4YAJB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (apo form)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acetyl-coenzyme A synthetase (dinucleotide-
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum opf8
molecule tags Ligase
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yajB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yajB02
2NUAB 2PVPA 1B6RA 2YZNA 2J9GA 5JVDF 4MV1A 2DZDA 3K5HA 1GLVA 1KJJA 4O4LF 4ZHQF 1E4EB 5HV6A 3GLKA 2CNUA 1I7LA 4O83A 4O2BF 1KUTA 4O7NA 3AX6A 3OUZA 4WD3A 2FB9A 4I50F 1GGOA 1KJIA 2FP4B 2HGSA 2W6PA 4L1KA 3R5XA 2V59A 3U9SA 3HB9A 4XZ3B 3JRWA 1EUCB 3MWDA 4DLKA 1KBLA 4O86A 5BPHA 3OUUA 3WNZA 3ETHA 4O7ZA 5CB4F 3LWBA 1JDBB 5BPFA 1AUXA 1EYZA 5H80A 3ETJA 5JQWA 2R85A 3KALA 1T36A 5CA1F 4FFPA 3RV4A 3WO0A 3N8DA 2XD4A 4MA5A 2NU6B 4TUYF 3RV3A 4IZOA 5GONF 3R9RA 1DV2A 2W6QA 2W71A 2R7MA 2ZDHA 3NUAA 4YJ3F 3TW6A 1CE8A 1KJ8A 4MAMA 4MV7A 3ORRA 3U54A 1E4EA 4FE2A 4FFOA 4ZOLF 5FNVF 3N6RA 2CNVA 4RZQA 4FGRA 4MV4A 3V4SA 4FFMA 4O82A 2R7KA 4YAKB 2YS6A 1EZ1A 2YRXA 4HNTA 4I4TF 4O7YA 2W6MA 3V4ZA 4EGJA 4YAJB 4E4TA 3R5FA 4IWXA 5HBRB 2R6FA 3TINA 1SCUB 5JVLA 4C5BA 2VR1A 2SCUB 2V58A 2CQYA 4IHJF 4HNUA 3UFXB 5I47A 3KREA 1M0TA 1W93A 1Z2OX 1WR2A 1IOWA 2W70A 1CS0A 2PN1A 3BG5A 4YJ2F 3RFCA 5CAEB 2P0AA 5JQGF 1A9XA 1KJ9A 2NU8B 4O84A 1JLLB 4C5CA 5EZYF 2HJWA 4ME6A 2FPPB 1BNCA 5J2UF 2R82A 4O7SA 4WBNF 2GLTA 2R7NA 5BMVF 2VQDA 4MV8A 2DWCA 4XYMB 3DF7A 2NU9B 4MA0A 4O7TA 1CQJB 3MJFA 1DIKA 3JZIA 3TIGA 1VBGA 1ULZA 2V5AA 5KX5F 5JH7F 2IP4A 3G8DA 4TV9F 1VKZA 1I7NA 3KAJA 2FPGB 1C30A 3K5IA 2R84A 4YB8B 4DIMA 3VA7A 1GSHA 2OLSA 4FU0A 2I8CA 3U9TA 3TQTA 4MV6A 1AUVA 2DIKA 2W6ZA 3HBLA 4YBZB 2PBZA 2YZMA 1UC9A 4O7VA 1EUDB 4EGQA 1PK8A 2ZDQA 2I80A 2Z04A 4I55F 4O4JF 4C5AA 2CNQA 4O7RA 5LA6F 4O7WA 2ZDGA 3I12A 5CA0F 1EHIA 5C1OA 4MV9A 1KJQA 2DLNA 2GPSA 4O2AF 3VPCA 3RUPA 1A48A 3VPBA 5LP6F 5LXTF 5J2TF 4NYEA 4QSHA 4O7LA 3GIDA 2R7LA 2C00A 1OBGA 3VMMA 4XX0B 2YW2A 2GQSA 1UC8A 3JRXA 4FFNA 1GSOA 1OBDA 4O81A 1JKJB 1BXRA 5C8YF 4TV8F 1Z2NX 3QFFA 1B6SA 5D8DA 2YZLA 4ZI7F 2GQRA 3TIIA 4M9UA 5LYJF 2FPIB 5K2MA 3Q1KA 2VPQA 2YL2A 2YYAA 3AW8A 2YWVA 1KC7A 1M6VA 3KAKA 5C1PA 5KKNB 4MV3A 4FFLA 2W6OA 3G8CA 1C3OA 3VOTA 5LOVF 4XYLB 3VPDA 2Z02A 3U55A 3MWEA 4ZQIA 4FFRA 1GSAA 1CQIB 2W6NA 2YZGA 3Q2OA 4HQ6A 4O4HF 1DV1A 1M0WA 1Z2PX 4HNVA 3LP8A 4Y8VB 4EG0A 5DMXA 1IOVA 4IWYA 2YRWA 1VBHA 2I87A 3SE7A 2NU7B 2YS7A 2X0SA 3E5NA 1PX2A 1W96A 2QK4A 5IYZF 4HR7A 4IIJF 2QF7A 2CZGA 3K3PA 3R5HA 3ORQA 3JZFA 1JDEA 2GPWA 4O4IF 3HO8A 2R87A 1KEEA 3R23A 2WYOA 3WO1A 2R86A 2XCLA
chains in the Genus database with same CATH superfamily
2NUAB 2R8HA 1TWHA 1CKNA 3GIKA 2UUBH 2PVPA 1IBMH 3HOWG 1FKAH 1B6RA 2YZNA 4LSXA 1N56A 2JEFA 4DR2H 4JI5H 1UNNC 2J9GA 4J9PA 5IYCG 1S9FA 2W8KA 3KHLA 4YR2A 4CC5A 5JVDF 3J7AK 4C2MA 2V4QA 4ED8A 4RAYA 4MV1A 3MR6A 5BYBA 5IP9G 2DZDA 4B3TH 1K83A 2HHFA 2AGOA 3RF2A 3K5HA 1GLVA 5KFDA 1KJJA 5IWAH 1TWCA 4O4LF 2JA7A 2J6UA 3SGIA 1K1QA 2UUAH 1Y1WA 2RF4A 5L1KA 4ZHQF 2VQEH 1E4EB 4JV5H 3H4DA 2UVVA 5HV6A 1SEIA 1RJRA 3GLKA 2JA7G 1XNQH 4F50A 4UCRA 1Y1WG 1MZBA 4GC7A 3I4MG 4JI6H 5F9NA 2CNUA 2HIVA 1I7LA 2JEJA 4O83A 1FJGH 2E5LH 2COGA 4O2BF 5IYDG 4A3LG 4A93G 1KUTA 5KG4A 4O7NA 2PMZE 3AX6A 4ECVA 2W9CA 2YU9A 4DV2H 3OUZA 3C0FB 4GKKH 4WD3A 2XGPA 4O3RA 3MFIA 4DV6H 2C2EA 2FB9A 2DPJA 1EKVA 4GC6A 2EJ3A 4R8UA 2ZGIA 1WH2A 4I50F 1GGOA 1KJIA 5D1OA 2FP4B 4RNNA 2XGQA 5L1LA 2HGSA 2W6PA 4ECYA 2DABA 2WB1A 3KHHA 4L1KA 2VOBA 3R5XA 3HXLA 2V59A 2WAQA 5DG9A 3G6YA 3PZPA 1ZETA 1CKMA 4HYKA 3CQZA 2FLPA 3U9SA 3HB9A 3FMAA 1N33H 4EFEA 4XZ3B 4JI0H 3JRWA 1EUCB 3MWDA 4DLKA 1KBLA 4UFZA 4EBCA 4O86A 5FR9A 5BPHA 3OUUA 3WNZA 2BR0A 1E4GT 5KFFA 3EYYA 4FM9A 4Q0YA 3ETHA 4O7ZA 5CB4F 4M7EA 4DV0H 1I50A 5KFUA 1XDNA 3BQ0A 1I1KA 5FJ8G 3LWBA 1JDBB 5BWVA 5DGAA 4PZ7A 5BPFA 1S0OA 5FD5A 4YHHH 