2R86A

Crystal structure of purp from pyrococcus furiosus complexed with atp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
334
structure length
334
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGAKGGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 102
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r86A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r86A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r86A01
2CZGA 4O4LF 4QSHA 3ETHA 3R9RA 1E4EA 1GSHA 5EZYF 2YL2A 1KJJA 5FNVF 3AW8A 3AX6A 3RV4A 5LXTF 4IHJF 4O84A 2YYAA 3JZFA 3KREA 4O7YA 3TQTA 1Z2OX 1JDEA 5CAEB 4EABA 4EGQA 4FU0A 2YS7A 4FFMA 4YJ3F 3JRXA 3VPDA 3UFXB 4L1KA 2R7LA 2C00A 4ZOLF 1Z2NX 1SCUB 2YZNA 4NYEA 1JLLB 4TV9F 2W6PA 1KBLA 4YJ2F 5H80A 3I12A 3VOTA 5BMVF 4FGRA 5BPFA 3LWBA 2YZGA 2YW2A 2R6FA 2DWCA 5KX5F 3HB9A 5GONF 2R7MA 1CE8A 2YS6A 4GGMX 2R82A 4TUYF 2NU7B 3U9SA 5IYZF 1A48A 2W6QA 3Q1KA 2NU6B 2R7NA 4C5BA 4MV6A 4MV3A 2PBZA 4RZQA 1BNCA 2YZMA 2ZDQA 3GIDA 4O7NA 2I80A 2OLSA 1AUXA 2V59A 3TW6A 4MAMA 4C5AA 3VMMA 4FFLA 5JH7F 1DIKA 1EUDB 1B6RA 3RUPA 4O7WA 3HBLA 2FPGB 1PK8A 2PVPA 4M98A 3JZIA 3V4SA 4EG0A 2WYOA 5J2UF 1CQJB 2FP4B 3OUUA 3TIIA 3BSYA 5HV6A 2PN1A 2CNVA 4XYLB 4M99A 2SCUB 4DIMA 1KUTA 4MV1A 2IP4A 2R85A 2VQDA 2W70A 1W93A 1KJ8A 1WR2A 4Y8VB 5JQWA 1GLVA 5LOVF 2W6ZA 4EA7A 1DV2A 2ZDHA 4O4IF 4I4TF 2GLTA 3G8CA 1CS0A 3Q2OA 2GQRA 3DF7A 5LA6F 4O7ZA 4IZOA 2GPWA 2R7KA 1VBGA 4C5CA 2QK4A 2NU9B 5D8DA 4MV7A 4EGJA 1EHIA 4FE2A 3ORQA 3MWEA 3BFPA 3SE7A 4O2AF 1C3OA 4EA8A 4MV8A 4DLKA 3OUZA 1UC8A 1I7NA 4XZ3B 2V5AA 1I7LA 3K5IA 4EAAA 1M0WA 3VPCA 3VPBA 5BPHA 1T36A 3JRWA 4MA0A 1EYZA 1IOWA 2W6NA 3TINA 2FB9A 3BG5A 5JQGF 2FPIB 3R5FA 4ME6A 3WO1A 2J9GA 2I8CA 2HGSA 4WBNF 2CNQA 2NU8B 4IWXA 3HO8A 5J2TF 1E4EB 3N6RA 4HNUA 1ULZA 3E5NA 2NPOA 5JVLA 3KAJA 3KALA 2QF7A 3U54A 1KJIA 3TIGA 3WNZA 2R87A 4FFOA 3RV3A 2DZDA 4ZI7F 1M6VA 1W96A 2YZLA 4O81A 3VA7A 4HNTA 2DIKA 3NUAA 2I87A 4O82A 1EUCB 2Z04A 3K5HA 4O7VA 4M9CA 1JDBB 4MV4A 3U55A 4YAJB 1VBHA 5C1OA 2P0AA 3G8DA 4YAKB 1KJ9A 2W6OA 1AUVA 2FPPB 4EA9A 1GSAA 4O7SA 2VR1A 4HR7A 1UC9A 4YB8B 2VPQA 4FFNA 4O86A 2W6MA 1BXRA 5CA0F 1DV1A 4O7TA 3R5HA 5HBRB 4I50F 3N8DA 4ZHQF 5LP6F 1KJQA 4O7RA 1GSOA 3WO0A 2V58A 2XD4A 4E4TA 4WD3A 4YBZB 2Z02A 3BSSA 2W71A 3BSWA 5KKNB 3R5XA 2NUAB 4HNVA 2HJWA 3QFFA 4FFRA 1KEEA 3LP8A 4O83A 2DLNA 2YRWA 1IOVA 2VHEA 4HQ6A 2YRXA 1GGOA 3MWDA 1A9XA 5DMXA 1M0TA 1Z2PX 4XX0B 4MA5A 2CQYA 4I55F 2R86A 5I47A 4XYMB 2X0SA 1JKJB 2CNUA 1OBDA 3RFCA 4M9UA 4O7LA 5CA1F 3ETJA 5C1PA 2R84A 1C30A 3KAKA 5CB4F 4FFPA 3U9TA 5JVDF 4ZQIA 5K2MA 4IIJF 4O4JF 2YWVA 1KC7A 2ZDGA 5LYJF 3MJFA 4IWYA 4TV8F 2GQSA 4MV9A 3V4ZA 2GPSA 1CQIB 3ORRA 3GLKA 4O2BF 4J6EA 2XCLA 3R23A 3K3PA 4O4HF 1EZ1A 1VKZA 1PX2A 5C8YF 1B6SA 1OBGA
chains in the Genus database with same CATH superfamily
4LMPA 2C03A 1N0IA 2G63A 3UUWA 2DT8A 3WNQA 5F7OA 2RGNA 4L08A 4M1KA 1WABA 2PBLA 1N6NA 4IRMA 1WPQA 3INRA 4IIEA 2B78A 4CETA 3IKLA 3RASA 5DAAA 5FH9A 2ILVA 1YZLA 5EOVA 4UCOA 3K2BA 4TUYA 4TM8A 1KI2A 3ZZUA 1T2FA 1NM5A 4KVAA 1EGMB 4F2DA 2O8NA 1DIGA 2QTFA 3OE7A 4XJTA 3HJCA 1SC9A 4CLOB 2JIDA 1P0QA 4L57A 5TE9A 1OAKA 3HJAA 3QOXA 4HX2A 3BPSA 4JI6B 5GONF 5JHHB 1I4WA 3QEBZ 4YT5A 3WL7A 4H7IA 2SHKA 3D8UA 5CLLA 4PIVA 2FV8A 3OTOH 2GBIA 3OQNA 1ZIOA 1VAJA 5L8VA 3NC0C 4MAMA 2C1XA 3VKUA 4C5AA 1IM8A 3L40A 4HG2A 3ZU6A 5L95A 4B85A 3V4OA 3UAWA 3HKCB 4NOJA 1LK7A 3HOUG 3NV7A 4EHIA 2C2KA 4QXRA 2X5KO 3MVEA 3BWXA 1CF2O 1RQXA 1WEHA 3G9TA 3GLHB 4OK5A 5IBCA 3RB3A 3R3SA 2WIFA 1TIPA 4F8JA 2ZYSA 1H9AA 4KQGA 4C3UA 4IM7A 2XE6A 3WWOA 3EVBA 2H1CA 1HDZA 4KXXA 2B61A 4UZSA 4LTMA 5EHQA 3WAJA 3OTWA 2BEUB 1TQ4A 2WVAA 2XYQA 2FZKA 1OWTA 3H5VA 3ZVLA 2DCUA 4YMTA 1QG4A 1JKIA 4CFYA 3EDYA 3FPJA 4LVNA 1VIMA 4P84A 4R3NA 4FZJA 4GI1A 5JFTA 4RTMA 3KT8A 3UT5A 5L9XA 1SVUA 3CNOA 1I7PA 1SB9A 1V96A 3X2EA 3V1KA 2AL7A 4GZMA 3THYB 2GHQA 2P79A 2CHQA 4JLBA 4P5EA 4QU9A 3A1NA 5C4XG 1S9DA 3I9NA 2G70A 4GBMA 4HNUA 1J7KA 2C2WA 1OX6A 3R5JA 3OU7A 1J24A 5TJ9A 1OBVA 3ZVNA 4PZ0A 3GUCA 2WIJA 4G1BA 3U7HB 3RS2A 4O82A 5JSZA 1FSFA 4TTTS 2HWYA 5FBWB 1IWBB 1MQAA 1KA9H 4RKRA 4BC1A 4UU8A 1ZOPA 2ZG6A 3VZDA 2IXAA 1E2LA 4EYIB 2HX1A 1DAKA 3KXLA 2FN3A 4IFEA 4AZVA 2O7RA 2GRJA 1IDN1 3N7TA 4Z0PA 2J9XB 1WJGA 1XQ1A 1H4VB 5A62A 2ZZKA 1XD8A 2PJUA 3WHKA 1AQYA 5CDYA 3E7DA 4Z51A 4W1QA 4LFCH 4ZT4A 3OMXA 1C7ZA 1KYTA 1ES9A 1S97A 1UXIA 4QQNA 1PJAA 2DWQA 3CBGA 3FFTA 3E5MA 1YI0A 5FPSA 2QE6A 9ABPA 4IDDA 3B6KA 4C6SA 2G6BA 4JUIA 2GCEA 5G4LA 2IHYA 4I8IA 4HEJA 1N2BA 2OORA 3HCCA 5TQ2B 4NONA 1G6HA 3RFFA 2X2PA 3STTA 3WIBA 3HCEA 5GY7A 4MRMA 1HFJA 3T35A 1GZUA 5FTNA 4V38A 2CMHA 3OQOA 3S2FA 1SIBE 1DEAA 1YBFA 1R8YA 3NHBA 4LF5H 4E5UA 3S2IA 1C3EA 2A1TR 4QREA 4BO9A 1VB5A 2NO7A 3WLEA 2P90A 3LX4A 1KKLA 3ZU2A 3CVWA 3HY3A 4ZDWA 4OMFG 4LPKA 4PXYA 1E1QA 1JDJA 4QUBA 1O0SA 4H1WA 1NXTA 1ZM7A 5DASA 4N5HX 1O87A 2QXYA 2FWMX 2Z2JA 3QENA 2YFHA 4Z9YA 4CF4A 5KVAA 1I14A 3UAZA 1A7JA 3LLSA 5HNKA 1LY1A 4G09A 4GZ6A 4JX8A 1EX6A 2XMSA 2HCBA 1YQWA 2NXNA 1FRVA 4TTIA 3I64A 1B16A 4HDSA 1XCGB 4MITA 1EPUA 4RQUA 3KV1A 1JEYA 1CC1S 4HJXA 4OHXA 