1GSHA

Structure of escherichia coli glutathione synthetase at ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
296
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glutathione biosynthesis ligase
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 101
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1gshA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1gshA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gshA01
3MWEA 1JKJB 2J9GA 3JZFA 2QK4A 4EA7A 5JVDF 3LWBA 1Z2OX 2GPSA 2NU6B 2NU7B 1EHIA 4O2BF 1C30A 2VR1A 3VA7A 4TV9F 2V58A 5JQGF 5BPHA 4IHJF 5LYJF 2YWVA 1IOVA 4C5AA 4HNVA 2R85A 1C3OA 1DIKA 5JQWA 4MA5A 3JRXA 5C1OA 2R86A 4MV4A 2YZNA 3ORRA 4IIJF 3WO0A 3N6RA 4O7VA 4ZI7F 3BFPA 4FFMA 3KAJA 4ZOLF 1GGOA 3LP8A 2I87A 5D8DA 3ORQA 1CQJB 1BXRA 4IZOA 1GSAA 4EGJA 2PVPA 4FFNA 2PBZA 4O83A 1JDEA 3U55A 1JDBB 2Z02A 2YS6A 2R6FA 4O7RA 2Z04A 2NPOA 1B6SA 4WD3A 2C00A 5DMXA 4I50F 4O7YA 2DZDA 3MJFA 4O7WA 5BMVF 4M9UA 3TQTA 1VBHA 5EZYF 4MV7A 3KAKA 2DLNA 5IYZF 2VPQA 3NUAA 4WBNF 2FPGB 2YS7A 2W6OA 2R87A 4DIMA 3R9RA 1CS0A 3BG5A 1EUDB 2YZGA 4GGMX 4MV1A 3VPDA 3TIIA 4MV6A 4O81A 4MAMA 4FFPA 2NU8B 3RUPA 4TUYF 5J2UF 3OUUA 3R5XA 5I47A 2FPPB 2V5AA 4C5BA 1T36A 4XZ3B 4O4LF 5CAEB 1CE8A 1GSHA 4O4JF 5LXTF 1KJ9A 4J6EA 1OBDA 4O2AF 2V59A 5C8YF 3ETJA 3K5HA 4HNUA 4NYEA 3UFXB 1DV2A 2SCUB 5H80A 4YAKB 5LOVF 1OBGA 3WNZA 2GPWA 2XD4A 2ZDGA 1ULZA 2P0AA 5HBRB 2FP4B 3TW6A 3G8CA 4TV8F 5KKNB 5LP6F 5C1PA 4EABA 2NU9B 4Y8VB 2CNUA 4FGRA 3GLKA 3ETHA 4YJ3F 3VMMA 4ZQIA 2DWCA 4M98A 4M9CA 2QF7A 4MV8A 4O84A 3R5HA 3AX6A 4FE2A 3HO8A 2VQDA 4O4IF 5CA1F 5JVLA 3U54A 2GQSA 2YL2A 5LA6F 1WR2A 5HV6A 4DLKA 4FFLA 4M99A 2HJWA 3QFFA 4L1KA 3R23A 4HNTA 3G8DA 3I12A 2ZDQA 2R7KA 2DIKA 4EA8A 1I7NA 1EYZA 5FNVF 2I80A 4MV9A 2XCLA 3WO1A 1VKZA 2CNQA 1B6RA 4IWXA 1A48A 2W6PA 4XX0B 1IOWA 2HGSA 2YZLA 4MA0A 4YJ2F 3V4ZA 4C5CA 2YW2A 1CQIB 5KX5F 4O4HF 1UC9A 2R82A 4ZHQF 1W93A 1KUTA 2OLSA 3KREA 2R7NA 3JRWA 3RV3A 2PN1A 4EA9A 1AUVA 4FFOA 3SE7A 3RFCA 3JZIA 3U9TA 1DV1A 1EZ1A 4YBZB 2ZDHA 3V4SA 1JLLB 3KALA 5GONF 1Z2PX 4O7NA 4O7TA 4O82A 3VOTA 4RZQA 4O7ZA 4O7SA 2YRWA 2YZMA 3E5NA 2W70A 5CB4F 1KBLA 3BSYA 2FB9A 3TIGA 2CNVA 1KC7A 2WYOA 1A9XA 4YAJB 3DF7A 1BNCA 1KJIA 3HBLA 4QSHA 4E4TA 1PX2A 2X0SA 4I4TF 1W96A 2CQYA 3TINA 4IWYA 4HR7A 3GIDA 2YRXA 2GQRA 1GLVA 4FFRA 4YB8B 4MV3A 2R84A 1UC8A 4HQ6A 3AW8A 1AUXA 3VPBA 1E4EB 3U9SA 3Q1KA 3BSSA 1KJQA 3RV4A 1EUCB 3R5FA 4XYLB 1I7LA 4O86A 3OUZA 1Z2NX 1SCUB 1E4EA 1KJJA 4FU0A 2W6ZA 4ME6A 2FPIB 1GSOA 3Q2OA 1PK8A 2NUAB 2YYAA 2W6QA 3N8DA 2GLTA 1M6VA 3K5IA 1KJ8A 2W71A 3MWDA 5CA0F 2VHEA 3VPCA 2W6MA 4EAAA 3HB9A 2I8CA 3K3PA 5K2MA 5J2TF 2R7MA 1M0TA 1KEEA 4EG0A 1M0WA 2CZGA 4O7LA 4XYMB 2W6NA 2R7LA 2IP4A 5JH7F 1VBGA 5BPFA 4EGQA 3BSWA 4I55F
chains in the Genus database with same CATH superfamily
2W11A 1LKZA 1N2IA 1KY4A 1LBEA 4CHTA 1VSQA 1ZR2A 1E98A 5I6DA 1XYGA 6YASA 2FY8A 1ILEA 4GC9A 1NUUA 4IRMA 1B74A 3C0FB 2I3AA 5FTLA 4LGYA 3WDKA 3CIFA 3PRJA 4IIVA 4U00A 1P5HA 2AFHE 1VB5A 2Q6OA 3PLRA 2R7ZA 4AS1A 5D1HA 3Q3IA 1J8DA 1ND5A 1E7WA 5REQB 1CQXA 4WKCA 1C9KA 4BX9A 2C2ZA 1JILA 5CH3A 4BJHB 4HB4A 3NUGA 1EWYA 4L85A 3U81A 2W8ZA 3KUDA 4ND4A 2PGAA 1U8TA 3BIJA 3SDBA 4E3ZA 2FF7A 1Q83A 1NURA 1SU6A 3ZHBA 4KBFA 5IYZF 1PL6A 5D5PA 4B4KA 1P29A 1AQNA 2D00A 3ASUA 3X1KA 5JSFA 1FRVA 1H3FA 3EQ8A 4ZP1A 5IPFA 2A5FA 4ECYA 3M49A 2WPDA 5C51B 1W19A 4M49A 3R5XA 5CM0A 3PDUA 4QC2A 2JAQA 3LDHA 2O1SA 4WOBA 3O2SB 2GNAA 1GSHA 1DPFA 1Z7EA 3IOCA 3IEKA 1VHQA 5JC1A 4Y30A 3I05A 4GM1A 1JR3A 4YT4A 1IDOA 2BCJQ 2PL5A 2IYNA 4F9GA 3L04A 4MR9A 2QUHA 1CZHA 3H3XA 2O2CA 4R1QA 4YJHA 3TZKA 1A8HA 1ZQ7A 2IP1A 1KQFA 4OJYA 3GJTA 4A0SA 2VN8A 4QIWE 1ESDA 2XWJI 5IASA 4CHGA 3QENA 2VDOB 1TLLA 2P3OA 4PNPA 2WIGA 4RQBA 2FSVA 1Z47A 1GU7A 4GW3A 3RS8A 3GEDA 3FSGD 2B1GA 3P9NA 2VJPA 1V41E 1S2OA 4OQNA 1CFJA 3G6WA 4EEXA 3H13A 2OMEA 4ETNA 1QYRA 1GZHB 2R7KA 4O4LB 4EI9A 3VDXA 2LV8A 3PE6A 4MMZB 2FUCA 1VIDA 4L9AA 3NFYA 4G65A 4CM8B 3MF4A 3EWIA 4NBWA 1O6GA 5FEUA 1PG0A 4A2QA 2JJ2A 4LYAA 4TTIA 3GBPA 2XD9A 5KYWB 4UBLA 2VRCA 1EFPA 1RJEA 4F7WA 3T7JA 2R00A 3TR6A 1W52X 4K9MA 3JSXA 1SR8A 1WP4A 2E82A 1S3FA 4RA6B 3TBFA 5EERA 3DV9A 4LGCA 4X66H 3UAVA 4CMHA 3UCXA 1BRTA 1I24A 5C8VA 5H9VA 4AKHA 1U2DC 2DE0X 5KMGA 3B1XA 1BVUA 3BSYA 1YL7A 2GF9A 1DGSA 4FXOA 2GYWA 1EWQA 1FRQA 1PNVA 4BKOA 4BQNA 3CT6A 3Q8PB 2Q3LA 5BR8B 1L7EA 3AI7A 4FP9A 2Y27A 1NHGA 5TS2A 4FNOA 1HNNA 4MICA 4HR7A 2QROA 5D1OB 1SCIA 2ZSJA 1F8GA 4UNPA 1SEIA 3C5VA 5TQ0B 3QXHA 1O7JA 4DQDA 3TZLA 3R24A 5ALHA 2RCYA 2A4KA 3R0XA 5IMBA 3QVOA 3MUNA 5DEIA 4G1UC 4G0QA 2RKOA 4AX4A 3VR2D 2A8YA 1MAUA 1PJ4A 1OYOA 1ZIXA 4L4YA 3WJ1A 1BTOA 2FJ0A 4JX9A 2R11A 3KYIB 2ECPA 2HG8A 1M10A 4V0NA 1WXFA 3QPBA 2MSKA 1PBNA 2BWJA 1OWLA 1GNQA 4E5SA 5K8TA 2Z83A 3ZDFA 4RF4A 2ARKA 2X86A 2GK7A 1B73A 3OE5A 4TOIA 2GLXA 2C5GA 4UM7A 3K9WA 4IO0A 4AMBA 3PO3G 3A9WA 4Q6BA 2BFBA 3KE9A 1XQWA 3G5TA 1KFBB 4QXAA 1RR6A 3M34A 3UJ6A 4N01A 4MGZR 2QY6A 2YWDA 2NZVG 2CUZA 3IP6A 3C7AA 3PXXA 1EIWA 1V8FA 5JAPA 4CU2A 1GL3A 1WCMA 2ZUUA 1NBEA 4DN6A 4HJXA 4FYWA 2GD1O 3U4QA 1ZL0A 3FJ1A 3UHJA 