3BA8A

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA ligase
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba8A02
2Q2UA 2CFMA 4X65B 4JI2B 4YY3B 1TAEA 4EQ5A 4LFBB 3NC0B 1J5EB 4NXNB 2VUGA 3KYHC 4DV5B 4LF9B 4DV1B 1CKMA 4DR7B 1IBMB 4DV3B 3S24A 3OTOB 2UXDB 4JI5B 5IWAB 1CKNB 4LF5B 4LF8B 4GKJB 4KHPB 2F4VB 3SGIA 4DR5B 4EFEA 3W5OA 3PN1A 1N32B 2UU9B 4B3MB 4GLXA 4DR1B 4PZ6A 1XNQB 3VNNA 3UQ8A 4LF6B 1FVIA 3NBYB 4DR6B 2UUBB 4UCTA 2HVQA 2HVSA 4B3SB 4JI7B 4LH7A 4JI4B 3RTXA 4UCVA 5D1OB 4JI3B 1ZAUA 4TOIA 4YHHB 2VQEB 4JV5B 2VQFB 3JSNA 4JI6B 4EFBA 3GB8B 4NXMB 2UUAB 4DRFA 1IBLB 1XMOB 2HHHB 4DR2B 4JYAB 4DV7B 4K0KB 4CC5A 1P16A 1VS0A 1XDNA 4DV2B 3W1GA 4JI1B 1HNXB 1A0IA 3BABA 1XNRB 5FPRA 4B3TB 4DR4B 4X66B 4CC6A 3NBZB 2ZM6B 5LMUB 3W1BA 1N33B 3RR5A 1V9PA 4UCRA 4DV6B 1XK5A 4DUYB 4LFCB 2UXCB 4DV0B 4X62B 1HNWB 5D1OA 5D1PA 1HNZB 4DV4B 1CKNA 1TA8A 1N34B 4LFAB 1CKOA 1S68A 4AQYB 3GJXB 4GKKB 3JSLA 4DUZB 1I94B 4DR3B 1X9NA 1N36B 5FPOA 4UCSA 5DISC 3T1HB 4PZ8A 3BAAA 1HR0B 2OWOA 4PZ7A 3BA8A 2E5LB 1FJGB 4UCOA 4UFZA 2Q2TA 1XMQB 4LF4B 4OX9B 2UUCB 3TY5A 2HVRA 5BR8B 3L2PA 3TY9A 3TY8A 3T1YB 4UCUA 4X64B 1IBKB 4LH6A 1B04A 1P8LA 4B3RB 3GDEA 5LMNB 2HIVA 4E6NA 2HIXA 3QWUA 2UXBB 4JI0B 4LF7B 4EEQA 1DGSA 4JI8B 3BA9A
chains in the Genus database with same CATH superfamily
4FLYA 5KFZA 1VQNV 1U96A 2V9WA 3AG1C 3Q4HA 2VQDA 3G4SV 1VARA 4PBCA 2X6AA 3FB5C 3SE7A 4MA0A 3JD1A 4FPPA 3EHBB 4RUAA 4A3GG 3JCUZ 2Q0OC 3WNZA 4O4JF 4DV1B 2P4KA 3N2GB 1ZUQA 2QKSA 3RB6A 5LOVF 5HNEA 4O3QA 4I4TB 5KFHA 1JR9A 3CCSV 4FLVA 3RIZA 2N04A 2VS0A 1DLBA 4DW0A 4EFEA 3AK2A 2YIAA 5DGAA 4DV0O 1HNWO 4FFBA 4CS4A 3NXSA 4PJ0Z 2D3OW 4ME6A 3K0DA 2R72A 4IZOA 3K5OA 4RU9A 2QKCA 1E4FT 5K2MA 2UUAO 4U7OA 1QNMA 3IC7A 1AR4A 2OCHA 1EKFA 2ZD9A 1M56B 4DV3H 1TVKB 4KP4A 2VUMA 2EZOA 3STZC 1Y1VA 4QW8A 5EOYA 3KAKA 4KHPH 5FL7G 2CTPA 1QVGU 1RYSA 5L3BA 4CMFA 1TUEB 4DV6O 4ED7A 2EJ7A 4NZOA 3TY9A 4CC5A 4CZZA 3CHXA 1LR1A 1XOUA 1ENVA 2UXBO 2JA7A 1C30A 3CD6V 4I55A 4YJ3A 2MK3A 4JYCA 5J2UB 3T99A 1Y1WG 1SCUB 3TW6A 4CC6A 1RP3B 1G6UA 5B1OA 2HVJC 4RAYA 3JAMW 1HNZH 1FPOA 4RO2A 5JH7B 1EKPA 3RGZA 5KFIA 4NXNO 4ICGA 1H8EG 4DV0B 2CH7B 5GONA 1HNWB 2HDKA 4HQ6A 2JJ2G 3W7TA 4AQYB 2WAMA 4X20B 1YZBA 1BE3H 1JXLA 5LHGA 4MV3A 5JWPA 4UCSA 5K1XA 3OW2U 1VF6C 1FFXA 1JLLB 2W9AA 3Q4HB 4MV1A 1IYEA 1DIKA 2JK5C 3U11A 4IIJF 2IP4A 2X6CA 1K33A 2OIEA 4J9OA 2DYSC 2QWPB 4TUYB 5H2FZ 3J80W 4J10A 4JI2O 4KL1A 4X62H 3TQ1A 4G27B 4C7UA 3OE7G 3OM3B 3ETDA 2UUBO 5EC1C 4ECWA 2EIJB 1P8LA 3QQMA 1KMIZ 1FS0G 2EIYA 4LF9O 5JCOC 5H6RA 2UXBB 3HO8A 3QWUA 5HV6A 5DMXA 4H44B 4DIMA 2CGOA 2WLKA 4LP8A 5J2TF 4FFBB 2NVYA 2Q7HA 5IDJA 2Q7DA 5C3EG 4KXRA 3RF2A 3B8MA 1I0HA 3RN4A 3ASOB 3WU2Z 2KB1A 4YXWG 4NXNB 2XIGA 1EUCB 4GC7A 5KFBA 1BQZA 4DK0A 1Q82W 4J42A 4I5SA 3PW2A 3D3IA 1M0TA 2FL4A 5KFJA 2FB5A 4TWKA 3H4DA 2YIBD 5B66Z 1B6RA 1AP5A 5KS8A 4J9RA 1RK6A 1VQLV 3R5FA 4Q0YA 5JVDB 5ITZA 4LFBH 1EHIA 2VA3A 2RNBA 1L8DA 4QE7A 2V5AA 3U55A 2UUBB 2W7OA 2FLLA 3OUUA 2EJ0A 3G80A 2R7LA 5LL6Y 2LGQA 1L0NH 3BACA 2ZE5A 5KUKA 2HG5C 4X89A 2RDJA 2EINB 2E76B 4GCZA 2WB1E 1OCCB 3K03A 3VQWA 4DRXA 2ETNA 3GIKA 4LWSA 4I4TF 3SJAC 1L1FA 4DV7B 5C8YA 1WH2A 1UC8A 5LGTA 3GIIA 3STLC 1I7LA 4A3MG 2EJ3A 3OSPA 3ZIAG 4LF7O 2R7MA 4MTDA 3A0HZ 3ABLB 4DL4A 4P9OA 4BR6A 2E2IA 1WPBA 4UUGA 1B33N 4JI7H 1M57B 4O7VA 3W1BA 2P7TC 4CH6A 3T9AA 2JEIA 3UO2A 4IL6Z 2JDIG 3N42B 4GYCB 5KT5A 2QWNB 5KFLA 5KFAA 5LA6A 2E75B 1Q3EA 4QPJA 3ZHSA 3E22A 2R84A 2CKZB 3VQVA 1MABG 2GDSA 4NB5A 3ZMUA 1V55B 4MVSA 1EN4A 1DV2A 2MCTA 1V54B 3OTOO 3HKZE 1XL4A 4F6RB 5DISC 5IYDG 5CR5A 1H2KA 1K7DA 4PHZA 1N56A 2YIDA 4LNUA 1HR0B 2ZQMA 4O3PA 1K83A 4ETSA 2BQUA 2ZDHA 4UCOA 3WWHA 4B3MO 2BSKA 5JQGF 3V6HA 2B9ZA 4E4EA 3TY5A 1I5YA 5J2UF 5FD6A 1EKVA 4DW1A 4GC6A 2Q6AA 1YEWA 2RGVA 2AGPA 1SEIA 5DG9A 1URFA 1R73A 5KFCA 1NZ6A 1XI1A 4YAKB 5JH7F 4LF7B 1LUWA 4A5UB 1THZA 3MDSA 3CCVV 2CFMA 3JD2A 4O4HA 4MVQA 4FM9A 5KX5B 1TAEA 3HBLA 3MHSC 3JATB 3NGDA 4R7CA 3SDLA 4PDVA 3PO3G 4IHJB 5KFNA 3OMIB 1CKMA 3AK1A 1KUTA 3OTOB 4JI5B 3LDEA 2F4VH 1YF2A 2CTRA 3U0GA 3R23A 4TUYF 2IA6A 4DUYO 5DLFA 5DQIA 3JCZA 5C8YB 4B3MB 5LL6b 3VNNA 3CRAA 3N44B 1GO3E 3BEHA 2VWKA 1VF5B 3JZIA 3RUPA 3F8NA 3LQSA 4WHXA 4DV1H 3KZIZ 2W6PA 4QIWE 2VWJA 5C1PA 4JI3H 3K3VA 1M56C 3WO1A 4O7ZA 2WA3A 1FJGO 5I5UA 1KJJA 3V4SA 3JRXA 5LA6B 2ZDIA 3CC2V 4EGQA 1VQMV 3THOA 3JAWB 3H1JH 4AYBE 1XMOH 2COJA 4AHCA 5IJ9B 4RUFA 3OR6C 4X64O 1PD3A 3HKBB 3SPCA 1P7BA 4JI1B 2YL2A 4R50A 4LNUB 4YQWA 4I7ZB 3BABA 4J9PA 2W0XA 4MA5A 4NTXA 3S3WA 2CNQA 2Z02A 5JVLA 3UCSC 4O3RA 5JVDF 5LBQA 2BSKB 1BHBA 1PX2A 4YJ3F 4DUYB 1I08A 2EX3A 1Q86W 5E25A 2WB1A 3SPHA 4WFBV 4DV4B 3FYEB 4NYEA 2OCCB 5I47A 2YSUB 2QEXV 1S0OA 1SFOA 4R6ZA 4A3KG 1Y1VG 2DJVA 5FPOA 1ULZA 2YUAA 1DF4A 4I9WA 3OT7A 1AJNA 1N4CA 2JGDA 4PZ7A 3BA8A 1YDXA 1MG1A 3VBBA 1Z5WA 1FJGB 4FM1A 3B40A 5AG2A 1IZ3A 3J7AU 3LWBA 5E1AC 4Q6GA 4ZI7A 2YICA 1HNWH 1DTOA 3B77A 1IDSA 4WFGA 1Z5VA 2PY5A 2NU7B 2P0AA 4U7CA 4X64B 2BR0A 4B3RB 3EYYA 4AQYH 1EZVH 1CE8A 2P6JA 3V6KA 2YEVA 3TK1A 4JI4O 2R93A 4CHIA 2R86A 3HKZA 2ZCEA 3R5XA 4UV8A 4JV5O 4ZBMA 2EJ2A 2IJKA 3JASB 1GLVA 4BBRG 2Q68A 3F7YC 3ETGA 2P22C 3HB9A 1EZJA 3P32A 4NKGB 3GWKC 3K04A 2F93B 3BG5A 4WBNA 2JEJA 2R7NA 3ORQA 4R8CA 3T54A 4LMYA 3PR5B 1DK1A 5I5TA 2RJZA 1GKFA 3FB8C 5GTIZ 1K4CC 1GN4A 2XGQA 2R9IA 5L3FA 1VF6A 1HNZO 4YIOA 2JEXA 3TEKA 1PKXA 2YC0A 1WNSA 4O4JA 4PDMA 5LHIA 3WWIA 4WFAV 2CK3G 3U54A 2HVSA 5KHIA 2R8KA 3RFRA 5KX5F 2AGAA 4JI4B 5LGNA 1PM9A 4RUCA 1XBLA 5EIBC 4F6EA 3FX7A 2HHFA 5BWTA 4MVMA 1ROPA 1AB3A 4JV5B 4IHJF 4DXWA 3LDDA 2QGNA 4LBEC 2XAGA 2DWCA 2W70A 3ABKB 3JZ6A 4TQSA 1NVPB 5FNVB 2DAAA 1EUDB 4PDRA 4X62O 2BCCH 2X5RA 3R5HA 4HBNA 3FAVA 1XNRH 5CA3A 1S5HC 1S5JA 4NTWA 4DL3A 2UUBH 4QGPA 5IP9G 5C8YF 2LFSA 3ABLC 2XASA 4O7WA 1PNMA 4ZI7B 3EPGA 4X1KA 2GBOA 3APOA 1M57C 3RR5A 4QIWA 2C2DA 5EBWC 3U9SA 3RB4A 2Q7GA 4MVOA 2HR3A 1HNZB 4U3JA 1AR1B 3K57A 4AYBA 1K97A 4TV8B 1PV0A 1LNQA 3AG4B 2FK3A 1ZWIC 3HOWG 4DV7H 3OD4A 3BQ2A 3CCJV 1XL6A 5LA6F 3T9CA 2GTAA 5IYBG 3HPLC 1AUVA 5EYPA 3OUZA 5EWEA 4ZQIA 5L3GA 1HP8A 3DC5A 3K79A 3PFFA 2JVDA 4F4ZA 2Q2TA 5FJ8G 1NTKH 3KHLA 1AJQA 4EEYA 4EKWA 1Z2NX 3KHRA 4WBNB 3VPCA 2FJZA 4GZRB 2ZDQA 2HVRA 5KFMA 2XTAA 1JDBB 1QR8A 4QE9A 3OSNA 1OCZB 1OV9A 1XEQA 4FIPC 1XUQA 1SKVA 2RMKB 3AW8A 4XYMB 4LSXA 4JTAB 4IRKA 1OCOC 3QZ8A 2YXLA 2ZNIA 4ED6A 4C5AA 4R8UA 1SQXH 1D5AA 2RQ6A 1M7JA 4A3CG 4RWUA 4YHHO 1NVPD 3L9DA 1S3JA 1HR0H 2GLTA 1SRYA 2CTQA 2JA6A 3OTFA 2OTLV 4K8ZA 2M6YA 3K9AA 5CA1B 4P9PA 2CGNA 1D2DA 1W59A 4DV2O 2Q5ZA 2FKLA 2A06H 5B1AB 2J6TA 1YITV 2DYSB 3OHBA 3LUTB 2Q69A 4X1IA 1ZL8A 2AZ0A 4QW9A 2HHFB 1ZTEA 1M4UA 4FFLA 2Q4PA 4TQFA 1F7YA 1HW7A 5J2TA 2ZJTA 1SQPH 1BT8A 5F9NA 2A79B 4QWAA 3F7VC 5KHKA 5DQGA 3RYHB 3MR6A 4ECZA 4NVPA 5EC2C 2QR4A 4UB8Z 2DQ3A 2ZIOA 5DM6V 4DUZO 1ZSPA 1TWHA 2FMAA 4ECYA 4UCTA 5CN0A 1IXBA 4J9LA 2M7WA 2ZGIA 2R7ZG 4TVIA 1H2GA 4Q20A 5I5XA 3RTXA 3DTGA 4JYYA 3CYOA 4JI5H 4JUZA 3HOXG 4OX9O 4YHHB 4FZ1A 4U3JB 2DLNA 3OHAA 2VQFB 4N21A 4MV7A 2HHHH 2A1HA 3ZMTA 3ABUA 2Q67A 1WPXA 2IH3C 4DV2B 5EYPB 4ZOLA 3M9OB 4DR4H 4FMTA 4J41A 3I56V 3RB0A 2P67A 3JRWA 5J9PC 1QLEC 1GM8A 2IBZH 4ED1A 1XK5A 1PP9H 2HGSA 2N05A 5D1OA 4UB6Z 1OHHG 1XDCA 4J11A 4DUZB 2W6NA 4RNMA 2R8IA 4JI1H 4QPKA 2C2RA 3RAQA 3K0GA 4NLGA 2F4VO 4AILC 2XGPA 3K3PA 5FNVF 4DR1O 4OX9B 2E74B 3OGIB 4FLTA 5KG1A 3UFXB 1GRJA 4A3JG 4B08A 3TETA 4IR9A 2IW5A 4RZQA 4DV4H 1RFYA 4J7KA 3SPGA 4ZI7F 4GX2A 3ABMC 2ZINA 3ML0A 2CW8A 4I0XB 4GT1A 3MR3A 3KREA 2ZNJA 1R3LC 5KT2A 1S9FA 4MTFA 4JI3O 4CS2A 4O81A 4EB6A 3M9NB 4TV8F 3JAKB 2PYJA 3AEIA 3ETEA 4LSAA 3GWOA 3C0FB 3H20A 2ILMA 3MHHC 4F4WA 1SERA 1XMOO 1JDEA 5J2UA 3MWDA 2YZGA 3TIIA 1QBZA 4DK1A 3HKDB 4LR3A 3ZRVA 5DQHA 3PW7A 2QWRB 4B3RH 3R66A 3A0BZ 1JOYA 5TISZ 4LF8H 1GSOA 1GMGA 3J81N 4WBNF 4FFKA 3KXYT 2CH7A 2YIBA 2NNUA 5KFGA 2B5UA 2AHZA 4DL6A 3SJBC 3X2QB 2F4VB 4X20A 2J9GA 4G3IA 