5K2MA

Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
273
Chain Sequence
b'MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RimK-related lysine biosynthesis protein
publication title Lysine Biosynthesis of Thermococcus kodakarensis with the Capacity to Function as an Ornithine Biosynthetic System.
pubmed doi rcsb
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Biosynthetic protein
total genus 88
structure length 273
sequence length 273
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 5k2mA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5k2mA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k2mA01
4HR7A 3U9TA 4XYLB 3WO0A 1JLLB 5LXTF 4E4TA 1EHIA 3BG5A 3K5IA 1CE8A 1KBLA 4EGJA 3Q1KA 5JQWA 2PN1A 1VKZA 2DZDA 2W6ZA 1UC9A 1T36A 2W6QA 5LP6F 3JRWA 2YZNA 5I47A 3V4ZA 4XYMB 2C00A 2V5AA 2W70A 3QFFA 4M9CA 4O4IF 2W6OA 1B6SA 3LWBA 5JVDF 5JH7F 4RZQA 2W6PA 5JVLA 3V4SA 3HB9A 2FPPB 3K3PA 2W6MA 1GGOA 3AW8A 2YS6A 4MAMA 4MA0A 4O4LF 3JZFA 3G8CA 1W93A 2R84A 5CAEB 1DV2A 1BXRA 3WNZA 3ETJA 1JDBB 1I7NA 1A9XA 2V59A 2R6FA 4M9UA 2QK4A 2DLNA 2GPSA 4TV9F 3BSSA 1VBHA 1SCUB 2XCLA 4YBZB 2FPGB 1KJJA 3VPBA 1M6VA 1E4EB 5DMXA 2P0AA 4GGMX 2OLSA 2YZGA 2ZDGA 3U9SA 4EA7A 2R7KA 1KJIA 3MJFA 3TIGA 2FPIB 1GSOA 1GLVA 4O2AF 4MV7A 3HBLA 2IP4A 4MV4A 4MV3A 1AUXA 3JZIA 3R23A 3VOTA 1IOVA 2ZDQA 2CQYA 2PBZA 4HNVA 4ZHQF 5IYZF 4XX0B 4FU0A 2YW2A 3RFCA 3RV3A 3WO1A 4XZ3B 4I4TF 3VPCA 4HNTA 1DV1A 5HV6A 5D8DA 2R82A 3AX6A 5C8YF 1JKJB 2VPQA 1KC7A 1WR2A 4C5BA 4EGQA 2FP4B 3MWEA 4DLKA 3BSWA 1CQIB 1IOWA 3OUUA 2DWCA 2DIKA 2PVPA 3VA7A 2CZGA 3R5HA 2YRXA 4EG0A 1DIKA 4M98A 3I12A 1EUCB 3HO8A 4YJ3F 2V58A 2YYAA 3R5FA 3TIIA 5LYJF 4DIMA 2J9GA 3GIDA 5CB4F 1KJQA 1AUVA 1KJ9A 2I87A 2R85A 1B6RA 5H80A 2YL2A 2QF7A 4WD3A 3Q2OA 4MV1A 2NU6B 3LP8A 2YZMA 1I7LA 4Y8VB 5KKNB 3TW6A 3RUPA 2W71A 5EZYF 2R7NA 2Z04A 4ZI7F 4I50F 4MA5A 3VPDA 2NU7B 1KJ8A 4EA9A 4L1KA 2NU9B 2GLTA 2GPWA 4HNUA 3G8DA 4I55F 5CA0F 2I80A 3GLKA 3OUZA 4WBNF 1PK8A 3R5XA 3VMMA 2W6NA 5HBRB 1CQJB 1CS0A 4YAJB 2R86A 1GSHA 3BFPA 2NU8B 1BNCA 3MWDA 3UFXB 4ME6A 1JDEA 4ZQIA 4IZOA 4O2BF 2HJWA 2X0SA 1W96A 5J2TF 5BPFA 1GSAA 2YRWA 4TV8F 2VR1A 5LOVF 4YAKB 4C5CA 3N8DA 3TINA 2NPOA 1PX2A 1KEEA 3ORQA 1ULZA 3TQTA 4IWXA 2ZDHA 4J6EA 5C1PA 4EAAA 4YB8B 2VQDA 5KX5F 5BMVF 5K2MA 1EUDB 4C5AA 2YS7A 1E4EA 5LA6F 1UC8A 1C30A 4O4HF 2SCUB 5BPHA 4HQ6A 3K5HA 3BSYA 4TUYF 2NUAB 4IHJF 2FB9A 2R7MA 4ZOLF 3JRXA 2VHEA 4MV6A 2R7LA 4YJ2F 4M99A 5CA1F 3ORRA 2XD4A 4EABA 3RV4A 2I8CA 1C3OA 1VBGA 3E5NA 4IWYA 4MV9A 2R87A 1EZ1A 3SE7A 5J2UF 5C1OA 3ETHA 3N6RA 1EYZA 4MV8A 4QSHA 5GONF 4EA8A
chains in the Genus database with same CATH superfamily
4HXGA 5L4NA 3I0ZA 1SBCA 2H2FA 3TECE 3ZTTA 1NI4B 2VSYA 4LFAB 5C53B 3EXEA 3RYCA 4HDSA 3NFRA 3DW3X 4NLLA 3S27A 4LJYA 3RBXA 2C42A 5G53C 2NO9A 3K94A 3VO8A 3F9CA 4INOA 1P2FA 4Y2QA 1AS0A 1L5LA 5IDXA 1I5OA 1TTHA 1NW7A 3K2BA 3FXAA 1PWHA 4Y6GB 2KS6A 1AV7A 2QT9A 4NEQA 1WB5A 1VJDA 221PA 2C2KA 2QL7A 3ZTYA 4BMVA 3WDKA 3CJTA 3AV0B 3P2IA 4D4JA 3VR6H 4BNTA 2IYXA 2HO4A 3ZHRA 3WYEA 4O8ZA 4BVFA 1JVBA 4JEHA 3KQWA 2P6MA 2RH9B 3KEQA 3OQ6A 4G9BA 3NWBA 3I6YA 3Q9SA 4IZ6A 1B26A 1C81A 2C2HA 4AIIA 1K2WA 2OLSA 2H8KA 3WKAA 4UEKA 2WSYB 4EA7A 3IS3A 3BMCB 3DAAA 3PJRA 4WVFA 3J80A 3P9PA 3PFKA 1Z0KA 3WKCA 1O94C 5CBKA 3DLBA 5KFIA 1OFVA 2HMUA 2JCYA 2IP1A 1EDZA 1TVCA 4JUZA 4O02B 4O2RA 3U3KA 3VR6D 5I7FA 1W34A 2FLVA 1N8TA 4FUTA 4UKDA 1KDZA 1V26A 2ZUEA 3I05A 1HR0B 4RMJA 4GLXA 4C6RA 3R0JA 3L1VA 1MIOB 5K0EA 5H3HA 2E4AA 1AKEA 4MUNA 3AETB 5FIUA 1V7PC 5B1DA 4ABTA 2HAEA 1BD3A 1JFFA 3BMNB 3UXMA 4Z49A 2O2HA 3T5TA 1RAIA 2DIKA 3JQFA 2LNDA 3WRYA 1J6UA 4RVHA 4DNFA 3WQBA 1SUCA 2Q5CA 2GD2A 4RJIA 1A76A 2E85A 3AXSA 4R2HA 4MKZA 1N6OA 5E3JA 4LZWA 5ALGA 2NXWA 1J7JA 4XUGB 3TY5A 5DX0A 2DPGA 3CZ4A 3CF0A 3GIPA 2G04A 4Z3DA 1U6KA 2VBIA 1JEDA 4D9JA 5EZYF 4ZI7F 3GFFA 5EIOA 2I2WA 5L1LA 5BORA 1FMFA 2ZVQX 4J0FA 4QQ8A 1XK5A 2OESA 1O95A 3NH6A 3ACDA 5DCUA 1RKUA 3I37X 1QNFA 4JT2A 1PZHA 5HZGA 1JR4A 1QDUA 4FHGA 3W3AA 1JAXA 3ZU2A 5IKXA 2YWJA 2VJKA 2JA6G 2P3SA 2WU0A 3U40A 1A95A 5BWXA 3RC3A 4KAXA 5BSWA 1KIFA 1GQSA 3RW9A 2NZJA 2D1SA 1AKYA 3EYAA 2R8JA 3O03A 1CUEA 2IK8A 2RGWA 1GYQA 2P9GA 4L5JA 4P36A 4I19A 1LLQA 3EVDA 4G07A 5IT0A 2AGOA 4Q7MB 1GV1A 2B8NA 3QHQA 1E96A 2R97A 3IP8A 3ROXA 5IC6A 4EEZA 4GP6A 4FILA 1K2VN 2FH5B 2YWCA 1ZSYA 3MWEB 4ALMA 5AESA 1BE6A 4DMHA 4FZ3A 3AHHA 2Q29A 3D64A 4BBRG 1DBQA 4J0EA 3TSCA 4XJSA 1AUOA 3A6FA 1E64A 4YUZA 3DL7A 1D4AA 3CKLA 4GPZA 2DPMA 1Q7GA 3ZGLA 3M5DA 5BXYA 1RHQA 4ZA2A 5K4HA 4JOBA 3EIFA 2DEUA 4RXUA 3N2KA 1F2DA 1JDNA 4PY2A 3AEUA 2GO7A 1IHUA 1P6XA 3SMQA 3UJ3X 2H18A 4A36A 3TNFA 2VK8A 5JQGF 3QV2A 3DSRA 4CQMD 2X19A 2ZUUA 3VUFA 2XPCA 4UHFA 2BGKA 4OQFA 3BDVA 4R83A 1XVAA 3KQSA 3WQHA 1SIBE 1CKNB 2GYYA 3RB8A 1SHTX 2XVAA 3HWX1 1CZKA 1T9ZA 3PE3A 1ZETA 2WWWA 1WZUA 2C58A 5I9SA 1P1IA 1EUQA 4DIDA 4DA0A 2HV8A 1P6UA 1JWLA 4EEYA 3U48A 3WY9A 2O5EA 2O5CA 3CE9A 1Y8QB 4RSHA 3NHJA 1XEXA 1X92A 1FSZA 4AL4A 1XTJA 4MWOA 4JLUA 3LVBA 2P4EA 5KNBH 4QWWA 2BGNA 2QY9A 1YR1A 3FOEC 3ZV7A 4UAJA 2IU3A 3CJQA 1WPGA 4DLBA 3G8CA 4UXHA 4GQAA 4JYBA 