5ITZA 2BZSA 3U3MA 1YI0A 2CVPA 4WK4B 4CODB 2VPQA 3PUJA 3ISJA 4NAVA 3D8TA 3O8DA 1TU4A 4U7WA 1RRPA 1CF4A 2UDPA 3HB0A 1FX1A 1QIIA 3IBYA 3DFUA 2IZ0A 1MO4A 5CM8B 1F4VA 5JCZA 4URYR 5J2UF 5IARA 1E1MA 2JIDA 3QEOA 3OCCA 4TQUS 1QCYA 2X3YA 3KPJA 3QPCA 3GLHB 3VU8A 3LQFA 1OBDA 1S8NA 2P3QA 4ZZ1A 1T5DX 4DF3A 5CDFE 4HQFA 2BKAA 1L1FA 1KTVA 2A3RA 1O95C 1XVIA 4BFUA 3MFQA 1BYIA 3GLGE 5IWAB 3IPCA 1RMYA 1SIUA 1CJKC 4B43A 2VT2A 2FK2A 1D4OA 1E8MA 2ZIXB 3WWCA 2IBMA 4KG7A 3ND5A 1KK1A 3SS9X 4JBXA 4Z9YA 1DDGA 3EVCA 1ZRHA 2RKWA 1SD1A 2HEGA 4Q7KA 4EW1A 1TK3A 2XT6A 3ZX4A 3GG9A 3JQFC 4BX8A 4ZEOA 1FVFA 3PZBA 1VL8A 2ZIZA 2W8BB 4QL3A 5TY0A 3M6XA 3G79A 4OGGA 4TGLA 1X7GA 4EY6A 2FN8A 3SY8A 3YASA 5KFJA 1R6TA 2ORIA 1USUA 4M1YA 3C45A 4RD2A 3DHEA 2PX0A 4D02A 2M6LA 3NH9A 3PX3A 2W7TA 4W6QA 3K1AB 2XH8A 2SKDA 3VPAA 3E3LA 4A0FA 2QM0A 4IKOA 4OM8A 1IIRA 3HCFA 2IFTA 2WA1A 2AFIE 2Y4NA 4PYJA 2MYPA 4KHPH 2V8BA 1S68A 3WDSA 1FSZA 2R7NA 5BO5A 2VDMB 2WPDD 1NJGA 2RKBA 3THWA 2ZBDA 2ZWVA 3WP1B 2IU0A 4KPYA 2HWKA 3HABA 2FSFA 3VR1A 4CM5A 3NPAA 3BEDA 4EGCB 5DYTA 1RZVA 3QVWA 4Q3BA 3MSCA 3KSDO 4BO6A 2UZ1B 4OK6A 3RO7A 3ZOKA 2VXYA 4MW7A 4I5EA 2BEVA 1E1QA 3E7DA 1RJPA 3U7QB 2WU3A 1CBUA 3KE8A 2ID4A 3HUDA 1QIKA 1TYAE 4N8DA 3GNLA 2HIAA 3OFND 4JR1A 1NSFA 1D3AA 3NWPA 1VL2A 2BIFA 5A6SA 4MTCA 4GPBA 2CNDA 1YFKA 2FLKA 3QSYA 1G6Q1 2VYCA 3E3OA 4QX6A 2OBYA 3RVMA 4MRAA 1L5HB 1ZX1A 3WL6A 1KE2A 2P2YA 3K4QA 2CYCA 5LQMA 5AUOB 1L7AA 1NQAO 2C4WA 4MS4A 1UJ4A 4D8WA 2WSIA 3RIGA 3VUFA 2H16A 3QBVA 3WGZA 4QM7A 2AOTB 4KR7A 3TQOA 2DFNA 3D81A 4BWSC 1RLJA 1OUMA 5JSQA 4NS1A 1MOPA 3ZDZB 4WWHA 1E5TA 4I5FA 5C5IA 4ENPA 3KKZA 1R5NA 2P6UA 6GPBA 2UUBB 1K92A 1KC3A 1C0KA 4PPQA 4R5MA 1JTVA 4C7KA 2Y0PA 4P86A 2ZBPA 3UATA 1EWTA 4HLUC 5JSZA 1XGKA 1XELA 2QN8A 5FOVA 4BB5A 1HM5A 1V4VA 4TN5A 4OHXA 4EMSA 3STVA 3JV7A 4YRSA 4D9KA 1B15A 4I4TB 4UFNA 4AZVA 4A2CA 1BHSA 2WUVA 3BORA 3HNRA 221PA 3RANA 5A3SA 3M6MD 3UJ9A 4O2BF 2X3FA 2VQ3A 2HSGA 2EATA 3UTCA 3FKIA 1H23A 4CLEA 1J70A 3R7WA 1XLWA 3GEEA 3PXEA 3R0ZA 3OOSA 1MZPA 4RB0A 2UVWA 5TJ9A 3GILA 1MH9A 3ICWA 3TX6A 4Q39A 1S5PA 1CR6A 2AHOA 4MO9A 1C1YA 2IZOA 4S1VA 2OGWA 1YL5A 5KJCA 1DAMA 4XA8A 1MRZA 4ZXFA 3CEBA 1Q44A 1X7ZA 4PQFA 3JZAA 1K08A 2IOYA 3FBGA 2HK6A 2IHBA 5DG9A 4EI8A 4XUCA 1QFYA 1W4RA 3U2QA 1X80A 4R84A 3HB5X 4TLMB 4WUTA 1PEDA 5JVDB 3WA7A 1Z4PX 4DA6A 5HQ3A 4ZREA 1I50A 2BD0A 1CJVC 4D2IA 5I8WA 4JI0B 1FMFA 5L4NA 5E6UB 5EOVA 5CK5A 1MJGA 2ST1A 4C5BA 3WAGA 1Z74A 3IUBA 1WCWA 4IHJA 2V59A 1ZGCA 4F93B 3R7BA 2OYCA 2ZROA 5B1HA 3VC1A 4D4JA 3CE6A 2JHPA 2YVKA 5JSUA 1QF6A 4BFZA 5H3HA 1EI9A 2A78A 1T0PA 1Q91A 5I7RA 1P7PA 4PU0A 2AFVA 2EEPA 4A6EA 2GSWA 3M89A 4FDUA 1NF9A 3QQPA 1O08A 3FKQA 3IUEA 2PKEA 3LOQA 3AVOA 3WWDA 2QF7A 4BB6A 1FBNA 3DDNA 2WT9A 4NG5A 5DTEA 2GKGA 4Z0NA 1AHHA 1KVRA 1JKMA 2HXGA 1VLVA 3THRA 1QF7A 4G23A 2NVWA 4KVZA 1TTQB 2FOIA 3WLAA 4K8OA 3GUVA 1TM3E 1A4IA 4ENTA 2I4LA 2ACWA 2YNMD 4FIDA 2B6HA 5ALYA 3E0XA 5DU2A 3JSAA 4WRRA 4DSAA 1AGNA 2YWJA 3ESCA 3U4CA 2W9BA 1R8JA 2JJ1A 3DEJA 1PR0A 4C5CA 5K8UA 3RE1A 2HTFA 2R47A 4X91A 1NN1A 1FRNA 3AY3A 3HV0A 1JR2A 4QGHA 3A31A 3VZRA 1S0UA 3VPHA 4K1XA 3C74A 3O8OB 1RP1A 1CDEA 1HQCA 2ZKLA 1ZXBA 5C7LO 3E5MA 1LNQA 3L84A 5GM2A 1K5HA 5B7QA 1PSDA 4WY5A 1YGYA 4RIEA 4CCYA 5FR9A 1MV5A 2ONZA 3ITKA 1S3SA 1QV7A 4HDRA 1U9JA 4RS3A 1VMEA 4QYXA 3HCCA 4P6VF 1T2NA 3RYCB 4ZCLA 4YAGA 1E9FA 3C3AA 1XIVA 1AVTA 1JPNA 3QWUA 4QATA 2Q62A 4OQQA 3ZG6A 1N75A 2Q5FA 3SWWA 4EAQA 1UEIA 3M6VA 3EWSA 2QN1A 3EZ7A 1JPVA 1T94A 3LFHA 5CX1A 4DARA 5KOHB 2YXLA 1Y5MA 1SBIA 1CIPA 2QU8A 3VYTB 4KODA 5HZGA 3THOA 1DIHA 2Q1WA 1CULC 4CKEA 3A3NA 2O5CA 5G4KA 5JAOA 2RH9B 4B3GA 5LOVA 2R62A 3R6GA 3CSUA 1P2SA 1U7WA 3EQZA 3F1LA 4UMVA 1ZM2A 3GJ7A 1ONPA 2R7LA 3M82A 3PB3A 4O5AA 2ZITA 2Z58A 4NV0A 4Y2YA 3NGMA 1JU4A 2VNAA 4AX8A 3HWSA 3DBHB 1O58A 3NKFA 2VPYA 3CKYA 3A9TA 3PC4A 4M0CA 3G8AA 2SNIE 3JCZA 2IF2A 3VA7A 4J43A 2XRZA 1TK2A 1H8EA 2FRXA 2GZ3A 5CB0A 3TM5A 1GUFA 3COYA 3UJNA 4MA5A 1WZEA 3BMXA 5FI1B 4BNZA 4RKQA 2HADA 3A06A 4IIGA 2F55A 1UZLA 3ND7A 4ZCRA 3STYA 5KFXA 3MPUA 1BXRA 4JLMA 2AUTA 3IEXA 4A92A 2QI9F 2XEXA 1YZ3A 3HCBA 5IH7A 1JDBB 2FJZA 2FEXA 1FSPA 5I7AA 3PQCA 1QH8B 2JEOA 1RIIA 4AZTA 5GM1A 4TTJA 1VBHA 2AKEA 5KFRA 3LHSA 3KAKA 4PIPA 1B8VA 1PV2A 4G26A 2HN9A 1EFVA 1YSCA 1V96A 4KQJA 4U2CA 5TVKA 5J4HA 3F8SA 3TSOA 3R9RA 1IXYA 2LIPA 1AY0A 4DDHA 1S0MA 2C07A 2ZAIA 3DE7X 3GFFA 1P5JA 3K0BA 4X45A 1P45A 3B38A 4ARZA 5CB4A 1B0AA 3GB9A 3R3VA 1FYDA 5BOSA 1JN0A 3TKAA 2NSDA 3I9MA 2YMMA 4B8WA 2QN3A 1RAGA 1GTJ1 4HYKA 1KO7A 2PD3A 4ZI7B 4RC9A 4ZEMA 2CB9A 1NUHA 4HWRA 4UFPA 4Q8EA 4OHCA 4R4JA 1NIPA 3K73O 1K8XB 4GSKA 2D2XA 3WYCA 5JS7A 1UT8A 1EDZA 3X1XA 2LGJA 5KNCA 3R9KA 1M6YA 5LFAA 4DL2A 5MFPA 1FFYA 1LLUA 3H8SA 2GXQA 4RDCA 4KYUA 3G82C 1ICIA 2NXWA 3UWKA 1YDHA 3G2QA 3ON5A 3PFKA 1Y7PA 3IQGX 2C8VA 4AKGA 4QDTA 3GROA 2C0QA 2ID8A 4Y7CA 2HZBA 1B00A 2Y67A 2CLKB 5EIAA 1TEHA 3ROGA 1A72A 4PSAA 4F2DA 4MEAA 3PO2G 4NCNA 4JYAH 3GI1A 1BMFA 5KFMA 2XCLA 3ZD9A 5JTUA 2J0SA 4PONA 4YTEA 3C4QA 1SHTX 4TQGA 3C7CB 4F92B 1KFEB 3PPVA 3F9RA 4QICA 5IVHA 1RIFA 1DSSG 5LP6B 2ATCA 2GAAA 2WW8A 4N6GA 1Y8QA 3QVLA 5H68A 5HP4A 3MERA 1DTWA 5ALPA 1UK7A 5LZ4A 4HAXA 3QLVC 1XDZA 4NOKA 3E8XA 3G3EA 3T7TA 4EBCA 3Q3VA 4HDKB 4O7NA 5FLXW 3Q41A 5DG7A 2ZBFA 3HCDA 4ZCSA 1COWD 1PP4A 2X3UA 3HH8A 2FSIA 3QPVA 4EBFA 3L8HA 1KK3A 1JT9A 1GQSA 4RIIA 4HX9A 3DEIA 1G21A 1PT7A 4WESB 1SBQA 2FPLA 4JI8H 1RDFA 2X0SA 3KYCB 1F14A 3CUEF 1RABA 2CUNA 2H5EA 5E95A 5FFFA 2WTMA 5LC1A 1V71A 1SXHA 4K9KA 1T0IA 2X2PA 5EWMB 3HUTA 5ARCA 5LMZA 2FFHA 3AC0A 4GI5A 4N1AA 1W30A 4H6PA 3GELA 2CNWA 2ZBQA 2FPKA 5IVIA 1Q19A 1E2KA 1KZGB 3KOUA 5ESWA 1CRQA 5GVRA 2PX3A 5IVKA 1SCUB 5KG3A 2HSWA 4AMVA 3K70B 2QDXA 3WKAA 3ZCXA 3AUJB 4CG2A 4LRWA 3FPEA 1H8HA 3NHBA 4RB3C 1XCLA 3UK1A 4WXHA 3UMGA 2UUCH 4MI3A 5ALLA 2Q5OA 1ZZGA 1QDUA 1TM1E 4POAA 3ZV5A 5FBQB 4UHEA 1E63A 2HJVA 3G1WA 5IZ4A 5DHQA 4TM5A 3LBNA 5BQ5A 2B1RA 3OTWA 4PLTA 4RA9B 2RDJA 3C3YA 2NYAA 1FP4A 4OX9Y 2GA9A 3QXCA 3TPFA 1ZAKA 3O8CA 4UARA 1FFGA 1MA0A 1OWMA 5ENZA 1CEQA 4F96A 4DCUA 1PZHA 4ZK6A 5BUZA 2Y66A 3KFLA 2R1UA 3RK0A 2HGXA 4CF7A 3D5EA 1ID1A 4F06A 2AVDA 1SKUA 3LTEA 5ER6A 5HIKA 3G6YA 2RONA 4JLKA 4DNQA 2PVPA 2HDNB 3A2KA 4POOA 2NSJA 1XZFA 3LYLA 4ZANA 1ZMRA 2G0NA 4CL8A 4N65A 5EIFA 3R74A 1L7RA 3EC2A 4AAYA 4G0UA 2NQTA 3P97A 1TRKA 4HQLA 2WAOA 2FF5A 1WVMA 1E4YA 4TL9A 3GZTB 4I55A 4I5IA 4GVPA 2PRJA 3I5XA 4K81B 1N8TA 1YDEA 3I30X 4Y2TA 3BQ2A 1VHTA 3WMFA 4JI7B 1QRUA 2QYTA 4XVUA 5JSHA 4BV2A 5K09A 2AWNA 2GM9A 5CD1A 1GJRA 2PZAA 4OSPA 2WTNA 2GNOA 3KLOA 1UWVA 1LRLA 1HNXB 3GFRA 1L4YA 3A3OA 3V1KA 4X94A 4DXAA 4DSZA 1MOQA 3AKEA 3CV3A 3IX7A 1PW5A 1ISMA 2J3IA 2WI8A 3DDOA 4D26A 2BI7A 5C1PA 4H08A 1GYRA 4FDAA 5J63A 2QL6A 1PJAA 4NJMA 4IUBS 1KRXA 1Y1PA 1CKNA 1CTQA 2GVZC 4OYYA 2O2SA 5IYZB 5GQSA 1G2OA 1L8OA 2FPSA 3HXOA 4ZT6A 3IPLA 2IPOA 2Y0DA 3WSWA 1J6UA 3ABSB 1SY7A 3UHAA 2XB9A 3M9MB 4N18A 2HJWA 1IUOA 5U1PA 1D6SA 1VI5A 4QQFA 1TECE 3BCHA 3WO1A 2VF7A 3V7UA 3LMLA 1E58A 1AMOA 4MV0A 1K4KA 4F5WA 1PTJA 2OGSA 2F3RA 1FUIA 1YVPA 4TMFA 2PKXA 1PD0A 4WADA 5MGNA 2Q2WA 4WNAB 3FVQA 2JLYA 1XKLA 3OZWA 3GEPA 1N4AA 1DUVG 4REQB 4WASA 1RHJA 2WICA 3KREA 1QX4A 3JD1A 1JLSA 2VDVE 5CFQA 4AYBA 3KCNA 3RGXA 4RPHA 2PRZA 5DLFA 5A2QW 4LGMA 3K94A 2FE4A 2GA8A 3CVZA 4BP9A 3RSHA 2J4DA 3TQIA 3HEMA 1GOTA 2RFLA 4IRCA 5E6SA 5FLEX 3PQDA 1G3UA 3DUFB 3BJMA 1JIUA 1DAPA 4E2FA 4CL0A 1MOZA 1IN5A 5BN3B 4FBGA 4A8JB 2VDKB 3U7HB 1C0EA 4G5RA 1U7HA 2HA7A 3H0CA 4FW8A 4EDFA 3R3WA 3ACCA 1D6JA 2QTGA 2RG7A 3VKWA 2QUIA 5B5SA 5ICMA 2FZKA 2JIQA 4BBPA 2HO5A 4LOLA 2YXBA 4TKLA 3T41A 1IYEA 4MWZA 5DYWA 3TY8A 3JARB 3K05A 1TXGA 2MOKA 3T3EA 2C9CA 3UMRA 3N6VA 5IVDA 1BMFD 1K3FA 4UCOA 3T9EA 3L8GA 4R2IA 3D8RA 2RHDA 4TQSA 2Z9CA 5KFPA 2O6HA 1VGRA 3B3JA 4LX8A 1V4NA 4YCBA 5FUBA 4XQ9A 3O84A 4W1PA 5KNCH 4O3NA 1L5NA 4KAAA 3RM3A 5HGJA 2F48A 2WZQA 2LCQA 1G20A 2OWEA 4DIEA 1KNXA 4KQ2A 3I8SA 4CEHB 2E2IA 3EMBA 1KARA 2BFNA 4C4ZA 2OEPA 2C84A 2PMEA 4TWAA 3RF2A 4AJIA 1NHWA 4MQEA 2CZQA 5AMXA 3KVRA 3TIVA 4U39A 4Z54A 4FSDA 4D3YA 5BSEA 1SG9A 3Q5EA 2Q7XA 2FMXA 3Q6MA 2B5WA 4DSTA 4QNMA 1X7XB 4FILA 3GJXC 3LCJA 4D8VA 4L5CA 1JFVA 1L3BA 1KEVA 4Z9BA 4WFQA 2P9BA 4G85A 2WTUA 3VU0A 2COEA 3QXXA 4AB1A 1C3VA 1Q0HA 3DOUA 5HF9A 3SLKA 5BRAA 3ZDYB 4CC5A 3R20A 3DOFA 5E3IA 2XNCA 2NQ2C 3PUVA 3CINA 1GPYA 1M8JA 4EFLA 1P19A 3TZEA 4JL6A 2G7MC 2JGAA 3W5CA 1YB5A 1I4TD 1X7YB 2Y0EA 2HU2A 3KXKA 1KHTA 1UMCB 1DIGA 1VSTA 4JVOA 1HX7A 2V6GA 1GPH1 1T36A 2HMSA 4NK5A 1AU9A 1IU9A 1EESA 2G0AA 4OHFA 3EEBA 3C6QA 1A95A 4G4JA 2DWUA 1F2TB 1KWGA 1MC8A 3OO0A 1KDYA 1TVEA 2OCAA 1NVTA 1SWVA 1ICEA 1AUOA 2ZXUA 4KE9A 1A9XB 2JEJA 5IUKC 1W36D 2QTTA 4IDFA 2OBNA 1I4WA 3HY6A 5BUSA 2IA6A 4G5YA 1CUZA 2WE7A 1HDGO 2GJSA 2CD9A 4M98A 2BAGA 3BN3A 4M7RA 4A2PA 1NJFA 5KFHA 4EKEA 2QTMA 1JA0A 3G0IA 1WVIA 1VG9B 1JE0A 3UC5A 3OM1A 3QUCA 3IUNA 1JDNA 5J2UB 1M33A 1AKQA 2IP2A 3D0RA 4GLWA 4RD3A 5F33A 4KK3A 2FKNA 1TZBA 4DR3H 4MDYA 1SEVA 4DUYB 3CGWA 2YJZA 1GAWA 2WG0A 2R8YA 5BURA 1SOWA 2CC2A 3GLVA 2IXBA 3CJRA 3QYJA 1ZAYA 3K92A 4J1QA 3VR3A 2Q5EA 5TQ2B 4O02B 2G6TA 2IU6A 1WV0A 3DTFA 4AXBA 4N3GA 2I91A 4DWWA 1SCNE 1JWLA 4O1IA 3FPFA 1JZSA 1RFLA 4GKKB 5EG5A 1K66A 4BMZA 5JD4A 2Q3CA 2HVRA 4CN9A 2R4TA 4PYLA 4TMVA 2Y0SE 5IDVA 4I9HA 5TRTA 4PF1A 5LPNA 3ZCRA 2C2BA 1KAOA 1KDRA 4OMFG 5KFOA 2QTLA 1K6IA 1RRMA 2OZPA 1EAYA 2G7ZA 2FE3A 4LRSB 3Q9NA 1AQLA 2JIOA 4WAUA 3AFNA 3S8MA 4B3DA 1SQFA 4BIIA 4RTOA 3PENA 4MRMA 2BEUB 1JECA 1HKUA 3NC1C 1NX6A 4P8RA 2EF1A 4KWTA 1U5AA 3O8QB 1G5QA 3W5DA 4EVSA 2II6A 3RAJA 1CS4C 1XDGA 2UVRA 3D02A 2I2FA 4EPRA 3ZK8A 1P0CA 4R3NA 2JA2A 4W5WA 3A6KA 1DTSA 1FDSA 1DRWA 5ESXA 3AW8A 3BK1A 2JAHA 4FJ0A 4O3PA 4NS4A 2GJ4A 4W63A 4BX0A 1LDYA 1M34A 3MMXA 5DBGA 3I2IA 3MRTA 1TZCA 4F8YA 5E7JA 1Y1VG 3Q9LA 4KO8A 3W9UA 6Q21A 1QMPA 1GWNA 3HYCA 3WLMA 1DWPA 2OBXA 4CLOA 2OLJA 5JH7F 5IDWA 3LPLA 5KFTA 1ESZA 2NUTB 3NOXA 2P6PA 2AN9A 4YYZA 2EBUA 6PFKA 3FPKA 3S3TA 1H6AA 3GB8B 4XH9B 1U3FA 2IEZA 4Z9AA 2KMLA 1C30A 3KU1A 2D0PB 3S2EA 3TTYA 3PTZA 3JATA 3ZHQA 1SXJB 2GAOA 1KZ6A 2M2IA 1QRSA 1UMKA 2W2OA 2HK9A 3G89A 4GI2A 1D2NA 1GFSA 2CSUA 3C15C 4HMPA 3ESAA 2FEKA 3UWOA 3A26A 5JBNA 4PTYA 4OQPA 1N0UA 1W9HA 3TFQA 3EDOA 5IMSA 3CSWA 3ET5A 4KN8A 