1GSHA

Structure of escherichia coli glutathione synthetase at ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
296
Chain Sequence
b'MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutathione biosynthesis ligase
total genus 101
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1gshA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1gshA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gshA01
4HNVA 2R7LA 2W6QA 3K3PA 4QSHA 4MV8A 4XX0B 3VA7A 4Y8VB 1E4EB 3JZFA 2VHEA 3R5FA 4O4LF 3G8CA 3HBLA 3U9TA 5I47A 2R7NA 5JQGF 2GQRA 2ZDQA 3TIGA 2XCLA 4DIMA 2CZGA 5HBRB 4IHJF 4MV4A 3NUAA 2DWCA 4MV7A 2DLNA 5J2UF 3MWEA 2W6ZA 3ORQA 4C5AA 5CA0F 5KX5F 4GGMX 4O7VA 1VKZA 3WO1A 4WBNF 1A9XA 4HQ6A 1KJIA 4NYEA 4M99A 2FPGB 2R84A 3VOTA 3MWDA 2NU9B 4YB8B 2R7KA 1GGOA 2DZDA 2R82A 1JKJB 1BNCA 4ME6A 4O7SA 4FFRA 2W6NA 4EA9A 4O86A 2R7MA 4FFNA 5BPHA 1W93A 2W71A 1ULZA 4MA5A 4O4JF 5LOVF 1EUCB 4O7TA 4YJ3F 3GIDA 5K2MA 1WR2A 2R6FA 1B6SA 2YZLA 4M98A 3BG5A 3JRXA 3WNZA 3QFFA 3N8DA 4IZOA 4M9CA 4E4TA 4EAAA 4MV9A 2NPOA 5FNVF 4YJ2F 2W6OA 5JH7F 3K5IA 3ETHA 3VMMA 3ETJA 4FFLA 4M9UA 1BXRA 1VBHA 3N6RA 4MV6A 2NU7B 4O7YA 1CS0A 3G8DA 3Q2OA 2ZDGA 1OBGA 1A48A 4L1KA 4XZ3B 2GPSA 4HNUA 4O83A 4IWXA 4FU0A 4MAMA 3V4SA 5C1OA 1KJ8A 2SCUB 5C8YF 4IWYA 3R5HA 4EA7A 2DIKA 3MJFA 2YZNA 4O7RA 5HV6A 4C5BA 2R85A 3JZIA 2GLTA 2IP4A 2WYOA 2V58A 3R5XA 5LXTF 1UC8A 2PBZA 5BMVF 5LP6F 3E5NA 3BFPA 1OBDA 2YW2A 3R23A 1Z2NX 2QK4A 2CQYA 5C1PA 5J2TF 4O2AF 1KJQA 2CNVA 4O4HF 2NUAB 3LWBA 5CB4F 2X0SA 4EABA 2YL2A 2GPWA 3KALA 4FFMA 3BSWA 5KKNB 3KREA 2YS7A 4FGRA 5D8DA 2YYAA 3TW6A 3UFXB 1PK8A 3BSYA 4HR7A 4TV8F 4EA8A 1PX2A 2YZGA 4O4IF 1SCUB 3ORRA 2PN1A 2VR1A 2HGSA 4O7WA 4I55F 2FPIB 2FB9A 1EZ1A 2YZMA 3VPDA 4IIJF 4YBZB 4DLKA 1W96A 2FPPB 5CA1F 3V4ZA 3HB9A 3LP8A 1C30A 3WO0A 4O84A 2OLSA 2W6MA 5JVDF 4EGQA 5LA6F 2I8CA 4ZOLF 4EGJA 5BPFA 4O82A 2W70A 3U54A 1GSHA 4FFPA 1KBLA 1AUXA 3AW8A 1C3OA 1CE8A 2C00A 3VPBA 5GONF 2VPQA 3RV3A 3KAKA 2PVPA 1JDEA 2ZDHA 5DMXA 3TINA 4I50F 5JVLA 1JDBB 5IYZF 2NU6B 2VQDA 2YRXA 2YRWA 1KUTA 1EUDB 4TV9F 4XYMB 1DIKA 2CNQA 2I80A 4YAJB 5CAEB 2R87A 1I7LA 2QF7A 1EHIA 2HJWA 3U55A 4FE2A 5LYJF 4O2BF 4ZQIA 4ZHQF 4EG0A 2YS6A 1T36A 2V5AA 3TIIA 3OUZA 4MV1A 1KC7A 4FFOA 3RFCA 1B6RA 2W6PA 1M6VA 1IOWA 3KAJA 4O81A 1UC9A 4RZQA 3U9SA 1DV2A 4ZI7F 2I87A 3VPCA 1KEEA 1KJ9A 1M0WA 1E4EA 4MA0A 2GQSA 4O7LA 2NU8B 1VBGA 1Z2OX 5H80A 3BSSA 3OUUA 4XYLB 2Z04A 5JQWA 1DV1A 2FP4B 2Z02A 1IOVA 4I4TF 3TQTA 4WD3A 2J9GA 3GLKA 4C5CA 2V59A 3RUPA 1JLLB 3AX6A 4O7NA 2XD4A 3R9RA 4O7ZA 4MV3A 3HO8A 3Q1KA 3SE7A 4J6EA 3JRWA 1CQIB 1Z2PX 1GSOA 3I12A 1M0TA 1GLVA 3K5HA 2R86A 4HNTA 1EYZA 5EZYF 1KJJA 1AUVA 3RV4A 4TUYF 3DF7A 1GSAA 1CQJB 4YAKB 1I7NA 2P0AA 2CNUA 2YWVA
chains in the Genus database with same CATH superfamily
2ZBPA 3GMIA 1ZCAA 3G0CA 2XGOA 4GI7A 5HKKD 3ILSA 3HE3A 3TPFA 4EW3A 5CDHA 2V6BA 3RTAA 1Z06A 3JX9A 1TAUA 1P62B 4OQPA 4CCWA 1OZHA 2EIXA 1N3LA 5TEWA 3WC4A 2AG0A 5A3RA 1IJEA 3LT4A 2W2LA 1AUOA 4LYGA 1GRQA 4LHVA 3E9YA 3LKVA 5KFNA 4KW7A 2IEBA 1A9XA 3L7MA 3ND6A 1XJWA 5TE9A 3VH4A 3JSNA 2ZWIA 1GGOA 1YVUA 3VDQA 2XSZD 5AI6A 5L3QA 4O2RA 4U7FA 4DCTA 2ZJFA 1RLUA 1GQFA 2WT4A 3HCEA 5D3ZA 1GXSA 3MD9A 2O48X 4DKXA 5IDWA 1I3CA 2EZTA 2QY9A 1NU8A 1QX4A 4M22A 5BORA 5EN4A 4L3OA 4H31A 1NVFA 2JJYA 4IFEA 3HC7A 1V9PA 1OXSC 5CLGA 4TXMA 3OIGA 2UUBB 4RANA 4LS3A 5EG5A 5DHUA 1T5DX 3RE1A 1Y5NA 1WB9A 1YS2X 1P4AA 4RS3A 5A62A 3IPLA 1ZGHA 3S99A 3MS2A 2VTDA 4Q45A 5KS8A 3QF4A 3IDSA 1RM4A 1OWPA 1YWGO 3BGWA 4CL0A 4JJ8A 1UOPA 4ZREA 3G0IA 4W8OA 3MHTA 3KZKA 1C80A 1EK1A 1IMJA 4UXIA 5EJ9A 2QYSA 3J7TA 5CFPA 3WJ2A 2J5XA 1NJ5A 3HM2A 3WOHA 4ENPA 4NCNA 2RHOA 3G2PA 2Q46A 3PPYA 3OF2A 2XDAA 4I1RA 4PYIA 4LHXA 4ZVQA 4PGGA 3I72A 2O2HA 1S7CA 2QD2A 2G5GX 1W6UA 3THXA 3KNZA 3ICWA 4KB5A 5TNXA 1SG6A 5KFZA 2IPLA 1ZGCA 4I3GA 4IXMA 1NXQA 4S35A 3Q3CA 1UOEA 1RBZA 3KJQA 3JVEA 3GLFA 1P2BA 2HCJB 5L7TA 2V97A 2AF4C 1MEOA 2YWDA 4F8EA 2DFKB 5JYDA 2WIGA 2XGSA 2HA7A 2JAHA 1YDMA 2VP6A 3DTFA 4YMVA 1IXKA 4NS1A 1KZHA 4Q3CA 2OP1A 1Y5MA 4HLNA 3GRRA 4IKPA 2JA2A 2QAGC 3EEIA 4W9MC 1LDYA 1DQZA 4H2DA 4O3SA 1JEAA 5JS8A 4UBIA 2AXPA 4JLBA 1BWQA 2C2HA 3UJ7A 4Q9KA 1V5IA 4CU2A 4RCNA 4HLUC 2E4ZA 4CKBB 4P08A 3JQ7A 2BN4A 2BGMA 4DLXA 1NXSA 1ZMXA 5HQ3B 3KO8A 4MAAA 1AMNA 3P19A 4PSVA 5AK3A 6Q21A 3G8BA 3QXJA 1C50A 2V0CA 3B6KA 2D4HA 3LU1A 3D6VA 3CVUA 2I3ZA 3T5PA 4OO3A 2BONA 1HR0B 1BFUA 5ICSA 4ZYZA 4WY2A 4DUPA 2RHDA 4NFLA 2I4TA 5FL3A 4IG9A 1MJFA 1CZKA 3WGKA 3JAMW 1U7OA 3UJHA 3OECA 5DIFA 2HRBA 3GZ4A 3OX1A 1YRLA 3VR1A 5DLQC 5EESA 4DA7A 5C81A 9LDBA 1ZW1A 3EIEA 3R9RA 1IBKB 1OVGA 3QY0A 4EA6A 3Q9UA 1MP0A 2AUNA 4TYWA 3CZ5A 4LOKA 3TXAA 2HVRA 4Y0AA 1LDNA 2VA8A 1G0NA 5H3CA 3HBAA 4P8RA 4UTVA 5BN4A 4ESVA 1GSAA 1Q1ZA 2PVSA 2PH7A 4CM6A 5FUMA 2CNKA 4HNVA 1W44A 2P9BA 4BBPA 3I34X 1JH8A 3DAYA 1PBNA 1FUIA 3PNOA 1IZYA 3RWBA 3AL0C 1FSPA 5JNSA 5BN5A 2ZPAA 5A3VA 4H17A 2JEGA 4FKZA 4QXMA 1L4UA 3RGZA 2NV0A 4B46A 1YFZA 4UE2A 2VNHA 2CZGA 4JVNA 5CCBA 2DQ4A 2X19A 4OGLA 2GWRA 1QBKC 4DL2A 4RDIA 1U9IC 2O6HA 4ESHA 4TKVB 2LVBA 2GZHA 5JWRA 2CVOA 4PQRA 2K2QB 