3BA8A

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba8A02
2VUGA 3BAAA 5D1PA 5BR8B 4DUYB 2UU9B 4DR3B 4DV7B 4JI8B 1P8LA 4TOIA 4DR5B 2UXBB 3T1HB 4KHPB 4EEQA 3RR5A 4UCSA 4JI3B 4LF8B 4X62B 3TY5A 2HVSA 4B3RB 1XMOB 4JI0B 3GJXB 5D1OA 4LFCB 4YHHB 2VQEB 4JV5B 4PZ8A 1XNRB 4DRFA 4K0KB 5FPRA 2VQFB 1XMQB 3L2PA 4DV1B 2HVQA 4E6NA 1HNWB 1N32B 1A0IA 4X65B 1P16A 4DUZB 4LF9B 2UXCB 1B04A 1CKMA 1FJGB 1DGSA 4AQYB 4LFBB 3NBZB 4PZ6A 1HR0B 3QWUA 5DISC 4JI5B 3JSNA 2F4VB 1I94B 3PN1A 4LH7A 3BABA 4DV2B 1IBLB 3BA9A 1HNXB 4JI4B 4EQ5A 4DV0B 4X66B 3S24A 3OTOB 5LMUB 4GLXA 4LFAB 1TAEA 2CFMA 4CC5A 2E5LB 4DV4B 3VNNA 2Q2UA 5LMNB 1IBMB 3TY8A 3RTXA 4UCTA 1N34B 4PZ7A 4JYAB 4DR7B 4DR6B 1N33B 4YY3B 5IWAB 4LF7B 2HHHB 4JI1B 1TA8A 3T1YB 2UXDB 1VS0A 4DR2B 3BA8A 4OX9B 4UCRA 1XNQB 4GKJB 3UQ8A 4UCVA 4LF5B 4NXMB 2Q2TA 3GB8B 1CKNB 4UCOA 1CKNA 4JI7B 2HIXA 4JI2B 2HIVA 4DR1B 1XK5A 1ZAUA 2ZM6B 4DV3B 5FPOA 4DV5B 4DV6B 2UUCB 1FVIA 4NXNB 1V9PA 2OWOA 1S68A 4UCUA 4LF4B 4UFZA 3GDEA 4JI6B 4B3MB 3SGIA 2HVRA 1XDNA 1J5EB 1N36B 1X9NA 5D1OB 3JSLA 4LH6A 4EFEA 4X64B 1HNZB 4DR4B 3KYHC 3NC0B 3W1GA 3W5OA 4B3SB 4CC6A 1IBKB 4B3TB 2UUAB 4EFBA 4LF6B 2UUBB 1CKOA 3NBYB 3W1BA 3TY9A 4GKKB
chains in the Genus database with same CATH superfamily
2YI9A 4QIWA 1G2WA 2XHBA 4CHIA 5BMVA 2QF7A 2XD4A 5DGAA 2V5AA 2Y0SA 4YHHH 4HBNA 4TVIA 3Q8SB 4FS1A 1IBLO 4ICGA 2AZ0A 2F1MA 1SQQH 3UO3A 4ZI7A 3TY5A 5B1BB 3Q8PB 3ETQA 4B3RB 4IIJB 3JAKA 5KX5A 3K5IA 3LP8A 3DTGA 2R9RB 3G6BA 1YTFD 1XNRO 1ZTEA 4IGGA 5IDJA 3L74H 3T1YO 3ETJA 2VPSA 2HHHO 1ET0A 1TWHA 4YIPA 3PO3G 3SE7A 4J0MA 3HBLA 1QHTA 4LFBH 5LYJA 2EJ0A 3OT7A 1BXRA 3IJ4A 2EINB 1B04A 3CEIA 1IXBA 3AG2C 1XNQO 3EYYA 2QM4A 4X66H 3G71V 5DECA 4WFBV 4AI8A 5JQWA 5L1JA 2CW7A 1BT8A 3JCZA 4KUMA 1FKAH 3L73H 1KU9A 3OR6C 1R6NA 4FLVA 4F4LA 4HR7A 3CCJV 3CCEV 2NN4A 5LGTA 5KFLA 2P22C 4ZIBA 1M7JA 5DQHA 2Y69C 1P7BA 5IWAH 3KXYT 2DE0X 4JI1H 1OZ0A 3DSQA 3J7AU 1OCZB 2A3QA 5EZYA 2EIYA 2P5OA 2ATLA 2HHHB 1S76D 3T1YB 5C1PA 3V6JA 2NUAB 3APQA 1FJGO 4RB1A 2YS6A 5JVLA 4JV2A 1GAXA 3M4IA 5CB4B 5E25A 3BY6A 2VPQA 3AW8A 2QM7A 4DR2H 1AJNA 3AG1B 4X89A 3BEHA 3ZCCA 5IJ9A 5HBRB 1E1RG 1VP7A 2UUCB 5IYZF 2QK4A 4O84A 4PHZA 5BWRA 1EZVH 2RGVA 3T1CA 4PDLA 4W4LA 1CQIB 3H1IH 2QB5A 2HJFC 1S97A 2UXNA 2RF4A 4DL3A 3SPHA 4O4LF 4MV7A 3GV7B 1NU1H 2OCCB 4MVUA 2R87A 2UU9O 4MTXA 3RYFA 1IBKB 3FMAA 3KHRA 5KFNA 3RYFB 3RGZA 1I7NA 3I5DA 4DR3B 4DV7B 1RPRA 3M7MX 2YRWA 4Q4CA 1BZKA 2UUAH 1H38A 3ZN1A 2VQEH 1ROPA 1W0JG 4GKKH 3HOWG 1I94O 1VEWA 3ZHRA 3TIGA 1IX9A 1EHIA 4DW1A 3OMAB 1N8RW 5IYCO 3RWRD 4PZ8A 3JAKB 1K5QA 3UZBA 3PO2G 2JEXA 3HB3B 2WWWA 4HNAA 4CS4A 4DRFA 5GONF 5KHIA 5LXTB 2JVDA 4DUZO 3V6HA 3HR0A 4MV3A 1HNWB 3ZRSA 2LW1A 2HEPA 3BVOA 4ECVA 1X59A 1QLEB 4EB6B 2YZMA 4JI5H 3ABTA 5KA6A 5JJNB 1A0GA 3GLKA 5BXZA 1HNXH 2WPDG 2V58A 2HJDA 2XAHA 2JK5C 4QGPA 3MWMA 4DLKA 2JA7G 1YJNV 1PD3A 3ABLC 4MT8A 5KG2A 1IDSA 5LA6B 1L0NH 3PN1A 4A3GG 3L75H 5CR5A 1DK1A 5LHHA 2B9ZA 3N43B 4J9PA 3VNNA 2R7KA 4UVCA 5J2UF 1IBMB 1VQLV 2NVYA 2ADQB 2UVVA 5IJ9B 2DYRB 2COIA 3SJBC 1V55C 2AGQA 5C8YA 5J2UB 3SYQA 5I5SA 3J7AK 2Q73A 4GLWA 1O75A 3GTJA 4OX9B 3STZC 4P9OA 1BNCA 3OGCC 4JYAH 1R6TA 3ZJZA 3UO2A 3UQ8A 5HFMA 1SYXB 1BQ0A 5KS8A 1K73W 4O7SA 3P3PA 2W7OA 4JI7B 3DC5A 1RSOB 4YAKB 4Q6GA 2DWCA 3GV5B 1CXZB 4NKGB 1Q7YW 4O4IB 5KUMA 5FD6A 2Y48A 3GIDA 1U96A 3H40A 5EYPA 2WTFA 2P7TC 5FLXW 1AI4A 5EYPB 1W0KG 1R1BA 3G6XA 1X9NA 1LUVA 1BGYH 3E8HA 2GV9A 2NU9B 3QZ7A 4LF6B 1RP3B 3OHAA 1QR9A 5T14A 2JA5G 2YIBA 5FNVA 2YZGA 1Y1VA 4Q45A 1NVPB 2E2HA 5BR8B 1QQCA 3T5HA 4A2BA 4I55F 1K3EA 4EB6A 4X65O 4K3AA 3T1HB 1NTMH 2ASDA 1BCCH 2ZE5A 2V59A 1K33A 2HVSA 4UUJC 2R7NA 1K7DA 3CYOA 3WO1A 3RB6A 5K3WA 1HR0O 1P4RA 3TGUH 1K92A 2YS7A 2BQ3A 4ED8A 2R8IA 1AILA 2VOBA 3W7SA 4DW0A 2GHYA 3HKEB 3N27A 4IR1A 2B63G 2JEIA 2UXBO 2JA6A 1KKDA 3IGAC 2R8KA 2J9GA 2YIBD 5KFFA 2V4DA 3PR4A 4DV1H 2ARHA 4JI4O 2R6FA 4DV2O 4QWCA 1HR0B 1SRYA 3A0RA 1S0OA 4QPKA 4PDBA 2ZE6A 3B2EE 1IYEA 3TINA 2OTLV 1QNMA 2A06H 4EBCA 3G80A 1N34H 2AHYA 4WF9V 4FM9A 2LFSA 1YF2A 2A1HA 2YCHA 2QTSA 3G4SV 1XREA 3CMEV 5B1BC 3OUSA 4IL6Z 5CBFA 2XCAA 1H2MA 2JRIA 4FFRA 3OW2U 1I3QA 3X2QB 3QF7A 2YW2A 4LF6O 1NH2B 5LL6Y 3RB0A 2R93G 4W4KA 2QWQB 3CE2A 4BBRG 3CRRA 2NU7B 4K6NA 1QCEA 4CKEA 5IYCG 2ZKOA 2Q4PA 5DM6V 4AHCA 3HOVG 4C2MA 2VUMG 3OUZA 4TV9B 2UXDO 4IR9A 3FB7C 4JI8O 2HIXA 4JI2B 1YZBA 2HIVA 4LF5H 1VQ7V 5KHHA 4J9LA 1AR5A 1FVIA 1CEZA 4NZNA 4JV1A 1OCRB 3EHBB 5EWFA 1JDEA 5IYZA 2C2EA 3DC6A 2VA3A 1I2LA 2ODMA 2X7RB 3BCCH 2FJZA 1HDJA 3L9DA 2HVRA 2Q69A 4LWSA 2CGOA 1V55B 4JAUA 1KJ8A 4XX0B 3TETA 1I7LA 2IBKA 3JSLA 3VQWA 4EKWA 2AHZA 4J9NA 5IYBO 5KX5F 3Q8QB 1T94A 4O4JB 4DR4O 1HNZH 3HT5A 3K5LA 4ECRA 4TOIA 4FS2A 5LP6C 5KFDA 3M9MB 4ED7A 4YR2A 5DG7A 3OM3B 3HOUG 3JZFA 2NNUA 2ZNIA 1GYFA 1XMQH 4YAJB 4X20A 4QIWF 1S0VA 4WFEA 5KFVA 5C8YF 3JAWB 1P7GA 3WWIA 1S0MA 2KKWA 4PELA 1QVFU 2JA6G 1V54C 4KHPO 1KJ9A 1S9FA 3ZMUA 2P90A 1EM1A 1P16A 4DUZB 2C35B 4LF9B 2FL4A 5C3EG 4F6RB 1JCHA 2QWPB 2IJIA 5DISC 3AYHB 1YJWV 4IYHA 1M56B 4DR6O 1EN6A 5KFOA 1E4FT 4RAYA 3TJTA 1I94B 4O7WA 5KG5A 4DK1A 3ABMB 2JJ1G 2RJZA 3H4BA 2BTQB 1G6UA 5LYJB 2WLKA 3R9RA 2UXCO 1DV1A 4DV7O 1YIJV 3AK1A 1UC9A 4LF7H 3U54A 1MNGA 1EKPA 5EZYB 4DV0H 2OCCC 4QWBA 5IYBG 3MFHA 3ML0A 4I55B 1KC7A 4DR6B 3BHPA 2R84A 4MV1A 3QVNA 5F9NA 4JZGA 2UVRA 1F4NA 3L71H 4J42A 3BA8A 4IHJA 4UV8A 5KFCA 2AZ2A 2YU9A 5BYBA 1XMOO 1Y6XA 3MR2A 4UCVA 4DR7H 4QJFA 4DR1H 2LGWA 3HKBB 3ZMTA 5KT7A 4ETSA 2UUCO 2YXYA 2B63A 3JYCA 2P0AA 4GT1A 1D2DA 1JXLA 1WPBA 1WB7A 3CEBA 4DL5A 4FM1A 2XAGA 2WB1E 5CA0F 3RBEA 1S10A 3JALA 3FKIA 1EBOA 1BHBA 4FVMA 1DF5A 4DL2A 4DL7A 4B3MH 1R3KC 4O4JF 4WBNF 4FM2A 4EBEA 3CRAA 1JLLB 4O82A 4B3SH 4JASA 3EFFK 5IP7G 3R23A 4DV3H 3K0GA 2WLMA 4RQFA 3GTOA 4ECWA 4NXNH 4TUYB 3CJHA 2CZGA 5D1OB 3GIIA 4BR6A 4DR4B 4EBDA 2QKCA 1PNLA 3MWEA 1SZXA 4LF4H 5LP6F 2O03A 4A3MG 1O9GA 4O7RA 4B08A 4AQYO 4IZOA 4ECQA 4F4YA 4KL1A 4FLTA 3EVKA 1BHAA 1N48A 3ABLB 4P9PA 5I47A 4LFCH 4CH6A 2W70A 3GTGA 2RCVA 4YBZB 4FFMA 4IIJA 5KX5B 3CX5F 5KT5A 1AVMA 2JS5A 4K0KO 1US6A 3AG2B 4U6PA 2EIJB 3LDEA 1AR4A 2Q0OC 3KZIZ 3AG4C 4JI3H 5FPRA 4JI2O 1JMKC 4X62O 4LF8H 4LNUB 4PBCA 4E6NA 5LGUA 1FXKC 1A0IA 2ZDIC 4YJ3B 3HKCA 1SESA 1Z2GA 1AR1B 2N05A 1CE8A 1Y1WA 2IM9A 3APOA 4RUCA 3H01A 3GVMA 1CPYA 1NZ6A 1N32H 2PGGA 3PZPA 3T9BA 5KFTA 3T99A 1FPOA 5JUMA 3DGEA 3IC9A 3JSNA 1E4EB 4IAJA 2WE6A 2W6ZA 4ZOLB 1IBLB 4EQ5A 3K9AA 1EN4A 1YVWA 3ZN0A 5J2TA 2LGQA 3RF2A 2EX3A 3OD4A 1TAEA 3UKMA 2BTQA 1XI1A 2XCLA 2G38A 4UCTA 4CKBA 4U7CA 2JIZG 4R6ZA 3H1LH 3OTOH 4DIMA 2AGPA 3B09A 1O9HA 3T5JA 1V51A 5EBWC 2XT9A 4H33A 1G4YB 4XBFA 3QG5A 1N33B 2SCUB 3JAMW 2FTKA 4HNTA 1FYJA 5L3BA 3N6RA 2PZSA 1MOFA 3HKDA 1WR2A 4O3QA 2Q67A 1BL8A 1XQ8A 5EK0A 1NR7A 4BIZA 5KAIZ 1RM1C 1KP3A 2ZGIA 2DMXA 2OLSA 5KFMA 5BPHA 4WCEV 3FAVB 1P84F 1K8AW 3WO0A 2WB1A 4O4IA 5H5NA 3ETDA 2HP8A 2ZM6B 3J80W 5LA6F 1NBMG 1YSCA 3CS5A 4DV5B 2Q7DA 1PNKA 1UPGA 3H9VA 5KG6A 1Y1WG 3STLC 3I56V 1GN6A 1GGOA 3JARB 4YJ2B 4MTEA 4MSWC 1M6VA 3LUTB 4NTWA 3X2QC 1VF7A 2R9AA 2QWNB 4O7NA 3HOZG 4LP8A 3QO8A 3VMMA 5IP9G 1SA0A 3M99B 1PX2A 4XDKA 1Y1VG 3D8CA 3NBYB 4ECUA 4HAMA 1Y67A 5GONB 3SPGA 4U3JB 2DN9A 3ZRWA 4B3RH 2CAZC 1DV2A 2FK1A 2NR5A 3HKCB 4J9SA 2A79B 3J80N 2UUBH 1N32O 1UFIA 1X4TA 1C3OA 4GC6A 3RV4A 1VF5B 5B1NA 2BQUA 3SPCA 3H1KH 1TVKB 1TWGA 1AROP 2X6CA 1BS3A 2BSKA 3ZMVA 2GPWA 2Z02A 3R5HA 2ITDC 1K1QA 4JI7O 4TSFG 5B3SB 4X62H 3BQ2A 2R72A 3KAJA 1I6UA 3CSWA 3VQYA 2RDCA 1T3NA 3UT5A 5FR9A 4MVZA 3VA7A 1HW7A 3SYPA 5KT2A 4K0KH 5HFLA 1VF6C 1SEIA 2Z5UA 4OX9O 2F4VO 1VKZA 2DJVA 4JGSA 1KBHA 3K06A 4RU9A 1PL4A 2IJKA 4IHJB 4A2AA 5DMXA 4AQYH 1G1XB 1SQFA 2FK3A 1TUBB 2E75B 3HKDB 4O2AB 1IBMO 4X88A 2ZDHA 5KFQA 5LP6A 2GSMB 4LFAB 4E4TA 5KMGA 2ZIMA 3WB2A 4DV4B 2Q2UA 4X1IB 2XC9A 5CB4F 3MJFA 2JGDB 3DXRB 2HJWA 4RUAA 3OFNG 1UNNC 2E5LH 1H2SB 4NTYA 4RUFA 1V54B 4F4XA 4B3MO 2A0LA 1VS0A 4DR2B 