3BA8A

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba8A02
4UCOA 4JI5B 2VUGA 3JSNA 2VQEB 4DV0B 4PZ7A 2HHHB 1CKNA 4B3SB 4DR7B 4PZ6A 5DISC 4EFBA 1ZAUA 4LF4B 4LF8B 4B3MB 3W5OA 4GKKB 4JI7B 4UCRA 2HVSA 3L2PA 4LF6B 1IBMB 3GB8B 3GDEA 1J5EB 3RR5A 3VNNA 4JI6B 4DR4B 3W1BA 2UUBB 2F4VB 3BABA 4UFZA 4NXNB 1HNWB 1HNZB 2UXBB 1XMQB 4TOIA 4GLXA 2HIXA 1FJGB 4YHHB 4JI8B 3BA9A 5FPRA 1I94B 2UXDB 1A0IA 4DR6B 1FVIA 5D1OB 2UUAB 4LFCB 4DV2B 1XNQB 4KHPB 2UUCB 1P8LA 3BAAA 3UQ8A 4PZ8A 1TAEA 1CKMA 4DR2B 4JI4B 3NBZB 4JI2B 1VS0A 4DR3B 4B3TB 4LF7B 5LMNB 3NBYB 5BR8B 1CKOA 4JI3B 4LF5B 4X64B 4DV3B 4EEQA 2ZM6B 4JV5B 4B3RB 5LMUB 1XMOB 2VQFB 5IWAB 1N33B 4K0KB 4LH7A 3BA8A 4DR1B 4OX9B 1S68A 4DV7B 1XDNA 4JYAB 1CKNB 1V9PA 1IBLB 4X62B 4YY3B 3TY5A 1N36B 4DR5B 4X65B 4DV1B 3KYHC 1P16A 4LFBB 3T1YB 3TY9A 3RTXA 2HVQA 1X9NA 4E6NA 4DV5B 4UCUA 4EFEA 1N32B 3JSLA 3T1HB 3W1GA 4NXMB 3QWUA 1HNXB 4DV4B 1TA8A 4JI0B 1IBKB 5FPOA 4DUZB 2Q2UA 4CC5A 4LH6A 4UCSA 4DV6B 2UU9B 1XNRB 3PN1A 4DUYB 1B04A 4UCTA 5D1PA 2Q2TA 3OTOB 4LF9B 2CFMA 2HIVA 2UXCB 2OWOA 2E5LB 4CC6A 4LFAB 3TY8A 4GKJB 1N34B 3GJXB 4AQYB 4JI1B 4UCVA 1XK5A 5D1OA 4EQ5A 1DGSA 3S24A 4X66B 2HVRA 4DRFA 3NC0B 3SGIA 1HR0B
chains in the Genus database with same CATH superfamily
5GW7A 5EWFA 4TV9B 2EINC 1HDJA 2EIMB 3LP8A 2VS0A 2YI8A 4JI7B 3CB2A 5IY5C 1KB9F 4QWBA 3P32A 4DL7A 4A5UB 4MV4A 2HVSA 4ZI7A 4TV8B 2UU9O 1WB8A 4X65H 2AHZA 3N27A 1M56B 2FKLA 2AGAA 5KG4A 1WA8A 1IYDA 5CA3A 1JFFB 4RUCA 1HNZB 5LA6B 3FX7A 2LGWA 4MTGA 4O4IB 4KFMA 4MV7A 1I0HA 3BRCA 3JATB 4A3DG 1OCOB 1EZ1A 3HKEA 5K2MA 2WLLA 1S0OA 5B3SB 5KFKA 4DK0A 4LF5H 2FB5A 1E4GT 2YL2A 1TWGA 5BR8B 1ZSPA 1I1KA 1OCCC 1JX4A 2EIJC 2JK5C 1HWYA 3H0GA 2VUMG 2ZDGA 5T14A 4F4YA 5EWGA 1B3QA 2UXBH 4LH7A 3BA8A 4BR6A 4W4LA 3W7TA 4FLTA 4E4TA 1N56A 1XDNA 4XDLA 2EJ2A 2UXDH 2UXCH 2UVRA 3OSPA 1AI7A 1XOUA 5BWUA 3PW7A 4DR3H 2BR0A 4QPJA 2G38A 2KB1A 2FB9A 5KG7A 2PUSA 2C22A 1JA8A 1HNXO 3E89A 4WFBV 5IWAH 3T9FA 4RAYA 2VQFH 4MTOA 2OTJV 4JAAA 3IG0A 2JA7G 4B3SO 3MJFA 1I1MA 1Z2NX 5BWRA 3RAQA 2OH2A 5KX5B 2RMKB 1XL6A 2CNUA 3DF7A 3PJSK 3OMNB 4NXNO 1NTZH 3T1YH 4QIWF 1VQMV 4NKGB 2BTQB 5J9PC 4PDMA 1IBMO 3K5IA 2PI4A 1KTAA 2ZINA 2P22C 2AU0A 4LFAB 4GKJB 3X2QC 4J9YB 2XAFA 1MABG 3ZHQA 3MDSA 4FZ0A 5KFSA 2HHHO 5I5UA 1OZ0A 2Y0IA 4PV1B 5KG2A 1AVMA 4X64H 4MS2A 4ETSA 5KT2A 4RB1A 3AYHB 1PV0A 4NR1A 1K4CC 3T9EA 2ASJA 4PDLA 1FPOA 5JQGF 3RIZA 4DV5O 4DV2H 4C5CA 2VOBA 3MFIA 4TV9A 5LL6b 3KCXA 1BXRA 2DABA 2DE0X 3QQMA 4JV0A 5IY5B 4YJ3F 1MG1A 1NR1A 3ETGA 2NU6B 3LQSA 4J9MA 3LULA 2GLTA 2ETNA 3G80A 3JD2A 1VQ7V 2IJIA 4H13B 1XNRO 4ECUA 3LSSA 1XMQB 2IBKA 5KG6A 2A79B 2WLJA 2OT5A 2OLSA 4NTYA 3WWHA 3FAVB 3JAKA 3ZRVA 2IH3C 1SQXH 3DTUB 1KBHA 3VQXA 3JD4A 1PD3A 4A3MG 1M9NA 4B3TO 1IOWA 3TJTA 2FK1A 1OCRC 1AI6A 1H2KA 3ZHSA 1Q82W 5JVDA 1SQVH 2QF7A 1URFA 4RB0A 2W9CB 3HKEB 4QW9A 3S3WA 1OBGA 1QVGU 2HKOA 3KTMA 2PZSA 2ZM6B 4JV5B 2Z02A 3U54A 3JAWA 1FFXA 5LMUB 2CGNA 1VKZA 1O75A 1YITV 4FFBB 4HN2A 5JVDF 3VQVA 1NVPD 4TV8F 5J2TB 1S68A 2V59A 1SERA 3RB0A 1WA8B 2CAZC 2IBZH 1I94H 1XMQO 4JZGA 1MA1A 4FLYA 2JRIA 1HR0O 3ZBHA 1YXBA 4A93G 5KT5A 1P16A 2BE3A 4TV8A 1UC9A 2SCUB 5JH7F 4JI7H 1SQQH 1QNMA 1Q6IA 2W6JG 4QPKA 1DV1A 3T9AA 1PNKA 1N8RW 4RB3C 5DG8A 2GTSA 4DR7O 1I1LA 1Q3EA 4FE2A 2EBOA 1KJQA 4DR4O 2BQRA 4LF5O 5FD5A 5CE8A 2PYLA 4HZ3A 2GPSA 1MSDA 5KT4A 1GN2A 1VQOV 4JI4H 5H2FZ 4X8AA 4DV4O 3G6YA 3WU2Z 1JX9A 4XZ3B 3T99A 3UM7A 3L4KA 3TY8A 1ORQC 1M57C 2FE3A 2ZM6H 4AQYB 5IYZF 2IH1C 3Q8RB 4YJ2A 5J2UA 4B3RH 2YW2A 1FKAH 2XAJA 4LBEC 2CTPA 2QYZA 4UV9A 1W96A 2GHYA 3J81N 4JAVA 4O2AF 1RM1B 1A9XA 2R7MA 4BBRG 4XDKA 5B66Z 2DOSA 4XDJA 4F4ZA 3E22A 5J2UF 1FXVA 2OCCB 1Y14B 1N34O 4AQYO 4J80A 3F5WC 3DGEA 3RYFA 1NTMH 2HJDA 3T5KA 3B09A 2Y4UA 5LMNH 3DC5A 2H8PC 4LF6B 1J5EB 3U0GA 4O7WA 4NVPA 3W1BA 2UUBB 1EUCB 2FKXA 3OEEG 4RUFA 4Q8FA 2A0LA 2LO1A 2N04A 2YI9A 4G2KA 1EKFA 4GLXA 3I56V 2F43G 1Q6UA 2YXYA 2R84A 1AR4A 1Y1WA 2UXNA 2WLIB 3KHHA 5KG1A 3TW6A 4YHHO 3HOYG 4GX2A 5B1AB 3CQZA 3E8HA 4X64O 1O9HA 3LDDA 1SA0B 3KKYA 4YY3O 2FL4A 4X66H 1Y1VG 3JD3A 4KP4A 5JQGB 3MHSC 5IYBG 4FFOA 3ZX6A 1KECA 2Q7HA 4CMFA 1JJOA 4FMTA 1V9PA 3U9SA 3K79A 4X62B 1PP9H 4YY3B 1A32A 1BGYH 4DR5B 3FB6C 2YDEA 1BHAA 4X62H 3ZMUA 2UUBH 3TIGA 1FXKA 3NUAA 2PY5A 3AG1B 2AGOA 4EFEA 3T1HB 2Q6AA 5EZYB 1AP5A 3H20A 3CCSV 3BCCH 2UU9H 4B08A 5E1AC 2XGQA 1NVPB 2L35A 2YCHA 3OGCC 1SYXB 1X4TA 4DUZB 1G8MA 3C3TA 2XT9A 2R93G 2PMZA 5BWVA 2VA3A 4H37A 2HGWA 4OX9H 3LUTB 1NR7A 2V4DA 2A7WA 2OYQA 1RM1C 4MAMA 5J2TF 2RGVA 1Z2GA 4JI1B 4GKKH 4JZ2A 3AK2A 1E1RG 5LHGA 2X6BA 1OWTA 3G4SV 3ZRSA 3VPDA 4I7HA 4DV0O 4LF7H 4FFLA 1IBLO 3K5LA 3OE7G 1AJPA 4IYHA 4XYMB 4JUZA 2QTOA 1GKFA 2ZQMA 5FNVA 5A9GA 1SF9A 5EZYA 2QTSA 4TM5A 1K1QA 3P30A 4C2MA 4XYLB 2W70A 4LSXA 1AN7A 5FNVF 4DV3O 4PBCA 1KT8A 2EIYA 1IBMB 2PI5A 1NT2B 5I5XA 4ECSA 2R8JA 1FJGO 4O2BB 4DYLA 1CQJB 4AILC 5C3EG 3GIKA 1XBLA 4C5AA 3X2QB 2Q9LA 2W71A 3A2FA 5BR8H 3H01A 4I9WA 1X59A 4MT8A 4TOIA 3TQTA 3QNEA 2PMZE 1K7DA 4QE9A 1I3QA 3QZ8A 1E1QG 4LWSB 4OPHA 5D1OB 3JATA 2P90A 4QJFB 1KJIA 2R9IA 2F1MA 3A0RA 2ZE5A 2EJ7A 4PZ8A 4O2AA 3ZN1A 1ZHSA 3ZRWA 1CKMA 5TISZ 4ZIBA 1EN5A 2K1EA 1JFFA 1ROPA 2W0XA 2IU0A 4DL6A 3RGZA 4JI6H 3H0GG 4LF7B 4QGPA 4MVRA 1K3EA 3AK3A 2W8KA 1ZWIC 4DV3B 3HKDA 4EEQA 2WLKA 4DL3A 3FFQA 2VQFB 3RJ0A 3HKCA 4W4KA 4R6ZA 4LF8O 4JI3O 3KAJA 2W9BA 3RVYA 5CN0A 3G6BA 2E74B 1L0LH 1VEWA 2HVKC 3STLC 1CKNB 4K6NA 1IBLB 3M8AA 4A3IG 2WA4A 3U10A 3L70H 4DUZH 4LMYA 5KX5F 2R6FA 3RYIB 5IJ9B 1YHQV 4E6NA 3CCLV 2JIZG 3RYFB 2C2RA 2C35B 1PM9A 4Z1MG 2E5LO 4JI1H 5F9LA 5C1PA 5KFQA 2R9AA 4DR6H 3IJ4A 1DF4A 2P4KA 5EC2C 1HNXB 1GO3F 4CHIA 1DLBA 3ETDA 2A1HA 2HHFB 3SYQA 1MMMA 5LXTA 3FMAA 1VF5B 3M9NB 3O9OA 1G2WA 4YJ2B 5LGUA 2HDKA 4JTAB 2R92A 2JGDA 4EBEA 2WLHA 1N32H 4FK5C 1S9FA 3CD6V 4NXMO 2F95B 4CS2A 1VBHA 5L1LA 1UFIA 2IU3A 2GDSA 1OJHA 4GX1A 2YICA 4D7TA 4X66B 2HVRA 1Z5WA 2F23A 1T36A 3CEBA 4Q4DA 4DQNA 2ODMA 1VAJA 1S5HC 2ZDIA 4ZHQB 2ZD9A 1KJ8A 4QE7A 5KFWA 3T2MA 1UJWB 2PGGA 2HHHB 2ZGIA 4A3JG 4BIZA 2E76B 3RWRD 3PR4A 5KMGA 2R93A 2NVXA 4WBNB 1F4MA 2ZDIC 4F6EA 4O83A 4JYBA 3L2PA 1HW7A 5KMGB 2ARHA 4NLGA 2DWDC 3NXSA 3O65A 2B5UA 1I94O 3AEIA 2AGPA 1HR0H 4H44B 4D6TH 4ZHQA 3GQCA 5L3FA 3E8GA 1HNWB 4PWQA 4JTCB 3CP1A 1DTOA 5J2TA 1FJGB 4MTFA 3L75H 4J0MA 2GSMB 4HNUA 5BYAA 5EBWC 4LFCB 2W6PA 3HKZA 2ZIOA 4DL2A 3R66A 5CA0A 1UPGA 3K08A 3ASOB 1VQ8V 4PJ0Z 2C2AA 4FZ1A 4TT3G 2XCAA 3RFCA 3N8DA 1CPYA 3NBZB 1IBLH 2JA5A 1F23A 5JVDB 4DLKA 1H2GA 1IX9A 5LBQA 4FM1A 1YIJV 1R6KA 3L9DA 1BZKA 4LNUA 1MOFA 4O4JA 1BCCH 1WPBA 1BE3H 4PA6A 3K3PA 3R5HA 1XI1A 4RWUA 3T5JA 3JD1A 3GV5B 3JYCA 1B6SA 1BJTA 3BJYA 4JV5O 5KFJA 2V4RA 4DUYH 3BEHA 4O2BF 4A3BG 5BR8O 2COGA 3V4SA 2JS3A 1AROP 3FB7C 4HNVA 1JR9A 3J81W 3RTXA 4ECVA 2JA8G 2CH7B 3UO2A 3RB4A 2RDCA 1N32B 3N6RA 1XQ8A 5KHIA 3J7AK 1QU7A 2UUAO 3SPIA 4TQSA 3C90A 2PN1A 5KFUA 4PD4F 5LMNO 1Q43A 4DV4B 5FLXW 3R5XA 4C5BA 1WPXA 3ORRA 5CB4A 1AJNA 4DAAA 1AR5A 2LGQA 1Q7YW 2EIMC 3HXLA 1K5QA 1XHZA 3PW0A 3CCVV 1AUXA 1VIBA 2QM8A 1YJWV 2D3OW 2VQDA 1Q5OA 4O2AB 2Q7EA 4CC6A 2COJA 3RYCA 2QWQB 1P49A 4YQWA 3L71H 3H4DA 3T5LA 4QNHB 4Q20A 1XK5A 5KG5A 5D1OA 3I5DA 4X89A 4YHHH 2KKWA 3VMMA 2NLJC 1A3GA 4UVBA 1SQFA 3WB1A 2PF4E 2N74A 5L3GA 1HR0B 5LP6C 1AILA 3DAAA 4JAUA 5IYBO 5EK0A 2VQEB 4X66O 2B1GA 4UB8Z 3H4BA 4DK1A 2QM4A 4B7KA 4EFBA 2V4QA 4F4LA 1JQ0A 4QWAA 3ABMB 1XEQA 4X88A 4ASUG 3K5MA 5LHIA 2IJKA 2NU7B 3RFRA 5DG7A 1P84F 3OEHG 3GVMA 4WHXA 2CUGA 3BQ2A 5LYJB 1VARA 1CE8A 1ZL8A 3CJHA 2VWKA 4O82A 2QWNB 4NXMH 5FLMG 5KAIZ 4KHPB 5BMVA 5DEDA 1WN7A 3HO8A 3GILA 3ETEA 1D2DA 1V55B 4ED1A 1GK9A 3AG4B 4ED7A 5EC1C 4YIOA 3ETJA 5IT9N 5HFMA 4YXWG 1Y74B 2WAQA 3ABMC 5FLXN 3OFNG 1GN3A 3PW4A 2RDIA 4DRXA 3ZJZA 3B8MA 2E3CA 2YWVA 3DTGA 3UFXB 1P4RA 3OW2U 4O7YA 1K5SA 2YEVA 2I8CA 4U7NA 4E4EA 4ABMA 3AW8A 4IWYA 1UNNC 1K83A 4FJCC 4NZMA 1L2ZA 4R7RA 1BHBA 1EYZA 3ABKB 1N33B 2JA5G 