1JZSA 5L4SA 1G2WA 4IP0A 1V3UA 3ETGA 1JILA 1EK2A 5EJ8A 2OK8A 3GMDA 2FMTA 4C6TA 2QK4A 1TWFA 4JBXA 4P22A 2WYUA 3UQ8A 1BMDA 4B6QA 3KTDA 3F5MA 5FUMA 1OJ7A 3R9WA 4XEUA 3O8RA 5KNBD 5FWAA 3IP9A 3EUFA 2WIBA 3U9SA 3R9XB 2XXBA 1ZHFA 3LG2A 2BT4A 3ROEA 3TEJA 2D1RA 1R66A 1CUFA 2ZR7A 3UFXA 5CW2A 2IZ6A 2CDBA 2XMDA 3A1UA 1T2DA 4EY7A 4HYKA 4ILEA 5IJ9A 3L04A 2WJGA 2PFGA 2AYYA 1P91A 1KKMA 2KLBA 2H7VA 1KHTA 3EZFA 3HL0A 5KFGA 3HLTA 3RSQA 2O2CA 2X7XA 1KC7A 1BH2A 1E2UA 3OPQA 3WL5A 1BIFA 5L3QA 1KQOA 3B6JA 4ZPXA 3V8MA 4IDHA 5M29A 3QW4B 4JCCA 2ADOA 2EKPA 3AP1A 4YT5A 1NUHA 4L74A 4ERNA 3A06A 1XEFA 1G8HA 3DMDA 1DT3A 3KFVA 4W7SA 3BCHA 3MXTA 5JASA 2V4QA 5KQSA 3X3HA 4YJDA 1NMZA 5CB8A 1G6OA 6NULA 3TGLA 3K9CA 4MJXA 2B4YA 4Z7JA 5B6JA 1K8YB 3GYGA 2HK8A 4X66B 5HK9A 3TLZA 3M82A 5BQOA 2W71A 5ALLA 3H9JA 1KWGA 1XYYA 1GPH1 5D3MB 5I01A 3D0KA 5FX2A 2IHUA 1KYQA 3PW0A 1BVYF 1T5LA 2R8PA 4GOXA 2EL9A 3PEYA 3HZOA 2QYSA 3H5LA 2Z08A 3S0JA 2VTBB 4LMPA 4CEJA 5ENZA 1HDCA 3SEFA 3MB8A 5FFFA 3KYBA 1OT5A 2P91A 2O3JA 4TYMA 2V8BA 1RAGA 1II0A 1AHHA 1E3LA 3RU7A 5BOVA 2BJWA 2H17A 5E9QA 4N7MA 2O3TA 1VJTA 3Q0EA 4MW0A 4KQ6A 2ZBFA 2XB9A 3JSAA 2SKEA 3CLKA 4B3XA 5FD8A 4GWGA 2HUNA 1N34H 3JAKA 4ZVPA 1IBMH 1U0NA 2R68A 3I1YA 3K05A 4UNPA 2YXDA 5ER6A 9LDTA 1D0SA 1PHPA 2YIMA 3DP7A 4Q9KA 1I32A 3P1JA 4OQDA 1H42A 2FRXA 1TU4A 3IR7A 1DP4A 1ZN8A 4IXDA 3AEKB 4C9BA 3VNUA 1K8XB 3G13A 4H77A 3A7DA 4ZDWA 3TQSA 3KYJB 1LGYA 3LUHA 5FUXA 4A6EA 3L8DA 5DGCA 5B58C 3G8BA 2ZYHA 1CUBA 2DWUA 3PXAA 3CF6R 2CL7X 2CLOB 4GKAA 2Y4RA 5LC1A 2FUNB 3CVVA 1JVNA 1JEJA 3DCYA 1FFXA 2HJGA 5CNIA 2V6BA 4HGPA 3BD6A 5ITZA 3TJZA 2J3IA 2J6BA 5HF6A 5ADVA 3KHRA 1JSZA 3F6CA 5FBLB 1JPVA 4IG4A 4JA2A 4WLEA 4NSNA 3EEOA 1TC1A 4CXMA 5ES3A 1PNVA 1UDWA 1DAHA 3IT2A 1Y6ZA 4WGFA 2FR0A 1L5YA 2QN8A 3TAUA 3T94A 1URPA 3KJQA 2QM7A 9ATCA 4TTTS 2OMEA 2JCVA 1FW6A 3T3NA 1QNLA 5FPHA 4F04A 4V1CA 1CY6A 1DRWA 5CGZA 1E2BA 1F2TA 2QRZA 2LR0A 1X6VA 1E1YA 2EZUA 1YRWA 2HIVA 3FZYA 4RHXA 5HK8A 4ZT6A 1HOTA 3STHA 2VPZA 3KJEA 1Z88A 1J5PA 3BE4A 2BJHA 1PF7E 5E7MA 2XMBA 2HTFA 1MIOA 4DCJA 4CKEB 1KJIA 1J7KA 4CL0A 3R4VA 4D92A 5KT3A 4JR1A 4NG4A 5JNWA 1SD2A 3M81A 2NNWB 1IOVA 3KXIA 3NCTA 3EWNA 1JJAA 4EECA 2EC5A 1UODA 2I62A 4OUKX 2I8AA 4YPVA 4EARA 4QM6A 1G3QA 4QUHA 3EGOA 2IYOA 1X0VA 4H6XA 3IT0A 2V7QD 4HAVA 3FUXA 2CNKA 2JEJA 4KGDA 2C78A 4HXFB 2WDZA 3SXPA 4BIIA 3BQ1A 5IZCA 3HBMA 4EG5A 3LY8A 4F12A 4HV4A 4ECUA 2ENWA 4DADA 3GLFB 4P32A 1TPZA 4G97A 1IOLA 3QPDA 3V46A 3D2AA 1UFRA 1HT3A 1Z6TA 4IDDA 5CFPA 1J20A 1VIVA 4LSMA 4EGAA 5I7HA 1YQUA 5DXJA 4U2FA 5AUOB 5SICE 1U2SA 1WCYA 2GMWA 5TVGA 1M5RA 3VKHA 3MRVA 3RYTC 1Y9ZA 1FUEA 4XVRA 4O3NA 5BT9A 1W5SA 3AI1A 2J45A 4WKNA 1RWOA 2D5LA 2O2DA 4ON9A 1ODLA 1QIMA 3CYFA 4EA9A 3G85A 3VDMA 3SF8B 1SWWA 5FNZA 1V1JA 2XW6A 2J7PA 4F38A 1DTEA 5JYEA 2IXTA 2H4YA 2A4MA 5I5UA 2QTTA 4HS4A 4MRSA 1OROA 2O3QA 2QG9A 4MW5A 4C04A 1Q12A 4YMUA 3MHTA 2GF2A 2QYHA 5C8ZA 3SYLA 1A7AA 5BSUA 1YUNA 2BY4A 5IK2D 3FYSA 2F62A 2X9LA 3ROMA 1B14A 3EQ9A 4L3WA 5IVHA 1U02A 1C3VA 3A4IA 4CYMA 3VI3B 1J56A 4CGYA 2FR8C 2DT5A 4RO0A 4N82A 2ZYVX 1PLLA 3TQTA 1BX1A 2WSIA 2IHZA 3I1JA 2R92A 3IEIA 4WUVA 1I7SB 3IIMA 4FTWA 2ISCA 1G9SA 3PNVA 2PL5A 3X1YA 5CLFA 2G28A 2WUFA 4NCAA 1TDJA 5KCMA 1B04A 3NHMA 4GMFA 2J4FA 1QH9A 5HJ7A 1XI2A 1ECGA 1DIRA 3BK7A 3BRSA 2BHTA 5ECWA 5BPHA 3A10A 1HRDA 3CJRA 3HNRA 3PK0A 3I0NA 1EA7A 4Z51A 4GOMD 2XGSA 3U1TA 2IUEA 2NT4A 1M2WA 1L4HA 2BGJA 4HYTA 4JQYA 5I4IA 3H04A 3IHKA 1TKCA 4BKRA 5GADl 1FU7A 1EWTA 4LXQA 5EIEA 4HQRA 1FJGB 1PFWA 1U4SA 1EGHA 4RB2C 5DM4A 3DEIA 2OCGA 3QSYA 1VBNA 5B1EA 1T2FA 5TX7A 2NAFA 4AUMA 1CE8A 5C3EG 1GDTA 1Y8CA 3E61A 1LDNA 3U09A 5AKJA 5BV8A 1IAQA 1RBZA 4DIFA 1ZOSA 4J0DA 1WW2A 4FFOA 2FUG6 2O0HA 4CFYA 1A5AB 2NUBA 2XEDA 1CV2A 1MORA 2F8LA 2EDAA 1SULA 1Y3FE 1YHNA 1P0QA 4MUFA 2NN3C 4JB8A 3NQ41 3MXOA 1N77A 4DL9A 4JR0A 3GRZA 3TMAA 4C03A 4TLCA 3R0QA 1Y1VG 3CXRA 4QVKA 1Q0ZA 5KG0A 3OE4A 2H7XA 3R9XA 1YJBA 5KWVA 3Q15C 3JQAB 3HVJA 3E7FA 3I9V1 2PR7A 4YJFB 3JVDA 2ZGIA 2ZYSA 4LF6H 4AYXA 3B3FA 2B63A 3H9GA 3JSXA 1OYYA 2AA3A 4P8RA 1QHEA 4AKEA 1HE3A 4X6XA 3PIDA 2AGQA 3MR2A 4LBYA 1L5OA 2VI5A 1NJ5A 2CVHA 4ZV4A 1MJGA 3K9BA 2BN4A 4UBKA 1G66A 5E6UB 3T5HA 1KZGB 2RKWA 3H6KA 1X42A 2NSJA 1ZLYA 3DHEA 3GPIA 4Y7CA 1XZDA 5IKEA 1B41A 4AFNA 2DCUA 2L19A 1IG0A 3VYTB 4I6GA 4D5GA 3IVRA 1R4ZA 4QEZA 3RDPA 4KMMA 4JL8A 4UXIA 1VSQA 5GY7A 3U3XA 1O94A 1BMTA 3FYHA 4DEVA 1I36A 3HMKA 4I4LA 4R8VA 3TD9A 1F38A 2V9ZA 1XDBA 3VPFA 4WOCA 4QRIA 5LQDA 1AKMA 1I0ZA 4RB3C 3KZCA 2UZAA 4HDKB 3OZGA 3HE3A 3U61B 2EW8A 2NUAA 5BQ5A 4C76A 1NXOA 4DL5A 4XFDA 3QE0A 3AF2A 3HBFA 4OI4A 4MVJI 1GAJA 1R0CA 4Q02A 2EZTA 4NV1A 1Z4IA 5DBOA 1PSDA 3DF7A 5CFMA 1ZD1A 1L5ZA 1P1FA 1P7CA 4KC0A 2E18A 4WN9A 4DLLA 1PJRA 3KB8A 3LUBA 1DWUA 4MLDA 5TR9A 4LV8B 3FY4A 3PZBA 2IYQA 2VTBA 1I3CA 2RH5A 4PV7A 3DZBA 1DAKA 2MOKA 2OVFA 3RF6A 2FG7C 4LF9H 4S05A 2NV2B 1VB5A 3FSGA 2VOBA 4YQEA 1JIJA 2FDRA 1YE5A 1MXHA 1O4WA 2W2PA 3CTMA 2JFYA 1R0LA 3WHLA 4IGFA 1DOHA 3SDSA 4BP8A 4E03A 4FDLA 3WMXA 4RFVA 1R37A 1BXKA 2JVIA 4TTSA 4R68A 2LCQA 4IRCA 4RVUA 4JJ8A 4WIAA 1EVKA 3TINA 2W9BA 1ORIA 4U02A 2NTEA 3KG2A 