4XX0B

Coa bound to pig gtp-specific succinyl-coa synthetase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
393
structure length
392
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structure of GTP-specific succinyl-CoA synthetase in complex with CoA.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 125
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xx0B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xx0B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xx0B03
2YZMA 5HV6A 4Y8VA 2XD4A 4TV9F 2R86A 3VA7A 1M6VA 4C5AA 1PK8A 1EYZA 2YV1A 1SCUA 1M0WA 2FP4A 2NU8A 4O82A 1KUTA 2Z02A 2YZGA 4NYEA 4FE2A 3JRWA 2VR1A 3VPDA 1KJQA 1DIKA 5BPHA 2YYAA 2PBZA 5CAEA 5JQWA 4MV4A 1PX2A 1I7NA 2R87A 2YS6A 2GQRA 4MV3A 2V5AA 4O7LA 3G8DA 3PFFA 3R5XA 4EGQA 3TINA 2FPIB 1B6RA 3VPBA 2W70A 3AW8A 1JLLA 3OUUA 5DMXA 5C1PA 3TIIA 1GSOA 4O84A 2R7MA 3MJFA 4XYMA 1Z2NX 1GGOA 4HR7A 4O81A 2DIKA 1CS0A 1A48A 4YJ2F 1JDBB 4O2AF 4O4LF 2ZDHA 4YB8A 2IP4A 3K5IA 4FFLA 1JKJB 1AUVA 2FPGA 4C5CA 2R7LA 5CB4F 4QSHA 4RZQA 5FNVF 3ETJA 2YRXA 2NUAA 1I7LA 1BXRA 4Y8VB 5HBRA 2V59A 2YRWA 5CA1F 3U54A 2PN1A 3N6RA 1SCUB 4O4JF 4MA0A 2NU8B 3ETHA 4DLKA 3TW6A 4IWYA 1IOVA 4FGRA 5BPFA 5H80A 3ORRA 2WYOA 3MWDB 1ULZA 4MV8A 4O83A 3MWEA 2R82A 4I55F 3N8DA 4YJ3F 4DIMA 2DWCA 2J9GA 3RUPA 4E4TA 2W6NA 3V4ZA 1UC8A 2ZDGA 2W6QA 2GPWA 4YAJA 3KREA 2V58A 3DF7A 3DMYA 1JLLB 2CNVA 4O7SA 2YZNA 3RV3A 3AX6A 4XYMB 2W71A 2QF7A 4FU0A 3R23A 2YS7A 1W96A 1E4EB 3RFCA 5JH7F 4XZ3A 3G8CA 1B6SA 2NU6A 1Z2PX 3Q2OA 4O7ZA 4O7WA 4O4HF 1KJJA 4MA5A 3WNZA 4WBNF 2CZGA 4ZI7F 1C3OA 4YBZA 2P0AA 3U55A 3VMMA 2FPGB 3JZIA 2DLNA 3JZFA 3WO1A 4FFPA 1EUDA 2GPSA 2NUAB 2CNQA 5HBRB 1KJ9A 2I87A 1OI7A 5LA6F 3RV4A 5KKNB 3OUZA 4C5BA 3GLKA 1KEEA 4ZHQF 4I4TF 4MV9A 2CQYA 5EZYF 2YWVA 1UC9A 4YAKA 1BNCA 1C30A 4XYLA 3MWEB 1W93A 2HJWA 2VPQA 2YV2A 2W6PA 5CAEB 4EGJA 4IHJF 3BG5A 2XCLA 5GONF 4FFRA 5JQGF 2FB9A 3LP8A 2FP4B 2I80A 4YAJB 4IIJF 5KX5F 4ME6A 2OLSA 4HQ6A 3K3PA 1CQIA 4HNUA 5D8DA 1Z2OX 4XX0A 1VKZA 5JVDF 1CE8A 1KJ8A 2Z04A 2GLTA 2NU7A 4XZ3B 2FPPA 2NU6B 3TIGA 2YZLA 2X0SA 4O7YA 2I8CA 5JVLA 2VQDA 2R7KA 3E5NA 1EUCA 1JDEA 4MV1A 4YBZB 5IYZF 4O86A 3WO0A 5LXTF 3R5HA 1EUDB 5LP6F 4FFNA 2CNUA 1DV1A 2W6ZA 3HO8A 4O4IF 2W6MA 4HNVA 4ZOLF 3VOTA 1KJIA 2QK4A 4M9UA 1GSAA 1KBLA 2NU9A 2SCUA 3KAKA 3MWDA 2R85A 4YB8B 3V4SA 4YAKB 1CQJA 4MV6A 4XYLB 3UFXA 1GSHA 1OBDA 4O7RA 4ZQIA 4TV8F 3NUAA 1EZ1A 4HNTA 1AUXA 2YL2A 3TQTA 1VBGA 3I12A 3K5HA 4FFMA 2YW2A 3GIDA 2DZDA 4MV7A 4O2BF 1CQIB 3KALA 4XX0B 3LWBA 3HB9A 5LOVF 1E4EA 1GLVA 5J2TF 1OBGA 3KAJA 2NU7B 3ORQA 3R5FA 2FPPB 4IWXA 2FPIA 4O7VA 1WR2A 3VPCA 3Q1KA 1M0TA 1EUCB 2GQSA 4O7NA 1KC7A 2CSUA 2ZDQA 4FFOA 4WD3A 5BMVF 2W6OA 4IZOA 2R84A 3U9TA 3SE7A 1IOWA 2PVPA 3HBLA 1VBHA 4TUYF 1A9XA 4EG0A 2R6FA 4MAMA 4L1KA 4O7TA 1EHIA 1T36A 5C1OA 5J2UF 2HGSA 2SCUB 1DV2A 2NU9B 5I47A 3R9RA 3QFFA 4I50F 1JKJA 2R7NA 5K2MA 1CQJB 3JRXA 5CA0F 3U9SA 5LYJF 3UFXB 5C8YF 2C00A
chains in the Genus database with same CATH superfamily
3F7OA 1K5DA 3HKCA 4AG6A 3S2IA 2JHGA 3FHOA 1GRNA 4F5EA 3GTJA 3NKLA 5HCUA 3DEIA 3VPDA 3M81A 1CLEA 2G9ZA 4XQGA 2O0LA 1YR8A 1PV2A 5FWNA 1FMFA 1C30B 2TECE 3TQRA 4I8IA 4DQLA 3EVEA 2G77B 1QRDA 4CC5A 3G9ZA 1QCDA 3WK8A 3LE8A 4CN8A 2WT8A 3LUAA 1VHWA 1P5JA 1E7YA 4R2JA 5HFAA 2ATVA 2HC9A 3TVYA 2BPOA 4Y9TA 2WC1A 3NBYB 2COUA 1G2QA 4ZXFA 3RB4A 1FJGB 2K7FA 1M1XB 5FFNA 4E22A 4I55A 3IPYA 2ZCVA 4QOJA 3UV3A 4XVHA 5KG1A 4YQFA 3U17A 3A7DA 2O8DA 2ORVA 1OZ0A 1DFGA 2OCLA 1L5SA 4A3JG 1G4AE 2VZLA 4GW3A 3SQLA 1NULA 4LF6B 3MWDB 1X3SA 1YR6A 3N2GA 4UDNA 3HL4A 3A6EA 5I4IA 1GNSA 1TUEA 4M89A 1Q1EA 4KQEA 3V4ZA 4A3EG 4OBEA 2IDMA 2YWBA 4X1IB 2ORWA 3OPNA 221PA 5FPPA 1ZR4A 4GHWA 1NOIA 1TQ4A 5JCOC 3RSLA 2F9MA 4OQNA 2IX9A 2NWQA 5ALIA 1Y8RA 4BO0A 1DG1G 3HCFA 2WQZA 3S2ZA 3LA8A 1WNFA 1RXYA 1SJ9A 1BH2A 4YUVA 2XMRA 1F12A 4EB6B 4MRRA 2F8MA 5B1HA 1UK9A 2P0AA 3BGWA 2FPGB 3RKUA 4RFVA 4Y3UA 4C1BA 2ATEA 1Y7IA 3PKJA 1JFLA 1KDRA 4WK4B 4B4UA 4YRRA 5LQKA 2J4DA 5DGDA 1KI6A 5KG4A 4H1HA 2R4QA 1S9HA 4HLQB 1WXIA 3IQWA 3I6YA 3PNOA 3MWEB 1SK9A 1VCHA 1A9OA 1EVLA 1Y33E 3PB3A 1ZHQA 1XTJA 3OLVA 3PNLA 1EWYA 4KOEC 1C1YA 4D3XA 4M1SA 2FP4B 4OHXA 1UBKS 1P29A 3IELA 4G09A 3MMZA 4HRVA 1U3VA 3G5UA 3OQJA 5AHRA 3N2NA 3W3AD 5KNBD 4WCDA 3FMVA 3I58A 2VDQB 3MG9A 1TJ3A 4IH1A 4ZCMA 5H3HA 5JDCA 3FM9A 1ZZGA 1YJXA 3D0RA 5JCOA 2Q5LA 2EZ8A 1UDRA 3A9RA 1PWZA 1MA0A 2IVFA 1KP9A 1E32A 3S2UA 3K4PA 1GUDA 3B1VA 4NF2A 4XOIA 3TM5A 4GP9A 3DDUA 3GAAA 4GR4A 1U8YA 1ZOPA 4HI0E 3GZNA 1G8SA 5LL6P 2G7MC 5J2TA 5FRDA 3A9TA 3HGTA 3QKIA 3EVCA 2R5NA 2DSNA 3KM0A 4NCKA 2E37A 3KDSE 1BN7A 4XXHA 1XU9A 1ULHA 3NFYA 2VDPB 1CB7A 2DSTA 5KMGA 2V0GA 4CMFA 5IJ9A 3N28A 3ZWAA 2KX7A 2NSYA 1DHRA 3ZZ1A 1I1QB 2IL1A 4G1FA 3JPYA 1WZUA 3DXFA 3ABQB 2FCRA 1UFRA 3ZWQA 2ZB3A 5ALWA 3G02A 2FRDC 2XIJA 3Q9NA 4C1NA 3EVNA 3NDBB 3VNQA 4QD3A 3W5SA 2B1RA 2HB6A 1X13A 4TWRA 1QHNA 2Q28A 3HBLA 4W9NC 1I94B 3W90A 3L7OA 1P62B 4C01A 3OOYA 5LWHA 2WAMA 4MUXA 2O3JA 1GOTA 3MFIA 5BT9A 4UVEA 5HZKA 4F4HA 1V0JA 3U4MA 1M6WA 5JSQA 4C5AA 2JAHA 1NF3A 3BYZA 3DP7A 3NC0C 1HQDA 5F12A 2JAPA 