1EUDB

Crystal structure of phosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
393
Chain Sequence
b'MVNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKARELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
molecule tags Ligase
source organism Sus scrofa
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
total genus 131
structure length 393
sequence length 395
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1eudB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1eudB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eudB03
1BNCA 5CA1F 5LA6F 4O81A 2SCUB 5JVDF 4O7TA 2GQSA 1C30A 4XZ3A 2CNVA 1UC8A 2YRXA 1AUXA 4ZOLF 3Q1KA 1JLLA 5JH7F 5JQGF 1M6VA 3Q2OA 3U54A 4O7LA 3VPBA 4O7VA 3U9SA 5H80A 3WO1A 3DF7A 2NU7B 3TQTA 4MA0A 1KBLA 2Z02A 3R5FA 4O4HF 3GIDA 2FB9A 1A9XA 2C00A 3RFCA 4EG0A 3HBLA 1VBHA 2GQRA 4TV9F 4YB8B 1I7NA 3MWEA 4C5CA 2W71A 3AX6A 2W6MA 4FGRA 5LP6F 2PVPA 1E4EA 2NU6A 2ZDQA 3JZFA 3V4ZA 1OI7A 1SCUA 2XD4A 3OUUA 1I7LA 5J2TF 3JRXA 5BMVF 5C1OA 1JDEA 3K5IA 1EHIA 2I87A 3TIGA 2SCUA 2CSUA 3TINA 2FPIB 3K3PA 3PFFA 4WBNF 2DIKA 1EYZA 4MV7A 5HBRA 2FPGA 2VR1A 3WNZA 4MV3A 4O4IF 2J9GA 4L1KA 4XYMB 4HR7A 1ULZA 5CA0F 3KAJA 4MV9A 5BPFA 4O7NA 4IHJF 3G8DA 1PK8A 1Z2NX 1VKZA 2R86A 1Z2PX 1EUCA 1JLLB 1OBGA 2HJWA 2R7LA 2QK4A 2FPPB 1W96A 4IIJF 3K5HA 1JKJB 5CAEA 4Y8VB 2V59A 3KALA 2YV1A 1KJJA 3RV4A 1CQIB 4IWXA 5C1PA 3VA7A 2YV2A 1JDBB 2IP4A 1B6SA 2R6FA 2FPPA 4O2AF 4ZI7F 1DIKA 3U55A 3MWDA 4O2BF 2V58A 2GPWA 4EGQA 4MAMA 2PN1A 3JZIA 4XX0B 1GGOA 2CNQA 1EZ1A 4YBZA 1KC7A 3G8CA 1CQIA 4O7YA 5CAEB 4QSHA 2FPIA 2NU8A 2FP4A 1PX2A 1SCUB 2ZDHA 4FU0A 3ETJA 4YAKB 3LP8A 4HQ6A 2I80A 5D8DA 4XYLB 4XYLA 2XCLA 3KREA 4E4TA 4O7RA 1UC9A 4YB8A 4XX0A 2W6QA 4IZOA 4MA5A 2YWVA 2X0SA 1CQJB 2FP4B 1CS0A 4WD3A 2R82A 3LWBA 2YS6A 4YJ3F 1KUTA 1E4EB 4RZQA 4EGJA 3RUPA 5HV6A 3VOTA 1WR2A 5I47A 4O7ZA 1KJ9A 4MV6A 2HGSA 3R23A 1OBDA 5KX5F 2W6OA 3HO8A 4I50F 2NUAA 2YL2A 2NU9B 5HBRB 4Y8VA 3GLKA 4TV8F 5LYJF 4O86A 2GLTA 3JRWA 1GSOA 4NYEA 2R85A 5DMXA 2W6ZA 1C3OA 1T36A 3ORQA 5GONF 3SE7A 1DV2A 2NU7A 1VBGA 4HNTA 2YW2A 2R7NA 4O83A 2YZLA 4HNUA 3ETHA 2R84A 3ORRA 2NUAB 3E5NA 1EUCB 3BG5A 2DWCA 2W70A 4ME6A 2CQYA 3MJFA 4O84A 4YJ2F 5JQWA 4MV4A 4C5BA 1A48A 3N6RA 1EUDB 3VPCA 2YZNA 3VPDA 2NU9A 2YRWA 3OUZA 3DMYA 5KKNB 2R7KA 3V4SA 4O82A 4I55F 4YAJA 1W93A 3R5XA 4MV1A 1IOVA 4ZQIA 3KAKA 2V5AA 1DV1A 5EZYF 2P0AA 4MV8A 1BXRA 4O4LF 4DIMA 4TUYF 3TW6A 5C8YF 3RV3A 3WO0A 2VQDA 3HB9A 5CB4F 4XZ3B 4O4JF 4DLKA 2YZGA 2YZMA 5IYZF 2FPGB 1KJIA 3MWEB 2PBZA 2QF7A 2GPSA 2R87A 2CNUA 1M0WA 1KEEA 1GLVA 2NU8B 3AW8A 2DLNA 4FFLA 2W6PA 3QFFA 4FFMA 1GSAA 3R9RA 4M9UA 4FFNA 3NUAA 4ZHQF 5BPHA 4YBZB 4IWYA 2DZDA 3R5HA 4YAKA 4YAJB 4I4TF 1IOWA 5K2MA 1CE8A 4FFRA 1Z2OX 1KJ8A 2YYAA 5J2UF 2YS7A 2OLSA 1GSHA 2R7MA 5JVLA 4O7SA 1EUDA 2VPQA 1M0TA 4O7WA 5LXTF 3TIIA 3MWDB 2W6NA 3I12A 4C5AA 2ZDGA 2Z04A 4HNVA 2I8CA 1CQJA 1AUVA 2NU6B 1KJQA 3N8DA 4FFOA 5LOVF 1B6RA 1JKJA 4XYMA 5FNVF 3UFXA 3VMMA 3UFXB 2CZGA 4FFPA 3U9TA 4FE2A 2WYOA
chains in the Genus database with same CATH superfamily
1SZJG 2G8LA 1LY1A 1NVDA 2X0FA 2H1OA 4RS4A 5F1OA 3OZGA 2PUBA 1C1XB 1I7PA 2YNMD 4FINA 4QHYA 4Q9DA 3KB2A 1WB6A 3TDMA 4DC0A 4W5RA 2FK3A 3AUSA 2ZIWB 3I9OA 4KFUA 3BH7A 4R2KA 3URMA 3VR6A 3GLGA 1VKRA 3QX8A 4KACA 3W7VA 3OEWA 3HSYA 2P2DA 3WYAA 8ABPA 2UYYA 4J03A 6YASA 4OXRA 5J40A 1TUBB 3GIQA 1YC2A 4YJHA 4UFOA 1BEZA 4YBRA 1EVIA 3CNOA 3RK1A 4OH1A 1H6BA 5FBVB 2J3JA 3THWA 3JQGA 3H97A 4KIGA 2VZLA 3GTOA 3VO8A 5ERXA 2OV3A 4OP3A 2OSVA 3T7JA 3V4VB 4BB5A 3PK0A 3RKUA 2G25A 3F3MA 4N6OA 1G6Q1 1ZD4A 2VJYA 2IPNA 1M6VA 2HO4A 3B52X 2HV9A 1VTKA 1OWTA 4INJA 1MC5A 5DCLA 3TLEA 3UAVA 3U44B 2ZAOA 3LZ6A 2EJ3A 2CUNA 4IEIA 4QGAA 4QFMA 3WRXC 4L8YA 1JDNA 3MGBA 4L7VA 4A16A 3EXIB 1HDCA 5HIJA 5A7FA 3S68A 2YH2A 3U3XA 1LDNA 1I1OA 1QHIA 2HH9A 2CFMA 5D1NA 1XMVA 2IU6A 1HGXA 4AKTA 1WL8A 2ZIFA 2ETXA 4NE7A 5K3FA 2NTEA 1OFUX 1JKMA 8ADHA 2XNDD 4DBZA 4CLEA 4NBTA 1JAHA 2CD9A 4ZCLA 3NDBB 1PR0A 5C8YA 3T12A 2FFHA 3SHVA 3T1QA 2JA7A 3PF8A 1SD1A 2HRZA 1Z5OA 1V6CA 5EY5B 3BCSA 3TQIA 2WKWA 2JDIA 5JO0A 4EG0A 1ZHSA 5DGAA 1ATIA 5JCOA 1VBHA 2GF0A 1ST2A 2KX7A 1ADCA 1I7NA 1UJ4A 4H7KA 2GVZC 1U1DA 1MJNA 2J33A 2ROQA 4GOND 5DPMA 3ZIAA 4ERXA 3G2JA 4MR9B 5HWSA 3REGA 3H5NA 1J07A 2W6MA 2JJ2D 4HDMA 4WV3A 2VUIB 3OM1A 4BUJA 1SBCA 4BVEA 3H7IA 4DR4B 1IOLA 1W6UA 1T6YA 1PR4A 3CKYA 4ZVKA 3ZDQA 1T5OA 4F93B 1C0KA 1G9TA 1U6IA 3IE1A 3R5TA 1FS4A 4AKSA 2QS9A 4AP9A 3V4ZA 3BUSA 3DE0X 1P7ZA 2ZI9A 2P2ZA 1LK0A 4KO3S 1WP4A 2X0NA 1N0IA 3ZZ0A 3MFHA 1SQ0A 4N0MA 2VH1A 1CRPA 1Y4DE 2XQKA 1NUHA 1RQRA 4O33A 5GTDA 1UBUS 2ZULA 3I9V6 3KUDA 4F5YA 4ANFA 4NCJA 1YWGO 1JDJA 3JYOA 4EUFA 3NVDA 3N7TA 4DV2H 4HAOA 5DOZA 1OBFO 4ZCRA 1U8CB 1ZU5A 3HFJA 4EY7A 3D3QA 4S12A 2GEBA 5AM5A 2WIKA 3S8YA 1JSCA 2WZDA 3SZUA 4GKAA 4B3HA 1M1YE 1IN1A 3QWFA 3R24A 4RMIA 3ODGA 1GT6A 3D2CA 1J22A 3NAZA 4HOYA 5EIHA 2Z2IA 5TGDA 4MEJA 1L1EA 1KJZA 4AQYB 1KY2A 2PFKA 3EEIA 3GDGA 1FDSA 4ZV9A 3JQ8B 1U0TA 3RRNA 2BKVA 3L8FA 2H1IA 5D1OB 3P94A 2QUAA 4KDRA 2P65A 1ZN7A 1Y7LA 3DE6X 2A9KA 2XPCA 3F6SA 1Z4QA 2WJ6A 3LT0A 2QLLA 