3BA8A

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba8A02
1FJGB 3VNNA 3PN1A 1HNWB 3NC0B 4B3MB 2HVQA 5BR8B 4DUYB 5D1OA 1N32B 4GKKB 5DISC 2UUAB 4LH7A 5LMUB 3BABA 3GB8B 2OWOA 1IBKB 2HIXA 4JI8B 4LF6B 3KYHC 4DRFA 1N33B 1S68A 1TA8A 5D1OB 2VUGA 1HNXB 5FPOA 4NXMB 2UU9B 1P16A 3OTOB 4YY3B 4DV2B 4DUZB 3TY8A 1TAEA 3TY9A 4E6NA 4DV3B 2Q2TA 2Q2UA 2UXBB 4JI6B 4DV1B 5LMNB 4JI0B 4JI4B 4DV7B 1N36B 4EEQA 4DR4B 3RR5A 3TY5A 1CKOA 4DR2B 3BA8A 4JV5B 2VQEB 1J5EB 4X66B 1XK5A 4YHHB 1IBMB 2E5LB 4LF7B 1P8LA 1N34B 1B04A 2ZM6B 4TOIA 1XMOB 3T1YB 4DV0B 1XMQB 5IWAB 4KHPB 4B3TB 3S24A 4JI3B 4K0KB 4LFAB 3NBYB 3W1BA 1CKMA 5FPRA 3SGIA 1HR0B 3T1HB 1I94B 4DR1B 1DGSA 4UCOA 1CKNB 4EFBA 4LFCB 4CC6A 2UXDB 3BA9A 2UUCB 4DR3B 1XDNA 2HVRA 4NXNB 3GJXB 4EFEA 3BAAA 1V9PA 1X9NA 4DV4B 4LH6A 1A0IA 4X65B 2HVSA 4UCRA 4JI7B 1HNZB 4OX9B 4JI2B 2CFMA 4GLXA 4UCSA 3GDEA 4X62B 4DR6B 2HIVA 4PZ6A 4DV6B 1CKNA 4JI5B 2HHHB 4UCVA 4JYAB 3JSNA 4CC5A 1IBLB 3W5OA 4JI1B 4LF9B 4DR5B 4LF8B 4UFZA 4DV5B 2VQFB 5D1PA 1FVIA 4LF5B 3L2PA 2UXCB 2F4VB 4LF4B 1XNQB 4PZ7A 4LFBB 2UUBB 4EQ5A 3W1GA 4X64B 3RTXA 4UCUA 1ZAUA 3UQ8A 4DR7B 3NBZB 4UCTA 3QWUA 4B3RB 3JSLA 4AQYB 4GKJB 4PZ8A 1XNRB 4B3SB 1VS0A
chains in the Genus database with same CATH superfamily
2BTOA 1FXHA 3N6RA 3QF7A 1ZETA 4KL1A 3L73H 2FPGB 1FXKC 2CW8A 5D1OA 4E2LA 4WF9V 3L4JA 2Y69C 4DV0H 3T1YH 3PW4A 5KFQA 2Q67A 5IT9N 2CTRA 5HNEA 2C2AA 2R8GA 3KYHC 2CZGA 3N44B 2QWRB 3ORQA 2UXBO 4IGGA 3CCSV 4YBZB 2CH7B 2WLKA 4PD4F 3PW0A 5H80A 3GV5B 1P16A 4RNNA 3PJSK 2EINB 5D8DA 1HNXO 1ULZA 5FR9A 3PO2G 2Q7HA 2YRXA 3H0GG 3ZHRA 2FMAA 1W0JG 4E6NA 3F7VC 3HPLC 1VQ6V 4IYHA 3K5NA 2Q2TA 5DGAA 2BQ3A 2ZDIC 1KC7A 1Z2GA 2YICA 4DUZO 2WTFA 1SKVA 4DV1B 2KKWA 2CUGA 3IJ4A 3L70H 4YY3H 2R7KA 1S0OA 4DR2H 2UXNA 4CKEA 1VQPV 1V55C 5IJ9A 4A3KG 4JI6O 3T9BA 1FKAH 4O3NA 4A2BA 3T5JA 1AUVA 1VQ4V 3FKIG 1D5AA 1JR9A 4TV8A 2RNBA 5D5QA 5L3FA 4JGSA 2ILMA 3CRAA 4H13B 5CBGA 4IHJA 3G8CA 2DOSA 5KAIZ 3MJFA 1CXZB 4OX9O 1RYSA 4A3BG 3JARA 4ED6A 3VQYA 1JQ0A 1N33H 2QF7A 2IBZH 2HHFB 4RQEA 4J9MA 2UUCB 4O3QA 1M9NA 5LOVB 3K0DA 4X89A 3F5TA 3RB3A 1DF4A 1IZ3A 3BVOA 3B4SA 4YJ3A 5KG6A 2P6JA 2DE0X 4UCRA 3AYHB 4OX9B 5I47A 2VOBA 3RGXA 2RDCA 2GUZA 1ZSPA 4GYCB 2OCCB 3SR2C 2WA3A 4FPPA 2IJKA 2QA4V 5H2FZ 5LOVF 3VBBA 2Y69B 1EZ1A 3V4ZA 5KFCA 4ECVA 3U11A 5IYBG 1OBGA 1IVSA 5FD5A 1K1SA 2NVYA 1O9GA 3MR3A 5C3EG 2V9WA 1ZAUA 3DTGA 1SQFA 1RYRA 3CCJV 1KUTA 2Y0IA 3L75H 4YAKB 1GRJA 4TSFG 3QZ7A 4L8JA 2QSAA 3VNNA 1HNWB 2XHBA 4K0KH 2Z3YA 1ENVA 3AG2B 1N32B 1KJ9A 1I7LA 5A9GA 1AN7A 4DUYO 5L1JA 2ZE5A 5JWPA 2Q7DA 5I5TA 5KFVA 1M0TA 2VWKA 2Q73A 1YZBA 3BY6A 4YJ2A 2ITDC 2RMKB 4A5UB 2J9GA 1AR5A 3Q4HA 1N36H 1SRYA 3E22B 1UJWB 1WSCA 4U3FH 4ECXA 2OLSA 5KX5B 3CCVV 1M90W 4MV1A 4MVMA 2AHZA 1K5QA 2QWNB 3EPGA 2HGWA 2WB1A 2HG8A 4A3FG 5LL6Y 4YHHO 3GTQA 2YI8A 3QO8A 1FKAO 3N6XA 1N0NA 3T54A 2X0SA 1PNKA 5FLMG 5L1KA 3I12A 2E3CA 1SEIA 3WFVA 4MAMA 4O2AA 4DV7B 1KJIA 1XILA 3OTOO 1M1KW 4MVSA 2XC9A 2BTQB 3T1YO 3CX5F 2ASDA 3TW6A 4I7ZB 3P30A 4U7NA 4IWYA 3WWIA 4FM0A 2QE7G 2Y4TA 3ZMSA 2JA8G 1B04A 5BPHA 1AJNA 2YS8A 4OXSA 1ZHQA 1AJPA 1DIKA 4O7RA 3HKBA 4DV4O 1S77D 4RNMA 5DGIA 2FPPB 4XYLB 3FB6C 1ZUQA 3MFHA 3CHXA 2MW2B 2P4KA 3KAKA 1I94B 4DV6O 2IU3A 1Z2PX 4ABMA 1XUQA 2JS3A 2R7MA 2UXDB 4JF3A 1GSOA 1XDNA 3VOUA 4JYCA 5IJ0A 2QM4A 2QM8A 1VP7A 1V9PA 3J80N 5IYDG 4X64H 4RUCA 4ED0A 4LFBH 4DV4B 5IYCG 2YS7A 2UUCO 4J7ZA 5DECA 1OCZB 1RK5A 3E8GA 4O4LA 1M7JA 4JI1H 5LP6F 5JVDB 1CKNA 1FFXA 4BR6A 5C4XG 1W93A 4X62H 1SQBH 3VPBA 4WBNA 4CKBA 4DK1A 2V58A 3L2PA 1QBZA 2UXCB 1EUDB 3K08A 2JGUA 4JI7O 5KT5A 4O3OA 3C3SA 5L3CA 3MFIA 1N8RW 3ZHUA 4ZHQF 2OTJV 3FAVA 4O4JA 3G4SV 1N56A 4PA4A 5AG2A 4RAZA 1KP2A 3AG1B 3CMEV 3DAAA 2ZT9B 5JJJB 1HR0H 1V51A 5FLXW 4DR6H 2HFEC 4JAUA 3ASOB 1NVPD 2UUAO 3OAAG 2UVWA 4O7WA 1WA8B 5DAAA 2V59A 5DISC 3GIIA 3G80A 2EIMC 2R9IA 3DGEA 2OTLV 3ZX6A 3RJ0A 1SQQH 2W6OA 1K3EA 1TUBA 4TWKA 4MVZA 1K92A 2WAMA 1J5EH 4ECUA 2EIYA 4J9ZB 5BR8O 4TQRA 5KHJA 1OZ0A 2UVVA 4DQNA 1JFFB 5GONB 2D2CB 4FK5C 3S3WA 1MSWD 1JX9A 2YIBA 2PMZA 1TAEA 1K34A 4PA9A 5LOVA 3N2KA 4JI0O 2PTMA 4YJ3B 1VQ8V 1Z5VA 4FLXA 2JS5A 1N34O 4O2BF 2CNQA 2XT9A 2YYAA 4DV3O 3LQSA 2LW7A 2CTQA 2W70A 4NXMH 2GHYA 3HKBB 5KX5A 4QJFA 5IYCO 5B1OA 3R5HA 1AUXA 2CGOA 4FLZA 2ZDGA 2VQEB 1H2SB 4DL5A 3X2QC 4X66B 1IBKH 1Y66A 3GV8B 3CRMA 2HGXA 5KS8A 3RAXA 3BRCA 2EIJB 4TUYA 1ZL8A 4LFAO 4I55A 1GN4A 1VMGA 3STZC 3UM7A 3CCUV 4HR7A 3ZRVA 2ALZA 2Y0SE 1QLEB 3ZIAG 2HJFC 4X65O 4CH4A 3Q1KA 2I87A 4O4HB 2FMLA 4X62O 4HYKA 4KFMA 3K06A 4M7EA 1E1QG 3E5NA 1YITV 3N8DA 3H9VA 2IW5A 4JI1O 3MWMA 4DR1O 3ABKB 2FPIB 5KG1A 2E76B 1NH2B 3JATA 3T4ZA 3DTUB 2UUBO 3JARB 2BOBC 1AI6A 3T9AA 5I5VA 2ATKC 4JYAH 3I4NG 4QWEA 2KQXA 3FYIB 3OUFA 4N21A 1FFTB 1CE8A 3CB2A 2BCCH 2G38A 4PDRA 1QVGU 3BFRA 4MS2A 3W5OA 4LF9B 3B77A 3ABUA 4KXRA 4J7JA 5JCOA 4DV5B 3ETJA 3P3NA 2QDOA 1U97A 1B6RA 4HNVA 4WBNF 3SJQC 1ORQC 3C90A 1CQIB 1TGOA 3N2KB 3L4KA 3EXAA 4AILC 5C44G 4LFCH 1JX4A 3ETGA 1BL8A 3GIPA 5IP7G 2R82A 3J7AU 3G67A 1HP8A 4NR1A 3VMMA 2QYZA 1T36A 1NKDA 3HKCA 4B3RO 4MW3A 5KKNB 3LUTB 3ABKC 2HVQA 4JI3H 2ZINA 4LFBO 3T5KA 3PR5B 5B66Z 2NU8B 4RNOA 3T5LA 3Q8PB 1VQNV 1R6KA 4DR3H 3RIZA 4DL3A 4LF7H 2WLNA 2PYJA 3H01A 4WFFA 4XDKA 2IP4A 3ASNC 4O7VA 3E8BA 1RJPA 3J81N 3FYEB 3CXCU 1HNXB 3ABMC 1KMIZ 3ZRSA 5FNVA 1RM1B 3WG7C 4HBNA 4E4EA 1N33O 2AHYA 4J41A 2VUMA 5EBLC 1TWGA 2XAFA 3W7UA 3NR7A 1AROP 2ZDIA 4LSXA 1SQGA 5BZBA 1XMOH 2VA2A 4DV2O 4ECWA 5C8YA 2V5AA 2WB1E 2E2HA 3GTGA 4JI0B 2OT5A 3JATB 1TVKA 4H37A 4JV5H 2W0XA 3K59A 2QWOB 3K5IA 4JI3O 2M7WA 4NTWA 2FJZA 3QQMA 4IHJB 3CJHA 5JH7F 3H0GA 4JI0H 2ADQB 3HR0A 1CQJB 1IBMB 1PNLA 4LF7B 1P8LA 1BE3H 4MV7A 4W4LA 5LP6C 4C5CA 3LNMB 4CH6A 3UO2A 4B08A 4QPKA 3GWKC 4OPHA 5L1LA 1MZEA 1MNGA 2K1EA 4JI3B 1W59A 2P5OA 5KHGA 5L3BA 2QTOA 4MW8A 1Y74A 4NXNO 2QJ1A 2WSSG 2PI5A 2R7LA 5DLFA 1R1BA 4IRKA 1KD1W 4O2BB 4ME6A 4Y8VB 1BT8A 4RAYA 4LF5O 3C0FB 1MA1A 1XNQH 3EFFK 5EYPB 4FE2A 5JUMA 2V1DA 4YJ2F 1K7DA 1GK9A 4UCSA 3HOXG 1GLVA 1S10A 2OCHA 3N2GA 3GIKA 4NKGB 2R86A 3R9RA 4JYAB 4CC5A 4LF4O 2H3OA 5CBFA 2EZPA 5GONA 5IJ0B 1SF9A 4LF8B 1EHIA 4GX5A 4DR7H 1NT2B 2R92A 5KFHA 5C8YF 3UCSC 5F9NA 3BEHA 1R9TA 4HN2A 1JA8A 1H2MA 1FXKB 4PI0A 4UCUA 3STLC 5E79Z 5EC2C 5BMVA 2EIJC 4DRXB 2P22C 5KFAA 1QLNA 1IBKO 1QU7A 4GUNA 1BNCA 3H1LH 4AQYO 3FB5C 2CH7A 1YCIA 4IT5A 4P9OA 1VQOV 2FB9A 5CA0B 3FB7C 3I4MG 4ECTA 1VQ7V 1JPXA 1Q6UA 4F4ZA 2N05A 3K79A 3QO5A 3SJAC 4LH7A 3MR5A 2NNUA 2DAAA 2Q9LA 4RUAA 1EFRG 1IBKB 4FFOA 4HQ6A 4X66H 4LF6B 4AYBE 5FNVF 5B5EZ 1P4RA 3TEKA 5LP6B 4ED1A 5LXTB 4IZOA 2B63A 1H8EG 5KFFA 3OR6C 2IH1C 2P06A 5K1XA 3TY9A 1I5YA 3ZEDA 4EEYA 4D7SA 2WLLB 1QR8A 1KTAA 1GH6A 4TV8B 3HKZA 5LP6A 4MTOA 4MV9A 2UXBB 1I1LA 2X6AA 1H38A 1VBGA 2DWDC 3PW5A 3N41B 3JCZA 5B1NA 1CKOA 4Q6GA 4HNAB 2HEPA 2AGQA 5IE9A 3JZ6A 2E5LB 3BJYA 1N48A 2OIEA 1YI2V 3RW0A 3CC4V 4EKWA 1TUEB 5KFTA 5KFUA 2LFSA 4J9NA 4H44B 2FK1A 2WAQA 4LNUB 5LGNA 2HJWA 4QJFB 2CGNA 4UXNA 1B6SA 1QHTA 1KJQA 3SGIA 5BY1A 2IH3C 2YXHA 3T1HB 1OCOB 4FLTA 2ZGIA 2YXLA 3MWEA 2E5LO 1IDSA 3EVKA 1S3JA 3DF7A 3HKDA 3UYYA 1AI7A 5EZYF 1I7NA 1R73A 5C5JA 4Q45A 4EB6B 2R70A 4O7LA 1KP3A 3V6KA 2PVPA 4ECRA 2KSWA 1UPGA 1KT8A 5IP9G 2VQFH 1FD9A 4GLXA 1JIHA 1EZVH 3APQA 5HFLA 2W6QA 4JI2O 1BMFG 3JSNA 2W6PA 3BQ2A 1ZX3A 2FB5A 4EYHB 2WDTA 2ODMA 3E22A 3K3VA 1JXLA 2DJVA 4ZQIA 1FYJA 1HNWO 1GM8A 2HKOA 1I6UA 4NZNA 4MSWC 1XNQB 3NUAA 1E4FT 1OCRC 2Q68A 4LBEC 1N32O 4FGRA 2YCHA 2P7TC 2GQSA 3CXHF 2F4VO 3K9SA 4MV3A 2UXDH 2HJDA 1R3LC 1K9MW 1GO3E 1SESA 4DR5O 3EPIA 5EDWA 2YDEA 5BXZA 2DZDA 5KHHA 3P32A 4KHPH 4U7OA 1A48A 1CP9A 4I5SA 4TUYB 5KFZA 2DYRC 5FL7G 2V4RA 5GONF 1WH2A 3OD4A 3ETQA 5LA6F 2VUGA 1FFXB 1Q3EA 4EGJA 4BWSC 4B3MO 3HKZE 4MTXA 1N36O 3A0BZ 3OTFA 2UVUA 2Q4PA 4LFAH 3OTOB 4KUMA 2JJ1G 4K6NA 4WFBV 5IWAH 1Q7YW 4RQFA 2Q69A 3SPCA 2ZXWB 3L74H 3G6BA 3MD0A 1TWAA 1WP8A 3LDEA 1JFFA 3SYOA 1KJJA 