4C3VA 4TLDA 4I36A 3PK0A 1EDDA 4YRLA 4KACA 4Z9YA 1G2WA 1DG9A 4UMFA 2Y68A 3GBVA 1LSSA 2VT2A 3CZRA 1FRFS 4MYHA 3E9MA 1L4GA 5CK4A 2ZAGA 4C0HA 4J9OA 1WLSA 2HEGA 5DASA 2HXGA 4G67A 2CC2A 1JIXA 3ND5A 3AUJB 2JLWA 3KJEA 2VIIA 3ZPXA 2CBGA 3W2TA 1CVIA 1U0BB 2PZMA 4OHPA 4JL5A 3LBIA 3S44A 4M9UA 5B37A 4CUZA 2YYZA 4EELA 1ONNA 2FN9A 5EIAA 1N6NA 1FNBA 1YVPA 4IDFA 5K8VA 1U5AA 4ECZA 4KBYA 4Y6QA 1TMGE 4ZO6A 1NG9A 2I03A 3E7XA 1NVWQ 3ZNQA 3VDRA 3L7BA 2NTEA 4EQ6A 2IHNA 2HV8A 1PG5A 5J4KA 2RK6A 2HNBA 4C5BA 3RUEA 4A5OA 2XB8A 2WFLA 4F4CA 1Z5NA 3L93A 4IXDA 5TQ2B 3B1VA 4ZI7B 3DE0X 4PC2A 1V1JA 3QJYA 5GJBA 3JSAA 1M34B 1Z5ZA 2V0NA 3MGBA 3IESA 3I39X 5FJ8G 4YWHA 2D2FA 3QF7A 5FPKA 1PX2A 1Q0LA 4YAJA 1Z5UA 1NAHA 1X7WA 3AP1A 3VR0A 3E9EA 4EWLA 1WB4A 1GZUA 4IRXA 4AYBA 4ZYVA 1CS0B 1TJ3A 4CV2A 2ZRCA 1OH7A 2G36A 2SECE 5F5LA 1DXQA 3K5PA 2F2TA 2H65A 1GZSA 4RELA 2Q41A 2WM9B 3WTBA 1II9A 4MQ5A 3SXUB 1KYQA 4JOSA 4MW7A 2RD2A 3T7RA 3PE3A 1DEHA 4CEIA 4JP2A 2RE8A 1I7PA 5FTWA 3QU7A 1L5SA 1D1TA 2PSSA 1GPAA 3TQIA 5CP8A 1KK3A 3I28A 4Y2JA 4D3DA 2F9FA 3FJYA 1SBHA 4OI1A 3W2EA 1O8BA 2G5TA 2Q3DA 3WZLA 3F8SA 1S3FA 2QF7A 4JYBA 2G4VA 1RP1A 4D5GA 4BASA 1NVVR 3WLTA 1F4VA 1HDZA 1WW2A 2BJVA 4G0PA 1JBQA 2Q5EA 3FY4A 3UQYS 1IQ0A 4ZKDA 4AI6A 1Y6ZA 3A3NA 1DBPA 1AY0A 2XMRA 2NYVA 4KQEA 3I6IA 3MS7A 1PQ4A 3C8DA 3OZWA 1XRMA 3CRW1 3L6RA 5C80A 1G6OA 1AO0A 3DNPA 1W30A 5TMBA 3RUAA 1YFKA 5AM5A 3K6SB 4ED8A 1XC7A 1HGXA 4GKAA 1KI7A 4KUEA 2QNBA 3RJZA 2Q3BA 5HBGA 1IHYA 1X13A 1CQIB 1Z16A 1ATIA 2DEUA 5KYTA 1A9SA 2HDNB 5E9AA 2VQEH 1CQJB 1EIZA 2M6LA 3I9FA 5E8RA 1IZZA 5SY9A 1E3EA 3FDZB 2E5FA 4CT5A 3DV0A 3ETCA 3RT1A 3VA7A 3D4PA 2GN1A 4OHCA 5DM2A 2BFPA 2Q6TA 3EASA 5AESA 4ZXFA 2EJBA 2RIPA 4QFCA 2O9JA 1D6JA 3ELBA 4L3VA 2VQFB 4P81A 2J6SA 5CT4A 2JBWA 2PUHA 4MV4A 2DBYA 1SOVA 3PUWA 3QFHA 1MB4A 2V7WA 1BD3A 2P2LA 1WABA 4FONA 1W48A 3EGCA 4XDHA 2AFHE 3ANXA 1K1EA 2KM1A 3A31A 4DMGA 5KFFA 4UJ5A 2R1TB 2GAFA 1RWVA 1YAJA 4GBGA 4NNPA 3NIFB 2P9JA 2VDJA 2QP9X 1VHQA 4WTOA 1XVUA 1YDGA 1N4AA 2WIJA 3ST7A 3LT0A 1JFFA 2P6NA 2H52A 2IYEA 3UANA 4LJ5A 1Z73A 4E2FA 1E1KA 4CLXA 1WCWA 1KMHB 5AI4A 2OP0A 4DREA 4YMUA 3CT6A 3KXLA 3JQQA 2HQSA 4UCQA 3TD6A 3I9MA 4TMXA 4Y9SA 1D2GA 1ISHA 3VOSA 4RAYA 5A7FA 4HNUA 1YCFA 1ZR2A 1XU9A 2I9KA 2X77A 4RPLA 3AXTA 1I1KA 4RSMA 2WMYA 4ZYYA 1LI5A 1SC1A 2WT8A 3KWFA 1N4DA 3INNA 4XWOA 2LGJA 2X8BA 4OJTA 4UUPA 4YASA 3EPJA 1JR3A 1VGQA 1ZMBA 4ZT4A 1HBJA 3PW0A 1Q12A 2DFLA 4PXSA 5BRJA 1ZYUA 4GM4A 2OAP1 4E5DA 2HRQA 2NT4A 1WCV1 3EAQA 3KQTA 1KP2A 1Q7GA 5DN6D 2ZIEA 4JYMA 2B8TA 3TNLA 4I1OA 3RVPA 5HSGA 4P4NA 1YB5A 2R6CA 2FPIB 4EAQA 3K9CA 3JTEA 4A7PA 2GVDC 4B3CA 1KO7A 4B76A 1S4MA 4WMLA 4KN5A 1LV7A 3SJUA 2JCBA 5ADHA 4BVKA 1LQUA 4YFYA 1N5MA 4MB0A 4HWPA 4K8RB 5IEBA 1KY4A 4TYNA 1NA5A 1XELA 1I1QB 1UINA 2Y93A 1HOTA 5KYYB 5JCJA 1WQ1R 1U2DA 3NBQA 2YOGA 5DMXA 2OHFA 2ECPA 2HPHA 4IPTA 5ERYA 3B1FA 2EF0A 4Y30A 1XNHA 1DVRA 2R62A 5JTUA 1KA9H 4PZZA 2ZEJA 3B3AA 3AT1A 2I7VA 1YC2A 4EHAA 1H2WA 4PBTA 4E2ZA 1DNPA 1V4BA 4JKIA 3IQWA 3C3XA 3GT7A 3TQ1A 4KDEA 2I1VB 4G8JA 3U48A 5K45A 4RMJA 3W7BA 4E15A 4DVJA 3AIKA 3L1KA 3STUA 1V9LA 1G9TA 2I87A 4BY1G 4IICA 3ZUGA 5CLHA 1NDUA 4H4DA 2JCSA 2BFNA 2YN4A 5B3JA 1JLKA 2OORA 3FFBA 2BR5A 4IGEA 4OUDB 5TJHA 4DQLA 3BB3A 1T9HA 1W0KA 2V59A 2WM2A 3GEBA 1CUGA 3B2EA 2FG6C 1Z6AA 4Y2RA 3GPCA 3DW3X 3FWYA 3OQNA 3GO4A 3ABZA 1VKHA 5ALWA 4F7DA 1GFSA 3IP7A 4UTNA 3DE3X 3HHPA 5DNWA 3IMCA 1PJBA 1RRPA 2MYPA 1XNQB 1JMVA 3IRUA 2XZDA 3COPA 3KJGA 3KZNA 2DY1A 1NP6A 2QZSA 3EIUA 3I6ZA 2E4VA 4BZWA 4LWPA 3EVAA 4HX9A 2I7CA 2VHEA 2JLRA 1HUQA 2W83A 4CEHB 5EJ6A 3T7EA 4EYEA 5J59A 2YXNA 5DI3A 3ANSA 5ALLA 4ITRC 1JF8A 4GBED 2JFYA 3I30X 1XVAA 1B2RA 4MGKR 2MDTA 5CIYA 1MV8A 3O8QA 4GOMD 4P53A 3QRWA 1ZLYA 4RQBA 3RRYA 3H0EA 4YYEA 1ABFA 3K8YA 5F21A 4KYTA 2UYHA 2RCYA 4N18A 1IDN1 4Y6OA 5JD6A 1L3IA 3GNQA 4IS2A 3FYSA 2K7FA 2D0PB 1IUKA 3IQDB 3CIOA 4ATNA 3N9IA 2I4OA 1W2HA 3MELA 1CY4A 2IDJA 1QGUA 5EIHA 3EA0A 1JXMA 4R9UC 1II8B 3SR4A 4WOPA 2FPGA 4M98A 4NULA 3MPUA 3A25A 4FZ3A 3CHYA 5BQ5A 4N5DA 2VJBA 3AETA 3M4YA 3CB2A 2PZAA 1L9XA 4OYRA 1U3GA 2JA1A 4HDCA 5JAPA 4O25A 2H2FA 2VCEA 5DNVA 4Q21A 3INTA 4RIEA 4RIGA 1I2LA 4ACAA 4LXGA 1F0PA 2HSZA 3SZ3A 2I7DA 4X61A 5L6MB 4UARA 2QZPA 1A77A 4ML3A 1VJ0A 3RGGA 1W2GA 1YJXA 1N32H 3UCXA 5AVRA 3U0BA 3SYMA 3DBVO 3UYYA 4ENWA 4TL8A 1VL0A 4ZJYA 2C35B 3RARA 2HTEA 4IOJA 4ECTA 3K2EA 4UTRA 2ZRBA 2WJZB 4LHEA 2Q5CA 2QVYX 3PHGA 4Q12A 4WN9A 1T10A 1J42A 2RAUA 2BKLA 4CR7A 4YY3B 1K7YA 3MT7A 5T8KA 3IN5A 4CQNA 2ZTSA 3AJ8A 3A28A 2R8GA 1VE5A 2ZAOA 4M4SA 1FFCA 3HXMA 3DT9A 4JSYA 3MOIA 3KHKA 3UHJA 4DL7A 5EJ8A 5E6UB 2GF2A 3DHYA 2F48A 4V3BA 4PZ6A 3EIOA 1WMEA 4RD4A 5ERGB 1QYXA 3GAFA 2WJPA 2YHSA 3EXEB 1FFSA 5FNZA 1BMFD 2DKFA 5IJ0B 1NG1A 1LTQA 4YJ3A 2PS1A 2YNMD 1UQRA 1NI4B 4MYDA 1JE0A 1M1YB 2C4KA 3TI7A 5CG2A 3IP3A 1YB1A 3LP5A 1JSCA 4YQYA 2CLFB 1AV7A 2G70A 1J1IA 4C9BA 1EAYA 4EI7A 3HL4A 2CWDA 2IYRA 4ZMRA 4O3PA 3TM5A 5A5DA 3LY8A 2X4LA 1T1GA 2AC7A 3GZNB 4BTVA 2UVVA 1DE0A 5EWMA 2HJWA 4OYLA 5DGBA 2IC5A 5KYUA 4KC0A 2H7YA 1P9RA 3DWIA 2BSQA 1IFXA 4FFOA 3N28A 3R0JA 4E0BA 