3IP3A 1TAUA 3M6WA 1SXJA 2V7TA 3MM4A 3TSWA 2V7BA 2OYRA 3IYLW 4Y2HA 2G67A 1U3VA 4YRKA 1CY8A 2W6JD 3DOFA 4Z8XA 1XOIA 1ZI6A 4HXEB 2X0EA 2Y68A 2ALJA 4RA9B 2EQAA 4O3QA 3DXYA 3CF6R 3IDAA 4IAJA 3NHYA 1WD7A 2GXQA 4JBIA 4DZTA 1GN9A 3Q2KA 1JDSA 1QLHA 1SA0A 1TLTA 5LMNH 3DD1A 3QVLA 4A8JC 1SU6A 4TZTA 3ND5A 4CQMB 2JHAA 2UU9B 1G60A 3NHLA 3HBLA 2FF7A 3A9VA 5E3JA 1EK1A 3QVGA 2XNCA 3HO1A 1NX9A 2BKEA 3A10A 3DUFA 4DMCA 2ZS9A 1H0HA 1R8JA 4D9IA 4HWGA 3TG2A 4JI0B 1EP9A 1PZXA 1O9HA 2R4QA 2R8JA 2PRKA 4KXVA 1N56A 4QPDA 2YVKA 2OCIA 5DBHX 2Q4BA 1DAMA 5EIOA 3C3WA 1CJMA 4AF8A 1GADO 1ORHA 4K6HA 4QWCA 1D5CA 4DIKA 2JBAB 4RK6A 3B9BA 4NAUA 1FFCA 2VTKA 3C5EA 2P6OA 1ZGGA 2G72A 1QRRA 2CNKA 3A1WA 2VPXA 3PU6A 1I4OA 1K27A 1P6XA 4FOSA 4HPWA 2BJHA 3QNWA 1CQIA 4RFSA 1NBHA 1VFNA 1FJGB 4MYUA 3AKYA 1ODJA 1E3MA 1WSAA 1QO7A 1WXHA 1WCXA 3DM5A 2P68A 2HY7A 5IANA 3JRWA 1YKFA 1II0A 1BCSB 3MB8A 1SQSA 1ZEJA 4B6RA 3COWA 3RU9A 4ZD6A 2Z3VA 2CNWD 3BMNB 2ZUBA 3CNQS 1KPIA 5JVLA 2OD7A 3NHMA 4GEGA 1R4AA 3NWBA 1N2CB 1LK5A 1MB0A 3QLEA 3SJAA 3H6KA 1N6RA 1OC4A 4NNPA 1PFQA 2ZZMA 3DWGA 3TZCA 2C3UA 4BMXA 1A8PA 4YAKB 1G66A 2R6GA 4X8MA 4P7KA 3UGJA 3P8ZA 4PYOA 2JI9A 3H1PA 1N77A 4LPSA 5CFMA 1FNSA 2HOQA 3E35A 4GLXA 1E6KA 1ZK3A 1V4VA 5JO0A 1ZRMA 3QLVA 3F4KA 1TWGA 1AS2A 5KKNB 3F3KA 3UOWA 1EXDA 1U0RA 1CEXA 1FC0A 4F1JA 1EB8A 4U63A 5A0FA 3MBIA 4RV4A 5AI9A 3ESCA 1R9MA 3ZE1B 1TM1E 2AOUA 1BO6A 4DREA 2ORVA 2PX6A 1J7JA 5JVDA 1JAXA 1F5SA 4MVCA 1ZH4A 5HJEA 1CKNB 5IDXA 4NZMA 1TZJA 1HFWA 3ZI4A 1TX4B 1LC0A 2PE5A 2VP4A 1M34E 3U9LA 1ZK0A 1TAGA 1HE1C 3I4CA 1OBCA 1PEDA 4YDSA 4DG8A 1ADYA 3EH2A 5CX4A 2WFMA 4MA4A 1JI3A 4YH1A 1COZA 5F21A 2CCGA 4D26A 7MHTA 2JLYA 2C0QA 2YYYA 2AN3A 2NUPA 4I50A 1VP9A 4PM4A 5CH8A 3P0EA 1WM1A 3BILA 3ROXA 3O94A 2QN3A 2BR4A 1VPTA 3BQ0A 4GSYA 4BAUA 1EVJA 3BWMA 3IBGA 1HDXA 5G1PA 3M9NB 1L2ZA 2N75A 4JLWA 1I2AA 3S2UA 3WGKA 4DT1B 1NLYA 4CIWA 1TCAA 1R27A 2IOHA 4F4YA 2GK7A 1VKHA 2VS1A 5F12A 4A3IG 3ZIUA 1QG6A 4X66B 4ALLA 3ZV7A 1HXHA 2P35A 2YNMA 1GPH1 4BB6A 3T7SA 1WOMA 1VHDA 2XKJE 4RLHA 4QO8A 5JNTA 2WB4A 3O8NA 3SD7A 4PYKA 5D1HA 3N39C 1KMMA 1G16A 5F3WB 3F2VA 1YHYA 3AR3A 3AKZA 3KO8A 1RYFA 2VTVA 5H80A 4QFDA 4ZODA 4AUNA 2OFXA 4JNKA 1ZJ6A 1R4NB 3BREA 1CE8A 1KBZA 1U3GA 2BMAA 3MA0A 5B4UA 4UCSA 1TA0A 3BXEA 3F7OA 3IAM6 1FLAA 4QWEA 3VNBA 4TS4A 3ADCA 4Z8YA 3A26A 2Z98A 5ERYA 3KWJA 4MCIA 4O7WA 2VAMA 4DR7B 3PWZA 3CZ9A 4E5DA 2RMKA 1XDWA 1E2KA 3JQFC 1IN7A 2CE7A 3DBIA 2V0NA 4Q24A 3FZGA 2ZGVA 4C0JA 5K4HA 1EEXB 1OLSA 1U2TA 3LRPA 2NV6A 1TWFA 4EI2A 2G0AA 4CDRA 2KW5A 2VQ6A 1V4YA 2DWUA 2J3EA 3ILYA 3G8AA 4BMSA 4WLOA 1X92A 3PICA 4YJHB 1YFJA 1TK9A 2XNDD 4LCJA 2R7KA 4JY7A 2QLTA 1NKVA 3R76A 4RFVA 5IF9A 1UKBA 4HQLA 3KETA 4RHXA 1AA6A 3LT2A 4TWRA 4DR3B 1IEQA 3AXTA 5C31A 1TI7A 1SMKA 1R50A 2F1OA 5JS6A 1Z6YA 3A9UA 1FUIA 3KT3A 4OYLA 3T9CA 3I2KA 2H4JA 3DTTA 2VIIA 2WOJA 1IL0A 2J5BA 4OHPA 3K70B 4CDGA 3R0XA 2GVNA 1ZA2A 1JJIA 5KFXA 1KEVA 2ZT5A 5ALYA 3P20A 1E6LA 1VJ1A 3AY3A 1BGXT 2P6PA 2CL0X 4TZKA 1R88A 1N3YA 1NTRA 1YR2A 3QX7A 1M2GA 2YHAA 5H02A 2P8SA 1E0DA 1BWQA 1Y37A 1C9NA 4BDTA 2ZIXA 3ABZA 4ZAFA 3G59A 1GDTA 1RC8A 3KT0A 3OLZA 3IMKA 4BNKA 4S3MA 1ORVA 1YJBA 4RD4A 4MOWA 5LLTA 4IJVA 4PO9A 5EEGA 3LQSA 3KFVA 4DXDA 2P40A 1UF9A 3U3ZA 1YV9A 2G1UA 4WD3A 2PV0A 2D6FA 4DWVA 3KPWA 1FCJA 1ZNZA 3MXTA 1E5XA 3A6FA 4XD7D 4RENA 3RADC 4URHA 5CVJA 3GLGB 1ODIA 2QUZA 1JQKA 2B35A 1E7SA 1U1GA 2ONYA 1U0EA 1T29A 1PQPA 3S5JA 5K3WA 5AI0A 3UT6A 3GUYA 3PNPA 1L4BA 2D1FA 3B8HA 4OJNA 3AM5A 1XI2A 1FK8A 3PUXA 1NATA 4WDQA 2J32A 4N5NA 1QH8B 3KEFA 3CPSA 5B3JA 5CLQA 1VE3A 2HZBA 4DJEC 5JDCC 1URPA 1ZDMA 3IAFA 1YB4A 3U7EB 2QR3A 4JLNA 4FR2A 2MT9A 1N34B 4M21A 1UZMA 1OSNA 2VNIA 3TLXA 2XE4A 4AMZA 1PFVA 5BW4A 3ROPA 4RVOA 4HMOA 4AD8A 2FWPA 3LD9A 3NEJA 1T2NA 2OKGA 2KSQA 1ESEA 2XZPA 3LCMA 2F43A 3QXSA 2VNSA 5JCOC 3K5WA 5M7EA 2GN8A 2HF8A 3FUTA 3CW8X 3H5RA 3EDRA 1UOOA 2GJSA 3LP5A 1N5DA 3DZHA 3T3IA 2WSMA 3AKEA 1RI3A 2JA7A 3TM4A 4NX2A 4GLWA 1P4JA 4JKIA 3F9RA 3HCWA 4HGQA 4HXFB 4CM9D 1QDLB 2XZLA 2W6PA 4YJ2F 2AR9A 2D0DA 1S10A 3EVZA 1XZGA 1LB1B 5HJ2A 3NHZA 3VPSA 1NDUA 3BDAA 1F06A 5A7GA 3O3OB 1OFTA 4ILEA 5KJEA 5ESXA 1E9BA 1U8CB 1K8YB 1E3QA 2ZJYA 4XLZA 2O8BA 4GD3Q 4MKHA 3UBTA 1Y81A 2G5CA 1CSEE 5EMLA 2JLUA 2XVYA 3V4SA 3DF9A 4Q1EA 1ZGJA 2QLFA 3OLXA 1SCDA 2ZSDA 3A9SA 2A94A 4BV9A 4LDRA 2NP6A 4X1YB 5HOEA 3D59A 2J07A 4DW8A 4XYBA 3H65A 2MCFA 2OEPA 4R5HA 4LG1A 4D9CA 4OD0A 5A9TA 1DXYA 3E3NA 4EK9A 2RI6A 4OGGA 5J1SB 2O6LA 1U5BB 2FVYA 4AUEA 2ZXUA 1A7AA 5AKYA 2IXTA 1VG8A 3IT2A 1JWLA 4L6AA 1XKQA 1XIVA 1U2GC 4KFRA 5HP4A 1A88A 4K1XA 1Z4LA 1ZRSA 4OUDA 4X00A 2AXQA 5CG1A 3T4EA 3IT0A 1NG1A 1FDSA 3C98A 4D9GA 3SF0A 1JSRA 2ZWMA 2H2FA 3DYVA 4R8LA 1PQ4A 5G0TA 4BGUA 2P4HX 3V8MA 1Z2AA 1ZD1A 3AF5A 4FI3F 2C97A 1T9BA 3AV3A 1DU4A 1P0CA 4X65H 1P5HA 4EG5A 1VXOA 4JOBA 1E92A 5KFZA 1A4UA 2V7QD 1N2IA 4CC5A 5D1OB 4BE7B 1WWKA 1UIMA 5KAMA 3RS5A 1ZONA 1P31A 1VA4A 4LF6H 2XYRA 3GIPA 2VFAA 4R7GA 1FDVA 1C1DA 3E70C 5LZ5A 2FZLA 4M1ZA 1GOTA 4YCJA 4KPUB 4WNAA 4MVJP 1UNNC 4PZ6A 1JV2B 1DC8A 4K0KB 4ID3A 2GPYA 4YRIA 4DIOA 1XCOA 2BTQA 4FIDA 