5TPWB 4A10A 1LDYA 1SWVA 2PLWA 1YB5A 4IUBS 4I9NA 1P39A 3ZY5A 1NYTA 5C34B 4P4NA 4NU5A 5EIOA 2OCIA 3UFBA 1FFBA 1O1YA 1TT5B 3FMOB 2I4IA 1L4MA 1EDOA 1W0CA 2FSVA 3OPYI 2GM3A 5IZ4A 2HT6A 1PP4A 2XRFA 2XVAA 4Q9HA 2RJOA 4R8VA 4O4IB 3RS8A 3VH2A 3BWVA 1RLOA 2Z6AA 3OE1A 4KXLA 3KFXA 3R6DA 3RUAA 1NVEA 4NHEA 4CG0A 2BGUA 4CMHA 4Z1OA 5FPYA 2XA2A 4D9JA 1AB5A 5JVDB 4EPYA 5AESA 3KVOA 3GAZA 4FOLA 5C31A 5AM3A 4QQFA 4NZOA 4R0NA 1AXGA 4MW9A 5BWXA 2W6CX 4KN8A 3WDLA 2JRCA 5JATA 1XO1A 5EHQA 1US8A 4ED2A 1EFCA 2HJGA 3HCOA 5EYPB 2HUNA 1VSVA 4AFNA 3C6BA 4FS2A 1BTOA 3JAMA 3MMPA 4PFSA 4PGGA 2MMCA 3ZDRA 3H1EA 1QO0A 4D92A 4GLJA 5EJ9A 1BROA 4RFSB 5CX1A 3RREA 4NBVA 3DAYA 4URUR 2OUIA 4M37A 1XLUA 1Z7GA 1DQSA 2PX8A 2XTZA 1E3QA 4HEQA 1A5ZA 3E7WA 1GCAA 3RC2A 4FEAA 1K0FA 3TVYA 5LBTA 1AZSC 1GZ3A 2WJPA 3NEJA 1XYGA 3PHLA 4X0EA 1U7DA 2N42A 1NBMA 2NZWA 3ELDA 1WMEA 1DOHA 2GNAA 4HAZA 4IEEA 5J5VA 3T9EA 3BJMA 4DLSA 5JCPA 1OIVA 1YZNA 4IIEA 1H4QA 3DTTA 4ICIA 3BB3A 1XKQA 4JNCA 1W2HA 3GWZA 1KVTA 4JC8A 4XB6B 4Y2GA 5ES3A 4M7PA 5A4FS 4JA2A 4OAQA 1H69A 3UPDA 3ZE7A 4G6ZA 2JIPA 5I4BA 3LK6A 5A4DA 4C03A 3RV4A 1D09A 2IYSA 1CDOA 2PWBA 2C5LA 1GNPA 3BRWD 3ZDFA 5EJ5A 2CBXA 3IJ5A 4NMWA 3QKSA 4MIOA 2IV7A 5HYVA 1D0IA 3DBRA 3NHRA 5I5VA 5P8WA 3VVCA 1E2LA 2YV2A 4PEVA 2V45A 1BDJA 3FIUA 4H0FA 3S2GA 1NQOA 2W9XA 3C6MA 4PSAA 4EY3A 5AW2A 4RPGA 2VP2A 3AHCA 3L8MA 1PD1A 5BR8B 2I6UA 2IYNA 1A9OA 4Z8XA 5HJ5A 3WL5A 3K0SA 2R7ZA 3DJFA 3P9KA 5JHHB 4IDHA 1DQNA 1UDRA 1V4YA 3IYLW 5K0NA 1IXYA 1N8KA 1E9DA 1V41E 4RNDB 4UVDA 1HFWA 4B7UA 3ZEAA 5ADVA 1WSBA 4X7BA 1DAGA 2WNSA 2BGLA 2X1MA 1BYIA 4JBYA 2FZWA 4XX0B 2WWRA 1YVUA 3ED1A 3MYRA 3A10A 4Q12A 4UVHA 4K9OA 5GMOA 1K3UB 3QXSA 5JC8A 4NAUA 1G17A 1I6WA 1JQDA 3MBIA 1R0KA 1U94A 3KOMA 4P1ZA 1LBIA 2AH5A 3TLAA 1RLUA 3CRMA 2IPXA 4UM9B 2LTAA 2YWHA 4I55A 4I7EA 5LLSA 1SXHA 1AZLA 4BKOA 3Q8LA 3UZBA 1KOFA 1BOFA 3T94A 5FO1A 2ZRPA 2R2AA 1T1EA 5TGTA 3MGAA 5D84A 3TAHA 3GMSA 4TMTA 5DGXA 4UZSA 3O31A 4M46A 1J24A 1V96A 1ZJ6A 5DM70 2DAAA 1H0RA 4AD8A 4L5BA 2IPOA 5IVIA 4RTKA 2O3TA 5TMDA 1U5AA 3JWHA 3CNLA 2JJ2A 1NA5A 3QVXA 5JD5A 2F55A 1IN7A 2P77A 2DTDA 1IBMH 3D3EA 3LZDA 1CUBA 4IXMA 5CNIA 5IBRA 2HF2A 1RE0A 2HV8A 1GO2A 2VOEA 3DL7A 4EKEA 1TLTA 2BR0A 4W5HA 5DGBA 2WB4A 1XVTA 2FPKA 2RHBA 3I9JA 4MUIA 4C6TA 1B6GA 5IASA 3KKZA 4RCYA 4LOJA 1Z4NA 2JIDA 4QXPA 4ECZA 5FUVA 2O59A 1F06A 2AUTA 3EHEA 4E51A 5K8JB 1Z3IX 3T54A 4AQDA 4S05A 5IS2A 2PMWB 1NKSA 1VYTA 4MVCA 3MQ4A 3Q8QB 1GD1O 1OQAA 2HB6A 4YJ3F 1QBKC 4K6MA 1X7HA 3JU3A 2OVBA 4II7A 2B37A 4ZZ1A 4K1LA 3DVAB 3SJUA 3WRWA 2JH8A 4CM8A 5KVAA 1XRMA 3CR3C 4XAQA 3G0BA 4KDCA 1QYIA 2GETA 4Z9AA 4YRJA 2Q2NA 5B4TA 1DRJA 3OUTA 1HKHA 5KT6A 2V7VA 1CUSA 2IU3A 3CO5A 3N2EA 3G8YA 5DLEA 2R1VA 3DTGA 3PDJA 5H4HA 2CXRA 5B1SA 4O7ZA 4HQ0A 4RA9B 3RK0A 4DWOA 4PHCA 4XQEA 4WZBB 1U99A 1XZLA 2B0CA 1P6XA 1NMQA 1BXZA 3IHWA 1GEEA 1YB2A 2VYFA 2VQ6A 3K20A 3N3AC 4NIMA 3SZ3A 4JEUA 4F5DA 4EBCA 4EJ2A 1KA9H 5BVHA 4AKEA 3LQ2A 3GN1A 1M2VA 4Y2YA 2C9CA 4NLLA 2NU9B 1HLPA 3HPQA 2HL6A 5HBRB 2AJTA 4FYJA 3UH0A 4IZIA 4DAOA 3DV0B 4ER7A 4HSEA 2ZUEA 4LVUA 2V7BA 3CPSA 3M5CA 4DSTA 3IEKA 2C42A 2H7CA 3ET5A 2WSIA 5TPZD 1LSOA 2JEJA 1JEEA 4TSRA 3U1TA 5IKOA 4B47A 4DQUA 5JCZA 5DAAA 6AT1A 4G0ZA 5BOSA 3ABIA 3NHMA 2Z9BA 1PW5A 3VYTB 2IEDA 3Q2IA 2NUPB 4WLEA 5A71A 5DLGA 3PX2A 1W85B 3MUNA 4KUEA 3KEMA 3L7YA 4PZEA 5DX1A 1Z34A 2YHIA 3ZJTA 3GO4A 4DV2B 1Z8NA 1YAHA 2QL7A 4P38A 1SAYA 2ZI4A 1E1KA 2PO7A 4OM7A 5D3QA 1WABA 4W5WA 5I9TA 3EF0A 1G3IA 3UJ6A 5C0OE 3JWPA 3G0HA 4JENA 4S3MA 4RY2A 1XLWA 3V8EA 1TM2A 4DQNA 1UODA 1XHFA 1XRQA 4KK4A 5FBKA 3OU2A 1CR2A 1QAMA 1ZS9A 4RMJA 2NVXA 5T4EA 1XN1A 3ZWCA 2HPAA 4YJ2F 4BY1G 5JQWA 4MV4A 4FBUA 3IO5A 3HJRA 1C9KA 1L3IA 2Q0QA 3ISVA 3GJTA 2IDKA 3IALA 4LYJA 5DI3B 4JI3H 1QRRA 4Y0VA 5IUKC 3VPFA 3OLXA 1FVXA 1M2FA 2ZVDA 4XFKA 1IUNA 4XVRA 4KQWA 4AN1A 4G8BA 1HEIA 1SOUA 2LKCA 2DSNA 5FWAA 1U80A 2EBWA 5AKYA 5JE8A 2FRXA 1SBNE 3OWOA 3SBEA 5IMBA 2BGTA 2WTAA 3I6BA 4GXNA 5A2QA 2EGHA 3N0XA 3MAGA 5HKAA 1QTNA 1MAVA 3VR6D 3KM0A 1OLXA 5LXTA 1RZUA 4XI9A 4RTNA 2AMVA 1S2IA 3O90A 3SFVA 3M4JA 1ZLYA 3UEOA 4I5FA 1PK7A 1AKNA 3NT2A 3OBIA 3U39A 4WXYB 3EHDA 2AOVA 4PHGA 1CUCA 4LGVA 2WIDA 5M5BA 5C80A 1OT5A 1C7QA 1XVLA 3V4FA 4UE3S 4NZZA 2RAVA 3UJAA 1Y8ZA 4E1AA 5DIZA 4F11A 4KGZA 4F4YA 3DMPA 2IPAB 4P22A 2VNAA 2F3UA 3MTQA 4DIMA 1EK5A 2L19A 3NYIA 3ZHYA 1DC7A 2BLNA 5AKHA 5BXQC 1KC1A 2ZJOA 1R5OA 4W6QA 3AERB 1G3QA 3GHHA 4R1QA 1IBLB 1O77A 1ZHOA 4BMVA 1JQLB 1FDUA 2CDCA 2MT9A 3FBWA 5LP1A 1G42A 4U8GA 1C8KA 1XZHA 4U6QA 5KFGA 3KWLA 2WSSD 4R01A 2AVNA 1A97A 1X1SA 1WU7A 4NYIR 4D6PA 2YBDA 3SM9A 2DH6A 1R8QA 4DEYA 3G8AA 4XJXA 3QFTA 1HETA 3A2NA 3PQ7A 4U7PB 1C4OA 1M10A 4XDYA 3RPEA 4BB0A 3ZJUA 4WESB 1H9BA 1ZGZA 2GDZA 1M2WA 3QQ5A 1UAAA 3P32A 3BCHA 1F7UA 4J43A 1JIQA 3AW8A 3RB6A 1ZUNB 4FYYA 3H4DA 2AEJA 2VKQA 3EQ9A 4KQMA 4U39A 5DLDA 2YIVX 1ZM7A 4LFBH 1XLVA 5JCOC 1GSAA 1J5PA 2ZRCA 5ALYA 2COKA 1W6RA 1GKIA 2GZ2A 5HDBB 3VH4A 1C3XA 3NUAA 2PEYA 5LCXA 3KYHC 2IBSA 4KXXA 3U09A 3CGWA 2H48A 4EEKA 3MOSA 3CRQA 2HU2A 4XFDA 3GPBA 1JT2A 2ZIEA 4OFZA 1RHUA 2VAXA 2NV2B 3HA5A 3SDZA 4J0DA 2HYIC 