3BA8A

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba8A02
4UFZA 1ZAUA 4CC5A 4LF6B 2HHHB 2UUBB 4NXNB 4DUYB 4LF7B 4DR6B 1IBKB 3VNNA 4DV1B 3OTOB 1XNQB 4KHPB 4X62B 5FPRA 1P8LA 1IBLB 4GKKB 1XNRB 4CC6A 2UXDB 3TY9A 5DISC 1DGSA 4JI0B 2Q2TA 4LF4B 4UCTA 2OWOA 4JI2B 1N32B 1HNWB 5D1PA 3PN1A 1B04A 1N33B 3JSLA 4LFAB 1CKMA 2HIVA 5D1OB 1J5EB 4X66B 1FVIA 3NBZB 4DR7B 1P16A 4DV6B 4DV3B 1VS0A 4DUZB 1CKNB 4B3TB 4NXMB 2UU9B 4PZ7A 4EEQA 4TOIA 2ZM6B 4DV4B 4JI8B 5LMUB 4DV2B 3T1YB 3GJXB 3BABA 1TAEA 2HVQA 2VUGA 3GDEA 3GB8B 3SGIA 4B3RB 4B3SB 4UCOA 4LF9B 4YHHB 1N34B 5LMNB 4JI4B 3W1BA 4LFCB 4UCSA 3S24A 1V9PA 3T1HB 4E6NA 4JI3B 4X65B 4LH7A 4UCUA 2F4VB 2UUCB 4PZ8A 1TA8A 4LF5B 4LF8B 4EFEA 4DR2B 4GKJB 1X9NA 4AQYB 4JV5B 2HIXA 4LFBB 3L2PA 3KYHC 3TY5A 2UXCB 3UQ8A 2HVSA 4DV0B 4DV5B 4LH6A 1CKOA 1XMQB 1XDNA 4GLXA 1XK5A 4EQ5A 2Q2UA 4K0KB 2UXBB 1A0IA 5D1OA 3RTXA 1S68A 1HNXB 4UCVA 3BA8A 4JI7B 1IBMB 1CKNA 3JSNA 4UCRA 4DR1B 4JI6B 4JI5B 2E5LB 1XMOB 2VQFB 3QWUA 4X64B 2CFMA 5FPOA 2HVRA 4YY3B 4DR5B 4DRFA 5BR8B 5IWAB 3BA9A 1N36B 3BAAA 4DR3B 3NBYB 3TY8A 1HNZB 3W5OA 2VQEB 4DR4B 1HR0B 4JYAB 2UUAB 3RR5A 4EFBA 1FJGB 4PZ6A 1I94B 4B3MB 4JI1B 3NC0B 3W1GA 4DV7B 4OX9B
chains in the Genus database with same CATH superfamily
1JPXA 5FNVB 2W9CB 2WA3A 2COGA 4NXNB 4O7ZA 2W0FC 1A9XA 1FYJA 3MFIA 3L4KA 2CNVA 3RJ0A 5DN6G 2WYOA 4X65H 2YI9A 2COJA 1AI6A 3CMEV 2UXBO 5DISC 5I5UA 1K3EA 2ZE6A 1JA8A 4UCTA 2OWOA 3IN5A 2PMZE 1Z2PX 4JI7O 1JLLB 1CKMA 2JEUA 2XCPA 3ASNB 4I9QA 1EZJA 1UC8A 3K5IA 2R86A 1NTZH 3CCJV 5KFVA 3QFFA 1QLEB 2W70A 4RNNA 1IOVA 2UXBH 5BR8O 4HR7A 3L70H 4MA5A 3GDEA 1CP9A 2ZT9B 5BPHA 4O7VA 2MCTA 3N41B 1ZHSA 2K9PA 1M5IA 1WA8A 2ZDHA 1KEEA 5B1NA 4JGSA 1KTAA 3SYQA 4UUJC 4CH5A 2B63A 4BIOA 1AP5A 3FAVB 3RV4A 2YS6A 4I50B 1SERA 4YAKB 3HOXG 2UUBO 5KHHA 2DJVA 4CS4A 3MJFA 3MD0A 5F2VO 3ORRA 5I5YA 4E4EA 1S97A 1PNLA 2EIKB 1IBLO 4Z1VA 4B7EA 2CKZB 5C8YF 3SPJA 2UXDO 4GCZA 5BPFA 3RYCB 3UQ8A 3OGCC 3ZJZA 4FLXA 3CEBA 1M90W 4N23A 1FS0G 2ADQB 4DYLA 1J5EO 2UUBH 2E76B 2WE6A 2HLDG 2Q9LA 2WA4A 5BYAA 5KKNB 1Q90D 3RTXA 1S68A 1UJWB 1IBLH 3V4SA 3GIIA 2FP4B 1KJIA 4F4YA 3I4MG 2UXDH 5LMUO 3SPHA 1OCOB 1V4YA 4A2AA 1UC9A 3WB2A 5J9PC 2EIJC 3SE7A 2B5UA 3RFCA 3J7AK 4YIPA 3RVYA 2YEVA 3VQWA 4YBZB 4FK5C 1L1FA 3OMAB 5F9NA 2R7ZG 4CKEA 5IYDG 4YJ2F 1IDSA 3T4ZA 5LMUH 3RR5A 5BWUA 2XUMA 4O4IB 4R7RA 1N0NA 2JEFA 1SZXA 3GIDA 2OCCB 3OM3B 1IURA 4F4ZA 5JWPA 2BSKB 4JUZA 5BWWA 3T5HA 2R8JA 2UXCO 5KG5A 3UT5B 1ULZA 1B3QA 2JS5A 3OTOB 1PNKA 4EG0A 1L8DA 5ITZA 1YZBA 4AHCA 4GKKB 5CR5A 1GM9A 4CC6A 1VQKV 4JI0B 2GLTA 1S03G 2PI5A 4LR3A 5L3BA 2VQFH 3K5HA 4XYLB 2A3QA 3PN1A 4O2AA 4A93G 2UXCH 1OWTA 5EZYF 4FFPA 5KFLA 3GILA 2RDIA 2JA5G 2P67A 1P7GA 5BWTA 1TUBB 4B3TB 2JGUA 3G4SV 3E22A 2QM4A 3HKEB 4PZ7A 4PA3A 1KP2A 5LXTF 5IWAO 4EKWA 2QF7A 3N2KA 1YJWV 4A3KG 3RAXA 1DF4A 4O4HB 4UUGA 2EIMC 4DR4O 2V4QA 1KBLA 3KHGA 1VEWA 1I94O 1UFIA 5I5WA 1K34A 4YXWG 5IWAH 4NXNO 2WDTA 2F4VB 2V59A 4TUYB 5F9LA 3JASA 1US6A 2JA7A 1TA8A 5IP9G 3QZ8A 1FXVA 3ZRSA 2BQUA 4DR4H 1N32H 2V7QG 4HZ3A 5BYBA 1RPRA 1JR9A 4TSFG 4IT5A 3KYHC 5GONB 3H20A 1I94H 4J9SA 2Q7HA 1B33N 2GDSA 4QIWE 4NXNH 5DG7A 4ZHQB 3DXRA 3MR6A 1N56A 4JAUA 2YIDA 5LBQA 2Y0SA 5CBFA 3ZHSA 3CRMA 4HAMA 2DWDC 4RZRA 4I9WA 5KFDA 2NU7B 4ECRA 3GIJA 1QQCA 3GIQA 5EZYB 1SA0B 2C2EA 2YIAA 5C1OA 3H0GA 1S0MA 2M6YA 2P90A 3CMAV 3HO8A 2HGWA 1FAFA 1AUVA 3OSNA 4Q4DA 1FXKB 2NLJC 1NH2D 2WB1A 1I1LA 2KB1A 1U96A 3H1KH 4YB8B 2QA4V 4WD3A 1FD9A 4B3MB 1NR7A 4IR1A 5KFZA 1BNCA 3CP1A 1EYZA 2A06H 4TT3G 2AGOA 4ME6A 3RBDA 1M1KW 5EBWC 5J2UB 2R85A 1GKFA 1H2SB 4JPRA 4D6TH 4DO2A 1XNRB 5K1XA 2R72A 4BW5A 1Y1VA 1ZETA 4O3OA 5L1KA 3IC9A 1GO3F 3LWBA 4IL6Z 5EWGA 1PP9H 1RK6A 1G1XB 1UNNC 1D2DA 3OD4A 4IHJB 4KP4A 4YY3H 1XILA 3VA7A 4RNOA 3T1CA 4Q8FA 5L1JA 1VS0A 2BTOA 3T9EA 4MVZA 1H2MA 1RM1C 2YDEA 2Z5UA 2QE7G 1WAZA 4DV4B 4JV0A 3CSWA 4UB8Z 5I5VA 4FZ1A 2ODTX 3GJXB 4X89A 3JAWB 1VQ6V 2R8IA 2YZGA 3CCQV 2XASA 4ASUG 5J2TB 4EEYA 4IZOA 3TIGA 3UO2A 4TV9A 2VPQA 1N34B 1TWFA 4EBCA 1KC8W 3N2GB 3TCUA 1DV1A 3STLC 1S5HC 1RP3B 2COIA 3HOUG 3SYOA 1PD3A 3ZRVA 1QR8A 3TJTA 3BRCA 1EFRG 1WRVA 2XCLA 3U11A 2R84A 3VPBA 2Q5ZA 3H1IH 4J41A 5IYZA 3Q8RB 3Q8PB 4I7HA 3OTOO 4BWSC 3OHBA 4GKKO 4JV2A 1WN7A 4MTFA 4LFAH 5JVLA 2HIXA 4P30A 5IP7G 3PW4A 4JI0O 4RB3C 1AJPA 1I6UA 1M56C 5EOYA 3CCLV 3TQ1A 1AR4A 1XMQB 1N8RW 4FFKA 3DC6A 4ZKIA 1W2BU 2FB5A 4JI8H 3CEIA 4MV8A 1P4RA 3C0FB 5D1OA 3OTOH 4X1KA 2NR5A 4B3TO 4PDBA 4B7KA 4QWDA 3CJHA 1CKNA 3JSNA 1Q6UA 3TEKA 2B1GA 5LMNH 5DLFA 4JI0H 1SESA 1SS3A 3UM7A 3BEHA 3MR5A 1XMOB 4IRCA 2DAAA 3M7MX 4PA4A 2F93B 3ZMTA 1M4UA 2UVVA 4EBDA 4FBTA 5JJNB 1ZLZA 4B3TH 1WA8B 1ZWIC 2HP8A 4R6ZA 4O2BA 2UUAB 2N04A 2ZCEA 2F4VO 4HN2A 1E4FT 4E4TA 1Q5OA 4G27B 2ZDIC 3MWEA 3RAQA 3TQTA 3JD2A 5B1BB 3U0ZA 4LF6B 2AW9A 3R9RA 4MVMA 4HYKA 3JAMN 3BG5A 3ETQA 1HP8A 4QJFA 3BQ0A 3DSQA 3B40A 4C5CA 3ETGA 3K9SA 2W6OA 4O2AF 4FVMA 1QHTA 2YC0A 4GX5A 5EWFA 4MSWC 3AK1A 2YZMA 3GV8B 3ABMB 1XBLA 2RF4A 5GW7A 2JK5C 2M05A 3T9DA 4DR3H 1SYXB 5DECA 3JALA 4I50A 4Z1MG 1XHZA 5BXZA 3LMLA 4MTXA 1KQSU 5IYCO 3WFVA 4NLGA 4TOIA 2WLKA 3RIZA 4I55B 4RUCA 4W4KA 3CD6V 3WWHA 1Y74A 1T5EA 1I7NA 2VUGA 1AI7A 2YI8A 4ECVA 3RB0A 3T5LA 2R92G 4RAIA 3OHAA 1XEQA 1SKVA 2YEVB 3AK3A 4B3MO 2E2HA 1N0JA 1ZTEA 2XNDG 2GHYA 4BR6A 4I5SA 4JI3B 2FPGB 4FM9A 1CXZB 5L3EA 1C30A 1COWG 2Y0SE 2G38A 2MW2B 3K79A 5DG9A 1NTMH 1GK9A 1YCIA 2EX3A 4QSHA 2IBKA 2Q6AA 1XNRO 3Q8QB 3FB7C 1TUEB 4PJ0Z 4JAVA 4LH6A 4WBNA 4X1IA 3VOTA 1XDNA 3W7UA 2FYUH 2PYLA 2Y0PA 1XL4A 3HB3B 4Q0YA 1AB3A 1KKCA 1JQ0A 4Q20A 4J9NA 4UCVA 3UZOA 2JIZG 4HYOA 1I1KA 5KFHA 2XAHA 1IBMB 4DV4O 2BOBC 4JI4H 2F95B 3LNMB 3AW8A 1XI1A 2ZIMA 4DL4A 2ZKOA 2X0LA 2Z3YA 1H8HG 3N2KB 2D3OW 3ABKC 1GM7A 4PD4F 1N34O 3J80W 4CMFA 4FM2A 3TY8A 3H1JH 2V4RA 2LP7A 2W6JG 2P0AA 4O4JF 4JV1A 4EB6A 3OUZA 4GYCB 5EWEA 4MTDA 1DLBA 4DV4H 4AQYH 3LDEA 2QYZA 5FR9A 4P9PA 1BXRA 3FYEB 3VMMA 4A5UB 5E25A 3K57A 1K5SA 3QVNA 3QZ7A 5JCOA 3FMAA 4O7RA 4ECQA 1Z5WA 2QWNB 1T36A 3ZHUA 3JASB 1N34H 4PA7A 1OBGA 2GV9A 4LF7B 3RVZA 2Y48A 1XMQO 2Q8VA 3J80N 2OIEA 1JCHA 1S3JA 2ASJA 2Q2TA 4JI6H 4F4LA 2R7LA 2B9ZA 5KFPA 3JZFA 3DXRB 5JUMA 5CA0A 1YITV 2EJRA 3AG3B 1PPJH 5KFNA 2R9IA 5KFGA 2YXYA 1XMOO 1VBHA 5HNEA 3OR7C 1R3IC 1Y14B 1LUWA 2QR4A 2Q67A 3RYIA 5HV6A 3T5KA 5CB4F 1Y4MA 2F43G 4ED0A 1JKJB 3R23A 4A3DG 2R93G 4NZNA 3GWKC 3LQSA 4CBCA 3DTGA 2UUAO 4C2MA 2Z04A 1W0JG 1XMOH 4WHXA 4PDRA 2DZDA 4X62H 3GTQA 5A9GA 1ZSPA 4LBEC 4LF6O 3RGZA 5CMUA 2W71A 1JDEA 1A32A 4RCNA 5CN0A 4FLTA 2DPJA 2LGWA 4GUNA 3TETA 2XD4A 4RZQA 3RF2A 3H4BA 4GC7A 2XAJA 5DGBA 4LC1A 2A79B 2UUAH 4WCEV 3THOA 2Y4UA 3ZEDA 4YAJB 1VQNV 2FK1A 2H94A 3T4DA 2HVSA 3D8CA 3GQCA 1VQ9V 4BIUA 1NI8A 1OCRB 3AK2A 4GLXA 1XQ8A 4J9PA 3AEIA 5FNVF 1S76D 1WSCA 3A8TA 3OUFA 3RBEA 1Q3EA 5LYJA 2PF4E 1JJ2U 2FK2A 3FDSA 1K4DC 5IY5B 2EILB 2W6ZA 4YHHH 3RB3A 4DL6A 1S0NA 2E5LB 2VQFB 2PN1A 3OGIB 4Q43A 3ABTA 2LFSA 1AVMA 3OUUA 4KL1A 5J2UA 5KFTA 1WPXA 4UVCA 4O2BF 1PL0A 3B4SA 1PL4A 2XHBA 3X2QB 3ABLB 4FIPC 1GN4A 3LSSA 5KHKA 4TV9B 5L3GA 3CE2A 4JI3O 2ZDGA 2R7NA 3BHPA 4MS2A 3LULA 2YS8A 3ORQA 4LMYA 4FLWA 3G6EV 4DV7B 4R8UA 5FJ8G 1SQBH 4ECZA 5IYZB 3CC2V 4HNVA 3JATA 1BHBA 4YR3A 1P8LA 4JI3H 2V58A 2P5OA 1G8MA 2HDKA 3J7AU 3QO5A 5KG7A 4DR1H 4LCUC 1V54C 4I50F 3IAYA 4DAAA 2XGQA 4JI2B 1N32B 4X65O 3CHXA 3V6KA 1IBMO 4OXSA 1AP6A 5D1OB 4X66B 1I2LA 1WCMA 1N36H 3PVXA 5IYCG 3CJHB 1R3KC 1CKNB 2B1IA 2BE3A 4EEQA 1A48A 4FJCC 1S10A 2EJ2A 1DTOA 1TWAA 2GTSA 4O81A 4CH6A 4JI1H 3DTFA 4O7WA 1SQQH 2OTLV 1N4CA 4PI0A 4UCOA 3K03A 1IBMH 2X7RB 2CTQA 1QLEC 5KT4A 4J11A 3A0RA 3CQZA 1AUXA 3AG1B 1DK1A 4O2BB 1GMGA 1RFYA 4X1YA 3BQ1A 4RB2C 3G8CA 1R9TA 3AYHB 1HWYA 1EN5A 3SYAA 3PR4A 5LOVA 4LF7O 1O75A 4U7CA 2C00A 3EXAA 1XHXA 2A1HA 3KHLA 3F7VC 2C2DA 4K8XA 2VA3A 4J9OA 4LFBB 4QJFB 4ED2A 2HFEC 3K5LA 3K59A 4I4TA 1CKOA 4O4IF 2WLIA 2NVXA 1Q43A 3QO8A 3K58A 4F6EA 2ZM6H 3GTOA 3HKBA 4LF7H 1A0IA 2OCHA 2RGVA 4J7JA 1R3JC 4JASA 4A3EG 3GTKA 5DQHA 2DYSC 2L6LA 3JALB 1W0KG 3LUTB 3RFRA 1MSWD 4UCRA 2CGOA 2XCAA 2W9AA 2QTSA 1OCCC 3QWUA 5DGAA 4X64B 4R8CA 5IJ0A 4ZIBA 1Y74B 2HGXA 4QPKA 4YY3B 5JQWA 3GWOA 4DIMA 2ZQMA 5KFRA 1AR5A 2YICA 3FD9A 5KT5A 2UUCH 3GVMA 1WPBA 2Q4PA 4EBEA 1VF5B 4GLWA 4FMTA 3ZRXA 3H40A 3F7YC 3LSQA 4DK1A 4MVUA 1VQ5V 2EZOA 3ABUA 3N27A 2XTAA 1AN7A 1JXLA 1I5YA 2WAMA 3O65A 4R50A 1NZ6A 1QVGU 4O4HF 1WH2A 1VF6C 3NXSA 4NVPA 4CKBA 2VPSA 1IXMA 1I50A 2Y4TA 4I55A 5DAAA 1KJQA 1GLVA 1XOUA 1GSHA 5KFAA 2ZDIA 4LNUA 3R5FA 2ODMA 1WP7A 5DG8A 4WBNB 3ML0A 4X1IB 4MV7A 2JEXA 2FE3A 4QWBA 4NR1A 2Z0AA 3T99A 1KU9A 2ZNJA 4TUYF 1Z2OX 1HNWB 2CH7A 2DYRC 2WPDG 3ZMZA 2Q7DA 4LFAB 4GC6A 2N05A 2QEXV 2FB9A 3N8DA 5KT7A 4TQDA 2E5LO 5GONF 2VQFO 4MVSA 5BMVA 5CA1A 3M9MB 1YEWA 4P2ZA 5LP6A 4ZQIA 4JI8B 3A2FA 3E35A 3H3VH 1TAEA 1Q81W 1QCEA 2CAZC 4ZHQF 4PDLA 4MVOA 2CTWA 2CTRA 2B63G 4IRDA 5LMNB 2HHHH 4EB6B 2E5LH 2DOSA 3OT7A 3K9AA 4DV7O 5I60A 2XGPA 2EIJB 4E6NA 5A2QW 2K1EA 2F1MA 2DLNA 4LH7A 4J7KA 1F4MA 3LNNA 2DMXA 5JQGA 3MWMA 1B06A 3GTJA 1SQVH 2BCCH 3ZMUA 1JDBB 4FM1A 1X9NA 5KFQA 1N33H 5KFBA 4OPHA 2ZE8A 5KAFZ 3JAKA 3CCRV 3L2PA 4BBRG 2ZINA 2J9GA 4DV7H 1VQ7V 4JI2O 1N32O 4NXMH 2DW4A 2UVWA 3AG2C 2DIKA 4X66O 3WWJA 4DV2H 1VARA 1K1SA 1KB9F 1PV0A 5CA0B 2JDIG 2ZE5A 5A2QN 4EGQA 3WO1A 4NYEA 3PO2G 2FK3A 2IJIA 5J2UF 1K73W 5KUMA 2WAQE 4PI2A 2Y4RA 4JI2H 2WLMA 2IMWP 3GIPA 4O3SA 3RYIB 2YSUB 2YU9A 1C3OA 5C1PA 4X66H 3OMIB 3GLKA 3RWRD 5HFLA 3KTMA 4IHJF 5KFYA 3BAAA 4DR3B 2PYJA 1VP7A 3S3XA 1V55C 5DM6V 5HBRB 4MT8A 4NTYA 4U3FH 2JJ2G 2ZXWB 3GB7C 3AG7A 2EIMB 3NC0B 3JCZA 4OX9B 3UYYA 5HFMA 5L9XA 3E8FA 4ECWA 4QIWF 2AHYA 1NJIW 5J2TF 4LFBO 2GPWA 3HKDA 2FLNA 4DQNA 3VNNA 5FLXN 3SYCA 4YJ3A 3KALA 2W6MA 2H8PC 5BWVA 2YUAA 5IYBO 3UZBA 5BWRA 2W8LA 2UXXA 1GAXA 2EINB 3MDSA 1DGSA 3ZHQA 1AILA 3B8NA 3J81N 3OTFA 4DK0A 3PW7A 2EULA 3CCUV 2ASLA 4BW9A 3ZHVA 4ZI7A 3RYFB 5KHJA 1KP3A 2AU0A 4LFBH 3JSLA 1JVMA 2LW1A 5LYJB 4ED1A 3O9OA 4XYMB 1HNZH 3MR2A 4K35A 1P7BA 4X64O 2ZNIA 4FFNA 1YIJV 5L1LA 2I87A 4YY3O 4MV9A 5LHHA 3U0GA 2YZLA 2WLLA 5DMXA 4TQSA 4CH3A 4HNTA 4ECTA 1BGYH 5JH7B 3ZRWB 4FFRA 1KBHA 4O7TA 3FB5C 2QKAA 2LJ2A 4J0MA 3B2EE 4X8AA 2IJHA 4LF9B 1Q82W 4JI4B 5LOVF 4X64H 2A9HA 2JA7G 4ICGA 4J9MA 2JA6A 2VA2A 2HJFC 1S5LZ 3VQXA 2H3OA 3IGAC 4ECYA 4R8UB 2R8KA 1SQXH 4I4TF 4MTGA 2YZNA 4NZMA 1MZBA 4H0LB 3JATB 4YP3A 4AQYB 3K08A 3HB9A 3E8GA 3M8AA 3V4ZA 1K4CC 4DLKA 3ZN1A 5C5JA 2ZDQA 4WFHA 2GQSA 3APQA 3ZMSA 1HNWO 4LFAO 1K8AW 4O4LA 4BIZA 1RSOA 3A0HZ 1N48A 1MA1A 3BA8A 3JYCA 5LA6A 1ZQ7A 5EDWA 4J9QA 3K04A 4JTCB 3H0GG 4JI8O 5FD5A 1BE3H 4Q4CA 3AG4C 4L87A 3EYYA 1Y1WA 2YIBA 4JI6B 3FB8C 4DL3A 1GGOA 1HNWH 2GBOA 3QF7A 4DRXB 3BFRA 3UCSC 4WFBV 4RUEA 5EBMC 2Z02A 1WJZA 2P6JA 3TK1A 2CK3G 5LMNO 4DR5B 1H2NA 4W4LA 1VKZA 2IP4A 4UV9A 3W5OA 2OTJV 2C2RA 2Q7EA 4N21A 1TVKA 4JYAB 1IYDA 5KFKA 2FLLA 3K0DA 5H5NA 5KFUA 5BY1A 4X1YB 3HR0A 4I55F 3W1GA 3HOVG 4KXRA 5JVDA 1VQMV 2ABJA 4TQFA 3RGXA 5LOVB 5DQGA 4RWUA 1VQPV 3QO7A 1Y1VG 3U54A 2RMKB 4MW8A 3JAMW 4WFEA 3RT3C 4X62B 5FPRA 2JVDA 2AZ0A 4TWKA 2O03A 1RPOA 4I4TB 2WLIB 1Q86W 4JI5H 2VOBA 4FFBA 1W59A 3R5XA 3MFHA 5T14A 1YSCA 3GV5B 5BMVF 3RBZA 1ORQC 3HKBB 4BY7G 2NN4A 1R6NA 4K6NA 2P4KA 5LP6F 1FVIA 1URFA 1EN4A 3E8BA 2XIGA 2AHZA 1P16A 1KT8A 3ZBHA 1IZ3A 4AYBE 2NNUA 1NKDA 1EUCB 4KUMA 3CC7V 1Q6HA 3NUAA 4DR3O 1SQFA 5IJ0B 3KAKA 3RV3A 4J42A 3ZN0A 2HJDA 3SGIA 3RB6A 4FFOA 3CRRA 3VBBA 4MTEA 4YHHB 2DN9A 1NH2B 4A3IG 4ABMA 1EKFA 2EIYA 4LFCB 5JQGF 3OMNB 3ZHTA 4OX9O 3V6HA 5EYPA 3B8MA 1U97A 1SCUB 4ZOLA 1EN6A 3FB6C 3QG5A 3OR6C 3FKIA 2XAGA 5KG6A 2W6NA 2FL4A 4H13B 1SC5B 4LNUB 4BBSG 3CYOA 3TW6A 4OX9H 2OYQA 3P30A 5LHIA 4HBNA 2W9BA 4DW0A 4K0KB 3B77A 4PA9A 1AI4A 2CH7B 3CWBH 3E8HA 4XDJA 4RAYA 3I4NG 2YCHA 3MHHC 3F8NA 5BMVB 5CA1B 4DR1B 2YXHA 4J10A 5LP6B 2CFMA 4CKCA 1IVSA 3ETHA 5IE9A 4LF9O 2AZ2A 4JI4O 3I56V 2VQDA 1RJRA 2FMAA 2KKWA 1N36B 4L8JA 4H44B 1GM8A 4FS1A 3RGBA 2VQEB 4UVBA 5LL6b 3KHHA 4ED6A 4DR2H 4GKJH 4RO2A 4YIOA 4PV1B 3BY6A 4G2KA 1BZKA 4JI1B 2PZSA 2IBZH 5KFSA 3MR3A 3LDDA 3PJSK 5IJ9B 3L9DA 4LF9H 4AQYO 3H1LH 1EM1A 5JQGB 1NT2B 3CX5F 5IYBG 2M7WA 2FTKA 1R1BA 1OCZC 1E4EA 1HNXH 3JAKB 3VQYA 1NVPD 1O9GA 2WWWA 5KFFA 4MV3A 1VAJA 3U55A 2J6TA 5KS8A 3UFXB 1SZTA 5D8DA 4PDMA 2J6SA 4JTAB 3RB4A 2QKSA 4J9LA 2D2CB 2VRZA 4JI6O 2RDCA 4K8ZA 4DV3B 2PY5A 1V51A 4YR0A 5LGTA 2YIBD 3DTUB 4F4XA 3KAJA 2NVYA 2ZM6B 2OT5A 1HR0H 4DR5O 5KFXA 2MK3A 3LP8A 4HNUA 3AG3C 1VQ8V 4IWYA 2VUMA 5D5PA 1BJTA 1MMMA 4JYAO 5C8YA 5AG2A 3ZS8C 3OUSA 4RB0A 3VPCA 3W1BA 4DUYH 3G6BA 2EJ3A 5LHGA 1AI5A 2JS3A 1NTKH 3SPCA 4DR5H 4O83A 4LWSA 2JA8G 3D3IA 2UUCB 1YF2A 2W6PA 4LF5B 4BXXG 4X62O 3HKDB 5B1AC 4LF8B 3ASOB 2JRIA 4U7NA 4TV9F 4JYAH 1NU1H 2RN9A 4YJ3B 4O4LF 3CVZA 2YL2A 3KCXA 4DV6H 5L3CA 1GSAA 4CS3A 2LW7A 3JZIA 3FYIB 5L3DA 1KJ9A 1T94A 3ZX6A 3QNEA 3D3QA 2IA6A 2UU9H 5LA6F 4QE9A 2Q2UA 4I7ZB 1Y76A 3NGDA 1M93A 4TQRA 4UXNA 3KREA 4ZI7B 2CZGA 5IYZF 3G6YA 1M9NA 1B6SA 4B3RH 2ASDA 1VF7A 4YJ2A 3GIMA 5JJEB 2GSMB 3H01A 3E89A 2FMLA 2E2IA 3CB2A 4Y8VB 1P49A 4WFFA 5KFCA 1QBZA 2WLLB 2W7PA 3W7TA 4YHHO 3JD4A 1K83A 4BY1G 4GX0A 5IY5C 5KFIA 1EKVA 4LFCO 2PTMA 4GZRB 4FLUA 5JVDF 5CAEB 2DPIA 4JV5H 3VQVA 2ZR3A 3RYFA 1AJNA 1FJGB 4IWXA 5KG3A 2CE4A 4DV5H 3Q2OA 5B3SB 1JFFB 4OGQB 4QE7A 3ABLC 4GX2A 2R6FA 1VBGA 1A0GA 4CC5A 1KD1W 3SJCC 5EIBD 2Q68A 4JAAA 4UB6Z 2HHHB 3TIIA 4LFCH 1ENVA 1NS1A 3G67A 4KHPB 5JH7A 1NR1A 3HKZE 3ZRWA 2J6UA 4ECSA 3IC7A 5E79Z 1ZL8A 4WFAV 3TY9A 3SPIA 1I1MA 4K0KO 5LXTA 5CE8A 3PR5B 4O4LB 1K9MW 4M7EA 1K1QA 2HR3A 1BT8A 1RSOB 1VQ4V 4FLZA 1N33B 4ETSA 1I3QA 4DR1O 3SDLA 2WAQA 2DQ3A 4NB5A 5LA6B 1RK5A 3BPZA 3L73H 3ETJA 1Q8IA 4NXMB 5C44G 4Q44A 5KG2A 4K0KH 1JJOA 1X4TA 4DV2B 1N36O 2NU6B 3WG7C 3W7SA 1M57C 2QKCA 1YDXA 2N74A 2ADPA 2VQEO 3CCSV 2IU3A 3EPGA 3G80A 3SJAC 2W0XA 4QGPA 5B5EZ 1E1QG 1WB7A 1QNMA 1TVKB 4JI1O 2W6IG 5IDJA 2AQ4A 4U6PA 4JF3A 2YWVA 2DQ0A 2RCVA 4IGGA 1GN2A 5JVDB 1QLNA 1KJJA 3HKCA 2VQEH 2Y69B 5KFWA 3T5JA 1IYEA 5KT6A 2KSDA 4DRXA 2W8KA 4F6RA 4TV8A 1SFOA 3ASNC 4NTWA 1S5JA 4A3BG 1YTFB 4OPAA 2HG8A 4FFBB 3PZPA 5GTHZ 3T1YH 3ZHRA 2BR0A 3I12A 4RUFA 1L0NH 1FPOA 3VOUA 1KUQA 5DGIA 2DWCA 2C28A 4DV3O 2GUZB 4ED8A 3TGUH 2FPIB 3UO3A 4QW9A 3LSUA 3H9VA 2ZM6O 1V54B 2NU8B 2QWQB 5KLVH 4WBNF 3T1HH 3C3SA 1RYSA 1ZX3A 3HT5A 3IFXA 4H33A 4DV3H 3HXLA 1HNZB 5EIBC 3GV7B 1B6RA 1SF9A 4QNHB 2EIKC 4A3MG 1GH6A 5EYPB 5KG1A 2UUCO 1PM9A 4LF5O 2R7ZA 1KC7A 3N44B 4LF8O 3C3TA 3CCEV 4ZOLB 4QWEA 1OHHG 3K3VA 4FLYA 2EBOA 1TWCA 3EHBB 4XDKA 1IBKB 2BTQA 3FKSG 1Y66A 3WB1A 4JI7H 4JYYA 3N40P 1JX4A 1M7JA 4Q8EA 1WCMG 3L4JA 1WR2A 4LF5H 1YHQV 4ECUA 1OCOC 2W9BB 4O3QA 4LF8H 2R7KA 4JYBA 4Q6GA 4O7SA 3CXHF 3U9SA 5BR8H 3NBZB 3T2MA 2C22A 2WLJA 4DUZB 4J9KA 3GTLA 2QWPB 5KG0A 2P06A 2Q73A 3R66A 1MOFA 2JA5A 1E4GT 1P84F 3BCCH 2HVQA 3E83A 2DYSB 5CBGA 3HBLA 5KA6A 1S77D 3K3PA 2FKXA 1GN3A 3APOA 5CA0F 2OCCC 2CW7A 1FJGO 1OCCB 4HNAA 4MTOA 2P7TC 3UKMA 4UCSA 1DV2A 2HJWA 3BVOA 3A0BZ 2EJ0A 4UCUA 3CCVV 2HHHO 3HOWG 2R87A 1UPGA 3K5NA 2SCUB 1CEZA 3CSXA 4MAMA 4E2LA 4KHPO 2HGSA 4M9UA 2JEIA 3W7XA 1KECA 3DF7A 3N42B 1J5EH 1E4EB 1FJGH 2GPSA 1YVWA 3JARA 2ZJTA 4I0XA 4DV0B 1QR9A 5GTIZ 3M9OB 5JCOC 2R70A 2PBZA 3Q1KA 2AXTZ 4GX1A 5IT9W 1MZEA 4R7CA 1N33O 4M0JA 1TWHA 3SJQC 4AILC 4CZZA 1QVFU 1X59A 4IIJA 4KHPH 4AYBA 1S0OA 3K5MA 4NXMO 4TVIA 1DAAA 4O84A 1XREA 5KMGA 1EUDB 1OBDA 1PX2A 1MABG 4DV2O 5IJ9A 4O3PA 3OEEG 4JI5B 3BACA 1XL6A 2DYRB 5KUKA 3R65A 3M4IA 1PKXA 5KFMA 4C5AA 1CQJB 1YI2V 2QM7A 3WWIA 3SYPA 1G2WA 2HHFA 1OV9A 3T9AA 5IT9N 5KX5A 5LYJF 5C8YB 1SQGA 4EGJA 3P3PA 4FFLA 3SJBC 4ZBMA 2W57A 1J95A 4NTXA 1M0WA 3L71H 4RAZA 2Y0IA 2GTAA 4LWSB 5JH7F 2AGPA 1YXBA 1BQ0A 1GTOA 3EVKA 1Q7YW 2ATKC 4X88A 1F7YA 2KQXA 4J9YB 4CS2A 4HQ6A 5DLGA 2KG7A 3PW0A 1B6QA 5FLXW 4IYIA 3STZC 2ZXWC 5KAIZ 3E2EA 4IRKA 2OIGA 2L35A 1KYOF 2IM9A 4MV6A 1Z2NX 2FKLA 4LSAA 4LF4B 1ZHQA 