5FPKA 1JXAA 2OZLB 3JYHA 5CVDA 2CJPA 3RM3A 5C3MA 1GLNA 3PENA 3GIKA 2F8LA 2AKYA 1E2UA 4XYLA 1PGOA 4WY8A 3L8DA 4V0LA 2UVPB 2DMRA 4I1SA 4C4YA 2D0IA 2VTBA 2VP2A 5EJIA 1L4YA 2BFFA 2PQ2A 4UBNA 3H6GA 1ZISA 1DO2A 1ZNXA 2YC2C 5EIAA 4EQZA 3E3AA 2Z9BA 2FOXA 1PR1A 4B75A 4ZV4A 3DPUA 3HB0A 3ENKA 3KUDA 3OWXA 4MIYA 4MKIA 2ZQYA 1GZHB 3WYEA 3GDWA 1OILA 5D84A 5CHEA 4NPAA 5BXQC 1VYVA 3B3FA 1S4MA 4CT4B 1UJ2A 2P75A 4LMAA 2MYUA 5E1MA 2J4DA 1VL6A 1ZGCA 1U98A 3OC0A 1H1LB 1DO8A 3HUEA 2RKWA 2AJTA 2MSDB 4MK4A 2RGAA 1VHWA 4FX5A 4UNQA 3FNRA 4QWBA 1FYWA 1E32A 4ZFNA 4G4IA 3UEOA 4B9AA 2R8GA 2WM2A 1HNWB 4ZEMA 4FT4A 4KIUA 4Y3UA 3EEQA 3FTPA 3KOZA 4FMCB 5JECA 4NJEA 5MGNA 1P2UA 2WOOA 4OAPA 3TOZA 1THZA 4DNXA 3F6RA 2J9FB 4RPCA 4IDCA 3RB8A 3F6EX 1KDRA 4YHHB 3W8EA 3F7MA 3DA8A 4RM3A 4WNYA 4ROTA 4CR6A 1S9HA 4U7WA 2FG7C 1AKQA 4FCCA 3W5SA 4O8CA 2P9GA 1IJBA 2Q4OA 5BOSA 2BBWA 2FOLA 2H1RA 1SC6A 2FPGB 2HWKA 1QVAA 1YJQA 1W73A 1SHJA 4HH1A 3U7GA 1FL9A 1WEKA 5IVKA 4MVJE 3CB4A 2C7BA 4BQPA 3ZV6A 3OEEA 2QG4A 2HMSA 4O3PA 5DW3A 3F8NA 3SEAA 3FVTA 4F1KA 1NXPA 2GF0A 4NJMB 5HILA 2HLNA 4KO4S 5LP6C 2WYIA 4B3TB 2H2DA 1RM3A 1UQTA 3MSCA 4WXPA 3C85A 5DIZA 5JRDS 2QQFA 4B4VA 4RGYA 2COEA 2GD2A 2H07A 3AB7A 1C4OA 4NRDA 1F0KA 3ROMA 1KYYA 4G1EB 4TLEA 1JU4A 5KYNA 4ZIRB 3A70A 3CUKA 5KKAA 5CCBA 6AT1A 2IS6A 1E1DA 2G5TA 1OWOA 2C28A 4NHEA 3L1UA 3WLNA 1Z39A 1XNQH 3AT1A 3MGAA 1LBQA 2W4IA 1BVHA 4DLAA 3BF7A 1TD1A 2C83A 4DV4H 4KDEA 4D02A 2IYRA 2HW8A 1VI5A 2REXB 3LQ2A 1C29B 4Y2JA 2I2XB 4DRZA 2BRUC 3QWUA 1KZ1A 2GDJA 5ICFA 2IRWA 3T9AA 5IWAB 4GOXA 3LPAA 2B83A 2JJ1D 3GPBA 1M54A 5A2QW 1Z38A 3U7QB 3C6XA 3PFFA 4HDKB 2ZBGA 2W9CA 3JWPA 5DNWA 4E21A 1RRFA 3SHOA 2FE3A 2GN1A 2YJZA 4A16A 4EBDA 2ZAGA 3I2HA 5HVNA 2B7LA 3R6DA 4BUZA 2VR1A 2B94A 5TXGA 2C3PA 5EIBC 1QGAA 4B2IA 3C7TA 5IAKA 4C9BA 4PLPA 1M1UA 4F7WA 2RGEA 1NUPA 4L4SA 4UU7A 1MABB 1HBJA 3W5BA 4PGGA 2P11A 4II2A 3I3OA 4H18A 1B1CA 1A96A 3D3QA 1KXZA 1W0CA 4GL4A 4YRLA 3WMRA 4DMRA 3UB3A 3DFIA 2HPVA 2IEGA 3IBTA 2R92A 2R00A 3I42A 2H48A 1AGYA 4W5JA 1T1EA 4NENA 2D5BA 2DTDA 2PX8A 3N70A 3CC8A 3WLIA 3E8MA 4KPYA 4ZN6A 2OHFA 1HLGA 3R3XA 4E5KA 1UXOA 3A25A 4XPIB 2G1KA 3EVTA 1Z4KA 5B12A 1UZNA 1KY2A 3QBTA 4ZOLB 3UCEA 1XCPA 5JANA 3Q8MA 2YWVA 1LDGA 5LDDC 4OXNA 3KNZA 1FFEA 5H68A 2EVWX 2XVAA 1MJ5A 4YXFA 3IEVA 4CKWA 4ENSA 3PW0A 5JQGB 1RM5A 2BFNA 5FFFA 3LDHA 5KCMA 1WS6A 1QHXA 2H51A 2CYAA 4J9UE 4XWOA 4C3VA 5A4MS 4RABA 1FMJA 4Q02A 3ANSA 4Q1CA 2Y6UA 1EVYA 2AOXA 4RJ2A 3W9SA 1JQBA 4C01A 2REOA 1FW8A 4JEMA 4EP1A 4I7HA 4Q6WA 1Z25A 4GVPA 2PS9A 1AUQA 1PEYA 5EUMA 5FD6A 3HYNA 2ZJZA 3MC1A 4WECA 2GEDA 2G04A 3HKZE 1JIVA 3I28A 2LUOA 4BNIA 3DSRA 3P19A 5H59A 3BYZA 1PG5A 2RJ3A 2HBZA 1EA7A 3FAZA 1QGYA 2VAXA 4G1UC 3H86A 3B12A 2DECA 2NVYA 3GP8A 1NN5A 2BEVB 2ZR8A 5FJ8G 4MV3A 2FZ4A 3AFNA 1EVEA 4FYJA 3KBOA 2WJAA 3RTBA 3A06A 1NMXA 2VRWA 2R8EA 5FI3A 2HVQA 5J40A 3DL2A 3KOXA 1WUKS 5JMOA 2ZJ5A 2A9PA 5LSAA 3DAAA 3D2BA 2QRKA 3UQYS 2DYKA 5CXSA 2C1EA 4B31A 4QT4A 5JNRA 5C44G 2VP3A 4B0PA 1PR0A 2JI8A 1MTZA 2IDMA 4B17A 1YJ8A 2O7NA 1YU9A 4EA7A 4AU1A 5CXUA 2V1XA 3KZKA 3AEZA 1UCFA 3RRBA 5EDWA 2W58A 1ZAUA 1FX0B 4U0KA 3HC7A 1F9EA 2XCQA 4KGVA 5HUHA 5BVHB 3AHEA 1Q92A 2YIJA 2HK9A 1KH2A 5KWIA 5DCLA 4D0SA 1ZOOA 1GUFA 2K87A 5KNCD 5I5UA 1Q2UA 4O8ZA 5FPRA 3RVJA 1MJGM 3WK8A 4S1VA 4MWTA 2FMKA 1F2VA 4DYHA 2NVOA 3ZQKA 3LZDA 4LMRA 1L3CA 5JLJA 5FD5A 2W37A 1FP4B 2QSUA 4KTVE 2CDAA 2AJLI 2FRDC 2WE6A 2RHDA 1QVWA 3GN2A 1TU4A 2H4ZA 4UHDA 2QXUA 2ENWA 1N8TA 1UKEA 4C89A 3X43A 2H7XA 3LUPA 3GT0A 4L85A 1QF6A 4BNNA 4MUMA 4J6FA 3FUVA 4G1VA 1Q19A 4LK3A 3DYIA 4D9MA 4G63A 1XTBA 2VDRB 3JAWA 4M86A 2Y77A 4DR2B 2VT7A 1T0UA 1SEVA 5E6RA 2DCMA 4KLZA 4MROA 4DIEA 5F2OA 1JKXA 5JH7B 1RM0A 2I71A 1U1FA 3N9IA 4DHEA 5KFJA 2XD9A 2FFAA 1AB6A 4ZI3A 2BEWA 2VF5X 3WYFA 4DC9A 2VJLA 5A9SA 3PNKA 4PR3A 4MZDA 4CMHA 5J2TA 3A1SA 2RI0A 4P31A 4B35A 3OKPA 3AVVA 1SBCA 1MJFA 1Z26A 2O2IA 3OZXA 2IYEA 1O3YA 4B7XA 1R6UA 2O2YA 1LKZA 3HXLA 1P75A 3NB0A 1JR6A 3VKGA 4EYHB 4F2HA 3IAS6 4QOJA 4YS6A 3UPTA 2BR5A 2H1LA 4OHMA 5C1PA 2AQIA 2WHPA 4L5CA 1MW9X 4BFUA 1DIBA 1JG3A 1ZESA 1SBTA 1S03G 1N8SA 1MA3A 1DZIA 4KREA 4QJFA 1F5NA 4PHCA 9LDTA 1T9AA 2I9PA 2ID4A 4JQYA 5C37A 1NU6A 4HI0E 5IJWA 1TVCA 3PXCX 3MJSA 4PTZA 1C0KA 4NP6A 2AE2A 4LDQA 3FPCA 2C92A 4EY4A 2VDWA 5ECYA 4Q45A 3ZGYA 4ED7A 1OI2A 2H4XA 5K0TA 1I30A 5IJ0A 3WSVA 2X76A 4IKOA 2VCHA 5KFIA 1XDGA 4UJ5A 4F3YA 1T8TA 5HF5A 4AVYA 1E2NA 4JYBA 3RV4A 2BFCB 2JDID 3ICPA 3DEHA 3NT5A 4P4NA 5EHZA 5KOHA 3DHYA 2JIPA 2HJSA 2P9YA 5EMHA 1RXSA 2I3DA 4JUZA 2DH5A 5B2ZA 4JL6A 2FSVC 3EGXB 5D3MA 5KNLA 2AQ8A 4ECQA 4J0MA 3OQIA 4Y2UA 3BCSA 4I4CA 2G7ZA 2OHOA 2QJOA 2E89A 4MV6A 3EPIA 2JA2A 3OZUA 3HSSA 1K7CA 4IIGA 5LQNA 4URVR 4OTZA 4F9FA 1K1QA 1PKEA 4FW9A 4WZAE 4Q7JB 4BPRA 4X7PA 2Q1WA 3KQQA 3PX2A 2W57A 1E7WA 3OT1B 3DAGA 1KVSA 3PHCA 4F8YA 1KYQA 4MUJA 1LPOA 3Q9SA 5FA8A 2DPGA 1NE7A 1SM4A 5T4HA 5LWHA 2AG0A 1PKXA 2GSDA 3G2JA 1C8LA 4YROA 3ENZA 1OLUB 1AGRA 1T1RA 2GLTA 1OJLA 4JQSA 5C9ZA 2ZRJA 5KU1A 1I1LA 1G5HA 1PZGA 4NZNA 1ML3A 1WXXA 5B1YA 4R8MA 1QKIA 4KV9A 1Q7GA 4NE2A 5KFSA 3ZGXA 3CF4G 3TQHA 