4XX0B

Coa bound to pig gtp-specific succinyl-coa synthetase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
393
structure length
392
Chain Sequence
b'MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structure of GTP-specific succinyl-CoA synthetase in complex with CoA.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 125
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xx0B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xx0B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xx0B03
5JQWA 2ZDGA 4IWXA 1CE8A 4O7YA 1DV1A 4ZQIA 3RV4A 4O4IF 3ORRA 3BG5A 2W6NA 2R84A 3G8CA 4O81A 1IOVA 1VBGA 2DZDA 3ETHA 3R5XA 2DIKA 5H80A 5I47A 4I4TF 1EHIA 4XZ3A 1JLLB 4HQ6A 4FFOA 5GONF 3AX6A 2FPPB 3TQTA 2VPQA 5IYZF 5KX5F 2XCLA 5HBRA 4MAMA 2NU7A 2ZDHA 1A48A 3Q1KA 4IIJF 4WBNF 1A9XA 1C30A 2FPIA 3K3PA 5C8YF 5JH7F 3V4SA 1CQJB 4FE2A 4EGQA 1BXRA 5KKNB 2YZMA 4O7ZA 2V5AA 2YV1A 4IHJF 1UC9A 3WO0A 2I80A 5C1PA 3K5HA 4O2BF 4MA5A 4O7SA 1DV2A 1EUCB 2CNVA 4MV9A 1WR2A 1M0TA 2YW2A 1JLLA 3WO1A 4ZOLF 2FPPA 1KJIA 1I7NA 2DWCA 4O4HF 3RFCA 1Z2PX 1T36A 2YS6A 2QF7A 4TUYF 1PK8A 1PX2A 4O7TA 1Z2NX 1IOWA 2R82A 3WNZA 5LA6F 2NU7B 2V58A 4QSHA 4WD3A 2VR1A 2CQYA 2FPGB 3U9TA 4NYEA 4ZHQF 5BMVF 2R7KA 4EG0A 2NU8B 4E4TA 2R85A 2W6OA 4MV1A 1GLVA 1EUDB 4O7RA 2YV2A 4O2AF 3GLKA 5C1OA 3R9RA 1EUCA 3R5HA 5LYJF 2NU6A 3JRXA 5CA0F 4C5BA 3TIGA 4YJ3F 4HNVA 2YRXA 1Z2OX 1KUTA 2YZNA 1CQIA 2GLTA 2V59A 2VQDA 1B6SA 1GSHA 1OI7A 1VKZA 1OBGA 2OLSA 3G8DA 4YJ2F 3VPCA 4YBZA 1KC7A 3PFFA 4FGRA 4DIMA 1KJ8A 2R86A 1ULZA 4MV7A 2FPGA 1B6RA 2FP4B 2R87A 2NU8A 2GPSA 4O86A 5JVDF 4HR7A 1C3OA 5LXTF 5LP6F 2PN1A 2J9GA 1EUDA 2QK4A 4IZOA 2CSUA 4FU0A 4O4LF 1AUVA 2XD4A 2GQSA 1M6VA 4MV3A 4O7VA 4M9UA 4EGJA 3LP8A 2DLNA 3VMMA 2NU6B 4O82A 3HBLA 5J2TF 3K5IA 4HNUA 4XYLA 2YRWA 3DF7A 3QFFA 1SCUB 2NU9A 1CQIB 1OBDA 4ME6A 1GGOA 4L1KA 4YAJA 4YBZB 4I50F 1E4EA 2YS7A 3N8DA 2CNQA 1EZ1A 3I12A 2FP4A 5J2UF 3VPBA 2NUAB 3ORQA 4RZQA 3RUPA 2FB9A 4IWYA 4TV9F 3VOTA 2R7MA 4O4JF 5FNVF 3MWEB 5CAEA 5JQGF 3N6RA 2CZGA 3HO8A 2W6ZA 1W93A 4YAKB 2I8CA 5JVLA 3JZIA 1I7LA 2R7LA 3VPDA 1KBLA 3NUAA 5BPFA 3U55A 2I87A 1JDEA 2PVPA 1SCUA 2Z04A 3E5NA 5HV6A 4FFMA 1JDBB 4XYLB 3DMYA 2W70A 3MWDA 1KJQA 4MV4A 2NU9B 2YZGA 1AUXA 3U54A 2YL2A 4XX0B 4YAJB 4YB8A 5EZYF 2NUAA 1E4EB 4FFLA 2CNUA 2SCUA 3AW8A 2P0AA 2ZDQA 4XYMA 5D8DA 2W6MA 1KJJA 3MWEA 2YYAA 4O83A 1DIKA 1KEEA 3SE7A 4Y8VA 3V4ZA 1KJ9A 3R5FA 1W96A 4MA0A 1JKJB 5CAEB 4YAKA 3KAJA 2R6FA 3UFXB 2YWVA 1M0WA 4C5AA 3GIDA 1VBHA 5LOVF 1EYZA 1GSAA 2C00A 5CA1F 4I55F 3OUZA 4O7LA 1GSOA 4HNTA 1BNCA 2W6PA 4DLKA 5DMXA 3TIIA 4C5CA 2GQRA 3R23A 2W71A 4MV6A 2GPWA 3OUUA 3U9SA 3ETJA 4XX0A 3LWBA 2X0SA 3VA7A 3MWDB 4TV8F 3TINA 3RV3A 5CB4F 4FFPA 4O7WA 4YB8B 3JZFA 4XZ3B 3Q2OA 2SCUB 4O84A 4XYMB 2YZLA 3JRWA 2W6QA 4FFRA 1JKJA 3UFXA 2HGSA 3KREA 5HBRB 1CS0A 4Y8VB 2WYOA 3MJFA 2IP4A 3KAKA 3TW6A 2Z02A 2HJWA 3HB9A 2R7NA 3KALA 5BPHA 2PBZA 1CQJA 4ZI7F 5K2MA 4MV8A 4O7NA 2FPIB 1UC8A 4FFNA
chains in the Genus database with same CATH superfamily
1OC2A 2BN4A 4D8XA 2E6UX 4UUNA 4QWEA 1ZJWA 4LFBH 5J40A 1U2PA 1YF3A 2BZSA 1RZ3A 1SZCA 5KB3A 2RGRA 5KFMA 1LGYA 3CZ4A 3CJQA 2I4OA 3IHWA 4PO3X 3ECCA 3NDPA 4PS0A 5KFSA 2F4NA 3EWNA 3K0KA 1XTVA 3H6GA 3UYKA 5P21A 3RS2A 3PQEA 2ZCVA 4UMEA 3A1DA 5EP1A 3SJCA 3V4LA 1MGPA 3L0DA 2QORA 1VPWA 3MLEA 2ZI4A 5KFZA 3KEOA 2R6HA 1M1UA 2IYSA 3QVGA 2I4NA 3LW7A 1GAEO 4GC7A 4RABA 1WR2A 1I4TD 1H8EA 2C7PA 2FMUA 3NUGA 1EVEA 5C4IA 3O9VA 1KO5A 4NNJA 2AMJA 1CS4C 4PAOA 3QG5A 1KO4A 3H9BA 1T0IA 2PL3A 4MUFA 2DBVO 4RYDA 4BWYA 5AKXA 1A1VA 2PU7A 4YV2A 3HGTA 4KU4A 3PEVA 2Q8NA 3GX1A 5AXCA 2ACWA 3QLTA 1E9RA 3FR8A 4ZAYA 4P84A 1BJKA 2OFFA 5J3JA 2FMKA 4UVIA 3TNFA 4HSEA 4R8VA 3FZYA 2IWRA 5FI1B 3QYPA 4R2MA 3UPUA 1XQ1A 2J5KA 4DIBA 1Y1RA 4HFJA 1PUJA 3QPBA 3GPIA 4ZK2A 4IDDA 2QE7A 4YJ3F 3JYLA 1B0PA 1XTSA 3Q3VA 2BEWB 4TXMA 3IOBA 4JL8A 4G23A 1JJ7A 3OZBA 4AWAA 2H2HA 4KOEC 3GUZA 4Z4FA 4BV8A 5ELMA 3EWSA 3IQZA 5DK6A 4EUSA 2GVZC 4L8LA 2GR9A 3IUNA 3MT0A 2VUUA 4W5HA 3ZX4A 1WMSA 1PLJA 1QP8A 2CSUA 5C81A 3RS5A 3SLGA 1HYHA 1D2GA 3CTMA 3ZWAA 1JTVA 2W2VA 3CRMA 4C87A 2VPIA 1RHUA 4DV1H 3TYXA 2XZPA 3GIQA 2ZKIA 2Y1OA 4KR0A 4TWZA 3DP7A 4A9AA 3MQ2A 4KC0A 2CYCA 3A11A 2CLOB 3VNNA 5EP3A 2MSKA 5EHQA 4CC6A 4BQFA 3RJTA 4ZOCA 1LY1A 3EIWA 2G1PA 5AWFC 4MIKA 5C1IA 4PLGA 3KYHC 3NPAA 2L42A 4D4IA 1XZNA 3UZBA 5J2UF 2JC3A 2E49A 5FOXA 2RGYA 5JCPA 5AJUA 4BY1G 4YCBA 5H8WA 5CK4A 2JIBA 4M8SA 5C1DA 3RAQA 2ZAOA 2H9IA 3AXTA 5M3BA 3OQIA 1Z0IA 3F2VA 4QOHA 1P2BA 4ZRNA 1D8TA 4M8IA 3AYZB 3T94A 1RWNA 1VIMA 2PT5A 1IK6A 4AMBA 2FZ5A 3TBHA 3UAZA 3DMDA 4PRKA 1LQTA 1DDGA 2DR0A 3L7DA 3IAUA 5BP7A 5IXJA 5FKJA 2P5SA 2Q5LA 4DBLE 4DABA 2YWHA 4F6CA 3H5IA 4BFXA 1P74A 2RFLA 2JBHA 1QYWA 3ZDQA 3UCFA 5JNSA 1BXZA 1VKOA 5IWCA 1AZWA 1BN7A 4UCQA 5JXIA 1FUYB 3GT0A 3FMAA 3ABIA 3SE0A 5DBFA 3E03A 3M6FA 4PG5A 2VLIA 5IN5A 5T8KA 2RHOA 3BQ9A 3P9ZA 4BNUA 3R23A 3ESDA 2XNKA 2H1FA 4FINA 2P75A 2QYZA 1A82A 2OH2A 7ABPA 4EMBA 3VC3A 1M7GA 4BNGA 2ZIEA 2NV0A 4DMMA 3JZFA 3Q1LA 4FWBA 3D4PA 2XNDA 4KFRA 4RK7A 2QJWA 2ZVJA 5IDVA 1CJSA 3U7GA 4Q3KA 1XLVA 3TW6A 