3G6XA 1NQTA 3J81W 4FBUA 4EYIB 1Y76B 2HVJC 4MV4A 5E1AC 2HIVA 4YQWA 4DR7B 3K5OA 3D36C 2P4VA 1PNMA 2EINC 4U3JB 4YJ2B 3AG2B 4QWAA 3CRAA 5L3FA 3GTGA 1FXKC 5DEDA 1H38A 2V1DA 1HNZO 1WB8A 1L2ZA 4UV8A 1KJ8A 2W7OA 5BWXA 3OEHG 5KFJA 4RQFA 5FD6A 3WU2Z 2ITDC 1S72V 1I0HA 3IG0A 4XDLA 2QB5A 2P22C 1V9PA 3HOYG 4IAJA 3JCUZ 4TV8F 1IBKO 1V55B 1VQLV 2OLSA 1AR1B 4DR2B 1D5AA 4GKJB 3R5HA 3F5WC 1SETA 1G6UA 2IJKA 1JIHA 1GYFA 3KKYA 1ZL8B 2CW8A 3KXYT 5LXTB 1XK5A 3L75H 5C93A 3CXCU 1OZ0A 1IBKH 2FPPB 2QDOA 2WSSG 5CA3A 1E79G 4DUZO 5FLMG 4O4JA 4PDVA 1HNXB 1SEIA 2YRWA 1R6TA 2ZD9A 1JFFA 4FZ0A 4O7YA 4X20A 1QU7A 3PW5A 2IW5A 1GRJA 1R6KA 2QJ1A 2E75B 2JGDA 5I5SA 1GO3E 1WNSA 2LFRA 5KFEA 1SRYA 3CPWU 5FPOA 2XOKG 3BJYA 1FFXA 3Q4HA 5KG4A 1BSMA 4DRFA 1TGOA 2RDJA 1JX9A 4DUZH 2BOCC 3WB0A 2VR1A 4JTDB 4PBCA 5KT2A 3G71V 3NR7A 1HR0B 3E5NA 4EFBA 3BQ2A 3DC5A 2AGAA 1EHIA 4UFZA 3H4DA 5K3WA 3T9CA 3HKCB 4DUYB 1BCCH 4DV0O 1R73A 2DABA 3RUPA 4J9ZB 4WF9V 4F6RB 3G6VA 1CE8A 4TV8B 2CQYA 3EPIA 4F50A 3HPLC 2PI4A 5CB4A 1RM1B 3DGEA 1BL8A 1FKAO 1Q6IA 4MA0A 4JYCA 3L74H 5JJJB 2NUAB 2R82A 5LL6Y 2Q7GA 3T54A 3T9FA 2WLHA 4JI5O 4DV0H 4DV6B 1K97A 1I7FA 1EKPA 2HVKC 2UU9B 1YJNV 3N6RA 1I08A 3K3WA 5I47A 4MW3A 3U10A 2GQRA 1LNQA 1E1RG 3CS5A 3MWDA 3BABA 1IX9A 1FKAH 1G4YB 2HG5C 4D7TA 4B3RB 2XAQA 4PELA 3AG4B 4B3SB 2JA6G 4DW1A 3JZ6A 4X9QA 1BMFG 4RU9A 2ALZA 3RYHA 4H37A 5B1BC 1ET0A 1VIBA 3VPDA 1PK8A 3JRXA 4O82A 5CA1F 2R92A 1YJ9V 2GUZA 1HDJA 4GKKH 3PW2A 1JOYA 1M56B 2V9WA 2ZR2A 5FNVA 4BWAA 4NYKA 2QSAA 2W9CA 3KHRA 3QQMA 1XUQA 1H2KA 2C2AA 4DL5A 2V4DA 3HKZA 2R8HA 5FL7G 3T9BA 4JV5B 3SI8A 2BTQB 4LF4O 1R3LC 3ABMC 5KHGA 4DV5B 1EBOA 2IH1C 3TXQA 2UVUA 4IIJF 4ED3A 2CTPA 1LUVA 1CPYA 1K5QA 2DE0X 1BS3A 2IJJA 4DXWA 4DR7O 3ZMVA 4ECXA 4L1KA 5LGUA 1WLEA 1Y1WG 1WP8A 3PO3G 1CS0A 3OE7G 2PGGA 4KFMA 2ZGIA 1T3NA 2X5RA 4LF4H 4A3GG 5KA5A 2KSWA 3LDCA 5L1IA 4AI8A 5KX5F 3CRQA 4XBFA 2HVRA 3SR2C 4DR7H 2F4VH 5EC2C 2XC9A 3C90A 2F23A 3ETDA 1GSOA 3KG2A 4HNAB 3IJ4A 4UVAA 5LP6C 1IOWA 2CNUA 4CE5A 4MV1A 2QM8A 2JEJA 2I80A 3FAVA 3DAAA 1Y6XA 2AGQA 4DR2O 4GKJO 4XX0B 1EZ1A 3G8DA 2UXNA 2YS7A 4DR6B 1S9FA 5K1PA 4DV1B 1XNQB 4O86A 3RYCA 2X6AA 5H6QA 4U7OA 3JARB 3CCMV 3M9NB 4I0XB 2YYAA 4A2BA 2X6BA 1H8EG 5K2MA 4F4WA 3FFQA 3ZIAG 4BAYA 5H2FZ 1HNXO 1M6VA 5D1PA 1I7LA 3AX6A 1B04A 1ROPA 4IIJB 4RUAA 1MZFA 4FFMA 4YJ3F 4J9RA 3FX7A 5EC1C 5KMGB 4K3AA 2VWJA 5KFOA 4FU0A 1EZVH 2QWRB 3EFFK 3T1YB 3N43B 5H6RA 4B3MH 1Y67A 5ITZB 3GB8B 4ED7A 4ZI7F 3ZCCA 1ZUQA 3OW2U 3TW7A 2PMZA 1RYRA 2HHFB 5I5TA 4PHZA 2JJ1G 1HR0O 3OAAG 2UVRA 5KX5B 5H80A 1F23A 1VF6A 2RQ6A 3N6XA 4FS2A 2R93A 4JZ2A 3S24A 4O4IA 4O2AB 3WNZA 3T1HB 1TWGA 4X65B 2WB1E 1XNRH 5DQIA 4IYHA 4D7SA 4FGRA 5C4XG 3FKIG 4DUYO 2BSKA 3E22B 5LGNA 3UT5A 3T7AA 3JD1A 5I5XA 2ATLA 2KG7B 3KZIZ 1XDCA 1K92A 1LR1A 1THZA 1Z5VA 1OCZB 2UXBB 3ASOC 4G28B 4DV6O 2YXLA 3GIKA 3W7WA 3ABKB 2ITCC 2A7WA 2UU9O 2WLNA 4JI7B 1TUBA 4O3RA 2CGNA 4C7UA 2JEGA 1AJQA 4O7NA 4CHIA 3HKEA 2RNBA 1KMIZ 1KUTA 2QTOA 4DL7A 4FLVA 4B3RO 5H9CA 4B3SO 3JD0A 3H1HH 4O4HA 2CDYA 4Z2WA 1BGWA 5BR8B 1K7DA 3NBYB 2EZPA 1YTFD 1F4NA 4O7LA 2R8GA 3MHSC 4YR2A 2X6CA 1D5NA 1VMGA 2VWKA 4B08A 5IYDO 4PZ6A 2RJZA 1H2LA 1XMQH 4J80A 4TUYA 4B3SH 5EBLC 3JRWA 5EK0A 4U3JA 1ZAUA 4JV5O 2ZE7A 1OCRC 3M99B 3E86A 2CUGA 1OJHA 1BHAA 2UUBB 4QWCA 3L72H 3ETEA 4DV5O 4MVRA 2ZIOA 5GONA 3I55V 1IBLB 3I5DA 5B3SC 2PVPA 3TXSA 2UXDB 1L0LH 3HOZG 2EILC 3P3NA 4NKGB 3Q8SB 5TISZ 5B1AB 4P9OA 4A3LG 4ZHQA 4DL2A 1CQIB 1J5EB 4O4JB 4XZ3B 2A0LA 2F66C 4A3JG 1IXBA 3CRCA 4PA6A 2FLPA 5KHIA 3X2QC 4X20B 4JXUA 4FM0A 1VQOV 4A3FG 2JGDB 2O57A 2VUMG 5BZBA 3KCYA 5EZYA 1SA0A 5LMUB 1NBMG 3WO0A 2NU9B 2EJ7A 2HKOA 2ILMA 1FFXB 2DWEC 4QW8A 3TINA 2OH2A 3D36A 3Q4HB 1A3GA 3GTMA 1I5XA 2XT9A 3RW0A 4LF6H 4LSXA 1H2GA 1FXKA 3SPGA 2Q0AA 2HEPA 1MSDA 2IH3C 2X0SA 2Q69A 1HW7A 4A3CG 3B09A 3MAQA 1KKDA 1F51A 2CNQA 4QPJA 2I8CA 2V5AA 4O3NA 4DR6O 4EYHB 5DGHA 3ICXA 1W93A 4PZ8A 2E74B 4DV1O 1XNQO 4TM5A 3K0GA 4G3IA 1SQPH 3SNOA 3V6JA 4EFEA 5D5QA 2YRXA 4MVQA 1M0TA 3U9TA 4WFGA 1NVPB 3TY5A 1K33A 1JMKC 2UXCB 2YW2A 2LO1A 2ARHA 3K06A 1RJPA 2QK4A 2R9RB 1Z2GA 5CB4B 4RNMA 1I2KA 1DIKA 4EQ5A 5B1OA 1AROP 2Y69C 2QWOB 4DR6H 4LP8A 4ZOLF 5C3EG 2Q0OC 4IHJA 5KT3A 1DF5A 4Q45A 5CM0A 4RB1A 2LGQA 4DV1H 3JD3A 1XNQH 2IU0A 4J7ZA 2BQRA 4JZGA 4C5BA 4PWQA 2RGRA 3PFFA 2C35B 4APMA 4FPPA 5B66Z 3T1YO 4GT1A 4CMDA 2XAFA 4FE2A 1MNGA 2ETNA 3OFNG 2BQ3A 5CBHA 3JAWA 4NZOA 1W96A 3AG1C 1MG1A 3QTCA 2FJZA 3GTPA 2VS0A 5J2TA 4CH4A 4QIWA 5IWAB 1FXHA 1FFTB 3BA9A 3CC4V 1BQZA 2LQTA 2E3CA 2QGNA 3N2GA 1RJQA 3T1HO 4DR4B 2PUSA 3RYHB 4IR9A 1O9HA 3P32A 3F5TA 2R7MA 4RQEA 3WG7B 2R9AA 4X1KB 3RN4A 2W6QA 1M57B 1I94B 3OSPA 1GN6A 3S3WA 2WTFA 1S0VA
chains in the Genus database with same CATH topology
1Z5WA 4TQFA 5FNVB 3RGXA 5LOVB 3JASB 1N34H 2GV9A 4NXNB 4LF7B 4CS2A 3JAMW 3L4KA 5FLXW 3FMAA 3RJ0A 2WYOA 4X65H 4X62B 5FPRA 2JVDA 2O03A 2YI9A 2IM9A 4I4TB 1Z2NX 5DISC 2Q2TA 4LF4B 4LSAA 4JI6H 4JI5H 2VOBA 4FFBA 1ZHQA 3J81W 4UCTA 2OWOA 3HKBB 1Z2PX 5CA0A 1CKMA 2HIVA 1FVIA 4DR7B 2XIGA 3K5OA 4I9QA 1P16A 4U3JB 4YJ2B 3RYIA 2UXBH 3KAKA 1SQFA 5IJ0B 3GDEA 3SGIA 1L2ZA 2MCTA 3N41B 1ZHSA 4MTEA 4YHHB 1M5IA 5FD6A 1XMOH 4LFCB 3IG0A 2P22C 1V9PA 4CH5A 4X62H 5EYPA 4IAJA 3RGZA 4I50B 5KHHA 4ZOLA 4CS4A 4FLTA 3RF2A 4RZQA 3QG5A 4DR2B 1D5AA 4GKJB 2UUAH 3THOA 3ZEDA 3RYCB 1G6UA 4LNUB 3UQ8A 2HVSA 4OX9H 2OYQA 4FLXA 1GYFA 2CW8A 3KXYT 5LXTB 4GLXA 1XK5A 1XQ8A 4HBNA 2UUBH 2WE6A 4K0KB 1IBKH 5JVDA 3RTXA 1S68A 1Q3EA 4O4JA 1HNXB 5LYJA 1SEIA 1IBLH 1JFFA 4RAYA 2YCHA 4YHHH 2UXDH 4X20A 3F8NA 2QJ1A 5BMVB 5CA1B 4DR1B 2E5LB 1WNSA 5LP6B 2VQFB 4A2AA 2CFMA 5FPOA 1FFXA 4KL1A 3WB2A 5J2UA 4DRFA 3J7AK 2XHBA 2KKWA 1TGOA 1N36B 4L8JA 4DUZH 3VQWA 3WB0A 5KHKA 4TV9B 3RGBA 2VQEB 5LL6b 4DR2H 4GKJH 5LMUH 1HR0B 3RR5A 3BHPA 4O4IB 4R7RA 4EFBA 4JI1B 2PZSA 4LMYA 4FLWA 4DV7B 5IJ9B 4LF9H 4UFZA 5IYZB 5JQGB 3HKCB 1NT2B 4DUYB 3JATA 3UT5B 1HNXH 3OTOB 2JS5A 4F6RB 3JAKB 3VQYA 4TV8B 1O9GA 1L8DA 1P8LA 5ITZA 4AHCA 2P5OA 4GKKB 4JI3H 4CC6A 4JI0B 4DR1H 5CB4A 1S03G 4LR3A 3IAYA 2VQFH 4JI2B 1N32B 3CHXA 5JJJB 3PN1A 4O2AA 5D1OB 2UXCH 4X66B 2Q7GA 4DV0H 1N36H 4DV6B 4K8ZA 1I7FA 1TUBB 4DV3B 2PY5A 1CKNB 4B3TB 2YIBD 2JGUA 2UU9B 3E22A 3KAJA 2QM4A 3HKEB 4PZ7A 4EEQA 1HR0H 3U10A 2ZM6B 3BABA 3N2KA 4CH6A 1FKAH 4JI1H 4O4HB 4D7TA 4B3RB 4B3SB 1IBMH 4PI0A 4UCOA 5D5PA 1BJTA 5C8YA 3ZS8C 4RB0A 3W1BA 3RYHA 4DUYH 4O2BB 4X1YA 4GKKH 4RB2C 4DR5H 5IWAH 2WDTA 5FNVA 2F4VB 4BWAA 4TUYB 5LOVA 1O75A 3JASA 2UUCB 1XHXA 1TA8A 4LF5B 4DR4H 1N32H 2V4DA 3HKDB 4LF8B 4JYAH 4K8XA 4JV5B 4YJ3B 3CVZA 4LFBB 2BTQB 3KYHC 5GONB 3H20A 1I94H 5KHGA 3K5LA 4DV6H 4DV5B 2Q7HA 4CS3A 4I4TA 3K59A 1CKOA 2UU9H 1Q43A 3K58A 2ZM6H 2Q2UA 4NXNH 1M93A 3HKBA 4LF7H 1A0IA 4ZHQB 4ZI7B 2RGVA 4B3RH 1VF7A 2PGGA 3JALB 3RFRA 4YJ2A 4LF4H 4UCRA 5JJEB 2KSWA 1QQCA 3QWUA 4X64B 3CB2A 1SA0B 1P49A 5EZYB 2YIAA 4ZIBA 5IJ0A 2HVRA 3SR2C 4YY3B 4DR7H 2F4VH 2UUCH 2PTMA 4FLUA 1WPBA 4HNAB 5LP6C 4JV5H 3VQVA 3RYFA 1FJGB 4B3MB 4DV5H 4DK1A 1JFFB 1AN7A 4CC5A 3SJCC 1WH2A 5EIBD 2HHHB 4NVPA 2VPSA 4DR6B 4LFCH 5K1PA 4I55A 4DV1B 1XNQB 5J2UB 3RYCA 1H2SB 4KHPB 4LNUA 5JH7A 3JARB 1XNRB 5K1XA 3TY9A 2R72A 4WBNB 4X1IB 5LXTA 4MV7A 4A2BA 2FE3A 1KU9A 2ZNJA 3FFQA 4O4LB 1Z2OX 1HNWB 4M7EA 5D1PA 4ETSA 1B04A 4IHJB 4FLZA 4LFAB 1N33B 4YY3H 4IIJB 5LA6B 4TQDA 5KMGB 3BPZA 1VS0A 2BTOA 5BMVA 5CA1A 2VWJA 1YEWA 1Q8IA 4NXMB 5LP6A 4DV4B 4JI8B 4K0KH 1JJOA 1X4TA 4DV2B 3T1YB 3GJXB 3A2FA 3JAWB 3N43B 4B3MH 1TAEA 2CAZC 5ITZB 3GB8B 5J2TB 4PHZA 4TV9A 3SJAC 1N34B 5LMNB 5KX5B 3N2GB 2HHHH 4EB6B 2RQ6A 2E5LH 3N6XA 1TVKB 3S24A 4O4IA 4O2AB 3T1HB 4E6NA 5A2QW 4X65B 1XNRH 2F1MA 4LH7A 4D7SA 5JVDB 3BRCA 3U11A 3LNNA 5IYZA 5JQGA 3E22B 3MWMA 3HKCA 4I7HA 2VQEH 4BWSC 3UT5A 4FM1A 1X9NA 1N33H 1WN7A 4DRXA 4LFAH 2HIXA 4F6RA 3JAKA 3L2PA 4TV8A 4RB3C 2ZINA 4DV7H 1I6UA 5EOYA 1S5JA 1XMQB 4NXMH 4FFBB 4JI8H 1Z5VA 4DV2H 3T1YH 2UXBB 3C0FB 