5K2MA

Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
273
Chain Sequence
MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RimK-related lysine biosynthesis protein
publication title Lysine Biosynthesis of Thermococcus kodakarensis with the Capacity to Function as an Ornithine Biosynthetic System.
pubmed doi rcsb
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
molecule tags Biosynthetic protein
total genus 88
structure length 273
sequence length 273
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 5k2mA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5k2mA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k2mA01
1GSAA 5JVDF 4I50F 1UC8A 4M98A 1KJ9A 5C8YF 2YS6A 2VPQA 2DIKA 2VHEA 4J6EA 3JZFA 1KC7A 4DLKA 4ZOLF 3E5NA 4IWYA 3TQTA 3BSYA 2HJWA 4MAMA 4MV1A 2R6FA 4IZOA 4C5AA 3R5XA 3TW6A 5CB4F 2YZMA 2R85A 1CE8A 5J2UF 2V59A 3V4SA 4FU0A 3JZIA 2GPWA 2W6MA 4O2AF 4YJ3F 3TIIA 3VA7A 2FPIB 4E4TA 5IYZF 2R84A 1EZ1A 4ZQIA 3VPDA 2FP4B 2P0AA 2W6PA 3G8CA 1KJJA 3GLKA 3R23A 3ETJA 1EUCB 1B6RA 4WD3A 4EABA 3Q2OA 2NU6B 3VOTA 3WNZA 2V58A 4TUYF 2YS7A 3MWEA 1KBLA 3UFXB 4YJ2F 2W6NA 4MV8A 4QSHA 4MV4A 1I7LA 3RV3A 1DV1A 1EHIA 1VBGA 5KKNB 3WO0A 1BNCA 1VBHA 4TV9F 2GLTA 4O2BF 5LYJF 2ZDHA 3JRXA 2VR1A 2X0SA 5C1OA 1C30A 2NU7B 3R5FA 1SCUB 2W6OA 4MA0A 1DIKA 3VPCA 2DZDA 4YAKB 4HQ6A 4RZQA 1KJ8A 4MV3A 3TIGA 4EGJA 4EA9A 4L1KA 2OLSA 4TV8F 2W6QA 4HR7A 4YBZB 2YW2A 5BPHA 3R5HA 2FPPB 3V4ZA 2XCLA 4XX0B 1ULZA 2R7KA 3K5HA 2I87A 2CZGA 2Z04A 3AW8A 1AUXA 4EGQA 5JVLA 1GGOA 2ZDGA 1KJIA 2R86A 2DWCA 2ZDQA 2R7MA 3MWDA 3HO8A 2YL2A 4XYMB 4YB8B 4DIMA 2QK4A 3VMMA 4IHJF 5D8DA 3U9SA 2NUAB 1GSHA 2R7NA 4Y8VB 3RV4A 2VQDA 5CAEB 3SE7A 2C00A 3JRWA 3K5IA 2I80A 4MV9A 3U9TA 4I55F 4MV7A 3BSSA 4EA8A 2I8CA 4ZHQF 1BXRA 5J2TF 2NPOA 3BSWA 3HB9A 3BG5A 4XYLB 3ETHA 1E4EA 3MJFA 5CA0F 2SCUB 3TINA 5JQWA 4MV6A 5HBRB 5CA1F 4ZI7F 1EYZA 2J9GA 3GIDA 1T36A 1DV2A 5EZYF 3K3PA 1I7NA 4HNVA 4C5BA 2R82A 4O4HF 1JKJB 1KJQA 5LA6F 5LP6F 3G8DA 5JH7F 4ME6A 1EUDB 3I12A 2R87A 1E4EB 2FPGB 2GPSA 3ORRA 2PN1A 4EG0A 3WO1A 4HNUA 2QF7A 3N6RA 3LWBA 5K2MA 2YRXA 1W93A 3HBLA 2FB9A 5DMXA 1KEEA 1PK8A 1GLVA 4M9UA 4C5CA 4WBNF 2W6ZA 3QFFA 2W70A 1CQJB 1W96A 4HNTA 4YAJB 3AX6A 4M99A 1JDBB 2R7LA 3OUUA 4IWXA 4M9CA 4GGMX 1AUVA 5GONF 2YZGA 5HV6A 5I47A 3RUPA 5KX5F 3Q1KA 2YRWA 1JDEA 2PBZA 2PVPA 1CS0A 1CQIB 4MA5A 4O4IF 1A9XA 3VPBA 2YYAA 5BMVF 1M6VA 5LOVF 2NU9B 3RFCA 4XZ3B 1PX2A 2DLNA 2W71A 1JLLB 3ORQA 5LXTF 1UC9A 1IOWA 5BPFA 5C1PA 5H80A 4EAAA 2IP4A 1VKZA 1GSOA 3BFPA 1IOVA 2V5AA 2NU8B 1WR2A 4I4TF 1B6SA 4O4LF 2XD4A 2CQYA 4EA7A 3N8DA 3OUZA 1C3OA 2YZNA 3LP8A
chains in the Genus database with same CATH superfamily
1IG3A 4W5HA 1FRZA 1O08A 4KIUA 4MIOA 4UUPA 5TV2A 3ZJVA 3BMQB 1QYVA 4WKGA 2QVBA 1A8PA 4J0IA 3CRMA 4S1OA 5KDLA 4IIJA 5ITVA 5G1NA 3T3IA 3FH0A 4ECWA 2GD2A 4QDUA 4Y0AA 5ALUA 3BRSA 2XMPA 1VFPA 4RTRA 4QUJA 3K5PA 2R00C 1CSEE 3JAKA 2L17A 4FLEA 3PHGA 4R98A 3SQLA 5LOVA 2AOXA 5D5PA 1XF9A 5LZ4A 1TKAA 4M60A 2P7IA 3CIFA 1RYZA 4KRFA 4YRQA 1JQ5A 4Z1MA 3KIPA 2C4TA 5E9QA 3USES 3GLKA 1IXYA 2PIDA 5FJ8G 2BLNA 4WNIA 3A1CA 5TPZD 3OG9A 2QBYB 3IT1A 2FG7C 5ARDA 1KAQA 1E1KA 4EI2A 2CDBA 2NYAA 2E5LH 4TSRA 4FSXA 1W34A 3HY3A 3UANA 3CZRA 3NVMB 2DFLA 3HOUG 4PYNA 2CUNA 2WM9B 1SVMA 1GKLA 3MRXA 3U4GA 4B3SB 3G0HA 2AOTB 2WFLA 3T52A 3TJZA 4KGXA 3N59A 2HGWA 5TXGA 1X42A 5DW0A 2WFMA 1F4PA 4WL0A 4LMYA 3RVJA 3KLPX 5IU6A 2C61A 4KNVA 2R5WA 2Q9BA 1XAHA 5FORA 5FHQA 2W6QA 5L7WA 3GMDA 1L5WA 2Q2VA 5ENVA 2CJPA 3A4IA 1NTRA 2X40A 3LK6A 2AFIB 5KSYA 4O83A 1U0OC 2W58A 3D5TA 4BY7G 3R6WA 2TYSB 4L6IA 1A7JA 4UC0A 4XD2A 5C3MA 2WM2A 2PX3A 1DAPA 3A0UA 3HR7A 3RWMB 3QMMA 3NBZB 1ADYA 1VGQA 2J6CA 1QF7A 2FEWB 3E4CA 2R6GA 1M5UA 5KYWB 1IZ7A 3PTLA 3RWBA 2G9UA 1OH8A 1YRLA 4GH5A 2E1PA 4E1BA 2JKZA 4ZZ0A 5F64A 4U8GA 3OZAA 1PS0A 4YVFA 4MUMA 4NL4H 3KYIB 2BONA 2JI4A 4O2BA 1W85B 1BIFA 1KQOA 4PSDA 3V7YA 1R0YA 3FCCA 4NCNA 5AM5A 5FA6A 1YRYE 4WOPA 1R0SA 1ONNA 2J9GA 3A3KA 2AFIE 2I54A 1I7NA 3LQ1A 3R5TA 3W2TA 2OXFA 4QDTA 3ABIA 2QM3A 4RK4A 2D7DA 2D2XA 1WSBA 4JU9A 3LMLA 1UINA 4X6XA 5L53A 3RUIA 1NV9A 4P92A 2HQSA 1W0KD 3RIZA 1SG9A 2WJGA 3JQBC 3F98A 4MHTA 2IBTA 1VI6A 5BQXA 3N7TA 4I19A 4IINA 2IZ5A 3GUVA 4UQLA 2YMMA 2XSZA 3I5UA 2EJ3A 3KVYA 3ZGYA 4LMRA 2I3BA 1G291 3L1IA 1ZSNA 3ZI7A 4O86A 2BZ1A 4HC4A 3UFXA 1Z7EA 4PONA 5T3YA 1G5TA 2C5HA 4RD6A 3ECCA 5FL3A 1AIPA 1Y8RB 4Q1FA 3FTPA 4P2BA 1P2VA 4G8CA 1SHZA 1VMEA 1Y4SA 2JA5A 2HDOA 3UA3A 1TW2A 1NWHA 1PUIA 1A5SB 5A6SA 2Y0SA 1VDZA 2C9DA 5MDHA 2CVFA 4ECXA 2PZJA 4NXNH 3OZGA 2OYSA 2XGOA 1I8TA 1ADCA 3N8DA 2C9MA 1GARA 1YTUA 2EZTA 3A6JA 1FYXA 1YI1A 3VHXA 1L9XA 3AV0B 3QIVA 4RYDA 3PDIA 5FWXB 2DUMA 2YWVA 3ZHRA 1Z62A 1WY5A 3OA2A 4QUHA 4L8FA 3L8FA 4EJ0A 1OLSB 1ZRSA 4QPCA 4PLVA 1YDMA 3SF8A 2R4UA 1D4ZA 3GWZA 3K94A 5IVHA 4W8OA 5DHSA 4DCJA 4B40A 1Z7YA 2AKAB 3CEAA 3TEFA 1N6IA 3NM6B 3UWDA 3BWYA 4RTKA 5C52B 4BN0A 2RGYA 1CF2O 3RBAA 2DLCX 3CM0A 4CM4A 5KYTA 3QKIA 1R5BA 1H3FA 2QNIA 4IFTA 4RQTA 2QD3A 1EZ1A 1DRKA 1J99A 4CODB 4HUTA 2JGLA 1RWWA 2XUGA 1GU0A 3R3VA 2HYIC 5FBQB 1P91A 2VYFA 2R8GA 1JHAA 4NWIA 4F4HA 3LF2A 2NU6B 