A;  5IWA Q;  2HVR A;  1SR3 A;  1LUZ A;  3J80 c;  3G6E A;  1IL2 A;  4JG2 A;  1E3P A;  4DV4 Q;  4LF7 Q;  3HKZ E;  1PH6 A;  1FJG Q;  3KDF B;  3PUV A;  1XNR Q;  2JA8 H;  4QL5 A;  4A3I G;  1PH8 A;  4L5S A;  3F2B A;  1GVP A;  3UDF A;  3HOZ H;  2KCM A;  2N78 A;  4P71 A;  3BA9 A;  1XJV A;  4EFB A;  4JI7 L;  4UCR A;  1EFW A;  1VQI A;  2Q2T A;  1XTD A;  4YWM A;  1PV4 A;  4LNQ A;  1DGS A;  2R93 G;  3B6Y A;  3BZK A;  1GO3 E;  2VQF L;  4O2D A;  4DV3 Q;  5IYB G;  1QVF A;  5GQO A;  4IFD J;  4UPA A;  4A3E G;  4MTN A;  2UUB Q;  1XK5 A;  4DUZ Q;  4JBW A;  2ID0 A;  4BXX H;  5C3E G;  4KLK A;  1Z47 A;  1J5E L;  4HJ8 A;  1OXT A;  1C0A A;  2E5L Q;  4C3I H;  2ATW A;  3J7A 5;  5JJK A;  1VQ5 A;  5C4J H;  2IT1 A;  1S72 A;  4DUY L;  1SRU A;  2ZJR A;  2NVQ H;  3FP9 A;  4UCV A;  2AMC B;  4NXN Q;  5GAE C;  4YCU A;  5C0X J;  2VL6 A;  4DK6 C;  3GTJ H;  1X55 A;  2MQH A;  4B3S L;  4PMW A;  3BA8 A;  1TWH H;  1J6Q A;  2JJQ A;  4BBS G;  2LXJ A;  4A4I A;  3KLW A;  1X9N A;  1LM0 A;  5IP9 H;  4DAM A;  3JC6 6;  4LF4 L;  3HFZ B;  3TS2 A;  1OXS C;  1QUQ A;  3RLO A;  1XMO L;  1N33 Q;  1AH9 A;  2VUG A;  3K7A H;  3EBE A;  1WI5 A;  4PZ7 A;  2UUC Q;  4BA1 I;  1EYG A;  3I4M H;  4HIK A;  4X64 L;  4JC0 A;  2UU9 Q;  1SE8 A;  1AE3 A;  2E2H H;  1Y14 B;  3GTQ H;  1HR0 W;  3I55 A;  3I4N G;  1EOV A;  1VCI A;  2CQO A;  3RR5 A;  3J81 j;  1N34 L;  4DV7 L;  3HOV G;  2AHO B;  2HVQ A;  4DR2 L;  1VQ8 A;  4K0K L;  1BVS A;  2WFW A;  4YCW A;  1UWV A;  1KQS A;  1E1O A;  2RHQ B;  2L15 A;  3NBZ B;  4R4C A;  4DPG A;  1VQP A;  4A3C G;  4LF6 Q;  1YHQ A;  1KIX A;  1S40 A;  2IX0 A;  1KC8 C;  2AWN A;  1YIJ A;  4POF A;  4DR5 Q;  2CCZ A;  1XNQ Q;  3I56 A;  2RHS B;  1PH2 A;  1L1O C;  1TA8 A;  4JI5 Q;  3TY5 A;  2C35 B;  4BA2 I;  2UXC L;  3I2Z A;  3PGZ A;  5IP9 G;  5M3F G;  3A74 A;  3ZJY C;  2YYZ A;  3CCQ A;  1KHI A;  2K50 A;  3S15 H;  2ES2 A;  4IOC A;  2ALY B;  3AFP A;  4GNX A;  2NN6 G;  4LFA Q;  4UP7 A;  2UUA L;  2IHE A;  2VZA A;  4DR6 L;  4A3D G;  4A3F H;  3PF4 A;  3J7Z C;  5IY0 A;  4GN3 B;  2VQE Q;  1S68 A;  4R4T A;  4JOI A;  4LWC A;  2E8G A;  2B63 H;  1NMG A;  2Q2I A;  4IPH A;  1RIP A;  3L7Z C;  1WJJ A;  4HJ9 A;  2GVB A;  1VQE A;  2WP8 J;  3NBH B;  4HJA A;  1HR0 L;  4IFD I;  1Q81 C;  4IOA A;  1I3Q H;  1B70 B;  2K5V A;  3L2P A;  4P73 A;  4QGU A;  3JAM c;  3A5U A;  4JI0 Q;  4MZ9 A;  2KEN A;  4LF8 Q;  4A93 H;  1Q1E A;  2I0Q A;  2N8N A;  3CC4 A;  4JI4 Q;  3T1H Q;  4XTC S;  3U58 A;  3PO2 H;  1N36 L;  5H1S E;  3HKZ G;  1R9T H;  3EN2 A;  1VQ6 A;  4NB3 A;  4QJF A;  2ZJQ A;  3AFQ A;  2JE6 I;  4B3M L;  1IYJ B;  4E6N A;  5C0X I;  5FLM H;  3OW2 A;  1Q86 C;  4B3R L;  4P72 A;  4QQB X;  4GKJ L;  1QUQ B;  3A5Z B;  4X6A H;  3GB8 B;  1HZB A;  1HNZ Q;  2H5X A;  2PNH A;  1E1T A;  1QVC A;  2R92 G;  3BAA A;  3GTK H;  4BY1 G;  4OO1 G;  2BH8 A;  3TY8 A;  2B63 G;  2RF4 A;  5LMU Q;  3CCV A;  3U50 C;  3OTO L;  3CCU A;  4OWX B;  4JI2 Q;  1I94 Q;  1X3E A;  3F1Z A;  1SMX A;  4DNI A;  4GN4 B;  4R4Q A;  3PF5 A;  5IP7 H;  2BH2 A;  1Q12 A;  3GTG H;  2NVX H;  4YHH L;  4OWW B;  4IJH A;  1S3O A;  2RCN A;  2ZM6 L;  1G29 1;  2LSS A;  4UP8 A;  3GTP H;  3PO2 G;  3HKS A;  4P74 A;  3RN5 A;  5AJ3 Q;  2F4V L;  4JCV E;  1D8L A;  3S2D H;  1JT8 A;  1VQL A;  1FL0 A;  3RLF A;  3GTL H;  1Y1W G;  5FLM G;  4X65 L;  1JE5 A;  3KYH C;  1P8L A;  1X3F A;  1Q7Y C;  2CFM A;  1PH7 A;  2OCE A;  4HJ7 A;  5K36 G;  1K0R A;  1CSP A;  1YIT A;  1SRO A;  1X54 A;  5E7N A;  5GAG C;  1IBM Q;  2JA5 G;  1U5K A;  4GNX B;  2Q2U A;  4OX9 L;  4DR4 Q;  1HH2 P;  1TXY A;  4X66 L;  3CXC A;  3CCS A;  1XMQ L;  1QVG A;  4GKK Q;  4A3J H;  1WCM H;  5LMN L;  3CMA A;  1EQQ A;  3FKI H;  4UCT A;  2E2I H;  3I4O A;  4A3K G;  3JSL A;  3PUY A;  4DR1 L;  1SFO H;  2NVY H;  4XIG S;  1Y1V G;  1YBY A;  1Z9F A;  3CPF A;  4IFD G;  1M1K C;  4JI7 Q;  1PFS A;  4C3J H;  3UDI A;  2Q2H A;  1E22 A;  1PH1 A;  4A3B H;  5IYD H;  1N8R C;  4A75 A;  2VQF Q;  2E2J H;  2BA0 A;  4GOP A;  1SN8 A;  1JB7 A;  1EIY B;  3HOY H;  1YEZ A;  3HOX G;  3W1B A;  3TS0 A;  2A8V A;  2JA6 H;  5IT9 c;  4JI6 L;  2MO0 A;  3AQQ A;  1A62 A;  4R4I A;  5DLQ E;  4DV6 L;  4GLX A;  1J5E Q;  1D7Q A;  4B3T L;  1IZ6 A;  5C4X G;  5M3M H;  2YV5 A;  1KRT A;  3TRZ A;  4DUY Q;  5JJI A;  4PZ6 A;  1OXV A;  4JI8 L;  1VQ7 A;  4UCU A;  4LFC L;  2LXK A;  3I7F A;  4UP9 A;  2EXD A;  4AQY L;  2JA8 G;  3FKI G;  4GLV B;  4B3S Q;  4LFB L;  4DAY B;  2WB1 G;  1L0W A;  3HOZ G;  1YZ6 A;  3PO3 H;  4BBR H;  3PIP A;  3M85 A;  4LF4 Q;  2IY5 B;  3UDG A;  5IE8 A;  2R7F A;  2Z6K C;  3J81 i;  1XMO Q;  1VQC A;  3NEN A;  3M3Y H;  2B3G A;  2JQO A;  1WYD A;  1UE1 A;  4JBM A;  4BY7 H;  3ULJ A;  4LF5 L;  4WJ3 M;  2PI2 E;  4NPS A;  1PH3 A;  4BXX G;  4X64 Q;  1B7Y B;  3F2D A;  1VQJ A;  2JA7 H;  3KFU A;  2UXB L;  2EIF A;  3BAB A;  5FPR A;  1N34 Q;  4DV7 Q;  2A1A A;  4DR2 Q;  3BZC A;  3ICE A;  4K0K Q;  4JYA L;  1H95 A;  5HY6 A;  1V43 A;  1EIF A;  2MFI A;  5JJL A;  3H3V I;  2NVT H;  2JEA I;  3GO5 A;  3A0J A;  2OQ0 A;  1CSQ A;  3CCL A;  3Q8D A;  3ULL A;  2HVS A;  2UXC Q;  3U4V A;  2FXQ A;  4GLA C;  2I5L X;  1HNX L;  3I4M G;  2A19 A;  1VQG A;  1JJ2 A;  1IXR A;  4EX5 A;  3WWV A;  3CME A;  3CC2 A;  2UUA Q;  1JMC A;  4KI0 A;  1PVO A;  1I5F A;  1YNX A;  1YJ9 A;  4DR6 Q;  3GJX B;  2WB1 E;  3S1R H;  1LYL A;  5ELN A;  4GOP B;  2KBN A;  2R6G A;  1QZG A;  2HHH L;  1B04 A;  1Q82 C;  3PUX A;  4DV2 L;  4C3H H;  1HR0 Q;  3UE0 A;  5FJ8 H;  1K9M C;  4GS3 A;  4KHP L;  1MIU A;  4OON A;  4JI1 L;  5GAD C;  3NEL A;  1O7I A;  3M7N A;  3HOU H;  2PMZ E;  3H3V H;  2VS1 A;  3CCE A;  2Y0S E;  4IPG A;  1L2F A;  1MJE A;  1HZC A;  4DV1 L;  1BBW A;  1N36 Q;  2MNA A;  1VQB A;  3BJU A;  2NZH A;  1X56 A;  1IBL L;  2IX1 A;  2N3S A;  1PH9 A;  4B3M Q;  3STB C;  4QIW E;  2GVA A;  1PA6 A;  4JV5 L;  4B3R Q;  4JI3 L;  3M9B A;  1CKM A;  1K3R A;  1JJC B;  1UEB A;  2KCT A;  4L5Q A;  5JEA G;  3CD6 A;  4GKJ Q;  4DV5 L;  5LMN W;  5C44 H;  2HQL A;  3RZD H; 
#chains in the Genus database with same CATH topology
 2B63 A;  2K1B A;  4ZYS A;  1ET9 A;  1XPR A;  1HUN A;  2C22 A;  3N42 B;  4J8Q A;  4YAJ B;  4AH6 A;  4FYD A;  4ED8 A;  1L1O A;  3OHA A;  2NU8 B;  2YS6 A;  4LF4 H;  2YZG A;  3WDN A;  5KT6 A;  2DNC A;  5T14 A;  5L1K A;  1A6X A;  1K83 H;  2K5W A;  5KG2 A;  1GD7 A;  4GOP C;  3J80 E;  4G7Z C;  2FK2 A;  5DQI A;  5C6A A;  2C2E A;  2MUY A;  3TN2 A;  1BQQ T;  1FNW A;  4JXU A;  2B63 B;  4GN5 A;  5KFY A;  3RTX A;  4KY5 A;  3T1Y L;  5I5V A;  4X65 Q;  1N32 L;  3I4M B;  5IYZ F;  1T5X D;  5ELB A;  4IPD A;  5KRU A;  4DR7 L;  2PI2 A;  4DR3 L;  3HO8 A;  3KAJ A;  3HOW H;  2R93 H;  2DLN A;  2R84 A;  3WO0 A;  3RNU A;  3IAY A;  4OX9 Q;  3J81 c;  1LTG D;  4NXM L;  3VPB A;  3M4Q A;  2WE6 A;  1VDZ A;  4HSV A;  3EPG A;  4J9K A;  4QF4 A;  2UXC H;  4O42 A;  2V4D A;  1ROD A;  1B44 D;  4J15 A;  1FVI A;  2H1E A;  2HGW A;  1E4G T;  1CQV A;  5C5J A;  4RUC A;  2JK8 A;  2VW9 A;  4CGY B;  4NZO A;  1F9R A;  3DAA A;  2NZO A;  1STA A;  4RAZ A;  2J0T D;  1BR9 A;  1M0T A;  5C4Z A;  1PHJ A;  3NC0 B;  3HXL A;  2K7V A;  3S15 B;  3MEH A;  1X6O A;  5C0X G;  2DJG C;  1JWS D;  4BBS H;  3GIJ A;  4EQ5 A;  4FXK C;  2E2D C;  1CTM A;  2Z9H A;  2F3I A;  4AIM A;  3BYT B;  4P2C B;  3TEH B;  4DV3 L;  1TWG H;  2NN6 I;  3D6C A;  4KN4 C;  2XSC A;  2CH4 A;  4ZUI A;  3NGD A;  2RDI A;  2PQE A;  2WB1 A;  5KFD A;  4LH7 A;  4AQY Q;  1SFO A;  1HFN A;  1D6E C;  3KF6 B;  1LT3 D;  1I3Q B;  4I7A A;  4GNX C;  3JAM W;  3OUU A;  3G6V A;  5EPJ A;  5DGI A;  1JIH A;  4TQU S;  1OXU A;  2MCT A;  3PUW A;  4TQR A;  5J3B A;  1T5E A;  2A68 C;  2R8I A;  4LF5 Q;  4RB2 C;  1TWF H;  2XNA C;  1PFB A;  3CF5 A;  1I4Q A;  4IAJ A;  2W9B B;  3K80 C;  1STG A;  2DPI A;  3OTO H;  2R85 A;  1LO5 D;  1K1Q A;  2K32 A;  1S0N A;  4WJ4 A;  3PIP 3;  2VUM G;  4JBJ A;  1EEI D;  2PO4 A;  4TVA B;  3TW6 A;  2CW7 A;  1F9P A;  5FD6 A;  1U9R A;  1VQ4 A;  4WJW A;  4LUZ A;  1PFN A;  2RA4 A;  3V96 A;  2RDH A;  5CV9 A;  1AZP A;  3PW5 A;  1E24 A;  4BBR G;  4OEL B;  3I73 A;  1IYE A;  2LS0 1;  1DXM A;  1TKW B;  1IBM H;  3GTG B;  4TM5 A;  4M9U A;  1YJN A;  5FR9 A;  3DWA A;  4CMF A;  3KOJ A;  4DR5 L;  3Q0A A;  5FD5 A;  2W6O A;  3K0Y A;  4IUP A;  4LUV A;  1W3S A;  2G9H D;  3OWE B;  1UUP A;  1OBG A;  4DV2 Q;  1NSN S;  5KFR A;  2UVR A;  3TZU A;  1NE3 A;  2CWP A;  2OWO A;  3J80 W;  4APV A;  2A6H C;  2MHV A;  1QG7 A;  4K6N A;  3T9F A;  3GIQ A;  4HIO A;  1ASZ A;  3FKI B;  1SE3 A;  2NUC A;  3CCJ A;  4DV1 Q;  1KUT A;  2NBF A;  2EJF C;  4JI4 H;  1TWA H;  1VQH A;  3MTS A;  4JV5 Q;  5EOY A;  3S2H H;  4XYL B;  2FB9 A;  4JI3 Q;  4A3B B;  4JI4 L;  2K75 A;  5KFL A;  3A55 A;  3HOY B;  4JI8 H;  3MVV A;  5EAY A;  1TVX A;  3TZD A;  4LFC H;  2WAQ A;  2WAQ G;  1RTO A;  2COG A;  1D5X C;  3G8D A;  4DU9 A;  5DMX A;  5D1O B;  1WTO A;  2PYK A;  4ALP A;  4ETS A;  1HZA A;  4YWL A;  1L0X B;  2WKC A;  2GPW A;  2F0O A;  3S1N H;  3UDX A;  1EKF A;  2AQ2 B;  2PCF B;  2PBZ A;  4EYH B;  1B1Z A;  3UQ8 A;  1YNN C;  2DNE A;  3TP6 A;  4MV4 A;  4PBC A;  4WRD A;  3C2P A;  4APM A;  1MSG A;  4UCO A;  4JI2 L;  1I94 L;  4J9R A;  1YVC A;  4IUU A;  3UE1 A;  2UXB H;  4IO9 A;  1CKN B;  3CKI B;  5J22 A;  2E2H A;  4A3K H;  2ZTD A;  4F87 A;  4Q8F A;  3T1Y Q;  3S9W A;  3H4D A;  1EWI A;  1N32 Q;  4JYA H;  2DN8 A;  1Y1V H;  4BY7 B;  2V58 A;  4JVZ A;  5CC4 A;  2R7Z A;  2R7Z G;  4DR7 Q;  4TQS A;  5D1P A;  4DR3 Q;  5K3W A;  2JA7 B;  4YQW A;  4IJL A;  4A3E H;  3L3O C;  1IW7 D;  4NXM Q;  1G6P A;  1B9N A;  4I50 F;  4GC6 A;  4RAY A;  1B2T A;  5AFW A;  1FGU A;  1IBM L;  1MKH A;  4IRK A;  2NVT B;  5C4X H;  1I2L A;  3G48 A;  3WO1 A;  3PIO A;  2PN1 A;  3GDE A;  1K28 A;  3N6X A;  4UDU C;  3OUZ A;  5BWT A;  1LUZ A;  2R3Z A;  2WKD A;  4U67 3;  3HKZ E;  2ICE C;  1PH6 A;  3QWN A;  4ZRZ A;  5I47 A;  4QL5 A;  2BQU A;  2HHH H;  1VF7 A;  3VPD A;  5CA1 F;  3Q1K A;  4Q4D A;  4RKL A;  2Q2T A;  1FNU A;  1PV4 A;  2RSO A;  2NUA B;  4DV3 Q;  2VQF L;  5IYB G;  2JEJ A;  1KJ9 A;  3G6X A;  3S1R B;  4JI1 H;  1ULZ A;  2R86 A;  1XK5 