5HBRB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 67
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5hbrB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5hbrB02
3R5XA 1KJ8A 4O7TA 1AUXA 2X0SA 5GONF 3VPBA 4QSHA 4O81A 3U9TA 3ORRA 4ZOLF 3HBLA 3DF7A 2GQRA 3R5FA 5BPHA 4O7NA 1PX2A 3GIDA 4MV1A 2HGSA 2VQDA 2NU9B 1M6VA 4O2AF 3TINA 4HNUA 4ME6A 4FFNA 2FPGB 2P0AA 3R5HA 3VPDA 3TQTA 4C5BA 2I87A 2HJWA 1EYZA 4DIMA 3HB9A 4O86A 2R87A 4ZI7F 1DV1A 3Q2OA 4I50F 2CNQA 3OUZA 1A48A 2XCLA 1E4EB 4YB8B 1C3OA 2GQSA 1M0WA 3TW6A 3ETJA 5J2TF 1PK8A 4C5CA 1BNCA 1IOWA 2YRXA 5LOVF 1Z2PX 2R82A 2NU6B 5HV6A 5DMXA 5C1OA 2W71A 2VR1A 4HNVA 3BG5A 1ULZA 2NUAB 2YS6A 5IYZF 3AX6A 2ZDGA 2SCUB 3U55A 4EGJA 1EZ1A 3JZIA 1DV2A 3OUUA 3VOTA 5BPFA 1JKJB 4M9UA 4MV8A 1I7LA 5H80A 5K2MA 2W6OA 5KX5F 2W6QA 4IZOA 1GSOA 2FP4B 1IOVA 3HO8A 1Z2NX 4MV3A 3RV3A 2W6ZA 2DWCA 5CA1F 3VMMA 3TIGA 1M0TA 2R7LA 4O7YA 1Z2OX 2YW2A 1EUDB 4O4IF 2DZDA 1GLVA 1KEEA 4XX0B 4XYMB 5JVDF 4O83A 1B6SA 1SCUB 5LP6F 5CAEB 4IWXA 2ZDQA 1JDBB 2I80A 5C1PA 1CQJB 4TUYF 1T36A 1KC7A 5CB4F 2ZDHA 3ETHA 2R7NA 1GSHA 3I12A 2QF7A 3MWDA 2R85A 5JQWA 4O7LA 3MJFA 5KKNB 3N8DA 4XYLB 4YAJB 1CS0A 2OLSA 3JZFA 2YZNA 1E4EA 2R6FA 5BMVF 3KAJA 1A9XA 2YZLA 4FFLA 2PVPA 2R7MA 4O7RA 1W93A 4FFPA 4FGRA 3VPCA 4C5AA 3AW8A 4MV9A 3WO0A 2PBZA 2IP4A 2YWVA 4ZHQF 4NYEA 5C8YF 1CQIB 4MV6A 4HQ6A 2FB9A 3KAKA 3ORQA 1W96A 4O4HF 4FFMA 1UC8A 4MA5A 5CA0F 1VBHA 3JRWA 2V5AA 4TV9F 4YAKB 2CNVA 1B6RA 1I7NA 4I55F 4YJ3F 5HBRB 3LWBA 2QK4A 2GPSA 3WO1A 4O7WA 3Q1KA 1OBDA 3U9SA 3JRXA 2PN1A 1EUCB 3RUPA 2J9GA 1GGOA 5JQGF 1KJIA 3G8DA 4RZQA 4DLKA 2Z04A 3RV4A 2YYAA 3G8CA 1JLLB 2W70A 3K5HA 3KALA 4MA0A 3RFCA 2VPQA 2YS7A 4FU0A 3MWEA 3K5IA 4MV7A 3R9RA 3TIIA 4ZQIA 2V59A 2W6MA 2R7KA 4I4TF 1C30A 3E5NA 1VKZA 4HR7A 1KJ9A 1KBLA 4O82A 5EZYF 2W6NA 2YRWA 4HNTA 2CQYA 4EGQA 4FE2A 4WD3A 2FPPB 2DIKA 2W6PA 2GPWA 4O2BF 5D8DA 2FPIB 4MV4A 4FFRA 2CNUA 2NU8B 1KUTA 2YZMA 4Y8VB 4YJ2F 5JH7F 2YL2A 3V4ZA 4O4JF 2R86A 3VA7A 3K3PA 3QFFA 3U54A 2NU7B 4E4TA 3UFXB 2WYOA 5FNVF 2DLNA 2Z02A 3R23A 3WNZA 4XZ3B 3GLKA 5J2UF 5LA6F 1CE8A 1AUVA 1VBGA 2GLTA 5LXTF 3N6RA 3NUAA 4EG0A 1JDEA 2YZGA 4IHJF 1GSAA 1KJQA 4O7VA 4MAMA 4O7ZA 5JVLA 3LP8A 3V4SA 4O7SA 1WR2A 1KJJA 2XD4A 3SE7A 5I47A 4FFOA 3KREA 1BXRA 4O4LF 4IIJF 4O84A 5LYJF 4L1KA 4TV8F 2I8CA 4YBZB 1DIKA 2V58A 4IWYA 2R84A 1OBGA 1EHIA 2C00A 2CZGA 4WBNF 1UC9A
chains in the Genus database with same CATH superfamily
2FLLA 3R5XA 1KJ8A 5FR9A 5BWTA 4O7TA 4A2BA 1EKPA 4RNOA 4DUYH 3OSPA 4FS1A 1AUXA 4LH7A 2X0SA 2O03A 5GONF 4M7EA 4F50A 3T9CA 4CC5A 2R8JA 3LULA 3F8NA 3VPBA 5KFOA 3RTXA 1I3QA 2R7ZA 4C2MA 3T99A 2WB1A 4QSHA 3Q8RB 4O81A 2R8GA 3U9TA 5DAAA 2F4VH 3T9FA 4CMFA 5KT2A 3PW7A 3TY8A 2Q2UA 3PR4A 3PN1A 3ORRA 4ZOLF 1P8LA 3HBLA 3DF7A 2GQRA 3R5FA 5FPOA 3WWIA 2XIGA 5C5JA 4RB2C 5BPHA 1Y14B 4PZ7A 4TQRA 3M9NB 4JI2H 4O7NA 1PX2A 3GIDA 2Q2TA 1K1SA 1TWAA 4YHHH 4MV1A 4U7CA 2OWOA 1XNRH 2EJ0A 3N42B 3MFHA 2V9WA 2HGSA 1RK6A 5KT6A 5I60A 1JX4A 2DAAA 2VQDA 2V4QA 4LF7H 2NU9B 1E4FT 3SNOA 3H3VH 3GJXB 5KFMA 4J9SA 1M6VA 2QYZA 4O2AF 5F9NA 3TINA 2CW7A 3GIPA 3MR6A 1B04A 1RJQA 2HGWA 4JI6H 5DQHA 2HDKA 1WCMG 4HNUA 4ME6A 4DR4H 4ECWA 1IYDA 4FFNA 5K3WA 1TWCA 3TEKA 4NZOA 4E6NA 4ED3A 4EYHB 2JA6G 3M4IA 5IP9G 3RBEA 2DPJA 2JA6A 5I5YA 1CKNB 2FPGB 2HHFA 2P0AA 3R5HA 3VPDA 3W1BA 4A3EG 3UZOA 3TQTA 4IRDA 1I2KA 4C5BA 2WDTA 2WTFA 2I87A 1I1MA 4LFBH 3BQ1A 3FKIG 2HJWA 3HOWG 2BR0A 1EYZA 3HOVG 4O3OA 4F4XA 1N33H 4RAZA 2AGPA 2JEFA 4X62H 4PZ8A 4DIMA 5C44G 3HB9A 4O86A 3U0GA 2R87A 3H0GG 2HGXA 4ZI7F 1DV1A 4BBRG 4EFBA 3Q2OA 3MR5A 4I50F 5DGAA 3RB4A 4IR1A 2CNQA 3OUZA 1ZHSA 4BBSG 1A48A 2XCLA 3PFFA 1E4EB 4EQ5A 4RNNA 4J9NA 3T5HA 4YR2A 3T5JA 4YB8B 2XCPA 3V6KA 1C3OA 2GQSA 4ED2A 3I4MG 2UVUA 4IAJA 1IYEA 4EEQA 5EDWA 3K3VA 4PDBA 1M0WA 3TW6A 3ETJA 4A3GG 2DABA 