5K2MA

Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
273
Chain Sequence
MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysine Biosynthesis of Thermococcus kodakarensis with the Capacity to Function as an Ornithine Biosynthetic System.
pubmed doi rcsb
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Biosynthetic protein
molecule keywords RimK-related lysine biosynthesis protein
total genus 88
structure length 273
sequence length 273
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 5k2mA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5k2mA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k2mA01
1CQIB 4I50F 3VA7A 3MJFA 2R7KA 5BPFA 3ORRA 2NU8B 2NU9B 2W6PA 4YJ2F 3TQTA 4DIMA 2W6OA 4EGJA 4O4IF 2GPWA 3HB9A 4HNUA 3AX6A 1JKJB 1B6RA 2IP4A 1SCUB 3RUPA 1PK8A 2FPGB 2NPOA 2QF7A 4HNTA 2XCLA 3LWBA 3TW6A 1I7LA 2Z04A 4L1KA 4ZOLF 4GGMX 3K5IA 1VBHA 1C30A 4TUYF 5J2TF 3RFCA 3WNZA 3U9SA 4XX0B 1VKZA 5K2MA 1GSOA 1KC7A 4J6EA 1VBGA 2CQYA 2VR1A 5D8DA 3JRXA 2R7MA 3RV4A 4C5CA 2YZMA 2V59A 4YAKB 1T36A 3JZIA 4WD3A 4EA8A 1CE8A 1B6SA 1GSHA 5JVLA 4MV7A 4HR7A 3GLKA 4C5BA 3R5FA 1CS0A 4Y8VB 5HV6A 1E4EA 2FPPB 5EZYF 2I87A 3U9TA 5C1OA 1EUDB 4MA0A 5CB4F 5LOVF 1KJJA 4M98A 4MA5A 3TINA 2J9GA 2PBZA 4MV9A 5JVDF 3VPBA 2W6NA 2W71A 2R7NA 1EUCB 2DLNA 3I12A 4TV9F 4EA9A 3V4SA 1WR2A 4I55F 4MV1A 2YS6A 2I8CA 3MWEA 5KKNB 1UC8A 1JDEA 5C1PA 3BSYA 2R6FA 5C8YF 4I4TF 1DV1A 3E5NA 4IWXA 4IWYA 5CAEB 1BXRA 1PX2A 4YJ3F 2R82A 3R5XA 3V4ZA 4M9CA 1IOVA 3VPDA 4M99A 4C5AA 4O2AF 1JDBB 2R85A 5LA6F 2FB9A 1C3OA 4O4LF 2DZDA 2C00A 2GLTA 1UC9A 2R86A 3HO8A 1EHIA 2NUAB 1ULZA 2DWCA 5LXTF 1AUVA 2P0AA 5LYJF 1W96A 2I80A 3TIIA 5J2UF 1M6VA 3BG5A 4MAMA 3Q2OA 1GGOA 2VQDA 1DV2A 3RV3A 3JZFA 2OLSA 4QSHA 2NU6B 3OUZA 2YS7A 4ZHQF 4YBZB 4DLKA 5LP6F 4ME6A 5BMVF 2ZDGA 4MV3A 3BSSA 3AW8A 4EABA 2PN1A 2R87A 2X0SA 5JH7F 1GSAA 2ZDQA 3R5HA 1BNCA 4MV8A 3WO1A 4EG0A 2CZGA 5JQWA 2YRWA 3Q1KA 4RZQA 4MV6A 2R84A 2NU7B 2QK4A 2YW2A 2HJWA 3ETHA 3LP8A 1KJ8A 2FP4B 4ZI7F 4HQ6A 4O2BF 2ZDHA 4FU0A 3BFPA 5CA0F 1JLLB 1AUXA 2FPIB 4MV4A 3G8CA 3VPCA 2GPSA 4HNVA 2VHEA 4O4HF 3BSWA 3VOTA 4XYMB 4XZ3B 4XYLB 2W6MA 1IOWA 3UFXB 1KBLA 2V58A 2YL2A 2YRXA 3GIDA 4E4TA 4EAAA 1GLVA 3K3PA 2YYAA 3VMMA 2SCUB 2W6QA 3OUUA 5IYZF 2YZNA 2V5AA 1KJ9A 3MWDA 1KJQA 5H80A 3ORQA 4WBNF 2W6ZA 1E4EB 5GONF 1DIKA 3WO0A 1CQJB 5I47A 3G8DA 1W93A 3JRWA 5CA1F 3K5HA 4YAJB 4IZOA 2W70A 4ZQIA 4EGQA 3TIGA 5BPHA 1KEEA 4M9UA 4EA7A 4TV8F 2XD4A 2YZGA 1A9XA 1KJIA 2R7LA 2VPQA 3ETJA 1EYZA 3QFFA 5HBRB 1EZ1A 5DMXA 3HBLA 3SE7A 2PVPA 5KX5F 2DIKA 3N8DA 3R23A 4IHJF 4YB8B 3N6RA 1I7NA
chains in the Genus database with same CATH superfamily
3OQPA 3IPXA 5DPMA 5G1OA 4AY4A 1O5TA 3J81k 4MYDA 1EX1A 2P9ZA 3VYRB 1C8VB 1GZDA 2A9PA 4G0NA 1G20B 3BFKA 5JROA 4CLDA 1ZU5A 4HEA6 4ZVTA 4I14A 1KIMA 1XMPA 3KHRA 4EBDA 1OAAA 4J16C 4YQFA 1U3UA 1Z8DA 2V7PA 3FNFA 3UXHA 2Q6TA 2MYPA 1G41A 1Q0LA 3H87A 2Y1WA 3U9SA 1G18A 4OLFA 1N5KA 4YNBA 2P27A 4HCJA 3ZV6A 4ZZ1A 4M55A 3Q7RA 1GAXA 4XYMA 1Y7PA 1MT3A 2ZB3A 1P80A 4OGKA 1DEXA 1P5JA 2E4YA 3IDSA 5C7YA 1ORWA 2NMVA 5FH9A 1W5BA 2PFKA 2Q2UA 2ZXUA 2VDWA 3NJ8A 3PU6A 4ARAA 5C7OO 5KFWA 1VXOA 5CAEA 1LVGA 3ZY4A 1Q0SA 1E1QD 4TL9A 2PU5A 3DOOA 3RGXA 1F0KA 1VC2A 4U2FA 2REOA 4YO8A 1KYIA 4E14A 2BMDA 5I5VA 1Z0SA 1QHEA 4MW4A 5CYOA 2IUFA 3V4SA 3Q8WA 2O5EA 4DJJA 3DBOB 4P4SB 4WSOA 1MH1A 4B6FA 4AG6A 4LNUA 5C8ZA 3A32A 5AJTA 2DBVO 3CXUA 4Z4GA 2BGGA 1LX7A 3K8ZA 3PNLA 4Z4CA 3OFNA 4CE6A 1M2OB 3RJZA 5HZGA 1VE1A 3DMTA 3UPTA 1YUBA 2G25A 1YK0A 4YRRA 4KO8A 4YCCA 5K01A 3CF4A 3O4VA 2DABA 3OCUA 4FHDA 4OM8A 1XZBA 4PNEA 4DR7B 4D0RA 3QWFA 4PANA 4UVDA 5AYVA 2XRFA 1DEKA 3AM4A 2Y92A 3AUAA 3FXAA 3MG9A 3WJAA 1L6IA 1XRMA 2BKVA 4G4IA 4DL3A 1XF1A 5I9BA 2ECKA 3C41J 3HP1A 3M0EA 1Z5ZA 4GMGA 3G7NA 3VYVA 4YAFA 4W6QA 4PX5A 3E48A 3ZKWB 4DUGD 2V7QD 3D6UA 4OYRA 2E4ZA 2ZRGA 4PYLA 4R6WA 2HGZA 1FP2A 2HTFA 3GFVA 3FTCA 5A3JA 4QG3A 3V1NA 2XXAA 2RSLA 1M8JA 4JYBA 4FFBA 1SQ5A 1N36H 3VNVA 3VSDA 1IQUA 2ZJ3A 2W2MA 3RC1A 4W5OA 1JPNA 8LDHA 3ESDA 1LBEA 2X8WA 3R3HA 1A9RA 5G41A 3V42A 1WY5A 2HA2A 4B5LA 3HZZA 4UE3S 5K8CA 2OAP1 3TDKA 3ETGA 5H02A 5FWYA 2PS0A 3HU1A 4RUAA 3ZDEA 1P8LA 3DMPA 3GXBA 1PBNA 4FI3C 4J76A 3M9OB 3EPIA 3QVWA 2X8AA 1ZMXA 3SIRA 4YXWD 1IDN1 4ZDJA 4CCYA 4Y2XA 3OBIA 4RCNA 1C7QA 5LXTA 4PVDA 5AHOA 1ZX1A 3FVQA 4P3PA 3Q8SB 4HH4A 1LPAB 4X93A 3EGOA 3K2IA 3KJZA 4YASA 5B1EA 1CUIA 1PJSA 4KO1S 1YVPA 2D0OB 1CUGA 2AF3C 3CWZA 1TIBA 4PWZA 1ZK4A 1OZGA 5L3SB 3ENVA 1RWKA 3MR6A 1LTHR 4YO7A 4DSNA 1N7HA 4BVFA 3CS3A 4IFTA 5LB2A 5B7QA 1OYVA 4JI4H 1IMOA 3LUHA 1OI4A 2IWHA 4MDEA 4DW8A 5BOSB 1NRIA 2VDKB 1GTZA 2RHRA 1UFVA 4RM3A 5K3AA 2ZSIA 3UJ7A 3QNWA 1WXWA 1KI1A 4K0RA 3UK7A 2J3KA 3FYSA 4HEHA 3FBTA 4J6FA 4BJHB 1KAGA 4OXNA 3DZFA 1K7XB 2QUAA 3TQOA 4D98A 1IUOA 3DD1A 3NS7A 4ND7A 5FUXA 3UWOA 4IX1A 2XPCA 4BX9A 1V9SA 3K5WA 1A88A 1Z4IA 3SOPA 1HORA 1GCOA 2FPGB 1ZD5A 1RPNA 3K4PA 2E5LH 3K6RA 3GLFA 3WGMA 2L82A 1MQ8B 1BQ4A 4UCTA 3HDTA 621PA 3VJLA 2HCFA 2Y76A 3JPWA 1YF3A 2CUKA 4X97A 3H84A 3T7TA 1R6BX 5LC1A 4JI8H 2GHQA 3L0CA 3L49A 1U0BB 4DV2B 3PWKA 1OE0A 1R6UA 2MSKA 2VTEA 