1EUDB

Crystal structure of phosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
393
Chain Sequence
MVNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKARELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
total genus 131
structure length 393
sequence length 395
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1eudB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1eudB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eudB03
2PN1A 3NUAA 2YV1A 5JQGF 2R6FA 4IZOA 4L1KA 2I87A 1EUCA 5C8YF 4WBNF 1JDEA 4YAKB 3K3PA 5C1PA 4FFPA 4YBZA 3K5HA 3LWBA 2YW2A 1VBGA 5CA1F 2R7NA 3HBLA 2Z04A 4HR7A 3N6RA 5LP6F 3TIGA 5KX5F 2Z02A 1T36A 1KJ8A 5J2TF 4C5BA 3WNZA 2NU6A 2I80A 4I55F 5HBRB 3JZFA 3ORRA 2FPPA 3AX6A 2C00A 2CZGA 2NU7A 4O4HF 3V4SA 5CAEB 3SE7A 1CE8A 2V58A 1SCUA 1EUDB 4EGQA 2R7LA 4WD3A 4ZHQF 3DF7A 3N8DA 4O7TA 1I7NA 2FPGB 5FNVF 3VPDA 4NYEA 3MWDA 2WYOA 5HV6A 5BMVF 4RZQA 3KALA 3WO1A 2FP4A 2X0SA 4EG0A 4ZOLF 4Y8VB 4O84A 1GSAA 4TV8F 3TIIA 4XYLA 2NUAB 2R85A 2VR1A 3KAJA 1M0TA 2ZDQA 2CNUA 1DV1A 2FB9A 1DV2A 2SCUA 3U9TA 4MAMA 1GSOA 2FPPB 5JH7F 3BG5A 5LXTF 3U55A 1CQIB 5IYZF 4FFMA 3VOTA 1JDBB 4QSHA 3PFFA 3R9RA 2YRWA 1AUVA 4FFRA 1A48A 5LA6F 2YZLA 1UC9A 4XYLB 1OBGA 3TW6A 4YAJB 3AW8A 1B6RA 3E5NA 3G8CA 1PX2A 4I4TF 3RV3A 3OUZA 2V5AA 4MV1A 4XZ3B 4FU0A 3VA7A 3V4ZA 2NU8B 2FPIB 2YZNA 4E4TA 3KREA 5LOVF 1W96A 2YL2A 1E4EA 2DZDA 2ZDGA 2YS6A 4MV9A 3TQTA 3VPCA 2ZDHA 5CA0F 2W6ZA 5JVLA 4IWXA 1W93A 4Y8VA 1DIKA 2DLNA 1B6SA 2NU7B 2R7MA 2R87A 3U54A 5H80A 2NU8A 5J2UF 2XCLA 2W71A 2FPGA 3R23A 2NUAA 1GLVA 1M0WA 4HQ6A 4MV6A 2W6QA 3MJFA 1Z2PX 3UFXB 2R82A 2HJWA 2V59A 2YYAA 2YZGA 3I12A 3K5IA 4M9UA 5JQWA 2W6PA 1KBLA 2CNVA 3GLKA 4DIMA 4FFOA 2XD4A 3JZIA 4IHJF 4O7ZA 4XZ3A 3ORQA 1JKJB 1KUTA 2R84A 3R5FA 2YV2A 4DLKA 4O4JF 1JLLB 3Q1KA 1KEEA 3VPBA 3RFCA 2YRXA 3MWEA 4YBZB 2GQSA 2FPIA 4YJ3F 3VMMA 2IP4A 2PVPA 4O7SA 4C5AA 2PBZA 3JRXA 1IOVA 2VPQA 5DMXA 2NU9A 1OBDA 1CS0A 1EYZA 4O7VA 1PK8A 4O7WA 3MWDB 4O2AF 4O4IF 1BXRA 4FGRA 5HBRA 4O81A 5EZYF 4TUYF 3KAKA 4YJ2F 1Z2OX 1ULZA 1IOWA 3LP8A 4MV4A 1SCUB 1KJ9A 2J9GA 5C1OA 4FFLA 4O83A 5CAEA 3GIDA 3Q2OA 1EUCB 4O7RA 5CB4F 4XX0A 1EZ1A 1GGOA 1JLLA 1BNCA 3U9SA 3UFXA 1WR2A 2YWVA 2NU6B 4ME6A 4YAKA 4EGJA 3MWEB 4XYMA 2W70A 1GSHA 1KC7A 4O82A 3HB9A 2GPWA 2I8CA 3R5XA 3ETJA 2NU9B 1M6VA 3DMYA 4C5CA 2GQRA 2DIKA 2R86A 2SCUB 1OI7A 4YB8A 4ZI7F 4O4LF 3OUUA 4ZQIA 1EHIA 4TV9F 2QK4A 5JVDF 1Z2NX 5K2MA 4MV8A 4MA5A 4MA0A 1UC8A 4FFNA 2HGSA 2CSUA 5LYJF 2YS7A 3G8DA 3RV4A 1CQIA 1VBHA 3JRWA 1C3OA 1JKJA 3RUPA 2CNQA 1E4EB 3ETHA 2DWCA 4HNUA 4I50F 2W6MA 4YAJA 1KJQA 2YZMA 4O7NA 4O86A 4XX0B 2FP4B 5I47A 4MV3A 4O7YA 1CQJB 5BPHA 3QFFA 1CQJA 4HNTA 4XYMB 2GLTA 2QF7A 2R7KA 5KKNB 3R5HA 1AUXA 1A9XA 1KJIA 2VQDA 2OLSA 2W6OA 2GPSA 1EUDA 3WO0A 3HO8A 1VKZA 2P0AA 5GONF 1KJJA 4O2BF 5BPFA 3TINA 1I7LA 4O7LA 4MV7A 1C30A 4YB8B 4IWYA 4FE2A 2CQYA 2W6NA 5D8DA 4HNVA 4IIJF
chains in the Genus database with same CATH superfamily
2PN1A 3EQ8A 4PAQA 3P9PA 1J8MF 4ZO4A 5A05A 2BIFA 2FHPA 4DYHA 4ZHQA 1C3VA 3Q72A 4KLNA 3CN7A 1P7CA 5IJ9B 4BO3A 3R3VA 2AGPA 4YJ2A 4GLFA 4B4OA 4IKOA 5CBKA 3D3NA 1ZVVA 3ZW8A 2XPCA 3PRHA 3UGTA 4DM3A 4UDNA 2AMYA 4ESHA 4C76A 3WSTA 4ZZIA 2O19A 2PD6A 2UZ1B 2ZE5A 1OAAA 3DEFA 4TTPA 4Z2AA 1NVKA 4GOLD 2MSEB 2VJAA 4JGBA 3RSFA 5CUQA 3TZEA 3GUCA 1MX1A 5FOWA 1EVZA 1IK6A 2P77A 1YMUA 1IEXA 4HOYA 4NYIQ 1HNXB 7MHTA 1O89A 1A88A 3V8BA 4LDPA 4LNUA 3R3XA 3BAFA 2IA5A 4U9HS 1O75A 4DCPA 5I7OA 3Q9NA 4G4SP 4HDMB 1J1ZA 1K9VF 3F4BA 3KZMA 4M76B 2CNWD 1P7YA 1C0KA 1NNUA 4XQCA 3OA0A 1W36B 1OFGA 5CYFA 1NX9A 1CKEA 3OZEA 4K0KH 2M9MA 1NR7A 1O3YA 1SH7A 2HEGA 2NVWA 1MORA 2XEDA 3BGSA 3MINB 4GI2A 1OTHA 1RXSA 1Y5LA 4IGKA 3VFDA 1D1TA 3ID6C 3L84A 4BDSA 2IHYA 1Y89A 2VOEA 2Z8ZA 4QFMA 1CC1S 1Q16A 3NVDA 1V3TA 1LDNA 2GJ4A 3WY9A 2I9PA 2G25A 2Z4SA 2X1VA 4W4TA 1N8KA 3KOOA 1KZ4A 1P7VA 2PWAA 1XTUA 1CX9B 3AUXA 1VFNA 1E6UA 1ZJWA 1Y3IA 4WWHA 1HUQA 5HBRB 1FMTA 2A6PA 4JI6H 4K88A 1NXQA 3GRKA 4UNSA 3KFVA 5IC6A 4IWNA 2PZFA 4S1PA 4XVUA 3AFOA 1I6MA 2BBWA 5EXXA 1ZH8A 4DF3A 2BKXA 3GIMA 4WNIA 2EF1A 1QIJA 4R2JA 4YAGA 4DDUA 3BWDD 4O3NA 1F20A 4YYEA 1R7RA 3G3EA 1UPFA 4KAJA 2K7ZA 4JT8A 4QRDA 3NTOA 5BWTA 4TV9A 1TQ2A 3JQ6A 1BVHA 4E13A 3AIOA 4H6VA 1SCUA 1NKVA 1M6YA 1ENZA 1NQXA 1OFVA 1X92A 1BVUA 2H4ZA 2I4OA 5EG5A 4DA7A 2GN6A 3A9SA 2FQXA 3WE7A 1NVBA 6YASA 2CDAA 1E5DA 1SNYA 1M67A 1P91A 2GXQA 3DTVD 3UV7A 1GTMA 1DJQA 1MT0A 1ZONA 4O7TA 1VP9A 2QPOA 2ZRPA 2Z8YA 2I3ZA 2M6LA 2PYDA 3GLHB 1IYZA 1ESNA 3VZBA 4KQ2A 3COPA 1X38A 4MRSA 4QO8A 1C9MA 1LJ8A 4PXAA 4DZRA 1BWRA 4HWRA 4LV5B 1MJHA 3F71A 3M5DA 1C3XA 2X3FA 4EG1A 3EZ9A 1REQA 2FPXA 2OBBA 4JIMA 2Q4DA 1FP6A 1L9KA 4LISA 2YUIA 2GF9A 4QDUA 3VI4B 1SZJG 2GYYA 4RXTA 3ZDEA 3ZHXA 1AF7A 5A5FA 1DAHA 2OGTA 1JTEA 4JSTA 1TQ8A 2IIQA 4PLVA 1EUZA 3V32A 3OM0A 1X3LA 3A3PA 2VYFA 1JP7A 1XXHA 2A0UA 3G0DA 4DV2H 4HG2A 2D7DA 3KEGA 4OJQA 4C4ZA 1JLRA 2AZMA 1AKTA 2IJGX 2QTMA 1BGWA 3RBDA 2ZI4A 5AW5A 5LYJB 2BFEB 1Q15A 1XYVA 3A2MA 2A9OA 1GSIA 2YHUA 5IJXA 2GEBA 4A0GA 3ZS8A 2NXWA 4ECEA 4YK7A 3LT2A 4Q47A 2C98A 3WK5A 2PVCA 4J9QA 3TIIA 