2R86A

Crystal structure of purp from pyrococcus furiosus complexed with atp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
334
structure length
334
Chain Sequence
b'MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGAKGGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 102
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r86A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r86A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r86A01
3KALA 5DMXA 3WO1A 4O2BF 4M98A 4IWYA 2W6ZA 1B6SA 3MWEA 4XZ3B 1KBLA 2W6OA 4MA5A 1CS0A 1VKZA 4O83A 1CE8A 2PVPA 4YBZB 4C5AA 2YL2A 2V5AA 3HBLA 4C5BA 4EGQA 5I47A 2R7NA 1Z2OX 4HNTA 2ZDQA 2FP4B 4EG0A 5JQWA 1PX2A 2R7KA 1CQIB 5J2UF 4MA0A 3OUZA 3K3PA 1KEEA 3WNZA 2Z02A 1AUVA 2NU9B 1CQJB 4NYEA 4YAKB 1C30A 5C8YF 1BNCA 4YJ2F 2HJWA 4GGMX 1AUXA 4O7NA 3GLKA 2GPSA 3R23A 2WYOA 1EZ1A 3AX6A 5CB4F 3ETJA 4IWXA 4ZOLF 4O7WA 3U9SA 2DLNA 4EA7A 2FPPB 1Z2PX 4FFNA 1GLVA 4FFMA 4EA8A 2R6FA 2NUAB 4E4TA 4QSHA 4O2AF 4I4TF 3TQTA 1I7LA 4FE2A 1VBHA 3RUPA 4O82A 1JDBB 2NPOA 5BPHA 3ORQA 2YZMA 2ZDHA 3HB9A 1B6RA 3JZIA 1OBGA 3QFFA 4XYLB 5CA0F 4IZOA 4C5CA 4O4JF 1I7NA 4I55F 4EGJA 2R85A 4YJ3F 2YS7A 2GQRA 4MAMA 4RZQA 4EABA 5D8DA 3AW8A 5LYJF 4ME6A 3Q1KA 5LP6F 1EUDB 2VQDA 3LWBA 2P0AA 3U55A 5C1PA 2CQYA 2OLSA 3HO8A 4MV4A 4DIMA 2CNQA 3MJFA 2QF7A 3E5NA 5HV6A 1DIKA 4IHJF 2CNVA 4YAJB 3K5IA 3G8DA 4TUYF 1UC9A 5K2MA 1GSHA 3GIDA 1T36A 4O84A 1VBGA 3LP8A 5KKNB 3OUUA 3BSSA 1E4EB 4MV1A 1JKJB 2R7MA 5FNVF 3VMMA 3TIGA 1IOWA 2W6QA 3R5XA 4HNUA 2W71A 5IYZF 3RV4A 4EA9A 1KC7A 2GPWA 1GGOA 1KJJA 5JH7F 1JDEA 3G8CA 3VOTA 3TW6A 1C3OA 4WD3A 2DWCA 2IP4A 1W96A 5BMVF 1E4EA 4O7YA 4I50F 4M9CA 4O81A 1KJIA 3BFPA 2VR1A 3JZFA 2FB9A 4MV8A 1DV2A 2SCUB 2NU6B 2W6PA 3R9RA 1SCUB 2HGSA 5H80A 1DV1A 4EAAA 3K5HA 2XCLA 2YYAA 1ULZA 4TV9F 4MV9A 1KUTA 3RV3A 1EYZA 1EHIA 2C00A 5BPFA 3RFCA 2XD4A 1BXRA 2I80A 3UFXB 2YZNA 2J9GA 3Q2OA 1M0TA 5JQGF 4TV8F 3U54A 3JRXA 3BG5A 1A9XA 3KAKA 2CZGA 3NUAA 2W70A 4FFRA 1KJQA 3N6RA 2YRXA 2YWVA 3TIIA 4HR7A 4M99A 3VA7A 1GSAA 2V58A 4ZHQF 3U9TA 4MV3A 3I12A 3MWDA 4FFLA 4YB8B 4FFOA 5J2TF 3JRWA 4L1KA 2YZLA 4O7SA 2PN1A 2I87A 2PBZA 3BSYA 4O7VA 3WO0A 4O7LA 1PK8A 1KJ8A 2W6MA 5CA1F 1OBDA 3ORRA 2FPIB 3V4ZA 3R5HA 4Y8VB 5LXTF 2Z04A 2R84A 4FFPA 5C1OA 1W93A 5CAEB 2QK4A 4ZQIA 3V4SA 1WR2A 2R86A 1A48A 1M6VA 4O7TA 2R82A 3SE7A 1GSOA 2X0SA 4XYMB 2R87A 5LOVF 4MV6A 2V59A 3VPDA 4O4HF 5JVDF 3R5FA 2YW2A 1EUCB 5GONF 2DZDA 4XX0B 4MV7A 4IIJF 3VPBA 4O86A 2FPGB 4O4LF 4J6EA 2YZGA 2R7LA 4HQ6A 1UC8A 5EZYF 2YS6A 2NU8B 4O7ZA 1Z2NX 3KAJA 5KX5F 5LA6F 1M0WA 2GQSA 4O7RA 4FGRA 3ETHA 1JLLB 4HNVA 2CNUA 2ZDGA 3DF7A 2W6NA 3VPCA 3N8DA 4WBNF 4ZI7F 2GLTA 3KREA 2DIKA 1KJ9A 5HBRB 2YRWA 4O4IF 1IOVA 3BSWA 5JVLA 2VPQA 3TINA 2NU7B 4DLKA 4M9UA 4FU0A 2VHEA 2I8CA
chains in the Genus database with same CATH superfamily
1OH7A 4GOND 2AFHE 4D9GA 2Y2VA 4M2LA 5EXSA 1UK9A 4A8HA 1ENZA 2YZKA 2NADA 1DQNA 4IL5A 3HBLA 4ML3A 2DFLA 3KOOA 2GVDC 3HXPA 3PBKA 2UUOA 1X0VA 4D3ZA 3SZLA 3JVDA 5H4GA 2VPXA 2X5KO 2O2SA 4NZ9A 5C51B 3EYYA 2NO6A 4MLCA 4X66H 2Z3VA 1D09A 4CKWA 4NOMA 1GT91 1T3TA 3WE7A 4XEHA 1Q0PA 3I9V1 3KXPA 4FNGA 3IE1A 4MHSA 1JEOA 3ER6A 3RROA 1GFIA 3K2EA 1JKMA 3F5DA 4QXPA 3KQWA 5BW4A 3GIIA 3H18A 5HM8A 3MR5A 4X94A 3KXKA 4KUHA 5TS3A 2GHRA 1U0EA 2BV3A 1CUGA 3FYCA 3X1XA 3R09A 4KXNA 2WJZB 4Y9DA 1F1JA 4BQNA 1WA5A 1SRQA 4EVIA 3ZIAA 5LNK6 2Q3DA 2W9XA 1ZW1A 2MTBA 3I72A 4L9SA 3H05A 4QIWA 3NUGA 1KFKB 4PFQA 8ADHA 1SIBE 3ACBA 1RAFA 3LRXA 3KRTA 5CB6A 4RIEA 4MS3A 4DIMA 5KHOC 3HOXG 2RBGA 4C3VA 3NBQA 4B6PA 5IMBA 1VGVA 1R6TA 3PNQA 1NVFA 3UB2A 2PRZA 3Q1LA 3AEKB 5FYQA 4RBNA 3D4NA 3Q7RA 2CFSA 4L0CA 4OLAA 2QM7A 3N58A 3RF2A 5CNMA 3N44B 3WC4A 2QV0A 3WBBA 2HGWA 1DV2A 2J41A 4B3SB 1ZZEA 2Z4SA 4U2BA 3P71T 1CJMA 4ZYYA 4Q4CA 3GN1A 3GDFA 1S0NA 3RU3A 2C8KA 2CNWA 1QWOA 4L8GA 4ALJA 5AVYA 1ECLA 4NRDA 1PD0A 1K66A 4IGFA 4KW7A 3RV3A 3HSKA 2B21A 3RUCA 4YP3A 1PJSA 1BWSA 4H3VA 1S7CA 2XLCA 3ZJ4A 4CCYB 2YN4A 3NDRA 1CP2A 3SGIA 4HVAA 3QITA 1RHUA 3UJCA 4L8FA 1KMHA 4E1AA 4KQXA 3UKOA 2CXHA 1A4RA 2O8BB 3L8CA 1IM5A 4ZTUB 4PIPA 5ALJA 2XIGA 2C9CA 3HUUA 3H0GA 1Y4UA 3H5OA 5JBIA 2CE7A 5JC1A 4GOOD 3A1FA 4CIYA 2ZIXB 4MUNA 5EMLA 1XDDA 3NYIA 4G09A 1UWKA 3RBXA 3V7FA 1E7RA 2XGPA 4PC1A 4QDXA 3ANTA 1PNTA 4X62B 3B48A 3NO4A 1Y34E 2JGAA 5L1JA 3C3MA 2Q5EA 2AFIA 3DLHA 3S4YA 3U3DA 1Z4MA 4BMDA 2XUPA 4X1YA 1YS6A 1BMFD 1CQXA 2QRZA 1D2MA 2JGEA 3ROMA 1FVIA 5CLQA 3FY4A 3SZ3A 2Y9PB 2RKWA 4LOKA 5D7BA 4CKBB 5DBHX 2BE7A 5TMDA 4TMXA 1FP6A 4RELA 3ZV5A 5LZ4A 5JPCA 4ZQEA 2XQIA 2W6ID 3HKZA 2PA0A 3GJXC 1ZINA 1NBOA 2P4QA 4Z2YA 5CB4B 5TDHA 3UWMA 4TWBA 3PD7A 1S8AA 3A6LA 2IU4A 4MK4A 5HJEA 5KG7A 4MWEA 2GYYA 4NBSA 4RZ3A 3U16A 3FCCA 1W35A 3NC0C 2C2BA 3K70B 3UANA 4YBZB 4L9WA 4F9EA 1PG0A 4CEJB 2WV9A 3ZI7A 1KZ4A 4WNAB 3IFSA 1OLSA 3WI7A 4HNAA 4ATNA 4W9RA 3RAFC 2OBFA 1RAEA 1PTKA 2VPSA 2JAOA 1PL6A 1JG4A 1I2ZA 3LHSA 5B53A 3KLBA 2R8XA 3QV1A 4XX1A 2FV8A 3TCKA 4QAQA 2YH2A 1UJ6A 5C8VA 5K0CA 4XD7D 4PTYA 5CLFA 3JD3A 2WIDA 4OREX 2VNHA 2FX2A 1VPTA 4QOHA 3GPBA 3V80A 2JLAA 1F9AA 4N6OA 1I1LA 1FVXA 4RSGA 