1H8HA 4MCIA 5P21A 3QXCA 4P81A 4MRPA 5CM2Z 4HNQA 2QUAA 4PZ9A 4OLJA 2BMFA 4MB2A 3UVEA 4RUCA 5HVNA 5BR8H 2ODTX 3RBXA 5C7LO 1SKMA 4HV4A 5DLPA 2BBTA 1VE1A 3HVRA 2Y0EA 2HMVA 5L1IA 2HJSA 1J2YA 3A2LA 1QPZA 4OFWA 1Q1NA 3ZD8A 2PAAA 1Z26A 1PWEA 2ZR9A 3KOZA 4WK2B 4JI6H 5I4KA 5PGMA 4JL5A 1SUCA 1FTWA 4Q9AA 4CKEB 3O8QB 1UZNA 2W4QA 4WKGA 3E7WA 1X8JA 3PFKA 3K72B 2JA8G 1VJ1A 1KMMA 2B6HA 1PR4A 2FCAA 4DC1A 3VNVA 1UMKA 3OWOA 4JQYA 1Y5NA 1N2GA 5AJXA 1T1IA 2VBCA 1QV6A 2SKCA 4DILA 4D9CA 2C1XA 3S1AA 3R77A 2AGVA 2NACA 3PX7A 3IGFA 1Y1QA 4X6XA 4N8EA 2JZCA 8LDHA 4XQ9A 3QYAA 4BOYA 3TLZA 2NXWA 5AKLA 3RAXA 3AM5A 4DQKA 3HE3A 2QTLA 1BSVA 2R7ZG 3DEZA 5EEGA 1Z36A 5KDDA 1O97C 1U1GA 2JAWA 3IBCA 2JF0A 4YBZA 3H5LA 3PXUA 2R8XA 2G06A 2JEFA 2VT2A 5HBRB 4X20B 4H31A 1Y6FA 4DNOA 3L4EA 1I32A 1ECBA 1LRKA 4IDEA 1V9CA 2Q6VA 4Q9NA 1KS9A 1Y1SA 3QLTA 1G60A 1YV9A 5FT9A 5B30A 4WBNB 1WDKA 1SEVA 4EKDA 3PL5A 2ZI3A 1QGZA 4L7QA 3HNOA 4UTVA 5JANA 4PYOA 4D0GA 1APBA 5FUWA 4B17A 3OMWA 3I0ZA 3RBZA 5EKSA 1JG1A 4O2AB 4IEIA 5EWMA 3CUYA 3GLTA 1V51A 3EVDA 2E5FA 3KD3A 4D41A 1K8ZB 1SA0B 1Q1AA 1V8ZA 3GVPA 2ONCA 5TE9A 4WLEA 3W1WA 4DY6A 3AP1A 3KJNA 1ISSA 4KIFA 4O3MA 4O1MA 4FFNA 2EZUA 3J7AC 1FFAA 3HCPA 4KWTA 2JFWA 2IS6A 3SGLA 1SBZA 2Q2NA 2M6KA 1U2DC 4X1KA 3QHAA 4MQ4A 4G0PA 1V2HE 4R16A 3CHYA 2IY9A 2GPAA 1I80A 4ZVRA 1GO2A 2R6GA 1B2RA 1SXJE 2XC9A 3G89A 3RC2A 2ECOA 3AVWA 3FJ1A 3WJ1A 4HX9A 1F0PA 3CCCA 2WQ6A 3TEKA 3IP9A 2OBYA 3NVMB 2P0EA 5IYCG 4ECZA 4ZYYA 5DGCA 4EZIA 2EFGA 1DQYA 3TW0A 1S10A 1RJWA 4ALKA 2FSVC 2HPVA 5LQNA 1CDEA 4F4CA 1YR3A 4ERXA 1IHUA 3A3PA 2GA8A 2IEAA 2Q0SA 2BJHA 4I1RA 4QJ3A 4F46A 3W8DA 4DLBA 4TQ9A 2AJ8A 3H5WA 2IS1A 1RS0A 4P7FA 2Z2XA 4ZO9A 4RO0A 4OY3A 4CEHB 5CR5A 2A57A 4CI9A 1JILA 2HWKA 3PEUA 3B3FA 2QY6A 1VJ5A 1OOEA 4C0XA 1YJAA 3M70A 3KSDO 3R0JA 3KXYT 3T7CA 1ACJA 2P35A 2FW0A 1KJZA 1WV0A 4Q34A 1GV1A 1TVKA 5E6RA 5LC1A 4F4ZA 1JNXX 2W22A 3HDGA 2O7QA 2BT4A 1Z0AA 1E7MA 3LOPA 2VPZA 4NZPA 2YNMA 2PPVA 3LDAA 1EXWA 1CC1S 1O7JA 3SYRA 2OM6A 3MD0A 4P4UA 3B2QA 4PPNA 1GD1O 4OHVA 1S8FA 1QTIA 2H1OA 3EDRA 1H5NA 1B0AA 2GYYA 4TT3D 4UVIA 4PZLA 4HATA 1BX0A 2PLAA 3WWDA 3OP4A 2JVJA 4LRQA 2B1IA 1MP0A 4I50A 1UJ4A 1CBUA 5KFRA 1DTSA 4FFLA 1AUVA 1D1SA 4WECA 2HQRA 3EZ2A 4IDCA 4C03A 1GRQA 4LXTA 4PE5B 3HRKA 1O5OA 1XSEA 4BYMA 2VK4A 2IKSA 5AVJA 1QANA 1JP7A 1XEAA 2PA3A 2PMKA 2JCVA 3LYHA 1K4MA 4Q03A 3JD3A 2EWMA 4ID3A 3ESYA 4BCCA 3TEJA 3I8XA 2QGZA 2RMKA 1LUAA 2D5LA 4YR2A 4BB6A 3OFJA 3L6UA 4NZNA 2XQVA 3ED5A 4C0AC 2H8KA 1AKMA 3QSYA 3DOCA 3HN6A 1VIDA 3P0HA 5CD1A 1FS4A 2I7VA 2P2CA 1UXGA 4NWIA 1LPBB 5F9FA 2OZLA 1SQ0A 1QHHB 5C8ZA 1SRQA 3COYA 2ZXEA 2A5YB 4MA5A 3PYLA 1DJLA 3TNLA 4G63A 3I9NA 4DEYA 4M0JA 5JTTA 1RLTA 1KKMA 3KPVA 4Q1FA 1QC5A 4GPZA 1JU4A 3IV7A 2YWXA 1DS6A 4B7ZA 4O2RA 2R11A 5D84A 4GWKA 4DVJA 3WGOA 2CWDA 1Y1RA 4EPTA 1XZEA 4B3TH 2C3YA 4M0KA 1PZEA 3FTCA 1KERA 1S0OA 2GNOA 2OMEA 4J0HA 1I5OA 3DUWA 1Y7LA 2I0FA 1CRZA 3UXHA 5KQSA 2QY9A 3EH2A 1AKNA 4B8YA 1UADA 4ZTZB 4IV5A 1U2TA 4NBRA 4WZZA 1XCBA 4ZOLA 3KNZA 1VDMA 1FX0A 3FFAA 4FYMA 1Y9ZA 3EW7A 4KDRA 5B2EA 1QDEA 4QUKA 7REQA 2DBYA 1P0QA 1CK4A 4H1TA 3E3NA 1C7EA 4WT7A 3R7LA 4IHAA 5LMNB 3O92A 4ZJPA 3EYYA 3WVNA 4ILEA 4QDOA 4BZPA 4PSAA 4IHJB 1IFXA 3N7UA 3R5HA 1A8QA 4F3NA 3R5JA 5A4DA 3OZIA 1DV1A 5GQSA 1P4JA 2MMCA 2W6ZA 3CNBA 4RCZA 2Z6AA 4EG5A 4H7EA 3ZNNA 1KXJA 3H2IA 5BN3B 2XDQB 5DHFA 2VJMA 2WAXA 5EYPB 3MINB 3HNRA 1X70A 3TGWA 1V71A 4CMHA 1UEJA 3RKRA 2WIJA 2R6JA 4PZAA 3DDCA 1KI2A 4UCFA 4IRXA 4JYMA 4NOKA 5KQPA 5DNWA 3NETA 1Z0SA 1WCIA 5I9NA 4FIDA 1BG6A 5F23A 4PAWA 2RF4A 2B83A 2HJHA 3KT0A 3VTFA 3O4HA 1EXVA 3W3ZB 4YRIA 1QAOA 1SKAA 5GJCA 5EHGA 4XX0B 4J9PA 2P1RA 4HAIA 2X0KA 5CHEA 5FP0A 2ZPAA 4KFCA 2B4YA 1FFWA 2GZDA 1FC0A 4DCNA 1LNZA 4NZ9A 4GC7A 3AVUA 5IKEA 3DS8A 3KKPA 2IA5A 4AO6A 4F5DA 3FETA 2PJDA 4TS4A 4RMGA 1PJQA 2PS0A 1YZTA 2QN8A 4D8YA 3GIMA 5ITZA 4ZHSA 4GYKA 4I14A 4XOUA 1HETA 3FTQA 2OMKA 2C98A 5AUNB 3ZW8A 3EOAI 4DT1A 1FMCA 1R0SA 3HP4A 1IK6A 2AXNA 2QRKA 4PM4A 4EFKA 3ESQA 5BNTA 2W37A 4AX4A 5FV4A 3TRJA 3ONFA 4EFDA 4TV8A 1W52X 3TMAA 1HE8B 5CT4A 1W4LA 4TYMA 1CUWA 3G8BA 4IDNA 1HEIA 3GDWA 3C6KA 4EKYA 5GVSA 4IFIA 2NVUB 2HNKA 1YKFA 3OC6A 4R1NA 4HDNB 2ZIEA 1SXJA 5JATA 1NI4B 1M8JA 2B8NA 4GMXA 4DA7A 2HXGA 3VU1A 4GVXA 4QBHA 3L6EA 4IG4A 4FCTA 3DKPA 3QQMA 3PFFA 4EGQA 5A7GA 4L78A 4XLLA 4NK5A 3ZHYA 1U3GA 5E8JA 1Q15A 1NNLA 3CEBA 3RWBA 2GLXA 2YVUA 2I6QA 3QYPA 3GXBA 4AICA 3VISA 1U3FA 1HE4A 2RBGA 3T4XA 4XFJA 4I08A 2OBNA 2BHNA 1O9BA 4I1SA 4AQDA 2HA3A 5CPBA 2R1ZA 2OBBA 2DCMA 4M49A 4KRGA 1MAVA 2V7BA 4ZO7A 1Z5PA 5DT9A 4CDGA 5IJZA 3E03A 4QGAA 1GPNA 5J59A 5A5FA 3U16A 4DCJA 1UBGA 4J6FA 3FTPA 3W5CA 3DP9A 1XHFA 4G0NA 4JI0H 1ORWA 1M2FA 2QD1A 5KC8A 5DIZA 4U7WA 2Q5IA 3CNOA 1C2TA 4DS3A 3RPEA 4DADA 2RI6A 3U6BA 4XIGS 1CZLA 2DBRA 4OHZA 2MU1A 4YJ2A 3JQGA 4YJHA 3C45A 1D2RA 1T4CB 3C3MA 1USGA 1HMYA 4M7RA 1CRPA 3Q2OA 4BUCA 1J70A 3ANMA 5KIAA 4JVSB 1T3NA 5JXHA 1S3SA 1SUFA 2VYQA 1QQ7A 2FUKA 3BMCA 3WKBA 2IHVA 2P6RA 3F49S 4KSYA 2FZCA 1JSCA 1K7YA 1UWLA 1PO7A 2IV2X 3ZV6A 2CXRA 4LZOA 4TTTS 3DCYA 2FRVA 4F6CA 3KHKA 4I1OA 4TZTA 4PQEA 3JPWA 