3MUFA 3ZWOA 4L8GA 3GLGA 2H92A 5MGNA 1YS4A 2XZDA 2HJHA 4EF6A 4BIMA 4G3XA 1ZIXA 1NYRA 5DSXA 3RV3A 1YIDA 4MRMA 5KVQA 4XVHA 4LJLA 4NBTA 2VAPA 2R2GA 4XB1A 3N6XA 3KQNA 1D4AA 2CB9A 3GGOA 3P2OA 2O57A 2MIIA 3BD6A 5KEIA 4WXMA 1U8UA 4FGWA 2A9JA 3BMOB 1TOAA 2AZMA 2WG1A 4J4TA 2B4TO 3SSAA 1HX7A 1XA3A 5CITA 3QPDA 3M6UA 3KB8A 2LTAA 1BTOA 2NSYA 5HR5A 3N53A 1Z35A 4EP1A 3IUQA 3MT8A 1PJRA 4FQ8A 1ZMOA 1MGPA 5FOTA 4OYLA 1P2TA 2FEPA 4O08A 3SPXA 4UMEA 4B46A 2VP9A 4AG6A 4ARIA 3QPCA 3W78A 3U80A 1CUYA 5ESRA 3W79A 5IH7A 3ED5A 2WSBA 1KI8A 2QNBA 3ZV5A 3MFIA 4Q8FA 2XRZA 1NF9A 1F5NA 2AQHA 1MTOA 2YASA 4WNAA 5AM0A 4FD3A 2NUAB 2NNWB 6REQB 3UAGA 3S0JA 5KNBA 1V26A 2CL6X 1C9NA 1I1MA 2WAQE 2RBGA 4XIFA 5DX1A 2YXPX 3DLBA 4CLOB 3PLRA 1J0CA 5AJUA 3FKSD 2BFEA 5LQKA 2FLWA 3KEMA 2FPUA 2PX8A 1Y7PA 1QQ6A 4DRZA 3PPVA 1KVRA 3GN2A 3CISA 1S10A 3RS4A 3TW8B 1A48A 4OVKA 3SOPA 1BCSA 4X20B 1ORDA 3DR5A 5DG9A 2ZLBA 3O4GA 1DV2A 3IUSA 4F7WA 4CEHB 4Y1GA 4DV3H 4G5QA 4L85A 4UCWA 2JFWA 4QFMA 4JLOA 4GZ5A 3RGWS 4ZV7A 1XEFA 3EFOA 1FRNA 3O2SB 4A3CG 4BL5A 1MAVA 4YP1A 4EELA 4P8RA 1F2VA 4AF7A 4BQPA 5BUZA 4QPNA 5EVCA 2QUJA 3MGAA 2JEGA 1ISFA 3K2EA 1M8FA 5G0UA 3OJLA 4DQKA 1X7XB 4DBZA 4HVCA 4MR9B 4O7WA 2WIBA 4EG7A 1AHHA 1EZ4A 3JAWA 2YBDA 2VJMB 5EN4A 4TMXA 3QEBZ 2G07A 2I7TA 3FX2A 5HKOA 4BLSA 7AT1A 2WSIA 4WLOA 4TYWA 3HABA 4OUDA 2MYTA 2AR9A 3GGSA 1CETA 4Y2UA 1T8PA 1NQVA 3D81A 1N78A 2XGQA 3IS3A 2ZXEA 3DAHA 5LC1A 7MHTA 4NQZA 2IYUA 4WADA 3LPAA 3LX5A 5FUMA 4LVUA 3GBVA 2QSZA 4HWOA 4KRGA 3TM4A 1IJEA 4MWTA 4UUBA 2RONA 2JZNA 1M6VB 2AGOA 5B3LA 2OFPA 1NVBA 1JE0A 3S2YA 1EG7A 1Y4DE 4PZYA 3LO5A 4Q3AA 2IPAB 1SC3A 3GHHA 5KFOA 5KWSA 2VJBA 1N57A 4DA7A 3QF4B 4OFBA 4MYTA 1Z5GA 3KQHA 4WA8A 3WLJA 4ZVVA 3NDBB 5KOJA 4HNRA 3F5FA 1WXIA 4K8RB 1Y9JA 3ORHA 5LNK6 4N82A 1DX9A 1QZZA 1UM8A 4IUCS 3UOAB 1W1UA 3JTMA 3TIFA 3FOEC 5BWRA 2FFJA 1HSZA 5FTKA 1QH9A 1H6DA 4C29A 3FBTA 3G6KA 1K9SA 2W37A 1EJ0A 3BRCA 3TVTA 4DLAA 2FLPA 1EVEA 1Z28A 2VXOA 3ORFA 4OXYA 4YHHH 1B26A 3C45A 1TPYA 4NH4A 3IEKA 1WKVA 4EATA 4IRDA 1HDGO 3TECE 2JFGA 3IIIA 4YRIA 1EJ6A 2X6RA 1GQQA 4R9SA 3BZBA 3ZHSA 1HLDA 2HF7A 4IFIA 2E2WA 2WUDA 3EG5A 3SXUA 1VJGA 5LZ5A 2JCXA 2CV1A 3BH7A 3KYDA 1LLFA 2F3RA 2HCRA 2WMOB 3IT3A 3KZCA 4LKRA 1VAJA 3UUFA 3NIGB 4KYTA 3ZS9A 2AZXA 4S04A 2XVYA 4DJFC 4TROA 1H8EA 1EHIA 4I50A 2Y92A 4B34A 5K3BA 2W8ZA 4OBEA 1KVQA 3EAQA 3DKPA 2F9LA 5DAAA 1KAGA 3E7FA 3TGWA 4OYHA 2WTNA 5HQJA 3S8YA 1GG8A 2C83A 1U9JA 1JXMA 1P9RA 4UU7A 3CVOA 2I03A 5CCBA 3GTPA 1T6BY 4F5DA 1GL3A 2NO1A 3RRMA 1DRUA 1WEHA 3HXTA 1PZNA 4ZQBA 1SULA 4R83A 1EAYA 3GUUA 2IC5A 5LZ2A 3WRVA 1GYRA 1GP2A 3GV5B 2IXEA 4NDZA 3FZEA 1VKJA 1H8HA 3OZBA 4C4PA 1RRGA 2R7MA 4YUZA 4AP9A 4N6OA 3QKRA 1TNDA 2C4UA 4PZCA 3JQ6A 3FRHA 1YJXA 1X1EA 3OQNA 2IDKA 3ENVA 3JVVA 1XTIA 3BTSA 4HDSB 4MQUA 2A1TS 4NS1A 1EEXB 4YMWA 2WHXA 2R7NA 2QTHA 2QJFA 2J0EA 5CXQA 2P35A 3U17A 4CN9A 2WNSA 3ZY3A 4RNMA 2QSUA 1B8VA 4IMJB 4O7SA 1JFFA 1VOTA 4K9OA 2BR3A 3T5CA 3P0FA 5FJJA 3WS7A 4RNOA 1X74A 3EWNA 1CZOA 1ISHA 1GTJ1 4MPRA 1CUVA 4OHBA 3MWFA 3IXMA 1T2AA 3VYWA 5JFTA 4UM7A 3LX6A 1JWLA 3GLVA 2FPXA 3MTDA 3ZXIA 1OROA 3D8RA 3U4MA 4QX6A 2E9SA 1RBYA 4YGXB 3GNLA 4HN4B 3JYOA 1TJ4A 1T6XA 1VDMA 3FPEA 3T1TA 4DOMA 3ZZ1A 2OUIA 2ZIGA 1MVLA 2SECE 2CNUA 2TS1A 3IQFA 4ECUA 1YCHA 2B92A 3AX6A 3WWCA 5D6NA 1ZXBA 3DL0A 4DLNA 3JSXA 3T3DA 3WIBA 4G5FA 4PR0A 3WNBA 2GCIA 5E6UA 1JP7A 4K88A 5COQA 2VK1A 2MYNA 4TS1A 5GM2A 3S3TA 2IE0A 3EZ6A 2OCAA 3VO1A 1ZD9A 1JALA 1HLFA 4JI8H 2AI3A 1YVEI 3T3EA 1JAHA 2BY4A 2AZ4A 3KSRA 2FOIA 3NHAA 3BGWA 3UQZA 4NEQA 4JB8A 4RB3C 5MFPA 4BS9A 5IJ0A 1R27A 2FN4A 3FHJA 1A8HA 4LNUB 4J6EA 4PO9A 1T9AA 2XD9A 3CO0S 4U9HS 4Y2XA 4UUNA 2HN9A 5AI4A 4TM7A 5DLFA 1DTWA 2QW1A 4JIGA 1UJ4A 5JH7B 2GBCA 4HYKA 3OE7D 4J4HA 2OT3B 2DWQA 5JMWA 4DRXB 4CM9A 2O2JA 3CLTC 1VECA 3SIWA 2V74B 4IDOA 4DUGA 2XDWA 3V4SA 4B76A 2ZM5A 2ZQZA 4Q3BA 3SG0A 4W5WA 3ZDRA 4EGSA 2EKQA 4X84A 5FBLB 2XKKA 3ZDXB 2VJYA 3LC1O 5CIQA 2C42A 1YJQA 1MC5A 3GFPA 3SQXA 1Z29A 3Q7QA 3WL5A 1KUTA 4DC9A 1G21E 2OFOA 5U4QA 3ZHVA 5KC9A 2OL4A 3MWEA 3ETEA 3LLCA 3BGVA 1FDSA 2VF8A 4C07A 2QJOA 6GPBA 3CC8A 1XTPA 1XZGA 3ZI4A 4M1SA 5DQGA 3GRZA 4YR2A 2X7JA 4H7EA 4OGWA 2VSXA 1XNRH 2YFYA 4RB1A 3E84A 3JW8A 3OU6A 1CUIA 4NFLA 4YAKB 5ENDA 5EE5B 2HDNB 1QFJA 1XU9A 3LGAA 1Y3DE 3RS2A 5IJ9B 5CTJA 1XQXA 5DRTA 4IOMA 3QMWA 4OXXA 1FMJA 3WGNA 2ZXUA 1HY3A 2OHHA 2WKWA 1DWUA 1BKDR 5BSHA 2ZIFA 4O7RA 4DJTA 2P5UA 2ROQA 1E5VA 2RARA 2H5JA 3LPDA 4BZXA 2FMFA 3DEKA 3THSA 5ARCA 1PJBA 2HHHB 2UVRA 4XCVA 2EWMA 2OBBA 3FOFC 1N2GA 2YINC 3NUQA 2R8OA 2VJNA 2JLQA 3ZE9A 1PZXA 1ZO8A 1MAHA 3OOSA 1XB2A 2FXVA 4KSCA 4ZJYA 3KHRA 1AQJA 4RVHA 1FUKA 2CNKA 4DPLA 4HB3A 1VG1A 3BWEA 3FB1A 4JYAH 1AKVA 1EVIA 3F0TA 1YXMA 4R05A 1JHXA 1YTLA 4OOFA 3SHOA 3ZLJA 3L9WA 3FFTA 3VNQA 1U3FA 2Q5HA 8OHMA 5LD2C 1M0EA 5I4BA 4UTXA 1XDUA 4OIFA 4C5BA 4Z86A 3VNBA 5E9JA 3CUTA 3ABQB 5AICA 3UMGA 3I32A 1KVSA 4XQ0A 3K0AA 2P1RA 1NFRA 1L5LA 4BLWA 3NKLA 4RUAA 2PE5A 2C59A 1Y7LA 5I5EA 3HB4X 1KS2A 1C8BA 2ZTMA 2XT0A 3RTDA 4X64H 1P5HA 5KSPA 1IZYA 4YT5A 4HNGA 2YHAA 1UBMS 2VQSA 1SZCA 4JA2A 4TL8A 4PR3A 3F3YA 3FFWA 4FLMA 5H9WA 1U80A 