5HBRB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 67
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5hbrB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5hbrB02
2YRWA 4L1KA 3BG5A 4WD3A 2NU9B 5BPFA 5I47A 1GLVA 1KJIA 4MV1A 4XYLB 2V58A 3NUAA 4C5BA 3G8DA 5JVDF 4HNVA 4O81A 5HBRB 1A48A 2NU7B 2ZDHA 4QSHA 3KALA 2XD4A 5LP6F 2IP4A 4YB8B 4IWXA 1A9XA 2W71A 2I87A 3V4ZA 4FFPA 3MJFA 2YWVA 2CZGA 1W96A 1DV2A 1KJQA 1CQJB 4Y8VB 4O83A 1B6SA 4ZQIA 4IIJF 1CQIB 4NYEA 2QF7A 5EZYF 2SCUB 4I55F 5CB4F 4O7YA 5CAEB 3TQTA 3TINA 4FGRA 3TIIA 3AX6A 4HNUA 4ZI7F 3V4SA 3R23A 4C5CA 4I50F 4TUYF 4HNTA 1CS0A 1EUCB 4FU0A 5LXTF 2Z02A 2GPWA 2NUAB 2W6NA 4O4LF 3N6RA 2DZDA 3R5FA 2W6OA 3RFCA 3WNZA 3N8DA 4ME6A 1M0WA 5K2MA 3U9SA 2CNVA 4MV4A 4FFNA 2V59A 5LA6F 2R85A 2R87A 2W70A 1ULZA 2FP4B 1GSOA 2VQDA 2YS6A 5JQGF 3KAJA 4O7WA 4MV3A 5C1PA 3I12A 5KKNB 3VA7A 2XCLA 1VBHA 1PX2A 1GSAA 2FPGB 2V5AA 1DIKA 4ZHQF 5C1OA 1OBGA 3VMMA 3DF7A 4O7SA 2W6PA 2FPIB 3JRWA 5JH7F 4IZOA 3VPBA 1GSHA 4XYMB 4O2AF 4MA0A 2P0AA 1I7NA 4MV9A 5J2UF 1PK8A 4E4TA 3WO1A 4YBZB 3R5XA 4O82A 2R82A 5CA1F 1KJ9A 3RV3A 1C30A 5LOVF 1VKZA 4YJ2F 5D8DA 4O4HF 2R86A 2HGSA 2OLSA 4O2BF 2DIKA 3VOTA 2R84A 5BPHA 1JDBB 1SCUB 4FFLA 1IOWA 1CE8A 2YYAA 2YZMA 4C5AA 1KJJA 4IWYA 4HQ6A 4MV8A 3OUZA 1E4EB 3JRXA 1EYZA 3HBLA 3TIGA 1Z2OX 1BNCA 3ORRA 3U54A 4O7NA 2YS7A 1T36A 1KBLA 2PN1A 1KC7A 3VPCA 2Z04A 3K5IA 4HR7A 4O7TA 3RV4A 2DWCA 2C00A 5GONF 1KEEA 5IYZF 3U9TA 1I7LA 2CNQA 4TV9F 1M0TA 3VPDA 3RUPA 1JDEA 2GLTA 1GGOA 2R7LA 5J2TF 3R5HA 1AUXA 4WBNF 2FPPB 2X0SA 2GPSA 2W6ZA 4O84A 4O7VA 1AUVA 3ETJA 2GQSA 3E5NA 1Z2PX 4EGQA 4O4JF 1WR2A 1EUDB 2FB9A 2YZLA 5KX5F 4FE2A 3SE7A 2WYOA 3OUUA 4XX0B 4MV6A 1W93A 2NU6B 4ZOLF 5HV6A 4MV7A 1IOVA 4EGJA 3GLKA 2YZNA 2VR1A 2R6FA 4RZQA 4DIMA 3R9RA 3KREA 2DLNA 3ETHA 4YAJB 5C8YF 4XZ3B 2YL2A 5FNVF 2W6QA 1BXRA 4O7LA 2I8CA 2YRXA 2R7NA 2GQRA 2R7MA 2W6MA 3AW8A 3MWDA 4MAMA 4DLKA 3KAKA 4TV8F 3JZIA 5BMVF 5LYJF 4YJ3F 3ORQA 2VPQA 3TW6A 5CA0F 5H80A 5DMXA 1E4EA 3G8CA 1JKJB 1M6VA 2ZDGA 4IHJF 3HB9A 3UFXB 4O4IF 3Q2OA 3HO8A 4MA5A 2QK4A 1UC8A 1KJ8A 2I80A 1OBDA 1Z2NX 4I4TF 3QFFA 4M9UA 1VBGA 3Q1KA 4O7ZA 3LWBA 4O7RA 5JQWA 4FFRA 2PVPA 4EG0A 3K3PA 3MWEA 2YZGA 3JZFA 2J9GA 2ZDQA 1EHIA 3GIDA 1EZ1A 1KUTA 3WO0A 1UC9A 1JLLB 3LP8A 1C3OA 2R7KA 2PBZA 1B6RA 2YW2A 4YAKB 2CQYA 5JVLA 4O86A 4FFOA 3K5HA 2CNUA 2HJWA 3U55A 1DV1A 2NU8B 4FFMA
chains in the Genus database with same CATH superfamily
2OWOA 2FK1A 5DQHA 1V51A 3U0GA 4A3FG 4B3TH 1XNQH 5I5TA 1N56A 2R93A 2YRWA 4L1KA 3BG5A 1GYFA 2RDJA 4J9SA 2ASJA 4J0MA 4LF9H 5EWFA 2R92G 4WD3A 4DR3H 3EYYA 4O3QA 3BABA 5KFMA 4F4ZA 2NU9B 5KFRA 3HXLA 5F9NA 4LF7H 5BPFA 5I47A 1A3GA 3CQZA 4ECSA 1GLVA 1KJIA 1EKPA 4MV1A 2CKZB 3BAAA 5F9LA 1K1SA 3GTOA 3HOVG 5KS8A 4XYLB 4BXXG 2V58A 4PDBA 2UVVA 5L9XA 1ZETA 3PFFA 3GTPA 4RUAA 1VS0A 3NUAA 2R8GA 5KFCA 4C5BA 4YY3H 3NC0B 3HT5A 5IYBG 1EKVA 2W9CB 4FS1A 1GO3E 3G8DA 5JVDF 1IBLH 4YR2A 1TAEA 5KG3A 1I2LA 4HNVA 3BQ1A 2JEJA 4Q8EA 4O81A 2W8KA 1V4YA 3PW4A 4DL6A 3V6JA 4CMFA 5HBRB 4CE5A 1A48A 4EEQA 4E6NA 3BQ0A 2DPJA 2FJZA 3PN1A 2DABA 2NU7B 4PBCA 2ZDHA 2WAQE 4JI0H 4RAZA 4QSHA 3KALA 1CKNB 2XD4A 5KFLA 4ED8A 5KT2A 4NZMA 4DV1H 2AGOA 1RYSA 5DGBA 3RB4A 5EWGA 2OH2A 2RDIA 3JZ6A 1E4GT 3TY8A 5LP6F 1XMQH 2IP4A 2B63G 4DR6H 4YB8B 1S97A 3GJXB 5I5WA 4IWXA 1TWGA 5IWAH 1A9XA 4RB3C 5I60A 2XGPA 2W71A 5LMUH 3OSPA 2E2HA 2I87A 3V4ZA 4CKCA 2AU0A 3FKIG 4LH6A 4FFPA 4J9KA 3MJFA 4ECTA 3GTKA 2FKLA 2YWVA 4AQYH 5HNEA 4ED0A 3H4BA 3GB8B 2VA3A 3EPIA 2CZGA 4RNOA 3N41B 2W8LA 1W96A 4O3SA 1M7JA 4YP3A 4LF8H 4EYIB 1DV2A 2R93G 2J6UA 1KJQA 2BR0A 3GTJA 4UUGA 4ED7A 1CQJB 3T5HA 4Y8VB 2IBKA 2ZJTA 4DV5H 4A93G 2Y0SE 4O83A 4TVIA 5KFEA 1WH2A 5I5XA 1B6SA 5I5VA 4LH7A 4ZQIA 4J9OA 2FLPA 4IIJF 1B33N 1CQIB 4NYEA 2QF7A 5EDWA 3T7AA 5EZYF 2E2IA 2SCUB 2R8HA 2Q7DA 