4YAJB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (apo form)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acetyl-coenzyme A synthetase (dinucleotide-
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum opf8
molecule tags Ligase
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yajB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yajB02
1UC9A 3G8CA 4FFPA 4DIMA 3LP8A 1OBDA 2CNVA 3I12A 2YZMA 2W6QA 5CB4F 2I8CA 2NU8B 3UFXB 3JRXA 1A48A 4MV1A 3U9TA 4XX0B 3R9RA 5JQGF 2ZDHA 1E4EA 2YS7A 2DWCA 4XZ3B 4O81A 4TV9F 2FP4B 1CE8A 4O7NA 2PVPA 5DMXA 3K5IA 5GONF 2R86A 2R7MA 1C3OA 2GQRA 3U54A 4HNTA 1GSOA 4YJ3F 2W6OA 4C5AA 4MV9A 3BG5A 5BPHA 1UC8A 1KC7A 4IIJF 3RV3A 4O4LF 4IWYA 2I80A 2YYAA 3R5HA 3N8DA 1JDEA 4O83A 4IHJF 2VR1A 3JZIA 1JLLB 3K3PA 2FPGB 2VQDA 4YJ2F 3WNZA 3V4ZA 2CNUA 3KAJA 1A9XA 4YB8B 1T36A 2YRXA 4MV7A 3JRWA 2DLNA 4DLKA 2DZDA 3ORRA 4HR7A 3RV4A 2YW2A 3KALA 1BNCA 5I47A 4YBZB 5LYJF 2W6ZA 3VA7A 4NYEA 3Q1KA 2HGSA 4MA5A 4XYLB 3VPCA 1EHIA 1PK8A 1M0WA 5LA6F 2FB9A 5LXTF 3ETJA 5LOVF 2VPQA 2YZGA 1KUTA 4ME6A 1KJ9A 2R7NA 2GQSA 4FFMA 4MAMA 4YAJB 4O4HF 3MWEA 4O4JF 4EG0A 5LP6F 5JH7F 2W6MA 5KX5F 5K2MA 3HB9A 1KBLA 3R23A 3VOTA 5CAEB 4FE2A 5C8YF 3AW8A 2QK4A 2R82A 1EUCB 2IP4A 4MV6A 3E5NA 4ZQIA 4IZOA 4MV4A 4O2AF 4RZQA 4HQ6A 1WR2A 1JKJB 5D8DA 2W70A 1ULZA 2WYOA 3TIGA 4O7SA 4MV3A 2PBZA 2R6FA 3HBLA 4C5BA 2R84A 2NU6B 1EZ1A 5J2TF 4L1KA 5JQWA 4O7ZA 3DF7A 4HNUA 4O7WA 1KJJA 2ZDQA 3NUAA 4O7RA 4IWXA 2QF7A 2GLTA 4Y8VB 5FNVF 4EGJA 1BXRA 3OUUA 1KJ8A 4FGRA 1Z2NX 2ZDGA 4FU0A 3ETHA 1DIKA 5EZYF 5CA1F 2I87A 4WD3A 1W93A 2PN1A 2SCUB 4I50F 4EGQA 3KREA 2XD4A 1AUXA 2R7LA 2FPPB 1CS0A 2GPWA 1I7LA 3VPBA 2C00A 1W96A 2XCLA 1KJQA 4O82A 3ORQA 3N6RA 3VPDA 3TW6A 5CA0F 1OBGA 2V5AA 2CNQA 4O7LA 3RUPA 5JVLA 1JDBB 4XYMB 2NU9B 5H80A 4WBNF 1B6SA 3KAKA 3QFFA 4M9UA 4FFRA 1IOVA 4FFOA 3LWBA 1IOWA 3OUZA 4O84A 1EUDB 4O4IF 2R87A 2FPIB 3WO1A 2YZLA 2DIKA 2YRWA 1CQIB 1KJIA 2P0AA 1EYZA 2GPSA 2YWVA 5KKNB 2CZGA 1VBGA 3TINA 2R7KA 3AX6A 1M0TA 5C1OA 2V58A 1M6VA 4I4TF 3HO8A 2CQYA 2Z04A 1E4EB 4C5CA 3Q2OA 4FFNA 4O7TA 3TIIA 2W6PA 4TV8F 1GLVA 3R5FA 3R5XA 4O7YA 2YS6A 1DV2A 2W6NA 3U9SA 1C30A 3SE7A 5BPFA 3MWDA 1I7NA 2J9GA 1CQJB 4O2BF 2NU7B 1Z2OX 1VBHA 1DV1A 5J2UF 4O86A 3V4SA 3JZFA 1GSAA 3K5HA 4YAKB 1AUVA 1B6RA 2R85A 4MA0A 2NUAB 3WO0A 2YZNA 3RFCA 2W71A 2X0SA 4I55F 2HJWA 5C1PA 2OLSA 3TQTA 3G8DA 1VKZA 3GLKA 3GIDA 5IYZF 1GGOA 4ZI7F 4ZHQF 1PX2A 4ZOLF 1Z2PX 4E4TA 4MV8A 4TUYF 2V59A 5HBRB 3VMMA 3U55A 5BMVF 4O7VA 3MJFA 2Z02A 5JVDF 4FFLA 4HNVA 1KEEA 4QSHA 1SCUB 5HV6A 2YL2A 1GSHA
chains in the Genus database with same CATH superfamily
1UC9A 5DG7A 3G8CA 4DR7H 4CHIA 4UCTA 2Y0SA 4LF6H 3NGDA 3G6YA 1P8LA 4FFPA 5KFXA 4Q44A 4ECYA 4DIMA 1BJTA 4LF8H 2R8JA 4B3RH 2UXCH 2FK3A 3LP8A 1RK5A 3T5HA 3HOXG 1OBDA 4U7CA 3RF2A 2DAAA 4DL3A 2CNVA 4DL4A 4CMDA 3I12A 3T9BA 3T5LA 3EPIA 1XK5A 4RCNA 2YZMA 2W6QA 5CB4F 4RZRA 4QWCA 2DPJA 5KFPA 2VUGA 2I8CA 2MCTA 2JA7A 1E4FT 4YR2A 2NU8B 4QWAA 4NXMH 5KFDA 2A1HA 3N6XA 4ED8A 4IRCA 3UFXB 5CM0A 3JRXA 1A48A 3T7AA 5KFNA 3J7AK 4MV1A 3RB0A 2Y0SE 1FKAH 3RTXA 1DGSA 3U9TA 4XX0B 3KHRA 4JYAH 3R9RA 5JQGF 2Q2UA 2ZDHA 5KG1A 1E4EA 5IYBG 3QZ7A 4A3DG 5CR5A 5DGIA 2YS7A 3L4KA 2DWCA 2JA7G 5KT5A 4XZ3B 4O81A 4R8UB 4TV9F 2FP4B 1CE8A 4O7NA 5KFJA 2PVPA 5DMXA 5BWUA 2J6SA 2EJ2A 5KFZA 1FVIA 3K5IA 5GONF 5BWXA 2R86A 2R7MA 1C3OA 2GQRA 5KFCA 5LMUH 3T54A 3U54A 1ZQ7A 4A3JG 4HNTA 5KFFA 4ECRA 1GSOA 4YJ3F 2DABA 2FLPA 1I50A 2EIYA 4PBCA 5DQIA 1N32H 1TWHA 3RR5A 4Q0YA 2HHFB 2W6OA 4C2MA 4JV2A 4C5AA 2UVUA 4MV9A 3BG5A 5BPHA 2W8LA 1UC8A 3KXYT 4NZNA 2COGA 4WHXA 1KC7A 5KFGA 2W9BB 1X9NA 4IIJF 4I7HA 4O3NA 3RV3A 4UCVA 1V51A 4QWEA 2HVRA 5EWFA 1V9PA 4IWYA 4O4LF 2I80A 1VAJA 4J0MA 4NLGA 3T9DA 3RBDA 2AGQA 4YHHH 2YYAA 4O3QA 4LF5H 3R5HA 3N8DA 1WH2A 3W1GA 4NXNH 1IBKH 5CE8A 1JDEA 2E2HA 