4UUGA

The (r)-selective amine transaminase from aspergillus fumigatus with inhibitor bound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
320
structure length
320
Chain Sequence
b'ASMDKVFSGYYARQKLLERSDNPFSKGIAYVEGKLVLPSDARIPLLDEGFMHSDLTYDVISVWDGRFFRLDDHLQRILESCDKMRLKFPLALSSVKNILAEMVAKSGIRDAFVEVIVTRGLTGVRGSKPEDLYNNNIYLLVLPYIWVMAPENQLHGGEAIITRTVRRTPPGAFDPTIKNLQWGDLTKGLFEAMDRGATYPFLTDGDTNLTEGSGFNIVLVKNGIIYTPDRGVLRGITRKSVIDVARANSIDIRLEVVPVEQAYHSDEIFMCTTAGGIMPITLLDGQPVNDGQVGPITKKIWDGYWEMHYNPAYSFPVDYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINE TRANSAMINASE
publication title Structural and Biochemical Characterization of the Dual Substrate Recognition of the (R)-Selective Amine Transaminase from Aspergillus Fumigatus
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Transferase
total genus 104
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 4uugA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 4uugA01
5E25A 1EKPA 4WHXA 1A3GA 5CE8A 1G2WA 1I1LA 1WRVA 3CEBA 5I5WA 2EIYA 1I1KA 5BWRA 4CE5A 1EKFA 4DAAA 3DAAA 1KTAA 3LQSA 5I60A 5I5YA 2ABJA 5CR5A 4DQNA 2COJA 4M0JA 3WWJA 5HNEA 2EJ2A 1KT8A 2HHFB 3UYYA 3CSWA 5BWTA 5I5VA 4K6NA 2HGXA 5BWUA 5I5XA 2EJ0A 1A0GA 4CHIA 5BWWA 2DAAA 4TM5A 4TVIA 5DAAA 2Y4RA 1I2KA 4PBCA 4UUGA 4CMDA 2HHFA 2COGA 3DTGA 5I5TA 3QQMA 1I1MA 4CMFA 1IYEA 3JZ6A 2EJ3A 3UZOA 4JXUA 2HDKA 2ZGIA 2COIA 3UZBA 5BWXA 2HGWA 1EKVA 2A1HA 5I5UA 5BWVA 3U0GA 3SNOA 5FR9A 3LULA 5CM0A 2DABA 3WWHA 3HT5A 5K3WA 1I2LA 3DTFA 3WWIA 2HG8A 1DAAA 1ET0A 1IYDA 5I5SA
chains in the Genus database with same CATH superfamily
4LH7A 3UFXB 4NZMA 1S68A 1B04A 3T9EA 4O4HF 1GSHA 4TUYF 3JSLA 2HVSA 1EKPA 1KBLA 3QFFA 3TW6A 4PZ7A 4MV6A 5KKNB 2I87A 2NUAB 5CB4F 5JH7F 4HNUA 3VMMA 4WBNF 4O86A 5FNVF 5FPOA 4TV8F 4O7YA 4DAAA 1KUTA 3TQTA 2ABJA 3KREA 3GB8B 3RV3A 2COJA 2GQSA 3WWJA 4O7SA 5HNEA 3ORQA 4FFRA 2HHFB 1XDNA 2Z02A 5BYAA 1CQIB 2R86A 