1BEEA 2QW8A 5E7QA 3VX3A 1J0AA 3A4MA 2PX5A 2OECA 3O0DA 2H57A 5KINB 1W0KA 1R3UA 1NAIA 2I2DA 4P4SA 4XB1A 2BKEA 2WUVA 5FFMA 4EFEA 5DF1A 5J58A 1DKMA 4MTLA 3TX2A 1JPNA 1ULAA 3OQJA 4EWLA 3P0IA 5DLPA 3ANNA 3AYHB 3V2GA 1RSZA 3ZK9A 4OXXA 4BVKA 1V6SA 3GIMA 2FN9A 5EOVA 3LQFA 1V2HE 3NWJA 1LDYA 2DE0X 3L6BA 2PTHA 1T5SA 3NM5A 2GXUA 1OTYA 4MWSA 3S2GA 4EB8A 5JCJD 2NO5A 3VH3A 2CJWB 3CE6A 4JXXA 3ETDA 4ZKDA 1L9KA 2B4AA 5K0JA 2REBA 4CCYA 4L72A 3PPXA 1W25A 3KKZA 1JG4A 2WMDA 1JLLB 5DGDA 1U7DA 1VCIA 2IEYA 4PN3A 2IV7A 2VA9A 2V45A 8ABPA 1OI2A 2J8ZA 5IYCG 5T4FA 2AR0A 3IULA 3GWZA 1AKWA 4M9XA 4FXPA 3HFGA 1JIKA 1V4BA 5EFOA 1K3FA 4I2NA 1CRPA 4HEQA 5C5DA 1DCTA 3R8XA 1MW9X 1V47A 3A6PC 3UNXA 2XE6A 3CMCO 3TPZA 1U4OA 3ZEAA 1PYDA 1J2JA 1OUMA 4MRAA 1CS4C 1UDAA 4MAFA 1NURA 1OLSA 4X66H 1EWQA 2W2LA 2NW6A 2DHQA 2CV0A 4CKCB 5HM8A 1EVIA 1PUIA 3KDSE 1GZHB 4IS2A 4I3HA 3Q3IA 3GP5A 5TQ0B 1Z2NX 1ZN2A 3EQ2A 1MUUA 2RHOA 3ONFA 1G21E 2GN8A 4YGYA 2D2IA 2BPOA 6LDHA 1L4FA 3DJFA 1Z5WA 4JP8A 4NE9A 4IW3B 5T4EA 1E66A 1W5EA 3TW8B 1QVAA 1C29B 2WV9A 4QBKA 1BSVA 3MMXA 1W36B 3SNKA 1PKXA 2BWJA 4CNQA 3O8CA 2Q9CA 4LRWA 1SPBS 3QELB 2WF7A 2XUKA 3RJ5A 5THXA 3QQMA 3RC7A 2P62A 5CIYA 1XZGA 3NRJA 2H2HA 4O4JB 2PH3A 3OFVA 5FB3A 3GLFA 2R82A 2FP3A 2YY5A 3B6EA 5CG2A 1DRJA 2IHKA 3HJHA 2FI1A 1S1CA 2B7LA 1PJ8A 3QVJA 3EZ7A 2P4UA 1Z7EA 3C3PA 3RHFA 4EUFA 2PRZA 4LX8A 3AR3A 5HF8A 3JTEA 5KMGB 3I58A 1T9CA 4ZT3A 3CNOA 1TC2A 1O9BA 3RYFB 4W5HA 3AT1A 2JIOA 3DB1A 4LWOA 2R751 5EY5B 5COBA 4B7CA 4UQLA 1K66A 4J4TA 1Y63A 1SQFA 1ZD3A 1HKUA 4BQPA 1PJ2A 3RG2A 2V1XA 4FQ8A 1ZVQA 4KITB 1T1GA 4P7KA 3LQ4A 3FUVA 1JQKA 4DY4A 1XZAA 2ODWA 3KDPA 1F0PA 4BLQA 2FPMA 4CVNA 3EPKA 1Y8AA 5IBRA 421PA 2IUYA 2NO7A 3FUWA 3OPYB 4LNUB 2I80A 3H5OA 3MTGA 3RUHA 3K73O 4M0CA 1O87A 1ZD9A 2VNSA 1P74A 5AW5A 4DR6B 4LJ4A 5DDIP 1VC2A 4ARIA 1TQ6A 4BPRA 1EWYA 3LLVA 3I6ZA 3D6TB 1ZAUA 4LSXA 5CFZA 1LBEA 3IKJA 4XW2A 5EPEA 4F2HA 1I4WA 2D0PB 4RNOA 1SXQA 4OHXA 2VC2B 3HDYA 4RJLA 3WHPA 3ESRA 3AOGA 1QCYA 2ZVJA 1YA4A 3B6KA 4KQKA 1D9XA 2GK3A 4Q1FA 5REQB 1QH8A 3PHIA 4J16C 3BJMA 5DRTA 2GBPA 2D2VA 3C3DA 3Q7PA 4PLYA 4QGBA 3PX3A 4WINA 4KRFA 4ZPJA 3SKVA 2QVBA 1ZA2A 1E8NA 5JYBA 4GYJA 5DXAA 3RPEA 4ZVVA 4OKSA 2PPVA 3WSVA 3AVUA 4JK3A 2BEJA 4UTOA 4RF3A 4CHTA 1SHJA 1AHIA 3KO8A 5EE1A 1NY5A 3KYCB 2BFEB 4L3OA 4AO7A 4EITA 1XLVA 1DQPA 4EPYA 3D2CA 4PDBA 5CTJA 2G9VA 3O8NA 2BEUB 4Y9UA 1Y1TA 1R9GA 4CLRB 4KO8A 3MJCA 4A3CG 1A3CA 1W76A 2HD4A 4BX2A 3IUQA 1FRZA 3CRW1 5A3VA 4R0NA 1XCJA 1IBSA 3K5IA 1CSEE 2PM8A 3FPJA 1SXHA 1NLFA 2WAXA 2HWKA 2VWPA 2PJRA 2H51A 1J23A 2YJTD 3OE5A 4ENRA 1DDGA 4QUGA 2G0TA 4DV0B 3EH1A 5LSAA 3EG9A 4UDOA 5T6MA 3KUCA 4XWTA 1SUDA 1RXYA 3GJ8A 5HJ5A 4YAWA 2X5RA 4YJFA 5D3QA 3QE9Y 4UNSA 4LYYA 4R2XA 3DZJA 5L51A 3U5TA 1YWGO 3IRUA 2JZNA 2V6FA 5B7GA 1QHSA 5CH5A 1UWCA 3CGWA 1NC3A 5E2AA 5IARA 4Y0AA 1SOUA 4NULA 2V7UA 2YR0A 2E1PA 4COOA 4O1HA 2G71A 3DZCA 4WT7A 4FOLA 3N2GB 1NPDA 3GFQA 5E6UA 2Q9BA 3FTEA 5ALVA 5KFWA 2RSLA 1EVQA 3WLJA 4F5ZA 4XVUA 2XZPA 5I6DA 3IHWA 3QE3A 3MJFA 3AZQA 4JBWA 5A04A 1CJCA 3OJCA 1XAIA 2ZUCA 3EF0A 5ICFA 1FXWF 5KI6A 5TGZA 3JQCA 3BXEA 4BNZA 2W9CB 4MRMB 3TKYA 3V2IA 1SXJD 1CP3A 4DIBA 2JL1A 3ZBPA 5DM1A 4B43A 1ZBQA 2V7TA 3W8FA 2RBEA 3DZIA 1I6LA 3C16C 2CE2X 4GECA 5ED0A 1NZJA 1CFJA 1Z4NA 1T3HA 4JBLA 5AKXA 1Z73A 4BP9A 1SG6A 2FP4B 3A11A 4MR9B 3GT7A 4KPEC 4E1BA 4EI8A 1SIUA 3TLKA 3FOWA 1J42A 3BWMA 3TM5A 2IQ5A 3DL4A 3FOCA 3AW9A 4FOOA 5FNVB 1FPQA 3G6YA 1O0SA 1N5LA 1G64A 3G2JA 4W1SA 5EYPB 2ABJA 3UVEA 4HAZA 3ISTA 1VE7A 1Y5IA 4RTMA 2D1TA 3ETNA 4Q6WA 4ES6A 5FHQA 5KDDA 3SP1A 4MWGA 3HJRA 3CS3A 5BR7A 3JCZA 4GNKA 1FJGH 1JQEA 1Y8RB 1NOIA 1SG0A 1AMUA 1ZNWA 2O0KA 2AOUB 3NANA 3MTIA 1MB9A 2WVGA 1ORWA 1RZ3A 3R3VA 1N1GA 1CZNA 1PR3A 1U0BB 2HQOA 2X0KA 1UPXA 1XCBA 4GOKA 4BNDB 4BFXA 3PDIB 5K1ZA 1ATZA 4XYMA 1TK2A 2PMDA 1LC0A 2OPHA 1LLCA 5KOIA 2OFFA 4TLDA 3RRFA 2ZB4A 3BXXA 4IFEA 3B36A 3E4DA 5DISC 3HCCA 1DFIA 2JGLA 4U9IS 3PW4A 4GL4A 1PD1A 1CIVA 2GQSA 2QJOA 2OOSA 4XFJA 1H0RA 1M1UA 2GQ0A 5EEHA 4YCAA 3CINA 4D25A 2G1JA 3ABZA 2VSOA 4TMTA 3F9IA 2NX2A 4RIIA 2C2YA 4FPXA 3IURA 2F1OA 4UQOA 5B3AA 4ZOQI 4AJJA 2WTMA 1XTIA 3X1MA 3P9YA 1Z2AA 2ZI7A 3ZHOA 4OAOA 5FI3A 2BEVB 4RU1A 1LUAA 2Q45A 1NXWA 2FY8A 1R5BA 2OC9A 5HBGA 4M9RA 4HPJB 4NBRA 2FR8A 4DABA 3E18A 1N34B 3O8QB 4WVLA 3NIBA 5TMEA 2UUBB 4B4VA 2JIQA 5LQNA 4ENQA 1IBMB 3RV4A 1D6NA 1D7OA 5T57A 3JQAD 3WGYA 2VUTA 1QQAA 1VDZA 1PYGA 1DC3A 5AJYA 2IHJA 1QGUA 1QYDA 4NHEA 1WHSB 3AMVA 3QWUA 4DF3A 2YQ5A 4G9GA 3OT4A 3VPXA 1OW3B 3L46A 3I5MA 3OJWA 4BLWA 3BGWA 1BDJA 5I5VA 2XOXA 4YCDA 1AS2A 5EUQB 2BBOA 2B6HA 5A2QA 2IV3A 4BEBA 2J9FA 2R6HA 3RTCA 1PE0A 1USUA 2AOWA 1M3SA 2HVRA 1VJGA 1POXA 3PENA 3UK0A 4CKCA 5F9LA 1OXKB 2CN1A 2B36A 3MOGA 4LDQA 1FDSA 3SZLA 3LCJA 3C4VA 2PRYA 4OKIA 5TQ0A 5AJWA 4DLAA 1ZC4A 4MA0A 4X62H 4BFCA 1T2NA 3V6JA 1H9AA 3Q10A 4ZIRA 2LGJA 4D80A 5AW1A 2WB4A 4ZU6X 3AF6A 4KCGA 3RARA 1Z56C 3VKFA 2EFHB 5CGQB 3VR6A 1PWZA 5T14A 2Q6IA 2N9UA 5B53A 1NJGA 1I3OA 4TV9B 2M6SA 4W99A 4KDCA 2C8KA 4HXEB 5KVVA 5KDOA 1N7JA 3BOSA 3PNSA 4CMKA 5HZMA 4IYRA 4WBNA 5DGTA 1JSCA 1SKMA 4FDMA 1NW9B 5EAIA 2NZVG 5CXUA 