5DGXA 3DVAB 3LHSA 3O84A 4II2A 1MJNA 4AX8A 3NKVA 3H42B 1G2IA 3ELWA 1HDXA 3LPLA 3S27A 2QVYX 3NIBA 4M0CA 1YQQA 3SDBA 2WU3A 3W8NA 1CDOA 2A5GA 2AQHA 2PLNA 3GDOA 5CW1A 5IT0A 4FBGA 2AEMA 2Z1MA 1R4MA 4R5HA 3W9SA 5FFFA 4U7CA 4QJBA 2AYZA 4MO9A 1XWWA 1GUYA 1PT5A 3LQRA 1Z29A 1PZNA 1YASA 1RHMA 4H6VA 4RB1A 5CB4B 3NTLA 4JV1A 4KC0A 1NKTA 1Z38A 4ZGGA 5DNCA 2HCRA 3BRWD 2FJZA 4YEDA 1GDDA 3OZDA 5DCLA 4HVLA 4ARZA 1MDBA 1XG5A 1TAUA 3NUZA 1Z4MA 5CR9A 1UZAA 5A9SB 4QPDA 1X2EA 4LJ7A 3OOJA 3IEPA 2WU4A 2EKQA 1VI5A 2HQBA 4DXDA 2GGSA 3K92A 2E4WA 5BWBA 4O1HA 3AJ8A 3WYDA 1L7XA 1AUXA 4W9RA 4QJ4A 3T7RA 4P4NA 5M7EA 3ZCPA 1EM8B 4MKIA 1YFJA 1WMAA 4OGWA 1CE8B 4UNNA 3VNBA 3G2OA 1BE1A 1POWA 4CM8A 4E3ZA 2WM3A 4FN5A 4C4YA 4QARA 3CR7A 4JLKA 5JTUA 2XQIA 1M7BA 5CCBA 2Y05A 3DE6X 4HFJA 4RIIA 1W76A 3H0KA 3WBFA 1JWLA 4EY4A 4DUGA 2AHRA 3HA5A 1NXOA 3L7CA 3SWWA 2BBWA 5FL7D 3W06A 2BHRA 3CVOA 1NRWA 3HFSA 4RIFA 1Q19A 2E5WA 2PUTA 4J1SA 3IHLA 3EVGA 3JRXA 1P0PA 3QVMA 1QFXA 3ITNA 4ZEWA 4YCCA 3EQ2A 5TF4A 3H1TA 1UANA 2X5JO 3OH8A 3GUYA 2XF8A 4PHTA 3IEKA 2P41A 3CUKA 4YIHA 4EBDA 2IY8A 2EJCA 5JVDB 4LJRA 4ZAFA 1DKOA 5D85A 5A9RA 1RFLA 2HU5A 5CCXA 3KV3O 1HSOA 2O2YA 5ICCA 2A30A 3OC0A 4D0SA 1N9GB 3R5XA 3TTWA 3T3HA 2VPTA 2YHSA 4FW8A 5AM2A 1AE1A 3GFOA 4L3WA 5ES3A 3JSXA 3RSHA 4UAGA 4O4IB 1U9YA 3IAHA 2ZUVA 1Y3HA 2QGFA 2ZE8A 4O81A 4DUYB 2E4VA 4D6YA 1LDBA 5JZVA 4ZI3A 4LZPA 3QW4B 4LHZA 3B9QA 1UP4A 3R3HA 4TVIA 5BWLA 3EMVA 1NY5A 3AKCA 5KEIA 1VJ0A 2GPYA 1R50A 4LDAA 4JV5H 3VKVA 4QFBA 3GV5B 5LL6b 2H29A 1ND6A 3GLHE 5KU1A 2AC4A 1A9PA 2W57A 3PGMA 4Z51A 3EIHA 1JFVA 3TM4A 4PYIA 5DDIP 1A9QA 4MS4A 4NXNH 3CZCA 4PXYA 1NQAO 1L8XA 1O94D 2VWHA 3K70D 3NM6B 3UH1A 1WDTA 4AUMA 4HAUA 2I6TA 2C77A 4QHTA 5FTLA 5I5EA 2IDJA 1FKAH 3OSZA 4I1IA 2JJ8A 5E9QA 4NBKA 1EK0A 3N3BC 1A82A 4MPTA 4LPKA 4W5NA 2XRYA 1EFPB 4C3ZA 2BSQA 4LBVA 1PTJA 4FU0A 3OPXA 4X63A 3HP7A 2ST1A 3VJRA 2J3HA 1N5LA 2QTHA 3HJAA 4A6EA 2JLAA 3D6FA 3B12A 4DIUA 4DR7B 2NU6A 2GEJA 4RH1A 1IEVA 4EEZA 1MFPA 1EFRD 4URHA 1WEKA 5B6IA 1OI2A 3C3EA 4WY2A 4OGLA 1GZ3A 2XTAA 3OT1A 1AMNA 3PXEA 5IARA 3PDUA 4LX8A 3AQIA 2CQYA 1FFEA 3VSEA 5D86A 4LHYA 3DZFA 2HZBA 4PCUA 4B09A 3AUAA 3TB4A 4HYQA 3VI4B 1M0SA 2X40A 3WJ2A 3B6JA 5BWXA 1E1CA 1RAHA 3RTXA 1H9BA 1G3RA 5JG7A 1Y42X 3DLCA 4XJSA 2ZS7A 3BE4A 3OCZA 3A1DA 3H4DA 1G7TA 2XE4A 1FFYA 3ZHUA 3X44A 1FUUA 4EBEA 5ERXA 4KNYA 9GPBA 3JARB 2NU7A 1ZD4A 3TTSA 1KSGA 2C9BA 3GIIA 3HA2A 2IYOA 2GS9A 4ED6A 2FPUA 1JU3A 1J9EA 3K8ZA 5EY5B 1P4GA 1V6SA 3RC7A 3MR6A 1SU7A 1GXSB 3EXHA 3ENWA 1ULSA 2FY8A 5HOQA 5FBZA 2YIDA 1P2SA 4ES6A 4ZYVA 5KFYA 4XIJA 3AEKB 2BF7A 4DN6A 1R00A 4RV4A 4M9UA 1N75A 2YMQA 4DBZA 2C2OA 4FB4A 3GLSA 4OAPA 1SUWA 2OGWA 1I3KA 3LBYA 2D1SA 2VXOA 4G86A 1E92A 2JH9A 3KV1A 4GOJA 5KYUB 3ICPA 4PC7A 4IAOA 2R97A 2X3YA 1ZVMA 1IZ7A 4OQDA 4OIMA 1S89A 2W9BB 3UG7A 2VWGA 2QI9F 4J9KA 5HX7A 4OFXA 4NPAA 3DL2A 4LY0A 5DSXA 3S6JA 3DLTA 4WXMA 1E5TA 2GTHA 1TPYA 1JU9A 3VYVA 1VAJA 1GCUA 3IA2A 1VL0A 2WWWA 3AEXA 3MQ4A 5ENZA 5HJ2A 1ID1A 3VR6D 1ZCZA 4F0JA 5LQJA 4PGMA 4LY9A 2PYIA 3SE7A 2O3TA 3WLTA 3K30A 3PF9A 3KU1A 4JR1A 4L6CA 4XJTA 2IP1A 4GWLA 3SKVA 4XVRA 4N49A 4XDGA 2XIQA 4B81A 2PKXA 3ROQA 3OOEA 1D4AA 3DAYA 3FNGA 2PU7A 3DFZA 3TX2A 3OU7A 4JZYA 3G17A 4IKEA 2BRUC 4I99A 3RYFA 2QRVA 4RPCA 3GRZA 3U62A 3AXTA 1XJQA 3X43A 5LZ9A 2PGOA 5LZ7A 8GPBA 5G1NA 4BVEA 1DCKA 2WWVD 4YY3H 2V5UA 1FYXA 1VYVA 1I3OA 2CEAA 5K8LA 5IWCA 1RIIA 3SF8A 5DKFA 1UJNA 4PTLA 4B6OA 5LCXA 2V3WA 6AT1A 2FW7A 1E5LA 3OQ6A 2O59A 1PS8A 1S68A 1CG6A 4G0ZA 2ANBA 5AD1A 4IDHA 2X9QA 4GWGA 4DR5B 2DERA 1J7KA 5EOYA 2JLUA 3ZYCA 2GJ8A 3P9ZA 1S5PA 3KOXA 3G2QA 2G8LA 4FGSA 4FGRA 4FHGA 4FLEA 1DEXA 1OVMA 5E8RA 2RHWA 1UJ2A 2EQAA 4C4AA 4Q6WA 3EFEA 3PCTA 4ALLA 2VJLA 3GV8B 1H6BA 1TYCA 2P3LA 2VP5A 3CLSD 3HFJA 2YV4A 1FRVA 1VIMA 3TYXA 1JLLB 1JFFA 2QJTA 1JVBA 4L4XA 3OP1A 1D6NA 2OLKA 3EHDA 1ZJ5A 2VHZA 5FQOA 3H4MA 2JLRA 3FYUB 1KE1A 4XIIA 1P1BA 5CRIA 2ZS8A 5BWOA 2EXXA 1F8XA 2FPLA 3VU9A 2R7ZA 2BR4A 1QNFA 1ZD2P 1MJGM 5JFTA 2Z6VA 2UZAA 3QXSA 1RLJA 3CZPA 2VA9A 1BVHA 3M1AA 4EPWA 2VXYA 3WL8A 5DCUA 1O6BA 1BA2A 3UWOA 5LJLA 5FKJA 4AN4A 4LMPA 2V0NA 1QH9A 3LUFA 2RFLA 5B2ZA 4YMUA 4IG9A 1R6TA 1ENZA 4BO6A 3K0CC 2GYUA 1CR4A 2D0IA 4X65H 3D8UA 3GLHA 1CJUC 1UT8A 2B2XA 3CINA 2X1LA 2ZBPA 4S12A 3D9QX 2Q3BA 3SOPA 2OXTA 2HHFA 1I1LA 2G0AA 1REQA 1O0SA 3KHLA 3WBBA 2BC9A 3ZTYA 5D8DA 1Z2OX 4W5RA 4I4CA 3TL3A 4O4HA 4MEJA 4B2PA 4RSRA 3M9WA 5AJTA 1UWKA 1UNNC 1M6YA 3IALA 2C58A 2DBVO 1G4HA 3ZH9B 3K9NA 5K4HA 1CS4C 4K9MA 1YQEA 4ZO8A 1JDTA 1RI2A 2JFZA 3VOTA 4XX1A 3UW1A 4QKQA 1SCDA 1S8OA 2FMFA 1OLXB 3K0KA 4G97A 3WY9A 3C85A 2DQSA 4OUKX 1U28C 1O03A 4EMUA 3M7IA 1KJNA 3IS3A 2RGVA 2YL2A 3I12A 2FW9A 5SV2A 4B3IA 1XF9A 3ZWYA 2VF8A 4YRTA 1JQ3A 3V6KA 3KALA 1AMUA 5FOXA 2PJRA 1CJBA 3WGTA 2X77A 4DLRA 4OLFA 1IBRA 1VYHA 1ONBA 2I3AA 1MOPA 3EPIA 2R66A 3R9XB 3PN1A 1DGQA 1YB2A 3V8QA 3ZJYA 4YX9A 3MILA 1FMTA 3UENA 4ZCPA 3DKKA 4TMYA 2H3EA 1U8FO 1J2UA 2ZUUA 3JAWA 4XQ0A 2Z95A 3BRCA 4L74A 4IMJB 4B45A 2Q21A 2UYGA 1OFUX 1Z08A 1LTKA 4RELA 1R5BA 1HNXH 1XPJA 4ARBA 3DFFA 2IYFA 1G7CA 1NN0A 4A0FA 4JUBA 2UXBH 1T1SA 