2XCLA 4FFPA 5I5XA 2R7LA 1A0GA 4CHIA 2DAAA 4MV1A 2GPSA 2DLNA 2FB9A 4TM5A 4TVIA 5DAAA 4XX0B 2Y4RA 3TY8A 4EGQA 2W6PA 2SCUB 4HNTA 2V58A 2HVRA 4UUGA 1TA8A 4UCOA 2QK4A 5GONF 3S24A 2YRXA 1KJQA 2YL2A 4IHJF 3Q1KA 4PZ6A 3U55A 2EJ3A 3HBLA 2ZGIA 2COIA 3R5XA 4YJ3F 3RTXA 1KC7A 4EQ5A 4O4LF 3UZBA 4FGRA 4I50F 2CNQA 1XK5A 2A1HA 2R84A 4L1KA 5BWVA 5LXTF 5DGIA 1W96A 5CAEB 1DGSA 1DV1A 5KX5F 3DTFA 2HG8A 1ET0A 2QF7A 5I5SA 4UFZA 2HJWA 3BA8A 4O7NA 3T7AA 4FFMA 3VOTA 2GPWA 1P16A 2X5RA 4O7ZA 4O2BF 2DIKA 2QB5A 3VPCA 3OUZA 1ZAUA 3BACA 5JVLA 3JZIA 5DMXA 2XD4A 4CC6A 3MWEA 5LA6F 2FPIB 2FPPB 2PVPA 2W6ZA 2NU7B 2YZLA 2EIYA 4CKBA 4EFEA 4HQ6A 1JDEA 5LP6F 2NU6B 2R85A 1EKFA 5HV6A 3DAAA 4TV9F 4MV4A 4XYMB 3LQSA 1B6RA 1UC9A 4MV8A 4O7RA 5CR5A 4O2AF 5J2UF 4DQNA 2PBZA 2V59A 4UCTA 1A0IA 2OWOA 5C1OA 1T36A 3UYYA 3JRWA 3W1BA 4RZQA 2IP4A 5BWUA 1EHIA 3ETHA 4MV9A 4YBZB 3JZFA 5BWWA 4UCUA 4O7WA 2HGSA 5CA1F 3T54A 4FU0A 3VA7A 4IWXA 1W93A 5JQWA 2W6OA 3V4SA 1M6VA 4RCNA 4PBCA 5KS8A 4CMDA 2P0AA 3NC0B 1PK8A 3DTGA 3VNNA 4M9UA 3QQMA 1CQJB 4CMFA 3JRXA 2VQDA 1B6SA 1E4EB 2W70A 2Q2UA 1GLVA 1EYZA 3K3PA 1EZ1A 1I7NA 3G8CA 1IOWA 5BWXA 1Z2PX 1I7LA 5EZYF 3TIGA 2HGWA 3Q2OA 4NZOA 5I5UA 1WR2A 4UCRA 3RV4A 2PN1A 5FR9A 1AUXA 2YZGA 5LYJF 5D1OB 1DAAA 2Z04A 1IYDA 4HN2A 3JSNA 5BPHA 4XYLB 3SGIA 4C5BA 3TINA 2ZDGA 4ZOLF 2HIXA 1A3GA 4HNVA 2HVQA 5CE8A 2YW2A 1I1LA 2VR1A 5JQGF 1JLLB 1WRVA 2I8CA 5DISC 1KJ8A 3AW8A 1I1KA 5BWRA 1CKOA 4ZHQF 4CE5A 1CKMA 5IYZF 4MAMA 1E4EA 2ODTX 3R5HA 1CKNB 5HBRB 1KJ9A 2W6NA 5I60A 3NBYB 1VBHA 4Y8VB 2VUGA 4MV7A 2GLTA 4NYEA 4LH6A 3W5OA 2EJ2A 1A9XA 3CSWA 5BWTA 5DGHA 4K6NA 4DRFA 1BNCA 4XZ3B 3WO0A 2W71A 5D1OA 3VPDA 1A48A 4FFOA 4QSHA 4O7TA 1IOVA 1AUVA 4ME6A 4O4IF 1M0WA 4YAJB 1M0TA 3NUAA 2NU8B 2W6MA 3OUUA 4O81A 1I2KA 1GSOA 3KYHC 2CNUA 4HR7A 4MA5A 5J2TF 3T9DA 4IWYA 3L2PA 1I1MA 3ORRA 4GLWA 3RUPA 1GGOA 2ZDHA 4GLXA 5D1PA 4YB8B 1CS0A 2DZDA 1TAEA 3JZ6A 1OBDA 2YYAA 4YAKB 1FVIA 2YWVA 