4IJMA 1VE3A 3BREA 2ZJYA 3QQ5A 5HK9A 4CJXA 4M0KA 4A3GG 4Y2QA 1RRGA 5K05A 1YDMA 5CIYA 2VLIA 3JVIA 2ORYA 3AF5A 2GYVA 4RXMA 4A0HA 5KTRA 2RGYA 3AEUA 1O9BA 4Q3AA 1E77A 1FOEB 2Q8PA 3OZWA 4F4WA 1O6GA 3MJDA 5GOZA 3WGIA 3EXAA 1Y4UA 4H08A 3HACA 2I65A 2CLIB 2JIPA 4L9SA 4CM4B 3IP5A 4V24A 1R37A 4PX2A 3TOSA 5AOBA 1VHLA 1YOVA 3TTXA 3THWB 1H6AA 1E7YA 1FP2A 1GKLA 1UH5A 4ALKA 2YQ4A 4RH1A 1UKVY 1W85B 1FK8A 3T3NA 2O3QA 4ZICA 3PIIA 1ZUIA 4CIBA 1K6MA 2XUDA 3ELDA 3OLXA 3EDCA 4L9RA 1Z5UA 4G0WA 1EPUA 1KKLA 2C57A 2PZEA 4JOSA 3TUIC 1RKVA 1J2YA 2HK7A 3SX2A 1I4OA 2WYIA 3B1WA 1F0YA 1P72A 4EY5A 5EJ9A 1GEEA 4B7CA 2V9CA 1G3RA 1YCGA 4QWBA 4LC0A 4WN3A 5EWLB 3C3WA 3HEAA 1KARA 4RSHA 4PO1A 3IIMA 5I9SA 3EAQA 4X1IA 3NZEA 3NHSA 3Q8MA 3IODA 3VVBA 3BE8A 2YFQA 4PCVA 4E2FA 5CVEA 3IT2A 5LC1A 3UF0A 4W5HA 2P3QA 2IUUA 1JFRA 3AONB 2G9UA 4MP8A 4NYJR 1V4VA 3IO3A 3JQEA 2IVZA 3E8SA 5M29A 1O95A 1RLJA 2O3SA 3WLQA 4JQCA 4BUJA 5KFVA 1PGQA 4YRKA 1M1YA 4FIZA 2OO5A 4C4YA 3V80A 3TSZA 4WN9A 4NKRA 3EDRA 4DDTA 1OH5A 4DADA 4AQ7A 3M34A 2H6EA 3HCRA 4X6UA 1ZU5A 3SJBA 4F2HA 5KFBA 2XMPA 3I1FA 2GZRA 3PU6A 2QBYA 3EMKA 3EFOB 1XX6A 3FH0A 4RVFA 2PVSA 2XOXA 5IJ9A 1OC2A 2GVZC 2WAXA 1DQRA 4O3OA 3E0XA 5JPCA 3KPJA 1Z3CA 1PEAA 1UPBA 5B58T 1MG5A 4GYKA 1ULUA 2QQGA 4RY2A 5DKFA 4P54A 5KNBA 4P92A 1NIPA 3AU9A 5AOAA 3R24A 2YHIA 1YE8A 1JLSA 1EX7A 1ESMA 5CDHA 2P2CA 2X0NA 1I9GA 1GHTA 4V03A 1ODCA 5KJ6A 1EX6A 3O6VA 5AK4A 3S70A 3BCRA 2VBFA 3W1GA 3NFRA 3OZIA 4E2ZA 3INGA 2IELA 4PGAA 4C4TA 2E89A 4GUDA 4S05A 3HXOA 4M54A 1AUQA 3BJZA 2QBYB 3ER8A 4WOJA 2F1HA 2PMZE 4LCJA 3ZU3A 4F4ZA 1P2BA 2RH9B 3TLBA 5IMSA 3UMYA 3MWLA 4RTLA 4CKBB 1SN7A 3NVMB 3GBVA 1ULTA 2BAGA 4LE1A 4LRYA 5BR1A 2XXAA 3LC7O 3FUXA 3OEYA 2FN3A 4LA4A 4V0OA 5CGZA 2V3WA 4F3CA 3G85A 4QREA 2JDID 5I5TA 1E2FA 4M38A 5GY7A 1OXMA 3M81A 2HHAA 1Z6QA 3QU7A 4DGQA 3KZVA 1NULA 3LBAA 4YXWA 3BX1A 3C6YA 3VUEA 2C7PA 1O94C 3FKSA 1ISSA 2QRVB 3VJLA 2O1SA 2BR5A 3SBEA 1LWOA 3I12A 3IP9A 4J7XA 2Z98A 1XCOA 3B52X 1SOMA 5D84A 5FBQB 3UQZA 2OHFA 4AQDA 1MVOA 4B09A 5JQWA 3QOYA 2FCRA 2KYRA 3WLSA 1IQ0A 3B1JA 2HLNA 3ISVA 3AM1A 1G20E 4CBVA 1F2DA 1TUIA 2V7BA 3NHBA 5ER6A 8ADHA 5I5GA 1TTHA 3LY7A 4NECA 2APJA 5PNTA 1D4AA 3WMEA 4FUTA 1U4OA 1EFDN 3R5FA 1KYYA 2BM8A 2VUSA 4IFIA 8ABPA 1BW9A 1R6AA 4WNAB 2ZRNA 3ZIAA 4MQ6A 1E6LA 1K66A 3VNBA 3EEOA 1BYIA 4RFVA 3CWQA 5B7QA 1SKYB 4QWMA 3MOIA 4F21A 1MD9A 1H5NA 1YBMA 5TDHA 1JPVA 4X44A 3SMQA 3CVXA 4L28A 1ISGA 2VNAA 2ZB2A 4KFCA 2DKNA 2RH4A 4ILKA 5HFAA 3FJOA 1ULAA 3PT5A 4DL5A 2JGEA 1LBIA 4GPTA 4JCOA 1XZJA 2J31A 3IMCA 4IJKA 4YEDA 2BDUA 3EW9A 3UJDA 5DTIA 3H4IA 3TECE 3D0RA 1OILA 3AYZB 3DVQX 1J00A 2ZJZA 3FUWA 3LYLA 2BFEA 1XDSA 4WT7A 1W5EA 4D8WA 4B3SB 3TQHA 3U3KA 2IP4A 1XJQA 4OJMX 3KQUA 1FNSA 3EZYA 2E48A 4YMHA 2DBZA 1U8XX 3UICA 3VR6H 1MVLA 2QV0A 3MHPA 1CIVA 1M54A 4TOIA 5H59A 1BHSA 4Y2VA 1CZOA 1SC9A 1ADCA 4MLPA 2W8KA 4AKGA 1L4HA 4EDHA 1N5OX 5BQ3A 3GFTA 5D7BA 2RC5A 1ZH2A 3NBKA 4DSUA 1UXGA 1XUOA 2VZ8A 4MPDA 2ANCA 2I6XA 3BK7A 1WMEA 2EBHX 3H0EA 3QKUA 5AVOA 4W9MC 2EP5A 1ODLA 3KQNA 3MILA 2DFVA 3SC4A 3A1WA 4YR7A 1JE0A 3GEMA 4AJOA 1G7RA 1Z2OX 1M5TA 5HA5A 2XCUA 5G0TA 4BY1G 3HYRA 4K86A 3OICA 2WF5A 3BSFA 4TYYA 3WWIA 1Y42X 4O83A 3OFND 2LKCA 3FNGA 2O8CA 1A9SA 2GYWA 3BOSA 4FHCA 2BBSA 5E0OA 1TWCA 3GGCA 3OKCA 2WTNA 3UT5B 4O7RA 1T25A 3SC3A 2XF8A 3E18A 1EBBA 1MB3A 3LCUA 1MH9A 3M6LA 4G1MB 4NZ9A 1ZW6A 1DPFA 4NK5A 2NZ8A 3QLUC 5LP6A 1JG6A 1EZ1A 4G4SO 1JLLA 1S2IA 1KO5A 4AI6A 3GZ4A 2DBQA 4CF5A 3SFTA 5JS1A 5AW1A 5HF6A 1EVJA 2DQYA 2AKEA 4FN5A 3KP1A 2WD7A 1W4RA 5A3RA 3UMVA 2F00A 2XIGA 1AU9A 3IEPA 2SHKA 2DABA 3LOPA 5JR3A 2WKRA 3QXHA 1AA9A 1RXCA 3A31A 3F6RA 3MTBA 3SJUA 4JITA 3EPIA 3CE6A 4WK4B 1RM5A 3OOHA 3IVCA 1R3DA 3B6JA 2ZB4A 3ICWA 1EJBA 5BSTA 1T6XA 5TB5A 4BNFA 5JXGA 1G16A 3LW8A 5K3OA 2PMCA 4UM8B 5DLQC 1H42A 3N7AA 2J9FA 2WA1A 1C4XA 1LJLA 1R4AA 4FCWA 1RAEA 4B5KA 2GPWA 1KK3A 1Q7TA 1G4UR 1A8PA 1ZSNA 5BUZA 3Q3IA 4XR4A 3AP2A 3OU2A 5BWLA 1VRCA 3DAFA 1O95D 3BXOA 4N7MA 5LU9A 3JSLA 3HL4A 5TEWA 3RANA 5DBIA 3NRCA 4PYLA 5ALWA 1BHJA 1M1NB 3FFBA 1HA3A 1NW3A 4OXNA 4PVCA 5DTJA 4LSWA 4U8HA 1D6SA 3H7AA 4Q9LA 5DNAA 4J49A 3COSA 3PFBA 4YACA 5EJIA 4LF9B 4K6NA 4LRWA 2R86A 4TKUB 1OGYA 2CCGA 3SHTA 3W3AD 3ZHUA 4CT5A 4ER6A 1NXVA 3VKVA 4MYRA 4CG3A 5L95A 1GPAA 5LQDA 3NBZB 2E4WA 2WIKA 1DEXA 1ZS9A 2VYVA 1OIXA 1G9XA 3TAXA 4LXTA 3LL4A 4BCDA 3TTTA 5K0SA 2VOBA 3GTKA 2B3TA 2CYBA 1TW3A 2WT4A 3RUIA 1U7OA 3FAZA 1Z0SA 3HKEA 1MX3A 2IEZA 3E81A 3QVVA 4REMA 3M1YA 3C5EA 4DIOA 4D9MA 3RVPA 1ZLXA 1N3BA 3FDFA 4FSXA 3K9WA 4IQFA 4X1YB 1QUEA 1FQKA 4UNRA 2WZDA 4W5RA 4L9WA 5FA6A 1ZN9A 2QRMA 3FPCA 3MQ2A 2CCKA 4JBXA 5IFLA 1VBHA 4NE2A 4CMIA 2IYSA 4JVLA 4AJPA 1ZWKA 4TVKA 3OE4A 3PE6A 3ENWA 5JS6A 3WLAA 4MQMA 4CM9A 1X7DA 1IM2A 1LLQA 4DRXB 3NIFB 3AL2A 1DQZA 4W5TA 2BQRA 3MELA 5EOYA 5AW9A 3QA9A 4E5NA 2IU4A 4QLBA 4BZXA 3QX7A 4G0OA 3T5HA 5HKLA 1PX0A 5K8CA 3F98A 1RHJA 4NDAA 1JXOA 1AGPA 5BPHA 4JEIA 1NVXQ 4MPTA 1QZTA 1B1CA 1YFZA 4HF7A 3H97A 3NKLA 4AJNA 5BNIA 3CKLA 1MH1A 3IRUA 2PXXA 4RHYA 3B3QA 3HU1A 1Q7GA 2FEWB 3KR9A 3EZNA 5FUQA 3TK1A 2DJ5A 3GRVA 3ECAA 1KJIA 