1GSHA

Structure of escherichia coli glutathione synthetase at ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
296
Chain Sequence
b'MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutathione biosynthesis ligase
total genus 101
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1gshA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1gshA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gshA01
2VHEA 2DZDA 4YBZB 4I4TF 1EUDB 2FPIB 5I47A 3DF7A 4IIJF 3AX6A 4XX0B 1KJQA 2NU6B 2W6ZA 4E4TA 2Z04A 3KALA 3LP8A 2Z02A 3ETHA 3VPBA 4FFLA 2V59A 4O7WA 2PN1A 5FNVF 5LXTF 2R82A 5LP6F 3BSWA 3HO8A 4XYMB 4YAKB 3K3PA 2CNUA 2V5AA 2WYOA 4FFPA 2W70A 5KX5F 2NU9B 2I80A 1GLVA 3MWDA 3VPDA 2GPSA 4HNVA 2ZDGA 3RUPA 2VR1A 2GLTA 1PK8A 3WO1A 4FGRA 4I50F 4RZQA 3G8CA 1UC8A 4GGMX 2YYAA 2FP4B 4O7LA 4IWYA 2SCUB 3KAJA 2W6NA 3WO0A 4EGJA 1WR2A 3GIDA 2FPGB 1DV2A 3HBLA 3N6RA 2W6PA 1KEEA 3AW8A 5CB4F 2X0SA 4TUYF 4FFNA 4EG0A 2DLNA 3VA7A 3MJFA 4MAMA 3RV3A 1W96A 4TV8F 2YZMA 3RV4A 1IOVA 3UFXB 1Z2NX 4O81A 2YZLA 4M98A 1M6VA 1GSOA 2XCLA 2R7LA 2P0AA 4O84A 3ORRA 1UC9A 3Q2OA 3TIIA 5C1OA 4YAJB 1KJ8A 1C3OA 1E4EA 4ZI7F 3U9TA 2ZDQA 4DIMA 1M0TA 4MA5A 2W6OA 2W6QA 4FU0A 5BPFA 1BXRA 1IOWA 1DIKA 3I12A 3JRWA 2W6MA 2GQSA 2W71A 2C00A 1JKJB 4O4LF 1T36A 4O7SA 5JVLA 2CZGA 1VBGA 4EA8A 2YWVA 1CE8A 3Q1KA 2PVPA 1EZ1A 2NUAB 5K2MA 4L1KA 3U54A 4O7RA 5LOVF 1KC7A 1M0WA 4EA7A 3E5NA 1EHIA 4O86A 3ETJA 2NU8B 2YZGA 4TV9F 3K5HA 5EZYF 2YL2A 2QK4A 4O7YA 1I7LA 4O7NA 1OBGA 3WNZA 5D8DA 1BNCA 3TW6A 4HR7A 5IYZF 1VBHA 3V4ZA 3KAKA 4ZQIA 3RFCA 3V4SA 2QF7A 2VPQA 4O4HF 2FPPB 3TINA 2CQYA 4IZOA 2YZNA 3TIGA 1KBLA 1VKZA 4MV1A 2YW2A 5LYJF 3BSSA 3VOTA 3OUUA 1B6SA 3U9SA 4IWXA 5C8YF 4NYEA 2YS6A 3LWBA 4MA0A 4O7VA 4O7TA 1Z2OX 4MV3A 4C5BA 2XD4A 5LA6F 4HQ6A 4O4IF 5H80A 5JQGF 3ORQA 5BPHA 4YB8B 1KUTA 4XZ3B 4MV4A 4ME6A 3R5HA 1AUXA 2IP4A 4EA9A 1PX2A 1W93A 2R6FA 5HBRB 4HNTA 4IHJF 1EUCB 3R9RA 5CA0F 4C5CA 1I7NA 3JZFA 1AUVA 2CNQA 4FE2A 1GSAA 2NPOA 2R86A 3JZIA 4ZHQF 3OUZA 4Y8VB 3TQTA 1JDEA 2YRXA 5JQWA 5C1PA 4M9CA 4WD3A 3VPCA 3BG5A 4O7ZA 4FFRA 3U55A 3HB9A 2DIKA 5GONF 1ULZA 4QSHA 1A48A 1DV1A 4MV7A 2R85A 5HV6A 1KJJA 3NUAA 5DMXA 2ZDHA 3VMMA 1CQIB 1JLLB 1JDBB 4M9UA 1Z2PX 4MV6A 4HNUA 1EYZA 5CA1F 4O83A 3GLKA 2HGSA 3KREA 4O2BF 4EGQA 1C30A 4XYLB 1OBDA 2DWCA 1CQJB 2OLSA 4WBNF 2PBZA 3BSYA 2VQDA 2I87A 2YRWA 4O4JF 1KJ9A 4C5AA 3G8DA 3R5XA 3R23A 5J2UF 4J6EA 1GGOA 4EABA 1A9XA 2R7NA 3K5IA 4ZOLF 2R87A 3R5FA 2FB9A 2V58A 2I8CA 2R7KA 5JVDF 3QFFA 3JRXA 4O2AF 1CS0A 4YJ3F 4DLKA 1SCUB 2HJWA 2YS7A 2J9GA 5J2TF 5KKNB 4O82A 4M99A 2R7MA 4MV8A 2GPWA 4EAAA 4FFMA 1GSHA 3BFPA 3N8DA 2CNVA 5BMVF 4I55F 4FFOA 2R84A 2NU7B 4YJ2F 5JH7F 1B6RA 1E4EB 2GQRA 5CAEB 3MWEA 3SE7A 4MV9A 1KJIA
chains in the Genus database with same CATH superfamily
1QF9A 1VJ5A 2O8EA 4YFYA 4WJLA 2A4KA 2Q28A 1EDZA 3M4NA 2VKQA 3FUTA 3UWSA 5KT6A 1T36B 1GGVA 2W9BB 1A8UA 4BLPA 1CY0A 4A8JA 1XCLA 4BJHB 3FRHA 3ESQA 2GBCA 3NHJA 4NYJR 3AERA 3R7WA 1P2SA 5HBGA 3MWDA 1HLPA 5LUAA 3ASUA 3F6SA 4Q47A 4X64B 3DWEX 2OCXA 1SWWA 3H3VH 3DWIA 1UEJA 2FQ1A 1PJ3A 3L1JA 4IG4A 4TMTA 3M6UA 3VNSA 4PU0A 5IT9A 1EXMA 5ITZB 1JX4A 3LX4A 4IAJA 3PDIB 2ZJ1A 1GPJA 2R6ZA 1P60A 1U0NA 2HD4A 3Q4GA 2RKOA 1D7AA 1H0HA 2FOXA 5GONA 3A1FA 3QKTA 2P0YA 3ZIAD 1XMOH 4H2DA 2Z5VA 1LC0A 2D7CA 3V97A 4EB0A 4AO8A 4LZOA 4A3IG 2I2WA 5M04A 2OWDA 1QCCA 3VKWA 2GZSA 4JU8A 4OXXA 1M6VA 2GVNA 5AVZA 3RSSA 1N6PA 1N9ZA 1N33H 3H9CA 3FPFA 3CH4B 4ETMA 2COUA 2JFOA 4HXGA 1YOVB 3BZWA 5J2UA 3E2IA 2W71A 5T4BA 4RQUA 1M1XB 4J9SA 4DWWA 1LPSA 1DKUA 4HC4A 3I64A 2DHRA 3NWEA 3HC7A 3W9UA 2P2YA 3M9MB 2WVHA 1EXWA 2XA9A 3USES 1CEXA 1DCFA 3WIDA 1MG0A 2ZAIA 3K4HA 4WINA 4EA7A 3ZK8A 2OP0A 1BX1A 3OTIA 5K0TA 3S4YA 4F72A 5AK3A 2Q4TA 4V24A 3CVZA 2WUFA 3VR1A 5AJUA 4M3NA 4MVCA 1OBCA 1RU3A 2AN4A 2WD9A 4UQOA 4KPUA 4WOJA 4OAQA 5FTNA 4D97A 1QV6A 2R8ZA 1BX0A 2HQOA 4AJKA 2FPPB 3YASA 1Q21A 5I5SA 1T8TA 1UC4B 4KCGA 3HB1A 5CYPA 3WY9A 3KG2A 3WB0A 1VJRA 4QTUB 2GN0A 4Y0AA 4UUAA 3HXOA 3IRUA 3GIMA 4K88A 2YASA 2R44A 3GVIA 2YDXA 4BAGA 1FS4A 3H1EA 3HKEA 3BQ9A 3RSOA 1TO1E 1G5PA 1E2EA 2XT9A 3WLKX 1BDJA 4J9KA 2Q5EA 2OAEA 1Z9BA 4B35A 1OQAA 1EX6A 2B8TA 1JU4A 4RXUA 1KH2A 2WSIA 4NTZA 3OP1A 3HKZA 4WY2A 5C0OE 2O6HA 3P52A 3R7DA 4UHBA 5DXJA 4ZA2A 2X0IA 1U0GA 2AEEA 4Y9DA 1I2KA 1N2EA 3O03A 5AVOA 1SUAA 5JYCA 1Y33E 4RV9A 5BO5A 3ZI0A 3BB1A 1C9MA 3JYQA 2TSYB 2XMRA 1M6YA 4GZ5A 1AN0A 4UUNA 1AKWA 1WZUA 3ND5A 1AQLA 1KRHA 3OQVA 3P26A 3IAFA 3A9RA 5DDIP 1RXSA 4ZMSA 1TC2A 1U4NA 4X1OA 3UKJA 1HZZC 4JJKA 1QE0A 2E6UX 4YQZA 3H11B 2IS6A 1ZVKA 2TECE 5F3DA 1JBEA 3I92A 4AMGA 3OKAA 1UXJA 3TPCA 3FMPB 2AIRA 3WFZA 4ZVPA 4DV4B 3KKMA 1LDEA 3EF3A 5KT3A 3IIMA 4D5GA 5D87A 1DQSA 2JH3A 4PC7A 3EGDA 2FGKA 3H5RA 1ZL2A 2PZKA 3JZAA 4PG4A 1TU3A 1OFVA 2O8FB 2XNDD 2H1LA 3PDCA 4O2AF 2FGJA 3B13B 4G1FA 3HG7A 1PGPA 4JUZA 1E2PA 2PD4A 3X1DA 2H06A 1TJ5A 2E7ZA 5LU8A 5CX1A 1OOEA 2X0KA 3PHHA 3N8DA 3M6XA 3IR6A 5E7IA 3FCAA 1RKBA 2W4IA 1PTJA 5EIWA 1D04A 4OHRA 4J03A 1Y98A 2WPDD 3HOWG 4KN8A 3ILSA 4ZHSA 3MGKA 5AVYA 2H3HA 3DCIA 2J5RA 1AKYA 3L84A 3I0NA 3ZXSA 5FNVF 