2R86A

Crystal structure of purp from pyrococcus furiosus complexed with atp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
334
structure length
334
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGAKGGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 102
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r86A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r86A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r86A01
4YJ2F 4FFNA 5LA6F 3U55A 5H80A 1UC9A 4O7YA 1EYZA 2VQDA 3OUUA 4MAMA 2YS7A 4FFLA 5CAEB 2YRWA 2PBZA 5J2UF 3G8DA 2FPIB 2YW2A 1I7LA 1CQJB 3RUPA 2YWVA 2PN1A 4O2BF 2I80A 3DF7A 4I50F 3VPDA 4O4JF 1B6SA 4HR7A 4C5CA 1VBGA 4YAKB 2X0SA 4YAJB 5CB4F 3TIGA 3VMMA 4MV9A 3GLKA 3VPBA 3G8CA 3N8DA 4O4LF 2ZDHA 3NUAA 3K5IA 3VA7A 4O7ZA 3TW6A 4Y8VB 1IOVA 5KX5F 1Z2NX 2R87A 4YB8B 4WD3A 2R6FA 2P0AA 2Z04A 3V4ZA 2YZNA 3BG5A 5JQGF 2R85A 4TUYF 3HBLA 4ME6A 4O7WA 1M0WA 1KJQA 3WNZA 1E4EB 4O86A 1UC8A 3JRXA 4C5BA 2W6OA 5BMVF 2V59A 4ZOLF 3TINA 1B6RA 2FPPB 1EUCB 3V4SA 5C1PA 4O83A 4O2AF 5LXTF 4MV3A 1E4EA 2SCUB 2W6QA 4MA0A 4TV9F 1AUVA 1A9XA 3LWBA 2WYOA 2CNQA 4WBNF 4I55F 4M9CA 3JZIA 2J9GA 1C3OA 2DLNA 1EZ1A 3WO1A 2NU8B 2CZGA 4ZHQF 2VHEA 4YJ3F 4ZQIA 1W93A 3WO0A 2I8CA 5BPFA 1BXRA 5JH7F 1KJJA 2PVPA 1GSAA 2FP4B 4XX0B 1GSOA 1KJ8A 3GIDA 2R7KA 4EGQA 3KALA 1M0TA 1CQIB 1JDEA 3I12A 3KAJA 4M9UA 4M99A 4MV8A 4I4TF 3TQTA 2IP4A 3RV4A 3R5XA 3TIIA 5C1OA 5KKNB 5J2TF 2QF7A 1IOWA 2ZDQA 2ZDGA 2GPSA 3BSWA 1DV2A 2R84A 3RV3A 4O7SA 5C8YF 2NUAB 3JZFA 2CQYA 3ETHA 4RZQA 1M6VA 2GQRA 1Z2OX 1A48A 1C30A 4HQ6A 3JRWA 3E5NA 3RFCA 4EAAA 4M98A 2DZDA 4O7LA 3K5HA 1VKZA 2Z02A 5CA0F 4FFPA 2NPOA 2DIKA 1PK8A 2W71A 4O7VA 3VPCA 1VBHA 3LP8A 4IIJF 5GONF 3BSYA 3K3PA 3HB9A 4FE2A 2GPWA 4XYMB 5FNVF 2HJWA 1ULZA 4YBZB 2W70A 5JQWA 2OLSA 1CS0A 3ORRA 3MJFA 4IHJF 1JDBB 2W6ZA 2CNVA 4O82A 3BFPA 2YYAA 2YZMA 4L1KA 3U54A 1EHIA 1CE8A 3VOTA 1OBGA 3AW8A 1PX2A 2NU6B 2R86A 4GGMX 2YZLA 3HO8A 2YS6A 5HBRB 3OUZA 4EABA 3Q1KA 3MWDA 2QK4A 2VR1A 4MA5A 4XZ3B 4HNUA 1OBDA 4O7RA 1KUTA 1GLVA 2W6NA 2NU7B 1I7NA 3R5HA 4MV7A 1KJ9A 4MV1A 3R5FA 4FFRA 1KC7A 2NU9B 4FGRA 3U9SA 4EA9A 4E4TA 3R9RA 2R7LA 1KEEA 2R7MA 4XYLB 4MV4A 4O81A 4HNTA 5IYZF 1T36A 2R82A 3KAKA 3SE7A 4IWYA 3Q2OA 4J6EA 4IWXA 4O4HF 4O7NA 4QSHA 4EA7A 3QFFA 3KREA 5CA1F 2DWCA 4O4IF 2V5AA 2XCLA 1W96A 1KBLA 2CNUA 3ETJA 5JVLA 1WR2A 4EGJA 4NYEA 5JVDF 1AUXA 5LOVF 1KJIA 1DV1A 5LP6F 4HNVA 3R23A 2HGSA 3U9TA 4EG0A 5K2MA 3BSSA 4FFOA 4FU0A 2VPQA 2GQSA 4MV6A 4DIMA 3N6RA 2V58A 1JKJB 3ORQA 5BPHA 1DIKA 3AX6A 1SCUB 1GGOA 1EUDB 1Z2PX 4FFMA 2W6MA 5HV6A 5LYJF 2FB9A 2R7NA 5EZYF 5D8DA 4O7TA 2FPGB 2YL2A 2YZGA 2YRXA 2XD4A 4ZI7F 1BNCA 4DLKA 5DMXA 2C00A 1GSHA 2GLTA 3MWEA 4C5AA 2I87A 5I47A 4O84A 4TV8F 3UFXB 2W6PA 4EA8A 4IZOA 1JLLB
chains in the Genus database with same CATH superfamily
3ZHQA 3HKZA 4ER5A 1Y9EA 4YI5A 3HOUG 3IV9A 1J97A 3AXTA 2Z1NA 3TLAA 3G3EA 2XGJA 2IS1A 4HZGA 4E94A 3EOAI 4XDZA 2YC2C 4GFDA 3PCXA 3HHPA 2P0YA 4QUHA 1A97A 5EMLA 2BFPA 5LLSA 2AYXA 1KK2A 5AK3A 3USZA 5L95A 2YIJA 5DBFA 5F64A 1NM5C 2WD7A 3NOVA 5B1DA 5K0JA 2XUHA 4F91B 1E9VA 2RONA 3I8SA 4CEIA 2VHYA 1N56A 2MMGA 2PT9A 1SC6A 1WB9A 3G7SA 1Q1AA 5T5QA 1RJQA 1IJEA 1T6ZA 5I8PA 1S2OA 5CX1A 4UC0A 1FMTA 1P2FA 3ZV4A 3QIVA 3NVDA 1K5DA 5HOEA 1GHTA 5CK4A 3NOQA 3ESXA 4M1SA 2FXIA 4IJWA 2QX9A 2EV9A 2YXLA 1D9ZA 3G0BA 1PSZA 3T61A 2NW6A 1X92A 1ZAUA 3EQ7A 3O8NA 1L5WA 3FNIA 4EDFA 1EZ4A 2WMOB 3DDHA 2ZETA 2L17A 4RYDA 4ZZ1A 2FPWA 2HO4A 3DBVO 3WO1A 4MUIA 2ZUCA 4KKVA 4S1VA 2AR9A 4MI9A 1AQNA 1E7QA 1U4OA 1XHLA 3UAXA 2O3UA 3CVYA 2CE2X 4L5JA 4ARBA 4HFJA 1OGJA 4WJZA 2FN9A 1GZHB 1H65A 4MKFA 4BQQA 4QARA 4NZYA 1RTTA 4JJFA 1WX1A 4L0CA 5GQSA 5BXQC 1G7CA 1I4OA 1ZISA 1KF0A 2H7VA 1X7YA 3AFHA 4E30A 3L79A 1GZ6A 1T2UA 4NXMH 4IJVA 1L2TA 3E5HA 5GPBA 5AICA 5GZ1A 3G6VA 5JO0A 1DQRA 4YACA 3AR7A 2Q29A 2GCIA 1QKKA 3ZH2A 3KT6A 3G82C 4B0OA 4DZZA 1VL2A 2HU7A 4AECA 3RVSA 4CIDA 2XH8A 4TVSA 3SVTA 5G4KA 1M8JA 3GAZA 2AMJA 3WJ7A 3QYPA 1FYEA 5ALDA 2BJVA 4C0LA 4PICA 3JSLA 3EYAA 1O75A 1W0JA 3AH8A 4WIAA 5JALA 3WGJA 2F3SA 3SR3A 1N57A 5ESDA 1YC5A 4F97A 2VA2A 5JQGB 4J1TC 3DAAA 3ZJVA 1W36D 2OMKA 4BX9A 4ECTA 3K0KA 1CRLA 1QH9A 2O2GA 3EVNA 3UXHA 5KNCD 2Y0SE 2JKYA 3GLIE 2PYDA 2CLFB 1YB6A 2WAOA 4HQFA 1RR6A 1C9YA 4M0PA 3NHAA 2VJKA 4WWHA 2NU7B 3TMAA 3LPCA 1EJ0A 2VSXA 2UZAA 2BE9A 2CW7A 4D97A 3GTMA 2RIRA 4V2UA 4JT8A 1I2ZA 3LKVA 3KEOA 1WMAA 4MW2A 2XITA 4FGWA 1JFRA 1G4UR 3N86A 3S40A 3IPRA 1VIYA 2IZZA 2G08A 2QI9F 5JH7B 4B71A 4O4IF 3KR1A 1BGVA 3FCSB 1RQLA 2C4MA 4DR2B 5GVSA 3UAVA 1V48A 2DR2A 1FTQA 1GO2A 2C96A 5FJ8G 1ZHFA 1NRWA 1YB5A 1SVWA 1P81A 5IK2A 3K1AB 2N75A 1MB3A 4OOEA 4TMKA 3U4QA 2EWWA 4PR3A 1FQKA 1JWBB 1UBLS 1MA0A 4MR8B 3O92A 4NYMQ 1QG4A 4Z7QB 4Z1MA 2CDBA 4EEYA 3AGPA 1T3NA 5LQRA 5KFJA 3B9PA 1OU0A 4IM7A 3TY8A 4AL4A 1TM3E 2A0UA 5H80A 2EP7A 4PS0A 3PO3G 3SE0A 1T5SA 1NUUA 1WH2A 3I9OA 4J0KA 1L2ZA 4XVQA 4CFZA 3CZ5A 2VJQA 1T8PA 1I4WA 4TSFD 4H4EA 3A06A 4G9GA 4PQFA 2N1MA 2CLDX 1OU4A 1J8FA 1VI2A 3QUQA 4LDZA 5I60A 1X3LA 4PHGA 1GPDG 1FRZA 1N2BA 4MLZA 5FEUA 2X5NA 4QNRA 3WFIA 4LRQA 2MSNA 