4UUGA

The (r)-selective amine transaminase from aspergillus fumigatus with inhibitor bound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
320
structure length
320
Chain Sequence
ASMDKVFSGYYARQKLLERSDNPFSKGIAYVEGKLVLPSDARIPLLDEGFMHSDLTYDVISVWDGRFFRLDDHLQRILESCDKMRLKFPLALSSVKNILAEMVAKSGIRDAFVEVIVTRGLTGVRGSKPEDLYNNNIYLLVLPYIWVMAPENQLHGGEAIITRTVRRTPPGAFDPTIKNLQWGDLTKGLFEAMDRGATYPFLTDGDTNLTEGSGFNIVLVKNGIIYTPDRGVLRGITRKSVIDVARANSIDIRLEVVPVEQAYHSDEIFMCTTAGGIMPITLLDGQPVNDGQVGPITKKIWDGYWEMHYNPAYSFPVDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Dual Substrate Recognition of the (R)-Selective Amine Transaminase from Aspergillus Fumigatus
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Transferase
molecule keywords AMINE TRANSAMINASE
total genus 104
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 4uugA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 4uugA01
4JXUA 2HGWA 2COIA 1G2WA 5I5SA 4CE5A 5BWWA 2COGA 5BWRA 4M0JA 3SNOA 5BWVA 2Y4RA 5CE8A 2ZGIA 3DAAA 3LULA 3UZOA 1I2LA 3HT5A 5I5VA 1EKPA 2A1HA 5HNEA 3CSWA 3U0GA 1WRVA 3DTGA 5DAAA 1I1LA 3JZ6A 4PBCA 1DAAA 4UUGA 4WHXA 4DAAA 5BWTA 5I60A 1A3GA 3LQSA 4TVIA 5FR9A 3CEBA 1IYDA 1A0GA 1KT8A 1I2KA 5CR5A 1I1KA 3UYYA 2EJ0A 5BWXA 1EKFA 4TM5A 1EKVA 1IYEA 3UZBA 3WWHA 5K3WA 5I5UA 3DTFA 2EJ2A 2HHFB 1ET0A 5CM0A 5I5YA 5I5XA 2HHFA 4CHIA 2HGXA 2DABA 5BWUA 1KTAA 1I1MA 5I5TA 2COJA 2EJ3A 4CMFA 2ABJA 2HDKA 4K6NA 3WWIA 2EIYA 5E25A 2DAAA 5I5WA 2HG8A 4DQNA 3QQMA 3WWJA 4CMDA
chains in the Genus database with same CATH superfamily
3TEKA 3GB8B 4O7YA 2HIVA 2R7MA 2COIA 4CC6A 3N8DA 3Q2OA 1GGOA 4MA5A 3L2PA 1CKMA 5CA1F 4FFNA 3ORRA 4YJ3F 1ULZA 3NBZB 4TUYF 3G8CA 3BG5A 3T9CA 2YS7A 2I80A 1JDBB 4FU0A 4O4IF 4YAKB 4NZMA 2ODTX 2Y4RA 5CE8A 1B04A 3BAAA 3BACA 3SGIA 3DAAA 3LULA 1EKPA 2A1HA 5HNEA 5JQWA 4O83A 4IHJF 1CQJB 2R7KA 4Y8VB 3T54A 5JVDF 4FFPA 1KEEA 3HO8A 2HVRA 1DAAA 4UUGA 1Z2PX 