3EA0A 1H2RS 3JALB 4Q44A 5AVTA 4H9GA 1P2BA 3Q7IA 3FOZA 5E6SB 1SRQA 4WOJA 2PVPA 3ZXUB 1ZSYA 4DQDA 2DUUA 4ZRNA 3VYSB 3HCEA 1XJ5A 3DKKA 3SE0A 2VQEB 4TKVB 5I7SA 3CE9A 1OIWA 4PICA 4EHNA 4ARUA 5JDIC 2DLNA 1TVEA 2FPKA 3BTOA 1T35A 4DLSA 4ZV9A 3QTBA 4NMXB 1Z2PX 3L06A 1M1XB 4FJ2A 3EW9A 1G2OA 2E4AA 2F43B 4HAUA 3I45A 2HIHA 5IULC 4D0GA 1Q91A 2KSWA 4MUJA 1DMRA 5JC1A 1IUPA 1U0TA 4G0WA 2XNSA 4ITUA 3PD7A 5ESXA 5FPSA 1POWA 1GD1O 3L8YA 2XWSA 4G23A 4FGKA 3N41B 1B73A 4INAA 4UQPA 3WAGA 3HZHA 3ZWPA 4UE6A 1ENZA 1TYEB 2BM1A 8ADHA 3ESYA 2NMVA 3IO5A 3UMFA 1E0SA 3TRFA 3BDAA 2AEFA 1YC5A 2AVDA 4O25A 2IF2A 4RLHA 2OVFA 4D9FA 3UK1A 5DYGA 1N1DA 4YAUA 1I14A 4N5NA 3F5DA 4HDKA 3ZGNA 2VHQA 1E64A 2HCFA 4EYKA 4YAWA 1JHMA 2J5RA 2UUOA 1JQDA 5ECDA 3WGJA 2WFZA 2W9CA 3AI3A 4K1LA 3ACDA 3GYBA 5J40A 3Q8RB 4FHDA 2PKRA 2C9BA 1PVVA 2PK3A 4YFVA 5BQPA 4EUSA 1IOZA 2QYOA 5KINB 3GIQA 3NP9A 5SY4A 1Z08A 1LF5A 3IBYA 3PXUA 4MP3A 4HNQA 2RHTA 1SB8A 3QXXA 3A28A 3RBXA 1G8AA 3GCZA 4UNQA 2DX7A 1GPYA 1Y5IA 1ZL0A 2H1OA 3WIUA 3AWDA 3Q0IA 3PDHA 1MB3A 1KIAA 3ZWYA 3A1NA 1PF7E 4N7RA 4K6HA 4LJ4A 2J31A 4DCNA 5E4YA 5LQJA 3UAXA 1L4MA 3LVRE 1U0EA 3NU1A 4BXOB 3L7CA 2CZGA 1Q0SA 1NU6A 3P45A 2XE4A 5FWYA 4WXYB 4P93A 4YY3H 1GGOA 1H66A 4M7RA 1FTQA 4MVJH 4IIEA 3OZFA 4JSTA 1FVHA 2VTBA 3D3WA 1NBMD 5C5EA 4MI6A 2DJIA 1RKVA 5TNXA 5FUQA 2D5AA 2C2EA 4AROA 4O4IB 4TTRA 4E1AA 1OZHA 2E87A 3AV3A 2Y1XA 3O0DA 4B4KA 2A5DA 3RB8A 3C70A 1XCLA 1Z45A 2EKLA 1C9KA 5IXSA 3DZHA 5HZMA 3DUFA 1L1FA 4J9SA 3AERB 2IHJA 1MC4A 2QMZA 4NJEA 1UMCA 5KB3A 5HMMA 1Z8DA 3ADOA 2QE7A 4CEIB 2YWHA 4G5OA 4XW2A 3AEKA 1MRSA 4Q34A 2Z43A 1BGVA 5EZYF 1YDFA 3MILA 1KJQA 4GLJA 2QLNA 4DXDA 3E8MA 3I1JA 1MN6A 4KQCA 1MJNA 1P77A 5DPMA 4AZ0A 2WUFA 1Q15A 2V0CA 3RAPR 2AIRA 2CFRA 1QPGA 4HNUA 1XNQB 4IM7A 3RUHA 3ROGA 1DXYA 2MOKA 4WT7A 2Q4BA 1OIVA 3D4BA 1YBVA 4N5LA 3B7PA 3J7AC 5JAHA 4N0PA 3GCXA 3HXMA 4R9NA 4EY7A 4GKJB 3ZIDA 1CUFA 2W4IA 4OH7A 2JLWA 4UVIA 5IDQA 1ZHQA 2EKDA 4MQFA 3PNKA 5AWFC 2ATEA 2FSIA 4FHGA 1PNRA 1JEAA 3K70B 2EGUA 4RHUA 4HNAB 4HB4A 2ISQA 2ZSHA 3I9MA 4BY1G 4I5DA 4F5YA 2P6PA 3OETA 1JR3D 2HCBA 3E7XA 5F9FA 4RUKA 4B87A 3O7WA 3U48A 3IPAA 2I6XA 1KI9A 4G0MA 3UTCA 1ST2A 2BGNA 1PVDA 4KIJA 4QATA 4Y9TA 4G0XA 5AI5A 3KRTA 3I2IA 1T2FA 1G6Q1 4KE8A 2X5RA 5CLIA 3SHTA 4LF4H 4O5OA 2NXCA 3BWBA 4E15A 2FZWA 3MRSA 3FUUA 4UBLA 1XDNA 3QITA 3T7TA 4PG4A 3ZCUA 3F8SA 4E4YA 5KJEA 4KUEA 2QRZA 5FBKA 3VXKA 3K71B 5KYXB 2ZR9A 3GIIA 2HGXA 2N3ZA 5F12A 2J48A 4MA4A 5KYYB 1Y42X 4DWWA 5K0ZA 1Q7GA 2B3DA 5L3SB 1OYWA 1HDZA 1YKSA 3PQ3A 2OP0A 4FYYA 2ILVA 3SVZA 3U31A 3KXKA 1WABA 3RC9A 1C7IA 2NP7A 1I3OA 5DG7A 2ZE6A 2ZANA 1T8YA 5CLGA 2A1HA 4DZTA 2HSWA 2E4WA 2QRJA 2EIHA 5IYCG 5FTWA 3U40A 2TMDA 1ZJJA 4W5OA 1QX4A 1UPTA 3GRFA 1U98A 3U5ZB 4YT2A 4HZGA 1E62A 2HRRA 2Y9PB 1HXHA 3AB8A 4HAIA 4QSHA 1NP3A 2N1BA 4B6FA 3GARA 5IHPA 2VOJA 3K0CA 4J43A 4D2IA 2I7VA 5HIIA 2ZDHA 4NNJA 1C30A 2COJA 1PVOA 4F4XA 4K9DA 1VM6A 4H15A 1YQDA 3FHLA 1R9GA 4TTTS 4H6PA 3RBZA 2FEKA 3B85A 3UJDA 3SWWA 1PTJC 3RKSA 4BAZA 1P2SA 5DGXA 4AJOA 1W7AA 1DT3A 5HTOA 2HIXA 4HP8A 4P4LA 1E2MA 4BX9A 1CB0A 3V6JA 5GIOE 3EZXA 1L3IA 1KU0A 1R6BX 4WOKA 2VHWA 4AZ3B 3KS9A 3HYCA 3C6QA 5K3FA 1CIPA 1MEEA 4CV3A 3PW2A 3UMMA 3KHSA 4ZVMA 4AZWA 2P9FA 2FEAA 2CFCA 3IQIX 3K16A 4ID3A 2P2DA 2WJ6A 1W36D 4FHCA 1ISSA 3BF8A 2GEDA 3UY4A 2H8KA 5HIMA 2Z9CA 4YRCA 4MGEA 4KLAA 2C9OA 2FFRA 3DTGA 4R1PA 2BE9A 4BNUA 1CF4A 3WKCA 1ZD4A 3BHIA 5DW3A 4UUMA 2ZJ4A 3PNLA 3WWZA 3SU8A 4CF4A 3IUBA 4NJMB 3MLAA 2NPOA 3S28A 3G5MA 2A1UB 4W8GA 1FUEA 2VA2A 2ZREA 1XRQA 4I1OA 2X5KO 1H3EA 1LDBA 2WICA 4EEQA 3Q8WA 3OSNA 3EGDB 5ITWA 4J16C 3V1KA 1WXHA 1IDOA 2JA7A 1ZK2A 2FR8A 1WSWA 2YR0A 1JDJA 4HSEA 2Y1LA 3L4EA 4G2NA 2R8ZA 4TQAA 1WVMA 2VDQB 3TZCA 2BEUB 4CKEA 1JQBA 2ZK7A 5F7JA 3TZEA 2AWOA 1XTVA 1JKIA 4UM5A 3V33A 4F2PA 2UVPA 4M8SA 1H4SA 4QDJA 4A8JA 1ORWA 2G09A 3D4PA 3IP1A 5KNDH 1KEEB 1Y4AE 3WGYA 4OJMX 1JR4A 5DT2A 5FI5A 2HREA 1RLTA 3L40A 3EC7A 5AH0A 4XEHA 1G5IA 3MJVA 1YVPA 3D7NA 3KUKA 3NW9A 1XI2A 4NBUA 5C1PA 4CI9A 1W4CA 4U3JB 3EVDA 1CEQA 2NN3C 2H9YA 1B42A 4Y2RA 3CX7A 5HTKA 4M7WA 3SSMA 1CR1A 2YC4C 4J9MA 1SUDA 1JHUA 4TRMA 4QT0A 1ZNWA 5AM3A 1JDBC 2J6UA 3NVAA 4WW0A 3RYFA 1EINA 2EJ0A 4GZ3A 4B3CA 5C5JA 4AO6A 4KLRA 2VA3A 1OX4B 4JFRA 2AGVA 3KKNA 2CF6A 4PYKA 2OHVA 4DL7A 3OO0A 3L6OO 3FY4A 2P69A 1Q7CA 2ZYWX 2K7FA 3MGCA 3SEFA 1ULBA 1M1ZA 5TJ9A 5F2KA 5A4DA 4AJJA 4BRWA 4RPLA 4BQSA 2ZAOA 1GSIA 4BNVA 4FMBB 2R92G 4CIAA 3AUKA 4BNMA 1EFLA 2ZYTX 1C1YA 2C20A 1TLFA 4YR9A 3SDZA 3CA8A 2XMQA 2YV3A 2SBTA 5EQDA 3MQ2A 3M5CA 2BCJQ 2QA5A 2C3MA 1VCNA 2I6QA 3HYLA 4JUIA 1XKXA 1VLMA 3W5HA 1LB1B 3V6MA 2PRYA 3M2PA 5H0IA 1X2BA 4IDPA 4C2TA 3UUGA 1KQ3A 2GD6A 2VOEA 3Q4GA 4PO8A 2LW7A 5JSFA 3VPXA 3OSUA 1W44A 2YY5A 4A6PA 3IJRA 5CPFA 3VBCA 4MA0A 2XADA 5I7VA 4V0QA 4LVOA 1CR4A 4OL0A 4I1SA 4YRSA 4RVUA 4CRWB 1ZI9A 2PZFA 3QZUA 3KJIA 1QRAA 2HK8A 1JXAA 4J7XA 3O75A 3W5CA 3URMA 3ZCPA 3EISA 4EJ6A 3HJCA 2BEJA 2YC2C 4OI0A 4OSOA 3U09A 2WSYB 4B6SA 3FR8A 4EUEA 4UTNA 2CYBA 3ILXA 1TM1E 1WNFA 1TMKA 3I01M 2OZKA 2JA8G 5HK8A 4EL0A 1QOPB 2O2YA 4B5LA 3EVAA 1I3CA 4LOJA 1JFSA 1DQYA 2A0YA 3TW4A 3KQLA 