5HBRB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 67
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5hbrB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5hbrB02
2WYOA 2CQYA 1VBHA 5EZYF 1AUVA 1EUDB 2W6PA 2YZLA 2YW2A 4XYMB 3RV4A 2J9GA 4O7VA 4MV9A 1CQIB 1EUCB 1C3OA 1UC8A 3KREA 1PK8A 4FFPA 5BPFA 2X0SA 3GLKA 1CQJB 5LXTF 4HQ6A 5LYJF 3NUAA 2HGSA 4YB8B 3VPDA 5JQWA 4FFNA 4DIMA 1JDEA 3HBLA 1OBGA 2R7KA 1VBGA 4Y8VB 4O7YA 4YJ3F 4YJ2F 2CNUA 4O83A 1EYZA 2NU7B 2R82A 1KJ9A 2DIKA 3N6RA 4IWXA 3Q1KA 2GQRA 1JKJB 2VPQA 4HR7A 4TV8F 2I80A 2ZDHA 2GPWA 3HO8A 1W93A 5KX5F 4M9UA 2W71A 3E5NA 4O4LF 1I7LA 2R7MA 3KALA 4TUYF 3V4SA 2VQDA 2YS6A 5C8YF 5C1PA 2R86A 4ZHQF 4XZ3B 2VR1A 4IWYA 4I55F 5LOVF 4DLKA 2PVPA 5LP6F 1DV1A 5IYZF 4C5BA 4FFMA 3N8DA 1W96A 1UC9A 1BNCA 1BXRA 1Z2NX 5JVDF 4HNVA 2R87A 2FP4B 4IHJF 3TINA 3U9SA 1M0WA 2DZDA 3U55A 2PN1A 3TQTA 2I8CA 1EZ1A 1IOVA 3I12A 4HNTA 4O7WA 2GPSA 3KAKA 2YZNA 4O7RA 2QK4A 5JVLA 3AX6A 5JQGF 5CA1F 5KKNB 4O2AF 1KJ8A 1GSAA 1E4EB 5GONF 4FFLA 4IIJF 2FPGB 3R5FA 3R5XA 1GLVA 1GSOA 1DV2A 4MV7A 4MAMA 2DLNA 5HBRB 2W6MA 1CE8A 4O86A 4ZI7F 5CAEB 4MA5A 2P0AA 4EG0A 4O4JF 1B6SA 1KJQA 4O7SA 3VOTA 1Z2PX 1KC7A 5D8DA 1WR2A 2R7NA 1SCUB 2V58A 4XX0B 3MJFA 4L1KA 2ZDGA 3TIGA 4I4TF 1OBDA 3K5HA 1Z2OX 1I7NA 1PX2A 3DF7A 1M0TA 2SCUB 3WO1A 3MWEA 3R5HA 3ETJA 4MV8A 2ZDQA 4MV3A 3VMMA 4C5AA 2DWCA 3ETHA 4I50F 4ZQIA 4O81A 2QF7A 1DIKA 2FPPB 4IZOA 2I87A 4YBZB 3ORRA 3AW8A 3JZFA 2YWVA 4EGJA 3JRWA 2W70A 2YZGA 2R84A 2W6NA 4TV9F 2W6QA 3R23A 1T36A 4O82A 2NUAB 3WO0A 1EHIA 3WNZA 3QFFA 4MV4A 2OLSA 3MWDA 5LA6F 2Z04A 3UFXB 3LWBA 2YZMA 2R6FA 1IOWA 1KJJA 3K5IA 4XYLB 3TIIA 3JZIA 3Q2OA 3R9RA 3ORQA 3JRXA 5J2UF 1E4EA 4EGQA 4O7TA 1KBLA 3RUPA 4HNUA 2YYAA 2NU8B 4FE2A 2Z02A 4ZOLF 2GQSA 5FNVF 2NU9B 2XCLA 4RZQA 1CS0A 1JLLB 2YRWA 5CB4F 2R85A 4MV6A 4YAKB 2CZGA 5K2MA 3SE7A 3U54A 4QSHA 5BMVF 1B6RA 4C5CA 1JDBB 3VA7A 2V59A 2W6OA 2YRXA 4O7LA 3KAJA 2R7LA 4WD3A 2PBZA 4E4TA 5HV6A 1GSHA 2FPIB 4ME6A 4FGRA 2GLTA 1VKZA 3LP8A 2V5AA 1M6VA 2IP4A 1A48A 1KUTA 4FFOA 5C1OA 3OUUA 1KJIA 3G8DA 3HB9A 2XD4A 3OUZA 4FU0A 4O4IF 5H80A 2CNVA 1GGOA 2YS7A 4MV1A 2W6ZA 2HJWA 5J2TF 3RFCA 1ULZA 4O2BF 3RV3A 3BG5A 4O7NA 5I47A 4O4HF 5JH7F 1AUXA 4NYEA 3TW6A 2FB9A 2YL2A 3GIDA 1KEEA 3V4ZA 4O7ZA 3VPCA 2CNQA 3G8CA 2C00A 3K3PA 5DMXA 4FFRA 1A9XA 4WBNF 3U9TA 2NU6B 4MA0A 4YAJB 5CA0F 4O84A 5BPHA 3VPBA 1C30A
chains in the Genus database with same CATH superfamily
2VA2A 5E25A 1BJTA 3J80W 3JAMW 2MCTA 5I5SA 1T94A 4LMYA 4RU9A 2ZM6H 2WYOA 3KHGA 2CQYA 4U6PA 5EWFA 3W5OA 2C2DA 1VBHA 5EZYF 1AUVA 1EUDB 2W6PA 2YZLA 1L2ZA 2HDKA 2HVSA 3RAQA 5L1LA 4MTDA 2YW2A 3HT5A 4XYMB 3RV4A 3RJ0A 4TQRA 3Q8RB 5BWUA 2J9GA 4QWBA 4DUYH 4O7VA 5KG7A 5DLFA 5FR9A 2XCAA 4DV2H 4YP3A 4MV9A 2ASDA 4B3SH 5KFUA 1CQIB 4CC6A 2JA8G 1EUCB 2R8HA 4DV4H 1K1QA 2AGOA 2HIVA 1C3OA 1UC8A 4DV7H 3TEKA 3KREA 3OTOH 3PFFA 3CVZA 4RB3C 1JXLA 1PK8A 3RF2A 3UYYA 2HGXA 4FFPA 1X9NA 5DGBA 1V9PA 5BPFA 2VQEH 1TWAA 4QWCA 3BABA 2X0SA 3GLKA 3RIZA 1CQJB 4BXXG 4FS1A 2BQ3A 1V51A 5LXTF 4HQ6A 5KFXA 2Y4RA 3N43B 4X62H 2B63A 5FPRA 3KHHA 5LYJF 3NUAA 2IA6A 3BQ2A 2JEFA 3GDEA 2AGQA 2RDIA 2FJZA 5KFGA 2HGSA 2ASJA 1IBMH 4J9OA 4YB8B 3VPDA 2W7OA 5JQWA 2UVWA 5I5TA 3V6KA 5IYBG 4FFNA 4F4XA 2FK1A 2AGPA 2ZGIA 4TVIA 1ET0A 4LSXA 3T7AA 5KT7A 4FS2A 4DIMA 1JDEA 4DL5A 4EEYA 2UXDH 3HBLA 2W8KA 1OBGA 3N44B 4DUZH 2R7KA 3BA9A 4F4WA 1VBGA 4R7RA 4Y8VB 4O7YA 4YJ3F 4YJ2F 2CNUA 2RGVA 4O83A 3HOWG 1M7JA 5KFAA 1EYZA 5KG1A 4E6NA 2R8JA 3GIIA 4BY1G 4TQSA 4ECXA 2NU7B 4B3MH 2R82A 3T9DA 4ED1A 1KJ9A 4DL7A 4JXUA 3FKIA 2DIKA 3N6RA 4IWXA 3GIPA 3H4BA 2PMZA 4LF6H 4CC5A 3Q1KA 5EWGA 2GQRA 1JKJB 3C0FB 3BJYA 2VPQA 4J9RA 4HR7A 3GV5B 4TV8F 3T9AA 4RB0A 2I80A 3QQMA 2W9BA 2ZDHA 3HOUG 2GPWA 5I5UA 3NBZB 3HO8A 1W93A 5BWTA 4DL6A 3PW2A 3BACA 3JSNA 5KX5F 4M9UA 2W71A 