4NVRA 4O7RA 5L6LB 5AKLA 3SIPA 5A0FA 4RNNA 5IYCG 4ENSA 4LF9B 4ZCIA 1YUMA 5MN5A 1LH0A 4CETA 2OM6A 3CEHA 2I7XA 3ZWXA 2EQAA 2YFHA 1M1UA 2KPOA 4K88A 4Z5XA 2VKQA 5GONA 3R7FA 3WR5A 1QRTA 3KWJA 3QYFA 5JEEA 1FS4A 4R2JA 4R41A 4O2BB 2BONA 1Z0FA 4WK2B 3FMOB 1G5FA 1RCUA 4ZAYA 4ZVMA 4X64B 4OUDA 4TRMA 2GZRA 3PI7A 4J1SA 5JAUA 3OIYA 2E21A 3ZIAD 1ELOA 2NN3C 10MHA 4XEHA 1RQ7A 3GIJA 4EWLA 3UTDA 2QRZA 4GLXA 3RVOA 3UK6A 2VL7A 1DT5A 4HT3B 4WCFA 4GMHA 3LX5A 4MVJI 2REQA 2FPMA 2H31A 1Q6YA 4XVQA 2Q2OA 3OE7D 2HAEA 3WQSB 2V9PA 2DUUA 2OSBA 4MIKA 1YVDA 4UU8A 1K86A 3DP7A 2MDTA 1MABA 4D3XA 3ZE2B 5MDHA 3BXGA 3DUWA 1RQLA 5ECWA 2JFBA 3VI4B 4AMGA 2Y1LA 4O4IF 3CRW1 1XPOA 3KAQA 3HR7A 5DE3A 3QKSA 3TOCA 3L6CA 4YUVA 5CCEA 1ET0A 2R48A 3K6SA 3H9QA 5TMEA 3OHSX 2W6JD 1O6ZA 2F8LA 3LHDA 5H83A 2CXXA 1J5EB 4H59A 3KWFA 3QVUA 4AY6A 2YN4A 2CDBA 3C7TA 2IBSA 1H0RA 3GP5A 3KT6A 2CXQA 2H07A 3JAWB 1SVSA 3ICEA 3BT7A 1TRHA 3DS8A 3OJ0A 1U2PA 2JIMA 1C4WA 2P79A 1XHFA 1V7PC 3QMVA 2C3PA 5IYBG 3K70C 4O3FA 3DLIA 3L1VA 4KDFA 5BYJA 5FYQA 3KV3O 4O6VA 3H4BA 1JR3E 4MMYB 1Z2CA 4LYEA 5H81A 3ABZA 3RSSA 3NWOA 1BYUA 4G07A 2O4UX 2AQHA 2AN4A 1NUQA 5BSUA 3JASB 4M2LA 1US8A 2QZ4A 3B12A 3ZKWB 4A27A 1EGMB 3ENZA 2EKZA 1HSOA 4UM9B 3RIHA 1FYVA 1AKEA 4ZHSA 2C82A 5A71A 5B58T 2FE1A 4TVBA 4Z9FA 1CG6A 2ZIGA 1QGUA 5HE8A 3PN1A 1Z39A 4TX1A 4EF4A 5IKEA 1L7BA 1Z4QA 1O2DA 4DRXA 4MGKR 5YASA 1YB2A 1EVZA 4LQCA 1X74A 5CFRA 1NE7A 2BR3A 4RPGA 4LJLA 3LW7A 2RGCA 1T9CA 4GGPA 2GWRA 1ZN2A 2XKKA 2YVQA 1E2QA 3HJFA 1Y3HA 1TDJA 1USIA 5FTKA 4J9KA 1XALA 2FWMX 2B92A 2HCRA 4ND1A 2K5UA 2PX4A 1B7GO 3L1KA 1FSGA 1Y34E 1Y9JA 3FCSB 3BQ0A 2WTFA 3KB8A 4MCAA 3FOAA 3NNDA 1CY0A 2PUHA 1CP2A 2FX5A 2OP0A 4ZAXA 2VPPA 3L0ZA 2R6CA 4H1HA 5L4SA 4G4IA 5EWEA 4Z0TA 1H3NA 1CUCA 3HM9A 2UVUA 1Z26A 3ZBQA 1DRKA 2V58A 1OMOA 5CTJA 3CG4A 3FR7A 2P75A 1C3OA 1I51A 3T4EA 2GD2A 3F6BX 2ZYDA 5KNLA 1F38A 5KFUA 3L8EA 1IUKA 2OENG 4LF4B 2WSBA 4CQMB 1U94A 2VNSA 1D04A 1XK6A 5BR7A 4DV4B 3H1PA 3T0GA 4B4DA 4CM4B 1QZXA 5CGZA 2BELA 2C00A 1JMKC 3VV2A 2GM4A 1GEEA 3GJ5A 5MN6A 3NT4A 4MV7A 1AO0A 2QZPA 1FMTA 2NXJA 4ZRDA 2FDXA 4X1YB 4AIRA 1NC1A 4GOMD 4FN4A 2CNOA 2FFBA 3IJ5A 2XCRB 2XT9A 1ZD2P 2QYOA 3WIUA 3EOBI 2XDQB 1FQOA 1QRAA 3BABA 3NCTA 2QE7D 1M2JA 1CUEA 5LQSA 1DJMA 4L02A 1A27A 3D7KA 2FSSA 4DWOA 1RADA 4US2R 5GJCA 1DV2A 4DM3A 2JHFA 3EAGA 1EUYA 1TVCA 4DUGD 2CLSA 3IT2A 2O57A 2VH5R 2QHXA 1OJ7A 3TDNA 5DLDA 3L6UA 2X2FA 2GLUA 4JXXA 1ZVJA 2QSZA 1NY6A 2IUTA 2CNUA 4FGRA 4YA6A 4RGYA 4CMAA 1SBNE 4I50A 1FVOA 4PZEA 1AGYA 2NP6A 2W58A 3S55A 3AYHB 1ORVA 4BXOA 3A9RA 2QD3A 3HBAA 2PCJA 3NHSA 2B35A 4M99A 4X5OA 1E2BA 1JZTA 4TUYA 2CF6A 3FCYA 3CX8A 4A8JC 1Q3TA 1CJBA 3QKUA 1P9RA 4O2AA 1KEKA 3MUEA 5EYPB 1ES9A 1XTIA 3CRQA 1SUAA 2C04A 1UZAA 2WD7A 4DA4A 3L07A 3USCS 4ZDJA 1OT5A 4BVHA 4GEKA 4J9QA 1Y89A 1AKMA 1P2FA 3ZOZA 3ILHA 1P77A 5LWHA 1P1HA 5JWOA 3WY9A 2XE8A 1GGKA 4P7BA 1QO0A 4OGFA 3KX2A 4RNCA 4HFJA 2I8AA 4O7ZA 1E61A 4O7SA 1HI9A 1NNSA 2QUZA 3RB4A 4GH5A 1CNMA 4IXTA 1ZJZA 3I92A 3CT4A 5M29A 5JATA 1Z4JA 4TQAA 3DF7A 5F76A 1EK1A 4OY3A 3EIWA 4RSGA 3SIWA 5ALTA 3KO8A 5DSZA 5IM4F 1XJQA 4A3JG 2BJVA 3UT5B 5HSGA 1RLIA 1ZM3A 4BS9A 1GGVA 1MQ8B 2R8RA 2JGDA 3ZWQA 1SRRA 1UKVY 4IBOA 3OOJA 4X62H 1CSEE 4OTZA 1NV9A 1NX9A 2HWWA 4GI1A 3W3AA 3BD9A 4O3RA 1JLRA 5IUNC 2KLHA 3RHZA 4C0HA 1SBYA 3QIVA 2RGEA 5JSKA 2XTZA 5AHWA 1OBCA 3PQEA 2J87A 4F86A 2W6MA 1K1QA 3MXTA 3TE7A 1JIXA 4RABA 1Z17A 4HAYA 2CMFA 4EB3A 1O97D 2ZETA 3DKIA 4JV2A 4URUR 4Y2GA 3RUFA 5AVXA 3RUDA 4YAFA 1J8FA 4FNGA 5ES3A 3PXBA 1R0XA 3ZDBA 4L74A 5KQPA 2CXPA 1WDMA 3AU9A 1HRDA 4OMCA 4UHFA 1VAJA 2X6RA 3DL2A 1LLFA 1Q20A 5IBCA 1Z6GA 5DM60 2DETA 3NHZA 1Q3KA 2Q0XA 3KKMA 1L7NA 4N8SA 1RPZA 3DB2A 1HYGA 1JH9A 4EB6B 2B4KA 1EQAA 5I7EA 5CB6A 1Q11A 4K6KA 4NCHA 1PLKA 2AGQA 5F12A 2SBTA 4UBJA 5H3LA 2M98A 4NBKA 2EJ2A 4MNTA 1GCOA 1T0JB 2C9MA 2CJFA 4B1FA 4DAAA 3TZHA 1I2ZA 2HLDA 1OB5A 1IZZA 4KVFA 4JQCA 2DR2A 3V7FA 2WWGA 1CEEA 2XTMA 3G7UA 3R1IA 3DP9A 1G5HA 1B2LA 4G1EB 3O1JC 2JJQA 1L3IA 1YI1A 3S2FA 2Y2VA 4BO2A 3A6EA 1VMIA 1CY6A 4FK8A 1YQTA 4QA9A 3ASYA 3DC7A 3ZR4B 1LJUA 4Z3KA 3MTGA 4MB0A 4F4YA 5B6JA 3HSSA 1MAAA 2GEDA 4G0MA 1K8ZB 3M5WA 4TRJA 5CBPA 3S2UA 1RYYA 4OFWA 4A1FA 3VU9A 5AXAA 4PG4A 3UUEA 3QOWA 1YA8A 2P9FA 3PT5A 5AVWA 1PSZA 3H05A 5HRCA 4ZCTA 3TW6A 3SBDA 5E7IA 5KUTA 1A7UA 4DJEC 3CNBA 5G02A 3BE5A 1JR3D 3CKKA 3T06B 2Y0BA 4NOLA 2R8PA 2PGNA 4GR5A 3TUIC 3ZZNA 4H0FA 3V42A 1EVIA 2GN1A 3N0RA 1X0VA 3GQCA 3PPIA 3C39A 2BFCA 4BRZA 3HL4A 4AQYB 4IAOA 5C7YA 1NPTO 4KRGA 2YIVX 3VNSA 5AVQA 3L40A 3CWZA 4RTKA 4TYWA 2AMVA 3CH7A 2XXJA 3QFTA 1Q5PA 1JPJA 5COBA 3E0QA 1RTKA 3FPHA 1YIDA 3T1HH 3CB4A 4FYHA 3J7AK 1LPBB 4KV7A 1T5LA 4Y18A 5K3FB 2YW2A 3BIFA 4S1PA 3D59A 1U2GA 2NZ2A 1CQIA 1E3IA 1G41A 3KPVA 1GQ2A 2NV6A 4XB1A 3TRIA 2WV9A 3SZ3A 3WNDA 1FP7A 1SD5A 1XEXB 4TSKA 3Q8MA 2DFVA 4JI2H 2JJ2D 2UYGA 3SC6A 5IWCA 4BO0A 3VJLA 1W4CA 5AKHA 3WDLA 5J4YA 1JHAA 1JG6A 2VRCD 3EXIB 4RWEA 4J16C 4QT0A 4KIFA 5DCYA 2OBBA 3STTA 5DZSA 5T57A 2EKPA 4MUMA 2ACKA 5GGXA 5BN1A 4F4HA 1RC0A 3H97A 2X8AA 3I04M 3NBMA 1KVSA 1CY7A 1YJAA 1ADCA 3P26A 5B1EA 1CDOA 