3S2SA 2ZRKA 4AN0A 4O3PA 5EQTA 3RS7A 2NVUB 3GMDA 4UBJA 2ENUA 4EYQA 4TUYA 4DLTA 1GDTA 1TM5E 2IF2A 1M34B 4J7CA 3RVMA 1II8B 4WVLA 5GJVC 2XXBA 2YHAA 4ECZA 3TPCA 1CTQA 4JEMA 5BSHA 4Z0TA 4NSNA 2W2KB 1P1BA 5HK8A 1UF9A 3VZCA 5SYAA 1FUUA 1LPSA 2IDZA 1C41A 3AR2A 3Q3JB 4DLBA 4Y30A 3RB0A 4GC7A 1JKJB 4NMLA 1I2MA 3L8MA 3RYCB 1FZQA 4C7VA 2GOYA 3BBLA 3O92A 4FC6A 1MZBA 4W8OA 3SF0A 1LWNA 3VDRA 4RGYA 2FWRA 4K8RB 5D6NA 4DV5B 1GGKA 2J6SA 4O81A 3BJZA 1TECE 4UNIA 4H7EA 2E87A 4RB2C 2VS1A 4WZZA 4JJAA 4CHGA 1BDBA 3CZRA 1O0SA 2PPVA 2FZVA 1NW8A 1R8XA 3WWJA 2I6TA 3CB2A 5ARCA 3LV8A 4NHEA 4DV3B 4A6EA 1XZNA 3IR7A 3WA6A 4OHRA 3A1SA 2Q6OA 4G2NA 3PZPA 3LYLA 1GXSB 1ZMRA 4NG4A 2PTHA 1U3GA 1ZVMA 3LDAA 1NUQA 4ZXPA 4I0WB 3OHMA 3EDOA 1YR7A 3AINA 4A73A 4INOA 3H3JA 4YVFA 4MVJI 3FPGA 1ZUNA 1V8ZA 2G0TA 3TDNA 1N6NA 2NV0A 2TSYB 2XUHA 3IR5A 2EXXA 2QAGA 1T10A 2P7IA 4WEOA 3HOYG 4R7GA 2VQEB 2PEZA 2QR2A 4A27A 4RY0A 1Z6AA 2ABJA 2RDJA 3WRYA 3GEBA 3B6KA 3FAZA 4FONA 4XDYA 3N2GB 4QUEA 4H35A 3OOHA 2YASA 2XT0A 4RETA 3BMCB 2O4UX 1AMNA 1M6VA 2J45A 3WGVA 2H1FA 4RKWA 4B3IA 1GRVA 3VPSA 4C7OB 1KEKA 3UKDA 3NJ4A 3IVRA 2R92A 1UK7A 4ZVRA 4BRZA 5F23A 3CLTD 4L51A 4BTEA 1KYYA 5I8WA 5FR1A 2WFAA 5D1NA 3PX2A 3SMQA 2JGLA 2ECFA 1CKEA 1OYVA 1RQXA 1TT5B 4V1CA 4IX9A 4X64H 2B63A 1XJWA 2VQFH 4DIFA 2R9VA 3ZHSA 1M2VA 1XU9A 5JSHA 1SHUX 3H87A 4NPHA 2JI9A 4YRTA 3RS4A 1JH8A 4QLBA 3U31A 1T3SA 1XD8A 3IDSA 1RVDA 3NKLA 4KO8A 4OHUA 1R9GA 4Y1GA 5EMKA 3ZNNA 1DXYA 5AKIA 2G9NA 1R66A 1L0BA 2WDZA 4L0MA 2EVWX 4RCYA 3HCOA 1I4DD 1V26A 3GJRA 1Y1VA 3C5HA 4AKGA 2QMQA 1ZIPA 1HMPA 4LF9H 2AJTA 2ZAOA 4O3FA 4NC9A 3G7SA 3D0RA 2VH1A 3VR3D 2XYHA 1R3DA 5LKAA 4YJFB 1OV6A 3D6UA 4HPJB 3IMEA 1G18A 1L2TA 1JHYA 4D3DA 4JOBA 3TOXA 3AESA 3EWNA 3UUEA 1YGYA 4R2LA 1FDRA 4OQXA 4GBGA 4DSUA 4MITA 2JGNA 3BFKA 4OQQA 5KTRA 5CD9A 1P4SA 4OBXA 2H54A 3QF4B 1WRBA 3WXMA 4XVRA 3PE6A 1L3BA 5HFNA 5CBPB 3Q6IA 2HV9A 4UTVA 2C82A 5I9MA 4FMCB 1OSNA 1AKEA 1LPOA 3H5NA 3R7LA 1N9KA 4LYAA 4WK4B 3SSNA 4V0RA 1ZM7A 3JD1A 2O8CB 3SQWA 1E92A 1GUFA 3RG2A 3OLYA 5E95A 4ETWA 3C7KA 1EFDN 2X5RA 3GWZA 2C2WA 1BVYF 3AI1A 1TCVA 2GJSA 1NVEA 5DISB 1JIIA 4DL5A 2H8GA 1U2PA 5CE8A 3TB4A 4MI1A 1UR5A 3UT5B 5JH7A 3IIMA 4FOOA 3AUXA 5JALA 2B82A 5I4KA 5B1IA 4XW2A 1MNQA 1COZA 2QEQA 4UNRA 3MJFA 5KQGA 2W2VA 2XNKA 4ZJZA 4YP1A 4RXTA 1TWGA 3L8HA 3NP7A 3PQCA 3NFYA 5AM4A 1K8ZB 1RS0A 1BFDA 2IYTA 4BNFA 2ZI4A 3QQPA 4X62H 1JG2A 2H4ZA 3ENNA 4TM7A 4K26A 4BMPB 3WQHA 1UDCA 3WYNA 2J7PA 2Y1FA 5B5SA 4BUZA 3OIGA 3THXB 2G7ZA 5AIAA 3V8PA 2NZWA 2EP8A 3L9XA 5EWEA 2Z5LA 5CG2A 3QWFA 1JF8A 1H4VB 1UMBA 4B73A 3O6VA 4N6NA 3QI2A 3AKDA 4X8MA 3OECA 2ZRNA 4B2IA 3PC6A 2VJKA 4UDYX 3T5BA 1XSEA 1ZA1A 3BTVA 3FPKA 3IALA 1YZGA 1GO3E 1A1SA 2VPWA 1GUAA 1L8QA 5TT0A 1BA3A 4U7GA 5AM5A 4LZPA 1MIOA 3S5UA 4GBED 1EQUA 2DUNA 2D0IA 4JQZA 2ALJA 4FFBA 3TQ1A 3PP8A 4QWCA 5EQJB 3SC2B 2BGWA 4FBUA 5A4KA 3CLUC 3MR3A 5FF9A 1R6DA 3E5HA 2QYZA 3O1LA 4EH1A 4MRAA 4R54A 1SZPA 2QX9A 1JSZA 5D3MA 1JECA 4HT3B 1JWAB 3K0CC 3UJPA 3ET5A 2H51A 3T3PB 4DJEC 1DC6A 1XTRA 3SDSA 2B0CA 3RVQA 3P27A 2PD4A 2O54A 2Y1EA 4Z0NA 3KSDO 2ZUFA 1W76A 2OMKA 1OF1A 2JAWA 4ER6A 1C3JA 3IVCA 1OWPA 5BXQC 3R0XA 1QU3A 2DP4E 4C21A 2OCKA 1XTVA 3W9SA 1IQ0A 2QKYA 4ZYZA 4MAAA 5AI0A 4DJTA 3EXFA 4EG4A 4BLQA 2ATIA 4KU4A 2AG5A 2RH5A 4JS0A 3HNRA 4J2OA 3RAXA 5KX5F 3KZXA 1UM9A 4RTJA 1TYBE 4Q05A 1G5FA 1PLKA 4FW8A 2UZ1B 3UGJA 4FW9A 1QK4A 1LEHA 4C2BA 1BN7A 1RYFA 3BT7A 4RTNA 1QFXA 4LF4B 1LSJA 4BFCA 2ZBEA 3HDTA 4IIJB 3STTA 1NMXA 1BXZA 3VVBA 2CK3A 4S0ZA 4J4HA 3L0CA 3DTVD 1AKRA 2UUAB 4DQLA 1LPNA 1S10A 2WT4A 2XMGA 3CZMA 1NUHA 5F5NA 4CM3A 5K8TA 1WCV1 3RKSA 3S99A 3HA7A 4BMCA 2X4DA 1EDBA 5DI9A 1R9TA 1UEXC 2IIQA 3TMAA 3FB4A 3FPLA 3OJLA 4DV5H 5D51S 5J2UF 2P2CA 3QTLA 3OQ6A 3L7DA 3QXJA 3H1TA 1U6IA 5DNVA 4Z7QB 4OUKX 3VTAA 3RRMA 2HJSA 1JHUA 2E21A 4R05A 2RHWA 4LFBB 3T7KA 3AJEA 1RKUA 1VE7A 4I66A 4DV3H 3I0ZA 1Z2DA 4Q39A 3M1YA 5IN5A 2QRMA 3QKSB 3INTA 2QT1A 5ED4A 4UVDA 3II6X 3F78A 4H0FA 1A98A 1ZCFA 2WM2A 3TZHA 4YV7A 3M1LA 3P19A 2ZSDA 3NBZC 1F0YA 3L7CA 2QDXA 2OYCA 2NO4A 2IODA 1Z4IA 1HQDA 5T67A 4GLBA 3REQB 3OE4A 5AUOB 2IVFA 4Z4GA 2VQEH 4HH3C 3M3PA 3T5GA 1I4EB 1KBZA 5EP3A 3V34A 1LLQA 2H11A 4OSOA 2DJ5A 1XTJA 4LMRA 5ELLA 3FOFC 5IYBG 5CHEA 3S2FA 4NL4H 5IN4A 1ZONA 4Z99A 1OI7A 1OBCA 4ZDWA 4HF7A 1H2RS 10MHA 4ONEA 3H0CA 1UZMA 4OJYA 1X8KA 1HUQA 2WA1A 2FSVC 3SZRA 4DA7A 1EJ6A 4MQ4A 3H4VA 3H2JA 3TZKA 1DUVG 1YDEA 2CXSA 4M0FA 4I9HA 4MPDA 2XGQA 1FUEA 4ZQCB 3CS3A 2J30A 2JIOA 2E2HA 2VJAA 4JYAH 1L5HA 1U6JA 3PR2B 4D5GA 5C9ZA 1YCDA 4RMHA 5BV1A 1SXHA 1JFLA 3TOSA 1K7EB 3LO8A 1ZA2A 3ISVA 4I2VA 5IXYA 1V9CA 2CZGA 3JASA 1NXPA 3EQ6A 3AM4A 1B1AA 4J0CA 3CUSA 4U9HS 1XXHA 2GESA 3AVQA 2ZR8A 4X0EA 4PQYA 3UUGA 4PWZA 4ED7A 3D81A 2YVQA 3HCPA 1MENA 2GN2A 1I3OA 4PRZA 4NU5A 4K86A 4ZIRA 2Y8EA 1N4AA 1OU0A 2Q1XA 3PLAE 2OBYA 4TTVA 3D5QA 3O8LA 5I5WA 3WLEA 4XRRA 1IAQA 2YYSA 1JJFA 1G8HA 3L6DA 3VNRA 2H00A 1H2AS 5B36A 3EZNA 3D4BA 1IJFA 3RHFA 3R5FA 3AERA 4P0PB 1SHKA 3HYNA 1XDNA 4UEKA 1P72A 2D5AA 3A3PA 2YV4A 3WLKX 1M5UA 4TZ6A 4EP1A 2I9PA 2HF7A 1QC5B 2ZCVA 4WECA 5I5SA 3O1JC 