3GV7B 1XK5A 4OX9H 2COGA 1S10A 3NBYB 4I55F 1RYRA 5C3EG 2HVRA 4CC6A 3LULA 4DAAA 5CB4F 4O7YA 3G6VA 2YCHA 1A0IA 5CAEB 3KTMA 3GTQA 3NBZB 3NGDA 5KFNA 3V6KA 5FPRA 3TQTA 4A3BG 1XDNA 3TINA 4FGRA 3TIIA 3LMLA 3AX6A 5FLXW 2WB1A 1RK6A 4C2MA 4HNUA 4O3OA 5CM0A 4PZ8A 1SEIA 5KFFA 4ZI7F 4JYAH 3V4SA 3OTOH 3R23A 4C5CA 4Q43A 4I50F 4X64H 1V9PA 4TUYF 3HOWG 4HNTA 1CS0A 1EUCB 4FU0A 3RB0A 4Q8FA 3KXYT 3RBDA 4BY7G 1Y1WA 4A3IG 4M0JA 4GKKH 2DAAA 4FM9A 1SFOA 1MZBA 5LXTF 2FK2A 5L1LA 3GV8B 3GV5B 3GIQA 1ET0A 2Z02A 2GPWA 3GIJA 2AGPA 4QIWE 5DGIA 2NUAB 5KFUA 2W6NA 4DL2A 4O4LF 1R9TA 3N6RA 2V4RA 1J5EH 2DZDA 3MR2A 1KT8A 3HOUG 4RU9A 3R5FA 4QJFA 2W6OA 5D1PA 4DQNA 1ZHQA 3RFCA 1TWFA 3FDSA 4R8UA 3WNZA 1HNXH 3N8DA 4LF6H 2UUBH 4J9PA 4ME6A 5CR5A 5D1OA 4ECVA 1M0WA 5K2MA 2RGVA 2W57A 5KG5A 1N48A 5L1KA 4GKJH 4A3EG 2RF4A 2JA7A 1RJRA 3U9SA 2CNVA 4MV4A 4FFNA 2V59A 5LA6F 4IR9A 4CC5A 2R85A 4JI2H 4DL3A 5DLFA 2UXDH 2R87A 3RR5A 4AYBA 1DGSA 2W70A 1ULZA 1N33H 2FP4B 1GSOA 4DV0H 3IN5A 2DPIA 1XNRH 1K1QA 2VQDA 2C22A 2J6SA 1ZHSA 2ZGIA 4GLXA 2YS6A 5JQGF 2J6TA 1I1KA 1I50A 4GC6A 1I6UA 4BY1G 2BQ3A 3KAJA 1RJQA 2COJA 4JI7H 4EBDA 4O7WA 1FVIA 3T9EA 4MV3A 4RCNA 4EQ5A 4J9MA 5C1PA 4DR7H 3I12A 4NLGA 4HYKA 1IBMH 1Y1WG 5KKNB 3QWUA 3W1GA 2W9CA 3G6YA 5L1IA 3H3VH 3HKZE 4R7RA 3VA7A 3RGZA 2XCLA 5C44G 4J9NA 2V9WA 4A3LG 1VBHA 2HVQA 4TM5A 4QW8A 3H4DA 2JA6A 1PX2A 4ECYA 3OHAA 4O3PA 5I5UA 1GSAA 4DUYH 4JV5H 4K0KH 2M05A 2FPGB 3GTMA 1WSCA 4RAYA 3GIPA 1IYDA 5A2QW 1CKNA 2V5AA 1DIKA 4ZHQF 5C1OA 3PO3G 1WRVA 2FE3A 2FMAA 1OBGA 2HHFB 3V6HA 4UCRA 3VMMA 3DF7A 4O7SA 5CE8A 4NXMH 2W6PA 2FPIB 3PR4A 1N32H 4DV6H 3JRWA 5JH7F 4IZOA 4IRCA 3VPBA 1GSHA 4JUZA 2JA8G 4A3DG 3BA8A 4XYMB 2HDKA 4UCVA 2V4QA 3L4KA 1K83A 4O2AF 4QWDA 4MA0A 3LQSA 2ALZA 5K3WA 2CFMA 2P0AA 1I7NA 4MV9A 4JV0A 5J2UF 4JI4H 3N6XA 4LFCH 1G2WA 4A3CG 3KYHC 2VUGA 1PK8A 5DGAA 2FLNA 4E4TA 2EJ3A 3WO1A 2UVWA 4IRKA 2JA7G 4YR0A 4YBZB 3T5JA 4DL4A 3R5XA 2UUCH 4O82A 2EJ0A 2R82A 2X5RA 1I2KA 5FJ8G 3MR5A 3K3VA 3J80W 4X65H 5CA1F 1KJ9A 3RV3A 5DQGA 4F50A 1DAAA 2JEGA 4ECUA 3GIKA 3RIZA 4HN2A 5E25A 1C30A 2Q2UA 3PW2A 5LOVF 1TA8A 1X9NA 3T1HH 2R8JA 1VKZA 1HNZH 4LFAH 3AYHB 4YJ2F 5KFHA 2JEFA 5D8DA 5KG0A 5EOYA 4O4HF 2R86A 2HGSA 1EKFA 2OLSA 3S24A 3RGXA 4GLWA 4O2BF 2PMZA 5KFTA 2DIKA 5DISC 5KG1A 3KHRA 3BJYA 4ED6A 2W9AA 4JI1H 2EJ2A 1S03G 3HOYG 2VPSA 2R84A 3VOTA 5BPHA 1Y1VA 2JA6G 1JDBB 5BWTA 1SCUB 2JA5A 4FFLA 2NVYA 3TEKA 1IOWA 1CE8A 2YYAA 2YZMA 5KFYA 4C5AA 1KJJA 3W5OA 5KFQA 5KFDA 4IWYA 5KT5A 4HQ6A 4MV8A 3OUZA 4APMA 1TWAA 2FK3A 1E4EB 3JRXA 1EYZA 3HBLA 2HGWA 3KHGA 5KFIA 3TIGA 3MFIA 1Z2OX 1I1LA 3DTGA 2HIXA 4FBUA 1N36H 1BNCA 3QZ8A 2VUMG 2AGQA 3ORRA 2W7OA 3QQMA 4RNMA 3U54A 5IT9W 3OHBA 5KFWA 3TY9A 3M9NB 4X66H 2R8IA 2FLLA 3PW7A 4O7NA 3BQ2A 2YS7A 3Q8RB 1P16A 5KG7A 3QZ7A 4B3RH 1T36A 1KBLA 2VA2A 4JV1A 2PN1A 5KT4A 4JI5H 1CKMA 4U7CA 1KC7A 4DR1H 4J9LA 4ECZA 1ZAUA 4ED1A 4TQSA 1T3NA 5KG6A 5DG7A 3VPCA 2Z04A 2YU9A 3K5IA 4HR7A 4O7TA 3RV4A 2WAQA 4LSAA 2DWCA 5KFVA 2C00A 3DAAA 5GONF 4DV3H 4MTEA 1KEEA 5IYZF 4JXUA 4Q44A 4DV7H 3RB6A 2HG8A 3U9TA 3N40P 3Q8SB 4QWBA 1I7LA 2CNQA 4TV9F 1M0TA 2ODTX 5KG4A 3VPDA 4F4YA 3RUPA 3N43B 1JDEA 4EFBA 3Q8PB 5DQIA 2AQ4A 4JI6H 4DV4H 2GLTA 5KG2A 1GGOA 2R7LA 2XC9A 4A3MG 3GIIA 5T14A 2C2DA 5J2TF 4DR4H 2JEIA 4DRFA 3R5HA 1Y1VG 4NZNA 3T54A 1TWCA 5FLMG 4PZ7A 3CEBA 2JA5G 1AUXA 2NVXA 3M9MB 4WBNF 1XMOH 3PW5A 2C35B 2FPPB 2X0SA 5KFAA 2XGQA 2GPSA 2W6ZA 4O84A 4UFZA 2ABJA 1AUVA 4O7VA 4CKBA 3ETJA 2Y0SA 3T1YH 2GQSA 3E5NA 1Z2PX 4A2BA 1RK5A 4EGQA 4O4JF 4BBRG 5BR8H 4EBCA 1N34H 3SNOA 5KT7A 1WR2A 5L1JA 1EUDB 3PW0A 2FB9A 2YZLA 4EEYA 3RAQA 4DV2H 2XCAA 5KX5F 3G6XA 5BYAA 5DG8A 3MR3A 3IG0A 2ASDA 3F8NA 3RF2A 1FJGH 4FE2A 3SE7A 4CHIA 2WYOA 5KFPA 2BQRA 2W9BB 5FPOA 4EFEA 4RNNA 3OUUA 4XX0B 2HVSA 4MV6A 4UCSA 3JSLA 1W93A 4Q4CA 3PZPA 1S0NA 1JXLA 