1SA0A 4AYBA 1N36B 1CEZA 2YXYA 4BIZA 4U3JA 2FLLA 3GTKA 2YUAA 3JYCA 3OSNA 3GV7B 2Z5UA 2ZE8A 2W6NA 3H4BA 3AK3A 3WWJA 1I94O 2JDIG 5CA1A 1Y1WG 1U96A 1WPBA 4X1YB 3JRWA 2QEXV 4J7KA 4TOIA 2RDJA 1AI4A 4W4KA 1N32H 2B9ZA 3RV4A 1Z2OX 3S24A 2KG7A 1Q90D 3OGCC 5KFOA 4Q43A 4DRXA 4B3MH 1T94A 4NZMA 5FPRA 5IDJA 1A9XA 2F66C 4A3DG 3RWRD 4F6RA 2J6UA 4O7ZA 3JAMW 4MTDA 3CC7V 3BA9A 5CR5A 1Y1VA 3T1HO 2HVRA 3ASOC 2ZR3A 1YEWA 4BY1G 2UUAH 5BWUA 3GILA 2VA3A 4BIUA 3HOWG 2GTAA 4X20B 2AZ2A 4JI7B 1GSHA 4FVMA 2YEVA 5EWFA 1ET0A 2RN9A 4DV6B 3TCUA 4R6ZA 5IYDO 4LFCO 5GTHZ 1JVMA 2E75B 4IR9A 1XNRO 2OYQA 4R8CA 4ECQA 2R7ZG 4X88A 2ASLA 1I3QA 4O7NA 5J2TA 2YIDA 4PZ7A 1SQPH 2QGNA 4GKJO 2R9RB 4FLUA 1VF6C 2N74A 4O4IA 2A9HA 1IBLH 5IYZA 2JEUA 4DLKA 4NVPA 1W2BU 1IYEA 1GN6A 2FP4B 2BQUA 4UUGA 1V55B 2BOCC 3K9AA 2XGPA 1QQCA 3GVMA 3TETA 2GDSA 4P9PA 2DYRB 4YY3O 1ZQ7A 3MAQA 1MABG 4IR1A 3CQZA 1JOYA 3B8NA 5CB4B 3HOVG 2OWOA 1T5EA 1H8HG 4O4IF 2HIXA 5DQIA 1H2NA 3C3TA 5B1AC 4IL6Z 2A3QA 3UT5A 4UV8A 4DK0A 1SA0B 1CPYA 4ZKIA 2AZ0A 4NXMB 2R87A 2JEIA 4JI4H 4DV2B 4GC7A 2CKZB 4R50A 2A0LA 4ZBMA 3KALA 1O9HA 3G71V 3M7MX 3CEBA 1NR1A 3RYCA 3RF2A 3RYIA 3GIDA 2W9CA 4TT3G 5KFIA 1LUWA 4JYYA 1JDBB 1XQ8A 5K2MA 2R93A 4J9SA 1PL4A 1VEWA 4FS1A 4MVRA 4MV8A 3ZHQA 5KT7A 1O75A 2X7RB 3E35A 4DV1H 2JEFA 5EWGA 1J5EB 4FBUA 1XK5A 4FZ1A 2V4DA 1WA8A 1F23A 3D36C 2PGGA 3JD3A 4CS3A 2R72A 3JAKA 2LW1A 1Y1VG 3ZRWB 3T1YB 2XIGA 2NU6B 3CCEV 1EKPA 3JZIA 2YS6A 4DV2H 5KFSA 4DXWA 2EJ0A 5DG7A 4EB6A 3PW7A 1FJGH 4M9UA 5FNVB 1B33N 3TXSA 3JALA 2BSKA 1XBLA 2R6FA 1PKXA 1NJIW 1VQKV 1YHQV 2RGVA 3JD4A 1K83A 5CA3A 5EC1C 1MSDA 4IYIA 4DV5O 2VS0A 4J80A 4X65B 3HXLA 4F4LA 4LF5H 2EULA 3FD9A 1H2KA 1KKDA 3F8NA 1URFA 1TVKB 2PBZA 4XBFA 4X62B 3IC7A 1PK8A 1F7YA 1BJTA 2HHHH 4P30A 1PNMA 1XL4A 4MTGA 2ZE7A 2ABJA 1TWFA 2ZR2A 4GX1A 5HBRB 3WNZA 2XAJA 2AGOA 2XTAA 2JA7A 2ZDQA 5KG4A 2UUBB 4F4XA 4ECYA 3RB6A 4O4HF 3UQ8A 2QWPB 4DW0A 3WO1A 2R9AA 3OMNB 4WHXA 3WO0A 1WN7A 2AU0A 2ZJTA 4B3SB 1S9FA 2EIKB 4DO2A 2IJJA 3SPGA 5K1PA 4R8UB 4HAMA 4YJ2B 1I08A 5EOYA 3W7WA 4X1YA 4NYEA 4LF6O 4Q4DA 2WYOA 4DR7O 3LNNA 3RGBA 4D7TA 3GB8B 4HNTA 2L35A 2IJIA 1P84F 3O65A 2COGA 4RO2A 1UFIA 3ZS8C 1SYXB 2HG5C 4IHJF 5KUMA 3V6JA 1C30A 2LO1A 1JDEA 1A3GA 1OCCB 2MCTA 4HZ3A 2CTPA 1Y14B 3VPDA 4MV4A 1M4UA 1NI8A 2F95B 3Q4HB 4TV9A 3BCCH 5KFKA 5EZYA 2DQ3A 1A0GA 5IWAO 5CM0A 1TWHA 4DL6A 3OM3B 3H3VH 4JASA 1US6A 1BZKA 2B5UA 4BAYA 4A2AA 2NUAB 3D3QA 4TUYF 4IIJF 3QZ8A 1NH2D 2EILB 5C93A 3RYIB 2W9CB 2OIGA 4DV3H 3FB8C 1L8DA 3ZCCA 5KHKA 3GIJA 1AP5A 5IJ9B 5J2UF 3GIQA 3A0RA 4LFAB 4JV5O 4WFHA 3RYHA 3RT3C 4FLYA 3HOZG 4CE5A 1VQ9V 5DGHA 3RVZA 3U10A 1PX2A 4YAJB 5JQGF 1EN5A 2F43G 4LH6A 3RYHB 3RAQA 3N42B 4U3JB 3WB2A 3E89A 3CP1A 4OGQB 4PZ6A 4Q44A 4B7KA 2IA6A 3JALB 2VRZA 2DYSB 4TV8F 5T14A 4B3SH 4MV6A 1VKZA 5I5WA 2ZIOA 1VQ5V 4D6TH 3FDSA 3T7AA 1GO3F 1MMMA 2W6JG 4B7EA 1Q86W 4LF5B 3HKEB 3CCMV 2F4VB 5JQGA 2WLLA 2UUBH 2EJ3A 4PA7A 4QWBA 1L0LH 3K5MA 1SQVH 5DM6V 5DLGA 3K0GA 3LMLA 2NU9B 2EIKC 2VQDA 3TGUH 2CAZC 2Q8VA 2W6MA 4LMYA 1K5SA 1K1QA 1JJOA 4LF8O 3Q2OA 2PZSA 1HDJA 3KTMA 5H6RA 1FJGB 3T9EA 3PN1A 2PI4A 4GLWA 4P2ZA 1D5NA 4O2AF 1NTMH 4QSHA 3KXYT 1DTOA 4RZRA 4B3SO 4DUYB 1WJZA 3DC6A 4X65H 3E8HA 1JMKC 1KU9A 3H1JH 2W6ZA 1NBMG 2YEVB 2XAGA 2ZDHA 2FLNA 3SNOA 2CE4A 3BABA 1M93A 5F2VO 1IOWA 3T9CA 3CRRA 2YL2A 5D1OB 4GZRB 4GCZA 3AW8A 5CA0A 2NN4A 3KCYA 2B1IA 1WCMG 5E25A 1G8MA 3BACA 5J2TB 4A3EG 3Q8QB 2DMXA 2FL4A 3UO3A 2HGSA 3BHPA 1XL6A 4JV1A 4BBSG 2PYLA 2R8IA 4BW5A 2EJRA 2PUSA 4IAJA 1WRVA 5BMVB 2VR1A 3CS5A 1OWTA 3RFCA 3M4IA 1S5HC 1OHHG 4JI4B 3IG0A 2QB5A 4PDLA 2C2EA 4G28B 1AILA 4FIPC 4DR4H 4YB8B 3QNEA 1XMOO 2F23A 1SS3A 2JK5C 3HKDB 4DV0B 3K03A 4ICGA 4JI4O 1WB7A 1RJQA 4DUYH 3T9FA 5J2TF 4JZGA 2ZM6O 1CKMA 3TINA 4U7CA 1WPXA 4AI8A 1QR9A 2W71A 3VQXA 1CKNB 1V54B 1Q81W 4ED3A 4NXNB 1MZBA 5LMUH 3PZPA 3G8DA 4X1IA 4ZHQB 3B09A 4O83A 2M05A 1K97A 2AGAA 4JUZA 2HVSA 2F4VH 1PP9H 3J81W 2EZOA 3R23A 1Q6IA 4MVQA 1GAXA 2O57A 1G6UA 2ZD9A 2P0AA 2C35B 5H6QA 3UT5B 2YZLA 1NS1A 2QKAA 4GT1A 5BWWA 4YR0A 4WCEV 4JI7H 1BXRA 4LF4B 3RV3A 1BGWA 4IIJA 1COWG 2GV9A 4RZQA 4JXUA 1I0HA 1M56C 1KQSU 1Y74B 1X4TA 4JI5O 1K8AW 2OH2A 4K3AA 4UUJC 2N04A 1K4DC 2IM9A 1XI1A 1VS0A 1S0NA 5B3SC 2GPSA 1M5IA 1XOUA 2EJ7A 4CS4A 1MG1A 5LMUO 4B3MB 4CMFA 5DGBA 3RBZA 5EWEA 4O4IB 4TQFA 4XYMB 3UFXB 1J95A 3A0HZ 3CCRV 1DAAA 3DC5A 1PD3A 3HB3B 3UZBA 5KFMA 1NVPB 1R3KC 2EX3A 2WLMA 2VPQA 5LL6b 4C5BA 4X8AA 3SE7A 4DL7A 2QKCA 5H9CA 1Y76A 5FPOA 5KFLA 3FMAA 3JAWB 4I4TF 1AJQA 4RB3C 1BGYH 5CB4A 1S72V 3CPWU 4FFMA 2DPJA 3ZRXA 1OCRB 1S0MA 4J9PA 2W9AA 4QWCA 2Z0AA 4DR4O 2GQRA 2Y0SA 3MR6A 4O3PA 2Q0OC 1N0JA 3VQVA 4YHHH 3G6XA 5KX5F 3OTOH 2P4VA 2W9BB 1J5EO 4I4TA 3FKSG 3JAKB 2JGDA 1RK6A 1GSAA 3PVXA 5LGUA 3DXRB 2C2DA 5B3SB 4B3TO 5DMXA 2R8JA 4DR2O 1OJHA 1Z5WA 4CS2A 1XMOB 1EBOA 5L3GA 2BSKB 2BTQA 4JTAB 2Q7EA 3I55V 2XOKG 3ORRA 1E4EA 2I8CA 2UU9H 2AW9A 5GTIZ 1FXVA 3ZN0A 1LNQA 1HNXH 2PMZE 4O86A 1YTFB 4DR1B 5ITZB 2JRIA 2HHHO 1WAZA 4A3LG 4C2MA 3KG2A 1YJ9V 5LYJF 3GJXB 4Q8FA 1OCCC 1X9NA 3PFFA 2W57A 4RUEA 5FD6A 5ITZA 3OE7G 3LDDA 2DIKA 4A3CG 4IIJB 1YJNV 4DR5H 3APOA 3FX7A 3MDSA 1YXBA 2XAHA 4YIOA 3OUSA 2HHHB 3F7YC 5KAFZ 3CCLV 5KUKA 3CCQV 3GLKA 4NLGA 1Y67A 3SYCA 4CKCA 5J9PC 3D8CA 2VUMG 5BYBA 1Q8IA 3SPIA 5CA1B 2VQFB 4RB1A 3GTMA 3VOTA 2XUMA 4MA0A 5CB4F 3QFFA 3IFXA 2ZQMA 3DSQA 4DV5H 2EILC 1YDXA 5JH7B 2K9PA 4PZ8A 1XNRB 2ZCEA 4PDVA 4LSAA 1M56B 2UVRA 2VQFO 1PV0A 1I1MA 3F5WC 1TWCA 2YIBD 4QIWE 2JA7G 5KLVH 1SZTA 4GKKB 1P7GA 4JYBA 1XHXA 4F4WA 3KKYA 1JJ2U 3K5HA 3TK1A 4ZOLF 3H20A 2E5LH 4ZIBA 2Y0PA 1S68A 4FJCC 2Z02A 4R7RA 2WLJA 3T1HH 5B1BC 5KFDA 2JGDB 5LMNH 3G6EV 2GLTA 4N23A 1V54C 2VQEO 3TQTA 2LJ2A 4YR3A 2A06H 3KHGA 1N34H 1FS0G 1SETA 4OPAA 2ODTX 5EYPA 3KAJA 4A3MG 5HV6A 5IY5B 3RN4A 3LDCA 3OGIB 4O84A 4O4LB 2Q0AA 2B1GA 3OHBA 3JASB 3OEEG 2V7QG 1QVFU 4A3IG 3ABTA 1EYZA 2NVXA 4LF6H 2UXBH 4QNHB 4ZOLB 2ASJA 2ZE6A 5CAEB 5KMGB 3CRQA 2X5RA 1N34B 1NU1H 5J2UA 2EBOA 4LP8A 5KFGA 3G6YA 3AK1A 1FXKA 1HW7A 5LMNO 1VQLV 5BWVA 4B3TB 4MVOA 2XGQA 5DG8A 4QIWA 3VPCA 5KFNA 3U9TA 4J9LA 3Q8RB 5EIBD 2JA6G 4UVCA 4J9RA 5L1IA 2KB1A 4DR6O 4X66O 3BG5A 1DGSA 1I2KA 1FPOA 4J9QA 4B3RH 1GGOA 1YF2A 4CH3A 1B3QA 3OFNG 1KC8W 1AVMA 5LYJA 5EZYB 4QPJA 2XCPA 4ETSA 4NTYA 1Y6XA 2DN9A 3GDEA 3ETEA 4DR6B 3T2MA 1I1KA 3H4DA 1BHAA 1FAFA 3OR7C 3V6HA 2H94A 1E4GT 1N4CA 2QM7A 1S76D 3GTOA 3LULA 3AEIA 3GWOA 4ZI7B 3ML0A 5D1PA 1DF5A 4QGPA 4AHCA 1HNZO 1BSMA 2Y4RA 1EN4A 3L72H 2UXCH 4EBCA 5KG3A 3B2EE 4MVUA 4DR7B 3ZJZA 4X9QA 4GKJB 1AI5A 2GSMB 2HVKC 4FM2A 2EINC 1IX9A 1TUBB 3OEHG 4WBNB 5KFWA 4JV2A 4ED8A 1X59A 2JEGA 1W96A 4I50F 3QO7A 5CN0A 3NC0B 4JI2H 3BQ1A 3SJCC 4Q0YA 1THZA 4X20A 1I7FA 5L3DA 3K5LA 4DV4H 2EJ2A 2GBOA 3KHRA 3RYFA 3K3WA 1L0NH 3IN5A 1M6VA 4J10A 2LFRA 2CNUA 4PBCA 5CA0F 1SC5B 4JI8B 4PA6A 4GKKO 5LXTF 4QW9A 4EYIB 3ZMZA 1GM9A 4DYLA 5JVLA 4FFRA 1E79G 1WCMA 4NYKA 2W8LA 4I0XB 1DLBA 2UU9B 1W0KG 4C5AA 4NB5A 4QWDA 3ZHSA 4HYOA 3ABLB 1Q6HA 5E1AC 3U54A 3J80W 4NXMO 2ZM6H 4UVBA 1IBMO 1UC9A 4IRCA 1SCUB 3CJHB 4TQSA 2YI9A 1XDCA 4ZI7F 1IBMH 4PA3A 3DXRA 2YSUB 5IY5C 2HP8A 4IWXA 1IOVA 4UB8Z 3HOYG 3W7SA 3RVYA 4YJ3F 5CBHA 5L3EA 4GX0A 4KP4A 3RYCB 4JV5B 1BHBA 4Z2WA 2JA6A 1M0WA 1KJ8A 3CEIA 1S5JA 3ETDA 1Y1WA 4WD3A 2ZM6B 4ZI7A 5GW7A 4KHPB 4O4JB 2KSDA 2YIAA 1DV2A 5KG7A 5CMUA 2JEJA 5LA6B 3AG3B 3U0ZA 4GKJH 4JI8H 4G3IA 3JCUZ 2DPIA 2SCUB 1LUVA 1VF6A 4DR3B 1GTOA 1H2GA 5JVDA 1G2WA 4L87A 4FFBB 2WLIA 1A0IA 3OSPA 5JCOC 5LA6A 3MR2A 1GMGA 3WU2Z 4WFEA 3JZFA 4JI2B 4Z1VA 4O4JF 2R8KA 1HNWH 4LCUC 3SI8A 3T99A 2WLHA 1VBHA 2ETNA 4JI5H 3WB0A 3FAVB 2JJ2G 1H2LA 5D5PA 2ARHA 1C3OA 4NZOA 2J6SA 4LC1A 3ZMTA 1OCOC 3PW2A 2NR5A 3A8TA 5KMGA 4YQWA 1AR4A 2CDYA 2WPDG 3OW2U 4J0MA 2XAQA 2AXTZ 3IC9A 2W7PA 4C7UA 4LF9H 3JSLA 1P49A 1K4CC 2ITCC 2FK2A 1CS0A 2YWVA 2A1HA 3RB4A 4ASUG 3KZIZ 2ZKOA 1UNNC 4OX9H 5EBWC 4CH5A 1XREA 5IYZB 3M99B 3U55A 