2R86A

Crystal structure of purp from pyrococcus furiosus complexed with atp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
334
structure length
334
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGAKGGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords PurP protein PF1517
total genus 102
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r86A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r86A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r86A01
2DLNA 2W6ZA 2IP4A 3R5HA 3U9TA 4NYEA 4O4JF 5LXTF 2W70A 2Z02A 2YWVA 3R5XA 3G8CA 3N8DA 4DIMA 2YW2A 4IIJF 3OUZA 2NU9B 3BSWA 4TV8F 5DMXA 4FU0A 1WR2A 3ORRA 4MV3A 1GSHA 2R82A 4MAMA 5LOVF 2J9GA 1GGOA 1KJIA 1DV2A 4XX0B 4M9CA 1DIKA 3WNZA 3VPDA 3TIIA 3U55A 1CQJB 4YBZB 5LYJF 4I55F 2QK4A 2R7NA 3WO1A 3KREA 5CB4F 1GSOA 3R5FA 4MV1A 2W71A 3G8DA 3VOTA 5CA0F 2DWCA 3U9SA 3JZFA 3ORQA 3K5HA 4MV9A 3GIDA 4FE2A 2YRWA 2R85A 2I8CA 3MWEA 3V4SA 2V58A 3SE7A 4J6EA 4EA8A 5J2TF 4HR7A 4TUYF 2CNUA 2YZMA 1M6VA 4O86A 1JDBB 4ZI7F 2PBZA 4MA0A 4WBNF 2FPGB 4EA7A 4YB8B 2R86A 5EZYF 1W96A 3BSSA 1DV1A 4ZOLF 4EGJA 1VBHA 3JRWA 1CS0A 4O83A 4IHJF 5D8DA 2I87A 1I7NA 4WD3A 2GQRA 2R84A 4EABA 1EHIA 1C30A 2CQYA 1W93A 3MJFA 3R9RA 4EA9A 2X0SA 2C00A 1BXRA 5HBRB 1GSAA 4YJ2F 4YJ3F 4IZOA 1JDEA 3DF7A 5GONF 1A48A 3ETJA 1B6SA 4Y8VB 2HGSA 1UC9A 3JRXA 3RUPA 4EG0A 1Z2PX 1EYZA 4O4HF 4XYLB 2W6PA 1PK8A 1I7LA 1KJ9A 5JQWA 4O4IF 4FFLA 5H80A 4HNUA 5JH7F 2YL2A 4M98A 1OBDA 2GLTA 5KKNB 3TQTA 1CQIB 2NPOA 2GQSA 3KALA 3VMMA 2PVPA 4O7RA 4MV4A 5FNVF 2CNQA 2OLSA 3BFPA 1VBGA 2DIKA 4O81A 3UFXB 4C5AA 3ETHA 1AUVA 3OUUA 3JZIA 3K3PA 4HNVA 4YAJB 2W6QA 3I12A 1AUXA 4O7WA 4RZQA 2YZNA 2ZDHA 3TW6A 3WO0A 5K2MA 3RV3A 3E5NA 4FFPA 4O7YA 4MV7A 4O2AF 1KJ8A 2R7LA 3RFCA 5J2UF 3Q1KA 3AW8A 5KX5F 1E4EB 5CA1F 3AX6A 2YYAA 4HQ6A 3LWBA 4IWXA 2FP4B 3VA7A 2SCUB 2W6MA 1EZ1A 3Q2OA 4FGRA 1A9XA 3K5IA 3HBLA 2FB9A 4O7TA 2I80A 2YZLA 2P0AA 1OBGA 2VR1A 5HV6A 3BG5A 1KBLA 2R6FA 4C5BA 1CE8A 4M99A 1KC7A 1M0WA 3U54A 4M9UA 3QFFA 2YZGA 3GLKA 2VPQA 5JVDF 4XYMB 4GGMX 5I47A 2NU7B 3TIGA 3R23A 4O2BF 4C5CA 4MV6A 3MWDA 2YRXA 2CZGA 5JQGF 2FPIB 2W6OA 1E4EA 1BNCA 1T36A 3TINA 5JVLA 4L1KA 3NUAA 2R87A 5LP6F 2VHEA 3VPCA 5IYZF 5CAEB 1VKZA 4ZQIA 1EUDB 3RV4A 4ZHQF 1SCUB 2DZDA 4O84A 4XZ3B 2YS6A 4O7LA 4FFRA 3VPBA 1IOWA 2ZDQA 4FFOA 1KUTA 2V59A 2CNVA 1JKJB 2R7MA 3KAKA 4DLKA 4O82A 4TV9F 2Z04A 4I4TF 2R7KA 1B6RA 2HJWA 4O7ZA 1EUCB 2XCLA 4E4TA 1C3OA 2FPPB 1GLVA 1Z2NX 4EAAA 2NUAB 1PX2A 5C8YF 1ULZA 4O7NA 1KJJA 2W6NA 1UC8A 3KAJA 2YS7A 5LA6F 4QSHA 4HNTA 5C1PA 3HB9A 2V5AA 1KJQA 4YAKB 2WYOA 4FFNA 4O7SA 4MV8A 1IOVA 4O4LF 4MA5A 2XD4A 2NU8B 1JLLB 2VQDA 3BSYA 3N6RA 1KEEA 4I50F 4IWYA 2NU6B 4FFMA 2QF7A 5BPHA 2GPSA 4O7VA 5BPFA 2GPWA 5C1OA 1Z2OX 3V4ZA 5BMVF 2PN1A 3LP8A 4EGQA 2ZDGA 3HO8A 1M0TA 4ME6A
chains in the Genus database with same CATH superfamily
1L0BA 1VYTA 1ANKA 2YXNA 4FINA 1U5BB 3G2NA 2DQKA 1II0A 3PWSA 3SYLA 2C5FA 5EEGA 4H31A 1TEVA 1QR6A 2BDEA 2WF6A 2XSZD 5JPCA 5ELXA 3G5TA 4ID3A 3E18A 1C3VA 1PAUA 1YZHA 1Z8NA 2Q8QA 2QT0A 5E1BA 3LT5A 1F4PA 2VAXA 3T1YH 1XD8A 3ZCRA 4TQ9A 3Q72A 3HN6A 1P9OA 5C4XG 1VL8A 4MKRA 2XXAA 1GEEA 3W2FA 2CVQA 3ILHA 1V1MB 3DEIA 2QX4A 2ANBA 4O3PA 4C29A 2ZQZA 4BE7B 1RYHA 3KQKA 3LZ6A 2FNAA 3MSCA 4KE8A 2JASA 3HVKA 5AKGA 1AMUA 1SQ5A 4FMBB 3FGZA 1I3NA 2H2IA 1VMAA 3JD0A 2HJRA 1RZ3A 3ORYA 3MWEB 2VT3A 4NOMA 1VJGA 2VUIB 1DBQA 4ITRC 3LDGA 2BUCA 5AI5A 4HZIA 3RVDA 1VJCA 1TYAE 4TYQA 3H5TA 1YJCA 4LI0A 2FKNA 1FW6A 4JCCA 1KJIA 2ZI7A 4RMHA 2Y1WA 3MHPA 1WXQA 5DSTA 1VHWA 3ZDBA 1OROA 1XPUA 1M5TA 2PO7A 3A11A 5HJ7A 1EXMA 1KAEA 4U2KA 5DWVA 4F1WA 3S44A 2JFYA 1C9NA 1MJHA 3IMEA 3OO1A 2C2GA 2Q8PA 4RSMA 1N6RA 2PGJA 2QTHA 3LX8A 3SGIA 2GCNA 5LOVB 3AF6A 4I55F 1TUBB 2H2AA 5BNIA 1DKLA 2JAWA 2HDOA 1EI9A 1VFNA 2G4VA 4OGFA 3M4JA 4TZ6A 3GVHA 3Q8LA 4EHJA 3A4YA 4R2HA 4DCMA 2Y93A 4JLWA 1ZLXA 1TK3A 1BJTA 2BFEA 2Z5LA 3UJ7A 3VVCA 1TKBA 3P8ZA 4P22A 1JH9A 2FSPA 3V9PA 3VNAA 1JKIA 1QDUA 3KV1A 4BDSA 4KQIA 5JAQA 4CGZA 5DYTA 3ETGA 2RJNA 3IUEA 3QFTA 4CU2A 4DM4A 2CJYA 1GUDA 3U1VA 1FRZA 3SSOA 4XQ0A 2JRLA 1KA9H 2OM6A 1XEAA 4OUDA 1XB2A 3JQBA 1EK1A 3PHBE 2RGBA 4ZIRA 2P4SA 1L8AA 5KU7A 1I1HA 1V25A 2R6CA 4OHKA 5CTAA 2MINA 4E5NA 4C87A 1APBA 1K98A 2LIPA 1HDOA 5ALIA 3O74A 4XUGB 4IIHA 4TQSA 2IEDA 1XK6A 5DW3A 3NT5A 2X6QA 2H11A 2W6CX 4ZGWA 3KVNA 1K8RA 2P7IA 4A15A 4Z3OA 4TYWA 4HSGA 1L2TA 2CYAA 1NUAA 1LI7A 1ULSA 4M86A 5HUHA 4L5JA 1R5JA 2YHUA 2OORA 3HKBA 4NJOA 3Q2KA 3CZRA 1ZQ9A 2BOVA 2IPMA 3GT0A 3GPBA 3MJ4A 4E5UA 1V7CA 2JJ8A 3AB7A 2OCKA 3ADPA 3K15A 4L9RA 3ONNA 3RG2A 3H13A 4FMDF 5L7WA 2LCQA 2WPNA 2FCRA 1Y7TA 3CX6A 4KPEC 3SY8A 2G1KA 3GJXB 1G19A 2CC2A 4H7EA 4IDDA 4MQBA 1ZM7A 4KQ6A 4P31A 1LK5A 3O6VA 4G1CA 1YJAA 3VJKA 4BBPA 2R8YA 4RF4A 1YU6A 1N33H 3A2LA 2OL4A 3NKVA 3T7RA 2WOOA 1NLZA 3KT0A 1UKZA 3JQPA 4N65A 3PKIA 2ECQA 4E2YA 4P33A 1GPNA 3FAZA 3K71B 3CBQA 4CFYA 2COEA 3DHVA 5D8DA 2I87A 2H9AA 2DULA 3KZVA 5IKOA 4ZZ2A 1GM5A 2OEPA 2XB2A 2ZJ8A 2R68A 4FLFA 1CZRA 4AUMA 4EABA 1N0VC 3K0CC 2D2XA 3DXYA 4DSNA 3OHPA 1M2NA 1DJQA 3P45A 2YWBA 2Y66A 4UVDA 3NDPA 3V3KA 1TYBE 