5BWTA 2Z04A 2R86A 4M9UA 3ORQA 5I60A 4FFMA 4YB8B 1DV2A 2W6MA 5DGIA 2OLSA 4UCTA 1XK5A 3R5FA 5BMVF 5K2MA 1JKJB 4LH7A 1I2KA 4HN2A 1EYZA 4IWXA 3UYYA 4UCRA 2GLTA 2PBZA 1CS0A 3U9TA 1VBHA 2V59A 4TV8F 3MWEA 3T7AA 2R85A 4FE2A 2FPGB 4CKBA 2YRXA 1CQIB 2J9GA 3HB9A 1DV1A 4MAMA 5FPOA 3AX6A 1IYEA 4IZOA 4UCOA 2Q7DA 1KJ9A 3UZBA 2V58A 5K3WA 3HBLA 2GPWA 4ZI7F 3KYHC 3OUUA 1P16A 2HGXA 2DABA 1ZAUA 1CE8A 1OBGA 2DLNA 1W93A 4O7ZA 4O4JF 2HJWA 4YAJB 3MJFA 3GLKA 2EJ3A 1CKNB 3KREA 2YZLA 3T9AA 2ABJA 4O4LF 2QF7A 2HIXA 4DRFA 2EIYA 2YYAA 2VR1A 4DQNA 3RUPA 1TA8A 2FPIB 4UFZA 3WWJA 1B6RA 3MWDA 4XYMB 1A9XA 3T9FA 4YJ2F 4O7TA 1WR2A 4E4TA 3TIIA 2X0SA 3LWBA 4FFLA 3BABA 4CC5A 3QFFA 3WNZA 2HGSA 5BWRA 4M0JA 2I8CA 4HQ6A 1Z2NX 4E6NA 4MV3A 2PVPA 4O81A 3SNOA 5BWVA 3JSNA 2C00A 3W5OA 1V9PA 3R23A 2DZDA 5CA0F 4LH6A 1CKNA 3TIGA 5KKNB 4MV9A 2YWVA 2CNUA 4ZHQF 2V5AA 2W6PA 3ETHA 3RFCA 3DTGA 3G8DA 5DAAA 3GDEA 4I55F 1I1LA 3JZ6A 4FGRA 5I47A 1VBGA 4I4TF 3WO0A 2Z02A 4DLKA 4XX0B 4L1KA 3VNNA 4TVIA 3V4ZA 2YZNA 1AUXA 5C1OA 4RCNA 2HVQA 5DGHA 2DWCA 3S24A 5CR5A 1C30A 3RR5A 4MV6A 4RZQA 2VUGA 4UCVA 2R87A 3KALA 2R7NA 1JLLB 3VMMA 4NZNA 3NC0B 1EKFA 4EQ5A 3T99A 4HR7A 4TM5A 5LA6F 5J2UF 1C3OA 2QB5A 1EUCB 3TW7A 5JQGF 2P0AA 2CNVA 4FFOA 3BA8A 3DTFA 1KJIA 1VS0A 4CKEA 2EJ2A 1ET0A 5BPFA 2OWOA 5I5YA 2W6NA 4O7SA 5IYZF 3RV3A 4TV9F 5LOVF 5LXTF 5D8DA 2YZMA 2ZDGA 4CMFA 2HDKA 3VPDA 2W70A 5I5WA 3KAKA 1IYDA 2R84A 4CMDA 3GIDA 4DIMA 4O86A 1GLVA 1G2WA 5I5SA 4EGQA 2FB9A 4NZOA 4O7VA 2NU9B 2NU8B 3N6RA 2COGA 3UQ8A 5BYAA 2YS6A 5HV6A 1PX2A 3JRXA 2YZGA 1A48A 4O82A 4O7WA 3U54A 3UZOA 1KJJA 3HT5A 1IOVA 4O2AF 1FVIA 1BNCA 3TY5A 3ETJA 3U0GA 3K5HA 4FFRA 4UCSA 3JRWA 4UCUA 1I7NA 4MV4A 5D1OA 1GSHA 4WHXA 2FP4B 5KS8A 3WO1A 3GJXB 1E4EA 1SCUB 4CKCA 3E5NA 4PZ8A 5DISC 3NBYB 3LQSA 4EEQA 4ME6A 3TY9A 5FR9A 5KX5F 3T9BA 4MV8A 3JZFA 1KT8A 1EZ1A 2W6OA 1I1KA 2EJ0A 3UFXB 3K5IA 4WBNF 2W6QA 3VOTA 2PN1A 3K3PA 2W71A 3RV4A 1A0IA 