1EUDB

Crystal structure of phosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
395
structure length
393
Chain Sequence
MVNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKARELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 131
structure length 393
sequence length 395
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1eudB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1eudB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eudB03
2FB9A 3MWDB 5FNVF 1Z2OX 2YL2A 4ZHQF 1IOVA 1W96A 4C5BA 3ORQA 4YBZA 1WR2A 3LWBA 3AX6A 1JDBB 2FPPB 5C1PA 2CQYA 3WO1A 5LYJF 4ZI7F 4C5CA 1M6VA 2P0AA 4HNTA 4O86A 4TV9F 4ME6A 4IIJF 3U9TA 2R6FA 3NUAA 4MV9A 5KX5F 1PK8A 1GGOA 2YYAA 2R7LA 3BG5A 1EUDA 2WYOA 2W6PA 2I87A 2DWCA 1AUVA 3R5XA 4O83A 1CQJB 1DV2A 1DV1A 1KBLA 4XZ3B 4YAKB 5J2UF 2NU6A 4IWYA 4XYLB 3ETJA 4YJ2F 3HO8A 2R7KA 1CQIB 5LOVF 3Q2OA 2NU8A 3WNZA 4O7SA 2C00A 2FP4A 5D8DA 3ORRA 2YS6A 2YRXA 2XD4A 5JVDF 1KEEA 3TIGA 2HJWA 4FGRA 1Z2NX 2J9GA 2ZDQA 4O81A 1EZ1A 2YV1A 2V58A 2CZGA 1SCUA 2NU7B 4XYMB 3MWEB 5BPHA 5LXTF 1T36A 3MWDA 4YJ3F 3AW8A 1M0TA 1IOWA 4YAJB 3R5FA 5CA1F 3JRWA 1KC7A 2PVPA 3TQTA 4FFLA 1KJJA 4O84A 3DF7A 1M0WA 2R7MA 4O2AF 4HNUA 4TV8F 1JLLB 4YB8B 3TW6A 4O4HF 2NUAA 5JVLA 3LP8A 3N6RA 2SCUA 4HQ6A 1CE8A 2NU9A 3DMYA 4O4JF 2W6QA 1UC8A 1E4EA 2ZDHA 4QSHA 4O7ZA 4FU0A 5DMXA 4DIMA 1DIKA 2V5AA 3QFFA 2CNUA 5GONF 2W6ZA 5H80A 4XX0A 4FFNA 1CQJA 3VA7A 4O4IF 1KJQA 4XZ3A 4YAKA 4MV6A 4FFOA 3K5HA 2R87A 3JZFA 2OLSA 1KJIA 2FPIB 5BMVF 5JH7F 3GLKA 2W70A 4YBZB 4FFPA 2YRWA 5JQWA 4Y8VB 4O7NA 3V4ZA 1C3OA 3RV3A 3VPCA 1UC9A 3OUZA 3KAKA 2FPGA 2VQDA 3ETHA 1EYZA 2QK4A 1GLVA 2Z04A 3OUUA 2CNQA 5K2MA 1EHIA 4FE2A 4EGQA 2CSUA 4O2BF 3MWEA 4XYMA 1VBGA 3WO0A 2PN1A 4O7YA 2YZGA 4MV3A 2GQRA 3JZIA 1A9XA 1CS0A 2YWVA 2YW2A 2R7NA 3U55A 2R82A 5CAEB 3Q1KA 3RFCA 1B6SA 4MV8A 4HNVA 4FFRA 2W6MA 3U9SA 1I7LA 2YV2A 4EG0A 3UFXB 1KJ8A 3KREA 3U54A 5LA6F 4L1KA 1W93A 2QF7A 3R5HA 5EZYF 3K3PA 2W71A 2FPPA 4O4LF 4HR7A 3PFFA 1OBDA 2VR1A 4O7WA 4I4TF 2IP4A 2V59A 1GSOA 4O7RA 1SCUB 2YS7A 4O7LA 1JDEA 3HBLA 5CA0F 5HV6A 3KAJA 2ZDGA 2X0SA 4MAMA 2W6NA 5C8YF 4MA5A 1VBHA 1EUCB 4DLKA 3N8DA 2FPIA 1JKJB 2R84A 5CB4F 5HBRB 2I8CA 4TUYF 4Y8VA 3VPBA 2DLNA 3E5NA 3RUPA 4XYLA 3GIDA 4EGJA 2DIKA 2NUAB 1Z2PX 1VKZA 5JQGF 1CQIA 2SCUB 2DZDA 4IHJF 2GQSA 2R85A 4O7TA 2NU9B 2YZMA 2GLTA 4WD3A 4WBNF 1E4EB 2GPSA 5J2TF 2XCLA 4NYEA 1GSHA 4C5AA 3SE7A 3K5IA 3KALA 3TIIA 4M9UA 4IWXA 5CAEA 4XX0B 4I50F 1KJ9A 4RZQA 3JRXA 4O7VA 2NU7A 3RV4A 5LP6F 3HB9A 1BXRA 5IYZF 2PBZA 2Z02A 4YAJA 1EUDB 3UFXA 1AUXA 4IZOA 1GSAA 4I55F 4E4TA 5I47A 2I80A 2NU6B 2W6OA 3R9RA 3MJFA 4ZQIA 2GPWA 5BPFA 2CNVA 1PX2A 1JLLA 4YB8A 2FPGB 3G8CA 1ULZA 2HGSA 3I12A 5C1OA 2NU8B 2YZNA 3VMMA 5KKNB 2FP4B 1OI7A 1I7NA 3G8DA 1B6RA 2YZLA 1A48A 4ZOLF 3VOTA 3V4SA 3VPDA 3R23A 2R86A 4MV4A 1KUTA 4FFMA 1EUCA 1C30A 1JKJA 2VPQA 5HBRA 4O82A 4MV7A 4MA0A 1OBGA 3TINA 1BNCA 4MV1A
chains in the Genus database with same CATH superfamily
1XZDA 2VT6A 5KG5A 2CF6A 2ZRKA 1B3BA 4GMDA 2HO5A 3UJHA 1TZJA 3MSXA 3RKUA 1T6YA 4BNDA 3KJHA 2WD9A 1KY4A 3AI3A 4LXUA 1KY2A 2WG0A 5JASA 1NV9A 3R3ZA 2Z3VA 4KXXA 2XT0A 4EYGA 3W6UA 5DJ5A 4TMTA 5AO9A 1HKUA 1Z12A 4MROA 4R2MA 1QU2A 1OILA 1KSHA 3K2QA 3QIAA 2H1VA 1SU4A 4N0MA 3Q11A 4R8SA 3GLHE 2HA5A 4ZKEA 3A3KA 3G85A 4RPCA 5E1DA 2O8EA 1V25A 3UT6A 4O7SA 2YDYA 3H40A 4DL3A 1U3GA 4L4ZA 4HK4A 5JD3A 4CC6A 5T4HA 2QTBA 4ZAFA 1X13A 2EEPA 2W4QA 1V1MB 4EMUA 3MS2A 4TXMA 2RONA 1VIMA 4BE7B 3M2TA 1I2CA 4Z99A 1IEVA 5ER9A 2ZB3A 1SHUX 3ICCA 1XL0A 2VAMA 5C7LO 1CF4A 4ZU3A 2WA1A 3HCOA 3G6WA 4YRNA 3W5HA 3G2IA 1GPMA 1ZI6A 2ZUVA 1CRLA 4CCSA 1ULUA 1QK4A 3NDBB 2QUAA 1SC1A 4BN5A 3VPAA 4YAUA 1VG1A 4YS6A 2FJ0A 3WK4A 1X39A 5L3QB 4XD7A 2AXEA 1JYEA 5K8VA 3UCEA 1SKAA 4WUVA 1C5KA 3KEQA 2R8IA 4OGWA 4WZ6A 4JIMA 5KJCA 1GM5A 4MGEA 3ZGXA 5FA8A 4TS1A 2I76A 1I6MA 1GD1O 3F7MA 3WIDA 3Q0EA 5EQDA 2QI9F 3SLGA 1I1HA 3ZV5A 3NAZA 1O97C 2BSXA 2HBRA 5FPSA 9GPBA 1S89A 3QX7A 5DM2A 4BEVA 4RIEA 5L9AA 2R92A 2FQXA 5AW8A 2JASA 3KKNA 1P7WA 4C7BA 2DHCA 3QTLA 2ZXUA 4JSYA 4C76A 3U9SA 3Q7EA 4L5AA 2H7YA 4BGDA 3KB1A 2C4TA 4IIYA 4XLLA 8ABPA 1KC3A 2OCPA 1LSSA 4W5JA 2G17A 2PMEA 1X9IA 2RAPA 2PJUA 5KQMA 1BVYF 4ARSA 1WUHS 1QWSA 5B58C 4O2LA 3C4QA 5DISC 1R6UA 4Q82A 1VPWA 2J3LA 4MAMA 3VGPA 3RSOA 5C81A 3PRJA 4OQQA 2H00A 5F76A 4K1XA 1BWQA 3AF5A 3NIGB 1ZA2A 4R7GA 1AGXA 2ASLA 5EP1A 5IKMA 3CPSA 1Z3CA 5CDFE 5EWGA 1P2UA 5HNKA 2XADA 1ODTC 2X4GA 4HYEA 1CB7A 4P08A 2PGLA 1GL3A 4B6PA 4D5EA 1IM8A 1GLNA 4HBGA 4QVIA 5CNIA 3CR8A 3P9XA 1W5TA 1D7OA 2PGAA 5GP1A 4Q3NA 3BABA 4RIIA 5HKAA 2QVLA 3VR2A 2GVNA 4O08A 3SFTA 2JJQA 4PYLA 4QPPA 3L7KA 1OXKB 2VPWA 4MRMB 4RZIA 1CDZA 4FEYA 1QCDA 3OOEA 5U4XA 3W8NA 4RKEA 4YDQA 3KLBA 1O0CA 1Z8NA 1ZVKA 2R6HA 1WB4A 2Z1MA 1ULSA 2QAIA 1VLQA 16PKA 2OHOA 4QDXA 3CGWA 4GM1A 5ED4A 4CV2A 3B6MA 3SKVA 1AQLA 2IE0A 3ZY4A 1JIXA 2V6GA 3V00A 2IYAA 1QIHA 3QEAZ 1OBGA 5ALWA 4NU8X 5TQ2A 4U9UA 5KNCA 2HG8A 3AEUA 4Q39A 3NX4A 4FYWA 4FGWA 3RTGA 3EXIA 4YLEA 5DGCA 3CJQA 1CNFA 5GV7A 3PFGA 1U8EA 1OAOA 1GCGA 3PZBA 2NZXA 2VQEB 4XI9A 3G6VA 2FX3A 4KMMA 1YRWA 