4FQ7A 2WK1A 1Y8AA 3QE2A 1LSJA 3I2IA 4G1UC 1GPWB 1X86B 3DCYA 4QGAA 4ZZ1A 3W4JA 5CITA 1B0PA 1C7FA 1GVNB 3ZHBA 2FVXA 5K0ZA 3ZBTA 4NABA 2IZOA 4JI3H 4K87A 3QLEA 2IYOA 3B82A 3E5RA 3GVXA 1XZKA 2G82A 3O2SB 3BB1A 3HYNA 3R3SA 2VDWA 2V4MA 2WIKA 3GRPA 5GAJA 2HMAA 3VGPA 5IT4A 2I65A 3P0JA 4MWCA 5LDHA 3CUUA 1Y3BE 3S7ZA 1OKKD 1WUYA 3SJ7A 2VN8A 1GNPA 4NE7A 1SWVA 1G8JA 1CY1A 1IRIA 4D9FA 4JI5H 1I4OA 1SRRA 3NNDA 3Q7EA 2VEOA 1CJKC 4XE5A 1GDDA 4NK5A 1RK6A 2C07A 4IYRA 3TRFA 3T1TA 2NTVA 4JI1H 2G67A 2ZKIA 1KI4A 4CG2A 4P54A 4O8ZA 4D9EA 4J16C 1AD2A 1CYDA 4OOFA 5F33A 5FBHA 2GF0A 3T4PA 1CE8B 3SJBA 1NV8A 5T67A 2IVFA 3JU3A 3PEVA 4I99A 4LSZA 4E21A 3G0IA 2HCFA 2AS0A 3TXXA 1QZUA 1QR2A 1JEOA 3SEQA 3QE9Y 2W6PA 1S2IA 2FPKA 1YQEA 4DV2H 3G88A 1I7LA 2QTZA 1KJ9A 4P6VF 1E1RD 4LDQA 2GI4A 3G2JA 4HMOA 5AKEA 2DWQA 3RAQA 1HNXH 3QMMA 4HBGA 4HWGA 4KSYA 2IP1A 3GLQA 3KQVA 1C2YA 4Q3KA 4DABA 5KNLA 3OOEA 2PMZA 3JD2A 5B3JC 4YONB 5CFPA 2XRZA 3KCNA 5JZVA 3DOUA 1SR8A 2AGVA 3N2GA 5AJZA 3UKDA 3UG6A 1OBDA 4L3WA 5KG0A 3KYIB 3UMSA 5KKNB 3PGA1 5HGXA 2PSJA 5EWMA 4S1OA 1MO3A 2QGNA 4BTVA 5JI2E 3JAMA 4NU5A 1NY6A 4O2AB 2QRJA 1E69A 1Z73A 2NPOA 4DRYA 2BGKA 1Z25A 2FLNA 2G0AA 2OHVA 4F2GA 3EUFA 4LZPA 5EP2A 1YQ9A 2H4FA 3I1FA 4AECA 3SR4A 5K3SA 4L7VA 3ZJ4A 5ESRA 4RMNA 4ISBA 1E61A 5SZJA 3T3DA 3KPVA 3UWPA 4E3ZA 1BXGA 2UYHA 1I6LA 4X84A 1NLUA 1Q20A 3L1VA 1Z0FA 3I2JA 2X5XA 3LCVB 1V37A 4K9OA 2HG8A 3Q12A 3IHTA 3DL2A 4F86A 1UPCA 2H9IA 1DJPA 1I2MA 4H2DA 5KFGA 1PFGA 1JKJA 4M0PA 3ETHA 1AUVA 2HA4A 3E05A 4MK4A 5B53A 2W2TA 5PNTA 1W46A 2ZB3A 4D9MA 1UXIA 1XSEA 3NHWA 4QXMA 3RFUA 1JT9A 1S02A 3IJEB 3RRNA 5CCXA 3I58A 2GZDA 3PQCA 4NE9A 2X8JA 5B6PA 2GWRA 1SVUA 2G63A 3OIDA 4B3DA 5HBRA 2JK1A 4LMRA 3GXOA 4R3NA 5JG7A 3U19A 5CH5A 3AM3A 5KFHA 1KSGA 3IOEA 1T15A 3AZPA 1C0KA 4ZT2A 1L3BA 2OYRA 1NF2A 3TTXA 4DCGA 5ALVA 4QGBA 2PRIA 3H86A 4RGYA 3PWZA 1JRLA 7ABPA 3TE7A 4RVGA 3A31A 1Y9DA 1NUQA 4O7YA 1WD5A 1ZY2A 2J67A 3PUIA 4BGIA 1P72A 4ZJZA 1S3SA 5A5DA 1BN7A 4BMSA 2D0DA 1CUUA 2IWRA 1I3CA 2HVRA 4WV3A 1YZYA 3GRRA 3W2EA 2BGMA 1N32H 4Q7JB 4Q9JA 1CEYA 3Q7TA 1VP3A 4NENB 3TM5A 3WYFA 3OOHA 1LV8A 2V6JA 4WE3A 4F6RB 1SU7A 3EWIA 3H16A 5CVTA 1Y8ZA 5JEEA 1XRNA 3LCCA 1ABFA 2IIQA 1P2VA 4OXQA 4ZTBA 4GC6A 4UNPA 1COWA 3AJEA 3GWGA 2PXCA 1RE0A 3KO8A 4OXRA 5A9SA 4RMIA 2EDCA 4B82A 2Z3WA 2ZUUA 1ZUWA 2E89A 4ZJPA 4LVOA 1GCAA 1Y9JA 1P0PA 2C4VA 2E4UA 2HWKA 3LUPA 5DYIA 2PMCA 5I5TA 4PWQA 2IYNA 3IHWA 1ISSA 1Z5PA 2W6MA 2FF7A 3CLKA 4LDJA 4INAA 3OTWA 2GARA 1CY7A 2VUMA 1GQQA 2H5EA 4HVAA 2NUTA 1ITZA 1CLUA 3AFHA 4HB0A 1I9GA 3B5IA 4NYMQ 4R7ZA 4C14A 1WY5A 1XRJA 2Y1EA 3GA5A 4XGNA 4TUYB 4CL3A 4OAPA 3ZHRA 3NRCA 1N5LA 3HBLA 2OLKA 2V9ZA 3FPSA 4B17A 1LNQA 3PYLA 1I51A 3HMKA 4LQCA 4FDMA 3ROKA 1SWWA 4Q1EA 4CKBA 4MWTA 5M2QA 1K86A 1GA4A 4OO3A 5BMVB 3PLNA 3DG9A 4TPKA 1J2UA 3DEYX 3GB8B 5AW8A 4HLDA 1RJPA 3IE0A 3GDHA 3N6VA 1F51E 3DKPA 3E70C 5HV6A 1A9PA 1F1JA 2E21A 4RZRA 3KLPX 3M7IA 4QQKA 4NJMB 3FD8A 5AJHA 4PNEA 4KXNA 4MUHA 5ALPA 1TM5E 3LZDA 1W36D 3KOOA 5K3AA 4DY6A 1WXHA 1TVEA 2HWWA 4ESOA 1KY2A 1R12A 2P9FA 5BO5A 3JQGA 3JQRA 3AOEA 4QDTA 1AKUA 5KG3A 4DUZB 1QWOA 2VJKA 4JFRA 1U5BA 3UVEA 1MVOA 4ZARA 5JARA 1DNPA 4DG8A 4DSAA 1OA1A 1X0VA 2JFGA 4PVCA 3GLUA 4J91A 1NPDA 1FNSA 2ZPTX 3TE6A 3FYSA 3FRJA 4AZ0B 1PX0A 4XYMB 2IEAA 3D1LA 3G8BA 4A8HA 5I47A 5LB4A 1KYIA 3DW1X 4ZC8A 2ZJ5A 3CLRC 4OBBA 5B7GA 4MP3A 4U7WA 3ICQB 2C78A 3U62A 4QBFA 1LY1A 1IPHA 3FZQA 2ZTHA 4XPZA 2HJHA 2ISQA 1FRQA 1YBVA 3LK6A 5ECGC 3AGQA 4KO4S 3GFPA 2J48A 1CUSA 2VRNA 3FPGA 2GT1A 4BQQA 4D25A 4I46A 1Y8RA 3Q8PB 1FS5A 1KKUA 4S12A 5I7AA 3CONA 2DPHA 2BBWA 3I2GA 4ZVMA 1H2XA 1PSZA 1ULTA 1MT3A 2QLTA 4EELA 1PT6A 1N2CA 4PPQA 4NV1A 2BR3A 4AP9A 1T26A 2H85A 1BROA 3FNIA 2BN4A 3UAVA 4AJKA 4BVKA 1YFJA 2QYZA 2OAQ1 4HAXA 1N2SA 1GYQA 4R2LA 2Z2YA 1O8BA 2X0NA 2WJ4A 3MIZA 5LQDA 4JJ4A 3VZDA 3BCHA 1NFRA 1VIMA 5TT1A 3K70C 2A0WA 5BW6B 3B1VA 5D3KA 3WVNA 3ZZMA 1LK0A 2FOIA 2H17A 5L1KA 4P3YA 5KFKA 4Y9RA 5E8JA 1QVZA 4PSVA 1E3IA 2Y1DA 3ZJTA 2IXGA 2OB2A 2R8OA 4G37A 4D0SA 4FR2A 4FFRA 3EXEA 3WYNA 5J2TB 3M6AA 2ACWA 3M89A 1Z5ZA 5KJ6A 3UAXA 4UCQA 2LWIA 1L4FA 2HNBA 1VHTA 3LKVA 3WIVA 1JQKA 1LI4A 2WU4A 2FMXA 5TR9A 3EX7C 1O3YA 5FQNA 1JV2B 1GZ6A 2FOXA 2P9ZA 1NUPA 2PK3A 4QWAA 3ABIA 3MG9A 1VFPA 3SCZA 3IEIA 3SXJA 1Z39A 3RUFA 1OZHA 2R7KA 2HDNB 2RARA 3EZGA 3FLEA 4RA6A 2BIFA 2BMFA 2CKDA 2PX2A 3JQ8A 3NX4A 3O4HA 3QI7A 4BYMA 4QUHA 2IWHA 2HHFA 2HF9A 5EHXA 2AE2A 2CY0A 2J7PA 1UDBA 2NO5A 1NW3A 2A94A 2XCLA 1KL7A 2X4IA 4UZFA 3DBOB 2YV2A 3SSMA 1GVHA 1CQPA 5CYPA 1YTLA 3TTYA 2XADA 2C4TA 3LY8A 4P4SB 5FUYA 3AKDA 1GLVA 4LECA 4UHJA 2OQ2A 1Y7IA 3VSCA 2A3NA 4ND1A 4GKVA 3W7AA 2KLBA 1NMSA 2UUPA 4HOYA 4LDAA 3WGIA 3IHKA 2WMOB 2V7PA 3NHRA 1N9ZA 5KSYA 2OXIA 3HCRA 2P27A 5CHEA 3WWJA 3KHRA 3UWOA 1EWQA 1AHNA 3GLHB 4KVAA 1AO0A 4QOFA 1RPAA 1JDSA 4EW3A 1KJJA 2GLUA 1IULA 5DTRA 3TQ1A 2VNKA 4TM7A 3IMGA 4J16A 4K28A 4X00A 1LLDA 2GJ8A 4X54A 4BLRA 2A0YA 4YAOA 1J9ZA 3OEHA 4YAUA 3GJ6A 1LPPA 1P39A 1OLXB 2F2TA 2VJLA 4DR4H 2X6TA 3B3JA 3DDUA 3DOHA 3ZLBA 3AP2A 3Q3GE 1DIGA 4J76A 3TXYA 3UJCA 4JQOA 4F3NA 4U6SA 2L42A 1WMSA 