1RHMA 5EHGA 3GLFE 4AJNA 3KIPA 4XWWA 3F7OA 5IF3A 2QM3A 1PBNA 3VOSA 5BW5A 4LFCB 1XTUA 3OT4A 4F3NA 3AEXA 3E3MA 4LBYA 4F1KA 3BABA 3PGKA 3GZTB 2HVRA 3SHVA 2IHVA 1GPAA 2FFJA 2GAFA 2SHKA 2PL9A 4GUDA 5KTSA 1G7TA 3I6QA 1Q6YA 4F45A 2DQ4A 2AT1A 1E2IA 2B2XA 3OLXA 3NBAA 1JLMA 2X7HA 2JH3A 1DMRA 3FOFC 2AC2A 4REQA 2YJZA 5M04A 3C6XA 4MLDA 3LOPA 1HA3A 3OTIA 2X9GA 3ZC3A 3VNAA 1FX0B 4HP8A 1U3GA 1M76A 1IH8A 4A27A 5D3MB 3KPYA 1D1PA 4XIIA 1V3TA 5I8PA 3D1JA 2G3YA 1PL0A 1XZQA 1NYLA 1Z56C 3AY3A 1VYHA 1NNUA 5JVDA 2HCBA 3I9FA 1FMTA 3H17A 4BRUA 3EISA 1N2HA 5FO1A 3ANLA 1KF0A 4F86A 3AVOA 4UJ5A 4DV3H 3I72A 1CX9B 2REBA 2QRKA 2HNKA 1P7YA 2ORVA 2JGNA 3IBFA 4D43A 2FEAA 2QW8A 4W7IA 1ACJA 3QU9A 4A2AA 1GRCA 1I9CA 3FF1A 5BMVF 2R25B 2VYQA 3G2MA 5KQMA 3OICA 1U8TA 4KAAA 1XLTA 5JPCA 2P3OA 1A0GA 2O2SA 3C3WA 4D8WA 1ORRA 2P67A 4C5BA 3H1FA 1RAAA 3TIXB 4G2NA 5KWIA 1L5HA 3IQGX 1NQVA 1TCVA 3OIYA 4UQPA 3GFGA 3AF2A 2FUNB 4ALLA 3H5LA 3N86A 4FW9A 2Q2QA 3OHBA 3B6EA 3N8NA 3DYBA 3H9QA 4ZT3A 4HR7A 2JHCA 3G2KA 5LP6F 3FYUB 4UQLA 3CWCA 1NN3A 1DIGA 5JG7A 2R6DA 2P79A 4C6TB 2RDMA 2I5PO 2B9EA 4NG5A 1Q77A 3RTXA 1K66A 3F0TA 1L8AA 2KYRA 2V45A 1EVYA 3HBLA 1R12A 4RVGA 4DDWA 4YRSA 3H2JA 1WNFA 4M3NA 1TM5E 1Y4ZA 1EJ6A 1NJ5A 4DUZB 3QVSA 1TX4B 2E48A 3I9NA 1V9LA 5DW3A 2UYOA 2FP4A 2GQ0A 3M6VA 4D5GA 3GGSA 5JUMA 2VPYA 4TROA 3OQ6A 3D5EA 2AHOA 3ZDZB 2VYFA 4PWZA 5I5VA 1JDBC 4YDSA 1MC5A 4DCTA 5I9IA 5IWAH 3OD5A 1N36H 1DAPA 1HOTA 3H8JA 4Y67A 5FUBA 1T2FA 1CZRA 1H1TA 3D8UA 3GRCA 3TWOA 3ZCSA 3BDVA 4GSLA 1GAWA 2ZJ8A 5AKHA 1V47A 3BMXA 4R51A 2RHHA 1Z28A 4F3CA 2OZLA 1R9MA 4YGYA 1T6BY 4A8JA 1JI0A 3K35A 1KA9H 3VPFA 3V6HA 1X1QA 3W5UA 4GE3A 2YBDA 4UCFA 2Q2VA 3UV6A 2OSBA 2D2FA 4CG2A 1JG3A 1DJQA 4C22A 2IZOA 4DLTA 4IS2A 3RTBA 3NHKA 5KVQA 2J6UA 4TV8B 3WTBA 3GIDA 3HGMA 4LMYA 1DKNA 3NXSA 1WKVA 3T1QA 3LYUA 5CA1F 4F4XA 1D2AA 4AURA 1P0FA 3EULA 3PQDA 1N33B 3D8SA 5JD6A 4K9MA 1GZ6A 1FYXA 1QO9A 3FSEA 3WNQA 3G2OA 2OSVA 3ELBA 3M4XA 4JUFA 4R3NA 2N1MA 5B53A 3EA4A 4IXDA 3R1IA 3RS4A 3N58A 2VBGA 3OO0A 1OILA 1PJLA 1DHRA 3EFEA 1RQLA 4WXHA 2QMEA 2Z2YA 4JR0A 3WRVA 5C5DA 4RGYA 1PUIA 2Z6AA 3P9IA 5IDQA 2VNHA 2DMRA 2PAAA 2IOYA 1A5TA 4CMEA 1X7YA 2RCYA 2FOXA 2YRFA 4TVKA 1MMFB 4G84A 4GGMX 4UCVA 3KT3A 2PG3A 2NZYA 3CM0A 1T8TA 5TMDA 3NKVA 3UPDA 4I14A 4M1OA 2ZE7A 2V7VA 1FS4A 4WNAA 1ZCZA 1OXUA 4DC0A 1RHJA 6CHYA 3ZNNA 4FEGA 1GQOA 3CEPB 1W49A 1AVTA 5DXAA 1H5QA 4N49A 1SKMA 2HTEA 2O0KA 1Q1QA 3C6ZA 3G0HA 3PDJA 2ZJ1A 1ZIYA 2YN0A 4CL8A 4PANA 3NAGA 4JCOA 1SRRA 4EENA 4UW9A 1IQ0A 4J7XA 4IEIA 3DA8A 3L06A 1ZM2A 3OFSA 2C7QA 1KEWA 4LI0A 1QVVA 5KFDA 3R75A 1XNQH 3QE3A 1UFVA 3UWKA 5IBCA 1E1NA 3BC1A 4ALJA 2J0EA 3U49A 1YR2A 5EZ5A 2JZOA 3GTJA 3T5CA 4PRZA 1TEVA 3OQJA 4W5QA 2O3SA 4OKNA 2C9YA 1U63A 4EFMA 3B13B 3RG2A 1Q91A 2DPLA 3SP1A 5H1YA 2XMPA 1H3FA 3KX2A 3E0QA 2UVPA 2V6GA 3AV0B 1ZAYA 3DO6A 4Z1OA 3NOVA 4B34A 3UJDA 2O48X 4HMPA 3CW2A 3DV9A 2JFGA 3KXYT 2O57A 1YVDA 2R8YA 4V2UA 3N2YA 4CMAA 2H2FA 2C9OA 3WJAA 3T1NA 2F8LA 5KTYA 3M9WA 1MVLA 4N65A 1T1SA 3CLSD 3WLEA 4G1BA 4E6PA 3O8QB 5DLYA 3WLHA 3FUCA 1OIVA 3OZXA 3WAJA 3R9KA 2VA3A 5L4NA 3A58B 4TRNA 5IKMA 4P4NA 2Y9MB 3WYNA 2NUBA 4DLLA 2C29D 4J43A 1QFSA 3GLFA 3WIDA 4B2YA 1E4GT 3T34A 2AJ8A 1VGQA 1CQIB 1TWGA 4CIYA 1QG6A 4R68A 4GX1A 2MYTA 4K9PA 1NXSA 1IBMH 4ALMA 1KU0A 4EMTA 5HXAA 3C5CA 4N3NA 1Z12A 3UTDA 4A0HA 1T5OA 2ZRLA 4L22A 5AW1A 2PLNA 3NOXA 3N53A 3HGQA 1Q7BA 1HG0A 3O7MA 2NTVA 4DCOA 4JT8A 3ZZ0A 4KE9A 2V9PA 4JBIA 1TZCA 2BGRA 4M22A 3ACDA 2P2LA 2AUNA 1XRJA 3M1AA 5TPWB 1SK9A 1I1HA 2A0KA 3KDSE 5CLFA 3L4EA 4TTQA 1OI2A 3G2NA 5T5QA 2XI4A 1TIBA 3WLPA 1TYZA 1RI1A 1ZJJA 2TMDA 1X7ZB 1H6DA 2AOUB 2BI8A 2CF6A 4G5RA 2DKOA 4FNGA 3TKAA 2BFEB 3PD7A 3G13A 3L1IA 4LKRA 1IZ9A 1M2NA 1Q3TA 4M9CA 1A9TA 2PMEA 3NNSA 13PKA 2R6FA 2EG9A 1T2DA 4YA6A 4YRNA 4B3RH 3UUEA 3UJNA 2P2DA 3AXSA 4XDHA 3X1XA 3T1VA 3VYRB 2CNDA 1AF7A 4MVCA 2VZLA 1H65A 3ZWMA 4URVR 1WB5A 3IX7A 4KQ6A 2YCLA 3HJCA 3R5JA 3KTAB 1ORIA 3VH2A 2O0LA 1MB3A 4LHYA 3GFQA 2YH2A 1T3ZA 3L92A 5KFWA 1AT1A 2WQ7A 1UBEA 4COKA 1J97A 1WB9A 2FLWA 3JRWA 3WK8A 4KFSA 5F9MA 1GZ3A 4GLOA 5JALA 3D3QA 2XUGA 2WYOA 2IOQA 3EMVA 1X94A 4KQKA 4FONA 3HG7A 5FJIA 1WW2A 1IHPA 3F49S 5CNJA 4S1PA 3PFGA 4WERA 1VL8A 2NUTA 2QPTA 4ZDKA 1O94D 1QOPB 4CTOA 3F8TA 2BCEA 2B92A 3N07A 4V38A 2OHVA 1QPZA 3V1NA 3WYDA 3DZKA 3KYCB 1MCZA 2FSPA 4JKOA 4B83A 3V6KA 1R0XA 4WADA 3RYHA 2PLRA 2WWVD 2HMYB 4CKZA 2V7UA 4UNSA 4JP3A 3T52A 3ZV4A 1ZHFA 2RHGB 4DQNA 4Q6WA 3MLAA 1NLMA 2TMYA 3VHXB 1SCQA 1CJCA 5EAIA 4D0NA 4MWDA 2J7PD 2LRHA 4FZ3A 1RFLA 1VLVA 1EWTA 1BCRA 4NP6A 3KVVA 2YV1A 3HYTA 3MJ4A 4MKFA 4BKPA 1KQFA 4TYNA 3DV0A 5BO5A 5KCZA 5DTQA 4MAAA 3HB0A 4KDCA 4MPJA 1M0TA 1HL3A 1GGJA 1SBIA 2ZRIA 3P2MA 3AHCA 1RTKA 3DYIA 2J1LA 4ZVNA 1W8IA 5EEGA 1US8A 4RZ3A 4XASA 4PYRA 1E64A 4QTZA 1V1RB 1OI3A 2VHQA 3DMHA 3RK4A 4GWGA 5E9QA 5BYJA 3CONA 4EEQA 2JLCA 4LE1A 4MKRA 1XZ8A 4XQGA 5HF8A 5GVRA 3RU7A 5BN4A 2IHJA 1XCMA 5ICCA 1ISGA 5K1ZA 3ZIAD 2GZAA 1E2DA 1I1QB 3FDJA 2H17A 1CBUA 5C4MA 1SMKA 2QYOA 5KQSA 2R65A 5TNXA 4G09A 3RC9A 2QE7D 3RE1A 3G8DA 3WHIA 1UP6A 2YWBA 3MLBA 2EATA 3H11B 1EFDN 1CD5A 