5HBRB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 67
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5hbrB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5hbrB02
2V59A 3QFFA 4DIMA 5JVLA 4TV9F 2QF7A 5DMXA 5CAEB 1BNCA 2P0AA 4WD3A 1M6VA 4ZOLF 1VBHA 4MV7A 4YJ3F 4O7WA 4Y8VB 5I47A 1UC9A 5J2UF 2GQSA 2HJWA 4MV1A 3VPCA 2YYAA 4O2BF 1UC8A 5JQWA 2W70A 3K5IA 3RV3A 2W71A 4YAJB 3KAKA 4FFPA 2R85A 3LWBA 1IOWA 2XD4A 2GLTA 3ETHA 4O81A 2V58A 2J9GA 2ZDHA 4DLKA 3TINA 1KJ9A 1KJ8A 2VQDA 5K2MA 4O7YA 2R7MA 2DIKA 5CA1F 2YS6A 2I8CA 2CNUA 3V4SA 3G8CA 2OLSA 2YRWA 1KJJA 4HR7A 1M0WA 4XYMB 2R87A 4O7TA 4XZ3B 4O4LF 2FPPB 4IIJF 5CA0F 2R6FA 5LOVF 3R5HA 3AX6A 4MA0A 3RFCA 4M9UA 1VKZA 3Q1KA 5LA6F 3NUAA 4C5BA 4I55F 3N8DA 4C5CA 2YL2A 1KEEA 1GSOA 2R7LA 2W6ZA 3KALA 1DV2A 2R82A 1EUCB 3MWEA 3JZIA 2C00A 4O7SA 5EZYF 5BPFA 3GIDA 4O4JF 1DV1A 1C3OA 4RZQA 5FNVF 5LP6F 1M0TA 1GSHA 4EG0A 1A9XA 4YJ2F 2YZNA 3R23A 3HBLA 4O83A 4O4IF 2FPGB 1EHIA 1KUTA 3KREA 2FP4B 5J2TF 1B6RA 4I50F 3ORRA 1OBDA 4IHJF 2ZDQA 1IOVA 3RUPA 2NUAB 4MV9A 1Z2OX 1GSAA 3K5HA 3VPBA 3LP8A 1W96A 2YRXA 2R7KA 1CE8A 4YAKB 2WYOA 4O4HF 3WNZA 4ZI7F 2PVPA 5CB4F 2ZDGA 4MV6A 5JVDF 4HNTA 3DF7A 4NYEA 3V4ZA 2I80A 1AUVA 4HNUA 3HO8A 5H80A 1JDBB 4TUYF 2CZGA 2YZMA 2Z04A 3KAJA 4I4TF 1A48A 4HNVA 4XX0B 4QSHA 4XYLB 2NU7B 3I12A 1C30A 2W6MA 2W6PA 2R86A 4O7VA 4FE2A 5C1OA 3U9TA 4FFRA 2QK4A 2DLNA 3UFXB 4IWXA 1CQJB 1B6SA 4HQ6A 4FU0A 2GPWA 2X0SA 4FGRA 3TQTA 1KBLA 3OUZA 5JQGF 4L1KA 1CS0A 4O2AF 4FFOA 4O7NA 3Q2OA 5C1PA 5KX5F 1JKJB 4E4TA 3TIGA 1T36A 4MA5A 2PBZA 5D8DA 2VR1A 1KJIA 2W6OA 1WR2A 2I87A 5LXTF 2IP4A 2YZGA 3WO1A 3HB9A 5JH7F 1OBGA 1PX2A 4WBNF 1E4EA 3VA7A 2YZLA 3R5XA 4YBZB 1Z2PX 4IZOA 3SE7A 3AW8A 1PK8A 1ULZA 2HGSA 1JDEA 1W93A 4C5AA 2XCLA 4EGQA 1EUDB 2FPIB 3BG5A 1EZ1A 3MJFA 1CQIB 2YW2A 3JZFA 2W6NA 2YS7A 5GONF 4O7ZA 3GLKA 2YWVA 2SCUB 3ETJA 1I7LA 1GLVA 1EYZA 2NU9B 1SCUB 4ME6A 4IWYA 5LYJF 1BXRA 4O7RA 3JRXA 5BPHA 1E4EB 2V5AA 3K3PA 3VMMA 2CNQA 2FB9A 1KC7A 3G8DA 4FFNA 3TW6A 3VPDA 4ZQIA 2GQRA 3R5FA 2CNVA 1AUXA 5HBRB 1KJQA 3U55A 1GGOA 4YB8B 4MAMA 3E5NA 4FFMA 5IYZF 2CQYA 1VBGA 4O7LA 4FFLA 4MV3A 4O82A 4O84A 2DZDA 1DIKA 1Z2NX 2NU8B 4EGJA 3U9SA 5BMVF 1I7NA 1JLLB 3OUUA 3ORQA 5HV6A 5C8YF 4O86A 3TIIA 3JRWA 2R84A 5KKNB 2NU6B 3VOTA 4MV8A 4TV8F 2DWCA 4MV4A 2Z02A 3N6RA 3RV4A 2R7NA 4ZHQF 3MWDA 2W6QA 3U54A 3R9RA 2PN1A 2VPQA 2GPSA 3WO0A
chains in the Genus database with same CATH superfamily
2V59A 2NVYA 3J81W 3QFFA 4DIMA 3BA9A 4TV9F 5JVLA 1N36H 1RJQA 2QF7A 5DMXA 2E2HA 5CAEB 1BNCA 1VS0A 2P0AA 3SNOA 3CVZA 4K0KH 4WD3A 1M6VA 4ZOLF 5DG9A 3RR5A 3GIQA 3TY8A 3TW7A 5KG0A 2BQ3A 2ODTX 1DGSA 1VBHA 4MV7A 2ZJTA 2C2DA 4YJ3F 4B3MH 3MFHA 4O7WA 4Y8VB 3H4BA 4DR1H 4A3DG 4LF7H 4GC7A 5I47A 1K1QA 1TWAA 1UC9A 3F8NA 4ETSA 3KYHC 5J2UF 3GDEA 2GQSA 2UVVA 5KFCA 2HJWA 1XMOH 4MV1A 4F4WA 3VPCA 3QWUA 2YYAA 3N42B 5KFTA 4J9NA 2JA5A 4LH7A 1XNQH 3I4MG 4O2BF 2ZM6H 3C0FB 3GJXB 1I1KA 2RGRA 2COGA 1UC8A 3BABA 3QQMA 1FJGH 3W5OA 5JQWA 2W70A 4QW8A 3K5IA 3BQ1A 3WWJA 1N32H 3HT5A 3G6VA 3RV3A 5EWEA 4RCNA 4PBCA 2W71A 4YAJB 3DAAA 4QWBA 3KAKA 5KFGA 5F9NA 3N41B 4YQWA 2BQUA 2VUGA 5L9XA 1I1MA 5DGHA 4JI7H 4UCOA 4FFPA 4BBSG 5DQHA 3FMAA 5A2QW 3PW7A 4U7CA 4FBUA 1RYRA 2R85A 4A3FG 4IRCA 1IYDA 1TA8A 4FS1A 2B63A 3LWBA 1IOWA 1Y1VG 1I2KA 1ZETA 2XD4A 4PDBA 4RAZA 2GLTA 1V51A 4B3TH 4NXNH 4JI0H 5DLFA 2C22A 4LSXA 1T94A 4ECXA 3T9BA 3T9FA 3ETHA 4O81A 5I5UA 4EFEA 2UXBH 4C2MA 4EYHB 2V58A 2J9GA 2ZDHA 4GLWA 4JV0A 5K3WA 5BYAA 3H40A 2R8IA 4DLKA 4QJFA 4O3OA 2HHFB 3TINA 2J6SA 1HNWH 4Q4CA 4A2AA 1KJ9A 1JIHA 5KFJA 1KJ8A 2ASJA 1BGWA 4R7RA 2Y0SA 5KFZA 2VQDA 4CKBA 2RGVA 5K2MA 4O7YA 4ECYA 2R7MA 2DIKA 4LFAH 5CA1F 2FKLA 4ED3A 2Q2TA 4ECVA 3JZ6A 2YS6A 3TQ1A 4BY7G 2Q2UA 2I8CA 4IR9A 2NVXA 3T5KA 3EPIA 5BWRA 1V9PA 2HG8A 5FPRA 5I5SA 5C5JA 1JX4A 1I6UA 