1SVWA 4NAVA 5K0GA 4LYEA 5IVIA 4L2IB 3LXMA 3SNKA 2V4QA 3PPVA 5AICA 3RTEA 5E2IA 2H7YA 3DLPX 3ZGYA 2ZRKA 2A5DA 1C81A 1HO3A 2OHHA 4IDPA 5ITWA 2EL9A 3BFXA 1W88A 1BQ4A 3LBHA 3AESB 4MV3A 5HF6A 1W581 2I03A 3G2KA 2QMOA 2ETXA 2HIGA 2ISCA 4E5YA 3O3CA 1Y3DE 3JWIA 5JRZA 3JR7A 1PLLA 3WGMA 4EI9A 2YWJA 3E5HA 2AFIE 4K9RA 1E98A 2R93G 3U7HB 4DIOA 3IE0A 2HA4A 1W0KA 3LPCA 5HF9A 5B1SA 2V7XA 3MBIA 4OXRA 3CEJA 2P0YA 1C5KA 4PLGA 3GFPA 3IQDB 5DN6D 1SHKA 4HAYA 3TDMA 1X38A 2CJYA 1BXRA 1BE6A 1ODFA 5AJWA 4OYLA 3QVTA 1CY2A 5CCDA 1IB0A 3KS9A 3PFWO 1OJLA 4QUEA 1UBTS 3QNMA 3NBKA 1J20A 1GQFA 3AVPA 1DARA 3PXXA 1E9RA 4N7RA 2Y1WA 4NE7A 3RBVA 5JXGA 4P92A 1ZA2A 2WF9A 4X64B 3BBPA 3UAWA 3R20A 4RK1A 3KTAA 3Q7QA 3RYCB 4UUQA 5IT9A 4WUVA 2RHTA 2A4KA 2HG8A 1T8TA 1R18A 2HD4A 3EFOA 2PQMA 2HR1A 3UAOA 1K6EA 3OLWA 2Z30A 3MJ4A 2R1TA 5D7BA 3ZX4A 3WO1A 4CKYA 4ESEA 3VU3A 1E7WA 2R00A 2ZM6B 3GZTB 3OLQA 3DE5X 5KX5A 1FYFA 3BFPA 3UQYS 1GTL1 2QW1A 4E14A 2QUZA 1H2AS 4N7MA 2FDRA 2ORED 1FRQA 5BWTA 1DJQA 1L4UA 3EZ6A 1NJ2A 2V0CA 2QAGC 5GONF 1TWAA 4A0QA 3QMVA 1W85A 2F00A 3U3XA 1UBSB 4G36A 3LH5A 1TUBB 3HYTA 4P38A 2CNWA 1GGNA 3HVJA 1U0FA 1X19A 2AA3A 5AHOA 2WWHA 1WX1A 4CCYA 2RDMA 3ZHTA 2ZCJA 3MZ0A 3N5CA 1Z5ZA 3L2OB 2I8CA 2ZROA 1I7QB 3IDSA 2GAFA 4NXMB 5IYZF 4PO8A 5E1OA 4UUAA 3QF4A 4NBSA 8AT1A 4CRWB 2REBA 4D74A 3AETB 4NBWA 4GYYA 3T0FA 1AKVA 5FTMA 4M6WA 4X5OA 2PLWA 3D7KA 3N39C 5AK3A 1IZ9A 2DKFA 5JHGB 2B2CA 3GAMA 4C2BA 4MR7B 3NFRA 3O7WA 1NUTA 1ULUA 4ZALA 3NHZA 1IBKB 2W6ID 4LJYA 2FE3A 1GFSA 1FFDA 4ZP1A 4WERA 5ITSA 2IBTA 1EP9A 2ATXA 4FGUA 3PGKA 4N5HX 4AY6A 4CTMA 2ONZA 3URKA 2XB9A 3AG6A 3THYB 5EG5A 1ZWKA 3T7SA 2NO0A 3JAKB 1QWOA 4LGMA 1IWOA 4PLHA 2RGDA 3V1MA 1CUIA 1N1MA 4GT1A 1WXGA 5EIBD 4GF5A 1TZBA 1IPEA 2QV7A 2MYPA 4UNPA 5EZSA 1A1SA 2WF6A 3NBMA 5EQTA 4LJKA 4JYZA 1GN9A 1ZJJA 4NCXA 4UXJA 1GYQA 3I01A 5CJ2A 1ZMBA 2X1VA 2CMDA 4D4JA 1Z5UA 2EJ3A 1QHFA 4YC7A 4CEJB 5BSMA 4L8WB 1MC5A 5CXXA 4R2WA 3A6LA 1PK9A 2V7GA 4R2MA 1SQGA 3LQ2A 3HB7A 5I9SA 1H0KA 4B4OA 1EWKA 2V4UA 2QXUA 4Q37A 3S40A 1PR2A 2AK2A 3S1LA 2PZFA 4ITVA 4XYGA 4UZEA 4JI3B 3KSRA 1ESMA 4RGBA 5K3FB 1IATA 4UE3S 3D8NA 5E0OA 1W94A 2RB4A 4RTOA 3CYFA 1EK2A 2M2IA 1NPDA 4RZSA 3N8KA 4FLFA 1ZIYA 4YYZA 4AUEA 2AMJA 4PCAA 4WBSA 3QZ7A 2OG2A 3LXUX 2GAOA 1YFKA 2IUEA 3MTGA 1AHIA 1HG0A 1ZD5A 3OIYA 2ZR7A 3AUTA 3IB3A 2P2SA 4U02A 2HGZA 2YRWA 1K2VN 3QX7A 4MR9A 3TZHA 2Q5EA 3EEIA 3PFNA 4MZDA 2E0IA 3G85A 3CS3A 1NLUA 3NIWA 2WWTA 3OX2A 2WM8A 2UUAH 4OGGA 3SFVA 3WLRA 2OZVA 2XGMA 2WTEA 4HGOA 3QI2A 1AQYA 3PJDA 4C05A 4DJFC 2X15A 1CV2A 4Q15A 1Q7CA 2A8YA 1SBTA 4P31A 3OZBA 2GTPA 2ZQZA 3A14A 1XJ5A 4C7OB 3GFFA 4K8OA 3PFHA 2EFHB 4YAOA 2JIMA 3RSSA 2AFIA 1W46A 4Y2XA 5FLEX 5I8PA 1NBEA 1M0EA 5BUZA 4C7MA 3KETA 3DPUA 3HM2A 3KLNA 4KVFA 2P8SA 2XB4A 4OHKA 3SJCA 2Q2TA 4XEUA 3C3BA 3FMFA 4DA8A 1MDFA 1SCIA 3KQMA 3WXMA 5TQ2A 5JASA 4K6KA 4GMDA 4Z0NA 2RHOA 1VB5A 3RVPA 3JWHA 5C4XG 1U8CB 4UHDA 3D8HA 7YASA 4IEEA 3KOMA 2AF3C 3WZLA 2NAPA 1JB9A 2O2GA 1GM5A 3RADC 2W58A 5TMEA 3BMNB 2XCRB 5EEHA 4YAJB 4PYKA 3C41J 1CF4A 3AJ9A 4I4IA 1SCQA 5HJ7A 1IAVA 1VKZA 2ZSJA 4A10A 3IVCA 2BFNA 1G98A 4ETIA 2VKTA 4IF6A 3HV0A 2I1WA 1G6HA 1FXWA 4MUBA 4AUNA 4HJRA 2P6PA 1G9TA 2IMWP 1Z39A 2UZ1B 4MV1A 3SI7A 4L4RA 3PQ3A 3H3JA 4WN3A 4E5UA 2FN3A 4BV3A 1A72A 1EQUA 2ODNA 3D6NB 4GPIB 4G07A 4E0BA 3QFTA 5EZYA 3R8XA 1T0UA 1GR0A 1U65A 2ZSUA 4HDMA 3F6BX 4RCVA 3H0GG 3D31A 4CFYA 3K8QA 4Q3LA 4H7JA 2XKKA 1ZC3A 3FJOA 2H4YA 4B4DA 2ARKA 3W05A 3R8FA 4JLPA 3LKZA 4DDMA 2XWJI 2HMTA 1U3UA 5KYGA 2AN3A 1A3CA 4QUHA 1FL9A 1VL8A 1CUFA 5JDIC 4RCYA 3FTFA 2AOXA 2X5RA 1JL3A 1AKQA 3DMPA 4FYHA 2R8GA 4BL5A 4ALNA 2X14A 2ZQYA 4XCQA 4EYQA 1G3UA 1E1MA 3Q7EA 1QRTA 4A0GA 5AKZA 2FRDA 3IT1A 4CF4A 2RHJA 2JCSA 1H2HA 1ZK2A 1LV7A 1TO2E 1TWHA 4RNMA 1V7CA 2HHHH 4HCJA 4E5NA 4Q16A 4W9NA 1QX4A 4D9IA 3VNRA 2B2NA 4KW7A 2XUPA 5EWGA 3O8OA 4F85A 4DJJA 3KOWA 1TCBA 5CVVA 1JT9A 1DKMA 1H1DA 3I73A 1X92A 2DAPA 3L2PA 3TNJA 3ZE0B 4ND2A 4ZEVA 4C6TB 5IRCD 1DWUA 2B5OA 3DMNA 3PEFA 1WZNA 2PUHA 1ZD8A 5HNKA 4U2BA 4RFSA 4JYBA 1CZUA 1PUXA 1NBAA 4I7HA 5I01A 1WF6A 3UOWA 2R4TA 1J4AA 1GU7A 4KX5A 3FZYA 2JA7G 1VLLA 4M7PA 4X9XA 3AFGA 3PSAA 5KNDD 3TQFA 2R62A 4A2BA 2ZRHA 3CR3C 5HK8A 4YMHA 2CLCX 3ISJA 5KT3A 4XCVA 1A1VA 1Z7YA 3ZZUA 4MQBA 4C4RA 1ADGA 2ZWOA 4MMXB 1GQOA 1E3TA 1IE3A 4CMGA 3IIJA 4KXYA 1PGPA 3HKBA 4DM4A 3MD9A 1P1JA 4MROA 3CRNA 4L0DA 1T3LA 4BBZA 3RS9A 3ONEA 1W4ZA 1GV0A 3DR3A 1CIJA 1FBNA 3DT8A 2J5BA 4JCOA 3QE9Y 3T9EA 2LUOA 5ECGC 3KQQA 4IJKA 2JI4A 1WCXA 3N6RA 4LRWA 2IS4A 1PAUA 2BZ0A 2OFPA 1V3UA 1I2BA 3HU2A 1XA3A 3DA8A 4HTFB 1G9SA 4C7VA 2OV3A 1Z5GA 3FGPA 4Y6GB 3IX7A 1UC8A 1V5IA 1W36C 3JD2A 5HKOA 4KK4A 4C0WA 3MT0A 3MMXA 3PZRA 3ENZA 5EIXA 2XHEA 5EIWA 4KQKA 3OCYA 4FDTA 4HVAA 3VBEA 1CKNA 2HRZA 1GZ7A 1NSTA 5IT9W 4IW3B 4WE3A 1JFSA 1MO5A 3CSDA 4FPXA 4JOBA 4WBNF 4OREX 3DV9A 2P8JA 2HH9A 2QYHA 5F2EA 1P1KA 3LBFA 3GTQA 2VA2A 4H4EA 1H8HD 4TKVB 3GLUA 4EY7A 4DNPA 1AURA 2X6TA 5FUYA 2PKEA 4I3HA 3LUCA 1DZIA 3FNBA 5AW6A 4AI6A 4D8WA 1QE0A 5CXSA 2VPPA 4OHBA 4MW5A 2GHRA 3PCXA 4K3UA 1V8OA 5EXSA 2LIVA 3UAXA 2GD0A 4GKJH 2AW3A 3FWPA 