1O7JA 1LLQA 2NO1A 4E2FA 1V8BA 4I66A 1UXJA 4J2OA 4OQXA 4G0UA 2FP3A 1OXMA 5BV8A 2QYHA 5DCWA 2I55A 3ZBQA 2IOYA 4IGKA 1DBVO 1GFZA 5IT4A 2BFOA 2HY7A 2GB4A 5DYNA 5EYPA 4QWEA 1NBAA 1EX9A 4OKSA 3BIXA 2NMVA 1I3OA 2M32A 3EZ6A 3GELA 4TVSA 2ERCA 2OORC 3NBAA 3IIJA 1M0TA 3R0JA 4LGYA 2H0RA 3KRTA 3IBCA 3E70C 3NWEA 1OV6A 3FX2A 5HTKA 2R79A 3H4MA 1LK5A 2DMRA 1J0BA 3M6XA 1LBTA 3PHIA 4MZDA 2HQSA 4OGLA 2EIHA 4P3NA 4Y30A 1WW3A 5BSHA 3C15C 3NFRA 3BXZA 5AOAA 2VT7A 3L6RA 4BXXG 1C81A 2POQX 5LVAA 2Z04A 4I46A 1P7WA 1M66A 1Q2UA 2O2HA 5BQPA 4TRMA 2I8CA 4PZLA 3RAPR 4LGCA 5FCDA 3C3EA 1AUVA 3EC7A 1KJQA 2XMZA 1PS0A 1QP7A 3WFZA 2VPPA 3S2SA 3ND9A 4OHUA 1CV2A 1X38A 2OAEA 2VTEA 4P7KA 4UMVA 3FKIG 1Q3KA 3CZAA 3M2TA 4ESOA 4KHPH 3IODA 4N65A 5DNUA 4PNPA 3K8YA 3TS1A 1UJMA 3RTGA 2D5BA 4CV0A 2GF2A 4PQFA 1QVRA 3EN0A 4TSFA 4DDVA 3BS4A 4C87A 3HO6A 1KJWA 3U9TA 1CEEA 4GQIA 3TW8B 1BNCA 1E0KA 1OCEA 2BFFB 3FZNA 4QFDA 4BJ5A 3AMVA 3V8VA 5FKJA 4LSWA 1T8UA 4EHNA 3EGDA 4JC5A 1I7DA 1K97A 5LP6A 3H9JA 5CJPA 3L5OA 2RGBA 3R40A 3VUFA 4D8UA 5AW4A 1TECE 2W7TA 3L7KA 4U6NA 3T3MB 3UMFA 1CXZA 1EP1B 4O5OA 1QPBA 2HHHH 1YZVA 2X1HA 5ALMA 1RWOA 4AURA 3S8MA 1NW6A 2X2OA 3G3EA 1KYIA 5KFUA 1WEHA 3ESCA 1UKVY 2NO0A 4ED7A 1K1QA 4FSHA 1C4XA 4QU5A 3TMAA 1N5MA 4KYUA 2A3NA 1IM5A 4TV9A 4JI4B 2Q6VA 4QQNA 4GXTA 2QYZA 3H5IA 4C3UA 2YMMA 1F3LA 5C8ZA 2WTMA 1RWNA 2FR8A 3KWMA 5KYUA 1DJNA 1N0WA 1TT7A 4AICA 1ZI6A 5KT4A 1O94C 5EUQB 1XC7A 4NS4A 3VBCA 2AYYA 4P4SB 1ODCA 1OXXK 2G1KA 3HOVG 3HI6A 1FYWA 3L79A 4FE4A 3WWPA 4ENQA 1G1AA 2H08A 5EWMA 5BV7A 4WQMA 2VF5X 2QG4A 2QAGC 3LUJA 4PO1A 3W5HA 1WPGA 1IN8A 4MA0A 3CHYA 2ECKA 3GFFA 3WS7A 1JIUA 3L8YA 1QWOA 4MEBA 5IBPA 1Z35A 4Q9NA 3OZBA 1W5AA 3IT2A 4KQJA 1P7VA 1YRYE 2NPOA 2I22A 3W8EA 4JELA 3IHKA 4LZNA 1OWLA 1PT5A 5L40A 1QANA 3KHSA 1EB8A 3LLCA 1EXVA 4UBJA 1LBHA 1R8YA 5JUWA 1H6DA 1TYAE 1A9XA 2Y4RA 3WLQA 1JHUA 3IEPA 4RACA 2I4MA 3O8CA 1FNBA 5E2IA 2E2HA 3R0QA 4NG4A 5K8VA 1FSFA 1I4OA 4AF7A 2JC3A 2IDZA 5LPNA 1KP9A 2G7MC 2C8JA 2V4MA 3K09C 4GQBA 5IM5A 5KYWA 2AEMA 4LHEA 4QBKA 3WYBA 1N5KA 3IELA 4ESHA 4EKDA 1YKFA 4FVTA 1XQYA 2BT4A 5KFYA 3AUAA 4V0NA 5AXBA 1Y6GA 3LVBA 4AJNA 4GP9A 2GQ0A 1K4MA 2JA5G 2QTTA 4WADA 2ZVPX 2HSZA 1JQKA 4HDSB 4DPMA 1YS1X 4BO4A 4PLWA 4ETNA 4F2WA 2YXBA 1NJ6A 3M81A 3ZDZB 2O54A 1SKQA 2DQYA 4K2AA 4AKIA 8LDHA 4QYIA 4UM8B 4M55A 2CC2A 3SX4A 1ZMTA 2CNBA 1KVSA 1KIMA 5ALFA 3LCCA 1XAHA 2PIAA 2TMYA 1QNFA 1EHIA 1XR3A 2I87A 2JRLA 2IHYA 3GGJA 1AGXA 2V98A 3LD9A 4GECA 4TLLB 5AW3A 5LJLA 3I53A 5B4VA 2Y0BA 5CDHA 3GLIE 1N1MA 2PVSA 1QOQB 4B4UA 2PM8A 3DPSA 4OHXA 4CG3A 1NLFA 5D3MA 1E4YA 3SIXA 1IZ7A 4UVIA 1EBBA 3O4RA 2O0LA 3UHAA 4ND6A 2YFHA 1Y3DE 4V38A 4XARA 1QIIA 1BW9B 1PFVA 2WK1A 2UZ4A 4LXTA 1FU8A 1KI6B 2B0JA 3GV8B 4MRMA 5HNEA 4W9MC 3MLEA 5JJKA 2Q3BA 2NQ8A 2YNMA 2HLHA 3V7YA 1R7RA 4JJ6A 4ZYVA 3K6SB 1Y3IA 1BHQ1 2UXCH 4HGQA 2DJIA 1L8LA 2FZ5A 2Q45A 3K92A 4I3FA 3TFQA 1QYVA 5DSXA 5JT1A 1G6HA 2A2ZA 1S68A 4TS3A 1A9ZA 1XPUA 1OBVA 1PKXA 1XKXA 2JIQA 1QRAA 2BZ0A 2QW8A 3OP1A 4EW6A 4HVAA 5EJ6A 4G4SP 3FFWA 1DLJA 5AM0A 3QTBA 1NXQA 1A7AA 2N1BA 1GHTA 3HA3A 3AYZB 3M5PA 3V5NA 4EHFA 1WAMA 1C7ZA 1B0ZA 1E7MA 4HQNA 3FW1A 4LF9H 3OE4A 1NQWA 3BSYA 1Z83A 2PL1A 4RA6A 1MO6A 3HB7A 4EG5A 3MHPA 2IYQA 1YFKA 3N8GA 4DVJA 3RGGA 2NW6A 4URXR 3JASB 1DJQA 1L1FA 2OD2A 3BDAA 4G85A 4HLQB 4IR9A 4K6OA 1NU6A 4FT2A 3VYRB 4ZVMA 1PJLA 1FU7A 3QQMA 4M7EA 4GGPA 2D0IA 1GPLA 4BU0A 4EVQA 4Q6WA 1TVCA 1VI6A 1YR3A 2AQKA 2PMZE 3KX2A 3OP4A 4MUHA 4TQAA 5E9QA 1N6LA 4YMVA 3BEDA 5B7GA 4D0RA 5AHKA 4FLFA 5EIFA 1PFUA 1DKLA 2AN3A 4PM4A 4JXZA 2NSJA 4HG2A 5CR9A 4ETMA 5H82A 1MOPA 1EX7A 2QTRA 3K5HA 3EVFA 4DQDA 4OQYA 2G4VA 4CPDA 4C6SA 1ZSVA 4IUDS 1Q92A 4MINA 1U0GA 1GU0A 3J7AC 1NVBA 4EF6A 1ZUWA 2YY6A 4YAFA 5EQFA 4C43A 1ORWA 4PICA 5HUQA 3G6KA 4RE6A 2QX8A 5JJCA 5K03A 1SBQA 3A37A 5AVOA 5TDHA 1TJ3A 5FBQB 1A9XB 1R18A 2CXUA 1O9GA 4DIBA 3CBGA 1G20B 2A5JA 3D6NB 2WHQA 4UPEA 1G7TA 2EKPA 3RD5A 2DAPA 3AEUB 3IUMA 2O1EA 1UH5A 2JJQA 5B2ZA 1G64A 5F2NA 2GJSA 3O8OA 2C0PA 1OXKB 1ZOIA 1YOBA 3PPWA 3H42B 4DM7A 1HQYE 4OUKX 3VKUA 3K30A 3PC7A 4S1PA 2R6FA 4HEA6 2ZYVX 3B9BA 2OO5A 1AO3A 2C88A 3G1WA 4GI3A 4K9KA 4Q1DA 3IB6A 1CB0A 4MW7A 2O57A 2Q0SA 4TTQA 3ONFA 1I1KA 3TPFA 3I2FA 2Y4NA 3O7WA 4QO8A 1IFXA 3EGOA 4LRYA 3EA4A 1Z06A 2Z30A 1NAIA 1LKZA 4TXMA 2TMDA 4MVJH 1GT91 3LY9A 3C5HA 2AFHB 2HAEA 2AR9A 2ZSEA 4OXYA 4YBZA 5G41A 1MHTA 4CEIB 2ZUUA 2Q46A 4NTZA 3QPCA 3QV2A 3RUFA 3EPIA 4ZFNA 4P0PB 4RCZA 1TM4E 3WRXA 2OL4A 2X9QA 3BMCB 3DEFA 2Q29A 3HUDA 1NJGA 3MRVA 3PRYA 1D6SA 4ZVOA 4B44A 1EXMA 2XADA 2PGOA 3BFVA 3EWSA 3KXYT 3GJ3A 3AU8A 4V2IA 4D6XA 3PEWA 4QBIA 5I5WA 3BIWA 1LRKA 2PU5A 1ETHA 3EA5A 4HF7A 1WXWA 2P4UA 5D6NA 2Y93A 4ECTA 5AP9A 1TKBA 2P7HA 3LWDA 1QIMA 4RGBA 1I6MA 1L7EA 4KI0A 4YALA 3A6LA 4X95A 4ZOLA 1UAGA 3D6AA 3N74A 3P0HA 4KQXA 3OX4A 3T5TA 1X9IA 1HDEA 1I3KA 1QIJA 1IWBB 3DCJA 3VO1A 2LDXA 1NY5A 4JITA 2XMSA 2J3MA 1OBHA 3OHSX 4LHSA 4LF7H 1I2KA 4F50A 4R3NA 1E32A 4UEJA 3O4JA 1KZ6A 1PJAA 3KEOA 1TK2A 2IXAA 3QIVA 2G06A 3TOSA 1WUIS 1C3OB 3E2MA 1XEXA 3HBJA 3A0RB 4W9NA 2WJYA 5H81A 5FAXA 4BNXA 3M6IA 5J47A 1SCJA 4BZXA 4MNTA 3H9UA 1AM4D 2X86A 3IEMA 3FPFA 3RVPA 1IQPA 2ZZKA 1E9SA 3BGSA 2HWYA 5FQOA 3BMQA 5ALZA 1PG2A 1UK7A 5CH8A 4WA8A 5FOVA 2UVPB 4RLHA 5TLSA 1O9BA 4NCXA 4PVDA 1CRWG 1RWPA 1FFHA 2ALJA 3PIIA 4B7CA 1LLUA 3KUKA 3I64A 2WJJA 3MCAA 3PPXA 4QNMA 5BYKA 3SF8B 3AVYA 2HKIA 2B2CA 3AILA 3BFKA 3D3NA 4ENTA 2VDRB 4AWAA 2PUWA 2C94A 2PS0A 2F8TA 1YFLA 4ND5A 4AY3A 1LTKA 1MO3A 4RKRA 2I03A 1ML4A 3DEYX 4W9NC 1P2VA 5KOHB 4FYMA 2V4QA 1ZD5A 3R0XA 1QTIA 1FJ2A 1RWXA 2FWAA 1Z4OA 2NSLA 3GOQA 2NVUB 2C9YA 4EGSA 3OQMA 3COJA 4P0QB 1N5OX 1PJ3A 2I1LA 3ANSA 4I50F 3X44A 5I7SA 2GA8A 2H07A 2WYIA 3GEEA 4Q05A 3PSHA 3RF2A 4X41A 2QI9F 1JWBB 2AQIA 2Q21A 4G56A 2RI6A 4NMHA 2R1UA 4GLBA 1F5SA 3PEEA 2JJ1A 1EK0A 1ZIOA 2GRAA 2Q6OA 4PPFA 4EA6A 1U28C 5G4LA 2EJ0A 3TYXA 2P5UA 4TV8F 1EXDA 4O3MA 1NN0A 5FV7A 1D7AA 2MR5A 3JRWA 3SAJA 3PENA 4RAQA 3ND6A 3SQNA 4AZ0B 1G8JA 1IN5A 3DBLA 1DAFA 1TWFA 2Q6LA 5JY6A 5K8IA 4DA7A 1HT1E 1UXGA 1ZPDA 4J9RA 2HDWA 2CNDA 4EITA 1CDZA 1RAEA 1Q16A 2M1ZA 3GEHA 1E2HA 2MYUA 2G83A 5ECWA 1LS1A 1UDXA 4TRNA 2OFOA 3ZIDA 1VBGA 5LOVA 4JR2A 1HDOA 5K0GA 3GJRA 4IDQA 1W7AA 4H1TA 3PUWA 1A5SB 2CFRA 2TRSB 2O3QA 4BQQA 1ZR2A 5ALXA 4C7MA 1P8AA 4FCTA 4YJDA 2JJ1D 1PJ8A 3O91A 3U81A 4YRSA 4PTYA 4B40A 2BFCA 5BSEA 1YDMA 4AY6A 1EAYA 2RH4A 3U61B 1K5DA 1WB5A 5FBHA 2J3QA 2PSJA 1IVSA 3S2FA 3H6KA 1JR2A 1IIBA 3UBMA 2BFAA 2P9ZA 4I4CA 2BAGA 1DC6A 1V25A 3F96A 2RHDA 1WCIB 1OLOA 3DMTC 3I6QA 2WJIA 3TQOA 4WSOA 4JJ4A 4A8JA 3PNPA 1QE5A 1MAHA 3HGQA 3FMAA 1X8XA 3E9EA 1QP8A 3OIGA 4OTZA 4C14A 1Z13A 2ZWVA 4HEHA 2E4XA 1GUBA 3JALB 4IHJA 3MR2A 5IK2D 3I52A 2XZDA 3UT0A 1ORRA 1MZVA 2XB9A 4JI2B 1RMTA 3BGWA 4I5GA 4OA8A 4PIPA 3OIVA 3U7JA 3OUZA 5EWFA 3GG9A 1EA7A 3EZLA 3O38A 2BPOA 2GEDA 5KTSA 3H86A 3M5WA 3SX2A 4B3SB 5K2OA 5CH5A 3F6EX 3RU2A 5DXAA 3BA8A 3JS5A 5EFZA 1Z5VA 1J6UA 1QZTA 1HLFA 1BKYA 1KNQA 4BO1A 4D98A 4NBNA 2Y1WA 1Q19A 5JH7B 3KDAA 1RRKA 4TYNA 4PZCA 4MCHA 3T3OA 1AIPA 2JW5A 1IY0A 3WYNA 3A9SA 2FMFA 1E6LA 2FZEA 4ZAXA 4OB6A 4YV1A 3ITEA 1BSVA 5T3YA 3PV0A 3UHFA 1PK9A 3CJQA 4R9VA 4YDSA 4UAJA 4KNYA 1RMYA 4N12A 5C1BA 2DXIA 1SIWA 4TRRA 4DMCA 1QPZA 1JHRA 1P29A 1UMCA 1F0NA 4MCJA 3LRTA 5ENDA 1DG9A 3TZEA 3Q11A 4L9AA 2I65A 3N2KA 3HWRA 1FRVA 2YXLA 4PAMA 3PR5B 1PTJC 3ETLA 4HDCA 4IDFA 1PQPA 3L41A 3RTDA 2WZQA 1P6UA 1GSIA 2QPLA 2VATA 4KAFA 4CM4B 2ODQA 5EOVA 1MIOB 1ECGA 2F4VH 2R1VB 4XZ3B 3U31A 1GPWB 1UXKA 1KDRA 1ZGBA 5DYYA 2Y4OA 3K53A 1NRWA 3LYHA 3RS2A 1XTPA 4CQLA 4QIHA 3SIRA 4GPIB 4JP8A 4Y6RA 1WXHA 4LF8H 5SYAA 4DQVA 5I8WA 4RIHA 1NIJA 2Q9BA 1UQUA 4Q7MB 2HSJA 5FTNA 1U8EA 2PD3A 5E3IA 3LT2A 3VO2A 1U81A 4IMJB 4X6XA 5DHRA 4J1NA 2PKYX 1WMDA 2NVWA 1PDOA 5KNCA 4HNGA 3R7LA 4XTCS 3JQFC 1L5GB 3A6FA 1TA0A 1QCYA 1OAKA 1E0SA 2Q27A 1V45E 4BAZA 1X8KA 2YN0A 3CISA 1TCBA 1XIVA 1DXQA 4YMGA 1H6CA 1JYSA 2XUZA 2ZAMA 4HDQB 5EGSA 1KJ8A 3B2EA 3PI7A 4K03A 3X1YA 2VRNA 2M05A 2J30A 3M34A 2W5UA 1GUAA 4HVCA 2JNWA 2D5AA 3TG8A 2BGKA 5DF1A 4K28A 4PLGA 3UF0A 4J90A 4C4OA 1YU6A 2VSFA 2ZJ8A 4Y2TA 3BRCA 4XYEA 1CWUA 2Q62A 3OJFA 1E9EA 1E62A 2COUA 5HF9A 4G09A 3RS4A 4OHWA 4G0QA 4DZTA 3SJ7A 4H17A 3ZD8A 2FE4A 4DA6A 2OAQ1 5I9LA 5JLAA 3QTTA 4BGVA 1L4KA 2G1UA 2Q1SA 4ZRNA 5FOQA 3AWDA 4YCDA 2G9RA 1F8YA 2ZUWA 3R0VA 5KYVA 1OUMA 1I94H 1RHMA 2P68A 4J91A 4Q7KA 4AF6A 2FPMA 2PZMA 4PC2A 1A8PA 4GMDA 3RS3A 3CEHA 4HB4A 2BTQA 3TR6A 2ZDGA 1DBWA 1FSSA 1VPLA 1DADA 3PYXA 3FROA 5IJ9B 4M60A 2CNWD 5COBA 3EPRA 1PG5A 3LIPA 4ZVVA 3SBXA 1XZDA 2D1QA 1DMSA 1UZMA 3ABZA 2NXWA 3MUOA 1RXSA 3HKDB 5DYTA 1RW4A 3BD9A 1BKSB 3NTLA 5CDUA 1EESA 1IPEA 4C2TA 2ATVA 4EBBA 5JXIA 2VNJA 5FBWB 4PAOA 1SCDA 2C97A 3KKQA 4NH4A 3UJDA 4BGEA 5GGXA 4D96A 3AR5A 5JNVA 2MSNA 3UUWA 5EMMA 2A9PA 5CYFA 3X2EA 1J70A 1NIPA 5KOHA 1KKMA 1UANA 5JSYA 5JV5A 5DGCA 3UCFA 4NECA 3KUUA 3LT5A 2CV0A 2XUDA 3MTAA 1L3CA 3D31A 4P86A 5CVTA 4ITRC 4L16A 5DN9A 3ILHA 1ZC3A 1PWXA 2N9UA 4HAXA 4NU6A 2J07A 2XQIA 4KWCA 1U1FA 4U7FA 3WJ7A 4Y18A 5LQKA 1EH5A 3K4HA 1ENZA 2P0EA 4CODB 2HK6A 1YS2X 1LV7A 1S0NA 4IUCS 4XCXA 2HR1A 4NV3A 1E6WA 1QLHA 1TYBE 2HTEA 3O94A 1KE1A 2GCIA 4PZDA 3JQ7B 2MINB 1BU8A 4AK9A 1U7TA 4ED6A 3D9QX 1U1IA 4HAIA 2QNRA 5L8VA 4JJ7A 1OXTA 1VE1A 2BBSA 3V4RA 2R00A 2AOUA 2B63G 1WQ3A 3Q1KA 2BGRA 4NEHB 3BZWA 4ITVA 4BO9A 1PSZA 3NH9A 4S35A 4BE9A 1Y8QA 3TK1A 1ZX1A 3O1IC 3GIIA 4U3JA 5BP7A 2C7OA 4IVPA 2F3TA 4IRCA 4CU2A 4LN1A 1TCVA 4XYGA 1MC8A 2P67A 2DM6A 1UK6A 3FHJA 1RYBA 1RI3A 5DHAA 4F4HA 8GPBA 2IYTA 3Q15C 5IC5A 5I4IA 2OOKA 2VHQA 4HYEA 1XNJA 1K9VF 2XHZA 1N2GA 4MRVA 2ORYA 5AVZA 1CJMA 3KQMA 4D6YA 1SYXB 3SHFA 4UQLA 1POXA 4MCIA 3AL0C 2H5JA 4U5XA 1PGOA 1VDZA 1ZRNA 4IJ5A 4JDUA 2RGNA 3D5QA 3ER8A 4FW8A 4YNBA 4G1VA 1L7DA 3ZJYA 3PU6A 2KJQA 2OHOA 2Z43A 4KSBA 3W2FA 3EYYA 4MIKA 4G0NA 4W8OA 2M6LA 3SQDA 3ZU5A 3QLJA 3WWJA 4LX8A 1IY8A 3CCFA 3TI7A 3L1IA 1EBFA 2QVCA 3E81A 3NTQA 4HH0A 4H1WA 3QVMA 4HZGA 4KIFA 4OATA 4QDJA 2I29A 1RJRA 1A4UA 5JBQA 1Q0RA 2P8JA 2JS7A 4XM0A 4JJKA 2Y0SE 1Q0TA 4OXIA 1E2BA 3GJ5A 4C7BA 4C5CA 4UNPA 3ENZA 4DQXA 2JZCA 2VP6A 4LHWA 2H4YA 4CKWB 1KVRA 3DM9B 2Z3ZA 4NPAA 3UKOA 5B3JC 3A6ZA 4G5SA 5KIAA 2G17A 1AURA 4DAEA 3N44B 1AQ6A 1PGJA 3KQVA 3R7FA 3WOVA 3BRSA 1JR4A 3JZFA 1I33A 