4FUQA 2ZIEA 4ZCTA 2A1UA 1V8BA 3FTNA 2IHBA 4GZLA 4ZCQA 2WUWE 4MQEB 4NCHA 3TRFA 1HRKA 2DYKA 3EXEB 4J0CA 2H1VA 3T15A 3TE7A 2YTZA 3E8XA 4IIBA 2RG7A 4F3NA 3V7NA 1L8XA 3I3SR 3MCVA 2R7NA 1H1DA 3DAYA 2LCQA 3T54A 3SC2B 3NBMA 2JEZA 4CMHA 5JG7A 4ZOAA 1OWMA 2C20A 2P2CA 2CLFB 1XALA 3QQ5A 5IBCA 2FWPA 1HDOA 1XMQB 2Z57A 3ZDCA 1QGUB 3E6AA 3KB8A 2G70A 3DC7A 3WLAA 1HKHA 4ZAGA 1FRNA 2Y6UA 4YVFA 1G60A 1DQZA 1J1UA 2PSHA 1JA0A 1UP4A 2SHKA 3KS9A 4Q19A 4NULA 5DHQA 3S81A 4HDOB 4MI6A 3ZDQA 1QFXA 2CZCA 5A5EA 5B58T 2C83A 2PV0A 1B73A 3NXSA 3ROPA 3PO3G 2C7BA 2JLYA 4GM4A 4KXNA 5TS2A 3QKIA 4AUNA 3ND7A 3AUYA 2B2CA 2IEAA 5DBEX 1TEZA 3T0GA 2IEIA 4BECA 3PK0A 5FUMA 4E6EA 4QYIA 4E5PA 4WOPA 1T2AA 3FPGA 4NV3A 3L6CA 4NBSA 3W79A 3M6AA 3MJHA 1UJ2A 3YASA 1Y9ZA 2AWOA 1W36B 4BRZA 3PI6A 1E60A 1RABA 1ZI8A 3DPUA 3C1OA 4JENA 3P0JA 4KSYA 6ABPA 2A0FA 1P2DA 1QH1A 3CR8A 3T4UA 2D1QA 3IIMA 3VDXA 3K9LA 5BWNA 3STYA 1H0KA 2D1SA 4MYTA 3EXHB 4KUHA 2NU7B 3LUFA 3T7SA 4GPAA 1QYIA 4LOHA 3EMKA 5FOTA 3V4RA 1EP1B 3JALB 3QQMA 2XKAA 4ESHA 4C4YA 1GRQA 3AOEC 4C0KA 1YB5A 1YQDA 3GT3A 3GLIB 4KFCA 3VYSB 2G6TA 5T64A 5CT9A 5IYDG 1WDWB 2D74A 1Q1EA 3A28A 3JYHA 4AJHA 4HAYA 4BX0A 4IG4A 4N0MA 3KTFA 3WHKA 1I4OA 4C7VA 5DWQA 3OCXA 1HR0B 1RCUA 4F46A 3QXJA 2V97A 2B0CA 3KVNA 5KG5A 4C01A 2NADA 5KX5A 3EPLA 3SX2A 4CCAA 4CYMA 4IZOA 1NSFA 3OE4A 5HXAA 1QPBA 1L7AA 3I6IA 1HI9A 1V11A 1W5FA 1WXHA 3I6BA 4LF9B 1T24A 4KOEC 3Q10A 1OFUA 1I6KA 4NNJA 3PI7A 4RPKA 1I2LA 2ID4A 4EW3A 5E6SB 3DFUA 1K8QA 2YY7A 2YBEA 4UQPA 4C0LA 4E5VA 2DJIA 4U2BA 2HCTA 2XCAA 1E9FA 4DIMA 2VXOA 3KSUA 1A8QA 1Q7GA 4ZICA 7GPBA 3AEXA 1M1NB 3QKRB 5AW9A 3IEKA 3I8SA 1ZVJA 2X0FA 4QYSA 2WE8A 3PUJA 4LKRA 4Y18A 5IYCG 2J0EA 1DJLA 4GNRA 1E1CB 2ZB7A 4CG2A 4YI3A 1M2EA 1MC4A 2ZIAA 4MO2A 3L93A 2QDXA 3AR8A 3UHPA 2BTOA 1WMBA 4B4WA 4B5KA 3QWUA 1QCCA 4JBLA 3TD6A 4CR8A 4KXWA 1P60A 4NP6A 3PO2G 1U3VA 5FPTA 4S2UA 2XMBA 2BMEA 2IGTA 2JZNA 2WIDA 1OBFO 3L0BA 3PWTA 4RKRA 4H1WA 1JW9B 3R3SA 4G5QA 2BGNA 1QHXA 2CCKA 1FSSA 2IIBA 1XWIA 3BQ1A 2XMPA 4Q21A 2GA9A 4RE5A 4H0FA 1B6SA 5AM5A 3AWIA 2EJ2A 4C9BA 1LLUA 4C5BA 4DMKA 2DF8A 2PH3A 1Z7BA 1CJKC 4JBYA 5TT0A 3HB5X 3EDOA 1SK9A 1Z7YA 2ZB4A 4I5DA 3AHEA 4ZN6A 5HQ3B 4M98A 3VXKA 5IJZA 1AUPA 3H2ZA 1E9DA 2VUSA 4V3CA 4CWAA 4LJ9A 1BFUA 4XB6B 3IB3A 3FSGD 3SR3A 1AKNA 4WCDA 1NP6A 1Y89A 1ECCA 3L9XA 3QPBA 3CUYA 4F2PA 5ILGA 1OSNA 2DUWA 3EFHA 4XUDA 4EHKA 1UH5A 5L40A 1R0BA 3AEKA 4M9XA 4TN1A 4EYQA 1CY8A 2Q46A 3MRTA 1SKYE 2FB9A 1EK2A 2WP0A 4JI7H 4JUBA 4Q9IA 1WW2A 2KX7A 2WE7A 3ANNA 2NUAB 2YWFA 4BKPA 4MUGA 4J0FA 1JAZA 4G63A 4DV7H 1YFJA 4A6EA 3AEZA 1HR0H 1YA6A 2VK8A 1SM4A 3K6JA 3ZIAD 4L7VA 2P65A 2FG5A 1PL7A 1F0PA 3Q0EA 4LC9A 3INYA 5EZSA 4F9GA 5T7BA 1V1JA 3ZI0A 2PKQO 3FYHA 4O83A 1NP7A 4MUIA 1U31A 3LC7O 2BGJA 4DLKA 1DKRA 3KLBA 3H16A 1EBBA 3N6VA 3GARA 3KKQA 4JLSA 4O59O 4C2UA 1VLZA 2P3QA 2E9SA 3EIQA 4ZEVA 4NBUA 2VK4A 2GK4A 1GR1A 3SHQA 3LKBA 1V71A 4H7IA 2XW6A 3PKJA 3GDWA 5EE1A 1E7QA 4YP3A 1XJ0A 2BTQB 4XD7D 3UT6A 2HZ7A 3M1IA 1SIUA 2WC1A 4RIEA 1QAOA 4II7A 4HAOA 3JQ9C 4O2BF 2ZSFA 2ZDHA 3S7ZA 4F6RA 4RDHA 2PKXA 1FNMA 1XAJA 4PO1A 5FV7A 1R3UA 5K3OA 1J5PA 2BE9A 3I0MA 1ENZA 3GYBA 1QHHA 5TPWA 4P3NA 1S0OA 3TRIA 1VE9A 3FVWA 1JHZA 3MOIA 4HX2A 2V0CA 4CQLB 2VHQA 4CN9A 3DW1X 2W83A 3IE0A 3PFWO 4DIUA 3T7CA 1ZVKA 2XTJA 1RZVA 3LPNA 5KYWA 5EYPB 4W7IA 1Q20A 3JYQA 4JDPA 1QP4A 4Z4HA 5K0GA 1RYBA 3LECA 1E4VA 1NDHA 5K45A 1T5BA 1T4BA 4K86A 3UICA 5ILOA 2Q0QA 5F35A 3NIDB 4BO5A 4DGSA 1WXDA 4NQRA 3W5BA 2QN6A 2Q7XA 2EL9A 1YDWA 2YQZA 2UV8A 4IO1A 3VZDA 1E3JA 4F85A 2BGWA 2YXPX 3MLAA 2BKEA 4R4JA 2WYOA 1MR3F 3O2SB 4XX0A 1CZUA 1KZ1A 3EIXA 3PXEA 3MJ4A 2EZ9A 1L5LA 2VYND 1WBBA 5HVNA 1PLJA 1BWPA 4G0QA 1L4BA 2F9MA 4FE7A 4DLVA 4GPIB 2AX3A 2W6PA 4ODIA 2QB5A 2UKDA 3NKFA 4P58A 1JEYA 4MW0A 2WKWA 3GPCA 2IZ6A 3BWVA 4JLUA 3HYCA 3UJ9A 3LRTA 4U2KA 1ZICA 1MDFA 2Z95A 3MD9A 1Y8RB 1Y14B 2CXSA 3SSOA 5HQTA 2VDQB 2YN2A 4RQBA 1NFRA 4ESOA 1EP9A 4IQFA 5KJ6A 2FW1A 1NYRA 1GRRA 3WSWA 4GUDA 3OE7A 3ROFA 4BLTA 1R2QA 4I3FA 4NABA 4AZTA 1PS8A 1ZOPA 3BMOB 1QYRA 5HKLA 1R0ZA 1YONA 5T3UA 1N2BA 1TLLA 2JJ8A 3MSXA 2B7BA 1XDDA 2N0SA 1WDLA 3RVKA 1UXKA 3O93A 3VR6D 5E0KB 3WWCA 3NEYA 4IEEA 4RADA 1PKEA 3LPAA 5CRIA 2G3YA 1V3QE 1XVTA 3LCUA 1KSJA 4B85A 4DM3A 2R92A 5JC8A 3Q7TA 1LD3A 3QE9Y 4R1NA 5BV1A 1GLGA 4YXFA 3O8DA 1CZOA 1TZ2A 2XADA 3A14A 4FGLA 4X60A 1N1DA 1E89A 1PL0A 1JDUA 4W8HA 2HNKA 4YP1A 5ALOA 1BCRA 1UDXA 2L0XA 2EOAA 2EC5A 1S97A 2XVAA 3CX6A 5FYQA 4KVZA 4OKNA 4D57A 1L7PA 1TEXA 2ZI5A 2AN9A 1F14A 2B6NA 5HNEA 2EG5A 3EGXB 2J67A 2P30A 3NETA 1QCDA 4FK8A 2YHIA 4B32A 4D6YA 1QANA 2VA3A 3ZWAA 4L73A 5LU9A 2PA0A 3OFND 1OBHA 3U4QB 2BEWA 1JDNA 2V7EA 1CV2A 1YZGA 2C82A 3PWZA 2IUUA 3EODA 5TGZA 3LUPA 3ESZA 3LYAA 4F4CA 5L8VA 2HIVA 1NXOA 2Q5EA 4ZEMA 5JSZB 3MINB 3OMWA 4Y2GA 1VJDA 2XCQA 4QARA 3TECE 3F8NA 2B1IA 1AKRA 4V2IA 5I9MA 3HYLA 3OFVA 1OVGA 3IXLA 4CM8B 1Q21A 4W5WA 1BHQ1 1FQWA 3OF2A 5KC8A 3HR8A 1NQAO 1RAHA 2X15A 7AT1A 2B1JA 2JGRA 4JELA 3FKJA 4M46A 1B8PA 3OHSX 5EWFA 3BCUA 1JG4A 1USUA 2SCUB 2IITA 1HQYE 4G8BA 5FPHA 4E4RA 4LAFA 4TQAA 2CC2A 3P45A 3L7KA 3OSUA 4UD2A 3DCYA 3PFNA 5I7SA 2ET6A 