1A0IA

Atp-dependent dna ligase from bacteriophage t7 complex with atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
348
structure length
332
Chain Sequence
VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDGVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFHRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQAAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWWKMKPENEADGIIQGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFDACTINPYDGWACQISYMEETPDGSLRHPSFVMFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title Crystal structure of an ATP-dependent DNA ligase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 89
structure length 332
sequence length 348
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF17879 DNA_ligase_C DNA ligase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a0iA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1a0iA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1a0iA01
5GAEC 1VQAA 2ID0A 4X64L 4GNXC 3CCJA 3BZCA 4KLKA 5IYCG 3CMEA 4GKKQ 1TWGH 4DR6L 3E9HA 2I0QA 5JJIA 2NN6I 3W1GA 3BJUA 2OQKA 4IJHA 4JI7L 1PH2A 4OX9L 3S2HH 1D8LA 4B3ML 4IPHA 1NE3A 1GKHA 1TWFH 1E3PA 1WCMH 2L15A 3K0XA 4R4CA 4JI8L 2JK8A 5M5YH 5LMNQ 3RN5A 1PH9A 1JB7A 1XPUA 3RZOH 3JAMc 2BA0A 4MTNA 3NENA 5BR8L 4EFEA 3MEFA 1YZ6A 4LFAQ 4BBSG 2AMCB 4LF5Q 3GJXB 2N3SA 1Q46A 2YTXA 2VY3A 2EIFA 4IPGA 5J3BA 2ZM6L 4ALPA 2WAQG 4HJ5A 1I94L 1AE2A 1C9OA 1HR0Q 1QVFA 2UXBQ 4APVA 1VCIA 5C0XI 5GAGC 3KJOA 1YHQA 2DGYA 5DLQE 1Y1VG 3U4ZA 4AIMA 4DK3C 3SGIA 4DKAC 4LFBQ 5JJLA 2Z6KA 1L1OB 1TXYA 1CSPA 1PYSB 4LFCQ 2MNAA 4J15A 1VQ6A 3NBZB 5ELNA 3PO2G 1MKHA 2K4KA 3GD7A 4C3IH 1Y1WH 1JE5A 4EX5A 2ZJRA 1QVCA 4A3MH 4LF4L 2NVYH 1OXUA 4R4IA 4LF6L 2K50A 4HIDA 1HZCA 5JEAJ 2R93G 1HNXQ 3H0GH 3CC7A 1PHJA 4IO9A 3S16H 4UCSA 4A3CH 5IY0A 4DV7Q 2E5LL 4YCUA 1VQKA 4UY8C 3I55A 4DV3Q 4NPSA 3STBC 3M9BA 1Q81C 1VQJA 4LH6A 4DK6C 3GTLH 4P72A 4LUZA 3ERSX 1MJCA 1XJVA 1X65A 1VQGA 1IBML 4EEQA 2MO0A 3HOVH 4H02A 1I3QH 4A3GH 2R7ZG 1E1OA 4P73A 3HOWH 3TY9A 2JA8G 3FHWA 2LXJA 1X3EA 4RG1A 4BY7G 2I5HA 4OO1G 4DUYQ 4JI6Q 2HHHQ 1BBUA 2E2IH 5C3EG 1V1QA 2E2HH 4JV5Q 4YHHQ 1TWHH 1WFQA 1B8AA 5JEAG 1Q82C 4X65Q 5ELOA 4L5QA 