2QYZA 2QWXA 5ALHA 3W5HA 4J0QA 1PBTA 2W0MA 3C16C 3ZK7A 3BWMA 1GPAA 1XMSA 5CCDA 3TN7A 5E1BA 1U3VA 3L79A 4JBNA 4NFLA 5IT9W 3N3AC 4F71A 2BKEA 5CLJA 2FLNA 4FGRA 5F77A 3LO8A 1HSOA 3UJ9A 3V2GA 3VYUB 1T3SA 1EI9A 3S1LA 3NH9A 1KSGA 4QDZA 5T6MA 2DWQA 1Y5LA 2WP8J 1ABFA 4W5NA 4D79A 1DJOA 2FPGB 2R751 1YZLA 4IVNA 1KK2A 1WUHS 3ZHYA 3DDZX 4OQMA 4KOEC 3SIXA 3W6UA 3W5SA 2FN8A 3LBNA 4FS2A 2OO7A 1G6Q1 3DMFA 2M6LA 4WBXC 4ZO9A 5K8VA 1IONA 4JEIA 4JYZA 1IOVA 3D7RA 1E6MA 2GK6A 3NBMA 1XVAA 2OZVA 4WT7A 2XDYA 2HK6A 1YZQA 3MF4A 3IUJA 3CLTC 3GQBB 3EODA 1WB6A 4TWRA 2JIMA 5AHKA 4HGQA 3ZDAA 4L9RA 1THMA 3OECA 4ZOLA 2DY1A 4DHEA 4XX0A 4ASUA 3N2ZB 1KL7A 1Q7EA 4GX1A 2JJ2D 4ED3A 4HD8A 1G7RA 4RLFA 2AEMA 3TVYA 1CLUA 2C2MA 4TLDA 2CHUA 3D3QA 5D1OA 4DCPA 4QDTA 3NHZA 2XX3A 4HGYA 2HREA 1E94E 2O50A 1GZ3A 1JR3D 1ST2A 1LLCA 2DU8A 3COWA 1RZUA 4MI1A 3T52A 1OZHA 1SC9A 1SOUA 2ZBDA 3O5AA 3L7CA 1QNFA 1K06A 4ZQFA 1VPDA 1GU0A 4O8ZA 4I50B 3Q7IA 4ZCSA 2JI9A 5F33A 1WJGA 4G3IA 1EBUA 1J07A 4MQEA 4DW8A 3ORQA 3Q7SA 4V38A 4IWNA 1MNQA 1WF3A 4B5LA 2C0PA 3CT4A 4NEHB 1UH5A 2UVUA 3DEZA 4FONA 5M5BA 3JWHA 3W5UA 3E7XA 1EGHA 4E5NA 4OM7A 3NRBA 3JQBA 2D3TA 3T3IA 1P9RA 2MT9A 1UFQA 4RB3C 3NGXA 1RWOA 5TS2A 1T9BA 2IZ1A 4H0FA 3M5WA 1XTIA 2KMLA 4TXNA 2FW9A 1IRIA 1NUUA 4ECEA 3O4JA 3A4MA 3SMQA 1IIBA 2VUGA 2Z56A 1G20E 1W35A 1N5DA 4M0CA 5ITSA 4I81A 4B3RH 5L45A 3ZZTA 1FNBA 2IZ0A 4RETA 3NALA 4CLEA 1Z4QA 4HNUA 2BBOA 5KVAA 4A6XA 2AJ8A 3T7RA 2C7PA 3SZLA 1VLVA 1H9AA 2CWDA 4D42A 4MUFA 2BDTA 2AWOA 1C8BA 2XAUA 2J3DA 3E4CA 1GYQA 3ZC3A 4CMEC 3HT5A 3IN5A 3R2JA 4XH9B 1U8FO 4IFEA 2A4MA 1HTTA 2HPAA 3P9SA 4Q3OA 3V6KA 3EGCA 1XZBA 1E8DA 2JA1A 4AJ4A 4NFHA 5KREA 2FB9A 3IKJA 3EIWA 1E0KA 1WUYA 4YUXA 3A31A 1J5EH 3MSXA 3QUSA 2WOOA 1DHTA 4M99A 4MV8A 4GVLA 2V4MA 3RK4A 4HQRA 2HK8A 5BMVF 2E5LH 3R7SA 2NU7B 4UFZA 4EBDA 1D8TA 1NZDA 3MOIA 1FP6A 4H3VA 5I7EA 3FWPA 4ID9A 2CHFA 1Z82A 1JYFA 3DF7A 9LDTA 4UDNA 2Z02A 1IY9A 3VPBA 4WSOA 4YJ3B 1ZD5A 4UD2A 3ROFA 1GNQA 4BO0A 4G0MA 1VAJA 3EZFA 4A3SA 1AX9A 2PWPA 1F8GA 4E5VA 5LPNA 1TJPB 4PF1A 1PJCA 3T35A 2H2DA 3ADPA 2DPJA 4YJ2B 4HB0A 1SUDA 1PK8A 4QTTB 3QMPA 4CLDA 5EE0A 1W4BA 2IBMA 3QWHA 4W9MC 3UJAA 2XZDA 2HPHA 2QUKA 1PJQA 1L0BA 2BLLA 1D0IA 3NC4A 4RK5A 1K2VN 3ZVRA 3K0BA 4RX1A 2HA4A 2NZYA 2V74B 4C0HA 1A97A 2PO7A 2R5NA 3AVTA 5F64A 1R8JA 4B17A 5FBWB 5K8UA 2GM9A 3R09A 4KXFB 4PAMA 4DQ0A 2XKJE 4G07A 4M98A 3D8HA 3EW7A 4BNLA 3ZY2A 2RSLA 3VZBA 4F0JA 2FR8C 1TT5A 3URMA 5EWFA 3Q5GA 4F85A 1MTZA 3U0VA 1QK4A 3TRFA 3OZCA 2NXEA 4NCIA 1H94A 3GJ8A 4ZOBA 4YPFA 2DF8A 3GZ4A 2ZUEA 5HJ7A 3RM3A 3WIOA 4JLUA 1TJNA 4G5HA 1XYYA 3O4VA 5DNDA 2ACKA 1G2WA 1EXVA 1WKBA 2GNAA 2OHIA 3AR9A 4O7RA 4DPKA 1RBQA 4LY9A 3Q85A 3GLIB 1ZK1A 1D07A 2V7VA 4ROTA 5E95A 3UG6A 1SCKA 5TGZA 4IGAA 2YNMC 5CPBA 5H4HA 2VHXA 1U5CA 1NHWA 2YJ6A 3H99A 5F9MA 3AC0A 3DL4A 1RAAA 1KHTA 5CG2A 1U9IA 3E8MA 2GEJA 2CNBA 4PQRA 1EGVB 2AFRA 3K1AB 3CF0A 5DAAA 2YXPX 4YGXB 3X2FA 1RWKA 4RXMA 2GZ3A 1E2KA 1IBMH 1XMQH 5KQMA 1US8B 4U3JA 1JVBA 4KYIB 1NM5C 4UDYX 3OM0A 2ZAGA 4L9WA 4LJ7A 4IRKA 3I39X 1BHO1 4DV0H 1NT2A 2NPOA 3B9BA 3EB9A 1L8AA 3GRKA 3MLBA 1GTRA 4ND6A 1OZAA 1JHXA 2C77A 3L05A 2EX0A 4EG1A 1MOPA 1N2BA 4R8UA 2G06A 1ABBA 4HNSA 1DAIA 3OEYA 2AN9A 2WHEA 4Q9DA 1NGSA 3NETA 4DPMA 4BO5A 3G13A 4IHJB 4M83A 2Q1YA 4MV7A 1Q11A 2IY7A 1LJLA 3PL5A 2ZYIA 1CUSA 5CW2A 2YFHA 4BMXA 4GSKA 3ZHVA 1C30A 2JPDA 4N6NA 1T9ZA 3BIFA 4LKOA 4W5HA 4TKLA 3B36A 2PWBA 4WLVA 4GOMD 4EEZA 2NO6A 1QH1A 5F1YA 4BMOB 4HRXA 4QQ8A 3PC6A 3B1VA 4EFMA 2ANCA 4KW7A 2HWYA 4LSWA 3BH7A 1GY8A 1T5OA 1L4YA 4O3NA 3I72A 4F2WA 5I48A 1J00A 3W3AD 3GJ4A 4LFCH 4J9UE 4QNNA 4XJTA 3KPWA 3OC0A 1DRKA 1HG0A 4Q4DA 2XUAA 1I0IA 1G8MA 3GPDG 3D4BA 4QWDA 1YFKA 4O3RA 2LWIA 4PYOA 3K0FA 2Q9AA 3OZDA 4N0PA 5KJFA 1GRCA 5DM0A 4OI4A 2JIDA 3ETLA 1KJYA 3KQQA 1FYEA 3CXUA 4XA8A 4ZDKA 1ZI8A 1FTQA 5DW3A 4BQFA 1FK8A 1L8XA 2DR0A 2JCYA 3ND6A 2AQIA 2DSTA 2OD7A 2WZQA 1X87A 4PLWA 4UEQA 2ZYGA 1I5EA 2H5IA 1YXMA 1EKFA 2CMHA 3BIJA 4XGQA 3DFZA 2SCUB 2GRJA 3X1JA 2BMWA 1BXGB 4EPRA 1X7WB 4JQYA 2O2DA 1DBVO 4TKUB 1XQXA 1Z47A 1NATA 1QG2A 3G17A 4I3FA 4XYGA 2EEPA 2GHQA 3CUYA 1BCSB 4BX2A 4Z4HA 4Z7NB 5IARA 2OK8A 3SHTA 2C2BA 2KQUA 2B4YA 3DYIA 1N1DA 2Y68A 5KFDA 3L4EA 2QR3A 4YRFA 5ALJA 5DYTA 2R92A 1JHQA 1P1FA 1TA8A 3RGXA 3P4UA 1MHPA 3WHPA 3W8NA 4H0NA 4JN6B 2VBGA 4MJ7A 2QAIA 4BWSC 4NPCA 2BD0A 1P16A 3PJGA 2C5EA 3JTEA 3NAGA 3F4KA 5C44G 2X22A 2D74A 2P78A 1VSBA 1JKJB 1Z63A 3QVSA 3UHPA 3FCEA 1RYZA 1XDZA 1T2VA 3I2HA 1XMOB 1VFPA 4MP8A 1YS4A 5KNCH 2AOWA 3ZBPA 3GNQA 1GG8A 4D02A 2ZROA 1D9XA 3RUCA 2EJ3A 4K9SA 4G0PA 1FP4B 2B1IA 1OVGA 4HMPA 2JIZD 3DCJA 3EC2A 4BQSA 1F06A 4QJIA 1TU4A 4KH1A 2GCGA 5KVQA 4HVLA 1VGVA 4CM8B 5U4QA 1CKEA 3G1UA 4RMNA 1V3QE 1BGVA 1W0JA 1KK3A 2GN4A 3DGFC 3OIGA 1J25A 3LY8A 3HGQA 2B21A 4GLFA 2CCGA 2VUIB 4F4CA 2CB0A 2IP2A 3RS7A 2AUTA 4PHFA 2AC4A 4WOCA 4DEVA 4U2DA 2C29D 3MTIA 1TTHA 3SKVA 3HSYA 3DMNA 4XZ3B 1KRXA 5I5GA 2LNDA 2GDJA 3OETA 3E27A 4NWIA 4KR3A 2V7GA 3JX9A 3AJ8A 2C9ZA 4DCSA 3ZK9A 2CHQA 4CGZA 2R86A 1N77A 2MYPA 2AI1A 4OYRA 4CR6A 1PZHA 4UOEA 2VNKA 4XGKA 2FUCA 4KB5A 1ZOOA 