4FLMA 2CFTA 3KQTA 5ALUA 3CRVA 4DV0B 4FHGA 5H81A 2JAUA 1E0KA 3F4LA 5FEUA 2DWPA 3GI1A 5LJIA 4M53A 3VR1A 1K4KA 2YWEA 3CX3A 1EX9A 2HHAA 1ZOIA 4BWYA 4Z9XA 3WFJA 3WJ2A 1EG7A 1QK4A 1BFDA 3W9BA 3L6RA 4EI8A 2B6HA 1IHUA 3KYDB 1J8MF 4B5LA 5HQ3B 3WX0A 3E9ZA 3IE1A 1A4RA 4G81A 3B1VA 3F5FA 4NOLA 2D1TA 2W6CX 5BMVB 3A2NA 2YZLA 1BS2A 4C1NA 2OCGA 4JI0H 1ZYUA 3UJDA 2QE7A 4JXJA 1VC2A 4BIIA 1LF5A 1A04A 3LVFO 4XOIA 2C95A 4K87A 2OQIA 2RHMA 5K0JA 1YZTA 3RR5A 2ZKLA 2I66A 3KCQA 1XK5A 4U9UA 4YR7A 1EWKA 1SURA 3ZY3A 3GILA 2XUFA 2PNJA 2PANA 3PDCA 3UJ7A 3WB0A 1NZJA 5KFLA 5ENZA 4RM2A 3KQNA 1AB5A 3HJBA 4YDHB 1D03A 4YBZB 1UKCA 3TQ1A 4JLAA 2XTNA 3JWEA 4UAUA 3SSOA 1SY7A 1PJLA 1FJGH 1O6GA 2BFAA 2P5SA 1RABA 1HSZA 3GCGA 3U19A 4DKJA 1CUHA 1KEEA 2QJFA 2PMCA 2WU0A 4JBWA 1PX0A 5I6DA 1EBUA 3M4ZA 4INAA 4CPDA 2XT0A 1OH8A 3IKTA 3UMJA 1TUBB 2ALZA 4D3SA 2CFOA 4RH0A 1WCWA 3USES 4JUAA 5DMXA 1Z2PX 3UW3A 1VYHA 2N3ZA 4E94A 3ASVA 1ENZA 2IZ1A 4ZOBA 4CV1A 1LSUA 2BE9A 5CK4A 2Q5JA 3ASYA 1E9VA 1TYAE 3T34A 3OFND 4V0MA 3LAWA 4B33A 2OO5C 5LL6P 1Q0LA 4F4DA 3LC0A 5AD1A 1IN1A 3EA4A 3JARA 3P45A 4F93B 1MA0A 2FNAA 4RGQA 1R0CA 4Z1MD 5BSWA 2HT6A 2W9BB 3EZGA 3LXRA 3UMVA 5T4BA 2CUTA 2V6FA 1OLXA 1IZZA 4UBLA 5CJPA 1Z68A 1QQ7A 3DDSA 3PEYA 3J80A 2TMDA 5DGIA 1JSCA 3ZE7A 2QJTA 1QZUA 1T4CA 2W90A 1GFWA 3AX6A 5L4SA 1I2ZA 5TF0A 3O5AA 3MIZA 5DHAA 4WZ6A 2HKIA 3NBYB 3BA8A 3KQLA 3H42B 4FFMA 4B1FA 1KVRA 8GPBA 4UTPA 4TZ0A 1ZNYA 1SXIA 1EXMA 1XTKA 3H1BA 1QONA 4J1TA 4Y8VA 2G06A 5T67A 4IIJA 2RBEA 4CEHB 4JHXA 4BWVA 2HK7A 4ZVVA 3FTCA 3ILSA 1FF9A 2P4UA 1LBSA 3H5AA 3IE2A 4YN3A 3VR4D 3TS1A 4C5BA 1JLHA 5JEEA 1TEHA 2GAIA 4F04A 5J1TB 1Z6PA 2JFZA 3AJAA 1YGPA 3DS8A 1QTQA 3BTOA 4TL6A 2XUZA 4RKFA 3NVDA 3RDPA 4L3VA 2NT3A 5ALGA 4RIEA 3BXZA 5LMUB 2BSXA 1Y1RA 4MP6A 1RBYA 1SVWA 1LI7A 2EV9A 5ITZA 3FKQA 1HE5A 2I4RA 1CEYA 5FQNA 2L69A 2V03A 1TVMA 3NWOA 1RQNA 3FUUA 2HPZA 5JXHA 4X66H 3F9IA 4QWDA 4B47A 5COQA 1RK5A 1CBUA 1NY5A 3EGIA 4PLVA 3RNOA 5IC4A 1TVEA 4GX0A 4UVIA 1M73E 2GNAA 2CXQA 3IURA 2ACEA 3EEIA 3EFBA 3ZDCA 4INPA 4NTZA 1G8GA 3DJYA 1WA5A 1VPVA 1GAXA 4LE0A 2EG9A 5KQGA 3PC3A 4O4HB 5KREA 5KFOA 3AFHA 2NYRA 2PDAA 2YIMA 1VJ0A 2DBYA 3OFVA 4NESA 1F7UA 2JAWA 3HHEA 1D1QA 3V7UA 3V4LA 3UM9A 2ZUFA 3U7IA 1RR6A 2AMJA 2ECKA 4YV0A 4D6XA 2EWVA 5BWMA 1MQ8B 2XMBA 1SG9A 3MR3A 1GTG1 3PCXA 4PICA 2OXTA 3BD8A 5JCZA 3HCOA 3IULA 3B3AA 3DE3X 4FOPA 4CQNA 4DR7H 3D2AA 4J1QA 1F8YA 3MRSA 1JUDA 5FWDA 5IWCA 2A14A 2VNHA 4B3CA 3D4PA 3I04M 4WZZA 4JX9A 1BMQA 2FK2A 4B3BA 4L28A 2XMPA 5J58A 1GRNA 5CRIA 3SMVA 3O4IA 1NBWB 1G63A 3GIMA 4A23A 4FOLA 1N1GA 1DWOA 3WRWA 4OH7A 4TXJA 4WHMA 3A14A 3QIAA 2JKZA 4JN6B 3CR3C 1IE3A 3SBDA 1QU2A 3IPCA 3FG9A 1CTQA 1GSOA 2OCKA 4KSYA 1UPCA 3GVXA 5DGDA 2R68A 2X9GA 1W1IA 3OTHA 2LGJA 2Q9UA 3ADDA 1S3FA 3U4IA 5T14A 4DR3H 2XIGA 1RADA 1GWNA 4MUBA 2FX3A 3ABOB 3ZZMA 3ZK8A 1GPLA 1UKVY 2LNDA 3WLPA 1IOVA 3CMMA 3SHQA 4B6OA 1TCUA 3PHJA 4ALJA 2E4YA 4AF7A 1GYFA 1J09A 4O4IB 1M7BA 4OJYA 1C81A 3DDNA 2JLSA 2BF4A 1M6YA 2IV7A 1PN3A 3THXB 1WBDA 1P17A 1M7JA 4IEIA 4PIMA 3DTGA 3FVRA 4R1OA 1QGOA 4F8EA 4PONA 1ZH0A 1SU7A 1L5MA 2V74B 3NRCA 3ZWQA 2NQTA 4MI6A 4RU9A 3MCWA 2B9VA 2VPWA 3C5WP 2E87A 3RG2A 1SVKA 2OLJA 5HMMA 2RHOA 5I7RA 1IPFA 1Q3TA 2CVPA 3SWWA 3BL5A 4LISA 2YZ2A 1U2DC 2X8AA 1QIDA 1NPYA 4Y2SA 3WY9A 5JCJA 3V4ZA 3ORRA 1T0JB 5JNSA 4P4SA 1BAPA 4Q3BA 4WA7A 2RKOA 1GG9A 5AVZA 4PAMA 2WNHA 3QUTA 3MERA 1KS2A 3AONB 3OSPA 2W2KB 4YO8A 1U2PA 2WJ6A 4P0QB 1YB5A 3D3KA 4B3MB 1UDWA 3VI4B 3O47A 5F77A 4CMFA 4GWLA 2CEKA 3ZE0B 4M9ZA 1QPGA 4N39A 1NURA 2FPPA 5CHYA 5FCDA 5KT7A 3F3YA 2XQKA 2UXCB 3W4IA 2VYVA 3O4FA 4AIRA 1LEHA 1TF2A 4KI7A 4LHXA 5K1ZA 1NL3A 3KQMA 4A92A 3KHHA 3EXHA 5T8KC 2UVRA 1XLUA 1TZ2A 4XH9B 1A48A 3IPYA 2JFPA 4FXPA 3AJDA 2VDJA 4G5FA 4C7MA 4Y2RA 3SVLA 3VMMA 5FR2A 3G2HA 3WLFA 3F8SA 3L18A 5DJ5A 4G0ZA 3CE9A 3GZTB 4PPFA 1TF5A 3TW7A 1XJ0A 1EA5A 1NLZA 2XX3A 2I91A 4R1PA 1HOTA 2XZTA 4YACA 2MYNA 2Q45A 4WW0A 3TF5A 1GGMA 2AG5A 3TD9A 2E5LB 1S68A 2OBNA 1XZNA 4HNHA 1OFGA 1DV2A 2OXEA 3WZ2A 2EHDA 2ZDHA 4PNZA 1KT8A 2A4MA 4IV5A 3BL6A 4DLLA 1LI5A 3N86A 3R40A 4EDFA 2QX6A 4D42A 3Q6IA 3HKBB 2GVZC 4B84A 4QDXA 4RQBA 4RJLA 5KNDH 5FPHA 2NO6A 4ZC1A 2X5NA 3RSZA 5CM2Z 2QDKA 3ESBA 1OH5A 1JEQA 1MT3A 2WMOB 2Y0EA 4KQKA 3MGGA 2LPMA 5E9AA 2E9SA 1H5QA 5EIWA 4Q3LA 2O05A 2V4QA 2OAEA 4MQ6A 3U3XA 4BU1A 2HZ7A 1KI6B 2HD4A 3ZXUB 5EYPB 3JV7A 4HTAA 1CRZA 4FUQA 1XBTA 1N2JA 5HFAA 1EM8A 2H0QA 1RMYA 4KRYA 1YE5A 5CLGA 4JI1H 3OD1A 5LNK6 2WAMA 3D2CA 3DKKA 3N2IA 5AJVB 3RV3A 3UV3A 2C4NA 1P19A 4F6RA 3G5UA 1SKMA 3GD7A 3DV9A 4ZU6X 3WNCA 3W9YA 2IQIA 1MZVA 2DUJA 5EVCA 1K92A 4AY4A 2GK6A 4WT7A 1H9CA 1J06A 1EM6A 3WR5A 3KTOA 3RHFA 3GJYA 2C0PA 2FKNA 4GM1A 3TSZA 4RSHA 1JKMA 5T41A 5SZKB 1UT8A 4OG2A 4PO1A 3IAM1 4UTZA 2QYZA 2VUSA 2WAOA 1ICIA 4I99A 4CV2A 2PMFA 2HSJA 2QM3A 2XDWA 2H2IA 2Z2XA 4ZYLA 1HKHA 2ZTMA 4WH0A 1V11A 4KR3A 1U28A 2GM3A 3KAPA 3LCCA 1Z28A 4CT0A 2DETA 4AK9A 4HQ6A 1EKXA 5G1NA 2CJXA 4DE5A 1WTCA 1E2PA 4JAVC 2O8CA 3HXTA 1KKMA 1DVRA 1HE2A 4O4JA 3Q72A 3TTXA 4TQ9A 4GBGA 4UMFA 3P5SA 4RZUA 2HF7A 1G18A 4FYXA 4OJTA 3ZWPA 1RCUA 