2EIYA

Crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
305
structure length
297
Chain Sequence
QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase Complexed with 4-Methylvaleric Acid
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Branched-chain amino acid aminotransferase
total genus 100
structure length 297
sequence length 305
chains with identical sequence B, C
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2eiyA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2eiyA01
5I5TA 3LULA 3CSWA 2HDKA 3UZBA 5I5XA 1IYDA 5K3WA 1ET0A 1I1LA 4CMDA 2DABA 3WWJA 1WRVA 2COJA 5CR5A 1DAAA 4UUGA 5BWUA 3U0GA 5CM0A 3WWIA 5I5UA 5I60A 1I2LA 1EKPA 1I1MA 2HHFB 1A0GA 1EKFA 2DAAA 4CMFA 3UZOA 5I5VA 2Y4RA 5I5SA 5BWTA 3UYYA 5I5YA 1I1KA 1IYEA 4TVIA 3JZ6A 4CE5A 2HGWA 5HNEA 2EIYA 1A3GA 5I5WA 4WHXA 1KTAA 3CEBA 2EJ2A 4JXUA 5E25A 5CE8A 5BWVA 3SNOA 4CHIA 2EJ0A 2HHFA 1EKVA 4M0JA 3DTFA 1KT8A 2A1HA 2HGXA 1I2KA 2COGA 2ABJA 5BWXA 4K6NA 5FR9A 4DAAA 3QQMA 5BWRA 5DAAA 5BWWA 3LQSA 4DQNA 3DTGA 3WWHA 1G2WA 2ZGIA 2EJ3A 3DAAA 2HG8A 4PBCA 2COIA 3HT5A 4TM5A
chains in the Genus database with same CATH superfamily
5I5TA 1KJIA 2V59A 4FFMA 4L1KA 2I87A 3LP8A 1GSHA 3CSWA 3UZBA 3RR5A 3PN1A 4C5CA 4LH6A 1UC9A 4C5AA 3TQTA 3NUAA 2XD4A 1KEEA 4CMDA 2DABA 4RCNA 2YS6A 4TUYF 1B04A 5DGIA 3KAJA 2Z02A 4HNUA 2CNQA 2R7KA 2DLNA 3E5NA 3AW8A 4EQ5A 3GLKA 1DV1A 5CM0A 2Z04A 3PFFA 3VMMA 5I5UA 3K5HA 2HHFB 1IOVA 2I80A 2R86A 3NC0B 4CMFA 2NU9B 2GLTA 1JKJB 4O84A 3TINA 5JVLA 1CKNB 1I1KA 4TVIA 3JZ6A 1X9NA 1BNCA 4HNTA 2HGWA 5HNEA 2R7LA 1KJQA 1KJ8A 1TAEA 3LWBA 4YAJB 4PZ8A 3JSNA 1TA8A 4DIMA 5IYZF 3MWDA 2ZDGA 2NUAB 3V4SA 3KYHC 1CQIB 2QF7A 1E4EA 3R5FA 1JDEA 4Q4CA 1XK5A 5I47A 2HHFA 2R82A 3HB9A 1Z2PX 3T9BA 3BA9A 4M0JA 3TW6A 3BA8A 4UCUA 2A1HA 5J2TF 4CKCA 1SCUB 4FFNA 1I2KA 3RFCA 4O4JF 2HVSA 5K2MA 1CE8A 5LXTF 4EG0A 2HGSA 5FR9A 4O7RA 3BACA 4MV4A 4CKEA 5C1PA 2CFMA 4C5BA 1CKMA 2GQRA 3DTGA 1CQJB 1G2WA 3W5OA 4M9UA 4HNVA 4NYEA 2X0SA 2HG8A 3LULA 1JLLB 4MV7A 2HDKA 4EGJA 1B6SA 1KJJA 4XYMB 2YW2A 4GLXA 5K3WA 2W6ZA 5JQGF 2W6PA 2W6OA 1ULZA 2HIVA 4XZ3B 3NBYB 2I8CA 3BABA 1PX2A 2R7NA 1CKOA 2P0AA 2ZDQA 1DGSA 1FVIA 1A48A 