4E31A 8LDHA 3GU3A 1IBCA 2D8AA 1Z5OA 3K0CC 3DPSA 4IIXA 1W581 1Q16A 5CVCA 2OZVA 1V9LA 2QTVA 4IDBA 1SOAA 4NIMA 2ZEJA 1C4WA 3K5PA 4F5EA 4KAJA 4HLQB 3D0RA 4FGUA 1J6UA 1SBNE 3U49A 2FPSA 3CVWA 4NPCA 2Y0PA 1AZTA 1F6WA 5CFNA 4I08A 5AT1A 4D8UA 5KOJB 1GGKA 2EQBA 4IG4A 3AJDA 4XJTA 3PS9A 2XHZA 3MR5A 3U40A 2HI0A 4Z4CA 1IYZA 1JB1A 3WO0A 3TAXA 4DWVA 5BNZA 1WEKA 2E4WA 3N07A 5JMPA 2XSZD 1EGVB 2P6NA 3THXA 2NO5A 2ILTA 4ED2A 2RH4A 5CH5A 3QUSA 1S3FA 3DEFA 4G9BA 1LJLA 4OPMA 4P3PA 4J76A 4M6WB 4WLOA 3ZXIA 1PU2A 3WRYC 5DTQA 3D7NA 3GVCA 1K75A 3QY0A 4LHWA 1W9MA 4AJJA 2VYCA 4J2HA 2HA4A 4GLOA 4MWTA 1MO3A 3ZTTA 4DM4A 3CX8A 2F1RA 3D1JA 1A5AB 3ZIUA 2CV0A 2IUYA 1FUEA 2P7IA 2GHRA 5J2UA 5IJ9B 1ZMXA 2J41A 4FFBB 3EH2A 2O3SA 1P72A 1PZXA 4QYTA 5JLJA 4UBOA 1W5FA 1ULZA 3RU3A 2L0XA 2QXUA 3F74A 3N2LA 2DFDA 3B2EA 4IGIA 1BVUA 1UJBA 1OBGA 1IONA 3ROPA 1CZOA 4KRFA 3H2HA 2PMZA 1XDSA 5A4JA 2VR1A 4P98A 4K81B 4G1BA 1FK8A 4I1OA 3PPWA 2XF2A 4P0PB 5ALUA 3QTBA 5CNJA 3QUAA 2J6UA 4P84A 2X0RA 4OBXA 3KSUA 1I14A 2YHAA 3BE4A 1OAKA 5EESA 5F21A 5TVKA 3OY2A 4RPKA 3HH8A 1YE5A 2QUHA 4XWGA 3NGMA 2WAXA 2COGA 2YV5A 2ACWA 2GD2A 6GPBA 1SKYE 2QBYA 1GTZA 2YDXA 1E2GA 1V3TA 4QTUB 1W94A 3L4KA 5HFAA 2BM9A 4YCLA 3UAGA 2IU4A 2KLBA 4CLHA 1C1HA 4KUGA 2BWJA 2D8MA 1I0LA 1IZYA 1PDOA 2P6OA 5L3RA 2EGGA 3BE6A 4FFMA 2OBYA 1AK9A 1TWAA 3L1VA 2QTZA 4NMWA 2X5OA 4ASUA 2FRXA 4O29A 3W1WA 5KNDA 1E2BA 4TQUS 2YZGA 2H9YA 2B6HA 3ZLBA 3D3WA 5DYGA 5CEFA 5IW8A 3TNJA 4Z86A 3OFSA 4LRXA 5C81A 2PVCA 1JH8A 1B00A 2J67A 5JSZB 1MC4A 3C6BA 1U2ZA 2R7AA 1FUUA 3ERCA 4TKUB 2GPYA 4RW0A 3LE8A 1I80A 1JG7A 1C4XA 4M87A 3DEYX 1W9HA 3TGWA 1TKAA 1XKQA 2NZXA 3UMVA 1JXAA 4X93A 3A3PA 3CUWA 4D79A 3DGEC 1ZD5A 3N8DA 3VSAA 2HSJA 1IY8A 4LXHA 2HJHA 3DZDA 3NW9A 5KX5F 3HJBA 1Z2NX 4NX2A 4MYSA 5CJPA 2YINC 3VU9A 1GDDA 1RYRA 1QE0A 1E3IA 4GSLA 1G7RA 4MJXA 2OO3A 1ZOOA 3L7JA 1Z5PA 4OK6A 1Y6RA 3MIZA 2OG1A 3I9KA 1F6DA 2F1OA 1Q0QA 2XWSA 5EXEA 4CEJA 1EUCB 5F76A 3ZY4A 1P18A 2SCUB 4EVQA 1KI7A 4WFQA 1L7RA 1R6XA 1E9BA 4UBMA 4W6QA 4NYJR 3GNSA 2AN4A 4JBWA 2C9OA 1AKTA 3N59A 1U7UA 1LUAA 1XVAA 3H0GG 1W35A 2ZRFA 4J1NA 3QMPA 1WL8A 4H7HA 2FPXA 2NP7A 5EVJA 2WILA 2B8NA 4OKSA 3JU3A 3WP0A 3NV9A 4N12A 3T5CA 1NGSA 3ELUA 1GU7A 2QN3A 3II6X 3R8CA 1AK1A 3BBPA 1JIIA 4I3HA 4EJSB 4UMFA 1ZA1A 4IIYA 5EIOA 2W98A 2UVQA 2XMQA 4Q3DA 2ZUDA 2HHFB 4CM1A 3DD1A 4MMZB 5KTNA 2P9QA 4OOFA 3MRVA 3VJMA 3U0VA 1QF7A 1B14A 2PHZA 3HOXG 5C4XG 1L5HB 3AU8A 2WUDA 3R9WA 4LNUA 4ZCQA 2IF2A 5AJUA 1UR5A 3K1ZA 4JHLA 4WSOA 2JFGA 2O3QA 3JAKB 3OQJA 1I8TA 4NULA 4HS9A 2W8BB 3T5BA 2ECKA 2FG5A 1DC5A 1DG9A 3L1IA 4LRYA 4UDXX 3VH4A 3HXPA 5DNCA 1E3MA 4W9MC 1PTJA 1O8BA 4BX2A 4Q1AA 2I4TA 4XM1A 2JFOA 5J59A 5LKAA 4LZNA 4BZWA 3GX1A 5L7YA 5ICGA 4NCAA 1INLA 4OXKA 1TZ2A 1TYAE 1VYHA 1EM8A 3BORA 4TTQA 1JMKC 3TCKA 4EQ6A 1LPPA 1SC9A 2AOUA 2QRJA 4MS1A 2FPPA 4MUFA 4Z4HA 4HEQA 3ORFA 4P6VF 3IQHX 1WBJB 2ZRJA 1EJBA 3CO0S 5E3IA 4AT1A 1PW7A 1COWD 2OPHA 1TQ8A 3FAZA 1W73A 1ST2A 4H18A 4O5AA 5BVGA 4IMRA 2A92A 4XJXA 4QREA 4WOJA 3D8TA 3CMCO 3R9RA 2ASDA 4X3PA 3HKDA 3UMGA 3L8DA 3AR6A 2ZBEA 2HMAA 4CE5A 3W7VA 4ECQA 1PWXA 2B4AA 1P0MA 1QIDA 4HG2A 3JZMA 1KYIA 1NQXA 2YVLA 6AT1A 2IHUA 1QYDA 3HL0A 3A05A 2JFXA 2NZJA 2EU8A 3IP8A 3J7AC 2IZ1A 1PV4A 2PMZE 2XOKA 1Y89A 3IIJA 1PR4A 1KIMA 3FNFA 5EOYA 3NBAA 5CBPA 1EUDB 5FV7A 2Q7XA 4P3XA 2BM0A 2LV8A 5I4CA 4FHEA 3BMQB 1CQXA 4BMZA 5A7GA 5LU9A 2Q3CA 4RLSA 1E3WA 3U0BA 2IXAA 2ZI3A 1R3UA 1F4LA 3DDUA 1XP8A 3WQHA 4QFMA 2FDRA 1C7ZA 3I4CA 1ZJJA 1J42A 4YAOA 1EDOA 4M2LA 3A3KA 3ANXA 5JAQA 4DSOA 3O4RA 1K86A 3TQHA 4P32A 2PUCA 4EW2A 2ZUWA 4G5GA 1QFSA 4FGZA 3ZZUA 5DM1A 4Q03A 1AVTA 1ETHA 1HEIA 3AEXA 3RIYA 1GJRA 2OUIA 2YY6A 4HZIA 6ABPA 1J5EH 2JNWA 1J90A 3FSEA 1V43A 1XJCA 3TJMA 4ARIA 1DKQA 4YPFA 4LX8A 1ISJA 2FF5A 4BNDA 1T3GA 5FOTA 1XZDA 1PG5A 3CG0A 4AJNA 3M2PA 3PEFA 4L28A 5J47A 1EXNA 2ETVA 4P3OA 1NMEA 1KTAA 2I3DA 1P0QA 1ZU4A 3PZRA 2OCKA 1RM0A 5IT5A 4BUJA 3ECSA 4B3GA 3WMEA 1WXQA 5AW1A 3U7FB 5KQGA 1B6RA 4LSZA 1YH3A 1E0DA 1NBAA 2QZZA 1UK9A 4TSKA 3TRKA 1O9HA 1PT5A 3WZLA 4L5YA 1XDUA 3ZY3A 4GBJA 3CLSD 1ORWA 5D3KA 4A3FG 1II0A 2GO7A 2QRZA 2VDVE 4I4CA 1CUZA 1DOAA 2XOXA 3EA0A 1QGED 3EPPA 5FNVA 1XR3A 2G17A 1S1CA 1QDEA 5CXXA 5EKDA 4L6IA 2P9TA 2W2TA 3KQHA 2EC5A 4JI8H 4IQ8A 1OT3A 4M9SA 3ZJ5A 2C1ZA 2P2YA 4XQ0A 5AQ1A 4PLGA 4FMDB 2WHPB 1RRMA 4GL4A 4A23A 2BFFA 3ABSB 1BYUA 1HR0B 5HP4A 2DWOA 1PEAA 4QVIA 3ETCA 3T99A 4ZAXA 5DNYB 4BN5A 2QJOA 3JQQA 1TZCA 4LE2A 4BBRG 4DADA 1RQPA 1WZUA 2I2DA 2MJLA 3Q3CA 2QQEA 4GX5A 1IFXA 1KBZA 5JASA 3I0ZA 2VQ6A 3JXEA 1EVJA 1R0LA 4AY5A 4PLZA 4YO8A 3QW2A 2VF5X 2REXB 2WF6A 1H93A 1XCMA 1BW9A 4EYSA 4LVNA 3TO5A 1C3VA 4M0CA 4RK4A 1YXMA 2WWFA 2Z83A 3O1JC 5TC4A 3AM1A 3F6CA 3OFKA 4B3JA 1DEKA 3OZGA 3UAOA 4Y30A 3M1LA 4PPFA 4AJOA 1AJEA 4M8NE 5KVCA 3QPBA 4R71A 1WM1A 3WQRA 4W5OA 4FFDA 1QHIA 4R41A 3NGDA 2BONA 5DFAA 1KZ6A 1M9NA 3P9CA 5HKOA 2CXRA 5AKZA 4H7FA 4WINA 4O59O 4YMUA 2B1IA 3HM9A 3PK0A 5DMHA 3VH1A 4AURA 4MUKA 1RWVA 3SP1A 5EYPB 1QLJA 4CLEA 3IAHA 2J85A 1E9DA 1V3UA 3BD6A 3ZQKA 3V2IA 1UPCA 4ZHQB 3BABA 4K88A 2PD6A 5IZCA 1X1SA 3SKYA 4ENVA 