4ZXFA 5KFMA 5K8JB 4ENVA 1DEXA 4IMIB 5D1PA 5ECWA 2QD2A 2GF9A 3LDFA 4UCVA 2Z1MA 2QLLA 3I4LA 1YKGA 4G2NA 2M32A 4MGHA 1LTKA 1UBTS 3MRSA 1Q74A 3O4RA 2BYTA 4V0SA 4GICA 1N3LA 3PX3A 3HLKA 3DP7A 4YIKA 2PSEA 2E4AA 3ZJYA 4A0GA 4EFBA 5IHPA 3UCEA 1XTTA 5KG6A 4TLCA 1E0DA 4ZQGA 3PHCA 3BIWA 3QI7A 1Z5WA 2WYWA 4NU5A 5ER6A 3RRXA 4RJ2A 4HF7A 2I87A 5E6SA 5KBYA 1TK3A 4YHBA 5F1OA 3W1VA 3EISA 1E18A 2C84A 2AOTA 2GA9A 5CR5A 4Y2TA 3JQRA 1V1RA 1J90A 1VKNA 3GFGA 1E64A 2JAOA 2FHPA 2O4UX 4EY8A 3EXHA 3KEGA 3I6IA 2P41A 3BAZA 4TTVA 4RPCA 1KR5A 3AO0B 3BFPA 1WXHA 1CS4C 2WWWA 3BC1A 3RUFA 4YMSA 3MINA 3D1VA 1YDGA 3D6FA 2EW1A 2GBGA 4YBZB 2RGAA 3GEDA 1MW9X 1OIWA 3PUIA 4QNRA 3AYZB 4DLNA 4O2AB 1UAYA 5DGCA 4MB6A 1TU0A 5KYKA 3QXJA 3RKRA 3PICA 3MMPA 4HAYA 3NIGB 3EPHA 3FF4A 2ZJTA 1KIMA 4G5GA 4XB2A 4NCBA 3RYIB 4TYMA 1LD3A 4BP3A 3BGSA 3QE0A 3W3ZB 3OESA 3NDIA 5JBNA 3B8HA 3PQ4A 3UVEA 4D4GA 1Y6GA 2BF4A 1JN0A 2Y4NA 1Q7BA 2ID8A 2P6PA 4QWBA 3W5IA 4CDGA 2SNIE 1OV6A 4PAGA 3FOEC 5FULA 3THWB 2UVVA 1EP3B 4C3VA 2AR9A 5EJ5A 2EFCB 3FWZA 3HDVA 4R8SA 3ZV6A 3NBZC 3TF5A 2DM6A 3KEMA 1LJ8A 4AB1A 1JDSA 2OE2A 1ZOPA 2VLBA 1J2YA 1XPOA 2WSSD 1ANKA 3CMCO 2GASA 2XC9A 4II7A 2XNJA 3BB3A 4M1TA 1KOJA 3UUEA 3NKLA 4N82A 4K46A 3ZD7A 1IL0A 4ISCA 5CB0A 3RIHA 1DBQA 4ERNA 4N0QA 1HEIA 3NQ41 3HMKA 3PC8A 1TVKB 2LCFA 3VOSA 1UXOA 4JL6A 3OX4A 3AF1A 5TB5A 3F4BA 4KGZA 5FPRA 4Y2VA 1NMXA 3IG0A 3UC9A 4Q9HA 5EP4A 4PLYA 3UV3A 1EGMB 4AJEA 4WZAA 2C9OA 5IUJC 2O3JA 4LC9A 3ASVA 1H93A 2VBCA 5FBHA 2OCAA 1YZFA 4XM0A 1Q2XA 1QMGA 4V3BA 4QGFA 4X7BA 2NUTB 2X9QA 4G09A 4UCWA 3P27A 4PY2A 1NJSA 1N6HA 3CJTA 4L7VA 2CUZA 4QEKA 5SICE 4MTEA 4GM1A 3VPHA 5D7NA 3UAYA 2W2LD 4YMIA 1R12A 2ZRDA 4IDGA 2CLFB 5GJWC 5H81A 3GT7A 3SGLA 4CKZA 2VYVD 2RDIA 1KSHA 4ED2A 1LU9A 1O89A 5A4DA 4DF3A 5ALSA 2C07A 3M6IA 4X66H 5GJCA 2RONA 3BMQA 2I66A 5HQ3B 4ZU1X 1Q0TA 2V8BA 9GPBA 5TQJA 1G9XA 3TGLA 5FTWA 4D41A 1LY1A 1OR8A 3NOOA 1N7GA 1IHOA 3FPGA 3RYTC 3OFND 5AVRA 2JA6A 1HKUA 4Y9TA 4A8HA 2JFWA 5MGNA 5B37A 2ZUFA 4LJSA 2YQ5A 1C9NA 1TYEB 1QYDA 3VAYA 4I4CA 1Y1WG 3VH1A 3GPBA 4C7OB 3PQ5A 3QZUA 4HFRA 4F92B 2B7BA 2GFHA 3ZJ5A 4MI6A 3KYBA 1MQ8B 4HQNA 5DMXA 2JLRA 2A33A 4B7AA 1E1CA 4LYYA 5EIBC 4GC6A 2RARA 1YRAA 5CDFA 5BWMA 3ZJVA 3TSCA 3GLKA 5DGBA 2I4TA 1LVGA 4DBVO 5EJ2A 1XTJA 2A9PA 4MTCA 1W5FA 4ZQEA 2K6GA 2ETXA 3KSRA 1DIHA 3LYAA 4MHOA 3GHYA 4PHHA 4QASA 2JHGA 4DGQA 2L2QA 4LOIA 4KQ2A 2ZQYA 1UEXC 4MPJA 1I50A 2PZJA 3O8BA 5ENVA 5FBZA 3E61A 3DAGA 4AS3A 3DTTA 3AB8A 2BVNA 2WAQA 3MJCA 3SFZA 2ZAYA 3BA6A 3C5EA 2WJGA 3Q15C 3ESYA 3E7DA 2DX7A 1YB4A 4B1FA 1QZ3A 1YIDA 5ILGA 4TLEA 3X1KA 5IAKA 1J42A 2WLSA 1FIUA 1L4HA 5EC8A 1VP9A 4E33A 3GUVA 3U7GA 4BFYA 1PGNA 2B3TA 1RKUA 3I73A 1CE8B 1DTSA 1J9GA 1BFKA 1RP1A 1K27A 2QRUA 5JJBA 3EEBA 4BQRA 5EESA 2M6KA 4PSDA 5BMVB 3P2KA 2R6AA 2ZYSA 3QUBA 1R16A 1SUFA 6NULA 3OLZA 4JT4A 4BHTA 1Q1NA 1J5EB 1KP2A 3ELUA 4EATA 4I50F 2WDZA 5AW1A 1S1CA 1P29A 4C04A 4R1NA 3GF4A 5ITWA 3LC2O 1CD5A 3WLAA 3VPFA 1AO0A 2MSCB 1EFPB 1JPVA 2J5QA 5CB6A 4LZPA 1QV9A 1R0WA 1EHYA 5CPFA 1X0XA 2FK3A 1ORWA 2IYQA 3T3EA 1T6BY 5A03A 4K26A 5I60A 1ABEA 3JAMW 4F97A 1G1AA 2I3BA 4RF2A 3CEMA 3MVEA 3OEWA 2ORIA 5K3FA 5EKSA 4PC1A 4ESOA 5EXEA 1LW7A 1ZY2A 4CM3A 3K9GA 4D9BA 3GLGA 4MRNA 3JS5A 4AN1A 3G0HA 2WSMA 3BFVA 4FS1A 5TT0A 3AB7A 3TMKA 3PWSA 1YJBA 3H1TA 3KXPA 1I3KA 1CIVA 1DEKA 2FPIA 2FR0A 4NU0A 2QLBA 4BVKA 2XCUA 2CXNA 2H0RA 2O7VA 1M34E 2BGGA 1Y8ZA 2GLUA 3PC7A 4KO8A 4C2AA 4Z53A 3EQ8A 4DCOA 1WKVA 1DJNA 4XGNA 3UO8B 4RK7A 1Q1ZA 1YRLA 3E5NA 2I6SA 3TEMA 4CKCB 3PA6A 1TOAA 3U7IA 1D1QA 1YF3A 4G63A 4Y1RB 3QKSB 4YASA 1Y81A 1ZH8A 4XJVA 2JJ8A 2Z4RA 3D8SA 4HGRA 4NR0A 2FMTA 2G6BA 3R6TA 4CI0B 1WMAA 3ZNOA 2PX6A 1MP0A 5A7GA 3KT8A 4CIVA 2BCJQ 3U3RA 3FNBA 1SN7A 4U7TB 3LQQA 1MIOB 1EG7A 4KVAA 1LS6A 2FZLA 2O2IA 3RIMA 1FJ2A 2C1XA 3RS0A 1Z18A 4H3HB 1F2TA 3S2UA 4IM7A 3WSVA 4EHKA 5LVAA 3TLGB 4HS9A 4OQNA 2PUJA 3OLWA 4UM8B 1T2UA 1YJCA 3LUCA 4U00A 1L7VC 5BPHA 3FETA 3FMAA 4CDRA 3B53X 1E3TA 2E49A 2FV8A 2G8LA 5FLYA 4A5SA 1ISSA 1R2QA 3BWXA 3NHMA 1XN4A 2FZVA 1FDUA 4YYEA 3JZIA 3AKDA 3LBIA 1P44A 5CEEA 3AHHA 2TMYA 4MWBA 1E1MA 1R0SA 3BRWD 4OHCA 4NNJA 4N1AA 5AOVA 3WYNA 1S0MA 1ICIA 5C34B 3T12A 3FW1A 2ZRKA 1ZEJA 3NTUA 1DKOA 3IKTA 1O57A 4GKAA 4GLOA 2JFPA 1AKUA 3OTOH 1ATIA 4FDLA 1AUQA 4KHPB 1CDEA 3AWDA 1QQ5A 4BGVA 1IBMB 5KZMB 1SCBA 2VXYA 2W6IA 5LUBA 3K20A 1U28C 3QQMA 3O21A 2PSSA 1QO0D 3KSBC 4DV0B 1QRTA 4J8PA 4D80A 4U7JA 5IF3A 4RFSB 1AQIA 2DPIA 1JDNA 4NNOA 4S3MA 1XEWX 2PH7A 3OCYA 5DM4A 3BRQA 4NFSA 1XDDA 1IC6A 3FDIA 4MUKA 4QFCA 5BN5B 4B73A 3EQ2A 4JT8A 3W5VA 3I6QA 1CXZA 2V7EA 4FMCF 3KUKA 4IIFA 3DDOA 2QZZA 4ARVA 4CQJA 2UZ4A 2YTZA 3RFTA 3RFXA 1WE2A 1AGXA 5DHPA 4Q16A 1T94A 5WRFA 1IZYA 5EUBA 2A0YA 3LPCA 3ONWA 2XB9A 3NUQA 3EEFA 3DYBA 2Y1FA 4QGBA 4NCXA 3WKAA 3LLCA 1GFWA 2GCNA 3IAHA 1GFZA 3NHLA 4UE2A 2ATLA 2PS0A 2A1TR 4CC6A 3KKZA 4MMZB 3C3AA 4EYKA 4KU4A 3WMFA 4HS4A 4R31A 4DLYA 3NWPA 4CF3A 3A4IA 3C0FB 5EKXA 4RTLA 4LFCB 4RTQA 1ZUD1 4X92A 4TSRA 2QMUA 5AQEA 1ZSVA 3MW8A 5J3JA 4YALA 1MVLA 4F6LA 3RT7A 5FI1B 3OF2A 3WB9A 1P6QA 1AKEA 4WNAA 3WWHA 3FNEA 1P77A 