1XE3A 4F2GA 2YWGA 3AUYA 3S29A 4GWKA 5E3JA 3QJGA 4D4GA 1A8UA 3P45A 5K6TA 1VHWA 3NUQA 4EM6A 3B8HA 4N41A 1YZ3A 2O05A 4ER5A 2V9CA 1PV2A 4BNDB 3Q41A 3PZPA 3WRVA 4JLOA 5IXSA 1ONNA 4FQ8A 5M34A 1EUYA 1K2WA 1XWFA 1DPGA 4BBZA 1XRLA 2P41A 4KLCA 2PH5A 1NQ5A 1C1XA 3G7NA 1RYZA 1RJEA 3PQCA 1STOA 3O4GA 5EXTA 4LG1A 4E32A 4EX6A 5JSZB 2ZCJA 5DG7A 1TZCA 3QXHA 1AG9A 1Z5NA 4NOLA 4RD3A 3BK1A 4X94A 5FI3A 3M8KA 5ESWA 1FSPA 2R9VA 4WBNF 2YQ5A 2P9GA 4IMIB 4QOFA 3HDVA 2VR1A 3L8HA 1ZLXA 4IFEA 1T3TA 2DPIA 1NX6A 1GPNA 3KLBA 5TVKA 1S03G 2YIDA 4AYTA 5CB4B 1Z63A 3RAXA 2OORA 2D4HA 2ZETA 3NC4A 3CH5A 5ICEA 3NZEA 4BEVA 1HNXH 1X86B 2IZ5A 4Q3KA 1LVGA 1SHZA 3TBHA 1U9ZA 1SN7A 3OFNA 4O4LB 4ARCA 4C0WA 1A04A 1U7OA 4YDHB 2C4NA 2OYCA 2P79A 2NTNA 2PKQO 4PRLA 1EDEA 3CB2A 2O2JA 3LDGA 3QE2A 1S8OA 4G5OA 4WK2B 5FWXB 1GRQA 1UM9B 1ULZA 4I1PA 3OO1A 1W4LA 1T1GA 2Q49A 2FSUA 2JK0A 1JLMA 4FZJA 4N8EA 3R9XB 3KHLA 1Y4SA 2DHDA 4KVAA 4A8JC 4EFNA 2EVWX 1GTSA 1QRSA 2EIXA 2JLSA 1OVGA 1TA9A 3FNIA 3CKMA 5CPBA 4ED3A 1EEXB 1FFGA 1P45A 2WWIA 3FTCA 4RHUA 1QGAA 5K3CA 4MICA 5G40A 2AD1A 4A2CA 1T25A 1PK8A 3TB6A 3PTLA 3IIEA 3GLHE 4B2PA 1XRRA 5KSWB 3HJAA 3QU2A 1Y1WA 5FJJA 1NSTA 1VECA 3JQ6A 4A0QA 1XZMA 3AZQA 1L4LA 3QVGA 4QARA 4ZODA 5IFLA 4NCAA 2OBLA 3VRHA 3NHUA 2F3PA 3B5EA 2RHRA 3PW7A 3BQ0A 3SQWA 3WL7A 2Z8XA 3SYKA 2HXGA 2W42A 2OK7A 2J5KA 3ELYA 4YJHB 1UF9A 1Z45A 4KC0A 2Z95A 4U2KA 1GGVA 1D8TA 4D3FA 5DFAA 2SKCA 1H3FA 1SIOA 3E3MA 2QLJA 1FLNA 3C8ZA 3IULA 4XASA 4XUDA 3RUCA 3MIIA 5FJ8G 3VZBA 2OZEA 3WB9A 3OD5A 3ADPA 1AA9A 1QYXA 2O0JA 3W90A 2VUMG 3AKEA 3IAUA 4X8HA 2IV3A 4C3VA 4DUGD 1A1VA 1MRNA 1K8YB 2HSWA 5I7RA 4AS1A 1BQ3A 3FMFA 4HUQA 2CMDA 4PSDA 1E3SA 5EMNA 3U5ZB 1O0BA 3JW8A 1P2UA 2ZQYA 4O3OA 4QUGA 3A3YA 3O92A 1N9GA 3G0GA 4MHSA 4F3CA 2HHAA 5DRTA 3LPCA 2QRVA 2ZRIA 3GA7A 5HXAA 3ADCA 2G04A 1SK9A 2H52A 4FUTA 1C7EA 2FEOA 4DT1B 5K3FB 5IAAA 1GXSB 3WLSA 4DLVA 3KQUA 1KR5A 1H65A 4CKCA 3HDGA 3B6IA 1UMBA 4P7JA 3QKWA 3HXTA 2VC2B 4YUVA 4UPVA 3A28A 2GA9A 1II9A 1YOVB 3IEXA 3ADKA 3L0SA 2EC5A 4WZ6A 3QEKA 2X3YA 4M83A 3VHXB 1XGKA 3G9TA 1EM6A 4F96A 4YDQA 3HDYA 10MHA 4D0GA 3BMNA 1L7XA 3ET4A 5FOWA 2P5SA 4O3SA 1VBMA 2UZ0A 3DDOA 3W5JA 1HDRA 1Y8CA 1A9PA 2XAAA 3JY6A 3KYDB 3N2ZB 1F4PA 3EA0A 4DZZA 3G6WA 3W4IA 4YRZA 3NWPA 5F9HA 3CWZA 1P9NA 2Y0CA 3NRCA 1DT5A 2KB0A 5KNDA 1D1QA 2X4GA 3DQZA 1SXJD 2QRVB 3GJ4A 3AT1A 1CQIA 5TEWA 4R9SA 3ZWQA 4KMSA 2VBFA 5A9SB 4X60A 4LJRA 3T5LA 1TCAA 5BNFA 1W88A 3D43A 3IN5A 2J45A 3H5RA 4GM0A 1C5KA 1W88B 4JDPA 4JH0A 4KXQA 1BAPA 4RF3A 1VRVA 1WX1A 1L8XA 4UTVA 3T9BA 3SXUB 1E5QA 1T5SA 2J5XA 2LV8A 5LQNA 1E3EA 1N9GB 3T5MA 3HZHA 4MQ4A 4BNGA 3W5OA 4K0RA 1NQTA 2QVZX 3DE1X 3IVAA 4UHKA 4CF3A 2BQRA 1W30A 3V33A 3C3WA 5KG3A 4F5EA 1XDWA 3PLNA 2PV0A 4UU7A 5FDFA 4XYLB 1YZFA 4MVWA 4OM8A 3ZJ5A 3G9QA 3KREA 3RDPA 3C41J 1UC9A 1ZITA 2ZRNA 1S5PA 3GN2A 4D9IA 1T8SA 1CKOA 1XDDA 4UEKA 3JQEA 4R1NA 3QEMB 1FXUA 1WD5A 3E23A 1X7WB 4GKBA 2CXNA 2YWVA 1ZCFA 2YQZA 3ZLJA 1P2SA 4MI6A 4RPJA 5T8KA 1CKMA 1RCTE 1W5EA 3GTQA 1C3JA 1QOZA 3LDAA 1VSTA 1LQTA 1QF9A 1Z6QA 4C3OB 4Q3EA 2NX2A 4QPCA 5CCXA 3RAFC 3UT6A 1OXSC 2XUFA 2PVCA 4I4LA 3WQRA 3EC1A 5TQ0A 2NPFA 3TTSA 4BS9A 4Q3BA 3DHEA 4GBMA 4POOA 2P11A 2VDKB 4DHEA 3WWIA 5KYTA 5IP9G 3OHAA 4ON9A 3COSA 3I3SR 3N6VA 3GIMA 5B3JA 3BWCA 4QYXA 2NUTA 4DCSA 1UPUA 2H63A 3FGOA 1VSUA 2JLZA 4NBRA 3K32A 5K4GA 2J5BA 4QPPA 1Y7IA 1QIKA 3KP1A 2GBLA 2OZVA 3PWZA 4PC6A 1IBCA 1ZXXA 1DQYA 3UK0A 1YQUA 5BWLA 3FGNA 2PQ0A 3WV5A 1I2CA 2SKDA 1TVMA 3VDQA 5BR8H 1C1YA 3CZQA 1KJ9A 4KQIA 5HIKA 3JZAA 4J7CA 4P33A 4IKEA 3QPUA 2BEWB 3LSTA 3LLUA 2W6JA 4AJ4A 2GCNA 1U3CA 1QFZA 2HA3A 3ZDAA 2VF2A 1SC9A 4Q9LA 5F77A 1W5TA 1OT3A 1H0SA 4LRSB 5F51A 3AETB 1DAKA 5GM1A 2ZB3A 4Y2QA 4XXHA 4Q6BA 1EG7A 4UHCA 2XEDA 4DJEC 5LYJF 1EK2A 3QVKA 4A26A 4D9KA 2GLTA 1GYQA 2Q7XA 4RAOA 2VCYA 3AQ4A 4EB0A 5KINB 2DABA 1K7XB 2JJ8A 4PHTA 3TQSA 4BQEA 4CXMA 1JH9A 2XOKD 2W6ZA 3OC6A 5BNWA 4OX9B 4ZA2A 1RHQA 1GUDA 3ML1A 4HGOA 2C96A 3WMGA 3CUUA 4A8HA 2IUUA 4KPYA 1P9RA 2C84A 2GSDA 3NAQA 4R9UC 1PG0A 2ZAYA 2BI7A 1CFJA 2J09A 4P4TA 1UPAA 1LZLA 5FR9A 1RR6A 4GPTA 3D8TA 4DV5B 5DULA 3KHHA 1Z26A 4I1SA 4KTTE 3OZDA 3GB9A 4N03A 4JLSA 1WDLA 3F6PA 4LJSA 5DISB 3RIMA 4EG4A 3MG9A 5GV8A 2BF4A 2ZSHA 4M54A 4O3RA 1DC3A 2GERA 2MIIA 4D42A 1FDOA 1AXEA 3OSUA 1AC5A 2B69A 3VMFA 2QI9C 3R3ZA 3T5PA 5KREA 4BASA 5DNAA 5AVYA 4O84A 3Q3HA 2UUOA 2W9CA 3NETA 3QLVA 2VSQA 5FI0B 3WYCA 3I58A 3FNEA 4EKNB 4YECA 2D2FA 2JL1A 7MDHA 1V39A 3AEXA 1C50A 1KI4A 3I9FA 4WBSA 3EZ2A 1NF8A 4UMDA 4YR0A 1B1CA 2AXPA 3OCWA 4URFA 2BUBA 3LI2A 2H1FA 2AF4C 1ZI8A 3B51X 2DWPA 3HY3A 2Q2UA 3WADA 5I4KA 4EDFA 4OBWA 4DNXA 2Q2QA 1KT8A 2FEWB 5JHGB 1DIOB 3FH0A 1U2TA 3LGAA 2ZBDA 2E37A 1L5KA 2AG6A 4BNDA 3UOWA 3BPSA 2DWUA 221PA 1W93A 5FBLB 4W9RA 4O2RA 2Z4RA 5HDQA 3A1VA 2D4AA 5CM8B 3R5XA 3IQIX 4QKQA 3JAKA 3PGMA 4Q45A 3P7MA 3JZ6A 1PFQA 4FQ7A 4J0CA 5CVDA 4ZQIA 1FQOA 2V5AA 3IDAA 4PG4A 4DCUA 4RANA 1GTRA 3DZFA 4ESVA 3I01M 1S3GA 3KSZO 2I4TA 1FMTA 2A58A 4F2DA 3VKGA 3V6MA 3FXAA 1FP4B 5AVTA 1SBZA 4CEJA 4DL4A 1N34H 3KZNA 1NZFA 1IZ0A 1Y9JA 1QKIA 4AUKA 4CMJA 1U9YA 2I3AA 4ZZ0A 3GRZA 2VL7A 