2EIYA

Crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
305
structure length
297
Chain Sequence
b'QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Branched-chain amino acid aminotransferase
publication title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase Complexed with 4-Methylvaleric Acid
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 100
structure length 297
sequence length 305
chains with identical sequence B, C
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2eiyA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2eiyA01
4CE5A 2HGXA 3DTGA 5DAAA 4PBCA 3LQSA 5I5XA 5FR9A 3QQMA 4DAAA 3UZOA 5CE8A 2HDKA 2EIYA 5BWRA 1KTAA 5I5UA 4CMDA 5BWUA 5BWTA 5I60A 5HNEA 1EKPA 3CSWA 4CHIA 1DAAA 2DAAA 2ZGIA 2EJ0A 4CMFA 2ABJA 3WWJA 4TM5A 4DQNA 1I1KA 4JXUA 2DABA 1A3GA 1EKFA 5CM0A 4M0JA 1WRVA 1EKVA 1KT8A 3HT5A 2COIA 5I5TA 4UUGA 5I5YA 1I2KA 5BWWA 4K6NA 1IYDA 1G2WA 4WHXA 2EJ2A 2HHFA 3WWIA 5BWXA 1A0GA 3CEBA 5K3WA 3UYYA 2HG8A 4TVIA 2COJA 2EJ3A 1I1MA 3WWHA 5BWVA 2Y4RA 1I2LA 1ET0A 2COGA 3LULA 2A1HA 2HHFB 3UZBA 3DTFA 3SNOA 2HGWA 3U0GA 5I5VA 1I1LA 5I5WA 3DAAA 5E25A 3JZ6A 5CR5A 1IYEA 5I5SA
chains in the Genus database with same CATH superfamily
2QB5A 2VQDA 1TA8A 1CKNA 3KYHC 2Q7DA 2HVQA 2ZDHA 4DIMA 3QQMA 3L2PA 2XD4A 4NYEA 2HDKA 1OBDA 4O7LA 1P16A 4FFNA 3CSWA 2YRXA 4GLWA 4L1KA 1KBLA 5DGIA 5GONF 2ZGIA 3W1GA 3WNZA 1T36A 4M9UA 3WWJA 4MV3A 4TM5A 4LH7A 1CKNB 2CNQA 2NU7B 5DMXA 3HBLA 1M0WA 3JRXA 3W1BA 3UQ8A 2R86A 4UCSA 1C30A 2C00A 1V9PA 1KT8A 4EEQA 2Z02A 2YW2A 2V59A 4UUGA 5J2UF 5HBRB 1IYDA 5IYZF 4YJ3F 1KJQA 3R5FA 2I8CA 4MV4A 1Z2NX 5BWXA 1KJIA 5FPRA 4XZ3B 5DISC 1GSAA 4NZNA 3TQTA 1WR2A 4YAJB 4RZQA 4TVIA 4NZOA 5HV6A 3T9BA 4FE2A 5FNVF 1I7LA 1AUXA 2W6OA 2I87A 2I80A 2Y4RA 4I4TF 3T7AA 3KAKA 4CKCA 4MV6A 4O7RA 5D1OA 3V4ZA 2COGA 1XDNA 3LULA 3GB8B 3ETHA 3RR5A 5C1PA 2Q2UA 4Q4CA 2HVRA 2R84A 5DGHA 3VMMA 3U0GA 3LP8A 1M0TA 4O7SA 4MV1A 2YWVA 4ZI7F 3U55A 3KALA 4O83A 1OBGA 4I55F 4O2AF 3TEKA 1CKMA 2HIVA 4O82A 3OUUA 2HGXA 3RV4A 5DAAA 5BYBA 5K2MA 4PBCA 3BABA 4FFLA 4HNUA 4DRFA 3TY9A 5CE8A 2EIYA 1CE8A 1EUDB 3VOTA 5J2TF 4EGQA 5I5UA 5BPFA 3GIDA 3HO8A 5I60A 5HNEA 2GLTA 1EKPA 3T54A 