3A6HA 3WBKA 2XWBF 3KHHA 2EC5A 3B53X 3PFGA 4MOWA 4HTFA 1H69A 4TMWA 4UATA 3A1CA 4V3BA 3C3CA 1E20A 1R2QA 2OCKA 3HXKA 2Q1YA 3C4JA 3UMSA 1FPQA 2C4KA 1C9JA 1C8LA 1H6DA 2QBYB 1H0SA 4L50A 1NXTA 3IURA 2YFYA 4HQ6A 1M6HA 4D74A 3VTZA 1VZ3A 2PU7A 4OJMX 4GD3Q 4BYGA 4BZQA 1P3Y1 2YIMA 4K40A 4B80A 1YGPA 1WSWA 1CNEA 1NC3A 3PSHA 1Z37A 1JAZA 2NUAB 3V4FA 3IUMA 1HOXA 4ZZIA 3T9BA 2WBLC 3AV0B 3GL9A 5E1MA 1YMVA 1G2WA 2B8WA 1GYFA 1R6XA 1P8AA 3AR7A 2VSFA 4FWTA 4H6WA 4I6GA 2GHQA 1A7KA 4Q4JB 2QENA 4XTRA 2RHBA 1BE0A 3N5CA 2QD1A 1BAPA 5IJ9A 2AYZA 4ZPJA 2OQRA 3COPA 3O4HA 4Q1CA 3O5AA 5BW8A 3UKDA 1R4MB 4M7OA 2UYCA 3LFTA 2VR1A 1SA0A 3JVIA 3VNRA 3ESZA 3TVYA 2ZOSA 2DPJA 1IATA 4M8LA 3S2GA 2FRVA 5FFMA 4ER7A 1VYVA 4FYKA 4R54A 4HRVA 3N2KB 1UBKS 1EUQA 4L2IB 5J4LA 1DELA 4JJEA 2J4CA 5FA5A 1NDUA 1P74A 4UDOA 5KG7A 2VUHB 1I6UA 3OIFA 3KXYT 3AEUB 3KUKA 5G1NA 3DTYA 1IPHA 2AN5A 2MINA 4L76A 1XNRB 1REQB 5GADl 3OSZA 3K71B 1QFJA 2C5LA 4U5QA 1OGYA 1QE0A 3C43A 3JQBC 2ATEA 4KSCA 4TPKA 2DPMA 3I0NA 8GPBA 1OY1A 4EW2A 4X54A 1IJBA 1AA9A 5A05A 3N6XA 2W37A 3F7MA 1VMAA 3BJIC 4I2VA 4R8LA 4PX5A 1SCKA 1UDAA 2WHRA 4HNUA 2DQSA 2DFDA 4UEOA 1XDBA 3OY2A 4R1OA 2XODA 3DTNA 4XIGS 2YOGA 2AQIA 2GN9A 5BN4B 3FN4A 3UPUA 4WLEA 2C2OA 1HT3A 5FA6A 3RG8A 1KK2A 4UEJA 3GUHA 2W57A 2C2XA 2QW1A 2W2XA 4BWGA 3M1LA 1XTRA 3WYDA 1Z2DA 4E2XA 5JCOC 1T1GA 2FR8A 2WSYB 2QM3A 3VBCA 2IJGX 1WPQA 3MWJA 3AM3A 1I5EA 1N1DA 3CCCA 3TW8A 1C7FA 3W3AH 4BU0A 1SXPA 2MMGA 1NVXQ 5ERXA 3MJRA 2QQGA 4KGXA 2ON6A 3DO6A 4A91A 1Z25A 5DK4A 1GLNA 1ENOA 5K8IA 2WDPA 3MCVA 4JB2A 1KI3A 4NXMH 4IR1A 1GCUA 1QHFA 3PR4A 3T7SA 2GS9A 4QWMA 5K01A 1FVXA 1Z0SA 4CKZA 4F4UA 4U8GA 1W85A 2QTNA 3W0LB 2Q3EA 4CF4A 5ALZA 2AS0A 4CZ2A 4TVSA 2P6RA 3WFIA 1EVEA 3LLMA 3MAJA 3KD3A 3R3XA 1VFPA 1YT5A 1KIFA 1NI4A 2NOAA 3LKDA 3W34A 1JV2B 3TLGB 4E31A 2GDZA 2BCGY 2IUEA 4FR2A 3ETLA 2C42A 3FCAA 2P2GA 2ZS8A 3RT1A 3UBMA 1ZW1A 1W5AA 4X1OA 3CNQS 4DE5A 2Q9CA 3L4JA 1DRJA 3R3HA 3C8ZA 1I1OA 4B81A 1IOLA 3I1YA 1QMGA 4DQKA 2FN4A 2PG3A 5TEVA 1IG0A 4ENUA 2JFHA 4X9XA 5D87A 3K0FB 1JT2A 1F8XA 3LDFA 1HYEA 1WXDA 1XLVA 1E1QD 2HMUA 5BNFA 2JGJA 1SQGA 3UO8B 5FORA 4NYIR 4V3CA 1KXJA 2VJMA 3TR0A 5LLDA 1T35A 4WINA 2H1WA 3IBCA 1UM9B 1QLWA 5FF9A 3SXUB 4JT9A 5I01A 1JHRA 3BKXA 4O4JA 2NP7A 3W2IA 4FEYA 1E4EA 4R98A 1YOVA 2GJ9A 4GBGA 2FPIB 3CMCO 4IZ6A 4P0QB 5ENVA 5G1OA 1M6VA 4P3NA 1U8CB 1ZRSA 2QLNA 3KZ1E 1OX6A 1XP5A 3C41J 3GO4A 7REQA 2AF4C 3ZHRA 4XB6B 5AOVA 3U6BA 3JD3A 1YRBA 2ACVA 3V8RA 4V0KA 2OAP1 2WLTA 3OD5A 2FUG6 5F7JA 4I7EA 2WDTA 3R0JA 4I1IA 4NX2A 3BE6A 4NCAA 1ZMTA 3ELYA 4E5YA 3LBIA 3U44A 1GRRA 4ZEXA 1TPZA 1YC2A 1FQKA 5AH0A 4PR0A 2XHZA 5MF6A 2A30A 4RE5A 3FPCA 1G21E 3HU3A 4K6MA 2FZVA 2ZJTA 3T5KA 2WC1A 1XKXA 2EW1A 3PI6A 4GLOA 2ECKA 3RQIA 4IZOA 5CLLA 4LE2A 1GU0A 1EM6A 2XAUA 3BZUA 5IANA 3N7UA 3Q98A 4P5PA 3IAUA 2PYDA 1FF9A 5EVCA 4XFJA 4U63A 3NC0B 3B51X 4FX2A 1XTSA 2OHJA 1ZBQA 3U3ZA 2JVIA 3J81k 3DEHA 1K7SN 5JH7B 1G9SA 4ZD6A 2QRPA 1TU3A 1QANA 4L7QA 3SKYA 3DKVA 1FFHA 1ZM7A 3OTQA 2X42A 5AVVA 4OFZA 4RX1A 1DKUA 3JYQA 5JFGA 4QEZA 1XTBA 1N8KA 1U2DA 2QYHA 4DQ0A 4QJ5A 2G40A 1Y1VA 5AQ1A 1DJQA 2ZU0C 2HJHA 1UZUA 4G09A 1U0BB 1N5LA 5EQTA 4BEVA 3CEPB 2BHRA 3UAWA 5L6MB 3RFVA 1ODTC 3H7IA 5HQJA 2Q7OE 4NY1A 1EGAA 2HK7A 5D51S 3QI7A 1RWKA 4YASA 4A16A 1IRXA 1YS9A 2O19A 1XVAA 2HMWA 1UJBA 2X5OA 5KT2A 3SNOA 4TKMA 2WM3A 1DX9A 4WNYA 1UF9A 5AJYA 1BN6A 1L5SA 4PX9A 4I6JA 4K6CA 2FW7A 1SUCA 2XUGA 3IR6A 5CDUA 4QYTA 4M60A 1ZEMA 1AG9A 5HOQA 1IN6A 5KIAA 3OP1A 4ECQA 5JWHA 1ZCBA 1F1BA 2GO7A 1IZYA 1GZ3A 1MZBA 5ALJA 1U1IA 2O7QA 1QVVA 4NC9A 4QLOA 3Q3JB 1ECLA 1BEEA 3WK9A 1FQJA 3K0CC 2AYXA 5JI2E 1J1UA 2N1BA 2ZUVA 2GEBA 2ZIUB 1OVMA 1LRJA 1YRAA 4RIHA 5LYJA 1T3NA 5F23A 2JJ1D 3NBQA 4YI5A 1R6BX 3G7SA 1R15A 4TWZA 3SE7A 5KTPA 5A1TA 4PSCA 1C2YA 1VJRA 1ZETA 4WZAA 5FUYA 1LC3A 3OSPA 4P5EA 4J2HA 5ALDA 1EEHA 3A1FA 4O4IB 4E5NA 4IVRA 5TIIA 4WMLA 1E9BA 3MJCA 3EXEB 4KR2A 3MK31 3OLXA 2FCRA 3ZVRA 1DADA 3WGNA 1P3JA 4FS8A 4B3MB 3KK0A 2DM6A 2QRMA 1BFUA 3PLNA 3UMFA 1VE6A 3TPCA 2XF8A 3GZNB 4CKCA 1Y9AA 1PJ8A 4X8MA 4B3RH 2O0JA 3PRYA 3OF3A 4PAMA 4RKYA 2DHQA 4NZNA 5KPDA 3SQXA 3TLXA 3LL7A 4FFBB 4XQGA 3FTPA 1Y8ZA 1KOFA 1I2DA 1OXXK 2GQ0A 2CFRA 4XWOA 1GNSA 1ECCA 2ZIEA 4ZO6A 3REQA 1MPTA 4E30A 2AG1A 1ZJ6A 1QUEA 1KSFX 1UBEA 1T6XA 3EPGA 1O95A 3U31A 1D2AA 1QHNA 4JLJA 1HGXA 1M0TA 5FOXA 3R5KA 1QQTA 1ML4A 3HCAA 1O03A 4AULA 1DKMA 1LDEA 4ASUA 4UUOA 1HTWA 4AYBE 1PS8A 3OIVA 2JLQA 4UXHA 3P32A 2HQOA 5F2OA 3JZFA 3WA6A 3CEMA 4MH0R 3CUWA 3RJZA 2PBFA 3AF5A 3JQFA 4ENVA 3DZBA 3KT3A 3DTVB 1PR9A 2PX2A 2YZ2A 4EJ2A 1J2UA 4DMUB 3HDTA 1MO2A 1EK6A 3S5JA 4UMEA 1AN7A 3JSLA 2H4WA 4BNWA 1YB7A 5DNAA 1ZIOA 3WKDA 1H8ED 4M7PA 4IDQA 4E0BA 1RJ9B 5NLLA 3OPQA 1YWGO 3OEEA 2QT9A 2HDWA 4D6XA 3WOHA 1SOUA 1S4QA 4ER6A 1ENYA 4BY1G 3IDOA 3OOYA 3AR3A 4Q0YA 2X76A 1S3GA 2C4MA 2J3KA 2AGVA 2AVNA 3PPYA 4G0XA 4AJHA 2FFQA 2W4IA 5M04A 4NMHA 2J8ZA 1BH6A 1XQ6A 1KETA 3EW7A 4QVGA 3C6BA 5HW0A 2Y1GA 5IRCD 1AQUA 1WD7A 1L8XA 2CK3A 2NU8A 3LP6A 2G04A 4WKOA 4XZ3B 1T8SA 2ICAA 3QUQA 3L7BA 2O0KA 4N0QA 5THQA 2O8BB 4NYEA 5EI5A 2BDTA 4MITA 3SSNA 1X1DA 