2VUHB 3RSSA 3GN2A 5IM4A 2I6FA 3LI2A 4KK3A 2A30A 4HGZA 5CB0A 1E1RA 4KTTE 1E7YA 3S70A 1KTAA 3AP2A 2I4OA 4H77A 1O6BA 2TMYA 4HXGA 3ILXA 1W76A 3LV8A 4MWSA 3GLIA 1N32H 1DZ3A 1V16A 1RJDA 5DXAA 1NXWA 1Y1VA 1K27A 4MLCA 3ZJVA 1P4SA 2BDUA 4ECUA 4L3WA 3L84A 3TSAA 1ONSA 3B89A 1QAMA 4K9OA 1IWBB 3NHJA 4EI8A 3BH0A 1XELA 1WXFA 3EIFA 4LF4B 4H1UA 5A6SB 3GLTA 4HYQA 4MUBA 2QM7A 3WMFA 3V4FA 1CULC 1Q7TA 2P75A 3UEOA 2VYNA 2JCGA 1N34H 1M6VB 4G1MB 4N01A 5T8KC 1D5WA 2IA5A 5B4TA 4UTNA 4DUPA 2XNKA 3PIDA 4TUYF 4D74A 1NYTA 3OTWA 3H5LA 1NDUA 4JOQA 4EB6B 2JEOA 3LY5A 1M67A 2N75A 2F1RA 4MQ6A 3M9XA 3BT7A 2H6EA 2V7GA 5CPFA 3PSAA 3VOSA 4IIDA 3U0BA 4JC0A 3B78A 5CXSA 2GZRA 2Q3BA 4M7RA 5KX5B 1V1RA 2A0WA 4FCVA 3FFAA 2HSWA 4AG3A 1I1MA 3HJFA 3MF4A 4DDKA 4B3RB 4IDFA 3MAAC 3D7MA 4F8YA 2EZ8A 3LMKA 3SZ3A 2JGLA 3GT0A 3GEBA 1NW8A 3LL7A 1U7DA 3CH5A 4RV5A 5H59A 3OEHA 4JHXA 4M1EA 5CP8A 2EKPA 3B1VA 3WKBA 1S4QA 3N0VA 5F9FA 3NU1A 1XRLA 3CVJA 4GPD1 5BSUA 2RH9B 3GCWA 4IFEA 1X3SA 5C51B 5LMUH 3G9ZA 4IDBA 4RZ2A 1AMOA 3EWAA 4JLPA 1P77A 4KFUA 4OGFA 4RY8A 4LRYA 4TKMA 1R18A 1U7OA 4LV5B 4NI5A 4W6ZA 5IG2A 1H2FA 3THWB 4JXZA 1C4WA 1J20A 1DI0A 2YJNA 2F64A 1MQAA 3A04A 5JMPA 3ZLBA 4FE4A 1EWKA 2ZM6H 2FK8A 2B21A 1A27A 1EUCA 2WU8A 2VP6A 2XSZA 3O8QB 5AI6A 5HKKA 3IP3A 3OD1A 2XJ9A 3I2YX 3ZC3A 2QMZA 3FNRA 4H1TA 5I7FA 1NP3A 1ZHFA 4B3JA 4A03A 1CQWA 3QPDA 1MHPA 2P5TB 4YCMA 1QFSA 2VT7A 3OTIA 1B8VA 1W85B 2QA5A 2XCIA 3L79A 4FE3A 3WO1A 3GDFA 4ML3A 4RPJA 4UM7A 5SZHB 3RUDA 4CKWA 2ZSAA 4CR7A 5FUVA 4RNOA 4UNPA 2R1UA 2PO7A 5FWNA 4K9MA 2X23A 3NTVA 3H11A 3KAJA 1MN6A 3BD6A 5AVWA 3LYUA 1U8ZA 1JHYA 1KP9A 3I32A 3U7QB 2PPVA 3EZNA 1VKJA 6REQB 4JQOA 1F60A 4MMZB 4MI3A 4AF8A 4R2XA 4POOA 5KTOA 4FBGA 2HLDD 1FUEA 1YKFA 3OURA 5DEIA 3UK6A 1XPRA 1Q22A 3GCGA 3MWFA 1TKCA 2ZJ0A 4HDKA 3WLSA 1M1NA 3DONA 4ZXPA 1Z38A 5AOVA 4YCAA 3VVCA 1XZLA 3DDOA 3VU8A 4ZO7A 2OCAA 4N47A 2P62A 2HGSA 2LKCA 5FWAA 3SFZA 5KT2A 1KJIA 1NWHA 1PR6A 2ZS8A 1ZRNA 2IOFK 3AQIA 1GQFA 5HF9A 3A10A 1XTZA 4B81A 1IEQA 2DH6A 2O0JA 4QYTA 3SNKA 5I8ZA 3TN7A 3H0EA 4HVCA 1X80B 2B8TA 2C4NA 2Z8ZA 1KYZA 3LDUA 2A9QA 1KI4A 4TXJA 5D3ZA 1HE5A 3D4BA 3EGVA 1T3LA 1FUUA 3CVZA 2OBFA 2GN4A 1OLXB 3QW4B 5DP2A 5C8YA 4MLPA 3DAAA 3OOJA 4LY3A 4RLSA 1CIJA 3TTVA 3DDZX 3TEKA 2GZHA 4JQZA 3U48A 3MJRA 5IT9A 2GB4A 1G2PA 1WSBA 4HNTA 4E0BA 4E11A 4LUCA 1LI4A 1G55A 3O9MA 4GGMX 1CZHA 3K5IA 1VBHA 5K20A 5HP4A 5DYWA 2PKQP 2X41A 2JNWA 4RU9A 4WZ6A 1N2EA 1SQGA 1KSGA 3WHPA 2KB0A 1S2DA 2PAAA 2A1UB 2G0TA 3U7HB 3PENA 4BCDA 5LKRA 2PWBA 3ZHBA 3HS3A 2P6MA 3NLLA 4F2DA 3LHIA 2EFJA 2O7QA 3LYLA 3UMFA 2YZLA 2F1HA 2HWWA 2Z2KA 4HI0E 3ZBTA 3ZGNA 4DLYA 2B7CA 1ZCJA 3U3DA 1WUKS 5AVXA 1U1EA 3Q85A 5FL3A 5KOJA 1T1RA 1E9CA 1D6MA 2P2ZA 2HJ9A 1F2VA 2A58A 3O90A 5AJUA 1KT8A 2CJWA 4KC0A 4CU2A 1L5SA 2VAWA 1ZBQA 3B6IA 2X4LA 4KX5A 1IFXA 1JMKC 1W35A 3FLAA 3NHYA 2J0UB 3RUEA 4Z9FA 3PS9A 3G8BA 3THSA 3QG1A 3SXPA 4DCPA 1NWCA 4B3FX 3P5SA 2PUFA 2Q3HA 3C1TA 4S1NA 2BGUA 2A5DA 1OI3A 1U3WA 4MNTA 5HJEA 1U7WA 1WO8A 2I3ZA 3RFTA 3UJDA 1N3BA 3GZNB 5LA6F 1KOLA 2R8ZA 1P5HA 3GFTA 1P72A 3G7UA 1RVDA 1UQTA 1K98A 2E2HA 2O4UX 1UJBA 3QXSA 5HPYB 2VS1A 2ILTA 2P35A 3R6GA 2HLHA 3VX4A 1GUDA 1L5WA 1Y82A 4HAXA 4TSFA 1Q0RA 5ITZA 5DVZA 2VPTA 4BY7G 1FFSA 1V43A 2MR6A 3QE4A 2ODNA 4TQSA 4ADSG 3UATA 3DEZA 5L3QB 2FQXA 1Q5PA 1H0SA 3EW7A 3TQQA 2GVDC 4JUFA 1NUHA 3ZZ1A 4PZAA 3QFRA 4M88A 2WQ6A 4O4HA 4WNYA 2ORED 1N33H 2OGSA 1EFPA 2R751 3CG0A 4DV6H 4GM1A 4HKTA 1PFUA 5JCOC 2IA6A 3HL4A 1UK7A 1HT3A 4PQRA 4FYHA 3HEAA 4Y1EA 2JIMA 1GU7A 2D2EA 3CVXA 4JI0B 3QTBA 5HUJA 3HCCA 4TQRA 1KMNA 1MNQA 1OAKA 2NZJA 2A78A 2XNHA 1DJPA 4R51A 4RGBA 4XASA 4K9LA 3IE2A 1Z13A 3AHCA 5BW5A 1X7DA 3QMPA 4FHCA 3E84A 4RNDB 1QK5A 3PX2A 4MGYR 1CJVC 1JU3A 3X1DA 2HXGA 4V0RA 3ISVA 4CDGA 4RA6B 4FX5A 3V8VA 2W22A 1YRWA 5HKOA 1J1IA 3ED1A 5F2KA 2XT0A 5EY5B 5H83A 3SVZA 3LHKA 3ZJYA 2DT8A 3PF9A 4BKUA 2TMKA 2AS0A 1BKYA 2LGJA 3TLJA 1UM9B 2GRUA 3IBSA 4QU5A 1Y0BA 2OKCA 3TBKA 2CLMB 5FBLB 3TMAA 3KLMX 1O9HA 1H23A 4O2BB 1E1YA 1F0NA 2RIRA 2P11A 2H9IA 1UFOA 1WPXA 2VUIB 5CVCA 2FPOA 3WWPA 4A6PA 1C7EA 4D4JA 2ZUBA 4L50A 1JHQA 2RK4A 2HWXA 2I2FA 1JDBC 4NXNH 2Y68A 3K32A 3N0XA 1FA9A 4B3IA 1Z5NA 3DO6A 3QQPA 2WVAA 1KP2A 5IAAA 1EK0A 4DC9A 1LDMA 2J6SA 3KJGA 1C3EA 2PLFA 4ZRMA 4AIRA 1GZ3A 2R1ZA 3QKWA 1I1HA 1O1YA 4UVEA 3H5RA 3RUPA 4TKVA 1E5XA 2EQAA 1ND6A 2IW1A 1OD6A 2H52A 3P9SA 2O8BA 4KGDA 7YASA 5BXYA 5DASA 4PLGA 2OQVA 5EJ9A 3KYIB 4F4DA 3V2HA 4O4IB 3BQMB 3GAAA 1IMJA 4ZO4A 3RKSA 5KFGA 4YV1A 3ASVA 2PIAA 3B8HA 2FPRA 3VR1A 3A31A 2FSIA 2WT9A 3L92A 3OT1B 3IURA 4ENRA 4DA7A 2HWKA 1PZXA 4DV5B 4N6NA 1F7VA 2G72A 4DWJA 5AXBA 3FBWA 3VZBA 4QWEA 3DMFA 4MVJA 3SDZA 5L3QA 4MHSA 3TRDA 3HCFA 3NHAA 5ERYA 4LQDA 3AUJB 1YNOA 1ZQ1A 2AL7A 3EIUA 4KFTA 4RQTA 3UTCA 4WZZA 4LA4A 2W4IA 4JUCA 5GWXA 4EDFA 2NZWA 2XGMA 2V6BA 1D2CA 1LJ8A 1YB2A 2WZCA 1B26A 2WKRA 2RHBA 3BM5A 3F49S 3BVPA 3GJSA 3U61B 3OPXA 3RVBA 3F9CA 5CLGA 1NE7A 4MV1A 2BHSA 3U3OA 3U4QA 1GAJA 4CZ2A 2PZFA 4DL5A 2BMFA 1FLAA 3RVQA 4KVFA 3KQKA 5DH9A 3ROZA 2OHGA 1QZ3A 3A9RA 4MVJP 2ZBGA 4WJZA 5E25A 3CGGA 3LPDA 3OM1A 2VCEA 1N9GB 1PS0A 2ZU0C 3DBLA 1T0BA 