2ATLA 3BA9A 2NU6B 2WB1E 4RUCA 4ED3A 3MR6A 4J9QA 4I7HA 1S0MA 4ZOLF 5KFOA 5HV6A 4DUZH 4MV7A 1S68A 2HHFA 3UZBA 4RB0A 4EYHB 4Q4DA 1T94A 3TW7A 3SI8A 3C0FB 4UCTA 2MCTA 3H20A 3M4IA 1IOVA 4F4WA 4EGJA 4MTDA 5KFBA 5FD5A 3GLKA 5BYBA 4RB2C 1KTAA 2VR1A 2YZNA 1Y14B 2VUMA 5KFJA 2VQEH 2R6FA 3TY5A 4RZQA 4DIMA 3M9OB 2RGRA 1VAJA 3H0GA 2ASLA 3R9RA 3H40A 3KREA 3T5KA 1RJPA 5BWWA 4PWQA 2DLNA 2HIVA 3ETHA 4YAJB 5C8YF 4BWSC 2YL2A 4XZ3B 3PVXA 2BQUA 2HHHH 5C5JA 5FNVF 2XCPA 5LL6b 2EIYA 2F4VH 2W6QA 1WCMA 2R7ZA 3UZOA 5JUMA 1B04A 4M7EA 2UVUA 1BXRA 4O7LA 2I8CA 3Q8QB 2YRXA 4LMYA 4QIWA 2R7NA 3I4MG 2XIGA 4LFBH 4FBTA 2E5LH 2GQRA 4ECRA 1O75A 2C2RA 5EWEA 1S9FA 2R7MA 3TQ1A 2W6MA 3HOXG 4ED2A 1BGWA 3AW8A 4CMDA 4QW9A 3MWDA 4MAMA 3UQ8A 3MFHA 4A3KG 3RB3A 5DAAA 1I3QA 4DLKA 3KAKA 4O3NA 1E4FT 4A2AA 4RB1A 5BWXA 4YR3A 4TV8F 5BWVA 3JZIA 3EPGA 4DL5A 3PR5B 5BMVF 1IYEA 4GC7A 5I5SA 2O03A 5LYJF 4PZ6A 2VQFH 4JI3H 4YJ3F 3ORQA 5IP9G 3T9CA 5DGHA 3FMAA 2HGXA 4CKEA 5KFSA 4AYBE 1I94H 4NXNH 5IP7G 4U6PA 2VPQA 4QWAA 4J9RA 3VNNA 5BWUA 3N42B 4LSXA 5IYDG 2CW8A 3TW6A 1A0GA 5CA0F 5H80A 3WWHA 1ZQ7A 3KHHA 5DMXA 2C2EA 4G3IA 1E4EA 2Y4RA 1P8LA 2WE6A 4JV2A 5DLGA 3GDEA 3G8CA 1JKJB 1M6VA 4NZOA 4ECXA 1HR0H 4UCOA 3RTXA 3T9FA 4FS2A 3T9AA 2WTFA 1L2ZA 4Q0YA 1FKAH 2UXCH 1CKOA 2ZDGA 1HNWH 4IHJF 3I4NG 3GTLA 4DL7A 2A1HA 3HB9A 3UFXB 5KFGA 4O4IF 4X62H 5FR9A 5FD6A 3Q2OA 3HO8A 4MA5A 4ETSA 5IYCG 2QK4A 3L4JA 4DR5H 1UC8A 1KJ8A 2I80A 3N44B 1TWHA 4YQWA 3HOZG 3H0GG 3HKZA 1OBDA 1Z2NX 4IAJA 3CVZA 4I4TF 3QFFA 4IR1A 4M9UA 1VBGA 3Q1KA 2R92A 4O7ZA 3SGIA 1JIHA 3RBEA 3LWBA 4O7RA 2Q2TA 3GIMA 1WCMG 2UU9H 2R7ZG 4WHXA 5JQWA 3PO2G 2C28A 4LF4H 4FFRA 1AN7A 4ECWA 1JX4A 2PVPA 4EG0A 2QYZA 3KHLA 3K3PA 3MWEA 3W1BA 4YHHH 2YZGA 4IRDA 3JZFA 4K6NA 5BWRA 2J9GA 2ZDQA 1EHIA 3GIDA 2CW7A 3MWMA 1EZ1A 3T99A 1KUTA 4QWCA 4Q45A 2QB5A 3RAXA 3WO0A 5KFZA 4DR2H 1S0OA 1UC9A 4B3SH 1JLLB 4B3MH 2W7PA 3LP8A 3JSNA 3L2PA 1UNNC 3T5LA 2IMWP 3CSWA 5KFXA 1C3OA 1I1MA 4LF5H 2R7KA 3JAMW 2PBZA 1B6RA 1BJTA 5KT3A 4A3JG 3GILA 5KT6A 2YW2A 3GTGA 2UUAH 4RZRA 4JI8H 3GQCA 4YAKB 3DTFA 2CQYA 2IA6A 5JVLA 5I5YA 3T9BA 4ECQA 2R8KA 2VOBA 4O86A 3J81W 3J7AK 4FFOA 4UCUA 5KFKA 4O3RA 4TQRA 4A3GG 5C4XG 1OWTA 2B63A 2ZM6H 3K5HA 2PMZE 4KHPH 3T9DA 4R8UB 2COIA 3FKIA 2CNUA 3WWJA 2HJWA 4F4XA 3BACA 5D1OB 3U55A 3RJ0A 5DG9A 1IBKH 4EBEA 4QWEA 2UXBH 3WWIA 2W9BA 3UYYA 1DV1A 2NU8B 1SYXB 3OSNA 4BBSG 4FFMA 5LMNH 2UVRA 2WDTA 2KSWA
chains in the Genus database with same CATH topology
2YRWA 4L1KA 3BG5A 4WD3A 2NU9B 5BPFA 5I47A 1GLVA 1KJIA 4MV1A 4XYLB 2V58A 3NUAA 4C5BA 3G8DA 5JVDF 4HNVA 4O81A 5HBRB 1A48A 2NU7B 2ZDHA 4QSHA 3KALA 2XD4A 5LP6F 2IP4A 4YB8B 4IWXA 1A9XA 2W71A 2I87A 3V4ZA 4FFPA 3MJFA 2YWVA 2CZGA 1W96A 1DV2A 1KJQA 1CQJB 4Y8VB 4O83A 1B6SA 4ZQIA 4IIJF 1CQIB 4NYEA 2QF7A 5EZYF 2SCUB 4I55F 5CB4F 4O7YA 5CAEB 3TQTA 3TINA 4FGRA 3TIIA 3AX6A 4HNUA 4ZI7F 3V4SA 3R23A 4C5CA 4I50F 4TUYF 4HNTA 1CS0A 1EUCB 4FU0A 5LXTF 2Z02A 2GPWA 2NUAB 2W6NA 4O4LF 3N6RA 2DZDA 3R5FA 2W6OA 3RFCA 3WNZA 3N8DA 4ME6A 1M0WA 5K2MA 3U9SA 2CNVA 4MV4A 4FFNA 2V59A 5LA6F 2R85A 2R87A 2W70A 1ULZA 2FP4B 1GSOA 2VQDA 2YS6A 5JQGF 3KAJA 4O7WA 4MV3A 5C1PA 3I12A 5KKNB 3VA7A 2XCLA 1VBHA 1PX2A 1GSAA 2FPGB 2V5AA 1DIKA 4ZHQF 5C1OA 1OBGA 3VMMA 3DF7A 4O7SA 2W6PA 2FPIB 3JRWA 5JH7F 4IZOA 3VPBA 1GSHA 4XYMB 4O2AF 4MA0A 2P0AA 1I7NA 4MV9A 5J2UF 1PK8A 4E4TA 3WO1A 4YBZB 3R5XA 4O82A 2R82A 5CA1F 1KJ9A 3RV3A 1C30A 5LOVF 1VKZA 4YJ2F 5D8DA 4O4HF 2R86A 2HGSA 2OLSA 4O2BF 2DIKA 3VOTA 2R84A 5BPHA 1JDBB 1SCUB 4FFLA 1IOWA 1CE8A 2YYAA 2YZMA 4C5AA 1KJJA 4IWYA 4HQ6A 4MV8A 3OUZA 1E4EB 3JRXA 1EYZA 3HBLA 3TIGA 1Z2OX 1BNCA 3ORRA 3U54A 4O7NA 2YS7A 1T36A 1KBLA 2PN1A 1KC7A 3VPCA 2Z04A 3K5IA 4HR7A 4O7TA 3RV4A 2DWCA 2C00A 5GONF 1KEEA 5IYZF 3U9TA 1I7LA 2CNQA 4TV9F 1M0TA 3VPDA 3RUPA 1JDEA 2GLTA 1GGOA 2R7LA 5J2TF 