4YAJB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (apo form)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acetyl-coenzyme A synthetase (dinucleotide-
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum opf8
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yajB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yajB02
5GONF 4MA0A 2SCUB 3BG5A 3LP8A 1PK8A 2R7LA 2W70A 4IZOA 1CS0A 4YJ2F 1WR2A 4HR7A 3KAKA 1EUCB 1DIKA 4MV7A 2PVPA 4ME6A 4O84A 3U9TA 4IWYA 3RFCA 5FNVF 4O2AF 4FE2A 4FFLA 1CQJB 5LA6F 5JH7F 2PBZA 2I87A 1SCUB 2FPPB 1VBHA 2I8CA 2DZDA 5KX5F 2R86A 3R5HA 2YWVA 1EHIA 2ZDQA 1KC7A 5BPFA 2YRXA 5C8YF 2YZMA 4TV9F 2C00A 2W6OA 4MV1A 3U54A 3N6RA 1AUVA 4HNUA 2X0SA 3U9SA 4XZ3B 5C1OA 2CZGA 2XCLA 3HB9A 4O81A 1GSOA 3R23A 4ZI7F 4C5CA 3RV4A 1W93A 3LWBA 3RV3A 4FFOA 4I4TF 4Y8VB 3VPBA 1JDEA 1KJ9A 1JLLB 2NU6B 3ORRA 3R5FA 1KJ8A 1KJQA 2W6PA 2V58A 3ETJA 4IWXA 5JVLA 3KREA 1CQIB 1CE8A 3VA7A 5IYZF 3QFFA 2R7MA 4O7YA 4O83A 4I50F 2GQRA 1E4EB 3TINA 4QSHA 2GQSA 1C30A 4O7WA 2ZDGA 2HGSA 1T36A 2YZGA 3VMMA 1JDBB 3JZFA 5LXTF 2FPGB 1IOVA 4C5BA 2NU8B 1OBGA 1AUXA 4O2BF 2V5AA 4FFNA 5I47A 1EUDB 2Z02A 2YYAA 3R5XA 4RZQA 3HO8A 3TIGA 2DLNA 2IP4A 3K3PA 4XX0B 1Z2NX 5H80A 4EG0A 3WO0A 4MAMA 3KAJA 2I80A 4WD3A 3GIDA 2OLSA 2GPSA 3K5HA 2WYOA 4O7NA 4XYMB 2YZNA 4E4TA 2CNQA 1KUTA 3U55A 1B6RA 3DF7A 3SE7A 1GSHA 1OBDA 2VPQA 4ZOLF 3VOTA 4HNTA 5CB4F 4O86A 5KKNB 2NU7B 2FP4B 4YAKB 5JQGF 2QK4A 1I7NA 3OUZA 2W71A 5CA1F 2J9GA 4C5AA 3TIIA 1B6SA 1BNCA 1M0WA 5EZYF 1BXRA 4FFRA 5C1PA 4IHJF 5DMXA 2W6ZA 5HV6A 3G8DA 4O4JF 2VR1A 4FGRA 1A9XA 4YJ3F 2FPIB 2YZLA 3VPDA 4FFPA 5CAEB 4O4LF 1M6VA 2R7NA 4DIMA 3MWDA 4IIJF 2DWCA 2W6QA 5CA0F 3UFXB 5JVDF 2R84A 2R82A 4WBNF 1IOWA 1Z2PX 4O4HF 1UC9A 4M9UA 2CNUA 5J2TF 1E4EA 3AX6A 3MJFA 5D8DA 3HBLA 2YW2A 2CNVA 3RUPA 3ETHA 3I12A 4O7ZA 4FFMA 4ZQIA 4EGQA 2R87A 1KJIA 2YRWA 2Z04A 3JRWA 5LOVF 2V59A 5LYJF 4O7TA 1C3OA 2R85A 3AW8A 3R9RA 4YB8B 2HJWA 4TUYF 2R6FA 5HBRB 2GPWA 2CQYA 4TV8F 4MV4A 3TQTA 4O7VA 2YS6A 2NUAB 4FU0A 1I7LA 1KEEA 2FB9A 5K2MA 3ORQA 4EGJA 1GLVA 1KBLA 1GGOA 2NU9B 4MV6A 4YAJB 4MV3A 3K5IA 5LP6F 3TW6A 3GLKA 3MWEA 3NUAA 1EYZA 4O7LA 1W96A 1ULZA 3N8DA 2GLTA 1JKJB 4I55F 4HNVA 3E5NA 4ZHQF 3JZIA 1PX2A 4O7SA 4YBZB 4O7RA 1EZ1A 1VBGA 2P0AA 1UC8A 4XYLB 4MA5A 2W6NA 1Z2OX 3G8CA 3OUUA 1VKZA 4L1KA 4MV9A 2R7KA 4NYEA 3Q2OA 3V4ZA 4HQ6A 3KALA 1KJJA 3WO1A 4DLKA 1A48A 5BMVF 4O4IF 2W6MA 2XD4A 3V4SA 4O82A 2YS7A 3JRXA 5JQWA 2DIKA 3Q1KA 2PN1A 2QF7A 4MV8A 2ZDHA 5BPHA 3VPCA 3WNZA 1GSAA 5J2UF 2VQDA 1DV1A 1M0TA 2YL2A 1DV2A
chains in the Genus database with same CATH superfamily
5EOYA 3H20A 4EEYA 1IYEA 5GONF 3L2PA 3GIMA 3QWUA 3IN5A 4MA0A 4DRFA 5I5UA 2SCUB 3BG5A 4TVIA 3LP8A 3HKZA 3KHLA 1RYRA 1PK8A 1HR0H 4ECTA 4JI4H 4UCSA 3PO3G 2R7LA 2W70A 4IZOA 1CS0A 4YJ2F 3N40P 4GLWA 1WR2A 3M9MB 3VNNA 5BWUA 4HR7A 3KAKA 4R7RA 1EUCB 2ALZA 2IMWP 1P8LA 1DIKA 4UCVA 4ECYA 4JV0A 2Q7DA 4MV7A 2Y0SE 4DR5H 4BXXG 4NLGA 2PVPA 4ME6A 4O84A 3U9TA 3UZOA 2R7ZA 4A3DG 4LF8H 3GIQA 4IWYA 4CMFA 3RFCA 5FNVF 4O2AF 4FE2A 4DV7H 3GTLA 2HHFA 4FFLA 4Q44A 1CQJB 1TAEA 3TW7A 5LA6F 5JH7F 5IYBG 5BR8H 2W9AA 2JA5G 4J9QA 5KFVA 2HGWA 5E25A 5KFXA 4IAJA 3U0GA 2PBZA 3CVZA 2B63G 3TY8A 2I87A 1SCUB 2FPPB 2Y0SA 2UVWA 1VBHA 5KFUA 3GJXB 3GTPA 2I8CA 2DZDA 5KX5F 2R86A 3R5HA 2YWVA 3HXLA 1EHIA 2FK3A 5KFZA 5BWRA 1BGWA 5FLXW 3T99A 3FMAA 5BWXA 2ZDQA 1TWAA 1T3NA 2UUAH 3PW4A 1B04A 4YQWA 1SFOA 4JXUA 3H0GA 5CE8A 1A3GA 2VQFH 4TQSA 1KC7A 5BPFA 3V6HA 2YRXA 5C8YF 1I1KA 2YZMA 4TV9F 4YR2A 2C22A 3GV5B 1K1QA 1I2KA 4CKBA 4FBTA 2C00A 2DPIA 2HIVA 2W6OA 3Q8SB 3RF2A 5C44G 4J9RA 4KHPH 4MV1A 3U54A 4YHHH 2UXCH 3N6RA 1V4YA 2XC9A 1S9FA 4APMA 4GKKH 2CW7A 3L4JA 3GTKA 1AUVA 3UZBA 3BAAA 5KFBA 4HNUA 2WTFA 2X0SA 1UNNC 2V9WA 4NZOA 3U9SA 4XZ3B 2ZGIA 2W9CB 1WSCA 3PN1A 5C5JA 4DV4H 1N34H 4Q8FA 5C1OA 2CZGA 