3LBAA 1U2SA 3Q98A 4HH0A 5ALJA 1JH9A 1DIRA 2O14A 4UJ3A 1OXMA 5JSYA 3FBGA 5LIRA 2ZTHA 2AN5A 4KN9S 4O1IA 1GL3A 3G6KA 2B83A 3GLRA 3KXKA 4UPEA 1N9ZA 2TS1A 5KI6A 2HMSA 1U2DC 4DG8A 4KXLA 5FUWA 3VKVA 1BTOA 1K3TA 4IIYA 3IOBA 1ZEJA 5AVKA 4QBGB 2OFPA 2DGDA 3RHTA 1HMYA 4L4RA 2OLKA 3B6ZA 3V4OA 1FTSA 2R1TA 2IX3A 3WKAA 4WW0A 5BQOA 1KKUA 4L8YA 4Q16A 4EJ0A 3MJSA 2ZPAA 4LBYA 1HF3A 3GJ4A 5FJIA 3M6WA 1AUQA 2GERA 5AH0A 4HXYA 1TM3E 4NBLA 3BFXA 3L8CA 5JNTA 1E63A 1HA3A 1UMBA 4HADA 5DULA 5D1HA 4JOSA 2IU3A 4WV3A 1L4EA 4GL4A 5A3VA 1RZUA 5H3HA 2BRUC 2XH8A 5F52A 1Q7BA 3UWPA 1J8MF 2GO7A 1W1UA 2N42A 2JPDA 2V9CA 3G5AA 2WWYA 3BCRA 1KQFA 1CNMA 3BOSA 3DLTA 3WFIA 5IN4A 3IAFA 1TO2E 5HILA 1WY7A 4MR9B 2VHJA 2H2AA 4DCOA 2XLBA 3T5LA 4XWYA 3KKKA 2YJ4A 3GQBB 4K6HA 1IYEA 2P1ZA 3DO8A 4HX9A 4TRNA 1ZH4A 3TE6A 1I94H 5F5NA 3SS9X 4YREA 2FRDC 1H2ZA 4XIFA 1JHVA 3OCZA 2FZ5A 3K0BA 3B38A 1LPPA 1W0JD 4D3FA 4PZUA 1L5YA 4AJ9A 2XVXA 3IOYA 3NBYC 1K0FA 4M1ZA 1C7IA 3ZE9A 1TMYA 4OBWA 3THWA 4B3TH 1F6DA 2Y8EA 1ISFA 4F6LA 4A16A 1VLHA 2V6IA 1N7IA 3ZWBA 3OWHA 2G7ZA 4EKNB 1KU0A 5DWVA 3I1IA 3BYZA 4BQOA 5CFZA 1W85A 4HNUA 3RC8A 3KYJB 1E79A 3MXOA 4S0ZA 4ZC8A 2FRDA 1JR2A 1ULAA 2L69A 2JEYA 2C8JA 3KVVA 5FNVB 4YMUA 3IVMA 5J47A 2XVMA 2CVHA 2B5VA 5DQHA 2H1LA 1P5ZB 3PD1A 4MK4A 1TFRA 2R7ZA 3ZE6A 5CVTA 1OC4A 1Z82A 1RYMA 1ZI6A 3S1LA 3HZHA 2G36A 1T9AA 4IVPA 2CQYA 1Z0DA 2R8XA 4D82A 4YR3A 2QMQA 4NSNA 4FINA 1XEXA 3PVSA 3R0JA 3OKFA 4BVKA 1I1LA 2PZ8A 2ID7A 4PCAA 3I6QA 4PHHA 4UUBA 2XKKA 2P2DA 4YQYA 2BUCA 3ZKAA 4ZVQA 1ZKDA 2C5AA 3A4NA 3TZHA 5CFOA 1JHDA 2BISA 2OV1A 4FDTA 3UC5A 5DXFA 3WK6A 3FF1A 2UVRA 4Q3LA 5KOHA 1Q6ZA 1IK4A 4X95A 2O1EA 5CBPA 2MSLA 3PUWA 4ZVLA 3PC7A 4Q4LA 2IBMA 3UGTA 2OZPA 3BWMA 5ERXA 4P31A 4PNHA 4BE9A 5DJ5A 4E32A 5LP1A 3J80A 4EI2A 5M04A 3FMAA 1I4EB 1YMQA 3OHMA 2PFGA 5EQDA 3ZHOA 4CMKA 1VE5A 2IYFA 4ID3A 4K7JA 4M9CA 2FUG6 3PIRA 3EA5A 3G6VA 2FSVC 3H3JA 4DMFA 1YFZA 4I1UA 1IQRA 2PNJA 4K8OA 2VTKA 3Q8LA 1FP1D 2E5FA 2PD4A 1WHSA 4D9KA 5A2GA 1FY2A 4D0LB 5HOQA 1FRFS 3F78A 3H11B 4OHCA 3LDFA 4TMFA 3U4CA 5ETJA 2IH5A 1PV2A 3IRVA 3O1HB 4RUKA 3BRWD 4UHCA 4DV3B 1UBJS 1GN8A 3FRJA 4L6IA 3SS8A 4P0TA 3V1YA 1SELA 2C61A 3REQB 3SDBA 2QJWA 2Q5QA 3O4RA 2QL5A 4IDAA 2XMQA 4QHYA 2RD2A 1ONNA 2YJGA 1LXCA 5IAJA 2FLKA 4HRYA 3EH1A 2IZOA 2R87A 3COPA 5EIFA 4HDNB 5BURA 5FOSA 5ALSA 5F73A 2BC9A 2DTDA 3CINA 5K3FB 4BO3A 3MEQA 5C52B 5EWLB 1R10A 1TFUA 2YZ2A 4RMJA 5BSFA 2OC4A 2XRMA 4L7QA 3WQQA 2BFEB 4EMBA 4O3MA 1NX6A 1FTWA 4O4HF 4EMTA 8AT1A 2QX9A 5H81A 1KTVA 2C35B 2F9LA 3GNLA 2BZ1A 3ZU6A 1L5VA 1WSWA 1XXHE 4IIJF 3JQAB 2IW3A 3P97A 3W5JA 4YCNA 2AEJA 4U7JA 3BSFA 3ZDYB 3MPOA 1JJVA 3R75A 3T6KA 5GZ3A 1XAGA 1US8A 4UPDA 4ED9A 4KH0A 4ALNA 1VI5A 4BE7B 4LMYA 1OVMA 2RGBA 4JXJA 1AIPA 2BBTA 2G76A 3PRJA 2ZZNA 1ZRSA 3LHDA 3NDPA 1SUWA 1UK8A 2WG0A 2ZLBA 4LJ4A 3CT6A 4UM8B 3N9IA 4YIKA 1JKXA 5ENDA 4W7SA 1Y6RA 4QDJA 1DBPA 4JI5H 2R48A 3U39A 1TL7C 2C4TA 3AR9A 5DLQC 3WLJA 4DHWA 1IXKA 2VDMB 3IV9A 5BWUA 1P75A 1FPMA 4OH7A 5HSGA 4DG5A 3VR2A 1SXJE 4BQNA 1DPFA 3E58A 3M8KA 4N6GA 2ANBA 5JZMA 2Q2TA 3LVFO 3D81A 5AP9A 4DMGA 3GA5A 5HIJA 3P7MA 2GARA 1D4OA 1T26A 1L8OA 3H4DA 3HMKA 4KDEA 2VJLA 1H4TA 1ZHOA 2FMAA 2ADMA 5E8JA 4AYTA 2BY4A 1SBCA 4LDJA 1YZYA 2W93A 3C8ZA 5A3SA 4DNXA 3TGPA 6LDHA 3ZZNA 1BEUB 1OA1A 2CXPA 1GTVA 3FAZA 4H7PA 3P9IA 2J8ZA 3BQ2A 4HN2A 4BHTA 3LULA 4LZPA 3TDMA 4QIWE 3FIJA 2WHQA 3CNNA 1WA5A 2GFHA 2I7DA 2OMKA 3A25A 1JBQA 3P20A 3LWZA 3SGLA 4NARA 2W2LD 3IUMA 5L6LB 2OUKA 1A7AA 3RRXA 2VRBA 3K9HA 3ASZA 3MBOA 1E1QA 4L76A 3MM4A 4LJ5A 4FDVA 1CZNA 4PYMA 1C4OA 2H54A 2W6JD 3A2MA 3GVPA 5HKBA 5HDBB 4PZDA 5KS8A 4R05A 4E2YA 2JCVA 2HF7A 3FDZB 4TROA 4NRDA 3B9PA 1Y6QA 5A4DA 3OPMA 4TV9F 3C3KA 3I23A 3UG6A 2H92A 3ZJTA 1G8AA 2XZPA 2J32A 4B3BA 3E5NA 4WFIA 4CODB 1EDOA 1MBZA 3LVRE 4LF5B 2B4RO 4C5AA 2GVNA 4U2CA 4RVGA 4WPGA 1UPTA 4AT1A 3VGJA 3M9WA 2REBA 3LDAA 3HABA 3KAQA 1H3EA 4F4JA 5DHAA 1LU9A 1QZTA 2WB1E 3CR7A 4KLAA 3RYTC 3ZY3A 5A5DA 4LHSA 1A04A 1OILA 4UEKA 4ZAWA 2HHFB 3OAAA 1ZM9A 5GY7A 4CLOB 2HHCA 3CY6A 1WU7A 1B2LA 2YS7A 1SVKA 2P90A 3FGPA 3MJDA 2Q28A 3Q2IA 2GFIA 3R5KA 4MH0R 4RHTA 3SIPA 5CDSA 4H1VA 1S9FA 2R5FA 3GUCA 3CLTD 4KIUA 3USES 5LQKA 1ZGGA 4M7EA 4Y2QA 1KO4A 4EWLA 3R3JA 1JDVA 2H18A 4KAAA 1C8BA 1TAHA 5EP4A 1JAIA 4BL5A 4Q7QA 1XFDA 1JSCA 2V0GA 4E1AA 1F5NA 3IKMB 1Z2DA 4AN1A 4ARIA 2WJZB 1D04A 1QH8A 2Q7DA 3EPRA 3QUQA 3VR4D 3G0BA 2VHEA 1PZMA 1ECFA 1F4PA 4BMOB 1CJUC 1T34A 1OT5A 1F12A 2QLMA 1I1OA 3SN6A 1PJTA 1VPTA 2W2XA 3A3KA 4RB0A 4Q34A 5IKEA 5GJBA 4NLGA 5D7NA 2DY1A 2DVMA 3DAFA 2QX6A 5JR3A 3PW2A 2PQ6A 4E31A 1UPXA 2R8IA 3ITEA 4PWYA 4TVIA 4QU0A 2FFQA 4WAUA 2G5TA 3EF3A 4J9KA 1QKKA 3BULA 4MZDA 1BCSA 1UZUA 2PJRA 1JEEA 1A77A 5E2IA 1N8TA 1OZHA 2J46A 3EF0A 4P35A 2FWIA 1C1HA 1MAHA 4YUYA 5D1PA 1W0JA 2ST1A 2Y1XA 3HYNA 2R7LA 1ZH0A 2Q2QA 3RF6A 1TQ2A 3DA8A 3C7KA 4JJ7A 1GT91 3OJEA 1U28C 5AVOA 2WM2A 5BOSA 3COJA 4CEIA 3VKHA 2BV3A 4FCTA 1ZR2A 5FJ8G 3TEJA 3KXIA 2FWNA 1UZMA 2EATA 1KAHA 4I50F 2YWRA 1BDIA 3QUTA 1QRTA 5C4IA 4JYAH 2QU8A 1J5XA 3OO0A 5JXWA 4UE6A 4IL5A 3O38A 2IV2X 4BKMA 4KMMA 2OKGA 1E9EA 4RV9A 1QONA 2FKAA 3P0EA 4ZHQB 