3PK0A 2NACA 2XH8A 1K1QA 4MW2A 2VNKA 1Y0BA 4QUIA 2QPAA 2I2AA 2R8OA 3EZ6A 4D8VA 4UMEA 1HLGA 4YP7A 5BWVA 4EITA 5J59A 2HA7A 2FZWA 1W1IA 2XWPA 2RGVA 4B6RA 4XVRA 3GT7A 3BIOA 3L18A 2QSZA 4RO0A 1SCDA 2YS6A 2W2XA 1LLCA 1YDEA 2V4RA 4HNQA 4L50A 3DLHA 3R24A 4D4GA 4FEAA 1U9ZA 4MRAA 2ZU0C 4IBOA 3GHHA 1DC3A 2C8LA 2IELA 2QE6A 3FCXA 4RPGA 4DM7A 3G5UA 1ZQ9A 1QMGA 1ZGAA 3M89A 5CGZA 2PRYA 1CY4A 5FBRB 4FMCF 3TW6A 2H1RA 5LDGA 1IUPA 3JYPA 4Q9JA 1WUYA 1OWNA 1X1BA 4CVNA 2ATCA 4DADA 4EI8A 1E7SA 4FC7A 4RJJA 2UZ3A 4U2KA 1YBAA 3HB4X 1JTVA 4C3OB 5IC5A 3V1NA 5C9ZA 1MNAA 1SOVA 1G8SA 3STWA 4EB3A 4P32A 2AJTA 5HILA 1NI5A 3M33A 5AR1A 3DOIA 1ODCA 5H02A 5BMVF 5BORA 3NBFA 5JH7F 1WW2A 1TAQA 1KSJA 3EGCA 1E20A 3OQ1A 5JWHA 3BD9A 1QIMA 2HT1A 5KJEA 3PW2A 1U1IA 2C2ZA 4AVYA 1Q3HA 3GLSA 3JSLA 4H08A 3CEJA 1VBFA 2V8OA 4P9NA 5L3ZA 2W83A 1A04A 4V1CA 4RGYA 1ZL0A 5FFFA 1U0SY 3CTMA 5KTPA 1PNTA 4XH9B 1RKUA 1KJYA 2WB1A 5LDDC 2PO5A 1JVSA 3PUJA 3ER6A 3HADA 3E3OA 1ORRA 2AFHB 4QU5A 1TA9A 3IKVA 2I29A 4K8RB 1NQTA 4TLEA 2UZ4A 5COBA 1LXCA 1OJLA 2B1JA 1V43A 2ZEJA 5KOIA 1ABBA 1Y3CE 1DC6A 1V9PA 2XNDD 4B3GA 3AVPA 4R8UA 4LYEA 3HDQA 4MUMA 2HRDA 5KJ1A 1OXVA 1OFIA 3OJLA 5CFPA 4UDNA 3NHLA 1E79A 3OU2A 1Q21A 1OTHA 4LDJA 4CGYA 2BZGA 5KYGA 3OPYB 5JJIA 2C8JA 3K2IA 3MA0A 2ACKA 1M34A 2KBEA 3T7SA 4RFVA 2R85A 1PK9A 1VRCA 2POQX 3U81A 2CFCA 3RIZA 1RAEA 3GW8A 1PU2A 3COSA 4B48A 5HWSA 4DAOA 4DGQA 1J9ZA 1AV7A 1C41A 3E82A 3HZZA 2I6GA 3T5BA 3V1UA 4XQCA 2O3QA 3QLUA 4KBFA 3W34A 3CUYA 5CIYA 2W8BB 1Q1NA 4Q21A 2OZPA 3MC1A 4GLFA 3EXHC 2LCQA 3FPCA 3GTQA 3SF8B 4R81A 3I01A 3QF4A 1PK7A 3PWKA 2JIDA 1XZAA 3QVJA 1NXWA 1U2SA 5K3FA 4E51A 4BAUA 1JNXX 3U56A 1N25A 1FS4A 4H15A 4M7PA 6NULA 4YTEA 4LXQA 3TLCA 2DWPA 3VV3A 3KYDA 2WOOA 4RX1A 3NBMA 1RLJA 4U5QA 1Y3IA 5F9MA 3OCZA 4GM0A 4R1LA 2WOJA 2GDJA 4G23A 1X6VA 2N47A 2AJBA 1QP4A 3NEAA 2VAVA 3UPUA 1HRDA 3TNJA 4X65H 4Q3EA 4IQ4A 3M6LA 2AUNA 5AHRA 3CEBA 5JALA 4XVUA 3FCUB 3O3OB 3D43A 4UQOA 3ILSA 2Q27A 4PQYA 2DXIA 3NKVA 2ANBA 1X0XA 1MV8A 3QNUA 5DF1A 1JIQA 5F1PA 3FKIG 4YMGA 2R1UA 2O3SA 2HXGA 4M8IA 1P9OA 5FAKA 2NLOA 5J2UF 4J07A 1IUOA 4B79A 2NYRA 4ZJUA 3ZD7A 4Y2PA 2EJTA 2IYYA 3D4BA 4K6MA 1FPQA 3L5OA 2MINA 2HHFA 1KFKB 3MMPA 1YU6A 4HMQA 4IRMA 5K3WA 4I14A 2W6ID 2G0AA 1YS6A 3AMVA 1OZGA 2GD6A 1VJDA 5GONA 2QP3A 3REOA 4QOHA 3MYRA 1NC3A 1RIIA 2YTZA 4JVLA 5C8YB 4DC0A 3IP8A 2H92A 2JBAA 1O6GA 2Q2NA 5JTTA 3DVAA 4X62H 2C4WA 2AMVA 3BJEA 3SC2A 1A4IA 1JG4A 2GERA 5LOVA 4PYQA 5EKDA 2XIGA 5JAIA 1PQ4A 1NW5A 3CRVA 4OY3A 2WSMA 2PRKA 4MLZA 4XZ3A 1ADBA 3PRYA 2VXCA 1FYFA 3H5VA 3TY9A 3VDXA 4JJ4A 4DJ5X 1Q2XA 3OEED 3PG5A 3EISA 1S01A 3I83A 1Y3DE 3HB0A 2QQFA 4QULA 2RGAA 4IKPA 2DTEA 1N7GA 1KOLA 1YKSA 5IZ4A 2ZR9A 1Z16A 2ZUWA 3EZXA 5DOVA 3U0VA 3MHPA 3MR2A 1E1CA 1TMKA 3ZJUA 2CKMA 4QLOA 4TM8A 3CH5A 1DQSA 3PS9A 3DEAA 3KBBA 4IRDA 2OHGA 4NATA 3OE4A 1P4RA 4D9MA 1RM4A 1LFAA 2HHLA 2PEZA 4NX2A 2CHFA 1GNPA 2GD2A 3ITNA 3EK2A 3DOHA 2R8EA 3TJRA 4LE2A 3OTGA 1UKVY 3ZIAA 1GSOA 4S3MA 4HQRA 5JW6A 2X22A 5CX1B 1N1GA 2JAWA 2X0SA 1ECJA 2QVXX 4LSWA 4UTPA 3Q8KA 4KWTA 3BS4A 4EHBA 4YR7A 2DLNA 2A0KA 1ZAKA 5GGYA 1K8RA 1GGVA 2EYQA 4QNNA 3QVGA 2MCTA 1NF9A 1J21A 1T3LA 4GNKA 3HYTA 1TT5A 5J23A 2E2IA 4J0KA 3DC7A 4MS3B 1LK0A 3N2EA 4OH7A 1LGYA 1E1RA 3BEDA 3QHAA 5DISB 3ZPXA 1DQPA 4KYVA 3NXKA 3QTTA 1PKEA 1FRQA 1Y9DA 2X3UA 1YJBA 3BGWA 4GOKA 4UZEA 3FI9A 4I1UA 4QUJA 3UYYA 4A1OA 3OM9A 4XFKA 3N5CA 1GVHA 4MUXA 3WRXA 2G40A 4XAQA 4MW0A 2CNVA 2ZQYA 5L4LA 3BQMB 3FWPA 1CLUA 5JLJA 4FJ1A 4R2LA 1C0KA 2NPOA 4JI4H 4R8LA 4N9WA 3PXGA 4NPHA 1AZSC 3CX6A 2P5TB 3ROQA 3Q88A 4WOCA 1Y7IA 2GEDA 3F73A 1XZCA 2B2NA 4MQEA 3I9LA 5P21A 4JI1H 3QHQA 5FHRA 2QN6A 1RS0A 4KAAA 3P9IA 3QKRA 2UXCB 3RJ0A 4MV1A 1YBMA 1MVLA 3GELA 2YN4A 2HC9A 1H0RA 3MERA 1GZ5A 4MWSA 3QE3A 4CT4B 3A4NA 2AYXA 2XYQA 3HP1A 1SCKA 3SM3A 2H9YA 1QG0A 4RTRA 2RJ3A 2MMGA 1A88A 3LK7A 3S2GA 3KBOA 1NGSA 4D9FA 2UV8A 2BFDB 4ZAZA 2RGNA 3UMSA 1H66A 3E9MA 4DLAA 3HU5A 4IV8A 1YFZA 4HDNA 3TE6A 1X1AA 3BUSA 4JXUA 2PZAA 2NZJA 2BGKA 4R8KA 3NYQA 1L3BA 1MQAA 2C59A 2J3QA 1HFJA 3K1YA 4H7EA 5JMWA 5HZGA 3F8NA 1H2WA 5DFAA 4DR6H 1C3OB 2YHBA 4DQDA 3OURA 2C07A 1JR3A 1UT8A 3WJ7A 3RGGA 2C5FA 1V5IA 2NNWB 2G9VA 3PEEA 2C2GA 3GTLA 2Q0QA 4QRIA 3VDQA 4BXXG 1F5SA 2WG2A 4EMSA 3H0KA 1SCQA 5DLFA 1DJOA 2Q2VA 4PWQA 1KVSA 3N6RA 1TLLA 4DMRA 1MG0A 3GLGE 4OOEA 4XM0A 4OGKA 3W5CA 4JB2A 1V4BA 2XTNA 2PEYA 3E05A 1JQBA 5CCEA 1O3YA 1QGAA 3ZWOA 4ZT7A 5BY2A 2CNOA 5B7PA 1PZGA 1QTRA 4IOJA 2BGNA 3KRTA 3BZUA 4HNAA 3MBOA 2W2NA 4OKNA 5EKUA 4WY8A 3GGPA 1S1MA 1WBDA 4XYEA 4GE0A 4FLEA 2RMKA 1LQ2A 4YQEA 1P72A 3QVXA 3R2JA 2OHIA 5AKJA 3DHEA 4CF4A 4O7NA 5CITA 1N8KA 1KC1A 5IYZB 4O33A 5KG3A 1YK0A 1QBKC 1PGOA 4KXWA 4AZ0A 1A0GA 4JP3A 3Q8PB 4JI0B 1O6BA 5ALRA 4L75A 4JI3H 4PC1A 4PLFA 2JGEA 4PSKA 5KDLA 4JB3A 4Q4JB 2N75A 4TWZA 2WE6A 3CZMA 1T3ZA 2NSYA 5BV2P 3K70D 2V9CA 3WLFA 2WJ4A 4RM2A 3RF2A 1YD7A 3I0ZA 3T5HA 4BVHA 3WQHA 1FTNA 2B83A 4KCGA 3BD6A 2VKTA 4OM7A 1EQAA 4OLAA 1DCKA 4C4PA 4BCBA 3OJEA 3IHLA 1RC1A 1B76A 3GNLA 1D04A 5LNK6 4OHPA 2NZ8A 4R16A 5B1YA 3QJGA 2QU8A 2XB4A 5EYPB 4ZCPA 3COYA 1TZKA 2PLWA 