1SQGA 3PN1A 4XZ3B 4DR1B 1XREA 4ZOLB 4BIUA 1UFIA 4DR6H 3H1KH 2W6QA 2R93G 1NTMH 5KHJA 5JJJB 3ETJA 3JALB 4J7JA 1F4MA 3B09A 2GPWA 5KG4A 2ZXWB 3ZMVA 4RAIA 1ET0A 2PVPA 4LH7A 4BW9A 3GIMA 5CA1F 2LJ2A 4TUYA 4M9UA 1DV1A 1GYFA 5D1OB 4JI3B 4MTGA 1MA1A 2Y48A 4U6PA 3K9SA 3N41B 3T5HA 4D7TA 3VA7A 3C3TA 3NR7A 3GB8B 5BYAA 1IBLB 1XMOB 2W7PA 4HNAB 2W6OA 3ABKC 4A3DG 1QR9A 2EIMB 1NT2B 4P2ZA 2IH1C 1H8HG 5B3SB 4L1KA 3QG5A 4AQYO 1QU7A 3K59A 2XCPA 3K58A 3WG7C 5KFXA 2A0LA 2COGA 3KHGA 1AI5A 4JI4H 4DAAA 1GO3F 4JZ2A 3OUSA 4CE5A 5KFWA 2BQ3A 4JV5H 2PZSA 4XDKA 4DV5O 1KT8A 1WR2A 4QIWF 1WB8A 2CUGA 1EYZA 2NUAB 2CAZC 3L72H 3AG4C 1VQOV 1IBMO 1I6UA 2WLLA 4B7EA 1WP8A 2R8GA 4EB6B 2KKWA 5GW7A 2I8CA 1FYJA 5JVDA 3N8DA 3SR2C 5DGIA 3L4KA 4BWSC 2B1GA 3IN5A 4FM2A 4L8JA 4PD4F 3K3WA 2AGOA 1BCCH 1OCRB 1OCZC 1OJHA 3PW5A 2EILC 5DLGA 1S77D 1KQSU 2RCVA 4YB8B 3ZS8C 4HNVA 4PELA 4EEQA 2IJJA 2XC9A 2ODTX 2OT5A 2WDTA 3E8FA 1NS1A 1NH2B 4FBTA 2H3OA 3H1IH 2MW2B 5FD5A 4LC1A 3AX6A 3LNMB 3T5LA 3Q8RB 2Q8VA 3V4ZA 1S0NA 1Y76A 1EBOA 4DV5B 3RV3A 5B1AC 2FMLA 3RVZA 1IBMB 3DTUB 3NUAA 3RYFB 1XNRO 3QNEA 2HGXA 2ZM6O 3T2MA 5KT6A 5KFYA 3GTOA 4BW5A 3CRRA 1RJPA 3UT5A 5KFKA 1W0JG 3F5WC 4DR5B 4OXSA 4FFOA 1N8RW 4F6RA 5B1BB 4DO2A 5KKNB 5KFFA 4EYIB 3EFFK 1K1SA 4ECXA 1VIBA 4MT8A 3RVYA 1IOVA 2WLHA 1CPYA 4DV7O 4JPRA 2HVQA 2FLNA 4IWYA 2WSSG 5IYCO 4WD3A 3H0GA 4M7EA 5EWGA 2VQEH 2DYRC 4C5BA 2QDOA 2L35A 4K0KH 4PV1B 3T9DA 2WLLB 1VS0A 2GHYA 2ASDA 3K06A 1WCMA 2RDIA 5K1PA 4MTXA 1NH2D 5BWXA 3T9FA 2QK4A 3HKEA 5KFEA 1N0NA 5KX5A 3OFNG 4JI8O 5FPRA 1XNRB 3JATA 3FKIG 4WFFA 1E1RG 1WB7A 4X66B 2ZM6B 4ZOLF 1Y4MA 1Q6IA 2RN9A 1HR0O 4IHJA 3GV8B 4YHHH 4A2BA 1M5IA 2K1EA 3PW0A 3GV7B 5D1PA 2VQFH 1K4DC 1I94H 3CCRV 2AHYA 2YZLA 4DQNA 1Q6HA 4DV2H 4ECVA 3RBDA 4IR1A 4WFEA 5CB4B 1K9MW 2V59A 1OBDA 2I87A 3HR0A 1AR5A 1I7FA 2QWQB 3RGBA 4LF4H 2IJHA 4XDLA 1WJZA 1H2LA 1DF5A 1O75A 1XMQB 3MAQA 1Y76B 5DGBA 4QJFB 4GX0A 4PA9A 2Q73A 4ZKIA 2ITDC 4RQEA 5KT4A 1WP7A 4UCUA 1TWAA 3AK3A 1B04A 3M8AA 2VR1A 2YS8A 4B3SO 3UT5B 4JXUA 2FK1A 4DUZH 1KBHA 1AUXA 3JAWA 2WE6A 4J9YB 4MW8A 4H33A 5IJ9A 4JI8B 4JI5O 3HKBA 4F4LA 1VQ7V 2QYZA 4HNUA 2HHHO 4OX9H 3G6XA 4A93G 1TWGA 3ZHUA 4DR4O 5EIBD 2W6IG 4B3TO 5L1JA 2Y4TA 1CQJB 1CKNB 2DZDA 1N33O 1OCOB 3SYOA 3L73H 2P06A 4LFCO 3X2QC 1EN6A 3HOUG 4G2KA 3GIJA 5F9LA 1ZLZA 1SQFA 3TGUH 4MTEA 1TWCA 1YVWA 1QVFU 2YU9A 4O2BA 3HKEB 5CE8A 3VQXA 4F4XA 3L70H 3JD0A 1K34A 4JI1O 1Z2OX 4B3SB 4CBCA 2ZXWC 4QNHB 1MZEA 2PGGA 2AXTZ 2P5OA 2LP7A 2ZIMA 2HKOA 4CH3A 1KEEA 4BIOA 1RSOA 2LW7A 1JX9A 1NR1A 2Y0IA 1G1XB 1JX4A 2HHHB 4DR1H 3MD0A 2C2EA 1XILA 4MSWC 2Y69C 1EZ1A 4DV4O 5KFTA 2EIMC 3L71H 3KG2A 2RF4A 5HFLA 1GSAA 5B3SC 3W7UA 3G71V 3VOUA 4O3OA 3JASA 3CPWU 4ECUA 1FXHA 4O7TA 3BY6A 1GN3A 4B3TB 4DR4B 2JEFA 3RYIA 1B3QA 5CBFA 5LMUB 3K08A 1N33B 3CEBA 3RB3A 5KFDA 2UXCH 1E1QG 4APMA 4Z1MG 4LFCB 5HFMA 3W7XA 1C3OA 3ASNB 4PWQA 2P4VA 1AI6A 4MAMA 4CMDA 3ZCCA 1CKOA 3P3NA 1NU1H 3I4MG 3SYPA 1IBLH 4GLWA 4O7NA 3LSSA 2JEUA 2HGWA 1K3EA 2N74A 2O57A 5BWVA 2R92A 3T7AA 4B3RO 4LF8O 2A3QA 1E4EB 4JV2A 2XAJA 3GIDA 5KMGB 3WB0A 4TQRA 3CE2A 1EN5A 5H9CA 5IE9A 5BR8H 1PPJH 4PA4A 1QLEB 3E8BA 4B7KA 3MR5A 2KG7B 3JD3A 2W9CA 2EBOA 4DL5A 3L2PA 3AG3C 4DR6O 2W71A 4ABMA 4LH6A 1IBKB 3W7SA 1OCRC 4MVRA 5A9GA 4E6NA 5DG8A 5CAEB 2DW4A 2DN9A 4FS1A 2VUMG 2EIKC 3LDCA 2JA5A 3BA9A 5FNVA 5LYJA 4HN2A 3W7WA 3GTJA 4O2BB 2ASLA 3N40P 5CB4F 4JF3A 3UZOA 4IAJA 1I1LA 4P30A 1R6KA 3M7MX 2HLDG 5F2VO 2V58A 2JA7G 2VPSA 1MZFA 1Y67A 1VEWA 3CWBH 2B63A 1QHTA 3GTKA 3ABMB 5L3CA 5I5YA 2GSMB 4LF8B 1RSOB 1JCHA 4TV8A 5DG7A 1E79G 2OLSA 1D5NA 1NR7A 2ZE6A 1P4RA 3ETHA 2R9RB 5C93A 4HNTA 3FFQA 1KJIA 2UVWA 5CA0A 3UQ8A 1AP6A 5B1BC 1SF9A 4RB0A 3H3VH 2BOCC 4NR1A 1FVIA 2PF4E 3RFCA 4DR6B 4DV5H 5IJ0A 3RYIB 5BWWA 2X6BA 1BXRA 1SETA 1IBMH 2BOBC 5IYCG 4IT5A 4JAAA 2WYOA 4UCVA 4QWBA 2UUCO 3RV4A 4EFBA 4DR5H 2OH2A 2VPQA 4JV0A 5KA5A 4DRFA 4BBSG 4D7SA 1Q8IA 4DR2B 4E4TA 1IX9A 3D3QA 1NTZH 4W4KA 1Y14B 2W8LA 1MSWD 2YWVA 4HZ3A 1Y74A 4JTDB 5D5QA 3J7AK 4CH4A 1A0IA 3CQZA 4JAUA 5CA1A 4PI2A 5LP6B 2LGWA 2W9CB 4X65O 2WTFA 4J7ZA 1T5EA 1XQ8A 3TJTA 4GX1A 2EJRA 4ED0A 5FLXN 3R9RA 1EM1A 2COIA 4BY1G 3H01A 5JCOA 4C5CA 1TUBA 4TSFG 2ABJA 4DR3B 5IWAO 1JA8A 2R85A 3T5JA 5LYJB 1Y6XA 1IURA 4GKJO 3RYHA 4A3LG 2DPIA 1KP2A 2OIGA 1UC9A 4X66H 3LSQA 2UVRA 1S03G 3RT3C 2ZM6H 3WG7B 4YR0A 3T9BA 4EGJA 2R9AA 1WCMG 2W6JG 2UUCB 1T36A 5K3WA 1E4GT 5KLVH 2VOBA 3SYAA 1KC8W 3TY8A 2UVVA 5I5SA 4Q8FA 4RUEA 1AN7A 3RBZA 2XOKG 1Y1WA 2XT9A 2QA4V 1B6QA 4UV9A 2VQEO 1P84F 4CH5A 2F95B 4H13B 4JI6O 4X65B 2YI8A 5CA0B 3J80N 1FXVA 5H80A 1XMQH 4K0KO 1FKAH 3VOTA 4QWCA 3A8TA 1GGOA 5IJ0B 4FGRA 2NU6B 1H2NA 1T3NA 3IFXA 2Y0PA 5C1OA 5KFPA 3RBEA 2BTOA 1VAJA 5KFRA 1JVMA 3P30A 3HKCA 2EILB 5IWAB 3G8DA 4LF5B 3RJ0A 1S0VA 1YCIA 1B06A 1WA8B 2Q9LA 3ZJZA 2ZR3A 4GKJB 2FTKA 3RW0A 4JI8H 1XNQH 3FB6C 1RYRA 3ZEDA 5KFOA 1GN2A 1VQPV 1X59A 4WF9V 4A3IG 1X4TA 2VQFO 1Y74B 3UYYA 1JJ2U 1I94O 4RB3C 2FPIB 3L75H 3HOZG 4ECSA 4X1YB 4EBEA 4O2BF 1KU9A 1MZBA 1JPXA 3CXCU 4QWDA 3CMEV 4LF4O 2HJWA 2VQEB 4JGSA 2ADQB 1GN6A 4JI6B 4O84A 4I0XA 1RPOA 2PMZE 4NXMB 1TUBB 4K0KB 1YHQV 3I12A 2NR5A 2H8PC 4Q4CA 2R8JA 3JAKA 4U7NA 4MV8A 5CM0A 1FD9A 1VQ5V 5A2QN 4B3SH 4PDLA 3E89A 3I5DA 5IY5C 3CSXA 1V9PA 1JFFB 2DYRB 2IU3A 3HKDA 1BJTA 1N34H 5BMVB 4O7SA 4EBDA 4O7YA 3ASNC 4NZMA 5IT9N 3EPIA 3I4NG 3GTQA 5EK0A 2GUZB 1H2SB 1VBHA 1I94B 2G38A 2UXDO 4FLUA 3T1HB 4ED8A 1M90W 3CB2A 4BIZA 1Z2PX 5C4XG 3E8HA 3H40A 2V7QG 3DGEA 2DABA 2R6FA 3FDSA 4B3TH 2DIKA 4TV9B 4HAMA 4OPHA 3CCEV 5LMUH 4ECTA 1N33H 4LF4B 3CRMA 1ZHQA 3JALA 3DTFA 1R9TA 4N23A 2NLJC 3ETQA 4LFCH 3N6RA 1JIHA 4FFMA 2QF7A 5LP6F 3GTLA 3HKCB 2ALZA 2XAHA 3G8CA 4YBZB 2HIVA 2V1DA 3ZHRA 4O4LB 1M1KW 4HNAA 2R87A 3N27A 1S5LZ 1F23A 4PA7A 1PNLA 4Z2WA 4UVCA 4FU0A 1QQCA 4RCNA 4ED2A 2F43G 3GTGA 4YIPA 3JZFA 5KFUA 2R92G 5DECA 5LYJF 2ODMA 2C35B 4YP3A 2ARHA 4LCUC 2X0LA 3SJCC 2HVKC 3LULA 2PTMA 5LXTA 3RAXA 1BQ0A 1SESA 1IBKH 2UXDB 3G6EV 2CQYA 4J80A 1TWFA 2YCHA 4JTCB 4DYLA 3SGIA 3KCYA 3N2KB 4DL2A 4A3FG 2UXCO 2UXNA 2QSAA 2Y4RA 4LF6H 1WRVA 1VKZA 1RM1C 1JQ0A 1BGYH 1P7GA 3ZRWA 1AI4A 5JQWA 2NU9B 5B5EZ 3NBYB 3U0ZA 3UO3A 1IBLO 5CA0F 3FB7C 1G2WA 3CVZA 4J9NA 1QCEA 3JARA 5JJNB 2Z04A 1BNCA 4O3NA 3CSWA 4J9SA 3VQYA 1MNGA 1KJQA 2QM7A 5BR8O 1I5XA 3H9VA 1XDNA 5IYDO 2VRZA 3CCQV 1S0MA 1HNXH 3CXHF 1GH6A 2B63G 3WWJA 1U97A 3V6JA 5LMNO 2CDYA 3RYCB 2LW1A 5KAIZ 1Q5OA 3WB1A 2DPJA 3TXQA 3GV5B 1AVMA 3B2EE 2J6UA 4YJ2B 5LP6C 1ORQC 3GILA 1W0KG 2YI9A 1GM7A 5LGUA 5BPFA 2UXCB 2E3CA 2W0FC 3RYFA 2ZDIC 3O65A 5JJEB 3GJXB 4DR2H 2PMZA 2FYUH 4DR7O 5IYZB 3QVNA 3JD4A 2YW2A 4GX5A 2Z0AA 2Y69B 1UJWB 4PZ8A 3ZMSA 3E86A 3G6YA 5KG2A 1I3QA 4ECRA 1FXKB 2D2CB 4YAJB 5I5VA 1Q43A 1YJ9V 2UVUA 1BSMA 4KUMA 5LXTB 4O83A 5BR8B 3T1YB 1US6A 2GTSA 4I50A 5L3EA 4JI0H 4MVZA 3WFVA 5LMNB 2HIXA 4DR3H 5D8DA 5BMVF 2ATKC 4A2AA 1R6NA 3D36C 3B8NA 3GTMA 1COWG 2PBZA 2Y0SE 4O86A 4JYBA 3ZRWB 4YY3B 4RQFA 1J5EH 3CJHA 2W57A 4EQ5A 5BY1A 3DXRB 4DR5O 2FK2A 2VUGA 3K5MA 2UUCH 4X9QA 3BVOA 3E35A 4O4IB 1WSCA 3RWRD 1YXBA 3OEHG 3AG3B 4TV9F 3GQCA 4DR7B 2HP8A 3JARB 4F50A 4QSHA 4J9ZB 4Q8EA 4ED3A 3CCMV 1M9NA 3ZX6A 5CMUA 2F23A 2UU9H 2CTWA 2HG8A 2EIKB 1RJQA 4X65H 2WLIA 2ZE8A 5FLXW 5CB4A 3K5IA 3D8CA 5JQGB 1GTOA 4K8XA 1S76D 2WA4A 2V4RA 4RZRA 2XCAA 2FLPA 4O4LF 3I55V 4HR7A 3E83A 3QF7A 1XHZA 2WLMA 2HJFC 2FKXA 3QTCA 1R3JC 5EZYB 4QJFA 3ZN1A 5IWAH 4LF5H 3WO0A 2GPSA 2FPGB 4X66O 4GKJH 4J9QA 1BGWA 5BYBA 3SPJA 2XAFA 2UUAB 1I1MA 2R70A 1DAAA 1A32A 1NQTA 1SZTA 3ZHQA 5FR9A 4Y8VB 4A3EG 1MOFA 1O9HA 1SQQH 4ZIBA 3CCUV 4CKBA 3Q2OA 3G6BA 1GM9A 2QTSA 1Z2GA 4ASUG 2IM9A 1LUVA 4PI0A 5KUMA 3UM7A 4DV6B 1PK8A 3TXSA 2JA6G 5EDWA 2WLJA 2Q0AA 2PUSA 3BQ1A 4GKKH 4I50B 4JI6H 1XMQO 1KECA 1FKAO 1CKNA 1KJ8A 2KQXA 4NXMH 3AG2C 3EVKA 3KAJA 4D6TH 1K8AW 1L0LH 1XHXA 3OMNB 4K35A 2WAQE 1X9NA 2IMWP 1VQ8V 2JGUA 3K5NA 2OWOA 1VBGA 3KALA 3CJHB 4OGQB 5KHGA 4Q44A 