4B2YA 1I94B 2CVFA 3NGLA 4OYYA 3VI3B 8LDHA 2FJZA 1JXLA 4Z9FA 1ZM7A 3MS4A 4DMFA 2CUKA 2ONJA 2Z5FA 1EB8A 3OEED 1U31A 3K9BA 3UJ6A 2XJ9A 1V3UA 1GJRA 4TTAA 5CA1A 4G5RA 5F35A 3RVOA 1NXPA 4ZDJA 3CLTD 5CT6A 4I1RA 3ESAA 2JFZA 3A14A 3KHKA 4IQFA 1G4AE 2Q6LA 3PP8A 4UHCA 4UM7A 3PIIA 4X93A 3S2ZA 3OJ0A 4HSEA 1I10A 3IPAA 3E53A 1CUDA 3KB8A 3Q6MA 1G17A 1V16A 1NMEA 3E05A 1JYEA 1EZ1A 2OHXA 2XDQA 1ID8A 1L7XA 4V0OA 4NZNA 4RLHA 4YACA 1JEQB 4RIIA 2C9DA 2VUMG 3U7QB 4HVTA 1JT9A 3UF0A 4HYTA 2YZGA 4M49A 6ADHA 1S3FA 1R3UA 3E7PA 4UUOA 4V1CA 1T5SA 3OFSA 2RHDA 3FWKA 4K6OA 1X8LA 4YPVA 2QN8A 2WF5A 3DLPX 3DEYX 4PANA 1E20A 1XELA 3HOYG 1USUA 4HATA 3GRPA 5F51A 1PEYA 4HN2A 3EXIB 4BV9A 4MV1A 3OSNA 2Q8PA 4ZIRB 5GJVC 3MMXA 4DV5H 3O26A 2GN6A 2L69A 3IIIA 4YJGA 2X58A 2ZAMA 2OK7A 3TTSA 2FZ4A 2QLTA 4XWGA 1ODIA 4YBRA 2P6RA 2WDTA 1CU1A 4H27A 3P4YA 1SBQA 3DEJA 2A5DA 2C4TA 3OZ7A 4D8TA 2CHGA 4CETA 5AM3A 2F43B 2FWBA 3IVCA 3RS9A 2XWSA 3G0BA 5F52A 2Q4RA 4R2JA 1VTKA 2P11A 4FE2A 3T5DA 1JP7A 1J1ZA 4GT1A 2B63A 5TT1A 1NZJA 4KQIA 1HYEA 2FPWA 2OORA 3KKQA 4B09A 2IHKA 3CVUA 4TLMB 2CLHB 2EBUA 9ABPA 4PSCA 1C0KA 2PT5A 3O8QB 3KIPA 1GV1A 3QLTA 4CT0A 2EGHA 4LISA 1IHPA 1MO4A 2VAPA 1ECLA 2ZJ0A 4GKVA 2X0NA 4MVJH 3VKFA 1Q91A 3CT6A 3NI2A 2G72A 4BVAA 3F3MA 2F9MA 3HVHA 1WP9A 1RQLA 4LMBA 4FYPA 5GY7A 4MVJF 3QBEA 5DHAA 2O5CA 4MQLA 2ZTMA 4RHYA 2DUMA 2XRFA 2HF9A 4UVIA 2F90A 3GPIA 4OVKA 1L5MA 5LMCA 1T15A 3O3NB 1Z7YA 2GAAA 1GO2A 1EFKA 2J9FA 4ZCTA 1H3FA 2C7RA 3P0HA 4OHXA 4FS8A 3VV2A 2WHPB 1K6XA 5H9WA 2ISQA 4XW2A 4M8NE 4XR9A 5BRJA 2QX4A 2H11A 4G9BA 2Y1DA 2M6RA 4PGFA 2BTEA 1FVHA 5I7FA 5ETJA 4RNOA 1YQWA 2D59A 1JDPA 3RR5A 1NXTA 5F4ZA 4B3SH 1FFHA 1PSZA 2VTEA 2BRUA 2WJ3A 4AKIA 4F2GA 2C95A 4WFKA 2SKCA 2J3LA 1EDEA 2BF7A 3FLAA 2WG2A 2G83A 4M7EA 3HWRA 3U48A 2V6JA 3PQ2A 2R8GA 2E4YA 3LY5A 1DAAA 4PAWA 4JV5H 5CDTA 4PHCA 2P67A 1ZCAA 3UJDA 4TWJA 1PT9A 2FWJA 2EQ5A 4S12A 1XXLA 3CINA 1KMHB 1ZP6A 4PLFA 1UXIA 1ZRSA 1P3JA 2RGXA 1DIOB 3HO6A 1PQWA 1ZMTA 3JR7A 4CR7A 3VU1A 1WF6A 2H1CA 1Q7GA 3DG9A 4DAEA 3L6CA 2ECPA 4G9EA 1SFRA 2BGWA 3BCSA 2YMQA 3D3EA 3QSGA 1T35A 1IZ8A 4YCLA 1R8SA 5FOXA 5BOSA 2EYUA 4B71A 3REQA 4EGJA 1D4AA 2CUTA 4R41A 1CX9B 3OU2A 5TQ2A 3BGOS 2BEKA 1VKHA 4EFKA 5L1JA 3DZ8A 5D6OA 2AFIE 1ZA2A 1V9LA 1UJBA 5K9ZA 2IWRA 4I2NA 3IPRA 3K94A 3IC5A 1W4CA 1GKLA 4YREA 2Q29A 2BE9A 3KJXA 1OD6A 2XCLA 2RGDA 1XZQA 1FDWA 1XTUA 3O1IC 4K9QA 3PLRA 1PW5A 4ECSA 4EQ6B 3NVMB 3PCRB 4JI1B 2REBA 2D1RA 1UL1X 1I3QA 2JIQA 2PJRA 4CL0A 2ZSEA 4OAPA 1YGYA 1UKEA 4KEAA 2IU6A 1X19A 2RK4A 5DLGA 3GT4A 3Q0IA 3IS3A 3HQ4O 2PVPA 1MAUA 2NXNA 1UJ2A 4JYPA 1B4DA 5ALVA 3H3XA 2EKLA 1Y7LA 2I6GA 5JD5A 1O94C 2F8MA 4N49A 4MS4A 3WRYC 4EPXA 2WE6A 2IQIA 3L93A 5EMHA 3EBOA 2YNMD 1PTKA 1N5RA 3GTQA 1MH1A 1XJ5A 5KWVA 4MKRA 3EGEA 3E3MA 1GU1A 1T2AA 2D2FA 1B0ZA 2QF7A 3C1OA 4O4HF 2G25A 1C1DA 5IP5A 1SU6A 4CKEA 3CMMA 4AY3A 4DWVA 2MR5A 1OFTA 2R5FA 3GGGA 5I9TA 3QEMA 4MHTA 1EE2A 4CIYA 3OM9A 3QXHA 1O87A 2EZ8A 2A7QA 2ZYWX 1Z28A 4YCBA 4QWCA 1HEYA 4H9GA 1F0KA 5K8LA 2Y8EA 3T54A 5FEMA 2OZLB 3EA4A 4X1YB 3AUUA 3E5MA 2AHRA 3CW9A 1PX2A 2X86A 3M9LA 4TUYA 3MMSA 3ZWWA 3CEJA 5E7JA 5JFGA 4YCDA 4ZCLA 3DBHA 2YZ2A 3WWPA 3DM5A 3FN4A 1USKA 1RXEA 5A05A 3AUYA 3TJZA 3TQTA 4MPDA 1OZGA 2G88A 5LM3A 3UB3A 4IJKA 2LW7A 1GZVA 1ODTC 2W98A 3KSAC 4UHHA 5KQRA 4E6NA 4A4DA 2ZJYA 3GI1A 3NP7A 1UK6A 1KTIA 1L5OA 2HVSA 1FUEA 4RHXA 4RPJA 3ZCQA 2OGUA 3IQIX 1I14A 3SMVA 3VYSB 3ENZA 1XAHA 5TEVA 2CNKA 3RCBA 2FP3A 5BN3B 4XD7A 2WKWA 3EPGA 4TTSA 3ZCUA 1FMTA 3HSSA 4RGYA 4EBCA 3K16A 4RK0A 3GLFA 2JA7A 1WZ2A 1RI2A 2RCNA 3D6TB 2G28A 1MX9A 2HLPA 2O1EA 1E2LA 4QXRA 4RA9B 1F12A 2BM8A 4G84A 3RAPR 4O3SA 4Q03A 2VP6A 2VJMA 2P2DA 1NF9A 2PX3A 1OU4A 4M1MA 1X1AA 3PXGA 4L8FA 4EHDA 3D4OA 2W9CB 3C74A 1QQ6A 2HRQA 4K6NA 1LQ2A 5ED4A 3CZMA 4ZODA 3DMTC 4R2HA 4UDXX 1GVHA 3UK6A 1PS0A 1L7QA 1T4DA 1C3OB 4FX5A 2CLSA 3PVCA 2C7OA 2BQ3A 2NVXA 5ERYA 3OX3A 4N41A 4UFPA 4OH7A 2VJKA 3TDKA 3HZHA 1GNSA 5AVXA 1A8SA 1XCGB 4UJ5A 4E4TA 5DSTA 4BZPA 3VZSA 3PDHA 4FI3F 2R7ZA 1KI2A 3SJUA 3AF2A 2B5VA 4AYTA 4G4SP 1PQ4A 1W5BA 3EXAA 4MARA 3MAJA 1IRXA 1Z74A 2E5FA 2MSWA 3ZTYA 3TLYA 1OH5A 1IN7A 3OP4A 4LYHA 2JIRA 2FZWA 1BDHA 4LOJA 1RLJA 2KBFA 3UEOA 3PGJA 3U4MA 4JP2A 2UAGA 4UU1A 1U3WA 2H1RA 3I8XA 4LYGA 2AHOA 1EA5A 1X7XA 2BEJA 2CBXA 1YFJA 2IDMA 3AGPA 1TFUA 5G02A 5AI8A 3R20A 4DPLA 4BBSG 3GD7A 1M1YB 4FNGA 4I3GA 4DCGA 4HFNA 4TV8F 4I1UA 1K8YB 4RKWA 4UEJA 1S3IA 1XLTA 4V1CI 2C2DA 1P4RA 4KTVE 1G3RA 2P0AA 1W44A 3LD9A 2LKDA 1BXKA 1Z83A 1GITA 3LZDA 4IUDS 5TS3A 1EVEA 2JLXA 2J3EA 3G7SA 4AMZA 4PLCA 2I99A 1KPIA 1UXGA 3TUZC 2OPHA 4U2FA 5B6IA 3D4LA 5EKTA 2IXTA 2C97A 3L7YA 3RKUA 5EXDA 3ONFA 3HJTA 1HSZA 5KOHB 1E2NA 2ZT7A 4PYRA 4ZAWA 1B3BA 1Z07A 4QTZA 3LLVA 4XDGA 1Q83A 5ESXA 3O3CA 3JZMA 4MDHA 3DZKA 2REOA 4GR5A 2F6RA 3I6BA 4BFLA 2QBYA 2Q5IA 2MWMA 2AA3A 2H4JA 4RNDB 1LXCA 1T8UA 2BM0A 4ZKDA 3GJRA 2DUWA 3UB2A 3ZWBA 3E9RA 3U0GA 2I65A 3SXUB 4BU0A 5E3HA 1KMMA 1N1MA 4KTTE 1VL8A 2CLLB 4MW6A 3WGGA 4W7HA 4C7BA 1CYDA 3TAUA 1OC2A 1N34H 1J06A 1KI6A 4F4HA 4ZK2A 1DFHA 1DAFA 3RF2A 2H9IA 2WUWE 1NNI1 1DBRA 4WOKA 3RSFA 