4P4LA 2PS3A 1DU4A 4LJSA 3G2MA 4LRXA 1PSWA 3KJXA 3L41A 3GIIA 3L8EA 1HV8A 2VPTA 3K09A 2TS1A 1SC3A 1B0UA 1XZEA 2Q5LA 3UIEA 3HM9A 2N9UA 3RIMA 3OE7A 1S8FA 3FWHA 2OXTA 3B85A 3D7RA 2NGRA 2M6LA 2OLKA 4URXR 3D8RA 1KI3A 3CRNA 4R41A 1SXIA 1FDVA 2B37A 2A0WA 3U26A 2P4SA 1C3LA 1W44A 2CDNA 3ESDA 1MO2A 4YHHB 2JGKA 2PJRA 3ZI7A 1Z8DA 3V4LA 1JSZA 2H2DA 5ALKA 4OHCA 1VJ5A 3NWEA 2ZJ0A 3IAFA 4NEQA 4P4GA 3VPSA 4QPCA 1HNWH 2PCJA 4GD3Q 5SZHB 1JNYA 4DIBA 1AU9A 1Y9JA 3OOJA 4FW9A 1L4GA 1Z6TA 3EXFB 1P29A 2Z2IA 3M4NA 4JR2A 3B2QA 3KYCA 1X1RA 2WM8A 3SBDA 2EKQA 1W25A 4KLZA 4Q4LA 2GK3A 4WXMA 1OASA 4ZYWA 3ZBUA 3AM3A 4KQ6A 3KOUA 5J2TA 5ERXA 1XZKA 4MI3A 3TDKA 3ZGZA 1YA6A 1VI2A 1DC5A 2X1HA 4XXHA 3T7JA 1FXSA 3GOQA 2Y0EA 5FBZA 3ET4A 2X9LA 4YMTA 5AICA 4GBED 5LM3A 4HYYA 1V4VA 5LP6A 4OLJA 2FPPB 2C29D 3TSAA 4B3JA 4B3SH 4CNBA 2HHHB 3P0IA 4H7FA 4JT9A 1JH9A 4P4TA 1RWOA 2QTGA 3T1OA 3SFVA 3IEKA 2XWBF 5LCXA 1H1LA 2P79A 5CJPA 1DELA 4GR9A 3G1TA 3RWMB 1YVDA 1PJSA 4H77A 3OCJA 2O8BB 5D1OA 4DMCA 2J0UB 2V1UA 3FZNA 3KM0A 3U4QA 2H06A 2YDXA 5CA1A 3CQ9A 1HXHA 2H5IA 4YVFA 9LDTA 5EA2A 2PX2A 5FYDA 4TWBA 1EFVB 4TS9A 5CEJA 3A11A 3LXUX 2WJZB 3HUFA 4YJHA 4UPEA 1KEEA 4KGDA 5DYNA 3EEOA 1TDJA 4B3IA 3W6NA 1TT7A 4PWZA 4S05A 3I1FA 1GYPA 1ZVQA 4TXJA 3WGOA 5HXAA 4PZPA 4R84A 1YV9A 3RRJA 2PMWB 3L4KA 4G0OA 3ZQUA 3RK0A 1MEEA 1I2KA 5TQVA 2UXBH 4TT3D 2WT9A 3PQEA 4MI6A 4AJKA 4BV9A 3GPDG 4RFSB 5I7SA 4N8EA 4ZYTA 2IIPA 4ENQA 2OCIA 4HD8A 3DAGA 1SUIA 3AVXA 4KR6A 3BE5A 4IIFA 4JXJA 3HP7A 1GILA 2ZBQA 3K8OE 4LHEA 1GZ4A 1JQJC 2ZVQX 1E1NA 5IEBA 1XTSA 3VYVA 4CQLB 1XTIA 3K9WA 2HIXA 4TRNA 5C5IA 2B6HA 4OHRA 4UUOA 2X0DA 1DEHA 3G0OA 5IWAH 2XCPA 4REOA 2QW0X 1DDGA 1NQWA 4TL8A 5BSMA 3WWZA 2JRCA 2F4NA 1TZMA 3TZKA 1ZOOA 5FO0A 2XGPA 2XE8A 4X1YB 1RWMA 5LQAA 4WECA 1TQ4A 4I9FA 1Q14A 3OX1A 2QAGA 4BX0A 2Z58A 4E33A 2EYUA 4P4UA 1CJVC 3KZNA 1J8YF 4YY3B 5JCOA 1EP9A 1YQGA 3KZCA 3G2NA 1T8UA 1B8VA 4JJIA 4YWHA 2XCQA 2Z8YA 4HBZA 1WY7A 2V4QA 2QQGA 2XXJA 3LQKA 2VHUA 1UKYA 2VWQA 3ZGOA 4J9OA 3R0JA 3SE0A 1NXVA 4BLOA 4K40A 2F17A 1WV1A 1XEWX 2A57A 2COJA 1CT9A 3RFVA 4BFCA 2HFKA 4Y1EA 1X70A 4S04A 2WVJA 1F8YA 2QT1A 4W4TA 2A5YB 1CQZA 2OT3B 2CFTA 3WWCA 3MEQA 5CVVA 2I4MA 5CURA 1JKFA 3D4IA 1X94A 2WLTA 1E60A 2J0SA 3K9NA 2WJWA 2XB2A 1P1RA 2VF7A 3IB6A 4TRJA 5LA6A 2W98A 2YJZA 5KWSA 1WE2A 5JXGA 1BU5A 3T3NA 3LQ2A 2JLWA 2P0YA 4OU4A 4MQFB 1ZGHA 1YL6A 4QFMA 1KI1A 1E5DA 3Q8LA 5HSGA 1Z06A 2O0LA 4EYSA 3WRYA 2PFSA 1AKWA 2EWVA 4AY5A 5DTRA 4TKVB 1M8KA 4DCPA 5TPZA 1AXRA 1EX7A 5EG5A 5REQB 4I66A 2ODQA 3LDGA 1HNZB 2VUIB 2IEAA 2Q9BA 5C32A 5FPOA 2HZBA 4RCYA 3C6YA 4IWNA 1RTTA 2I2XB 3HV2A 1PJLA 2IHVA 2ZM5A 1NLYA 4RPHA 3A1NA 4IHJA 1UP6A 3TSCA 4H17A 3ZLTA 2X0RA 4NENB 2NZYA 3QI7A 4TTSA 3PW0A 5DBEX 2RHJA 3SI7A 4L8FA 1BA2A 4PSUA 1E0JA 3RODA 2ZUEA 4Q16A 4X66H 2VDPB 5FWXA 4O3OA 3O4GA 5HJ7A 4Z51A 1G2OA 1L4NA 1MOPA 1VGRA 4XGNA 2WB1E 5JEDA 2W7PA 1N2SA 5CXUA 3RW9A 2PH3A 1IEXA 1UEJA 2BFEB 2ORIA 3ZH9B 2F4VB 1Z07A 2F1OA 4YCLA 4YMLA 4YJ2B 3DZCA 3N74A 2FEAA 4R2JA 3PJFA 3FSGA 2R1VA 1SY7A 1W88B 2FPOA 1F2UB 2AFIE 4IWYA 1JPUA 2CXXA 1CUAA 2XR1A 2QQ5A 5B58T 3TW0A 4WVFA 1I5EA 2ZUCA 4IDNA 1BJTA 1EKVA 1KOFA 3SCZA 2AG0A 5EESA 4PXAA 3GCDA 3GAZA 1QIIA 4ENWA 4A3KG 1XRSB 3ZD8A 1UAGA 1FVFA 4FBLA 5DTQA 3HVRA 3AUAA 1GO2A 3P1JA 2YNMC 1R0BA 1FP4A 1MIOA 2OFPA 1OI2A 1ZZEA 5TC4A 5CIWA 4QASA 3F5MA 4WZAB 3B78A 2X40A 5JVLA 2HSGA 1DMSA 5LIRA 3T12A 2ZE5A 2ZZMA 2JH9A 5C34B 4O4JF 5DLPA 2VZ8A 3EGDA 1HNNA 3H2HA 5KMGA 3V6KA 4MYTA 4D0NA 3EGXA 2AX3A 2PMKA 1D0VA 2CVHA 1RKXA 3SZGA 5C8ZA 3QKSA 4MW1A 5FI3A 1P5HA 5KFFA 3IYLW 2IIQA 2FMTA 4BO5A 4M53A 4DV0B 4EF5A 1P73A 3DVLA 3W4KA 3PW7A 3PTZA 3VC1A 4EYHB 2IX9A 4CM8A 1WB6A 4Y9UA 4NNJA 4LBWA 3O4HA 4MB6A 3TPCA 1GOTA 3GRFA 3A27A 3UNXA 3ZW8A 5K2MA 1TM2A 4FE2A 2WHQA 3KQTA 4O2BF 1DO0A 3JQBC 4ZTBA 1BDMA 2Q4TA 3WYAA 3QA3E 2ZKIA 4F12A 3K6JA 2GXSA 2JF0A 2WMYA 1JN0A 3EODA 3IDAA 2VRCD 1E2JA 3WS7A 1UEXC 4KGXA 2IU6A 3SC3A 5T8KC 3WGUA 3JVUA 5IT5A 2B94A 1J25A 3KPUA 4YONB 1ZJYA 2BFNA 4XVQA 1NXXA 2J9ZB 1PL0A 2FRVA 3FE2A 1R66A 1A7JA 3I37X 2WJIA 2ONKA 3MT0A 2XCRB 3C5VA 3SSNA 4N3BA 1ZC4A 1JTFA 1CR2A 5E9QA 4ZYXA 1DIHA 3S7TA 3AERA 3WLRA 4L5YA 4DDHA 3QELB 1E98A 2BJWA 2ZTSA 4BUCA 4N5IX 2E85A 3R7WA 3LGAA 2OVFA 2O07A 3NVKI 4HXEB 2F3TA 1ZSVA 4UAJA 3HK2A 4JLUA 3K0EA 1JZQA 2VH2A 3H4DA 4N54A 4CKWA 1JYFA 3AHEA 3FVTA 5BWBA 3OKPA 1P2BA 2XWSA 2IA6A 4C3UA 5CCXA 1XQ9A 1JX6A 4AMZA 3AZQA 4XSGA 3YASA 2UVVA 2DFKB 3O8LA 2REQA 2GTHA 1BMTA 3H6HA 3AJ8A 4WDQA 3HNOA 3AP2A 3L84A 2XPCA 5KYUB 2WDTA 2ABJA 2XXAA 1BN6A 1C1DB 1ECLA 3AB7A 2Z08A 4DREA 2VDOB 2L17A 3PYMA 3LPLA 4NOLA 2FW6A 3DTVD 1XMVA 1RYHA 4J9QA 3ICPA 5F2OA 2GZDA 4IR9A 3VYWA 1IM2A 1L2ZA 4H2DA 4GPBA 5EMJA 2WIDA 1G3MA 4BZXA 4W1SA 1NG9A 5HIIA 1BDIA 4Z4CA 5G1OA 4X7PA 1T3HA 3O8CA 1KR2A 2BKXA 3FJ1A 4FOTA 3N6VA 4YUZA 4RNDB 2X8BA 5AW5A 2FW0A 1LCIA 4IUYA 4GUAA 3BMNB 3JQFC 1MAUA 4QOGA 2XCIA 3L0DA 4PO8A 1VOTA 1V16A 4HDKA 4XCQA 1J0CA 2ID4A 3WK8A 4IGIA 3FAKA 1UJ4A 2N46A 2HQ1A 4ZHSA 2AKAB 2ONJA 2BI4A 5IFKA 5JTUA 5BSKA 3FWKA 3PPXA 4RHEA 2EXXA 3GRYA 5A9RA 1ZM3A 3AVWA 4M21A 3WWJA 