4XX0B

Coa bound to pig gtp-specific succinyl-coa synthetase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
393
structure length
392
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structure of GTP-specific succinyl-CoA synthetase in complex with CoA.
pubmed doi rcsb
source organism Sus scrofa
total genus 125
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xx0B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xx0B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xx0B03
4NYEA 1KC7A 4O7VA 2YWVA 2W71A 1E4EA 2PVPA 3ORRA 1Z2NX 4MV6A 3TINA 2NU7A 5IYZF 3OUUA 2V59A 5JQWA 4EGJA 1IOVA 2GLTA 5I47A 5CB4F 1KUTA 1EUDB 2YZGA 1AUVA 4ZHQF 4XYMA 3LWBA 3SE7A 3MJFA 3MWEA 2W70A 4ZI7F 2HGSA 3UFXA 1JLLB 3R23A 5D8DA 2R6FA 4MV4A 1W93A 2R7MA 1OBDA 4MA0A 3TIGA 2YV2A 2PN1A 3R5HA 4IWYA 3RUPA 2ZDGA 2VPQA 2NUAA 3U9TA 4XYLA 5K2MA 1CQIB 4HNVA 2W6ZA 2FP4B 2R87A 3G8DA 4FFMA 4MAMA 2Z04A 3RFCA 1M0TA 2I80A 2CZGA 3U9SA 4YB8A 3RV3A 1VBGA 1BNCA 1M6VA 2W6PA 5BPHA 1AUXA 4MV3A 1KJJA 4EG0A 3DF7A 4MA5A 5GONF 2VQDA 3ETHA 4O7RA 5JH7F 1GGOA 5HV6A 2YRXA 1KJQA 3E5NA 1UC8A 1EHIA 4WBNF 3VPDA 5J2TF 3VPCA 1ULZA 1KJIA 2R84A 1DIKA 2DWCA 3KAKA 1BXRA 4XYMB 4O7LA 4TV8F 2DIKA 3MWEB 1VBHA 3UFXB 4ZOLF 1KEEA 1JKJB 2FPIB 3RV4A 4C5AA 2ZDQA 3Q1KA 4HNTA 2V58A 2YV1A 4ME6A 3PFFA 2R82A 3MWDA 4O82A 4O4JF 5KX5F 4O83A 5HBRA 4TUYF 4XYLB 3V4ZA 4FFLA 1B6RA 2R86A 5DMXA 1PX2A 5H80A 2XCLA 1GSHA 4I4TF 4O2BF 4YJ3F 1KBLA 1A48A 4XZ3A 5CA0F 2V5AA 1SCUA 2YRWA 4I55F 5FNVF 2HJWA 4YBZA 1C3OA 2YZLA 1WR2A 1DV2A 3GLKA 4O7ZA 1CQJA 1VKZA 1I7LA 4DIMA 2YL2A 3JZFA 4Y8VA 3KALA 4XX0A 3JZIA 1GLVA 3U54A 4HQ6A 4IWXA 4O4HF 2SCUB 3VMMA 4M9UA 4O4LF 2NU9A 3JRWA 4IHJF 2IP4A 1GSAA 2R7LA 2VR1A 5LOVF 3HBLA 3NUAA 2I87A 1E4EB 2YZNA 4MV9A 4O7SA 4TV9F 3BG5A 2ZDHA 1CE8A 3WO1A 4O2AF 4O4IF 1PK8A 2NU7B 5HBRB 5CAEA 2W6QA 4HNUA 3ORQA 2NU6A 4YAKA 3G8CA 3HO8A 1W96A 4XZ3B 3WNZA 1SCUB 2OLSA 3K5IA 4ZQIA 1OI7A 3VA7A 4YBZB 3HB9A 2DZDA 3KREA 4HR7A 5BMVF 1C30A 1UC9A 2R85A 1JDBB 3TW6A 1CQJB 5CA1F 4MV1A 2CQYA 4Y8VB 4XX0B 3LP8A 1A9XA 1CQIA 2FPGA 3I12A 2FPPA 5EZYF 4O81A 4FGRA 2NUAB 2NU9B 1KJ9A 5J2UF 2J9GA 1OBGA 4O7YA 3K3PA 4QSHA 1KJ8A 4FFOA 5LA6F 2YZMA 2GQRA 4YAJA 2YS6A 1EYZA 4O84A 2PBZA 4YB8B 4I50F 1I7NA 5LXTF 1Z2OX 1DV1A 5KKNB 1Z2PX 5C8YF 5BPFA 5C1PA 2NU8A 5CAEB 2GPSA 3R5XA 2NU6B 4EGQA 3ETJA 2YS7A 4YAKB 2CNQA 1EUCA 5JVLA 2W6NA 2W6MA 2Z02A 3K5HA 2I8CA 3VOTA 2WYOA 2CSUA 1JKJA 2FPIA 3OUZA 3TQTA 4FFNA 2YYAA 3TIIA 5LYJF 4IIJF 4FU0A 4FFPA 2P0AA 2CNUA 1IOWA 4MV8A 2QK4A 3N8DA 4C5CA 1T36A 2C00A 2GPWA 2CNVA 2FPGB 4O7WA 2FPPB 3MWDB 3JRXA 2FB9A 1GSOA 2R7NA 4IZOA 3AW8A 1EUDA 4C5BA 3AX6A 3R5FA 2YW2A 4FFRA 3KAJA 4L1KA 4MV7A 5JVDF 1M0WA 4YAJB 3WO0A 3V4SA 3U55A 2GQSA 1JLLA 3R9RA 1JDEA 4DLKA 1EZ1A 2R7KA 4FE2A 3N6RA 4RZQA 3GIDA 5JQGF 4YJ2F 4E4TA 2NU8B 4O7NA 3Q2OA 3VPBA 5C1OA 2XD4A 1CS0A 2SCUA 3DMYA 2W6OA 1B6SA 2DLNA 2QF7A 3QFFA 4O86A 2X0SA 2FP4A 4O7TA 1EUCB 5LP6F 4WD3A
chains in the Genus database with same CATH superfamily
3DCJA 3SEAA 3A36A 2AN3A 3OSNA 3GDHA 2WG0A 3CJQA 3LL4A 5BVHA 1B1AA 4ILEA 1E1LA 4Y2GA 4X1OA 1EEHA 2C03A 1P5JA 1QVWA 5AVOA 3WRXA 1T8SA 1L4FA 1RZUA 3LNCA 3TRFA 2GHIA 5F78A 4X20B 4K2AA 4QL3A 1ECBA 3O8CA 3VR5H 5TVKA 4L6AA 2I5PO 5EYPB 2FK2A 4TMVA 1INLA 3DVRX 1U5CA 1QS0A 5C4GB 3VSDA 3MS4A 1HQDA 1ZGCA 5IKMA 4Z2AA 4J0JA 4DJFC 3WGGA 5BUQA 2AVNA 3CEPB 4H2DA 1A5SB 2VPIA 4JI7H 3GCWA 5SYMA 2FRDC 2FQWA 5A6SA 1KAQA 3BIJA 3EF1A 3TQOA 5AJVB 1UC8A 3H9BA 1JF8A 1SCDA 3KHGA 1F2UB 1AZSC 1G98A 3O26A 1RI2A 4DUYH 1DEXA 1SU4A 2BFBA 3H04A 4BKQA 4XYMB 3D7NA 3UJ8A 4RMGA 3UK7A 3VNQA 4XDYA 3SHTA 2CBXA 4QVGA 4E22A 1SXJD 3OY2A 4RNOA 8LDHA 1QRRA 1OVGA 3OCUA 5EY5B 1IAQA 1ZVMA 2EJCA 1NMSA 1ZZEA 1SHTX 3HOXG 4X0EA 1PYGA 3FNIA 2F1KA 3WBFA 5KWVA 3N0RA 4L76A 5KINB 1VL0A 2YWFA 2EC5A 1T25A 4PTZA 2OHFA 1P0FA 2X3UA 2ST1A 4KX3A 4ENSA 5I9LA 1KYYA 5KG0A 1M34A 1S2GA 5ANRB 5CUQA 3JALB 2XGMA 4DR4B 3GFRA 1FMTA 3NOOA 4GX5A 3LUAA 4RVGA 1PVOA 2JDIA 1YGYA 3HBLA 1WUJS 4DYVA 4NMHA 4B74A 3AEKB 1JIQA 1X1DA 4LRTB 2HF8A 2PKQP 4YRNA 3PEFA 4RM3A 3HU3A 1YAHA 3PF9A 5ESRA 3HUDA 3B13B 3EEIA 3TL3A 1HNZB 4HEA1 3RB8A 2GASA 1FDIA 2BHSA 2CFOA 4OEHA 5AW8A 4N7JA 1WCIB 3SOZA 4D79A 4TVIA 3VKVA 2Z1NA 4BMDA 3P2OA 4F6RA 4ZOBA 4DCGA 1ZGZA 2H7XA 2EYUA 3ZXYA 3KSDO 3LP8A 1W5FA 1OWMA 2GUGA 5ES3A 4MUYA 2PWYA 1HORA 4JQSA 5D3KA 5SZIA 4BECA 3TNLA 4JD5A 3LDUA 2OXRA 5TJ9A 3VPGA 4ZK6A 3GV0A 4BO9A 2O4CA 3AF2A 2H6EA 4QUJA 1C9JA 1ISJA 1H4QA 3WGOA 1OWPA 1VCMA 5FWYB 3GRUA 2C4VA 5IYZA 3ZK7A 1QWSA 3SX4A 4DEVA 5FBLB 1XG5A 4INAA 3GBPA 4C03A 2FPIA 2XYHA 1OREA 3ZZUA 4G5HA 4BKUA 1XXHB 1AGRA 4J0IA 1DAIA 4AKIA 1YMUA 5AW4A 1VHQA 5IC6A 1UH5A 1E9RA 4N4AA 4PC1A 1WSWA 3T94A 2W2VA 2CXSA 1TAEA 3SXJA 2NACA 1MHPA 3KB8A 4UE3S 3H5RA 4CLRB 1X1RA 2HZBA 3H1PA 2JB9A 5CITA 1VLZA 3RHFA 3VZBA 4EKEA 5HKAA 2IOYA 3EPHA 2LV8A 3T3MB 2LWIA 1PEDA 3TGWA 4C20A 3QNUA 3AU9A 3MN1A 2FSVC 5AJYA 2C2EA 2W37A 4MMYB 2D13A 4GLBA 3FJOA 2F4NA 4ER3A 2QIPA 3DGEC 1EWQA 3U4CA 4LISA 2J3QA 4LWPA 3WQRA 1W36C 3VR6A 3HU5A 4TKMA 3WFJA 4R8UB 2VHUA 1YI0A 4MW4A 2PH1A 4YBRA 5IHPA 