4MTEA 4LMYA 2C2DA 4OX9H 1HNZH 2X5RA 3TY9A 1R9TA 4ED7A 3H3VH 1XMOH 4CC6A 5DISC 1AUXA 4AQYH 4K6NA 3MWMA 1EYZA 5H80A 2IBKA 4AYBE 3PFFA 4EEYA 3MR5A 4Q4DA 5D1PA 3ETJA 5JQWA 3T5KA 4A2BA 1IBKH 2R85A 4HN2A 4CKBA 5KFNA 3KALA 3OHBA 1T36A 5CA1F 4FFPA 3RV4A 3WO0A 4CKEA 3N8DA 4B3SH 2XD4A 4J9SA 3GQCA 5DGBA 4MA5A 3PO2G 4UCVA 4DR3H 2NU6B 3T5JA 5LMNH 4F4XA 4TUYF 1M7JA 2ZM6H 3RV3A 4IZOA 5I5WA 1GYFA 4O3SA 3MR3A 3QZ7A 4A3BG 1T94A 4QJFA 3NGDA 4J9QA 2E2HA 5KT5A 1EKFA 3H40A 5GONF 1B33N 4A3CG 4CMDA 2AU0A 3R9RA 3GTOA 1DV2A 5KFYA 4DL4A 4LSAA 1S10A 2B63A 2W6QA 2W71A 4ECWA 3N41B 3JAMW 3PN1A 1TWFA 3GIQA 1HR0H 3PW5A 1HNWH 5IT9W 4A3IG 2R7MA 2J6TA 2ZDHA 3NUAA 4PBCA 2CW8A 4ECRA 4YJ3F 4LH6A 4UCOA 3TW6A 1CE8A 3GTMA 5L1IA 5A2QW 1KJ8A 4MAMA 4MV7A 3PO3G 3ORRA 2E2IA 3N40P 5KT3A 1GO3E 3U54A 4LF9H 4DUYH 1E4EA 2VUMA 4FE2A 4FFOA 5BWXA 4ZOLF 5FNVF 1EKPA 4QWBA 3RJ0A 5C5JA 3N6RA 2FLNA 4NXMH 5DG8A 2CNVA 3BQ1A 3GB8B 4PZ8A 4RZQA 3UYYA 3HOUG 4FGRA 3QQMA 2CFMA 2BQRA 2A1HA 2HGWA 5I5SA 3RGXA 4MV4A 3V4SA 3PR5B 3AYHB 4FFMA 1BJTA 4APMA 2EIYA 4O82A 2R7KA 1S0NA 3M4IA 3QWUA 4YAKB 4IR1A 4BXXG 2YS6A 1EZ1A 2YRXA 4HNTA 4I4TF 4O7YA 2UVRA 1VAJA 5KT7A 5KFWA 3GILA 1RK5A 2W6MA 3V4ZA 4EGJA 4YAJB 3T7AA 5KFVA 3LULA 4E4TA 3GTPA 2UUCH 3R5FA 4IWXA 5HBRB 1V9PA 1Y14B 4RU9A 2R6FA 2BQ3A 3M9MB 1S0MA 3GTQA 2Q7DA 3WWIA 3TINA 5FLMG 1CKOA 2XCPA 4K0KH 4A3FG 1DAAA 5KFIA 1TAEA 2Q2TA 3T54A 3JSLA 4X62H 1ZHQA 1SCUB 5JVLA 4C5BA 4EYIB 3GTGA 2VR1A 3T99A 5I60A 3K3VA 4J9LA 4G3IA 2C28A 2SCUB 3HT5A 4O3QA 2V58A 4DR5H 2CQYA 3GTJA 4IHJF 4HNUA 2C35B 5BWUA 3UFXB 2Y0SA 4TQSA 3BA9A 5I47A 1J5EH 4NLGA 2JA6G 3I4NG 3KREA 2C22A 1M0TA 3RTXA 4PDBA 4R7RA 1W93A 5DAAA 3J81W 4WHXA 4Q8EA 1Z2OX 1WR2A 1IOWA 4GLXA 2MCTA 3RIZA 2W70A 1CS0A 4F4WA 2UXCH 2PN1A 3BG5A 4JI8H 4YJ2F 3RFCA 5CAEB 2HVSA 3L4JA 3HOZG 4A3DG 2P0AA 4MTDA 4A3KG 3RB3A 5JQGF 4I7HA 2ZJTA 1A9XA 3UZOA 4RAZA 3RAXA 3BQ2A 1P16A 3GIIA 1KJ9A 5I5YA 2NU8B 5DG7A 3IG0A 3BACA 4O84A 1X9NA 1WCMG 2WB1E 4A2AA 4A3MG 3CSWA 4GLWA 1JLLB 5KFGA 4C5CA 5EZYF 2HJWA 3UZBA 2WAQE 4PWQA 4DR7H 4ME6A 2QYZA 4YP3A 5DGHA 3RBEA 3W1GA 1AN7A 2UU9H 3TY5A 5KFRA 4Q8FA 2FPPB 4DL7A 4FS2A 1BNCA 5KFTA 5J2UF 5BR8H 4LF7H 4RUAA 2R82A 4DL3A 5FPOA 4O7SA 2EJ0A 4JV1A 3DTGA 4WBNF 5JUMA 2AQ4A 4J9OA 1I6UA 4JI2H 3RBDA 1Y1VG 1SFOA 2GLTA 2R7NA 1V4YA 2WDTA 1G2WA 3M9NB 5BMVF 2UVWA 4LF4H 2VQDA 2CW7A 2YCHA 4MV8A 3FDSA 1IYEA 2JEIA 1N36H 5FLXW 2DWCA 2HVQA 4IRCA 1O75A 4ECZA 4XYMB 4CE5A 1JXLA 3DF7A 2NU9B 1S68A 5IYBG 3H0GG 2W9BB 4DV7H 2AGQA 3L2PA 5KG1A 4MA0A 4LFCH 4O7TA 3KHRA 3FKIG 3JSNA 3GIMA 2FKLA 1CQJB 3EPGA 3DAAA 1E4FT 5KFPA 3MJFA 4DR4H 1HNXH 1DIKA 4FS1A 3TQ1A 1I2KA 2NVYA 2KSWA 2R8IA 3J80W 4PZ6A 3JZIA 5KFBA 3TIGA 2EJ2A 1N32H 4ECQA 2OWOA 3WWHA 1VBGA 5L1JA 2FJZA 4RB3C 4BY1G 1ULZA 2VA3A 1S03G 2V5AA 4CHIA 2R8KA 5KX5F 5KFCA 4QIWA 5JH7F 2RDIA 2IP4A 3G8DA 3CVZA 5LMUH 4ECSA 4TV9F 1VKZA 1ZAUA 2DAAA 3TW7A 3VNNA 3N6XA 2JA8G 2FK1A 5FD6A 4U6PA 4JI3H 4IRKA 1XK5A 3G6VA 4J9NA 5KFSA 4QIWE 1I7NA 5T14A 2IA6A 4NXNH 2VPSA 1I1MA 3KAJA 2FK3A 2HVRA 5K3WA 4FBUA 1A0IA 2FPGB 1C30A 1ET0A 4IAJA 2HHHH 3K5IA 2R84A 4YB8B 3NBYB 4DIMA 3HKZA 4YR0A 3HOVG 3VA7A 5KFEA 4RUCA 2RGVA 4ED0A 4RNMA 5CR5A 1GSHA 2OLSA 4FU0A 2I8CA 3U9TA 2HIXA 3TQTA 4Q45A 3OHAA 3T1HH 5BWWA 1JIHA 4YR3A 4MV6A 1AUVA 1JX4A 2OH2A 3T9AA 4Q4CA 2DIKA 5CE8A 5DQIA 1OWTA 2W6ZA 3HBLA 4YBZB 3DTFA 2PBZA 1UC9A 2YZMA 3NBZB 1BGWA 5KG0A 4O7VA 1I1LA 1EUDB 4EGQA 3TEKA 4DUZH 2C2RA 2W8LA 2UXBH 2XIGA 5C4XG 5CM0A 1PK8A 2ZDQA 3V6KA 4EBDA 3V6HA 2I80A 2Z04A 4I55F 4O4JF 4C5AA 5KG6A 2WE6A 3T5HA 4B3RH 2CNQA 4O7RA 5LA6F 1K1SA 4RB0A 4Q43A 4TQRA 4J9MA 3RB0A 3GTLA 4O7WA 4RNOA 2ZDGA 3I12A 5CA0F 1EHIA 3N44B 4B3MH 5C1OA 4MV9A 1KJQA 2DLNA 4JXUA 5KFAA 2GPSA 5DGIA 4BWSC 4RB1A 4DR6H 1ZQ7A 4UCUA 3W1BA 4QWDA 4DV5H 5EWEA 4O2AF 3VPCA 3T1YH 4JI1H 4DRFA 4QWAA 3RUPA 4QWEA 3TY8A 3HOXG 