4JT8A 5MN5A 4BEVA 3H5IA 3EAQA 3DOCA 2D5LA 5TE9A 3ONEA 3PGKA 3HEMA 5DP1A 3S55A 3ZYZA 2V3WA 4MVJM 2OESA 3DMTA 3OC0A 1P2FA 2EL9A 1TJYA 4GLLA 4PQRA 3K9QO 3A4IA 1OFVA 4RDCA 4X92A 1U7XA 1FDUA 1VHQA 3X0DA 3KK0A 2L19A 1TUIA 3NDJA 1CDDA 4HVCA 3PJRA 3WMWA 5ARDA 4EHFA 2GBIA 5E2BA 1A82A 1JA9A 3ONVA 4K9RA 1NVUQ 1FKAH 4ILEA 4PZUA 4O83A 1PF7E 4XIJA 1I6LA 3GJZA 1IZ7A 3STYA 3W2HA 3HB5X 3ZHYA 4EG0A 5EWJA 1JX6A 4O29A 1JALA 3AHCA 2AWOA 3VZDA 3N2KA 4IOLA 4OBBA 1H3NA 4A1FA 5T8KA 4MI3A 1QF6A 1MX5A 4ZXFA 3KJZA 4U6SA 1A5TA 5G0WA 3LUCA 1YS7A 3I45A 4QIHA 1RM5A 1NKTA 5TNXA 1TTPB 4P32A 4CIAA 5ILQA 2GUGA 4GMXA 3C1TA 2HWKA 1RWOA 3VDQA 2PKQP 4MUHA 2X8LA 4IAOA 5FNVB 3ZUGA 1GRNA 3G7NA 5KNCD 3B7WA 3TRHA 3CNBA 4I2NA 2Q2NA 5JS6A 1PUXA 1IOLA 4DEXA 3QU4A 1YL6A 1NX6A 3C3JA 3RODA 2J4CA 4G4JA 3WLFA 2FNAA 3SLRA 2OWOA 3N8NA 5I8ZA 3WGOA 1Q84A 3ZE6A 2DFVA 3GFFA 5HBGA 5C8DA 3MILA 2HHHH 5E3JA 1V1RA 1GEGA 2ZBRA 3V4VB 1NWHA 2B6NA 4P7FA 3AEUB 3GXOA 1QP7A 1NBWB 3PPVA 5BR4A 1E8NA 4QHYA 4E5MA 4NCHA 4MYSA 3NBMA 4BZWA 1OAAA 3ZE1B 1ULSA 3I05A 4KV7A 2WQZA 5L95A 4HYTA 3BMQA 1KJJA 2PANA 2ZBPA 1BX1A 2XQKA 3TXYA 2A35A 4IHKA 2ZPAA 3HEBA 2WB1A 3COYA 3OJEA 4WIAA 2PRIA 3AFNA 4UBIA 5C1BA 3HVIA 2J33A 1A9TA 2Q1YA 1Z5PA 2D5BA 2DPHA 3AL0C 2OCDA 2XJ9A 5L3RA 1YMUA 3BXXA 1WCYA 2YQ5A 4QJBA 1C7FA 2FEWB 3JRNA 3V48A 4BO9A 4Q1CA 4H7IA 2ZS8A 1FRVA 1E98A 4KI7A 3JWIA 4MMXB 1BX0A 2A1IA 4DR2B 4LF4H 2C5GA 1RM4A 3MS4A 3Q2OA 1RPJA 1Y9EA 1WS6A 4M4SA 1DG9A 1FNNA 2UUAH 3V7WA 4NLGA 2WTNA 4DQ0A 3RFXA 2O5VA 2PUTA 3QFSA 3L8DA 4KIFA 1CNEA 3ZCQA 2GPNA 4B46A 3U13A 3ZU3A 3C6KA 3M9XA 4J2HA 3AFIA 3A06A 2C95A 1P6QA 4HQNA 2W6MA 2IA5A 4QPCA 4Y2VA 3Q15C 4LJ8A 1PX0A 3EVTA 1NBIA 5CM8B 4Y2QA 4JN6B 4H27A 3DZ8A 1O4WA 2QUHA 4AQYH 4RVFA 2B2XA 4H4DA 5JNUA 3DBIA 4MV0A 4RM2A 5H9VA 5LWQA 1U8EA 4MWTA 4UBLA 4IX1A 3GJ0A 4N4AA 4EHKA 4MYUA 2QENA 1ZIOA 1H23A 3RB8A 4KN5A 2DYKA 2IBMA 2XY4A 2WPNA 1A7UA 1ADJA 1I3LA 4Q7QA 1LRKA 1FP4B 2B25A 5FL7D 2ZB2A 2R8YA 1C7RA 3O8NA 1E5LA 1SEVA 2FUG6 4C1BA 4MW2A 3BGIA 3PHIA 4M0EA 2BFOA 4RZSA 1FF9A 4KV9A 3SVTA 4Q45A 3FOWA 2Y67A 5F3DA 1XMOB 3RUDA 3DLIA 4YC7A 1G3UA 2BEWA 3AFMA 1TJ3A 2JJMA 3F8NA 3BJIC 1A5AB 1BHQ1 2DKFA 4BU0A 3IA7A 4CE5A 4Q12A 1YZLA 5LMNB 2K5UA 2JK1A 5FTKA 2H7VA 3WHLA 2WJVA 1I80A 4QNNA 1KMIY 3HM2A 3GELA 3GP8A 2O48X 1VBMA 1DKMA 3HY3A 3FG9A 1U0RA 4RABA 1EESA 1JFTA 2PWBA 3QKRA 4IH9A 3PYXA 3ESBA 3L8ZA 1WOYA 2XNDD 4AP9A 3CR8A 1WUYA 4H2DA 1SUFA 5KTSA 1HTWA 4DR7H 1HQCA 1Z2PX 4X66B 2GBFA 5JY1A 3CR3C 5COQA 2AUTA 2REBA 2FMHA 3GA5A 3AF4A 3HP7A 2XVZA 2OFPA 2X2OA 3ZBUA 1Z36A 5DBGA 4ZJYA 1KWGA 1BS9A 1L5MA 2VDKB 3M9OB 3D3WB 3DDOA 4RJLA 1OBGA 2Q8NA 3V1NA 4INJA 3ESRA 3UQYS 5JYCA 2WTAA 2P3SA 4PAMA 1YRHA 4ETNA 5HF8A 2JGRA 5LP6F 1I1NA 1RRGA 5TQ2B 4CUJA 1MZVA 2ZBDA 2CNQA 3UOGA 3SVZA 2AQHA 1ML4A 3KTFA 4U7JA 2GXAA 4JOSA 1QKIA 3L7MA 1I1HA 3BN3A 4B6RA 4B45A 3MD0A 4ZT5A 2C2GA 1FL9A 3C16C 2G8NA 4YAJA 1SCQA 3MCAA 5FH9A 5PNTA 3AYXB 4WBSA 5LNK1 3M3DA 4KNYA 3JAKA 3NDIA 2B98A 3TY5A 3ZTYA 3DL7A 5I7RA 1Z0DA 4PLCA 4P35A 4C29A 2JH8A 3BFPA 1NBMA 2XB2A 1MKYA 4YJDA 5IARA 4GXRA 4X6XA 4FZJA 3KEGA 3KUXA 2VZ0A 4XWKA 1OXMA 1RYDA 2CFIA 2Q5QA 5B1YA 3IBTA 2C2XA 4TTQA 4W63A 1EHIA 2BISA 4BLVA 3A0RB 4N0EA 2VJPA 2XA2A 3PX3A 3VOBA 1AHNA 4WSOA 4GECA 2EJ0A 2OH2A 3EGDA 2HA6A 4UEOA 1C0KA 3IAXA 1WDTA 2FX3A 2N75A 3K1AB 1EINA 3S8YA 1R4NB 3LW7A 3WJ2A 3N7TA 5BV0A 3D7RA 1HYQA 5CFOA 4TQGA 3L8FA 3CT6A 4B76A 1E1RA 5KFYA 3V3KA 4N5LA 4ALMA 3EZ6A 2PUFA 1BRMA 1TEZA 4GPZA 3DBLB 5DQIA 2PX3A 3GLGA 2E4YA 3VUFA 1YRLA 4H4CA 4ZK6A 2OE2A 3K2IA 2ZS7A 4LCEA 4GI2A 3UH0A 3OCJA 1QR6A 2CT8A 3WDLA 1W36D 4U5XA 5J47A 3I04A 3MSCA 1BFUA 3KHUA 5C5CA 1VDZA 2FZ4A 2EX1A 4C2UA 5JEDA 1REQB 3EF0A 2VHZA 5IAOA 1CKOA 1CY6A 3LUPA 2ZBGA 3ZE2B 2VO1A 5CPBA 3KHGA 5H7XA 4RMGA 3WNQA 3QSGA 5G0SA 2RBEA 3KAJA 3CZ4A 4NPCA 3Q3VA 3I42A 4MO2A 3CF6R 3IXMA 2VH5R 3MJDA 1GRRA 2JIZA 3LKVA 4GMGA 4NNOA 4J0IA 1JSCA 4JGGA 5IAAA 5JSZA 4PXSA 1VE1A 5G40A 4YMIA 2DT5A 3DZCA 4QUHA 2CC2A 1NUUA 1K6XA 3H83A 5J1TB 3DG9A 1EAYA 3AUUA 4UPDA 4BLWA 4DWOA 1ACLA 4JGBA 1J0DA 1JDPA 4LBWA 5D7NA 1XTSA 3R1IA 2ORVA 1QVVA 4Q9LA 2GAAA 2AEJA 3ENQA 3SG0A 3CZAA 5BWOA 2H92A 4EW3A 3B5JA 1V4VA 2LBPA 3CRW1 3GYBA 6ABPA 2YDXA 3MT9A 1I0LA 3NUQA 5AW4A 4P54A 5KYYB 1W5FA 5FJ8G 2B61A 2IHTA 5IW8A 4ASUA 4QAJA 1NLUA 3BDIA 3P2IA 4XGNA 3OQIB 3I9FA 2F67A 3PDUA 3S27A 4PLFA 4R69A 5IH7A 2QN9A 4HTAA 4AG3A 2Q6IA 4NMMA 1YCGA 4GIBA 2PK3A 4YROA 4DV0B 2FN7A 3U3OA 5ETJA 3L7IA 1U02A 4EY8A 1T1IA 5A0TA 1NVMB 2E4XA 1V11A 4PSCA 4GWLA 3PYLA 2KMLA 5CYPA 5LD2B 2AGPA 1WXXA 4FR2A 3QEMB 3GTPA 3FSGD 5KNBA 2K7FA 2GTIA 1XJCA 3I4CA 1S2MA 4WAUA 2B34A 5EUCA 4CQJA 1FDVA 3FSJX 2ECPA 5DWDA 4TVOA 4GR4A 1GQFA 4CTKA 1T9HA 3SHTA 4JI6B 5IVIA 3DAYA 2PZAA 4X7RA 2WVGA 5DCUA 1TA0A 5JHHB 1IBRA 5L3ZA 2QTRA 1JEQA 5EZQA 3NVAA 4FYMA 1POXA 5HUQA 1U2ZA 2QHXA 2QRJA 5EJ4A 1PGNA 3W6ZA 4LSXA 3RRYA 4XWTA 2P5TB 2IY7A 2C9ZA 3TY9A 3LUFA 1FX0A 3EIXA 1H1LA 2HHCA 2XSZA 1TYCA 1NW5A 2X41A 4B48A 3QOWA 1ENPA 2PGIA 4QFDA 3MOGA 1BXGA 3PNOA 3ILVA 4RJTA 4ZEOA 2MYUA 1Z6TA 4MUIA 3HLTA 4F3KA 2QN3A 2DY0A 3IAEA 1G9XA 