3BA8A

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
b'PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba8A02
1S68A 1ZAUA 4EFEA 1V9PA 5DISC 3T1YB 2Q2TA 1CKMA 1VS0A 4JI5B 4LF4B 3NBYB 4X62B 3JSNA 3BA8A 4LFAB 4YY3B 2OWOA 3L2PA 1HNXB 2UUBB 1IBKB 4DV5B 4JI8B 4GKKB 4UCVA 1IBLB 4JI3B 3RTXA 5IWAB 1I94B 4TOIA 4DR6B 4UCRA 1HNZB 1XMQB 1TAEA 1N33B 1XMOB 4LF7B 1DGSA 4B3SB 4EFBA 4B3TB 3NBZB 2HVSA 4DV2B 4X65B 1XNRB 3W1BA 5FPOA 1X9NA 1TA8A 3PN1A 4DUZB 4B3MB 4OX9B 4LH7A 4JI4B 2UXDB 3BAAA 4DR1B 1N36B 4UFZA 1FJGB 3TY8A 2UXBB 1XDNA 4DV1B 4DRFA 4DV4B 4LFBB 3TY9A 4DV6B 1XK5A 4E6NA 2VQEB 4JI0B 4YHHB 4NXMB 4PZ8A 1N34B 3TY5A 4K0KB 4LF8B 4X66B 1P16A 3GB8B 3W1GA 2UU9B 2HVRA 3VNNA 4GKJB 2ZM6B 5LMNB 5FPRA 5BR8B 3QWUA 4LF5B 3OTOB 4EQ5A 4NXNB 2E5LB 4DUYB 1FVIA 4DV0B 1B04A 4B3RB 4LFCB 4EEQA 4UCSA 3RR5A 4LH6A 1P8LA 4UCOA 1J5EB 4JYAB 4JV5B 1CKOA 1IBMB 3NC0B 3KYHC 3T1HB 2HIXA 4JI2B 3UQ8A 2HHHB 3W5OA 4CC6A 3BA9A 4AQYB 4GLXA 1HNWB 2HVQA 1CKNA 1CKNB 1XNQB 4DV7B 5LMUB 5D1OA 4PZ6A 5D1OB 1A0IA 4KHPB 4DR2B 3GJXB 4PZ7A 2CFMA 2F4VB 1HR0B 4JI7B 4JI6B 2VUGA 4UCUA 3JSLA 4UCTA 4DV3B 4DR3B 4LF9B 3SGIA 4DR4B 2UUCB 3BABA 2UXCB 4DR5B 1N32B 3GDEA 5D1PA 2VQFB 3S24A 2Q2UA 4DR7B 2UUAB 4JI1B 2HIVA 4X64B 4CC5A 4LF6B
chains in the Genus database with same CATH superfamily
1JJOA 4FK5C 5IJ9A 3BEHA 5DGIA 3V6KA 2VQFO 3ZHTA 1VIBA 2UUAO 2ZR2A 5EWFA 2CW8A 1Y76B 2QM7A 4LFAB 5JJEB 2WA4A 3TETA 3BPZA 3DC5A 2W7OA 2FK1A 2CTPA 3TIIA 1Y1VG 3L75H 1V55B 4OXSA 2DQ0A 4BBRG 4DV5O 2R92A 5L1KA 3VQYA 2OCCC 4QIWE 3HPLC 3DTGA 4JI3O 1M57C 2XAGA 3DC6A 4DIMA 4I9WA 5FD6A 4JAAA 2DYRB 1N33O 2GUZA 4YJ3B 3I4NG 1SQGA 3ETQA 3N2GA 3SYAA 1RJPA 2XAHA 1S5HC 1KP2A 4F4LA 2JEUA 1N36B 3OEEG 2W6JG 5K1XA 5KHKA 3CPWU 4F6RA 3OGIB 3QZ8A 2IJJA 4DV0H 5JVLA 2EX3A 1NTMH 3K3WA 1N8RW 1WSCA 1N34B 2MW2B 2RNBA 3FB6C 3TY5A 4M9UA 5KKNB 4YR3A 1M1KW 2HVJC 2LFSA 1NVPD 1QQCA 2UU9B 3H20A 3F7YC 1JLLB 1NVPB 3TIGA 4PDVA 5LMNB 5KUMA 2DMXA 4AHCA 3QWUA 2JJ1G 1C30A 5BWUA 3D36A 2UU9H 1KEEA 1H2LA 5EOYA 4X1YA 1HWYA 3SDLA 4FLWA 1K1SA 4ECVA 2P90A 1VARA 1K9MW 5H5NA 4ZHQA 4DL6A 1I50A 5KT7A 4I4TB 5B3SB 2B63A 5CB4A 1GMGA 1PL4A 3E22B 4A3CG 1YHQV 3SJBC 3HKZA 5C4XG 1AUVA 3I5DA 4RNMA 4IR1A 1BHAA 4X1IB 1QLEC 5DMXA 3TQ1A 1WJZA 4LF4O 2W6NA 3PW7A 5I5SA 2CGNA 1ZTEA 3H40A 1EYZA 1IX9A 4YY3O 2C2EA 2W8KA 1GYFA 1NKDA 3JSLA 2Q7DA 3HB9A 1SZXA 1KKDA 3LNMB 4DR5B 4ZI7A 4IRKA 1F4NA 4JI1B 3JAMN 4DR6H 1HNZH 4JF3A 1MMMA 2VPQA 1AP6A 4MSWC 4MS2A 3U54A 3DTUB 4JI1H 1O9GA 4ED2A 3Q8PB 3ASOC 5C8YB 2Q7HA 4C5CA 3AW8A 1PNLA 5B1BC 1VQ4V 5KFBA 2Y4UA 2JGDB 4QIWF 4TSFG 4X62O 5EYPB 1IBKB 3K5HA 4A3EG 3GTQA 4K8XA 1R3KC 3V6HA 4LNUB 4I4TF 5BPHA 2JEGA 2YZNA 2ZXWB 1THZA 1YSCA 4TOIA 4R8UB 1PP9H 1VF7A 2FLLA 2VQEO 3EVKA 4QPKA 4JI0H 4L87A 5H9CA 4O7YA 4DV2B 3B2EE 1ULZA 1P7BA 3VMMA 2R9RB 2VWKA 1VQ9V 1X9NA 4CH3A 1KJ8A 4MTXA 5HFMA 2V5AA 4ECTA 4Q6GA 2PY5A 4J9RA 3HOWG 5LGNA 1LR1A 3JD4A 3R5FA 4O3QA 2IH1C 3N27A 1M56C 1RJRA 4LF5O 4IYIA 4I55B 4DQNA 1Q6UA 2KG7B 3KAKA 2ZJTA 5J2UA 3N41B 2YU9A 2FYUH 3CRQA 2BSKA 4PDLA 4J9MA 4DV6O 2COIA 3GIMA 1H2NA 2R70A 5CBFA 4KUMA 1F51A 3BCCH 5IT9N 1JXLA 2XCPA 4WFFA 4DRXA 4TQSA 5EBMC 1PK8A 1SC5B 1AJNA 2UVRA 1H2GA 5KFEA 1HNWH 3KXYT 3K5IA 2AGPA 2NNUA 4DUYB 2F66C 2VRZA 5KFIA 1VQKV 3SPCA 1UJWB 2ZT9B 1P8LA 4I9QA 3LQSA 1M6VA 3STZC 2QK4A 3CC2V 4YIPA 4JI7H 1ZL8B 4KFMA 1KMIZ 2JS5A 3TXQA 1IBMB 2V4QA 3T7AA 5K3WA 3SPIA 1SETA 4JI2B 3L4KA 3UQ8A 2X7RB 2KSDA 3HXLA 3T5JA 3CMEV 3JD0A 5DGAA 2KSWA 2IU3A 2I8CA 1DAAA 4JI2H 3ICXA 5LMUB 4PZ6A 5D1OB 3ZEDA 2CTQA 4I55F 3JAKA 1PKXA 1OCOC 5CE8A 5EBWC 5BMVA 5FNVB 5LHGA 5F2VO 1A0GA 2V59A 3OW2U 2DIKA 5A9GA 1VQOV 5B1AC 3LSQA 1HR0O 2W6ZA 4DV3B 4DR3B 1I1KA 4TUYB 2EIMB 4JI6O 3CEBA 2IM9A 1FFTB 3BABA 2C2AA 4FLTA 1M5IA 3Q8SB 1Q6HA 5DGBA 4DV3H 1I5XA 5JQGB 2EIJC 4FS1A 2UUCO 3GIJA 1OCCB 1XMOH 3T1YB 5LXTF 1HNXO 2AGQA 4A3LG 2F95B 3D36C 4CKBA 1NQTA 4C5AA 4DUZH 3G6XA 4FLYA 2DPIA 4PD4F 1Y1VA 4PDRA 4CH5A 3JASA 4Z1VA 4PA7A 2W6PA 1L0LH 3JALB 4DR1O 3OAAG 3R9RA 1V54C 3O9OA 2QWNB 3ZS8C 3B4SA 4UUGA 5KFQA 2QWPB 5FD5A 5IWAB 1WA8A 1WCMG 2YEVB 3M4IA 1K97A 2WLIB 4YHHO 4CH4A 4B3SB 1A3GA 4ED8A 4H33A 2DYSB 4X65B 5IYCG 1QNMA 1EN4A 3Q4HB 5LGTA 5FNVF 2X0SA 2A9HA 4QWEA 4B3SH 2EINC 4CZZA 4XX0B 3C0FB 2A3QA 2E5LH 4TUYF 1Y74B 3JRWA 2I87A 4DW1A 4TQRA 3RT3C 4X20B 4LMYA 1H2MA 4EBCA 4X9QA 1ZLZA 4JAUA 5BWVA 1B6SA 4RZQA 3RB0A 1GM8A 1JKJB 2PTMA 3RYIA 3LSSA 2FLNA 2AHZA 5GTIZ 4X66B 1L2ZA 1U97A 2DE0X 3F8NA 3K3VA 3T1HH 2IA6A 3RAQA 4QE7A 1CXZB 4FLXA 3J81W 5KFHA 3K04A 1Y1WA 4O4HA 2BOCC 4DV7H 2XNDG 1Q5OA 3L72H 4DR2H 1KD1W 2JEFA 3V6JA 4MAMA 3RR5A 4H13B 3E89A 2V58A 2IMWP 4JYAB 1Q8IA 1CE8A 1CKOA 4DV0O 2OH2A 1D5AA 2A7WA 3T99A 2XOKG 2WAQA 4H37A 5KAIZ 4JV5O 3FMAA 2Y4TA 1WAZA 3Q2OA 4BY7G 1CKNB 4RQFA 2FB9A 1K92A 1E4GT 2K9PA 5DQIA 4Q8EA 2KQXA 1RM1C 5DG7A 2QKSA 1AVMA 3CRMA 1EZVH 3OHAA 5EDWA 1ORQC 1VQ7V 3K79A 2F4VB 2GLTA 3TCUA 1YIJV 4ED0A 2XCLA 3BACA 3N44B 4JUZA 2BQ3A 4UCTA 2F4VH 2AGAA 2PMZA 1GM7A 2VQFB 2UUAB 4TV9F 1VF5B 4IIJB 5BPFA 1V9PA 2VQFH 1VS0A 3FX7A 1EHIA 2UUAH 3TK1A 1SQXH 1RSOA 2FB5A 5KFZA 3LULA 5LHIA 1K1QA 1E79G 1G8MA 3I12A 4DV5B 2VS0A 4MVZA 1SQFA 3UM7A 5KX5A 4XZ3B 4TVIA 4JI3B 4BWSC 2UUBO 3MR3A 5C1OA 5DM6V 4DV5H 3JZ6A 3KCYA 1BGWA 1PX2A 2DN9A 1N33B 3TXSA 1GO3E 3GIPA 3ZHUA 4JI3H 1R3IC 1R6TA 2P5OA 3NGDA 5EZYB 2HEPA 2XGQA 4B3TO 5K1PA 4DL2A 1WN7A 1XNRO 4A3DG 1EN6A 4DW0A 1F4MA 2NUAB 1Q90D 5EC1C 2DAAA 1DTOA 2YDEA 3LSUA 1TWCA 2RGVA 1YXBA 3NUAA 5KG1A 1P7GA 3G67A 4CH6A 1G4YB 4UUJC 4IIJF 1RK6A 4DV4O 3KTMA 2ZQMA 4O7RA 5FLXN 1ZSPA 1JX9A 3E8FA 3FKSG 4IRCA 1AR4A 1WPBA 4GC6A 2R92G 5AG2A 4RB2C 2QKAA 4IWXA 1FYJA 2AHYA 4QGPA 2W6MA 5KMGB 2BCCH 2QEXV 4A2BA 3CCEV 5KHIA 5CA1A 4EEQA 4FJCC 4ECYA 2FL4A 3KZIZ 2OIEA 2GBOA 3B09A 1OCZB 2E2IA 3S3XA 1I1LA 4MV7A 2WTFA 1JQ0A 4O4IA 1AJPA 4OPHA 1YJWV 1FPOA 4YR0A 3JAMW 3RAXA 2E2HA 3ZN0A 5J2TB 4YP3A 4J9QA 1A0IA 1HNWO 5EK0A 3WB0A 4O2AA 3A0RA 1YDXA 5KFUA 4JI5O 3OR7C 2YIAA 4LP8A 4LF4H 2YS6A 3OGCC 2Y0SA 2R8GA 1X59A 4YY3H 3KHLA 2QGNA 1JMKC 1KP3A 1UC8A 1TUBB 5IYZA 3GWKC 4CE5A 1N4CA 2E74B 2H94A 1WR2A 4ECRA 3IFXA 2R82A 4CC5A 1TVKB 1K83A 4O4JF 4FFBB 1M0TA 1SQBH 3JAWB 3NBYB 3RYCB 4X62B 4I0XB 4LF6O 1FXKA 3JD1A 1DV2A 4B3MO 2CAZC 2Z0AA 1B6RA 4O4LF 2NU9B 4J9SA 2Q0OC 3DSQA 1GO3F 4X62H 1WCMA 4JI8B 2LP7A 4IL6Z 4B7KA 3HKDA 1URFA 5J2TF 4B08A 3W7TA 2W9CA 2VQEH 5ITZB 4IHJA 4R6ZA 1NH2D 5D5PA 3NBZB 2HVSA 3AG1C 3ETHA 4D7TA 4YBZB 1NH2B 3ZX6A 2E76B 4LF8H 3WG7B 3PN1A 4O3NA 5JH7B 1CQIB 2LJ2A 1BZKA 1SCUB 1MG1A 2UXXA 1Q81W 2UXDB 3BAAA 3RN4A 5JVDF 3GTMA 4GKJH 4DUZO 3H9VA 4HR7A 5LOVF 1BQZA 4JZGA 4QWBA 2EIKC 4LF5H 1OCRC 3GV7B 4YJ2A 4NXNH 1YTFD 1AR1B 3RFRA 3D8CA 4DK1A 4DV6B 2IJIA 2BE3A 1YTFB 4WFHA 4ME6A 4ED6A 1M7JA 1JCHA 2NU7B 2UXNA 3PO2G 3U11A 2WLLA 3OMAB 2OCCB 4YAKB 2F93B 3DTFA 2YRXA 3HBLA 3N2KA 1M57B 1BCCH 4RNNA 2HHHH 2W57A 3HKEB 4BIUA 1GN4A 1P49A 2HGWA 1H2SB 1SERA 5BR8O 5IYDO 2R93A 4LH6A 2Q8VA 2ITDC 5CA3A 3MD0A 4FZ1A 1DK1A 3CJHA 4CS2A 4UXNA 4TV8B 4K3AA 2HIXA 3N43B 3ZMUA 5JH7F 4ED1A 4CC6A 2WB1E 2CGOA 3CX5F 5KFKA 4DR4O 4WCEV 4A3KG 3WO1A 4LF9H 3CCQV 2WE6A 5L9XA 2CUGA 1YITV 3LDDA 5KG0A 3SE7A 4Q8FA 2UVWA 3N6RA 3HOYG 3E35A 1FXVA 2YS8A 1XEQA 4QJFA 5DQHA 1QBZA 1H2KA 3T9DA 3ZRXA 4DR2O 1HR0B 3VOTA 4GZRB 5DQGA 4JI6B 2DLNA 5K2MA 4R8CA 4ZOLB 1JPXA 3PO3G 4FE2A 2AZ0A 4FPPA 4ECXA 2HKOA 2WPDG 3HKCA 2R8KA 3K0GA 1SS3A 4JI6H 4F4WA 1K73W 2UUCB 3CVZA 3SI8A 1BS3A 1HNXB 5LA6B 3K3PA 1XMQO 2W71A 2UUCH 4HNAA 3SYCA 2CE4A 4D7SA 2NR5A 2E75B 1BT8A 1Y76A 1LUVA 3K5OA 4WFAV 2XHBA 2R84A 2EJ7A 1QLEB 2ZCEA 3L2PA 1FS0G 4JI4H 2RJZA 4UB6Z 1K7DA 4J9LA 4DR1H 5KFOA 2UXBO 5C1PA 3RYFB 3G80A 3VQVA 1S76D 1M0WA 4MA5A 4GT1A 1RK5A 5KFDA 2JA6G 3FD9A 2ZE7A 4MV6A 4FIPC 1XILA 4YHHH 2DWDC 5TISZ 2VOBA 4NXMH 3K9AA 2FMLA 2HLDG 1XI1A 3V4ZA 1O75A 4AI8A 4NVPA 1H8EG 1WB8A 3T9AA 4XDKA 2COJA 3ASOB 2PVPA 4J9YB 1R73A 1VQNV 3QQMA 2ZDQA 2Y69C 2M6YA 5BY1A 1RJQA 1UNNC 3R65A 3JARB 5DLGA 5HNEA 3A2FA 4E6NA 1YI2V 1SA0A 3OSNA 5LA6F 5CA0B 4JYYA 3LP8A 3AK2A 4A2AA 4U7OA 2JIZG 3H3VH 5DECA 4JV0A 3E86A 2HVRA 1GN2A 4K0KO 1SFOA 3VNNA 2CQYA 2BR0A 3N40P 4YXWG 3W7XA 3K5MA 2HHFB 1FXKC 1SZTA 2B9ZA 2OT5A 3P3PA 1CEZA 4CKCA 4FFLA 1FVIA 3ABTA 4DV0B 4KHPO 3SJCC 1M56B 2CNUA 4NZMA 5BWTA 2YZLA 2C00A 2NU8B 4JV5B 1PL0A 5LP6C 3TW7A 3D3QA 4X89A 4QIWA 1Y6XA 5A2QN 4FFNA 1YJ9V 1FAFA 2RCVA 4JV5H 3Q8QB 4I4TA 3CYOA 5IJ9B 2D3OW 5I5VA 1RYRA 3WO0A 1Q82W 1N32O 4IYHA 3GTLA 2PYLA 1PPJH 2WLMA 1H8HG 2GDSA 3AG3C 1AB3A 2W7PA 4PZ7A 2FP4B 3ORQA 4YB8B 2BTQA 4UV8A 3AG4C 2XASA 1I7LA 5CA0F 1Y1WG 1S5LZ 5KT3A 4P30A 4TT3G 4MT8A 4O2BB 5I5TA 2LFRA 4BY1G 2M7WA 1KKCA 4GKKO 4GX5A 3GQCA 4NTXA 4EB6B 4HYKA 1OJHA 2ZDIA 4YJ3F 5BZBA 3OUFA 3OFNG 1ZAUA 2UVUA 5HFLA 3IN5A 2GUZB 1VMGA 1NJIW 2HGSA 2Q2TA 4LSAA 3N2GB 4DXWA 3VPBA 4J9PA 2KB1A 1OCOB 3RUPA 4E2LA 2UUBB 4NB5A 5EYPA 3HT5A 2LGWA 2YXLA 1SKVA 5JWPA 4LNUA 4J7KA 5B1AB 2AXTZ 3IGAC 2UUBH 1HDJA 3IC7A 4DR6B 1HNZB 4BIZA 2YZMA 3ZRSA 4B3TB 5FLXW 4L8JA 2YIBD 3G6VA 2EIJB 2YXYA 1XNRB 4E4EA 1QR8A 1B33N 3UCSC 4FLVA 4B3TH 2A0LA 4U6PA 5KFXA 1VF6A 2BTOA 1XNRH 4R7CA 1LUWA 1R6KA 4O2BF 2WWWA 3GTOA 2XAJA 3EXAA 4X1YB 4I55A 1ET0A 4DRFA 2FPIB 1V54B 4DV4B 5L3FA 3ETJA 1OBDA 1G1XB 1BSMA 3H1IH 4JI0B 2ODMA 1J5EH 2GTSA 4DV1O 5F9NA 2X6CA 4RU9A 5B1NA 2O57A 1EUDB 4DV4H 2LGQA 2YS7A 2NU6B 5CB4B 5DLFA 2QSAA 2QE7G 1GAXA 3NXSA 2ADQB 4LF8O 4QWAA 2EINB 4FLUA 5D8DA 5IP7G 3UFXB 3THOA 4QW9A 3W7UA 1R9TA 3E8GA 2DQ3A 4GKJO 1HP8A 5LXTA 2AGOA 4NXNO 1K5QA 3U9TA 1V55C 2RDJA 3HKBA 3P32A 5L1IA 2B5UA 3T9FA 5C44G 5IJ0B 2PYJA 3W5OA 2C35B 1JA8A 3GWOA 5CM0A 4GLXA 1HNWB 4TM5A 3C3SA 2HHHO 2EZPA 5D1OA 5C8YF 4DR7H 3RF2A 2CDYA 3ZRVA 5JJNB 5DEDA 3RB4A 4GUNA 4PA6A 4ASUG 3OUZA 5FNVA 3B8MA 3APOA 4JI5H 5KA6A 4JI7B 2I80A 2QR4A 4I50B 2RGRA 5FR9A 3QVNA 5L3EA 3QF7A 1K5SA 2YIDA 2CNVA 4FM2A 1S9FA 4J41A 4GC7A 3RB3A 4LF6B 4LF9O 2MCTA 5IYCO 2P06A 1KUQA 5DISC 3GIDA 1P84F 5LYJB 1E4EA 5IYBG 2C2RA 1RM1B 4X64O 2LW7A 2CNQA 3K08A 4FFRA 1N0JA 1GM9A 2RN9A 4KXRA 3ZRWA 4LF6H 2WYOA 2QTOA 3RGXA 4B3MH 4P2ZA 4PA9A 1DF4A 1CP9A 1DV1A 1AJQA 3JALA 2HFEC 4F4ZA 2JA6A 5KT6A 5J2UB 4JYCA 2R8HA 4LFBO 2BSKB 3R5XA 2WAMA 3SPGA 1XMOB 3RWRD 4DRXB 2PI4A 5EWEA 4PA4A 1KBHA 1Q3EA 3M99B 3IC9A 4DUZB 3OT7A 4J42A 5KG6A 3OE7G 1W96A 2EJ2A 1TUEB 4PJ0Z 5KFTA 2R7ZA 4I50F 3SNOA 4Z2WA 3OTOH 2EJRA 5KG4A 2PF4E 4JI4O 4X20A 3TY9A 4C7UA 1XK5A 2PN1A 4Q44A 4LFCH 1Q7YW 1BXRA 5JJJB 5LYJF 4DL7A 1TWHA 2K1EA 2OYQA 1MABG 2ZDIC 1S0NA 4NXMO 4WBNB 3G71V 1D2DA 3N42B 4A93G 3AG7A 2ITCC 1OHHG 4WFGA 4H44B 4TV9A 5BR8B 3L4JA 2E5LB 1M4UA 2H8PC 4IWYA 5BMVB 2AZ2A 1B04A 4BAYA 5KFMA 5BR8H 1BL8A 2YC0A 2R6FA 2QTSA 3TEKA 4ICGA 3STLC 2FTKA 4WD3A 2ZXWC 1Y4MA 3KYHC 3T1HB 5JQGF 3WWJA 2ZNIA 2DABA 4G27B 3JCUZ 4RB3C 4BIOA 2HJFC 4DR4H 1CKNA 3UT5A 3ZBHA 1K4CC 2COGA 2ODTX 5C5JA 4F4YA 4DV7B 3HOZG 3CC7V 2DJVA 4KL1A 1CPYA 2HVKC 4DR2B 4RUFA 2HDKA 3DAAA 3K9SA 4MTFA 3U0ZA 1RFYA 3JASB 3IG0A 4LFAO 4FS2A 4DK0A 1M9NA 2KKWA 1WA8B 4N21A 1V51A 2W9BB 4WBNF 2R93G 1Z2NX 2ARHA 3PR5B 5B66Z 4CMFA 4IIJA 2CW7A 2OCHA 2AQ4A 4FM0A 5DN6G 1XMQH 3ML0A 4ZBMA 1AI6A 1NTKH 4O86A 3F5TA 2O03A 3TGUH 4LR3A 2Q7GA 2EIYA 2F43G 3RBZA 5JQWA 2F1MA 3K06A 2NN4A 1N36O 4WHXA 1Z2OX 2UXBH 2C28A 2YW2A 3ABLC 4O81A 1VQMV 4WF9V 4UV9A 1N34O 3JATA 1TA8A 3GIKA 1GLVA 1MA1A 2Q0AA 2QYZA 4BWAA 4LH7A 1IXMA 2YCHA 3KG2A 5LMNO 2F23A 2R85A 4FBTA 3VPDA 2DWEC 5C3EG 3M9MB 2CK3G 4HQ6A 1XQ8A 4RB0A 4ED7A 1VQPV 1QVGU 1CQJB 5A2QW 3H1JH 4K0KB 3U55A 3WB1A 1FFXB 4ECQA 3RYHA 1BQ0A 3G8DA 3AG1B 2JK5C 5KG2A 4AYBE 1YEWA 4K0KH 4NKGB 1XDCA 3DXRA 2PUSA 3K58A 2L6LA 5KMGA 4MW3A 1XNQH 4O4JA 1SEIA 4IT5A 2H3OA 4Y8VB 4KHPH 2EIKB 1OCRB 4UCSA 3J80N 4EBDA 3HB3B 3QO7A 4O4LA 4FM1A 3U9SA 2GV9A 1J5EO 1SYXB 3MJFA 4C2MA 4LSXA 1PV0A 3D3IA 4FGRA 1UPGA 5IDJA 5CN0A 1IYEA 4J9KA 1ROPA 5J2TA 2HVQA 1MZEA 1BMFG 4DR5O 4L1KA 1N32H 3L71H 4LBEC 1RSOB 3PW5A 4O3SA 1AR5A 2FPGB 3JRXA 4HBNA 4QWCA 4DYLA 4MV4A 5IY5C 5JVDA 4FVMA 3BQ2A 5LOVA 3CSXA 4X1KA 1VP7A 3SPHA 3CCVV 5EZYF 4GKKH 1ZHQA 1JDBB 4A3GG 2W6QA 2ZIMA 3L74H 1TVKA 1T5EA 2XAQA 4EKWA 5EC2C 3P30A 5KFNA 4DV2O 4DR7O 3JAWA 2QWOB 4LF4B 4I0XA 3GIIA 1NI8A 2P4KA 3ZHQA 4YY3B 5HV6A 3IJ4A 2Y48A 4MV8A 1TWFA 5KHJA 1AI5A 4U3JB 3ZMTA 2DZDA 2EJ3A 1FJGH 2XAFA 1IURA 5CBHA 4J9ZB 1XL4A 4ABMA 2JVDA 4DL3A 2ZE8A 1DGSA 1R3JC 1RP3B 2CH7B 1L8DA 4GCZA 3SJQC 4X88A 4EBEA 4EEYA 1P4RA 4EYHB 3CCMV 1LNQA 4ZIBA 1Q86W 3CCSV 2R72A 1J95A 2JJ2G 4E4TA 1Y14B 5KLVH 4D6TH 5E25A 5CA1B 2B1GA 3B8NA 4DV1B 3GTKA 1KC8W 2ILMA 1OV9A 2VQEB 5KFYA 5KFGA 1S0MA 3WWIA 1PNKA 4DV1H 5BWRA 3G6BA 4O7SA 4JGSA 4PA3A 4LF8B 5KHGA 1IBMO 4UVBA 3UYYA 4G28B 5IT9W 3GIQA 3AEIA 5I5YA 3QZ7A 2N05A 2Z02A 2JS3A 4GKJB 4AQYH 3CEIA 3T2MA 3HR0A 4LF5B 3VPCA 4NXNB 4O2AB 1KTAA 3K5LA 5LMUO 4LWSA 1S10A 2IJHA 1RYSA 1NR1A 1UC9A 1DLBA 3OTOO 4HN2A 2Y69B 3JCZA 5BWWA 5KS8A 3FKIG 1BNCA 4B3RO 3ZIAG 4LFCO 2YYAA 2XT9A 1ZUQA 5IYZB 4A3FG 1W2BU 1IVSA 1MOFA 2HHHB 1AILA 2Z5UA 3MHHC 3QO5A 1JFFA 4Q20A 3X2QC 5CA1F 2Q7EA 1HW7A 4RAYA 1FXKB 4W4LA 5IP9G 4BXXG 3Q8RB 2JEJA 4JV1A 2CZGA 2VUGA 1KU9A 2ZD9A 3M9NB 3VA7A 1S3JA 5LP6B 1GRJA 2HJDA 1IXBA 3FB8C 2R8IA 4LF9B 1DF5A 2W9CB 3FAVA 3S24A 1I08A 3GDEA 4IHJB 4NYKA 4O82A 5IWAO 4X64B 2Q67A 5LA6A 4O2AF 3GTGA 4P9OA 4LF7H 4IGGA 3W7SA 2ZGIA 4UVAA 2ZDGA 3K59A 4X64H 4R7RA 1VQ5V 3AG3B 3L70H 5EIBC 3ABKC 3H4BA 1S5JA 2OLSA 4J80A 4CMDA 3AG4B 4MA0A 1WNSA 4PWQA 5GONB 1BHBA 2JA7A 3RYFA 3RTXA 5KFVA 2WB1A 1C3OA 4FFMA 3H1LH 4LFBH 2WLLB 1E1QG 1TAEA 4H0LB 3QFFA 2W6IG 3N2KB 3H01A 1BE3H 3RV3A 4GX0A 4HZ3A 3T5LA 4K8ZA 5EWGA 4KP4A 1VQ6V 4EGJA 3VQWA 4X66O 5L3DA 3AG2C 4RQEA 3CMAV 4JI4B 3K5NA 4DR1B 5LP6F 4Q4DA 4I5SA 4OX9O 2HR3A 1XDNA 4TV8F 4G3IA 4RAIA 1VKZA 3DGEA 1S0VA 4JASA 1R1BA 3CJHB 1GK9A 3ETGA 1FXHA 1KJQA 4YHHB 4JYAO 4NXMB 4PZ8A 3T5HA 1WPXA 5FL7G 3GTJA 3ABMC 1PM9A 2QM8A 4IRDA 4J9OA 1R3LC 1N0NA 2RF4A 1SQVH 3BQ1A 4NZNA 2C2DA 2V1DA 2JEXA 2Q68A 1I7NA 4YJ3A 1Z5WA 3R5HA 3ASNC 3JZFA 5GONF 4ZOLF 3O65A 2ADPA 1XUQA 2WLJA 3CB2A 1EN5A 5B1BB 1IOVA 2P67A 4PBCA 3LDCA 2FLPA 1XHZA 4UCOA 3ABUA 4A5UB 4MV9A 2R7ZG 4RO2A 1I5YA 1MZBA 1PNMA 1Y66A 1FKAO 2R86A 4HNUA 3BVOA 1T36A 4JPRA 1QR9A 2N74A 4X8AA 3BA9A 4RB1A 5BWXA 2VPSA 3WG7C 4FBUA 4HNAB 4RWUA 1XBLA 2JA5A 1Z2GA 2D2CB 2R8JA 3GJXB 3RBEA 4ETSA 4MTOA 2VWJA 3RB6A 1XNQO 2CFMA 2VA3A 5KT2A 3MDSA 2FMAA 3OD4A 4LFAH 2HJWA 3ZMVA 4O2BA 3OUSA 5DG9A 2Q4PA 1EFRG 4RUEA 5KFCA 4TQFA 3SGIA 4CKEA 3T1CA 4DO2A 4W4KA 4EB6A 3CCRV 3BG5A 1V4YA 1VQ8V 4WFEA 2R7MA 4O3PA 4A3JG 2ZKOA 5HBRB 2QJ1A 4M7EA 3CCUV 3T9BA 1KB9F 3E22A 1XOUA 3QG5A 2VUMA 3MWMA 1B3QA 2ATKC 3BA8A 4X1IA 3T54A 4MTDA 2YI8A 2AU0A 1ZETA 4GLWA 4EYIB 4PDMA 2GQSA 1N36H 2Y0IA 2W0XA 1I7FA 1H38A 4ZQIA 1SA0B 1GN6A 4UCRA 2HGXA 4JTDB 5GW7A 2EULA 3EPGA 1IBLO 4EFBA 2WA3A 1I94O 1GGOA 3WU2Z 1SQPH 1N34H 4XDJA 4O7NA 2YIBA 1SF9A 5FPOA 4JTAB 2V4RA 1GH6A 3AK1A 2JA8G 3HKZE 1T3NA 3T4ZA 1I3QA 4PI2A 5LL6b 5C8YA 1JVMA 5LMNH 3J7AU 2Y0PA 2FPPB 3RBDA 2JGDA 3J80W 4F6RB 5KG3A 4LCUC 1FJGO 4ECSA 4F6EA 3CCJV 1I2KA 4R8UA 5B1OA 2WLNA 2R7NA 1KECA 3GB8B 5CR5A 3W1GA 1JX4A 4XYMB 2SCUB 2WLHA 2OIGA 1OZ0A 3CS5A 2GQRA 2OTLV 1IDSA 4K35A 3JZIA 2ZINA 3FKIA 2BTQB 4JXUA 1M93A 2EILC 4PV1B 2R7KA 1J5EB 3IAYA 2KG7A 4HNTA 3E83A 1PD3A 3GV5B 3RGZA 4Z1MG 5IJ0A 4ZHQB 1KJ9A 3JYCA 4FMTA 2IBZH 3FYEB 4BW9A 4DR5H 2DWCA 3QNEA 5IYBO 1BJTA 4AQYO 2FK2A 3OUUA 3CE2A 3VBBA 2FKLA 5H80A 1FD9A 2J6TA 1XREA 1KBLA 1K4DC 2XTAA 4U3FH 3MAQA 1QU7A 1Y67A 3H1KH 1I1MA 5I60A 5KA5A 1SQQH 4I50A 2E3CA 4GX2A 1IBKH 4JI8O 3TJTA 1W93A 4XYLB 1ZL8A 1NS1A 3ETEA 1KUTA 2Z04A 2Q2UA 4ZI7B 4DR7B 2QM4A 3T9EA 3OSPA 1S0OA 5LBQA 1S68A 3A8TA 1GSOA 4QW8A 2DYRC 2UXCO 3M7MX 5LYJA 3MHSC 5DG8A 3HOVG 1CKMA 4DV2H 1YVWA 4JI5B 2FE3A 4QNHB 1W0JG 5KUKA 5KFAA 4FFKA 2OWOA 2XCAA 3PZPA 1WLEA 2HG5C 3B40A 2UXDO 4FLZA 4JV2A 2NVYA 1K34A 3NR7A 4RZRA 2XUMA 4P9PA 3MR5A 