1EKVA 1P8LA 2QK4A 2YW2A 4O2BF 1B6SA 4C5CA 3Q1KA 5CB4F 2FPPB 4PZ6A 3DF7A 1E4EB 1W96A 5H80A 4IIJF 1DGSA 2CNQA 2HHFB 2R82A 2Q2TA 5CM0A 4ZOLF 2ZDQA 2HHFA 2XD4A 2NUAB 4CHIA 4XZ3B 5C1PA 2IP4A 2CFMA 1GSOA 5BWUA 5I5TA 1I1MA 2W6ZA 5C8YF 2COJA 3U55A 1I7LA 4QSHA 1X9NA 3I12A 3R9RA 4HNVA 2R7LA 3KAJA 1KJ8A 4K6NA 1PK8A 4NYEA 2DAAA 1EHIA 2GQRA 4I50F 4C5BA 3QQMA 3OUZA 4IWYA 3BA9A 4C5AA 4O7RA 4JXUA 1DIKA 2DIKA 2HGWA 2YRWA 4Q4CA 1GSAA 1KJQA 3PN1A 4CE5A 3R5HA 4EFBA 5BWWA 1VKZA 2I87A 1KBLA 4EGJA 4MV1A 4MV7A 3SE7A 4ZQIA 3TQTA 2NU7B 1S68A 5CAEB 3T9EA 5JVLA 4O7NA 3LP8A 3U9SA 3TY8A 2ZGIA 2VQDA 5I5VA 1I2LA 4HNTA 4MA0A 1KC7A 2SCUB 3CSWA 3RTXA 3R5XA 1WRVA 5DMXA 4PZ7A 1JDEA 3QWUA 1M6VA 4O7LA 1BXRA 4PBCA 4GLWA 4DAAA 3JSLA 5BPHA 1M0TA 1M0WA 1AUVA 3T9DA 1A3GA 5D1PA 1KUTA 3NUAA 2GPSA 3TW6A 1UC8A 5LP6F 3CEBA 2CZGA 1A0GA 1EUDB 3VA7A 4EG0A 2XCLA 2HVSA 1OBDA 2WYOA 1IOWA 5BWXA 2ZDHA 3W1BA 5JH7F 3JZIA 4GLXA 5EZYF 2X5RA 2YL2A 1Z2OX 4HNUA 5LYJF 5HBRB 4EFEA 3WWHA 4O4HF 2GQSA 3AW8A 3VPBA 5I5UA 3TINA 1CKOA 4XYLB 4O84A 5I5XA 2Q2UA 5FNVF 4Q4DA 1XDNA 5BYBA 3W1GA 1KTAA 2NU6B 3VPCA 2VPQA 3PFFA 3V4SA 5FPRA 1TAEA 5J2TF 1T36A 3WWIA 5GONF 5E25A 4YBZB 2HG8A 1UC9A 5D1OB
chains in the Genus database with same CATH topology
3TEKA 4JXUA 2HGWA 2COIA 4Q4CA 3T9FA 1G2WA 5I5SA 4CE5A 4NZOA 5BWWA 2COGA 5BWRA 4M0JA 5BYAA 3T9CA 3SNOA 5BWVA 4NZMA 3T9EA 2ODTX 2Y4RA 5CE8A 3BACA 3SGIA 2ZGIA 3DAAA 3LULA 3UZOA 1I2LA 3HT5A 5I5VA 1EKPA 2A1HA 5HNEA 3CSWA 3U0GA 1WRVA 3DTGA 5DAAA 3T54A 1I1LA 3JZ6A 4PBCA 1DAAA 4UUGA 4WHXA 4DAAA 5BWTA 4GLWA 5I47A 5KS8A 3T9DA 4CKCA 5I60A 1A3GA 3LQSA 4TVIA 5DGIA 1UC8A 5FR9A 3CEBA 1IYDA 3T9BA 4RCNA 5K2MA 1A0GA 1KT8A 5DGHA 1I2KA 5CR5A 4HN2A 1I1KA 4IWXA 3UYYA 2EJ0A 5BWXA 3T7AA 4NZNA 4CKBA 1EKFA 3T99A 4TM5A 1EKVA 2X5RA 1IYEA 2Q7DA 2QB5A 3UZBA 3TW7A 3WWHA 5K3WA 5I5UA 3DTFA 4IWYA 4CKEA 2EJ2A 2HHFB 1ET0A 5CM0A 5I5YA 5I5XA 2HHFA 4CHIA 2HGXA 2DABA 1ZAUA 4Q4DA 