5EBLC 1XNQO 2DMXA 1NI8A 3Q8SB 3T9EA 4L87A 3TW7A 3L4JA 4XBFA 4YJ2F 2CW7A 5H5NA 2JJ1G 5DEDA 1M0WA 1MMMA 4YR2A 1ZETA 3T1HH 4A3BG 2WLIB 4BAYA 1CEZA 5EWFA 2FPPB 4JI2B 4I55B 4YJ3B 5IYZF 4TM5A 2QM4A 5L9XA 1SYXB 3NC0B 5I60A 3ZHTA 1VQ4V 4F4YA 4FK5C 4CKEA 1VQKV 4LF9B 2NVXA 4WFHA 4UUJC 4JV1A 5GONB 3AG7A 4J9MA 3WB2A 3CMAV 5A2QW 4EG0A 2DWDC 2QKAA 2CZGA 5LXTF 4CKCA 3CP1A 4ZHQA 1Q7YW 3KHHA 5C5JA 1AROP 2QTOA 3W5OA 1RJRA 2HEPA 3APQA 1FFXB 1SC5B 5IT9W 1XNQB 4LFAO 1N34O 3IAYA 1FAFA 5L1IA 3HOYG 4XDJA 2Y0SA 1E4EA 3GTPA 1GK9A 3CRCA 2NU8B 5BPHA 4RNNA 5KAFZ 3SNOA 3ORRA 4FZ0A 5KMGA 1VF7A 1TGOA 5E79Z 3BQ0A 2IJIA 2M05A 5DGHA 4PA3A 1IYDA 3SPIA 4Q4DA 2KG7A 1QLNA 2YS6A 2UXDH 1CXZB 1FFTB 4O4IF 4TOIA 2GQSA 5LMUO 4FFNA 2PI4A 4QWEA 1SS3A 3CC7V 1Q81W 3FD9A 5IYBO 3MWEA 4GUNA 1V4YA 3W1GA 3LMLA 2GV9A 5L1LA 4IYIA 1I1KA 3U10A 2HFEC 3CCLV 1GAXA 2XCLA 5KFVA 5BZBA 3NBZB 1K73W 2OYQA 1A3GA 3HXLA 5DAAA 4JZGA 2DE0X 3ZHVA 3CEIA 4UCRA 1A48A 1M6VA 3SJQC 2J6SA 2NN4A 2ASJA 1HDJA 4BY7G 5DN6G 3IC9A 1VQ9V 1L2ZA 2ITCC 2WLNA 1N34B 1AI7A 4LFAB 5EZYF 4I7HA 3KKYA 2W6ZA 3TIGA 2DQ0A 1N0JA 3E2EA 1W2BU 3MFIA 4RB2C 2AW9A 2E2HA 3QZ7A 1IBKO 2R7ZA 5ITZB 2E5LH 2F1MA 3L74H 5CBGA 1BL8A 5D5PA 1KTAA 1KYOF 1N32O 4IYHA 4UFZA 3ZRSA 4R7RA 1ZHSA 1FXKC 5IY5B 1KC7A 2YXYA 4LF6O 1KB9F 5EBMC 1RK5A 5KG6A 4MS2A 2IBKA 4DRXB 2ATLA 3GIQA 4ZHQB 3B4SA 4LWSB 1K5SA 2WAQA 4I50F 5CBHA 1DGSA 1ZQ7A 3O9OA 3J81W 2Q2UA 2EULA 3OR7C 5T14A 1P49A 4O3SA 4JYAO 3T4DA 3E5NA 2W6MA 4FS2A 2YZMA 5LP6A 1HNXO 3PVXA 1VQ6V 4NZNA 3OGCC 3T1YH 4X8AA 2JS3A 3E22B 4UVBA 5LMNH 1J95A 1CS0A 2R8HA 3QO5A 1WLEA 1N32B 1UNNC 2W8KA 2PI5A 4GLXA 3OAAG 4YY3H 2YRXA 4E2LA 4FM0A 5HBRB 3ZN0A 4LF6B 1Q90D 2GQRA 1N36O 4DR2O 1W93A 2Q7EA 4K6NA 4I55F 1SA0A 4DR7H 2V4DA 3PO2G 2CNUA 4RAZA 4O2AA 3JSNA 4RNOA 5GONF 2YDEA 3BFRA 4PDBA 4JYAB 2B1IA 2YXHA 4U3FH 1P16A 5JUMA 1KBLA 3D36A 4Q43A 1RM1B 2A7WA 4FJCC 4O4HB 1HNXB 2PN1A 4J0MA 4JI0O 2VA2A 3PR4A 2F66C 4H0LB 3MJFA 5H6QA 4DR3O 2V4QA 2JA8G 1OBGA 1VP7A 3GVMA 5KA6A 4DV0H 1HWYA 2AQ4A 4YR3A 3CS5A 3CC4V 1PL0A 1I2KA 4MV4A 1J5EO 3ICXA 4O7LA 2EIJC 5KT3A 3M99B 1TA8A 2UUAH 4RB1A 1WA8A 4DV3O 4TT3G 3N43B 1N36B 3ABTA 3QFFA 4KHPO 3H4BA 1YJWV 5BWRA 4BXXG 4BWAA 3KCXA 3F5TA 3ASOC 1Q6UA 4I9QA 1I50A 2UU9O 3C3SA 1S72V 4DV6H 3RGXA 1I2LA 4X1YA 2Z3YA 2BTQA 4PA6A 4DL7A 4ECQA 1VMGA 2UXBH 1O9GA 3HB3B 3Q8QB 3CX5F 2L6LA 4JI0B 3H0GG 4FLZA 2P90A 2OTJV 3OUFA 1BS3A 1WN7A 3AG1B 4G28B 4X88A 4LF5O 3T5KA 5KG7A 4NXNH 3VMMA 3JAMN 2JS5A 1R3KC 4MTOA 3QO7A 4KFMA 1J5EB 5LOVA 3BCCH 5BWUA 2YYAA 5C44G 4EBCA 4UXNA 1SA0B 1S97A 3FMAA 4FFPA 3PZPA 1JFFA 4DV3B 2CE4A 2EINC 4W4LA 4O82A 3T1CA 4O2AB 5BMVA 5KG0A 1OCCC 4M0JA 2K9PA 4MVUA 1V51A 3OMAB 1ZX3A 4KHPB 2GUZA 1F51A 2XHBA 1N48A 1H2MA 1G8MA 1BHAA 1K92A 2UU9B 1PL4A 2Z5UA 4MV6A 4PZ6A 1I7NA 4JI2H 4H37A 4ZHQF 2JGDB 1JKJB 4GKKO 5L1KA 3SYQA 3TQTA 5KG3A 4NXMO 4TV9A 3OEEG 5KG5A 4LF9H 3A2FA 3UZBA 1BZKA 5KFSA 2QE7G 1KUQA 1ZAUA 4NYKA 1K1QA 1R6TA 4K3AA 2RDCA 2YEVB 2DOSA 2JEGA 3H1LH 2IU0A 4IRDA 3HT5A 1V55C 2LQTA 1NKDA 1V54C 4Z1VA 3SYCA 2PYLA 2FP4B 4O4LA 2C28A 1AJPA 2C22A 5KFQA 3R65A 5B1NA 3JYCA 3TCUA 1A0GA 2X0SA 3T1HO 3TINA 2ZKOA 1AILA 2BTQB 4LFBO 4IRCA 3K5LA 4X62B 3FYIB 4XYLB 1KKCA 3GIPA 1KKDA 4GKKB 1M93A 1MSDA 3K5HA 3N2KA 2BE3A 4O7RA 4IIJA 3IGAC 1YSCA 5GTHZ 2R82A 4O4JB 5L3DA 3C90A 4AI8A 3N6XA 5LOVB 3MWMA 4O4HF 1W96A 3BPZA 1NJIW 3Q1KA 1S10A 3BJYA 2ZR2A 2ADPA 4MV9A 3A0RA 2AU0A 1CP9A 1R3IC 4LFAH 2YRWA 3PJSK 2YS7A 4JI7O 4FLWA 3AG2B 5KT7A 4LF7H 3AYHB 4FBUA 2R7KA 3E8GA 2XNDG 3FKIA 3FKSG 2JIZG 3ZBHA 3FAVB 3MR2A 2O03A 3GLKA 4IGGA 3RYCA 1SQBH 4LFBB 5KHHA 4IWXA 1H38A 4FVMA 3KYHC 4X1KB 3VPDA 4EYHB 4YJ2A 3OTOH 2ZT9B 1SQVH 3GB7C 1OWTA 1G4YB 3BRCA 1UPGA 3S24A 3SI8A 4Q45A 4WCEV 3ZRXA 1A9XA 2KSWA 3EXAA 3P3PA 4B3MH 4UVAA 5IYZA 1R1BA 1B6SA 1PNKA 2W9BA 3UKMA 4JAVA 2X7RB 1YTFB 2QWOB 2ZE7A 3ZMZA 1JMKC 2FB9A 2UXXA 2HJDA 4TQDA 2C00A 2SCUB 1FXKA 3IG0A 1NBMG 4FLXA 2YZNA 4JI7B 4OPAA 4HYKA 3DAAA 3N2GA 2XUMA 1YJNV 2E5LO 2C2AA 1YIJV 1OZ0A 1F4NA 4I4TA 5IP7G 3Q8PB 2LO1A 3BHPA 1KJ9A 2ZDGA 5I5WA 4CS3A 2OCCC 4R8UB 1N32H 4J9KA 1CQIB 1RPRA 4O2AF 1SZXA 3T4ZA 4IIJB 3PW4A 2RGRA 2Y4UA 3DSQA 4FE2A 1K5QA 1WAZA 3HOVG 4DLKA 1IVSA 3DXRA 2JA5G 1GSHA 3IJ4A 3VPBA 3LP8A 4DUYH 1IOWA 4X1IB 1ZL8B 4O4IA 3M4IA 2JRIA 2WWWA 1TVKA 3G67A 3H1HH 2XD4A 3DF7A 3LSUA 1KD1W 5J2TB 1EFRG 2QM8A 1S68A 3MFHA 4DV1O 3U9TA 3JSLA 2QB5A 4C2MA 3M9MB 4JYAH 3T1YO 3DC6A 4FFRA 4XX0B 2QJ1A 3BAAA 5JQGA 2WPDG 1YTFD 4HYOA 1FJGH 2E5LB 1YI2V 2H94A 1Y66A 5LHHA 1IXMA 3QO8A 5FLMG 2A9HA 2KSDA 3G6VA 3KTMA 1KP3A 4X64H 2LFRA 5EZYA 4YY3O 2I80A 4NTYA 5JH7A 2CNVA 1T94A 2XAQA 3LNNA 3S3XA 3GDEA 1BMFG 2AGQA 2BQRA 1JJOA 5BXZA 3CRQA 1N36H 4JASA 2AZ2A 4MW3A 2EZPA 2W9BB 2DWEC 2FE3A
chains in the Genus database with same CATH topology
4FLYA 5LYJA 4JI2B 4I55B 4YJ3B 3OTFA 4K8ZA 4O2BB 2QM4A 3N40P 5CA1B 1SYXB 3NC0B 4IAJA 3M7MX 4LF9B 4X1IA 4DV1B 3N2GB 2VPSA 5GONB 3WB2A 1QHTA 4I4TB 5A2QW 1M4UA 4FLVA 3RIZA 4TQFA 1HW7A 5J2TA 4LF8B 4ZHQA 2ZJTA 4TV8A 4EFEA 3W5OA 2YIAA 2HEPA 1FFXB 4FFBA 3FFQA 5KHKA 5IT9W 1XNQB 3RYHB 3IAYA 4CS4A 4NVPA 5CA0A 3UQ8A 4RB0A 2R72A 2ZIOA 3K5OA 1FVIA 1E4FT 4DR6B 5KMGA 4DV5H 1VF7A 1TGOA 4UCTA 3RYIB 5IJ0A 1IBMH 4DV3H 3RTXA 1TVKB 2UXDH 4JI5H 2WYOA 4UCVA 5EOYA 3KAKA 4TOIA 4YHHB 4U3JB 4KHPH 2VQFB 4MV7A 4EFBA 2HHHH 4DR5H 4DRFA 3TY9A 4D7SA 1Q8IA 4DR2B 4CC5A 4DV2B 3W1GA 3CHXA 3LMLA 5EYPB 2GV9A 4ZOLA 4DR4H 5D5QA 3J7AK 4CH4A 1A0IA 4I55A 4YJ3A 3U10A 5J2UB 5CA1A 4CC6A 3NBZB 4PI2A 5LP6B 2OYQA 1G6UA 3HXLA 4RAYA 4UCRA 3JAMW 1XK5A 1HNZH 1T5EA 1XQ8A 5JH7B 2HGSA 3RGZA 4DV0B 5D1OA 5GONA 1HNWB 1L2ZA 4LFAB 1N34B 4I7HA 4AQYB 4X20B 4DUZB 5JCOA 4RB2C 1TUBA 4DR3B 4JI1H 4UCSA 5K1XA 1FFXA 5LYJB 5ITZB 2E5LH 2F1MA 3RYHA 5D5PA 4AILC 3U11A 1S03G 4X66H 2ZM6H 4R7RA 4UFZA 1ZHSA 4OX9B 2R9AA 4FLTA 2UUCB 1E4GT 4TUYB 3J80W 4KL1A 4B08A 4X62H 2VOBA 3TY8A 4RZQA 4DV4H 1P8LA 4DRXB 2ZINA 2CW8A 1KMIZ 4ZHQB 3QWUA 1AN7A 5JCOC 2UXBB 2ZNJA 1DGSA 4CS2A 4FFBB 4EB6A 4CH5A 2Q7HA 2F95B 3J81W 2Q2UA 3JAKB 2PYJA 4X65B 2YI8A 4LSAA 5CA0B 3C0FB 3H20A 3RF2A 1P49A 1XMQH 1FKAH 5J2UA 4NXNB 5IJ0B 2XIGA 5LP6A 4DK0A 2BTOA 4DK1A 3HKDB 4LR3A 3T1YH 1M0TA 4B3RH 4LF8H 3E22B 3HKCA 5IWAB 5LMNH 3KXYT 2YIBD 2YIBA 4LF5B 3RJ0A 4GKJB 3SJBC 2F4VB 4X20A 4JI8H 1XNQH 1SQGA 3PN1A 3ZEDA 1N32B 4GLXA 4DR1B 4YY3H 4Q0YA 1X4TA 5JVDB 4FM0A 4ZOLB 5ITZA 4DR6H 4LFBH 4RB3C 4LF6B 1L8DA 5KHJA 5JJJB 3JALB 2UUBB 2Q7EA 4X1YB 1SA0A 4DR7H 1KU9A 4LH7A 4BW9A 2V4DA 1MZBA 4TUYA 1GYFA 5D1OB 4JI3B 4RAZA 4O2AA 2VQEB 3VQWA 4DRXA 3N41B 3JSNA 4JI6B 4D7TA 3GB8B 4PDBA 4NXMB 1TUBB 3SJAC 1XMOB 1IBLB 4HNAB 4JYAB 4DV7B 4K0KB 1P16A 5C8YA 1WH2A 1NT2B 1HNXB 4O4HB 3JAKA 4J0MA 3QG5A 3K59A 2F66C 4MTDA 3K58A 1WPBA 4B3SH 4JI7H 4JI4H 3W1BA 4CH6A 3CSXA 1V9PA 4DV0H 1JFFB 3N42B 4GYCB 3HKDA 1BJTA 1N34H 5BMVB 4JV5H 3ICXA 2PZSA 5LA6A 1Q3EA 3E22A 1TA8A 3VQVA 2UUAH 2CAZC 4RB1A 2MCTA 1H2SB 1I94B 1I6UA 3N43B 1N36B 4F6RB 4FLUA 4EB6B 3T1HB 5DISC 2KKWA 3CB2A 4PHZA 1Z2PX 4LNUA 1HR0B 5JVDA 4BWAA 4B3TH 4ETSA 3SR2C 3L4KA 4TV9B 4I9QA 4UCOA 4BWSC 5LMUH 1N33H 4LF4B 1ZHQA 3JALA 4FM2A 4DV6H 3TY5A 3RGXA 3ETQA 4X1YA 4LFCH 2BTQA 5FD6A 4L8JA 1YEWA 2RGVA 1SEIA 3HKCB 2UXBH 1O9GA 1XI1A 2HIVA 4JI0B 4FLZA 3ZS8C 4LF7B 4EEQA 4O4LB 4HNAA 1WN7A 2WDTA 2CFMA 5FD5A 4NXNH 1QQCA 4O4HA 4FM9A 5KX5B 1TAEA 2JS5A 3JATB 1J5EB 5LOVA 4DV5B 3SJCC 1SA0B 4IHJB 3FMAA 2PTMA 5LXTA 1CKMA 1IBMB 1JFFA 4DV3B 3RYFB 1IBKH 3OTOB 2UXDB 4JI5B 4O2AB 5BMVA 2F4VH 3UT5A 2YCHA 4KHPB 3SGIA 2XHBA 3N2KB 4DR5B 5C8YB 2UU9B 4B3MB 4PZ6A 4F6RA 4JI2H 5LL6b 4LF6H 3VNNA 3N44B 2VWKA 3F8NA 3NBYB 3U0ZA 4TV9A 4LF9H 3A2FA 2HVQA 4DV1H 4M7EA 3CVZA 2VWJA 4JI3H 3K3VA 2VQEH 3JARA 5JJNB 1ZAUA 5LA6B 3VQYA 3THOA 3JAWB 1XMOH 4K0KH 4AHCA 5IJ9B 1XDNA 1VS0A 1HNXH 2PYLA 3HKBB 4O4LA 4JI1B 4LNUB 5K1PA 3RYCB 3BABA 3HKEA 1Q5OA 3WB1A 5KX5A 1XNRB 5FPRA 3JATA 4X66B 3B2EE 2ZM6B 4YJ2B 5LP6C 