3OMXA 1B6TA 2I3ZA 3HV2A 1XRLA 2OYCA 3H2YA 4X7MA 5KSZA 2ZRDA 1XTZA 2P9FA 5DT9A 3X1ZA 1N2HA 4P38A 4AUNA 2QMYA 2CXNA 4ZHQF 4XYMA 4I4TA 4PICA 3CSWA 1N5RA 4IY1A 1PFKA 4FMDF 3BFJA 2QZSA 2VJCA 1AE1A 2ACKA 3NVDA 2Y4OA 4JQYA 4D4MA 5SZJA 2I76A 3O47A 4BLVA 3FNEA 4FFWA 1THMA 1MA3A 1AQUA 1X6VA 1N4DA 2B8EA 1I2LA 1C8VB 3U56A 4JX9A 1QXSA 5ICSA 1TJ4A 1PT7A 2BRUC 3AOEC 3OZTA 4RZIA 3AF5A 4XQ9A 3QV2A 5EP1A 4Q7MB 5CG2A 1FFHA 3WICA 1XDNA 1MGOA 4COKA 2W0MA 4YR0A 2EKQA 1VBHA 1OLUA 4IUBS 2GHTA 1MZPA 2WUFA 3AEKA 1B6GA 4XLLA 1JSXA 3C3JA 3RRYA 1SKAA 3HA3A 2EJVA 2VPZA 5JW6A 4G85A 1EP3B 3T1QA 2DFKB 2PMZE 3SIRA 4BYGA 1KKMA 2ZT7A 2RGXA 4IV5A 4OQQA 5I8ZA 4XD7D 5TT1A 1SBCA 3RREA 4CEHB 2Y1LA 2GXUA 1KQNA 1ZHOA 5B57C 1KBLA 2QD1A 3NNNA 3GRPA 4OJYA 4W6QA 2UXDB 1WCIA 4ZDWA 1N5JA 3CR7A 1F2VA 2L69A 3VH1A 3QEAZ 2PUBA 4EAQA 1Y8QA 3GLHE 2JIDA 2Q1SA 4NSNA 3E81A 1BX3A 5C52B 4O1IA 5GIPE 1XBTA 4NE9A 1XNQB 2VQFH 1U9IC 4MKXA 1N2IA 1DJPA 4BVLA 4AMUA 5TPZA 3W78A 3EUFA 4IMJB 4BO2A 2YMPA 2LP4Y 4NCHA 1R0WA 4RF2A 1N92A 3I52A 5E6SA 4D8YA 4R7TA 2PDAA 1TM2A 4P4NA 4Q4DA 4V0RA 4C1NA 4PAQA 3D2BA 2V8OA 3BSFA 4UMDA 2GLXA 3JQAD 2PTHA 2GF0A 3GNLA 2RH9B 4Q8FA 1FCJA 4FI3F 5AKJA 2CNWD 2X4GA 5A05A 1HO3A 4OOEA 3BWYA 3LF2A 4B82A 1QX3A 3OA0A 2WOOA 4MKRA 1Q1AA 3BHMA 1UZMA 1D7AA 4RCZA 1ZSVA 2X86A 4R2LA 4X63A 2RHOA 1C81A 2IXTA 2WSSD 2ZJ8A 4ACAA 1T2EA 1UJ2A 4WKNA 2CZCA 1Y1QA 2AMYA 3UWOA 5A71A 4CM4A 2B8WA 4CLRA 3BM5A 2BKUA 1KEUA 2PBRA 1SPXA 1WB6A 4J2OA 5HIIA 1I7NA 4ZGGA 3P5BA 4L8WB 4DLWA 5K8CA 1YNOA 2WUDA 3VI3B 2Q3DA 3G9ZA 2J67A 3K9QO 3R3UA 1DKLA 2QUIA 3KE9A 3Q3HA 1E20A 3R0ZA 4O4IB 5CX1B 2CSUA 2C1EA 4RF5A 4MOWA 1AB6A 2Q9UA 5B2FA 2HD4A 4KVAA 5FLKA 4R1UA 1ZH8A 2CNUA 4P8RA 4HSEA 1A9XB 2IBTA 1KZ6A 4BP8A 1XTBA 3WIUA 5P21A 4WSOA 2FOLA 2V4ZA 4MW0A 2GZSA 4P4SA 2OFXA 2GQSA 2CK3D 3CYFA 2JFYA 5IWAB 4F85A 1RACA 4E5UA 1PR9A 1AKNA 3IVCA 5G41A 3OFSA 4MXDA 3GT7A 4JI4B 3ER6A 5EE3A 5EJIA 4IMPA 2OYRA 4FMCB 5BNZA 1DAEA 3ZC3A 3VPHA 1WV0A 4ED7A 3V5NA 2PZJA 1QK3A 3V33A 1T0HB 4HF7A 4OM8A 2VPWA 1K7FB 3VHXB 5T6BA 4PNZA 1YKGA 1HX7A 4I5FA 4ND3A 5LU9A 5C34B 3EZ9A 4KXLA 3FR8A 2HHFB 2WABA 3D0QA 4G37A 1OLXB 3DLIA 3QX7A 4EY5A 3WSVA 4TS1A 3EB9A 3JTEA 1P19A 2HT1A 4G8DA 3WNQA 4UBJA 1X7ZB 2WF7A 4BX8A 2O8NA 3CLTD 3C8HA 4OBXA 3PK0A 1KPHA 5K0EA 5F77A 4L02A 4BY1G 4CEHA 4JT4A 1H2WA 4H27A 4WNCA 4EW6A 4D7AA 3HH8A 3HUTA 3IKTA 4AKTA 4MQ4A 2CYAA 4CLDA 2ZBGA 1C9MA 1DIOB 3FWNA 3R44A 2GN9A 4GBGA 4WNYA 3ABRB 3TB4A 1MZBA 3RRNA 4FSHA 4KH1A 1XTIA 3EODA 3MWEB 4Q7KA 5A5DA 1IYZA 2EL9A 1RP7A 5E1BA 1MEEA 2R751 2P0YA 4ZICA 1E9VA 3H75A 1X87A 2P78A 4AZVA 4HTAA 1TYAE 4MJXA 3KPJA 4EYEA 1Z37A 3A7EA 1JWBB 2GFHA 1VYTA 2XCLA 4KQ9A 3Q72A 1QBKC 1FRVA 2X5OA 3HCOA 2R3SA 1LLDA 1OIXA 1Y63A 1OAOA 3GEEA 3E1GA 3IUMA 1RQGA 2P11A 2FSSA 1WW3A 2Q4TA 3TRDA 1UBRS 4KV7A 3TNJA 2XZOA 4OQYA 4M0MA 3EYAA 1ZI6A 1VM6A 4CLHA 3KHUA 3M6IA 3FMOB 2AQIA 2EZUA 4P4UA 2BTEA 2FWPA 3UK2A 4Z0HO 4JEHA 2R1TB 4GRIA 1I10A 1DELA 4PQGA 3B9PA 5KPJA 4ZOLB 1VP3A 1KJYA 5DGTA 3V7YA 2BTOA 4CLXA 1UCFA 1MH1A 2QW8A 3B51X 2D59A 1HQYE 4O4IA 2GO1A 2BKEA 4G4JA 1VE3A 2VEOA 3I4MG 3GC6A 2GBLA 3MAAC 2GEDA 5AT1A 3C3EA 1GGMA 1JFSA 2JLVA 1A9XA 1ADGA 3KSRA 2VJNA 2WFLB 1EI9A 5CK4A 5DULA 1XNGA 1UXKA 2O14A 1KJ9A 5A2QW 2BSAA 5DHUA 2A94A 1CX9B 5FX2A 1JEYB 3R5TA 4Y1RB 2UXBB 4FNGA 3H8VA 1MCZA 3E2MA 1DLJA 1FMLA 5IJAA 4R3UC 3H2JA 3D31A 3GJ7A 2NU6B 3S2UA 1YI8A 3FNHA 3KZCA 2O8EA 3CA8A 4QJ4A 3QYFA 1GTMA 4ZJZA 1L1EA 3K6JA 2FSPA 3PQ3A 5CYGA 3AIIA 3QXXA 2OQRA 4YRBA 2A9PA 2AXEA 3C6YA 3VHXA 2VYND 2OE2A 3QKSB 3BZBA 2HC9A 2HHFA 1EFDN 4QOIA 5BNTA 1ZMOA 5JBQA 4MLPA 4N12A 4WMLA 3WGVA 2QDXA 1TKAA 4X7BA 4QOEA 5CCBA 5DI9A 2C5GA 3CUEF 4JLMA 1Z62A 1DJNA 1G19A 1OU0A 5EE5B 2PGAA 1JAIA 2WZCA 3TY5A 3DAAA 4K6NA 1MNAA 3AKYA 3N86A 4BNXA 4GYJA 3Q6IA 1TW3A 3RB4A 4TMWA 5AQEA 3A6KA 3OURA 1I5RA 1W36B 3O90A 2YWVA 1RKUA 2BI8A 3SXUA 4Q1CA 1JXQA 3ZHBA 2FRDA 4RTRA 4ZYUA 1ILWA 3RAPR 3H4VA 2AEJA 5AKYA 3RH0A 3K9BA 2BHRA 2IHBA 1AF7A 2BD0A 2QY9A 4JL6A 3MWEA 2DUUA 4B4KA 3IBGA 2WQ7A 3L46A 2JHCA 2FSGA 2X5KO 1Y5MA 3FHCB 1S96A 4FDVA 4BO4A 3TIGA 5D1NA 3COWA 2J5RA 5H02A 1VPLA 2G7MC 2E55A 3WJAA 5GY7A 3LAWA 4JI5H 5HE8A 2RGVA 1IBCA 5CDSA 5J4KA 2R8JA 4EG1A 3J81k 2Q1TA 2YJZA 4LC9A 1R5NA 2YXPX 2D1FA 1UBKS 1W2GA 3T4XA 2B3DA 1VI2A 3SYTA 1KJQA 3VAYA 3JV7A 1V7CA 3CR3C 4JVSB 3WMWA 5HZMA 3ZGZA 1BMFA 1W88A 4PYLA 5AOAA 3AW9A 4AWAA 3SK0A 3LMKA 2O7NA 3M6AA 3U62A 3FH0A 3QMWA 3UUGA 3SF8A 5L9XA 2HLPA 1MT3A 2R1TA 3IUSA 5FWAA 2Y6VA 1UJBA 2JIMA 4GYKA 2H0AA 3P9ZA 2IIQA 1U04A 4ZVOA 3BRWA 2Q6KA 3L07A 4DLTA 3UZBA 4PGMA 2X4IA 3NHUA 1EFRA 5AYVA 4WT7A 2V7QD 5ALJA 2IZOA 3HCRA 2XWBF 4IS3A 4YC7A 4F72A 3ONVA 1X15A 3DONA 1CF2O 4R05A 3BRQA 2C4MA 3HS3A 3ZQUA 2WFLA 3LO8A 1UQTA 5TVGA 3MUEA 2PMKA 3ENKA 3TW0A 1H2AS 5H68A 5JOQA 5SZKB 3CGWA 3KTOA 3HWRA 1DNPA 1VGQA 5LOVF 4L4YA 4M8IA 1MAWA 2B37A 1SR8A 2P6UA 5DG7A 2D5IA 4EITA 2XZTA 4NBKA 2ERYA 2XODA 4KXQA 4RB3C 3C5HA 3FFAA 3ASYA 2NU6A 3MFHA 2WYHA 1VBNA 4RKQA 1Z82A 1HRDA 4NTZA 1W48A 4EKNB 2V4MA 5BV8A 3QU2A 4Y6RA 2H57A 4HWSA 3T6KA 2ZSUA 1F0KA 3TB6A 5KJFA 3HUEA 1XZFA 4LXQA 4A8TA 3FHLA 1L5NA 1TO6A 3QKSA 1SKYE 1R3UA 3IQHX 3QWFA 4PC3A 1I4TD 5KFLA 1Y5LA 3ZWQA 2W4MA 2FMXA 1E79A 2ZUUA 2GN0A 5B6PA 1J97A 5KKNB 2FSVA 2FFHA 2QTVA 1SG0A 2X2FA 5DTMA 4QWMA 2FMTA 5CXXA 1UAYA 3SYNA 1Q19A 3U39A 3NHJA 1SN7A 1E3DA 3ANXA 3H1EA 2JLCA 4DCCA 1NW9B 3RROA 1YQEA 5AESA 4DV5B 2Z2XA 5LYJF 4ZU1X 3PEUA 1ONOA 4HX2A 1I7DA 4N48A 4HXYA 5JYCA 5EINA 5JPIA 4ARVA 4BAZA 4ZRDA 5I6DA 3AIMA 2HWKA 2EG5A 4CM1A 5HEKA 5I7UA 5JY6A 3IEIA 4EI8A 1M2OB 5LZ7A 1XLTC 3CH4B 3VPXA 3KQHA 3KAJA 1Q7TA 1P2TA 2I6UA 3LY7A 4D8TA 3TSOA 1OFGA 4RNMA 4DIFA 3N58A 1N3BA 4D1YA 4JLAA 2HF9A 1DAHA 1QF7A 2HQSA 1S89A 3QW2A 3WP1B 4GX1A 3IV9A 3FE2A 4GKKB 2YASA 1SZPA 1ZA2A 2PJZA 1P91A 2EHDA 2UVUA 4MW7A 2AMJA 4R8VA 4L4XA 2IT1A 1V1MB 1JQ5A 4DR7H 3LJKA 3IBSA 3W77A 4OY3A 2BRUA 4X1YB 3NBXX 3GRZA 2HR1A 2YQ5A 3I9NA 4J9VA 3M9XA 1ZHQA 4JV5H 3DE6X 2ZS9A 2OENG 2YWEA 2BEUB 4F3TA 1N75A 1WABA 3P0RA 3DWIA 2V6JA 4LZJA 3G5LA 2VPPA 3IFSA 1ZRHA 4IUCS 1SBNE 4J49A 3SJZA 4A9AA 1WLSA 3IJRA 4YCSA 5GJCA 3VU0A 1GGHA 5KWSA 1JA9A 3TAXA 2A14A 1CKOA 4NEQA 3MJVA 2KX7A 2DPHA 1ULTA 3DE2X 2ZE6A 3FTPA 1FSSA 4HS9A 4J8PA 3FDZB 1R8SA 5SY6A 3PQCA 2WHRA 5J5CA 2CXXA 5TB5A 1M6YA 4YMTA 4L8LA 3C4QA 3GFSA 2G7ZA 3DV9A 2R5WA 4B3CA 2IY8A 1U9IA 1RQXA 3IO3A 4UUOA 3GT3A 3HA7A 3WYAA 3GUVA 3W8DA 3MHTA 3QPAA 2CXHA 3EDYA 4XCVA 1II9A 1MQ9A 3T7SA 3H0KA 5CMLA 1WKBA 3AVPA 4ZCQA 1LBQA 4M0KA 3JZ6A 1W9MA 1BA2A 4PZDA 3BULA 2YMLA 1HUQA 3PQEA 1Y1RA 1QG6A 1KAEA 4DBLE 4GXNA 3N2KB 1PLKA 3P96A 3H3JA 2FETA 3QLVC 1OX4B 1O8CA 3PSAA 4F9GA 3QXJA 4OATA 5JASA 1RJQA 2E49A 3ZWDA 1PQUA 3V8VA 1YQTA 1F8YA 1HM5A 3UGQA 4GYYA 1U3TA 3T06B 1GJRA 1YOVB 5F64A 4CKBB 2ZUWA 5F1OA 4NYIR 5D3MA 3F2VA 4M0CA 1C4OA 2GYUA 1BXZA 1OA1A 4Z4IA 2GH1A 1P9NA 2PGJA 3VYVA 4TQ9A 3AR6A 1TTTA 4Q3AA 3T0FA 3PEWA 2YQ4A 4NV3A 4DB2A 1QLJA 3E70C 1UK6A 2WJJA 5K0ZA 3AFNA 3ADPA 2ZUFA 3GI1A 1U2SA 2CT8A 2ZE8A 3CVVA 5HIAA 1UJCA 3AJDA 1YU9A 4TL6A 4GGOA 1QYWA 4D0LB 4N3BA 5IVIA 3CUSA 3GHYA 1R16A 2JA6A 4BPBA 3ACDA 1WCMG 2Q5QA 3CE9A 3U49A 2VTDA 1GA4A 5GMOA 1FOEB 5JIBA 3LUBA 3NDPA 3EGXB 2QYTA 1S2MA 5JXHA 4KIUA 4BE9A 1HG0A 4DLZA 2WSIA 1I01A 4DWWA 2DFPA 3VR5D 1CUEA 2R2GA 4EYQA 4KPUA 3IXMA 3JPWA 2RCNA 1P16A 1FX0A 4IJ6A 2JI7A 4LUCA 4I99A 1PJ2A 3NAMA 5AJUA 3CLKA 2ECFA 4X1YA 3ASZA 4G5FA 2Q0QA 4PFJA 4R2IA 1E6LA 1TADA 2NQ2C 4LZZA 5JATA 4KTTE 3QFRA 2G4LA 4TRMA 3LQ4A 1CUUA 4LJ7A 5JROA 3R3ZA 3Q9SA 2BEUA 1OBCA 4CCYB 3MT0A 4YAJB 4G4GA 3LRTA 5EXXA 4FOPA 4P3YA 2ZSDA 3GLUA 1JAZA 3MTJA 2I91A 1FZTA 2EL7A 2C4KA 2YIVX 3GV8B 2RIRA 1W5SA 3AYHB 2NV6A 3IQEA 3V80A 5IZCC 4WKBA 4IYRA 3NHSA 3ND9A 5J2TA 3KYIB 3GJ5A 2X19A 5CE8A 3QVJA 3B5IA 3HXQA 4C2TA 4PGFA 2JVIA 1UPTA 4TSFD 4RQAA 1QO0D 1YULA 5G4KA 2OXIA 9LDBA 1LW6E 3RM3A 2C7OA 2HQRA 2GD0A 5FR2A 5F4BA 3B1XA 5IFKA 3AR9A 3OFND 2Q8PA 2Z58A 5K3CA 1N0WA 4A0SA 5AW9A 2CMHA 4V0KA 1VG0B 1VC2A 3ROPA 4HAWA 3N6VA 1JBEA 1PR3A 3U3JA 1VTKA 4Q7QA 4UOEA 1XPUA 1LLUA 3ESZA 5L4NA 2FG6C 4RHXA 1MQAA 3ZCXA 2Y1OA 3K8YA 3WHIA 2OSBA 2XA9A 1XDUA 4KQGA 1YRHA 3H0CA 2Y66A 4AX8A 1FXWA 3N2KA 5A06A 3GJYA 4YS6A 3CZAA 3D8UA 4UVGA 3IODA 2AEMA 2VQSA 4TXHA 1OX4A 5KBYA 1N48A 4HVLA 5F2KA 2MYUA 4G0MA 1M67A 2Z09A 4GIBA 4G9EA 3AIOA 1O5OA 2I4MA 2NADA 4Y6GB 3TEKA 3U48A 3WYDA 3MQFA 1QGOA 4CM5A 1RHRA 2GM4A 2Q6TA 3OJ0A 7MHTA 4OMUA 4PWYA 2HVSA 3A6GA 1Q2UA 1YOVA 3STVA 4F71A 3EDRA 1P2FA 4QTXA 1FFWA 5KWJA 2J7KA 2Z9BA 4HQKA 1S3SA 2P2CA 3PQ7A 1D5WA 3CLRD 4O4JF 2PGLA 2G63A 4RZSA 4ZXPA 5AVUA 4GICA 3L0YA 1KERA 2CN1A 2AV6A 1VJ1A 1P18A 3EULA 5CYPA 5LJLA 3AM4A 1RYRA 2JFQA 5KDDA 2NVOA 2PVSA 2BMDA 3USZA 3EUAA 1U2TA 1C7ZA 5IF9A 3WGNA 2DR0A 5JC8A 3HP1A 2IUUA 5F23A 4HQ6A 5FTNA 1QE3A 2DRIA 4M9UA 4O4LF 2VZ9A 4A93G 2C5HA 5JH7B 2EP8A 2FA9A 3PUVA 3UVEA 3NWJA 3W8NA 3EGXA 4YDQA 3W7VA 3PN1A 3MFQA 3G2IA 2QZZA 5CBPA 4O2AF 1WDWB 2RHRA 5CVEA 4TRRA 3EDOA 3U3KA 3W9YA 4Z4GA 4EZIA 1XDSA 2CUKA 1JDJA 5AHXA 3ZDXB 4JJEA 3M2PA 4RLFA 2DT8A 2EX0A 5CDGA 1DCMA 4MV1A 4IDFA 4EBDA 4L15A 4LCJA 3KDPA 1AUPA 1W0JD 2FPUA 3QJGA 3WIOA 1IONA 4CCYA 2I7CA 1OXTA 4YAJA 1L9XA 1EYZA 4HNAB 4HEHA 3IIEA 2HLNA 1FLDA 1NXTA 3UZOA 3OKFA 3WA7A 2FR1A 4D9GA 5SY4A 1XP8A 4GP7A 1N2JA 5LMNB 2VDPB 3AK4A 3KG2A 3LDGA 3TE7A 4BMOB 1YD7A 3HWSA 4I5IA 1BHJA 4E2XA 3DAHA 2TMGA 5EIOA 2KBEA 1F8XA 3F6BX 2IS4A 3ICEA 5BYBA 5L51A 3T7CA 2WKQA 2JKVA 3EXFA 4NZYA 5CNMA 2DU8A 4KVGA 1E7QA 1VMEA 4Z1OA 3UJBA 1P6UA 3AETA 2J6TA 2WMOB 5CPFA 5HCNA 2J41A 1BXKA 4B45A 4RGYA 2Q28A 2B4QA 2YIJA 1ICEA 2CNBA 1J8DA 1YBAA 4CM8A 1NU6A 1TZ2A 4G2TA 2VXOA 1XRSB 1PEKE 1H5UA 2ILVA 1EDBA 2C61A 1YB4A 3MCTA 1GZVA 4D9MA 4X8OA 4XQ0A 2GD1O 4CIWA 2VCEA 3DZ8A 2W8ZA 1AKVA 1RXUA 5K0FA 4P7GA 4MRMB 2WILA 3AP2A 1KPIA 2VYCA 2IIBA 4IIJB 3G6YA 1KEVA 4ED6A 2Z83A 1NVTA 5T14A 5AJHA 1U0TA 4MP6A 3OZFA 1CUHA 1JG6A 1I32A 4CF4A 2B7LA 4E70A 1DX6A 3G2MA 2DG2A 1QIJA 1EK1A 3VJLA 2QR3A 1HR0H 2BWJA 2XT9A 2E82A 4K46A 1ST3A 3LUKA 1KFKB 3QITA 1Z0IA 5MGBA 1V6AA 3OCCA 3PFBA 4G8CA 3KFVA 4BFSA 5G0TA 2BQ3A 3AZPA 5AW7A 4DMKA 5BWTA 1T8TA 3QF7A 3ZD6A 1SOWA 3ETDA 3U1BA 5I5YA 3URKA 1V3QE 4PFSA 4YLEA 3NX4A 4J16C 2NTEA 4KNYA 1AD2A 2L0XA 2H2AA 1DG3A 3KYJB 1PEYA 5JH7A 1NW6A 