2CNUA 3V4SA 2R93G 4DRFA 3RB0A 1IBKH 4R8UB 4RB2C 2R8JA 3GQCA 4Q44A 5I5YA 1WSCA 3G8CA 1CKMA 4E6NA 2YRWA 2OLSA 2IMWP 1KJJA 4HR7A 4FS2A 4ECQA 1BJTA 1M0WA 4XYMB 4QWCA 3KHRA 2R87A 1EKFA 1KT8A 5CM0A 4O7TA 1S03G 5BR8H 1XMQH 4XZ3B 1TWCA 5KFFA 3OHBA 3GIIA 4DV4H 4LF8H 1WH2A 4QW9A 3I4NG 5DLGA 4O4LF 5KFXA 4QIWA 2UUBH 2FPPB 4PZ8A 1S10A 4DV7H 4IIJF 4J9MA 5CA0F 5BWXA 2R6FA 4F4YA 2DPJA 5LOVF 4K6NA 1G2WA 2ABJA 4MTDA 2VQFH 3R5HA 2ASDA 3AX6A 3PR5B 4MA0A 1N33H 3RFCA 3PZPA 3RAXA 4M9UA 1VKZA 5FLXW 3Q1KA 3PW2A 3GTOA 3T5HA 5LA6F 3NUAA 5KT6A 3PO3G 4C5BA 4DUZH 4I55F 3N8DA 1MZBA 4C5CA 2YL2A 2FK1A 5EWFA 1KEEA 1GSOA 2DAAA 4FM9A 2W7PA 1RYSA 2R7LA 2V4QA 5KG6A 3T54A 4UCVA 3T9EA 5IYCG 2W6ZA 1E4GT 4A3JG 3KALA 1DV2A 1I94H 4LF4H 2AGPA 4LF6H 2R82A 1EUCB 3MWEA 4J9RA 1ZAUA 4PZ6A 2FJZA 1Y1WG 3H20A 3JZIA 2C00A 4O7SA 5EZYF 5FLMG 2E5LH 3VNNA 5BPFA 3FKIG 5KFOA 1S0OA 3CQZA 3GIDA 3GIKA 4O4JF 5L1JA 1ZQ7A 4CE5A 5KFBA 1DV1A 1C3OA 3BA8A 4DL5A 4RZQA 3KTMA 4O3SA 1SEIA 1TWFA 3M4IA 2HHFA 2Y0SE 3MR3A 2W9BA 4X64H 4AQYH 4A3GG 4OX9H 5FNVF 5LP6F 5KG3A 1M0TA 5KFVA 4EYIB 2W7OA 5L1IA 1GSHA 5D1OB 4EG0A 3TY9A 4YJ2F 1A9XA 1P16A 3Q8QB 4FBTA 2YZNA 4CKCA 5IWAH 3R23A 3UZBA 3HBLA 4JI2H 5KFLA 4Q43A 2CW8A 3JSLA 3SGIA 5KG4A 2M05A 4R8UA 4HN2A 3T1YH 4NLGA 2XCAA 1OWTA 4CMDA 5I5XA 2Y4RA 4O83A 2C2RA 4O4IF 2FPGB 4RUAA 4QWAA 1T3NA 1SFOA 4YY3H 1CKNA 3RF2A 3HOXG 1EHIA 4O3PA 2F4VH 1KUTA 3KREA 5KFAA 3MR2A 2FP4B 5DISC 5J2TF 5BWVA 4JV5H 3HKZA 4QIWE 3G6YA 1B6RA 3U0GA 4I50F 3ORRA 5KT7A 2C28A 3JAMW 3Q8RB 4UFZA 4DR2H 2UUAH 1OBDA 4IHJF 1CKOA 1Y1VA 4J9KA 2ZDQA 1IOVA 3RUPA 2NUAB 4MV9A 5BWWA 1ET0A 1O75A 5KT5A 1Y14B 4ED7A 1Z2OX 3PR4A 3GTQA 3RJ0A 1GSAA 3K5HA 3VPBA 3S24A 2R8GA 3LP8A 3T99A 3UQ8A 1J5EH 4B3SH 4BBRG 5EWGA 5KT4A 2IA6A 1W96A 5KFKA 5KFQA 2UUCH 2YRXA 3GV5B 4GKJH 4RB1A 2R7KA 1X9NA 1CE8A 1GO3E 4UCTA 4YAKB 5I5WA 2WYOA 4O4HF 3WNZA 4ZI7F 5BWTA 1VAJA 2PVPA 5EOYA 5CB4F 3G6XA 4DL4A 2AQ4A 2ZDGA 4MV6A 2EJ3A 5JVDF 1WCMG 3K3VA 4MTEA 4CC6A 4HNTA 4EBDA 3DF7A 3PW0A 1A3GA 4NYEA 4GLXA 2PMZA 2I80A 3V4ZA 1AUVA 4JI8H 3MR6A 4HNUA 4DV2H 3HO8A 5H80A 1P8LA 2AU0A 3V6JA 1JDBB 3GB8B 4NZNA 3M9NB 3L4KA 3GV7B 1IBLH 4TUYF 3JSNA 2CZGA 3RTXA 2WB1A 3EYYA 2R93A 2YZMA 4ED0A 2Z04A 3LULA 5DGAA 5C4XG 2W9BB 3KAJA 4DR4H 4UCSA 1N56A 2AGOA 4JUZA 3N44B 4I4TF 3HOWG 1A48A 1E4FT 5LMNH 4DV3H 4IRKA 5D1PA 2UVRA 4HNVA 4XX0B 2EJ0A 2CW7A 1TWHA 5FJ8G 2MCTA 2YCHA 2DPIA 4GKKH 2JEGA 3RIZA 4JV1A 4QSHA 4A3KG 4XYLB 5D1OA 3J80W 2XCPA 2NU7B 5FR9A 2XC9A 2WTFA 2HVQA 4X62H 3I12A 1C30A 1WRVA 2ASLA 2WDTA 5EDWA 4CHIA 2W6MA 3GIPA 5KFIA 4J9OA 4JI5H 2W6PA 1L2ZA 4LSAA 2R86A 4TM5A 2WAQA 5IP9G 4O7VA 4FE2A 4DR3H 4Q8FA 5BYBA 4DR7H 5C1OA 4DR5H 1CKNB 3U9TA 4ECWA 4JI3H 4A3MG 2HVSA 2YU9A 2W9CB 4RNOA 4FFRA 2QK4A 2DLNA 5DGIA 3UFXB 3RGXA 5BWUA 2RDIA 3GILA 3GTKA 4IWXA 4TVIA 5KS8A 4RNNA 2RF4A 4A93G 3RB3A 3V6KA 3NBZB 1CQJB 4PZ7A 1B6SA 4HQ6A 4ED2A 1S68A 3J7AK 4FU0A 2JA6G 2UU9H 3V6HA 4J9SA 3M9MB 3RAQA 1S97A 2GPWA 4F50A 3HOYG 4U6PA 2X0SA 4FGRA 3TQTA 5KFMA 5IYBG 3HOUG 3N43B 3BJYA 1KBLA 3PO2G 5I60A 1Y1WA 1I1LA 5KFSA 5IP7G 5KT3A 3CSWA 2R92A 2R7ZG 2UVWA 3FKIA 2JEIA 2ATLA 4DUYH 1EKPA 4JV2A 2R92G 3OUZA 4RB3C 5JQGF 5KFNA 4J9QA 4A3LG 3DTGA 4L1KA 1CS0A 3RBDA 3LQSA 4O2AF 4FFOA 4O7NA 5DGBA 3Q2OA 4A3IG 5C1PA 3BAAA 3N40P 3HOZG 5F9LA 3PW5A 3LMLA 2HHHH 5KX5F 2VPSA 1JKJB 4E4TA 1TWGA 3TIGA 4O3RA 4DV0H 4B3RH 2WB1E 1T36A 1S9FA 4MA5A 2JEFA 2X5RA 2PBZA 5D8DA 2VR1A 4CKEA 4JI6H 1KJIA 3NBYB 4Q8EA 2J6UA 2VUMG 4Q0YA 2W6OA 2BR0A 1JXLA 3GTLA 4J9PA 2O03A 4RU9A 3OSNA 1WR2A 2I87A 5LXTF 5DG7A 4X65H 3PFFA 4DAAA 2C2EA 2JA7G 2IP4A 1A0IA 2YZGA 4O3NA 4HYKA 3WO1A 3HB9A 5JH7F 5HNEA 1OBGA 1PX2A 1TAEA 4DL3A 4DV1H 5E25A 2E2IA 2HIVA 1E4EA 4WBNF 2VOBA 5IYDG 3VA7A 2YZLA 5LL6b 3SI8A 1FKAH 4EBCA 3R5XA 3QZ8A 2WAQE 4YBZB 1Z2PX 4ECUA 5CE8A 2ALZA 4CMFA 3H0GG 