3PN1A 3T99A 3ETJA 3MWDA 1IOWA 3G8CA 1DAAA 2DAAA 3K3PA 1E4EA 4CKEA 4CMFA 1A0IA 4O7ZA 5KX5F 2Q2TA 1FVIA 3RFCA 5LYJF 1I1KA 4ME6A 4JXUA 5CA0F 1KEEA 2DABA 3TW7A 5CM0A 4M0JA 1JDEA 1EKVA 3JSLA 4IIJF 5C1OA 5CAEB 5JQGF 1CKOA 5I5TA 5I5YA 5BWWA 2W6PA 3R9RA 1E4EB 4I50F 4UCUA 4WHXA 3GDEA 2EJ2A 1ULZA 1DV1A 1EZ1A 2YYAA 3WWIA 1EUCB 1CS0A 4O86A 3W5OA 1AUVA 1DGSA 4XYMB 2ODTX 2W6ZA 3KAJA 3UYYA 4NZMA 1I7NA 4HN2A 1S68A 2VUGA 3BA8A 2CNVA 4E4TA 4FU0A 3T9EA 1I2LA 2QK4A 4Y8VB 1TAEA 2NU8B 1SCUB 3N8DA 3QWUA 4DLKA 4O4IF 3T9CA 3U9SA 3UZBA 4O4LF 2YZMA 4EQ5A 2HGWA 3JSNA 3DF7A 5I5VA 1VBHA 4FFRA 1BXRA 4FGRA 5E25A 4IZOA 2FB9A 3GJXB 2HGSA 3VPCA 4UCTA 2YZLA 5JVDF 2OWOA 1UC8A 4GLXA 2OLSA 2R87A 3Q1KA 5EZYF 3BG5A 3U54A 1GGOA 2HVSA 4CE5A 4TV8F 1JLLB 3UFXB 4CKBA 5FR9A 1Z2OX 4MV8A 4EG0A 1KC7A 3UZOA 2YS6A 4MA0A 2W6NA 3NBZB 5BWRA 1W96A 3R23A 4TUYF 4C5AA 2W6QA 3S24A 3HB9A 4CMDA 3TIGA 3RUPA 3T9AA 1X9NA 1GLVA 4CHIA 4HR7A 4IHJF 3MWEA 2X0SA 3RV3A 2EJ0A 1KJ8A 4O7WA 3WO0A 1GSHA 4MAMA 5D1OB 3T9FA 1Z2PX 2FP4B 1A3GA 2R7MA 4MA5A 2YL2A 3TY5A 1WRVA 3U9TA 1PK8A 1VKZA 4O4JF 2IP4A 5KS8A 1EYZA 1PX2A 3HT5A 2J9GA 4YJ2F 2W70A 2WYOA 2YZNA 2W71A 3VPDA 5KKNB 2PN1A 1GSOA 1VBGA 1JKJB 4ZOLF 5LA6F 5BMVF 4K6NA 4PZ8A 1B6RA 2Z04A 4EGJA 1CQJB 1G2WA 2R82A 4IWXA 2YS7A 2HHFA 1P8LA 2FPGB 4FFOA 3K5HA 2V5AA 3SE7A 1EHIA 4O7VA 2GQRA 3CEBA 3R5XA 5CB4F 2HG8A 2COJA 4YBZB 4WBNF 3T9DA 3PFFA 3KREA 5BYAA 4O81A 1B6SA 5BWVA 2P0AA 1B04A 2DIKA 3AX6A 3NUAA 5JH7F 1A9XA 4E6NA 3E5NA 4EFEA 1ET0A 4ZHQF 3TINA 4C5CA 2A1HA 3N6RA 2HHFB 2FPIB 3DTFA 3SNOA 1DV2A 3NC0B 3R5HA 4HQ6A 4UCVA 1I1LA 5I5WA 2CNUA 1KJ9A 3VA7A 2VPQA 4UCRA 3TY8A 1ZAUA 3SGIA 4RCNA 3WO1A 2NUAB 3QFFA 3DTGA 5C8YF 5JQWA 2HIXA 3LQSA 5I5XA 2V58A 4DAAA 4XYLB 4YAKB 3K5IA 4O7YA 3NBYB 1KTAA 2YRWA 3LWBA 4FFMA 2PBZA 2DZDA 5BWUA 5BWTA 4O4HF 1C3OA 2PVPA 4HNTA 2HJWA 4HNVA 3OUZA 2NU6B 2R7NA 4XX0B 3ORRA 2W6MA 2NU9B 3AW8A 5CA1F 1XK5A 2ZDGA 5LXTF 2ABJA 3G8DA 4DQNA 2X5RA 4UFZA 1EKFA 4YB8B 1KJJA 4O84A 4O7TA 1UC9A 3RTXA 4CC5A 5I47A 1JDBB 2COIA 3MJFA 1M6VA 2VR1A 1I2KA 2XCLA 2ZDQA 4ZQIA 3V4SA 1VS0A 2DWCA 5H80A 3VNNA 5BPHA 4MV7A 4FFPA 1IOVA 3JZIA 3GLKA 2SCUB 4CC6A 3TW6A 2CZGA 5FPOA 3JRWA 3BAAA 3JZFA 1A0GA 5K3WA 2QF7A 3ORQA 2R7LA 2GPSA 2EJ3A 4PZ6A 1I1MA 4IWYA 3BACA 2GPWA 3WWHA 4UCOA 1BNCA 4O7NA 5D8DA 4EFBA 4O2BF 5LOVF 3TIIA 3I12A 4C5BA 1DIKA 4QSHA 2FPPB 2GQSA 4MV9A 5D1PA 3Q2OA 4PZ7A 4LH6A 2DLNA 3BA9A 5JVLA 3VPBA 4TV9F 1KUTA 3DAAA 2CFMA 3JZ6A 2YZGA 1CQIB 2R85A 1W93A 5LP6F 2R7KA 4Q4DA 1A48A 5CR5A 1IYEA 5I5SA