1GG8A 1KTAA 2WUFA 2W37A 3ICOA 2D5BA 3AKEA 2HJGA 4I19A 4CN9A 4EG3A 5LD2C 2J6BA 4F8YA 4YBRA 3RR2A 4DT1B 3CJTA 4QKQA 4MWTA 4HDSB 5K6AC 4KE6A 2WVGA 5KYNA 3TGWA 3E9RA 4JI5B 4FZRA 4WGFA 4GAEA 3A70A 4AB1A 4K2HA 3EXG2 3IUPA 4MRNA 5CXXA 1VG9B 4X44A 1N7IA 3DS8A 1Y37A 3DCNA 1SIOA 3KJFA 4ND2A 4MKRA 2ZTHA 1R6VA 1QTIA 2O48X 1EU1A 4IXNA 2A78A 5G3ZA 4O2AF 1NSFA 4GLOA 1T2AA 3KHRA 3T9FA 3L2OB 4TTRA 2IV3A 1OIWA 4QDJA 2NVWA 1P80A 3LYAA 4QUDA 5KFKA 1RHKA 3OP4A 3VZPA 2DBRA 2PMFA 8ATCA 3KZOA 4BMNA 3I28A 4I2NA 4AZ3B 2IYRA 4CR7A 3ZHSA 3OD1A 2XJ9A 4PPFA 1TM7E 3ZVMA 3RU2A 3EFOA 5I4IA 1OLUA 1EFRD 4U2EA 2R66A 1DCFA 5C8VA 3L4SO 2E5FA 3VH2A 4CKEA 4EKNB 2H4HA 1NFRA 1BU8A 2QTVB 1VL8A 2PA3A 2XHEA 4NE7A 3N76A 1W0KD 3LP6A 5ALLA 3SJ7A 2XIJA 3ZK7A 4C6TA 2BQ3A 5DLEA 4FLFA 3RAGA 1ZCFA 1U0GA 5EHGA 4B8YA 3GCZA 1U7OA 2R00C 3GRZA 1ZLXA 1SVOA 3N2GB 2D7JA 4W5RA 1AUQA 3D7MA 1BH6A 4UCUA 2C83A 2XYVA 2WF5A 1Y8QB 4KN5A 4FFRA 4EPWA 2HV8A 4B31A 4TRRA 4JEIA 2VJPA 4ZMBA 1VECA 2UDPA 3R7AA 2YJ3A 5DHQA 5HP4A 4HAYA 1O1YA 1SVLA 3WJAA 4EENA 1LS6A 4GX2A 5JG7A 2PO7A 3GOHA 3FVVA 3NRCA 1CY0A 1BC5A 3PQ2A 1SRQA 1A9ZA 1IY9A 4KPGA 3BHNA 3JQAA 4HX9A 5FOVA 1JR3E 1QHXA 4MVCA 4KV7A 2X41A 3G2HA 4JI6H 4IRUB 3WSVA 2JLUA 3HLYA 1KMHB 5JSKA 1Y3AA 3O7WA 3WGGA 3OQVA 1XLVA 5HQJA 3FGNA 5L53A 3SZMA 3H6GA 3PPVA 3K30A 3IULA 3QF7A 4H6VA 3CW8X 1FJ2A 3MOGA 4H6XA 2A1TR 4J0JA 3F96A 1YONA 1Q77A 3BL6A 4LSZA 4D3ZA 1ES9A 3V4FA 5HRUA 3H3XA 4F84A 2WAMA 3N3AC 5EHIA 4PQEA 3GBSA 3GTPA 4ZQCB 2AMFA 3B82A 3FMVA 5IBRA 2EZ4A 2PS9A 3EVEA 3ZDZB 3LKZA 4KXLA 2C4KA 3OEHD 1V6SA 3A37A 1RD4A 2PGOA 1FSFA 1XF9A 1NDQA 3D8BA 3V8RA 3H18A 2R6DA 3GPCA 4ZRNA 1OU4A 1QF7A 5SYMA 1JIKA 1OLSB 3HVJA 2Q46A 2UVWA 1P1HA 2GYVA 1V8DA 5SY9A 1VBNA 3K96A 4F71A 1KKMA 2EG9A 1LVHA 5CR5A 4Q9AA 4CF6A 3TLGA 2ZBDA 4QUGA 2IHKA 2JJ2D 2GO7A 9ABPA 1X1TA 2Q1WA 3LOPA 1D2RA 1RJ9A 2HL6A 2QUIA 5JADA 4BPBA 3K9GA 5KHLB 1Y1QA 2BGMA 2BMAA 2XUOA 3LVBA 4CV0A 5IU6A 2WYOA 2CLEB 4E4RA 3NLLA 1KFCB 3FDJA 2WUDA 3CNQS 4X8OA 1CUWA 3QXGA 3LXXA 5K6TA 4OSOA 5A4KA 2CK3D 1WMBA 2VJOA 1UXOA 2YH2A 1LSUA 1MNQA 4A0FA 2JI7A 2ECFA 2JA5G 3WR5A 2PDAA 4GMGA 1UPCA 2O8CA 2CZGA 1Z4OA 3KQVA 3Q7SA 1DC4A 3GV0A 2YWDA 4NFYA 3EVTA 2Z8ZA 3RHSA 3KVOA 3C87A 1N6OA 4FS3A 4Y1FA 5THXA 2HNAA 2DBQA 5BV7A 5FTWA 4FNGA 1R64A 4Y1GA 3KDAA 2WQ6A 2OCBA 4CMGA 1BXGA 4O4HF 1NDUA 2SCUA 3BKWA 4JKOA 3Q7IA 4A0HA 3M3DA 4AJPA 4TUYB 1N32B 3GB8B 4TKLA 4C4YA 4HDOB 4YT8A 4MS4A 3U7GA 2WHYA 3IUMA 1HE2A 1NJFA 1HK7A 1PJ8A 3Q6MA 1F4VA 4DNXA 5T57A 3LDFA 1U5CA 3QE9Y 3LU1A 4J4TA 1LTQA 1JIJA 1SUWA 4W8HA 1P7ZA 5DCLA 5KG0A 4DCCA 1JVBA 3NHSA 4HT3B 3MBIA 5AKHA 5EIFA 1I4WA 3STXA 2I1WA 2AV6A 2P6UA 2WQZA 2YN0A 1BGXT 5FUQA 4BN0A 4XYGA 3O82A 2JGAA 4DRZA 4UNNA 4HPJB 1WHTA 4JV5H 5K8IA 3ZHVA 1PR1A 5AJVB 3KLMX 3AF2A 5HKOA 1TKCA 3EGIA 4RENA 1VIDA 4BV2A 2QGZA 4Z2YA 5G2OA 3FRHA 3ZLJA 1I50A 3GEEA 4KWCA 4Y2QA 5TQJA 3FXAA 3G8YA 3N2NA 2R9VA 3SLKA 2ADMA 4CM9A 5KT6A 2BFOA 4RJ2A 2AXPA 3ZVRA 4FFSA 3U54A 1ZOPA 1CRPA 1ZD5A 3KSBC 2OFFA 1G18A 2P3OA 3HKDB 5IM4F 1XPOA 3MJDA 1N0VC 3LA6A 1G8YA 1L1FA 1ZAUA 1LB1B 5KEIA 3LDUA 2ZDGA 4UFOA 4XWGA 4RTNA 4W7SA 4TV9B 4A8JC 3T99A 3GN2A 3X2FA 3NMUF 3E5NA 1N7HA 2VP6A 2VWGA 4U2GA 1A71A 1ZG3A 1CWUA 4YRGA 2CJFA 4ZT6A 4G5QA 2BCGY 2QT9A 5GQSA 3KZMA 4C01A 1JQKA 1TQDA 1PUXA 3OIYA 4HUTA 3PR4A 3G9TA 3MCAA 2DBVO 2RHBA 1SCNE 5JVDB 3E8SA 2AI3A 3ZGVA 3R8FA 4JJ6A 2IQ5A 2V03A 3RAPR 2C99A 2C3MA 4DV3B 4DL9A 3RC2A 1ZSNA 2HDNB 5LXTB 4L57A 3A9UA 1M2HA 3DOUA 5GM1A 1H3EA 4JYAB 1O96A 4XQ9A 2HLHA 2GASA 3A6KA 3N75A 4AG5A 1NN1A 3ELUA 3ME5A 3PKZA 4FQ7A 4OHMA 2C9OA 3UB4A 4E14A 2BBWA 1H2EA 1KYYA 2IPOA 2V7PA 2VJYA 3M6WA 4E2WA 2Z98A 4CDGA 1ONPA 1PLLA 1FRFS 1T36B 4EPTA 4LXYA 3RYFB 3V34A 2HK6A 4LRYA 4X8MA 4BNUA 1I7DA 2P78A 2FQQA 4JN6B 3AX6A 3GVIA 3V80A 4ABYA 1VJGA 2GRJA 1EFPA 2PX5A 3C6QA 4I36A 4DZZA 1G7TA 1E9SA 4WLVA 2NXNA 3S7ZA 2E9SA 4F6RB 3VDRA 2NVUB 3D5TA 2RK3A 3L4BC 1FYXA 3WLOA 2WU1A 1XELA 4X3OA 1YVEI 3TB6A 3AESA 3LV8A 3S81A 4LF5B 4XIJA 1L9XA 5K0TA 4LJLA 4CKYA 1C7QA 5TSDA 2UZ1B 2QUBA 5KWJA 5CCDA 2EGUA 1UBEA 3SS7X 4C0AC 2FPMA 1IC6A 5DN6A 5I9BA 4FSHA 4YP3A 1NVTA 2QMYA 1JA1A 1SUSA 5FT9A 3BHIA 4A93G 3UWMA 3D7SA 4RABA 1JR2A 3GJ8A 1ENOA 3PD1A 2ZRLA 1M74A 4Q3LA 3MWFA 4YV0A 1Y1SA 5JFTA 3FWZA 2W8LA 5LD2B 4B2IA 3KG2A 5K6RA 5JDIA 1ZU4A 1SUDA 2PSJA 3CF0A 2Y1XA 1UKAA 3I42A 3UT5B 5KYXB 4YAEA 2JLRA 1I6KA 2NTYC 3IAXA 2BRUC 6ABPA 4BE9A 4ECEA 3KQHA 2QIPA 2JA8G 4I3GA 4X92A 1E1KA 5ELMA 2G0NA 3UQ8A 3VM6A 1YE5A 2C5BA 5SY6A 2VYVD 3FY4A 4A1FA 4J0EA 3L6DA 1MDBA 1XMQH 2Z4TA 4B4OA 1LC3A 4AYBE 3TL3A 1UDAA 4YBZB 4GYJA 4AN1A 2VCHA 3MOSA 1V51A 2D7CA 2PYZA 1NJSA 4DPKA 3D2LA 1B6TA 3A32A 2O2DA 5A9TA 3L46A 3RB3A 4K9NA 5K45A 2YU9A 2XT6A 1WZNA 2WD7B 2R82A 1SJ9A 5CT6A 1XYVA 5DM1A 2XYPA 1QUFA 1UF9A 2O20A 621PA 1GFIA 2V7VA 1UK7A 1CJKC 5AVUA 4PO3X 5JOQA 4DV4B 3URKA 3KOWA 3OUTA 3CX8A 5FNVB 1UC4B 2H1IA 3LLSA 3DD5A 3HYLA 4WLNA 4U7DA 2IYVA 1YZHA 4JLAA 3UA4A 3P9KA 1X74A 2HH9A 2FZCA 3HO1A 1TTPB 3CVZA 2GZ3A 2JJ1D 1CJCA 5TDHA 1V7PC 1R15A 4C89A 4BXOA 1N6RA 3OWHA 4IZHA 1IZZA 1Z56C 4GOND 5KINB 3CHYA 3UXYA 