1HNZH 1IBMH 4IZOA 2UXDH 5KFHA 3BQ0A 4ECZA 3SE7A 4ED1A 3OSPA 1XNRH 5T14A 3AW8A 1PK8A 2W9CA 4RB0A 4F4XA 1I50A 4LH6A 2OH2A 1ULZA 2HGSA 2HDKA 1JDEA 1W93A 2C35B 2R8KA 4Q4DA 4I7HA 4RUCA 4C5AA 1K83A 2XCLA 5DAAA 4M7EA 4YR2A 4EGQA 2W8KA 5DQGA 3GTPA 1EUDB 2FPIB 4JI1H 2COJA 1WCMA 5KG5A 3NC0B 3OTOH 2VQEH 4LF5H 4PWQA 1RK5A 4Q45A 5KFEA 2WE6A 3BG5A 4QWDA 4GC6A 1V4YA 1A0GA 2FK3A 3NGDA 3GIJA 4J9LA 1EZ1A 3MJFA 2BQRA 1CQIB 2YW2A 3JZFA 3RB4A 4APMA 2FMAA 4LFCH 2W6NA 2YS7A 4JYAH 4LMYA 4AYBA 1B04A 3WWIA 4YHHH 5KG7A 3L4JA 3EPGA 5GONF 4O7ZA 1XK5A 3GLKA 4EQ5A 3RB6A 4M0JA 5C3EG 2YWVA 4EEQA 2SCUB 1B33N 5LMUH 2JA5G 3ETJA 1I7LA 1GLVA 1EYZA 3IG0A 3QZ7A 2V4RA 2NU9B 4J0MA 4YR3A 4UUGA 1FVIA 1SCUB 4UCUA 3FDSA 3DTFA 3RGZA 3Q8PB 3HOVG 4ME6A 5FPOA 5KFYA 4IWYA 4ECSA 2W57A 5LYJF 5JUMA 3T1HH 1KTAA 1BXRA 4RAYA 4O7RA 3JRXA 5BPHA 1DAAA 4RZRA 4ED8A 2FLPA 3KHGA 3GIMA 2VA2A 4IRDA 4RNMA 3GTJA 1E4EB 2V5AA 3K3PA 3Q8SB 3VMMA 2CFMA 4BY1G 3IN5A 4ED6A 2CNQA 2FK2A 2FB9A 5C44G 1KC7A 3N6XA 2JA6A 3G8DA 4FFNA 3TW6A 3VPDA 5FD6A 4ZQIA 4EEYA 2GQRA 2B63G 2J6TA 3R5FA 3GTMA 2CNVA 1AUXA 3UYYA 4A3CG 3HXLA 3W1GA 2Q7DA 5HBRB 5KFPA 5FD5A 3PVXA 1I2LA 3MWMA 1KJQA 1ZHSA 2R7ZA 4KHPH 3U55A 3OHAA 1GGOA 3HKZE 4YB8B 4ECRA 4A3EG 2R8HA 1K1SA 5I5TA 1XDNA 4MAMA 3KXYT 3E5NA 3PW4A 2XGPA 1RJRA 2AGQA 4LF9H 4FFMA 1SYXB 5KG1A 4DL2A 5IYZF 2W8LA 2CQYA 2EJ2A 4YR0A 5CR5A 4JXUA 3UZOA 2KSWA 3PN1A 1VBGA 4O7LA 4X66H 4YP3A 4DL6A 4DL7A 4FFLA 4MV3A 4O82A 3TY5A 2XIGA 4TQRA 2RDJA 3T9CA 5IT9W 4O84A 3BQ2A 3GV8B 5KFRA 2DZDA 5KG2A 3W1BA 4UCRA 1DIKA 1Z2NX 5I5VA 3TEKA 2FE3A 4NXMH 4NZOA 4BXXG 5KT2A 2NU8B 4EBEA 2COIA 2HVRA 2A1HA 2HIXA 2VUMA 3AYHB 4AYBE 2JEJA 3GTGA 4DV5H 4EGJA 3U9SA 2PMZE 5BMVF 4IAJA 3CEBA 3MR5A 4LFBH 1I7NA 1JLLB 4EFBA 3OUUA 5DG8A 3ORQA 2FLNA 4A2BA 1R9TA 2OWOA 2JA7A 5HV6A 5KFUA 1AN7A 5C8YF 3T5LA 4O86A 3L2PA 4QWEA 2QB5A 5KFDA 3T5JA 3TIIA 1N48A 2DABA 2HGWA 2HGXA 3JRWA 4DR6H 2R84A 4IR1A 1S0MA 3RBEA 1GYFA 5KKNB 3MFIA 4BWSC 4O3QA 2XGQA 1S0NA 4TQSA 2NU6B 1RJPA 2VA3A 3KHLA 3T9AA 1M7JA 3T7AA 3VOTA 4MV8A 2CKZB 1HNXH 4JI4H 5L1KA 3H0GA 2IBKA 4TV8F 2DWCA 4A3BG 1EKVA 5DQIA 4MV4A 5L1LA 1N34H 2UXCH 4WHXA 1IYEA 2V9WA 3H3VH 2Z02A 3N6RA 4CC5A 3RV4A 4DQNA 2R7NA 2ZGIA 5KFWA 4ZHQF 4DV6H 3M9OB 4F4ZA 2UVUA 2JA8G 3MWDA 2W6QA 3BACA 1RK6A 3U54A 3R9RA 1ZHQA 3KHHA 2W9AA 4G3IA 2EIYA 3T9DA 3WWHA 2QYZA 2PN1A 1UNNC 2VPQA 3H4DA 2GPSA 3WO0A 4ECTA 1I3QA 1HR0H 2FLLA 4NZMA
chains in the Genus database with same CATH topology
2V59A 3QFFA 4DIMA 5JVLA 4TV9F 2QF7A 5DMXA 5CAEB 1BNCA 2P0AA 4WD3A 1M6VA 4ZOLF 1VBHA 4MV7A 4YJ3F 4O7WA 4Y8VB 5I47A 1UC9A 5J2UF 2GQSA 2HJWA 4MV1A 3VPCA 2YYAA 4O2BF 1UC8A 5JQWA 2W70A 3K5IA 3RV3A 2W71A 4YAJB 3KAKA 4FFPA 2R85A 3LWBA 1IOWA 2XD4A 2GLTA 3ETHA 4O81A 2V58A 2J9GA 2ZDHA 4DLKA 3TINA 1KJ9A 1KJ8A 2VQDA 5K2MA 4O7YA 2R7MA 2DIKA 5CA1F 2YS6A 2I8CA 2CNUA 3V4SA 3G8CA 2OLSA 2YRWA 1KJJA 4HR7A 1M0WA 4XYMB 2R87A 4O7TA 4XZ3B 4O4LF 2FPPB 4IIJF 5CA0F 2R6FA 5LOVF 3R5HA 3AX6A 4MA0A 3RFCA 4M9UA 1VKZA 3Q1KA 5LA6F 3NUAA 4C5BA 4I55F 3N8DA 4C5CA 2YL2A 1KEEA 1GSOA 2R7LA 2W6ZA 3KALA 1DV2A 2R82A 1EUCB 3MWEA 3JZIA 2C00A 4O7SA 5EZYF 5BPFA 3GIDA 4O4JF 1DV1A 1C3OA 4RZQA 5FNVF 5LP6F 1M0TA 1GSHA 4EG0A 1A9XA 4YJ2F 2YZNA 3R23A 3HBLA 4O83A 4O4IF 2FPGB 1EHIA 1KUTA 3KREA 2FP4B 5J2TF 1B6RA 4I50F 3ORRA 1OBDA 4IHJF 2ZDQA 1IOVA 3RUPA 2NUAB 4MV9A 1Z2OX 1GSAA 3K5HA 3VPBA 3LP8A 1W96A 2YRXA 2R7KA 1CE8A 4YAKB 2WYOA 4O4HF 3WNZA 4ZI7F 2PVPA 5CB4F 2ZDGA 4MV6A 5JVDF 4HNTA 3DF7A 4NYEA 3V4ZA 2I80A 1AUVA 4HNUA 3HO8A 5H80A 1JDBB 4TUYF 2CZGA 2YZMA 2Z04A 3KAJA 4I4TF 1A48A 4HNVA 4XX0B 4QSHA 4XYLB 2NU7B 3I12A 1C30A 2W6MA 2W6PA 2R86A 4O7VA 4FE2A 5C1OA 3U9TA 4FFRA 2QK4A 2DLNA 3UFXB 4IWXA 1CQJB 1B6SA 4HQ6A 4FU0A 2GPWA 2X0SA 4FGRA 3TQTA 1KBLA 3OUZA 5JQGF 4L1KA 1CS0A 4O2AF 4FFOA 4O7NA 3Q2OA 5C1PA 5KX5F 