1GLVA 2YWVA 3DF7A 1KUTA 3KALA 3T9AA 5FPOA 3Q1KA 4UUGA 3U0GA 5CB4F 3TEKA 4O2BF 3RV4A 2NU8B 3ETHA 5I60A 3VPDA 4DLKA 4UCVA 2DAAA 1EYZA 2W6QA 2HVQA 4YAKB 3UZOA 5BWTA 4FFOA 3K3PA 1IYEA 1M6VA 2YS7A 5I5WA 1Z2OX 4MA5A 1KTAA 1Z2NX 2EJ2A 2GQSA 3T9CA 5BWVA 1I7NA 4EGQA 2W6MA 3L2PA 1EUDB 4CHIA 3RV3A 2NU6B 4O7VA 4MV6A 3U9TA 3RUPA 4YB8B 4EFBA 3QWUA 5LYJF 2YRWA 1S68A 4Y8VB 2VUGA 2WYOA 4FFRA 3W1BA 3KAKA 4UCRA 2C00A 4QSHA 2Q7DA 2PVPA 3OUZA 4EFEA 5BWWA 1WR2A 2DZDA 4O81A 1A9XA 5C1OA 4DQNA 3WWHA 4O7YA 4HN2A 2PN1A 3R5XA 2ZGIA 3ORRA 3I12A 3HO8A 3TY8A 3KREA 3TY9A 3U54A 4IWYA 4GLWA 3G8DA 3HT5A 4WBNF 5D1OA 4MA0A 3MWEA 5LOVF 2YZGA 4UCTA 1IYDA 5DMXA 3TY5A 3T7AA 4DRFA 3TIGA 4E4TA 1CS0A 4YJ2F 1ET0A 5D1PA 2FPGB 1GSAA 4IWXA 3VNNA 3WWJA 4O82A 3NBZB 5BMVF 1WRVA 3JZFA 1C30A 4FE2A 2YZLA 1T36A 2OWOA 1DAAA 5BWUA 1AUXA 5D1OB 3WWIA 1I2LA 4RZQA 1EKPA 1I1MA 3U9SA 5FNVF 3T9EA 2HIXA 3JRWA 5KX5F 4MV1A 5I5VA 4XYLB 5I5SA 3UYYA 3JRXA 4I4TF 2FB9A 5CA0F 4MAMA 4O7ZA 1M0WA 4MV8A 4XX0B 5J2UF 4CE5A 3SE7A 4IIJF 3TW7A 3JSLA 4FU0A 1VS0A 3CEBA 4JXUA 4E6NA 5E25A 3W1GA 5C8YF 5JVDF 1AUVA 3OUUA 3MJFA 3ORQA 2YZNA 4O83A 4O7NA 5LA6F 3R9RA 4CKBA 4ZI7F 3RTXA 5HBRB 2EJ0A 4TV9F 4TV8F 4LH7A 1EKVA 2FPIB 2R84A 1DV2A 3G8CA 1GSOA 3R23A 2CNUA 3T9DA 3S24A 3T54A 2HGXA 3T9FA 2Q2TA 5KS8A 4HQ6A 2ABJA 1UC8A 3UFXB 3ETJA 1DIKA 2DIKA 2YZMA 4IZOA 1VBHA 4O4HF 4ZHQF 4K6NA 5KKNB 1KC7A 4DAAA 5BYAA 5BWRA 2CNVA 1W93A 5HV6A 3LQSA 3QFFA 4O7WA 4FFPA 5D8DA 1XDNA 2W6NA 4O2AF 1C3OA 2FP4B 2EJ3A 3UQ8A 5JH7F 4PBCA 3BAAA 4TM5A 4ME6A 4I55F 4Q4DA 3U55A 1P16A 5I5XA 1IOWA 2DWCA 1OBGA 2SCUB 2YYAA 1KBLA 2FPPB 3GIDA 2V5AA 1I1LA 2W70A 2HJWA 3VPCA 1VBGA 3Q2OA 2HVRA 4UFZA 4PZ6A 3AX6A 1W96A 4IHJF 3N6RA 2ODTX 3BG5A 4UCOA 2COJA 1I7LA 1V9PA 2YRXA 5CR5A 4HR7A 3R5HA 3VA7A 2QB5A 4I50F 3JZIA 4FFLA 1PK8A 5EZYF 5H80A 3GJXB 4CC6A 1A0GA 4MV9A 3GB8B 5LP6F 2VQDA 1EKFA 1VKZA 4O4LF 4MV3A 3VPBA 5BPFA 2Y4RA 2GPSA 5DGHA 3WO0A 5I5YA 4PZ7A 2GPWA 4ZQIA 2OLSA 4O7SA 2CZGA 3K5IA 2J9GA 2EIYA 1EHIA 1OBDA 1A3GA 4WHXA 1BXRA 5CE8A 1JDBB 2R87A 4FGRA 1ZAUA 2R7MA 2ZDHA 2PBZA 5BPHA 2Q2UA 3SNOA 4NZMA 5BYBA 4NZNA 4O7LA 1B6RA 4O4IF 4O7TA 2NU7B 2IP4A 2VPQA 3VOTA 1KJ9A 1EZ1A 4CC5A 3DTFA 1E4EB 4YJ3F 1KT8A 5JQWA 2YL2A 1EUCB 3N8DA 2COGA 3WNZA 5BWXA 2X5RA 5FPRA 3TIIA 4UCSA 4NZOA 2VR1A 3QQMA 5DAAA 4EEQA 1M0TA 5CA1F 4ZOLF 3SGIA 3GDEA 1GGOA 1P8LA 1CKNA 5DISC 2V58A 2XCLA 2W71A 2R85A 4YBZB 3V4ZA 3DAAA 1A0IA 5CAEB 3HBLA 4O86A 5GONF 2COIA 3T99A 3WO1A 2QK4A