2WPDG 3GTOA 4F4XA 1KU9A 1R6TA 4O4HF 2JA6A 3CMEV 4CH5A 4X1YA 4UUJC 1XUQA 5KFHA 4LF7O 1V4YA 2FPPB 3OAAG 2P06A 4KXRA 3G71V 3UCSC 5JJNB 1S3JA 4ZI7B 4MV1A 2ADPA 3GTMA 4EKWA 5EDWA 1H2LA 3J80W 1N33O 3N42B 5LXTF 4TWKA 5I5VA 4JYCA 5JJEB 4IRDA 4NXMB 1R6NA 3OR6C 2JEGA 4O81A 3CPWU 4MV6A 3BVOA 1N36H 3EXAA 3GIJA 1AUVA 4UCSA 1KBLA 1SA0A 1B06A 3R9RA 4L87A 3Q1KA 4JI0O 3K3VA 1AB3A 4EYIB 4ICGA 5LP6B 2E5LB 1COWG 2IW5A 3ZEDA 2XHBA 2X0LA 4JV5H 1R1BA 2DQ3A 4TV9F 5DQIA 2Q0AA 2UXCO 2AGQA 1PNLA 5BMVF 2WE6A 3HOZG 2VUGA 4A3GG 5JH7B 1E4EB 5KFBA 3A8TA 1QQCA 4LP8A 2PVPA 1UC8A 4PZ7A 4DV0B 1Z2PX 3UZBA 2QK4A 3RGXA 4BXXG 1HNXH 3IAYA 1JOYA 2ABJA 3WWIA 4LF8B 1BMFG 3CX5F 2UUAH 3J80N 4MV9A 4RZQA 3AG2C 5LA6F 1FXHA 5KFFA 4B3SH 4LF8H 1NH2D 4JI3H 1K73W 4YJ3A 2CNQA 3PW2A 4O4IF 2MCTA 4DV6O 3MR2A 1V54C 4IHJB 3RAXA 3GTPA 2JA7A 3UO3A 5KUMA 5IT9W 2XOKG 3TK1A 4DR2O 5I47A 1LNQA 4J7JA 4IIJA 2UXXA 4DUZO 1BQZA 1W2BU 2UXBB 1XNQH 1F7YA 3GIIA 5BYBA 5ITZA 5E25A 5DM6V 1LUVA 2IA6A 1H8HG 2Q73A 2DLNA 4F6RA 2E5LH 4MV8A 1MZFA 4GZRB 1L1FA 2W6OA 2UVVA 4IL6Z 3KREA 1GN6A 1E4FT 2VUMA 3LMLA 4DR5O 5LMNB 5CA1B 2RQ6A 2X6CA 2XAGA 3IFXA 4NTWA 4DL4A 3SR2C 1L0NH 1I7FA 3C0FB 3T9BA 1WLEA 2CK3G 4JPRA 4HR7A 4JGSA 1RJRA 4DV1O 3SE7A 4DR1B 2FPIB 3HOXG 4LFAO 2WTFA 1Z5VA 1NBMG 4HNAB 5LYJF 4X65B 5DAAA 3E8FA 1EUDB 3ZMSA 1RK5A 3DXRA 1P7BA 2DYSC 3JALA 4HNTA 3D8CA 1M5IA 4XBFA 1XREA 5FD6A 1F4NA 2DIKA 4CE5A 4EYHB 2IMWP 3ZHTA 4OPAA 1OCRB 5EBMC 2ITCC 2VQEO 1W0JG 4YJ2F 3W1GA 4RCNA 3T9CA 5CA1A 4U6PA 5H5NA 1VMGA 1WCMG 3JAWB 2L6LA 4X65O 4JI0B 3GTKA 1IBKB 4CBCA 2YZGA 3ABTA 1K8AW 5BWTA 5A2QN 2DMXA 1YJNV 4YAJB 4DV7H 5D1PA 4EEYA 2J6SA 2KQXA 4J9PA 2CFMA 1OBDA 1RPRA 1ZQ7A 4O4HB 1M4UA 1OCCB 3GJXB 1PK8A 4UVCA 4GC7A 2QR4A 2H94A 4J10A 4X62O 1NTKH 2RGRA 1TVKB 3CRQA 1XMQH 1EKVA 3APQA 4IRCA 4FM0A 3DSQA 1EM1A 2V1DA 5KFXA 3FB8C 2XCPA 3ORQA 4YJ3B 4JI7O 4A3CG 3B2EE 5KA5A 1SCUB 1PPJH 2WYOA 3G6VA 5B1NA 3FB5C 2CTQA 2HG5C 3B8NA 4X1KB 5KLVH 3N40P 1RYRA 2Z0AA 4IGGA 4UCRA 3TIIA 3CE2A 3CCMV 1E4EA 1MNGA 4LF9H 4X1IB 3C3SA 3OMAB 5EYPA 2F4VH 1KUTA 3VPBA 4JI4O 1BNCA 2F4VB 3SI8A 4HAMA 4R8UA 4CS3A 4CH4A 5D8DA 4YAKB 1K34A 4YHHB 5GTHZ 3BA9A 4I4TB 1JXLA 4AI8A 3J7AU 2CW7A 5LP6A 4B3MH 5DMXA 1GMGA 2ZM6O 3EPGA 1XNQB 4RNNA 4I50B 3UQ8A 4J9OA 1PL0A 3SYCA 1O9GA 2BTQA 5IJ0B 2DYSB 2MW2B 4FFKA 4Z2WA 4MW8A 1A0GA 5A2QW 3HT5A 2GQRA 3R5FA 2V58A 2LFSA 3H1KH 1VQ4V 1IYEA 1Y76A 2RNBA 3ETQA 5CA0F 5IWAB 4LF4O 4QWEA 3M9MB 4Q44A 3HKBB 5LOVA 4LSAA 1M0WA 5CAEB 2ATKC 2NNUA 1US6A 4JTDB 2QA4V 3QFFA 2Z5UA 5KHGA 4O4LF 4QSHA 4X1YB 2ZE6A 5KFIA 4P30A 3GV8B 4I5SA 4IR9A 5I5SA 1JKJB 3T1YB 1S0NA 1XNQO 3K5NA 2UUCO 3N44B 5IP7G 4DIMA 4DV5B 2YSUB 3GV7B 4J9LA 5KFDA 1GTOA 2KG7B 5K1XA 2FMAA 4DV5H 2JJ2G 2Y0SA 1N48A 5K3WA 1VQNV 4YBZB 2EJ3A 4GC6A 2VA2A 2X7RB 1BL8A 3JRWA 4IRKA 1CS0A 2BSKB 4DV6B 1KEEA 1M57B 2DPIA 2DN9A 2P0AA 3RT3C 3N2GB 3ABKC 5C8YB 1ZX3A 3VBBA 2WLLB 2P7TC 4PDRA 2ZJTA 2B63A 2LQTA 1PKXA 3IN5A 3JARA 4ED3A 4EGJA 1LR1A 5LYJA 2CKZB 3QO7A 1B6QA 1QCEA 3GIMA 4PDVA 4PA3A 5IDJA 5LA6A 2ZDHA 3SJBC 1NKDA 1R73A 1H2MA 5CB4F 4G27B 2WSSG 4CKEA 1SZTA 4O7NA 3K5OA 2UUBO 1M90W 4FM2A 3K59A 1NU1H 1S5JA 3I4MG 4FFMA 5DGBA 3MR6A 5LOVB 1TGOA 2YUAA 1VQ9V 3UYYA 5BZBA 2EZOA 4IYIA 3GTQA 5JJJB 1M0TA 2FYUH 4IIJF 3APOA 2V7QG 5IYZA 5DLFA 4Y8VB 3OR7C 3H1IH 3ZHUA 2MK3A 2QSAA 5FL7G 5IJ0A 1Y66A 3UT5A 4WFAV 4I0XA 4NXNB 1QLNA 4ZOLF 2HIXA 2KSDA 2UXDB 4JI8B 1HP8A 3D36C 3V6KA 3RYCB 1W0KG 5LMUH 5KA6A 4JI8H 3N2KA 4EB6B 3LWBA 3K9SA 4ED0A 2HJFC 1RFYA 2CQYA 4NZNA 4DV0H 5EIBC 3VOUA 1NH2B 1Q90D 1RJQA 1HNWO 4UV8A 1I2KA 3HOUG 1M7JA 4O3NA 4MV3A 1S10A 2A06H 2FLLA 2YIAA 1AR1B 2CH7A 1OCZC 2AHYA 2ODTX 4BY7G 1XILA 1XMOH 2EILC 5DN6G 3BQ0A 4J7ZA 4B3RO 1WJZA 3JASA 4JYAB 2WAQE 3TQ1A 4FS1A 4QWCA 2WLNA 3I55V 3JASB 1GYFA 1L8DA 3QO8A 4P9OA 3OM3B 1NZ6A 5GTIZ 4FGRA 3T1HH 1TWCA 1YEWA 4U7OA 4ZQIA 2XGPA 1CXZB 1V55C 4HYOA 4O4JB 4GKJO 2GPWA 2CW8A 5FJ8G 2IJJA 4A3FG 4AHCA 3OHBA 4O7SA 3BFRA 1D5AA 4ZBMA 1A48A 2ZDQA 2CTRA 1TUBA 3WFVA 4DUYB 3OTOB 5CA0B 2Q68A 2JEUA 5BY1A 2UXCB 2EJ0A 2M05A 5FR9A 1WH2A 4O3PA 4UCVA 3T1CA 3TXSA 3UT5B 1DGSA 4O7VA 5BPHA 2JA6G 2XNDG 2UVWA 3K3WA 5KG0A 2JEFA 4BIOA 3HBLA 3ZN0A 2YZMA 1BGWA 4UCOA 4JASA 2YZNA 3JSNA 4HNAA 4CKCA 2R92G 4IHJF 2UUCH 3R65A 3CXCU 4PI2A 3LSUA 1SC5B 1QHTA 2OTLV 4K8XA 4E2LA 3TINA 2WB1A 3RW0A 5BWXA 3WWJA 1KJJA 2R85A 3CC4V 5KT7A 1T3NA 3D36A 4DV1H 5KG3A 3GB8B 1GLVA 3GDEA 4WD3A 1S5LZ 1GSHA 3T54A 3PW5A 3BABA 2R70A 2FK2A 2YS6A 3G6EV 3JARB 4K0KH 3ABLC 4RQFA 1QLEB 1YZBA 3ZIAG 1N32O 3H40A 5LGNA 2R7ZA 2HVJC 3GTLA 1JMKC 5B1AC 2VQEH 4A3LG 1AI5A 2QGNA 2B9ZA 2RN9A 1KC7A 2BSKA 1H2NA 4K35A 4FLVA 1H2SB 4JI2B 2XAQA 2WA3A 4DR3B 3RBEA 4NB5A 1YJ9V 3KAKA 1TWHA 4NYKA 1DK1A 2R87A 3HOWG 3SPHA 2QB5A 4OX9O 4O86A 2ZCEA 5H9CA 5LOVF 4EB6A 4KHPO 3G8CA 4MVQA 2W6ZA 1WB7A 3CRRA 2RJZA 1JDBB 5CR5A 4EG0A 1S72V 2OIGA 2HR3A 2QEXV 1GAXA 2P6JA 1J5EO 2CNVA 3LSQA 3CWBH 4TUYF 1RSOB 3KYHC 3AG3B 2P5OA 3U55A 5BPFA 2HVQA 1VQPV 1SQBH 3HKCB 3SYAA 4Q6GA 4JI8O 4FLUA 4RZRA 5AG2A 1DIKA 4ED8A 4PHZA 1MZEA 2QDOA 3P3PA 3HB3B 3QWUA 2J6TA 2V9WA 4J9ZB 1KKCA 3OUUA 4IR1A 5IYDO 1AP6A 3OTFA 1XNRB 3HPLC 1EHIA 3VA7A 3OUSA 4WFGA 3VOTA 2B1IA 3KALA 2FLPA 4LWSA 2ZNJA 1YTFD 4I4TA 3EFFK 3GIQA 4CZZA 4APMA 1EKPA 5L3BA 5C1OA 2Q0OC 3T5HA 2ASLA 1R3JC 4BIUA 1G4YB 4RNOA 5C5JA 3SGIA 4ZI7F 5IYCG 1KC8W 2EZPA 4DR7B 5DQHA 3SJAC 4X1KA 5DISC 2KG7A 3M4IA 3VQWA 4JYAH 2CTWA 1SQPH 4J41A 4ECQA 3CXHF 4FFRA 4ZOLA 2QWRB 3P3NA 1YDXA 4LR3A 3E8BA 3SYPA 3VNNA 3G6XA 3GWKC 3G67A 1TVKA 3MHHC 4UFZA 3T1YO 2JS5A 3RUPA 3L72H 2VR1A 4ED2A 2IJHA 3HKBA 3CCEV 5LP6F 1I5XA 3PVXA 1EN4A 5FPRA 5HFLA 4P9PA 5KT6A 2A3QA 5GONB 1FVIA 5DGAA 3V6HA 1ZHQA 2DWCA 3ML0A 4WFEA 2GTAA 4Q45A 3RN4A 4FLWA 3N43B 3ZS8C 3Q8QB 3N6XA 1KKDA 4DR6O 3G8DA 3CCQV 1IXMA 1ZL8B 3FYEB 2ZXWC 3E35A 3AG2B 4X20A 3UZOA 3I4NG 2GUZB 3FKIG 1EZJA 1R3KC 4B3TB 4MVSA 2HLDG 2EINB 2PYJA 1FYJA 5HV6A 5JQWA 2NVYA 4QW8A 5KAFZ 2W6NA 2ATLA 2R7LA 3HR0A 1DAAA 1FXKB 3QTCA 2NR5A 3K0GA 5JWPA 4O3RA 5DGHA 3SPJA 4OX9B 4JI5H 4R8UB 3A0BZ 5KFCA 3WO1A 3JCUZ 2JDIG 1Y1WG 2A9HA 2RCVA 3S3XA 4NYEA 4F4WA 1RSOA 3JRXA 1E79G 5KFEA 1XNRH 2R8IA 2XTAA 1WNSA 5KHJA 3R23A 2CZGA 2KSWA 4LFBO 1M56C 3F7VC 3K5HA 3QVNA 4LFCH 2Q67A 1I7NA 5C8YF 3AG7A 1WCMA 3K57A 2Y48A 4MA5A 1Q6HA 2H3OA 3M99B 1K4DC 2NU8B 4J9KA 3RF2A 3RGBA 4K8ZA 2YRXA 2YZLA 5C4XG 4UCTA 3M9OB 4QIWE 1RK6A 3PR5B 4F50A 1M6VA 5ITZB 2QKAA 2DYRB 2OWOA 1B6RA 3MFHA 2CE4A 2YS8A 4DO2A 1VQLV 2PBZA 1ENVA 3TW7A 1SQGA 3H3VH 2WAMA 4O84A 2WB1E 1S03G 3BQ1A 2EIKB 4R7CA 4U3JB 3W7UA 1VQKV 5KUKA 4MVZA 4IZOA 5B1OA 3BPZA 4B3SB 4D7SA 1W93A 1GGOA 3L73H 5KFTA 2EX3A 1SEIA 4DR7H 3E22B 4MSWC 4J42A 5D5PA 3SPCA 3JALB 3T4ZA 1WR2A 5KT3A 4N21A 4DUYO 2Z3YA 3TCUA 4LNUB 1K1SA 2YRWA 2X5RA 4YIPA 2Q7DA 1P7GA 3CSWA 1OHHG 4TVIA 2DQ0A 4JI0H 5I5WA 3CYOA 1GSAA 1D5NA 1VF6C 2VQFO 1XL4A 4GX5A 4P2ZA 2D2CB 1FKAO 3OUZA 2FJZA 3Q8SB 2QJ1A 2GUZA 4JI4B 2W6IG 3AG1C 4QWDA 1BT8A 3SJQC 4X20B 1VS0A 2DPJA 3ASNB 1GM8A 1NS1A 4R50A 2Q7GA 2ZR3A 3CEIA 5CM0A 4LF5B 1VQ6V 2XC9A 2C28A 4A2BA 4AQYH 4RAZA 4WBNA 5GONA 2R7KA 3TGUH 2LW1A 5L3CA 4H33A 1WP8A 3ABUA 2Q5ZA 3TY5A 2JEJA 2EILB 2YS7A 4FPPA 5KFRA 1EBOA 1QLEC 4KL1A 4RO2A 4I4TF 2BCCH 4I7ZB 2YIDA 2W7PA 1GM9A 3V6JA 3JSLA 2AZ0A 1JDEA 4CMDA 3MD0A 2YEVB 2DW4A 5C93A 4RQEA 4I55B 1V51A 1TA8A 3N2GA 2ALZA 1BS3A 2JEIA 4XX0B 3JZFA 1T94A 4CS4A 3LDEA 3AX6A 2W8LA 2Y4TA 3OUFA 4CKBA 4IT5A 5JCOA 1GRJA 3MAQA 5KS8A 5BMVB 2W6MA 1S0VA 2AQ4A 3SDLA 1FAFA 4ZKIA 3ASNC 4JF3A 3WG7B 1AJQA 4HBNA 4GUNA 4BWAA 3KG2A 4MW3A 2E2HA 1VF7A 5H6RA 2R82A 2X6AA 4GCZA 3WB2A 4LFAH 5EWEA 1HNZH 4B3TH 3S24A 2J9GA 2B63G 4I0XB 4J9RA 3MR3A 2I80A 4Z1VA 3EYYA 3K0DA 5CBHA 2W6QA 5IYZB 3JAMW 2JJ1G 1CKNA 3IGAC 4ECZA 5L1IA 2LW7A 1TUEB 2YXLA 4CH3A 4GKKB 5KFGA 4LFCO 1YVWA 4J9SA 2I87A 3RB3A 4JI6B 5KFOA 4G3IA 1J5EH 4DV7O 2DZDA 2XIGA 3L4JA 3HKZE 5IP9G 1N0JA 1QR8A 4IWXA 2W7OA 