1FA9A 3VJMA 1GVHA 3ZDFA 4FGLA 2DFKB 4Y9SA 1DC8A 2JL1A 2B78A 4BY9E 4B46A 2HSJA 3AB7A 3INYA 5BVGB 5IEJA 3GGCA 1O96A 6ADHA 4R8RA 1IC6A 1Q0SA 5THQA 2SHKA 4BLPA 2QM8A 5LMUH 3DDHA 3KQLA 4J75A 1AB5A 3QTBA 3I45A 1I2MA 4XWGA 2WUFA 1UKBA 2HT6A 3L93A 2DQ4A 4ECVA 1R16A 4OAOA 1TM5E 3DL0A 2PMZE 3L6OO 3S2FA 1U2DA 2CNKA 3CEPB 5JPIA 2BUBA 2OZEA 5JNTA 3AM4A 1ML4A 1ZL2A 3GJ3A 2P11A 1VGQA 5CYPA 4QQNA 5AUOB 4CF5A 1FMLA 2P9HA 3LNCA 3MCZA 4KQWA 3P71T 1GZ6A 4GNRA 2WG2A 1BQEA 4QW9A 1ECLA 1X9HA 2FPKA 2SBTA 4IJ6A 4RSGA 1OKKA 2VRCA 1XEXA 1U7XA 1AUPA 4C0HA 3HADA 2LV8A 1YHZA 5IUJC 2W8BA 1WZEA 5TB5A 3OOWA 3N2ZB 4I6JA 2A5JA 4ZDIA 2FSVA 4MS1A 4NBTA 1ZN2A 1CUCA 4LTNA 1KSFX 4XTCS 5HKBA 3LD9A 5JC8A 4XA8A 3AYHB 3BWEA 3SVZA 1ZUIA 2JGLA 2I2XB 3REOA 5ADHA 3F67A 4BYGA 5DN9A 2H4FA 3LQYA 5HTOA 3VKWA 4FCVA 4XCXA 2WHEA 2JB9A 3UBMA 1FQKA 2R0QC 2R6FA 3O8DA 4RK4A 1P18A 3L6RA 3U44A 2HIVA 2ZYDA 1ZINA 4HRYA 4CKCB 2QR2A 2XQFA 1OC2A 2HOQA 3AVVA 2OV6A 2ZRGA 2EZ4A 1MB0A 2BFFA 4OAQA 4DLYA 1IWBB 3HJTA 1IXZA 2REQA 4W8HA 1PWXA 1NV8A 2GK7A 1RWXA 2XT0A 2G36A 2WJJA 3MN1A 3FWNA 3OEHA 1NXVA 3CZQA 4IUDS 5JAPA 3FY4A 3ESDA 3AUXA 3NYRA 3WNBA 4IJ5A 1H4QA 4DMUB 4Q4AA 3J81k 3GJ6A 5BN5A 3PGA1 2GPJA 1NV9A 3C43A 5D3QA 4DA0A 4WV3A 4KSBA 1N33B 4Y1RB 3VVCA 1JDJA 3TCXB 5CUQA 2WVGA 3UM9A 2BEKA 1A9XB 1HDZA 3HTXA 4LNHA 2H2AA 2FLVA 3CNQS 2QTCA 2J6SA 4ZGBA 1QIDA 3MTIA 4QULA 2HLPA 1KBZA 3SM9A 4F8YA 1FRNA 3ZBTA 3LPNA 2WQ7A 2H85A 1HE1C 3W9YA 2CV2A 4DLKA 1QS0B 1WBBA 5IDXA 4PYMA 3KKKA 3OPYI 2PT9A 1ENOA 3C7CB 1T4DA 4E1AA 3PICA 1L9KA 2IH2A 4TKUB 1GPH1 4AULA 1SOWA 2F1JA 4J9SA 3Q3VA 2PWBA 3EASA 3OCXA 1C50A 3IO3A 4G5HA 4BQFA 5HQTA 4AUKA 2GXQA 4TLDA 2WY2D 5DV9A 4TSRA 1P3JA 1M10A 2BKUA 1M1ZA 1U1DA 4RTLA 1FNDA 1MNQA 2YNMD 3MLBA 4RGQA 5IXSA 2AR7A 1WMBA 3U55A 3VMMA 3LK6A 5KFZA 2LDXA 4XKJA 5JJBA 1OX6A 1IXKA 3PR3A 2INGX 3IP3A 1VP3A 3UYKA 3OUZA 3ODPA 1LQ2A 2F8SA 4TXHA 3VZCA 3U56A 4DQXA 4ED0A 2QMEA 1C7IA 2QD5A 1T5LA 4YJDA 5GOZA 4JDUA 4K6NA 1ZKMA 4OX9H 4IHJF 1X8LA 1TIPA 5MGBA 2VNSA 1F20A 3BTVA 3DQPA 5JFGA 2RAVA 2CLSA 4H7PA 3B1YA 4CWAA 1UBEA 3CZRA 1UPTA 2AOUB 1EX7A 2RHHA 4Z53A 1VIYA 4I46A 4NQZA 2VXBA 4LJ6A 5LIPA 5I8WA 3G79A 4Q05A 1YVRA 3PT9A 3WZ2A 2B63G 1QGOA 5EE3A 1TYEB 2O19A 2HKIA 4I7EA 3HJHA 2QL5A 4LY3A 2DM6A 3FSEA 2VAPA 4FYJA 1X80A 2OFXA 3ZZNA 3MWMA 2Z9CA 4Z7OB 5EMMA 3D3WB 4YACA 1F7UA 4BVAA 2BFEA 1I6KA 4APMA 1J8MF 2QN9A 3UH0A 3GH1A 4JX9A 4LPSA 5CDSA 3U6KA 3E23A 5BORA 3SICE 4R71A 3PUHA 3CG4A 4RTNA 4QU8A 1L7NA 2XSZA 3ZV3A 5PNTA 1OW3B 1XAIA 1L6IA 4HNTA 3GR6A 1DX9A 5EWLB 4MIYA 4QYIA 1XTVA 4UBKA 3KZVA 3FVRA 4MV7A 1KQFA 4B34A 5CX4A 3USES 2YOHA 3ZWVA 5I5UA 3IVGA 4GKAA 2W43A 4TSFD 3MAJA 1SFOA 3KDAA 3KL2A 1YUNA 5LXTA 3RF7A 3FB4A 1LI4A 1R6DA 3E4DA 4X1YA 1VZ2A 4OHMA 3DB1A 2H2IA 5EKXA 1VBHA 4TXLA 1RZ3A 5KFEA 2YCLA 2FEPA 2H1HA 2J3MA 3L7KA 2SCUB 2QDKA 3ZWDA 1NQUA 3EZYA 3RT1A 1RMYA 4M54A 4D9NA 2O1XA 1G8PA 4K7JA 5ALYA 5C1BA 1UC4B 3ME5A 5C8YF 1N6RA 1XQ6A 2PMZA 1IL0A 3MBOA 4ZQGA 1TMGE 3QUCA 2PZ8A 3L7AA 4DV6H 1RYNA 4JWTA 2Y0PA 5CK5A 4RQAA 1SZJG 3GQVA 2V8BA 3TIFA 3UGJA 2IF2A 3QZUA 4TTRA 2YVLA 2HTFA 3M6MD 5ALMA 1X8KA 3NV9A 2PWAA 3FPEA 1ZESA 4A3FG 2IYSA 4A3DG 4JVOA 3FCCA 4BE4A 4FJ0A 4J3FA 1XNQH 2QIPA 3LT2A 3ANTA 5KFCA 1N7JA 3L8ZA 2OXEA 4AKGA 2IWRA 2XBUA 4UHCA 3E1KA 1Z68A 4J0DA 2PV0A 5AVKA 4FS3A 2R93A 4YCMA 1WM1A 3KAPA 4KQMA 4X7RA 1DUVG 1UZUA 2O5CA 2BE9A 2P2NA 4AD8A 5AVUA 3O9MA 3AOGA 1I4WA 2V59A 2JI9A 2WIFA 3D6VA 5T4FA 4KHPH 2OILA 1THTA 5DB4A 1XPOA 1R1DA 1M3SA 1A5AB 1OPXA 1P80A 3FR7A 4R1UA 4JASB 1KJYA 5ALTA 4DV4H 3B89A 3OTWA 3M6LA 2JRCA 1CERA 2W0MA 3IQZA 2YYYA 2OXFA 1JIJA 5DBIA 4PWZA 2XXAA 4AYTA 4Q93A 2HADA 1B42A 1USIA 4PTZA 2CXUA 3GG9A 1EAMA 2CXSA 3EYWA 4JJIA 3W2IA 1KIAA 4MV0A 2WM2A 5F35A 2A94A 2JHFA 1A50B 1YS6A 4JBXA 5EP4A 4I4TA 3L4KA 4PZPA 2QUKA 1K8QA 3Q3GE 1EJBA 3NUQA 4H6WA 2HLHA 2P9YA 2IEYA 4ZOQI 5IUNC 2ZOSA 4FNOA 4BNJA 4XUDA 4TQGA 1SXJD 3RFTA 1V7PC 3N0RA 1P39A 2GO1A 5KOIA 2PUBA 2O2XA 4EL0A 1Y4SA 1JQEA 5F7OA 1D2HA 3EPRA 2BWJA 4EYSA 4Q4JB 2EBHX 3C3DA 2C22A 3Q41A 4L7VA 2C31A 1XMOH 2HHLA 3ZWWA 3EPPA 2M98A 2KWIA 4FFDA 3GARA 2ON6A 5KWEA 2OOSA 3AF3A 1A97A 3HJRA 1XZGA 1Z8FA 2VLBA 5MHTA 3THWA 4Y9RA 2PZMA 5CJJA 3QH4A 3LHDA 1FXUA 3W2GA 2COJA 2CW5A 1WUJS 4GLJA 2GK6A 2XW6A 4HSEA 3T4EA 4AYBE 5AP9A 5ALJA 3QTLA 3BRSA 1R0RE 2VP4A 3FOZA 1NLZA 3EY4A 1POXA 3GGGA 3S2GA 2A35A 3D2LA 4J0CA 4N54A 3ZU5A 2HRQA 2FRXA 2G07A 3UTDA 2D1TA 3DE4X 4UW9A 1TJYA 1IBLB 4LXQA 3H1BA 3C3WA 1F2UB 5JEDA 5B58C 5DK6A 5HUJA 4EHJA 1WTAA 3B20A 3NJ4A 2ONYA 4ALJA 4X66B 3L4BC 2JFXA 4XM0A 5JMTA 4QUGA 5H4GA 1VG1A 3DEFA 4YVFA 1RT9A 2M6LA 4IOLA 2QXYA 4KYTA 2BDEA 4JUFA 4LRTB 3BE5A 4U2FA 1IBCA 5E2AA 1I51A 4YCLA 1W87A 3UF0A 1DBIA 5KFIA 2AJBA 3ZU6A 3PNMA 3HHPA 4LQ4A 4WY5A 4XRRA 3N70A 3BSWA 1JHAA 1TWCA 3GJYA 2J08A 2LP4Y 2DE0X 5K2OA 4QRDA 1Q6YA 5CB0A 1MC8A 5IDWA 1SBHA 3AO0B 1ZJZA 4AO7A 3IKLA 2J0UA 3AL0C 1TAGA 1EKFA 2COGA 4Z6KA 5CA0F 1OFIA 4YCSA 4ILKA 3B9BA 2UXCH 3A1NA 5IG2A 4M83A 5AXBA 5JAMA 3BIFA 3H9GA 4TLEA 1UK6A 2P2ZA 2AUMA 2FWMX 2PMWB 3EBPA 3TD6A 3LUJA 3C4JA 3RRZA 3R3XA 1A95A 3CN7A 