2YXLA 5D1OA 3OTOH 5CA0B 4X1KA 4PDBA 4JI7B 1TUBA 1CKNA 3JSNA 5LMNH 4JI0H 3HKEA 1KMIZ 4PI2A 4JI2H 1XMOB 4FLVA 3RYIB 3T1HH 3M7MX 4X66H 4O4HA 1BGWA 3RWRD 2F93B 1M4UA 5BR8B 3BAAA 5JJNB 4DR3B 2PYJA 3NBYB 3HXLA 1HNZB 4DV3H 4B3TH 5EIBC 4O2BA 2UUAB 1E4FT 2ZCEA 2VWKA 4B08A 4PZ6A 1Q5OA 5EYPB 2RJZA 3NC0B 4OX9B 1XMQH 4TUYA 4B3SH 3N44B 4ZOLB 4U3JA 1ZAUA 3U0ZA 3K3VA 4LF6B 4FLYA 2UUBB 3HKDA 1IBKB 3VNNA 3ETQA 4YJ3A 3KALA 2BTQA 2ZIOA 5GONA 3DSQA 3WB1A 4JI7H 1IBLB 3N40P 4FVMA 1QHTA 2UXDB 1DGSA 3OTFA 4DK0A 3L4JA 4LF5H 4BW9A 4ZHQA 4ZI7A 4LF8H 3RYFB 5KHJA 4LFBH 3JSLA 4Q6GA 1J5EB 4O4JB 3NBZB 5BR8H 2F66C 5LYJB 4DR3H 1SYXB 3JALA 4I50A 1XHZA 3LMLA 5KHIA 1HNZH 4DUZB 4X20B 2ZNIA 4FM0A 4TOIA 4MV9A 1E4GT 4I55B 1SA0A 5EZYA 5LMUB 3RIZA 1T5EA 4CH3A 2HVQA 2VUGA 1FFXB 5JH7B 2YI8A 4J0MA 3B2EE 4LF9B 4LF6H 1SKVA 4LSXA 4JI4B 2CW7A 2Q0AA 2HEPA 4HNAA 1HW7A 4UCSA 4X64H 3MAQA 4JI3B 4UCUA 3VQXA 4FM9A 3K5NA 3CSXA 3ICXA 4PZ8A 2HGSA 2EX3A 5D5QA 4EFEA 1MZBA 3JATB 1M0TA 4AQYB 3DF7A 3N42B 1J5EH 3TY5A 1FJGH 1JMKC 2UXCB 3JARA 2ZJTA 4DV0B 4LH6A 4WBNA 2R70A 5JCOC 4X1IA 5IT9W 1XDNA 5CB4B 2PYLA 4EQ5A 4O4LA 4Q0YA 4DR6H 4AILC 1RSOA 4IHJA 4DV1H 1XNQH 4RB1A 4IIJA 4KHPH 4UCVA 3BA8A 3K5MA 5LA6A 2RGRA 5KMGA 1IBMB 5FD5A 4APMA 4JI4H 2F95B 5IJ9A 3EYYA 2YIBA 4JI6B 4JI5B 1XI1A 1HNWH 2ZIMA 4DRXB 3JAWA 3QF7A 3M4IA 3N2KB 3QTCA 5J2TA 4CH4A 3J80W 4DR5B 5IWAB 3BA9A 4FM2A 3TY8A 2E3CA 5KX5A 3N2GA 3W5OA 4EB6A 5C8YB 1SQGA 4GYCB 2Q7EA 4DR4B 2PUSA 3RYHB 3SJBC 4MTDA 1TVKA 2W57A 4DV4H 4AQYH 1O9HA 4JYAB 2R9AA 4X1KB 4X1YB 1I94B 3K57A 1M0WA 4RAZA 3W1GA 5JCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFZ A;  1ZAU A;  4CC5 A;  4LF6 B;  2HHH B;  2UUB B;  4NXN B;  4DUY B;  4LF7 B;  4DR6 B;  1IBK B;  3VNN A;  4DV1 B;  3OTO B;  1XNQ B;  4KHP B;  4X62 B;  5FPR A;  1P8L A;  1IBL B;  4GKK B;  1XNR B;  4CC6 A;  2UXD B;  3TY9 A;  5DIS C;  1DGS A;  4JI0 B;  2Q2T A;  4LF4 B;  4UCT A;  2OWO A;  4JI2 B;  1N32 B;  1HNW B;  5D1P A;  3PN1 A;  1B04 A;  1N33 B;  3JSL A;  4LFA B;  1CKM A;  2HIV A;  5D1O B;  1J5E B;  4X66 B;  1FVI A;  3NBZ B;  4DR7 B;  1P16 A;  4DV6 B;  4DV3 B;  1VS0 A;  4DUZ B;  1CKN B;  4B3T B;  4NXM B;  2UU9 B;  4PZ7 A;  4EEQ A;  4TOI A;  2ZM6 B;  4DV4 B;  4JI8 B;  5LMU B;  4DV2 B;  3T1Y B;  3GJX B;  3BAB A;  1TAE A;  2HVQ A;  2VUG A;  3GDE A;  3GB8 B;  3SGI A;  4B3R B;  4B3S B;  4UCO A;  4LF9 B;  4YHH B;  1N34 B;  5LMN B;  4JI4 B;  3W1B A;  4LFC B;  4UCS A;  3S24 A;  1V9P A;  3T1H B;  4E6N A;  4JI3 B;  4X65 B;  4LH7 A;  4UCU A;  2F4V B;  2UUC B;  4PZ8 A;  1TA8 A;  4LF5 B;  4LF8 B;  4EFE A;  4DR2 B;  4GKJ B;  1X9N A;  4AQY B;  4JV5 B;  2HIX A;  4LFB B;  3L2P A;  3KYH C;  3TY5 A;  2UXC B;  3UQ8 A;  2HVS A;  4DV0 B;  4DV5 B;  4LH6 A;  1CKO A;  1XMQ B;  1XDN A;  4GLX A;  1XK5 A;  4EQ5 A;  2Q2U A;  4K0K B;  2UXB B;  1A0I A;  5D1O A;  3RTX A;  1S68 A;  1HNX B;  4UCV A;  3BA8 A;  4JI7 B;  1IBM B;  1CKN A;  3JSN A;  4UCR A;  4DR1 B;  4JI6 B;  4JI5 B;  2E5L B;  1XMO B;  2VQF B;  3QWU A;  4X64 B;  2CFM A;  5FPO A;  2HVR A;  4YY3 B;  4DR5 B;  4DRF A;  5BR8 B;  5IWA B;  3BA9 A;  1N36 B;  3BAA A;  4DR3 B;  3NBY B;  3TY8 A;  1HNZ B;  3W5O A;  2VQE B;  4DR4 B;  1HR0 B;  4JYA B;  2UUA B;  3RR5 A;  4EFB A;  1FJG B;  4PZ6 A;  1I94 B;  4B3M B;  4JI1 B;  3NC0 B;  3W1G A;  4DV7 B;  4OX9 B; 
#chains in the Genus database with same CATH topology
 1JPX A;  5FNV B;  2W9C B;  2WA3 A;  2COG A;  4NXN B;  4O7Z A;  2W0F C;  1A9X A;  1FYJ A;  3MFI A;  3L4K A;  2CNV A;  3RJ0 A;  5DN6 G;  2WYO A;  4X65 H;  2YI9 A;  2COJ A;  1AI6 A;  3CME V;  2UXB O;  5DIS C;  5I5U A;  1K3E A;  2ZE6 A;  1JA8 A;  4UCT A;  2OWO A;  3IN5 A;  2PMZ E;  1Z2P X;  4JI7 O;  1JLL B;  1CKM A;  2JEU A;  2XCP A;  3ASN B;  4I9Q A;  1EZJ A;  1UC8 A;  3K5I A;  2R86 A;  1NTZ H;  3CCJ V;  5KFV A;  3QFF A;  1QLE B;  2W70 A;  4RNN A;  1IOV A;  2UXB H;  5BR8 O;  4HR7 A;  3L70 H;  4MA5 A;  3GDE A;  1CP9 A;  2ZT9 B;  5BPH A;  4O7V A;  2MCT A;  3N41 B;  1ZHS A;  2K9P A;  1M5I A;  1WA8 A;  2ZDH A;  1KEE A;  5B1N A;  4JGS A;  1KTA A;  3SYQ A;  4UUJ C;  4CH5 A;  2B63 A;  4BIO A;  1AP5 A;  3FAV B;  3RV4 A;  2YS6 A;  4I50 B;  1SER A;  4YAK B;  3HOX G;  2UUB O;  5KHH A;  2DJV A;  4CS4 A;  3MJF A;  3MD0 A;  5F2V O;  3ORR A;  5I5Y A;  4E4E A;  1S97 A;  1PNL A;  2EIK B;  1IBL O;  4Z1V A;  4B7E A;  2CKZ B;  5C8Y F;  3SPJ A;  2UXD O;  4GCZ A;  5BPF A;  3RYC B;  3UQ8 A;  3OGC C;  3ZJZ A;  4FLX A;  3CEB A;  1M90 W;  4N23 A;  1FS0 G;  2ADQ B;  4DYL A;  1J5E O;  2UUB H;  2E76 B;  2WE6 A;  2HLD G;  2Q9L A;  2WA4 A;  5BYA A;  5KKN B;  1Q90 D;  3RTX A;  1S68 A;  1UJW B;  1IBL H;  3V4S A;  3GII A;  2FP4 B;  1KJI A;  4F4Y A;  3I4M G;  2UXD H;  5LMU O;  3SPH A;  1OCO B;  1V4Y A;  4A2A A;  1UC9 A;  3WB2 A;  5J9P C;  2EIJ C;  3SE7 A;  2B5U A;  3RFC A;  3J7A K;  4YIP A;  3RVY A;  2YEV A;  3VQW A;  4YBZ B;  4FK5 C;  1L1F A;  3OMA B;  5F9N A;  2R7Z G;  4CKE A;  5IYD G;  4YJ2 F;  1IDS A;  3T4Z A;  5LMU H;  3RR5 A;  5BWU A;  2XUM A;  4O4I B;  4R7R A;  1N0N A;  2JEF A;  1SZX A;  3GID A;  2OCC B;  3OM3 B;  1IUR A;  4F4Z A;  5JWP A;  2BSK B;  4JUZ A;  5BWW A;  3T5H A;  2R8J A;  2UXC O;  5KG5 A;  3UT5 B;  1ULZ A;  1B3Q A;  2JS5 A;  3OTO B;  1PNK A;  4EG0 A;  1L8D A;  5ITZ A;  1YZB A;  4AHC A;  4GKK B;  5CR5 A;  1GM9 A;  4CC6 A;  1VQK V;  4JI0 B;  2GLT A;  1S03 G;  2PI5 A;  4LR3 A;  5L3B A;  2VQF H;  3K5H A;  4XYL B;  2A3Q A;  3PN1 A;  4O2A A;  4A93 G;  2UXC H;  1OWT A;  5EZY F;  4FFP A;  5KFL A;  3GIL A;  2RDI A;  2JA5 G;  2P67 A;  1P7G A;  5BWT A;  1TUB B;  4B3T B;  2JGU A;  3G4S V;  3E22 A;  2QM4 A;  3HKE B;  4PZ7 A;  4PA3 A;  1KP2 A;  5LXT F;  5IWA O;  4EKW A;  2QF7 A;  3N2K A;  1YJW V;  4A3K G;  3RAX A;  1DF4 A;  4O4H B;  4UUG A;  2EIM C;  4DR4 O;  2V4Q A;  1KBL A;  3KHG A;  1VEW A;  1I94 O;  1UFI A;  5I5W A;  1K34 A;  4YXW G;  5IWA H;  4NXN O;  2WDT A;  2F4V B;  2V59 A;  4TUY B;  5F9L A;  3JAS A;  1US6 A;  2JA7 A;  1TA8 A;  5IP9 G;  3QZ8 A;  1FXV A;  3ZRS A;  2BQU A;  4DR4 H;  1N32 H;  2V7Q G;  4HZ3 A;  5BYB A;  1RPR A;  1JR9 A;  4TSF G;  4IT5 A;  3KYH C;  5GON B;  3H20 A;  1I94 H;  4J9S A;  2Q7H A;  1B33 N;  2GDS A;  4QIW E;  4NXN H;  5DG7 A;  4ZHQ B;  3DXR A;  3MR6 A;  1N56 A;  4JAU A;  2YID A;  5LBQ A;  2Y0S A;  5CBF A;  3ZHS A;  3CRM A;  4HAM A;  2DWD C;  4RZR A;  4I9W A;  5KFD A;  2NU7 B;  4ECR A;  3GIJ A;  1QQC A;  3GIQ A;  5EZY B;  1SA0 B;  2C2E A;  2YIA A;  5C1O A;  3H0G A;  1S0M A;  2M6Y A;  2P90 A;  3CMA V;  3HO8 A;  2HGW A;  1FAF A;  1AUV A;  3OSN A;  4Q4D A;  1FXK B;  2NLJ C;  1NH2 D;  2WB1 A;  1I1L A;  2KB1 A;  1U96 A;  3H1K H;  4YB8 B;  2QA4 V;  4WD3 A;  1FD9 A;  4B3M B;  1NR7 A;  4IR1 A;  5KFZ A;  1BNC A;  3CP1 A;  1EYZ A;  2A06 H;  4TT3 G;  2AGO A;  4ME6 A;  3RBD A;  1M1K W;  5EBW C;  5J2U B;  2R85 A;  1GKF A;  1H2S B;  4JPR A;  4D6T H;  4DO2 A;  1XNR B;  5K1X A;  2R72 A;  4BW5 A;  1Y1V A;  1ZET A;  4O3O A;  5L1K A;  3IC9 A;  1GO3 F;  3LWB A;  4IL6 Z;  5EWG A;  1PP9 H;  1RK6 A;  1G1X B;  1UNN C;  1D2D A;  3OD4 A;  4IHJ B;  4KP4 A;  4YY3 H;  1XIL A;  3VA7 A;  4RNO A;  3T1C A;  4Q8F A;  5L1J A;  1VS0 A;  2BTO A;  3T9E A;  4MVZ A;  1H2M A;  1RM1 C;  2YDE A;  2Z5U A;  2QE7 G;  1WAZ A;  4DV4 B;  4JV0 A;  3CSW A;  4UB8 Z;  5I5V A;  4FZ1 A;  2ODT X;  3GJX B;  4X89 A;  3JAW B;  1VQ6 V;  2R8I A;  2YZG A;  3CCQ V;  2XAS A;  4ASU G;  5J2T B;  4EEY A;  4IZO A;  3TIG A;  3UO2 A;  4TV9 A;  2VPQ A;  1N34 B;  1TWF A;  4EBC A;  1KC8 W;  3N2G B;  3TCU A;  1DV1 A;  3STL C;  1S5H C;  1RP3 B;  2COI A;  3HOU G;  3SYO A;  1PD3 A;  3ZRV A;  1QR8 A;  3TJT A;  3BRC A;  1EFR G;  1WRV A;  2XCL A;  3U11 A;  2R84 A;  3VPB A;  2Q5Z A;  3H1I H;  4J41 A;  5IYZ A;  3Q8R B;  3Q8P B;  4I7H A;  3OTO O;  4BWS C;  3OHB A;  4GKK O;  4JV2 A;  1WN7 A;  4MTF