3DAHA 1L9XA 1YACA 4RZSA 1GNLA 3O4RA 3EUWA 2ZUTA 4Q4HA 1G20E 4G36A 3ZUGA 4LFBB 1G0OA 3JQ8A 5IT9W 7ABPA 2ILTA 4S2UA 3A3YA 4XRRA 4H7KA 4LMAA 4F3TA 5KFEA 1PWYE 2C61A 3OWHA 3GJZA 1JRLA 3SFZA 2UU9H 2XGPA 4YRKA 5HRAA 4ZQIA 1Q0TA 2O48X 1MEOA 2O9JA 3TJRA 4ED7A 1B3RA 3O8LA 5KNCD 2EDAA 1Y1WG 3KT0A 5CVJA 4FE2A 3SR3A 3OVMA 5AHXA 4N5LA 5B2EA 1ZI8A 1H5NA 3PGLA 2REBA 1XMJA 2BP7A 3R23A 1QVRA 4PZZA 2J67A 1UKCA 1RWOA 5FR2A 1TYZA 4CGYA 4LJ6A 5K5EA 4DR4B 2HMYB 4HLUA 2QAGB 4GZ5A 2XKBA 4FUQA 2VSYA 4F4WA 1WBBA 3GTLA 4X97A 3IHTA 4JC0A 4RLFA 2HRBA 3RYTC 1NT2A 4F4XA 5K3CA 4ARCA 3JRWA 1XMXA 2O03A 2XW6A 1N7GA 2QTCA 2HT1A 4TLDA 3W3ZB 4Y67A 5EP2A 1Y3AA 5FQNA 2X9VA 3UXEA 3V4SA 1HRKA 2XMRA 2EJCA 1EM8B 3ENNA 4MS3A 3AG6A 5BVHA 1TVKB 3GF4A 3P9CA 4R2MA 2OILA 3TFOA 1X9GA 4KK4A 1ACMA 3TQ1A 2ZT6A 1GRCA 1LS6A 3IEPA 5A4DA 1W6RA 3H5NA 4XEUA 3C1OA 1EVQA 1W2GA 3VC2A 5FWDA 4BBRG 3FZGA 4G1MB 2CNNA 1ACLA 4RH3A 3MNFA 1ZY2A 4FFRA 5BSVA 2BKUA 1BCSA 1QDLB 1NNUA 2OPHA 3L1IA 3LZCA 1W1IA 3QKRA 5L1KA 1AGRA 4URZR 1OV4A 2MYNA 3OTIA 5DM0A 1VYTA 2CNWD 2GBCA 3RADC 1JKFA 2V6JA 4OHKA 2ZVJA 4M55A 4HS9A 1I10A 4TXNA 1OGJA 3MT7A 4YUWA 5G0WA 4C6TB 5KTYA 1H8HD 4GE3A 5FWYA 3MWEA 5G2OA 1JKJB 5BSMA 5IXYA 1TYEB 2I76A 2HLPA 2F1OA 4QNRA 3K6RA 4PZLA 4BV8A 1YJCA 3BXPA 4X20A 1BSVA 4J2OA 1M2VA 5UKDA 1KYXA 3FI0A 1DIKA 3BCSA 2F9LA 1GKLA 4B3XA 4MV4A 4KTTE 1M7JA 1CUFA 2HA2A 1UEXC 3ZWPA 2AHRA 3EUFA 4A0QA 1PKEA 2ORWA 3IDQA 4H16A 4JJ8A 4YI3A 3UJCA 2KX7A 1RT9A 4IQ4A 1GKKA 4NAHA 3QVJA 3NV9A 2GTIA 4RKRA 2C3MA 2ASDA 1XK7A 1CW2B 3RAPR 4RZ2A 5DXAA 1GTRA 5CG1A 4LHYA 3KBOA 4QW8A 2XVYA 4FVTA 4F84A 1TW3A 1M9NA 3I01A 2JA6G 3PQFA 3WNVA 3HG7A 3F5QA 3U13A 1QKJA 1ML3A 1M34E 2HA3A 3TX2A 2Q29A 3B6MA 4MAMA 4ZVQA 1LX6A 3HU5A 5IBQA 3H0KA 3A7DA 1HLFA 1PDWA 3IPRA 3O47A 1BS2A 3WB0A 1CE8A 4FOLA 1XMQB 1W0CA 3QW4B 3SS8A 1BE8A 2H52A 1NR7A 1N4DA 2A1TR 3OIDA 3P4XA 2IIBA 1W76A 3Q3EA 1NR5A 4YAKB 2MSWA 4ASUD 4KQIA 2AZ4A 3FNRA 3BPSA 2AG6A 1GAXA 4LXHA 3G8CA 1R9GA 4M9RA 4EABA 5CYGA 1BEZA 5D7NA 4Y8VB 2ZCUA 5B4TA 1Y9DA 2WKWA 2CMHA 2NU9A 5B6IA 3ESBA 3AKZA 1JJIA 3PNPA 4H1UA 4Q1DA 2JF0A 3D1JA 1WXIA 2XUAA 1E4FT 3ADBA 3P2KA 5DGIA 4J8PA 1JVSA 5LCXA 3OJEA 4HWTA 1J0EA 1N2CB 1UKZA 3IHWA 3HBJA 3FNIA 1OLSA 1VJ5A 4RK1A 2H00A 1VJTA 4DLKA 4TKUB 4RV4A 1N6RA 4FGKA 1G5PA 2Q2TA 2YH2A 1AK9A 1LPNA 3L6OO 1V8DA 1U0JA 1OA1A 3P0IA 2V7WA 1I3OA 2D3WA 4F71A 5KDDA 2AG5A 2FZCA 2P1DA 2NZYA 1NP3A 1MW9X 3ZE9A 1DAEA 1XL1A 2RI0A 3G2PA 3CWCA 2QMZA 3TTUA 1JDBC 2VJYA 3HZHA 2R6AA 2G25A 3U3KA 2WP8J 4A2AA 3OZBA 4RO0A 3H1AA 3MCZA 1L5YA 2HM7A 3GOQA 3AETB 1AKWA 1XEAA 2QLTA 3M1IA 3X2FA 2XQVA 3GZJA 2NXEA 4I4LA 4NV3A 5C5DA 1QIFA 2B8NA 1C3EA 1JLLA 3OU7A 2A88A 4NPHA 2VBGA 3KDAA 3BQNB 4OG2A 1MV8A 1SC4A 4L28A 4DYDA 3DW3X 4YAJB 2FSHA 3MTBA 4BNTA 2C03A 3OHBA 3EHEA 4EZIA 1E5QA 4QOFA 4FZ3A 2B2CA 4BAZA 1HDYA 2BH9A 4LF8B 2CCKA 2JARA 5EY5B 5F1PA 2QAJA 2BE9A 4M22A 3DZJA 3COJA 2O8CB 5TJHA 1A76A 2ZTHA 1NQTA 3V3TA 1TF5A 4JKOA 4O4LA 4P3YA 2WTEA 1OAOC 4ZO7A 2DUMA 3PE4A 4ZGWA 2K87A 4N5NA 4FZJA 4ME6A 4L6AA 3IAEA 1LWOA 1B0PA 1GTZA 3TLYA 4EFBA 4QHYA 3ROPA 4Y6SA 1C14A 1WPGA 4Y6GB 2AJLI 4AWBA 3PFWO 2F4VH 1D8TA 4RVOA 2IX3A 2ZT8A 4XDZA 1HZZC 2XDWA 2CXHA 2H1HA 2PRKA 3GRCA 3U3XA 1LF5A 3I9FA 5JCXA 1P62B 1CUAA 2I3GA 4XOUA 3IT1A 1R9MA 8LDHA 1JJ7A 5LP6C 1ONBA 1NMZA 1P1JA 5GV7A 1RZUA 4UTRA 2LP4Y 2REXB 2RK6A 1ZU5A 3WIBA 3BWEA 1KVTA 1U8ZA 3F71A 1Q1EA 1AUQA 1L4KA 4HPJB 2FK8A 1GGOA 1Z6YA 1YQDA 1SN7A 4ZC1A 2WILA 2VHWA 2IV2X 1KI6A 3E22A 4GDFA 3V6KA 1XVVA 1EUZA 2DFPA 3NDPA 2EP8A 4U6SA 8AT1A 4S2EA 1RWWA 4DCJA 4K8RB 1C1XB 4AY2A 3AHJA 5D1NA 1EGHA 4FS1A 2FZWA 3MIZA 4CKYA 3NUAA 5GGYA 3NUZA 3EVBA 3QLVA 3D43A 2HJ9A 1JWAB 1PYDA 2L0XA 1CLEA 1XWIA 3L8DA 1QQ6A 1THTA 4GX1A 3VAAA 1YQEA 5CCXA 1RQ2A 1HR0B 2O2JA 1KYQA 1RXSA 3FMFA 5U9CA 3KYBA 5JZBA 2ZM6H 2DTDA 4EECA 3FPBA 1H6BA 2AOUB 3TTXA 2VT7A 5BYBA 3I58A 1F8YA 1PQYA 4K28A 4Q4AA 5K0EA 4KOEC 4PZ7A 3PZPA 1R8SA 5KFYA 3U19A 3IAHA 1MAWA 3CMMA 3CVXA 4DBLE 4URXR 1TCUA 1Z5OA 1P0QA 2BL4A 1OZHA 2VF4X 2FZ5A 4NWIA 4LV8B 4FJ1A 1BFKA 2R8GA 4HYYA 5HIJA 5JPCA 2DPLA 3FCEA 4TKVA 4WBNA 4R01A 2R6JA 5JTTA 1MHTA 4UHJA 1FEZA 1R5BA 3IA7A 3WK5A 2LTAA 3KYDA 3A1DA 2Q5CA 2QP3A 3AJEA 3R8CA 5HKBA 5J2TA 4XX1A 4OBBA 3FB1A 1JLMA 1IHYA 2FK1A 5A04A 5B1YA 4N82A 1UBFA 3MT9A 2C4TA 4BMOB 2XVXA 2JFNA 1A0IA 1IBSA 1ZI6A 2QU7A 3MR6A 4IXDA 1GR0A 4OQMA 2F64A 5EKXA 3FPJA 4MYTA 4MLZA 1JIQA 3F78A 3VR3D 4KXVA 5K4HA 3N2LA 3LUGA 4DV5H 4DCMA 2QTRA 1WCIB 2JIZA 3JQAA 3D6HA 4KJXA 4YBZB 3ROEA 4D5GA 2CNLA 1UIMA 1Q50A 1FFSA 4TRNA 4UASA 4IJ5A 1GA6A 3QLUC 2WA2A 3L7LA 3UQ8A 1ZR4A 4BNHA 3KETA 3IGFA 5DM70 3D7LA 4I1SA 3VO8A 5SY4A 1CR0A 1O5OA 1B33N 2H51A 3JAMW 1N5JA 2VDLB 1LV7A 3TS1A 2BKEA 3IJEB 5DBOA 2O2DA 5CYOA 1KRWA 3RSLA 1P1BA 4RMNA 3F6YA 1GCIA 1VSUA 2FLVA 1G8JA 4LZPA 4IFBA 3MJVA 3IRUA 2YWBA 1U8AA 2Y6UA 1IZ7A 1GIAA 3EPPA 5EJ7A 1ODFA 3DBVO 4HO1X 4EKYA 4XFKA 5KSPA 4CUZA 3ZLVA 2C94A 3NFRA 2HU5A 5K1ZA 1NBMA 2V4QA 4E11A 1VP9A 2H7YA 3QFRA 1BH2A 4IV8A 1CB0A 4QFBA 3K5IA 3HVRA 5FWXB 4CIYA 2C7OA 4K87A 4NESA 5I8PA 2A0KA 1QIEA 1N2ZA 4YCLA 2WWTA 4C0QC 