The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
101
|
sequence length |
316
|
structure length |
296
|
Chain Sequence |
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
GLUTATHIONE BIOSYNTHETIC LIGASE
|
publication title |
Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb |
source organism |
Escherichia coli
|
molecule tags |
Glutathione biosynthesis ligase
|
total genus |
101
|
structure length |
296
|
sequence length |
316
|
ec nomenclature |
ec
6.3.2.3: Glutathione synthase. |
pdb deposition date | 1995-05-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02951 | GSH-S_N | Prokaryotic glutathione synthetase, N-terminal domain |
A | PF02955 | GSH-S_ATP | Prokaryotic glutathione synthetase, ATP-grasp domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | D-amino Acid Aminotransferase; Chain A, domain 1 | ATP-grasp fold, B domain | ||
Alpha Beta | 2-Layer Sandwich | Dna Ligase; domain 1 | ATP-grasp fold, A domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |