1GSHA

Structure of escherichia coli glutathione synthetase at ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
296
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutathione biosynthesis ligase
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
total genus 101
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1gshA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1gshA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gshA01
4FE2A 4YAJB 4EGJA 5JQGF 5LYJF 2I8CA 1GSAA 2W6QA 4WBNF 4EGQA 4YBZB 5CAEB 3WNZA 1JKJB 3K5IA 4ZI7F 2PBZA 1CQIB 3R5FA 4M99A 3TQTA 1DV1A 2ZDGA 3LWBA 2NPOA 2R6FA 2YRWA 4ZQIA 3TW6A 3Q2OA 2YW2A 2YZMA 2ZDQA 1EUDB 4FFRA 5D8DA 2YZLA 3K5HA 2YZGA 4MV9A 2R84A 4FFMA 4O82A 4FFLA 3VPDA 4HNVA 1BXRA 1EUCB 2CZGA 1KUTA 5LP6F 2CNQA 4O7WA 2DLNA 3AW8A 2WYOA 5CB4F 2DIKA 4I4TF 3U9TA 1EZ1A 4FFNA 4EA9A 5LOVF 2FPPB 1E4EA 3RV4A 3BSWA 3V4ZA 3U54A 4MV8A 2QF7A 2FPGB 1B6RA 5I47A 1KJJA 3E5NA 2NU8B 4ZOLF 3VOTA 4J6EA 1UC9A 1T36A 1AUVA 1DIKA 2R86A 2YS6A 5JVDF 1C3OA 2YZNA 1IOWA 4O7LA 4HNTA 4IHJF 2V59A 5C8YF 4O86A 4M9CA 4FGRA 4Y8VB 1EHIA 3U9SA 4HQ6A 2OLSA 3KALA 2HJWA 4EA8A 2YRXA 4MV1A 1KBLA 2W70A 5LA6F 5DMXA 1B6SA 3QFFA 5J2TF 4O4JF 2W71A 3HB9A 3TINA 1IOVA 2DZDA 2VPQA 4YAKB 4FFOA 1KJ9A 3GLKA 2HGSA 4MA5A 4QSHA 1KJ8A 2C00A 2XD4A 3BSYA 1JLLB 3Q1KA 1I7LA 5EZYF 4O7TA 4DIMA 3ORQA 3JRXA 2YWVA 3G8DA 4O7RA 4HNUA 2DWCA 4C5AA 4O4HF 4MV3A 5CA0F 1OBGA 4XYLB 4O7ZA 4MV4A 3MJFA 4O2AF 3RUPA 4C5CA 1EYZA 2CQYA 1VBGA 4O2BF 2ZDHA 1ULZA 1CE8A 2NU6B 2I80A 5C1PA 4MV7A 5LXTF 2QK4A 2FPIB 2V58A 1WR2A 2V5AA 2W6NA 5JH7F 1AUXA 2Z04A 3NUAA 3HBLA 2IP4A 3WO1A 3KREA 2VQDA 4NYEA 1E4EB 4O4IF 2R87A 3BFPA 4ZHQF 2Z02A 5J2UF 1PK8A 3R5XA 2GQRA 3VPBA 4RZQA 1KEEA 2SCUB 4IIJF 4TV9F 4O7VA 1GSOA 2GQSA 1Z2NX 4XX0B 5K2MA 4YJ3F 5GONF 1C30A 4EG0A 3ETJA 4O7YA 3VMMA 5IYZF 4EA7A 1Z2PX 2NUAB 2W6OA 2R7NA 4DLKA 4O84A 2X0SA 3DF7A 4TV8F 2R7KA 5FNVF 2YYAA 2VR1A 4M98A 1GGOA 1KC7A 3WO0A 4IWYA 4M9UA 3OUZA 3N8DA 2GPSA 1OBDA 2FB9A 4O7SA 4XYMB 3UFXB 2CNUA 2PVPA 1M6VA 2I87A 3RFCA 2NU9B 1PX2A 3RV3A 2R7LA 1GSHA 5BMVF 2W6ZA 1A9XA 5CA1F 1W96A 5JVLA 3OUUA 4FFPA 4MA0A 3SE7A 2W6PA 1KJIA 1KJQA 1CQJB 4GGMX 3R9RA 5HBRB 4WD3A 2VHEA 5C1OA 3JZIA 1W93A 4I55F 4O7NA 3ORRA 3JZFA 2YS7A 3MWDA 1GLVA 4C5BA 2YL2A 5KX5F 3GIDA 4E4TA 3N6RA 4IWXA 3BSSA 2R82A 4TUYF 3R5HA 4EAAA 1JDBB 3TIIA 4YJ2F 2CNVA 3VPCA 3I12A 5HV6A 2XCLA 3JRWA 4FU0A 1UC8A 4IZOA 5KKNB 4MV6A 4ME6A 3BG5A 2GLTA 5BPHA 3R23A 1DV2A 3G8CA 4I50F 3AX6A 3TIGA 4XZ3B 1M0TA 2NU7B 4L1KA 4HR7A 1M0WA 1I7NA 2R7MA 2P0AA 3KAJA 1CS0A 3HO8A 2PN1A 1Z2OX 3MWEA 3U55A 3KAKA 5BPFA 4O4LF 3VA7A 1A48A 2FP4B 4O83A 4O81A 1VBHA 1BNCA 1JDEA 3LP8A 4EABA 4YB8B 2R85A 5H80A 3V4SA 3K3PA 2W6MA 5JQWA 1VKZA 1SCUB 2GPWA 3ETHA 4MAMA 2J9GA
chains in the Genus database with same CATH superfamily
2J6BA 4MHOA 3TO5A 3QFTA 4L57A 2QZJA 4TRNA 3VTFA 1YE8A 4J3FA 4B3TB 1X8XA 4PPNA 3B3QA 3AF0A 1PJ3A 1ZQ1A 2GD2A 2P6RA 3CNEA 4EGQA 4C0AC 3U44A 2PZJA 4DR6B 5BWLA 4G0VA 4CM4A 4YMSA 4X66H 1XU4A 5DSXA 1G38A 2YV4A 3WNZA 3MRVA 3OFNA 4ECRA 1D4ZA 1X1BA 4OK3A 1RJWA 3FYUB 4C6HA 1VJGA 5DTRA 1R0CA 2MYTA 4WA8A 3MBIA 4UUPA 2XCPA 3GRVA 4KQJA 5EKUA 2VDRB 2H7VA 2XT6A 3I39X 4GWGA 5FPQA 1YBAA 1JNYA 2ADOA 3F2IA 3U39A 4HFNA 3OJCA 3E15A 4FWBA 3I6IA 1KORA 1H4QA 1SWWA 4ZO9A 2J87A 4ZV7A 3JVIA 4XUGB 2BJHA 3IESA 4XASA 1NATA 4G0ZA 5BRNA 2P91A 5G3ZA 1NTOA 3F5DA 3JPYA 4OK6A 4PAGA 4GR9A 13PKA 2W37A 1XYYA 3EDRA 4YVFA 4AI6A 3ZWVA 4KXYA 1Z35A 4DPMA 3JQBC 3GFPA 3U09A 5FPHA 1RLOA 1U0SY 1UOEA 1F6DA 3DC7A 3ZWYA 3NWEA 1MAAA 1E6WA 2I4RA 1QHGA 3K5HA 1MR3F 2EJTA 1RADA 2NACA 2O3RA 2OVFA 2VDQB 3E4CA 1ISMA 4J0IA 3P9CA 4RELA 1Y1PA 2RHCA 1OXBB 2I3AA 1C50A 4DR5B 1Z0AA 4J7CA 3FFXA 3AGQA 3QPWA 4AWBA 2VPWA 1E9SA 5HA5A 5M7EA 3ZTYA 1LRJA 4UUOA 4DPKA 4Y7CA 4QM7A 2N75A 3ECCA 2VTEA 4G4GA 1EBBA 1WQ4A 3NAZA 1BH2A 1MABA 1RXYA 3FLBA 4FI3C 4G5SA 4V0MA 4XEUA 1AKEA 1FJXA 2OMKA 3BWCA 3VH2A 5HNKA 2SKDA 2BJWA 5BR8B 1EDEA 2PQ2A 2WP8J 1ENOA 2V8BA 3HN6A 5EEHA 4GXQA 1HYHA 4Q4CA 1O9BA 1T4CA 2HCBA 4ES6A 2C7PA 4JSRA 1FNBA 2W6ID 2ZVQX 3UJCA 5C34B 2CJFA 1JJIA 1QHNA 4JLPA 1CQPA 4ALMA 4CMEA 3AESA 4DXHA 4J4HA 3G2JA 2PX3A 3PPYA 4FFNA 4JBLA 3SCZA 1EXVA 1F7VA 3DUWA 4DLUA 2FR0A 3MGGA 5H4HA 1I1KA 2R3SA 4CT5A 4EBBA 1QQBA 1YXMA 3D8UA 3IBGA 4LOHA 3L7MA 5AVKA 4O3RA 4CVNA 4WMLA 3FZYA 3EA5A 1M2JA 4KN6A 4TN5A 4EG4A 2O7VA 4YREA 5IAAA 4IF6A 3IR6A 4M7RA 1YKGA 2B7CA 1VL1A 2AGVA 2VJCA 1C9NA 1TLLA 5KOJA 1CQZA 3PF8A 3V4ZA 1PS0A 4A82A 4HPXB 1UR5A 2CXTA 1NBEA 2HF8A 3CZ9A 5JWOA 4YJFB 1U1EA 1ULAA 1VGQA 1M34B 1MD9A 2R2GA 4P4GA 1FTGA 2B6HA 3UG6A 3NP9A 3KB6A 4BDSA 1P7ZA 4QQNA 1X38A 4FW9A 4RQUA 2R6DA 2OFXA 4XPIA 4ZJPA 1NLFA 3OTOH 3O2NA 3RRXA 5DQGA 1A76A 2C9MA 3KFXA 3I52A 4FYWA 1WU8A 5AVOA 4NV1A 3UW3A 4YRZA 5JS8A 3THYB 1D1QA 2BR4A 1Z9BA 2BISA 3KQOA 5DJ5A 3REGA 1ZZEA 2EFGA 5AUOB 1NG9A 1D8AA 1TVCA 5DHTA 2ZSIA 2YN2A 3WGHA 1G20A 2YVLA 3VHQA 4NAUA 1U4SA 2HZ7A 3L9WA 4LXUA 1Z56C 1SM4A 3BXFA 2D5LA 2NU6A 1T2NA 3GJ7A 4LISA 3HFGA 5D1NA 3RFUA 3TLMA 4L07A 4CFYA 2Z6VA 1NL3A 2P2SA 4DSZA 4PQEA 1G20E 2V59A 3CBGA 3O75A 4R1OA 3YASA 4RD4A 2M9MA 5JNSA 3SIXA 2B8TA 5FOWA 1KEEB 5ILOA 3T4PA 2PHZA 2W11A 3E53A 2WIJA 4GSLA 3ZIDA 3E8SA 4R40A 1KH3A 3EEYA 3GTQA 2X13A 1DDOA 5T14A 1YO6A 4TVOA 1INLA 2FUKA 2XOXA 1VL6A 3QVOA 1C3VA 1IN8A 3ZHBA 1DARA 2A5LA 4C20A 5E38A 4DLAA 2I29A 1PYOA 2I8LA 1U3CA 3GWGA 1T1EA 3QPDA 3MHPA 3PR4A 1CY7A 3OLVA 4RA6B 3BMQA 3DTYA 4RVFA 5D3QA 4E2WA 2UVPB 3EYWA 1TUIA 1ONOA 2VLBA 3PC8A 1TC1A 3R41A 4NATA 3PKJA 2VAWA 4JT2A 2VJPA 5AI4A 4DILA 5AM2A 5EIBC 2P4SA 1NNI1 3TQSA 2P2NA 4DR7H 2HNBA 3OX4A 4QD3A 1KMHB 4U7HA 5D84A 3S2IA 3TZ6A 4RVSA 1Y3CE 1EDZA 1KNQA 2WIDA 3KR2A 5DGCA 2EKLA 3OPYI 2VPQA 4YAKB 3PVZA 4PS1A 1PJZA 2PUEA 4KEAA 4U2FA 4F93B 1AS2A 4UE2A 2HF7A 4OK5A 4MR8B 3TDMA 1KJ9A 1RRVA 3CLUC 1LLDA 2AFRA 2DFPA 2J45A 2LVBA 1DG9A 2ZYVX 2FEWB 2OSBA 1MAWA 4MDEA 2DCUA 3B78A 5EYPA 3UAXA 2VDPB 4FFBB 1B2LA 3REFA 5ES4B 4J0CA 4JU9A 1G41A 3FCCA 1JLHA 2ZTMA 3VXKA 2W2KB 2VZ0A 3AHFA 5H9WA 4D9MA 4ZCLA 5U9CA 4A2CA 5GADl 2ZWVA 1U8ZA 2BEKA 2FZ4A 3PYLA 1I13A 1AHIA 1F4PA 1KMHA 1GHTA 3ES9A 3OWHA 5CK4A 3W2FA 2GBLA 2R6ZA 4XZ3A 2WDZA 1OW3B 5KFBA 2DKNA 2QJOA 1HT3A 3TSCA 4EHJA 1XMJA 2FQ1A 3DXYA 3L4BC 3NOXA 1AGRA 4ITUA 4JKIA 3VO2A 5CBKA 3R9XA 4LI0A 4DJJA 2G77B 2IK8A 1RLMA 3H2ZA 5CVDA 1FQJA 3SI8A 3H3VH 1V7CA 2ZP1A 3C1TA 4N12A 3I9OA 1YS7A 1IQPA 4QLAA 1OBGA 4WBSA 1A5TA 1YR2A 4Z5XA 1QMPA 3TSZA 4P92A 1PNVA 2QUKA 2QG9A 2XZOA 4X3CA 1DIHA 2V7WA 5LM3A 2JCSA 1EK0A 1SUSA 5BWRA 3OJLA 4ZDWA 3DDSA 2OOSA 1QIMA 3WGJA 1H2EA 4YECA 3OCCA 5AK4A 1NHGA 2VDMB 4BLUA 1RWQA 3F9IA 2F3UA 2QAGB 3DOOA 4HMOA 1IATA 4ENSA 1VKNA 2NPFA 3CVWA 2WRZA 2O8FB 2JFXA 5L6LB 1NR5A 1XVAA 3CLRC 2GYUA 3L07A 1JLMA 4JR2A 1W5SA 2C4MA 3A2LA 3H9GA 4ED1A 4UTOA 4RHCA 5BV2P 5IWAB 1B8OA 1WQ3A 2A1TR 3FMVA 3EQZA 4GOOD 1HNXB 1GPNA 3CNBA 2QW8A 1B8VA 3O94A 2ROQA 1N2SA 4FNAA 4HFRA 1PGPA 1PZFA 4PX2A 4TZKA 1YZGA 1E2BA 3L93A 4AMZA 4IL5A 3W3AH 5EZ6B 2FH5B 4QUEA 2XCRB 4EYEA 4E51A 1TO1E 5KFNA 1U9YA 2NGRA 3B6KA 3GJTA 2ONYA 3I0NA 4L16A 4U2CA 4DS3A 4Q3DA 4AN4A 1OXSC 1PT5A 2BEVB 4DDHA 5AVTA 1E1QD 3WLNA 2C8VA 1Y14B 3DOHA 3L0SA 1DFIA 3O73A 1TJ4A 4J0QA 5A4KA 4D42A 4LFBB 1VA4A 3P32A 4UCUA 4TTSA 3FM9A 2PQ6A 4LJYA 4DDMA 4E1VA 1OB5A 5L3ZA 1PFVA 3C5EA 4LHSA 4RH3A 5EE9A 1A98A 1JMYA 1NBMD 1Q74A 3M9NB 1DQNA 1WF6A 1ZM4A 2X7XA 3AHJA 4LCEA 2WTUA 1N33H 3BFPA 4D9GA 1QJ4A 4A3IG 3RAFC 3TTSA 1DKMA 3T7SA 1U7UA 4ENRA 1QRAA 1C9YA 3WQSB 3KKZA 4DB2A 1XLTA 2G7MC 4ZCQA 4LMBA 4MO2A 4DAEA 5T4EA 1Q14A 5DKFA 2JI8A 2VUIB 3GA0A 4U02A 4O7VA 2A3NA 1X1RA 4GVPA 3CYFA 3UXHA 4TMKA 2AEJA 1HQKA 5LP6A 3ZBUA 3WGTA 2XVMA 1R0SA 2DFNA 5H7XA 3O4VA 2CCGA 1CCWA 8ABPA 2Q45A 4N01A 3PIDA 1FNCA 1WTCA 1ZESA 4IDPA 4JVOA 2WV9A 4B44A 1SY7A 1OZFA 4BEBA 2BEUB 4C04A 1NZJA 4N7RA 1XLVA 1ZK1A 2ZKIA 3KXLA 4GMHA 4WZZA 4BQQA 2WHPA 4ARBA 4BFZA 4DMRA 1FUKA 2Q2NA 4IJMA 3F90A 2WJGA 3I83A 3OI7A 3HCRA 1YMVA 2ADFA 3DFZA 4O84A 4K6MA 4TKZA 5HJ7A 3EG5A 1OBFO 4G8BA 4AKTA 4CU5A 1UBUS 1NLMA 3HG7A 2QN9A 1Y63A 3OCUA 3PNYA 4RNDB 4TWJA 3IP5A 5CFOA 4W5QA 5LQNA 3ZCVA 1N7HA 3DEKA 2XB4A 3M6UA 4AWXA 1AQJA 4KBYA 5FRDA 5HM8A 5BYAA 1UJ5A 1AIPA 5JNTA 3NVKI 3DE2X 1E94E 4BNZA 5CGZA 2RGUA 2X0KA 3G0HA 5CPFA 3RBXA 5C1DA 2CWWA 4U7FA 1Z5GA 2Q5FA 4OP2A 1GJRA 3NRJA 4LNUA 3SU8A 4Z1MD 3I6MA 4IEIA 1VL2A 3B6EA 1MCZA 1TYDE 1ZXLA 3DNPA 3GMIA 3I1FA 1QG0A 4ASUA 3N87A 2GCNA 5REQA 3NZEA 3RYIB 4TSFA 1B43A 5CT8A 4K9PA 1UL1X 3WGLA 1D3AA 4DV7B 4A3FG 1V96A 3AZQA 3E1KA 3MG9A 3MB8A 4RGBA 2R7LA 3JASB 4XIIA 3SK0A 2VRCD 3T34A 4U3JA 3M1LA 5GQSA 3JVEA 3HR8A 1SBNE 1NW8A 1OXVA 4QJFA 1I7PA 3VZCA 1WVIA 1GFZA 4LSWA 5TQ0A 3WDMA 1JJAA 2RARA 4XJTA 2ZVJA 2QRVA 2A9KA 2PZKA 2ZE6A 4NZ9A 4RM2A 4CL8A 3QKTA 2PL3A 3BH7A 2FE4A 4P35A 1N4AA 1V9LA 4ZVLA 4V02A 5I9BA 3FYDA 1R0XA 2XQGA 3TBFA 1L1EA 4UVHA 3WHIA 3GLIB 5GM1A 2AYZA 4CKXA 1E0SA 3WKAA 4A0FA 1I3OA 4MDHA 2QQFA 3E70C 2I1WA 3G0GA 3D8SA 3GDFA 5F5XA 4B81A 3BABA 3W79A 4B6SA 5LP1A 3IQIX 3DCYA 2JW5A 4G81A 4QUIA 4CTMA 3IFSA 5CT5A 4DA7A 2W90A 4UBOA 2OO5A 1YJQA 2JIDA 5KAMA 3PV0A 4F4YA 3S8MA 3G49A 2EQAA 1JW9B 4CV1A 3N7TA 3PW4A 3HB7A 3ITKA 4GSKA 4EO7A 5A9SA 3FNIA 1DX4A 2J5BA 2P0EA 4PEVA 4JQCA 4QQFA 5KDLA 1D7OA 1PGJA 3GGPA 5LSAA 1WZUA 4XSHA 1QO7A 3L0BA 4HNAB 4KLRA 5EPUA 1X1TA 2OQIA 1KS2A 4CQNA 1U3FA 3X3HA 1YZKA 1I01A 2PKCA 2Q2QA 4JX9A 4UHFA 3CZ4A 5CCEA 1L9XA 5A0VA 4P8RA 4CM8A 1PVVA 2I4OA 4UZEA 4YHHH 1L8OA 3U7IA 3HXTA 4HNQA 3OUTA 3ZTWA 5K51A 1H23A 2Q49A 2ZJTA 2XE7A 4CMEC 4MV6A 5H1YA 2VBCA 1LJ8A 2JCBA 1JIXA 2BH2A 3GGGA 3GIJA 2EWMA 1A4XA 1T8RA 4RHFA 1U0TA 5IHPA 4HZUA 1W46A 1UFRA 1Y7PA 2M6SA 3KKNA 2HSWA 1WTAA 3PQ2A 4BMZA 2F43B 3D59A 2V6BA 1XNQH 2NU7B 3IOYA 3W6OA 5HF5A 5TX7A 1RTTA 2ATXA 4IV8A 3I0MA 4JLOA 5ARCA 3WNQA 1ZOOA 3MN1A 3IMKA 1ECLA 1LV8A 2Y66A 1YGYA 3JSXA 1TPYA 3JQFA 3AC0A 4TWZA 3BILA 3PUVA 3CCFA 2GFIA 2HMWA 2HVQA 4D6XA 3SR4A 1FSFA 1GUBA 3QVXA 3L7OA 2UYGA 1W5TA 3EA0A 4G1EB 5CP8A 5NULA 5JBQA 1IRIA 1DC4A 1LRLA 3SGLA 1DDIA 2Q3FA 4LFCH 5JPDA 1JL3A 2A2ZA 1T26A 2DG2A 1V6CA 2PT5A 3DFUA 5HQJA 3WMWA 4ZMRA 4NV0A 3L6RA 1V47A 1RCFA 2OQRA 1P2TA 2P1DA 4WDQA 2ODPA 3RFVA 5KYNA 1EFRD 1I3LA 5AW3A 5A1TA 3UMJA 4FWTA 2R5NA 1W94A 