4B3TH 4X1IB 4ZHQA 2CQYA 1GN2A 1YTFD 2CW7A 2BR0A 1KB9F 4FMTA 1B6QA 1IXMA 2YZMA 4PI2A 4ECZA 3ZRWA 1GM7A 3AX6A 4BW9A 2VQEH 1ZHSA 3R5XA 4PWQA 4RWUA 4JTCB 4UVAA 2LQTA 3H40A 1PPJH 1A32A 1MOFA 1NZ6A 5BWRA 3RYFB 3TY8A 2WAQE 3TQ1A 5BPFA 1SERA 2QKSA 4XDJA 2UU9O 4O3SA 4A93G 2NLJC 1QCEA 1Y4MA 1IXBA 5A2QN 4PDMA 1KECA 4E4TA 4DW1A 3JAMN 3OMIB 4EGQA 3M9NB 4QIWF 1EZJA 3BPZA 3TY5A 1EN6A 3KHLA 4BY7G 4DR2B 3OUZA 1K73W 5KFBA 2DWCA 3CC2V 1RPOA 3GIMA 2MK3A 3E86A 3SPHA 3M9MB 1BQZA 1T3NA 3MWDA 4O2BA 4K8XA 3ZMUA 4O7YA 2XASA 1KYOF 2DQ0A 2QR4A 2YC0A 5I5UA 3W1BA 1WP7A 2YU9A 1HR0B 1KEEA 2D3OW 3IGAC 3K04A 3AG4C 3ZMVA 1VIBA 4LNUA 4UCOA 4K0KO 4PHZA 4RB0A 3R65A 4EFEA 5KT6A 1KBHA 1KBLA 4FZ0A 4J9YB 3VA7A 1F4MA 1XNQO 4O4HA 3UZOA 4DIMA 4Z1MG 4LF8H 4A3JG 2P67A 5LGTA 2HIVA 3GTLA 4MT8A 4JZ2A 4QWAA 4JI5B 2UXCO 4ZOLA 4TM5A 2Y4UA 1RFYA 2QWQB 4DR5B 5EIBC 3K5OA 2OCCC 4JYAO 1EM1A 4G2KA 2KG7B 3NXSA 4X64B 3W7TA 2RF4A 1MZFA 1VAJA 5I5XA 3K3PA 3SYPA 4FFNA 4I4TB 1HWYA 2C22A 2RCVA 3QTCA 2NU7B 2W7OA 3SJBC 1SFOA 3RGZA 2WA4A 5DQGA 4GC6A 4LR3A 5EBMC 3AG7A 1R6TA 1P7BA 5L9XA 4CZZA 5K3WA 3H1KH 4NTXA 4ECSA 2R85A 4XDLA 2Q5ZA 3ZN1A 3E8FA 4O4LF 3PO3G 3D36A 1E1RG 2COIA 4FLWA 5KG0A 2FTKA 4PELA 4F6EA 4DAAA 1Q5OA 4DRFA 1WLEA 2C00A 2DLNA 4XZ3B 4DR1H 5TISZ 4RCNA 2R93G 1ZLZA 4H33A 4DV7O 2COJA 4DL2A 1XEQA 4M0JA 2HDKA 4DV7H 2ZIMA 4K35A 2IJHA 1IURA 4QW8A 4DV3B 2WWWA 3QG5A 3RFRA 3B40A 4CHIA 3CD6V 3R66A 3P3PA 3B8MA 5KHIA 3J7AK 2RQ6A 4Q4CA 4J11A 4U6PA 3RB0A 1WB8A 2Q7GA 4CBCA 3RR5A 2J6TA 3THOA 1LR1A 1L2ZA 5JJNB 3FKIA 4DV1O 1G1XB 5H5NA 2A7WA 3W7XA 4YHHB 4LWSB 2XCLA 2W8KA 5I5YA 1YSCA 1WNSA 1AP6A 1GN3A 3AG4B 1NQTA 5LBQA 3EHBB 4DV0O 1DK1A 1PM9A 4TQDA 1JCHA 5EK0A 5BYAA 3CWBH 2DYSC 4Q20A 3N27A 2FKXA 4CMDA 4EFBA 5CA1F 4LFCB 4CC6A 3H1HH 2ZXWC 3GB7C 1S97A 4WFAV 3K58A 2DABA 3D3IA 1E4EB 4F6RB 4LF4H 3FFQA 1BQ0A 2QK4A 3ABMB 3OUUA 4QE9A 2IU0A 2JA5G 1OBDA 2V4QA 4R7CA 2PF4E 2JA5A 3JD2A 1AR1B 1GKFA 4BWAA 5LHIA 3JASA 2H8PC 1VARA 5LXTA 3LSSA 4UFZA 2ZNJA 3Q8SB 2YW2A 2R92G 5KFPA 3CYOA 2RGRA 2W0FC 2E2IA 4F50A 3T1CA 3RTXA 1S03G 1AB3A 1DV1A 2C2RA 2YZNA 4UCTA 3UKMA 2CK3G 3QWUA 4O2AB 4B3RB 1RSOB 4I55F 3N40P 4ED7A 1F4NA 3KREA 1EKVA 2FKLA 5IT9W 5KFXA 1BCCH 5BR8B 2P90A 1OV9A 3I5DA 4FFPA 4I50A 4O82A 3A2FA 3WWHA 1ZL8B 5LMUB 2R84A 4NXNH 3TW7A 4PDBA 2UUCH 3PR4A 5I5SA 3OT7A 4BXXG 5BWXA 4FU0A 4J42A 5FJ8G 1N33B 4O81A 4A3GG 4I50B 4RUFA 4TV9B 4R8UA 1RM1C 3LP8A 3LWBA 5DEDA 1EUCB 2B63G 3S3XA 4YY3B 2HVJC 3DTFA 2XCAA 1RJRA 2GPWA 3AK2A 4RAIA 2W9BA 2AQ4A 3V4SA 4FM9A 3QVNA 1NR7A 1R6NA 2LGQA 1QNMA 2LP7A 3IAYA 3E2EA 5LMNB 2EIMB 3KCXA 2R8HA 4EEQA 4DR4B 1QLEC 4LF7O 4F4YA 2FLPA 2A79B 5JJEB 1EKFA 4EBEA 5C8YB 3HKCB 5F9LA 3L71H 3JD1A 5DG9A 1BS3A 3ZBHA 3X2QB 2CTWA 2JIZG 2X6CA 5JQGB 3RBDA 3T9DA 3CE2A 1V4YA 3ZHTA 2PN1A 4FBTA 4MTFA 2LGWA 4GKKH 1XHZA 5IYZF 1GYFA 1KKCA 4K8ZA 3RBEA 4PJ0Z 4FFKA 2YZGA 4RB2C 3EYYA 1Z2NX 3TIIA 4ED2A 3T4DA 4APMA 4DR3O 4XX0B 4FFLA 4WFGA 1XNRH 4I0XA 2HLDG 3JD0A 4X1KB 3GTJA 5J2UB 4UV9A 3M9OB 4I55B 1JKJB 2Z04A 2WE6A 2FE3A 4LF9O 2C28A 2UXDO 2W6IG 1R3IC 3CRCA 4YIPA 3U0GA 1HNZB 5BR8H 5DQHA 2HR3A 3HB9A 4YP3A 2F1MA 3CSXA 4RU9A 2ATLA 5KA6A 1YIJV 2BQRA 1IBLB 2JVDA 2RJZA 4JI1B 1S0VA 1NTZH 1VF5B 5JQWA 1D2DA 4JPRA 2ZNIA 4O7SA 4MA5A 2IMWP 2BE3A 5JH7A 4H0LB 5BMVF 4HNUA 1RPRA 2X6BA 4J9OA 2IBKA 4LFBB 3ABLC 4Q8EA 3AG2C 3OHAA 3LSQA 1ROPA 1I2LA 3JRXA 3E83A 4PV1B 1FJGO 1VQMV 3NBZB 2RDIA 4AQYB 1S5LZ 4JTDB 1IBLO 3CMAV 1I94H 3SYQA 4JI8O 3VQWA 3W1GA 5JVDF 2ADPA 3L9DA 3LSUA 5IYBO 4BIOA 4DV6H 2VPSA 3ETHA 1PL0A 5KT4A 3H1IH 1Y76B 1WR2A 3JAWA 4O3RA 1ZWIC 4YXWG 4EG0A 4LWSA 1XMQH 2UUAB 5A2QW 3I56V 5LHHA 5LYJB 1IYDA 3ICXA 4UB6Z 3NGDA 1M57B 2DW4A 1TA8A 3N2GB 3T5HA 3M8AA 1OCZC 3OMAB 1SQXH 4TVIA 2Q6AA 3WG7B 2FK3A 1B06A 4J9KA 2VWJA 1UC8A 2R7ZA 2HHFA 3SDLA 4GX2A 4DUZB 1K33A 4QE7A 3HOUG 4JAVA 4JI6H 4FLVA 5HFMA 3TXQA 4I9WA 2JEXA 2UXXA 3CSWA 4L1KA 4BBRG 5KA5A 2Q2UA 3ASNB 1I5XA 2E74B 4JI6B 5KG2A 3O9OA 5KFEA 3MHHC 2GUZB 2L6LA 1Q43A 3HO8A 3HBLA 3BA8A 4DL4A 3AG1C 5C1PA 2YRWA 2XNDG 2CNVA 5CE8A 1Q82W 3ZHVA 2AGPA 3U9SA 1KUQA 1G4YB 1R3JC 4TV9F 5KFYA 1XMQB 5IWAB 1HR0O 2I80A 2GTSA 3G6VA 4DUZH 1I50A 5B1AB 5BWTA 5KG5A 5KFRA 2WLIB 4K0KB 3NBYB 3AG3C 1RP3B 4JAAA 3HT5A 1YVWA 2DWEC 4AQYH 4YR2A 2F93B 3N43B 2M6YA 1XMQO 2O03A 4KHPO 3BAAA 2PY5A 3CVZA 3GQCA 3R5FA 5DN6G 3WB1A 1VF7A 4I9QA 4MTEA 4G27B 1L1FA 2FYUH 4FS2A 2CFMA 5LHGA 2QTSA 3HKEA 4X1KA 2XD4A 5KT3A 4JV0A 1M57C 2R7NA 4UCVA 4HNAA 1JLLB 4X64O 3SYAA 1F51A 3K57A 4FFBA 5I60A 1RSOA 1FVIA 5KFJA 3BQ0A 1HNZH 2X0LA 4FM1A 3TJTA 1NTKH 1ZTEA 5FLXN 4EQ5A 3KHHA 4EBDA 4I7HA 1YJWV 5B1BB 5KT2A 3RUPA 1SZXA 3GTPA 4O7TA 2Y48A 3SPJA 3TIGA 3MHSC 5C1OA 4IRDA
chains in the Genus database with same CATH topology
1FJGB 2BTOA 3PN1A 3KXYT 3QF7A 4KL1A 4OX9H 5CA0B 4CH5A 4DUYB 5IYZB 2CW8A 4X65H 5D1OA 4B3TH 1JMKC 1KU9A 4X1IB 4ZHQA 3L4JA 3SJAC 4DV0H 3T1YH 4LH7A 2CW7A 3BABA 1M93A 4PI2A 1IBKB 4X66H 4LF6B 3KYHC 3N44B 4BW9A 2VQEH 1ZHSA 5D1OB 5CA0A 5LP6B 1P16A 5LXTB 5J2TB 3RYFB 3TY8A 2HGSA 2Q7HA 5K1XA 3BHPA 3TY9A 3ZEDA 4D7SA 2PYLA 4E6NA 2PUSA 3K5NA 2Q2TA 4IAJA 4TV8B 5LP6A 5BMVB 4MV9A 2UXBB 1SKVA 3M4IA 4DV1B 2KKWA 4JI4B 3IG0A 4YY3H 4DR2H 3BPZA 5IJ9A 3TY5A 3N41B 1CKOA 1FKAH 4Q6GA 4DR4H 4HNAB 4DR2B 4A2BA 2HEPA 1D5AA 2E5LB 4TV8A 5D5QA 3HKDB 4DV0B 4O2BA 4K8XA 4IHJA 4LNUB 4DUYH 1QHTA 3W1BA 1CKMA 3SGIA 1HR0B 3T1HB 4FLTA 3JARA 2YXLA 3VQXA 3VQYA 1N33H 4LNUA 4UCOA 1CKNB 4PHZA 3DF7A 3HKDA 4RB0A 2UUCB 4NXNB 4EFEA 5LOVB 1MZBA 5LMUH 4EB6B 2R70A 4X1IA 4ZHQB 4YJ3A 2HVSA 4UCRA 2KSWA 2F4VH 4O4HA 3J81W 4OX9B 2VQFH 4GLXA 2VOBA 3RGXA 4LF8H 2HIVA 4JI5B 4GYCB 1G6UA 4ZOLA 3SR2C 3JSNA 2WDTA 3K3VA 3E22A 4DR5B 3UT5B 5EIBC 3K5OA 4JI7H 1I6UA 3U11A 4LF4B 1XNQB 1E4FT 1BGWA 5FD5A 1O9GA 4IIJA 4X64B 1ZAUA 2GV9A 4RZQA 1SQFA 2YCHA 2UXDH 1X4TA 4I4TB 2IM9A 3QTCA 1XI1A 1VS0A 3SJBC 3RGZA 4L8JA 4LR3A 3VNNA 1M5IA 1HNWB 4CS4A 2XHBA 4K0KH 4B3MB 5KHHA 4O4IB 4TQFA 4KHPH 1N32B 1AN7A 4FLWA 4TUYB 2EX3A 1Q5OA 4DRFA 5LL6b 1WH2A 4DR1H 3ETQA 1M0TA 2VWKA 2VUGA 1FFXB 1Q3EA 4YJ2A 5FPOA 3FMAA 4BWSC 3JAWB 4RB3C 5CB4A 3OTFA 4LFAH 1N36H 3E22B 3OTOB 4DV7H 2ZIMA 5KX5B 5IWAH 4DV3B 3QG5A 3RFRA 2YI8A 3N6XA 5KHIA 4YHHH 1JFFA 3J7AK 2RQ6A 3VQVA 2E3CA 1SEIA 1SA0A 4O2AA 4DV7B 3OTOH 1N36B 2Q7GA 4I4TA 3RR5A 3JAKB 4U3JA 3THOA 1L2ZA 5JJNB 2BTQB 4YHHB 5CA1A 1WPBA 4X1YB 4FM0A 1B04A 1Z5WA 4CS2A 4TOIA 1XMOB 1WNSA 1N32H 1ZHQA 2BTQA 2Q7EA 3HKBA 3S24A 1Z2OX 4DRXA 4B3MH 2UU9H 5FPRA 3CHXA 2F66C 3KAKA 4TQDA 1HNXH 3RWRD 4F6RA 1I94B 4DR1B 3JAMW 5ITZB 4MTDA 1Z2PX 4EFBA 4LFCB 4CC6A 2UXDB 3BA9A 1XDNA 2HVRA 3GJXB 1YEWA 5IJ0A 2UUAH 2QM4A 3K58A 1V9PA 4X64H 1X9NA 2W57A 4LFBH 4DV4B 4F6RB 4LF4H 4X20B 3FFQA 5FD6A 5ITZA 4JI7B 4FVMA 4IIJB 4O4LA 4DR5H 4JI1H 5JVDB 4DV6B 1CKNA 1FFXA 2HHHB 4BWAA 3JASA 4X62H 2OYQA 5LXTA 4UFZA 4WBNA 2ZNJA 4DK1A 1Q8IA 5CA1B 2VQFB 3L2PA 4RB1A 2UXCB 2RGRA 2JGUA 5J2TA 4PZ7A 3RTXA 4FLUA 3DSQA 1S03G 4O4JA 4DV5H 4UCTA 3N40P 3QWUA 4O2AB 4O4IA 4B3RB 4RAZA 5IYZA 5JH7B 1IBLH 4NVPA 4PZ8A 1XNRB 2ZCEA 5JJJB 4LSAA 1HR0H 5FLXW 4DR6H 5IT9W 5BR8B 2YIBD 1QQCA 4I50A 3A2FA 4GKKB 3MAQA 5DISC 1XHXA 5LMUB 5CB4B 4NXNH 3RJ0A 2OWOA 4PDBA 1T5EA 2UUCH 3H20A 2E5LH 1TUBA 2HIXA 4ZIBA 1J5EH 1N33B 1S68A 4I50B 4TV9B 3UT5A 4R7RA 3T1HH 4DK0A 1SA0B 5KHJA 4NXMB 1JFFB 5GONB 4YY3B 4JI4H 4DV2B 5LMNH 2YIBA 1TAEA 5LOVA 3N2KA 3KALA 1O9HA 1N34H 3M7MX 4FM9A 2PTMA 4YJ3B 5EYPA 1Z5VA 3RYCA 2JS5A 4FLXA 3RF2A 3KAJA 3RYIA 3IAYA 5LMNB 4EEQA 4DR4B 4NXMH 1XQ8A 3HKBB 5KX5A 4O4LB 5JJEB 2Q0AA 5C8YB 3HKCB 3JASB 4FLZA 1O75A 2VQEB 4DV1H 1H2SB 1J5EB 4LF6H 2UXBH 4X66B 4ZOLB 1XK5A 2V4DA 1IBKH 2PGGA 4CS3A 5JQGB 3BRCA 2R72A 5KMGB 3JAKA 5J2UA 1N34B 4TUYA 4I55A 3T1YB 2XIGA 4GKKH 1HW7A 1XHZA 1GYFA 4B3TB 4K8ZA 4DV2H 4RB2C 3EYYA 1Z2NX 4CH4A 4EB6A 4O4HB 1FJGH 4APMA 5EIBD 1XNRH 5FNVB 1DGSA 3JALA 4X1KB 4B3RH 5J2UB 4M7EA 4I55B 4CH3A 2RGVA 2WE6A 2FE3A 