3ADOA 1TVEA 1L2ZA 1A50B 1A5ZA 5CXUA 2VCYA 3TW8B 3FYUB 1N0HA 2YQZA 4QT4A 3KHSA 3V7WA 4OBWA 1CT9A 3L6DA 2JBAB 1MKYA 4RNNA 1GDDA 4Z3KA 3JASA 4W6QA 3Q5EA 3OQOA 2QMZA 1W1UA 4EL0A 1M7BA 2XUPA 3O90A 5L6LB 2VZ0A 4ZVRA 1DAEA 1LRJA 2X9VA 2IOFA 4G1MB 3TGPA 4TL6A 4P4UA 3SZOA 3RVDA 3CLSC 7REQA 2H65A 1X14A 1EG2A 4L57A 2YICA 4RVUA 3OT5A 5DBOA 1DAKA 1DC3A 4N03A 1C3VA 1E1DA 2LD4A 3ZQKA 5LP6A 2AF3C 5L3SB 2J45A 4OIFA 4WERA 4LHYA 5CEFA 2C5FA 1BN6A 1AKNA 1O96A 4OK3A 1IN8A 5JEEA 2AKEA 3FJ1A 2Q3LA 4ZOQI 2CJWB 2VL7A 4V0ME 3P1JA 3WNVA 4TM8A 2Z8YM 2G5TA 1GPBA 3CONA 3U3KA 1QC5B 1X94A 3UAZA 1SG9A 1OI4A 3JD0A 2NYAA 4A5OA 4IJUA 4BGIA 1DADA 3OTOB 3TM5A 4LZJA 1TKAA 1BDMA 1EUCA 3E22B 5CFZA 2H59A 1T4CB 3P7MA 3CX3A 2Q62A 3V8BA 1ZH6A 3SE7A 4A93G 2PM8A 4RS3A 3DF9A 3N0WA 4G4JA 1OA0A 5I7WA 4X20B 4UE6A 5T4HA 3KTMA 1TB4A 1O3YA 1HDGO 1HNWB 3RAQA 1PL8A 2ONYA 4RJJA 3U1TA 3FA2A 4M2LA 1K8ZB 2HLDD 4FMCB 3ZHXA 3CZRA 2I3DA 3CVOA 1WKCA 5FTLA 4FZ5A 3T15A 1PZMA 1FJHA 1UPXA 4HO1X 2H29A 5KVVA 1K68A 2JKYA 2J7KA 3OMWA 4BN4A 1O75A 5F2KA 2DTDA 3LY7A 4AROA 1NFFA 4NPHA 5JUMA 4JJFA 2MCFA 3IMGA 1ZW1A 3DLTA 2BFPA 4H3SA 1Z5ZA 3E5HA 1ISIA 2OHGA 1RDFA 1Z0IA 4DXDA 2H54A 3MGAA 3NWBA 3KZKA 3AFGA 4BEWA 3FMIA 3KXIA 2AK2A 4TL7A 4DIFA 1ZRMA 2R62A 4RF3A 4C06A 3JSNA 2VZ9A 4QIWA 2BJHA 3A06A 2VYFA 3VQTA 4DL9A 4OP3A 1NW8A 3ZW9A 2AG8A 5IMSA 1IVYA 1GKIA 1PZNA 5B7QA 1IVSA 3BK7A 1NDHA 4PYLA 3F2VA 1Q77A 4ARAA 4O4IA 2H3EA 3ABSB 3NH6A 1N32H 5BWLA 1UZAA 4W7IA 3W7AA 1DRUA 2ZRJA 3I0ZA 5ALQA 3BJRA 1XCMA 3HCAA 3ZEIA 4P2BA 3ABQB 3BJIC 3F73A 2Q3FA 2EARA 3EG9A 3PR2B 4QQKA 3SEQA 3TYXA 3DOIA 3SYTA 3T5PA 2QVBA 4BLOA 3A9TA 5KT5A 1J39A 3K30A 1USWA 3IAAA 1J2EA 3SKYA 1SBTA 1MR3F 5EHGA 3AF6A 4OATA 3OUUA 4U7HA 3HN7A 1DCKA 3OU7A 4EI9A 5DXFA 4PRZA 3TX2A 5B7GA 1JKMA 3I52A 3PU6A 3LXXA 1C1YA 4DFDA 4H1HA 5EIAA 4U9UA 3NB0A 3F2IA 2YV1A 2I3AA 1HOTA 4YR2A 3F71A 5G0WA 3N87A 3S2YA 2YOFA 2ASVA 3G5TA 4GE0A 1S8AA 5JDCA 2PRYA 3Q3IA 5G2OA 1EFVA 5CVJA 3OUZA 2HDKA 3P9RA 4R9VA 5DPMA 1B8OA 1FMJA 1CYEA 4UFNA 2ZSKA 4KGXA 4IXMA 1LPPA 9MHTA 4YDQA 1QGED 4YR0A 4YROA 4KE6A 3BYZA 1HNZH 5EIBD 4EEQA 4GDFA 5A0TA 3EHEA 3OQNA 4BX8A 2I2AA 4GUAA 2WTXA 4RIHA 4RTMA 1GHTA 2E9SA 2GJ4A 4OGLA 1H4SA 4M1OA 4DTCA 3HUEA 3PVSA 4AT1A 1WCXA 2Y0CA 2JI7A 3O3MB 4J0HA 4N40A 3GNTA 3GLTA 2GBFA 2JC3A 5KJ6A 1X7DA 3HLTA 4MW5A 1XQ1A 3CF4A 5DV9A 5C3EG 3PG5A 5E0OA 3UJ7A 1WW8A 4UUQA 5HXAA 3MWFA 3GRUA 2PS1A 4EAAA 4UW9A 4ZALA 2X2FA 1ZHSA 3B7PA 4LE1A 1ODFA 1P7CA 3U26A 1UBCA 4QWMA 1D03A 3PRYA 1F17A 1MNAA 3JSLA 3RYFB 5JECA 3KJZA 4K8RB 4RBNA 3NX4A 4H17A 5T4FA 1XRRA 1DX9A 5KSOA 1XKTA 2IOQA 3K2QA 1BMQA 4K7JA 2H31A 1QVZA 3VR3A 5J23A 1X9HA 3T4EA 4K28A 5AW3A 4NV3A 2ZR8A 5JMWA 3PGMA 1N2CA 3ROQA 3GBSA 5TARA 4K1XA 2NU9B 5EA2A 1UCFA 1A5SB 4ENRA 1GLNA 3SXJA 2XRYA 1H5NA 4BO4A 1Z36A 4NAHA 4ZT5A 3NPAA 3G8CA 2X6RA 1M2OA 3KLOA 4B3SB 3VR6H 4E4RA 2ILVA 1N33B 5FLXA 1PR9A 4INAA 4MR9B 1VP3A 3DAHA 4DC1A 1AQUA 2G07A 2A0XA 3VUFA 3Q8LA 4G67A 1ZXLA 5KG4A 3CTMA 1LW6E 3CW2A 3WL5A 1II9A 3QM1A 2ZR7A 3EAQA 2IF0A 3SM9A 4QFBA 3COYA 5HPYB 3NEJA 1WCWA 3CX4A 1RXWA 1Z17A 1PVVA 1UKYA 4REQB 4L75A 2X5OA 5JBIA 2HMTA 2HJVA 4JS0A 4KLZA 1SZPA 4F7DA 4DIKA 3UA4A 1BQ4A 2QMQA 4DM4A 1TYDE 4TLLB 4L2IA 5K6AC 5HIAA 3X1XA 5JR3A 3I6MA 5LQDA 1THZA 5F5NA 1JWLA 4OU4A 1RC1A 2QNBA 2QTVB 1GCAA 5GGYA 2E2HA 3L4BC 3PIDA 3O2JA 1OAOA 3FWHA 3U54A 1KI8A 4U6SA 1YASA 3I9LA 5LDHA 1SXIA 4CCWA 3PA8A 4ZDWA 2EJCA 4YI3A 4MRVA 1W5EA 3S2IA 4DNOA 1TVMA 4B6SA 3LK6A 1N0VC 2CJFA 4LSGA 3N07A 2O03A 4EQZA 3OIFA 4EX6A 2PMDA 4CKWA 4F2PA 4HRAA 1SUPA 4O5OA 2GPTA 2YXDA 2PYZA 2YZNA 4RAOA 3QBJA 3EWSA 5CG1A 3QVTA 4B3FX 5AW9A 3G1TA 1QKIA 1W9HA 3I4CA 4GKBA 4RM2A 1Z8FA 4C5BA 4X60A 1E1LA 3IMFA 5HYVA 2QGFA 1SCIA 2I1QA 1JECA 1JB1A 5JJ5A 3STTA 1KS9A 4DV1H 4O4HB 2ONKA 3UJ3X 1JEDA 2XADA 3SE0A 3EDYA 2RC6A 4K1LA 2ZB7A 4OFXA 3P5BA 5K8TA 3R9RA 2ZE7A 3Q98A 4EBFA 3Q2KA 2GAIA 1S5PA 4JP8A 2R1TB 3K32A 5IF9A 3FUUA 4UUPA 2VZLA 4D8XA 1OAKA 1YS1X 1XKLA 1MZVA 4J1SA 1KC1A 2PO5A 3FROA 2VRCA 4HNAB 4RU9A 1LK5A 4DLXA 2FK1A 3D2LA 1SUEA 1V6AA 2Y6VA 1OFIA 2XIQA 5DN9A 3K09A 4Q8FA 3S2FA 3PGXA 4AXXA 3V8NA 1YA8A 1LBIA 1MGPA 5KKAA 1TM2A 1UPBA 4D45A 1M2EA 2M9MA 2WHXA 4J91A 2ZXUA 2JRCA 1WVGA 4ICIA 1RWXA 2WU3A 5BYBA 1QVAA 3QELB 3SC6A 2ODPA 1M54A 1QP7A 1URPA 4U5XA 2FZ5A 2DPXA 2WSLA 3KM0A 2NTYC 3JVVA 1C4WA 3VVLA 1OI7A 1EEXB 1PDOA 3CRRA 2W90A 1XVTA 4E1AA 1Y1QA 1NPYA 3PFNA 2WVJA 4WOBA 1UPUA 3I9JA 3ET5A 4DN6A 2EQAA 1AV6A 3A6PC 2XHEA 4PEVA 4WKPA 4KQ9A 2CXSA 3DNPA 4FNAA 5JI3E 2ZZKA 1IHDA 5EHQA 1O1YA 2PMWB 3QVMA 1Z2AA 5LZ2A 1E7SA 3FVVA 2W8ZA 3W8FA 1NWCA 4FR2A 1MT3A 2LE0A 4K9OA 5IDQA 3IVRA 4ALNA 5JAZA 1FY2A 1CUIA 3KFLA 2E2WA 3BSWA 5C4XG 3MAAC 3H83A 4Q4JB 3C8ZA 1R50A 3H8VA 5AI6A 3W79A 1XHLA 4G37A 1J1IA 1CZHA 4XD2A 1G63A 2Y1XA 1U1GA 3VU9B 2HNBA 2REQB 4YR7A 4ZZIA 3MFQA 3CN9A 2WVGA 5KMGB 3PFKA 2QE7D 4LZWA 4P22A 3SGIA 1VL1A 4LH6A 2CLCX 2DCUA 3A9WA 5K0CA 2VP2A 3STHA 5JZOA 5EUMA 2ZOSA 1Q5PA 3WO0A 4DXHA 3DVSX 3M3PA 3O95A 3DUFB 1LNSA 2X40A 2CKZB 2JGEA 4B3JA 4CQMD 3L7BA 4RPLA 2JF0A 4N0MA 1WCMA 1JLMA 4B7UA 2DBZA 2HVQA 