1G5QA 3AOGA 5CA1F 3VYRB 3U4IA 4Q82A 3TQ1A 2GTHA 1NFFA 1BQEA 5KWVA 1NDQA 3S4YA 5T67A 4EEQA 4U6NA 2ZYUX 3QEMB 4QX6A 4R9UC 2PIDA 5J4YA 2JA1A 2A6PA 2Y9PB 5JCOA 1WVIA 4JA0A 5I8WA 2PIAA 3L9XA 5EWEA 3H6HA 2OH2A 1NTRA 5KFBA 3KLNA 4PN3A 3IIEA 3LFUA 5BV0A 1B3RA 8OHMA 1N5JA 2JCVA 4IO0A 4RIHA 2QL7A 4FZ5A 1BJTA 1J0EA 1PJRA 4C4ZA 4YT4A 3RHFA 4WLVA 1P4HA 2GO1A 4Q39A 1G60A 4NTZA 5AVZA 1MCZA 4ZK2A 1GG2A 1BXRB 1HRKA 4TGLA 4JVLA 4BUZA 3FTEA 4QRDA 4LDRA 5KYWB 3QVUA 1ZC4A 4JENA 2MINA 3BMOA 3QY9A 5LQJA 4S12A 3R6TA 2CF6A 2X7HA 4QWWA 1I13A 4GOLD 5IDQA 1IHDA 1VSVA 3RAGA 1W5SA 3H1BA 4XH9B 3I34X 5FHRA 1VTKA 5EUCA 4N76A 1UXHA 1GAQA 1SUPA 2I6SA 221PA 3KQMA 4GAEA 3QWHA 4UZEA 2VZ0A 4Q9HA 3HRKA 3QU5A 2DABA 3RIMA 2XA1A 5C9ZA 2G70A 5CDUA 1KEWA 1U2PA 4PHHA 4MXDA 4TUYF 3DHEA 3PNSA 4U6PA 4A92A 1M0EA 1M10A 5L53A 4MS4B 5F9NA 2CHGA 3J81A 1QVZA 4HWOA 1RQGA 4PAMA 1J1ZA 4WK0B 4LHSA 2YFKA 1H1LB 3EVAA 1JKJA 2HLDA 4P4GA 3CISA 1OF1A 1EQ2A 2AD5A 3A27A 2Q6OA 3N7UA 1NVXQ 2BKEA 4FONA 1KK3A 2D0IA 3RQIA 2F4NA 5LOVA 2AMYA 3A9VA 1GRVA 1C3OA 3O9MA 4P2BA 8ATCA 4ABYA 1OTXA 1YJ8A 4J0QA 3FTNA 2I8CA 5BPFA 2IF0A 1P3DA 5IH7A 2VRCD 4CKXA 3D5EA 3QBDA 5JSKA 3SDSA 4DEXA 1NX6A 2OLEA 5L3VA 4TTPA 4H17A 1WUHS 4B4UA 2ON6A 2F9FA 2QUIA 1X7ZB 1KJZA 4PZ7A 4NENA 5K8UA 5BNWA 3BQ2A 1JA1A 1MNAA 1CCWA 1TLLA 3KSZO 1HDIA 2PWPA 4LHZA 1M1YA 3NTRA 2XUDA 2WJJA 2B21A 5BQOA 5IEBA 4HDQB 3I9JA 5HUHA 2WE8A 2H31A 3RJTA 4GSYA 3UGJA 4Z2AA 3HWWA 2RK6A 1RRPA 4MK4A 1XA0A 3P26A 1CJUC 3GK3A 2OVFA 1K1EA 1QG0A 2LCIA 1ELOA 2FNAA 2QD3A 5SZJA 4YMVA 3VKUA 3RT9A 4O8ZA 3P9YA 1E2EA 4UAGA 1ISFA 4I8IA 5HCUA 1GYPA 3D3KA 1Y1TA 3DMNA 1ZMRA 4I5DA 3D31A 1H6AA 1CUCA 2YWHA 2W9CB 3Q1KA 5I7HA 1OBDA 4LE1A 1T43A 2DY1A 4G1CA 3HADA 1BS1A 4X61A 4PYMA 2OLJA 3H9BA 4TV9B 1GYFA 4LV8B 1RPTA 5JANA 4X00A 1ODFA 4O81A 4FT4A 1AGYA 4RMGA 2QM8A 1KAGA 4IWXA 2QX4A 3JD3A 5F9LA 3GDFA 4CIVA 3Q3IA 2J6HA 5T57A 2X23A 4HFRA 4L0DA 1U3WA 5IKPA 3CW2A 2R1TB 1YMVA 4WJKB 5FPOA 1E1QD 1RHRA 1EP3B 2JFWA 1AF7A 1L7MA 2PZ8A 3X2EA 3ZCQA 3DJFA 1WDMA 3WXMA 2BEUA 3E03A 1N3YA 4TN5A 4HDNA 2VVTA 5TGDA 2QTHA 3ZVNA 2Q1SA 3NXKA 1RI2A 2CBGA 3FSRA 4ZRDA 3D4IA 3QG1A 1QTRA 3RRNA 4B48A 4A2CA 4A0HA 2A14A 2E2IA 2LNDA 2RJ3A 4DRXA 1RXYA 3I30X 1U8YA 1E4VA 4M0MA 3ZK8A 3CGGA 2CHFA 2I87A 1JEEA 2DUJA 2NSHA 1JJIA 1YZFA 2C3YA 2ZJ0A 1OTYA 3U26A 4EY3A 3DB1A 2HC9A 4MAMA 2RI1A 3PC3A 3F7NA 4HSGA 3PFCA 4N54A 2YUIA 3RSOA 1NMQA 4TZ0A 3KNZA 3VHLB 4B9EA 3ZCVA 3V7WA 3TKLA 1CQZA 5BMOA 1WZEA 4ZPJA 5K1ZA 3ZCTA 1TF2A 3H20A 1MRNA 3HEAA 2YWCA 2Q3JA 5JNTA 4JI0H 4U2KA 1I2KA 3D3QA 3K6SA 1E6CA 4MQEB 5F9FA 5IZ4A 1C9EA 4RFLA 1RADA 2CVQA 2VUTA 5DSTA 4YAGA 1V41E 5KFUA 4JA2A 4ATNA 1WSWA 4I2VA 2OAEA 5DXFA 2A94A 4PSAA 4KSCA 5KS2A 5KUTA 5B58T 1YZGA 2L82A 5B3LA 4X5OA 3PHIA 3DTVB 3L0YA 3H4VA 4PYIA 2PUAA 3FHJA 3GGGA 3VFDA 2WWXA 3GFGA 1EK2A 4PWYA 4UU1A 1R4NA 2MSEB 1KAMA 2UVRA 1U8CB 2JH3A 3W1VA 3DA8A 4Q1BA 3ZGNA 4CXMA 2WSIA 5FH9A 4C0AC 4QXQA 2F43A 3G85A 2G6TA 5TY0A 2DHRA 3PPVA 3UFXA 3MWLA 1XRPA 1ODIA 2CUNA 2G0TA 3NOOA 3JD4A 2GHQA 3VO1A 3RRBA 4OGFA 4YQZA 1CY2A 4N0DA 3GVHA 4YLEA 5KT6A 3WDMA 2VPZA 2D7JA 3MWJA 4A91A 5K2OA 4V1CA 1N6KA 1E32A 3D02A 1ZH8A 3IG0A 3KC2A 2EFEB 4EHJA 4JFAA 2W9XA 3UCEA 2ZR7A 1SRQA 3QX3A 3GBPA 5DM4A 4G0XA 3IUEA 1UDRA 5JMWA 1JX4A 4EY7A 5ESRA 4IDQA 4OP2A 1KDVA 3H4IA 5IRCD 4FP9A 2NPOA 1G5RA 1KSJA 2Z2JA 3A6KA 1GNPA 2XWBF 3K9QO 1P5RA 2CB0A 1E0JA 2ZPAA 1AKEA 4R7GA 1Y3IA 3UMRA 4M21A 4AY6A 3L7IA 3JALB 1H1TA 4NXMB 2Y8EA 5CFRA 1JQLB 2YMLA 3L7BA 2ZWVA 2DSTA 3H1GA 4FQ5A 2FE1A 2VUMA 4A0SA 1YJAA 5COAA 4JX9A 4CT0A 5A03A 4KZKA 2QQGA 1M1YE 1TD9A 4KIFA 1BKYA 5IAGA 1Q6YA 3GXBA 4Q7EA 2G3YA 5IBRA 3SFVA 4CETA 3OLWA 2QVZX 5I5EA 3U9SA 4IH1A 4J9QA 1AN9A 2Z8ZA 2FZ5A 1DBQA 3EPGA 4ED9A 3O4GA 1NLMA 4LQLA 3PU6A 3ZCXA 5IAEA 4XWOA 3UKJA 1Q0TA 1HE2A 4CCYB 4YAIA 4EM6A 3HKBB 4CMGA 5F5NA 3RYFA 4HTFB 3SYTA 2BZ0A 2NSLA 3TLCA 3D0KA 3L93A 4HNVA 1QFJA 5EJ9A 3D4BA 3L41A 4CG2A 4TS4A 3OD5A 2DECA 5IFKA 3PA8A 4M86A 1W4LA 4F46A 3DOOA 2IYXA 1T5IA 2Q5JA 4I5GA 4FIZA 1ORIA 5CA0B 3PTAA 4PLFA 3LS2A 2X42A 3L6DA 1KZ4A 4GOKA 4C5AA 3UMYA 3Q72A 5HIKA 3D4PA 5AKXA 1ORRA 2YWEA 3H5IA 1HDEA 1NW8A 3M1IA 3IBTA 2TMYA 4QUJA 1GM5A 2FMIA 4TYYA 4MYUA 1OYYA 2W93A 2NN3C 2FQ1A 1ECLA 3ZYCA 4FVTA 4CHIA 3HFSA 4B6OA 521PA 3DYIA 2ZE8A 4AG5A 4KPUA 3I73A 5C3UA 4RNOA 1QNLA 4QOJA 4HRAA 3RVRA 6LDHA 3ISJA 2Y0SA 3HR4A 2QSUA 1K7YA 3R7DA 4CR7A 2BMFA 4FYIA 1Z7GA 4XR4A 4HUQB 1H66A 4K28A 3OFNA 1JBEA 3VR2D 3BQMB 3EARA 1J99A 3FKQA 3TZLA 2PRKA 1E2HA 8GPBA 2BIFA 2Q3EA 1S3IA 5NULA 4CQLB 2CDRA 2KX7A 1EVZA 5JI2E 4MUEA 3V1LA 5LZ8A 4PLPA 3E7FA 3L8HA 4M7PA 4LGMA 3I0MA 4K9PA 4FPXA 4LDPA 2JA7A 4HPWA 2JARA 3BC1A 1U11A 5BWVA 4J75A 4FYPA 2WTUA 1KI1A 4WZBB 1NLZA 1A9OA 2W4IA 2IYLD 3IUBA 3LCUA 1GSOA 3ND8A 4LZJA 4OQMA 5BNTA 4XB1A 1XB2A 1DOZA 1OX4B 1THZA 1E2MA 2JD0A 3RSHA 3ZWYA 1W44A 4W5RA 5CGQB 2G4CA 1L1QA 1B76A 3JATA 4DV7H 3G89A 1T2AA 2DT8A 2FK1A 3CNEA 2VSNA 1CIJA 1ZW1A 4OB7A 5AW0A 1Z56C 4Q8EA 1S7GA 3DAPA 4G3XA 1X2BA 4JWTA 1R12A 3ND5A 1H9BA 5BR4A 5E6UB 3R3HA 5CNMA 2ZYGA 3DOCA 4XRRA 3L6BA 3BXEA 1EXMA 2BEVB 1SUDA 