1S68A 4HYKA 3WWJA 4O83A 4ECZA 3Q8PB 4JI1H 4JI4H 4IHJF 4CKBA 5EWEA 4DR3H 4ED1A 2VR1A 4O3PA 5D1PA 4X66H 4ED7A 2BR0A 2UUCH 4LSXA 4ECUA 3JZIA 3J80W 5KFHA 4NZMA 4A2AA 4MTDA 5FPOA 1JLLB 3QWUA 2QB5A 3K3PA 4JI3H 2FPGB 2VQDA 4AYBA 5KFOA 4YJ2F 3WNZA 5DG9A 2C2RA 3V4ZA 1FJGH 2CNUA 3RAQA 3GIMA 2NVXA 3KAJA 5DGBA 4DUZH 1A9XA 4YB8B 1T36A 2YRXA 2UU9H 4MV7A 2VA3A 3EYYA 3JRWA 4UCUA 3FKIA 3MR3A 2DLNA 2VA2A 4DLKA 2DZDA 3V6KA 3H0GG 3ORRA 4HR7A 1KTAA 3RV4A 2ODTX 1AN7A 2YW2A 3KALA 3G6XA 1BNCA 2UVRA 5I47A 4ED6A 2ABJA 4YBZB 4IRKA 3I4MG 4PDBA 3LMLA 2FLNA 3T9AA 5FR9A 2Y4RA 5DISC 5LYJF 3OSPA 2W6ZA 2IBKA 3VA7A 4NYEA 4DV3H 3Q1KA 3RIZA 1CKMA 2HGSA 4MA5A 4AYBE 4JI8H 1XMOH 4JV1A 4IRDA 2HVQA 5A2QW 3RB4A 4XYLB 3VPCA 5KG4A 4FS1A 2UUAH 4A3BG 1B04A 4K6NA 3BA9A 2FE3A 2CKZB 3GIJA 3GTOA 2UUBH 4RUCA 5L1JA 4DAAA 3MR6A 1EHIA 1PK8A 5DGAA 3BAAA 5KFAA 1M0WA 5LA6F 2IMWP 2FKLA 3PN1A 2FB9A 4PZ7A 5KFTA 2C28A 2WTFA 4LMYA 3N41B 1RYSA 4DR2H 4QWBA 1I1MA 1SYXB 5LXTF 1M7JA 2RF4A 3GV8B 3ETJA 4DL6A 1K1SA 1RK6A 3GTQA 5LOVF 5BWTA 3H20A 3T9FA 4BWSC 5KFQA 2VPQA 2YZGA 4DV2H 4LF9H 1KUTA 3QZ8A 2CW8A 4ME6A 1XMQH 1KJ9A 3HKZA 2R7NA 4LH6A 5D1OB 2GQSA 5BYAA 2DPIA 4A3LG 4YP3A 4DR6H 4FFMA 3T9CA 3V6JA 4MAMA 4YAJB 3MFHA 4EYIB 2ASJA 4B3TH 4DUYH 2JEFA 4O4HF 3MWEA 4O4JF 4EG0A 5LP6F 4J9NA 3GTLA 5JH7F 2XCPA 2W6MA 5KX5F 5EOYA 4YY3H 1VS0A 5K2MA 3HB9A 1KBLA 2XGQA 3R23A 3VOTA 5CAEB 2WB1A 4FE2A 1P16A 4Q8EA 1RJQA 5KFYA 4EEYA 5C8YF 4JUZA 5KT2A 3AW8A 4FM9A 3CSWA 2QK4A 4DL5A 4J9OA 4EQ5A 3Q8QB 2HIVA 2W9CB 2R82A 1EUCB 5I5UA 2IP4A 4MV6A 2XC9A 2E5LH 4CE5A 2RGRA 1B33N 3HKZE 3N42B 5KT4A 3E5NA 4ZQIA 2W8KA 2IA6A 4IZOA 3TEKA 5F9LA 3JSNA 5L1LA 4EFBA 3UZOA 5KG6A 3HOUG 2B63A 4LF4H 4LFCH 4MV4A 5KG2A 4O2AF 1IYEA 2W7OA 3M9OB 1ZETA 4DQNA 4RZQA 3BABA 3PW5A 5DQGA 2WB1E 3KHHA 4DV1H 4GKJH 3PVXA 1TA8A 2X5RA 2W7PA 4HQ6A 1WR2A 3BQ2A 1HNWH 1JKJB 3I4NG 5D8DA 2W70A 3T1YH 4LFAH 1ULZA 4BY1G 1V4YA 2XIGA 4OX9H 2WYOA 3TIGA 4O7SA 4MV3A 5BWVA 3SGIA 2PBZA 4QJFA 2R6FA 3VNNA 4R8UA 5IP9G 2ATLA 4G3IA 2B63G 3HBLA 4A2BA 4A3KG 3SI8A 5C44G 4C5BA 5L9XA 2R84A 3GV7B 1N34H 3QQMA 4NZOA 5DLGA 1IBLH 2NU6B 1RJPA 1EZ1A 3HOYG 4UCOA 5J2TF 2RDIA 4UUGA 2V4QA 2PMZA 4A3FG 4L1KA 5JQWA 4EFEA 4TQSA 4JI0H 4O7ZA 3DF7A 3UQ8A 2AGPA 3GV5B 4HNUA 2O03A 1I94H 4BY7G 3IN5A 1A0IA 4O7WA 2JEGA 4EEQA 1KJJA 2HHFA 2R92A 2ZDQA 3NUAA 5HNEA 4F4YA 4O7RA 2AU0A 4IWXA 2FMAA 5FLMG 3S24A 2UVVA 4IR1A 2QF7A 2GLTA 3W5OA 4Y8VB 5FNVF 4Q4CA 4EGJA 1HNZH 1BXRA 4A3CG 4HN2A 3OUUA 2HGXA 3EPGA 3T9EA 4UFZA 4DV0H 4GC6A 3T99A 1UNNC 1KJ8A 4FGRA 4U6PA 1Z2NX 4A3GG 1S03G 1TWFA 1A0GA 2ZGIA 4AQYH 2WDTA 4Q4DA 3HXLA 2ZDGA 1IBMH 2WAQA 2FJZA 4GLXA 2PMZE 2BQ3A 4MTEA 4DL2A 3HOVG 3BQ0A 1JXLA 5KG7A 3MR2A 4FU0A 3ETHA 1DIKA 3UZBA 3HOWG 5EZYF 5KT3A 1CKOA 4RNMA 1N36H 3PZPA 5CA1F 2I87A 4WD3A 1W93A 2PN1A 2SCUB 4I50F 4EGQA 4LF7H 1R9TA 3FDSA 4E6NA 4QW9A 1TAEA 3RAXA 4J9LA 4JI5H 4A3MG 1K83A 4O3SA 3KREA 1SEIA 4J9KA 4K0KH 2XD4A 1AUXA 2R7LA 2QYZA 2FPPB 3PR5B 1HNXH 2OWOA 3RJ0A 4J9MA 4ECSA 1CS0A 2GPWA 3M9NB 4FS2A 1I7LA 4Q8FA 3VPBA 2C00A 1S9FA 1W96A 4ECTA 4A3EG 2XCLA 5KFBA 3MWMA 4ECWA 3PW4A 1KJQA 4O82A 5FPRA 3ORQA 1GO3E 3FKIG 3GIQA 3N6RA 4QIWA 5KFVA 1OWTA 4APMA 3KHGA 3VPDA 1SFOA 4TVIA 3RB3A 2VQEH 2UXBH 3TW6A 5FLXW 5KFMA 1EKVA 5CA0F 5KFIA 1CKNB 2JA6A 4O3OA 4PZ6A 1OBGA 2V5AA 2CNQA 4O7LA 3NBYB 3RUPA 5JVLA 3F8NA 3H4DA 3GTJA 5T14A 1JDBB 2JA5A 4XYMB 3OHAA 2NU9B 3MR5A 3JAMW 5H80A 4WBNF 4F4WA 1B6SA 3H40A 5FD5A 5BWRA 5KFSA 3KAKA 4Q45A 4FBUA 4JXUA 3JZ6A 1ZHSA 4RB0A 3J81W 3QFFA 4EBCA 5KG3A 4M9UA 4A3IG 3GB8B 4BBRG 4FFRA 3GDEA 1EKFA 5L1IA 1IOVA 4GC7A 4DL7A 1S0NA 4FFOA 2JA6G 1ET0A 3LWBA 4EYHB 1IOWA 4QIWE 3OUZA 4O84A 2JEIA 3LQSA 2JA5G 1I6UA 4J9PA 5I5SA 1ZAUA 1EUDB 1WCMA 1GYFA 4JI6H 4O4IF 3K3VA 3N44B 2R87A 5JUMA 2FLLA 1RJRA 2YU9A 2FPIB 3HT5A 5KFWA 3W1BA 4QW8A 3WO1A 1JIHA 2YZLA 1ZHQA 5IWAH 