5HNEA 2HG8A 3GV8B 1A48A 4X65H 4BY7G 3VPBA 5LP6F 5LXTF 5J2TF 4NYEA 5KG5A 4QSHA 5KT6A 2ODTX 4O7LA 3GIDA 2R7LA 2C00A 1OBGA 1A0GA 3VMMA 5BWRA 3Q8SB 4XX0B 4O3NA 3LQSA 3OTOH 2V4RA 2JA6A 1KTAA 2YW2A 2JA5A 2R7ZA 2M05A 1DGSA 2NVXA 2GQSA 3KTMA 3GV7B 4O3OA 4ED2A 5KFMA 1UC8A 1P8LA 2HDKA 3JRXA 5KFZA 2JA5G 1S97A 4UCTA 2R7ZG 3W5OA 4A3EG 3GJXB 1I2LA 2QB5A 4TVIA 2WTFA 4BBRG 3N43B 4X66H 2R92G 4FFNA 2Y0SE 3PW2A 1GSOA 1OBDA 4O81A 1SYXB 5C3EG 4A3JG 1JKJB 1BXRA 3G6XA 5C8YF 1L2ZA 4TV8F 4KHPH 3GV5B 4BBSG 3PVXA 2W57A 1Z2NX 3T9FA 2VUGA 4LFAH 3QFFA 1B6SA 3QZ8A 5D8DA 2YZLA 4ZI7F 2ASDA 2PMZA 2RGRA 4EEQA 1WCMA 3H20A 1RJQA 2ABJA 2W9BA 4Q44A 4RZRA 2GQRA 3TIIA 2FE3A 4M9UA 4TM5A 5KS8A 5LYJF 1CKNB 2FPIB 1TWGA 3OSNA 3KHGA 3H4BA 5K2MA 3Q8RB 4RCNA 5E25A 3Q1KA 4NZNA 3U0GA 3GIPA 5KG7A 4ECTA 2VPQA 2YL2A 1ZHSA 5KFQA 5KFJA 1WSCA 1VS0A 1FVIA 2XCAA 5IP7G 3N42B 4EYHB 2YYAA 5I5VA 5L9XA 2CKZB 4LFBH 3CEBA 4QW8A 3AW8A 4DQNA 2DPIA 2YWVA 4JUZA 2Y4RA 4UUGA 1M6VA 1KC7A 3KAKA 3T9EA 4RB2C 4LH7A 3IN5A 3T9CA 1Y1VA 2R93A 3Q8PB 5C1PA 3PW4A 2HHFB 4ECXA 3M9OB 3RB6A 4FBTA 5KKNB 3JZ6A 5BYAA 1TWAA 5KG3A 5EWFA 4ED1A 1RYRA 2ASJA 3MR2A 1TA8A 4DV4H 4MV3A 2R93G 4FFLA 3PW0A 4ED3A 3WWJA 2W6OA 4U7CA 5EWGA 3G8CA 3H0GA 5KT4A 4DV1H 4NZMA 4DAAA 4DV3H 3RAQA 1IYDA 1C3OA 3FKIA 4J0MA 4DR1H 3VOTA 3T5LA 5LOVF 4XYLB 5I5XA 4J9RA 3MFHA 3RGZA 2IMWP 5C44G 2ASLA 3VPDA 2Z02A 3U55A 3MWEA 4ZQIA 4DL2A 4FFRA 2ATLA 5LL6b 2W9CB 3V6JA 3PR4A 1GSAA 4JYAH 4DL5A 3T9BA 4EFBA 4YY3H 4YQWA 1I94H 1CQIB 3UQ8A 2Q2UA 4R8UB 4F4ZA 4AYBA 2W6NA 2YZGA 3Q2OA 4HQ6A 1N34H 3BAAA 5D1OB 4EQ5A 4LF8H 3F8NA 4O4HF 5FPRA 2F4VH 2R92A 1XMQH 2XC9A 5EDWA 5KFOA 4X64H 1DV1A 2RDJA 4JI4H 4JI7H 1M0WA 4DL6A 1Z2PX 3PW7A 2BQUA 4HNVA 3LP8A 3EPIA 1T3NA 1IBLH 2J6SA 4GKJH 1N48A 3KXYT 4Y8VB 4EG0A 4LF5H 1RJPA 5EOYA 5F9LA 3GIJA 1RYSA 3RR5A 4O3PA 4QW9A 3L4KA 3SI8A 2JEGA 5DMXA 1IOVA 1XNRH 3NC0B 4M0JA 1KT8A 4ECUA 4IWYA 4NZOA 3T9DA 3KYHC 2YRWA 2FMAA 2W7PA 2W7OA 2AGPA 1VBHA 2I87A 1RK6A 2O03A 3HKZE 3GTKA 5KT2A 3SE7A 4EBEA 2NU7B 2YS7A 2X0SA 3SNOA 3E5NA 1PX2A 5DQHA 4CMFA 4CKCA 4UCSA 1B04A 1W96A 5DQGA 5DLGA 4ED6A 2COIA 2QK4A 4J9KA 4JV0A 2ALZA 5IYZF 2V9WA 4HR7A 5BWTA 2UVUA 5KG2A 4IIJF 2QF7A 2CZGA 4F4YA 3K3PA 3OSPA 3R5HA 3ORQA 3JZFA 2B63G 5KFLA 2R8GA 2UXDH 4IRDA 2R8JA 2FK2A 3BJYA 1V51A 1JDEA 3LMLA 2GPWA 2HGXA 5KFXA 3HOYG 4E6NA 5I5UA 3BABA 4O4IF 3HO8A 5KFHA 2VQFH 4ETSA 4JV2A 5DLFA 4A3GG 2R87A 3S24A 1KEEA 3GDEA 2FLLA 3R23A 4QWCA 3Q8QB 4LF6H 3RB4A 5KFKA 2VA2A 2COJA 2W9AA 2WYOA 3BA8A 3WO1A 1WRVA 2R86A 5I5TA 1A3GA 2XCLA 4IR9A 2VUMG 1I3QA
chains in the Genus database with same CATH topology
2NUAB 2PVPA 1B6RA 2YZNA 2J9GA 5JVDF 4MV1A 2DZDA 3K5HA 1GLVA 1KJJA 4O4LF 4ZHQF 1E4EB 5HV6A 3GLKA 2CNUA 1I7LA 4O83A 4O2BF 1KUTA 4O7NA 3AX6A 3OUZA 4WD3A 2FB9A 4I50F 1GGOA 1KJIA 2FP4B 2HGSA 2W6PA 4L1KA 3R5XA 2V59A 3U9SA 3HB9A 4XZ3B 3JRWA 1EUCB 3MWDA 4DLKA 1KBLA 4O86A 5BPHA 3OUUA 3WNZA 3ETHA 4O7ZA 5CB4F 3LWBA 1JDBB 5BPFA 1AUXA 1EYZA 5H80A 3ETJA 5JQWA 2R85A 3KALA 1T36A 5CA1F 4FFPA 3RV4A 3WO0A 3N8DA 2XD4A 4MA5A 2NU6B 4TUYF 3RV3A 4IZOA 5GONF 3R9RA 1DV2A 2W6QA 2W71A 2R7MA 2ZDHA 3NUAA 4YJ3F 3TW6A 1CE8A 1KJ8A 4MAMA 4MV7A 3ORRA 3U54A 1E4EA 4FE2A 4FFOA 4ZOLF 5FNVF 3N6RA 2CNVA 4RZQA 4FGRA 4MV4A 3V4SA 4FFMA 4O82A 2R7KA 4YAKB 2YS6A 1EZ1A 2YRXA 4HNTA 4I4TF 4O7YA 2W6MA 3V4ZA 4EGJA 4YAJB 4E4TA 3R5FA 4IWXA 5HBRB 2R6FA 3TINA 1SCUB 5JVLA 4C5BA 2VR1A 2SCUB 2V58A 2CQYA 4IHJF 4HNUA 3UFXB 5I47A 3KREA 1M0TA 1W93A 1Z2OX 1WR2A 1IOWA 2W70A 1CS0A 2PN1A 3BG5A 4YJ2F 3RFCA 5CAEB 2P0AA 5JQGF 1A9XA 1KJ9A 2NU8B 4O84A 1JLLB 4C5CA 5EZYF 2HJWA 4ME6A 2FPPB 1BNCA 5J2UF 2R82A 4O7SA 4WBNF 2GLTA 2R7NA 5BMVF 2VQDA 4MV8A 2DWCA 4XYMB 3DF7A 2NU9B 4MA0A 4O7TA 1CQJB 3MJFA 1DIKA 3JZIA 3TIGA 1VBGA 1ULZA 2V5AA 5KX5F 5JH7F 2IP4A 3G8DA 4TV9F 1VKZA 1I7NA 3KAJA 2FPGB 1C30A 3K5IA 2R84A 4YB8B 