4J7ZA 5GTHZ 4NZOA 1S03G 4ZHQF 2N04A 2W9AA 2YWVA 4UCVA 2QB5A 2IW5A 4DL4A 3H4DA 4TUYA 1VQLV 5CB4F 1A32A 5KFLA 1G2WA 2WLKA 1EZJA 1YJNV 2ZIOA 4J9NA 5JQGA 5KHHA 3W1BA 4WFBV 1COWG 4LF7O 4Q43A 4RAZA 4B3MB 2YRWA 2R7LA 3WWHA 4TWKA 3MWDA 3SR2C 1GTOA 5I5WA 4YIOA 5LXTB 4UFZA 2VR1A 3EHBB 4QWDA 2XD4A 1NBMG 4DUYH 2X0LA 3FB5C 2RMKB 3P3NA 1JIHA 2A06H 2Q6AA 3PW2A 4ZI7F 3HKBB 4MVOA 2XIGA 3SJAC 2GHYA 3ABLB 2YEVA 2Q69A 5E79Z 4CBCA 1MSDA 2WLIA 1P16A 2GPSA 5B3SC 1IBMH 4WBNA 1F23A 3Q4HA 4QE9A 1VBHA 3SPJA 3G6YA 3AYHB 2CTWA 3OTOB 4EQ5A 2PBZA 2J6UA 4M0JA 5LMUH 3WNZA 2ZM6O 3H0GG 4B3RB 3LNNA 4LFCB 4I7HA 1L0NH 1AROP 1Y74A 2XC9A 3UZOA 3K03A 2X6BA 4B3RH 4JYBA 3OM3B 3NC0B 2ZE5A 3BRCA 5KFWA 5KT5A 3RV4A 3N6XA 3M8AA 5KT4A 4O3RA 4OGQB 4DR3H 3FB7C 2VQDA 4MVMA 4PI0A 1NR7A 3ZN1A 3U0GA 2Z3YA 3UKMA 1E4EB 3C3TA 5L3BA 4J7JA 3KHGA 1NTZH 1UFIA 3KCXA 3ZRWB 3JAKB 2HG8A 4MV1A 3E8BA 3EYYA 3T1YH 1K8AW 5J2UF 3RW0A 2P0AA 2Q73A 4RNOA 1X4TA 3CCLV 4QPJA 3ZHVA 2IP4A 2QKCA 2YSUB 4UCUA 2CTRA 2W9BA 2JDIG 2PZSA 1E4FT 4DR4B 3Q1KA 3HO8A 5D1PA 4EG0A 1AN7A 2FK3A 1TGOA 1IOWA 5IWAH 2P6JA 4XDLA 1WP7A 3OMIB 4ECWA 1YCIA 5KFSA 5J9PC 3KHRA 4F50A 3ZHRA 3APQA 4X65H 3GILA 1VF6C 3CXHF 1TWGA 5KG5A 2QWQB 2QWRB 1K33A 2ZE6A 5IY5B 1A48A 4XBFA 2QDOA 2WSSG 2JGUA 2YI9A 2WDTA 5CMUA 4IAJA 4O7ZA 4Q45A 1XMQB 3OEHG 4MVUA 2IBKA 2WAQE 2YUAA 2W8LA 2MK3A 2Y4RA 4YR2A 5BMVF 2GPWA 4MVQA 4X66H 4TV9B 3PFFA 4OX9B 3JD2A 2Q9LA 5L1LA 2BQRA 1GSHA 3TY8A 2UXBB 4BBSG 1ENVA 2R9IA 2M05A 5F9LA 3G6EV 4OX9H 5IE9A 2RDIA 4I7ZB 1O9HA 4NYEA 3UO3A 3CD6V 1MSWD 1OBGA 3UO2A 4JYAH 2DPJA 3RYIB 2JA7G 1FFXA 4J10A 3N8DA 1YF2A 2PMZE 1GKFA 1QHTA 3EPIA 3UT5B 4O7VA 4EGQA 3CP1A 5EZYA 1MNGA 1S97A 4ZKIA 4HNVA 3I55V 5B5EZ 5LGUA 1KYOF 1G6UA 4O4HB 2UU9O 1TWAA 4IR9A 5KAFZ 4C5BA 1ZQ7A 4O7LA 2X6AA 4FU0A 4OPAA 3RFCA 4FM9A 2L35A 3CXCU 1Q43A 3GLKA 3CRAA 2EIMC 1FKAH 1Z5VA 4CHIA 2NLJC 4YQWA 2ZR3A 3E8HA 3RIZA 1WB7A 3RVYA 1OCCC 1XNQB 4APMA 4ECUA 2YICA 1RPRA 2GSMB 3RJ0A 4KHPB 3BHPA 1EM1A 5JCOA 1A9XA 3T5KA 2FKXA 4BR6A 3PVXA 5CAEB 5BXZA 1ZX3A 4NLGA 2JEIA 4O7TA 1AUXA 3OMNB 4YAJB 1AI7A 3B77A 3AX6A 1RPOA 4QSHA 4FFPA 4PDBA 1CS0A 3WB2A 1EUCB 2ABJA 1VAJA 1N32B 1I0HA 4AYBA 3I4MG 2ZDHA 4DR6O 2YL2A 1HNZO 3LMLA 3JATB 2DYSC 1IZ3A 1NZ6A 3K0DA 4O4HF 2X5RA 2DW4A 2CKZB 3MFIA 3X2QB 2A1HA 1N33H 4RUAA 3L73H 4JI1O 2A79B 2ZNJA 1KT8A 3ORRA 2EBOA 1EBOA 5H6RA 2P4VA 1B6QA 2JA5G 1EZ1A 5KX5B 4U3JA 4GKKB 1IBLB 1IBKO 1JDEA 2R87A 2W6OA 4MTGA 1I94B 1JJ2U 1TUBA 3OR6C 4DAAA 2ALZA 4JI0O 2CH7A 3RYHB 1IBLH 2PI5A 1I94H 4NR1A 1US6A 4FFBA 3DXRB 3BY6A 3KREA 1GSAA 5I47A 2ETNA 5EIBD 3RYCA 4O4JB 3FYIB 4G2KA 4LC1A 3HOXG 1XHXA 3ABKB 3FFQA 1S72V 1FJGB 4A3MG 3GB7C 3MR6A 2VUMG 4PHZA 3TINA 2P22C 4O4LB 2G38A 3A0HZ 2Y0SE 3PW0A 4UB8Z 3CHXA 4NTYA 3KKYA 3CRCA 5E1AC 1U96A 1SRYA 1M90W 2B1IA 5ITZA 2HP8A 3G8CA 5BYBA 3ZJZA 2NVXA 1I2LA 1L1FA 3AG2B 3H0GA 5JH7A 4R50A 1D5NA 3HOUG 4O3OA 4IZOA 1YZBA 3LWBA 4HYOA 5KX5F 2LQTA 4ED3A 5KG7A 1WP8A 2R9AA 4N23A 3ZMSA 1ZHSA 1QVFU 1Q6IA 5JVDB 1WRVA 4DUYO 1K3EA 5LOVB 2LW1A 3RVZA 4JI7O 4X1KB 3RGBA 2JRIA 3UZBA 2ASJA 1QLNA 5KFRA 3CRRA 3ABMB 3V4SA 2C22A 1N48A 4O4IB 3MWEA 2W0FC 4AQYB 4CS3A 2BQUA 2AW9A 5JUMA 3E5NA 3TQTA 4JI2O 3H1HH 4PELA 1S77D 3HKEA 5H2FZ 3WFVA 2B63G 2W70A 3BFRA 2XGPA 3SYOA 3ASNB 1IYDA 2EZOA 3VQXA 5L3CA 3GV8B 5L3GA 3R23A 4JTCB 4Q4CA 5LP6A 2Q5ZA 3EFFK 4NTWA 1ZWIC 1EKFA 4ECZA 4JI8H 4TV8A 4O7WA 3QO8A 3KAJA 3ZHSA 3F5WC 2UXCB 1B06A 5KFJA 2UVVA 2YXHA 3CC4V 4Q0YA 4DV3O 4DR3O 1XL6A 3SYQA 4A3BG 4EFEA 1XMOO 2UXCH 4J0MA 5FLMG 3M9OB 5C93A 1GN3A 3K57A 3U10A 3JSNA 1WH2A 4TQDA 3OTFA 3T1YO 3C90A 3G4SV 4K6NA 2UXDH 1OWTA 4RUCA 3ZCCA 2ATLA 3F7VC 3LUTB 5GONA 4ZOLA 2IU0A 3T4DA 4O4IF 5T14A 1F7YA 2V7QG 3HKDB 3MR2A 2PGGA 1EKPA 4RCNA 5LL6Y 1KJIA 1MZFA 3A0BZ 3LDEA 4DV6H 2RQ6A 4AILC 3PR4A 2ASDA 4LF7B 3SYPA 3W7WA 3GVMA 1AI4A 5D5QA 4DLKA 2P7TC 4A3IG 4B3SO 3T9CA 5JCOC 1NT2B 1W0KG 4O84A 2V4DA 4LWSB 4X65O 3ETDA 3KHHA 5LHHA 3R66A 3I56V 2E5LO 1DIKA 1I6UA 4YJ2B 5DGHA 2VA2A 3VOUA 1VBGA 4MVRA 4LFBB 5IYZF 3ZMZA 1KC7A 2DOSA 3JD3A 4JAVA 3CQZA 3FDSA 2EJ0A 1OCZC 3MFHA 1N56A 4UVCA 4B7EA 4O83A 4DL5A 1BGYH 1R6NA 5H6QA 4U7NA 1JFFB 1NU1H 2RDCA 3T1HO 1E1RG 4MTEA 4BW5A 2ZM6B 3CWBH 5FPRA 3L9DA 4F4XA 2BOBC 1Z2PX 1T94A 2GTAA 4DV7O 3PJSK 1AP5A 2OTJV 4GYCB 2IJKA 2J6SA 2QA4V 2ZM6H 1EKVA 2J9GA 5KFFA 3OHBA 3PW4A 2QF7A 5FJ8G 2ASLA 4IHJF 3JARA 5EBLC 3KALA 5L1JA 2LO1A 3CSWA 1HR0H 3FAVB 1VEWA 5CA0A 3E2EA 1JOYA 3TW6A 5I5XA 4CS4A 3QTCA 5BYAA 3BQ0A 4MV3A 3J81N 4HAMA 5DAAA 1HNXH 4U7CA 4YJ2F 3GTPA 2HHFA 5CBGA 4FFOA 2IH3C 3AK3A 4QJFB 1KJJA 2EILB 4MVSA 5IYDG 1W59A 2YZGA 3DF7A 3J7AK 1QCEA 4J11A 2F4VO 3HKCB 5KFPA 3BJYA 1JR9A 1SESA 4MW8A 5I5UA 4GX1A 2V9WA 2FJZA 4JZ2A 2HIVA 3S3WA 4FZ0A 1KQSU
chains in the Genus database with same CATH topology
1TVKB 1JJOA 5IJ9A 4FM0A 1S68A 1XMQH 4FFBB 3M7MX 5LYJA 1M0TA 1CKMA 4DV2H 3JAWB 4JI5B 3RYCB 3NBYB 4X62B 2FE3A 2CW8A 4LFAB 2O03A 2CAZC 4LR3A 2OWOA 5JJEB 3BPZA 2Q7GA 4FLZA 3DSQA 2F1MA 4X62H 4JI8B 1S03G 4UCVA 1Z2OX 2UXBH 3HKDA 4B08A 4TUYA 3VQYA 2VQEH 5ITZB 4IHJA 3NBZB 5D5PA 2HVSA 2ZIOA 3JATA 5JQGA 5KHHA 4D7TA 3W1BA 5FD6A 1TA8A 4LF8H 3PN1A 5JH7B 4RAZA 4B3MB 4YJ3B 2Q0AA 1SQGA 3ETQA 3N2GA 4LH7A 4BWAA 2YCHA 2UXDB 3BAAA 3SR2C 4GKJH 1N36B 5LXTB 4UFZA 4LF5H 4NXNH 4YJ2A 5K1XA 5KHKA 4DUYH 4F6RA 3RFRA 4DV0H 4DK1A 4DV6B 1XQ8A 2EX3A 3HKBB 4RB0A 2XIGA 3SJAC 3U11A 5A2QW 1N34B 3TY5A 4K0KB 2F93B 3WB1A 1FFXB 3RYHA 1P16A 3N2KA 1IBMH 4WBNA 1QQCA 2UU9B 2HHHH 1YEWA 3H20A 2W57A 4K0KH 3HKEB 5LMNB 2PUSA 4AHCA 3K58A 3QWUA 3OTOB 4EQ5A 5KMGA 1P49A 1XNQH 2UU9H 4O4JA 1H2SB 1SEIA 5LMUH 4KHPH 4B3RB 3LNNA 4LFCB 5EOYA 4UCSA 4I7HA 4X1YA 4LH6A 4FLWA 4O4LA 4CS2A 4FM1A 4B3RH 4TV8B 2GV9A 3NC0B 1SYXB 3BRCA 2HIXA 3N43B 4ZHQA 4LSXA 3N6XA 4CC6A 4I4TB 4DR3H 4LF9H 5J2TA 4PI0A 2HVQA 5CB4A 2WE6A 3E22B 1N32H 3SJBC 3JAKB 4X1IB 3EYYA 3T1YH 4HBNA 1HR0B 4JI6B 1X4TA 5JVDA 4ZOLB 4FVMA 5LOVA 1GYFA 4UCUA 3JSLA 3HKCA 3CSXA 4X1KA 4JI6H 2PZSA 1E4FT 4DR4B 2UUCB 4GKKH 3CVZA 5D1PA 4DR5B 1AN7A 1ZHQA 4ZI7A 4JI1B 1TGOA 2ZIMA 1HNXB 5IWAH 1TVKA 1T5EA 1HNZH 4DR6H 5LA6B 2UUCH 4HNAA 4D7SA 3JAWA 4LF4B 4JI1H 1O9GA 4X65H 2XHBA 3K5OA 5C8YB 2Q7HA 4YY3B 2ZCEA 3L2PA 4JI4H 1IBKB 5EYPB 2RJZA 5KHJA 4DR1H 4K8XA 4U3JB 1FJGH 4LNUB 3RYFB 2JGUA 2YI9A 2WDTA 3VQVA 1M0WA 4TOIA 2JVDA 4IAJA 1VF7A 1XMQB 4JI0H 1DGSA 4YHHH 4DV2B 2VOBA 4NXMH 3B2EE 1L8DA 2VWKA 1X9NA 4CH3A 1XI1A 1O75A 4X66H 4NVPA 4TV9B 4ZIBA 4OX9B 4Q6GA 2PY5A 2R72A 5CA1B 3TY8A 2UXBB 4OX9H 4I55B 4DV1B 2ZJTA 3KAKA 1O9HA 3JARB 5J2UA 4E6NA 3A2FA 2VQEB 3N41B 1SA0A 4JYAH 4DV1H 5CA0B 4A2AA 2R70A 3RYIB 4LF8B 1FFXA 5KHGA 1QHTA 4DRXA 3UT5B 5IT9W 2HVRA 5EZYA 3VNNA 4GKJB 4AQYH 3N40P 1HNWH 3K5MA 4LF5B 3KXYT 4NXNB 4O2AB 1G6UA 4O4HB 3K5LA 4DUYB 1FVIA 4DV0B 2F66C 3SJCC 1P8LA 4FM9A 4I9QA 4JV5B 5LP6C 4JI7H 1Q43A 1KMIZ 2JS5A 1IBMB 5IYZB 1Z5VA 1FKAH 4JI2B 3L4KA 3UQ8A 2HHHB 3HXLA 4JV5H 4I4TA 5IJ9B 3RIZA 1JFFA 2KSWA 1XNQB 4APMA 4JI2H 3ICXA 5LMUB 4PZ6A 5D1OB 3ZEDA 2Q7EA 3RJ0A 1HW7A 4KHPB 3BHPA 4RAYA 5JCOA 2PYLA 3JAKA 4PZ7A 5BMVA 5FNVB 2BTQA 2VUGA 1KU9A 5LP6B 4O2BB 4PDBA 3WB2A 4DV3B 4DR3B 4TUYB 4LF9B 2IM9A 3BABA 3S24A 1N32B 3GDEA 4IHJB 4EB6B 4FLTA 1M5IA 4X64B 3LMLA 3JATB 5LA6A 5JQGB 4DV3H 1ZAUA 1N33H 1XMOH 4LF7H 2HGSA 4LSAA 3T1YB 2Q2TA 3N2GB 2ZNJA 3K59A 4X64H 2F95B 4R7RA 4DUZH 5EIBC 4FLYA 1S5JA 2UUBB 4CH5A 5EYPA 3JASA 3JALB 1WNSA 5KX5B 2YXLA 4U3JA 5GONB 1SKVA 4GKKB 3ZS8C 4LNUA 1IBLB 3RYFA 3RTXA 5FD5A 2UUBH 5IWAB 1I94B 4DR6B 1TUBA 1HNZB 4LFBH 3M4IA 1TAEA 3RYHB 4CH4A 4B3SB 3N2KB 4B3TB 5FLXW 4L8JA 2YIBD 1IBLH 4K8ZA 1I94H 4X65B 1XNRB 3VQWA 4FFBA 4B3SH 4FLVA 4B3TH 4JI4B 3RYCA 5EIBD 3C0FB 4O4JB 3K5NA 2BTOA 1XNRH 4DR1B 1XHXA 3FFQA 1FJGB 4X1YB 2E5LH 4I55A 1XDNA 4PHZA 4DRFA 4DV4B 4X20B 2P22C 4O4LB 4LMYA 4JI0B 4YHHB 3CHXA 2HIVA 1J5EH 4RZQA 4NXMB 4PZ8A 2PTMA 4DV4H 3RYIA 4X66B 5ITZA 1L2ZA 3F8NA 5CB4B 3K3VA 3T1HH 4FLXA 