1G6OA 1MOQA 3E9RA 1OHHA 4OMCA 1YCGA 3GIKA 5AHXA 1NPYA 4X65B 1BYIA 4UHHA 4BMDA 3IP3A 3VC3A 3GGDA 4D0NA 2J30A 4MKRA 1RABA 4DR1B 2V1XA 2I4IA 2PGNA 1J2YA 2DHDA 2Y0CA 4OHFA 4IOKA 2R82A 4FR0A 4JITA 4C4YA 2D7JA 2V98A 3NALA 3MTEA 3T5HA 4G01B 1MENA 5ALPA 3VO8A 3TJRA 1ZITA 2VUTA 4M1ZA 2H65A 4C20A 3CH6A 5FNVF 821PA 2JFVA 3LF1A 2WG0A 3DONA 2PR7A 2G1AA 4H77A 5C5DA 3G1TA 3RC8A 4F3YA 3WWYA 3VHQA 3G49A 5EMKA 3ANXA 1F7UA 2XOKA 4OKSA 4HDRB 2ZT5A 1KR2A 1NRIA 3T3NA 2GJ8A 3OPYB 3H8VA 4MPTA 4CQMA 1EUCA 1SC1A 3L8GA 4TLDA 3JWEA 3PNPA 1TECE 3VR5H 3R5KA 1O9HA 3WKBA 1KI1A 3V9PA 4HEJA 5GWXA 3URKA 1NONA 3N2GA 1BX3A 2YTZA 5JJBA 3QPUA 1NATA 3GLUA 3X1ZA 4B6JA 1Z12A 5MHTA 2WSLA 2PKYX 1TDJA 2XDYA 2P9QA 3V8PA 2YOHA 1YRQA 3O31A 3FHCB 5AKYA 4FWTA 1K2VN 1C7EA 4DJDC 2UUAB 3PIIA 5J2TB 1X7WA 4MQMA 1QRRA 3D6NB 2JGFA 1WDMA 5EAIA 4E70A 1GNRA 2UXBB 4DNPA 1Z6YA 1ZL2A 1C81A 3KOYA 1DOHA 2QM8A 3B51X 3CXUA 2BFNA 1L8OA 1KWKA 1PR4A 5FXMA 1E7QA 3WMGA 1I4OA 3U3XA 4AICA 3CRVA 1OGYA 1FVIA 1O3YA 1HNNA 2OBNA 1U5BA 3CHYA 4K03A 4OHOA 2BMJA 3V8EA 1UZLA 3JWJA 2W6PA 1UP4A 5ES3A 1KJJA 4DL6A 1U7XA 3QNWA 3BJZA 5CGZA 4ZKEA 3OZIA 1LD3A 3JPWA 4GKKH 2QT1A 3HUDA 4LWOA 4D3YA 5IRCD 4N0MA 3GMTA 3MJHA 2XYHA 4MV8A 1XMXA 4TN5A 1KSGA 2CDRA 2QR2A 1XTTA 2JLZA 4ECZA 1YUMA 5FPOA 3OJEA 4BP1A 3BD8A 1L5ZA 4PSKA 1USGA 2GN8A 3MINA 5AVRA 5ECGC 5E4JA 5IH3A 3HMKA 2WYIA 3R7BA 1S7CA 2R751 4D9KA 3FG9A 2PBLA 5FWNA 4BTLA 3O9MA 3ZKAA 4E2YA 3KUUA 4B7ZA 2ZKIA 5FPPA 2VNAA 1YB7A 3HKDB 1P29A 4DG5A 4DGSA 3FPJA 2ASVA 1N6LA 4GPEA 2OYCA 3NJRA 2H00A 2GO1A 4WH0A 1Z73A 4CV1A 1K4KA 1AUXA 1TB4A 3R75A 2EFCB 2GM4A 3MQFA 3FHTA 4DV4H 4HX9A 3BIOA 2GCGA 3A3YA 2LZ0A 2PX0A 3H0GG 1YRAA 1CE8B 3O73A 3E03A 4L73A 1FIUA 2XI4A 3WIVA 3U19A 4EEKA 1E1CB 3C43A 3W2FA 2G7ZA 2IUYA 4Z7OB 1GRVA 3PFIA 4CBVA 2WW8A 4HAOA 2FWMX 1P9OA 3UQ8A 3GZTB 3UHOA 2I65A 1NLYA 4YCSA 1OXTA 4CM5A 3HR8A 4F12A 4LYHA 1S8OA 3HMQA 1LRLA 2HPVA 2WM8A 3LIIA 1HF3A 3I2HA 4CXMA 3O8CA 3WRYA 4JT2A 4UAUA 2R79A 1IAQA 6PFKA 1R8XA 1MW8X 1L7OA 1R0WA 1TA0A 3TUZC 4UHDA 1Z82A 1N6RA 3E7PA 2XQGA 3JS5A 2ORYA 1AZTA 3DWEX 4YJFA 3QI2A 4UTVA 1X9NA 3BREA 1Y6RA 1SKAA 4GVLA 1PR6A 5HKBA 3ZIAA 1V8OA 3Q88A 2QT9A 3OT5A 2HX1A 4DW8A 4BUJA 5BSFA 5ALJA 1SN7A 1AKTA 3L1KA 1ORVA 1RC0A 2J0UA 9LDTA 3CPJB 4L9WA 2X14A 5M7EA 1YQGA 1UQUA 2P2LA 3HNRA 4R2IA 5BN3A 1E2GA 5C32A 4D46A 1RXYA 3G7UA 4YH1A 1QHIA 3UF0A 1AUVA 1ZU5A 4DV0B 1N0WA 4G4SP 1WXDA 3CT6A 4HEA1 3HXQA 1EM6A 2ASEA 1I6KA 2G4LA 4EFKA 1OVGA 2F3SA 5DNVA 3RAQA 5KWEA 2O2GA 3LWZA 4EK9A 1FL9A 4G63A 1ZNZA 2V4MA 2AI2A 4TQRA 3G9XA 5CT6A 5DQIA 1EUYA 4A3FG 1NM5C 2OLJA 1RAFA 3ZZNA 4HWTA 3A2NA 2Q50A 2D6FA 3L6RA 1OLUA 1KFKB 1RHUA 2YNMC 1W5EA 4ZEMA 1OW3B 3NNNA 2AG8A 1U7UA 5EWGA 1SKUA 3FOAA 3X1YA 3O9ZA 2C8VA 2F8TA 4IKPA 4PYIA 3IJEB 3PBKA 2P27A 4EB3A 1DIOB 1QTNA 2WJJA 2D5BA 4HDNA 1VBMA 4C88A 2CL7X 1NQWA 1C9JA 5LQDA 1R8YA 4C2AA 3I30X 2Y77A 4J8PA 3A7DA 2RD2A 4K7JA 1QK5A 3LBAA 4YBRA 1MO6A 4N8SA 1V5EA 5ESDA 3KHHA 3BT7A 3GVCA 3BGSA 4F60A 1Z6ZA 2QAGA 4KAJA 1P17A 3UV6A 4QAJA 2PAAA 4KTTE 2ENUA 3C4QA 1OLXA 4LSGA 1RI3A 1ECCA 2XOEA 1DKPA 3EXG1 4ALNA 5K0SA 4TUYF 2ZVPX 4G0OA 4FS3A 1VPTA 2B4AA 4V0OA 3LUCA 5JJCA 4C3VA 2OXCA 4BRZA 1U2DA 4IQ0A 3NT5A 1BXGA 1P31A 3FPSA 3R3UA 4QYTA 5FD6A 2PUDA 3UZBA 4UBMA 3QBJA 2UDPA 4IUDS 1BFUA 2HVQA 4ECQA 4DJJA 3Q2KA 4QQFA 3CE6A 3R09A 4ER6A 2RHGB 4H16A 1CUBA 1J2TA 5DCUA 1ZHOA 3D7SA 3DCYA 4FKZA 1HFWA 5K0BA 2CNNA 3I5YA 4YRFA 1L8AA 4F85A 1E9SA 5J4KA 4OP1A 1NP7A 4PNZA 1ND5A 1MAUA 2ACEA 3BRWA 1GZ7A 2FZCA 3MD9A 1W73A 2DWCA 4HBGA 3I73A 4L16A 4BJHB 2PUAA 3DZBA 5BMOA 3KX2A 3QV2A 3O3MB 3BACA 2ZTUA 3GA5A 2XUOA 4FWIB 4GOOD 1FRFS 4K86A 4G9EA 4O2AB 3W6OA 1NVVR 4QYXA 2VQDA 2HCJB 2BH9A 1NW8A 3NHRA 2IDJA 4Q4AA 1WCYA 1EB9A 1NKTA 4Y2GA 4JLAA 4GPBA 4M9QA 4NFHA 3JQ7B 4J9VA 4C0LA 4X8MA 2H57A 1GUYA 1T3TA 2CB0A 1ODFA 1ANKA 1UK8A 3ZQKA 3N28A 1B41A 1SQGA 1NC1A 4MUXA 3GLFB 2AG0A 2H06A 4AJLA 3TRDA 4ZV4A 1BFDA 2V9PA 3PUHA 3L77A 1C4XA 4HFJA 5JASA 1IM5A 1QF9A 4FYJA 3V32A 3KJFA 2CVZA 5FUYA 1USUA 2JVJA 4FLFA 2GPAA 4HYEA 2XITA 3AVYA 3KO8A 1S8FA 1C7ZA 3WGUA 4ZEVA 4KBFA 3SZUA 2H0QA 1K6MA 2UZAA 2YJ5A 2XUIA 3HOXG 5E4TA 2D5IA 4RXTA 3BM5A 4EQZA 3JQAB 1X3LA 1PFVA 2W2VA 4ZDKA 1PNQA 4RFSA 3O8DA 1AG9A 4F6RA 1S1MA 2XMCA 5DBGA 2G70A 4ARZB 3W7VA 4MUHA 3I9NA 1HWYA 3AUSA 2BRUC 2QMYA 3B38A 1ZVJA 1NVGA 5G4KA 2D0PB 4J3JA 3QX3A 1TAEA 4A5OA 4EDHA 3GLFE 4AXXA 4UHEA 1AVTA 4P38A 1XFAA 4C03A 1RC8A 1ZOPA 1BN7A 1NJ2A 4EFNA 3HBJA 2FG5A 3AFOA 5EZYA 1P60A 3F90A 5EIEA 4P54A 3QU9A 4UCTA 4QJIA 3TX2A 2YBEA 3IMEA 3WWIA 3FF4A 3H5WA 3HFRA 1L7AA 4NYMQ 3KELA 4E08A 1LW7A 1PSDA 1IB0A 2O2IA 5LP6B 2HUPA 2N47A 3UK7A 1X39A 4Q7KA 1EA5A 4HUJA 4U6SA 1OY1A 4KJXA 2SHKA 2CFMA 3MJDA 2OGZA 1J8MF 3EGOA 4Q82A 3O1LA 4AD8A 3GTKA 4GI7A 1QP7A 2XYRA 3COVA 4Q12A 3FDXA 3BWMA 3WK4A 5E9WA 1YQTA 3T94A 1SBCA 5LPNA 1Y3FE 3QWAA 2CKZB 4YGYA 5I60A 2Y8EA 1QLJA 2XA9A 1XZCA 4XPIB 2C5FA 4LYAA 1S89A 4LECA 3O26A 4Y18A 4QYSA 1SU6A 2ZYGA 4FCVA 2O8DB 4X54A 4G56A 2P62A 3GFBA 1Y1PA 2OECA 2AC7A 5JSZA 4A26A 3LX4A 5LDHA 4LI3X 1VSTA 3GMSA 5HBRA 3VH1A 4WEQA 5E1OA 1Z0SA 2TRSB 3RS9A 1E9VA 1WVIA 