3E5NA 5DGHA 4O4LF 1I7LA 1XDNA 2PMZE 2R7MA 2FE3A 4JV0A 4J9LA 4PDBA 1BGWA 2UXBH 4JUZA 2IMWP 3KALA 5KFQA 3OHAA 4DV6H 4NXMH 1S0MA 3GTPA 4TUYF 3V4SA 1WCMA 3FDSA 1P16A 2VQDA 2YS6A 3GIQA 5KFLA 4JV2A 5C8YF 5C1PA 5EOYA 2CKZB 4DR4H 2OWOA 5I5WA 3RB3A 4EFBA 2R86A 4ZHQF 3F8NA 4J9KA 3T1HH 3IG0A 2XGQA 2C2EA 4XZ3B 2XC9A 4GKJH 3KYHC 2VR1A 4QIWA 2UVVA 1TWGA 4A3DG 5I60A 5DQHA 3GTLA 1KTAA 4IWYA 4LH6A 4GKKH 3KHLA 4I55F 1N56A 1XMOH 4R8UA 5FD5A 5LOVF 3HOYG 4DLKA 2PVPA 3KHRA 1O75A 3BAAA 4ED3A 3M9NB 2COJA 5LP6F 5FPOA 1DV1A 4UCTA 4LH7A 5IYZF 1Y14B 5KT2A 3OHBA 4C5BA 4OX9H 5D1OB 2B63G 4FFMA 1JIHA 3N8DA 1TWCA 4QIWE 1W96A 5C44G 1UC9A 1XMQH 1BNCA 1BXRA 5L1JA 5KFFA 3MR5A 4DR7H 1Z2NX 4Q8FA 5JVDF 4HNVA 1TWHA 1I50A 4LF5H 2R87A 2UUBH 5L9XA 4U7CA 2R8IA 2FP4B 3DTFA 4ECSA 4IHJF 3TINA 3U9SA 1M0WA 3MFIA 2DZDA 3U55A 4ECZA 2PN1A 2W9CA 1A3GA 4QWEA 5LMNH 3TQTA 3Q8QB 1HNZH 3AYHB 4Q0YA 5FLXW 3CEBA 1IYDA 4GC7A 4LF9H 4DV0H 2I8CA 4CE5A 1EZ1A 1IOVA 3I12A 1RJRA 3N41B 5KG6A 4Q8EA 4HNTA 4O7WA 1S9FA 1ZHSA 1XNRH 4GLXA 2GPSA 3L4JA 3KAKA 3TW7A 4B3RH 3RR5A 2FLPA 3FKIG 2YZNA 4O7RA 2ZJTA 2ATLA 4J9MA 2F4VH 2QK4A 5I5YA 5JVLA 5KG4A 3BQ1A 3AX6A 1EKFA 1E4FT 5JQGF 5CA1F 5FD6A 1I94H 4J0MA 5KKNB 4O2AF 1KJ8A 5BWRA 5IP7G 3MR6A 3M9OB 1GSAA 1E4EB 4RAZA 2VUMG 2EIYA 2Q7DA 5GONF 1HNXH 4FFLA 4JV1A 2JA7A 3RBDA 4IIJF 5CE8A 2FK2A 4JI0H 1I2KA 2FPGB 3R5FA 3UZBA 2BQUA 3LULA 3N42B 3R5XA 1RJPA 1GLVA 1GSOA 1DV2A 5KFKA 2A1HA 1WCMG 4MV7A 4DL4A 2BR0A 1XNQH 1T3NA 3GTMA 2JA5A 5C5JA 4MAMA 4JI5H 2DLNA 1SEIA 4A3IG 3GILA 1I1LA 3PW4A 3PO3G 5KFYA 5HBRB 1WSCA 2W6MA 1CE8A 4O86A 3SI8A 4ZI7F 5CAEB 4EBCA 5LMUH 2E5LH 2QB5A 4MA5A 2P0AA 5KFWA 4EG0A 2V4RA 4PZ6A 5KFSA 3I4NG 4O4JF 1B6SA 1KJQA 3WWHA 4A93G 4O7SA 3VOTA 1Z2PX 1KC7A 2ALZA 5D8DA 3GQCA 4A3KG 1UNNC 1WR2A 4PWQA 4X65H 4EYHB 1WH2A 4DR1H 4DL2A 5DGIA 5KFZA 3W1BA 4NZNA 2R7NA 3GV8B 5DG7A 4Q4CA 4JI3H 4JYAH 1B04A 1SCUB 4NZOA 2V58A 4JI6H 4A3MG 4IAJA 4XX0B 5KFIA 1B33N 3MJFA 4L1KA 2ZDGA 3I4MG 3GTGA 4A3GG 4DL3A 3TIGA 3FMAA 3H3VH 4NLGA 3S24A 3WWIA 4QW8A 4I4TF 1N34H 3LQSA 4O3QA 2RDJA 3T54A 1OBDA 2R7ZG 3K5HA 5D1PA 3TQ1A 1Z2OX 4ECTA 1KT8A 4UUGA 4F4ZA 2COIA 1I7NA 1PX2A 3DF7A 5KFCA 2V4QA 1M0TA 5KFNA 3Q8PB 4UCVA 4X64H 4GC6A 3PW7A 2J6TA 2VUMA 1RYSA 4FBUA 2SCUB 3RTXA 3K3VA 3TY5A 4YR0A 1HR0H 4ECVA 3M4IA 4YR2A 2BQRA 1J5EH 3WO1A 3MWEA 2X5RA 3SGIA 2W9BB 4LF4H 3GTOA 4F4YA 3R5HA 4UFZA 3ETJA 5I5XA 1CKNB 2ZDQA 4MV8A 3IN5A 3GJXB 4MV3A 3VMMA 2JA7G 3J7AK 5IT9W 4C5AA 4O3SA 3QZ7A 2HHFB 4G3IA 2DWCA 4QWAA 4RNMA 3ETHA 4I50F 3JZ6A 3H0GA 4BBSG 4CMFA 4ZQIA 4ED0A 2RGRA 4O81A 5IP9G 1EKVA 4C2MA 2QF7A 2FKLA 2DAAA 1DIKA 5F9LA 3HOZG 4DV3H 5KFEA 4TM5A 4CMDA 2VQFH 2FPPB 4IZOA 1JX4A 2JA5G 4A2AA 1S68A 4M7EA 2I87A 4YBZB 3WWJA 4RNOA 3T1YH 5IYCG 5KT3A 3ORRA 4Q43A 3AW8A 4J9PA 4A3EG 5T14A 4J9QA 5KG0A 2HHHH 2QYZA 4A3JG 3JZFA 2FMAA 4DR5H 4X66H 2HIXA 3RAXA 2DPIA 1P8LA 5KFMA 3PZPA 2YWVA 4NZMA 1S0OA 4EGJA 4HYKA 3JRWA 1RJQA 5FJ8G 3HKZA 3PO2G 3H20A 3BQ0A 2JEJA 3HOVG 4J9SA 1S03G 4DR3H 1K83A 2W70A 1EKPA 2YZGA 2R84A 4IRKA 3LMLA 1K1SA 2FK3A 4LSAA 3SNOA 5D1OA 4YQWA 2W6NA 4FBTA 4TV9F 3T9EA 2W6QA 4LF8H 4RB1A 2R7ZA 3R23A 3KXYT 1T36A 2HGWA 3HXLA 4O82A 2NUAB 3WO0A 3RBEA 1EHIA 2C2RA 3MFHA 5HNEA 2C35B 3WNZA 5KG2A 3QFFA 4HN2A 5KFJA 4MV4A 2CW8A 3PR4A 4JI4H 1IBKH 1VS0A 2OLSA 3MWDA 5LA6F 5KFBA 4EFEA 1IYEA 3VNNA 2W57A 2Q2TA 2Z04A 1ZAUA 3UFXB 3LWBA 2COGA 4RAYA 3GV7B 2YZMA 4RCNA 4I7HA 3RB4A 2R6FA 4EBDA 4RUAA 3PR5B 4ED6A 1IOWA 5FLMG 1KJJA 3K5IA 2W7PA 2FLNA 4XYLB 3H4DA 4ECRA 4JI1H 4LFCH 3PW0A 3W1GA 2NVYA 4LF7H 3TIIA 3RB6A 3OSPA 4WHXA 3GTKA 5BWXA 3JZIA 4ED8A 3V6HA 5CM0A 2ASLA 3L4KA 2VUGA 4K6NA 4O3PA 4Q44A 3Q2OA 3R9RA 2HVQA 3ORQA 3JRXA 5J2UF 5KFRA 2UUCH 3GTQA 1E4EA 2WDTA 2AQ4A 4QJFA 1N32H 2CFMA 5F9NA 1FVIA 5KT6A 4EGQA 4ED2A 4O7TA 4BBRG 2WTFA 1KBLA 4DRFA 3H0GG 5C4XG 