4O7ZA 2WSSG 1JVMA 2W6IG 4UCRA 1S5LZ 2HDKA 1NQTA 4IHJF 3CCRV 1K83A 2H3OA 1KQSU 3BG5A 3V4ZA 1KP2A 2BR0A 1KUTA 2Q2TA 2UUCH 2YRXA 1I1LA 2PI4A 1NT2B 1FS0G 2FB5A 4LMYA 3IFXA 4DR1O 3ASNC 4DR7O 5HNEA 2BOBC 3GIPA 1ZETA 1GSOA 1WJZA 4J7KA 1GN3A 3ZRWB 3RGXA 2PI5A 3WWJA 1EKVA 1OBDA 3U9TA 1IBKH 1YHQV 4DV0O 1P49A 1PPJH 4EYIB 2ZCEA 4DV6H 2ETNA 1SQGA 2W9BA 4LF7O 4B7KA 4CMFA 3QO5A 4DV7H 2UUAB 3JAMN 2BSKB 1HWYA 4ZBMA 4DV6O 4GKKB 3RB3A 3CC2V 4LNUA 1IBKO 3QNEA 1Q43A 2UU9B 3RYHA 2HKOA 4MA5A 4I5SA 4RAIA 2FMAA 2YI8A 1PM9A 1MG1A 3P3NA 3FDSA 2NU8B 5KHKA 3FB5C 4JYCA 4GCZA 5JJEB 3F5WC 3KALA 1GKFA 3DF7A 4JYYA 3JAWA 3GTLA 4EYHB 2W9CB 4KHPH 5B5EZ 1I1MA 2HGXA 2JDIG 3V4SA 4PA4A 2FPPB 2GLTA 2PVPA 2C2RA 1EUDB 4WD3A 3TXSA 2KB1A 5KFKA 3N40P 1Z5VA 1BQZA 5KT6A 2E5LO 3RV3A 4FFPA 1XMQO 1XEQA 2VR1A 2HG5C 4DRXA 5CBHA 3CHXA 1FJGB 3U11A 1F7YA 4O83A 1JKJB 4JTDB 3Q1KA 1WP8A 2P4VA 3FKSG 3LSQA 2CNQA 4ECSA 1Q3EA 4JUZA 3LNNA 2I80A 1IBMH 4A3IG 2YS8A 1JIHA 3N41B 1SC5B 5EWGA 2YEVB 4ECZA 1KJIA 3GTQA 2YEVA 4Z1MG 2F4VH 5KMGB 2PMZE 2WLHA 4MTOA 4OX9H 3H1HH 4JYAB 1XDCA 2FK2A 2I8CA 4PV1B 3N44B 1YDXA 3E8BA 3OUUA 2KSWA 1M0TA 4FU0A 5L1LA 4BY7G 1R6KA 4YJ2A 2R9IA 2QDOA 3BPZA 1XNQB 4WBNB 2CK3G 4LF5O 5DGBA 4JI7H 1B06A 5A9GA 2IP4A 5BWWA 1ZSPA 2WLIB 5CA0B 4HYKA 2UXDH 1CKNB 4MV9A 3IAYA 5KFEA 4UCOA 3PW2A 3ETGA 2EJ3A 2N04A 4ABMA 3FKIG 3ZHVA 5EIBC 2ILMA 3MR3A 4MAMA 4O3PA 5C5JA 5C1OA 2UUBO 3SDLA 4K35A 3ORRA 2ITCC 4KFMA 1V4YA 1GSHA 3JD2A 4N21A 4TV8A 3E5NA 4GX5A 4WFFA 4B3RO 1K5SA 3JRXA 2OWOA 1KECA 3C3SA 4ZQIA 2IH1C 3ETHA 4Q0YA 5KFZA 4LF6H 4LWSB 3ZIAG 5EIBD 3GTMA 2PYJA 2VA2A 2Z3YA 3M9NB 2BCCH 4ED0A 1N36B 4MTGA 2CDYA 4LH6A 3W1GA 4OPHA 2GBOA 3CRMA 4RWUA 1B6QA 2FYUH 2COJA 3W5OA 1AP6A 2Q6AA 2XOKG 3EXAA 3OEHG 1OV9A 1L2ZA 1TGOA 4FZ0A 4Q20A 1GO3E 3JALB 1Z5WA 1S03G 4DUYB 1G8MA 3K04A 2DWDC 3TIIA 4GX0A 3GIQA 1Y4MA 4ZI7B 3FX7A 4MVOA 4GX2A 5DQIA 2R93A 3T5KA 4BXXG 3N2GA 2Y4RA 4CE5A 4MV4A 3AX6A 1WH2A 3H3VH 4FFOA 3VOUA 2UXBH 3N2KA 1L0LH 2HGSA 3RAQA 4O4IF 2QKAA 1DLBA 2KSDA 2Z0AA 5LA6A 4RNNA 1DTOA 3A8TA 2O57A 1TUBA 4U3JA 4DV1B 3CCUV 3CC4V 1PNMA 1HR0H 1I2KA 2R70A 4MV8A 5IY5B 4TT3G 3B77A 1OBGA 4LC1A 4B7EA 3OTOO 1VQPV 5ITZB 3DTFA 1S0NA 3SI8A 3RVZA 2ZD9A 4X65H 4AYBA 4RQEA 3QWUA 3R65A 5LL6b 2AU0A 4BWSC 1MABG 1ZX3A 4XZ3B 1H8EG 3HXLA 3LDCA 1VQKV 4CZZA 4Z1VA 2FB9A 1MZFA 4QNHB 1JR9A 5CA1F 3S24A 2I87A 4A3DG 1SETA 3EPGA 2Y4UA 3H0GG 2DABA 5H80A 4O3RA 3GIMA 3LWBA 1M57B 1KTAA 3OEEG 2LO1A 2W71A 5KFUA 3HB9A 2CTWA 2QJ1A 2YL2A 1DF4A 4HNVA 5B1OA 4CS3A 1IOWA 4RUEA 4NR1A 4LF8O 2HLDG 4JI3O 4JI2H 4LF5B 1RJQA 2ZDQA 1R3JC 5C44G 4IWXA 4NYKA 2WLIA 5EBLC 1K97A 4QPJA 5DG9A 4LCUC 5CA0A 1VQ6V 4RB0A 3S3XA 2Y4TA 4JYAO 4A93G 3RBZA 5FL7G 2CGNA 3CQZA 4LFCO 3FB8C 4FMTA 5BWUA 3F5TA 4I4TA 3SPJA 2BE3A 1URFA 4PA3A 4TWKA 3CCMV 1Q90D 2ZE7A 1Y74A 5KHGA 3GWKC 4LF4O 1D5AA 1F23A 1Z2NX 1HNZB 2XAQA 5CAEB 3MFIA 2LFRA 1SFOA 4NXNO 3C90A 1YEWA 1CKOA 2EJ7A 3SJAC 4DV3O 3ORQA 3KTMA 5E79Z 3WB0A 2ZNJA 3D36C 4B3SO 4I7HA 1RJRA 3L70H 3K5HA 1B6SA 5KFJA 4J9MA 5BMVB 2GTAA 2C2AA 2P4KA 2F66C 4IRCA 1AN7A 2XNDG 4EEQA 3RR5A 4DRXB 1RYRA 4JI5O 2ASJA 1ZHSA 2DIKA 1WCMG 1K4CC 4K8XA 4H13B 2IU0A 4HNUA 2WAMA 5J9PC 1AP5A 4DUZH 2EBOA 3VPBA 3ETEA 1XMOH 5JH7A 1Y76A 4XYMB 2K1EA 3T7AA 3CWBH 3KHLA 4QW8A 5CA1B 1GTOA 1Y76B 1CS0A 5JH7F 2Q7HA 3ABMC 2RDJA 4IRKA 2YIAA 4GC7A 2FLLA 4Q44A 3WG7B 2L6LA 2QWRB 4DAAA 2EIJC 1I94H 4L8JA 3G67A 2PF4E 4FM0A 2VQEO 5ITZA 4WHXA 1IOVA 1M5IA 5H6RA 2UUAO 4DL6A 3WB1A 2UXCH 1N56A 1JFFA 5EBMC 3OTFA 1EUCB 2WLJA 2XIGA 4DV0B 3V6KA 5EC2C 4TV9A 4DR6H 3U0ZA 2YWVA 1MZBA 3CPWU 3BACA 4H37A 4PZ7A 5C8YB 1WP7A 5JVDF 1YI2V 1VIBA 4DR7B 3ZX6A 1GSAA 3T2MA 1QVGU 4O4HF 3VQVA 4R50A 4M9UA 5KT3A 3RGBA 3OSNA 4QE7A 3F7VC 4JAAA 4MVRA 5BZBA 5KT4A 1N0NA 2QEXV 1OCCC 4ZHQF 4WFGA 1D5NA 1M90W 4IWYA 4DR2O 5L1KA 2DYRC 2GQRA 2DQ3A 2CW8A 1H2NA 1XK5A 3G8CA 2PMZA 2CTPA 4DV3B 1K1SA 1XHZA 4NXNB 1TUEB 1PV0A 3BQ1A 2GTSA 4Y8VB 2Q68A 3CC7V 1HNZO 4DR4H 4C5BA 4LF4B 4O7YA 4UFZA 5FNVF 3O65A 3C0FB 1RM1B 4JI1O 5IWAO 4JTCB 1ZHQA 4L1KA 2FE3A 4ZHQB 5A2QW 3ASNB 3FFQA 3FB6C 1EYZA 3KHGA 2EJ2A 1Y74B 2QA4V 2XTAA 2JEJA 4MV6A 2ABJA 2XGQA 3LSUA 4O4HB 3NGDA 3BAAA 1UJWB 3IC7A 1LR1A 2OIGA 3UYYA 5CA1A 1FKAO 1K34A 2DOSA 4PDMA 5LBQA 4O81A 1KJQA 1MSDA 1Q6HA 2W6NA 4J9QA 4PJ0Z 1I0HA 1FXKA 3JZ6A 2ZDIA 4JI3B 1OCOC 4D7SA 4LF8B 4F6RA 1ZL8B 4JI8H 4ED1A 4J11A 4D7TA 1R73A 1ZL8A 4DXWA 4JV5B 4TQRA 5KFIA 5DAAA 1JFFB 1IXMA 4MS2A 1WRVA 2HVKC 4NZMA 2ZT9B 2VQFB 3HKEA 5KLVH 4ZI7F 1M9NA 1N32B 3GILA 2DWEC 3ZMSA 1B33N 4EEYA 5H2FZ 1XNRH 2EZOA 3J81W 2GDSA 1GN2A 3H4DA 3E2EA 1IBLH 4J7ZA 3SYAA 2DAAA 1SF9A 2QKSA 3CXHF 1VQ9V 1DAAA 2IJHA 4JXUA 3R66A 3SNOA 3I4MG 2DW4A 4RB2C 4FZ1A 2HFEC 2W7PA 2ATKC 2FLNA 3DTUB 1N34O 5EZYF 3A0HZ 3ASOB 2EJRA 4Q4DA 1K4DC 3OTOB 1WA8A 1BMFG 5LMUB 4AYBE 5BWVA 4MVSA 1KB9F 2MW2B 4FLYA 3M8AA 4DV2H 2YZLA 1TWAA 4JI4H 4DV1O 5KFXA 2NLJC 1VQ8V 1TWCA 4ECTA 4MVQA 4NB5A 2R8GA 1AI6A 5LMNH 1ZWIC 3JRWA 1KYOF 2E76B 1B6RA 4I50A 3R5FA 5KA5A 3RW0A 4GKJB 4UXNA 1NKDA 4I0XA 4I50B 5DEDA 3ZEDA 2ZM6H 3K3PA 2A9HA 1I5XA 1KD1W 4YIOA 4QSHA 4NXMB 5L3GA 2HHFB 1RK5A 5EWEA 3F8NA 4Q8EA 1ENVA 2CNUA 2FP4B 5DGHA 3PR5B 2NVXA 1A48A 2Y0SE 4F50A 4MW3A 3RIZA 4QE9A 3TW6A 5C4XG 3AEIA 3ZS8C 3ZBHA 1SERA 1DIKA 3T4DA 2W9BB 1GRJA 2R8HA 5BY1A 1XDNA 2EIKB 1J5EB 1OCZC 4YY3O 1AUVA 3B8MA 4X64B 4J41A 2IA6A 5CBGA 5FNVB 3K57A 4EFBA 4HN2A 2UUBB 4LSXA 2J6SA 2VUGA 2DPJA 4FLXA 4UUGA 4O4LA 2F23A 1OCCB 5C93A 1P8LA 5J2TF 3RYHB 3W7TA 2V7QG 2VS0A 1XILA 2DYSC 4KP4A 3KHHA 1E79G 3G6EV 2FPIB 2F43G 3HO8A 1Q6IA 4X62B 5JJJB 1S77D 1RFYA 1KBLA 4PDRA 3ZHSA 4NVPA 1VF6A 2K9PA 4DR5H 1RPOA 4FBUA 5H9CA 4FFBA 2QR4A 3K58A 4K0KB 2CE4A 2ZDGA 2WA4A 4DK0A 4O4JA 4JI0H 1VQ4V 2ZXWC 1WAZA 3OUFA 4DL4A 4PI0A 1L8DA 3PFFA 1VARA 2L35A 5LHGA 3O9OA 4AQYB 3ABUA 4QW9A 1FFXB 2J6UA 2KG7B 4C5AA 5F9LA 4FE2A 2AGOA 4LFAH 4K8ZA 4DV4H 3TCUA 5KFHA 1RK6A 2ZXWB 5BMVF 3BABA 3G8DA 1OHHG 3B40A 5FJ8G 2FLPA 1E1QG 4PDVA 5I5VA 4O3OA 1I50A 2E5LB 5IYDG 1AI7A 3TEKA 1M0WA 4IRDA 5DQGA 1HNXO 1MZEA 4PD4F 3H0GA 4A3JG 4D6TH 3DXRA 3ABKB 1XOUA 2R92G 4LBEC 4MTDA 2WYOA 4YY3B 1J5EO 1H2GA 1WSCA 2FKXA 1AJPA 5KUKA 2RNBA 4X1YB 2JA8G 1VAJA 4JZ2A 2PY5A 2UVWA 3L72H 4CH3A 2ASLA 3GV8B 5IT9N 3ABKC 2WLLB 2QYZA 3W7XA 1ZAUA 3JASA 1COWG 5GONA 5FPOA 4DV6B 4GKKO 2YZNA 5GTHZ 4APMA 4ECYA 5IE9A 3LQSA 4MW8A 3DAAA 3K59A 4PA9A 1S68A 4UCUA 2F93B 5IYZB 4R8UB 4MVMA 4JI6B 3SJCC 1W2BU 3SGIA 3VPDA 1YITV 1QLEC 3K3WA 2LJ2A 1KUQA 2M7WA 4J9ZB 4UB6Z 2W9CA 2UU9H 2EINC 2HG8A 3AG7A 3OAAG 4B3TB 4IIJF 3CP1A 4FPPA 3KG2A 5K1XA 4JF3A 3SR2C 3M9OB 4F6EA 3OHBA 2WAQA 4X8AA 3B8NA 3WFVA 5JVDA 5LMUO 2GPSA 1B3QA 3T9AA 3JARA 5EDWA 4FLWA 2HVJC 4KHPB 5BWXA 2V4RA 5LOVA 3ZRXA 2CNVA 4UCSA 4F4WA 1XHXA 3UCSC 2YIDA 1FFXA 2COGA 4CMDA 4YHHB 2ZQMA 5CN0A 3RYIA 1IURA 2CTQA 2HR3A 3SJQC 4JAVA 1QR8A 3WNZA 1T5EA 4IT5A 1WLEA 2LP7A 4NYEA 2HVQA 1FJGH 1CP9A 3GIJA 1U97A 2NU6B 3RAXA 2D3OW 1I7FA 3E8GA 2VQFO 3CB2A 2JGDA 2CTRA 4NZOA 3K5MA 4LFBB 2Q9LA 1QLNA 3JZIA 3E86A 1PK8A 5KFAA 1E4EA 2H94A 4X9QA 2VRZA 4ZOLA 2F4VB 5B66Z 1Y66A 5JQGB 1Z2PX 4RZRA 2CH7B 1SQVH 3FD9A 5JQGA 5LXTA 1VQNV 5DLGA 4X66B 2ZR3A 3K9SA 2EILC 1NVPD 3K79A 3KAKA 3UT5B 3OSPA 4RZQA 1BJTA 4X66O 1NTKH 5K2MA 1NTZH 1GK9A 1K9MW 3RTXA 4M7EA 4I55A 3IN5A 3MHSC 2EIKC 1XNQH 3D3QA 4ED2A 2W6QA 1H8HG 5B3SC 1ULZA 3T54A 3UM7A 5IWAB 4UVBA 3CCQV 4PA6A 4JI1B 3CRQA 1TA8A 4FK5C 1Q86W 2UXDB 5D8DA 3U9SA 2EZPA 4LFBO 5KG1A 2XASA 3D3IA 4O2BF 3QQMA 1FXVA 3RFCA 4JV0A 4I9QA 5IJ0B 4TV8F 2HHHH 4TQSA 3T1YH 1RYSA 2DQ0A 1R3LC 2P06A 1WPXA 1VQMV 2MK3A 3E89A 1EKFA 2IH3C 2WLLA 3JD4A 4WFAV 4YHHO 4I4TF 1N36H 1V9PA 4YB8B 1XL6A 3E35A 4YXWG 3PW7A 2W8KA 1A9XA 1AUXA 4I4TB 4PWQA 1WB8A 3BFRA 2JA7A 2PN1A 4DUYH 4E4EA 4C7UA 4CKCA 2HHFA 4HQ6A 1R3IC 4G2KA 2X6BA 5KFGA 1RSOA 4DV5O 3HOYG 2CH7A 4B3TO 1NH2D 2GUZA 2B1GA 3PJSK 1GMGA 2YICA 5DG8A 1SQXH 1YTFB 2UXBB 2GQSA 1FXKB 