2A9VA 3NG1A 3ZHSA 2WU1A 1EXNA 2MYNA 3DZKA 4IJKA 4OVKA 2Q1XA 3HWX1 4QGGA 1CVRA 2YZGA 3KQSA 1RZRA 3S2IA 3W3AH 5FUMA 2CJYA 2PBZA 2FEAA 2P4SA 4G23A 4RCVA 4MQLA 4NBUA 4HN2A 2K7ZA 4OKNA 1II8A 1ULHA 3LA6A 5JDCC 5D2CA 3YASA 1WCWA 4Y0AA 3DZGA 2DT5A 3WQSB 3O8DA 3TX6A 2O0MA 2XXAA 4GPEA 3TY5A 5G2OA 2AFIB 2WAXA 4XVHA 4ND3A 4NESA 1P80A 2R8RA 4AUNA 4ZHQF 3JAWA 3GAFA 3DWGA 4DV4B 1NDQA 1U0RA 4AZTA 1C3EA 1RJWA 2QYTA 5LMUH 1RM3A 1IOWA 5AKLA 2F90A 1GKKA 3K6KA 1L5HA 1MDBA 4FFRA 4MWZA 3PIDA 1QGUB 5IZCA 3PPIA 4IOLA 3PNMA 3JQ9C 3RTCA 4MAAA 3W8DA 1U3DA 5T4HA 4CKXA 1XZIA 4MUBA 5AUQA 2FWPA 4NYJR 4O4JA 5B1YA 1MVOA 1YBMA 2BBOA 1OWMA 1PO7A 4DE5A 4ZVSA 4X8OA 1Y4UA 3S7TA 5CMLA 3RG8A 2HMVA 3FCOA 2AXEA 2OXRA 4NBLA 4QIWE 1I10A 1OR8A 3HDHA 4L75A 5D5PA 1YUBA 3REQA 4YMTA 5HQ3A 3P9SA 1JBKA 2ADOA 4BQSA 4IR1A 1WQ1R 2FZCA 4Q18A 4XR4A 4BCDA 5EWLB 2NSYA 5EJGA 4JOCA 2WDZA 5EOYA 4CFSA 3WKEA 1EIWA 2QXTA 1T9AA 4Q0YA 3OESA 5J2TB 1EFAA 1FW6A 2J7KA 3HHEA 3VV2A 2J0VA 1KK3A 3GXBA 4KRFA 3N8DA 2X3UA 3EGVA 1KPIA 3BE4A 5DWVA 3I45A 2HWKA 1LPBB 3OAAA 2J3HA 4HUJA 4ZRMA 1TUGA 2OWDA 5LP6C 4JI8B 4ITUA 1CZNA 1D2EA 5KJ1A 2IH2A 3VMMA 2AUMA 4WJZA 3CF6R 4AO8A 3IH5A 3C3KA 3UWKA 4GNRA 1H94A 1Q7RA 3FKSD 4JASB 4M8NE 3WL3A 4DMMA 2X5NA 4DV6B 3AR2A 3DVAA 2OFXA 4M2LA 5LA6F 2ZU6A 4O81A 4JY7A 4XJTA 3F8TA 4ZDKA 5C18A 3KQLA 4O7TA 4YR3A 2E6KA 3CCCA 1JVBA 4AG3A 3DVLA 2GBLC 4WN3A 3C43A 3RVJA 1UT6A 3D6HA 2CNVA 4TYMA 2ZJTA 2RGVA 3RQIA 3O26A 1PYDA 1HT2E 2C5GA 1U6JA 4BTVA 2OO3A 4O2AA 1ZVVA 2UDPA 4GAEA 3SVTA 2P6MA 3IT3A 4WCFA 1HE2A 1XVAA 4YRIA 8MHTA 2M1XA 3TE7A 3W9YA 1MQ8B 4DM4A 3LO5A 5GIPE 4TLAA 2QG6A 2FHSA 4MYSA 5TMBA 4C7XA 3AR7A 4EYEA 5DGIA 1VPVA 4H7EA 4C78A 3S4YA 1JLLA 3OE7D 1JE1A 3PFHA 5CBKA 3CVYA 3R7NA 1N8TA 2EX1A 4JIMA 4FEEA 1PT9A 4QEDA 3BQNB 5CVUA 3HY6A 5EKSA 3QG1A 3VI3B 2VBCA 3KL4A 1E94E 2JAPA 4DB4A 2GK6A 1QS0B 5HG0A 5G4KB 1JS1X 1D2AA 1PRYA 4OQPA 4PSUA 5KVVA 2YASA 3QKRA 3T34A 3G1TA 3WGYA 1QVVA 2NU7B 4O4HB 1F6BA 4QSMA 2O19A 1U28A 3TQTA 1MTZA 1V8PA 1XKLA 4M9XA 4M1YA 3PBKA 1SXJC 4QTUB 2WT9A 1DWPA 4E13A 1MF7A 4U0KA 1CEQA 5KUTA 3KSBC 2DPGA 1NI3A 3N5CA 2C57A 4TUYA 4EHIA 1V7QA 1ZVMA 1AKMA 1ESCA 3TD2A 1IZ9A 1K3FA 1ZIPA 2HMAA 3TCNA 5EHZA 2OV4A 4ZQCB 4AJOA 5CDYA 3GYBA 3O8QB 3D0RA 3LJKA 4JJZA 3L40A 3KS9A 2C22A 2CXTA 1KYYA 1D4AA 2IDMA 2GQRA 4D9GA 3WDMA 3RROA 1KC3A 2ZSFA 5EE9A 2K5UA 1TM1E 3E7XA 3MWEA 2FWNA 4GLOA 2OBNA 5JAZA 2V0GA 5BR4A 4IMPA 4J0HA 4DMUB 2PUCA 2LIPA 1Q5PA 3E03A 3BCUA 4KIUA 1BVUA 1E9AA 1FTWA 1E4GT 2PH3A 2CL0X 2CEAA 4LC9A 4ENSA 3C45A 1WULS 3VU3A 2ZDQA 2VA8A 2DHQA 3I6ZA 4A3MG 1TRHA 2PX6A 5KEIA 1AB6A 2XBUA 1S8FA 4PX2A 1PL6A 1GTL1 1TEHA 3OT5A 1P19A 5K51A 2O2ZA 4EKYA 3NDPA 4W7IA 1N9KA 5JMPA 4DLTA 1C7FA 5JASA 1S96A 4L15A 4EHLA 4TXHA 1Q6YA 1U8FO 2C2WA 3TIFA 3ZY6A 1U0NA 2A9OA 3V6KA 1XZEA 3LPLA 1HLGA 4UUOA 1KDTA 5E6RA 4R1LA 1P2BA 3P96A 3TIGA 5ALKA 3ADDA 3JQBC 4RPHA 4CT5A 4ZAWA 2X3FA 3NH6A 1PYOA 5F4ZA 5ELMA 1EYZA 2HLDA 2EHDA 2HX1A 3DNPA 4G1CA 1UFRA 4WKNA 4HWTA 2GM9A 2AFVA 2ZTVA 2ZYSA 4PE5B 1Y1RA 2Z8ZA 5DTIA 2PS1A 3PQ4A 4K8OA 4EG7A 3A1NA 4Q4HA 1V8DA 1K68A 2GXAA 1HT0A 1T4GA 1YCDA 2QJFA 2VZEA 4ZQBA 2QTGA 2IF2A 2RB5A 4XCQA 4L07A 4V24A 3RJTA 5KNCD 1KQGA 1UKYA 4X93A 4L1KA 1W87A 1P4GA 3GZTB 5LD2B 2PX4A 2WJHA 1Q7GA 3SR0A 2A5LA 5CT6A 1TE2A 4QJ5A 5HVNA 3B7WA 1HWYA 2I6TA 3KOUA 4D81A 1LLDA 4MPRA 5LQJA 5KNDH 4QDTA 3V80A 2ZU0C 4IFIA 5L3QA 1QRUA 5DVZA 2X9VA 3EIUA 3TGLA 1NQVA 3OM8A 5LQRA 2W2LD 1KTVA 3I1IA 2JGDA 4RZSA 1X0XA 1KZ7B 2ODEA 1M0SA 3FCEA 1P44A 1BFDA 4JBHA 1X9GA 4B1FA 5EQTA 4C7VA 2BQ3A 3DHNA 4ES6A 6NULA 1LWNA 1SWWA 2YMLA 2DPJA 4KQFA 2KSWA 4L8GA 3NTUA 5K8UA 2YIJA 3ESZA 5A62A 1N92A 4C6HA 5JDCA 3ZQUA 1M2NA 1I1NA 3I2HA 4J0IA 4PQEA 4WXRA 5TEVA 3VZCA 3ZCQA 1IJEA 3H75A 4DV6H 4MUEA 5HSGA 2QDKA 5LYYA 2BDTA 3Q6MA 4YCSA 4I81A 2FZLA 4S24A 5JJ5A 4EEQA 3OOJA 4KCGA 1S7GA 1KSFX 5GM2A 4V03A 1MC4A 4BNJA 1WNFA 4R1TA 5LZ7A 4OB8A 5L4SA 1NE7A 4E1VA 4UXJA 5BYAA 3E9CA 5BSRA 4H4EA 2BFEA 1WW8A 5B3KA 4IKPA 4NE2A 2BMFA 1Z18A 4LDJA 3H8VA 4FNAA 4BFWA 4IIJF 4Z3DA 4JVMA 2J87A 3E5RA 5SZIA 2HVRA 1ULSA 3DZBA 4MVYA 5CK4A 1XTIA 1JHOA 3AUUA 3DTNA 3WFIA 1FP1D 1ECCA 1L7OA 3SKYA 4RZXA 4BC1A 4IDDA 1ODSA 3T3DA 2IIVA 5C35A 4CMDA 3KALA 3ZHCA 2N3ZA 2ZJ0A 2XKBA 4RIFA 3ZX4A 1QDLB 3GMDA 1N6NA 1V4NA 4CHGA 4Q4DA 4UXIA 1CUUA 3KV3O 1U63A 3E2IA 5TT1A 3CUEF 2Q5EA 5JPIA 4KXYA 1S8NA 3UH1A 4BECA 2PA0A 4QOIA 5ADHA 4QWWA 5AUOB 2H51A 3EK2A 5JVDA 3TW4A 1PJSA 1ATZA 3IBFA 5CTAA 4JYZA 1JDBB 3HE3A 4E22A 3ZCXA 1QFXA 5FLKA 3TSYA 4YCCA 4ZHQB 2HA2A 2XCQA 3GMTA 3OJWA 3GNSA 4MS4A 1TU0A 3L9WA 5H16A 2CUZA 2MCFA 5EIXA 1ZIDA 5KQSA 4LH6A 4MIEA 2R0QC 5A6VA 4QASA 2VH5R 3H16A 3OPVA 3E84A 4IDBA 4GBED 4JT4A 2BFNA 5J4YA 2IBTA 4MYDA 4EMBA 4RJ2A 3IPCA 4YJ2B 3VZRA 2BP7B 4YR2A 2V58A 4LNAA 1JA1A 4ZAVA 1Z0AA 4JYPA 1U2DA 3VTAA 2Q99A 4HHEA 3JZIA 1M5UA 2NADA 4J29A 1SU6A 2XH8A 4B4WA 5KC8A 1ZBQA 4I2VA 3V00A 4ZJUA 1U0HC 1G8KA 1WB9A 1TLFA 2Z9DA 1RYYA 4G1BA 1KC7A 1X13A 4ND8A 2CHVA 1UEJA 2DTXA 4QLAA 5ED0A 1CZUA 3B3FA 4BVAA 1MQAA 5EJ4A 4UCXA 4RQUA 4D45A 1QHSA 1YQDA 4INPA 2FW1A 3CLSD 3H8WA 3DDZX 4TTPA 1G9XA 1MKYA 