2YV3A 1LRLA 3CRNA 3MB8A 1EDZA 1VMIA 3GRZA 5F2NA 5JT1A 2W70A 3A1SA 1O4VA 1N2IA 3FSGD 1XTIA 2OBNA 3K4PA 4TL9A 2ZP1A 2D3TA 2VF8A 3D6MA 1MVLA 2FUG6 1SVOA 2VAPA 1KARA 1PJBA 1DRJA 1ICEA 4FMPA 2I2AA 4LV5B 5JS6A 5K0LA 5K09A 1NXXA 2I4RA 1GNRA 4QW9A 4WVLA 1JQBA 2LIVA 2V3VA 4Y1EA 2NZUG 2R7MA 4HQKA 3QWIA 4B74A 2ZAIA 4EW3A 1ZCFA 3PLNA 3BE8A 4EO7A 3FBGA 3L82B 2BSAA 2PLFA 1QO9A 2O2HA 1O8CA 4CU2A 3L0CA 5K8LA 3MGGA 4HDSB 2D1FA 2GZMA 5AKYA 2RKBA 2J3LA 2VEOA 4CI0B 1ICIA 1FJGH 1HF3A 1Q7TA 2QL5A 1WZIA 3ZIDA 3HU5A 4M0JA 4C3OB 3A6GA 1C1DB 1OQAA 1ZSYA 2OB2A 1ML4A 1CHNA 4LOKA 2C8VA 4Z7OB 1R0CA 4N5DA 5EMNA 5D8DA 1ZPDA 2VJOA 2VP4A 3FDXA 1C7IA 1XD2B 4UNIA 4D99A 5HQTA 5KJFA 3ASZA 1D2RA 1F2UB 2VPTA 3MWEA 2M6RA 1XHFA 5BQPA 2BMAA 4DR6H 4EGAA 2QY9A 3TJZA 1FJ2A 2W4QA 4MULA 1H8HD 3L43A 5KPJA 4G1VA 4QNMA 2LPMA 2TMDA 2OXRA 3HN2A 2VJYA 4GKAA 5KOHB 4NBVA 3DDZX 3MJTA 1I7LA 2CK3A 2LDXA 2XVAA 1LLFA 3NKVA 4YRGA 3KVRA 3WK9A 5JYCA 5DQGA 3FM9A 4DCVA 4MCAA 1ENZA 4XGIA 3QBVA 5KFCA 4G63A 3NUAA 3TW6A 2XR1A 2JZNA 5LQNA 3PNLA 5E4FA 4YRRA 2QD2A 4JBLA 1PJ8A 5AVKA 4RL4A 5AOBA 3IBSA 3S1AB 2HPVA 1TMYA 2WFAA 3PUXA 2ASEA 1CK4A 2BVNA 2YRFA 2PJDA 2OKGA 4D2IA 3PFKA 2E85A 2X1VA 1BE1A 2PZLA 2C77A 3ZHYA 4O4IB 3ENVA 4OD0A 4E2YA 2JEGA 3MRSA 3OPMA 4ARVA 4KW7A 3TW4A 5BP7A 1DTWA 1H0SA 1KAEA 2CKZB 3H5TA 2DHDA 4X41A 2GFQA 4MWGA 2EJVA 1ZUNA 1V47A 5JVDA 2G40A 2XCOA 1I7DA 3EBOA 4DARA 5A2GA 2HJSA 1EKXA 1E2FA 2J3QA 2QG4A 1KNQA 3I8OA 4R8VA 4OAPA 2NTVA 2Q4TA 3RAJA 2FG7C 1N34H 1TU3A 4WAUA 4A8HA 4NF2A 4ERXA 3MUOA 3GCWA 5CLIA 1A4XA 3QIAA 2DEUA 4AKHA 5MFPA 3IQDB 9MHTA 2IYNA 4KIUA 4KE6A 4WHMA 4DUYH 5AOVA 2C3OA 4BE4A 4A27A 2Y0CA 3REOA 3GJXB 5IVPA 4PQEA 4EF6A 3EZ2A 2RAFA 2WJ6A 1C4KA 2XQJA 3AUAA 5GZ6A 1UBRS 3E4DA 4ZA2A 3BHMA 1SMKA 2MYNA 3OM1A 3KR9A 2OQ2A 4ER6A 1F60A 9ABPA 1P7CA 1SUEA 4U2CA 3TE7A 3SF8A 4LYGA 3FUUA 2B78A 2I0FA 3AP2A 2WQ7A 3OZWA 3GFPA 4FN4A 4O2LA 1Y4AE 3PFHA 4ILEA 4CF7A 5FBRB 3I39X 3KKLA 5E2IA 4COOA 4NQZA 3FR7A 2HV9A 2BMDA 3J80W 3F8NA 2VK1A 3A28A 5HTOA 1P4GA 3UHPA 5A0TA 4MWEA 4B3BA 1L3IA 5D3MA 5EIWA 3TQIA 4AI6A 2J09A 2HNAA 4CV2A 5G1NA 4FM9A 1XI2A 1HTTA 3J80A 2EW2A 4URUR 1OFGA 2BUAA 1PIWA 2HT1A 1I7NA 3HVJA 1ZICA 4RD0A 2FSFA 3LX4A 4LJ7A 4NY1A 3K73O 3FBTA 2W0SA 3KZMA 3GRRA 4PGHA 4J9MA 2A8YA 1RC8A 4R1OA 1I30A 2EJWA 4N47A 5FYDA 2IP1A 2UXDH 1J7JA 2FSUA 1G1MA 1ZK1A 4GZMA 2QHXA 1V1MA 2RHRA 4RWZA 4CTKA 1BS2A 3PENA 2FG6C 3EVBA 1E96A 3RRMA 4G56A 3G2MA 1L8QA 4OX9Y 1C50A 4BV3A 2XCRB 5B3AA 3ZE8A 2BTQB 4RACA 2G9VA 5ALLA 3V1KA 1YMUA 2DLDA 5L40A 1FFCA 2R8PA 1EVEA 4G0UA 2PH7A 5HNKA 4P80A 1WZCA 3CQ9A 1PCXA 2OYCA 3QWBA 3VZCA 2V9CA 5CM9C 5DI3A 2R7NA 1RI3A 3DV0A 1ZIYA 2SECE 4U02A 4ZWNA 3OTGA 4B40A 1YVRA 4CM7A 4NBSA 1FUIA 3B1XA 3JY6A 1T0IA 4W5TA 4PPYA 2ZRAA 1CRQA 2O2DA 2QNBA 3R20A 2WWTA 1IAVA 3GP8A 3R2JA 3C3CA 2YXEA 3DXFA 1AGRA 2OO5A 4A9AA 5DJ5A 2WY2D 1QGOA 2ODEA 3E8XA 1CP2A 3RYCB 2PSDA 4EB6B 5KHAA 1LW7A 2B7BA 4MW6A 3EXFB 4N6OA 4EECA 3UCFA 1E2PA 3I5YA 4XUCA 2BN4A 1E8DA 4XWAA 5I7FA 1QRUA 4F84A 5EJMA 3C8DA 2JEFA 4GZLA 1NPTO 1REQB 4OXNA 5H4GA 821PA 3W1GA 1YQWA 5KAPA 1DIAA 2C2WA 3EE6A 4CVNA 3RASA 1T9DA 2VK8A 5DEIA 3PI7A 2P0AA 3LDGA 4UCQA 4KR0A 4X63A 3UO8B 2YZNA 4B3RH 1TA9A 2VNSA 1N2JA 3E8SA 1L3BA 3M5CA 4TS1A 1MAHA 2OA0A 1M7JA 2FK7A 2VUMG 4HC4A 4MW0A 4OLBA 4UVGA 4EZEA 4IJ5A 3GFQA 2R8GA 4LZAA 2H3EA 1BCSA 1TTHA 4KYTA 3IMKA 3BJRA 1NVTA 4KODA 3V55A 4BMOB 3P27A 2X4GA 4BNJA 3WA7A 3H16A 2EL9A 1M66A 1WABA 2HFKA 2A9JA 2AYYA 4YCMA 3EAQA 4MLDA 5DISB 4PN7A 2OXEA 5L1JA 3LUCA 1Z25A 5KT3A 2VPYA 5E7IA 1LVGA 4U2EA 4F12A 3DC2A 3K1JA 4C2BA 5BN5B 4X62H 3QVXA 3ZQJA 1QC5B 2XV1A 4BC1A 3G2QA 2JC3A 3PGMA 1QQ7A 2HN9A 3A4IA 4MVJP 1M1NA 4Q8FA 3BPSA 2DPXA 1NR7A 4N7BA 3RHSA 3Q8XB 1VECA 1UJ2A 3HYCA 4D8VA 4TTIA 2BHTA 4MQMA 1C2YA 3WIBA 2FWBA 4JI8B 4YR3A 4FW9A 5EHGA 3STYA 1QBGA 5MN6A 2W2LD 5BSRA 3WLIA 5FAKA 5KX5B 3SC2B 1V51A 5KJCA 4YRBA 2X6QA 4OGWA 4DBVO 2XKBA 1MZBA 4BKQA 4J9OA 3PNQA 4HP8A 4KX5A 2JFBA 3BWVA 4EMBA 2Y68A 3TW8B 3RIHA 5HBRB 4YRQA 3RQSA 4DF3A 4D4HA 1PJ3A 1Z6ZA 5TPWB 2XCQA 3WYBA 3TOSA 2RARA 3WAJA 3WHLA 4RK7A 1R9JA 3AL0C 4RA9A 3KJXA 1XE3A 3FRHA 1CUXA 2X9NA 3OF2A 3V00A 5HGXA 3PZBA 1ZD4A 4F72A 1S2IA 1AH2A 5EP3A 2ZAYA 3RH0A 1HSZA 2X5JO 1N6LA 4FWTA 5A4DA 4L3WA 4LX0A 1K6JA 3SBOA 2CLCX 2ZOSA 4CM6A 1SXJD 2YYSA 4X60A 1UFVA 2O06A 3GYGA 3LSYA 4I5EA 3HVIA 2ZZKA 2ZVPX 1PT9A 4NJEB 2JFNA 3E70C 5EIXA 3K70D 4RNNA 1PS8A 3VDXA 2PUDA 1KMNA 2JS7A 3LOQA 4OIFA 2UUBH 5BPHA 2FFJA 2G9UA 2XUFA 1ZRSA 2JA7G 3R76A 1JHOA 3AKCA 3THSA 3KWLA 2QRKA 2Q8NA 5FI3A 3GEHA 4FDUA 1DFHA 1YCGA 1P7WA 3EUAA 2WFMA 1JI0A 1JLSA 3O8RA 1Y1VA 4KDEA 1GNSA 3ZU2A 1F1JA 4DLKA 4EK9A 4R68A 3V2HA 5E7MA 4DWWA 2QB5A 4ZJUA 4A73A 4ARSA 1UMCB 5LNK6 3ZW9A 5JQGA 2WT8A 3TX6A 4I2NA 4WKGA 3P4UA 5KSPA 3QSYA 4BAUA 3FRIA 4DNFA 1YJ5A 3QJGA 4HNRA 5LZ2A 3DV9A 2C5LA 3TVYA 1S8OA 4RTSA 4PRYA 1OH8A 4RZRA 5IVDA 4DCJA 2YW2A 2CGEA 1P1FA 1TUBA 3DHNA 4L08A 3LT4A 5EXDA 4U7FA 2AKEA 2QD4A 3M6IA 3G7UA 1ENOA 2QZPA 4MV9A 2A78A 1ZAKA 1C30B 2G5TA 1C41A 4OH7A 1NT4A 3KUDA 4QWAA 2JGJA 4ECVA 4E5PA 3PQ8A 2LVBA 1SR8A 5AJVB 