5J2TF 3C0FB 1PK8A 4RNMA 3BA9A 1N32H 4C5CA 1S9FA 3T9BA 1BNCA 2HG8A 5KFZA 1FVIA 2UVVA 4MTEA 1IOWA 2YRXA 4GLXA 5BWVA 5LOVF 2W8LA 1Z2PX 1Y1WG 2R82A 1J5EH 1O75A 5I5SA 3IG0A 2W7OA 4GLWA 1Y1WA 4LMYA 4FBUA 2NU6B 5HV6A 5DMXA 1SEIA 4WHXA 5C1OA 2W9AA 2Y4RA 2IMWP 2W71A 2VR1A 4CMDA 4R8UB 4QWCA 2HVQA 4HYKA 3M9OB 4HNVA 2AU0A 1A3GA 4A3LG 2FK1A 4Q44A 3GDEA 3BG5A 2COGA 1ULZA 5DLGA 2NUAB 2YS6A 2FK2A 5T14A 2C2DA 2W9CA 3T5LA 1VAJA 3PW0A 5IYZF 3NGDA 1V51A 4ED8A 4JI0H 3AX6A 2ZDGA 1V4YA 4RB0A 3Q8PB 5I5XA 1CKNA 2SCUB 2JEGA 3BACA 2WAQA 1TWFA 4DL2A 5HNEA 1EKFA 1IBLH 2WE6A 5KG0A 3BJYA 3U55A 4EGJA 3OHBA 5KT4A 1ZQ7A 1IBKH 1EZ1A 4CKBA 4GC6A 3JZIA 1DV2A 3OUUA 3VOTA 1I1LA 1JKJB 3NC0B 3S24A 3WWJA 4DAAA 5BPFA 5BWUA 1BJTA 4A3IG 4K0KH 4M9UA 2RDIA 3V6HA 2IA6A 4DV7H 2E5LH 3GIMA 4MV8A 3GTGA 4QIWA 3DTGA 3N44B 3I4NG 4CHIA 1I7LA 5H80A 1ZAUA 3BQ0A 4UFZA 5K2MA 2W6OA 3RAQA 4Q8FA 5KX5F 2W6QA 2FK3A 3FDSA 5F9LA 4HN2A 3LQSA 4IZOA 3JAMW 3PZPA 1N34H 2R92G 4NXMH 1TWGA 1GSOA 1ZETA 4JYAH 2FP4B 4O3QA 1IOVA 3HO8A 1HR0H 5D1PA 5KFUA 3CQZA 1S10A 1IBMH 1Z2NX 4MV3A 3RV3A 3HOXG 2W6ZA 5KG6A 2VUGA 1RJPA 4LSXA 1N36H 2DPIA 3OSNA 3RB6A 4DR7H 3PW4A 2R8HA 2DWCA 5CA1F 1XNQH 4X65H 4LF5H 4UCVA 3VMMA 3TIGA 3VNNA 5KFAA 2RGRA 4JV5H 2JA7A 5D1OA 1M0TA 5L1JA 1P16A 2R7LA 2VQFH 3N40P 4QWEA 2Y0SA 3SGIA 4LH6A 4O7YA 1Z2OX 4TQSA 2J6TA 3GV8B 4J9RA 5DQIA 4ETSA 5KFEA 4DR5H 2YW2A 5DGIA 4NXNH 1EUDB 4O4IF 3GIJA 2DZDA 2Q7DA 1GLVA 1ET0A 2IBKA 3GTJA 3T9AA 3HT5A 1KEEA 5KFSA 3DAAA 1HNWH 5FLMG 4XX0B 4DV5H 4XYMB 4CKEA 5JVDF 2UU9H 4FS2A 3JSNA 2RGVA 4ECTA 4O83A 1B6SA 3GTKA 4QJFA 1SCUB 4JUZA 1WRVA 2XGPA 5LP6F 5CAEB 4EEYA 4IWXA 3BABA 5KG2A 2ZDQA 2ZJTA 3N6XA 3BQ2A 2CKZB 4EYIB 5KG7A 4ECUA 5DQGA 3UZBA 2FMAA 3RAXA 1JDBB 4Q45A 2I80A 1V9PA 2RDJA 5FD5A 2AGOA 4YY3H 4YR0A 5C1PA 1CQJB 2CW8A 4TUYF 1T36A 2FKLA 4TM5A 1KC7A 3HKZE 5CB4F 2ZDHA 3KYHC 1RK5A 4O3PA 1I1KA 5IYBG 3ETHA 1MZBA 2R7NA 3OTOH 5KFTA 1GSHA 3I12A 2QF7A 4UCUA 2VOBA 2UVWA 2BQ3A 4R7RA 3MWDA 2R85A 3BA8A 3V6JA 5I5TA 4NLGA 3EPIA 1K83A 3TY9A 5FD6A 4FBTA 4JI5H 3W5OA 4Q8EA 4O3NA 2R93A 1N56A 3EPGA 5JQWA 4O7LA 1S68A 3H4DA 2UUBH 4B3MH 3MJFA 2R93G 4UCOA 4B3TH 5KKNB 5FPRA 2W9BB 3BAAA 3N8DA 4XYLB 1T94A 4YAJB 4TVIA 1CS0A 3HOUG 2B63G 3RF2A 5BYAA 1DGSA 3T7AA 2OLSA 1I94H 4NZNA 4LF8H 3JZFA 4DV0H 2YZNA 4J0MA 1E4EA 2KSWA 4QWAA 5IYCG 2R6FA 4YQWA 4JXUA 1Y1VA 3T5KA 2J6UA 4PBCA 5BMVF 2ABJA 2EJ2A 4B3SH 3KAJA 4BY1G 1A9XA 3T54A 2YZLA 1SYXB 3AYHB 4ED7A 4FFLA 2HVRA 3MR2A 2PVPA 3H0GA 2R7MA 4O7RA 4EFEA 5I5WA 2RF4A 4RUAA 1W93A 4FFPA 4FGRA 3VPCA 4C5AA 4JI3H 2C2RA 3AW8A 4MV9A 4JI7H 3WO0A 3GQCA 4BWSC 4DUZH 4B3RH 4A93G 1HNXH 2PBZA 3JZ6A 2IP4A 2EIYA 2VA2A 1S03G 4Q0YA 2E2IA 2YWVA 3GTOA 4ZHQF 4NYEA 4BY7G 5C8YF 1BGWA 5KFRA 4X64H 2ASJA 2R92A 1CQIB 4MV6A 4J9MA 1S0NA 2VPSA 4HQ6A 2FB9A 5BR8H 5LMUH 4AYBA 4IRCA 4F4ZA 1CKMA 3KAKA 3RJ0A 4ECSA 3ORQA 2C22A 2J6SA 2BQUA 4UCSA 4LF4H 3RB0A 1T3NA 1W96A 1RYSA 2JEJA 3QZ7A 2NVXA 4O4HF 4FFMA 4QW8A 2COIA 1I50A 4J9PA 1UC8A 2UXDH 4MA5A 3M9MB 5CA0F 1VBHA 3JRWA 3KHHA 5JUMA 2V5AA 4JV1A 4TV9F 4YAKB 3TY5A 3UYYA 2XCAA 2CNVA 1E4GT 3T1YH 4JI4H 3HOYG 1I6UA 2JEIA 1B6RA 1M7JA 1I7NA 3SI8A 1AN7A 4ECVA 4LF9H 4A3CG 4I55F 4YJ3F 4QW9A 4PWQA 3CVZA 3Q8QB 4ED6A 4DL4A 5HBRB 3LWBA 2C35B 4GKKH 2MCTA 2QK4A 1FKAH 3EYYA 4ECRA 1R9TA 1TWHA 5KFVA 5EWFA 1A0GA 2GPSA 5KG4A 3OHAA 3G6YA 3T1HH 2HVSA 4DL6A 2JA8G 3WO1A 4O7WA 4QWDA 3Q1KA 3KHRA 1OBDA 3RB3A 1CKOA 5BYBA 3U9SA 4OX9H 5EOYA 5KG1A 5KFJA 1TA8A 5L1LA 1G2WA 5KT7A 2R7ZG 2ZM6H 3JRXA 2UUAH 4GKJH 2AQ4A 2PN1A 3GIKA 1EUCB 1WH2A 3RUPA 1JIHA 4IRKA 2UUCH 3PW2A 3GTLA 3W1GA 1RYRA 2J9GA 3H40A 4DRFA 5KFIA 2V4RA 4BXXG 4AYBE 1GGOA 5JQGF 3RGZA 1ZHQA 5KFCA 1KJIA 3RGXA 3G8DA 4RZQA 1WSCA 5KFHA 4DLKA 3MFIA 2Z04A 4GC7A 5KG3A 1XDNA 5FLXW 2FJZA 2Y0SE 3RV4A 4CKCA 2YYAA 3G8CA 2YU9A 1JLLB 2W70A 5L1KA 