1QFMA 4CT4B 3UYKA 1WA5A 4UHEA 4G0XA 3MWJA 1ITZA 4C0SA 3H1GA 5FL3A 1BMFA 1OYOA 1CVIA 1LF5A 4QGHA 4YR9A 3KUDA 1U7XA 4RK6A 2DJIA 1HL7A 4BDSA 5KG3A 1PJSA 4BNIA 3E9DA 3CVVA 2GEFA 1AMNA 4O7SA 1V35A 4TV8B 1U0OC 2EC5A 5L7YA 1JV2B 3QVGA 2QRMA 3WLPA 3SFTA 3A6HA 4AICA 1T91A 5IJAA 5TPZA 2B4TO 3H86A 3ZCTA 5I8PA 3ANTA 4LA4A 4B48A 5JH7B 3K0HA 1LX7A 2O8CB 4EKEA 3PQ6A 3U62A 2PKQO 4AIIA 3AY6A 2I29A 3D3WB 3INTA 1OBGA 3I2FA 1Y5MA 5LDDC 1DAMA 3DAYA 3BOSA 3Q10A 4YC7A 3UJBA 5FDFA 2EJTA 4EJMA 4GWGA 4YP7A 2H63A 4YRMA 1P4AA 1FRNA 2FSHA 1I4OA 3HYSA 3TIGA 5KYNA 3CFYA 1SCAA 1BHSA 3PX2A 4HX2A 3BACA 3H16A 3U9SA 4ZXPA 3HY3A 4PDBA 4U2GA 1R9TA 2OVBA 2VHYA 3SSOA 3MAGA 3A7EA 3TUIC 5JRJA 4P5DA 5IJ0B 5JCOC 3IUBA 1XRJA 3FKSD 4EA9A 4EYGA 1AOXA 4RF4A 5I5VA 1NQ5A 4B3RB 4KBGA 1QAMA 4FKBA 3HXTA 5CVTA 1DC5A 1QJ4A 3HEMA 3UBTA 2FEXA 4LXXA 2XA2A 2OP1A 2GBPA 4BY7G 2D8MA 4TMFA 4ZVUA 2IYVA 1N34B 1PLLA 3L7IA 3U4QB 4CKBA 3QPBA 2R47A 2V65A 5BV7A 3OF3A 3KUXA 4FOOA 3OE5A 4RA6B 3GFFA 3RANA 4XDHA 3UPDA 5E4TA 1SHZA 5CNJA 1BWPA 3WX0A 1C7ZA 4IPTA 1UPTA 2IXDA 2NXCA 2E5LB 3I53A 3PD1A 3DV9A 3DEIA 4R7ZA 3IMEA 4YP0A 3TRHA 4I36A 2E0IA 4W5JA 3Q3EA 5K3CA 1KMCA 3OZXA 3UNXA 2XI4A 3V4FA 1D3AA 3A6KA 4B3IA 3N1UA 5FOUA 1RRPA 4HJRA 3LPLA 4YQYA 4L22A 5J4LA 1LKZA 2XEDA 1HMPA 2VRWA 3QPUA 5DZSA 5BN4B 2X6TA 5IBCA 1JR2A 4OF4A 1Y1TA 4J16A 1QTIA 3TSAA 1GCIA 3OG9A 4XIJA 1MO6A 2QGZA 4PYMA 3FKQA 5D5HA 2ZKIA 4AK9A 1PFYA 1GRQA 3MPUA 4HHEA 3IEIA 3KHUA 4TZTA 3NHSA 2QOEA 3RC8A 2Z6AA 1IZ0A 3RQIA 3QUCA 1YR3A 2ES4A 5FWYB 4LN1A 4PLZA 4B9EA 1OXTA 3R9WA 1HRKA 3HLYA 1YE3A 5AM2A 5AK0A 4XYMB 1CKNA 1EZZA 4NQZA 3UCXA 2B6NA 3QKRB 1NZFA 5FI0B 4IMJB 3N7TA 2Q7OE 5IUKC 3V1TC 2QZ9A 5T8KA 5CLLA 4QYMA 4EI2A 4H08A 3M5CA 1ZRNA 3SS7X 1EAYA 3FSRA 3H1FA 1QYWA 1WB4A 3IVAA 1YBFA 1M8FA 2PFSA 2RHGB 1UC8A 3FM9A 1O08A 3D81A 1CUZA 3DO5A 3ADKA 3M5PA 3I8SA 1VIMA 3I62A 4B3MH 4QYTA 3W6ZA 1KQFA 1W8DA 4QGGA 1XKQA 3AVPA 1QIMA 2AYXA 3TTUA 4G23A 1L5HB 5EWLB 3FBTA 4LC1A 2ZPUA 3CKKA 4EVQA 3UC5A 4P0PB 1EAMA 3ENVA 3ZVMA 2QTFA 4KNYA 4O25A 4EPWA 3O8DA 4WKGA 2AVNA 2HY7A 3N3BC 1GPLA 2RGVA 2RHOA 3EFEA 3WC4A 2ZWMA 1ENZA 1Z4NA 1XD8A 3MILA 4O4JB 2N1MA 4QT0A 3UQZA 4UCRA 1NURA 1Z5UA 4GSYA 5EOVA 1D2AA 3BRSA 5IAAA 5LA6A 3AXTA 1IHUA 2O1SA 1T34A 2EF1A 1T9CA 2GXQA 2BGTA 5KNDD 3C41J 2DQ4A 4FI3C 4YAKA 5K2MA 5BV8A 4DLVA 1HTWA 2VAMA 4GUDA 1O94D 3HWSA 2OCDA 2DLCX 1Y1VA 3A1SA 1FW6A 2HA7A 4AO7A 1TM1E 3PW5A 2LRHA 2E2IA 5DF1A 3THXB 1Y8QA 4WESB 1L5ZA 2N0SA 3Q5DA 2X13A 4H59A 3Q3GE 3TBFA 2FZCA 1QHEA 4MWEA 5JI2E 1XMQB 1CR6A 4Q3DA 2O0JA 4KBFA 4PSVA 3OPNA 1QZTA 1U3GA 5ALGA 4TQUS 5KG5A 2VPIA 2AK3A 3R5TA 3O8CA 2QE6A 4RJIA 5B2EA 1QIIA 4ZJPA 1FMLA 3GVXA 2ENWA 5K03A 3W5DA 3TQRA 2H7VA 4K9RA 4TTPA 1N32B 2H1HA 2RI0A 1PNQA 4G5OA 4PLGA 3K70B 4X84A 3U4DA 3DE2X 3CX7A 2XWJI 5FUBA 1ENOA 2IVFA 2GJAA 1C7IA 4LHVA 5KTRA 4TZ0A 4WBNA 5JE8A 3DOCA 2ZLBA 1IXRC 4X54A 4XUGB 2FCAA 4X61A 3IJPA 4BOYA 3ZHSA 1UZNA 5FLEX 1JR3E 4Y8VB 4TTQA 4FDTA 3KOUA 4Q7JB 5A4AA 4XPZA 3K2EA 2PKWA 3WAJA 4PV7A 3VNRA 3IBCA 1MU0A 2O8VA 3L18A 5FI3A 2W2KA 3RK1A 1ZGZA 4YRLA 1KP9A 1YJ5A 3ESRA 2A5FA 2XLCA 3P0IA 1NG1A 2PGIA 4PZ9A 2CGEA 1YI0A 1ZXXA 2MIIA 4DA9A 1N5JA 1TAHA 2QX9A 3NO4A 2EZ4A 2JVJA 3I58A 3K2BA 2E1RA 1JEYB 4YRSA 3FTEA 4MO9A 1VE3A 4DJDC 4G0QA 2COKA 3H84A 4WA7A 3ZW8A 2CVOA 3NC1C 3TZQA 1PWXA 5DWDA 5DI9A 2NSYA 1G7CA 3ZGNA 3GA0A 1W85A 4BNTA 1H23A 1BVRA 2QAGB 4EABA 4EFLA 2CSXA 2WV9A 5FLKA 2J9XB 2HYDA 1LLDA 5JSFA 3I2JA 3WIUA 1M2GA 1THGA 4EEXA 2FJPA 3SD7A 3DZGA 1HNZB 2R8YA 2WV7A 5CX4A 3DHYA 3HACA 2HADA 4LRSB 4XR4A 3HNOA 3S28A 1I9GA 4IDPA 5LLDA 2NSDA 5AK5A 2FEOA 2P8SA 4LRXA 1U3FA 5B12A 4F11A 4ZTUB 3VVMA 2OFFA 3NHYA 4A23A 1N2IA 5CD9A 1IHYA 3H5OA 4RPHA 1U04A 3EK2A 3AJRA 3G82C 1LTQA 4DNQA 2BGLA 4ECVA 3CPJB 3OX1A 5JALA 1X1SA 4CV3A 1U98A 1O5TA 3Q0TA 5F4BA 2RC5A 4MUYA 1T5IA 1Y1KE 2VF4X 1YV9A 2IGBA 3O1LA 4FQ7A 4F5ZA 4DVGA 3LX5A 3O7MA 3TCNA 5G4KB 3ZKWA 4LYEA 1WHSB 3RE1A 1KI1A 5CR9A 2GEUA 2WABA 4F04A 2AMJA 2Q4OA 1CEYA 4FLFA 3WMWA 1F2UA 3GD5A 3E9EA 4DCJA 3WGQA 1UOQA 2UVDA 4CMIB 5ALPA 2V3CC 2AE2A 1JSCA 3DSRA 1HDYA 4Y6GB 3B9RA 3K15A 3CUTA 2GD0A 4XUDA 4O81A 3AVQA 2B35A 4WXMA 2VIIA 3I9FA 4MAAA 1FSSA 2ZSAA 4HTFB 2WWRA 1CQXA 1PLKA 3B5IA 1XHEA 4EDFA 2ZDQA 1OIXA 4BB5A 3RIGA 1T3GA 1Y4UA 2W9AA 1ULAA 2WIJA 2GVDC 4JOBA 4JI2H 3P9NA 5THQA 2J30A 2QEQA 4UJ3A 4Q9IA 1A69A 1C29B 2EFHB 3L46A 3PQ7A 5TVKA 2R68A 4DDHA 5AVSA 1E99A 3GZNA 3PQ3A 4L74A 3VC1A 4YAIA 4H77A 2VK2A 3L1VA 2X8JB 3K6RA 1GAXA 4JOCA 5EZYF 5HHTA 1XTZA 4FCTA 1XRQA 2WWHA 3A10A 4X6XA 3N8HA 3VKVA 2OH2A 3F90A 5A2QA 3PEFA 2KLHA 1OHHA 4IIYA 4NECA 2H57A 3SJBA 4HGOA 3ZGYA 3RC9A 4BNUA 2FRVA 1B6GA 1LZKA 2ZJBA 5KYVA 1SBNE 2XODA 4QFMA 3ZQUA 2X8WA 3T5JA 5H16A 4LDQA 3A25A 3H9EO 2VTDA 3DGEC 3P9CA 3B9QA 3PHLA 4LW8A 4L8VA 3FLEA 3VR4H 5A06A 4MIYA 1X2BA 3A3KA 4Y67A 1XJ0A 3ANLA 3HZZA 4EKIA 1HDOA 1I32A 3WNCA 3ZWXA 3Q8MA 3UQYS 1ZZGA 2B94A 4YP1A 3AZPA 1EMDA 3B6IA 3L5KA 1M7HA 1JQJC 4IJVA 3COPA 4U0JA 1ZVJA 1EX7A 3FD8A 2W58A 2HA5A 1RZRA 4JA2A 3AIOA 1P2DA 3SDSA 1JIKA 1MX5A 1M7JA 1QRRA 1MTOA 1XD2B 1QGDA 4YLEA 3CLSD 1MABB 