A;  4BXX H;  2VPS A;  2HD3 A;  2ID0 A;  2DY7 A;  4HJ8 A;  1OXT A;  2KCN A;  4C3H B;  2X0S A;  5EWE A;  2W71 A;  1IBL H;  4F88 A;  2IT1 A;  1I1L A;  3VYU A;  4DUY L;  1DZ1 A;  3HB9 A;  2P5Z X;  5LA6 F;  1B50 A;  4IUV A;  4KD4 A;  3HOU B;  4DK6 C;  2SEB D;  1OO9 B;  4IR9 A;  1TWH H;  1J6Q A;  1BCP D;  2LXJ A;  4A4I A;  3M4Y A;  4DAM A;  5IOD A;  2AQ4 A;  4QB4 A;  4ABN A;  2UXD H;  5J2T F;  3FEW X;  4PZ7 A;  4A3F B;  1JC7 A;  4YHH H;  1EL0 A;  1GUS A;  3FDS A;  3PW2 A;  4WD3 A;  3ONA B;  1H9J A;  5JOB A;  2NWG A;  4MAM A;  2CQO A;  1VCI A;  3RR5 A;  3J81 j;  1N34 L;  4ME5 A;  4KN7 C;  4K2L A;  1B6S A;  1VQ8 A;  3SE7 A;  1U4P A;  2XVS A;  1KQS A;  2QKI C;  5DG9 A;  5LHY 1;  1K83 B;  5HBR B;  2H4O A;  1YHQ A;  4ZKB B;  4AYB B;  1S40 A;  1KC8 C;  1KIX A;  3S2D B;  5DQG A;  2KJX A;  5KG0 A;  1YIJ A;  2CNV A;  4DR5 Q;  2CCZ A;  5LMN H;  4LMY A;  2C35 B;  4BA2 I;  4O7R A;  5IP9 G;  5M3F G;  4DV0 H;  3VA5 A;  4EGV A;  1KHI A;  1IYU A;  3I12 A;  3TME A;  4X62 H;  5KFQ A;  2CNU A;  4UP7 A;  2NYZ D;  3HOW B;  2R93 B;  1I6U A;  4DR6 L;  3J7Z C;  3MWD A;  4LWC A;  2E8G A;  2WAC A;  4LF7 H;  1NMG A;  2Q2I A;  4IPH A;  1WJJ A;  5EBC A;  1HR0 L;  5IIF A;  1Q81 C;  4IOA A;  1B70 B;  4FBT A;  4QGU A;  1GOZ A;  1STY A;  5E4W C;  4DL7 A;  5DG7 A;  4A93 H;  3CC4 A;  2SOB A;  4JI4 Q;  4QWA A;  4H0L C;  4XTC S;  4EFE A;  5H1S E;  4DUZ H;  1R9T H;  3EN2 A;  4NB3 A;  4BBS B;  2A73 B;  3K5M A;  1CQJ B;  4B3R L;  3L4K A;  4GKJ L;  1TWG B;  3AW8 A;  3GB8 B;  3OMG A;  3CU7 A;  5K36 H;  4QWE A;  3CEB A;  5LP6 F;  4NXN H;  3BAA A;  3C0F B;  4IWX A;  5JPM C;  1RHP A;  2BH8 A;  3QO2 A;  3TY8 A;  4OIJ A;  2RF4 A;  1A3U A;  3LNN A;  3TII A;  3VOT A;  5K5P A;  2YW2 A;  3CCU A;  4OWX B;  4JI2 Q;  1I94 Q;  1LAC A;  2XCL A;  1HRJ A;  1GXD C;  3T5H A;  5NUC A;  2UUC H;  1Q12 A;  4U6P A;  2NVX H;  4YHH L;  4OWW B;  2F0T A;  4IJH A;  3R9R A;  2UU9 H;  4B9X A;  1TWF B;  3EFX D;  2LSS A;  4HMI A;  3GTP H;  4MTE A;  1HHV A;  3KLS X;  4X3S A;  2F4V L;  2W8L A;  2F3V A;  1JT8 A;  1VQL A;  1BBX C;  3H0G A;  4C2M A;  3GTL H;  1SE2 A;  4RNO A;  1JE5 A;  3KYH C;  2EYJ A;  1X3F A;  1JOR A;  4OEM B;  3W3A A;  1PH7 A;  3UYY A;  2K04 A;  1IBM Q;  1SRO A;  1G2T A;  3T9B A;  2Q2U A;  1U5K A;  4GNX B;  3FVQ A;  4ED0 A;  4I55 F;  5FLX E;  3Q8S B;  3L4J A;  1QVG A;  4MV1 A;  2JSO A;  4JI5 H;  1H9K A;  1WCM H;  1OWT A;  5LMN L;  4DK1 A;  2E2I H;  2JXM B;  1JDB B;  1O75 A;  3JSL A;  4R7R A;  3RD4 A;  1SYB A;  4NDX A;  4XIG S;  3WOF A;  2OLS A;  3KXY T;  4IFD G;  5C8Y F;  1PFS A;  4LFA H;  3UDI A;  5I4D A;  1E22 A;  4ECY A;  1MI2 A;  1N8R C;  4A75 A;  2VQF Q;  1EY7 A;  3R2I A;  2BA0 A;  3Q8P B;  1SN8 A;  1JB7 A;  2VQE H;  3BJY A;  2HGS A;  3MFI A;  4C56 C;  2JA6 H;  1JR0 D;  1EEF D;  1A62 A;  5DLQ E;  3MA2 B;  3A8K E;  1B4O A;  5M3M H;  1K3B C;  3Q24 A;  2E76 C;  1N48 A;  4DUY Q;  4LF8 H;  1RD9 D;  4O3O A;  4PZ6 A;  1OXV A;  3U9O A;  1EU4 A;  3NTH A;  3I7F A;  4RA8 A;  2EXD A;  2F0D A;  4C1N I;  1X32 A;  4FNF A;  2JA8 G;  3FKI G;  4GLV B;  4LFB L;  1S5B D;  2D2C C;  1L0W A;  5LOV F;  1TWA B;  5DQH A;  5IGE A;  5T1G A;  4YY3 H;  4RGN A;  3PO3 H;  3S2H B;  2R87 A;  5L1L A;  4EBC A;  1GYF A;  3M3Y H;  2Z6K C;  3J81 i;  1VQC A;  2F0H A;  4K14 A;  4JBM A;  1KTK A;  5BWR A;  3NK9 A;  3ULJ A;  4WJ3 M;  3HP3 A;  3BAC A;  2PI2 E;  4RHS A;  2KQ3 A;  4YR3 A;  1S5E D;  5BYB A;  4FM9 A;  4C3I G;  3KFU A;  2B2Y A;  2ZDQ A;  2VB2 X;  2EIF A;  3BAB A;  1N34 Q;  1S97 A;  2ZGI A;  1MBY A;  3S1N B;  2RBM A;  4MV7 A;  3GTJ A;  3TIG A;  3E3X A;  3H3V I;  5KS8 A;  2PZU A;  2HCI A;  2DIK A;  2OQ0 A;  1GUT A;  4EVO A;  4NKL A;  2BDN A;  3NXW A;  3OPO A;  1FNV A;  3G8C A;  2R61 A;  2KUM A;  4A3K B;  4I65 A;  3U4V A;  1S0M A;  3H3V C;  1Y1V B;  4RFB A;  1WTV A;  2OEO A;  4DL3 A;  4FFM A;  4J0M A;  4O4I F;  3GTQ A;  4RGM A;  1K8M A;  4FF4 A;  4IZO A;  2R82 A;  4A3E B;  4DR6 Q;  1F9Q A;  2WB1 E;  2VA2 A;  1LYL A;  3NE5 B;  2V59 A;  5L9X A;  1XNR H;  2B2V A;  5J1Z A;  4Y8V B;  1RF2 D;  1HR0 Q;  3I4L A;  5C4X B;  4KHP L;  5BPF A;  4LMQ D;  5GAD C;  2FKL A;  1CQI B;  3M7N A;  4O3P A;  2QB5 A;  3H3V H;  4ECQ A;  1HZC A;  1TT2 A;  3I91 A;  1VQB A;  5T1I A;  1J5E H;  2IX1 A;  4K5V A;  2FPP B;  3HBL A;  2GVA A;  5FKA C;  4B3R Q;  3HZX A;  2F0F A;  2W6M A;  4GKJ Q;  1RDP D;  1PRT C;  5FLX W;  2NZ1 D;  1SYC A;  4EQN A;  1NR2 A;  3J81 L;  2O2L D;  1FGB D;  4O0A A;  1IBK L;  4H7B A;  4O7W A;  2Z02 A;  4JBK A;  5CYU A;  3PR5 B;  4C3H G;  3ULP A;  3K3V A;  4YY3 L;  5KNB A;  5BWW A;  5CV8 A;  1XMO H;  1H9R A;  5DG8 A;  1Z2O X;  4DK3 C;  1UE7 A;  3EIV A;  4F8M A;  1IYD A;  2HJW A;  3N40 P;  5KT2 A;  4YHH Q;  3HOU G;  1UNS A;  4EBE A;  1TWH B;  1HNW L;  4F4W A;  1IOV A;  1S10 A;  1WFQ A;  2ZJP A;  5GRO A;  3J80 L;  2F4V Q;  1X65 A;  2ASD A;  3LGJ A;  5CMD A;  1IHZ A;  4DV7 H;  3VNN A;  1PTO H;  4RH6 A;  1VQ9 A;  1QWY A;  2HCC A;  4K0K H;  4A3I H;  1JJG A;  3GTK A;  5CE8 A;  