4DIMA 3VA7A 1GSHA 2OLSA 4FU0A 2I8CA 3U9TA 3TQTA 4MV6A 1AUVA 2DIKA 2W6ZA 3HBLA 4YBZB 2PBZA 2YZMA 1UC9A 4O7VA 1EUDB 4EGQA 1PK8A 2ZDQA 2I80A 2Z04A 4I55F 4O4JF 4C5AA 2CNQA 4O7RA 5LA6F 4O7WA 2ZDGA 3I12A 5CA0F 1EHIA 5C1OA 4MV9A 1KJQA 2DLNA 2GPSA 4O2AF 3VPCA 3RUPA 1A48A 3VPBA 5LP6F 5LXTF 5J2TF 4NYEA 4QSHA 4O7LA 3GIDA 2R7LA 2C00A 1OBGA 3VMMA 4XX0B 2YW2A 2GQSA 1UC8A 3JRXA 4FFNA 1GSOA 1OBDA 4O81A 1JKJB 1BXRA 5C8YF 4TV8F 1Z2NX 3QFFA 1B6SA 5D8DA 2YZLA 4ZI7F 2GQRA 3TIIA 4M9UA 5LYJF 2FPIB 5K2MA 3Q1KA 2VPQA 2YL2A 2YYAA 3AW8A 2YWVA 1KC7A 1M6VA 3KAKA 5C1PA 5KKNB 4MV3A 4FFLA 2W6OA 3G8CA 1C3OA 3VOTA 5LOVF 4XYLB 3VPDA 2Z02A 3U55A 3MWEA 4ZQIA 4FFRA 1GSAA 1CQIB 2W6NA 2YZGA 3Q2OA 4HQ6A 4O4HF 1DV1A 1M0WA 1Z2PX 4HNVA 3LP8A 4Y8VB 4EG0A 5DMXA 1IOVA 4IWYA 2YRWA 1VBHA 2I87A 3SE7A 2NU7B 2YS7A 2X0SA 3E5NA 1PX2A 1W96A 2QK4A 5IYZF 4HR7A 4IIJF 2QF7A 2CZGA 3K3PA 3R5HA 3ORQA 3JZFA 1JDEA 2GPWA 4O4IF 3HO8A 2R87A 1KEEA 3R23A 2WYOA 3WO1A 2R86A 2XCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUA B;  2PVP A;  1B6R A;  2YZN A;  2J9G A;  5JVD F;  4MV1 A;  2DZD A;  3K5H A;  1GLV A;  1KJJ A;  4O4L F;  4ZHQ F;  1E4E B;  5HV6 A;  3GLK A;  2CNU A;  1I7L A;  4O83 A;  4O2B F;  1KUT A;  4O7N A;  3AX6 A;  3OUZ A;  4WD3 A;  2FB9 A;  4I50 F;  1GGO A;  1KJI A;  2FP4 B;  2HGS A;  2W6P A;  4L1K A;  3R5X A;  2V59 A;  3U9S A;  3HB9 A;  4XZ3 B;  3JRW A;  1EUC B;  3MWD A;  4DLK A;  1KBL A;  4O86 A;  5BPH A;  3OUU A;  3WNZ A;  3ETH A;  4O7Z A;  5CB4 F;  3LWB A;  1JDB B;  5BPF A;  1AUX A;  1EYZ A;  5H80 A;  3ETJ A;  5JQW A;  2R85 A;  3KAL A;  1T36 A;  5CA1 F;  4FFP A;  3RV4 A;  3WO0 A;  3N8D A;  2XD4 A;  4MA5 A;  2NU6 B;  4TUY F;  3RV3 A;  4IZO A;  5GON F;  3R9R A;  1DV2 A;  2W6Q A;  2W71 A;  2R7M A;  2ZDH A;  3NUA A;  4YJ3 F;  3TW6 A;  1CE8 A;  1KJ8 A;  4MAM A;  4MV7 A;  3ORR A;  3U54 A;  1E4E A;  4FE2 A;  4FFO A;  4ZOL F;  5FNV F;  3N6R A;  2CNV A;  4RZQ A;  4FGR A;  4MV4 A;  3V4S A;  4FFM A;  4O82 A;  2R7K A;  4YAK B;  2YS6 A;  1EZ1 A;  2YRX A;  4HNT A;  4I4T F;  4O7Y A;  2W6M A;  3V4Z A;  4EGJ A;  4YAJ B;  4E4T A;  3R5F A;  4IWX A;  5HBR B;  2R6F A;  3TIN A;  1SCU B;  5JVL A;  4C5B A;  2VR1 A;  2SCU B;  2V58 A;  2CQY A;  4IHJ F;  4HNU A;  3UFX B;  5I47 A;  3KRE A;  1M0T A;  1W93 A;  1Z2O X;  1WR2 A;  1IOW A;  2W70 A;  1CS0 A;  2PN1 A;  3BG5 A;  4YJ2 F;  3RFC A;  5CAE B;  2P0A A;  5JQG F;  1A9X A;  1KJ9 A;  2NU8 B;  4O84 A;  1JLL B;  4C5C A;  5EZY F;  2HJW A;  4ME6 A;  2FPP B;  1BNC A;  5J2U F;  2R82 A;  4O7S A;  4WBN F;  2GLT A;  2R7N A;  5BMV F;  2VQD A;  4MV8 A;  2DWC A;  4XYM B;  3DF7 A;  2NU9 B;  4MA0 A;  4O7T A;  1CQJ B;  3MJF A;  1DIK A;  3JZI A;  3TIG A;  1VBG A;  1ULZ A;  2V5A A;  5KX5 F;  5JH7 F;  2IP4 A;  3G8D A;  4TV9 F;  1VKZ A;  1I7N A;  3KAJ A;  2FPG B;  1C30 A;  3K5I A;  2R84 A;  4YB8 B;  4DIM A;  3VA7 A;  1GSH A;  2OLS A;  4FU0 A;  2I8C A;  3U9T A;  3TQT A;  4MV6 A;  1AUV A;  2DIK A;  2W6Z A;  3HBL A;  4YBZ B;  2PBZ A;  2YZM A;  1UC9 A;  4O7V A;  1EUD B;  4EGQ A;  1PK8 A;  2ZDQ A;  2I80 A;  2Z04 A;  4I55 F;  4O4J F;  4C5A A;  2CNQ A;  4O7R A;  5LA6 F;  4O7W A;  2ZDG A;  3I12 A;  5CA0 F;  1EHI A;  5C1O A;  4MV9 A;  1KJQ A;  2DLN A;  2GPS A;  4O2A F;  3VPC A;  3RUP A;  1A48 A;  3VPB A;  5LP6 F;  5LXT F;  5J2T F;  4NYE A;  4QSH A;  4O7L A;  3GID A;  2R7L A;  2C00 A;  1OBG A;  3VMM A;  4XX0 B;  2YW2 A;  2GQS A;  1UC8 A;  3JRX A;  4FFN A;  1GSO A;  1OBD A;  4O81 A;  1JKJ B;  1BXR A;  5C8Y F;  4TV8 F;  1Z2N X;  3QFF A;  1B6S A;  5D8D A;  2YZL A;  4ZI7 F;  2GQR A;  3TII A;  4M9U A;  5LYJ F;  2FPI B;  5K2M A;  3Q1K A;  2VPQ A;  2YL2 A;  2YYA A;  3AW8 A;  2YWV A;  1KC7 A;  1M6V A;  3KAK A;  5C1P A;  5KKN B;  4MV3 A;  4FFL A;  2W6O A;  3G8C A;  1C3O A;  3VOT A;  5LOV F;  4XYL B;  3VPD A;  2Z02 A;  3U55 A;  3MWE A;  4ZQI A;  4FFR A;  1GSA A;  1CQI B;  2W6N A;  2YZG A;  3Q2O A;  4HQ6 A;  4O4H F;  1DV1 A;  1M0W A;  1Z2P X;  4HNV A;  3LP8 A;  4Y8V B;  4EG0 A;  5DMX A;  1IOV A;  4IWY A;  2YRW A;  1VBH A;  2I87 A;  3SE7 A;  2NU7 B;  2YS7 A;  2X0S A;  3E5N A;  1PX2 A;  1W96 A;  2QK4 A;  5IYZ F;  4HR7 A;  4IIJ F;  2QF7 A;  2CZG A;  3K3P A;  3R5H A;  3ORQ A;  3JZF A;  1JDE A;  2GPW A;  4O4I F;  3HO8 A;  2R87 A;  1KEE A;  3R23 A;  2WYO A;  3WO1 A;  2R86 A;  2XCL A; 