4HFRA 3MJCA 3RI3A 3T35A 1GA6A 4N3BA 1W2HA 5IF3A 1PK9A 4OHYA 3QUQA 2FW9A 1BEUB 4BFWA 4OO3A 1CY7A 1WZNA 3ANYB 1N32H 3L7KA 1CR6A 2HD4A 4X71A 1V16A 3ESCA 1RYEA 5TT1A 3RF7A 1GR0A 3H1GA 2EZ8A 4OQFA 2G5GX 4BRSA 4HS4A 5MN5A 3B53X 4RSMA 4RV9A 4ZCSA 1A9YA 2ASJA 2ODEA 3FSJX 3D6VA 3K4QA 4UAVA 1SXQA 4KB5A 1N5DA 3P0HA 3QW4B 4URVR 2P4EA 4FT4A 2GPYA 4KO8A 1S9HA 1GFZA 4IIJB 1TGYA 4XRGA 5BSVA 2XA2A 2PWZA 3KB1A 4EITA 5F3RA 5J2UB 1N9GA 1IBRA 2XECA 4ALJA 2D0DA 5D8DA 5IZ4A 3EAFA 2F62A 3H4DA 4HQRA 2E4ZA 3GUYA 3K3VA 3JAKB 2C00A 1RJGA 2UVVA 3ROPA 1LBEA 1MHPA 5LOVB 1JVNA 2QMUA 1ZNQO 2FTKE 1IEQA 4NOKA 3OCXA 1WETA 1XNHA 5D1HA 4BHTA 2Z6AA 4CGYA 2BEKA 3SF0A 5DBEX 5CFZA 1EK2A 4CIXA 3NTXA 3RRFA 2AUMA 2DKFA 1YASA 4CVNA 2VCYA 3CZ9A 4ZA2A 3DE1X 3TFQA 1MVOA 3QKSA 4D8VA 4GPAA 1RWBA 5TPZA 4QPPA 1D6JA 4RU1A 3WKEA 2VWQA 1K5DA 2RH5A 3K0HA 1KDYA 4KQWA 4YONB 2WYOA 1RQ7A 2WFLB 2X0KA 2HTEA 5FQNA 3K1JA 4BEJA 4XWYA 1ZINA 1HEUA 3QVMA 2AGPA 4Z53A 5FLYA 3AR2A 2A6PA 2CLLB 5GAJA 4WBNF 3GRRA 3QFFA 1C1XB 2JHFA 3W1EA 1L7BA 2I5PO 3A9SA 3T9EA 2OB1A 4RM2A 5GGXA 4YP0A 2NO7A 4GGPA 1FS6A 1CY1A 3UJ9A 3GEDA 3RUPA 3LBNA 4KPYA 1T2NA 1AZLA 1X9HA 2LRHA 1X1SA 2GLXA 2PZAA 1VRWA 3G2NA 4H35A 4QYWA 2AXNA 1ZUWA 3MFYA 4AKHA 1IB6A 2VK4A 3VU9A 2LUOA 3LNTA 4EMUA 4GR9A 5IJZA 1GPJA 2EWVA 2ZYIA 3AB7A 3LCMA 1IRIA 4E5DA 1UANA 2WKQA 2FN3A 2C0QA 4B31A 4EAAA 4KMOA 5LZ7A 2GESA 1N2ZA 1DAHA 3BJRA 3X3HA 1F2DA 3QM1A 4ZEOA 2NO4A 3L6DA 1XVUA 4YQEA 1DQZA 1N6KA 1TCUA 3LUDA 2JIMA 3VTKA 4O2BB 4ZEXA 3M1AA 1ZI8A 5JXJA 5B64A 1J0EA 1M6EX 2JFOA 1P5RA 4HPJB 1DOAA 3CKYA 5JS6A 1DJPA 4Y67A 5HJ5A 4UM9B 1YQQA 5BWXA 4B6QA 3AHEA 4DQLA 1KZ9A 2UYCA 1QYCA 3U7RA 1PHRA 3F8TA 1XRNA 4E2XA 1RXCA 4MVJD 1JSLA 2XIGA 3RBVA 1MRZA 3QLVC 5TQJA 3Q2IA 1E3WA 3OBBA 3V2UA 4I99A 3FR7A 2OCIA 3G2OA 1HR0B 1PR2A 1XXLA 2HA3A 2OAGA 4RKEA 2QR5A 4QBKA 2GN9A 1X2EA 3LQFA 721PA 4P4UA 2BISA 3SQMA 3QHQA 2PD3A 1MOSA 4MLPA 3PQFA 3DTTA 5IBPA 5AVSA 4CMFA 3OHMA 3D5EA 4BAGA 4WD3A 5KQPA 1T1SA 3P20A 1PAUA 5TF0A 4D42A 3UFXB 4L22A 4TM5A 2EZ9A 3IAAA 4Q48A 3OU7A 3P96A 4QHTA 1F3OA 4YO8A 1BROA 3WO0A 4UUGA 1VBHA 4TV9F 1QTIA 3A4VA 2G36A 2RHHA 1YMQA 3HS3A 5A6SB 1R0KA 1R15A 2ZXFA 1L4YA 2K2QB 2Y6UA 1Y9EA 2CNWA 1EEHA 4BJ5A 1RNLA 4NG4A 2DPGA 1GM5A 1X7GA 3VHXB 2XNDD 1VE6A 3BN3A 1OMOA 3PDIB 2JFPA 2FU5C 4KFTA 2ZB3A 3IOYA 4KFUA 1NN5A 4E5SA 2Q3MA 4PIMA 3HU2A 1A27A 1LY1A 1XN1A 3B78A 3PB3A 3SF8B 1RXEA 3JZMA 3EQ8A 4ZT5A 1M2VB 4EGFA 4LE2A 4GBJA 4AS1A 4ZYLA 5FFNA 3C98A 5FAKA 3K72B 2N9UA 2ZAYA 1RI2A 2M1ZA 1OA1A 4AJ4A 4N6NA 1YVUA 1Y7TA 3AL0C 2Y0SE 4CCSA 2A9OA 1KH2A 3OTGA 4ED0A 3ZQJA 1P75A 4PGMA 5AM1A 3N8HA 3OQ6A 2APJA 4F8EA 4TT8A 2ODBA 2GRUA 3DE0X 2NPFA 2H5EA 5B7NA 5DYTA 5KHLB 1Z4KA 2PJUA 2XDQA 1A8QA 4MVJP 3S2SA 3I42A 3KXPA 2DABA 3UG7A 3KV3O 3ML1A 2IK8A 1RJEA 5IWCA 2N0SA 5AKEA 1NP6A 3RIMA 2HHFA 4YP3A 4MRMB 4HVAA 4FS1A 3QVJA 3KEQA 4BNDA 4L4RA 4I66A 1BRMA 1G8JA 1WB6A 5D86A 5EP4A 1E8MA 4CU2A 3S44A 3ER6A 4ND8A 1KI3A 3I5XA 3IIMA 1JEDA 1U7WA 5DGTA 1ECGA 1XLUA 2VP0A 3PKZA 3QZ7A 1SXPA 4Y0NA 3OPMA 2RHJA 4F9EA 3B6JA 5JCOC 4E5PA 4YHBA 5I45A 3EASA 1QGZA 4BBZA 5DGAA 1TRHA 2ZUBA 5G3ZA 2FSUA 2R7LA 4D9BA 1DGQA 1F3LA 3O8QB 1F8GA 3GWGA 3GQBA 4GLLA 1JFRA 2PD6A 4HQ0A 1HV8A 4Z9AA 1H0RA 2YYAA 5EMMA 1ZH6A 4Q1BA 1MDBA 2E4UA 3N2EA 3ESRA 4HN2A 4LX8A 4JU8A 1IN7A 4WNAB 1KAMA 2JI8A 2A86A 2B0CA 4KKXB 4C4RA 4P4SB 1KC1A 1RZVA 2QRGA 3WAKA 5AW2A 1ESDA 3EDRA 5TMEA 2OPBA 4UUOA 2J9RA 1Q57A 4BV3A 2YZNA 2B2CA 3KHTA 4A2QA 2PKWA 4L78A 3AKYA 4N76A 2JGKA 3JZFA 3WNVA 3OC6A 3DQQA 1NURA 3FKSA 5HCIA 4NBKA 3C5VA 4RCZA 1BCSB 3Q7TA 4EB8A 2SNIE 5FNVA 3Q0TA 3R4VA 2ZSFA 1QHXA 2IYNA 1I24A 2V55B 4QTTB 1LBIA 1M2JA 2DUNA 4D92A 2QQEA 3EXAA 3O83A 1GR1A 1NG1A 2AYZA 2HU5A 3GU3A 4YB8A 2ZUVA 3B52X 2OCPA 3Q3IA 1JSXA 2OWDA 1Q22A 4NYEA 1SBIA 4I14A 2WYHA 4YCCA 2XNJA 3UWOA 3JZIA 3UFBA 5FYDA 1UJBA 3G1WA 4ZT6A 3KSUA 3N0WA 4L50A 2FYTA 4RENA 3TMYA 1S3FA 1DE0A 1T8SA 2GM3A 4OLBA 2XBLA 1KO1A 5AFSA 1CZLA 2P0AA 1V47A 3JAWB 2OCXA 4QUIA 4OB6A 4WN3A 4OUDB 3H20A 1Z3CA 3MWJA 4DZZA 2QI9F 5DH9A 4IIHA 1P72A 4Q3LA 3FROA 3RS3A 3SSOA 2FPSA 2V6FA 1IXRC 1RQLA 3KPUA 3W8RA 2J07A 4BVFA 3EMVA 3THYA 5T57A 3LP6A 4OHMA 1YQUA 1QQ5A 2B1QA 2VJAA 4JJ6A 1SVSA 4YI3A 1NMYA 2H1WA 3R5FA 2NPIA 3JQ8A 4RLQA 1CYEA 3NBKA 2D1TA 2GARA 3H5TA 3H3JA 3GBSA 5JSYA 1KZ1A 4QA9A 4YMTA 4RPCA 3GYGA 4LDJA 4KQIA 4PZ0A 4QUDA 4WBXC 5KFYA 2GMWA 4UTPA 4RX1A 3GD5A 5KOJB 1L1QA 1G20A 1UT5A 3SZGA 3Q15C 4KITB 1Z6QA 3AVVA 4AT1A 5KNDD 1FJGB 2QZZA 2OK7A 2PUWA 4X1KA 1I0LA 4JV1A 3HLKA 4BO9A 5IP5A 1AQLA 3PZBA 1JLLA 4AQ7A 4ZYWA 3F7NA 3MELA 2DY0A 1TUEA 3KVRA 2P1ZA 3CU5A 2HZ7A 2PMZA 4DGQA 2FF5A 1CRPA 3MYRA 2J6HA 4ER5A 4JYMA 1CJCA 3T9BA 2FPMA 3LQ4A 3CUEF 4ZZ3A 2ZRNA 3SXUB 4N4AA 3IDQA 2RBKA 3GEBA 3JWHA 4RBNA 2XCSB 1K6IA 3KYDB 2YQ5A 3V4OA 1FFGA 4PLPA 1X8KA 4I3FA 4I6EA 3EC2A 2BKEA 3DKVA 3ZW8A 1BGWA 3GIJA 5A5GA 2JFZA 1V8ZA 3H1FA 4RDIA 3HY4A 5A7GA 3IHTA 1KPGA 3I62A 1E3TA 3CKMA 3TNLA 3VNRA 4PLWA 3F7OA 3BGIA 3LQSA 3RFFA 4EM6A 2HMTA 4GYWA 4JI0B 1RKBA 2C4HA 2I6SA 1Y3IA 2NIPA 3T7RA 4IH4A 2C5AA 2IVFA 3CO5A 4AWAA 4BO4A 1TAHA 4DT1A 1NVDA 3CKKA 4ZO7A 1CQJB 2JK0A 