1MG5A 3KB6A 3ECAA 4F60A 4OYLA 5EL0A 3TD9A 4YJHA 4YRCA 3KR9A 5KG2A 1MEJA 4DV1B 5JWHA 3EGVA 5CT4A 1UKBA 1JHMA 3F7MA 3V5NA 1TWHA 5HSGA 1BS1A 1HT2E 1M2NA 5FO1A 5BVGB 5EFZA 4EJSA 1H0RA 3EOBI 5LIPA 4BVFA 4Y9SA 3ROMA 1MZBA 1KJ9A 5CTJA 3DW3X 4A91A 4EFDA 3GZTB 1R6XA 3SQMA 5HRCA 4F3YA 4N8EA 1UF9A 3GUUA 3KHLA 3M6FA 3MHPA 2RH9B 3GT3A 1B93A 4MPPA 4AAYA 1I1KA 4HWSA 1E7QA 4I55F 2Y0EA 4LJYA 4ZANA 3ZR4B 5BMOA 2QT0A 1OLSB 5KYXA 3I01M 3QG1A 2BFMA 4GM4A 3EVBA 3E1SA 5HA5A 1WXEA 1XMIA 3Q9LA 4BNMA 1EWRA 1HYQA 3WL4A 1L6IA 4H31A 5CFRA 1TXGA 2P2CA 3OSUA 1H1DA 1SKYE 3AKYA 3WRVA 4U9IS 5DNUA 2H4XA 2VUTA 1MENA 3A3NA 3WJ1A 4IG9A 4E0BA 4LYFA 1BD3A 3C6MA 3PE3A 3C5HA 3AVUA 3U40A 3SSAA 2B83A 3VTAA 4Y2HA 2QTWB 3BMCA 3K0CC 2EL9A 3GILA 2Q1TA 1QVVA 3SR0A 2C2KA 5ADHA 3K71B 3NCHA 1OFUX 3ABZA 1A5TA 4BFTA 3AIMA 2BKAA 4B6PA 2X8AA 4JP1A 1KVRA 3DHWC 3DB1A 1YRHA 3KLMX 2AZXA 4TXMA 5HK8A 3EE6A 2R8BA 1MIHA 1HE1C 3BD7A 2GCEA 4V2UA 4N6GA 5TJHA 3KZMA 1N6LA 4N5DA 2FMHA 2PQMA 4A16A 4X00A 1AXRA 2Z2JA 4BVEA 1O5OA 5JVDA 4ZARA 3SJAA 3O94A 2XQGA 5C7IO 4IOKA 3QPVA 3PB3A 1XT6A 1M8KA 4L1KA 2AXEA 3GC6A 1PR0A 3JQAA 3R75A 4A2BA 3CURA 5K8IA 3F6BX 5A2QW 4XQ0A 3ZXYA 3G3EA 4HLUC 2WP0A 4WKOA 2AFHE 3L0DA 4X6YA 1O0BA 1Z0DA 3V8VA 2VDMB 3CW8X 4L02A 4X66B 4L3WA 1Y8RA 2NO0A 3FI0A 1UM9A 4TS3A 1KVUA 4PR0A 1XKXA 4BECA 4AJ2A 5JANA 3PRKE 1BC5A 4X0EA 1RLIA 5IT4A 2Y92A 3DZJA 2HDOA 3H3FA 3OZWA 2C1EA 4B0OA 2J6HA 3GFQA 4B6EA 2B34A 4KXYA 4F3RA 4FN5A 4JI0H 1IDOA 3DMGA 2YY5A 1V9CA 4S1NA 4HYQA 1CUBA 4HMQA 3AEYA 1HDRA 3HOXG 3MJRA 4IFTA 4IXWA 5KJCA 1LTHR 1YI1A 3FCYA 4KV7A 1G9TA 4TYYA 3QK7A 4GFDA 1UKAA 5I3CA 2A67A 3H05A 3I30X 2DFNA 2RHRA 4CNQA 1CUFA 1JDEA 4R1UA 3KPJA 4HGNA 4Q05A 1A5BB 3QXXA 5HWSA 2IS4A 3GFOA 3AKCA 4O7ZA 4MUNA 2R00C 5IH7A 4MPRA 4CM6A 1CFJA 2IUUA 3NOVA 2CF6A 4JLOA 5AESA 1ZOSA 2XXAB 3LFHA 2VSXA 4UOQA 2V7WA 4DYDA 1F2VA 4M54A 2WUGA 1GRNA 3KTOA 2O1WA 4IGFA 1ORVA 3Q7EA 5BW6B 1CNMA 1ZN9A 2O3QA 4ENSA 1SK8A 2L17A 3O83A 3TLZA 3GFPA 2ZS7A 1ZSNA 3OCUA 1ZXBA 1H8HD 1B76A 5I5EA 4US0R 2DFPA 3TLKA 4IEFB 3IR5A 3DNFA 5IEBA 2AF4C 4C6RA 3R7AA 2YIJA 2RHCA 3LQSA 3SS8A 4EA6A 1LA2A 4M76B 1V4NA 2KSQA 4MKZA 5C3UA 4HDMB 4DIBA 1B23P 2QM3A 4R5MA 2OM2A 2BSQA 1KZ7B 4DC9A 1JHDA 4DCMA 4MROA 3AHIA 2JJQA 3S1AB 3AEUA 3IYLW 5JH7F 2KE5A 3TNYA 3WQRA 3JXEA 4RHEA 1B7GO 1DAOA 1IH8A 3OZGA 2HRZA 4RJTA 1F9AA 5I7OA 4TMKA 3AETA 4P80A 2DHEA 4Q3KA 4QXOA 7YASA 3N2KB 1SBYA 4KQFA 2PUVA 3HB0A 3OOEA 3HUDA 3FOBA 4EHAA 2PMBA 2WYOA 4WNYA 3UHOA 1K6EA 4NX2A 5IMBA 4W8HA 3JVIA 1SHLA 2Z8YA 3MIIA 4E7OA 1SVNA 2HRDA 1FTWA 1H8ED 2DSNA 4V0RA 1UFOA 1DVRA 4X44A 4ENPA 2C98A 1VL5A 2PTHA 3THRA 3FKJA 3SHQA 1QWSA 2JBHA 2V03A 3SIRA 1B16A 2O59A 2QTTA 1FYDA 4AFNA 4DWOA 5B6PA 3UHJA 4G36A 2OV4A 3B3QA 3RV3A 2HX1A 3SC2A 5BSVA 4QUIA 3GN2A 1Z2NX 1EP1B 2GFQA 4WA8A 4YDHB 4BWYA 5I5WA 1F20A 5LJIA 4CM7A 3ZDRA 5INTA 2QTGA 4HDCA 2R2AA 3NS7A 3UJCA 5EYPB 4KIGA 3D2AA 4OQFA 4EYQA 2OFWA 1AM4D 4B3MB 3IE2A 2QRGA 3NIDB 2PUAA 4JKYA 5D86A 4P83A 5J2TA 3BEOA 3T5TA 3L0OA 3ITKA 3UENA 1J2UA 2LCIA 3UHAA 3ZD9A 2FDXA 1G55A 1REQA 3T41A 2QK4A 3G2OA 1C81A 3WBJA 1T0IA 2I7DA 1NASA 3IV7A 4HDAA 1Z4OA 1M6WA 3TOVA 3DE0X 4H1UA 3C1UA 5IC6A 1Q3TA 1WZEA 4ZWNA 2GD6A 2IPAB 3IUQA 3EVZA 2QTCA 5L1IA 4F4DA 2C5AA 2RJ3A 3BFKA 3P5SA 3ZDCA 1R6AA 1HLFA 2RBEA 1JEJA 1K5PA 4AUNA 2FQYA 3HNRA 3V1KA 1KO4A 2UDPA 1KIAA 1VJTA 2HB6A 3ACBA 4QBFA 1A9XB 5EIFA 1EX1A 1ISFA 4GP9A 4NS4A 5AR1A 2P6OA 4EKYA 3C5WP 3V8PA 3FTFA 4MYRA 3RIXA 5BW4A 5DVZA 4B5KA 1NVEA 4FOLA 2Z9BA 4DMCA 5HE8A 1OILA 4X65H 4DWJA 2WLTA 4E13A 3RB3A 2LGJA 5EPUA 1AVTA 5C37A 6REQA 1PHRA 4RVNA 2AI3A 4KR9A 5KQPA 2HHJA 1QJCA 4QM7A 4ZVOA 3OCXA 4DG8A 2ZRNA 3CLUC 1QGUA 5C46F 4A0QA 5EPOA 2OYRA 1Z62A 2JANA 2HIVA 5FV7A 1C0LA 1L5KA 5L3QB 2HXYA 5KDOA 2J3QA 2YV2A 4CEJA 4IXDA 3SF0A 2CYCA 3A3YA 2Q4DA 4HB2A 2EJVA 1HE8B 1B1CA 4X3CA 3KHTA 1PDWA 4O4LB 3JPWA 3QJ5A 2P69A 4M9UA 4G8BA 4WZBB 1J8MF 3G1WA 4TLBA 5LXTA 3DV0B 1O77A 1QYCA 1QMPA 1QGYA 2WMNB 4IQ0A 3NBFA 1QX3A 2GA8A 1L9KA 3R4VA 3FLBA 4TTRA 1ZDMA 4M1EA 4O4JF 4MS3A 4RMJA 2WG1A 2ZRQA 1GGOA 2C61A 3BL5A 3HUTA 1Z45A 2P2ZA 3ZLUA 2QDKA 1C5KA 4B3DA 1O4WA 2V4ZA 5J1TB 2AXPA 2CXPA 3OJCA 1Y3DE 2R7MA 1Y9AA 3AK4A 4QPNA 2WQ6A 2VSQA 3WL7A 4A6EA 3LHKA 1R3DA 4RL6A 4Q4AB 3LPMA 4XWTA 5BQPA 1H2EA 5B6JA 3RWOA 1L6RA 3WSWA 1Z12A 3K9LA 1H1LA 4R2IA 3QSYA 1CZUA 2YCLA 2DXIA 3NHKA 4HAZA 3CVXA 3OJWA 4CXMA 1RWQA 3PQCA 4UDOA 5E7QA 4BXXG 1H9CA 4OSOA 4XEHA 4X1IA 5CTAA 1R1DA 2AYYA 1SCDA 2E21A 3ZBUA 1FVFA 4WNIA 4JLAA 1TNDA 1QOQB 3F49S 3ZVNA 2VAWA 2FP4B 3DO8A 3GL9A 1TKRA 2A59A 4PZAA 2RGGA 5EJ6A 2F17A 3MCUA 4JXXA 1JLHA 1HE3A 3AY3A 1FFWA 1RYDA 2DTXA 1GPH1 4LUCA 4C29A 2UYGA 5A7FA 3QLVA 2PNJA 1D5WA 1MVNA 1GSOA 2Q1WA 4NJMA 4XGRA 3MELA 4V0QA 1NU8A 4QRDA 3HU2A 2HNKA 5H59A 4LPSA 1UMCA 2FWNA 3DC7A 2IYWA 2FEWB 1XEAA 2ZVPX 1OUMA 1E9VA 1K08A 1Z5PA 4AMBA 1KAGA 2C7QA 4LECA 5FTJA 1Q7RA 2ZT8A 3KCQA 3Q1KA 1JIHA 1I1NA 3H5LA 4DRXB 4DV5B 5KVCA 4X9XA 3WLMA 2VWPA 1E63A 4AJPA 2O5EA 2XUDA 4DABA 3UXYA 3GLRA 5A5FA 1NVDA 1PI3A 4MP6A 3OLCX 2J6TA 5CURA 1DC4A 1LWNA 1U81A 2QPLA 3GLHE 2Z9DA 3MQ2A 