4J9PA 2FE3A 3T5KA 2XCLA 1N48A 3HB9A 3KHHA 3OSNA 4O81A 5KT5A 4LFAH 5KT3A 5I5SA 4DR7H 2RF4A 1EKFA 5I5TA 4QWCA 4DL4A 1TWFA 1GSOA 4E6NA 1ZAUA 3R23A 4ZI7F 2R92A 5EWEA 2E2HA 4AQYH 4UCOA 3G6XA 4C5CA 4U7CA 1N33H 1CKMA 3NBYB 3RV4A 1W93A 3G6YA 1JIHA 1E4GT 4RB3C 5BYBA 3LWBA 4JI7H 4A3JG 3RV3A 2R7ZG 4FFOA 4I4TF 3CQZA 4Y8VB 5DLFA 3VPBA 2JA5A 4ED8A 3T9BA 1JDEA 3DTGA 2DAAA 5BWTA 1KJ9A 4O3NA 1JLLB 2NU6B 3ORRA 4ECXA 3R5FA 4DL2A 1S0NA 2B63A 1KJ8A 3W5OA 1Y1VA 1KJQA 2W6PA 3SNOA 2V4QA 4CE5A 4LH7A 2JEGA 2V58A 2FKLA 3ETJA 3UQ8A 4IWXA 1EKPA 5JVLA 3HOYG 2W8LA 4IRKA 3KREA 4PZ7A 5FD5A 4O3OA 4JUZA 1JXLA 1ZHSA 1XMQH 2IA6A 4BY1G 2W7OA 1XNRH 5F9NA 1CQIB 1CE8A 5KFNA 2QB5A 2WAQE 5FLMG 1WCMG 3VA7A 3H0GG 4ED1A 5IYZF 1XDNA 3QFFA 3RB6A 2COIA 5DAAA 2R7MA 4O7YA 4O83A 5EWFA 4I50F 5BWWA 4RB2C 4A3EG 5LMNH 3M4IA 2GQRA 1E4EB 3TINA 5L1KA 1IYDA 4LF6H 3T9AA 4QSHA 5L1IA 2NVYA 4RAYA 4RUAA 3OHBA 2HG8A 2GQSA 2FK1A 4F4WA 2C35B 5KS8A 1C30A 2EJ2A 3PW0A 4O7WA 2AGQA 2ZDGA 2HGSA 3T9EA 1RJPA 2R93A 2WAQA 1T36A 4ED6A 2YZGA 4ED7A 4QWAA 1GO3E 3L4KA 2RDJA 3VMMA 2VA3A 5IP9G 1JDBB 4CC5A 3MWMA 3DAAA 4YR0A 5D1OB 3G6VA 4NZNA 2AU0A 1I3QA 4A2BA 1GYFA 4JV1A 2VQEH 5LMUH 3JZFA 5LXTF 3V6KA 2FPGB 1IOVA 1DAAA 4C5BA 4IR9A 4J9LA 2E5LH 2NU8B 1OBGA 2UUCH 1AUXA 4O2BF 3OHAA 2OH2A 1Y1WA 2CKZB 4PZ8A 2V5AA 4FFNA 2HVQA 1SYXB 5I47A 2R92G 4F50A 1EUDB 1KT8A 4CKCA 2Z02A 2YYAA 3T9DA 4GLXA 3MR5A 3R5XA 4RZQA 4LFCH 3HO8A 4UUGA 3TIGA 4F4XA 5F9LA 2VPSA 2DLNA 2IP4A 5DGHA 4ED3A 2HHFB 2W9BA 3K3PA 4XX0B 4DR1H 3T5HA 2UU9H 3HOWG 2BR0A 5I5XA 4RNMA 3QQMA 3BACA 1I2LA 3T9FA 2AGOA 1Z2NX 5H80A 5KFKA 3RAXA 4EG0A 2UVRA 2UXDH 4B3TH 3PR5B 2ASJA 3WO0A 3NGDA 2C28A 3JSLA 4C2MA 5CM0A 3BA9A 4MAMA 1XMOH 3PZPA 4DL5A 1S03G 1TWCA 5KG4A 3KAJA 2O03A 2I80A 3N6XA 4ECQA 4JV5H 4WD3A 1ZETA 4OX9H 2WDTA 3GIDA 3PW2A 3M9NB 4UCUA 4Q8EA 2OLSA 3W1BA 2AGPA 1A0GA 2GPSA 1WCMA 3K5HA 5KFWA 4A3FG 4EYIB 4PDBA 3T54A 2XGQA 3TY5A 2WYOA 4EQ5A 2V4RA 2YU9A 2DABA 2EIYA 2XCAA 2VUGA 1ET0A 4DL3A 3GTOA 4O7NA 4XYMB 2ZM6H 3RB3A 2R8KA 1TA8A 2YZNA 4E4TA 2CNQA 5KFPA 4ED0A 1KUTA 3TY9A 2UUBH 4DR6H 3U55A 4M7EA 1B6RA 5KFSA 4YP3A 4LH6A 3DF7A 3SE7A 1GSHA 1S10A 5FJ8G 2FLNA 1OBDA 4J9MA 3T5LA 3WWJA 1O75A 1L2ZA 1K83A 5EDWA 1TWHA 2VPQA 4ZOLF 3JSNA 1RYSA 1CKNA 3GTJA 5KT2A 3VOTA 5KFAA 4GC6A 4HNTA 3RBDA 5CB4F 4O86A 1IBLH 5KKNB 2NU7B 5KG1A 4BWSC 2FP4B 4EYHB 4F4ZA 4GC7A 4YAKB 4DR2H 3J80W 4A2AA 1Y1WG 1HNZH 4Q45A 4FBUA 2BQUA 4K6NA 5KFMA 3GTMA 3AYHB 3PFFA 4EFEA 5JQGF 2Q2UA 2QK4A 2HDKA 1I1LA 1I7NA 3OUZA 4A3LG 2AQ4A 4X64H 1N56A 2W71A 5CA1F 3EYYA 1X9NA 2J9GA 5DGIA 1IBMH 4C5AA 4GKJH 4QIWE 3GTQA 3RAQA 3TIIA 5KFOA 1B6SA 2X5RA 5KFQA 2J6TA 4B3MH 4EBCA 5KG2A 4ECUA 2C2DA 4J9SA 4LF4H 1BNCA 3HOVG 1IBKH 2MCTA 1M0WA 5EZYF 3RGXA 2PMZE 4RZRA 1BXRA 4ECWA 3RB4A 2NVXA 2E2IA 4FFRA 1HNWH 2ABJA 4DV3H 4CMDA 4LMYA 3BABA 5KT7A 5C1PA 4RB0A 5KT4A 4U6PA 5KFEA 3K3VA 3LQSA 4IHJF 2W6ZA 4PZ6A 4WHXA 5DISC 5DMXA 5HV6A 4QIWA 4R8UA 3G8DA 4FS1A 5C3EG 3HT5A 4CC6A 3F8NA 4QJFA 4J9OA 4HYKA 2HHHH 2IBKA 4O4JF 2VR1A 1XNQH 4JYAH 3BA8A 3T5JA 5DLGA 4QWDA 4FGRA 3PR4A 3I4MG 4PBCA 1A9XA 4B3SH 2BQRA 4YJ3F 3RIZA 5I5YA 3OTOH 3T1HH 2PMZA 2FPIB 4LFBH 2YZLA 3J81W 2RGRA 3FKIG 3VPDA 4FFPA 3V6JA 2FJZA 5KFGA 5CAEB 4B3RH 4O4LF 5KFCA 5KG6A 5KG5A 1M6VA 2C2RA 4O3QA 4LF5H 4Q4CA 2R7NA 4JI8H 4DIMA 3MWDA 4IIJF 2DWCA 2W6QA 5CA0F 4DV1H 5I60A 3UFXB 5KFFA 2JEJA 4A3MG 2ODTX 1ZQ7A 5JVDF 2CFMA 4EBDA 1I6UA 4ED2A 2FLLA 3EPGA 4J0MA 1FVIA 4K0KH 4J9KA 2R84A 2R82A 2CW8A 1N36H 4WBNF 2RGVA 2HIXA 1IOWA 4Q4DA 4YY3H 1Z2PX 3MR6A 5L1LA 4O4HF 3RR5A 5A2QW 4A3BG 1V9PA 1UC9A 3WWHA 4JI5H 4DR4H 4M9UA 5EWGA 1RJRA 3KXYT 4UFZA 3I4NG 3PO2G 3H4BA 2CNUA 5J2TF 5IYDG 1E4EA 3AX6A 3MJFA 3JAMW 4ECRA 5D8DA 4Q43A 4ECSA 5DQIA 3HBLA 2C2EA 4G3IA 4JI2H 5DG7A 2COGA 2YW2A 4EFBA 3SGIA 2CNVA 4X62H 2XGPA 1I94H 4UCTA 4DV2H 3RUPA 3ETHA 3I12A 2HVRA 