1FRQA 3MSCA 3DW1X 4Q01A 5KMGA 4AG3A 3UMGA 4BZZA 3RAPR 2OLSA 2N75A 5FD6A 4YQYA 3OHMA 1CY2A 3ONFA 2OK7A 4CNBA 1J1IA 3ZGXA 1T36B 1TB4A 4G4JA 4UM5A 5FADA 4CIXA 3U4MA 3N8HA 2C2HA 3L04A 4HAWA 5DNVA 5IWAH 4MLCA 2Q6KA 3KJZA 3NGDA 2PLRA 4BMNA 3EGVA 5AJTA 1CJSA 4NU5A 1FBNA 4L8WB 1J07A 1I7LA 1G3QA 3V7WA 4J90A 1FFEA 3E22A 3OLVA 3CXUA 3QELB 4NH4A 1WVMA 1MB9A 4XASA 5HZMA 4YFYA 5I51A 4D3FA 3GLFE 4LHWA 2FZ4A 3GLFB 2HGXA 3UC5A 1SVNA 1SQ5A 5MHTA 3DCJA 2WUEA 3W9YA 3D6TB 4PZLA 3OCWA 2HRBA 3D3EA 3H0KA 4UBLA 3WLFA 4BFCA 3QG5A 4IHAA 3RYFB 3LP6A 4Y6OA 4H7FA 1MHTA 1WOMA 4M1KA 5EMLA 4Q39A 4KXUA 4PTYA 2CLSA 4AMUA 9LDBA 1XTZA 2GZAA 1TKCA 3OTWA 7AT1A 4BKQA 4PZPA 2DKFA 3PDCA 1KPHA 1KR2A 3PR2B 3BYZA 1ZLYA 1SUDA 3PFGA 3RU9A 5LQRA 2F3PA 1J8QA 4NIMA 4KQ6A 1XF1A 3M4IA 1JHPA 2NVXA 1TVCA 4PE5B 5DW0A 4EO9A 1ZK3A 4M8KA 1S5PA 2O59A 5CFRA 4TYWA 3OIFA 4KR0A 2XVMA 5DULA 4UULA 1XZHA 4W8OA 1YAJA 4D4KA 4X60A 4EA9A 2UYCA 4X65H 1I6WA 3MTDA 4JI2B 1UZUA 3DTYA 4RKWA 1NUPA 3A8TA 1PJSA 3R0XA 3RHSA 4MI3A 5HP4A 3FPEA 4I8XA 3BXHA 1PU2A 1U80A 1EE9A 3OJEA 5HIJA 5KX5A 4GP7A 4XXHA 4TWAA 3GP5A 4DWVA 2H1CA 5HJ7A 3H7IA 2PR7A 1GFWA 3LWBA 2GWRA 4H0FA 1KJZA 5CA1F 3KXIA 1PF7E 3OC0A 4X7RA 2WZBA 2DVMA 3QVUA 3RNLA 1ZYUA 3GNTA 2RBGA 1L7VC 3OU7A 1QQTA 3H0GA 2YINC 1G6HA 4FYVA 4G4GA 1F0NA 2H17A 2FEKA 1SOVA 3KEQA 3T9CA 3PQEA 1FFAA 5AM4A 2OHHA 3ES9A 1K7YA 3F4KA 3KDAA 1XZPA 3HWWA 4MB2A 2A1UA 2F3SA 1PJ4A 2N3ZA 4NMLA 4QOGA 3GNLA 4FVTA 5K6RA 1EX1A 1M1NA 1FRVA 2QUZA 1AN0A 2MOKA 3PHIA 1KRHA 3GT7A 3OFNA 3PPXA 4LDAA 2PA3A 4RDHA 5FTNA 1T5OA 1E7RA 3ULKA 3T99A 2QUJA 3CB2A 4UHHA 1JB9A 4X3PA 4MHSA 1JX6A 2I8LA 2VBCA 3TF5A 1EUQA 2Y1OA 3KB2A 1LTHR 4TVOA 2PY6A 2G9NA 3IEIA 1OXUA 2Y9PB 1KY2A 5E4YA 3EUFA 5EHGA 4G5XA 1JAXA 3HCAA 3UUWA 5B55A 5ES4B 2C77A 3G5UA 3MMNA 5CEFA 2W00A 3QLTA 3O4IA 2WDZA 1PV1A 3DEJA 3OIVA 3OLCX 4I1SA 4RFSA 2NPFA 4P08A 3H3VH 1NYTA 1F14A 1WU8A 2ASVA 2IYQA 4IIUA 5JASA 2VDKB 2XTJA 2I6SA 3CZAA 1AHIA 4L4UA 4DVGA 2ZS9A 2PGJA 3AMVA 2WU1A 3C3MA 4RIHA 3TZ6A 3TE7A 1U6IA 1H0RA 4RAOA 4KPUA 3MHTA 5CA1B 4WCFA 4WNCA 4WUTA 4MIEA 3INNA 1Q1AA 3VPDA 4C07A 5KUTA 4KV7A 3GD7A 1D1QA 3BD7A 3L1VA 3ND6A 5CVTA 4DB4A 5IC4A 1QH8A 2W11A 4J2HA 3IBYA 1RTTA 4D82A 5FLXA 3V6JA 3WHKA 1GRVA 2E4YA 1BKDR 1Q14A 4DG5A 3QZ7A 1MO4A 3HC7A 4K28A 4FOTA 1SD5A 2ZI5A 3AY6A 2QKYA 2Z08A 3FJ1A 4HAOA 3IA2A 4P3KA 2OQVA 4DR5B 1CSEE 2PRZA 1RYYA 1TGYA 3GJ7A 3P9CA 3CC8A 2QTCA 4KWTA 1GNVA 1GSAA 1PWHA 2VK4A 2MSNA 3AR9A 1DEAA 2AR0A 1W2HA 1CP2A 2FUG6 4KFSA 3WDKA 5BV1A 4B71A 3NHLA 2P6NA 3OOYA 1I7SB 2VYVD 3GVCA 2O14A 2Y2VA 3FLBA 1A4RA 3MYRA 3X1WA 1PBTA 2ZRJA 3L4KA 2EFDB 4XGIA 5I9TA 3HUDA 3L7YA 4QT4A 1LB1B 1R4ZA 1BCRA 2W58A 4GPEA 5EP1A 3DT9A 4L4YA 4INZA 4EBFA 1JFTA 2CMGA 4GPZA 1H0HA 1EDBA 1E4FT 2JFZA 5A6SB 4C4RA 1P9NA 4CIWA 2V3VA 1Y1WG 5BSMA 2GHRA 1E32A 1H1DA 5IKMA 1QKIA 5ETJA 1QOPB 1IM5A 2UYGA 1NFFA 4OX9B 3DBLA 4OHZA 3WAJA 1M8JA 4RJKA 2CXXA 3H1BA 4WV3A 6REQA 1QP0A 3BK1A 1Z45A 1A4IA 2R3SA 3PW4A 1HBJA 2WV7A 3FCAA 3KLNA 4P22A 3R76A 3IUJA 2HIGA 5K3FB 2J4DA 5FLXW 1E2EA 4KI7A 5I4IA 3G02A 2UKDA 3SJCA 2Q6TA 3WKEA 3PX3A 3F96A 8AT1A 2ZT5A 3LBIA 5I7WA 4N03A 3OPVA 5JIBA 2O4CA 1K8ZB 4HNSA 4ZDWA 4D26A 3RTEA 4LYDA 2OORA 1V3UA 4WE3A 2PL5A 2JIMA 4CKZA 1ZSVA 1MGPA 5I5VA 4HZUA 4OXRA 4U7HA 5ENDA 5EJ5A 4QQRA 4CF4A 3E7FA 4L85A 2JGLA 2I2BA 1T3TA 4INOA 3WIDA 2PFKA 4RABA 4UFPA 2VTKA 1N1GA 2WINI 2C42A 4Q4JA 4DLWA 4OQXA 2JC3A 5EIBD 3VHQA 4AZ3A 4EA8A 2P2YA 4GKAA 4H9GA 1XDNA 4RCNA 1SCAA 4NFLA 4LFAH 1W29A 3JVDA 2IL1A 3ZDDA 2Q5IA 5KFSA 4MV1A 3AV3A 1E1RD 4J43A 1BQ3A 4Y1GA 4ETNA 2AMFA 3WRYA 1JWLA 2RB5A 2W4IA 4NPAA 1T4GA 3OEEA 3VNSA 3WLMA 5FR2A 1Q91A 4RKFA 5KI6A 1PYOA 4LZOA 3CZCA 5DTMA 1AKQA 1OWNA 3NHYA 2BI8A 3DFUA 2VUHB 1U3GA 3DJYA 2QJWA 3ICOA 3QUTA 4GLWA 4BQSA 2WFLA 4HB2A 2XT9A 5KTOA 2BLNA 3T1QA 4IH9A 1G8SA 4UPEA 2IYOA 3PP8A 1UEXC 4TS9A 1NNSA 2G7MC 2AQ8A 2WHPB 4O33A 4RD0A 2CVZA 3OTQA 4DV5H 1W5FA 1W0CA 1JQ5A 4YDSA 2GLUA 3FIUA 1QF9A 4MVJA 3HJRA 5DLFA 2W2LA 1QUFA 1RCTE 1T35A 2ZSKA 3A4VA 3BWXA 3LHSA 5DNUA 1MQ8B 1LPOA 2BLLA 1SXJD 3H0CA 3WBKA 4XUGB 3WZMA 2N1BA 3LCCA 4F7WA 3GAMA 5HX7A 2OBYA 3ZZNA 5I9IA 4IRCA 3N0WA 2UVUA 4LBVA 3HCBA 3PL1A 4Y8VA 1JDZA 2DLNA 4PZAA 2XOEA 4KE7A 3V4LA 4ARVA 2IV2X 4CLRA 2ZJ3A 2CN1A 2YWDA 3DMRA 4YQEA 4UHBA 2JK1A 5JDCC 4BEJA 4TTTS 1E2BA 5FQNA 4RUKA 1XK5A 3HCEA 5T8KA 2QP4A 1LBHA 3SQLA 3NGMA 1HDXA 4QBFA 4BC0A 4OYRA 3A1VA 4J2TA 4E2YA 3TOZA 2QDXA 1FSGA 3PITA 3TZLA 4G23A 5L3SB 2WWTA 3L7JA 2H54A 1XPOA 1FS5A 2RGAA 1PZHA 3L5KA 4ZXFA 2VHYA 3IB6A 3ZQ6A 4BXOA 3EVAA 5CA1A 2PKQP 2UUBH 3IS3A 3JQCA 4A36A 5F1KA 2VA8A 3TSOA 1Z5WA 2PZLA 3IDZA 1V26A 4GVLA 1SA0B 1DADA 4EFKA 5FUXA 5FWYA 3W5DA 3C4QA 3LXUX 2Z6UA 4YALA 2HU5A 4I4CA 4LSGA 4QQ8A 4BMXA 3DOOA 2JIZD 5FEMA 2IK8A 4J0DA 2J3QA 2OEPA 1PTJC 1Z36A 1KBLA 1U2SA 2EYUA 2UXDB 1Y98A 2ZXFA 1U94A 2C5SA 3D4BA 1LPSA 4EG8A 4RAZA 9ATCA 3IXLA 3JAMA 2MSDB 5E9JA 1YNSA 2PTHA 5K4AA 5D5PA 4DDKA 1TVKA 2QX9A 1AHHA 4FDLA 1O03A 1W47A 2V7TA 1K8RA 5KT2A 1IN8A 4V0MA 1XNQH 1I3KA 1Z56C 5E6RA 4B2YA 2YV2A 2Z4RA 1YR6A 4MR8A 2H65A 2L17A 4ETSA 5H9VA 1F6DA 1L1EA 