5BWUA 5BYBA 1KTAA 1I1MA 5I5TA 2COJA 3PFFA 2EJ3A 3T9AA 4CMFA 2ABJA 2HDKA 3VPDA 4K6NA 3WWIA 2EIYA 5E25A 2DAAA 5I5WA 2HG8A 4DQNA 1UC9A 3QQMA 3WWJA 4CMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXU A;  2HGW A;  2COI A;  1G2W A;  5I5S A;  4CE5 A;  5BWW A;  2COG A;  5BWR A;  4M0J A;  3SNO A;  5BWV A;  2Y4R A;  5CE8 A;  2ZGI A;  3DAA A;  3LUL A;  3UZO A;  1I2L A;  3HT5 A;  5I5V A;  1EKP A;  2A1H A;  5HNE A;  3CSW A;  3U0G A;  1WRV A;  3DTG A;  5DAA A;  1I1L A;  3JZ6 A;  4PBC A;  1DAA A;  4UUG A;  4WHX A;  4DAA A;  5BWT A;  5I60 A;  1A3G A;  3LQS A;  4TVI A;  5FR9 A;  3CEB A;  1IYD A;  1A0G A;  1KT8 A;  1I2K A;  5CR5 A;  1I1K A;  3UYY A;  2EJ0 A;  5BWX A;  1EKF A;  4TM5 A;  1EKV A;  1IYE A;  3UZB A;  3WWH A;  5K3W A;  5I5U A;  3DTF A;  2EJ2 A;  2HHF B;  1ET0 A;  5CM0 A;  5I5Y A;  5I5X A;  2HHF A;  4CHI A;  2HGX A;  2DAB A;  5BWU A;  1KTA A;  1I1M A;  5I5T A;  2COJ A;  2EJ3 A;  4CMF A;  2ABJ A;  2HDK A;  4K6N A;  3WWI A;  2EIY A;  5E25 A;  2DAA A;  5I5W A;  2HG8 A;  4DQN A;  3QQM A;  3WWJ A;  4CMD A; 
#chains in the Genus database with same CATH topology
 3TEK A;  3GB8 B;  4O7Y A;  2HIV A;  2R7M A;  2COI A;  4CC6 A;  3N8D A;  3Q2O A;  1GGO A;  4MA5 A;  3L2P A;  1CKM A;  5CA1 F;  4FFN A;  3ORR A;  4YJ3 F;  1ULZ A;  3NBZ B;  4TUY F;  3G8C A;  3BG5 A;  3T9C A;  2YS7 A;  2I80 A;  1JDB B;  4FU0 A;  4O4I F;  4YAK B;  4NZM A;  2ODT X;  2Y4R A;  5CE8 A;  1B04 A;  3BAA A;  3BAC A;  3SGI A;  3DAA A;  3LUL A;  1EKP A;  2A1H A;  5HNE A;  5JQW A;  4O83 A;  4IHJ F;  1CQJ B;  2R7K A;  4Y8V B;  3T54 A;  5JVD F;  4FFP A;  1KEE A;  3HO8 A;  2HVR A;  1DAA A;  4UUG A;  1Z2P X;  5BWT A;  2Z04 A;  2R86 A;  4M9U A;  3ORQ A;  5I60 A;  4FFM A;  4YB8 B;  1DV2 A;  2W6M A;  5DGI A;  2OLS A;  4UCT A;  1XK5 A;  3R5F A;  5BMV F;  5K2M A;  1JKJ B;  4LH7 A;  1I2K A;  4HN2 A;  1EYZ A;  4IWX A;  3UYY A;  4UCR A;  2GLT A;  2PBZ A;  1CS0 