1SIUA 2XWPA 4MV7A 3T9DA 3KEFA 3D4OA 1BFDA 4F8JA 4FTWA 4AIRA 2VO1A 4O0LA 3HFSA 4RZHA 2ZYRA 1GT6A 2NZUG 1NY6A 3U26A 1HEUA 3PRJA 3A2NA 3OSPA 1G64A 2PD4A 1Z6TA 2ZYIA 1NQUA 2DQKA 4UUPA 1WPRA 4OUDB 3EMDA 3B6IA 4MRMA 3GJ0A 3UFBA 3K0SA 4DDTA 1DLIA 3QVWA 4XLZA 1UJCA 3DEJA 1EQUA 4M9SA 1ZS9A 3ESZA 3I4LA 4JUBA 4RZSA 2FE1A 4PN3A 4KXYA 1ISJA 4AS3A 2WWHA 1CKOA 5G0VA 1DELA 2FB9A 3BQNB 1P2DA 3HS3A 3CT4A 3KOUA 2RGNC 4D96A 4LHEA 3L3BA 1H2YA 4PCLA 4AMYA 2F4VB 4L0CA 1QH8A 3K8OE 3FPKA 2IBMA 3Q3EA 1BOFA 1OIXA 2ZRJA 2VJLA 1HQDA 1SFOA 2PVPA 4R16A 4CLEA 3PQ5A 2R8PA 1U3WA 2Z6QA 1FS5A 5ALDA 1K1SA 3MWLA 4AU1A 4B9AA 4QXMA 3VUFA 1WTCA 1DKLA 1MENA 4P7KA 2VCHA 1QIHA 3GCGA 1ZOIA 2OESA 5HMMA 4Y6SA 1OTYA 2F6RA 2PR2A 2P9YA 4L15A 3TD2A 4LVCA 2HHAA 2I6UA 1U0GA 3ZJ5A 3VC7A 3D3EA 3LU1A 4TYYA 5EOVA 4C43A 4MW5A 5DWDA 2WSLA 4EEKA 3D6NB 2GHQA 1XFAA 1Y81A 1OUMA 1R66A 2UVDA 2JVKA 5CYGA 1TU3A 1BMTA 1KSHA 4JMLA 4QHSA 2WSIA 1LSUA 2HO5A 2WIJA 2W7OA 3TINA 2OFPA 4EFKA 4I55A 1WIWA 1YOBA 1XPOA 3OQVA 2I7DA 4QU5A 4AKEA 2COKA 1YBAA 5HBRB 4BFYA 3AF0A 4UVEA 1ONOA 3N2EA 3WA6A 1K8ZB 1JSRA 3WL6A 3WYCA 4ADSG 4F12A 1CRZA 4CFYA 5ALUA 2QKYA 5HILA 3HADA 3URKA 3HXLA 2R84A 1AKTA 3W7VA 1UJMA 3R40A 1RBZA 1B0AA 1YBVA 4TTVA 3V4OA 5BWVA 3RF7A 1LVGA 1AV6A 3WV4A 4M1SA 1CULC 3K2BA 5E4TA 3UK6A 5C8YB 1E4YA 1AU9A 1XWFA 4RNOA 2RJ3A 2GPBA 3CEMA 4X24A 1U0EA 3DDZX 4X90A 4NLGA 2N1BA 4KPFC 3PHIA 1N5KA 3R77A 3QMVA 3AZPA 3VJRA 2NZ2A 1DC3A 2EFHB 1R37A 4YUWA 1LRJA 2FWPA 4EW6A 1SQGA 1UXOA 2JI9A 1HRDA 4GVLA 3BFVA 1M2EA 3KZVA 4OM8A 5CYFA 3C8DA 4AKTA 1PV2A 1I3CA 3PN1A 4RY0A 2OLKA 3C3CA 5K3OA 3LVFO 3K94A 5DOVA 4FE7A 5DXFA 2PA3A 5CVJA 3NH9A 5I5GA 2VUGA 1IXZA 3DT6A 4MQFB 2GLXA 4M8LA 5CVCA 4AP9A 5JNLA 3WBKA 5LIRA 3GRRA 2ZRQA 1VIVA 4ND7A 1FNMA 2HK8A 3CLTC 5AVVA 5CD9A 2WIFA 2YIMA 1FFXA 1K6JA 2XAUA 3ZBTA 3RRXA 3TLMA 3AEYA 3LFHA 3DTTA 5A71A 4CM4A 5BVGA 4NZZA 1P4GA 2ZBDA 2Q1SA 5DGHA 1SHLA 3M6WA 3EVNA 2QQ0A 4EO7A 5DCWA 1IZ0A 1VKJA 3OJ0A 3JQBC 2R96A 3OT1B 2G36A 3N8IA 5CGQB 5IHXA 2FPGA 5KYGA 2CCJA 1UDCA 3LRXA 4DBZA 3W1WA 1YTUA 4CMHA 1YACA 3T3PB 2HSWA 3GIJA 2H59A 4JUIA 2R7ZA 2ZGVA 4AZTA 1TF5A 1AUVA 3UXYA 2Q6KA 3O26A 3CIOA 1EKVA 5H59A 3PC4A 5DH9A 3ROTA 2J85A 4A4DA 2X5JO 4A82A 4ZHQB 3CF2A 1GT91 3IEPA 4XYEA 2Q27A 1P1RA 1ZGHA 3D59A 4QM7A 3WSTA 2VBIA 5DRYA 1G3RA 5C8DA 5F7OA 5HUQA 2Y9PB 4P82A 1UAGA 3MRSA 1CR6A 3CNEA 4BP8A 3CPEA 3ZG6A 3NTLA 1QHHA 3BL5A 3AKDA 5B2ZA 3ET5A 5I9LA 5GV7A 1EFPB 3Q12A 3D9QX 1SQFA 3IV6A 1EXWA 3NT2A 4DILA 5K09A 1CW2B 1YKFA 4IL5A 4EUHA 4KHPH 1UMKA 1U0RA 2IPAB 3GUYA 4Q21A 4AY3A 2XITA 4MGZR 1D4FA 2P4SA 2FPXA 4JXZA 2O5RA 3UA3A 4WFKA 2D1QA 2PH7A 4R5MA 4POAA 1OMOA 4XPZA 2C2WA 1SVOA 1U2GC 4HAZA 1MBZA 5ALMA 2XA2A 2NSYA 3H6HA 2Z0MA 1VL0A 2VKQA 1Y1SA 4QEKA 4LH7A 2W6MA 1U9IC 2V1UA 2PKQP 4QUEA 1UJNA 3R5FA 3MINA 3LGAA 1E7SA 4YONB 3M2TA 1REQB 1QF6A 2GS9A 1GEGA 3F46A 4YV7A 4L3VA 4M98A 5HUHA 4E21A 4DWWA 4EFDA 4RTRA 3F97A 3RROA 3RYFB 5KOIA 3OOSA 1SB9A 2VJMB 2OFOA 5K4AA 5FX2A 2IV7A 4LAFA 2ZBUA 4GICA 3C1AA 4UUQA 3R7FA 3C85A 4EF5A 3DOOA 3GVPA 2JCSA 4OXXA 4ZO8A 3FDIA 3GAFA 5GM1A 1NMSA 1Z6AA 3JY6A 3OIUA 4R1QA 5CB4A 1FB5A 1Y0BA 4TM8A 4QQFA 2INGX 1W4AA 3RB0A 2HHLA 3MS7A 4UHEA 5ADHA 1MO2A 5ANRB 1Z68A 3A14A 3H9GA 3NFRA 2AW3A 4D79A 4ED0A 2EQBA 1SQ5A 2IYYA 4MHOA 5HKBA 3QVUA 1X9HA 2VUMG 3ZK7A 3KYJB 2Q9UA 3FCCA 4MB0A 1BWRA 3I4NG 1DIHA 5BRJA 4PGMA 1RJ9B 1XF9A 1ZI9A 4LQCA 1CFZA 1WCXA 2XZDA 3ILXA 2D3WA 2BFCA 2NYUA 5E8JA 4Z4QA 1ZZGA 3FPFA 1H2BA 3PXXA 3BQMB 1NPTO 2CNWA 3ZU2A 4Q7QA 4JGBA 4HWPA 4RIFA 1SBQA 1KFJB 1WO8A 2C0PA 3O0TA 4KAXA 5G0TA 5E1DA 1SFRA 2WJIA 1I1LA 4RJTA 4JV1A 5M5BA 3WRXC 3N76A 1X3SA 3UJ3X 1JF8A 1F06A 3I3OA 3K16A 1OXSC 4CI9A 3QW4B 3JVDA 3L1HA 1R3DA 4LXIA 3DONA 4PNZA 4FIZA 1BFKA 4DSOA 5J4KA 2OBLA 3PWSA 1RDFA 1PEYA 1Z5WA 3TCXB 4KMRA 1X8KA 3K0EA 8ADHA 3LY5A 5K8VA 1WXGA 5HG0A 3KZMA 5AKGA 5G41A 3AHGA 3IV9A 2W8BA 5JAOA 2XUIA 1SPBS 2P4UA 3O0DA 1Y8RB 4RPGA 3NBQA 3AM4A 1DS6A 3L7MA 3CW8X 4REOA 4NATA 3BCSA 4R31A 4A6EA 5F9FA 3DL2A 2I34A 2UU9H 4I3FA 1L5VA 3M1LA 4JX8A 3VYUB 4BY9E 2J9GA 4RDCA 1NVGA 3Q5DA 3AUFA 1B76A 2FFAA 3WYBA 4D9EA 4IDCA 2Z30A 3S0JA 3RYTC 1ADFA 4WE3A 1W36C 3JYNA 4R8SA 2EHDA 3I2FA 1JG7A 2GOYA 3DAOA 4M8KA 1PD1A 4MS4B 5JHHB 4DE5A 2OQVA 5DCLA 2XMCA 3BXGA 5IC4A 2PJRA 1X1DA 3PXBA 3LECA 5AI8A 5GJBA 2PKWA 3M70A 1GLGA 5CHYA 1IEWA 4IDGA 4G1VA 1OV6A 2FRVA 1W46A 1H23A 4L9SA 1Z18A 4BN5A 2YN2A 2IYAA 2Q5QA 2R48A 4GBGA 4IF6A 2NYRA 2PE5A 4K87A 1KZYC 5EZYB 3ZI4A 3TLXA 4OHWA 1HSOA 3AL3A 2HBRA 3WKBA 2H16A 1XMQB 1QP7A 2HU5A 3GBSA 1GADO 5K6RA 3C3JA 5FWXA 3U54A 1L9XA 4IILA 4PGHA 2HSJA 2GJ4A 3MUOA 2XMGA 4CIWA 3GIMA 3ND6A 1J00A 5IC6A 1E4EB 4WFQA 3TPCA 3JQCA 1JZQA 3GJRA 3UUWA 2VATA 4US1R 1AKNA 2QD3A 4KGXA 5L1JA 4IQ4A 2PS1A 3ZXYA 1CCWA 1YHZA 2QTCA 2F3PA 3ZHTA 3QBVA 5HGXA 3DVAB 4BV3A 2Y8EA 1ZO8A 5CDTA 5EJFA 2G72A 2EBHX 5HDQA 3MMXA 1UT6A 2UUCB 1BMQA 3MMPA 1ZP6A 2ZXUA 5IT4A 1BCSB 3JAWB 1JMVA 1PG2A 4BVGA 2PUEA 4JB8A 1XR3A 2GUWA 2SKDA 2XQGA 1M1YB 3AGPA 4X6LA 2WHQA 3MJFA 3GY0A 1O97D 3T3DA 2H4JA 4MI1A 3REFA 2FETA 3AMVA 4FB5A 3IFSA 4PSKA 4LHSA 5LN1A 3IBCA 