1Q77A 1Q7BA 1ZIOA 2GSDA 3T15A 4HPJB 1Z12A 1VQ1A 2Q5OA 3D8BA 3UAZA 3AY7A 4TYMA 1TC1A 4MW5A 4KITB 3RWOA 3L0BA 4XQGA 4FQ8A 3NIFB 4JHXA 5ITSA 1NZDA 2E82A 1QGUB 2IDZA 2C35B 5DV9A 2ZG6A 1LPOA 1I3NA 1ZHSA 3LFTA 4YWJA 5AKJA 2HG8A 3KEFA 1Y37A 1N36H 4WZBE 4HZUB 1J49A 4OMFG 5GIPE 4K87A 3WFJA 5DASA 1LBSA 3T0FA 3E7PA 2FN7A 3GQVA 1J22A 1GKKA 4MA0A 3UQZA 1KOGA 3GELA 3WKDA 4MR8A 2Y4OA 1QKJA 4NYJQ 2BI7A 4BBAA 1DSSG 3BH7A 1E2UA 4F93B 2ZRQA 3AEUB 5JD6A 1R15A 5B1IA 3EGVA 4HXYA 1D8TA 4J7UA 2UXCB 2AMFA 3EDCA 1M73E 2CMFA 5I5UA 5F3RA 2B4RO 2DH6A 1WULS 3G68A 4LVCA 1G0NA 1L7DA 1NUPA 3ESQA 3SNKA 3I12A 4B32A 5C35A 2QWXA 2WUGA 4H7KA 5KFAA 5L3SA 2R8EA 3LUDA 3ER8A 2RAPA 3QWUA 2QF7A 1PNVA 1THTA 3D6JA 3K96A 3K05A 5AW8A 4DV4H 2VLIA 4OJYA 3OKCA 5D00A 4BTLA 4ZYLA 2VPXA 4D44A 3GJ0A 5T4FA 5TGTA 2OEPA 4G1UC 4KIWA 2GRUA 4MUYA 4G5SA 2EHDA 3LYAA 2DQYA 1U9YA 2BQUA 2ZGIA 4BBSG 3F71A 4LZWA 4J6FA 3V3TA 3HYTA 1JR3D 3DVLA 4ESVA 1VPDA 3TW7A 5CB4A 3G9UA 4HXFB 3DVQX 1LFDB 2QQFA 4GPZA 1TF7A 1ES9A 3KOUA 1JEOA 2R00A 1I2BA 3QHPA 3CX7A 3Q9LA 3B8HA 4I66A 3FTQA 6NULA 1RRFA 5TVGA 3EZNA 4MA5A 4OYHA 2YR0A 3PW5A 3EXAA 2IH2A 2WWHA 1U98A 5F1PA 5KOJA 3RB6A 2GKGA 3S1LA 4QUBA 3U31A 2GB4A 4RTJA 3HJAA 3OM8A 2ST1A 4ZEWA 3A6DA 5ALJA 4JLWA 5A7HA 4F21A 3ED1A 2AQ4A 4QTXA 4H27A 4KQ9A 4AUKA 3KAKA 4CDNA 2AG5A 3E8MA 1H4SA 1FMCA 3FLBA 4BLRA 1RPZA 4IDCA 1W36B 1BROA 3U17A 4LXTA 2GKSA 2J7KA 3CH5A 2IY8A 4M6WA 2ZRDA 3RFFA 3P9IA 1BRTA 4C0QC 2DHEA 3CURA 4LCEA 1T10A 4GOXA 5KWSA 3A31A 3KVNA 2WZQA 2VTDA 4XDYA 1R37A 1XTQA 1L5LA 2R62A 2WFZA 2Y77A 4O5OA 2YZ7A 4GIBA 3U80A 1KZGB 1IJFA 1GQYA 5F2EA 3L0ZA 4KXQA 4JQYA 1KWGA 2WKWA 2LP4Y 3TGLA 3D8NA 5AXCA 1NRJB 2HH9A 1YIDA 4L4ZA 2QT0A 3TM5A 4CNBA 3AONB 1YFZA 4MWOA 4AO7A 3QLVA 4INOA 3K92A 2GEFA 2ODPA 3TSYA 3EXG2 2P4UA 4HT3B 3SIPA 4LI0A 4EEKA 2CNKA 2V7EA 1A0IA 3DF9A 1E3JA 2C22A 3UM9A 3T5JA 3GQCA 4OLAA 2EWMA 1RAAA 3G5LA 4Z49A 3BKWA 4BCBA 2K6GA 3THYB 5J1SB 1XD9A 1RQXA 4S1TA 2R6HA 4L9SA 2PGOA 5CAEA 1T1IA 2O0MA 3OPVA 2JEZA 1TEVA 4EP1A 1PKEA 4N3AA 4JXZA 1VL1A 3G8CA 4O4LF 3CB4A 2VFAA 4RQUA 5KG6A 3D4OA 4OU4A 3VYVA 5FD5A 2FEMA 1P73A 4ZMRA 1U8ZA 3KUUA 4WD3A 3OOSA 1QK5A 1Z7BA 5EZQA 4YDHB 2B92A 2IPAB 1CU1A 3PDJA 1IM5A 3AFMA 5KYVA 3TEJA 3KLBA 4FLFA 2W2QA 3GFOA 3VDQA 2FE4A 5CA1B 3H84A 4DS3A 3M5WA 2P8SA 1EK0A 4GYWA 5B7GA 4X6XA 1UKBA 4OXIA 2QJTA 2CCGA 1NJ6A 1PDWA 4XGNA 1PBNA 5B2ZA 3X1XA 3GT7A 5LFAA 1C3XA 2A5LA 4ZREA 5TT1A 4DCSA 1T4CB 3GN2A 2HXGA 1Z6GA 3RS9A 5GJCA 2I76A 4D3SA 4LXQA 3CYFA 1FX0B 2IX3A 4R9VA 4MROA 4LHVA 2Q7DA 3O8OA 1JN0A 4JYZA 5KOIA 2Y76A 3CKMA 3P4YA 1P9RA 2HRDA 5JSZA 1Z5VA 5IVKA 1NF8A 1PYOA 5ECWA 3L7YA 1JT9A 2E37A 4EKDA 4WCFB 4ENTA 3AHCA 3M4YA 4RCZA 3U3ZA 2AC2A 3OC0A 3LY5A 1RQ2A 4ZVVA 1QRSA 5CIYA 2BGUA 3OHPA 2ZPUA 4CUZA 1LGYA 1S0NA 1TXGA 4DC0A 5HE9A 1A3CA 3WR5A 4D6PA 3GUYA 3LBYA 3C2QA 5C8ZA 2HR1A 4DRFA 2YY7A 3EPLA 4OG2A 1XEAA 1HLPA 4C6TB 1IG3A 3DB2A 4ZVTA 1F1BA 4B4DA 1NQVA 2FX3A 4W5QA 4TUYB 1BYIA 2HQRA 1XC7A 1SVUA 2X0JA 3CZMA 3ZWPA 2ZRPA 3BMNB 1OYWA 1XFDA 1HFEL 5EKXA 5CYFA 1YZLA 3AY0A 5EXTA 1OVMA 3USCS 4R9NA 1EUZA 5KFOA 1RI1A 1T9ZA 1I2MA 1TB4A 5LQDA 5ERXA 2O9JA 4XJVA 5AKHA 5B4TA 4AKEA 4R0NA 1XN4A 2ZSFA 1E63A 1K08A 5KQLA 4L4YA 4BMDA 1FP2A 1RXIA 1E0SA 3D6NB 1SD1A 4DKJA 1FFAA 4L4UA 4Y98A 2RHHA 3QSGA 3UUFA 2CHVA 5DTIA 4F4CA 4NHOA 2Z09A 4EHLA 2WPNA 3V6JA 2HHFA 1PFKA 4PWQA 5C34B 4IG9A 2ZE5A 3ZWCA 4KQ6A 2C8KA 3J81W 3KTAB 5JSUA 3EZLA 1GPMA 1LLUA 4Y1FA 2GBFA 1T2NA 1N0UA 2A5GA 2Z5GA 3LLCA 2X1MA 1PYGA 2Q2WA 1CR6A 3JAKA 1JE1A 3ZI7A 4N49A 2W8BA 2Q6LA 1F2TB 4KLCA 5AQEA 1G7TA 5LJIA 2WJAA 2X58A 1YS2X 2X15A 4MW1A 3DMPA 5CLFA 2ZBVA 1BNCA 1N5MA 2W6ID 1QX4A 1U4SA 4XD7D 2JBAB 5AH0A 2LDBA 4DVJA 1AF4A 4IV5A 1WXXA 3HDTA 3PUYA 3H65A 4LXXA 1DAMA 2AJLI 4O7YA 4GQAA 4PTZA 2AMVA 3IVGA 3KL4A 4FDAA 1I7SB 4BLWA 5FULA 4BPRA 1N6HA 5GONA 1SC4A 2BMWA 4PIMA 5AYVA 4C0BA 4UM9D 4DOMA 2V4QA 2PGIA 2VATA 3KD2A 2HAEA 3S2UA 2AFIB 1VHJA 4NMMA 2IBMA 3BRWD 4Q4AB 1ZIXA 4FXPA 5BUSA 2VYQA 1P4RA 3TY9A 5LL6P 3HLTA 3HY6A 1WRBA 1RQ7A 1ZGBA 1KI6B 1AD2A 2IS6A 4HEHA 2IPLA 1MJGA 4A3GG 4YB8A 3KPYA 3QVLA 3CZ9A 5DK4A 3WKCA 1D2CA 4PGGA 3JQGA 3PUZA 4CJXA 1I2CA 4B75A 1LI5A 3ZE0B 2V54A 1LDNA 5K3BA 5CD1A 2Q9UA 3OT1A 3UPDA 3VR6D 3EZYA 1R3DA 4QGFA 3BMQA 3R74A 1CR2A 3FFTA 2EKPA 2QPTA 1SH7A 3HFGA 3ONEA 3FPGA 2HY7A 1IZZA 4E6EA 1CERA 5KG0A 1IJKA 3PA6A 4B47A 4DEVA 3UT6A 2Y1WA 4C6RA 3C7DB 1E2JA 1RT9A 3S6JA 5FCDA 5C53B 1MU0A 5IJ0A 4ZOQI 2AE1A 3EC2A 4UHBA 1G8SA 1QG2A 3ZHUA 2B8TA 5GM2A 3ZVLA 1DL5A 5JMTA 4C01A 4BJ1A 4OI1A 3HWRA 5IEJA 1U28A 2QRUA 4XXHA 2C2GA 2OKCA 2OXIA 3C87A 2XUKA 2XBUA 5AUNB 4OJKA 5HQ3B 3H75A 1Y1VG 4O7LA 5KYYB 2Q4DA 3GJ3A 4QASA 2VNJA 3DXXA 3OEEA 4DA8A 5JAPA 3W5AA 2Y27A 2UZ0A 5F5XA 1DX4A 1O54A 4OVKA 3A6EA 1MX5A 1FFEA 3QE3A 4UQOA 5JD3A 4X66B 1E7SA 2C2XA 1OREA 3U37A 1R6UA 1O6BA 4QULA 4OQZA 4PQYA 2GXSA 4YCNA 4DV7B 1DIBA 5ILQA 1F3OA 4MJLA 3BMXA 3IERA 1USIA 2E55A 1CUUA 2PBRA 2VCYA 2CJYA 3H8SA 4XFDA 2IVFA 4J2TA 4NZPA 4PSVA 5AXAA 1ADJA 1ACJA 4CL2A 1UADA 4U1RA 5ALIA 2XB9A 3KHRA 2GBIA 5TNXA 1JAHA 3IKVA 2PX3A 4JB2A 1FNBA 2N3ZA 3AYHB 