1P17A 3NT4A 5CXSA 4EUKA 1LS6A 1E79A 1VBFA 2KS6A 4JJ7A 3SJUA 3RU2A 3WFZA 3K9GA 4BUCA 2WRZA 3A6JA 4HN9A 2XBUA 1V26A 4KAAA 4BFTA 2HV8A 4CQLB 3QZ7A 2EX1A 1U2GA 3VR5A 4R1SA 4RPJA 2JATA 4O4LF 3N0WA 3MOIA 4Y0NA 1JZSA 1SA0B 4LYGA 1T0BA 4ZP1A 2JEFA 2VQDA 1QTNA 3I6IA 3JASB 4KOAA 3U0BA 2GAFA 4WECA 1PJ3A 4JYBA 3TLGB 4ABYA 1PEKE 4BKUA 5CFNA 5EHZA 1CRZA 3O0TA 5T4BA 2GUWA 4RE6A 3AJ8A 1NXXA 2JJ2D 3I5MA 1ZPDA 4IWYA 1KBZA 4WOKA 3WLHA 3UAOA 3VZCA 4C0BA 1UKAA 2K7FA 3HB1A 4HXYA 3BE5A 1N34H 3RRBA 3EIFA 4WDRA 3ROGA 4BHTA 5DCLA 2PAAA 1I10A 4CV1A 2WTFA 1EUZA 2WYIA 4Z7OB 4XSGA 2H00A 1GUFA 4CYMA 1QQ7A 2P6UA 4G36A 5DMHA 2A8YA 4JHXA 1OC2A 2FLLA 3A1UA 3RFXA 3GLSA 1WCXA 1XJCA 3FTPA 3BHIA 2XGPA 1UPBA 2AA3A 4YP9A 4RSGA 3M9NB 2PPVA 4KB5A 5F5NA 2XMGA 3PDIB 2FZEA 3H4IA 3DZKA 1TXGA 1R8SA 4IDHA 1V5FA 2O54A 1XL1A 1OTYA 5F23A 1WW8A 3OTIA 4RPHA 1JHDA 3P94A 4KR3A 4BS9A 1U3VA 3THYA 3ZOKA 3PITA 4ZYLA 3A1FA 4CIDA 4WZ6A 2IYXA 4RPGA 3QNMA 3SJZA 1AUOA 4Z0PA 1UUFA 2HU7A 1VE6A 5IJXA 1WCMG 3GT3A 3NTVA 3DEKA 2J5BA 4Y1FA 3NM5A 5J9FA 4Z5XA 5KFWA 4OATA 2WI8A 3IP7A 4E31A 3QOYA 2REQB 2G06A 4JQCA 5JSHA 3SZLA 1DB3A 2NV2B 3TBHA 3I1IA 4S05A 4NOKA 4F5ZA 3VZPA 3LVRE 2WIFA 1MO2A 1QMPA 1MF7A 5IT0A 2HH9A 2RH5A 1D03A 4IFBA 4XCQA 4INZA 3WLOA 1VIDA 2ZU0C 1Y3AA 1WOYA 2IUSA 4Q3LA 3TSYA 2DLDA 3H9EO 1O6ZA 3F2VA 4JL6A 3R7BA 4GRIA 2CXPA 3O91A 3WHIA 1JL3A 3TNLA 1V48A 4FHFA 1UBCA 3VOBA 1ORTA 3W5BA 1MAHA 2WWGA 2JFPA 3A1VA 1NWHA 2UUAH 2E87A 2Q50A 3IXQA 4YMVA 3RS4A 3QE4A 3CJRA 1NSFA 3ZDCA 1MGOA 1XLVA 1E9FA 1I0ZA 4M0DA 4GT1A 4H16A 3QVOA 5GONA 1QYIA 3QVXA 4GOJA 4PZLA 1QYRA 3S0JA 1LI5A 3LMLA 5KFMA 2C7BA 3R5FA 3O5AA 1QO0A 4OBXA 1WCYA 1ZD1A 2J6HA 4RVUA 3DM9B 4J03A 5KKAA 2AU0A 2XKJE 1LPOA 2Y0CA 4PO9A 4RK7A 1H2EA 1WLYA 3MTEA 3FZGA 3GEHA 1B73A 4J2OA 4PZ9A 3ROPA 3FMGA 1OF1A 2ZZNA 3PW2A 1MW8X 2X9VA 3ORQA 3KWLA 4OOEA 1GOTA 2GZSA 5EHNA 5ENZA 4Q18A 3GEPA 1QCZA 2G9RA 3CT4A 1QF6A 4Y2TA 1HFKA 3IQZA 3F0TA 4IDEA 5JWHA 2FFJA 3KLNA 2IUUA 3L1UA 3RUIA 1ZJ4A 3VR4H 5G4KA 3EDRA 3MWYW 4QW8A 1FFCA 1JECA 5ALOA 3UB3A 4Q3BA 4AVYA 2BFBB 3QTBA 4NICA 2PX8A 2I3BA 4KDFA 1BU5A 3MC1A 1VBMA 3DMPA 2R6DA 4JZKA 2OXCA 3T6KA 2K2WA 1Y4AE 1YUBA 3VYVA 4O3NA 2ENWA 1V6CA 4RO0A 1EIWA 4BNJA 1WDTA 3HR7A 4E6EA 2Q0XA 4OL9A 4N18A 1X19A 1C8LA 2GCPA 3ZWMA 1DHRA 2F8MA 3OAAD 5GWXA 3C6MA 4B44A 2PBZA 5C4IA 5KVSA 4RD0A 3FW1A 1LX6A 3DZIA 2I7DA 2QROA 3DP7A 4WCVA 3MUNA 4B43A 4E5VA 5C5CA 4MTEA 1QP0A 3HH8A 3RUDA 4QOHA 3R8CA 2YXBA 3QFCA 4D4KA 3QX3A 1KERA 1P1KA 3EGDA 1W96A 4NG5A 1R8YA 3R7DA 3TEFA 2X22A 3NHFA 4YRMA 3I9V6 2Z43A 4M0KA 2UUBH 3ND5A 1U9YA 2RH4A 4N49A 5CCDA 3VGJA 2G08A 4W9NC 1GLGA 3ZQ4A 5BVGB 1SYXB 2QRZA 1T0HB 4RNOA 1PVOA 2ZYTX 1VE7A 4FZ3A 2C88A 3BFXA 3PX3A 2YNMA 6ADHA 1QHXA 1EXWA 1U28C 1W4BA 3BWMA 3QWBA 2YCHA 3ISVA 4KMOA 5ALXA 5PGMA 3T3EA 4A0HA 3HJAA 4PHCA 5IJ0A 3C0FB 1F06A 2XECA 2ZETA 1X7WB 2I99A 4H1HA 5FV4A 3ZXUB 4GOXA 1HTWA 2OUKA 5KDOA 1L3CA 2Q9UA 2DQYA 3W3AH 1WE2A 1E2PA 1XMXA 4O33A 4RHUA 3PLAE 1MKYA 5DGBA 3C1TA 1MCZA 3LIPA 2V7QD 5K51A 4XIJA 3LF1A 4DXHA 5K6RA 1UJ6A 1ZRNA 1KF0A 2XITA 3GJSA 5C46F 4INPA 3FWNA 2Z1NA 2A9RA 1WB6A 2R2GA 3C1OA 4XQ9A 3TN7A 3UGQA 1EAMA 2IHUA 4TKUA 2ZIFA 2XAAA 5CT8A 2G70A 1SOMA 3IXLA 2A5DA 3C85A 4DWJA 5JTTA 2FEAA 5IAAA 1GSAA 2JLXA 3VR5H 1ETUA 4ZZ3A 3GQBA 5TQ2B 1KR2A 1GZHB 3WWOA 4JYCA 2B92A 3DVLA 4A0RA 2ZIAA 5KFAA 1EP1B 1FPQA 4MR9A 2YZ2A 1U2SA 5JD5A 2NG1A 2MSEB 4BN5A 4EUEA 5J23A 5H7XA 2P77A 3U4AA 1LDBA 1LS1A 1XQ6A 1PKXA 1ZSNA 3NDIA 4Y8VB 3O4VA 4M1OA 1K63A 1Z4NA 4MI1A 1T1RA 2XCIA 3V4FA 5B1HA 1NVMB 2C3OA 3Q5DA 5HP4A 4ZCSA 1T24A 4QGGA 2P62A 4IHJA 5TVGA 3BUSA 5I7OA 2ZSHA 1EYZA 4KO3S 5AJTA 4JJZA 1ILEA 3C4QA 1DFHA 1BOOA 1N2BA 3GUCA 2OO5A 2AKAB 3HWX1 4B31A 4KXXA 4YAKA 4AO7A 3FCXA 1IMJA 3A04A 2XGSA 1R4NA 2OD9A 4OLHA 3CXRA 2QE7A 3C70A 1J0DA 3DCIA 1Q1QA 4MQLA 1QTRA 1QZTA 1M33A 3LDHA 4EHDA 3H0KA 2CWWA 1SIUA 1DKOA 3NIWA 4X6XA 1RLTA 1EFVA 5BOVA 4U9UA 5K1ZA 4C2AA 2UV8A 1YHNA 2DFNA 1GZUA 3A1EA 4TTSA 2WPDA 1IXKA 4HNUA 3L6EA 3G0GA 5E6SA 3SEZA 3TB6A 4B09A 2P69A 1D2GA 1QQTA 4PYMA 2IOYA 2GLTA 5I5XA 3KVRA 3R0JA 3ZQKA 1VJRA 1DC6A 1Z47A 2Y2VA 1DX9A 2HK7A 2JDID 2QLNA 3I04M 3L84A 4BAZA 2PA3A 5EE5B 2GQSA 1U0HC 1TCBA 1GU1A 2UUCB 3VMMA 1XYVA 4ER6A 4GC7A 1RRMA 1VDMA 2NV0A 4RNNA 2VYVD 2JFQA 3C3JA 3O8QA 4IHJB 4L4YA 5JOQA 5JMOA 2BJHA 1FDIA 3ZTWA 4EW1A 2OLSA 4N5IX 3QUAA 2CFMA 4NX2A 3L07A 4D3FA 2HIAA 1ZAYA 3MMSA 4FNAA 5AM3A 2ZAIA 4ITUA 4MB6A 2OGZA 3R8XA 4GEGA 1SCJA 1F2TA 2VSYA 3AP3A 1SQ0A 1Y8QA 2IEGA 3NM4A 5FR2A 2CHUA 5DNUA 4RGVA 4RPIA 3ENNA 4RGQA 1E1CB 5DLEA 2UAGA 4KIWA 1A69A 2VYND 4ASUD 1I4EB 1R50A 1I2BA 1UM8A 1AUXA 1QH0A 2AYXA 2G17A 4OXXA 4RXTA 5HCIA 3T9DA 1KPHA 4ODIA 4BRSA 1O58A 5ECWA 2L0XA 3IR5A 5F5LA 3LC1O 2YWDA 2RI0A 2XA9A 1I1NA 3KWMA 2G25A 5EPOA 3P27A 1PZGA 3I2YX 5IC6A 2QTTA 2DVMA 3VR1A 1K0FA 5B4VA 1OMOA 1SUCA 4G5FA 1N32B 2FKAA 2G5PA 2HDKA 3EYAA 4JU8A 3PQEA 1P33A 4EG5A 4YR9A 3CZ4A 3STWA 1M1YB 3LT0A 4DCCA 4YRBA 5HS4A 2C9CA 3ESDA 5JH7A 1WW2A 1KEEB 2R44A 5U4XA 3OP4A 3P0IA 1JXMA 1PFQA 3QWFA 4TZ0A 1E2HA 2JJQA 3M5WA 3D2BA 2QNRA 3QENA 3WLTA 4QNRA 3L3BA 