3J81W 5JH7A 4YJ3A 4FLUA 1Z5WA 4O4HA 3THOA 4DV7H 1Q5OA 3CB2A 2R9AA 5LXTA 4DR2H 1ZHSA 3RR5A 5JVDB 1XHZA 4UCOA 4JYAB 1Q8IA 4MV9A 1CKOA 5LOVB 1MZBA 1D5AA 4X1KB 3HKBA 3RGBA 2CW7A 3FMAA 5IJ0B 4O4IB 2PYJA 3W5OA 3BA9A 4AQYB 4GLXA 1HNWB 4RB1A 4CS3A 2VPSA 1CKNB 4HNAB 5D1OA 1E4GT 4DR7H 3HKEA 3RF2A 3GJXB 5JJNB 4ETSA 2VWJA 3VQXA 5FNVA 2CFMA 4JI5H 2F4VB 4JI7B 4LFAH 5LP6A 4O2BA 3N44B 4I50B 2RGRA 4UCTA 2F4VH 4JI8H 4TV8A 4TQFA 3QF7A 3SGIA 3KAJA 2UXCB 4EB6A 2VQFB 4FM2A 2UUAB 4Q0YA 4IIJB 2QJ1A 4M7EA 4LF6B 2MCTA 4EFEA 3E22A 1V9PA 5DISC 2UXCH 5LYJB 4J0MA 2VQFH 1VS0A 3QG5A 2UUAH 3K57A 4LF6H 1RSOA 3U10A 3JSNA 1WH2A 3MWMA 4TQDA 2WYOA 3BA8A 4X1IA 3RGXA 3OTFA 4MTDA 4B3MH 2YI8A 2UXDH 3JALA 4DV5B 5KX5A 1SQFA 5GONA 4ZOLA 1N36H 5J2UB 1I7FA 4JI3B 4BWSC 1SA0B 3HKDB 2PGGA 4DV5H 4UCRA 1BGWA 4DV6H 2RQ6A 4AILC 1N33B 1XMOB 4LF7B 3RWRD 4EFBA 4JI3H 4DRXB 1N34H 2P5OA 5D5QA 5EZYB 2HEPA 2YIBA 5FPOA 1Q3EA 4DUZB 5JCOC 1NT2B 5K1PA 1WN7A 2V4DA 5LL6b 4PI2A 5C8YA 5LMNH 3OTOH 1I6UA 4YJ2B 2RGVA 3J80W 4F6RB 4X20A 4LFBB 3TY9A 1XK5A 4CH6A 4LFCH 5JJJB 2OYQA 1JFFB 3GB8B 3W1GA 4WBNB 1WPBA 3N42B 4RB2C 4MTEA 2ZM6B 4TV9A 5FPRA 5BR8B 3L4JA 2E5LB 1Z2PX 1M4UA 5KMGB 4A2BA 5BMVB 4GYCB 2ZINA 5KHIA 2BTQB 2ZM6H 1B04A 1M93A 5CA1A 5BR8H 4EEQA 1J5EB 3IAYA 1HR0H 3JARA 3KALA 3RGZA 3KYHC 3T1HB 5IJ0A 5CA0A 4MV7A 4O4IA 2ZNIA 4ZHQB 4RB3C 3JAMW 4DR4H 1CKNA 4CS4A 3QTCA 3UT5A 5J2TB 4BW9A 4DR5H 4DV7B 1BJTA 1HNXH 4KL1A 1A0IA 4DR2B 3WB0A 4O2AA 3U0ZA 2YIAA 3MAQA 4LF4H 3JASB 3IG0A 4YY3H 3DF7A 4DK0A 4I50A 3J7AK 2E3CA 2KKWA 1IBKH 1JMKC 3HKCB 1TUBB 5IYZA 1Z2NX 2Q2UA 4ZI7B 4DR7B 2QM4A 4IIJA 4CC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S68 A;  1ZAU A;  4EFE A;  1V9P A;  5DIS C;  3T1Y B;  2Q2T A;  1CKM A;  1VS0 A;  4JI5 B;  4LF4 B;  3NBY B;  4X62 B;  3JSN A;  3BA8 A;  4LFA B;  4YY3 B;  2OWO A;  3L2P A;  1HNX B;  2UUB B;  1IBK B;  4DV5 B;  4JI8 B;  4GKK B;  4UCV A;  1IBL B;  4JI3 B;  3RTX A;  5IWA B;  1I94 B;  4TOI A;  4DR6 B;  4UCR A;  1HNZ B;  1XMQ B;  1TAE A;  1N33 B;  1XMO B;  4LF7 B;  1DGS A;  4B3S B;  4EFB A;  4B3T B;  3NBZ B;  2HVS A;  4DV2 B;  4X65 B;  1XNR B;  3W1B A;  5FPO A;  1X9N A;  1TA8 A;  3PN1 A;  4DUZ B;  4B3M B;  4OX9 B;  4LH7 A;  4JI4 B;  2UXD B;  3BAA A;  4DR1 B;  1N36 B;  4UFZ A;  1FJG B;  3TY8 A;  2UXB B;  1XDN A;  4DV1 B;  4DRF A;  4DV4 B;  4LFB B;  3TY9 A;  4DV6 B;  1XK5 A;  4E6N A;  2VQE B;  4JI0 B;  4YHH B;  4NXM B;  4PZ8 A;  1N34 B;  3TY5 A;  4K0K B;  4LF8 B;  4X66 B;  1P16 A;  3GB8 B;  3W1G A;  2UU9 B;  2HVR A;  3VNN A;  4GKJ B;  2ZM6 B;  5LMN B;  5FPR A;  5BR8 B;  3QWU A;  4LF5 B;  3OTO B;  4EQ5 A;  4NXN B;  2E5L B;  4DUY B;  1FVI A;  4DV0 B;  1B04 A;  4B3R B;  4LFC B;  4EEQ A;  4UCS A;  3RR5 A;  4LH6 A;  1P8L A;  4UCO A;  1J5E B;  4JYA B;  4JV5 B;  1CKO A;  1IBM B;  3NC0 B;  3KYH C;  3T1H B;  2HIX A;  4JI2 B;  3UQ8 A;  2HHH B;  3W5O A;  4CC6 A;  3BA9 A;  4AQY B;  4GLX A;  1HNW B;  2HVQ A;  1CKN A;  1CKN B;  1XNQ B;  4DV7 B;  5LMU B;  5D1O A;  4PZ6 A;  5D1O B;  1A0I A;  4KHP B;  4DR2 B;  3GJX B;  4PZ7 A;  2CFM A;  2F4V B;  1HR0 B;  4JI7 B;  4JI6 B;  2VUG A;  4UCU A;  3JSL A;  4UCT A;  4DV3 B;  4DR3 B;  4LF9 B;  3SGI A;  4DR4 B;  2UUC B;  3BAB A;  2UXC B;  4DR5 B;  1N32 B;  3GDE A;  5D1P A;  2VQF B;  3S24 A;  2Q2U A;  4DR7 B;  2UUA B;  4JI1 B;  2HIV A;  4X64 B;  4CC5 A;  4LF6 B; 
#chains in the Genus database with same CATH topology
 1JJO A;  4FK5 C;  5IJ9 A;  3BEH A;  5DGI A;  3V6K A;  2VQF O;  3ZHT A;  1VIB A;  2UUA O;  2ZR2 A;  5EWF A;  2CW8 A;  1Y76 B;  2QM7 A;  4LFA B;  5JJE B;  2WA4 A;  3TET A;  3BPZ A;  3DC5 A;  2W7O A;  2FK1 A;  2CTP A;  3TII A;  1Y1V G;  3L75 H;  1V55 B;  4OXS A;  2DQ0 A;  4BBR G;  4DV5 O;  2R92 A;  5L1K A;  3VQY A;  2OCC C;  4QIW E;  3HPL C;  3DTG A;  4JI3 O;  1M57 C;  2XAG A;  3DC6 A;  4DIM A;  4I9W A;  5FD6 A;  4JAA A;  2DYR B;  1N33 O;  2GUZ A;  4YJ3 B;  3I4N G;  1SQG A;  3ETQ A;  3N2G A;  3SYA A;  1RJP A;  2XAH A;  1S5H C;  1KP2 A;  4F4L A;  2JEU A;  1N36 B;  3OEE G;  2W6J G;  5K1X A;  5KHK A;  3CPW U;  4F6R A;  3OGI B;  3QZ8 A;  2IJJ A;  4DV0 H;  5JVL A;  2EX3 A;  1NTM H;  3K3W A;  1N8R W;  1WSC A;  1N34 B;  2MW2 B;  2RNB A;  3FB6 C;  3TY5 A;  4M9U A;  5KKN B;  4YR3 A;  1M1K W;  2HVJ C;  2LFS A;  1NVP D;  1QQC A;  2UU9 B;  3H20 A;  3F7Y C;  1JLL B;  1NVP B;  3TIG A;  4PDV A;  5LMN B;  5KUM A;  2DMX A;  4AHC A;  3QWU A;  2JJ1 G;  1C30 A;  5BWU A;  3D36 A;  2UU9 H;  1KEE A;  1H2L A;  5EOY A;  4X1Y A;  1HWY A;  3SDL A;  4FLW A;  1K1S A;  4ECV A;  2P90 A;  1VAR A;  1K9M W;  5H5N A;  4ZHQ A;  4DL6 A;  1I50 A;  5KT7 A;  4I4T B;  5B3S B;  2B63 A;  5CB4 A;  1GMG A;  1PL4 A;  3E22 B;  4A3C G;  1YHQ V;  3SJB C;  3HKZ A;  5C4X G;  1AUV A;  3I5D A;  4RNM A;  4IR1 A;  1BHA A;  4X1I B;  1QLE C;  5DMX A;  3TQ1 A;  1WJZ A;  4LF4 O;  2W6N A;  3PW7 A;  5I5S A;  2CGN A;  1ZTE A;  3H40 A;  1EYZ A;  1IX9 A;  4YY3 O;  2C2E A;  2W8K A;  1GYF A;  1NKD A;  3JSL A;  2Q7D A;  3HB9 A;  1SZX A;  1KKD A;  3LNM B;  4DR5 B;  4ZI7 A;  4IRK A;  1F4N A;  4JI1 B;  3JAM N;  4DR6 H;  1HNZ H;  4JF3 A;  1MMM A;  2VPQ A;  1AP6 A;  4MSW C;  4MS2 A;  3U54 A;  3DTU B;  4JI1 H;  1O9G A;  4ED2 A;  3Q8P B;  3ASO C;  5C8Y B;  2Q7H A;  4C5C A;  3AW8 A;  1PNL A;  5B1B C;  1VQ4 V;  5KFB A;  2Y4U A;  2JGD B;  4QIW F;  4TSF G;  4X62 O;  5EYP B;  1IBK B;  3K5H A;  4A3E G;  3GTQ A;  4K8X A;  1R3K C;  3V6H A;  4LNU B;  4I4T F;  5BPH A;  2JEG A;  2YZN A;  2ZXW B;  1THZ A;  1YSC A;  4TOI A;  4R8U B;  1PP9 H;  1VF7 A;  2FLL A;  2VQE O;  3EVK A;  4QPK A;  4JI0 H;  4L87 A;  5H9C A;  4O7Y A;  4DV2 B;  3B2E E;  1ULZ A;  1P7B A;  3VMM A;  2R9R B;  2VWK A;  1VQ9 V;  1X9N A;  4CH3 A;  1KJ8 A;  4MTX A;  5HFM A;  2V5A A;  4ECT A;  4Q6G A;  2PY5 A;  4J9R A;  3HOW G;  5LGN A;  1LR1 A;  3JD4 A;  3R5F A;  4O3Q A;  2IH1 C;  3N27 A;  1M56 C;  1RJR A;  4LF5 O;  4IYI A;  4I55 B;  4DQN A;  1Q6U A;  2KG7 B;  3KAK A;  2ZJT A;  5J2U A;  3N41 B;  2YU9 A;  2FYU H;  3CRQ A;  2BSK A;  4PDL A;  4J9M A;  4DV6 O;  2COI A;  3GIM A;  1H2N A;  2R70 A;  5CBF A;  4KUM A;  1F51 A;  3BCC H;  5IT9 N;  1JXL A;  2XCP A;  4WFF A;  4DRX A;  4TQS A;  5EBM C;  1PK8 A;  1SC5 B;  1AJN A;  2UVR A;  1H2G A;  5KFE A;  1HNW H;  3KXY T;  3K5I A;  2AGP A;  2NNU A;  4DUY B;  2F66 C;  2VRZ A;  5KFI A;  1VQK V;  3SPC A;  1UJW B;  2ZT9 B;  1P8L A;  4I9Q A;  3LQS A;  1M6V A;  3STZ C;  2QK4 A;  3CC2 V;  4YIP A;  4JI7 H;  1ZL8 B;  4KFM A;  1KMI Z;  2JS5 A;  3TXQ A;  1IBM B;  2V4Q A;  3T7A A;  5K3W A;  3SPI A;  1SET A;  4JI2 B;  3L4K A;  3UQ8 A;  2X7R B;  2KSD A;  3HXL A;  3T5J A;  3CME V;  3JD0 A;  5DGA A;  2KSW A;  2IU3 A;  2I8C A;  1DAA A;  4JI2 H;  3ICX A;  5LMU B;  4PZ6 A;  5D1O B;  3ZED A;  2CTQ A;  4I55 F;  3JAK A;  1PKX A;  1OCO C;  5CE8 A;  5EBW C;  5BMV A;  5FNV B;  5LHG A;  5F2V O;  1A0G A;  2V59 A;  3OW2 U;  2DIK A;  5A9G A;  1VQO V;  5B1A C;  3LSQ A;  1HR0 O;  2W6Z A;  4DV3 B;  4DR3 B;  1I1K A;  4TUY B;  2EIM B;  4JI6 O;  3CEB A;  2IM9 A;  1FFT B;  3BAB A;  2C2A A;  4FLT A;  1M5I A;  3Q8S B;  1Q6H A;  5DGB A;  4DV3 H;  1I5X A;  5JQG B;  2EIJ C;  4FS1 A;  2UUC O;  3GIJ A;  1OCC B;  1XMO H;  3T1Y B;  5LXT F;  1HNX O;  2AGQ A;  4A3L G;  2F95 B;  3D36 C;  4CKB A;  1NQT A;  4C5A A;  4DUZ H;  3G6X A;  4FLY A;  2DPI A;  4PD4 F;  1Y1V A;  4PDR A;  4CH5 A;  3JAS A;  4Z1V A;  4PA7 A;  2W6P A;  1L0L H;  3JAL B;  4DR1 O;  3OAA G;  3R9R A;  1V54 C;  3O9O A;  2QWN B;  3ZS8 C;  3B4S A;  4UUG A;  5KFQ A;  2QWP B;  5FD5 A;  5IWA B;  1WA8 A;  1WCM G;  2YEV B;  3M4I A;  1K97 A;  2WLI B;  4YHH O;  4CH4 A;  4B3S B;  1A3G A;  4ED8 A;  4H33 A;  2DYS B;  4X65 B;  5IYC G;  1QNM A;  1EN4 A;  3Q4H B;  5LGT A;  5FNV F;  2X0S A;  2A9H A;  4QWE A;  4B3S H;  2EIN C;  4CZZ A;  4XX0 B;  3C0F B;  2A3Q A;  2E5L H;  