4O3MA 3Q9NA 1BQ4A 2HJVA 4PCLA 2AEMA 3MJ4A 4NK4A 3Q5EA 3P32A 1RJ9B 1YDGA 4QPPA 4QC2A 3OCYA 4O3PA 4BJ5A 4BC1A 2JH9A 1YZ3A 4LVCA 1WETA 1US8B 4JC5A 5KYXA 2YOHA 4NIMA 3CF4G 2F7SA 1WXGA 3GN1A 4A5OA 3K0HA 4FWBA 3GTLA 1N4DA 3TRIA 4DXDA 2ZUVA 4C5BA 2P6UA 1XOIA 1ULTA 2X0FA 4AZTA 3CX8A 3HP1A 2IS2A 2A9JA 3E8XA 4HB3A 3BSWA 5B37A 1OWNA 3EQ7A 3RUEA 3ZCSA 1ZH0A 1KVTA 3M1LA 1V11B 1Z8NA 3MAAC 4MVJG 2X58A 2WM2A 2H29A 2AMFA 4D8VA 4KXWA 1G5FA 4IV0A 3I62A 2DPIA 3B85A 3S8EA 3EODA 4CG2A 4WPGA 1U3UA 3VZBA 1L8AA 3WGOA 3L7OA 4CF3A 1LA2A 4X3OA 2J31A 5TDHA 2FZKA 4QGAA 1SBTA 2R8ZA 5CXSA 1DOZA 1OQAA 1T24A 4GT1A 3M4JA 2WE8A 2DJIA 3U6KA 1DB3A 3L0SA 4DRXB 4TLLB 1RJPA 3FBWA 2OSVA 4NATA 3D3WA 2R8EA 2WFLB 1IBKH 4E30A 1H5UA 1BMFD 1E58A 3RBVA 5LNK6 5K3AA 4FFSA 4XCQA 2YINC 5DTEA 1D7AA 1E99A 1DOAA 4ITVA 5A4MS 4DGSA 4YXFA 1P1JA 1FNMA 2OH2A 2QTHA 1GZSA 2V8OA 4XB6B 3WWEA 5ES4B 3IB3A 2RDJA 4MGZR 4Y67A 4KE6A 3F9RA 3SSOA 2YZLA 4ETSA 1CIJA 3FTDA 4MJLA 2XUFA 2N1MA 2ZBRA 1CT9A 3JQBC 3NB0A 4EF6A 1R16A 3D8SA 3OQVA 2QQ0A 1OZAA 5DULA 5HKLA 1L4EA 5DPMA 2WKSA 3QTTA 1TK9A 4CQMA 5J4YA 2DTEA 3KYCA 5A4JA 1YZVA 3HRHA 1JV2B 4F45A 3PRKE 2OBNA 3AY3A 1GNTA 3LUAA 5KFSA 4GQIA 1RQLA 1WCMA 1XEWX 3FMPB 5JCPA 2BFMA 3CXUA 2Z9DA 5DO9A 4JKOA 4RA9A 1J0EA 5FUQA 2DBYA 2HDKA 1JKXA 3QU4A 2I8CA 5DISB 2IYWA 3OZ7A 1KVRA 5CIQA 4QFCA 3L05A 4OXQA 5T67A 4HGZA 4X1OA 3JWGA 1GUAA 1AA9A 1XZIA 3T5BA 3WO0A 3I45A 4HWSA 4PPQA 1IRXA 4I6EA 3DE7X 1EINA 2PX8A 5AHKA 1T5IA 1Z6QA 2GA9A 2AG5A 4XWYA 4Z7NB 2D4AA 1W36D 1NDUA 2JBAA 3ABIA 1FX0A 1LW7A 1YI8A 1R6XA 3O1LA 5H1YA 1UXJA 4LCEA 4N54A 4NZNA 2HK7A 2NTYC 3B8EA 3NDPA 3DC7A 2Z3WA 4A2QA 1G18A 5EWFA 4HZUA 4ESEA 2BCGY 3IP5A 4DKXA 3ZQJA 3T5LA 5EJ6A 5KTTA 2Z43A 2NO1A 2WTUA 5KNBA 5J59A 2YJ6A 3AFNA 2GK4A 4KQIA 3USZA 2PX4A 3ORSA 3A6GA 4B6PA 4KVGA 4BGEA 1ZVVA 3TSZA 1A27A 3T7TA 2VWHA 3NBXX 4IJ5A 2WB1E 1F0NA 4ZRDA 3K9HA 5EC8A 2JA7A 2HRCA 1KAOA 4I50A 2OC4A 4I5FA 2R4UA 1Y48E 1ISGA 4RD2A 3G17A 5AW7A 5C8VA 3F5DA 1VPVA 1E3WB 1C4OA 3B51X 2OFWA 2HADA 4DR6H 1T0JB 4X20A 2RGUA 2ZUDA 5ECGC 3RU2A 1XNGA 3BRQA 1WE2A 4A6DA 3QKIA 4LF6B 3GLGB 4AVYA 4NEGA 5KQRA 3B7WA 1NZDA 1SXGA 5LIPA 2QUAA 1WOMA 3WLPA 5KC9A 4MR9A 1KH1A 2WM8A 5C5IA 1YBVA 5LOVA 3O95A 5LJLA 2A1TS 4LMYA 4GE3A 1BOOA 5IMSA 2C84A 2Q7OE 2PLAA 2RHWA 3BXZA 2V6GA 2HGXA 4RHEA 3AM4A 2XOEA 1IY8A 3C74A 2IXEA 1RFLA 4OP3A 4FC6A 4CG1A 1NXQA 4GMDA 1G8GA 5KYTA 1YQEA 4EJ6A 4YRSA 4D79A 5HQJA 1MZVA 3FVTA 2G9RA 3S6JA 2ZJ8A 1UAAA 5G0SA 1CERA 1RLJA 4DSTA 5JI3E 4EBCA 3ITDA 4BZPA 4AKHA 4YP7A 1NG1A 1LPNA 5CD9A 1FLNA 1V16A 3ER9A 4EH1A 3G7NA 3ZHTA 2VAXA 4F6LA 3QRWA 2HW8A 1NLUA 4BC0A 1JLSA 2C9CA 1C0IA 2I2AA 3RUPA 2VS1A 4J1QA 3WB1A 2ZUFA 1H2AS 5GZ1A 2CDRA 5DFAA 2Q3EA 2G83A 2Z5LA 1WDTA 3PDIA 1B33N 1MB3A 4AN4A 3OWOA 2CNWD 4JU8A 2NU9B 1CEYA 5INTA 3R3HA 4PR0A 1H0KA 2GLTA 2VQFH 5HOEA 1V7QA 3TX6A 3SC3A 2W2NA 2A33A 3AWIA 4R98A 1AF7A 4DV0H 3HR8A 3OTGA 4MI6A 3WYAA 3H2SA 1H9BA 2FWBA 2R1TA 4LF9B 1UBUS 3OLYA 3ZDZB 1T3GA 3BIFA 3GARA 1NRJB 1CUIA 2ECQA 2PS1A 5IN5A 2OBFA 4ZYVA 5DW3A 4DVGA 5M34A 3BMOB 2WYVA 2VP5A 3H2HA 2HLNA 2AFHA 1Q1EA 1SCDA 5HIIA 4KQEA 1FMLA 5L1KA 3B5IA 4Q0YA 4QYIB 2OZPA 1UFQA 2BKVA 1IOZA 4N40A 3VSBA 4YB8B 4NYMR 2AR9A 5F2NA 1J39A 4KWIA 3G5AA 3KB6A 2MSEB 4E33A 1YB4A 4PZEA 2C4UA 4XGNA 4IJWA 1ST2A 3PV0A 1YQ9A 3L6CA 5L95A 2FTKE 4NOLA 4E3ZA 1U7WA 1HG1A 4J16A 5KFMA 1Z0ZA 3D2BA 1VZ2A 3QI2A 4MV9A 1OIXA 3OFND 1VECA 1G17A 5J2UB 2C8JA 1EYZA 1Q5PA 5BN1A 4RPCA 4CF6A 4N5LA 4OFXA 3A7EA 3URMA 1UBFA 4IOKA 5IBCA 2J4DA 1UC9A 4PGAA 3LY5A 1KZ7B 4LBZA 3O4FA 1LX6A 5IYZB 3PR1A 1RPAA 1DAGA 1OXVA 4UAUA 2R1VA 1NC1A 1Y7HA 1B76A 4GRDA 4LYEA 2ZCJA 1QIIA 1EB9A 5KPDA 1SXJC 1YVUA 4BWFB 2KLHA 1QG0A 3S2ZA 2CJXA 1IQPA 1ID8A 4CN9A 4EFKA 3A6HA 4Q1VA 2ECKA 1X77A 1WNFA 3QWHA 4RD0A 5HIAA 1EA5A 1SVWA 4DR4H 4FC7A 1MEOA 3KQUA 1YHZA 3GUUA 4UTPA 2VPWA 4M0JA 1QQ6A 2VJYA 4Y18A 4XQEA 2GM9A 1KY2A 3QPWA 3JSLA 3FPEA 4NVRA 1CF2O 5K8JB 4JV0A 1KU0A 1YFZA 3UCFA 2PX3A 2B7BA 5FPYA 1EVYA 4CMDA 4A0RA 3D8BA 2V7QA 2C3OA 2GB4A 2XT0A 3VR1A 1US8A 5EQFA 3GFGA 1L5WA 5IH7A 5E6SA 1X74A 3GF4A 3E3LA 4XDZA 3M49A 2OHJA 2VCYA 1R5OA 1JXOA 2DPYA 3E9ZA 3HV0A 1LFAA 1YA6A 3IMEA 2CFMA 5DIFA 1C3EA 1NASA 1IQRA 3PLRA 4E5KA 4PS1A 3QVGA 4G4GA 3H2JA 3JZMA 3HA7A 3HBAA 5TF4A 1WXFA 4R69A 3L49A 4Y1GA 3RTGA 2OCYC 4Q18A 3I2HA 1JEYB 1TKAA 5BRJA 3KB2A 1CX9B 1PD0A 3ICEA 1UINA 4HVTA 5EWLA 4CUJA 4WXHA 4LHYA 3VZQA 3ZZ0A 4BYGA 2XCIA 2UUBH 4XM1A 2QLMA 2WG0A 2FFAA 3ZGNA 2UVPA 3IDAA 4CCWA 5KT5A 2I1WA 2BZSA 2XA1A 3DXYA 3BXHA 3B1XA 4M8IA 4M76B 2J48A 2WFLA 2ESRA 3D3QA 3I4FA 4DAEA 1UEJA 3BIOA 2VJQA 5FKJA 5D86A 5JSKA 3NRBA 3V8NA 5IK2A 2IH4A 2B4KA 3C3MA 3HCAA 2IVZA 3F3YA 4OGWA 1Q84A 4K8RB 2Q4BA 3KC2A 1XHFA 1NI4A 3ECAA 1DINA 3UJ8A 4XI9A 3UGJA 5JS8A 4A9AA 1GCAA 2VAWA 5FOSA 2IS1A 3FIUA 4FZVA 2RHMA 4IM7A 4R2JA 4KIWA 3T3GA 2A5FA 3ZDDA 4IJ6A 1W4BA 2HSZA 2AMLA 2XDYA 4JJ6A 1MHPA 5H59A 3KYIB 4Z9YA 4GO1A 1Z22A 1CJSA 1OZHA 2B69A 1QGYA 2V5VA 1Y5MA 3A25A 1KYXA 3F96A 3SHQA 3BHMA 4F71A 3N8KA 3F6BX 4ZQGA 1GUDA 3Q12A 3WLQA 4Z4IA 1EX1A 3WK5A 3ESQA 5C1PA 4RSRA 4HRAA 4B4KA 2QTGA 3HJFA 1AHNA 1EXVA 