2R93A 1Y1WA 2DIKA 3T1HH 2CW7A 3N40P 2YRWA 1G2WA 5KT7A 4BBSG 1CQIB 1S10A 2F4VH 4ED2A 2BQRA 4A93G 1KJIA 2P0AA 5D1OA 4DR5H 3SNOA 1EYZA 4LH7A 4ECQA 2R7ZA 5I5YA 1WCMG 5KFEA 3OTOH 2E2IA 4CC5A 3NBZB 3NC0B 4J9SA 4F4XA 2EJ3A 5I5TA 3GQCA 2GPSA 3MFIA 2YWVA 4CC6A 5KKNB 3GIPA 2YCHA 2CZGA 4M7EA 1BGWA 1VBGA 4JI7H 2R93G 1Y1WG 3TINA 1K1QA 3BA8A 2R7KA 5K3WA 2ASDA 3AX6A 1M0TA 4LSAA 5C1OA 2V58A 2COJA 1M6VA 3UYYA 4I4TF 5I60A 3FMAA 3HO8A 4ECVA 1EKPA 1A3GA 2NVYA 3OHBA 3WWIA 2ASLA 2EJ0A 2CQYA 4RNOA 2Z04A 5I5XA 2VOBA 5FD6A 3OSNA 1E4EB 3H4BA 2W9CA 1T3NA 2R7ZG 2HG8A 4X62H 4J9RA 4ED3A 5DLFA 3N43B 4C5CA 3Q2OA 4FFNA 4O7TA 2ALZA 2R8GA 3GILA 5IYDG 4EBEA 4J9QA 2AGOA 2J6TA 4B3MH 1I3QA 2ZM6H 5I5VA 4Q43A 3TIIA 3RGZA 5IT9W 2W6PA 4TV8F 3PW7A 1GLVA 3R5FA 5KG5A 4CKCA 2ZJTA 3R5XA 4JI2H 4O7YA 2YS6A 5EDWA 1DV2A 4DRFA 4RAYA 4YQWA 3PO2G 1KT8A 5C3EG 3GTKA 2RGVA 2W6NA 5DAAA 4IR9A 4CKEA 1HR0H 3U9SA 1N33H 1S0MA 3AYHB 2XCAA 1C30A 4UCRA 1JX4A 3GTGA 2UXDH 3PW0A 4X65H 3SE7A 3BJYA 1J5EH 3KYHC 5BPFA 1DAAA 5E25A 4TM5A 5IP7G 4M0JA 5FJ8G 3U0GA 3CQZA 4DR1H 3TQ1A 4O3RA 2COIA 3MWDA 3T5KA 2HHHH 4RUAA 1I7NA 3HOZG 3CEBA 5KFLA 1RYRA 4YR3A 2J9GA 3PFFA 2W9BA 3RGXA 2FK1A 1CQJB 2JEJA 1L2ZA 4O2BF 2OH2A 2NU7B 4QWDA 1VBHA 1DV1A 1Z2OX 5J2UF 4ECXA 2C22A 2VPSA 4JV5H 4O86A 1TWCA 5KFRA 3KHLA 3V4SA 4CMFA 2W57A 3TY5A 2V4RA 3JZFA 4PZ8A 1S0OA 3BACA 1GSAA 5KFUA 4DV6H 3K5HA 2R92G 3DAAA 5C4XG 2R8HA 1AUVA 4YAKB 1B6RA 3KTMA 2R85A 2JA8G 4KHPH 5DG8A 4MA0A 2C2EA 3WWHA 4X64H 2W9AA 3RBEA 5EWGA 2NUAB 3WO0A 4DR4H 3PW2A 3GIIA 5BYBA 2YZNA 1N48A 5L1KA 5DGHA 3GTMA 3Q8RB 3RFCA 2J6UA 2W71A 4YR0A 2X0SA 4I55F 3H0GA 2HJWA 3M4IA 3PO3G 1I2LA 5C1PA 1O75A 1WSCA 2OLSA 2WAQE 1MZBA 2C2DA 1XDNA 3TQTA 5KG0A 3RB6A 3G8DA 1VKZA 3GLKA 2R8KA 2HVSA 2FK2A 4FBTA 3GIDA 4ETSA 5IYZF 4F50A 1Y1VA 4UCSA 1E4GT 3GIKA 1I1LA 1GGOA 2VUMA 1I1KA 4RB2C 3DTGA 1Y14B 3V6HA 3JSLA 3G6VA 2UVWA 2Q2TA 4ZI7F 3DTFA 4ZHQF 1PX2A 5C5JA 4ZOLF 1Z2PX 4E4TA 4MV8A 3C0FB 3LULA 4EBDA 5LL6b 4TUYF 3Q8SB 4RB3C 4LFBH 5I5WA 1T94A 2HIXA 4R7RA 5F9NA 2HDKA 2V59A 2Q7DA 2WE6A 1TWGA 1CKNA 5HBRB 3VMMA 4GLWA 4B3SH 3U55A 1Y1VG 4JV0A 2BQUA 4RB1A 4IAJA 1WRVA 3TY9A 3T5JA 5BMVF 2VUMG 4ED0A 3TW7A 4O7VA 3MJFA 5BWWA 4RAZA 4DV4H 4TQRA 2KSWA 1IYDA 3IG0A 2V9WA 2Z02A 3TY8A 4RU9A 2XGPA 5KFKA 3PR4A 3CVZA 3GJXB 4DV5H 5JVDF 2RDJA 3H3VH 1XNQH 4BXXG 4GKKH 1I2KA 2HGWA 5BR8H 2VQFH 4DV7H 1TWAA 3M9MB 3L4JA 2R8IA 4FFLA 5KS8A 4HNVA 2M05A 5LMNH 3GTPA 2CFMA 3L2PA 4F4ZA 1KEEA 2AQ4A 4QSHA 2C35B 5KT6A 4RNNA 1S97A 1SCUB 5HV6A 4PWQA 5DQHA 3BQ1A 2YL2A 1N56A 1GSHA 5IYCG 1XNRH
chains in the Genus database with same CATH topology
1UC9A 3G8CA 4FFPA 4DIMA 3LP8A 1OBDA 2CNVA 3I12A 2YZMA 2W6QA 5CB4F 2I8CA 2NU8B 3UFXB 3JRXA 1A48A 4MV1A 3U9TA 4XX0B 3R9RA 5JQGF 2ZDHA 1E4EA 2YS7A 2DWCA 4XZ3B 4O81A 4TV9F 2FP4B 1CE8A 4O7NA 2PVPA 5DMXA 3K5IA 5GONF 2R86A 2R7MA 1C3OA 2GQRA 3U54A 4HNTA 1GSOA 4YJ3F 2W6OA 4C5AA 4MV9A 3BG5A 5BPHA 1UC8A 1KC7A 4IIJF 3RV3A 4O4LF 4IWYA 2I80A 2YYAA 3R5HA 3N8DA 1JDEA 4O83A 4IHJF 2VR1A 3JZIA 1JLLB 3K3PA 2FPGB 2VQDA 4YJ2F 3WNZA 3V4ZA 2CNUA 3KAJA 1A9XA 4YB8B 1T36A 2YRXA 4MV7A 3JRWA 2DLNA 4DLKA 2DZDA 3ORRA 4HR7A 3RV4A 2YW2A 3KALA 1BNCA 5I47A 4YBZB 5LYJF 2W6ZA 3VA7A 4NYEA 3Q1KA 2HGSA 4MA5A 4XYLB 3VPCA 1EHIA 1PK8A 1M0WA 5LA6F 2FB9A 5LXTF 3ETJA 5LOVF 2VPQA 2YZGA 1KUTA 4ME6A 1KJ9A 2R7NA 2GQSA 4FFMA 4MAMA 4YAJB 4O4HF 3MWEA 4O4JF 4EG0A 5LP6F 5JH7F 2W6MA 5KX5F 5K2MA 3HB9A 1KBLA 3R23A 3VOTA 5CAEB 4FE2A 5C8YF 3AW8A 2QK4A 2R82A 1EUCB 2IP4A 4MV6A 3E5NA 4ZQIA 4IZOA 4MV4A 4O2AF 4RZQA 4HQ6A 1WR2A 1JKJB 5D8DA 2W70A 1ULZA 2WYOA 3TIGA 4O7SA 4MV3A 2PBZA 2R6FA 3HBLA 4C5BA 2R84A 2NU6B 1EZ1A 5J2TF 4L1KA 5JQWA 4O7ZA 3DF7A 4HNUA 4O7WA 1KJJA 2ZDQA 3NUAA 4O7RA 4IWXA 2QF7A 2GLTA 4Y8VB 5FNVF 4EGJA 1BXRA 3OUUA 1KJ8A 4FGRA 1Z2NX 2ZDGA 4FU0A 3ETHA 1DIKA 5EZYF 5CA1F 2I87A 4WD3A 1W93A 