2Y1DA 3HKZA 2CNWD 2WA1A 2MCFA 2D7JA 2IV7A 3KTMA 2G4VA 4YUVA 2DH5A 5TQ2B 4DDWA 4YB8B 5BRAA 4HX9A 4B87A 2R85A 3S1AA 2GJSA 3W4IA 4HDKA 4UZFA 3DBVO 3ZHUA 4EJ6A 2EFHB 2W6MA 1UWVA 2QDKA 4JITA 1D4OA 3TNDA 3O4IA 4CL0A 4EBDA 1MQSA 4PHFA 5CVEA 1LU9A 1Y1TA 3IHWA 5FWYB 2F3RA 3C6XA 4KB5A 4X7RA 1NMXA 3B70A 4YAFA 1IM5A 1URPA 1L3IA 4J91A 4X45A 3SLKA 5C37A 3ULKA 2FN4A 1IBLH 2Z9CA 2VDUE 4E33A 1ADJA 4Q45A 2A9VA 3THRA 4FFDA 4QXMA 4ADSG 5BSVA 1VZ2A 2GA8A 3EY9A 4KMSA 1G5IA 4YBZB 3WLQA 1RAIA 2FLNA 1IU9A 1VHWA 1OJLA 2J9FB 4G0XA 4JSYA 2Z95A 3CRRA 5E9JA 1RRKA 2VJBA 2XWPA 4F60A 4NCBA 2QD2A 5BVHB 5H8WA 2GN6A 5ITSA 4A92A 2WE6A 4FM9A 4X1OA 1E9RA 3ROMA 3TOVA 2PCJA 4MTDA 3U7QA 1H2BA 2L42A 2RH5A 2FU5C 3VMFA 1ADFA 5AVJA 2DPIA 4YRLA 3F3YA 3K4PA 1KI9A 5JDIC 3VO1A 1IHYA 3CO0S 3TQOA 1I10A 5CYGA 2K87A 2DFLA 1PL6A 3AL2A 3HY4A 5KX5A 1U8YA 2Q5HA 4ZQIA 3EWSA 4GWLA 1SUFA 4IS3A 4JBYA 4OOFA 3TZLA 5L45A 1P4AA 4KR3A 1Q7TA 4X71A 4QAJA 2FQWA 4DSOA 3ADPA 3ZZNA 2DAPA 2FTKE 3AMVA 1LK5A 1TQ8A 4KPUA 4LIPD 1W47A 1R3UA 1BXGA 2G28A 4PX9A 2FSIA 4I4TB 4LE0A 5BXYA 1UOOA 1YZVA 2GHRA 3EVBA 3GT4A 1Y4ZA 4MV9A 5BYJA 5LOVA 2YVAA 1H2RS 3I4CA 2OT3B 3K31A 5GJCA 2GZ2A 1SCQA 2X2FA 4BO3A 2DT5A 4JIGA 3RJTA 4LHYA 3VPDA 2YV1A 3O4FA 4Q18A 2PKQO 1OE0A 3AEXA 3QTTA 2A9FA 1FPQA 3ETLA 4E32A 4EHFA 1SBIA 3F3KA 3BF7A 3I04M 2JH8A 2ZI4A 5FBRB 3MJHA 1Y48E 3JPWA 5A5GA 2CW5A 5TLSA 3S2ZA 1A71A 4CQJA 4UKDA 1W88A 3MCAA 4EUEA 3VTAA 4EYKA 2VZLA 1KI1A 1MV5A 4ONEA 5IX8A 3GLVA 2AE1A 4IO1A 2WMDA 4ITVA 5FORA 3J80W 1GADO 3DFIA 3KHUA 5JD5A 2X0JA 1DG3A 1Z37A 4PG7A 3WAKA 4CLRA 2OB1A 3OY7A 4HWPA 2ATIA 4R6XA 5FFFA 3J7AK 4OOEA 2V98A 4F5DA 2H3EA 3FZNA 4LWOA 3JTEA 1J0XO 4L5JA 4OMUA 5ALNA 2X9QA 1VQ1A 1WXHA 5HTKA 2J48A 3QFCA 1R4NB 3LTEA 2FPPB 2OK8A 6REQA 2Y8EA 3UK2A 5ED0A 1QQAA 1S7GA 4OFZA 4XTCS 2AFVA 3M4NA 2Y6VA 5D1HA 5C52B 3HJAA 3ICOA 4RH1A 2AG6A 1A5AB 1TVKA 2X1HA 4QJIA 1P7WA 1Z6TA 1EDOA 3CF4G 4FJ0A 1Y33E 5K3BA 1AT1A 1OVGA 3FRJA 4HQKA 4X44A 4DCMA 3EODA 1N57A 3CWQA 1DBWA 1ECJA 1Y3FE 3EEQA 3I45A 2QOEA 5IKEA 1AO0A 4YDSA 3GLIE 3DLHA 1Q57A 1MO5A 4PBCA 3O9MA 4TL6A 3JQPA 4DQDA 5BWCA 2VQ6A 2WHYA 4HEJA 5EUBA 3KHGA 2O7QA 2LCFA 1NOIA 4J6EA 3GV0A 1T3ZA 3B1JA 3HJBA 1JYEA 3U81A 3WAGA 1QH0A 2XVZA 2B1IA 3BZUA 1ZIDA 5IT5A 3MR5A 2CDAA 3DJFA 1DIKA 4C43A 3NW9A 4Q1FA 1S5PA 3HRIA 4GKJH 1ETUA 5ALUA 5HBRA 1LBSA 1M2OA 3IUEA 3N2GB 3ZE1B 3FPBA 4QKQA 5KJCA 4O4JB 1EQ2A 1LK0A 3SJAA 3WWYA 3FNQA 4DLPA 3NONA 1CKEA 3KZXA 4AUNA 5EIFA 5EQFA 3PT5A 1K06A 3C85A 3CKYA 1GUYA 4Z9BA 2RGEA 5A5DA 2VBIA 2HXSA 4YRDA 4LN1A 4B4VA 3AB7A 3AF2A 4OGLA 2CK3A 1A9OA 1WMDA 1Y8QA 1CFZA 2FJUA 5H3HA 3MMZA 1EHIA 2WU4A 2VRCA 2IWHA 3SJZA 5KWSA 2FX5A 2FOXA 5FH9A 1RLIA 1U5BA 3F5FA 5HKKD 4YY3H 2VPIA 2ZQZA 1QM5A 2I76A 3KALA 2JJYA 4UDYX 4XGRA 5CPBA 2AZXA 4LSXA 4JLVA 4EMSA 4PAMA 2HO4A 2I67A 4MAAA 3QV1A 1DRVA 3RUAA 3HOUG 2NYUA 4NJOA 2HWYA 2IYNA 1GUZA 1KBLA 4YT4A 1MU0A 4TM7A 1M73E 2WWIA 4B76A 5LOVB 3T15A 3FE2A 4XKJA 4BJ3A 1U7DA 2RCNA 5IT9A 4NZYA 4U7WA 3AB3A 2GEFA 3UM9A 5D3MB 3THSA 2VYVD 4FOPA 4OQNA 3BA9A 3T3HA 5J58A 2JHCA 2EFJA 3EF0A 1Q20A 1KHHA 2SCUA 4RFLA 4O5OA 1HKUA 3LHSA 1I94B 3JWHA 3BXGA 1TQ4A 1C80A 3K2BA 4FINA 2REXB 1JJBA 3K9NA 1WY7A 5DSTA 3N41B 1UK7A 2FLKA 2G08A 2QNIA 2IEBA 4HO1X 4V0OA 1OMOA 3B9RA 4U9UA 5F51A 3T52A 4DLYA 3DPIA 2HGSA 3GMDA 4PY2A 5ENDA 4YCDA 2YIDA 3E84A 3CNLA 1KFKB 1QCDA 2VH1A 1FUUA 2YHBA 5JAOA 4CCAA 2W8ZA 1I7LA 2A0XA 2HPHA 5CT4A 2UU9H 2GTPA 1SVIA 4PZ7A 3L6OO 4E11A 2OZVA 3UBMA 4E5YA 4IH9A 5J23A 1HDGO 1DAMA 1ZNWA 4BAUA 3GUUA 3PR2B 3TEJA 1UP4A 3B1YA 9LDBA 3GA7A 2RI0A 5ECDA 4KIFA 3MJRA 5D5HA 1YH3A 3L0CA 1G8AA 4ARZA 4V1CI 3O8OB 1E3WB 1K0UA 2EEPA 1R5JA 1SUDA 2AL7A 3BXHA 2NXWA 3QVKA 3EDCA 2DKFA 5FTKA 4B3JA 1TXGA 3KTOA 4ZQBA 2LE0A 3TPZA 3TR0A 3TYXA 3IDZA 5LQDA 1CG6A 4Q9JA 3ZJVA 4MAFA 1CRQA 1T6NA 1REQB 2FSHA 1FVXA 3Q72A 4NH4A 1RP7A 2ZUBA 3MQFA 2XDWA 5AJVB 1Z8NA 5KFJA 1TA0A 3LOPA 3R3ZA 3INTA 2WW8A 3NM5A 1M75A 3RUPA 3T06B 3AWDA 3NLLA 4C5CA 1Z4IA 4IP0A 4W5WA 3O82A 1EYZA 4ZV4A 5FLYA 1K5GA 5K8LA 3VAYA 3OCXA 3EQ2A 2XUFA 1AQYA 3KE9A 5FBLB 2I3GA 3N86A 4PXYA 3T5TA 1QOQB 1SXIA 5JS2A 4YRMA 2WTBA 5KYXB 4DB4A 1HOXA 4XQ0A 1NU8A 5JVDA 4WKOA 3SP1A 1HPLA 2VDWA 3D8HA 5CK5A 1WXFA 4NG4A 3D7NA 1QLWA 3DW1X 4JROA 1HLDA 3JVDA 5HFNA 3L8YA 1UZLA 3MWKA 2FUCA 1GG8A 1I0ZA 2IXDA 5LXTF 1QV9A 3E8XA 3KZCA 4DV4H 1YS2X 2V9PA 2FK8A 4IINA 2GDJA 2Y0EA 5TMDA 4KH0A 4PSCA 1Z0JA 3QEBZ 5KFHA 2V4MA 4WXHA 4XGKA 5K0JA 2AG8A 3DVRX 1V0JA 3HLYA 1DEAA 4B85A 1X7WA 4FGSA 4PZEA 4OBWA 3ZGZA 1G8PA 4CF4A 2P7IA 4C7OA 3BXXA 3IP7A 2JKZA 3HU1A 5J2TB 2W22A 1HRDA 1V9SA 3Q3VA 3VR5A 1QF9A 4D26A 1C0PA 2ZPTX 1O75A 5DXFA 1M1YB 4OJTA 2VIIA 2X76A 4KQ2A 4EEZA 3OQOA 1XVIA 1P1FA 1G4HA 4KQFA 3ZQ4A 5I7HA 1ZGHA 4LOLA 1FLNA 2AGPA 5LUAA 2UYHA 3A1EA 3IRUA 3OAAA 1NV8A 2IC5A 4CUZA 1FNSA 1R8XA 2PFGA 3KYCB 2QPTA 4IGKA 5ALOA 4LVOA 4BJ6A 4TUYB 1Y1LA 1VIYA 4F5WA 1ZH8A 2A84A 1J25A 2P4QA 2NPIA 1L5YA 2AX3A 4OHMA 1LX7A 3C7DB 5EXSA 4YAWA 1I36A 4GRIA 3UFXA 1IPEA 3G2LA 4S1WA 4X8LA 2ZI3A 4KZPA 5IG2A 4JS0A 1DADA 3FMOB 3K3VA 4UFPA 4WVFA 2XCQA 1Z15A 2QE7A 3I9KA 5HQ3B 