3K5HA 3KALA 4J9QA 4A3KG 4O3RA 5I5UA 2XGQA 4DR1H 2VUMA 1GYFA 2XC9A 4MA0A 2YCHA 3TW7A 3RFCA 4I7HA 4QWBA 2VPQA 1RJRA 4DL7A 1N48A 5FJ8G 2M05A 2UXCH 2UXBH 2YS7A 4DV1H 5KFWA 4FU0A 3J80W 1XK5A 3MWEA 3K5IA 5BWRA 1WCMA 5L9XA 3Q8SB 3KHGA 4DV4H 4MV7A 3R9RA 4F4WA 5L1IA 2ZGIA 2AGQA 3TIIA 4ZQIA 2V59A 2W6MA 2R7KA 1VS0A 2ATLA 5IWAH 2JA5G 4I4TF 1C30A 3E5NA 1VKZA 5KFLA 5LL6b 4HR7A 1KJ9A 4O82A 3NBZB 5EZYF 1KBLA 1Y1VG 2W6NA 2YRWA 4HNTA 3KHLA 1S0MA 4IR9A 2CQYA 1XMQH 2VQEH 4EBCA 4EGQA 5KFFA 2OH2A 3TQ1A 4FE2A 4WD3A 2FPPB 4A2AA 2VA3A 2DIKA 3T9DA 2W6PA 2COJA 2GPWA 4FM9A 5KFBA 3N41B 3H4BA 4O2BF 1KT8A 3GV7B 4DR6H 3GTPA 5D8DA 2FPIB 3RR5A 2CFMA 1K1QA 4J9KA 3HOZG 2WB1E 3NBYB 4MV4A 4FFRA 5KS8A 3WWHA 4DV6H 5CE8A 2X5RA 1HNZH 2CNUA 4K6NA 5KFQA 4RB1A 2FLNA 5IYDG 2NU8B 1KUTA 2YZMA 4Y8VB 4JI8H 1EKVA 4YJ2F 3PO2G 3JSLA 3LMLA 5JH7F 2YL2A 5D1OB 5DG9A 4RZRA 3V4ZA 2R8KA 5DLFA 3HKZA 4A3JG 2HIVA 2ASLA 4O4JF 2R86A 3VA7A 2NVYA 3K3PA 4RAYA 4DV2H 5I5VA 4QIWE 3N43B 3QFFA 4Q4DA 3U54A 2EJ3A 5DISC 4DQNA 1UNNC 2FE3A 5KFNA 1B33N 4DL5A 2C2EA 2NU7B 4E4TA 5A2QW 3FMAA 1SFOA 2HHHH 3GV5B 1XMOH 3UFXB 2WYOA 3G6XA 5FNVF 2DLNA 3GIIA 5BWXA 5KT5A 2Z02A 3PO3G 4JI1H 2HIXA 3L2PA 5DGBA 3PVXA 3GILA 5KG5A 3R23A 5E25A 2ODTX 3J81W 3QZ8A 2PMZA 3WNZA 2WAQE 3G6VA 4XZ3B 5DG7A 5BWWA 3GTQA 4JV2A 2ASDA 3L4KA 3PW5A 4M0JA 4ECYA 3L4JA 3GLKA 4RU9A 2ALZA 5J2UF 4G3IA 5LA6F 1CE8A 4JV0A 3DTFA 4EBDA 3QQMA 4ECXA 2B63A 4RCNA 1S0OA 1AUVA 1VBGA 5IP7G 4A3MG 2GLTA 5LXTF 3N6RA 5LMNH 3NUAA 5CR5A 4UCRA 5EWEA 5C3EG 5KFKA 4A3FG 3FKIA 1S97A 1KTAA 5KT3A 4Q43A 4EG0A 5DG8A 4KHPH 4YP3A 1JDEA 1L2ZA 3KTMA 2YZGA 4IHJF 2E2HA 4LFAH 1JXLA 3UQ8A 5KFXA 5KFDA 2W8KA 5IT9W 1GSAA 1KJQA 3CEBA 4APMA 4O7VA 4DR2H 3J7AK 4MAMA 4A3BG 4O7ZA 4PZ6A 5KFPA 4RB3C 5JVLA 4CC6A 5EWGA 4LFCH 1TAEA 3LP8A 5KFYA 3RIZA 4X66H 4ED1A 3MR3A 5DGHA 4EBEA 2W9BA 4O3SA 3MWMA 4Q4CA 3GB8B 3RBDA 3V4SA 1GO3E 2W7PA 4O7SA 1WR2A 1X9NA 3HXLA 4F4YA 2BQRA 1KJJA 4MTDA 4A3DG 2XD4A 3H20A 1FJGH 4CE5A 3SE7A 5I47A 4FFOA 3KREA 1OWTA 2HHFB 4LF6H 2VUMG 3QWUA 1BXRA 3CSWA 3GIQA 3T9EA 3PR5B 4DR3H 2PMZE 4O4LF 4IIJF 4RUCA 4J9LA 2UVRA 3GTMA 4O84A 5LYJF 4R8UA 4L1KA 4TV8F 4UUGA 4DV3H 2C28A 2W57A 3IN5A 2R8IA 2FLPA 3KXYT 4DL3A 4YR3A 2JA7G 4ED0A 4NZMA 5CM0A 2I8CA 2W9CB 4YBZB 1A0IA 1DIKA 2JA5A 2QB5A 4UCTA 4AQYH 2A1HA 2V58A 1DAAA 4IWYA 2R84A 1OBGA 1EHIA 2C00A 5KFGA 5C4XG 4LSAA 1I2LA 4ECQA 4J9OA 4ECZA 2CZGA 4WBNF 4U6PA 1UC9A
chains in the Genus database with same CATH topology
3R5XA 1KJ8A 4O7TA 1AUXA 2X0SA 5GONF 3VPBA 4QSHA 4O81A 3U9TA 3ORRA 4ZOLF 3HBLA 3DF7A 2GQRA 3R5FA 5BPHA 4O7NA 1PX2A 3GIDA 4MV1A 2HGSA 2VQDA 2NU9B 1M6VA 4O2AF 3TINA 4HNUA 4ME6A 4FFNA 2FPGB 2P0AA 3R5HA 3VPDA 3TQTA 4C5BA 2I87A 2HJWA 1EYZA 4DIMA 3HB9A 4O86A 2R87A 4ZI7F 1DV1A 3Q2OA 4I50F 2CNQA 3OUZA 1A48A 2XCLA 1E4EB 4YB8B 1C3OA 2GQSA 1M0WA 3TW6A 3ETJA 5J2TF 1PK8A 4C5CA 1BNCA 1IOWA 2YRXA 5LOVF 1Z2PX 2R82A 2NU6B 5HV6A 5DMXA 5C1OA 2W71A 2VR1A 4HNVA 3BG5A 1ULZA 2NUAB 2YS6A 5IYZF 3AX6A 2ZDGA 2SCUB 3U55A 4EGJA 1EZ1A 3JZIA 1DV2A 3OUUA 3VOTA 5BPFA 1JKJB 4M9UA 4MV8A 1I7LA 5H80A 5K2MA 2W6OA 5KX5F 2W6QA 4IZOA 1GSOA 2FP4B 1IOVA 3HO8A 1Z2NX 4MV3A 3RV3A 2W6ZA 2DWCA 5CA1F 3VMMA 3TIGA 1M0TA 2R7LA 4O7YA 1Z2OX 2YW2A 1EUDB 4O4IF 2DZDA 1GLVA 1KEEA 4XX0B 4XYMB 5JVDF 4O83A 1B6SA 1SCUB 5LP6F 5CAEB 4IWXA 2ZDQA 1JDBB 2I80A 5C1PA 1CQJB 4TUYF 1T36A 1KC7A 5CB4F 2ZDHA 3ETHA 2R7NA 1GSHA 3I12A 2QF7A 3MWDA 2R85A 5JQWA 4O7LA 3MJFA 5KKNB 3N8DA 4XYLB 4YAJB 1CS0A 2OLSA 3JZFA 2YZNA 1E4EA 2R6FA 5BMVF 3KAJA 1A9XA 2YZLA 4FFLA 2PVPA 2R7MA 4O7RA 1W93A 4FFPA 4FGRA 3VPCA 4C5AA 3AW8A 4MV9A 3WO0A 2PBZA 2IP4A 2YWVA 4ZHQF 4NYEA 5C8YF 1CQIB 4MV6A 4HQ6A 2FB9A 3KAKA 3ORQA 1W96A 4O4HF 4FFMA 1UC8A 4MA5A 5CA0F 1VBHA 3JRWA 2V5AA 4TV9F 4YAKB 2CNVA 1B6RA 1I7NA 4I55F 4YJ3F 5HBRB 3LWBA 2QK4A 2GPSA 3WO1A 4O7WA 