4TV9 F;  2B29 A;  2K5H A;  4YR0 A;  4DNR B;  4FXG C;  1EQR A;  1CHQ D;  5KT4 A;  2C9O A;  5D3I B;  1JCK B;  1I4H A;  2EJ3 A;  1KNA A;  5JAV A;  2EQS A;  5LMN Q;  2MGS A;  5C3E H;  4PNY A;  2FLN A;  4J9P A;  2CWA A;  2AUK A;  2D62 A;  5IWA L;  1I4P A;  3TQ1 A;  1MGS A;  4A3G H;  5I6Y A;  2ZTC A;  2B2W C;  4Q43 A;  5COR A;  2WAQ E;  1FJG L;  2KVM A;  1XNR L;  3LML A;  2D5D A;  2K52 A;  1NMF A;  4O82 A;  4S3S A;  4O4H F;  3DTG A;  2F0L A;  4JV0 A;  1ZQ7 A;  1PZI D;  2XGT A;  2KA7 A;  2F0I A;  1YI2 A;  4FF2 A;  1T36 A;  2G9D A;  4CKC A;  2F52 A;  3F2C A;  1EIH A;  4RB3 C;  1EZ1 A;  3H40 A;  2FP4 B;  4A3J G;  4KMU C;  4DKA C;  3HOW G;  2E75 C;  1EFI D;  3RV3 A;  4RG1 A;  1L2Z A;  1AUV A;  4CC5 A;  2NVY A;  3R5H A;  3M4O H;  4LFB Q;  1Y69 U;  4Y7N H;  3E9H A;  3I4N H;  3HOV H;  3K5L A;  1BJT A;  4C3J G;  4CMD A;  2IJ0 A;  3U9S A;  5IYD G;  1Z7T A;  2ATL A;  1XXG A;  4A93 B;  1M4V A;  3MWY W;  1C7Y A;  2CH4 W;  1D5M C;  2V4Q A;  4K5X A;  4A3C H;  2ZXO A;  1HUM A;  1R9T B;  3GV7 B;  1PXU A;  4MV8 A;  3M4P A;  3PCO B;  3QWU A;  1KJ8 A;  1A8V A;  1VAJ A;  1W2B A;  5HGQ A;  5CV6 A;  3G4S A;  2JA9 A;  1K8G A;  1IL8 A;  2BA1 A;  1EY8 A;  3OHB A;  2RDJ A;  2GPS A;  2F0E A;  2ZM6 H;  2NTT A;  4RMF A;  1I50 H;  5A35 A;  3Q8R B;  3CC7 A;  1H9S A;  1WR2 A;  2X6G A;  5I5W A;  3RN2 A;  2BCO A;  2DAB A;  2IMW P;  2B2U A;  1K0S A;  1A9X A;  2NVX B;  5C5L A;  5E3F A;  3ORR A;  1BKB A;  2PQA A;  3GTP B;  4FP5 D;  4RGT A;  2FK3 A;  3PV0 A;  5A2Q E;  3SGI A;  1HCZ A;  2DPJ A;  1SEB D;  2HIV A;  4X66 H;  3KLR A;  1RJQ A;  2WDT A;  3CSW A;  3GTL B;  2MPM A;  1HZ9 A;  4HIM A;  1CUK A;  1Q46 A;  4L8J A;  4IUN A;  4HJ5 A;  1KDC A;  3GP7 A;  2N88 A;  1K8A C;  2EJ2 A;  2HG8 A;  4O3Q A;  3NP8 A;  4KHP Q;  4QY7 A;  5BMV F;  4FBU A;  1WCM B;  4FF1 A;  2DGY A;  2CQY A;  1B9M A;  1VMP A;  2R92 H;  2K4K A;  1WTP A;  3KDF A;  4FXD A;  2E2I B;  5JH7 F;  5DLF A;  3T54 A;  5J2U F;  4ED6 A;  4OIK A;  4GC7 A;  1RCV D;  3DM3 A;  4RZR A;  3ERQ A;  5BYA A;  4JI0 L;  1DOM A;  1RK6 A;  3KJP A;  3KF8 B;  4B3T H;  3ERS X;  2R7D A;  4V19 0;  1GUO A;  4ODG A;  4UAI A;  1CQF A;  3QR8 A;  3GQC A;  2PMZ B;  3MXN B;  2LMC B;  2Y0S B;  1TY0 A;  2JA6 B;  3IG0 A;  1DYQ A;  4O7L A;  2B8F A;  1HFG A;  5FJ8 G;  1IBK Q;  5M3M B;  1S5C D;  2Z4I A;  3EJI A;  3HRZ C;  2GN5 A;  4QIW B;  3NPP A;  1A3T A;  4YY3 Q;  1G51 A;  3BQ2 A;  4X64 H;  4YCV A;  3F8T A;  3MJF A;  3UFX B;  1QIL A;  2FPG B;  2JA5 H;  5LMU L;  3RLN A;  2DZD A;  2IBK A;  4O2B F;  1HNW Q;  4R8U A;  1DJR D;  5KFK A;  1ZKO A;  3PO3 B;  1GHK A;  2I5M X;  1KL9 A;  3M3Y B;  3K8A A;  5C44 G;  1UE5 A;  3ETH A;  4LUO A;  2MO1 A;  1EUD B;  3A7L A;  3PSI A;  4G4K A;  2W9C A;  3HS0 C;  1T9H A;  1HA6 A;  1VQN A;  1XMQ Q;  5IYC G;  5TSS A;  4L5T A;  4IQZ A;  4IPC A;  1KRS A;  3CQZ A;  3HOX H;  1RTN A;  5KFC A;  3BZD B;  5EQ0 A;  1EY4 A;  1HNX H;  1E4E B;  1BNZ A;  2F0N A;  2IX3 A;  4DR4 L;  2QEX A;  5ELO A;  3CPW A;  2AWO A;  4K5W A;  4GKK L;  1WTR A;  5IWA Q;  4Q5V A;  3UZB A;  2ZDH A;  1IW7 C;  3J80 c;  1IL2 A;  2YU9 A;  4JG2 A;  1E3P A;  3SNO A;  5CA0 F;  4OHJ A;  3ERO A;  1FJG Q;  1XNR Q;  1KT8 A;  1WH2 A;  3L9A X;  3UDF A;  5EPK A;  4E4T A;  4P71 A;  4EFB A;  3RB4 A;  3SE0 A;  4JI7 L;  4IIJ F;  1EFW A;  4IRC A;  5ELC A;  1VQI A;  1XTD A;  1EY6 A;  3M9N B;  3SK4 A;  1G91 A;  1V1P A;  3DWQ A;  4FVM A;  1ENF A;  3EA6 A;  4UPA A;  3T9D A;  4A3E G;  4MTN A;  1JXL A;  1PDQ A;  5JJZ A;  4JBW A;  3U9T A;  4E6I A;  3NBH A;  4KLK A;  1EYA A;  5DEH A;  1C0A A;  2B2U C;  2PVP A;  5JJK A;  1VQ5 A;  1S72 A;  1K8O A;  4DLK A;  5CBE E;  4UCV A;  3JRX A;  2PW7 A;  5A2Q W;  2N55 A;  2ODT X;  5C0X J;  2EZV A;  1X55 A;  4ECR A;  1JDE A;  1CA6 A;  3N41 B;  2A6E D;  2HHF B;  5I5T A;  2VUM A;  4LF4 L;  1TWC A;  4HED A;  1OXS C;  1QUQ A;  3RLO A;  3T4A C;  1WI5 A;  2R7M A;  3Q23 A;  5CR3 A;  2C28 A;  4BA1 I;  3ND8 A;  4N8F A;  2K6A A;  2NN6 H;  3TP7 A;  4X64 L;  2F0S A;  4HIK A;  2CNQ A;  1BCP C;  3FDT A;  5G3L D;  3N6R A;  5CB4 F;  4HR7 B;  2JYO A;  5BR8 H;  1RYR A;  4HYK A;  1EY9 A;  5C3W A;  5LXT F;  1TY2 A;  4K6D A;  1E1O A;  4PWQ A;  1VBG A;  4R4C A;  1WSC A;  4DPG A;  4NLG A;  2YZL A;  1WRV A;  3OSO A;  5IGG A;  2IX0 A;  3K59 A;  1HTP A;  3C46 A;  1DCZ A;  1F2L A;  4POF A;  3QOL A;  3KBG A;  1GUG A;  1PRT B;  3IFT A;  1L1O C;  3I56 A;  1TA8 A;  1FKA H;  2UXC L;  2RKS A;  1PTO B;  2GLT A;  1VKZ A;  4F4Y A;  4DR1 H;  3BG3 A;  5HV6 A;  3KK7 A;  1QNU A;  2VOB A;  1ML0 D;  4A3I B;  2YYZ A;  1ESR A;  1KDB A;  1SYG A;  1WVL A;  4IOC A;  2ALY B;  2ES2 A;  1I1K A;  4U68 A;  3VR3 A;  4O3S A;  2EOT A;  2IHE A;  3G6J B;  2VZA A;  4A3D G;  4A3F H;  1ONL A;  3PF4 A;  1U4M A;  5IY0 A;  4GN3 B;  4JOI A;  4DV4 H;  2B63 H;  4JI6 H;  4KKT A;  5C3E B;  4XQJ A;  1UNN C;  2K01 A;  4QUF A;  3L2P A;  4IUR A;  1CS0 A;  4KJN A;  3A5U A;  1Q8I A;  1R4P B;  4JI0 Q;  1GUW A;  5KFP A;  2O5I C;  2I0Q A;  2N8N A;  4IN3 A;  