1VG0B 2PXAA 1SUIA 4V1CA 2P1RA 2AE1A 2NVBA 2PGDA 3H2BA 2WDPA 1NAIA 5EUQB 4UCRA 3LBNA 3S2UA 4RXMA 1HETA 5EVCA 5FNVA 3BFJA 1P1FA 3KVYA 3RVSA 2O5EA 4U8GA 1TCUA 3ZWCA 3GTKA 4MYDA 3Q9SA 4FGLA 3R6WA 4HFRA 3CINA 4PLWA 4XRRA 4Y6RA 3SOZA 1PWYE 4J0IA 3ABZA 5CLLA 5K3CA 1XU7A 3C3MA 4R2KA 2NVUB 3R8FA 3M5DA 2QRNA 4DG9A 2OGTA 4KXQA 1ZL0A 2OYCA 5C3UA 1L1RA 5D3ZA 1IYDA 3KP1A 1H69A 5FPTA 3BBLA 2FW7A 4HKTA 3TLKA 4CI0B 3ZU6A 3PTAA 2WLTA 3WRXA 1XYGA 3ZWPA 3B1KA 4HDNB 1T5IA 5CMLA 4HAUA 2PIAA 4LQ4A 2BDTA 2EQBA 2LD4A 1Y3DE 3M70A 1AC5A 1YOBA 4JLBA 4ZXPA 3W2TA 5KOJA 1BEUB 2YDYA 4OAQA 3OU7A 5KDLA 2JFVA 1NQXA 2GFIA 3JALA 2FF5A 3QOWA 4XDGA 5AK3A 3CLHA 2OXEA 3PKJA 2MU1A 3DBHA 4YT4A 2H4XA 2GAOA 4GI1A 4D26A 2SNIE 2FWIA 2WM2A 1ISMA 5AICA 1Z6PA 2V6FA 2WFLA 5EKXA 5LMCA 3VR6A 1I9CA 1ZINA 4UCVA 2DBVO 5TSDA 1K75A 1W35A 3PC2A 3R5SA 3RNOA 5FLXA 4PYKA 2BFBA 3VC2A 4BVAA 1C0IA 4Y9TA 1SPXA 1T1EA 5TGTA 4JCOA 4DLUA 3A6KA 3F71A 3W6OA 3M9LA 3AEQB 2GASA 1IY9A 1SBYA 5F4ZA 3WDSA 2OFXA 4R1NA 3TI9A 5A3JA 4N7RA 1ZDMA 3RKSA 2YCLA 1G8YA 1T9BA 1U99A 2GN6A 4D3DA 1KQFA 3NU1A 3NEPX 1KNXA 3BXZA 5IAKA 4UXIA 3MOSA 5AVZA 1W0CA 1NW7A 1G3RA 4OFXA 4RKYA 2FLKA 3SYMA 4B7CA 4WK0B 3K0CA 4YRDA 1S7GA 1K7EB 1OA0A 3IIMA 3O3OB 1MAAA 4JL8A 3QHQA 3T3OA 4FGZA 4D80A 2OQVA 3G79A 1V7ZA 3R3HA 3E9RA 2HRZA 2XB4A 4FCTA 1RLIA 1T36A 2AOUB 2BZ0A 2ONCA 4N4AA 3PEUA 1TZJA 4YJHB 2VDJA 3GFOA 4IRXA 1PNTA 2DUWA 5TMDA 3BX1A 1YV9A 1RYFA 4L4ZA 4R2XA 4YQYA 5C35A 1M7HA 3LCRA 4ES6A 1K8ZB 1PR3A 1OBVA 1PNOA 4XVRA 2OXTA 1NN5A 1Z4JA 3I1YA 4Z9AA 4N47A 5H3CA 5TT0A 3SR0A 8ABPA 1TMKA 1FJXA 3E9NA 3VU0A 4ZQIA 1A77A 2SHKA 2J3JA 1VG9B 2V3VA 3RV4A 1E8DA 3QBTA 4MVJH 5IJZA 3NKFA 2V5VA 1YIDA 3TIXB 4TN1A 3Q7IA 5I7WA 4P32A 3UYYA 2XB9A 1J2JA 1DT3A 3GPLA 4JVNA 2W2VA 4GICA 2XCQA 4FYPA 4O0LA 3WOHA 3BWCA 5DGXA 4EZIA 4QELA 3OLWA 4G4GA 3PCTA 4OPMA 4QTTB 2YS6A 1JLSA 1IZ0A 1GSIA 3O90A 3DBVO 4HLUA 1SG0A 1Z6ZA 2P8JA 1H0RA 4BNVA 2DPXA 2F9LA 1XMOH 4JB3A 4O4LA 4PX3A 1PZHA 3WRWA 3OURA 5F9HA 1DXOA 1UT6A 4MO2A 3W6ZA 5ICGA 5DCYA 1R6DA 1PTJC 4QICA 4E5DA 1CJMA 1XDUA 1NBMD 1QV6A 1M7JA 1JVSA 3OWXA 5E3HA 2IHBA 4ZI2A 3TTVA 1KYTA 1WMAA 1ZNQO 3DMNA 4O7ZA 3MMPA 3T7KA 4A6DA 6REQB 1QH1A 4K6OA 2EWVA 3GEMA 2OXFA 4O3QA 3GHHA 4U02A 5DI9A 3G9UA 3ZV7A 1L9KA 3T7CA 1FSZA 3B53X 2H2HA 4KX3A 1UWVA 4OHUA 1L7DA 1DZ3A 1Z2NX 1A7JA 3M1AA 4FOSA 5SV2A 1A5ZA 2W4MA 1XZPA 3EPIA 2Y9MB 3BABA 9ABPA 2A92A 4RLQA 1Q0PA 2HLPA 3DO8A 5B7NA 2KSQA 3T1HB 1F2VA 1XNJA 3ICWA 3DMDA 3T41A 1O6FA 3WISA 5D5HA 3K16A 5JS7A 2HOQA 4G0MA 2YMPA 1H4TA 4K8RB 3UJ8A 3FOCA 1PBNA 1KC3A 4TLMB 1IVSA 1TEXA 3ODGA 3GTQA 2OZVA 5TY0A 2BZ1A 3F90A 4DQVA 1RMTA 1YKFA 2YN4A 1VS0A 1OFGA 2I6FA 2P2GA 1BFKA 3R0ZA 4ANFA 5HIJA 5J5VA 1E9VA 4Y2JA 1SA0A 1L6IA 4RQTA 1GA6A 5ALTA 4KLNA 4MV8A 1T9DA 2FVYA 2QL6A 3HS3A 1IOVA 2F6RA 1OLUB 4CQNA 1DEAA 4ZU6X 1Q50A 2Y9PB 3PHLA 1Q17A 4O4IA 3ERCA 3ICEA 5EJFA 4N01A 4AY2A 2X3FA 4FW8A 4EMSA 4DA6A 2DUUA 3HKDA 5AXCA 4P35A 2DH6A 4F93B 4PBSA 3HDYA 3N6RA 1LBSA 4TV8B 3EEOA 4JI0H 1CUGA 1X7HA 4GMDA 1I7SB 1O0CA 1IONA 4H7FA 4Q9LA 3FYUA 4G84A 1Y4SA 5LBTA 3RU9A 3WGZA 1I3LA 1FUIA 4G3XA 2O2HA 3J80W 2Z1DA 2IH5A 1U3WA 2YV1A 2QRVB 3DLAA 5FPHA 3TW7A 4R1MA 2NVYA 2ZSKA 2Q9BA 2AG8A 5KDDA 2ASLA 1HTBA 5BWXA 1I2AA 2GVZC 2Q1UA 4Q47A 4QXAA 4W7IA 1O9BA 4YO7A 2F43A 4DIDA 1P8LA 3ZK8A 4WLOA 4DT1B 2PNFA 2IP2A 3A9TA 3C8DA 1BMFA 4ZOCA 5E8RA 4GLOA 2FU5C 1QOPB 3WLQA 3IURA 3PN1A 5KT4A 1NVDA 2F62A 3OIYA 2HHFB 3Q41A 1WPQA 1C81A 3ED5A 1Z56C 2UUBB 2E2HA 1Z22A 1JFTA 1RI3A 1X7DA 1OIWA 5LMNB 1DP4A 3B1XA 5LU9A 5JNLA 2B4YA 2FQXA 2R751 1TMYA 4HGZA 1BDIA 3R5XA 1DADA 2QUBA 5EIOA 2DWOA 4IVQA 4RYLA 1HGXA 1V5IA 4ZHQB 2DY1A 1GWNA 2RMKA 3FBWA 3ND8A 2Q45A 1CIVA 1M66A 5CP8A 3U3MA 1OREA 2E48A 1YZLA 1FFGA 2ZCVA 3DAGA 5DMXA 4I8XA 5HDQA 5TRTA 1CS0B 3EIUA 3EVTA 4JLNA 3CKLA 3DMHA 3CO0S 3RC3A 3PXCX 3WKDA 2WIAA 5C8ZA 3KSMA 4ALIA 1JHYA 2FEOA 3IRUA 4I81A 4BX8A 1H93A 1E7SA 3BF8A 1PJAA 3F5DA 3FNFA 5A5EA 2OP1A 3HK2A 3RGWS 1UM9A 3AKYA 4KXUA 5LOVF 1PV1A 5ALHA 3VR6H 1TLFA 4M1TA 5KQSA 1D4OA 4DL3A 4RKFA 1UK8A 2BDUA 4DDMA 3T54A 4BKQA 3ADOA 1AKEA 4M9CA 4AF7A 3D0KA 5LNK6 3A6EA 2PZJA 2NZUG 3M2PA 1I4LD 1MENA 1SY7A 1CQJB 1IZ9A 2HU8A 1OVGA 3B9PA 4OM7A 3Q8QB 4AKEA 4ARZB 5JC8A 2NXWA 2ZUSA 5JCXA 1USVA 1OXTA 1LZKA 3DDWA 4IBOA 5DXFA 5EIHA 4BZQA 5B12A 1MIHA 2OCGA 4RHEA 4UU7A 2GJSA 3NJ4A 1L7XA 1U2DC 3A28A 4M1QA 4K9RA 4OQEA 3SMVA 4D79A 2NQ8A 2R7NA 3HCAA 2UU9H 3FN4A 3OM8A 5F52A 1E2QA 1QK5A 1Z0AA 1RRFA 2HA7A 2ZRAA 3GJRA 2JA6A 1DWPA 4NS4A 4RCYA 3WMWA 4AIIA 3PQ5A 2ZITA 1PFKA 5IS2A 3VOTA 1QGAA 3P1JA 5A6SB 5BNFA 4BZPA 5I9BA 2MYUA 3GIQA 4K46A 5A0VA 5AKLA 3DBIA 2JGDA 3AQIA 4B4VA 4B6PA 1EPUA 4JZYA 4R1PA 2V0CA 5C4GB 3NUGA 2QX6A 2CNKA 3F6PA 3TSCA 4FE2A 4NBNA 4YR2A 1BVHA 1JZQA 4RDIA 3S27A 3LDUA 2AFVA 2CMFA 2IHYA 1PUIA 3RF2A 4C6TA 4BGDA 1X7ZA 3U44A 2FLPA 5BQOA 1PUXA 1QBKC 3EHDA 1BKSB 4HNAB 2QQ0A 1GU7A 1A2KC 1G5FA 2FX2A 1P29A 1Z0SA 2VP4A 2XTJA 1RCFA 3OKPA 4LSXA 1PT7A 2QRMA 3ZKWA 1IATA 3ZBPA 2EIYA 4ZRMA 3AONB 1L5HA 4X65B 2HF2A 4O8CA 2CLDX 2ATEA 4RD6A 5BSFA 4OX9Y 4W1RA 5TVKA 3AFOA 3IBTA 1YQDA 3K96A 