2Y0PA 1XDCA 1KMIZ 5CA1F 4MTEA 4QJFA 1RJPA 5I5YA 3AG4C 5L3EA 2F93B 3F5TA 3BAAA 1B33N 3K06A 2EIKC 4DRXB 4N23A 1KP3A 1SS3A 5CB4B 4DR2B 4DR4H 4PELA 4FBTA 1Y74A 3QO5A 3NBYB 3JZIA 4O2BA 3Q8PB 4DV4H 1I2LA 3SNOA 4MVMA 4I55A 1C30A 4NZOA 3FKIA 3KHRA 5DECA 1G1XB 4TQFA 3CCRV 1PX2A 3CS5A 3CJHB 1K9MW 4FM9A 4WF9V 4DV7B 3ZMVA 1FJGH 3K03A 4QIWA 4R8CA 1SFOA 1N36B 4BAYA 3PO3G 1DF5A 1GM7A 2HGXA 4Q8EA 2VPQA 2ZKOA 3TY9A 4IAJA 1X9NA 3CC2V 4O7ZA 2BTOA 4B3MO 3ZMZA 1Z2OX 2YC0A 4J7KA 4YB8B 4FBUA 4ECYA 2JGUA 3F7YC 1H8EG 1FXKC 1NI8A 1Y76B 2ZIMA 3E86A 4PA9A 3W7XA 4DV6H 2ZT9B 3WB0A 3NGDA 1SKVA 4OGQB 1BSMA 2K9PA 3H1JH 3SPGA 4DR2H 3GTJA 2ZE7A 2ADQB 3PN1A 1GH6A 1B04A 3FD9A 2OIEA 5F2VO 3BY6A 1BQ0A 2XASA 3KCYA 1Y6XA 2EIJB 2LP7A 1YTFB 2ZXWB 4JV2A 1WRVA 3ZCCA 3DTFA 3GB7C 4A3EG 5B1BB 3FYIB 2LJ2A 2QE7G 2VRZA 4O3OA 4FFPA 4EBDA 3SJCC 3WO0A 3RV4A 2DAAA 3LDCA 1F51A 4ED6A 4RUEA 5B3SC 3DXRB 1M93A 3U0ZA 5B5EZ 2COIA 4OXSA 4U3FH 3K04A 2ITDC 3F8NA 1IXBA 4O3SA 4O4JF 5IYDG 2YU9A 3V4ZA 2YXHA 4I55F 1JCHA 4PA4A 3H1HH 2JEXA 3SYOA 3EPIA 4FVMA 3D3IA 2Y69C 1T5EA 4DR4B 2HEPA 2HGSA 3GIDA 4RU9A 2C2EA 4UVAA 4O7RA 4MA0A 4JI2O 4LC1A 4I50F 3KHLA 4LF6O 1ZLZA 4U3JA 4PA7A 1M1KW 3TXQA 1EN6A 1A0IA 5L9XA 3D3QA 4YR2A 2JGDB 4CH6A 4FLXA 2PTMA 3B40A 4WFHA 5H6QA 4LFBH 1WP7A 2UUCB 1RP3B 1QR9A 1KP2A 1TAEA 1IBKO 2R72A 5HNEA 4ECTA 2CDYA 2HJWA 1R3IC 2GQSA 2R8GA 2ILMA 2YIBA 3H9VA 5KFMA 1K33A 2YYAA 4ECXA 4O4LB 1LUWA 4DR1O 1IVSA 5D5QA 4B3RB 1I7LA 5EBLC 3BG5A 4UXNA 2R8KA 1IURA 3E83A 2V5AA 2FTKA 3RYIA 4K0KB 2VPSA 4GKKO 1N0NA 3GTGA 5F9NA 1DV2A 1VBGA 4J9NA 4BW5A 2FPGB 1VF6A 4YR3A 2R7ZG 4RAIA 1RPOA 5CBGA 4DV1B 4M9UA 4HYKA 3HOVG 3T7AA 1C3OA 4Q0YA 3AG3C 4UCUA 5J2UB 4GX0A 4A3KG 1QBZA 2AXTZ 4MVUA 2BOCC 5C44G 4U7CA 4DV3H 1I50A 3PZPA 3PO2G 3ZHRA 4LF9O 2R9RB 2P67A 1FS0G 2F4VO 1OCOC 1YSCA 3OTOH 1HNWH 3ZRWB 3ZMTA 3N41B 2UU9B 3BACA 1I08A 1WAZA 1YI2V 1RYSA 1JJ2U 3K58A 3VPCA 5DGIA 5LL6Y 1XMOO 5C8YA 2UXBO 3JCZA 1N4CA 1TWFA 2ASDA 5B1BC 1I6UA 4DRFA 2C2DA 2OCHA 2QWOB 4TUYB 1U96A 1IDSA 4JI6O 4WCEV 4IIJB 4LCUC 1QVFU 1YCIA 3THOA 4RNMA 2HP8A 4BBSG 4A2AA 3RYHA 4GT1A 3RBDA 4IHJA 5KKNB 5IWAO 4LF4B 1ZETA 1VQ5V 2Q69A 4FLZA 3ZHVA 4B3MB 3ABLB 2R86A 4LF4H 4ZOLB 2WDTA 4JXUA 4FFBA 5IJ9A 2EJRA 2R7NA 4GKJH 1J95A 2HFEC 5I60A 4EGQA 4ZHQF 3CCUV 3AK1A 4YP3A 3MWMA 1SETA 4TQDA 4DXWA 4NXNH 3CSXA 4AYBA 4FIPC 4X9QA 1IBMH 2EULA 2XD4A 3K9AA 3CCJV 1NQTA 2W9BB 4J9QA 5H80A 4DV2B 5KFZA 3HKDB 3FAVA 4BWSC 3EVKA 1P8LA 4JI1O 1ZUQA 4DW0A 2Y0SE 2DJVA 3LNNA 4MTXA 4RB2C 3JD0A 3UKMA 1U97A 1XHXA 1GSOA 2C00A 3I12A 4ECWA 1CKOA 4I50A 4JI3B 3CC7V 1YF2A 3QF7A 5KHHA 2WWWA 5L1KA 1Y67A 4DV2O 1XMOB 3B77A 4KUMA 2Y69B 3CVZA 3RB6A 3GLKA 4GYCB 3IC7A 3KXYT 3Q2OA 1Q86W 5EIBD 4RUAA 1HNZO 3ETHA 3Q4HB 5I5TA 1R9TA 1JPXA 1TWAA 3Q4HA 2BOBC 1ULZA 2W57A 4X1IA 5EYPB 2XAHA 3MWDA 1FD9A 2VWJA 4FU0A 3PFFA 2Q8VA 1W59A 5GONF 1KQSU 3L74H 3T4DA 1I5YA 2E2IA 5EOYA 1Q81W 2J6UA 1PL4A 5BXZA 3U11A 2O03A 4TQRA 1V54B 5FNVB 3OSNA 2JVDA 2BQ3A 3CRMA 2N05A 3DC6A 4MVOA 2BQUA 3MR5A 1KYOF 3H1LH 3LNMB 4H0LB 3OHAA 4FFNA 2Q2UA 5L3DA 4CC5A 4LH6A 2AW9A 4Q43A 3W7SA 2DYRC 4DR1H 5KX5A 1SESA 1OCZB 4I9QA 4LF9B 2IP4A 2M7WA 3CMAV 1IZ3A 5HBRB 1R3LC 4O4HA 4KHPH 4HQ6A 2FMLA 5LMUO 3RV3A 4JYYA 1H38A 2XUMA 3CRCA 1GN4A 2XCLA 5L1JA 2QM7A 3NR7A 1Y4MA 5KFLA 1JIHA 1WSCA 3NC0B 1ET0A 2DWEC 4J11A 3STZC 4JI5B 5KFVA 3WG7C 3B4SA 4WFFA 2M6YA 2QWPB 4AYBE 2FP4B 3U9TA 2GBOA 4O7TA 4M7EA 1N33H 4NTXA 4PZ6A 1OV9A 1Y1VA 1ZAUA 5JUMA 4GLWA 2Y4RA 3W5OA 3RYHB 4C7UA 2NU9B 3ICXA 2ZE8A 3EHBB 5KFAA 4K3AA 3CHXA 3RR5A 1N36O 4TUYA 5LGTA 3OTOO 1S77D 3RVZA 2UXDO 3QZ7A 2YIBD 4EBCA 2W9AA 1NJIW 4Q4CA 4DR3O 3QG5A 3IC9A 2WLMA 2Q4PA 3WNZA 1AI4A 1I94B 2QKSA 5DLGA 1EZVH 4DW1A 4DR6B 3T1HO 2UUAB 4O7LA 2F66C 4TSFG 5JQGA 1FFTB 5CBFA 1SZXA 4O4IA 4DL5A 3T9DA 4L1KA 1TUBB 3ASOC 2LFRA 3E5NA 4ECRA 2UVUA 1SRYA 3JZ6A 1KUQA 1K92A 4F6RB 4X64B 5BWWA 2ZR2A 1S97A 2WLIA 2X0SA 1N34H 3BHPA 4JYAO 4B7EA 1IOVA 1Q8IA 3M7MX 3OT7A 3TEKA 4PDBA 2FLNA 3E2EA 5KFPA 5DQGA 4FS2A 3GWOA 4YR0A 2RDJA 4UB6Z 1KJ9A 1G6UA 5K1PA 5KFNA 2ZNIA 3FDSA 5CMUA 3RBZA 2NUAB 2HHHH 5DG9A 3OGIB 1KD1W 2OCCC 1THZA 1S76D 4LFBB 4BY1G 2FK3A 2P4VA 1MSWD 4ME6A 4JV1A 2NN4A 5IYCO 3MWEA 4UUGA 2QKCA 2RF4A 1FFXB 1EFRG 4L8JA 4MTDA 4O4LA 1ZTEA 3KZIZ 2E75B 4PI0A 3JAMN 5IE9A 3GIPA 2W9CA 3HB9A 1CEZA 3FKSG 4WBNF 5JVLA 3VQYA 3KHGA 5JH7A 1GO3E 2Z04A 1CP9A 5FPOA 4YY3H 2W0FC 3OMIB 4DR5H 5LXTB 4O3QA 2HHFA 4JI2H 5KFYA 2Q2TA 5EZYF 4LF6H 1K97A 4K0KO 5E79Z 2O57A 2HG8A 3JAKB 2HIVA 1PNMA 2GV9A 2CGOA 3OD4A 1JVMA 3ZRXA 1N34B 1VP7A 1MZBA 3W7WA 1CQIB 3N2KB 5JCOC 4JI5O 1JLLB 1S0MA 4EQ5A 5LHHA 3A0HZ 3CRAA 2AZ2A 5KHKA 4G28B 1IBKH 2IM9A 2R8HA 3TETA 4M0JA 4BW9A
chains in the Genus database with same CATH topology
4ZHQB 3EYYA 3K5OA 4FM2A 3K59A 1S5JA 2PGGA 5IYZB 2HHHB 3JAMW 1CKNA 4TV9B 3RWRD 5KMGA 5LOVB 1TGOA 2YI8A 2YXLA 4CH3A 4GKKB 4JI7B 3CB2A 4WBNB 2HVSA 4ZI7A 4TV8B 5JJJB 3L2PA 1M0TA 1HW7A 5KMGB 4X65H 4JI6B 5IYZA 1HR0H 1J5EH 4ZHQA 2XIGA 5IJ0A 4NXNB 3UT5A 3L4JA 1JFFB 1HNWB 1HNZB 5LA6B 5J2TA 2HIXA 1FJGB 2UXDB 4JI8B 4O4IB 3RYCB 4J0MA 4MV7A 5LMUH 4LFCB 1KMIZ 4JI8H 4MTEA 2ZIOA 3N2KA 4EB6B 5CA0A 3BRCA 3JATB 2F93B 3BAAA 3HKEA 4DV0H 4DK0A 4DRXB 4DR2B 3NBZB 5CB4B 5EIBC 1IBLH 4DR4H 5JVDB 4LF5H 1E4GT 4FM1A 3NBYB 5BR8B 4LNUA 4O2BA 4O4JA 4DV4H 1WPBA 2YIAA 4I55A 1XI1A 4TQFA 1XMOH 1BJTA 2UXBH 4FM9A 4LH7A 3BA8A 4FLTA 4DV7B 1XDNA 3JASA 4JYAB 4DUYH 1FJGH 2UXDH 2UXCH 1N36B 4DR3H 3JASB 1GYFA 1L8DA 3J81W 3TY9A 3RTXA 4IAJA 1X9NA 2BTOA 3T1HH 2PUSA 1YEWA 1Z2OX 1N32B 5IWAH 4RAYA 1XQ8A 5KHIA 2VQFH 3J7AK 3IG0A 4O4JB 2JGUA 2CW8A 1Z2NX 2ZIMA 4DV6H 1Q43A 4AHCA 5KX5B 4DV4B 5FLXW 3WB0A 1SKVA 3DF7A 5CB4A 1D5AA 4DR2H 3HXLA 3T1YH 1XHZA 3PN1A 1TUBA 4DUYB 1B04A 2BTQB 3OTOB 5CA0B 2ZINA 2P22C 1Q5OA 4O2AB 2Q7EA 4LFAB 2UXCB 4CC6A 3RYCA 1P49A 4GKJB 1WH2A 4UCVA 1XK5A 3UT5B 5D1OA 3SJCC 1DGSA 4YHHH 2KKWA 1SQFA 3WB1A 4X64H 1BGWA 1HR0B 4UCOA 5LP6C 4ETSA 1M93A 3JSNA 4HNAA 3U0ZA 4RB1A 2VQEB 2UUCH 4PI2A 4DK1A 2QM4A 1QHTA 4K8XA 4EFBA 3F8NA 3RIZA 4DV2H 2VOBA 4TV9A 5LL6b 4DV1H 3K5MA 4FVMA 3GB8B 3GDEA 1T5EA 4DR4B 2HEPA 3RFRA 2HGSA 3BABA 2R70A 5LYJB 3JARB 4U3JA 4K0KH 1XMQB 2VWKA 1A0IA 4NXMH 3JAKA 4CH6A 4FLXA 2PTMA 1JMKC 4KHPB 5BMVA 4LFBH 1WN7A 3VQXA 2UUCB 2VQEH 1TAEA 2R72A 4FLVA 1H2SB 4JI2B 5JVDA 4DR3B 4DRXA 2E3CA 2YIBA 3KAKA 4RB0A 3HKEB 4O4LB 2PZSA 2ZCEA 2ZM6B 5D5QA 4EB6A 4JV5B 3JAWA 1FFXA 5LMUB 4B3RB 4R7RA 1L2ZA 1O75A 4FFBB 1N33B 3VQVA 1KU9A 2RJZA 3RYIA 4K0KB 2VPSA 5J2TB 1S68A 4X1YA 2CAZC 4CH5A 1I94H 4FLYA 4DV1B 3KYHC 1P16A 5JJNB 2P5OA 4TV8A 4ZI7B 4Q0YA 4JI7H 2HVQA 3HKCB 3J80W 4UCUA 3N42B 4Q6GA 5J2UB 4FLUA 5JJEB 4RB3C 4PHZA 4NXMB 3QWUA 1Q3EA 4DV3H 5FD5A 1N36H 2PYLA 3OTOH 1HNWH 3N41B 4JI4H 2UU9B 4UCSA 3OTFA 1XNRB 1SA0A 3K58A 3K3VA 3KALA 3L4KA 5LP6B 2ZNJA 2E5LB 3TY8A 4I4TA 3ZEDA 2FE3A 5C8YA 2XHBA 2ZM6H 4AQYB 4APMA 4B3RH 4YJ2A 5J2UA 4JV5H 2Q0AA 1FKAH 1I6UA 4DRFA 4TUYB 2WE6A 3SGIA 2VUGA 5JH7B 4IIJB 3THOA 1QQCA 3E22A 4PZ7A 4DV0B 4A2AA 3RYHA 1Z2PX 3RGXA 4DR7B 4IHJA 4X1KA 3SJAC 3IAYA 4LF4B 5DISC 3M4IA 3VQWA 1HNXH 4FLZA 4LF8B 4JYAH 4B3MB 2UUAH 3RYFA 4MV9A 4RZQA 4LF4H 4ZOLB 2WDTA 4ZOLA 4FFBA 5IJ9A 4B3SH 4JI3H 4LF8H 4GKJH 4YJ3A 5LMNH 2MCTA 4LF6B 4LR3A 4IHJB 3MWMA 4TQDA 1J5EB 3VNNA 5IT9W 4NXNH 4NVPA 3W1BA 2UUBB 1TVKA 3CSXA 4UFZA 4IIJA 2JS5A 1IBMH 2YI9A 2UXBB 3HKBA 1XNQH 4GLXA 5FPRA 5GONB 1FVIA 5ITZA 1ZHQA 4DV2B 3HKDB 4F6RA 4BWSC 2E5LH 1P8LA 4FLWA 3N43B 3ZS8C 3N6XA 3LNNA 4X20A 1O9HA 1SA0B 4RB2C 1E4FT 1XHXA 4B3TB 3LMLA 5LMNB 5CA1B 2RQ6A 1CKOA 4X66H 4I50A 4JI3B 2PYJA 3QF7A 5KHHA 5JQGB 3SR2C 1XMOB 1I7FA 3C0FB 3CVZA 3QTCA 4GYCB 2Q7HA 4DR1B 4OX9B 1JJOA 3KXYT 4JI5H 5EIBD 1V9PA 4X62B 4YY3B 1Z5VA 4HNAB 4DR5B 4X65B 2W57A 4X1IA 5EYPB 1RSOA 4X62H 1XNRH 2UUBH 3JALA 2VWJA 1M5IA 5FD6A 1WNSA 2PY5A 5KHJA 4EFEA 2KSWA 5EOYA 3T1HB 3U11A 5EZYB 2O03A 3W1GA 3H20A 4LFCH 5FNVB 5CA1A 