4NR0A 1L7MA 2I2CA 3HKBA 4MOWA 2Q8PA 3AF2A 3DAFA 4W1PA 1P0QA 1HT1E 4M54A 1DBRA 3TQSA 4ZPJA 4AYWA 2H54A 1JAIA 5KWVA 1YOBA 2WNIA 4WA7A 3SS9X 1N1GA 2PAFA 2RHWA 4GWLA 3JU3A 1XALA 3M6FA 4B2LA 1E3IA 4XJTA 4J76A 5LXTF 3FPKA 3I4CA 1YJ8A 2L2QA 1NT4A 2QP4A 2B98A 3GQCA 4UCRA 3ADPA 2GM5A 2VKQA 4KQ6A 4HEQA 4EA7A 1WMAA 3LM8A 4FYHA 4R5HA 3ABRB 1IJFA 3L0PA 2Q2TA 3I09A 1JFFB 4HGPA 1IEVA 2W6CX 1FPQA 4ARCA 4D80A 4PZZA 5J58A 4DIKA 2R47A 4JQSA 1Z6AA 5SZHB 1WUKS 4DKXA 1WBBA 2WJVA 2ZROA 1NVWQ 1ZJ6A 5EGNA 2GCNA 3Q3GE 3BL8A 2XJ4A 1FSZA 2BCGY 2CHGA 4CLRA 1GPLA 1VIDA 3PCXA 4NEHB 2YUIA 1USWA 2ONYA 2JA6G 4FT2A 4GC7A 1EG2A 1E9CA 4PG8A 4X62H 3UCFA 1JG1A 3T9CA 2VH2A 2RHOA 1Q0RA 2ORWA 2V6IA 1L0BA 2VF4X 2VWPA 5C4GB 3DEAA 4NJOA 5AW0A 5A2GA 2FN8A 1TUBA 2GN4A 1P3Y1 3RQSA 1C3LA 4R2XA 3DOFA 1PQWA 3MTBA 3DMRA 5DHRA 1CG6A 3TBFA 1V8BA 4NDAA 2JEZA 5E6UB 1KEVA 4CMIA 1EK5A 2D1SA 3INYA 5M04A 5TE9A 4FW9A 3H1PA 5TF4A 1FDUA 3AZPA 1TZ2A 3EIWA 1LDMA 4GW3A 1J21A 2RH9B 1GCUA 3TRJA 4ZJPA 2Q07A 4D41A 1Z74A 4HH4A 4KR7A 3QTTA 2BMFA 2PM8A 3OJOA 3EH2A 1I2ZA 1E2FA 1BFKA 5K8LA 5IJ0B 2CHVA 4NDNE 5CJ2A 3STVA 4KH1A 3VVMA 4Q16A 3QWHA 1AJEA 2YHUA 1ULZA 2Q99A 3TGLA 2SKCA 3F5QA 1GNVA 3KQYA 3L07A 2HA7A 4F93B 3DE5X 4WFIA 5KAPA 3VR5D 4Y6LA 2B25A 2A2ZA 1O6BA 4L72A 3P19A 1HMPA 3IUNA 2ZYRA 1UK6A 1GZDA 5DLYA 5EJ7A 1RD4A 1DI0A 4MW1A 3W34A 5SY9A 1IBKH 4MTLA 3WRWA 4J9KA 3OE7A 3SJAA 5A05A 3PO2G 4CHGA 5U9CA 4TUYA 4KL8S 3TDNA 3MAAC 3IGFA 2VNHA 3INRA 4URWR 3R3XA 3PEUA 2D3WA 3KU4A 2I0FA 5DGBA 3HKEA 1T13A 3STYA 4AP6A 2WTXA 4GF5A 1ZKDA 3WTBA 3ELYA 2F4VH 4BGUA 4BWGA 4X95A 1JXLA 1HDCA 1I94B 2FUG1 3L84A 4X6UA 4RJ2A 1FRVA 2NT3A 2GPJA 1QG6A 3FPLA 3CPHA 2OG1A 3C1OA 3G8DA 5CM2Z 4RA9A 4RU9A 4PQRA 4GZMA 4YR3A 1SKQA 4KI0A 2WKRA 3NZEA 4FSDA 1VJ0A 4L0DA 2HK6A 4QJ4A 3DT8A 4BNJA 4CG0A 4LY3A 3PRYA 2GTPA 2Q5JA 3CUKA 1YR3A 2QEQA 2I91A 4LOHA 3CR8A 2NO6A 1P74A 1KMMA 4R16A 4RFLA 3W5SA 1UEJA 3H04A 2CJXA 1DHRA 4OUKX 5G1PA 3CX6A 4BVAA 1WXGA 1Z34A 5C8VA 3RSQA 4KAFA 4XUCA 3ORSA 5HPYB 3MZ0A 1OB5A 3PE4A 2HXYA 5BMVF 3IQGX 2XOXA 5H5JA 5ICMA 1P1KA 4EKIA 2C97A 4XDZA 4OYYA 5DF1A 1XK6A 3F5SA 3ETDA 3ONVA 1TM3E 3P9QA 1OPXA 1TIBA 3JQCA 1ACMA 5B3JC 2BTEA 1L7DA 1NMEA 1RWKA 1OT5A 2PGDA 5KYGA 5C4IA 2UVQA 2VAVA 5H3HA 1NKSA 4RIGA 1Z8HA 2JGDB 3HGMA 5CVCA 1JF8A 3EGXB 4DSOA 4LC1A 1JHDA 4TMVA 1WSCA 2B1JA 2DT5A 4PX5A 4HLUA 4QEKA 3X1JA 1NBEA 2J6TA 4DL5A 4XM1A 2ZRMA 3H87A 3E22A 1NXOA 1ZCAA 4DNXA 1VSUA 3EF0A 3VZBA 2A0KA 3F1LA 4EIWA 1KO4A 4CF3A 4LZPA 5H1YA 1U2EA 2BFCA 1U9YA 3SZ3A 1LBSA 1QGOA 5LMNH 3NOOA 1J1ZA 3Q5EA 2B7BA 4URXR 4EY6A 1BJTA 4LF6H 1E7RA 4ZO6A 4OLAA 1QK4A 5F2OA 3KD2A 4ETSA 2PU5A 1BVYF 2RK6A 4DLVA 3P2IA 1NLFA 4PZ8A 1H0KA 4BB6A 4P31A 3SQWA 4Q0YA 2F6RA 5IX8A 4EW6A 2YKGA 1JJFA 4JUDX 3LRXA 4N54A 3KETA 3ZY4A 1KTIA 1PL0A 1JJAA 3HLTA 4EW1A 3IURA 1TA8A 1XIVA 2MHCA 3SYMA 4QUAA 5HIKA 4P98A 4W9NA 3W2EA 1PJ2A 3V5NA 5K8VA 3DLIA 1DV1A 5GVRA 3RU3A 5AK5A 4KQMA 1CDDA 3L0SA 3H2KA 1YAHA 3LKZA 5DLEA 2J3EA 4X3OA 2FZ4A 4YEDA 3CCCA 2IYAA 3IVRA 3JTEA 2FDXA 3U9LA 4NFYA 3R0XA 4F71A 2I4LA 3S4YA 3U55A 1B8NA 2D00A 2YV5A 2ZQ5A 1Y3BE 1Y6QA 1P2UA 4O5AA 3LLSA 2AJTA 2XWBF 3WYEA 1BH2A 3DBOB 3GVPA 2H63A 1KE1A 4D81A 4A0GA 1C2TA 1KFCB 2BP7B 2ZB8A 3VR0A 4D3ZA 5T14A 2JBWA 2PJRA 3D4IA 5FAXA 4UFOA 1CHDA 1E60A 4C7MA 3GCGA 4MQEA 1SOMA 1RYRA 1U8YA 4DHWA 2ALJA 1RQGA 3CWCA 1RYFA 3GRVA 4ZK2A 5IMSA 1G18A 1WZUA 1PK7A 3Q87B 5A5VA 4EB6B 4ZVNA 2G88A 4KQ9A 5AKZA 5EIAA 4FWBA 5HM8A 2Q2QA 1TKRA 2AOWA 4RQAA 3UH0A 2I1VB 2Q0QA 1J0DA 2JA5G 5HDBB 1NMXA 3ZJ4A 2PGOA 2Z5VA 3LUHA 4HDKB 4O3RA 3PGA1 5EMLA 3WL3A 4PS1A 2E85A 1XEXA 4AS3A 4NENA 5JFOA 3V1LA 4JR2A 3ZHZA 4BKQA 4XAQA 1RXWA 2W9CB 1BE8A 3TEMA 4U6PA 2QE6A 3K9FC 3VVLA 2C77A 2XMBA 4ACBA 3AJ8A 3E9NA 1VKOA 1GQSA 2QSJA 4J0JA 5ALGA 4FDAA 4IILA 1UM9B 1P0CA 3F7MA 5CW1A 1NLZA 1M1YA 4BO8A 5F9NA 2ATLA 1BMTA 5HJEA 4A03A 2YJGA 3C3YA 3DOHA 3TQ1A 2QNRA 4R8KA 2ZIZA 1Y14B 4CL2A 5FOUA 3WK9A 2A0XA 5IPFA 4A3DG 4K9KA 5F1OA 3U3MA 3WO1A 2W2TA 2OZLA 2OMKA 2JA2A 1JLKA 1TEXA 3I01A 3AHIA 3E3LA 3R6DA 3AY0A 3PNYA 2CKMA 4QEDA 4DR7B 2H1SA 4LXHA 4XKJA 1G8PA 2ZUCA 4Y9RA 2GCPA 2VOBA 3OO1A 1FSFA 1LLCA 1FSSA 5JI3E 4BO1A 2V45A 3WR5A 4DA4A 3BZUA 4P5DA 3RRZA 4N39A 2RAUA 3W5JA 3D3WB 3RU7A 1QO0D 2VL7A 3WWHA 1AC5A 2AA3A 3LA8A 2VSYA 1XZFA 3VQTA 1G8MA 4KSYA 5TS2A 3C3BA 1QZUA 1RACA 1T10A 2J9XB 1NBMA 2Q2NA 2HA4A 5IUKC 2D59A 2DB3A 3USCS 4D9IA 4TTQA 3DZ8A 3DUFB 1EWQA 5BQ3A 5JVDF 2Y67A 4RHEA 1JG7A 2KW5A 4UCSA 4A9AA 4NJEB 2WOOA 4YYEA 4RZ3A 3AEKB 4DCUA 2W98A 5KS2A 2WU8A 3Q6IA 1JAZA 4DV5H 2I6UA 3NHPA 3J81W 3SI8A 5IM5A 1L4NA 4DY6A 2ZKLA 4DMHA 1W4LA 4WBNA 2PG3A 2JHAA 3R74A 5CT8A 2IYVA 2EWWA 1MFPA 1I7PA 3GFSA 1KE2A 2D54A 3BTVA 3K0FA 1GYFA 2E3JA 2Q5EA 4DQVA 3ADCA 2XTAA 3QVKA 3RW9A 2P77A 2GJSA 4O63O 1T2EA 5JRZA 5TMPA 4JR1A 3KEFA 2QYZA 3FZQA 5HP4A 3FRIA 4X60A 1GG9A 1JEJA 1EM8B 3DOUA 1RRMA 2GFQA 4M36A 2XWPA 4EA6A 3DB1A 4B3DA 5AVQA 1GA1A 2JBAA 2OLEA 3IPYA 3SR4A 1KRWA 2P30A 2NX2A 4FDUA 2F3PA 4TXMA 3QOYA 4BO7A 4OBWA 1W9MA 2E6UX 3OTQA 3QWIA 4M88A 1KOGA 3TXYA 4YUAA 4NKRA 3RU2A 4RK5A 4R2LA 4R68A 3FKIA 1U4SA 3KQOA 1XRJA 2GX6A 2OHOA 2Q7DA 