#chains in the Genus database with same CATH topology
 2NUA B;  2R8H A;  1TWH A;  1CKN A;  3GIK A;  2UUB H;  2PVP A;  1IBM H;  3HOW G;  1FKA H;  1B6R A;  2YZN A;  4LSX A;  1N56 A;  2JEF A;  4DR2 H;  4JI5 H;  1UNN C;  2J9G A;  4J9P A;  5IYC G;  1S9F A;  2W8K A;  3KHL A;  4YR2 A;  4CC5 A;  5JVD F;  3J7A K;  4C2M A;  2V4Q A;  4ED8 A;  4RAY A;  4MV1 A;  3MR6 A;  5BYB A;  5IP9 G;  2DZD A;  4B3T H;  1K83 A;  2HHF A;  2AGO A;  3RF2 A;  3K5H A;  1GLV A;  5KFD A;  1KJJ A;  5IWA H;  1TWC A;  4O4L F;  2JA7 A;  2J6U A;  3SGI A;  1K1Q A;  2UUA H;  1Y1W A;  2RF4 A;  5L1K A;  4ZHQ F;  2VQE H;  1E4E B;  4JV5 H;  3H4D A;  2UVV A;  5HV6 A;  1SEI A;  1RJR A;  3GLK A;  2JA7 G;  1XNQ H;  4F50 A;  4UCR A;  1Y1W G;  1MZB A;  4GC7 A;  3I4M G;  4JI6 H;  5F9N A;  2CNU A;  2HIV A;  1I7L A;  2JEJ A;  4O83 A;  1FJG H;  2E5L H;  2COG A;  4O2B F;  5IYD G;  4A3L G;  4A93 G;  1KUT A;  5KG4 A;  4O7N A;  2PMZ E;  3AX6 A;  4ECV A;  2W9C A;  2YU9 A;  4DV2 H;  3OUZ A;  3C0F B;  4GKK H;  4WD3 A;  2XGP A;  4O3R A;  3MFI A;  4DV6 H;  2C2E A;  2FB9 A;  2DPJ A;  1EKV A;  4GC6 A;  2EJ3 A;  4R8U A;  2ZGI A;  1WH2 A;  4I50 F;  1GGO A;  1KJI A;  5D1O A;  2FP4 B;  4RNN A;  2XGQ A;  5L1L A;  2HGS A;  2W6P A;  4ECY A;  2DAB A;  2WB1 A;  3KHH A;  4L1K A;  2VOB A;  3R5X A;  3HXL A;  2V59 A;  2WAQ A;  5DG9 A;  3G6Y A;  3PZP A;  1ZET A;  1CKM A;  4HYK A;  3CQZ A;  2FLP A;  3U9S A;  3HB9 A;  3FMA A;  1N33 H;  4EFE A;  4XZ3 B;  4JI0 H;  3JRW A;  1EUC B;  3MWD A;  4DLK A;  1KBL A;  4UFZ A;  4EBC A;  4O86 A;  5FR9 A;  5BPH A;  3OUU A;  3WNZ A;  2BR0 A;  1E4G T;  5KFF A;  3EYY A;  4FM9 A;  4Q0Y A;  3ETH A;  4O7Z A;  5CB4 F;  4M7E A;  4DV0 H;  1I50 A;  5KFU A;  1XDN A;  3BQ0 A;  1I1K A;  5FJ8 G;  3LWB A;  1JDB B;  5BWV A;  5DGA A;  4PZ7 A;  5BPF A;  1S0O A;  5FD5 A;  4YHH H;  4MTE A;  4LMY A;  2C2D A;  4OX9 H;  1HNZ H;  2X5R A;  3TY9 A;  1R9T A;  4ED7 A;  3H3V H;  1XMO H;  4CC6 A;  5DIS C;  1AUX A;  4AQY H;  4K6N A;  3MWM A;  1EYZ A;  5H80 A;  2IBK A;  4AYB E;  3PFF A;  4EEY A;  3MR5 A;  4Q4D A;  5D1P A;  3ETJ A;  5JQW A;  3T5K A;  4A2B A;  1IBK H;  2R85 A;  4HN2 A;  4CKB A;  5KFN A;  3KAL A;  3OHB A;  1T36 A;  5CA1 F;  4FFP A;  3RV4 A;  3WO0 A;  4CKE A;  3N8D A;  4B3S H;  2XD4 A;  4J9S A;  3GQC A;  5DGB A;  4MA5 A;  3PO2 G;  4UCV A;  4DR3 H;  2NU6 B;  3T5J A;  5LMN H;  4F4X A;  4TUY F;  1M7J A;  2ZM6 H;  3RV3 A;  4IZO A;  5I5W A;  1GYF A;  4O3S A;  3MR3 A;  3QZ7 A;  4A3B G;  1T94 A;  4QJF A;  3NGD A;  4J9Q A;  2E2H A;  5KT5 A;  1EKF A;  3H40 A;  5GON F;  1B33 N;  4A3C G;  4CMD A;  2AU0 A;  3R9R A;  3GTO A;  1DV2 A;  5KFY A;  4DL4 A;  4LSA A;  1S10 A;  2B63 A;  2W6Q A;  2W71 A;  4ECW A;  3N41 B;  3JAM W;  3PN1 A;  1TWF A;  3GIQ A;  1HR0 H;  3PW5 A;  1HNW H;  5IT9 W;  4A3I G;  2R7M A;  2J6T A;  2ZDH A;  3NUA A;  4PBC A;  2CW8 A;  4ECR A;  4YJ3 F;  4LH6 A;  4UCO A;  3TW6 A;  1CE8 A;  3GTM A;  5L1I A;  5A2Q W;  1KJ8 A;  4MAM A;  4MV7 A;  3PO3 G;  3ORR A;  2E2I A;  3N40 P;  5KT3 A;  1GO3 E;  3U54 A;  4LF9 H;  4DUY H;  1E4E A;  2VUM A;  4FE2 A;  4FFO A;  5BWX A;  4ZOL F;  5FNV F;  1EKP A;  4QWB A;  3RJ0 A;  5C5J A;  3N6R A;  2FLN A;  4NXM H;  5DG8 A;  2CNV A;  3BQ1 A;  3GB8 B;  4PZ8 A;  4RZQ A;  3UYY A;  3HOU G;  4FGR A;  3QQM A;  2CFM A;  2BQR A;  2A1H A;  2HGW A;  5I5S