2YI9A 2BTQB 4IHJA 4DUYB 2EX3A 4YHHH 3K5LA 1M5IA 4A2BA 2UXCB 5D1PA 2E3CA 3RYFA 4X62B 2VQFH 4DV4B 1I94H 5JJEB 3GJXB 4GKKB 4DR2H 1M93A 5IYZB 4DV2H 3N2KA 5FPOA 4IIJA 5CB4B 4PZ8A 1I7FA 4PZ7A 3RGBA 4LF4H 3BA8A 4O4JB 1Z5WA 1FJGB 4FM1A 1O75A 5LOVB 3MAQA 1XMQB 3MWMA 3N6XA 1Q43A 4Q6GA 3BPZA 4ZI7A 5LXTB 5BR8B 1HNWH 2PY5A 1Z5VA 3T1YB 4UCUA 4MV9A 4LFAH 4X64B 4I50A 1B04A 4B3RB 3EYYA 4AQYH 4JI0H 4DUZH 3UT5B 5LMNB 4FLWA 4LF7H 2HIXA 3JAWA 2WE6A 4DR3H 4A2AA 2ZCEA 4JI8B 5IJ9A 3HKBA 1J5EH 4YY3B 2O03A 3JASB 2W57A 3RYCA 4EQ5A 2P22C 4LFBB 4OX9H 5KHHA 2VUGA 3K5MA 2F93B 2UUCH 4FVMA 3KYHC 4X1KB 4O4IB 4WBNA 3RWRD 4LMYA 4YJ2A 3OTOH 1HR0H 4DR7B 3BRCA 3JARB 3S24A 5EIBD 2RJZA 1CKNB 2KSWA 2UU9H 4B3MH 5IYZA 4X65H 5FLXW 1SQFA 5CB4A 4MTEA 5JQGB 4K8XA 1JMKC 4O2BA 3HKEB 4TQDA 3VQXA 1WNSA 4O4JA 3QF7A 3IG0A 1XHZA 4FLXA 2HVSA 1Z2OX 5KHIA 4B3SB 3QTCA 4JI7B 3RFRA 5EZYB 4JI4B 3N2GA 2PGGA 5EIBC 2P5OA 5IWAH 2ZIMA 4LF5H 4I4TA 4CH3A 4GKJH 4JV5B 3BHPA 1BGWA 1RSOA 4CS3A 1N32H 2UUAB 2R70A 2HHHB 4DR1H 5FNVB 4IIJB 2RGRA 3DSQA 4HBNA 1XNRH 1S5JA 1O9HA 2UUBH 3JASA 4ZIBA 4B3TB 4DR4B 3RYIA 5LMUB 4DUYH 4ZI7B 1N33B 4X1IB 4X1KA 4O4IA 3RR5A 2IM9A 3M4IA 2UXCH 4PI0A 1TVKA 4DV6B 4APMA 3DF7A 4LFCB 2Q7GA 2Q0AA 2PUSA 4GKKH 4I50B 1HNZB 4JI6H 4U3JA 5J2TB 3K57A 1CKNA 1S68A 1CKOA 4NXMH 4TV8B 3KAJA 3JSLA 1IBLH 4JYAH 4DV7H 1XHXA 1X9NA 5EYPA 2JGUA 3K5NA 2QJ1A 3BAAA 5JQGA 2OWOA 1FJGH 3KALA 2E5LB 2JVDA 3WB0A 5KMGB 5KHGA 2Q2TA 5BR8H 1Z2NX 4WBNB 2HVRA 4X64H 3L2PA 3L4JA 5EZYA 5JH7A 1SKVA 1IBKB 3LNNA 4LH6A 2CW7A 4LSXA 3GDEA 4E6NA 1M0WA 2YXLA 1JJOA 2ZNIA 1N36H 3T1HH 2RQ6A 1D5AA 2FE3A 3BA9A 5FNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2U A;  2CFM A;  4X65 B;  4JI2 B;  4YY3 B;  1TAE A;  4EQ5 A;  4LFB B;  3NC0 B;  1J5E B;  4NXN B;  2VUG A;  3KYH C;  4DV5 B;  4LF9 B;  4DV1 B;  1CKM A;  4DR7 B;  1IBM B;  4DV3 B;  3S24 A;  3OTO B;  2UXD B;  4JI5 B;  5IWA B;  1CKN B;  4LF5 B;  4LF8 B;  4GKJ B;  4KHP B;  2F4V B;  3SGI A;  4DR5 B;  4EFE A;  3W5O A;  3PN1 A;  1N32 B;  2UU9 B;  4B3M B;  4GLX A;  4DR1 B;  4PZ6 A;  1XNQ B;  3VNN A;  3UQ8 A;  4LF6 B;  1FVI A;  3NBY B;  4DR6 B;  2UUB B;  4UCT A;  2HVQ A;  2HVS A;  4B3S B;  4JI7 B;  4LH7 A;  4JI4 B;  3RTX A;  4UCV A;  5D1O B;  4JI3 B;  1ZAU A;  4TOI A;  4YHH B;  2VQE B;  4JV5 B;  2VQF B;  3JSN A;  4JI6 B;  4EFB A;  3GB8 B;  4NXM B;  2UUA B;  4DRF A;  1IBL B;  1XMO B;  2HHH B;  4DR2 B;  4JYA B;  4DV7 B;  4K0K B;  4CC5 A;  1P16 A;  1VS0 A;  1XDN A;  4DV2 B;  3W1G A;  4JI1 B;  1HNX B;  1A0I A;  3BAB A;  1XNR B;  5FPR A;  4B3T B;  4DR4 B;  4X66 B;  4CC6 A;  3NBZ B;  2ZM6 B;  5LMU B;  3W1B A;  1N33 B;  3RR5 A;  1V9P A;  4UCR A;  4DV6 B;  1XK5 A;  4DUY B;  4LFC B;  2UXC B;  4DV0 B;  4X62 B;  1HNW B;  5D1O A;  5D1P A;  1HNZ B;  4DV4 B;  1CKN A;  1TA8 A;  1N34 B;  4LFA B;  1CKO A;  1S68 A;  4AQY B;  3GJX B;  4GKK B;  3JSL A;  4DUZ B;  1I94 B;  4DR3 B;  1X9N A;  1N36 B;  5FPO A;  4UCS A;  5DIS C;  3T1H B;  4PZ8 A;  3BAA A;  1HR0 B;  2OWO A;  4PZ7 A;  3BA8 A;  2E5L B;  1FJG B;  4UCO A;  4UFZ A;  2Q2T A;  1XMQ B;  4LF4 B;  4OX9 B;  2UUC B;  3TY5 A;  2HVR A;  5BR8 B;  3L2P A;  3TY9 A;  3TY8 A;  3T1Y B;  4UCU A;  4X64 B;  1IBK B;  4LH6 A;  1B04 A;  1P8L A;  4B3R B;  3GDE A;  5LMN B;  2HIV A;  4E6N A;  2HIX A;  3QWU A;  2UXB B;  4JI0 B;  4LF7 B;  4EEQ A;  1DGS A;  4JI8 B;  3BA9 A; 
#chains in the Genus database with same CATH topology
 4FLY A;  5KFZ A;  1VQN V;  1U96 A;  2V9W A;  3AG1 C;  3Q4H A;  2VQD A;  3G4S V;  1VAR A;  4PBC A;  2X6A A;  3FB5 C;  3SE7 A;  4MA0 A;  3JD1 A;  4FPP A;  3EHB B;  4RUA A;  4A3G G;  3JCU Z;  2Q0O C;  3WNZ A;  4O4J F;  4DV1 B;  2P4K A;  3N2G B;  1ZUQ A;  2QKS A;  3RB6 A;  5LOV F;  5HNE A;  4O3Q A;  4I4T B;  5KFH A;  1JR9 A;  3CCS V;  4FLV A;  3RIZ A;  2N04 A;  2VS0 A;  1DLB A;  4DW0 A;  4EFE A;  3AK2 A;  2YIA A;  5DGA A;  4DV0 O;  1HNW O;  4FFB A;  4CS4 A;  3NXS A;  4PJ0 Z;  2D3O W;  4ME6 A;  3K0D A;  2R72 A;  4IZO A;  3K5O A;  4RU9 A;  2QKC A;  1E4F T;  5K2M A;  2UUA O;  4U7O A;  1QNM A;  3IC7 A;  1AR4 A;  2OCH A;  1EKF A;  2ZD9 A;  1M56 B;  4DV3 H;  1TVK B;  4KP4 A;  2VUM A;  2EZO A;  3STZ C;  1Y1V A;  4QW8 A;  5EOY A;  3KAK A;  4KHP H;  5FL7 G;  2CTP A;  1QVG U;  1RYS A;  5L3B A;  4CMF A;  1TUE B;  4DV6 O;  4ED7 A;  2EJ7 A;  4NZO A;  3TY9 A;  4CC5 A;  4CZZ A;  3CHX A;  1LR1 A;  1XOU A;  1ENV A;  2UXB O;  2JA7 A;  1C30 A;  3CD6 V;  4I55 A;  4YJ3 A;  2MK3 A;  4JYC A;  5J2U B;  3T99 A;  1Y1W G;  1SCU B;  3TW6 A;  4CC6 A;  1RP3 B;  1G6U A;  5B1O A;  2HVJ C;  4RAY A;  3JAM W;  1HNZ H;  1FPO A;  4RO2 A;  5JH7 B;  1EKP A;  3RGZ A;  5KFI A;  4NXN O;  4ICG A;  1H8E G;  4DV0 B;  2CH7 B;  5GON A;  1HNW B;  2HDK A;  4HQ6 A;  2JJ2 G;  3W7T A;  4AQY B;  2WAM A;  4X20 B;  1YZB A;  1BE3 H;  1JXL A;  5LHG A;  4MV3 A;  5JWP A;  4UCS A;  5K1X A;  3OW2 U;  1VF6 C;  1FFX A;  1JLL B;  2W9A A;  3Q4H B;  4MV1 A;  1IYE A;  1DIK A;  2JK5 C;  3U11 A;  4IIJ F;  2IP4 A;  2X6C A;  1K33 A;  2OIE A;  4J9O A;  2DYS C;  2QWP B;  4TUY B;  5H2F Z;  3J80 W;  4J10 A;  4JI2 O;  4KL1 A;  4X62 H;  3TQ1 A;  4G27 B;  4C7U A;  3OE7 G;  3OM3 B;  3ETD A;  2UUB O;  5EC1 C;  4ECW A;  2EIJ B;  1P8L A;  3QQM A;  1KMI Z;  1FS0 G;  2EIY A;  4LF9 O;  5JCO C;  5H6R A;  2UXB B;  3HO8 A;  3QWU A;  5HV6 A;  5DMX A;  4H44 B;  4DIM A;  2CGO A;  2WLK A;  4LP8 A;  5J2T F;  4FFB B;  2NVY A;  2Q7H A;  5IDJ A;  2Q7D A;  5C3E G;  4KXR A;  3RF2 A;  3B8M A;  1I0H A;  3RN4 A;  3ASO B;  3WU2 Z;  2KB1 A;  4YXW G;  4NXN B;  2XIG A;  1EUC B;  4GC7 A;  5KFB A;  1BQZ A;  4DK0 A;  1Q82 W;  4J42 A;  4I5S A;  3PW2 A;  3D3I A;  1M0T A;  2FL4 A;  5KFJ A;  2FB5 A;  4TWK A;  3H4D A;  2YIB D;  5B66 Z;  1B6R A;  1AP5 A;  5KS8 A;  4J9R A;  1RK6 A;  1VQL V;  3R5F A;  4Q0Y A;  5JVD B;  5ITZ A;  4LFB H;  1EHI A;  2VA3 A;  2RNB A;  1L8D A;  4QE7 A;  2V5A A;  3U55 A;  2UUB B;  2W7O A;  2FLL A;  3OUU A;  2EJ0 A;  3G80 A;  2R7L A;  5LL6 Y;  2LGQ A;  1L0N H;  3BAC A;  2ZE5 A;  5KUK A;  2HG5 C;  4X89 A;  2RDJ A;  2EIN B;  2E76 B;  4GCZ A;  2WB1 E;  1OCC B;  3K03 A;  3VQW A;  4DRX A;  2ETN A;  3GIK A;  4LWS A;  4I4T F;  3SJA C;  1L1F A;  4DV7 B;  5C8Y A;  1WH2 A;  1UC8 A;  5LGT A;  3GII A;  3STL C;  1I7L A;  4A3M G;  2EJ3 A;  3OSP A;  3ZIA G;  4LF7 O;  2R7M A;  4MTD A;  3A0H Z;  3ABL B;  4DL4 A;  4P9O A;  4BR6 A;  2E2I A;  1WPB A;  4UUG A;  1B33 N;  4JI7 H;  1M57 B;  4O7V A;  3W1B A;  2P7T C;  4CH6 A;  3T9A A;  2JEI A;  3UO2 A;  4IL6 Z;  2JDI G;  3N42 B;  4GYC B;  5KT5 A;  2QWN B;  5KFL A;  5KFA A;  5LA6 A;  2E75 B;  1Q3E A;  4QPJ A;  3ZHS A;  3E22 A;  2R84 A;  2CKZ B;  3VQV A;  1MAB G;  2GDS A;  4NB5 A;  3ZMU A;  1V55 B;  4MVS A;  1EN4 A;  1DV2 A;  2MCT A;  1V54 B;  3OTO O;  3HKZ E;  1XL4 A;  4F6R B;  5DIS C;  5IYD G;  5CR5 A;  1H2K A;  1K7D A;  4PHZ A;  1N56 A;  2YID A;  4LNU A;  1HR0 B;  2ZQM A;  4O3P A;  1K83 A;  4ETS A;  2BQU A;  2ZDH A;  4UCO A;  3WWH A;  4B3M O;  2BSK A;  5JQG F;  3V6H A;  2B9Z A;  4E4E A;  3TY5 A;  1I5Y A;  5J2U F;  5FD6 A;  1EKV A;  4DW1 A;  4GC6 A;  2Q6A A;  1YEW A;  2RGV A;  2AGP A;  1SEI A;  5DG9 A;  1URF A;  1R73 A;  5KFC A;  1NZ6 A;  1XI1 A;  4YAK B;  5JH7 F;  4LF7 B;  1LUW A;  4A5U B;  1THZ A;  3MDS A;  3CCV V;  2CFM A;  3JD2 A;  4O4H A;  4MVQ A;  4FM9 A;  5KX5 B;  1TAE A;  3HBL A;  3MHS C;  3JAT B;  3NGD A;  4R7C A;  3SDL A;  4PDV A;  3PO3 G;  4IHJ B;  5KFN A;  3OMI B;  1CKM A;  3AK1 A;  1KUT A;  3OTO B;  4JI5 B;  3LDE A;  2F4V H;  1YF2 A;  2CTR A;  3U0G A;  3R23 A;  4TUY F;  2IA6 A;  4DUY O;  5DLF A;  5DQI A;  3JCZ A;  5C8Y B;  4B3M B;  5LL6 b;  3VNN A;  3CRA A;  3N44 B;  1GO3 E;  3BEH A;  2VWK A;  1VF5 B;  3JZI A;  3RUP A;  3F8N A;  3LQS A;  4WHX A;  4DV1 H;  3KZI Z;  2W6P A;  4QIW E;  2VWJ A;  5C1P A;  4JI3 H;  3K3V A;  1M56 C;  3WO1 A;  