4C5AA 1QF9A 1SEPA 4KPUB 3RQIA 1Y81A 1Z63A 3OVMA 5HUHA 3NIGB 2C29D 2PBRA 1T1JA 3I9KA 3R7AA 3BMCA 2DUNA 3OA0A 1WUJS 4DHEA 2ZJAA 1DEAA 1XEWY 2CJFA 1CY0A 3FD8A 1OI7A 3N5KA 4H6WA 3C1UA 5BSRA 1V51A 2COKA 4BOYA 4C89A 1XN4A 2YU9A 3VU8A 1FJ2A 3AETA 2XYHA 2FA9A 2IEZA 4MMXB 2FW9A 4JA0A 1PQ4A 1UQUA 3BMNA 3VC1A 4R6WA 3WGVA 4MPDA 3GRCA 1U3FA 2OXFA 2OBLA 3RAJA 4O0MA 4QYMA 3ZV4A 2I7TA 1RDFA 5JZOA 1GG5A 3EC2A 5TS3A 4YLGA 1TRHA 4R5MA 4I8DA 5EZ6B 3DDNA 1SUFA 2CLIB 3BF8A 4Y30A 1V25A 3FZNA 1XVVA 4HVLA 5LB2A 4YR0A 4HLCA 4NCKA 1FFWA 2XJ9A 2G80A 3NUGA 3QOXA 2CYAA 5IN4A 3TOZA 2H2WA 1NU6A 2A92A 2BJVA 2NZYA 1EVJA 3OPMA 2GJ8A 2JBHA 2VBFA 1Z47A 1GPDG 1M1XB 2QM3A 4BGIA 1Q83A 2ZSUA 2CKDA 2XWBF 1AXGA 2XCPA 1YS6A 1H65A 1TEHA 3BK2A 2J3EA 2QG4A 2FCRA 1LBIA 3IP6A 1QE5A 3GLGA 4A3IG 3E5MA 4J03A 2OR3A 4JOCA 4GXRA 1MKYA 2MSCB 1IFXA 1NX6A 4ZYYA 4JLJA 2HOQA 4MGIR 3I9FA 1ZISA 2LCIA 2FSHA 1THTA 4WXEA 1ODFA 4MVJE 1SXJB 1RCTE 4UPDA 1E0DA 4KFTA 3VYVA 4Z1MD 4J8PA 1XZFA 2IYSA 1HL3A 3AR2A 4MEBA 4C4PA 2GPBA 1LSOA 2AFIE 1WXHA 2BDTA 4MVJM 1SVMA 2FE3A 1UJBA 2CD7A 3U31A 2R5NA 1BGWA 1SU4A 4M3NA 3MWEA 3M5PA 2AZ4A 1Y3HA 4XWOA 1YASA 3ONDA 2C5FA 3OZRA 3DDCA 1Q1NA 2PXAA 3U55A 4KLZA 5A3JA 1A5SB 4IDEA 1CR0A 2W57A 2ZIFA 2G07A 1DRUA 4H59A 2AT1A 1YU6A 1G8FA 2WWYA 5T3UA 5B6IA 3GN2A 1M1ZA 1IC6A 4E88A 4BLUA 3G89A 1SHKA 3DMPA 2I2CA 2XE8A 5CYOA 2CEAA 1H0HA 2I6TA 2HQBA 1VKHA 1DC4A 4TUYB 4XUEA 1AN9A 3PTZA 3DT6A 1P8JA 1CKNA 3TMYA 1DG1G 3RAQA 4ZOBA 4HLQB 3DB2A 4QBHA 4H4EA 2VYQA 2Z9CA 3VKGA 1TZKA 3QNMA 4U5QA 4QDKA 3TEKA 1I30A 2W6NA 3VQTA 3TBFA 3OJFA 3BA6A 3O4RA 4PYRA 2RI0A 1OHHD 3LXRA 3PDUA 3ZQ6A 1Y8QA 3KALA 1E6MA 5BYBA 3CNEA 1KH2A 1LU9A 1IZZA 4S1WA 1L8XA 5B7QA 3L7CA 1QP4A 5D1HA 2CE7A 5HG0A 3MUNA 2Z8XA 4IVRA 2BF4A 4OJTA 1R9JA 3V4FA 5HGJA 3UWKA 1AN0A 3KZNA 4YCSA 1W36C 2IZZA 5JCJA 1DO2A 2NVYA 1L7RA 3G59A 3D81A 1X9NA 1U0RA 4D41A 2JIBA 1ODTC 1NQUA 4KE9A 4LC9A 5JSUA 3L0YA 4X24A 3ZY2A 5HCNA 1OCEA 1FYWA 3G9ZA 4IKOA 1RYSA 4RZSA 5K8UA 1B93A 3UMCA 3ENQA 2TMGA 1PW7A 1NXVA 1ORDA 2P9QA 3JQBA 4ZOLB 3VXKA 3N75A 4LGYA 1KMHB 3O90A 3ELWA 1UIMA 4PEVA 3F7NA 3KQNA 2HPAA 1PWEA 3H2BA 4Z2AA 1ZUD1 3K20A 4F46A 2IE0A 1I14A 2NSYA 1GNRA 5IYZA 3V48A 4GH5A 3ROTA 2C2EA 2UKDA 4D9FA 5K0NA 4YRPA 3CLVA 1O0BA 1A4RA 4HMOA 4D81A 1Z25A 1W29A 4L27A 2I7DA 1ZW1A 2XNSA 5DOZA 4WKBA 2X9NA 5IT9W 4BX8A 3LQSA 2IX9A 4BO6A 4PBSA 1T3NA 3DV0B 2ZPUA 1NVUQ 1L9XA 5EZSA 3S7ZA 2WKRA 4PVCA 2GVZC 4G63A 4Y3UA 3O4IA 2FLWA 3EOZA 5LM3A 2FFHA 3AHCA 1RWWA 3QEJA 1G8PA 2IW3A 4AULA 3ZDCA 5K99A 2OCLA 1E2FA 1KO8A 3W90A 2AJCA 3LYUA 2I03A 4D1YA 3OJ0A 2ZE8A 1OH6A 1KFKB 5D3MA 3CONA 5JSYA 5IKPA 4KXUA 4X62B 4UJ3A 3M4NA 4M1QA 2IXAA 5B4TA 3OX2A 5ITWA 3QUSA 4ARUA 5LLTA 3PKZA 4EKEA 4CTKA 2Z2ZA 3OCCA 4NKRA 3HXMA 1PR4A 4PLZA 5ILGA 4PPFA 5K03A 5A1TA 5FLXA 2VZ9A 1A88A 3F47A 2O1EA 1NW3A 5KPJA 2FEXA 5JDIC 3ICVA 2DQYA 3H4MA 4D96A 3LY9A 2O8BB 3DG9A 1OPXA 2VQSA 2EZ8A 1A9PA 1XDSA 2F4NA 4C4TA 3RFCA 2W8BB 3W6OA 5HV6A 1L4MA 3JQDA 4HWOA 3VAZA 3IQWA 1PVVA 4HJXA 3AH8A 3SJUA 4OVKA 4ZI5A 1RWPA 3BD7A 5EXPA 3EX7C 3HN2A 2GA8A 4GI2A 2CFIA 3J7AC 4GE0A 1ZPDA 2EJCA 3EA0A 1NE7A 5LQCA 4L8FA 1GFWA 4OM7A 3OMWA 4ZI2A 3O4HA 3R3UA 1MP0A 1QPGA 4MGKR 3WB0A 3AEKA 5JXGA 5HRUA 3T7DA 4PFSA 4QUDA 4LF4H 4Q21A 4OGKA 4B4OA 2OB1A 4LAFA 4J0IA 4MDEA 1OY1A 1TD1A 3WLOA 3A27A 3M34A 2XB4A 1UT8A 1SKQA 2JLCA 1XVIA 3FCEA 1E2PA 2BRUC 4BY9E 4PZCA 3MBOA 3TNLA 1E59A 1OFGA 4BVHA 3OPNA 4ASUD 1TLFA 5A02A 1XC7A 1NV9A 4XCXA 1JH9A 3X2FA 4A0HA 4AI6A 3QUAA 3N42B 2O8FB 2BD0A 1OZGA 2QTVB 3COJA 2JHFA 3CLTD 2DVMA 1ZBDA 5BPFA 3SGLA 2WWRA 5TC4A 1IBKB 4B6FA 4PLCA 3W8NA 1KIAA 3ORQA 4KPUA 4C2TA 3UIEA 2J41A 3H7IA 2GEJA 3OY7A 4AB1A 1QK4A 3R8CA 3FB4A 4PXAA 1AKNA 2MCTA 1UKCA 4CM4B 4K9QA 4GZ5A 1E1KA 1G2QA 2V7PA 4V2IA 1VGVA 4U39A 4FZ5A 4I2VA 5BMVB 2QIOA 1U1EA 4LRUA 3KVYA 4CNBA 4BAUA 1N2CB 4MICA 3D4OA 3ZU5A 4FS2A 2ZE5A 4CKEA 1B16A 2ZPTX 1LY1A 2NV0A 3ZZ1A 3TW0A 5L45A 3RB0A 1YZKA 3HGQA 1Z7YA 4D42A 2FSSA 2QW0X 2QENA 3CZAA 5EXDA 4YMWA 4DL3A 4MWCA 4AJKA 1A9YA 5JMPA 4NXNB 1JI0A 5JEEA 1LRLA 3PJFA 4EPTA 5GPBA 3VGPA 3BG5A 2PMEA 1R6VA 4IJUA 2HGSA 4RU9A 4G0YA 2FZLA 5KB3A 3U6BA 1WUHS 3HADA 3Q87B 3QTBA 2V3CC 4EI7A 4HWKA 3H17A 1G20E 1PIWA 5ED4A 3C6BA 1GTSA 2A88A 2AHOA 3QVMA 5FUYA 3RLFA 1USWA 2OLEA 4I9HA 4YUAA 2EF1A 3PS9A 4Z9BA 3FLEA 3R0XA 3WMRA 1S0NA 2VDRB 2XODA 3ZNOA 4MCIA 4R1OA 2M2IA 5FT9A 4YHHH 3AILA 3ILYA 1QR2A 4ZCQA 1NMYA 4BE7B 1W93A 3OH8A 1AUQA 4Y1FA 1KFCB 2CUZA 4NTZA 2F59A 3VV3A 2GHRA 4ZGGA 1CW2B 1JJVA 1H85A 5TB5A 3SF8A 4V02A 3EOBI 1LD3A 2VWQA 2J59A 3C70A 1SXJA 1OGIA 1RYMA 3LLUA 3WLLA 4INZA 3AC0A 4MROA 5KNLA 4EY6A 5I9IA 4PZLA 2GWHA 3LPLA 1K9SA 1GTL1 3KOWA 4H3KB 4QUKA 4OCZA 4DL6A 1JQ3A 1YRHA 4Z0TA 4JVLA 5FP0A 2PIDA 3QZ7A 5PGMA 3K4HA 1EEHA 2G17A 1UZUA 2C5HA 2QL9A 4Q3LA 2OO3A 3E0XA 1YVRA 1PNTA 3CTPA 1DBSA 1UH5A 3V00A 4ZTBA 3QNUA 1A3GA 1ZFNA 2QMZA 5KO2A 2BMFA 1A96A 1W46A 3TJMA 5KT7A 2GXQA 2A3RA 3FTQA 3LQ2A 3QQPA 3W5UA 5HA5A 3G0IA 5C44G 1XLTC 3LA6A 2OP1A 2UVDA 3WMWA 2QPLA 3G82C 1TE2A 3H4TA 3WIEA 4YRBA 2ZI5A 5DLFA 1EUCB 3DMTC 2P3LA 4K26A 1XRMA 1W1WA 4UUNA 2KM1A 5DYTA 1TM2A 4IDBA 