A;  4LFA H;  5JVL A;  2HIX A;  4P30 A;  5IP7 G;  3PW4 A;  4JI0 O;  4RB3 C;  1AJP A;  1I6U A;  1M56 C;  5EOY A;  3CCL V;  3TQ1 A;  1AR4 A;  1XMQ B;  1N8R W;  4FFK A;  3DC6 A;  4ZKI A;  1W2B U;  2FB5 A;  4JI8 H;  3CEI A;  4MV8 A;  1P4R A;  3C0F B;  5D1O A;  3OTO H;  4X1K A;  2NR5 A;  4B3T O;  4PDB A;  4B7K A;  4QWD A;  3CJH A;  1CKN A;  3JSN A;  1Q6U A;  3TEK A;  2B1G A;  5LMN H;  5DLF A;  4JI0 H;  1SES A;  1SS3 A;  3UM7 A;  3BEH A;  3MR5 A;  1XMO B;  4IRC A;  2DAA A;  3M7M X;  4PA4 A;  2F93 B;  3ZMT A;  1M4U A;  2UVV A;  4EBD A;  4FBT A;  5JJN B;  1ZLZ A;  4B3T H;  1WA8 B;  1ZWI C;  2HP8 A;  4R6Z A;  4O2B A;  2UUA B;  2N04 A;  2ZCE A;  2F4V O;  4HN2 A;  1E4F T;  4E4T A;  1Q5O A;  4G27 B;  2ZDI C;  3MWE A;  3RAQ A;  3TQT A;  3JD2 A;  5B1B B;  3U0Z A;  4LF6 B;  2AW9 A;  3R9R A;  4MVM A;  4HYK A;  3JAM N;  3BG5 A;  3ETQ A;  1HP8 A;  4QJF A;  3BQ0 A;  3DSQ A;  3B40 A;  4C5C A;  3ETG A;  3K9S A;  2W6O A;  4O2A F;  4FVM A;  1QHT A;  2YC0 A;  4GX5 A;  5EWF A;  4MSW C;  3AK1 A;  2YZM A;  3GV8 B;  3ABM B;  1XBL A;  2RF4 A;  5GW7 A;  2JK5 C;  2M05 A;  3T9D A;  4DR3 H;  1SYX B;  5DEC A;  3JAL A;  4I50 A;  4Z1M G;  1XHZ A;  5BXZ A;  3LML A;  4MTX A;  1KQS U;  5IYC O;  3WFV A;  4NLG A;  4TOI A;  2WLK A;  3RIZ A;  4I55 B;  4RUC A;  4W4K A;  3CD6 V;  3WWH A;  1Y74 A;  1T5E A;  1I7N A;  2VUG A;  1AI7 A;  2YI8 A;  4ECV A;  3RB0 A;  3T5L A;  2R92 G;  4RAI A;  3OHA A;  1XEQ A;  1SKV A;  2YEV B;  3AK3 A;  4B3M O;  2E2H A;  1N0J A;  1ZTE A;  2XND G;  2GHY A;  4BR6 A;  4I5S A;  4JI3 B;  2FPG B;  4FM9 A;  1CXZ B;  5L3E A;  1C30 A;  1COW G;  2Y0S E;  2G38 A;  2MW2 B;  3K79 A;  5DG9 A;  1NTM H;  1GK9 A;  1YCI A;  2EX3 A;  4QSH A;  2IBK A;  2Q6A A;  1XNR O;  3Q8Q B;  3FB7 C;  1TUE B;  4PJ0 Z;  4JAV A;  4LH6 A;  4WBN A;  4X1I A;  3VOT A;  1XDN A;  3W7U A;  2FYU H;  2PYL A;  2Y0P A;  1XL4 A;  3HB3 B;  4Q0Y A;  1AB3 A;  1KKC A;  1JQ0 A;  4Q20 A;  4J9N A;  4UCV A;  3UZO A;  2JIZ G;  4HYO A;  1I1K A;  5KFH A;  2XAH A;  1IBM B;  4DV4 O;  2BOB C;  4JI4 H;  2F95 B;  3LNM B;  3AW8 A;  1XI1 A;  2ZIM A;  4DL4 A;  2ZKO A;  2X0L A;  2Z3Y A;  1H8H G;  3N2K B;  2D3O W;  3ABK C;  1GM7 A;  4PD4 F;  1N34 O;  3J80 W;  4CMF A;  4FM2 A;  3TY8 A;  3H1J H;  2V4R A;  2LP7 A;  2W6J G;  2P0A A;  4O4J F;  4JV1 A;  4EB6 A;  3OUZ A;  4GYC B;  5EWE A;  4MTD A;  1DLB A;  4DV4 H;  4AQY H;  3LDE A;  2QYZ A;  5FR9 A;  4P9P A;  1BXR A;  3FYE B;  3VMM A;  4A5U B;  5E25 A;  3K57 A;  1K5S A;  3QVN A;  3QZ7 A;  5JCO A;  3FMA A;  4O7R A;  4ECQ A;  1Z5W A;  2QWN B;  1T36 A;  3ZHU A;  3JAS B;  1N34 H;  4PA7 A;  1OBG A;  2GV9 A;  4LF7 B;  3RVZ A;  2Y48 A;  1XMQ O;  2Q8V A;  3J80 N;  2OIE A;  1JCH A;  1S3J A;  2ASJ A;  2Q2T A;  4JI6 H;  4F4L A;  2R7L A;  2B9Z A;  5KFP A;  3JZF A;  3DXR B;  5JUM A;  5CA0 A;  1YIT V;  2EJR A;  3AG3 B;  1PPJ H;  5KFN A;  2R9I A;  5KFG A;  2YXY A;  1XMO O;  1VBH A;  5HNE A;  3OR7 C;  1R3I C;  1Y14 B;  1LUW A;  2QR4 A;  2Q67 A;  3RYI A;  5HV6 A;  3T5K A;  5CB4 F;  1Y4M A;  2F43 G;  4ED0 A;  1JKJ B;  3R23 A;  4A3D G;  2R93 G;  4NZN A;  3GWK C;  3LQS A;  4CBC A;  3DTG A;  2UUA O;  4C2M A;  2Z04 A;  1W0J G;  1XMO H;  4WHX A;  4PDR A;  2DZD A;  4X62 H;  3GTQ A;  5A9G A;  1ZSP A;  4LBE C;  4LF6 O;  3RGZ A;  5CMU A;  2W71 A;  1JDE A;  1A32 A;  4RCN A;  5CN0 A;  4FLT A;  2DPJ A;  2LGW A;  4GUN A;  3TET A;  2XD4 A;  4RZQ A;  3RF2 A;  3H4B A;  4GC7 A;  2XAJ A;  5DGB A;  4LC1 A;  2A79 B;  2UUA H;  4WCE V;  3THO A;  2Y4U A;  3ZED A;  4YAJ B;  1VQN V;  2FK1 A;  2H94 A;  3T4D A;  2HVS A;  3D8C A;  3GQC A;  1VQ9 V;  4BIU A;  1NI8 A;  1OCR B;  3AK2 A;  4GLX A;  1XQ8 A;  4J9P A;  3AEI A;  5FNV F;  1S76 D;  1WSC A;  3A8T A;  3OUF A;  3RBE A;  1Q3E A;  5LYJ A;  2PF4 E;  1JJ2 U;  2FK2 A;  3FDS A;  1K4D C;  5IY5 B;  2EIL B;  2W6Z A;  4YHH H;  3RB3 A;  4DL6 A;  1S0N A;  2E5L B;  2VQF B;  2PN1 A;  3OGI B;  4Q43 A;  3ABT A;  2LFS A;  1AVM A;  3OUU A;  4KL1 A;  5J2U A;  5KFT A;  1WPX A;  4UVC A;  4O2B F;  1PL0 A;  3B4S A;  1PL4 A;  2XHB A;  3X2Q B;  3ABL B;  4FIP C;  1GN4 A;  3LSS A;  5KHK A;  4TV9 B;  5L3G A;  3CE2 A;  4JI3 O;  2ZDG A;  2R7N A;  3BHP A;  4MS2 A;  3LUL A;  2YS8 A;  3ORQ A;  4LMY A;  4FLW A;  3G6E V;  4DV7 B;  4R8U A;  5FJ8 G;  1SQB H;  4ECZ A;  5IYZ B;  3CC2 V;  4HNV A;  3JAT A;  1BHB A;  4YR3 A;  1P8L A;  4JI3 H;  2V58 A;  2P5O A;  1G8M A;  2HDK A;  3J7A U;  3QO5 A;  5KG7 A;  4DR1 H;  4LCU C;  1V54 C;  4I50 F;  3IAY A;  4DAA A;  2XGQ A;  4JI2 B;  1N32 B;  4X65 O;  3CHX A;  3V6K A;  1IBM O;  4OXS A;  1AP6 A;  5D1O B;  4X66 B;  1I2L A;  1WCM A;  1N36 H;  3PVX A;  5IYC G;  3CJH B;  1R3K C;  1CKN B;  2B1I A;  2BE3 A;  4EEQ A;  1A48 A;  4FJC C;  1S10 A;  2EJ2 A;  1DTO A;  1TWA A;  2GTS A;  4O81 A;  4CH6 A;  4JI1 H;  3DTF A;  4O7W A;  1SQQ H;  2OTL V;  1N4C A;  4PI0 A;  4UCO A;  3K03 A;  1IBM H;  2X7R B;  2CTQ A;  1QLE C;  5KT4 A;  4J11 A;  3A0R A;  3CQZ A;  1AUX A;  3AG1 B;  1DK1 A;  4O2B B;  1GMG A;  1RFY A;  4X1Y A;  3BQ1 A;  4RB2 C;  3G8C A;  1R9T A;  3AYH B;  1HWY A;  1EN5 A;  3SYA A;  3PR4 A;  5LOV A;  4LF7 O;  1O75 A;  4U7C A;  2C00 A;  3EXA A;  1XHX A;  2A1H A;  3KHL A;  3F7V C;  2C2D A;  4K8X A;  2VA3 A;  4J9O A;  4LFB B;  4QJF B;  4ED2 A;  2HFE C;  3K5L A;  3K59 A;  4I4T A;  1CKO A;  4O4I F;  2WLI A;  2NVX A;  1Q43 A;  3QO8 A;  3K58 A;  4F6E A;  2ZM6 H;  3GTO A;  3HKB A;  4LF7 H;  1A0I A;  2OCH A;  2RGV A;  4J7J A;  1R3J C;  4JAS A;  4A3E G;  3GTK A;  5DQH A;  2DYS C;  2L6L A;  3JAL B;  1W0K G;  3LUT B;  3RFR A;  1MSW D;  4UCR A;  2CGO A;  2XCA A;  2W9A A;  2QTS A;  1OCC C;  3QWU A;  5DGA A;  4X64 B;  4R8C A;  5IJ0 A;  4ZIB A;  1Y74 B;  2HGX A;  4QPK A;  4YY3 B;  5JQW A;  3GWO A;  4DIM A;  2ZQM A;  5KFR A;  1AR5 A;  2YIC A;  3FD9 A;  5KT5 A;  2UUC H;  3GVM A;  1WPB A;  2Q4P A;  4EBE A;  1VF5 B;  4GLW A;  4FMT A;  3ZRX A;  3H40 A;  3F7Y C;  3LSQ A;  4DK1 A;  4MVU A;  1VQ5 V;  2EZO A;  3ABU A;  3N27 A;  2XTA A;  1AN7 A;  1JXL A;  1I5Y A;  2WAM A;  3O65 A;  4R50 A;  1NZ6 A;  1QVG U;  4O4H F;  1WH2 A;  1VF6 C;  3NXS A;  4NVP A;  4CKB A;  2VPS A;  1IXM A;  1I50 A;  2Y4T A;  4I55 A;  5DAA A;  1KJQ A;  1GLV A;  1XOU A;  1GSH A;  5KFA A;  2ZDI A;  4LNU A;  3R5F A;  2ODM A;  1WP7 A;  5DG8 A;  4WBN B;  3ML0 A;  4X1I B;  4MV7 A;  2JEX A;  2FE3 A;  4QWB A;  4NR1 A;  2Z0A A;  3T99 A;  1KU9 A;  2ZNJ A;  4TUY F;  1Z2O X;  1HNW B;  2CH7 A;  2DYR C;  2WPD G;  3ZMZ A;  2Q7D A;  4LFA B;  4GC6 A;  2N05 A;  2QEX V;  2FB9 A;  3N8D A;  5KT7 A;  4TQD A;  2E5L O;  5GON F;  2VQF O;  4MVS A;  5BMV A;  5CA1 A;  3M9M B;  1YEW A;  4P2Z A;  5LP6 A;  4ZQI A;  4JI8 B;  3A2F A;  3E35 A;  3H3V H;  1TAE A;  1Q81 W;  1QCE A;  2CAZ C;  4ZHQ F;  4PDL A;  4MVO A;  2CTW A;  2CTR A;  2B63 G;  4IRD A;  5LMN B;  2HHH H;  4EB6 B;  2E5L H;  2DOS A;  3OT7 A;  3K9A A;  4DV7 O;  5I60 A;  2XGP A;  2EIJ B;  4E6N A;  5A2Q W;  2K1E A;  2F1M A;  2DLN A;  4LH7 A;  4J7K A;  1F4M A;  3LNN A;  2DMX A;  5JQG A;  3MWM A;  1B06 A;  3GTJ A;  1SQV H;  2BCC H;  3ZMU A;  1JDB B;  4FM1 A;  1X9N A;  5KFQ A;  1N33 H;  5KFB A;  4OPH A;  2ZE8 A;  5KAF Z;  3JAK A;  3CCR V;  3L2P A;  4BBR G;  2ZIN A;  2J9G A;  4DV7 H;  1VQ7 V;  4JI2 O;  1N32 O;  4NXM H;  2DW4 A;  2UVW A;  3AG2 C;  2DIK A;  4X66 O;  3WWJ A;  4DV2 H;  1VAR A;  1K1S A;  1KB9 F;  1PV0 A;  5CA0 B;  2JDI G;  2ZE5 A;  5A2Q N;  4EGQ A;  3WO1 A;  4NYE A;  3PO2 G;  2FK3 A;  2IJI A;  5J2U F;  1K73 W;  5KUM A;  2WAQ E;  4PI2 A;  2Y4R A;  4JI2 H;  2WLM A;  2IMW P;  3GIP A;  4O3S A;  3RYI B;  2YSU B;  2YU9 A;  1C3O A;  5C1P A;  4X66 H;  3OMI B;  3GLK A;  3RWR D;  5HFL A;  3KTM A;  4IHJ F;  5KFY A;  3BAA A;  4DR3 B;  2PYJ A;  1VP7 A;  3S3X A;  1V55 C;  5DM6 V;  5HBR B;  4MT8 A;  4NTY A;  4U3F H;  2JJ2 G;  2ZXW B;  3GB7 