2R8JA 4UCRA 4O7ZA 3TEKA 4RNNA 3QZ8A 3EPIA 4DR3H 4NXNH 4ECVA 4FFMA 1S68A 4DV5H 1MZBA 4ZQIA 4EGQA 2R87A 5FR9A 3N43B 1KJIA 2YRWA 2Z04A 3JRWA 2VOBA 5LOVF 5FD6A 4LF7H 4M0JA 5IWAH 2J6SA 5D1OA 2V59A 5LYJF 4O7TA 5KFYA 1C3OA 2R85A 5DG9A 3AW8A 1S0OA 3FDSA 3R9RA 4JV2A 2J6UA 4QW8A 4AYBA 5IYCG 4DV0H 1I1MA 2JA7G 4TM5A 3GV8B 4YB8B 1TWGA 2HJWA 4TUYF 4ECZA 4DQNA 4NXMH 5I5WA 3LULA 2R6FA 5HBRB 5KFDA 4DL6A 1RK6A 5KFJA 5KG0A 1N32H 2GPWA 2CQYA 4TV8F 2JA6A 4MV4A 3T1YH 3RBEA 4O3PA 1EKVA 2A1HA 4NZMA 4O7VA 3TQTA 1FJGH 2YS6A 3GIKA 3MFHA 2FLPA 2BQ3A 4RCNA 5K3WA 2NUAB 3MR3A 4FU0A 4JI3H 3Q8RB 2UXBH 3NBZB 4EEQA 4CKEA 1I7LA 3FKIA 1T94A 3RJ0A 2W7PA 2R8HA 1KEEA 5KFTA 4FS2A 4Q0YA 4DAAA 4JI0H 3H4DA 2VA2A 4QW9A 5KT6A 2VUMG 2W8KA 3JZ6A 4CHIA 4A3IG 3SI8A 4LF9H 2F4VH 5FPRA 3PW7A 3DTFA 5C4XG 2FB9A 5K2MA 1FKAH 3ORQA 4EGJA 2FMAA 1GLVA 1RK5A 4PWQA 1KBLA 1GGOA 2ASLA 3S24A 2NU9B 4MV6A 2JEFA 4YAJB 4MV3A 3W1GA 3K5IA 5LP6F 3N44B 3NC0B 4QWEA 3TW6A 1CKNB 1VAJA 3N42B 1I50A 3GLKA 3MWEA 3Q8PB 1K1SA 3BQ1A 2FK2A 2HVSA 4YR3A 2Y4RA 3NUAA 1OWTA 4O3SA 5FPOA 2EJ0A 4EBEA 2W57A 1EYZA 5BYAA 5BWVA 4O7LA 4MTEA 3CEBA 4TQRA 1W96A 5LL6b 1ULZA 3N8DA 1ZHQA 2R8GA 2GLTA 1JKJB 4I55F 4RAZA 4HNVA 4QWBA 5KFLA 4LSXA 5JUMA 1A0IA 3UYYA 3KTMA 5IP7G 4I7HA 3E5NA 4IRDA 4BBSG 1M7JA 4O3RA 4JI1H 2DPJA 4ZHQF 1Y1VG 4ETSA 2KSWA 3MFIA 3JZIA 2W9CA 3GIPA 3HOUG 2JA8G 1PX2A 3KYHC 4O7SA 1RJQA 5KG7A 2UVVA 2YCHA 4YBZB 4HN2A 4BY7G 4O7RA 1EZ1A 1VBGA 2EJ3A 2ZJTA 5KFRA 2XIGA 5DQGA 3BQ0A 3J7AK 3LMLA 2JA7A 1VS0A 2P0AA 2WE6A 3KHRA 1UC8A 5DGAA 3PVXA 5T14A 4XYLB 4A3CG 5L9XA 1E4FT 4R8UB 5IT9W 3IG0A 4BBRG 4MA5A 3GV7B 2W6NA 1Z2OX 3G8CA 1P16A 1KTAA 3OUUA 1VKZA 2QYZA 1R9TA 3BQ2A 4L1KA 5KFHA 2UVUA 4MV9A 1S0MA 1S97A 2JA6G 1AN7A 3OSPA 4A3KG 4LSAA 2R7KA 4NYEA 3Q2OA 4FM9A 3RTXA 1CKOA 3V4ZA 2JEIA 2R8IA 4HQ6A 5DQHA 3GQCA 3HOZG 3KALA 5KFIA 2XCPA 3MR2A 2ASDA 2VUMA 3C0FB 3WWIA 1KJJA 4DUYH 3T7AA 3WO1A 1B33N 4X65H 3RGZA 4A3GG 4DLKA 3KHGA 1A48A 5BMVF 5DG8A 4O4IF 4DV6H 2W6MA 1BJTA 2XD4A 4JI6H 3V4SA 3CSWA 4O82A 4IRCA 3QZ7A 2YS7A 4F4YA 3H3VH 3GILA 2Q2TA 1HNXH 4RB1A 3GDEA 3JRXA 2WB1E 3PW5A 5JQWA 2DIKA 3Q1KA 1G2WA 2COJA 2PN1A 4RUCA 3GIJA 3GB8B 3BJYA 4A93G 1XK5A 2HGXA 2QF7A 4MV8A 4X66H 4RU9A 3GTGA 1DGSA 5DGBA 2ZDHA 1JX4A 5BPHA 3HOXG 3H40A 2M05A 4J9NA 1V51A 3VPCA 5I5VA 3HKZE 3TQ1A 4MTDA 5CR5A 2OWOA 5KG3A 3WNZA 1GSAA 3Q8QB 2RDIA 3GIIA 3N41B 2WB1A 3RB0A 5J2UF 5L1JA 4AYBE 4DL7A 2VQDA 1DV1A 3T9CA 1Y14B 1WRVA 1M0TA 2YL2A 4RNOA 2ATLA 1J5EH 3M9OB 4IR1A 2R93G 4DUZH 2W9BB 1DV2A 1WH2A 1SEIA 5HNEA 5D1PA
chains in the Genus database with same CATH topology
5GONF 4MA0A 2SCUB 3BG5A 3LP8A 1PK8A 2R7LA 2W70A 4IZOA 1CS0A 4YJ2F 1WR2A 4HR7A 3KAKA 1EUCB 1DIKA 4MV7A 2PVPA 4ME6A 4O84A 3U9TA 4IWYA 3RFCA 5FNVF 4O2AF 4FE2A 4FFLA 1CQJB 5LA6F 5JH7F 2PBZA 2I87A 1SCUB 2FPPB 1VBHA 2I8CA 2DZDA 5KX5F 2R86A 3R5HA 2YWVA 1EHIA 2ZDQA 1KC7A 5BPFA 2YRXA 5C8YF 2YZMA 4TV9F 2C00A 2W6OA 4MV1A 3U54A 3N6RA 1AUVA 4HNUA 2X0SA 3U9SA 4XZ3B 5C1OA 2CZGA 2XCLA 3HB9A 4O81A 1GSOA 3R23A 4ZI7F 4C5CA 3RV4A 1W93A 3LWBA 3RV3A 4FFOA 4I4TF 4Y8VB 3VPBA 1JDEA 1KJ9A 1JLLB 2NU6B 3ORRA 3R5FA 1KJ8A 1KJQA 2W6PA 2V58A 3ETJA 4IWXA 5JVLA 3KREA 1CQIB 1CE8A 3VA7A 5IYZF 3QFFA 2R7MA 4O7YA 4O83A 4I50F 2GQRA 1E4EB 3TINA 4QSHA 2GQSA 1C30A 4O7WA 2ZDGA 2HGSA 1T36A 2YZGA 3VMMA 1JDBB 3JZFA 5LXTF 2FPGB 1IOVA 4C5BA 2NU8B 1OBGA 1AUXA 4O2BF 2V5AA 4FFNA 5I47A 1EUDB 2Z02A 2YYAA 3R5XA 4RZQA 3HO8A 3TIGA 2DLNA 2IP4A 3K3PA 4XX0B 1Z2NX 5H80A 4EG0A 3WO0A 4MAMA 3KAJA 2I80A 4WD3A 3GIDA 2OLSA 2GPSA 3K5HA 2WYOA 4O7NA 4XYMB 2YZNA 4E4TA 2CNQA 1KUTA 3U55A 1B6RA 3DF7A 3SE7A 1GSHA 1OBDA 2VPQA 4ZOLF 3VOTA 4HNTA 5CB4F 4O86A 5KKNB 2NU7B 2FP4B 4YAKB 5JQGF 2QK4A 1I7NA 3OUZA 2W71A 5CA1F 2J9GA 4C5AA 3TIIA 1B6SA 1BNCA 1M0WA 5EZYF 1BXRA 4FFRA 5C1PA 4IHJF 5DMXA 2W6ZA 5HV6A 3G8DA 4O4JF 2VR1A 4FGRA 