1JKJB 4E4TA 3TIGA 1T36A 4MA5A 2PBZA 5D8DA 2VR1A 1KJIA 2W6OA 1WR2A 2I87A 5LXTF 2IP4A 2YZGA 3WO1A 3HB9A 5JH7F 1OBGA 1PX2A 4WBNF 1E4EA 3VA7A 2YZLA 3R5XA 4YBZB 1Z2PX 4IZOA 3SE7A 3AW8A 1PK8A 1ULZA 2HGSA 1JDEA 1W93A 4C5AA 2XCLA 4EGQA 1EUDB 2FPIB 3BG5A 1EZ1A 3MJFA 1CQIB 2YW2A 3JZFA 2W6NA 2YS7A 5GONF 4O7ZA 3GLKA 2YWVA 2SCUB 3ETJA 1I7LA 1GLVA 1EYZA 2NU9B 1SCUB 4ME6A 4IWYA 5LYJF 1BXRA 4O7RA 3JRXA 5BPHA 1E4EB 2V5AA 3K3PA 3VMMA 2CNQA 2FB9A 1KC7A 3G8DA 4FFNA 3TW6A 3VPDA 4ZQIA 2GQRA 3R5FA 2CNVA 1AUXA 5HBRB 1KJQA 3U55A 1GGOA 4YB8B 4MAMA 3E5NA 4FFMA 5IYZF 2CQYA 1VBGA 4O7LA 4FFLA 4MV3A 4O82A 4O84A 2DZDA 1DIKA 1Z2NX 2NU8B 4EGJA 3U9SA 5BMVF 1I7NA 1JLLB 3OUUA 3ORQA 5HV6A 5C8YF 4O86A 3TIIA 3JRWA 2R84A 5KKNB 2NU6B 3VOTA 4MV8A 4TV8F 2DWCA 4MV4A 2Z02A 3N6RA 3RV4A 2R7NA 4ZHQF 3MWDA 2W6QA 3U54A 3R9RA 2PN1A 2VPQA 2GPSA 3WO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V59 A;  3QFF A;  4DIM A;  5JVL A;  4TV9 F;  2QF7 A;  5DMX A;  5CAE B;  1BNC A;  2P0A A;  4WD3 A;  1M6V A;  4ZOL F;  1VBH A;  4MV7 A;  4YJ3 F;  4O7W A;  4Y8V B;  5I47 A;  1UC9 A;  5J2U F;  2GQS A;  2HJW A;  4MV1 A;  3VPC A;  2YYA A;  4O2B F;  1UC8 A;  5JQW A;  2W70 A;  3K5I A;  3RV3 A;  2W71 A;  4YAJ B;  3KAK A;  4FFP A;  2R85 A;  3LWB A;  1IOW A;  2XD4 A;  2GLT A;  3ETH A;  4O81 A;  2V58 A;  2J9G A;  2ZDH A;  4DLK A;  3TIN A;  1KJ9 A;  1KJ8 A;  2VQD A;  5K2M A;  4O7Y A;  2R7M A;  2DIK A;  5CA1 F;  2YS6 A;  2I8C A;  2CNU A;  3V4S A;  3G8C A;  2OLS A;  2YRW A;  1KJJ A;  4HR7 A;  1M0W A;  4XYM B;  2R87 A;  4O7T A;  4XZ3 B;  4O4L F;  2FPP B;  4IIJ F;  5CA0 F;  2R6F A;  5LOV F;  3R5H A;  3AX6 A;  4MA0 A;  3RFC A;  4M9U A;  1VKZ A;  3Q1K A;  5LA6 F;  3NUA A;  4C5B A;  4I55 F;  3N8D A;  4C5C A;  2YL2 A;  1KEE A;  1GSO A;  2R7L A;  2W6Z A;  3KAL A;  1DV2 A;  2R82 A;  1EUC B;  3MWE A;  3JZI A;  2C00 A;  4O7S A;  5EZY F;  5BPF A;  3GID A;  4O4J F;  1DV1 A;  1C3O A;  4RZQ A;  5FNV F;  5LP6 F;  1M0T A;  1GSH A;  4EG0 A;  1A9X A;  4YJ2 F;  2YZN A;  3R23 A;  3HBL A;  4O83 A;  4O4I F;  2FPG B;  1EHI A;  1KUT A;  3KRE A;  2FP4 B;  5J2T F;  1B6R A;  4I50 F;  3ORR A;  1OBD A;  4IHJ F;  2ZDQ A;  1IOV A;  3RUP A;  2NUA B;  4MV9 A;  1Z2O X;  1GSA A;  3K5H A;  3VPB A;  3LP8 A;  1W96 A;  2YRX A;  2R7K A;  1CE8 A;  4YAK B;  2WYO A;  4O4H F;  3WNZ A;  4ZI7 F;  2PVP A;  5CB4 F;  2ZDG A;  4MV6 A;  5JVD F;  4HNT A;  3DF7 A;  4NYE A;  3V4Z A;  2I80 A;  1AUV A;  4HNU A;  3HO8 A;  5H80 A;  1JDB B;  4TUY F;  2CZG A;  2YZM A;  2Z04 A;  3KAJ A;  4I4T F;  1A48 A;  4HNV A;  4XX0 B;  4QSH A;  4XYL B;  2NU7 B;  3I12 A;  1C30 A;  2W6M A;  2W6P A;  2R86 A;  4O7V A;  4FE2 A;  5C1O A;  3U9T A;  4FFR A;  2QK4 A;  2DLN A;  3UFX B;  4IWX A;  1CQJ B;  1B6S A;  4HQ6 A;  4FU0 A;  2GPW A;  2X0S A;  4FGR A;  3TQT A;  1KBL A;  3OUZ A;  5JQG F;  4L1K A;  1CS0 A;  4O2A F;  4FFO A;  4O7N A;  3Q2O A;  5C1P A;  5KX5 F;  1JKJ B;  4E4T A;  3TIG A;  1T36 A;  4MA5 A;  2PBZ A;  5D8D A;  2VR1 A;  1KJI A;  2W6O A;  1WR2 A;  2I87 A;  5LXT F;  2IP4 A;  2YZG A;  3WO1 A;  3HB9 A;  5JH7 F;  1OBG A;  1PX2 A;  4WBN F;  1E4E A;  3VA7 A;  2YZL A;  3R5X A;  4YBZ B;  1Z2P X;  4IZO A;  3SE7 A;  3AW8 A;  1PK8 A;  1ULZ A;  2HGS A;  1JDE A;  1W93 A;  4C5A A;  2XCL A;  4EGQ A;  1EUD B;  2FPI B;  3BG5 A;  1EZ1 A;  3MJF A;  1CQI B;  2YW2 A;  3JZF A;  2W6N A;  2YS7 A;  5GON F;  4O7Z A;  3GLK A;  2YWV A;  2SCU B;  3ETJ A;  1I7L A;  1GLV A;  1EYZ A;  2NU9 B;  1SCU B;  4ME6 A;  4IWY A;  5LYJ F;  1BXR A;  4O7R A;  3JRX A;  5BPH A;  1E4E B;  2V5A A;  3K3P A;  3VMM A;  2CNQ A;  2FB9 A;  1KC7 A;  3G8D A;  4FFN A;  3TW6 A;  3VPD A;  4ZQI A;  2GQR A;  3R5F A;  2CNV A;  1AUX A;  5HBR B;  1KJQ A;  3U55 A;  1GGO A;  4YB8 B;  4MAM A;  3E5N A;  4FFM A;  5IYZ F;  2CQY A;  1VBG A;  4O7L A;  4FFL A;  4MV3 A;  4O82 A;  4O84 A;  2DZD A;  1DIK A;  1Z2N X;  2NU8 B;  4EGJ A;  3U9S A;  5BMV F;  1I7N A;  1JLL B;  3OUU A;  3ORQ A;  5HV6 A;  5C8Y F;  4O86 A;  3TII A;  3JRW A;  2R84 A;  5KKN B;  2NU6 B;  3VOT A;  4MV8 A;  4TV8 F;  2DWC A;  4MV4 A;  2Z02 A;  3N6R A;  3RV4 A;  2R7N A;  4ZHQ F;  3MWD A;  2W6Q A;  3U54 A;  3R9R A;  2PN1 A;  2VPQ A;  2GPS A;  3WO0 A; 