3KR0A 3TLBA 2WHXA 1RE0A 3C6XA 2Q3JA 4UHCA 3SSOA 4NYJR 4ZV7A 4JT2A 3R20A 1XMOH 4F85A 1FTYA 3ANYB 3BE8A 2XAAA 4FFOA 5J2TF 4Z4IA 1C14A 4W9NC 3MQ2A 4JR2A 2CNBA 4RTLA 2WKQA 2XECA 3ORRA 3CUEF 4NF2A 5AOBA 2VUUA 5AJTA 2IL1A 3WL4A 3T94A 1D1QA 2JLVA 1VJTA 3TMYA 3K35A 4YP9A 3Q41A 3R74A 1HK7A 3AIKA 4H6VA 1TA9A 3DBRB 3GLFB 3NNDA 1PL0A 2LIPA 1XNQB 3WP1B 1T25A 3HYRA 1TEHA 3PF8A 4L2IB 1OXTA 4JHXA 2PUCA 1ZAKA 2DZDA 1XAHA 3TBKA 3TNJA 2ZJAA 4NMWA 4MVYA 5AM3A 4R1NA 3PEYA 1Y9DA 4RWZA 1K83A 4LGVA 2WNSA 2CLOB 2AN9A 1XTIA 2X76A 1G1AA 3OEHD 4YJ3A 1L5GB 1M1ZA 1C8VB 1J7KA 1JBQA 3CNEA 4US1R 4EFEA 3FKSD 4AT1A 1E2GA 1TZJA 3VDXA 4V0OA 3W8FA 2BDUA 1SUIA 2C61A 2QPOA 3ILSA 2IYNA 5EWFA 1ADFA 1M5RA 1K68A 4O33A 3D6TB 4X64B 4G25A 4MUYA 3G0BA 2VQFB 3VR2D 3AWIA 3NBYC 5DMXA 1KYIA 2FWIA 4ZCTA 5BWXA 3PEUA 4CHTA 3ROGA 2JD0A 4QTTB 1KPIA 2V5AA 3GJ8A 5C53B 2JJQA 1GPYA 2VF5X 2FEOA 4Q1VA 3M89A 4LF9B 2BTEA 1GVHA 1JDTA 1WCXA 3WNZA 1AUVA 4JU8A 1I0IA 1BDMA 2ZTVA 4D1YA 1JEYB 3L5KA 3BZWA 5C44G 3C6QA 3TTXA 1FIUA 4PG4A 4RSMA 3MTQA 3ND7A 1SZCA 2EW1A 2YXNA 1RWKA 5CXSA 1G64A 3JQBA 4GP7A 4EJSA 1P1CA 5HZHA 2NQTA 3PENA 3A9VA 5LYJA 2BUBA 4FFNA 5IG2A 4FFMA 3BM5A 4GP6A 3LTEA 5LZ8A 2PU5A 3N8IA 2O6HA 3EGIA 3QLVA 3OOWA 5C4GB 4XUGB 2UZ3A 4Z0HO 3GJ7A 2WEKA 3A3NA 1V95A 3ZGLA 3P4XA 4JI1H 4C6SA 2QUAA 3I32A 3MWEB 2FMTA 2V3VA 3BCSA 1M7BA 1KDYA 2A7QA 2IU0A 3GROA 1OV4A 4G0ZA 2C92A 2PX8A 4LS3A 3WL7A 2CCGA 1K4MA 1UMDA 1KAGA 1VPVA 1IONA 1GARA 4YXWD 1COWA 1KEEB 3DZHA 2F62A 4N0QA 5TSDA 3I9LA 3HOZG 1C30B 3EMDA 5BV7A 2Q1SA 4K9PA 4OY3A 1Y7PA 3COJA 3HVRA 4PTZA 1UMCA 4A03A 1QR2A 2YXLA 1YBMA 2Z5VA 4JJ7A 1NXTA 1YF3A 2OLKA 4UE2A 1PFYA 1PZHA 2FXIA 4B47A 3PUZA 5C3UA 3MAJA 1A8QA 4E51A 2VP2A 3IJPA 3TLYA 4B5LA 5FR9A 2VTEA 1TQDA 1YL5A 3B9QA 1GCIA 2ZPUA 3O9VA 1ZETA 3MJCA 4OB7A 3QEAZ 2HRRA 5DNWA 5F12A 1OFHA 2O3JA 3CG0A 1UXOA 3CSSA 4OQDA 2VKTA 3VHRA 2I4OA 5A5DA 1L6IA 5LL6P 2I80A 1AK1A 4NE2A 4ZZIA 4IVRA 1OMOA 3U7JA 3QZ7A 2Z6AA 1P7CA 2AOTB 1Y9ZA 3VKWA 1KTIA 4R8KA 4CQLA 4QDOA 3JYOA 2BSXA 2VOJA 1PSDA 1WV0A 1GAEO 1QF7A 2PN1A 1HRDA 2FMXA 5E4FA 4AUEA 3BFXA 1ZD3A 2FPIB 3R6LA 4YP0A 2Z04A 4FNMA 4BZXA 4PO8A 4F60A 5EKSA 1G41A 2BJVA 4O7TA 3VBEA 5HDBB 1WSWA 3RAJA 1YHYA 5CX4A 2Q2VA 3K6JA 3HZHA 3ET4A 5AK5A 5KUTA 2YHIB 5FPYA 3FGPA 2UYYA 1Z28A 2EIHA 4QYIB 4Q16A 1PQPA 3TGWA 3D3QA 4FEYA 2BYTA 1ZCZA 4DV0H 1IHYA 4TYYA 4QYXA 3LW8A 2JZOA 2Q5LA 5BQFA 4AKHA 2AG0A 1SXGA 4RLSA 2V6GA 3DTTA 1H4QA 2Z08A 5ICMA 3VO1A 5JJKA 4BZQA 5JYBA 3F49S 1QGYA 4YAOA 2KWIA 3U3JA 2VNAA 4A2AA 1XK5A 4RPIA 3WA7A 1OI2A 1L5YA 4JUCA 1W52X 1T1RA 4NULA 5C8YB 2YRWA 2GN4A 5U9CA 3V5NA 1PYOA 4D97A 1SU4A 1Q95A 1VHLA 2A3RA 1ND6A 1YQUA 3KWJA 2NX2A 4I9FA 4CCSA 3DPSA 2MSNA 4JI6H 4IXNA 3ZKWB 5DW0A 2ADOA 4OAQA 1B6SA 1FFCA 3BD9A 4ZT2A 1UP7A 2XE4A 3NVDA 2PVPA 1CEQA 2M32A 3DBHA 3DQPA 3C70A 3MG9A 5I47A 3LFTA 1KA9H 3PC8A 4ARVA 1L7DA 2BMWA 3MTBA 1N0WA 2WICA 3OPYA 4BMXA 3O3MB 3HCAA 5ULLA 2NVXA 1UWVA 4ECTA 3DKRA 3KQTA 5BOSB 2SKCA 4NTZA 2RONA 1XYGA 1NP3A 4JBHA 1PR9A 4FWBA 5GTDA 2J5XA 3B5IA 3ZWBA 1DBIA 3NXKA 1RWXA 1PLLA 3UVEA 5HG0A 2XZLA 3GDGA 1JXAA 3HUFA 4DVJA 5A71A 1RAIA 2HSWA 3NHPA 1CJSA 1G66A 1Z4JA 2POQX 1NV8A 1SVSA 2RHBA 2W22A 4N3AA 3VZQA 2C2HA 2JNWA 1A8HA 2DBZA 5K7SA 1AV7A 2C4WA 3ORQA 4M8NE 3JZMA 4A9AA 1M8PA 4JLVA 5D1PA 2VBCA 4FMBB 3KAPA 4TYMA 2F3TA 3W5SA 3H4BA 1QORA 1SCAA 3WL5A 1LD3A 1WXEA 3UJ7A 1CU1A 2XB9A 1WVMA 4N9WA 1F2TA 3IVMA 3CXUA 3A4MA 1GN8A 5ADVA 1M1XB 4U2CA 5E25A 1U8YA 1UBEA 3TUZC 4IDCA 2VAMA 1P2SA 1Y80A 3L1IA 2J59A 4ZOEA 5JSYA 3HUDA 2FUNB 4UZSA 4QXRA 4MV1A 3S2ZA 2J6HA 4TXNA 4IM7A 3P9NA 2B8NA 1D8AA 3GZJA 5DM2A 1XNQH 2C83A 4CGZA 4TTSA 3D0QA 4CEIA 3W5JA 5J1SB 1FU7A 4OBWA 5DTRA 3GH3A 3PJGA 2BONA 5BSMA 3HV0A 5DK6A 4EHNA 3OT1A 1Q0UA 1Q0LA 3O47A 1JI0A 1M9NA 4OUDB 2W6PA 4ZAXA 4ENTA 4F71A 2XKBA 4I5EA 2HWUA 3LUDA 3K5HA 1VHJA 2W7OA 1UAGA 4PQEA 3RC3A 3VHLB 1PWXA 2J5KA 3GRYA 3MGAA 3OT5A 3SOPA 1DKOA 5E1BA 4C87A 3OJWA 3ORHA 5AR1A 4RNDB 4KVAA 4JYAB 2JIBA 5KJ6A 1X14A 5ICCA 2ONYA 1YIAA 1JPJA 2FW8A 1HOXA 3MOSA 4JWTA 1UC4B 1PCXA 4YB8B 1YV9A 1UBOS 4HAUA 1VFNA 3CWZA 1T2EA 2PUAA 4N0DA 1R6VA 3TSYA 3IAFA 3O84A 2IWRA 1GCUA 2ZXUA 5JDIC 3GILA 3TVDA 1KFJB 2ARKA 5BSTA 1GGEA 4LJKA 5CAEB 3SJ7A 3QWHA 3ZHVA 1RXVA 1GAQA 3H3XA 1P0MA 2CJFA 3QKIA 1KDZA 4B81A 1K4YA 1D9ZA 1IDOA 4XYMB 2DQ4A 4K6GA 4CLXA 4I3GA 3FRHA 5EEGA 1U4NA 3UCFA 3DTNA 2B1QA 2IH4A 2NLOA 3JQGA 5FD8A 3JQAA 5FLXA 3QKWA 2HMTA 6PFKA 3F4KA 1WHSB 1IU9A 3QPWA 4D45A 3PPYA 4NYIR 4OFBA 3KVOA 1IPHA 1U0TA 1N9GB 2RCNA 4FYKA 2JAUA 2QM8A 4I4IA 3CLVA 1TWCA 2XKKA 2JZCA 3IIKA 1D5CA 4BX8A 3T5KA 1W34A 3FHJA 4KQMA 5GV8A 4Q1BA 3EHEA 2PXXA 2D5CA 3A25A 4AJKA 3T5JA 4CF7A 3I5MA 2PSJA 3CG4A 4Z51A 4LYFA 2GBGA 4E46A 2ID8A 4GBMA 4F4XA 1MHPA 5DXJA 1DEXA 1XLTA 5FBQB 4MEJA 1I2BA 2GILA 3QFTA 2HQOA 2J3IA 2GRAA 3BA9A 4RZRA 3C1AA 4NDZA 4EPWA 1LDEA 1UBLS 5LJLA 3QWBA 1DKRA 4R3WA 3DXYA 1F20A 1GUYA 1QCCA 3B12A 4FX5A 3RABA 2VP9A 4G37A 2G04A 3TR5A 5M7EA 2AOUB 1JHDA 1R3UA 3L1UA 3LDUA 3EXIB 2P41A 3P0RA 1V3UA 1FVHA 4PY2A 3A70A 3LLSA 4QLAA 3QU2A 4E7PA 2V8OA 5DULA 3ZW9A 4M1EA 5HXAA 1XD2B 