2ZRMA 1FFHA 3S4YA 3MR5A 3Q3JB 1E6UA 1BS2A 4BZQA 4Z7NB 4LVUA 1PBNA 3FCUB 1TECE 1KKUA 1DG9A 2V54A 3B51X 1WW3A 3S8YA 2X0DA 3L4BA 4GG1A 4V2UA 1DC4A 3HY3A 1FU4A 4J0QA 1NQWA 1UFOA 3Q11A 4UM5A 5HF5A 2XJ4A 4CLEA 1DQNA 2K87A 1SHUX 1SG9A 1WDWB 4NATA 3G82C 4O4LF 2PZAA 1KO7A 1G5RA 1NSFA 4YI3A 4JBYA 1ZCBA 3CR8A 4Z9AA 5EE1A 5FLXA 3BQ0A 1I4DD 2JEZA 5A04A 3GJ5A 2WDTA 1HNZH 1EZZA 3N8IA 1KRHA 4I66A 1LFAA 3F8WA 1QHYA 4J9NA 3D4IA 3HXOA 1RSZA 2ONKA 1L4EA 2EYUA 3RASA 2CUKA 3OICA 3U0BA 4CDNA 1GIAA 3TSYA 4KQHA 5DP1A 4XGIA 1SK8A 4ONEA 4Z9BA 3IBYA 1R4NA 3IV9A 1G7RA 4DUGD 1FNSA 3Q0TA 2CK3A 4B3HA 3KBBA 1CX9B 2BHTA 3AT1A 4QUBA 4DCGA 3GUCA 1ZSVA 3HUTA 2Z2IA 4D79A 4MIKA 2QBYA 1OU0A 1X7GA 4G84A 2J7KA 1PZGA 5J2UB 1NPTO 5GOTA 2PKWA 1N6KA 2GXSA 4PSCA 5KU7A 4D9EA 2H65A 4YP9A 1G6OA 2GKOA 1SBCA 2QLBA 2F43A 2WSIA 4X54A 3A6PC 4J9LA 4K46A 2B7BA 2ZR0A 2GI4A 2C3MA 1G4UR 3WQRA 1W1WA 4D0NA 4QDUA 4L76A 1P19A 1WBJB 4DZTA 3DVLA 3G7SA 4MV9A 5REQB 3SYKA 1C0IA 1B6TA 3X1KA 4UFPA 1BYUA 1XD9A 1AGRA 1GPMA 3DPSA 4EGJA 5L3SA 1S9DA 3E35A 4M60A 3CH6A 3L4JA 1XD2A 3KVRA 4ESHA 2BAGA 4KMMA 3ED1A 2R5FA 1C1XB 4TTVA 3IHTA 2YOFA 2EU8A 3O0TA 4ZCLA 1NLFA 1PZMA 4D56A 4AKHA 1PZHA 3V3TA 1PZFA 3KLMX 3GB9A 2PZLA 4AZTA 2ZJTA 4O86A 5COBA 1P7CA 1SVMA 2FWNA 2UZ3A 2JVKA 2IYQA 4WCFB 3RWMB 3LTNC 4EL5A 5F98A 1CHDA 3D43A 1V16A 1TRHA 4TN1A 2BBOA 4FVTA 4GM1A 2RH4A 1GPDG 2CLEB 2PWYA 1T9GR 3H0GA 1U2GC 4X3OA 5FB3A 3O1HB 3HL0A 1QO0A 4QOHA 2B25A 4YCDA 4B7XA 1X2BA 1BDBA 3QV1A 3EIQA 3K5HA 3D3JA 4EF4A 4I5DA 1WSWA 2IUUA 4DARA 3ELDA 2K4MA 1UJBA 1FP7A 2KM1A 3DLIA 1Q11A 5EPUA 4WAUA 2CL7X 3MIZA 3H9EO 2C9OA 2VDLB 1DJMA 4ZT2A 3HA7A 4W8OA 1UK8A 1NASA 1ATZA 1NW9B 3IAM6 4CODB 1FUIA 5J5VA 3EISA 4D8VA 1FSFA 2WJ4A 3G0BA 4URFA 3ER8A 1F1JA 2R6R1 1V3TA 2JLCA 3T0IA 2NYRA 1VIAA 1O95C 4AYBA 5E3JA 3GJXB 4P3KA 1ZIXA 1R0YA 4WASA 1H42A 2C00A 4TQRA 1UWVA 1ESCA 4HG2A 2RARA 3X1JA 1NDHA 3PQFA 2ILVA 2BRUA 3HPQA 6ABPA 2YXDA 5BSKA 1KJQA 4MVYA 3KU4A 3PLRA 1U2GA 5L6LB 2E4UA 3O90A 1G8KA 3EDMA 4N48A 2WAYA 2WIBA 4TWIA 3PJGA 4PAGA 4WNAB 1H93A 5KPDA 1QMGA 3E8MA 3G49A 2Z3WA 1OZGA 2JA7A 2G9VA 2IHTA 4RHXA 5DHPA 2VDKB 4CCWA 2XMPA 4KWHA 5KNCH 1QVRA 4XB1A 1U3WA 4EF6A 4XD7A 2Y77A 1IUOA 5KSPA 2AX3A 1E2DA 4ZIRB 1TT5B 4E6EA 1WUTA 5EIOA 3KD2A 7ADHA 2IYAA 3I34X 2QSJA 5K0ZA 1Q91A 4JXXA 2IXAA 2VZ9A 1IBMB 3M9MB 2CHUA 3A3NA 4LFCH 4XFDA 1OREA 1FJGH 4LF5B 1CNMA 3RU7A 3GEDA 4TRJA 1WMFA 1AIPA 1II8A 3N2LA 4DLAA 5LQDA 4RTMA 1UT6A 3R3YA 1G9XA 4CE5A 2J48A 3DNMA 4MKFA 4MLCA 3VGJA 5L40A 1B1CA 3TZCA 3AG5A 1P7PA 1FX1A 2AZTA 5I7WA 1C7ZA 3U4IA 1OLUA 4HMPA 2CNVA 3UOAB 4CLRA 4A73A 3L0BA 3TZBA 3WWIA 4ARUA 3DAOA 1JJIA 1Z5OA 2XQJA 4LF6H 1XN4A 4PFQA 4OF4A 5I9LA 4MLPA 4PRYA 4N12A 1QQ6A 5AW2A 1U94A 2A9FA 3WDMA 3NLLA 2OD7A 4K3VA 4PLPA 3HUUA 1U0TA 4QW8A 2VQ6A 4R01A 2BZ1A 4YMVA 4I2VA 4L51A 4HWOA 1ISRA 3UZOA 4E21A 4KEAA 5FAKA 3K0CA 1MENA 2RC6A 3JATB 4R84A 5CH8A 4NCJA 4ER3A 4TYYA 4FE3A 3L7DA 2D3WA 5F51A 2Q41A 2C8VA 4L4UA 4U7JA 4UOZA 1B8VA 5KREA 1FUYB 4KWIA 2PX3A 5GVRA 2R7AA 1JAYA 4BU1A 4B6JA 1QLWA 3VRHA 3LKBA 2BFMA 1N32B 5A03A 4J9QA 4GFDA 2XMSA 2Z8XA 1P6UA 3RBEA 5HMLA 2HLDD 3QPAA 2BJVA 2XUZA 5J23A 4Y6LA 4A1FA 3KB1A 2ZU6A 3EXFA 4MGKR 5BNWA 1EQAA 1MJFA 1AG9A 5IJ0A 3RS7A 2DPIA 4A8HA 5E3HA 3SIWA 1DDOA 2Q5FA 2CBZA 4YH1A 2XMCA 2BMDA 1JG3A 3RVBA 1U28A 3ZBPA 1W5AA 3JR3A 2QU7A 3JZDA 5BQ3A 3T95A 1M66A 2E1PA 4HT3B 1A2KC 4WADA 2XCTB 2R1VA 4NCBA 3HJNA 1UBMS 4ZT7A 2MCTA 3COZA 4BB9A 3BT7A 2YQZA 3V4RA 5A02A 4EUHA 1WXHA 4MVJD 3C0KA 1FP4A 1ZM3A 1SKBA 1SBYA 3WTBA 3H7IA 4N8SA 2FV8A 5IM5A 4L15A 4NLGA 2X9NA 1EGMB 3VMFA 5KUTA 4EEYA 2CSUA 1JECA 1IUKA 2QQGA 1LPOA 3GFTA 2H06A 4CF7A 1KZ6A 4RENA 4AZ0A 2GBLC 1RVDA 2CYAA 1JKXA 3CNHA 3KEOA 1C9JA 3BREA 4YMIA 3UQ8A 4DV2B 4QUIA 2MYNA 2Q4RA 5ESDA 1GAXA 5DQGA 3HSKA 4Y2UA 4P7JA 1P1CA 3S2EA 5FTJA 2WWIA 3LVBA 1SVNA 3SQOA 2B4AA 2F64A 3BHNA 3TBHA 1RYFA 3GNSA 2JIRA 5BXYA 1TC1A 4IUCS 1SXIA 3A4YA 4LSXA 3AY7A 2YQ4A 3D4LA 4TZKA 4WFIA 3IPCA 1YD7A 1BCSB 5KFVA 4NE2A 4B6RA 1UPBA 3D7NA 1PNOA 2R8HA 3T94A 2EWWA 4ZU6X 1Z4OA 5EKUA 3WTCA 2G5CA 1O3YA 2ZT7A 4DR3H 2V8OA 5ER9A 1A96A 2QOEA 3DHEA 3MTBA 1ZQ7A 4U7GA 4DB2A 2FMAA 4NG5A 4TV9A 1ZO8A 1NXQA 1RI3A 1B16A 4OQMA 3PPIA 4A91A 1F51E 5FLXW 4FILA 5EQDA 4BB5A 4A3MG 3AIOA 2PXHA 1NNUA 4TPKA 6REQB 3IP8A 4OQQA 4CIWA 4LZJA 3WISA 2OGSA 2WWGA 2YY7A 1GPWB 1ZETA 3TNDA 1ST2A 4OA8A 3MOSA 1ZK4A 4FKZA 4KQ1A 1IZYA 3D7SA 2JA1A 1NOKA 4A6PA 3DDSA 4NJEA 2ODAA 4TX1A 3OJOA 3RSCA 2QVLA 2I4MA 4RZXA 2VZ0A 3DF7A 2QAJA 3VUEA 2EIXA 2RAPA 1II9A 5AW3A 4TUYB 1W96A 4YECA 1CKMA 1M1YB 4P6VF 5LIRA 2ZTHA 3N07A 4XLTA 1CVRA 1RYYA 3ROEA 5I7RA 4JR2A 2OQ2A 3UHFA 1VMKA 4IYJA 1DDIA 4GZMA 2ZJ2A 1EUDA 1CUHA 1NZJA 4DBLE 1KYQA 2Q2WA 4I9GA 2IH5A 1AN0A 5A5EA 1KJ9A 3ZVNA 4WY8A 1C9DB 1X6VA 2QG6A 1VECA 4FJ1A 3LRPA 3JALA 1MF7A 1K4YA 2HAEA 5FLMG 4HYEA 1BMTA 3UUEA 4CHTA 2ZULA 3THOA 2QAGA 2VPQA 2VF7A 4TRNA 2JFQA 3VR5A 4B80A 3WK7A 1EFDN 3C7TA 3EUEA 4D97A 4FFRA 2EDCA 3WAGA 2BDUA 4EM6A 2VZ8A 1W0KD 4PSUA 3LC2O 1TQHA 3QVLA 3IQXA 2JFOA 3RVMA 5ECWA 3RNOA 2IOYA 3IQHX 1DI0A 5CFLA 4MPJA 3PDCA 2E2WA 3BJYA 4ECXA 