4O7Z A;  2WA3 A;  1FJG O;  5I5U A;  1KJJ A;  3V4S A;  3JRX A;  5LA6 B;  2ZDI A;  3CC2 V;  4EGQ A;  1VQM V;  3THO A;  3JAW B;  3H1J H;  4AYB E;  1XMO H;  2COJ A;  4AHC A;  5IJ9 B;  4RUF A;  3OR6 C;  4X64 O;  1PD3 A;  3HKB B;  3SPC A;  1P7B A;  4JI1 B;  2YL2 A;  4R50 A;  4LNU B;  4YQW A;  4I7Z B;  3BAB A;  4J9P A;  2W0X A;  4MA5 A;  4NTX A;  3S3W A;  2CNQ A;  2Z02 A;  5JVL A;  3UCS C;  4O3R A;  5JVD F;  5LBQ A;  2BSK B;  1BHB A;  1PX2 A;  4YJ3 F;  4DUY B;  1I08 A;  2EX3 A;  1Q86 W;  5E25 A;  2WB1 A;  3SPH A;  4WFB V;  4DV4 B;  3FYE B;  4NYE A;  2OCC B;  5I47 A;  2YSU B;  2QEX V;  1S0O A;  1SFO A;  4R6Z A;  4A3K G;  1Y1V G;  2DJV A;  5FPO A;  1ULZ A;  2YUA A;  1DF4 A;  4I9W A;  3OT7 A;  1AJN A;  1N4C A;  2JGD A;  4PZ7 A;  3BA8 A;  1YDX A;  1MG1 A;  3VBB A;  1Z5W A;  1FJG B;  4FM1 A;  3B40 A;  5AG2 A;  1IZ3 A;  3J7A U;  3LWB A;  5E1A C;  4Q6G A;  4ZI7 A;  2YIC A;  1HNW H;  1DTO A;  3B77 A;  1IDS A;  4WFG A;  1Z5V A;  2PY5 A;  2NU7 B;  2P0A A;  4U7C A;  4X64 B;  2BR0 A;  4B3R B;  3EYY A;  4AQY H;  1EZV H;  1CE8 A;  2P6J A;  3V6K A;  2YEV A;  3TK1 A;  4JI4 O;  2R93 A;  4CHI A;  2R86 A;  3HKZ A;  2ZCE A;  3R5X A;  4UV8 A;  4JV5 O;  4ZBM A;  2EJ2 A;  2IJK A;  3JAS B;  1GLV A;  4BBR G;  2Q68 A;  3F7Y C;  3ETG A;  2P22 C;  3HB9 A;  1EZJ A;  3P32 A;  4NKG B;  3GWK C;  3K04 A;  2F93 B;  3BG5 A;  4WBN A;  2JEJ A;  2R7N A;  3ORQ A;  4R8C A;  3T54 A;  4LMY A;  3PR5 B;  1DK1 A;  5I5T A;  2RJZ A;  1GKF A;  3FB8 C;  5GTI Z;  1K4C C;  1GN4 A;  2XGQ A;  2R9I A;  5L3F A;  1VF6 A;  1HNZ O;  4YIO A;  2JEX A;  3TEK A;  1PKX A;  2YC0 A;  1WNS A;  4O4J A;  4PDM A;  5LHI A;  3WWI A;  4WFA V;  2CK3 G;  3U54 A;  2HVS A;  5KHI A;  2R8K A;  3RFR A;  5KX5 F;  2AGA A;  4JI4 B;  5LGN A;  1PM9 A;  4RUC A;  1XBL A;  5EIB C;  4F6E A;  3FX7 A;  2HHF A;  5BWT A;  4MVM A;  1ROP A;  1AB3 A;  4JV5 B;  4IHJ F;  4DXW A;  3LDD A;  2QGN A;  4LBE C;  2XAG A;  2DWC A;  2W70 A;  3ABK B;  3JZ6 A;  4TQS A;  1NVP B;  5FNV B;  2DAA A;  1EUD B;  4PDR A;  4X62 O;  2BCC H;  2X5R A;  3R5H A;  4HBN A;  3FAV A;  1XNR H;  5CA3 A;  1S5H C;  1S5J A;  4NTW A;  4DL3 A;  2UUB H;  4QGP A;  5IP9 G;  5C8Y F;  2LFS A;  3ABL C;  2XAS A;  4O7W A;  1PNM A;  4ZI7 B;  3EPG A;  4X1K A;  2GBO A;  3APO A;  1M57 C;  3RR5 A;  4QIW A;  2C2D A;  5EBW C;  3U9S A;  3RB4 A;  2Q7G A;  4MVO A;  2HR3 A;  1HNZ B;  4U3J A;  1AR1 B;  3K57 A;  4AYB A;  1K97 A;  4TV8 B;  1PV0 A;  1LNQ A;  3AG4 B;  2FK3 A;  1ZWI C;  3HOW G;  4DV7 H;  3OD4 A;  3BQ2 A;  3CCJ V;  1XL6 A;  5LA6 F;  3T9C A;  2GTA A;  5IYB G;  3HPL C;  1AUV A;  5EYP A;  3OUZ A;  5EWE A;  4ZQI A;  5L3G A;  1HP8 A;  3DC5 A;  3K79 A;  3PFF A;  2JVD A;  4F4Z A;  2Q2T A;  5FJ8 G;  1NTK H;  3KHL A;  1AJQ A;  4EEY A;  4EKW A;  1Z2N X;  3KHR A;  4WBN B;  3VPC A;  2FJZ A;  4GZR B;  2ZDQ A;  2HVR A;  5KFM A;  2XTA A;  1JDB B;  1QR8 A;  4QE9 A;  3OSN A;  1OCZ B;  1OV9 A;  1XEQ A;  4FIP C;  1XUQ A;  1SKV A;  2RMK B;  3AW8 A;  4XYM B;  4LSX A;  4JTA B;  4IRK A;  1OCO C;  3QZ8 A;  2YXL A;  2ZNI A;  4ED6 A;  4C5A A;  4R8U A;  1SQX H;  1D5A A;  2RQ6 A;  1M7J A;  4A3C G;  4RWU A;  4YHH O;  1NVP D;  3L9D A;  1S3J A;  1HR0 H;  2GLT A;  1SRY A;  2CTQ A;  2JA6 A;  3OTF A;  2OTL V;  4K8Z A;  2M6Y A;  3K9A A;  5CA1 B;  4P9P A;  2CGN A;  1D2D A;  1W59 A;  4DV2 O;  2Q5Z A;  2FKL A;  2A06 H;  5B1A B;  2J6T A;  1YIT V;  2DYS B;  3OHB A;  3LUT B;  2Q69 A;  4X1I A;  1ZL8 A;  2AZ0 A;  4QW9 A;  2HHF B;  1ZTE A;  1M4U A;  4FFL A;  2Q4P A;  4TQF A;  1F7Y A;  1HW7 A;  5J2T A;  2ZJT A;  1SQP H;  1BT8 A;  5F9N A;  2A79 B;  4QWA A;  3F7V C;  5KHK A;  5DQG A;  3RYH B;  3MR6 A;  4ECZ A;  4NVP A;  5EC2 C;  2QR4 A;  4UB8 Z;  2DQ3 A;  2ZIO A;  5DM6 V;  4DUZ O;  1ZSP A;  1TWH A;  2FMA A;  4ECY A;  4UCT A;  5CN0 A;  1IXB A;  4J9L A;  2M7W A;  2ZGI A;  2R7Z G;  4TVI A;  1H2G A;  4Q20 A;  5I5X A;  3RTX A;  3DTG A;  4JYY A;  3CYO A;  4JI5 H;  4JUZ A;  3HOX G;  4OX9 O;  4YHH B;  4FZ1 A;  4U3J B;  2DLN A;  3OHA A;  2VQF B;  4N21 A;  4MV7 A;  2HHH H;  2A1H A;  3ZMT A;  3ABU A;  2Q67 A;  1WPX A;  2IH3 C;  4DV2 B;  5EYP B;  4ZOL A;  3M9O B;  4DR4 H;  4FMT A;  4J41 A;  3I56 V;  3RB0 A;  2P67 A;  3JRW A;  5J9P C;  1QLE C;  1GM8 A;  2IBZ H;  4ED1 A;  1XK5 A;  1PP9 H;  2HGS A;  2N05 A;  5D1O A;  4UB6 Z;  1OHH G;  1XDC A;  4J11 A;  4DUZ B;  2W6N A;  4RNM A;  2R8I A;  4JI1 H;  4QPK A;  2C2R A;  3RAQ A;  3K0G A;  4NLG A;  2F4V O;  4AIL C;  2XGP A;  3K3P A;  5FNV F;  4DR1 O;  4OX9 B;  2E74 B;  3OGI B;  4FLT A;  5KG1 A;  3UFX B;  1GRJ A;  4A3J G;  4B08 A;  3TET A;  4IR9 A;  2IW5 A;  4RZQ A;  4DV4 H;  1RFY A;  4J7K A;  3SPG A;  4ZI7 F;  4GX2 A;  3ABM C;  2ZIN A;  3ML0 A;  2CW8 A;  4I0X B;  4GT1 A;  3MR3 A;  3KRE A;  2ZNJ A;  1R3L C;  5KT2 A;  1S9F A;  4MTF A;  4JI3 O;  4CS2 A;  4O81 A;  4EB6 A;  3M9N B;  4TV8 F;  3JAK B;  2PYJ A;  3AEI A;  3ETE A;  4LSA A;  3GWO A;  3C0F B;  3H20 A;  2ILM A;  3MHH C;  4F4W A;  1SER A;  1XMO O;  1JDE A;  5J2U A;  3MWD A;  2YZG A;  3TII A;  1QBZ A;  4DK1 A;  3HKD B;  4LR3 A;  3ZRV A;  5DQH A;  3PW7 A;  2QWR B;  4B3R H;  3R66 A;  3A0B Z;  1JOY A;  5TIS Z;  4LF8 H;  1GSO A;  1GMG A;  3J81 N;  4WBN F;  4FFK A;  3KXY T;  2CH7 A;  2YIB A;  2NNU A;  5KFG A;  2B5U A;  2AHZ A;  4DL6 A;  3SJB C;  3X2Q B;  2F4V B;  4X20 A;  2J9G A;  4G3I A;  1SQG A;  3PN1 A;  4XZ3 B;  4DR1 B;  1XRE A;  4ZOL B;  4BIU A;  1UFI A;  4DR6 H;  3H1K H;  2W6Q A;  2R93 G;  1NTM H;  5KHJ A;  5JJJ B;  3ETJ A;  3JAL B;  4J7J A;  1F4M A;  3B09 A;  2GPW A;  5KG4 A;  2ZXW B;  3ZMV A;  4RAI A;  1ET0 A;  2PVP A;  4LH7 A;  4BW9 A;  3GIM A;  5CA1 F;  2LJ2 A;  4TUY A;  4M9U A;  1DV1 A;  1GYF A;  5D1O B;  4JI3 B;  4MTG A;  1MA1 A;  2Y48 A;  4U6P A;  3K9S A;  3N41 B;  3T5H A;  4D7T A;  3VA7 A;  3C3T A;  3NR7 A;  3GB8 B;  5BYA A;  1IBL B;  1XMO B;  2W7P A;  4HNA B;  2W6O A;  3ABK C;  4A3D G;  1QR9 A;  2EIM B;  1NT2 B;  4P2Z A;  2IH1 C;  1H8H G;  5B3S B;  4L1K A;  3QG5 A;  4AQY O;  1QU7 A;  3K59 A;  2XCP A;  3K58 A;  3WG7 C;  5KFX A;  2A0L A;  2COG A;  3KHG A;  1AI5 A;  4JI4 H;  4DAA A;  1GO3 F;  4JZ2 A;  3OUS A;  4CE5 A;  5KFW A;  2BQ3 A;  4JV5 H;  2PZS A;  4XDK A;  4DV5 O;  1KT8 A;  1WR2 A;  4QIW F;  1WB8 A;  2CUG A;  1EYZ A;  2NUA B;  2CAZ C;  3L72 H;  3AG4 C;  1VQO V;  1IBM O;  1I6U A;  2WLL A;  4B7E A;  1WP8 A;  2R8G A;  4EB6 B;  2KKW A;  5GW7 A;  2I8C A;  1FYJ A;  5JVD A;  3N8D A;  3SR2 C;  5DGI A;  3L4K A;  4BWS C;  2B1G A;  3IN5 A;  4FM2 A;  4L8J A;  4PD4 F;  3K3W A;  2AGO A;  1BCC H;  1OCR B;  1OCZ C;  1OJH A;  3PW5 A;  2EIL C;  5DLG A;  1S77 D;  1KQS U;  2RCV A;  4YB8 B;  3ZS8 C;  4HNV A;  4PEL A;  4EEQ A;  2IJJ A;  2XC9 A;  2ODT X;  2OT5 A;  2WDT A;  3E8F A;  1NS1 A;  1NH2 B;  4FBT A;  2H3O A;  3H1I H;  2MW2 B;  5FD5 A;  4LC1 A;  3AX6 A;  3LNM B;  3T5L A;  3Q8R B;  2Q8V A;  3V4Z A;  1S0N A;  1Y76 A;  1EBO A;  4DV5 B;  3RV3 A;  5B1A C;  2FML A;  3RVZ A;  1IBM B;  3DTU B;  3NUA A;  3RYF B;  1XNR O;  3QNE A;  2HGX A;  2ZM6 O;  3T2M A;  5KT6 A;  5KFY A;  3GTO A;  4BW5 A;  3CRR A;  1RJP A;  3UT5 A;  5KFK A;  1W0J G;  3F5W C;  4DR5 B;  4OXS A;  4FFO A;  1N8R W;  4F6R A;  5B1B B;  4DO2 A;  5KKN B;  5KFF A;  4EYI B;  3EFF K;  1K1S A;  4ECX A;  1VIB A;  4MT8 A;  3RVY A;  1IOV A;  2WLH A;  1CPY A;  4DV7 O;  4JPR A;  2HVQ A;  2FLN A;  4IWY A;  2WSS G;  5IYC O;  4WD3 A;  3H0G A;  4M7E A;  5EWG A;  2VQE H;  2DYR C;  4C5B A;  2QDO A;  2L35 A;  4K0K H;  4PV1 B;  3T9D A;  2WLL B;  1VS0 A;  2GHY A;  2ASD A;  3K06 A;  1WCM A;  2RDI A;  5K1P A;  4MTX A;  1NH2 D;  5BWX A;  3T9F A;  2QK4 A;  3HKE A;  5KFE A;  1N0N A;  5KX5 A;  3OFN G;  4JI8 O;  5FPR A;  1XNR B;  3JAT A;  3FKI G;  4WFF A;  1E1R G;  1WB7 A;  4X66 B;  2ZM6 B;  4ZOL F;  1Y4M A;  1Q6I A;  2RN9 A;  1HR0 O;  4IHJ A;  3GV8 