C;  3AG7 A;  2EIM B;  3NC0 B;  3JCZ A;  4OX9 B;  3UYY A;  5HFM A;  5L9X A;  3E8F A;  4ECW A;  4QIW F;  2AHY A;  1NJI W;  5J2T F;  4LFB O;  2GPW A;  3HKD A;  2FLN A;  4DQN A;  3VNN A;  5FLX N;  3SYC A;  4YJ3 A;  3KAL A;  2W6M A;  2H8P C;  5BWV A;  2YUA A;  5IYB O;  3UZB A;  5BWR A;  2W8L A;  2UXX A;  1GAX A;  2EIN B;  3MDS A;  1DGS A;  3ZHQ A;  1AIL A;  3B8N A;  3J81 N;  3OTF A;  4DK0 A;  3PW7 A;  2EUL A;  3CCU V;  2ASL A;  4BW9 A;  3ZHV A;  4ZI7 A;  3RYF B;  5KHJ A;  1KP3 A;  2AU0 A;  4LFB H;  3JSL A;  1JVM A;  2LW1 A;  5LYJ B;  4ED1 A;  3O9O A;  4XYM B;  1HNZ H;  3MR2 A;  4K35 A;  1P7B A;  4X64 O;  2ZNI A;  4FFN A;  1YIJ V;  5L1L A;  2I87 A;  4YY3 O;  4MV9 A;  5LHH A;  3U0G A;  2YZL A;  2WLL A;  5DMX A;  4TQS A;  4CH3 A;  4HNT A;  4ECT A;  1BGY H;  5JH7 B;  3ZRW B;  4FFR A;  1KBH A;  4O7T A;  3FB5 C;  2QKA A;  2LJ2 A;  4J0M A;  3B2E E;  4X8A A;  2IJH A;  4LF9 B;  1Q82 W;  4JI4 B;  5LOV F;  4X64 H;  2A9H A;  2JA7 G;  4ICG A;  4J9M A;  2JA6 A;  2VA2 A;  2HJF C;  1S5L Z;  3VQX A;  2H3O A;  3IGA C;  4ECY A;  4R8U B;  2R8K A;  1SQX H;  4I4T F;  4MTG A;  2YZN A;  4NZM A;  1MZB A;  4H0L B;  3JAT B;  4YP3 A;  4AQY B;  3K08 A;  3HB9 A;  3E8G A;  3M8A A;  3V4Z A;  1K4C C;  4DLK A;  3ZN1 A;  5C5J A;  2ZDQ A;  4WFH A;  2GQS A;  3APQ A;  3ZMS A;  1HNW O;  4LFA O;  1K8A W;  4O4L A;  4BIZ A;  1RSO A;  3A0H Z;  1N48 A;  1MA1 A;  3BA8 A;  3JYC A;  5LA6 A;  1ZQ7 A;  5EDW A;  4J9Q A;  3K04 A;  4JTC B;  3H0G G;  4JI8 O;  5FD5 A;  1BE3 H;  4Q4C A;  3AG4 C;  4L87 A;  3EYY A;  1Y1W A;  2YIB A;  4JI6 B;  3FB8 C;  4DL3 A;  1GGO A;  1HNW H;  2GBO A;  3QF7 A;  4DRX B;  3BFR A;  3UCS C;  4WFB V;  4RUE A;  5EBM C;  2Z02 A;  1WJZ A;  2P6J A;  3TK1 A;  2CK3 G;  5LMN O;  4DR5 B;  1H2N A;  4W4L A;  1VKZ A;  2IP4 A;  4UV9 A;  3W5O A;  2OTJ V;  2C2R A;  2Q7E A;  4N21 A;  1TVK A;  4JYA B;  1IYD A;  5KFK A;  2FLL A;  3K0D A;  5H5N A;  5KFU A;  5BY1 A;  4X1Y B;  3HR0 A;  4I55 F;  3W1G A;  3HOV G;  4KXR A;  5JVD A;  1VQM V;  2ABJ A;  4TQF A;  3RGX A;  5LOV B;  5DQG A;  4RWU A;  1VQP V;  3QO7 A;  1Y1V G;  3U54 A;  2RMK B;  4MW8 A;  3JAM W;  4WFE A;  3RT3 C;  4X62 B;  5FPR A;  2JVD A;  2AZ0 A;  4TWK A;  2O03 A;  1RPO A;  4I4T B;  2WLI B;  1Q86 W;  4JI5 H;  2VOB A;  4FFB A;  1W59 A;  3R5X A;  3MFH A;  5T14 A;  1YSC A;  3GV5 B;  5BMV F;  3RBZ A;  1ORQ C;  3HKB B;  4BY7 G;  2NN4 A;  1R6N A;  4K6N A;  2P4K A;  5LP6 F;  1FVI A;  1URF A;  1EN4 A;  3E8B A;  2XIG A;  2AHZ A;  1P16 A;  1KT8 A;  3ZBH A;  1IZ3 A;  4AYB E;  2NNU A;  1NKD A;  1EUC B;  4KUM A;  3CC7 V;  1Q6H A;  3NUA A;  4DR3 O;  1SQF A;  5IJ0 B;  3KAK A;  3RV3 A;  4J42 A;  3ZN0 A;  2HJD A;  3SGI A;  3RB6 A;  4FFO A;  3CRR A;  3VBB A;  4MTE A;  4YHH B;  2DN9 A;  1NH2 B;  4A3I G;  4ABM A;  1EKF A;  2EIY A;  4LFC B;  5JQG F;  3OMN B;  3ZHT A;  4OX9 O;  3V6H A;  5EYP A;  3B8M A;  1U97 A;  1SCU B;  4ZOL A;  1EN6 A;  3FB6 C;  3QG5 A;  3OR6 C;  3FKI A;  2XAG A;  5KG6 A;  2W6N A;  2FL4 A;  4H13 B;  1SC5 B;  4LNU B;  4BBS G;  3CYO A;  3TW6 A;  4OX9 H;  2OYQ A;  3P30 A;  5LHI A;  4HBN A;  2W9B A;  4DW0 A;  4K0K B;  3B77 A;  4PA9 A;  1AI4 A;  2CH7 B;  3CWB H;  3E8H A;  4XDJ A;  4RAY A;  3I4N G;  2YCH A;  3MHH C;  3F8N A;  5BMV B;  5CA1 B;  4DR1 B;  2YXH A;  4J10 A;  5LP6 B;  2CFM A;  4CKC A;  1IVS A;  3ETH A;  5IE9 A;  4LF9 O;  2AZ2 A;  4JI4 O;  3I56 V;  2VQD A;  1RJR A;  2FMA A;  2KKW A;  1N36 B;  4L8J A;  4H44 B;  1GM8 A;  4FS1 A;  3RGB A;  2VQE B;  4UVB A;  5LL6 b;  3KHH A;  4ED6 A;  4DR2 H;  4GKJ H;  4RO2 A;  4YIO A;  4PV1 B;  3BY6 A;  4G2K A;  1BZK A;  4JI1 B;  2PZS A;  2IBZ H;  5KFS A;  3MR3 A;  3LDD A;  3PJS K;  5IJ9 B;  3L9D A;  4LF9 H;  4AQY O;  3H1L H;  1EM1 A;  5JQG B;  1NT2 B;  3CX5 F;  5IYB G;  2M7W A;  2FTK A;  1R1B A;  1OCZ C;  1E4E A;  1HNX H;  3JAK B;  3VQY A;  1NVP D;  1O9G A;  2WWW A;  5KFF A;  4MV3 A;  1VAJ A;  3U55 A;  2J6T A;  5KS8 A;  3UFX B;  1SZT A;  5D8D A;  4PDM A;  2J6S A;  4JTA B;  3RB4 A;  2QKS A;  4J9L A;  2D2C B;  2VRZ A;  4JI6 O;  2RDC A;  4K8Z A;  4DV3 B;  2PY5 A;  1V51 A;  4YR0 A;  5LGT A;  2YIB D;  3DTU B;  4F4X A;  3KAJ A;  2NVY A;  2ZM6 B;  2OT5 A;  1HR0 H;  4DR5 O;  5KFX A;  2MK3 A;  3LP8 A;  4HNU A;  3AG3 C;  1VQ8 V;  4IWY A;  2VUM A;  5D5P A;  1BJT A;  1MMM A;  4JYA O;  5C8Y A;  5AG2 A;  3ZS8 C;  3OUS A;  4RB0 A;  3VPC A;  3W1B A;  4DUY H;  3G6B A;  2EJ3 A;  5LHG A;  1AI5 A;  2JS3 A;  1NTK H;  3SPC A;  4DR5 H;  4O83 A;  4LWS A;  2JA8 G;  3D3I A;  2UUC B;  1YF2 A;  2W6P A;  4LF5 B;  4BXX G;  4X62 O;  3HKD B;  5B1A C;  4LF8 B;  3ASO B;  2JRI A;  4U7N A;  4TV9 F;  4JYA H;  1NU1 H;  2RN9 A;  4YJ3 B;  4O4L F;  3CVZ A;  2YL2 A;  3KCX A;  4DV6 H;  5L3C A;  1GSA A;  4CS3 A;  2LW7 A;  3JZI A;  3FYI B;  5L3D A;  1KJ9 A;  1T94 A;  3ZX6 A;  3QNE A;  3D3Q A;  2IA6 A;  2UU9 H;  5LA6 F;  4QE9 A;  2Q2U A;  4I7Z B;  1Y76 A;  3NGD A;  1M93 A;  4TQR A;  4UXN A;  3KRE A;  4ZI7 B;  2CZG A;  5IYZ F;  3G6Y A;  1M9N A;  1B6S A;  4B3R H;  2ASD A;  1VF7 A;  4YJ2 A;  3GIM A;  5JJE B;  2GSM B;  3H01 A;  3E89 A;  2FML A;  2E2I A;  3CB2 A;  4Y8V B;  1P49 A;  4WFF A;  5KFC A;  1QBZ A;  2WLL B;  2W7P A;  3W7T A;  4YHH O;  3JD4 A;  1K83 A;  4BY1 G;  4GX0 A;  5IY5 C;  5KFI A;  1EKV A;  4LFC O;  2PTM A;  4GZR B;  4FLU A;  5JVD F;  5CAE B;  2DPI A;  4JV5 H;  3VQV A;  2ZR3 A;  3RYF A;  1AJN A;  1FJG B;  4IWX A;  5KG3 A;  2CE4 A;  4DV5 H;  3Q2O A;  5B3S B;  1JFF B;  4OGQ B;  4QE7 A;  3ABL C;  4GX2 A;  2R6F A;  1VBG A;  1A0G A;  4CC5 A;  1KD1 W;  3SJC C;  5EIB D;  2Q68 A;  4JAA A;  4UB6 Z;  2HHH B;  3TII A;  4LFC H;  1ENV A;  1NS1 A;  3G67 A;  4KHP B;  5JH7 A;  1NR1 A;  3HKZ E;  3ZRW A;  2J6U A;  4ECS A;  3IC7 A;  5E79 Z;  1ZL8 A;  4WFA V;  3TY9 A;  3SPI A;  1I1M A;  4K0K O;  5LXT A;  5CE8 A;  3PR5 B;  4O4L B;  1K9M W;  4M7E A;  1K1Q A;  2HR3 A;  1BT8 A;  1RSO B;  1VQ4 V;  4FLZ A;  1N33 B;  4ETS A;  1I3Q A;  4DR1 O;  3SDL A;  2WAQ A;  2DQ3 A;  4NB5 A;  5LA6 B;  1RK5 A;  3BPZ A;  3L73 H;  3ETJ A;  1Q8I A;  4NXM B;  5C44 G;  4Q44 A;  5KG2 A;  4K0K H;  1JJO A;  1X4T A;  4DV2 B;  1N36 O;  2NU6 B;  3WG7 C;  3W7S A;  1M57 C;  2QKC A;  1YDX A;  2N74 A;  2ADP A;  2VQE O;  3CCS V;  2IU3 A;  3EPG A;  3G80 A;  3SJA C;  2W0X A;  4QGP A;  5B5E Z;  1E1Q G;  1WB7 A;  1QNM A;  1TVK B;  4JI1 O;  2W6I G;  5IDJ A;  2AQ4 A;  4U6P A;  4JF3 A;  2YWV A;  2DQ0 A;  2RCV A;  4IGG A;  1GN2 A;  5JVD B;  1QLN A;  1KJJ A;  3HKC A;  2VQE H;  2Y69 B;  5KFW A;  3T5J A;  1IYE A;  5KT6 A;  2KSD A;  4DRX A;  2W8K A;  4F6R A;  4TV8 A;  1SFO A;  3ASN C;  4NTW A;  1S5J A;  4A3B G;  1YTF B;  4OPA A;  2HG8 A;  4FFB B;  3PZP A;  5GTH Z;  3T1Y H;  3ZHR A;  2BR0 A;  3I12 A;  4RUF A;  1L0N H;  1FPO A;  3VOU A;  1KUQ A;  5DGI A;  2DWC A;  2C28 A;  4DV3 O;  2GUZ B;  4ED8 A;  3TGU H;  2FPI B;  3UO3 A;  4QW9 A;  3LSU A;  3H9V A;  2ZM6 O;  1V54 B;  2NU8 B;  2QWQ B;  5KLV H;  4WBN F;  3T1H H;  3C3S A;  1RYS A;  1ZX3 A;  3HT5 A;  3IFX A;  4H33 A;  4DV3 H;  3HXL A;  1HNZ B;  5EIB C;  3GV7 B;  1B6R A;  1SF9 A;  4QNH B;  2EIK C;  4A3M G;  1GH6 A;  5EYP B;  5KG1 A;  2UUC O;  1PM9 A;  4LF5 O;  2R7Z A;  1KC7 A;  3N44 B;  4LF8 O;  3C3T A;  3CCE V;  4ZOL B;  4QWE A;  1OHH G;  3K3V A;  4FLY A;  2EBO A;  1TWC A;  3EHB B;  4XDK A;  1IBK B;  2BTQ A;  3FKS G;  1Y66 A;  3WB1 A;  4JI7 H;  4JYY A;  3N40 P;  1JX4 A;  1M7J A;  4Q8E A;  1WCM G;  3L4J A;  1WR2 A;  4LF5 H;  1YHQ V;  4ECU A;  1OCO C;  2W9B B;  4O3Q A;  4LF8 H;  2R7K A;  4JYB A;  4Q6G A;  4O7S A;  3CXH F;  3U9S A;  5BR8 H;  3NBZ B;  3T2M A;  2C22 A;  2WLJ A;  4DUZ B;  4J9K A;  3GTL A;  2QWP B;  5KG0 A;  2P06 A;  2Q73 A;  3R66 A;  1MOF A;  2JA5 A;  1E4G T;  1P84 F;  3BCC H;  2HVQ A;  3E83 A;  2DYS B;  5CBG A;  3HBL A;  5KA6 A;  1S77 D;  3K3P A;  2FKX A;  