4WEQA 3S40A 1VL6A 3CE9A 3KVNA 1A4XA 3ZYZA 1YRBA 3G2PA 3I4MG 1KIAA 2ZB3A 4ED6A 2YJ6A 2AEJA 3KOWA 3QYAA 5CK5A 5EE5B 1T4DA 2OWEA 4PQYA 4XOUA 3UJBA 3MF4A 3QM1A 2C4WA 3Q8WA 4BPBA 4Q66C 1IH8A 4M1TA 4EKNB 4HAIA 5GM2A 3SJZA 1ZD2P 3L8ZA 1P1RA 3JQBA 2IPXA 3KJEA 3LQQA 1KI7A 1XVLA 3K6JA 4YPOA 2XSZA 2QVXX 4JJIA 4QHSA 1X1RA 1S01A 3A7DA 4R2KA 4Y9SA 3UOAB 4YN3A 3BJYA 2YWEA 3BWMA 4YRBA 4WN9B 4TLAA 3H6HA 1Q0UA 3QPBA 1LLFA 2G36A 3ZDYB 4RV4A 2O5RA 1W581 2CV0A 2O0JA 3LQ2A 1QO9A 3GWGA 2IH4A 2G8NA 1JIVA 3RHTA 2AUNA 1MRSA 4JA2A 2OCBA 4I3GA 1U8AA 4RF5A 3EVFA 3TW4A 3W1EA 3H2GA 2XUZA 3TLGA 2HDKA 1QB8A 2IYEA 5CLFA 5KSZA 1JDSA 3FHCB 1T9HA 4RU1A 4RVUA 1UAGA 5HIMA 1KY3A 3BD6A 1ECPA 3PDWA 5K03A 1CS0A 2OH2A 3UAZA 1A2QA 5JOQA 2YWJA 2PWPA 4C78A 2OL4A 4II7A 4OX9H 1JI3A 3GIIA 4M1EA 3V8NA 3ZDFA 1HYGA 3F9RA 1W1IA 3QQPA 5C31A 4UHFA 2GAAA 5JI2E 3C48A 4OI2A 3L8YA 1FNMA 2OZVA 4G8JA 1J09A 2CYAA 2WJ6A 1SRRA 4OPMA 3HQ4O 5BVHA 1RLUA 2QUIA 3ROGA 2JW5A 1VIMA 3DTFA 3GMIA 4M1OA 1FLDA 3I6YA 1QFSA 1MN6A 2CFMA 4PWQA 1QLHA 3HPQA 3Q7IA 4M9ZA 3GIJA 4NOJA 3S1AA 1TYAE 3WK4A 3ZEAA 1EQ2A 2HFKA 2FW7A 2AI2A 2ZS7A 3EIWA 1X19A 4NOMA 3ZN2A 2HWXA 1UBHS 4Q3CA 4X54A 5LMZA 5LR6A 3EG9B 1XAJA 1GNTA 2DFPA 4A3JG 3KJQA 4LSMA 4PTLA 1C1DA 3GRAA 4HVAA 1B0ZA 1HKUA 2QLTA 4EJFA 2XE4A 2O0KA 3N44B 1YUMA 4A73A 4EG7A 2IVFA 4JI5H 2QYHA 4QKQA 4REQA 4HQOA 2I6TA 4G07A 1A8SA 1BXGA 1QRTA 2HYIC 1R0XA 1KP2A 3GDHA 3H3JA 4H31A 1J7JA 2I78A 1PT5A 3LA6A 3JQ7B 3MPOA 4Z3KA 4G1VA 4P4LA 3P8ZA 4DTIA 5B6PA 4YCNA 2UZ3A 2FDXA 3V6HA 2BMVA 3MWFA 4XYMA 1YULA 2BBOA 1A9OA 2HNAA 1ZIOA 3RSCA 4BQIA 4JB2A 2AN1A 2WSBA 4LJYA 1PJ8A 5TRTA 3B36A 2PMKA 4WJLA 2FMUA 1C3EA 4DMRA 5KT5A 3HEBA 1FTGA 4P7JA 2GN2A 2Y0PA 1T94A 3T3HA 5AI9A 3G5TA 2M32A 2XWJI 4YP6A 3CLTC 3F46A 5MGBA 2G9RA 1BQEA 5TVKA 4CMAA 1XWIA 4UTPA 5IM4F 1E1RA 1JAIA 2DQSA 2X41A 1E1YA 1TUEA 3PTLA 4RW0A 3DAAA 1P2FA 3AJEA 3I5XA 3V33A 2COJA 1DDOA 3L6DA 3LUKA 3OVMA 2CFTA 4A6XA 3RYCA 2DIKA 4IVNA 1F8XA 3FW1A 3M89A 1MPXA 3FPHA 2XF2A 2ZG6A 1UFQA 3PC6A 4HY3A 4JL8A 4K6GA 3U4DA 4JI7H 2IHKA 1Z08A 1VZ2A 2NG1A 4C1BA 3DEHA 3PVXA 1K1QA 2EFHB 1J9GA 4HB4A 4UU1A 1WP9A 2LTAA 3PB3A 4OXQA 2QMOA 4EB3A 3H5AA 1FF9A 4DV5B 3CQ9A 3RK0A 1T0IA 2QIOA 4QNRA 2IH2A 3I1JA 2W90A 3ENZA 4X20A 3H9BA 4MVJD 5T41A 5TE9A 2W2LD 4U6PA 3S1LA 2FK2A 1NHGA 1ZJYA 2HMVA 2TS1A 3NEJA 1M5UA 1YBHA 2QB5A 4EBDA 3LX5A 4QQKA 5B7NA 1EXWA 3CUTA 1TQ6A 5GV8A 1VFPA 3ONEA 3M0EA 1TU4A 3OG9A 4P86A 4AAYA 5FLKA 4OX9Y 5CPBA 4CU5A 3H5TA 1HK7A 4BJ5A 4TS4A 1NRIA 2YV5A 2V0CA 3OF5A 5BNTA 4G0UA 3FDZB 2IIPA 1UP6A 1PW7A 4Z8XA 1QH0A 1Q92A 2D1FA 1U7XA 2AEMA 3ZJ4A 2WUVA 1N9KA 3ICPA 3PPYA 4NU8X 2JB9A 5JXJA 1K08A 2FN9A 1K5HA 1XTBA 2O7QA 1DO0A 3NAMA 4IEEA 2BFDB 4M3NA 3WRXA 2R7KA 3IE2A 4F46A 4DDWA 3R5HA 1PRYA 2ZCUA 3OC6A 5ELLA 2B3DA 3PNMA 1UBGA 4MW0A 3ZWKA 1RBZA 4XA8A 5KT7A 5J1SB 3ZG6A 3ND9A 4AP9A 4H59A 2V9WA 3JD1A 4A0FA 3HDTA 4E5KA 1O94A 1RWMA 2PT6A 4ZGWA 1J5PA 2BMWA 2X0DA 3AVYA 4H7KA 4H35A 5A2QA 4FFBA 4J4HA 3N3BC 3ME5A 3S8MA 3K70B 1RI1A 1XNRB 3EFOA 1OCEA 3PDJA 4D9KA 1WQ4A 1X1CA 4RORA 4F8EA 3ENNA 3RO7A 1E5LA 2JHCA 4C0BA 4WZZA 5LBUA 5JQGB 1XZDA 4F60A 5JWOA 3S8YA 3H75A 5HF5A 1ZQ9A 1MF7A 3PGA1 3HFJA 1T6ZA 3LYHA 4L0DA 1C9KA 3U26A 2CFOA 1NC3A 1GGKA 2WQZA 4TKVA 3KKEA 1OUMA 3E8XA 2JD1A 5FBRB 4AQYB 5F76A 4C7BA 2G9VA 1CRQA 2AZDA 4LF7B 3S2IA 3WGUA 5EJ8A 3LU1A 1PR1A 1CNEA 2AOWA 4ECRA 2CUKA 1HZJA 1N0VC 1YB5A 2FWPA 1J2RA 3QNUA 3DUFA 1ARZA 4KQIA 4O3FA 4DFDA 1Z8DA 5J4LA 1YTUA 1ACLA 1ZPDA 2A9FA 2FF7A 1L4EA 2RHGB 4ZJPA 3PN1A 4CM5A 4QTUB 1HMYA 4KN6A 2VA9A 5DXJA 1YA6A 1RRVA 2WTEA 1T2FA 4UREA 2M6RA 3D5TA 3WB1A 2HDOA 3O8BA 4ECSA 3NOOA 1PJBA 1DOAA 1QHHA 3C7KA 1OY1A 3FMPB 3B5EA 1JFFB 5C8DA 3F6PA 4ES6A 4DV6H 5FJ8G 2ZWIA 3QOWA 3KIPA 5A2GA 4D96A 3DLHA 2QENA 1WSWA 4CMEA 1L4KA 1RAHA 1CRPA 4FHGA 4D42A 2VAXA 3D8BA 4L75A 1IHPA 4RM3A 3VR3D 5C1PA 2I7VA 3BL8A 1U3UA 1N5IA 1XTIA 1L1RA 3LRTA 1DQYA 1FMCA 2AS0A 4QIWE 1HNNA 2I34A 2DH5A 1RDFA 2ORVA 4OHFA 3DFZA 3ZLUA 3PI6A 4RJTA 2PHZA 5CFQA 1BIFA 1TA0A 2WF6A 1SK9A 1XMSA 3U62A 3UWPA 1NI3A 3LCJA 5JCJD 1VBGA 1O1YA 2P1ZA 4ADSG 2IKQA 3GTQA 3MJVA 1J42A 1JS1X 4TWBA 4EA6A 1QQBA 3EIEA 3M82A 2F2TA 5DEOA 4DV0B 2ZJOA 2WZQA 4FBGA 2IBTA 3O31A 1QCCA 3F7TA 1U1DA 4CMEC 5BUCA 5FNZA 2ASDA 5JECA 1X8KA 4HN2A 3ONNA 1VHTA 4JJ4A 4DSNA 1UJ5A 4DL4A 5F2KA 2WYHA 4EB8A 3MIZA 1KYTA 2JRCA 2QU8A 3I92A 1KJ8A 2AMLA 2OXFA 3ACBA 1P1FA 4DR6B 3V9AA 3HO6A 4QUAA 3DJFA 2BR3A 1ZXLA 5JTTA 4IIYA 2KBFA 2G28A 1I33A 2E5FA 2X7JA 3HCFA 5DGDA 1A82A 5IBRA 3T12A 3ZU2A 2VDOB 4YMSA 4Z7JA 3EGIA 3NONA 3EPLA 3AILA 3V1KA 4EY7A 2O8BA 3QF7A 3RJTA 3AW9A 3W9SA 4AJHA 2IXTA 3BD8A 3RCBA 1LSJA 1QO7A 1U0TA 4GOOD 4G67A 4EJSB 1ZIYA 3MINA 3VZRA 2OBXA 3R3SA 2NXNA 3NAQA 2H4YA 5DCUA 3ETDA 5DSXA 5BQ5A 5FBVB 5ANRB 3ESYA 4IJWA 2JCGA 3FLMA 4L8GA 4KNVA 4JXUA 4CMHA 2D2FA 2VQEB 3REQB 1R88A 1EFPA 1XJ5A 1Y37A 1Q44A 1M1ZA 2EBFX 1FTYA 2G0AA 3BMOA 4KZPA 4B4VA 1T2EA 4NCJA 2CLOB 3T3EA 3CZ5A 2PEYA 4N3NA 3KOXA 4YMVA 1V9PA 2VQFH 1W36D 4EFBA 3UKOA 1V11B 4KDRA 1A5TA 5EQJB 3BDIA 1ZH6A 4AKEA 4OSPA 3DDSA 2WWWA 1F8FA 2DQ4A 4L5CA 1YACA 1T1RA 