2QLMA 3VSBA 3OM8A 2PT7A 1Q0QA 4L02A 5EWMA 3T5HA 2P9QA 4WKCA 3AYZB 2D7CA 1GR0A 4CLOA 3LXXA 4NARA 1E64A 5HUQA 1SYXB 3ICCA 3I05A 2GQSA 4R5MA 5GJBA 4DQKA 1ZNWA 3PD1A 3VU1A 2AVNA 4K0KH 1W5BA 1XV5A 2R6DA 4HAIA 5JD5A 3FMOB 2PA0A 3ESAA 3VUFA 4TWZA 4JI2H 3SP1A 1GP2A 3KPJA 3ETHA 2Y0CA 3RODA 2ZRHA 3H5NA 2QLBA 1M2OB 3K0FA 1VMEA 1CXZA 1IWOA 1QVRA 4BLWA 4TV9A 1P0PA 3U4MA 4ETMA 3DZCA 1ZMBA 1QHYA 4IVRA 2HLHA 4PIPA 4ZJYA 2F59A 3NDRA 5LYYA 1GGEA 4LHEA 4X8LA 1CQWA 2GBFA 2GN0A 4P7FA 3TH5A 3WGTA 1J0CA 1AIPA 3WRXA 2C1ZA 3R4VA 1RZ3A 2WINI 4MNTA 5FFNA 1DC6A 4FKBA 2RGWA 4NDAA 3TRDA 4UQLA 5KTNA 2VF7A 5ER9A 1JQEA 3KEGA 5KFAA 5BV1A 3N6VA 1PS8A 1SUBA 1Q95A 2BEUA 4V03A 1ZJYA 3ZIAA 3Q1KA 5AICA 4WKPA 4YR3A 3N42B 1PSDA 4B71A 2XY4A 3CH6A 4OJKA 1GTMA 3U4DA 5HIAA 1JS1X 1Y63A 1NBAA 5DGAA 2EP5A 5FLKA 1NLFA 1C5KA 3EWSA 3LWZA 3THYA 3IO5A 1NIJA 3P2OA 4RHTA 4B4OA 3GTGA 2B2NA 5BV8A 4BO4A 5JWOA 2ZRNA 1KDZA 3B9QA 2WVGA 5EI5A 3W0LB 2PZLA 2FVXA 1TW2A 1AKTA 2E6UX 4XRRA 3Q5GA 4AT1A 3BJYA 3MXOA 4C06A 2I62A 2B25A 1A95A 2JVJA 4O2BB 1ZH6A 2XMDA 3HZOA 3AW9A 5B53A 1AH2A 2CD7A 1KEUA 1YJAA 2QRNA 3DE5X 3Q41A 1RLJA 4MMXB 4JR2A 2NZXA 5EXXA 3GGCA 3I2FA 3W1GA 1LPAB 2OD2A 3LT0A 4UPVA 1WX1A 2IYLD 3R7DA 1X9HA 1ZUWA 4FDLA 5G53C 3C8ZA 1VBKA 4J8PA 1T4BA 4WEQA 4L3WA 2HTFA 3EGDB 1NR7A 1AKUA 5EMKA 2HMVA 2JK1A 4IH1A 3B2QA 1AKWA 3GPDG 4JXKA 1R4MB 1CUFA 5IRCD 2XGSA 1Z37A 1JN0A 3VR6A 1NI4B 1SCUA 7ABPA 4TMXA 2ZIUB 1VLZA 4QBKA 2BFDB 3IAAA 3G8DA 4GGOA 2VPYA 2IHZA 2R3SA 5DW0A 1XTZA 1UPXA 4B3TH 2VQFH 2CDBA 2JEFA 1IXSB 4HWKA 5DYNA 1V8FA 4ECYA 2I2DA 2ZBUA 1L4HA 3GIQA 3CEPB 4UFZA 1Y1KE 4ZHQF 3HV0A 3L0PA 2XWBF 3EF1A 2NM0A 3WGGA 1J90A 2W71A 3K6JA 5A3SA 1IG3A 2IUEA 3FYUA 4BV3A 3UA4A 1GZ3A 3NEAA 2PG3A 1M34B 2PLNA 4G8JA 5GOTA 1DTSA 2P3OA 3KX2A 2HJHA 4R4JA 4Q0YA 2JFFA 4H3VA 4KXQA 4M22A 3HCFA 4N3CA 2QTAA 2W2PA 4K6FA 4JI8B 1Z2EA 4JJFA 3DMRA 3PDIB 5J43A 5TPZD 3CYFA 1UWKA 3QXCA 3WMEA 2IHUA 4KGZA 1PS0A 2BVNA 3IUQA 2PEZA 1JXLA 5IWAH 2R86A 4HJRA 4R2XA 4PQGA 5DOVA 3UHFA 5IS2A 5TQVA 2FHPA 2FW0A 2ZUWA 2JGRA 4OPMA 3H9GA 4ED3A 2R6ZA 2PZKA 3E0QA 3UHOA 1MHPA 1PR9A 1OFUA 3GWGA 2XCAA 1LSOA 4RA9A 5MFZA 4LXTA 3ACBA 1UOQA 1JYFA 3H4BA 4J6EA 1BXGB 3DCYA 3M1AA 4Z9BA 5F7XA 4DQLA 1W5TA 1NNSA 3UZOA 4N5MA 1ELOA 1GRRA 5CDUA 2M9MA 4A3CG 1H22A 1RYHA 4S1PA 4FYKA 4DAAA 2VG8A 2CVHA 1Y8CA 3PW2A 5A3JA 3PHLA 1BU8A 1K7YA 3MNFA 4BE4A 1W0KA 2QSJA 2R6AA 3S1LA 2AWNA 1DZ3A 5HXAA 3C7CB 1J1ZA 2PGOA 1WCV1 1GL9B 5DM1A 2R7LA 4UARA 3H0EA 5IFKA 3RVPA 1JP7A 3CPEA 4BN4A 5D5HA 1UUFA 3NRBA 4TKUA 2HCTA 2WVHA 5KS2A 1R00A 1KO8A 3VISA 3BIXA 1OJ7A 1UMKA 5KYXB 1Y1TA 2FSHA 2AU0A 1IUKA 4LQCA 2P5YA 3WFIA 2WF5A 1DDIA 1H69A 1BCRA 2AN5A 3VTZA 2X0NA 3DXXA 2XYPA 5EC8A 1X80A 3DLCA 5T5QA 4LSMA 3IVAA 1LZLA 2G40A 1M0SA 3VUEA 5BN3A 1XQXA 1A2OA 4UE2A 2G1AA 4A8JB 4Y2TA 2VI5A 3P71T 2XCIA 1I7DA 1A9XB 4JLPA 3OA2A 4AKIA 2NO9A 4ZKDA 1H4SA 5LCXA 2VHQA 4QARA 5G0VA 3HOWG 2IOFA 1TCCA 4S04A 3V1MA 3QI7A 1KMHB 4YTEA 1HNXH 3T12A 1BGWA 3LDFA 3RW9A 5ALSA 2Z6QA 1FXSA 3RUDA 4IDBA 4MV7A 3EFOA 3S8MA 4EKNB 2BDTA 1OB5A 4KYIB 4QGBA 5JZBA 5F4BA 2RAFA 3JVDA 3HBFA 2P3SA 4V0SA 1JZQA 5AOVA 4E15A 5EJ5A 4B9EA 2Z57A 5CVVA 2BZ1A 4BQFA 1YOVB 4QIWA 2OMKA 1TGYA 3NP9A 1D8TA 4DV3B 3M9XA 4GKJH 2IU4A 3EXEA 4QO7A 3ZDQA 3X1DA 1EE1A 5IPFA 3RGWS 3P5BA 2FR0A 1M2VB 3FVWA 3KLPX 4CYMA 4A3DG 4M0CA 5KTRA 1QRDA 4GSKA 3F9CA 1RYSA 2ZIEA 5FOSA 3VU9B 2PQ6A 3A8TA 2RGBA 3BE6A 3NMUF 1Z6GA 4Q03A 1OX4B 3U4GA 3BRWD 3FB1A 1BFUA 3AVYA 1IB6A 2WFAA 4BPBA 3OQ1A 3K20A 3L0ZA 3ONWA 1PFUA 4JASB 4KYTA 1TB4A 1USKA 2X2EA 3QXGA 5EXSA 5DTMA 3D6VA 1HFKA 4AJKA 4E4TA 3G2IA 2JF0A 4H7PA 2HDNB 2YHIB 2FG5A 2UZ0A 5JNVA 4GXTA 2IVZA 1TFRA 4P0PB 3TX2A 4II7A 4DSOA 3OZDA 5CEJA 4HNVA 3ACDA 4K9DA 3SZRA 2RAVA 3IUSA 2CW8A 1K6EA 4J4HA 2YVLA 4A3MG 4FEGA 1KI1A 3JVIA 2YZ7A 3K1JA 2IWRA 2GZMA 1PDWA 2FEMA 3QK7A 4M7RA 3FTQA 4OHWA 4Q4DA 1EX1A 4ASUD 2ATEA 1OV4A 4KJZA 3GCDA 4BLVA 3CBQA 3VJKA 3T0IA 3ND9A 5B1DA 2P9EA 3R7SA 3DDZX 4RY2A 1KFBB 4BUJA 1YT5A 1RLIA 1TMKA 3PHGA 2ZTHA 4DLBA 3MTBA 4BVBA 1QE0A 4WLEA 3I2JA 1L4NA 3LUDA 4DR2H 1Z0IA 2A7QA 4K6MA 1MFPA 1Y6ZA 1GM5A 1ZJZA 3G85A 4WACA 4MYHA 3ZHOA 4BP9A 4ZZ1A 2B63A 4EF6A 2VL7A 2V7PA 1PVOA 2YV4A 2VT6A 13PKA 1VKRA 4ED0A 3MZ0A 4QBGB 1MENA 2AE1A 2WB1A 1TNDA 3AF6A 2A33A 4R31A 4O84A 3OPYB 1YR8A 4D1YA 2CNOA 3CEJA 1RHJA 2C88A 1QYVA 3LBYA 4JA0A 4EUNA 3IVCA 5DYYA 2FFQA 4HNSA 3GRYA 4RZIA 4CF3A 1K86A 1WMDA 3DUWA 1V1RB 1MAHA 2DT5A 3LV8A 1SK9A 1PZNA 1VCOA 4OX9B 2VK8A 3WB2A 1M1NA 5DBOA 4MW4A 3VR2D 3HZRA 5BYBA 2X8WA 3AVOA 2BCGY 1HDIA 1M5TA 1R3DA 4FBGA 4GX2A 1AUXA 1T15A 1HL3A 1L8XA 4L16A 4RAOA 1B0AA 1FVXA 1CDOA 2OOKA 3O2QB 1YDWA 3HPRA 2G71A 1CQJB 3T7CA 3H4MA 2GBPA 2H3HA 3LWDA 4ONEA 1LLCA 3TLJA 2OENG 4KDRA 2HU5A 5HIKA 1HF3A 4LNHA 1DMRA 5A71A 3C43A 4OFBA 2IOQA 3L6CA 4MQUA 2AJCA 3C16C 2Q21A 2H85A 3HBNA 2JLQA 1H9BA 2CLHB 4ZARA 4U7CA 5EXDA 3N05A 2P27A 2B1IA 3GB9A 4DLRA 5DLFA 4TWAA 3JYQA 4DDMA 2QK4A 2ERXA 3NV9A 1V5WA 1CLUA 1Y82A 4OFXA 3QBVA 3THWB 3WQQA 3EQ7A 1RWPA 5IP5A 3WL8A 2XQVA 4ZVNA 2Q6OA 1GFSA 2H11A 1L5KA 3P0FA 3A3OA 2QR5A 4Z7QB 3IUJA 3QE9Y 