4NBVA 4PFQA 3P9XA 3AESB 4XARA 3RHSA 3AU8A 3GCWA 5KJCA 1WP9A 3C14C 4QNMA 4PZDA 2ALJA 3K1AB 4R83A 2IEIA 3HBMA 4PGAA 1K8RA 2MINB 5AJVB 2H5JA 4DLLA 4CM8A 3K6KA 1I6LA 4KQJA 4A3MG 1GT91 2W43A 3V8MA 3Q2KA 4A16A 2A7QA 1GRCA 2ZTUA 4S12A 5HPYB 4MJ3A 5C8DA 1QH1A 1XE3A 3N07A 4TQGA 3NDBB 1FS6A 3ZTWA 3OUTA 3OHSX 2FAXA 1GPKA 4INPA 2VPIA 4Z4FA 4AS2A 4AUNA 1E6KA 3QHQA 4ED9A 3UJ6A 1AHPA 3EGXA 4B9AA 3IIEA 1FMCA 4QHYA 1WZCA 4PAQA 2DVMA 1QP8A 4TQSA 2EP7A 3COJA 2NADA 3IL2A 3MMXA 4AK9A 1NM5C 2G3YA 2X5JO 3S1AB 1N6HA 3S55A 2W37A 4O2LA 3WZMA 4GUDA 4MIKA 1PJQA 3ZUPA 4C06A 4LXHA 4G8DA 1GTVA 3EZLA 2EBUA 5IXSA 2AF3C 1ZOSA 2XT9A 3IYLW 4NBUA 5EINA 1Y6GA 3LUPA 2X40A 3UGQA 4M2LA 4OM7A 3KBBA 1RYZA 3WGYA 1WBJB 4HTFA 3EGEA 3PFWO 2X9QA 2ZK7A 5J58A 1MHPA 1C9DB 2BI8A 2N46A 4HDRB 2B1QA 1RM5A 5E4JA 4RH0A 1SG0A 3GTGA 1NHWA 1YR3A 3AM3A 5BOVA 5CGZA 1VTKA 4LDJA 5KSZA 4IDEA 4KVAA 4ZZ1A 3W5OA 3QUAA 3JTMA 3EEOA 4TN5A 3DTVB 3I9KA 1EFPB 1FKAH 4A91A 1E32A 1T2VA 1FUYB 2P6MA 4IQGA 1QPZA 3AUXA 3N2KA 4L28A 1JYEA 2R6ZA 1K8QA 5CT6A 1N2BA 3T5DA 1F2TA 4HEA1 1KJ8A 1FZQA 2B8JA 1NDHA 2R85A 2ONKA 1O0BA 5DW0A 5FFFA 1OW3B 4I50A 1UC8A 1B8OA 2PLAA 3GEGA 2XUHA 1SRQA 3GA5A 3H11A 1PG2A 1CJUC 3B13B 2WAYA 1WXWA 1YDEA 4AULA 1E9BA 3U4CA 4Z7JA 2QAGA 2YS7A 2ZSKA 3LS2A 3S8YA 2A9RA 4CLRA 5I9SA 4RF3A 3IAS1 2HO5A 4V24A 1OYOA 4GOND 4HLUA 2GVZC 4IINA 2QM0A 1RM0A 2EZ4A 4LV6A 1AS3A 1TIKA 2O2JA 4DLKA 1G7TA 2QI9F 2B3TA 4LF6H 1JVSA 3ZQJA 4QUKA 4JC8A 4X7PA 2BDUA 5LZ4A 4BAUA 3PFBA 4YRGA 1SA0A 4DR7B 2C2RA 3AJEA 4ED6A 1U2QA 2H2DA 5KT6A 1TM2A 3PNPA 4DM7A 3MT9A 2WHPA 2I5PO 3OX3A 4IQ0A 4RACA 4M0KA 2VTBA 1LA2A 5A4DA 5EZ6B 4M0CA 4XYMB 3VNVA 4RJTA 2F43A 2AJCA 3OF3A 1XR3A 2OXEA 1KY3A 3KD3A 5CFOA 4JYPA 5AI9A 5JMWA 2I33A 4WJKB 1NP3A 1M1NB 4JBXA 5KSWB 4BIIA 4DA9A 1XTRA 2X3FA 4UUBA 3W5VA 5JBQA 2X9VA 3H04A 4JI8H 2ZWAA 3CLHA 1NVKA 3T9CA 3H9UA 5JZ9A 4D4LA 1NC3A 4J91A 3RB6A 3OZXA 2RC5A 3PFGA 2HMVA 1IK6A 2PUJA 3VR4D 3PO3G 3GLKA 1A5BB 2VDQB 1TQDA 1U9IA 5KT7A 1ZBQA 2EP5A 4MKZA 3FHJA 3QQPA 1QO0D 3RI3A 4Q1AA 3MMPA 1PS0A 2UUAB 2QWXA 3VU8A 4CQMD 8ABPA 3FLAA 1DTSA 2A57A 4BVHA 3QZ8A 4G23A 3BT7A 3SQDA 3SM3A 2JCYA 1UFRA 1SVIA 4ZQEA 3FUXA 4TM8A 1ZJZA 2E4WA 3PA6A 5AHKA 1DLJA 3KIPA 2R6R1 1GCIA 1JHOA 1LNQA 2C1ZA 2WVJA 4B6OA 4ZVMA 1K7SN 2W2PA 1EMDA 2JGDA 3K20A 1VKRA 3O8NA 3FNBA 2FFAA 3HDTA 1J0CA 4C05A 3ICVA 2BKAA 5AW6A 4A6PA 2E37A 1AHIA 3HB0A 1CKNA 1V5WA 4EQ5A 4NBSA 1C4XA 2ZATA 4EPTA 4QDUA 3RYIA 1X80B 2BCJQ 2QT9A 2G1PA 1PJ4A 3F5SA 5DBIA 1GARA 1H6DA 2XNSA 4NAUA 5CVVA 5KCMA 1RRKA 1K08A 2VUMA 3R09A 2O7QA 3GFOA 2VA3A 3NRJA 3BRCA 1HT0A 4R84A 4O86A 3RK1A 2A88A 1UKAA 1PAUA 3VAYA 3OE5A 4WNYA 5KJ1A 4E5YA 5E0OA 1YJAA 2BFWA 1WSAA 1QIEA 3S4YA 2TMKA 5A7HA 4C1BA 3E9CA 2RI6A 1MEEA 4RY0A 4MRRA 5EP4A 1GNTA 1OZGA 1HL7A 2AB0A 4BNVA 3VJLA 5NLLA 1Z0AA 5AVVA 5AKJA 2NU7B 1NUQA 1E0SA 4PRKA 3QX3A 2C96A 4DWWA 3SIXA 3ZDDA 1ILWA 4FFBB 3KWJA 4ZVOA 2ZIAA 1XJQA 2B63G 4EG7A 5HX7A 4MW2A 2NVWA 2QGZA 1E2MA 4M60A 4BY7G 4K9DA 2DFVA 2PMBA 1SELA 4HH3C 3ROFA 1G18A 2PMCA 4E33A 3K92A 5E2AA 3T3MB 1THMA 3GCDA 3WY9A 2VNKA 2RGGA 2BGLA 4IFTA 4RAZA 2NO7A 5KFCA 2CBXA 2QY6A 3VU9A 3S2YA 3KJZA 4ARIA 4ECRA 5EMLA 3D1VA 1V5EA 3I1FA 5K6RA 1CLUA 3LG2A 4M6WB 1PGQA 2XGGA 4HZUB 3ELDA 4MA4A 1XEWY 1XYYA 1NLMA 1DJLA 3KQNA 1NASA 4GC9A 2FFRA 3E53A 4DLSA 2QROA 3RUHA 2XEXA 4QQNA 1TO1E 2FQ1A 4UBNA 3VYSB 5EE5B 2I6TA 4AN0A 2HK7A 3IRVA 1OXVA 4GXNA 2IDKA 4RVSA 4QNRA 2ZUCA 2VLIA 2YMPA 2VPSA 1T3LA 2LNDA 2JL1A 2W70A 2JH8A 4Z4GA 3SLRA 3RD5A 4J0KA 4U8HA 1T1EA 3QBJA 2PO5A 1GU1A 4EBDA 3ED5A 3JS5A 1ZRMA 2RHWA 5DTRA 2WKRA 1QO7A 2Q4BA 2G04A 1I2ZA 3GRKA 4J9PA 4I50F 4P33A 4UFPA 1JHPA 3WP1B 2LDXA 2HVSA 5SZIA 3SLKA 1I8TA 2PZLA 4PCUA 5IPFA 3OHBA 5REQA 3TL2A 3AKYA 2J45A 4B1FA 5CVJA 1VIVA 3SOZA 1P17A 1PHRA 5F4ZA 3K96A 2DHRA 3I4FA 3ZLJA 4R8UA 4TMYA 2H0QA 3EXIB 4LQDA 4RPIA 2YV2A 2BFOA 4L2IA 1SOAA 3PXAA 3N6VA 3HYCA 4QVKA 1RW4A 2GN8A 1UDXA 1LJLA 2EZUA 3KSMA 1BMQA 3R3SA 2IYPA 2H63A 1R0SA 1CKOA 1GKIA 3CH6A 3RYFA 2DT5A 4LY9A 2AG8A 1Y6FA 1Z74A 1DBVO 1NXOA 2OO5C 4F97A 1FF9A 4N47A 1G9SA 5L3RA 1VI6A 3HABA 3OFKA 2GHRA 4RUCA 3EW7A 5JZSA 3Q1KA 4NZPA 3HB4X 5E7QA 4E5MA 3KFXA 2XQIA 4KGZA 1VCOA 4TKUB 5JJIA 3EY4A 4CDNA 1PGPA 4V39A 3DE2X 4BFXA 3SXJA 1UADA 2Y0SE 3EWAA 1MR3F 3FN4A 1E7MA 3MR5A 2PH5A 3ORSA 3DB1A 1EUCA 2EJ0A 2W57A 1KEEB 4UU0A 3RC7A 5EXPA 4AIIA 1PFVA 3M0EA 4DSTA 2CZQA 3FCUB 1DELA 2IZ5A 2IXTA 3W5HA 3B7WA 3IV6A 3IAS6 4HN4B 1XCMA 3VVMA 2P4HX 4JN6B 4KTTE 3OJXA 3LZCA 1VSTA 2H18A 3DTTA 1TYEB 2BMAA 1T1RA 4DQ0A 4HGPA 3R7DA 3I42A 4OXIA 1SO8A 3TSCA 2HDOA 1WW3A 3PJFA 4Y9UA 4IGIA 2GBGA 2DLCX 1Y3IA 4FN5A 1WHSB 4NXMB 1C81A 4F1WA 1EFVB 2Q3LA 1V4NA 3IB3A 5JDIC 4J9NA 3C3BA 4FYIA 2QI9C 3BE8A 3BGVA 4B7CA 3QU4A 5JS2A 4D0RA 4UXJA 3DVLA 5FBQB 3M8KA 4DHWA 3EEQA 2O1XA 4E21A 3RH0A 5F35A 3DPSA 5AIAA 3WP0A 2HQOA 3RLFA 4IQ4A 2QXTA 1N2JA 2R751 4I55A 4Z86A 4I4CA 4R1LA 3UKOA 3JYNA 2X1VA 2C31A 4N0DA 2JEIA 3PQ5A 2CN1A 1N1MA 3UGJA 4DV1H 2ZUUA 5E6RB 1QIDA 3AB7A 1Z47A 1CR1A 1X1DA 3R5TA 4B3HA 4YAWA 4ECVA 1E2HA 2AOWA 1JJ7A 1IULA 5LZ7A 1ZOPA 2EKPA 5TGTA 5CNKA 