4FXPA 4BQFA 2HB6A 5KYWB 4N8DA 5FA5A 1QF6A 3V97A 1Z2AA 1T5BA 1OAOC 4EMSA 3GJ8A 4R7ZA 2QLBA 1SUEA 4BLUA 2HCTA 1AIPA 3UHJA 3AOGA 4DR3B 2WI8A 1AF4A 4H0NA 2R8RA 2Q5OA 1O89A 3A0UA 3FSJX 1R8QA 1JIVA 1NNSA 7REQB 1EJ0A 2O2HA 4M88A 1NYQA 1HI9A 3RBEA 1MX9A 1CW2B 4MHSA 2QTFA 2W7PA 3BIWA 1V39A 3NDBB 3FZQA 2QMEA 3FOAA 1XNRH 5TV2A 2D54A 3M70A 2V98A 3AXSA 1OW3B 4RL4A 3OFJA 5DCYA 1MJHA 1IXRC 3IV6A 4PHFA 1UXHA 4RFSB 1E3WA 3BIFA 4IRDA 1JJIA 1IG3A 3T3HA 5EFOA 2GR9A 2D4HA 3IT0A 4HNAA 4E09A 1E4GT 4GI3A 2JLRA 1C29B 2BUAA 5ADVA 3HO8A 3KWLA 2OLSA 4DCMA 3SVTA 2DECA 4QX6A 3HJTA 1JBQA 2O2JA 4UUGA 2QTHA 2YCBA 3HACA 2B9EA 2CEAA 3DULA 5IC5A 4AYBE 2JD0A 1XLTA 3RVQA 5LWHA 3BA6A 4MEBA 4EA7A 4CLOB 4OGLA 4RENA 1XXLA 2BZ1A 3ZHOA 1DO0A 4XIGS 3K0SA 1J00A 2O3JA 2XNJA 3CWZA 3GFFA 1RCTE 5DGAA 3ZIUA 1CXZA 1A98A 2A33A 1IBMH 2NO1A 5ADUS 1DGSA 5AI6A 1C2TA 1DC7A 4PPQA 4WXMA 2PT7A 4MGYR 3HEBA 2DR3A 1GKIA 3N8GA 4MQLA 4D44A 1ZN9A 4CR8A 4G3XA 4FOOA 3A3KA 2WR8A 3L49A 3WMXA 5KKCA 1Z17A 3QI7A 5A3QA 5G1NA 5FUBA 4MRMA 2XKAA 4E88A 2ZRAA 4IIJA 2XCRB 4P86A 1GSOA 1PZHA 4LXTA 5K0SA 3NC1C 1SIOA 1NYLA 1HE3A 4FFRA 1QDUA 2E4YA 2NVYA 3NJ8A 1CY2A 4LQDA 5SYNA 5U4XA 1J2TA 4A10A 3GIDA 3ZGNA 3HK2A 4KHPB 4BRSA 1JQEA 4Y2XA 3H5AA 3ZVLA 2CBGA 4QODA 4EJFA 4NZOA 1ONSA 5KFUA 4ROSA 4NYMR 3JWIA 1K3UB 3HBNA 2PS1A 1FRFS 2CXTA 3C3YA 3D5TA 4D57A 2YV4A 4RTJA 4WNIA 5EEGA 1QQ6A 4H1VA 3K0CC 3NOQA 1G5HA 1T5SA 2QQFA 1MB2A 2FEWB 4ZO8A 4KQ6A 3PDCA 4MR9B 3RSOA 2UYCA 3D1JA 3E8XA 2XGPA 1XI2A 3V32A 4B4WA 3ER9A 5EJAA 1G8YA 4RE5A 3KJHA 5JEEA 3LT0A 1MBZA 1R9TA 4P5DA 2YYYA 3ZE9A 1JIJA 5HW0A 1HDCA 3ET4A 1ORDA 3PLRA 5IMBA 3V00A 3ZGXA 1TMOA 3V46A 5CP8A 1U0LA 1L7BA 1BWPA 1XSEA 1E6CA 3T9AA 3CW8X 2EX1A 1P1BA 4GHWA 1RHUA 1I8TA 1ISRA 4DIDA 3ZWPA 7REQA 5HKKD 1TECE 1D2HA 2PMEA 4HGZA 2B8NA 3RIZA 3QLVA 4FKMA 4LYYA 3GUZA 1XKQA 2DBRA 4TTTS 3AVWA 4LECA 4HEJA 4YRTA 3U3OA 1NI3A 1E64A 2HA2A 2FHPA 3L0IB 4TYWA 5KT4A 1POWA 1L5QA 3F73A 1CDZA 1I7QB 4IWNA 1CDOA 2IS6A 1YUBA 3QUAA 1MVNA 4CYMA 3HXLA 4UZEA 5HPYB 4JI0H 2DWPA 2DIKA 3CPEA 4E3ZA 1HQCA 2JIOA 1P9RA 2CVZA 2VF2A 5BV1A 4QPCA 3TFOA 4BPRA 5KX5F 1CF9A 2CBZA 4A3EG 3NONA 3BA1A 1OD6A 2W9AA 4JSTA 3EG5A 2PQ0A 5ARDA 3ZX4A 2ZM6H 1F51E 3UXEA 5C2JB 5ER9A 1DX4A 3MRVA 1V4NA 2BI4A 3I9JA 4I55F 1KK0A 4EG7A 1CUXA 4B40A 2OT3B 3IR7A 1M1NA 2D74A 3UGTA 2DHDA 3PUYA 3SJAA 1OX6A 3I2GA 3U54A 3GPLA 3BK1A 3DZCA 1Q92A 3E53A 1QCDA 1TJ5A 1JEJA 4L57A 721PA 3JWPA 1H22A 4FBUA 4CLOA 4LXHA 3FPEA 3THWB 1O75A 1KBQA 5DK6A 1QMPA 3AGQA 2NZ8A 2LRHA 4D4JA 3PW5A 4F7DA 3P27A 3D8TA 1E0JA 2O2SA 4D8WA 1T4BA 2HG8A 2W2NA 3CLSD 3KLPX 1UPAA 4RMHA 2CVFA 4X20A 4FCWA 4PPNA 2WAYA 3Q9UA 3RUCA 2QUAA 4BLWA 2QQ5A 3LK6A 1WAMA 3S5UA 4Z49A 4N3AA 5EYPA 3ZY5A 3LZDA 2X0IA 2II6A 2ZBRA 4F6CA 3QE9Y 1TQ6A 4XX0B 1K75A 1W29A 3WK8A 3FPFA 2CMFA 5FUMA 3NYQA 1NG1A 4V1CI 1U8CB 3F9RA 1K6MA 3TEMA 2FWJA 4NPCA 4FFDA 2Q5CA 4YR7A 1TYCA 4XR9A 4L9WA 3WVNA 5LXTF 2I2AA 3H9GA 4H9GA 4LGYA 1Y3DE 1F2UA 3V6KA 5IZCA 2A35A 3S81A 2GSWA 2TECE 1L5ZA 2DERA 4R9RA 4HBGA 3FUXA 4GFDA 4QUKA 1K8ZB 3MSCA 2CDAA 3TS1A 2QVBA 4M1TA 1L7NA 1TTPB 1TJNA 4S1OA 2X8BA 4G1VA 5TPWB 1RQRA 3FTNA 1KU6A 1DUVG 3C6KA 2YX1A 2ZYIA 4LOLA 4NBWA 3UJAA 1ZVQA 3G88A 4S05A 1KMMA 2Z5LA 1E6MA 1NOKA 2JA2A 4MR9A 1A5TA 4B1FA 1O0BA 1XYVA 4ED0A 4PLTA 2J3EA 1DOAA 3LBAA 2BGUA 3JQ7B 4M1KA 1JKXA 4OL0A 5BP7A 2F67A 5HRCA 3FZNA 1GZ4A 5JXJA 2AMVA 3GG2A 3VNVA 1TUEA 4ZO7A 1RQ7A 5JD5A 1WO8A 1V0JA 3FETA 3CTMA 4MVJM 2XD4A 3JALA 3R0XA 1OV4A 1UANA 1JTFA 2WF8A 2E4WA 4IBOA 3HYRA 4OB7A 3I0MA 3D59A 3T7TA 4D74A 5CW2A 2C2YA 2VH1A 2YN0A 5KZMB 2WB2A 3SBEA 2J0QA 1K06A 3E2PA 1OA0A 3VNSA 1I80A 2J7PD 5I9MA 2QM3A 3AKEA 3LP6A 4LH7A 4H16A 3WR5A 4Q0YA 2O8FB 1NXPA 1RJPA 5ALUA 3DMPA 3TUZC 4EB0A 1CZKA 5DNDA 3WB9A 1BKDR 1Z0DA 3CF2A 2WT9A 1VJGA 2IWRA 2Y1EA 5JTUA 4DMRA 4AZSA 4RNNA 4NH0A 1ODTC 1V47A 4IWYA 3GLVA 4HQ0A 1TJ3A 2VRCD 1SUPA 1N2SA 1RJ9B 1K6XA 1YB5A 3AJEA 4Q6BA 1UT6A 1I36A 1Z4LA 3H84A 4EJ6A 1YIOA 3OWOA 5LQJA 3LRPA 1NMYA 4AO8A 1FTWA 5B1SA 2J0UB 2KWIA 4AP5A 3BL8A 2P2YA 5FWYA 3SHOA 1DCTA 2BIFA 1GUFA 2V3CC 2FG7C 5IK2A 4R6WA 5KREA 4YJHB 2YU9A 5EJ2A 3THWA 1XZBA 2C8JA 1XXHA 1XTQA 1DJOA 1D0IA 3OTWA 3PFFA 1RWOA 5BW5A 1W25A 1T3LA 1QJ4A 5CH5A 5HCUA 2C9YA 3Q4GA 1Q15A 1E7YA 2RBGA 4CMEC 1GSHA 2QZ9A 5JAOA 4LY0A 2OHXA 4E32A 3HM9A 5CA0F 2GAOA 3E84A 3WBJA 1GFSA 3DKPA 1UK7A 3GTJA 1XA4A 2R79A 3W0LB 4ARSA 4C6TB 4R81A 1L3BA 1RFLA 3HKCB 4ROTA 3DDHA 1Z6GA 2O2XA 4XX0A 3F8SA 2IHUA 1CJKC 1Q0SA 2ZI4A 3NBFA 3BCUA 1MOZA 2AB0A 1BXGB 1ZK1A 2XUZA 1LVGA 1PR0A 3DEKA 4GP6A 2Q3LA 3RWMB 3TPZA 4Q19A 4LCBA 1ESZA 4R8UA 1BDMA 4W5QA 4RYLA 2RI6A 3BG5A 1J2UA 3OLZA 1MO6A 1JHOA 2JHAA 3OLXA 5A5GA 5BVGB 4D92A 1Z0JA 3O95A 4M87A 1J23A 3WL7A 1LRJA 2ZANA 3UUFA 1HSOA 4QC2A 3KV3O 5BR4A 4ZVKA 5F3DA 3UAZA 3EEOA 5JLAA 5TPWA 3RVKA 4DV0H 4PPGA 4X62H 1FVIA 2HH9A 4I66A 3P52A 3KCQA 3DM5A 1Q17A 3L8MA 4TS9A 2FMIA 1P1FA 2C59A 1PWYE 1AK2A 3D5EA 3JQ7A 4AU1A 5KT7A 1KJ8A 2Q27A 2KS6A 2GQRA 2IOFK 2B20A 4J75A 1TRHA 2OK8A 2ZWPA 4YWJA 4ALMA 3VVBA 3A8TA 5IXYA 4J7UA 3VFDA 2ZULA 5TQ0B 6ABPA 3DYVA 3GVPA 2ZGIA 1D0VA 3URMA 