1BCSA 3N9IA 1QS0B 4URXR 3V7NA 3HUEA 4L74A 1P0MA 4LJLA 1R66A 4JVSB 4KLZA 4RD2A 4XVQA 4GLXA 4M8NE 1E2MA 4FQ5A 5DHPA 2ZRHA 5GM2A 1IXSB 5JSYA 4CLOB 1TWCA 1ZM9A 4Q03A 1T5LA 2V6IA 3QTLA 1Z0DA 2Q3BA 2RGWA 2VVTA 1GL9B 2C22A 1WIWA 3SDSA 2UDPA 2VSOA 2FK1A 3VYTB 4JEHA 3D3NA 4PYIA 1U2GC 4HTFA 1YJ5A 4X1YA 5REQB 3UF0A 2WSLA 2AZDA 2B5WA 3RASA 1PG2A 3TKYA 3COJA 4RTSA 2BYTA 5T3YA 4RV4A 4X63A 4ZVVA 4W5WA 3MLEA 3VNRA 3ZBUA 1XI2A 4IHJF 1UOPA 2AG6A 3IAHA 2ADMA 4LFAB 3JWGA 3FIJA 3FPCA 2OQIA 2RDMA 4OYLA 3HV2A 5SZKB 2ZQ5A 4WD3A 2R84A 1YSCA 1EFRA 4AMBA 2QLMA 2NYAA 1KIAA 1ZI8A 4NENA 2EJUA 4QM7A 4BLSA 2HBRA 5BSKA 4A2WA 1AA9A 1N34B 2PPLA 3E2PA 3WLLA 4R6WA 2WJYA 2DWPA 1J56A 4LV6A 2P67A 1XA3A 1U0SY 2X76A 4IOKA 4KWTA 3K7EA 1JYSA 2AL7A 1ZWLA 3HZRA 4NEHB 5FF9A 3UWKA 4EEXA 5A4JA 4LGVA 1ZOIA 3VVLA 1PT5A 4QU9A 1AN9A 2A0KA 1A4IA 4BQPA 4PF1A 1GYPA 1NUTA 2A7QA 1XTTA 3R20A 1HZZC 4WA7A 3W2HA 4UNRA 4YV7A 4IRKA 1XEXA 3V8BA 5KHLB 2IOHA 2OV8A 1H65A 1R0XA 4Q9DA 5HBRB 5AK4A 5B2ZA 5JRZA 3HCBA 3FCAA 2VSXA 1ZGAA 1VPVA 1ZUNA 4FE3A 3T5CA 3RJTA 3JTEA 1YDMA 2XDQA 2B94A 1G7TA 5FTKA 1U5CA 2EP8A 1DOHA 1VHDA 4LCBA 4US2R 4U5QA 1N3BA 2B1JA 3WBBA 3E7DA 3BC1A 4CCAA 5CG1A 3JSAA 4FM9A 5IG2A 4B3SB 2I6GA 5IFKA 5BSRA 4XARA 3LPDA 2Z1MA 2NUAA 3BAFA 1PR0A 2G28A 3DOFA 2XGQA 4J4HA 4PPFA 4LOIA 4Z6KA 1B0ZA 2A9JA 4POOA 3RSOA 1ABEA 3VYSB 4DPKA 5L45A 5E1DA 1UPXA 1FLAA 1JAXA 3TXAA 4L27A 4U7HA 2Q3FA 2W9CA 3ZDQA 3HSYA 5DN6A 4ZYUA 4G65A 3MLAA 5CGQB 3JSNA 4C4RA 5E6UB 2VOJA 1ZOPA 2C9BA 1F3OA 4HNRA 4PVDA 4AIRA 3ZHVA 4XWKA 4A3EG 2LPMA 3C14C 2Q2OA 1PR2A 2VF8A 4R54A 4MW6A 1AUQA 4X20B 1JJ7A 3C24A 3P2EA 4PCLA 5COAA 4TYYA 2QD2A 4XGRA 4C4AA 1LRLA 3TEMA 1A9SA 4M98A 5TMEA 4C6RA 4IDPA 4S24A 4UD2A 2VFAA 1AKRA 1T0PA 5ESWA 5K45A 3DMTC 1PFWA 4GM0A 4KAXA 4YK7A 3PIIA 3T7EA 4BIMA 4DAOA 3AF1A 1VRVA 2XUKA 1KDYA 4I5IA 3E27A 2JGJA 2VHXA 3SMQA 5AQEA 4PZEA 3TZKA 2FRXA 5CB6A 4G4JA 1LSOA 1E3QA 2WAOA 1WHSB 1DDIA 3CZMA 2B8TA 5TX7A 4B0PA 4E1AA 5B3AA 1HZJA 4OMFG 4E70A 2JLSA 4B87A 3ICVA 1QLJA 2IPXA 2KW5A 1BRTA 4XYGA 4U4AA 4COOA 2Z4RA 3OFJA 1KPGA 1X8JA 1VSQA 1V11B 1OHHA 1YZVA 1P0CA 5LQCA 1A97A 2NTJA 2BLLA 2XVYA 3TS1A 4ZPXA 5I6DA 3H9JA 3HXQA 4CTMA 5L3SA 3NNNA 2E5WA 4F72A 4YTEA 4FHCA 3E6AA 2IUTA 1PS9A 3ANNA 1XC7A 2BJVA 3EF0A 4FSDA 1O96B 5AXBA 4AS3A 1WL8A 1Y42X 4LE2A 3TUIC 2ZR0A 1FX0B 2DMRA 4UMDA 2JD0A 5FX2A 5IEJA 5LXTA 2OSBA 1G18A 3H42B 3IPRA 3OZUA 1L5GB 5KQMA 1B93A 3B9BA 2ZCUA 4DQXA 2QVXX 1KO5A 1RKQA 4QUKA 4U5XA 2WAMA 4GPAA 1SXGA 3ZW8A 3KC2A 5JAPA 2VDKB 3LRPA 5E9QA 2ZSJA 3PK0A 1WUTA 5J2UF 4XEHA 3UATA 1GIAA 4A2QA 4KMRA 1Q16A 4PNHA 5EJ2A 2H2GA 5JJKA 3T5LA 1Z35A 1Z88A 1PZEA 2CBGA 3A7EA 4ZYXA 4ER0A 1H1DA 1XQWA 1IVYA 3JQFA 3RU3A 3VR4A 3N8KA 4RKWA 4DGSA 4F4CA 3L6CA 5ESXA 3ZNNA 3I42A 3N75A 1WZEA 1WTCA 1YRBA 3HACA 5CPFA 5FWDA 1AGPA 2GBCA 2GYWA 4JC5A 4U8HA 3QLJA 2NSYA 4NVRA 4KYVA 1YS9A 4Q3OA 1C5KA 4EYSA 1BJRE 3F8WA 2W11A 4YASA 4XB2A 3TZBA 4ZI7B 4DLWA 4D82A 1U8AA 1ONNA 2EZ8A 2O7QA 1W6RA 2H2FA 2ZW9A 1M2FA 4ZREA 3ZV5A 1OX4B 3AB8A 2BMVA 4DLVA 1SH7A 1R5OA 3FMVA 2DHDA 2VXYA 3R9XA 1Y14B 1HRKA 1JEQB 2GNOA 1GL7A 3ESQA 1R27A 3NTXA 1XZJA 3KOMA 3TTTA 3L7NA 4FYWA 2ZIXA 4UCXA 2L18A 2PZFA 4ND8A 1O9GA 1A2QA 4LRYA 1NIJA 3RUCA 4DJFC 2ZAOA 3IVGA 2CUTA 4BN4A 3F9IA 1OWOA 2HHHH 3RRZA 3RSCA 4PWYA 4HWSA 4OP3A 1FDWA 5AM1A 1S4MA 4RF3A 2VT7A 5K0NA 4GWLA 1T8TA 2NU9A 4MW5A 3Q8KA 4MKZA 2WYHA 1MPTA 1ZR4A 1T3NA 2A1HA 1K3FA 4PRLA 4EDHA 4DREA 1ZIYA 2D8MA 2Z09A 4D81A 3N2LA 2XRYA 4RHTA 4PYRA 3FOZA 1FU8A 1MLDA 3PVSA 3GUUA 1XXHB 1SBQA 3OEYA 1D6NA 2PQ6A 1J2YA 1YZFA 2ZYWX 4MVJM 4N3BA 2NPFA 3ULKA 2PSHA 1NFFA 2W2QA 5ITSA 1X80B 3UMMA 4B45A 5B6IA 5EMKA 1AK1A 1VLHA 3DDOA 1QONA 3HA2A 4YI5A 1A5TA 1DJOA 4KODA 4RLSA 2NU7B 2CLFB 2Q9AA 2OMEA 4IVPA 1PU2A 5M3BA 2QL9A 1IBKB 4ZI7A 2I03A 4QPCA 3NXKA 4MLPA 3HSSA 5FR9A 2B7LA 2VATA 4RIGA 3UAZA 3KBOA 1RZRD 1JPJA 1P19A 2PANA 1Z5UA 4F2HA 5JY1A 3PFIA 2CLLB 2J4FA 2JJ1D 5P21A 3AYZB 4OX9B 4LF4H 3LI2A 3RAGA 5KWIA 1JR4A 1UZLA 1WNFA 2WWIA 2IYSA 2POQX 1NXQA 4RVCA 4RDHA 1QKKA 2Y4RA 5C3MA 3Q9LA 5LU8A 4WKGA 4DE5A 1GRQA 1U04A 3CISA 5DW0A 4W4TA 3X1YA 4IJQA 4CMKA 1VIVA 5JCJD 1O94D 3ND6A 3IVAA 2P2ZA 3DZDA 4BFSA 4Q45A 2FXVA 1OZAA 1BDMA 3IALA 2GD1O 1MX5A 3RAJA 4U6PA 3I2KA 4M0EA 4OHWA 2PWYA 1QKIA 4XDYA 1Z6QA 4MS1A 1DPGA 2FWJA 1KE1A 2XF8A 1TQ6A 3ET5A 3CF4G 3IDZA 4RZ3A 4WWHA 4WY8A 2D00A 1C0PA 5CIWA 3IPAA 2DM6A 1LKZA 4IG4A 4Z4QA 1L5RA 1WUKS 2AZ4A 3E5MA 3QKIA 5KJEA 3RYHA 2WHRA 5FUXA 4DJTA 4ZKDA 4IKEA 1O96A 3VV3A 5A0FA 1ELOA 2JZNA 5CJJA 1GNLA 3W7BA 1IU9A 2MMGA 3BGVA 4YAEA 4XDZA 4CMCA 4ECVA 1YVDA 2HTEA 4XB6B 4JLOA 4YAGA 5K8IA 2VRCA 3VPBA 3NP9A 5EE0A 2ERXA 1A8SA 2JLCA 3NBZC 4FC7A 4NH0A 3LYAA 3HA3A 2AK2A 4IJ6A 4BQEA 1JWAB 3B6KA 4ZFNA 2ZULA 1YS4A 1WQ1R 2O3TA 2V54A 3L0IB 2QS9A 2XXAB 1X1CA 2JAOA 3KCQA 4RAYA 3AVQA 1KFKB 3CCFA 1U98A 2JH8A 5I4KA 2JA7G 3UICA 4DC9A 5KB3A 1Z8DA 4W9NA 2OOSA 5SICE 1WHSA 1G2IA 1RXUA 4WTOA 3N5CA 3HDJA 2GSDA 2Y3IA 1T3ZA 3BWXA 3I9V1 4DUGD 3LWNA 3L4KA 1CB0A 4K88A 3ZE8A 4PTLA 3FYDA 2ZVJA 3MCVA 2V6GA 1Q1GA 1XALA 3UWSA 3MK31 4DV2B 4UHCA 3T7DA 7ADHA 4EUNA 