2JVDA 2UU9H 3JAWB 4B08A 3K57A 4JI0B 1IBKB 2YCHA 1SYXB 1X4TA 4DUZB 2Q2UA 3RF2A 4CC5A 4LH6A 3RGBA 4K8ZA 4DV7H 4UCTA 5D1PA 4DR1H 4OX9H 5KX5A 4I9QA 2V4DA 4LF9B 2CFMA 4KHPH 4O4HA 5ITZB 2OYQA 2OWOA 4O4HB 1M4UA 3GJXB 2RGVA 4JI1B 4GKKH 1SQGA 2RGRA 1TVKB 4I7HA 1XMQH 1S03G 4LF7H 4U3JB 3NC0B 4FM0A 3DSQA 3K5LA 4JI5B 4YJ3B 5FNVA 3B2EE 4M7EA 5EZYA 3BPZA 4B3SB 4PZ6A 1N33H 4D7SA 2WYOA 1ZAUA 4X1KB 4LSXA 3N40P 3W5OA 1AN7A 3RYHB 2EX3A 1SEIA 4UCRA 4DR7H 3E22B 5D5PA 3JALB 3ICXA 3CHXA 1IBMB 3RR5A 4LF9H 1NT2B 4X1IB 5EYPA 4TUYA 2F4VH 4LNUB 4O2BB 4AILC 2YIBD 2F4VB 5BR8H 3A2FA 3QG5A 4CS3A 4CH4A 4JI0H 4TOIA 4YHHB 3BA9A 1I94B 4I4TB 4DR6B 2CW7A 5LP6A 5D1OB 2UUAB 4B3MH 3JATA 1XNQB 2F66C 2F1MA 5JQGA 4I50B 3UQ8A 4PZ8A 4O2AA 4O4IA 2QJ1A 1ZHSA 1CKMA 4JI4B 1O9GA 4ZIBA 4X20B 1JFFA 1VS0A 4JI6H 2BTQA 1TUBB 5IJ0B 3RGZA 4LF7B 5A2QW 2Q7GA 4LF5B 4F6RB 4A2BA 4X64B 4DV3B 3HKDA 4EEQA 1N34H 3BHPA 4AQYH 4RAZA 3ETQA 3FFQA 2VQFB 1Q8IA 3M7MX 3RJ0A 4WBNA 5GONA 5IWAB 4PDBA 3HKCA 3KAJA 3HKBB 5LOVA 4LSAA 1G6UA 5K1PA 1M0WA 2ZNIA 1CKNB 1IBLB 3TY5A 3U10A 5KHGA 2HHHH 4X1YB 4DUZH 4LFBB 3T1YB 4LMYA 4KL1A 3RYIB 3K5NA 5IJ9B 4E6NA 3N44B 4DV5B 3RYFB 1FFXB 4L8JA 3JSLA 4MTDA 4O4LA 5K1XA 4DV5H 4PI0A 4JI1H 2R9AA 4DR6H 4I55B 3VQYA 1HNXB 1TA8A 3N2GA 5JH7A 4CS4A 5FPOA 4YY3H 5LXTA 4DR5H 5LXTB 3FMAA 4DV6B 5JCOA 4JI2H 2Q2TA 3MAQA 4YJ2B 5BMVB 4LF6H 3N2GB 3JAKB 2HIVA 5C8YB 2GV9A 1N32H 4HBNA 2ZJTA 4BWAA 1N34B 2F95B 4CS2A 1MZBA 1VF7A 3N2KB 3JARA 5JCOC 3WB2A 5LYJA 4EQ5A 4LFAH 1HNZH 4D7TA 4B3TH 3S24A 5KHKA 4X66B 2HVRA 1IBKH 1Z5WA 2IM9A 5LA6A 4BW9A 3SJBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCO A;  4JI5 B;  2VUG A;  3JSN A;  2VQE B;  4DV0 B;  4PZ7 A;  2HHH B;  1CKN A;  4B3S B;  4DR7 B;  4PZ6 A;  5DIS C;  4EFB A;  1ZAU A;  4LF4 B;  4LF8 B;  4B3M B;  3W5O A;  4GKK B;  4JI7 B;  4UCR A;  2HVS A;  3L2P A;  4LF6 B;  1IBM B;  3GB8 B;  3GDE A;  1J5E B;  3RR5 A;  3VNN A;  4JI6 B;  4DR4 B;  3W1B A;  2UUB B;  2F4V B;  3BAB A;  4UFZ A;  4NXN B;  1HNW B;  1HNZ B;  2UXB B;  1XMQ B;  4TOI A;  4GLX A;  2HIX A;  1FJG B;  4YHH B;  4JI8 B;  3BA9 A;  5FPR A;  1I94 B;  2UXD B;  1A0I A;  4DR6 B;  1FVI A;  5D1O B;  2UUA B;  4LFC B;  4DV2 B;  1XNQ B;  4KHP B;  2UUC B;  1P8L A;  3BAA A;  3UQ8 A;  4PZ8 A;  1TAE A;  1CKM A;  4DR2 B;  4JI4 B;  3NBZ B;  4JI2 B;  1VS0 A;  4DR3 B;  4B3T B;  4LF7 B;  5LMN B;  3NBY B;  5BR8 B;  1CKO A;  4JI3 B;  4LF5 B;  4X64 B;  4DV3 B;  4EEQ A;  2ZM6 B;  4JV5 B;  4B3R B;  5LMU B;  1XMO B;  2VQF B;  5IWA B;  1N33 B;  4K0K B;  4LH7 A;  3BA8 A;  4DR1 B;  4OX9 B;  1S68 A;  4DV7 B;  1XDN A;  4JYA B;  1CKN B;  1V9P A;  1IBL B;  4X62 B;  4YY3 B;  3TY5 A;  1N36 B;  4DR5 B;  4X65 B;  4DV1 B;  3KYH C;  1P16 A;  4LFB B;  3T1Y B;  3TY9 A;  3RTX A;  2HVQ A;  1X9N A;  4E6N A;  4DV5 B;  4UCU A;  4EFE A;  1N32 B;  3JSL A;  3T1H B;  3W1G A;  4NXM B;  3QWU A;  1HNX B;  4DV4 B;  1TA8 A;  4JI0 B;  1IBK B;  5FPO A;  4DUZ B;  2Q2U A;  4CC5 A;  4LH6 A;  4UCS A;  4DV6 B;  2UU9 B;  1XNR B;  3PN1 A;  4DUY B;  1B04 A;  4UCT A;  5D1P A;  2Q2T A;  3OTO B;  4LF9 B;  2CFM A;  2HIV A;  2UXC B;  2OWO A;  2E5L B;  4CC6 A;  4LFA B;  3TY8 A;  4GKJ B;  1N34 B;  3GJX B;  4AQY B;  4JI1 B;  4UCV A;  1XK5 A;  5D1O A;  4EQ5 A;  1DGS A;  3S24 A;  4X66 B;  2HVR A;  4DRF A;  3NC0 B;  3SGI A;  1HR0 B; 
#chains in the Genus database with same CATH topology
 5GW7 A;  5EWF A;  4TV9 B;  2EIN C;  1HDJ A;  2EIM B;  3LP8 A;  2VS0 A;  2YI8 A;  4JI7 B;  3CB2 A;  5IY5 C;  1KB9 F;  4QWB A;  3P32 A;  4DL7 A;  4A5U B;  4MV4 A;  2HVS A;  4ZI7 A;  4TV8 B;  2UU9 O;  1WB8 A;  4X65 H;  2AHZ A;  3N27 A;  1M56 B;  2FKL A;  2AGA A;  5KG4 A;  1WA8 A;  1IYD A;  5CA3 A;  1JFF B;  4RUC A;  1HNZ B;  5LA6 B;  3FX7 A;  2LGW A;  4MTG A;  4O4I B;  4KFM A;  4MV7 A;  1I0H A;  3BRC A;  3JAT B;  4A3D G;  1OCO B;  1EZ1 A;  3HKE A;  5K2M A;  2WLL A;  1S0O A;  5B3S B;  5KFK A;  4DK0 A;  4LF5 H;  2FB5 A;  1E4G T;  2YL2 A;  1TWG A;  5BR8 B;  1ZSP A;  1I1K A;  1OCC C;  1JX4 A;  2EIJ C;  2JK5 C;  1HWY A;  3H0G A;  2VUM G;  2ZDG A;  5T14 A;  4F4Y A;  5EWG A;  1B3Q A;  2UXB H;  4LH7 A;  3BA8 A;  4BR6 A;  4W4L A;  3W7T A;  4FLT A;  4E4T A;  1N56 A;  1XDN A;  4XDL A;  2EJ2 A;  2UXD H;  2UXC H;  2UVR A;  3OSP A;  1AI7 A;  1XOU A;  5BWU A;  3PW7 A;  4DR3 H;  2BR0 A;  4QPJ A;  2G38 A;  2KB1 A;  2FB9 A;  5KG7 A;  2PUS A;  2C22 A;  1JA8 A;  1HNX O;  3E89 A;  4WFB V;  5IWA H;  3T9F A;  4RAY A;  2VQF H;  4MTO A;  2OTJ V;  4JAA A;  3IG0 A;  2JA7 G;  4B3S O;  3MJF A;  1I1M A;  1Z2N X;  5BWR A;  3RAQ A;  2OH2 A;  5KX5 B;  2RMK B;  1XL6 A;  2CNU A;  3DF7 A;  3PJS K;  3OMN B;  4NXN O;  1NTZ H;  3T1Y H;  4QIW F;  1VQM V;  4NKG B;  2BTQ B;  5J9P C;  4PDM A;  1IBM O;  3K5I A;  2PI4 A;  1KTA A;  2ZIN A;  2P22 C;  2AU0 A;  4LFA B;  4GKJ B;  3X2Q C;  4J9Y B;  2XAF A;  1MAB G;  3ZHQ A;  3MDS A;  4FZ0 A;  5KFS A;  2HHH O;  5I5U A;  1OZ0 A;  2Y0I A;  4PV1 B;  5KG2 A;  1AVM A;  4X64 H;  4MS2 A;  4ETS A;  5KT2 A;  4RB1 A;  3AYH B;  1PV0 A;  4NR1 A;  1K4C C;  3T9E A;  2ASJ A;  4PDL A;  1FPO A;  5JQG F;  3RIZ A;  4DV5 O;  4DV2 H;  4C5C A;  2VOB A;  3MFI A;  4TV9 A;  5LL6 b;  3KCX A;  1BXR A;  2DAB A;  2DE0 X;  3QQM A;  4JV0 A;  5IY5 B;  4YJ3 F;  1MG1 A;  1NR1 A;  3ETG A;  2NU6 B;  3LQS A;  4J9M A;  3LUL A;  2GLT A;  2ETN A;  3G80 A;  3JD2 A;  1VQ7 V;  2IJI A;  4H13 B;  1XNR O;  4ECU A;  3LSS A;  1XMQ B;  2IBK A;  5KG6 A;  2A79 B;  2WLJ A;  2OT5 A;  2OLS A;  4NTY A;  3WWH A;  3FAV B;  3JAK A;  3ZRV A;  2IH3 C;  1SQX H;  3DTU B;  1KBH A;  3VQX A;  3JD4 A;  1PD3 A;  4A3M G;  1M9N A;  4B3T O;  1IOW A;  3TJT A;  2FK1 A;  1OCR C;  1AI6 A;  1H2K A;  3ZHS A;  1Q82 W;  5JVD A;  1SQV H;  2QF7 A;  1URF A;  4RB0 A;  2W9C B;  3HKE B;  4QW9 A;  3S3W A;  1OBG A;  1QVG U;  2HKO A;  3KTM A;  2PZS A;  2ZM6 B;  4JV5 B;  2Z02 A;  3U54 A;  3JAW A;  1FFX A;  5LMU B;  2CGN A;  1VKZ A;  1O75 A;  1YIT V;  4FFB B;  4HN2 A;  5JVD F;  3VQV A;  1NVP D;  4TV8 F;  5J2T B;  1S68 A;  2V59 A;  1SER A;  3RB0 A;  1WA8 B;  2CAZ C;  2IBZ H;  1I94 H;  1XMQ O;  4JZG A;  1MA1 A;  4FLY A;  2JRI A;  1HR0 O;  3ZBH A;  1YXB A;  4A93 G;  5KT5 A;  1P16 A;  2BE3 A;  4TV8 A;  1UC9 A;  2SCU B;  5JH7 F;  4JI7 H;  1SQQ H;  1QNM A;  1Q6I A;  2W6J G;  4QPK A;  1DV1 A;  3T9A A;  1PNK A;  1N8R W;  4RB3 C;  5DG8 A;  2GTS A;  4DR7 O;  1I1L A;  1Q3E A;  4FE2 A;  2EBO A;  1KJQ A;  4DR4 O;  2BQR A;  4LF5 O;  5FD5 A;  5CE8 A;  2PYL A;  4HZ3 A;  2GPS A;  1MSD A;  5KT4 A;  1GN2 A;  1VQO V;  4JI4 H;  5H2F Z;  4X8A A;  4DV4 O;  3G6Y A;  3WU2 Z;  1JX9 A;  4XZ3 B;  3T99 A;  3UM7 A;  3L4K A;  3TY8 A;  1ORQ C;  1M57 C;  2FE3 A;  2ZM6 H;  4AQY B;  5IYZ F;  2IH1 C;  3Q8R B;  4YJ2 A;  5J2U A;  4B3R H;  2YW2 A;  1FKA H;  2XAJ A;  4LBE C;  2CTP A;  2QYZ A;  4UV9 A;  1W96 A;  2GHY A;  3J81 N;  4JAV A;  4O2A F;  1RM1 B;  1A9X A;  2R7M A;  4BBR G;  4XDK A;  5B66 Z;  2DOS A;  4XDJ A;  4F4Z A;  3E22 A;  5J2U F;  1FXV A;  2OCC B;  1Y14 B;  1N34 O;  4AQY O;  4J80 A;  3F5W C;  3DGE A;  3RYF A;  1NTM H;  2HJD A;  3T5K A;  3B09 A;  2Y4U A;  5LMN H;  3DC5 A;  2H8P C;  4LF6 B;  1J5E B;  3U0G A;  4O7W A;  4NVP A;  3W1B A;  2UUB B;  1EUC B;  2FKX A;  3OEE G;  4RUF A;  4Q8F A;  2A0L A;  2LO1 A;  2N04 A;  2YI9 A;  4G2K A;  1EKF A;  4GLX A;  3I56 V;  2F43 G;  1Q6U A;  2YXY A;  2R84 A;  1AR4 A;  1Y1W A;  2UXN A;  2WLI B;  3KHH A;  5KG1 A;  3TW6 A;  4YHH O;  3HOY G;  4GX2 A;  5B1A B;  3CQZ A;  3E8H A;  4X64 O;  1O9H A;  3LDD A;  1SA0 B;  3KKY A;  4YY3 O;  2FL4 A;  4X66 H;  1Y1V G;  3JD3 A;  4KP4 A;  5JQG B;  3MHS C;  5IYB G;  4FFO A;  3ZX6 A;  1KEC A;  2Q7H A;  4CMF A;  1JJO A;  4FMT A;  1V9P A;  3U9S A;  3K79 A;  4X62 B;  1PP9 H;  4YY3 B;  1A32 A;  1BGY H;  4DR5 B;  3FB6 C;  2YDE A;  1BHA A;  4X62 H;  3ZMU A;  2UUB H;  3TIG