chains in the Genus database with same CATH topology
5I5TA 3LULA 4Q4DA 3CSWA 2HDKA 3UZBA 5I5XA 1IYDA 5K3WA 1UC9A 3T7AA 1ET0A 1I1LA 4CMDA 4IWXA 2DABA 3WWJA 4RCNA 2ODTX 1WRVA 5DGIA 2COJA 3T9AA 5CR5A 1DAAA 4UUGA 5BWUA 3U0GA 3TEKA 2QB5A 5CM0A 3PFFA 3WWIA 5I5UA 5I60A 1I2LA 1EKPA 1I1MA 2HHFB 1A0GA 3VPDA 1EKFA 2DAAA 3T9EA 4CMFA 3UZOA 5I5VA 2Y4RA 5I5SA 5BWTA 3UYYA 5DGHA 5I5YA 1I1KA 1IYEA 4TVIA 3JZ6A 4CE5A 2HGWA 5HNEA 2EIYA 3TW7A 1A3GA 5I5WA 4WHXA 1KTAA 3CEBA 2EJ2A 4JXUA 5E25A 5CE8A 3T9CA 5BWVA 1ZAUA 3SNOA 4CHIA 4NZMA 5BYBA 4CKBA 4NZNA 4Q4CA 2EJ0A 5I47A 2HHFA 3T9BA 1EKVA 4M0JA 3DTFA 1KT8A 2A1HA 3T9DA 3T54A 2HGXA 3T9FA 4CKCA 5KS8A 1I2KA 2COGA 2ABJA 1UC8A 5BWXA 2X5RA 5K2MA 2Q7DA 4NZOA 4K6NA 5FR9A 4DAAA 3QQMA 5BYAA 3BACA 5BWRA 5DAAA 5BWWA 4CKEA 3LQSA 3SGIA 4DQNA 3DTGA 3WWHA 4HN2A 1G2WA 2ZGIA 2EJ3A 3DAAA 4IWYA 2HG8A 4PBCA 4GLWA 2COIA 3HT5A 3T99A 4TM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5T A;  3LUL A;  3CSW A;  2HDK A;  3UZB A;  5I5X A;  1IYD A;  5K3W A;  1ET0 A;  1I1L A;  4CMD A;  2DAB A;  3WWJ A;  1WRV A;  2COJ A;  5CR5 A;  1DAA A;  4UUG A;  5BWU A;  3U0G A;  5CM0 A;  3WWI A;  5I5U A;  5I60 A;  1I2L A;  1EKP A;  1I1M A;  2HHF B;  1A0G A;  1EKF A;  2DAA A;  4CMF A;  3UZO A;  5I5V A;  2Y4R A;  5I5S A;  5BWT A;  3UYY A;  5I5Y A;  1I1K A;  1IYE A;  4TVI A;  3JZ6 A;  4CE5 A;  2HGW A;  5HNE A;  2EIY A;  1A3G A;  5I5W A;  4WHX A;  1KTA A;  3CEB A;  2EJ2 A;  4JXU A;  5E25 A;  5CE8 A;  5BWV A;  3SNO A;  4CHI A;  2EJ0 A;  2HHF A;  1EKV A;  4M0J A;  3DTF A;  1KT8 A;  2A1H A;  2HGX A;  1I2K A;  2COG A;  2ABJ A;  5BWX A;  4K6N A;  5FR9 A;  4DAA A;  3QQM A;  5BWR A;  5DAA A;  5BWW A;  3LQS A;  4DQN A;  3DTG A;  3WWH A;  1G2W A;  2ZGI A;  2EJ3 A;  3DAA A;  2HG8 A;  4PBC A;  2COI A;  3HT5 A;  4TM5 A; 
#chains in the Genus database with same CATH topology