1W5AA 5EJAA 1JTFA 1GCIA 1B14A 1J5EH 5FBWB 5ALRA 4TMZA 1RLMA 5AR1A 4F8YA 1IZZA 1B7GO 4RVSA 1QZZA 3KR0A 5JDCA 3L5KA 4GYKA 4MWOA 5AM4A 3EAQA 4M1MA 3ZGOA 1XMJA 1GPUA 4H3VA 2FWAA 2XMQA 5LA6F 3NV7A 3VDRA 5IHPA 1T4DA 1NI4B 2BONA 3PF9A 3N8IA 2NADA 4K6FA 3FNHA 4YRKA 2H4WA 5CAEA 1JU9A 3Q9UA 5CM2Z 2FGKA 3MZ0A 4N6GA 2ZXFA 5KYNA 2YCBA 4HQOA 5JSKA 4A0FA 3K0AB 5KWJA 2IH4A 4M46A 1YQQA 2VWQA 3JWHA 4LWQA 5J4LA 5ULLA 4MO9A 1JAIA 1J4AA 3DFIA 3DVQX 4CLEA 3LDFA 4CT4B 3HOVG 3T7TA 4HH4A 1GNTA 3H4VA 1JR3D 2PKQO 4J1SA 3EEYA 1YK1A 4C78A 1RKVA 2WNIA 1YVPA 3EMVA 1JFFA 2KBEA 1XFDA 1JSLA 1JLLB 1P5RA 1QYCA 2UXCH 1WXWA 2YJ4A 3R6LA 3ZNOA 2XC9A 2BZGA 4L8VA 4QGSA 4MULA 4KE7A 1E79D 2XDQB 3OCVA 2IW1A 2JGIA 5CX4A 2PKRA 1XZDA 2RFLA 1ZUNB 2UYGA 1PGJA 3UAWA 4OA5A 2J1LA 3MR5A 1SRQA 4RB0A 4TM5A 2CUKA 2BL4A 2PLNA 3IKMB 3IUSA 4LN1A 4OM8A 2D54A 1G41A 3EAGA 3V42A 2UYQA 5BV8A 2FDCA 3P9PA 1B8NA 4QG3A 1DCTA 3WQRA 3ZW7A 3DF9A 5LYJA 4BC1A 4LF4B 1PZFA 1EM8B 1M6WA 2FN9A 1UBEA 1EQ2A 2F00A 2QU7A 3ESCA 3HO8A 4M0JA 5I4BA 2WG0A 2YWRA 3QWAA 3RTBA 2NZ8A 5FT9A 4LRXA 3T1QA 4DXDA 2Q3DA 2R6AA 1L3IA 1J8QA 1OT5A 1BX3A 2SKCA 5FIUA 4BYGA 5I7EA 1E4YA 1QFMA 3R5HA 1ISJA 3E58A 5GOTA 3ZGVA 2Q3CA 3PXBA 4ILEA 1JIKA 3L41A 2QVZX 5KFNA 1Y48E 3MRTA 2QB5A 4X24A 5HUJA 3VPXA 3E9EA 4ZVTA 1DRUA 3FM9A 3VRHA 2EBFX 3I01A 3AEUA 3F3YA 4LJ9A 4X92A 2FRVA 4RSHA 3P9NA 3HXKA 5K0SA 1JXOA 2A9KA 5GJVC 1G5TA 5BN1A 5CIYA 5AIAA 4GVLA 4TTTS 5FPSA 1X7YA 5DO9A 4DYHA 2LTAA 4P3NA 4ZD6A 1EK5A 2UKDA 4CR6A 5K5EA 5DM70 2O59A 4EUHA 3ROXA 2XCPA 3BWBA 5REQA 3BD9A 2OKCA 2SICE 4II2A 4D6XA 4HZUA 2WHYA 3R7LA 1A04A 2LE0A 3ORRA 3E3LA 2CB9A 3ZC3A 3UWDA 3ZBQA 5FWXB 3L7OA 1X77A 1C2TA 3ZVRA 2VEDA 4DTIA 1KY3A 1PZNA 2YXLA 4YFYA 5DV9A 1H2WA 1NX6A 2I4TA 4UM5A 3ADBA 3T5HA 3HKEA 5HKBA 2A4KA 3UT5B 4KQ2A 4UASA 2XE8A 1I6MA 3K9CA 4JQYA 3SHVA 4ERXA 5DTEA 5KSZA 5AVJA 1GG2A 3ZJUA 3AFGA 2Z8ZA 3N0RA 2A5LA 3BQNB 3KUCA 1AGXA 4IUYA 2BGLA 1NRWA 2JF0A 1YASA 5FTJA 4I5EA 1B74A 1DAGA 1T35A 4B1FA 2GF9A 4NTZA 2PA0A 3TX6A 4KLRA 4PC6A 1JJVA 2IYWA 3U4QB 5FLKA 3RAFC 2QT9A 3ZKWB 5COQA 5JVDB 2FPIA 3OC6A 4OMDA 3WDKA 2VRBA 2AEFA 3EWAA 5DYGA 2PH3A 1QYWA 3AF5A 1KH2A 4J2TA 3FMPB 1Y4ZA 4NY1A 4P5DA 4MV1A 4IINA 4YAWA 3U7HB 4OXNA 4L08A 1E7QA 3KNZA 4BE9A 3W1EA 1JA0A 4ALKA 4HNQA 3EFEA 3L8CA 3TFOA 1VMIA 4BNZA 2ETXA 1NBOA 1LFAA 2QYSA 2VJMA 3JZFA 1IL0A 4MV9A 3SI8A 2DFLA 4Q4HA 2E55A 2FQYA 2FY8A 4OU5A 4EF5A 1E5QA 1MFPA 5DGTA 2H63A 3E8SA 5F78A 3OJLA 3SBOA 4B4KA 1NVBA 4DR6H 2XVXA 3D59A 2ZQYA 5JTUA 4A9AA 3WA7A 3RRJA 3VNVA 3E3OA 5IKEA 3D8BA 3UOWA 1AV6A 2FEXA 3D4OA 2WC1A 3H19A 5KG4A 4WESB 1ZJJA 2CL7X 2QP4A 2WT4A 2YVKA 5AFSA 4AROA 2SECE 1D1SA 2GK6A 3E22A 1CUXA 3LIIA 2D5AA 1FP4B 3SR3A 3QZUA 4TUYF 3BTSA 3DYIA 4HTAA 2CNUA 1WXXA 1ZJ6A 2YH2A 3K09A 4ARZA 2Y99A 4NHEA 4FK8A 1FFEA 2NXNA 4F4HA 2H1WA 4NCAA 3NGDA 5CX1B 3VPAA 1NF9A 4UDNA 4E4YA 2DT8A 3E1KA 4H7DA 1OIVA 4AJ9A 2AUNA 4JLSA 3QP9A 1XKQA 1P2TA 4HDAA 2G3YA 1GV0A 3AESA 4CMDA 2XCAA 2N1MA 4NR0A 1H22A 4UUMA 4X44A 1OFHA 5HFAA 4MRSA 4EGJA 2HT6A 2HMVA 4PAOA 3TBKA 3V32A 4ZDJA 1JIXA 1SUEA 4YAFA 1GT91 3H3XA 1NXTA 1CS0A 5IDXA 1NJ6A 1YRHA 5DT9A 4HQLA 1U7UA 2R2AA 1QH8A 2H2WA 3ABRB 4ZHQA 1EWTA 1XRMA 2ATVA 2EG9A 2ZPAA 1QIFA 1G21E 2R6ZA 3P0HA 4YT8A 9ATCA 2XBLA 3NFRA 1GQOA 1T4CA 4US1R 4ZKEA 4DM7A 1VQ1A 5FFFA 3WLMA 4OI1A 2GQRA 3V4LA 1ZXBA 1HFWA 4BVEA 4QULA 4JGBA 1UBTS 2PZLA 1DC3A 1ULHA 3AU9A 4MS3B 2Q7DA 3TMKA 3VH3A 4AMYA 3GP8A 5A2GA 1OR8A 1EHIA 4FUQA 3MD9A 4TQGA 5LA6B 2DUNA 1N2GA 3OPXA 3BICA 5JJ5A 4IJKA 4FPXA 4HDOB 5IDWA 2Y1FA 3TOSA 5KFLA 3PRJA 4JAVC 2ZCJA 1DU4A 2L19A 4GE0A 2HGWA 2W9BB 4HN2A 2TRSB 1DAIA 1KMHA 1USUA 1HQKA 3DTVA 1MIOB 4K9SA 4JR2A 2L82A 4A10A 3K9FC 3EZYA 1MRZA 1CUDA 1R6XA 2YKGA 4ZC1A 1E2IA 4IOMA 2HF7A 3KHGA 3R0XA 2JL1A 3LUHA 3IT1A 2IY8A 2A9QA 4WOBA 5BT8A 3CRNA 2ACKA 1EUDA 2V7UA 3R7WB 1JU3A 4JT9A 5D3QA 3CF2A 3C97A 3QBVA 1AK9A 3PPVA 3TQHA 3NTQA 3GLIE 2DG2A 5FAKA 3EPKA 3HKDB 3EMKA 1XAIA 3ENQA 2DQ4A 1W25A 4IM7A 1ICEA 3QRWA 4D9CA 1WBJB 4WT7A 5HTOA 4G8CA 4PQYA 5A5FA 4W5QA 1QYDA 3PE3A 3MQ2A 3W5CA 1ECPA 2Y71A 4QU0A 4ENSA 1M9NA 3JSLA 2OB1A 2A5FA 4HGNA 1JLHA 5EJ5A 4JI8B 2FSSA 4WZBE 1SVLA 2Z2IA 5DHSA 2ZWVA 4YX9A 2G9NA 4EI8A 3SC3A 2ORED 2FK8A 4G0YA 3UB2A 2FUG6 3LVFO 1DI0A 1YCHA 4UFOA 3CRRA 1VB5A 2ZT5A 2GTPA 3H7AA 3JR7A 3UK1A 3VR2A 4B6RA 2VSFA 3WSTA 3HDTA 2NO6A 4QPDA 1XTJA 3Q0IA 1RCTE 1SVOA 1O57A 2DPYA 1ZQ1A 2HIXA 2ZRKA 4BBSG 3QUTA 1B42A 2EJBA 1CT9A 1X94A 3OIVA 3DBLB 1FYFA 3EFBA 4G5GA 4DV7H 1X9HA 3PDUA 1HNNA 1NXVA 2XGOA 3I73A 3T9BA 3IQEA 2NACA 2I9PA 2IU0A 2JGNA 2D0OB 3UJHA 1TAQA 2EGHA 1UBSB 4GMFA 2DQSA 1JIQA 2J8ZA 3LULA 2DJ5A 4PLHA 3V5NA 4DCOA 2O8DA 4FYVA 1Z36A 3KHHA 5DM2A 4ON9A 2R8IA 1OGIA 4JV0A 2XKBA 2RGVA 1VL1A 1BHQ1 3PGVA 5G2OA 5BSUA 3V1YA 1J1ZA 1OILA 2QEQA 4HZGA 2CBZA 4Q6WA 4W9RA 3ZY4A 421PA 2IV7A 1AQ6A 3T15A 2IZ5A 3U7QA 4P0QB 5AHXA 2ODAA 2PSEA 2QRUA 1D1TA 1C9JA 3A4LA 4WASA 3IAXA 5DSXA 1NV9A 3C6YA 3ENWA 1G4UR 4YJGB 5DNAA 5J63A 2ZBUA 1AVTA 4BZXA 3T9FA 2OZLB 3RNLA 2LCIA 4HEHA 5IJWA 4KHPH 3OPMA 4MITA 3JZIA 4BNTA 3C3YA 4LE0A 4P58A 3AVOA 1YRQA 5CVUA 4TKVA 