3MWMA 3JATA 5LYJA 4X65B 3HXLA 5EZYB 1HNZB 4LF5H 5BR8H 3JARB 3F8NA 4ETSA 2F1MA 1TVKB 3CSXA 3GDEA 4X62B 4DR6B 4JYAH 1BJTA 2HHHH 3CB2A 1E4GT 1IBLB 2JVDA 2RJZA 3W5OA 4JI1B 4LF9B 2ZNIA 4ZI7B 4DV5B 5JCOA 5D1PA 5JH7A 4AHCA 4LFBB 2UUBB 2UXCH 3UQ8A 1TGOA 3N2KB 3B2EE 3L4KA 2R9AA 4AILC 4DR7B 3NBZB 4LFCH 4AQYB 2ZJTA 4GKJB 4FM2A 1I94H 1TUBB 3VQWA 4WBNB 4B3SB 3W1GA 4DV6H 2VPSA 3HKCA 5K1PA 4YJ2B 2HVQA 3NC0B 4JI2H 3SJCC 4Q0YA 2ZINA 3JAWA 5EOYA 4JI3H 4X20A 1I7FA 4X1YA 3K5LA 4DV4H 1XMQH 3RYFA 2UUAB 2WYOA 5A2QW 3LNNA 3RGBA 4D7TA 5LYJB 3GB8B 4DR3H 3RIZA 3ICXA 4LF7H 2PYJA 4JI8B 1TA8A 3N2GB 3ZS8C 1HNXB 1SYXB 1KMIZ 5FNVA 2UU9B 2VWJA 4HBNA 2MCTA 4DUZB 4JI6H 4FLVA 4LSXA 1SQGA 3J80W 1XMOH 2ZM6H 1M4UA 2Q2UA 2F95B 5C8YA 2YI9A 4TV9A 1IBMH 5EZYA 4JI6B 4JI0B 3JATB 1TVKA 4JV5H 3K59A 1Q43A 3BA8A 4IHJB 3RYCB 4JV5B 4A2AA 4JI0H 1M0WA 1IBMB 4LF7B 1P8LA 4MV7A 1S5JA 5LP6C 3RYIB 2ZM6B 4ZI7A 4DV3H 1L8DA 4CH6A 1XMQB 4B08A 5KHKA 5IWAB 4O4JB 4KHPB 4DUZH 5IJ9B 2YIAA 4JI3B 2P5OA 4K0KB 4LFAB 3NBYB 5KHGA 2QJ1A 3RYHA 4FLYA 5LA6B 3U0ZA 4GKJH 4AQYH 4JI8H 2F93B 4O2BB 4DR3B 3U10A 3N43B 5JVDA 2O03A 3BAAA 2PY5A 3CVZA 4RAYA 4FFBB 3WB1A 3C0FB 1VF7A 4LH6A 3RYHB 4I9QA 5EYPB 5JCOC 1A0IA 5LA6A 4MTEA 1XNQH 3N42B 4U3JB 4JI2B 2CFMA 4UCSA 3WB2A 1HNWH 3HKEA 4PZ6A 3N2GA 3JALB 4X1KA 4B3SH 4JI5H 4UCVA 4HNAA 3WB0A 4JYAB 4CC5A 5D5PA 5IJ0B 2ZIOA 5GONA 4LF8B 4DR7H 1NT2B 3K57A 4FFBA 1RSOA 4LF5B 1FVIA 1HNZH 3HKEB 2F4VB 5JQGA 5KMGA 4FM1A 2UUBH 4EQ5A 4PI0A 4UCUA 3K5MA 4J0MA 5BMVA 3LMLA 4I7HA 4DRXB 4LF9H 2P22C 2CAZC 3JSLA 1P49A 4LMYA 1JJOA 1WN7A 2PZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG B;  3VNN A;  3PN1 A;  1HNW B;  3NC0 B;  4B3M B;  2HVQ A;  5BR8 B;  4DUY B;  5D1O A;  1N32 B;  4GKK B;  5DIS C;  2UUA B;  4LH7 A;  5LMU B;  3BAB A;  3GB8 B;  2OWO A;  1IBK B;  2HIX A;  4JI8 B;  4LF6 B;  3KYH C;  4DRF A;  1N33 B;  1S68 A;  1TA8 A;  5D1O B;  2VUG A;  1HNX B;  5FPO A;  4NXM B;  2UU9 B;  1P16 A;  3OTO B;  4YY3 B;  4DV2 B;  4DUZ B;  3TY8 A;  1TAE A;  3TY9 A;  4E6N A;  4DV3 B;  2Q2T A;  2Q2U A;  2UXB B;  4JI6 B;  4DV1 B;  5LMN B;  4JI0 B;  4JI4 B;  4DV7 B;  1N36 B;  4EEQ A;  4DR4 B;  3RR5 A;  3TY5 A;  1CKO A;  4DR2 B;  3BA8 A;  4JV5 B;  2VQE B;  1J5E B;  4X66 B;  1XK5 A;  4YHH B;  1IBM B;  2E5L B;  4LF7 B;  1P8L A;  1N34 B;  1B04 A;  2ZM6 B;  4TOI A;  1XMO B;  3T1Y B;  4DV0 B;  1XMQ B;  5IWA B;  4KHP B;  4B3T B;  3S24 A;  4JI3 B;  4K0K B;  4LFA B;  3NBY B;  3W1B A;  1CKM A;  5FPR A;  3SGI A;  1HR0 B;  3T1H B;  1I94 B;  4DR1 B;  1DGS A;  4UCO A;  1CKN B;  4EFB A;  4LFC B;  4CC6 A;  2UXD B;  3BA9 A;  2UUC B;  4DR3 B;  1XDN A;  2HVR A;  4NXN B;  3GJX B;  4EFE A;  3BAA A;  1V9P A;  1X9N A;  4DV4 B;  4LH6 A;  1A0I A;  4X65 B;  2HVS A;  4UCR A;  4JI7 B;  1HNZ B;  4OX9 B;  4JI2 B;  2CFM A;  4GLX A;  4UCS A;  3GDE A;  4X62 B;  4DR6 B;  2HIV A;  4PZ6 A;  4DV6 B;  1CKN A;  4JI5 B;  2HHH B;  4UCV A;  4JYA B;  3JSN A;  4CC5 A;  1IBL B;  3W5O A;  4JI1 B;  4LF9 B;  4DR5 B;  4LF8 B;  4UFZ A;  4DV5 B;  2VQF B;  5D1P A;  1FVI A;  4LF5 B;  3L2P A;  2UXC B;  2F4V B;  4LF4 B;  1XNQ B;  4PZ7 A;  4LFB B;  2UUB B;  4EQ5 A;  3W1G A;  4X64 B;  3RTX A;  4UCU A;  1ZAU A;  3UQ8 A;  4DR7 B;  3NBZ B;  4UCT A;  3QWU A;  4B3R B;  3JSL A;  4AQY B;  4GKJ B;  4PZ8 A;  1XNR B;  4B3S B;  1VS0 A; 
#chains in the Genus database with same CATH topology
 2BTO A;  1FXH A;  3N6R A;  3QF7 A;  1ZET A;  4KL1 A;  3L73 H;  2FPG B;  1FXK C;  2CW8 A;  5D1O A;  4E2L A;  4WF9 V;  3L4J A;  2Y69 C;  4DV0 H;  3T1Y H;  3PW4 A;  5KFQ A;  2Q67 A;  5IT9 N;  2CTR A;  5HNE A;  2C2A A;  2R8G A;  3KYH C;  2CZG A;  3N44 B;  2QWR B;  3ORQ A;  2UXB O;  4IGG A;  3CCS V;  4YBZ B;  2CH7 B;  2WLK A;  4PD4 F;  3PW0 A;  5H80 A;  3GV5 B;  1P16 A;  4RNN A;  3PJS K;  2EIN B;  5D8D A;  1HNX O;  1ULZ A;  5FR9 A;  3PO2 G;  2Q7H A;  2YRX A;  3H0G G;  3ZHR A;  2FMA A;  1W0J G;  4E6N A;  3F7V C;  3HPL C;  1VQ6 V;  4IYH A;  3K5N A;  2Q2T A;  5DGA A;  2BQ3 A;  2ZDI C;  1KC7 A;  1Z2G A;  2YIC A;  4DUZ O;  2WTF A;  1SKV A;  4DV1 B;  2KKW A;  2CUG A;  3IJ4 A;  3L70 H;  4YY3 H;  2R7K A;  1S0O A;  4DR2 H;  2UXN A;  4CKE A;  1VQP V;  1V55 C;  5IJ9 A;  4A3K G;  4JI6 O;  3T9B A;  1FKA H;  4O3N A;  4A2B A;  3T5J A;  1AUV A;  1VQ4 V;  3FKI G;  1D5A A;  1JR9 A;  4TV8 A;  2RNB A;  5D5Q A;  5L3F A;  4JGS A;  2ILM A;  3CRA A;  4H13 B;  5CBG A;  4IHJ A;  3G8C A;  2DOS A;  5KAI Z;  3MJF A;  1CXZ B;  4OX9 O;  1RYS A;  4A3B G;  3JAR A;  4ED6 A;  3VQY A;  1JQ0 A;  1N33 H;  2QF7 A;  2IBZ H;  2HHF B;  4RQE A;  4J9M A;  2UUC B;  4O3Q A;  1M9N A;  5LOV B;  3K0D A;  4X89 A;  3F5T A;  3RB3 A;  1DF4 A;  1IZ3 A;  3BVO A;  3B4S A;  4YJ3 A;  5KG6 A;  2P6J A;  2DE0 X;  4UCR A;  3AYH B;  4OX9 B;  5I47 A;  2VOB A;  3RGX A;  2RDC A;  2GUZ A;  1ZSP A;  4GYC B;  2OCC B;  3SR2 C;  2WA3 A;  4FPP A;  2IJK A;  2QA4 V;  5H2F Z;  5LOV F;  3VBB A;  2Y69 B;  1EZ1 A;  3V4Z A;  5KFC A;  4ECV A;  3U11 A;  5IYB G;  1OBG A;  1IVS A;  5FD5 A;  1K1S A;  2NVY A;  1O9G A;  3MR3 A;  5C3E G;  2V9W A;  1ZAU A;  3DTG A;  1SQF A;  1RYR A;  3CCJ V;  1KUT A;  2Y0I A;  3L75 H;  4YAK B;  1GRJ A;  4TSF G;  3QZ7 A;  4L8J A;  2QSA A;  3VNN A;  1HNW B;  2XHB A;  4K0K H;  2Z3Y A;  1ENV A;  3AG2 B;  1N32 B;  1KJ9 A;  1I7L A;  5A9G A;  1AN7 A;  4DUY O;  5L1J A;  2ZE5 A;  5JWP A;  2Q7D A;  5I5T A;  5KFV A;  1M0T A;  2VWK A;  2Q73 A;  1YZB A;  3BY6 A;  4YJ2 A;  2ITD C;  2RMK B;  4A5U B;  2J9G A;  1AR5 A;  3Q4H A;  1N36 H;  1SRY A;  3E22 B;  1UJW B;  1WSC A;  4U3F H;  4ECX A;  2OLS A;  5KX5 B;  3CCV V;  1M90 W;  4MV1 A;  4MVM A;  2AHZ A;  1K5Q A;  2QWN B;  3EPG A;  2HGW A;  2WB1 A;  2HG8 A;  4A3F G;  5LL6 Y;  4YHH O;  3GTQ A;  2YI8 A;  3QO8 A;  1FKA O;  3N6X A;  1N0N A;  3T54 A;  2X0S A;  1PNK A;  5FLM G;  5L1K A;  3I12 A;  2E3C A;  1SEI A;  3WFV A;  4MAM A;  4O2A A;  4DV7 B;  1KJI A;  1XIL A;  3OTO O;  1M1K W;  4MVS A;  2XC9 A;  2BTQ B;  3T1Y O;  3CX5 F;  2ASD A;  3TW6 A;  4I7Z B;  3P30 A;  4U7N A;  4IWY A;  3WWI A;  4FM0 A;  2QE7 G;  2Y4T A;  3ZMS A;  2JA8 G;  1B04 A;  5BPH A;  1AJN A;  2YS8 A;  4OXS A;  1ZHQ A;  1AJP A;  1DIK A;  4O7R A;  3HKB A;  4DV4 O;  1S77 D;  4RNM A;  5DGI A;  2FPP B;  4XYL B;  3FB6 C;  1ZUQ A;  3MFH A;  3CHX A;  2MW2 B;  2P4K A;  3KAK A;  1I94 B;  4DV6 O;  2IU3 A;  1Z2P X;  4ABM A;  1XUQ A;  2JS3 A;  2R7M A;  2UXD B;  4JF3 A;  1GSO A;  1XDN A;  3VOU A;  4JYC A;  5IJ0 A;  2QM4 A;  2QM8 A;  1VP7 A;  1V9P A;  3J80 N;  5IYD G;  4X64 H;  4RUC A;  4ED0 A;  4LFB H;  4DV4 B;  5IYC G;  2YS7 A;  2UUC O;  4J7Z A;  5DEC A;  1OCZ B;  1RK5 A;  3E8G A;  4O4L A;  1M7J A;  4JI1 H;  5LP6 F;  5JVD B;  1CKN A;  1FFX A;  4BR6 A;  5C4X G;  1W93 A;  4X62 H;  1SQB H;  3VPB A;  4WBN A;  4CKB A;  4DK1 A;  2V58 A;  3L2P A;  1QBZ A;  2UXC B;  1EUD B;  3K08 A;  2JGU A;  4JI7 O;  5KT5 A;  4O3O A;  3C3S A;  5L3C A;  3MFI A;  1N8R W;  3ZHU A;  4ZHQ F;  2OTJ V;  3FAV A;  4O4J A;  3G4S V;  1N56 A;  4PA4 A;  5AG2 A;  4RAZ A;  1KP2 A;  3AG1 B;  3CME V;  3DAA A;  2ZT9 B;  5JJJ B;  1HR0 H;  1V51 A;  5FLX W;  4DR6 H;  2HFE C;  4JAU A;  3ASO B;  1NVP D;  2UUA O;  3OAA G;  2UVW A;  4O7W A;  1WA8 B;  5DAA A;  2V59 A;  5DIS C;  3GII A;  3G80 A;  2EIM C;  2R9I A;  3DGE A;  2OTL V;  3ZX6 A;  3RJ0 A;  1SQQ H;  2W6O A;  1K3E A;  1TUB A;  4TWK A;  4MVZ A;  1K92 A;  2WAM A;  1J5E H;  4ECU A;  2EIY A;  4J9Z B;  5BR8 O;  4TQR A;  5KHJ A;  1OZ0 A;  2UVV A;  4DQN A;  1JFF B;  5GON B;  2D2C B;  4FK5 C;  3S3W A;  1MSW D;  1JX9 A;  2YIB A;  2PMZ A;  1TAE A;  1K34 A;  4PA9 A;  5LOV A;  3N2K A;  4JI0 O;  2PTM A;  4YJ3 B;  1VQ8 V;  1Z5V A;  4FLX A;  2JS5 A;  1N34 O;  4O2B F;  2CNQ A;  2XT9 A;  2YYA A;  4DV3 O;  3LQS A;  2LW7 A;  2CTQ A;  2W70 A;  4NXM H;  2GHY A;  3HKB B;  5KX5 A;  4QJF A;  5IYC O;  5B1O