4TUY F;  1Y74 B;  3JRW A;  2I87 A;  4DW1 A;  4TQR A;  3RT3 C;  4X20 B;  4LMY A;  1H2M A;  4EBC A;  4X9Q A;  1ZLZ A;  4JAU A;  5BWV A;  1B6S A;  4RZQ A;  3RB0 A;  1GM8 A;  1JKJ B;  2PTM A;  3RYI A;  3LSS A;  2FLN A;  2AHZ A;  5GTI Z;  4X66 B;  1L2Z A;  1U97 A;  2DE0 X;  3F8N A;  3K3V A;  3T1H H;  2IA6 A;  3RAQ A;  4QE7 A;  1CXZ B;  4FLX A;  3J81 W;  5KFH A;  3K04 A;  1Y1W A;  4O4H A;  2BOC C;  4DV7 H;  2XND G;  1Q5O A;  3L72 H;  4DR2 H;  1KD1 W;  2JEF A;  3V6J A;  4MAM A;  3RR5 A;  4H13 B;  3E89 A;  2V58 A;  2IMW P;  4JYA B;  1Q8I A;  1CE8 A;  1CKO A;  4DV0 O;  2OH2 A;  1D5A A;  2A7W A;  3T99 A;  2XOK G;  2WAQ A;  4H37 A;  5KAI Z;  4JV5 O;  3FMA A;  2Y4T A;  1WAZ A;  3Q2O A;  4BY7 G;  1CKN B;  4RQF A;  2FB9 A;  1K92 A;  1E4G T;  2K9P A;  5DQI A;  4Q8E A;  2KQX A;  1RM1 C;  5DG7 A;  2QKS A;  1AVM A;  3CRM A;  1EZV H;  3OHA A;  5EDW A;  1ORQ C;  1VQ7 V;  3K79 A;  2F4V B;  2GLT A;  3TCU A;  1YIJ V;  4ED0 A;  2XCL A;  3BAC A;  3N44 B;  4JUZ A;  2BQ3 A;  4UCT A;  2F4V H;  2AGA A;  2PMZ A;  1GM7 A;  2VQF B;  2UUA B;  4TV9 F;  1VF5 B;  4IIJ B;  5BPF A;  1V9P A;  2VQF H;  1VS0 A;  3FX7 A;  1EHI A;  2UUA H;  3TK1 A;  1SQX H;  1RSO A;  2FB5 A;  5KFZ A;  3LUL A;  5LHI A;  1K1Q A;  1E79 G;  1G8M A;  3I12 A;  4DV5 B;  2VS0 A;  4MVZ A;  1SQF A;  3UM7 A;  5KX5 A;  4XZ3 B;  4TVI A;  4JI3 B;  4BWS C;  2UUB O;  3MR3 A;  5C1O A;  5DM6 V;  4DV5 H;  3JZ6 A;  3KCY A;  1BGW A;  1PX2 A;  2DN9 A;  1N33 B;  3TXS A;  1GO3 E;  3GIP A;  3ZHU A;  4JI3 H;  1R3I C;  1R6T A;  2P5O A;  3NGD A;  5EZY B;  2HEP A;  2XGQ A;  4B3T O;  5K1P A;  4DL2 A;  1WN7 A;  1XNR O;  4A3D G;  1EN6 A;  4DW0 A;  1F4M A;  2NUA B;  1Q90 D;  5EC1 C;  2DAA A;  1DTO A;  2YDE A;  3LSU A;  1TWC A;  2RGV A;  1YXB A;  3NUA A;  5KG1 A;  1P7G A;  3G67 A;  4CH6 A;  1G4Y B;  4UUJ C;  4IIJ F;  1RK6 A;  4DV4 O;  3KTM A;  2ZQM A;  4O7R A;  5FLX N;  1ZSP A;  1JX9 A;  3E8F A;  3FKS G;  4IRC A;  1AR4 A;  1WPB A;  4GC6 A;  2R92 G;  5AG2 A;  4RB2 C;  2QKA A;  4IWX A;  1FYJ A;  2AHY A;  4QGP A;  2W6M A;  5KMG B;  2BCC H;  2QEX V;  4A2B A;  3CCE V;  5KHI A;  5CA1 A;  4EEQ A;  4FJC C;  4ECY A;  2FL4 A;  3KZI Z;  2OIE A;  2GBO A;  3B09 A;  1OCZ B;  2E2I A;  3S3X A;  1I1L A;  4MV7 A;  2WTF A;  1JQ0 A;  4O4I A;  1AJP A;  4OPH A;  1YJW V;  1FPO A;  4YR0 A;  3JAM W;  3RAX A;  2E2H A;  3ZN0 A;  5J2T B;  4YP3 A;  4J9Q A;  1A0I A;  1HNW O;  5EK0 A;  3WB0 A;  4O2A A;  3A0R A;  1YDX A;  5KFU A;  4JI5 O;  3OR7 C;  2YIA A;  4LP8 A;  4LF4 H;  2YS6 A;  3OGC C;  2Y0S A;  2R8G A;  1X59 A;  4YY3 H;  3KHL A;  2QGN A;  1JMK C;  1KP3 A;  1UC8 A;  1TUB B;  5IYZ A;  3GWK C;  4CE5 A;  1N4C A;  2E74 B;  2H94 A;  1WR2 A;  4ECR A;  3IFX A;  2R82 A;  4CC5 A;  1TVK B;  1K83 A;  4O4J F;  4FFB B;  1M0T A;  1SQB H;  3JAW B;  3NBY B;  3RYC B;  4X62 B;  4I0X B;  4LF6 O;  1FXK A;  3JD1 A;  1DV2 A;  4B3M O;  2CAZ C;  2Z0A A;  1B6R A;  4O4L F;  2NU9 B;  4J9S A;  2Q0O C;  3DSQ A;  1GO3 F;  4X62 H;  1WCM A;  4JI8 B;  2LP7 A;  4IL6 Z;  4B7K A;  3HKD A;  1URF A;  5J2T F;  4B08 A;  3W7T A;  2W9C A;  2VQE H;  5ITZ B;  4IHJ A;  4R6Z A;  1NH2 D;  5D5P A;  3NBZ B;  2HVS A;  3AG1 C;  3ETH A;  4D7T A;  4YBZ B;  1NH2 B;  3ZX6 A;  2E76 B;  4LF8 H;  3WG7 B;  3PN1 A;  4O3N A;  5JH7 B;  1CQI B;  2LJ2 A;  1BZK A;  1SCU B;  1MG1 A;  2UXX A;  1Q81 W;  2UXD B;  3BAA A;  3RN4 A;  5JVD F;  3GTM A;  4GKJ H;  4DUZ O;  3H9V A;  4HR7 A;  5LOV F;  1BQZ A;  4JZG A;  4QWB A;  2EIK C;  4LF5 H;  1OCR C;  3GV7 B;  4YJ2 A;  4NXN H;  1YTF D;  1AR1 B;  3RFR A;  3D8C A;  4DK1 A;  4DV6 B;  2IJI A;  2BE3 A;  1YTF B;  4WFH A;  4ME6 A;  4ED6 A;  1M7J A;  1JCH A;  2NU7 B;  2UXN A;  3PO2 G;  3U11 A;  2WLL A;  3OMA B;  2OCC B;  4YAK B;  2F93 B;  3DTF A;  2YRX A;  3HBL A;  3N2K A;  1M57 B;  1BCC H;  4RNN A;  2HHH H;  2W57 A;  3HKE B;  4BIU A;  1GN4 A;  1P49 A;  2HGW A;  1H2S B;  1SER A;  5BR8 O;  5IYD O;  2R93 A;  4LH6 A;  2Q8V A;  2ITD C;  5CA3 A;  3MD0 A;  4FZ1 A;  1DK1 A;  3CJH A;  4CS2 A;  4UXN A;  4TV8 B;  4K3A A;  2HIX A;  3N43 B;  3ZMU A;  5JH7 F;  4ED1 A;  4CC6 A;  2WB1 E;  2CGO A;  3CX5 F;  5KFK A;  4DR4 O;  4WCE V;  4A3K G;  3WO1 A;  4LF9 H;  3CCQ V;  2WE6 A;  5L9X A;  2CUG A;  1YIT V;  3LDD A;  5KG0 A;  3SE7 A;  4Q8F A;  2UVW A;  3N6R A;  3HOY G;  3E35 A;  1FXV A;  2YS8 A;  1XEQ A;  4QJF A;  5DQH A;  1QBZ A;  1H2K A;  3T9D A;  3ZRX A;  4DR2 O;  1HR0 B;  3VOT A;  4GZR B;  5DQG A;  4JI6 B;  2DLN A;  5K2M A;  4R8C A;  4ZOL B;  1JPX A;  3PO3 G;  4FE2 A;  2AZ0 A;  4FPP A;  4ECX A;  2HKO A;  2WPD G;  3HKC A;  2R8K A;  3K0G A;  1SS3 A;  4JI6 H;  4F4W A;  1K73 W;  2UUC B;  3CVZ A;  3SI8 A;  1BS3 A;  1HNX B;  5LA6 B;  3K3P A;  1XMQ O;  2W71 A;  2UUC H;  4HNA A;  3SYC A;  2CE4 A;  4D7S A;  2NR5 A;  2E75 B;  1BT8 A;  1Y76 A;  1LUV A;  3K5O A;  4WFA V;  2XHB A;  2R84 A;  2EJ7 A;  1QLE B;  2ZCE A;  3L2P A;  1FS0 G;  4JI4 H;  2RJZ A;  4UB6 Z;  1K7D A;  4J9L A;  4DR1 H;  5KFO A;  2UXB O;  5C1P A;  3RYF B;  3G80 A;  3VQV A;  1S76 D;  1M0W A;  4MA5 A;  4GT1 A;  1RK5 A;  5KFD A;  2JA6 G;  3FD9 A;  2ZE7 A;  4MV6 A;  4FIP C;  1XIL A;  4YHH H;  2DWD C;  5TIS Z;  2VOB A;  4NXM H;  3K9A A;  2FML A;  2HLD G;  1XI1 A;  3V4Z A;  1O75 A;  4AI8 A;  4NVP A;  1H8E G;  1WB8 A;  3T9A A;  4XDK A;  2COJ A;  3ASO B;  2PVP A;  4J9Y B;  1R73 A;  1VQN V;  3QQM A;  2ZDQ A;  2Y69 C;  2M6Y A;  5BY1 A;  1RJQ A;  1UNN C;  3R65 A;  3JAR B;  5DLG A;  5HNE A;  3A2F A;  4E6N A;  1YI2 V;  1SA0 A;  3OSN A;  5LA6 F;  5CA0 B;  4JYY A;  3LP8 A;  3AK2 A;  4A2A A;  4U7O A;  2JIZ G;  3H3V H;  5DEC A;  4JV0 A;  3E86 A;  2HVR A;  1GN2 A;  4K0K O;  1SFO A;  3VNN A;  2CQY A;  2BR0 A;  3N40 P;  4YXW G;  3W7X A;  3K5M A;  2HHF B;  1FXK C;  1SZT A;  2B9Z A;  2OT5 A;  3P3P A;  1CEZ A;  4CKC A;  4FFL A;  1FVI A;  3ABT A;  4DV0 B;  4KHP O;  3SJC C;  1M56 B;  2CNU A;  4NZM A;  5BWT A;  2YZL A;  2C00 A;  2NU8 B;  4JV5 B;  1PL0 A;  5LP6 C;  3TW7 A;  3D3Q A;  4X89 A;  4QIW A;  1Y6X A;  5A2Q N;  4FFN A;  1YJ9 V;  1FAF A;  2RCV A;  4JV5 H;  3Q8Q B;  4I4T A;  3CYO A;  5IJ9 B;  2D3O W;  5I5V A;  1RYR A;  3WO0 A;  1Q82 W;  1N32 O;  4IYH A;  3GTL A;  2PYL A;  1PPJ H;  2WLM A;  1H8H G;  2GDS A;  3AG3 C;  1AB3 A;  2W7P A;  4PZ7 A;  2FP4 B;  3ORQ A;  4YB8 B;  2BTQ A;  4UV8 A;  3AG4 C;  2XAS A;  1I7L A;  5CA0 F;  1Y1W G;  1S5L Z;  5KT3 A;  4P30 A;  4TT3 G;  4MT8 A;  4O2B B;  5I5T A;  2LFR A;  4BY1 G;  2M7W A;  1KKC A;  4GKK O;  4GX5 A;  3GQC A;  4NTX A;  4EB6 B;  4HYK A;  1OJH A;  2ZDI A;  4YJ3 F;  5BZB A;  3OUF A;  3OFN G;  1ZAU A;  2UVU A;  5HFL A;  3IN5 A;  2GUZ B;  1VMG A;  1NJI W;  2HGS A;  2Q2T A;  4LSA A;  3N2G B;  4DXW A;  3VPB A;  4J9P A;  2KB1 A;  1OCO B;  3RUP A;  4E2L A;  2UUB B;  4NB5 A;  5EYP A;  3HT5 A;  2LGW A;  2YXL A;  1SKV A;  5JWP A;  4LNU A;  4J7K A;  5B1A B;  2AXT Z;  3IGA C;  2UUB H;  1HDJ A;  3IC7 A;  4DR6 B;  1HNZ B;  4BIZ A;  2YZM A;  3ZRS A;  4B3T B;  5FLX W;  4L8J A;  2YIB D;  3G6V A;  2EIJ B;  2YXY A;  1XNR B;  4E4E A;  1QR8 A;  1B33 N;  3UCS C;  4FLV A;  4B3T H;  2A0L A;  4U6P A;  5KFX A;  1VF6 A;  2BTO A;  1XNR H;  4R7C A;  1LUW A;  1R6K A;  4O2B F;  2WWW A;  3GTO A;  2XAJ A;  3EXA A;  4X1Y B;  4I55 A;  1ET0 A;  4DRF A;  2FPI B;  1V54 B;  4DV4 B;  5L3F A;  3ETJ A;  1OBD A;  1G1X B;  1BSM A;  3H1I H;  4JI0 B;  2ODM A;  1J5E H;  2GTS A;  4DV1 O;  5F9N A;  2X6C A;  4RU9 A;  5B1N A;  2O57 A;  1EUD B;  4DV4 H;  2LGQ A;  2YS7 A;  2NU6 B;  5CB4 B;  5DLF A;  2QSA A;  2QE7 G;  1GAX A;  3NXS A;  2ADQ B;  4LF8 O;  4QWA A;  2EIN B;  4FLU A;  5D8D A;  5IP7 G;  3UFX B;  3THO A;  4QW9 A;  3W7U A;  1R9T A;  3E8G A;  2DQ3 A;  4GKJ O;  1HP8 A;  5LXT A;  2AGO A;  4NXN O;  1K5Q A;  3U9T A;  1V55 C;  2RDJ A;  3HKB A;  3P32 A;  5L1I A;  2B5U A;  3T9F A;  5C44 G;  5IJ0 B;  2PYJ A;  