2EP5A 2JBWA 4JEIA 5DGAA 1N48A 1JH8A 3IKTA 1V5GA 1YZLA 1HXHA 4Y30A 2QGNA 4R0NA 2R7KA 1ZM4A 3E82A 3WMFA 3QOWA 2IYRA 4CBVA 2G9QA 4NEQA 1D6SA 5EJ9A 4ZVNA 2Y1XA 2OZKA 2B63A 2EBWA 3TLMA 2ZJ5A 5AQ1A 2B9VA 2QK4A 2YINC 2P7IA 3E70C 5F5NA 4CIBA 4N6OA 1SUEA 5EMHA 3R3JA 1OGIA 1E7QA 4GC9A 2OV2A 1ISGA 4C4TA 1YJ5A 3KE8A 4C29A 3QFSA 3P7MA 4B79A 5KT2A 1RK5A 3TQTA 2WT4A 1UBNA 5ERYA 1NC3A 3SY8A 4BLSA 3U3OA 1OZHA 2C5LA 5E6UA 5DFAA 1I3MA 1KAGA 4AG3A 1YONA 1L7RA 1VPTA 3H97A 1WB9A 4YMTA 1X14A 2HHJA 3AHHA 5B3KA 3WYAA 3E6AA 1PEDA 4O7NA 1KC7A 1TM3E 5FHQA 2AOTB 4L6AA 1HKHA 4DDTA 1JRLA 4HXFB 3UO8B 5E4FA 1WAMA 1X7WA 1M7JA 1OA0A 5DX8A 1RWKA 3PHLA 1G20B 3SHTA 2Q7OE 1FXSA 3H7AA 4MUMA 4J3NA 1ECCA 2XUQA 3I05A 4D9JA 3K15A 5ANRB 1DPGA 5FWAA 2Z98A 2ECFA 1EM6A 2BFOA 2HDWA 1GZHB 2WJ3A 1QGUA 1W34A 2PBZA 1USVA 1SIUA 1RJGA 3TSZA 5F1PA 5K3WA 3JQ7A 4PRLA 4DM3A 1A4RA 4X7MA 5TQJA 2R5WA 3GFBA 3A1TA 5HKLA 4MP6A 4CNQA 4M86A 4KRFA 5ICGA 4OBBA 1ZVVA 4L4SA 4JWKA 3V1UA 2PFSA 3C39A 5AM1A 1YS1X 1OWPA 5G41A 3R24A 3LSYA 1TX4B 1UMCA 4JK3A 4LYGA 4DLNA 2O1WA 4ZMBA 2Y1CA 3DOUA 5D1NA 2P9EA 1UBOS 2C99A 2X9GA 4NRDA 2JD2A 3VYWA 1W19A 1SU6A 3U54A 4PZZA 5K45A 2GPBA 2JK1A 3PTLA 4OFBA 1JZSA 3O3MB 1NU8A 4DR6B 2FEAA 4GR5A 1N25A 4PFJA 3TFWA 4KAXA 4TZ6A 3ZQUA 4F60A 5JHHB 2PUEA 1CP2A 2H3HA 1S1MA 3DHNA 1D6MA 2XNDA 1E20A 3B6ZA 4PPQA 2FWRA 3AVTA 3I32A 4QPZA 4F91B 3BICA 3A9VA 4XZ3A 3B7PA 1SUAA 2NZXA 4S2EA 3UJ9A 2KSWA 1ECFA 4CLOA 3TXAA 4AF7A 3VC7A 5IVHA 3D54D 4JI7B 1JWAB 4H9GA 3IUSA 5H8WA 3I2KA 4DBLC 5JCJA 1RMTA 3KVOA 2VP6A 4DKJA 2W6CX 3OPYA 2NUPB 1E7SA 4RHTA 4NC9A 1IXRC 2EJUA 3FSJX 3PXAA 3BRQA 5M3BA 4QVGA 2NX2A 5FLYA 3SE0A 5JV5A 4WOBA 4NLLA 4ITRC 4TKMA 3RUHA 2XXBA 4PZ6A 3RIMA 4JLSA 1SXHA 2H51A 4KQXA 3N0VA 3CLUC 4NCAA 2X4GA 1Y4UA 2GRUA 3A37A 3B1FA 3ZDYB 2VHJA 3V80A 1LBEA 4ZMSA 3C6YA 3FDJA 5DTEA 4NCHA 2EG5A 4HFRA 2GWHA 1QVZA 4ZQEA 4ZI7A 3UPTA 2YR0A 1TZJA 3ZEAA 3HRHA 3SLKA 2Y2UA 3IQIX 2FZWA 2GPTA 3RI3A 3QY0A 2XAAA 3E9QA 5EJEA 4M8SA 3PNVA 2A9RA 1OZAA 1X1RA 1GRVA 3V7WA 3W9BA 1I2DA 3KAKA 5LOVA 3UCXA 2ZI4A 1K3FA 3TIVA 5F2NA 2W2QA 2C7GA 4DBVO 5LMNH 1OX4A 5CM8B 3B2NA 2O8DB 2X8JA 1OMOA 3FPKA 3QKRA 4PFKA 2GF0A 5JDIA 2W9AA 3R6WA 2XUGA 3PA8A 1GZ4A 1L5WA 4G0XA 2Z43A 3A4MA 1WD5A 4N40A 5K8UA 3C4VA 3AFOA 4HMQA 5EESA 3HCDA 4M9XA 4YT8A 3WIBA 3IP5A 3R5FA 1NF9A 1ZUHA 3HO6A 1QIEA 3LY7A 3TLGB 5TQ0B 3EQ9A 1X1TA 1ZH8A 1VHTA 1Z16A 5FI1B 4CEIA 4BASA 5DSTA 4NEGA 3WGVA 2XNSA 1D07A 4J8PA 2O1SA 5ILGA 1XRPA 4BEWA 2NU9B 3WGNA 2ZPUA 4CKBA 1NYRA 1A5ZA 3W0LB 2AIRA 5KVQA 1TA9A 3E9YA 4Q6BA 1T3SA 1A5SB 4TOIA 2BEWB 3QG1A 4P22A 1EYZA 4IIJB 3B48A 4TS3A 5KG7A 1BCRA 1S2LA 2FHSA 5DHRA 1OAKA 4RMNA 4G25A 1SKYB 4LDZA 2Z5LA 1JI0A 1WOMA 4KGDA 4LA4A 2EKZA 3M6VA 2P9FA 1W1UA 1MO6A 1Y3IA 2NZWA 2V5AA 4GUDA 1V35A 3JWPA 4FI3F 4KAJA 2VTKA 5A6SA 1SXQA 3TINA 5KCZA 3FPGA 4ZI5A 4B3GA 3R44A 3C3PA 5DMXA 4GKBA 4RJLA 4JB0A 5E2BA 1Z7EA 2BGJA 4DG5A 2BTOA 4XPIA 2ZB7A 4Q48A 2IZ6A 3DE1X 2VDOB 5M2QA 3MMSA 4O2AF 3CUTA 3K0AB 5WRFA 4A36A 2YJ3A 4HVTA 4ZYLA 5L45A 2JASA 1JXMA 2ROQA 3UUGA 1H66A 5F4ZA 4JLNA 1TU4A 5D5PA 4F86A 2R751 1DTWB 4YJKA 3PO3G 3VU0A 1M2JA 2QX8A 1VKRA 1ZKDA 4XD2A 1T1JA 4FN4A 4ND4A 1M6EX 1MT3A 5LFAA 1E4VA 2C2RA 3VR2A 2ASLA 4XASA 3RHFA 1PD1A 4XPZA 3ZW9A 5E6SA 3VAYA 4MO2A 1QYWA 1YRHA 2FF7A 1WNTA 3KQYA 3FHCB 4KKXB 2W71A 4IDOA 5FJJA 2RKWA 5CDYA 4ZGWA 1U2SA 3LFHA 5KCMA 4AP5A 2H1SA 4RD2A 1EBFA 4AJJA 2XNCA 1MHPA 3WIDA 3F4BA 1H2RS 3OWXA 2Z2JA 2JZOA 1TA8A 1I6MA 4Q44A 2V7UA 1YZ3A 1M34B 3CSWA 3FDXA 1P5HA 2J85A 5ENDA 2ABJA 2XAUA 2HL6A 1Q5PA 3EJWA 3ZQ6A 3LHFA 4YALA 3AKDA 3OJCA 2HK9A 2WICA 3H9CA 5IANA 3O3OB 3NM5A 2AKYA 2ZAYA 3N43B 3OECA 3R41A 5JO9A 1WQ3A 2VJQA 4ZCRA 1A4UA 5AW5A 1Y5LA 5TQVA 3PBKA 1L5ZA 2WKWA 4X44A 4KDFA 5LA6B 4Q7QA 5KFDA 3LQQA 3UC5A 1LQTA 2YRFA 3M6WA 3G5LA 3KHSA 5ALUA 4FZ3A 2IC5A 1EE1A 4N6GA 3GC6A 4JQZA 1UMDB 5I60A 5UKDA 2A14A 3H40A 3LBAA 4OI1A 3BEOA 4PG8A 5FUMA 2HSEA 4R1MA 4IVNA 3HXMA 2GAIA 4J49A 4NPCA 4BKMA 5JALA 1YS9A 4S1PA 5JZSA 4KO1S 2G28A 3A2KA 1FYWA 4R8VA 5AT1A 2XMGA 5CMLA 1KY4A 2R85A 2CJXA 1HTWA 1QYRA 1XTUA 3U7QA 4BCDA 4LZZA 4JI5H 5F7ZA 1VI6A 4UBOA 4H3KB 1I6LA 4YPOA 1HFWA 2FW6A 1E1LA 4NMLA 2XYVA 2RGAA 1JIHA 1N77A 1O97D 1E3IA 3PC7A 2AU0A 4Q18A 1KYWA 2FEOA 1NTOA 4N5MA 1KYXA 5EJAA 2ZAIA 2C2MA 2RKOA 2L0XA 2BMAA 2LCQA 1V11A 4YT5A 3PQCA 4JVLA 4BFYA 3S0JA 3BXZA 1CY6A 1FLVA 4P3PA 3NAQA 4HS9A 5FPTA 2A9QA 3VNNA 2ALJA 2PRIA 1CU1A 2WTBA 4M1ZA 2G0TA 1JYFA 1ZAKA 1D2CA 3UQZA 5AKGA 3SQDA 2AQKA 4HN4B 2X8LA 2Q3FA 1NURA 4BQSA 2WTFA 3CZ4A 3DAHA 3R4VA 1L9XA 2OUIA 4M1YA 4D9HA 4EGCB 3DV0A 1FDVA 1PL6A 4QNMA 1DLIA 3RVOA 3UMCA 1ZIOA 1WDLA 2ZXUA 4Q3DA 3I1JA 1RPTA 2QX6A 4B48A 3IODA 3MWYW 5BR1A 2GJAA 3LT4A 4R81A 5J9FA 3HCNA 1RM3A 2IPNA 1X0VA 2WOOA 5DH9A 1CQPA 1HT2E 2J4FA 4UDYX 1WQ4A 2PMEA 3OJWA 2Q0XA 2WSSA 3BD7A 3DOIA 4CL2A 2O5RA 4S24A 3O2QB 2E9SA 2WA2A 2OPHA 3VVMA 2TMYA 1PR5A 3FUVA 1LU9A 5IC4A 1CEQA 3WL5A 3T1YB 1T25A 1XAGA 4HAVA 4MGHA 1NWCA 3V8VA 4U6NA 3QIAA 4G0QA 1JKJB 3DE7X 1MB9A 2GK4A 5LU9A 4Q4HA 4ER5A 4RZQA 1HF3A 3SIPA 1YBVA 4LF8B 4MK4A 1JAIA 3VPFA 5FJIA 4DMCA 4EARA 