1FZQA 5EJGA 2W2XA 1HEYA 4KO3S 1JHXA 1ZN2A 2C7BA 5DQIA 4RENA 4HN4B 1NAIA 5CTJA 5IUKC 2PRSA 4I4TF 1UC4B 1RKUA 1GV0A 5BNFA 4MX8A 4AKSA 2WIBA 4NCKA 3TQTA 2W11A 3AWDA 5A0FA 4NBLA 2AN1A 3GLQA 1VL2A 2ZDHA 1N1MA 5ECWA 2JLUA 1E5XA 1V1MB 4E32A 3NBZB 1QC5A 1XP8A 5DTMA 1L7MA 2DUUA 2UKDA 3KXLA 5HQ3A 1IM5A 5IX8A 2AN4A 1QH9A 3GP3A 4YRTA 2COJA 1I1MA 1KH3A 2YWRA 5E6SA 3T9CA 1NVXQ 1WX1A 5K0GA 3DVLA 2AI3A 4BN0A 3SNOA 1QIKA 3QJGA 1TYAE 1PK8A 3THWA 3VYVA 2NQ2C 2CUTA 4D57A 3PNMA 1H9AA 1T9DA 5LB2A 2JFQA 4WXRA 3T3HA 5JNTA 5SZKB 4KQXA 5CA0B 1JMYA 2V3WA 2ZYGA 2ZK7A 5ITWA 3MJCA 1N48A 1DFGA 3NX4A 3PFIA 4NBVA 2D2VA 2II6A 4JV2A 3DTFA 5CFLA 1UZNA 4CR6A 1T8RA 3AY0A 3ROGA 4GMHA 4RVFA 2RBKA 2ZRCA 5GGYA 1U0JA 4F5ZA 2UZ1A 2X1VA 2NTYC 5AOVA 1BVRA 1ZH4A 5AVWA 4WKNA 4UTRA 1M5RA 3DWIA 2LCFA 5H0IA 2IW3A 1TM2A 5KWSA 2PRJA 4O2AA 3H13A 5FXMA 1YB1A 3GPDG 1M1XB 3U9LA 1R16A 2ODWA 2R86A 4UM5A 2XRZA 1KI6A 3LSYA 1ZD8A 3USZA 5D1OA 1PD0A 4I7HA 3CU5A 3AEQB 4FU0A 1Y80A 3I5YA 2J67A 4OFXA 1EVKA 3NWPA 1UMDA 2VHZA 2Y66A 3QVTA 3SDBA 4CLRA 3I5XA 3G59A 1GPYA 3BKXA 1G4UR 1N0HA 4YHHB 2DUNA 3SSMA 2QSZA 3V1MA 1OXVA 1VSUA 4DSAA 3N8DA 2X0KA 2LKCA 3FLMA 4RA6A 1G7CA 3S2YA 4XRRA 3V7WA 4QC2A 5CXUA 3OZCA 4DSZA 2E21A 3KBBA 4ZEMA 4GL4A 4X45A 1ID8A 4HH0A 5FBVB 2GNPA 1DKMA 1WCWA 3HCNA 3S28A 5CBPB 3ZCUA 1FFHA 2XTMA 5T57A 4UFPA 1JBEA 3PHCA 5CW2A 4G8CA 2RI0A 5AESA 1OQAA 3ERCA 3DSRA 4RKEA 4DDUA 2BSXA 4NXNB 4W5JA 1ONPA 2OV8A 1UIMA 1DZ3A 5E3IA 3I5MA 3RRZA 4ITUA 2FLLA 1OZAA 4DA8A 2Q2NA 3KTMA 1D6SA 1EIZA 2BEVA 3LFUA 1GQYA 1X80B 2D7JA 3WISA 4Q4JA 1MN6A 3LBYA 1FYEA 1U3FA 4LF8B 1FDTA 5DEIA 3GV7B 1VS0A 1UBTS 3BQ1A 2YWVA 4N0DA 3AVQA 3ASUA 2A0WA 2PXHA 4R2IA 5BVHA 2DY0A 5GM2A 4OGFA 1W35A 3T99A 3WGYA 1LBIA 3S1AA 2BBWA 4G0NA 1NE2A 2PS9A 3M2PA 2FRDC 4ZZ3A 1JQ3A 5IN4A 4MWEA 5F2NA 4RHTA 3CHYA 4KKXB 4HLNA 1T43A 4R8MA 2AGPA 1T3GA 3P27A 4MWTA 3MA0A 4TVOA 3RD5A 3DZFA 1NKSA 2C2BA 1Z2EA 1Z4NA 3O5AA 3JQPA 5ALEA 3GXOA 1O6CA 2ZRDA 5A3VA 5B6IA 1EGAA 2R68A 4LSAA 1JVNA 3E61A 1AK1A 3EPLA 1X77A 3KPWA 3JSLA 2QM7A 4W5WA 1G3MA 3ZD8A 3AHEA 4WFJA 4KQMA 1R9GA 2GN8A 4JVLA 4C89A 4YCNA 2O9JA 3KFXA 2ALZA 1Y5RA 4GT1A 1TAEA 4ZGGA 2A4MA 5EJ2A 4A6PA 2AG8A 3HJFA 3SNHA 4FPXA 1XQ9A 3AOEA 3I9JA 3KKPA 4JVMA 4P4LA 4OFWA 4NHOA 3WLJA 5HCUA 4O33A 2Q4OA 5FOQA 2G7ZA 1E2QA 2X15A 5AIBA 2CVFA 3VR2A 1GA4A 3MOGA 2DWCA 3RFCA 5EMNA 4JLDA 1BC5A 3WMRA 2HL6A 2EIXA 2RJNA 4KXVA 5B3JC 4BPRA 3WBFA 4LJ7A 2YIDA 5JD3A 4YLYA 2P9BA 1M33A 4R9VA 4J0FA 4MI6A 1HNXH 1MFZA 5FPSA 3FOBA 4INOA 2FI1A 3FD8A 4Q9LA 4OLFA 1K92A 1RAFA 4ZPXA 3FRJA 2XB6A 3BGVA 4KAJA 3CZ9A 4DCJA 3SIPA 2QB5A 1B6SA 2CFCA 3RI3A 1Q2XA 4IFEA 2GILA 1W88B 3RLFA 3UOAB 1SPXA 3OP1A 3JQAD 1A8IA 3BB1A 1VG1A 1UFQA 5DGBA 2KPOA 1UJ6A 1QYIA 5L3SB 2P1ZA 2QRVA 3OQNA 2QY6A 4EI8A 3UMMA 3ZV3A 1MQSA 4LF9B 1U8UA 2O8DA 2HHJA 3KLPX 4KO8A 3AESB 1RTTA 4LJLA 1U2EA 3HY4A 3A28A 1OT3A 1JKXA 5H02A 1G5QA 5EP2A 2DGDA 4AY6A 4HDQB 3V8MA 1NGSA 4RFSB 4A10A 4BNVA 4E13A 4FGWA 1FCJA 2Q4DA 3OOWA 5ARCA 2FW1A 4OGGA 4RZQA 3Q8XB 2OO5A 3JR7A 3E6AA 1PAUA 5B55A 5K45A 3SXUA 4RZ2A 3AC0A 1ZLXA 3PKIA 4XB6B 3R20A 4BO3A 4HDCA 4W1QA 3I2JA 3K7EA 4P5PA 5HVNA 1DWQA 2NT3A 4LYYA 3VTZA 4OBEA 4IH9A 3HOUG 3LX4A 2A0FA 4FBUA 1HNWB 4MVJP 5IP7G 2CZQA 4CN8A 2PRKA 4BQSA 1M8GA 1R6BX 1YDEA 3FWPA 4AL4A 4D44A 4GDFA 1G6KA 1J2EA 5ALXA 2B1QA 2PZBA 4YYEA 4ZHSA 1RKXA 4HS4A 4MMYB 5A3SA 1JKJB 1X7WB 2F62A 4PBTA 4TM5A 2AXQA 2C3OA 3HP1A 1YQEA 1JVBA 3FNFA 3HV0A 2CXRA 2ZSUA 2ID9A 2Y1EA 1HTBA 1YL5A 4WECA 3K4PA 5C3EG 4AG3A 4CEHA 2H5LA 5KT6A 5FORA 3EAGA 4OJYA 1BX3A 2OUKA 1KC3A 1SAYA 3P8ZA 5TQ2A 3VM6A 3PNOA 4IR1A 4BMXA 1UNNC 4HS9A 4EHJA 4PQFA 4M1KA 3VO8A 3EEFA 1EDZA 2G5GX 4RSHA 2GA9A 1FFYA 5K3DA 3NP7A 1QZZA 4FKMA 3K30A 1SHTX 4B6FA 2P4QA 1YZFA 1RP1A 4MS3B 3FYHA 3VZSA 4EO4A 3R5XA 3LUKA 4EYSA 5H3HA 1RJWA 1L7EA 3CEAA 4R7GA 4CMGA 3QVOA 4C7VA 1JKMA 3UMVA 1JLLB 1KDOA 3LQ2A 4DAAA 4HWKA 1STOA 3OEYA 2J9ZB 1IBLB 3DDUA 2I03A 2JB9A 3P4UA 1WHTA 3IQXA 1RAEA 1FQKA 1QCCA 3H2BA 2V7WA 3O75A 4XQEA 3FCXA 1F8YA 3RHZA 2XOKD 4V0LA 1NBAA 2FPIA 1SXIA 2H51A 1FFEA 3D6HA 4DZRA 3NT4A 4N8EA 2QGNA 1OHHD 2I1WA 1E4FT 3ABZA 1GL3A 4RA9B 2QL7A 1KI9A 4BLRA 5KC8A 1KAMA 3PGXA 2A1TR 2H2AA 4JVOA 3W90A 2IV3A 4JQSA 4J49A 1FFCA 4J8PA 1VHLA 5ALLA 1DEOA 1XZEA 3EVAA 3S81A 1QG4A 2FKLA 3U1BA 1N6OA 2PXAA 4Z9FA 1KZ6A 2HV9A 3NTXA 1TFUA 3OIWA 4YMSA 1T3HA 1N8SA 1NJ6A 3TAXA 2ZBFA 3W9UA 2ZSFA 4MGKR 4JI5B 1M2OB 2ZBRA 1E3JA 1SD5A 2P9CA 2QM0A 2CL6X 3GQVA 1D0VA 2YVLA 1KYXA 3D0QA 5I7SA 1XPJA 4FM9A 3GTMA 4IDPA 4JP1A 2CF5A 3KFLA 1PWEA 2R1TA 2AKYA 3A04A 4BXOB 3QV2A 1SXJB 3ZJYA 4B7AA 1NURA 3DR5A 4AVYA 3ZWWA 3VAYA 3STXA 4KWHA 1IM2A 4K0KH 3BCHA 3O21A 1C9YA 3WRYC 3KB2A 4M4SA 5AW4A 3QEKA 1TIPA 3MPOA 2JEZA 1QCZA 4N76A 4HNUA 1UCFA 4QEZA 4BGVA 1M74A 3NYIA 1E99A 4Q3CA 2PYDA 3QF4A 4J0MA 4ZYWA 3OFKA 1ZHQA 3W6NA 4GUAA 1A77A 4Z2YA 3AVUA 4H4DA 4R1OA 4II3A 3VSCA 4YJ3B 3ZOKA 3PXAA 5E6UB 2R7MA 1R1DA 4HYTA 4QOEA 4TX1A 3A26A 1Y1WG 1XRPA 2QZSA 1BRMA 3KTDA 2ZREA 1DAOA 4ILEA 3QU2A 4E7OA 5J23A 3IQDB 1ZCFA 3TAHA 1GNQA 1WABA 1Z5UA 2VZ0A 3RAXA 4J16A 3G89A 4I5IA 4P93A 4MR7B 4QDKA 