3W5O A;  2C35 B;  1JA8 A;  3GWO A;  5CM0 A;  4GLX A;  1HNW B;  4TM5 A;  3C3S A;  2HHH O;  2EZP A;  5D1O A;  5C8Y F;  4DR7 H;  3RF2 A;  2CDY A;  3ZRV A;  5JJN B;  5DED A;  3RB4 A;  4GUN A;  4PA6 A;  4ASU G;  3OUZ A;  5FNV A;  3B8M A;  3APO A;  4JI5 H;  5KA6 A;  4JI7 B;  2I80 A;  2QR4 A;  4I50 B;  2RGR A;  5FR9 A;  3QVN A;  5L3E A;  3QF7 A;  1K5S A;  2YID A;  2CNV A;  4FM2 A;  1S9F A;  4J41 A;  4GC7 A;  3RB3 A;  4LF6 B;  4LF9 O;  2MCT A;  5IYC O;  2P06 A;  1KUQ A;  5DIS C;  3GID A;  1P84 F;  5LYJ B;  1E4E A;  5IYB G;  2C2R A;  1RM1 B;  4X64 O;  2LW7 A;  2CNQ A;  3K08 A;  4FFR A;  1N0J A;  1GM9 A;  2RN9 A;  4KXR A;  3ZRW A;  4LF6 H;  2WYO A;  2QTO A;  3RGX A;  4B3M H;  4P2Z A;  4PA9 A;  1DF4 A;  1CP9 A;  1DV1 A;  1AJQ A;  3JAL A;  2HFE C;  4F4Z A;  2JA6 A;  5KT6 A;  5J2U B;  4JYC A;  2R8H A;  4LFB O;  2BSK B;  3R5X A;  2WAM A;  3SPG A;  1XMO B;  3RWR D;  4DRX B;  2PI4 A;  5EWE A;  4PA4 A;  1KBH A;  1Q3E A;  3M99 B;  3IC9 A;  4DUZ B;  3OT7 A;  4J42 A;  5KG6 A;  3OE7 G;  1W96 A;  2EJ2 A;  1TUE B;  4PJ0 Z;  5KFT A;  2R7Z A;  4I50 F;  3SNO A;  4Z2W A;  3OTO H;  2EJR A;  5KG4 A;  2PF4 E;  4JI4 O;  4X20 A;  3TY9 A;  4C7U A;  1XK5 A;  2PN1 A;  4Q44 A;  4LFC H;  1Q7Y W;  1BXR A;  5JJJ B;  5LYJ F;  4DL7 A;  1TWH A;  2K1E A;  2OYQ A;  1MAB G;  2ZDI C;  1S0N A;  4NXM O;  4WBN B;  3G71 V;  1D2D A;  3N42 B;  4A93 G;  3AG7 A;  2ITC C;  1OHH G;  4WFG A;  4H44 B;  4TV9 A;  5BR8 B;  3L4J A;  2E5L B;  1M4U A;  2H8P C;  4IWY A;  5BMV B;  2AZ2 A;  1B04 A;  4BAY A;  5KFM A;  5BR8 H;  1BL8 A;  2YC0 A;  2R6F A;  2QTS A;  3TEK A;  4ICG A;  3STL C;  2FTK A;  4WD3 A;  2ZXW C;  1Y4M A;  3KYH C;  3T1H B;  5JQG F;  3WWJ A;  2ZNI A;  2DAB A;  4G27 B;  3JCU Z;  4RB3 C;  4BIO A;  2HJF C;  4DR4 H;  1CKN A;  3UT5 A;  3ZBH A;  1K4C C;  2COG A;  2ODT X;  5C5J A;  4F4Y A;  4DV7 B;  3HOZ G;  3CC7 V;  2DJV A;  4KL1 A;  1CPY A;  2HVK C;  4DR2 B;  4RUF A;  2HDK A;  3DAA A;  3K9S A;  4MTF A;  3U0Z A;  1RFY A;  3JAS B;  3IG0 A;  4LFA O;  4FS2 A;  4DK0 A;  1M9N A;  2KKW A;  1WA8 B;  4N21 A;  1V51 A;  2W9B B;  4WBN F;  2R93 G;  1Z2N X;  2ARH A;  3PR5 B;  5B66 Z;  4CMF A;  4IIJ A;  2CW7 A;  2OCH A;  2AQ4 A;  4FM0 A;  5DN6 G;  1XMQ H;  3ML0 A;  4ZBM A;  1AI6 A;  1NTK H;  4O86 A;  3F5T A;  2O03 A;  3TGU H;  4LR3 A;  2Q7G A;  2EIY A;  2F43 G;  3RBZ A;  5JQW A;  2F1M A;  3K06 A;  2NN4 A;  1N36 O;  4WHX A;  1Z2O X;  2UXB H;  2C28 A;  2YW2 A;  3ABL C;  4O81 A;  1VQM V;  4WF9 V;  4UV9 A;  1N34 O;  3JAT A;  1TA8 A;  3GIK A;  1GLV A;  1MA1 A;  2Q0A A;  2QYZ A;  4BWA A;  4LH7 A;  1IXM A;  2YCH A;  3KG2 A;  5LMN O;  2F23 A;  2R85 A;  4FBT A;  3VPD A;  2DWE C;  5C3E G;  3M9M B;  2CK3 G;  4HQ6 A;  1XQ8 A;  4RB0 A;  4ED7 A;  1VQP V;  1QVG U;  1CQJ B;  5A2Q W;  3H1J H;  4K0K B;  3U55 A;  3WB1 A;  1FFX B;  4ECQ A;  3RYH A;  1BQ0 A;  3G8D A;  3AG1 B;  2JK5 C;  5KG2 A;  4AYB E;  1YEW A;  4K0K H;  4NKG B;  1XDC A;  3DXR A;  2PUS A;  3K58 A;  2L6L A;  5KMG A;  4MW3 A;  1XNQ H;  4O4J A;  1SEI A;  4IT5 A;  2H3O A;  4Y8V B;  4KHP H;  2EIK B;  1OCR B;  4UCS A;  3J80 N;  4EBD A;  3HB3 B;  3QO7 A;  4O4L A;  4FM1 A;  3U9S A;  2GV9 A;  1J5E O;  1SYX B;  3MJF A;  4C2M A;  4LSX A;  1PV0 A;  3D3I A;  4FGR A;  1UPG A;  5IDJ A;  5CN0 A;  1IYE A;  4J9K A;  1ROP A;  5J2T A;  2HVQ A;  1MZE A;  1BMF G;  4DR5 O;  4L1K A;  1N32 H;  3L71 H;  4LBE C;  1RSO B;  3PW5 A;  4O3S A;  1AR5 A;  2FPG B;  3JRX A;  4HBN A;  4QWC A;  4DYL A;  4MV4 A;  5IY5 C;  5JVD A;  4FVM A;  3BQ2 A;  5LOV A;  3CSX A;  4X1K A;  1VP7 A;  3SPH A;  3CCV V;  5EZY F;  4GKK H;  1ZHQ A;  1JDB B;  4A3G G;  2W6Q A;  2ZIM A;  3L74 H;  1TVK A;  1T5E A;  2XAQ A;  4EKW A;  5EC2 C;  3P30 A;  5KFN A;  4DV2 O;  4DR7 O;  3JAW A;  2QWO B;  4LF4 B;  4I0X A;  3GII A;  1NI8 A;  2P4K A;  3ZHQ A;  4YY3 B;  5HV6 A;  3IJ4 A;  2Y48 A;  4MV8 A;  1TWF A;  5KHJ A;  1AI5 A;  4U3J B;  3ZMT A;  2DZD A;  2EJ3 A;  1FJG H;  2XAF A;  1IUR A;  5CBH A;  4J9Z B;  1XL4 A;  4ABM A;  2JVD A;  4DL3 A;  2ZE8 A;  1DGS A;  1R3J C;  1RP3 B;  2CH7 B;  1L8D A;  4GCZ A;  3SJQ C;  4X88 A;  4EBE A;  4EEY A;  1P4R A;  4EYH B;  3CCM V;  1LNQ A;  4ZIB A;  1Q86 W;  3CCS V;  2R72 A;  1J95 A;  2JJ2 G;  4E4T A;  1Y14 B;  5KLV H;  4D6T H;  5E25 A;  5CA1 B;  2B1G A;  3B8N A;  4DV1 B;  3GTK A;  1KC8 W;  2ILM A;  1OV9 A;  2VQE B;  5KFY A;  5KFG A;  1S0M A;  3WWI A;  1PNK A;  4DV1 H;  5BWR A;  3G6B A;  4O7S A;  4JGS A;  4PA3 A;  4LF8 B;  5KHG A;  1IBM O;  4UVB A;  3UYY A;  4G28 B;  5IT9 W;  3GIQ A;  3AEI A;  5I5Y A;  3QZ7 A;  2N05 A;  2Z02 A;  2JS3 A;  4GKJ B;  4AQY H;  3CEI A;  3T2M A;  3HR0 A;  4LF5 B;  3VPC A;  4NXN B;  4O2A B;  1KTA A;  3K5L A;  5LMU O;  4LWS A;  1S10 A;  2IJH A;  1RYS A;  1NR1 A;  1UC9 A;  1DLB A;  3OTO O;  4HN2 A;  2Y69 B;  3JCZ A;  5BWW A;  5KS8 A;  3FKI G;  1BNC A;  4B3R O;  3ZIA G;  4LFC O;  2YYA A;  2XT9 A;  1ZUQ A;  5IYZ B;  4A3F G;  1W2B U;  1IVS A;  1MOF A;  2HHH B;  1AIL A;  2Z5U A;  3MHH C;  3QO5 A;  1JFF A;  4Q20 A;  3X2Q C;  5CA1 F;  2Q7E A;  1HW7 A;  4RAY A;  1FXK B;  4W4L A;  5IP9 G;  4BXX G;  3Q8R B;  2JEJ A;  4JV1 A;  2CZG A;  2VUG A;  1KU9 A;  2ZD9 A;  3M9N B;  3VA7 A;  1S3J A;  5LP6 B;  1GRJ A;  2HJD A;  1IXB A;  3FB8 C;  2R8I A;  4LF9 B;  1DF5 A;  2W9C B;  3FAV A;  3S24 A;  1I08 A;  3GDE A;  4IHJ B;  4NYK A;  4O82 A;  5IWA O;  4X64 B;  2Q67 A;  5LA6 A;  4O2A F;  3GTG A;  4P9O A;  4LF7 H;  4IGG A;  3W7S A;  2ZGI A;  4UVA A;  2ZDG A;  3K59 A;  4X64 H;  4R7R A;  1VQ5 V;  3AG3 B;  3L70 H;  5EIB C;  3ABK C;  3H4B A;  1S5J A;  2OLS A;  4J80 A;  4CMD A;  3AG4 B;  4MA0 A;  1WNS A;  4PWQ A;  5GON B;  1BHB A;  2JA7 A;  3RYF A;  3RTX A;  5KFV A;  2WB1 A;  1C3O A;  4FFM A;  3H1L H;  4LFB H;  2WLL B;  1E1Q G;  1TAE A;  4H0L B;  3QFF A;  2W6I G;  3N2K B;  3H01 A;  1BE3 H;  3RV3 A;  4GX0 A;  4HZ3 A;  3T5L A;  4K8Z A;  5EWG A;  4KP4 A;  1VQ6 V;  4EGJ A;  3VQW A;  4X66 O;  5L3D A;  3AG2 C;  4RQE A;  3CMA V;  4JI4 B;  3K5N A;  4DR1 B;  5LP6 F;  4Q4D A;  4I5S A;  4OX9 O;  2HR3 A;  1XDN A;  4TV8 F;  4G3I A;  4RAI A;  1VKZ A;  3DGE A;  1S0V A;  4JAS A;  1R1B A;  3CJH B;  1GK9 A;  3ETG A;  1FXH A;  1KJQ A;  4YHH B;  4JYA O;  4NXM B;  4PZ8 A;  3T5H A;  1WPX A;  5FL7 G;  3GTJ A;  3ABM C;  1PM9 A;  2QM8 A;  4IRD A;  4J9O A;  1R3L C;  1N0N A;  2RF4 A;  1SQV H;  3BQ1 A;  4NZN A;  2C2D A;  2V1D A;  2JEX A;  2Q68 A;  1I7N A;  4YJ3 A;  1Z5W A;  3R5H A;  3ASN C;  3JZF A;  5GON F;  4ZOL F;  3O65 A;  2ADP A;  1XUQ A;  2WLJ A;  3CB2 A;  1EN5 A;  5B1B B;  1IOV A;  2P67 A;  4PBC A;  3LDC A;  2FLP A;  1XHZ A;  4UCO A;  3ABU A;  4A5U B;  4MV9 A;  2R7Z G;  4RO2 A;  1I5Y A;  1MZB A;  1PNM A;  1Y66 A;  1FKA O;  2R86 A;  4HNU A;  3BVO A;  1T36 A;  4JPR A;  1QR9 A;  2N74 A;  4X8A A;  3BA9 A;  4RB1 A;  5BWX A;  2VPS A;  3WG7 C;  4FBU A;  4HNA B;  4RWU A;  1XBL A;  2JA5 A;  1Z2G A;  2D2C B;  2R8J A;  3GJX B;  3RBE A;  4ETS A;  4MTO A;  2VWJ A;  3RB6 A;  1XNQ O;  2CFM A;  2VA3 A;  5KT2 A;  3MDS A;  2FMA A;  3OD4 A;  4LFA H;  2HJW A;  3ZMV A;  4O2B A;  3OUS A;  5DG9 A;  2Q4P A;  1EFR G;  4RUE A;  5KFC A;  4TQF A;  3SGI A;  4CKE A;  3T1C A;  4DO2 A;  4W4K A;  4EB6 A;  3CCR V;  3BG5 A;  1V4Y A;  1VQ8 V;  4WFE A;  2R7M A;  4O3P A;  4A3J G;  2ZKO A;  5HBR B;  2QJ1 A;  4M7E A;  3CCU V;  3T9B A;  1KB9 F;  3E22 A;  1XOU A;  3QG5 A;  2VUM A;  3MWM A;  1B3Q A;  2ATK C;  3BA8 A;  4X1I A;  3T54 A;  4MTD A;  2YI8 A;  2AU0 A;  1ZET A;  4GLW A;  4EYI B;  4PDM A;  2GQS A;  1N36 H;  2Y0I A;  2W0X A;  1I7F A;  1H38 A;  4ZQI A;  1SA0 B;  1GN6 A;  4UCR A;  2HGX A;  4JTD B;  5GW7 A;  2EUL A;  3EPG A;  1IBL O;  4EFB A;  2WA3 A;  1I94 O;  1GGO A;  3WU2 Z;  1SQP H;  1N34 H;  4XDJ A;  4O7N A;  2YIB A;  1SF9 A;  5FPO A;  4JTA B;  2V4R A;  1GH6 A;  3AK1 A;  2JA8 G;  3HKZ E;  1T3N A;  3T4Z A;  1I3Q A;  4PI2 A;  5LL6 b;  5C8Y A;  1JVM A;  5LMN H;  3J7A U;  2Y0P A;  2FPP B;  3RBD A;  2JGD A;  3J80 W;  4F6R B;  5KG3 A;  4LCU C;  1FJG O;  4ECS A;  4F6E A;  3CCJ V;  1I2K A;  4R8U A;  5B1O A;  2WLN A;  2R7N A;  1KEC A;  3GB8 B;  5CR5 A;  3W1G A;  1JX4 A;  4XYM B;  2SCU B;  2WLH A;  2OIG A;  1OZ0 A;  3CS5 A;  2GQR A;  2OTL V;  1IDS A;  4K35 A;  3JZI A;  2ZIN A;  3FKI A;  2BTQ B;  4JXU A;  1M93 A;  2EIL C;  4PV1 B;  2R7K A;  1J5E B;  3IAY A;  2KG7 A;  4HNT A;  3E83 A;  1PD3 A;  3GV5 B;  3RGZ A;  4Z1M G;  5IJ0 A;  4ZHQ B;  1KJ9 A;  3JYC A;  4FMT A;  2IBZ H;  3FYE B;  4BW9 A;  4DR5 H;  2DWC A;  3QNE A;  5IYB O;  1BJT A;  4AQY O;  2FK2 A;  3OUU A;  3CE2 A;  3VBB A;  2FKL A;  5H80 A;  1FD9 A;  2J6T A;  1XRE A;  1KBL A;  1K4D C;  2XTA A;  4U3F H;  3MAQ A;  1QU7 A;  1Y67 A;  3H1K H;  1I1M A;  5I60 A;  5KA5 A;  1SQQ H;  4I50 A;  2E3C A;  4GX2 A;  1IBK H;  4JI8 O;  3TJT A;  1W93 A;  4XYL B;  1ZL8 A;  1NS1 A;  3ETE A;  1KUT A;  2Z04 A;  2Q2U A;  4ZI7 B;  4DR7 B;  2QM4 A;  3T9E A;  3OSP A;  1S0O A;  5LBQ A;  1S68 A;  3A8T A;  1GSO A;  4QW8 A;  2DYR C;  2UXC O;  3M7M X;  5LYJ A;  3MHS C;  5DG8 A;  3HOV G;  1CKM A;  4DV2 H;  1YVW A;  4JI5 B;  2FE3 A;  4QNH B;  1W0J G;  5KUK A;  5KFA A;  4FFK A;  2OWO A;  2XCA A;  3PZP A;  1WLE A;  2HG5 C;  3B40 A;  2UXD O;  4FLZ A;  4JV2 A;  2NVY A;  1K34 A;  3NR7 A;  4RZR A;  2XUM A;  4P9P A;  3MR5 A;  4J7Z A;  5GTH Z;  4NZO A;  1S03 G;  4ZHQ F;  2N04 A;  2W9A A;  2YWV A;  4UCV A;  2QB5 A;  2IW5 A;  4DL4 A;  3H4D A;  4TUY A;  1VQL V;  5CB4 F;  1A32 A;  5KFL A;  1G2W A;  2WLK A;  1EZJ A;  1YJN V;  2ZIO A;  4J9N A;  5JQG A;  5KHH A;  3W1B A;  4WFB V;  1COW G;  4LF7 O;  4Q43 A;  4RAZ A;  4B3M B;  2YRW A;  2R7L A;  3WWH A;  4TWK A;  3MWD A;  3SR2 C;  1GTO A;  5I5W A;  4YIO A;  5LXT B;  4UFZ A;  2VR1 A;  3EHB B;  4QWD A;  2XD4 A;  1NBM G;  4DUY H;  2X0L A;  3FB5 C;  2RMK B;  3P3N A;  1JIH A;  2A06 H;  2Q6A A;  3PW2 A;  4ZI7 F;  3HKB B;  4MVO A;  2XIG A;  3SJA C;  2GHY A;  3ABL B;  2YEV A;  2Q69 A;  5E79 Z;  4CBC A;  1MSD A;  2WLI A;  1P16 A;  2GPS A;  5B3S C;  1IBM H;  4WBN A;  1F23 A;  3Q4H A;  4QE9 A;  1VBH A;  3SPJ A;  3G6Y A;  3AYH B;  2CTW A;  3OTO B;  4EQ5 A;  2PBZ A;  2J6U A;  4M0J A;  5LMU H;  3WNZ A;  2ZM6 O;  3H0G G;  4B3R B;  3LNN A;  4LFC B;  4I7H A;  1L0N H;  1ARO P;  1Y74 A;  2XC9 A;  3UZO A;  3K03 A;  2X6B A;  4B3R H;  4JYB A;  3OM3 B;  3NC0 B;  2ZE5 A;  3BRC A;  5KFW A;  5KT5 A;  3RV4 A;  3N6X A;  3M8A A;  5KT4 A;  4O3R A;  4OGQ B;  4DR3 H;  3FB7 C;  2VQD A;  4MVM A;  4PI0 A;  1NR7 A;  3ZN1 A;  3U0G A;  2Z3Y A;  3UKM A;  1E4E B;  3C3T A;  5L3B A;  4J7J A;  3KHG A;  1NTZ H;  1UFI A;  3KCX A;  3ZRW B;  3JAK B;  2HG8 A;  4MV1 A;  3E8B A;  3EYY A;  3T1Y H;  1K8A W;  5J2U F;  3RW0 A;  2P0A A;  2Q73 A;  4RNO A;  1X4T A;  3CCL V;  4QPJ A;  3ZHV A;  2IP4 A;  2QKC A;  2YSU B;  4UCU A;  2CTR A;  2W9B A;  2JDI G;  2PZS A;  1E4F T;  4DR4 B;  3Q1K A;  3HO8 A;  5D1P A;  4EG0 A;  1AN7 A;  2FK3 A;  1TGO A;  1IOW A;  5IWA H;  2P6J A;  4XDL A;  1WP7 A;  3OMI B;  4ECW A;  1YCI A;  5KFS A;  5J9P C;  3KHR A;  4F50 A;  3ZHR A;  3APQ A;  4X65 H;  3GIL A;  1VF6 C;  3CXH F;  1TWG A;  5KG5 A;  2QWQ B;  2QWR B;  1K33 A;  2ZE6 A;  5IY5 B;  1A48 A;  4XBF A;  2QDO A;  2WSS G;  2JGU A;  2YI9 A;  2WDT A;  5CMU A;  4IAJ A;  4O7Z A;  4Q45 A;  1XMQ B;  3OEH G;  4MVU A;  2IBK A;  2WAQ E;  2YUA A;  2W8L A;  2MK3 A;  2Y4R A;  4YR2 A;  5BMV F;  2GPW A;  4MVQ A;  4X66 H;  4TV9 B;  3PFF A;  4OX9 B;  3JD2 A;  2Q9L A;  5L1L A;  2BQR A;  1GSH A;  3TY8 A;  2UXB B;  4BBS G;  1ENV A;  2R9I A;  2M05 A;  5F9L A;  3G6E V;  4OX9 H;  5IE9 A;  2RDI A;  4I7Z B;  1O9H A;  4NYE A;  3UO3 A;  3CD6 V;  1MSW D;  1OBG A;  3UO2 A;  4JYA H;  2DPJ A;  3RYI B;  2JA7 G;  1FFX A;  4J10 A;  3N8D A;  1YF2 A;  2PMZ E;  1GKF A;  1QHT A;  3EPI A;  3UT5 B;  4O7V A;  4EGQ A;  3CP1 A;  5EZY A;  1MNG A;  1S97 A;  4ZKI A;  4HNV A;  3I55 V;  5B5E Z;  5LGU A;  1KYO F;  1G6U A;  4O4H B;  2UU9 O;  1TWA A;  4IR9 A;  5KAF Z;  4C5B A;  1ZQ7 A;  4O7L A;  2X6A A;  4FU0 A;  4OPA A;  3RFC A;  4FM9 A;  2L35 A;  3CXC U;  1Q43 A;  3GLK A;  3CRA A;  2EIM C;  1FKA H;  1Z5V A;  4CHI A;  2NLJ C;  4YQW A;  2ZR3 A;  3E8H A;  3RIZ A;  1WB7 A;  3RVY A;  1OCC C;  1XNQ B;  4APM A;  4ECU A;  2YIC A;  1RPR A;  2GSM B;  3RJ0 A;  4KHP B;  3BHP A;  1EM1 A;  5JCO A;  1A9X A;  3T5K A;  2FKX A;  4BR6 A;  3PVX A;  5CAE B;  5BXZ A;  1ZX3 A;  4NLG A;  2JEI A;  4O7T A;  1AUX A;  3OMN B;  4YAJ B;  1AI7 A;  3B77 A;  3AX6 A;  1RPO A;  4QSH A;  4FFP A;  4PDB A;  1CS0 A;  3WB2 A;  1EUC B;  2ABJ A;  1VAJ A;  1N32 B;  1I0H A;  4AYB A;  3I4M G;  2ZDH A;  4DR6 O;  2YL2 A;  1HNZ O;  3LML A;  3JAT B;  2DYS C;  1IZ3 A;  1NZ6 A;  3K0D A;  4O4H F;  2X5R A;  2DW4 A;  2CKZ B;  3MFI A;  3X2Q B;  2A1H A;  1N33 H;  4RUA A;  3L73 H;  4JI1 O;  2A79 B;  2ZNJ A;  1KT8 A;  3ORR A;  2EBO A;  1EBO A;  5H6R A;  2P4V A;  1B6Q A;  2JA5 G;  1EZ1 A;  5KX5 B;  4U3J A;  4GKK B;  1IBL B;  1IBK O;  1JDE A;  2R87 A;  2W6O A;  4MTG A;  1I94 B;  1JJ2 U;  1TUB A;  3OR6 C;  4DAA A;  2ALZ A;  4JI0 O;  2CH7 A;  3RYH B;  1IBL H;  2PI5 A;  1I94 H;  4NR1 A;  1US6 A;  4FFB A;  3DXR B;  3BY6 A;  3KRE A;  1GSA A;  5I47 A;  2ETN A;  5EIB D;  3RYC A;  4O4J B;  3FYI B;  4G2K A;  4LC1 A;  3HOX G;  1XHX A;  3ABK B;  3FFQ A;  1S72 V;  1FJG B;  4A3M G;  3GB7 C;  3MR6 A;  2VUM G;  4PHZ A;  3TIN A;  2P22 C;  4O4L B;  2G38 A;  3A0H Z;  2Y0S E;  3PW0 A;  4UB8 Z;  3CHX A;  4NTY A;  3KKY A;  3CRC A;  5E1A C;  1U96 A;  1SRY A;  1M90 W;  2B1I A;  5ITZ A;  2HP8 A;  3G8C A;  5BYB A;  3ZJZ A;  2NVX A;  1I2L A;  1L1F A;  3AG2 B;  3H0G A;  5JH7 A;  4R50 A;  1D5N A;  3HOU G;  4O3O A;  4IZO A;  1YZB A;  3LWB A;  4HYO A;  5KX5 F;  2LQT A;  4ED3 A;  5KG7 A;  1WP8 A;  2R9A A;  4N23 A;  3ZMS A;  1ZHS A;  1QVF U;  1Q6I A;  5JVD B;  1WRV A;  4DUY O;  1K3E A;  5LOV B;  2LW1 A;  3RVZ A;  4JI7 O;  4X1K B;  3RGB A;  2JRI A;  3UZB A;  2ASJ A;  1QLN A;  5KFR A;  3CRR A;  3ABM B;  3V4S A;  2C22 A;  1N48 A;  4O4I B;  3MWE A;  2W0F C;  4AQY B;  4CS3 A;  2BQU A;  2AW9 A;  5JUM A;  3E5N A;  3TQT A;  4JI2 O;  3H1H H;  4PEL A;  1S77 D;  3HKE A;  5H2F Z;  3WFV A;  2B63 G;  2W70 A;  3BFR A;  2XGP A;  3SYO A;  3ASN B;  1IYD A;  2EZO A;  3VQX A;  5L3C A;  3GV8 B;  5L3G A;  3R23 A;  4JTC B;  4Q4C A;  5LP6 A;  2Q5Z A;  3EFF K;  4NTW A;  1ZWI C;  1EKF A;  4ECZ A;  4JI8 H;  4TV8 A;  4O7W A;  3QO8 A;  3KAJ A;  3ZHS A;  3F5W C;  2UXC B;  1B06 A;  5KFJ A;  2UVV A;  2YXH A;  3CC4 V;  4Q0Y A;  4DV3 O;  4DR3 O;  1XL6 A;  3SYQ A;  4A3B G;  4EFE A;  1XMO O;  2UXC H;  4J0M A;  5FLM G;  3M9O B;  5C93 A;  1GN3 A;  3K57 A;  3U10 A;  3JSN A;  1WH2 A;  4TQD A;  3OTF A;  3T1Y O;  3C90 A;  3G4S V;  4K6N A;  2UXD H;  1OWT A;  4RUC A;  3ZCC A;  2ATL A;  3F7V C;  3LUT B;  5GON A;  4ZOL A;  2IU0 A;  3T4D A;  4O4I F;  5T14 A;  1F7Y A;  2V7Q G;  3HKD B;  3MR2 A;  2PGG A;  1EKP A;  4RCN A;  5LL6 Y;  1KJI A;  1MZF A;  3A0B Z;  3LDE A;  4DV6 H;  2RQ6 A;  4AIL C;  3PR4 A;  2ASD A;  4LF7 B;  3SYP A;  3W7W A;  3GVM A;  1AI4 A;  5D5Q A;  4DLK A;  2P7T C;  4A3I G;  4B3S O;  3T9C A;  5JCO C;  1NT2 B;  1W0K G;  4O84 A;  2V4D A;  4LWS B;  4X65 O;  3ETD A;  3KHH A;  5LHH A;  3R66 A;  3I56 V;  2E5L O;  1DIK A;  1I6U A;  4YJ2 B;  5DGH A;  2VA2 A;  3VOU A;  1VBG A;  4MVR A;  4LFB B;  5IYZ F;  3ZMZ A;  1KC7 A;  2DOS A;  3JD3 A;  4JAV A;  3CQZ A;  3FDS A;  2EJ0 A;  1OCZ C;  3MFH A;  1N56 A;  4UVC A;  4B7E A;  4O83 A;  4DL5 A;  1BGY H;  1R6N A;  5H6Q A;  4U7N A;  1JFF B;  1NU1 H;  2RDC A;  3T1H O;  1E1R G;  4MTE A;  4BW5 A;  2ZM6 B;  3CWB H;  5FPR A;  3L9D A;  4F4X A;  2BOB C;  1Z2P X;  1T94 A;  2GTA A;  4DV7 O;  3PJS K;  1AP5 A;  2OTJ V;  4GYC B;  2IJK A;  2J6S A;  2QA4 V;  2ZM6 H;  1EKV A;  2J9G A;  5KFF A;  3OHB A;  3PW4 A;  2QF7 A;  5FJ8 G;  2ASL A;  4IHJ F;  3JAR A;  5EBL C;  3KAL A;  5L1J A;  2LO1 A;  3CSW A;  1HR0 H;  3FAV B;  1VEW A;  5CA0 A;  3E2E A;  1JOY A;  3TW6 A;  5I5X A;  4CS4 A;  3QTC A;  5BYA A;  3BQ0 A;  4MV3 A;  3J81 N;  4HAM A;  5DAA A;  1HNX H;  4U7C A;  4YJ2 F;  3GTP A;  2HHF A;  5CBG A;  4FFO A;  2IH3 C;  3AK3 A;  4QJF B;  1KJJ A;  2EIL B;  4MVS A;  5IYD G;  1W59 A;  2YZG A;  3DF7 A;  3J7A K;  1QCE A;  4J11 A;  2F4V O;  3HKC B;  5KFP A;  3BJY A;  1JR9 A;  1SES A;  4MW8 A;  5I5U A;  4GX1 A;  2V9W A;  2FJZ A;  4JZ2 A;  2HIV A;  3S3W A;  4FZ0 A;  1KQS U; 