4MV7A 5GM1A 2W2PA 4FI3C 5DTJA 4E3ZA 2Z9CA 1N6PA 5FV4A 4BVHA 1U7ZA 5TQJA 1Y4UA 1ULSA 3TZQA 1PTJC 1XAJA 4OUKX 5F1KA 2QP9X 4FILA 6PFKA 2GD1O 4EA6A 4M7RA 1ZIDA 4L9RA 3VPFA 3A6LA 2C7QA 3GYBA 1RKVA 4KDCA 4DL9A 5K5EA 1I33A 5K6RA 3OCJA 2R79A 4J0EA 3BB3A 3UKDA 4P3YA 1T25A 4GC7A 4Q45A 2VL7A 4TWAA 1NR5A 2H9AA 3U5ZB 4Q1EA 3DL2A 5JS1A 1ZZGA 3UEOA 1R6BX 4ZI7F 4URYR 3R8XA 1PT6A 2DLCX 5F7OA 5L4NA 1WF3A 4YMIA 3O8DA 1FJGB 1ZH6A 2HD4A 4DV2H 4FMCF 4CR6A 3CLTD 4UFPA 4Q3EA 1SHTX 2CJFA 3OA0A 5CBKA 1GU0A 3O8QB 3M49A 2HQ1A 2IYWA 3HE3A 3C3WA 2UUCH 3NBZB 1U5CA 4KQFA 1V8DA 1AKWA 3DKRA 4K6NA 4LMBA 1E4YA 1G4AE 3BQ9A 3FF1A 4I50F 4MSUA 4UKDA 3IUJA 3F47A 3ENKA 2W4MA 4P7KA 3CXRA 1VKHA 4QJBA 3IRVA 3F7OA 4DR6B 1RABA 5HFJA 3UWKA 3TSAA 1Y8ZA 2I1QA 3UJ8A 1B04A 1SIOA 5EJ7A 4ZHQA 1UOQA 2C99A 3EWAA 4YAJA 2G0AA 5L7TA 2R1VA 4WLNA 2G1AA 2NVYA 1NJ8A 1P33A 5AVOA 3FMOB 5JJKA 1JEAA 2C07A 2RK4A 3VNVA 1YGYA 1H2FA 3QEMA 1LVHA 1A8UA 1E20A 4M3NA 5LD2B 3ZDAA 2IPNA 3V32A 2R8YA 2WJ4A 2F00A 1NJGA 3RF6A 4DDVA 1FW8A 3S2FA 1HG0A 3OZCA 2PR7A 4GRDA 5A9RA 1ZJWA 3UA3A 3JS5A 5JBQA 4WXYB 3RSGA 4DDTA 1UODA 1KDOA 2WPDA 3SJZA 1CY7A 5EQDA 3EDOA 3ZHXA 3MTDA 3NWPA 4BO9A 1FRNA 2ID9A 1NLFA 2JIZA 4B3SH 2GZ2A 3ZKWB 4BEJA 1D9XA 4YXWD 1A2KC 1BXRA 4PYJA 4XX0B 2HF8A 1NVMB 2FGKA 3G6WA 3WLRA 1A2QA 2C31A 5EZYA 4H0CA 4KVZA 4F5DA 3QW4B 5IDVA 1YAJA 1Z33A 2N47A 2FSVA 2ZQZA 4B33A 2PO5A 3ROGA 2ZDQA 4DR5H 4D4JA 2PRYA 4GT1A 1VJ5A 4HLNA 1DV2A 4ZZIA 4MR7B 1UXGA 1QV7A 4DSUA 1ZONA 4BIIA 2FEWB 4M0UA 2FWNA 4P5PA 3T1HH 3GEGA 4YRPA 5DCLA 5FOWA 1OAAA 4AUEA 3PQ4A 1W49A 5KQPA 1MFZA 4YMTA 5GIOE 5C8VA 3THWB 3SSNA 5FTJA 3FKIA 4ZMBA 1RCFA 1IMJA 3FSJX 4ZVPA 4DUYB 1UPTA 4MS4A 1QOQB 2DR0A 1T0PA 1T1RA 1N6OA 1JXLA 2EBHX 4G41A 3JCZA 5A6VA 4PZYA 1H1LA 1VS0A 3FGZA 4FOOA 1UMDB 3KT8A 1LRJA 4BFUA 3LCJA 5D51S 1MC1A 4BX8A 3CSUA 1S10A 1NNI1 1DX9A 5CEJA 2P90A 1LNQA 3SXUB 4ARZB 1YE8A 4HVAA 4WDRA 3QVGB 1H0KA 1BEZA 3NUQA 2GCPA 4EO4A 5JFGA 3M7IA 5JS7A 5BMVA 4UD2A 3O38A 3OURA 2G7ZA 1A9ZA 5LBTA 2XCSB 2VWPA 4WLUA 1R6TA 3BGIA 2HWWA 4BNWA 3H5LA 4D3DA 1QRAA 5KU1A 1QFXA 1DO2A 4X90A 4URHA 4WBNA 2BTOA 2YHIB 4BO3A 3QKRB 1FCJA 1K4MA 2VBGA 3ZWQA 2G1UA 2PKRA 4I1SA 2BR3A 1OA0A 3W5SA 3TTVA 1FX1A 1X0VA 2CLKB 2P9JA 2QXTA 1HYHA 2GJ9A 4G84A 3H83A 4ENPA 4HB3A 1TMGE 4IDNA 4MVXA 5T8KA 5F7ZA 4Q4HA 1F6BA 3WYCA 1PR2A 1SY7A 1W4RA 3GRUA 4YS6A 2UXDB 3RRZA 1GGEA 3SQXA 3N7TA 4IDGA 3K72B 3NC0C 3SHFA 3MHTA 2IHZA 3D3EA 2JAPA 4FLEA 4QTZA 2E21A 5DM70 5BRNA 2WOJA 4Q9IA 4JVMA 4XOUA 1N3IA 5EWLB 1UJ5A 2Z2XA 3K8ZA 5CK5A 1K2WA 4IMPA 3OQVA 2RD2A 4FBGA 2ZJTA 1CDDA 2HBZA 1RKUA 2HKIA 4W1RA 4LKOA 3EC7A 5IZCC 1Y8CA 1NZJA 2DBQA 3EMBA 2AVDA 1RHQA 3CWQA 1XCLA 3G88A 3JQ8A 4PX9A 2AGQA 3UK2A 4KXYA 4F9FA 1JHPA 1T2CA 3NHRA 3X0DA 4GSKA 1PVVA 3PQFA 4TV9A 2ES4A 5JCOC 1ZGAA 2QG6A 2VP9A 2UZIR 4JI3H 1IXSB 1RAEA 4U6QA 4G8BA 3O93A 3REFA 2PKEA 2PD3A 2OB1A 4FIDA 5DO9A 2REOA 2WT4A 3LVBA 3GFRA 3I6BA 3FW1A 2PY6A 4KFSA 3EWNA 4BRSA 3ZEAA 2LKDA 4C22A 4UE2A 4UBLA 1V9PA 2CNWD 5FUVA 1OXVA 3T7SA 3KQWA 2V7WA 1YIOA 1V5IA 3OAAD 4TLEA 1GL9B 3ISVA 2YQ5A 2C3MA 2QJRA 4MRVA 4NPHA 4JD5A 4DQUA 4DXAA 1FC0A 1GITA 3TLEA 4M0DA 1EQUA 3DMFA 1ANKA 4RGBA 2H4YA 3H3XA 3WBBA 4WPGA 3PFFA 4B3RB 1N1GA 5HIAA 1IG0A 2JZCA 4AZSA 1MBZA 4MINA 4Z2YA 2ZTLA 2QLNA 2GM3A 3ZD6A 5HKAA 5F52A 2YU9A 4PPNA 4N8DA 1ECPA 1YL7A 4IKPA 4OMCA 1R4ZA 1U7DA 3I2GA 1UWCA 5HF5A 3BGVA 2ZANA 1DBPA 3QM1A 3ZWAA 1SO8A 2BKXA 1O1YA 2NTEA 1H1DA 2J4FA 3GJSA 1VL0A 1SVNA 4BTEA 1A9SA 3OPXA 1XT6A 2DCUA 5AM2A 2CY0A 3K0FB 2MOKA 3HZZA 2Q27A 4EPTA 2C61A 1BQ4A 1EP1B 1WZ2A 3TN7A 3QFSA 1QMGA 2DMRA 2IU0A 1VG8A 4E7OA 4MQEA 2ZSEA 2P9GA 3AVTA 2EZ9A 5K8TA 4R5MA 4ZOEA 4IQ4A 3HY3A 3K0BA 5BOSB 3VPCA 1ZU5A 3WRWA 2SNIE 2H2FA 2HHHH 2F67A 2XDAA 2GM5A 2DWQA 4ZJPA 2DUUA 4X62B 2QTWB 1NF3A 4P7JA 5ALQA 3W3AD 2HU8A 3JZDA 5D2CA 3PWSA 4UTOA 4BLOA 2ABJA 1NW4A 2DM6A 5FHQA 1SCBA 3FYUB 1XKLA 1FFWA 5ARCA 3H3JA 5ESXA 3KHUA 2DPYA 2VHWA 3N7AA 1U5AA 3ADBA 1GG8A 1X77A 2P77A 2VLBA 1BJRE 1MVOA 2HCTA 3EQ9A 2W37A 3ZD7A 2C4UA 5JNUA 2DF8A 1I0ZA 2IYAA 1AKUA 3PSHA 3OPYA 4GXRA 3LZDA 1TI7A 3Q87B 4FGRA 1H0HA 1GL3A 2AWOA 2ZITA 4BU1A 1K68A 4UHDA 1HLDA 1T9AA 3VU0A 3GLQA 1PO7A 1MABB 4HNAA 4IJUA 1S03G 4O4HF 3BAZA 4TVKA 1QWOA 2W0MA 4Z53A 3KQVA 2Q6TA 4LFBH 4O3SA 2FZKA 1ABFA 2WK1A 3ZY5A 1I7PA 3IQGX 4ED1A 5DW3A 3IEVA 2POQX 5AKIA 2V3CC 2ALZA 1RMYA 4I9FA 2VH2A 1CUFA 5GGXA 3RS4A 3F2IA 4QLOA 1G16A 4JC5A 1G42A 2O2CA 2RHJA 4JS0A 1URPA 3WYFA 1BHO1 2JIQA 2O0JA 7ABPA 5EJEA 1E9RA 3M4NA 2YNMD 3N05A 4BGIA 1KSHA 1GFZA 1XALA 4JOSA 2H65A 4YP6A 5ETJA 2Q6IA 2UUBB 3FHCB 5F9HA 2P2LA 2AFIE 3NHJA 1G5FA 2JANA 3V80A 3C3AA 4Q7JB 2GNPA 2YDYA 4LBYA 4ISCA 1P61B 1A8QA 1KRXA 4LNHA 3UB2A 4O3MA 3UBTA 5FBWB 2ZTVA 3HDQA 3ICVA 3F3SA 3LY8A 3G2IA 4YN3A 1YQGA 5DIZA 4PX5A 4S35A 5FWYA 5C5IA 3TLBA 3PRYA 3UJDA 4J16A 1XDNA 1IU9A 4BO5A 3KSBC 5JNVA 2R6FA 3H1TA 1SU7A 3R3JA 4E1BA 4GYKA 1Z34A 4RBNA 3DSRA 3HKBA 1J0CA 3WLLA 2JIDA 4UPVA 4HTFA 1N2CB 3SYLA 2RBKA 5BWWA 4ZYWA 2Z8YA 4XTRA 4OB8A 4KR2A 3ZJUA 4A93G 4FDLA 1QFYA 3URKA 5BSEA 2ALJA 3WS7A 4BV9A 2V59A 1DARA 4GBGA 3T9DA 