4CMIB 4F84A 5HIKA 4B9EA 3GJZA 3PVXA 5CNMA 3LZ6A 2IDMA 1ORVA 3MFHA 3QVJA 2AMLA 1PYGA 3CSWA 2PX2A 5DNAA 1FU7A 3F8NA 1LDMA 4IIHA 4M1ZA 1Y3AA 2FXVA 1Y1VG 1GY8A 2JFUA 3SE7A 3G1UA 3EWIA 3MIZA 3B6KA 1FFGA 1LLFA 5EXSA 2GSWA 4M7WA 3KAJA 5HZMA 1N2CB 5M29A 1SIOA 5KG5A 1P18A 1Z4QA 2ZXEA 5GZ6A 3IPCA 5J2UB 3W1VA 3RTCA 5KVVA 4O02B 2DABA 3O2SB 1W25A 1SOMA 1OB5A 2VPZA 2JGDA 1Z29A 4H0CA 2H1HA 4JLJA 2DKNA 1RYDA 3A2KA 1RI5A 4N47A 3ND5A 1SQ6A 4JBGA 3UATA 1U1GA 3GZNB 4AN1A 3BWDD 2OBBA 4NCJA 3NM5A 3DZDA 3D7MA 4RIGA 1YU6A 1RWPA 1EM8B 4Y8VB 4GC5A 2I1VB 4KACA 1V37A 4RPCA 5JEEA 3BGOS 1SK8A 2VP0A 3PHHA 2QX9A 4Y6OA 1WY7A 5B7NA 5LC1A 2BHNA 2IYNA 1FRFS 2BR3A 5CCBA 4HGYA 4TKVB 3W0LB 1RAHA 5HW0A 5MN4A 3L5OA 1SEPA 2RAUA 4EBEA 3BGIA 5K3EA 3D7SA 4MICA 3HYCA 1SZDA 5CE8A 1BEZA 3TUIC 2AR9A 1EDEA 2B25A 3CN7A 5JLAA 1IN8A 2X76A 4AT1A 3IEMA 3UWSA 5JAZA 4GWKA 3COJA 2EDAA 3GWZA 5C37A 1CDOA 2FGKA 3SQOA 3L6DA 3D2AA 1XP5A 3M8KA 4AM8A 1PWZA 4ESHA 4QPNA 3E9DA 4ZCIA 4ER6A 2B0CA 4N0EA 2PFGA 1OKKA 3I5UA 2NMVA 5BW6B 3R7WB 5JI2E 2C3MA 2V6IA 2Y1FA 3CH4B 3NDRA 3FNQA 3OETA 3ES9A 3HKDA 3R3ZA 1G19A 4DLPA 5JPIA 4ML3A 4CTJA 4FE4A 3NETA 4G6ZA 1EX1A 2YNMA 4EBFA 4ZOBA 3N39C 3BRQA 2UYHA 3EH2A 4FBGA 3IUMA 3ZK8A 4RY8A 3FVVA 1F3OA 3DEKA 3HUFA 3ADKA 4A0QA 4U6SA 3TTSA 1S68A 4DWOA 1W85B 1B23P 2XQFA 3EA5A 1P1HA 2YIJA 4IS3A 5F1OA 1FFBA 4KLZA 5ESWA 3HKEB 4XH9B 4EX6A 5D2CA 4BBSG 4M37A 1E3QA 3G8BA 3R8CA 3STUA 4X9XA 5TVGA 1ZWKA 3SIRA 2QLBA 1JDTA 1CRPA 5EINA 1GUBA 1YZYA 4X61A 4HUJA 2GPSA 1ONNA 4NJEA 1DKQA 5LMUH 4IWNA 4KO4S 2JFPA 2JIRA 2B7BA 4XFKA 2GO1A 4PG8A 4ERXA 2DTEA 2J3QA 2JDIA 2XQJA 4ENUA 2H11A 4B1FA 3CLSC 4QUGA 2XWJI 2NSHA 1YJ5A 3Q8QB 4GKJH 3G8YA 4DFDA 5EPOA 1NYQA 4HH1A 1OJ7A 2FMHA 4Y2VA 2ZI9A 5F9LA 4EB6B 1THMA 4U9IS 4CJXA 2PUBA 1KWGA 4B3MB 2VDWA 1L5OA 4TSFD 1G4HA 2C9DA 5CLJA 1O75A 1T5SA 5F2OA 1W93A 1YIOA 5B1EA 3HJGA 3B53X 4DXAA 1K5PA 4B3SB 4O3PA 5K8UA 1K7CA 1Z4PX 2IKQA 5E7JA 3DBHB 3WQQA 5C7YA 5FAKA 2CFIA 5FP0A 2GYVA 1LS6A 4K5QA 5LP6B 3EA0A 4CKWB 4WOCA 1R4MB 2J8ZA 4KMSA 1YRLA 2E18A 4KV9A 3VKVA 2VFAA 1EFUA 1T5HX 1TVMA 3ZN2A 1GQRA 2DTDA 4UCUA 1Q7CA 2UXDB 1UBNA 5EXPA 1JIVA 1O1YA 4YAKA 3KETA 5LQKA 3I6ZA 2YY7A 4BLQA 3MS4A 1YJAA 2C00A 1P2TA 2O3QA 5A4IS 2HW8A 1FYDA 3IULA 4RK1A 2FXIA 3LD9A 5KWEA 1HI9A 2A5YB 1HT0A 1JEYA 3T7RA 5LB4A 1FJHA 2HX1A 4HAIA 4FYWA 1U31A 4C6HA 1Y6GA 4KMOA 4S05A 4ZI7B 1YS6A 4FYVA 3F74A 1GUFA 1H8ED 1IN6A 4WXYB 4FFWA 3N0VA 1VBKA 2EVWX 4GP6A 1K3FA 1TMKA 1MG5A 2BC9A 3KHGA 2ASJA 1FTNA 2QLLA 2GTHA 5C5CA 4QHYA 3EYWA 3L0ZA 3GFPA 1NX9A 4YRLA 3F5QA 1THGA 2DWUA 3AGQA 4CCYA 1J33A 3T61A 1N75A 1XD2B 3IRUA 1APBA 4C7XA 3EY4A 1Q84A 4WIAA 3HBFA 5BUQA 3UHAA 2UYYA 3KQWA 2BGIA 4F56A 1NVMB 2G1KA 2RB4A 5ERXA 4NIMA 1BAPA 4XZ3A 3W2FA 1KJWA 4GEKA 4GR9A 3HDHA 1O94C 4A3BG 3OLZA 3DBLA 1Y6RA 4NCIA 1YRQA 5GJVC 4MEJA 2NO7A 1IBKB 4B2LA 3VJLA 3RJ9A 2PUAA 5TR9A 3MSCA 3H1BA 3PNBA 4W9MC 4PAGA 4FX2A 2F17A 3TKLA 3PZRA 3WOVA 5F7XA 6YASA 4TUYB 2FZEA 1QB7A 3D0OA 1MD9A 2P91A 2ALJA 1EDOA 2WZQA 1YA4A 3H97A 4GSYA 1C9NA 3VU9A 4FZJA 1GNRA 2VK2A 1QE5A 2A9VA 4ARCA 3JD2A 4U4AA 4BCCA 2XCIA 4YUZA 1AOXA 4GX5A 1XXHB 3WMWA 4MW9A 3VR2D 3WXBA 4JLSA 1GRRA 3ELUA 2FU5C 2FWIA 5KJEA 2NVWA 3KAPA 1WSDA 1ESNA 5KTRA 2WF6A 2GHIA 3LQFA 1ZI8A 3QVKA 1WNTA 4RPJA 1RC8A 3DDSA 2RGDA 1RYMA 4GPAA 4DQ0A 2IA6A 3HL4A 1CQXA 1OLXA 2VF8A 3HU2A 4CKBA 2R8ZA 1UDBA 2PZGA 3EZFA 2Z2JA 2AG6A 5IYBG 4FZVA 2Q3BA 3LXUX 2GPNA 4JELA 2O19A 2DFPA 1ODSA 2B21A 2FH5B 2GM4A 8ABPA 5KO2A 1D2EA 4RUCA 4DR7B 2C04A 5KOYA 1PZEA 4WDRA 1KZ1A 3AONB 2HIAA 3KHRA 4F9FA 1UQUA 2CVHA 3G5AA 4XUDA 2OORA 5FV4A 2PT9A 1MG0A 4LJSA 4LDPA 3ZIDA 3N9IA 3OKFA 2ZAGA 2H0QA 2H85A 1R8JA 2WDZA 5TE9A 3UKJA 4K05A 2CN1A 5F7ZA 2IF0A 2PH5A 1GNSA 3EXEB 1XA0A 4RTJA 4WNIA 2JK1A 4AXXA 1QS0B 5SYMA 4DPLA 5JCXA 3F67A 4XJXA 5C3UA 4HOYA 2GI4A 3QKRA 4RVNA 4BO0A 4CUZA 1E79A 4IO0A 2AXEA 1I7DA 1D2MA 2H7YA 4LZOA 5CFNA 2C28A 5FNVF 1JV2B 4L9RA 3KJEA 4DLUA 4K9DA 4X1KA 1CQPA 1WKBA 4TS1A 3GBVA 2XNDD 4R1LA 4BVAA 4YXWA 3MWKA 4HDKB 1P72A 3VPDA 1OXKB 3L8MA 5AKIA 2BI7A 3ROKA 1SHZA 2JVJA 4B31A 2FW9A 3RBVA 4MV4A 3U3ZA 1AIPA 2DUMA 1AUXA 2ASLA 3A4TA 3PW4A 4C2AA 3REQA 1IUPA 4XYMA 3TTXA 1SCDA 2PMWB 4V1CB 2WVGA 4UFNA 3DLAA 1J9GA 1W48A 4JZYA 3QMWA 5KFPA 4UNQA 1VL6A 3N2GB 1SKYB 1N77A 4E03A 3KPJA 1FK8A 2A4KA 2ZYVX 1DVRA 3U48A 4LISA 2FMFA 5BSHA 5K51A 1YR3A 2AC7A 2OC4A 2VF2A 3W3AA 2WFZA 2RGCA 1FTYA 2VHJA 3ZX5A 4G3IA 5C7LO 1RBYA 4BYGA 2MOKA 1NVVQ 1RKBA 3E3OA 4LGYA 3HBNA 5T8KC 1MJNA 5JJKA 1XMSA 2RMKA 4D3XA 2ZWMA 2ASDA 1JRLA 2J45A 3FGNA 2C3YA 4O7NA 3V6JA 4P1ZA 3PTLA 5HBGA 3TSCA 4AUEA 3TMAA 4RTNA 5FWDA 2JS7A 5DT2A 3UICA 1EP1B 1T91A 2YUTA 3L0SA 2C07A 4AYWA 4FGZA 4Z3KA 1K8RA 1L5QA 4FFOA 2R00A 5HIMA 4IIDA 3O4JA 4MNTA 4A3DG 5IVDA 1VE9A 3CISA 2JA8G 2AVDA 3AT1A 5KSPA 3IR5A 3S2GA 1C30A 3BSFA 2NZJA 3BGWA 1XZKA 5EFZA 1TMGE 1N2ZA 1CHDA 4RU1A 2A9FA 2CKMA 5JBNA 3IEVA 3NBYB 1Z7YA 4JYBA 3EXHA 5H3CA 2VHTA 3G2LA 2EZ4A 5JV5A 4XCQA 2OLJA 1P91A 4HNAA 3AIOA 4MHTA 1NTOA 2OCIA 1ESCA 1OX6A 1Z4KA 4EJFA 2IBKA 1L7NA 3PYXA 4E11A 1Z13A 1GU0A 2XE7A 2VQFH 4J0KA 1IOWA 2G82A 4JEHA 