4JI6O 4FFLA 4YQWA 3U10A 5KG7A 4YR3A 4ECXA 1GH6A 4DR3H 4R7CA 3JATA 4YJ2F 1J95A 3E22A 4O2BA 3T9FA 2VQEB 4QWEA 2PYLA 1N33O 3IG0A 1M93A 2B1IA 2IW5A 4HZ3A 1I1KA 4O4HA 4J80A 4EGJA 2JEFA 2OT5A 4YJ3A 3HKZE 5KFBA 3CSXA 3T1HO 3K5NA 4X65B 4BW5A 4BW9A 1KJJA 2RN9A 4FGRA 3JD0A 5BR8O 2DZDA 1JX4A 2W6MA 1HNWH 4RAZA 3KKYA 3T9DA 5FLMG 2FPGB 3LMLA 4FFKA 4F4ZA 2RQ6A 3QTCA 4OPAA 5DN6G 4JI5B 2QE7G 3FYEB 1SQBH 5J2TB 1HNXB 3BA9A 3CCVV 1IYDA 3SYCA 4GLXA 1SS3A 4YR0A 2VQDA 2W6OA 5GTIZ 1YCIA 1Y14B 2AQ4A 1SKVA 3TK1A 2Q7GA 2R7MA 3MDSA 3TQTA 4I9WA 4TQFA 5CA3A 4A3LG 1JX9A 2QTOA 3JASB 1NJIW 3ZHQA 3CCSV 4TV8B 3ZHUA 2OIEA 1FXHA 2R7ZA 5CB4A 2YXHA 1MA1A 1FFTB 2Y69B 1AJQA 3W7UA 4TUYA 2QWOB 3I4NG 1XL4A 5JCOA 2ZIOA 5B1AB 1E4GT 2DYSB 3LDDA 2W6PA 4YJ3F 3TW7A 2RDIA 1H2KA 2FMLA 2PTMA 3FYIB 5LGNA 1JJOA 1TWFA 2IMWP 1N0JA 2M6YA 5KAFZ 2C22A 1Q6UA 2JEUA 3JD3A 5L3DA 2GUZB 4J10A 2X6AA 5KFPA 2E74B 2EILB 2BOCC 2UVUA 1QU7A 2R8JA 2WA3A 4I7ZB 3D36A 3MWDA 3RYCA 5LOVB 3L4JA 5BPFA 2XGPA 3CD6V 4I0XB 4UVAA 5KHJA 1A32A 4FLUA 4BIOA 1M57C 5IY5C 4A5UB 3NC0B 3KYHC 3CJHB 3N2KB 3VOTA 2JS3A 5CE8A 1C30A 1SA0B 4BY1G 3ZRVA 1AB3A 4X64O 4BBSG 1Z2OX 5EC1C 1KEEA 3T9EA 3C3TA 3H1JH 3GQCA 1N4CA 1L1FA 1HNWO 4DQNA 3VQXA 5L3FA 5BR8H 2OCHA 4A3KG 1XMOB 2IU3A 3NXSA 3WG7C 4OGQB 4I50F 3SPIA 5CMUA 2XUMA 3T1HH 4A3BG 4P2ZA 2W0FC 3HOXG 1BE3H 1CQJB 1I08A 2B5UA 5H6QA 5L1IA 4HNAB 4ED6A 5L3CA 4TM5A 2KQXA 3MAQA 3L2PA 3MR5A 4RB3C 3N6XA 3Q4HA 3RBDA 4NXMO 1JOYA 2OYQA 2X0LA 2PUSA 2XAFA 3KCXA 4ZKIA 2UXCB 4DR3O 1A3GA 2WAQE 5I5TA 3K08A 3PW4A 4GKJO 3PW0A 1EZJA 5FD5A 1GM9A 1S72V 4PZ6A 1NS1A 4J9KA 3N42B 4PI2A 2YYAA 4CH5A 3P32A 3RFRA 2UXXA 4O7TA 1VBHA 2OTJV 5KFRA 3F7YC 1JDBB 3L4KA 3ZHTA 3T5LA 3LSSA 5IJ0A 1THZA 1ORQC 2R86A 4O2AA 4LF9O 2EULA 5BYAA 3BJYA 2AGAA 3GIKA 4FBTA 3Q2OA 1YXBA 3LULA 3FAVA 1N34B 2CKZB 2C28A 3RB4A 4X1IA 5J2UA 1R9TA 3RN4A 1EFRG 2LQTA 2R92A 2RMKB 2KG7A 3A0BZ 4WFHA 1N36O 3QFFA 2C2DA 1S3JA 2YSUB 2R7ZG 4XYLB 3SYOA 3RYCB 2FKLA 3GB7C 5KFYA 5KG0A 2W9AA 4FFNA 2QM8A 4BAYA 1ZUQA 3RJ0A 2CQYA 3OR7C 4QIWE 1JJ2U 4YP3A 4GYCB 1MSWD 4A3EG 2EIMB 2JJ2G 3TXQA 2C00A 4BIUA 2RGRA 1Q82W 3I12A 4JV5O 4ASUG 1W59A 5F2VO 2WDTA 3H20A 3THOA 5L3EA 3E8FA 4WBNA 1M4UA 5LXTF 3GDEA 3K03A 4CBCA 3GTKA 2P67A 5KFSA 3J81N 1EN5A 1VQOV 3Q8RB 2IBZH 4XDJA 4O3SA 4R8CA 4RO2A 5A2QN 4ED3A 4EFEA 4O2BB 1W96A 2R7LA 5K1PA 3MHHC 2PBZA 3OMIB 3BQ0A 4X1KB 3AK3A 3R5XA 4MTFA 5D1PA 1JQ0A 4X1KA 4L87A 3BRCA 4JI8B 3UFXB 3Q4HB 4A3FG 4G3IA 4TQDA 4JV5H 1M1KW 3N2GB 2J6TA 4U3FH 2Z04A 5DGIA 3PVXA 1KKCA 2VQFH 4KXRA 4PA7A 3RYIB 5GW7A 4CS2A 5D1OA 4FFBB 4GUNA 1LNQA 1S5HC 4GX1A 4RNMA 2WLNA 1XNRB 3QZ8A 1TVKA 2Q7EA 3JCUZ 2AXTZ 2ZR2A 1XUQA 1XMQB 1Q81W 5LOVF 2JGUA 4LR3A 4OXSA 1KMIZ 5LP6B 5IT9W 5JVDB 1Q5OA 3ASOC 4H44B 3UZOA 5KFWA 1F51A 2XCPA 1CKMA 3QO7A 3KCYA 2V9WA 1DGSA 3MD0A 3NBZB 5B1AC 3LNMB 2ODTX 3HPLC 3JATB 4QWAA 4RNOA 4XDLA 3E22B 1W93A 5LMUH 2H8PC 4GZRB 4LF9H 2Y0IA 3OGIB 2F95B 1GLVA 1S5JA 5AG2A 1SZTA 4DV2B 4JI4B 5I5YA 3TQ1A 4C5CA 4FJCC 2W6JG 4FLZA 2JEGA 2CFMA 4CC5A 3T4ZA 3HKZA 1T36A 1Q8IA 2P6JA 5LMNB 1SCUB 3AG3B 2V4QA 4FIPC 3TY8A 3K0DA 5KKNB 3WU2Z 2Q8VA 3CXCU 2BQRA 4GKJH 3T9CA 4DYLA 5E1AC 4E2LA 3NR7A 3B4SA 4N23A 3WWHA 3U0GA 5I5XA 2YC0A 4LF7B 3OMNB 4NXMH 4O3NA 5I5WA 2QGNA 1I5YA 3U55A 3AK2A 4U7OA 1YJ9V 1NI8A 2LW7A 2W8LA 3KREA 1JA8A 5KG4A 5L9XA 3ZMZA 3AG3C 4ZHQA 4LSAA 3GTPA 5HV6A 5LHIA 5LYJF 5D5PA 1VBGA 1CKNA 2YXLA 4DR1B 4JYBA 3S3WA 5D5QA 1PKXA 4EGQA 2YDEA 4O4LB 3G6YA 2E3CA 1J5EH 4X64H 4DO2A 4MA0A 1GO3F 1PP9H 4JPRA 2ZJTA 4BWAA 4Q43A 3MR6A 1WN7A 4TV9F 4QJFB 4B3MB 1GM7A 2VWJA 2YUAA 4AILC 1KT8A 4R7RA 4B3SB 4CC6A 1IZ3A 3GWOA 3W1BA 3TY9A 5KG3A 3CMAV 2A7WA 3PW5A 1OCRC 1VQ5V 2JA5A 1XBLA 2OH2A 4DV4O 1LUWA 4H0LB 3VBBA 2DPIA 4LFAO 5CM0A 4DR5B 1BSMA 3EPIA 2X0SA 3ICXA 2ALZA 5JCOC 3AG1C 4NLGA 1ZQ7A 1WCMA 4JI0B 3GJXB 2VWKA 5FLXN 3JD1A 1EZ1A 4LFCB 4O7LA 4X20B 1BGWA 3A2FA 4CH4A 1QBZA 1MMMA 4TUYF 5EOYA 4QWDA 4JI0O 3K5OA 1M56C 4IYIA 1UC8A 2ZE8A 4O7VA 1FD9A 1WA8B 3K3VA 4DR5O 2IJJA 1JPXA 5DLFA 4Q8FA 2W0XA 5BWTA 3RT3C 4J9RA 1KC8W 3AG4B 2Q5ZA 1SQPH 2EIMC 5JQGF 1RJPA 3P30A 4A3CG 4LH7A 4U7NA 5JH7B 4X1YA 3OE7G 5JWPA 4P30A 3RVYA 2X5RA 4RCNA 2D2CB 2R85A 4YY3H 4O2AF 2V1DA 4J9OA 1HP8A 2BTOA 2XAJA 1GM8A 2ADPA 2ZINA 2E2IA 5I60A 3N8DA 1F4MA 2QSAA 3HKBA 2W57A 1GN4A 1ZLZA 1PL0A 2VUMA 1N33H 1OWTA 1VMGA 1WNSA 4J9YB 3VPCA 2MCTA 4Z2WA 3I55V 3CVZA 3GB8B 2Q0AA 3E83A 4UV9A 2M05A 2ZM6O 3CCLV 1OCOB 1OJHA 4NTXA 2CUGA 4EG0A 5IYDO 4G28B 5I5UA 4JI6H 4ME6A 5LMNO 2N74A 2R82A 2Y0PA 1H2LA 1IVSA 1FAFA 2DLNA 4B3TH 4HYOA 3RUPA 1NR1A 4ZOLF 4DV5H 4M0JA 4O86A 4R8UA 2HGWA 3CRCA 4G27B 2AW9A 4J7JA 3G6VA 4DUYO 3W7WA 5TISZ 4UB8Z 4JTAB 3NUAA 1AI5A
chains in the Genus database with same CATH topology
3SJAC 2YI9A 3WB0A 2XHBA 2ZNJA 4KL1A 5BMVA 4FLTA 4I7HA 5BMVB 4LFCH 4CH6A 4YHHH 2UXBB 4HBNA 2F66C 1AN7A 4IIJA 2F1MA 3U10A 5KX5B 4EEQA 3RR5A 4ZI7A 4DRXB 3TY5A 2JS5A 3ETQA 4DR3H 4B3RB 4IIJB 3JAKA 5KX5A 3JATA 1ZHSA 3E22A 4O2BA 2VQEB 4K8XA 2VPSA 2PYLA 3IG0A 1M93A 4DUZH 4O4HA 4JI3H 5FPRA 4LF8H 1JMKC 4J0MA 1XMOH 4LNUB 5JH7A 4YJ3A 1QHTA 4E6NA 4LFBH 3CSXA 5LYJA 1A0IA 5CA1B 4YJ3B 3K5NA 4X65B 3HKCA 2Q7HA 4BW9A 2YIAA 2IM9A 1B04A 1I94H 3EYYA 4L8JA 1HNWH 4RAZA 1N32H 4FM0A 2QM4A 2PGGA 5ITZA 3LMLA 1M5IA 4X66H 2CW7A 1FKAH 2RQ6A 3QTCA 3WB1A 1KU9A 4JI5B 2UXCH 1JFFA 3JSNA 3OTFA 4IAJA 4FLVA 2WE6A 4ZOLB 5J2TB 1IBLB 4EQ5A 1HNXB 3BA9A 2XIGA 4DV0B 5J2TA 2P22C 4ZIBA 3RF2A 4GLXA 2EX3A 4TV9A 1TAEA 4DR6H 3U0ZA 2BTQA 1XI1A 1MZBA 5IWAH 3KXYT 1SKVA 4JI1H 2Q7GA 4UCTA 4PZ7A 3DSQA 5C8YB 4TQFA 3JASB 3OTOH 5EZYA 4DR7B 1O9HA 2P5OA 1N33B 3QG5A 2HHHB 3JAMW 4TV8B 3VQVA 3T1YB 3RGBA 2PZSA 5CB4A 4RB1A 3HKDA 3M4IA 5CB4B 1XQ8A 4TUYA 5JCOA 2ZIOA 1E4GT 4DR2H 2CW8A 2PTMA 5IJ9A 1JJOA 4O4IA 1XK5A 2ZM6B 3J80W 4DV3B 4DV5B 2UUCB 1XHZA 4NXNB 4PHZA 3JARB 4YJ2B 2RGVA 4MTEA 4DR4H 4LF4B 3L4JA 4UFZA 3RYCA 5LOVB 3C0FB 5KHJA 4FLUA 4MV7A 1VF7A 1ZHQA 2R9AA 2FE3A 5A2QW 4ZHQB 3FFQA 3NC0B 3KYHC 3N2KB 1IBKB 1SA0A 3RYFA 3FMAA 3NBYB 4O4HB 1SA0B 3RYFB 3RGZA 3BAAA 5GONB 4U3JB 4DR3B 4DV7B 4B3RH 2CAZC 5CA1A 3M7MX 3HKCB 1Z2OX 2UUAH 2UUBH 2VQEH 4GKKH 1X4TA 3VQXA 5BR8H 4JI3B 4D7SA 4LF8B 4F6RA 4JI8H 1XMOB 4D7TA 1CKOA 3RWRD 1TVKB 4JV5B 3JAKB 4PZ8A 3T1HH 1JFFB 4DRFA 4HNAA 4CS4A 2VQFB 4X62H 4HNAB 3HKEA 5KHIA 2R72A 2JVDA 5LXTB 3MAQA 3L2PA 3KAJA 4RB3C 3N6XA 1I6UA 1HNWB 1N32B 3VQYA 2HEPA 1XNRH 3UT5A 4EB6B 2OYQA 2PUSA 1HW7A 3J81W 2UXCB 4JI5H 4K0KH 1SEIA 5JJNB 5FD5A 4PZ6A 1IBLH 1HNXH 3N42B 4PI2A 4CH5A 3MWMA 3RFRA 4RB2C 4IHJB 5LA6B 4A2AA 4AQYH 3PN1A 3L4KA 1SQFA 1TUBB 3HKDB 4O2AB 5IJ0A 5LP6A 3OTOB 5LMUB 4LFAB 5KMGA 2ZIMA 3WB2A 4O2AA 3N43B 4DV4B 3VNNA 2Q2UA 4X1IB 4FLYA 1IBMB 4DV2H 5IJ9B 1N34B 4JI4H 4X1IA 3SJBC 5J2UA 5C8YA 5J2UB 2E5LH 1H2SB 5LMNH 3J7AK 1O75A 1VS0A 4DR2B 4OX9B 4I50A 4UCRA 3RYCB 4GKJB 4JYAH 3UQ8A 4I50B 3ZEDA 2ZM6H 1SYXB 4NXMB 2Q2TA 2UUCH 3RJ0A 1NT2B 4LMYA 4GYCB 3F8NA 4JI7B 4Q6GA 2RGRA 4O4IB 3RGXA 5FD6A 3RIZA 2WDTA 3H20A 5EYPA 3THOA 3ZS8C 5FLXW 4WBNA 1M4UA 1IBKH 3GDEA 1P49A 5EYPB 2ZCEA 4DV6H 1SQGA 1XDNA 1J5EB 1X9NA 4EFEA 4O2BB 4DV7H 4X64B 5K1PA 2GV9A 5FNVB 3K57A 4EFBA 2UUAB 2UUBB 4LF6B 4LSXA 4X1KB 4GKKB 2YIBA 5FNVA 2VUGA 4LNUA 5D1PA 5BR8B 4X1KA 1QQCA 4FLXA 1Q43A 4A2BA 2UU9B 3BRCA 3RYHA 4O4LA 4JI8B 2YI8A 1P8LA 3RYHB 4TQDA 4EB6A 5KHKA 4JV5H 3T1HB 3N2GB 5JJEB 3KALA 3DF7A 2HVSA 4X62B 2VQFH 5JJJB 3JAWA 3RYIB 4CS2A 5D1OA 4FFBB 4NVPA 4DR5H 4KHPH 4FFBA 1XNRB 1TVKA 2Q7EA 3K58A 4K0KB 1XMQB 2VOBA 4DK0A 4O4JA 2JGUA 4LR3A 4JI0H 1KMIZ 5LP6B 3HKEB 5IT9W 5JVDB 1Q5OA 3N40P 1Z5VA 4PI0A 1L8DA 2YIBD 1CKMA 2V4DA 4DV1H 4DRXA 1DGSA 3CHXA 4AQYB 1FJGB 3NBZB 3U11A 3JATB 1HR0B 1FFXB 3E22B 4PDBA 5LMUH 4LFAH 4LF9H 4K8ZA 2F95B 4DV4H 3B2EE 1Q3EA 3LNNA 1IBMH 1S5JA 3BABA 4DV2B 4JI4B 1N34H 3N41B 4FM9A 2YCHA 4FLZA 2CFMA 4CC5A 2E5LB 2F4VH 1M0WA 1Q8IA 5KMGB 5LMNB 3TY8A 4OX9H 3QF7A 4GKJH 4JYAB 3N44B 