 5I5T A;  1KJI A;  2V59 A;  4FFM A;  4L1K A;  2I87 A;  3LP8 A;  1GSH A;  3CSW A;  3UZB A;  3RR5 A;  3PN1 A;  4C5C A;  4LH6 A;  1UC9 A;  4C5A A;  3TQT A;  3NUA A;  2XD4 A;  1KEE A;  4CMD A;  2DAB A;  4RCN A;  2YS6 A;  4TUY F;  1B04 A;  5DGI A;  3KAJ A;  2Z02 A;  4HNU A;  2CNQ A;  2R7K A;  2DLN A;  3E5N A;  3AW8 A;  4EQ5 A;  3GLK A;  1DV1 A;  5CM0 A;  2Z04 A;  3PFF A;  3VMM A;  5I5U A;  3K5H A;  2HHF B;  1IOV A;  2I80 A;  2R86 A;  3NC0 B;  4CMF A;  2NU9 B;  2GLT A;  1JKJ B;  4O84 A;  3TIN A;  5JVL A;  1CKN B;  1I1K A;  4TVI A;  3JZ6 A;  1X9N A;  1BNC A;  4HNT A;  2HGW A;  5HNE A;  2R7L A;  1KJQ A;  1KJ8 A;  1TAE A;  3LWB A;  4YAJ B;  4PZ8 A;  3JSN A;  1TA8 A;  4DIM A;  5IYZ F;  3MWD A;  2ZDG A;  2NUA B;  3V4S A;  3KYH C;  1CQI B;  2QF7 A;  1E4E A;  3R5F A;  1JDE A;  4Q4C A;  1XK5 A;  5I47 A;  2HHF A;  2R82 A;  3HB9 A;  1Z2P X;  3T9B A;  3BA9 A;  4M0J A;  3TW6 A;  3BA8 A;  4UCU A;  2A1H A;  5J2T F;  4CKC A;  1SCU B;  4FFN A;  1I2K A;  3RFC A;  4O4J F;  2HVS A;  5K2M A;  1CE8 A;  5LXT F;  4EG0 A;  2HGS A;  5FR9 A;  4O7R A;  3BAC A;  4MV4 A;  4CKE A;  5C1P A;  2CFM A;  4C5B A;  1CKM A;  2GQR A;  3DTG A;  1CQJ B;  1G2W A;  3W5O A;  4M9U A;  4HNV A;  4NYE A;  2X0S A;  2HG8 A;  3LUL A;  1JLL B;  4MV7 A;  2HDK A;  4EGJ A;  1B6S A;  1KJJ A;  4XYM B;  2YW2 A;  4GLX A;  5K3W A;  2W6Z A;  5JQG F;  2W6P A;  2W6O A;  1ULZ A;  2HIV A;  4XZ3 B;  3NBY B;  2I8C A;  3BAB A;  1PX2 A;  2R7N A;  1CKO A;  2P0A A;  2ZDQ A;  1DGS A;  1FVI A;  1A48 A;  1GLV A;  2YWV A;  3DF7 A;  1KUT A;  3KAL A;  3T9A A;  5FPO A;  3Q1K A;  4UUG A;  3U0G A;  5CB4 F;  3TEK A;  4O2B F;  3RV4 A;  2NU8 B;  3ETH A;  5I60 A;  3VPD A;  4DLK A;  4UCV A;  2DAA A;  1EYZ A;  2W6Q A;  2HVQ A;  4YAK B;  3UZO A;  5BWT A;  4FFO A;  3K3P A;  1IYE A;  1M6V A;  2YS7 A;  5I5W A;  1Z2O X;  4MA5 A;  1KTA A;  1Z2N X;  2EJ2 A;  2GQS A;  3T9C A;  5BWV A;  1I7N A;  4EGQ A;  2W6M A;  3L2P A;  1EUD B;  4CHI A;  3RV3 A;  2NU6 B;  4O7V A;  4MV6 A;  3U9T A;  3RUP A;  4YB8 B;  4EFB A;  3QWU A;  5LYJ F;  2YRW A;  1S68 A;  4Y8V B;  2VUG A;  2WYO A;  4FFR A;  3W1B A;  3KAK A;  4UCR A;  2C00 A;  4QSH A;  2Q7D A;  2PVP A;  3OUZ A;  4EFE A;  5BWW A;  1WR2 