3WGNA 4HMQA 2QUIA 1FMJA 1XCGB 2NU7B 2ZJZA 4ZT5A 3JVVA 1O3YA 4AJHA 3AHHA 2QRLA 3C6KA 3IAS6 3ZWBA 1YL6A 4WN9A 3DUFB 2B63A 1N3IA 2R85A 4HVTA 4EL5A 2VEDA 5F1KA 2RGGA 2JA5A 1NM5A 3DMFA 3JWIA 3A3KA 5FPPA 1QQBA 3DXFA 3A6LA 4YPFA 3R9XB 1JW9B 1PFUA 2R8RA 1PGQA 2YZNA 4JOSA 4LNUA 2AOTA 1Z63A 2W90A 2DR2A 4B3GA 3MT7A 4LJ5A 2NXJA 2VC2B 4ARZB 3JAKB 1GCAA 3KRTA 1CC1S 2KLBA 3R3WA 4EJ6A 2PGNA 1RFGE 4QQKA 1VA4A 2OYSA 3Q8KA 2OFWA 2CL7X 4A3JG 1BWSA 4LDQA 5KYYA 3AFGA 2NNWB 4PG4A 1V6AA 3TUJC 5HDBB 4O82A 1FVXA 1YRAA 2WIGA 4G81A 4F9TA 2XQIA 4O4LA 2EW1A 1GTVA 2H2DA 3B70A 2V6MA 1B8UA 3ONDA 3QKSA 2B34A 4MUIA 4L8GA 3QQMA 1EMDA 2QMYA 3CBQA 2IEDA 3TG8A 2P9JA 4INPA 1SCJA 4YFYA 4HRXA 3LK7A 3L41A 4O4JF 4RAOA 3C45A 4WLFA 3T1YB 2JEOA 2AX4A 4QIWE 3HEMA 121PA 5FFFA 4WKOA 1VSTA 2BE9A 3KKZA 2TSYB 1T10A 5AUPB 3WR5A 3O6VA 1U0NA 3LPLA 3HZHA 2K4MA 2R8JA 1IYEA 3UWDA 4BE4A 4OP1A 4PZ0A 3OJEA 5EKDA 3EAQA 1M6HA 1TKAA 3U13A 1W5TA 5EWJB 2JFHA 1XJ5A 4CUKA 2P9FA 3E9YA 3KLNA 1JYFA 3C41J 3SF8A 5LZ7A 2H2IA 1V16B 2C78A 4PFKA 1RPAA 4N12A 4TSKA 4YN3A 3LWNA 1KXJA 5B3LA 3DS8A 5DX0A 3M6MD 3WY9A 4IQGA 4KEAA 2R4QA 5IYZA 4U9UA 5DMXA 3EIXA 4A8JC 2QRZA 1IFXA 2QTAA 4QDJA 2FWJA 4QTTB 2NUPA 1VTKA 3MWDB 1UKEA 3ETCA 3L07A 3IJPA 6Q21A 4BWGA 1GTMA 1Y9ZA 3KT8A 2P2SA 4R6WA 2OV6A 2PGAA 2FK2A 3ZXUB 2F1KA 3A1CA 4HLQB 5DK4A 4DTCA 3ZCQA 3ILSA 3LQRA 4UNNA 4DSNA 1SG6A 1I3MA 1CE8A 4KO1S 1HLDA 3P4YA 5D3KA 4OCZA 5G40A 3OZIA 3BWMA 4LI3X 3NH6A 4ZYZA 1UOPA 4KQWA 4LECA 1QH0A 5HFAA 2XXBA 3S55A 3LT1A 4MVXA 5I8ZA 1HOXA 3UB3A 4XARA 3WWPA 2O2JA 4TKUB 1N1EA 3SVZA 2Y4NA 1QVRA 1Z2DA 4CMEC 1CY7A 4QWMA 2ZFUA 3SYNA 2VA2A 3KLOA 3PC2A 1Z07A 4O2BB 1QF9A 1JHYA 3LS2A 1J4AA 3VGPA 1K06A 4HZUA 3G88A 2VJQA 2W2KB 3CGWA 1OIWA 3NIBA 4RNCA 2IWHA 4J9MA 2YZMA 1JIHA 1U9ZA 3TLAA 2OO3A 2BIFA 4UATA 1G17A 1A2KC 3EB9A 4E94A 5JWRA 2W2QA 1WUHS 2HPVA 5DULA 2C9MA 3DE2X 4KQEA 5TMEA 2FPPA 2L17A 4M53A 3AFOA 1FIUA 2WMYA 5TXGA 4JI8B 1QPBA 4HSGA 3RKSA 4F6RA 4OQLA 2WNSA 1LC0A 2O1SA 1KK2A 3TSOA 5E6RB 3VDRA 2Q2OA 4QLBA 2O3JA 4KLAA 2EKDA 4C3OB 3MCUA 4PC7A 1CETA 3QELB 1A8HA 9GPBA 3HABA 5I7UA 1QBGA 1XAJA 4PLYA 2VNAA 4MRSA 4HWTA 1NRJB 3Q3IA 1PT6A 4NX2A 3A3OA 2IYRA 1ILEA 1C2YA 1HZJA 3Q3CA 1H4SA 3LF2A 1R18A 1NC3A 3BFKA 1PDWA 1NNEA 2BJVA 3I0MA 1JDSA 1Y7IA 3K1AB 5DNEA 4NECA 3WLOA 4DBLC 4CKCB 4C29A 1C1DA 3KV3O 2EJUA 3H5OA 3FA2A 1M0EA 2I66A 3QGMA 2HQSA 1RXIA 4PINA 1L6IA 3U7QA 1E60A 2QK4A 3FUVA 1P9NA 4J1QA 3T3NA 3WGIA 5BT8A 1T9GR 4P3KA 2LW7A 4Q39A 5HKAA 1YZLA 1VA5A 2ONZA 3ZVNA 1GGOA 1ORTA 3LUPA 4DRXB 2VDNB 4K28A 1NZFA 1JI3A 1KI8A 4I2VA 3FNHA 1O2DA 3SM3A 4JWKA 2JJ2A 2JGLA 2Z2IA 4AJ2A 1M34B 5CVUA 1WVIA 2ZCJA 5DOZA 1XDBA 4JJFA 2CXOA 5JVLA 4P4UA 5EPEA 2PEYA 1WBJB 3OU7A 3MJRA 4LVOA 4AK9A 4YMTA 3DNPA 3VUEA 2H63A 3QJYA 1JA0A 4TN1A 2W8KA 1ORDA 5LOVB 3MUFA 4AROA 1N9KA 4AO8A 4LYDA 4PTZA 4OUKX 1RRCA 5D1HA 1PNTA 5AYVA 1YSCA 2HMVA 1M2HA 3DD5A 3FKIA 1PWHA 2Z9BA 1OA1A 2CLFB 1GSOA 4WGGA 2W57A 2PWAA 3GA7A 4Q47A 1KVQA 5LWHA 4MQ4A 4ZAZA 3K0AB 1ZC3A 4P8RA 4HVLA 1M2KA 4HQNA 1B16A 2G77B 2WJ4A 3VHLB 3AKEA 3PQCA 1X13A 1I2BA 2W4IA 1Y6JA 3HU5A 3OESA 5JBQA 3TB6A 2KWIA 1VJTA 5JNUA 3RVDA 5K0FA 2DUWA 3HB7A 1URPA 2Q21A 2HY7A 1UK9A 1E3MA 1D7AA 2Z1DA 3DAYA 2Q3DA 2N75A 1NFRA 1VKRA 2A5JA 4AO7A 5H82A 1R0YA 1QVZA 5EMKA 1YZUA 2QAGA 1RE0A 3GJXB 5EESA 4JI2B 1MAUA 2OP0A 1OWPA 4YHBA 5BV0A 5DHQA 1O97C 4XSHA 5I5YA 2D5CA 4JC0A 3P9CA 2C4UA 4BZXA 3CUVA 3E5MA 3DOEA 4U7JA 3CKMA 4O4IA 2JIMA 1YAHA 3UC9A 1CY6A 3EVGA 2CUKA 3DNFA 2W48A 2VTVA 3OF2A 2YHIA 3FDSA 3FPLA 4WBSA 1H66A 3AIKA 3HP4A 3WNVA 4DL9A 1GDDA 3LDGA 4J2OA 5IH3A 4DQUA 4OM7A 2DE0X 4BLPA 4QIWA 3PR1A 4CMCA 1G38A 4RFVA 1RQ2A 1XDUA 1Y3CE 1IQPA 4URYR 1FUEA 4WH0A 5DGDA 1U28A 4E4RA 4J2HA 3ZWPA 2QLTA 4YTEA 4DV6H 5CFQA 1V8OA 2VT7A 1EXVA 3U4IA 3MQFA 1PV4A 2BCGY 2V74B 2GF2A 2NV6A 1PGOA 2BELA 3ZU3A 1BDMA 3ZV5A 2IDJA 4CKEA 1G2OA 1GQFA 2HA2A 3TOZA 1WHSA 3JRXA 3AEKA 2FK1A 2ZBGA 5LD2C 5B37A 2FVYA 2XA1A 4NEGA 2ZS7A 4QPPA 2NG1A 4V0KA 1WZCA 2OLSA 3LAWA 1AE1A 1W6UA 4L78A 1WCV1 3EQ6A 1BIFA 4RCYA 1J8MF 5BW8A 2LDXA 1OAAA 1F14A 2D13A 1RI3A 3LQ1A 5JC1A 2CDNA 1VYUA 2FEPA 5LXTF 4YJ2A 2BKVA 3UV7A 4DWVA 4Q9KA 4TS4A 4LPSA 4QJBA 4IXMA 4I50B 2ZTSA 1A9QA 5CJPA 1FJGB 3FI9A 4TYQA 5DWVA 2REXB 4DR5B 4NFYA 1S7GA 4YJDA 3T5AA 1SUCA 3UTCA 1EESA 3TLYA 1I33A 4L72A 1BG6A 2VT6A 3O9ZA 3ESAA 1M2WA 1FUIA 2O8NA 3YASA 1E6KA 1JJFA 1E79D 1MOPA 2AK3A 3IXMA 4NEQA 2YINC 4NJMA 1V5IA 3RVLA 2SBTA 2Z2KA 3N2NA 5BQPA 1XK7A 4BJ1A 1GXSB 3CRW1 3PBKA 2RK3A 3ZNPA 4IV0A 2EIYA 3QTTA 1T5DX 3UAOA 4YXWD 4OHMA 1THTA 4FDAA 1X1CA 1E7YA 2GEBA 2CWWA 3ZHUA 3MFYA 3WIVA 2VDPB 2H1RA 2HLHA 3AW9A 2R6ZA 3ZQKA 1H2AS 2FW0A 5LQDA 2VQEH 1J5EH 5J63A 3K9FC 2R1VB 2NWQA 4S2UA 4JC5A 4MGEA 3KQHA 5KFQA 3HCPA 4MA0A 3K8YA 4YY3H 2A1UB 1UFRA 1EU1A 3HUEA 1FLAA 4ESEA 3HDJA 2QQFA 2NSJA 3RASA 4JYPA 1GFWA 3KZOA 4ZGWA 1GU7A 1D1SA 3H7AA 1QGDA 4RVSA 4X3OA 3KV1A 2EZUA 4F9GA 3UUFA 1YH3A 4J07A 2H4FA 2RHJA 3NOQA 4L73A 2NP6A 4TTTS 3DHNA 1LQ2A 3CEHA 3VA7A 2B4TO 3WKAA 2ZSDA 1B14A 2E37A 4FKBA 4G9EA 5FEMA 3UXHA 1Y3FE 4FI3C 3JQ7A 4EW2A 4YUVA 5IT5A 3PW7A 2HMAA 2ZIZA 