1J00A 3EPLA 4K0KB 2XAUA 4IEEA 3DTFA 1I7DA 4DV4B 1DL5A 3IPAA 1B6RA 3COWA 3P2YA 4N3CA 2I3GA 1I7LA 4Z4CA 4L73A 4KQ2A 1QHXA 3EFOB 4LKRA 2WFZA 2QJWA 1BAPA 3K2IA 5JCZA 3EVZA 1OI3A 3OTIA 3ZWAA 2IP2A 2PUAA 2H59A 4ARAA 1Q17A 4G8JA 3IEMA 1S0MA 3IQDB 1FTYA 1HQDA 4RUCA 5TVKA 1H6BA 2R44A 1H93A 1TAHA 1UKEA 3JS5A 4KV7A 5ERXA 2VNJA 2A59A 4TKMA 3R9IA 4K2AA 4PSAA 4L0CA 1XZMA 3TDMA 4ER6A 3TN7A 4NMMA 3L4JA 1U8ZA 1GTG1 5P21A 3OY2A 3F0TA 1AQNA 1RXIA 4YMIA 2VQFB 1TMKA 1OXUA 3BTOA 2WTNA 1JTFA 3GVHA 3DONA 3L0IB 4GQBA 2IU6A 1Q91A 1XWFA 3RR5A 3N70A 3RWOA 1Q20A 3M9XA 1R7RA 1V5WA 3FDJA 4Y2PA 3E3AA 3K8ZA 5H7XA 2R5FA 4G4SP 3JQAA 3M6LA 1HDYA 1ENZA 4UUOA 1GADO 1PVDA 4QYXA 5K2MA 1TM3E 4CQJA 1C7QA 3RT7A 1U6JA 2ACKA 5AI6A 4Z4EA 5CR9A 4U00A 1DC7A 4J07A 3NTUA 4OX9Y 3CMMA 4XR9A 3W1WA 4BEVA 3AVOA 2JJ2D 3FLBA 3WK8A 2WG1A 3Q7IA 3NLLA 1ZOLA 3AUYA 4Q9JA 5CLJA 2I6QA 4HY3A 3SE0A 1AMNA 1FCJA 4XAQA 3SSMA 2DFKB 4NOMA 1IJBA 2R87A 4PNHA 3HVRA 1EFUA 4J0JA 4NU5A 2HLPA 3PPYA 2JFHA 1YKSA 5B57C 3E15A 3RGZA 3KLNA 2G8NA 4KN6A 5IVPA 3BIXA 3MRTA 4FE4A 3KZ1E 3OM0A 2G06A 2JFXA 4IEIA 2V98A 1CR6A 4NS1A 1NT2A 1QFMA 4B7ZA 3W9SA 4HDKA 4NI5A 5DBHX 4ZU1X 2ZJ1A 3I9NA 4XGRA 4G0WA 3PKIA 4A3SA 4AZVA 4QAJA 4U6QA 4Q4CA 3GLHB 3IP7A 2WJVA 3WGQA 4DJ5X 2XGQA 4R7ZA 3I4NG 1HDZA 4Q3OA 4C0KA 5KZMB 1NUPA 2A35A 1G6KA 2WF6A 5TPWB 3ULKA 1M6YA 1PV2A 2O2EA 2GFHA 2RHHA 4QLAA 2ZM5A 2AJLI 5BSHA 2PGIA 3RSFA 1GPLA 1GL6A 2OYSA 4YBZB 2W22A 2AN4A 4OB6A 5TQJA 4AURA 1SEIA 1MO2A 3RS2A 3M6AA 1ZYUA 4DR4B 2O8BA 1IG3A 3HWWA 2HA4A 3T1NA 1KK1A 1KI4A 1AMOA 3ZHBA 3HXLA 3RSSA 4E22A 2JVJA 3E9MA 3CIOA 2MYTA 3ME5A 1KE2A 4XA8A 1GVHA 4YRMA 3TE6A 1AUXA 2YOGA 3MJRA 3WYCA 1Y3CE 4KXNA 3EA5A 4N6NA 4EEXA 1JSLA 4PZ7A 2IT1A 4L07A 4XZ3B 3MVEA 3ZGVA 3CN9A 4BFWA 2H1HA 3BA9A 3OHAA 2XJ4A 5KYKA 1DEKA 4H6PA 1K7SN 4ADSG 4DCVA 3FMOB 3GGGA 2O6LA 1ODIA 4PZ0A 5E25A 2XMZA 2O7QA 2DAAA 3E7PA 4UEQA 5FTMA 3LPCA 3V7NA 3VTFA 3D5QA 4YCCA 2C5BA 4B4WA 5DG9A 1OZ0A 1P77A 1E63A 3ZWOA 1MOSA 4NH0A 4BMPB 4F1KA 1T2CA 3V32A 3T8YA 1BMFA 2PYIA 4OHZA 1HLPA 1SURA 1FX1A 3ODGA 4ND4A 5I9MA 3RIGA 2CJWA 3F8NA 3QKWA 3TW6A 2ZFUA 1WLYA 3K2EA 3UAXA 2IYFA 4CEIB 4JC8A 1JLLA 1XQVA 1L1RA 4DQVA 1NATA 4RH0A 4C0JA 3HCOA 3NP9A 3Q0IA 2XAAA 3ZNPA 1N2IA 1F48A 1MOZA 2TMDA 1IB0A 4RIFA 2G4CA 1GA4A 3ZBQA 1P4RA 2COUA 3V7FA 5JD3A 3VHRA 1NP7A 5JXHA 2AQIA 4NWIA 3VPAA 5FBWB 4NJEB 2H4ZA 4RHUA 2QY6A 3PKJA 1ULZA 4FLMA 4JJZA 3BTVA 2WHEA 3DUWA 3IIKA 5F12A 4B3GA 4XWGA 1DC5A 4W7HA 1HQCA 2NVUB 3AYZB 1AZLA 1T9DA 5CFQA 3VC7A 3DZDA 4G4SO 4RELA 1PEKE 3RB6A 1Y0BA 3KLOA 1ETUA 1L4YA 4ZREA 1SB9A 4BX3A 1NIJA 1B8OA 4M8LA 3UCXA 3S44A 4DBLC 3TW8A 2XY4A 2H4WA 3PC7A 1NI3A 1R8JA 4BMOB 1A0OA 2XD4A 2X0DA 3QA9A 3QELA 1XRQA 4ER3A 3L1KA 1M8JA 3PQDA 3FUUA 4FLFA 4LBVA 5HE8A 2CBGA 3QF7A 4OHRA 5G3ZA 1PT7A 3TG8A 1R3DA 4LXGA 2VT6A 4O4JA 5GOZA 5U4XA 1RK5A 3TVYA 1ZMRA 4PYNA 4IXMA 4TM7A 5KOJB 4AC9A 6REQB 3HJNA 1QLJA 1UZLA 2WHRA 1CYDA 1FNBA 2C04A 5KMGA 4ZZIA 1SPXA 2OD2A 3ZQ4A 3W9YA 1QGOA 3RYFA 2VL7A 4EHHA 2BC9A 5C80A 4JV2A 2X13A 1IZ9A 1Y5NA 1QDEA 4L8GA 3VTAA 5K6RA 1XCOA 2QGZA 4P34A 4MX8A 1ZXXA 3CG4A 3BQMB 3SR4A 2VEDA 4A8TA 4PG7A 4WRRA 2PLRA 3PO3G 2PGOA 2GJAA 1EKVA 1K8ZB 3IKVA 3ZJYA 3CZCA 4Y1EA 3ZIDA 1U3VA 4OK5A 5DVZA 1KO4A 4A3GG 1TWAA 4X7RA 1WB4A 1DDOA 1WNTA 3OPYA 4LNUA 1ZZGA 3PW7A 2D5IA 3NYWA 2IF2A 1IBLB 1WTCA 2YICA 1KQ3A 3ENVA 5KKCA 1WLSA 3QWBA 3O94A 1E77A 4G36A 4MV3A 1WMBA 1ZCJA 2FW8A 2DMRA 1EU1A 2HF7A 4UATA 3H97A 2AG0A 3AP2A 3BYZA 1ZZEA 2VSFA 4HQLA 4X41A 1UOQA 5TE9A 1EUCA 1RLIA 1PTJC 1DIGA 1BKYA 4EHDA 2A67A 5REQA 1E0JA 1JKJB 4FMCB 5EGNA 1AKQA 4KN5A 1Y7TA 3P0HA 1SVLA 2I4MA 5HS4A 3C6MA 4UEJA 1VKOA 3FPKA 5SY6A 5KYWB 4N1AA 3CLTC 1SU8A 5JDIA 5AHOA 5B1IA 3KHLA 2JGJA 1GSIA 3GFVA 1TIBA 4I1IA 2CNWA 3GJXC 3M70A 4D3FA 2RAVA 3VSCA 1VYVA 1V0JA 4YP0A 3R7WB 4DMCA 2WHQA 5H80A 1STOA 2BFEA 5B7NA 2C9OA 3B20A 2Q6VA 5MFZA 4A03A 4CMJA 4FS1A 1KVSA 3D6JA 4EKDA 5G1NA 3D59A 1W4LA 2BEUA 5BSVA 4NXNH 4DE5A 2CUTA 4D8XA 2WHPB 4JZKA 4CLRA 2IBMA 3UWDA 3CH5A 1FP7A 2YOFA 4ECSA 2ST1A 3F8WA 5IFKA 2XUAA 2QL5A 3KJZA 4GI1A 1HE2A 1M6EX 4PLGA 5EZQA 5LP1A 3AUJB 3I6QA 3TQOA 3FHTA 4ED0A 1XLWA 1CDZA 1DC6A 1IEXA 4I9FA 4KRXA 1W9MA 4F2PA 2QRNA 4XVCA 2FQYA 3EDRA 2R66A 4ENPA 3ZY6A 1ZDMA 4FFDA 2HA2A 3L9WA 1VA4A 3BACA 4BNFA 1DEXA 3PNPA 2CVPA 2H63A 4ZAZA 4KI0A 2LZ0A 1YR3A 4IIVA 2BRUA 2ZZNA 1X8XA 2YH2A 3KR9A 4JL5A 3L6DA 3WSTA 4EBBA 2PL9A 3D8NA 4PC7A 2AEEA 4OGLA 3DEHA 1YHYA 2PVSA 1O54A 1P80A 1CDOA 1L5RA 5LFAA 4BJHB 1NKSA 4KWHA 3LQ1A 2QX8A 3OFNA 4J76A 3N2GA 5BMOA 3KTMA 3ZIAD 4C0BA 1Z12A 5FBKA 3EUWA 1RAEA 5K0LA 1VMAA 1V4NA 3FWNA 3O92A 1HSOA 1U7PA 4HEJA 3PE4A 2JI8A 3SD7A 1ZITA 5TT1A 1GTZA 1T34A 3BFXA 4EKIA 3KE9A 4WZAB 2XNCA 4X44A 4KG7A 2W9CA 2EX0A 2VUMA 3E5RA 1MABB 1S2GA 4MRMA 4BNHA 1KP2A 3EW9A 2XVMA 3TUIC 1K08A 1Q0PA 2JKVA 5AFSA 5JPCA 2YTZA 4PPNA 1LSSA 4NEHB 4P86A 2ZJOA 1D2AA 3T3MB 3RTBA 4EGJA 2FP4A 3WIUA 1HDGO 3OOSA 3HXQA 2UZ1B 4XX1A 4OJKA 3S2FA 1W35A 5DGHA 1N3LA 2XWPA 5FNVA 1KAMA 4HAIA 3VAAA 4K0KH 3JQQA 1G5RA 1M76A 1Q2UA 2FQ1A 3H5NA 5EYPA 4BO3A 3PLNA 1MAAA 4DV4H 1JA0A 4W1RA 2CEKA 5DHSA 1NOJA 4MXDA 3JV7A 