B;  4YHH H;  4A2B A;  1M5I A;  2K1E A;  3PW0 A;  3GV7 B;  5D1P A;  2VQF H;  1K4D C;  1I94 H;  3CCR V;  2AHY A;  2YZL A;  4DQN A;  1Q6H A;  4DV2 H;  4ECV A;  3RBD A;  4IR1 A;  4WFE A;  5CB4 B;  1K9M W;  2V59 A;  1OBD A;  2I87 A;  3HR0 A;  1AR5 A;  1I7F A;  2QWQ B;  3RGB A;  4LF4 H;  2IJH A;  4XDL A;  1WJZ A;  1H2L A;  1DF5 A;  1O75 A;  1XMQ B;  3MAQ A;  1Y76 B;  5DGB A;  4QJF B;  4GX0 A;  4PA9 A;  2Q73 A;  4ZKI A;  2ITD C;  4RQE A;  5KT4 A;  1WP7 A;  4UCU A;  1TWA A;  3AK3 A;  1B04 A;  3M8A A;  2VR1 A;  2YS8 A;  4B3S O;  3UT5 B;  4JXU A;  2FK1 A;  4DUZ H;  1KBH A;  1AUX A;  3JAW A;  2WE6 A;  4J9Y B;  4MW8 A;  4H33 A;  5IJ9 A;  4JI8 B;  4JI5 O;  3HKB A;  4F4L A;  1VQ7 V;  2QYZ A;  4HNU A;  2HHH O;  4OX9 H;  3G6X A;  4A93 G;  1TWG A;  3ZHU A;  4DR4 O;  5EIB D;  2W6I G;  4B3T O;  5L1J A;  2Y4T A;  1CQJ B;  1CKN B;  2DZD A;  1N33 O;  1OCO B;  3SYO A;  3L73 H;  2P06 A;  4LFC O;  3X2Q C;  1EN6 A;  3HOU G;  4G2K A;  3GIJ A;  5F9L A;  1ZLZ A;  1SQF A;  3TGU H;  4MTE A;  1TWC A;  1YVW A;  1QVF U;  2YU9 A;  4O2B A;  3HKE B;  5CE8 A;  3VQX A;  4F4X A;  3L70 H;  3JD0 A;  1K34 A;  4JI1 O;  1Z2O X;  4B3S B;  4CBC A;  2ZXW C;  4QNH B;  1MZE A;  2PGG A;  2AXT Z;  2P5O A;  2LP7 A;  2ZIM A;  2HKO A;  4CH3 A;  1KEE A;  4BIO A;  1RSO A;  2LW7 A;  1JX9 A;  1NR1 A;  2Y0I A;  1G1X B;  1JX4 A;  2HHH B;  4DR1 H;  3MD0 A;  2C2E A;  1XIL A;  4MSW C;  2Y69 C;  1EZ1 A;  4DV4 O;  5KFT A;  2EIM C;  3L71 H;  3KG2 A;  2RF4 A;  5HFL A;  1GSA A;  5B3S C;  3W7U A;  3G71 V;  3VOU A;  4O3O A;  3JAS A;  3CPW U;  4ECU A;  1FXH A;  4O7T A;  3BY6 A;  1GN3 A;  4B3T B;  4DR4 B;  2JEF A;  3RYI A;  1B3Q A;  5CBF A;  5LMU B;  3K08 A;  1N33 B;  3CEB A;  3RB3 A;  5KFD A;  2UXC H;  1E1Q G;  4APM A;  4Z1M G;  4LFC B;  5HFM A;  3W7X A;  1C3O A;  3ASN B;  4PWQ A;  2P4V A;  1AI6 A;  4MAM A;  4CMD A;  3ZCC A;  1CKO A;  3P3N A;  1NU1 H;  3I4M G;  3SYP A;  1IBL H;  4GLW A;  4O7N A;  3LSS A;  2JEU A;  2HGW A;  1K3E A;  2N74 A;  2O57 A;  5BWV A;  2R92 A;  3T7A A;  4B3R O;  4LF8 O;  2A3Q A;  1E4E B;  4JV2 A;  2XAJ A;  3GID A;  5KMG B;  3WB0 A;  4TQR A;  3CE2 A;  1EN5 A;  5H9C A;  5IE9 A;  5BR8 H;  1PPJ H;  4PA4 A;  1QLE B;  3E8B A;  4B7K A;  3MR5 A;  2KG7 B;  3JD3 A;  2W9C A;  2EBO A;  4DL5 A;  3L2P A;  3AG3 C;  4DR6 O;  2W71 A;  4ABM A;  4LH6 A;  1IBK B;  3W7S A;  1OCR C;  4MVR A;  5A9G A;  4E6N A;  5DG8 A;  5CAE B;  2DW4 A;  2DN9 A;  4FS1 A;  2VUM G;  2EIK C;  3LDC A;  2JA5 A;  3BA9 A;  5FNV A;  5LYJ A;  4HN2 A;  3W7W A;  3GTJ A;  4O2B B;  2ASL A;  3N40 P;  5CB4 F;  4JF3 A;  3UZO A;  4IAJ A;  1I1L A;  4P30 A;  1R6K A;  3M7M X;  2HLD G;  5F2V O;  2V58 A;  2JA7 G;  2VPS A;  1MZF A;  1Y67 A;  1VEW A;  3CWB H;  2B63 A;  1QHT A;  3GTK A;  3ABM B;  5L3C A;  5I5Y A;  2GSM B;  4LF8 B;  1RSO B;  1JCH A;  4TV8 A;  5DG7 A;  1E79 G;  2OLS A;  1D5N A;  1NR7 A;  2ZE6 A;  1P4R A;  3ETH A;  2R9R B;  5C93 A;  4HNT A;  3FFQ A;  1KJI A;  2UVW A;  5CA0 A;  3UQ8 A;  1AP6 A;  5B1B C;  1SF9 A;  4RB0 A;  3H3V H;  2BOC C;  4NR1 A;  1FVI A;  2PF4 E;  3RFC A;  4DR6 B;  4DV5 H;  5IJ0 A;  3RYI B;  5BWW A;  2X6B A;  1BXR A;  1SET A;  1IBM H;  2BOB C;  5IYC G;  4IT5 A;  4JAA A;  2WYO A;  4UCV A;  4QWB A;  2UUC O;  3RV4 A;  4EFB A;  4DR5 H;  2OH2 A;  2VPQ A;  4JV0 A;  5KA5 A;  4DRF A;  4BBS G;  4D7S A;  1Q8I A;  4DR2 B;  4E4T A;  1IX9 A;  3D3Q A;  1NTZ H;  4W4K A;  1Y14 B;  2W8L A;  1MSW D;  2YWV A;  4HZ3 A;  1Y74 A;  4JTD B;  5D5Q A;  3J7A K;  4CH4 A;  1A0I A;  3CQZ A;  4JAU A;  5CA1 A;  4PI2 A;  5LP6 B;  2LGW A;  2W9C B;  4X65 O;  2WTF A;  4J7Z A;  1T5E A;  1XQ8 A;  3TJT A;  4GX1 A;  2EJR A;  4ED0 A;  5FLX N;  3R9R A;  1EM1 A;  2COI A;  4BY1 G;  3H01 A;  5JCO A;  4C5C A;  1TUB A;  4TSF G;  2ABJ A;  4DR3 B;  5IWA O;  1JA8 A;  2R85 A;  3T5J A;  5LYJ B;  1Y6X A;  1IUR A;  4GKJ O;  3RYH A;  4A3L G;  2DPI A;  1KP2 A;  2OIG A;  1UC9 A;  4X66 H;  3LSQ A;  2UVR A;  1S03 G;  3RT3 C;  2ZM6 H;  3WG7 B;  4YR0 A;  3T9B A;  4EGJ A;  2R9A A;  1WCM G;  2W6J G;  2UUC B;  1T36 A;  5K3W A;  1E4G T;  5KLV H;  2VOB A;  3SYA A;  1KC8 W;  3TY8 A;  2UVV A;  5I5S A;  4Q8F A;  4RUE A;  1AN7 A;  3RBZ A;  2XOK G;  1Y1W A;  2XT9 A;  2QA4 V;  1B6Q A;  4UV9 A;  2VQE O;  1P84 F;  4CH5 A;  2F95 B;  4H13 B;  4JI6 O;  4X65 B;  2YI8 A;  5CA0 B;  3J80 N;  1FXV A;  5H80 A;  1XMQ H;  4K0K O;  1FKA H;  3VOT A;  4QWC A;  3A8T A;  1GGO A;  5IJ0 B;  4FGR A;  2NU6 B;  1H2N A;  1T3N A;  3IFX A;  2Y0P A;  5C1O A;  5KFP A;  3RBE A;  2BTO A;  1VAJ A;  5KFR A;  1JVM A;  3P30 A;  3HKC A;  2EIL B;  5IWA B;  3G8D A;  4LF5 B;  3RJ0 A;  1S0V A;  1YCI A;  1B06 A;  1WA8 B;  2Q9L A;  3ZJZ A;  2ZR3 A;  4GKJ B;  2FTK A;  3RW0 A;  4JI8 H;  1XNQ H;  3FB6 C;  1RYR A;  3ZED A;  5KFO A;  1GN2 A;  1VQP V;  1X59 A;  4WF9 V;  4A3I G;  1X4T A;  2VQF O;  1Y74 B;  3UYY A;  1JJ2 U;  1I94 O;  4RB3 C;  2FPI B;  3L75 H;  3HOZ G;  4ECS A;  4X1Y B;  4EBE A;  4O2B F;  1KU9 A;  1MZB A;  1JPX A;  3CXC U;  4QWD A;  3CME V;  4LF4 O;  2HJW A;  2VQE B;  4JGS A;  2ADQ B;  1GN6 A;  4JI6 B;  4O84 A;  4I0X A;  1RPO A;  2PMZ E;  4NXM B;  1TUB B;  4K0K B;  1YHQ V;  3I12 A;  2NR5 A;  2H8P C;  4Q4C A;  2R8J A;  3JAK A;  4U7N A;  4MV8 A;  5CM0 A;  1FD9 A;  1VQ5 V;  5A2Q N;  4B3S H;  4PDL A;  3E89 A;  3I5D A;  5IY5 C;  3CSX A;  1V9P A;  1JFF B;  2DYR B;  2IU3 A;  3HKD A;  1BJT A;  1N34 H;  5BMV B;  4O7S A;  4EBD A;  4O7Y A;  3ASN C;  4NZM A;  5IT9 N;  3EPI A;  3I4N G;  3GTQ A;  5EK0 A;  2GUZ B;  1H2S B;  1VBH A;  1I94 B;  2G38 A;  2UXD O;  4FLU A;  3T1H B;  4ED8 A;  1M90 W;  3CB2 A;  4BIZ A;  1Z2P X;  5C4X G;  3E8H A;  3H40 A;  2V7Q G;  3DGE A;  2DAB A;  2R6F A;  3FDS A;  4B3T H;  2DIK A;  4TV9 B;  4HAM A;  4OPH A;  3CCE V;  5LMU H;  4ECT A;  1N33 H;  4LF4 B;  3CRM A;  1ZHQ A;  3JAL A;  3DTF A;  1R9T A;  4N23 A;  2NLJ C;  3ETQ A;  4LFC H;  3N6R A;  1JIH A;  4FFM A;  2QF7 A;  5LP6 F;  3GTL A;  3HKC B;  2ALZ A;  2XAH A;  3G8C A;  4YBZ B;  2HIV A;  2V1D A;  3ZHR A;  4O4L B;  1M1K W;  4HNA A;  2R87 A;  3N27 A;  1S5L Z;  1F23 A;  4PA7 A;  1PNL A;  4Z2W A;  4UVC A;  4FU0 A;  1QQC A;  4RCN A;  4ED2 A;  2F43 G;  3GTG A;  4YIP A;  3JZF A;  5KFU A;  2R92 G;  5DEC A;  5LYJ F;  2ODM A;  2C35 B;  4YP3 A;  2ARH A;  4LCU C;  2X0L A;  3SJC C;  2HVK C;  3LUL A;  2PTM A;  5LXT A;  3RAX A;  1BQ0 A;  1SES A;  1IBK H;  2UXD B;  3G6E V;  2CQY A;  4J80 A;  1TWF A;  2YCH A;  4JTC B;  4DYL A;  3SGI A;  3KCY A;  3N2K B;  4DL2 A;  4A3F G;  2UXC O;  2UXN A;  2QSA A;  2Y4R A;  4LF6 H;  1WRV A;  1VKZ A;  1RM1 C;  1JQ0 A;  1BGY H;  1P7G A;  3ZRW A;  1AI4 A;  5JQW A;  2NU9 B;  5B5E Z;  3NBY B;  3U0Z A;  3UO3 A;  1IBL O;  5CA0 F;  3FB7 C;  1G2W A;  3CVZ A;  4J9N A;  1QCE A;  3JAR A;  5JJN B;  2Z04 A;  1BNC A;  4O3N A;  3CSW A;  4J9S A;  3VQY A;  1MNG A;  1KJQ A;  2QM7 A;  5BR8 O;  1I5X A;  3H9V A;  1XDN A;  5IYD O;  2VRZ A;  3CCQ V;  1S0M A;  1HNX H;  3CXH F;  1GH6 A;  2B63 G;  3WWJ A;  1U97 A;  3V6J A;  5LMN O;  2CDY A;  3RYC B;  2LW1 A;  5KAI Z;  1Q5O A;  3WB1 A;  2DPJ A;  3TXQ A;  3GV5 B;  1AVM A;  3B2E E;  2J6U A;  4YJ2 B;  5LP6 C;  1ORQ C;  3GIL A;  1W0K G;  2YI9 A;  1GM7 A;  5LGU A;  5BPF A;  2UXC B;  2E3C A;  2W0F C;  3RYF A;  2ZDI C;  3O65 A;  5JJE B;  3GJX B;  4DR2 H;  2PMZ A;  2FYU H;  4DR7 O;  5IYZ B;  3QVN A;  3JD4 A;  2YW2 A;  4GX5 A;  2Z0A A;  2Y69 B;  1UJW B;  4PZ8 A;  3ZMS A;  3E86 A;  3G6Y A;  5KG2 A;  1I3Q A;  4ECR A;  1FXK B;  2D2C B;  4YAJ B;  5I5V A;  1Q43 A;  1YJ9 V;  2UVU A;  1BSM A;  4KUM A;  5LXT B;  4O83 A;  5BR8 B;  3T1Y B;  1US6 A;  2GTS A;  4I50 A;  5L3E A;  4JI0 H;  4MVZ A;  3WFV A;  5LMN B;  2HIX A;  4DR3 H;  5D8D A;  5BMV F;  2ATK C;  4A2A A;  1R6N A;  3D36 C;  3B8N A;  3GTM A;  1COW G;  2PBZ A;  2Y0S E;  4O86 A;  4JYB A;  3ZRW B;  4YY3 B;  4RQF