3QYAA 5AXAA 3HM9A 1N5LA 1TGVA 1ISRA 1CX9B 1SZPA 3QYFA 1V9PA 5DMHA 4CI0B 1MABA 2NO9A 1NY5A 2EJTA 2JGDA 1L2ZA 1ZK3A 2Q4EA 1G63A 2Y0DA 5K4AA 3I1YA 3IBYA 3ADPA 3DM5A 4ZOLF 1Z08A 3A1TA 4QWAA 5CMLA 4B8YA 3MD0A 4HWOA 3W1GA 4DHEA 1XDZA 2C4HA 1QGDA 1W4ZA 3ZXIA 3MBIA 3U4IA 4FNMA 4XM2A 1OA0A 4RTKA 4EA8A 4LF6B 5AK6A 1JAYA 1TX4B 4NYJR 1RMTA 2HJRA 1Y3FE 1JJFA 1WU8A 1XLWA 2ECPA 2RDMA 4MUJA 4RKWA 1SR8A 1V7QA 3S2ZA 4DADA 3KU4A 2PUEA 4N41A 4A3SA 2Q1UA 1SN7A 1QHYA 3B9BA 1J21A 2GKSA 2CHUA 3LE8A 3TINA 3L4EA 4M1TA 3GD5A 1Q11A 2C2HA 3BORA 4PSUA 5HJ2A 3U9LA 2FETA 4U2EA 5JZ9A 5IDVA 1TWGA 4JKOA 1XPUA 4G5GA 3C0FB 1DJNA 4UFZA 4CQMA 5KU1A 5CFNA 3HKEA 4I4TF 4FX2A 1A9QA 1M2VB 2O57A 3BERA 4IFIA 3ZUGA 1S03G 1KXJA 3AEUA 3EWSA 4KIWA 4ZMSA 3PA8A 4O3SA 3NXKA 4YGYA 2DPYA 1DBSA 1O6CA 3HRKA 1UPAA 4NCNA 3VZQA 1UXHA 3OZ7A 1W0CA 1INLA 2HUPA 4GOXA 3HH8A 1HG0A 3PVXA 2DWCA 5T57A 4WMLA 4K6GA 4ZVKA 5FA8A 1EKXA 3RU2A 3CPJB 3H5OA 2QQGA 4FYYA 3STTA 2C1EA 3BMCB 2DR3A 4EUEA 2VSXA 4EG8A 1I2DA 7REQA 4MYUA 1SQSA 4ZODA 4QDXA 4O7WA 3T1HB 1NYLA 4ZJYA 5I9LA 1VIYA 1KS9A 1HX7A 1JKJA 1G17A 1WD7A 3FHLA 3ZWXA 4C04A 3PR2B 4WKOA 1NV8A 1E3SA 4DLLA 4ZDWA 2E37A 5KYWB 3RYIB 1EXMA 1JPJA 2GCOA 1M2NA 5FTMA 5C9ZA 3AVVA 2H4WA 2Q2WA 1NQXA 2XRZA 2JLSA 4M4SA 1N5RA 2FI1A 1D8TA 4WCFB 3T35A 2GPBA 3IDQA 4DKXA 4A3IG 2RGEA 2HVQA 4FHEA 2PBLA 3BF7A 1IB0A 1XEXB 1ZHHA 3D3EA 1L6RA 1T94A 4R8LA 2XOKD 1JT2A 4J0QA 3AJAA 2PLRA 3K1TA 1M34B 2HK8A 4IXMA 3ADOA 2ZAIA 3MQ4A 3F8SA 3DKVA 4UUNA 5KINB 3LUKA 1OB5A 3RBZA 3H19A 5KG2A 4OSPA 1X7WB 2Q5LA 3C48A 3I1JA 2H5JA 4NOMA 3GJRA 4DR3H 1XZFA 3HB1A 3NFYA 5IEJA 1H4VB 4INJA 1SXIA 1JFFA 4JY7A 2PEZA 1RMQA 4S1TA 2JCXA 4IIJA 1KVQA 4CGYA 5JSUA 1Z2EA 3IHLA 1JHXA 1QC5A 4G1CA 2K5UA 3TNLA 4HS4A 1R4NA 4W82A 2R97A 2OPHA 5A62A 1UZAA 4UTRA 1VA4A 1UKEA 2OZLA 2XHEA 4Z51A 1TJ3A 3WOHA 4CQNA 4OQ4A 3DVLA 3WYCA 1AK2A 2J08A 2WMYA 1J9EA 3N5CA 2H3EA 4LIPD 4O29A 5DTIA 4YJDA 1JX6A 3Q0TA 1PJLA 4HQNA 4RMIA 4EOGA 3H0GG 4F5WA 5M34A 3VTFA 3WI7A 3N2ZB 3SVLA 1KGSA 2CNBA 1JQKA 2WF8A 1OH8A 4QLBA 3TW6A 3T1QA 2UUPA 4URYR 5C3EG 1C7JA 5FOUA 2EZ4A 5MFZA 2OLEA 1JG6A 1Y1WA 1EEHA 3LXRA 3L41A 4Y1GA 1ENOA 2XEDA 1P45A 1XDBA 1CP3A 2JZCA 2X40A 2R9VA 3L4JA 3NRCA 4YAKB 2VDJA 3QPCA 3FFXA 1HZZC 2WF9A 4A8TA 1AGXA 2P4HX 3KWJA 3PUXA 3OSNA 3UJ3X 1X7XB 3A6HA 3LGXA 4C0JA 4YHHB 2G0NA 1PEKE 3RGGA 3EZYA 4X91A 5D1OB 4J1SA 1YZQA 4PXAA 1Z74A 2O0KA 3RT1A 3DF7A 2HL6A 4FBLA 3WGYA 4F86A 1H2EA 1WVMA 3KL2A 1N78A 4WNCA 3VI4B 2JDID 1Y1QA 1T6YA 2PGAA 1J8DA 2Q0SA 3T7IA 4GEKA 1NLFA 4B6OA 4AY5A 1GNTA 1A98A 4KQEA 1NMSA 1DTWB 1M72A 2I2XB 1G5PA 4KQ1A 1JR4A 1EEXB 1SRRA 3PCRB 4NBNA 4MEBA 4DTIA 1CG6A 2QAJA 2PD3A 4PR3A 1N9GA 4BNHA 4GR9A 2OO5C 1Y1PA 2YNMA 4HN9A 5KQPA 4DRXB 2MSDB 2X0JA 4FR5A 3MRXA 1KH3A 2AZTA 1Y4ZA 3I2IA 4RF2A 3CYFA 5EXEA 3OIUA 3U4GA 3H9EO 4WFKA 3I34X 3KUKA 2JLXA 2O7NA 3FYTA 4QTUB 2BAGA 3H42B 1LRLA 5A02A 1ORVA 5KG3A 4LQ4A 1WXQA 1OPRA 1CU1A 1VMAA 2V3VA 1X13A 2AF4C 3QFCA 1QQTA 1K5DA 4B7ZA 1BJRE 4IIUA 3QELB 1N2GA 1NN1A 3W7VA 2PSDA 4RIGA 1JGTA 4K6MA 5B3JC 1DFIA 1NNLA 3IMEA 5FTKA 1D2AA 1PJAA 1V1MA 2YFHA 3LVBA 3Q87B 4QPPA 1H0HA 3T3DA 4AMZA 1D2GA 1ISPA 2YY6A 2D4AA 1IZ9A 3QX9A 2JK1A 2AW5A 1M1XB 4GOLD 5FBHA 2HG8A 2D3TA 5JS2A 4DZRA 5C80A 3Q8KA 4L27A 1KJ8A 1DOAA 3BJMA 4LRXA 2CE7A 4PGFA 3S3TA 3D7KA 1WOMA 3A6EA 3HXPA 4ARVA 1QVZA 2XUKA 5K3CA 3X1ZA 1DAFA 2O3TA 4B46A 3ZCTA 2W8LA 1A5SB 2NUPB 3SF0A 4B3HA 4BO8A 3FCUB 2LE0A 1K89A 3A4LA 3C8MA 1IN5A 1F1JA 4ZEOA 5L3SA 3T5PA 5FA5A 1E2QA 1J2RA 2HA6A 4H4DA 2YZNA 3D8UA 1CEXA 1KJ9A 4KIGA 4MP6A 3FZQA 5H0IA 3ZQJA 1EU1A 4X7BA 4CF6A 5ITZB 1X8JA 3MHTA 1KI2A 1DIHA 3KUUA 1UEIA 4CTMA 4Y7DA 2C2RA 1TYBE 5C1IA 1JG1A 7MDHA 4LSXA 1VDMA 2KJQA 1BMTA 4KVGA 4MAFA 3BE6A 2B30A 2BBOA 2GUGA 3I8XA 1DQYA 2FTKE 1RR6A 4DR7H 1RI5A 1YOVB 2C5BA 1EYZA 2PKEA 5CEEA 3AILA 1OFIA 3T5KA 4U1RA 1ODJA 5BXQC 4DR6H 3RRBA 3A4VA 1LPSA 4LXHA 3VJRA 2VWHA 5KWVA 2HSEA 4G24A 3H2KA 3H0GA 2X9NA 5BWXA 3GTLA 1JUDA 1CDOA 1U8XX 2YMQA 1L1EA 5LUBA 2WY2D 3B6JA 4E21A 3MUFA 1Y1VG 5JAMA 1A1VA 2C2YA 1DJQA 2ZS7A 3DOHA 4NCBA 1Z16A 1YE5A 1GKYA 1UDBA 1FXWF 2FMKA 2HYDA 2O2DA 1GPWB 1UUFA 2CVQA 2X6QA 3BHJA 3JY6A 3AOEA 5CLHA 2FDCA 2XXBA 1IXSB 4BPRA 4OSOA 1RP1A 2PUWA 4GVPA 4IDPA 3GA7A 4V0QA 5B1HA 1BKDR 3GUUA 2R7MA 3SPXA 2G83A 4BZQA 3HCAA 2VP2A 4B1FA 5BSMA 3DMHA 2QJOA 4GBED 3AR2A 1BJTA 3N05A 1UINA 4C7JA 4C3UA 5K51A 3LGAA 1DU4A 3BGOS 3FZYA 3HKBB 4G8JA 4UMFA 5FBQB 3ROXA 3SU8A 5KNCD 1WB4A 2Y67A 1FBNA 2O8CA 5CH8A 3L8DA 4C21A 3LU1A 4PHFA 4WXHA 3C3PA 1T9KA 3NVAA 4PBSA 3USZA 2CFMA 2BFBA 2ZQZA 2XGPA 2GGSA 3B6EA 1QFMA 5K8JB 5IC6A 2OYCA 1CRWG 2X0EA 3T95A 1XRJA 3Q3IA 4HRVA 4J1TA 3PUZA 4DDTA 3BXXA 2HA7A 3FH0A 5JEEA 3CEPB 1E9RA 3HN2A 3NCHA 4HJRA 4BLPA 3OG9A 2Q6KA 4LX8A 4LY0A 4LY6A 3H4TA 2II6A 5J59A 5DNAA 4C03A 1OLSB 1SPXA 3GRRA 4YT4A 3ZK9A 1ZH6A 4C87A 1D7OA 3GDGA 3NVKI 1SBYA 4ECRA 3IPRA 2Z1MA 2AEMA 3DL7A 5BUQA 4C4TA 4P5EA 1ZUD1 3PEEA 1CRPA 1E69A 2FX2A 1WF3A 2V8OA 1X7ZB 4OHBA 2R6DA 4GECA 1G2WA 2WFLA 3C5CA 4Y2UA 3TLGA 3GIJA 1FFAA 1MJGA 3KHLA 4J91A 5CJ2A 2OD9A 5FXMA 3ZE8A 1NE2A 1Z8HA 2IDMA 3L07A 1K7SN 4KW7A 1L5GB 