2KSWA 4MTDA 1M0TA 2WYOA 4YY3B 4LF7B 4NXMH 4YJ2A 3BPZA 4AHCA 1XNQB 4WBNB 4JI7H 4X1YB 4TV9B 5CA0B 4ZHQA 2PY5A 4LSAA 2UXDH 1CKNB 4MV9A 3IAYA 4UCOA 4CH3A 5D5PA 1CKNA 2HIXA 4JI2B 2HIVA 2YXLA 4DR1B 4LF5H 1ZAUA 3JASA 5EIBC 5GONA 5KHHA 5D5QA 5FPOA 4DV6B 4APMA 1FVIA 4O4LB 2E3CA 1J5EH 4TV8A 3K59A 4X64H 2OWOA 5IYZA 4UCUA 1S68A 2ZJTA 4Q0YA 4LF6H 4BWAA 5EIBD 2F93B 5IYZB 1WN7A 4JI6B 3SJCC 2PYJA 3SGIA 4B3MB 2HVRA 2VWJA 1N36B 4AILC 2UU9H 3JSLA 4LH6A 3W1GA 4R7RA 3W5OA 3VQWA 4B3SB 4CC6A 4B3TB 3W1BA 3TY9A 5K1XA 1L2ZA 1TGOA 3JALB 1Z5WA 3SR2C 1S03G 4O4JB 4DUYB 1HNZH 5JVDA 3K5LA 4TOIA 3JARA 4DR5B 5LP6C 4FLWA 4KHPB 4ZI7B 5LOVA 3ICXA 5JCOC 3N2GA 2ZNIA 4UCSA 1GYFA 1XMQH 1XHXA 4X20A 4JI0B 3GJXB 2VWKA 1WH2A 1FFXA 4LFCB 4X20B 4YHHB 1BGWA 2UXBH 3A2FA 3N2KA 4CH4A 3JAWB 3RYIA 2HGSA 5EOYA 5LA6A 3K5OA 1T5EA 2KKWA 1TUBA 4U3JA 4DV1B 2HVQA 1FJGH 3K3VA 1HR0H 1P16A 2R70A 4DUZB 4LF9B 1I7FA 3CB2A 5ITZB 3K5MA 4LFBB 4F6RB 4X65H 3QWUA 5DISC 5LL6b 4ZOLA 4BWSC 2F4VB 1E4FT 3HXLA 5JQGB 4RAYA 1Z2PX 1I94B 4LH7A 4DK1A 5JH7B 5JQGA 5LXTA 2RJZA 4X1YA 4X66B 3S24A 2BTQB 1G6UA 5LYJB 3KAKA 3UT5B 4YY3H 4LF7H 1BJTA 4RZQA 3RTXA 4M7EA 4I55A 5EZYB 4DV0H 1XNQH 2BTOA 4I55B 2ZINA 3BHPA 4DR6B 5IWAB 2QJ1A 4JI1B 1TA8A 2UXDB 3BA8A 4CS3A 4IHJA 3HKBA 2W57A 4UCVA 4JI2H 4I9QA 4DR7H 5IJ0B 4LF5B 4DR1H 3HKBB 1N33H 2MCTA 1WNSA 3CVZA 4ETSA 2HHHH 3T1YH 3GB8B 2Q0AA 5CA0A 1WPBA 4RB0A 4FM1A 3JALA 4FVMA 4B3MH 4JI6H 1N36H 1V9PA 4FM2A 4I4TA 4B3SH 4B3TH 4DV3H 4I4TB 4DV5H 4NXNH 4TUYB 5KHGA 4DUYH 5D1OB 1D5AA 1Z2NX 4DR4B 1HNZB 4LF4H 2O03A 1O9GA 1YEWA 1RSOA 4B08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUG A;  3BAA A;  5D1P A;  5BR8 B;  4DUY B;  2UU9 B;  4DR3 B;  4DV7 B;  4JI8 B;  1P8L A;  4TOI A;  4DR5 B;  2UXB B;  3T1H B;  4KHP B;  4EEQ A;  3RR5 A;  4UCS A;  4JI3 B;  4LF8 B;  4X62 B;  3TY5 A;  2HVS A;  4B3R B;  1XMO B;  4JI0 B;  3GJX B;  5D1O A;  4LFC B;  4YHH B;  2VQE B;  4JV5 B;  4PZ8 A;  1XNR B;  4DRF A;  4K0K B;  5FPR A;  2VQF B;  1XMQ B;  3L2P A;  4DV1 B;  2HVQ A;  4E6N A;  1HNW B;  1N32 B;  1A0I A;  4X65 B;  1P16 A;  4DUZ B;  4LF9 B;  2UXC B;  1B04 A;  1CKM A;  1FJG B;  1DGS A;  4AQY B;  4LFB B;  3NBZ B;  4PZ6 A;  1HR0 B;  3QWU A;  5DIS C;  4JI5 B;  3JSN A;  2F4V B;  1I94 B;  3PN1 A;  4LH7 A;  3BAB A;  4DV2 B;  1IBL B;  3BA9 A;  1HNX B;  4JI4 B;  4EQ5 A;  4DV0 B;  4X66 B;  3S24 A;  3OTO B;  5LMU B;  4GLX A;  4LFA B;  1TAE A;  2CFM A;  4CC5 A;  2E5L B;  4DV4 B;  3VNN A;  2Q2U A;  5LMN B;  1IBM B;  3TY8 A;  3RTX A;  4UCT A;  1N34 B;  4PZ7 A;  4JYA B;  4DR7 B;  4DR6 B;  1N33 B;  4YY3 B;  5IWA B;  4LF7 B;  2HHH B;  4JI1 B;  1TA8 A;  3T1Y B;  2UXD B;  1VS0 A;  4DR2 B;  3BA8 A;  4OX9 B;  4UCR A;  1XNQ B;  4GKJ B;  3UQ8 A;  4UCV A;  4LF5 B;  4NXM B;  2Q2T A;  3GB8 B;  1CKN B;  4UCO A;  1CKN A;  4JI7 B;  2HIX A;  4JI2 B;  2HIV A;  4DR1 B;  1XK5 A;  1ZAU A;  2ZM6 B;  4DV3 B;  5FPO A;  4DV5 B;  4DV6 B;  2UUC B;  1FVI A;  4NXN B;  1V9P A;  2OWO A;  1S68 A;  4UCU A;  4LF4 B;  4UFZ A;  3GDE A;  4JI6 B;  4B3M B;  3SGI A;  2HVR A;  1XDN A;  1J5E B;  1N36 B;  1X9N A;  5D1O B;  3JSL A;  4LH6 A;  4EFE A;  4X64 B;  1HNZ B;  4DR4 B;  3KYH C;  3NC0 B;  3W1G A;  3W5O A;  4B3S B;  4CC6 A;  1IBK B;  4B3T B;  2UUA B;  4EFB A;  4LF6 B;  2UUB B;  1CKO A;  3NBY B;  3W1B A;  3TY9 A;  4GKK B; 
#chains in the Genus database with same CATH topology
 2YI9 A;  4QIW A;  1G2W A;  2XHB A;  4CHI A;  5BMV A;  2QF7 A;  2XD4 A;  5DGA A;  2V5A A;  2Y0S A;  4YHH H;  4HBN A;  4TVI A;  3Q8S B;  4FS1 A;  1IBL O;  4ICG A;  2AZ0 A;  2F1M A;  1SQQ H;  3UO3 A;  4ZI7 A;  3TY5 A;  5B1B B;  3Q8P B;  3ETQ A;  4B3R B;  4IIJ B;  3JAK A;  5KX5 A;  3K5I A;  3LP8 A;  3DTG A;  2R9R B;  3G6B A;  1YTF D;  1XNR O;  1ZTE A;  4IGG A;  5IDJ A;  3L74 H;  3T1Y O;  3ETJ A;  2VPS A;  2HHH O;  1ET0 A;  1TWH A;  4YIP A;  3PO3 G;  3SE7 A;  4J0M A;  3HBL A;  1QHT A;  4LFB H;  5LYJ A;  2EJ0 A;  3OT7 A;  1BXR A;  3IJ4 A;  2EIN B;  1B04 A;  3CEI A;  1IXB A;  3AG2 C;  1XNQ O;  3EYY A;  2QM4 A;  4X66 H;  3G71 V;  5DEC A;  4WFB V;  4AI8 A;  5JQW A;  5L1J A;  2CW7 A;  1BT8 A;  3JCZ A;  4KUM A;  1FKA H;  3L73 H;  1KU9 A;  3OR6 C;  1R6N A;  4FLV A;  4F4L A;  4HR7 A;  3CCJ V;  3CCE V;  2NN4 A;  5LGT A;  5KFL A;  2P22 C;  4ZIB A;  1M7J A;  5DQH A;  2Y69 C;  1P7B A;  5IWA H;  3KXY T;  2DE0 X;  4JI1 H;  1OZ0 A;  3DSQ A;  3J7A U;  1OCZ B;  2A3Q A;  5EZY A;  2EIY A;  2P5O A;  2ATL A;  2HHH B;  1S76 D;  3T1Y B;  5C1P A;  3V6J A;  2NUA B;  3APQ A;  1FJG O;  4RB1 A;  2YS6 A;  5JVL A;  4JV2 A;  1GAX A;  3M4I A;  5CB4 B;  5E25 A;  3BY6 A;  2VPQ A;  3AW8 A;  2QM7 A;  4DR2 H;  1AJN A;  3AG1 B;  4X89 A;  3BEH A;  3ZCC A;  5IJ9 A;  5HBR B;  1E1R G;  1VP7 A;  2UUC B;  5IYZ F;  2QK4 A;  4O84 A;  4PHZ A;  5BWR A;  1EZV H;  2RGV A;  3T1C A;  4PDL A;  4W4L A;  1CQI B;  3H1I H;  2QB5 A;  2HJF C;  1S97 A;  2UXN A;  2RF4 A;  4DL3 A;  3SPH A;  4O4L F;  4MV7 A;  3GV7 B;  1NU1 H;  2OCC B;  4MVU A;  2R87 A;  2UU9 O;  4MTX A;  3RYF A;  1IBK B;  3FMA A;  3KHR A;  5KFN A;  3RYF B;  3RGZ A;  1I7N A;  3I5D A;  4DR3 B;  4DV7 B;  1RPR A;  3M7M X;  2YRW A;  4Q4C A;  1BZK A;  2UUA H;  1H38 A;  3ZN1 A;  2VQE H;  1ROP A;  1W0J G;  4GKK H;  3HOW G;  1I94 O;  1VEW A;  3ZHR A;  3TIG A;  1IX9 A;  1EHI A;  4DW1 A;  3OMA B;  1N8R W;  5IYC O;  3RWR D;  4PZ8 A;  3JAK B;  1K5Q A;  3UZB A;  3PO2 G;  2JEX A;  3HB3 B;  2WWW A;  4HNA A;  4CS4 A;  4DRF A;  5GON F;  5KHI A;  5LXT B;  2JVD A;  4DUZ O;  3V6H A;  3HR0 A;  4MV3 A;  1HNW B;  3ZRS A;  2LW1 A;  2HEP A;  3BVO A;  4ECV A;  1X59 A;  1QLE B;  4EB6 B;  2YZM A;  4JI5 H;  3ABT A;  5KA6 A;  5JJN B;  1A0G A;  3GLK A;  5BXZ A;  1HNX H;  2WPD G;  2V58 A;  2HJD A;  2XAH A;  2JK5 C;  4QGP A;  3MWM A;  4DLK A;  2JA7 G;  1YJN V;  1PD3 A;  3ABL C;  4MT8 A;  5KG2 A;  1IDS A;  5LA6 B;  1L0N H;  3PN1 A;  4A3G G;  3L75 H;  5CR5 A;  1DK1 A;  5LHH A;  2B9Z A;  3N43 B;  4J9P A;  3VNN A;  2R7K A;  4UVC A;  5J2U F;  1IBM B;  1VQL V;  2NVY A;  2ADQ B;  2UVV A;  5IJ9 B;  2DYR B;  2COI A;  3SJB C;  1V55 C;  2AGQ A;  5C8Y A;  5J2U B;  3SYQ A;  5I5S A;  3J7A K;  2Q73 A;  4GLW A;  1O75 A;  3GTJ A;  4OX9 B;  3STZ C;  4P9O A;  1BNC A;  3OGC C;  4JYA H;  1R6T A;  3ZJZ A;  3UO2 A;  3UQ8 A;  5HFM A;  1SYX B;  1BQ0 A;  5KS8 A;  1K73 W;  4O7S A;  3P3P A;  2W7O A;  4JI7 B;  3DC5 A;  1RSO B;  4YAK B;  4Q6G A;  2DWC A;  3GV5 B;  1CXZ B;  4NKG B;  1Q7Y W;  4O4I B;  5KUM A;  5FD6 A;  2Y48 A;  3GID A;  1U96 A;  3H40 A;  5EYP A;  2WTF A;  2P7T C;  5FLX W;  1AI4 A;  5EYP B;  1W0K G;  1R1B A;  3G6X A;  1X9N A;  1LUV A;  1BGY H;  3E8H A;  2GV9 A;  2NU9 B;  3QZ7 A;  4LF6 B;  1RP3 B;  3OHA A;  1QR9 A;  5T14 A;  2JA5 G;  2YIB A;  5FNV A;  2YZG A;  1Y1V A;  4Q45 A;  1NVP B;  2E2H A;  5BR8 B;  1QQC A;  3T5H A;  4A2B A;  4I55 F;  1K3E A;  4EB6 A;  4X65 O;  4K3A A;  3T1H B;  1NTM H;  2ASD A;  1BCC H;  2ZE5 A;  2V59 A;  1K33 A;  2HVS A;  4UUJ C;  2R7N A;  1K7D A;  3CYO A;  3WO1 A;  3RB6 A;  5K3W A;  1HR0 O;  1P4R A;  3TGU H;  1K92 A;  2YS7 A;  2BQ3 A;  4ED8 A;  2R8I A;  1AIL A;  2VOB A;  3W7S A;  4DW0 A;  2GHY A;  3HKE B;  3N27 A;  4IR1 A;  2B63 G;  2JEI A;  2UXB O;  2JA6 A;  1KKD A;  3IGA C;  2R8K A;  2J9G A;  2YIB D;  5KFF A;  2V4D A;  3PR4 A;  4DV1 H;  2ARH A;  4JI4 O;  2R6F A;  4DV2 O;  4QWC A;  1HR0 B;  1SRY A;  3A0R A;  1S0O A;  4QPK A;  4PDB A;  2ZE6 A;  3B2E E;  1IYE A;  3TIN A;  2OTL V;  1QNM A;  2A06 H;  4EBC A;  3G80 A;  1N34 H;  2AHY A;  4WF9 V;  4FM9 A;  2LFS A;  1YF2 A;  2A1H A;  2YCH A;  2QTS A;  3G4S V;  1XRE A;  3CME V;  5B1B C;  3OUS A;  4IL6 Z;  5CBF A;  2XCA A;  1H2M A;  2JRI A;  4FFR A;  3OW2 U;  1I3Q A;  3X2Q B;  3QF7 A;  2YW2 A;  4LF6 O;  1NH2 B;  5LL6 Y;  3RB0 A;  2R93 G;  4W4K A;  2QWQ B;  3CE2 A;  4BBR G;  3CRR A;  2NU7 B;  4K6N