1GN3 A;  3APO A;  5CA0 F;  2OCC C;  2CW7 A;  1FJG O;  1OCC B;  4HNA A;  4MTO A;  2P7T C;  3UKM A;  4UCS A;  1DV2 A;  2HJW A;  3BVO A;  3A0B Z;  2EJ0 A;  4UCU A;  3CCV V;  2HHH O;  3HOW G;  2R87 A;  1UPG A;  3K5N A;  2SCU B;  1CEZ A;  3CSX A;  4MAM A;  4E2L A;  4KHP O;  2HGS A;  4M9U A;  2JEI A;  3W7X A;  1KEC A;  3DF7 A;  3N42 B;  1J5E H;  1E4E B;  1FJG H;  2GPS A;  1YVW A;  3JAR A;  2ZJT A;  4I0X A;  4DV0 B;  1QR9 A;  5GTI Z;  3M9O B;  5JCO C;  2R70 A;  2PBZ A;  3Q1K A;  2AXT Z;  4GX1 A;  5IT9 W;  1MZE A;  4R7C A;  1N33 O;  4M0J A;  1TWH A;  3SJQ C;  4AIL C;  4CZZ A;  1QVF U;  1X59 A;  4IIJ A;  4KHP H;  4AYB A;  1S0O A;  3K5M A;  4NXM O;  4TVI A;  1DAA A;  4O84 A;  1XRE A;  5KMG A;  1EUD B;  1OBD A;  1PX2 A;  1MAB G;  4DV2 O;  5IJ9 A;  4O3P A;  3OEE G;  4JI5 B;  3BAC A;  1XL6 A;  2DYR B;  5KUK A;  3R65 A;  3M4I A;  1PKX A;  5KFM A;  4C5A A;  1CQJ B;  1YI2 V;  2QM7 A;  3WWI A;  3SYP A;  1G2W A;  2HHF A;  1OV9 A;  3T9A A;  5IT9 N;  5KX5 A;  5LYJ F;  5C8Y B;  1SQG A;  4EGJ A;  3P3P A;  4FFL A;  3SJB C;  4ZBM A;  2W57 A;  1J95 A;  4NTX A;  1M0W A;  3L71 H;  4RAZ A;  2Y0I A;  2GTA A;  4LWS B;  5JH7 F;  2AGP A;  1YXB A;  1BQ0 A;  1GTO A;  3EVK A;  1Q7Y W;  2ATK C;  4X88 A;  1F7Y A;  2KQX A;  4J9Y B;  4CS2 A;  4HQ6 A;  5DLG A;  2KG7 A;  3PW0 A;  1B6Q A;  5FLX W;  4IYI A;  3STZ C;  2ZXW C;  5KAI Z;  3E2E A;  4IRK A;  2OIG A;  2L35 A;  1KYO F;  2IM9 A;  4MV6 A;  1Z2N X;  2FKL A;  4LSA A;  4LF4 B;  1ZHQ A;  3G6X A;  1NQT A;  3J81 W;  4FBU A;  4EYI B;  1Y76 B;  2HVJ C;  4MV4 A;  5E1A C;  2HIV A;  4YQW A;  4DR7 B;  3K5O A;  3D36 C;  2P4V A;  1PNM A;  2EIN C;  4U3J B;  4YJ2 B;  3AG2 B;  4QWA A;  3CRA A;  5L3F A;  3GTG A;  1FXK C;  5DED A;  1H38 A;  2V1D A;  1HNZ O;  1WB8 A;  1L2Z A;  4UV8 A;  1KJ8 A;  2W7O A;  5BWX A;  3OEH G;  5KFJ A;  4RQF A;  5FD6 A;  3WU2 Z;  2ITD C;  1S72 V;  1I0H A;  3IG0 A;  4XDL A;  2QB5 A;  2P22 C;  1V9P A;  3HOY G;  4IAJ A;  3JCU Z;  4TV8 F;  1IBK O;  1V55 B;  1VQL V;  2OLS A;  1AR1 B;  4DR2 B;  1D5A A;  4GKJ B;  3R5H A;  3F5W C;  1SET A;  1G6U A;  2IJK A;  1JIH A;  1GYF A;  3KKY A;  1ZL8 B;  2CW8 A;  3KXY T;  5LXT B;  1XK5 A;  3L75 H;  5C93 A;  3CXC U;  1OZ0 A;  1IBK H;  2FPP B;  2QDO A;  2WSS G;  5CA3 A;  1E79 G;  4DUZ O;  5FLM G;  4O4J A;  4PDV A;  1HNX B;  1SEI A;  2YRW A;  1R6T A;  2ZD9 A;  1JFF A;  4FZ0 A;  4O7Y A;  4X20 A;  1QU7 A;  3PW5 A;  2IW5 A;  1GRJ A;  1R6K A;  2QJ1 A;  2E75 B;  2JGD A;  5I5S A;  1GO3 E;  1WNS A;  2LFR A;  5KFE A;  1SRY A;  3CPW U;  5FPO A;  2XOK G;  3BJY A;  1FFX A;  3Q4H A;  5KG4 A;  1BSM A;  4DRF A;  1TGO A;  2RDJ A;  1JX9 A;  4DUZ H;  2BOC C;  3WB0 A;  2VR1 A;  4JTD B;  4PBC A;  5KT2 A;  3G71 V;  3NR7 A;  1HR0 B;  3E5N A;  4EFB A;  3BQ2 A;  3DC5 A;  2AGA A;  1EHI A;  4UFZ A;  3H4D A;  5K3W A;  3T9C A;  3HKC B;  4DUY B;  1BCC H;  4DV0 O;  1R73 A;  2DAB A;  3RUP A;  4J9Z B;  4WF9 V;  4F6R B;  3G6V A;  1CE8 A;  4TV8 B;  2CQY A;  3EPI A;  4F50 A;  3HPL C;  2PI4 A;  5CB4 A;  1RM1 B;  3DGE A;  1BL8 A;  1FKA O;  1Q6I A;  4MA0 A;  4JYC A;  3L74 H;  5JJJ B;  2NUA B;  2R82 A;  5LL6 Y;  2Q7G A;  3T54 A;  3T9F A;  2WLH A;  4JI5 O;  4DV0 H;  4DV6 B;  1K97 A;  1I7F A;  1EKP A;  2HVK C;  2UU9 B;  1YJN V;  3N6R A;  1I08 A;  3K3W A;  5I47 A;  4MW3 A;  3U10 A;  2GQR A;  1LNQ A;  1E1R G;  3CS5 A;  3MWD A;  3BAB A;  1IX9 A;  1FKA H;  1G4Y B;  2HG5 C;  4D7T A;  4B3R B;  2XAQ A;  4PEL A;  3AG4 B;  4B3S B;  2JA6 G;  4DW1 A;  3JZ6 A;  4X9Q A;  1BMF G;  4RU9 A;  2ALZ A;  3RYH A;  4H37 A;  5B1B C;  1ET0 A;  1VIB A;  3VPD A;  1PK8 A;  3JRX A;  4O82 A;  5CA1 F;  2R92 A;  1YJ9 V;  2GUZ A;  1HDJ A;  4GKK H;  3PW2 A;  1JOY A;  1M56 B;  2V9W A;  2ZR2 A;  5FNV A;  4BWA A;  4NYK A;  2QSA A;  2W9C A;  3KHR A;  3QQM A;  1XUQ A;  1H2K A;  2C2A A;  4DL5 A;  2V4D A;  3HKZ A;  2R8H A;  5FL7 G;  3T9B A;  4JV5 B;  3SI8 A;  2BTQ B;  4LF4 O;  1R3L C;  3ABM C;  5KHG A;  4DV5 B;  1EBO A;  2IH1 C;  3TXQ A;  2UVU A;  4IIJ F;  4ED3 A;  2CTP A;  1LUV A;  1CPY A;  1K5Q A;  2DE0 X;  1BS3 A;  2IJJ A;  4DXW A;  4DR7 O;  3ZMV A;  4ECX A;  4L1K A;  5LGU A;  1WLE A;  1Y1W G;  1WP8 A;  3PO3 G;  1CS0 A;  3OE7 G;  2PGG A;  4KFM A;  2ZGI A;  1T3N A;  2X5R A;  4LF4 H;  4A3G G;  5KA5 A;  2KSW A;  3LDC A;  5L1I A;  4AI8 A;  5KX5 F;  3CRQ A;  4XBF A;  2HVR A;  3SR2 C;  4DR7 H;  2F4V H;  5EC2 C;  2XC9 A;  3C90 A;  2F23 A;  3ETD A;  1GSO A;  3KG2 A;  4HNA B;  3IJ4 A;  4UVA A;  5LP6 C;  1IOW A;  2CNU A;  4CE5 A;  4MV1 A;  2QM8 A;  2JEJ A;  2I80 A;  3FAV A;  3DAA A;  1Y6X A;  2AGQ A;  4DR2 O;  4GKJ O;  4XX0 B;  1EZ1 A;  3G8D A;  2UXN A;  2YS7 A;  4DR6 B;  1S9F A;  5K1P A;  4DV1 B;  1XNQ B;  4O86 A;  3RYC A;  2X6A A;  5H6Q A;  4U7O A;  3JAR B;  3CCM V;  3M9N B;  4I0X B;  2YYA A;  4A2B A;  2X6B A;  1H8E G;  5K2M A;  4F4W A;  3FFQ A;  3ZIA G;  4BAY A;  5H2F Z;  1HNX O;  1M6V A;  5D1P A;  1I7L A;  3AX6 A;  1B04 A;  1ROP A;  4IIJ B;  4RUA A;  1MZF A;  4FFM A;  4YJ3 F;  4J9R A;  3FX7 A;  5EC1 C;  5KMG B;  4K3A A;  2VWJ A;  5KFO A;  4FU0 A;  1EZV H;  2QWR B;  3EFF K;  3T1Y B;  3N43 B;  5H6R A;  4B3M H;  1Y67 A;  5ITZ B;  3GB8 B;  4ED7 A;  4ZI7 F;  3ZCC A;  1ZUQ A;  3OW2 U;  3TW7 A;  2PMZ A;  1RYR A;  2HHF B;  5I5T A;  4PHZ A;  2JJ1 G;  1HR0 O;  3OAA G;  2UVR A;  5KX5 B;  5H80 A;  1F23 A;  1VF6 A;  2RQ6 A;  3N6X A;  4FS2 A;  2R93 A;  4JZ2 A;  3S24 A;  4O4I A;  4O2A B;  3WNZ A;  3T1H B;  1TWG A;  4X65 B;  2WB1 E;  1XNR H;  5DQI A;  4IYH A;  4D7S A;  4FGR A;  5C4X G;  3FKI G;  4DUY O;  2BSK A;  3E22 B;  5LGN A;  3UT5 A;  3T7A A;  3JD1 A;  5I5X A;  2ATL A;  2KG7 B;  3KZI Z;  1XDC A;  1K92 A;  1LR1 A;  1THZ A;  1Z5V A;  1OCZ B;  2UXB B;  3ASO C;  4G28 B;  4DV6 O;  2YXL A;  3GIK A;  3W7W A;  3ABK B;  2ITC C;  2A7W A;  2UU9 O;  2WLN A;  4JI7 B;  1TUB A;  4O3R A;  2CGN A;  4C7U A;  2JEG A;  1AJQ A;  4O7N A;  4CHI A;  3HKE A;  2RNB A;  1KMI Z;  1KUT A;  2QTO A;  4DL7 A;  4FLV A;  4B3R O;  5H9C A;  4B3S O;  3JD0 A;  3H1H H;  4O4H A;  2CDY A;  4Z2W A;  1BGW A;  5BR8 B;  1K7D A;  3NBY B;  2EZP A;  1YTF D;  1F4N A;  4O7L A;  2R8G A;  3MHS C;  4YR2 A;  2X6C A;  1D5N A;  1VMG A;  2VWK A;  4B08 A;  5IYD O;  4PZ6 A;  2RJZ A;  1H2L A;  1XMQ H;  4J80 A;  4TUY A;  4B3S H;  5EBL C;  3JRW A;  5EK0 A;  4U3J A;  1ZAU A;  4JV5 O;  2ZE7 A;  1OCR C;  3M99 B;  3E86 A;  2CUG A;  1OJH A;  1BHA A;  2UUB B;  4QWC A;  3L72 H;  3ETE A;  4DV5 O;  4MVR A;  2ZIO A;  5GON A;  3I55 V;  1IBL B;  3I5D A;  5B3S C;  2PVP A;  3TXS A;  2UXD B;  1L0L H;  3HOZ G;  2EIL C;  3P3N A;  4NKG B;  3Q8S B;  5TIS Z;  5B1A B;  4P9O A;  4A3L G;  4ZHQ A;  4DL2 A;  1CQI B;  1J5E B;  4O4J B;  4XZ3 B;  2A0L A;  2F66 C;  4A3J G;  1IXB A;  3CRC A;  4PA6 A;  2FLP A;  5KHI A;  3X2Q C;  4X20 B;  4JXU A;  4FM0 A;  1VQO V;  4A3F G;  2JGD B;  2O57 A;  2VUM G;  5BZB A;  3KCY A;  5EZY A;  1SA0 A;  5LMU B;  1NBM G;  3WO0 A;  2NU9 B;  2EJ7 A;  2HKO A;  2ILM A;  1FFX B;  2DWE C;  4QW8 A;  3TIN A;  2OH2 A;  3D36 A;  3Q4H B;  1A3G A;  3GTM A;  1I5X A;  2XT9 A;  3RW0 A;  4LF6 H;  4LSX A;  1H2G A;  1FXK A;  3SPG A;  2Q0A A;  2HEP A;  1MSD A;  2IH3 C;  2X0S A;  2Q69 A;  1HW7 A;  4A3C G;  3B09 A;  3MAQ A;  1KKD A;  1F51 A;  2CNQ A;  4QPJ A;  2I8C A;  2V5A A;  4O3N A;  4DR6 O;  4EYH B;  5DGH A;  3ICX A;  1W93 A;  4PZ8 A;  2E74 B;  4DV1 O;  1XNQ O;  4TM5 A;  3K0G A;  4G3I A;  1SQP H;  3SNO A;  3V6J A;  4EFE A;  5D5Q A;  2YRX A;  4MVQ A;  1M0T A;  3U9T A;  4WFG A;  1NVP B;  3TY5 A;  1K33 A;  1JMK C;  2UXC B;  2YW2 A;  2LO1 A;  2ARH A;  3K06 A;  1RJP A;  2QK4 A;  2R9R B;  1Z2G A;  5CB4 B;  4RNM A;  1I2K A;  1DIK A;  4EQ5 A;  5B1O A;  1ARO P;  2Y69 C;  2QWO B;  4DR6 H;  4LP8 A;  4ZOL F;  5C3E G;  2Q0O C;  4IHJ A;  5KT3 A;  1DF5 A;  4Q45 A;  5CM0 A;  4RB1 A;  2LGQ A;  4DV1 H;  3JD3 A;  1XNQ H;  2IU0 A;  4J7Z A;  2BQR A;  4JZG A;  4C5B A;  4PWQ A;  2RGR A;  3PFF A;  2C35 B;  4APM A;  4FPP A;  5B66 Z;  3T1Y O;  4GT1 A;  4CMD A;  2XAF A;  4FE2 A;  1MNG A;  2ETN A;  3OFN G;  2BQ3 A;  5CBH A;  3JAW A;  4NZO A;  1W96 A;  3AG1 C;  1MG1 A;  3QTC A;  2FJZ A;  3GTP A;  2VS0 A;  5J2T A;  4CH4 A;  4QIW A;  5IWA B;  1FXH A;  1FFT B;  3BA9 A;  3CC4 V;  1BQZ A;  2LQT A;  2E3C A;  2QGN A;  3N2G A;  1RJQ A;  3T1H O;  4DR4 B;  2PUS A;  3RYH B;  4IR9 A;  1O9H A;  3P32 A;  3F5T A;  2R7M A;  4RQE A;  3WG7 B;  2R9A A;  4X1K B;  3RN4 A;  2W6Q A;  1M57 B;  1I94 B;  3OSP A;  1GN6 A;  3S3W A;  2WTF A;  1S0V A; 