#chains in the Genus database with same CATH homology
 1TVK B;  1JJO A;  5IJ9 A;  4FM0 A;  1S68 A;  1XMQ H;  4FFB B;  3M7M X;  5LYJ A;  1M0T A;  1CKM A;  4DV2 H;  3JAW B;  4JI5 B;  3RYC B;  3NBY B;  4X62 B;  2FE3 A;  2CW8 A;  4LFA B;  2O03 A;  2CAZ C;  4LR3 A;  2OWO A;  5JJE B;  3BPZ A;  2Q7G A;  4FLZ A;  3DSQ A;  2F1M A;  4X62 H;  4JI8 B;  1S03 G;  4UCV A;  1Z2O X;  2UXB H;  3HKD A;  4B08 A;  4TUY A;  3VQY A;  2VQE H;  5ITZ B;  4IHJ A;  3NBZ B;  5D5P A;  2HVS A;  2ZIO A;  3JAT A;  5JQG A;  5KHH A;  4D7T A;  3W1B A;  5FD6 A;  1TA8 A;  4LF8 H;  3PN1 A;  5JH7 B;  4RAZ A;  4B3M B;  4YJ3 B;  2Q0A A;  1SQG A;  3ETQ A;  3N2G A;  4LH7 A;  4BWA A;  2YCH A;  2UXD B;  3BAA A;  3SR2 C;  4GKJ H;  1N36 B;  5LXT B;  4UFZ A;  4LF5 H;  4NXN H;  4YJ2 A;  5K1X A;  5KHK A;  4DUY H;  4F6R A;  3RFR A;  4DV0 H;  4DK1 A;  4DV6 B;  1XQ8 A;  2EX3 A;  3HKB B;  4RB0 A;  2XIG A;  3SJA C;  3U11 A;  5A2Q W;  1N34 B;  3TY5 A;  4K0K B;  2F93 B;  3WB1 A;  1FFX B;  3RYH A;  1P16 A;  3N2K A;  1IBM H;  4WBN A;  1QQC A;  2UU9 B;  2HHH H;  1YEW A;  3H20 A;  2W57 A;  4K0K H;  3HKE B;  5LMN B;  2PUS A;  4AHC A;  3K58 A;  3QWU A;  3OTO B;  4EQ5 A;  5KMG A;  1P49 A;  1XNQ H;  2UU9 H;  4O4J A;  1H2S B;  1SEI A;  5LMU H;  4KHP H;  4B3R B;  3LNN A;  4LFC B;  5EOY A;  4UCS A;  4I7H A;  4X1Y A;  4LH6 A;  4FLW A;  4O4L A;  4CS2 A;  4FM1 A;  4B3R H;  4TV8 B;  2GV9 A;  3NC0 B;  1SYX B;  3BRC A;  2HIX A;  3N43 B;  4ZHQ A;  4LSX A;  3N6X A;  4CC6 A;  4I4T B;  4DR3 H;  4LF9 H;  5J2T A;  4PI0 A;  2HVQ A;  5CB4 A;  2WE6 A;  3E22 B;  1N32 H;  3SJB C;  3JAK B;  4X1I B;  3EYY A;  3T1Y H;  4HBN A;  1HR0 B;  4JI6 B;  1X4T A;  5JVD A;  4ZOL B;  4FVM A;  5LOV A;  1GYF A;  4UCU A;  3JSL A;  3HKC A;  3CSX A;  4X1K A;  4JI6 H;  2PZS A;  1E4F T;  4DR4 B;  2UUC B;  4GKK H;  3CVZ A;  5D1P A;  4DR5 B;  1AN7 A;  1ZHQ A;  4ZI7 A;  4JI1 B;  1TGO A;  2ZIM A;  1HNX B;  5IWA H;  1TVK A;  1T5E A;  1HNZ H;  4DR6 H;  5LA6 B;  2UUC H;  4HNA A;  4D7S A;  3JAW A;  4LF4 B;  4JI1 H;  1O9G A;  4X65 H;  2XHB A;  3K5O A;  5C8Y B;  2Q7H A;  4YY3 B;  2ZCE A;  3L2P A;  4JI4 H;  1IBK B;  5EYP B;  2RJZ A;  5KHJ A;  4DR1 H;  4K8X A;  4U3J B;  1FJG H;  4LNU B;  3RYF B;  2JGU A;  2YI9 A;  2WDT A;  3VQV A;  1M0W A;  4TOI A;  2JVD A;  4IAJ A;  1VF7 A;  1XMQ B;  4JI0 H;  1DGS A;  4YHH H;  4DV2 B;  2VOB A;  4NXM H;  3B2E E;  1L8D A;  2VWK A;  1X9N A;  4CH3 A;  1XI1 A;  1O75 A;  4X66 H;  4NVP A;  4TV9 B;  4ZIB A;  4OX9 B;  4Q6G A;  2PY5 A;  2R72 A;  5CA1 B;  3TY8 A;  2UXB B;  4OX9 H;  4I55 B;  4DV1 B;  2ZJT A;  3KAK A;  1O9H A;  3JAR B;  5J2U A;  4E6N A;  3A2F A;  2VQE B;  3N41 B;  1SA0 A;  4JYA H;  4DV1 H;  5CA0 B;  4A2A A;  2R70 A;  3RYI B;  4LF8 B;  1FFX A;  5KHG A;  1QHT A;  4DRX A;  3UT5 B;  5IT9 W;  2HVR A;  5EZY A;  3VNN A;  4GKJ B;  4AQY H;  3N40 P;  1HNW H;  3K5M A;  4LF5 B;  3KXY T;  4NXN B;  4O2A B;  1G6U A;  4O4H B;  3K5L A;  4DUY B;  1FVI A;  4DV0 B;  2F66 C;  3SJC C;  1P8L A;  4FM9 A;  4I9Q A;  4JV5 B;  5LP6 C;  4JI7 H;  1Q43 A;  1KMI Z;  2JS5 A;  1IBM B;  5IYZ B;  1Z5V A;  1FKA H;  4JI2 B;  3L4K A;  3UQ8 A;  2HHH B;  3HXL A;  4JV5 H;  4I4T A;  5IJ9 B;  3RIZ A;  1JFF A;  2KSW A;  1XNQ B;  4APM A;  4JI2 H;  3ICX A;  5LMU B;  4PZ6 A;  5D1O B;  3ZED A;  2Q7E A;  3RJ0 A;  1HW7 A;  4KHP B;  3BHP A;  4RAY A;  5JCO A;  2PYL A;  3JAK A;  4PZ7 A;  5BMV A;  5FNV B;  2BTQ A;  2VUG A;  1KU9 A;  5LP6 B;  4O2B B;  4PDB A;  3WB2 A;  4DV3 B;  4DR3 B;  4TUY B;  4LF9 B;  2IM9 A;  3BAB A;  3S24 A;  1N32 B;  3GDE A;  4IHJ B;  4EB6 B;  4FLT A;  1M5I A;  4X64 B;  3LML A;  3JAT B;  5LA6 A;  5JQG B;  4DV3 H;  1ZAU A;  1N33 H;  1XMO H;  4LF7 H;  2HGS A;  4LSA A;  3T1Y B;  2Q2T A;  3N2G B;  2ZNJ A;  3K59 A;  4X64 H;  2F95 B;  4R7R A;  4DUZ H;  5EIB C;  4FLY A;  1S5J A;  2UUB B;  4CH5 A;  5EYP A;  3JAS A;  3JAL B;  1WNS A;  5KX5 B;  2YXL A;  4U3J A;  5GON B;  1SKV A;  4GKK B;  3ZS8 C;  4LNU A;  1IBL B;  3RYF A;  3RTX A;  5FD5 A;  2UUB H;  5IWA B;  1I94 B;  4DR6 B;  1TUB A;  1HNZ B;  4LFB H;  3M4I A;  1TAE A;  3RYH B;  4CH4 A;  4B3S B;  3N2K B;  4B3T B;  5FLX W;  4L8J A;  2YIB D;  1IBL H;  4K8Z A;  1I94 H;  4X65 B;  1XNR B;  3VQW A;  4FFB A;  4B3S H;  4FLV A;  4B3T H;  4JI4 B;  3RYC A;  5EIB D;  3C0F B;  4O4J B;  3K5N A;  2BTO A;  1XNR H;  4DR1 B;  1XHX A;  3FFQ A;  1FJG B;  4X1Y B;  2E5L H;  4I55 A;  1XDN A;  4PHZ A;  4DRF A;  4DV4 B;  4X20 B;  2P22 C;  4O4L B;  4LMY A;  4JI0 B;  4YHH B;  3CHX A;  2HIV A;  1J5E H;  4RZQ A;  4NXM B;  4PZ8 A;  2PTM A;  4DV4 H;  3RYI A;  4X66 B;  5ITZ A;  1L2Z A;  3F8N A;  5CB4 B;  3K3V A;  3T1H H;  4FLX A;  3J81 W;  5JH7 A;  4YJ3 A;  4FLU A;  1Z5W A;  4O4H A;  3THO A;  4DV7 H;  1Q5O A;  3CB2 A;  2R9A A;  5LXT A;  4DR2 H;  1ZHS A;  3RR5 A;  5JVD B;  1XHZ A;  4UCO A;  4JYA B;  1Q8I A;  4MV9 A;  1CKO A;  5LOV B;  1MZB A;  1D5A A;  4X1K B;  3HKB A;  3RGB A;  2CW7 A;  3FMA A;  5IJ0 B;  4O4I B;  2PYJ A;  3W5O A;  3BA9 A;  4AQY B;  4GLX A;  1HNW B;  4RB1 A;  4CS3 A;  2VPS A;  1CKN B;  4HNA B;  5D1O A;  1E4G T;  4DR7 H;  3HKE A;  3RF2 A;  3GJX B;  5JJN B;  4ETS A;  2VWJ A;  3VQX A;  5FNV A;  2CFM A;  4JI5 H;  2F4V B;  4JI7 B;  4LFA H;  5LP6 A;  4O2B A;  3N44 B;  4I50 B;  2RGR A;  4UCT A;  2F4V H;  4JI8 H;  4TV8 A;  4TQF A;  3QF7 A;  3SGI A;  3KAJ A;  2UXC B;  4EB6 A;  2VQF B;  4FM2 A;  2UUA B;  4Q0Y A;  4IIJ B;  2QJ1 A;  4M7E A;  4LF6 B;  2MCT A;  4EFE A;  3E22 A;  1V9P A;  5DIS C;  2UXC H;  5LYJ B;  4J0M A;  2VQF H;  1VS0 A;  3QG5 A;  2UUA H;  3K57 A;  4LF6 H;  1RSO A;  3U10 A;  3JSN A;  1WH2 A;  3MWM A;  4TQD A;  2WYO A;  3BA8 A;  4X1I A;  3RGX A;  3OTF A;  4MTD A;  4B3M H;  2YI8 A;  2UXD H;  3JAL A;  4DV5 B;  5KX5 A;  1SQF A;  5GON A;  4ZOL A;  1N36 H;  5J2U B;  1I7F A;  4JI3 B;  4BWS C;  1SA0 B;  3HKD B;  2PGG A;  4DV5 H;  4UCR A;  1BGW A;  4DV6 H;  2RQ6 A;  4AIL C;  1N33 B;  1XMO B;  4LF7 B;  3RWR D;  4EFB A;  4JI3 H;  4DRX B;  1N34 H;  2P5O A;  5D5Q A;  5EZY B;  2HEP A;  2YIB A;  5FPO A;  1Q3E A;  4DUZ B;  5JCO C;  1NT2 B;  5K1P A;  1WN7 A;  2V4D A;  5LL6 b;  4PI2 A;  5C8Y A;  5LMN H;  3OTO H;  1I6U A;  4YJ2 B;  2RGV A;  3J80 W;  4F6R B;  4X20 A;  4LFB B;  3TY9 A;  1XK5 A;  4CH6 A;  4LFC H;  5JJJ B;  2OYQ A;  1JFF B;  3GB8 B;  3W1G A;  4WBN B;  1WPB A;  3N42 B;  4RB2 C;  4MTE A;  2ZM6 B;  4TV9 A;  5FPR A;  5BR8 B;  3L4J A;  2E5L B;  1Z2P X;  1M4U A;  5KMG B;  4A2B A;  5BMV B;  4GYC B;  2ZIN A;  5KHI A;  2BTQ B;  2ZM6 H;  1B04 A;  1M93 A;  5CA1 A;  5BR8 H;  4EEQ A;  1J5E B;  3IAY A;  1HR0 H;  3JAR A;  3KAL A;  3RGZ A;  3KYH C;  3T1H B;  5IJ0 A;  5CA0 A;  4MV7 A;  4O4I A;  2ZNI A;  4ZHQ B;  4RB3 C;  3JAM W;  4DR4 H;  1CKN A;  4CS4 A;  3QTC A;  3UT5 A;  5J2T B;  4BW9 A;  4DR5 H;  4DV7 B;  1BJT A;  1HNX H;  4KL1 A;  1A0I A;  4DR2 B;  3WB0 A;  4O2A A;  3U0Z A;  2YIA A;  3MAQ A;  4LF4 H;  3JAS B;  3IG0 A;  4YY3 H;  3DF7 A;  4DK0 A;  4I50 A;  3J7A K;  2E3C A;  2KKW A;  1IBK H;  1JMK C;  3HKC B;  1TUB B;  5IYZ A;  1Z2N X;  2Q2U A;  4ZI7 B;  4DR7 B;  2QM4 A;  4IIJ A;  4CC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...