3PHBE 1T3LA 4QXMA 1E59A 3RROA 5M7EA 3TXAA 4JI2B 4J1TA 1P1JA 3ZI4A 1GZHB 1M83A 1XVVA 3LULA 4RCZA 4R5HA 3FYUC 1J9EA 4I6JA 1U90A 2C5GA 2WW8A 5EZYB 4HTAA 2PSFA 4P4NA 4ZVKA 3THOA 1Y6QA 1J4AA 3V1UA 4OHYA 2ZGIA 4FZJA 2DCMA 3DHEA 2D0OB 2L19A 2CXHA 4RD1A 4E2XA 1V7ZA 1RQXA 4MVJP 1IUNA 3ICCA 3FPHA 4JUIA 5FR1A 4HDSB 5IZCA 5DBEX 4W5RA 4NRDA 3PE4A 3C24A 1GSAA 4R8VA 3VR2D 5KNBH 4F56A 3B7GA 4M7WA 3VO1A 4AJIA 4YONB 4JJ4A 1LDGA 1V8OA 2V9ZA 3OTHA 1B0UA 2DIKA 4L8LA 4C0LA 1A77A 3C6ZA 1PQUA 4WY5A 1NVTA 2JH8A 5GMOA 3F8SA 3QMVA 1ZUIA 1J8YF 3OPQA 2WNHA 3GA7A 1U8YA 1X8KA 3RHZA 3Q7TA 3GMIA 5TGDA 1U3CA 5EQFA 2LP4Y 3TO5A 4CUJA 4O29A 1A9PA 5LQSA 1QAQA 3HJRA 4EJFA 2LVBA 3V3KA 3WLNA 1B74A 4BLUA 1OFHA 1DQPA 1GYFA 3ZJUA 3SSMA 3JALA 4MQUA 3G02A 3NJ4A 2GO1A 3CV3A 4JV5B 2F1IA 2Z1DA 1VG9B 2JEZA 2F1OA 1OLXA 3Q8KA 4YGYA 1QGZA 5F9LA 3HBAA 3KQVA 1X7HA 4AM8A 2P9ZA 4PGGA 2UUCH 1HE2A 3QMMA 2GCIA 1A82A 3PYLA 3W77A 5KI6A 1KY5A 2NVUA 2H7XA 1IEVA 4GZMA 5A4IS 5KS8A 3HVJA 5DYIA 1VPTA 2R25B 1JMKC 1GSIA 4D0GA 5KOJA 4R1SA 1JLRA 4JENA 1AKTA 3T3OA 2G5CA 4R0MA 2CB9A 4QU5A 5LMZA 4HAIA 1J8QA 4MCJA 3K3PA 1ZD1A 5KSPA 5JNLA 5BR4A 4I55B 3EPIA 1I6KA 1S2OA 3JQ8A 4HQFA 3D8TA 2JFVA 2B5OA 4GI3A 4W9RA 3RSGA 2ZIFA 3PR5B 2GTHA 4QAJA 1USGA 1SYXB 1QS0B 2RAUA 3RAJA 1DBPA 3SI7A 1EHCA 3W9BA 1KDOA 1WABA 4U7PB 5BUCA 3FVTA 1FCJA 3M83A 2HQSA 1XDSA 2QJRA 4FGJA 4NV0A 3DLBA 4HRYA 3HEBA 1T3HA 4QUGA 3C7DB 3DV2A 2CKDA 4YJKA 2Y0DA 3CLKA 1BJRE 2WZCA 4PIVA 1ZCJA 4WN9B 4XWWA 5HQTA 2J6UA 5BVHA 1EA7A 1C14A 4KLAA 1BRMA 3BXPA 3T34A 5HRUA 2O7NA 3UWPA 1M5TA 3MJVA 1Y5RA 1OXKB 2P62A 3KZVA 2CDRA 1MJGM 1KFBB 1SVLA 4NV1A 2BGIA 3NVKI 5AIAA 1AMOA 4JODA 4UCFA 1GAWA 5JVLA 1V26A 2WWYA 2TRSB 4LXQA 2HIAA 2JDID 5FBRB 3W4JA 3H4TA 4EMBA 3EOAI 1E2GA 4PAQA 3QG5A 3KVVA 1VLZA 5IWAH 4BV2A 4MUIA 4II2A 1PEKE 4AW9A 1VSUA 4Z6KA 5UKDA 3N9IA 3L7OA 2R6GA 4UVHA 1D8AA 2EG9A 1TWGA 4HDRB 4N5IX 3LCRA 5D3MA 3B1WA 3GFBA 4KFUA 4YLGA 2VPQA 3C43A 4M0FA 4BFSA 3F47A 1QLHA 3FNFA 2EATA 3TBKA 2GYUA 4OY3A 1NQOA 3VVCA 2FMIA 1II8B 2N3ZA 5CXSA 2PFGA 1AXEA 1RACA 3KZOA 2IUFA 1HK7A 4OKNA 4O7VA 3GDGA 1AU9A 2PRIA 4UBOA 3CO0S 3OM8A 5ISMA 4BNNA 3FBWA 1NDUA 4HQ6A 1VYUA 1M8PA 4B2LA 2NUPB 2EGUA 1FFDA 4J0IA 3QY9A 4L8WB 1TI7A 2F3RA 4EI7A 5DKFA 1LI5A 2W4QA 2QUIA 1KO1A 2BWJA 3MC1A 1GZSA 4G5FA 5C5JA 1Z6QA 4P4LA 3KQHA 3F3YA 3AHJA 4DOMA 4LDPA 4JY7A 1VKRA 1PX0A 1VIDA 3I5AA 5L3RA 3ICPA 4QYXA 1KZ4A 3F5QA 3G49A 2FYTA 1EM8A 1WSAA 4ARUA 5BNZA 2JLAA 3OO0A 1OYVA 4CG0A 3L2OB 4UPVA 5FOWA 4OKSA 1H85A 2A0KA 2VTKA 1RHUA 5T57A 5DNAA 2A5YB 1GXSB 1CHNA 2JAXA 1QV7A 2DRIA 5FHQA 1U6KA 1N5IA 2LPMA 3V42A 4OSPA 4Z1MD 3OPYA 1P9NA 1UMBA 4YMVA 2B82A 2CHVA 3BDVA 2B36A 4FGKA 4JI0B 1YQTA 4DDTA 1SUBA 5FLXW 4WXRA 4IIHA 1MJHA 2HOQA 5FB3A 1E9CA 2HT6A 2R65A 3V8RA 4E14A 4YMLA 2Q6KA 4PLPA 3N8GA 3B6MA 4ZU3A 5LMNH 2QJWA 1O8CA 1O8BA 1WMDA 4HPWA 3EFOA 1JE1A 2P9JA 1YMVA 1FP1D 4HI0E 3FNIA 2J7PD 4RIEA 5HKKD 4WRRA 2PGAA 4EG8A 2UZ1A 4F2HA 3KTAB 3ZNPA 4XCQA 1FSFA 4DR5H 3D4IA 3SYMA 1FDOA 3HBMA 4JU9A 1UBHS 1S0OA 3E1KA 5EWEA 4JB0A 1G21B 4NZYA 1R9JA 4M6WB 4QEDA 3BQ2A 3PXDA 2C2GA 2CDNA 3KKPA 1O95C 4HJXA 5AVKA 3RG2A 3N2GB 2W2VA 3AX6A 3KT6A 5H82A 2GN8A 2GKOA 4WZ6A 2YU9A 1K4YA 4DLUA 3HM9A 4UASA 2BPOA 1L8LA 2O14A 3CVJA 1L9XA 1EPUA 2XCSB 1NVMB 4C4TA 3IPCA 1GPNA 2I1WA 4QZVA 5BSEA 1AHIA 4ED1A 3IERA 1H2AS 1W5TA 3F1KA 4F4YA 4RCVA 3CH6A 3EYWA 5JMOA 1ZVVA 2VT7A 4LQCA 4QIHA 2F1KA 5IKPA 1AURA 4CF7A 4JLJA 3KQUA 1R8YA 4K9KA 3FR7A 1FNMA 3VGJA 3Q7QA 1I2LA 4GOXA 1ZGBA 4R9NA 5NLLA 2XMBA 4FMBB 4C0BA 1JL3A 3WRXA 2Q0SA 3AIKA 4PC3A 2VQEH 4QYWA 4ALJA 1V11B 3L7NA 3E48A 2PV0A 4LJ5A 3OPMA 1CZLA 1QE3A 3LE8A 4ML3A 3NIWA 3TUJC 3KVNA 3UT5B 5DIZA 2O8BA 4KKXB 1RJDA 4E70A 4ZPJA 4PNZA 4AKTA 3H2JA 5IK2A 1JKIA 1KORA 3MQFA 3BQMB 2W93A 2ASLA 3DO6A 3I12A 1NNEA 3JRWA 3GAAA 4LDNA 3MUOA 2ZPTX 4GOJA 4WCFB 3I2YX 1K0FA 3UWOA 1RHMA 1S0NA 5AM1A 1CB7A 2W22A 3VHLB 3GIQA 4Q34A 5J5VA 3GR6A 4POAA 4OHFA 3IRVA 4P7FA 1GGNA 5LZ7A 5H3HA 3HKBA 2XYHA 3VHXA 1TM5E 4HDNA 1XXHB 4GZLA 2COIA 4OKIA 2OWEA 3GG2A 1S03G 3OA0A 5FTKA 3RYCA 2CJXA 3Q3HA 3N44B 2PLWA 2FPOA 3H1AA 1TWCA 2ZJAA 3H5VA 2FR1A 4Q39A 4IUCS 3X2EA 5EWJB 5LYJF 5LL6b 1SURA 1DG3A 3MTGA 1J97A 2X1MA 1I2DA 3H87A 1T1EA 3GGOA 1EWKA 1V5GA 2BEUA 4C2MA 2PMCA 5SV2A 1KI3A 3BCHA 4FDVA 2QW0X 3V9PA 4Q9KA 3B51X 1IWPB 4N5NA 4L4ZA 3JU3A 3ADCA 4LCBA 4ZJZA 4BBRG 5FQNA 4ECYA 3AEKA 2AJLI 1E8NA 3RJMA 1XVIA 5FORA 2J33A 2H48A 2P90A 4OJKA 4UMDA 3K6SA 1U7UA 3FZYA 3BSFA 2GO7A 2WQ7A 5CBKA 2PK3A 5HFAA 3CLHA 4RSRA 3OQ1A 1COWA 1OW3B 4LGVA 3CZCA 4HZIA 4LTDA 4NS1A 1EE1A 1A3GA 2FF5A 2WEKA 3ORSA 1XNRH 4K3UA 5GONF 5D7BA 4G97A 2GRAA 1TYAE 4RJLA 1TC1A 5FADA 4BGUA 3I83A 2R4QA 4JLBA 3LWNA 1AQNA 2DWPA 4M37A 2C5HA 3I1FA 3JQ9A 4X65B 3F6YA 2HFJA 1OASA 4IVRA 3KD3A 1UQRA 1APBA 3A3OA 5CNIA 3HCCA 1YRQA 4OQEA 4ZTZB 1MXHA 4LCJA 1K5GA 3R5XA 5J2UF 1Y1WA 1H2ZA 1E6KA 2O3SA 3PKZA 3PNBA 2IK8A 2I8CA 2HZ7A 3RLIA 1GQYA 5CITA 4MYTA 2WYVA 2BW0A 3UJPA 3GELA 2NZXA 2QENA 3C6XA 1RKQA 4AY4A 1QP0A 3BMOB 3FMOB 2R84A 2C57A 5AIBA 1M2FA 4G5QA 1B6RA 3CNHA 1DQRA 5GZ1A 2WIAA 2QLNA 1STOA