A;  3U9T A;  1VBH A;  2V59 A;  4TV8 F;  3MWE A;  3T7A A;  2R85 A;  4FE2 A;  2FPG B;  4CKB A;  2YRX A;  1CQI B;  2J9G A;  3HB9 A;  1DV1 A;  4MAM A;  5FPO A;  3AX6 A;  1IYE A;  4IZO A;  4UCO A;  2Q7D A;  1KJ9 A;  3UZB A;  2V58 A;  5K3W A;  3HBL A;  2GPW A;  4ZI7 F;  3KYH C;  3OUU A;  1P16 A;  2HGX A;  2DAB A;  1ZAU A;  1CE8 A;  1OBG A;  2DLN A;  1W93 A;  4O7Z A;  4O4J F;  2HJW A;  4YAJ B;  3MJF A;  3GLK A;  2EJ3 A;  1CKN B;  3KRE A;  2YZL A;  3T9A A;  2ABJ A;  4O4L F;  2QF7 A;  2HIX A;  4DRF A;  2EIY A;  2YYA A;  2VR1 A;  4DQN A;  3RUP A;  1TA8 A;  2FPI B;  4UFZ A;  3WWJ A;  1B6R A;  3MWD A;  4XYM B;  1A9X A;  3T9F A;  4YJ2 F;  4O7T A;  1WR2 A;  4E4T A;  3TII A;  2X0S A;  3LWB A;  4FFL A;  3BAB A;  4CC5 A;  3QFF A;  3WNZ A;  2HGS A;  5BWR A;  4M0J A;  2I8C A;  4HQ6 A;  1Z2N X;  4E6N A;  4MV3 A;  2PVP A;  4O81 A;  3SNO A;  5BWV A;  3JSN A;  2C00 A;  3W5O A;  1V9P A;  3R23 A;  2DZD A;  5CA0 F;  4LH6 A;  1CKN A;  3TIG A;  5KKN B;  4MV9 A;  2YWV A;  2CNU A;  4ZHQ F;  2V5A A;  2W6P A;  3ETH A;  3RFC A;  3DTG A;  3G8D A;  5DAA A;  3GDE A;  4I55 F;  1I1L A;  3JZ6 A;  4FGR A;  5I47 A;  1VBG A;  4I4T F;  3WO0 A;  2Z02 A;  4DLK A;  4XX0 B;  4L1K A;  3VNN A;  4TVI A;  3V4Z A;  2YZN A;  1AUX A;  5C1O A;  4RCN A;  2HVQ A;  5DGH A;  2DWC A;  3S24 A;  5CR5 A;  1C30 A;  3RR5 A;  4MV6 A;  4RZQ A;  2VUG A;  4UCV A;  2R87 A;  3KAL A;  2R7N A;  1JLL B;  3VMM A;  4NZN A;  3NC0 B;  1EKF A;  4EQ5 A;  3T99 A;  4HR7 A;  4TM5 A;  5LA6 F;  5J2U F;  1C3O A;  2QB5 A;  1EUC B;  3TW7 A;  5JQG F;  2P0A A;  2CNV A;  4FFO A;  3BA8 A;  3DTF A;  1KJI A;  1VS0 A;  4CKE A;  2EJ2 A;  1ET0 A;  5BPF A;  2OWO A;  5I5Y A;  2W6N A;  4O7S A;  5IYZ F;  3RV3 A;  4TV9 F;  5LOV F;  5LXT F;  5D8D A;  2YZM A;  2ZDG A;  4CMF A;  2HDK A;  3VPD A;  2W70 A;  5I5W A;  3KAK A;  1IYD A;  2R84 A;  4CMD A;  3GID A;  4DIM A;  4O86 A;  1GLV A;  1G2W A;  5I5S A;  4EGQ A;  2FB9 A;  4NZO A;  4O7V A;  2NU9 B;  2NU8 B;  3N6R A;  2COG A;  3UQ8 A;  5BYA A;  2YS6 A;  5HV6 A;  1PX2 A;  3JRX A;  2YZG A;  1A48 A;  4O82 A;  4O7W A;  3U54 A;  3UZO A;  1KJJ A;  3HT5 A;  1IOV A;  4O2A F;  1FVI A;  1BNC A;  3TY5 A;  3ETJ A;  3U0G A;  3K5H A;  4FFR A;  4UCS A;  3JRW A;  4UCU A;  1I7N A;  4MV4 A;  5D1O A;  1GSH A;  4WHX A;  2FP4 B;  5KS8 A;  3WO1 A;  3GJX B;  1E4E A;  1SCU B;  4CKC A;  3E5N A;  4PZ8 A;  5DIS C;  3NBY B;  3LQS A;  4EEQ A;  4ME6 A;  3TY9 A;  5FR9 A;  5KX5 F;  3T9B A;  4MV8 A;  3JZF A;  1KT8 A;  1EZ1 A;  2W6O A;  1I1K A;  2EJ0 A;  3UFX B;  3K5I A;  4WBN F;  2W6Q A;  3VOT A;  2PN1 A;  3K3P A;  2W71 A;  3RV4 A;  1A0I A;  1EKV A;  1P8L A;  2QK4 A;  2YW2 A;  4O2B F;  1B6S A;  4C5C A;  3Q1K A;  5CB4 F;  2FPP B;  4PZ6 A;  3DF7 A;  1E4E B;  1W96 A;  5H80 A;  4IIJ F;  1DGS A;  2CNQ A;  2HHF B;  2R82 A;  2Q2T A;  5CM0 A;  4ZOL F;  2ZDQ A;  2HHF A;  2XD4 A;  2NUA B;  4CHI A;  4XZ3 B;  5C1P A;  2IP4 A;  2CFM A;  1GSO A;  5BWU A;  5I5T A;  1I1M A;  2W6Z A;  5C8Y F;  2COJ A;  3U55 A;  1I7L A;  4QSH A;  1X9N A;  3I12 A;  3R9R A;  4HNV A;  2R7L A;  3KAJ A;  1KJ8 A;  4K6N A;  1PK8 A;  4NYE A;  2DAA A;  1EHI A;  2GQR A;  4I50 F;  4C5B A;  3QQM A;  3OUZ A;  4IWY A;  3BA9 A;  4C5A A;  4O7R A;  4JXU A;  1DIK A;  2DIK A;  2HGW A;  2YRW A;  4Q4C A;  1GSA A;  1KJQ A;  3PN1 A;  4CE5 A;  3R5H A;  4EFB A;  5BWW A;  1VKZ A;  2I87 A;  1KBL A;  4EGJ A;  4MV1 A;  4MV7 A;  3SE7 A;  4ZQI A;  3TQT A;  2NU7 B;  1S68 A;  5CAE B;  3T9E A;  5JVL A;  4O7N A;  3LP8 A;  3U9S A;  3TY8 A;  2ZGI A;  2VQD A;  5I5V A;  1I2L A;  4HNT A;  4MA0 A;  1KC7 A;  2SCU B;  3CSW A;  3RTX A;  3R5X A;  1WRV A;  5DMX A;  4PZ7 A;  1JDE A;  3QWU A;  1M6V A;  4O7L A;  1BXR A;  4PBC A;  4GLW A;  4DAA A;  3JSL A;  5BPH A;  1M0T A;  1M0W A;  1AUV A;  3T9D A;  1A3G A;  5D1P A;  1KUT A;  3NUA A;  2GPS A;  3TW6 A;  1UC8 A;  5LP6 F;  