5C4IA 3BFPA 1R6BX 4PF1A 4LV6A 2ZIGA 4FFWA 4Q7KA 2DFNA 4MGHA 1OU4A 2DWUA 4OFXA 1FDRA 1XAGA 1JKIA 3OCXA 2IOFK 3QBEA 4JUDX 3IUNA 5CLGA 4CMFA 4JP3A 2VQEH 5C5JA 5FLMG 1S9HA 2R97A 3SX4A 4DLYA 3QF4A 4F6CA 2V7EA 1JEEA 1JN0A 4X93A 2HY7A 3NT5A 2BISA 4DOMA 3CRRA 2JEZA 4Q6WA 4HDSA 4BNJA 4ECXA 2D7CA 3VAZA 2FR0A 5FPQA 2C4TA 3VNVA 1JDJA 4GC5A 4RJLA 5ILGA 5J23A 4H3HB 3WMXA 5F5LA 1TCAA 2ID9A 3AP1A 3S55A 5EWJA 5CD9A 1I32A 4YONB 3PNVA 2QRLA 1KEEB 2P9BA 3LYUA 2X0RA 4LYGA 5FULA 3KAJA 1KBOA 5KYUB 1EK0A 2J0EA 4ML3A 1M0TA 2PKQO 1I3QA 2NQ2C 3K92A 4TRRA 5KHAA 4CCSA 3C6XA 3PYMA 2VF5X 3VKWA 4OB7A 2BKLA 3L0SA 3GTPA 4NAHA 4LRTB 1IN4A 4ZVKA 1WLYA 1B6TA 3S2SA 1T0JB 2FEOA 1LPBB 3LV8A 1QH8B 3BORA 3KWFA 3WA6A 2VH5R 1F5SA 1DIGA 2ZYAA 2BJHA 1G0OA 3PVCA 4MK4A 3T5DA 1SB8A 2X15A 3PQ5A 1ISMA 2VH2A 5HZGA 3GP3A 4EEKA 2NZXA 1QVZA 2B1JA 2DQZA 2UAGA 1LV7A 5G2OA 1Z2AA 3GWZA 3KBBA 3N53A 3UK2A 8OHMA 4NTZA 4H1WA 2IY9A 2FKLA 3DT6A 4W7SA 1CKMA 5LD2B 3AHIA 3H4VA 2BQ3A 2A3NA 5GV7A 3M7IA 1EA5A 5JQGA 4B3SH 1AUVA 4YCJA 1DRWA 2P1DA 1SU8A 4HWPA 2YZLA 3ZWOA 4BFYA 3G9ZA 4XYLB 5G40A 1T8PA 4DCNA 1OX4A 4JMLA 3RNOA 2I67A 1O94D 4PNEA 2E6UX 1UBKS 4WZBB 3RVBA 1WCMG 3FDXA 2ABWA 3I8OA 3PC8A 3E9YA 4XTRA 2RI1A 1PIWA 4KFRA 1EI9A 2CV2A 4P1ZA 1G7CA 3DSRA 2JEFA 3RYTC 3JWHA 1MAAA 3ZHOA 4TZ6A 3D8UA 3DFFA 3RF2A 3VO8A 3HVUA 3OZUA 4H7JA 4K9OA 2ASLA 3LULA 1QYCA 4PN3A 2J0QA 2YRFA 4HEHA 4TSFA 3KREA 4F5ZA 1J39A 2BGLA 2ZJ8A 1Z74A 2IXFA 3AB7A 1JG2A 3JYPA 4F72A 5BW5A 2COIA 3DEZA 2NXJA 3ICCA 4XWGA 1FL9A 4HP8A 1QG2A 5DHRA 3GLIA 5KOHB 2BFMA 3EXEA 3O94A 4Q4HA 1I94B 2ZYTX 3CF6R 2HIVA 3FETA 1CR4A 2V5UA 3GYGA 1VL5A 4L76A 4Q21A 4BQFA 2NSJA 2ZIAA 5FEUA 3JD2A 4ZQGA 5E95A 4BLWA 4UOEA 3AESB 4CM6A 1QBGA 5I4KA 3FSGA 2WTXA 4YP5A 5JC1A 1FFCA 2FUCA 5FPRA 1II0A 2GASA 4NU0A 3UWOA 1XNRH 1Y3HA 3I2YX 3LP5A 1CUSA 1Z8NA 5DG7A 2VAPA 4PIVA 4WFKA 2R6HA 2C96A 4NFYA 2ZUWA 3VR6D 1M8KA 3U1BA 2QAGA 4J07A 2R7ZG 1Q0SA 1SURA 3M49A 5KNBD 3D59A 3O3CA 1ZOSA 3QA3E 3EF1A 4KYVA 4Z0TA 5LMUB 3EB9A 1T5SA 1JHQA 3U7QA 1JUDA 1DC3A 2NU8A 2H00A 2VAWA 3GJYA 3OT1B 3CNLA 4TX1A 4DR3H 3KUXA 2W71A 5B57C 5CE8A 2VWHA 4IYJA 3AESA 2NPOA 3H4DA 1R6TA 1X7YA 2HUPA 4IRKA 1BMDA 3GRYA 3HG7A 3P9ZA 1U1IA 1GN9A 4OQYA 5AICA 5G4KA 2DJIA 2BJVA 2IDKA 2IUYA 2CMDA 1VMEA 4GLLA 4HL6A 3VX3A 4UXHA 3ICEA 2DKOA 2Z57A 1XO1A 2WILA 4YJFB 3IUBA 3GJ3A 3CLHA 1HEIA 3PNOA 3SIWA 3WTCA 4I36A 1LDMA 1NN5A 1MZBA 1WR8A 4DBLE 3QXGA 4LGVA 2Q41A 3VBEA 1L7XA 1NDUA 5CVVA 2QAGB 2HQSA 4LJ5A 4ZAYA 4YXWD 2OD2A 1E2DA 2VNKA 1EJ2A 3TRJA 5K8LA 3JZIA 1YQDA 4G97A 1IULA 1SXHA 2CNNA 2LVBA 4I14A 1FJ2A 4XZ3A 4YUWA 4KNYA 1NBAA 1C8LA 1Y81A 3WQQA 4BVBA 3G82C 5FOSA 5K01A 5H16A 1U8YA 3BB4A 2FSSA 5SYMA 1BROA 5TQ0A 1XD2A 1CR2A 1VAJA 1NYRA 2FPKA 3DOCA 2G63A 3THSA 2UVDA 1HGXA 4MTCA 2J6SA 5DT2A 4IMRA 3A10A 4LBYA 1OI4A 3SM3A 3GZNB 5JNSA 2OB2A 2J6CA 2JA6G 3K53A 3UOGA 1WXXA 4CNQA 1PS0A 4E3ZA 3DKPA 3KKLA 1XDZA 4EQ6B 4B3RB 2GLXA 4NEGA 4EG3A 2NZVG 3SHOA 4QVKA 2PUWA 4NL4H 4NV1A 1IQRA 3BB3A 3FKQA 2IITA 2EGGA 3PNPA 2OB1A 1N0IA 2DECA 2IHJA 4FYJA 4RL4A 1KQFA 1XC7A 2P8JA 4CM1A 1W4AA 2C2XA 3C2QA 3GV7B 3DF9A 1HO3A 3W6NA 4ZDJA 2CMFA 2WRZA 3I52A 1Z75A 5HKBA 2DFLA 2Z83A 2PD4A 4GRDA 5IAKA 1KQGA 4WVLA 1HL3A 3K3VA 1A9YA 2R6DA 3KSUA 3OJCA 4TMYA 1AY0A 3T41A 4F5WA 1GTZA 3PO2G 4KO8A 1NJSA 1O08A 3IYLW 4TS3A 4JI1B 2AJTA 2YWBA 4HUJA 1SK8A 3C1AA 3ICVA 2ZJ6A 4OHKA 5U4XA 1VI2A 5A4KA 3P9SA 4IHJB 1P6XA 3O9ZA 4KZKA 3WA7A 4QUJA 4GRAA 2CNWA 4BBJA 1XNQB 2EWVA 1YZGA 2NSLA 4GNKA 3N0RA 1E7SA 4DEYA 3WKBA 3HRHA 2INGX 5K6AA 1Z63A 4KL8S 3GAZA 1F38A 3R2JA 2Y0CA 1K2WA 3CCBA 1WCV1 3G8BA 4M83A 5E1OA 3IB3A 3TR6A 1P9OA 1ZR4A 1I6LA 4TVSA 1YIAA 4AO6A 5IJWA 2ZEJA 1AS3A 1BEEA 2P0EA 3PUIA 3X2FA 4MUEA 1ZJ5A 3GDOA 3OPQA 5H3LA 4YJ2F 1LRKA 1N5RA 2ODEA 2Z3VA 3EXFB 5FJJA 4D5GA 5KX5B 2D5CA 4FHZA 1E3WA 4PHHA 1SXJE 5K7SA 1KJ9A 3DOJA 2QTVA 3A4YA 3O2JA 2R8XA 1Y1KE 3C3JA 1YZNA 1SYXB 1N32H 3UT5A 3N9IA 5ABPA 2RF4A 2JBAA 1OA1A 4BZQA 2V3CC 4BO5A 4E6EA 5AM2A 5LOVA 2VUTA 2GJAA 3AWDA 1Q0RA 1CTQA 4Z7NB 1P4HA 1JJAA 2AMVA 3NT2A 4LDNA 2PBFA 2YMQA 2IBMA 4D9BA 1L5LA 2C58A 5FV4A 1WR2A 1D0VA 2ZE6A 2ZLBA 1I1QB 2GJ8A 2ZW9A 4NI5A 4NZMA 2UYQA 3LXMA 4O2RA 3SYLA 4M9CA 1FDIA 3ZGOA 4YAKA 3AZQA 2AN3A 5AVTA 1AUOA 3AVWA 3A9VA 4AG5A 4A8JB 1TM2A 2LCQA 2R8EA 1RPZA 5BSFA 4MSUA 4ZJZA 4DC1A 3AR5A 1Z7GA 4NP6A 4J9RA 4QXAA 2H11A 1X8XA 3BQ1A 4RMNA 2HA0A 2PU7A 1KI4A 4H1TA 3QP9A 4B3FX 1NW6A 2REOA 2IYXA 3IKMB 4K1XA 3ZZ1A 3HB9A 5JROA 4Q7LA 4Z4EA 3AIKA 3R5XA 2OZLA 2JEOA 2OXCA 3DE5X 1VPWA 2A94A 3UUFA 1YJCA 4A1FA 1NVDA 1Q7BA 2HMUA 3I42A 2JCVA 4MWSA 3MD9A 1L5NA 3N05A 4S04A 4CMBA 5I3CA 3W5IA 1VL8A 3AIMA 3WJ2A 2IS4A 4DT1A 4HVLA 4HV4A 3E2IA 2XH8A 5ILQA 1X9GA 3I0NA 3PXEA 3UCEA 3P9YA 4MCHA 3WXMA 5HFJA 2SCUB 2Y4NA 3E84A 3BQ9A 3VU3A 1IDN1 5KQRA 2OZEA 2H9AA 1PZNA 4O29A 5FP0A 3W7AA 1V8DA 2ZUCA 3E9QA 2PV7A 2G76A 1QHIA 3PXBA 4GR4A 1SKAA 4G81A 1ZOPA 2K4MA 4FW8A 2V98A 3SYKA 3KVYA 5EWGA 4N82A 4B79A 2QK4A 2QAJA 1JSCA 3T5TA 2PTGA 5C80A 1OBHA 4LRSB 4H7PA 2OSVA 5JJBA 5KSWB 1T1JA 3E9CA 2I3AA 2ZE7A 4MPJA 1SUEA 4L5JA 2EL7A 5FUVA 3EJWA 3B3JA 1L5HB 