#chains in the Genus database with same CATH topology
 2V59 A;  2NVY A;  3J81 W;  3QFF A;  4DIM A;  3BA9 A;  4TV9 F;  5JVL A;  1N36 H;  1RJQ A;  2QF7 A;  5DMX A;  2E2H A;  5CAE B;  1BNC A;  1VS0 A;  2P0A A;  3SNO A;  3CVZ A;  4K0K H;  4WD3 A;  1M6V A;  4ZOL F;  5DG9 A;  3RR5 A;  3GIQ A;  3TY8 A;  3TW7 A;  5KG0 A;  2BQ3 A;  2ODT X;  1DGS A;  1VBH A;  4MV7 A;  2ZJT A;  2C2D A;  4YJ3 F;  4B3M H;  3MFH A;  4O7W A;  4Y8V B;  3H4B A;  4DR1 H;  4A3D G;  4LF7 H;  4GC7 A;  5I47 A;  1K1Q A;  1TWA A;  1UC9 A;  3F8N A;  4ETS A;  3KYH C;  5J2U F;  3GDE A;  2GQS A;  2UVV A;  5KFC A;  2HJW A;  1XMO H;  4MV1 A;  4F4W A;  3VPC A;  3QWU A;  2YYA A;  3N42 B;  5KFT A;  4J9N A;  2JA5 A;  4LH7 A;  1XNQ H;  3I4M G;  4O2B F;  2ZM6 H;  3C0F B;  3GJX B;  1I1K A;  2RGR A;  2COG A;  1UC8 A;  3BAB A;  3QQM A;  1FJG H;  3W5O A;  5JQW A;  2W70 A;  4QW8 A;  3K5I A;  3BQ1 A;  3WWJ A;  1N32 H;  3HT5 A;  3G6V A;  3RV3 A;  5EWE A;  4RCN A;  4PBC A;  2W71 A;  4YAJ B;  3DAA A;  4QWB A;  3KAK A;  5KFG A;  5F9N A;  3N41 B;  4YQW A;  2BQU A;  2VUG A;  5L9X A;  1I1M A;  5DGH A;  4JI7 H;  4UCO A;  4FFP A;  4BBS G;  5DQH A;  3FMA A;  5A2Q W;  3PW7 A;  4U7C A;  4FBU A;  1RYR A;  2R85 A;  4A3F G;  4IRC A;  1IYD A;  1TA8 A;  4FS1 A;  2B63 A;  3LWB A;  1IOW A;  1Y1V G;  1I2K A;  1ZET A;  2XD4 A;  4PDB A;  4RAZ A;  2GLT A;  1V51 A;  4B3T H;  4NXN H;  4JI0 H;  5DLF A;  2C22 A;  4LSX A;  1T94 A;  4ECX A;  3T9B A;  3T9F A;  3ETH A;  4O81 A;  5I5U A;  4EFE A;  2UXB H;  4C2M A;  4EYH B;  2V58 A;  2J9G A;  2ZDH A;  4GLW A;  4JV0 A;  5K3W A;  5BYA A;  3H40 A;  2R8I A;  4DLK A;  4QJF A;  4O3O A;  2HHF B;  3TIN A;  2J6S A;  1HNW H;  4Q4C A;  4A2A A;  1KJ9 A;  1JIH A;  5KFJ A;  1KJ8 A;  2ASJ A;  1BGW A;  4R7R A;  2Y0S A;  5KFZ A;  2VQD A;  4CKB A;  2RGV A;  5K2M A;  4O7Y A;  4ECY A;  2R7M A;  2DIK A;  4LFA H;  5CA1 F;  2FKL A;  4ED3 A;  2Q2T A;  4ECV A;  3JZ6 A;  2YS6 A;  3TQ1 A;  4BY7 G;  2Q2U A;  2I8C A;  4IR9 A;  2NVX A;  3T5K A;  3EPI A;  5BWR A;  1V9P A;  2HG8 A;  5FPR A;  5I5S A;  5C5J A;  1JX4 A;  1I6U A;  2CNU A;  3V4S A;  2R93 G;  4DRF A;  3RB0 A;  1IBK H;  4R8U B;  4RB2 C;  2R8J A;  3GQC A;  4Q44 A;  5I5Y A;  1WSC A;  3G8C A;  1CKM A;  4E6N A;  2YRW A;  2OLS A;  2IMW P;  1KJJ A;  4HR7 A;  4FS2 A;  4ECQ A;  1BJT A;  1M0W A;  4XYM B;  4QWC A;  3KHR A;  2R87 A;  1EKF A;  1KT8 A;  5CM0 A;  4O7T A;  1S03 G;  5BR8 H;  1XMQ H;  4XZ3 B;  1TWC A;  5KFF A;  3OHB A;  3GII A;  4DV4 H;  4LF8 H;  1WH2 A;  4QW9 A;  3I4N G;  5DLG A;  4O4L F;  5KFX A;  4QIW A;  2UUB H;  2FPP B;  4PZ8 A;  1S10 A;  4DV7 H;  4IIJ F;  4J9M A;  5CA0 F;  5BWX A;  2R6F A;  4F4Y A;  2DPJ A;  5LOV F;  4K6N A;  1G2W A;  2ABJ A;  4MTD A;  2VQF H;  3R5H A;  2ASD A;  3AX6 A;  3PR5 B;  4MA0 A;  1N33 H;  3RFC A;  3PZP A;  3RAX A;  4M9U A;  1VKZ A;  5FLX W;  3Q1K A;  3PW2 A;  3GTO A;  3T5H A;  5LA6 F;  3NUA A;  5KT6 A;  3PO3 G;  4C5B A;  4DUZ H;  4I55 F;  3N8D A;  1MZB A;  4C5C A;  2YL2 A;  2FK1 A;  5EWF A;  1KEE A;  1GSO A;  2DAA A;  4FM9 A;  2W7P A;  1RYS A;  2R7L A;  2V4Q A;  5KG6 A;  3T54 A;  4UCV A;  3T9E A;  5IYC G;  2W6Z A;  1E4G T;  4A3J G;  3KAL A;  1DV2 A;  1I94 H;  4LF4 H;  2AGP A;  4LF6 H;  2R82 A;  1EUC B;  3MWE A;  4J9R A;  1ZAU A;  4PZ6 A;  2FJZ A;  1Y1W G;  3H20 A;  3JZI A;  2C00 A;  4O7S A;  5EZY F;  5FLM G;  2E5L H;  3VNN A;  5BPF A;  3FKI G;  5KFO A;  