3Q1KA 1OBDA 3U9SA 3JRXA 2PN1A 1EUCB 3RUPA 2J9GA 1GGOA 5JQGF 1KJIA 3G8DA 4RZQA 4DLKA 2Z04A 3RV4A 2YYAA 3G8CA 1JLLB 2W70A 3K5HA 3KALA 4MA0A 3RFCA 2VPQA 2YS7A 4FU0A 3MWEA 3K5IA 4MV7A 3R9RA 3TIIA 4ZQIA 2V59A 2W6MA 2R7KA 4I4TF 1C30A 3E5NA 1VKZA 4HR7A 1KJ9A 1KBLA 4O82A 5EZYF 2W6NA 2YRWA 4HNTA 2CQYA 4EGQA 4FE2A 4WD3A 2FPPB 2DIKA 2W6PA 2GPWA 4O2BF 5D8DA 2FPIB 4MV4A 4FFRA 2CNUA 2NU8B 1KUTA 2YZMA 4Y8VB 4YJ2F 5JH7F 2YL2A 3V4ZA 4O4JF 2R86A 3VA7A 3K3PA 3QFFA 3U54A 2NU7B 4E4TA 3UFXB 2WYOA 5FNVF 2DLNA 2Z02A 3R23A 3WNZA 4XZ3B 3GLKA 5J2UF 5LA6F 1CE8A 1AUVA 1VBGA 2GLTA 5LXTF 3N6RA 3NUAA 4EG0A 1JDEA 2YZGA 4IHJF 1GSAA 1KJQA 4O7VA 4MAMA 4O7ZA 5JVLA 3LP8A 3V4SA 4O7SA 1WR2A 1KJJA 2XD4A 3SE7A 5I47A 4FFOA 3KREA 1BXRA 4O4LF 4IIJF 4O84A 5LYJF 4L1KA 4TV8F 2I8CA 4YBZB 1DIKA 2V58A 4IWYA 2R84A 1OBGA 1EHIA 2C00A 2CZGA 4WBNF 1UC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5X A;  1KJ8 A;  4O7T A;  1AUX A;  2X0S A;  5GON F;  3VPB A;  4QSH A;  4O81 A;  3U9T A;  3ORR A;  4ZOL F;  3HBL A;  3DF7 A;  2GQR A;  3R5F A;  5BPH A;  4O7N A;  1PX2 A;  3GID A;  4MV1 A;  2HGS A;  2VQD A;  2NU9 B;  1M6V A;  4O2A F;  3TIN A;  4HNU A;  4ME6 A;  4FFN A;  2FPG B;  2P0A A;  3R5H A;  3VPD A;  3TQT A;  4C5B A;  2I87 A;  2HJW A;  1EYZ A;  4DIM A;  3HB9 A;  4O86 A;  2R87 A;  4ZI7 F;  1DV1 A;  3Q2O A;  4I50 F;  2CNQ A;  3OUZ A;  1A48 A;  2XCL A;  1E4E B;  4YB8 B;  1C3O A;  2GQS A;  1M0W A;  3TW6 A;  3ETJ A;  5J2T F;  1PK8 A;  4C5C A;  1BNC A;  1IOW A;  2YRX A;  5LOV F;  1Z2P X;  2R82 A;  2NU6 B;  5HV6 A;  5DMX A;  5C1O A;  2W71 A;  2VR1 A;  4HNV A;  3BG5 A;  1ULZ A;  2NUA B;  2YS6 A;  5IYZ F;  3AX6 A;  2ZDG A;  2SCU B;  3U55 A;  4EGJ A;  1EZ1 A;  3JZI A;  1DV2 A;  3OUU A;  3VOT A;  5BPF A;  1JKJ B;  4M9U A;  4MV8 A;  1I7L A;  5H80 A;  5K2M A;  2W6O A;  5KX5 F;  2W6Q A;  4IZO A;  1GSO A;  2FP4 B;  1IOV A;  3HO8 A;  1Z2N X;  4MV3 A;  3RV3 A;  2W6Z A;  2DWC A;  5CA1 F;  3VMM A;  3TIG A;  1M0T A;  2R7L A;  4O7Y A;  1Z2O X;  2YW2 A;  1EUD B;  4O4I F;  2DZD A;  1GLV A;  1KEE A;  4XX0 B;  4XYM B;  5JVD F;  4O83 A;  1B6S A;  1SCU B;  5LP6 F;  5CAE B;  4IWX A;  2ZDQ A;  1JDB B;  2I80 A;  5C1P A;  1CQJ B;  4TUY F;  1T36 A;  1KC7 A;  5CB4 F;  2ZDH A;  3ETH A;  2R7N A;  1GSH A;  3I12 A;  2QF7 A;  3MWD A;  2R85 A;  5JQW A;  4O7L A;  3MJF A;  5KKN B;  3N8D A;  4XYL B;  4YAJ B;  1CS0 A;  2OLS A;  3JZF A;  2YZN A;  1E4E A;  2R6F A;  5BMV F;  3KAJ A;  1A9X A;  2YZL A;  4FFL A;  2PVP A;  2R7M A;  4O7R A;  1W93 A;  4FFP A;  4FGR A;  3VPC A;  4C5A A;  3AW8 A;  4MV9 A;  3WO0 A;  2PBZ A;  2IP4 A;  2YWV A;  4ZHQ F;  4NYE A;  5C8Y F;  1CQI B;  4MV6 A;  4HQ6 A;  2FB9 A;  3KAK A;  3ORQ A;  1W96 A;  4O4H F;  4FFM A;  1UC8 A;  4MA5 A;  5CA0 F;  1VBH A;  3JRW A;  2V5A A;  4TV9 F;  4YAK B;  2CNV A;  1B6R A;  1I7N A;  4I55 F;  4YJ3 F;  5HBR B;  3LWB A;  2QK4 A;  2GPS A;  3WO1 A;  4O7W A;  3Q1K A;  1OBD A;  3U9S A;  3JRX A;  2PN1 A;  1EUC B;  3RUP A;  2J9G A;  1GGO A;  5JQG F;  1KJI A;  3G8D A;  4RZQ A;  4DLK A;  2Z04 A;  3RV4 A;  2YYA A;  3G8C A;  1JLL B;  2W70 A;  3K5H A;  3KAL A;  4MA0 A;  3RFC A;  2VPQ A;  2YS7 A;  4FU0 A;  3MWE A;  3K5I A;  4MV7 A;  3R9R A;  3TII A;  4ZQI A;  2V59 A;  2W6M A;  2R7K A;  4I4T F;  1C30 A;  3E5N A;  1VKZ A;  4HR7 A;  1KJ9 A;  1KBL A;  4O82 A;  5EZY F;  2W6N A;  2YRW A;  4HNT A;  2CQY A;  4EGQ A;  4FE2 A;  4WD3 A;  2FPP B;  2DIK A;  2W6P A;  2GPW A;  4O2B F;  5D8D A;  2FPI B;  4MV4 A;  4FFR A;  2CNU A;  2NU8 B;  1KUT A;  2YZM A;  4Y8V B;  4YJ2 F;  5JH7 F;  2YL2 A;  3V4Z A;  4O4J F;  2R86 A;  3VA7 A;  3K3P A;  3QFF A;  3U54 A;  2NU7 B;  4E4T A;  3UFX B;  2WYO A;  5FNV F;  2DLN A;  2Z02 A;  3R23 A;  3WNZ A;  4XZ3 B;  3GLK A;  5J2U F;  5LA6 F;  1CE8 A;  1AUV A;  1VBG A;  2GLT A;  5LXT F;  3N6R A;  3NUA A;  4EG0 A;  1JDE A;  2YZG A;  4IHJ F;  1GSA A;  1KJQ A;  4O7V A;  4MAM A;  4O7Z A;  5JVL A;  3LP8 A;  3V4S A;  4O7S A;  1WR2 A;  1KJJ A;  2XD4 A;  3SE7 A;  5I47 A;  4FFO A;  3KRE A;  1BXR A;  4O4L F;  4IIJ F;  4O84 A;  5LYJ F;  4L1K A;  4TV8 F;  2I8C A;  4YBZ B;  1DIK A;  2V58 A;  4IWY A;  2R84 A;  1OBG A;  1EHI A;  2C00 A;  2CZG A;  4WBN F;  1UC9 A; 