4O83A 1VS0A 3T9BA 1CKNA 4FFNA 3T99A 1SCUB 3NBZB 2J9GA 3N8DA 3GLKA 1KJIA 4I4TF 3U0GA 3HB9A 4E4TA 3SNOA 1BXRA 5CM0A 3SE7A 3WWHA 3GIDA 2YRWA 5C8YF 3PFFA 2CZGA 1I2LA 3BA9A 2R87A 2NU9B 1CE8A 4IZOA 4NZNA 4ZI7F 3U9TA 3G8DA 2GQRA 4UCSA 4YJ2F 4PZ8A 5E25A 3R23A 4ZQIA 3I12A 1DIKA 3VPBA 4FE2A 3BABA 4WHXA 5CA0F 1EUDB 2YZNA 1G2WA 2R7MA 2R82A 3QWUA 4O7LA 4E6NA 3DF7A 3CEBA 2I80A 1OBGA 5I5WA 2CFMA 1PX2A 1P8LA 1X9NA 2C00A 4O82A 3R5FA 2ZDQA 1KTAA 4EG0A 4CKEA 3T9CA 4MV3A 5I5YA 3TW7A 3WNZA 5BMVF 4M0JA 2Q7DA 3BAAA 5D8DA 2VPQA 1KT8A 3UQ8A 3TY5A 5I5VA 3K5HA 3AX6A 1KEEA 4O7VA 3TEKA 2FPGB 2HGXA 5K2MA 3N6RA 3E5NA 4UCVA 5H80A 4MA0A 3RFCA 2EJ0A 3T9AA 3U9SA 3KALA 4IIJF 1JKJB 4EFBA 1GSAA 3TIIA 1KJJA 4O4JF 4EEQA 2WYOA 2YS7A 4Q4CA 4DIMA 3LP8A 3GJXB 3HO8A 4C5CA 3TY9A 1V9PA 2Q2TA 2DWCA 2HHFA 2COGA 1UC8A 3BG5A 5I5TA 4O84A 1VBGA 4Q4DA 2YZMA 3PN1A 2OLSA 2YS6A 2V5AA 1Z2NX 1DV2A 5JVDF 2W6QA 5FPRA 5BYBA 1IYEA 1JDBB 3MJFA 3MWDA 4DLKA 5I47A 3KAJA 3U54A 3LWBA 3UZOA 4JXUA 2R7NA 2HDKA 3V4ZA 1C30A 3GDEA 1C3OA 1EUCB 3W1GA 4CC5A 4C5AA 3R9RA 3KAKA 2CNVA 2R7KA 1Z2OX 1EKVA 4CKCA 5BPFA 1ULZA 3ETJA 3LULA 3K5IA 2DABA 3T9FA 1VKZA 5LOVF 3HT5A 2X0SA 5K3WA 4FFLA 5C1PA 3WWIA 2FP4B 3RR5A 4EGJA 2HIVA 4I55F 3WO1A
chains in the Genus database with same CATH topology
4NZMA 5E25A 3SGIA 3T9EA 3T7AA 1EKPA 4WHXA 1A3GA 2X5RA 5CE8A 2QB5A 1G2WA 1ZAUA 3BACA 1I1LA 1WRVA 3CEBA 5I5WA 2EIYA 4CKBA 1I1KA 5BWRA 4CE5A 2ODTX 1EKFA 4DAAA 3DAAA 1KTAA 3LQSA 5I60A 1UC9A 4CKEA 3T9CA 5I5YA 3TW7A 2ABJA 5CR5A 4DQNA 2COJA 4M0JA 3WWJA 2Q7DA 5HNEA 2EJ2A 1KT8A 2HHFB 3UYYA 3CSWA 5BWTA 5DGHA 5BYAA 5I5VA 4K6NA 3TEKA 2HGXA 5BWUA 5K2MA 5I5XA 2EJ0A 1A0GA 3T9AA 4CHIA 5BWWA 2DAAA 3VPDA 3T54A 4TM5A 4TVIA 5DAAA 2Y4RA 4IWXA 4Q4CA 1I2KA 4RCNA 4PBCA 5KS8A 4UUGA 4CMDA 3T9DA 2HHFA 2COGA 3DTGA 1UC8A 4IWYA 5I5TA 3QQMA 1I1MA 4Q4DA 4CMFA 4GLWA 5BYBA 1IYEA 3JZ6A 5I47A 2EJ3A 3UZOA 4JXUA 2HDKA 3T9BA 2ZGIA 3T99A 2COIA 3UZBA 