A;  1J5E H;  3CJH A;  2W57 A;  4EQ5 A;  5BY1 A;  3DXR B;  4DR5 O;  2FK2 A;  2VUG A;  3K5M A;  2UUC H;  4X9Q A;  3BVO A;  3E35 A;  4O4I B;  1WSC A;  3RWR D;  1YXB A;  3OEH G;  3AG3 B;  4TV9 F;  3GQC A;  4DR7 B;  2HP8 A;  3JAR B;  4F50 A;  4QSH A;  4J9Z B;  4Q8E A;  4ED3 A;  3CCM V;  1M9N A;  3ZX6 A;  5CMU A;  2F23 A;  2UU9 H;  2CTW A;  2HG8 A;  2EIK B;  1RJQ A;  4X65 H;  2WLI A;  2ZE8 A;  5FLX W;  5CB4 A;  3K5I A;  3D8C A;  5JQG B;  1GTO A;  4K8X A;  1S76 D;  2WA4 A;  2V4R A;  4RZR A;  2XCA A;  2FLP A;  4O4L F;  3I55 V;  4HR7 A;  3E83 A;  3QF7 A;  1XHZ A;  2WLM A;  2HJF C;  2FKX A;  3QTC A;  1R3J C;  5EZY B;  4QJF A;  3ZN1 A;  5IWA H;  4LF5 H;  3WO0 A;  2GPS A;  2FPG B;  4X66 O;  4GKJ H;  4J9Q A;  1BGW A;  5BYB A;  3SPJ A;  2XAF A;  2UUA B;  1I1M A;  2R70 A;  1DAA A;  1A32 A;  1NQT A;  1SZT A;  3ZHQ A;  5FR9 A;  4Y8V B;  4A3E G;  1MOF A;  1O9H A;  1SQQ H;  4ZIB A;  3CCU V;  4CKB A;  3Q2O A;  3G6B A;  1GM9 A;  2QTS A;  1Z2G A;  4ASU G;  2IM9 A;  1LUV A;  4PI0 A;  5KUM A;  3UM7 A;  4DV6 B;  1PK8 A;  3TXS A;  2JA6 G;  5EDW A;  2WLJ A;  2Q0A A;  2PUS A;  3BQ1 A;  4GKK H;  4I50 B;  4JI6 H;  1XMQ O;  1KEC A;  1FKA O;  1CKN A;  1KJ8 A;  2KQX A;  4NXM H;  3AG2 C;  3EVK A;  3KAJ A;  4D6T H;  1K8A W;  1L0L H;  1XHX A;  3OMN B;  4K35 A;  2WAQ E;  1X9N A;  2IMW P;  1VQ8 V;  2JGU A;  3K5N A;  2OWO A;  1VBG A;  3KAL A;  3CJH B;  4OGQ B;  5KHG A;  4Q44 A;  5EBL C;  1XNQ O;  2DMX A;  1NI8 A;  3Q8S B;  3T9E A;  4L87 A;  3TW7 A;  3L4J A;  4XBF A;  4YJ2 F;  2CW7 A;  5H5N A;  2JJ1 G;  5DED A;  1M0W A;  1MMM A;  4YR2 A;  1ZET A;  3T1H H;  4A3B G;  2WLI B;  4BAY A;  1CEZ A;  5EWF A;  2FPP B;  4JI2 B;  4I55 B;  4YJ3 B;  5IYZ F;  4TM5 A;  2QM4 A;  5L9X A;  1SYX B;  3NC0 B;  5I60 A;  3ZHT A;  1VQ4 V;  4F4Y A;  4FK5 C;  4CKE A;  1VQK V;  4LF9 B;  2NVX A;  4WFH A;  4UUJ C;  4JV1 A;  5GON B;  3AG7 A;  4J9M A;  3WB2 A;  3CMA V;  5A2Q W;  4EG0 A;  2DWD C;  2QKA A;  2CZG A;  5LXT F;  4CKC A;  3CP1 A;  4ZHQ A;  1Q7Y W;  3KHH A;  5C5J A;  1ARO P;  2QTO A;  3W5O A;  1RJR A;  2HEP A;  3APQ A;  1FFX B;  1SC5 B;  5IT9 W;  1XNQ B;  4LFA O;  1N34 O;  3IAY A;  1FAF A;  5L1I A;  3HOY G;  4XDJ A;  2Y0S A;  1E4E A;  3GTP A;  1GK9 A;  3CRC A;  2NU8 B;  5BPH A;  4RNN A;  5KAF Z;  3SNO A;  3ORR A;  4FZ0 A;  5KMG A;  1VF7 A;  1TGO A;  5E79 Z;  3BQ0 A;  2IJI A;  2M05 A;  5DGH A;  4PA3 A;  1IYD A;  3SPI A;  4Q4D A;  2KG7 A;  1QLN A;  2YS6 A;  2UXD H;  1CXZ B;  1FFT B;  4O4I F;  4TOI A;  2GQS A;  5LMU O;  4FFN A;  2PI4 A;  4QWE A;  1SS3 A;  3CC7 V;  1Q81 W;  3FD9 A;  5IYB O;  3MWE A;  4GUN A;  1V4Y A;  3W1G A;  3LML A;  2GV9 A;  5L1L A;  4IYI A;  1I1K A;  3U10 A;  2HFE C;  3CCL V;  1GAX A;  2XCL A;  5KFV A;  5BZB A;  3NBZ B;  1K73 W;  2OYQ A;  1A3G A;  3HXL A;  5DAA A;  4JZG A;  2DE0 X;  3ZHV A;  3CEI A;  4UCR A;  1A48 A;  1M6V A;  3SJQ C;  2J6S A;  2NN4 A;  2ASJ A;  1HDJ A;  4BY7 G;  5DN6 G;  3IC9 A;  1VQ9 V;  1L2Z A;  2ITC C;  2WLN A;  1N34 B;  1AI7 A;  4LFA B;  5EZY F;  4I7H A;  3KKY A;  2W6Z A;  3TIG A;  2DQ0 A;  1N0J A;  3E2E A;  1W2B U;  3MFI A;  4RB2 C;  2AW9 A;  2E2H A;  3QZ7 A;  1IBK O;  2R7Z A;  5ITZ B;  2E5L H;  2F1M A;  3L74 H;  5CBG A;  1BL8 A;  5D5P A;  1KTA A;  1KYO F;  1N32 O;  4IYH A;  4UFZ A;  3ZRS A;  4R7R A;  1ZHS A;  1FXK C;  5IY5 B;  1KC7 A;  2YXY A;  4LF6 O;  1KB9 F;  5EBM C;  1RK5 A;  5KG6 A;  4MS2 A;  2IBK A;  4DRX B;  2ATL A;  3GIQ A;  4ZHQ B;  3B4S A;  4LWS B;  1K5S A;  2WAQ A;  4I50 F;  5CBH A;  1DGS A;  1ZQ7 A;  3O9O A;  3J81 W;  2Q2U A;  2EUL A;  3OR7 C;  5T14 A;  1P49 A;  4O3S A;  4JYA O;  3T4D A;  3E5N A;  2W6M A;  4FS2 A;  2YZM A;  5LP6 A;  1HNX O;  3PVX A;  1VQ6 V;  4NZN A;  3OGC C;  3T1Y H;  4X8A A;  2JS3 A;  3E22 B;  4UVB A;  5LMN H;  1J95 A;  1CS0 A;  2R8H A;  3QO5 A;  1WLE A;  1N32 B;  1UNN C;  2W8K A;  2PI5 A;  4GLX A;  3OAA G;  4YY3 H;  2YRX A;  4E2L A;  4FM0 A;  5HBR B;  3ZN0 A;  4LF6 B;  1Q90 D;  2GQR A;  1N36 O;  4DR2 O;  1W93 A;  2Q7E A;  4K6N A;  4I55 F;  1SA0 A;  4DR7 H;  2V4D A;  3PO2 G;  2CNU A;  4RAZ A;  4O2A A;  3JSN A;  4RNO A;  5GON F;  2YDE A;  3BFR A;  4PDB A;  4JYA B;  2B1I A;  2YXH A;  4U3F H;  1P16 A;  5JUM A;  1KBL A;  3D36 A;  4Q43 A;  1RM1 B;  2A7W A;  4FJC C;  4O4H B;  1HNX B;  2PN1 A;  4J0M A;  4JI0 O;  2VA2 A;  3PR4 A;  2F66 C;  4H0L B;  3MJF A;  5H6Q A;  4DR3 O;  2V4Q A;  2JA8 G;  1OBG A;  1VP7 A;  3GVM A;  5KA6 A;  4DV0 H;  1HWY A;  2AQ4 A;  4YR3 A;  3CS5 A;  3CC4 V;  1PL0 A;  1I2K A;  4MV4 A;  1J5E O;  3ICX A;  4O7L A;  2EIJ C;  5KT3 A;  3M99 B;  1TA8 A;  2UUA H;  4RB1 A;  1WA8 A;  4DV3 O;  4TT3 G;  3N43 B;  1N36 B;  3ABT A;  3QFF A;  4KHP O;  3H4B A;  1YJW V;  5BWR A;  4BXX G;  4BWA A;  3KCX A;  3F5T A;  3ASO C;  1Q6U A;  4I9Q A;  1I50 A;  2UU9 O;  3C3S A;  1S72 V;  4DV6 H;  3RGX A;  1I2L A;  4X1Y A;  2Z3Y A;  2BTQ A;  4PA6 A;  4DL7 A;  4ECQ A;  1VMG A;  2UXB H;  1O9G A;  3HB3 B;  3Q8Q B;  3CX5 F;  2L6L A;  4JI0 B;  3H0G G;  4FLZ A;  2P90 A;  2OTJ V;  3OUF A;  1BS3 A;  1WN7 A;  3AG1 B;  4G28 B;  4X88 A;  4LF5 O;  3T5K A;  5KG7 A;  4NXN H;  3VMM A;  3JAM N;  2JS5 A;  1R3K C;  4MTO A;  3QO7 A;  4KFM A;  1J5E B;  5LOV A;  3BCC H;  5BWU A;  2YYA A;  5C44 G;  4EBC A;  4UXN A;  1SA0 B;  1S97 A;  3FMA A;  4FFP A;  3PZP A;  1JFF A;  4DV3 B;  2CE4 A;  2EIN C;  4W4L A;  4O82 A;  3T1C A;  4O2A B;  5BMV A;  5KG0 A;  1OCC C;  4M0J A;  2K9P A;  4MVU A;  1V51 A;  3OMA B;  1ZX3 A;  4KHP B;  2GUZ A;  1F51 A;  2XHB A;  1N48 A;  1H2M A;  1G8M A;  1BHA A;  1K92 A;  2UU9 B;  1PL4 A;  2Z5U A;  4MV6 A;  4PZ6 A;  1I7N A;  4JI2 H;  4H37 A;  4ZHQ F;  2JGD B;  1JKJ B;  4GKK O;  5L1K A;  3SYQ A;  3TQT A;  5KG3 A;  4NXM O;  4TV9 A;  3OEE G;  5KG5 A;  4LF9 H;  3A2F A;  3UZB A;  1BZK A;  5KFS A;  2QE7 G;  1KUQ A;  1ZAU A;  4NYK A;  1K1Q A;  1R6T A;  4K3A A;  2RDC A;  2YEV B;  2DOS A;  2JEG A;  3H1L H;  2IU0 A;  4IRD A;  3HT5 A;  1V55 C;  2LQT A;  1NKD A;  1V54 C;  4Z1V A;  3SYC A;  2PYL A;  2FP4 B;  4O4L A;  2C28 A;  1AJP A;  2C22 A;  5KFQ A;  3R65 A;  5B1N A;  3JYC A;  3TCU A;  1A0G A;  2X0S A;  3T1H O;  3TIN A;  2ZKO A;  1AIL A;  2BTQ B;  4LFB O;  4IRC A;  3K5L A;  4X62 B;  3FYI B;  4XYL B;  1KKC A;  3GIP A;  1KKD A;  4GKK B;  1M93 A;  1MSD A;  3K5H A;  3N2K A;  2BE3 A;  4O7R A;  4IIJ A;  3IGA C;  1YSC A;  5GTH Z;  2R82 A;  4O4J B;  5L3D A;  3C90 A;  4AI8 A;  3N6X A;  5LOV B;  3MWM A;  4O4H F;  1W96 A;  3BPZ A;  1NJI W;  3Q1K A;  1S10 A;  3BJY A;  2ZR2 A;  2ADP A;  4MV9 A;  3A0R A;  2AU0 A;  1CP9 A;  1R3I C;  4LFA H;  2YRW A;  3PJS K;  2YS7 A;  4JI7 O;  4FLW A;  3AG2 B;  5KT7 A;  4LF7 H;  3AYH B;  4FBU A;  2R7K A;  3E8G A;  2XND G;  3FKI A;  3FKS G;  2JIZ G;  3ZBH A;  3FAV B;  3MR2 A;  2O03 A;  3GLK A;  4IGG A;  3RYC A;  1SQB H;  4LFB B;  5KHH A;  4IWX A;  1H38 A;  4FVM A;  3KYH C;  4X1K B;  3VPD A;  4EYH B;  4YJ2 A;  3OTO H;  2ZT9 B;  1SQV H;  3GB7 C;  1OWT A;  1G4Y B;  3BRC A;  1UPG A;  3S24 A;  3SI8 A;  4Q45 A;  4WCE V;  3ZRX A;  1A9X A;  2KSW A;  3EXA A;  3P3P A;  4B3M H;  4UVA A;  5IYZ A;  1R1B A;  1B6S A;  1PNK A;  2W9B A;  3UKM A;  4JAV A;  2X7R B;  1YTF B;  2QWO B;  2ZE7 A;  3ZMZ A;  1JMK C;  2FB9 A;  2UXX A;  2HJD A;  4TQD A;  2C00 A;  2SCU B;  1FXK A;  3IG0 A;  1NBM G;  4FLX A;  2YZN A;  4JI7 B;  4OPA A;  4HYK A;  3DAA A;  3N2G A;  2XUM A;  1YJN V;  2E5L O;  2C2A A;  1YIJ V;  1OZ0 A;  1F4N A;  4I4T A;  5IP7 G;  3Q8P B;  2LO1 A;  3BHP A;  1KJ9 A;  2ZDG A;  5I5W A;  4CS3 A;  2OCC C;  4R8U B;  1N32 H;  4J9K A;  1CQI B;  1RPR A;  4O2A F;  1SZX A;  3T4Z A;  4IIJ B;  3PW4 A;  2RGR A;  2Y4U A;  3DSQ A;  4FE2 A;  1K5Q A;  1WAZ A;  3HOV G;  4DLK A;  1IVS A;  3DXR A;  2JA5 G;  1GSH A;  3IJ4 A;  3VPB A;  3LP8 A;  4DUY H;  1IOW A;  4X1I B;  1ZL8 B;  4O4I A;  3M4I A;  2JRI A;  2WWW A;  1TVK A;  3G67 A;  3H1H H;  2XD4 A;  3DF7 A;  3LSU A;  1KD1 W;  5J2T B;  1EFR G;  2QM8 A;  1S68 A;  3MFH A;  4DV1 O;  3U9T A;  3JSL A;  2QB5 A;  4C2M A;  3M9M B;  4JYA H;  3T1Y O;  3DC6 A;  4FFR A;  4XX0 B;  2QJ1 A;  3BAA A;  5JQG A;  2WPD G;  1YTF D;  4HYO A;  1FJG H;  2E5L B;  1YI2 V;  2H94 A;  1Y66 A;  5LHH A;  1IXM A;  3QO8 A;  5FLM G;  2A9H A;  2KSD A;  3G6V A;  3KTM A;  1KP3 A;  4X64 H;  2LFR A;  5EZY A;  4YY3 O;  2I80 A;  4NTY A;  5JH7 A;  2CNV A;  1T94 A;  2XAQ A;  3LNN A;  3S3X A;  3GDE A;  1BMF G;  2AGQ A;  2BQR A;  1JJO A;  5BXZ A;  3CRQ A;  1N36 H;  4JAS A;  2AZ2 A;  4MW3 A;  2EZP A;  2W9B B;  2DWE C;  2FE3 A; 