3R5HA 1AUXA 4WBNF 2FPPB 2X0SA 2GPSA 2W6ZA 4O84A 4O7VA 1AUVA 3ETJA 2GQSA 3E5NA 1Z2PX 4EGQA 4O4JF 1WR2A 1EUDB 2FB9A 2YZLA 5KX5F 4FE2A 3SE7A 2WYOA 3OUUA 4XX0B 4MV6A 1W93A 2NU6B 4ZOLF 5HV6A 4MV7A 1IOVA 4EGJA 3GLKA 2YZNA 2VR1A 2R6FA 4RZQA 4DIMA 3R9RA 3KREA 2DLNA 3ETHA 4YAJB 5C8YF 4XZ3B 2YL2A 5FNVF 2W6QA 1BXRA 4O7LA 2I8CA 2YRXA 2R7NA 2GQRA 2R7MA 2W6MA 3AW8A 3MWDA 4MAMA 4DLKA 3KAKA 4TV8F 3JZIA 5BMVF 5LYJF 4YJ3F 3ORQA 2VPQA 3TW6A 5CA0F 5H80A 5DMXA 1E4EA 3G8CA 1JKJB 1M6VA 2ZDGA 4IHJF 3HB9A 3UFXB 4O4IF 3Q2OA 3HO8A 4MA5A 2QK4A 1UC8A 1KJ8A 2I80A 1OBDA 1Z2NX 4I4TF 3QFFA 4M9UA 1VBGA 3Q1KA 4O7ZA 3LWBA 4O7RA 5JQWA 4FFRA 2PVPA 4EG0A 3K3PA 3MWEA 2YZGA 3JZFA 2J9GA 2ZDQA 1EHIA 3GIDA 1EZ1A 1KUTA 3WO0A 1UC9A 1JLLB 3LP8A 1C3OA 2R7KA 2PBZA 1B6RA 2YW2A 4YAKB 2CQYA 5JVLA 4O86A 4FFOA 3K5HA 2CNUA 2HJWA 3U55A 1DV1A 2NU8B 4FFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRW A;  4L1K A;  3BG5 A;  4WD3 A;  2NU9 B;  5BPF A;  5I47 A;  1GLV A;  1KJI A;  4MV1 A;  4XYL B;  2V58 A;  3NUA A;  4C5B A;  3G8D A;  5JVD F;  4HNV A;  4O81 A;  5HBR B;  1A48 A;  2NU7 B;  2ZDH A;  4QSH A;  3KAL A;  2XD4 A;  5LP6 F;  2IP4 A;  4YB8 B;  4IWX A;  1A9X A;  2W71 A;  2I87 A;  3V4Z A;  4FFP A;  3MJF A;  2YWV A;  2CZG A;  1W96 A;  1DV2 A;  1KJQ A;  1CQJ B;  4Y8V B;  4O83 A;  1B6S A;  4ZQI A;  4IIJ F;  1CQI B;  4NYE A;  2QF7 A;  5EZY F;  2SCU B;  4I55 F;  5CB4 F;  4O7Y A;  5CAE B;  3TQT A;  3TIN A;  4FGR A;  3TII A;  3AX6 A;  4HNU A;  4ZI7 F;  3V4S A;  3R23 A;  4C5C A;  4I50 F;  4TUY F;  4HNT A;  1CS0 A;  1EUC B;  4FU0 A;  5LXT F;  2Z02 A;  2GPW A;  2NUA B;  2W6N A;  4O4L F;  3N6R A;  2DZD A;  3R5F A;  2W6O A;  3RFC A;  3WNZ A;  3N8D A;  4ME6 A;  1M0W A;  5K2M A;  3U9S A;  2CNV A;  4MV4 A;  4FFN A;  2V59 A;  5LA6 F;  2R85 A;  2R87 A;  2W70 A;  1ULZ A;  2FP4 B;  1GSO A;  2VQD A;  2YS6 A;  5JQG F;  3KAJ A;  4O7W A;  4MV3 A;  5C1P A;  3I12 A;  5KKN B;  3VA7 A;  2XCL A;  1VBH A;  1PX2 A;  1GSA A;  2FPG B;  2V5A A;  1DIK A;  4ZHQ F;  5C1O A;  1OBG A;  3VMM A;  3DF7 A;  4O7S A;  2W6P A;  2FPI B;  3JRW A;  5JH7 F;  4IZO A;  3VPB A;  1GSH A;  4XYM B;  4O2A F;  4MA0 A;  2P0A A;  1I7N A;  4MV9 A;  5J2U F;  1PK8 A;  4E4T A;  3WO1 A;  4YBZ B;  3R5X A;  4O82 A;  2R82 A;  5CA1 F;  1KJ9 A;  3RV3 A;  1C30 A;  5LOV F;  1VKZ A;  4YJ2 F;  5D8D A;  4O4H F;  2R86 A;  2HGS A;  2OLS A;  4O2B F;  2DIK A;  3VOT A;  2R84 A;  5BPH A;  1JDB B;  1SCU B;  4FFL A;  1IOW A;  1CE8 A;  2YYA A;  2YZM A;  4C5A A;  1KJJ A;  4IWY A;  4HQ6 A;  4MV8 A;  3OUZ A;  1E4E B;  3JRX A;  1EYZ A;  3HBL A;  3TIG A;  1Z2O X;  1BNC A;  3ORR A;  3U54 A;  4O7N A;  2YS7 A;  1T36 A;  1KBL A;  2PN1 A;  1KC7 A;  3VPC A;  2Z04 A;  3K5I A;  4HR7 A;  4O7T A;  3RV4 A;  2DWC A;  2C00 A;  5GON F;  1KEE A;  5IYZ F;  3U9T A;  1I7L A;  2CNQ A;  4TV9 F;  1M0T A;  3VPD A;  3RUP A;  1JDE A;  2GLT A;  1GGO A;  2R7L A;  5J2T F;  3R5H A;  1AUX A;  4WBN F;  2FPP B;  2X0S A;  2GPS A;  2W6Z A;  4O84 A;  4O7V A;  1AUV A;  3ETJ A;  2GQS A;  3E5N A;  1Z2P X;  4EGQ A;  4O4J F;  1WR2 A;  1EUD B;  2FB9 A;  2YZL A;  5KX5 F;  4FE2 A;  3SE7 A;  2WYO A;  3OUU A;  4XX0 B;  4MV6 A;  1W93 A;  2NU6 B;  4ZOL F;  5HV6 A;  4MV7 A;  1IOV A;  4EGJ A;  3GLK A;  2YZN A;  2VR1 A;  2R6F A;  4RZQ A;  4DIM A;  3R9R A;  3KRE A;  2DLN A;  3ETH A;  4YAJ B;  5C8Y F;  4XZ3 B;  2YL2 A;  5FNV F;  2W6Q A;  1BXR A;  4O7L A;  2I8C A;  2YRX A;  2R7N A;  2GQR A;  2R7M A;  2W6M A;  3AW8 A;  3MWD A;  4MAM A;  4DLK A;  3KAK A;  4TV8 F;  3JZI A;  5BMV F;  5LYJ F;  4YJ3 F;  3ORQ A;  2VPQ A;  3TW6 A;  5CA0 F;  5H80 A;  5DMX A;  1E4E A;  3G8C A;  1JKJ B;  1M6V A;  2ZDG A;  4IHJ F;  3HB9 A;  3UFX B;  4O4I F;  3Q2O A;  3HO8 A;  4MA5 A;  2QK4 A;  1UC8 A;  1KJ8 A;  2I80 A;  1OBD A;  1Z2N X;  4I4T F;  3QFF A;  4M9U A;  1VBG A;  3Q1K A;  4O7Z A;  3LWB A;  4O7R A;  5JQW A;  4FFR A;  2PVP A;  4EG0 A;  3K3P A;  3MWE A;  2YZG A;  3JZF A;  2J9G A;  2ZDQ A;  1EHI A;  3GID A;  1EZ1 A;  1KUT A;  3WO0 A;  1UC9 A;  1JLL B;  3LP8 A;  1C3O A;  2R7K A;  2PBZ A;  1B6R A;  2YW2 A;  4YAK B;  2CQY A;  5JVL A;  4O86 A;  4FFO A;  3K5H A;  2CNU A;  2HJW A;  3U55 A;  1DV1 A;  2NU8 B;  4FFM A; 