3Q1LA 2IIBA 2UYOA 3EGVA 4UUPA 3GIDA 4YR9A 2KPOA 5KCMA 3ISTA 3ASVA 4S1TA 4EHJA 5FA5A 1KVQA 3CUKA 2JHAA 2H29A 4IQGA 3VR6H 2JA6A 2NYVA 3QPCA 4HDRB 2H85A 4Y30A 4YDHB 5F51A 4HY3A 3V55A 2YUIA 2C9BA 3WLQA 2FY8A 4G84A 4LNUA 1GPH1 4BVEA 5DM60 4KNVA 3I39X 1PWEA 3AKCA 2G7ZA 4QJ5A 4KO2S 3TTSA 3IRVA 3LIPA 1T9DA 2KHZA 2QA5A 2VQ3A 2DFTA 5C0OE 3TLEA 4E2YA 3FOWA 1WNFA 3SVZA 3BE6A 1OC2A 1PX2A 4U7TB 1SBNE 1OXUA 2FQWA 4N41A 3D02A 4Q24A 3VMMA 4FDTA 2Q6VA 1ZJJA 3V97A 4I6GA 1M6WA 2R86A 3ITKA 3HOVG 5FOUA 1OFTA 5BWCA 3I6QA 3O9ZA 4JB0A 5CFNA 4G5HA 5JS7A 3PXBA 4ZP1A 5HBRA 3BFVA 3C3AA 2XMPA 2G1KA 1L8LA 5KU1A 4LN1A 1WL8A 4HAUA 4C88A 3MLEA 3DJFA 4LYFA 4QYWA 2JEFA 1T4GA 3HCFA 2XCUA 1M67A 3CINA 2GAOA 5ITSA 2FFAA 4BRSA 2G1PA 4DNPA 3CS3A 4G41A 1TB4A 3EIQA 3F5QA 3EQ6A 3JVEA 3K92A 4RYDA 3WG9A 4K0KH 1RRVA 2RH5A 2FSPA 1T94A 4CJXA 2FEOA 5TV2A 4C14A 1CUJA 3DV2A 4ARZB 2AZ4A 3PJEA 2TYSB 1Z5WA 4FX5A 1WF3A 4TN1A 3ML1A 5KFMA 2R5NA 3EUEA 3M5PA 2VL7A 5DZSA 3KCQA 3INYA 4XJVA 5BW6B 5FR9A 1C1XA 3K71B 3WMEA 4ZV7A 3F78A 4DNOA 4G4SP 1PNQA 4LAFA 4HFRA 4MB0A 2QLLA 2XUFA 3HR4A 2PVPA 3CUWA 1UP4A 1PCXA 3OZEA 2C61A 3OPYA 4RB1A 3AUSA 1X1SA 4N18A 3ACBA 4HNUA 3UJBA 1JLLB 3EMVA 5DNYB 4U8HA 2GTIA 3PPIA 5CB4B 5I7WA 5ECWA 1SUPA 3AJDA 4MQ4A 1GYRA 3WHPA 1HG0A 1RQXA 1QH1B 2BTQB 5H80A 4DL2A 4WBNB 2VHQA 1S0MA 2ADOA 1HT1E 1THGA 2GEBA 3FA2A 4CPDA 4H7HA 1MORA 5BN4A 3DMDA 4B32A 2ZYAA 2B98A 4GX1A 5E9WA 4CKCA 2Y1KA 3HB5X 2EX0A 2RAFA 5AHWA 4DVGA 4IR1A 2UU9H 2HPAA 1JT2A 2E2WA 1PYGA 2Y2UA 3EIUA 4FI3C 3EMDA 3UTDA 3WLTA 2G25A 1K92A 3ICQB 1TCVA 1BS1A 2QRPA 2IQIA 5IAJA 1V9LA 4TV8A 3BOSA 1VBGA 3WO0A 2GHIA 1M33A 2ZUTA 7MHTA 4MULA 4GFDA 3UHPA 1EM6A 3PYLA 4YEDA 1NF3A 5BSHA 5AUNB 5AP9A 3D81A 4CQMB 4BS9A 5G4KB 1P6XA 4JT2A 1DHRA 1Q84A 1YAHA 3PW5A 4DQXA 4CTJA 2OHVA 4I6EA 3EPKA 1QF6A 1MPTA 3ZVLA 3ZNPA 1QHIA 4R2HA 3UJ9A 4KH0A 1E2BA 3D8NA 4ZEXA 3SX2A 1R9GA 2WE8A 4AQYH 4WJKB 1WULS 3UG6A 3R5JA 1LA2A 1PYOA 1JDPA 3OBBA 3DCYA 2PKQP 3EVZA 2ZJ3A 4LE0A 3R9IA 1RZRA 4C78A 1J0BA 1WPRA 3JD3A 3DDOA 2COUA 1ZMXA 3GBPA 5GVRA 3DMFA 3FYUC 4DJFC 4LJ7A 4C07A 1U2PA 4ENTA 4W5OA 1G5HA 3T1NA 2NPIA 2O1EA 3MTGA 2HSWA 4ZDWA 2HOQA 3DMTC 2FF7A 5AUOB 2ZQ5A 5JHGB 4YXWD 2E6KA 4KNWA 3I34X 4NYIR 1C4XA 3SBXA 3W06A 5L4SA 4RZQA 2DSTA 3PENA 5TRTA 2C82A 4GEKA 3PSAA 1YJXA 2CY0A 2WFAA 2IS2A 2XZTA 3F46A 4A8JB 4IZOA 3S1SA 1SZPA 5JMPA 3QKWA 4WL0A 1IXYA 3AWDA 2XD9A 1FUYB 2ATEA 5I5WA 4II2A 2JGRA 4N0EA 2Z57A 3RTEA 5JI3E 1GFWA 1UKCA 2FP4B 4A82A 1UCFA 3SHWA 4ED9A 4LF9B 2OO5C 4WKCA 3W90A 4M0MA 1XBTA 3WYGA 1T0HB 1PR5A 3BQ2A 5IVHA 2QLJA 2JAOA 1Y5IA 4Z4HA 1QO9A 2PZEA 2HLPA 1W96A 4XDZA 3GT3A 2D0OB 4MR7B 4PAWA 2F62A 4BBZA 3PHHA 3B1JA 3KB6A 3KTAB 1P16A 1UXHA 4D80A 1CKNB 1U0FA 3MCUA 3V2UA 1D2NA 3D8TA 1JEJA 4K0RA 2F59A 1XC7A 4QU9A 4HH1A 2E4VA 4B3DA 5JAUA 3RYCB 2BKLA 3SSAA 3EXEB 1SPBS 4O1IA 2PH7A 3L0OA 2ZIUB 2I87A 3A36A 2RDIA 4PGMA 2X23A 3NWBA 2PXHA 4NC9A 4AMGA 4KQHA 1VB3A 4PFQA 4ED1A 4O8CA 2D6FA 2P2GA 2XV1A 3IJEB 1Y1WG 1GG2A 2NPFA 1QC5B 3M1LA 4BO3A 5KQRA 1PSZA 1E66A 1NL3A 1DKOA 3BKXA 1DS6A 1ADJA 1Y98A 3ZZTA 3I6ZA 4S1PA 4YAJB 4YCJA 3FOAA 3PFHA 2ZWOA 3PTLA 2R2GA 4RULA 5TPWB 1RXCA 1T5TA 2FG6C 1ANKA 2WEKA 2P11A 1UZMA 4F4JA 1YB2A 2XMZA 1R74A 1RQRA 3QPAA 2W6QA 2GHRA 4LS3A 1KO1A 1TA0A 3EARA 1QHFA 5GINE 5DNVA 4JQZA 3BXHA 4XWYA 3VNNA 3QM1A 5C5CA 1PZHA 1H2BA 2UVDA 2R97A 4N9QA 1BH2A 5AM4A 1JLRA 5DPMA 4CLOB 3KUKA 1Y6QA 4RD6A 3FX2A 4KFUA 4RNMA 1U6JA 4C7MA 4JOQA 5CD9A 1O95C 4A2BA 5EGNA 3V8QA 5AI8A 4R1NA 4NFHA 2WAYA 5TXGA 3NHZA 3CB4A 5CM9C 4XEUA 3A9VA 3RH0A 2HR1A 4MVJD 3BJYA 1NMEA 3BMQB 4ZDKA 3H83A 4MYDA 3JASA 2W8ZA 4MVJF 3DJYA 3UFXB 1KH1A 4Z7NB 4F92B 4QL3A 4F4IA 2QF7A 2XB8A 5LL6P 1IUKA 5ALQA 1UMBA 3PFFA 4W5QA 1HLFA 4AY3A 5CNJA 4LQCA 1ZPDA 1GCUA 3RFFA 4K88A 2BH2A 3S68A 2Q7DA 4ARIA 1H05A 5ADHA 1ZONA 4ENPA 5HQTA 3O38A 4R2XA 4LCEA 2R8ZA 4OO3A 4U00A 3AVYA 2O2SA 3NEJA 3O21A 3PFWO 2EDAA 3EE6A 5IVKA 1N3BA 1A9YA 4TM7A 2XMSA 5F77A 3RF6A 2OGSA 3ECCA 1P4AA 4JXXA 4KPFC 5K0JA 2OOSA 1TC1A 1NVBA 4AKIA 3OPNA 2C7GA 1G66A 1MB9A 1P9WA 2OG1A 2Q7OE 4G0WA 5A4IS 4JLBA 1KJ9A 1JF8A 4KIFA 3ZU6A 4ECWA 1QRDA 2ZRAA 2X0IA 2FK3A 2BEUB 4LYJA 1TWHA 4Q1FA 2WJHA 5G0VA 1ZBDA 4A26A 2X6RA 2W6OA 1AHIA 2VUMA 3W3AA 1U99A 2XSZA 3C3MA 2PX6A 2GVDC 2F2TA 1ZI9A 3BXOA 4ZCQA 2NU8B 3D0RA 1P2DA 2PV7A 4Z1MA 1YIAA 1AGYA 4PNHA 4HGQA 4DV2B 4Y2TA 5IULC 3HRIA 1WVIA 4HWKA 2BR0A 4MXDA 2XJ4A 2O3UA 3MLAA 2P2NA 2D1SA 4ZHQB 1VL0A 2IPLA 2QM3A 1NMQA 3WSTA 4OREX 4YPOA 2CMKA 4MA0A 1W5SA 3CUSA 4YJDA 2GBIA 2QRMA 4FT2A 1U90A 1E2FA 1IEWA 5IJAA 1IJEA 1QSGA 1EWQA 2HIAA 1P2FA 4ID9A 1P2VA 1RXEA 5IYZA 3JYQA 1ZRSA 4ZK6A 1HZZC 1VSTA 3FTDA 3I2KA 2B63A 1R50A 3AQ4A 3SZRA 2PCLA 4B3MB 1KVTA 3CXUA 1F8UA 4RJTA 1PK8A 4PLZA 4U39A 5FXMA 4ZQEA 5G1NA 1L7VC 3LSTA 1V1RA 2KWIA 3NFYA 3PL5A 1I2LA 2I6TA 1UWCA 2XCAA 4RHUA 3P52A 1EXWA 3HYRA 4L7VA 1TCBA 4R40A 1BQEA 2GF0A 4I9GA 1FDUA 4MUNA 3QMWA 3WK7A 2Q5OA 1NWCA 3ZNOA 3H2BA 1H8HD 1XZBA 4BFWA 5ARBA 4IJQA 1B15A 4UAVA 3ECSA 4FGRA 5CD1A 3OEYA 5F5XA 1MXFA 3RS0A 3HH8A 3GJ0A 3KLPX 4EYKA 4DDTA 1I7QB 4CUJA 3OJCA 3EY9A 1SA0A 4OM8A 