3E5MA 2DTXA 1LEHA 5JMPA 3NOXA 5FPPA 1L5RA 3JRWA 3JQPA 4IM7A 4KDEA 4A5SA 2CNQA 5T57A 1QE3A 1L0BA 4RETA 1IVNA 2P69A 2XZTA 5FBWB 4WX2B 3MNFA 4N0DA 4YAIA 1Z18A 3GT0A 1DS6A 1AH2A 1XQXA 2NO0A 2ORED 2CXQA 2FPWA 3LIPA 4I2NA 2Z9DA 3E3LA 4R0VA 1HI9A 3O9MA 3UMRA 5I47A 4C1NA 4EI8A 4KKVA 3O8QB 1MA3A 2ORWA 4P93A 1YKGA 3N5CA 4JDPA 1I2AA 1HLFA 5DLDA 3T7KA 1F8UA 1SQ6A 4YC7A 4DLSA 1EBFA 1C0PA 1KEPA 2W8LA 1N2JA 1QV9A 1T43A 2CZCA 2WKWA 3IOBA 1DIAA 1RWXA 4MJ3A 4IDQA 3QJ5A 4AMVA 3R9IA 2VPZA 4BKMA 1MR3F 3GP8A 2B35A 1YJ5A 4EG6A 1Y7PA 4TRNA 4BNNA 3X43A 3W5AA 4YRAA 3FTQA 1VE5A 1EUDA 2A2ZA 3GHHA 4GLJA 5DHTA 1IUKA 2ZSJA 5FLEX 1JLHA 2CL0X 1I1KA 2QSYA 2JKYA 1Y1LA 2O1EA 4EMSA 4BE4A 5C37A 5FWDA 1YL7A 4WCFC 1XTRA 4LGCA 4O2AA 5CDFA 3V1NA 4DJTA 3L43A 2G40A 2FWAA 4QECA 5HVNA 5AVKA 2HJ9A 1B15A 3W79A 3UBTA 4C0QC 2G04A 5HM8A 1DFGA 2DULA 1MHPA 3FDIA 4H0NA 4O4HA 5DISC 1I4WA 1NZJA 4RGQA 4OY3A 5LLSA 1P0MA 2NYAA 3RBVA 2GEKA 1AG9A 1ES9A 2WJJA 4I81A 4N8DA 1VCOA 4QUBA 4RULA 2X76A 2Q2TA 3HADA 4HJRA 4NC9A 4EQ5A 4I6JA 2OECA 5ALJA 3EISA 3CCFA 3OMWA 4YRTA 4ZCIA 1F3OA 3NC4A 1BWPA 1AUPA 1NM5C 2H2GA 1GGJA 3D7LA 4MR7B 1NLUA 3M9OB 2OLKA 3RVNA 3QUCA 1RBMA 4O2BA 3D5QA 1L2TA 1IN5A 1NWCA 3UMFA 1TVKB 3EVCA 3WBBA 5ADVA 3F5SA 4TUYA 1X74A 1YZHA 4INPA 5DBGA 2J07A 4Z3DA 2OFFA 4MRNA 4BIMA 1B6GA 4G01B 1N7HA 3OFKA 5EE3A 1KRWA 3DMDA 4B2IA 4NBKA 1RXUA 5FBHA 4EF4A 2W83A 2HXSA 3NDBB 2F3UA 3VU9A 5AM0A 1CJKC 3RKSA 2W0MA 5LL6b 1PLJA 1S3SA 3G6WA 1AX9A 3ZQUA 4DA8A 4K0KB 3PR1A 1CV2A 2NQ8A 4P38A 3NDRA 5KS8A 1OHHD 4J7CA 4U2DA 4JFRA 5HCUA 3W04A 4FSHA 3C41J 5FLYA 5A9RA 5J2TA 3REQA 3KWLA 5A06A 2JGDB 1VI5A 2NSDA 4ANFA 4GI1A 2X0JA 3UT6A 1WUIS 3WICA 1WDKA 1J2EA 3IAHA 2Z04A 2JBAB 2XWSA 5DN9A 3SS7X 3T52A 3NJ4A 2VDRB 5FR9A 2IYUA 3DVAB 1WQ3A 1XKLA 1J23A 3F49S 2OYCA 1SQFA 2W6IA 3DBHA 3F5MA 3TIGA 2CWDA 3GHYA 3NBUA 4CL8A 2FSUA 4BNXA 4BQEA 3C7AA 1HE8B 3O74A 5E6UB 5AXAA 1ZISA 2N1MA 5A7FA 2QUKA 2ZK7A 2YJTD 4EFMA 4WL0A 5DHQA 1WWKA 5HSGA 1UDXA 1HT2E 2YIDA 4S0ZA 4DA6A 4F96A 3KLPX 2P6RA 2VDJA 3BCUA 5T8KC 4J1TC 3C70A 2ZTUA 5KWSA 3AUJB 3ISTA 4X95A 4TT3A 1EKPA 5BVGB 1CETA 3D02A 2GCEA 4YCMA 4MYSA 3DVLA 2QZZA 1P1IA 5TQJA 3K0SA 3JZ6A 5ICMA 3AB3A 3N2KB 2IY8A 3D3KA 2O8CB 4ZEWA 2VI5A 3DV9A 4ARBA 1OYOA 1FTWA 1JXMA 1SCBA 2Q62A 1ZNXA 4KTTE 4QEKA 3I8XA 5ALZA 4RK1A 4PQGA 3ILXA 4P4TA 1D2GA 4JQYA 4NONA 4WD3A 2HSEA 5B3AA 1YASA 3O26A 3RWOA 4F2WA 1P60A 3BGWA 3ANTA 4MGZR 3IUMA 2A14A 3TZKA 3LRPA 3VISA 4BP9A 1PUJA 2PZKA 5I5XA 4MB0A 3TO5A 3IMFA 5B7GA 2WP8J 1KHTA 2RK3A 2XDYA 4HAYA 2ID4A 2OBNA 3G2JA 2EG9A 4IBOA 2COEA 5HV6A 4XB2A 5FTMA 3ACDA 4XSGA 3V3KA 1T29A 1G3UA 5HGJA 1NVMB 1ZDMA 3UW1A 1P8LA 2B98A 4ARUA 3F73A 1P7ZA 4A03A 3BCHA 4JQOA 4WKGA 4D9GA 2QYSA 4M22A 1GPJA 4US1R 1OROA 4DSZA 1JT9A 1XRNA 1DCFA 4L15A 5K0BA 4ND8B 1XCBA 3O03A 1CJBA 4S24A 3WL5A 3X1ZA 4TQGA 4B4UA 3GIPA 2WAOA 4ED2A 1JPUA 5H82A 3A4NA 3N28A 3ZCTA 5JFGA 4M6WA 1AMOA 2VJCA 1OIVA 3C3PA 3OIDA 2OE2A 1JWAB 1V2GA 2XW6A 1UDCA 3NEPX 1HTWA 3ZY4A 5JCOC 2BI7A 5HKAA 1UOOA 5AIAA 2B8JA 4OAQA 1LXCA 1DTSA 4TV9B 4G0YA 2YQZA 4C08A 2QNRA 4NHOA 3IPYA 4KBFA 3HKDB 2VR1A 5AKJA 3M3PA 4J3NA 4QLAA 2A4MA 2B92A 4RA9A 1E4GT 2DFTA 1GRQA 2Y0EA 3OCUA 4AO8A 4WESA 5BY2A 1AF4A 1H2ZA 1I7QB 3K70C 3P9QA 3KSBC 1J21A 4FNGA 1RC8A 3P9NA 3I5UA 3IEXA 1ABBA 4ZQEA 4R7GA 2WIBA 3B6ZA 3ELUA 3PNLA 4PBTA 4YV1A 2WG0A 3QJYA 1W5SA 4V3BA 3R6WA 5KIAA 1XTVA 1XD9A 3C45A 3GR6A 5NULA 4D4MA 1DG9A 3EGWA 3BG5A 3URMA 3FI9A 4ZKEA 1JG1A 3W2TA 1CUVA 3GBPA 4CMIB 5AKIA 3V3TA 3HO1A 3A6FA 4OHVA 3LFUA 1G5HA 4OKIA 4N76A 1RKQA 1FXSA 4NF2A 3HS3A 4PR3A 4YDHB 5J4YA 1CE8B 5IJAA 3MJSA 4KXVA 3KYHC 1E0DA 1P1CA 1Z38A 2H92A 3P2MA 5AOCA 1QHEA 2ZYSA 2OP0A 3LBFA 1PG2A 5EUCA 1U1FA 3KQPA 4MS4A 1CVIA 3M1LA 4YMWA 1YCDA 1K3FA 2GN9A 2HJRA 3PG5A 3QSGA 3C14C 2UU9H 1I36A 2ZTSA 3UKDA 4ZVVA 3MMZA 3FKJA 4I9NA 4Q7EA 1XMQB 3KKZA 3S2YA 4HTAA 3V4RA 3UCXA 3A6ZA 3W5CA 2HGWA 4PYKA 4YCSA 1E1KA 2GBIA 3PQ3A 1MBZA 1NVVR 5KFDA 2FWJA 3PQCA 3H4BA 1OC4A 3UTDA 4M1QA 2GPBA 3O1JC 1KOJA 1R0BA 4EABA 1R50A 4TM8A 5FAKA 1E1LA 1PI3A 2YL2A 2WIAA 4DHWA 4Q7QA 5F9LA 2GRAA 2IY7A 4GR5A 4P2BA 3DLIA 3W9UA 3ZV6A 2NVBA 3JYOA 1D2NA 2PUTA 2YVAA 4FYPA 2DAAA 2ZGVA 3PGLA 1MAUA 4L5IA 2N9UA 4PSCA 5ADWA 3HMKA 2XVYA 1HQDA 5ED4A 5CB0A 4GP6A 1W19A 3E8MA 1UMCA 2BM0A 3SU8A 1TQDA 1T8WA 3TQTA 4CGYA 5ITZB 1EVKA 4YREA 5ITZA 4EYHB 1Y1RA 1EXVA 4YUZA 2R60A 3RTCA 1V3QE 1NM5A 1X1BA 1AKNA 2R68A 3MC1A 1JAYA 4RHTA 4OVKA 3HB1A 4DLTA 4FDMA 1CEEA 3L1KA 1V6SA 2VUUA 1GAEO 3QWIA 3VHXB 3DWFA 1II9A 1GZ3A 5CFPA 4E5VA 2GEFA 5FHRA 4ACBA 5IH3A 5HQ3A 3TEKA 1I1OA 2F1IA 3K6KA 3R7WA 5LZ9A 2ZJTA 4D0RA 4RNNA 4RH3A 1KC1A 4D46A 5JZSA 2V5VA 4P80A 4RD4A 2C88A 3C5VA 3VV3A 6Q21A 1OZFA 2IH5A 3ZGZA 2G8LA 2X3UA 1Y1TA 4PAWA 4QPJC 4ZHQB 4R69A 4CEJA 2ZTVA 3GQBA 1P33A 2NMVA 3SOZA 1NG1A 3BH7A 3NH6A 1WMAA 2Q1XA 4RUAA 3GH3A 4IYRA 4ZGBA 4FC6A 4A2CA 5ESWA 5KCMA 5LB2A 2WDPA 3AF1A 2QXTA 1KZGB 3QEKA 4RZXA 3IEVA 4V0LA 3U3ZA 4C06A 3PR5B 1N33H 2FMIA 1Z7WA 3T5AA 2YYAA 4MV0A 3JALA 1SOWA 1C30B 3R7NA 3VKFA 2BEUB 1NURA 1QPGA 5B7PA 4LV8B 1XU7A 4U0KA 3ZK7A 2I91A 3Q7RA 3FCOA 