4DR2H 3RUPA 3MR2A 5I5VA 3T9CA 4HNUA 1Y1VA 1GO3E 3NGDA 4JI8H 5KFTA 5BR8H 4MTEA 2W9AA 5EWEA 4Q45A 3H40A 4ECYA 4ED7A 3T9FA 2JA6A 2YYAA 2R8GA 1I6UA 1MZBA 5KG3A 4DR6H 4JV5H 2NU8B 4FE2A 2Z02A 3MR3A 4ECQA 3EPIA 4ZOLF 2GQSA 5JUMA 2EJ2A 4GLWA 5FNVF 3T5LA 1SFOA 1TA8A 3G6YA 2NU9B 4A2BA 4LFAH 3GB8B 2JEGA 4EEQA 2O03A 5LL6b 3CQZA 2WAQA 2AU0A 2XCLA 2DPJA 3G6VA 4RZQA 1CS0A 4DAAA 4ECUA 3GTJA 4UCSA 4QW9A 1JLLB 2XCPA 3V6JA 5KG5A 2YRWA 5DG8A 1S97A 5CB4F 2R85A 3HOXG 4MV6A 1V4YA 3T5KA 3QWUA 4YAKB 1WRVA 2CZGA 3UQ8A 4AYBA 3GIJA 1FJGH 2UUAH 5K2MA 4EYIB 3SE7A 3U54A 2J6UA 4QSHA 4PZ8A 5C3EG 1I2LA 3L2PA 5BMVF 1S10A 4B3TH 3NC0B 5KFOA 4A3LG 1B6RA 2WAQE 4C5CA 2YCHA 1G2WA 2R92G 1JDBB 3TY8A 1A0GA 1OWTA 2ODTX 3VA7A 1RK5A 4ETSA 3QZ8A 1R9TA 2WE6A 4AQYH 2V59A 2W6OA 2YRXA 4O7LA 2Y0SA 4AYBE 3KAJA 2R7LA 5BYAA 1TWFA 3MWMA 1A0IA 4WD3A 4O3RA 2E2HA 1VAJA 4EQ5A 5K3WA 4YHHH 2PBZA 3TY9A 4E4TA 5KS8A 3KTMA 3N40P 2R93A 1Y1WG 5HV6A 2E2IA 2C22A 3M9MB 5DLGA 2OH2A 4KHPH 1GSHA 2FPIB 4UCRA 4RNNA 5IWAH 2FLLA 4APMA 5EDWA 3PW5A 2EJ0A 4ME6A 1AN7A 4DQNA 3G6XA 2Y0SE 4FGRA 2GLTA 1VKZA 4CKBA 3LP8A 5BWWA 4QWDA 4NXNH 2V5AA 3EYYA 5CR5A 3JSLA 1M6VA 4BY7G 2HVRA 4A3CG 3T99A 4LFBH 5KT5A 2IP4A 1A48A 3T9BA 4A3FG 1CKNA 3T5JA 3Q8SB 4ECWA 1DAAA 2DABA 2UVUA 1KUTA 2JEIA 4FFOA 1TAEA 5C1OA 3DTGA 3OUUA 3T5HA 1KJIA 4CHIA 3G8DA 2RF4A 2HHFA 2VOBA 2CW7A 4YY3H 4JI7H 2VA3A 3HB9A 2NVXA 2UXCH 4UCOA 1S0NA 2XD4A 3CSWA 3OUZA 1N33H 4FU0A 4IR9A 4O4IF 4RZRA 1Y1VG 2YU9A 1HNWH 3BA8A 4R8UB 5H80A 2CNVA 1I1KA 5KFDA 1GGOA 2YS7A 4F50A 2JA6G 4FM9A 1RK6A 4BWSC 2ABJA 4MV1A 3RGZA 5KT4A 1GYFA 2VPSA 2W6ZA 2UVRA 4PZ7A 2HJWA 2W8LA 5IYDG 5J2TF 3NBYB 4O3OA 3RFCA 3EPGA 1IBLH 4IR1A 4IRCA 1ULZA 5DG9A 4RUCA 4DV1H 1FKAH 2WB1A 5DQIA 4EBEA 3RB0A 2IBKA 4O2BF 1SYXB 3OSNA 3RV3A 2UU9H 5KFVA 2XGPA 3U0GA 4RB2C 2R92A 3PVXA 4CKCA 3BG5A 2KSWA 1N36H 4O7NA 5I47A 4O4HF 2W9CB 2Q2UA 3RGXA 5DGAA 1N48A 3HKZE 4O3NA 2J6SA 5JH7F 1AUXA 5BYBA 2WB1E 4NYEA 4M0JA 2FB9A 3TW6A 4JI2H 3J81W 3GIMA 2HG8A 1CKOA 2YL2A 3GIDA 4PBCA 3N6XA 1RYRA 5BWVA 1KEEA 2M05A 2V9WA 1DGSA 5KFHA 3V4ZA 1ZETA 4K0KH 2EJ3A 1Y1WA 4CKEA 2C28A 1I3QA 5L1KA 1CKMA 4O7ZA 4IRDA 1XK5A 3VPCA 2CNQA 3DAAA 5DAAA 1E4GT 4A3BG 3G8CA 2C00A 3K3PA 5DMXA 5KFPA 4YR3A 4FFRA 1A9XA 4WBNF 4UCUA 4Q4DA 3GIKA 4J9NA 2XIGA 1I1MA 5L1IA 3U9TA 2R93G 3PN1A 2R8KA 2NU6B 4DV5H 1ZHQA 5A2QW 4MA0A 4YAJB 5DISC 5CA0F 5DQGA 4O84A 3UZOA 5BPHA 3VPBA 1ZQ7A 1C30A
chains in the Genus database with same CATH topology
2WYOA 2CQYA 1VBHA 5EZYF 1AUVA 1EUDB 2W6PA 2YZLA 2YW2A 4XYMB 3RV4A 2J9GA 4O7VA 4MV9A 1CQIB 1EUCB 1C3OA 1UC8A 3KREA 1PK8A 4FFPA 5BPFA 2X0SA 3GLKA 1CQJB 5LXTF 4HQ6A 5LYJF 3NUAA 2HGSA 4YB8B 3VPDA 5JQWA 4FFNA 4DIMA 1JDEA 3HBLA 1OBGA 2R7KA 1VBGA 4Y8VB 4O7YA 4YJ3F 4YJ2F 2CNUA 4O83A 1EYZA 2NU7B 2R82A 1KJ9A 2DIKA 3N6RA 4IWXA 3Q1KA 2GQRA 1JKJB 2VPQA 4HR7A 4TV8F 2I80A 2ZDHA 2GPWA 3HO8A 1W93A 5KX5F 4M9UA 2W71A 3E5NA 4O4LF 1I7LA 2R7MA 3KALA 4TUYF 3V4SA 2VQDA 2YS6A 5C8YF 5C1PA 2R86A 4ZHQF 4XZ3B 2VR1A 4IWYA 4I55F 5LOVF 4DLKA 2PVPA 5LP6F 1DV1A 5IYZF 4C5BA 4FFMA 3N8DA 1W96A 1UC9A 1BNCA 1BXRA 1Z2NX 5JVDF 4HNVA 2R87A 2FP4B 4IHJF 3TINA 3U9SA 1M0WA 2DZDA 3U55A 2PN1A 3TQTA 2I8CA 1EZ1A 1IOVA 3I12A 4HNTA 4O7WA 2GPSA 3KAKA 2YZNA 4O7RA 2QK4A 5JVLA 3AX6A 5JQGF 5CA1F 5KKNB 4O2AF 1KJ8A 1GSAA 1E4EB 5GONF 4FFLA 4IIJF 2FPGB 3R5FA 3R5XA 1GLVA 1GSOA 1DV2A 4MV7A 4MAMA 2DLNA 5HBRB 2W6MA 1CE8A 4O86A 4ZI7F 5CAEB 4MA5A 2P0AA 4EG0A 4O4JF 1B6SA 1KJQA 4O7SA 3VOTA 1Z2PX 1KC7A 5D8DA 1WR2A 2R7NA 1SCUB 2V58A 4XX0B 3MJFA 4L1KA 2ZDGA 3TIGA 4I4TF 1OBDA 3K5HA 1Z2OX 1I7NA 1PX2A 3DF7A 1M0TA 2SCUB 3WO1A 3MWEA 3R5HA 3ETJA 4MV8A 2ZDQA 4MV3A 3VMMA 4C5AA 2DWCA 3ETHA 4I50F 4ZQIA 4O81A 2QF7A 1DIKA 2FPPB 4IZOA 2I87A 4YBZB 3ORRA 3AW8A 3JZFA 2YWVA 4EGJA 3JRWA 2W70A 2YZGA 2R84A 2W6NA 4TV9F 2W6QA 3R23A 1T36A 