#chains in the Genus database with same CATH topology
 2FLL A;  3R5X A;  1KJ8 A;  5FR9 A;  5BWT A;  4O7T A;  4A2B A;  1EKP A;  4RNO A;  4DUY H;  3OSP A;  4FS1 A;  1AUX A;  4LH7 A;  2X0S A;  2O03 A;  5GON F;  4M7E A;  4F50 A;  3T9C A;  4CC5 A;  2R8J A;  3LUL A;  3F8N A;  3VPB A;  5KFO A;  3RTX A;  1I3Q A;  2R7Z A;  4C2M A;  3T99 A;  2WB1 A;  4QSH A;  3Q8R B;  4O81 A;  2R8G A;  3U9T A;  5DAA A;  2F4V H;  3T9F A;  4CMF A;  5KT2 A;  3PW7 A;  3TY8 A;  2Q2U A;  3PR4 A;  3PN1 A;  3ORR A;  4ZOL F;  1P8L A;  3HBL A;  3DF7 A;  2GQR A;  3R5F A;  5FPO A;  3WWI A;  2XIG A;  5C5J A;  4RB2 C;  5BPH A;  1Y14 B;  4PZ7 A;  4TQR A;  3M9N B;  4JI2 H;  4O7N A;  1PX2 A;  3GID A;  2Q2T A;  1K1S A;  1TWA A;  4YHH H;  4MV1 A;  4U7C A;  2OWO A;  1XNR H;  2EJ0 A;  3N42 B;  3MFH A;  2V9W A;  2HGS A;  1RK6 A;  5KT6 A;  5I60 A;  1JX4 A;  2DAA A;  2VQD A;  2V4Q A;  4LF7 H;  2NU9 B;  1E4F T;  3SNO A;  3H3V H;  3GJX B;  5KFM A;  4J9S A;  1M6V A;  2QYZ A;  4O2A F;  5F9N A;  3TIN A;  2CW7 A;  3GIP A;  3MR6 A;  1B04 A;  1RJQ A;  2HGW A;  4JI6 H;  5DQH A;  2HDK A;  1WCM G;  4HNU A;  4ME6 A;  4DR4 H;  4ECW A;  1IYD A;  4FFN A;  5K3W A;  1TWC A;  3TEK A;  4NZO A;  4E6N A;  4ED3 A;  4EYH B;  2JA6 G;  3M4I A;  5IP9 G;  3RBE A;  2DPJ A;  2JA6 A;  5I5Y A;  1CKN B;  2FPG B;  2HHF A;  2P0A A;  3R5H A;  3VPD A;  3W1B A;  4A3E G;  3UZO A;  3TQT A;  4IRD A;  1I2K A;  4C5B A;  2WDT A;  2WTF A;  2I87 A;  1I1M A;  4LFB H;  3BQ1 A;  3FKI G;  2HJW A;  3HOW G;  2BR0 A;  1EYZ A;  3HOV G;  4O3O A;  4F4X A;  1N33 H;  4RAZ A;  2AGP A;  2JEF A;  4X62 H;  4PZ8 A;  4DIM A;  5C44 G;  3HB9 A;  4O86 A;  3U0G A;  2R87 A;  3H0G G;  2HGX A;  4ZI7 F;  1DV1 A;  4BBR G;  4EFB A;  3Q2O A;  3MR5 A;  4I50 F;  5DGA A;  3RB4 A;  4IR1 A;  2CNQ A;  3OUZ A;  1ZHS A;  4BBS G;  1A48 A;  2XCL A;  3PFF A;  1E4E B;  4EQ5 A;  4RNN A;  4J9N A;  3T5H A;  4YR2 A;  3T5J A;  4YB8 B;  2XCP A;  3V6K A;  1C3O A;  2GQS A;  4ED2 A;  3I4M G;  2UVU A;  4IAJ A;  1IYE A;  4EEQ A;  5EDW A;  3K3V A;  4PDB A;  1M0W A;  3TW6 A;  3ETJ A;  4A3G G;  2DAB A;  5J2T F;  3C0F B;  1PK8 A;  4RNM A;  3BA9 A;  1N32 H;  4C5C A;  1S9F A;  3T9B A;  1BNC A;  2HG8 A;  5KFZ A;  1FVI A;  2UVV A;  4MTE A;  1IOW A;  2YRX A;  4GLX A;  5BWV A;  5LOV F;  2W8L A;  1Z2P X;  1Y1W G;  2R82 A;  1J5E H;  1O75 A;  5I5S A;  3IG0 A;  2W7O A;  4GLW A;  1Y1W A;  4LMY A;  4FBU A;  2NU6 B;  5HV6 A;  5DMX A;  1SEI A;  4WHX A;  5C1O A;  2W9A A;  2Y4R A;  2IMW P;  2W71 A;  2VR1 A;  4CMD A;  4R8U B;  4QWC A;  2HVQ A;  4HYK A;  3M9O B;  4HNV A;  2AU0 A;  1A3G A;  4A3L G;  2FK1 A;  4Q44 A;  3GDE A;  3BG5 A;  2COG A;  1ULZ A;  5DLG A;  2NUA B;  2YS6 A;  2FK2 A;  5T14 A;  2C2D A;  2W9C A;  3T5L A;  1VAJ A;  3PW0 A;  5IYZ F;  3NGD A;  1V51 A;  4ED8 A;  4JI0 H;  3AX6 A;  2ZDG A;  1V4Y A;  4RB0 A;  3Q8P B;  5I5X A;  1CKN A;  2SCU B;  2JEG A;  3BAC A;  2WAQ A;  1TWF A;  4DL2 A;  5HNE A;  1EKF A;  1IBL H;  2WE6 A;  5KG0 A;  3BJY A;  3U55 A;  4EGJ A;  3OHB A;  5KT4 A;  1ZQ7 A;  1IBK H;  1EZ1 A;  4CKB A;  4GC6 A;  3JZI A;  1DV2 A;  3OUU A;  3VOT A;  1I1L A;  1JKJ B;  3NC0 B;  3S24 A;  3WWJ A;  4DAA A;  5BPF A;  5BWU A;  1BJT A;  4A3I G;  4K0K H;  4M9U A;  2RDI A;  3V6H A;  2IA6 A;  4DV7 H;  2E5L H;  3GIM A;  4MV8 A;  3GTG A;  4QIW A;  3DTG A;  3N44 B;  3I4N G;  4CHI A;  1I7L A;  5H80 A;  1ZAU A;  3BQ0 A;  4UFZ A;  5K2M A;  