1S0O A;  3CQZ A;  3GID A;  3GIK A;  4O4J F;  5L1J A;  1ZQ7 A;  4CE5 A;  5KFB A;  1DV1 A;  1C3O A;  3BA8 A;  4DL5 A;  4RZQ A;  3KTM A;  4O3S A;  1SEI A;  1TWF A;  3M4I A;  2HHF A;  2Y0S E;  3MR3 A;  2W9B A;  4X64 H;  4AQY H;  4A3G G;  4OX9 H;  5FNV F;  5LP6 F;  5KG3 A;  1M0T A;  5KFV A;  4EYI B;  2W7O A;  5L1I A;  1GSH A;  5D1O B;  4EG0 A;  3TY9 A;  4YJ2 F;  1A9X A;  1P16 A;  3Q8Q B;  4FBT A;  2YZN A;  4CKC A;  5IWA H;  3R23 A;  3UZB A;  3HBL A;  4JI2 H;  5KFL A;  4Q43 A;  2CW8 A;  3JSL A;  3SGI A;  5KG4 A;  2M05 A;  4R8U A;  4HN2 A;  3T1Y H;  4NLG A;  2XCA A;  1OWT A;  4CMD A;  5I5X A;  2Y4R A;  4O83 A;  2C2R A;  4O4I F;  2FPG B;  4RUA A;  4QWA A;  1T3N A;  1SFO A;  4YY3 H;  1CKN A;  3RF2 A;  3HOX G;  1EHI A;  4O3P A;  2F4V H;  1KUT A;  3KRE A;  5KFA A;  3MR2 A;  2FP4 B;  5DIS C;  5J2T F;  5BWV A;  4JV5 H;  3HKZ A;  4QIW E;  3G6Y A;  1B6R A;  3U0G A;  4I50 F;  3ORR A;  5KT7 A;  2C28 A;  3JAM W;  3Q8R B;  4UFZ A;  4DR2 H;  2UUA H;  1OBD A;  4IHJ F;  1CKO A;  1Y1V A;  4J9K A;  2ZDQ A;  1IOV A;  3RUP A;  2NUA B;  4MV9 A;  5BWW A;  1ET0 A;  1O75 A;  5KT5 A;  1Y14 B;  4ED7 A;  1Z2O X;  3PR4 A;  3GTQ A;  3RJ0 A;  1GSA A;  3K5H A;  3VPB A;  3S24 A;  2R8G A;  3LP8 A;  3T99 A;  3UQ8 A;  1J5E H;  4B3S H;  4BBR G;  5EWG A;  5KT4 A;  2IA6 A;  1W96 A;  5KFK A;  5KFQ A;  2UUC H;  2YRX A;  3GV5 B;  4GKJ H;  4RB1 A;  2R7K A;  1X9N A;  1CE8 A;  1GO3 E;  4UCT A;  4YAK B;  5I5W A;  2WYO A;  4O4H F;  3WNZ A;  4ZI7 F;  5BWT A;  1VAJ A;  2PVP A;  5EOY A;  5CB4 F;  3G6X A;  4DL4 A;  2AQ4 A;  2ZDG A;  4MV6 A;  2EJ3 A;  5JVD F;  1WCM G;  3K3V A;  4MTE A;  4CC6 A;  4HNT A;  4EBD A;  3DF7 A;  3PW0 A;  1A3G A;  4NYE A;  4GLX A;  2PMZ A;  2I80 A;  3V4Z A;  1AUV A;  4JI8 H;  3MR6 A;  4HNU A;  4DV2 H;  3HO8 A;  5H80 A;  1P8L A;  2AU0 A;  3V6J A;  1JDB B;  3GB8 B;  4NZN A;  3M9N B;  3L4K A;  3GV7 B;  1IBL H;  4TUY F;  3JSN A;  2CZG A;  3RTX A;  2WB1 A;  3EYY A;  2R93 A;  2YZM A;  4ED0 A;  2Z04 A;  3LUL A;  5DGA A;  5C4X G;  2W9B B;  3KAJ A;  4DR4 H;  4UCS A;  1N56 A;  2AGO A;  4JUZ A;  3N44 B;  4I4T F;  3HOW G;  1A48 A;  1E4F T;  5LMN H;  4DV3 H;  4IRK A;  5D1P A;  2UVR A;  4HNV A;  4XX0 B;  2EJ0 A;  2CW7 A;  1TWH A;  5FJ8 G;  2MCT A;  2YCH A;  2DPI A;  4GKK H;  2JEG A;  3RIZ A;  4JV1 A;  4QSH A;  4A3K G;  4XYL B;  5D1O A;  3J80 W;  2XCP A;  2NU7 B;  5FR9 A;  2XC9 A;  2WTF A;  2HVQ A;  4X62 H;  3I12 A;  1C30 A;  1WRV A;  2ASL A;  2WDT A;  5EDW A;  4CHI A;  2W6M A;  3GIP A;  5KFI A;  4J9O A;  4JI5 H;  2W6P A;  1L2Z A;  4LSA A;  2R86 A;  4TM5 A;  2WAQ A;  5IP9 G;  4O7V A;  4FE2 A;  4DR3 H;  4Q8F A;  5BYB A;  4DR7 H;  5C1O A;  4DR5 H;  1CKN B;  3U9T A;  4ECW A;  4JI3 H;  4A3M G;  2HVS A;  2YU9 A;  2W9C B;  4RNO A;  4FFR A;  2QK4 A;  2DLN A;  5DGI A;  3UFX B;  3RGX A;  5BWU A;  2RDI A;  3GIL A;  3GTK A;  4IWX A;  4TVI A;  5KS8 A;  4RNN A;  2RF4 A;  4A93 G;  3RB3 A;  3V6K A;  3NBZ B;  1CQJ B;  4PZ7 A;  1B6S A;  4HQ6 A;  4ED2 A;  1S68 A;  3J7A K;  4FU0 A;  2JA6 G;  2UU9 H;  3V6H A;  4J9S A;  3M9M B;  3RAQ A;  1S97 A;  2GPW A;  4F50 A;  3HOY G;  4U6P A;  2X0S A;  4FGR A;  3TQT A;  5KFM A;  5IYB G;  3HOU G;  3N43 B;  3BJY A;  1KBL A;  3PO2 G;  5I60 A;  1Y1W A;  1I1L A;  5KFS A;  5IP7 G;  5KT3 A;  3CSW A;  2R92 A;  2R7Z G;  2UVW A;  3FKI A;  2JEI A;  2ATL A;  4DUY H;  1EKP A;  4JV2 A;  2R92 G;  3OUZ A;  4RB3 C;  5JQG F;  5KFN A;  4J9Q A;  4A3L G;  3DTG A;  4L1K A;  1CS0 A;  3RBD A;  3LQS A;  4O2A F;  4FFO A;  4O7N A;  5DGB A;  3Q2O A;  4A3I G;  5C1P A;  3BAA A;  3N40 P;  3HOZ G;  5F9L A;  3PW5 A;  3LML A;  2HHH H;  5KX5 F;  2VPS A;  1JKJ B;  4E4T A;  1TWG A;  3TIG A;  4O3R A;  4DV0 H;  4B3R H;  2WB1 E;  1T36 A;  1S9F A;  4MA5 A;  2JEF A;  2X5R A;  2PBZ A;  5D8D A;  2VR1 A;  