A;  3R5H A;  1AUX A;  2CGO A;  4FLZ A;  2ZDG A;  2VQE B;  1H2S B;  4DL5 A;  3X2Q C;  4X66 B;  1IBK H;  1Y66 A;  3GV8 B;  3CRM A;  2HGX A;  5KS8 A;  3RAX A;  3BRC A;  2EIJ B;  4TUY A;  1ZL8 A;  4LFA O;  4I55 A;  1GN4 A;  1VMG A;  3STZ C;  3UM7 A;  3CCU V;  4HR7 A;  3ZRV A;  2ALZ A;  2Y0S E;  1QLE B;  3ZIA G;  2HJF C;  4X65 O;  4CH4 A;  3Q1K A;  2I87 A;  4O4H B;  2FML A;  4X62 O;  4HYK A;  4KFM A;  3K06 A;  4M7E A;  1E1Q G;  3E5N A;  1YIT V;  3N8D A;  3H9V A;  2IW5 A;  4JI1 O;  3MWM A;  4DR1 O;  3ABK B;  2FPI B;  5KG1 A;  2E76 B;  1NH2 B;  3JAT A;  3T4Z A;  3DTU B;  2UUB O;  3JAR B;  2BOB C;  1AI6 A;  3T9A A;  5I5V A;  2ATK C;  4JYA H;  3I4N G;  4QWE A;  2KQX A;  3FYI B;  3OUF A;  4N21 A;  1FFT B;  1CE8 A;  3CB2 A;  2BCC H;  2G38 A;  4PDR A;  1QVG U;  3BFR A;  4MS2 A;  3W5O A;  4LF9 B;  3B77 A;  3ABU A;  4KXR A;  4J7J A;  5JCO A;  4DV5 B;  3ETJ A;  3P3N A;  2QDO A;  1U97 A;  1B6R A;  4HNV A;  4WBN F;  3SJQ C;  1ORQ C;  3C90 A;  1CQI B;  1TGO A;  3N2K B;  3L4K A;  3EXA A;  4AIL C;  5C44 G;  4LFC H;  1JX4 A;  3ETG A;  1BL8 A;  3GIP A;  5IP7 G;  2R82 A;  3J7A U;  3G67 A;  1HP8 A;  4NR1 A;  3VMM A;  2QYZ A;  1T36 A;  1NKD A;  3HKC A;  4B3R O;  4MW3 A;  5KKN B;  3LUT B;  3ABK C;  2HVQ A;  4JI3 H;  2ZIN A;  4LFB O;  3T5K A;  3PR5 B;  5B66 Z;  2NU8 B;  4RNO A;  3T5L A;  3Q8P B;  1VQN V;  1R6K A;  4DR3 H;  3RIZ A;  4DL3 A;  4LF7 H;  2WLN A;  2PYJ A;  3H01 A;  4WFF A;  4XDK A;  2IP4 A;  3ASN C;  4O7V A;  3E8B A;  1RJP A;  3J81 N;  3FYE B;  3CXC U;  1HNX B;  3ABM C;  1KMI Z;  3ZRS A;  5FNV A;  1RM1 B;  3WG7 C;  4HBN A;  4E4E A;  1N33 O;  2AHY A;  4J41 A;  2VUM A;  5EBL C;  1TWG A;  2XAF A;  3W7U A;  3NR7 A;  1ARO P;  2ZDI A;  4LSX A;  1SQG A;  5BZB A;  1XMO H;  2VA2 A;  4DV2 O;  4ECW A;  5C8Y A;  2V5A A;  2WB1 E;  2E2H A;  3GTG A;  4JI0 B;  2OT5 A;  3JAT B;  1TVK A;  4H37 A;  4JV5 H;  2W0X A;  3K59 A;  2QWO B;  3K5I A;  4JI3 O;  2M7W A;  4NTW A;  2FJZ A;  3QQM A;  4IHJ B;  3CJH A;  5JH7 F;  3H0G A;  4JI0 H;  2ADQ B;  3HR0 A;  1CQJ B;  1IBM B;  1PNL A;  4LF7 B;  1P8L A;  1BE3 H;  4MV7 A;  4W4L A;  5LP6 C;  4C5C A;  3LNM B;  4CH6 A;  3UO2 A;  4B08 A;  4QPK A;  3GWK C;  4OPH A;  5L1L A;  1MZE A;  1MNG A;  2K1E A;  4JI3 B;  1W59 A;  2P5O A;  5KHG A;  5L3B A;  2QTO A;  4MW8 A;  1Y74 A;  4NXN O;  2QJ1 A;  2WSS G;  2PI5 A;  2R7L A;  5DLF A;  1R1B A;  4IRK A;  1KD1 W;  4O2B B;  4ME6 A;  4Y8V B;  1BT8 A;  4RAY A;  4LF5 O;  3C0F B;  1MA1 A;  1XNQ H;  3EFF K;  5EYP B;  4FE2 A;  5JUM A;  2V1D A;  4YJ2 F;  1K7D A;  1GK9 A;  4UCS A;  3HOX G;  1GLV A;  1S10 A;  2OCH A;  3N2G A;  3GIK A;  4NKG B;  2R86 A;  3R9R A;  4JYA B;  4CC5 A;  4LF4 O;  2H3O A;  5CBF A;  2EZP A;  5GON A;  5IJ0 B;  1SF9 A;  4LF8 B;  1EHI A;  4GX5 A;  4DR7 H;  1NT2 B;  2R92 A;  5KFH A;  5C8Y F;  3UCS C;  5F9N A;  3BEH A;  1R9T A;  4HN2 A;  1JA8 A;  1H2M A;  1FXK B;  4PI0 A;  4UCU A;  3STL C;  5E79 Z;  5EC2 C;  5BMV A;  2EIJ C;  4DRX B;  2P22 C;  5KFA A;  1QLN A;  1IBK O;  1QU7 A;  4GUN A;  1BNC A;  3H1L H;  4AQY O;  3FB5 C;  2CH7 A;  1YCI A;  4IT5 A;  4P9O A;  1VQO V;  2FB9 A;  5CA0 B;  3FB7 C;  3I4M G;  4ECT A;  1VQ7 V;  1JPX A;  1Q6U A;  4F4Z A;  2N05 A;  3K79 A;  3QO5 A;  3SJA C;  4LH7 A;  3MR5 A;  2NNU A;  2DAA A;  2Q9L A;  4RUA A;  1EFR G;  1IBK B;  4FFO A;  4HQ6 A;  4X66 H;  4LF6 B;  4AYB E;  5FNV F;  5B5E Z;  1P4R A;  3TEK A;  5LP6 B;  4ED1 A;  5LXT B;  4IZO A;  2B63 A;  1H8E G;  5KFF A;  3OR6 C;  2IH1 C;  2P06 A;  5K1X A;  3TY9 A;  1I5Y A;  3ZED A;  4EEY A;  4D7S A;  2WLL B;  1QR8 A;  1KTA A;  1GH6 A;  4TV8 B;  3HKZ A;  5LP6 A;  4MTO A;  4MV9 A;  2UXB B;  1I1L A;  2X6A A;  1H38 A;  1VBG A;  2DWD C;  3PW5 A;  3N41 B;  3JCZ A;  5B1N A;  1CKO A;  4Q6G A;  4HNA B;  2HEP A;  2AGQ A;  5IE9 A;  3JZ6 A;  2E5L B;  3BJY A;  1N48 A;  2OIE A;  1YI2 V;  3RW0 A;  3CC4 V;  4EKW A;  1TUE B;  5KFT A;  5KFU A;  2LFS A;  4J9N A;  4H44 B;  2FK1 A;  2WAQ A;  4LNU B;  5LGN A;  2HJW A;  4QJF B;  2CGN A;  4UXN A;  1B6S A;  1QHT A;  1KJQ A;  3SGI A;  5BY1 A;  2IH3 C;  2YXH A;  3T1H B;  1OCO B;  4FLT A;  2ZGI A;  2YXL A;  3MWE A;  2E5L O;  1IDS A;  3EVK A;  1S3J A;  3DF7 A;  3HKD A;  3UYY A;  1AI7 A;  5EZY F;  1I7N A;  1R73 A;  5C5J A;  4Q45 A;  4EB6 B;  2R70 A;  4O7L A;  1KP3 A;  3V6K A;  2PVP A;  4ECR A;  2KSW A;  1UPG A;  1KT8 A;  5IP9 G;  2VQF H;  1FD9 A;  4GLX A;  1JIH A;  1EZV H;  3APQ A;  5HFL A;  2W6Q A;  4JI2 O;  1BMF G;  3JSN A;  2W6P A;  3BQ2 A;  1ZX3 A;  2FB5 A;  4EYH B;  2WDT A;  2ODM A;  3E22 A;  3K3V A;  1JXL A;  2DJV A;  4ZQI A;  1FYJ A;  1HNW O;  1GM8 A;  2HKO A;  1I6U A;  4NZN A;  4MSW C;  1XNQ B;  3NUA A;  1E4F T;  1OCR C;  2Q68 A;  4LBE C;  1N32 O;  4FGR A;  2YCH A;  2P7T C;  2GQS A;  3CXH F;  2F4V O;  3K9S A;  4MV3 A;  2UXD H;  2HJD A;  1R3L C;  1K9M W;  1GO3 E;  1SES A;  4DR5 O;  3EPI A;  5EDW A;  2YDE A;  5BXZ A;  2DZD A;  5KHH A;  3P32 A;  4KHP H;  4U7O A;  1A48 A;  1CP9 A;  4I5S A;  4TUY B;  5KFZ A;  2DYR C;  5FL7 G;  2V4R A;  5GON F;  1WH2 A;  3OD4 A;  3ETQ A;  5LA6 F;  2VUG A;  1FFX B;  1Q3E A;  4EGJ A;  4BWS C;  4B3M O;  3HKZ E;  4MTX A;  1N36 O;  3A0B Z;  3OTF A;  2UVU A;  2Q4P A;  4LFA H;  3OTO B;  4KUM A;  2JJ1 G;  4K6N A;  4WFB V;  5IWA H;  1Q7Y W;  4RQF A;  2Q69 A;  3SPC A;  2ZXW B;  3L74 H;  3G6B A;  3MD0 A;  1TWA A;  1WP8 A;  3LDE A;  1JFF A;  3SYO A;  1KJJ A;  1SA0 A;  4AYB A;  1N36 B;  1CEZ A;  2YXY A;  4BIZ A;  4U3J A;  2FLL A;  3GTK A;  2YUA A;  3JYC A;  3OSN A;  3GV7 B;  2Z5U A;  2ZE8 A;  2W6N A;  3H4B A;  3AK3 A;  3WWJ A;  1I94 O;  2JDI G;  5CA1 A;  1Y1W G;  1U96 A;  1WPB A;  4X1Y B;  3JRW A;  2QEX V;  4J7K A;  4TOI A;  2RDJ A;  1AI4 A;  4W4K A;  1N32 H;  2B9Z A;  3RV4 A;  1Z2O X;  3S24 A;  2KG7 A;  1Q90 D;  3OGC C;  5KFO A;  4Q43 A;  4DRX A;  4B3M H;  1T94 A;  4NZM A;  5FPR A;  5IDJ A;  1A9X A;  2F66 C;  4A3D G;  3RWR D;  4F6R A;  2J6U A;  4O7Z A;  3JAM W;  4MTD A;  3CC7 V;  3BA9 A;  5CR5 A;  1Y1V A;  3T1H O;  2HVR A;  3ASO C;  2ZR3 A;  1YEW A;  4BY1 G;  2UUA H;  5BWU A;  3GIL A;  2VA3 A;  4BIU A;  3HOW G;  2GTA A;  4X20 B;  2AZ2 A;  4JI7 B;  1GSH A;  4FVM A;  2YEV A;  5EWF A;  1ET0 A;  2RN9 A;  4DV6 B;  3TCU A;  4R6Z A;  5IYD O;  4LFC O;  5GTH Z;  1JVM A;  2E75 B;  4IR9 A;  1XNR O;  2OYQ A;  4R8C A;  4ECQ A;  2R7Z G;  4X88 A;  2ASL A;  1I3Q A;  4O7N A;  5J2T A;  2YID A;  4PZ7 A;  1SQP H;  2QGN A;  4GKJ O;  2R9R B;  4FLU A;  1VF6 C;  2N74 A;  4O4I A;  2A9H A;  1IBL H;  5IYZ A;  2JEU A;  4DLK A;  4NVP A;  1W2B U;  1IYE A;  1GN6 A;  2FP4 B;  2BQU A;  4UUG A;  1V55 B;  2BOC C;  3K9A A;  2XGP A;  1QQC A;  3GVM A;  3TET A;  2GDS A;  4P9P A;  2DYR B;  4YY3 O;  1ZQ7 A;  3MAQ A;  1MAB G;  4IR1 A;  3CQZ A;  1JOY A;  3B8N A;  5CB4 B;  3HOV G;  2OWO A;  1T5E A;  1H8H G;  4O4I F;  2HIX A;  5DQI A;  1H2N A;  3C3T A;  5B1A C;  4IL6 Z;  2A3Q A;  3UT5 A;  4UV8 A;  4DK0 A;  1SA0 B;  1CPY A;  4ZKI A;  2AZ0 A;  4NXM B;  2R87 A;  2JEI A;  4JI4 H;  4DV2 B;  4GC7 A;  2CKZ B;  4R50 A;  2A0L A;  4ZBM A;  3KAL A;  1O9H A;  3G71 V;  3M7M X;  3CEB A;  1NR1 A;  3RYC A;  3RF2 A;  3RYI A;  3GID A;  2W9C A;  4TT3 G;  5KFI A;  1LUW A;  4JYY A;  1JDB B;  1XQ8 A;  5K2M A;  2R93 A;  4J9S A;  1PL4 A;  1VEW A;  4FS1 A;  4MVR A;  4MV8 A;  3ZHQ A;  5KT7 A;  1O75 A;  2X7R B;  3E35 A;  4DV1 H;  2JEF A;  5EWG A;  1J5E B;  4FBU A;  1XK5 A;  4FZ1 A;  2V4D A;  1WA8 A;  1F23 A;  3D36 C;  2PGG A;  3JD3 A;  4CS3 A;  2R72 A;  3JAK A;  2LW1 A;  1Y1V G;  3ZRW B;  3T1Y B;  2XIG A;  2NU6 B;  3CCE V;  1EKP A;  3JZI A;  2YS6 A;  4DV2 H;  5KFS A;  4DXW A;  2EJ0 A;  5DG7 A;  4EB6 A;  3PW7 A;  1FJG H;  4M9U A;  5FNV B;  1B33 N;  3TXS A;  3JAL A;  2BSK A;  1XBL A;  2R6F A;  1PKX A;  1NJI W;  1VQK V;  1YHQ V;  2RGV A;  3JD4 A;  1K83 A;  5CA3 A;  5EC1 