3CEB A;  2CZG A;  1A0G A;  1EUD B;  3VA7 A;  4EG0 A;  2XCL A;  2HVS A;  1OBD A;  2WYO A;  1IOW A;  5BWX A;  2ZDH A;  3W1B A;  5JH7 F;  3JZI A;  4GLX A;  5EZY F;  2X5R A;  2YL2 A;  1Z2O X;  4HNU A;  5LYJ F;  5HBR B;  4EFE A;  3WWH A;  4O4H F;  2GQS A;  3AW8 A;  3VPB A;  5I5U A;  3TIN A;  1CKO A;  4XYL B;  4O84 A;  5I5X A;  2Q2U A;  5FNV F;  4Q4D A;  1XDN A;  5BYB A;  3W1G A;  1KTA A;  2NU6 B;  3VPC A;  2VPQ A;  3PFF A;  3V4S A;  5FPR A;  1TAE A;  5J2T F;  1T36 A;  3WWI A;  5GON F;  5E25 A;  4YBZ B;  2HG8 A;  1UC9 A;  5D1O B; 
#chains in the Genus database with same CATH homology
 3TEK A;  4JXU A;  2HGW A;  2COI A;  4Q4C A;  3T9F A;  1G2W A;  5I5S A;  4CE5 A;  4NZO A;  5BWW A;  2COG A;  5BWR A;  4M0J A;  5BYA A;  3T9C A;  3SNO A;  5BWV A;  4NZM A;  3T9E A;  2ODT X;  2Y4R A;  5CE8 A;  3BAC A;  3SGI A;  2ZGI A;  3DAA A;  3LUL A;  3UZO A;  1I2L A;  3HT5 A;  5I5V A;  1EKP A;  2A1H A;  5HNE A;  3CSW A;  3U0G A;  1WRV A;  3DTG A;  5DAA A;  3T54 A;  1I1L A;  3JZ6 A;  4PBC A;  1DAA A;  4UUG A;  4WHX A;  4DAA A;  5BWT A;  4GLW A;  5I47 A;  5KS8 A;  3T9D A;  4CKC A;  5I60 A;  1A3G A;  3LQS A;  4TVI A;  5DGI A;  1UC8 A;  5FR9 A;  3CEB A;  1IYD A;  3T9B A;  4RCN A;  5K2M A;  1A0G A;  1KT8 A;  5DGH A;  1I2K A;  5CR5 A;  4HN2 A;  1I1K A;  4IWX A;  3UYY A;  2EJ0 A;  5BWX A;  3T7A A;  4NZN A;  4CKB A;  1EKF A;  3T99 A;  4TM5 A;  1EKV A;  2X5R A;  1IYE A;  2Q7D A;  2QB5 A;  3UZB A;  3TW7 A;  3WWH A;  5K3W A;  5I5U A;  3DTF A;  4IWY A;  4CKE A;  2EJ2 A;  2HHF B;  1ET0 A;  5CM0 A;  5I5Y A;  5I5X A;  2HHF A;  4CHI A;  2HGX A;  2DAB A;  1ZAU A;  4Q4D A;  5BWU A;  5BYB A;  1KTA A;  1I1M A;  5I5T A;  2COJ A;  3PFF A;  2EJ3 A;  3T9A A;  4CMF A;  2ABJ A;  2HDK A;  3VPD A;  4K6N A;  3WWI A;  2EIY A;  5E25 A;  2DAA A;  5I5W A;  2HG8 A;  4DQN A;  1UC9 A;  3QQM A;  3WWJ A;  4CMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...