A;  3RGX A;  4MV4 A;  3V4S A;  3PR5 B;  3AYH B;  4FFM A;  1BJT A;  4APM A;  2EIY A;  4O82 A;  2R7K A;  1S0N A;  3M4I A;  3QWU A;  4YAK B;  4IR1 A;  4BXX G;  2YS6 A;  1EZ1 A;  2YRX A;  4HNT A;  4I4T F;  4O7Y A;  2UVR A;  1VAJ A;  5KT7 A;  5KFW A;  3GIL A;  1RK5 A;  2W6M A;  3V4Z A;  4EGJ A;  4YAJ B;  3T7A A;  5KFV A;  3LUL A;  4E4T A;  3GTP A;  2UUC H;  3R5F A;  4IWX A;  5HBR B;  1V9P A;  1Y14 B;  4RU9 A;  2R6F A;  2BQ3 A;  3M9M B;  1S0M A;  3GTQ A;  2Q7D A;  3WWI A;  3TIN A;  5FLM G;  1CKO A;  2XCP A;  4K0K H;  4A3F G;  1DAA A;  5KFI A;  1TAE A;  2Q2T A;  3T54 A;  3JSL A;  4X62 H;  1ZHQ A;  1SCU B;  5JVL A;  4C5B A;  4EYI B;  3GTG A;  2VR1 A;  3T99 A;  5I60 A;  3K3V A;  4J9L A;  4G3I A;  2C28 A;  2SCU B;  3HT5 A;  4O3Q A;  2V58 A;  4DR5 H;  2CQY A;  3GTJ A;  4IHJ F;  4HNU A;  2C35 B;  5BWU A;  3UFX B;  2Y0S A;  4TQS A;  3BA9 A;  5I47 A;  1J5E H;  4NLG A;  2JA6 G;  3I4N G;  3KRE A;  2C22 A;  1M0T A;  3RTX A;  4PDB A;  4R7R A;  1W93 A;  5DAA A;  3J81 W;  4WHX A;  4Q8E A;  1Z2O X;  1WR2 A;  1IOW A;  4GLX A;  2MCT A;  3RIZ A;  2W70 A;  1CS0 A;  4F4W A;  2UXC H;  2PN1 A;  3BG5 A;  4JI8 H;  4YJ2 F;  3RFC A;  5CAE B;  2HVS A;  3L4J A;  3HOZ G;  4A3D G;  2P0A A;  4MTD A;  4A3K G;  3RB3 A;  5JQG F;  4I7H A;  2ZJT A;  1A9X A;  3UZO A;  4RAZ A;  3RAX A;  3BQ2 A;  1P16 A;  3GII A;  1KJ9 A;  5I5Y A;  2NU8 B;  5DG7 A;  3IG0 A;  3BAC A;  4O84 A;  1X9N A;  1WCM G;  2WB1 E;  4A2A A;  4A3M G;  3CSW A;  4GLW A;  1JLL B;  5KFG A;  4C5C A;  5EZY F;  2HJW A;  3UZB A;  2WAQ E;  4PWQ A;  4DR7 H;  4ME6 A;  2QYZ A;  4YP3 A;  5DGH A;  3RBE A;  3W1G A;  1AN7 A;  2UU9 H;  3TY5 A;  5KFR A;  4Q8F A;  2FPP B;  4DL7 A;  4FS2 A;  1BNC A;  5KFT A;  5J2U F;  5BR8 H;  4LF7 H;  4RUA A;  2R82 A;  4DL3 A;  5FPO A;  4O7S A;  2EJ0 A;  4JV1 A;  3DTG A;  4WBN F;  5JUM A;  2AQ4 A;  4J9O A;  1I6U A;  4JI2 H;  3RBD A;  1Y1V G;  1SFO A;  2GLT A;  2R7N A;  1V4Y A;  2WDT A;  1G2W A;  3M9N B;  5BMV F;  2UVW A;  4LF4 H;  2VQD A;  2CW7 A;  2YCH A;  4MV8 A;  3FDS A;  1IYE A;  2JEI A;  1N36 H;  5FLX W;  2DWC A;  2HVQ A;  4IRC A;  1O75 A;  4ECZ A;  4XYM B;  4CE5 A;  1JXL A;  3DF7 A;  2NU9 B;  1S68 A;  5IYB G;  3H0G G;  2W9B B;  4DV7 H;  2AGQ A;  3L2P A;  5KG1 A;  4MA0 A;  4LFC H;  4O7T A;  3KHR A;  3FKI G;  3JSN A;  3GIM A;  2FKL A;  1CQJ B;  3EPG A;  3DAA A;  1E4F T;  5KFP A;  3MJF A;  4DR4 H;  1HNX H;  1DIK A;  4FS1 A;  3TQ1 A;  1I2K A;  2NVY A;  2KSW A;  2R8I A;  3J80 W;  4PZ6 A;  3JZI A;  5KFB A;  3TIG A;  2EJ2 A;  1N32 H;  4ECQ A;  2OWO A;  3WWH A;  1VBG A;  5L1J A;  2FJZ A;  4RB3 C;  4BY1 G;  1ULZ A;  2VA3 A;  1S03 G;  2V5A A;  4CHI A;  2R8K A;  5KX5 F;  5KFC A;  4QIW A;  5JH7 F;  2RDI A;  2IP4 A;  3G8D A;  3CVZ A;  5LMU H;  4ECS A;  4TV9 F;  1VKZ A;  1ZAU A;  2DAA A;  3TW7 A;  3VNN A;  3N6X A;  2JA8 G;  2FK1 A;  5FD6 A;  4U6P A;  4JI3 H;  4IRK A;  1XK5 A;  3G6V A;  4J9N A;  5KFS A;  4QIW E;  1I7N A;  5T14 A;  2IA6 A;  4NXN H;  2VPS A;  1I1M A;  3KAJ A;  2FK3 A;  2HVR A;  5K3W A;  4FBU A;  1A0I A;  2FPG B;  1C30 A;  1ET0 A;  4IAJ A;  2HHH H;  3K5I A;  2R84 A;  4YB8 B;  3NBY B;  4DIM A;  3HKZ A;  4YR0 A;  3HOV G;  3VA7 A;  5KFE A;  4RUC A;  2RGV A;  4ED0 A;  4RNM A;  5CR5 A;  1GSH A;  2OLS A;  4FU0 A;  2I8C A;  3U9T A;  2HIX A;  3TQT A;  4Q45 A;  3OHA A;  3T1H H;  5BWW A;  1JIH A;  4YR3 A;  4MV6 A;  1AUV A;  1JX4 A;  2OH2 A;  3T9A A;  4Q4C A;  2DIK A;  5CE8 A;  5DQI A;  1OWT A;  2W6Z A;  3HBL A;  4YBZ B;  3DTF A;  2PBZ A;  1UC9 A;  2YZM A;  3NBZ B;  1BGW A;  5KG0 A;  4O7V A;  1I1L A;  1EUD B;  4EGQ A;  3TEK A;  4DUZ H;  2C2R A;  2W8L A;  2UXB H;  2XIG A;  5C4X G;  5CM0 A;  1PK8 A;  2ZDQ A;  3V6K A;  4EBD A;  3V6H A;  2I80 A;  2Z04 A;  4I55 F;  4O4J F;  4C5A A;  5KG6 A;  2WE6 A;  3T5H A;  4B3R H;  2CNQ A;  