C;  1MSD A;  4IYI A;  4DV5 O;  2VS0 A;  4J80 A;  4X65 B;  3HXL A;  4F4L A;  4LF5 H;  2EUL A;  3FD9 A;  1H2K A;  1KKD A;  3F8N A;  1URF A;  1TVK B;  2PBZ A;  4XBF A;  4X62 B;  3IC7 A;  1PK8 A;  1F7Y A;  1BJT A;  2HHH H;  4P30 A;  1PNM A;  1XL4 A;  4MTG A;  2ZE7 A;  2ABJ A;  1TWF A;  2ZR2 A;  4GX1 A;  5HBR B;  3WNZ A;  2XAJ A;  2AGO A;  2XTA A;  2JA7 A;  2ZDQ A;  5KG4 A;  2UUB B;  4F4X A;  4ECY A;  3RB6 A;  4O4H F;  3UQ8 A;  2QWP B;  4DW0 A;  3WO1 A;  2R9A A;  3OMN B;  4WHX A;  3WO0 A;  1WN7 A;  2AU0 A;  2ZJT A;  4B3S B;  1S9F A;  2EIK B;  4DO2 A;  2IJJ A;  3SPG A;  5K1P A;  4R8U B;  4HAM A;  4YJ2 B;  1I08 A;  5EOY A;  3W7W A;  4X1Y A;  4NYE A;  4LF6 O;  4Q4D A;  2WYO A;  4DR7 O;  3LNN A;  3RGB A;  4D7T A;  3GB8 B;  4HNT A;  2L35 A;  2IJI A;  1P84 F;  3O65 A;  2COG A;  4RO2 A;  1UFI A;  3ZS8 C;  1SYX B;  2HG5 C;  4IHJ F;  5KUM A;  3V6J A;  1C30 A;  2LO1 A;  1JDE A;  1A3G A;  1OCC B;  2MCT A;  4HZ3 A;  2CTP A;  1Y14 B;  3VPD A;  4MV4 A;  1M4U A;  1NI8 A;  2F95 B;  3Q4H B;  4TV9 A;  3BCC H;  5KFK A;  5EZY A;  2DQ3 A;  1A0G A;  5IWA O;  5CM0 A;  1TWH A;  4DL6 A;  3OM3 B;  3H3V H;  4JAS A;  1US6 A;  1BZK A;  2B5U A;  4BAY A;  4A2A A;  2NUA B;  3D3Q A;  4TUY F;  4IIJ F;  3QZ8 A;  1NH2 D;  2EIL B;  5C93 A;  3RYI B;  2W9C B;  2OIG A;  4DV3 H;  3FB8 C;  1L8D A;  3ZCC A;  5KHK A;  3GIJ A;  1AP5 A;  5IJ9 B;  5J2U F;  3GIQ A;  3A0R A;  4LFA B;  4JV5 O;  4WFH A;  3RYH A;  3RT3 C;  4FLY A;  3HOZ G;  4CE5 A;  1VQ9 V;  5DGH A;  3RVZ A;  3U10 A;  1PX2 A;  4YAJ B;  5JQG F;  1EN5 A;  2F43 G;  4LH6 A;  3RYH B;  3RAQ A;  3N42 B;  4U3J B;  3WB2 A;  3E89 A;  3CP1 A;  4OGQ B;  4PZ6 A;  4Q44 A;  4B7K A;  2IA6 A;  3JAL B;  2VRZ A;  2DYS B;  4TV8 F;  5T14 A;  4B3S H;  4MV6 A;  1VKZ A;  5I5W A;  2ZIO A;  1VQ5 V;  4D6T H;  3FDS A;  3T7A A;  1GO3 F;  1MMM A;  2W6J G;  4B7E A;  1Q86 W;  4LF5 B;  3HKE B;  3CCM V;  2F4V B;  5JQG A;  2WLL A;  2UUB H;  2EJ3 A;  4PA7 A;  4QWB A;  1L0L H;  3K5M A;  1SQV H;  5DM6 V;  5DLG A;  3K0G A;  3LML A;  2NU9 B;  2EIK C;  2VQD A;  3TGU H;  2CAZ C;  2Q8V A;  2W6M A;  4LMY A;  1K5S A;  1K1Q A;  1JJO A;  4LF8 O;  3Q2O A;  2PZS A;  1HDJ A;  3KTM A;  5H6R A;  1FJG B;  3T9E A;  3PN1 A;  2PI4 A;  4GLW A;  4P2Z A;  1D5N A;  4O2A F;  1NTM H;  4QSH A;  3KXY T;  1DTO A;  4RZR A;  4B3S O;  4DUY B;  1WJZ A;  3DC6 A;  4X65 H;  3E8H A;  1JMK C;  1KU9 A;  3H1J H;  2W6Z A;  1NBM G;  2YEV B;  2XAG A;  2ZDH A;  2FLN A;  3SNO A;  2CE4 A;  3BAB A;  1M93 A;  5F2V O;  1IOW A;  3T9C A;  3CRR A;  2YL2 A;  5D1O B;  4GZR B;  4GCZ A;  3AW8 A;  5CA0 A;  2NN4 A;  3KCY A;  2B1I A;  1WCM G;  5E25 A;  1G8M A;  3BAC A;  5J2T B;  4A3E G;  3Q8Q B;  2DMX A;  2FL4 A;  3UO3 A;  2HGS A;  3BHP A;  1XL6 A;  4JV1 A;  4BBS G;  2PYL A;  2R8I A;  4BW5 A;  2EJR A;  2PUS A;  4IAJ A;  1WRV A;  5BMV B;  2VR1 A;  3CS5 A;  1OWT A;  3RFC A;  3M4I A;  1S5H C;  1OHH G;  4JI4 B;  3IG0 A;  2QB5 A;  4PDL A;  2C2E A;  4G28 B;  1AIL A;  4FIP C;  4DR4 H;  4YB8 B;  3QNE A;  1XMO O;  2F23 A;  1SS3 A;  2JK5 C;  3HKD B;  4DV0 B;  3K03 A;  4ICG A;  4JI4 O;  1WB7 A;  1RJQ A;  4DUY H;  3T9F A;  5J2T F;  4JZG A;  2ZM6 O;  1CKM A;  3TIN A;  4U7C A;  1WPX A;  4AI8 A;  1QR9 A;  2W71 A;  3VQX A;  1CKN B;  1V54 B;  1Q81 W;  4ED3 A;  4NXN B;  1MZB A;  5LMU H;  3PZP A;  3G8D A;  4X1I A;  4ZHQ B;  3B09 A;  4O83 A;  2M05 A;  1K97 A;  2AGA A;  4JUZ A;  2HVS A;  2F4V H;  1PP9 H;  3J81 W;  2EZO A;  3R23 A;  1Q6I A;  4MVQ A;  1GAX A;  2O57 A;  1G6U A;  2ZD9 A;  2P0A A;  2C35 B;  5H6Q A;  3UT5 B;  2YZL A;  1NS1 A;  2QKA A;  4GT1 A;  5BWW A;  4YR0 A;  4WCE V;  4JI7 H;  1BXR A;  4LF4 B;  3RV3 A;  1BGW A;  4IIJ A;  1COW G;  2GV9 A;  4RZQ A;  4JXU A;  1I0H A;  1M56 C;  1KQS U;  1Y74 B;  1X4T A;  4JI5 O;  1K8A W;  2OH2 A;  4K3A A;  4UUJ C;  2N04 A;  1K4D C;  2IM9 A;  1XI1 A;  1VS0 A;  1S0N A;  5B3S C;  2GPS A;  1M5I A;  1XOU A;  2EJ7 A;  4CS4 A;  1MG1 A;  5LMU O;  4B3M B;  4CMF A;  5DGB A;  3RBZ A;  5EWE A;  4O4I B;  4TQF A;  4XYM B;  3UFX B;  1J95 A;  3A0H Z;  3CCR V;  1DAA A;  3DC5 A;  1PD3 A;  3HB3 B;  3UZB A;  5KFM A;  1NVP B;  1R3K C;  2EX3 A;  2WLM A;  2VPQ A;  5LL6 b;  4C5B A;  4X8A A;  3SE7 A;  4DL7 A;  2QKC A;  5H9C A;  1Y76 A;  5FPO A;  5KFL A;  3FMA A;  3JAW B;  4I4T F;  1AJQ A;  4RB3 C;  1BGY H;  5CB4 A;  1S72 V;  3CPW U;  4FFM A;  2DPJ A;  3ZRX A;  1OCR B;  1S0M A;  4J9P A;  2W9A A;  4QWC A;  2Z0A A;  4DR4 O;  2GQR A;  2Y0S A;  3MR6 A;  4O3P A;  2Q0O C;  1N0J A;  3VQV A;  4YHH H;  3G6X A;  5KX5 F;  3OTO H;  2P4V A;  2W9B B;  1J5E O;  4I4T A;  3FKS G;  3JAK B;  2JGD A;  1RK6 A;  1GSA A;  3PVX A;  5LGU A;  3DXR B;  2C2D A;  5B3S B;  4B3T O;  5DMX A;  2R8J A;  4DR2 O;  1OJH A;  1Z5W A;  4CS2 A;  1XMO B;  1EBO A;  5L3G A;  2BSK B;  2BTQ A;  4JTA B;  2Q7E A;  3I55 V;  2XOK G;  3ORR A;  1E4E A;  2I8C A;  2UU9 H;  2AW9 A;  5GTI Z;  1FXV A;  3ZN0 A;  1LNQ A;  1HNX H;  2PMZ E;  4O86 A;  1YTF B;  4DR1 B;  5ITZ B;  2JRI A;  2HHH O;  1WAZ A;  4A3L G;  4C2M A;  3KG2 A;  1YJ9 V;  5LYJ F;  3GJX B;  4Q8F A;  1OCC C;  1X9N A;  3PFF A;  2W57 A;  4RUE A;  5FD6 A;  5ITZ A;  3OE7 G;  3LDD A;  2DIK A;  4A3C G;  4IIJ B;  1YJN V;  4DR5 H;  3APO A;  3FX7 A;  3MDS A;  1YXB A;  2XAH A;  4YIO A;  3OUS A;  2HHH B;  3F7Y C;  5KAF Z;  3CCL V;  5KUK A;  3CCQ V;  3GLK A;  4NLG A;  1Y67 A;  3SYC A;  4CKC A;  5J9P C;  3D8C A;  2VUM G;  5BYB A;  1Q8I A;  3SPI A;  5CA1 B;  2VQF B;  4RB1 A;  3GTM A;  3VOT A;  2XUM A;  4MA0 A;  5CB4 F;  3QFF A;  3IFX A;  2ZQM A;  3DSQ A;  4DV5 H;  2EIL C;  1YDX A;  5JH7 B;  2K9P A;  4PZ8 A;  1XNR B;  2ZCE A;  4PDV A;  4LSA A;  1M56 B;  2UVR A;  2VQF O;  1PV0 A;  1I1M A;  3F5W C;  1TWC A;  2YIB D;  4QIW E;  2JA7 G;  5KLV H;  1SZT A;  4GKK B;  1P7G A;  4JYB A;  1XHX A;  4F4W A;  3KKY A;  1JJ2 U;  3K5H A;  3TK1 A;  4ZOL F;  3H20 A;  2E5L H;  4ZIB A;  2Y0P A;  1S68 A;  4FJC C;  2Z02 A;  4R7R A;  2WLJ A;  3T1H H;  5B1B C;  5KFD A;  2JGD B;  5LMN H;  3G6E V;  2GLT A;  4N23 A;  1V54 C;  2VQE O;  3TQT A;  2LJ2 A;  4YR3 A;  2A06 H;  3KHG A;  1N34 H;  1FS0 G;  1SET A;  4OPA A;  2ODT X;  5EYP A;  3KAJ A;  4A3M G;  5HV6 A;  5IY5 B;  3RN4 A;  3LDC A;  3OGI B;  4O84 A;  4O4L B;  2Q0A A;  2B1G A;  3OHB A;  3JAS B;  3OEE G;  2V7Q G;  1QVF U;  4A3I G;  3ABT A;  1EYZ A;  2NVX A;  4LF6 H;  2UXB H;  4QNH B;  4ZOL B;  2ASJ A;  2ZE6 A;  5CAE B;  5KMG B;  3CRQ A;  2X5R A;  1N34 B;  1NU1 H;  5J2U A;  2EBO A;  4LP8 A;  5KFG A;  3G6Y A;  3AK1 A;  1FXK A;  1HW7 A;  5LMN O;  1VQL V;  5BWV A;  4B3T B;  4MVO A;  2XGQ A;  5DG8 A;  4QIW A;  3VPC A;  5KFN A;  3U9T A;  4J9L A;  3Q8R B;  5EIB D;  2JA6 G;  4UVC A;  4J9R A;  5L1I A;  2KB1 A;  4DR6 O;  4X66 O;  3BG5 A;  1DGS A;  1I2K A;  1FPO A;  4J9Q A;  4B3R H;  1GGO A;  1YF2 A;  4CH3 A;  1B3Q A;  3OFN G;  1KC8 W;  1AVM A;  5LYJ A;  5EZY B;  4QPJ A;  2XCP A;  4ETS A;  4NTY A;  1Y6X A;  2DN9 A;  3GDE A;  3ETE A;  4DR6 B;  3T2M A;  1I1K A;  3H4D A;  1BHA A;  1FAF A;  3OR7 C;  3V6H A;  2H94 A;  1E4G T;  1N4C A;  2QM7 A;  1S76 D;  3GTO A;  3LUL A;  3AEI A;  3GWO A;  4ZI7 B;  3ML0 A;  5D1P A;  1DF5 A;  4QGP A;  4AHC A;  1HNZ O;  1BSM A;  2Y4R A;  1EN4 A;  3L72 H;  2UXC H;  4EBC A;  5KG3 A;  3B2E E;  4MVU A;  4DR7 B;  3ZJZ A;  4X9Q A;  4GKJ B;  1AI5 A;  2GSM B;  2HVK C;  4FM2 A;  2EIN C;  1IX9 A;  1TUB B;  3OEH G;  4WBN B;  5KFW A;  4JV2 A;  4ED8 A;  1X59 A;  2JEG A;  1W96 A;  4I50 F;  3QO7 A;  5CN0 A;  3NC0 B;  4JI2 H;  3BQ1 A;  3SJC C;  4Q0Y A;  1THZ A;  4X20 A;  1I7F A;  5L3D A;  3K5L A;  4DV4 H;  2EJ2 A;  2GBO A;  3KHR A;  3RYF A;  3K3W A;  1L0N H;  3IN5 A;  1M6V A;  4J10 A;  2LFR A;  2CNU A;  4PBC A;  5CA0 F;  1SC5 B;  4JI8 B;  4PA6 A;  4GKK O;  5LXT F;  4QW9 A;  4EYI B;  3ZMZ A;  1GM9 A;  4DYL A;  5JVL A;  4FFR A;  