A;  1FXK A;  3NUA A;  2PY5 A;  3AG1 B;  2AGO A;  4EFE A;  3T1H B;  2Q6A A;  5EZY B;  1AP5 A;  3H20 A;  3CCS V;  3BCC H;  2UU9 H;  4B08 A;  5E1A C;  2XGQ A;  1NVP B;  2L35 A;  2YCH A;  3OGC C;  1SYX B;  1X4T A;  4DUZ B;  1G8M A;  3C3T A;  2XT9 A;  2R93 G;  2PMZ A;  5BWV A;  2VA3 A;  4H37 A;  2HGW A;  4OX9 H;  3LUT B;  1NR7 A;  2V4D A;  2A7W A;  2OYQ A;  1RM1 C;  4MAM A;  5J2T F;  2RGV A;  1Z2G A;  4JI1 B;  4GKK H;  4JZ2 A;  3AK2 A;  1E1R G;  5LHG A;  2X6B A;  1OWT A;  3G4S V;  3ZRS A;  3VPD A;  4I7H A;  4DV0 O;  4LF7 H;  4FFL A;  1IBL O;  3K5L A;  3OE7 G;  1AJP A;  4IYH A;  4XYM B;  4JUZ A;  2QTO A;  1GKF A;  2ZQM A;  5FNV A;  5A9G A;  1SF9 A;  5EZY A;  2QTS A;  4TM5 A;  1K1Q A;  3P30 A;  4C2M A;  4XYL B;  2W70 A;  4LSX A;  1AN7 A;  5FNV F;  4DV3 O;  4PBC A;  1KT8 A;  2EIY A;  1IBM B;  2PI5 A;  1NT2 B;  5I5X A;  4ECS A;  2R8J A;  1FJG O;  4O2B B;  4DYL A;  1CQJ B;  4AIL C;  5C3E G;  3GIK A;  1XBL A;  4C5A A;  3X2Q B;  2Q9L A;  2W71 A;  3A2F A;  5BR8 H;  3H01 A;  4I9W A;  1X59 A;  4MT8 A;  4TOI A;  3TQT A;  3QNE A;  2PMZ E;  1K7D A;  4QE9 A;  1I3Q A;  3QZ8 A;  1E1Q G;  4LWS B;  4OPH A;  5D1O B;  3JAT A;  2P90 A;  4QJF B;  1KJI A;  2R9I A;  2F1M A;  3A0R A;  2ZE5 A;  2EJ7 A;  4PZ8 A;  4O2A A;  3ZN1 A;  1ZHS A;  3ZRW A;  1CKM A;  5TIS Z;  4ZIB A;  1EN5 A;  2K1E A;  1JFF A;  1ROP A;  2W0X A;  2IU0 A;  4DL6 A;  3RGZ A;  4JI6 H;  3H0G G;  4LF7 B;  4QGP A;  4MVR A;  1K3E A;  3AK3 A;  2W8K A;  1ZWI C;  4DV3 B;  3HKD A;  4EEQ A;  2WLK A;  4DL3 A;  3FFQ A;  2VQF B;  3RJ0 A;  3HKC A;  4W4K A;  4R6Z A;  4LF8 O;  4JI3 O;  3KAJ A;  2W9B A;  3RVY A;  5CN0 A;  3G6B A;  2E74 B;  1L0L H;  1VEW A;  2HVK C;  3STL C;  1CKN B;  4K6N A;  1IBL B;  3M8A A;  4A3I G;  2WA4 A;  3U10 A;  3L70 H;  4DUZ H;  4LMY A;  5KX5 F;  2R6F A;  3RYI B;  5IJ9 B;  1YHQ V;  4E6N A;  3CCL V;  2JIZ G;  3RYF B;  2C2R A;  2C35 B;  1PM9 A;  4Z1M G;  2E5L O;  4JI1 H;  5F9L A;  5C1P A;  5KFQ A;  2R9A A;  4DR6 H;  3IJ4 A;  1DF4 A;  2P4K A;  5EC2 C;  1HNX B;  1GO3 F;  4CHI A;  1DLB A;  3ETD A;  2A1H A;  2HHF B;  3SYQ A;  1MMM A;  5LXT A;  3FMA A;  1VF5 B;  3M9N B;  3O9O A;  1G2W A;  4YJ2 B;  5LGU A;  2HDK A;  4JTA B;  2R92 A;  2JGD A;  4EBE A;  2WLH A;  1N32 H;  4FK5 C;  1S9F A;  3CD6 V;  4NXM O;  2F95 B;  4CS2 A;  1VBH A;  5L1L A;  1UFI A;  2IU3 A;  2GDS A;  1OJH A;  4GX1 A;  2YIC A;  4D7T A;  4X66 B;  2HVR A;  1Z5W A;  2F23 A;  1T36 A;  3CEB A;  4Q4D A;  4DQN A;  2ODM A;  1VAJ A;  1S5H C;  2ZDI A;  4ZHQ B;  2ZD9 A;  1KJ8 A;  4QE7 A;  5KFW A;  3T2M A;  1UJW B;  2PGG A;  2HHH B;  2ZGI A;  4A3J G;  4BIZ A;  2E76 B;  3RWR D;  3PR4 A;  5KMG A;  2R93 A;  2NVX A;  4WBN B;  1F4M A;  2ZDI C;  4F6E A;  4O83 A;  4JYB A;  3L2P A;  1HW7 A;  5KMG B;  2ARH A;  4NLG A;  2DWD C;  3NXS A;  3O65 A;  2B5U A;  1I94 O;  3AEI A;  2AGP A;  1HR0 H;  4H44 B;  4D6T H;  4ZHQ A;  3GQC A;  5L3F A;  3E8G A;  1HNW B;  4PWQ A;  4JTC B;  3CP1 A;  1DTO A;  5J2T A;  1FJG B;  4MTF A;  3L75 H;  4J0M A;  2GSM B;  4HNU A;  5BYA A;  5EBW C;  4LFC B;  2W6P A;  3HKZ A;  2ZIO A;  4DL2 A;  3R66 A;  5CA0 A;  1UPG A;  3K08 A;  3ASO B;  1VQ8 V;  4PJ0 Z;  2C2A A;  4FZ1 A;  4TT3 G;  2XCA A;  3RFC A;  3N8D A;  1CPY A;  3NBZ B;  1IBL H;  2JA5 A;  1F23 A;  5JVD B;  4DLK A;  1H2G A;  1IX9 A;  5LBQ A;  4FM1 A;  1YIJ V;  1R6K A;  3L9D A;  1BZK A;  4LNU A;  1MOF A;  4O4J A;  1BCC H;  1WPB A;  1BE3 H;  4PA6 A;  3K3P A;  3R5H A;  1XI1 A;  4RWU A;  3T5J A;  3JD1 A;  3GV5 B;  3JYC A;  1B6S A;  1BJT A;  3BJY A;  4JV5 O;  5KFJ A;  2V4R A;  4DUY H;  3BEH A;  4O2B F;  4A3B G;  5BR8 O;  2COG A;  3V4S A;  2JS3 A;  1ARO P;  3FB7 C;  4HNV A;  1JR9 A;  3J81 W;  3RTX A;  4ECV A;  2JA8 G;  2CH7 B;  3UO2 A;  3RB4 A;  2RDC A;  1N32 B;  3N6R A;  1XQ8 A;  5KHI A;  3J7A K;  1QU7 A;  2UUA O;  3SPI A;  4TQS A;  3C90 A;  2PN1 A;  5KFU A;  4PD4 F;  5LMN O;  1Q43 A;  4DV4 B;  5FLX W;  3R5X A;  4C5B A;  1WPX A;  3ORR A;  5CB4 A;  1AJN A;  4DAA A;  1AR5 A;  2LGQ A;  1Q7Y W;  2EIM C;  3HXL A;  1K5Q A;  1XHZ A;  3PW0 A;  3CCV V;  1AUX A;  1VIB A;  2QM8 A;  1YJW V;  2D3O W;  2VQD A;  1Q5O A;  4O2A B;  2Q7E A;  4CC6 A;  2COJ A;  3RYC A;  2QWQ B;  1P49 A;  4YQW A;  3L71 H;  3H4D A;  3T5L A;  4QNH B;  4Q20 A;  1XK5 A;  5KG5 A;  5D1O A;  3I5D A;  4X89 A;  4YHH H;  2KKW A;  3VMM A;  2NLJ C;  1A3G A;  4UVB A;  1SQF A;  3WB1 A;  2PF4 E;  2N74 A;  5L3G A;  1HR0 B;  5LP6 C;  1AIL A;  3DAA A;  4JAU A;  5IYB O;  5EK0 A;  2VQE B;  4X66 O;  2B1G A;  4UB8 Z;  3H4B A;  4DK1 A;  2QM4 A;  4B7K A;  4EFB A;  2V4Q A;  4F4L A;  1JQ0 A;  4QWA A;  3ABM B;  1XEQ A;  4X88 A;  4ASU G;  3K5M A;  5LHI A;  2IJK A;  2NU7 B;  3RFR A;  5DG7 A;  1P84 F;  3OEH G;  3GVM A;  4WHX A;  2CUG A;  3BQ2 A;  5LYJ B;  1VAR A;  1CE8 A;  1ZL8 A;  3CJH A;  2VWK A;  4O82 A;  2QWN B;  4NXM H;  5FLM G;  5KAI Z;  4KHP B;  5BMV A;  5DED A;  1WN7 A;  3HO8 A;  3GIL A;  3ETE A;  1D2D A;  1V55 B;  4ED1 A;  1GK9 A;  3AG4 B;  4ED7 A;  5EC1 C;  4YIO A;  3ETJ A;  5IT9 N;  5HFM A;  4YXW G;  1Y74 B;  2WAQ A;  3ABM C;  5FLX N;  3OFN G;  1GN3 A;  3PW4 A;  2RDI A;  4DRX A;  3ZJZ A;  3B8M A;  2E3C A;  2YWV A;  3DTG A;  3UFX B;  1P4R A;  3OW2 U;  4O7Y A;  1K5S A;  2YEV A;  2I8C A;  4U7N A;  4E4E A;  4ABM A;  3AW8 A;  4IWY A;  1UNN C;  1K83 A;  4FJC C;  4NZM A;  1L2Z A;  4R7R A;  1BHB A;  1EYZ A;  3ABK B;  1N33 B;  2JA5 G;  2WPD G;  3GTO A;  4F4X A;  1KU9 A;  1R6T A;  4O4H F;  2JA6 A;  3CME V;  4CH5 A;  4X1Y A;  4UUJ C;  1XUQ A;  5KFH A;  4LF7 O;  1V4Y A;  2FPP B;  3OAA G;  2P06 A;  4KXR A;  3G71 V;  3UCS C;  5JJN B;  1S3J A;  4ZI7 B;  4MV1 A;  2ADP A;  3GTM A;  4EKW A;  5EDW A;  1H2L A;  3J80 W;  1N33 O;  3N42 B;  5LXT F;  4TWK A;  5I5V A;  4JYC A;  5JJE B;  4IRD A;  4NXM B;  1R6N A;  3OR6 C;  2JEG A;  4O81 A;  3CPW U;  4MV6 A;  3BVO A;  1N36 H;  3EXA A;  3GIJ A;  1AUV A;  4UCS A;  1KBL A;  1SA0 A;  1B06 A;  3R9R A;  4L87 A;  3Q1K A;  4JI0 O;  3K3V A;  1AB3 A;  4EYI B;  4ICG A;  5LP6 B;  2E5L B;  1COW G;  2IW5 A;  3ZED A;  2XHB A;  2X0L A;  4JV5 H;  1R1B A;  2DQ3 A;  4TV9 F;  5DQI A;  2Q0A A;  2UXC O;  2AGQ A;  1PNL A;  5BMV F;  2WE6 A;  3HOZ G;  2VUG A;  4A3G G;  5JH7 B;  1E4E B;  5KFB A;  3A8T A;  1QQC A;  4LP8 A;  2PVP A;  1UC8 A;  4PZ7 A;  4DV0 B;  1Z2P X;  3UZB A;  2QK4 A;  3RGX A;  4BXX G;  1HNX H;  3IAY A;  1JOY A;  2ABJ A;  3WWI A;  4LF8 B;  1BMF G;  3CX5 F;  2UUA H;  3J80 N;  4MV9 A;  4RZQ A;  3AG2 C;  5LA6 F;  1FXH A;  5KFF A;  4B3S H;  4LF8 H;  1NH2 D;  4JI3 H;  1K73 W;  4YJ3 A;  2CNQ A;  3PW2 A;  4O4I F;  2MCT A;  4DV6 O;  3MR2 A;  1V54 C;  4IHJ B;  3RAX A;  3GTP A;  2JA7 A;  3UO3 A;  5KUM A;  5IT9 W;  2XOK G;  3TK1 A;  4DR2 O;  5I47 A;  1LNQ A;  4J7J A;  4IIJ A;  2UXX A;  4DUZ O;  1BQZ A;  1W2B U;  2UXB B;  1XNQ H;  1F7Y A;  3GII A;  5BYB A;  5ITZ A;  5E25 A;  5DM6 V;  1LUV A;  2IA6 A;  1H8H G;  2Q73 A;  2DLN A;  4F6R A;  2E5L H;  4MV8 A;  1MZF A;  4GZR B;  1L1F A;  2W6O A;  2UVV A;  4IL6 Z;  3KRE A;  1GN6 A;  1E4F T;  2VUM A;  3LML A;  4DR5 O;  5LMN B;  5CA1 B;  2RQ6 A;  2X6C A;  2XAG A;  3IFX A;  4NTW A;  4DL4 A;  3SR2 C;  1L0N H;  1I7F A;  3C0F B;  3T9B A;  1WLE A;  2CK3 G;  4JPR A;  4HR7 A;  4JGS A;  1RJR A;  4DV1 O;  3SE7 A;  4DR1 B;  2FPI B;  3HOX G;  4LFA O;  2WTF A;  1Z5V A;  1NBM G;  4HNA B;  5LYJ F;  4X65 B;  5DAA A;  3E8F A;  1EUD B;  3ZMS A;  1RK5 A;  3DXR A;  1P7B A;  2DYS C;  3JAL A;  4HNT A;  3D8C A;  1M5I A;  4XBF A;  1XRE A;  5FD6 A;  1F4N A;  2DIK A;  4CE5 A;  4EYH B;  2IMW P;  3ZHT A;  4OPA A;  1OCR B;  5EBM C;  2ITC C;  2VQE O;  1W0J G;  4YJ2 F;  3W1G A;  4RCN A;  3T9C A;  5CA1 A;  4U6P A;  5H5N A;  1VMG A;  1WCM G;  3JAW B;  2L6L A;  4X65 O;  4JI0 B;  3GTK A;  1IBK B;  4CBC A;  2YZG A;  3ABT A;  1K8A W;  5BWT A;  5A2Q N;  2DMX