2I6GA 3JV7A 3UMCA 1DAKA 3S8YA 1J7JA 5E9AA 5IC5A 4IHJA 4MS3B 4YJ2B 1NC1A 4PC2A 3WYCA 4NBKA 1UPBA 2QUJA 3C5VA 3Q0EA 2GAOA 3RS4A 1GZSA 1VHLA 4X6YA 5AFSA 4UU0A 2OZPA 4P7FA 3MCZA 3MTDA 3P20A 4RU9A 1P18A 2ZS7A 4QXAA 1EKXA 2VHVA 4ZU3A 1SB9A 1LQUA 1RM3A 4DEVA 4YR3A 3B5EA 1NNEA 4QFDA 3Q9LA 4EA7A 5C51B 2NUAB 3OTGA 4K6HA 2FE3A 4D9CA 4JI7H 1UBLS 4EJ0A 3EXIB 3COZA 2R7NA 3P45A 4M49A 4MXDA 1KYWA 4BMCA 3R6WA 1I2DA 2YWCA 1PTJC 1WEHA 1UKVY 2YCBA 3MIZA 4H2DA 2LCQA 2G1PA 1PZGA 2Q9UA 4LECA 2CXQA 1IPFA 1UBFA 2GHQA 3N0TA 3OF3A 4A2AA 1GKKA 1Q1NA 2GM5A 4LBYA 4NC9A 4W1SA 5G40A 4QDTA 4LEIA 4XX0A 3KQPA 5DBIA 5A0FA 5IKMA 4LNHA 2GILA 3UJ7A 5FTWA 2O2EA 4KE8A 5KTKA 4HH0A 1SFRA 1GTVA 1Q92A 5KFFA 1ZJJA 3KX2A 1KDZA 3V1NA 3VVLA 4F1WA 3TQRA 1RZVA 4KTTE 1KP2A 3U56A 3F1LA 4I5IA 5A4MS 4FK8A 3D4LA 4H1TA 3C6YA 2CNUA 2ZYRA 2EZTA 5F5LA 2CB9A 2ONJA 3F6RA 1JECA 3VUEA 5KJ1A 3PDUA 3TZEA 1IQRA 1I30A 3ZNPA 2GN2A 2JDID 3C7CB 3OOYA 4WK4B 4X61A 4LRSB 2BSAA 2JA6G 3GD7A 3Q9UA 1YDMA 3SEQA 5DU2A 1QO0A 3W90A 1ZHHA 3LZ6A 4YCSA 4CEJB 4G41A 3LL4A 8AT1A 1I9CA 4GF5A 3R5KA 3BTUA 3LD9A 1W4ZA 1NSTA 3ZNNA 4JT8A 2UVRA 1O1YA 1CJKC 1DJQA 3PWTA 2HEGA 1JAIA 1PNQA 2H48A 3MTAA 4TS3A 5LQKA 1UDWA 2BBTA 2IYTA 2G0AA 4IH1A 3HXMA 2R7ZA 3GCZA 1F0KA 2JJ1D 5A9SB 2ZJ4A 5CFNA 5JY6A 3DWFA 1N34B 3H86A 4E5KA 1E3TA 3GGJA 4TTAA 1C9KA 2B8EA 1XNJA 2YKGA 1ZKDA 4FMCF 1DBSA 1I80A 4TTJA 1USGA 4DWOA 4DUPA 4UUGA 2OBYA 4WD3A 4X1IB 5C1OA 1ZI9A 2REOA 2V5VA 3URMA 2EX0A 4RIHA 1DO8A 3LX4A 3OFKA 1RXCA 1AS3A 1ZOIA 2W43A 4FN4A 3RRMA 3RADC 3G5AA 2CWDA 5DF1A 3T3MB 3UUWA 2QX9A 3NRBA 4C0JA 3EZFA 1XRJA 2I2BA 3WHPA 4KWTA 4BFSA 5HZGA 4PN3A 3Q15C 5KFLA 4YRPA 3KSUA 2EKQA 1SK9A 4BFUA 3IEXA 5ITZA 2GTHA 4I08A 4UAGA 4PSUA 3G17A 4XAQA 1EUCA 2MSWA 4AO8A 2VYFA 4BO6A 3VNNA 2J4DA 4A3DG 3B20A 4AUEA 5MN4A 3K15A 3RSLA 3HU2A 5ESRA 3KJZA 3O0DA 2O8CA 5H16A 2RJNA 4C6TA 4FHCA 5J63A 4FUTA 4MIKA 2OWOA 1DBIA 4IRCA 4HPWA 1IDN1 1TVEA 2YDXA 3H13A 3M6MD 4UVGA 3NEAA 4Q1DA 4Y2SA 5LZ7A 5L1IA 5AJXA 4DCGA 2O06A 2R1TA 2RJOA 3O3NB 2F7SA 3PUWA 2G1UA 3B9PA 4J2TA 1ZHQA 1V1MA 3MLEA 2XVAA 1KYQA 5LKRA 4X93A 2EJWA 3DHVA 4JI8H 1LBQA 3IMFA 2F90A 4Z54A 3DEFA 1KFCB 1OY1A 1YOBA 4PZ9A 3KSAC 5DHAA 1S01A 3SC2B 1IBRA 1KGSA 2RK6A 3FUVA 2W8BA 2YVKA 4FZVA 1K3FA 2VCYA 4HKTA 4OQFA 2CBXA 3ZDEA 4BVGA 2B21A 5AI6A 1YR8A 3SHTA 4W9NA 4PYQA 2XNKA 1KE1A 3TI9A 1YQEA 3A31A 5LUBA 1KGDA 3CR7A 5BMOA 3G0CA 2GEVA 2ZYWX 1SCKA 1MXHA 2NNWB 3FCXA 1L5KA 4JVMA 2GXAA 1ZUIA 5EIHA 1XROA 3NJ8A 4QASA 2HX1A 4IDCA 5F12A 2L17A 2HSEA 4HNSA 4B2IA 5FR1A 4F2GA 4X65H 3CVXA 4P3YA 5KNBH 2DUUA 5CYOA 1U7XA 2C9OA 4ECXA 2R66A 3EBLA 2WMNB 3O8LA 5AJUA 4CTNA 3ILVA 4F9FA 1NFRA 2XH8A 1JLRA 4HAWA 2CJWB 5AXBA 4F8EA 1E7WA 4HDOB 5AVVA 2DPJA 1NVDA 4OP1A 3F97A 4TVBA 5BR7A 9ATCA 1CP3A 5BYBA 1A4UA 2BKXA 1JYFA 3QVJA 4ODIA 4OL9A 3SYKA 3WWCA 1U2QA 3QU7A 3WHLA 1S9DA 2FW7A 3D4IA 3LOQA 2FFJA 3E9DA 3RODA 1IOLA 4B7XA 3GR6A 2YXPX 1Z6XA 1OLUB 3V4SA 2PXHA 2ZRGA 2ZXEA 2ACWA 5AUPB 1IZZA 2Q6LA 2B0CA 4TM5A 2QRHA 1IUOA 4G65A 5KVCA 1KAEA 1ZCZA 5DRTA 5KFVA 3GRUA 2BTQA 2HMUA 3HGMA 4JEIA 5BP7A 5I6DA 1W36D 2AK2A 3HP7A 3Q9SA 1U0OC 3ZKAA 4TVSA 1W2GA 2GAAA 2QY6A 4A3EG 3FPCA 4CV0A 2WG1A 4NQRA 5DRYA 4FBUA 2ARKA 1ZXBA 2C2KA 2HN9A 3S3TA 4BY9E 1DGSA 5IJAA 5CUQA 3CKKA 5ITVA 1QGOA 3ASVA 3T5BA 4QTYA 1KI6A 4NBRA 1K97A 1UJCA 3B9BA 2DWQA 3KFLA 3M9LA 3R1IA 4J2OA 4BE7B 3HYRA 4ZCTA 3OCYA 3L8DA 2XEDA 4G1UC 3PXUA 4JJ7A 1HF3A 1XDBA 3OF2A 5F2EA 5THQA 4HAYA 4KO4S 5AYVA 3QUAA 2ERYA 3S2SA 2BEVA 1XXLA 3CN9A 3LK6A 2J9RA 3ZJYA 1G3MA 1ONSA 3ZDBA 1O0BA 1JG3A 4EEKA 5AHRA 2QN6A 2VAVA 3F6EX 3L40A 1JRLA 2H2WA 1Q17A 1TNDA 3H4MA 1I4DD 4GOKA 4M7OA 5AKEA 4DAOA 4F9EA 1KK2A 4HDQB 1AKNA 5B3JA 5TPZD 5JMTA 2XXAB 3O21A 2V7GA 4RK1A 3UQZA 1OI2A 2Q6IA 2QQGA 1N2OA 5A7HA 2YW2A 1V71A 3SHWA 3HZRA 1O94C 1HTBA 4LF9H 3OY2A 4GQAA 3TRHA 5AXDA 1H9CA 4PYKA 4XIGS 5JCOC 4P7JA 2JGFA 3VPFA 3B48A 4UCVA 1FFWA 2EFYA 3C98A 4Z4CA 3K9BA 3HLKA 3F4KA 1B8NA 2JRLA 4FQ8A 3PGVA 4P3OA 3PRKE 1FMTA 4TRRA 4URXR 5LJIA 3I30X 1JZSA 2GETA 3SWWA 2CYBA 4OHVA 3C3EA 1X39A 1L7XA 3IYLW 1YQUA 4DR5H 4UBKA 3W6PA 2I99A 4REOA 4GOLD 3EUEA 4MWEA 1A9QA 5LP6C 5LZ4A 1C9JA 4Q03A 4DL3A 1JVNA 2XDAA 4OXRA 2R5FA 3V5NA 3RYCB 3W77A 3VZPA 4S35A 3PUJA 1EVYA 3K0KA 5BSTA 4G85A 5L7TA 1JEYB 4CM9D 3NOVA 3R0ZA 3HO1A 2I3BA 3X1DA 4ZCIA 3PHLA 2IWRA 4BNUA 2A88A 5K03A 3RBEA 2R00C 2XYQA 3HMKA 1HA3A 2LKCA 4XQGA 3O3CA 2JJQA 3S0JA 4CV2A 4MUXA 3LBYA 1NVBA 4K9KA 4F45A 2QTMA 2C03A 3VZSA 3HSKA 4QQKA 4TXHA 1ZMRA 2GYYA 4R8LA 1XU7A 3ZCSA 5D3KA 1YACA 2NXEA 2O8VA 3EXFB 5T7BA 1GAQA 1WXDA 1TJ3A 2V9CA 3H65A 4M1SA 2EJUA 3I2KA 2FPUA 2WG0A 3UJ6A 2QLJA 3D4OA 2VJMB 3FNHA 3TGPA 4R8RA 3D81A 5JG7A 4RA9A 3VX4A 1J42A 2PLFA 5CFLA 4OI0A 1P91A 2PUHA 4KLZA 3D7KA 4RCVA 5DQHA 2PQMA 3OPMA 4TXJA 2ZE5A 5FB3A 2AB0A 1AXEA 5AW1A 1RHQA 4P32A 3C87A 2E18A 3NDRA 4QJ5A 4M0KA 2HGXA 1QIKA 3FPKA 1OT3A 4Y0VA 3SQWA 1E2HA 1T2AA 1U28C 3C8MA 3HOVG 3W1BA 4YCCA 3O8NA 1Q15A 3ZI0A 3QBVA 4YV7A 4ROTA 1DG1G 1ZA2A 2PD6A 1J1ZA 3RDPA 4JV1A 1MFZA 2DR3A 1QUEA 1GDDA 3HR4A 3P97A 4INOA 4EOGA 1KMIY 4BGDA 2D62A 4AZWA 2PKQP 2XGJA 