1E79 G;  1WCM A;  4NYK A;  2W8L A;  4I0X B;  1DLB A;  2UU9 B;  1W0K G;  4C5A A;  4NB5 A;  4QWD A;  3ZHS A;  4HYO A;  3ABL B;  1Q6H A;  5E1A C;  3U54 A;  3J80 W;  4NXM O;  2ZM6 H;  4UVB A;  1IBM O;  1UC9 A;  4IRC A;  1SCU B;  3CJH B;  4TQS A;  2YI9 A;  1XDC A;  4ZI7 F;  1IBM H;  4PA3 A;  3DXR A;  2YSU B;  5IY5 C;  2HP8 A;  4IWX A;  1IOV A;  4UB8 Z;  3HOY G;  3W7S A;  3RVY A;  4YJ3 F;  5CBH A;  5L3E A;  4GX0 A;  4KP4 A;  3RYC B;  4JV5 B;  1BHB A;  4Z2W A;  2JA6 A;  1M0W A;  1KJ8 A;  3CEI A;  1S5J A;  3ETD A;  1Y1W A;  4WD3 A;  2ZM6 B;  4ZI7 A;  5GW7 A;  4KHP B;  4O4J B;  2KSD A;  2YIA A;  1DV2 A;  5KG7 A;  5CMU A;  2JEJ A;  5LA6 B;  3AG3 B;  3U0Z A;  4GKJ H;  4JI8 H;  4G3I A;  3JCU Z;  2DPI A;  2SCU B;  1LUV A;  1VF6 A;  4DR3 B;  1GTO A;  1H2G A;  5JVD A;  1G2W A;  4L87 A;  4FFB B;  2WLI A;  1A0I A;  3OSP A;  5JCO C;  5LA6 A;  3MR2 A;  1GMG A;  3WU2 Z;  4WFE A;  3JZF A;  4JI2 B;  4Z1V A;  4O4J F;  2R8K A;  1HNW H;  4LCU C;  3SI8 A;  3T99 A;  2WLH A;  1VBH A;  2ETN A;  4JI5 H;  3WB0 A;  3FAV B;  2JJ2 G;  1H2L A;  5D5P A;  2ARH A;  1C3O A;  4NZO A;  2J6S A;  4LC1 A;  3ZMT A;  1OCO C;  3PW2 A;  2NR5 A;  3A8T A;  5KMG A;  4YQW A;  1AR4 A;  2CDY A;  2WPD G;  3OW2 U;  4J0M A;  2XAQ A;  2AXT Z;  3IC9 A;  2W7P A;  4C7U A;  4LF9 H;  3JSL A;  1P49 A;  1K4C C;  2ITC C;  2FK2 A;  1CS0 A;  2YWV A;  2A1H A;  3RB4 A;  4ASU G;  3KZI Z;  2ZKO A;  1UNN C;  4OX9 H;  5EBW C;  4CH5 A;  1XRE A;  5IYZ B;  3M99 B;  3U55 A;  4B3T H;  4X1I B;  4ZHQ A;  2CQY A;  1GN2 A;  1YTF D;  2CW7 A;  2BR0 A;  1KB9 F;  4FMT A;  1B6Q A;  1IXM A;  2YZM A;  4PI2 A;  4ECZ A;  3ZRW A;  1GM7 A;  3AX6 A;  4BW9 A;  2VQE H;  1ZHS A;  3R5X A;  4PWQ A;  4RWU A;  4JTC B;  4UVA A;  2LQT A;  3H40 A;  1PPJ H;  1A32 A;  1MOF A;  1NZ6 A;  5BWR A;  3RYF B;  3TY8 A;  2WAQ E;  3TQ1 A;  5BPF A;  1SER A;  2QKS A;  4XDJ A;  2UU9 O;  4O3S A;  4A93 G;  2NLJ C;  1QCE A;  1Y4M A;  1IXB A;  5A2Q N;  4PDM A;  1KEC A;  4E4T A;  4DW1 A;  3JAM N;  3OMI B;  4EGQ A;  3M9N B;  4QIW F;  1EZJ A;  3BPZ A;  3TY5 A;  1EN6 A;  3KHL A;  4BY7 G;  4DR2 B;  3OUZ A;  1K73 W;  5KFB A;  2DWC A;  3CC2 V;  1RPO A;  3GIM A;  2MK3 A;  3E86 A;  3SPH A;  3M9M B;  1BQZ A;  1T3N A;  3MWD A;  4O2B A;  4K8X A;  3ZMU A;  4O7Y A;  2XAS A;  1KYO F;  2DQ0 A;  2QR4 A;  2YC0 A;  5I5U A;  3W1B A;  1WP7 A;  2YU9 A;  1HR0 B;  1KEE A;  2D3O W;  3IGA C;  3K04 A;  3AG4 C;  3ZMV A;  1VIB A;  4LNU A;  4UCO A;  4K0K O;  4PHZ A;  4RB0 A;  3R65 A;  4EFE A;  5KT6 A;  1KBH A;  1KBL A;  4FZ0 A;  4J9Y B;  3VA7 A;  1F4M A;  1XNQ O;  4O4H A;  3UZO A;  4DIM A;  4Z1M G;  4LF8 H;  4A3J G;  2P67 A;  5LGT A;  2HIV A;  3GTL A;  4MT8 A;  4JZ2 A;  4QWA A;  4JI5 B;  2UXC O;  4ZOL A;  4TM5 A;  2Y4U A;  1RFY A;  2QWQ B;  4DR5 B;  5EIB C;  3K5O A;  2OCC C;  4JYA O;  1EM1 A;  4G2K A;  2KG7 B;  3NXS A;  4X64 B;  3W7T A;  2RF4 A;  1MZF A;  1VAJ A;  5I5X A;  3K3P A;  3SYP A;  4FFN A;  4I4T B;  1HWY A;  2C22 A;  2RCV A;  3QTC A;  2NU7 B;  2W7O A;  3SJB C;  1SFO A;  3RGZ A;  2WA4 A;  5DQG A;  4GC6 A;  4LR3 A;  5EBM C;  3AG7 A;  1R6T A;  1P7B A;  5L9X A;  4CZZ A;  5K3W A;  3H1K H;  4NTX A;  4ECS A;  2R85 A;  4XDL A;  2Q5Z A;  3ZN1 A;  3E8F A;  4O4L F;  3PO3 G;  3D36 A;  1E1R G;  2COI A;  4FLW A;  5KG0 A;  2FTK A;  4PEL A;  4F6E A;  4DAA A;  1Q5O A;  4DRF A;  1WLE A;  2C00 A;  2DLN A;  4XZ3 B;  4DR1 H;  5TIS Z;  4RCN A;  2R93 G;  1ZLZ A;  4H33 A;  4DV7 O;  2COJ A;  4DL2 A;  1XEQ A;  4M0J A;  2HDK A;  4DV7 H;  2ZIM A;  4K35 A;  2IJH A;  1IUR A;  4QW8 A;  4DV3 B;  2WWW A;  3QG5 A;  3RFR A;  3B40 A;  4CHI A;  3CD6 V;  3R66 A;  3P3P A;  3B8M A;  5KHI A;  3J7A K;  2RQ6 A;  4Q4C A;  4J11 A;  4U6P A;  3RB0 A;  1WB8 A;  2Q7G A;  4CBC A;  3RR5 A;  2J6T A;  3THO A;  1LR1 A;  1L2Z A;  5JJN B;  3FKI A;  4DV1 O;  1G1X B;  5H5N A;  2A7W A;  3W7X A;  4YHH B;  4LWS B;  2XCL A;  2W8K A;  5I5Y A;  1YSC A;  1WNS A;  1AP6 A;  1GN3 A;  3AG4 B;  1NQT A;  5LBQ A;  3EHB B;  4DV0 O;  1DK1 A;  1PM9 A;  4TQD A;  1JCH A;  5EK0 A;  5BYA A;  3CWB H;  2DYS C;  4Q20 A;  3N27 A;  2FKX A;  4CMD A;  4EFB A;  5CA1 F;  4LFC B;  4CC6 A;  3H1H H;  2ZXW C;  3GB7 C;  1S97 A;  4WFA V;  3K58 A;  2DAB A;  3D3I A;  1E4E B;  4F6R B;  4LF4 H;  3FFQ A;  1BQ0 A;  2QK4 A;  3ABM B;  3OUU A;  4QE9 A;  2IU0 A;  2JA5 G;  1OBD A;  2V4Q A;  4R7C A;  2PF4 E;  2JA5 A;  3JD2 A;  1AR1 B;  1GKF A;  4BWA A;  5LHI A;  3JAS A;  2H8P C;  1VAR A;  5LXT A;  3LSS A;  4UFZ A;  2ZNJ A;  3Q8S B;  2YW2 A;  2R92 G;  5KFP A;  3CYO A;  2RGR A;  2W0F C;  2E2I A;  4F50 A;  3T1C A;  3RTX A;  1S03 G;  1AB3 A;  1DV1 A;  2C2R A;  2YZN A;  4UCT A;  3UKM A;  2CK3 G;  3QWU A;  4O2A B;  4B3R B;  1RSO B;  4I55 F;  3N40 P;  4ED7 A;  1F4N A;  3KRE A;  1EKV A;  2FKL A;  5IT9 W;  5KFX A;  1BCC H;  5BR8 B;  2P90 A;  1OV9 A;  3I5D A;  4FFP A;  4I50 A;  4O82 A;  3A2F A;  3WWH A;  1ZL8 B;  5LMU B;  2R84 A;  4NXN H;  3TW7 A;  4PDB A;  2UUC H;  3PR4 A;  5I5S A;  3OT7 A;  4BXX G;  5BWX A;  4FU0 A;  4J42 A;  5FJ8 G;  1N33 B;  4O81 A;  4A3G G;  4I50 B;  4RUF A;  4TV9 B;  4R8U A;  1RM1 C;  3LP8 A;  3LWB A;  5DED A;  1EUC B;  2B63 G;  3S3X A;  4YY3 B;  2HVJ C;  3DTF A;  2XCA A;  1RJR A;  2GPW A;  3AK2 A;  4RAI A;  2W9B A;  2AQ4 A;  3V4S A;  4FM9 A;  3QVN A;  1NR7 A;  1R6N A;  2LGQ A;  1QNM A;  2LP7 A;  3IAY A;  3E2E A;  5LMN B;  2EIM B;  3KCX A;  2R8H A;  4EEQ A;  4DR4 B;  1QLE C;  4LF7 O;  4F4Y A;  2FLP A;  2A79 B;  5JJE B;  1EKF A;  4EBE A;  5C8Y B;  3HKC B;  5F9L A;  3L71 H;  3JD1 A;  5DG9 A;  1BS3 A;  3ZBH A;  3X2Q B;  2CTW A;  2JIZ G;  2X6C A;  5JQG B;  3RBD A;  3T9D A;  3CE2 A;  1V4Y A;  3ZHT A;  2PN1 A;  4FBT A;  4MTF A;  2LGW A;  4GKK H;  1XHZ A;  5IYZ F;  1GYF A;  1KKC A;  4K8Z A;  3RBE A;  4PJ0 Z;  4FFK A;  2YZG A;  4RB2 C;  3EYY A;  1Z2N X;  3TII A;  4ED2 A;  3T4D A;  4APM A;  4DR3 O;  4XX0 B;  4FFL A;  4WFG A;  1XNR H;  4I0X A;  2HLD G;  3JD0 A;  4X1K B;  3GTJ A;  5J2U B;  4UV9 A;  3M9O B;  4I55 B;  1JKJ B;  2Z04 A;  2WE6 A;  2FE3 A;  4LF9 O;  2C28 A;  2UXD O;  2W6I G;  1R3I C;  3CRC A;  4YIP A;  3U0G A;  1HNZ B;  5BR8 H;  5DQH A;  2HR3 A;  3HB9 A;  4YP3 A;  2F1M A;  3CSX A;  4RU9 A;  2ATL A;  5KA6 A;  1YIJ V;  2BQR A;  1IBL B;  2JVD A;  2RJZ A;  4JI1 B;  1S0V A;  1NTZ H;  1VF5 B;  5JQW A;  1D2D A;  4JPR A;  2ZNI A;  4O7S A;  4MA5 A;  2IMW P;  2BE3 A;  5JH7 A;  4H0L B;  5BMV F;  4HNU A;  1RPR A;  2X6B A;  4J9O A;  2IBK A;  4LFB B;  3ABL C;  4Q8E A;  3AG2 C;  3OHA A;  3LSQ A;  1ROP A;  1I2L A;  3JRX A;  3E83 A;  4PV1 B;  1FJG O;  1VQM V;  3NBZ B;  2RDI A;  4AQY B;  1S5L Z;  4JTD B;  1IBL O;  3CMA V;  1I94 H;  3SYQ A;  4JI8 O;  3VQW A;  3W1G A;  5JVD F;  2ADP A;  3L9D A;  3LSU A;  5IYB O;  4BIO A;  4DV6 H;  2VPS A;  3ETH A;  1PL0 A;  5KT4 A;  3H1I H;  1Y76 B;  1WR2 A;  3JAW A;  4O3R A;  1ZWI C;  4YXW G;  4EG0 A;  4LWS A;  1XMQ H;  2UUA B;  5A2Q W;  3I56 V;  5LHH A;  5LYJ B;  1IYD A;  3ICX A;  4UB6 Z;  3NGD A;  1M57 B;  2DW4 A;  1TA8 A;  3N2G B;  3T5H A;  3M8A A;  1OCZ C;  3OMA B;  1SQX H;  4TVI A;  2Q6A A;  3WG7 B;  2FK3 A;  1B06 A;  4J9K A;  2VWJ A;  1UC8 A;  2R7Z A;  2HHF A;  3SDL A;  4GX2 A;  4DUZ B;  1K33 A;  4QE7 A;  3HOU G;  4JAV A;  4JI6 H;  4FLV A;  5HFM A;  3TXQ A;  4I9W A;  2JEX A;  2UXX A;  3CSW A;  4L1K A;  4BBR G;  5KA5 A;  2Q2U A;  3ASN B;  1I5X A;  2E74 B;  4JI6 B;  5KG2 A;  3O9O A;  5KFE A;  3MHH C;  2GUZ B;  2L6L A;  1Q43 A;  3HO8 A;  3HBL A;  3BA8 A;  4DL4 A;  3AG1 C;  5C1P A;  2YRW A;  2XND G;  2CNV A;  5CE8 A;  1Q82 W;  3ZHV A;  2AGP A;  3U9S A;  1KUQ A;  1G4Y B;  1R3J C;  4TV9 F;  5KFY A;  1XMQ B;  5IWA B;  1HR0 O;  2I80 A;  2GTS A;  3G6V A;  4DUZ H;  1I50 A;  5B1A B;  5BWT A;  5KG5 A;  5KFR A;  2WLI B;  4K0K B;  3NBY B;  3AG3 C;  1RP3 B;  4JAA A;  3HT5 A;  1YVW A;  2DWE C;  4AQY H;  4YR2 A;  2F93 B;  3N43 B;  2M6Y A;  1XMQ O;  2O03 A;  4KHP O;  3BAA A;  2PY5 A;  3CVZ A;  3GQC A;  3R5F A;  5DN6 G;  3WB1 A;  1VF7 A;  4I9Q A;  4MTE A;  4G27 B;  1L1F A;  2FYU H;  4FS2 A;  2CFM A;  5LHG A;  2QTS A;  3HKE A;  4X1K A;  2XD4 A;  5KT3 A;  4JV0 A;  1M57 C;  2R7N A;  4UCV A;  4HNA A;  1JLL B;  4X64 O;  3SYA A;  1F51 A;  3K57 A;  4FFB A;  5I60 A;  1RSO A;  1FVI A;  5KFJ A;  3BQ0 A;  1HNZ H;  2X0L A;  4FM1 A;  3TJT A;  1NTK H;  1ZTE A;  5FLX N;  4EQ5 A;  3KHH A;  4EBD A;  4I7H A;  1YJW V;  5B1B B;  5KT2 A;  3RUP A;  1SZX A;  3GTP A;  4O7T A;  2Y48 A;  3SPJ A;  3TIG A;  3MHS C;  5C1O A;  4IRD A; 