3HLTA 2GZDA 5GAJA 3GLGA 1JX6A 3W6PA 4XQCA 5K7SA 4QL3A 1Y1PA 2FJUA 1Q0UA 3HO8A 1X74A 2GK3A 5C4GB 1E4EB 1ECJA 1SC3A 4DXHA 4EY5A 3QPBA 4E6NA 1C0LA 4IUCS 2WZBA 3DCNA 3FY4A 1XVAA 4NG4A 2JHGA 4V0RA 3A9WA 4KIFA 1Y9ZA 3UK2A 1L5QA 5L6MB 1CUWA 1ORTA 3JATB 5IULC 4KK4A 3U55A 1UT5A 1H2HA 3SQOA 1ZQ9A 4JJ6A 1V6SA 1WB6A 3MJTA 2B4KA 1T5BA 4M49A 1F6WA 4XCVA 4A2AA 2ERCA 2GD0A 2FZEA 2XRYA 5AJTA 1CF9A 4HNGA 3ZYZA 1FVHA 3QW4B 4NAVA 1DV1A 3N58A 1O94A 3OHMA 1XPJA 1AK1A 1C3XA 4LMBA 1DKQA 1SCIA 5FUBA 1UFVA 3PVCA 3FNFA 4X97A 3KU1A 2DBVO 3TBKA 3ZKWB 4UZFA 1QS0A 2QTHA 1EU1A 4DV0H 5JMPA 5TR9A 2PV7A 4MVXA 2X4GA 2FWIA 1LI4A 4C0QC 4JJIA 3AUSA 1MZPA 5G2OA 3N8KA 5E4YA 4X60A 1G21A 3HJFA 1GO2A 1NNI1 4J2TA 3F5DA 1LTKA 3CUSA 2EKZA 4Y2XA 1BWRA 4YV1A 1K4MA 3N2EA 3TL6A 1HL7A 3PNQA 1T9HA 3FGPA 2EW2A 1GGKA 3SDSA 1E4OA 2D3TA 1M72A 2WKWA 1SCBA 1LTHR 3EA0A 3UQZA 2Q3BA 3KKQA 4NBTA 1IMJA 4PSAA 2EJTA 1WO8A 5LYJF 1WD5A 2C8KA 2GCOB 2A58A 1MH9A 1X9IA 4LJSA 4Q9LA 4F7DA 4X3PA 2PT5A 3GDEA 5EZYA 2GCGA 1JR2A 4AQ7A 4QT0A 2ZSFA 1LS1A 2HDOA 2C9BA 3ZHBA 1KARA 4HZIA 4B32A 5FAXA 4UNIA 1A9PA 2O1XA 3W79A 2ORYA 3KTMA 4URUR 4V0KA 1PG0A 3IE0A 1NRIA 4LWPA 1DAIA 4BWFB 4ZCIA 4CHGA 3INTA 4WBXC 1VPDA 1WQ1R 3P9XA 3A36A 4NE9A 2BHRA 2YJTD 3QVMA 1DP4A 3CJTA 2FSUA 4P34A 2UXDB 1AQUA 4JIMA 2VYFA 1J0AA 3K0AB 3GEEA 4HB4A 2NVWA 3QFSA 2X86A 4M1QA 2Z4RA 4GZ3A 2NO5A 2PSDA 1NUSA 1HUQA 4BLTA 2ZCVA 4RJJA 1PQWA 2QRQA 1E69A 4XIGS 3QZ7A 2D4AA 4OCZA 3UB2A 4GG1A 2IP2A 4AL4A 1LRJA 4JI6H 3ER6A 2JFWA 2ZPTX 4Q1BA 3VVMA 5JADA 1LDMA 1ZGAA 1G2QA 2YS6A 3G68A 1FRFS 1CFZA 3DTVD 2CYCA 2BP7A 4PQRA 3ND8A 2V59A 2DR2A 4QUKA 1I7QB 1C0EA 4FS1A 2XAUA 3ZHXA 4RBNA 2O0HA 3QKRB 4KW7A 1PK8A 2PQ0A 1W46A 2IU3A 2WTNA 1SN7A 1DIHA 3R6GA 2Z2IA 1UODA 2FZCA 1ZSVA 3WIVA 3JTMA 3ZJUA 1XZAA 1TMYA 2X8LA 3WK5A 1ESMA 2A88A 2BHSA 4L7QA 2A84A 3RUHA 4WOKA 5FBKA 1WUIS 3T94A 3IAS1 5T4EA 3DLIA 3SF8A 4HAOA 2PSEA 3PDUA 3F0TA 4KN8A 4W6ZA 4CIVA 4Z4CA 2OWDA 3B89A 2B5VA 3LKBA 1D07A 4XSGA 4MHTA 4B4KA 4IQ4A 3I0MA 3DVQX 3OZFA 4DANA 4G97A 3R6LA 1EHYA 3ROFA 3WDMA 1G3QA 3Q3CA 1GYRA 4D9EA 4U5QA 4DRXB 2C4VA 4RF2A 3P2KA 3T5GA 3VPCA 2ECOA 3T5LA 4DSTA 1UBNA 5HS4A 4HVCA 3Q8XB 2P2LA 4TS1A 1W76A 1HDGO 3AB8A 2ZUEA 2WUGA 2HGSA 4FNOA 2F64A 2X40A 1W87A 2PWYA 1NBEA 3PG5A 1SCNE 4D5EA 4ZI7F 2UVPA 3CNEA 1DAFA 4M83A 4MI1A 1FDRA 2IDJA 3M6IA 3JD4A 3M6VA 4IS2A 4WOJA 4QX6A 1IY1A 2YUIA 1CZLA 5MF6A 1B43A 4HP8A 4QD3A 4LOLA 3D7KA 2OM6A 5CITA 3GAAA 4JC8A 2QTVB 1L7DA 2P0EA 5K4AA 1VGVA 4J2OA 3HN7A 1L8OA 2FOIA 3AUUA 4HN2A 2OD9A 2FQ1A 3FAKA 1YZGA 4B6SA 4TXLA 1A98A 5A5DA 1W2WB 2RGRA 3VH4A 2X1LA 3SVZA 2QLLA 2IUTA 2NYAA 4OY3A 5DV9A 4XDHA 4I55F 2IYTA 3I53A 3ZY4A 4I6EA 1LVHA 1HA3A 5B37A 3T7TA 3FOWA 4RPJA 1ETUA 3F7TA 1TA8A 3KU4A 2X0SA 3IQGX 2O3TA 2ZBPA 2H4WA 4H6WA 3WWDA 3CGWA 4EW3A 3EYWA 1O89A 2YR0A 1XTVA 3EZ2A 3VNRA 1KJZA 3UWMA 1IPEA 1T6NA 4TTPA 4V2IA 1Q57A 3JASB 2ZDGA 4C6HA 4J1NA 2ZJ8A 1RYNA 4DN6A 4DCVA 1MB4A 4DPLA 1KE1A 4CI9A 1R1DA 2QBYB 4TVIA 3A3KA 3V4FA 3DLHA 1KP3A 1V47A 3KHLA 2VHTA 2CDCA 2FEXA 5I5GA 2QNIA 3X1KA 1PTJC 4AJ2A 4FPXA 3VJLA 4NFLA 3ZCUA 3A4VA 4PLHA 5CB6A 5LL6b 2OY0A 4EHBA 2QPLA 1A1SA 3WLAA 3T15A 1NVDA 3W1WA 1QIMA 3OIFA 1MKYA 3OTGA 1V4BA 5KTTA 4KN6A 1OUMA 1AV7A 3MFQA 5FI5A 2PR2A 1A7KA 4PZZA 2IUUA 4EUKA 1O96A 1RTTA 1M66A 2C2HA 3E2IA 5IEJA 4ZYXA 1U8TA 4QOEA 4XDYA 2HIXA 1K4YA 4EL5A 4HNRA 1DAEA 4DR5B 1VL8A 1CJCA 3HR8A 1T1GA 4WLNA 1JBKA 4UCTA 3V46A 4ARCA 1HV8A 1XLTC 3T7DA 1OI7A 3C5CA 1NFFA 2UU9H 2ZQ5A 3F3MA 3ITKA 1E3DA 4A2PA 4FFLA 5D85A 3PV0A 5L1KA 3L05A 2PVPA 5THQA 5F9HA 3T9BA 1PV1A 1MJNA 4DPKA 2J87A 1PT5A 1NVXQ 3GRUA 2YIDA 1KIMA 3A28A 3LCJA 4M4SA 3VJRA 3FWYA 2W6ID 3R7FA 5EINA 4N65A 5LU8A 2ZGIA 1R4ZA 1EFVB 3QUBA 4LSZA 2HQSA 5BV2P 3DB2A 3NT2A 3U49A 2FG6C 4C87A 1BYIA 5A2GA 4B3MH 2Y9MB 1U0LA 1THGA 3ICOA 4RB1A 2OH2A 1Q0ZA 3DFZA 4HAWA 2QI9C 3EG5A 2A0WA 3U7QA 1J1IA 3MCAA 2UUBB 1L8QA 4C5CA 2UXCH 4Z9FA 3SLGA 1GRQA 1ND5A 2WTUA 1WRBA 4DSZA 4KBGA 5J23A 4LYYA 1F38A 4UXHA 5DNEA 4F4HA 2Q2UA 2H5LA 4HNAA 5LP6B 4O2RA 3M9MB 1Z88A 1WHSA 5B5SA 5KVQA 4RF4A 3LUBA 1MABA 1X9GA 4KACA 1QZXA 3K09C 2HADA 5T3YA 2PMWB 4CL2A 1XP8A 3RE1A 3W6ZA 4LSAA 3AUYA 5AVOA 4IJMA 3DZDA 1XVVA 2NU8B 3EW7A 3Q6NA 2P9BA 2Q6LA 4DA0A 3G1TA 4KZKA 4EPXA 4NPHA 4XARA 4C2BA 1TU3A 4DF3A 3LW8A 3LLCA 3GUUA 1V9CA 2OBXA 3ZDAA 1UT6A 1H8EA 5KOYA 4M36A 1TAEA 2VSNA 2FF5A 2E5LH 3TR6A 4FGZA 3J80W 3P52A 1QORA 1NX6A 4HVAA 5IABA 3WG9A 3VDRA 4LGMA 2R6R1 2DC1A 4KRFA 3L0CA 1T5DX 3W5HA 4D41A 4HPJB 3FDZB 2PLAA 2Y4RA 4IH9A 3UCFA 1L9KA 4MB6A 2G8LA 3D2LA 3TLZA 1RJFA 2GQ0A 5AUNB 4P35A 4MIEA 1BG6A 4WUVA 5JFOA 5JQGA 4UQOA 3BB4A 2Z8YA 2IC5A 1U2SA 4YMGA 4PG6A 3T3HA 4ZJPA 1NY6A 2QTBA 4WFIA 3D31A 3WP0A 4GVLA 1A0IA 2F48A 3RGXA 4HRYA 1AK9A 4N4AA 4DTIA 2J0QA 2CMDA 3F1LA 1ZN9A 1IUOA 4FYVA 3PGVA 1BKSB 1Q2XA 4JODA 3B1KA 4DJ5X 4IP0A 5BSKA 1O57A 3Q88A 3I2GA 4MHOA 2CVZA 5FUQA 3DMNA 4EFDA 3U62A 3LRXA 1F51E 3WWJA 1BU5A 3OETA 3KPVA 2OM2A 3FPFA 3DAYA 5LPNA 3JX9A 2HN9A 4HTFB 3IB3A 3SHWA 1NASA 1E79A 2PS0A 4QPJC 1SCJA 3GQBB 4UREA 3HHPA 4TV8F 1Q7TA 1DNPA 3RBZA 4NULA 1WHTA 5FJJA 