2W6O A;  3RAQ A;  4Q8F A;  5KX5 F;  2W6Q A;  2FK3 A;  3FDS A;  5F9L A;  4HN2 A;  3LQS A;  4IZO A;  3JAM W;  3PZP A;  1N34 H;  2R92 G;  4NXM H;  1TWG A;  1GSO A;  1ZET A;  4JYA H;  2FP4 B;  4O3Q A;  1IOV A;  3HO8 A;  1HR0 H;  5D1P A;  5KFU A;  3CQZ A;  1S10 A;  1IBM H;  1Z2N X;  4MV3 A;  3RV3 A;  3HOX G;  2W6Z A;  5KG6 A;  2VUG A;  1RJP A;  4LSX A;  1N36 H;  2DPI A;  3OSN A;  3RB6 A;  4DR7 H;  3PW4 A;  2R8H A;  2DWC A;  5CA1 F;  1XNQ H;  4X65 H;  4LF5 H;  4UCV A;  3VMM A;  3TIG A;  3VNN A;  5KFA A;  2RGR A;  4JV5 H;  2JA7 A;  5D1O A;  1M0T A;  5L1J A;  1P16 A;  2R7L A;  2VQF H;  3N40 P;  4QWE A;  2Y0S A;  3SGI A;  4LH6 A;  4O7Y A;  1Z2O X;  4TQS A;  2J6T A;  3GV8 B;  4J9R A;  5DQI A;  4ETS A;  5KFE A;  4DR5 H;  2YW2 A;  5DGI A;  4NXN H;  1EUD B;  4O4I F;  3GIJ A;  2DZD A;  2Q7D A;  1GLV A;  1ET0 A;  2IBK A;  3GTJ A;  3T9A A;  3HT5 A;  1KEE A;  5KFS A;  3DAA A;  1HNW H;  5FLM G;  4XX0 B;  4DV5 H;  4XYM B;  4CKE A;  5JVD F;  2UU9 H;  4FS2 A;  3JSN A;  2RGV A;  4ECT A;  4O83 A;  1B6S A;  3GTK A;  4QJF A;  1SCU B;  4JUZ A;  1WRV A;  2XGP A;  5LP6 F;  5CAE B;  4EEY A;  4IWX A;  3BAB A;  5KG2 A;  2ZDQ A;  2ZJT A;  3N6X A;  3BQ2 A;  2CKZ B;  4EYI B;  5KG7 A;  4ECU A;  5DQG A;  3UZB A;  2FMA A;  3RAX A;  1JDB B;  4Q45 A;  2I80 A;  1V9P A;  2RDJ A;  5FD5 A;  2AGO A;  4YY3 H;  4YR0 A;  5C1P A;  1CQJ B;  2CW8 A;  4TUY F;  1T36 A;  2FKL A;  4TM5 A;  1KC7 A;  3HKZ E;  5CB4 F;  2ZDH A;  3KYH C;  1RK5 A;  4O3P A;  1I1K A;  5IYB G;  3ETH A;  1MZB A;  2R7N A;  3OTO H;  5KFT A;  1GSH A;  3I12 A;  2QF7 A;  4UCU A;  2VOB A;  2UVW A;  2BQ3 A;  4R7R A;  3MWD A;  2R85 A;  3BA8 A;  3V6J A;  5I5T A;  4NLG A;  3EPI A;  1K83 A;  3TY9 A;  5FD6 A;  4FBT A;  4JI5 H;  3W5O A;  4Q8E A;  4O3N A;  2R93 A;  1N56 A;  3EPG A;  5JQW A;  4O7L A;  1S68 A;  3H4D A;  2UUB H;  4B3M H;  3MJF A;  2R93 G;  4UCO A;  4B3T H;  5KKN B;  5FPR A;  2W9B B;  3BAA A;  3N8D A;  4XYL B;  1T94 A;  4YAJ B;  4TVI A;  1CS0 A;  3HOU G;  2B63 G;  3RF2 A;  5BYA A;  1DGS A;  3T7A A;  2OLS A;  1I94 H;  4NZN A;  4LF8 H;  3JZF A;  4DV0 H;  2YZN A;  4J0M A;  1E4E A;  2KSW A;  4QWA A;  5IYC G;  2R6F A;  4YQW A;  4JXU A;  1Y1V A;  3T5K A;  2J6U A;  4PBC A;  5BMV F;  2ABJ A;  2EJ2 A;  4B3S H;  3KAJ A;  4BY1 G;  1A9X A;  3T54 A;  2YZL A;  1SYX B;  3AYH B;  4ED7 A;  4FFL A;  2HVR A;  3MR2 A;  2PVP A;  3H0G A;  2R7M A;  4O7R A;  4EFE A;  5I5W A;  2RF4 A;  4RUA A;  1W93 A;  4FFP A;  4FGR A;  3VPC A;  4C5A A;  4JI3 H;  2C2R A;  3AW8 A;  4MV9 A;  4JI7 H;  3WO0 A;  3GQC A;  4BWS C;  4DUZ H;  4B3R H;  4A93 G;  1HNX H;  2PBZ A;  3JZ6 A;  2IP4 A;  2EIY A;  2VA2 A;  1S03 G;  4Q0Y A;  2E2I A;  2YWV A;  3GTO A;  4ZHQ F;  4NYE A;  4BY7 G;  5C8Y F;  1BGW A;  5KFR A;  4X64 H;  2ASJ A;  2R92 A;  1CQI B;  4MV6 A;  4J9M A;  1S0N A;  2VPS A;  4HQ6 A;  2FB9 A;  5BR8 H;  5LMU H;  4AYB A;  4IRC A;  4F4Z A;  1CKM A;  3KAK A;  3RJ0 A;  4ECS A;  3ORQ A;  2C22 A;  2J6S A;  2BQU A;  4UCS A;  4LF4 H;  3RB0 A;  1T3N A;  1W96 A;  1RYS A;  2JEJ A;  3QZ7 A;  2NVX A;  4O4H F;  4FFM A;  4QW8 A;  2COI A;  1I50 A;  4J9P A;  1UC8 A;  2UXD H;  4MA5 A;  3M9M B;  5CA0 F;  1VBH A;  3JRW A;  3KHH A;  5JUM A;  2V5A A;  4JV1 A;  4TV9 F;  4YAK B;  3TY5 A;  3UYY A;  2XCA A;  2CNV A;  1E4G T;  3T1Y H;  4JI4 H;  3HOY G;  1I6U A;  2JEI A;  1B6R A;  1M7J A;  1I7N A;  3SI8 A;  1AN7 A;  4ECV A;  4LF9 H;  4A3C G;  4I55 F;  4YJ3 F;  4QW9 A;  4PWQ A;  3CVZ A;  3Q8Q B;  4ED6 A;  4DL4 A;  5HBR B;  3LWB A;  2C35 B;  4GKK H;  2MCT A;  2QK4 A;  1FKA H;  3EYY A;  4ECR A;  1R9T A;  1TWH A;  5KFV A;  5EWF A;  1A0G A;  2GPS A;  5KG4 A;  3OHA A;  3G6Y A;  3T1H H;  2HVS A;  4DL6 A;  2JA8 G;  3WO1 A;  4O7W A;  4QWD A;  3Q1K A;  3KHR A;  1OBD A;  3RB3 A;  1CKO A;  5BYB A;  