4O82A 2NUAB 3WO0A 1EHIA 3WNZA 3QFFA 4MV4A 2OLSA 3MWDA 5LA6F 2Z04A 3UFXB 3LWBA 2YZMA 2R6FA 1IOWA 1KJJA 3K5IA 4XYLB 3TIIA 3JZIA 3Q2OA 3R9RA 3ORQA 3JRXA 5J2UF 1E4EA 4EGQA 4O7TA 1KBLA 3RUPA 4HNUA 2YYAA 2NU8B 4FE2A 2Z02A 4ZOLF 2GQSA 5FNVF 2NU9B 2XCLA 4RZQA 1CS0A 1JLLB 2YRWA 5CB4F 2R85A 4MV6A 4YAKB 2CZGA 5K2MA 3SE7A 3U54A 4QSHA 5BMVF 1B6RA 4C5CA 1JDBB 3VA7A 2V59A 2W6OA 2YRXA 4O7LA 3KAJA 2R7LA 4WD3A 2PBZA 4E4TA 5HV6A 1GSHA 2FPIB 4ME6A 4FGRA 2GLTA 1VKZA 3LP8A 2V5AA 1M6VA 2IP4A 1A48A 1KUTA 4FFOA 5C1OA 3OUUA 1KJIA 3G8DA 3HB9A 2XD4A 3OUZA 4FU0A 4O4IF 5H80A 2CNVA 1GGOA 2YS7A 4MV1A 2W6ZA 2HJWA 5J2TF 3RFCA 1ULZA 4O2BF 3RV3A 3BG5A 4O7NA 5I47A 4O4HF 5JH7F 1AUXA 4NYEA 3TW6A 2FB9A 2YL2A 3GIDA 1KEEA 3V4ZA 4O7ZA 3VPCA 2CNQA 3G8CA 2C00A 3K3PA 5DMXA 4FFRA 1A9XA 4WBNF 3U9TA 2NU6B 4MA0A 4YAJB 5CA0F 4O84A 5BPHA 3VPBA 1C30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WYO A;  2CQY A;  1VBH A;  5EZY F;  1AUV A;  1EUD B;  2W6P A;  2YZL A;  2YW2 A;  4XYM B;  3RV4 A;  2J9G A;  4O7V A;  4MV9 A;  1CQI B;  1EUC B;  1C3O A;  1UC8 A;  3KRE A;  1PK8 A;  4FFP A;  5BPF A;  2X0S A;  3GLK A;  1CQJ B;  5LXT F;  4HQ6 A;  5LYJ F;  3NUA A;  2HGS A;  4YB8 B;  3VPD A;  5JQW A;  4FFN A;  4DIM A;  1JDE A;  3HBL A;  1OBG A;  2R7K A;  1VBG A;  4Y8V B;  4O7Y A;  4YJ3 F;  4YJ2 F;  2CNU A;  4O83 A;  1EYZ A;  2NU7 B;  2R82 A;  1KJ9 A;  2DIK A;  3N6R A;  4IWX A;  3Q1K A;  2GQR A;  1JKJ B;  2VPQ A;  4HR7 A;  4TV8 F;  2I80 A;  2ZDH A;  2GPW A;  3HO8 A;  1W93 A;  5KX5 F;  4M9U A;  2W71 A;  3E5N A;  4O4L F;  1I7L A;  2R7M A;  3KAL A;  4TUY F;  3V4S A;  2VQD A;  2YS6 A;  5C8Y F;  5C1P A;  2R86 A;  4ZHQ F;  4XZ3 B;  2VR1 A;  4IWY A;  4I55 F;  5LOV F;  4DLK A;  2PVP A;  5LP6 F;  1DV1 A;  5IYZ F;  4C5B A;  4FFM A;  3N8D A;  1W96 A;  1UC9 A;  1BNC A;  1BXR A;  1Z2N X;  5JVD F;  4HNV A;  2R87 A;  2FP4 B;  4IHJ F;  3TIN A;  3U9S A;  1M0W A;  2DZD A;  3U55 A;  2PN1 A;  3TQT A;  2I8C A;  1EZ1 A;  1IOV A;  3I12 A;  4HNT A;  4O7W A;  2GPS A;  3KAK A;  2YZN A;  4O7R A;  2QK4 A;  5JVL A;  3AX6 A;  5JQG F;  5CA1 F;  5KKN B;  4O2A F;  1KJ8 A;  1GSA A;  1E4E B;  5GON F;  4FFL A;  4IIJ F;  2FPG B;  3R5F A;  3R5X A;  1GLV A;  1GSO A;  1DV2 A;  4MV7 A;  4MAM A;  2DLN A;  5HBR B;  2W6M A;  1CE8 A;  4O86 A;  4ZI7 F;  5CAE B;  4MA5 A;  2P0A A;  4EG0 A;  4O4J F;  1B6S A;  1KJQ A;  4O7S A;  3VOT A;  1Z2P X;  1KC7 A;  5D8D A;  1WR2 A;  2R7N A;  1SCU B;  2V58 A;  4XX0 B;  3MJF A;  4L1K A;  2ZDG A;  3TIG A;  4I4T F;  1OBD A;  3K5H A;  1Z2O X;  1I7N A;  1PX2 A;  3DF7 A;  1M0T A;  2SCU B;  3WO1 A;  3MWE A;  3R5H A;  3ETJ A;  4MV8 A;  2ZDQ A;  4MV3 A;  3VMM A;  4C5A A;  2DWC A;  3ETH A;  4I50 F;  4ZQI A;  4O81 A;  2QF7 A;  1DIK A;  2FPP B;  4IZO A;  2I87 A;  4YBZ B;  3ORR A;  3AW8 A;  3JZF A;  2YWV A;  4EGJ A;  3JRW A;  2W70 A;  2YZG A;  2R84 A;  2W6N A;  4TV9 F;  2W6Q A;  3R23 A;  1T36 A;  4O82 A;  2NUA B;  3WO0 A;  1EHI A;  3WNZ A;  3QFF A;  4MV4 A;  2OLS A;  3MWD A;  5LA6 F;  2Z04 A;  3UFX B;  3LWB A;  2YZM A;  2R6F A;  1IOW A;  1KJJ A;  3K5I A;  4XYL B;  3TII A;  3JZI A;  3Q2O A;  3R9R A;  3ORQ A;  3JRX A;  5J2U F;  1E4E A;  4EGQ A;  4O7T A;  1KBL A;  3RUP A;  4HNU A;  2YYA A;  2NU8 B;  4FE2 A;  2Z02 A;  4ZOL F;  2GQS A;  5FNV F;  2NU9 B;  2XCL A;  4RZQ A;  1CS0 A;  1JLL B;  2YRW A;  5CB4 F;  2R85 A;  4MV6 A;  4YAK B;  2CZG A;  5K2M A;  3SE7 A;  3U54 A;  4QSH A;  5BMV F;  1B6R A;  4C5C A;  1JDB B;  3VA7 A;  2V59 A;  2W6O A;  2YRX A;  4O7L A;  3KAJ A;  2R7L A;  4WD3 A;  2PBZ A;  4E4T A;  5HV6 A;  1GSH A;  2FPI B;  4ME6 A;  4FGR A;  2GLT A;  1VKZ A;  3LP8 A;  2V5A A;  1M6V A;  2IP4 A;  1A48 A;  1KUT A;  4FFO A;  5C1O A;  3OUU A;  1KJI A;  3G8D A;  3HB9 A;  2XD4 A;  3OUZ A;  4FU0 A;  4O4I F;  5H80 A;  2CNV A;  1GGO A;  2YS7 A;  4MV1 A;  2W6Z A;  2HJW A;  5J2T F;  3RFC A;  1ULZ A;  4O2B F;  3RV3 A;  3BG5 A;  4O7N A;  5I47 A;  4O4H F;  5JH7 F;  1AUX A;  4NYE A;  3TW6 A;  2FB9 A;  2YL2 A;  3GID A;  1KEE A;  3V4Z A;  4O7Z A;  3VPC A;  2CNQ A;  3G8C A;  2C00 A;  3K3P A;  5DMX A;  4FFR A;  1A9X A;  4WBN F;  3U9T A;  2NU6 B;  4MA0 A;  4YAJ B;  5CA0 F;  4O84 A;  5BPH A;  3VPB A;  1C30 A; 