1A9XA 4YJ3F 2FPIB 2YZLA 3VPDA 4FFPA 5CAEB 4O4LF 1M6VA 2R7NA 4DIMA 3MWDA 4IIJF 2DWCA 2W6QA 5CA0F 3UFXB 5JVDF 2R84A 2R82A 4WBNF 1IOWA 1Z2PX 4O4HF 1UC9A 4M9UA 2CNUA 5J2TF 1E4EA 3AX6A 3MJFA 5D8DA 3HBLA 2YW2A 2CNVA 3RUPA 3ETHA 3I12A 4O7ZA 4FFMA 4ZQIA 4EGQA 2R87A 1KJIA 2YRWA 2Z04A 3JRWA 5LOVF 2V59A 5LYJF 4O7TA 1C3OA 2R85A 3AW8A 3R9RA 4YB8B 2HJWA 4TUYF 2R6FA 5HBRB 2GPWA 2CQYA 4TV8F 4MV4A 3TQTA 4O7VA 2YS6A 2NUAB 4FU0A 1I7LA 1KEEA 2FB9A 5K2MA 3ORQA 4EGJA 1GLVA 1KBLA 1GGOA 2NU9B 4MV6A 4YAJB 4MV3A 3K5IA 5LP6F 3TW6A 3GLKA 3MWEA 3NUAA 1EYZA 4O7LA 1W96A 1ULZA 3N8DA 2GLTA 1JKJB 4I55F 4HNVA 3E5NA 4ZHQF 3JZIA 1PX2A 4O7SA 4YBZB 4O7RA 1EZ1A 1VBGA 2P0AA 1UC8A 4XYLB 4MA5A 2W6NA 1Z2OX 3G8CA 3OUUA 1VKZA 4L1KA 4MV9A 2R7KA 4NYEA 3Q2OA 3V4ZA 4HQ6A 3KALA 1KJJA 3WO1A 4DLKA 1A48A 5BMVF 4O4IF 2W6MA 2XD4A 3V4SA 4O82A 2YS7A 3JRXA 5JQWA 2DIKA 3Q1KA 2PN1A 2QF7A 4MV8A 2ZDHA 5BPHA 3VPCA 3WNZA 1GSAA 5J2UF 2VQDA 1DV1A 1M0TA 2YL2A 1DV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GON F;  4MA0 A;  2SCU B;  3BG5 A;  3LP8 A;  1PK8 A;  2R7L A;  2W70 A;  4IZO A;  1CS0 A;  4YJ2 F;  1WR2 A;  4HR7 A;  3KAK A;  1EUC B;  1DIK A;  4MV7 A;  2PVP A;  4ME6 A;  4O84 A;  3U9T A;  4IWY A;  3RFC A;  5FNV F;  4O2A F;  4FE2 A;  4FFL A;  1CQJ B;  5LA6 F;  5JH7 F;  2PBZ A;  2I87 A;  1SCU B;  2FPP B;  1VBH A;  2I8C A;  2DZD A;  5KX5 F;  2R86 A;  3R5H A;  2YWV A;  1EHI A;  2ZDQ A;  1KC7 A;  5BPF A;  2YRX A;  5C8Y F;  2YZM A;  4TV9 F;  2C00 A;  2W6O A;  4MV1 A;  3U54 A;  3N6R A;  1AUV A;  4HNU A;  2X0S A;  3U9S A;  4XZ3 B;  5C1O A;  2CZG A;  2XCL A;  3HB9 A;  4O81 A;  1GSO A;  3R23 A;  4ZI7 F;  4C5C A;  3RV4 A;  1W93 A;  3LWB A;  3RV3 A;  4FFO A;  4I4T F;  4Y8V B;  3VPB A;  1JDE A;  1KJ9 A;  1JLL B;  2NU6 B;  3ORR A;  3R5F A;  1KJ8 A;  1KJQ A;  2W6P A;  2V58 A;  3ETJ A;  4IWX A;  5JVL A;  3KRE A;  1CQI B;  1CE8 A;  3VA7 A;  5IYZ F;  3QFF A;  2R7M A;  4O7Y A;  4O83 A;  4I50 F;  2GQR A;  1E4E B;  3TIN A;  4QSH A;  2GQS A;  1C30 A;  4O7W A;  2ZDG A;  2HGS A;  1T36 A;  2YZG A;  3VMM A;  1JDB B;  3JZF A;  5LXT F;  2FPG B;  1IOV A;  4C5B A;  2NU8 B;  1OBG A;  1AUX A;  4O2B F;  2V5A A;  4FFN A;  5I47 A;  1EUD B;  2Z02 A;  2YYA A;  3R5X A;  4RZQ A;  3HO8 A;  3TIG A;  2DLN A;  2IP4 A;  3K3P A;  4XX0 B;  1Z2N X;  5H80 A;  4EG0 A;  3WO0 A;  4MAM A;  3KAJ A;  2I80 A;  4WD3 A;  3GID A;  2OLS A;  2GPS A;  3K5H A;  2WYO A;  4O7N A;  4XYM B;  2YZN A;  4E4T A;  2CNQ A;  1KUT A;  3U55 A;  1B6R A;  3DF7 A;  3SE7 A;  1GSH A;  1OBD A;  2VPQ A;  4ZOL F;  3VOT A;  4HNT A;  5CB4 F;  4O86 A;  5KKN B;  2NU7 B;  2FP4 B;  4YAK B;  5JQG F;  2QK4 A;  1I7N A;  3OUZ A;  2W71 A;  5CA1 F;  2J9G A;  4C5A A;  3TII A;  1B6S A;  1BNC A;  1M0W A;  5EZY F;  1BXR A;  4FFR A;  5C1P A;  4IHJ F;  5DMX A;  2W6Z A;  5HV6 A;  3G8D A;  4O4J F;  2VR1 A;  4FGR A;  1A9X A;  4YJ3 F;  2FPI B;  2YZL A;  3VPD A;  4FFP A;  5CAE B;  4O4L F;  1M6V A;  2R7N A;  4DIM A;  3MWD A;  4IIJ F;  2DWC A;  2W6Q A;  5CA0 F;  3UFX B;  5JVD F;  2R84 A;  2R82 A;  4WBN F;  1IOW A;  1Z2P X;  4O4H F;  1UC9 A;  4M9U A;  2CNU A;  5J2T F;  1E4E A;  3AX6 A;  3MJF A;  5D8D A;  3HBL A;  2YW2 A;  2CNV A;  3RUP A;  3ETH A;  3I12 A;  4O7Z A;  4FFM A;  4ZQI A;  4EGQ A;  2R87 A;  1KJI A;  2YRW A;  2Z04 A;  3JRW A;  5LOV F;  2V59 A;  5LYJ F;  4O7T A;  1C3O A;  2R85 A;  3AW8 A;  3R9R A;  4YB8 B;  2HJW A;  4TUY F;  2R6F A;  5HBR B;  2GPW A;  2CQY A;  4TV8 F;  4MV4 A;  3TQT A;  4O7V A;  2YS6 A;  2NUA B;  4FU0 A;  1I7L A;  1KEE A;  2FB9 A;  5K2M A;  3ORQ A;  4EGJ A;  1GLV A;  1KBL A;  1GGO A;  2NU9 B;  4MV6 A;  4YAJ B;  4MV3 A;  3K5I A;  5LP6 F;  3TW6 A;  3GLK A;  3MWE A;  3NUA A;  1EYZ A;  4O7L A;  1W96 A;  1ULZ A;  3N8D A;  2GLT A;  1JKJ B;  4I55 F;  4HNV A;  3E5N A;  4ZHQ F;  3JZI A;  1PX2 A;  4O7S A;  4YBZ B;  4O7R A;  1EZ1 A;  1VBG A;  2P0A A;  1UC8 A;  4XYL B;  4MA5 A;  2W6N A;  1Z2O X;  3G8C A;  3OUU A;  1VKZ A;  4L1K A;  4MV9 A;  2R7K A;  4NYE A;  3Q2O A;  3V4Z A;  4HQ6 A;  3KAL A;  1KJJ A;  3WO1 A;  4DLK A;  1A48 A;  5BMV F;  4O4I F;  2W6M A;  2XD4 A;  3V4S A;  4O82 A;  2YS7 A;  3JRX A;  5JQW A;  2DIK A;  3Q1K A;  2PN1 A;  2QF7 A;  4MV8 A;  2ZDH A;  5BPH A;  3VPC A;  3WNZ A;  1GSA A;  5J2U F;  2VQD A;  1DV1 A;  1M0T A;  2YL2 A;  1DV2 A; 