chains in the Genus database with same CATH topology
2QB5A 4CE5A 2Q7DA 2HGXA 4CKBA 3DTGA 5DAAA 5BYBA 5K2MA 4PBCA 3LQSA 5I5XA 5FR9A 3QQMA 4DAAA 3UZOA 5CE8A 2HDKA 2EIYA 5BWRA 1KTAA 5I5UA 4CMDA 5BWUA 5BWTA 5I60A 3T9AA 5HNEA 3T54A 1EKPA 3CSWA 3T99A 4CHIA 4GLWA 1DAAA 2DAAA 5DGIA 2ZGIA 2EJ0A 4CKEA 4CMFA 2ABJA 3WWJA 4TM5A 4DQNA 1I1KA 2X5RA 4JXUA 2DABA 3T9FA 1A3GA 1EKFA 3TW7A 5CM0A 4M0JA 1WRVA 1EKVA 1UC9A 1KT8A 5I47A 5KS8A 3HT5A 2COIA 3VPDA 5I5TA 4UUGA 5I5YA 1I2KA 5BWWA 4K6NA 1IYDA 1G2WA 4IWXA 4WHXA 2EJ2A 2HHFA 3WWIA 5BWXA 1A0GA 4NZNA 2ODTX 3CEBA 5K3WA 3UYYA 4NZMA 2HG8A 4TVIA 2COJA 2EJ3A 4HN2A 1I1MA 4IWYA 3BACA 4NZOA 3T9DA 3PFFA 3T9BA 3WWHA 5BYAA 5BWVA 3T9EA 2Y4RA 1I2LA 3T7AA 4CKCA 1ET0A 2COGA 3LULA 2A1HA 3T9CA 4Q4CA 2HHFB 3UZBA 5DGHA 3DTFA 3SNOA 2HGWA 3U0GA 5I5VA 1I1LA 5I5WA 3DAAA 5E25A 3JZ6A 1ZAUA 3SGIA 1UC8A 4Q4DA 3TEKA 4RCNA 5CR5A 1IYEA 5I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE5 A;  2HGX A;  3DTG A;  5DAA A;  4PBC A;  3LQS A;  5I5X A;  5FR9 A;  3QQM A;  4DAA A;  3UZO A;  5CE8 A;  2HDK A;  2EIY A;  5BWR A;  1KTA A;  5I5U A;  4CMD A;  5BWU A;  5BWT A;  5I60 A;  5HNE A;  1EKP A;  3CSW A;  4CHI A;  1DAA A;  2DAA A;  2ZGI A;  2EJ0 A;  4CMF A;  2ABJ A;  3WWJ A;  4TM5 A;  4DQN A;  1I1K A;  4JXU A;  2DAB A;  1A3G A;  1EKF A;  5CM0 A;  4M0J A;  1WRV A;  1EKV A;  1KT8 A;  3HT5 A;  2COI A;  5I5T A;  4UUG A;  5I5Y A;  1I2K A;  5BWW A;  4K6N A;  1IYD A;  1G2W A;  4WHX A;  2EJ2 A;  2HHF A;  3WWI A;  5BWX A;  1A0G A;  3CEB A;  5K3W A;  3UYY A;  2HG8 A;  4TVI A;  2COJ A;  2EJ3 A;  1I1M A;  3WWH A;  5BWV A;  2Y4R A;  1I2L A;  1ET0 A;  2COG A;  3LUL A;  2A1H A;  2HHF B;  3UZB A;  3DTF A;  3SNO A;  2HGW A;  3U0G A;  5I5V A;  1I1L A;  5I5W A;  3DAA A;  5E25 A;  3JZ6 A;  5CR5 A;  1IYE A;  5I5S A; 
#chains in the Genus database with same CATH topology