4O7R A;  5LA6 F;  1K1S A;  4RB0 A;  4Q43 A;  4TQR A;  4J9M A;  3RB0 A;  3GTL A;  4O7W A;  4RNO A;  2ZDG A;  3I12 A;  5CA0 F;  1EHI A;  3N44 B;  4B3M H;  5C1O A;  4MV9 A;  1KJQ A;  2DLN A;  4JXU A;  5KFA A;  2GPS A;  5DGI A;  4BWS C;  4RB1 A;  4DR6 H;  1ZQ7 A;  4UCU A;  3W1B A;  4QWD A;  4DV5 H;  5EWE A;  4O2A F;  3VPC A;  3T1Y H;  4JI1 H;  4DRF A;  4QWA A;  3RUP A;  4QWE A;  3TY8 A;  3HOX G;  5HNE A;  2HG8 A;  3GV8 B;  1A48 A;  4X65 H;  4BY7 G;  3VPB A;  5LP6 F;  5LXT F;  5J2T F;  4NYE A;  5KG5 A;  4QSH A;  5KT6 A;  2ODT X;  4O7L A;  3GID A;  2R7L A;  2C00 A;  1OBG A;  1A0G A;  3VMM A;  5BWR A;  3Q8S B;  4XX0 B;  4O3N A;  3LQS A;  3OTO H;  2V4R A;  2JA6 A;  1KTA A;  2YW2 A;  2JA5 A;  2R7Z A;  2M05 A;  1DGS A;  2NVX A;  2GQS A;  3KTM A;  3GV7 B;  4O3O A;  4ED2 A;  5KFM A;  1UC8 A;  1P8L A;  2HDK A;  3JRX A;  5KFZ A;  2JA5 G;  1S97 A;  4UCT A;  2R7Z G;  3W5O A;  4A3E G;  3GJX B;  1I2L A;  2QB5 A;  4TVI A;  2WTF A;  4BBR G;  3N43 B;  4X66 H;  2R92 G;  4FFN A;  2Y0S E;  3PW2 A;  1GSO A;  1OBD A;  4O81 A;  1SYX B;  5C3E G;  4A3J G;  1JKJ B;  1BXR A;  3G6X A;  5C8Y F;  1L2Z A;  4TV8 F;  4KHP H;  3GV5 B;  4BBS G;  3PVX A;  2W57 A;  1Z2N X;  3T9F A;  2VUG A;  4LFA H;  3QFF A;  1B6S A;  3QZ8 A;  5D8D A;  2YZL A;  4ZI7 F;  2ASD A;  2PMZ A;  2RGR A;  4EEQ A;  1WCM A;  3H20 A;  1RJQ A;  2ABJ A;  2W9B A;  4Q44 A;  4RZR A;  2GQR A;  3TII A;  2FE3 A;  4M9U A;  4TM5 A;  5KS8 A;  5LYJ F;  1CKN B;  2FPI B;  1TWG A;  3OSN A;  3KHG A;  3H4B A;  5K2M A;  3Q8R B;  4RCN A;  5E25 A;  3Q1K A;  4NZN A;  3U0G A;  3GIP A;  5KG7 A;  4ECT A;  2VPQ A;  2YL2 A;  1ZHS A;  5KFQ A;  5KFJ A;  1WSC A;  1VS0 A;  1FVI A;  2XCA A;  5IP7 G;  3N42 B;  4EYH B;  2YYA A;  5I5V A;  5L9X A;  2CKZ B;  4LFB H;  3CEB A;  4QW8 A;  3AW8 A;  4DQN A;  2DPI A;  2YWV A;  4JUZ A;  2Y4R A;  4UUG A;  1M6V A;  1KC7 A;  3KAK A;  3T9E A;  4RB2 C;  4LH7 A;  3IN5 A;  3T9C A;  1Y1V A;  2R93 A;  3Q8P B;  5C1P A;  3PW4 A;  2HHF B;  4ECX A;  3M9O B;  3RB6 A;  4FBT A;  5KKN B;  3JZ6 A;  5BYA A;  1TWA A;  5KG3 A;  5EWF A;  4ED1 A;  1RYR A;  2ASJ A;  3MR2 A;  1TA8 A;  4DV4 H;  4MV3 A;  2R93 G;  4FFL A;  3PW0 A;  4ED3 A;  3WWJ A;  2W6O A;  4U7C A;  5EWG A;  3G8C A;  3H0G A;  5KT4 A;  4DV1 H;  4NZM A;  4DAA A;  4DV3 H;  3RAQ A;  1IYD A;  1C3O A;  3FKI A;  4J0M A;  4DR1 H;  3VOT A;  3T5L A;  5LOV F;  4XYL B;  5I5X A;  4J9R A;  3MFH A;  3RGZ A;  2IMW P;  5C44 G;  2ASL A;  3VPD A;  2Z02 A;  3U55 A;  3MWE A;  4ZQI A;  4DL2 A;  4FFR A;  2ATL A;  5LL6 b;  2W9C B;  3V6J A;  3PR4 A;  1GSA A;  4JYA H;  4DL5 A;  3T9B A;  4EFB A;  4YY3 H;  4YQW A;  1I94 H;  1CQI B;  3UQ8 A;  2Q2U A;  4R8U B;  4F4Z A;  4AYB A;  2W6N A;  2YZG A;  3Q2O A;  4HQ6 A;  1N34 H;  3BAA A;  5D1O B;  4EQ5 A;  4LF8 H;  3F8N A;  4O4H F;  5FPR A;  2F4V H;  2R92 A;  1XMQ H;  2XC9 A;  5EDW A;  5KFO A;  4X64 H;  1DV1 A;  2RDJ A;  4JI4 H;  4JI7 H;  1M0W A;  4DL6 A;  1Z2P X;  3PW7 A;  2BQU A;  4HNV A;  3LP8 A;  3EPI A;  1T3N A;  1IBL H;  2J6S A;  4GKJ H;  1N48 A;  3KXY T;  4Y8V B;  4EG0 A;  4LF5 H;  1RJP A;  5EOY A;  5F9L A;  3GIJ A;  1RYS A;  3RR5 A;  4O3P A;  4QW9 A;  3L4K A;  3SI8 A;  2JEG A;  5DMX A;  1IOV A;  1XNR H;  3NC0 B;  4M0J A;  1KT8 A;  4ECU A;  4IWY A;  4NZO A;  3T9D A;  3KYH C;  2YRW A;  2FMA A;  2W7P A;  2W7O A;  2AGP A;  1VBH A;  2I87 A;  1RK6 A;  2O03 A;  3HKZ E;  3GTK A;  5KT2 A;  3SE7 A;  4EBE A;  2NU7 B;  2YS7 A;  2X0S A;  3SNO A;  3E5N A;  1PX2 A;  5DQH A;  4CMF A;  4CKC A;  4UCS A;  1B04 A;  1W96 A;  5DQG A;  5DLG A;  4ED6 A;  2COI A;  2QK4 A;  4J9K A;  4JV0 A;  2ALZ A;  5IYZ F;  2V9W A;  4HR7 A;  5BWT A;  2UVU A;  5KG2 A;  4IIJ F;  2QF7 A;  2CZG A;  4F4Y A;  3K3P A;  3OSP A;  3R5H A;  3ORQ A;  3JZF A;  2B63 G;  5KFL A;  2R8G A;  2UXD H;  4IRD A;  2R8J A;  2FK2 A;  3BJY A;  1V51 A;  1JDE A;  3LML A;  2GPW A;  2HGX A;  5KFX A;  3HOY G;  4E6N A;  5I5U A;  3BAB A;  4O4I F;  3HO8 A;  5KFH A;  2VQF H;  4ETS A;  4JV2 A;  5DLF A;  4A3G G;  2R87 A;  3S24 A;  1KEE A;  3GDE A;  2FLL A;  3R23 A;  4QWC A;  3Q8Q B;  4LF6 H;  3RB4 A;  5KFK A;  2VA2 A;  2COJ A;  2W9A A;  2WYO A;  3BA8 A;  3WO1 A;  1WRV A;  2R86 A;  5I5T A;  1A3G A;  2XCL A;  4IR9 A;  2VUM G;  1I3Q A; 