1B0PA 5CVVA 1ZSNA 4WCFC 3FUVA 4DDHA 3EJ6A 3W7VA 1AU9A 2I78A 3DKVA 1UXHA 3GWGA 1IN6A 1NI4B 2R8IA 4NABA 1L7AA 3UV6A 4HMOA 2PU7A 2LKCA 1PJ8A 4V38A 2B9EA 5FULA 4HN2A 4KP7A 4MB0A 4Y0NA 4DNOA 1QQ7A 3E9CA 5K99A 4W5OA 1KRWA 5AQEA 4YK7A 4D4MA 2YV5A 4JU9A 1YACA 1AA9A 2FWPA 3D4LA 1P91A 5KHAA 2J6IA 4NI5A 1EKVA 3C6ZA 3K0FA 2CWWA 2YWJA 2ZOSA 5BVGA 4M49A 5JDCA 2HHHB 4CM8A 3PIIA 3M2TA 4ZI5A 3HY6A 3W3AA 3AY7A 1NNUA 3PLRA 2QVXX 1B8UA 1NDHA 5JZBA 3MQ4A 2IP4A 4Q00A 2OLEA 1LPAB 1ZS9A 2Y1KA 5DK4A 4YPFA 1AHPA 4PZ8A 1P2UA 1RBYA 5EE5B 3KQOA 1JRLA 1OX4A 3E27A 3BQ9A 2QRVA 1J8DA 4IR1A 2XYPA 5EIFA 5LXTB 7MHTA 3IG0A 2JJ2D 4CCAA 1Q2UA 2VYVD 3R7WB 5P8WA 1SXJC 5LVAA 2ZRPA 5AHRA 2QMEA 1JHMA 4G56A 4OB8A 3VGJA 3IOMA 3QOXA 5ANRB 4XFJA 3TSCA 1C1YA 1KGDA 2PD3A 4GKKB 2G06A 2R4QA 4W82A 4ARZB 4MTLA 4S1OA 3N28A 3ABQB 1DG1G 3FH0A 2OL4A 1JLSA 3D2BA 1RM0A 4DLWA 2RG1A 5K8VA 2QGNA 3ZGXA 3OCVA 5FBRB 2Z09A 1YK1A 3PS9A 2HBRA 3LOUA 2PV0A 2ETVA 4KNVA 1U7ZA 3BJYA 3M6LA 3QFCA 1SH7A 3P2EA 2R84A 3HOWG 1YS9A 5AK3A 3HH8A 3MLEA 1BMQA 1OIXA 3WLPA 4KGDA 1DINA 3I2IA 1LUAA 1EGMB 3QELB 4TWRA 3R75A 3EB9A 2M1ZA 2ZB3A 4MUKA 3I39X 3KOXA 4FDMA 2A0XA 4ED0A 1G5IA 1OPRA 4XPIB 3ZDFA 1D8TA 4ZREA 3ZDEA 4QWMA 4AQYB 3D6JA 4I4NA 3KQYA 4DB4A 1Y1SA 4WLVA 1GNTA 3OPVA 1RC1A 4TKVA 2JLWA 5AVWA 1OXKB 1EFPA 3VR5D 4EG8A 3B51X 4ZWNA 1D4FA 2CNUA 3GT0A 2WP8J 4XSHA 3WGZA 4CM7A 1S89A 3ZVKA 3WHPA 3B60A 5CDUA 3TOCA 3COPA 4EDHA 3DKKA 3EH1A 2BFCB 3M6AA 1TM4E 2BGUA 4WLUA 2EYUA 5DM1A 4ZO7A 3DKIA 2HMSA 4FCWA 4KWTA 3S70A 3RB4A 1UBNA 2YV2A 3PHCA 3KALA 3TFQA 1GUZA 4E1BA 3OZUA 3LM8A 5K3FA 2JIMA 1OHHD 2C9YA 2J0UA 3SQXA 4YV0A 1A1VA 4CE6A 2W9BB 2J85A 3OQPA 4EB6A 1QDUA 3V8EA 1U0NA 1QANA 3ZJVA 2J5RA 4KXYA 4XOUA 2DBYA 2WTFA 1ZESA 3LE8A 4G5GA 4WHMA 2C7GA 1PW5A 2FUG1 4HRVA 2Y0PA 4KXXA 1R15A 3FPFA 1N6IA 3DDNA 3G2LA 3GP3A 4AKIA 4OXNA 2ZIVB 5ALNA 4BLUA 2Y1WA 1YUBA 5ILGA 1LDNA 1JR3D 4YIHA 4EA7A 4U8GA 3PTAA 1H66A 1WLYA 3HABA 2EGUA 5GADl 1BEUB 1Z2EA 1A88A 4DR7B 3VQTA 3WB9A 2FSIA 3HNPA 1C29B 2GA9A 5JJIA 2C42A 1NIJA 2JLCA 3CEJA 2ZZMA 3HWRA 2VJCA 4FT4A 2V7GA 2OYRA 1MORA 3UWDA 5BRNA 3I6QA 5GQSA 4KMMA 1IBLH 4TTTS 3MF4A 2GYUA 4BNKA 4J6FA 4ZO4A 3M4YA 2Z9BA 5IVDA 4DT1A 3GRPA 3ZWDA 5AVKA 4BCCA 4QIWE 3IP6A 4ZQFA 2JARA 5IKPA 2CXRA 3KOUA 4UHDA 4I5FA 3SD7A 4OA8A 3RC8A 4L85A 1A9RA 1J1UA 1U0HC 5E7IA 2P6NA 3P9SA 1AX9A 3AT1A 4EJ2A 2ZJ6A 4MR8A 5A9SB 4IVPA 1HY3A 2OV1A 3LBAA 3PXXA 3FR8A 3ICQB 1IBKB 1M2HA 1ABBA 3CVJA 2GAIA 3JQ7B 2E55A 2XWSA 2QB5A 2FLPA 4LPSA 3PDIA 1II9A 4B40A 2YMPA 3NBUA 1QIGA 1E8MA 1A50B 1YCHA 3ZLTA 2G28A 1U0OC 4YLGA 3M6WA 5KS2A 4F2GA 1FFBA 1JJIA 4PG8A 3MWKA 5FRDA 2AC7A 2HM7A 4C88A 4DA4A 4IOMA 4HBZA 1RVV1 1XPRA 2IV7A 1KO1A 1J2YA 3HU2A 2FWMX 5KWSA 5KJ1A 2ZJFA 4KR6A 1TT7A 4AYXA 2GD2A 5EMMA 3GOHA 1P31A 2FXVA 2Z43A 4TYWA 1AF7A 4L9RA 3M4JA 4HG2A 1R0KA 2G4VA 3HDGA 2FK3A 1Z0SA 2E0IA 4KAJA 1ZXXA 3K6KA 2NXCA 2R2AA 5I7HA 5FD5A 4RS4A 1FEZA 2VSFA 1E9BA 4L72A 2I8LA 3Q8PB 3MT7A 3GIPA 3RAGA 3HGQA 4L7QA 4NLLA 2QK4A 3ELDA 2IYPA 2BKLA 3PNMA 3BIFA 4ZQIA 2J3HA 4NH4A 4YRNA 1D7AA 2B1IA 1TJNA 4YLYA 4CMGA 2Z9CA 4ZI7B 1BOFA 1R6UA 4GEGA 2QYTA 2A9RA 5KG1A 3AVUA 5F9FA 3K0AA 5I4CA 2OORA 1E32A 3PNLA 3E58A 2A0UA 2QUJA 4EM6A 2P9QA 4O2BB 4A26A 5KYGA 1ZXBA 2W9AA 3D2CA 2VJMA 4XYGA 2IX3A 3LYAA 2AFIE 4CFYA 3KBOA 5DSXA 3E9ZA 1J23A 1BN6A 3ABOB 5GOZA 3O0DA 3NHRA 4KRGA 2JFPA 3NIGB 1RNLA 3NJ8A 3VR6H 2Y1LA 5MN4A 2AOWA 4P34A 1JHOA 1IH8A 2NT4A 5LUAA 2GN1A 4RIIA 1AKYA 2PKEA 1QHIA 1NLZA 3AK4A 1NYRA 3EOZA 2FK1A 3TD9A 1A9SA 3IE2A 4G9EA 3PEFA 2D1QA 4C4RA 3HKZE 1UKBA 4AD8A 2G1UA 3W2TA 1NIPA 5K8IA 2AEFA 4S24A 3SVLA 3JV7A 2VBGA 1SURA 3C43A 4QARA 1Z68A 3OF5A 4BO3A 4FGZA 4I8XA 3CO0S 4RVCA 5F9LA 5FTMA 4QXAA 4N8DA 5JQWA 3ZG6A 5FHQA 4MS4A 2C2OA 2L2QA 2IYYA 3USZA 3C3PA 2WZDA 1NTOA 3UFBA 1U2DA 5IK2D 2NU9B 2XUJA 13PKA 1IK4A 4BB6A 3EGCA 4P33A 1WDWB 5J4YA 2I65A 3HZRA 2QD1A 4A5SA 1M2KA 3UB4A 3DEKA 1QYWA 2HU7A 2V6BA 4ZOLF 1Z07A 1XQVA 2Q7OE 3RYIA 3RKUA 4J9RA 3REFA 4IKOA 3ZGVA 3CLRC 5CX1A 1NJ2A 1PKEA 3L0SA 4GKKH 3DQZA 4KHPB 4M46A 1X87A 2ZYUX 3L02A 1G5HA 2V0GA 3VKVA 4OK6A 3GNLA 2G09A 1FFEA 3IVGA 3GAZA 3KTAA 3KEFA 1U9YA 1V41E 3OAAA 4EYHB 4NY1A 2PRYA 1OT5A 4Y2SA 4O4JF 2O9JA 2EJ2A 4F3CA 3WWYA 4KQKA 1SU8A 4URXR 2PUGA 1H2WA 3N39C 3QHAA 3MT8A 4UEQA 1KZ9A 2VOBA 1B6GA 3RADC 1GTRA 4YCNA 3OZ7A 5A4AA 3TIFA 4MGIR 1N2GA 4JJ6A 2IOQA 5KKNB 2F3UA 3O8OA 4IZIA 2VJYA 3WIBA 3A4NA 5E2IA 2WAQA 1VL2A 3LQRA 1UP4A 4MVJG 3G8CA 4TV8B 3FNHA 4WD3A 1O94D 2YJ6A 1FFAA 1I5EA 1PEKE 4JELA 4JC4A 3FLAA 4DXDA 1N2BA 3BGVA 2V98A 5IKMA 4DMUB 4DDMA 2ZQ5A 5IZCC 3WL8A 2FMKA 4AJLA 3NTQA 1SCUB 3QBJA 1ORHA 4H3HB 2XCLA 3DBVO 5KFNA 2J87A 1QE5A 3S1LA 1NA5A 2QMOA 3CH6A 1G8JA 2EWMA 1S9FA 4NP6A 2ZSEA 1KIMA 3D4PA 2CW8A 3M6VA 1E94E 1GQSA 1T1EA 5DCWA 4QDUA 1BXRA 3NCTA 1GD1O 4AJOA 1XMXA 3ZW8A 1IHDA 3WYCA 1MABA 2LTAA 4GE3A 5SZJA 2CEAA 3BA1A 1FQJA 5AVQA 3PWSA 2R751 4LX8A 3EW9A 4KXLA 4DLXA 4EUNA 4LXHA 4XRGA 4RE6A 2ZR0A 3CT4A 2G17A 5LOVA 1DXQA 2ZVPX 3PICA 3JQ9A 1F2UB 3ED5A 4PX5A 1G5TA 2NUTB 2PQMA 3M4XA 5CA1F 3VH1A 5KMGA 3G8AA 2JL1A 4ODIA 4BS9A 4QBHA 