3DE3X 1UQRA 3W7VA 4PGAA 1J49A 1ONOA 4R4JA 4V03A 5DBEX 2RSLA 1E7YA 5NLLA 3SIPA 4YPVA 3QQ5A 2PR2A 3GLGB 3FUUA 5DH9A 5FRDA 3U09A 5FTMA 2EU8A 1S2LA 4CN9A 6YASA 1NYQA 2GYVA 1L5VA 1YVEI 5TIIA 1A3CA 1RZVA 3C3DA 1SD1A 1V9CA 2Q0SA 4GRAA 5FWYB 1WM1A 1Q15A 2XKAA 3DC7A 1U7ZA 3IOCA 5J47A 1UF9A 4LH7A 1EGVB 3ONVA 2X5NA 4QLBA 3CVWA 2FEKA 2CHVA 4BO0A 4GR9A 3RAPR 4G9GA 5JSFA 4V0QA 1JG2A 2CXUA 4JKYA 3OD1A 3T4EA 3WLAA 3Q7QA 4H27A 1AIPA 4N5LA 3BZWA 5KFDA 5A4KA 5LZ8A 4E6NA 2YJNA 5J1TB 1OTXA 4YJHA 1PVDA 3B7PA 2WABA 5THQA 3REOA 4JGIA 5C1DA 1BWSA 1Z2EA 2BM9A 2E85A 3T5JA 3D1VA 4IXNA 5FKJA 5L4NA 2B5OA 4KR6A 3HKZE 1N5OX 2YVUA 1CDZA 3LBIA 4FOTA 2WVJA 2KPOA 3AERA 5ER9A 1WETA 4UUBA 3ZZ0A 4D98A 2IUYA 1I32A 2PMFA 4WCFB 5B3LA 1NN0A 2AXEA 3CX3A 1TWFA 2B8EA 2G04A 3T5DA 3BIOA 1R88A 1WZCA 2IVZA 5IJAA 3TKLA 3HC7A 3SD7A 1RWQA 3V4VB 3EXFA 2H1OA 4E15A 1Z4IA 2QQGA 1I30A 4GVPA 3V7YA 4PN7A 3BS4A 1ECJA 7REQB 2DTEA 4GI3A 2Y1OA 2XUPA 4GLLA 2FB9A 3RSFA 4D9IA 4DEVA 3R77A 4PO8A 3OEHD 1D07A 2C95A 3LG2A 4ZRDA 1KI7A 2PKEA 3FJYA 3VSBA 2NGRA 4ZAGA 5C5JA 4ED0A 1UMKA 2V74B 1ZKDA 1DIRA 3AI7A 3KLMX 2HHJA 4CL2A 5EIEA 5K7SA 2HQSA 3N40P 3CWCA 1ZCAA 2RHBA 1H2FA 4E2XA 4E33A 2V9PA 4ECEA 4C7OA 2R3SA 1M8KA 3WL8A 1NJ2A 3L2PA 4RY0A 2O8BA 3T8YA 5KOJB 1HURA 3A37A 4M76B 3SYRA 3OPVA 3BMCB 3DFZA 4FZRA 2OFPA 1IBLH 3FTNA 4HDNA 2I7XA 4WGFA 2JK0A 1YI0A 1JEYB 10MHA 4UCWA 3R5JA 2FYTA 1W4RA 1YIAA 2IFTA 2IUFA 4IAJA 2WB4A 3GEIA 1A2OA 4EY7A 3PHJA 4RVFA 2YZGA 3OSZA 4OK5A 1RYYA 2XLBA 2XWSA 4YUAA 3L1JA 2VUSA 3CRZA 3DZGA 3M6VA 8ADHA 1SXJC 1SBIA 2HBQA 3E2IA 1S9HA 3HCOA 3V2HA 3E03A 3JXEA 1G6HA 2O6HA 2Q4DA 3KUKA 1W2HA 3LP6A 2QG6A 4DIOA 1KZYC 2ZUEA 3EFOA 5JALA 3B70A 4YP1A 1ZRSA 3AUUA 1F0PA 1KZ6A 2W7TA 2JHAA 3MWDA 4BBZA 4QRIA 1H2BA 1QIJA 4II3A 2VQEH 1KY4A 3PC7A 4B6QA 5A7GA 3RR5A 2DLCX 1PEYA 5IU6A 4OQYA 2GPYA 2YVLA 4FDAA 1HLGA 4BWYA 5FWNA 2ZYSA 2JPDA 1UOOA 4W1SA 1ZGZA 1KQ3A 2WSIA 1MG5A 4X64B 3P20A 4LF6B 4N48A 2QAGB 4H3KB 1EUQA 2P2CA 1U9ZA 1ADYA 1T6ZA 4B4UA 2R62A 4HGYA 1K3TA 4AN1A 4EFLA 5JDIA 2YNMC 1TAEA 1G4AE 3WYBA 4JT4A 4D9NA 4G4SP 1ZK2A 2Q46A 1VKZA 4G4SO 3ZHYA 2PJDA 2H51A 1W9HA 1Z0JA 3A9WA 3EGXB 1SCUB 3PNPA 2Q6IA 2XZLA 1TYZA 3N2KA 4DTCA 1HE8B 1NXSA 4NI5A 2OC9A 3C45A 2P9JA 5GZ3A 3KHUA 3UHOA 1Y1VG 5FLMG 3RHSA 4KK4A 1OBHA 2BT4A 2VYCA 3GMIA 2R6R1 3LOUA 4GU5A 1E5DA 2JHCA 1RAIA 3L92A 3S81A 4ACBA 1S2NA 3CU5A 5MFZA 3RT1A 2I62A 4ZXFA 1IOWA 2ZDQA 2NTYC 3A58B 1XZCA 4FFOA 3A25A 1KUTA 4NMHA 3WL4A 4BLOA 3IMFA 4DLKA 1U2QA 4OHCA 1Q84A 3LGXA 1J7KA 3H20A 1IBSA 2OECA 2QG9A 1Z7GA 1N3YA 4CXMA 2GLXA 2X58A 2X1HA 4GMKA 4CKYA 5KFOA 3T7JA 4YGXB 1B6RA 2HB6A 1M8FA 5DZSA 4OHZA 4G1MB 2WJVA 1IG0A 4CBVA 4YJ2A 3P7MA 3V97A 3H3FA 1KDOA 3M6XA 3MQ4A 1N2XA 4HDCA 4WNAB 3IT0A 1U81A 2XNDA 4RXUA 3D6MA 1Z0UA 4FX5A 4UHHA 1CVIA 3K9QO 4DL5A 1FQOA 1YR6A 4G5OA 3N39C 4J9UE 3UZOA 1JB1A 2PXXA 3O8OB 3T7SA 2AMLA 1FJGB 4Y9SA 5L4LA 1XDBA 1UBGA 2QTVB 2ZJ7A 1E96A 1U0RA 2P0EA 1UWKA 2P4QA 4RHFA 2FZ5A 3P2OA 1MNAA 3DOEA 2EGGA 1PDOA 3EISA 1E8MA 2PS0A 4H59A 4TXLA 4E12A 2AR0A 2OO5C 3D0QA 5E9JA 1WABA 4B6EA 2CDBA 4X64H 2IHTA 2XMBA 1TA4A 3I2FA 4K8OA 2IXTA 3AHJA 2WUVA 4I5GA 4YAKB 2FH5B 2F90A 1ZUHA 2YC4C 5GP1A 1KEZA 2W42A 2X5OA 2I76A 2V6MA 2AR9A 2VK1A 1H66A 5KYWB 1RRCA 5CCBA 2UVUA 4QYMA 2D1TA 2J0QA 5A0TA 4EKYA 3ER9A 2C5HA 4XXHA 1UFRA 4JIMA 4A8PA 3DQPA 1M2OA 1TT7A 4EHKA 4EL5A 1FUEA 3BXFA 4MWSA 1NG1A 3ADKA 2PKXA 1ZI6A 1QM5A 3BAZA 4R69A 5BMOA 2ZI6A 2CW7A 1JE1A 1SHLA 2B4QA 2J41A 1KH1A 2WF5A 1Y1SA 3TNJA 4EUSA 4AYXA 1I4TD 3HN7A 3IEXA 1XEFA 3NHPA 2O06A 4ZANA 1XRPA 2PFSA 3KKLA 2GPWA 4HS4A 3L0CA 4K6KA 1S1CA 2EOAA 2X77A 2QW0X 1HT1E 2Z8YM 4OJQA 5DN9A 2OO3A 2CDAA 1HDGO 3CE6A 3I8SA 3IP6A 3MINB 3QYPA 4OMCA 3UXMA 4BX9A 3UMYA 2OBNA 3QW4B 2PSFA 4XQEA 4CFZA 4TV9B 3EA4A 1W4LA 3T61A 1U65A 3WMGA 1PGNA 4DKXA 4DLXA 5J58A 4TLLB 4W63A 4CMAA 1WXFA 3PKZA 4Z1OA 5JASA 3OUTA 4TWRA 4FILA 2R97A 3DBRB 1FMJA 4LMYA 4A93G 2R6GA 3PE4A 4HAYA 1J23A 3HU1A 5F2EA 5JPDA 3PEWA 4TL7A 2RKBA 4RELA 1Z28A 4MQEA 1LRJA 4OIMA 4NYEA 3KL2A 3RBAA 1FSPA 1VOTA 2HWYA 2X7JA 1A2BA 3C3KA 3E81A 4IDBA 3F2IA 4ED6A 3AQ4A 1XRSB 2XJ4A 5IM5A 4Q6BA 5FUMA 1T10A 2NIPA 3EDMA 4ZQGA 1S2DA 2P3SA 2ID8A 1VZ3A 4F91B 3AJAA 3M9MB 1L7QA 1LW7A 1W44A 3P2JA 1T5TA 4QUJA 4UM9D 1PR4A 2H1HA 4H0FA 5CIQA 2GNAA 3L8FA 4HGRA 4N3NA 4JXZA 4UU8A 1KQGA 1X7GA 4E5SA 1QP4A 2RDIA 1YB1A 1WR2A 2CXQA 1XTPA 3Q7PA 2GERA 4AX4A 5AW7A 5JADA 4PTYA 1GSHA 3H9UA 3S1SA 3JQQA 3T3MB 4D9KA 2W2MA 2RHRA 3JX9A 1DS6A 3KPWA 3ZGYA 2X5RA 1ORWA 1ZW6A 4NDAA 5AJXA 1T9GS 2HHCA 3RE1A 3BXXA 2BP7B 2R93A 1J9GA 2A1UB 4ZU3A 2DGDA 2BM8A 1FVFA 3NIFB 1P0QA 1P2SA 1EVIA 2WQZA 2ZU6A 2RHWA 4Y2XA 3KXIA 4ETMA 5K0TA 2CV1A 4A2BA 3LS2A 4R0VA 4FTWA 5MFPA 1HMYA 1QUEA 4Q12A 5HM8A 2DKNA 3AI3A 5BSTA 4W8HA 5JPIA 3EXHC 5ILGA 3NWJA 2EJWA 1QG2A 3DOIA 4V0KA 3OFNA 4BO6A 3TVDA 2WD7A 1AO3A 1ESEA 3ZHXA 3I9JA 3PXAA 4G97A 4U2EA 3WLRA 4R31A 1U2DA 3DH0A 1H8HA 2A59A 3I09A 2AZXA 1SN7A 4DR1B 2ZI9A 3ODPA 3I1JA 4I19A 4P82A 3X1JA 2YFQA 2YWXA 2EZ4A 5I5UA 3LFUA 1ADJA 1GRVA 2D06A 2HTFA 3MR2A 1JAHA 3PT9A 4IHKA 4L4SA 3VZSA 2PR7A 3KD3A 2PWZA 3S40A 