#chains in the Genus database with same CATH topology
 2OWO A;  2FK1 A;  5DQH A;  1V51 A;  3U0G A;  4A3F G;  4B3T H;  1XNQ H;  5I5T A;  1N56 A;  2R93 A;  2YRW A;  4L1K A;  3BG5 A;  1GYF A;  2RDJ A;  4J9S A;  2ASJ A;  4J0M A;  4LF9 H;  5EWF A;  2R92 G;  4WD3 A;  4DR3 H;  3EYY A;  4O3Q A;  3BAB A;  5KFM A;  4F4Z A;  2NU9 B;  5KFR A;  3HXL A;  5F9N A;  4LF7 H;  5BPF A;  5I47 A;  1A3G A;  3CQZ A;  4ECS A;  1GLV A;  1KJI A;  1EKP A;  4MV1 A;  2CKZ B;  3BAA A;  5F9L A;  1K1S A;  3GTO A;  3HOV G;  5KS8 A;  4XYL B;  4BXX G;  2V58 A;  4PDB A;  2UVV A;  5L9X A;  1ZET A;  3PFF A;  3GTP A;  4RUA A;  1VS0 A;  3NUA A;  2R8G A;  5KFC A;  4C5B A;  4YY3 H;  3NC0 B;  3HT5 A;  5IYB G;  1EKV A;  2W9C B;  4FS1 A;  1GO3 E;  3G8D A;  5JVD F;  1IBL H;  4YR2 A;  1TAE A;  5KG3 A;  1I2L A;  4HNV A;  3BQ1 A;  2JEJ A;  4Q8E A;  4O81 A;  2W8K A;  1V4Y A;  3PW4 A;  4DL6 A;  3V6J A;  4CMF A;  5HBR B;  4CE5 A;  1A48 A;  4EEQ A;  4E6N A;  3BQ0 A;  2DPJ A;  2FJZ A;  3PN1 A;  2DAB A;  2NU7 B;  4PBC A;  2ZDH A;  2WAQ E;  4JI0 H;  4RAZ A;  4QSH A;  3KAL A;  1CKN B;  2XD4 A;  5KFL A;  4ED8 A;  5KT2 A;  4NZM A;  4DV1 H;  2AGO A;  1RYS A;  5DGB A;  3RB4 A;  5EWG A;  2OH2 A;  2RDI A;  3JZ6 A;  1E4G T;  3TY8 A;  5LP6 F;  1XMQ H;  2IP4 A;  2B63 G;  4DR6 H;  4YB8 B;  1S97 A;  3GJX B;  5I5W A;  4IWX A;  1TWG A;  5IWA H;  1A9X A;  4RB3 C;  5I60 A;  2XGP A;  2W71 A;  5LMU H;  3OSP A;  2E2H A;  2I87 A;  3V4Z A;  4CKC A;  2AU0 A;  3FKI G;  4LH6 A;  4FFP A;  4J9K A;  3MJF A;  4ECT A;  3GTK A;  2FKL A;  2YWV A;  4AQY H;  5HNE A;  4ED0 A;  3H4B A;  3GB8 B;  2VA3 A;  3EPI A;  2CZG A;  4RNO A;  3N41 B;  2W8L A;  1W96 A;  4O3S A;  1M7J A;  4YP3 A;  4LF8 H;  4EYI B;  1DV2 A;  2R93 G;  2J6U A;  1KJQ A;  2BR0 A;  3GTJ A;  4UUG A;  4ED7 A;  1CQJ B;  3T5H A;  4Y8V B;  2IBK A;  2ZJT A;  4DV5 H;  4A93 G;  2Y0S E;  4O83 A;  4TVI A;  5KFE A;  1WH2 A;  5I5X A;  1B6S A;  5I5V A;  4LH7 A;  4ZQI A;  4J9O A;  2FLP A;  4IIJ F;  1B33 N;  1CQI B;  4NYE A;  2QF7 A;  5EDW A;  3T7A A;  5EZY F;  2E2I A;  2SCU B;  2R8H A;  2Q7D A;  3GV7 B;  1XK5 A;  4OX9 H;  2COG A;  1S10 A;  3NBY B;  4I55 F;  1RYR A;  5C3E G;  2HVR A;  4CC6 A;  3LUL A;  4DAA A;  5CB4 F;  4O7Y A;  3G6V A;  2YCH A;  1A0I A;  5CAE B;  3KTM A;  3GTQ A;  3NBZ B;  3NGD A;  5KFN A;  3V6K A;  5FPR A;  3TQT A;  4A3B G;  1XDN A;  3TIN A;  4FGR A;  3TII A;  3LML A;  3AX6 A;  5FLX W;  2WB1 A;  1RK6 A;  4C2M A;  4HNU A;  4O3O A;  5CM0 A;  4PZ8 A;  1SEI A;  5KFF A;  4ZI7 F;  4JYA H;  3V4S A;  3OTO H;  3R23 A;  4C5C A;  4Q43 A;  4I50 F;  4X64 H;  1V9P A;  4TUY F;  3HOW G;  4HNT A;  1CS0 A;  1EUC B;  4FU0 A;  3RB0 A;  4Q8F A;  3KXY T;  3RBD A;  4BY7 G;  1Y1W A;  4A3I G;  4M0J A;  4GKK H;  2DAA A;  4FM9 A;  1SFO A;  1MZB A;  5LXT F;  2FK2 A;  5L1L A;  3GV8 B;  3GV5 B;  3GIQ A;  1ET0 A;  2Z02 A;  2GPW A;  3GIJ A;  2AGP A;  4QIW E;  5DGI A;  2NUA B;  5KFU A;  2W6N A;  4DL2 A;  4O4L F;  1R9T A;  3N6R A;  2V4R A;  1J5E H;  2DZD A;  3MR2 A;  1KT8 A;  3HOU G;  4RU9 A;  3R5F A;  4QJF A;  2W6O A;  5D1P A;  4DQN A;  1ZHQ A;  3RFC A;  1TWF A;  3FDS A;  4R8U A;  3WNZ A;  1HNX H;  3N8D A;  4LF6 H;  2UUB H;  4J9P A;  4ME6 A;  5CR5 A;  5D1O A;  4ECV A;  1M0W A;  5K2M A;  2RGV A;  2W57 A;  5KG5 A;  1N48 A;  5L1K A;  4GKJ H;  4A3E G;  2RF4 A;  2JA7 A;  1RJR A;  3U9S A;  2CNV A;  4MV4 A;  4FFN A;  2V59 A;  5LA6 F;  