A;  1YJN V;  4YAJ B;  4DV7 H;  5D1P A;  4EEY A;  2J6S A;  2KQX A;  4J9P A;  2CFM A;  1OBD A;  1RPR A;  1ZQ7 A;  4O4H B;  1M4U A;  1OCC B;  3GJX B;  1PK8 A;  4UVC A;  4GC7 A;  2QR4 A;  2H94 A;  4J10 A;  4X62 O;  1NTK H;  2RGR A;  1TVK B;  3CRQ A;  1XMQ H;  1EKV A;  3APQ A;  4IRC A;  4FM0 A;  3DSQ A;  1EM1 A;  2V1D A;  5KFX A;  3FB8 C;  2XCP A;  3ORQ A;  4YJ3 B;  4JI7 O;  4A3C G;  3B2E E;  5KA5 A;  1SCU B;  1PPJ H;  2WYO A;  3G6V A;  5B1N A;  3FB5 C;  2CTQ A;  2HG5 C;  3B8N A;  4X1K B;  5KLV H;  3N40 P;  1RYR A;  2Z0A A;  4IGG A;  4UCR A;  3TII A;  3CE2 A;  3CCM V;  1E4E A;  1MNG A;  4LF9 H;  4X1I B;  3C3S A;  3OMA B;  5EYP A;  2F4V H;  1KUT A;  3VPB A;  4JI4 O;  1BNC A;  2F4V B;  3SI8 A;  4HAM A;  4R8U A;  4CS3 A;  4CH4 A;  5D8D A;  4YAK B;  1K34 A;  4YHH B;  5GTH Z;  3BA9 A;  4I4T B;  1JXL A;  4AI8 A;  3J7A U;  2CW7 A;  5LP6 A;  4B3M H;  5DMX A;  1GMG A;  2ZM6 O;  3EPG A;  1XNQ B;  4RNN A;  4I50 B;  3UQ8 A;  4J9O A;  1PL0 A;  3SYC A;  1O9G A;  2BTQ A;  5IJ0 B;  2DYS B;  2MW2 B;  4FFK A;  4Z2W A;  4MW8 A;  1A0G A;  5A2Q W;  3HT5 A;  2GQR A;  3R5F A;  2V58 A;  2LFS A;  3H1K H;  1VQ4 V;  1IYE A;  1Y76 A;  2RNB A;  3ETQ A;  5CA0 F;  5IWA B;  4LF4 O;  4QWE A;  3M9M B;  4Q44 A;  3HKB B;  5LOV A;  4LSA A;  1M0W A;  5CAE B;  2ATK C;  2NNU A;  1US6 A;  4JTD B;  2QA4 V;  3QFF A;  2Z5U A;  5KHG A;  4O4L F;  4QSH A;  4X1Y B;  2ZE6 A;  5KFI A;  4P30 A;  3GV8 B;  4I5S A;  4IR9 A;  5I5S A;  1JKJ B;  3T1Y B;  1S0N A;  1XNQ O;  3K5N A;  2UUC O;  3N44 B;  5IP7 G;  4DIM A;  4DV5 B;  2YSU B;  3GV7 B;  4J9L A;  5KFD A;  1GTO A;  2KG7 B;  5K1X A;  2FMA A;  4DV5 H;  2JJ2 G;  2Y0S A;  1N48 A;  5K3W A;  1VQN V;  4YBZ B;  2EJ3 A;  4GC6 A;  2VA2 A;  2X7R B;  1BL8 A;  3JRW A;  4IRK A;  1CS0 A;  2BSK B;  4DV6 B;  1KEE A;  1M57 B;  2DPI A;  2DN9 A;  2P0A A;  3RT3 C;  3N2G B;  3ABK C;  5C8Y B;  1ZX3 A;  3VBB A;  2WLL B;  2P7T C;  4PDR A;  2ZJT A;  2B63 A;  2LQT A;  1PKX A;  3IN5 A;  3JAR A;  4ED3 A;  4EGJ A;  1LR1 A;  5LYJ A;  2CKZ B;  3QO7 A;  1B6Q A;  1QCE A;  3GIM A;  4PDV A;  4PA3 A;  5IDJ A;  5LA6 A;  2ZDH A;  3SJB C;  1NKD A;  1R73 A;  1H2M A;  5CB4 F;  4G27 B;  2WSS G;  4CKE A;  1SZT A;  4O7N A;  3K5O A;  2UUB O;  1M90 W;  4FM2 A;  3K59 A;  1NU1 H;  1S5J A;  3I4M G;  4FFM A;  5DGB A;  3MR6 A;  5LOV B;  1TGO A;  2YUA A;  1VQ9 V;  3UYY A;  5BZB A;  2EZO A;  4IYI A;  3GTQ A;  5JJJ B;  1M0T A;  2FYU H;  4IIJ F;  3APO A;  2V7Q G;  5IYZ A;  5DLF A;  4Y8V B;  3OR7 C;  3H1I H;  3ZHU A;  2MK3 A;  2QSA A;  5FL7 G;  5IJ0 A;  1Y66 A;  3UT5 A;  4WFA V;  4I0X A;  4NXN B;  1QLN A;  4ZOL F;  2HIX A;  2KSD A;  2UXD B;  4JI8 B;  1HP8 A;  3D36 C;  3V6K A;  3RYC B;  1W0K G;  5LMU H;  5KA6 A;  4JI8 H;  3N2K A;  4EB6 B;  3LWB A;  3K9S A;  4ED0 A;  2HJF C;  1RFY A;  2CQY A;  4NZN A;  4DV0 H;  5EIB C;  3VOU A;  1NH2 B;  1Q90 D;  1RJQ A;  1HNW O;  4UV8 A;  1I2K A;  3HOU G;  1M7J A;  4O3N A;  4MV3 A;  1S10 A;  2A06 H;  2FLL A;  2YIA A;  1AR1 B;  2CH7 A;  1OCZ C;  2AHY A;  2ODT X;  4BY7 G;  1XIL A;  1XMO H;  2EIL C;  5DN6 G;  3BQ0 A;  4J7Z A;  4B3R O;  1WJZ A;  3JAS A;  4JYA B;  2WAQ E;  3TQ1 A;  4FS1 A;  4QWC A;  2WLN A;  3I55 V;  3JAS B;  1GYF A;  1L8D A;  3QO8 A;  4P9O A;  3OM3 B;  1NZ6 A;  5GTI Z;  4FGR A;  3T1H H;  1TWC A;  1YEW A;  4U7O A;  4ZQI A;  2XGP A;  1CXZ B;  1V55 C;  4HYO A;  4O4J B;  4GKJ O;  2GPW A;  2CW8 A;  5FJ8 G;  2IJJ A;  4A3F G;  4AHC A;  3OHB A;  4O7S A;  3BFR A;  1D5A A;  4ZBM A;  1A48 A;  2ZDQ A;  2CTR A;  1TUB A;  3WFV A;  4DUY B;  3OTO B;  5CA0 B;  2Q68 A;  2JEU A;  5BY1 A;  2UXC B;  2EJ0 A;  2M05 A;  5FR9 A;  1WH2 A;  4O3P A;  4UCV A;  3T1C A;  3TXS A;  3UT5 B;  1DGS A;  4O7V A;  5BPH A;  2JA6 G;  2XND G;  2UVW A;  3K3W A;  5KG0 A;  2JEF A;  4BIO A;  3HBL A;  3ZN0 A;  2YZM A;  1BGW A;  4UCO A;  4JAS A;  2YZN A;  3JSN A;  4HNA A;  4CKC A;  2R92 G;  4IHJ F;  2UUC H;  3R65 A;  3CXC U;  4PI2 A;  3LSU A;  1SC5 B;  1QHT A;  2OTL V;  4K8X A;  4E2L A;  3TIN A;  2WB1 A;  3RW0 A;  5BWX A;  3WWJ A;  1KJJ A;  2R85 A;  3CC4 V;  5KT7 A;  1T3N A;  3D36 A;  4DV1 H;  5KG3 A;  3GB8 B;  1GLV A;  3GDE A;  4WD3 A;  1S5L Z;  1GSH A;  3T54 A;  3PW5 A;  3BAB A;  2R70 A;  2FK2 A;  2YS6 A;  3G6E V;  3JAR B;  4K0K H;  3ABL C;  4RQF A;  1QLE B;  1YZB A;  3ZIA G;  1N32 O;  3H40 A;  5LGN A;  2R7Z A;  2HVJ C;  3GTL A;  1JMK C;  5B1A C;  2VQE H;  4A3L G;  1AI5 A;  2QGN A;  2B9Z A;  2RN9 A;  1KC7 A;  2BSK A;  1H2N A;  4K35 A;  4FLV A;  1H2S B;  4JI2 B;  2XAQ A;  2WA3 A;  4DR3 B;  3RBE A;  4NB5 A;  1YJ9 V;  3KAK A;  1TWH A;  4NYK A;  1DK1 A;  2R87 A;  3HOW G;  3SPH A;  2QB5 A;  4OX9 O;  4O86 A;  2ZCE A;  5H9C A;  5LOV F;  4EB6 A;  4KHP O;  3G8C A;  4MVQ A;  2W6Z A;  1WB7 A;  3CRR A;  2RJZ A;  1JDB B;  5CR5 A;  4EG0 A;  1S72 V;  2OIG A;  2HR3 A;  2QEX V;  1GAX A;  2P6J A;  1J5E O;  2CNV A;  3LSQ A;  3CWB H;  4TUY F;  1RSO B;  3KYH C;  3AG3 B;  2P5O A;  3U55 A;  5BPF A;  2HVQ A;  1VQP V;  1SQB H;  3HKC B;  3SYA A;  4Q6G A;  4JI8 O;  4FLU A;  4RZR A;  5AG2 A;  1DIK A;  4ED8 A;  4PHZ A;  1MZE A;  2QDO A;  3P3P A;  3HB3 B;  3QWU A;  2J6T A;  2V9W A;  4J9Z B;  1KKC A;  3OUU A;  4IR1 A;  5IYD O;  1AP6 A;  3OTF A;  1XNR B;  3HPL C;  1EHI A;  3VA7 A;  3OUS A;  4WFG A;  3VOT A;  2B1I A;  3KAL A;  2FLP A;  4LWS A;  2ZNJ A;  1YTF D;  4I4T A;  3EFF K;  3GIQ A;  4CZZ A;  4APM A;  1EKP A;  5L3B A;  5C1O A;  2Q0O C;  3T5H A;  2ASL A;  1R3J C;  4BIU A;  1G4Y B;  4RNO A;  5C5J A;  3SGI A;  4ZI7 F;  5IYC G;  1KC8 W;  2EZP A;  4DR7 B;  5DQH A;  3SJA C;  4X1K A;  5DIS C;  2KG7 A;  3M4I A;  3VQW A;  4JYA H;  2CTW A;  1SQP H;  4J41 A;  4ECQ A;  3CXH F;  4FFR A;  4ZOL A;  2QWR B;  3P3N A;  1YDX A;  4LR3 A;  3E8B A;  3SYP A;  3VNN A;  3G6X A;  3GWK C;  3G67 A;  1TVK A;  3MHH C;  4UFZ A;  3T1Y O;  2JS5 A;  3RUP A;  3L72 H;  2VR1 A;  4ED2 A;  2IJH A;  3HKB A;  3CCE V;  5LP6 F;  1I5X A;  3PVX A;  1EN4 A;  5FPR A;  5HFL A;  4P9P A;  5KT6 A;  2A3Q A;  5GON B;  1FVI A;  5DGA A;  3V6H A;  1ZHQ A;  2DWC A;  3ML0 A;  4WFE A;  2GTA A;  4Q45 A;  3RN4 A;  4FLW A;  3N43 B;  3ZS8 C;  3Q8Q B;  3N6X A;  1KKD A;  4DR6 O;  3G8D A;  3CCQ V;  1IXM A;  1ZL8 B;  3FYE B;  2ZXW C;  3E35 A;  3AG2 B;  4X20 A;  3UZO A;  3I4N G;  2GUZ B;  3FKI G;  1EZJ A;  1R3K C;  4B3T B;  4MVS A;  2HLD G;  2EIN B;  2PYJ A;  1FYJ A;  5HV6 A;  5JQW A;  2NVY A;  4QW8 A;  5KAF Z;  2W6N A;  2ATL A;  2R7L A;  3HR0 A;  1DAA A;  1FXK B;  3QTC A;  2NR5 A;  3K0G A;  5JWP A;  4O3R A;  5DGH A;  3SPJ A;  4OX9 B;  4JI5 H;  4R8U B;  3A0B Z;  5KFC A;  3WO1 A;  3JCU Z;  2JDI G;  1Y1W G;  2A9H A;  2RCV A;  3S3X A;  4NYE A;  4F4W A;  1RSO A;  3JRX A;  1E79 G;  5KFE A;  1XNR H;  2R8I A;  2XTA A;  1WNS A;  5KHJ A;  3R23 A;  2CZG A;  2KSW A;  4LFB O;  1M56 C;  3F7V C;  3K5H A;  3QVN A;  4LFC H;  2Q67 A;  1I7N A;  5C8Y F;  3AG7 A;  1WCM A;  3K57 A;  2Y48 A;  4MA5 A;  1Q6H A;  2H3O A;  3M99 B;  1K4D C;  2NU8 B;  4J9K A;  3RF2 A;  3RGB A;  4K8Z A;  2YRX A;  2YZL A;  5C4X G;  4UCT A;  3M9O B;  4QIW E;  1RK6 A;  3PR5 B;  4F50 A;  1M6V A;  5ITZ B;  2QKA A;  2DYR B;  2OWO A;  1B6R A;  3MFH A;  2CE4 A;  2YS8 A;  4DO2 A;  1VQL V;  2PBZ A;  1ENV A;  3TW7 A;  1SQG A;  3H3V H;  2WAM A;  4O84 A;  2WB1 E;  1S03 G;  3BQ1 A;  2EIK B;  4R7C A;  4U3J B;  3W7U A;  1VQK V;  5KUK A;  4MVZ A;  4IZO A;  5B1O A;  3BPZ A;  4B3S B;  4D7S A;  1W93 A;  1GGO A;  3L73 H;  5KFT A;  2EX3 A;  1SEI A;  4DR7 H;  3E22 B;  4MSW C;  4J42 A;  5D5P A;  3SPC A;  3JAL B;  3T4Z A;  1WR2 A;  5KT3 A;  4N21 A;  4DUY O;  2Z3Y A;  3TCU A;  4LNU B;  1K1S A;  2YRW A;  2X5R A;  4YIP A;  2Q7D A;  1P7G A;  3CSW A;  1OHH G;  4TVI A;  2DQ0 A;  4JI0 H;  5I5W A;  3CYO A;  1GSA A;  1D5N A;  1VF6 C;  2VQF O;  1XL4 A;  4GX5 A;  4P2Z A;  2D2C B;  1FKA O;  