4DR5B 1P62B 3K5HA 5THXA 3ER8A 3GFQA 5JCOC 1CKEA 1GDTA 1GLNA 1VHJA 4IRUB 1THGA 3A6DA 1ZJ5A 1ZN9A 3MMNA 2YRWA 3OFKA 4K6MA 2VA8A 4GECA 2YFHA 1LPNA 2Y05A 4KUHA 4XCXA 2LV8A 2OZKA 4B5LA 4F84A 4BNIA 1QP7A 3IBFA 5BYAA 4RL4A 3KJNA 1YK0A 2EX0A 4UNQA 2V58A 3AKEA 1XTUA 3IUJA 4LXHA 4CKZA 1ZUD1 3UK2A 4YI3A 2D1FA 2R5NA 4CEHB 2HXYA 3QFSA 1QG0A 4PM4A 4F2WA 3MJTA 2K2QB 4NULA 2Y0SA 4HYYA 1ZRMA 3VUEA 1GAXA 1JHXA 3NTOA 5AD1A 5JSZA 2H4JA 3QWUA 4B3MH 1HYEA 2N9UA 1NQAO 1HG1A 3NM6B 4WKPA 3DKRA 2XW6A 4GOMD 4MA0A 3WWCA 4C4SA 3O84A 4JR1A 2W9AA 4GNKA 1G20B 5I5YA 1RW4A 4ER5A 3GNSA 1SK8A 4WXHA 3GTMA 3HKCB 4EQ6B 1HWYA 3LSYA 4UUPA 4A5OA 2IS6A 2CJXA 1P6UA 5AHRA 3DT6A 3FR8A 3BSSA 4HPJB 1T3HA 1L5LA 1DV1A 1VHLA 1YCGA 2IITA 2WM8A 4IUCS 4IOLA 4HWPA 5FUBA 4TXNA 3R76A 1E89A 3N53A 4DWOA 1YR2A 3ZZTA 3PGXA 2ZJYA 4AYBA 2GRAA 4KRGA 4RAZA 3W9BA 2OZEA 5K3FA 4KDCA 2WSYB 3HVRA 2F8TA 3OG9A 2ZBPA 5DVZA 1ZESA 4X9XA 1H3FA 3HLKA 3OC0A 2PX0A 1UMCB 4P0PB 3ZWXA 3L43A 4CM9A 4CTKA 3TG2A 1JYFA 3O4FA 1IG3A 3MWMA 1YJBA 4IXWA 2O5VA 4P08A 3GRUA 4HRYA 3ICOA 2W2XA 2ACVA 3LUKA 4WY2A 2IXFA 2C2WA 3GGOA 5BQXA 5J1SB 5E3JA 2BKXA 4OBWA 4JITA 4Q3DA 1KWGA 5FLEX 1HT3A 1RJ9B 3OZGA 4Q21A 3PDIA 4ZTZB 4ZVPA 5JEDA 3P9CA 1NF8A 4EFNA 1JR2A 2HNKA 3A3KA 3CJQA 2OGWA 4LJ8A 4QBTA 2YRFA 3MTGA 1K3UB 2NUBA 2CNBA 4P0TA 4TSFD 3KT3A 4A3SA 4MQ4A 1V95A 4A3IG 5EKDA 1EVLA 1Q0UA 2F1HA 2CJFA 1Q19A 1V45E 3GD5A 3PXEA 4GPZA 4WL0A 3VPSA 3ZDZB 1IMOA 1VSUA 5DISB 5FTLA 2FK7A 2ZRQA 1T2CA 2WWVD 4KFUA 1XMSA 2ADFA 2WJHA 5IN4A 3JATB 5D3MB 2XBMA 2VNHA 1L4KA 3AUSA 1BCRA 2QD1A 3PC8C 1RWBA 2VDMB 2OFFA 1WY7A 1WCMA 4IXDA 4PG8A 1RQLA 3O8RA 1UP7A 3EOBI 3ICCA 3PS9A 4X61A 1TGYA 3QYJA 3EVCA 3K5PA 3KQMA 4DV3B 1GEGA 1JMVA 3EEFA 3GLRA 3JAMW 1JNXX 4B3TH 5KT3A 3TG8A 3VYUB 1NNUA 3UMGA 1JLMA 3PR3A 4UMVA 4WLNA 1O1YA 1ZVJA 4LRUA 2CKZB 4WUVA 4LF8H 4AQDA 5H9WA 3TLJA 1QGUA 3MGAA 3GH1A 2IBMA 5IZCA 3TGPA 1YDHA 4JVMA 3EGIA 1Z2PX 1IK6A 3MTQA 4BNNA 5CLJA 2O8BB 3FI0A 4H6VA 5CK4A 5JRDS 3PFHA 1LA2A 3KOZA 1RM0A 2WWXA 4Z9FA 3UMJA 4OK3A 3WNBA 1MC5A 4JEMA 1JILA 5L3VA 1IRXA 1VJ1A 3HJGA 3S1AB 3QEKA 2C3MA 3KM0A 1GPJA 2Z4TA 4Z4IA 2Z6VA 1LJ8A 4WZAE 3TAHA 1DKNA 3KQQA 1USKA 2VUGA 5KT5A 3EW9A 5ALWA 1EFAA 1G8HA 1JHAA 2O9JA 5A2QW 5LFAA 3ADCA 3HJCA 3SHFA 1IUNA 1M83A 2R8EA 3EXFB 5AI6A 1RADA 2NQ2C 4UTRA 2HEIA 2HD4A 5BWNA 1L8LA 2HJSA 1ND5A 2FSGA 4WINA 7MDHA 3G89A 2H08A 4D96A 4ECWA 1D2EA 1NMXA 4O08A 3ZY5A 3H4DA 3GJ4A 3HGMA 4AAYA 3ET4A 2PVPA 2B4AA 2I4RA 1PFVA 3DL4A 1ZNYA 4RKRA 4NCHA 5KREA 2A9FA 4MAAA 2C2KA 3ACDA 3D5QA 1EUYA 4RA6B 3BMQA 5JANA 4DJ5X 2DHQA 2Z30A 3BERA 2GEKA 3NHBA 1HL7A 1G60A 3UJ3X 5C7OO 3G8AA 2RBKA 1X9IA 5GVRA 3MCTA 1P8AA 2VL7A 3TVYA 1BMQA 3M83A 3HO1A 2V7QA 1VG8A 2QVGA 2F4VB 4RL6A 1GTZA 1Q6ZA 4K0KH 3AJ9A 4UDXX 2XUJA 2XSZA 4LF7H 1EFPB 4QFCA 4DADA 3H11A 5L4SA 2LCFA 1GPKA 3MPUA 4OHVA 2D5IA 1P7YA 1YAJA 2C4HA 4LG1A 2KSWA 2FW9A 2VJNA 4KYUA 3S8YA 3M49A 4R40A 1M0EA 4NZMA 4K9NA 2I6XA 5ES3A 3RV3A 1OYWA 1FB5A 3S2ZA 4GDFA 4JI4B 2ZSIA 4P80A 3PPIA 3BHJA 4K9LA 4O5OA 5M5BA 2ICAA 4IDGA 2BM0A 1XCOA 4RA9A 4MV7A 2D8AA 1OAKA 4YRFA 3K20A 2XAUA 4HVCA 5KJFA 2I71A 4Q4CA 2WKSA 1NOJA 4TKVB 5DYNA 4PYJA 2F4NA 4CM8A 2TYSB 4CM5A 4CQMA 2Y8EA 3BRCA 1W88B 3GD7A 5D7BA 1Y1LA 1JQBA 2ZB2A 3C2QA 3PNOA 2RAPA 3PZRA 4NZPA 5FHQA 5KOIA 5KX5F 5I7FA 3IIIA 4YJGA 2H5LA 2Y0EA 3ZD9A 4I66A 4Z0HO 2NU8A 3STUA 3QBJA 4IIFA 1QXSA 1N5MA 3AILA 4PR0A 4BFCA 3WL6A 4F3TA 1EB8A 1XTZA 3ZK7A 3FLAA 2BTOA 1ENYA 2I54A 3OJEA 3TI7A 4E32A 2UZ3A 3U7QB 2BKEA 1P16A 3GC6A 1CKOA 2COUA 2WJ3A 4GX2A 3F67A 4DR2B 4XGKA 3B3QA 1LDMA 4M6WA 5CNJA 5B1YA 2X0DA 3CG0A 1ENOA 3F74A 4IHQA 4PU0A 1WPXA 3CY6A 1D0IA 2P65A 3HUDA 2PZMA 3Q40A 1DRVA 4FE7A 4NNJA 2PG3A 3W1BA 4JELA 5CVDA 4CI9A 1QK4A 1A3GA 2WWYA 3RC2A 2M1ZA 3TZEA 3DBLA 3IR7A 1JDJA 3OY2A 1JAZA 2LGJA 4K5QA 1YUMA 4XPIB 1F3LA 5C31A 4RZUA 4AUNA 5LP6A 3X1WA 2R48A 2G8LA 3KZXA 3QFHA 1LDYA 3HJUA 4CC5A 4MTDA 1E6CA 2C5SA 2CVPA 3T4UA 4A3LG 4ZCMA 4BX3A 1EJBA 4JXUA 4IIXA 1LJLA 3JZDA 4KN5A 1JALA 3OCXA 1Z15A 1MDBA 5B55A 2QPOA 2EBHX 3OQHA 3OZWA 1G3MA 1CUZA 1V8OA 1XU9A 3P9SA 4XB1A 1HG0A 3COZA 3WWHA 5JDCC 2MMCA 3LXXA 3STHA 4D99A 2CFOA 3KJFA 2JA6G 2WB1E 4DEXA 3RIHA 1TD9A 1EX6A 4I2NA 1TEZA 3H6HA 5TLSA 3QU5A 4TUYA 4WNYA 1QF9A 4YCLA 1SUWA 1HNWH 3FH0A 4FGWA 4EB8A 1WG8A 2JIBA 1N36B 3HYRA 1EM6A 5KWVA 4IILA 3QH4A 1BHJA 3KQWA 2O3JA 3HY4A 2OCDA 2PD4A 1SELA 1MAWA 1Z62A 1ZD5A 2X8BA 2Z58A 3CRQA 2YRXA 1YB7A 2W0MA 5I7VA 4LDPA 2JA8G 3BMXA 2P41A 5H1YA 1SB9A 4K9MA 2AMYA 5KFPA 3RGXA 4TVIA 1L5YA 4K86A 1WZIA 3SFTA 3BZUA 5L8VA 4LTNA 5CLIA 1C7RA 2F1RA 1FVIA 1NDQA 4K6NA 3KQOA 3FDFA 1DTWA 3AU8A 1SEIA 3TQFA 4KQFA 3QWHA 2FFQA 2ZUDA 1UJMA 3WGGA 1W7AA 1OAOC 1E3LA 5IYZF 5JYBA 1QG6A 1QSGA 1EGQA 1RVV1 2CUNA 3STYA 3SWWA 1I0IA 2UZIR 1RRKA 4WNIA 5AH0A 3KJXA 3RRYA 1MRNA 2R1VB 4PO1A 1TOAA 1WCV1 5FOWA 3SC2B 1CB7A 2DHEA 1E3WB 3TW8B 1PG0A 3AVXA 2B6NA 1ECBA 1QHHB 1Z5NA 4A2AA 2BY4A 2O2ZA 2DZDA 1RC0A 1DMRA 2WJAA 1N9GA 1HFEL 4FJ2A 1A88A 2KI5A 1TLLA 1ADGA 3CLUD 5HQJA 3NBYB 3BKWA 3F5FA 1M2VA 4IIBA 4OLFA 5LWQA 2J59A 4XZ3B 1GN9A 2JFNA 4J94A 3SJCA 1XJQA 3CHYA