3L02A 4YS6A 5JSZA 1X1TA 3QBDA 3A2KA 4F4XA 2YZNA 4C43A 4P7FA 4XGQA 4CG3A 3VX4A 2EATA 3I6QA 3L43A 2YASA 1R6UA 4X7RA 1ZA1A 1S8NA 5I5VA 2I34A 5AKGA 3U81A 2DWUA 2J59A 4X20A 3H2SA 5HILA 1N6OA 3M6XA 3QBVA 3HSSA 1JEYA 3PPXA 1HZZC 2PKQO 1FW6A 1VIAA 4HWGA 1QGOA 5MHTA 1LX6A 4N8EA 1XZ8A 1ZIPA 5KJ6A 1PDWA 3D8SA 3OOSA 4G0ZA 2VKQA 2NW6A 3BWMA 4QGHA 3W5IA 1KMNA 3S8EA 1E1NA 3N2EA 2GUGA 5CHEA 1ZUNA 3ADBA 1HFKA 1AG9A 3HMQA 3RU9A 3GEMA 2LZ0A 4AW9A 1GDTA 3QZUA 4ALMA 3F6EX 1VHJA 4XRRA 2JLCA 5KFSA 4E2WA 2WWWA 2QE7A 4BKOA 3WGOA 4RSGA 5J4VA 3HBJA 5K0GA 3UWPA 3E9ZA 8ATCA 2QX7A 2BFCA 3HKCB 3KR1A 4BFLA 1KFEB 3BKWA 5JASA 5L1IA 1CB7A 2YWRA 4V0MA 1SAYA 1U4NA 2P3OA 3N70A 1P1JA 3V9PA 1JPNA 5HRCA 3TUZC 3PS9A 3QVXA 2H4XA 1I1NA 4JNKA 1YOVB 1VDMA 1S2IA 4MR9B 3UIEA 2NZWA 1G2OA 4EB0A 4XM0A 3P5BA 1ULHA 4IRDA 1TJYA 3ER6A 3B51X 5FD5A 1KJ9A 4X1IA 3GJ0A 1PNOA 2JRCA 1J00A 4YA6A 3W6PA 1TJNA 5EP1A 2XQKA 4XEUA 1AZTA 3LRPA 4V1CB 3VR4H 3PP8A 1JG2A 4IDOA 4RMNA 5KYGA 2PUCA 1BZYA 4NV0A 3NEYA 4WXHA 4AO8A 3QEJA 2OK7A 2G1UA 1H93A 3HO8A 2VUGA 2YYSA 3S1SA 3RIGA 1G20E 5FWDA 4LX0A 3SBXA 1VE3A 4R7TA 4JK3A 4ZAWA 1D2NA 3OSZA 2OHIA 2D0IA 5F9MA 3O1JC 4HX2A 4V2IA 2ORYA 2VP3A 4QFMA 1JA9A 1PLJA 2C5FA 1KSGA 3WE7A 3ESXA 4M8SA 3HVRA 4DIBA 1XMOB 2I8AA 4BLSA 4IDCA 1VJCA 3AYXB 1ZZGA 3H87A 1YZNA 1E94E 4EB3A 2IKSA 1QZZA 3OI7A 3T7AA 5A5FA 5GWXA 3E0XA 1J7JA 1Z38A 4JWTA 2FDRA 4QJ5A 2W2NA 3OA0A 2WIBA 3WTCA 1JILA 1FP1D 2H59A 4KFUA 1DJOA 3J80W 3GEEA 4DNXA 2PMWB 4KFTA 4R98A 3IJEB 3VSAA 3ZNNA 2BEVB 3EQ9A 4UCUA 4XDZA 5FO0A 5ALGA 3AF4A 3CWCA 3GLGA 3CKLA 4XXHA 1KFBB 2VF8A 2PZFA 4AFNA 3NX4A 3I2FA 2CJWB 4DDWA 1GPNA 3IUQA 2O8DA 1LBQA 7GPBA 2AOVA 3QPCA 1PT9A 2Z56A 1EFCA 3KELA 2G28A 2ZJ6A 3TLJA 1JAHA 5IBRA 2W4QA 5JRDS 1YZQA 3PC6A 5I8ZA 4HGYA 2D7JA 2OGWA 1C0IA 1G6HA 5CJJA 3AP2A 1M75A 1SVKA 4F60A 1GCAA 4L4ZA 2CNDA 4DRZA 4F2DA 1YH3A 3G8YA 4G37A 3DKIA 1C3JA 3IE1A 1NW9B 5COBA 1VG1A 1Z07A 3M1YA 4KR6A 1J24A 1R37A 3FMGA 3O95A 2I2WA 5I5WA 2JIBA 1Y1TA 2WU8A 1M7HA 4AX4A 3DO5A 1B43A 1IAQA 5BSRA 1AKRA 5IT9A 4XB6B 2YFHA 2Q07A 4KFCA 1E7WA 3R3HA 1VCIA 3GF4A 1LNSA 4MS4A 4DJ5X 3WMEA 3IKVA 1CF4A 4Q39A 4XVCA 2E82A 4GSLA 1X0VA 5DT2A 1AF7A 2Y1EA 4E3WA 2REXB 2VF5X 4NOKA 2XAUA 2JEFA 1QZUA 3EXAA 5D3QA 2W5UA 3OEHA 2XMQA 2GYUA 3T9BA 3P5SA 1U8CB 3AWDA 3GLHB 3C48A 1KRWA 2QX6A 4JUIA 4I55F 4Q8FA 3FTFA 1E61A 2J7PA 1FYVA 3AJAA 2FG7C 1ACMA 1EJ0A 4NG5A 3Q3GE 3W5JA 2PZKA 3K8QA 1JEEA 5A4AA 5JNVA 5E6SB 2XKJE 3RPEA 3RTEA 3FRJA 4PQYA 2BEUA 4BNGA 5DU2A 5FOWA 4MGHA 4L07A 5FR9A 3OQOA 3BZBA 1CYDA 4GS5A 1SCDA 2CLDX 5BVHA 4OM8A 2GTPA 3ILVA 4N5NA 3U3OA 1RAGA 1JGTA 4MWZA 1U0HC 4RD0A 1O54A 4HDKA 1JDBB 2VSOA 2B1IA 2R8KA 4DR2B 3E23A 5KFLA 4UREA 3DEZA 2A5DA 3OETA 4KVZA 4BCCA 3R6TA 1EHIA 4UVGA 1RC0A 1SC6A 3Q87B 3RBDA 2B8NA 3Q3JB 3Q11A 3F7NA 5ELMA 4JI0H 2J33A 2ZYIA 4LRSB 3MTJA 3EGWA 2OD9A 4PLFA 2XB9A 3DB2A 1JJFA 1ADYA 1PP4A 2KB0A 1JAYA 3EVNA 4H3KB 1J97A 2BW0A 5GM1A 2OXIA 3D8UA 4LK2A 2COJA 1FYFA 1GRNA 5JYCA 5H80A 2C5LA 1NM5A 2IPXA 3C8UA 4CC5A 3OPYB 1OJLA 5B12A 3TTSA 5DTQA 4TMWA 4PZYA 4G1CA 2EHJA 3WDSA 1FU4A 1S4QA 1EZZA 4JQOA 5H81A 2VHVA 2GERA 3BE6A 3FCOA 5KVAA 1MKYA 5J4HA 1W4ZA 2TMDA 1COWD 4KOAA 2CDRA 2Z3WA 1P77A 3ASVA 2EVWX 1C0EA 1Q95A 5JHHB 1MAWA 4LXTA 1WNFA 4YP7A 3OZIA 5FQNA 4FPXA 4ID3A 4HF7A 4AS3A 1BHO1 3LCJA 5ITZB 4D26A 2PRZA 3QVOA 5E3IA 3O47A 4QBKA 5CURA 1PWZA 2P3SA 4C87A 4Y6PA 3RS3A 3MWEB 2WJ3A 3UXMA 3O7MA 5L4LA 2P8SA 5CEJA 4BX3A 3H1FA 3LT2A 5G0VA 4AC9A 5D5HA 2O3JA 3UAGA 2VUHB 1YC5A 1QCYA 1ISIA 4DCSA 3GLVA 3K0KA 2Y3IA 4IGFA 3ONNA 3S2ZA 4C0QC 2DJIA 4BLTA 3A6LA 4EJSC 1DT5A 4XUGB 3VNQA 3FROA 3G2JA 3PRJA 5DLPA 5AYVA 5T5QA 4MV7A 3QZ7A 4IIDA 5IK2D 1BJTA 2AFRA 1Y42X 4GGMX 1VJ5A 5KB3A 4TTQA 3BHMA 2X8WA 4P0QB 5I45A 1LW7A 3L8YA 2R82A 1TX4B 1P5HA 1WVIA 4ZANA 3OTGA 2FUKA 2HI0A 8AT1A 3ISTA 3W8RA 5LYYA 5C4MA 4M83A 3D3WA 1RAFA 4AJNA 2OYSA 1MNAA 3X0DA 2G67A 3EXG1 2HMWA 3HJBA 3CO5A 4YJ2F 3CZ4A 3MGGA 1HTBA 1G8SA 3A8TA 1CZLA 2IMWP 2ZI3A 5D1PA 3I9V1 3AV0B 1QORA 3MAJA 1JR2A 1Z22A 4DMFA 4MUHA 2A35A 1UM8A 1K7FB 4QL3A 2B4AA 1SM4A 1PVVA 1ISPA 3NT5A 1XTUA 2VS1A 3AYHB 4MCHA 1ETUA 2EJWA 2VTVA 2E0IA 2XKBA 3MCWA 3T1VA 3WKEA 1UCFA 4C7VA 4N82A 1KAMA 2ZOSA 4Y0NA 1A7KA 2FUG1 2AN9A 2X4IA 2ZRMA 4ED2A 1B7GO 2Q3JA 3ZBUA 3KALA 5P21A 1XZMA 3NIWA 3NAQA 1I7DA 1KOLA 4K6KA 4FX5A 2REQB 4EFKA 1QBGA 1DJQA 1EFRD 2WR8A 5JR3A 1RPZA 4D9HA 3R9IA 3R77A 4FZJA 1IN7A 2VTEA 1GUFA 4Y7CA 4EHHA 1U0EA 1BW9A 1EI9A 1Q0QA 2DH6A 2ZCUA 3CRNA 2RDMA 2PLFA 2YWBA 1HQDA 2R4UA 1PR0A 1V1MA 3NUGA 3P2JA 1KYZA 1KEZA 4WKNA 5JEEA 2C00A 2KYRA 3P9CA 5K8IA 2XVZA 2J9FA 4ZVPA 1V5GA 1OXUA 1NW6A 2WD9A 4E3ZA 5L45A 4YCAA 2AKYA 1RPNA 4ANFA 4O5AA 2EQAA 4E7OA 3QLEA 1Z8FA 4PAMA 3JAKB 1QC5A 1E7YA 4UFNA 3P0HA 2QJFA 2ZRNA 3PNBA 1OLUB 1M2OA 3CUKA 3QVSA 2PRIA 3Q0TA 4URZR 2D7DA 3NWEA 3G7NA 2FX3A 1TZ2A 3JQ9C 1M5UA 5D3KA 5IM4F 4BOYA 2JLSA 5BVGB 3AUYA 7REQB 3NKLA 4KH0A 3X1JA 5TT0A 1Y1RA 2J0EA 3N41B 4QVGA 1HI9A 2XMGA 2YNMC 3ZHXA 1SCNE 1R4NB 4QREA 1WXIA 3ZLVA 4CG1A 4EMTA 3PR1A 2YJ3A 4IDPA 1ISRA 3JD1A 1IPFA 5ALEA 2J4DA 1QE3A 3QPWA 2VDOB 1QIGA 