4GRDA 2B34A 4Y6PA 1VE9A 2BEVA 1EWVA 2PR7A 5HQTA 1Z47A 2WABA 1DRKA 2PBFA 1JMVA 3B53X 4EPTA 2OBYA 2FP3A 5DGTA 3SK0A 1W1UA 4RAYA 3ESZA 4ND6A 3PQDA 1DIOB 4DV2B 3CLHA 2A9JA 3C6BA 1GL3A 4ADSG 1YACA 3UMYA 1VJRA 2PL3A 1V1MA 1X9NA 4AKGA 1O95D 1XXHE 3UYYA 4JEIA 4KWCA 5CT8A 1LA2A 1B93A 4L76A 2BQUA 1DKNA 1J9EA 4QWMA 4WZAB 4GLBA 2J45A 3RSQA 3ZWAA 1CWUA 5BV7A 5HF8A 1X7YA 1ICEA 2FMAA 1DRJA 1MNAA 1T2AA 5EJ6A 3GELA 1BN7A 1Z4JA 4EHFA 4S24A 2Z8ZA 1U1CA 1AQLA 2CYBA 3AR2A 5DRYA 5I7UA 2Y0SA 5KTPA 5AKKA 1CUVA 4UHKA 1B6RA 1MOQA 2BY4A 2ZWVA 5DHUA 3ENQA 1DAGA 3JZIA 3BX1A 5A6SA 5JCPA 1A77A 1OPXA 2V8OA 4B8ZA 1RXYA 1ECFA 4BO1A 3FTNA 5DTEA 3VU3A 2NV0A 4PBCA 1Y1VG 1F14A 3GROA 5EJFA 5JTUA 2W6ZA 2IYFA 3WV5A 4IDFA 4RHEA 4P1ZA 4B44A 2DEUA 2GEFA 3AF3A 2PFSA 1A8SA 2B7CA 3IAHA 1YR6A 5B3KA 4RNDB 4YQWA 1S8AA 2ID7A 4LYGA 1QSGA 4Q01A 3MW8A 5FORA 3BD6A 3HDQA 3LVQE 1M0WA 1ZM2A 1N6HA 1C7IA 3GIIA 3H1EA 2FEKA 3LKDA 3QSYA 4CLEA 3FMFA 5FBLB 2ES4A 4HGYA 2I8LA 1ZHQA 2W5UA 4HMQA 3E5NA 3S1AB 3U17A 1MX3A 3KALA 1JG4A 1T6ZA 4C78A 4AP5A 1UP6A 1Q0PA 3PW4A 3AR8A 3AFMA 3LUFA 5DNCA 4FFSA 4CTOA 5H16A 4EY6A 3GGDA 5K3FB 4ZYVA 3H0CA 4X24A 3KKOA 3ED5A 5D00A 2JL1A 1IB0A 4YJKA 3R20A 4ZP1A 3RJ9A 1LLUA 1E2HA 4K3VA 2YTZA 2HLDA 2C5HA 5J59A 4O3FA 1NVMB 1GL6A 3ZBTA 3OWHA 3HPQA 4CEJB 2OV3A 3OOSA 1I8TA 2V9PA 2GBLC 4CKCB 5HSGA 1PWXA 3BA9A 2R4TA 4BAGA 1Q84A 1TQ8A 1Q1ZA 4ZGBA 5H70A 1V1JA 5A4IS 4MPRA 4NMXB 3FGZA 3EGCA 3O8LA 4XW2A 1GUBA 3RBDA 1DIRA 1R3UA 5BR8B 5HTKA 4WIAA 2VT2A 2Q2VA 2X9LA 3F46A 4M9SA 3OPQA 3L49A 5I47A 3VNAA 1I1QB 1R74A 5ED4A 2BFCA 3P2EA 2J30A 2R1VB 2V9WA 4RY0A 2WB2A 2PXCA 3R0ZA 3JAKB 4PAOA 4BLPA 2F3PA 1N34H 3QEOA 3W04A 3BTVA 4AULA 1DKRA 1XK6A 4RHUA 2EBUA 1SU4A 2ZJ7A 1P2FA 4OLHA 3IDFA 3HN2A 3H1GA 4C0LA 1PRYA 7ADHA 3C7KA 1J9GA 1ZVKA 3S0JA 3V3TA 1UPUA 4KNVA 5L6LB 2OCLA 4A8HA 4WBNB 2E37A 2OAP1 1ULSA 4OU4A 4JGBA 3G0HA 2JCYA 3CRMA 1RMQA 2WIAA 4X9XA 5IZCC 3FSJX 4JVMA 3OFJA 4KAJA 4IDHA 1JAHA 3M83A 4IL5A 2YYAA 5LNK1 3L92A 2Y1LA 3B82A 4P81A 1NBIA 4CNQA 1FU4A 1NQXA 1J8YF 3MLBA 1QWSA 1JVBA 2GM4A 3DO6A 2P9CA 4QECA 3TGPA 5AJZA 2YYSA 3I01A 2OHHA 2QLNA 1ZLXA 3LBAA 4JLMA 5EJAA 2QM7A 1KI8A 2W0SA 5DISB 3V80A 3EEBA 5AM1A 4IDGA 5TY0A 4MRPA 4Q3DA 4LKRA 4R7RA 3OH8A 5I8ZA 1WMBA 1D1PA 2O2SA 4HYTA 4O3NA 2NUAA 4MLZA 5ESRA 3AHIA 1Q91A 4CGZA 1P77A 2AJ8A 5AJWA 1YR1A 3JTEA 4KO3S 4LX0A 1HRDA 3VI3B 4XX0A 3QWHA 2C04A 2X0RA 1SVMA 1MDFA 3ZNPA 5E9JA 5HWSA 4FZ5A 3G0GA 2UYYA 1LNZA 2NW6A 4JBLA 3KEQA 3MGCA 1C2YA 4V1CB 3KYDA 1LSJA 1A0GA 1FFAA 5ALTA 5DI3A 3MJHA 1K9SA 1USGA 3CKKA 2FCRA 1DKPA 3AVQA 4NZPA 4PZCA 3CKMA 3CSUA 3VZBA 1L7EA 5E7JA 1IC6A 3GP5A 1YDFA 2MTBA 1VJCA 1QGZA 1PFYA 2UZAA 2CSXA 1C1YA 1FRQA 4CMDA 1BW9B 7GPBA 4XEUA 5ALJA 1IY9A 3BEDA 5CA0B 1KHTA 3I62A 2XHEA 3OMWA 2LV8A 3S81A 3P9QA 5THXA 3KJXA 5I7OA 3T5KA 4XJSA 1XRSB 4CWAA 2AG8A 1G7RA 1IOWA 5CEFA 3BQMB 3HEAA 3U0GA 2ZAYA 2M32A 1CZRA 4A15A 2HCFA 3GIJA 3RS9A 1P1KA 2P9ZA 3ENWA 4P54A 1ZS9A 4EKGA 4FFOA 4OMDA 2WJWA 2FHSA 5GGXA 3O9ZA 5DI9A 3PC2A 4AJ9A 4KIJA 2X5OA 2ZB4A 3K0CA 3DDUA 4QIHA 2C20A 3IMFA 5FTMA 5B55A 2Q9AA 3L7LA 3RC8A 3ST7A 3RKUA 4U7FA 2AYZA 3W7AA 4NE7A 2F17A 4GBED 1ULUA 3QKSB 3EC2A 3UJHA 4A10A 4Y2PA 2MOKA 1JHOA 1ZEMA 3QXXA 4G23A 2PKYX 1EVIA 1U0JA 3HKCA 2JGNA 3G8BA 2H06A 1O1YA 3NLLA 4CM4B 3E9YA 5JAOA 1M8KA 3D81A 1OXMA 1A2KC 2X23A 5IC5A 3FHLA 2HIMA 2KS6A 1OX5A 2X15A 3IEUA 3GLHA 2AK2A 4BBPA 2PLFA 4I4TB 3HCNA 1F2UB 4DV3H 1C8BA 5A1TA 4Z1OA 2QTLA 4KGXA 1ODLA 1TYZA 3C3MA 3TLGB 4LH7A 4R7ZA 2IH5A 2PRIA 3AO0B 3NHJA 5DYTA 2ZYHA 3OPYI 1JFSA 3PIIA 4UCVA 2CNUA 1R9GA 4XI9A 1WZ2A 1E0AA 3LE8A 1C4KA 1E2BA 2VRNA 1GGHA 4MUXA 1U9CA 2PX0A 3GT4A 2BKXA 2QB5A 4EOGA 4UBMA 5JZOA 4ZAXA 4EUEA 1M83A 1D9ZA 5KWSA 4K05A 1CDZA 1JA1A 4N7RA 1NPTO 4PINA 1CZKA 3VYSB 2JIZD 3NC0B 4HQFA 1LQ2A 3IIJA 2BGMA 2AZMA 1YZNA 5DO9A 1X1DA 4QU0A 1SIWA 1V9LA 3K16A 1LF0A 1HNWH 5H1YA 3WOVA 3ZXXA 3TDKA 4C7XA 2COGA 1JG6A 4RJTA 3CXRA 4HB0A 1W49A 1Z2OX 2HHHB 2XCTB 4EABA 4AYWA 5EZQA 2Q0SA 3GFBA 5I5XA 2B69A 2FUG6 4FINA 4IOMA 1GZSA 1TQ6A 4NCAA 3S99A 1P2BA 1I80A 3CA8A 1UPAA 2VOBA 3GLIE 2O8FB 1ZM4A 1UBGA 1EK6A 4OXXA 1T10A 4YHHH 2IU6A 2Q3FA 3LQ1A 2HB6A 4MS3B 3OJXA 5G3ZA 2H8GA 2FMHA 3V00A 2R8IA 2UUPA 3LQQA 5AVUA 2PS1A 3K8YA 3IP7A 1BKDR 4LF7B 3TIVA 1HQCA 1NUUA 1PNOA 4RD3A 1JFVA 3ZV3A 3KP1A 3KUXA 1RKVA 4W6QA 2NUBA 4S35A 4U2KA 5JXJA 1I2CA 1TYCA 2OAQ1 4GKKB 3CWZA 1K0FA 4AYBE 3FJYA 5TQ2A 3ADPA 1EWYA 1ITZA 3IOMA 5ICEA 2DERA 3LULA 3H2BA 4M7WA 3FPEA 1MIHA 3N5CA 1GLVA 4LEIA 5DHFA 4FYMA 3JQ9C 2RC6A 5EVJA 2WLTA 2RJNA 1P1FA 1W4RA 5TV2A 1SCAA 3L6OO 5SYAA 1JZTA 1Z7YA 3I2YX 2GUWA 3QVJA 2FCAA 4EJMA 3S8YA 4MR7B 3Q2IA 1DG1G 3O6VA 1RKQA 3R0QA 3PEVA 2Y67A 3BFPA 1BHO1 6PFKA 3LTNC 1WE2A 2DTEA 5U4XA 4UE3S 4XIIA 4E5MA 4OX9H 4M0JA 5CXXA 4TVKA 3GU3A 4PZUA 5EA2A 3GFPA 1OH6A 1R9JA 1XR3A 1M6NA 4DCSA 2QOEA 4HRVA 2L42A 3CPJB 1IHYA 1E3IA 4KE9A 1OTHA 1QFJA 2UDPA 4RD0A 1Y7TA 4WFQA 1G4AE 4FZ3A 3WGOA 3FIUA 1EFRA 3TDMA 3FCXA 2MIIA 3DZIA 4GYJA 2VDUE 1B2LA 4K8OA 3LJKA 1CY6A 1NJSA 4CC6A 1WPRA 2BFOA 5DGXA 4PGHA 4EF5A 2DZDA 1W96A 5DP2A 2J6SA 4CFZA 4BNTA 