3U9S A;  4OX9 H;  5EOY A;  5KG1 A;  5KFJ A;  1TA8 A;  5L1L A;  1G2W A;  5KT7 A;  2R7Z G;  2ZM6 H;  3JRX A;  2UUA H;  4GKJ H;  2AQ4 A;  2PN1 A;  3GIK A;  1EUC B;  1WH2 A;  3RUP A;  1JIH A;  4IRK A;  2UUC H;  3PW2 A;  3GTL A;  3W1G A;  1RYR A;  2J9G A;  3H40 A;  4DRF A;  5KFI A;  2V4R A;  4BXX G;  4AYB E;  1GGO A;  5JQG F;  3RGZ A;  1ZHQ A;  5KFC A;  1KJI A;  3RGX A;  3G8D A;  4RZQ A;  1WSC A;  5KFH A;  4DLK A;  3MFI A;  2Z04 A;  4GC7 A;  5KG3 A;  1XDN A;  5FLX W;  2FJZ A;  2Y0S E;  3RV4 A;  4CKC A;  2YYA A;  3G8C A;  2YU9 A;  1JLL B;  2W70 A;  5L1K A;  3K5H A;  3KAL A;  4J9Q A;  4A3K G;  4O3R A;  5I5U A;  2XGQ A;  4DR1 H;  2VUM A;  1GYF A;  2XC9 A;  4MA0 A;  2YCH A;  3TW7 A;  3RFC A;  4I7H A;  4QWB A;  2VPQ A;  1RJR A;  4DL7 A;  1N48 A;  5FJ8 G;  2M05 A;  2UXC H;  2UXB H;  2YS7 A;  4DV1 H;  5KFW A;  4FU0 A;  3J80 W;  1XK5 A;  3MWE A;  3K5I A;  5BWR A;  1WCM A;  5L9X A;  3Q8S B;  3KHG A;  4DV4 H;  4MV7 A;  3R9R A;  4F4W A;  5L1I A;  2ZGI A;  2AGQ A;  3TII A;  4ZQI A;  2V59 A;  2W6M A;  2R7K A;  1VS0 A;  2ATL A;  5IWA H;  2JA5 G;  4I4T F;  1C30 A;  3E5N A;  1VKZ A;  5KFL A;  5LL6 b;  4HR7 A;  1KJ9 A;  4O82 A;  3NBZ B;  5EZY F;  1KBL A;  1Y1V G;  2W6N A;  2YRW A;  4HNT A;  3KHL A;  1S0M A;  4IR9 A;  2CQY A;  1XMQ H;  2VQE H;  4EBC A;  4EGQ A;  5KFF A;  2OH2 A;  3TQ1 A;  4FE2 A;  4WD3 A;  2FPP B;  4A2A A;  2VA3 A;  2DIK A;  3T9D A;  2W6P A;  2COJ A;  2GPW A;  4FM9 A;  5KFB A;  3N41 B;  3H4B A;  4O2B F;  1KT8 A;  3GV7 B;  4DR6 H;  3GTP A;  5D8D A;  2FPI B;  3RR5 A;  2CFM A;  1K1Q A;  4J9K A;  3HOZ G;  2WB1 E;  3NBY B;  4MV4 A;  4FFR A;  5KS8 A;  3WWH A;  4DV6 H;  5CE8 A;  2X5R A;  1HNZ H;  2CNU A;  4K6N A;  5KFQ A;  4RB1 A;  2FLN A;  5IYD G;  2NU8 B;  1KUT A;  2YZM A;  4Y8V B;  4JI8 H;  1EKV A;  4YJ2 F;  3PO2 G;  3JSL A;  3LML A;  5JH7 F;  2YL2 A;  5D1O B;  5DG9 A;  4RZR A;  3V4Z A;  2R8K A;  5DLF A;  3HKZ A;  4A3J G;  2HIV A;  2ASL A;  4O4J F;  2R86 A;  3VA7 A;  2NVY A;  3K3P A;  4RAY A;  4DV2 H;  5I5V A;  4QIW E;  3N43 B;  3QFF A;  4Q4D A;  3U54 A;  2EJ3 A;  5DIS C;  4DQN A;  1UNN C;  2FE3 A;  5KFN A;  1B33 N;  4DL5 A;  2C2E A;  2NU7 B;  4E4T A;  5A2Q W;  3FMA A;  1SFO A;  2HHH H;  3GV5 B;  1XMO H;  3UFX B;  2WYO A;  3G6X A;  5FNV F;  2DLN A;  3GII A;  5BWX A;  5KT5 A;  2Z02 A;  3PO3 G;  4JI1 H;  2HIX A;  3L2P A;  5DGB A;  3PVX A;  3GIL A;  5KG5 A;  3R23 A;  5E25 A;  2ODT X;  3J81 W;  3QZ8 A;  2PMZ A;  3WNZ A;  2WAQ E;  3G6V A;  4XZ3 B;  5DG7 A;  5BWW A;  3GTQ A;  4JV2 A;  2ASD A;  3L4K A;  3PW5 A;  4M0J A;  4ECY A;  3L4J A;  3GLK A;  4RU9 A;  2ALZ A;  5J2U F;  4G3I A;  5LA6 F;  1CE8 A;  4JV0 A;  3DTF A;  4EBD A;  3QQM A;  4ECX A;  2B63 A;  4RCN A;  1S0O A;  1AUV A;  1VBG A;  5IP7 G;  4A3M G;  2GLT A;  5LXT F;  3N6R A;  5LMN H;  3NUA A;  5CR5 A;  4UCR A;  5EWE A;  5C3E G;  5KFK A;  4A3F G;  3FKI A;  1S97 A;  1KTA A;  5KT3 A;  4Q43 A;  4EG0 A;  5DG8 A;  4KHP H;  4YP3 A;  1JDE A;  1L2Z A;  3KTM A;  2YZG A;  4IHJ F;  2E2H A;  4LFA H;  1JXL A;  3UQ8 A;  5KFX A;  5KFD A;  2W8K A;  5IT9 W;  1GSA A;  1KJQ A;  3CEB A;  4APM A;  4O7V A;  4DR2 H;  3J7A K;  4MAM A;  4A3B G;  4O7Z A;  4PZ6 A;  5KFP A;  4RB3 C;  5JVL A;  4CC6 A;  5EWG A;  4LFC H;  1TAE A;  3LP8 A;  5KFY A;  3RIZ A;  4X66 H;  4ED1 A;  3MR3 A;  5DGH A;  4EBE A;  2W9B A;  4O3S A;  3MWM A;  4Q4C A;  3GB8 B;  3RBD A;  3V4S A;  1GO3 E;  2W7P A;  4O7S A;  1WR2 A;  1X9N A;  3HXL A;  4F4Y A;  2BQR A;  1KJJ A;  4MTD A;  4A3D G;  2XD4 A;  3H20 A;  1FJG H;  4CE5 A;  3SE7 A;  5I47 A;  4FFO A;  3KRE A;  1OWT A;  2HHF B;  4LF6 H;  2VUM G;  3QWU A;  1BXR A;  3CSW A;  3GIQ A;  3T9E A;  3PR5 B;  4DR3 H;  2PMZ E;  4O4L F;  4IIJ F;  4RUC A;  4J9L A;  2UVR A;  3GTM A;  4O84 A;  5LYJ F;  4R8U A;  4L1K A;  4TV8 F;  4UUG A;  4DV3 H;  2C28 A;  2W57 A;  3IN5 A;  2R8I A;  2FLP A;  3KXY T;  4DL3 A;  4YR3 A;  2JA7 G;  4ED0 A;  4NZM A;  5CM0 A;  2I8C A;  2W9C B;  4YBZ B;  1A0I A;  1DIK A;  2JA5 A;  2QB5 A;  4UCT A;  4AQY H;  2A1H A;  2V58 A;  1DAA A;  4IWY A;  2R84 A;  1OBG A;  1EHI A;  2C00 A;  5KFG A;  5C4X G;  4LSA A;  1I2L A;  4ECQ A;  4J9O A;  4ECZ A;  2CZG A;  4WBN F;  4U6P A;  1UC9 A; 