1GUDA 1XTKA 3VKVA 1P74A 4J1QA 4CE5A 4MYTA 5M3BA 2G82A 2DBRA 1O8CA 4B83A 2P5SA 2XUKA 1UBMS 5HKKA 4OMDA 3S0JA 4BFCA 4I9NA 3NASA 3B7PA 3SKVA 4EW1A 4BCDA 1N9ZA 1SEPA 1RZRD 1G8KA 3FGNA 4NEQA 1JG4A 2UZ1B 3WGTA 4R7ZA 5I7OA 4KHPH 1RFLA 5HM8A 2IYFA 4KWHA 1EWVA 3HNOA 5DNDA 3OQMA 2UUOA 1GGFA 1JE1A 5DZSA 2VT3A 4EKIA 2J5RA 2CLHB 1FYEA 4O8CA 2IU6A 2OR3A 2DG2A 4H3SA 2VDVE 3NJ4A 3B6ZA 1DQNA 2V7XA 1NBAA 4F5ZA 2XSZA 2FFHA 2V7UA 2ZVJA 3I2IA 3QWBA 3ZCVA 2O8FA 3OPMA 4H7DA 1QS0B 4EBBA 2CKDA 5F3DA 1N1GA 5JU6A 3GMDA 1NLZA 1PJLA 2WSLA 4QYMA 2I91A 5CEEA 3QVGA 5C7YA 3O2QB 2J7KA 1QHGA 5AM4A 1XT6A 2J8ZA 4URWR 3ZWWA 1WX1A 3RRXA 4G0XA 3F1LA 3W6ZA 2BQUA 2YIDA 3WG9A 3BH0A 3VHRA 4DAEA 5I8WA 1P3JA 4GMHA 5IZCC 4ILKA 1OLXB 1YGYA 4J2OA 1E9VA 1WCIB 3RVMA 1FDIA 3RKRA 3VZQA 3MJTA 5FULA 4ARAA 1I6MA 5IT5A 2HREA 4DJAA 3DEHA 3X2SA 3L7LA 1CNMA 3JZDA 2REOA 4MUMA 3WV5A 3AJDA 1U0SY 2H1CA 5KYNA 3HRHA 3WKAA 1O9HA 1YR8A 1OX6A 1D1PA 4P84A 2HADA 1LZLA 4UZEA 2D2XA 1NBHA 3H5VA 4EB8A 3ZYCA 4KQIA 3HKBB 1IHDA 4GF5A 3IBYA 3A1UA 5HK9A 2XDQB 1Z75A 5JSHA 1HNWB 1FTNA 3SJZA 4UM8B 3FMFA 3F3KA 2QP4A 1A1VA 1ZEMA 3F9CA 3H84A 3F78A 3EPIA 3QWAA 3ICOA 4R71A 1XCPA 3A6PC 2ZRDA 2OLSA 4IGAA 1PG0A 4LN1A 3X1XA 2W7OA 2I8CA 2NO4A 3QVJA 4MXDA 1J2YA 3N2YA 2BFAA 1KDRA 2WJVA 3QPUA 4DCUA 1WM1A 5EKXA 2QA5A 5BWVA 1B4DA 3MBIA 3M4IA 1E9AA 4NSNA 1KH3A 2OO5A 3STTA 3MCZA 4RVGA 5GOTA 5ESWA 4WY8A 1BVYF 2QRHA 2YCBA 2HJHA 1YJQA 3RRBA 2P77A 4K6CA 2UVWA 4QHTA 1ST2A 3ISJA 2PSDA 4Q9IA 4DV7H 3VDXA 2AFHA 3U26A 3BMOB 1FEZA 4UEWA 2XLCA 4PTYA 3OE7D 5B2ZA 4Z9FA 3GTOA 4MUIA 2G25A 3BJEA 3KAJA 9GPBA 3JD2A 4L8FA 2ES4A 3EXFB 1PVOA 1UPXA 4UZSA 3P4UA 1P5FA 3TQQA 3MJCA 4OHRA 4N3CA 3E6AA 4ECYA 5H83A 5SZKB 1KMQA 1VLHA 3R75A 1WDWB 5A4KA 3AOEC 1Y4ZA 4OUKX 4Y98A 3G0OA 5H68A 3HBFA 2EIYA 4XJSA 2AMYA 3UT5A 4U5XA 5HUJA 2JC3A 3FX2A 4QFDA 4D4MA 2BUCA 3I9V6 1KK0A 3F8NA 4QBFA 1PNVA 1Q6ZA 3GIIA 1XG5A 3VJRA 1I10A 4HQOA 1L4EA 3AIOA 3GB9A 1PLKA 4LMYA 1ODLA 5JDIA 1E60A 1OD6A 4R1QA 3L4KA 1GZ3A 1PD0A 4G0WA 3BIXA 3SOPA 2CJYA 1SQ5A 4LXXA 2QRMA 1L6IA 3MC1A 1JIQA 1V1RB 2I54A 1PJRA 1KXJA 2FUG6 1QYRA 4U6NA 5C18A 4HMOA 3GRFA 3M3DA 4BO9A 2CFIA 2QQGA 5KWVA 4RS4A 4B7AA 1SHUX 1PK7A 1G5IA 1KYXA 3KQQA 4EM6A 3D7KA 3WJAA 1TK9A 4JU9A 4UCTA 4C6SA 3COYA 4DDVA 4R2IA 2PGLA 1GUYA 1SB9A 5CA0F 5EZ5A 1CZRA 3DV2A 4Y1EA 3AUAA 1QZ3A 4LYYA 5HYVA 2DQZA 3C4JA 2VL7A 1RQPA 3L4BC 5HJEA 1BE1A 5FUVA 4GZ6A 3M5PA 4LJAA 3VZCA 1RYMA 1LGYA 2QTLA 1DWPA 3LAWA 4HDAA 2VHJA 3AI2A 5DX1A 2XCSB 4RA9A 2DPLA 4UTXA 1NVUQ 2IEAA 3SEFA 3R4CA 1GZ6A 1WUJS 3TEFA 1HDOA 4OGGA 3NVAA 1T1IA 4GT1A 1E69A 1SUWA 2FKAA 1HZZA 821PA 2QMZA 1YK1A 3SC6A 2FEXA 4BZPA 1COWA 4H60A 2QRLA 2ZRKA 1AJEA 4IIJA 1W5TA 3GTQA 3ETJA 5AW7A 1ENYA 1J5PA 3ZY4A 4EPVA 3OTOB 1B42A 4W7HA 4BQNA 2IELA 1XMJA 1M66A 4DR3H 5K4GA 4PG8A 1ESCA 1P29A 2OHOA 4MVWA 4O3OA 4H59A 3HBNA 1YJ8A 1AQIA 4IWXA 2A0XA 4Q34A 2YUIA 3LBAA 5DRTA 4LZLA 5AIBA 1M83A 4R6WA 2FNAA 1SQ0A 1DPFA 1XZFA 4WESB 2YFKA 4R51A 2W6JD 4M8KA 3L84A 1Q74A 3SLGA 1Z2NX 1ECPA 4N40A 3B6JA 4JJEA 2NUAB 1C30B 3R5JA 1WDKA 2RCNA 3E4DA 2WSSD 1FVIA 1NR5A 2VCYA 3RASA 2V7VA 5CXSA 1JR6A 2MOKA 5KWEA 1ST3A 5BQFA 1J5EB 2VF4X 1Q6YA 1ZOOA 1VIMA 3E3MA 1B3BA 4NFHA 1E1MA 4LX8A 1C14A 2P7IA 1LF5A 1U7DA 4QASA 3AHJA 5TQVA 2PXAA 3VH2A 4KQKA 1T6YA 3TCXB 3ZWAA 3AI3A 2YXDA 1DADA 4JLNA 1OI7A 5HR5A 1XN1A 1QKJA 4NENA 2OOKA 1R4MB 5TQ0B 4XSVA 1CKEA 3QA9A 2V4QA 1EVKA 2G1JA 2PHZA 1C7RA 3AF3A 1Z0DA 1NQ5A 1JI0A 3M9XA 3V32A 5KOIA 4E5KA 4JI3H 4E6PA 1L2TA 1AA9A 2Q5LA 1JFVA 1U8XX 1N3IA 1ZM7A 4WVLA 2Q3FA 3O0DA 3EAGA 2A8YA 4KBGA 4YLGA 1TPZA 5A0FA 4MLZA 4P31A 3KQMA 5ULLA 2V6MA 4CL2A 4BC1A 3VHXB 2W6PA 1PV2A 2QRVB 4W6ZA 4FBLA 1CT9A 3EDOA 3TL6A 5LPNA 3OCVA 2C9CA 3VU3A 4WA8A 3T52A 2ZIGA 3IO5A 1YS6A 1PK9A 3R6GA 2JIPA 4TWIA 3KYDB 3R6WA 1NSTA 1ODJA 2HG8A 3AWIA 4ZC8A 1QOQB 4CIWA 3PNYA 3BQ1A 2Y1CA 3LBHA 4FWIB 5C3MA 4RKYA 2JLXA 3TDKA 1NULA 5H3HA 5DX0A 5KEIA 2XD4A 1KXZA 3R40A 2UV8A 3QVKA 4LXUA 3HDYA 4LFCH 4QRDA 1DEAA 2AEEA 3DWEX 4RF2A 4DLNA 1J90A 4IVPA 3LKBA 3CEMA 5JCPA 3AR2A 2UXDB 3HY6A 5D00A 1SY7A 3ROKA 3K9HA 4QOHA 2PGNA 1VRWA 3FYDA 1CRWG 4LBZA 4Y8VB 5HQJA 4WKGA 3GIWA 4UU7A 1PEYA 3R3ZA 1JJAA 2VUTA 3GDOA 4F5WA 3GFSA 3QFTA 2XBUA 5E3JA 3WLQA 2O20A 4J9SA 2ORED 5IEJA 1XQYA 3T7IA 1Z33A 3IQHX 2LCIA 1HYHA 4DWOA 1YR9A 3ET5A 3EUEA 4PG4A 3I53A 2I4LA 3NEJA 4BWFB 3KOMA 2C2BA 6YASA 2XTZA 1ZRSA 3VTZA 4IV0A 1DP4A 2JCXA 1U8UA 4ZOAA 2J32A 5G4KB 3RSHA 4K6FA 3TIVA 4IZIA 2AZXA 1DXYA 1NBEA 3KLOA 3UJ9A 4UM9D 1EDBA 3HK2A 2COUA 2GN6A 2P2ZA 2WJWA 1M6NA 2GAAA 4E4TA 4F3KA 1XTPA 4MB6A 4WT7A 2V7GA 2IYYA 4KXWA 1XNJA 2X15A 1OFUA 1OIWA 1QFJA 4JY7A 4J03A 4LYDA 3IBFA 1OC2A 1ZRNA 2XDYA 2HF2A 4I5IA 4W82A 1WCMA 3CU5A 2CSUA 3DR3A 4IV8A 2NQ8A 4UE6A 3W78A 2PH3A 1JIUA 4GMFA 4ZMSA 1ECCA 1UK9A 2CDBA 2IHUA 3ZXXA 4XZ3B 1JYSA 2BDTA 1UNNC 4D45A 3NHSA 1FVHA 4GE3A 3F7TA 1Y4SA 3EAFA 1MEJA 1PW7A 4LRXA 3ZW9A 3STVA 3PN1A 1EKXA 2VUUA 3FCEA 1ZD4A 4KVGA 5I5EA 4C2TA 1D4OA 5TX7A 5B58T 3GT3A 2I4IA 4TXLA 3A9VA 4EBEA 3AB3A 4PM4A 4HSGA 5TV2A 1T4MA 2AMFA 2R7ZA 4CTNA 4IIEA 2ZIVB 4FBTA 4R1TA 1TK3A 