4A3G B;  2QF7 A;  5H80 A;  3A56 A;  4Q44 A;  4YP3 A;  2PNR C;  4HMJ A;  2ZJQ A;  3AFQ A;  2JE6 I;  2E5L H;  1PRT F;  1CZW A;  3VYS A;  5C0X I;  2ZXP A;  5FLM H;  3Q22 A;  4O7Y A;  4QQB X;  1PTO F;  2F0Q A;  5M9O A;  5BPH A;  4X6A H;  2QW7 A;  3RJ0 A;  2H5X A;  2PNH A;  3T51 B;  2A1H A;  2VPQ A;  1F2Z A;  3SEB A;  4BY1 G;  4OO1 G;  2WV6 D;  3M4O B;  5LMU Q;  1S03 G;  2W6Z A;  4Y7N B;  1I7N A;  4ZI7 F;  3U50 C;  3BQ1 A;  3I4N B;  1VMC A;  3MFG A;  3OTO L;  3HOV B;  4YJ2 F;  4KHV A;  4DNT B;  4R4Q A;  4DAP A;  2BH2 A;  2K03 A;  1AN8 A;  1G2S A;  2Z8L A;  2KSW A;  1WD0 A;  1S3O A;  3NWT A;  1G29 1;  4RB0 A;  1NNX A;  3HKS A;  1EYZ A;  5LL6 X;  5DGH A;  4JCV E;  1GLV A;  1A3G A;  2ZXR A;  2MP1 A;  1Y1W G;  1Y1W A;  2NTS A;  2PZT A;  2M05 A;  1D1I A;  1O78 A;  2CFM A;  2OCE A;  4HJ7 A;  2EY2 A;  5K36 G;  4RNM A;  5GAG C;  4LF6 H;  1EKP A;  2EPB A;  4DR4 Q;  1X3Q A;  1I50 B;  5DGA A;  4GKK Q;  1XNQ H;  4Q8E A;  4KKS A;  1HQM C;  1OBD A;  2WII B;  4J9N A;  4QWC A;  4GZY C;  2R6F A;  4DL2 A;  4DR1 L;  2K33 A;  1SFO H;  2YZN A;  3GTO A;  1YBY A;  4WFN 3;  2BR0 A;  1STB A;  1Z9F A;  5CV4 A;  4RU9 A;  1CT1 D;  4JI7 Q;  3GTM A;  5KFS A;  1BO0 A;  4CJ1 B;  1C30 A;  2E2J H;  1EIY B;  4WOR A;  1JB3 A;  3AX6 A;  2XD4 A;  3W1B A;  3HKZ B;  4PMB A;  2A8V A;  4JI6 L;  3FMC A;  2YV5 A;  2FMM A;  4MIU A;  5EDW A;  1G2W A;  4JI8 L;  4UCU A;  1VQ7 A;  2B8G A;  4YAK B;  3MXG A;  4LFC L;  1XYI A;  1CA5 A;  2R92 B;  2M2L A;  1DON A;  4DAY B;  5IGF A;  1E2V A;  3HOZ G;  2EIY A;  2WTF A;  1PK8 A;  1JOO A;  3H94 A;  4BBR H;  3M85 A;  4LF4 Q;  2IY5 B;  2FMA A;  5EWG A;  3BDL A;  3H91 A;  4KJO A;  1HNZ H;  3I3C A;  3MZ5 A;  1B3A A;  1LTT D;  1UE1 A;  3RMH A;  2OF1 A;  1ILP A;  1MSH A;  4X64 Q;  3KHH A;  3F2D A;  1QB5 D;  1VQJ A;  3TSS A;  2AQ1 B;  1JIC A;  2UXB L;  2IPK D;  2HQE A;  2J9G A;  2QEJ C;  3ICE A;  2XWB B;  4MN3 A;  4JYA L;  1H95 A;  2CW0 D;  4FF3 A;  1V43 A;  4LF9 H;  1EIF A;  2FJ2 A;  2MFI A;  5JJL A;  2JA5 B;  1SMY D;  3U0G A;  3VPC A;  2FE3 A;  5KFZ A;  5KT7 A;  1CSQ A;  3TBI B;  5JVG 3;  2B2T A;  3GV8 B;  4Q4C A;  2VR1 A;  2HVS A;  2UXC Q;  4ECZ A;  5C5M A;  2I5L X;  3IL8 A;  3I4M G;  2A19 A;  3JZI A;  1VQG A;  1B33 N;  1JJ2 A;  2DJF C;  3WWV A;  3CC2 A;  1I5F A;  3GJX B;  4MV3 A;  4GOP B;  4DIM A;  1T94 A;  2R6G A;  3HOX B;  1ZEQ X;  3BVM A;  2HHH L;  2Q8T A;  3QZ8 A;  3PUX A;  4O7N A;  3C1F A;  5C1P A;  3KUP A;  1MIU A;  3BQ0 A;  2ASJ A;  4OON A;  4JI1 L;  2XC9 A;  4J9Q A;  2XRS D;  1O7I A;  1GSO A;  1Z6H A;  1C8C A;  1JX4 A;  4BWG B;  1SJH D;  3I90 A;  3T5J A;  3RIZ A;  1X3P A;  1X56 A;  1IBL L;  2N3S A;  3BDO A;  4ZCK A;  3STB C;  1PA6 A;  4N9T A;  1ZYR D;  1CKM A;  5I2X A;  1JJC B;  2DAA A;  5JEA G;  2E2H H;  1AUX A;  2HQL A;  3RZD H;  1C4Q A;  2GQS A;  2W8K A;  1STH A;  1WTQ A;  4L1K A;  3URY A;  2R7Z H;  4B3S H;  4N8X 1;  3KF6 A;  4EEQ A;  3TQY A;  3R3O A;  4CE5 A;  2SCU B;  1I3Q A;  2L0C A;  3JSN A;  1N9W A;  3OTO Q;  2UXD L;  4MV6 A;  1SYF A;  3S14 H;  2PW5 A;  4ILW A;  3CVZ A;  5DM7 3;  4G7H C;  1YJW A;  1KAW A;  1CZG A;  3FMA A;  3PR4 A;  2UVW A;  2W9B A;  5BN4 A;  3JZ6 A;  2VY3 A;  4CKE A;  2K28 A;  2Q8I B;  5KGU A;  4DR2 H;  1TS2 A;  3FHW A;  4LF9 L;  4JV1 A;  4ED2 A;  1A63 A;  5EKK A;  2JEB I;  3KHR A;  3NHH A;  4FGR A;  5IYB H;  5KG5 A;  3JAM i;  3W1G A;  2XWJ B;  1Q8K A;  4DV0 L;  3GIP A;  1GKH A;  4FDB A;  4NZM A;  1RL2 A;  2BQ3 A;  1AE2 A;  5IP7 G;  3GTG A;  4DR1 Q;  2QK4 A;  4FFO A;  2QGQ A;  4X62 L;  1M90 C;  4H02 A;  1HPC A;  1LT4 D;  2R8G A;  3DWP A;  2YS7 A;  2AGP A;  1BOS A;  4LF7 L;  1EZ6 A;  2OTL A;  4POG A;  3H20 A;  1SNM A;  4QCL A;  5KFG A;  4RHR A;  3A8I E;  4JI6 Q;  4A3L H;  1JOK A;  4K6L A;  1GM5 A;  4JW0 A;  2EDG A;  4K8I A;  5I5U A;  4ME3 A;  3PN1 A;  4CHI A;  1TS3 A;  3FKI A;  4JI8 Q;  1BBU A;  1QJO A;  4MHE A;  4EQP A;  5M5W H;  2B2T C;  5FLX c;  4DUZ L;  4R4O A;  4LFC Q;  1PYB A;  2KOL A;  2D0P A;  5KFW A;  3QJY A;  3RAX A;  1N36 H;  4O81 A;  1FD7 D;  3MWE A;  3CP0 A;  4X3U A;  3V05 A;  1D5Z C;  4B3M H;  3L0O A;  1L1O B;  4M0J A;  4A3B G;  3KTM A;  4A3M H;  4NXN L;  2UVV A;  3K0X A;  3HOY G;  3GIL A;  3PFF A;  4A3G G;  1PLF A;  3F8N A;  4YWK A;  2IP4 A;  5KG4 A;  1O7Z A;  1I7L A;  5I5X A;  1RJR A;  1EUJ A;  5D1O A;  3RUP A;  2YTX A;  4XYO A;  1VQK A;  2UXB Q;  5IGB A;  4O4J F;  3GIM A;  3J80 i;  5M3F H;  2UUC L;  1HTL D;  4LSX A;  1V9P A;  4JYA Q;  3D8G A;  1C9O A;  3SDZ A;  2UU9 L;  4DAV A;  1CE8 A;  3D31 A;  2DUD A;  4Y52 H;  4H13 C;  5EGT A;  2AGQ A;  3CW2 C;  1CKN A;  2HUG A;  3E5N A;  3MEF A;  5L37 A;  3G71 A;  4UY8 C;  3A54 A;  1DD2 A;  4X65 H;  4O7V A;  4BY7 G;  2ZTE A;  3JAM L;  5D8D A;  3QOJ A;  4HNU A;  3RBD A;  2LY7 A;  2JA7 A;  2JA7 G;  2OQK A;  4PV1 C;  2F0V A;  5M5Y H;  4JI5 L;  4O3N A;  4OX9 H;  5KFA A;  3RGZ A;  3GIK A;  5KIX A;  2B39 A;  3K58 A;  3MR5 A;  3DM1 A;  2M9V A;  2HHH Q;  1B8A A;  2VA3 A;  2EYP A;  1NBW A;  1NJI C;  