2PN1A 2SCUB 4I50F 4EGQA 3KREA 2XD4A 1AUXA 2R7LA 2FPPB 1CS0A 2GPWA 1I7LA 3VPBA 2C00A 1W96A 2XCLA 1KJQA 4O82A 3ORQA 3N6RA 3VPDA 3TW6A 5CA0F 1OBGA 2V5AA 2CNQA 4O7LA 3RUPA 5JVLA 1JDBB 4XYMB 2NU9B 5H80A 4WBNF 1B6SA 3KAKA 3QFFA 4M9UA 4FFRA 1IOVA 4FFOA 3LWBA 1IOWA 3OUZA 4O84A 1EUDB 4O4IF 2R87A 2FPIB 3WO1A 2YZLA 2DIKA 2YRWA 1CQIB 1KJIA 2P0AA 1EYZA 2GPSA 2YWVA 5KKNB 2CZGA 1VBGA 3TINA 2R7KA 3AX6A 1M0TA 5C1OA 2V58A 1M6VA 4I4TF 3HO8A 2CQYA 2Z04A 1E4EB 4C5CA 3Q2OA 4FFNA 4O7TA 3TIIA 2W6PA 4TV8F 1GLVA 3R5FA 3R5XA 4O7YA 2YS6A 1DV2A 2W6NA 3U9SA 1C30A 3SE7A 5BPFA 3MWDA 1I7NA 2J9GA 1CQJB 4O2BF 2NU7B 1Z2OX 1VBHA 1DV1A 5J2UF 4O86A 3V4SA 3JZFA 1GSAA 3K5HA 4YAKB 1AUVA 1B6RA 2R85A 4MA0A 2NUAB 3WO0A 2YZNA 3RFCA 2W71A 2X0SA 4I55F 2HJWA 5C1PA 2OLSA 3TQTA 3G8DA 1VKZA 3GLKA 3GIDA 5IYZF 1GGOA 4ZI7F 4ZHQF 1PX2A 4ZOLF 1Z2PX 4E4TA 4MV8A 4TUYF 2V59A 5HBRB 3VMMA 3U55A 5BMVF 4O7VA 3MJFA 2Z02A 5JVDF 4FFLA 4HNVA 1KEEA 4QSHA 1SCUB 5HV6A 2YL2A 1GSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UC9 A;  3G8C A;  4FFP A;  4DIM A;  3LP8 A;  1OBD A;  2CNV A;  3I12 A;  2YZM A;  2W6Q A;  5CB4 F;  2I8C A;  2NU8 B;  3UFX B;  3JRX A;  1A48 A;  4MV1 A;  3U9T A;  4XX0 B;  3R9R A;  5JQG F;  2ZDH A;  1E4E A;  2YS7 A;  2DWC A;  4XZ3 B;  4O81 A;  4TV9 F;  2FP4 B;  1CE8 A;  4O7N A;  2PVP A;  5DMX A;  3K5I A;  5GON F;  2R86 A;  2R7M A;  1C3O A;  2GQR A;  3U54 A;  4HNT A;  1GSO A;  4YJ3 F;  2W6O A;  4C5A A;  4MV9 A;  3BG5 A;  5BPH A;  1UC8 A;  1KC7 A;  4IIJ F;  3RV3 A;  4O4L F;  4IWY A;  2I80 A;  2YYA A;  3R5H A;  3N8D A;  1JDE A;  4O83 A;  4IHJ F;  2VR1 A;  3JZI A;  1JLL B;  3K3P A;  2FPG B;  2VQD A;  4YJ2 F;  3WNZ A;  3V4Z A;  2CNU A;  3KAJ A;  1A9X A;  4YB8 B;  1T36 A;  2YRX A;  4MV7 A;  3JRW A;  2DLN A;  4DLK A;  2DZD A;  3ORR A;  4HR7 A;  3RV4 A;  2YW2 A;  3KAL A;  1BNC A;  5I47 A;  4YBZ B;  5LYJ F;  2W6Z A;  3VA7 A;  4NYE A;  3Q1K A;  2HGS A;  4MA5 A;  4XYL B;  3VPC A;  1EHI A;  1PK8 A;  1M0W A;  5LA6 F;  2FB9 A;  5LXT F;  3ETJ A;  5LOV F;  2VPQ A;  2YZG A;  1KUT A;  4ME6 A;  1KJ9 A;  2R7N A;  2GQS A;  4FFM A;  4MAM A;  4YAJ B;  4O4H F;  3MWE A;  4O4J F;  4EG0 A;  5LP6 F;  5JH7 F;  2W6M A;  5KX5 F;  5K2M A;  3HB9 A;  1KBL A;  3R23 A;  3VOT A;  5CAE B;  4FE2 A;  5C8Y F;  3AW8 A;  2QK4 A;  2R82 A;  1EUC B;  2IP4 A;  4MV6 A;  3E5N A;  4ZQI A;  4IZO A;  4MV4 A;  4O2A F;  4RZQ A;  4HQ6 A;  1WR2 A;  1JKJ B;  5D8D A;  2W70 A;  1ULZ A;  2WYO A;  3TIG A;  4O7S A;  4MV3 A;  2PBZ A;  2R6F A;  3HBL A;  4C5B A;  2R84 A;  2NU6 B;  1EZ1 A;  5J2T F;  4L1K A;  5JQW A;  4O7Z A;  3DF7 A;  4HNU A;  4O7W A;  1KJJ A;  2ZDQ A;  3NUA A;  4O7R A;  4IWX A;  2QF7 A;  2GLT A;  4Y8V B;  5FNV F;  4EGJ A;  1BXR A;  3OUU A;  1KJ8 A;  4FGR A;  1Z2N X;  2ZDG A;  4FU0 A;  3ETH A;  1DIK A;  5EZY F;  5CA1 F;  2I87 A;  4WD3 A;  1W93 A;  2PN1 A;  2SCU B;  4I50 F;  4EGQ A;  3KRE A;  2XD4 A;  1AUX A;  2R7L A;  2FPP B;  1CS0 A;  2GPW A;  1I7L A;  3VPB A;  2C00 A;  1W96 A;  2XCL A;  1KJQ A;  4O82 A;  3ORQ A;  3N6R A;  3VPD A;  3TW6 A;  5CA0 F;  1OBG A;  2V5A A;  2CNQ A;  4O7L A;  3RUP A;  5JVL A;  1JDB B;  4XYM B;  2NU9 B;  5H80 A;  4WBN F;  1B6S A;  3KAK A;  3QFF A;  4M9U A;  4FFR A;  1IOV A;  4FFO A;  3LWB A;  1IOW A;  3OUZ A;  4O84 A;  1EUD B;  4O4I F;  2R87 A;  2FPI B;  3WO1 A;  2YZL A;  2DIK A;  2YRW A;  1CQI B;  1KJI A;  2P0A A;  1EYZ A;  2GPS A;  2YWV A;  5KKN B;  2CZG A;  1VBG A;  3TIN A;  2R7K A;  3AX6 A;  1M0T A;  5C1O A;  2V58 A;  1M6V A;  4I4T F;  3HO8 A;  2CQY A;  2Z04 A;  1E4E B;  4C5C A;  3Q2O A;  4FFN A;  4O7T A;  3TII A;  2W6P A;  4TV8 F;  1GLV A;  3R5F A;  3R5X A;  4O7Y A;  2YS6 A;  1DV2 A;  2W6N A;  3U9S A;  1C30 A;  3SE7 A;  5BPF A;  3MWD A;  1I7N A;  2J9G A;  1CQJ B;  4O2B F;  2NU7 B;  1Z2O X;  1VBH A;  1DV1 A;  5J2U F;  4O86 A;  3V4S A;  3JZF A;  1GSA A;  3K5H A;  4YAK B;  1AUV A;  1B6R A;  2R85 A;  4MA0 A;  2NUA B;  3WO0 A;  2YZN A;  3RFC A;  2W71 A;  2X0S A;  4I55 F;  2HJW A;  5C1P A;  2OLS A;  3TQT A;  3G8D A;  1VKZ A;  3GLK A;  3GID A;  5IYZ F;  1GGO A;  4ZI7 F;  4ZHQ F;  1PX2 A;  4ZOL F;  1Z2P X;  4E4T A;  4MV8 A;  4TUY F;  2V59 A;  5HBR B;  3VMM A;  3U55 A;  5BMV F;  4O7V A;  3MJF A;  2Z02 A;  5JVD F;  4FFL A;  4HNV A;  1KEE A;  4QSH A;  1SCU B;  5HV6 A;  2YL2 A;  1GSH A; 