2FP4A 3N8KA 2AI2A 2V54A 4GLFA 4L51A 2R6ZA 1DAEA 4ALLA 1PX2A 2R11A 3HOZG 1HZJA 1U65A 2FGJA 1SXJE 5DMHA 5KT3A 2WWHA 2J1LA 1EFVA 1B0PA 4HN9A 3QE4A 2VPWA 4CM3A 1N1DA 1T0BA 3PNKA 1LSSA 2C9OA 3R3VA 3MUFA 1B42A 3FTFA 3MWLA 2FKAA 3NEPX 1SVOA 1H05A 4UFPA 3ZDBA 4A0HA 2I80A 3T5KA 1CRLA 2OHGA 2CB9A 3V55A 1YDGA 4D9MA 2HC9A 1L4HA 5HBGA 4XYLA 2XCLA 5KYYA 2ZAIA 1IK4A 2ZR9A 3LXRA 2ZUFA 1RI4A 2JLVA 2CHUA 4JLPA 2G1JA 4XLLA 4DUZB 4M0KA 1ZIYA 3JQAD 2VTBB 4IZOA 4MR9A 1CJCA 4GM4A 2H4WA 1NXTA 3W05A 4KX5A 3MWGA 3G2NA 2BH9A 1A2QA 4NK4A 1NHGA 3HOXG 1V6AA 1DFGA 1YJ5A 1NUQA 4BKMA 4HN4B 2REQB 2C29D 2O1XA 2QRZA 4UNSA 2YKGA 1M6NA 3NW9A 4B3CA 1O58A 3F3YA 3FUXA 2LCIA 2EX0A 3FFBA 4PGFA 5IJXA 1WBJB 5IRCD 1MFPA 3HKEA 1UBCA 4P5PA 1IBKB 3GFVA 4WD3A 3E48A 1NC3A 2CVFA 2H9IA 3U4AA 1NBIA 1JKFA 3EUEA 3TVTA 2Q6IA 4A8PA 4CKZA 2O5CA 2FXVA 3MJHA 1KUTA 2II6A 4HXEB 4Q15A 4BDSA 3RLFA 1E4EB 3Q87B 1RXWA 3RC9A 3BIOA 2ZI6A 2I5PO 2RGEA 2GCPA 1EJ0A 3EIQA 2Y1GA 4FM9A 2DP4E 1FMLA 4FFSA 5BN3A 3CJRA 1BE8A 3K96A 4IVNA 2FMIA 4UU0A 2PWAA 5E0KB 5EUCA 4EENA 1G98A 1ZM4A 1U0JA 4XDZA 2XOKA 4E4RA 5A0VA 1FS5A 3THYA 1ZD8A 2PE5A 5KFAA 4P2GA 4LF6H 1I4EB 1M1XB 1T6BY 3D8HA 4PFQA 3UJ9A 3TLMA 3DKIA 3M4YA 3H65A 4A91A 3DUWA 4TYQA 5F5XA 3RQSA 4GBGA 4ZOEA 2ZBVA 2XRZA 2XTMA 5EXSA 1PZGA 3N43B 1PNTA 1EJ6A 3EISA 2XRMA 3SSNA 2QQEA 2GJAA 2IXTA 3QOYA 3IIKA 4JV5H 1IU9A 4HLDA 4KQCA 4XJSA 3E6AA 4UNNA 3MZ0A 5K45A 4N3GA 1PLJA 1GDHA 3JQRA 3FF4A 1M34A 1ONSA 4N01A 3PQEA 2WLSA 3PVSA 1V3UA 3HUFA 5B1IA 2WHYA 1J42A 3GVXA 3UV3A 3H11B 4A6PA 4O3PA 4PZAA 1FA9A 2OENG 1MLDA 4HUQB 4M1OA 3THYB 1U1CA 1VLLA 1KSGA 1UJ5A 2ACKA 1QVZA 1IHXA 2TS1A 4G0OA 1EVYA 4I3HA 4DEVA 4RHXA 3PNQA 3H3FA 5AHOA 3E1KA 1DNPA 1VHDA 2ZUTA 1CLEA 4BBPA 5BUSA 4AI6A 1NBOA 4KVZA 5A2GA 4OQZA 1TD9A 3K0EA 3ORRA 1W44A 2UU9B 1ABFA 4Z4IA 2NYAA 4MO9A 4ZV7A 2R7ZG 1WF3A 5FTKA 2JKYA 3B48A 4L02A 1R0ZA 3TTUA 1ODFA 4CLHA 3JATA 3MJFA 3NNSA 3RAGA 1MOSA 1WO8A 4OQFA 2G88A 3STXA 3QBTA 3UCXA 3RC3A 2FG7C 1CR1A 1YJAA 1N2XA 4XYBA 2J3DA 5K0TA 5HFJA 2IWHA 4COOA 2Q5FA 5DHSA 3VPCA 5FHQA 3WGMA 2CNOA 2FAXA 1Y4ZA 5KJEA 4UATA 5IJWA 2DETA 1FZTA 1ZCZA 3W1WA 2ZROA 2ZEJA 2V8OA 3WBFA 2ONCA 4HSGA 3CEBA 1KMHA 2BN4A 3B1FA 5E7MA 3UMVA 5NULA 3EDYA 2J0SA 2UXCB 1KVUA 1C0EA 4H60A 3DMYA 1F60A 4P53A 5K9ZA 2H92A 2AZTA 3ENQA 3OICA 2R7KA 3GLHB 1NVTA 3V4SA 1MG5A 1V3VA 2DULA 3V4PB 3SI8A 3RIYA 1JAXA 1NNUA 2BQUA 5CVCA 3DG9A 1T24A 2J9RA 3G2LA 3TQRA 2GILA 2I62A 3AM5A 3B3GA 3UW3A 2DY1A 4JJGA 3PA8A 4OGFA 5FOXA 3C4JA 2VCEA 3AEZA 1KYVA 3RVNA 4PIVA 1HURA 3BDIA 1N7GA 4RD4A 1YTLA 4E5NA 4TTTS 2MYTA 4II3A 4PWQA 1T3NA 2C9BA 1QX3A 2JEZA 3R3JA 3ZVLA 2WKQA 4HNRA 3PTZA 2VTBA 1N32H 4KN6A 5D87A 4CHTA 1LK7A 4MS4B 4N76A 1FDWA 4RKYA 1F2UA 3JYHA 1IQRA 2PJZA 4CEHB 2YWRA 4IUYA 4HTAA 1QOPB 2D3WA 3QIAA 1YJXA 5L51A 4GKJB 1P4RA 1RI1A 4HDNA 1H1LB 3LYLA 4RK1A 2BSXA 3AR3A 5TS2A 4GMXA 2B30A 1LJ8A 3K0AB 2ZAGA 2NPIA 2GD0A 2IPMA 5CT5A 4MB0A 3RFVA 3SGLA 4ZC8A 4C7KA 4DYVA 4HX9A 4J3FA 5T14A 2UUAB 3A4NA 3LXMA 1ENPA 3R9XA 1YBHA 4W1PA 1EGVB 2GN8A 1D9XA 1O5TA 5TB5A 3ZCPA 4BUCA 5CITA 1ZH8A 3D0KA 4OYRA 4KFCA 1G66A 3A3NA 4GRIA 1KEEA 3OOSA 3DWFA 4UAGA 3K72B 2D1SA 3ANTA 4GMHA 1G8FA 2C2OA 1LW6E 4FFLA 2C8KA 1AK9A 1RIFA 2EKDA 2L18A 2LVBA 2GN2A 3PQ2A 4L9WA 4RPLA 5AICA 3MXTA 2F3QA 4MUYA 4YIKA 3UW1A 1WXFA 4OK3A 3T9AA 5K5EA 4CLRB 4DJTA 2BZGA 3KQNA 3DFFA 2QZ4A 3GU3A 2YVLA 4GS5A 4KE7A 2W2OA 3NO4A 1VKNA 3ZGOA 5GVSA 1GRCA 2HIHA 3IDFA 3IP5A 2IZ0A 2HIVA 3ITKA 4LJ5A 4REOA 4TWAA 2AOTB 3FOZA 3AYXB 2PDAA 4H7DA 4DQ0A 1SU7A 2PXHA 2YQ4A 1CZKA 2XBLA 1F51E 3FSRA 4UKDA 3STHA 4G0WA 1GL3A 3FDSA 2LNDA 2YS7A 2P2CA 5FWNA 3I09A 3U60B 3LVRE 1SBYA 5LWQA 2XA9A 4YV2A 4D3XA 4TMYA 4B6FA 2BMJA 1Z6GA 4NQZA 4UCSA 5JVLA 3AI7A 2D1TA 2J6HA 1QIHA 3AY0A 3BCRA 4HDAA 5DBHX 3J81A 4FP9A 3S2EA 1S2GA 3KLOA 1Z0UA 1BXGA 1YS9A 4OQEA 4LNUA 2VDWA 2IS6A 3VPSA 4MUXA 3G2MA 4BKPA 4F7DA 1EWVA 4NENB 3G1UA 2A59A 2BE7A 1AS2A 2MCTA 5KYKA 3KPJA 3C1UA 5L3QB 4WFKA 3SYMA 4M1SA 2IS4A 3RAQA 2EEZA 1ISGA 2QP3A 4J8PA 5IKMA 2ENWA 2JI7A 2W22A 2EF0A 2NU6B 1JHMA 1U0OC 2E89A 2JCYA 3EDRA 4DCVA 4UOEA 3KSUA 5F52A 3B1YA 1OX4B 4WKPA 4Y2HA 1ZUHA 4D4JA 2UVDA 5AXDA 1ZH2A 3B5JA 4H9GA 1ZD1A 1IRXA 2HEIA 3VDMA 4LKOA 1PD0A 1FMJA 1XMPA 2APJA 1OFGA 1JPUA 4AX8A 4TN1A 4WOCA 1MORA 5K0JA 2ECFA 5ESDA 2EDAA 2OLJA 2QROA 3Q5EA 4TMWA 2Z2XA 4RDCA 1GNLA 2GN4A 3WK8A 4CCAA 4D46A 4IIHA 4F9EA 2C3OA 5IU6A 1OX5A 3HCWA 2FQYA 1JG3A 4Q4LA 4UASA 2OZPA 4E5KA 1OU0A 4X85A 1SCBA 1WF6A 3KOWA 2OZLA 1XTTA 2IZ1A 1I4DD 5I5SA 4W1QA 1H66A 3LW7A 4I6JA 4M0UA 4PXAA 1KPHA 3DEJA 2POCA 3LVFO 3QGMA 1FY2A 1Y8RA 4EHAA 5C32A 2YFYA 4MR8B 4XE5A 1G8MA 3LKVA 3B82A 4DV1H 3BSWA 4IIFA 4UDYX 3T15A 4CT4B 1QRTA 3EXG1 1X9NA 4MVXA 1K6JA 2NT3A 4DARA 2V3CC 2VPYA 4FIDA 3G5TA 2BFDB 3JARB 2CT8A 2WAAA 3B1XA 2YHIB 1XD2B 4RIIA 2YCHA 4Q7EA 2YC2C 5I5YA 2I7TA 1KZ1A 1JQ3A 3WHPA 3NGMA 5ARDA 3UOAB 3RG2A 2DFNA 5ITZA 3OOYA 1L9XA 3A6EA 1FJGB 2CW8A 1T10A 2XUPA 3R8XA 5K8LA 3K8OE 13PKA 3PCTA 1RXUA 5K4HA 1UWVA 2JCXA 1B4DA 2P30A 4RWEA 3W3AD 3PHBE 5E4JA 1JA9A 3GF4A 1O5IA 5EP1A 4M0FA 1PQWA 3JQPA 1TVKA 4TXNA 4POAA 4FMDF 4N3NA 