3W4JA 3MWEB 2HYIC 3SHVA 4U3JB 3FDXA 2DB3A 4ENVA 4GI7A 2VSOA 5A3QA 2IYFA 2G5PA 3GG9A 2CV0A 2NIPA 4KVAA 2ONCA 2MCFA 2R47A 4ZVQA 1MHPA 2NXJA 1OCEA 3BILA 3WLJA 4ZOBA 5C37A 4UAGA 4AX4A 4TKZA 4CIYA 2DQSA 1U6KA 3ZIUA 1YB1A 1ZESA 4UVGA 5DHFA 2I71A 3RVPA 4FIZA 4PLCA 1S0UA 4QDOA 3CWQA 2WHXA 2A88A 4LKOA 2CW8A 3M3PA 2Y4OA 4MDYA 3NJRA 3KU4A 3EXFA 2RC5A 3I52A 1FNDA 1RE0A 1W2HA 4DV7B 3PHLA 4F7WA 4HYQA 1GLVA 1K2WA 3G2QA 1X92A 2GXQA 5JR3A 3KYJB 3OHSX 2V8BA 5AUPB 4WTOA 2PFGA 1XDDA 3GCXA 3VUFA 2NSDA 1PT7A 1ZHQA 2JAXA 3CVXA 4HF7A 1G5FA 2NUPB 3IP7A 1GIAA 4ND7A 2HPVA 1X7GA 1GAJA 1T0IA 1ODKA 2PNJA 4DABA 4DLSA 1NVVR 1HY3A 4QDUA 3K9FC 5AWFC 4HOYA 2FPPA 2CNLA 3WLKX 2Q3MA 3EXHA 1PT6A 4OP2A 3G6YA 4OXXA 5BW5A 5LKAA 1H0KA 3P4UA 4FONA 5LMNB 1C9DB 1W35A 4MITA 2QN1A 5FBQB 1F8GA 2PIDA 3FTNA 2D4AA 1H1DA 4IIVA 1M2FA 1XFDA 4HX2A 2PL1A 3KL4A 2XUIA 1JV2B 4UEOA 5IP7G 1BO6A 3G1WA 1MV5A 1NIPA 4F04A 4PU0A 5JSHA 1EFVA 2MDTA 3B3JA 5E9AA 4OLBA 2P6PA 2A0XA 1HOTA 3W2EA 3HVUA 3K9CA 5T14A 4KYTA 3OTHA 1FW8A 1GTVA 1YDWA 1DKRA 3BSSA 1U7PA 3Q6IA 1KAQA 3GY0A 4LZLA 3IBSA 3FYUB 4RFSA 3CE9A 1M34E 1DGQA 3ISJA 1IRIA 2EZUA 3OJOA 2OUKA 2DCMA 1TF7A 1XFAA 1N2OA 3GH1A 4WESB 2YWXA 4X7RA 1UJBA 2N1MA 4JL5A 3FHOA 1GTZA 2WF9A 2PQMA 5EIBD 3OH8A 1RZVA 2R68A 2IC5A 4I4NA 3K6SA 1EFCA 1WOMA 1I3QA 4LOLA 4ZT5A 5KNLA 2O7VA 2PUEA 2O3TA 1QZXA 3CH6A 3N2IA 2FPKA 3Q8WA 3AFHA 4RL4A 1GAWA 2XVZA 4X1YA 3H3FA 4EW6A 4UHEA 1ZRHA 4DBZA 1WCWA 4WK0B 4BQPA 5CH5A 1TCUA 5TX7A 3ENQA 3CLSC 1GA6A 5TS2A 4MP6A 5JJCA 1JHXA 3I2JA 4YMUA 4ZCLA 4A15A 2EP7A 1IBKH 1KEVA 3BTSA 3QLVC 4OKIA 3IQEA 4GGOA 3DOEA 3BCUA 2VYQA 4RTOA 4TT8A 4M0PA 4CV1A 2JL1A 4N6GA 1XCBA 3JVVA 2REOA 1LRKA 1P7VA 2VWHA 1L8OA 1M2OB 2QZSA 3QSYA 3O0TA 3H1PA 1EZ1A 1J7JA 3NUGA 1UFQA 5JXJA 4UW9A 1BKDR 2CCJA 2ASJA 2D06A 2XAUA 5FV7A 4H3VA 3X1ZA 2JZNA 2E3JA 4DSAA 3MWDA 2RDJA 1Q7RA 2W9BA 2HWWA 1EFKA 3JRWA 4NDNE 3PIRA 4X1KB 4E94A 4GHWA 1IN6A 3CSUA 4G97A 2FVXA 3Q9UA 3RBDA 2A9JA 3LG2A 3GLRA 1IWOA 4YRQA 1W5FA 2EQAA 4WHXA 4RY0A 4M7OA 2DQ4A 3BPSA 4QXQA 4D41A 4JIGA 4ARCA 4OP1A 1U28C 4JP2A 4A2PA 4OH1A 4NJMA 3FCAA 2IBTA 2WU8A 4IG4A 4ZICA 1MU0A 1M5RA 5JSQA 2RGGA 1A8UA 4MQFA 3OKCA 4U0KA 3ZWVA 2PANA 3FF4A 1UDWA 2XYRA 2YOHA 2X42A 1KJIA 3RHZA 4RA6B 4F8EA 1K4KA 3RWBA 4TM5A 1HNXH 1KKLA 3RIEA 3NKFA 1O08A 1NY6A 3ETHA 1LBIA 4C7VA 4ED8A 2I6XA 3B6IA 4NIMA 3K0SA 4E5KA 2IY9A 4LDQA 4J43A 5EUQB 2ZAMA 3F67A 3M70A 2J6SA 4NCBA 1D4ZA 5AXCA 1Z29A 3VUEA 4HNVA 1AGRA 2HRRA 4WOPA 4FBMA 1ND5A 3HUTA 3JU3A 3ZU4A 4RESA 1GRQA 2NTJA 3BACA 1AVTA 2PA0A 3TX6A 2PUHA 3CFYA 5HS4A 1ENZA 1KAEA 3HOWG 4ALNA 3F3YA 3C0FB 5C1BA 1YRHA 4CQJA 3JWEA 2B30A 4MK4A 1DOZA 3Q9LA 3CN7A 4R6XA 4QBGB 3L7IA 3VNBA 3NHWA 3MRXA 2W4MA 3I30X 1JG7A 4LWQA 2V1XA 2ZIAA 4B2LA 1UAYA 1IJKA 1JALA 1SHKA 4EZIA 4E1VA 1F2UA 2J6IA 4J1TC 1D07A 2ZB4A 6REQA 2DIKA 1PGPA 4MDEA 3SNKA 2IYQA 4RF4A 3ZHOA 2HCTA 3Q98A 2BAGA 2R2AA 3L8MA 1Z7GA 1ST2A 4LBZA 3DTGA 3B9PA 4NYEA 4OQXA 3PQFA 3TIIA 3UK7A 3KR1A 4U6NA 1XMJA 3W7VA 3TAXA 3RPEA 1KP3A 1TWCA 2D8AA 2UYYA 3OTWA 4NH0A 3FN4A 3LUCA 2V4UA 4LY0A 1U1CA 2ZI4A 2OO3A 1AHNA 3SQMA 1M0SA 2GEKA 2EHJA 4OBXA 1QVVA 4WPGA 1Q1BA 3T3DA 2XRFA 1TNDA 4ZOLF 1FJXA 3HOYG 1F9AA 3W9SA 3OBIA 3S2ZA 3Q5GA 3P19A 4BWVA 1EVEA 2C4HA 3D6HA 5CFOA 1EUCA 4V02A 1MRNA 1JFFB 5KX5A 1W4CA 4TGLA 1X7XA 1XB2A 3GWZA 1JSXA 2AKEA 4NYJR 5JIBA 2E4AA 1UXKA 3ZWWA 2PZGA 4TXNA 5I9SA 1WDWB 1ADCA 4LCBA 2XUZA 1IBRA 1Z6GA 3JR7A 4N3GA 3E5RA 3NCHA 5KQLA 4C30A 4MVWA 4DUGD 1C7FA 2FJUA 4TTIA 4F60A 4QYTA 3WGTA 5EJAA 3DO8A 5AVKA 2VK2A 3MRSA 4BFLA 1F0YA 4M4SA 3RSZA 1VDZA 1A5TA 2Q0XA 4QPNA 5CUQA 3UK2A 4GPIB 4KRYA 1G20A 5C3UA 4AMYA 4YP9A 4POOA 3WLSA 2GX6A 2V7WA 3COPA 2E37A 3E1SA 3VNUA 1DZ3A 2ZJYA 1UKEA 4TMYA 2X5NA 4UMFA 1KFEB 1BKYA 3QOWA 4RGQA 2H5JA 1OJ7A 1LK5A 2ZYGA 4HAXA 1FUKA 1KEKA 3RB8A 4DMKA 2XQIA 3IEIA 3VAYA 3JTEA 3F7TA 4HL6A 4ZOQI 1Z88A 5HTKA 3HWX1 4J49A 4XYMB 2O54A 3A1DA 4PZLA 3Q10A 3QELA 3TF5A 4I4TB 2X4LA 1XRRA 5AHXA 2H1WA 1CK4A 2FW8A 1RYBA 5JS8A 4HYTA 4R1MA 3W0LB 1NI4B 3ASZA 1W48A 1JJBA 1S2MA 5LBTA 4JLOA 1R8JA 3PCTA 3UGKA 2Q0SA 1V5GA 3LUJA 5PGMA 1T2CA 1NMYA 5AW1A 5I4BA 2AHOA 3T4XA 1GLGA 3PF8A 2B1GA 2C95A 2AFVA 1T8YA 4FUTA 2R11A 4F7DA 4CMCA 4FFOA 3HZOA 3I5MA 5CP8A 1CHNA 2FFHA 5KYUA 2AR9A 1SBIA 2E4ZA 4L0DA 5KFDA 1QHGA 1C1DA 4QFCA 5GJVC 3VPFA 4GWLA 2JEGA 2YRWA 1ZL2A 3ENZA 1NE7A 2HRQA 5L9XA 2NO9A 2YFQA 2I7XA 2DWOA 3B9QA 1HG1A 1ZJ4A 4IUCS 1H9AA 3UXHA 2F48A 4MTDA 4FFBB 3OKAA 3ZZMA 2YFHA 5ESDA 2HWUA 5FJIA 3WJ2A 1VJRA 1TE2A 4XM2A 3MCWA 3ELDA 3UC5A 4C7OB 3OZ7A 1YI1A 3K3PA 3TRFA 1USUA 4ZC8A 5HE9A 1P44A 2X8AA 5FUMA 4CIWA 1F6WA 3LHSA 1YH3A 1CYEA 3ZDCA 4L4SA 4YQZA 3ZDFA 5KS2A 1RBMA 5DLQC 5A7HA 5AT1A 3OJFA 2PG3A 1VCMA 1E5TA 2OTCA 2X8JB 2XOKD 1N36H 1AQIA 2UXDB 1GT91 1Z36A 1WDTA 2C98A 1ZVVA 3ZU3A 1PR6A 4FUQA 3C7TA 4DT1A 2VZEA 1J8MF 2EJVA 2H7XA 2B6NA 2I7VA 2VPIA 1UQUA 3PV0A 3WZLA 4Z0NA 1KP2A 1L4FA 5HYVA 1TKAA 2C5SA 4I9HA 1RQ2A 5DG8A 4QHYA 4JC4A 4I55B 3NG1A 4K9RA 1Y8RA 4O7VA 4JQSA 1M5TA 3HN7A 1ZJ6A 2A9QA 1WSBA 2A9RA 3U62A 3DUFB 4LXIA 1ITZA 4EKEA 4E5PA 1ODSA 5BRNA 1O6CA 4WGGA 4E08A 