 2QB5 A;  2VQD A;  1TA8 A;  1CKN A;  3KYH C;  2Q7D A;  2HVQ A;  2ZDH A;  4DIM A;  3QQM A;  3L2P A;  2XD4 A;  4NYE A;  2HDK A;  1OBD A;  4O7L A;  1P16 A;  4FFN A;  3CSW A;  2YRX A;  4GLW A;  4L1K A;  1KBL A;  5DGI A;  5GON F;  2ZGI A;  3W1G A;  3WNZ A;  1T36 A;  4M9U A;  3WWJ A;  4MV3 A;  4TM5 A;  4LH7 A;  1CKN B;  2CNQ A;  2NU7 B;  5DMX A;  3HBL A;  1M0W A;  3JRX A;  3W1B A;  3UQ8 A;  2R86 A;  4UCS A;  1C30 A;  2C00 A;  1V9P A;  1KT8 A;  4EEQ A;  2Z02 A;  2YW2 A;  2V59 A;  4UUG A;  5J2U F;  5HBR B;  1IYD A;  5IYZ F;  4YJ3 F;  1KJQ A;  3R5F A;  2I8C A;  4MV4 A;  1Z2N X;  5BWX A;  1KJI A;  5FPR A;  4XZ3 B;  5DIS C;  1GSA A;  4NZN A;  3TQT A;  1WR2 A;  4YAJ B;  4RZQ A;  4TVI A;  4NZO A;  5HV6 A;  3T9B A;  4FE2 A;  5FNV F;  1I7L A;  1AUX A;  2W6O A;  2I87 A;  2I80 A;  2Y4R A;  4I4T F;  3T7A A;  3KAK A;  4CKC A;  4MV6 A;  4O7R A;  5D1O A;  3V4Z A;  2COG A;  1XDN A;  3LUL A;  3GB8 B;  3ETH A;  3RR5 A;  5C1P A;  2Q2U A;  4Q4C A;  2HVR A;  2R84 A;  5DGH A;  3VMM A;  3U0G A;  3LP8 A;  1M0T A;  4O7S A;  4MV1 A;  2YWV A;  4ZI7 F;  3U55 A;  3KAL A;  4O83 A;  1OBG A;  4I55 F;  4O2A F;  3TEK A;  1CKM A;  2HIV A;  4O82 A;  3OUU A;  2HGX A;  3RV4 A;  5DAA A;  5BYB A;  5K2M A;  4PBC A;  3BAB A;  4FFL A;  4HNU A;  4DRF A;  3TY9 A;  5CE8 A;  2EIY A;  1CE8 A;  1EUD B;  3VOT A;  5J2T F;  4EGQ A;  5I5U A;  5BPF A;  3GID A;  3HO8 A;  5I60 A;  5HNE A;  2GLT A;  1EKP A;  3T54 A;  3PN1 A;  3T99 A;  3ETJ A;  3MWD A;  1IOW A;  3G8C A;  1DAA A;  2DAA A;  3K3P A;  1E4E A;  4CKE A;  4CMF A;  1A0I A;  4O7Z A;  5KX5 F;  2Q2T A;  1FVI A;  3RFC A;  5LYJ F;  1I1K A;  4ME6 A;  4JXU A;  5CA0 F;  1KEE A;  2DAB A;  3TW7 A;  5CM0 A;  4M0J A;  1JDE A;  1EKV A;  3JSL A;  4IIJ F;  5C1O A;  5CAE B;  5JQG F;  1CKO A;  5I5T A;  5I5Y A;  5BWW A;  2W6P A;  3R9R A;  1E4E B;  4I50 F;  4UCU A;  4WHX A;  3GDE A;  2EJ2 A;  1ULZ A;  1DV1 A;  1EZ1 A;  2YYA A;  3WWI A;  1EUC B;  1CS0 A;  4O86 A;  3W5O A;  1AUV A;  1DGS A;  4XYM B;  2ODT X;  2W6Z A;  3KAJ A;  3UYY A;  4NZM A;  1I7N A;  4HN2 A;  1S68 A;  2VUG A;  3BA8 A;  2CNV A;  4E4T A;  4FU0 A;  3T9E A;  1I2L A;  2QK4 A;  4Y8V B;  1TAE A;  2NU8 B;  1SCU B;  3N8D