1RNLA 1TO1E 2WKSA 4M1WA 5D1OB 4W8GA 4RY8A 4J90A 3UICA 4HCJA 1L7QA 3VOSA 1RD4A 2GAIA 3IUNA 4X7PA 3FPJA 2ZBRA 5L51A 5CA0A 2Q4BA 2C2KA 1VJCA 1KQFA 4I55F 1LK0A 1V8PA 1VZ3A 3ZZMA 1M33A 3OZVA 2VYNA 4GEKA 1XAIA 4DLWA 3ZJYA 3AEKA 3SSAA 4X3OA 1J1UA 1N5OX 2JF0A 3Q5GA 4EITA 5C1DA 2O5CA 1FMFA 5E7JA 4R3UC 3SOPA 3BHNA 3NIBA 3HYLA 3RVMA 1M2FA 3I6ZA 2FK2A 5KYNA 4BO4A 2I2XB 2QG9A 1AUPA 3TQTA 4LI3X 5JCJA 4ZU1X 5B7NA 2HK7A 1E6KA 1M8PA 3IA2A 2XTZA 2WJWA 1L0BA 2JIMA 1JYFA 4LNAA 4S0XA 4UTRA 2WYWA 4BRWA 3JRWA 1CR4A 1C14A 3NM4A 4XTCS 4E5DA 2ZWIA 3DTYA 4R8KA 2FUEA 3QQMA 3CZRA 4JXKA 4GICA 3LP8A 3VAAA 2V5VA 1LU9A 3LQYA 2EARA 1L4YA 3FI0A 2ZWMA 4WQMA 3ZY2A 5JNWA 2IOFA 1C4OA 3B6EA 2I7XA 2J1LA 3H8JA 1VDZA 1ZJ4A 3KZNA 4XB2A 3BA9A 4DV4B 2MCFA 3JYLA 1ITZA 1A7AA 1HQCA 4QDOA 4Y2QA 3WDSA 4NDAA 3TZBA 1OV6A 2NNLD 3VPAA 5BSKA 4D41A 4X7MA 4CCAA 4AX8A 1KFCB 4OJMX 1Z7WA 2W6NA 4BKRA 1R8JA 3A36A 3FA2A 1Y4DE 2F48A 4QU9A 3IFSA 5U1PA 3SR4A 4RZIA 4DIEA 4KBGA 1C7JA 1K7XB 4ZJYA 3CE6A 3GEMA 4RB1A 4WZBA 3MAJA 4PO1A 2JJ1A 2XTNA 2VUHB 4E6NA 2R68A 3NGXA 3CVJA 1Z0SA 5EWMB 4J7AA 4C2MA 1OX4A 4B17A 4JFRA 2H29A 1Z07A 3JX9A 3ZJTA 4RTRA 2DWCA 1A4UA 5F4BA 4Y7DA 2XOEA 2C5GA 3KL2A 2QMOA 4NJMA 2GWHA 2GVNA 4BHTA 3M9XA 4ND1A 1WPRA 3I8XA 1K8ZB 2QRNA 1OW3B 3K35A 4YV1A 1QHEA 3O74A 1H2ZA 1UBSB 3QOFA 5KKAA 1QB8A 5A4IS 5CHEA 2BFCB 1MX3A 3ROEA 2ZTHA 5A0VA 1E1YA 4O7TA 2R11A 1J5EB 2WVAA 4BDTA 1E6WA 2XGMA 4FFSA 3HJUA 1O5OA 4BVFA 4TV8F 4Y2XA 1Z2CA 4G0NA 2EX1A 4ZDIA 3H9EO 1KEZA 1WJGA 4QYXA 4OKIA 5BRAA 5LA6F 4J07A 3V8EA 2JFVA 5E95A 2W8LA 2D4HA 3BERA 2NT4A 1T5LA 2OZPA 1KNXA 421PA 4ESEA 1NVUQ 4F2GA 3H9UA 4GGOA 1H2YA 4YAUA 1XQYA 3PTLA 5B55A 1P9NA 3T7JA 1L7AA 2Q0XA 1SCJA 3S5UA 1Y8QB 2G71A 4ZICA 2QMUA 3G5MA 2H59A 1YR7A 2AN1A 2BOVA 1ZEJA 3I9V1 3W5BA 4KVFA 1C80A 4R1NA 2QTTA 1W4AA 1Z2AA 3FKIG 5AKKA 4I8XA 3W1BA 4JUDX 4P1ZA 1K1QA 2ZYVX 5DNWA 4IL5A 1Q20A 1RTKA 3RF7A 5EN4A 1XTBA 4V0LA 4HDSA 4Q9AA 4BJHB 4ZOCA 2OYRA 1WQ1R 4JBNA 2TRSB 3M3HA 2TECE 2H2HA 2C54A 1C1DA 4INAA 1XRQA 4QYSA 3QWFA 4OM7A 3VR5D 4B4VA 2EBWA 1M6YA 4RD2A 1I36A 4U3JB 3IRUA 1PW5A 2QJWA 1E7YA 4BMNA 4W1QA 1G5PA 1ZOPA 2RC5A 3VR6H 2FSHA 1HZJA 4AF6A 4C3ZA 2PTGA 2QE7D 4YRAA 1L4FA 2O1XA 4FLMA 2ZXFA 4PIPA 1P44A 2ZCJA 4FCWA 3NVMB 5BN3B 3AHGA 1E60A 3I1IA 3VHRA 1CQIB 1C5KA 3TD9A 5KOHA 3MMZA 2HA7A 2NXJA 2QRLA 5FJJA 4EYIB 1JG3A 2VNIA 3JW8A 3HB7A 2VJLA 3I3OA 3QEKA 3DMGA 4LY3A 4DTCA 4YI3A 3F8WA 3KVOA 4X64H 2WTXA 2GJSA 5TEVA 1XZNA 3C3MA 2VJNA 2INGX 4V0OA 1E1LA 4INZA 4KC0A 3UK1A 1KERA 1W8DA 4L6CA 1U0SY 1RKBA 1U1GA 3K94A 4BNHA 4ZQBA 1VHWA 4Q1CA 3AIIA 1LS6A 3LIIA 4ZCMA 3MGCA 3MXTA 3Q8MA 3H87A 4TM7A 3VNNA 5DT2A 3S1AA 1MG0A 2VDKB 1BH2A 1G0OA 3I83A 3KD3A 1RK5A 4GLBA 1JU4A 4G8DA 3VH2A 2HJ9A 2J3KA 5FRDA 3V1TC 4L1KA 2J3EA 4B5LA 4XGQA 3NHSA 3K2IA 1I0IA 4MB2A 4MQLA 2J7PA 1PZHA 5AHXA 4ITRC 2XDYA 4UVDA 5EMKA 2XKKA 3E3OA 2VA8A 3ZJ4A 2FZVA 3OCZA 1ZJ5A 3MILA 3TQCA 1R4MB 2Z6AA 4F4JA 1RWPA 1VE3A 3Q7IA 1PNTA 4GM4A 2DQSA 2RJOA 2D0DA 2NT3A 2ECQA 4M8IA 4ECZA 3O31A 3GIIA 2NU7A 4M54A 3FF4A 4HNTA 1AV7A 2YV4A 1DWUA 4BWYA 1EWVA 5YASA 5IXYA 5D7BA 1AKVA 3C7CB 1PZMA 3LP5A 3F6YA 3GTJA 2HX1A 4R2XA 2HRBA 1SJ9A 4H6VA 2DJIA 1FW6A 3FKSA 4RMHA 3T1OA 4LDNA 3VNRA 1G2IA 5JH7A 2Z2KA 3GRKA 3FDJA 1E64A 5EIBD 1U04A 2NTYC 4JP5A 2R3SA 3CVUA 4UDNA 2HMTA 3AESB 2RJNA 3IQEA 2PMFA 1KU6A 2K5UA 1V7CA 5LB4A 3IKMB 4QGGA 1M1ZA 2M6KA 4KIGA 3K1AA 3DE6X 1K4KA 5AM0A 1ZP6A 1PZNA 3EPHA 4EA8A 1HDOA 3HRHA 4FGLA 1K98A 1K0UA 4K9SA 2E4UA 5HF8A 1OXMA 1JYSA 3S2IA 1TYBE 3EHDA 2P4EA 4QOEA 5SY9A 3TL6A 3O7MA 2Q49A 4L57A 3RUPA 1T2EA 2H1LA 3VAYA 1PFYA 4RGQA 3DXYA 4KI0A 3RI3A 3RTDA 2QPLA 3PQ3A 4H1UA 3JQAD 4B83A 4UW9A 5JJBA 4LK3A 3CBQA 2WYIA 3TG2A 2X2OA 4D0RA 1WMEA 1X1DA 3K5IA 4UZFA 4R4JA 1KR5A 2PZGA 1ZG3A 2ORIA 3FPHA 3L5OA 1HYBA 1WDLA 3LKDA 1C7FA 2C58A 4FFVA 1PFWA 2ZJ4A 1MX9A 3BA1A 2F90A 4QEKA 5ECDA 3TRJA 3RS2A 3OF3A 2KI5A 4BDSA 2UVVA 1IRIA 3NXSA 4HDRB 3KKOA 1UPBA 2IYPA 2LKCA 1NPYA 1RM5A 3K0HA 1T0JB 2XWPA 4C03A 2GK3A 2I4LA 1ZETA 1U7HA 3UNXA 2NXCA 3N0XA 4PRZA 2C95A 3AWDA 1ZNYA 4TVOA 3VJRA 1UZUA 4A0FA 3O5AA 4IXNA 3W5OA 2ZVDA 4FZVA 1E1CB 2VAMA 1O6GA 3WWCA 5KTTA 2VSYA 1FP7A 2YOFA 1TAEA 2ZULA 8ADHA 4QGBA 1MXFA 3V8NA 3RKSA 1TNDA 4F50A 3C70A 4FYKA 4ZDKA 1V5EA 2YN0A 3T4XA 3VNUA 1ZR4A 2CWWA 4WW0A 4OLJA 3QV2A 5AD1A 4KQMA 4TZTA 3RIEA 4DQNA 2DPHA 3QVSA 2YBEA 3QEJA 3UH0A 3GLGB 1JA0A 2AX3A 4GI7A 4BBJA 3DEZA 4HMQA 3HJHA 1PI3A 1REQA 4PXAA 1O6CA 5DCYA 4BRUA 3OJOA 3RC8A 3N87A 4OAQA 4F7WA 3KSMA 4D4KA 3KPJA 3ADPA 1BXGB 3H0KA 1ETUA 1F17A 3DLHA 3R3UA 2C97A 1QP8A 3FFBA 3TLXA 4O4LB 3S8EA 2D2EA 4QFDA 1Z5GA 3HB5X 3G2JA 5HNEA 3LTEA 3OPNA 5LN1A 5AJTA 3P2JA 1XTVA 1M2OB 3QMMA 1Q1NA 2W11A 5IJ9A 4ZCSA 4FFBA 3OZIA 1X0XA 4BFXA 3NDIA 1GGFA 5HZGA 1TRKA 3K5WA 1CNMA 1NUSA 1L5FA 4LSMA 1YZNA 3D2LA 1K3TA 3KWJA 1KFJB 3R3WA 5D1HA 5AUOB 3LBIA 3LT1A 4CGYA 2IEBA 1U2EA 2NUBA 4EI8A 1L4EA 4QTTB 4Y0NA 5M34A 3F2VA 4EFNA 2RKWA 3FVVA 4R54A 5BSVA 1KY3A 4MO2A 2B69A 3LRPA 5JHHB 1Q44A 1GADO 1BKDR 5DNDA 2W9AA 1Z88A 2C5AA 3TWOA 4U39A 4K6FA 2R7ZA 1GNQA 3PXEA 1QC5A 4A2WA 4QDUA 1IM2A 