4YRGA 3GR6A 2NTJA 2FPXA 3B3GA 3WNBA 4M53A 1A5ZA 3MWYW 1R8QA 4CIVA 5ALEA 4LJ7A 1N6PA 1QO7A 2P5UA 1K88A 2I7CA 5JBQA 4DRFA 2JIRA 1IXZA 3BXFA 1YK0A 3HQ4O 4E14A 3UGTA 1KQOA 5CR9A 5KNDA 4GGOA 5K8LA 2UZ1A 1AHNA 3QV1A 2PWZA 4L27A 1S1MA 4FSHA 2QEQA 4RHYA 3NIBA 5D6OA 3MOGA 2AX3A 1WY7A 1DWUA 5ECGC 5JNUA 2X5RA 5K05A 4D3FA 2CD7A 4JT4A 2Q0QA 4K9RA 1O1YA 3ETGA 3GAMA 3KPWA 4BLSA 1EKFA 3HBMA 3BAZA 2IE0A 2POQX 3C5CA 2NTNA 4RQAA 5KWJA 1R4NA 1L7DA 3WRXC 4HSGA 4R68A 1N36B 4RLSA 3S2YA 3KDPA 3OF2A 3TECE 5ALGA 5SYMA 1Q2XA 1N2XA 4U7PB 4UUNA 5FLYA 1NKVA 5K0CA 1NVMB 5I9NA 2P1ZA 1KS9A 3S6JA 1K27A 4YHBA 3I4LA 2JKVA 5G0TA 1QO9A 3B8HA 2IX9A 1HT2E 2QAGC 1NZFA 3EFBA 5FOWA 4H18A 1K2VN 5JARA 1KWKA 1L5QA 1S6YA 1XZHA 3CEAA 1JEQA 2F59A 1NTOA 3ZTWA 3P9YA 2FEPA 1JFFA 1Y5RA 2ECQA 1FA9A 5H5JA 3SI7A 4ZCQA 4MCHA 2W7PA 5CE8A 4YQFA 1QV6A 3K9LA 1IBLB 4H3KB 2DJIA 2I2DA 2O2YA 4IAJA 1PDOA 3NTLA 3W7BA 1M2GA 2PZMA 4CEIB 3ZXIA 1JQ5A 3DGEC 1P2VA 3W78A 2ZBEA 2WUGA 1M2FA 2WHYA 2Y05A 4XWAA 3LOPA 3WHLA 5LDDC 4K6OA 2AV6A 2GERA 3F6CA 1IPFA 4CUJA 3H9JA 1WM1A 1MX9A 3KIPA 3EX7C 2BBTA 1XRQA 4H6XA 2CWDA 2XE7A 2ZZMA 5EDWA 2XGOA 1Q21A 1Y5NA 4BQRA 3BWYA 3PIIA 1ENZA 4LXIA 2ZE7A 1GGNA 5JVDA 4QUGA 4ED1A 3VDQA 1GYQA 4W9MC 4BQSA 2ZWOA 5JNRA 2C5HA 1ZH4A 2OZEA 3QIAA 3DJFA 1VL5A 3LKVA 3NIFB 1WUTA 2NG1A 3LLSA 3OKAA 3QBEA 4XD7A 4JI3B 4IQGA 4MIEA 4KH1A 1VE3A 2G9VA 3L1HA 2XDYA 1NQUA 4KHZA 2QDKA 3E1KA 1EZ1A 5DH9A 1DC5A 2RK4A 2FETA 2VSNA 3IR5A 5CLJA 4EG6A 1NSTA 2B4QA 3D6NB 1EVYA 3EQ9A 2YHAA 3D3WB 2XTAA 2ZU6A 4YRJA 2FVYA 1UPBA 1AO3A 3KUXA 3VO9A 3EG5A 3WJAA 2PUCA 5CCBA 5B2FA 1TAQA 2IIVA 3KSBC 3E27A 1JQEA 2M6SA 1T8WA 2D59A 1CYDA 1IEWA 1AUPA 1UJ6A 1I0LA 1L4GA 5EP4A 1OH7A 4G84A 3KV1A 4BL5A 4LF6B 1BS1A 1F0NA 3VH1A 1RI1A 2WR8A 3WLEA 2AEJA 3EMKA 3BSSA 1KJQA 2IHTA 2OOKA 4FB5A 3CJQA 2QN6A 3C14C 4PC1A 5EZ6B 4LMRA 1FXWA 3ZZ1A 3VQTA 3PITA 2OVBA 4DV2H 3HR4A 2B34A 3NWJA 3R40A 4NECA 4RZUA 2BDEA 4RAYA 4ZU6X 1EFDN 3O03A 1W8IA 5INTA 3NVMB 1F5SA 3EW9A 3P9XA 4MVJP 4AMUA 2GHTA 2UV8A 1IK6A 4L5JA 1U0OC 3FD8A 5FTNA 3AUFA 3GEHA 4B3HA 1AJEA 2VWQA 3DAPA 5K0SA 1E92A 4G5QA 4J49A 4DLSA 3RYHB 2VF8A 2JIZD 1CWUA 4DA9A 5BWRA 2YVUA 3FW1A 4TL6A 2EARA 4RK4A 3AW9A 4V0LA 2HMTA 4Z0PA 2G80A 5D1PA 2E4XA 4TQRA 1V1JA 2ZGVA 3FYTA 1P1CA 2GETA 1CETA 1RCTE 1FJ2A 3PXUA 4P2GA 3FLEA 2PGLA 1IN8A 2BLLA 3CUYA 3B5IA 2HGZA 4E13A 3BIOA 1B6SA 1Q1ZA 5HZKA 1WQ4A 1T5OA 4HGYA 5BMVF 5DQHA 2WYVA 3A4YA 1W5TA 1BKYA 3ITEA 3LPDA 4K46A 5IAEA 2D2VA 2VLBA 4ARUA 3VMFA 5LWQA 1DBVO 4JEMA 1DC7A 3E8MA 2A57A 2XNHA 1HUQA 4JC8A 4R7GA 2M32A 1E5VA 1KIMA 4YR0A 3SF8A 1OLUA 4EI7A 5KHOC 3I53A 4PPNA 2GXAA 2N42A 1QWOA 1Z4LA 3OTOB 3LBYA 2Q1UA 5FV4A 4IDGA 3LG2A 2ADOA 2JA5G 4PZAA 1ZJ5A 1V5GA 5LZ5A 4O3MA 3QJGA 4L07A 3FLBA 3DBHA 1CFZA 2GPWA 3GMDA 3SG0A 1BMQA 2KW5A 4AUMA 4AJ9A 4AWXA 3VX3A 4PSDA 1R50A 3K6KA 3IQEA 5IKMA 2WV7A 4WJLA 5AVUA 2WWXA 5ALWA 3RABA 3TEMA 4Y9TA 1IM5A 1OZFA 1S7GA 1O87A 3OMLA 1WW2A 1IPEA 4Q9IA 4DCGA 3HJUA 5L95A 3RBDA 2JLZA 4HD8A 5T7BA 1D2HA 3DONA 2BQRA 3PRHA 2GXUA 1H2FA 4AY3A 3RODA 2Z95A 3BB1A 3KWLA 5LA6F 1K3UB 2BHLA 2DKOA 5AI9A 2H2HA 4FKZA 4OHZA 2Y6VA 1RBZA 2WU1A 1SXJC 2E4YA 4EY4A 1P4RA 2D2EA 2J0UA 4NDZA 4TTQA 1CUHA 1GNTA 3L8YA 2B1IA 2XV1A 5LYYA 5DP2A 4B31A 4ZAVA 5LQKA 4FEAA 3CIOA 3ASZA 3GPIA 2Q4EA 4LDQA 4CM1A 1DUSA 4WSOA 3GRFA 3QITA 2IYEA 5KNDH 3W6UA 5HUQA 5KYXB 4B4OA 3AIMA 4G0ZA 1KF0A 3DR3A 2R6GA 4DV0H 2NUPB 4U7CA 4KXMA 1EQUA 4YDRA 2HBYA 4ZI7A 2JDIA 3M2TA 1QTQA 1STOA 3UUWA 3VOTA 2EZ9A 2QTWB 2WVAA 1YRQA 4KO1S 4F5EA 4OATA 2VH2A 5I5XA 1QFMA 3I6BA 1WCYA 3LX8A 2ISSD 1TTTA 3LK6A 2XIQA 3A3KA 1WX1A 1R10A 1QO0D 1THZA 1MGOA 1Z4NA 2V7VA 4R9RA 1VDMA 1P1KA 3BH6A 3ZDRA 3OHAA 4JYBA 5LQUA 4GYYA 1T3ZA 1XPJA 2OQ2A 1FZQA 4ZOEA 4IKEA 3QU7A 1Y1WA 2NTYC 1VIAA 2CNKA 3H7AA 3HDVA 2QMUA 3RVJA 3IV7A 5L7YA 3NJ4A 4BKRA 3JQPA 3ICOA 5AKYA 2UUBH 1E79A 4Q1AA 1BMTA 1WXQA 3U60B 4EJ6A 1SXQA 1KEZA 2ZP1A 4EG3A 4FU0A 3EZGA 2I99A 5A3RA 3UXYA 4GP7A 5AIAA 2AL7A 2PYZA 3ZV3A 3W3AD 2ZREA 4RHEA 2MR5A 2PS1A 2QL9A 1YZGA 4OIMA 3JYOA 2C35B 1KBOA 2C99A 3KDSE 2A33A 4JP8A 4ETSA 5DP1A 2QX4A 1N1GA 4PRKA 3AUUA 1XBTA 1Y7LA 2G67A 3I1JA 3L18A 3VOAA 4B3TB 1DXYA 3P0RA 3TOVA 3OJOA 4G8CA 4TQ9A 3U26A 3GTJA 3CX4A 3EZXA 4LISA 4OB8A 4OH7A 4DVGA 1LU9A 2M9MA 1MVOA 4H4EA 2CCJA 3ANMA 1MX5A 2A4MA 3SNKA 4J0EA 4G5HA 3KHSA 2I54A 3GT4A 4IIXA 2ZANA 4B6FA 2CHQA 1UPCA 1C2TA 5CT6A 1NBWB 3DBLB 1NW7A 2Q4TA 1MX1A 1IOVA 3GT3A 5C1OA 1DJPA 1LQ2A 1HE5A 1G5RA 1RKVA 3ETEA 2VS1A 2G0TA 3F6RA 3FBWA 2AZTA 1RTTA 1ZHQA 1X1EA 3D2AA 2JCBA 4JUFA 2CVOA 2GEFA 3NEPX 4YJ2B 2UXCB 1VSVA 3DOOA 4EITA 4ALKA 3U55A 1Y6GA 4QRIA 5EWMA 3E61A 5I4IA 1HT1E 3Q8WA 4D0GA 1AMNA 3IR7A 3N5KA 1WUJS 1RWBA 1L4EA 4JI0H 2PSEA 1S9FA 2IYTA 1A8SA 2B8TA 1JEEA 5ER9A 3IRVA 4BGIA 3HI4A 4ND8A 4B6JA 1TWFA 3U39A 2IH2A 2HLDD 2JLCA 4W5QA 2FPGA 4KUGA 4MXDA 2PEYA 2WU4A 1OXKB 4Y2UA 4BNIA 4O2LA 2XGMA 2C88A 1TO6A 2EOAA 1U0FA 3P2MA 5B6PA 4LW8A 1J0CA 1U80A 4IJQA 4MRSA 1L3CA 1Q7CA 4P84A 1ZGJA 3SAJA 1CUJA 1XZGA 2BFEA 1HE8B 3LHFA 4GEGA 1PNOA 4PR3A 1D2EA 3BDVA 1XMOH 2ATXA 5F73A 3WQRA 1IBKH 4HNGA 1DHTA 