1JHDA 3IXMA 1N3IA 1E5DA 5G0WA 1BMTA 4XCXA 1EE1A 1B74A 4WLFA 4YALA 1E1YA 4UATA 4BZZA 4OQZA 1IJKA 1T1GA 1T36A 4JQSA 1I14A 3OU7A 5KYTA 3N2IA 3IPYA 1ZI6A 3LHKA 1OLSA 1RC0A 4H6VA 4KYVA 2R86A 4ZZ2A 1RBZA 3MWYW 1ODSA 3O3OB 2Q0SA 3KSDO 3AHDA 4H18A 2AH5A 2JASA 5A5VA 2HADA 2HV9A 4IG4A 4U4AA 3H4BA 1P0FA 2JAXA 2JJMA 2XTNA 2ZGVA 2FWIA 5KWJA 5F3WB 3FTEA 4DZRA 1ATIA 1GRCA 5C8YF 4N0PA 1DTEA 3LUJA 3QVGA 3L04A 3R24A 1SBHA 4HI0E 1NE2A 3QXCA 4HQFA 5IAKA 2JA1A 3A3YA 2I2CA 3G8YA 3LCVB 4J16C 4KJZA 1H2YA 1FY2A 1NXQA 2W6JD 4LXIA 1M74A 4PO9A 4PZCA 4KX3A 1JPNA 3E3LA 3DCJA 4MLDA 1QCYA 5BRJA 1QHHA 4PRZA 4FHEA 4N8EA 4R2MA 1N5RA 2D06A 3DB1A 1YHYA 2GYVA 1K2WA 4DLRA 2YRXA 1DXHA 2OZEA 2OORC 3F67A 3JSNA 2XWBF 4NMHA 3RS7A 4AF7A 4D4GA 4OLAA 2RHWA 2E21A 2GBLC 5AIBA 1TU0A 4FSHA 4YR7A 4J9MA 2FW0A 2EF1A 4UU1A 4A6DA 3ZGLA 2EFEB 4KFCA 3N6VA 3QLVA 2E49A 2PFSA 2LDBA 3FWYA 1V4BA 2JS7A 3IOEA 3K8QA 2GK3A 2C0PA 2D2VA 3KB8A 4OUDA 1RLUA 4YJGB 2D2EA 3K0BA 4XDZA 1SUEA 4DLZA 5DG9A 4A3GG 1G3IA 4Q7EA 1FRVA 2DHEA 3T1YH 4QELA 4N8DA 5AK6A 3RT7A 1QVRA 3C1UA 3GMTA 1P5ZB 3N0XA 3X1WA 2ZWOA 3A3OA 3JQFC 2ZBQA 2E5LH 1T0HB 2O1WA 1TZKA 4JGIA 4YJFA 2AUTA 2ECFA 2QYOA 3N07A 5GP1A 1S2OA 3EIHA 2QZ9A 1P3JA 4MDFA 2GZAA 1OFTA 1RK6A 3H3XA 4J1QA 1JE1A 5F33A 3WMEA 1AZSC 3IEIA 4EW1A 1JLLB 2QRNA 2ZB7A 4NULA 1BWRA 2O7RA 4N7BA 4ECYA 2LWIA 3U3ZA 8ATCA 1OZGA 2Z2KA 2VYQA 2FWBA 3IPCA 2A1UA 3R77A 4ZN6A 3Q88A 1KRWA 1C3XA 4IDDA 3HNRA 1K7EB 1R10A 5TXGA 3KV1A 1YU9A 1L5FA 3CGGA 3H18A 5AW9A 3RGXA 1KU0A 1C7QA 4AX4A 2MSNA 1ZD4A 3PXBA 2BC9A 3O38A 3RT1A 5TPZA 4YPVA 3AZPA 1M6NA 1FP4B 2XTJA 3CJTA 3LMLA 1FX0B 1CHDA 4CYMA 1XFAA 4O4HF 1PLJA 2REQA 3ZDCA 4O3PA 4YR9A 3AJDA 3VR1A 1DTSA 1A1SA 2D00A 5D6NA 4QNRA 1SIWA 1HFKA 4Z1OA 2DCMA 3AM5A 2B63G 4CKZA 2X86A 1YWGO 3GLHB 2Z2ZA 5G02A 3SZRA 3NOQA 4IV5A 3LFTA 1W581 3LWNA 4L7VA 1OXTA 1Z5NA 3R0QA 4B3CA 1KQGA 1T6XA 1U0JA 4FVTA 5EWJB 4HRVA 3STVA 4IHJB 4MS3A 4B6EA 3W05A 3WRXC 821PA 5IAOA 4YJ2A 3LBHA 5H4GA 1FP4A 3B51X 3WKDA 1FVOA 4ASUD 4B0OA 4H7HA 3VNSA 2FSVC 2W0SA 1PFKA 1KS9A 1TKCA 3L4KA 3I4LA 2AZMA 4DIEA 4X24A 3ZJ5A 2QSJA 4TSRA 4UE3S 1HL3A 5GJBA 1XLTC 2AWNA 1BFKA 3MQ4A 3FTDA 4IS2A 3HDTA 4N41A 1QRTA 4J1SA 3D2BA 3WBBA 4DWJA 4AYBE 3E3MA 5BWTA 4J9PA 2G1KA 1D09A 3DFFA 2L82A 2O03A 3AVXA 1HKHA 1XQXA 2BR3A 3RHZA 2QK4A 4EUSA 3RBZA 3U4QB 5K0LA 2FPIB 1VCHA 1AKWA 3FR8A 5JPCA 4OYYA 1CJUC 3D6VA 1N6KA 4LC1A 1VC2A 1PFGA 2OXIA 3WGNA 3AVVA 3LKVA 4ED7A 4TMXA 1WCIB 2F9FA 3GL9A 2QM7A 1MH1A 2XIJA 5B2EA 5CR9A 1H6BA 4DYDA 4URFA 4EG6A 3ADBA 2W57A 2DHDA 2WFLA 1HE1C 4LOAA 2VOJA 2WB4A 3SYNA 2EDCA 4CUJA 4I2VA 4Q0MA 3R75A 3T54A 3ICVA 3AHIA 3KVRA 3W5CA 5HRUA 2CN1A 3K0EA 2Q5CA 1UIMA 3BULA 4JI6H 2Q3EA 3WTCA 1SKBA 3FTQA 4WERA 2NT3A 2PX8A 5DN6A 1T8UA 3H5NA 4X92A 3DMTA 3VNAA 5ENZA 2H11A 4REMA 3M4XA 2IYEA 5GMOA 3WSWA 3F6YA 3U3DA 3ZZ0A 5KNBD 3O9VA 5J9FA 2IPXA 2XRFA 2PXXA 1T9KA 2QX6A 4HSGA 4IYRA 4ML3A 5LMNB 1YULA 3LHDA 1O96B 1R3DA 1Z6QA 3T5CA 1IXSB 1E3JA 1YR9A 2C9YA 2P4UA 1BEEA 1R7RA 2EP8A 2GHTA 4RHYA 1LV7A 5ERGB 3AOGA 1AKRA 3QF7A 2IU0A 3AUTA 3QVGB 1KOFA 5E4JA 2O7SA 1GSOA 4S0ZA 3AK4A 4EFBA 2C98A 3H6GA 4HH4A 3MGKA 4CE6A 3KXDA 2HQRA 4OQYA 5LMZA 3COYA 3MINB 1AKVA 2PKEA 4KXMA 3F46A 5K2MA 3K2EA 4AKHA 5F7OA 3V4PB 4LY3A 4GPAA 4OHPA 3IALA 1QHFA 3CF4A 1XK6A 4JA2A 2RHRA 3OPVA 4BVAA 4PVDA 4YUAA 2QPOA 1LQTA 2CVHA 1FS6A 2P2LA 2EXXA 4QICA 4B6JA 4NMMA 4PYIA 4URHA 3LI2A 4N40A 1I6WA 4MZDA 1AQLA 1W2HA 1RYYA 4UDXX 5BR1A 1VI2A 4GPBA 1SPXA 3BK1A 5CLHA 5HW0A 3T38A 1SC9A 1Y42X 3WA6A 4WJLA 1KARA 3BHJA 4NPAA 3EPIA 3RS0A 5HVNA 1KTIA 3LQ4A 5AW8A 1X7ZB 1HR0H 1TRKA 3B9QA 5HUHA 2Q3MA 3W5DA 4DQXA 1U6JA 3U48A 5FNVF 1H5QA 4OO3A 1Q1BA 1IY8A 3CLTC 5DE3A 1P2VA 2W2MA 3UGTA 5JUMA 3P9ZA 4QPZA 4W1QA 2HRQA 1P8AA 2O57A 3U3RA 1MW8X 3C3DA 1GGOA 3Q8QB 2ORWA 4Y7DA 3VSDA 3I42A 3M6WA 5G1OA 2G9RA 3QFRA 1XTIA 2VAMA 1KVRA 2BGLA 4YQYA 5AVUA 2Y92A 2XUDA 2FB9A 2XB2A 4KO3S 3P9QA 1WUTA 5EJ4A 5K0SA 4JJAA 5BMVB 3AEKA 3PWSA 4A8JB 4QYWA 2CFCA 2IPMA 4V0RA 5I9NA 1JSCA 1ZC4A 2QL6A 3T7EA 1KWKA 4JUFA 5EZQA 4LYEA 3E23A 3K6SB 4TVKA 4MR9A 5ALRA 5K2OA 3HOWG 3F6CA 4WN3A 4TYWA 3A9TA 4G8CA 1RWOA 3QKRB 5JUWA 1EJ0A 4U7DA 4YP0A 3HKBA 1YKFA 4GOJA 1K8QA 1WUIS 4JL8A 2Q29A 4URUR 3VH1A 5INTA 2P78A 3QLUC 4U1RA 4ZDKA 1WZIA 4LFAH 2AXQA 3GEPA 3GZTB 4AICA 3DZFA 3HP4A 3KL4A 3DT6A 4WZBB 5FA8A 4XWKA 3F4LA 4NE2A 3D54D 4NOJA 5AOCA 2IHJA 2D74A 2CHEA 1QS0A 4A0QA 2AFIB 3FG9A 4FR0A 2VHWA 3GV5B 4XGNA 3QWHA 4QG3A 1XKQA 5FOTA 2BGTA 4HADA 3TRJA 4BO9A 4BO1A 4UD6A 2ZBPA 3K8OE 1AHNA 3VKWA 5G4KB 2O8BA 2J3QA 1XAIA 1VE3A 4R8VA 5ICEA 4ZU6X 3DDOA 3W0LB 4QT4A 2WAQA 5CVCA 1OKKA 2EGUA 5CH5A 4ZVOA 4MYSA 4AX8A 4WBNB 4LF4B 2XYGA 1ET0A 2PMEA 4ECUA 1QYRA 2P6PA 2HUPA 3DBOB 1JH9A 4AP9A 2Q2TA 3AETB 1Q44A 5HKOA 5KYYB 5JQGB 4MI3A 4ZCMA 3KYBA 2F4VH 4O2BA 2O2ZA 1M1NB 2UYOA 5C53B 4BLTA 3WJ1A 3BGOS 4J1TC 1RACA 3PNQA 3EWAA 4C7KA 5C32A 1PU2A 2R82A 4S1VA 1Z45A 4ENTA 4UVIA 3EQ9A 1ANKA 1YJ5A 4YJ2F 2OAQ1 3PPXA 5DYNA 1BW9B 1CF2O 4AZ3A 1NMEA 1FP2A 1HFWA 4BJ1A 2HCFA 2OKCA 1PFUA 2ZJOA 1YBVA 2A94A 1J4AA 3IXQA 4FU0A 2QA5A 4HPJB 4R9VA 3T7JA 3IE0A 