3OJFA 4Z0PA 3WYEA 3GEGA 1SXQA 3FPAA 4EARA 4D02A 3DKKA 3PIDA 2E5LB 2QD5A 3S8YA 5EIFA 3BMOB 3F96A 2DE0X 4F21A 2H65A 2ZJBA 2J6HA 3A70A 3LQFA 4BU0A 2AXQA 1JG7A 3SQWA 3NXKA 1SUSA 4A6XA 5C35A 2O8FA 2O2ZA 4FN5A 4HQLA 2PUGA 3B20A 1JYSA 2ID8A 2M6SA 1P6XA 3ODGA 3WJ2A 4D0GA 4R1PA 4B7XA 4KE6A 1I1QB 4II2A 2D1QA 2OMKA 4A3JG 4NBRA 3GVCA 3LGAA 3OEEA 1UXGA 3QW4B 1D2GA 1GGNA 5J4YA 1J7JA 1QIKA 3HSKA 3PT9A 1MC8A 1NG9A 2FN8A 1RJ9A 3WK9A 1JIIA 3TOZA 2W0SA 1RHQA 5CBKA 8MHTA 4O7VA 5DG8A 4J16A 3DZBA 1KTIA 1SFOA 5E7IA 3KPUA 5J9FA 4PZCA 2J0UA 2EERA 4EFKA 3WK7A 2XUHA 1G9SA 2OWOA 2VUGA 5MF6A 3GGDA 4C4ZA 2X6RA 3FJ1A 3PNBA 1ETHA 4NMMA 5E3JA 4YJHA 4ZAFA 2Y9PB 4AMVA 1JQJC 2FJUA 3TM4A 4Q8EA 3GJTA 2BFPA 5FLXA 2VKQA 2PQ2A 3V6LA 2WWRA 1TUGA 1T9AA 4YMUA 4MKGA 1RR6A 4CKWB 4XDHA 5LBIA 4DAEA 1XTUA 4LHVA 5C53B 4RK4A 4A5SA 2XMDA 1DKQA 3GQBB 2GTIA 3CRNA 3OIGA 1UEXC 4JJ4A 4OQLA 3U4DA 5DWDA 2ZZNA 4C6TA 5BW4A 1DSSG 1NN3A 3HKCA 2IH4A 2BFAA 3NG1A 4BC1A 4LFCB 2IS2A 4FIZA 3KUDA 1QAOA 2C58A 5CX1A 2W83A 5KG6A 5FNZA 4E2YA 4NPHA 2Y1FA 3G2PA 2GM9A 3OEYA 5FI1B 3CY6A 1I1NA 1E0AA 5CVJA 4B7ZA 1VGVA 2AZXA 4OQXA 2H48A 3LW8A 5BVGA 4M53A 4KXMA 4Q7LA 4FE4A 3WMFA 4WJKB 1WCWA 4J4BA 1GNLA 1NF2A 2Q1YA 2ZETA 3UG7A 2Y1WA 3M89A 3HEAA 1SGWA 1KGDA 2CDBA 3I6MA 5JJKA 5FADA 2FZLA 1MJGM 1Z0AA 4RBNA 4MWTA 1FB5A 1H69A 2CF5A 4Z7NB 4FT2A 3VH3A 5CFRA 3IAS1 1NPTO 2V6GA 4ND6A 1P2UA 2AQKA 1ISGA 3NOXA 2V97A 1H42A 2Z2ZA 1XPOA 3D6JA 3C97A 1CY7A 1AMOA 1IXYA 4UVDA 2B69A 2WU3A 1PKEA 1UFQA 3D64A 1MB3A 2NU7B 5KFXA 1OLXA 2OMEA 3U7FB 2HW8A 4OQPA 3PYLA 2B0CA 3UOGA 5TQ0A 3UH1A 3LY5A 1X7ZA 4JV2A 3CPSA 2YMMA 1A8IA 3DB1A 2HZ7A 1D8TA 1D1TA 1TXGA 5JNTA 1SHKA 3E82A 4JKYA 4X90A 2NV0A 5KCZA 4D97A 1IK6A 1SRRA 3PUJA 1Y1VG 4LHEA 4IVPA 1NQXA 1GRVA 1NWCA 5LVAA 3E2IA 4K3UA 3STWA 2MMGA 4O4HB 1KY4A 4ZN6A 1VCOA 2WJVA 1Z26A 3QYAA 2RGWA 2C54A 3RASA 3PQ6A 4D8XA 2H2DA 4RYDA 2OA0A 4H18A 3A9VA 2RGAA 1K4YA 4D9NA 5PNTA 3INNA 4QDUA 3QXSA 2PBFA 1YDMA 3HMQA 1MDFA 4PLVA 2C5BA 2INGX 3NW9A 1PUIA 5I3CA 3K0CA 5K0CA 5GWXA 2ODPA 3Q6NA 4CJXA 1ZU5A 3SHVA 1OROA 3BMNB 4JHLA 3C6QA 2I2FA 3WA6A 4OJNA 3G6VA 4CIVA 4X6LA 2PZLA 1CF4A 2QP4A 2H92A 1HLFA 2IODA 4UDOA 3DEFA 4PM4A 5KPDA 3B1VA 3QIVA 3DMRA 2PT5A 1R9MA 2O23A 1IQ0A 2FR0A 3CX4A 4LJ8A 5AKIA 1NRXA 1FFXB 3A1NA 3K15A 4I6JA 1RE0A 3OCJA 1OH6A 5JCJA 4XGNA 4O86A 3A37A 3HM2A 1XZEA 3B60A 1R5OA 4PINA 1I50A 1KS2A 1Z2EA 1H2HA 3U0BA 3KLNA 4I3FA 2GJKA 2GEVA 3ETEA 1OXBB 1YCDA 3LTEA 4NXMB 3DWGA 4ZOLA 4IR9A 2WM3A 3RJ9A 1UJNA 3FOFC 1QQ7A 3RHSA 2FWIA 3BDVA 4RU9A 6PFKA 1G8AA 5I8PA 1FC0A 1I6WA 1YVEI 2ZRIA 5F1PA 1A04A 2FDCA 3T1NA 2DXIA 4RKRA 5TARA 2FX3A 4S1PA 4UNIA 1GQSA 1WA5A 2F1OA 5IBCA 2RGBA 1A7UA 1HXHA 2I7XA 3VU8A 3MCAA 4DSNA 4F4JA 4MWDA 1MQ8B 2D8AA 1JEYA 3E8SA 4POOA 3M1LA 2AI1A 4Y1RA 2CMGA 2O3QA 2K4MA 5LP6B 2FCAA 4BQOA 3LVFO 5HWSA 4Y7DA 2AW5A 4C0WA 2H1WA 4O7RA 4Z1MA 3KSUA 4B76A 1XMXA 4H3VA 4HFMA 1U65A 3MWGA 1KYIA 2GEJA 4URWR 4BNWA 1C0LA 4Q82A 3SOPA 1EXNA 4FNMA 2J30A 3QMPA 5EC8A 2R93A 3ZTTA 5LD2C 4WJLA 1T6NA 3C6MA 1TU4A 4IQ4A 3C98A 4FJ2A 4AUEA 1HE2A 4RX1A 4ZCPA 3Q7SA 3QKIA 4F2WA 3PW0A 1YFKA 5C7YA 1YR1A 1YVUA 3CC8A 2JGJA 3LRXA 4BO5A 2HJVA 3LOUA 5JJBA 3GFQA 5K01A 4DADA 4F60A 3WL8A 3OHBA 4CUJA 2GQ0A 3SGLA 4RIIA 1Z3IX 4DA9A 2CEKA 3DYIA 3TH5A 5KHLB 1JSZA 3C45A 1N9GB 5KQRA 2CHUA 4R0NA 3I83A 1H2YA 4O4HA 4UHFA 1ANKA 2MR6A 4Q3NA 1P1HA 1HKUA 1JJ7A 1VFNA 5HXAA 3S2IA 5KFMA 1X7XB 4CGZA 2Q0SA 3TR6A 3UJCA 4DXDA 2ZWVA 3O1LA 3SMQA 3I3SR 4QAQA 4HR7A 2JEJA 4YALA 2FCRA 1GG8A 4DA7A 3G6XA 3C3KA 3EIFA 1E6UA 4CMHA 5FJJA 2C2KA 3NVAA 5CDFE 1ZAYA 2NO0A 5IVPA 4FNOA 5F2NA 4YLGA 4EUFA 1O97D 1FDVA 1CYEA 1RRMA 1GYPA 3PVXA 2IE8A 2M6RA 2H5EA 5I48A 3DEYX 3N9IA 2ZE5A 2IEAA 5K8VA 3OQMA 4ZIRB 3U7IA 1KI1A 5AOCA 4E5KA 1MQSA 4EENA 4AFNA 3ZG6A 1ZD3A 5BNWA 1UKBA 4NK5A 3LKBA 2XI4A 3SY8A 1RWVA 2P5YA 1EUYA 1PZEA 3L7MA 3H7IA 4A0QA 3NDJA 2A86A 1H8ED 1ULSA 2RDJA 3PR4A 1NAHA 2QLLA 3BHJA 1LWNA 1N2ZA 5GP1A 4K0KB 1NJ1A 1T29A 3OCZA 2XNKA 2JEZA 1D2MA 5A02A 3UA3A 4QU8A 2K7ZA 1RWKA 2ATEA 1XMOH 1GNVA 4TZTA 2CXRA 1ABBA 1NW7A 3RJ5A 3JWGA 5ALGA 3IMCA 1GNQA 9ABPA 3PDIB 2CCGA 4GXQA 4IIUA 3QFFA 4IIFA 4O7TA 1EUCB 2PUEA 4X41A 2H1OA 3WGTA 1U2ZA 2HJ9A 3EC1A 4Q12A 3W6PA 3H9UA 1ZUWA 3GUUA 3AVTA 5LP6A 1DFGA 4ODIA 4XTCS 5TQJA 2OV4A 3AF1A 1O6CA 2IF2A 3MBOA 1HC7A 2P5UA 2FN4A 3IE2A 5LBTA 1AO0A 4YJDA 1SEVA 1KK2A 3I39X 1ZBQA 3DPUA 1ENYA 4MQMA 2GZ1A 1QYIA 4KQEA 4BNHA 1J49A 4JI8H 3GVHA 1L4HA 1GL6A 1DBSA 3GJXB 2FZGA 1BVRA 1OBDA 2OGZA 2R00C 3F7OA 4QQRA 4BKRA 2BDTA 4CMEA 3KR2A 2BHTA 4PCUA 3WL6A 4ZT5A 3KQOA 1A0OA 1L5FA 4CC6A 3QY9A 4ECRA 1J8YF 1FNSA 2JLAA 1PBTA 1DDIA 1Z33A 5DKFA 3IEKA 6ADHA 5AOBA 4ZCIA 2XYVA 2FLLA 3EQ8A 4XWKA 3A1FA 1L4NA 1YRWA 2QENA 2DWCA 1I4DD 1Y6RA 5D86A 2MU1A 3NWPA 2VUMG 2Y0SE 2BUBA 4O5OA 3ZCVA 1N9GA 5ED0A 3L2OB 4MGKR 1QZZA 4ECZA 4GL2A 3TLZA 3Q11A 2EZTA 2AN4A 4ZHSA 2MINB 1T24A 4W63A 2JLWA 4WOCA 1C1DB 1M2OA 4RPIA 1PG5A 3I0ZA 3ETNA 4YAFA 5JADA 3VHQA 1X7XA 4PTLA 3ZDBA 1DJMA 2ZIGA 4X66H 3BSYA 2A9OA 2CGEA 2QRGA 4HYEA 1TAGA 4CHTA 3RTEA 3GYBA 4G6ZA 3U7JA 2NMVA 4DT1B 1M6WA 1NUQA 4ZVTA 3RT7A 