A;  1QCE A;  4CKE A;  5IYC G;  2ZKO A;  2Q4P A;  5DM6 V;  4AHC A;  3HOV G;  4C2M A;  2VUM G;  3OUZ A;  4TV9 B;  2UXD O;  4IR9 A;  3FB7 C;  4JI8 O;  2HIX A;  4JI2 B;  1YZB A;  2HIV A;  4LF5 H;  1VQ7 V;  5KHH A;  4J9L A;  1AR5 A;  1FVI A;  1CEZ A;  4NZN A;  4JV1 A;  1OCR B;  3EHB B;  5EWF A;  1JDE A;  5IYZ A;  2C2E A;  3DC6 A;  2VA3 A;  1I2L A;  2ODM A;  2X7R B;  3BCC H;  2FJZ A;  1HDJ A;  3L9D A;  2HVR A;  2Q69 A;  4LWS A;  2CGO A;  1V55 B;  4JAU A;  1KJ8 A;  4XX0 B;  3TET A;  1I7L A;  2IBK A;  3JSL A;  3VQW A;  4EKW A;  2AHZ A;  4J9N A;  5IYB O;  5KX5 F;  3Q8Q B;  1T94 A;  4O4J B;  4DR4 O;  1HNZ H;  3HT5 A;  3K5L A;  4ECR A;  4TOI A;  4FS2 A;  5LP6 C;  5KFD A;  3M9M B;  4ED7 A;  4YR2 A;  5DG7 A;  3OM3 B;  3HOU G;  3JZF A;  2NNU A;  2ZNI A;  1GYF A;  1XMQ H;  4YAJ B;  4X20 A;  4QIW F;  1S0V A;  4WFE A;  5KFV A;  5C8Y F;  3JAW B;  1P7G A;  3WWI A;  1S0M A;  2KKW A;  4PEL A;  1QVF U;  2JA6 G;  1V54 C;  4KHP O;  1KJ9 A;  1S9F A;  3ZMU A;  2P90 A;  1EM1 A;  1P16 A;  4DUZ B;  2C35 B;  4LF9 B;  2FL4 A;  5C3E G;  4F6R B;  1JCH A;  2QWP B;  2IJI A;  5DIS C;  3AYH B;  1YJW V;  4IYH A;  1M56 B;  4DR6 O;  1EN6 A;  5KFO A;  1E4F T;  4RAY A;  3TJT A;  1I94 B;  4O7W A;  5KG5 A;  4DK1 A;  3ABM B;  2JJ1 G;  2RJZ A;  3H4B A;  2BTQ B;  1G6U A;  5LYJ B;  2WLK A;  3R9R A;  2UXC O;  1DV1 A;  4DV7 O;  1YIJ V;  3AK1 A;  1UC9 A;  4LF7 H;  3U54 A;  1MNG A;  1EKP A;  5EZY B;  4DV0 H;  2OCC C;  4QWB A;  5IYB G;  3MFH A;  3ML0 A;  4I55 B;  1KC7 A;  4DR6 B;  3BHP A;  2R84 A;  4MV1 A;  3QVN A;  5F9N A;  4JZG A;  2UVR A;  1F4N A;  3L71 H;  4J42 A;  3BA8 A;  4IHJ A;  4UV8 A;  5KFC A;  2AZ2 A;  2YU9 A;  5BYB A;  1XMO O;  1Y6X A;  3MR2 A;  4UCV A;  4DR7 H;  4QJF A;  4DR1 H;  2LGW A;  3HKB B;  3ZMT A;  5KT7 A;  4ETS A;  2UUC O;  2YXY A;  2B63 A;  3JYC A;  2P0A A;  4GT1 A;  1D2D A;  1JXL A;  1WPB A;  1WB7 A;  3CEB A;  4DL5 A;  4FM1 A;  2XAG A;  2WB1 E;  5CA0 F;  3RBE A;  1S10 A;  3JAL A;  3FKI A;  1EBO A;  1BHB A;  4FVM A;  1DF5 A;  4DL2 A;  4DL7 A;  4B3M H;  1R3K C;  4O4J F;  4WBN F;  4FM2 A;  4EBE A;  3CRA A;  1JLL B;  4O82 A;  4B3S H;  4JAS A;  3EFF K;  5IP7 G;  3R23 A;  4DV3 H;  3K0G A;  2WLM A;  4RQF A;  3GTO A;  4ECW A;  4NXN H;  4TUY B;  3CJH A;  2CZG A;  5D1O B;  3GII A;  4BR6 A;  4DR4 B;  4EBD A;  2QKC A;  1PNL A;  3MWE A;  1SZX A;  4LF4 H;  5LP6 F;  2O03 A;  4A3M G;  1O9G A;  4O7R A;  4B08 A;  4AQY O;  4IZO A;  4ECQ A;  4F4Y A;  4KL1 A;  4FLT A;  3EVK A;  1BHA A;  1N48 A;  3ABL B;  4P9P A;  5I47 A;  4LFC H;  4CH6 A;  2W70 A;  3GTG A;  2RCV A;  4YBZ B;  4FFM A;  4IIJ A;  5KX5 B;  3CX5 F;  5KT5 A;  1AVM A;  2JS5 A;  4K0K O;  1US6 A;  3AG2 B;  4U6P A;  2EIJ B;  3LDE A;  1AR4 A;  2Q0O C;  3KZI Z;  3AG4 C;  4JI3 H;  5FPR A;  4JI2 O;  1JMK C;  4X62 O;  4LF8 H;  4LNU B;  4PBC A;  4E6N A;  5LGU A;  1FXK C;  1A0I A;  2ZDI C;  4YJ3 B;  3HKC A;  1SES A;  1Z2G A;  1AR1 B;  2N05 A;  1CE8 A;  1Y1W A;  2IM9 A;  3APO A;  4RUC A;  3H01 A;  3GVM A;  1CPY A;  1NZ6 A;  1N32 H;  2PGG A;  3PZP A;  3T9B A;  5KFT A;  3T99 A;  1FPO A;  5JUM A;  3DGE A;  3IC9 A;  3JSN A;  1E4E B;  4IAJ A;  2WE6 A;  2W6Z A;  4ZOL B;  1IBL B;  4EQ5 A;  3K9A A;  1EN4 A;  1YVW A;  3ZN0 A;  5J2T A;  2LGQ A;  3RF2 A;  2EX3 A;  3OD4 A;  1TAE A;  3UKM A;  2BTQ A;  1XI1 A;  2XCL A;  2G38 A;  4UCT A;  4CKB A;  4U7C A;  2JIZ G;  4R6Z A;  3H1L H;  3OTO H;  4DIM A;  2AGP A;  3B09 A;  1O9H A;  3T5J A;  1V51 A;  5EBW C;  2XT9 A;  4H33 A;  1G4Y B;  4XBF A;  3QG5 A;  1N33 B;  2SCU B;  3JAM W;  2FTK A;  4HNT A;  1FYJ A;  5L3B A;  3N6R A;  2PZS A;  1MOF A;  3HKD A;  1WR2 A;  4O3Q A;  2Q67 A;  1BL8 A;  1XQ8 A;  5EK0 A;  1NR7 A;  4BIZ A;  5KAI Z;  1RM1 C;  1KP3 A;  2ZGI A;  2DMX A;  2OLS A;  5KFM A;  5BPH A;  4WCE V;  3FAV B;  1P84 F;  1K8A W;  3WO0 A;  2WB1 A;  4O4I A;  5H5N A;  3ETD A;  2HP8 A;  2ZM6 B;  3J80 W;  5LA6 F;  1NBM G;  1YSC A;  3CS5 A;  4DV5 B;  2Q7D A;  1PNK A;  1UPG A;  3H9V A;  5KG6 A;  1Y1W G;  3STL C;  3I56 V;  1GN6 A;  1GGO A;  3JAR B;  4YJ2 B;  4MTE A;  4MSW C;  1M6V A;  3LUT B;  4NTW A;  3X2Q C;  1VF7 A;  2R9A A;  2QWN B;  4O7N A;  3HOZ G;  4LP8 A;  3QO8 A;  3VMM A;  5IP9 G;  1SA0 A;  3M99 B;  1PX2 A;  4XDK A;  1Y1V G;  3D8C A;  3NBY B;  4ECU A;  4HAM A;  1Y67 A;  5GON B;  3SPG A;  4U3J B;  2DN9 A;  3ZRW A;  4B3R H;  2CAZ C;  1DV2 A;  2FK1 A;  2NR5 A;  3HKC B;  4J9S A;  2A79 B;  3J80 N;  2UUB H;  1N32 O;  1UFI A;  1X4T A;  1C3O A;  4GC6 A;  3RV4 A;  1VF5 B;  5B1N A;  2BQU A;  3SPC A;  3H1K H;  1TVK B;  1TWG A;  1ARO P;  2X6C A;  1BS3 A;  2BSK A;  3ZMV A;  2GPW A;  2Z02 A;  3R5H A;  2ITD C;  1K1Q A;  4JI7 O;  4TSF G;  5B3S B;  4X62 H;  3BQ2 A;  2R72 A;  3KAJ A;  1I6U A;  3CSW A;  3VQY A;  2RDC A;  1T3N A;  3UT5 A;  5FR9 A;  4MVZ A;  3VA7 A;  1HW7 A;  3SYP A;  5KT2 A;  4K0K H;  5HFL A;  1VF6 C;  1SEI A;  2Z5U A;  4OX9 O;  2F4V O;  1VKZ A;  2DJV A;  4JGS A;  1KBH A;  3K06 A;  4RU9 A;  1PL4 A;  2IJK A;  4IHJ B;  4A2A A;  5DMX A;  4AQY H;  1G1X B;  1SQF A;  2FK3 A;  1TUB B;  2E75 B;  3HKD B;  4O2A B;  1IBM O;  4X88 A;  2ZDH A;  5KFQ A;  5LP6 A;  2GSM B;  4LFA B;  4E4T A;  5KMG A;  2ZIM A;  3WB2 A;  4DV4 B;  2Q2U A;  4X1I B;  2XC9 A;  5CB4 F;  3MJF A;  2JGD B;  3DXR B;  2HJW A;  4RUA A;  3OFN G;  1UNN C;  2E5L H;  1H2S B;  4NTY A;  4RUF A;  1V54 B;  4F4X A;  4B3M O;  2A0L A;  1VS0 A;  4DR2 B;  4O7Z A;  2WSS G;  1JVM A;  2W6I G;  4UCR A;  1S5L Z;  2HDK A;  1NQT A;  4IHJ F;  3CCR V;  1K83 A;  2H3O A;  1KQS U;  3BG5 A;  3V4Z A;  1KP2 A;  2BR0 A;  1KUT A;  2Q2T A;  2UUC H;  2YRX A;  1I1L A;  2PI4 A;  1NT2 B;  1FS0 G;  2FB5 A;  4LMY A;  3IFX A;  4DR1 O;  3ASN C;  4DR7 O;  5HNE A;  2BOB C;  3GIP A;  1ZET A;  1GSO A;  1WJZ A;  4J7K A;  1GN3 A;  3ZRW B;  3RGX A;  2PI5 A;  3WWJ A;  1EKV A;  1OBD A;  3U9T A;  1IBK H;  1YHQ V;  4DV0 O;  1P49 A;  1PPJ H;  4EYI B;  2ZCE A;  4DV6 H;  2ETN A;  1SQG A;  2W9B A;  4LF7 O;  4B7K A;  4CMF A;  3QO5 A;  4DV7 H;  2UUA B;  3JAM N;  2BSK B;  1HWY A;  4ZBM A;  4DV6 O;  4GKK B;  3RB3 A;  3CC2 V;  4LNU A;  1IBK O;  3QNE A;  1Q43 A;  2UU9 B;  3RYH A;  2HKO A;  4MA5 A;  4I5S A;  4RAI A;  2FMA A;  2YI8 A;  1PM9 A;  1MG1 A;  3P3N A;  3FDS A;  2NU8 B;  5KHK A;  3FB5 C;  4JYC A;  4GCZ A;  5JJE B;  3F5W C;  3KAL A;  1GKF A;  3DF7 A;  4JYY A;  3JAW A;  3GTL A;  4EYH B;  2W9C B;  4KHP H;  5B5E Z;  1I1M A;  2HGX A;  2JDI G;  3V4S A;  4PA4 A;  2FPP B;  2GLT A;  2PVP A;  2C2R A;  1EUD B;  4WD3 A;  3TXS A;  2KB1 A;  5KFK A;  3N40 P;  1Z5V A;  1BQZ A;  5KT6 A;  2E5L O;  3RV3 A;  4FFP A;  1XMQ O;  1XEQ A;  2VR1 A;  2HG5 C;  4DRX A;  5CBH A;  3CHX A;  1FJG B;  3U11 A;  1F7Y A;  4O83 A;  1JKJ B;  4JTD B;  3Q1K A;  1WP8 A;  2P4V A;  3FKS G;  3LSQ A;  2CNQ A;  4ECS A;  1Q3E A;  4JUZ A;  3LNN A;  2I80 A;  1IBM H;  4A3I G;  2YS8 A;  1JIH A;  3N41 B;  1SC5 B;  5EWG A;  2YEV B;  4ECZ A;  1KJI A;  3GTQ A;  2YEV A;  4Z1M G;  2F4V H;  5KMG B;  2PMZ E;  2WLH A;  4MTO A;  4OX9 H;  3H1H H;  4JYA B;  1XDC A;  2FK2 A;  2I8C A;  4PV1 B;  3N44 B;  1YDX A;  3E8B A;  3OUU A;  2KSW A;  1M0T A;  4FU0 A;  5L1L A;  4BY7 G;  1R6K A;  4YJ2 A;  2R9I A;  2QDO A;  3BPZ A;  1XNQ B;  4WBN B;  2CK3 G;  4LF5 O;  5DGB A;  4JI7 H;  1B06 A;  5A9G A;  2IP4 A;  5BWW A;  1ZSP A;  2WLI B;  5CA0 B;  4HYK A;  2UXD H;  1CKN B;  4MV9 A;  3IAY A;  5KFE A;  4UCO A;  3PW2 A;  3ETG A;  2EJ3 A;  2N04 A;  4ABM A;  3FKI G;  3ZHV A;  5EIB C;  2ILM A;  3MR3 A;  4MAM A;  4O3P A;  5C5J A;  5C1O A;  2UUB O;  3SDL A;  4K35 A;  3ORR A;  2ITC C;  4KFM A;  1V4Y A;  1GSH A;  3JD2 A;  4N21 A;  4TV8 A;  3E5N A;  4GX5 A;  4WFF A;  4B3R O;  1K5S A;  3JRX A;  2OWO A;  1KEC A;  3C3S A;  4ZQI A;  2IH1 C;  3ETH A;  4Q0Y A;  5KFZ A;  4LF6 H;  4LWS B;  3ZIA G;  5EIB D;  3GTM A;  2PYJ A;  2VA2 