3OUZ A;  2FJZ A;  3Q8S B;  2QJ1 A;  2GUZ A;  4JI4 B;  2W6I G;  3AG1 C;  4QWD A;  1BT8 A;  3SJQ C;  4X20 B;  1VS0 A;  2DPJ A;  3ASN B;  1GM8 A;  1NS1 A;  4R50 A;  2Q7G A;  2ZR3 A;  3CEI A;  5CM0 A;  4LF5 B;  1VQ6 V;  2XC9 A;  2C28 A;  4A2B A;  4AQY H;  4RAZ A;  4WBN A;  5GON A;  2R7K A;  3TGU H;  2LW1 A;  5L3C A;  4H33 A;  1WP8 A;  3ABU A;  2Q5Z A;  3TY5 A;  2JEJ A;  2EIL B;  2YS7 A;  4FPP A;  5KFR A;  1EBO A;  1QLE C;  4KL1 A;  4RO2 A;  4I4T F;  2BCC H;  4I7Z B;  2YID A;  2W7P A;  1GM9 A;  3V6J A;  3JSL A;  2AZ0 A;  1JDE A;  4CMD A;  3MD0 A;  2YEV B;  2DW4 A;  5C93 A;  4RQE A;  4I55 B;  1V51 A;  1TA8 A;  3N2G A;  2ALZ A;  1BS3 A;  2JEI A;  4XX0 B;  3JZF A;  1T94 A;  4CS4 A;  3LDE A;  3AX6 A;  2W8L A;  2Y4T A;  3OUF A;  4CKB A;  4IT5 A;  5JCO A;  1GRJ A;  3MAQ A;  5KS8 A;  5BMV B;  2W6M A;  1S0V A;  2AQ4 A;  3SDL A;  1FAF A;  4ZKI A;  3ASN C;  4JF3 A;  3WG7 B;  1AJQ A;  4HBN A;  4GUN A;  4BWA A;  3KG2 A;  4MW3 A;  2E2H A;  1VF7 A;  5H6R A;  2R82 A;  2X6A A;  4GCZ A;  3WB2 A;  4LFA H;  5EWE A;  1HNZ H;  4B3T H;  3S24 A;  2J9G A;  2B63 G;  4I0X B;  4J9R A;  3MR3 A;  2I80 A;  4Z1V A;  3EYY A;  3K0D A;  5CBH A;  2W6Q A;  5IYZ B;  3JAM W;  2JJ1 G;  1CKN A;  3IGA C;  4ECZ A;  5L1I A;  2LW7 A;  1TUE B;  2YXL A;  4CH3 A;  4GKK B;  5KFG A;  4LFC O;  1YVW A;  4J9S A;  2I87 A;  3RB3 A;  4JI6 B;  5KFO A;  4G3I A;  1J5E H;  4DV7 O;  2DZD A;  2XIG A;  3L4J A;  3HKZ E;  5IP9 G;  1N0J A;  1QR8 A;  4IWX A;  2W7O A;  2Y0P A;  1XDC A;  1KMI Z;  5CA1 F;  4MTE A;  4QJF A;  1RJP A;  5I5Y A;  3AG4 C;  5L3E A;  2F93 B;  3F5T A;  3BAA A;  1B33 N;  3K06 A;  2EIK C;  4DRX B;  4N23 A;  1KP3 A;  1SS3 A;  5CB4 B;  4DR2 B;  4DR4 H;  4PEL A;  4FBT A;  1Y74 A;  3QO5 A;  3NBY B;  3JZI A;  4O2B A;  3Q8P B;  4DV4 H;  1I2L A;  3SNO A;  4MVM A;  4I55 A;  1C30 A;  4NZO A;  3FKI A;  3KHR A;  5DEC A;  1G1X B;  4TQF A;  3CCR V;  1PX2 A;  3CS5 A;  3CJH B;  1K9M W;  4FM9 A;  4WF9 V;  4DV7 B;  3ZMV A;  1FJG H;  3K03 A;  4QIW A;  4R8C A;  1SFO A;  1N36 B;  4BAY A;  3PO3 G;  1DF5 A;  1GM7 A;  2HGX A;  4Q8E A;  2VPQ A;  2ZKO A;  3TY9 A;  4IAJ A;  1X9N A;  3CC2 V;  4O7Z A;  2BTO A;  4B3M O;  3ZMZ A;  1Z2O X;  2YC0 A;  4J7K A;  4YB8 B;  4FBU A;  4ECY A;  2JGU A;  3F7Y C;  1H8E G;  1FXK C;  1NI8 A;  1Y76 B;  2ZIM A;  3E86 A;  4PA9 A;  3W7X A;  4DV6 H;  2ZT9 B;  3WB0 A;  3NGD A;  1SKV A;  4OGQ B;  1BSM A;  2K9P A;  3H1J H;  3SPG A;  4DR2 H;  3GTJ A;  2ZE7 A;  2ADQ B;  3PN1 A;  1GH6 A;  1B04 A;  3FD9 A;  2OIE A;  5F2V O;  3BY6 A;  1BQ0 A;  2XAS A;  3KCY A;  1Y6X A;  2EIJ B;  2LP7 A;  1YTF B;  2ZXW B;  4JV2 A;  1WRV A;  3ZCC A;  3DTF A;  3GB7 C;  4A3E G;  5B1B B;  3FYI B;  2LJ2 A;  2QE7 G;  2VRZ A;  4O3O A;  4FFP A;  4EBD A;  3SJC C;  3WO0 A;  3RV4 A;  2DAA A;  3LDC A;  1F51 A;  4ED6 A;  4RUE A;  5B3S C;  3DXR B;  1M93 A;  3U0Z A;  5B5E Z;  2COI A;  4OXS A;  4U3F H;  3K04 A;  2ITD C;  3F8N A;  1IXB A;  4O3S A;  4O4J F;  5IYD G;  2YU9 A;  3V4Z A;  2YXH A;  4I55 F;  1JCH A;  4PA4 A;  3H1H H;  2JEX A;  3SYO A;  3EPI A;  4FVM A;  3D3I A;  2Y69 C;  1T5E A;  4DR4 B;  2HEP A;  2HGS A;  3GID A;  4RU9 A;  2C2E A;  4UVA A;  4O7R A;  4MA0 A;  4JI2 O;  4LC1 A;  4I50 F;  3KHL A;  4LF6 O;  1ZLZ A;  4U3J A;  4PA7 A;  1M1K W;  3TXQ A;  1EN6 A;  1A0I A;  5L9X A;  3D3Q A;  4YR2 A;  2JGD B;  4CH6 A;  4FLX A;  2PTM A;  3B40 A;  4WFH A;  5H6Q A;  4LFB H;  1WP7 A;  2UUC B;  1RP3 B;  1QR9 A;  1KP2 A;  1TAE A;  1IBK O;  2R72 A;  5HNE A;  4ECT A;  2CDY A;  2HJW A;  1R3I C;  2GQS A;  2R8G A;  2ILM A;  2YIB A;  3H9V A;  5KFM A;  1K33 A;  2YYA A;  4ECX A;  4O4L B;  1LUW A;  4DR1 O;  1IVS A;  5D5Q A;  4B3R B;  1I7L A;  5EBL C;  3BG5 A;  4UXN A;  2R8K A;  1IUR A;  3E83 A;  2V5A A;  2FTK A;  3RYI A;  4K0K B;  2VPS A;  4GKK O;  1N0N A;  3GTG A;  5F9N A;  1DV2 A;  1VBG A;  4J9N A;  4BW5 A;  2FPG B;  1VF6 A;  4YR3 A;  2R7Z G;  4RAI A;  1RPO A;  5CBG A;  4DV1 B;  4M9U A;  4HYK A;  3HOV G;  3T7A A;  1C3O A;  4Q0Y A;  3AG3 C;  4UCU A;  5J2U B;  4GX0 A;  4A3K G;  1QBZ A;  2AXT Z;  4MVU A;  2BOC C;  5C44 G;  4U7C A;  4DV3 H;  1I50 A;  3PZP A;  3PO2 G;  3ZHR A;  4LF9 O;  2R9R B;  2P67 A;  1FS0 G;  2F4V O;  1OCO C;  1YSC A;  3OTO H;  1HNW H;  3ZRW B;  3ZMT A;  3N41 B;  2UU9 B;  3BAC A;  1I08 A;  1WAZ A;  1YI2 V;  1RYS A;  1JJ2 U;  3K58 A;  3VPC A;  5DGI A;  5LL6 Y;  1XMO O;  5C8Y A;  2UXB O;  3JCZ A;  1N4C A;  1TWF A;  2ASD A;  5B1B C;  1I6U A;  4DRF A;  2C2D A;  2OCH A;  2QWO B;  4TUY B;  1U96 A;  1IDS A;  4JI6 O;  4WCE V;  4IIJ B;  4LCU C;  1QVF U;  1YCI A;  3THO A;  4RNM A;  2HP8 A;  4BBS G;  4A2A A;  3RYH A;  4GT1 A;  3RBD A;  4IHJ A;  5KKN B;  5IWA O;  4LF4 B;  1ZET A;  1VQ5 V;  2Q69 A;  4FLZ A;  3ZHV A;  4B3M B;  3ABL B;  2R86 A;  4LF4 H;  4ZOL B;  2WDT A;  4JXU A;  4FFB A;  5IJ9 A;  2EJR A;  2R7N A;  4GKJ H;  1J95 A;  2HFE C;  5I60 A;  4EGQ A;  4ZHQ F;  3CCU V;  3AK1 A;  4YP3 A;  3MWM A;  1SET A;  4TQD A;  4DXW A;  4NXN H;  3CSX A;  4AYB A;  4FIP C;  4X9Q A;  1IBM H;  2EUL A;  2XD4 A;  3K9A A;  3CCJ V;  1NQT A;  2W9B B;  4J9Q A;  5H80 A;  4DV2 B;  5KFZ A;  3HKD B;  3FAV A;  4BWS C;  3EVK A;  1P8L A;  4JI1 O;  1ZUQ A;  4DW0 A;  2Y0S E;  2DJV A;  3LNN A;  4MTX A;  4RB2 C;  3JD0 A;  3UKM A;  1U97 A;  1XHX A;  1GSO A;  2C00 A;  3I12 A;  4ECW A;  1CKO A;  4I50 A;  4JI3 B;  3CC7 V;  1YF2 A;  3QF7 A;  5KHH A;  2WWW A;  5L1K A;  1Y67 A;  4DV2 O;  1XMO B;  3B77 A;  4KUM A;  2Y69 B;  3CVZ A;  3RB6 A;  3GLK A;  4GYC B;  3IC7 A;  3KXY T;  3Q2O A;  1Q86 W;  5EIB D;  4RUA A;  1HNZ O;  3ETH A;  3Q4H B;  5I5T A;  1R9T A;  1JPX A;  1TWA A;  3Q4H A;  2BOB C;  1ULZ A;  2W57 A;  4X1I A;  5EYP B;  2XAH A;  3MWD A;  1FD9 A;  2VWJ A;  4FU0 A;  3PFF A;  2Q8V A;  1W59 A;  5GON F;  1KQS U;  3L74 H;  3T4D A;  1I5Y A;  2E2I A;  5EOY A;  1Q81 W;  2J6U A;  1PL4 A;  5BXZ A;  3U11 A;  2O03 A;  4TQR A;  1V54 B;  5FNV B;  3OSN A;  2JVD A;  2BQ3 A;  3CRM A;  2N05 A;  3DC6 A;  4MVO A;  2BQU A;  3MR5 A;  1KYO F;  3H1L H;  3LNM B;  4H0L B;  3OHA A;  4FFN A;  2Q2U A;  5L3D A;  4CC5 A;  4LH6 A;  2AW9 A;  4Q43 A;  3W7S A;  2DYR C;  4DR1 H;  5KX5 A;  1SES A;  1OCZ B;  4I9Q A;  4LF9 B;  2IP4 A;  2M7W A;  3CMA V;  1IZ3 A;  5HBR B;  1R3L C;  4O4H A;  4KHP H;  4HQ6 A;  2FML A;  5LMU O;  3RV3 A;  4JYY A;  1H38 A;  2XUM A;  3CRC A;  1GN4 A;  2XCL A;  5L1J A;  2QM7 A;  3NR7 A;  1Y4M A;  5KFL A;  1JIH A;  1WSC A;  3NC0 B;  1ET0 A;  2DWE C;  4J11 A;  3STZ C;  4JI5 B;  5KFV A;  3WG7 C;  3B4S A;  4WFF A;  2M6Y A;  2QWP B;  4AYB E;  2FP4 B;  3U9T A;  2GBO A;  4O7T A;  4M7E A;  1N33 H;  4NTX A;  4PZ6 A;  1OV9 A;  1Y1V A;  1ZAU A;  5JUM A;  4GLW A;  2Y4R A;  3W5O A;  3RYH B;  4C7U A;  2NU9 B;  3ICX A;  2ZE8 A;  3EHB B;  5KFA A;  4K3A A;  3CHX A;  3RR5 A;  1N36 O;  4TUY A;  5LGT A;  3OTO O;  1S77 D;  3RVZ A;  2UXD O;  3QZ7 A;  2YIB D;  4EBC A;  2W9A A;  1NJI W;  4Q4C A;  4DR3 O;  3QG5 A;  3IC9 A;  2WLM A;  2Q4P A;  3WNZ A;  1AI4 A;  1I94 B;  2QKS A;  5DLG A;  1EZV H;  4DW1 A;  4DR6 B;  3T1H O;  2UUA B;  4O7L A;  2F66 C;  4TSF G;  5JQG A;  1FFT B;  5CBF A;  1SZX A;  4O4I A;  4DL5 A;  3T9D A;  4L1K A;  1TUB B;  3ASO C;  2LFR A;  3E5N A;  4ECR A;  2UVU A;  1SRY A;  3JZ6 A;  1KUQ A;  1K92 A;  4F6R B;  4X64 B;  5BWW A;  2ZR2 A;  1S97 A;  2WLI A;  2X0S A;  1N34 H;  3BHP A;  4JYA O;  4B7E A;  1IOV A;  1Q8I A;  3M7M X;  3OT7 A;  3TEK A;  4PDB A;  2FLN A;  3E2E A;  5KFP A;  5DQG A;  4FS2 A;  3GWO A;  4YR0 A;  2RDJ A;  4UB6 Z;  1KJ9 A;  1G6U A;  5K1P A;  5KFN A;  2ZNI A;  3FDS A;  5CMU A;  3RBZ A;  2NUA B;  2HHH H;  5DG9 A;  3OGI B;  1KD1 W;  2OCC C;  1THZ A;  1S76 D;  4LFB B;  4BY1 G;  2FK3 A;  2P4V A;  1MSW D;  4ME6 A;  4JV1 A;  2NN4 A;  5IYC O;  3MWE A;  4UUG A;  2QKC A;  2RF4 A;  1FFX B;  1EFR G;  4L8J A;  4MTD A;  4O4L A;  1ZTE A;  3KZI Z;  2E75 B;  4PI0 A;  3JAM N;  5IE9 A;  3GIP A;  2W9C A;  3HB9 A;  1CEZ A;  3FKS G;  4WBN F;  5JVL A;  3VQY A;  3KHG A;  5JH7 A;  1GO3 E;  2Z04 A;  1CP9 A;  5FPO A;  4YY3 H;  2W0F C;  3OMI B;  4DR5 H;  5LXT B;  4O3Q A;  2HHF A;  4JI2 H;  5KFY A;  2Q2T A;  5EZY F;  4LF6 H;  1K97 A;  4K0K O;  5E79 Z;  2O57 A;  2HG8 A;  3JAK B;  2HIV A;  1PNM A;  2GV9 A;  2CGO A;  3OD4 A;  1JVM A;  3ZRX A;  1N34 B;  1VP7 A;  1MZB A;  3W7W A;  1CQI B;  3N2K B;  5JCO C;  4JI5 O;  1JLL B;  1S0M A;  4EQ5 A;  5LHH A;  3A0H Z;  3CRA A;  2AZ2 A;  5KHK A;  4G28 B;  1IBK H;  2IM9 A;  2R8H A;  3TET A;  4M0J A;  4BW9 A; 