5BWNA 3GAZA 2WABA 4EDHA 1WBBA 4NI5A 4EHIA 521PA 4H7HA 1GR1A 4CQMB 1CZOA 3GPBA 4C4YA 1ZUWA 5KX5B 1IBSA 3GRFA 1IVSA 1WZ2A 1E6WA 1P7ZA 2VOBA 1AHIA 4HWSA 5H83A 4MRRA 1K6EA 4GZ6A 4PZDA 5JH7B 3PEUA 4QVGA 4ZAVA 3ZV7A 1FSPA 1KZGB 4LWPA 4RKYA 2J48A 4U7HA 4E14A 1N34B 2ZIWB 3BE8A 4K88A 4TWBA 2RHMA 4GRIA 2A7QA 4K6CA 1E58A 3ROXA 3WLKX 3OOYA 2WJVA 3VO1A 1CUFA 4QBHA 4PTLA 2PDAA 2PKCA 4OO3A 1GN9A 2XHEA 1H93A 3O38A 2NV2B 4EHDA 4UREA 2RDIA 4MHSA 5EGSA 3N2KB 3GNTA 1WD7A 2FUKA 4TKLA 1Z2NX 3IHTA 1DUIA 4DL6A 1KEVA 2HF9A 5GV8A 4CIVA 5A9SB 2WJZB 1ZY2A 3HOXG 1KAOA 3NRBA 5C5IA 4Q82A 5REQA 3F6EX 5CX1A 5FOWA 1YBFA 4KZKA 3ENVA 5B6PA 1MB9A 1UK8A 2EJTA 2BM9A 1WJGA 4JOCA 4KKVA 2GBFA 2UVRA 5AVJA 1RR6A 2EXXA 5CD1A 1JQLB 2IXGA 4HWGA 4G0UA 1BMFA 2V65A 4FYPA 5ELXA 4DM7A 3OLWA 5D5QA 3HXPA 5CGZA 4P38A 1DX6A 2Z08A 3DCJA 4IY1A 3EX7C 4GD3Q 3SFVA 3RKUA 1NNSA 1AO0A 4CHTA 1T3LA 5JSZA 5GQSA 4JJ6A 3PT9A 1G20E 1ML4A 1DAFA 4R5HA 3ZGYA 5LMNB 1W0KA 2ONCA 1IEXA 2I1LA 1L7PA 3QXHA 4FD3A 3QFFA 3OQ1A 4ME6A 3GLRA 4FC6A 3AF5A 2ZRMA 3GB9A 3HA7A 2CW5A 1G9SA 4MROA 1GYPA 3ECAA 1A69A 2P9TA 3FIJA 3PXCX 2KW5A 3OLYA 2A9JA 2B4AA 5DHSA 1XB2A 1N7JA 3AJEA 4QPDA 4AWBA 5HS6A 4HFRA 3SYKA 4RJLA 2CMHA 1NQWA 5LMZA 1H9CA 4GKVA 1V11A 4BXXG 2BMDA 3I9LA 3PLAE 1U8EA 1W4LA 4I6GA 4QO8A 1BU8A 2OE2A 1W19A 1X6VA 1FXUA 3UIEA 1OPXA 3E9RA 3GC6A 1B3BA 1T2UA 5ALZA 5LQCA 1N5DA 1QMGA 5K4HA 3FUTA 2JBAA 2EARA 3SGLA 1BFUA 2RHDA 1BS2A 4BX3A 2VTBA 2CZCA 2JLWA 5ILOA 4A3KG 3NRJA 2DT8A 3M3PA 2QTMA 5U4XA 4ZXFA 1VE1A 2Q0SA 1RABA 1SU7A 3EHEA 2OXFA 3JALA 3PKZA 1SH7A 3LYAA 1XZFA 3A8TA 5SY6A 5AMXA 3G5TA 2CNWD 1UR5A 2IL1A 2Y27A 4H35A 4A3LG 2DJ5A 3JVUA 3T1TA 1IZZA 1JAYA 3ZY4A 3OPVA 1Y7LA 1F60A 3SX4A 3OZUA 4QQ8A 1WAMA 1G5RA 3BJIC 1G8FA 4IZ6A 1XX6A 2WF9A 4AIIA 5I6DA 3G0CA 1VDMA 2J3IA 3U3OA 2XSZA 4M76B 4BEWA 2ON6A 1KT8A 1D0SA 4YJHB 1NATA 2JKZA 3U61B 2E5LH 4F9EA 3BD7A 3MD0A 3P97A 1NXXA 4WT7A 1KGDA 3KJQA 3NBMA 2ZS9A 2I62A 5ESDA 4P08A 4Q4LA 2X9LA 2XF2A 1BDHA 2HZ7A 2WHPA 3BD9A 3GDEA 4DR1H 3ELWA 2YIVX 4CI0B 4D9KA 3J80W 3TQFA 5ALFA 2FZCA 4W8HA 5C5JA 3JSNA 1MX5A 2ERCA 4UDOA 3PPVA 3GPLA 3CCBA 5EJ4A 5LDHA 2Q6IA 4PPYA 3FGZA 5IW8A 1P5HA 1TRHA 1XJ0A 2WHRA 2PZEA 1W94A 3EF0A 1GGEA 3VH4A 3FRHA 4UHFA 4UJ3A 5B36A 4X66H 4XQCA 5TT0A 2B35A 2QTVA 3OA0A 1Y7HA 5CURA 4WBNA 5I7AA 3ESQA 5EHNA 3E9EA 1JAXA 2NPIA 4MXDA 2QJRA 3HSKA 3KD3A 1A9RA 4JAVC 3PUHA 2OGTA 4GPTA 3SZOA 3R6TA 1XEAA 2W42A 1FYFA 5CLGA 2VHWA 3I6MA 2YV4A 4K9SA 4UOZA 5SYAA 3O7WA 4KPUA 5BSFA 1KNQA 3K0FB 5JU6A 1BO6A 2G6TA 3FCAA 5EYPB 3RS8A 1N2JA 1U5BB 1Y1TA 4Z54A 1AB5A 2QRPA 4D74A 4B3XA 5JSQA 3OCYA 1L9KA 1NPDA 3ECSA 2GLTA 1ULSA 4EFLA 4GR4A 4GL2A 3STYA 3BH6A 4RKRA 1Y42X 3IBGA 3PEEA 1YJ8A 4YACA 4EG1A 3EQZA 3VFDA 4HXEB 3DBVO 1FPMA 1Y8AA 4XSGA 4RORA 2WFLA 2RC6A 3BMOA 4J7UA 4EY4A 1GZ5A 3WKEA 2HMUA 5IKEA 2F48A 1E1RA 4JVSB 6REQB 5BMOA 1N32H 4DL2A 3R9IA 4WNYA 4ER5A 2ID4A 2UZIR 1W4CA 3F6RA 1C1XA 4LBWA 1Q1GA 2OTCA 1VMAA 3TGLA 3A1TA 1TKCA 3GRKA 1UBUS 2R2AA 4AC9A 3T7AA 2DLDA 3ZGNA 1XI2A 1IEVA 1Q12A 3U4MA 2XQVA 2LIVA 5KYWB 1EDBA 3GYGA 5LUAA 1NSYA 5E4JA 2DG2A 3V48A 5JRZA 1KYYA 5FBLB 4RK0A 4M0EA 3DWEX 4ZMSA 4UE2A 1EXNA 1JEOA 1GKIA 3IXLA 3GL9A 2FUEA 4RWZA 1WWKA 2W2PA 1D04A 2ORYA 1Z5VA 3L43A 3SDSA 3K71B 3RFFA 2GBGA 2H18A 4PY2A 4B45A 4DA0A 5HS4A 1WDWB 3IESA 1EAYA 1V4BA 1DQSA 1OGIA 3RLIA 4X62H 1TUBB 3FIUA 2A8YA 4FR0A 3DW1X 3KQKA 4N5NA 4C7JA 1FDRA 2VWHA 5E9WA 4FNMA 4QGAA 4DC9A 3N2IA 3FX2A 4J7CA 2WK1A 5DM70 4BMZA 1YR6A 3T5BA 4KI7A 1YFLA 3IR6A 4Q45A 1KEEA 4WFIA 1P45A 4C7OB 4LN1A 4EQ6B 2QD5A 5IULC 4HBGA 3Q40A 2R4UA 3K3VA 3LC2O 4C5AA 1GCUA 3JZAA 4KNWA 2PHZA 3U3XA 5NLLA 4NAHA 4R1UA 1RRPA 3PDHA 4ZREA 4IIJA 2A3NA 1H0HA 1YDMA 3AY7A 1V6CA 3V7FA 3COYA 1AKUA 4BKOA 1C4OA 1E9SA 3TN7A 2IZ1A 4BBAA 4TL7A 2DFLA 2CWDA 1XEXB 2JLQA 3M9MB 3QUCA 3FTQA 2IZZA 3GJ5A 1Y1LA 3ESXA 1THZA 4CQLA 3FWYA 3ZW7A 4P58A 4Z4GA 3JWPA 2VDUE 1QR6A 2CXUA 1X7HA 4KFCA 1LNSA 3EFOB 5ICMA 2QX6A 3K9BA 2V7BA 1KY4A 3ZGXA 5HKKA 1H1LA 1K89A 4YJFB 1U3TA 4KLCA 3OZ7A 4V39A 3SZ3A 2EZTA 2BYTA 4BP3A 3I9V1 1TU0A 3H99A 4ED2A 2AX3A 5E9JA 4BEBA 4YT8A 1GPLA 4HBZA 5DNWA 1MB2A 1RQGA 1AKMA 4JR2A 3NHPA 4PYKA 4H27A 1I32A 1NXPA 1K63A 4CLOA 2AJDA 1V25A 4HH4A 4UHBA 1HURA 5J43A 3LQKA 4YIKA 5JASA 4O7ZA 1Z5GA 2LV8A 2WV9A 1J2RA 5G4KB 2BGNA 2BFBA 4KYVA 3AEUB 2QU7A 2VHCA 1TF2A 5K8CA 1XA4A 3WO1A 3K15A 5JAIA 2NQTA 1UOEA 5BMVB 2PZAA 3MQ4A 4FBTA 3RUDA 1S0MA 3GV0A 4ACBA 2CHQA 1FC0A 1RLTA 2DBRA 2B9VA 4E2YA 5E1BA 3MOIA 4EG0A 1VP9A 1Q0QA 4IH4A 4YGXB 1E6CA 3SEAA 1TA8A 4OGKA 3GRZA 4FGSA 5ALYA 1Q0LA 4U6QA 5CJJA 1HFWA 4Y9RA 3GCZA 4IDQA 1K1EA 3PRHA 3ZKWA 3MCAA 2NVOA 2E4AA 2X8AA 1EXDA 1PSZA 5BWCA 3PR5B 3FYCA 4LNHA 1Y3IA 2OL4A 2VHYA 4L9AA 3CYFA 2ZUCA 3O8DA 3N1UA 1X7XB 3W8DA 1NRWA 2FKNA 1BS9A 3W3AH 2H29A 4G3XA 4RMHA 3HYLA 3OUTA 4DMKA 4E0BA 4IJUA 4U5QA 3DOJA 3WSWA 1DXHA 4HB0A 3B3GA 3AZQA 2FSVA 2YHBA 4PTYA 3PIDA 1IQUA 3T9BA 4NS4A 5EMJA 4BCBA 3GHHA 3AI1A 5GAJA 4TOIA 2BDUA 3GJYA 5KPJA 1U80A 3TQIA 5KFAA 3VPXA 1TTHA 4AF6A 5B12A 3EGDB 2PZJA 1JMKC 3L2PA 2PKEA 3H3XA 1WB6A 1YNSA 5KOHB 3MYRA 2ANCA 3GEGA 5AKZA 1BROA 4EI2A 