#chains in the Genus database with same CATH homology
 2NUA B;  2PVP A;  1B6R A;  2YZN A;  2J9G A;  5JVD F;  4MV1 A;  2DZD A;  3K5H A;  1GLV A;  1KJJ A;  4O4L F;  4ZHQ F;  1E4E B;  5HV6 A;  3GLK A;  2CNU A;  1I7L A;  4O83 A;  4O2B F;  1KUT A;  4O7N A;  3AX6 A;  3OUZ A;  4WD3 A;  2FB9 A;  4I50 F;  1GGO A;  1KJI A;  2FP4 B;  2HGS A;  2W6P A;  4L1K A;  3R5X A;  2V59 A;  3U9S A;  3HB9 A;  4XZ3 B;  3JRW A;  1EUC B;  3MWD A;  4DLK A;  1KBL A;  4O86 A;  5BPH A;  3OUU A;  3WNZ A;  3ETH A;  4O7Z A;  5CB4 F;  3LWB A;  1JDB B;  5BPF A;  1AUX A;  1EYZ A;  5H80 A;  3ETJ A;  5JQW A;  2R85 A;  3KAL A;  1T36 A;  5CA1 F;  4FFP A;  3RV4 A;  3WO0 A;  3N8D A;  2XD4 A;  4MA5 A;  2NU6 B;  4TUY F;  3RV3 A;  4IZO A;  5GON F;  3R9R A;  1DV2 A;  2W6Q A;  2W71 A;  2R7M A;  2ZDH A;  3NUA A;  4YJ3 F;  3TW6 A;  1CE8 A;  1KJ8 A;  4MAM A;  4MV7 A;  3ORR A;  3U54 A;  1E4E A;  4FE2 A;  4FFO A;  4ZOL F;  5FNV F;  3N6R A;  2CNV A;  4RZQ A;  4FGR A;  4MV4 A;  3V4S A;  4FFM A;  4O82 A;  2R7K A;  4YAK B;  2YS6 A;  1EZ1 A;  2YRX A;  4HNT A;  4I4T F;  4O7Y A;  2W6M A;  3V4Z A;  4EGJ A;  4YAJ B;  4E4T A;  3R5F A;  4IWX A;  5HBR B;  2R6F A;  3TIN A;  1SCU B;  5JVL A;  4C5B A;  2VR1 A;  2SCU B;  2V58 A;  2CQY A;  4IHJ F;  4HNU A;  3UFX B;  5I47 A;  3KRE A;  1M0T A;  1W93 A;  1Z2O X;  1WR2 A;  1IOW A;  2W70 A;  1CS0 A;  2PN1 A;  3BG5 A;  4YJ2 F;  3RFC A;  5CAE B;  2P0A A;  5JQG F;  1A9X A;  1KJ9 A;  2NU8 B;  4O84 A;  1JLL B;  4C5C A;  5EZY F;  2HJW A;  4ME6 A;  2FPP B;  1BNC A;  5J2U F;  2R82 A;  4O7S A;  4WBN F;  2GLT A;  2R7N A;  5BMV F;  2VQD A;  4MV8 A;  2DWC A;  4XYM B;  3DF7 A;  2NU9 B;  4MA0 A;  4O7T A;  1CQJ B;  3MJF A;  1DIK A;  3JZI A;  3TIG A;  1VBG A;  1ULZ A;  2V5A A;  5KX5 F;  5JH7 F;  2IP4 A;  3G8D A;  4TV9 F;  1VKZ A;  1I7N A;  3KAJ A;  2FPG B;  1C30 A;  3K5I A;  2R84 A;  4YB8 B;  4DIM A;  3VA7 A;  1GSH A;  2OLS A;  4FU0 A;  2I8C A;  3U9T A;  3TQT A;  4MV6 A;  1AUV A;  2DIK A;  2W6Z A;  3HBL A;  4YBZ B;  2PBZ A;  2YZM A;  1UC9 A;  4O7V A;  1EUD B;  4EGQ A;  1PK8 A;  2ZDQ A;  2I80 A;  2Z04 A;  4I55 F;  4O4J F;  4C5A A;  2CNQ A;  4O7R A;  5LA6 F;  4O7W A;  2ZDG A;  3I12 A;  5CA0 F;  1EHI A;  5C1O A;  4MV9 A;  1KJQ A;  2DLN A;  2GPS A;  4O2A F;  3VPC A;  3RUP A;  1A48 A;  3VPB A;  5LP6 F;  5LXT F;  5J2T F;  4NYE A;  4QSH A;  4O7L A;  3GID A;  2R7L A;  2C00 A;  1OBG A;  3VMM A;  4XX0 B;  2YW2 A;  2GQS A;  1UC8 A;  3JRX A;  4FFN A;  1GSO A;  1OBD A;  4O81 A;  1JKJ B;  1BXR A;  5C8Y F;  4TV8 F;  1Z2N X;  3QFF A;  1B6S A;  5D8D A;  2YZL A;  4ZI7 F;  2GQR A;  3TII A;  4M9U A;  5LYJ F;  2FPI B;  5K2M A;  3Q1K A;  2VPQ A;  2YL2 A;  2YYA A;  3AW8 A;  2YWV A;  1KC7 A;  1M6V A;  3KAK A;  5C1P A;  5KKN B;  4MV3 A;  4FFL A;  2W6O A;  3G8C A;  1C3O A;  3VOT A;  5LOV F;  4XYL B;  3VPD A;  2Z02 A;  3U55 A;  3MWE A;  4ZQI A;  4FFR A;  1GSA A;  1CQI B;  2W6N A;  2YZG A;  3Q2O A;  4HQ6 A;  4O4H F;  1DV1 A;  1M0W A;  1Z2P X;  4HNV A;  3LP8 A;  4Y8V B;  4EG0 A;  5DMX A;  1IOV A;  4IWY A;  2YRW A;  1VBH A;  2I87 A;  3SE7 A;  2NU7 B;  2YS7 A;  2X0S A;  3E5N A;  1PX2 A;  1W96 A;  2QK4 A;  5IYZ F;  4HR7 A;  4IIJ F;  2QF7 A;  2CZG A;  3K3P A;  3R5H A;  3ORQ A;  3JZF A;  1JDE A;  2GPW A;  4O4I F;  3HO8 A;  2R87 A;  1KEE A;  3R23 A;  2WYO A;  3WO1 A;  2R86 A;  2XCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...