#chains in the Genus database with same CATH topology
 2VA2 A;  5E25 A;  1BJT A;  3J80 W;  3JAM W;  2MCT A;  5I5S A;  1T94 A;  4LMY A;  4RU9 A;  2ZM6 H;  2WYO A;  3KHG A;  2CQY A;  4U6P A;  5EWF A;  3W5O A;  2C2D A;  1VBH A;  5EZY F;  1AUV A;  1EUD B;  2W6P A;  2YZL A;  1L2Z A;  2HDK A;  2HVS A;  3RAQ A;  5L1L A;  4MTD A;  2YW2 A;  3HT5 A;  4XYM B;  3RV4 A;  3RJ0 A;  4TQR A;  3Q8R B;  5BWU A;  2J9G A;  4QWB A;  4DUY H;  4O7V A;  5KG7 A;  5DLF A;  5FR9 A;  2XCA A;  4DV2 H;  4YP3 A;  4MV9 A;  2ASD A;  4B3S H;  5KFU A;  1CQI B;  4CC6 A;  2JA8 G;  1EUC B;  2R8H A;  4DV4 H;  1K1Q A;  2AGO A;  2HIV A;  1C3O A;  1UC8 A;  4DV7 H;  3TEK A;  3KRE A;  3OTO H;  3PFF A;  3CVZ A;  4RB3 C;  1JXL A;  1PK8 A;  3RF2 A;  3UYY A;  2HGX A;  4FFP A;  1X9N A;  5DGB A;  1V9P A;  5BPF A;  2VQE H;  1TWA A;  4QWC A;  3BAB A;  2X0S A;  3GLK A;  3RIZ A;  1CQJ B;  4BXX G;  4FS1 A;  2BQ3 A;  1V51 A;  5LXT F;  4HQ6 A;  5KFX A;  2Y4R A;  3N43 B;  4X62 H;  2B63 A;  5FPR A;  3KHH A;  5LYJ F;  3NUA A;  2IA6 A;  3BQ2 A;  2JEF A;  3GDE A;  2AGQ A;  2RDI A;  2FJZ A;  5KFG A;  2HGS A;  2ASJ A;  1IBM H;  4J9O A;  4YB8 B;  3VPD A;  2W7O A;  5JQW A;  2UVW A;  5I5T A;  3V6K A;  5IYB G;  4FFN A;  4F4X A;  2FK1 A;  2AGP A;  2ZGI A;  4TVI A;  1ET0 A;  4LSX A;  3T7A A;  5KT7 A;  4FS2 A;  4DIM A;  1JDE A;  4DL5 A;  4EEY A;  2UXD H;  3HBL A;  2W8K A;  1OBG A;  3N44 B;  4DUZ H;  2R7K A;  3BA9 A;  4F4W A;  1VBG A;  4R7R A;  4Y8V B;  4O7Y A;  4YJ3 F;  4YJ2 F;  2CNU A;  2RGV A;  4O83 A;  3HOW G;  1M7J A;  5KFA A;  1EYZ A;  5KG1 A;  4E6N A;  2R8J A;  3GII A;  4BY1 G;  4TQS A;  4ECX A;  2NU7 B;  4B3M H;  2R82 A;  3T9D A;  4ED1 A;  1KJ9 A;  4DL7 A;  4JXU A;  3FKI A;  2DIK A;  3N6R A;  4IWX A;  3GIP A;  3H4B A;  2PMZ A;  4LF6 H;  4CC5 A;  3Q1K A;  5EWG A;  2GQR A;  1JKJ B;  3C0F B;  3BJY A;  2VPQ A;  4J9R A;  4HR7 A;  3GV5 B;  4TV8 F;  3T9A A;  4RB0 A;  2I80 A;  3QQM A;  2W9B A;  2ZDH A;  3HOU G;  2GPW A;  5I5U A;  3NBZ B;  3HO8 A;  1W93 A;  5BWT A;  4DL6 A;  3PW2 A;  3BAC A;  3JSN A;  5KX5 F;  4M9U A;  2W71 A;  3E5N A;  5DGH A;  4O4L F;  1I7L A;  1XDN A;  2PMZ E;  2R7M A;  2FE3 A;  4JV0 A;  4J9L A;  4PDB A;  1BGW A;  2UXB H;  4JUZ A;  2IMW P;  3KAL A;  5KFQ A;  3OHA A;  4DV6 H;  4NXM H;  1S0M A;  3GTP A;  4TUY F;  3V4S A;  1WCM A;  3FDS A;  1P16 A;  2VQD A;  2YS6 A;  3GIQ A;  5KFL A;  4JV2 A;  5C8Y F;  5C1P A;  5EOY A;  2CKZ B;  4DR4 H;  2OWO A;  5I5W A;  3RB3 A;  4EFB A;  2R86 A;  4ZHQ F;  3F8N A;  4J9K A;  3T1H H;  3IG0 A;  2XGQ A;  2C2E A;  4XZ3 B;  2XC9 A;  4GKJ H;  3KYH C;  2VR1 A;  4QIW A;  2UVV A;  1TWG A;  4A3D G;  5I60 A;  5DQH A;  3GTL A;  1KTA A;  4IWY A;  4LH6 A;  4GKK H;  3KHL A;  4I55 F;  1N56 A;  1XMO H;  4R8U A;  5FD5 A;  5LOV F;  3HOY G;  4DLK A;  2PVP A;  3KHR A;  1O75 A;  3BAA A;  4ED3 A;  3M9N B;  2COJ A;  5LP6 F;  5FPO A;  1DV1 A;  4UCT A;  4LH7 A;  5IYZ F;  1Y14 B;  5KT2 A;  3OHB A;  4C5B A;  4OX9 H;  5D1O B;  2B63 G;  4FFM A;  1JIH A;  3N8D A;  1TWC A;  4QIW E;  1W96 A;  5C44 G;  1UC9 A;  1XMQ H;  1BNC A;  1BXR A;  5L1J A;  5KFF A;  3MR5 A;  4DR7 H;  1Z2N X;  4Q8F A;  5JVD F;  4HNV A;  1TWH A;  1I50 A;  4LF5 H;  2R87 A;  2UUB H;  5L9X A;  4U7C A;  2R8I A;  2FP4 B;  3DTF A;  4ECS A;  4IHJ F;  3TIN A;  3U9S A;  1M0W A;  3MFI A;  2DZD A;  3U55 A;  4ECZ A;  2PN1 A;  2W9C A;  1A3G A;  4QWE A;  5LMN H;  3TQT A;  