#chains in the Genus database with same CATH topology
 5EOY A;  3H20 A;  4EEY A;  1IYE A;  5GON F;  3L2P A;  3GIM A;  3QWU A;  3IN5 A;  4MA0 A;  4DRF A;  5I5U A;  2SCU B;  3BG5 A;  4TVI A;  3LP8 A;  3HKZ A;  3KHL A;  1RYR A;  1PK8 A;  1HR0 H;  4ECT A;  4JI4 H;  4UCS A;  3PO3 G;  2R7L A;  2W70 A;  4IZO A;  1CS0 A;  4YJ2 F;  3N40 P;  4GLW A;  1WR2 A;  3M9M B;  3VNN A;  5BWU A;  4HR7 A;  3KAK A;  4R7R A;  1EUC B;  2ALZ A;  2IMW P;  1P8L A;  1DIK A;  4UCV A;  4ECY A;  4JV0 A;  2Q7D A;  4MV7 A;  2Y0S E;  4DR5 H;  4BXX G;  4NLG A;  2PVP A;  4ME6 A;  4O84 A;  3U9T A;  3UZO A;  2R7Z A;  4A3D G;  4LF8 H;  3GIQ A;  4IWY A;  4CMF A;  3RFC A;  5FNV F;  4O2A F;  4FE2 A;  4DV7 H;  3GTL A;  2HHF A;  4FFL A;  4Q44 A;  1CQJ B;  1TAE A;  3TW7 A;  5LA6 F;  5JH7 F;  5IYB G;  5BR8 H;  2W9A A;  2JA5 G;  4J9Q A;  5KFV A;  2HGW A;  5E25 A;  5KFX A;  4IAJ A;  3U0G A;  2PBZ A;  3CVZ A;  2B63 G;  3TY8 A;  2I87 A;  1SCU B;  2FPP B;  2Y0S A;  2UVW A;  1VBH A;  5KFU A;  3GJX B;  3GTP A;  2I8C A;  2DZD A;  5KX5 F;  2R86 A;  3R5H A;  2YWV A;  3HXL A;  1EHI A;  2FK3 A;  5KFZ A;  5BWR A;  1BGW A;  5FLX W;  3T99 A;  3FMA A;  5BWX A;  2ZDQ A;  1TWA A;  1T3N A;  2UUA H;  3PW4 A;  1B04 A;  4YQW A;  1SFO A;  4JXU A;  3H0G A;  5CE8 A;  1A3G A;  2VQF H;  4TQS A;  1KC7 A;  5BPF A;  3V6H A;  2YRX A;  5C8Y F;  1I1K A;  2YZM A;  4TV9 F;  4YR2 A;  2C22 A;  3GV5 B;  1K1Q A;  1I2K A;  4CKB A;  4FBT A;  2C00 A;  2DPI A;  2HIV A;  2W6O A;  3Q8S B;  3RF2 A;  5C44 G;  4J9R A;  4KHP H;  4MV1 A;  3U54 A;  4YHH H;  2UXC H;  3N6R A;  1V4Y A;  2XC9 A;  1S9F A;  4APM A;  4GKK H;  2CW7 A;  3L4J A;  3GTK A;  1AUV A;  3UZB A;  3BAA A;  5KFB A;  4HNU A;  2WTF A;  2X0S A;  1UNN C;  2V9W A;  4NZO A;  3U9S A;  4XZ3 B;  2ZGI A;  2W9C B;  1WSC A;  3PN1 A;  5C5J A;  4DV4 H;  1N34 H;  4Q8F A;  5C1O A;  2CZG A;  4J9P A;  2FE3 A;  3T5K A;  2XCL A;  1N48 A;  3HB9 A;  3KHH A;  3OSN A;  4O81 A;  5KT5 A;  4LFA H;  5KT3 A;  5I5S A;  4DR7 H;  2RF4 A;  1EKF A;  5I5T A;  4QWC A;  4DL4 A;  1TWF A;  1GSO A;  4E6N A;  1ZAU A;  3R23 A;  4ZI7 F;  2R92 A;  5EWE A;  2E2H A;  4AQY H;  4UCO A;  3G6X A;  4C5C A;  4U7C A;  1N33 H;  1CKM A;  3NBY B;  3RV4 A;  1W93 A;  3G6Y A;  1JIH A;  1E4G T;  4RB3 C;  5BYB A;  3LWB A;  4JI7 H;  4A3J G;  3RV3 A;  2R7Z G;  4FFO A;  4I4T F;  3CQZ A;  4Y8V B;  5DLF A;  3VPB A;  2JA5 A;  4ED8 A;  3T9B A;  1JDE A;  3DTG A;  2DAA A;  5BWT A;  1KJ9 A;  4O3N A;  1JLL B;  2NU6 B;  3ORR A;  4ECX A;  3R5F A;  4DL2 A;  1S0N A;  2B63 A;  1KJ8 A;  3W5O A;  1Y1V A;  1KJQ A;  2W6P A;  3SNO A;  2V4Q A;  4CE5 A;  4LH7 A;  2JEG A;  2V58 A;  2FKL A;  3ETJ A;  3UQ8 A;  4IWX A;  1EKP A;  5JVL A;  3HOY G;  2W8L A;  4IRK A;  3KRE A;  4PZ7 A;  5FD5 A;  4O3O A;  4JUZ A;  1JXL A;  1ZHS A;  1XMQ H;  2IA6 A;  4BY1 G;  2W7O A;  1XNR H;  5F9N A;  1CQI B;  1CE8 A;  5KFN A;  2QB5 A;  2WAQ E;  5FLM G;  1WCM G;  3VA7 A;  3H0G G;  4ED1 A;  5IYZ F;  1XDN A;  3QFF A;  3RB6 A;  2COI A;  5DAA A;  2R7M A;  4O7Y A;  4O83 A;  5EWF A;  4I50 F;  5BWW A;  4RB2 C;  4A3E G;  5LMN H;  3M4I A;  2GQR A;  1E4E B;  3TIN A;  5L1K A;  1IYD A;  4LF6 H;  3T9A A;  4QSH A;  5L1I A;  2NVY A;  4RAY A;  4RUA A;  3OHB A;  2HG8 A;  2GQS A;  2FK1 A;  4F4W A;  2C35 B;  5KS8 A;  1C30 A;  2EJ2 A;  3PW0 A;  4O7W A;  2AGQ A;  2ZDG A;  