2VHCA 2HIMA 4QGFA 1FW6A 4DCOA 1E7MA 5IFKA 2AQ8A 4IDEA 5J58A 3MK31 5T64A 3PZRA 4ITUA 5LM3A 3UZOA 5KQSA 3SE7A 1X2EA 4BQQA 2HU2A 1XROA 1ZEMA 3HDJA 1TAUA 4N54A 1SBQA 5PGMA 3GMTA 4JA0A 5AMXA 4C4YA 2FSHA 3NNSA 4W6QA 4UU0A 1Q14A 4MR7B 2HSZA 2C4VA 4F5DA 2AVNA 3CH5A 3IH5A 5LQRA 3RC9A 2F64A 4QVKA 2ASDA 3OD1A 1OFIA 3QLUC 1Z47A 1YNOA 3FCSB 4ARUA 1RXSA 4QATA 5JAPA 4OP2A 1ISFA 3GQBA 2VHWA 3U09A 2V4ZA 1JQEA 2PL3A 4QBGB 3WJ1A 3DV0B 5EUMA 3CCFA 4XEUA 2XMCA 3HNOA 3W1BA 1K9SA 1KJ9A 2VHTA 1JTEA 2X0RA 4IQ4A 4DSAA 3IBCA 3MB5A 2D0PB 4IH1A 3WIVA 1KK2A 4QWWA 2WG1A 1P74A 4UNQA 2WM3A 3MYRA 1ZIDA 3MS7A 2I3ZA 1K3TA 1Z38A 2OBMA 1VHTA 1SUBA 5K6TA 1RYYA 4OKSA 4GLXA 4KXWA 4B6QA 1G4AE 2XR1A 4KR7A 1IBKH 5B4VA 1KY2A 4MZXA 3MVEA 1MEJA 4L5CA 4UPVA 2D0DA 4G9BA 4YLEA 4ZCPA 3RYHA 4UPEA 5DTIA 2OV8A 1O95D 3E4DA 1RC0A 3RS9A 4YBRA 4WXEA 3NHMA 3M6FA 3KXIA 1OT3A 3OOSA 2FZWA 2RAUA 2KB0A 3VYVA 3PSHA 4P93A 2F8SA 1X1QA 4YAKA 1Z8DA 3E1GA 2VQ6A 1ZVQA 6Q21A 5CHYA 3CKLA 5DG7A 2CCKA 1HKUA 4KIGA 2ZYSA 5DDIP 1KYZA 2R6FA 1CUSA 2QTNA 4S2EA 4HTFA 3E15A 4NBUA 1TEXA 2AN4A 3RUAA 1X1TA 3UH1A 3L49A 2BUCA 1XK7A 4RK0A 5CTJA 4IS2A 5CB0A 2QG9A 3HU3A 3JPYA 3KLOA 4DDKA 1RZRA 4UU1A 3UJ9A 2GCOA 4JUAA 1DAFA 3GIMA 3A27A 3VTKA 1SHZA 3TDKA 2X4LA 5BMVA 5K0FA 4JI1B 4YMTA 2DHCA 5LIRA 3TUIC 3DW3X 1UMKA 3DUFB 2CYBA 1UC9A 4YRAA 1ZMOA 3I6MA 2RI6A 3L0DA 3W9YA 3C3CA 2VSQA 1KI2A 2PZLA 1MEOA 4GL4A 1W25A 1IEQA 3IUNA 5GV7A 3U5ZB 4RD1A 3GV5B 4BP9A 3IB3A 1T3GA 3EUEA 2A0FA 1XCJA 5CDFA 3FPJA 3PZBA 4G4SO 2P6MA 1EG2A 1J5XA 3GUZA 2OFXA 2VYND 2F9LA 3DTVB 2NTEA 4JI7B 4CKEA 3BMOB 1UBUS 1PHRA 3LKZA 1EJBA 1FVOA 1Y8CA 4U7FA 2EDAA 1WULS 4L6AA 1RWPA 3PUHA 4CR6A 5M5BA 1L4HA 4YAEA 3RVLA 3FTEA 1ZNQO 1J1ZA 1O58A 1FLVA 3IIJA 3CYFA 3GLIA 3TGPA 1ZG3A 1J4AA 1U5BA 3HDYA 2P2LA 3AG6A 4MS1A 1DBPA 1E4VA 5D1OB 2QRKA 1FXWA 3PXBA 1N9ZA 2IYLD 4BFWA 2DUJA 3H2IA 3WYGA 2G1JA 2V7QD 1Z83A 4LJ9A 1T91A 2F4VB 1CJTC 2W4QA 5TJHA 1W85A 4S2UA 3F5QA 1CBUA 3FLMA 1R0WA 2W9CA 3OTGA 4ND2A 3WLQA 1DE0A 3WS7A 3BSYA 3T52A 1WSBA 2JA5G 2GFIA 4TSFA 4NATA 3BH0A 3AUKA 4CDMA 3ADBA 3QUQA 3RIXA 3U4AA 4OI0A 2XZOA 5MDHA 3UBMA 3STXA 4P3YA 1PGPA 1C3XA 2FLWA 4C30A 1B73A 4FC7A 5EKXA 3R6WA 3O4FA 3ZOKA 5LKRA 3CR7A 4Y1RB 3V46A 3ZY4A 2L0XA 1KZ7B 4AECA 4AX8A 5IJ9B 1RD4A 2HK9A 4NNJA 5FFFA 5HKBA 3BFVA 5JATA 4ZEVA 1DHRA 1YKSA 1KP3A 3TM4A 1S0MA 2FEXA 3BEOA 1LK0A 2C4TA 4KHPH 1WUKS 4IDDA 4B3BA 3DHNA 4O7ZA 3ETGA 2DTDA 2G5PA 2P2GA 3SZGA 1IPFA 2OO3A 3DZDA 3K4QA 3OJ0A 4ZAYA 4WNCA 3FFAA 2YIJA 3LXUX 1OX6A 3P0IA 3WZ2A 3GJ5A 4YQFA 2W6NA 3AOEA 1RLTA 5AKEA 4QUJA 1E3MA 5ALVA 2UUBH 3T7AA 3WB2A 2P35A 4JLNA 3CA8A 3U3RA 2REQB 4FEGA 3TINA 4Q9KA 2V7VA 3KIPA 4GI7A 3RBDA 2RKOA 4AL4A 2Q9CA 2MSKA 2LKDA 5EPOA 3QRWA 5H81A 1ULTA 3MUOA 3UAVA 1P7VA 5IDVA 4Q3EA 3WRXC 1I1MA 4IILA 4OXKA 5TQ0B 2HOQA 2TRSB 4P81A 2W83A 4BQPA 3AILA 1IPEA 2ZTSA 2R7KA 2FW7A 4MA0A 2FCRA 2GUWA 2ZIFA 2HIAA 3WLTA 1CQJB 3GT7A 2WFLB 4UM9D 1JNXX 4BY9E 3RS8A 3ZGNA 1FP1D 2J6UA 1ZH2A 4C7KA 5KYNA 4ER0A 4PZAA 1GGFA 4EKDA 2IHJA 3M4IA 3ZXXA 4IWXA 3JD2A 1SGWA 1TK3A 2GLXA 4ENVA 5C5DA 5L9XA 2W6CX 4PU0A 3NWEA 4I9UA 1CY4A 2HNBA 3AI3A 2PKCA 4DKJA 3AR9A 1HE3A 2R25B 2JD2A 5AFSA 3VYTB 1IVSA 1I50A 3FLBA 5KFVA 1N2CB 3R9XB 3MRVA 1U2RA 3RF6A 1Y8RA 4L0QA 1KZHA 1EFCA 3G6YA 3K0CA 4ZV4A 4KNWA 4E07A 5EWMA 2R4TA 2O59A 1KI6A 3NXSA 1IOZA 3G8YA 2WD7B 2CXXA 2IYRA 3U55A 3T8YA 2GO1A 5M04A 1GL3A 3O7MA 3OD5A 1A4XA 3THWB 3RREA 2A92A 3DQQA 3O21A 4AZ3B 4ECVA 4LVNA 1YR1A 3CE9A 1S3IA 2JJ1A 3Q7TA 3WB0A 1TQ8A 3GJ6A 3WK8A 1Y81A 4BC0A 1U28C 1MJGM 2J9YB 3ABSB 2JA8G 3BRWD 3JX9A 1YFJA 1Z82A 3U4IA 1U8UA 4XWYA 5LB2A 4LHYA 3WGYA 5CURA 4BO4A 4LE0A 1ZVKA 3BMNB 3Q8MA 5DT2A 3BAZA 1EVZA 1NQTA 1PSZA 3U3XA 3AUTA 2PWPA 3L05A 2C0QA 1HKHA 1LVUA 2IDJA 3VSCA 5KYTA 2F1IA 1GKUB 4R0VA 4TSKA 3CRZA 4HOYA 2QN1A 2XI4A 5BSFA 2B99A 3ISTA 3NOOA 1J6UA 1ULAA 4P08A 3B2QA 421PA 4F9TA 1C9JA 1T43A 1ZYUA 4IR7A 1L7RA 1O9HA 3H4IA 4YTEA 1E3EA 3C4QA 2FGKA 2IYZA 1YA4A 4LK2A 4X85A 3M9NB 5F9MA 4HKTA 2NIPA 4RSHA 1HYBA 4IMRA 1C7EA 3K0KA 2VJQA 1NF2A 2YOGA 1HE2A 3FUTA 1XXHE 3BOSA 3B5EA 3U2QA 1D0VA 2CJXA 5EP1A 5A9TA 1AHHA 1FMFA 3GTMA 1CS4C 4J2TA 3KVNA 4W7SA 1C5KA 5JW6A 2WJAA 1VPLA 2BMFA 3OCUA 1ECPA 2IVZA 3FNFA 3P20A 1P8LA 4D96A 1PFKA 1JLHA 1N57A 4XM1A 4QOGA 1WUIS 2Q1TA 4JR0A 1TM1E 3QW2A 2ZW9A 3PA8A 3EGEA 2XNJA 5C34B 2VHVA 3DDHA 2P68A 4B4VA 3AUYA 3MJVA 1YC5A 2C54A 1T0HB 3PL1A 1QJ4A 2PXAA 1GPUA 3O82A 5EZYF 2IA6A 3EXAA 1KDRA 5AOVA 2FRXA 2GRJA 1H4SA 3WFIA 1DRUA 2RK6A 4IDAA 3WZLA 2GZDA 4DA8A 1XVLA 3TSOA 2XQGA 1PR4A 1YDGA 1JZQA 4HZUB 2UZAA 3WYBA 3LA8A 1W19A 3OC6A 3VKHA 2MU1A 5JMTA 3DB2A 3DC7A 4CODB 4AQ7A 2DQKA 5HRUA 1SUPA 4FEAA 4BNJA 4CRWB 2B7CA 3P9YA 4EF4A 4UCRA 5A04A 3CUUA 3KU4A 4PR3A 4PN7A 2GJ8A 4OQMA 1Z3IX 5JADA 5KX5B 1U9JA 3R24A 4I08A 5DGAA 4J3FA 3MFYA 4WRRA 2VXCA 3EUFA 3ETEA 4KQ2A 1PX2A 1LX7A 1CETA 5A0FA 1DHTA 1NMQA 3IAS6 2NSDA 4JI7H 4AC9A 4RADA 3D1JA 1AXRA 4IIFA 4QECA 1F5NA 1WSAA 4F4IA 3AEQA 4XR4A 5CK4A 3TEJA 3QVGB 2Z8XA 5HE9A 3RGGA 1VTKA 3LQ2A 5E6UB 4Z3DA 4X20B 1E2JA 4IHJB 1IZ8A 2QYOA 4C08A 3AHJA 2HKIA 4QEDA 3R4VA 4FGSA 