4QUC A;  3STB D;  4XX0 B;  3E5S A;  4LFA L;  3DTF A;  1SND A;  1QCB D;  3KJO A;  1VF5 C;  3S1M H;  2VQE L;  2XTI A;  2OTJ A;  1A0I A;  4O7S A;  4JI1 Q;  3M7G A;  5FPO A;  2ASB A;  3P1H A;  2WB1 B;  3WNZ A;  1VQA A;  5D3D A;  1SFO B;  1ZAU A;  4KHZ A;  5JPN C;  1IBL Q;  2L11 A;  4H44 C;  4O3R A;  4LF8 L;  4XQQ A;  4R1J A;  4HID A;  3TY9 A;  1OTC A;  2E2J B;  3RFC A;  3AEV A;  4AQY H;  2W7O A;  3T56 B;  1I1M A;  4BS9 A;  5JQW A;  2V5A A;  1F77 A;  4C2M H;  3H0G H;  1V8Q A;  3VDY A;  1K73 C;  2UXD Q;  1JQY D;  2Z1C A;  1EY0 A;  3JZF A;  4DRF A;  3KHG A;  4FS1 A;  2YTY A;  3PMF A;  4XT3 B;  4LF5 H;  4C5A A;  3NSW A;  1NAP A;  3NEM A;  5M5X H;  1S9F A;  2O4X A;  3OOC A;  3VR5 A;  1NY4 A;  4A2B A;  3PUZ A;  2AKW B;  4NW2 A;  4LJZ C;  3A8J E;  4BBR B;  2G5D A;  1LTL A;  3BU2 A;  1YNJ D;  2XIW A;  3QQM A;  4IHJ F;  2AUJ D;  3GD7 A;  4A3F G;  2I5H A;  4CHT B;  3RAQ A;  1SAP A;  1YHA A;  1GGO A;  5FO9 B;  4LF9 Q;  5AJ3 L;  4XT1 B;  1XPU A;  1DAA A;  1HA5 A;  4IZ8 A;  4FO2 A;  5IT9 E;  1YHB A;  2O5J C;  4C5B A;  4RZQ A;  5E4X A;  2NU9 B;  4G7O C;  5KX5 F;  5I6W A;  4DV0 Q;  2L1B A;  3GV5 B;  2R8J A;  5DLG A;  4OXP A;  1K83 A;  4X3K A;  2EYO A;  4X62 Q;  4AYB A;  1PYS B;  3NTI A;  4AYB G;  1KTA A;  2N49 A;  2B2Y C;  2O03 A;  2HVR A;  3NUC A;  1SR3 A;  3T53 B;  3G6E A;  1TS4 A;  2GA4 B;  1BXT A;  3F2U A;  5I2Y A;  2XCA A;  4LF7 Q;  5EJW A;  2JA8 H;  3DXJ C;  1PH8 A;  4L5S A;  4DAA A;  3F2B A;  1GVP A;  2COJ A;  2N78 A;  4O1N A;  3WWI A;  5KFX A;  3PZP A;  2F0P A;  4DQN A;  4YWM A;  2R93 A;  2R93 G;  1DGS A;  2KHS A;  3B6Y A;  1GO3 E;  1QVF A;  3Q8Q B;  3P20 A;  5EKI A;  2P0A A;  3D4R A;  5LL6 b;  2I80 A;  3H6M A;  2NB0 A;  2WAQ B;  4DUZ Q;  3BVZ A;  1J5E L;  1Z47 A;  2F03 A;  4YR2 A;  4DV1 H;  4XDX A;  1ZHS A;  4C3I H;  3J7A 5;  4XYM B;  3OW7 A;  5C4J H;  4JV5 H;  2BE5 D;  4IWY A;  4JI3 H;  1LTI D;  2NVQ H;  2AMC B;  4NXN Q;  2ZJT A;  5GAE C;  4YCU A;  2EYM A;  3GTJ H;  2B2V C;  1SEI A;  3BA8 A;  4PMW A;  3KHL A;  2SDF A;  4BBS G;  1LLR D;  4IUT A;  3JC6 6;  3TS2 A;  3HFZ B;  2RGV A;  1XMO L;  1TWG A;  1MD2 D;  3K7A H;  5L1J A;  3ZYY X;  2E2H B;  1HQR D;  3RZD B;  2UUC Q;  1Y8P B;  2BQR A;  1EYG A;  4J9M A;  3V6K A;  4ID6 A;  4JC0 A;  2UU9 Q;  1R4Q B;  5DNF A;  2A6E C;  2R7Z B;  3A7A B;  4FFL A;  1Y14 B;  3GTQ H;  1HR0 W;  3I55 A;  3M9O B;  1EOV A;  2ENB A;  2XRQ D;  4DV7 L;  3RB0 A;  2AHO B;  2HVQ A;  3RF2 A;  1G8Z D;  3K5O A;  3N52 A;  4K0K L;  3S14 B;  2RHQ B;  3T1Y H;  3NBZ B;  1N32 H;  1ET0 A;  3TDQ A;  5LL6 S;  1TWF A;  4HCS A;  3G6Y A;  2IA6 A;  4DR7 H;  2AWN A;  3NTK A;  2BOS A;  4YBZ B;  5KG3 A;  4J1M A;  5KNC A;  2RHS B;  3QG1 A;  3U54 A;  1PX2 A;  4JI5 Q;  2J7Z A;  4ED7 A;  1ESF A;  3I2Z A;  4M7E A;  4NXM H;  3A74 A;  4J9L A;  2KCC A;  2K50 A;  4HAE A;  5KYL A;  5KFM A;  3AFP A;  4GNX A;  2NN6 G;  4LFA Q;  3K5N A;  5KEE A;  1V51 A;  5E1F A;  5CV5 A;  1LTB D;  2VQE Q;  1A48 A;  4R4T A;  1LTR D;  1RIP A;  3L7Z C;  3RUZ A;  5J39 A;  3FRP B;  3SXH A;  2WP8 J;  4DV6 H;  1CI3 M;  1O7Y A;  4HJA A;  4EYI B;  1KNE A;  2W6N A;  1O80 A;  4L6T B;  3JAM c;  1ENC A;  1SNP A;  4MZ9 A;  2IWH A;  3X3M A;  4CJ2 C;  4LF8 Q;  4C1N K;  4DV3 H;  2ZDG A;  2R8K A;  5FK9 C;  1EYC A;  1EYD A;  2PZW A;  1Y8N B;  3U58 A;  3PO2 H;  5ISR A;  2RVL A;  3IN5 A;  3V6J A;  5IT9 W;  1WTW A;  3E6Z X;  4ME6 A;  4E6N A;  1LT5 D;  2I46 A;  3OW2 A;  1N56 A;  1KLU D;  1J8I A;  1B53 A;  1HZB A;  1SXT A;  3MR6 A;  1ICW A;  1QVC A;  5M5W B;  3GTK H;  3J81 E;  3R5F A;  2B63 G;  1TWA A;  2QYZ A;  1Q90 A;  2K5D A;  3TQT A;  4JPB W;  1X3E A;  3F1Z A;  1SMX A;  2W9A A;  4RGO S;  3PF5 A;  4A3M B;  1SBB B;  4HQ6 A;  2A69 D;  2I07 B;  4Q0F A;  3WOE A;  2AGO A;  3I72 A;  2FFK B;  3OMC A;  1EOT A;  2ZM6 L;  1CHP D;  4RCN A;  2TMP A;  3RN5 A;  5AJ3 Q;  4IUQ A;  3S2D H;  1BXR A;  3OIP A;  2QCP X;  1FL0 A;  2XGP A;  4ED1 A;  5FLM G;  4NZN A;  5M3F B;  1SYX B;  1P8L A;  5KT3 A;  1Q7Y C;  3MR3 A;  1K0R A;  1YIT A;  1IOW A;  1X54 A;  5E7N A;  3TEK A;  4ZAI A;  1S5F D;  1IKL A;  1II3 A;  3BVG A;  1D2B A;  1BNC A;  5L1I A;  1HH2 P;  4DR5 H;  4OL7 A;  3VYR A;  4X66 L;  4A3J H;  2X69 A;  1RKN A;  1VBH A;  3CMA A;  4UCT A;  3I4O A;  4A3K G;  3DHQ A;  3PUY A;  2NVY H;  1Y1V A;  1Y1V G;  3CPF A;  2EJG C;  3R93 A;  1M1K C;  4C3J H;  3IKJ A;  4MTK A;  5IYD H;  2AU0 A;  4CDD C;  5M5Y B;  1I2K A;  2F0G A;  5DAU A;  1DV2 A;  1EWC A;  3P7J A;  1YEZ A;  4FS2 A;  3EVQ A;  1DV1 A;  3AMU A;  1XTC D;  2MO0 A;  4R4I A;  1J5E Q;  1G6Z A;  4DV6 L;  1D7Q A;  4GLX A;  3P75 A;  1IZ6 A;  4B3T L;  1A2U A;  5C4X G;  1KRT A;  3S1M B;  4DXF A;  4DV5 H;  2R7K A;  5JVD F;  4RAU C;  1LAB A;  4UP9 A;  1UAP A;  3DMU A;  1C48 A;  2WB1 G;  1YZ6 A;  5DGB A;  3PW0 A;  1U4R A;  3PQI A;  3PIP A;  2MJ8 A;  3J7Y W;  1XMO Q;  1SNQ A;  3NEN A;  1AEX A;  3K5I A;  2B3G A;  1XX8 A;  2JQO A;  1WYD A;  2L5T A;  2OT2 A;  4C5C A;  5JQG F;  3EQL C;  3OHX C;  2FHT A;  2JN4 A;  