3Q8Q B;  1HNZ H;  3AYH B;  4Q0Y A;  5FLX W;  3CEB A;  1IYD A;  4GC7 A;  4LF9 H;  4DV0 H;  2I8C A;  4CE5 A;  1EZ1 A;  1IOV A;  3I12 A;  1RJR A;  3N41 B;  5KG6 A;  4Q8E A;  4HNT A;  4O7W A;  1S9F A;  1ZHS A;  1XNR H;  4GLX A;  2GPS A;  3L4J A;  3KAK A;  3TW7 A;  4B3R H;  3RR5 A;  2FLP A;  3FKI G;  2YZN A;  4O7R A;  2ZJT A;  2ATL A;  4J9M A;  2F4V H;  2QK4 A;  5I5Y A;  5JVL A;  5KG4 A;  3BQ1 A;  3AX6 A;  1EKF A;  1E4F T;  5JQG F;  5CA1 F;  5FD6 A;  1I94 H;  4J0M A;  5KKN B;  4O2A F;  1KJ8 A;  5BWR A;  5IP7 G;  3MR6 A;  3M9O B;  1GSA A;  1E4E B;  4RAZ A;  2VUM G;  2EIY A;  2Q7D A;  5GON F;  1HNX H;  4FFL A;  4JV1 A;  2JA7 A;  3RBD A;  4IIJ F;  5CE8 A;  2FK2 A;  4JI0 H;  1I2K A;  2FPG B;  3R5F A;  3UZB A;  2BQU A;  3LUL A;  3N42 B;  3R5X A;  1RJP A;  1GLV A;  1GSO A;  1DV2 A;  5KFK A;  2A1H A;  1WCM G;  4MV7 A;  4DL4 A;  2BR0 A;  1XNQ H;  1T3N A;  3GTM A;  2JA5 A;  5C5J A;  4MAM A;  4JI5 H;  2DLN A;  1SEI A;  4A3I G;  3GIL A;  1I1L A;  3PW4 A;  3PO3 G;  5KFY A;  5HBR B;  1WSC A;  2W6M A;  1CE8 A;  4O86 A;  3SI8 A;  4ZI7 F;  5CAE B;  4EBC A;  5LMU H;  2E5L H;  2QB5 A;  4MA5 A;  2P0A A;  5KFW A;  4EG0 A;  2V4R A;  4PZ6 A;  5KFS A;  3I4N G;  4O4J F;  1B6S A;  1KJQ A;  3WWH A;  4A93 G;  4O7S A;  3VOT A;  1Z2P X;  1KC7 A;  2ALZ A;  5D8D A;  3GQC A;  4A3K G;  1UNN C;  1WR2 A;  4PWQ A;  4X65 H;  4EYH B;  1WH2 A;  4DR1 H;  4DL2 A;  5DGI A;  5KFZ A;  3W1B A;  4NZN A;  2R7N A;  3GV8 B;  5DG7 A;  4Q4C A;  4JI3 H;  4JYA H;  1B04 A;  1SCU B;  4NZO A;  2V58 A;  4JI6 H;  4A3M G;  4IAJ A;  4XX0 B;  5KFI A;  1B33 N;  3MJF A;  4L1K A;  2ZDG A;  3I4M G;  3GTG A;  4A3G G;  4DL3 A;  3TIG A;  3FMA A;  3H3V H;  4NLG A;  3S24 A;  3WWI A;  4QW8 A;  4I4T F;  1N34 H;  3LQS A;  4O3Q A;  2RDJ A;  3T54 A;  1OBD A;  2R7Z G;  3K5H A;  5D1P A;  3TQ1 A;  1Z2O X;  4ECT A;  1KT8 A;  4UUG A;  4F4Z A;  2COI A;  1I7N A;  1PX2 A;  3DF7 A;  5KFC A;  2V4Q A;  1M0T A;  5KFN A;  3Q8P B;  4UCV A;  4X64 H;  4GC6 A;  3PW7 A;  2J6T A;  2VUM A;  1RYS A;  4FBU A;  2SCU B;  3RTX A;  3K3V A;  3TY5 A;  4YR0 A;  1HR0 H;  4ECV A;  3M4I A;  4YR2 A;  2BQR A;  1J5E H;  3WO1 A;  3MWE A;  2X5R A;  3SGI A;  2W9B B;  4LF4 H;  3GTO A;  4F4Y A;  3R5H A;  4UFZ A;  3ETJ A;  5I5X A;  1CKN B;  2ZDQ A;  4MV8 A;  3IN5 A;  3GJX B;  4MV3 A;  3VMM A;  2JA7 G;  3J7A K;  5IT9 W;  4C5A A;  4O3S A;  3QZ7 A;  2HHF B;  4G3I A;  2DWC A;  4QWA A;  4RNM A;  3ETH A;  4I50 F;  3JZ6 A;  3H0G A;  4BBS G;  4CMF A;  4ZQI A;  4ED0 A;  2RGR A;  4O81 A;  5IP9 G;  1EKV A;  4C2M A;  2QF7 A;  2FKL A;  2DAA A;  1DIK A;  5F9L A;  3HOZ G;  4DV3 H;  5KFE A;  4TM5 A;  4CMD A;  2VQF H;  2FPP B;  4IZO A;  1JX4 A;  2JA5 G;  4A2A A;  1S68 A;  4M7E A;  2I87 A;  4YBZ B;  3WWJ A;  4RNO A;  3T1Y H;  5IYC G;  5KT3 A;  3ORR A;  4Q43 A;  3AW8 A;  4J9P A;  4A3E G;  5T14 A;  4J9Q A;  5KG0 A;  2HHH H;  2QYZ A;  4A3J G;  3JZF A;  2FMA A;  4DR5 H;  4X66 H;  2HIX A;  3RAX A;  2DPI A;  1P8L A;  5KFM A;  3PZP A;  2YWV A;  4NZM A;  1S0O A;  4EGJ A;  4HYK A;  3JRW A;  1RJQ A;  5FJ8 G;  3HKZ A;  3PO2 G;  3H20 A;  3BQ0 A;  2JEJ A;  3HOV G;  4J9S A;  1S03 G;  4DR3 H;  1K83 A;  2W70 A;  1EKP A;  2YZG A;  2R84 A;  4IRK A;  3LML A;  1K1S A;  2FK3 A;  4LSA A;  3SNO A;  5D1O A;  4YQW A;  2W6N A;  4FBT A;  4TV9 F;  3T9E A;  2W6Q A;  4LF8 H;  4RB1 A;  2R7Z A;  3R23 A;  3KXY T;  1T36 A;  2HGW A;  3HXL A;  4O82 A;  2NUA B;  3WO0 A;  3RBE A;  1EHI A;  2C2R A;  3MFH A;  5HNE A;  2C35 B;  3WNZ A;  5KG2 A;  3QFF A;  4HN2 A;  5KFJ A;  4MV4 A;  2CW8 A;  3PR4 A;  4JI4 H;  1IBK H;  1VS0 A;  2OLS A;  3MWD A;  5LA6 F;  5KFB A;  4EFE A;  1IYE A;  3VNN A;  2W57 A;  2Q2T A;  2Z04 A;  1ZAU A;  3UFX B;  3LWB A;  2COG A;  4RAY A;  3GV7 B;  2YZM A;  4RCN A;  4I7H A;  3RB4 A;  2R6F A;  