1KP9A 1Q7BA 4YRPA 1G8MA 2AEMA 2B6HA 1G8GA 3G0GA 5JLAA 2CKMA 3HWSA 2JEJA 2W90A 3I2YX 2F4VH 3VUEA 4GWGA 4EMBA 1H8HA 2IUSA 2WD8A 3QFFA 3CRRA 5KG3A 3ZY5A 2ZQYA 1MA3A 1XCOA 5GAJA 3VR5H 2BW0A 5AVVA 1H2EA 1PI3A 2HYDA 3VU8A 2FHSA 2V97A 2BKUA 2P9CA 3MCUA 2SICE 3RRNA 3O4JA 1R0YA 3W79A 2FLLA 1GKYA 3VMMA 4UE6A 3QUCA 4EKGA 1K5PA 3BJRA 3NTOA 5CT6A 5KFXA 4QREA 3ITEA 1RCUA 1E61A 4RIGA 3TFOA 2Q21A 2WWIA 1CJKC 1J2EA 5NLLA 1C3OA 2GN6A 4DIBA 2QL6A 1YVDA 4I50F 2BM8A 1XPJA 4F8EA 4DR1B 4LCJA 3AQIA 1KEWA 3QGMA 4WASA 4A0FA 2IYQA 2B2NA 2IXAA 5DV9A 1WMSA 1XZQA 2FAXA 1Z7WA 2WB1E 1WD5A 4KPFC 3V7YA 5JCPA 3CISA 6ADHA 3I92A 2Q41A 3I30X 5IMSA 4K9LA 3DZJA 2ONZA 3EZGA 4TV9F 2NACA 5IUJC 3A1EA 4B71A 4L8WB 2VF4X 1KK3A 1ZGJA 3C3YA 5JMOA 1T5SA 5I7VA 1JMKC 3RAPR 4KXUA 4KPUA 1LA2A 3NUAA 2VHUA 3G2JA 3RIGA 2XXJA 1IHPA 2O7NA 5AJZA 1J8YF 1CR1A 2BEUB 3ZQUA 4AP5A 1GPWB 4DXAA 3GLSA 3EDQA 4FBGA 1ZHHA 4QC2A 3R5HA 1S2NA 2ZVQX 4FFPA 2OB2A 4QJIA 3N2NA 3SIPA 3EZXA 1ADBA 1N1DA 3DH0A 3UWSA 2QVBA 5DE3A 5J4KA 2GJ4A 2YNMC 4B9EA 2CVQA 1J9ZA 5KT3A 3SY8A 4DQUA 5ES4B 2JD1A 2XOKD 3OPMA 2KSWA 4RF5A 5JVDF 1M54A 1Q21A 4NBRA 3VZPA 2CLEB 1VGRA 2AH5A 2G1AA 4AUKA 4WBNA 2JEYA 1S2DA 5EWLA 4HUQA 1N0UA 3FWNA 5JCZA 2XTMA 4G5XA 2A30A 2W2QA 2NU8B 4Q7EA 4RGBA 2O0JA 4JZYA 4IAJA 2RGNA 4FQ8A 3NASA 1X9NA 4TTJA 5TT1A 4IDOA 1U8CB 3I61A 2AT1A 3DVAA 3E53A 1E3LA 2PIDA 5DM0A 2HLPA 4FHDA 1HQYE 3FIJA 2OZLA 4NCBA 1RJQA 2G25A 1ZY2A 3BWXA 4EO7A 1WX1A 2DIKA 1E1QD 5HBRB 4M3NA 5AW2A 4ZAVA 1LF0A 4ZMRA 1DCFA 1ZNYA 3Q8RB 3A6HA 4AQDA 1KC3A 5TMEA 5F2KA 2ZP1A 2VP3A 3HKCB 3ZYCA 4KE7A 3IPCA 3E22A 1Z0FA 3K9HA 3L4BC 5B6IA 4DSNA 3I58A 5HIKA 2I76A 3BULA 2HZ7A 4H1UA 1X3LA 1E6LA 2C5LA 1VKZA 1G20A 4QWBA 1CG6A 2O50A 4BVLA 3CTPA 3IC5A 4JNCA 2ZROA 4C6RA 1NU6A 3RG8A 3TXXA 2MSDB 3ZLJA 4NENA 3EC2A 2H3EA 5LYYA 1Z5OA 4Z3OA 1XKXA 5KVQA 3IELA 5DO9A 2Y4NA 4K7JA 2C7QA 4J0JA 5K01A 1IXKA 4POAA 4UMVA 5HZKA 3L43A 3D6NB 4HDAA 1WXQA 3VKGA 3G1UA 3C1OA 5B2ZA 4RAYA 1DJOA 1JHPA 3UICA 2XH8A 4D81A 1FX1A 4NK5A 4Q21A 3TTVA 2JHGA 3JYHA 1SPBS 3F73A 3HL4A 4GFDA 5K0EA 5CDSA 4BTLA 1I4LD 2IITA 5J4HA 5TPZD 2GO7A 3KD3A 5ILOA 2IPMA 2P9GA 4TMVA 5LQCA 1ISPA 3S1AA 1R6BX 1PZMA 1B6RA 2BLNA 1J07A 1W36B 2HW8A 1CUIA 4EI8A 4LMYA 2ZRAA 1TJ4A 1Z8FA 1CE8B 3QMVA 3CU5A 2HUPA 3BL8A 4GKBA 2AVDA 2EFGA 2UVWA 5KNCH 1G21A 1G6HA 2Q7XA 2MYTA 3FMFA 1AHIA 1EH5A 3AQ4A 3NOQA 1YA8A 4YACA 1IBLB 4AK9A 3E9QA 2VHXA 1KERA 2A6PA 1U3WA 4X7PA 4B3FX 1OZFA 2W71A 1SOVA 5IYZF 5A4IS 3Q5EA 4Q8EA 3MCWA 1ESNA 5JQGB 3IERA 5AVUA 2DFNA 1L5FA 2IXEA 5H3CA 2C0PA 1P1JA 1SC3A 4L9AA 3M33A 1MG0A 2PJZA 3PD1A 2XCAA 4DEYA 4YO8A 2FZGA 3HP1A 1SG6A 4GI5A 4ZOCA 1UJ2A 5HCIA 3NGMA 1JILA 1A4IA 1KKUA 1PR6A 1OLXB 3LT1A 2QLBA 3W8EA 3HRIA 4PCAA 2JH3A 3H5AA 4BLOA 2QG4A 3ADOA 4GR5A 1NBME 2Q2UA 4N65A 3ZVMA 3RB6A 1Q1EA 1NKSA 5T4EA 1UPFA 3T5PA 2H5EA 2FR0A 5HE8A 4QGAA 3PC7A 5JCJA 2BR5A 3O8QB 4G8BA 3JWHA 4IJUA 2YWDA 4AJPA 4F86A 2Z6VA 1T8WA 1VCNA 3GZNA 4R2IA 1Z75A 3VA7A 3WQRA 3D8UA 5DNUA 1T9GS 2JDIA 3OTWA 3PJEA 2GFHA 4AIRA 3H8JA 4H59A 3G82C 1K9VF 2WUFA 2R4UA 5EXPA 1W94A 3ON5A 3RNLA 5I9SA 4O3RA 2YRFA 4MO9A 3U3ZA 5KO2A 3K7EA 2HQRA 1ZGCA 5C52B 3L7JA 2FYTA 4PXAA 1BH6A 2PKXA 1ONNA 4AB1A 1K8YB 1YQGA 4KQEA 3Q3HA 3K1ZA 4FPXA 5HK9A 1DARA 2VP0A 3GLGE 2O1SA 2CJWA 3NTVA 4K6CA 1SK9A 2D5IA 3U37A 4OATA 4F4FA 5T6MA 3GCWA 1H0SA 4CTMA 1A69A 1U4SA 3A6KA 4OGWA 2YS6A 4WOCA 5DN6D 4F8YA 4II3A 3KSAC 1IXRC 2F17A 4II7A 1XT6A 5ECYA 4Q4DA 2Y3IA 5A03A 3VH3A 2ZR9A 4BLTA 4BJHB 5WRFA 3IESA 3IN5A 2GYVA 3BXFA 1IHUA 1RYRA 4EJ6A 4D98A 1PJRA 3A04A 4XB6B 4M1SA 4KLRA 2G9QA 1UDRA 1U9IC 2A9PA 3FMPB 4DZTA 5K6AC 2QDKA 2AHOA 3SM9A 4BXOA 2HEIA 1AZSC 3ROFA 1QAOA 2VUHB 3EVEA 1D6JA 1F48A 1I3MA 3CB4A 3T3DA 4JUIA 3ZD6A 3B89A 3L6UA 1Q50A 2CLFB 2XADA 1V4YA 5BN3A 5LBUA 4N76A 1A71A 3HKDA 1N0IA 3QK7A 3CVOA 2H52A 1K1QA 3M6MD 1VLJA 1GAJA 1EK1A 5DTJA 2J0QA 4DR1H 5AM0A 2YQ4A 3F96A 4QUGA 2XGGA 3QVMA 1RAAA 3TCNA 2WPDA 3QE2A 1YQEA 2AW5A 4EY7A 1LNQA 1NGSA 3ABRB 4AMZA 3HU1A 1L4BA 5CDYA 4MRMA 5KEIA 4NH0A 4XQ0A 1XYYA 3IEIA 5JTUA 4DRFA 1CLEA 2OY0A 1UBSB 1T5OA 3CPHA 3TW7A 4O5OA 2CMGA 2ACKA 4MXDA 2JBHA 2O05A 5IRCD 2J4DA 4B3RB 2QVGA 3LIIA 3UN1A 4BP1A 4LJ4A 2DQZA 4H3SA 2QR5A 2DUUA 4JBNA 3ZX4A 4BX2A 3HXKA 2YXDA 3PXUA 5KTOA 4OBEA 4LHEA 5EG5A 3NWPA 1JIQA 2JIDA 1K97A 3I1IA 3AEXA 2GMWA 5FLXW 4B1FA 4TLAA 3KYDA 1U8XX 3HC7A 1PYDA 3NI2A 1P45A 1UDAA 1MOPA 3GB9A 4UCWA 2B4RO 2QTWB 1LK5A 1EGAA 4QZVA 4Q9NA 4LHWA 3BDVA 1MH9A 5D5PA 5HKAA 5FTWA 4MGHA 5AKLA 2DULA 5GPBA 1SD5A 1G7SA 3GL9A 4HB0A 5LDGA 2UXCB 3CURA 3RYTC 2DWCA 4NOKA 1SR8A 2VPPA 3H1PA 2VSOA 5LN1A 5A0VA 4BKRA 2X6QA 1NY6A 2E5WA 4DQNA 1X7YB 5CITA 2W2XA 3DL0A 5KJFA 4DLLA 4XM2A 1LF5A 1GGNA 2WM8A 4PPNA 3UV3A 3GHYA 1HYHA 4M87A 3OZVA 4DNQA 3ULKA 5DM4A 5C8XA 4J9SA 1IUOA 3THYB 2GM4A 4ZPJA 5M29A 2QTTA 2HHLA 2VDJA 1U1DA 4IZHA 5KFZA 1M10A 4O5AA 4YRFA 4DGSA 2PX2A 3CIFA 1XMQH 2CD9A 4L08A 3H5TA 5A7HA 3OLVA 1A97A 1JG3A 1IN4A 3H4MA 1W4BA 1YZYA 3AFOA 1O5IA 4U3JB 4EZBA 1FFSA 4C1NA 1YIOA 2ZJTA 2WYWA 3NIDB 4U2GA 4WADA 4DRXB 3QY0A 2CLDX 5JXHA 4CMIA 4NCAA 3HWX1 1U0JA 1ZSVA 2OHXA 