1CK1 A;  3V2T A;  4BXX G;  2YL2 A;  3T9A A;  5KFJ A;  1B7Y B;  5KND A;  2RDF A;  4UHV A;  4M1U B;  1V4Y A;  4ECT A;  5FPR A;  1IKM A;  4JI2 H;  1I94 H;  4C2M B;  3H0G B;  4DV7 Q;  5CM0 A;  1W96 A;  2A1A A;  4HTH A;  5ELE A;  4ECS A;  4K0K Q;  2Z4H A;  2JEA I;  1TWH A;  3GO5 A;  4NMZ A;  1FR3 A;  2KEE A;  5M5X B;  1AZQ A;  3T5K A;  1M7J A;  3HT5 A;  3ULL A;  2CW0 C;  2FXQ A;  1KJI A;  2EYL A;  1HNX L;  1SMY C;  2FMC A;  1ZET A;  2PPB C;  3K57 A;  1IXR A;  5HNE A;  3CME A;  1C3O A;  3R5X A;  3J81 W;  1JMC A;  1YNX A;  3LX0 A;  1YJ9 A;  5KFT A;  1MZB A;  4TV8 F;  1V1O A;  1QZG A;  2SNM A;  3DEP A;  1Q82 C;  3MXU A;  3UE0 A;  5FJ8 H;  1DM0 B;  1QOH A;  4K8J A;  1K9M C;  2CQA A;  5KYI A;  3GV3 A;  5D65 A;  3QZ7 A;  2VQF H;  3SVM A;  5F9N A;  2UUB H;  2F4I A;  1L2F A;  2JA8 B;  1B6R A;  3RGX A;  2F0J A;  4KK7 A;  3AB9 A;  1PH9 A;  3DUZ A;  3M9M B;  4RCO A;  2ALZ A;  3SHL A;  2W70 A;  4Z9C B;  1DIK A;  1K3R A;  4DUY H;  2KCT A;  3CD6 A;  4DV5 L;  2QDL A;  5C44 H;  3BS1 A;  2K5Q A;  2HGX A;  3H4B A;  4KY6 A;  1QE6 A;  1E7Z A;  3ITP A;  3CCR A;  3S16 H;  4DF7 A;  4ECX A;  3LWU A;  4I7Z C;  4YJ3 F;  1PMR A;  2RCF A;  1NTG A;  4C3I B;  5KT5 A;  1N33 H;  1ZYR C;  4G57 A;  1LTS D;  5IYC H;  5C4J B;  4JUZ A;  5BN5 A;  3RZO H;  2NVQ B;  1TII D;  4A93 G;  3CQZ H;  4LH6 A;  2YRW A;  2YRX A;  5JVH 3;  1TAE A;  3GTJ B;  1M6V A;  3R8B A;  2RQX A;  1R9T A;  1ASY A;  2ZM6 Q;  5BR8 L;  1OXX K;  3DEO A;  4U7C A;  1EZ8 A;  2YU9 H;  4IAL A;  1N34 H;  1VQF A;  2IHF A;  3K7A B;  2IL8 A;  4ZOL F;  5C0X H;  3AYH B;  2XN9 C;  5DIS C;  3V4S A;  4RWS C;  3NBY B;  3CCM A;  5KKN B;  4BWS C;  1PFM A;  1WOC A;  4DL5 A;  1BUV T;  3GTQ B;  4A76 A;  2VB3 X;  5HGT A;  5FLX L;  2F1M A;  4B08 A;  3H15 A;  4X66 Q;  5EWF A;  1KJQ A;  1P16 A;  1PH5 A;  3M4I A;  5KFU A;  4QW9 A;  2QDB A;  2VNU D;  5GAH C;  3U4Z A;  1L0Y B;  4FE2 A;  2OH2 A;  2FJZ A;  2NVX A;  1KDA A;  1GUN A;  5FO7 B;  5CBA E;  3CRL C;  3GTP A;  3PIO 3;  3S17 H;  1HJP A;  1ZXT A;  4ZLT F;  1U4L A;  3LP8 A;  4DR6 H;  3VR6 A;  4DV4 L;  1I6H H;  3GTL A;  3QFF A;  2RDG A;  3HGB A;  3C3L A;  1CKO A;  3T9C A;  1I4X A;  4RUA A;  5BWU A;  4JV2 A;  5CAE B;  1HR0 H;  2NU6 B;  5KFO A;  1SYD A;  4DV6 Q;  1VQM A;  1SSO A;  3TRE A;  4B3T Q;  2VUM H;  3BG5 A;  3PW7 A;  1TWC H;  4UUG A;  2F0U A;  3T1H H;  1WCM A;  2V1C C;  1MJC A;  1WCM G;  1SCU B;  3E9I A;  4RB1 A;  2E2I A;  3E0E A;  1W6J A;  2UUB L;  1JOQ A;  2A68 D;  4KY7 A;  4PZ8 A;  2E5L L;  4F50 A;  3K81 C;  1ILQ A;  2AQ3 B;  1KXL A;  3KF8 A;  4CDE C;  1KD1 C;  4B3R H;  5JVL A;  4GKJ H;  3K7U C;  4JOI C;  4ZKC B;  3PO2 B;  1M0W A;  2PMZ A;  3MXN A;  1DOL A;  4FFP A;  1QNK A;  1U0L A;  2Y0S G;  2Y0S A;  2JA6 G;  1UE6 A;  1VQO A;  1AFP A;  2UVU A;  2JA6 A;  3ER0 A;  4TKO B;  3HEJ A;  2GQR A;  2L55 A;  3I70 A;  1UEA B;  5M3M G;  3KLS A;  1N33 L;  4A3L G;  4QIW A;  4R8I A;  3KRE A;  4HSP A;  4FU0 A;  1PYW D;  3SK5 A;  4L5R C;  2FK1 A;  4MA5 A;  3WWH A;  4AYB E;  3GTK B;  2J6S A;  4OO1 I;  1W93 A;  3W5O A;  1Z2N X;  4A3D H;  2F4V H;  3PO3 G;  1QZH A;  4O83 A;  4TSS A;  2HDM A;  2K14 A;  3MC0 B;  3K3P A;  1H9M A;  3HG9 A;  1NUC A;  5G3L F;  4O4L F;  4LSA A;  3ND9 A;  1XWE A;  5CR5 A;  1CM9 A;  4P75 A;  4LF6 L;  4FFR A;  1V1Q A;  4A3M G;  1HNX Q;  3OSP A;  4FFN A;  1KBL A;  3KBX A;  1CFM A;  3D4W A;  1UC8 A;  3ORQ A;  1GHJ A;  5CGK A;  2D9U A;  1XNQ L;  5KG6 A;  5KFH A;  2KHI A;  2RSN A;  5KFI A;  5C1O A;  2A6H D;  3GV6 A;  4ZUJ A;  1LT6 D;  1BGW A;  4WHX A;  1STN A;  3VR4 A;  2YWV A;  1A2T A;  2A74 C;  4MTD A;  4M8A A;  5EKL A;  1E4E A;  2W7P A;  2L4N A;  3S24 A;  1KAA A;  3EPI A;  4K2K A;  2L12 A;  2Z6K A;  4CC6 A;  4A3J B;  2QA4 A;  2SNS A;  1PH4 A;  2CHB D;  3D4D A;  1WTX A;  3AU7 A;  4BY1 H;  1GSH A;  3MR2 A;  2D0O A;  2CKZ B;  1TR5 A;  4OO1 H;  2NVY B;  2FLL A;  2K5N A;  3DLL A;  4ED3 A;  4PG3 A;  3TW7 A;  4PDB A;  1JE4 A;  1AW7 A;  1XPO A;  3R2T A;  4C3J B;  1STE A;  1A0G A;  1JLL B;  1XDN A;  4I4T F;  4UCS A;  4MNO A;  4OWT B;  3S1Q H;  1EQV A;  4ZK9 B;  1A3V A;  3T1H L;  3OIQ A;  4DV5 Q;  3LQS A;  2I87 A;  3J7A V;  1RYS A;  2BDO A;  3D0F A;  2M00 A;  3R23 A;  2R7L A;  1TU2 B;  2EE1 A;  1BDO A;  4LFB H;  1YNN D;  4CJ0 B;  4EGJ A;  5GON F;  2J4X A;  4CDC C;  4EQO A;  4UFZ A;  4DL6 A;  1Y1W H;  1HNZ L;  3IRB A;  1RK5 A;  2EY1 A;  3I8Z A;  4HNV A;  3BDC A;  3CAM A;  2L9H A;  1M8A A;  3X3N A;  3SK6 A;  1F9S A;  1Q1B A;  1HXY D;  2HHF A;  1W6K A;  5BR8 Q;  4LW1 A;  5JEA J;  1H9S B;  4L63 B;  1Z2P X;  5F2D A;  2YTV A;  3VMM A;  4F7X A;  5LYJ F;  2CW8 A;  4QMG A;  5C3X A;  1EKV A;  3GTO H;  1VQD A;  2HIX A;  5EBD A;  3GTM H;  2PQA B;  1VS0 A;  4HR7 A;  1GSA A;  4O7T A;  2R8H A;  1YNJ C;  3NWS A;  4IRD A;  2HT1 A;  2DWC A;  3SK8 A;  4GLW A;  5KFB A;  2KHJ A;  3H0G G;  4ECU A;  5IT9 L;  1EWH A;  3VR2 A;  1X3G A;  1DOK A;  2UUA H;  1SLJ A;  2TSS A;  2Z0S A;  3OYY A;  4QWD A;  4TVI A;  1LTA D;  3IFD A;  3MFH A;  5BWV