A;  2Z3Y A;  3M9N B;  2BCC H;  4ED0 A;  1N36 B;  4MTG A;  2CDY A;  4LH6 A;  3W1G A;  4OPH A;  2GBO A;  3CRM A;  4RWU A;  1B6Q A;  2FYU H;  2COJ A;  3W5O A;  1AP6 A;  2Q6A A;  2XOK G;  3EXA A;  3OEH G;  1OV9 A;  1L2Z A;  1TGO A;  4FZ0 A;  4Q20 A;  1GO3 E;  3JAL B;  1Z5W A;  1S03 G;  4DUY B;  1G8M A;  3K04 A;  2DWD C;  3TII A;  4GX0 A;  3GIQ A;  1Y4M A;  4ZI7 B;  3FX7 A;  4MVO A;  4GX2 A;  5DQI A;  2R93 A;  3T5K A;  4BXX G;  3N2G A;  2Y4R A;  4CE5 A;  4MV4 A;  3AX6 A;  1WH2 A;  3H3V H;  4FFO A;  3VOU A;  2UXB H;  3N2K A;  1L0L H;  2HGS A;  3RAQ A;  4O4I F;  2QKA A;  1DLB A;  2KSD A;  2Z0A A;  5LA6 A;  4RNN A;  1DTO A;  3A8T A;  2O57 A;  1TUB A;  4U3J A;  4DV1 B;  3CCU V;  3CC4 V;  1PNM A;  1HR0 H;  1I2K A;  2R70 A;  4MV8 A;  5IY5 B;  4TT3 G;  3B77 A;  1OBG A;  4LC1 A;  4B7E A;  3OTO O;  1VQP V;  5ITZ B;  3DTF A;  1S0N A;  3SI8 A;  3RVZ A;  2ZD9 A;  4X65 H;  4AYB A;  4RQE A;  3QWU A;  3R65 A;  5LL6 b;  2AU0 A;  4BWS C;  1MAB G;  1ZX3 A;  4XZ3 B;  1H8E G;  3HXL A;  3LDC A;  1VQK V;  4CZZ A;  4Z1V A;  2FB9 A;  1MZF A;  4QNH B;  1JR9 A;  5CA1 F;  3S24 A;  2I87 A;  4A3D G;  1SET A;  3EPG A;  2Y4U A;  3H0G G;  2DAB A;  5H80 A;  4O3R A;  3GIM A;  3LWB A;  1M57 B;  1KTA A;  3OEE G;  2LO1 A;  2W71 A;  5KFU A;  3HB9 A;  2CTW A;  2QJ1 A;  2YL2 A;  1DF4 A;  4HNV A;  5B1O A;  4CS3 A;  1IOW A;  4RUE A;  4NR1 A;  4LF8 O;  2HLD G;  4JI3 O;  4JI2 H;  4LF5 B;  1RJQ A;  2ZDQ A;  1R3J C;  5C44 G;  4IWX A;  4NYK A;  2WLI A;  5EBL C;  1K97 A;  4QPJ A;  5DG9 A;  4LCU C;  5CA0 A;  1VQ6 V;  4RB0 A;  3S3X A;  2Y4T A;  4JYA O;  4A93 G;  3RBZ A;  5FL7 G;  2CGN A;  3CQZ A;  4LFC O;  3FB8 C;  4FMT A;  5BWU A;  3F5T A;  4I4T A;  3SPJ A;  2BE3 A;  1URF A;  4PA3 A;  4TWK A;  3CCM V;  1Q90 D;  2ZE7 A;  1Y74 A;  5KHG A;  3GWK C;  4LF4 O;  1D5A A;  1F23 A;  1Z2N X;  1HNZ B;  2XAQ A;  5CAE B;  3MFI A;  2LFR A;  1SFO A;  4NXN O;  3C90 A;  1YEW A;  1CKO A;  2EJ7 A;  3SJA C;  4DV3 O;  3ORQ A;  3KTM A;  5E79 Z;  3WB0 A;  2ZNJ A;  3D36 C;  4B3S O;  4I7H A;  1RJR A;  3L70 H;  3K5H A;  1B6S A;  5KFJ A;  4J9M A;  5BMV B;  2GTA A;  2C2A A;  2P4K A;  2F66 C;  4IRC A;  1AN7 A;  2XND G;  4EEQ A;  3RR5 A;  4DRX B;  1RYR A;  4JI5 O;  2ASJ A;  1ZHS A;  2DIK A;  1WCM G;  1K4C C;  4K8X A;  4H13 B;  2IU0 A;  4HNU A;  2WAM A;  5J9P C;  1AP5 A;  4DUZ H;  2EBO A;  3VPB A;  3ETE A;  1XMO H;  5JH7 A;  1Y76 A;  4XYM B;  2K1E A;  3T7A A;  3CWB H;  3KHL A;  4QW8 A;  5CA1 B;  1GTO A;  1Y76 B;  1CS0 A;  5JH7 F;  2Q7H A;  3ABM C;  2RDJ A;  4IRK A;  2YIA A;  4GC7 A;  2FLL A;  4Q44 A;  3WG7 B;  2L6L A;  2QWR B;  4DAA A;  2EIJ C;  1I94 H;  4L8J A;  3G67 A;  2PF4 E;  4FM0 A;  2VQE O;  5ITZ A;  4WHX A;  1IOV A;  1M5I A;  5H6R A;  2UUA O;  4DL6 A;  3WB1 A;  2UXC H;  1N56 A;  1JFF A;  5EBM C;  3OTF A;  1EUC B;  2WLJ A;  2XIG A;  4DV0 B;  3V6K A;  5EC2 C;  4TV9 A;  4DR6 H;  3U0Z A;  2YWV A;  1MZB A;  3CPW U;  3BAC A;  4H37 A;  4PZ7 A;  5C8Y B;  1WP7 A;  5JVD F;  1YI2 V;  1VIB A;  4DR7 B;  3ZX6 A;  1GSA A;  3T2M A;  1QVG U;  4O4H F;  3VQV A;  4R50 A;  4M9U A;  5KT3 A;  3RGB A;  3OSN A;  4QE7 A;  3F7V C;  4JAA A;  4MVR A;  5BZB A;  5KT4 A;  1N0N A;  2QEX V;  1OCC C;  4ZHQ F;  4WFG A;  1D5N A;  1M90 W;  4IWY A;  4DR2 O;  5L1K A;  2DYR C;  2GQR A;  2DQ3 A;  2CW8 A;  1H2N A;  1XK5 A;  3G8C A;  2PMZ A;  2CTP A;  4DV3 B;  1K1S A;  1XHZ A;  4NXN B;  1TUE B;  1PV0 A;  3BQ1 A;  2GTS A;  4Y8V B;  2Q68 A;  3CC7 V;  1HNZ O;  4DR4 H;  4C5B A;  4LF4 B;  4O7Y A;  4UFZ A;  5FNV F;  3O65 A;  3C0F B;  1RM1 B;  4JI1 O;  5IWA O;  4JTC B;  1ZHQ A;  4L1K A;  2FE3 A;  4ZHQ B;  5A2Q W;  3ASN B;  3FFQ A;  3FB6 C;  1EYZ A;  3KHG A;  2EJ2 A;  1Y74 B;  2QA4 V;  2XTA A;  2JEJ A;  4MV6 A;  2ABJ A;  2XGQ A;  3LSU A;  4O4H B;  3NGD A;  3BAA A;  1UJW B;  3IC7 A;  1LR1 A;  2OIG A;  3UYY A;  5CA1 A;  1FKA O;  1K34 A;  2DOS A;  4PDM A;  5LBQ A;  4O81 A;  1KJQ A;  1MSD A;  1Q6H A;  2W6N A;  4J9Q A;  4PJ0 Z;  1I0H A;  1FXK A;  3JZ6 A;  2ZDI A;  4JI3 B;  1OCO C;  4D7S A;  4LF8 B;  4F6R A;  1ZL8 B;  4JI8 H;  4ED1 A;  4J11 A;  4D7T A;  1R73 A;  1ZL8 A;  4DXW A;  4JV5 B;  4TQR A;  5KFI A;  5DAA A;  1JFF B;  1IXM A;  4MS2 A;  1WRV A;  2HVK C;  4NZM A;  2ZT9 B;  2VQF B;  3HKE A;  5KLV H;  4ZI7 F;  1M9N A;  1N32 B;  3GIL A;  2DWE C;  3ZMS A;  1B33 N;  4EEY A;  5H2F Z;  1XNR H;  2EZO A;  3J81 W;  2GDS A;  1GN2 A;  3H4D A;  3E2E A;  1IBL H;  4J7Z A;  3SYA A;  2DAA A;  1SF9 A;  2QKS A;  3CXH F;  1VQ9 V;  1DAA A;  2IJH A;  4JXU A;  3R66 A;  3SNO A;  3I4M G;  2DW4 A;  4RB2 C;  4FZ1 A;  2HFE C;  2W7P A;  2ATK C;  2FLN A;  3DTU B;  1N34 O;  5EZY F;  3A0H Z;  3ASO B;  2EJR A;  4Q4D A;  1K4D C;  3OTO B;  1WA8 A;  1BMF G;  5LMU B;  4AYB E;  5BWV A;  4MVS A;  1KB9 F;  2MW2 B;  4FLY A;  3M8A A;  4DV2 H;  2YZL A;  1TWA A;  4JI4 H;  4DV1 O;  5KFX A;  2NLJ C;  1VQ8 V;  1TWC A;  4ECT A;  4MVQ A;  4NB5 A;  2R8G A;  1AI6 A;  5LMN H;  1ZWI C;  3JRW A;  1KYO F;  2E76 B;  1B6R A;  4I50 A;  3R5F A;  5KA5 A;  3RW0 A;  4GKJ B;  4UXN A;  1NKD A;  4I0X A;  4I50 B;  5DED A;  3ZED A;  2ZM6 H;  3K3P A;  2A9H A;  1I5X A;  1KD1 W;  4YIO A;  4QSH A;  4NXM B;  5L3G A;  2HHF B;  1RK5 A;  5EWE A;  3F8N A;  4Q8E A;  1ENV A;  2CNU A;  2FP4 B;  5DGH A;  3PR5 B;  2NVX A;  1A48 A;  2Y0S E;  4F50 A;  4MW3 A;  3RIZ A;  4QE9 A;  3TW6 A;  5C4X G;  3AEI A;  3ZS8 C;  3ZBH A;  1SER A;  1DIK A;  3T4D A;  2W9B B;  1GRJ A;  2R8H A;  5BY1 A;  1XDN A;  2EIK B;  1J5E B;  1OCZ C;  4YY3 O;  1AUV A;  3B8M A;  4X64 B;  4J41 A;  2IA6 A;  5CBG A;  5FNV B;  3K57 A;  4EFB A;  4HN2 A;  2UUB B;  4LSX A;  2J6S A;  2VUG A;  2DPJ A;  4FLX A;  4UUG A;  4O4L A;  2F23 A;  1OCC B;  5C93 A;  1P8L A;  5J2T F;  3RYH B;  3W7T A;  2V7Q G;  2VS0 A;  1XIL A;  2DYS C;  4KP4 A;  3KHH A;  1E79 G;  3G6E V;  2FPI B;  2F43 G;  3HO8 A;  1Q6I A;  4X62 B;  5JJJ B;  1S77 D;  1RFY A;  1KBL A;  4PDR A;  3ZHS A;  4NVP A;  1VF6 A;  2K9P A;  4DR5 H;  1RPO A;  4FBU A;  5H9C A;  4FFB A;  2QR4 A;  3K58 A;  4K0K B;  2CE4 A;  2ZDG A;  2WA4 A;  4DK0 A;  4O4J A;  4JI0 H;  1VQ4 V;  2ZXW C;  1WAZ A;  3OUF A;  4DL4 A;  4PI0 A;  1L8D A;  3PFF A;  1VAR A;  2L35 A;  5LHG A;  3O9O A;  4AQY B;  3ABU A;  4QW9 A;  1FFX B;  2J6U A;  2KG7 B;  4C5A A;  5F9L A;  4FE2 A;  2AGO A;  4LFA H;  4K8Z A;  4DV4 H;  3TCU A;  5KFH A;  1RK6 A;  2ZXW B;  5BMV F;  3BAB A;  3G8D A;  1OHH G;  3B40 A;  5FJ8 G;  2FLP A;  1E1Q G;  4PDV A;  5I5V A;  4O3O A;  1I50 A;  2E5L B;  5IYD G;  1AI7 A;  3TEK A;  1M0W A;  4IRD A;  5DQG A;  1HNX O;  1MZE A;  4PD4 F;  3H0G A;  4A3J G;  4D6T H;  3DXR A;  3ABK B;  1XOU A;  2R92 G;  4LBE C;  4MTD A;  2WYO A;  4YY3 B;  1J5E O;  1H2G A;  1WSC A;  2FKX A;  1AJP A;  5KUK A;  2RNB A;  4X1Y B;  2JA8 G;  1VAJ A;  4JZ2 A;  2PY5 A;  2UVW A;  3L72 H;  4CH3 A;  2ASL A;  3GV8 B;  5IT9 N;  3ABK C;  2WLL B;  2QYZ A;  3W7X A;  1ZAU A;  3JAS A;  1COW G;  5GON A;  5FPO A;  4DV6 B;  4GKK O;  2YZN A;  5GTH Z;  4APM A;  4ECY A;  5IE9 A;  3LQS A;  4MW8 A;  3DAA A;  3K59 A;  4PA9 A;  1S68 A;  4UCU A;  2F93 B;  5IYZ B;  4R8U B;  4MVM A;  4JI6 B;  3SJC C;  1W2B U;  3SGI A;  3VPD A;  1YIT V;  1QLE C;  3K3W A;  2LJ2 A;  1KUQ A;  2M7W A;  4J9Z B;  4UB6 Z;  2W9C A;  2UU9 H;  2EIN C;  2HG8 A;  3AG7 A;  3OAA G;  4B3T B;  4IIJ F;  3CP1 A;  4FPP A;  3KG2 A;  5K1X A;  4JF3 A;  3SR2 C;  3M9O B;  4F6E A;  3OHB A;  2WAQ A;  4X8A A;  3B8N A;  3WFV A;  5JVD A;  5LMU O;  2GPS A;  1B3Q A;  3T9A A;  3JAR A;  5EDW A;  4FLW A;  2HVJ C;  4KHP B;  5BWX A;  2V4R A;  5LOV A;  3ZRX A;  2CNV A;  4UCS A;  4F4W A;  1XHX A;  3UCS C;  2YID A;  1FFX A;  2COG A;  4CMD A;  4YHH B;  2ZQM A;  5CN0 A;  3RYI A;  1IUR A;  2CTQ A;  2HR3 A;  3SJQ C;  4JAV A;  1QR8 A;  3WNZ A;  1T5E A;  4IT5 A;  1WLE A;  2LP7 A;  4NYE A;  2HVQ A;  