5JV5A 2BF7A 3OKPA 5H3HA 4CKBB 3U1BA 4ETNA 2HSEA 4ZQCB 1ADFA 3EOBI 4BWVA 1P1KA 3AVXA 3ROZA 3FOAA 1W0KD 5A3JA 3PGJA 1CUBA 1X1QA 4HFMA 3K1TA 1ZRMA 4A15A 3KIPA 4JI0B 3QWAA 3AC0A 2IHVA 3SC2A 3T3MB 2FUG1 1MGPA 5E1BA 3MFIA 3OE7D 5IS2A 1EX9A 3B2NA 3ZN2A 4XUGB 2JVJA 3V3KA 3O82A 3A58B 3DTFA 1JIHA 5HW0A 3R4CA 4AXBA 1FVXA 2FDXA 3P0HA 1TL7C 1U1EA 2COJA 4N6GA 4B2LA 3CH6A 4XARA 3TW8A 2JHFA 5FPTA 4M89A 2NOAA 3CRQA 4GWGA 5FUXA 2PUEA 1LQTA 5TPWA 2DAPA 4V24A 4O2BF 1SFRA 1CZNA 3E9MA 3ZDYB 3FPFA 1JFSA 2AD1A 4IEFB 3S8YA 3QFHA 1H2XA 4EBDA 4TKUA 4QT4A 3E9RA 5JJ5A 1JA9A 2L42A 3EIQA 3LL4A 1FLDA 2D2XA 4L5AA 3LVQE 2IOQA 4BOYA 4MHTA 4RIIA 2AG0A 5CM8B 4JUIA 2OBFA 1R0YA 4B84A 3WDLA 3BG5A 3PW7A 1RYZA 4RF5A 3ER6A 1W8IA 1CBUA 3AUKA 1N5IA 2WTFA 4ETWA 3KDSE 4A2BA 1ABBA 2VWGA 2HIXA 5D3ZA 2OO5C 2JCBA 3H6GA 4FS3A 1VE9A 3CNNA 3FPLA 1AY0A 2A0XA 4DMGA 2XMDA 1KDTA 4TLCA 3O4FA 3FCYA 1F4VA 5ITWA 4HB2A 3NCHA 2R8HA 1ENYA 2H7XA 4I4IA 4KQXA 2C88A 1U0RA 3OEWA 1Z5ZA 2JW5A 5TARA 3MFQA 1GARA 1EUCA 1ZUHA 4DIBA 1CZLA 2H4HA 4BZPA 1H05A 2SCUA 5EFZA 5HPYB 1UMCA 3DAGA 3VSEA 1OE0A 3O7WA 4RVFA 4I1UA 3CSWA 2QUKA 3BL6A 3CUYA 1BMFA 4B44A 1BDHA 4C4PA 4CL8A 4MWBA 4IRUB 4RQBA 2LR0A 3TVTA 1DU4A 1IEQA 3H97A 3S8MA 3SJCA 4TM5A 2GAAA 5KFGA 4EJSA 3C3EA 1NY6A 3V6KA 1U8AA 1AHNA 1UWVA 2Q9CA 1QH8B 1I32A 5AJHA 4ARUA 1DADA 3RVOA 3TS1A 1QZ3A 3D3JA 1C30A 1CEXA 5JZOA 3E58A 4B3SB 2A3RA 1ZR2A 3BZBA 2EKQA 1V4YA 1L5HA 3NBFA 1JHXA 2P78A 1ZOLA 4MLPA 4OU5A 3D8HA 2IDKA 3BTVA 3KHKA 3ETDA 3MBIA 3EGCA 3L3BA 4U7JA 2J30A 2ET6A 4DR5B 5EERA 1TJ3A 3FFWA 1TU4A 3UW3A 3WOHA 5AW7A 1YJCA 1OV4A 2ZUSA 2HYDA 3DD5A 2CXUA 4KFRA 3W3AH 3H1AA 3NU1A 3WWYA 4NK5A 3OWOA 2XCAA 1W7AA 1M2GA 4AZ3B 4II3A 3RTCA 3RJ9A 1IJBA 1M1XB 3E2PA 2WTNA 1NXVA 5KNBA 3MTBA 4YONB 2GN9A 3ZNOA 2VTKA 1CNFA 4CM9D 3TTTA 1FVHA 1OXSC 4RB0A 3D8SA 3M82A 2W22A 1V2GA 1GUAA 2NZ2A 1KXJA 1FSZA 3CQZA 2YMQA 3LK7A 5FQNA 4N6NA 3PQDA 2AN5A 3B6ZA 3RODA 7ADHA 3Q2OA 2JGLA 4HH3C 1G2WA 5I5SA 3WTBA 3B5EA 1RWOA 4WOKA 2BBSA 3PP8A 1ZNQO 4BMYA 5EE5B 3ENWA 4NHEA 3VTAA 2M6SA 1Q84A 3JQ6A 3H5OA 2CSUA 4TWJA 3FDIA 3ABQB 4OHYA 2W42A 2PMKA 4CM8B 1CSEE 2J5RA 5K0GA 1KZ7B 1NC1A 3CKYA 3GIPA 2EFCB 4IIGA 3WLAA 3IBCA 3U19A 5ADVA 2QTLA 2JK0A 3ZZTA 2A5JA 1GTVA 1TUEA 3LNTA 4IF6A 4UM8B 4X24A 1GAXA 3PITA 3OQHA 5CT8A 3FLMA 2IODA 1WW8A 3S7ZA 4G5HA 1EUDA 4P5EA 1D0SA 4L8VA 1A7JA 2NMVA 1SXJB 1Q0LA 4NBRA 5HEKA 4ES6A 2FN3A 2ONJA 3T7CA 2EQAA 1XN1A 2AI2A 3PR4A 1V9SA 2QSJA 1R88A 3K70B 1KIFA 1MG5A 1NXWA 3PDHA 2X19A 1RJPA 2Q07A 1BHQ1 1V4BA 5A7FA 2WF9A 4KACA 1OB2A 4JY7A 3Q8WA 4D4LA 5I9LA 2JCXA 3VR3D 4JAVC 4EBFA 4IIHA 4LJAA 4M38A 3ZDDA 3ID6C 3KQQA 5TS2A 4I3GA 3INYA 4MW4A 3SC4A 3BQ0A 4ROSA 1QRTA 2VC2B 3MJCA 1H3EA 3PFWO 1VJTA 4ZOBA 4NJOA 1W48A 1Y3AA 4B45A 2WJGA 2RI6A 4PTLA 3MSCA 1QTNA 3TUIC 5I5VA 5ALNA 3KJZA 3H5AA 5IKOA 4LZLA 2V98A 3MFHA 4YUWA 4RADA 5KNCA 1H9AA 1DUSA 4GGPA 5JIBA 1BXZA 5IJZA 4PX3A 4YDSA 2QN9A 5C8DA 4JI3B 2I55A 2Z9BA 3RSSA 1HDXA 3GJ5A 5JZBA 1NX9A 2GLXA 4PO9A 2QTBA 1PK9A 3NDPA 5SZHB 1VL6A 2AHRA 1NBME 1EWTA 3AB8A 4R7RA 3UGTA 2RE8A 1KTIA 2P30A 2WR8A 4C07A 1GUDA 1YHZA 1YDMA 1NUQA 5F7JA 4ZI7B 2R6JA 5C4IA 1BWQA 3DEIA 5C31A 4K1LA 1F12A 1FTWA 2CNOA 2AK2A 4FMCB 4M99A 1EAMA 1ZM4A 1EJ2A 1K7FB 4X8LA 1C9DB 5C1OA 4GMDA 3THYA 3A1CA 3P45A 2VTEA 5AI9A 4G9EA 5FEMA 2JAQA 4RFSB 4Q0YA 5LWQA 3IJEB 1YB7A 3ZHVA 1PEKE 4I50B 1ISMA 5GTDA 4LF8H 2QEQA 2WI8A 2X4DA 2WHPA 1SHJA 5AM4A 1Q0HA 4F2HA 3RNOA 2B34A 3L2OB 1W76A 3N42B 2FPOA 2GNOA 4N3NA 3PKIA 3KQPA 5B53A 1SG0A 2IJGX 3JQAB 3SQMA 1N3BA 3SSOA 4Z5XA 3E82A 3CVVA 4B3CA 4TSFA 5I45A 5JSFA 4MRAA 3P0IA 5C32A 4JCOA 4LRSB 3TQRA 1K88A 1DX6A 3NIGB 3PC6A 4TX1A 4P4LA 1YRBA 1C7EA 3LKBA 4ED0A 1RC0A 3QQ5A 1DRVA 1N7HA 3PHLA 2R9VA 3KBBA 4LC1A 2VT3A 2PQ6A 2X0KA 3VZRA 1T4CA 4KU4A 3K71B 3JQPA 4AJ4A 5KC9A 1ZEMA 1EX1A 1C8BA 3PVZA 5A04A 5KTYA 1DAGA 3CLRD 2O2SA 3RVNA 2FEXA 4QHYA 3K8OE 3KQKA 3BL5A 4YRFA 2XZOA 4OFWA 4BNIA 2I3GA 4KXLA 5EYPA 4BKUA 1FFYA 1D6SA 3R7WB 3V4FA 1XZIA 3V1NA 2AK3A 1AUXA 1L5SA 4D9CA 1T5TA 4J3JA 1OY1A 1AQUA 2R00C 3DVSX 2NO4A 3K9FC 2XJ9A 1U9JA 3SK0A 2C0QA 1AO3A 4D45A 1PNOA 3WWPA 1YZTA 5E1DA 2YIDA 4IJKA 5ARBA 3TLJA 4Q6BA 2IQIA 5ENZA 1PZEA 2XSZA 1RRVA 4C6TA 3R6GA 2HCJB 2JI7A 3O4VA 4OSPA 4S2UA 2WOOA 4TQGA 1XQ1A 3H1EA 3CU5A 3T3EA 4LFBB 5JG7A 4IZOA 4TUYA 2ZE7A 4PPQA 4MO9A 4E5UA 2FA9A 2O05A 3A25A 2J0VA 5HIIA 2EZTA 5EUQB 1CLUA 5KTRA 4JUFA 2XQKA 3EY4A 3K4QA 4BQPA 5AI0A 1D1QA 1IYEA 2J5XA 5KYWA 2QLMA 1QDUA 5K3WA 4HNSA 4PGAA 4QODA 1EEHA 3OJFA 2QVCA 3F78A 3TOCA 1LA2A 3BX1A 3UCXA 1KY5A 3QVVA 4RJJA 4V3CA 3QA3E 1UMBB 1WEHA 5AWFC 3ZWNA 1DZIA 3BRCA 4A6PA 4M7EA 1NG1A 2BDTA 2Y1GA 3K9GA 2X76A 3UOWA 3QLVC 1S68A 3RRXA 1JG2A 1N34B 1RK6A 5TQ0B 3O3MB 2AU0A 1ZHOA 2JFHA 2A4MA 2JAOA 1U0JA 2AFHB 1E98A 4ZODA 1V26A 1U8UA 1Z7YA 4CKCB 4ZU6X 1KR2A 1DTEA 2YJ4A 2NYVA 4OGKA 3IVMA 5NLLA 4EHHA 3CR8A 5LNK1 2HXSA 3VR5H 3SS9X 1DRWA 4BE9A 4MWSA 1MN6A 1X9HA 5EJAA 4IFIA 4C3VA 2AGOA 1A0GA 1KOLA 5K6TA 2CVOA 1O9BA 1W30A 4YJKA 3VYSB 1DXYA 4NESA 2JBAA 1B93A 3TUZC 2R7ZG 4H3SA 1B16A 5E0KB 4H0FA 4PG7A 3FJ1A 4FCVA 2TS1A 1UAGA 1U80A