3DL4A 4TV8A 2R1TA 1XCPA 3G7SA 3KBOA 4JLOA 4FCCA 4KN9S 4QATA 4R71A 1U7ZA 2CD9A 1UJBA 1TYBE 3G1TA 4TXLA 2EW8A 4X8OA 4Y0NA 3UVEA 1M0EA 3N70A 1I13A 1GKUB 4AG6A 2A7QA 3DZBA 3D6UA 3JXEA 1TU0A 2RD2A 2JFXA 1ZNYA 1U0NA 3D1JA 4ZZ1A 1I0ZA 1ZAYA 2P2GA 1KVSA 3EQ9A 4QAQA 1ODKA 1JBEA 3R7AA 1LSOA 2XMRA 3K0AA 5HTKA 3Q3EA 1FUEA 4RZSA 1PCXA 1JLLB 3EGDB 2ZBDA 3KDSE 5KT4A 2PGLA 2XMBA 2UUOA 121PA 1YSCA 3PZRA 4M9QA 5KWIA 4F4YA 3DTVB 4F9GA 1ZGCA 2QI9C 2VPXA 2Z2KA 4FW9A 4O59O 3H42B 2I1VB 2A5GA 2EZTA 4UJ5A 3HCPA 4JDUA 5LNK6 1SBIA 2CLFB 2BGKA 4E6NA 3N2KA 2WJHA 1R8JA 2C95A 3KB1A 3AEKB 4TTVA 4I9GA 2O3JA 4WOPA 3BS4A 3QWHA 5AUNB 4RBNA 1CY6A 3FGOA 3PPVA 1H4VB 1ZHOA 2PMDA 3BIJA 2QZ4A 2FRDC 4EBBA 1D6NA 4KR6A 4L8LA 4KPFC 2GA9A 4EGCB 4LJ9A 4EHDA 5KHOC 2HSDA 2WA2A 1DO2A 1DC7A 1RYHA 1SBHA 2OO7A 3I4FA 3I6BA 3OZDA 1YBAA 4Q1EA 4UW9A 5DNDA 3VYWA 1KTVA 4FHFA 4OH7A 2I4IA 4ZMBA 4Z3OA 4WECA 4HDAA 5C3EG 3WFIA 1C7JA 3WKAA 5ESXA 4KKXB 2EDCA 1JDVA 3EIUA 1T9DA 4KG7A 3WLIA 2B1RA 3W5UA 3BEDA 3WGVA 3OF3A 2WKPA 1XYYA 5KZMB 1UAAA 4XQ9A 1H2AS 1KP3A 3TGPA 2JLXA 3SXJA 2HIHA 2HNBA 2IDZA 4XIJA 3DEIA 5KC8A 1FVIA 4NNOA 3RTDA 1NR5A 3CZ4A 2JA6A 4UARA 1WUYA 2H0AA 4DDHA 5EMHA 3A1UA 2DPIA 1D07A 1L4GA 2R1VA 3F1LA 1IOWA 3RS2A 1U02A 3N07A 3LP8A 1P4AA 1QG4A 3DBLB 1EZ4A 2PQ0A 4Q15A 4R1NA 5CVDA 3TD9A 3WYGA 3ZPXA 1NNEA 4X0EA 3CNEA 5JAQA 2HMTA 3PJGA 1BGVA 5JS7A 3VPFA 3SC2A 2X0FA 1N9ZA 2D1SA 3SC6A 1A7JA 4RB2C 2JI9A 1IOLA 4L08A 3EA4A 5F78A 1GPLA 3DXYA 1QFYA 1V7QA 1PHRA 3EZGA 4RESA 3NXSA 3U7EB 1WPXA 4PW0A 2C3PA 2WAQA 4WKBA 3WLRA 3GLGB 2ZPAA 2ASEA 1K27A 4CKWB 1E1MA 1W0KA 2ID7A 1A27A 2E1RA 3TBHA 2D2IA 5ALLA 2ODPA 4INJA 4TGLA 4A2WA 3WGOA 1KHHA 2PYIA 2FE4A 4M8SA 3MYYA 1P5FA 3H99A 3D7MA 1JHVA 4EI9A 3HKBB 5HMLA 3W8FA 5DHUA 1TUGA 1GCOA 1RPJA 2XQFA 3DOHA 1EKFA 2I2XB 1DRJA 4Y2XA 4LF4B 2NO1A 4URHA 4CFYA 4HN9A 4JS0A 5I48A 4RKRA 4B6QA 5F2NA 1A72A 4IOLA 1KBZA 1P2UA 5DP2A 1NNI1 1A5ZA 1OZHA 1UFRA 2XJ4A 3GXOA 4ZU6X 5ICSA 2VF4X 3HBAA 5IYBG 5EXPA 4OV6B 2YFYA 1KU0A 1OX5A 2ZM6B 1VL1A 4NCBA 3RUHA 3U1VA 1BJKA 3MCAA 4XVRA 4TTJA 5JCXA 3AETA 4X64B 2ZYIA 4K9QA 4EFDA 1Y1WA 2Q2QA 3LF2A 4H17A 4Q48A 4D5EA 3U6BA 4XUCA 5AO9A 5JSYA 4DW8A 1O77A 1PZEA 2PH7A 2C31A 1IVSA 1TCBA 2BFWA 2FR1A 5JG7A 3DV0B 1Y6FA 5EWFA 1RI2A 4JB0A 4OXIA 4MYTA 2J3DA 4U7PB 5L3QA 2JHPA 1IATA 4R8SA 3ANNA 3JQAB 1KAHA 1WF3A 5DH9A 2QGNA 2IS1A 4IFTA 1NMZA 1PJQA 1SOAA 2OGSA 5DX0A 5KDDA 4MA5A 1G5TA 2J87A 4DL7A 3HB7A 3OFJA 5IW8A 3GL9A 3WSVA 4A8JA 1F4PA 1WXQA 3M8KA 4R9NA 4E15A 2MDTA 3PUXA 5LM3A 2XD9A 4TTSA 3RV4A 2DBYA 4A3DG 1GZ4A 2PT5A 2YIVX 4AWAA 1UBOS 2AZ4A 4A92A 4FLEA 1FPMA 1HM5A 4DRYA 2Q9CA 1L3BA 1XR3A 1JF8A 3W1BA 2BN4A 2BP7B 1DG1G 3HJNA 1V1JA 3F97A 4FZ5A 4PNPA 4B2PA 1AZWA 1C7QA 4HNUA 1IHXA 3KPUA 3MPUA 1U3VA 1XI2A 3QUAA 4QXMA 2A1UB 3NWEA 1A9TA 4YAJA 3LG2A 4EGSA 5LOVB 3Q12A 2Z8YM 4ZDIA 3QEBZ 2YHAA 2CLMB 1WCMA 3OTOH 4XWTA 5CFZA 1GADO 5COAA 1PTKA 1Z16A 3HH8A 4LWOA 1SXQA 3TDKA 3QFFA 2PWYA 5F1OA 6GPBA 4BWGA 2JARA 4DCJA 1YE3A 5TARA 1EFRA 1VJGA 1NBIA 4Y1RB 4DR3B 2GLTA 3PTAA 3ZWQA 5KFOA 3VSBA 3K8OE 3FVVA 2XCAA 3JQRA 2HSJA 1X0XA 3AUKA 3FPJA 4KH1A 4WUVA 4EYGA 1RAGA 1B3RA 3KR0A 4FILA 4GWLA 4FLFA 4KQKA 4ZRDA 1LWNA 5EZSA 1ZNZA 1CJVC 3PSHA 1UP7A 1N0WA 2OV8A 1CUUA 1SFOA 2OCAA 3MGGA 3QOXA 5DCWA 1TYDE 1DIRA 4RD3A 2GCOA 4E30A 3AVUA 2A5JA 3ZGNA 4FEAA 5BN5A 5LCXA 4PLHA 4RA6B 2WJAA 1VKZA 2IZ5A 1Q0ZA 5THXA 3TMYA 3FHLA 4FDUA 4RSMA 3HKZA 2I1QA 2WSSA 5U4QA 1K89A 3N8IA 1FVOA 1GZSA 3OEED 2BHNA 3G2NA 2PRSA 1DTEA 3U4CA 4CLEA 4ND5A 1JJBA 4YRZA 4P5PA 1ZITA 2BFOA 1EVLA 4G0VA 2IYRA 4RE6A 3LQFA 2OM2A 4BWSC 3I2IA 3VHLB 3U56A 1U0LA 2X6TA 3TLYA 2BH2A 4C4PA 3DL0A 1E9FA 2VNIA 5K6TA 4PC6A 2VG8A 3CLUD 4AZ0A 4W5JA 1UJ6A 4CIAA 1IZ8A 1TYZA 2ZBRA 3EFBA 4DIKA 4A1OA 3DLPX 2FEMA 3G2MA 5TPWA 4ZRNA 4EKYA 1MV8A 3I6MA 1EFTA 5EZYA 4ENVA 3LNCA 2G1JA 2CLLB 2IXDA 1XZCA 3U7QB 4BASA 1G20A 2A35A 3VYUB 1Y7LA 4AIIA 2B61A 1NBOA 4PCLA 4L8FA 1X86B 2CW7A 4Z4CA 3OAAA 4MVCA 4J7UA 2AU0A 1NUSA 3WMFA 2GFQA 1WB6A 3CLKA 1WD5A 4GKVA 4NBNA 3S2EA 4CHTA 5C32A 2XIQA 4PX9A 1JDEA 1ISFA 3AI1A 4ZTBA 4B4KA 1U3CA 2A9KA 1Q0PA 3FPBA 4NBWA 3SS9X 3HOZG 4C21A 3OP4A 3P9XA 4L8YA 1XNJA 4Q4AB 5AQ1A 4IJUA 4TS1A 2ILVA 1GNRA 3D8SA 2KE5A 3FY4A 3GFSA 3CR7A 4R9UC 4B84A 3M6FA 1VBKA 3QFCA 3RF6A 1FW8A 1J97A 5JSHA 1K92A 2A78A 4L4ZA 4GRIA 3JYNA 4HNRA 4A82A 4OTZA 4BRSA 4XUDA 4TMVA 4GX1A 3VR3A 3CYFA 4OGWA 2FFHA 2H85A 1TC1A 3UXMA 1W4LA 4R84A 4UEOA 5DYNA 1PV2A 5HCIA 3LQSA 3PDIB 3LSTA 1E2UA 1V95A 1JZTA 4ECVA 1V5GA 3T5JA 1YRQA 5GAJA 3BZBA 5B2EA 1RSZA 1A3CA 1R15A 1K1EA 2GO1A 1QIIA 2KLBA 5JCJA 4YCDA 3LLMA 5HG0A 3NDIA 4BVEA 1FJGB 1TLLA 4TM7A 3RADC 1D03A 2CNDA 2WKQA 1U7WA 3P2EA 4RWEA 4X61A 4I55F 3M1IA 2V7QD 1QLWA 3QFSA 1QS0A 2P9QA 2QG9A 5T4EA 3CGWA 3OKPA 1SXGA 1QO0D 5KSYA 4BQPA 3KVRA 1M6EX 3S2FA 4MVXA 2XDAA 3UUEA 1SCKA 2XUIA 1WXWA 1IL0A 1W0KD 4G09A 1NVAA 1L4MA 3F9CA 2C4HA 4OATA 1E59A 4HB0A 4N49A 3PR4A 3ZC3A 4E5PA 3GTMA 2FPSA 2QJFA 4G86A 3HR7A 2AR7A 2EJ0A 1UJMA 4PBSA 3S8EA 4K9PA 1N2CB 2XWPA 1DX6A 3DZIA 1OZGA 4ZREA 4R81A 4HNQA 4JI0H 2JA8G 1M1YE 1O57A 1XVVA 3IBSA 3CR8A 