#chains in the Genus database with same CATH homology
 1FJG B;  2BTO A;  3PN1 A;  3KXY T;  3QF7 A;  4KL1 A;  4OX9 H;  5CA0 B;  4CH5 A;  4DUY B;  5IYZ B;  2CW8 A;  4X65 H;  5D1O A;  4B3T H;  1JMK C;  1KU9 A;  4X1I B;  4ZHQ A;  3L4J A;  3SJA C;  4DV0 H;  3T1Y H;  4LH7 A;  2CW7 A;  3BAB A;  1M93 A;  4PI2 A;  1IBK B;  4X66 H;  4LF6 B;  3KYH C;  3N44 B;  4BW9 A;  2VQE H;  1ZHS A;  5D1O B;  5CA0 A;  5LP6 B;  1P16 A;  5LXT B;  5J2T B;  3RYF B;  3TY8 A;  2HGS A;  2Q7H A;  5K1X A;  3BHP A;  3TY9 A;  3ZED A;  4D7S A;  2PYL A;  4E6N A;  2PUS A;  3K5N A;  2Q2T A;  4IAJ A;  4TV8 B;  5LP6 A;  5BMV B;  4MV9 A;  2UXB B;  1SKV A;  3M4I A;  4DV1 B;  2KKW A;  4JI4 B;  3IG0 A;  4YY3 H;  4DR2 H;  3BPZ A;  5IJ9 A;  3TY5 A;  3N41 B;  1CKO A;  1FKA H;  4Q6G A;  4DR4 H;  4HNA B;  4DR2 B;  4A2B A;  2HEP A;  1D5A A;  2E5L B;  4TV8 A;  5D5Q A;  3HKD B;  4DV0 B;  4O2B A;  4K8X A;  4IHJ A;  4LNU B;  4DUY H;  1QHT A;  3W1B A;  1CKM A;  3SGI A;  1HR0 B;  3T1H B;  4FLT A;  3JAR A;  2YXL A;  3VQX A;  3VQY A;  1N33 H;  4LNU A;  4UCO A;  1CKN B;  4PHZ A;  3DF7 A;  3HKD A;  4RB0 A;  2UUC B;  4NXN B;  4EFE A;  5LOV B;  1MZB A;  5LMU H;  4EB6 B;  2R70 A;  4X1I A;  4ZHQ B;  4YJ3 A;  2HVS A;  4UCR A;  2KSW A;  2F4V H;  4O4H A;  3J81 W;  4OX9 B;  2VQF H;  4GLX A;  2VOB A;  3RGX A;  4LF8 H;  2HIV A;  4JI5 B;  4GYC B;  1G6U A;  4ZOL A;  3SR2 C;  3JSN A;  2WDT A;  3K3V A;  3E22 A;  4DR5 B;  3UT5 B;  5EIB C;  3K5O A;  4JI7 H;  1I6U A;  3U11 A;  4LF4 B;  1XNQ B;  1E4F T;  1BGW A;  5FD5 A;  1O9G A;  4IIJ A;  4X64 B;  1ZAU A;  2GV9 A;  4RZQ A;  1SQF A;  2YCH A;  2UXD H;  1X4T A;  4I4T B;  2IM9 A;  3QTC A;  1XI1 A;  1VS0 A;  3SJB C;  3RGZ A;  4L8J A;  4LR3 A;  3VNN A;  1M5I A;  1HNW B;  4CS4 A;  2XHB A;  4K0K H;  4B3M B;  5KHH A;  4O4I B;  4TQF A;  4KHP H;  1N32 B;  1AN7 A;  4FLW A;  4TUY B;  2EX3 A;  1Q5O A;  4DRF A;  5LL6 b;  1WH2 A;  4DR1 H;  3ETQ A;  1M0T A;  2VWK A;  2VUG A;  1FFX B;  1Q3E A;  4YJ2 A;  5FPO A;  3FMA A;  4BWS C;  3JAW B;  4RB3 C;  5CB4 A;  3OTF A;  4LFA H;  1N36 H;  3E22 B;  3OTO B;  4DV7 H;  2ZIM A;  5KX5 B;  5IWA H;  4DV3 B;  3QG5 A;  3RFR A;  2YI8 A;  3N6X A;  5KHI A;  4YHH H;  1JFF A;  3J7A K;  2RQ6 A;  3VQV A;  2E3C A;  1SEI A;  1SA0 A;  4O2A A;  4DV7 B;  3OTO H;  1N36 B;  2Q7G A;  4I4T A;  3RR5 A;  3JAK B;  4U3J A;  3THO A;  1L2Z A;  5JJN B;  2BTQ B;  4YHH B;  5CA1 A;  1WPB A;  4X1Y B;  4FM0 A;  1B04 A;  1Z5W A;  4CS2 A;  4TOI A;  1XMO B;  1WNS A;  1N32 H;  1ZHQ A;  2BTQ A;  2Q7E A;  3HKB A;  3S24 A;  1Z2O X;  4DRX A;  4B3M H;  2UU9 H;  5FPR A;  3CHX A;  2F66 C;  3KAK A;  4TQD A;  1HNX H;  3RWR D;  4F6R A;  1I94 B;  4DR1 B;  3JAM W;  5ITZ B;  4MTD A;  1Z2P X;  4EFB A;  4LFC B;  4CC6 A;  2UXD B;  3BA9 A;  1XDN A;  2HVR A;  3GJX B;  1YEW A;  5IJ0 A;  2UUA H;  2QM4 A;  3K58 A;  1V9P A;  4X64 H;  1X9N A;  2W57 A;  4LFB H;  4DV4 B;  4F6R B;  4LF4 H;  4X20 B;  3FFQ A;  5FD6 A;  5ITZ A;  4JI7 B;  4FVM A;  4IIJ B;  4O4L A;  4DR5 H;  4JI1 H;  5JVD B;  4DV6 B;  1CKN A;  1FFX A;  2HHH B;  4BWA A;  3JAS A;  4X62 H;  2OYQ A;  5LXT A;  4UFZ A;  4WBN A;  2ZNJ A;  4DK1 A;  1Q8I A;  5CA1 B;  2VQF B;  3L2P A;  4RB1 A;  2UXC B;  2RGR A;  2JGU A;  5J2T A;  4PZ7 A;  3RTX A;  4FLU A;  3DSQ A;  1S03 G;  4O4J A;  4DV5 H;  4UCT A;  3N40 P;  3QWU A;  4O2A B;  4O4I A;  4B3R B;  4RAZ A;  5IYZ A;  5JH7 B;  1IBL H;  4NVP A;  4PZ8 A;  1XNR B;  2ZCE A;  5JJJ B;  4LSA A;  1HR0 H;  5FLX W;  4DR6 H;  5IT9 W;  5BR8 B;  2YIB D;  1QQC A;  4I50 A;  3A2F A;  4GKK B;  3MAQ A;  5DIS C;  1XHX A;  5LMU B;  5CB4 B;  4NXN H;  3RJ0 A;  2OWO A;  4PDB A;  1T5E A;  2UUC H;  3H20 A;  2E5L H;  1TUB A;  2HIX A;  4ZIB A;  1J5E H;  1N33 B;  1S68 A;  4I50 B;  4TV9 B;  3UT5 A;  4R7R A;  3T1H H;  4DK0 A;  1SA0 B;  5KHJ A;  4NXM B;  1JFF B;  5GON B;  4YY3 B;  4JI4 H;  4DV2 B;  5LMN H;  2YIB A;  1TAE A;  5LOV A;  3N2K A;  3KAL A;  1O9H A;  1N34 H;  3M7M X;  4FM9 A;  2PTM A;  4YJ3 B;  5EYP A;  1Z5V A;  3RYC A;  2JS5 A;  4FLX A;  3RF2 A;  3KAJ A;  3RYI A;  3IAY A;  5LMN B;  4EEQ A;  4DR4 B;  4NXM H;  1XQ8 A;  3HKB B;  5KX5 A;  4O4L B;  5JJE B;  2Q0A A;  5C8Y B;  3HKC B;  3JAS B;  4FLZ A;  1O75 A;  2VQE B;  4DV1 H;  1H2S B;  1J5E B;  4LF6 H;  2UXB H;  4X66 B;  4ZOL B;  1XK5 A;  2V4D A;  1IBK H;  2PGG A;  4CS3 A;  5JQG B;  3BRC A;  2R72 A;  5KMG B;  3JAK A;  5J2U A;  1N34 B;  4TUY A;  4I55 A;  3T1Y B;  2XIG A;  4GKK H;  1HW7 A;  1XHZ A;  1GYF A;  4B3T B;  4K8Z A;  4DV2 H;  4RB2 C;  3EYY A;  1Z2N X;  4CH4 A;  4EB6 A;  4O4H B;  1FJG H;  4APM A;  5EIB D;  1XNR H;  5FNV B;  1DGS A;  3JAL A;  4X1K B;  4B3R H;  5J2U B;  4M7E A;  4I55 B;  4CH3 A;  2RGV A;  2WE6 A;  2FE3 A;  3MWM A;  3JAT A;  5LYJ A;  4X65 B;  3HXL A;  5EZY B;  1HNZ B;  4LF5 H;  5BR8 H;  3JAR B;  3F8N A;  4ETS A;  2F1M A;  1TVK B;  3CSX A;  3GDE A;  4X62 B;  4DR6 B;  4JYA H;  1BJT A;  2HHH H;  3CB2 A;  1E4G T;  1IBL B;  2JVD A;  2RJZ A;  3W5O A;  4JI1 B;  4LF9 B;  2ZNI A;  4ZI7 B;  4DV5 B;  5JCO A;  5D1P A;  5JH7 A;  4AHC A;  4LFB B;  2UUB B;  2UXC H;  3UQ8 A;  1TGO A;  3N2K B;  3B2E E;  3L4K A;  2R9A A;  4AIL C;  4DR7 B;  3NBZ B;  4LFC H;  4AQY B;  2ZJT A;  4GKJ B;  4FM2 A;  1I94 H;  1TUB B;  3VQW A;  4WBN B;  4B3S B;  3W1G A;  4DV6 H;  2VPS A;  3HKC A;  5K1P A;  4YJ2 B;  2HVQ A;  3NC0 B;  4JI2 H;  3SJC C;  4Q0Y A;  2ZIN A;  3JAW A;  5EOY A;  4JI3 H;  4X20 A;  1I7F A;  4X1Y A;  3K5L A;  4DV4 H;  1XMQ H;  3RYF A;  2UUA B;  2WYO A;  5A2Q W;  3LNN A;  3RGB A;  4D7T A;  5LYJ B;  3GB8 B;  4DR3 H;  3RIZ A;  3ICX A;  4LF7 H;  2PYJ A;  4JI8 B;  1TA8 A;  3N2G B;  3ZS8 C;  1HNX B;  1SYX B;  1KMI Z;  5FNV A;  2UU9 B;  2VWJ A;  4HBN A;  2MCT A;  4DUZ B;  4JI6 H;  4FLV A;  4LSX A;  1SQG A;  3J80 W;  1XMO H;  2ZM6 H;  1M4U A;  2Q2U A;  2F95 B;  5C8Y A;  2YI9 A;  4TV9 A;  1IBM H;  5EZY A;  4JI6 B;  4JI0 B;  3JAT B;  1TVK A;  4JV5 H;  3K59 A;  1Q43 A;  3BA8 A;  4IHJ B;  3RYC B;  4JV5 B;  4A2A A;  4JI0 H;  1M0W A;  1IBM B;  4LF7 B;  1P8L A;  4MV7 A;  1S5J A;  5LP6 C;  3RYI B;  2ZM6 B;  4ZI7 A;  4DV3 H;  1L8D A;  4CH6 A;  1XMQ B;  4B08 A;  5KHK A;  5IWA B;  4O4J B;  4KHP B;  4DUZ H;  5IJ9 B;  2YIA A;  4JI3 B;  2P5O A;  4K0K B;  4LFA B;  3NBY B;  5KHG A;  2QJ1 A;  3RYH A;  4FLY A;  5LA6 B;  3U0Z A;  4GKJ H;  4AQY H;  4JI8 H;  2F93 B;  4O2B B;  4DR3 B;  3U10 A;  3N43 B;  5JVD A;  2O03 A;  3BAA A;  2PY5 A;  3CVZ A;  4RAY A;  4FFB B;  3WB1 A;  3C0F B;  1VF7 A;  4LH6 A;  3RYH B;  4I9Q A;  5EYP B;  5JCO C;  1A0I A;  5LA6 A;  4MTE A;  1XNQ H;  3N42 B;  4U3J B;  4JI2 B;  2CFM A;  4UCS A;  3WB2 A;  1HNW H;  3HKE A;  4PZ6 A;  3N2G A;  3JAL B;  4X1K A;  4B3S H;  4JI5 H;  4UCV A;  4HNA A;  3WB0 A;  4JYA B;  4CC5 A;  5D5P A;  5IJ0 B;  2ZIO A;  5GON A;  4LF8 B;  4DR7 H;  1NT2 B;  3K57 A;  4FFB A;  1RSO A;  4LF5 B;  1FVI A;  1HNZ H;  3HKE B;  2F4V B;  5JQG A;  5KMG A;  4FM1 A;  2UUB H;  4EQ5 A;  4PI0 A;  4UCU A;  3K5M A;  4J0M A;  5BMV A;  3LML A;  4I7H A;  4DRX B;  4LF9 H;  2P22 C;  2CAZ C;  3JSL A;  1P49 A;  4LMY A;  1JJO A;  1WN7 A;  2PZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...