4IR9 A;  4CC5 A;  2R85 A;  4JI2 H;  4DL3 A;  5DLF A;  2UXD H;  2R87 A;  3RR5 A;  4AYB A;  1DGS A;  2W70 A;  1ULZ A;  1N33 H;  2FP4 B;  1GSO A;  4DV0 H;  3IN5 A;  2DPI A;  1XNR H;  1K1Q A;  2VQD A;  2C22 A;  2J6S A;  1ZHS A;  2ZGI A;  4GLX A;  2YS6 A;  5JQG F;  2J6T A;  1I1K A;  1I50 A;  4GC6 A;  1I6U A;  4BY1 G;  2BQ3 A;  3KAJ A;  1RJQ A;  2COJ A;  4JI7 H;  4EBD A;  4O7W A;  1FVI A;  3T9E A;  4MV3 A;  4RCN A;  4EQ5 A;  4J9M A;  5C1P A;  4DR7 H;  3I12 A;  4NLG A;  4HYK A;  1IBM H;  1Y1W G;  5KKN B;  3QWU A;  3W1G A;  2W9C A;  3G6Y A;  5L1I A;  3H3V H;  3HKZ E;  4R7R A;  3VA7 A;  3RGZ A;  2XCL A;  5C44 G;  4J9N A;  2V9W A;  4A3L G;  1VBH A;  2HVQ A;  4TM5 A;  4QW8 A;  3H4D A;  2JA6 A;  1PX2 A;  4ECY A;  3OHA A;  4O3P A;  5I5U A;  1GSA A;  4DUY H;  4JV5 H;  4K0K H;  2M05 A;  2FPG B;  3GTM A;  1WSC A;  4RAY A;  3GIP A;  1IYD A;  5A2Q W;  1CKN A;  2V5A A;  1DIK A;  4ZHQ F;  5C1O A;  3PO3 G;  1WRV A;  2FE3 A;  2FMA A;  1OBG A;  2HHF B;  3V6H A;  4UCR A;  3VMM A;  3DF7 A;  4O7S A;  5CE8 A;  4NXM H;  2W6P A;  2FPI B;  3PR4 A;  1N32 H;  4DV6 H;  3JRW A;  5JH7 F;  4IZO A;  4IRC A;  3VPB A;  1GSH A;  4JUZ A;  2JA8 G;  4A3D G;  3BA8 A;  4XYM B;  2HDK A;  4UCV A;  2V4Q A;  3L4K A;  1K83 A;  4O2A F;  4QWD A;  4MA0 A;  3LQS A;  2ALZ A;  5K3W A;  2CFM A;  2P0A A;  1I7N A;  4MV9 A;  4JV0 A;  5J2U F;  4JI4 H;  3N6X A;  4LFC H;  1G2W A;  4A3C G;  3KYH C;  2VUG A;  1PK8 A;  5DGA A;  2FLN A;  4E4T A;  2EJ3 A;  3WO1 A;  2UVW A;  4IRK A;  2JA7 G;  4YR0 A;  4YBZ B;  3T5J A;  4DL4 A;  3R5X A;  2UUC H;  4O82 A;  2EJ0 A;  2R82 A;  2X5R A;  1I2K A;  5FJ8 G;  3MR5 A;  3K3V A;  3J80 W;  4X65 H;  5CA1 F;  1KJ9 A;  3RV3 A;  5DQG A;  4F50 A;  1DAA A;  2JEG A;  4ECU A;  3GIK A;  3RIZ A;  4HN2 A;  5E25 A;  1C30 A;  2Q2U A;  3PW2 A;  5LOV F;  1TA8 A;  1X9N A;  3T1H H;  2R8J A;  1VKZ A;  1HNZ H;  4LFA H;  3AYH B;  4YJ2 F;  5KFH A;  2JEF A;  5D8D A;  5KG0 A;  5EOY A;  4O4H F;  2R86 A;  2HGS A;  1EKF A;  2OLS A;  3S24 A;  3RGX A;  4GLW A;  4O2B F;  2PMZ A;  5KFT A;  2DIK A;  5DIS C;  5KG1 A;  3KHR A;  3BJY A;  4ED6 A;  2W9A A;  4JI1 H;  2EJ2 A;  1S03 G;  3HOY G;  2VPS A;  2R84 A;  3VOT A;  5BPH A;  1Y1V A;  2JA6 G;  1JDB B;  5BWT A;  1SCU B;  2JA5 A;  4FFL A;  2NVY A;  3TEK A;  1IOW A;  1CE8 A;  2YYA A;  2YZM A;  5KFY A;  4C5A A;  1KJJ A;  3W5O A;  5KFQ A;  5KFD A;  4IWY A;  5KT5 A;  4HQ6 A;  4MV8 A;  3OUZ A;  4APM A;  1TWA A;  2FK3 A;  1E4E B;  3JRX A;  1EYZ A;  3HBL A;  2HGW A;  3KHG A;  5KFI A;  3TIG A;  3MFI A;  1Z2O X;  1I1L A;  3DTG A;  2HIX A;  4FBU A;  1N36 H;  1BNC A;  3QZ8 A;  2VUM G;  2AGQ A;  3ORR A;  2W7O A;  3QQM A;  4RNM A;  3U54 A;  5IT9 W;  3OHB A;  5KFW A;  3TY9 A;  3M9N B;  4X66 H;  2R8I A;  2FLL A;  3PW7 A;  4O7N A;  3BQ2 A;  2YS7 A;  3Q8R B;  1P16 A;  5KG7 A;  3QZ7 A;  4B3R H;  1T36 A;  1KBL A;  2VA2 A;  4JV1 A;  2PN1 A;  5KT4 A;  4JI5 H;  1CKM A;  4U7C A;  1KC7 A;  4DR1 H;  4J9L A;  4ECZ A;  1ZAU A;  4ED1 A;  4TQS A;  1T3N A;  5KG6 A;  5DG7 A;  3VPC A;  2Z04 A;  2YU9 A;  3K5I A;  4HR7 A;  4O7T A;  3RV4 A;  2WAQ A;  4LSA A;  2DWC A;  5KFV A;  2C00 A;  3DAA A;  5GON F;  4DV3 H;  4MTE A;  1KEE A;  5IYZ F;  4JXU A;  4Q44 A;  4DV7 H;  3RB6 A;  2HG8 A;  3U9T A;  3N40 P;  3Q8S B;  4QWB A;  1I7L A;  2CNQ A;  4TV9 F;  1M0T A;  2ODT X;  5KG4 A;  3VPD A;  4F4Y A;  3RUP A;  3N43 B;  1JDE A;  4EFB A;  3Q8P B;  5DQI A;  2AQ4 A;  4JI6 H;  4DV4 H;  2GLT A;  5KG2 A;  1GGO A;  2R7L A;  2XC9 A;  4A3M G;  3GII A;  5T14 A;  2C2D A;  5J2T F;  4DR4 H;  2JEI A;  4DRF A;  3R5H A;  1Y1V G;  4NZN A;  3T54 A;  1TWC A;  5FLM G;  4PZ7 A;  3CEB A;  2JA5 G;  1AUX A;  2NVX A;  3M9M B;  4WBN F;  1XMO H;  3PW5 A;  2C35 B;  2FPP B;  2X0S A;  5KFA A;  2XGQ A;  2GPS A;  2W6Z A;  4O84 A;  