3RS7A 2ZRAA 4AJEA 5CIWA 1HSZA 4KO4S 1ZEJA 2P1RA 5IKPA 4RD6A 3V1MA 2IK8A 4R1OA 2D5CA 2BTEA 2WPDD 3H18A 2ZM6H 3DFZA 2A5YB 2I2AA 2I2FA 3E3AA 3H42B 4E12A 1CDEA 1EZ1A 2JBHA 4IIJF 5DN6A 3OTHA 1D3AA 3GDGA 2IOHA 2FE3A 4DCNA 1I9CA 4B45A 4N41A 1J2RA 2RGRA 3CIFA 1U7WA 1DKUA 3PXBA 1EX9A 5I7SA 3ZDBA 1GP2A 1X3SA 1JJVA 2X0RA 4WHMA 3GD5A 1RD4A 4EYQA 3O4JA 4O1IA 3D7RA 3ISVA 2FWRA 2R92G 5ESDA 4ZEMA 2YDXA 1XKXA 2AU0A 3AFIA 2WFAA 1RT9A 3ILYA 1AHNA 2Y1XA 4JEMA 2ZRJA 2J1LA 1ORIA 2B9EA 3AU9A 4R8LA 2YRWA 4LXQA 4EOGA 1WETA 4Z0HO 2QJRA 3UATA 4N9WA 1A2KC 1L1QA 2RGWA 3WRWA 4JI6B 4RVUA 4N5IX 5CM9C 3V2IA 721PA 3NIBA 1U8EA 3BDIA 5DF1A 4E4YA 1V8BA 1NQTA 4BQSA 2Q1TA 3DVQX 3AL2A 2DKNA 3A6JA 3LK6A 2WQ7A 1UWCA 1T8PA 3G88A 4LGVA 4PCLA 4Q3KA 3MBOA 1BGXT 3WKDA 3PICA 3UENA 4EJSA 4J29A 5B6PA 4C76A 1B0UA 3NPMA 1RXWA 2FXIA 4IFBA 2W2KB 4PIVA 5JH7B 5BSUA 5BNTA 2J4CA 4BO6A 1QIKA 2HRZA 4RTNA 1ML3A 4OL0A 2J09A 1Y9DA 1FLAA 1H94A 4TN1A 2QRQA 2VJMB 4YRAA 2VZ0A 4F84A 1UMCA 1RI3A 3LNCA 5G0SA 5EZYF 2FEOA 1NVMB 2SBTA 2CWWA 2O4UX 4DB2A 2A58A 3LCUA 4NCHA 3QEBZ 1JIHA 4CFSA 1QHHB 4OYYA 4S0ZA 4RAOA 3P4XA 1ZUD1 4HNAA 5JZOA 1CBUA 4PAGA 4IIYA 4H6WA 3HLKA 2HLHA 3P9QA 3RTDA 2CLMB 4V38A 3OHAA 2ZRLA 3B38A 1XPRA 5TGZA 2GQRA 2ZUBA 3NV7A 5FJJA 4WOKA 1UFQA 1MB3A 5KFGA 3H20A 2COKA 3BWVA 3NWBA 1Z0SA 3HGQA 3T1OA 2ATIA 3TNDA 2GFQA 1BXGA 3CQZA 3N0RA 4UD6A 5D85A 1JKFA 3IHLA 4G5YA 4G1EB 1R4AA 1J9ZA 4KUHA 4TTTS 4HDMB 1M6WA 3A32A 3SGIA 4FYKA 1L4LA 1BQ3A 3RC3A 4KLCA 4HYEA 4RGVA 3MMSA 1NAIA 1OZFA 4S1TA 3JRNA 3OWOA 3AGPA 4EG5A 1GN8A 4CHTA 5C53B 4GP7A 4LHZA 4PLWA 1U94A 4LSAA 2YWXA 4D0NA 4BE9A 1LDEA 3BIOA 4G4SO 1RIFA 2DR0A 4KAJA 3Q7RA 4CHIA 1YE3A 4GOLD 3ODGA 3ZD9A 1L8QA 3NWOA 1MRSA 3EPRA 4NCXA 3KT6A 3BA6A 3LXRA 4BNUA 3LUBA 1U8TA 1TZKA 2VG8A 4FIZA 4JQSA 3MWDB 1REQA 5B1YA 5DLDA 4DYDA 2BFFA 4TXJA 1JFLA 4ND5A 4P9NA 1RLIA 4WHXA 1E8MA 2BI7A 6REQB 2B99A 1WV1A 4XLLA 1QRRA 3UBTA 1NW3A 1DC8A 4Z1MD 2ZBDA 4DUYB 5JUMA 4Y9DA 1TECE 1ZL0A 3RB4A 4J0DA 3MTEA 1GFIA 1QDUA 4LNUA 1V11A 2QE6A 5BW4A 2GBLC 3NMUF 3DAGA 4IOLA 2BSAA 4OLBA 2X3UA 1G3QA 1HNXB 4ZCPA 2JI4A 2ZJOA 4M9RA 1GL9B 1MVLA 2BHNA 1RVDA 1U7ZA 3TW6A 4H7EA 2UZ0A 4ALNA 3TTUA 1DB3A 3TOCA 4R69A 4RD2A 2UVQA 1B73A 1VIYA 4G9GA 1JIKA 1W1WA 4HGQA 1IMOA 3AEZA 3HACA 1ISFA 3N2ZB 1S3IA 3AQIA 5TJ9A 1F3LA 3C3YA 4HS4A 3Q98A 1BHJA 3CNLA 1R0ZA 5U1PA 4BFZA 3JQ9A 2Z6QA 1TMKA 3GVPA 3PQCA 2AH5A 3A4YA 2AKAB 2P9QA 4CIBA 4P0TA 3O8RA 3HZOA 4QU8A 2IV7A 1U8ZA 1BMFA 3OMWA 1D2CA 4Z49A 3QSYA 1TT5B 1ICEA 1G63A 2YNMA 2ZUFA 1RTTA 2HIXA 4UBJA 4QUGA 3ZJ4A 1XRRA 4BN0A 1A0GA 3DWGA 1USIA 3HN2A 1XEXB 4WCDA 1J5XA 2RF4A 4PC1A 5C7LO 4FYJA 1NXWA 1Y1VG 4BGDA 5K0JA 3LLCA 1TT7A 4FD3A 1WQ3A 4MX8A 5E8JA 5CM8B 1VPDA 1TUIA 3KVOA 1RAAA 1I3KA 4MUAA 3USES 4J4HA 1R6TA 4N7JA 4CN9A 1U1FA 4QO7A 3LCRA 1PZGA 1SVNA 2O8CB 6NULA 5EWEA 1H3NA 2XQGA 3DE5X 4NKRA 5HA5A 3S70A 1N77A 3FMIA 1J9GA 4D41A 4BVLA 1A5SB 2HH9A 4OKSA 3W1WA 2GARA 4P4GA 4Q43A 2WG1A 2IIBA 3GTLA 4HRVA 1NT4A 1CY2A 1P7PA 5BT9A 2NU9A 3QGMA 3D9QX 4QBHA 2JIOA 2BM1A 2W9CB 2UVUA 2AQHA 2Q6VA 3EARA 3EN0A 5A5VA 3WOVA 3P8ZA 4K3VA 3Q85A 4K9SA 1YQ9A 3OSUA 1G5QA 5HHTA 2Z8YA 4DNPA 1V25A 1PL8A 4LQ4A 4PSKA 2XA1A 1WKCA 4Z8XA 5LMUH 1QVRA 3RSSA 3REGA 5CVEA 4A82A 4FOOA 2G8NA 4YXFA 1WR8A 4X0EA 3UT0A 4JUCA 2DB3A 1GDHA 3UMYA 1BE0A 4HT3B 2CLSA 3SVTA 4S04A 3NUAA 2V9CA 5HIIA 5IZCA 4HNRA 3OVMA 3EVCA 4ROSA 1IXYA 4FW9A 2X41A 2X5NA 5B1SA 1T0PA 2O8EA 4ZEVA 5ARCA 4X62B 4QKQA 3AF2A 5SY6A 2QN3A 5J2TA 3A70A 1MAUA 4KYUA 3BWEA 5IVKA 1F0KA 3RRFA 4DV0B 2J0QA 3G9UA 2AQIA 2GXAA 5HBRA 1OGJA 3V34A 3HYNA 5LA6B 4NH4A 2PSJA 1I1OA 2WB1A 3UMCA 3DEKA 4UQOA 4N8SA 2L42A 3A6HA 4L7VA 2FQQA 5KYKA 3KTDA 2Q7DA 1E7SA 1SQGA 4H16A 5ITSA 4MICA 4ZT3A 4LJ8A 4LXIA 2NPOA 2JAOA 5FNVF 1O96A 4AJJA 4I5FA 3DP9A 4H7IA 4J3NA 4CIVA 1UWKA 3THOA 1IYDA 2PFKA 2ZROA 1OILA 3L6OO 3L3BA 4I3FA 3OD5A 1CJCA 5BOSA 4CV0A 4EEQA 4CKZA 1FFEA 2H92A 4L8VA 5HJ7A 2CUZA 5KU1A 4FU0A 4HRXA 4DCOA 4JDPA 5FLEX 4IRUB 5JADA 3ZGYA 3EX7C 5F9NA 1EFDN 3N8GA 2UYQA 4PPFA 3W0LB 1NFRA 1RM3A 4LVUA 4PNEA 1IY1A 5ES4B 3WIDA 4QQRA 3ZI7A 3FGOA 4YCMA 4EPXA 3WK6A 2PGDA 3U16A 1UP6A 5K3SA 3MWLA 5T6MA 1IWOA 2GEDA 4MUJA 2IP1A 2BQ3A 4ZHQA 5DTJA 5I9LA 3MYRA 2OGUA 4OGWA 1JG7A 3RK4A 1IEVA 4MQEB 4C0KA 4NECA 3V1KA 2PIDA 1EK0A 3IP9A 1MAVA 2C5HA 2EGGA 3OLQA 1W19A 4PYMA 1V51A 4WXPA 4GLOA 3VI3B 3V7WA 5K3FB 1SKQA 2Y0SA 3THWB 2C4WA 4DG9A 4QG3A 2YHAA 5MDHA 2VQ6A 4R68A 3UEOA 3BMCA 3DZBA 1TZJA 5LNK6 4OJQA 1PJSA 2ZE5A 4RXTA 1STOA 4W4TA 3LUCA 3L7KA 4EG8A 2I22A 3AOEA 4Q0YA 3GVHA 1P5ZB 1CLEA 3P0JA 1W36B 2CDNA 3A26A 5TVKA 3PNQA 4XIFA 1T8UA 5C2JB 3MTGA 2NU6B 1N36B 3HVKA 4RJ2A 1JDJA 2F1JA 1KHTA 4YJ2A 1T9GS 4D99A 4KREA 3RC2A 5JDCC 4U7DA 2DU8A 4QWEA 5B36A 1VPLA 4G9EA 5AK0A 1A2BA 4JASB 5ESXA 2ZVPX 3GGPA 5LZ8A 4CU5A 3BMQB 4LRYA 3ED1A 1F9AA 4I46A 5BURA 5HFNA 4NONA 3ROPA 5J1TB 1QB8A 5IVPA 5LQSA 1AIPA 2ODPA 4P4SB 2WB4A 1E4EA 3LMKA 1I2CA 1U9CA 2NU8B 2XEDA 1N1DA 5HJ5A 4HEJA 4WKPA 3H2GA 1CUIA 2JCGA 2WPDA 4A3IG 3JQAB 4E32A 4OATA 4Q15A 2UXCB 5F12A 2XMDA 2AC2A 3F5FA 4C20A 2FPLA 3EMVA 2BV3A 3VR4A 5B4VA 1J09A 