4EBD A;  4RUA A;  3PR5 B;  4ED6 A;  1IOW A;  5FLM G;  1KJJ A;  3K5I A;  2W7P A;  2FLN A;  4XYL B;  3H4D A;  4ECR A;  4JI1 H;  4LFC H;  3PW0 A;  3W1G A;  2NVY A;  4LF7 H;  3TII A;  3RB6 A;  3OSP A;  4WHX A;  3GTK A;  5BWX A;  3JZI A;  4ED8 A;  3V6H A;  5CM0 A;  2ASL A;  3L4K A;  2VUG A;  4K6N A;  4O3P A;  4Q44 A;  3Q2O A;  3R9R A;  2HVQ A;  3ORQ A;  3JRX A;  5J2U F;  5KFR A;  2UUC H;  3GTQ A;  1E4E A;  2WDT A;  2AQ4 A;  4QJF A;  1N32 H;  2CFM A;  5F9N A;  1FVI A;  5KT6 A;  4EGQ A;  4ED2 A;  4O7T A;  4BBR G;  2WTF A;  1KBL A;  4DRF A;  3H0G G;  5C4X G;  4DR2 H;  3RUP A;  3MR2 A;  5I5V A;  3T9C A;  4HNU A;  1Y1V A;  1GO3 E;  3NGD A;  4JI8 H;  5KFT A;  5BR8 H;  4MTE A;  2W9A A;  5EWE A;  4Q45 A;  3H40 A;  4ECY A;  4ED7 A;  3T9F A;  2JA6 A;  2YYA A;  2R8G A;  1I6U A;  1MZB A;  5KG3 A;  4DR6 H;  4JV5 H;  2NU8 B;  4FE2 A;  2Z02 A;  3MR3 A;  4ECQ A;  3EPI A;  4ZOL F;  2GQS A;  5JUM A;  2EJ2 A;  4GLW A;  5FNV F;  3T5L A;  1SFO A;  1TA8 A;  3G6Y A;  2NU9 B;  4A2B A;  4LFA H;  3GB8 B;  2JEG A;  4EEQ A;  2O03 A;  5LL6 b;  3CQZ A;  2WAQ A;  2AU0 A;  2XCL A;  2DPJ A;  3G6V A;  4RZQ A;  1CS0 A;  4DAA A;  4ECU A;  3GTJ A;  4UCS A;  4QW9 A;  1JLL B;  2XCP A;  3V6J A;  5KG5 A;  2YRW A;  5DG8 A;  1S97 A;  5CB4 F;  2R85 A;  3HOX G;  4MV6 A;  1V4Y A;  3T5K A;  3QWU A;  4YAK B;  1WRV A;  2CZG A;  3UQ8 A;  4AYB A;  3GIJ A;  1FJG H;  2UUA H;  5K2M A;  4EYI B;  3SE7 A;  3U54 A;  2J6U A;  4QSH A;  4PZ8 A;  5C3E G;  1I2L A;  3L2P A;  5BMV F;  1S10 A;  4B3T H;  3NC0 B;  5KFO A;  4A3L G;  1B6R A;  2WAQ E;  4C5C A;  2YCH A;  1G2W A;  2R92 G;  1JDB B;  3TY8 A;  1A0G A;  1OWT A;  2ODT X;  3VA7 A;  1RK5 A;  4ETS A;  3QZ8 A;  1R9T A;  2WE6 A;  4AQY H;  2V59 A;  2W6O A;  2YRX A;  4O7L A;  2Y0S A;  4AYB E;  3KAJ A;  2R7L A;  5BYA A;  1TWF A;  3MWM A;  1A0I A;  4WD3 A;  4O3R A;  2E2H A;  1VAJ A;  4EQ5 A;  5K3W A;  4YHH H;  2PBZ A;  3TY9 A;  4E4T A;  5KS8 A;  3KTM A;  3N40 P;  2R93 A;  1Y1W G;  5HV6 A;  2E2I A;  2C22 A;  3M9M B;  5DLG A;  2OH2 A;  4KHP H;  1GSH A;  2FPI B;  4UCR A;  4RNN A;  5IWA H;  2FLL A;  4APM A;  5EDW A;  3PW5 A;  2EJ0 A;  4ME6 A;  1AN7 A;  4DQN A;  3G6X A;  2Y0S E;  4FGR A;  2GLT A;  1VKZ A;  4CKB A;  3LP8 A;  5BWW A;  4QWD A;  4NXN H;  2V5A A;  3EYY A;  5CR5 A;  3JSL A;  1M6V A;  4BY7 G;  2HVR A;  4A3C G;  3T99 A;  4LFB H;  5KT5 A;  2IP4 A;  1A48 A;  3T9B A;  4A3F G;  1CKN A;  3T5J A;  3Q8S B;  4ECW A;  1DAA A;  2DAB A;  2UVU A;  1KUT A;  2JEI A;  4FFO A;  1TAE A;  5C1O A;  3DTG A;  3OUU A;  3T5H A;  1KJI A;  4CHI A;  3G8D A;  2RF4 A;  2HHF A;  2VOB A;  2CW7 A;  4YY3 H;  4JI7 H;  2VA3 A;  3HB9 A;  2NVX A;  2UXC H;  4UCO A;  1S0N A;  2XD4 A;  3CSW A;  3OUZ A;  1N33 H;  4FU0 A;  4IR9 A;  4O4I F;  4RZR A;  1Y1V G;  2YU9 A;  1HNW H;  3BA8 A;  4R8U B;  5H80 A;  2CNV A;  1I1K A;  5KFD A;  1GGO A;  2YS7 A;  4F50 A;  2JA6 G;  4FM9 A;  1RK6 A;  4BWS C;  2ABJ A;  4MV1 A;  3RGZ A;  5KT4 A;  1GYF A;  2VPS A;  2W6Z A;  2UVR A;  4PZ7 A;  2HJW A;  2W8L A;  5IYD G;  5J2T F;  3NBY B;  4O3O A;  3RFC A;  3EPG A;  1IBL H;  4IR1 A;  4IRC A;  1ULZ A;  5DG9 A;  4RUC A;  4DV1 H;  1FKA H;  2WB1 A;  5DQI A;  4EBE A;  3RB0 A;  2IBK A;  4O2B F;  1SYX B;  3OSN A;  3RV3 A;  2UU9 H;  5KFV A;  2XGP A;  3U0G A;  4RB2 C;  2R92 A;  3PVX A;  4CKC A;  3BG5 A;  2KSW A;  1N36 H;  4O7N A;  5I47 A;  4O4H F;  2W9C B;  2Q2U A;  3RGX A;  5DGA A;  1N48 A;  3HKZ E;  4O3N A;  2J6S A;  5JH7 F;  1AUX A;  5BYB A;  2WB1 E;  4NYE A;  4M0J A;  2FB9 A;  3TW6 A;  4JI2 H;  3J81 W;  3GIM A;  2HG8 A;  1CKO A;  2YL2 A;  3GID A;  4PBC A;  3N6X A;  1RYR A;  5BWV A;  1KEE A;  2M05 A;  2V9W A;  1DGS A;  5KFH A;  3V4Z A;  1ZET A;  4K0K H;  2EJ3 A;  1Y1W A;  4CKE A;  2C28 A;  1I3Q A;  5L1K A;  1CKM A;  4O7Z A;  4IRD A;  1XK5 A;  3VPC A;  2CNQ A;  3DAA A;  5DAA A;  1E4G T;  4A3B G;  3G8C A;  2C00 A;  3K3P A;  5DMX A;  5KFP A;  4YR3 A;  4FFR A;  1A9X A;  4WBN F;  4UCU A;  4Q4D A;  3GIK A;  4J9N A;  2XIG A;  1I1M A;  5L1I A;  3U9T A;  2R93 G;  3PN1 A;  2R8K A;  2NU6 B;  4DV5 H;  1ZHQ A;  5A2Q W;  4MA0 A;  4YAJ B;  5DIS C;  5CA0 F;  5DQG A;  4O84 A;  3UZO A;  5BPH A;  3VPB A;  1ZQ7 A;  1C30 A; 