A;  2DZD A;  4O81 A;  1A9X A;  5C1O A;  4DQN A;  3WWH A;  4O7Y A;  4HN2 A;  2PN1 A;  3R5X A;  2ZGI A;  3ORR A;  3I12 A;  3HO8 A;  3TY8 A;  3KRE A;  3TY9 A;  3U54 A;  4IWY A;  4GLW A;  3G8D A;  3HT5 A;  4WBN F;  5D1O A;  4MA0 A;  3MWE A;  5LOV F;  2YZG A;  4UCT A;  1IYD A;  5DMX A;  3TY5 A;  3T7A A;  4DRF A;  3TIG A;  4E4T A;  1CS0 A;  4YJ2 F;  1ET0 A;  5D1P A;  2FPG B;  1GSA A;  4IWX A;  3VNN A;  3WWJ A;  4O82 A;  3NBZ B;  5BMV F;  1WRV A;  3JZF A;  1C30 A;  4FE2 A;  2YZL A;  1T36 A;  2OWO A;  1DAA A;  5BWU A;  1AUX A;  5D1O B;  3WWI A;  1I2L A;  4RZQ A;  1EKP A;  1I1M A;  3U9S A;  5FNV F;  3T9E A;  2HIX A;  3JRW A;  5KX5 F;  4MV1 A;  5I5V A;  4XYL B;  5I5S A;  3UYY A;  3JRX A;  4I4T F;  2FB9 A;  5CA0 F;  4MAM A;  4O7Z A;  1M0W A;  4MV8 A;  4XX0 B;  5J2U F;  4CE5 A;  3SE7 A;  4IIJ F;  3TW7 A;  3JSL A;  4FU0 A;  1VS0 A;  3CEB A;  4JXU A;  4E6N A;  5E25 A;  3W1G A;  5C8Y F;  5JVD F;  1AUV A;  3OUU A;  3MJF A;  3ORQ A;  2YZN A;  4O83 A;  4O7N A;  5LA6 F;  3R9R A;  4CKB A;  4ZI7 F;  3RTX A;  5HBR B;  2EJ0 A;  4TV9 F;  4TV8 F;  4LH7 A;  1EKV A;  2FPI B;  2R84 A;  1DV2 A;  3G8C A;  1GSO A;  3R23 A;  2CNU A;  3T9D A;  3S24 A;  3T54 A;  2HGX A;  3T9F A;  2Q2T A;  5KS8 A;  4HQ6 A;  2ABJ A;  1UC8 A;  3UFX B;  3ETJ A;  1DIK A;  2DIK A;  2YZM A;  4IZO A;  1VBH A;  4O4H F;  4ZHQ F;  4K6N A;  5KKN B;  1KC7 A;  4DAA A;  5BYA A;  5BWR A;  2CNV A;  1W93 A;  5HV6 A;  3LQS A;  3QFF A;  4O7W A;  4FFP A;  5D8D A;  1XDN A;  2W6N A;  4O2A F;  1C3O A;  2FP4 B;  2EJ3 A;  3UQ8 A;  5JH7 F;  4PBC A;  3BAA A;  4TM5 A;  4ME6 A;  4I55 F;  4Q4D A;  3U55 A;  1P16 A;  5I5X A;  1IOW A;  2DWC A;  1OBG A;  2SCU B;  2YYA A;  1KBL A;  2FPP B;  3GID A;  2V5A A;  1I1L A;  2W70 A;  2HJW A;  3VPC A;  1VBG A;  3Q2O A;  2HVR A;  4UFZ A;  4PZ6 A;  3AX6 A;  1W96 A;  4IHJ F;  3N6R A;  2ODT X;  3BG5 A;  4UCO A;  2COJ A;  1I7L A;  1V9P A;  2YRX A;  5CR5 A;  4HR7 A;  3R5H A;  3VA7 A;  2QB5 A;  4I50 F;  3JZI A;  4FFL A;  1PK8 A;  5EZY F;  5H80 A;  3GJX B;  4CC6 A;  1A0G A;  4MV9 A;  3GB8 B;  5LP6 F;  2VQD A;  1EKF A;  1VKZ A;  4O4L F;  4MV3 A;  3VPB A;  5BPF A;  2Y4R A;  2GPS A;  5DGH A;  