#chains in the Genus database with same CATH homology
 3R5X A;  1KJ8 A;  4O7T A;  1AUX A;  2X0S A;  5GON F;  3VPB A;  4QSH A;  4O81 A;  3U9T A;  3ORR A;  4ZOL F;  3HBL A;  3DF7 A;  2GQR A;  3R5F A;  5BPH A;  4O7N A;  1PX2 A;  3GID A;  4MV1 A;  2HGS A;  2VQD A;  2NU9 B;  1M6V A;  4O2A F;  3TIN A;  4HNU A;  4ME6 A;  4FFN A;  2FPG B;  2P0A A;  3R5H A;  3VPD A;  3TQT A;  4C5B A;  2I87 A;  2HJW A;  1EYZ A;  4DIM A;  3HB9 A;  4O86 A;  2R87 A;  4ZI7 F;  1DV1 A;  3Q2O A;  4I50 F;  2CNQ A;  3OUZ A;  1A48 A;  2XCL A;  1E4E B;  4YB8 B;  1C3O A;  2GQS A;  1M0W A;  3TW6 A;  3ETJ A;  5J2T F;  1PK8 A;  4C5C A;  1BNC A;  1IOW A;  2YRX A;  5LOV F;  1Z2P X;  2R82 A;  2NU6 B;  5HV6 A;  5DMX A;  5C1O A;  2W71 A;  2VR1 A;  4HNV A;  3BG5 A;  1ULZ A;  2NUA B;  2YS6 A;  5IYZ F;  3AX6 A;  2ZDG A;  2SCU B;  3U55 A;  4EGJ A;  1EZ1 A;  3JZI A;  1DV2 A;  3OUU A;  3VOT A;  5BPF A;  1JKJ B;  4M9U A;  4MV8 A;  1I7L A;  5H80 A;  5K2M A;  2W6O A;  5KX5 F;  2W6Q A;  4IZO A;  1GSO A;  2FP4 B;  1IOV A;  3HO8 A;  1Z2N X;  4MV3 A;  3RV3 A;  2W6Z A;  2DWC A;  5CA1 F;  3VMM A;  3TIG A;  1M0T A;  2R7L A;  4O7Y A;  1Z2O X;  2YW2 A;  1EUD B;  4O4I F;  2DZD A;  1GLV A;  1KEE A;  4XX0 B;  4XYM B;  5JVD F;  4O83 A;  1B6S A;  1SCU B;  5LP6 F;  5CAE B;  4IWX A;  2ZDQ A;  1JDB B;  2I80 A;  5C1P A;  1CQJ B;  4TUY F;  1T36 A;  1KC7 A;  5CB4 F;  2ZDH A;  3ETH A;  2R7N A;  1GSH A;  3I12 A;  2QF7 A;  3MWD A;  2R85 A;  5JQW A;  4O7L A;  3MJF A;  5KKN B;  3N8D A;  4XYL B;  4YAJ B;  1CS0 A;  2OLS A;  3JZF A;  2YZN A;  1E4E A;  2R6F A;  5BMV F;  3KAJ A;  1A9X A;  2YZL A;  4FFL A;  2PVP A;  2R7M A;  4O7R A;  1W93 A;  4FFP A;  4FGR A;  3VPC A;  4C5A A;  3AW8 A;  4MV9 A;  3WO0 A;  2PBZ A;  2IP4 A;  2YWV A;  4ZHQ F;  4NYE A;  5C8Y F;  1CQI B;  4MV6 A;  4HQ6 A;  2FB9 A;  3KAK A;  3ORQ A;  1W96 A;  4O4H F;  4FFM A;  1UC8 A;  4MA5 A;  5CA0 F;  1VBH A;  3JRW A;  2V5A A;  4TV9 F;  4YAK B;  2CNV A;  1B6R A;  1I7N A;  4I55 F;  4YJ3 F;  5HBR B;  3LWB A;  2QK4 A;  2GPS A;  3WO1 A;  4O7W A;  3Q1K A;  1OBD A;  3U9S A;  3JRX A;  2PN1 A;  1EUC B;  3RUP A;  2J9G A;  1GGO A;  5JQG F;  1KJI A;  3G8D A;  4RZQ A;  4DLK A;  2Z04 A;  3RV4 A;  2YYA A;  3G8C A;  1JLL B;  2W70 A;  3K5H A;  3KAL A;  4MA0 A;  3RFC A;  2VPQ A;  2YS7 A;  4FU0 A;  3MWE A;  3K5I A;  4MV7 A;  3R9R A;  3TII A;  4ZQI A;  2V59 A;  2W6M A;  2R7K A;  4I4T F;  1C30 A;  3E5N A;  1VKZ A;  4HR7 A;  1KJ9 A;  1KBL A;  4O82 A;  5EZY F;  2W6N A;  2YRW A;  4HNT A;  2CQY A;  4EGQ A;  4FE2 A;  4WD3 A;  2FPP B;  2DIK A;  2W6P A;  2GPW A;  4O2B F;  5D8D A;  2FPI B;  4MV4 A;  4FFR A;  2CNU A;  2NU8 B;  1KUT A;  2YZM A;  4Y8V B;  4YJ2 F;  5JH7 F;  2YL2 A;  3V4Z A;  4O4J F;  2R86 A;  3VA7 A;  3K3P A;  3QFF A;  3U54 A;  2NU7 B;  4E4T A;  3UFX B;  2WYO A;  5FNV F;  2DLN A;  2Z02 A;  3R23 A;  3WNZ A;  4XZ3 B;  3GLK A;  5J2U F;  5LA6 F;  1CE8 A;  1AUV A;  1VBG A;  2GLT A;  5LXT F;  3N6R A;  3NUA A;  4EG0 A;  1JDE A;  2YZG A;  4IHJ F;  1GSA A;  1KJQ A;  4O7V A;  4MAM A;  4O7Z A;  5JVL A;  3LP8 A;  3V4S A;  4O7S A;  1WR2 A;  1KJJ A;  2XD4 A;  3SE7 A;  5I47 A;  4FFO A;  3KRE A;  1BXR A;  4O4L F;  4IIJ F;  4O84 A;  5LYJ F;  4L1K A;  4TV8 F;  2I8C A;  4YBZ B;  1DIK A;  2V58 A;  4IWY A;  2R84 A;  1OBG A;  1EHI A;  2C00 A;  2CZG A;  4WBN F;  1UC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...