2G3YA 4DUYH 4ID9A 3EAGA 3II6X 3BCHA 5KVVA 3T7EA 1DBVO 4DV1B 1NF8A 3NWJA 3K6SA 4X7PA 2HQSA 4E4TA 1H94A 3DO5A 3L0OA 4P08A 3QPDA 5IT4A 1GADO 1T5HX 2QLNA 4E51A 5B53A 4MWBA 3ULKA 5IF9A 4YRMA 5IFKA 2WKPA 1P33A 3BQ2A 3ZLTA 3FDSA 1G8JA 3D8SA 4QGHA 3CFYA 3HFRA 3NDPA 4E33A 2Q1WA 3NDIA 2ILTA 1JI3A 3L0IB 1E1DA 1G16A 1HE3A 1FU7A 3WL4A 3BOSA 3CKYA 2X5OA 3OEHD 4HQKA 1WSCA 3RRMA 4TS1A 4AJPA 2C82A 4DMFA 4RNDB 1N2XA 4L3OA 4MQMA 3VKUA 1T1EA 4G37A 5EJFA 4J7AA 2OHFA 4RLSA 4EG7A 4AFNA 4P5PA 1B76A 3R0QA 1W4AA 1B8UA 1E69A 4DR7H 2MT9A 3PQ6A 4F3TA 1OILA 4KPFC 1MO4A 3GLFB 1BWQA 3BG5A 2XRMA 5TPZA 4BBJA 4OXQA 2C5BA 2D3TA 3C8UA 4Q00A 4ZYZA 4J2TA 1JSZA 1L4LA 4ED9A 2RGGA 3ENNA 1L4HA 1N34B 3FTNA 4MTLA 1OWLA 2JAQA 3DM5A 4RK5A 4LEIA 4AJEA 3RLFA 2FEWB 2J9XB 1WHSB 1EFTA 4BAZA 4DR4B 4C0JA 2C2KA 2YHIB 3UAVA 5K3BA 3FLAA 4QTXA 1WB6A 2VC2B 4KNVA 2YVKA 2XZOA 4QWDA 2OP1A 4NHOA 1VG9B 3MC1A 4KBFA 1UEXC 1C3XA 3KJEA 2C0CA 4V0QA 4PQFA 3ZHXA 1KEKA 5KSWB 4ECQA 3E2IA 1QZTA 1RYMA 2YHBA 1RAFA 1O5IA 2BGNA 2G7ZA 1CEYA 3RT9A 4JGBA 1ZOLA 3E84A 3NGMA 4BQQA 4KYIB 1AD2A 1SD5A 2CKDA 3NBQA 1H1TA 4AJIA 3P9XA 1QG4A 4NBLA 1NJGA 1YVUA 3MJHA 2BP7B 4RESA 1YS2X 2ZWAA 3UXMA 2VDNB 3GIDA 1EGQA 1GCOA 3HWRA 4WW0A 4QFCA 1PFUA 1Z8HA 4RY8A 1WB5A 1CUZA 2OB1A 4YCJA 4RADA 2MINA 2FPPB 1T8RA 1UAAA 1NW5A 3WFZA 4DMGA 3RFXA 2FPIA 2ZYIA 3IQGX 2IHUA 4KTVE 2NQTA 5CB6A 5JMOA 2VSXA 4WZBB 1U1FA 4IXWA 1BHO1 1RAAA 2C61A 5LN1A 1DIAA 1XU4A 3KT3A 4JYCA 5DO9A 3R6GA 4K6GA 3TQOA 3A26A 3ZY6A 2PRKA 1VI2A 1JQ5A 4WJKB 5CYGA 2H11A 1S4QA 2O6LA 4JX8A 3ORFA 3TVDA 4EPYA 5KFWA 2YTZA 1ESZA 2JAUA 1WUYA 1YZNA 2O3UA 2W00A 2Z4SA 2ZT8A 1D2AA 3R5TA 1ND5A 4FUQA 2V74B 4NBUA 1Z74A 5DSZA 3GVIA 2XDYA 1EINA 4WN9A 5LDDC 5GZ6A 4NU6A 2AN1A 3TS1A 2F3TA 4KR2A 1R0KA 1NAHA 2XVMA 5DTQA 3ROTA 1L5HB 4D8UA 3AI3A 1VLHA 1E1NA 3FWHA 2D5AA 4IRKA 4UREA 1IB6A 1D5CA 5IASA 2TYSB 3JVEA 2XSZD 4YRBA 2XDWA 3SX2A 5J43A 3VR4A 3V7YA 1ECPA 1EIZA 4BXOA 5A4JA 4BNIA 2NUTA 5T14A 1A5BB 3LKDA 1MOZA 5CB4F 4QSHA 1A9TA 2VYVA 1QGYA 2QT0A 3KSMA 2BM9A 3NHYA 3QBTA 4TMWA 1JJBA 2ZSEA 4CNBA 5DEOA 5KVCA 5EINA 2X23A 4EY3A 3RODA 1XCJA 4IH4A 3NAGA 2OVBA 5B4VA 1YTLA 5DQIA 4D98A 4CMIA 3ONNA 2J9GA 5GJVC 2P4SA 4R3UC 2XMDA 5L3RA 3JVUA 3NJ8A 3KTOA 2ZVJA 2ZR8A 4BKPA 1ZQ1A 5FI3A 4TN5A 3NHSA 5KT7A 3RVJA 2B3TA 3HQ4O 2EEPA 2CFSA 1KSHA 4K1LA 1MAHA 4AP9A 1NJ5A 4ZPJA 4FEGA 1Z2PX 4ESOA 1XQVA 2A4MA 4R1SA 2YASA 3BDVA 2W6JA 1XMSA 4EW6A 4CQLB 2SKDA 3NT2A 4YS6A 5D87A 3QWIA 3KB2A 3MTJA 1ZNYA 1JHPA 4KMOA 2I4LA 4OL0A 2JLZA 4MEAA 3T3PB 2DX7A 4OGFA 4INZA 4QFMA 1U31A 1Q21A 4IZ6A 3GI1A 1GQQA 3OEWA 1L3IA 1XLWA 4IMIB 1SCJA 1B0UA 4M1EA 3SN6A 3MM4A 2C03A 1C9MA 4R9SA 4JD5A 1S0UA 3LP8A 2WYWA 4IM7A 1OBHA 1AS3A 1E3QA 4HLDA 3TFQA 1S02A 3LLCA 1BXGA 3HY4A 4P0PB 4Q9HA 5LP6C 2IBKA 5JVDF 2VTBB 3D8RA 3M6FA 1Z2CA 1M2WA 2Z2KA 5A06A 5EUQB 3BXOA 1SUPA 5K7SA 3LRTA 3MGBA 3ZQ4A 1R9JA 3A4IA 2IZ7A 2Q07A 2WIAA 4BFXA 1JDBC 1XTBA 5LBTA 2AHOA 2EGUA 3U3RA 1ZVKA 4J90A 3A32A 3AL3A 1SCNE 1MMFB 2GBPA 1TMYA 1MV5A 3NTUA 1ZBDA 3OZSA 4O4IF 4JT9A 3WLHA 3MBKA 2ICAA 5EXTA 3H5IA 4ZFNA 3GA0A 2WG1A 3UAGA 1EX6A 1OH8A 4BC0A 3I8SA 1DQPA 4DWOA 3ZDEA 5T41A 5KSOA 3R0VA 2HHAA 1EP1B 4NNOA 3DAGA 5DGIA 2XCQA 5CTJA 5ERGB 4BAGA 2FR0A 5KVSA 2WRZA 1OLSB 4O3PA 3Q6MA 1WULS 4HEA6 2BHSA 4EA7A 5E1MA 4BQNA 2PKQP 4ZQCB 1NMSA 3C24A 5AM5A 5G3ZA 2MOKA 4RGVA 4QUDA 4E1BA 2FZVA 2WB1E 3SEFA 1EDBA 1XYVA 2QD3A 2NYAA 5CVDA 3ST7A 3M0EA 2FN8A 1CJMA 1SUBA 1GT6A 5BP7A 3THXA 1H0RA 4XGQA 4W5TA 1J8QA 1JHUA 4YJHB 2OP0A 1K9VF 3FCAA 2AXPA 2W2OA 4RS4A 2J6TA 3NHKA 2Z8YA 2YWCA 1M1NB 4U2KA 4BMCA 1TW3A 2R48A 1V37A 1SRRA 3GGJA 1US8A 1PVVA 3E7XA 2R6ZA 3FCYA 2QTTA 1Z4LA 3KEFA 1TO6A 3CEHA 2ZM5A 2AJLI 4RPIA 4EEQA 4QRHA 3CW9A 1FMJA 1K06A 1V48A 3LQKA 1BMQA 5L3QB 4ISBA 3OHAA 3CRW1 2ZTUA 4OP3A 2VVTA 3PENA 1AQNA 2YS6A 1JT2A 6GPBA 4HQLA 5M5BA 1ULBA 4HNAA 1BOFA 2C2BA 3K1YA 1ZITA 2X0JA 1RACA 3K70B 5IWAB 4JOCA 1ZNQO 3RREA 1GGOA 3ASZA 4URYR 1YMUA 4A8PA 5TIIA 1LB1B 2CLOB 2QVZX 3H5OA 5AW9A 4LOIA 3CISA 1YZQA 5SZKB 1WA5A 1QYVA 4ZCIA 1JIIA 5FR2A 1I3LA 2RHLA 1V1JA 4LC9A 1HEYA 3EEFA 4EEXA 1C8KA 4RZUA 5HEKA 2HLNA 1TT7A 4Y18A 3KLOA 5ICEA 3EZGA 4K9PA 3EGWA 4BMVA 1U8XX 4F2DA 2V6MA 2B1JA 2F55A 5DG9A 5CFMA 1WY5A 4C30A 1UIRA 2C92A 3WLNA 3L49A 2FDCA 4NP6A 3L1VA 1VG0B 2GPWA 3MRSA 3KREA 3B38A 1DWQA 5K09A 5JJLA 4YBRA 3CB4A 1SEPA 1PS0A 2KI5A 3PW0A 2KLBA 2Q49A 1CNEA 1S1CA 2AWOA 2O52A 5B12A 4Q1DA 3QMWA 3OKFA 2RK4A 1H0SA 1VBKA 4INPA 5L1KA 5DW3A 3DLHA 1IY8A 1MG5A 5GY7A 2JIBA 2Y1LA 3N1UA 2WKQA 3JZIA 2PSSA 1IQPA 2BMWA 1D0SA 2WD9A 2OLJA 4CIVA 4X64H 5B1YA 2Q8QA 8OHMA 1G8GA 3RS2A 3JASA 1DRWA 2NZYA 4JAVC 5AW0A 1TQ2A 1F4PA 5C5EA 5F73A 4H1WA 3NOXA 4QXMA 2PV7A 4DHWA 2QQ5A 5CPFA 3IBFA 3EGEA 2IZZA 5FI5A 4US2R 2VSYA 4P4TA 2O8CB 2DTDA 4A3BG 3OCWA 2W6PA 3ADDA 3RYHA 3STUA 1Y1LA 3PVCA 4QOIA 4OSEA 4L5IA 1P9WA 3PT5A 5IDVA 2ZM6H 3GMSA 4GLLA 3DC7A 1G8MA 1JG2A 1K4KA 4CUKA 2BI8A 2C78A 3CKKA 1U63A 3KOYA 4A26A 1KR5A 4AYWA 4PQYA 1I2KA 4FGWA 1NJ8A 2WUWE 3E5MA 1U02A 3ENVA 2DQKA 3GFGA 4PX5A 4G2NA 3PNQA 4COOA 1DIBA 2GYVA 3EB9A 2JJ1A 2GB4A 4PG7A 4A3IG 4BWYA 1I50A