5BWXA 2HGWA 1EKVA 2A1HA 4NZOA 5I5UA 5BWVA 3U0GA 4CKCA 5DGIA 3SNOA 5FR9A 3LULA 5CM0A 2DABA 3WWHA 3T9FA 3PFFA 3HT5A 5K3WA 1I2LA 3DTFA 3WWIA 2HG8A 1DAAA 1ET0A 4NZNA 1IYDA 4HN2A 5I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E25 A;  1EKP A;  4WHX A;  1A3G A;  5CE8 A;  1G2W A;  1I1L A;  1WRV A;  3CEB A;  5I5W A;  2EIY A;  1I1K A;  5BWR A;  4CE5 A;  1EKF A;  4DAA A;  3DAA A;  1KTA A;  3LQS A;  5I60 A;  5I5Y A;  2ABJ A;  5CR5 A;  4DQN A;  2COJ A;  4M0J A;  3WWJ A;  5HNE A;  2EJ2 A;  1KT8 A;  2HHF B;  3UYY A;  3CSW A;  5BWT A;  5I5V A;  4K6N A;  2HGX A;  5BWU A;  5I5X A;  2EJ0 A;  1A0G A;  4CHI A;  5BWW A;  2DAA A;  4TM5 A;  4TVI A;  5DAA A;  2Y4R A;  1I2K A;  4PBC A;  4UUG A;  4CMD A;  2HHF A;  2COG A;  3DTG A;  5I5T A;  3QQM A;  1I1M A;  4CMF A;  1IYE A;  3JZ6 A;  2EJ3 A;  3UZO A;  4JXU A;  2HDK A;  2ZGI A;  2COI A;  3UZB A;  5BWX A;  2HGW A;  1EKV A;  2A1H A;  5I5U A;  5BWV A;  3U0G A;  3SNO A;  5FR9 A;  3LUL A;  5CM0 A;  2DAB A;  3WWH A;  3HT5 A;  5K3W A;  1I2L A;  3DTF A;  3WWI A;  2HG8 A;  1DAA A;  1ET0 A;  1IYD A;  5I5S A; 
#chains in the Genus database with same CATH topology
 4LH7 A;  3UFX B;  4NZM A;  1S68 A;  1B04 A;  3T9E A;  4O4H F;  1GSH A;  4TUY F;  3JSL A;  2HVS A;  1EKP A;  1KBL A;  3QFF A;  3TW6 A;  4PZ7 A;  4MV6 A;  5KKN B;  2I87 A;  2NUA B;  5CB4 F;  5JH7 F;  4HNU A;  3VMM A;  4WBN F;  4O86 A;  5FNV F;  5FPO A;  4TV8 F;  4O7Y A;  4DAA A;  1KUT A;  3TQT A;  2ABJ A;  3KRE A;  3GB8 B;  3RV3 A;  2COJ A;  2GQS A;  3WWJ A;  4O7S A;  5HNE A;  3ORQ A;  4FFR A;  2HHF B;  1XDN A;  2Z02 A;  5BYA A;  1CQI B;  2R86 A;  2XCL A;  4FFP A;  5I5X A;  2R7L A;  1A0G A;  4CHI A;  2DAA A;  4MV1 A;  2GPS A;  2DLN A;  2FB9 A;  4TM5 A;  4TVI A;  5DAA A;  4XX0 B;  2Y4R A;  3TY8 A;  4EGQ A;  2W6P A;  2SCU B;  4HNT A;  2V58 A;  2HVR A;  4UUG A;  1TA8 A;  4UCO A;  2QK4 A;  5GON F;  3S24 A;  2YRX A;  1KJQ A;  2YL2 A;  