#chains in the Genus database with same CATH topology
 1UC9 A;  5DG7 A;  3G8C A;  4DR7 H;  4CHI A;  4UCT A;  2Y0S A;  4LF6 H;  3NGD A;  3G6Y A;  1P8L A;  4FFP A;  5KFX A;  4Q44 A;  4ECY A;  4DIM A;  1BJT A;  4LF8 H;  2R8J A;  4B3R H;  2UXC H;  2FK3 A;  3LP8 A;  1RK5 A;  3T5H A;  3HOX G;  1OBD A;  4U7C A;  3RF2 A;  2DAA A;  4DL3 A;  2CNV A;  4DL4 A;  4CMD A;  3I12 A;  3T9B A;  3T5L A;  3EPI A;  1XK5 A;  4RCN A;  2YZM A;  2W6Q A;  5CB4 F;  4RZR A;  4QWC A;  2DPJ A;  5KFP A;  2VUG A;  2I8C A;  2MCT A;  2JA7 A;  1E4F T;  4YR2 A;  2NU8 B;  4QWA A;  4NXM H;  5KFD A;  2A1H A;  3N6X A;  4ED8 A;  4IRC A;  3UFX B;  5CM0 A;  3JRX A;  1A48 A;  3T7A A;  5KFN A;  3J7A K;  4MV1 A;  3RB0 A;  2Y0S E;  1FKA H;  3RTX A;  1DGS A;  3U9T A;  4XX0 B;  3KHR A;  4JYA H;  3R9R A;  5JQG F;  2Q2U A;  2ZDH A;  5KG1 A;  1E4E A;  5IYB G;  3QZ7 A;  4A3D G;  5CR5 A;  5DGI A;  2YS7 A;  3L4K A;  2DWC A;  2JA7 G;  5KT5 A;  4XZ3 B;  4O81 A;  4R8U B;  4TV9 F;  2FP4 B;  1CE8 A;  4O7N A;  5KFJ A;  2PVP A;  5DMX A;  5BWU A;  2J6S A;  2EJ2 A;  5KFZ A;  1FVI A;  3K5I A;  5GON F;  5BWX A;  2R86 A;  2R7M A;  1C3O A;  2GQR A;  5KFC A;  5LMU H;  3T54 A;  3U54 A;  1ZQ7 A;  4A3J G;  4HNT A;  5KFF A;  4ECR A;  1GSO A;  4YJ3 F;  2DAB A;  2FLP A;  1I50 A;  2EIY A;  4PBC A;  5DQI A;  1N32 H;  1TWH A;  3RR5 A;  4Q0Y A;  2HHF B;  2W6O A;  4C2M A;  4JV2 A;  4C5A A;  2UVU A;  4MV9 A;  3BG5 A;  5BPH A;  2W8L A;  1UC8 A;  3KXY T;  4NZN A;  2COG A;  4WHX A;  1KC7 A;  5KFG A;  2W9B B;  1X9N A;  4IIJ F;  4I7H A;  4O3N A;  3RV3 A;  4UCV A;  1V51 A;  4QWE A;  2HVR A;  5EWF A;  1V9P A;  4IWY A;  4O4L F;  2I80 A;  1VAJ A;  4J0M A;  4NLG A;  3T9D A;  3RBD A;  2AGQ A;  4YHH H;  2YYA A;  4O3Q A;  4LF5 H;  3R5H A;  3N8D A;  1WH2 A;  3W1G A;  4NXN H;  1IBK H;  5CE8 A;  1JDE A;  2E2H A;  1S68 A;  4HYK A;  3WWJ A;  4O83 A;  4ECZ A;  3Q8P B;  4JI1 H;  4JI4 H;  4IHJ F;  4CKB A;  5EWE A;  4DR3 H;  4ED1 A;  2VR1 A;  4O3P A;  5D1P A;  4X66 H;  4ED7 A;  2BR0 A;  2UUC H;  4LSX A;  4ECU A;  3JZI A;  3J80 W;  5KFH A;  4NZM A;  4A2A A;  4MTD A;  5FPO A;  1JLL B;  3QWU A;  2QB5 A;  3K3P A;  4JI3 H;  2FPG B;  2VQD A;  4AYB A;  5KFO A;  4YJ2 F;  3WNZ A;  5DG9 A;  2C2R A;  3V4Z A;  1FJG H;  2CNU A;  3RAQ A;  3GIM A;  2NVX A;  3KAJ A;  5DGB A;  4DUZ H;  1A9X A;  4YB8 B;  1T36 A;  2YRX A;  2UU9 H;  4MV7 A;  2VA3 A;  3EYY A;  3JRW A;  4UCU A;  3FKI A;  3MR3 A;  2DLN A;  2VA2 A;  4DLK A;  2DZD A;  3V6K A;  3H0G G;  3ORR A;  4HR7 A;  1KTA A;  3RV4 A;  2ODT X;  1AN7 A;  2YW2 A;  3KAL A;  3G6X A;  1BNC A;  2UVR A;  5I47 A;  4ED6 A;  2ABJ A;  4YBZ B;  4IRK A;  3I4M G;  4PDB A;  3LML A;  2FLN A;  3T9A A;  5FR9 A;  2Y4R A;  5DIS C;  5LYJ F;  3OSP A;  2W6Z A;  2IBK A;  3VA7 A;  4NYE A;  4DV3 H;  3Q1K A;  3RIZ A;  1CKM A;  2HGS A;  4MA5 A;  4AYB E;  4JI8 H;  1XMO H;  4JV1 A;  4IRD A;  2HVQ A;  5A2Q W;  3RB4 A;  4XYL B;  3VPC A;  5KG4 A;  4FS1 A;  2UUA H;  4A3B G;  1B04 A;  4K6N A;  3BA9 A;  2FE3 A;  2CKZ B;  3GIJ A;  3GTO A;  2UUB H;  4RUC A;  5L1J A;  4DAA A;  3MR6 A;  1EHI A;  1PK8 A;  5DGA A;  3BAA A;  5KFA A;  1M0W A;  5LA6 F;  2IMW P;  2FKL A;  3PN1 A;  2FB9 A;  4PZ7 A;  5KFT A;  2C28 A;  2WTF A;  4LMY A;  3N41 B;  1RYS A;  4DR2 H;  4QWB A;  1I1M A;  1SYX B;  5LXT F;  1M7J A;  2RF4 A;  3GV8 B;  