3K30A 5DXFA 3WSTA 3DS8A 2QE7D 1EVZA 2NSYA 4JXZA 3ZCTA 1EWKA 5KT2A 5GONB 3B2NA 2QXYA 5HRUA 2JA5G 3NCTA 4KLRA 1V1MA 1F8FA 5FTKA 1NBME 2VK8A 2PJRA 1TGVA 5KJ6A 3ZXIA 4QXMA 4Z51A 4N7MA 3FF1A 5ICCA 3M9LA 4P35A 4B2LA 1ONPA 3G7UA 2R6JA 4PHHA 3JU3A 4M0FA 2IDZA 5JJ5A 4MWZA 3NHFA 1NUHA 1TF5A 3KTFA 4M86A 2G71A 3L0ZA 1N8KA 1KPGA 5H59A 2LKDA 4FEGA 4ZALA 5CFPA 1W19A 3IHLA 4GLWA 3EMKA 3FYTA 2P2ZA 2GESA 1XZNA 2RHJA 1APBA 4BWYA 1I2AA 1ZJ5A 1WXDA 3N2LA 2KQUA 3FDZA 2XUKA 1E18A 1NBIA 3FGZA 4G1EB 2RH8A 1PFVA 2GHRA 1X1AA 3CRW1 2BBOA 1NQUA 3QLTA 4RTPA 2IF0A 5HM8A 5KS8A 3QVMA 4HB0A 3L06A 1A3GA 3MXTA 3HB7A 4PXSA 1E3IA 4NOLA 4P32A 1N3IA 4ZQHA 5CR5A 3C8UA 4UASA 4ZZIA 1E1KA 1EUCA 1W4BA 2Z02A 2G6TA 1W35A 1TE2A 2E3JA 1T9GS 3TLEA 1IUKA 3JQBC 1ISMA 4D6XA 4IJKA 3N2EA 2Z8YA 3TR5A 1V43A 1EH5A 4BL5A 4NQRA 4GYWA 1Z7YA 3BXPA 1KAMA 4AJ2A 3IHWA 4B3MB 2MHCA 2X9GA 2PX8A 4B2IA 3IAHA 4C2UA 2BJVA 4KVZA 2RG7A 1L5SA 3W5AA 3EVNA 2VBCA 5BW8A 1ACJA 4KLNA 3AM3A 4YP0A 4Z3DA 1CY0A 4CM9D 3R20A 3ZY6A 4RCVA 4LWZA 4E4TA 1BH6A 4BMYA 5BT9A 2FE4A 2Q2WA 1HNNA 4DW8A 4C7OB 2GB4A 2A5YB 1FSPA 4BFVA 1QRTA 3VH4A 3ORFA 3FDJA 5DTQA 4DV1B 2QTCA 4CKBA 3TDMA 4DNFA 5DLYA 2C96A 1QNLA 2WJWA 2PX2A 1BE1A 5BORA 5CG1A 3SHWA 3FCCA 2C35B 2GPTA 3P9YA 3OE7D 3PA6A 3QTBA 4C7XA 1KH3A 3QPVA 3PCRB 1SU6A 4LQ4A 3EWIA 4TRJA 3MJFA 5M34A 4KR7A 1YZFA 3EDQA 1J90A 1ZM9A 4OI4A 4BV2A 2LE0A 4IGAA 1U1CA 2MINA 3WADA 4FWTA 3FUWA 1AGYA 3LKDA 5FO1A 2XVMA 4R71A 4RVFA 2XOKD 1C1DA 3ZH2A 1DUSA 3H1BA 4HNVA 2AEEA 1L5GB 4BEJA 4BP3A 4PYQA 4QUBA 2WSMA 4AYBA 3FKSD 5FLMG 4EW2A 1SB8A 3OIUA 3T5MA 2Q1XA 4F8EA 3SBXA 4UM5A 4ZMBA 5I7RA 1IHUA 2CWWA 2FUNB 5EZ5A 3CW9A 4NCAA 4MA5A 1MVOA 1KDTA 2YJ3A 3TJRA 4MP8A 1EFTA 3E5NA 4C3OB 1S2DA 1B8VA 1BG6A 1GKLA 3VR2D 1PK9A 4FHZA 3GLGE 4EH1A 4KFCA 3IKLA 1B93A 3H8JA 3C87A 1O8BA 3KFXA 3GIWA 4E0BA 1SVIA 5LD2B 3NALA 5KG4A 4HXEB 3O9VA 2RONA 5JR3A 2XCTB 4Y98A 5K6AA 3THSA 2NP7A 5HK9A 3HUUA 3HJHA 1JPUA 3WGHA 3ZPXA 1LVUA 1JSCA 1P4SA 4ZT7A 4Y3UA 1Z22A 1FFYA 1YRLA 5AKXA 5KFSA 1OFVA 3GUHA 4P22A 1UBJS 3S1SA 1E69A 2OKCA 2UUPA 4JUDX 4BLOA 4P92A 1HOTA 1QG4A 1K5HA 3K05A 3UENA 1DBRA 2W98A 4TV9B 2Z57A 1JIXA 2YNMD 1IPEA 4FCCA 1X1QA 1HOXA 4Q9HA 3I6QA 3O4GA 4PONA 1BX0A 1OWOA 2W6JA 1PT5A 2HDKA 5GADl 4LRWA 4TYMA 2Q7XA 3W04A 4G81A 1LF0A 4ECTA 1O5TA 3Q0EA 4N1AA 4L5AA 2QN2A 2JA7G 4F12A 2WU0A 4JA2A 1K68A 4ND4A 3ZLJA 5JUWA 1E9SA 2P68A 4C6SA 4WINA 4R5MA 1KYZA 3T1VA 3WLHA 3H18A 4BFLA 3I9OA 3IQFA 4C76A 2Q6LA 1WDTA 4HB4A 5E9WA 4I6EA 1G64A 3W8RA 3L0CA 1FQOA 2RBEA 3GJ4A 4AZWA 5LLSA 4M36A 2JEGA 1KE2A 2YVKA 2RIPA 4AS2A 4PTYA 4MZDA 5G02A 4JLUA 5LA6F 2ZPUA 3BA8A 3VKFA 3CO0S 1LI5A 4DQLA 4BV3A 2J0EA 2QMUA 2Y0CA 2ZE7A 3RAXA 2VHWA 1U7HA 4OFZA 2OY0A 1II0A 2QOEA 4EGQA 3OHPA 5K3FB 1U1IA 4ZI5A 3BBPA 4I8XA 1G2IA 3WGYA 3E3AA 3QTTA 2P3SA 2GHQA 2RB5A 1G8SA 3LHKA 3OUZA 3FOWA 3KKQA 3CHYA 1TLTA 3RRFA 2OHHA 4WZAE 2O0MA 1WG8A 3ZCUA 3HTXA 3GLHB 5AQ1A 4BXOB 4TS3A 5JI3E 3NIGB 3OZBA 1N2CE 2DY1A 2Z6UA 4IJUA 4LIPD 3EX7C 4DM3A 1PQ4A 1VPEA 4M3NA 4FD2A 1X14A 2C77A 4C4PA 1QIGA 4WVLA 5B4VA 3U81A 1I6MA 3RUAA 1RC1A 1EJ2A 4KLCA 1F6BA 1GA1A 2DOKA 1XIVA 3QX8A 3T41A 2WTNA 4YQFA 3RC8A 2WYWA 2HLHA 2AUNA 4JFAA 4KR6A 1OXSC 1CY1A 3W6UA 5KFJA 1VDMA 3CS3A 2B92A 1ZEJA 1M9NA 2AJDA 4YK7A 2WTFA 1USKA 4MV6A 3B5JA 4M2LA 3SZLA 1CQZA 3M6LA 1COWD 2HMAA 1GTG1 1V8ZA 3L9XA 4TMYA 3SDSA 4EGJA 3OPNA 1CE8B 2GLTA 4CT5A 3R9XB 5CB4F 1ZXXA 4DCOA 4F96A 1XKXA 1JEAA 4D80A 3KZNA 2C9MA 3KJZA 1J0EA 2W8BB 3H9CA 1ZC4A 3OLYA 4K9SA 5C4IA 3BRSA 4AYTA 4LTDA 2QXTA 4DLAA 4QDZA 4D5EA 4YCBA 4C2BA 2BZSA 3X1JA 1EM6A 3PFWO 4LH6A 2AG1A 2GZHA 1ZUIA 4BRZA 1N1EA 1KJWA 4N18A 4M9RA 3OPYI 1ZA1A 2GEKA 2HIAA 4S0ZA 3DEAA 2G9UA 1BQ4A 3K70B 2BFCB 1MPTA 3LT1A 3LV8A 4HXFB 2IBMA 1BMQA 3NRBA 1U28C 3GY0A 4TV9A 4L5JA 3THRA 3QZ8A 1U8UA 3BF7A 4PV7A 4CF5A 1L8QA 4H7EA 4ZEMA 4BIMA 2D5AA 1GFZA 3EPLA 4ENPA 1PFQA 3S29A 4TPKA 2JFXA 4PRLA 1JFFB 1ZK2A 4LGVA 4E6EA 4DQVA 1BROA 2OG1A 3UXMA 3KR9A 2H7CA 1VAJA 9LDTA 3WOVA 3VZRA 5KVVA 2QT9A 4C4SA 1CJUC 3TTVA 3Q7IA 2VP4A 1RRFA 4R68A 4RUCA 2RD2A 2YTZA 1ULHA 1L0BA 3IRVA 4FQ8A 3QM1A 1NVKA 1UNNC 1UFRA 1TTQB 1VJCA 1X92A 2EDCA 4FC7A 2ZUBA 2AFHE 1E2KA 1I2DA 3MW8A 4XGQA 1PL6A 4ZU3A 1SQ6A 2IHTA 2Q2VA 1ZD8A 2O6LA 5KG1A 3TOCA 2XB2A 4UD2A 1L5LA 4L51A 1HT0A 1JR4A 1WXFA 3BJMA 2PMZA 2QQGA 3TLAA 1SUAA 4QOFA 4D9CA 3RSHA 5FJ8G 3RR2A 1Y1LA 1WX1A 2BDUA 5F7ZA 3I5YA 2PUTA 4AQDA 5ICGA 1NJSA 3TQHA 5EJ9A 4Y9UA 4QM6A 2A7XA 1JDUA 2GZ2A 4IYJA 1JAHA 1CYDA 5C81A 4ENUA 2YJ4A 4FW8A 4OKNA 3GLHA 1HRKA 2DX7A 2VL7A 4F06A 1UK8A 5C7OO 4OFWA 4ZDJA 1R6VA 3LHDA 5K6RA 2FPWA 3MPUA 1RYMA 1BKSB 3V8BA 2X14A 3E1SA 4BNNA 1IN4A 5D7NA 5FTJA 3EEYA 3IVAA 4V39A 2V0NA 4C89A 1KSGA 1YZQA 1RPNA 3G0OA 1XMVA 2Q4RA 1UF9A 4EFMA 1Z6AA 2QRNA 5KYWA 1K2WA 1F4VA 3ZNNA 2BFWA 3TQTA 2NUPB 3LGXA 1PJSA 2G0AA 3P9RA 4DBLC 3I0NA 1DT3A 2GETA 1IPHA 2V74B 5MN4A 1SIUA 2NO6A 4JC4A 1OGYA 2GNOA 4UUPA 1UZAA 4ZQCB 3FHTA 5KFEA 2ZB4A 2QLFA 3AEXA 3H05A 1C8KA 3IPYA 1FFCA 5FAXA 3DBIA 2P9BA 3RE1A 3CF6R 2W8BA 2ZW9A 3T34A 1LS1A 1JDEA 2R00A 2VA9A 1OU4A 3CVZA 1ZWLA 2VSYA 3G5AA 2NU8B 2ZR0A 1UFKA 