2R6HA 5I7RA 5FI0B 2YJTD 2WSBA 2VUHB 1IIRA 3E1SA 4CTOA 5JNWA 2GRUA 4Y9DA 2PZAA 4BEVA 2HRDA 4L02A 5ESXA 3JY6A 3IVGA 2GPJA 2G6BA 2BKVA 1DV2A 2G88A 2GCGA 2JI9A 3HKCB 1TA9A 1Y9AA 1A3GA 2YUIA 1CP2A 1JJVA 2QKYA 3AX6A 1ECPA 3Q40A 3V1MA 5JMOA 1VP3A 3C8DA 2IITA 2R8PA 2WJAA 3DDCA 3DKRA 2ZM6B 2G5GX 1DPFA 3MS2A 2O2CA 1KWGA 3B82A 1CJTC 2HZBA 1QIFA 2RGDA 5BY2A 2WWFA 2XWQA 2C2DA 1XUOA 1NFFA 1VJ1A 4E7PA 4DVJA 1LC3A 3OECA 4YWJA 2OCPA 1KY2A 3GOHA 1K6MA 1J1UA 4AJ9A 1L8AA 1C41A 5BQFA 4O4LF 5BSHA 3AR7A 4ZAXA 4YRAA 1GL7A 2XSZA 3BWVA 4F9TA 1NLZA 4G4IA 2IQ5A 1WHSA 1H8HA 2CYAA 2JCYA 1B8PA 2QD5A 2ZRIA 3IJ5A 2NO7A 1T2CA 5T8KC 4JI8B 2KWIA 1EFLA 2IVZA 1VB3A 2JH9A 2BQRA 1KHTA 3RLIA 2D5BA 2WNHA 3GD5A 5TEWA 2CD9A 4FUQA 1FFYA 2PR2A 1Z07A 3ZV4A 3FFBA 4B33A 1HGXA 4DUZH 2PXCA 3FGNA 3TB6A 5BSFA 1XPUA 1T3NA 3AVTA 5DGDA 2P3QA 2PIAA 2B2CA 4I4TA 3DV2A 4K6FA 1XDWA 2PUTA 4XLLA 3U6KA 4TTVA 2UU9B 3OE7A 1GRNA 4G67A 3N8NA 4MWZA 3B1ZA 2YQZA 5TRTA 1GZVA 2VA9A 1VKZA 1UDAA 3G0OA 2HDOA 4X3OA 1QH9A 3OSZA 4I14A 3H84A 3HEAA 3RGGA 3PZPA 1JLSA 1M7GA 3ANNA 4R8MA 1J00A 4MAMA 3HVUA 3PLNA 5DCUA 5DTJA 2JHFA 2ZSUA 2BFMA 2IZOA 3C7TA 1SCDA 2FAXA 3B1KA 1JIUA 4LDQA 4DANA 2R1TB 4WW0A 4H7PA 3RVMA 4EFEA 4B79A 1L5OA 4DDVA 4PRLA 5ALPA 2CBZA 2PWYA 3RJMA 4ZODA 4QOFA 4FHZA 1GZ6A 5BN4B 1YS4A 1ZBDA 3ZY2A 4YRBA 2VUSA 1K9SA 2ZXUA 1DELA 1KYZA 1VJRA 1J24A 2YCLA 5IDXA 1PYGA 2OWDA 3PG5A 4FMDB 3X1XA 2BGNA 2O2HA 2WDPA 4ZI7F 4EY3A 1RKBA 5EHXA 2POQX 3KQVA 3DL2A 4LQ4A 5EVJA 3ZHTA 4ETIA 1F38A 4K9LA 5JATA 2HB6A 5I7OA 4R71A 1N25A 5KTMA 2AQKA 2ZUFA 3HKBB 1K27A 1JU4A 3HLTA 1RYDA 3LWBA 4FNOA 4A3MG 4G4SP 1W5BA 1YI1A 4L6AA 1M3SA 4F6RB 4RPHA 5B36A 1HDXA 5HPYB 3V8PA 2C2XA 1NWHA 4JI4H 4FLMA 4N3BA 3FCOA 4FZ5A 1YUBA 4JVSB 1TYZA 4Y6RA 4EECA 2ISCA 1OU4A 1JQAA 2BRUC 4EFKA 4DY4A 2O1EA 4MRMB 3WRWA 5EJGA 1PFWA 4LJ7A 3HJHA 2H4XA 3I09A 3TQ1A 3T95A 2ZQYA 4L8FA 1ESZA 3QYJA 1NJ1A 2Q1UA 4GW3A 2D1TA 3EGEA 4IW3B 4Z4FA 1XCJA 5E2AA 5DX8A 5F5NA 1DCTA 1K4KA 3QTLA 3RS9A 3VR5D 3GW8A 1ZK2A 5EZYB 4LFBH 2M6KA 4DV1H 3LF2A 4JASB 1JIQA 4P7BA 4BKRA 2X40A 2W4QA 4MZXA 3GUCA 3KOXA 4OXNA 1E7YA 1OFUA 1I5EA 4H08A 2UXDH 2R6GA 4L74A 5DLDA 1KQNA 2YYZA 2ZB8A 2CNQA 1NDHA 2V45A 4P4SA 1KQFA 3NBQA 3FETA 3OF5A 4H6PA 3U7HB 1RI1A 2CLFB 5FOVA 4RL6A 4UTRA 1E62A 3PC3A 1BTOA 1T1SA 4ZT4A 4OHZA 3UIEA 3TF5A 2QU7A 4J3JA 3VKUA 3GNLA 5EESA 2B3DA 4CI0B 5SZJA 1SIOA 3HPRA 2FSVA 3GP5A 5HBGA 2JEZA 4CWAA 5T67A 3TW7A 5IMSA 2OE2A 3N5CA 2IHVA 3P4YA 2B1QA 3D6HA 4JX8A 4UW9A 3I32A 5IP5A 1A72A 3PWZA 1QVAA 4V0SA 3CEHA 2Y0PA 2G1JA 2OVBA 4Z7JA 1GYRA 2BMFA 4OMCA 4RY9A 3TRFA 1E3IA 2JCVA 5DG7A 3RV4A 4PLYA 3TLAA 4UNNA 1JIJA 5TGZA 4JFAA 3BSWA 4RHTA 3H6HA 4XDGA 3EZ9A 4NICA 4RACA 2GJ9A 2G9QA 4KO8A 4R31A 2ACEA 1K88A 2ATEA 5EVCA 1XWIA 1ORHA 3T0FA 2BEJA 2PBFA 4ERXA 2J7PA 3QY0A 4Z8XA 1TADA 1P0MA 1U3TA 3TNLA 3WYAA 3LPDA 5B7GA 3EC7A 3PJRA 4B3MH 1TMOA 2V1UA 3Q3GE 4ENPA 4X65B 4NCXA 3L2OB 2FK7A 4UM5A 1YA8A 2NUAA 1KYXA 1R4ZA 1Y98A 3DNMA 5FNVB 3PUZA 1S0NA 2V9WA 3FFWA 4KTVE 3OJWA 4OCZA 4EBFA 3M5WA 1XTUA 4PYNA 4MRPA 4Y2PA 4ENUA 4O02B 2JFYA 2Z08A 4LZZA 4KHPB 2NTEA 4C0HA 2WAXA 1N0IA 2O8FA 4Q8FA 4GMDA 1ND6A 3CTPA 4O33A 1IOWA 2Q3DA 3PXXA 1ZH2A 2BFPA 4W9RA 3BIWA 3OU2A 2R92G 4DUYH 1IVYA 4RUKA 1TJPB 4OJNA 4Y2RA 1KP9A 3RG2A 2GK7A 3EAQA 3GLQA 2Q5IA 1W35A 2XKJE 3SEFA 2IGBA 2X6TA 4NFLA 2C4HA 3LP5A 4FPXA 1V35A 4XWWA 1EE9A 2R8JA 3FMAA 1GA6A 1J8MF 1SUCA 4HGPA 1R64A 2OGTA 3IMGA 2ZWMA 1YE3A 2F1IA 4GX0A 5EIXA 5L3SA 1Z8FA 3U9SA 2X1MA 2QNRA 4GEKA 3TDNA 2DPXA 3BK2A 4H3KB 4FZRA 3RIMA 1GSIA 1ZIYA 1ZJ4A 2ZR9A 2OCAA 2WHQA 3C7AA 4HBGA 3T3IA 2DKOA 4AYWA 4DIKA 1YS6A 3LUPA 3BIOA 2BF7A 2EZUA 1FQKA 5JR3A 2BHTA 2P4HX 4QHSA 1FP1D 1A7JA 4WXRA 4YGYA 5H02A 1EFPB 3QIAA 2XJ4A 1FE8A 2HBQA 2JIOA 1KSHA 2H6EA 3DZIA 3J81W 3RCBA 2EW1A 4Y6QA 5LLDA 1CUBA 3KKQA 1QP0A 1KBQA 4MEAA 3DZBA 1MC4A 2RB5A 4LPKA 5E3HA 5A1JA 4LI3X 5TDHA 4V1CA 3H4TA 2WTFA 4UTZA 3UOWA 3RAQA 4ED3A 1U2SA 4OGKA 1NQVA 4A6XA 3G88A 4Y9SA 1J2YA 3PW2A 4O4HB 4B34A 4RYDA 1O0CA 3N59A 4R7TA 2GT1A 1DX9A 4B4DA 2B8WA 2ADMA 1PNRA 4FFWA 1U0GA 3LHFA 1U7ZA 1MG5A 1PJLA 3U7GA 2XD4A 5FJIA 3WL6A 4G0NA 4A0HA 3ABRB 2NU8A 4BQNA 1EXWA 4EKNB 5JVDB 5L8VA 3BUSA 3VDXA 3HV0A 4QGHA 4RXMA 1WMAA 4LTNA 5IW8A 3HUEA 1LLQA 3DS8A 2HA7A 4O7TA 2BAGA 3HL0A 2WTEA 3GH3A 1AZTA 4YPFA 5FTJA 5FLMG 3WGQA 5CLJA 2QRMA 4MI9A 1Z68A 1RTKA 3AR8A 2YWVA 3IAM6 3LA8A 4IEEA 1Y0BA 3DOJA 4D4JA 4Q3KA 1U8TA 4BFWA 2QQ5A 3H9QA 2EWWA 3ELWA 3H19A 2QW1A 3JD3A 4HWTA 3PF9A 4RKRA 3KV3O 4B6FA 1Z63A 1WZNA 3K09C 1D5CA 1GNVA 3V6HA 2J46A 4B09A 3TRDA 4ECZA 4A2WA 2ZTLA 3Q6IA 1UQUA 4D4HA 4F2HA 1E2GA 5L3QB 1HX7A 1VMEA 4HGYA 3RW9A 1PX0A 3T1HH 5B1SA 4X5OA 4RNOA 1ECGA 2JFBA 5FF9A 5KFWA 3MWDB 1IZ7A 5TY0A 3NXKA 2PS9A 3K70D 2PUJA 2P2GA 2X6RA 1UWKA 1CR2A 3N2EA 4L5AA 2F3SA 4JXUA 1PGNA 3GJQA 1N2IA 5DLGA 3CN7A 4QA9A 2WWYA 2DGDA 2LCIA 3FSRA 5E6UA 1KAGA 1P2UA 2BFCA 1V41E 3NH9A 4URYR 3RUDA 3D2LA 4AY5A 2YICA 4JAVC 3G89A 3AJAA 2F67A 2I7XA 2OCKA 1YB2A 3GFSA 4OY3A 2H85A 1Z08A 1IK4A 2QD4A 1SG6A 2Z2YA 5GY7A 3DJYA 4JJ8A 1P9OA 3I53A 2M1ZA 1RKVA 3GPDG 3T12A 4HEA6 4QTXA 1X7GA 