#chains in the Genus database with same CATH homology
 2WYO A;  2CQY A;  1VBH A;  5EZY F;  1AUV A;  1EUD B;  2W6P A;  2YZL A;  2YW2 A;  4XYM B;  3RV4 A;  2J9G A;  4O7V A;  4MV9 A;  1CQI B;  1EUC B;  1C3O A;  1UC8 A;  3KRE A;  1PK8 A;  4FFP A;  5BPF A;  2X0S A;  3GLK A;  1CQJ B;  5LXT F;  4HQ6 A;  5LYJ F;  3NUA A;  2HGS A;  4YB8 B;  3VPD A;  5JQW A;  4FFN A;  4DIM A;  1JDE A;  3HBL A;  1OBG A;  2R7K A;  1VBG A;  4Y8V B;  4O7Y A;  4YJ3 F;  4YJ2 F;  2CNU A;  4O83 A;  1EYZ A;  2NU7 B;  2R82 A;  1KJ9 A;  2DIK A;  3N6R A;  4IWX A;  3Q1K A;  2GQR A;  1JKJ B;  2VPQ A;  4HR7 A;  4TV8 F;  2I80 A;  2ZDH A;  2GPW A;  3HO8 A;  1W93 A;  5KX5 F;  4M9U A;  2W71 A;  3E5N A;  4O4L F;  1I7L A;  2R7M A;  3KAL A;  4TUY F;  3V4S A;  2VQD A;  2YS6 A;  5C8Y F;  5C1P A;  2R86 A;  4ZHQ F;  4XZ3 B;  2VR1 A;  4IWY A;  4I55 F;  5LOV F;  4DLK A;  2PVP A;  5LP6 F;  1DV1 A;  5IYZ F;  4C5B A;  4FFM A;  3N8D A;  1W96 A;  1UC9 A;  1BNC A;  1BXR A;  1Z2N X;  5JVD F;  4HNV A;  2R87 A;  2FP4 B;  4IHJ F;  3TIN A;  3U9S A;  1M0W A;  2DZD A;  3U55 A;  2PN1 A;  3TQT A;  2I8C A;  1EZ1 A;  1IOV A;  3I12 A;  4HNT A;  4O7W A;  2GPS A;  3KAK A;  2YZN A;  4O7R A;  2QK4 A;  5JVL A;  3AX6 A;  5JQG F;  5CA1 F;  5KKN B;  4O2A F;  1KJ8 A;  1GSA A;  1E4E B;  5GON F;  4FFL A;  4IIJ F;  2FPG B;  3R5F A;  3R5X A;  1GLV A;  1GSO A;  1DV2 A;  4MV7 A;  4MAM A;  2DLN A;  5HBR B;  2W6M A;  1CE8 A;  4O86 A;  4ZI7 F;  5CAE B;  4MA5 A;  2P0A A;  4EG0 A;  4O4J F;  1B6S A;  1KJQ A;  4O7S A;  3VOT A;  1Z2P X;  1KC7 A;  5D8D A;  1WR2 A;  2R7N A;  1SCU B;  2V58 A;  4XX0 B;  3MJF A;  4L1K A;  2ZDG A;  3TIG A;  4I4T F;  1OBD A;  3K5H A;  1Z2O X;  1I7N A;  1PX2 A;  3DF7 A;  1M0T A;  2SCU B;  3WO1 A;  3MWE A;  3R5H A;  3ETJ A;  4MV8 A;  2ZDQ A;  4MV3 A;  3VMM A;  4C5A A;  2DWC A;  3ETH A;  4I50 F;  4ZQI A;  4O81 A;  2QF7 A;  1DIK A;  2FPP B;  4IZO A;  2I87 A;  4YBZ B;  3ORR A;  3AW8 A;  3JZF A;  2YWV A;  4EGJ A;  3JRW A;  2W70 A;  2YZG A;  2R84 A;  2W6N A;  4TV9 F;  2W6Q A;  3R23 A;  1T36 A;  4O82 A;  2NUA B;  3WO0 A;  1EHI A;  3WNZ A;  3QFF A;  4MV4 A;  2OLS A;  3MWD A;  5LA6 F;  2Z04 A;  3UFX B;  3LWB A;  2YZM A;  2R6F A;  1IOW A;  1KJJ A;  3K5I A;  4XYL B;  3TII A;  3JZI A;  3Q2O A;  3R9R A;  3ORQ A;  3JRX A;  5J2U F;  1E4E A;  4EGQ A;  4O7T A;  1KBL A;  3RUP A;  4HNU A;  2YYA A;  2NU8 B;  4FE2 A;  2Z02 A;  4ZOL F;  2GQS A;  5FNV F;  2NU9 B;  2XCL A;  4RZQ A;  1CS0 A;  1JLL B;  2YRW A;  5CB4 F;  2R85 A;  4MV6 A;  4YAK B;  2CZG A;  5K2M A;  3SE7 A;  3U54 A;  4QSH A;  5BMV F;  1B6R A;  4C5C A;  1JDB B;  3VA7 A;  2V59 A;  2W6O A;  2YRX A;  4O7L A;  3KAJ A;  2R7L A;  4WD3 A;  2PBZ A;  4E4T A;  5HV6 A;  1GSH A;  2FPI B;  4ME6 A;  4FGR A;  2GLT A;  1VKZ A;  3LP8 A;  2V5A A;  1M6V A;  2IP4 A;  1A48 A;  1KUT A;  4FFO A;  5C1O A;  3OUU A;  1KJI A;  3G8D A;  3HB9 A;  2XD4 A;  3OUZ A;  4FU0 A;  4O4I F;  5H80 A;  2CNV A;  1GGO A;  2YS7 A;  4MV1 A;  2W6Z A;  2HJW A;  5J2T F;  3RFC A;  1ULZ A;  4O2B F;  3RV3 A;  3BG5 A;  4O7N A;  5I47 A;  4O4H F;  5JH7 F;  1AUX A;  4NYE A;  3TW6 A;  2FB9 A;  2YL2 A;  3GID A;  1KEE A;  3V4Z A;  4O7Z A;  3VPC A;  2CNQ A;  3G8C A;  2C00 A;  3K3P A;  5DMX A;  4FFR A;  1A9X A;  4WBN F;  3U9T A;  2NU6 B;  4MA0 A;  4YAJ B;  5CA0 F;  4O84 A;  5BPH A;  3VPB A;  1C30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...