4IHJ F;  3Q1K A;  4PZ6 A;  3U55 A;  2EJ3 A;  3HBL A;  2ZGI A;  2COI A;  3R5X A;  4YJ3 F;  3RTX A;  1KC7 A;  4EQ5 A;  4O4L F;  3UZB A;  4FGR A;  4I50 F;  2CNQ A;  1XK5 A;  2A1H A;  2R84 A;  4L1K A;  5BWV A;  5LXT F;  5DGI A;  1W96 A;  5CAE B;  1DGS A;  1DV1 A;  5KX5 F;  3DTF A;  2HG8 A;  1ET0 A;  2QF7 A;  5I5S A;  4UFZ A;  2HJW A;  3BA8 A;  4O7N A;  3T7A A;  4FFM A;  3VOT A;  2GPW A;  1P16 A;  2X5R A;  4O7Z A;  4O2B F;  2DIK A;  2QB5 A;  3VPC A;  3OUZ A;  1ZAU A;  3BAC A;  5JVL A;  3JZI A;  5DMX A;  2XD4 A;  4CC6 A;  3MWE A;  5LA6 F;  2FPI B;  2FPP B;  2PVP A;  2W6Z A;  2NU7 B;  2YZL A;  2EIY A;  4CKB A;  4EFE A;  4HQ6 A;  1JDE A;  5LP6 F;  2NU6 B;  2R85 A;  1EKF A;  5HV6 A;  3DAA A;  4TV9 F;  4MV4 A;  4XYM B;  3LQS A;  1B6R A;  1UC9 A;  4MV8 A;  4O7R A;  5CR5 A;  4O2A F;  5J2U F;  4DQN A;  2PBZ A;  2V59 A;  4UCT A;  1A0I A;  2OWO A;  5C1O A;  1T36 A;  3UYY A;  3JRW A;  3W1B A;  4RZQ A;  2IP4 A;  5BWU A;  1EHI A;  3ETH A;  4MV9 A;  4YBZ B;  3JZF A;  5BWW A;  4UCU A;  4O7W A;  2HGS A;  5CA1 F;  3T54 A;  4FU0 A;  3VA7 A;  4IWX A;  1W93 A;  5JQW A;  2W6O A;  3V4S A;  1M6V A;  4RCN A;  4PBC A;  5KS8 A;  4CMD A;  2P0A A;  3NC0 B;  1PK8 A;  3DTG A;  3VNN A;  4M9U A;  3QQM A;  1CQJ B;  4CMF A;  3JRX A;  2VQD A;  1B6S A;  1E4E B;  2W70 A;  2Q2U A;  1GLV A;  1EYZ A;  3K3P A;  1EZ1 A;  1I7N A;  3G8C A;  1IOW A;  5BWX A;  1Z2P X;  1I7L A;  5EZY F;  3TIG A;  2HGW A;  3Q2O A;  4NZO A;  5I5U A;  1WR2 A;  4UCR A;  3RV4 A;  2PN1 A;  5FR9 A;  1AUX A;  2YZG A;  5LYJ F;  5D1O B;  1DAA A;  2Z04 A;  1IYD A;  4HN2 A;  3JSN A;  5BPH A;  4XYL B;  3SGI A;  4C5B A;  3TIN A;  2ZDG A;  4ZOL F;  2HIX A;  1A3G A;  4HNV A;  2HVQ A;  5CE8 A;  2YW2 A;  1I1L A;  2VR1 A;  5JQG F;  1JLL B;  1WRV A;  2I8C A;  5DIS C;  1KJ8 A;  3AW8 A;  1I1K A;  5BWR A;  1CKO A;  4ZHQ F;  4CE5 A;  1CKM A;  5IYZ F;  4MAM A;  1E4E A;  2ODT X;  3R5H A;  1CKN B;  5HBR