3MEQA 1G4UR 1HSOA 3E9CA 4MQ5A 4MYDA 2DE0X 1SKQA 3MUNA 4LVNA 3FPAA 1BXKA 1CF4A 2DPGA 5L40A 3BMCA 3N0WA 3NWBA 4OBBA 5KG4A 3G1WA 1LZKA 3L7BA 3HO6A 3QU2A 5EHZA 2G3YA 2IP1A 3OH8A 2MSKA 5I60A 3B7GA 3LM8A 4ND5A 3RG8A 3TR6A 4EEQA 2H8GA 4YXFA 3WB2A 3WWEA 4L9WA 3LC2O 2XWJI 1NJFA 5B4UA 5BN1A 4P0QB 3PCRB 3ORHA 3SYTA 3QG1A 2FMXA 4BN4A 5JSQA 1ZD8A 4X1KA 4XDYA 4HAXA 1SU8A 1JHAA 4I4LA 3RS2A 2UYYA 4XFDA 2PVSA 4ZANA 3RTBA 3USCS 5IANA 3O83A 2EP5A 3EVEA 5SZIA 2W83A 3VI3B 1PV1A 2H18A 4JBWA 1E4EB 2JKVA 1YV9A 1E8NA 1RLTA 1NZFA 1T5OA 2DSTA 1POWA 3ANMA 4LGCA 3ZKWA 5KKCA 1VPVA 2Y0SE 3GRAA 4MNTA 2H1IA 1XD9A 3RTXA 4RD2A 1QC5A 1PK8A 2C2GA 3MWGA 2FLLA 1GTJ1 1UEJA 1Z5PA 1S3SA 3AJ8A 4H4CA 3RS5A 2ISSD 3K73O 4J7AA 5CJPA 5JMWA 3WWOA 3H8JA 4K9MA 3QV2A 3NBFA 5H59A 1EK1A 1WG8A 1RYBA 1XX6A 3G2PA 4JDPA 3WB0A 4JOSA 4HL6A 3ZBPA 1RZRA 2R8BA 2XKBA 2GWHA 3NM6B 3GFQA 5AJYA 5BSGA 1DSSG 1EFUA 1QS0B 1L7BA 2ABWA 5B6JA 4HYKA 2PYDA 3EPJA 4I9FA 1Z3IX 4O3QA 3KE8A 5HQ3A 1FK8A 3ORYA 5HOQA 2XUGA 3ADKA 4ZTBA 2WFAA 1ZX1A 3WZLA 4MQLA 2I54A 3GV7B 3O4HA 3V00A 2C7GA 3K70C 1U80A 1A2KC 1GDHA 1XKXA 4NCHA 5ALQA 5K5EA 1E9VA 1ELOA 3RSZA 3LC0A 4DV0H 3B1VA 1GCOA 4PSVA 4BS9A 2C3YA 2MIIA 4G9BA 4Y2JA 1E20A 2JD0A 4S05A 4KUGA 4GLFA 4E5VA 1O89A 3PC6A 2MJLA 1F60A 3D6FA 3NR2A 3ILHA 1U8AA 2LP4Y 4TS1A 4MUIA 3U80A 4Q9KA 3L7YA 5BT9A 3RARA 3JW8A 2ZYSA 4B4KA 1VYUA 3HNOA 3RQSA 3BMNA 1RHRA 4MYRA 4CG3A 2A9PA 4MQFB 1R8YA 2ON6A 3FDXA 4Q1VA 2G7ZA 3ZWAA 3CB2A 2EV9A 2FPPA 3A9UA 3EGVA 1QE5A 3JQ7B 4CMIB 1ODFA 2MCTA 4KQKA 4RCNA 1FJGH 1PT9A 3FKSD 4NMLA 5J1TB 4M2LA 5KT2A 3FYSA 2HU2A 1GV0A 2C0QA 3NETA 4H9GA 2A0WA 4QBGB 2WU0A 5FBKA 5H68A 3ZU6A 3ST7A 3RWOA 3RU3A 1CRLA 1Z6GA 1T9CA 2J7KA 1QU2A 1XMQH 1UZUA 1Q95A 4NBWA 3ZWNA 3L2PA 1JAZA 1KC3A 2YJ5A 5ALZA 3D8TA 1NFQA 1TYAE 1MGPA 2IS2A 4RVDA 1W88B 2R8KA 1E2IA 4QT0A 4GM0A 4XYEA 3UMRA 4EZBA 2CLLB 1EEHA 1JWLA 1CYDA 4TT8A 2ZSJA 4UPVA 1QIEA 2G6TA 5HDQA 1Z7GA 5E4FA 4BIIA 4CMAA 5CFZA 3ANXA 2PNFA 4K86A 3DMYA 4GIBA 3D2AA 1ZGCA 3OEHA 1JKXA 1BVHA 3JALB 4MA0A 1E99A 3AI1A 5B3AA 1DRKA 2QDXA 3TOZA 1GTSA 3BDAA 3OZWA 5EJ5A 3C5CA 3V6LA 4RTLA 2NIPA 4WA7A 3DOCA 1BXGB 2FPSA 3H9BA 2IS1A 5HCNA 3OTOB 1MOZA 1QRRA 1YC5A 3D64A 1H42A 5DNAA 1O96A 5EPEA 2Z6QA 2PY6A 1B41A 3HI6A 2JA7G 3GFVA 1R8JA 1P5JA 2OG1A 2CNDA 2IBSA 2WM3A 3BICA 2R0QC 1GLVA 1JZQA 1U1GA 1ZIXA 1JPUA 2EKPA 3H42B 4JLBA 4GNRA 4CF5A 5KTNA 1E3WA 4OLBA 1VXOA 4KQMA 2RFLA 1Y5MA 5DNVA 3TAUA 1OHHA 2GJ8A 3JD1A 4Y8VA 1G20B 5ED4A 3GIDA 2XLCA 4HH3C 5E6UB 5FA5A 1YQWA 1HDYA 3RC3A 1TUBA 2DMRA 3AEQB 5HIAA 4QUAA 4UE6A 3KKPA 3GXOA 3W5AA 3R5HA 4GGPA 3LXRA 4V3CA 3PKIA 4HB3A 3S55A 3VJKA 4E09A 4G5YA 5K6RA 3F7OA 3IQFA 2Z83A 4O3SA 3ZJUA 2HDHA 4WOCA 1ZMXA 2ZROA 4RYLA 5CX4A 4DCJA 4ND7A 3ZW8A 1I2AA 1I8TA 4DV4B 2YMQA 2O05A 4EFNA 3IVXA 1XTTA 3EQ6A 4PLZA 3V55A 3OSNA 3HE3A 3AVPA 2YJ3A 2YV3A 2ZJZA 2FPIA 5KKNB 3FLMA 1JVBA 3IUPA 2I0FA 2AWOA 1N9GB 3H97A 4L2IA 3G2HA 4R98A 2QTCA 1GAXA 2RGAA 2ZI6A 3ZU5A 5KOJB 3IODA 1ST2A 5I5YA 2X4GA 2PE5A 3QXHA 4A2PA 2ZR7A 2YHSA 3AL0C 1XMVA 2IPOA 2R7AA 3KLNA 1LF5A 4TM8A 1Z5UA 4D02A 2EKBA 2OV4A 4MWSA 2FZWA 3X44A 4PNEA 1D8TA 3LTNC 2X5OA 1WL8A 1WW2A 4FW8A 1ESMA 1RMTA 3GDHA 1ODIA 4TN1A 1U7TA 1UC4B 2AUNA 1UH5A 2AQ4A 4EPVA 4AXXA 2P0AA 4A3BG 4O29A 4WCFB 1ZH0A 5JS6A 2AS0A 3RYCA 2PN1A 2IY8A 3LF1A 4HAOA 1NBMA 4KG7A 2QJWA 2C4WA 5DTQA 4XSVA 3RAXA 4RUAA 2X8AA 4IDNA 5AT1A 4F4JA 4DPLA 4I6JA 3VC1A 4BAZA 4UNQA 4R7GA 5EWJA 4D44A 4DUGD 1M1ZA 3DVQX 4L28A 4EI2A 3KPYA 3P2OA 4WFKA 5ANRB 3PQ8A 3GTJA 5JD6A 1TTPB 3K0AA 4O81A 5JARA 2OZLA 3OMXA 1Z0KA 3GLHA 3X1MA 2OHIA 1VBHA 2HJVA 3C6MA 3IAS1 3HKZE 4WNCA 3WXMA 3DE0X 1TTTA 2NG1A 5A6SB 3OCVA 1NM5C 4QM6A 3CA8A 1QGYA 3MMNA 5THXA 1PWXA 3BA8A 2WSIA 4LK3A 3ZPXA 3ENWA 2PU5A 1ISHA 3TNYA 3UB3A 2BIFA 2ERCA 1NPTO 1UIRA 2R48A 3STTA 5JC1A 3RD5A 1CUHA 2QR2A 2N47A 1P5RA 3II6X 3TXXA 5IJ9B 1EM6A 1Y1KE 1U2GC 3OJ0A 5HZHA 1SZDA 5JQWA 2KM1A 4LDRA 4E6EA 3FTFA 3KSZO 5FLEX 3K6KA 2GPWA 4DJEC 1TM3E 1S03G 2A1TS 1QO9A 4RHEA 1X7YA 3HJUA 4ZI7A 3NAGA 3JQGA 4LJ8A 3E9YA 4KQ1A 4OM7A 4DJTA 1GEGA 1V4VA 4ND2A 8ADHA 1OASA 2LW7A 2W6QA 1WHSB 1C9MA 2FUG6 5FI5A 1Z29A 3SS8A 4M9QA 1YF3A 4RF3A 3RT9A 1D4AA 2GBFA 1O97D 4J0FA 5JSUA 2EJCA 1EWRA 5GTDA 3IEPA 4AJEA 1YK0A 4UAUA 5TF4A 2CXOA 2QM3A 3P27A 4YS6A 3SG0A 2G76A 3OD1A 4DA8A 2BTQB 5D7NA 1U8CB 5D01A 3I2HA 1E2NA 1O8BA 1O7JA 3OQHA 2A5DA 2X2OA 4PYOA 4CPDA 1AB5A 3A1SA 1JHOA 1RIIA 4Q3EA 4H35A 3V7NA 3NASA 3A1WA 1XIVA 3V6MA 3QEAZ 1GFSA 4KWHA 4RB1A 4IOMA 5CNJA 4UVDA 3RRFA 5JASA 1BSVA 2R6FA 4JB3A 5KFMA 1H94A 1PZXA 3IP6A 3KZOA 2Q4BA 5EIAA 4N47A 5CG1A 1MB9A 1JT2A 2YZMA 1ZETA 2FW9A 2YC2C 4MKIA 3OLZA 1EUDB 4KQWA 3RM3A 2A3RA 3PGMA 1UMKA 1COWD 1CVIA 2WJVA 3OEWA 2QPAA 4S2EA 1G18A 5G0UA 3ZW7A 4G0UA 5F9NA 2VXOA 3WYBA 5BNWA 1ZGZA 2B61A 1QBGA 3PGLA 4BP1A 1LTKA 3ZVNA 2Y0SA 2YZGA 1VM6A 2QTFA 1IB6A 4ZT3A 1U2ZA 3H5VA 4LJ6A 4UXHA 1P9NA 1EKPA 1E7SA 2O1XA 1G8YA 1J6UA 1DZIA 3A4NA 4OU5A 1NP7A 5CA1A 2I2AA 4K05A 1TQDA 1KMCA 5LP6F 5A2QW 4RMHA 5LZ9A 1CC1S 2A86A 2I7VA 3GJSA 3PQ6A 1V51A 4WLUA 4O4LB 5GGXA 1U9IC 1YDWA 2B8JA 2C5FA 3TK1A 4Z4GA 1WLSA 