4UFZ A;  2ABJ A;  1AUV A;  4O7V A;  4CKB A;  3ETJ A;  2Y0S A;  3T1Y H;  2GQS A;  3E5N A;  1Z2P X;  4A2B A;  1RK5 A;  4EGQ A;  4O4J F;  4BBR G;  5BR8 H;  4EBC A;  1N34 H;  3SNO A;  5KT7 A;  1WR2 A;  5L1J A;  1EUD B;  3PW0 A;  2FB9 A;  2YZL A;  4EEY A;  3RAQ A;  4DV2 H;  2XCA A;  5KX5 F;  3G6X A;  5BYA A;  5DG8 A;  3MR3 A;  3IG0 A;  2ASD A;  3F8N A;  3RF2 A;  1FJG H;  4FE2 A;  3SE7 A;  4CHI A;  2WYO A;  5KFP A;  2BQR A;  2W9B B;  5FPO A;  4EFE A;  4RNN A;  3OUU A;  4XX0 B;  2HVS A;  4MV6 A;  4UCS A;  3JSL A;  1W93 A;  4Q4C A;  3PZP A;  1S0N A;  1JXL A;  2ATL A;  3BA9 A;  2NU6 B;  2WB1 E;  4RUC A;  4ED3 A;  3MR6 A;  4J9Q A;  4I7H A;  1S0M A;  4ZOL F;  5KFO A;  5HV6 A;  4DUZ H;  4MV7 A;  1S68 A;  2HHF A;  3UZB A;  4RB0 A;  4EYH B;  4Q4D A;  1T94 A;  3TW7 A;  3SI8 A;  3C0F B;  4UCT A;  2MCT A;  3H20 A;  3M4I A;  1IOV A;  4F4W A;  4EGJ A;  4MTD A;  5KFB A;  5FD5 A;  3GLK A;  5BYB A;  4RB2 C;  1KTA A;  2VR1 A;  2YZN A;  1Y14 B;  2VUM A;  5KFJ A;  2VQE H;  2R6F A;  3TY5 A;  4RZQ A;  4DIM A;  3M9O B;  2RGR A;  1VAJ A;  3H0G A;  2ASL A;  3R9R A;  3H40 A;  3KRE A;  3T5K A;  1RJP A;  5BWW A;  4PWQ A;  2DLN A;  2HIV A;  3ETH A;  4YAJ B;  5C8Y F;  4BWS C;  2YL2 A;  4XZ3 B;  3PVX A;  2BQU A;  2HHH H;  5C5J A;  5FNV F;  2XCP A;  5LL6 b;  2EIY A;  2F4V H;  2W6Q A;  1WCM A;  2R7Z A;  3UZO A;  5JUM A;  1B04 A;  4M7E A;  2UVU A;  1BXR A;  4O7L A;  2I8C A;  3Q8Q B;  2YRX A;  4LMY A;  4QIW A;  2R7N A;  3I4M G;  2XIG A;  4LFB H;  4FBT A;  2E5L H;  2GQR A;  4ECR A;  1O75 A;  2C2R A;  5EWE A;  1S9F A;  2R7M A;  3TQ1 A;  2W6M A;  3HOX G;  4ED2 A;  1BGW A;  3AW8 A;  4CMD A;  4QW9 A;  3MWD A;  4MAM A;  3UQ8 A;  3MFH A;  4A3K G;  3RB3 A;  5DAA A;  1I3Q A;  4DLK A;  3KAK A;  4O3N A;  1E4F T;  4A2A A;  4RB1 A;  5BWX A;  4YR3 A;  4TV8 F;  5BWV A;  3JZI A;  3EPG A;  4DL5 A;  3PR5 B;  5BMV F;  1IYE A;  4GC7 A;  5I5S A;  2O03 A;  5LYJ F;  4PZ6 A;  2VQF H;  4JI3 H;  4YJ3 F;  3ORQ A;  5IP9 G;  3T9C A;  5DGH A;  3FMA A;  2HGX A;  4CKE A;  5KFS A;  4AYB E;  1I94 H;  4NXN H;  5IP7 G;  4U6P A;  2VPQ A;  4QWA A;  4J9R A;  3VNN A;  5BWU A;  3N42 B;  4LSX A;  5IYD G;  2CW8 A;  3TW6 A;  1A0G A;  5CA0 F;  5H80 A;  3WWH A;  1ZQ7 A;  3KHH A;  5DMX A;  2C2E A;  4G3I A;  1E4E A;  2Y4R A;  1P8L A;  2WE6 A;  4JV2 A;  5DLG A;  3GDE A;  3G8C A;  1JKJ B;  1M6V A;  4NZO A;  4ECX A;  1HR0 H;  4UCO A;  3RTX A;  3T9F A;  4FS2 A;  3T9A A;  2WTF A;  1L2Z A;  4Q0Y A;  1FKA H;  2UXC H;  1CKO A;  2ZDG A;  1HNW H;  4IHJ F;  3I4N G;  3GTL A;  4DL7 A;  2A1H A;  3HB9 A;  3UFX B;  5KFG A;  4O4I F;  4X62 H;  5FR9 A;  5FD6 A;  3Q2O A;  3HO8 A;  4MA5 A;  4ETS A;  5IYC G;  2QK4 A;  3L4J A;  4DR5 H;  1UC8 A;  1KJ8 A;  2I80 A;  3N44 B;  1TWH A;  4YQW A;  3HOZ G;  3H0G G;  3HKZ A;  1OBD A;  1Z2N X;  4IAJ A;  3CVZ A;  4I4T F;  3QFF A;  4IR1 A;  4M9U A;  1VBG A;  3Q1K A;  2R92 A;  4O7Z A;  3SGI A;  1JIH A;  3RBE A;  3LWB A;  4O7R A;  2Q2T A;  3GIM A;  1WCM G;  2UU9 H;  2R7Z G;  4WHX A;  5JQW A;  3PO2 G;  2C28 A;  4LF4 H;  4FFR A;  1AN7 A;  4ECW A;  1JX4 A;  2PVP A;  4EG0 A;  2QYZ A;  3KHL A;  3K3P A;  3MWE A;  3W1B A;  4YHH H;  2YZG A;  4IRD A;  3JZF A;  4K6N A;  5BWR A;  2J9G A;  2ZDQ A;  1EHI A;  3GID A;  2CW7 A;  3MWM A;  1EZ1 A;  3T99 A;  1KUT A;  4QWC A;  4Q45 A;  2QB5 A;  3RAX A;  3WO0 A;  5KFZ A;  4DR2 H;  1S0O A;  1UC9 A;  4B3S H;  1JLL B;  4B3M H;  2W7P A;  3LP8 A;  3JSN A;  3L2P A;  1UNN C;  3T5L A;  2IMW P;  3CSW A;  5KFX A;  1C3O A;  1I1M A;  4LF5 H;  2R7K A;  3JAM W;  2PBZ A;  1B6R A;  1BJT A;  5KT3 A;  4A3J G;  3GIL A;  5KT6 A;  2YW2 A;  3GTG A;  2UUA H;  4RZR A;  4JI8 H;  3GQC A;  4YAK B;  3DTF A;  2CQY A;  2IA6 A;  5JVL A;  5I5Y A;  3T9B A;  4ECQ A;  2R8K A;  2VOB A;  4O86 A;  3J81 W;  3J7A K;  4FFO A;  4UCU A;  5KFK A;  4O3R A;  4TQR A;  4A3G G;  5C4X G;  1OWT A;  2B63 A;  2ZM6 H;  3K5H A;  2PMZ E;  4KHP H;  3T9D A;  4R8U B;  2COI A;  3FKI A;  2CNU A;  3WWJ A;  2HJW A;  4F4X A;  3BAC A;  5D1O B;  3U55 A;  3RJ0 A;  5DG9 A;  1IBK H;  4EBE A;  4QWE A;  2UXB H;  3WWI A;  2W9B A;  3UYY A;  1DV1 A;  2NU8 B;  1SYX B;  3OSN A;  4BBS G;  4FFM A;  5LMN H;  2UVR A;  2WDT A;  2KSW A; 