2HGS A;  3T9E A;  1RJP A;  2R93 A;  2WAQ A;  1T36 A;  4ED6 A;  2YZG A;  4ED7 A;  4QWA A;  1GO3 E;  3L4K A;  2RDJ A;  3VMM A;  2VA3 A;  5IP9 G;  1JDB B;  4CC5 A;  3MWM A;  3DAA A;  4YR0 A;  5D1O B;  3G6V A;  4NZN A;  2AU0 A;  1I3Q A;  4A2B A;  1GYF A;  4JV1 A;  2VQE H;  5LMU H;  3JZF A;  5LXT F;  3V6K A;  2FPG B;  1IOV A;  1DAA A;  4C5B A;  4IR9 A;  4J9L A;  2E5L H;  2NU8 B;  1OBG A;  2UUC H;  1AUX A;  4O2B F;  3OHA A;  2OH2 A;  1Y1W A;  2CKZ B;  4PZ8 A;  2V5A A;  4FFN A;  2HVQ A;  1SYX B;  5I47 A;  2R92 G;  4F50 A;  1EUD B;  1KT8 A;  4CKC A;  2Z02 A;  2YYA A;  3T9D A;  4GLX A;  3MR5 A;  3R5X A;  4RZQ A;  4LFC H;  3HO8 A;  4UUG A;  3TIG A;  4F4X A;  5F9L A;  2VPS A;  2DLN A;  2IP4 A;  5DGH A;  4ED3 A;  2HHF B;  2W9B A;  3K3P A;  4XX0 B;  4DR1 H;  3T5H A;  2UU9 H;  3HOW G;  2BR0 A;  5I5X A;  4RNM A;  3QQM A;  3BAC A;  1I2L A;  3T9F A;  2AGO A;  1Z2N X;  5H80 A;  5KFK A;  3RAX A;  4EG0 A;  2UVR A;  2UXD H;  4B3T H;  3PR5 B;  2ASJ A;  3WO0 A;  3NGD A;  2C28 A;  3JSL A;  4C2M A;  5CM0 A;  3BA9 A;  4MAM A;  1XMO H;  3PZP A;  4DL5 A;  1S03 G;  1TWC A;  5KG4 A;  3KAJ A;  2O03 A;  2I80 A;  3N6X A;  4ECQ A;  4JV5 H;  4WD3 A;  1ZET A;  4OX9 H;  2WDT A;  3GID A;  3PW2 A;  3M9N B;  4UCU A;  4Q8E A;  2OLS A;  3W1B A;  2AGP A;  1A0G A;  2GPS A;  1WCM A;  3K5H A;  5KFW A;  4A3F G;  4EYI B;  4PDB A;  3T54 A;  2XGQ A;  3TY5 A;  2WYO A;  4EQ5 A;  2V4R A;  2YU9 A;  2DAB A;  2EIY A;  2XCA A;  2VUG A;  1ET0 A;  4DL3 A;  3GTO A;  4O7N A;  4XYM B;  2ZM6 H;  3RB3 A;  2R8K A;  1TA8 A;  2YZN A;  4E4T A;  2CNQ A;  5KFP A;  4ED0 A;  1KUT A;  3TY9 A;  2UUB H;  4DR6 H;  3U55 A;  4M7E A;  1B6R A;  5KFS A;  4YP3 A;  4LH6 A;  3DF7 A;  3SE7 A;  1GSH A;  1S10 A;  5FJ8 G;  2FLN A;  1OBD A;  4J9M A;  3T5L A;  3WWJ A;  1O75 A;  1L2Z A;  1K83 A;  5EDW A;  1TWH A;  2VPQ A;  4ZOL F;  3JSN A;  1RYS A;  1CKN A;  3GTJ A;  5KT2 A;  3VOT A;  5KFA A;  4GC6 A;  4HNT A;  3RBD A;  5CB4 F;  4O86 A;  1IBL H;  5KKN B;  2NU7 B;  5KG1 A;  4BWS C;  2FP4 B;  4EYH B;  4F4Z A;  4GC7 A;  4YAK B;  4DR2 H;  3J80 W;  4A2A A;  1Y1W G;  1HNZ H;  4Q45 A;  4FBU A;  2BQU A;  4K6N A;  5KFM A;  3GTM A;  3AYH B;  3PFF A;  4EFE A;  5JQG F;  2Q2U A;  2QK4 A;  2HDK A;  1I1L A;  1I7N A;  3OUZ A;  4A3L G;  2AQ4 A;  4X64 H;  1N56 A;  2W71 A;  5CA1 F;  3EYY A;  1X9N A;  2J9G A;  5DGI A;  1IBM H;  4C5A A;  4GKJ H;  4QIW E;  3GTQ A;  3RAQ A;  3TII A;  5KFO A;  1B6S A;  2X5R A;  5KFQ A;  2J6T A;  4B3M H;  4EBC A;  5KG2 A;  4ECU A;  2C2D A;  4J9S A;  4LF4 H;  1BNC A;  3HOV G;  1IBK H;  2MCT A;  1M0W A;  5EZY F;  3RGX A;  2PMZ E;  4RZR A;  1BXR A;  4ECW A;  3RB4 A;  2NVX A;  2E2I A;  4FFR A;  1HNW H;  2ABJ A;  4DV3 H;  4CMD A;  4LMY A;  3BAB A;  5KT7 A;  5C1P A;  4RB0 A;  5KT4 A;  4U6P A;  5KFE A;  3K3V A;  3LQS A;  4IHJ F;  2W6Z A;  4PZ6 A;  4WHX A;  5DIS C;  5DMX A;  5HV6 A;  4QIW A;  4R8U A;  3G8D A;  4FS1 A;  5C3E G;  3HT5 A;  4CC6 A;  3F8N A;  4QJF A;  4J9O A;  4HYK A;  2HHH H;  2IBK A;  4O4J F;  2VR1 A;  1XNQ H;  4JYA H;  3BA8 A;  3T5J A;  5DLG A;  4QWD A;  4FGR A;  3PR4 A;  3I4M G;  4PBC A;  1A9X A;  4B3S H;  2BQR A;  4YJ3 F;  3RIZ A;  5I5Y A;  3OTO H;  3T1H H;  2PMZ A;  2FPI B;  4LFB H;  2YZL A;  3J81 W;  2RGR A;  3FKI G;  3VPD A;  4FFP A;  3V6J A;  2FJZ A;  5KFG A;  5CAE B;  4B3R H;  4O4L F;  5KFC A;  5KG6 A;  5KG5 A;  1M6V A;  2C2R A;  4O3Q A;  4LF5 H;  4Q4C A;  2R7N A;  4JI8 H;  4DIM A;  3MWD A;  4IIJ F;  2DWC A;  2W6Q A;  5CA0 F;  4DV1 H;  5I60 A;  3UFX B;  5KFF A;  2JEJ A;  4A3M G;  2ODT X;  1ZQ7 A;  5JVD F;  2CFM A;  4EBD A;  1I6U A;  4ED2 A;  2FLL A;  3EPG A;  4J0M A;  1FVI A;  4K0K H;  4J9K A;  2R84 A;  2R82 A;  2CW8 A;  1N36 H;  4WBN F;  2RGV A;  2HIX A;  1IOW A;  4Q4D A;  4YY3 H;  1Z2P X;  3MR6 A;  5L1L A;  4O4H F;  3RR5 