3ETJ A;  4DL6 A;  1K1S A;  1RK6 A;  3GTQ A;  5LOV F;  5BWT A;  3H20 A;  3T9F A;  4BWS C;  5KFQ A;  2VPQ A;  2YZG A;  4DV2 H;  4LF9 H;  1KUT A;  3QZ8 A;  2CW8 A;  4ME6 A;  1XMQ H;  1KJ9 A;  3HKZ A;  2R7N A;  4LH6 A;  5D1O B;  2GQS A;  5BYA A;  2DPI A;  4A3L G;  4YP3 A;  4DR6 H;  4FFM A;  3T9C A;  3V6J A;  4MAM A;  4YAJ B;  3MFH A;  4EYI B;  2ASJ A;  4B3T H;  4DUY H;  2JEF A;  4O4H F;  3MWE A;  4O4J F;  4EG0 A;  5LP6 F;  4J9N A;  3GTL A;  5JH7 F;  2XCP A;  2W6M A;  5KX5 F;  5EOY A;  4YY3 H;  1VS0 A;  5K2M A;  3HB9 A;  1KBL A;  2XGQ A;  3R23 A;  3VOT A;  5CAE B;  2WB1 A;  4FE2 A;  1P16 A;  4Q8E A;  1RJQ A;  5KFY A;  4EEY A;  5C8Y F;  4JUZ A;  5KT2 A;  3AW8 A;  4FM9 A;  3CSW A;  2QK4 A;  4DL5 A;  4J9O A;  4EQ5 A;  3Q8Q B;  2HIV A;  2W9C B;  2R82 A;  1EUC B;  5I5U A;  2IP4 A;  4MV6 A;  2XC9 A;  2E5L H;  4CE5 A;  2RGR A;  1B33 N;  3HKZ E;  3N42 B;  5KT4 A;  3E5N A;  4ZQI A;  2W8K A;  2IA6 A;  4IZO A;  3TEK A;  5F9L A;  3JSN A;  5L1L A;  4EFB A;  3UZO A;  5KG6 A;  3HOU G;  2B63 A;  4LF4 H;  4LFC H;  4MV4 A;  5KG2 A;  4O2A F;  1IYE A;  2W7O A;  3M9O B;  1ZET A;  4DQN A;  4RZQ A;  3BAB A;  3PW5 A;  5DQG A;  2WB1 E;  3KHH A;  4DV1 H;  4GKJ H;  3PVX A;  1TA8 A;  2X5R A;  2W7P A;  4HQ6 A;  1WR2 A;  3BQ2 A;  1HNW H;  1JKJ B;  3I4N G;  5D8D A;  2W70 A;  3T1Y H;  4LFA H;  1ULZ A;  4BY1 G;  1V4Y A;  2XIG A;  4OX9 H;  2WYO A;  3TIG A;  4O7S A;  4MV3 A;  5BWV A;  3SGI A;  2PBZ A;  4QJF A;  2R6F A;  3VNN A;  4R8U A;  5IP9 G;  2ATL A;  4G3I A;  2B63 G;  3HBL A;  4A2B A;  4A3K G;  3SI8 A;  5C44 G;  4C5B A;  5L9X A;  2R84 A;  3GV7 B;  1N34 H;  3QQM A;  4NZO A;  5DLG A;  1IBL H;  2NU6 B;  1RJP A;  1EZ1 A;  3HOY G;  4UCO A;  5J2T F;  2RDI A;  4UUG A;  2V4Q A;  2PMZ A;  4A3F G;  4L1K A;  5JQW A;  4EFE A;  4TQS A;  4JI0 H;  4O7Z A;  3DF7 A;  3UQ8 A;  2AGP A;  3GV5 B;  4HNU A;  2O03 A;  1I94 H;  4BY7 G;  3IN5 A;  1A0I A;  4O7W A;  2JEG A;  4EEQ A;  1KJJ A;  2HHF A;  2R92 A;  2ZDQ A;  3NUA A;  5HNE A;  4F4Y A;  4O7R A;  2AU0 A;  4IWX A;  2FMA A;  5FLM G;  3S24 A;  2UVV A;  4IR1 A;  2QF7 A;  2GLT A;  3W5O A;  4Y8V B;  5FNV F;  4Q4C A;  4EGJ A;  1HNZ H;  1BXR A;  4A3C G;  4HN2 A;  3OUU A;  2HGX A;  3EPG A;  3T9E A;  4UFZ A;  4DV0 H;  4GC6 A;  3T99 A;  1UNN C;  1KJ8 A;  4FGR A;  4U6P A;  1Z2N X;  4A3G G;  1S03 G;  1TWF A;  1A0G A;  2ZGI A;  4AQY H;  2WDT A;  4Q4D A;  3HXL A;  2ZDG A;  1IBM H;  2WAQ A;  2FJZ A;  4GLX A;  2PMZ E;  2BQ3 A;  4MTE A;  4DL2 A;  3HOV G;  3BQ0 A;  1JXL A;  5KG7 A;  3MR2 A;  4FU0 A;  3ETH A;  1DIK A;  3UZB A;  3HOW G;  5EZY F;  5KT3 A;  1CKO A;  4RNM A;  1N36 H;  3PZP A;  5CA1 F;  2I87 A;  4WD3 A;  1W93 A;  2PN1 A;  2SCU B;  4I50 F;  4EGQ A;  4LF7 H;  1R9T A;  3FDS A;  4E6N A;  4QW9 A;  1TAE A;  3RAX A;  4J9L A;  4JI5 H;  4A3M G;  1K83 A;  4O3S A;  3KRE A;  1SEI A;  4J9K A;  4K0K H;  2XD4 A;  1AUX A;  2R7L A;  2QYZ A;  2FPP B;  3PR5 B;  1HNX H;  2OWO A;  3RJ0 A;  4J9M A;  4ECS A;  1CS0 A;  2GPW A;  3M9N B;  4FS2 A;  1I7L A;  4Q8F A;  3VPB A;  2C00 A;  1S9F A;  1W96 A;  4ECT A;  4A3E G;  2XCL A;  5KFB A;  3MWM A;  4ECW A;  3PW4 A;  1KJQ A;  4O82 A;  5FPR A;  3ORQ A;  1GO3 E;  3FKI G;  3GIQ A;  3N6R A;  4QIW A;  5KFV A;  1OWT A;  4APM A;  3KHG A;  3VPD A;  1SFO A;  4TVI A;  3RB3 A;  2VQE H;  2UXB H;  3TW6 A;  5FLX W;  5KFM A;  1EKV A;  5CA0 F;  5KFI A;  1CKN B;  2JA6 A;  4O3O A;  4PZ6 A;  1OBG A;  2V5A A;  2CNQ A;  4O7L A;  3NBY B;  3RUP A;  5JVL A;  3F8N A;  3H4D A;  3GTJ A;  5T14 A;  1JDB B;  2JA5 A;  4XYM B;  3OHA A;  2NU9 B;  3MR5 A;  3JAM W;  5H80 A;  4WBN F;  4F4W A;  1B6S A;  3H40 A;  5FD5 A;  5BWR A;  5KFS A;  3KAK A;  4Q45 A;  4FBU A;  4JXU A;  3JZ6 A;  1ZHS A;  4RB0 A;  3J81 W;  3QFF A;  4EBC A;  5KG3 A;  4M9U A;  4A3I G;  3GB8 B;  4BBR G;  4FFR A;  3GDE A;  