#chains in the Genus database with same CATH homology
 2YRW A;  4L1K A;  3BG5 A;  4WD3 A;  2NU9 B;  5BPF A;  5I47 A;  1GLV A;  1KJI A;  4MV1 A;  4XYL B;  2V58 A;  3NUA A;  4C5B A;  3G8D A;  5JVD F;  4HNV A;  4O81 A;  5HBR B;  1A48 A;  2NU7 B;  2ZDH A;  4QSH A;  3KAL A;  2XD4 A;  5LP6 F;  2IP4 A;  4YB8 B;  4IWX A;  1A9X A;  2W71 A;  2I87 A;  3V4Z A;  4FFP A;  3MJF A;  2YWV A;  2CZG A;  1W96 A;  1DV2 A;  1KJQ A;  1CQJ B;  4Y8V B;  4O83 A;  1B6S A;  4ZQI A;  4IIJ F;  1CQI B;  4NYE A;  2QF7 A;  5EZY F;  2SCU B;  4I55 F;  5CB4 F;  4O7Y A;  5CAE B;  3TQT A;  3TIN A;  4FGR A;  3TII A;  3AX6 A;  4HNU A;  4ZI7 F;  3V4S A;  3R23 A;  4C5C A;  4I50 F;  4TUY F;  4HNT A;  1CS0 A;  1EUC B;  4FU0 A;  5LXT F;  2Z02 A;  2GPW A;  2NUA B;  2W6N A;  4O4L F;  3N6R A;  2DZD A;  3R5F A;  2W6O A;  3RFC A;  3WNZ A;  3N8D A;  4ME6 A;  1M0W A;  5K2M A;  3U9S A;  2CNV A;  4MV4 A;  4FFN A;  2V59 A;  5LA6 F;  2R85 A;  2R87 A;  2W70 A;  1ULZ A;  2FP4 B;  1GSO A;  2VQD A;  2YS6 A;  5JQG F;  3KAJ A;  4O7W A;  4MV3 A;  5C1P A;  3I12 A;  5KKN B;  3VA7 A;  2XCL A;  1VBH A;  1PX2 A;  1GSA A;  2FPG B;  2V5A A;  1DIK A;  4ZHQ F;  5C1O A;  1OBG A;  3VMM A;  3DF7 A;  4O7S A;  2W6P A;  2FPI B;  3JRW A;  5JH7 F;  4IZO A;  3VPB A;  1GSH A;  4XYM B;  4O2A F;  4MA0 A;  2P0A A;  1I7N A;  4MV9 A;  5J2U F;  1PK8 A;  4E4T A;  3WO1 A;  4YBZ B;  3R5X A;  4O82 A;  2R82 A;  5CA1 F;  1KJ9 A;  3RV3 A;  1C30 A;  5LOV F;  1VKZ A;  4YJ2 F;  5D8D A;  4O4H F;  2R86 A;  2HGS A;  2OLS A;  4O2B F;  2DIK A;  3VOT A;  2R84 A;  5BPH A;  1JDB B;  1SCU B;  4FFL A;  1IOW A;  1CE8 A;  2YYA A;  2YZM A;  4C5A A;  1KJJ A;  4IWY A;  4HQ6 A;  4MV8 A;  3OUZ A;  1E4E B;  3JRX A;  1EYZ A;  3HBL A;  3TIG A;  1Z2O X;  1BNC A;  3ORR A;  3U54 A;  4O7N A;  2YS7 A;  1T36 A;  1KBL A;  2PN1 A;  1KC7 A;  3VPC A;  2Z04 A;  3K5I A;  4HR7 A;  4O7T A;  3RV4 A;  2DWC A;  2C00 A;  5GON F;  1KEE A;  5IYZ F;  3U9T A;  1I7L A;  2CNQ A;  4TV9 F;  1M0T A;  3VPD A;  3RUP A;  1JDE A;  2GLT A;  1GGO A;  2R7L A;  5J2T F;  3R5H A;  1AUX A;  4WBN F;  2FPP B;  2X0S A;  2GPS A;  2W6Z A;  4O84 A;  4O7V A;  1AUV A;  3ETJ A;  2GQS A;  3E5N A;  1Z2P X;  4EGQ A;  4O4J F;  1WR2 A;  1EUD B;  2FB9 A;  2YZL A;  5KX5 F;  4FE2 A;  3SE7 A;  2WYO A;  3OUU A;  4XX0 B;  4MV6 A;  1W93 A;  2NU6 B;  4ZOL F;  5HV6 A;  4MV7 A;  1IOV A;  4EGJ A;  3GLK A;  2YZN A;  2VR1 A;  2R6F A;  4RZQ A;  4DIM A;  3R9R A;  3KRE A;  2DLN A;  3ETH A;  4YAJ B;  5C8Y F;  4XZ3 B;  2YL2 A;  5FNV F;  2W6Q A;  1BXR A;  4O7L A;  2I8C A;  2YRX A;  2R7N A;  2GQR A;  2R7M A;  2W6M A;  3AW8 A;  3MWD A;  4MAM A;  4DLK A;  3KAK A;  4TV8 F;  3JZI A;  5BMV F;  5LYJ F;  4YJ3 F;  3ORQ A;  2VPQ A;  3TW6 A;  5CA0 F;  5H80 A;  5DMX A;  1E4E A;  3G8C A;  1JKJ B;  1M6V A;  2ZDG A;  4IHJ F;  3HB9 A;  3UFX B;  4O4I F;  3Q2O A;  3HO8 A;  4MA5 A;  2QK4 A;  1UC8 A;  1KJ8 A;  2I80 A;  1OBD A;  1Z2N X;  4I4T F;  3QFF A;  4M9U A;  1VBG A;  3Q1K A;  4O7Z A;  3LWB A;  4O7R A;  5JQW A;  4FFR A;  2PVP A;  4EG0 A;  3K3P A;  3MWE A;  2YZG A;  3JZF A;  2J9G A;  2ZDQ A;  1EHI A;  3GID A;  1EZ1 A;  1KUT A;  3WO0 A;  1UC9 A;  1JLL B;  3LP8 A;  1C3O A;  2R7K A;  2PBZ A;  1B6R A;  2YW2 A;  4YAK B;  2CQY A;  5JVL A;  4O86 A;  4FFO A;  3K5H A;  2CNU A;  2HJW A;  3U55 A;  1DV1 A;  2NU8 B;  4FFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...