4CKE A;  4JI6 H;  1KJI A;  3NBY B;  4Q8E A;  2J6U A;  2VUM G;  4Q0Y A;  2W6O A;  2BR0 A;  1JXL A;  3GTL A;  4J9P A;  2O03 A;  4RU9 A;  3OSN A;  1WR2 A;  2I87 A;  5LXT F;  5DG7 A;  4X65 H;  3PFF A;  4DAA A;  2C2E A;  2JA7 G;  2IP4 A;  1A0I A;  2YZG A;  4O3N A;  4HYK A;  3WO1 A;  3HB9 A;  5JH7 F;  5HNE A;  1OBG A;  1PX2 A;  1TAE A;  4DL3 A;  4DV1 H;  5E25 A;  2E2I A;  2HIV A;  1E4E A;  4WBN F;  2VOB A;  5IYD G;  3VA7 A;  2YZL A;  5LL6 b;  3SI8 A;  1FKA H;  4EBC A;  3R5X A;  3QZ8 A;  2WAQ E;  4YBZ B;  1Z2P X;  4ECU A;  5CE8 A;  2ALZ A;  4CMF A;  3H0G G;  1HNZ H;  1IBM H;  4IZO A;  2UXD H;  5KFH A;  3BQ0 A;  4ECZ A;  3SE7 A;  4ED1 A;  3OSP A;  1XNR H;  5T14 A;  3AW8 A;  1PK8 A;  2W9C A;  4RB0 A;  4F4X A;  1I50 A;  4LH6 A;  2OH2 A;  1ULZ A;  2HGS A;  2HDK A;  1JDE A;  1W93 A;  2C35 B;  2R8K A;  4Q4D A;  4I7H A;  4RUC A;  4C5A A;  1K83 A;  2XCL A;  5DAA A;  4M7E A;  4YR2 A;  4EGQ A;  2W8K A;  5DQG A;  3GTP A;  1EUD B;  2FPI B;  4JI1 H;  2COJ A;  1WCM A;  5KG5 A;  3NC0 B;  3OTO H;  2VQE H;  4LF5 H;  4PWQ A;  1RK5 A;  4Q45 A;  5KFE A;  2WE6 A;  3BG5 A;  4QWD A;  4GC6 A;  1V4Y A;  1A0G A;  2FK3 A;  3NGD A;  3GIJ A;  4J9L A;  1EZ1 A;  3MJF A;  2BQR A;  1CQI B;  2YW2 A;  3JZF A;  3RB4 A;  4APM A;  2FMA A;  4LFC H;  2W6N A;  2YS7 A;  4JYA H;  4LMY A;  4AYB A;  1B04 A;  3WWI A;  4YHH H;  5KG7 A;  3L4J A;  3EPG A;  5GON F;  4O7Z A;  1XK5 A;  3GLK A;  4EQ5 A;  3RB6 A;  4M0J A;  5C3E G;  2YWV A;  4EEQ A;  2SCU B;  1B33 N;  5LMU H;  2JA5 G;  3ETJ A;  1I7L A;  1GLV A;  1EYZ A;  3IG0 A;  3QZ7 A;  2V4R A;  2NU9 B;  4J0M A;  4YR3 A;  4UUG A;  1FVI A;  1SCU B;  4UCU A;  3FDS A;  3DTF A;  3RGZ A;  3Q8P B;  3HOV G;  4ME6 A;  5FPO A;  5KFY A;  4IWY A;  4ECS A;  2W57 A;  5LYJ F;  5JUM A;  3T1H H;  1KTA A;  1BXR A;  4RAY A;  4O7R A;  3JRX A;  5BPH A;  1DAA A;  4RZR A;  4ED8 A;  2FLP A;  3KHG A;  3GIM A;  2VA2 A;  4IRD A;  4RNM A;  3GTJ A;  1E4E B;  2V5A A;  3K3P A;  3Q8S B;  3VMM A;  2CFM A;  4BY1 G;  3IN5 A;  4ED6 A;  2CNQ A;  2FK2 A;  2FB9 A;  5C44 G;  1KC7 A;  3N6X A;  2JA6 A;  3G8D A;  4FFN A;  3TW6 A;  3VPD A;  5FD6 A;  4ZQI A;  4EEY A;  2GQR A;  2B63 G;  2J6T A;  3R5F A;  3GTM A;  2CNV A;  1AUX A;  3UYY A;  4A3C G;  3HXL A;  3W1G A;  2Q7D A;  5HBR B;  5KFP A;  5FD5 A;  3PVX A;  1I2L A;  3MWM A;  1KJQ A;  1ZHS A;  2R7Z A;  4KHP H;  3U55 A;  3OHA A;  1GGO A;  3HKZ E;  4YB8 B;  4ECR A;  4A3E G;  2R8H A;  1K1S A;  5I5T A;  1XDN A;  4MAM A;  3KXY T;  3E5N A;  3PW4 A;  2XGP A;  1RJR A;  2AGQ A;  4LF9 H;  4FFM A;  1SYX B;  5KG1 A;  4DL2 A;  5IYZ F;  2W8L A;  2CQY A;  2EJ2 A;  4YR0 A;  5CR5 A;  4JXU A;  3UZO A;  2KSW A;  3PN1 A;  1VBG A;  4O7L A;  4X66 H;  4YP3 A;  4DL6 A;  4DL7 A;  4FFL A;  4MV3 A;  4O82 A;  3TY5 A;  2XIG A;  4TQR A;  2RDJ A;  3T9C A;  5IT9 W;  4O84 A;  3BQ2 A;  3GV8 B;  5KFR A;  2DZD A;  5KG2 A;  3W1B A;  4UCR A;  1DIK A;  1Z2N X;  5I5V A;  3TEK A;  2FE3 A;  4NXM H;  4NZO A;  4BXX G;  5KT2 A;  2NU8 B;  4EBE A;  2COI A;  2HVR A;  2A1H A;  2HIX A;  2VUM A;  3AYH B;  4AYB E;  2JEJ A;  3GTG A;  4DV5 H;  4EGJ A;  3U9S A;  2PMZ E;  5BMV F;  4IAJ A;  3CEB A;  3MR5 A;  4LFB H;  1I7N A;  1JLL B;  4EFB A;  3OUU A;  5DG8 A;  3ORQ A;  2FLN A;  4A2B A;  1R9T A;  2OWO A;  2JA7 A;  5HV6 A;  5KFU A;  1AN7 A;  5C8Y F;  3T5L A;  4O86 A;  3L2P A;  4QWE A;  2QB5 A;  5KFD A;  3T5J A;  3TII A;  1N48 A;  2DAB A;  2HGW A;  2HGX A;  3JRW A;  4DR6 H;  2R84 A;  4IR1 A;  1S0M A;  3RBE A;  1GYF A;  5KKN B;  3MFI A;  4BWS C;  4O3Q A;  2XGQ A;  1S0N A;  4TQS A;  2NU6 B;  1RJP A;  2VA3 A;  3KHL A;  3T9A A;  1M7J A;  3T7A A;  3VOT A;  4MV8 A;  2CKZ B;  1HNX H;  4JI4 H;  5L1K A;  3H0G A;  2IBK A;  4TV8 F;  2DWC A;  4A3B G;  1EKV A;  5DQI A;  4MV4 A;  5L1L A;  1N34 H;  2UXC H;  4WHX A;  1IYE A;  2V9W A;  3H3V H;  2Z02 A;  3N6R A;  4CC5 A;  3RV4 A;  4DQN A;  2R7N A;  2ZGI A;  5KFW A;  4ZHQ F;  4DV6 H;  3M9O B;  4F4Z A;  2UVU A;  2JA8 G;  3MWD A;  2W6Q A;  3BAC A;  1RK6 A;  3U54 A;  3R9R A;  1ZHQ A;  3KHH A;  2W9A A;  4G3I A;  2EIY A;  3T9D A;  3WWH A;  2QYZ A;  2PN1 A;  1UNN C;  2VPQ A;  3H4D A;  2GPS A;  3WO0 A;  4ECT A;  1I3Q A;  1HR0 H;  2FLL A;  4NZM A; 