A;  5A2Q W;  4A3B G;  1V9P A;  1UC9 A;  3WWH A;  4JI5 H;  4DR4 H;  4M9U A;  5EWG A;  1RJR A;  3KXY T;  4UFZ A;  3I4N G;  3PO2 G;  3H4B A;  2CNU A;  5J2T F;  5IYD G;  1E4E A;  3AX6 A;  3MJF A;  3JAM W;  4ECR A;  5D8D A;  4Q43 A;  4ECS A;  5DQI A;  3HBL A;  2C2E A;  4G3I A;  4JI2 H;  5DG7 A;  2COG A;  2YW2 A;  4EFB A;  3SGI A;  2CNV A;  4X62 H;  2XGP A;  1I94 H;  4UCT A;  4DV2 H;  3RUP A;  3ETH A;  3I12 A;  2HVR A;  2R8J A;  4UCR A;  4O7Z A;  3TEK A;  4RNN A;  3QZ8 A;  3EPI A;  4DR3 H;  4NXN H;  4ECV A;  4FFM A;  1S68 A;  4DV5 H;  1MZB A;  4ZQI A;  4EGQ A;  2R87 A;  5FR9 A;  3N43 B;  1KJI A;  2YRW A;  2Z04 A;  3JRW A;  2VOB A;  5LOV F;  5FD6 A;  4LF7 H;  4M0J A;  5IWA H;  2J6S A;  5D1O A;  2V59 A;  5LYJ F;  4O7T A;  5KFY A;  1C3O A;  2R85 A;  5DG9 A;  3AW8 A;  1S0O A;  3FDS A;  3R9R A;  4JV2 A;  2J6U A;  4QW8 A;  4AYB A;  5IYC G;  4DV0 H;  1I1M A;  2JA7 G;  4TM5 A;  3GV8 B;  4YB8 B;  1TWG A;  2HJW A;  4TUY F;  4ECZ A;  4DQN A;  4NXM H;  5I5W A;  3LUL A;  2R6F A;  5HBR B;  5KFD A;  4DL6 A;  1RK6 A;  5KFJ A;  5KG0 A;  1N32 H;  2GPW A;  2CQY A;  4TV8 F;  2JA6 A;  4MV4 A;  3T1Y H;  3RBE A;  4O3P A;  1EKV A;  2A1H A;  4NZM A;  4O7V A;  3TQT A;  1FJG H;  2YS6 A;  3GIK A;  3MFH A;  2FLP A;  2BQ3 A;  4RCN A;  5K3W A;  2NUA B;  3MR3 A;  4FU0 A;  4JI3 H;  3Q8R B;  2UXB H;  3NBZ B;  4EEQ A;  4CKE A;  1I7L A;  3FKI A;  1T94 A;  3RJ0 A;  2W7P A;  2R8H A;  1KEE A;  5KFT A;  4FS2 A;  4Q0Y A;  4DAA A;  4JI0 H;  3H4D A;  2VA2 A;  4QW9 A;  5KT6 A;  2VUM G;  2W8K A;  3JZ6 A;  4CHI A;  4A3I G;  3SI8 A;  4LF9 H;  2F4V H;  5FPR A;  3PW7 A;  3DTF A;  5C4X G;  2FB9 A;  5K2M A;  1FKA H;  3ORQ A;  4EGJ A;  2FMA A;  1GLV A;  1RK5 A;  4PWQ A;  1KBL A;  1GGO A;  2ASL A;  3S24 A;  2NU9 B;  4MV6 A;  2JEF A;  4YAJ B;  4MV3 A;  3W1G A;  3K5I A;  5LP6 F;  3N44 B;  3NC0 B;  4QWE A;  3TW6 A;  1CKN B;  1VAJ A;  3N42 B;  1I50 A;  3GLK A;  3MWE A;  3Q8P B;  1K1S A;  3BQ1 A;  2FK2 A;  2HVS A;  4YR3 A;  2Y4R A;  3NUA A;  1OWT A;  4O3S A;  5FPO A;  2EJ0 A;  4EBE A;  2W57 A;  1EYZ A;  5BYA A;  5BWV A;  4O7L A;  4MTE A;  3CEB A;  4TQR A;  1W96 A;  5LL6 b;  1ULZ A;  3N8D A;  1ZHQ A;  2R8G A;  2GLT A;  1JKJ B;  4I55 F;  4RAZ A;  4HNV A;  4QWB A;  5KFL A;  4LSX A;  5JUM A;  1A0I A;  3UYY A;  3KTM A;  5IP7 G;  4I7H A;  3E5N A;  4IRD A;  4BBS G;  1M7J A;  4O3R A;  4JI1 H;  2DPJ A;  4ZHQ F;  1Y1V G;  4ETS A;  2KSW A;  3MFI A;  3JZI A;  2W9C A;  3GIP A;  3HOU G;  2JA8 G;  1PX2 A;  3KYH C;  4O7S A;  1RJQ A;  5KG7 A;  2UVV A;  2YCH A;  4YBZ B;  4HN2 A;  4BY7 G;  4O7R A;  1EZ1 A;  1VBG A;  2EJ3 A;  2ZJT A;  5KFR A;  2XIG A;  5DQG A;  3BQ0 A;  3J7A K;  3LML A;  2JA7 A;  1VS0 A;  2P0A A;  2WE6 A;  3KHR A;  1UC8 A;  5DGA A;  3PVX A;  5T14 A;  4XYL B;  4A3C G;  5L9X A;  1E4F T;  4R8U B;  5IT9 W;  3IG0 A;  4BBR G;  4MA5 A;  3GV7 B;  2W6N A;  1Z2O X;  3G8C A;  1P16 A;  1KTA A;  3OUU A;  1VKZ A;  2QYZ A;  1R9T A;  3BQ2 A;  4L1K A;  5KFH A;  2UVU A;  4MV9 A;  1S0M A;  1S97 A;  2JA6 G;  1AN7 A;  3OSP A;  4A3K G;  4LSA A;  2R7K A;  4NYE A;  3Q2O A;  4FM9 A;  3RTX A;  1CKO A;  3V4Z A;  2JEI A;  2R8I A;  4HQ6 A;  5DQH A;  3GQC A;  3HOZ G;  3KAL A;  5KFI A;  2XCP A;  3MR2 A;  2ASD A;  2VUM A;  3C0F B;  3WWI A;  1KJJ A;  4DUY H;  3T7A A;  3WO1 A;  1B33 N;  4X65 H;  3RGZ A;  4A3G G;  4DLK A;  3KHG A;  1A48 A;  5BMV F;  5DG8 A;  4O4I F;  4DV6 H;  2W6M A;  1BJT A;  2XD4 A;  4JI6 H;  3V4S A;  3CSW A;  4O82 A;  4IRC A;  3QZ7 A;  2YS7 A;  4F4Y A;  3H3V H;  3GIL A;  2Q2T A;  1HNX H;  4RB1 A;  3GDE A;  3JRX A;  2WB1 E;  3PW5 A;  5JQW A;  2DIK A;  3Q1K A;  1G2W A;  2COJ A;  2PN1 A;  4RUC A;  3GIJ A;  3GB8 B;  3BJY A;  4A93 G;  1XK5 A;  2HGX A;  2QF7 A;  4MV8 A;  4X66 H;  4RU9 A;  3GTG A;  1DGS A;  5DGB A;  2ZDH A;  1JX4 A;  5BPH A;  3HOX G;  3H40 A;  2M05 A;  4J9N A;  1V51 A;  3VPC A;  5I5V A;  3HKZ E;  3TQ1 A;  4MTD A;  5CR5 A;  2OWO A;  5KG3 A;  3WNZ A;  1GSA A;  3Q8Q B;  2RDI A;  3GII A;  3N41 B;  2WB1 A;  3RB0 A;  5J2U F;  5L1J A;  4AYB E;  4DL7 A;  2VQD A;  1DV1 A;  3T9C A;  1Y14 B;  1WRV A;  1M0T A;  2YL2 A;  4RNO A;  2ATL A;  1J5E H;  3M9O B;  4IR1 A;  2R93 G;  4DUZ H;  2W9B B;  1DV2 A;  1WH2 A;  1SEI A;  5HNE A;  5D1P A; 