B;  1KJ9 A;  2W6N A;  5I60 A;  3NBY B;  1VBH A;  4Y8V B;  2VUG A;  4MV7 A;  2GLT A;  4NYE A;  4LH6 A;  3W5O A;  2EJ2 A;  1A9X A;  3CSW A;  5BWT A;  5DGH A;  4K6N A;  4DRF A;  1BNC A;  4XZ3 B;  3WO0 A;  2W71 A;  5D1O A;  3VPD A;  1A48 A;  4FFO A;  4QSH A;  4O7T A;  1IOV A;  1AUV A;  4ME6 A;  4O4I F;  1M0W A;  4YAJ B;  1M0T A;  3NUA A;  2NU8 B;  2W6M A;  3OUU A;  4O81 A;  1I2K A;  1GSO A;  3KYH C;  2CNU A;  4HR7 A;  4MA5 A;  5J2T F;  3T9D A;  4IWY A;  3L2P A;  1I1M A;  3ORR A;  4GLW A;  3RUP A;  1GGO A;  2ZDH A;  4GLX A;  5D1P A;  4YB8 B;  1CS0 A;  2DZD A;  1TAE A;  3JZ6 A;  1OBD A;  2YYA A;  4YAK B;  1FVI A;  2YWV A;  4O83 A;  1VS0 A;  3T9B A;  1CKN A;  4FFN A;  3T99 A;  1SCU B;  3NBZ B;  2J9G A;  3N8D A;  3GLK A;  1KJI A;  4I4T F;  3U0G A;  3HB9 A;  4E4T A;  3SNO A;  1BXR A;  5CM0 A;  3SE7 A;  3WWH A;  3GID A;  2YRW A;  5C8Y F;  3PFF A;  2CZG A;  1I2L A;  3BA9 A;  2R87 A;  2NU9 B;  1CE8 A;  4IZO A;  4NZN A;  4ZI7 F;  3U9T A;  3G8D A;  2GQR A;  4UCS A;  4YJ2 F;  4PZ8 A;  5E25 A;  3R23 A;  4ZQI A;  3I12 A;  1DIK A;  3VPB A;  4FE2 A;  3BAB A;  4WHX A;  5CA0 F;  1EUD B;  2YZN A;  1G2W A;  2R7M A;  2R82 A;  3QWU A;  4O7L A;  4E6N A;  3DF7 A;  3CEB A;  2I80 A;  1OBG A;  5I5W A;  2CFM A;  1PX2 A;  1P8L A;  1X9N A;  2C00 A;  4O82 A;  3R5F A;  2ZDQ A;  1KTA A;  4EG0 A;  4CKE A;  3T9C A;  4MV3 A;  5I5Y A;  3TW7 A;  3WNZ A;  5BMV F;  4M0J A;  2Q7D A;  3BAA A;  5D8D A;  2VPQ A;  1KT8 A;  3UQ8 A;  3TY5 A;  5I5V A;  3K5H A;  3AX6 A;  1KEE A;  4O7V A;  3TEK A;  2FPG B;  2HGX A;  5K2M A;  3N6R A;  3E5N A;  4UCV A;  5H80 A;  4MA0 A;  3RFC A;  2EJ0 A;  3T9A A;  3U9S A;  3KAL A;  4IIJ F;  1JKJ B;  4EFB A;  1GSA A;  3TII A;  1KJJ A;  4O4J F;  4EEQ A;  2WYO A;  2YS7 A;  4Q4C A;  4DIM A;  3LP8 A;  3GJX B;  3HO8 A;  4C5C A;  3TY9 A;  1V9P A;  2Q2T A;  2DWC A;  2HHF A;  2COG A;  1UC8 A;  3BG5 A;  5I5T A;  4O84 A;  1VBG A;  4Q4D A;  