2ZUWA 1J2JA 1RWNA 1GN9A 4NH4A 1O08A 4MUNA 4X8HA 2DPGA 4YJKA 4YHBA 4ZOLA 4I36A 5KJCA 2YKGA 1KJZA 4ZTZB 1P1KA 1YDGA 3TX6A 4AMGA 2PUTA 4D4MA 4MV4A 1HC7A 2HREA 1NATA 1MA3A 1R0WA 3EUAA 3EVGA 3MFYA 4KAXA 4RNCA 2UYOA 4Z86A 4EYOA 3O95A 5AVTA 5KOJB 1KAEA 4DLBA 1W0KA 1GPUA 1G5IA 4K81B 3OZEA 2VBCA 5E6UA 4KU4A 4AIIA 4ZK6A 4Q00A 1AA9A 2QT9A 5CFLA 2QLJA 5E9QA 4LNUB 5JTTA 3M6XA 2UXDH 3OPQA 3ZIAA 5DM2A 4PFSA 2POQX 4DNQA 3DUFA 1MX5A 3MTEA 3P2EA 1E5QA 2F43A 3LFHA 3LUBA 3QY0A 3JRWA 2FR0A 1TA4A 2V0NA 4HGNA 4TUYA 5IASA 1RQNA 3VHRA 2IS4A 2GD6A 2B1QA 3TSOA 1HTWA 1XMSA 1T3GA 3EQ6A 3BWXA 3D0KA 1LSSA 4O4JB 5JY1A 5B2EA 1R9GA 1GDDA 2Q1SA 4JU8A 4NCJA 3RS7A 3JVVA 1SUIA 4BBRG 3GW8A 4DV0B 3KIPA 1A71A 1OYYA 3TLCA 1NURA 2DWUA 5LZ5A 2QQ5A 3FYDA 3ZD9A 1EKVA 1T3TA 2EFYA 4UDNA 3PE3A 1H2BA 2JCYA 3RVDA 2DAAA 3EVAA 5DWDA 3TZ6A 2QMHA 2P3LA 2VRCA 1EPUA 2COKA 1V96A 2V45A 8ATCA 3JQGB 1ZIOA 1GAQA 3LQQA 5YASA 3RYIA 4X6UA 1IBLH 4R8SA 4G25A 1IE3A 4QPNA 3F8TA 3FYUC 4RHXA 4AO6A 5LM3A 3IEPA 3MT9A 4KN6A 3LC1O 3C3YA 3RK1A 3TNDA 5I51A 5KUTA 1DB3A 3PUKA 4UBLA 1OREA 2LCFA 4WBSA 4ZI5A 2OAQ1 4IIEA 3S4YA 1NQTA 3DO5A 4E7PA 3GLKA 5DI3B 4Z7OB 1KY2A 1SOWA 1TKBA 1VE7A 1VSVA 2B1RA 4PPYA 4RPCA 5JNVA 4DTCA 1YV9A 1LF5A 2NYUA 2FK2A 1U4OA 2QM8A 3CZ5A 2W0SA 4W8OA 1N2OA 4C4RA 4EENA 4RFLA 4F2WA 4XGIA 1A4XA 1LNSA 1W47A 2C97A 2QN8A 2W6ID 4TMYA 4EBEA 4O7ZA 1Q2UA 9ABPA 1R4ZA 1XZGA 1WKBA 2P0YA 3N1UA 4K6CA 1HGXA 3WK7A 4EYSA 1JQ5A 4MJ7A 3UOAB 3DYBA 4BAUA 4R2KA 4JR2A 4Z4QA 4YJ3F 4WNAB 1QWSA 2QSYA 3QXGA 1WPRA 2OXCA 2ONKA 3JYLA 2YV2A 1JDBB 1G5TA 3G2NA 5BW8A 4IAJA 4JLWA 4ERXA 1APBA 3N3AC 4IVQA 2ZQYA 1XMQH 4X6LA 1WZEA 3W9YA 5CA0B 1DTWA 2YHBA 4IRMA 5AUOB 3QVJA 4MAMA 3HU3A 3GJ6A 5I6DA 1HFJA 3A6ZA 4V3BA 5E1DA 1CF4A 4RFVA 2UYHA 2H5IA 4IJ5A 4B76A 1GYQA 1D2HA 2X2PA 3OPYA 2RC6A 4BGEA 1KR2A 5JVDA 1BGVA 2AKEA 1ECLA 1UBUS 2P1DA 5KTKA 2IS1A 4UUQA 3HJRA 4JI4B 4NX2A 3UB2A 5CT5A 2VAPA 4UMEA 1DBRA 1YRQA 1QH8B 3FSJX 4MR8A 4YMIA 2V9ZA 4BVLA 3E7DA 1TYCA 4AQYB 3CH7A 2XY4A 3BFPA 4A91A 1HLFA 2Q5OA 1K92A 2YIMA 3D64A 3LQ1A 3X0DA 3QEMB 5IRCD 3UFXB 3IAUA 4X45A 1ZJYA 3DCNA 4MEJA 3V55A 4D99A 4O7NA 3UQZA 1DCFA 5IYZF 3TW7A 1J4AA 4AY3A 3U7RA 4P4NA 1ORIA 1MORA 1M8GA 2BI4A 4PE5B 2WV9A 1LDNA 4D4KA 2HX1A 2MOKA 3O82A 1RRCA 2C3OA 1K1QA 1IEWA 1P7CA 3E9NA 4JI3B 3GFGA 5A7GA 2FK3A 1BSVA 1DBVO 4XR9A 1NKVA 3IDFA 1AN0A 3NVMB 3TW8B 1PTKA 1JLLA 2IYAA 1KAQA 5DMXA 1EVZA 4MQ4A 1LVHA 3E1SA 4ND8A 2C54A 4Y1FA 2DUMA 1GP2A 1ITZA 5AHKA 3X2SA 4QQ8A 4X71A 4MRSA 1B4DA 2HU2A 4YROA 4HLQB 4D9NA 5HCIA 5HYVA 4JI5B 5DGHA 2UVVA 1XE3A 2B4TO 1J1ZA 1LLFA 1BEZA 2B9EA 2GCGA 3DWEX 1TD1A 1C3VA 2OP1A 3AX6A 2BQ3A 3EOAI 5BN5B 3X3HA 4K1LA 1LKZA 1IHUA 3I2FA 5DGBA 1US8B 2IBKA 5EGSA 4DV6B 2ZR9A 2A94A 1PUIA 3EEFA 5J9FA 4WCFC 3LZCA 3F7TA 3R0XA 3VKGA 1KXZA 3H9QA 1KQ3A 5FQNA 2F3UA 5KPDA 5BN1A 2IU0A 2ZIWB 3DBHA 2RE8A 3NM6B 1TW2A 2YDXA 2YHSA 2JIOA 4LXTA 4ARZA 1N56A 3R5FA 4BGDA 1G2IA 4MIOA 1HG1A 5HBRA 3TKAA 4F2GA 1P1CA 3RD5A 5BOVA 3GLGB 4ECWA 3ZVNA 3T1YB 3PCXA 3CRW1 3TY8A 3HM2A 5CD1A 2GXAA 4XIGS 1P4HA 2C95A 3CVOA 4M8NE 1S8OA 4BYGA 2BH9A 2BSQA 3ZV4A 5DFAA 1Y9DA 3KR9A 2ZYDA 4IWNA 2I8CA 3L46A 2UVQA 3UENA 4EY6A 4K87A 4W5HA 1OAOC 1TM4E 4ENQA 2RGVA 2HO4A 3OZBA 3ZQKA 1B1CA 4JJIA 5CA0A 4XIIA 2FE4A 3O4IA 1Z37A 4DF3A 3BF8A 1I7PA 1PFVA 5JD6A 4HQ0A 3CB2A 1A8UA 2A7XA 2ODAA 2QRQA 1YVEI 2ABWA 4MRRA 3FVTA 1J22A 1MENA 5CYGA 4F93B 5L7WA 3IQIX 1ZP6A 2HBRA 3PGXA 1AV6A 4IDEA 2GD0A 4MSUA 3B5JA 5BR8H 3HDVA 3AY0A 5FNVA 5TMBA 5JXGA 3UJPA 3RRYA 4A2BA 1SHZA 1WB9A 1LBSA 4EEKA 5JTUA 2K87A 5G1PA 1GTL1 2P2YA 3H8SA 3ZBUA 4CM3A 4CU5A 3ZCRA 1N5OX 4S24A 1RI1A 5BYJA 3U3KA 1G19A 5DQIA 1ADGA 4HNQA 1HYGA 2D2XA 1I6LA 2JS7A 5J63A 2J5QA 4E5NA 3RK0A 4BVBA 5HQ3A 5I7RA 3HXQA 1FXWA 1L5RA 1RW4A 1HL3A 1KAOA 1CIPA 2A9VA 2AQ8A 2E89A 4PSDA 3I9OA 3AESB 1TCVA 4GSYA 1N92A 3RCBA 4CQMD 2BTQA 4G56A 2FPIB 4IQ4A 2CWDA 1ZZGA 4WJKB 4G41A 2JJQA 1A8SA 3GWGA 5KDDA 5TF4A 5EIOA 3CTMA 4Q7LA 4R31A 5AJZA 5L4SA 3DR5A 1JR3A 3N7TA 2L18A 1KSHA 3GRCA 3S2SA 3UMJA 1Y4SA 1P4JA 2C92A 4YJGB 3DH0A 4GMDA 4PG6A 3AB8A 3EXFB 3AIIA 3FKQA 3MIZA 2DSNA 2QM3A 2A86A 1TUEA 2H4XA 5KFRA 3FLMA 4A3CG 3JARA 5AXDA 5LDGA 3S8YA 4B44A 4M9SA 2ZUFA 3WRXA 1UKVY 2NUAA 2FK7A 5ECDA 1A9XA 1O4WA 1TO6A 2J0VA 3EY4A 4LFAH 3GNQA 2VPQA 3FPBA 3IBGA 3FNEA 5E4YA 4A3EG 1JN0A 3M6LA 4MP8A 5FTJA 3ROKA 1G6HA 5KNCH 3RIYA 2FW6A 2I67A 2AFIE 2WAMA 4HMPA 1XTPA 4BX3A 4EYIB 1G21A 4IS3A 1F5SA 1JPUA 3OZTA 4LDPA 5EJIA 5JJCA 1WX1A 3AP3A 2ZAYA 4TM5A 1L5ZA 3L0IB 5ALXA 1CEEA 1ULHA 2F1JA 4QOIA 4EB6A 5BSRA 4JV1A 2W6OA 3B48A 2DTEA 2NZ8A 3PHHA 4XVUA 2AXQA 4HDNA 2R4UA 1KPGA 3OECA 3OQHA 5AM0A 4AKHA 1BEEA 1NIJA 3PUVA 4A10A 4WVLA 1P7YA 2OSBA 4GBMA 1KMCA 3E9CA 4PSVA 3PL1A 1H2AS 2JD0A 2DAPA 3NBAA 2VKQA 3OY7A 1VYVA 3NDIA 4UHEA 1XMJA 1RWQA 1A48A 3MVEA 1XQ6A 3B20A 3KEOA 2HVRA 5JUWA 1IVNA 2LVBA 1M6EX 3Q4GA 3NHBA 3FD8A 1JT9A 4UMDA 3T7EA 1NOKA 4R2HA 2ZPUA 3HFSA 3LFTA 3LK6A 3KFXA 1KO5A 4U7FA 4GYKA 3KKPA 3T5BA 2IYYA 5DOZA 1TK9A 3MHPA 4AKTA 1VBMA 4PRYA 4OU5A 2H65A 3Q3HA 5CU7A 5P21A 2MJLA 1QX4A 4AUMA 5KYYB 4GBGA 3W1WA 4RD2A 3Q6IA 3SBOA 5AM4A 1NLZA 4M2LA 