#chains in the Genus database with same CATH homology
 1Z5W A;  4TQF A;  5FNV B;  3RGX A;  5LOV B;  3JAS B;  1N34 H;  2GV9 A;  4NXN B;  4LF7 B;  4CS2 A;  3JAM W;  3L4K A;  5FLX W;  3FMA A;  3RJ0 A;  2WYO A;  4X65 H;  4X62 B;  5FPR A;  2JVD A;  2O03 A;  2YI9 A;  2IM9 A;  4I4T B;  1Z2N X;  5DIS C;  2Q2T A;  4LF4 B;  4LSA A;  4JI6 H;  4JI5 H;  2VOB A;  4FFB A;  1ZHQ A;  3J81 W;  4UCT A;  2OWO A;  3HKB B;  1Z2P X;  5CA0 A;  1CKM A;  2HIV A;  1FVI A;  4DR7 B;  2XIG A;  3K5O A;  4I9Q A;  1P16 A;  4U3J B;  4YJ2 B;  3RYI A;  2UXB H;  3KAK A;  1SQF A;  5IJ0 B;  3GDE A;  3SGI A;  1L2Z A;  2MCT A;  3N41 B;  1ZHS A;  4MTE A;  4YHH B;  1M5I A;  5FD6 A;  1XMO H;  4LFC B;  3IG0 A;  2P22 C;  1V9P A;  4CH5 A;  4X62 H;  5EYP A;  4IAJ A;  3RGZ A;  4I50 B;  5KHH A;  4ZOL A;  4CS4 A;  4FLT A;  3RF2 A;  4RZQ A;  3QG5 A;  4DR2 B;  1D5A A;  4GKJ B;  2UUA H;  3THO A;  3ZED A;  3RYC B;  1G6U A;  4LNU B;  3UQ8 A;  2HVS A;  4OX9 H;  2OYQ A;  4FLX A;  1GYF A;  2CW8 A;  3KXY T;  5LXT B;  4GLX A;  1XK5 A;  1XQ8 A;  4HBN A;  2UUB H;  2WE6 A;  4K0K B;  1IBK H;  5JVD A;  3RTX A;  1S68 A;  1Q3E A;  4O4J A;  1HNX B;  5LYJ A;  1SEI A;  1IBL H;  1JFF A;  4RAY A;  2YCH A;  4YHH H;  2UXD H;  4X20 A;  3F8N A;  2QJ1 A;  5BMV B;  5CA1 B;  4DR1 B;  2E5L B;  1WNS A;  5LP6 B;  2VQF B;  4A2A A;  2CFM A;  5FPO A;  1FFX A;  4KL1 A;  3WB2 A;  5J2U A;  4DRF A;  3J7A K;  2XHB A;  2KKW A;  1TGO A;  1N36 B;  4L8J A;  4DUZ H;  3VQW A;  3WB0 A;  5KHK A;  4TV9 B;  3RGB A;  2VQE B;  5LL6 b;  4DR2 H;  4GKJ H;  5LMU H;  1HR0 B;  3RR5 A;  3BHP A;  4O4I B;  4R7R A;  4EFB A;  4JI1 B;  2PZS A;  4LMY A;  4FLW A;  4DV7 B;  5IJ9 B;  4LF9 H;  4UFZ A;  5IYZ B;  5JQG B;  3HKC B;  1NT2 B;  4DUY B;  3JAT A;  3UT5 B;  1HNX H;  3OTO B;  2JS5 A;  4F6R B;  3JAK B;  3VQY A;  4TV8 B;  1O9G A;  1L8D A;  1P8L A;  5ITZ A;  4AHC A;  2P5O A;  4GKK B;  4JI3 H;  4CC6 A;  4JI0 B;  4DR1 H;  5CB4 A;  1S03 G;  4LR3 A;  3IAY A;  2VQF H;  4JI2 B;  1N32 B;  3CHX A;  5JJJ B;  3PN1 A;  4O2A A;  5D1O B;  2UXC H;  4X66 B;  2Q7G A;  4DV0 H;  1N36 H;  4DV6 B;  4K8Z A;  1I7F A;  1TUB B;  4DV3 B;  2PY5 A;  1CKN B;  4B3T B;  2YIB D;  2JGU A;  2UU9 B;  3E22 A;  3KAJ A;  2QM4 A;  3HKE B;  4PZ7 A;  4EEQ A;  1HR0 H;  3U10 A;  2ZM6 B;  3BAB A;  3N2K A;  4CH6 A;  1FKA H;  4JI1 H;  4O4H B;  4D7T A;  4B3R B;  4B3S B;  1IBM H;  4PI0 A;  4UCO A;  5D5P A;  1BJT A;  5C8Y A;  3ZS8 C;  4RB0 A;  3W1B A;  3RYH A;  4DUY H;  4O2B B;  4X1Y A;  4GKK H;  4RB2 C;  4DR5 H;  5IWA H;  2WDT A;  5FNV A;  2F4V B;  4BWA A;  4TUY B;  5LOV A;  1O75 A;  3JAS A;  2UUC B;  1XHX A;  1TA8 A;  4LF5 B;  4DR4 H;  1N32 H;  2V4D A;  3HKD B;  4LF8 B;  4JYA H;  4K8X A;  4JV5 B;  4YJ3 B;  3CVZ A;  4LFB B;  2BTQ B;  3KYH C;  5GON B;  3H20 A;  1I94 H;  5KHG A;  3K5L A;  4DV6 H;  4DV5 B;  2Q7H A;  4CS3 A;  4I4T A;  3K59 A;  1CKO A;  2UU9 H;  1Q43 A;  3K58 A;  2ZM6 H;  2Q2U A;  4NXN H;  1M93 A;  3HKB A;  4LF7 H;  1A0I A;  4ZHQ B;  4ZI7 B;  2RGV A;  4B3R H;  1VF7 A;  2PGG A;  3JAL B;  3RFR A;  4YJ2 A;  4LF4 H;  4UCR A;  5JJE B;  2KSW A;  1QQC A;  3QWU A;  4X64 B;  3CB2 A;  1SA0 B;  1P49 A;  5EZY B;  2YIA A;  4ZIB A;  5IJ0 A;  2HVR A;  3SR2 C;  4YY3 B;  4DR7 H;  2F4V H;  2UUC H;  2PTM A;  4FLU A;  1WPB A;  4HNA B;  5LP6 C;  4JV5 H;  3VQV A;  3RYF A;  1FJG B;  4B3M B;  4DV5 H;  4DK1 A;  1JFF B;  1AN7 A;  4CC5 A;  3SJC C;  1WH2 A;  5EIB D;  2HHH B;  4NVP A;  2VPS A;  4DR6 B;  4LFC H;  5K1P A;  4I55 A;  4DV1 B;  1XNQ B;  5J2U B;  3RYC A;  1H2S B;  4KHP B;  4LNU A;  5JH7 A;  3JAR B;  1XNR B;  5K1X A;  3TY9 A;  2R72 A;  4WBN B;  4X1I B;  5LXT A;  4MV7 A;  4A2B A;  2FE3 A;  1KU9 A;  2ZNJ A;  3FFQ A;  4O4L B;  1Z2O X;  1HNW B;  4M7E A;  5D1P A;  4ETS A;  1B04 A;  4IHJ B;  4FLZ A;  4LFA B;  1N33 B;  4YY3 H;  4IIJ B;  5LA6 B;  4TQD A;  5KMG B;  3BPZ A;  1VS0 A;  2BTO A;  5BMV A;  5CA1 A;  2VWJ A;  1YEW A;  1Q8I A;  4NXM B;  5LP6 A;  4DV4 B;  4JI8 B;  4K0K H;  1JJO A;  1X4T A;  4DV2 B;  3T1Y B;  3GJX B;  3A2F A;  3JAW B;  3N43 B;  4B3M H;  1TAE A;  2CAZ C;  5ITZ B;  3GB8 B;  5J2T B;  4PHZ A;  4TV9 A;  3SJA C;  1N34 B;  5LMN B;  5KX5 B;  3N2G B;  2HHH H;  4EB6 B;  2RQ6 A;  2E5L H;  3N6X A;  1TVK B;  3S24 A;  4O4I A;  4O2A B;  3T1H B;  4E6N A;  5A2Q W;  4X65 B;  1XNR H;  2F1M A;  4LH7 A;  4D7S A;  5JVD B;  3BRC A;  3U11 A;  3LNN A;  5IYZ A;  5JQG A;  3E22 B;  3MWM A;  3HKC A;  4I7H A;  2VQE H;  4BWS C;  3UT5 A;  4FM1 A;  1X9N A;  1N33 H;  1WN7 A;  4DRX A;  4LFA H;  2HIX A;  4F6R A;  3JAK A;  3L2P A;  4TV8 A;  4RB3 C;  2ZIN A;  4DV7 H;  1I6U A;  5EOY A;  1S5J A;  1XMQ B;  4NXM H;  4FFB B;  4JI8 H;  1Z5V A;  4DV2 H;  3T1Y H;  2UXB B;  3C0F B;  2YXL A;  5D1O A;  3OTO H;  5CA0 B;  4X1K A;  4PDB A;  4JI7 B;  1TUB A;  1CKN A;  3JSN A;  5LMN H;  4JI0 H;  3HKE A;  1KMI Z;  4PI2 A;  4JI2 H;  1XMO B;  4FLV A;  3RYI B;  3T1H H;  3M7M X;  4X66 H;  4O4H A;  1BGW A;  3RWR D;  2F93 B;  1M4U A;  5BR8 B;  3BAA A;  5JJN B;  4DR3 B;  2PYJ A;  3NBY B;  3HXL A;  1HNZ B;  4DV3 H;  4B3T H;  5EIB C;  4O2B A;  2UUA B;  1E4F T;  2ZCE A;  2VWK A;  4B08 A;  4PZ6 A;  1Q5O A;  5EYP B;  2RJZ A;  3NC0 B;  4OX9 B;  1XMQ H;  4TUY A;  4B3S H;  3N44 B;  4ZOL B;  4U3J A;  1ZAU A;  3U0Z A;  3K3V A;  4LF6 B;  4FLY A;  2UUB B;  3HKD A;  1IBK B;  3VNN A;  3ETQ A;  4YJ3 A;  3KAL A;  2BTQ A;  2ZIO A;  5GON A;  3DSQ A;  3WB1 A;  4JI7 H;  1IBL B;  3N40 P;  4FVM A;  1QHT A;  2UXD B;  1DGS A;  3OTF A;  4DK0 A;  3L4J A;  4LF5 H;  4BW9 A;  4ZHQ A;  4ZI7 A;  4LF8 H;  3RYF B;  5KHJ A;  4LFB H;  3JSL A;  4Q6G A;  1J5E B;  4O4J B;  3NBZ B;  5BR8 H;  2F66 C;  5LYJ B;  4DR3 H;  1SYX B;  3JAL A;  4I50 A;  1XHZ A;  3LML A;  5KHI A;  1HNZ H;  4DUZ B;  4X20 B;  2ZNI A;  4FM0 A;  4TOI A;  4MV9 A;  1E4G T;  4I55 B;  1SA0 A;  5EZY A;  5LMU B;  3RIZ A;  1T5E A;  4CH3 A;  2HVQ A;  2VUG A;  1FFX B;  5JH7 B;  2YI8 A;  4J0M A;  3B2E E;  4LF9 B;  4LF6 H;  1SKV A;  4LSX A;  4JI4 B;  2CW7 A;  2Q0A A;  2HEP A;  4HNA A;  1HW7 A;  4UCS A;  4X64 H;  3MAQ A;  4JI3 B;  4UCU A;  3VQX A;  4FM9 A;  3K5N A;  3CSX A;  3ICX A;  4PZ8 A;  2HGS A;  2EX3 A;  5D5Q A;  4EFE A;  1MZB A;  3JAT B;  1M0T A;  4AQY B;  3DF7 A;  3N42 B;  1J5E H;  3TY5 A;  1FJG H;  1JMK C;  2UXC B;  3JAR A;  2ZJT A;  4DV0 B;  4LH6 A;  4WBN A;  2R70 A;  5JCO C;  4X1I A;  5IT9 W;  1XDN A;  5CB4 B;  2PYL A;  4EQ5 A;  4O4L A;  4Q0Y A;  4DR6 H;  4AIL C;  1RSO A;  4IHJ A;  4DV1 H;  1XNQ H;  4RB1 A;  4IIJ A;  4KHP H;  4UCV A;  3BA8 A;  3K5M A;  5LA6 A;  2RGR A;  5KMG A;  1IBM B;  5FD5 A;  4APM A;  4JI4 H;  2F95 B;  5IJ9 A;  3EYY A;  2YIB A;  4JI6 B;  4JI5 B;  1XI1 A;  1HNW H;  2ZIM A;  4DRX B;  3JAW A;  3QF7 A;  3M4I A;  3N2K B;  3QTC A;  5J2T A;  4CH4 A;  3J80 W;  4DR5 B;  5IWA B;  3BA9 A;  4FM2 A;  3TY8 A;  2E3C A;  5KX5 A;  3N2G A;  3W5O A;  4EB6 A;  5C8Y B;  1SQG A;  4GYC B;  2Q7E A;  4DR4 B;  2PUS A;  3RYH B;  3SJB C;  4MTD A;  1TVK A;  2W57 A;  4DV4 H;  4AQY H;  1O9H A;  4JYA B;  2R9A A;  4X1K B;  4X1Y B;  1I94 B;  3K57 A;  1M0W A;  4RAZ A;  3W1G A;  5JCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...