5HCNA 1L1RA 4JYAB 4TT8A 3H2HA 3E7WA 4M1WA 2FF7A 4PWQA 4WACA 2BKUA 1FQJA 2CNBA 3ZLJA 1K8QA 2ISQA 3H18A 4LGMA 1RWBA 5A5DA 5AHWA 2YYSA 2IXBA 3LUDA 4L9WA 5I4BA 5CP8A 3ASYA 1Q1ZA 2JFOA 1WZUA 5IANA 2O7QA 4Z7OB 4RWEA 3VXKA 1RYYA 3HTXA 2XUDA 2IXEA 1D1QA 3ZD9A 3FTCA 5CA1B 4LYGA 1Z6QA 4EHBA 4QGGA 3AVVA 1Y8QA 3IE2A 2WT8A 3OM1A 4YCDA 3SSOA 4GLBA 3E3LA 4X8OA 1CF9A 1XZLA 2RGUA 2OUIA 2C5AA 2JGIA 3EVZA 3UJ7A 4GMDA 4FJ0A 3ZE1B 2XMBA 2HA4A 2E3JA 3RANA 1A97A 3U9SA 5D5PA 1U90A 2IZ7A 1V4YA 3UGJA 3K1YA 3REGA 3GNSA 1E7QA 4Q43A 1ETUA 1YE8A 5J5CA 4DV4B 3QE9Y 1N3BA 1WTAA 1PFGA 3HNPA 5JMWA 1KO8A 1EX9A 4FFSA 1C50A 4FEAA 5C1BA 3LIPA 4JP5A 3IUQA 4UOEA 4QDZA 5F3DA 2PMZE 3OSUA 1QQ7A 5ENVA 1UKYA 2MCTA 2IPNA 2N0SA 4OFZA 1USUA 4AY5A 1VE7A 3KR9A 4O3QA 2YQZA 2QRMA 5JI3E 4OOFA 5GOTA 1AUPA 1YB2A 3SXPA 4HLDA 4WCVA 3F3KA 2QSJA 4OGWA 4B5LA 3SLKA 1UM8A 1OTHA 4F8EA 1IN7A 3QFHA 1W4BA 2R6JA 4WMLA 4RNMA 1PNOA 3ZLTA 5BN3A 4NY1A 1JEQA 4EFBA 2KQUA 4CKXA 4RNDB 1XRLA 4YVFA 1BYIA 4DPMA 4RO0A 2Z3WA 3UB4A 4RL4A 1NBOA 3PIRA 4A8PA 4US2R 1WMFA 3ICWA 2I2DA 2WA1A 3IT2A 5LZ5A 3TDNA 4DR3B 3TLGA 3ZS9A 3WNCA 1UJ4A 2VP4A 5JROA 2IUEA 2H7XA 3JWHA 4PM4A 5M34A 4IJQA 4YP7A 4JYMA 1DX4A 5LKRA 5CDFE 4CW7A 1J9ZA 4HQOA 221PA 1CUYA 1T6ZA 4JUCA 1Q0ZA 1ZVQA 4RTLA 3CX4A 4R98A 4U7TB 5DMHA 2CXTA 4WESA 5SYNA 3AOEC 3X1MA 1CUZA 1YIAA 3RTAA 3IBSA 1W29A 3WADA 2IZ0A 3OO1A 3WLNA 4W63A 4O4HA 1VI6A 4YEDA 2W6OA 3EG9A 3F98A 4AXBA 3HVKA 5IJWA 4FS3A 4GHWA 2W8ZA 5CT4A 4QOGA 3LA6A 4QDUA 4JA0A 2XUPA 4BGEA 1VL5A 2K5UA 2JLBA 1G5PA 2V5VA 1DC4A 4LXYA 2BISA 3S5JA 3TRHA 1LXCA 3BD8A 4D26A 1XSEA 1P62B 4DJ5X 1DOHA 3P19A 3PFNA 4Z0NA 4F1JA 3S4YA 2O06A 3HUUA 3ZCPA 3CR3C 1BMFD 2V03A 5I45A 4L95C 2QBYA 1C7FA 1CUHA 3ANTA 1XWWA 1H2ZA 1V5GA 2B1RA 5TMBA 5C2JB 4MVJI 1TLFA 1U4NA 1M2GA 1MUUA 4GNKA 3HB4X 4ECTA 4Q7MB 1X1TA 1V9CA 3ESBA 5KMGB 2C57A 2JFYA 1AKWA 3FE2A 1T1JA 3AJ8A 2XYGA 2QQ5A 1DO2A 1KPIA 2R62A 4RLHA 2VDVE 3QMPA 4QDXA 2GN2A 1YCFA 1HQCA 1L7DA 4LRSB 4I1RA 5JSKA 2EKZA 1PTKA 2GLUA 2OM6A 1GD1O 3EDYA 4NG4A 4EKNB 2XA9A 5L9XA 1DRKA 4IDFA 2C2ZA 4OK6A 1XKLA 2JVIA 1OBFO 1V1JA 2UXCH 1T4MA 5KYUB 1TQ4A 3O4VA 4GYJA 3X1KA 3HA2A 4NOJA 1SUAA 1IAVA 1FVHA 1OT5A 3EDCA 1RZRA 2QNIA 4D02A 1ORHA 1U7PA 4EJSB 5JAQA 3V1UA 1UL1X 5AVRA 3L46A 1TVKA 4JWTA 4KW7A 4HF7A 2VDOB 1AZTA 1TQ8A 5EWLB 2V98A 1I5EA 4ARUA 5EHZA 4AUKA 2P5TB 2AIRA 2TMGA 2PS3A 3PFBA 3MGCA 3R0JA 3RRMA 4LBZA 2O5EA 3A1EA 5AVQA 1R8QA 1N7HA 1RZVA 3HOVG 5DKFA 4X95A 5TC4A 2D54A 3P2OA 1P29A 1O8BA 2AF3C 4B7XA 4GLFA 3KLBA 3ZDAA 1CR2A 1S8NA 1G0OA 5I9NA 2QD4A 1JHDA 4XM1A 3GTOA 1XJWA 3CX8A 1XVAA 4LF6H 4IVPA 3TO5A 5AK6A 3TSWA 1G8JA 1ZQ7A 2WYUA 3QPDA 3C3XA 5JANA 3D6JA 1PSWA 1TKBA 2CB9A 5FTJA 4Q3EA 4WLEA 2DPMA 5FPRA 1CQJA 1DO0A 2CJWA 4ZOAA 3TQQA 4MV8A 4FILA 3M82A 1D2NA 2XSZD 5HOEA 1LKZA 7MHTA 3B12A 4G1EB 1SOUA 4LZAA 1L5ZA 4C1BA 2PS0A 2ZB2A 2I3AA 2MSWA 4LF4B 5K3WA 3L0IB 3PCRB 3GEIA 3RBXA 1K6IA 4PYOA 2JI8A 4YX9A 2G0AA 3OQHA 1F4LA 1TPYA 4BP9A 4FMDF 2FG7C 4MB6A 4DLBA 3VVLA 4KV7A 4D0RA 1ZNXA 5EIEA 1BH6A 1LZKA 4RUAA 4MW1A 3UHFA 2IYEA 3UJAA 1DFHA 1XLTC 1VBNA 1XCOA 3GA0A 4TL9A 2FWBA 3GMDA 5CXXA 1NASA 4RHEA 3D54D 4LYAA 2LGJA 3MYYA 2DPJA 1M8KA 3SXJA 1ZH2A 2YWCA 4BMOB 3S99A 2A67A 4CF6A 3K5HA 1HE3A 2UUBH 4L3WA 3B9RA 4JXKA 3N28A 4KXFB 3GZJA 4FGLA 4RFLA 1KMHA 3K96A 3N74A 3ZHSA 1CZUA 4BX9A 4PLTA 1ZM7A 3FTPA 5HCIA 4UM9D 1S9HA 4ZVRA 2V97A 2CQYA 3G5UA 3P0JA 1ZMBA 1ZA2A 2ZU6A 3IURA 4LQLA 3SKVA 3U3KA 4X64B 1BXRB 4MLPA 2XGPA 3M33A 3INNA 2H1IA 4RD3A 1KC1A 1I94B 3FW1A 1CEEA 1KY2A 1M6VB 2FSHA 3WX0A 1H3EA 2LE0A 4KPEC 5BUZA 3IJRA 2X13A 1TLTA 4RPKA 5EL0A 1OBGA 1D4AA 3IEXA 1R3UA 2H48A 2H1LA 2VUHB 1RI4A 4HGQA 1OW3B 4LC0A 3WKCA 2QRHA 3CC8A 4AX8A 1EK1A 4KXUA 4NYMQ 2QDXA 1DDOA 4UD2A 1Z2AA 2FSGA 4J9KA 1CUVA 1E92A 4O86A 5JVDF 3ESYA 1JFFA 1AKQA 2EP7A 4FUQA 1UM9A 2XEXA 3W9YA 2J3DA 1S2GA 3HK2A 3VV2A 5C8VA 1E9AA 3IAEA 3DTVB 3LK6A 4J75A 1DBIA 3O8NA 1UBFA 1UJBA 3BZUA 3GMSA 1NXTA 3M5PA 4ITVA 4G85A 4PRYA 4UCSA 3KJIA 2H65A 3CKYA 4J1NA 4IOLA 3GNLA 2HDKA 4LOJA 3KWMA 3BXHA 4R40A 3ZGOA 2XTJA 4A0FA 4GO1A 5DLQC 3NHBA 2GD2A 4TV9F 1E66A 2PTGA 4I19A 1ISPA 3MJEA 2VSYA 1SD1A 3CF6R 1XL1A 2L19A 2YU9A 4DJJA 2IYLD 4CM3A 2QRQA 2H8KA 1HYEA 2ZPAA 1PLLA 4Y0AA 4G0WA 3AB8A 3ZE2B 4TWJA 1Z5NA 5LQUA 3QZ8A 3RM3A 3UQ8A 4OAPA 4WNCA 1ULBA 3RDPA 1Z6XA 4RF3A 4D41A 4YQWA 1EEXB 1RRMA 3BDIA 3N7TA 1K7EB 4MP6A 2W0SA 3I83A 1XMOH 3EOZA 3K70B 1G16A 1TMOA 1JJVA 1DIKA 1WZNA 1I2LA 5F9HA 5CDFA 4J16C 4G26A 2DQSA 3OIGA 2G08A 2WB2A 4CIBA 1ZSVA 3BB3A 3IP5A 1JKIA 1IC6A 1RPZA 5B4UA 1RM3A 3F8SA 1RYHA 1JJAA 2IELA 5B57C 3FDZB 4X41A 2YVAA 3ZQ6A 2QTFA 1TAQA 2RGAA 3R9WA 4LE0A 5IDXA 2HZBA 5BRNA 1CUUA 2P6UA 3WIBA 1V96A 2ZI7A 3CNBA 4QARA 4FFPA 4PDBA 3K0CA 4M83A 3LWZA 3MOSA 1AA6A 2XKBA 1PLKA 5D6NA 1OKKD 4O84A 4A03A 5J1SB 1PZHA 3Q4GA 4GLLA 4OK5A 4XLLA 3ZGVA 3NTQA 3VGJA 4MS1B 1FP6A 2Y3IA 3W9BA 5K2MA 3UZUA 2YNMD 3K2EA 1L4LA 3I28A 4IHQA 4A3GG 2WSYB 2J09A 1BDBA 3R5SA 1SBHA 4B32A 1HDCA 3KKMA 2GAOA 1TK3A 2VCEA 2OD9A 2Y0DA 5J58A 2KMLA 4J91A 1RYZA 1FTQA 2G9UA 3F90A 4YJGB 3D81A 4X65H 4P53A 2ZSBA 4GC9A 4EAAA 4MR8B