2YZM A;  3PN1 A;  2OLS A;  2YS6 A;  2V5A A;  1Z2N X;  1DV2 A;  5JVD F;  2W6Q A;  5FPR A;  5BYB A;  1IYE A;  1JDB B;  3MJF A;  3MWD A;  4DLK A;  5I47 A;  3KAJ A;  3U54 A;  3LWB A;  3UZO A;  4JXU A;  2R7N A;  2HDK A;  3V4Z A;  1C30 A;  3GDE A;  1C3O A;  1EUC B;  3W1G A;  4CC5 A;  4C5A A;  3R9R A;  3KAK A;  2CNV A;  2R7K A;  1Z2O X;  1EKV A;  4CKC A;  5BPF A;  1ULZ A;  3ETJ A;  3LUL A;  3K5I A;  2DAB A;  3T9F A;  1VKZ A;  5LOV F;  3HT5 A;  2X0S A;  5K3W A;  4FFL A;  5C1P A;  3WWI A;  2FP4 B;  3RR5 A;  4EGJ A;  2HIV A;  4I55 F;  3WO1 A; 
#chains in the Genus database with same CATH homology
 4NZM A;  5E25 A;  3SGI A;  3T9E A;  3T7A A;  1EKP A;  4WHX A;  1A3G A;  2X5R A;  5CE8 A;  2QB5 A;  1G2W A;  1ZAU A;  3BAC A;  1I1L A;  1WRV A;  3CEB A;  5I5W A;  2EIY A;  4CKB A;  1I1K A;  5BWR A;  4CE5 A;  2ODT X;  1EKF A;  4DAA A;  3DAA A;  1KTA A;  3LQS A;  5I60 A;  1UC9 A;  4CKE A;  3T9C A;  5I5Y A;  3TW7 A;  2ABJ A;  5CR5 A;  4DQN A;  2COJ A;  4M0J A;  3WWJ A;  2Q7D A;  5HNE A;  2EJ2 A;  1KT8 A;  2HHF B;  3UYY A;  3CSW A;  5BWT A;  5DGH A;  5BYA A;  5I5V A;  4K6N A;  3TEK A;  2HGX A;  5BWU A;  5K2M A;  5I5X A;  2EJ0 A;  1A0G A;  3T9A A;  4CHI A;  5BWW A;  2DAA A;  3VPD A;  3T54 A;  4TM5 A;  4TVI A;  5DAA A;  2Y4R A;  4IWX A;  4Q4C A;  1I2K A;  4RCN A;  4PBC A;  5KS8 A;  4UUG A;  4CMD A;  3T9D A;  2HHF A;  2COG A;  3DTG A;  1UC8 A;  4IWY A;  5I5T A;  3QQM A;  1I1M A;  4Q4D A;  4CMF A;  4GLW A;  5BYB A;  1IYE A;  3JZ6 A;  5I47 A;  2EJ3 A;  3UZO A;  4JXU A;  2HDK A;  3T9B A;  2ZGI A;  3T99 A;  2COI A;  3UZB A;  5BWX A;  2HGW A;  1EKV A;  2A1H A;  4NZO A;  5I5U A;  5BWV A;  3U0G A;  4CKC A;  5DGI A;  3SNO A;  5FR9 A;  3LUL A;  5CM0 A;  2DAB A;  3WWH A;  3T9F A;  3PFF A;  3HT5 A;  5K3W A;  1I2L A;  3DTF A;  3WWI A;  2HG8 A;  1DAA A;  1ET0 A;  4NZN A;  1IYD A;  4HN2 A;  5I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...