#chains in the Genus database with same CATH homology
 4FLY A;  5LYJ A;  4JI2 B;  4I55 B;  4YJ3 B;  3OTF A;  4K8Z A;  4O2B B;  2QM4 A;  3N40 P;  5CA1 B;  1SYX B;  3NC0 B;  4IAJ A;  3M7M X;  4LF9 B;  4X1I A;  4DV1 B;  3N2G B;  2VPS A;  5GON B;  3WB2 A;  1QHT A;  4I4T B;  5A2Q W;  1M4U A;  4FLV A;  3RIZ A;  4TQF A;  1HW7 A;  5J2T A;  4LF8 B;  4ZHQ A;  2ZJT A;  4TV8 A;  4EFE A;  3W5O A;  2YIA A;  2HEP A;  1FFX B;  4FFB A;  3FFQ A;  5KHK A;  5IT9 W;  1XNQ B;  3RYH B;  3IAY A;  4CS4 A;  4NVP A;  5CA0 A;  3UQ8 A;  4RB0 A;  2R72 A;  2ZIO A;  3K5O A;  1FVI A;  1E4F T;  4DR6 B;  5KMG A;  4DV5 H;  1VF7 A;  1TGO A;  4UCT A;  3RYI B;  5IJ0 A;  1IBM H;  4DV3 H;  3RTX A;  1TVK B;  2UXD H;  4JI5 H;  2WYO A;  4UCV A;  5EOY A;  3KAK A;  4TOI A;  4YHH B;  4U3J B;  4KHP H;  2VQF B;  4MV7 A;  4EFB A;  2HHH H;  4DR5 H;  4DRF A;  3TY9 A;  4D7S A;  1Q8I A;  4DR2 B;  4CC5 A;  4DV2 B;  3W1G A;  3CHX A;  3LML A;  5EYP B;  2GV9 A;  4ZOL A;  4DR4 H;  5D5Q A;  3J7A K;  4CH4 A;  1A0I A;  4I55 A;  4YJ3 A;  3U10 A;  5J2U B;  5CA1 A;  4CC6 A;  3NBZ B;  4PI2 A;  5LP6 B;  2OYQ A;  1G6U A;  3HXL A;  4RAY A;  4UCR A;  3JAM W;  1XK5 A;  1HNZ H;  1T5E A;  1XQ8 A;  5JH7 B;  2HGS A;  3RGZ A;  4DV0 B;  5D1O A;  5GON A;  1HNW B;  1L2Z A;  4LFA B;  1N34 B;  4I7H A;  4AQY B;  4X20 B;  4DUZ B;  5JCO A;  4RB2 C;  1TUB A;  4DR3 B;  4JI1 H;  4UCS A;  5K1X A;  1FFX A;  5LYJ B;  5ITZ B;  2E5L H;  2F1M A;  3RYH A;  5D5P A;  4AIL C;  3U11 A;  1S03 G;  4X66 H;  2ZM6 H;  4R7R A;  4UFZ A;  1ZHS A;  4OX9 B;  2R9A A;  4FLT A;  2UUC B;  1E4G T;  4TUY B;  3J80 W;  4KL1 A;  4B08 A;  4X62 H;  2VOB A;  3TY8 A;  4RZQ A;  4DV4 H;  1P8L A;  4DRX B;  2ZIN A;  2CW8 A;  1KMI Z;  4ZHQ B;  3QWU A;  1AN7 A;  5JCO C;  2UXB B;  2ZNJ A;  1DGS A;  4CS2 A;  4FFB B;  4EB6 A;  4CH5 A;  2Q7H A;  2F95 B;  3J81 W;  2Q2U A;  3JAK B;  2PYJ A;  4X65 B;  2YI8 A;  4LSA A;  5CA0 B;  3C0F B;  3H20 A;  3RF2 A;  1P49 A;  1XMQ H;  1FKA H;  5J2U A;  4NXN B;  5IJ0 B;  2XIG A;  5LP6 A;  4DK0 A;  2BTO A;  4DK1 A;  3HKD B;  4LR3 A;  3T1Y H;  1M0T A;  4B3R H;  4LF8 H;  3E22 B;  3HKC A;  5IWA B;  5LMN H;  3KXY T;  2YIB D;  2YIB A;  4LF5 B;  3RJ0 A;  4GKJ B;  3SJB C;  2F4V B;  4X20 A;  4JI8 H;  1XNQ H;  1SQG A;  3PN1 A;  3ZED A;  1N32 B;  4GLX A;  4DR1 B;  4YY3 H;  4Q0Y A;  1X4T A;  5JVD B;  4FM0 A;  4ZOL B;  5ITZ A;  4DR6 H;  4LFB H;  4RB3 C;  4LF6 B;  1L8D A;  5KHJ A;  5JJJ B;  3JAL B;  2UUB B;  2Q7E A;  4X1Y B;  1SA0 A;  4DR7 H;  1KU9 A;  4LH7 A;  4BW9 A;  2V4D A;  1MZB A;  4TUY A;  1GYF A;  5D1O B;  4JI3 B;  4RAZ A;  4O2A A;  2VQE B;  3VQW A;  4DRX A;  3N41 B;  3JSN A;  4JI6 B;  4D7T A;  3GB8 B;  4PDB A;  4NXM B;  1TUB B;  3SJA C;  1XMO B;  1IBL B;  4HNA B;  4JYA B;  4DV7 B;  4K0K B;  1P16 A;  5C8Y A;  1WH2 A;  1NT2 B;  1HNX B;  4O4H B;  3JAK A;  4J0M A;  3QG5 A;  3K59 A;  2F66 C;  4MTD A;  3K58 A;  1WPB A;  4B3S H;  4JI7 H;  4JI4 H;  3W1B A;  4CH6 A;  3CSX A;  1V9P A;  4DV0 H;  1JFF B;  3N42 B;  4GYC B;  3HKD A;  1BJT A;  1N34 H;  5BMV B;  4JV5 H;  3ICX A;  2PZS A;  5LA6 A;  1Q3E A;  3E22 A;  1TA8 A;  3VQV A;  2UUA H;  2CAZ C;  4RB1 A;  2MCT A;  1H2S B;  1I94 B;  1I6U A;  3N43 B;  1N36 B;  4F6R B;  4FLU A;  4EB6 B;  3T1H B;  5DIS C;  2KKW A;  3CB2 A;  4PHZ A;  1Z2P X;  4LNU A;  1HR0 B;  5JVD A;  4BWA A;  4B3T H;  4ETS A;  3SR2 C;  3L4K A;  4TV9 B;  4I9Q A;  4UCO A;  4BWS C;  5LMU H;  1N33 H;  4LF4 B;  1ZHQ A;  3JAL A;  4FM2 A;  4DV6 H;  3TY5 A;  3RGX A;  3ETQ A;  4X1Y A;  4LFC H;  2BTQ A;  5FD6 A;  4L8J A;  1YEW A;  2RGV A;  1SEI A;  3HKC B;  2UXB H;  1O9G A;  1XI1 A;  2HIV A;  4JI0 B;  4FLZ A;  3ZS8 C;  4LF7 B;  4EEQ A;  4O4L B;  4HNA A;  1WN7 A;  2WDT A;  2CFM A;  5FD5 A;  4NXN H;  1QQC A;  4O4H A;  4FM9 A;  5KX5 B;  1TAE A;  2JS5 A;  3JAT B;  1J5E B;  5LOV A;  4DV5 B;  3SJC C;  1SA0 B;  4IHJ B;  3FMA A;  2PTM A;  5LXT A;  1CKM A;  1IBM B;  1JFF A;  4DV3 B;  3RYF B;  1IBK H;  3OTO B;  2UXD B;  4JI5 B;  4O2A B;  5BMV A;  2F4V H;  3UT5 A;  2YCH A;  4KHP B;  3SGI A;  2XHB A;  3N2K B;  4DR5 B;  5C8Y B;  2UU9 B;  4B3M B;  4PZ6 A;  4F6R A;  4JI2 H;  5LL6 b;  4LF6 H;  3VNN A;  3N44 B;  2VWK A;  3F8N A;  3NBY B;  3U0Z A;  4TV9 A;  4LF9 H;  3A2F A;  2HVQ A;  4DV1 H;  4M7E A;  3CVZ A;  2VWJ A;  4JI3 H;  3K3V A;  2VQE H;  3JAR A;  5JJN B;  1ZAU A;  5LA6 B;  3VQY A;  3THO A;  3JAW B;  1XMO H;  4K0K H;  4AHC A;  5IJ9 B;  1XDN A;  1VS0 A;  1HNX H;  2PYL A;  3HKB B;  4O4L A;  4JI1 B;  4LNU B;  5K1P A;  3RYC B;  3BAB A;  3HKE A;  1Q5O A;  3WB1 A;  5KX5 A;  1XNR B;  5FPR A;  3JAT A;  4X66 B;  3B2E E;  2ZM6 B;  4YJ2 B;  5LP6 C;  2YI9 A;  2BTQ B;  4IHJ A;  4DUY B;  2EX3 A;  4YHH H;  3K5L A;  1M5I A;  4A2B A;  2UXC B;  5D1P A;  2E3C A;  3RYF A;  4X62 B;  2VQF H;  4DV4 B;  1I94 H;  5JJE B;  3GJX B;  4GKK B;  4DR2 H;  1M93 A;  5IYZ B;  4DV2 H;  3N2K A;  5FPO A;  4IIJ A;  5CB4 B;  4PZ8 A;  1I7F A;  4PZ7 A;  3RGB A;  4LF4 H;  3BA8 A;  4O4J B;  1Z5W A;  1FJG B;  4FM1 A;  1O75 A;  5LOV B;  3MAQ A;  1XMQ B;  3MWM A;  3N6X A;  1Q43 A;  4Q6G A;  3BPZ A;  4ZI7 A;  5LXT B;  5BR8 B;  1HNW H;  2PY5 A;  1Z5V A;  3T1Y B;  4UCU A;  4MV9 A;  4LFA H;  4X64 B;  4I50 A;  1B04 A;  4B3R B;  3EYY A;  4AQY H;  4JI0 H;  4DUZ H;  3UT5 B;  5LMN B;  4FLW A;  4LF7 H;  2HIX A;  3JAW A;  2WE6 A;  4DR3 H;  4A2A A;  2ZCE A;  4JI8 B;  5IJ9 A;  3HKB A;  1J5E H;  4YY3 B;  2O03 A;  3JAS B;  2W57 A;  3RYC A;  4EQ5 A;  2P22 C;  4LFB B;  4OX9 H;  5KHH A;  2VUG A;  3K5M A;  2F93 B;  2UUC H;  4FVM A;  3KYH C;  4X1K B;  4O4I B;  4WBN A;  3RWR D;  4LMY A;  4YJ2 A;  3OTO H;  1HR0 H;  4DR7 B;  3BRC A;  3JAR B;  3S24 A;  5EIB D;  2RJZ A;  1CKN B;  2KSW A;  2UU9 H;  4B3M H;  5IYZ A;  4X65 H;  5FLX W;  1SQF A;  5CB4 A;  4MTE A;  5JQG B;  4K8X A;  1JMK C;  4O2B A;  3HKE B;  4TQD A;  3VQX A;  1WNS A;  4O4J A;  3QF7 A;  3IG0 A;  1XHZ A;  4FLX A;  2HVS A;  1Z2O X;  5KHI A;  4B3S B;  3QTC A;  4JI7 B;  3RFR A;  5EZY B;  4JI4 B;  3N2G A;  2PGG A;  5EIB C;  2P5O A;  5IWA H;  2ZIM A;  4LF5 H;  4I4T A;  4CH3 A;  4GKJ H;  4JV5 B;  3BHP A;  1BGW A;  1RSO A;  4CS3 A;  1N32 H;  2UUA B;  2R70 A;  2HHH B;  4DR1 H;  5FNV B;  4IIJ B;  2RGR A;  3DSQ A;  4HBN A;  1XNR H;  1S5J A;  1O9H A;  2UUB H;  3JAS A;  4ZIB A;  4B3T B;  4DR4 B;  3RYI A;  5LMU B;  4DUY H;  4ZI7 B;  1N33 B;  4X1I B;  4X1K A;  4O4I A;  3RR5 A;  2IM9 A;  3M4I A;  2UXC H;  4PI0 A;  1TVK A;  4DV6 B;  4APM A;  3DF7 A;  4LFC B;  2Q7G A;  2Q0A A;  2PUS A;  4GKK H;  4I50 B;  1HNZ B;  4JI6 H;  4U3J A;  5J2T B;  3K57 A;  1CKN A;  1S68 A;  1CKO A;  4NXM H;  4TV8 B;  3KAJ A;  3JSL A;  1IBL H;  4JYA H;  4DV7 H;  1XHX A;  1X9N A;  5EYP A;  2JGU A;  3K5N A;  2QJ1 A;  3BAA A;  5JQG A;  2OWO A;  1FJG H;  3KAL A;  2E5L B;  2JVD A;  3WB0 A;  5KMG B;  5KHG A;  2Q2T A;  5BR8 H;  1Z2N X;  4WBN B;  2HVR A;  4X64 H;  3L2P A;  3L4J A;  5EZY A;  5JH7 A;  1SKV A;  1IBK B;  3LNN A;  4LH6 A;  2CW7 A;  4LSX A;  3GDE A;  4E6N A;  1M0W A;  2YXL A;  1JJO A;  2ZNI A;  1N36 H;  3T1H H;  2RQ6 A;  1D5A A;  2FE3 A;  3BA9 A;  5FNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...