A;  3QWU A;  4DLK A;  4O4I F;  3T9C A;  3U9S A;  3UZB A;  4O4L F;  2YZM A;  4EQ5 A;  2HGW A;  3JSN A;  3DF7 A;  5I5V A;  1VBH A;  4FFR A;  1BXR A;  4FGR A;  5E25 A;  4IZO A;  2FB9 A;  3GJX B;  2HGS A;  3VPC A;  4UCT A;  2YZL A;  5JVD F;  2OWO A;  1UC8 A;  4GLX A;  2OLS A;  2R87 A;  3Q1K A;  5EZY F;  3BG5 A;  3U54 A;  1GGO A;  2HVS A;  4CE5 A;  4TV8 F;  1JLL B;  3UFX B;  4CKB A;  5FR9 A;  1Z2O X;  4MV8 A;  4EG0 A;  1KC7 A;  3UZO A;  2YS6 A;  4MA0 A;  2W6N A;  3NBZ B;  5BWR A;  1W96 A;  3R23 A;  4TUY F;  4C5A A;  2W6Q A;  3S24 A;  3HB9 A;  4CMD A;  3TIG A;  3RUP A;  3T9A A;  1X9N A;  1GLV A;  4CHI A;  4HR7 A;  4IHJ F;  3MWE A;  2X0S A;  3RV3 A;  2EJ0 A;  1KJ8 A;  4O7W A;  3WO0 A;  1GSH A;  4MAM A;  5D1O B;  3T9F A;  1Z2P X;  2FP4 B;  1A3G A;  2R7M A;  4MA5 A;  2YL2 A;  3TY5 A;  1WRV A;  3U9T A;  1PK8 A;  1VKZ A;  4O4J F;  2IP4 A;  5KS8 A;  1EYZ A;  1PX2 A;  3HT5 A;  2J9G A;  4YJ2 F;  2W70 A;  2WYO A;  2YZN A;  2W71 A;  3VPD A;  5KKN B;  2PN1 A;  1GSO A;  1VBG A;  1JKJ B;  4ZOL F;  5LA6 F;  5BMV F;  4K6N A;  4PZ8 A;  1B6R A;  2Z04 A;  4EGJ A;  1CQJ B;  1G2W A;  2R82 A;  4IWX A;  2YS7 A;  2HHF A;  1P8L A;  2FPG B;  4FFO A;  3K5H A;  2V5A A;  3SE7 A;  1EHI A;  4O7V A;  2GQR A;  3CEB A;  3R5X A;  5CB4 F;  2HG8 A;  2COJ A;  4YBZ B;  4WBN F;  3T9D A;  3PFF A;  3KRE A;  5BYA A;  4O81 A;  1B6S A;  5BWV A;  2P0A A;  1B04 A;  2DIK A;  3AX6 A;  3NUA A;  5JH7 F;  1A9X A;  4E6N A;  3E5N A;  4EFE A;  1ET0 A;  4ZHQ F;  3TIN A;  4C5C A;  2A1H A;  3N6R A;  2HHF B;  2FPI B;  3DTF A;  3SNO A;  1DV2 A;  3NC0 B;  3R5H A;  4HQ6 A;  4UCV A;  1I1L A;  5I5W A;  2CNU A;  1KJ9 A;  3VA7 A;  2VPQ A;  4UCR A;  3TY8 A;  1ZAU A;  3SGI A;  4RCN A;  3WO1 A;  2NUA B;  3QFF A;  3DTG A;  5C8Y F;  5JQW A;  2HIX A;  3LQS A;  5I5X A;  2V58 A;  4DAA A;  4XYL B;  4YAK B;  3K5I A;  4O7Y A;  3NBY B;  1KTA A;  2YRW A;  3LWB A;  4FFM A;  2PBZ A;  2DZD A;  5BWU A;  5BWT A;  4O4H F;  1C3O A;  2PVP A;  4HNT A;  2HJW A;  4HNV A;  3OUZ A;  2NU6 B;  2R7N A;  4XX0 B;  3ORR A;  2W6M A;  2NU9 B;  3AW8 A;  5CA1 F;  1XK5 A;  2ZDG A;  5LXT F;  2ABJ A;  3G8D A;  4DQN A;  2X5R A;  4UFZ A;  1EKF A;  4YB8 B;  