5IMSA 5DOZA 3UMRA 3W1EA 3IFSA 1Z39A 3FLEA 3EHEA 2LVBA 3AY6A 3NOVA 3FLAA 4ZEWA 4H0CA 5IANA 2CLLB 3KETA 4URFA 2LKDA 4PTZA 4AZ3A 1EBFA 1MOSA 5LQMA 2WSSA 3HA3A 3W6PA 3NV7A 3VTZA 1YZQA 3QVSA 1N34H 4GXQA 4PX5A 4C5BA 1T0UA 4XIIA 3Q3HA 2VSYA 3QSGA 2VDLB 1VL1A 1YJQA 5I9TA 3AR6A 4MVJH 2RB4A 5EZ6B 3H16A 4GPEA 3E9YA 4JUCA 1TW3A 3FFAA 1WABA 3SR4A 3L01A 3O3CA 3N2GA 3T1YB 1NTOA 3MUFA 4P5EA 1QB7A 2HCJB 4IO1A 3LQ1A 1I4OA 4L5IA 4BC0A 1G3RA 2R7KA 4L2IA 4ZOCA 1U2QA 5E6SB 3F3SA 1GPWB 2Z9CA 1OD6A 1X80A 1SXHA 3A2KA 3M3HA 1C7EA 4KI7A 2ZYRA 4FYJA 3S2EA 4IOKA 5BYKA 2R25B 4K9PA 3I6YA 4XCVA 2W00A 3HXPA 3OLXA 2MSEB 5MFZA 1TIPA 3PFIA 4ETWA 3L2PA 2HWKA 3Q8XB 2CV1A 2H1CA 1EWVA 1L4BA 1TJNA 2BSAA 2A3RA 4WNIA 3V7FA 2WWIA 2O2EA 4DV5B 4I7EA 3WJ1A 1TVMA 1XYGA 1QGOA 2FZLA 4F38A 1E2GA 1RCTE 2Y8EA 3AYXB 4F2HA 5K05A 2JG3A 1CJUC 4B8WA 5CXQA 5ETJA 4LGMA 2AEMA 1PW5A 2GBCA 2OO7A 4GL2A 2JBWA 1NV8A 2VPZA 1YO6A 3O92A 3PL1A 2CXHA 3DLTA 5DMHA 1CY2A 1QPZA 4NSNA 4DA9A 1DXYA 5CDTA 4FFPA 4C05A 4E13A 4W5TA 2JCGA 2R8KA 4J9SA 5IF3A 2CL7X 2VQDA 5T7BA 4O0LA 4XD7D 3KZVA 1NQVA 4N48A 1V1MA 2GCPA 3L6EA 1YVPA 3MRTA 3OCWA 3RCBA 1EFLA 5KVCA 2V65A 2Q0HA 4LJKA 3K73O 2HDKA 5L6LB 3UV3A 5KFVA 1JHAA 2LNDA 4CM6A 1OLSA 4P33A 5GJWC 5EJ6A 2Q29A 3L0YA 5EXSA 3RJMA 2ZI5A 4DDMA 3WAKA 5CLLA 4EVSA 1GV1A 4L1KA 1VMAA 4RW0A 3R5HA 1DIRA 5HCNA 3OMXA 1XTTA 2Q3DA 1H0SA 4L07A 5JD6A 1L7NA 2DETA 3EFHA 3WBJA 4KRGA 1CS4C 3FPEA 3PCXA 4PCAA 2P4UA 1R0KA 3RQSA 5L3QA 5AI5A 4CM7A 1A0OA 4OJNA 1QCZA 4ND3A 4FBUA 3K94A 3HMKA 3IGFA 1D1QA 3W1BA 3IRUA 2HQSA 5E4FA 2JA1A 1DDIA 1TJYA 4IVPA 4I5IA 2JJMA 1BEZA 4ZAYA 4EK9A 2I3ZA 3PRKE 1SNYA 1VHJA 4YMWA 2YXBA 4OQEA 3EBOA 1B14A 3LYLA 5JAQA 5E4TA 2OQVA 5AK5A 1E5XA 5ADWA 2ZBGA 5IWCA 3OIWA 3SPXA 2FJZA 2QRJA 2V6FA 2OECA 1BFDA 1TUEA 2WSBA 5J4LA 2WUVA 3STTA 1OZAA 2V6IA 3TMAA 2IHZA 2E82A 3A4YA 1W36B 3FAZA 1ECFA 3NT4A 1U98A 4MGHA 5IMBA 3R9RA 4YJ3B 3AEXA 2P30A 4G8JA 1PFQA 4C7XA 3Q5EA 4UE2A 4J1NA 4YRJA 1RYYA 3IDQA 4H1WA 2VBGA 5DW3A 3R23A 3KPYA 4U6PA 2WE7A 4HO1X 1EGHA 4F3TA 3KJIA 1G9XA 3AWIA 4K6KA 1IPHA 1UBHS 4URWR 3M49A 1V8PA 4KQJA 2GWHA 4MPRA 2C03A 4US2R 4U2BA 3IKTA 1IHXA 4DV1B 3U3XA 3H2GA 4NBKA 1U0RA 2YNMA 1MVOA 1AKTA 3S99A 4JWKA 4LSXA 1AZTA 2I6SA 1RRGA 1PZEA 5HJ5A 5D6NA 2WT4A 4CKZA 2ZM6H 3R6TA 5GWXA 1X3SA 4WFIA 5LQCA 5KNCD 3BWMA 1O5IA 2HIGA 3T5JA 5JCJA 1NUQA 5E2BA 3V8MA 1D09A 4ZYYA 5CT5A 5AVJA 2W2PA 3H4IA 5LZ5A 3E2PA 4MWGA 4JT4A 4IRCA 4MRMA 4G5RA 3KZKA 5M29A 2LBPA 1RMYA 2NTEA 1KERA 2C8KA 2XMQA 3ZWNA 3BSWA 2V7QA 4J91A 2B2XA 1H6AA 2ARKA 4FYHA 2R0QC 1DIAA 2BGGA 3TTTA 221PA 3D9QX 5D84A 5ALDA 1UPTA 4HNSA 5HE8A 2ZGVA 2X13A 1JQAA 1I2BA 3QI2A 3DLAA 4O5OA 1P9LA 8AT1A 5FYQA 1BXRB 3JQBA 3R09A 2W22A 5CMLA 1V3UA 4CL2A 4TV9A 1IUNA 2HX1A 3MXOA 2VDKB 1RI1A 2ZTVA 4ISBA 4TSFA 5KPJA 5TB5A 1YJAA 3CA8A 3ILXA 2IPXA 1WXEA 4PVDA 1OT5A 4GMXA 1HQDA 3JVDA 2G06A 3PEUA 4KUHA 3AVQA 1TWGA 1R6DA 1WXGA 3TEJA 1QAOA 3FUTA 2R87A 1XCJA 3N0XA 4WLOA 1I1KA 1I0IA 1BVUA 2XGGA 2J5QA 5LKRA 1F4PA 2YZ7A 2Z2XA 4EZBA 5KG2A 2ID7A 2B92A 2ZVPX 1UK8A 4FR2A 5LXTA 2CJWB 3KHSA 3F1LA 2IZ5A 2B8JA 2JIOA 3NC4A 4DF3A 2DY1A 3AIKA 1AQUA 1LDEA 1WSCA 4DQUA 2AEEA 4A6XA 5KSYA 2CLSA 4QXMA 3IG0A 4CV3A 3G0HA 1TUBB 2L82A 2KJQA 1ZK3A 3RREA 1XK5A 2OV3A 1CFZA 1GZ3A 1XPUA 1ICEA 2D0IA 3DWIA 2VVTA 3NP7A 2ZVJA 4A10A 3CLUD 2A5DA 3E23A 2Q3FA 3N0VA 4C4SA 1FDOA 2CN1A 1ZBQA 1P91A 4K8OA 2UVRA 3IUSA 3NHBA 1RMTA 3WL8A 1KDTA 4ZXPA 4JI7B 4LC1A 2CLHB 1GG9A 3Q3JB 3U5ZB 1CZNA 3ORHA 1ZHSA 2DU8A 3QEMB 3QJ5A 3HBLA 5CA0F 5LYJB 4ZI7B 4WMLA 3JYLA 4WK2B 4HTFB 2UYQA 1XZIA 4FQ8A 4C43A 4NAUA 4JITA 4V0SA 2QTWB 4NVRA 3S24A 4PNZA 3HNPA 4XE5A 3TSZA 2NVUA 2VAWA 3W5BA 5GOZA 1ISSA 1EFAA 3VPBA 5KSPA 2C54A 1VGVA 3WIUA 4GLWA 3UHJA 1E79D 1V1JA 1YDFA 2UZ1A 1J09A 3VR4A 1GGJA 1JG2A 5DSTA 3M81A 1JHQA 4FDLA 2OUIA 1NASA 4M9UA 4IWXA 4LDAA 2JIPA 2OZKA 3H0GG 2HI0A 3S8EA 1J0DA 1W4BA 3WKBA 5KB3A 3T94A 4OFZA 2JLSA 2BEWB 4G1UC 1MA0A 2AFHA 2PLFA 4GI3A 3ZI0A 1J22A 4OL0A 3F6PA 1YZLA 1Z38A 4QATA 1OH8A 3CKMA 4NXNH 3MTIA 5DYIA 3PEWA 4L0MA 3H75A 4JP1A 4BZPA 1TM4E 4KO4S 1YAJA 1A7AA 3R8XA 5F1OA 5H4HA 5K6AA 4J90A 4LE1A 3X1MA 3B70A 3USCS 4WNCA 4NESA 4EHNA 3IXQA 3BXEA 1ZIOA 5U1PA 3Q7QA 1GGFA 3O2JA 4PQFA 3L82B 2Y77A 4GOOD 4HV4A 5I60A 4BP9A 1OKKA 4KTTE 5JAZA 4IVRA 4Z7OB 4RPIA 2C2XA 2D1FA 4TS4A 4F4DA 3UKOA 1XNJA 2V4ZA 2DPMA 1B33N 5A0TA 1FLVA 4YBZA 2Q5CA 4E2ZA 1XVVA 5KTNA 1OBVA 2MSCB 3KWJA 1IBMB 3WIBA 3KR0A 4DSOA 3RS2A 2I67A 4DTIA 1VXOA 5FWAA 1AS2A 2R8YA 3T4UA 3A58B 3VSAA 1GXSB 4GGPA 4R01A 2GF9A 3NASA 1TTHA 2DTDA 1YZKA 1XAHA 2C78A 2W8BA 1I32A 1WKVA 3QOYA 1WPQA 1AN7A 4JCOA 3AHDA 3S0JA 2VQ6A 1Y1RA 3SXJA 1B0ZA 1ZMTA 3CVYA 1EWRA 3SF8A 1F17A 2PLNA 4ZVVA 3KXIA 4ZT2A 1RWNA 4XARA 4TSKA 5HOEA 1A2OA 1LPPA 4BYMA 1Z2NX 4TL9A 5PNTA 4FHGA 3S5UA 3FHJA 1XNQB 1CULC 3B3QA 4ZVLA 1JW9B 2QMOA 4M36A 2A9OA 4ILKA 1LW7A 3MIZA 4F5YA 5CFRA 2R00A 1NULA 2H3EA 2GQ0A 5BVGB 4HG2A 3A6LA 3DMHA 5ARDA 3E7WA 1L1RA 3BF7A 1DAOA 5ALVA 3RASA 4QYMA 5AM2A 4R3NA 3T7DA 1DNPA 2IEZA 4N0QA 4NXMB 4FU0A 4HDRA 3P0RA 4EFLA 1OFUA 5JS6A 5EWFA 3JYHA 4X3CA 5GONF 1HYHA 4C4AA 3U49A 