3FHOA 4HAXA 4ZGGA 5T7BA 2GJ4A 2H1IA 4F12A 1FA9A 2QKYA 2FWNA 3SR3A 2R8ZA 3ADBA 1ST3A 1OYYA 3CQZA 1CW2B 3INNA 5JXWA 4LOHA 1IHPA 2M98A 4DUGD 4HWTA 5H5JA 3HFSA 3DFUA 3KVOA 4WINA 4CQMA 5J2UB 4AWAA 4XB1A 1WPGA 2E85A 3SX4A 4OL0A 1IHDA 1GZ5A 2VSFA 1PJQA 1CR0A 2GUGA 3V33A 1LBIA 3N2KB 1Z06A 1NXXA 1BSVA 4UPEA 3W2GA 2Q9CA 2O7SA 3I1YA 2Z08A 3RC2A 5F9NA 2WI8A 3TX6A 3UGKA 1J8QA 2P7IA 1JYSA 3IC5A 5LUAA 2YHSA 2LVBA 4ZVUA 4NU0A 3CPHA 4ZQCB 3A6KA 2ZI6A 2JBAA 3HYSA 4WK0B 1ISRA 1DKLA 4FJ2A 3LT1A 1SULA 3CHYA 2PL1A 4LRWA 3HR4A 1ZH2A 2AXNA 5ALMA 3AZPA 3VBEA 3M3PA 1EIZA 3QUCA 4PAGA 3MWFA 5CJJA 1I1KA 4BQOA 4CTJA 4E2YA 3ZDBA 4DCMA 3LO5A 3P9CA 4G5GA 2G4CA 2F62A 2IEBA 2DR0A 1HE4A 3OJOA 5JYDA 2PX4A 1CT9A 2B8JA 2EG5A 1BCSA 1B04A 3E1SA 4MVJI 4PLGA 4BLRA 1DPGA 3FMVA 4MS1B 3LLUA 1UWLA 4C22A 3ECSA 3R4CA 3UAYA 2B92A 5AXCA 3KKPA 3BMNA 4CU5A 1CJKC 1C0PA 4ZCLA 3I32A 1YRLA 1N2CA 2ZROA 3CW2A 3MAAC 4FNMA 3NTUA 3D0KA 5HKOA 5LN1A 2NNLD 3RBEA 2A78A 1JQAA 2O1EA 5UKDA 2EC5A 4IGFA 4P3KA 3O3NB 2BTOA 3D6UA 4IAOA 3M2PA 4IBOA 4YAKA 4FLFA 3JZAA 5JALA 1YK0A 4BGEA 1E6WA 1J2EA 2BBTA 4HZUB 4QXQA 4ZEWA 3LWBA 3GV5B 4L22A 3ZK9A 1N1DA 1CRPA 3ZG6A 1EJ6A 4P4GA 3FKIG 1XL0A 4TUYF 3E7PA 1FMFA 3G88A 2W6QA 4Y30A 4FSHA 4YAWA 3LC2O 4PO3X 5M34A 1C1XB 3OCXA 5HFJA 4UBIA 4LV8B 1TZBA 3A3PA 2VWHA 5FTJA 4IO1A 3P2JA 1EJ0A 1UBTS 3LBNA 3ZD8A 5U9CA 2FQYA 2A9VA 3U37A 2BHLA 4HLCA 3TOSA 2OG2A 5HKAA 3W6NA 3C0KA 1ZQ1A 5IJ9B 2QNBA 1EWRA 1CKNA 3VC1A 1F0NA 3CJRA 3DHEA 3W5JA 3EXIB 3LQKA 4Q6BA 3W4JA 1JZSA 3E6AA 2UXDH 4UTVA 3CLRC 3L0YA 4L50A 4BBZA 5CDFA 1VZ3A 5KYKA 2JH9A 1BA2A 3GLIB 1GNQA 3W2EA 3G2NA 2W2NA 3IG0A 4IZOA 4HEHA 4RNMA 3DMTC 4KPEC 1E6CA 4DEXA 1UL1X 2JFUA 4FMDF 4YAFA 1L1RA 1Q3KA 2OESA 3FZEA 1SBZA 2AI3A 4E4RA 5JC8A 3MR2A 2R9VA 3OLQA 4G01B 1JR4A 5REQB 1I2BA 4F4FA 4DT1A 4MVJH 3QMWA 1RBMA 3IUEA 3HVRA 1X39A 1CP3A 3L8ZA 2PNFA 1FDIA 4KQJA 4YJFB 1ZKMA 1ZBQA 5AVYA 5DBIA 1YQEA 1T3TA 1ZY2A 1B4DA 4Q18A 5HJ5A 2OVBA 4CI0B 3A6ZA 2HRZA 5J9FA 5HPYB 1DEKA 4EH1A 2UZ3A 3UMMA 4OI0A 3PLRA 4EFMA 5A0VA 5ALOA 1P29A 1U8AA 3WWHA 1Z5NA 3B85A 3DZBA 2H08A 1R4NA 2WAXA 1DBVO 2FWAA 1PZFA 1UWVA 2H29A 1NULA 5D87A 2DULA 5AJYA 2WKQA 4QJ5A 4BQRA 2BC9A 5IKOA 1F6BA 2ZE8A 1W5AA 1SOAA 4Z6KA 1OIXA 3ZDRA 3U3MA 5HIIA 1KBQA 2VJDA 3TZBA 2GHTA 3HWSA 4LF8B 1Z08A 1KO4A 2WQ6A 2AMLA 2C2OA 3OE7D 2FN8A 3DCIA 5CNMA 4V0NA 5JY6A 4JBYA 3RUCA 4RTLA 1JI0A 4E5SA 1HT0A 2F67A 3RK1A 3TKLA 3ZS9A 2YOGA 3GRVA 4NATA 1FJXA 4UMVA 2WD9A 1IRIA 1ZICA 3CN7A 3K6KA 3SYMA 2WT8A 2XJ4A 3OO1A 2X7HA 2BCJQ 5JAMA 4YJHA 2X13A 2VYQA 1Y1WA 2JI6A 3RFCA 1UBUS 1UBOS 3BTUA 5DGBA 3IUBA 1Y42X 4I1IA 2W83A 4RKWA 5KYVA 3JQGB 3W1BA 2VA3A 1LNSA 4RTSA 4G4JA 3AFIA 5K8VA 1ZK4A 2YVUA 2ZT8A 2GO7A 2IPAB 1NOIA 1XVIA 4BYMA 2XUDA 2ZWAA 1RJDA 3S5UA 1NN0A 2MSCB 3MCTA 3D1LA 3PT9A 3OF3A 1F20A 2AMVA 1RBQA 1THTA 5C8YF 3BK2A 3L4BA 2AI1A 5LWQA 5EKUA 2EZ9A 5B58T 1P4SA 2OXCA 3M4IA 3N2YA 3LYHA 4UW9A 2C8VA 4DUZB 3SM9A 5KTYA 3N8NA 4QJIA 4LKOA 1LLDA 4Y18A 1V95A 4J9NA 4YAUA 4DDKA 2WRZA 3EDMA 3IJRA 5JZVA 2SNIE 3GLVA 4C4ZA 2H7CA 3AVPA 3KZ1E 1MEEA 2IPNA 4TT3A 2AK3A 2DWCA 1S5PA 3NAZA 2YOFA 3VZQA 3QTLA 4H6PA 2EKQA 1P1BA 4QPZA 1D7OA 2BMEA 2NU6B 4R9SA 3OZWA 4TYWA 2HK8A 4I9NA 3DGEC 1VSQA 3AVWA 5HYVA 2ZWIA 5JROA 4QSMA 2AF3C 3N53A 1WRVA 2UYGA 2GHRA 1L6RA 3A1TA 4I8XA 3JQBC 1V3QE 3EGDA 1QH8A 4H77A 1RP1A 1JQLB 3KTAB 4RMJA 2O4CA 1MU0A 2YWJA 3PXGA 3MILA 3QBDA 2VQSA 3GD5A 1PR3A 1UJCA 4YT4A 4OB7A 5CYFA 1MIOB 2C5EA 1JAZA 4MYSA 5EJ7A 3C74A 3HS3A 2PH5A 4A9AA 1E7QA 4WVLA 1AKMA 2HTEA 2GN4A 4MDYA 2O1SA 1MAWA 4XWAA 4JOQA 5DLGA 1TT5B 4J7XA 4DR5H 5IHPA 5AVTA 4GYKA 1QYCA 1W19A 4HN9A 1YOBA 1E0SA 4YP7A 3R3JA 4F38A 4H4CA 4C4AA 4XYEA 2FPMA 2QD3A 4ED6A 1SQ0A 3A0UA 3BXHA 1L1QA 4DL7A 1J8DA 2Z1DA 4OKIA 2CCJA 4HUQB 4F46A 2JJ8A 1U02A 1E1QD 1CRLA 2HHLA 1O97D 4JUDX 1PT9A 3GH3A 1EK2A 5CPFA 1T8RA 4MRNA 4GW3A 4MRRA 5KNDA 3RAPR 5F7ZA 2X6RA 4UTRA 2OZEA 3ZNOA 4DC0A 2IL1A 4GECA 3BRCA 5FO0A 2CXTA 4QW8A 2PH1A 1HGXA 4D0RA 2XEDA 4NMLA 4O86A 4J3JA 3ZWVA 1TRHA 5DNDA 2UUBH 2HNKA 1XZLA 4FHEA 1KWKA 3DOOA 3SJ7A 1FKAH 1EXNA 3QE4A 3C6MA 3D8SA 4NI5A 5IYCG 1SXJD 1W2GA 1QCYA 4RF5A 3GNQA 3EQ9A 5KWEA 4Z49A 3AP3A 2FDXA 3O31A 5I4IA 3AILA 3N59A 3W5OA 2NO1A 4X1YA 1P45A 4L4UA 1XHFA 2QW1A 2IZ5A 4NZZA 2ZIVB 4MGEA 3MJVA 2WLSA 2AC2A 4M1MA 2P8JA 2E0IA 5ILQA 2G4LA 4RHFA 4FFWA 1U5BA 4LJKA 5AW6A 3KXKA 1U7UA 3NUGA 1J21A 1TTPB 1YVUA 3OX4A 2LKCA 2YXNA 5JVDF 1D04A 1JT9A 4PC2A 5ADHA 1I01A 4XVRA 2C5GA 4JEHA 2QD2A 2JFGA 4UM8B 3IO3A 2CXSA 1E0JA 4CXMA 1ZETA 3JD2A 2IW1A 1KTAA 1ZIYA 4OHVA 4FD2A 1U0OC 1R5NA 1X1SA 3ZJ4A 2B2XA 4A1OA 3O4VA 3I8OA 3KVNA 2XRMA 4GPIB 1NF9A 4GI2A 2JFVA 4UUOA 4FM9A 5EZSA 2EJVA 4YGXB 5G0SA 1FYVA 4G0PA 2Q3CA 4A93G 3R8XA 2FWBA 3DV0B 5D1OA 2YY5A 3RJMA 3KD3A 4ZVRA 1I6UA 2QU7A 3PUWA 5LOVB 4E03A 2BFMA 3CH4B 1TA9A 3R6WA 1OAOA 1C1HA 3CLKA 1U7PA 3E15A 4KPUA 3CV3A 3NOVA 3EGOA 1V6AA 4R2JA 4XCXA 1YR7A 4H7EA 1XMPA 3LUKA 1XKXA 4PYJA 5BUZA 1RE0A 3A9CA 5LQKA 2H1FA 4FI3C 3ULKA 4F4XA 4CTNA 3W1VA 1P0IA 4OYYA 2OZLA 2E2WA 2XCUA 4FGJA 3QVKA 1ODFA 2N9UA 2CLKB 2WP0A 1DCTA 1ULHA 5LMUH 1EZZA 1JSX<