3A9RA 4P54A 4YBZA 1QF6A 1QIDA 2GDJA 2EG5A 1M2NA 1Y8RA 4K40A 1GZ4A 4E2XA 1K0FA 4NE7A 5CFNA 1QGAA 1UBRS 4RFLA 4RADA 3GFTA 3KV3O 2ROQA 5D5QA 2WSBA 3C3JA 1SZDA 1NVKA 1ITZA 2AOUA 2VJMB 3PDJA 3R3ZA 1L1FA 4H1UA 2O2XA 1WDLA 3ZHXA 4ZQEA 4AF7A 4MK4A 2QXYA 3C39A 2NSDA 3C0FB 1TKRA 2FPGB 4FE2A 4FFPA 1E3MA 1GWNA 4MRVA 4QT0A 5KFAA 4R7TA 2G82A 3CRMA 2ZDGA 4BNDA 3TQCA 2APJA 5C4IA 2TECE 1V43A 1T3SA 4RPGA 1PSZA 3V4LA 2O52A 5AI0A 4QJIA 1CRWG 5KTPA 1OASA 5LBIA 5FHRA 4YWHA 4IDFA 1R8QA 3DVSX 4RK5A 2O2SA 4YR7A 4WASA 2ZR9A 4NBNA 3L0PA 1X1DA 4TN1A 4RDXA 1DV1A 1L3IA 1CK4A 4BKPA 4C2UA 2WICA 5HM6A 1D2EA 5JNRA 2C8LA 4GR9A 3SOZA 3QVOA 5ADUS 5IBQA 4DA9A 5A0VA 2OM2A 5IJAA 1SMKA 4TV8B 3AESB 4OXYA 1QBKC 2BEVA 3C5HA 1Q95A 2C7OA 3ND6A 1NQTA 3MJSA 4B6SA 5TSDA 1ONBA 1GZUA 2PXHA 2X0EA 3O8QA 4INPA 5LU8A 2QPTA 3PRJA 2FPRA 5AR1A 2G9ZA 4C01A 3GJZA 1VS0A 4IRDA 5CK4A 4BQEA 1AN7A 1RC1A 4KR9A 1XLTA 3EIEA 4GRAA 4W5QA 2BONA 4R16A 1W6UA 2QMQA 1VE1A 3F6PA 1USVA 4F97A 2E1RA 1WHSA 3DMTA 1U0TA 2VYFA 5ALZA 4DDKA 1A0IA 2K7ZA 2DY1A 4LF4B 2WABA 2R1ZA 5K0CA 5HRAA 2AVDA 3PN1A 4I1YA 4E2YA 4AQYB 2AN9A 3WTCA 3PU6A 621PA 4HVCA 4WBNF 4O84A 2ZSAA 4IX1A 3QBVA 5MFPA 3PI7A 1J07A 3J81W 4JXKA 4QU5A 3FG9A 3LDGA 4JP3A 5K6TA 3IBSA 3GJXB 3OJEA 2RAPA 2G08A 4WY8A 4YLYA 1USIA 5LBUA 4X63A 3DKVA 3I34X 3WLSA 1YJXA 2OL4A 1T2UA 3ZDYB 4YDQA 4NZOA 4NBVA 4OIMA 2C4MA 4B48A 4N3AA 4GBGA 2W7OA 3AK4A 1JVSA 3RVLA 2L82A 5IPFA 1Z4JA 1ZQ9A 1MH9A 5TMDA 3EVAA 1YVPA 3HA3A 3VR3D 4ENUA 4EQ6B 3QMVA 3HR7A 1ZM3A 3C3EA 4H0FA 4TV9A 3TRFA 4JLBA 3E1SA 3QFSA 3HZZA 1D4FA 1ZOPA 5EIAA 1QAMA 3A0RB 4B47A 3O1IC 1QHFA 3GLRA 4IDPA 1DRVA 1YB2A 2VP2A 1RYFA 2P9YA 3T9AA 1KC1A 4UCTA 4Q48A 4U63A 5JJBA 1RJ9A 1YJQA 2ONYA 3UW1A 1DS6A 2GPTA 2RJNA 3V7UA 4MH0R 5A9TA 2WMOB 2EVWX 1YGPA 4JI6B 1X7GA 4DMFA 4JLMA 1ABEA 1F4PA 3G0CA 1UBJS 2O7NA 4J2HA 2VPYA 4OLBA 2X8LA 5GONB 3VVLA 2WT8A 1VSVA 4UBOA 4CKYA 3EPHA 1R9TA 1S2DA 2PWBA 2FLLA 5HIKA 4QBIA 2V4UA 1N0WA 3VOAA 1RHMA 1NYQA 2Q5FA 3ADPA 1V11A 1UQRA 1RYRA 4WDQA 1QTRA 2V7WA 1QV7A 4EK9A 2WSMA 5BP7A 4ECRA 3H5WA 3D4LA 5DN9A 4I5IA 1P4GA 1JNYA 2UVUA 1E2JA 2YMPA 2ZULA 1FYVA 4KACA 4P7JA 3DHWC 1XXLA 1IMOA 1WCWA 4MKIA 3HJBA 2VH5R 5EE3A 4PE5B 4NCXA 2XRZA 4Z1MA 1OF1A 1VHTA 1ZJYA 3R7NA 1Y6RA 2WTBA 3IVCA 3P2MA 4LXHA 4D9BA 3AEZA 2B6NA 5CFOA 4P08A 4WXMA 4YHHB 4DRXA 5F4ZA 3WV4A 4X6UA 1F8UA 3RAGA 5JSFA 5AW6A 3QXCA 4B7UA 1UZNA 3SBXA 5J47A 5BW8A 1FTNA 4ZJZA 1VE5A 3DDWA 1JKJA 3QEOA 1SBQA 5HKAA 1M7BA 3LT4A 1I6MA 1R6BX 4IX9A 1O4VA 1BGXT 4DOMA 4TVBA 4AO8A 5CM8B 1I1MA 4DKJA 5ALSA 5KYWA 1OYVA 1XXHB 1Y1SA 4J4HA 3UTDA 2BE7A 3F3KA 2VPQA 1E5TA 3G6KA 2Y1GA 1MC4A 3PUHA 5KT6A 1MVLA 1VLQA 2C3MA 4LC1A 2WHYA 5I7WA 3BWEA 1NSTA 2R6ZA 4WJLA 4Q4DA 1NZFA 4QU9A 3QUTA 4KYVA 3HHEA 2HV9A 1A82A 2VHQA 4OMCA 3GPCA 1VB3A 4C6HA 3CPJB 2QTRA 1N2GA 2DFLA 2WHPA 2EHJA 4GPD1 4ZCIA 4HQFA 2P11A 5CLHA 3W5IA 1V1MB 4EYGA 1UMCB 4F4UA 4MUHA 4PYJA 4GWKA 2E4UA 2WVJA 1S4MA 1KR2A 1W85B 3WWYA 3B52X 5CCXA 5I7RA 4XB2A 2RHJA 4XSVA 1L7NA 2WZCA 1OHHA 1DBWA 3IVGA 3PQEA 3BJIC 3VM6A 2VHJA 2H92A 1RWQA 4HCJA 2ZEJA 4I50F 4H2DA 4DRZA 4KAAA 4RHFA 5DAAA 2QZ9A 3L4SO 2EBUA 2QG6A 1GTMA 4MVJP 4QQFA 1TU3A 5ULLA 1OX5A 2XDWA 4YYZA 4RUKA 4G37A 2FEWB 5CDFA 3A9SA 4WOPA 3SS9X 3GJ4A 1EP2B 2A1IA 4Q43A 2R86A 2Q5EA 1GSHA 2HMVA 3QOYA 1LDBA 4JBGA 1FVFA 4MUKA 5EERA 1P2SA 3G0OA 9ABPA 2G5GX 3GBSA 5E4TA 4R2LA 4V0RA 4IGKA 1U3GA 5LOVF 4YAOA 3K0AB 4E14A 3V1TC 5ALDA 2VATA 2XLCA 3MK31 2EJUA 5FNVF 4B82A 2F1HA 4H3SA 4A92A 3LTEA 2AI2A 3IRVA 3S1AB 4YP9A 2Z02A 4KQXA 4L4YA 2X41A 4CT0A 1RM0A 3S24A 2W7TA 2WJWA 3BDIA 1NQ5A 3AQ4A 1E3WA 4M8NE 4ERXA 2HFJA 4R8KA 5EESA 4HK4A 4QHSA 2PS0A 3JPWA 3THXB 1MABA 4KBYA 1IBLH 3PHCA 1P5JA 2GEFA 4DQLA 4IOLA 1AOXA 1ZX1A 4CKXA 1TTQB 3MGBA 3CNLA 1U65A 1QX3A 4WBXC 1TQ8A 3NXSA 2EKZA 3SJCA 3K1AB 1EDDA 4O3FA 4F56A 2Y1CA 3SI7A 1AQUA 5C1OA 5ECDA 2HT1A 1AV6A 4S1OA 4WI1A 4LH6A 2YHIB 1L7DA 4CFZA 3TLGB 1D1QA 4J9QA 4AJIA 3CX7A 1HE5A 3NDRA 4YGXB 1ODSA 5JI2E 3FZQA 3TQRA 4YDHB 1P7VA 1ZC3A 1RBYA 2QS9A 2IYTA 4FD3A 1DARA 2HX1A 5I47A 1DJNA 4TTIA 5DLEA 1WSDA 3RWBA 2DT8A 4ZAVA 4RENA 4KMRA 4RVSA 2GFIA 3BZWA 2Q9UA 3MWDB 4I1RA 1DXYA 2GHIA 1G3RA 4PSCA 3T1QA 3UMBA 1TJ3A 2ZANA 5JNSA 5ALOA 5M7EA 1TWGA 1II9A 1CC1S 1NM5C 2AI1A 2A0XA 2FPGA 5AK3A 3PDHA 2BCJQ 5LWHA 1GUZA 2GD0A 5FTJA 3RB4A 1NYTA 2XMRA 5SY4A 4CM9D 3R75A 3WL4A 4I14A 1RT9A 3WGKA 1EM8B 4B0PA 3VVBA 4GI3A 1KFBB 4GX5A 2NU9A 3A4LA 2OUKA 2ODQA 2VP6A 4PG4A 2JGDB 5C51B 2FQXA 5DBFA 1FNCA 5BW6B 3UK1A 1AG9A 1J0XO 3C2QA 3N07A 3NV7A 3M1IA 3BULA 2XMSA 4GMKA 4EENA 4URFA 2ZJ3A 1NU8A 1WVGA 5I4CA 2B99A 1OX4B 3IA7A 2FE1A 1U3WA 3F6EX 4JYZA 3NZEA 1USGA 2QMYA 1ZSNA 2CSXA 3BMOA 1EKFA 4TV8A 1JAHA 3A58B 3RKRA 5EDWA 4QYIA 3G2LA 4BO4A 1Z83A 4YB8A 2WIKA 1IXKA 3M9NB 1QTNA 3ZDFA 5BSGA 2Q2OA 1ZD2P 3OESA 4B6OA 1M5UA 1MZBA 1N7GA 1EI9A 1X1QA 3KREA 4BGVA 4A1OA 1O8BA 4NPAA 2DLCX 3CZRA 1LVHA 1L5VA 1NVMB 1HE4A 4OAPA 2IE8A 3RREA 4F85A 1GPJA 5ALJA 3QLJA 1PTJA 3EXAA 2P4QA 2ISQA 2R85A 2ZRHA 2HQ1A 4PVDA 4ASUA 3EFBA 1NIPA 2B5WA 2VSNA 5TS2A 1VFPA 4G1UC 1Z0JA 3W0LB 4XGKA 2AD1A 1IL0A 2ZTLA 3IESA 1ZM7A 4QJFA 5DYWA 2PLWA 