1QO0A 4BPBA 3L4BA 4REQB 2F00A 2GWHA 3OESA 3RBEA 4PWYA 2RHTA 5KMGB 4CQMA 1Q0RA 1ECLA 4IJUA 4R2XA 3UGKA 4G81A 3ROGA 4U7TB 2C4MA 2QT0A 3TTYA 1PSWA 2UXBH 2JHFA 4JJ6A 4FLMA 2ZS7A 1RFGE 1NQXA 3AILA 3H40A 1K2WA 2QS9A 1GPH1 5D7NA 2YVUA 1C41A 1CIVA 1FFYA 2XECA 5BMVB 1IZ8A 5LN1A 2EP8A 4M1ZA 1HEYA 4LZZA 3L0ZA 1E9DA 1R00A 4JVMA 2FWIA 2ZDQA 1PJCA 3NVMB 3SYTA 3TVYA 3B82A 5AOAA 1TWFA 1IN8A 1SBYA 2VOBA 4FEYA 1Z34A 1M2KA 4E30A 4DW8A 1HE4A 4FR0A 2P67A 4EMSA 1IC6A 4OXYA 4WCFB 1QNFA 1V9SA 1E1QD 5ADUS 1NXPA 1XCGB 1DZ3A 4RYDA 1JEDA 3OP4A 4OX9B 2XMPA 2HUPA 4C0SA 1RWQA 4FFRA 2QMYA 5I8PA 1ZMOA 3BE5A 3CC8A 4J2TA 1TYAE 3FMOB 2G0TA 1L5HA 2AI3A 2I7XA 3U4IA 4EVSA 1HG0A 2R6FA 3FTPA 3NC0B 4LE2A 1RRMA 3E5RA 1WMAA 5IM4A 1V47A 3R3UA 3PQ2A 4PRZA 1T2NA 3QE9Y 3IEPA 3U17A 1C9YA 1KRXA 1I4WA 3O1IC 2OYCA 4AMUA 4DJFC 4AY3A 3VTAA 3DT6A 3RREA 2GD0A 3HVUA 4OBBA 2P5UA 4HFMA 4EY8A 2A9QA 4JB8A 3REQB 3T9AA 1ODTC 3C85A 3P2YA 3TUJC 1XFDA 3T1YB 3DAHA 4AY5A 4G65A 2VHCA 2ENUA 2F3UA 1JNYA 5GONA 5LQAA 1XZBA 2I55A 1KSHA 3H4DA 4ZZIA 4ECAA 3NBYC 4JYZA 4RC9A 4QQKA 1ZN8A 1U99A 3F5DA 1FRZA 1SPBS 4DNFA 1U6KA 4JP8A 4N01A 5J2TF 3PZBA 1G42A 3LVFO 4UOZA 3ZVKA 3K53A 1EKPA 3EIHA 5LWHA 4J49A 1R0WA 1EZ4A 3RW9A 3IA2A 2ZPUA 1KORA 5K0FA 2GPNA 3O7WA 4DPMA 4U0KA 4UQLA 2CHGA 1LV8A 5KG7A 4P6VF 4YAEA 2ZTVA 3NWPA 2NXNA 4RTSA 1U8YA 4F3CA 3HL0A 2ZI4A 1G20A 1J06A 5AMXA 3TKYA 3UK7A 1N33B 1G8PA 3HB9A 1V45E 4H7JA 5IM5A 5KPDA 5IP9G 1A27A 2MYNA 2W2MA 4EHIA 1X7ZB 3C8ZA 3ACBA 4DT1A 4L4SA 1SHLA 2QDXA 3O4HA 4QYTA 1I3QA 4QJBA 4YV2A 2A0UA 2WYHA 4ECUA 2B98A 1KPGA 4PG5A 4EI8A 1SBNE 5AOCA 4TL9A 2COIA 2B25A 3E8MA 2A1HA 2ZQ5A 4RJKA 3PUKA 3QOWA 4RA6A 5ILQA 3IDAA 4K0KH 2OHHA 2F1KA 4ZQIA 3PPVA 4ZHQF 3TQRA 3JALA 4XQGA 5HOQA 1S3GA 1QSGA 1IRXA 2ZXFA 2YQ5A 3TZLA 5GJWC 4KO1S 3DUWA 1V16B 2IY9A 1I01A 1P1KA 3QYPA 1HG1A 3OBBA 3KSAC 4L0DA 5GINE 4JJFA 5KG2A 4L08A 4J0CA 4WAUA 4C3UA 3PFNA 4ETWA 2D8AA 4UTZA 3FPJA 2GYVA 3KUXA 4RIFA 3QKRB 5KO2A 4CV3A 3OQHA 2H1HA 2QD4A 3MFYA 2ZCVA 3DFUA 5BNFA 1RIIA 1D2MA 4R3NA 2EKZA 2W0MA 2BE7A 2R86A 4EZIA 1XMQH 4NOLA 1Z8HA 2OILA 1IH8A 1UMBB 3MAGA 2W22A 1Q7TA 5ALHA 1Q3KA 2OHVA 5E3HA 2BGJA 3QPDA 4LE0A 2CNWD 4MR7A 4D8UA 1P18A 4FDLA 5CT5A 4BBSG 1T0HB 3GH1A 2UUCH 2XUIA 1A0OA 2IHZA 3ONDA 1WG8A 4QDTA 2PFGA 2XX3A 5JFOA 1TUBB 5LP6B 2JA6A 1MPXA 2AMVA 4QJ4A 3H4IA 2AJDA 4RPCA 3H5NA 3K0EA 1OFUX 2QXUA 2VDKB 4EVRA 4XIIA 5FB3A 4WLVA 4TLCA 4ZCSA 4WPGA 3QNUA 5EQDA 2OLJA 5A2QA 3TEKA 4ND4A 2DTEA 3LGXA 2Q8NA 4Q3AA 2Z9BA 2CW5A 3IXMA 1P33A 2DR3A 3HA5A 2QG4A 2PZJA 2IGTA 1Z0UA 4DQXA 4QELA 4MRMA 2X2FA 2BGKA 3N0TA 4G97A 5KOJB 2E87A 2R7MA 4OQLA 2JA8G 3RSLA 5J5AA 2OYRA 2VBFA 3OA2A 1Y82A 2MT9A 2WZDA 5EXSA 4E08A 1I1LA 5T64A 1JKIA 5HVNA 5G0WA 4WWHA 1LDGA 2QMOA 5K2OA 3H1EA 2N9UA 3VV2A 4G4JA 4EAAA 4EGFA 2QW1A 2ZQYA 4ZTBA 4IBOA 1APBA 4W7IA 3ETHA 1UOOA 4XPZA 1N92A 4H35A 3VO9A 1S9HA 1EB9A 4OJYA 5IYCG 4GPEA 1WB5A 3PKJA 1I4OA 2RH4A 4GZMA 2CD7A 1GKKA 2VZLA 5ICCA 5K3WA 1KR2A 2X0DA 3B9PA 2H48A 2VNIA 1DINA 3TY5A 5KSOA 1UBTS 4D9GA 1RKXA 2Q5OA 2R3SA 4CDGA 3VKGA 4MQMA 3CXUA 2BZSA 1NI5A 2LIPA 1QTNA 1IIRA 1FRQA 4AZ3B 2JFQA 1HE2A 4OSEA 3HMKA 1IN5A 2CDCA 4LFAB 3H9QA 4I5DA 1DIGA 4CM9D 4RIHA 3ZY3A 1P61B 2WTMA 3TLGB 4TSKA 5KYWA 3M1LA 3QV2A 3S5UA 5IC5A 3WXMA 3D0RA 2Q5QA 3T7KA 1Q7EA 5AUQA 2ZGVA 5CA0A 3E1KA 1XXHE 5IP7G 1WXXA 1C4OA 1Z0KA 3DSRA 2OM2A 1SKYB 4PN3A 1LPPA 4XB1A 2IH4A 2AUTA 1VGRA 5L4SA 2C88A 4BVJA 3SC3A 2ORIA 3F4BA 1RJ9A 1N8SA 4D4HA 3D3QA 1TEXA 1XEFA 4D1YA 4IV5A 1I2KA 2FFQA 2P9EA 3L8MA 4U2EA 1JKMA 2O52A 5I9NA 3ESQA 1Z8NA 1LX7A 5GONF 5CBPB 4C0BA 3PD0A 3Q41A 2F8LA 5G1PA 1TQ8A 3ABOB 5AVYA 4ZEXA 1BJRE 2PMZE 5B3KA 1QANA 4G09A 4MUFA 3DLBA 1TLTA 5BSEA 2JA5A 4CODB 3BGDA 5LDDC 3STHA 1CUXA 4CMHA 5KYXA 3J81A 3MVEA 3HU1A 3F4LA 2BTQA 4D9CA 1HYGA 5LZ2A 2H8GA 1UPTA 1XDWA 2YJTD 3MQFA 5IN4A 3VUEA 3RLIA 4U3JB 2RHMA 5EVCA 2DSTA 2UZ3A 4WLOA 2QUAA 4OQNA 1EUZA 3ESDA 3KJHA 4KWCA 3IQFA 4KLNA 1RQRA 2GAJA 2Y2VA 2Z04A 4AY6A 1DSSG 2RGCA 4UUAA 2HHCA 4PS1A 1ZN9A 4NJMB 1R0CA 5DHRA 3ZV5A 2WUWE 3X1WA 4FC7A 4NEHB 1BEEA 3R4VA 1C1YA 5E1DA 2J67A 5J40A 2GCEA 1GTSA 2BQRA 3RG2A 2I99A 4DDTA 1ZC4A 3R6LA 3PCRB 1KAQA 1MB9A 3SP1A 5H8WA 3EOAI 4OSPA 4FZRA 2XF8A 4A3EG 3UWMA 1WA5A 4PLVA 2NSHA 1FBTA 3BD8A 1D2HA 1YTLA 2WWHA 2FW8A 4JV0A 3GPIA 4R0VA 4CIAA 2NAFA 2OG2A 2YHBA 3QH4A 3G2NA 1J2TA 2HA6A 2XZOA 3I73A 3CR3C 2E3JA 3E61A 2DFPA 1H0RA 4D82A 5EYPB 2KX7A 4LF5H 2WJ6A 3I32A 1EP9A 1OASA 5KTKA 1JT9A 1X1SA 3JQEA 2PV7A 3V8PA 2POQX 4QT4A 1OXMA 2HIMA 2ZRPA 3VZPA 2WKSA 3FR8A 3I4MG 3COWA 3W4KA 4FYHA 5C8YA 2R6GA 3AXSA 1YJCA 2ERCA 3FJ1A 5EIBC 1RHQA 4M99A 3HS3A 1ZI9A 1Y3AA 4XRGA 2PUFA 1JG6A 1DAEA 4BMYA 3H16A 1A0IA 3VC3A 1XOIA 4PZEA 5LU9A 1E3SA 4BUZA 2G77B 5HGXA 4QLBA 1Y8QA 3JWEA 1O2DA 5A3JA 3D2BA 1VHLA 2K5UA 2GBLA 1Q0PA 1ND6A 1ZK3A 3HKZE 3IUMA 2O50A 2HWKA 1WRBA 4TV8A 1U80A 1F38A 1UF9A 2FRXA 4LISA 3KOYA 2EJ3A 3MSCA 3TOVA 1ZM2A 3DOUA 5GP1A 4E6NA 4I9UA 3DCJA 1D6NA 3D54D 3ITKA 1GITA 4H7FA 1OBOA 2FOIA 1PR4A 4BUCA 1ZVKA 3JD0A 1OBGA 2HWWA 1PEDA 4DRXB 1NV9A 4YRRA 5IULC 3HFRA 1GG8A 3V4SA 1P60A 2QAIA 2RFLA 