1KJJ A;  4O84 A;  4O7T A;  1UC9 A;  3RTX A;  4CC5 A;  5I47 A;  1JDB B;  2COI A;  3MJF A;  1M6V A;  2VR1 A;  1I2K A;  2XCL A;  2ZDQ A;  4ZQI A;  3V4S A;  1VS0 A;  2DWC A;  5H80 A;  3VNN A;  5BPH A;  4MV7 A;  4FFP A;  1IOV A;  3JZI A;  3GLK A;  2SCU B;  4CC6 A;  3TW6 A;  2CZG A;  5FPO A;  3JRW A;  3BAA A;  3JZF A;  1A0G A;  5K3W A;  2QF7 A;  3ORQ A;  2R7L A;  2GPS A;  2EJ3 A;  4PZ6 A;  1I1M A;  4IWY A;  3BAC A;  2GPW A;  3WWH A;  4UCO A;  1BNC A;  4O7N A;  5D8D A;  4EFB A;  4O2B F;  5LOV F;  3TII A;  3I12 A;  4C5B A;  1DIK A;  4QSH A;  2FPP B;  2GQS A;  4MV9 A;  5D1P A;  3Q2O A;  4PZ7 A;  4LH6 A;  2DLN A;  3BA9 A;  5JVL A;  3VPB A;  4TV9 F;  1KUT A;  3DAA A;  2CFM A;  3JZ6 A;  2YZG A;  1CQI B;  2R85 A;  1W93 A;  5LP6 F;  2R7K A;  4Q4D A;  1A48 A;  5CR5 A;  1IYE A;  5I5S A; 
#chains in the Genus database with same CATH homology
 2QB5 A;  4CE5 A;  2Q7D A;  2HGX A;  4CKB A;  3DTG A;  5DAA A;  5BYB A;  5K2M A;  4PBC A;  3LQS A;  5I5X A;  5FR9 A;  3QQM A;  4DAA A;  3UZO A;  5CE8 A;  2HDK A;  2EIY A;  5BWR A;  1KTA A;  5I5U A;  4CMD A;  5BWU A;  5BWT A;  5I60 A;  3T9A A;  5HNE A;  3T54 A;  1EKP A;  3CSW A;  3T99 A;  4CHI A;  4GLW A;  1DAA A;  2DAA A;  5DGI A;  2ZGI A;  2EJ0 A;  4CKE A;  4CMF A;  2ABJ A;  3WWJ A;  4TM5 A;  4DQN A;  1I1K A;  2X5R A;  4JXU A;  2DAB A;  3T9F A;  1A3G A;  1EKF A;  3TW7 A;  5CM0 A;  4M0J A;  1WRV A;  1EKV A;  1UC9 A;  1KT8 A;  5I47 A;  5KS8 A;  3HT5 A;  2COI A;  3VPD A;  5I5T A;  4UUG A;  5I5Y A;  1I2K A;  5BWW A;  4K6N A;  1IYD A;  1G2W A;  4IWX A;  4WHX A;  2EJ2 A;  2HHF A;  3WWI A;  5BWX A;  1A0G A;  4NZN A;  2ODT X;  3CEB A;  5K3W A;  3UYY A;  4NZM A;  2HG8 A;  4TVI A;  2COJ A;  2EJ3 A;  4HN2 A;  1I1M A;  4IWY A;  3BAC A;  4NZO A;  3T9D A;  3PFF A;  3T9B A;  3WWH A;  5BYA A;  5BWV A;  3T9E A;  2Y4R A;  1I2L A;  3T7A A;  4CKC A;  1ET0 A;  2COG A;  3LUL A;  2A1H A;  3T9C A;  4Q4C A;  2HHF B;  3UZB A;  5DGH A;  3DTF A;  3SNO A;  2HGW A;  3U0G A;  5I5V A;  1I1L A;  5I5W A;  3DAA A;  5E25 A;  3JZ6 A;  1ZAU A;  3SGI A;  1UC8 A;  4Q4D A;  3TEK A;  4RCN A;  5CR5 A;  1IYE A;  5I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...