2BY4A 3TAHA 2ZREA 1Y4DE 4KRXA 4JLDA 2R8EA 5L7TA 1TWFA 2RC5A 1V37A 4RGVA 2COEA 1O96A 1DUSA 3EWAA 1CKNB 3OICA 3DEIA 2PZBA 5F3WB 2HVQA 2XUGA 1FYXA 3FHCB 1DAHA 5EIBC 1PZEA 1CDEA 1LQUA 1I10A 4YHHB 2E3JA 1M2OB 4O4IA 4D9FA 2HXYA 4NFHA 1PT7A 1TVKB 5DRYA 3I4MG 3A9UA 1IZYA 2B1JA 2CJPA 5KZMB 4MIKA 3DV2A 3W1VA 1XZHA 4NBTA 3LQ1A 1J25A 2GASA 2OAQ1 3SWWA 2BQUA 2IYVA 5KYXA 3PXCX 2H1CA 3DF7A 1TDJA 3SX0A 2AD5A 2JA7G 3D7NA 2QMHA 1TKBA 3I2HA 5CDHA 1AOXA 2WHPA 1Z7EA 1G19A 1WXGA 1W5AA 5FBLB 5DGXA 3CZPA 1UK6A 3N70A 4WZAA 3TW8B 4RA9A 4K88A 5EERA 1UAAA 3MJRA 2FJ0A 3R0IA 1SKYB 2C8LA 4MDHA 2DB3A 3PKZA 4WKNA 1AXEA 4IGEA 1IMOA 5L3SA 3QX7A 2VDVE 2WG2A 5FV7A 2GZ2A 1GUDA 2OD2A 1UJCA 4MQFA 3ZXYA 1HDIA 4TRNA 1WCIA 3H2ZA 1ILEA 3UIEA 1N5JA 2W00A 5I45A 4F5EA 4KQIA 2GF9A 1VZ2A 5CA0B 2COJA 5IDQA 1TUBA 3SHWA 3LDFA 4D4LA 1NZJA 1WDLA 4GMDA 2X8JA 4AMBA 2YVKA 2BR4A 3MEQA 4I55A 3FJYA 4RV9A 3HZOA 4TLMB 2AU0A 4UOQA 4GO1A 3GMSA 5DG8A 1AZLA 1Q20A 1E5QA 1S8FA 3BWDD 4PLYA 4N82A 2Y1GA 1VE9A 2EQBA 2O1WA 4OP1A 3KR2A 4JOCA 5IWCA 2M6LA 4X95A 4FNAA 1MB0A 3ZGYA 1RPAA 2VPIA 1WHTA 1TMKA 1K6EA 5BNZA 1DRJA 3FMGA 1BSVA 1QIJA 3ERCA 3PG5A 3Q1KA 2OLJA 4TXJA 4D2IA 1NDQA 1VMDA 3C85A 3WK4A 4GZ6A 1EFRD 1PT8A 2OGSA 4CN8A 4NFSA 2EG5A 3KNZA 3IQHX 3NHLA 3KJEA 3VM6A 3K92A 3JQ6A 4N3NA 1N3BA 1MPTA 2JLYA 2ZWAA 3ESZA 1QIKA 3ZCXA 5BMOA 1XCGB 4KG7A 5B1EA 4F06A 4CF6A 1LZKA 1WDKA 2JHFA 3OKAA 1ONOA 4R81A 2F43B 1Y5IA 1Y7LA 2VFAA 4JJKA 2R66A 4NZPA 3ZV4A 4CG2A 3L7OA 3SLGA 5G53C 2QZPA 3QVXA 4PLWA 3TLMA 3I23A 3A8TA 4Q3KA 1JFSA 1VLZA 2WWRA 2EIYA 4IGIA 3RJZA 3K70C 3H97A 1MMFB 4GG1A 3T7DA 1E60A 2GVNA 4LJYA 2ODWA 3D6VA 4IJ5A 1FUIA 1T3NA 1H5NA 4G1CA 3RFCA 3TDMA 2GTPA 1X15A 1J8VA 3OQHA 3ZE0B 5KTMA 4LZWA 4DMRA 1BZYA 4KE8A 4QDJA 4AS2A 1A76A 1GPNA 4HR7A 2VP5A 1MOSA 1HGXA 4YJHB 3EEIA 4QTXA 3JQCA 3E3MA 5EZSA 4F2WA 3KXDA 4J9MA 3JATB 1LTQA 2H0QA 4JQYA 3ICOA 1GYPA 2D00A 1EUQA 3MAAC 2XYGA 4NJMB 2XZTA 1P39A 2DETA 2B9VA 3BBPA 4BTVA 1FMCA 4MV5A 1CUCA 1E5VA 4UASA 3N3BC 4BDSA 1K2WA 2ZZNA 3MW8A 5C18A 2QAJA 4HQKA 2JFUA 4EJFA 3GW8A 4TL9A 5KC8A 5IJ0B 3H7IA 1V2GA 2KI5A 4AZ0B 2KHZA 4JQCA 4M7PA 1GL6A 1JHXA 3B3FA 4ISBA 3MTJA 1ZGAA 2WWVD 2HHJA 3WWHA 1LZLA 5B3JC 4HDRA 2IBTA 1ODLA 3AHDA 5DGHA 3F90A 4B3RH 2ZJYA 4RQUA 4LYJA 2I3AA 1Y4ZA 1ISIA 4AULA 2QSZA 5ARBA 1DKLA 3UPTA 2JGDA 4BFTA 1KI1A 2H1WA 5DASA 4ZOQI 2PLFA 2G7MC 3DL2A 3T9FA 2COIA 3PFCA 3O73A 2V7UA 1E6EA 2FTKE 1YE8A 2F1OA 2V7PA 4KITB 1AK2A 3P32A 3CPJB 3G5LA 4UUOA 3EF3A 4JBYA 4M6WB 4G85A 2QN2A 5I5EA 1R2QA 1KR2A 3M4NA 2D7DA 3WO1A 4MUXA 2UUBB 1OREA 3K9GA 1MRSA 5KS8A 2UXCH 2QLJA 4JLWA 2FFQA 4BWYA 5TJ9A 9ATCA 4LTDA 1NUSA 4M9ZA 2LE0A 2P27A 1QIMA 2G6BA 5FPKA 5IBQA 4Q82A 3FKQA 2CXNA 5C0OE 4TMTA 1G8FA 1Y1PA 3UG6A 1AZTA 2I99A 3EPHA 5EAIA 4IRDA 1EP1B 1A72A 4E2FA 2GEVA 4L75A 1P2BA 4XASA 1ZCBA 1PU2A 1KZGB 6AT1A 4K6FA 3OOJA 3ME5A 4M0PA 4EPRA 2B5OA 4ALNA 2H63A 2W7TA 4Z1MD 5HM6A 2R6CA 5JSQA 3DMGA 4I4TF 1I4WA 4LOAA 1N5MA 1MXFA 2JAPA 3C5CA 1UDXA 3BIXA 1K7XB 2O8NA 3JWJA 1IWPB 4G81A 4KLNA 2R8RA 2W93A 2NAPA 1XWFA 4ND6A 3TCXB 1I7NA 1EM8A 4M0JA 3AGQA 2IHKA 2QROA 2IUTA 4HFMA 1PUIA 4M54A 5A9RA 5JS2A 2ZUVA 2GJ9A 3C98A 1KSHA 2DKNA 2QNBA 5IBCA 4JQSA 1NL3A 1GJRA 4LZAA 3N2EA 2NYUA 3BWVA 1O9GA 4JV2A 2WP0A 3R3SA 4G3IA 1DELA 4N12A 3E23A 2CHVA 3H0KA 3OX3A 2HJ9A 4D3FA 2NTJA 1WNFA 4ECEA 4HQLA 2PUWA 2O2CA 1WDMA 4TKLA 3PW5A 1J90A 3C45A 1BW9A 4DGQA 4GSYA 4YHHH 2VYQA 4EARA 1UDWA 2BEJA 1W0KD 4OX9Y 2DHRA 5JYDA 4OFZA 2Q1WA 5EIOA 2X4GA 3PXGA 1BD3A 4KHZA 1CUWA 3TNYA 4KMOA 4FHZA 4FIDA 2MHCA 2B1RA 4I1PA 4JX8A 4FOPA 1A3CA 1T0BA 2QZ4A 3AIOA 4I3HA 1GZHB 3CRQA 5IVPA 4D0SA 4V2IA 4S04A 1K4KA 3LQ4A 2IQIA 2GN8A 3OJFA 4DR5H 1USWA 4XX0A 4FYJA 3FPAA 2L82A 1KYTA 2YJNA 1XZLA 1MC5A 1CR4A 5JU6A 2UVDA 3E7XA 2JCBA 3I76A 4QRIA 4BN0A 4KO3S 4IHAA 4RCNA 1FFXA 3ZCRA 5T41A 1C3EA 3NQ41 2F2TA 1QH0A 1SBTA 4Y1FA 3B2NA 4JCCA 2Y4OA 2EIXA 3NOVA 4I8DA 5H3HA 1PWHA 1K6MA 1QYXA 3AZOA 2Q0QA 1HDOA 3D1VA 4LKRA 3E61A 3SKXA 4O4LA 2VK4A 4M0MA 4DC9A 4RDIA 3EXG1 2QUKA 3UK0A 1UJBA 5DISC 2X0SA 4FOTA 1RRPA 1P80A 1WBBA 2FUCA 2ROQA 4EYOA 1RE1A 2WUGA 4O4HF 4WKGA 1N32B 5JAMA 3GDWA 1X9IA 5FORA 3ZDBA 1QFZA 4Q0MA 4WGGA 5TQVA 1S4QA 3B85A 4P80A 5JAOA 1ZWKA 2OV4A 3IP7A 3FCEA 4OI2A 4Q4JB 2ZAIA 2GJAA 3O3OB 1DIBA 1J21A 4R4JA 4HSGA 3AETA 1CVIA 4EHIA 4EB8A 3M5WA 2WIGA 3EGOA 4QDTA 1Z7YA 1YS2X 2BHSA 2RDIA 2R5FA 3BQ2A 2E2IA 2AF3C 2DFTA 3AUFA 2VPQA 3NT5A 2X0EA 1F4LA 4GHWA 3TNFA 3UYLA 5K8UA 1AG9A 1OKKD 4TVSA 4MVJA 2RB4A 3H8SA 1JFFB 4CU5A 2Y1DA 1T4CB 4RVNA 3F71A 1B26A 1QOQB 1HLGA 5CB8A 2VWGA 4X1IA 4R5HA 3RIHA 4B4UA 2PTGA 3Q40A 1YJ8A 5BSUA 3WKAA 4BVGA 2UVUA 2Z2ZA 2ORIA 2XVAA 1W7AA 2WJ3A 1XTBA 1S1CA 2A1UB 4WEQA 2FP4B 4FVTA 4OGKA 1NSFA 1HDYA 4O0MA 1YBAA 2HL6A 5FA6A 1XCMA 2C5SA 3N8GA 3I83A 2EQ5A 4LNHA 5TF4A 1KR5A 2XAUA 3LHDA 4PGFA 1YTLA 4KAFA 1G2IA 2B7BA 1KYQA 4E5KA 3GMIA 1S02A 5DXAA 4EGAA 2BP7B 2Y66A 4NBWA 2PQ6A 1N5DA 4O7WA 1RQNA 4MARA 4PZLA 2F6RA 4P5PA 5FPHA 2GCPA 3LWDA 3G2OA 4FSXA 1X9GA 3DCJA 4ZO9A 3FMOB 4UTRA 2D1YA 5DLFA 1CRZA 1H3FA 2YV3A 2VSYA 1N48A 4PSKA 1VXRA 1FDSA 4FDTA 3IAS1 1VZ3A