A;  1F2Y A;  4X3T A;  2Y4R A;  4DV4 Q;  1BCP B;  1EU3 A;  2VXW A;  3GID A;  3KDF B;  3PUV A;  4NP5 A;  4A3I G;  1SDF A;  4JK1 C;  3BA9 A;  3HOZ H;  3U55 A;  2KCM A;  1XJV A;  1SYE A;  3O13 A;  4UCR A;  3NUA A;  2W6Q A;  4LNQ A;  4O2A F;  3BZK A;  5E25 A;  4KHP H;  4O2D A;  5GQO A;  3T16 A;  4IFD J;  1SE4 A;  5CV7 A;  3Q6S A;  2F0W A;  2UUB Q;  3SI8 A;  4XQN A;  4EGQ A;  5C3E G;  2W6P A;  3PW4 A;  3MAQ A;  2E5L Q;  2ATW A;  4HNT A;  2V4R A;  1S5D D;  1SRU A;  5JUM A;  2YCH A;  3RBE A;  2ZJR A;  3FP9 A;  2Q8R E;  2ABJ A;  2VL6 A;  1JWM D;  2MQH A;  4B3S L;  3N43 B;  2JJQ A;  2C00 A;  1A15 A;  4Q45 A;  3KLW A;  1X9N A;  2BE5 C;  1LM0 A;  4R8U B;  1IBK H;  5IP9 H;  1BCP F;  3SR1 A;  2F0M A;  1N33 Q;  1AH9 A;  2VUG A;  4EBD A;  3EBE A;  3UI2 A;  2EXZ A;  3G7L A;  4PQX A;  5C44 B;  4DGZ A;  3RB6 A;  2C2D A;  3I4M H;  2KEC A;  4J6H A;  2XIG A;  1E2W A;  3S16 B;  4ECW A;  1KLG D;  1SE8 A;  2W9C B;  1AE3 A;  2QIL A;  2YYA A;  2KED A;  1BF4 A;  1HNW H;  3I4N G;  3V6H A;  3HOV G;  2C2R A;  2B2W A;  4XXE A;  3RZO B;  4DR2 L;  5FNV F;  5KG7 A;  1BVS A;  2WFW A;  3CQZ B;  4YCW A;  1UWV A;  5EPL A;  2L15 A;  2ASL A;  1KJJ A;  3KAL A;  1B3Q A;  3NBI A;  1VQP A;  4LF6 Q;  4A3C G;  1KC7 A;  2J6T A;  3T7A A;  4DA2 A;  1XMQ H;  4KTA A;  4ULL A;  5A2Q L;  1XNQ Q;  1PH2 A;  3MXP A;  4QSH A;  5K2M A;  2YU9 B;  3TY5 A;  3TIN A;  2Z04 A;  3RB3 A;  2JEG A;  3PGZ A;  4A2A A;  1WTH A;  3GQB A;  4HN7 A;  3BYY B;  3ZJY C;  2EVB A;  2IW3 A;  1EIG A;  3CCQ A;  3S15 H;  1AP0 A;  2FPI B;  1I6V C;  3NQI A;  2UUA L;  3QB3 A;  2CZG A;  3LWB A;  1I50 A;  2V9W A;  1V1P B;  3NQT A;  5JEA H;  5IWA H;  2XGQ A;  2X5R A;  5KG1 A;  1EY5 A;  1S68 A;  4RNN A;  4RKB A;  4R9W A;  1Y8O B;  3V4Z A;  3K6O A;  2WIN B;  2F3W A;  3W2D A;  4YB8 B;  1FJG H;  4HJ9 A;  2GVB A;  1VQE A;  3NBH B;  3CHB D;  4CKB A;  1IYV A;  4IFD I;  2EY5 A;  1GJX A;  1I3Q H;  2Q7D A;  2K5V A;  3MWM A;  4P73 A;  1F2M A;  3J7A K;  3S17 B;  4NYE A;  2KEN A;  4CDF C;  1KEE A;  1Q1E A;  5HUR A;  5DM6 3;  1I6H B;  2OXP A;  3T1H Q;  4TUY F;  2K05 A;  4DL4 A;  1N36 L;  3HKZ A;  3HKZ G;  2EYF A;  1VQ6 A;  4QJF A;  4B3M L;  1IYJ B;  1FYC A;  2EJ0 A;  1Q86 C;  2VUM B;  4P72 A;  5ELF A;  1TWC B;  4R8N A;  1QUQ B;  3A5Z B;  4EG0 A;  3CRK C;  2W57 A;  1HNZ Q;  1E1T A;  2I8C A;  2R92 A;  2R92 G;  4TRD A;  1E0B A;  1PZK D;  1I4R A;  1PTO C;  1RJP A;  4DAY A;  1J9O A;  3ETJ A;  4EEY A;  3CCV A;  1EUC B;  1E4F T;  2WYO A;  4DNI A;  4GN4 B;  1Q3L A;  5KFE A;  4IFD H;  5IP7 H;  3GTG H;  4DK0 A;  2HDL A;  5KFN A;  2R7N A;  2XCP A;  2RCN A;  4HCE A;  5BN3 A;  4UP8 A;  3PO2 G;  4P74 A;  5IOC A;  2JEI A;  4N9P A;  1D8L A;  5FOB B;  4HN2 A;  4MV9 A;  1PZJ D;  3RLF A;  1ENA A;  2J6U A;  3DF7 A;  4X65 L;  2A69 C;  2C5C A;  2EJM A;  1O7L A;  3UZO A;  1K1S A;  3EYY A;  1CSP A;  2DY8 A;  3PVX A;  4DXG A;  2JA5 A;  2JA5 G;  4QW8 A;  4CBV A;  4ECV A;  1TS5 A;  2EY6 A;  4OX9 L;  1TXY A;  3CXC A;  2COI A;  2A5H A;  2ZT9 C;  3CCS A;  1XMQ L;  4A3D B;  5EZY F;  2JEF A;  1EQQ A;  3FKI H;  2LFN A;  3N8D A;  4DV2 H;  2VQD A;  1EQT A;  2X6L A;  2Q2H A;  1PH1 A;  4A3B H;  1I4G A;  1UC9 A;  1ICF B;  1SNC A;  4DFA A;  4GOP A;  3HOY H;  4ZHQ F;  1AN7 A;  5IGD A;  3HOX G;  1S4Z A;  4XZ3 B;  5FO8 B;  5KFV A;  3TS0 A;  4F4X A;  4F4Z A;  5IT9 c;  4WBN F;  1E2Z A;  3AQQ A;  2E74 C;  2RGR A;  4Q0Y A;  5KFF A;  3H09 A;  3OWF A;  1LV9 A;  3TP8 A;  4JI0 H;  3TRZ A;  3T5L A;  5DAA A;  5JJI A;  3KAK A;  2LKV A;  1SNO A;  1JWU D;  5IGC A;  2YZM A;  3T13 A;  3J7A F;  2LXK A;  4AQY L;  4BY1 B;  4O84 A;  4B3S Q;  2FIN B;  3C1E A;  1RJT A;  4G3I A;  3T99 A;  4J9O A;  3UDG A;  5IE8 A;  2R7F A;  4KKU A;  3S1Q B;  3Q2O A;  1T3N A;  1ET6 A;  3GII A;  4BY7 H;  4LF5 L;  3QIA A;  4NPS A;  4DN4 M;  1PH3 A;  5F9L A;  5LMU H;  5D14 A;  4ZQ3 A;  2JA7 H;  3MFY A;  2EYH A;  3FPP A;  4XYQ A;  1Y1W B;  4DR2 Q;  3BZC A;  5HY6 A;  4DR3 H;  1SJE D;  1TQO A;  2NVT H;  3RV4 A;  1NR4 A;  4LK1 C;  3A0J A;  2JP1 A;  3VA7 A;  2CVR A;  2F0K A;  3T9E A;  4QWB A;  3CCL A;  3Q8D A;  5I60 A;  3LWE A;  4B9W A;  4GLA C;  3GLK A;  3LUL A;  3GTO B;  3JAM E;  4J9S A;  2ICI A;  3VYT A;  3GTM B;  4EX5 A;  1NCV A;  1EHI A;  4DR4 H;  4KV6 A;  2UUA Q;  1PVO A;  4KI0 A;  1JKJ B;  4GKK H;  3S1R H;  5ELN A;  4KD3 A;  3WWJ A;  1WD1 A;  2KBN A;  3E0J A;  4V0B A;  1B04 A;  4DV2 L;  5ELD A;  3TP5 A;  4C3H H;  2Z6B A;  2HDK A;  1D1K A;  2NU7 B;  1S0O A;  4I7H A;  4JI7 H;  4MA0 A;  3FPU B;  4GS3 A;  1KAB A;  4OGQ C;  3NEL A;  5I9P A;  3HOU H;  1PRT D;  3K5H A;  2PMZ E;  2VS1 A;  3D3R A;  3CCE A;  2Y0S E;  4O7Z A;  5I5S A;  4IPG A;  1MHW C;  1PTO D;  4DV1 L;  1MJE A;  4IR1 A;  1BBW A;  4LAA A;  5COY A;  5I9O A;  2MNA A;  1N36 Q;  3HOZ B;  3BJU A;  4ZQI A;  2NZH A;  5BWX A;  5C4H A;  4JV5 L;  2FLP A;  4B3M Q;  1ZHQ A;  3OSN A;  4QIW E;  5I5Y A;  4YIJ A;  4JI3 L;  3M9B A;  4O86 A;  3JRW A;  3MHB A;  1UEB A;  3N44 B;  4L5Q A;  3D6W A;  5LMN W;  4PMC