3WO0 A;  5I5Y A;  4PZ7 A;  2GPW A;  4ZQI A;  2OLS A;  4O7S A;  2CZG A;  3K5I A;  2J9G A;  2EIY A;  1EHI A;  1OBD A;  1A3G A;  4WHX A;  1BXR A;  5CE8 A;  1JDB B;  2R87 A;  4FGR A;  1ZAU A;  2R7M A;  2ZDH A;  2PBZ A;  5BPH A;  2Q2U A;  3SNO A;  4NZM A;  5BYB A;  4NZN A;  4O7L A;  1B6R A;  4O4I F;  4O7T A;  2NU7 B;  2IP4 A;  2VPQ A;  3VOT A;  1KJ9 A;  1EZ1 A;  4CC5 A;  3DTF A;  1E4E B;  4YJ3 F;  1KT8 A;  5JQW A;  2YL2 A;  1EUC B;  3N8D A;  2COG A;  3WNZ A;  5BWX A;  2X5R A;  5FPR A;  3TII A;  4UCS A;  4NZO A;  2VR1 A;  3QQM A;  5DAA A;  4EEQ A;  1M0T A;  5CA1 F;  4ZOL F;  3SGI A;  3GDE A;  1GGO A;  1P8L A;  1CKN A;  5DIS C;  2V58 A;  2XCL A;  2W71 A;  2R85 A;  4YBZ B;  3V4Z A;  3DAA A;  1A0I A;  5CAE B;  3HBL A;  4O86 A;  5GON F;  2COI A;  3T99 A;  3WO1 A;  2QK4 A; 
#chains in the Genus database with same CATH homology
 5I5T A;  3LUL A;  4Q4D A;  3CSW A;  2HDK A;  3UZB A;  5I5X A;  1IYD A;  5K3W A;  1UC9 A;  3T7A A;  1ET0 A;  1I1L A;  4CMD A;  4IWX A;  2DAB A;  3WWJ A;  4RCN A;  2ODT X;  1WRV A;  5DGI A;  2COJ A;  3T9A A;  5CR5 A;  1DAA A;  4UUG A;  5BWU A;  3U0G A;  3TEK A;  2QB5 A;  5CM0 A;  3PFF A;  3WWI A;  5I5U A;  5I60 A;  1I2L A;  1EKP A;  1I1M A;  2HHF B;  1A0G A;  3VPD A;  1EKF A;  2DAA A;  3T9E A;  4CMF A;  3UZO A;  5I5V A;  2Y4R A;  5I5S A;  5BWT A;  3UYY A;  5DGH A;  5I5Y A;  1I1K A;  1IYE A;  4TVI A;  3JZ6 A;  4CE5 A;  2HGW A;  5HNE A;  2EIY A;  3TW7 A;  1A3G A;  5I5W A;  4WHX A;  1KTA A;  3CEB A;  2EJ2 A;  4JXU A;  5E25 A;  5CE8 A;  3T9C A;  5BWV A;  1ZAU A;  3SNO A;  4CHI A;  4NZM A;  5BYB A;  4CKB A;  4NZN A;  4Q4C A;  2EJ0 A;  5I47 A;  2HHF A;  3T9B A;  1EKV A;  4M0J A;  3DTF A;  1KT8 A;  2A1H A;  3T9D A;  3T54 A;  2HGX A;  3T9F A;  4CKC A;  5KS8 A;  1I2K A;  2COG A;  2ABJ A;  1UC8 A;  5BWX A;  2X5R A;  5K2M A;  2Q7D A;  4NZO A;  4K6N A;  5FR9 A;  4DAA A;  3QQM A;  5BYA A;  3BAC A;  5BWR A;  5DAA A;  5BWW A;  4CKE A;  3LQS A;  3SGI A;  4DQN A;  3DTG A;  3WWH A;  4HN2 A;  1G2W A;  2ZGI A;  2EJ3 A;  3DAA A;  4IWY A;  2HG8 A;  4PBC A;  4GLW A;  2COI A;  3HT5 A;  3T99 A;  4TM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...