2XGQA 2ZWIA 1P8AA 2A7QA 4QOSA 1QP7A 4IGFA 3UW3A 5CFQA 1NJFA 1DUVG 3H8JA 4TLBA 4YB8A 3F7MA 2FFRA 1TTQB 1SXJB 2KPOA 2Z09A 1O94A 1FBTA 5KNCA 1GTG1 1S0MA 2EX4A 3P0IA 4C0BA 2AWNA 4D9BA 3ZI7A 3BMQA 1RWBA 2F90A 1FLNA 3GCZA 1M7BA 5CD9A 2Z5FA 1M5RA 1M1YE 2W4QA 5EFZA 3K1ZA 3RC3A 3UAZA 4RPHA 4ALJA 4I0WB 1WZUA 1ZIDA 4X62H 1EGQA 2FXIA 2I2BA 3GK3A 4GQBA 5KSPA 1U6JA 3B12A 3OI7A 5E3HA 2VJAA 3C14C 3C6ZA 5EYPA 4F6CA 3C1AA 4KOAA 2XCRB 2AQ4A 2VA9A 1BQEA 5GADl 3L04A 1ZN7A 2RHOA 4KE7A 4TTJA 1SCAA 2EP8A 1O0SA 1A8IA 4XB1A 1BVUA 5ALHA 4FOLA 4TVKA 2A8YA 5JS7A 4IXNA 3GLIE 3C74A 4S35A 4QDOA 2GZDA 5JZOA 3I0NA 5K05A 4R8RA 1ZRMA 2OCGA 2QI9C 5GPBA 2ZYWX 1I36A 4QASA 2EKQA 1DO0A 4QSMA 2CW7A 4WHMA 2PBFA 3FPJA 3LM8A 2JGNA 3JQCA 5K6RA 4K9NA 4QUDA 4JV5B 2ZRJA 1PZHA 1RAFA 5DCWA 4QM6A 4YPFA 4B80A 4M3NA 3NNDA 3D4IA 3GLHE 3NIWA 4LWZA 1XRPA 4NFYA 4D3ZA 2WJ3A 3GRFA 1BE1A 3DBRB 3WKDA 3AIKA 3KQOA 2ORIA 5CTAA 3JD2A 4O3OA 4D9JA 4EQZA 5JNSA 3IC5A 3LX6A 3D6TB 3JTMA 3OWXA 1G7TA 1YIOA 4L4ZA 5ESRA 1OLOA 1OIWA 2O3UA 1IATA 5FD5A 4CDMA 1LB1B 2G5GX 1FJGB 4QTYA 3PTAA 5DLYA 3M4ZA 4LJLA 4LE2A 3ME5A 2ZE5A 4X84A 2BSXA 2HK9A 3PW4A 5JMOA 4IHJF 2FWJA 1EWTA 2LIVA 2JA5G 5B3LA 3QK7A 1R0CA 3WJ1A 4EUKA 2F59A 3K3VA 2WA1A 1R16A 3CMCO 2WU4A 2NU9B 1NJSA 1NW3A 2DU8A 3PDCA 4TOIA 5CLIA 5T3YA 5GVSA 4LKOA 5DGTA 3WWYA 4EKIA 1TK2A 3QX8A 5DLEA 5K8IA 3ELBA 1TJ4A 2NPIA 4FQ7A 2I3GA 2GDZA 2EJUA 2NO0A 4FLMA 4G86A 5IXJA 2ACEA 2OQIA 4Q4HA 4EUNA 1CUUA 2O8VA 5IJ9A 2R6JA 1VKZA 3EVZA 5ARDA 2O6LA 1YR1A 2HDHA 3MWJA 1NVFA 1E2HA 4MCIA 2FJPA 4WESB 1JHAA 2OY0A 2R6ZA 2VI5A 1EFTA 4G2NA 4S1VA 4A8PA 4CHIA 5KT4A 5BYAA 5JCOA 1CE8A 4KACA 1GSHA 4QXQA 5C5IA 1YJXA 4ZRDA 3V2UA 1QO0D 3KYCB 1PSDA 3ZZTA 1QQAA 4OYLA 3G1UA 4RMGA 4XPIB 4C06A 2PUBA 4G0WA 5DGIA 3NMUF 1K6JA 1UXJA 1RE0A 1G8KA 4JX8A 2AR9A 4IF6A 4Y0AA 2OOSA 1EFUA 2JB9A 1ABEA 3GELA 4BN5A 1UKCA 1OR8A 2GZ2A 3K0KA 6Q21A 2I29A 4JB0A 3LPCA 3AL3A 2BR4A 2NO5A 5HKKD 1PV4A 1FFHA 1GU1A 1SC3A 16PKA 4RVOA 5KT5A 2Z6QA 5DYNA 1SQ0A 1XCJA 2AOTB 4M87A 4QHSA 4EFEA 2CE2X 1OAOA 2VKTA 2RJ3A 3L0DA 5BP7A 5F7OA 2HHLA 4M21A 4ER7A 1CQXA 2F43B 2O1WA 4HUQA 1UAGA 1XL1A 2VA2A 3DAPA 2QG9A 3EMBA 4JIMA 5FPSA 4EKGA 4YUZA 2J3HA 5KEIA 2CD7A 2FWMX 3LSYA 1LJUA 2NWQA 1DC8A 2FA9A 3E9MA 3KOMA 3C3AA 1HWYA 4LSAA 3BA6A 3ESAA 3A4TA 4UHJA 3UOGA 2MYNA 2GPJA 4D2IA 2YJ6A 4CDRA 1XKQA 1A2KC 5JAPA 4GLWA 4YJHB 5KTTA 5L4LA 1SIOA 1XHFA 2Q9CA 1XVLA 5FNVF 1H93A 2FH5B 4TV8A 5FFNA 3B36A 1QIHA 5FUBA 1M2KA 4L0MA 4NZYA 5HFAA 3ZGVA 4HWTA 5EMKA 4BNIA 1KVRA 3KQUA 4GKAA 4E13A 4B3CA 2Z6AA 4ENUA 4DL2A 3WNQA 2R84A 3QXXA 2R93A 1CC1S 2CLKB 4XVRA 4YUAA 4JUZA 1H5QA 2G9RA 5F64A 1J97A 1D6SA 4UBOA 1VRVA 5LYJB 1OI2A 3N41B 2M6SA 5JMTA 2WBLC 4V24A 1WABA 4FB4A 4C30A 1U94A 1NNUA 2MCTA 1USVA 2IYXA 2NAPA 4RORA 1R15A 1M9NA 4WQMA 4OQNA 3TRJA 5JAOA 1AVTA 1HFWA 2G9QA 4R5MA 3SSAA 1SUFA 2YHAA 1GKUB 2VH5R 4MB2A 5JYEA 4YRCA 1GCAA 5I9SA 4Y6LA 1IWOA 4KRXA 1PT9A 1GVNB 1L5KA 1XZ8A 3O94A 2OGUA 2IF0A 2H3HA 1Q3KA 3Q40A 3WLKX 3U7GA 1RK6A 3UMMA 4YAJB 4JV0A 4Q12A 2GZ1A 1TPZA 3KXLA 5KFYA 1IL0A 1JXOA 2J1LA 1CVRA 2XOEA 5FI3A 3QG5A 1Z6XA 4CKCA 2GN6A 2PL5A 2PRSA 2H2FA 1KP3A 2IYVA 3QKUA 1YKSA 5DBIA 1NG9A 2VSOA 3E4DA 3G5UA 1H6DA 3VR6H 4O4LA 4AYBA 3KVRA 3WNBA 3ZH9B 4AKSA 4ZGBA 1QBGA 1I4TD 3M6FA 3CLRC 10MHA 2FSGA 1UNNC 1VCIA 3L4BA 4OHZA 3GBVA 1PGJA 4YJ2F 2AVDA 1Z2NX 1J23A 3CIOA 3DFKA 2JF0A 4D96A 3ITDA 5ES3A 5E1MA 5JQGB 4XSGA 1JNYA 3RVJA 3ISJA 3DTNA 1DE0A 4NECA 2O2SA 1HY3A 1SFRA 3DE7X 5SZIA 4KXUA 1KFCB 1LS1A 2GVZC 2WWTA 1R8XA 5J2TF 3G49A 4MV9A 1UMDA 1R1DA 2I4IA 2VF2A 5K2MA 2QUKA 2ZJ1A 3HFRA 4IMJB 5EKDA 5L51A 3VGPA 2GAAA 3AR3A 4IY1A 3QHPA 1Z5OA 4MWZA 4YDHB 4ZP1A 1XEAA 1Z6GA 1RDFA 1SHUX 2FSFA 1FUKA 1M2VA 4JBHA 4O5AA 5LZ7A 1KQGA 4X62B 2RGRA 2H7VA 3EVTA 1VFPA 4FZ5A 2UXDB 4MZXA 2DWOA 3F97A 5JNWA 4MI1A 3QKTA 2JAUA 2NOAA 2I87A 1ZNWA 3MGGA 3OFKA 2R96A 4BVAA 4FYKA 3CLUC 4JJAA 4IIJB 4EL0A 5JE8A 1FNBA 4JODA 1XTJA 3UJ6A 5LD2B 4U7TB 3GGJA 4DY4A 3OP4A 3PC4A 1XYGA 4M1MA 1SXGA 1ESCA 1MB4A 2NTEA 3GVCA 1I2MA 4TSRA 4R41A 3VRHA 5LWHA 2C7RA 1W2GA 2OZLB 2VNSA 2VOJA 4J4BA 2HIXA 3AGPA 4BAGA 4E46A 4XA8A 2PGJA 5K3EA 4LDRA 3V7UA 1RJGA 3O8OA 3PZPA 4WOCA 5IP9G 4X1IB 1UC9A 3GFOA 2VPSA 2A0KA 3RAJA 1V6SA 2CHQA 1Y8ZA 1ULZA 4G0UA 4CL0A 5LKAA 1RZRA 1SVNA 3A0RB 3AEUB 3HYRA 1E1MA 4W1QA 3MWMA 1KH2A 5JQGF 3RT9A 4BMVA 5A5FA 3NWBA 1DV2A 4TXLA 2YZKA 5EHXA 4DG9A 2CL5A 3PEWA 1PRYA 4W9RA 4OX9Y 5FF9A 1PVOA 3FMVA 4H6VA 4BAZA 3KQWA 4KV7A 4EABA 3EOZA 3EVDA 4LHWA 2ASDA 4HTAA 4DMUB 1E6LA 5ILQA 1Y8QB 2IZZA 3CN9A 1PFKA 4L5IA 4WA7A 2CZGA 2QVCA 2YRWA 2VAXA 2BPOA 4YRTA 1T2EA 4LF6H 2Y4NA 2HCBA 3T3NA 5DN6A 1QIDA 4KZPA 5JCXA 1DAAA 3MERA 3KPUA 1PZGA 1X80A 4V03A 3G5LA 1WR8A 2VH1A 3R41A 1UKAA 4G9GA 5LQUA 3EASA 3G9UA 1XZDA 3GWZA 1B14A 1OBOA 1QWOA 3W6UA 3ZD6A 2CMGA 2FPGA 4BIIA 4LF7H 1T9GS 3MWGA 3OOEA 2AJTA 5KBYA 1PP4A 1HDRA 1RRFA 5HJ5A 4YAJA 4DXDA 4WDQA 4R1TA 5AKLA 4BKOA 4G0YA 4EGCB 1N3IA 1ZBDA 2CCGA 1WCXA 4LDQA 1EFRD 3CXRA 1B0UA 4C4SA 3B60A 1GV0A 4F92B 1V7PC 1M6HA 2IF2A 2QJFA 2QUHA 3ORSA 3VR5H 3TBFA 1UOQA 3DE6X 4QG7A 4KO2S 3ZHYA 1EUQA 4GKJB 4UREA 5F5XA 1QVRA 