#chains in the Genus database with same CATH homology
 4ZHQ B;  3EYY A;  3K5O A;  4FM2 A;  3K59 A;  1S5J A;  2PGG A;  5IYZ B;  2HHH B;  3JAM W;  1CKN A;  4TV9 B;  3RWR D;  5KMG A;  5LOV B;  1TGO A;  2YI8 A;  2YXL A;  4CH3 A;  4GKK B;  4JI7 B;  3CB2 A;  4WBN B;  2HVS A;  4ZI7 A;  4TV8 B;  5JJJ B;  3L2P A;  1M0T A;  1HW7 A;  5KMG B;  4X65 H;  4JI6 B;  5IYZ A;  1HR0 H;  1J5E H;  4ZHQ A;  2XIG A;  5IJ0 A;  4NXN B;  3UT5 A;  3L4J A;  1JFF B;  1HNW B;  1HNZ B;  5LA6 B;  5J2T A;  2HIX A;  1FJG B;  2UXD B;  4JI8 B;  4O4I B;  3RYC B;  4J0M A;  4MV7 A;  5LMU H;  4LFC B;  1KMI Z;  4JI8 H;  4MTE A;  2ZIO A;  3N2K A;  4EB6 B;  5CA0 A;  3BRC A;  3JAT B;  2F93 B;  3BAA A;  3HKE A;  4DV0 H;  4DK0 A;  4DRX B;  4DR2 B;  3NBZ B;  5CB4 B;  5EIB C;  1IBL H;  4DR4 H;  5JVD B;  4LF5 H;  1E4G T;  4FM1 A;  3NBY B;  5BR8 B;  4LNU A;  4O2B A;  4O4J A;  4DV4 H;  1WPB A;  2YIA A;  4I55 A;  1XI1 A;  4TQF A;  1XMO H;  1BJT A;  2UXB H;  4FM9 A;  4LH7 A;  3BA8 A;  4FLT A;  4DV7 B;  1XDN A;  3JAS A;  4JYA B;  4DUY H;  1FJG H;  2UXD H;  2UXC H;  1N36 B;  4DR3 H;  3JAS B;  1GYF A;  1L8D A;  3J81 W;  3TY9 A;  3RTX A;  4IAJ A;  1X9N A;  2BTO A;  3T1H H;  2PUS A;  1YEW A;  1Z2O X;  1N32 B;  5IWA H;  4RAY A;  1XQ8 A;  5KHI A;  2VQF H;  3J7A K;  3IG0 A;  4O4J B;  2JGU A;  2CW8 A;  1Z2N X;  2ZIM A;  4DV6 H;  1Q43 A;  4AHC A;  5KX5 B;  4DV4 B;  5FLX W;  3WB0 A;  1SKV A;  3DF7 A;  5CB4 A;  1D5A A;  4DR2 H;  3HXL A;  3T1Y H;  1XHZ A;  3PN1 A;  1TUB A;  4DUY B;  1B04 A;  2BTQ B;  3OTO B;  5CA0 B;  2ZIN A;  2P22 C;  1Q5O A;  4O2A B;  2Q7E A;  4LFA B;  2UXC B;  4CC6 A;  3RYC A;  1P49 A;  4GKJ B;  1WH2 A;  4UCV A;  1XK5 A;  3UT5 B;  5D1O A;  3SJC C;  1DGS A;  4YHH H;  2KKW A;  1SQF A;  3WB1 A;  4X64 H;  1BGW A;  1HR0 B;  4UCO A;  5LP6 C;  4ETS A;  1M93 A;  3JSN A;  4HNA A;  3U0Z A;  4RB1 A;  2VQE B;  2UUC H;  4PI2 A;  4DK1 A;  2QM4 A;  1QHT A;  4K8X A;  4EFB A;  3F8N A;  3RIZ A;  4DV2 H;  2VOB A;  4TV9 A;  5LL6 b;  4DV1 H;  3K5M A;  4FVM A;  3GB8 B;  3GDE A;  1T5E A;  4DR4 B;  2HEP A;  3RFR A;  2HGS A;  3BAB A;  2R70 A;  5LYJ B;  3JAR B;  4U3J A;  4K0K H;  1XMQ B;  2VWK A;  1A0I A;  4NXM H;  3JAK A;  4CH6 A;  4FLX A;  2PTM A;  1JMK C;  4KHP B;  5BMV A;  4LFB H;  1WN7 A;  3VQX A;  2UUC B;  2VQE H;  1TAE A;  2R72 A;  4FLV A;  1H2S B;  4JI2 B;  5JVD A;  4DR3 B;  4DRX A;  2E3C A;  2YIB A;  3KAK A;  4RB0 A;  3HKE B;  4O4L B;  2PZS A;  2ZCE A;  2ZM6 B;  5D5Q A;  4EB6 A;  4JV5 B;  3JAW A;  1FFX A;  5LMU B;  4B3R B;  4R7R A;  1L2Z A;  1O75 A;  4FFB B;  1N33 B;  3VQV A;  1KU9 A;  2RJZ A;  3RYI A;  4K0K B;  2VPS A;  5J2T B;  1S68 A;  4X1Y A;  2CAZ C;  4CH5 A;  1I94 H;  4FLY A;  4DV1 B;  3KYH C;  1P16 A;  5JJN B;  2P5O A;  4TV8 A;  4ZI7 B;  4Q0Y A;  4JI7 H;  2HVQ A;  3HKC B;  3J80 W;  4UCU A;  3N42 B;  4Q6G A;  5J2U B;  4FLU A;  5JJE B;  4RB3 C;  4PHZ A;  4NXM B;  3QWU A;  1Q3E A;  4DV3 H;  5FD5 A;  1N36 H;  2PYL A;  3OTO H;  1HNW H;  3N41 B;  4JI4 H;  2UU9 B;  4UCS A;  3OTF A;  1XNR B;  1SA0 A;  3K58 A;  3K3V A;  3KAL A;  3L4K A;  5LP6 B;  2ZNJ A;  2E5L B;  3TY8 A;  4I4T A;  3ZED A;  2FE3 A;  5C8Y A;  2XHB A;  2ZM6 H;  4AQY B;  4APM A;  4B3R H;  4YJ2 A;  5J2U A;  4JV5 H;  2Q0A A;  1FKA H;  1I6U A;  4DRF A;  4TUY B;  2WE6 A;  3SGI A;  2VUG A;  5JH7 B;  4IIJ B;  3THO A;  1QQC A;  3E22 A;  4PZ7 A;  4DV0 B;  4A2A A;  3RYH A;  1Z2P X;  3RGX A;  4DR7 B;  4IHJ A;  4X1K A;  3SJA C;  3IAY A;  4LF4 B;  5DIS C;  3M4I A;  3VQW A;  1HNX H;  4FLZ A;  4LF8 B;  4JYA H;  4B3M B;  2UUA H;  3RYF A;  4MV9 A;  4RZQ A;  4LF4 H;  4ZOL B;  2WDT A;  4ZOL A;  4FFB A;  5IJ9 A;  4B3S H;  4JI3 H;  4LF8 H;  4GKJ H;  4YJ3 A;  5LMN H;  2MCT A;  4LF6 B;  4LR3 A;  4IHJ B;  3MWM A;  4TQD A;  1J5E B;  3VNN A;  5IT9 W;  4NXN H;  4NVP A;  3W1B A;  2UUB B;  1TVK A;  3CSX A;  4UFZ A;  4IIJ A;  2JS5 A;  1IBM H;  2YI9 A;  2UXB B;  3HKB A;  1XNQ H;  4GLX A;  5FPR A;  5GON B;  1FVI A;  5ITZ A;  1ZHQ A;  4DV2 B;  3HKD B;  4F6R A;  4BWS C;  2E5L H;  1P8L A;  4FLW A;  3N43 B;  3ZS8 C;  3N6X A;  3LNN A;  4X20 A;  1O9H A;  1SA0 B;  4RB2 C;  1E4F T;  1XHX A;  4B3T B;  3LML A;  5LMN B;  5CA1 B;  2RQ6 A;  1CKO A;  4X66 H;  4I50 A;  4JI3 B;  2PYJ A;  3QF7 A;  5KHH A;  5JQG B;  3SR2 C;  1XMO B;  1I7F A;  3C0F B;  3CVZ A;  3QTC A;  4GYC B;  2Q7H A;  4DR1 B;  4OX9 B;  1JJO A;  3KXY T;  4JI5 H;  5EIB D;  1V9P A;  4X62 B;  4YY3 B;  1Z5V A;  4HNA B;  4DR5 B;  4X65 B;  2W57 A;  4X1I A;  5EYP B;  1RSO A;  4X62 H;  1XNR H;  2UUB H;  3JAL A;  2VWJ A;  1M5I A;  5FD6 A;  1WNS A;  2PY5 A;  5KHJ A;  4EFE A;  2KSW A;  5EOY A;  3T1H B;  3U11 A;  5EZY B;  2O03 A;  3W1G A;  3H20 A;  4LFC H;  5FNV B;  5CA1 A;  2JVD A;  2UU9 H;  3JAW B;  4B08 A;  3K57 A;  4JI0 B;  1IBK B;  2YCH A;  1SYX B;  1X4T A;  4DUZ B;  2Q2U A;  3RF2 A;  4CC5 A;  4LH6 A;  3RGB A;  4K8Z A;  4DV7 H;  4UCT A;  5D1P A;  4DR1 H;  4OX9 H;  5KX5 A;  4I9Q A;  2V4D A;  4LF9 B;  2CFM A;  4KHP H;  4O4H A;  5ITZ B;  2OYQ A;  2OWO A;  4O4H B;  1M4U A;  3GJX B;  2RGV A;  4JI1 B;  4GKK H;  1SQG A;  2RGR A;  1TVK B;  4I7H A;  1XMQ H;  1S03 G;  4LF7 H;  4U3J B;  3NC0 B;  4FM0 A;  3DSQ A;  3K5L A;  4JI5 B;  4YJ3 B;  5FNV A;  3B2E E;  4M7E A;  5EZY A;  3BPZ A;  4B3S B;  4PZ6 A;  1N33 H;  4D7S A;  2WYO A;  1ZAU A;  4X1K B;  4LSX A;  3N40 P;  3W5O A;  1AN7 A;  3RYH B;  2EX3 A;  1SEI A;  4UCR A;  4DR7 H;  3E22 B;  5D5P A;  3JAL B;  3ICX A;  3CHX A;  1IBM B;  3RR5 A;  4LF9 H;  1NT2 B;  4X1I B;  5EYP A;  4TUY A;  2F4V H;  4LNU B;  4O2B B;  4AIL C;  2YIB D;  2F4V B;  5BR8 H;  3A2F A;  3QG5 A;  4CS3 A;  4CH4 A;  4JI0 H;  4TOI A;  4YHH B;  3BA9 A;  1I94 B;  4I4T B;  4DR6 B;  2CW7 A;  5LP6 A;  5D1O B;  2UUA B;  4B3M H;  3JAT A;  1XNQ B;  2F66 C;  2F1M A;  5JQG A;  4I50 B;  3UQ8 A;  4PZ8 A;  4O2A A;  4O4I A;  2QJ1 A;  1ZHS A;  1CKM A;  4JI4 B;  1O9G A;  4ZIB A;  4X20 B;  1JFF A;  1VS0 A;  4JI6 H;  2BTQ A;  1TUB B;  5IJ0 B;  3RGZ A;  4LF7 B;  5A2Q W;  2Q7G A;  4LF5 B;  4F6R B;  4A2B A;  4X64 B;  4DV3 B;  3HKD A;  4EEQ A;  1N34 H;  3BHP A;  4AQY H;  4RAZ A;  3ETQ A;  3FFQ A;  2VQF B;  1Q8I A;  3M7M X;  3RJ0 A;  4WBN A;  5GON A;  5IWA B;  4PDB A;  3HKC A;  3KAJ A;  3HKB B;  5LOV A;  4LSA A;  1G6U A;  5K1P A;  1M0W A;  2ZNI A;  1CKN B;  1IBL B;  3TY5 A;  3U10 A;  5KHG A;  2HHH H;  4X1Y B;  4DUZ H;  4LFB B;  3T1Y B;  4LMY A;  4KL1 A;  3RYI B;  3K5N A;  5IJ9 B;  4E6N A;  3N44 B;  4DV5 B;  3RYF B;  1FFX B;  4L8J A;  3JSL A;  4MTD A;  4O4L A;  5K1X A;  4DV5 H;  4PI0 A;  4JI1 H;  2R9A A;  4DR6 H;  4I55 B;  3VQY A;  1HNX B;  1TA8 A;  3N2G A;  5JH7 A;  4CS4 A;  5FPO A;  4YY3 H;  5LXT A;  4DR5 H;  5LXT B;  3FMA A;  4DV6 B;  5JCO A;  4JI2 H;  2Q2T A;  3MAQ A;  4YJ2 B;  5BMV B;  4LF6 H;  3N2G B;  3JAK B;  2HIV A;  5C8Y B;  2GV9 A;  1N32 H;  4HBN A;  2ZJT A;  4BWA A;  1N34 B;  2F95 B;  4CS2 A;  1MZB A;  1VF7 A;  3N2K B;  3JAR A;  5JCO C;  3WB2 A;  5LYJ A;  4EQ5 A;  4LFA H;  1HNZ H;  4D7T A;  4B3T H;  3S24 A;  5KHK A;  4X66 B;  2HVR A;  1IBK H;  1Z5W A;  2IM9 A;  5LA6 A;  4BW9 A;  3SJB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...