1MQ8B 1GEEA 2YYZA 1RMQA 3AIIA 4BLSA 4EKYA 2Z9DA 2FR1A 4BL5A 2NO7A 4UTZA 5C7IO 3N41B 1OZ0A 4JJKA 4HMOA 5HK8A 3EULA 2DRIA 3DVRX 1KDZA 1NQOA 4HWRA 2YINC 1RYDA 4B7UA 4X8HA 5EXEA 4UREA 3OFJA 4H4CA 2GHTA 3FNHA 1HMPA 2G70A 2J3JA 1HT2E 1JIIA 4IDBA 4NU6A 5C8YA 2W6MA 4OAOA 5F7ZA 4ZO4A 1DKMA 4GI1A 4UPVA 3RRMA 4L3WA 3GROA 5B1SA 1DQYA 4KHPH 1Q74A 4YDSA 1G20E 3R7SA 1AS3A 4J2TA 3S2FA 2FEXA 3B6EA 1FUIA 4O7RA 2W0MA 4YUYA 1X14A 3FPGA 1HUQA 1RT9A 1RQGA 1UBJS 3GUZA 1QPGA 1J70A 5B2FA 1HURA 4G67A 3PNLA 3DONA 4BQSA 3DDUA 3JPYA 3DAYA 3GXBA 1ZXXA 3TJZA 3ZIAD 4FYMA 1I2MA 2Z5FA 4DLUA 1AB5A 3ERCA 4XB6B 4RCZA 4MTEA 4WN9B 1FDIA 4ARZA 1HI9A 4IF6A 1Q83A 5EZSA 3GYBA 5EUMA 4JI2H 3RF7A 3D4PA 1HM5A 4WDRA 1JHRA 1AF7A 2Y0SA 3E18A 2ZS7A 3H4VA 1XJ0A 1KI7A 4RZHA 1H5QA 1F0PA 2IDMA 1RPJA 1Z35A 1Y4AE 3KFVA 4Y6OA 5LR6A 5KFCA 2IH4A 2FOXA 4BP1A 3BVPA 5LC1A 3KKKA 1SO8A 1GZUA 4GBMA 4DZRA 1YQ9A 2IOHA 1JLLA 3HOXG 1E1RD 1FX0B 3F7OA 2HGSA 4GNRA 1SKYB 2YZNA 3F2VA 2OMEA 1XQ1A 4W6QA 4IH9A 4JEUA 4AULA 1TA8A 1B42A 5CX1A 3QXSA 3Q3IA 4OUKX 4M0CA 4E6EA 4JVMA 3KPWA 2BTQA 4HNHA 3AU9A 2Z43A 3RRYA 1SK8A 1XTPA 4UD2A 4JBXA 4WBNA 3L8FA 1N0UA 2XA2A 3IP1A 1VHDA 2C9MA 1W5BA 1E0SA 1CUGA 2I2DA 4W1PA 1J1ZA 3W5UA 5EAIA 3N43B 4H16A 4IIJB 1NI3A 3QYPA 1NMSA 3BQNB 1VKNA 3S6JA 3UZBA 4R9SA 4YN3A 5IYDG 3LNTA 3AXTA 4J7CA 2IYZA 4U7GA 2CQYA 4KZKA 2NUTB 1INLA 5DGDA 3AY0A 2IPNA 5D3MB 4MS3A 5B55A 4EW2A 4O86A 3K6KA 1AG9A 5E1MA 2R6FA 2WUGA 2HK8A 1YUNA 2AGQA 5E9JA 1S8NA 1Y1KE 1WRBA 1JWBB 3A10A 3PNPA 1CPYA 2MTBA 1IBLH 1DV1A 3QKUA 3KQSA 2X15A 3E5MA 1AOXA 3WGJA 5B4VA 1U8XX 4CU2A 3GA7A 3ZH2A 4D9NA 3M1YA 4WXHA 421PA 5MDHA 1LSJA 2YRXA 3I9MA 1CP3A 1L7EA 5KT7A 2J59A 2L42A 5EJ9A 3UGJA 5F5NA 2QRZA 4G1VA 2IU3A 3U5TA 3PNKA 1TC2A 1ADFA 3IDZA 1GNRA 1YUBA 4F2PA 4P84A 5FPPA 4X8LA 2AH5A 1JR3D 1HQCA 2MYTA 1OI3A 4LOIA 3UKJA 3U40A 1EDOA 2BFDA 3H3JA 1AY0A 1G5IA 2ZDHA 4RELA 1FU7A 3QFFA 1CY6A 1X8XA 1Y1LA 1K5PA 1AGPA 2FMIA 1ZN8A 2A0FA 4JH0A 3ZHCA 3C39A 1V3VA 3L02A 1HX7A 4UFZA 3ZQ4A 2GRUA 4M3NA 1VGQA 2XZPA 2O4UX 2EV9A 2JGDB 4I9UA 3EJ6A 4K6OA 2FWAA 2GFHA 4B3HA 5HZKA 3DZDA 2Q99A 1KI8A 4MAAA 4UEQA 4RIFA 1NQAO 1C3OA 3U7JA 3TBKA 4LYAA 2GFQA 2H0RA 1QDUA 1T0BA 4G25A 1EYZA 3F6RA 2CMGA 4BO4A 4TVIA 1VLLA 2YIVX 1E2EA 3MD0A 1D9XA 1ZW1A 3KPVA 2E87A 3HCPA 4RPKA 3L5KA 3VDMA 1UJCA 4EYQA 2YHUA 1WW3A 5BWUA 4JBGA 2HGZA 3GPLA 3NANA 4Y98A 4E5YA 1T1GA 4AJOA 1US8B 5K3SA 2WT8A 1LQTA 1NR5A 5I7VA 3GGCA 4KI0A 2H4YA 4O4LF 1DT5A 3KTAA 3MRVA 2FN9A 2HU5A 2VR1A 1K6EA 1SPXA 1CKNA 1DRKA 1RAHA 3H1AA 3Q5DA 4YPVA 1YI8A 3AR9A 5IJXA 5K0ZA 1Z6XA 2XQJA 4BJ6A 1S5PA 4MO2A 2X5RA 1RXSA 4QBFA 1KH3A 3RYCA 4WOBA 1MJNA 1P7PA 4EUEA 2AMJA 4RXMA 4MPPA 1T3NA 4TOIA 5E38A 2IV7A 1ZXBA 3JZAA 4MR8B 1JEQB 5C1DA 4JUFA 2C9CA 5A71A 4OXIA 3QITA 2XVAA 4LSGA 4ZO7A 1UIMA 3A7DA 3SQOA 4UTVA 4Q4JA 1QC5A 2X9GA 5E1OA 2GM4A 2VEOA 3KELA 5K5EA 2W2TA 3NTQA 1TGVA 2KQUA 3RNLA 1AO0A 2DAPA 2TSYB 3IP3A 1I13A 1PL8A 3ANSA 4NDZA 3ROFA 1JU9A 4YAJA 4CGZA 2B21A 4NMXB 3TLJA 4OHBA 2H0AA 3L4BA 5TPWA 4LMYA 3A14A 1U7HA 1RP1A 1EM8B 5EYPA 3DKPA 5KKNB 2E48A 4B84A 1W52X 1NW7A 4UAUA 3GJ7A 2GAIA 1CUXA 3KQKA 1HOXA 3ZDAA 4ZI5A 3R74A 5JC8A 4PZZA 3PLAE 3RSLA 4A3FG 1IXZA 3TINA 1K7CA 5J4HA 3BCSA 3GTMA 4C4TA 2HA6A 4YAFA 1K5DA 1GQ2A 4BIIA 2VT2A 5CYGA 4LFBH 1PVVA 2P91A 4DAEA 1S4MA 1ML3A 1TL7C 1Z2CA 4NK5A 4QX6A 4ZXFA 1LF5A 3UPTA 1WQ3A 3S70A 1RLIA 5MF6A 3EYWA 3AB3A 4CR8A 3OLQA 5E0KB 1NJ5A 3SIXA 4KXNA 1KZ4A 1H1TA 2BRUA 4FS2A 3WOHA 1J2YA 2FK1A 4ARUA 2ZR7A 2Z5GA 2EP5A 1EBBA 3DLBA 5JJLA 3P9NA 3WYDA 2CKZB 4MQBA 2GN6A 1ZN7A 3OFNA 1L8QA 3SBEA 4LVCA 4RZ2A 1RU3A 4PIPA 1G19A 2IUTA 3QH4A 7AT1A 4KWEA 4WADA 4RF3A 4YP6A 3AF3A 5F35A 2EJ3A 3A28A 2XUDA 2ZTUA 5ADUS 2R5FA 4MLPA 1JG6A 3TYXA 2E18A 5K20A 4RQAA 3HYSA 2QD2A 4Y9DA 1CS0B 5CA1F 2QWXA 2WILA 1O0BA 3Q9NA 1IM5A 2B9VA 3HR8A 4TL7A 2PQ6A 1GADO 1URPA 4YREA 1ZIDA 2ZSFA 4QFBA 2IDZA 3AEYA 4Y2XA 5AVQA 1P1JA 3I3SR 2NX2A 4D8YA 4MIKA 4N03A 4IMIB 3ZJYA 3RE1A 4ILEA 2X2FA 5DBIA 1Z73A 4BQEA 1K6XA 5I7FA 5FP0A 1AQJA 4MRPA 1E7WA 2FGKA 3FM9A 2O8BA 2RHTA 2J0UA 2Q07A 3C6MA 2VXYA 2BZ0A 2YYYA 4X6YA 3GRUA 2JEJA 1UXJA 3W9YA 3STHA 4I50B 5E7MA 5C18A 1WSAA 1NLZA 1POXA 1O57A 1PJ4A 3LQQA 3KKMA 1Z0KA 3STYA 4G0MA 4KR3A 2VATA 1EUQA 2ANCA 2Q9UA 3KJNA 3RVRA 1UFRA 3GIPA 3UPDA 1VJ1A 2J8ZA 4M1OA 4RF5A 2ZZNA 1EB8A 1E2LA 3AF1A 3HU3A 4PFJA 3KKQA 2ZIWB 4Z3DA 4DY4A 4NICA 3REFA 3FMGA 1N1MA 4V0RA 1KO5A 2CL5A 5EE3A 5KNCH 1LPOA 3O2QB 1UWLA 4XJXA 5AJHA 1Y9EA 1ULTA 2ID9A 2QSJA 4U63A 3L05A 3PGVA 4ISCA 4OJTA 4FYPA 1YQTA 3CNNA 4RKQA 4QARA 4BMVA 1S3GA 2HVQA 4HATA 3V4OA 4CQLA 4XCXA 4KXUA 3ZV4A 4RNOA 3DAPA 4KKVA 4PIVA 1IOZA 3I92A 1RJWA 4U02A 4Z9AA 3ZZUA 2FYTA 5EDWA 5HX7A 2ZB7A 1ORHA 2QTNA 1QO0A 5SY4A 3W8DA 1IRXA 1SVWA 3FKIA 2OBLA 4FB4A 1O0SA 3DMPA 4FFVA 3OU6A 3QZUA 2GB4A 3DE0X 3ETNA 1JAIA 1KETA 5I6DA 1KF0A 1QONA 5JWRA 3TOXA 3P0FA 3P9YA 2F64A 3U3JA 1VCOA 4BQIA 4II3A 1KA9H 3P71T 1OUMA 2IDKA 2ZIFA 4RCNA 4U3JA 3PHCA 2C94A 4FE4A 1NONA 1XZFA 1RLOA 2FDCA 4CM1A 1ESZA 1MMFB 2G88A 4GKKH 4WE3A 5CDUA 4D82A 3OFSA 2GPWA 3A4IA 3ZHQA 3CKYA 1XX6A 2JFYA 3E3NA 2QYT