2AGOA 1ZD8A 3MRSA 1Z29A 1QGOA 4JNKA 2BH2A 2Z9BA 4LF8H 1RHUA 3BE8A 4D8VA 3TI9A 1R9TA 5I4BA 2ZJ5A 1A4IA 3IJRA 2BT4A 2QTBA 4OV6B 1YJCA 2QN3A 3QY9A 4G07A 2CD9A 3IUBA 4F1JA 2DB3A 5HW0A 1KFBB 3R7DA 4YT8A 4AJ2A 2R5NA 2OD2A 1YBMA 2SECE 3K73O 2ORYA 5D1OA 3A9UA 2IWRA 3V1UA 4DR5H 4CHGA 4DR4B 1PJ4A 1W59A 3B3JA 3HA7A 4I4TA 3L4KA 4OAOA 1I7LA 3QLUC 4EO4A 1S1CA 4R0MA 1CFZA 3UKDA 3H8VA 3Q3EA 4FEEA 3AVYA 2EL7A 1GSOA 3EYYA 2O07A 5AI4A 3K53A 3W2HA 2G67A 3DTVD 3G8AA 3LGSA 3MT7A 4BWGA 2KLHA 2OG2A 1Q74A 4G36A 3WMWA 1PGPA 2NZYA 2EFCB 4V2UA 1MA0A 5IT9W 1EFCA 2BW0A 3ADDA 1ECBA 3X1XA 3Q3GE 1VGQA 2I4RA 3FJYA 3HBNA 3JZDA 3UJCA 4O0MA 3QVGB 1XEFA 2FRVA 1C14A 4D9FA 3LKDA 3TRKA 1KIFA 1M1ZA 1OXTA 1ML4A 3BZWA 3KB1A 4IICA 4PCUA 5BW4A 5JH7A 1G5RA 4QUKA 4EHBA 1M2WA 1OLUB 4XWKA 4KNVA 1FE8A 5C8YF 5D1NA 4I6JA 1HFKA 4IWYA 2VQFH 5KAMA 3WQSB 3EZFA 2IOYA 3KTAB 3B1ZA 9LDTA 2QZ4A 3LZ6A 3HCWA 3GI1A 3SC6A 2ZKLA 3K30A 3UAVA 4RD3A 4QKQA 4AJIA 3BIWA 1H6CA 3A58B 1WPQA 2LBPA 2J9FA 2Y1KA 2Z1DA 3LDGA 5I45A 4CLEA 4CIAA 1FW8A 5EJFA 4BFUA 1W96A 1POWA 5EJAA 3HWSA 3L82B 1KEZA 3M3HA 1SVUA 5EL0A 5B3JA 3T5HA 3HKDA 4QGGA 2D54A 1R9MA 2ODEA 3OD5A 1O96A 2V6GA 2VPXA 5CNMA 5F5LA 4GWLA 3PW0A 4IJ6A 2HGXA 1U0NA 4X1OA 4IVNA 4B3MB 2LXNA 3C3BA 1T9GR 2ACWA 5EIBD 1G20E 4GI1A 4F11A 1LV8A 1AZWA 3ONNA 5F1PA 4QBKA 1G21B 2Q07A 4L2IA 4ABTA 4UNSA 4RTMA 1HMPA 2P9FA 1BAPA 1AKTA 1XTKA 2HV9A 4HFJA 5AKGA 5ALMA 1XYYA 2YOFA 2XMZA 3UUEA 1B74A 5B12A 4YAUA 1IBMB 2YYYA 3P2JA 5KKCA 1FJ2A 2B3DA 2IYTA 4J9VA 4JOBA 2ZYGA 3DCIA 2NZUG 1R4MB 2FSVA 4GE0A 3RYCB 2DERA 2IZ0A 5IBQA 2CXUA 2R4TA 3TIVA 1NFQA 4NS1A 4U0KA 2PO5A 3F67A 3NV9A 4G1BA 4R6XA 1A8PA 1GLVA 2DPJA 1S68A 1CUEA 1Q7EA 2DUJA 1AK9A 3EXFA 3IJEB 3AFIA 4QUIA 2BZ0A 3TUZC 1E8DA 2KS6A 4FDUA 5A0TA 3FYUA 1OWNA 1V7CA 3CEMA 3LQKA 4U4AA 4EECA 2EYUA 2JLRA 3WS7A 1Y3HA 2DTXA 2VCYA 3DWFA 3IIEA 4FDMA 2NSJA 1D6JA 3MTIA 5MDHA 4MUEA 5AQ1A 1RPJA 2Q0HA 1AT1A 3CSWA 1BN7A 1NL3A 2XOXA 3AFMA 1Q1AA 3F46A 3KZCA 1H2RS 4N7BA 4P98A 3KD2A 1CQIA 1W5TA 1Z5PA 2BCGY 1IQ0A 1IN8A 4JZYA 1K1EA 3RS0A 4RVCA 1Z56C 1M83A 1II9A 1XO1A 4NF2A 1P3DA 5THXA 3SZMA 4DMHA 1ENYA 4WA8A 5BPFA 1A2QA 3U6BA 4Y98A 1T5DX 2C04A 3QUBA 4LSZA 3KLNA 1E1LA 1SG9A 2NV6A 4ID9A 4ZT4A 4RK1A 1QMPA 1L1FA 3SSMA 3W7BA 3HVRA 1RXWA 2Q3MA 1CKEA 3QWIA 3PSHA 3WMRA 3FPEA 4Q1CA 2ZUUA 2GBLC 3EFOA 3ELUA 4KQWA 4XX1A 2NVUA 5COAA 1FVHA 4QBFA 3O03A 4Q9DA 4Q24A 5EWJA 4YJ2A 2Z04A 2R8BA 4K88A 4G4GA 4N3NA 5DRYA 3ZNPA 4EUFA 4DT1A 1PAUA 3VNUA 4B8ZA 4Q0YA 4D4GA 3RUIA 1J06A 4OIFA 4FGWA 4OHMA 5CNIA 3BFJA 4IO0A 3ROQA 3RSFA 1NI3A 3QTLA 1O9BA 4F4HA 5AVZA 2AJBA 3I72A 4TL6A 5CLLA 2NVYA 3N0TA 2V59A 1M2OA 3IQEA 4WUVA 2QT0A 3Q15C 3VHXA 5EXTA 3WBJA 3KG2A 2ZIFA 2BFFA 3S2FA 1BXKA 1L9XA 1GZ5A 3BK7A 3H2YA 4MKHA 2ASEA 2XDQA 3UWDA 4U5XA 2FPPB 4CM6A 1GZSA 4OA5A 3UYYA 4QAJA 1AURA 4IUDS 2WM9B 2F67A 1AQUA 2W5UA 4RPGA 4AO8A 4DWVA 5BVHA 4GL2A 1S0UA 3KZKA 2HQRA 3MCUA 4AMVA 4DMCA 5KOHB 4LV6A 1BOFA 2ZZMA 1GIAA 1KEVA 2H7XA 2AG6A 4XQ9A 1IQPA 2EVWX 2O48X 4ED6A 5KKNB 1BXGA 1PJBA 1PKXA 1J7JA 1UJ6A 3OLVA 4TS3A 4CV0A 2C5EA 4LYFA 2WIAA 1FYVA 2CMKA 2GTPA 1KQPA 2BOVA 2J09A 1XA4A 5E2AA 1HE2A 3R3ZA 4DJ5X 2NLOA 4OGLA 1QB7A 4WDRA 4V1CI 1H1TA 2QRVB 4EHFA 4Y3UA 3I92A 4RDXA 1HM5A 2ID9A 4KR0A 1V16B 1TECE 3KTDA 4IUBS 4EG3A 4XB2A 1N6KA 1IY0A 4R8MA 4EHDA 3ZVLA 1NPDA 1QOQB 3NANA 1FFXB 2I9PA 3GV8B 3GD7A 4IMPA 1R12A 6YASA 4IHKA 4OXXA 4DRFA 4F84A 1EJ6A 1UKYA 2FAXA 2JBAB 1U9IC 1VG1A 1ZNZA 4Y0VA 3U60B 3BX1A 1SB8A 3TR6A 1JE0A 1BJKA 3H5NA 1QIFA 2VTVA 1VYTA 3F5SA 4OTZA 4TYPA 2WJHA 2WKQA 3A4YA 3REQA 1JHMA 5CDUA 3NOVA 2CEAA 3LWNA 5K0NA 1NM5C 2QU7A 3GMIA 4IP0A 2PXXA 3A3PA 8ABPA 2JA7G 3KDPA 3PW7A 1DC4A 4UUGA 5BWWA 4E5YA 5KSYA 1FP6A 4L5AA 2G5PA 3C97A 3W5VA 3K09A 1U1GA 4P80A 1ND5A 3OHBA 2YIJA 3TF5A 4H2DA 3C6KA 2ZS9A 2E85A 2IOQA 1E59A 5LJLA 2B36A 1Z73A 4JJZA 1IK6A 3AUTA 1E7SA 2QQ0A 3P9CA 3PITA 1Z0AA 2Z5VA 4NAUA 1WLYA 1DFHA 4QJ5A 4RBNA 3W3AD 2CHFA 3K8QA 1UBCA 2XCPA 3M4NA 5FB3A 2AG1A 3NGMA 2I6QA 5IBRA 2O8EA 4O7RA 2WA2A 3NJRA 4ROSA 4DLZA 1QQBA 1Q0ZA 2H29A 1E2PA 2HV8A 3I61A 5TT1A 4XIYA 3PC6A 3F6RA 2ZUEA 4MQUA 5K3WA 3GDOA 2V74B 4OEHA 4X24A 4IGKA 3G2HA 4CCSA 5DK4A 4CKYA 3EULA 2IV3A 3ZWCA 3G79A 2AI3A 3S5UA 2V7WA 4CG3A 5AKZA 1B76A 5BSVA 2PWYA 1E2LA 4BX2A 2HSZA 1YZLA 2NUTA 1M74A 3WJ7A 4FYMA 4RZXA 1VIMA 5EWLA 5FEUA 1HO3A 4HC4A 4W4TA 4EELA 3H2HA 4PR0A 2P6OA 4ETWA 1BW9B 2OH2A 1Z3IX 4D9CA 1VJ5A 2CNKA 3F90A 1C4XA 1R0XA 4OGGA 2B1GA 1OZ0A 4Y9UA 3LQYA 4RSMA 5LSAA 1XVIA 2JIZD 1E9VA 2IU4A 2WILA 2PRIA 4MINA 4PZYA 2QLBA 2ZITA 2W2NA 4W8GA 4WN9A 4YYEA 1WUTA 5BMOA 3AJ9A 2COEA 4CEJA 2WD7B 3FSGA 3VNAA 1CZRA 4P4LA 2FEKA 4JGIA 1L8QA 3KDSE 4DYDA 4PSCA 3VR5A 5KU7A 2A84A 3NKLA 4XW2A 4D4LA 2HJVA 4QIHA 3A6LA 2DY0A 4L6CA 3VR2D 4OHKA 1E2IA 2GI4A 5MGNA 2P3SA 4TLLB 1R64A 1MB2A 4YONB 1ZESA 3DYVA 1T8TA 3CO5A 4LWPA 5AK0A 5TJHA 4DLPA 4E7OA 4FCWA 3AJRA 2D00A 3KUXA 4INOA 4YV7A 2CXTA 1T5SA 1NMEA 4LF8B 1DVRA 3KR2A 4I4TB 4PO8A 3WK8A 1PGOA 1V8OA 3GRUA 2MR5A 3D4OA 4LHYA 4YYZA 4EX7A 3IEXA 1SUCA 4IILA 1KQNA 1U7XA 5DYYA 5EKUA 1X8XA 4BO4A 4C05A 2QN2A 1JDEA 2EV9A 1YMVA 4K0KH 2ATIA 1B15A