1FJG H;  1CP9 A;  3GIJ A;  1U97 A;  2NU6 B;  3RAX A;  2D3O W;  1I7F A;  3E8G A;  2VQF O;  3CB2 A;  2JGD A;  2CTR A;  4NZO A;  3K5M A;  4LFB B;  2Q9L A;  1QLN A;  3JZI A;  3E86 A;  1PK8 A;  5KFA A;  1E4E A;  2H94 A;  4X9Q A;  2VRZ A;  4ZOL A;  2F4V B;  5B66 Z;  1Y66 A;  5JQG B;  1Z2P X;  4RZR A;  2CH7 B;  1SQV H;  3FD9 A;  5JQG A;  5LXT A;  1VQN V;  5DLG A;  4X66 B;  2ZR3 A;  3K9S A;  2EIL C;  1NVP D;  3K79 A;  3KAK A;  3UT5 B;  3OSP A;  4RZQ A;  1BJT A;  4X66 O;  1NTK H;  5K2M A;  1NTZ H;  1GK9 A;  1K9M W;  3RTX A;  4M7E A;  4I55 A;  3IN5 A;  3MHS C;  2EIK C;  1XNQ H;  3D3Q A;  4ED2 A;  2W6Q A;  1H8H G;  5B3S C;  1ULZ A;  3T54 A;  3UM7 A;  5IWA B;  4UVB A;  3CCQ V;  4PA6 A;  4JI1 B;  3CRQ A;  1TA8 A;  4FK5 C;  1Q86 W;  2UXD B;  5D8D A;  3U9S A;  2EZP A;  4LFB O;  5KG1 A;  2XAS A;  3D3I A;  4O2B F;  3QQM A;  1FXV A;  3RFC A;  4JV0 A;  4I9Q A;  5IJ0 B;  4TV8 F;  2HHH H;  4TQS A;  3T1Y H;  1RYS A;  2DQ0 A;  1R3L C;  2P06 A;  1WPX A;  1VQM V;  2MK3 A;  3E89 A;  1EKF A;  2IH3 C;  2WLL A;  3JD4 A;  4WFA V;  4YHH O;  4I4T F;  1N36 H;  1V9P A;  4YB8 B;  1XL6 A;  3E35 A;  4YXW G;  3PW7 A;  2W8K A;  1A9X A;  1AUX A;  4I4T B;  4PWQ A;  1WB8 A;  3BFR A;  2JA7 A;  2PN1 A;  4DUY H;  4E4E A;  4C7U A;  4CKC A;  2HHF A;  4HQ6 A;  1R3I C;  4G2K A;  2X6B A;  5KFG A;  1RSO A;  4DV5 O;  3HOY G;  2CH7 A;  4B3T O;  1NH2 D;  2GUZ A;  2B1G A;  3PJS K;  1GMG A;  2YIC A;  5DG8 A;  1SQX H;  1YTF B;  2UXB B;  2GQS A;  1FXK B;  4JI6 O;  4FFL A;  4YQW A;  3U10 A;  5KG7 A;  4YR3 A;  4ECX A;  1GH6 A;  4DR3 H;  4R7C A;  3JAT A;  4YJ2 F;  1J95 A;  3E22 A;  4O2B A;  3T9F A;  2VQE B;  4QWE A;  2PYL A;  1N33 O;  3IG0 A;  1M93 A;  2B1I A;  2IW5 A;  4HZ3 A;  1I1K A;  4O4H A;  4J80 A;  4EGJ A;  2JEF A;  2OT5 A;  4YJ3 A;  3HKZ E;  5KFB A;  3CSX A;  3T1H O;  3K5N A;  4X65 B;  4BW5 A;  4BW9 A;  1KJJ A;  2RN9 A;  4FGR A;  3JD0 A;  5BR8 O;  2DZD A;  1JX4 A;  2W6M A;  1HNW H;  4RAZ A;  3KKY A;  3T9D A;  5FLM G;  2FPG B;  3LML A;  4FFK A;  4F4Z A;  2RQ6 A;  3QTC A;  4OPA A;  5DN6 G;  4JI5 B;  2QE7 G;  3FYE B;  1SQB H;  5J2T B;  1HNX B;  3BA9 A;  3CCV V;  1IYD A;  3SYC A;  4GLX A;  1SS3 A;  4YR0 A;  2VQD A;  2W6O A;  5GTI Z;  1YCI A;  1Y14 B;  2AQ4 A;  1SKV A;  3TK1 A;  2Q7G A;  2R7M A;  3MDS A;  3TQT A;  4I9W A;  4TQF A;  5CA3 A;  4A3L G;  1JX9 A;  2QTO A;  3JAS B;  1NJI W;  3ZHQ A;  3CCS V;  4TV8 B;  3ZHU A;  2OIE A;  1FXH A;  2R7Z A;  5CB4 A;  2YXH A;  1MA1 A;  1FFT B;  2Y69 B;  1AJQ A;  3W7U A;  4TUY A;  2QWO B;  3I4N G;  1XL4 A;  5JCO A;  2ZIO A;  5B1A B;  1E4G T;  2DYS B;  3LDD A;  2W6P A;  4YJ3 F;  3TW7 A;  2RDI A;  1H2K A;  2FML A;  2PTM A;  3FYI B;  5LGN A;  1JJO A;  1TWF A;  2IMW P;  1N0J A;  2M6Y A;  5KAF Z;  2C22 A;  1Q6U A;  2JEU A;  3JD3 A;  5L3D A;  2GUZ B;  4J10 A;  2X6A A;  5KFP A;  2E74 B;  2EIL B;  2BOC C;  2UVU A;  1QU7 A;  2R8J A;  2WA3 A;  4I7Z B;  3D36 A;  3MWD A;  3RYC A;  5LOV B;  3L4J A;  5BPF A;  2XGP A;  3CD6 V;  4I0X B;  4UVA A;  5KHJ A;  1A32 A;  4FLU A;  4BIO A;  1M57 C;  5IY5 C;  4A5U B;  3NC0 B;  3KYH C;  3CJH B;  3N2K B;  3VOT A;  2JS3 A;  5CE8 A;  1C30 A;  1SA0 B;  4BY1 G;  3ZRV A;  1AB3 A;  4X64 O;  4BBS G;  1Z2O X;  5EC1 C;  1KEE A;  3T9E A;  3C3T A;  3H1J H;  3GQC A;  1N4C A;  1L1F A;  1HNW O;  4DQN A;  3VQX A;  5L3F A;  5BR8 H;  2OCH A;  4A3K G;  1XMO B;  2IU3 A;  3NXS A;  3WG7 C;  4OGQ B;  4I50 F;  3SPI A;  5CMU A;  2XUM A;  3T1H H;  4A3B G;  4P2Z A;  2W0F C;  3HOX G;  1BE3 H;  1CQJ B;  1I08 A;  2B5U A;  5H6Q A;  5L1I A;  4HNA B;  4ED6 A;  5L3C A;  4TM5 A;  2KQX A;  3MAQ A;  3L2P A;  3MR5 A;  4RB3 C;  3N6X A;  3Q4H A;  3RBD A;  4NXM O;  1JOY A;  2OYQ A;  2X0L A;  2PUS A;  2XAF A;  3KCX A;  4ZKI A;  2UXC B;  4DR3 O;  1A3G A;  2WAQ E;  5I5T A;  3K08 A;  3PW4 A;  4GKJ O;  3PW0 A;  1EZJ A;  5FD5 A;  1GM9 A;  1S72 V;  4PZ6 A;  1NS1 A;  4J9K A;  3N42 B;  4PI2 A;  2YYA A;  4CH5 A;  3P32 A;  3RFR A;  2UXX A;  4O7T A;  1VBH A;  2OTJ V;  5KFR A;  3F7Y C;  1JDB B;  3L4K A;  3ZHT A;  3T5L A;  3LSS A;  5IJ0 A;  1THZ A;  1ORQ C;  2R86 A;  4O2A A;  4LF9 O;  2EUL A;  5BYA A;  3BJY A;  2AGA A;  3GIK A;  4FBT A;  3Q2O A;  1YXB A;  3LUL A;  3FAV A;  1N34 B;  2CKZ B;  2C28 A;  3RB4 A;  4X1I A;  5J2U A;  1R9T A;  3RN4 A;  1EFR G;  2LQT A;  2R92 A;  2RMK B;  2KG7 A;  3A0B Z;  4WFH A;  1N36 O;  3QFF A;  2C2D A;  1S3J A;  2YSU B;  2R7Z G;  4XYL B;  3SYO A;  3RYC B;  2FKL A;  3GB7 C;  5KFY A;  5KG0 A;  2W9A A;  4FFN A;  2QM8 A;  4BAY A;  1ZUQ A;  3RJ0 A;  2CQY A;  3OR7 C;  4QIW E;  1JJ2 U;  4YP3 A;  4GYC B;  1MSW D;  4A3E G;  2EIM B;  2JJ2 G;  3TXQ A;  2C00 A;  4BIU A;  2RGR A;  1Q82 W;  3I12 A;  4JV5 O;  4ASU G;  1W59 A;  5F2V O;  2WDT A;  3H20 A;  3THO A;  5L3E A;  3E8F A;  4WBN A;  1M4U A;  5LXT F;  3GDE A;  3K03 A;  4CBC A;  3GTK A;  2P67 A;  5KFS A;  3J81 N;  1EN5 A;  1VQO V;  3Q8R B;  2IBZ H;  4XDJ A;  4O3S A;  4R8C A;  4RO2 A;  5A2Q N;  4ED3 A;  4EFE A;  4O2B B;  1W96 A;  2R7L A;  5K1P A;  3MHH C;  2PBZ A;  3OMI B;  3BQ0 A;  4X1K B;  3AK3 A;  3R5X A;  4MTF A;  5D1P A;  1JQ0 A;  4X1K A;  4L87 A;  3BRC A;  4JI8 B;  3UFX B;  3Q4H B;  4A3F G;  4G3I A;  4TQD A;  4JV5 H;  1M1K W;  3N2G B;  2J6T A;  4U3F H;  2Z04 A;  5DGI A;  3PVX A;  1KKC A;  2VQF H;  4KXR A;  4PA7 A;  3RYI B;  5GW7 A;  4CS2 A;  5D1O A;  4FFB B;  4GUN A;  1LNQ A;  1S5H C;  4GX1 A;  4RNM A;  2WLN A;  1XNR B;  3QZ8 A;  1TVK A;  2Q7E A;  3JCU Z;  2AXT Z;  2ZR2 A;  1XUQ A;  1XMQ B;  1Q81 W;  5LOV F;  2JGU A;  4LR3 A;  4OXS A;  1KMI Z;  5LP6 B;  5IT9 W;  5JVD B;  1Q5O A;  3ASO C;  4H44 B;  3UZO A;  5KFW A;  1F51 A;  2XCP A;  1CKM A;  3QO7 A;  3KCY A;  2V9W A;  1DGS A;  3MD0 A;  3NBZ B;  5B1A C;  3LNM B;  2ODT X;  3HPL C;  3JAT B;  4QWA A;  4RNO A;  4XDL A;  3E22 B;  1W93 A;  5LMU H;  2H8P C;  4GZR B;  4LF9 H;  2Y0I A;  3OGI B;  2F95 B;  1GLV A;  1S5J A;  5AG2 A;  1SZT A;  4DV2 B;  4JI4 B;  5I5Y A;  3TQ1 A;  4C5C A;  4FJC C;  2W6J G;  4FLZ A;  2JEG A;  2CFM A;  4CC5 A;  3T4Z A;  3HKZ A;  1T36 A;  1Q8I A;  2P6J A;  5LMN B;  1SCU B;  3AG3 B;  2V4Q A;  4FIP C;  3TY8 A;  3K0D A;  5KKN B;  3WU2 Z;  2Q8V A;  3CXC U;  2BQR A;  4GKJ H;  3T9C A;  4DYL A;  5E1A C;  4E2L A;  3NR7 A;  3B4S A;  4N23 A;  3WWH A;  3U0G A;  5I5X A;  2YC0 A;  4LF7 B;  3OMN B;  4NXM H;  4O3N A;  5I5W A;  2QGN A;  1I5Y A;  3U55 A;  3AK2 A;  4U7O A;  1YJ9 V;  1NI8 A;  2LW7 A;  2W8L A;  3KRE A;  1JA8 A;  5KG4 A;  5L9X A;  3ZMZ A;  3AG3 C;  4ZHQ A;  4LSA A;  3GTP A;  5HV6 A;  5LHI A;  5LYJ F;  5D5P A;  1VBG A;  1CKN A;  2YXL A;  4DR1 B;  4JYB A;  3S3W A;  5D5Q A;  1PKX A;  4EGQ A;  2YDE A;  4O4L B;  3G6Y A;  2E3C A;  1J5E H;  4X64 H;  4DO2 A;  4MA0 A;  1GO3 F;  1PP9 H;  4JPR A;  2ZJT A;  4BWA A;  4Q43 A;  3MR6 A;  1WN7 A;  4TV9 F;  4QJF B;  4B3M B;  1GM7 A;  2VWJ A;  2YUA A;  4AIL C;  1KT8 A;  4R7R A;  4B3S B;  4CC6 A;  1IZ3 A;  3GWO A;  3W1B A;  3TY9 A;  5KG3 A;  3CMA V;  2A7W A;  3PW5 A;  1OCR C;  1VQ5 V;  2JA5 A;  1XBL A;  2OH2 A;  4DV4 O;  1LUW A;  4H0L B;  3VBB A;  2DPI A;  4LFA O;  5CM0 A;  4DR5 B;  1BSM A;  3EPI A;  2X0S A;  3ICX A;  2ALZ A;  5JCO C;  3AG1 C;  4NLG A;  1ZQ7 A;  1WCM A;  4JI0 B;  3GJX B;  2VWK A;  5FLX N;  3JD1 A;  1EZ1 A;  4LFC B;  4O7L A;  4X20 B;  1BGW A;  3A2F A;  4CH4 A;  1QBZ A;  1MMM A;  4TUY F;  5EOY A;  4QWD A;  4JI0 O;  3K5O A;  1M56 C;  4IYI A;  1UC8 A;  2ZE8 A;  4O7V A;  1FD9 A;  1WA8 B;  3K3V A;  4DR5 O;  2IJJ A;  1JPX A;  5DLF A;  4Q8F A;  2W0X A;  5BWT A;  3RT3 C;  4J9R A;  1KC8 W;  3AG4 B;  2Q5Z A;  1SQP H;  2EIM C;  5JQG F;  1RJP A;  3P30 A;  4A3C G;  4LH7 A;  4U7N A;  5JH7 B;  4X1Y A;  3OE7 G;  5JWP A;  4P30 A;  3RVY A;  2X5R A;  4RCN A;  2D2C B;  2R85 A;  4YY3 H;  4O2A F;  2V1D A;  4J9O A;  1HP8 A;  2BTO A;  2XAJ A;  1GM8 A;  2ADP A;  2ZIN A;  2E2I A;  5I60 A;  3N8D A;  1F4M A;  2QSA A;  3HKB A;  2W57 A;  1GN4 A;  1ZLZ A;  1PL0 A;  2VUM A;  1N33 H;  1OWT A;  1VMG A;  1WNS A;  4J9Y B;  3VPC A;  2MCT A;  4Z2W A;  3I55 V;  3CVZ A;  3GB8 B;  2Q0A A;  3E83 A;  4UV9 A;  2M05 A;  2ZM6 O;  3CCL V;  1OCO B;  1OJH A;  4NTX A;  2CUG A;  4EG0 A;  5IYD O;  4G28 B;  5I5U A;  4JI6 H;  4ME6 A;  5LMN O;  2N74 A;  2R82 A;  2Y0P A;  1H2L A;  1IVS A;  1FAF A;  2DLN A;  4B3T H;  4HYO A;  3RUP A;  1NR1 A;  4ZOL F;  4DV5 H;  4M0J A;  4O86 A;  4R8U A;  2HGW A;  3CRC A;  4G27 B;  2AW9 A;  4J7J A;  3G6V A;  4DUY O;  3W7W A;  5TIS Z;  4UB8 Z;  4JTA B;  3NUA A;  1AI5 A; 