5FD5A 5C1OA 3HI6A 2IOFK 2FPPA 2CBGA 4ZMRA 2CXSA 2Z9DA 1X38A 3EVEA 3FDIA 4NVRA 4QGHA 2AMVA 4BY9E 4GECA 2XW6A 1V8FA 2Z1NA 1JR3A 1WCXA 3LYAA 1Q7EA 3OKCA 2BDUA 3T3MB 4P1ZA 2SKEA 1KEUA 4C6TA 2RH8A 2AD1A 5IASA 4IQ4A 3OWXA 3OIDA 2Z04A 3KTAA 5GP1A 2X8JA 4HTAA 2HPZA 2B21A 3C7CB 1Y5RA 1UBKS 1WZEA 2ZJFA 4AUEA 3DWIA 4H3VA 3WLQA 5HF9A 3U7IA 3CH4B 3OOYA 2A30A 1N5KA 2ONCA 1YZTA 3MR2A 1GFIA 1OFUA 4WLUA 1CK4A 3AF5A 2F9MA 1JHOA 1AB6A 1BYUA 1B14A 1P39A 4HATA 3KT8A 4RMIA 4EA8A 4W8HA 1U0GA 1X7HA 3CNOA 3QX8A 4Z4FA 2IBMA 1Z2DA 1O94C 2IY9A 3MJFA 3P26A 4BGEA 3GP3A 4BAUA 1GQFA 1I33A 2DFVA 3VPSA 4YCBA 5IWAB 1OZAA 3UJ6A 3L79A 5EYPA 3P32A 2WPNA 3VC2A 3ZUGA 2J7KA 3GIMA 1E4EB 2BTQA 1PDOA 4EFMA 3IRVA 4YJHB 2GVZC 1RWNA 1C30B 4J0CA 5I9MA 3LWDA 5TR9A 2JFYA 1P4HA 2GBLC 3T3OA 3MW8A 3N7UA 4DUYB 5DMXA 3ZJ5A 1CUHA 4OQLA 1FTNA 2IOFA 2E18A 5I7HA 1HQCA 5D87A 2GUWA 1IL0A 2RMKA 1EDBA 1PNTA 1TKBA 3V8VA 1AK1A 2AHOA 4RTNA 2G72A 3SCZA 3QUAA 2FW1A 3WLAA 1XZEA 3HCRA 5F1YA 4M8LA 5IKXA 2VA9A 4QWWA 4HFNA 5K3FB 4JOSA 4BBRG 3LFTA 1J9GA 3R3HA 4J9OA 3FVTA 2VLIA 5DTQA 2B8JA 1F4VA 4BO0A 5BR4A 3RJTA 1FP4A 3U3DA 3REQB 4MAFA 4DR4B 1F51E 2PRKA 3KKPA 2R8PA 3QE9Y 2P0YA 2Z08A 4GPTA 4FGUA 4FQ5A 3U3RA 3R7SA 4UOEA 4F7DA 2JPDA 1N34B 1T91A 1TYCA 1U7HA 1IN1A 1DAAA 1Y5LA 3CH7A 3WKDA 3AG6A 2AC2A 5DEOA 2R1TA 5EJMA 3JQQA 3MB8A 1GSAA 3X2EA 1GADO 2ZEJA 3W3AA 4PAMA 2BMEA 2D2VA 3P2EA 1OH5A 4ZO8A 3PUKA 5AOVA 4RW0A 4WY2A 2RAPA 4NBVA 4QVGA 1KPIA 3H0CA 2ZVJA 3F8WA 3R5SA 5D1NA 4LRQA 3OKAA 3EYAA 2A0WA 1WOYA 4R7ZA 1KMCA 3R20A 4EX7A 5A3VA 1S2MA 4XUDA 4WBSA 1TMOA 3LUPA 3IERA 1FP7A 4CKBA 3PGJA 13PKA 2NVXA 3PVZA 4JP3A 1U9IC 4F9TA 7ABPA 5IYZF 1Q19A 4YMHA 1GCAA 1O5TA 2DXIA 4CKEB 4L95C 1SMKA 1UF9A 4HAVA 5CFPA 1RYSA 4WUVA 4A8JB 3MBKA 4MVJF 4LF5H 1R0ZA 2Z1MA 3B3JA 3M89A 3T8YA 3LDHA 4G6ZA 4RH3A 1S1CA 3ZWXA 2QROA 3EZGA 2GLTA 2VJQA 3CBGA 3SJBA 2J9FA 4LRXA 4AP5A 3ICPA 2XB6A 4GE0A 3O4VA 4A3EG 5LQAA 3U44A 1LNZA 3IBTA 5TSDA 1T8RA 4P22A 4CLHA 4MV3A 4DG8A 4NU5A 5SICE 1CC1S 1N92A 4RF4A 1N2IA 2ERYA 5B1YA 2IKQA 3AVQA 4WE3A 3RSOA 3O8OA 2YVUA 5C80A 4LYDA 3QY9A 5IN5A 1G5PA 3LHDA 3RFTA 2BEVB 5F98A 2BFDA 3OMXA 3ZE7A 3W1BA 1H2ZA 1B43A 1KJZA 2BMVA 3RYFB 3GJ3A 4DCGA 1DCTA 2JJQA 5IYBG 2EF0A 1CNEA 3UBTA 4WXEA 1JT9A 4DDTA 1RHKA 5EHQA 4GRDA 1KMHA 3OOHA 4QOSA 2GHQA 4EYHB 4RD3A 3N2LA 3H2YA 1I32A 5DBOA 2HBZA 1H42A 1V8PA 2NZUG 1Z4OA 4M9ZA 4YA6A 3ZBQA 1W8IA 1Z0IA 3THXA 3HWRA 1YD7A 2JAOA 3VSEA 3RV4A 4CUJA 5FBZA 1TF2A 1RQNA 3CZAA 3PHJA 4C22A 1WW8A 2UAGA 2AMJA 2AHRA 1YVRA 1JI0A 2C1EA 2PNJA 1SEIA 1K7FB 1MQAA 1G2WA 5JNSA 2CL0X 1VMAA 1NKVA 3X0DA 3R40A 1XEAA 4U7TB 5JSKA 1TO1E 2BVNA 1T94A 2HHLA 3DXFA 4MO9A 1YJ5A 1NYQA 1DIAA 2WFAA 3EBPA 1CJBA 5FBVB 2IYTA 4WZAA 1XT6A 3P7MA 4Z2AA 4L3OA 4B17A 3MM4A 1YK1A 1N1MA 4OQ4A 1ECLA 4UULA 1QE3A 2RGDA 2WC1A 2PRIA 1PJZA 1ZYUA 3T1HB 5F52A 2WRZA 1UIMA 3PIDA 1M2WA 1Q44A 1GZ4A 3KSZO 1KK1A 3NHFA 3WMXA 5IT9A 4XIGS 4QAQA 3IOCA 1P2FA 2QL9A 1H94A 4ZTBA 2LV8A 4FFMA 3FHOA 4BNYA 4Q3CA 1AKMA 1YS7A 1OWOA 3FE2A 4D4HA 5JRJA 4YT4A 4FOPA 1G5RA 1ZLXA 3IQHX 3DO8A 1X1DA 2AYYA 3OZRA 2PQ6A 3P1JA 3KNZA 4URHA 3E8SA 1ABBA 4IHKA 1PN3A 3VKVA 1Z4NA 3PC4A 5TARA 5F73A 4RM3A 1WP4A 1RPAA 2UYYA 5A71A 4PCUA 1Q1GA 2IH5A 1QAQA 5DLGA 2HM7A 3PEWA 2HJSA 1FDVA 1N48A 4O4LF 1V1JA 3VVCA 1X8XA 4HX2A 3L5OA 1ZS9A 1GZVA 1D4FA 3HV2A 2Q1TA 1AKUA 3H2ZA 2BM0A 2JGRA 3CB4A 1E61A 4UU0A 1BW9A 2I4OA 5ALYA 3ZD8A 4UPVA 5CD9A 1T43A 5DTMA 1GZ5A 4CMJA 3H16A 3U1TA 4G2TA 4D82A 4KIWA 4MHOA 2D0IA 2KPOA 3LT4A 1Z5VA 2R25B 3FLEA 4RPJA 4KPEC 4XYMA 2X9NA 1DEKA 3QPAA 2JLYA 2REOA 1QO9A 5LB2A 1CV2A 3A25A 1YBAA 3EZ9A 4DV1B 3V46A 4E2WA 2ODPA 5AUNB 4FN4A 2PUEA 4UCUA 1AF4A 5JNWA 3CLUC 5DYWA 4F8JA 5LXTA 4M7EA 2YFHA 5IVKA 3HB1A 3UGQA 1XPOA 1XTQA 1TMYA 1EUCB 2Y2UA 4FYKA 5C3UA 4X66B 4CQMB 3P9XA 5BNZA 4HFMA 2ZJ6A 3TD9A 1BMFD 1YZVA 3UHJA 4DLRA 3KQVA 4DB2A 2LGJA 5GV7A 2IU6A 1XMOB 3OCJA 4EKGA 4Y2JA 1U3DA 1A8UA 4A3BG 4OB8A 1TD1A 1PJSA 1UPCA 1RDFA 4GX1A 4DR2H 4BCCA 3AVXA 3BWDD 4INPA 4D9EA 1X7WB 3UV3A 3RBEA 3IOBA 3WBBA 2QG6A 3P2KA 3AEYA 3TL2A 2NVWA 2ZFUA 3T15A 3QWFA 2FMKA 1OA0A 2KLBA 4L28A 3A05A 1Q6YA 2B1RA 4GPZA 2WA2A 2Z2ZA 2ZDGA 5JXWA 1CY4A 1AQ6A 3GILA 2QAIA 4YASA 5AHRA 4L9AA 1QXSA 4F2WA 1DAKA 5JIBA 1E7YA 3PL1A 4OGLA 2ZG6A 5DHAA 4TWIA 4YPFA 4C9BA 4OHWA 2ZAMA 4X1IA 1ENOA 2EARA 4V03A 4X6LA 4IQGA 3CR3C 2PXCA 1QQ7A 1F0NA 2Y2VA 3WJ1A 1Q1EA 2X5XA 4H7KA 1IUOA 4LVCA 3C6KA 4H7IA 3SIXA 3GVIA 5DYYA 5CBPA 3GJ7A 1BWRA 4C0AC 2M05A 3GEGA 3SKVA 4KRYA 3B70A 4JI5H 5LA6F 2A5LA 4EFEA 1VA4A 2HSZA 3AF4A 4UBOA 5JARA 1OTXA 2ALZA 4DSZA 3G9QA 2DLDA 5FCDA 1ZNXA 2EBFX 3GJXB 3RR5A 2BSAA 2ODWA 3MINB 3S5UA 2QD4A 2QENA 3GMIA 4I46A 1PYOA 4MWOA 4X44A 5FV7A 4JLPA 1Y80A 4HADA 1V5IA 5E0OA 2V4QA 3SYKA 1ZSVA 1EVKA 2GQRA 5L4LA 3DDCA 4CG1A 1K0FA 1AZSC 4QVIA 4EJSC 1QONA 2I99A 1VL6A 1ETUA 1W0KA 3QKTA 1IY8A 1AQYA 2XGSA 1M6WA 3DF7A 3VRHA 3RU9A 1JLSA 3N8GA 1E2LA 3ROZA 1Q7TA 1JLRA 3UZUA 1M5RA 3Q3HA 3DO6A 4M0MA 3N1UA 2YRFA 2HT6A 4QXMA 4JL5A 2WDPA 1M0TA 1Z5PA 3VJMA 2CVOA 1ZR2A 4AJEA 3ND6A 2QTZA 3P4YA 3MT9A 2VAXA 2ZRPA 1UFVA 5BR8H 3AQIA 5KJ1A 1ZK4A 1U1DA 1DXOA 5DM0A 9ATCA 1FC0A 3FYCA 3U4CA 3IVAA 3RFUA 1A0IA 2GEKA 4FEYA 3RIEA 1P1CA 2V03A 5KSOA 2FMTA 3FWZA 5BORA 3QA3E 1OXVA 5DB4A 1RJDA 1DJLA 2OGSA 3EPHA 2NZVG 4GOXA 3RVBA 2KB0A 4YRTA 2XUFA 5E25A 4PPQA 4YJFB 2ZWMA 4YCJA 3GB9A 2O3QA 5K51A 3AR6A 2EJUA 4AY6A 2WTEA 2BI4A 4XWWA 4I5IA 3W1WA 2J9ZB 2IZ7A 4FU0A 3U7FB 3NC1C 4KKVA 5I5WA 3A9TA 1ZA1A 4QE3A 5BMVA 4FNGA 3O95A 1ZISA 4MCIA 2J0UB 4U9UA 3IUYA 2R8HA 3F6RA 4LXTA 1VCMA 2X9LA 2NTJA 1DX6A 5BN3B 5FA5A 3H13A 4CM4B 5CFLA 3ETJA 4YMIA 4CDNA 2ZIVB 2IDZA 3Q2OA 1MC1A 2IV2X 5EKXA 3VZRA 5DP1A 1O57A 1KF0A 2C2BA 3BB4A 4O1IA 2E4YA 2V7BA 1I0IA 2B9EA 5K0TA 3DVQX 4EPTA 2W0MA 3KM0A 2GR9A 3HSKA 4EUNA 3ZJUA 2XKBA 1P5FA 2PFSA 5T67A 1GZ3A 3PENA 4NU6A 1ARZA 4OSEA 5K6RA 1QVVA 3GLGB 1KMQA 1Y7IA 1S97A 2NTVA 3S40A 1XD8A 1RFLA 4R1TA 1N5LA 1OLUB 3D6FA 5THXA 2EIXA 2J3QA 1XTBA 4S1VA 5BQOA 2GOYA 1I01A 5JBQA 5I5XA 2M6KA 3NH9A 4PBTA 3HWX1 5KSZA 5KQGA 2W6ID 3PFKA 2BR4A 1D2EA 2G9NA 3C7AA 4CCYA 4GX0A 1LK5A 4DQ0A 3NVKI 4D6PA 3I83A 1N8SA 1C14A 3T5MA 1I13A 1A9PA 3GTQA 1KERA 2H2GA 5F77A 4B3FX 2FFAA 2BKVA 3FYDA 3X1MA 2ONZA 3OQIA 1SCJA 3DE3X 1PGJA 3IHKA 2H52A 3HEAA 1QOZA 2C7OA 1NWCA 1ONBA 4DIDA 4QBFA 2QAGB 3GLGE 3UYKA 4BLVA 3C6XA 3FXAA 4IV5A 1KTAA 2D5CA 5HCNA 1U5AA 2ATXA 3IQDB 2V9CA 3E9CA 1OLXB 1A9QA 2O2ZA 1R6VA 1U8XX 1Z07A 2FF7A 1BXRA 4GM0A 5DBHX 1N6PA 3TSOA 2YOFA 4YN3A 3FVRA 1US8A 3UAOA 2BFEB 3TLKA 3H2IA 2HR1A 3COJA 1MG0A 2YH2A 4EHIA 4IRXA 5LMUB 3SK0A 2AYXA 1UWKA 4RZHA 2XUZA 1NUTA 2GN1A 3UGJA 1WXEA 4MRAA 1YNSA 1QHSA 1NVFA 4DIOA 2XTNA 3GRUA 4LJ5A 3C87A 1BXGB 3UHPA 4O7LA 2IZ0A 4EHHA 4OJNA 3NC0C 3AHGA 3FNQA 2YRXA 4YXFA 1FZQA 4MVWA 1ES9A 4A23A 5K0NA 2J3JA 1GJRA 3EFOB 1U28C 2D0OB 2Q5QA 2Q4RA 3PUZA 5E2AA 1B74A 2QD5A 1AKWA 3MHTA 3B48A 3BBPA 4L57A 2JIQA 2WAOA 4HV4A 1P7YA 2FEOA 3CW2A 4EHFA 3EVGA 1LNSA 4TYYA 4LUCA 2OGTA 2EKPA 4JMLA 2ZJ8A 3ONEA 4IKOA 5LYYA 5H4GA 2WWYA 2WUVA 4L07A 1OFUX 2VHVA 3TTYA 1TTHA 2IBSA 4WLEA 3O3OB 4B2YA 3EGIA 2HGZA 3L5KA 1VRVA 1BDBA 1BZYA 3BA1A 2ZUSA 3HM2A 1CQPA 2Y4OA 3PD0A 2WLSA 5IJAA 4QBHA 3DPUA 4QDXA 3KDPA 2HEGA 3GFOA 4WQMA 5I5SA 3ZD7A 4R54A 2WYVA 3M81A 4E7PA 4M0UA 2II6A 4CM8A 1UKAA 1B1CA 4NULA 4DXAA 1IZ9A 3RVNA 4PWYA 1SK9A 1BN6A 1MLDA 4RCNA 1F1JA 3EYWA 5ED4A 3D6MA 5EI5A 3IOEA 3ZLVA 3QSGA 4EY8A 2C7RA 3OURA 2OORA 1TYAE 4PE5B 5EWMA 1VJCA 1Q95A 1ZHHA 5FRDA 2C31A 4WERA 3AZOA 3UMYA 2OA0A 2CHQA 3T61A 2PMWB 3WK6A 4JJKA 2WP8J 4UASA 1PG0A 1QIMA 2OXRA 4GLWA 4KQFA 2VBFA 1PZGA 3KXYT 2WWRA 3TQIA 3WYCA 1Y9AA 4G25A 1N6NA 3KWFA 1FMFA 1KBZA 5IJXA 1E4OA 3DWFA 4YQFA 1HRKA 2IUTA 4DPMA 4EI7A 4JLDA 4MW9A 3W5VA 4RFSB 1YONA 2DY1A 2PZKA 4FZRA 4F6RB 1QC5A 4XJSA 2PA0A 5KFSA 3OLCX 3P2YA 4XB2A 3LUBA 2O5CA 2I3ZA 4AKEA 2I4TA 4D9NA 3W2IA 2VPIA 3BF7A 1IDN1 5B58T 5G4KB 3TTWA 4ND3A 4NMHA 1M74A 3HU5A 4J9NA 1CDEA 2HIVA 2NZJA 4BGDA 1IHYA 5KFPA 2VSOA 1EFCA 4EW2A 1Y5MA 3V6KA 2JAPA 2NV2B 3L7OA 1A72A 4XOIA 1JDUA 1P4SA 5ILGA 1O89A 3RUEA 3QYJA 3NV9A 2XLCA 2JA7G 2XIQA 3DM9B 2BGKA 1RHMA 4I50B 1DJMA 4L8YA 2QD1A 3VSCA 2BQRA 1T5DX 3UJNA 1RP1A 2JG3A 2WWFA 3BQNB 3UH1A 2XYQA 1PEYA 1ENYA 4C14A 2JIBA 1LPMA 3AKCA 5T6MA 3H9CA 4B7AA 4E46A 1Q1ZA 1L4HA 2XUPA 1G3UA 4JP5A 1M67A 2IY7A 1KC3A 1LJLA 4Y98A 3HOVG 2WZCA 4YR0A 3AF6A 4RPIA 3HCCA 3D6TB 3TD6A 1LNQA 3BK1A 4C04A 1M75A 4U1RA 5L8VA 3P4UA 3N2YA 4MPDA 1XZIA 4KWTA 1KIFA 2C5BA 4HYQA 1QG4A 4JDUA 3EUFA 1L5KA 3GZNA 1PEAA 1QCZA 5HIJA 3JRWA 3IP8A 1VTKA 4TXHA 1D2GA 2OCGA 2WSMA 1ADFA 3P5SA 2W2KA 5F5NA 4B6GA 3DULA 1H9AA 3QKRB 4EPWA 3IE1A 1NXXA 1P4RA 4NSNA 4TYNA 2ZRFA 4CT5A 2I7CA 1K4MA 3HVJA 2VJKA 3OIFA 3WY9A 2Z3WA 3BQ1A 3VTFA 4XGKA 1JG4A 2DF8A 3ONWA 5HBRB 5G2OA 2DSNA 1AY0A 4BNWA 2L42A 4JROA 3I76A 4FONA 2RGXA 4WK4B 3H5NA 1NR1A 1QVWA 4U63A 3RE1A 2K6GA 1TJ5A 1DUVG 3OIGA 4WNYA 3JQPA 4Z4HA 1H93A 2NVUA 4C0JA 2XMZA 1V16B 2PBFA 4Q0MA 3QFHA 4EJFA 5M34A 3TW0A 2HUNA 1YVDA 2CYCA 3A7EA 3UJBA 2HOQA 5C51B 3RHTA 2C99A 2W9XA 1DKLA 2P2YA 3HWSA 1DGSA 2G9RA 2R8YA 4U2BA 3K8QA 3U0VA 2X5JO 4W5RA 5GY7A 4R4JA 1UPBA 1FX1A 2P6UA 2NXJA 1C8LA 2QL7A 5ISMA 1N9GB 5BWTA 2IPMA 3AP3A 3I2GA 3PW0A 5B3KA 4W63A 5CH5A 4GU5A 1TZBA 3E2PA 4O2RA 4KREA 3S7TA 2NUPA 3WLFA 4MVJM 1MZPA 2F1KA 2ETVA 1SXJC 4PN7A 5JUWA 4DMKA 2W8KA 3HNPA 3GF4A 5LDGA 3L4JA 4ZWNA 5KFHA 1SZPA 3EH1A 3NGXA 3WQRA 1H2YA 1RYYA 3OLVA 3FWPA 2FE4A 4ISCA 3QKSB 4EQ6A 1CIVA 1N75A 3E9YA 4JLBA 2R96A 4JXUA 4FR2A 2IP2A 4GT1A 2FX3A 1JU3A 3AESA 2JFBA 2WD8A 4A73A 3KJHA 4YK7A 2P2GA 2B69A 1KNQA 4GUAA 2ZB2A 3IPLA 4OI1A 1DTWB 3KOOA 3HR4A 2NM0A 5ADUS 3D31A 3T9FA 2HFKA 3RHZA 5D1OA 1JBKA 5ABPA 4X91A 3VH4A 3A6LA 2G4CA 1V2HE 1PKXA 5IP7G 3GPIA 1G66A 4HAYA 3K1ZA 4MYRA 4ODIA 3M9WA 4ILKA 3R9WA 1P61B 1GY8A 3DD1A 2ZS8A 1PR3A 3OPYI 3R3WA 3ZXXA 4O81A 1SRRA 3PXAA 3UYLA 4ECTA 2G77B 3FIUA 2HRCA 1KKLA 1OI7A 3S2ZA 1RWQA 3FTQA 1ZHSA 4D56A 3UA4A 2BD0A 1JLHA 1I4LD 3SM9A 4KN6A 3A1DA 2I3DA 2G80A 4CIWA 2UZ4A 1VYTA 2D4AA 3PEYA 1Y1LA 3NDRA 2V6BA 3MWEB 2UUBH 2IU0A 1KQFA 4WNCA 1T6ZA 1WY7A 2VK2A 1OXSC 4RKYA 3O92A 2IUSA 4NYIQ 4F0JA 4A1FA 4DBLC 1Z0JA 1C7JA 1CY2A 4XQCA 4HDCA 1UDXA 1L4UA 1TQ4A 1VKHA 2IS6A 3D4OA 4RABA 4DV6B 4HF7A 1GTL1 5AJZA 3K1AA 1GPDG 4JC4A 1P44A 2DPXA 3H2GA