#chains in the Genus database with same CATH homology
 5GON F;  4MA0 A;  2SCU B;  3BG5 A;  3LP8 A;  1PK8 A;  2R7L A;  2W70 A;  4IZO A;  1CS0 A;  4YJ2 F;  1WR2 A;  4HR7 A;  3KAK A;  1EUC B;  1DIK A;  4MV7 A;  2PVP A;  4ME6 A;  4O84 A;  3U9T A;  4IWY A;  3RFC A;  5FNV F;  4O2A F;  4FE2 A;  4FFL A;  1CQJ B;  5LA6 F;  5JH7 F;  2PBZ A;  2I87 A;  1SCU B;  2FPP B;  1VBH A;  2I8C A;  2DZD A;  5KX5 F;  2R86 A;  3R5H A;  2YWV A;  1EHI A;  2ZDQ A;  1KC7 A;  5BPF A;  2YRX A;  5C8Y F;  2YZM A;  4TV9 F;  2C00 A;  2W6O A;  4MV1 A;  3U54 A;  3N6R A;  1AUV A;  4HNU A;  2X0S A;  3U9S A;  4XZ3 B;  5C1O A;  2CZG A;  2XCL A;  3HB9 A;  4O81 A;  1GSO A;  3R23 A;  4ZI7 F;  4C5C A;  3RV4 A;  1W93 A;  3LWB A;  3RV3 A;  4FFO A;  4I4T F;  4Y8V B;  3VPB A;  1JDE A;  1KJ9 A;  1JLL B;  2NU6 B;  3ORR A;  3R5F A;  1KJ8 A;  1KJQ A;  2W6P A;  2V58 A;  3ETJ A;  4IWX A;  5JVL A;  3KRE A;  1CQI B;  1CE8 A;  3VA7 A;  5IYZ F;  3QFF A;  2R7M A;  4O7Y A;  4O83 A;  4I50 F;  2GQR A;  1E4E B;  3TIN A;  4QSH A;  2GQS A;  1C30 A;  4O7W A;  2ZDG A;  2HGS A;  1T36 A;  2YZG A;  3VMM A;  1JDB B;  3JZF A;  5LXT F;  2FPG B;  1IOV A;  4C5B A;  2NU8 B;  1OBG A;  1AUX A;  4O2B F;  2V5A A;  4FFN A;  5I47 A;  1EUD B;  2Z02 A;  2YYA A;  3R5X A;  4RZQ A;  3HO8 A;  3TIG A;  2DLN A;  2IP4 A;  3K3P A;  4XX0 B;  1Z2N X;  5H80 A;  4EG0 A;  3WO0 A;  4MAM A;  3KAJ A;  2I80 A;  4WD3 A;  3GID A;  2OLS A;  2GPS A;  3K5H A;  2WYO A;  4O7N A;  4XYM B;  2YZN A;  4E4T A;  2CNQ A;  1KUT A;  3U55 A;  1B6R A;  3DF7 A;  3SE7 A;  1GSH A;  1OBD A;  2VPQ A;  4ZOL F;  3VOT A;  4HNT A;  5CB4 F;  4O86 A;  5KKN B;  2NU7 B;  2FP4 B;  4YAK B;  5JQG F;  2QK4 A;  1I7N A;  3OUZ A;  2W71 A;  5CA1 F;  2J9G A;  4C5A A;  3TII A;  1B6S A;  1BNC A;  1M0W A;  5EZY F;  1BXR A;  4FFR A;  5C1P A;  4IHJ F;  5DMX A;  2W6Z A;  5HV6 A;  3G8D A;  4O4J F;  2VR1 A;  4FGR A;  1A9X A;  4YJ3 F;  2FPI B;  2YZL A;  3VPD A;  4FFP A;  5CAE B;  4O4L F;  1M6V A;  2R7N A;  4DIM A;  3MWD A;  4IIJ F;  2DWC A;  2W6Q A;  5CA0 F;  3UFX B;  5JVD F;  2R84 A;  2R82 A;  4WBN F;  1IOW A;  1Z2P X;  4O4H F;  1UC9 A;  4M9U A;  2CNU A;  5J2T F;  1E4E A;  3AX6 A;  3MJF A;  5D8D A;  3HBL A;  2YW2 A;  2CNV A;  3RUP A;  3ETH A;  3I12 A;  4O7Z A;  4FFM A;  4ZQI A;  4EGQ A;  2R87 A;  1KJI A;  2YRW A;  2Z04 A;  3JRW A;  5LOV F;  2V59 A;  5LYJ F;  4O7T A;  1C3O A;  2R85 A;  3AW8 A;  3R9R A;  4YB8 B;  2HJW A;  4TUY F;  2R6F A;  5HBR B;  2GPW A;  2CQY A;  4TV8 F;  4MV4 A;  3TQT A;  4O7V A;  2YS6 A;  2NUA B;  4FU0 A;  1I7L A;  1KEE A;  2FB9 A;  5K2M A;  3ORQ A;  4EGJ A;  1GLV A;  1KBL A;  1GGO A;  2NU9 B;  4MV6 A;  4YAJ B;  4MV3 A;  3K5I A;  5LP6 F;  3TW6 A;  3GLK A;  3MWE A;  3NUA A;  1EYZ A;  4O7L A;  1W96 A;  1ULZ A;  3N8D A;  2GLT A;  1JKJ B;  4I55 F;  4HNV A;  3E5N A;  4ZHQ F;  3JZI A;  1PX2 A;  4O7S A;  4YBZ B;  4O7R A;  1EZ1 A;  1VBG A;  2P0A A;  1UC8 A;  4XYL B;  4MA5 A;  2W6N A;  1Z2O X;  3G8C A;  3OUU A;  1VKZ A;  4L1K A;  4MV9 A;  2R7K A;  4NYE A;  3Q2O A;  3V4Z A;  4HQ6 A;  3KAL A;  1KJJ A;  3WO1 A;  4DLK A;  1A48 A;  5BMV F;  4O4I F;  2W6M A;  2XD4 A;  3V4S A;  4O82 A;  2YS7 A;  3JRX A;  5JQW A;  2DIK A;  3Q1K A;  2PN1 A;  2QF7 A;  4MV8 A;  2ZDH A;  5BPH A;  3VPC A;  3WNZ A;  1GSA A;  5J2U F;  2VQD A;  1DV1 A;  1M0T A;  2YL2 A;  1DV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...