#chains in the Genus database with same CATH homology
 2V59 A;  3QFF A;  4DIM A;  5JVL A;  4TV9 F;  2QF7 A;  5DMX A;  5CAE B;  1BNC A;  2P0A A;  4WD3 A;  1M6V A;  4ZOL F;  1VBH A;  4MV7 A;  4YJ3 F;  4O7W A;  4Y8V B;  5I47 A;  1UC9 A;  5J2U F;  2GQS A;  2HJW A;  4MV1 A;  3VPC A;  2YYA A;  4O2B F;  1UC8 A;  5JQW A;  2W70 A;  3K5I A;  3RV3 A;  2W71 A;  4YAJ B;  3KAK A;  4FFP A;  2R85 A;  3LWB A;  1IOW A;  2XD4 A;  2GLT A;  3ETH A;  4O81 A;  2V58 A;  2J9G A;  2ZDH A;  4DLK A;  3TIN A;  1KJ9 A;  1KJ8 A;  2VQD A;  5K2M A;  4O7Y A;  2R7M A;  2DIK A;  5CA1 F;  2YS6 A;  2I8C A;  2CNU A;  3V4S A;  3G8C A;  2OLS A;  2YRW A;  1KJJ A;  4HR7 A;  1M0W A;  4XYM B;  2R87 A;  4O7T A;  4XZ3 B;  4O4L F;  2FPP B;  4IIJ F;  5CA0 F;  2R6F A;  5LOV F;  3R5H A;  3AX6 A;  4MA0 A;  3RFC A;  4M9U A;  1VKZ A;  3Q1K A;  5LA6 F;  3NUA A;  4C5B A;  4I55 F;  3N8D A;  4C5C A;  2YL2 A;  1KEE A;  1GSO A;  2R7L A;  2W6Z A;  3KAL A;  1DV2 A;  2R82 A;  1EUC B;  3MWE A;  3JZI A;  2C00 A;  4O7S A;  5EZY F;  5BPF A;  3GID A;  4O4J F;  1DV1 A;  1C3O A;  4RZQ A;  5FNV F;  5LP6 F;  1M0T A;  1GSH A;  4EG0 A;  1A9X A;  4YJ2 F;  2YZN A;  3R23 A;  3HBL A;  4O83 A;  4O4I F;  2FPG B;  1EHI A;  1KUT A;  3KRE A;  2FP4 B;  5J2T F;  1B6R A;  4I50 F;  3ORR A;  1OBD A;  4IHJ F;  2ZDQ A;  1IOV A;  3RUP A;  2NUA B;  4MV9 A;  1Z2O X;  1GSA A;  3K5H A;  3VPB A;  3LP8 A;  1W96 A;  2YRX A;  2R7K A;  1CE8 A;  4YAK B;  2WYO A;  4O4H F;  3WNZ A;  4ZI7 F;  2PVP A;  5CB4 F;  2ZDG A;  4MV6 A;  5JVD F;  4HNT A;  3DF7 A;  4NYE A;  3V4Z A;  2I80 A;  1AUV A;  4HNU A;  3HO8 A;  5H80 A;  1JDB B;  4TUY F;  2CZG A;  2YZM A;  2Z04 A;  3KAJ A;  4I4T F;  1A48 A;  4HNV A;  4XX0 B;  4QSH A;  4XYL B;  2NU7 B;  3I12 A;  1C30 A;  2W6M A;  2W6P A;  2R86 A;  4O7V A;  4FE2 A;  5C1O A;  3U9T A;  4FFR A;  2QK4 A;  2DLN A;  3UFX B;  4IWX A;  1CQJ B;  1B6S A;  4HQ6 A;  4FU0 A;  2GPW A;  2X0S A;  4FGR A;  3TQT A;  1KBL A;  3OUZ A;  5JQG F;  4L1K A;  1CS0 A;  4O2A F;  4FFO A;  4O7N A;  3Q2O A;  5C1P A;  5KX5 F;  1JKJ B;  4E4T A;  3TIG A;  1T36 A;  4MA5 A;  2PBZ A;  5D8D A;  2VR1 A;  1KJI A;  2W6O A;  1WR2 A;  2I87 A;  5LXT F;  2IP4 A;  2YZG A;  3WO1 A;  3HB9 A;  5JH7 F;  1OBG A;  1PX2 A;  4WBN F;  1E4E A;  3VA7 A;  2YZL A;  3R5X A;  4YBZ B;  1Z2P X;  4IZO A;  3SE7 A;  3AW8 A;  1PK8 A;  1ULZ A;  2HGS A;  1JDE A;  1W93 A;  4C5A A;  2XCL A;  4EGQ A;  1EUD B;  2FPI B;  3BG5 A;  1EZ1 A;  3MJF A;  1CQI B;  2YW2 A;  3JZF A;  2W6N A;  2YS7 A;  5GON F;  4O7Z A;  3GLK A;  2YWV A;  2SCU B;  3ETJ A;  1I7L A;  1GLV A;  1EYZ A;  2NU9 B;  1SCU B;  4ME6 A;  4IWY A;  5LYJ F;  1BXR A;  4O7R A;  3JRX A;  5BPH A;  1E4E B;  2V5A A;  3K3P A;  3VMM A;  2CNQ A;  2FB9 A;  1KC7 A;  3G8D A;  4FFN A;  3TW6 A;  3VPD A;  4ZQI A;  2GQR A;  3R5F A;  2CNV A;  1AUX A;  5HBR B;  1KJQ A;  3U55 A;  1GGO A;  4YB8 B;  4MAM A;  3E5N A;  4FFM A;  5IYZ F;  2CQY A;  1VBG A;  4O7L A;  4FFL A;  4MV3 A;  4O82 A;  4O84 A;  2DZD A;  1DIK A;  1Z2N X;  2NU8 B;  4EGJ A;  3U9S A;  5BMV F;  1I7N A;  1JLL B;  3OUU A;  3ORQ A;  5HV6 A;  5C8Y F;  4O86 A;  3TII A;  3JRW A;  2R84 A;  5KKN B;  2NU6 B;  3VOT A;  4MV8 A;  4TV8 F;  2DWC A;  4MV4 A;  2Z02 A;  3N6R A;  3RV4 A;  2R7N A;  4ZHQ F;  3MWD A;  2W6Q A;  3U54 A;  3R9R A;  2PN1 A;  2VPQ A;  2GPS A;  3WO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...