1EKF A;  5L1I A;  1IOV A;  4GC7 A;  4DL7 A;  1S0N A;  4FFO A;  2JA6 G;  1ET0 A;  3LWB A;  4EYH B;  1IOW A;  4QIW E;  3OUZ A;  4O84 A;  2JEI A;  3LQS A;  2JA5 G;  1I6U A;  4J9P A;  5I5S A;  1ZAU A;  1EUD B;  1WCM A;  1GYF A;  4JI6 H;  4O4I F;  3K3V A;  3N44 B;  2R87 A;  5JUM A;  2FLL A;  1RJR A;  2YU9 A;  2FPI B;  3HT5 A;  5KFW A;  3W1B A;  4QW8 A;  3WO1 A;  1JIH A;  2YZL A;  1ZHQ A;  5IWA H;  2R93 A;  1Y1W A;  2DIK A;  3T1H H;  2CW7 A;  3N40 P;  2YRW A;  1G2W A;  5KT7 A;  4BBS G;  1CQI B;  1S10 A;  2F4V H;  4ED2 A;  2BQR A;  4A93 G;  1KJI A;  2P0A A;  5D1O A;  4DR5 H;  3SNO A;  1EYZ A;  4LH7 A;  4ECQ A;  2R7Z A;  5I5Y A;  1WCM G;  5KFE A;  3OTO H;  2E2I A;  4CC5 A;  3NBZ B;  3NC0 B;  4J9S A;  4F4X A;  2EJ3 A;  5I5T A;  3GQC A;  2GPS A;  3MFI A;  2YWV A;  4CC6 A;  5KKN B;  3GIP A;  2YCH A;  2CZG A;  4M7E A;  1BGW A;  1VBG A;  4JI7 H;  2R93 G;  1Y1W G;  3TIN A;  1K1Q A;  3BA8 A;  2R7K A;  5K3W A;  2ASD A;  3AX6 A;  1M0T A;  4LSA A;  5C1O A;  2V58 A;  2COJ A;  1M6V A;  3UYY A;  4I4T F;  5I60 A;  3FMA A;  3HO8 A;  4ECV A;  1EKP A;  1A3G A;  2NVY A;  3OHB A;  3WWI A;  2ASL A;  2EJ0 A;  2CQY A;  4RNO A;  2Z04 A;  5I5X A;  2VOB A;  5FD6 A;  3OSN A;  1E4E B;  3H4B A;  2W9C A;  1T3N A;  2R7Z G;  2HG8 A;  4X62 H;  4J9R A;  4ED3 A;  5DLF A;  3N43 B;  4C5C A;  3Q2O A;  4FFN A;  4O7T A;  2ALZ A;  2R8G A;  3GIL A;  5IYD G;  4EBE A;  4J9Q A;  2AGO A;  2J6T A;  4B3M H;  1I3Q A;  2ZM6 H;  5I5V A;  4Q43 A;  3TII A;  3RGZ A;  5IT9 W;  2W6P A;  4TV8 F;  3PW7 A;  1GLV A;  3R5F A;  5KG5 A;  4CKC A;  2ZJT A;  3R5X A;  4JI2 H;  4O7Y A;  2YS6 A;  5EDW A;  1DV2 A;  4DRF A;  4RAY A;  4YQW A;  3PO2 G;  1KT8 A;  5C3E G;  3GTK A;  2RGV A;  2W6N A;  5DAA A;  4IR9 A;  4CKE A;  1HR0 H;  3U9S A;  1N33 H;  1S0M A;  3AYH B;  2XCA A;  1C30 A;  4UCR A;  1JX4 A;  3GTG A;  2UXD H;  3PW0 A;  4X65 H;  3SE7 A;  3BJY A;  1J5E H;  3KYH C;  5BPF A;  1DAA A;  5E25 A;  4TM5 A;  5IP7 G;  4M0J A;  5FJ8 G;  3U0G A;  3CQZ A;  4DR1 H;  3TQ1 A;  4O3R A;  2COI A;  3MWD A;  3T5K A;  2HHH H;  4RUA A;  1I7N A;  3HOZ G;  3CEB A;  5KFL A;  1RYR A;  4YR3 A;  2J9G A;  3PFF A;  2W9B A;  3RGX A;  2FK1 A;  1CQJ B;  2JEJ A;  1L2Z A;  4O2B F;  2OH2 A;  2NU7 B;  4QWD A;  1VBH A;  1DV1 A;  1Z2O X;  5J2U F;  4ECX A;  2C22 A;  2VPS A;  4JV5 H;  4O86 A;  1TWC A;  5KFR A;  3KHL A;  3V4S A;  4CMF A;  2W57 A;  3TY5 A;  2V4R A;  3JZF A;  4PZ8 A;  1S0O A;  3BAC A;  1GSA A;  5KFU A;  4DV6 H;  3K5H A;  2R92 G;  3DAA A;  5C4X G;  2R8H A;  1AUV A;  4YAK B;  1B6R A;  3KTM A;  2R85 A;  2JA8 G;  4KHP H;  5DG8 A;  4MA0 A;  2C2E A;  3WWH A;  4X64 H;  2W9A A;  3RBE A;  5EWG A;  2NUA B;  3WO0 A;  4DR4 H;  3PW2 A;  3GII A;  5BYB A;  2YZN A;  1N48 A;  5L1K A;  5DGH A;  3GTM A;  3Q8R B;  3RFC A;  2J6U A;  2W71 A;  4YR0 A;  2X0S A;  4I55 F;  3H0G A;  2HJW A;  3M4I A;  3PO3 G;  1I2L A;  5C1P A;  1O75 A;  1WSC A;  2OLS A;  2WAQ E;  1MZB A;  2C2D A;  1XDN A;  3TQT A;  5KG0 A;  3RB6 A;  3G8D A;  1VKZ A;  3GLK A;  2R8K A;  2HVS A;  2FK2 A;  4FBT A;  3GID A;  4ETS A;  5IYZ F;  4F50 A;  1Y1V A;  4UCS A;  1E4G T;  3GIK A;  1I1L A;  1GGO A;  2VUM A;  1I1K A;  4RB2 C;  3DTG A;  1Y14 B;  3V6H A;  3JSL A;  3G6V A;  2UVW A;  2Q2T A;  4ZI7 F;  3DTF A;  4ZHQ F;  1PX2 A;  5C5J A;  4ZOL F;  1Z2P X;  4E4T A;  4MV8 A;  3C0F B;  3LUL A;  4EBD A;  5LL6 b;  4TUY F;  3Q8S B;  4RB3 C;  4LFB H;  5I5W A;  1T94 A;  2HIX A;  4R7R A;  5F9N A;  2HDK A;  2V59 A;  2Q7D A;  2WE6 A;  1TWG A;  1CKN A;  5HBR B;  3VMM A;  4GLW A;  4B3S H;  3U55 A;  1Y1V G;  4JV0 A;  2BQU A;  4RB1 A;  4IAJ A;  1WRV A;  3TY9 A;  3T5J A;  5BMV F;  2VUM G;  4ED0 A;  3TW7 A;  4O7V A;  3MJF A;  5BWW A;  4RAZ A;  4DV4 H;  4TQR A;  2KSW A;  1IYD A;  3IG0 A;  2V9W A;  2Z02 A;  3TY8 A;  4RU9 A;  2XGP A;  5KFK A;  3PR4 A;  3CVZ A;  3GJX B;  4DV5 H;  5JVD F;  2RDJ A;  3H3V H;  1XNQ H;  4BXX G;  4GKK H;  1I2K A;  2HGW A;  5BR8 H;  2VQF H;  4DV7 H;  1TWA A;  3M9M B;  3L4J A;  2R8I A;  4FFL A;  5KS8 A;  4HNV A;  2M05 A;  5LMN H;  3GTP A;  2CFM A;  3L2P A;  4F4Z A;  1KEE A;  2AQ4 A;  4QSH A;  2C35 B;  5KT6 A;  4RNN A;  1S97 A;  1SCU B;  5HV6 A;  4PWQ A;  5DQH A;  3BQ1 A;  2YL2 A;  1N56 A;  1GSH A;  5IYC G;  1XNR H; 