3O2QB 2XIJA 5LZ8A 2XCUA 5FBKA 3FWPA 2FPKA 2CD9A 4UNNA 3FI9A 2ZSIA 4BNUA 4RFSA 4D8VA 3P4YA 1KMHB 3TTWA 3U4IA 3DTFA 4BZXA 4DV3B 2GZDA 3AHDA 3BXGA 2C2HA 1U0HC 4W7HA 2EQ5A 4Q47A 2VIIA 2R47A 4RDCA 4X95A 2X2EA 1JR3D 4OAPA 3OFVA 2VHZA 4J9RA 4UXJA 1Y4AE 3A2KA 5K3SA 2XXAB 3E9CA 5TGZA 1K08A 2JEOA 3KJIA 7ABPA 2E1RA 1Q0HA 4M9QA 2MYTA 4RD6A 4M55A 1JFFA 3JAKB 2AD5A 2QJTA 3NYIA 4LHZA 3H87A 2XF8A 2VS1A 2R92G 5ES4B 1PNRA 3U9TA 1C0IA 1PL8A 3Q3IA 3OM9A 4UJ3A 2XIQA 1AM4D 1MX3A 2I6FA 2WA1A 3TMYA 1WBJB 3ANLA 5KQGA 3RVSA 3KEQA 3WDMA 1HDIA 2Z8ZA 3S40A 1IHDA 1ZMRA 5A0VA 4R8MA 5JYBA 4CEIB 3VKGA 4Q9DA 1QCZA 1BN6A 4JITA 5K03A 4YHHH 4PHTA 3O0DA 3VPCA 1GPJA 1C7JA 4KXXA 1Z8NA 4AMYA 1ZC3A 4F38A 3RVJA 1Y5IA 4B33A 5AXDA 3BCSA 4PZYA 2IOQA 1B43A 4HNTA 4E03A 4AN4A 1F38A 2POQX 3NGMA 4KV9A 4IRCA 3E23A 1R0BA 4QWCA 2HPHA 1O5IA 1RAFA 3CSDA 1NN0A 5KFAA 4BVEA 4PCLA 3KEMA 5HMMA 4C0KA 4NBTA 1NMZA 1ODIA 4HEQA 3OOHA 3AL0C 1RAAA 4LNAA 4LX0A 4BDSA 2ABJA 4LK3A 4RACA 3HJRA 4Y6SA 2XA2A 3II6X 4YRPA 2GKOA 5JE8A 1UBMS 1JR6A 1QGED 4FLFA 1CY4A 1UP4A 4R8LA 4DNXA 5L1KA 1LV8A 4Q16A 1IVNA 1XD9A 3RU9A 3HABA 2OVFA 3NAGA 4LF4B 2VHXA 2F2TA 2ZJFA 1CSEE 2IEGA 2Q5EA 2ZT8A 3OTOH 4HH4A 4BLSA 1Z5UA 4DGQA 1O08A 5MN5A 1NT4A 2XYRA 1ISFA 3C5CA 5CCDA 3Q8XB 2G9VA 2EBWA 2I66A 1SCUB 3JQBA 4Z8XA 2NUPA 1JT9A 2QI9C 1R9GA 1CUSA 1DC8A 5M04A 3AHCA 4M1SA 1HMPA 1MVLA 4YMWA 4JI2H 3G8BA 3ZDZB 3I34X 1R4NB 1J20A 1GU1A 1U3FA 3GJRA 5AK3A 2ALJA 2BR4A 4U2EA 4OBBA 2B78A 2ZUTA 4A23A 3ZU2A 5TDHA 1WUYA 3R7SA 1M1UA 3MCZA 1ISIA 3I2KA 3K1JA 4P84A 1RWPA 3WWOA 1L7RA 4EJMA 1ZUD1 2WP0A 2Q4DA 3UEOA 2H1FA 2NU8A 1QR2A 4D0NA 5B4TA 1AURA 4QUGA 4ESVA 2M9MA 5C8ZA 5KVCA 1UBUS 4HAVA 4TWRA 1WL8A 3K0KA 4JODA 3M2TA 1FX1A 2OUKA 2RAFA 5L3SB 2EU8A 1CZOA 3PFCA 3WLAA 4DQ0A 2PKCA 5B55A 5ECGC 2CNVA 2QP9X 1AY0A 4TZ0A 5CA1B 2DPGA 2FEOA 5DVZA 3R7BA 2QM8A 1U2GC 2WKRA 3SX0A 2XXAA 3EUWA 1EB8A 3L1UA 2Y1DA 2CLFB 1TEVA 1KF0A 5LP6C 5FUQA 4JB3A 3ROXA 3GJQA 3JAKA 3HBFA 2FOIA 1MC5A 2I6TA 3PRJA 2FW7A 1ULUA 1TJPB 3R76A 5LYYA 2OCYC 1AC5A 4F9TA 1I2MA 1ECGA 2JGDB 2DABA 3FROA 3N8IA 1SIWA 1E9DA 1QVZA 3TAHA 1Q12A 3KQPA 3I58A 4CEIA 2H9YA 3PNYA 4PYKA 3CX7A 1SKYB 2BOVA 2IFTA 3CF4A 3RHTA 1QQAA 1MX1A 1VKOA 5JMWA 3DL7A 1XMJA 5AWFC 3VAZA 5EWLB 3R0JA 4XR4A 1A9SA 1AZWA 3Q40A 3GRYA 3WQQA 1WZ2A 2A5FA 5K0LA 4CQMD 1JQBA 1LPOA 2DLDA 4MV4A 4N76A 4PG7A 2WM2A 2Y99A 5JARA 1H23A 1XKLA 2E48A 5CT6A 4EEYA 3STHA 5JQGB 3M4NA 2G83A 2VWQA 2XNHA 2B2XA 3K73O 2M05A 1L7PA 2Q3EA 4BZZA 5T4HA 3KHTA 4B4UA 2V1UA 4QJFA 1Z8HA 2C5AA 1KYXA 3FUCA 5KOYA 2C97A 3IAXA 2F64A 4L28A 1J5PA 1T6XA 2V7BA 1CEEA 2ZYAA 5K0NA 4E2ZA 4DL4A 4KPGA 1LFDB 4GC5A 4HAZA 3NUQA 3C0FB 4EHJA 3GTPA 3H3XA 2PRIA 1Q7CA 4MWEA 2REOA 1CLUA 4XJVA 1RC8A 3X1KA 3ZTYA 2ZRCA 1OXVA 1P4RA 4G0WA 4LSAA 3WLNA 4Q15A 4D4GA 1N25A 2A8YA 2GKSA 1PZFA 4TTSA 4ARUA 3M9NB 1R6UA 3LM8A 3V8PA 4YMSA 4H3KB 2R7ZG 2A0WA 3N0TA 2C2BA 3W9SA 4UQOA 5GOZA 4BATA 1SCUA 3AVXA 1G5RA 1J1UA 4Z3OA 1G66A 1CQPA 2QSJA 3WRWA 3ZXUB 1HH4A 1TAUA 2H52A 1YTUA 3H83A 2IXGA 1GFWA 4D9IA 2HQ1A 4DPKA 1UPCA 5KJEA 3RK0A 1AJEA 2SCUB 2B63G 5EMHA 3WC4A 5T3UA 1KSJA 2GRJA 1JHMA 4FBGA 3U1VA 1HYGA 2K2QB 3NT4A 2WMDA 3VOBA 4D81A 3CB4A 1G8KA 5JYDA 3OZUA 2QNRA 3HN7A 3ZGVA 4RGVA 3HR4A 3HKZE 2HNAA 3FVVA 1UBHS 2W2XA 3HY3A 4LRSB 1KO4A 4RPHA 3UT5B 3OF5A 3CU5A 5KWEA 3BQ0A 2Y8EA 1US8B 2F17A 5FP0A 2J33A 4O2BB 3H0GA 4YGXB 3ZJ5A 3UIEA 5L3SA 5DF1A 4CVNA 3HDHA 2Q3CA 1RAGA 1PT9A 4RA6B 1Y1SA 4DEXA 2IRWA 4MKIA 4HB2A 1I1LA 4KACA 1H9BA 5CA1A 1GUZA 4KIJA 1VHJA 3OQBA 1NQAO 5JJCA 1OMOA 2BLLA 3DFUA 3M49A 4ARZB 4JP1A 3WKAA 3N7UA 1DRWA 4DJ5X 4YP5A 4GL4A 1DCFA 1LPSA 2EX4A 1ZKDA 3EPIA 1G38A 1NLUA 3O83A 2JGDA 1EXMA 3T0IA 1LWOA 1JIHA 2Z6VA 1O58A 2OHVA 5H3LA 3D6NB 3G9TA 5JS7A 2VOEA 3GJXC 1KRWA 3H2IA 3QVTA 5H82A 4CL8A 3EFEA 3NGDA 2ZOSA 1Q95A 4D6YA 1PLJA 1IXKA 1M76A 4C5BA 3QPWA 2Z8XA 1U2RA 5ERYA 1EWRA 2IPLA 3W9UA 4K7JA 1V6CA 3QX3A 1MX5A 4D0SA 3GX1A 4UULA 1QAQA 4UHJA 1CULC 2CJXA 1L3IA 3W6NA 3F6CA 5T8KA 5C1BA 1GN9A 2FW9A 1BXGA 5JQGA 3V1KA 1N56A 3U7GA 1N2OA 1F9AA 3RGGA 5C1DA 1UKEA 7ADHA 4QDKA 2WAAA 1JIKA 2VQEH 4FLEA 1PGPA 1YJQA 2JNWA 3FUTA 1V9LA 5HF9A 1IOLA 4E4YA 1QK5A 5IDYA 4NAVA 1XEWX 3K4PA 4MS3B 3DEJA 3OIVA 1U28A 1L8XA 3GCDA 3H5LA 5EG5A 5FA6A 4QWAA 2W2KB 1PQWA 3LXXA 1SBQA 3C3BA 1P3JA 5EQJB 1JNYA 3EZGA 4DV4H 1L4YA 1LLCA 5IG2A 1CP2A 3B3FA 3HNOA 1KQOA 1XL1A 4I19A 1QM5A 1RAIA 1HDEA 4B09A 5KFCA 3FLMA 2AOWA 5DMHA 1TZMA 4QFBA 4N6NA 4O5AA 3QENA 1JAXA 2R8EA 5DGCA 4NX2A 4YJ2B 3PQ4A 2P2GA 1TK9A 4BBRG 4GS5A 5E2BA 5IT5A 3OQHA 4W9MC 4UQPA 3AP1A 2QVYX 1RJDA 1V2GA 3B48A 4GUAA 5CDFA 1TF2A 3OQVA 1AKEA 1KYWA 4L75A 4DJAA 5K6AC 2CFCA 1LLQA 2GS9A 1N8NA 3RBAA 1FK8A 4G97A 4RK5A 4ZGWA 3LWDA 1G6HA 2AG6A 1KJIA 3HCAA 3JXEA 1J8QA 3V4OA 1CUYA 1OT3A 3BMOA 4X7PA 3I6ZA 4H08A 1CUDA 1T1GA 2ZDQA 2YV1A 3AINA 5IT9W 4LRUA 2CUNA 1ZHFA 4BBZA 4EECA 2ZS8A 1IBKB 4INOA 3HVUA 3LVRE 1NFFA 5DMXA 2PS0A 4EHIA 3H4BA 2C5FA 1GOTA 5J40A 2AWOA 1I94B 3OQ6A 4XCQA 4MYDA 3UT5A 3P2KA 4Q9NA 1VCIA 3Q12A 3WZ2A 3CTPA 4O2BA 4XDZA 2B4RO 2HSJA 1ULBA 3L7KA 2JFPA 2UYYA 4RA6A 1KP2A 4H1UA 1RXVA 4J91A 