5HBRB 1GDHA 5CB8A 1IN1A 1VPVA 2DUJA 4LKOA 1XV5A 4LJ9A 1T6YA 2QZ9A 2F2TA 3PICA 5KTRA 4B3BA 2YJGA 3GFSA 2HVQA 4LXTA 3ZWVA 1HYQA 3PD7A 1TB4A 2C2KA 1ZHFA 3AQIA 5DOZA 2R8ZA 1F6BA 3QK7A 1GQYA 1G1AA 1Z12A 1A77A 1YS1X 4B9AA 1YULA 1J07A 2VT6A 3THXA 3WKEA 2VHXA 4ED0A 2O8VA 4GAEA 1YZFA 4EDHA 3E35A 1ZITA 4NOMA 4JU9A 5AUPB 2ZSBA 2XR1A 1VCHA 5SY6A 4YXFA 4UNIA 2JGMA 3O92A 2JA6A 4YAEA 2P11A 3O9ZA 1G0NA 5CVUA 1GTSA 4IEEA 1B6GA 1QDEA 1PRYA 2I6UA 4R9VA 1P60A 2C54A 3EMVA 1BCRA 4NYMQ 3PVZA 4KMSA 2IYQA 3HO1A 3WTBA 1I94H 3RS7A 3HJHA 3JZIA 1XA0A 3BL8A 3EDQA 4R2WA 3R3YA 3JALA 4I99A 3EVFA 1NWCA 3T8YA 1J7KA 2BR0A 2YRWA 4JQOA 1SBCA 2UXBB 4B76A 5A3JA 4R3WA 3T7IA 3ACBA 1RXWA 2EZUA 2CLCX 4DV7B 3FOCA 3N07A 5JYBA 3UMJA 2Z6AA 4J0GA 5HJ5A 3P9RA 2J30A 5CM9C 1DEOA 1H2AS 1VG1A 2CQYA 3G88A 3VHLB 3Q9UA 4LRQA 3I9V1 5KPJA 2Z2XA 2QI9C 2WJJA 3QY0A 2AYYA 1P72A 3VVCA 3WFJA 3AERB 2FNAA 4IR7A 1C7IA 5C5CA 4UOEA 3KHKA 2NVXA 3AY7A 3G2KA 3O7MA 4A3FG 3NOQA 4GZMA 1AGXA 3K8QA 2C22A 1NRIA 1XRRA 4QUAA 2LE0A 3DPUA 2E4ZA 1I4EB 4BLPA 3SQNA 2Y1XA 3U3DA 3RS4A 3AGQA 3NTVA 4WLVA 4XDHA 3CUSA 4I8XA 2W0SA 4WNAA 2AR9A 2VZLA 3JQCA 2VHJA 2QRHA 3VH4A 2J59A 4I4NA 1N8NA 3LYHA 3AVYA 4XYMA 2HH9A 2JEYA 2VDPB 2NACA 4EENA 3I6IA 1DE0A 4J0MA 4LNAA 2JEGA 4WZAE 1Y98A 4LC1A 3RAFC 4J4BA 2BEWA 1Z2OX 4HNRA 1U4NA 3EIXA 4DEYA 2Q46A 3HJNA 3DVAB 2ODQA 4BNGA 4LA4A 1J56A 2ZSHA 1GM5A 2JKYA 1PO7A 2NO1A 3DUFA 2C57A 4HQOA 3WRXA 2AMYA 5BN3A 2V3CC 4A8JA 1J2RA 2ERYA 3L0BA 4QM6A 2B20A 3U1VA 3WYGA 4RTRA 4PHGA 4D57A 1SXGA 2DRIA 3W8RA 4MR8A 5HKAA 4KLCA 3X1YA 3A9UA 4BEBA 2ZYIA 1FFAA 1Y8AA 4G41A 3JARA 2VCEA 1NVUQ 1EFUA 3ZK9A 1P4JA 3LXUX 1FNDA 3DCNA 4F12A 4JLVA 4DNFA 2XADA 5KI6A 2RIRA 4JBIA 5I5WA 3KQMA 1IULA 2YZ7A 2FUKA 1I9CA 1FDOA 2LD4A 5KDLA 1BJRE 4DA7A 1FX0B 3TLKA 4BFLA 3JWPA 4R1LA 5LMNB 1YB6A 1A9TA 3C2QA 1ISSA 3IVAA 3A2NA 1G4UR 5ALFA 4HB3A 1O8BA 1LLDA 3G2LA 4ZJPA 1G8GA 5C8YF 3DBIA 1U2ZA 3QZ8A 5DNWA 4C3VA 4XR4A 3VR4A 2SCUB 2ECOA 1T10A 3GG2A 2QTVB 5B1DA 1ZCZA 1R4ZA 1Y6RA 4RPIA 1Q0ZA 3ZH9B 3JS5A 1O94C 3CHYA 4CEHA 1EVKA 4LX0A 1K6XA 3L41A 4OHOA 3A4NA 1MC4A 3SGLA 4JVSB 4G67A 4GICA 3GGOA 5LDGA 4QGSA 4ZGBA 4E4RA 4Y1RA 4LHVA 4YJ3F 4XIIA 4A0RA 4B3CA 3N59A 5LLTA 4DA0A 4BP1A 5LJLA 2XCAA 4UFOA 3C8DA 4KMRA 1IXRC 3NHPA 1EXNA 3N7AA 3DAAA 2GT1A 4ZYLA 1MJGM 2WJWA 5CYPA 2CVQA 3R9IA 2IOFA 1GP2A 4DJJA 4UDYX 2IY7A 3PUIA 2CVHA 9MHTA 2WT4A 4Y9DA 2V98A 1XZNA 3KJNA 3IDAA 3FGOA 1XMVA 1KKLA 2FMHA 1U98A 5J3JA 4PBRA 2O3SA 1X7YA 2GPJA 1QRRA 3QFSA 1Y42X 1F51E 4FOTA 1E3WA 1ZOLA 1FNNA 3H84A 1C50A 2ALZA 4I5DA 4PZCA 3T9FA 4ZC8A 5F7OA 4G8BA 4BXXG 4H7IA 1NXPA 5ILGA 4O59O 4DFDA 1UQRA 1GSIA 3P0JA 3CLKA 1A9XA 2OLEA 1TT5B 4BVFA 1OF1A 4LMPA 4D9FA 5JNWA 5H8WA 3QEAZ 4D9NA 4F2PA 4V0QA 3D4PA 3IIEA 4YLGA 2IYOA 3S29A 1LSOA 4YRZA 3UOWA 1E5DA 2QL7A 2BZ1A 4P53A 2FR0A 3UJPA 3RVBA 3H9EO 3GXOA 4EHFA 4NYJQ 2OCGA 3BMCA 1T9GR 1RU3A 1G19A 5J2UA 3VH2A 1QZZA 4KWEA 1V6SA 4PYNA 3RFTA 1EUCB 2FPWA 3UN1A 3F8TA 5BV1A 2XKJE 4DXHA 5T4FA 4RM2A 2VNHA 3RQSA 1A0OA 4FOOA 5CITA 1GUZA 4F38A 3ZDDA 3HB7A 1T2AA 3GY0A 1DL5A 3CZ4A 5CXUA 2IBKA 3LTNC 2H4ZA 4QPPA 3LX4A 1SVLA 3SDZA 4BYMA 3OF5A 1RJRA 3AFOA 4CQNA 2UZAA 2HWXA 4QOHA 2R8OA 1TCVA 2F00A 1HK7A 3EIOA 2VWGA 3N7TA 4KQKA 2R3SA 3LWDA 5EHQA 4QODA 3CVVA 3SZLA 3LC2O 3C3EA 1W88A 4JGBA 1FMJA 4MW0A 3UGKA 4YNBA 4RE6A 4MDHA 1WZCA 3ZWCA 3GGJA 1WOYA 3BWMA 3I37X 1I2AA 1U3UA 2C2GA 1WO8A 5L1IA 4JHLA 4HXEB 3ONFA 3ORRA 5E9WA 4IIJF 3RTAA 4ZU1X 1QHXA 2XLBA 4JXJA 1OVGA 1V7ZA 3PHHA 3U1BA 2VVTA 3KZKA 2IYRA 3DZHA 4RK6A 4QXMA 4U9UA 2HQ1A 2HBRA 2GJKA 3Q2KA 2DBVO 3MHPA 2GD0A 1ZM9A 4B45A 5DMXA 3RARA 3A4TA 1L5OA 2J32A 1ZUNB 1ZPDA 5H3CA 5I9IA 1U4OA 1U99A 3GA7A 2G8LA 3WIOA 4WV3A 3E6AA 4BU1A 2O8FB 4PVCA 1XNGA 3PNOA 3W7VA 4J16A 2Q0HA 4P4SB 4WKNA 1C29B 4PTLA 5IJAA 3VPGA 2GILA 4UZSA 5FA8A 4O81A 1AHPA 4YUXA 3AINA 2VUMG 4Q4CA 1Y8RA 2M05A 1B04A 1L7PA 821PA 3L7JA 4BOYA 2ZYGA 3KEFA 2AK2A 5JHGB 1I7QB 2DTXA 2NUTA 3AG5A 1G6OA 4ZQCB 1C4XA 4R8UB 4JSRA 2LCFA 1C41A 2O3UA 2QN2A 3KTAA 2O8EB 3L01A 3HYRA 1EXVA 5ECYA 3C1UA 3T5JA 4B7XA 3C85A 1DOAA 4AM8A 3Q8KA 3TRJA 5KG5A 4COOA 4LFCB 4OQEA 1NP6A 5DGXA 4OGWA 3RBZA 4DCVA 3PFCA 1K89A 2YXDA 3HI6A 1J39A 3ZHCA 3IP8A 4OF4A 4DCOA 2R65A 3VJRA 4E88A 1DG9A 3AB8A 3R5HA 2BGIA 4LTMA 4W5NA 3FF1A 1T1JA 3L8MA 3RJ9A 1Z83A 1USGA 3UW3A 4RVDA 5KDOA 2YHIB 4NR0A 4UCWA 4UOZA 4LC0A 5IDQA 1U8UA 3W1EA 2VPXA 2OV4A 1MAVA 2WJAA 1UBCA 3Q6NA 2Y9MB 4QYIB 2C5FA 2E6KA 3B6KA 1HYHA 4BNKA 5B3AA 3MJHA 4YJ2F 3ES9A 1HPLA 2XT0A 3RPEA 5C81A 1KBQA 4O2BA 1WW8A 2CL5A 4B3SH 3M3DA 4N5HX 1G3IA 4A3MG 2NGRA 1V7CA 3L7CA 1EG7A 3DFMA 4R51A 1V8BA 4FIZA 2HF2A 5FT9A 2IXFA 2TMGA 4XWWA 1SKMA 2PXXA 3H3JA 3SEQA 2XWQA 3OMXA 2I67A 2FKAA 5LZ2A 1Q84A 5KG1A 4MYRA 3TBKA 1HDOA 3B9PA 3D6UA 1QIJA 2FG6C 3HUFA 5AJTA 2NAPA 1IYDA 1JQKA 3GH3A 3BJYA 1KO1A 4YALA 2UVQA 5FL7A 4MB6A 1LVUA 3SSOA 3TXAA 4Y98A 3MWMA 1HQDA 2A2ZA 1OYWA 1Z28A 3ZXUB 4AJOA 1E69A 4I46A 4EY8A 3OY7A 3HRHA 1TIKA 2FK7A 3JQBA 2OXTA 4OLAA 2ZSIA 1AZWA 3KLPX 1GZ5A 5KX5A 1HNZB 1RE1A 1PZFA 4FQ8A 3KJGA 2YMQA 2B4AA 1DQRA 5EJ5A 1A2KC 4XCVA 3FNHA 2O8DA 3VR4H<