#chains in the Genus database with same CATH homology
 3SJA C;  2YI9 A;  3WB0 A;  2XHB A;  2ZNJ A;  4KL1 A;  5BMV A;  4FLT A;  4I7H A;  5BMV B;  4LFC H;  4CH6 A;  4YHH H;  2UXB B;  4HBN A;  2F66 C;  1AN7 A;  4IIJ A;  2F1M A;  3U10 A;  5KX5 B;  4EEQ A;  3RR5 A;  4ZI7 A;  4DRX B;  3TY5 A;  2JS5 A;  3ETQ A;  4DR3 H;  4B3R B;  4IIJ B;  3JAK A;  5KX5 A;  3JAT A;  1ZHS A;  3E22 A;  4O2B A;  2VQE B;  4K8X A;  2VPS A;  2PYL A;  3IG0 A;  1M93 A;  4DUZ H;  4O4H A;  4JI3 H;  5FPR A;  4LF8 H;  1JMK C;  4J0M A;  1XMO H;  4LNU B;  5JH7 A;  4YJ3 A;  1QHT A;  4E6N A;  4LFB H;  3CSX A;  5LYJ A;  1A0I A;  5CA1 B;  4YJ3 B;  3K5N A;  4X65 B;  3HKC A;  2Q7H A;  4BW9 A;  2YIA A;  2IM9 A;  1B04 A;  1I94 H;  3EYY A;  4L8J A;  1HNW H;  4RAZ A;  1N32 H;  4FM0 A;  2QM4 A;  2PGG A;  5ITZ A;  3LML A;  1M5I A;  4X66 H;  2CW7 A;  1FKA H;  2RQ6 A;  3QTC A;  3WB1 A;  1KU9 A;  4JI5 B;  2UXC H;  1JFF A;  3JSN A;  3OTF A;  4IAJ A;  4FLV A;  2WE6 A;  4ZOL B;  5J2T B;  1IBL B;  4EQ5 A;  1HNX B;  3BA9 A;  2XIG A;  4DV0 B;  5J2T A;  2P22 C;  4ZIB A;  3RF2 A;  4GLX A;  2EX3 A;  4TV9 A;  1TAE A;  4DR6 H;  3U0Z A;  2BTQ A;  1XI1 A;  1MZB A;  5IWA H;  3KXY T;  1SKV A;  4JI1 H;  2Q7G A;  4UCT A;  4PZ7 A;  3DSQ A;  5C8Y B;  4TQF A;  3JAS B;  3OTO H;  5EZY A;  4DR7 B;  1O9H A;  2P5O A;  1N33 B;  3QG5 A;  2HHH B;  3JAM W;  4TV8 B;  3VQV A;  3T1Y B;  3RGB A;  2PZS A;  5CB4 A;  4RB1 A;  3HKD A;  3M4I A;  5CB4 B;  1XQ8 A;  4TUY A;  5JCO A;  2ZIO A;  1E4G T;  4DR2 H;  2CW8 A;  2PTM A;  5IJ9 A;  1JJO A;  4O4I A;  1XK5 A;  2ZM6 B;  3J80 W;  4DV3 B;  4DV5 B;  2UUC B;  1XHZ A;  4NXN B;  4PHZ A;  3JAR B;  4YJ2 B;  2RGV A;  4MTE A;  4DR4 H;  4LF4 B;  3L4J A;  4UFZ A;  3RYC A;  5LOV B;  3C0F B;  5KHJ A;  4FLU A;  4MV7 A;  1VF7 A;  1ZHQ A;  2R9A A;  2FE3 A;  5A2Q W;  4ZHQ B;  3FFQ A;  3NC0 B;  3KYH C;  3N2K B;  1IBK B;  1SA0 A;  3RYF A;  3FMA A;  3NBY B;  4O4H B;  1SA0 B;  3RYF B;  3RGZ A;  3BAA A;  5GON B;  4U3J B;  4DR3 B;  4DV7 B;  4B3R H;  2CAZ C;  5CA1 A;  3M7M X;  3HKC B;  1Z2O X;  2UUA H;  2UUB H;  2VQE H;  4GKK H;  1X4T A;  3VQX A;  5BR8 H;  4JI3 B;  4D7S A;  4LF8 B;  4F6R A;  4JI8 H;  1XMO B;  4D7T A;  1CKO A;  3RWR D;  1TVK B;  4JV5 B;  3JAK B;  4PZ8 A;  3T1H H;  1JFF B;  4DRF A;  4HNA A;  4CS4 A;  2VQF B;  4X62 H;  4HNA B;  3HKE A;  5KHI A;  2R72 A;  2JVD A;  5LXT B;  3MAQ A;  3L2P A;  3KAJ A;  4RB3 C;  3N6X A;  1I6U A;  1HNW B;  1N32 B;  3VQY A;  2HEP A;  1XNR H;  3UT5 A;  4EB6 B;  2OYQ A;  2PUS A;  1HW7 A;  3J81 W;  2UXC B;  4JI5 H;  4K0K H;  1SEI A;  5JJN B;  5FD5 A;  4PZ6 A;  1IBL H;  1HNX H;  3N42 B;  4PI2 A;  4CH5 A;  3MWM A;  3RFR A;  4RB2 C;  4IHJ B;  5LA6 B;  4A2A A;  4AQY H;  3PN1 A;  3L4K A;  1SQF A;  1TUB B;  3HKD B;  4O2A B;  5IJ0 A;  5LP6 A;  3OTO B;  5LMU B;  4LFA B;  5KMG A;  2ZIM A;  3WB2 A;  4O2A A;  3N43 B;  4DV4 B;  3VNN A;  2Q2U A;  4X1I B;  4FLY A;  1IBM B;  4DV2 H;  5IJ9 B;  1N34 B;  4JI4 H;  4X1I A;  3SJB C;  5J2U A;  5C8Y A;  5J2U B;  2E5L H;  1H2S B;  5LMN H;  3J7A K;  1O75 A;  1VS0 A;  4DR2 B;  4OX9 B;  4I50 A;  4UCR A;  3RYC B;  4GKJ B;  4JYA H;  3UQ8 A;  4I50 B;  3ZED A;  2ZM6 H;  1SYX B;  4NXM B;  2Q2T A;  2UUC H;  3RJ0 A;  1NT2 B;  4LMY A;  4GYC B;  3F8N A;  4JI7 B;  4Q6G A;  2RGR A;  4O4I B;  3RGX A;  5FD6 A;  3RIZ A;  2WDT A;  3H20 A;  5EYP A;  3THO A;  3ZS8 C;  5FLX W;  4WBN A;  1M4U A;  1IBK H;  3GDE A;  1P49 A;  5EYP B;  2ZCE A;  4DV6 H;  1SQG A;  1XDN A;  1J5E B;  1X9N A;  4EFE A;  4O2B B;  4DV7 H;  4X64 B;  5K1P A;  2GV9 A;  5FNV B;  3K57 A;  4EFB A;  2UUA B;  2UUB B;  4LF6 B;  4LSX A;  4X1K B;  4GKK B;  2YIB A;  5FNV A;  2VUG A;  4LNU A;  5D1P A;  5BR8 B;  4X1K A;  1QQC A;  4FLX A;  1Q43 A;  4A2B A;  2UU9 B;  3BRC A;  3RYH A;  4O4L A;  4JI8 B;  2YI8 A;  1P8L A;  3RYH B;  4TQD A;  4EB6 A;  5KHK A;  4JV5 H;  3T1H B;  3N2G B;  5JJE B;  3KAL A;  3DF7 A;  2HVS A;  4X62 B;  2VQF H;  5JJJ B;  3JAW A;  3RYI B;  4CS2 A;  5D1O A;  4FFB B;  4NVP A;  4DR5 H;  4KHP H;  4FFB A;  1XNR B;  1TVK A;  2Q7E A;  3K58 A;  4K0K B;  1XMQ B;  2VOB A;  4DK0 A;  4O4J A;  2JGU A;  4LR3 A;  4JI0 H;  1KMI Z;  5LP6 B;  3HKE B;  5IT9 W;  5JVD B;  1Q5O A;  3N40 P;  1Z5V A;  4PI0 A;  1L8D A;  2YIB D;  1CKM A;  2V4D A;  4DV1 H;  4DRX A;  1DGS A;  3CHX A;  4AQY B;  1FJG B;  3NBZ B;  3U11 A;  3JAT B;  1HR0 B;  1FFX B;  3E22 B;  4PDB A;  5LMU H;  4LFA H;  4LF9 H;  4K8Z A;  2F95 B;  4DV4 H;  3B2E E;  1Q3E A;  3LNN A;  1IBM H;  1S5J A;  3BAB A;  4DV2 B;  4JI4 B;  1N34 H;  3N41 B;  4FM9 A;  2YCH A;  4FLZ A;  2CFM A;  4CC5 A;  2E5L B;  2F4V H;  1M0W A;  1Q8I A;  5KMG B;  5LMN B;  3TY8 A;  4OX9 H;  3QF7 A;  4GKJ H;  4JYA B;  3N44 B;  2KSW A;  4MTD A;  1M0T A;  2WYO A;  4YY3 B;  4LF7 B;  4NXM H;  4YJ2 A;  3BPZ A;  4AHC A;  1XNQ B;  4WBN B;  4JI7 H;  4X1Y B;  4TV9 B;  5CA0 B;  4ZHQ A;  2PY5 A;  4LSA A;  2UXD H;  1CKN B;  4MV9 A;  3IAY A;  4UCO A;  4CH3 A;  5D5P A;  1CKN A;  2HIX A;  4JI2 B;  2HIV A;  2YXL A;  4DR1 B;  4LF5 H;  1ZAU A;  3JAS A;  5EIB C;  5GON A;  5KHH A;  5D5Q A;  5FPO A;  4DV6 B;  4APM A;  1FVI A;  4O4L B;  2E3C A;  1J5E H;  4TV8 A;  3K59 A;  4X64 H;  2OWO A;  5IYZ A;  4UCU A;  1S68 A;  2ZJT A;  4Q0Y A;  4LF6 H;  4BWA A;  5EIB D;  2F93 B;  5IYZ B;  1WN7 A;  4JI6 B;  3SJC C;  2PYJ A;  3SGI A;  4B3M B;  2HVR A;  2VWJ A;  1N36 B;  4AIL C;  2UU9 H;  3JSL A;  4LH6 A;  3W1G A;  4R7R A;  3W5O A;  3VQW A;  4B3S B;  4CC6 A;  4B3T B;  3W1B A;  3TY9 A;  5K1X A;  1L2Z A;  1TGO A;  3JAL B;  1Z5W A;  3SR2 C;  1S03 G;  4O4J B;  4DUY B;  1HNZ H;  5JVD A;  3K5L A;  4TOI A;  3JAR A;  4DR5 B;  5LP6 C;  4FLW A;  4KHP B;  4ZI7 B;  5LOV A;  3ICX A;  5JCO C;  3N2G A;  2ZNI A;  4UCS A;  1GYF A;  1XMQ H;  1XHX A;  4X20 A;  4JI0 B;  3GJX B;  2VWK A;  1WH2 A;  1FFX A;  4LFC B;  4X20 B;  4YHH B;  1BGW A;  2UXB H;  3A2F A;  3N2K A;  4CH4 A;  3JAW B;  3RYI A;  2HGS A;  5EOY A;  5LA6 A;  3K5O A;  1T5E A;  2KKW A;  1TUB A;  4U3J A;  4DV1 B;  2HVQ A;  1FJG H;  3K3V A;  1HR0 H;  1P16 A;  2R70 A;  4DUZ B;  4LF9 B;  1I7F A;  3CB2 A;  5ITZ B;  3K5M A;  4LFB B;  4F6R B;  4X65 H;  3QWU A;  5DIS C;  5LL6 b;  4ZOL A;  4BWS C;  2F4V B;  1E4F T;  3HXL A;  5JQG B;  4RAY A;  1Z2P X;  1I94 B;  4LH7 A;  4DK1 A;  5JH7 B;  5JQG A;  5LXT A;  2RJZ A;  4X1Y A;  4X66 B;  3S24 A;  2BTQ B;  1G6U A;  5LYJ B;  3KAK A;  3UT5 B;  4YY3 H;  4LF7 H;  1BJT A;  4RZQ A;  3RTX A;  4M7E A;  4I55 A;  5EZY B;  4DV0 H;  1XNQ H;  2BTO A;  4I55 B;  2ZIN A;  3BHP A;  4DR6 B;  5IWA B;  2QJ1 A;  4JI1 B;  1TA8 A;  2UXD B;  3BA8 A;  4CS3 A;  4IHJ A;  3HKB A;  2W57 A;  4UCV A;  4JI2 H;  4I9Q A;  4DR7 H;  5IJ0 B;  4LF5 B;  4DR1 H;  3HKB B;  1N33 H;  2MCT A;  1WNS A;  3CVZ A;  4ETS A;  2HHH H;  3T1Y H;  3GB8 B;  2Q0A A;  5CA0 A;  1WPB A;  4RB0 A;  4FM1 A;  3JAL A;  4FVM A;  4B3M H;  4JI6 H;  1N36 H;  1V9P A;  4FM2 A;  4I4T A;  4B3S H;  4B3T H;  4DV3 H;  4I4T B;  4DV5 H;  4NXN H;  4TUY B;  5KHG A;  4DUY H;  5D1O B;  1D5A A;  1Z2N X;  4DR4 B;  1HNZ B;  4LF4 H;  2O03 A;  1O9G A;  1YEW A;  1RSO A;  4B08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...