2PD4A 3OZRA 3ZQ6A 1AN0A 1M8KA 3ZDYB 1RT9A 1UPTA 1Z4LA 3VC7A 2PUCA 4PRKA 3V2HA 4O1MA 1JFTA 5HGJA 3C3YA 4F2PA 2FJ0A 1TWCA 2O8BB 1ZU4A 3U9TA 5EPOA 4F46A 1AMOA 5TMPA 1ORWA 2OZLB 3ETDA 4OIMA 1V2HE 4DLXA 2DHCA 3WNCA 4F12A 1UT6A 1I7DA 2H2DA 1T8WA 1I3KA 2QEQA 1Z25A 5FWXB 3TJMA 4IDFA 4GDFA 3GFFA 3QELA 1CFJA 4Q24A 2FZCA 1TF7A 4V2UA 3EZLA 5EP2A 2HHJA 1AJEA 4R8KA 2XE8A 4RY0A 5DGAA 2DQ4A 2PEYA 4M8NE 5KHAA 4JZYA 2RHDA 4DCNA 4BU1A 4PLVA 3KZKA 4OAPA 2UUCB 1V8OA 3JD0A 3U54A 4I3GA 3HPQA 5FL7A 2ZULA 2NVOA 4JUDX 3BXPA 1IPHA 3Q8MA 1IY9A 1FLAA 1R5OA 3DOEA 5IF9A 3MGAA 3C5WP 4TX1A 4S0XA 3R7WA 1L6RA 4B47A 1VYVA 4UCRA 5IUNC 3CONA 1LNQA 5CFQA 3K6SA 3IOCA 3L8MA 4TV9A 3RKUA 3FOCA 5FUBA 3LT2A 1I5OA 2REBA 3PVCA 4PX3A 4BTVA 1M8FA 3C8ZA 3VV2A 1UC9A 2X8JB 3IBFA 2QB5A 3WIBA 2G63A 4AMGA 7YASA 3V97A 4CF7A 4ZHQB 1CBUA 1IHXA 1ZM3A 3VKVA 2C3PA 4GE0A 3HVJA 3DKKA 5AR1A 4PLFA 1I24A 5EWEA 3HZZA 1MZPA 2Q6OA 4DADA 2ORVA 1QCCA 2QXTA 2XUJA 2PGJA 3E3AA 1ULHA 4FYKA 1GU1A 2CNKA 1G9TA 1K7CA 3I1YA 3VR6H 2HR1A 5AJWA 4I1OA 3CNHA 3PZBA 1OAKA 1U0NA 4X1YA 5JZVA 1XKLA 2R1VA 1OWOA 3JQCA 1EWKA 1JJFA 1A8HA 1T15A 1CLUA 3HMQA 4RS3A 5HCIA 1RQXA 1VMAA 3QUQA 1BCRB 1P0CA 2YHIA 2VJQA 4Y8VB 2PV0A 3UT5B 3L92A 2H0RA 1QZTA 3HVHA 3EEOA 3M9XA 1L3CA 1NUPA 2BH9A 2UXBH 3M0EA 4PGGA 3HBJA 2H4FA 4RSMA 5IBPA 4LPSA 3FH0A 4R51A 4RH0A 1F2DA 2MSLA 1ML4A 3KQNA 2ZT8A 2H9YA 4KP7A 1QQ6A 3WSVA 1JQLB 4J6FA 3JQAB 4R2WA 1NVVQ 2P9QA 5F9HA 2W2OA 1TWHA 4RCYA 2J3KA 1ZINA 2ZCUA 4KN5A 1T29A 1TCCA 1HL7A 1TAGA 1ZK4A 3A7EA 3NTXA 1Q77A 1EVEA 2A6PA 4BKPA 1B6SA 5IBQA 3PB3A 4IHAA 4X90A 4XM1A 1G8MA 1MXFA 3L46A 3MAGA 4GC5A 5JE8A 4ZEMA 4K9DA 3O2SB 3QBJA 1RU3A 3MUFA 4HCJA 5IAJA 2P9ZA 4BWYA 1Y6ZA 4NI5A 4OJQA 4ZP1A 3K4HA 1E2DA 3W4KA 1ZNQO 1PVOA 1EKVA 1TW2A 3BMOB 4OU4A 4QARA 4UFOA 2QUHA 5HKAA 1G98A 3W5JA 5KFTA 1SELA 4IXNA 5KFZA 3Q6NA 4ARSA 3KSMA 1X70A 3HI4A 2YVUA 4E14A 1I2KA 1DIOB 4EY5A 1SG0A 1C9DB 2AE2A 1N2JA 2JVKA 2R8OA 3A7DA 5KIAA 3QPUA 1YRWA 2Y93A 3R7NA 2IXAA 3K0CA 1JG6A 4BRSA 1IXKA 4UU7A 1C8KA 1QB8A 1F5SA 1RWXA 3H2YA 4MQBA 3VR6D 4CMHA 1GPYA 4RTQA 3LPMA 2DH6A 1YRLA 1RQLA 2ZSBA 3LY7A 3NNNA 2NUTA 1I1MA 1SOVA 3FDZB 5DI3A 2DPLA 2J3LA 4B7UA 3MUEA 1X1QA 2ZSFA 2DWCA 2O2IA 2RG7A 3BB3A 3FNBA 4HWGA 4F4FA 1MEEA 4DMHA 3I2GA 5A03A 4JP5A 2NM0A 2QVCA 4DMUB 3ZH2A 5J3JA 4OIFA 4AC9A 4BNMA 1ECCA 3JAMW 1UKAA 1CR6A 2RGNC 1YJ8A 2B1RA 2OUIA 3L7NA 5DX0A 3UMYA 3UCFA 1X19A 5TJHA 3PU6A 3ZZ1A 3GLFB 3A1CA 3N53A 2Q27A 1BOFA 1PUJA 3ER6A 3L7JA 5FBQB 3F2VA 3RRNA 4ESHA 1Y8RA 1BW9A 1GV1A 4AZ3B 4BNTA 4EPWA 4Q12A 4WASA 2FF7A 4DIFA 4NFHA 1RM0A 1Z6YA 4RDHA 3QMWA 1C3OB 3IKMB 1W36B 3ANYB 4ILEA 4URWR 1MJ5A 2XAAA 4LBVA 2ZDHA 1Z26A 4ECVA 3ROEA 5JLJA 3N44B 4ZCSA 1JQJC 5JSZB 1KH2A 3QE4A 4GHWA 5KQGA 1FA9A 2PSFA 4E2FA 5J2TA 1UXGA 1VHTA 1EGMB 4ZAGA 5CX1A 5DBEX 4QEDA 5DYTA 3B2EA 3R9IA 3OLQA 4G84A 3KETA 3CH4B 4IR1A 1EEXB 1R37A 2MSEB 3DE1X 2ES4A 3DWEX 3QZ8A 4RMNA 3GPLA 2EGGA 3CSDA 4E70A 4RFSB 4EY8A 3ZDQA 1FFAA 2OOKA 3ENZA 1KZ4A 5JRZA 1JUDA 5ICSA 3KU4A 2QYSA 3GNSA 2GSDA 3RUFA 2P7HA 3S6JA 1IY2A 1FX0A 2AFIA 2VDWB 4TRMA 2OHOA 3BCHA 1Z12A 3L0IB 3PYMA 1M2EA 2R1UA 2IHNA 2E5FA 3B6MA 5TS2A 1YZ3A 4RK0A 1CUCA 1W0KD 4C7JA 3HU3A 1AUXA 2Z04A 1QFSA 4UJ3A 3VPAA 1R8SA 2EIHA 4DUYB 1E1CA 4KCGA 4Z7NB 1MHTA 1XK5A 3F9CA 4RMGA 4DBLE 4BAGA 5L3VA 3Q9NA 3UJ9A 1MC1A 1A9TA 1T10A 4PXAA 3G2KA 4KDCA 3QPCA 2O0KA 1BXZA 1E32A 3C6BA 2QQEA 3RAJA 1UFOA 4C21A 1KEUA 2WJIA 1MGOA 4NMXB 4A8JA 1SB8A 3EE6A 5EZ5A 3OZ7A 3VPBA 3K5WA 1MIHA 4X8HA 1J2JA 1N77A 2ZUTA 1NQ5A 2BEUA 1KEEA 4L4XA 3ZNQA 3EMBA 2GCIA 2PGIA 1JIIA 3A32A 1T9BA 1YIOA 3REOA 3W06A 2W2NA 3L01A 5GZ3A 3LXXA 4TV9F 1CY6A 3JVUA 4HUQB 4KRYA 4U7GA 2HDKA 3UOGA 3KYHC 5ESDA 5KYGA 3VAAA 1ZHSA 4M21A 3WB1A 4A6PA 1KOGA 2D2XA 2PX2A 2YFQA 3IDFA 1IMJA 2ZAMA 4I9HA 4PFSA 4EL0A 4ALIA 1GOTA 2O2SA 4EG1A 1Y3HA 1WEKA 1NJ6A 4YMGA 1X7ZA 3EXEB 5BQ5A 1ND5A 1OSNA 1RBMA 3ZXSA 1M2KA 3PNVA 1UBNA 1VB5A 2J0QA 5BQXA 3CG4A 3UPDA 1U5CA 4YNBA 4LF5H 3BWEA 3KQHA 2R65A 3A1FA 4JLWA 4JUIA 3Q3CA 2CDRA 2QMQA 5A9RA 1ZCBA 2WT4A 1UKZA 1X0XA 2IH2A 4BXOB 1PUIA 2PWBA 3QYFA 3NYQA 1BEZA 3IR7A 3ZZMA 1E0DA 1PEDA 5M04A 3B7WA 1Y6FA 2Q6VA 2IYXA 2X58A 4Q7JB 4DOMA 1Z13A 4NU6A 4R2LA 3IS3A 1AMNA 4BP9A 3GTKA 2GPAA 1I2ZA 2JLAA 3UHAA 5EJFA 3L43A 1LCIA 1TEXA 3RRZA 2FK2A 2C94A 4ZJZA 4PE5B 1QZXA 5GZ6A 2HQ1A 3BORA 3K1AA 3C3AA 4GBED 1IDOA 1YFKA 1ZVMA 4NJMA 4WINA 2QUBA 1GWNA 1IBSA 2JVJA 4P2GA 1WE2A 5AVRA 3FCUB 1EX6A 2AG0A 2I34A 5BNZA 4XWYA 5EJ6A 1IL0A 3LUAA 5FYQA 1CX9B 1XRMA 1Z34A 3RK4A 1YZQA 5CM2Z 1KQPA 1T4CB 1ISSA 3UAOA 1M7BA 2I9PA 3AR3A 3I9MA 3V3TA 4ED8A 3QKIA 2QZ4A 1Z83A 2PLWA 4GLJA 3LXMA 4A5OA 5KG1A 2JZOA 4LZNA 1V3VA 2H5JA 1SVKA 5KFYA 2GEUA 3EXG1 1A82A 3ZEIA 2VUGA 4EPRA 1XBTA 3ETNA 1FRFS 2EJVA 4Z9AA 3HCPA 4XVUA 1UZNA 4MS1B 3KPUA 4D97A 3DD5A 3HU5A 2JLXA 2QXYA 4OGFA 5C5IA 3IXLA 1RE1A 3Q7EA 4QYIA 3GMSA 1KJQA 4RA9B 4A36A 1W8IA 3DB2A 1OVMA 2ZXFA 3QVUA 5HBRB 4L9SA 3OZGA 1AV7A 2PL9A 3MLBA 3V1LA 2FF5A 1VGRA 1IAVA 4P7KA 2RH4A 1CUEA 4ID9A 2ZT5A 3MJ4A 5E6SA 4TSKA 3P9KA 4DG9A 3N9IA 2QVGA 1PHRA 5DCLA 1XXHE 5BQ3A 4V03A 4J9LA 2IF2A