4FKBA 3NHZA 1LRKA 3FOAA 2PVCA 1S2GA 5AK4A 5LZ9A 3R23A 3Q10A 4P2BA 4S0XA 4GC7A 4C6TB 2CL5A 3T5CA 1NBME 2KSQA 1V8PA 4KE9A 4G8CA 1T4CA 2LWIA 1S03G 4HR7A 4F9GA 4A2AA 3TO5A 4EEZA 3NHFA 4URHA 3TZKA 3IUEA 5TB5A 3OPVA 1DXHA 2YMMA 1LLFA 4LSGA 4Q9AA 1YCDA 4Y2PA 4US1R 2OQRA 2CW7A 1OF1A 1W2WB 3CNBA 1RR6A 4L8GA 3SQNA 2ZBRA 3MJVA 4I8DA 4Q44A 5EGSA 2KQUA 3DP7A 3MSXA 3F96A 1PV1A 1T9DA 1A96A 3H17A 5K8CA 2JIDA 3CVYA 3SDBA 4RVOA 2O0JA 4CKWB 4V0KA 1SXHA 1E3MA 3RUDA 5DXJA 2JI6A 5WRFA 3SX2A 4GBJA 4PWQA 3F5MA 1YS1X 2P9CA 2A3NA 5CU7A 3UBMA 2ZYUX 1HFWA 5AKHA 3WWJA 3A1CA 3TCKA 3IAAA 3RIHA 3T5HA 3PWZA 2NO1A 4PZAA 1AGPA 4MHSA 4UNNA 4EG0A 2G88A 1XBTA 2WDPA 4B17A 1GTJ1 1N0UA 4J1NA 4CRWB 4KX3A 4JROA 4RAQA 4PSAA 3FSJX 1T8RA 2FN7A 3KDSE 3ZGVA 4RPGA 4H7PA 1EUDA 3COZA 2RK4A 4PTLA 2H1WA 3PIRA 1X38A 3W79A 1MPTA 1SCIA 1UFVA 3TOXA 3O3NB 5KX5A 5JCZA 2A5LA 4G5SA 4PVCA 3BWYA 3AHIA 3V8VA 2HF8A 5EE0A 1OAKA 3GUVA 4LF4B 1XL0A 3A1SA 3P9ZA 3NC4A 4PHGA 3K0SA 1X1CA 4QWDA 2BT4A 3AERA 1ENPA 1UWLA 3FAZA 2DQKA 5FQOA 1I80A 2AN5A 1EXDA 1T5HX 2O06A 2X9LA 3E1SA 4NMHA 1JDNA 2EV9A 4FFSA 5K4AA 3CM0A 4RORA 4JI1B 4UAVA 5IKXA 3E7WA 1QYIA 4M1OA 4RPJA 5BYAA 3BPSA 3CSSA 1LVHA 5HZMA 3JSLA 2ZG6A 4YBRA 3P9SA 4JVOA 3ZIUA 2BBSA 9LDTA 3F6SA 4RWEA 2PZBA 3PTAA 1HDRA 5AHOA 3O6VA 3PXUA 4D0GA 5BWOA 4A1OA 1FTYA 1JW9B 4BQIA 4BTEA 1TW3A 3AUTA 3MR2A 5DX8A 4TMFA 4FT2A 1KOFA 4B3SH 2AEMA 5AKXA 2PD3A 1ENOA 1CFZA 3JASB 4BRUA 3S2IA 5IK2A 5FKJA 4LCJA 3HR8A 3H1GA 1AV6A 1XQ6A 4RSHA 1VKJA 1ULAA 4J9UE 5TPZD 4B8ZA 2BLNA 5JAUA 3MD0A 2HJRA 2RIRA 4O4JF 3FHCB 3GT4A 2AQKA 1E59A 5GY7A 5I3CA 3LX6A 4RQUA 4B3XA 3ZBQA 3QMVA 3H5TA 4TYMA 3ASYA 2GBFA 4ERNA 3ZCPA 4EO4A 3R1IA 2QNRA 1DIRA 4DEVA 3HZHA 3N8NA 3SFVA 4ARZB 2BTOA 1SUCA 1K6IA 1GG9A 2JEJA 2C29D 3GFFA 1NJSA 3WL7A 4ZCMA 3MYYA 2FUNB 3IOEA 2J4FA 3EWNA 2ZB2A 4LWOA 4PDBA 2Z4TA 3C6KA 2JASA 2X7XA 2CNWA 1XLVA 3TLYA 4TL6A 3PVSA 3HDVA 4NWIA 5C1OA 4ND8B 3NHPA 4QDJA 2R7AA 2HIAA 5C8YF 4JZYA 5EZYA 4EA7A 2H9AA 2OZLA 4LWZA 3KKEA 2NUPB 1G8JA 2I6GA 4TV9A 4GKVA 1ISMA 1Q22A 3DL7A 1F8YA 1V5FA 1B0ZA 3P0IA 1EVYA 2Q3EA 5KQPA 4FFMA 3ZDCA 4J0MA 3H65A 4GYKA 3RU7A 5AOVA 1EP2B 1M2HA 3DMPA 5JDCA 4TV8F 1GU7A 1TM1E 4BMDA 1ZD2P 3KR0A 5JAIA 3HOWG 2EFYA 1Z56C 4IJWA 1WULS 5DOVA 2I1WA 3DAOA 1KS2A 4G5RA 4TXHA 1EFRA 2ODWA 4EO7A 5EIBD 1RMYA 1PV4A 1ARZA 3LPAA 2MJLA 4YQWA 1CP3A 4MW6A 3AV3A 2PYZA 3HP7A 1NI3A 3GTMA 4LH7A 4TZKA 1IPHA 2C9MA 1EP3B 2XWBF 3TUIC 4D3YA 3D8RA 2BHTA 3OT4A 2NXCA 4NRDA 4AZ0A 1SCUA 3W5DA 2DUJA 3EGVA 4TS9A 3ER8A 1NYQA 2HCTA 1A1SA 1Z35A 3GP3A 4FMCB 2XUOA 2GEJA 3UQZA 3SSOA 5JJ5A 5BR1A 2VWHA 4D25A 4KQCA 5E4FA 1RWOA 1QE0A 2JJ2D 1XWWA 3MWKA 1KH2A 5JNWA 4B7ZA 3D3KA 4XDGA 2AD5A 2IYOA 1JDUA 1Z18A 3KHRA 3VJMA 2QTTA 3MQ4A 3UJPA 4GLFA 2E9SA 1Q0ZA 1OOEA 4X95A 5ADWA 5C52B 5EWLA 2P0EA 2BR0A 4NU6A 5JE8A 2I1LA 4MQBA 3W3ZB 5DLYA 5JQGA 1OLSA 3JARA 1ZS9A 2FFBA 5FX2A 2JLAA 3EVBA 4AO7A 2QU7A 1ADBA 3F6RA 4WDQA 1Z2OX 4RABA 1H1LA 1DAAA 4BN5A 2E2WA 3TBHA 5J4LA 1EEXB 3WL6A 4BPRA 4REMA 2VT7A 5B1HA 4AF7A 3R6DA 4FJ2A 1O4WA 3ZYZA 2FLVA 1RNLA 1B6TA 1GPLA 3CKMA 3AX6A 1NT2A 1XCJA 1Y1QA 5ALSA 1OH8A 1R8XA 1BDIA 4LPSA 1UZAA 2A5JA 4PBSA 1OFTA 3VPAA 3UK0A 3WLAA 3R7FA 3FOZA 2CLKB 3RAJA 2F1RA 1YBVA 2DM6A 3MINB 2DHQA 4EFMA 2PGOA 3WHKA 4I66A 4D8YA 2GAIA 3OBIA 2C8LA 2I8LA 2Z6AA 3G2IA 3U9TA 1YZFA 1W47A 2IU0A 2ZLBA 5CDSA 4EY7A 5B2EA 1L8XA 4LBYA 1N0IA 4YI3A 5TF0A 1ZL2A 3PC7A 3X2EA 3A1VA 5E1BA 3DS8A 5KX5F 5IXYA 1RZRA 3UJDA 5DBHX 2QX9A 1Z4IA 2X58A 5JC8A 1HWYA 4BS9A 3CUUA 3D8HA 1AA6A 4ABTA 1QLHA 4DLWA 1ZMRA 1KERA 4X6YA 5EHIA 1ZOLA 4N3BA 2B34A 2O03A 2BSXA 3GJ8A 3EZGA 3G49A 3OOYA 4IKEA 3LA6A 4AJKA 4QJIA 1X39A 1G5TA 3U4QB 2OXTA 1Z6TA 3ROTA 5HDQA 1JXLA 1WSCA 3ZW7A 1T9AA 3RU3A 4JV1A 3HJCA 5TDHA 4KCGA 4DLYA 3TJZA 5KT3A 4G07A 4KPUA 3J7AK 4M8IA 4O1HA 1H0KA 4F4YA 4FB5A 2CV2A 4JJZA 2PBLA 3TX2A 5LMNH 3URKA 3L79A 2PG3A 4B43A 4BEWA 1JFTA 2FLKA 2GPSA 2G06A 1SIBE 3CPSA 3WICA 2ANBA 2ZTLA 4AJ4A 2CJXA 4YCLA 2WZCA 1K4YA 3GIJA 3Q9SA 3L5OA 4TM7A 1HXHA 5ED0A 2C9DA 3AEQA 1ZW6A 2IYAA 1CJTC 3UUFA 1WUKS 2IJGX 3ZDFA 1ULTA 2HU7A 1TEHA 4JH0A 1MQSA 4L51A 4X85A 2WHXA 1ZK1A 3DQQA 2WMDA 3FCYA 2RAVA 1ESNA 2GYWA 4J9KA 4DUGD 5THXA 2JGAA 3DTYA 3E4CA 4J9LA 3NBUA 3QKSB 4S3MA 1ISGA 1P0IA 4NBTA 5THQA 3ZJYA 1P9WA 1BU8A 1PFQA 2WWRA 2O3UA 2Z2KA 4IIXA 4X1KB 1KIAA 3WIOA 2WWXA 5BWXA 4LSMA 3UFXA 4ZQHA 3N58A 4ZO7A 2QRNA 4FHDA 4M1QA 4C22A 3KSDO 4E1BA 1JZTA 4B33A 5AM1A 3LFUA 4OD0A 1Z5PA 5DISB 2KLBA 2CFRA 3BMNB 4NPCA 2J85A 1E6EA 3K1JA 1KUTA 1HFEL 5A4FS 4TV9F 2FU5C 4M21A 2GK7A 5FNVA 5EOYA 1SXJB 1QHNA 4UC0A 3OPXA 2BHSA 3AR5A 4M38A 3N8IA 5LNK1 1M2VB 3IODA 2NWQA 2O0LA 1EVQA 5KDLA 4CR8A 2QVZX 4X1OA 5HZGA 4OXQA 4FNAA 2IA6A 3KTAB 1Y6QA 2YWJA 2YWEA 3WLLA 3RFCA 4I0WB 3O83A 2PJDA 3OE7A 2K7ZA 3D5TA 3PV0A 3D31A 4KU4A 1GCGA 2VP4A 1IBSA 3TB4A 5DM0A 1NBOA 3T3EA 2AFIB 4KI7A 4ZV4A 5EUMA 1V3UA 4FC6A 3DPIA 3CEBA 1QX3A 4FWTA 3V2HA 2J0UB 3AVPA 2YIMA 4CF4A 2ZUDA 4MW4A 1U04A 1ZRHA 4Z4EA 3TB6A 2QZ4A 2PEZA 2CZCA 3AINA 2CMHA 3WLJA 5P8WA 4FK8A 1NWCA 2NOAA 1G66A 3QBEA 1D2EA 2QZJA 4FMDB 1L5RA 8LDHA 2IOFA