3IVMA 1QHXA 4KUEA 2J9YB 3UAWA 1Q57A 2B0CA 2XUOA 2Q28A 4LXGA 1Q95A 2W2KB 2YY5A 1WHSB 1W88B 3NLLA 1NW8A 3K5WA 2FTKE 4YRRA 1CUCA 5G41A 2GXSA 3EE6A 3UEOA 3UV3A 4AICA 4A2QA 1CKNA 1JHDA 1M2VA 1NPTO 1OFUX 3DDOA 1EK1A 4JLKA 2O07A 1IEVA 3FWHA 4BBPA 3U60B 3GGPA 5TR9A 3OMXA 3B1FA 1CY4A 1Y9ZA 3QW2A 3PA8A 3E35A 1N48A 4KAFA 4QA9A 4X63A 5CYOA 1Q7CA 4MJXA 2AOVA 3P2IA 3RUDA 3SX0A 3PD7A 1NJ5A 4FYYA 3RS8A 2DR0A 5A3QA 1NQTA 1ZUNA 1UODA 3O1IC 5DM1A 2WM2A 4E08A 3Q88A 4DYVA 3K09A 2D0IA 1RJEA 3AQ4A 3W0LB 2XE7A 1JH9A 4TMFA 2NP7A 4JJGA 1Y7HA 1RPNA 2X9GA 4BPRA 2A88A 4NZYA 4D97A 3LQKA 2H59A 2X1HA 2RH5A 4UZEA 5D1OB 1M34B 2D00A 1RJDA 4R9VA 4XDGA 2EP7A 2BE7A 1CD5A 3Q7QA 2IQ5A 3MR6A 2AJ8A 1F2VA 2CNUA 2CJWB 4DR6H 3AQIA 1UT6A 2KLHA 2ZVQX 3C7CB 1USKA 1M6NA 1L4LA 2HBRA 3D3QA 2O8DA 1A97A 1SA0A 4WASA 3ELYA 3BFJA 5I4BA 1XJCA 2D8AA 4FE3A 4LF8H 1KIFA 1ZA1A 2JNWA 3FNRA 4FZ3A 5K8TA 3AG5A 3T4UA 2EZ4A 4R0NA 3FTCA 2EZUA 4NESA 4XGKA 5AJYA 4UFZA 1FUIA 2ZIFA 5ALTA 2WM9B 1HC7A 3AFIA 4XFKA 4WBNB 2WAAA 3IQIX 4EJ2A 2ZAMA 3GA0A 4BMPB 3DD5A 4DPMA 2C0QA 2KX7A 4H6PA 4BV9A 4RHUA 1Y1VG 4QSHA 1EXNA 1ONNA 2QR2A 4DMCA 3CRW1 2UVPA 3DO8A 2K2QB 3EXEB 5PGMA 1AV6A 5K9ZA 1NZDA 1OR8A 2BF4A 2N46A 5BSUA 1HRDA 4UKDA 5TPZA 3EQ2A 1AB6A 2XDQB 3FYSA 5C35A 4BVLA 2P9HA 5BV7A 4BJ3A 3H8VA 4DL2A 2WWFA 5C4GB 2Q7OE 3SFVA 3MCUA 3GTGA 1L4NA 4MICA 5AOVA 1PX2A 4YR2A 4R8UB 1Z25A 1Q11A 3E03A 2F9FA 4JYMA 5D00A 1E3DA 4AZ0B 3DPSA 3H8SA 4JVMA 3C3AA 5BMOA 3QMWA 1CB0A 4GI7A 4ASUA 2P0YA 1O95C 4PYIA 4PXYA 1SVIA 2QW8A 2VRCA 2X77A 4PPFA 3BIWA 2W4MA 3LLVA 3MCVA 3W4IA 1KORA 5EMJA 2P68A 2QUBA 1K5GA 3MCZA 4AN1A 5EPOA 2ZUFA 5KG4A 2IU6A 3K8ZA 5ERXA 1PZXA 1E7WA 4LY9A 3M4JA 2QT0A 4H1VA 1P61B 3ET5A 3EG5A 3HYCA 5FUYA 2EC5A 1ECGA 1FNCA 3IAUA 5K3DA 2ZDGA 1N7GA 2E2IA 2XR1A 1XTTA 3ND5A 4MV9A 1K63A 1NX6A 1VCNA 4Y6LA 3WNBA 3WVNA 5I7FA 5I7UA 4TLDA 3ZXIA 4V1CA 2GRJA 3AF6A 3V7FA 2IGTA 2D54A 3EQ6A 3JATA 3NB0A 4QARA 4BMVA 3A6PC 3X1XA 3Q40A 1XD8A 2A7XA 1I6UA 3HU5A 3M9MB 2QAGC 1T6NA 1NVEA 3DZGA 1Y5RA 5CT9A 2HBQA 3Q9LA 5ALGA 4A4DA 2VCYA 1BWQA 2YIMA 4ALLA 3QY9A 2B8WA 3IEMA 2ZRCA 2IT1A 2C5BA 4RAYA 1Y7TA 3ZV3A 1PEYA 3RQIA 3UC9A 4NS1A 1XL1A 5MF6A 2NZWA 3CXRA 4OM8A 1QG0A 4NOKA 1IZZA 3ZI4A 2JEYA 1V9CA 3KHHA 4Q03A 1GY8A 2I2FA 1J2JA 1Z0AA 4LH6A 4QJ5A 3TSYA 1K8XB 3PD0A 2R9VA 2YN2A 3IT1A 2BGUA 4R41A 1VGRA 4RAQA 5ECWA 5H4GA 5IVPA 3VM6A 3PBKA 4HATA 2O57A 5F77A 3N76A 1KDTA 4FX2A 4TZTA 4XJTA 2DUJA 4Y2PA 1L7QA 5CH3A 5HE8A 5JFOA 1SCJA 4POAA 5EI5A 4O4IA 5BWXA 4HDOB 1SAYA 1UT8A 5IXSA 3HCDA 4HYYA 1WCIB 5E7QA 4F4XA 2JI4A 2AFRA 2VTDA 4EYSA 5ALNA 4ZIRB 1YQGA 1RPAA 3QVOA 3COZA 5FWAA 4RF3A 1H5QA 1GXSA 4I46A 1GZ5A 1K7XB 1U6KA 2WG2A 2QDKA 1MDBA 4PLZA 1OPXA 2XGQA 3W90A 2YFHA 1RRKA 3ONWA 3NALA 2V1UA 3RABA 2J0UB 4TVBA 4UBKA 3MTJA 3MGCA 3WWYA 4BZWA 5HTOA 4MUIA 4BO2A 2R84A 3IDQA 1VSQA 5H9WA 1E3QA 1P6UA 4D81A 1IY2A 1NOIA 2X8JA 3HL0A 4UFOA 5DVZA 4BHTA 4CVNA 3TDMA 4BBZA 1S4QA 5AUQA 4ETIA 1AQ6A 1FQOA 2F43A 2LE0A 4ESVA 4NXNH 2J6HA 4JI7B 4IUDS 3HV2A 1CERA 1CRLA 4K9SA 4LF5H 1TYCA 1Z12A 2QE7A 4E32A 2OCKA 5IABA 1AS0A 2MINB 3HN6A 1O6CA 3IP7A 1GQOA 4GFDA 1OREA 2CVFA 4HAZA 4JYCA 3E1KA 2W43A 1ZUD1 3DR5A 2PKYX 2RJOA 4LC1A 4OMUA 1T3LA 1I1NA 4A2PA 1HEYA 1UJCA 1XP8A 3FFXA 1JNYA 3KWJA 2YUTA 4GM4A 4BEWA 5L3QB 3L7DA 3T5PA 1R4MB 3M4NA 1R64A 4TTRA 3VNQA 4JMPA 1P62B 3VMMA 1HMPA 4Q45A 1V9SA 2OTCA 1GGEA 4YV0A 2EKBA 3FSEA 2GAOA 5E3HA 1WD7A 2QX8A 3HFSA 1T0PA 3GAFA 5DP1A 2VPQA 5C7YA 3HOVG 1IHYA 3A25A 5K3CA 5L1JA 1FU8A 1QF7A 3FYHA 3RASA 4PLGA 2QTBA 3RIZA 5JEEA 3WRWA 4F93B 1BTOA 5ALVA 2QR3A 2WU0A 4RKYA 1VECA 3PHHA 2PFGA 4JLNA 3TPFA 1N4DA 1R9NA 3MWDB 4V1CI 5GINE 4B3MB 4EZBA 4NR0A 3M3HA 3HHPA 3IIEA 3JD3A 3BCSA 4L2IA 4OXYA 4N3CA 4UZFA 4YJ3B 1YR2A 3DHYA 3DO5A 1RM4A 4FD2A 4D80A 3ZDBA 2O2IA 3Q8QB 5DNEA 4TN1A 2CB0A 5TF4A 2BFPA 3E3AA 1MIOB 4R3UC 5JZ9A 2OBLA 3B6EA 4QYWA 3H5VA 1QBKC 3ZYCA 2HJSA 4XQEA 4C4SA 2BTOA 2R6R1 3O4FA 2Y4OA 1PK7A 2E2WA 4IOKA 4KP7A 5DWDA 2BEVB 3A3NA 4QWWA 3DWIA 4BVAA 3GIDA 1UBFA 3F7OA 4KQWA 3IXMA 4PZCA 2QMZA 5DTRA 4YP1A 3R4VA 4ND7A 5AK0A 1CZUA 5H0IA 4B75A 4U7WA 2JVIA 2Q7DA 2ZBEA 3K4PA 4XX0A 2F3QA 3RRZA 1DCTA 1K7EB 1ESDA 1CY8A 2XCOA 1T3ZA 1R5JA 2X5RA 4GE3A 2AOTA 4H16A 4JJKA 3AJAA 3SJAA 2H1OA 1P3JA 4P7KA 1LPNA 3ANMA 1JKXA 2NO6A 4MI6A 2LIPA 4LZZA 3V8VA 2O2SA 3I34X 4FS8A 3COVA 2W2NA 3HA3A 2JA1A 5GONA 2HCBA 3AEKA 3KL2A 4IXNA 3N8KA 4WJZA 5BR7A 1JKFA 1GUAA 2BD0A 4D9IA 1SXIA 2C5GA 1WLSA 4KXQA 3KOYA 1ST3A 2C7QA 2NVOA 4M9RA 4QBTA 3MJEA 3V97A 1SMKA 2G6BA 5HNEA 1HXHA 2I66A 2O7NA 2ZT7A 2R8YA 3CKKA 3H5RA 2IW1A 3Q0TA 5FA8A 5B1IA 3TRKA 5CEEA 1VXRA 3ETJA 4CF6A 1W44A 1P16A 5EZ6B 1FS4A 2EARA 2PU5A 2G72A 2WT8A 5DWQA 2ISQA 1WB5A 2KMLA 3PSAA 1E98A 1WUTA 2A0XA 1LKZA 2WJWA 4KNWA 2VRCD 4R6WA 3MJTA 3TZHA 5AW7A 2GQRA 2Q9BA 4M21A 1R00A 2YIJA 1BDMA 3CUWA 2OFPA 3JR7A 3V1YA 3ORHA 1X7ZB 2HAEA 3CJQA 4MINA 4RXUA 5G3YA 4BO9A 2BHRA 4L0CA 5FPTA 2REQB 3K1YA 4S1VA 3C39A 2G06A 3P19A 3VDXA 4WESB 3L6UA 3WV4A 1SULA 2GJSA 4JP2A 4PIPA 1I0LA 4WLEA 5ULLA 2ADFA 3TFQA 4GT1A 3AY7A 2UUCH 4NFSA 3AYHB 5FD8A 4OHOA 2PRYA 4GC9A 4OLBA