#chains in the Genus database with same CATH homology
 1UC9 A;  3G8C A;  4FFP A;  4DIM A;  3LP8 A;  1OBD A;  2CNV A;  3I12 A;  2YZM A;  2W6Q A;  5CB4 F;  2I8C A;  2NU8 B;  3UFX B;  3JRX A;  1A48 A;  4MV1 A;  3U9T A;  4XX0 B;  3R9R A;  5JQG F;  2ZDH A;  1E4E A;  2YS7 A;  2DWC A;  4XZ3 B;  4O81 A;  4TV9 F;  2FP4 B;  1CE8 A;  4O7N A;  2PVP A;  5DMX A;  3K5I A;  5GON F;  2R86 A;  2R7M A;  1C3O A;  2GQR A;  3U54 A;  4HNT A;  1GSO A;  4YJ3 F;  2W6O A;  4C5A A;  4MV9 A;  3BG5 A;  5BPH A;  1UC8 A;  1KC7 A;  4IIJ F;  3RV3 A;  4O4L F;  4IWY A;  2I80 A;  2YYA A;  3R5H A;  3N8D A;  1JDE A;  4O83 A;  4IHJ F;  2VR1 A;  3JZI A;  1JLL B;  3K3P A;  2FPG B;  2VQD A;  4YJ2 F;  3WNZ A;  3V4Z A;  2CNU A;  3KAJ A;  1A9X A;  4YB8 B;  1T36 A;  2YRX A;  4MV7 A;  3JRW A;  2DLN A;  4DLK A;  2DZD A;  3ORR A;  4HR7 A;  3RV4 A;  2YW2 A;  3KAL A;  1BNC A;  5I47 A;  4YBZ B;  5LYJ F;  2W6Z A;  3VA7 A;  4NYE A;  3Q1K A;  2HGS A;  4MA5 A;  4XYL B;  3VPC A;  1EHI A;  1PK8 A;  1M0W A;  5LA6 F;  2FB9 A;  5LXT F;  3ETJ A;  5LOV F;  2VPQ A;  2YZG A;  1KUT A;  4ME6 A;  1KJ9 A;  2R7N A;  2GQS A;  4FFM A;  4MAM A;  4YAJ B;  4O4H F;  3MWE A;  4O4J F;  4EG0 A;  5LP6 F;  5JH7 F;  2W6M A;  5KX5 F;  5K2M A;  3HB9 A;  1KBL A;  3R23 A;  3VOT A;  5CAE B;  4FE2 A;  5C8Y F;  3AW8 A;  2QK4 A;  2R82 A;  1EUC B;  2IP4 A;  4MV6 A;  3E5N A;  4ZQI A;  4IZO A;  4MV4 A;  4O2A F;  4RZQ A;  4HQ6 A;  1WR2 A;  1JKJ B;  5D8D A;  2W70 A;  1ULZ A;  2WYO A;  3TIG A;  4O7S A;  4MV3 A;  2PBZ A;  2R6F A;  3HBL A;  4C5B A;  2R84 A;  2NU6 B;  1EZ1 A;  5J2T F;  4L1K A;  5JQW A;  4O7Z A;  3DF7 A;  4HNU A;  4O7W A;  1KJJ A;  2ZDQ A;  3NUA A;  4O7R A;  4IWX A;  2QF7 A;  2GLT A;  4Y8V B;  5FNV F;  4EGJ A;  1BXR A;  3OUU A;  1KJ8 A;  4FGR A;  1Z2N X;  2ZDG A;  4FU0 A;  3ETH A;  1DIK A;  5EZY F;  5CA1 F;  2I87 A;  4WD3 A;  1W93 A;  2PN1 A;  2SCU B;  4I50 F;  4EGQ A;  3KRE A;  2XD4 A;  1AUX A;  2R7L A;  2FPP B;  1CS0 A;  2GPW A;  1I7L A;  3VPB A;  2C00 A;  1W96 A;  2XCL A;  1KJQ A;  4O82 A;  3ORQ A;  3N6R A;  3VPD A;  3TW6 A;  5CA0 F;  1OBG A;  2V5A A;  2CNQ A;  4O7L A;  3RUP A;  5JVL A;  1JDB B;  4XYM B;  2NU9 B;  5H80 A;  4WBN F;  1B6S A;  3KAK A;  3QFF A;  4M9U A;  4FFR A;  1IOV A;  4FFO A;  3LWB A;  1IOW A;  3OUZ A;  4O84 A;  1EUD B;  4O4I F;  2R87 A;  2FPI B;  3WO1 A;  2YZL A;  2DIK A;  2YRW A;  1CQI B;  1KJI A;  2P0A A;  1EYZ A;  2GPS A;  2YWV A;  5KKN B;  2CZG A;  1VBG A;  3TIN A;  2R7K A;  3AX6 A;  1M0T A;  5C1O A;  2V58 A;  1M6V A;  4I4T F;  3HO8 A;  2CQY A;  2Z04 A;  1E4E B;  4C5C A;  3Q2O A;  4FFN A;  4O7T A;  3TII A;  2W6P A;  4TV8 F;  1GLV A;  3R5F A;  3R5X A;  4O7Y A;  2YS6 A;  1DV2 A;  2W6N A;  3U9S A;  1C30 A;  3SE7 A;  5BPF A;  3MWD A;  1I7N A;  2J9G A;  1CQJ B;  4O2B F;  2NU7 B;  1Z2O X;  1VBH A;  1DV1 A;  5J2U F;  4O86 A;  3V4S A;  3JZF A;  1GSA A;  3K5H A;  4YAK B;  1AUV A;  1B6R A;  2R85 A;  4MA0 A;  2NUA B;  3WO0 A;  2YZN A;  3RFC A;  2W71 A;  2X0S A;  4I55 F;  2HJW A;  5C1P A;  2OLS A;  3TQT A;  3G8D A;  1VKZ A;  3GLK A;  3GID A;  5IYZ F;  1GGO A;  4ZI7 F;  4ZHQ F;  1PX2 A;  4ZOL F;  1Z2P X;  4E4T A;  4MV8 A;  4TUY F;  2V59 A;  5HBR B;  3VMM A;  3U55 A;  5BMV F;  4O7V A;  3MJF A;  2Z02 A;  5JVD F;  4FFL A;  4HNV A;  1KEE A;  4QSH A;  1SCU B;  5HV6 A;  2YL2 A;  1GSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...