4O4HF 3NVMB 2FB9A 1RWKA 2FPWA 2JD1A 2Z58A 2XIGA 3QU5A 5THXA 3B7PA 1CKNB 1NRXA 3I2YX 2NZUG 3TSZA 1ZOPA 4C4ZA 5E6SB 1AKYA 2DQKA 4PO9A 3TNYA 4TVIA 1VB5A 3HQ4O 4Z4QA 4A03A 4NL4H 3IP9A 2IHNA 4JUZA 2FMTA 4ZI3A 1A9TA 3CX3A 3I32A 3JX9A 4WCFC 1XLTC 1A1SA 3DEIA 3PDWA 2Q41A 4O2BA 1R0LA 4LFAB 1U7UA 4MVJP 3ZBTA 2FFBA 4ZEOA 3H40A 2PFSA 3A6PC 4GICA 2JATA 1UBMS 2P75A 4DIKA 2XJ4A 3P5BA 3RJZA 4J3NA 3BGIA 4IIXA 1QX4A 4G26A 1M75A 3ANNA 3Q8PB 1JZTA 2DQSA 2NLOA 1M6WA 2ZXEA 2B1GA 4HDKB 5AKKA 5FYDA 2FG6C 5FLMG 5TGZA 2C5BA 3OUUA 2M9MA 4IH1A 3N2LA 3MSCA 3V8MA 2R8HA 2R62A 2O52A 3JRXA 4R7RA 1NLUA 4PRZA 5LA6B 5JS6A 3EIFA 4GVLA 3GLIB 3BQ1A 3KU4A 1TGYA 2AG5A 1QF7A 2ORIA 2OK8A 5EJ2A 3LCRA 4JKOA 3MERA 5FPHA 1RZRD 2L69A 3I61A 2HA0A 3UT5B 4GI5A 4L3OA 4M0DA 2F9FA 3RYHA 4AJJA 3HKZE 4BLVA 2JH3A 1RAIA 3GUHA 5ALGA 2WPDA 3RHTA 2W93A 3OEHA 3LF2A 4YRDA 1L4GA 5FNVB 3L43A 5HBRA 3X2SA 4WZBA 1UEXC 3QY0A 5SY6A 2H29A 1R74A 3ENVA 3SEAA 3WG9A 5IC4A 3RUDA 1CQPA 3T1YH 3OCYA 4GX1A 1K1SA 4BFZA 5ED4A 4KYVA 2Q7DA 3ID6C 3HFRA 3KFLA 3I8SA 3KKKA 1G5HA 1JDBC 2LIVA 3PJEA 2F59A 4B3GA 1X7GA 4XYMB 4MB2A 5A06A 1EFLA 4MW6A 1Z38A 2BI4A 2EYQA 4GVXA 4WMLA 3W5SA 1SHTX 3VZSA 4NNOA 1FP2A 1H8HA 2HK9A 4M7RA 4F2PA 4B3SH 2AFIE 2DUWA 4IP0A 1DIAA 1VIAA 5E8RA 2O3SA 2VRCD 4WCFB 3GLIA 1ECLA 2A5YB 1ZM9A 3F3SA 5COAA 4M88A 5G1PA 1Y1SA 5K3AA 4UTRA 4DNQA 2XCAA 5CHEA 4MK4A 3AUTA 3HUEA 4YFYA 2WTUA 4IHJF 4E3WA 4LF4H 2XTJA 1TAGA 2DGDA 2OD9A 2P3QA 4JGGA 3P0EA 2WV7A 1YU9A 2I7VA 3KKEA 3WGTA 1IYDA 5JD4A 4N3BA 2CLDX 3BHIA 1P62B 1WXDA 1QKKA 1MXFA 3T1VA 2FN7A 4WZAA 1THGA 2EBUA 4HLUC 1EE1A 4FS1A 1Q0PA 3D6JA 3CTMA 1PL8A 4H6VA 4J76A 4JX8A 4XWKA 4UULA 1VKZA 4N7JA 9ATCA 1U0FA 4IHJB 4E07A 1L5ZA 4GKJH 4ZOBA 2BL4A 4ZALA 2XB4A 1SVMA 4Q02A 1WSDA 3BWXA 1BHSA 1WCMG 1Z5PA 2C54A 5L95A 1O95D 4KR3A 1ND6A 4A3SA 6REQA 4OGWA 4NABA 4YHHB 3TQFA 1XQXA 5FOUA 1WRVA 1TM7E 1KVQA 3GEGA 5K20A 1LBQA 1UQRA 1LPNA 2H11A 2I3DA 2IKSA 4F45A 2W8BB 3AF0A 4LWQA 5IJZA 2P9CA 3CVUA 3UXHA 4X90A 3U3JA 1K88A 3HVKA 3KV1A 1Y1VA 2HU5A 3CWCA 3IPYA 3OTIA 1PFKA 4B35A 2CYBA 5JZOA 4OSPA 3PWSA 5H3LA 4NOMA 4CM7A 5CDGA 2YJZA 4FGZA 4MYRA 3CMCO 4I08A 4WXPA 5KG5A 1RLIA 1TQ2A 1QQAA 1BX0A 2FZGA 1E79A 3TZHA 1ZAKA 2QVYX 5A1JA 2Y1EA 4IV5A 4MJXA 4UDOA 4CTKA 5ICFA 4DR6B 4F97A 1SXGA 5JYEA 3OHMA 2IOFA 1MENA 4IR7A 5LYJB 1F4LA 4I6EA 3GV5B 1ZNXA 3KHTA 3WIDA 1Q0UA 4H7HA 2QZJA 3VSAA 1XZCA 5AI4A 2P2LA 5E6UA 3QWUA 2PKRA 3VPXA 3KXKA 1LNSA 3HWWA 5CLGA 4ZI7F 4NONA 1C3LA 4EO4A 2X5JO 2DQ4A 3AB3A 3THOA 3TR5A 1BC5A 2O7NA 5KO2A 5JPDA 3FVVA 4ZCQA 4MUFA 1W19A 1EGMB 3BABA 1JXOA 1IQUA 1QLJA 2DFKB 1RRPA 4GU5A 5SY9A 3N07A 4JVLA 3QF7A 1I14A 1FTNA 4YI3A 3OY7A 2MSCB 1R0SA 1EZ1A 2AYXA 3D6UA 1O0CA 1HT3A 1EQ2A 5JNUA 2W48A 1E3MA 1XTJA 3DYBA 2UVPA 3A11A 1JJFA 1T1IA 3K09A 6PFKA 5CAEB 2UXDH 4TQ9A 1I8TA 2HBYA 2XXAB 3DD5A 1W581 5FORA 3T6KA 1LV8A 2ZCUA 1GUFA 1JDVA 4EG8A 3NIDB 2FU5C 3O9ZA 3WSWA 1OBCA 3VDRA 1DOZA 1WZCA 1M8GA 1XAIA 1WMFA 4MRRA 5CGQB 1NWCA 1L5LA 3VTZA 5LL6P 3NYQA 3ILVA 1SPXA 3G0IA 5ERGB 2F48A 1UBEA 2FQ1A 1E2NA 2OGWA 2AJDA 1S9HA 2WTBA 5AVWA 5ITZB 5I9SA 4B87A 1S0UA 1BCSB 1ES9A 1WPQA 1XZAA 1K5GA 1IBLH 2GAJA 2XEXA 4QUAA 4R7ZA 5AHXA 2GZHA 1SVIA 1P4JA 5LLTA 4OO3A 2VQ3A 2OCXA 3I4LA 3C5EA 3FLAA 2VDWB 4KV9A 4DM3A 2WNIA 3N40P 2JFNA 3DE5X 4JJAA 5ECYA 4I50B 4QEZA 3ZZMA 2Y1OA 4I5DA 2W6QA 4E5SA 1ZAUA 3IUNA 1T9GR 5TIIA 4B73A 2R48A 1GL6A 2PTHA 3GZJA 2GBIA 4OKIA 3HLTA 4MKIA 4UHHA 1JAYA 4BHTA 4EPWA 3TY9A 3HNPA 5K6AA 4HGRA 3EB9A 4JC0A 3UWDA 1DKNA 4NMLA 1PT8A 3TJMA 4LNUB 3NEYA 1YB4A 1H1LA 1P0CA 3NASA 1EM8A 1JH8A 2GI4A 4CC6A 1CUYA 1DHTA 1XCMA 2FLKA 3EAFA 2FF5A 2ZQ5A 3BMQB 2PGNA 3X3HA 2AGPA 1JDTA 521PA 4L6IA 3R5JA 1TW3A 2NXJA 4FS8A 4MQEA 1PN3A 4JS0A 1Z6YA 1ODKA 1NV9A 1FOEB 2F9LA 1UPBA 2AF3C 2INGX 3Q3IA 4F4XA 4Q8FA 1ZQ1A 3LUKA 2OM6A 1PNVA 1MV8A 4D9CA 4F60A 2BEKA 2PJRA 3U4QB 3M6VA 1X8LA 4BNZA 1C1DA 2Z08A 4FWIB 4F3YA 3EPKA 5E3HA 2AUNA 1ML3A 2QUBA 5CDFA 2NTYC 2ASDA 1OBDA 1JPVA 5CRIA 3IQGX 2H1HA 5CW1A 1OF1A 3BICA 1ZW1A 4PC1A 4WNAA 3OZSA 4KE9A 2X76A 2B6NA 2IYEA 3E8MA 3LBYA 4DIUA 3D6TB 2R6GA 3LGSA 2NUAA 4MDYA 4OQDA 4R9NA 3X1XA 2F1RA 5A5DA 4WE3A 1RD4A 2UUCB 2FV8A 3FUCA 1VIYA 4X6UA 5G3YA 2QX4A 1RQLA 2Q2WA 4OFWA 1PDVA 2WWGA 1ZXLA 4O86A 4TTSA 4AZ3A 2OXIA 1M76A 3DFMA 2UAGA 4B80A 1MNQA 1USGA 2NV6A 3DV2A 2ZWIA 4BBRG 4MQ6A 4TTJA 5KTRA 3ZUPA 2QRPA 2W8ZA 3HR4A 1YH3A 1G20A 1ESDA 1UJ2A 3RC7A 3GQBB 1IZ8A 1DEXA 2HADA 2OQIA 3UMMA 1DV2A 1RM5A 1GAWA 4QPNA 2QSUA 2AEEA 4PFKA 1EWTA 4I7HA 1E60A 4LEIA 2C2KA 4RQAA 1PGQA 4MHTA 1Z37A 2FSGA 3FOEC 3O2NA 3MS4A 3K15A 2IGTA 2VQFH 2O2YA 3JTEA 2XOEA 3W2IA 2WJWA 1L4UA 4X84A 5F5LA 3HXQA 2VAPA 4YCAA 3SJZA 3WIUA 4AJ9A 4EL5A 3NX4A 1I1MA 1XEFA 2G9VA 1CEXA 2DHEA 1WETA 2G08A 5I9MA 1N6OA 1N0HA 1VL0A 2GO7A 2X5OA 4FN5A 4PQYA 2IYYA 2EFDB 3TX2A 1SBHA 1XRPA 1B8UA 1NNI1 1VLHA 4Q00A 3WWDA 3B2NA 4XSHA 4B9EA 5BWMA 2DKOA 2OQVA 1H23A 5DU2A 3K2BA 2ZYIA 1XWIA 2WWTA 5TV2A 4J0MA 4HKTA 1W25A 4LH7A 1W8IA 1K08A 5DHTA 4ZU6X 3RAEC 3IS3A 3SS8A 4AS2A 3ZI4A 3FB1A 3VPDA 2FH5B 2VTKA 4YASA 3B3AA 3O7MA 1FKAH 3T3IA 3U5TA 1VSQA 1ID8A 1AK2A 3MIZA 4J0GA </