3JPYA 2ZQZA 1ATIA 2YQZA 4P36A 4LJSA 3ZGYA 1CZHA 2GXSA 2HSEA 2OOKA 2BDEA 3UBMA 2GARA 3BKXA 4ARZA 2UVDA 2XT6A 2IYTA 1JTVA 3PRKE 4R2WA 1G21E 5JD4A 3KQKA 2QM0A 2A1HA 4DM4A 3RRXA 4WKCA 3L7IA 4MROA 1GPWB 2AE2A 3HWWA 4QDTA 3RC2A 4FQ7A 4P4LA 1CQJB 3VTKA 3ETCA 3RSZA 4EYKA 4LYAA 4L5CA 1JLMA 3RJZA 3EXIB 4C0QC 4CKWA 1P61B 3HOWG 5CIWA 4YRRA 3U3RA 3WTCA 5AVXA 3GQBA 2O3UA 2WM8A 1IPFA 1CJTC 5HDBB 3ED5A 4DV6H 3ISJA 3AEYA 3ETJA 1OXXK 1MO5A 2DTEA 1E2BA 4KN8A 4L22A 4QICA 3E5RA 5EVCA 5CCXA 3ZXSA 3DUFB 5J59A 1X3SA 3RJ0A 4MS3A 4E31A 4NLGA 2DHCA 1KBOA 3EW7A 4KTVE 5HX7A 4K6OA 1EBFA 1ZUNB 4LJ9A 4NBLA 4RIGA 1XD8A 1GRNA 4K81B 2YR0A 3IURA 1YR9A 1P5FA 4ARCA 4OLAA 3HI6A 4Q9AA 3I9FA 3RUDA 4L85A 4GC9A 1C3OB 1OLOA 3BDIA 2VT3A 4ND2A 1N6OA 1KVSA 4JI3H 5A4DA 4TQSA 2LKCA 3O74A 2IZ0A 1T0BA 3JD2A 1DHTA 1U9JA 3GLGB 4F3YA 2UZ1B 2C31A 2EP5A 1OUMA 3QF4B 1L7OA 3DBRB 3VHRA 3BVPA 3RS8A 5KNCH 4P3OA 2L19A 2GFIA 5CPBA 3AVOA 4P98A 2NU7A 3ANMA 1V6SA 3VR1A 1NBMA 1QP0A 5FO0A 5JQWA 2WBLC 3M4ZA 4CW7A 5FPTA 4NE7A 2VTBB 3LUGA 1AUOA 2QL9A 3I5AA 4ALIA 1G6KA 3P45A 4BUZA 5FOTA 2MCTA 3JZMA 4N8EA 4JI1B 3GXBA 4F4CA 2H1CA 1Q83A 3WQBA 3KJXA 2VLBA 5K2MA 5B12A 1FUKA 2HK9A 2ZRGA 4FUTA 2HA3A 4PX9A 3C4VA 2OO5A 1S0OA 3NWBA 1LB1B 3R4VA 2R8YA 1J1IA 1NKTA 1QO7A 3VGPA 3MQ2A 3FYCA 5EUBA 2VA8A 5IN5A 2ISCA 2HA6A 1FFBA 5EJ8A 1T0IA 3SSOA 5JBNA 3QUQA 1JHXA 2HDOA 4JV1A 2BHLA 1YACA 4Y67A 4U0KA 5CXUA 5EKUA 1RPJA 2CZQA 4RK0A 3WI7A 4AICA 3GLSA 3BMNA 1TLLA 3INTA 3IQXA 4YDRA 3LZ6A 1ZCBA 4O02B 4NRDA 3U4AA 3CO5A 1IEXA 5KB3A 3RHZA 4Y2HA 3V7WA 4P54A 1VSVA 3KJGA 4LYDA 4DL9A 4TTRA 2W4QA 3HSSA 5L53A 2CLEB 1ZINA 4MVJF 3AUYA 4G0ZA 3WQHA 4YR2A 4YPVA 1PSDA 1CQJA 1FFXA 2I33A 5G0UA 4KE7A 3WKEA 1XMQB 3EXIA 4E3WA 5K4HA 1WP4A 5FOQA 1GQOA 4MDEA 4QRHA 4FGLA 1Y1WG 3TYXA 2PEYA 3L92A 4IO1A 3W8FA 3LQYA 1MRZA 3G0CA 2FUG6 4O7SA 4FHFA 2P3OA 2BW0A 1JKFA 4GSYA 3ZLUA 1XK5A 2VDQB 2G5PA 2WMNB 3CRMA 3KJEA 3FFWA 1ZZGA 4LV6A 2HBZA 2HKIA 5F1YA 3UM9A 4DQKA 3RVRA 1N2CB 2IYAA 2Q5JA 2A88A 3IVXA 1F06A 4JKOA 5JZOA 3DUFA 2C92A 1FVXA 3TFWA 2AG0A 4YH1A 1BAPA 3A9WA 3S7TA 1U2GA 1ZUNA 1Z5NA 3CRRA 2HBRA 5FAKA 3GARA 4B3XA 4P7KA 1NE7A 2ZRHA 1XMPA 3RG8A 4HWTA 3M6WA 1FJHA 2X41A 4YR3A 5GAJA 4O3NA 1A9RA 1BD4A 2C8LA 2Y2UA 3TMAA 1QFJA 3OG9A 1CBUA 2GWHA 4L4SA 1TCCA 2GT1A 1OKKA 3F7MA 5FBQB 4LMRA 1LEHA 5IS2A 5E7QA 4MUGA 3GLGA 4BTLA 5E7MA 1D2AA 2AXNA 1DRJA 3DBRA 1P0QA 3UJPA 3K8QA 2NZVG 3Q98A 4LGMA 4JBIA 1J25A 4DV2H 3RI3A 3ZQKA 3BRCA 2OL4A 4P34A 2YHAA 1ID8A 1Z36A 2X9QA 5IFLA 2VTBA 2NV2B 4M1YA 1OI2A 3SEZA 3TQSA 4F45A 5BWUA 3RIGA 4R1NA 2DUNA 4YMGA 4UU7A 1USUA 1BHO1 4PZ7A 1QGUB 4FYMA 1RXWA 2HEGA 4N7RA 3K70C 3PNQA 1K9SA 1UQRA 5HS6A 2P6PA 4ASUD 2VT6A 1N9KA 1Z6YA 1V2HE 1SG9A 2IUYA 3BXEA 4DOMA 1QIDA 4PW0A 3RPEA 3VSCA 2PX4A 3W3ZB 4RQTA 2JFVA 1IULA 1GG2A 3H4DA 5JFGA 1FFSA 4RNCA 1E63A 1M66A 2A9JA 1YHNA 3ZUGA 5KNDH 4TWBA 4ENVA 2FFAA 4AG3A 3ZHCA 5DQHA 5LM3A 1XO1A 3NKVA 2FZ5A 1MRSA 3GPDG 2DH6A 4DWVA 1SM4A 2EW2A 5C4MA 2HWXA 4OX9Y 5DYYA 5CFLA 4RF3A 2W93A 3B3GA 4OQDA 2JFGA 3UICA 3AI1A 1SZCA 5DHPA 1LPAB 1Y3AA 2WJZB 5BQOA 2J4FA 2OKGA 3F47A 1WCXA 1GNSA 4EB8A 1EQ2A 5KU1A 1YFJA 2DCMA 5D85A 5DX8A 2C2DA 3QQMA 3WNBA 4ZYLA 4GMFA 2C4NA 2RI1A 3HT5A 1GRQA 1IBLB 1P31A 5U4QA 2AFHB 4TLCA 3ZDAA 2I4IA 2R11A 4ED8A 2QN3A 2YRXA 3VC7A 4ZIRA 3R7AA 3PVCA 4JYAB 4YRGA 2Q5FA 1DDGA 3P26A 4WZBE 3BC1A 4FYPA 3L04A 2JA1A 3K8ZA 3M6VA 4TXNA 4FN4A 4Z7JA 3TOSA 4F2GA 1XJQA 4BRUA 2C4HA 1QBGA 5BWCA 4GEKA 3K0EA 2Z6QA 1B0AA 2X0DA 2IW1A 1L1RA 1N2CA 4PQRA 4RGBA 1HEIA 1GRCA 4JROA 4QE3A 2C99A 3PDIA 1XVTA 3UYYA 5GVRA 1XDWA 4UUBA 1QONA 4FS3A 5FKJA 3HXOA 1C1YA 1NJ5A 2O3TA 4RK7A 2GK6A 1W6RA 1VB3A 1GVNB 3UV7A 3CGGA 3RF2A 1TZKA 4W9NC 3FVTA 3W05A 1ZG3A 3NUAA 2GBFA 3AG6A 2RAPA 1Z0ZA 2UUOA 1RRCA 4UATA 1GIAA 5BV0A 1PR2A 3NANA 4L3OA 4YPFA 1UWKA 4PZ8A 2VNIA 1QDEA 1E77A 3W79A 2ZIEA 3IP6A 3SSMA 2ET6A 4TUYB 5E25A 4WQMA 2ETVA 1QPBA 4RSHA 1EX9A 1TIPA 2V7WA 1E7WA 1O9HA 1ZVVA 2A9VA 3FRHA 4QATA 1WXGA 3AILA 3HJNA 1PWXA 2GAFA 3DMNA 5LDGA 2GWRA 4Y2TA 5LNK6 1NMXA 1ELOA 3VTAA 2OCKA 2X5RA 2PYZA 2H2HA 2XX3A 2H2GA 3CT4A 2QD4A 4FFOA 1LV7A 2A67A 1QGUA 2Z5FA 1CC1S 3PNPA 3KKEA 3WYCA 1MP0A 3T5CA 2VDVE 4JGGA 3OZXA 4Y2UA 2VSNA 2AC2A 3G2OA 2N3ZA 4MI1A 3RRJA 4KU4A 2NQ8A 1X1SA 3CXRA 1KMIY 2I6SA 5H5JA 4ILKA 2CNQA 1YAJA 1E59A 2QUHA 3NNSA 3B78A 1SXJE 1F8GA 4X44A 1ZNXA 1G42A 3WLEA 1PT8A 1TVMA 4WCVA 4DJJA 1RBYA 4BJ1A 4LE1A 2H4HA 1GY8A 3TVDA 3G85A 1WSCA 4UVIA 4DL2A 4E2FA 3OZ7A 1U8ZA 2FPPB 2CHQA 3PXGA 3JRXA 4HRAA 3T3GA 3R8CA 4DA4A 2VA3A 3AHHA 1U7ZA 3W1VA 4PYMA 2CW8A 1S2IA 4DT1A 2XUAA 1C4WA 4LY3A 3IN5A 2W22A 3OIDA 4LI3X 2J5XA 1Q7BA 4HJXA 1UBEA 3G23A 5GONA 3X1DA 2PPLA 3RVDA 1MPXA 3SP1A 2CCKA 2LCQA 1LQUA 3KC2A 4ZV9A 4JV0A 1XEFA 5G4LA 3ZX5A 2F8MA 4E46A 3TINA 4Q9JA 3DZHA 5IULC 2A9FA 2AZ4A 2PWBA 5LPNA 3NMUF 2PMFA 3RTBA 3U19A 4HHEA 4PSKA 4PVCA 4F1WA 3ZVMA 1RLMA 1QHEA 1Z07A 1XD2B 4OHOA 3W90A 1RWMA 3IMKA 2C95A 3OQJA 4IIXA 1U8AA 1MEOA 5FPQA 4QKQA 1JPJA 1VKRA 1OZFA 2PSHA 4NNJA 3DTNA 1MTZA 1NP7A 5FBHA 2VSFA 3T1TA 3F6PA 2QHXA 1GQQA 1KNQA 1ODKA 2JFHA 1J70A 1G7RA 1WW8A 1R3DA 6CHYA<