5J2UA 2XQVA 5A03A 3CRRA 4NQRA 5FTWA 2FOIA 3T7IA 1JXAA 5EIXA 4A27A 3T3DA 2FK3A 3DBOB 3RRJA 4Y2VA 1LRJA 3DXXA 1TCCA 4NARA 4CM6A 3LULA 5MN5A 4P0PB 4GZMA 2OGUA 4L8YA 1CUVA 2A1TR 3G49A 3JR7A 5LDHA 4XUCA 3WWIA 3VYWA 3PI6A 4UCVA 4EQ6A 3UO8B 1C7EA 1JL3A 3I5YA 4GKBA 3HL4A 4G0VA 5KNDH 4DR7B 3RUDA 4F9GA 3DUFB 1QZTA 5IM5A 2HCRA 3IKMB 1N0VC 6ABPA 4HB2A 4LF7B 3SSNA 2JLQA 4KP7A 4LFBB 4RACA 1RWKA 4P80A 4WKGA 3PTLA 2XKKA 5FTKA 3HNOA 2E2HA 4CM1A 3DBVO 2FN7A 2UZ4A 1E6EA 3RSGA 4QUIA 5KNDD 3S1LA 4PRYA 4U9UA 4EYQA 4ND6A 5F5LA 4DS3A 4XASA 4PTLA 2ZTMA 3CBQA 5JU6A 1SKBA 2EJVA 2NQ8A 2ZBVA 3SI8A 3PHHA 1GOTA 2JA2A 1Y9AA 1KSFX 3GB9A 1IIBA 4PGGA 1JU4A 3SC6A 2PS9A 4FN5A 4GI5A 4U5XA 4R2MA 1Q11A 3KQPA 1VYHA 2VJCA 3M5CA 1ADCA 1NMSA 1Y33E 4LSAA 5A4DA 1E98A 4LV5B 4YR3A 5T3YA 2NYRA 1Q3HA 3RRXA 2GZ1A 1JGTA 2V54A 1ORTA 4E31A 1YAHA 1JEYA 4LYAA 3M6MD 4RB0A 3FPAA 1H2WA 1P7WA 1K1SA 2WD8A 3M6XA 3SQOA 5EHIA 1P1CA 3DFUA 5K01A 4CIVA 1DGSA 3NU1A 4RZ2A 1ILEA 5CG1A 5DEIA 1DPGA 4WKOA 2JAXA 3RF2A 5IX8A 2DHDA 2PZBA 4KHZA 4DTIA 1D4ZA 5DTIA 4UZSA 3F73A 1QO0D 2VP0A 3FRJA 1RE1A 2ZIVB 2OG1A 3MAGA 4PYIA 3GG2A 5D7NA 3IP1A 3AY6A 2PUCA 3HEAA 1C7JA 2CL0X 2G8LA 4LVUA 3FCAA 1PJTA 2YN4A 4JQSA 3HWRA 3BSSA 4U8GA 2F55A 3LVRE 4NJMB 1Y6QA 4QECA 2DQZA 2PG3A 4AQYH 2CF5A 1M9NA 3P0JA 4NAHA 4IRKA 4TYPA 4R3WA 3VZDA 4BQSA 1BVHA 2H1CA 1E2KA 4A3FG 2OZVA 2E5WA 4L5IA 2QIPA 1JNXX 3HS3A 3I73A 4ZC1A 2VDMB 2MU1A 4P58A 2I5PO 4RKQA 3ZD9A 4Q19A 2PFKA 1WF3A 3OHSX 3AUXA 4ND8B 4UCFA 3QSGA 3L1IA 4IF4A 3B6IA 5FQOA 4YAEA 5KFPA 3RGGA 4ZCRA 1XPJA 3ZHYA 1SA0B 1BE0A 1ULBA 2JGFA 3EIWA 2F6RA 4ZYTA 2JRCA 1V1MA 3UB2A 3EA4A 1YDHA 5AD1A 4CG3A 1QRSA 3PC3A 2Q28A 3I39X 5IP9G 2C95A 2Q6LA 1YZYA 4PHFA 2ERYA 1S9HA 2X9QA 1VIYA 5AO9A 1ZRNA 3T38A 1D2CA 3LT5A 4ZGBA 2AK3A 3AL0C 2GZRA 5CLQA 5LWQA 1QVRA 1QK5A 4JI6H 1YONA 3HJTA 3W5AA 1D2MA 2O05A 1NF3A 3EPRA 4CKWB 4QZVA 3QWIA 2CKMA 1H1DA 4PGMA 1KEPA 3U56A 2F3TA 1NJFA 1DXHA 1TZMA 4JXJA 3BEDA 3KHTA 2B8EA 4Y9RA 5A06A 3ZJ4A 4JEMA 3G8DA 1NW8A 1SK8A 3DNMA 1VM6A 4JXUA 1M6HA 1W1UA 2WSSD 2E3JA 2Q1XA 3HPQA 3O8LA 3H8VA 1ZK3A 1SUIA 2J1LA 4OD0A 1XD9A 3EGDB 1GNQA 4CRWB 3ZDRA 1U9ZA 2O06A 1Y6FA 4WLOA 2AOXA 2PO5A 4PAMA 2G7MC 2XDQB 2C5AA 2CLLB 1CD5A 2YVUA 4QJ5A 3ANSA 1XPOA 1GFSA 5BNTA 3CT4A 2H5JA 2HJHA 1CJUC 2GZ2A 3O93A 2XD9A 1CKMA 1S8OA 1KDVA 1TLLA 2FFJA 2AMVA 4K87A 1UOPA 4KPYA 5A3RA 5EXXA 2PKEA 4YS6A 5JR3A 521PA 3R0VA 5I9NA 3C8ZA 1T4CB 3OM8A 4GMGA 4HQ6A 3OAAD 4GKKH 3T5CA 3E1KA 4P3PA 5KS2A 4AXXA 1WY7A 3K0KA 2VZLA 4N0MA 3Q2KA 3U4GA 3UAGA 1GAQA 4TSFD 3RKSA 1NMXA 2EKQA 4R81A 4XWKA 3VKUA 4AS2A 4OA8A 4R84A 4JBNA 3V4PB 1DAEA 1JDBC 1FSGA 3V7WA 3E8SA 4K1LA 2ZJ2A 3EIQA 2CVZA 2QX6A 4CLEA 3SHFA 2ZYRA 4N49A 1M7GA 3G2HA 4L50A 3GJYA 4H0NA 2C1EA 3OZSA 4DCTA 4M46A 4MSUA 1WMAA 1V1RB 4HDRB 3FI9A 2OV3A 3DO8A 1R0YA 3UHPA 1TGVA 4BBSG 1DIBA 3ESYA 4DCPA 2YWEA 3QG5A 4KZKA 4KQCA 2QM8A 3NIWA 3O9VA 1RXSA 4PX5A 3UV3A 1QPBA 3RUIA 2P75A 3MT0A 2DWQA 2YUTA 4JI1B 1VHLA 3GEBA 3JASB 3KLPX 3F7OA 1OXBB 1XUOA 2O50A 4BWGA 4COKA 4TUYA 1DAOA 1FDTA 8AT1A 4HSGA 1ODCA 2UYYA 3LPDA 4C3OB 4H7DA 4C7VA 2VK1A 3WK9A 2II6A 1IATA 1OX4A 3TLMA 2O20A 4TVOA 3M3DA 2AKYA 3UXEA 4BLOA 1PFVA 3MWFA 4AROA 2Y68A 2C5EA 2J5BA 3OKCA 1PDVA 2POQX 1P62B 3AB8A 2Q5OA 3DZKA 3S1SA 5F3DA 4EUHA 1PFUA 4UHDA 4Z7QB 5U9CA 4F86A 5G40A 1ZQ7A 2J6SA 4B2YA 5KFHA 2IEDA 1A69A 1XT6A 1U8AA 3RVMA 4YDSA 1M1YB 5LQKA 3K71B 4C0WA 3WK6A 4EFNA 3WV5A 2M32A 5F7XA 5IYZF 4R31A 2HK9A 1OE0A 2JI6A 1SC9A 4M49A 1NVFA 3CUEF 4DLZA 4EB3A 1C8BA 3OZVA 3ICWA 4N9QA 5CXXA 2ZVPX 4ZT4A 3WB2A 3IAEA 2XCAA 3SC4A 4JSTA 1N0IA 2IUFA 4QULA 3UMRA 5C8YB 3I23A 2CJPA 5E4JA 4DLKA 5K09A 3VHQA 2YRXA 1BHSA 5MDHA 3MQ2A 3BGOS 4OSEA 5JAHA 4G23A 4UM7A 4WKPA 2F2TA 3AHIA 2IMWP 4U2DA 4ZOLA 3ZDEA 2O8VA 4TQAA 2WNHA 4ZT2A 5FH9A 1KMHA 3A3PA 3KAJA 2O0LA 2I3ZA 3KJFA 2WEKA 3EIUA 4G5GA 2VJOA 4F9TA 2AEJA 1JMKC 4R1NA 2ZTVA 4DUYB 1NDQA 2ECPA 1NY6A 1CNEA 5CK5A 3D3JA 4R0MA 4LXTA 3HN6A 2YXLA 2BZGA 5BR8H 1EE9A 3EJ6A 4GPIB 3GB8B 2FEAA 3IQFA 3IYLW 4RXTA 3UMJA 1KWKA 2BM8A 2NU8B 3DV0A 4BVBA 4IFBA 2EKLA 2GHQA 1T9HA 2PZMA 5DKFA 1Z8FA 1IYZA 3FCXA 4FEEA 1Z17A 5U4QA 4GM0A 3F78A 2J0EA 2QKYA 3AUKA 1RJRA 4JN6B 4O8CA 4GUDA 2P9CA 5IJWA 1KAEA 4RWEA 1R5NA 2VBGA 1TRKA 3PFBA 3OX3A 1SKUA 3IC5A 2VP3A 1GHTA 4BIMA 3OE7D 3HCBA 1XA0A 2XUPA 4A16A 4AWXA 4F4YA 3RRBA 1N6KA 5HXAA 4KLAA 3I1IA 2OXCA 4OF4A 4UD6A 1UBSB 3D6UA 4WNYA 5GWXA 3PGLA 2AUMA 3EAGA 4KO4S 2FQQA 1WB9A 3WRVA 1U0OC 2PH1A 4NONA 3RS0A 5DNUA 2GGSA 4MZXA 1EVLA 4V3CA 2XNDD 4OUDB 4WHXA 2HKIA 4GX0A 1V4YA 4IH4A 3U4AA 2J08A 5KYUB 4U2CA 1FP6A 4NXMB 1KORA 4JWTA 2LTAA 4O7NA 2O2YA 3D7MA 1T0BA 1GKUB 4CCSA 1K68A 2W8BA 3VU3A 4AS3A 1JFRA 3ORFA 3UOGA 3GLIE 3DAHA 4WZ6A 1EFRD 2B5VA 4MPRA 3D7NA 2GLXA 3HUUA 3OX4A 3C6KA 2RGVA 4L8VA 3P19A 4E1AA 4YI5A 3TFWA 5IP7G 3GUHA 2CB9A 3KLBA 2YCHA 4I3FA 1ZRHA 4BBJA 5CCBA 1XCMA 3DDOA 4TVIA 4DQUA 3QVKA 1SZJG 2J9RA 4IQ8A 2WDPA 4BLSA 1RNLA 4WK2B 3GT0A 3LC7O 1H22A 2W6MA 3PFNA 3AW8A 1C9DB 3LX8A 1MFPA 4NJMA 3S2SA 5JYDA 4A10A 3CUWA 4Q03A 4YRZA 3KPJA 4O29A 3HXKA 4B44A 4CTJA 4YMGA 1JDBB 3ZWBA 3ZK8A 3DPSA 5EJIA 1NOKA 1ZR2A 4KGXA