1RIPA 4A76A 3T1YL 1UWVA 4A3KH 1NTGA 3KDFB 1VQLA 2C35B 2UUAQ 3GTMH 2UXDL 2N8NA 1KL9A 1L2FA 4JBKA 2GVAA 1B7YB 3JSLA 1VQDA 4AQYQ 4A3JH 3PIOA 5GAHC 2PMZE 3GTOH 1V9PA 4L5TA 5IP7G 3CW2C 3CPWA 4JI0L 1YEZA 3HOYH 3AQQA 2K5HA 1S3OA 1GO3E 3S2DH 1TA8A 1S68A 3BU2A 4A3FH 2N78A 2K14A 1K8AC 1VQIA 3I4NH 4QIWE 1JJCB 1FJGQ 4LUOA 3AEVA 5IYBH 1J5EQ 2IT1A 4JI5L 1PYBA 2JA6G 2QEXA 2KHIA 3CQZH 2JA7H 4O0AA 3W1BA 5IWAQ 1PA6A 3J7ZC 3S1NH 1P8LA 2RHSB 4C3JH 3J80c 4DR5Q 1NY4A 4DV5L 3S17H 3UE0A 4QJFA 5C44G 1X54A 2WFWA 4YHHL 1N34Q 1LYLA 1GM5A 5DISC 2VQEL 4BA1I 1E24A 3S1QH 1SMXA 4JI1Q 5GADC 4A93H 4LF9L 3G4SA 2Z0SA 2WP8J 4B3TQ 2Q2TA 1E7ZA 3I4MG 1H95A 3FKIG 4IOCA 3T1HL 1EWIA 3PUZA 2QA4A 3EBEA 3HOZG 3D31A 1U5KA 4JI2Q 3M4PA 1IL2A 4UCTA 1YITA 1BBWA 4DR2L 1VQ9A 2VUMH 4NXNL 2IX0A 4YWLA 3HOXH 1XNQL 3VNNA 4GS3A 4YY3L 4CC5A 4B3RL 1PFSA 5FLXc 2XTIA 2NVTH 4A3BH 2R7FA 1FJGL 4BXXG 1K83H 2D0PA 4KHPQ 1HNWL 2KCTA 1QUQB 4XTCS 5AJ3Q 1J5EL 5M3MG 1IXRA 3CAMA 1K3RA 3CCLA 1XMQL 1XTDA 1KC8C 2WB1G 4TQUS 1XPOA 1V43A 3G48A 4LF7L 1A63A 2F3IA 4MZ9A 3G6EA 1VQBA 2PQAB 4DR3L 1LM0A 4JC0A 4A3EG 2CQOA 2NVQH 2AWOA 2XGTA 1JJGA 3I7FA 1SN8A 1O7IA 2Q2IA 3J80i 3FP9A 2OQ0A 3AFQA 2RCNA 3J81i 1NJIC 3U58A 1VQ7A 4POGA 4HIMA 5C0XJ 4BBRG 2A8VA 4PG3A 2JA9A 4IFDG 1YHAA 3KDFA 2ATWA 1G6PA 1N33L 2VQFL 3E0EA 2KHJA 3S14H 1HNZL 5IYDH 2I5LX 1VQNA 3ICEA 1Y14B 2FXQA 4GLAC 3RNUA 2K5VA 2CWAA 3PF4A 1Y1VH 1PVOA 3G71A 2ZJQA 4X6AH 2AKWB 3F2CA 1XK5A 3NBYB 1CKMA 4UCVA 1AE3A 4AYBG 1NMGA 4DV1Q 1BKBA 4DV0Q 3CD6A 4AH6A 1PH5A 3PO2H 1C0AA 2UUCL 4GOPA 1N32Q 2Y0SG 2UU9L 1IBKL 1OTCA 3BA8A 4GOPC 2Z6KC 5FPRA 4UP8A 2KENA 4IPDA 3GO5A 4WJ4A 4LW1A 4LNQA 4CC6A 1R9TH 3HFZB 2F4VQ 1CKOA 1TWAH 4QY7A 2OTJA 4R1JA 1N36Q 4GKKL 2K52A 1Q12A 4HJ8A 4P74A 5E7NA 2R93H 1YNXA 2JEAI 3EN2A 1QVGA 1CUKA 4K0KQ 3OTOQ 4L5SA 4OXPA 3CCSA 3RLFA 2YTVA 3TS0A 2AHOB 4OWWB 3H3VH 1YBYA 3KF6A 5LMNL 1EIYB 1YI2A 1WOCA 3CP0A 3S1MH 4DR4Q 1TAEA 1YHBA 5GROA 1KRSA 3W5OA 4LFAL 3WWVA 4LWCA 4LF5L 5LMUQ 1G51A 3H3VI 1Q7YC 2JA5H 1JMCA 1FGUA 2JJQA 3JAMi 4EQ5A 1HR0L 3ZJYC 2UXBL 3S15H 3A74A 1HH2P 3JC66 1VQOA 3BZKA 3J81j 4DV6Q 2R7ZH 4A3LG 1X9NA 1NMFA 2Q2UA 2HQLA 3Q8DA 1W2BA 1HJPA 4BY7H 1HZ9A 2IHEA 4LFBL 3HOUH 1N32L 2PI2A 2HVQA 4IPCA 1VQ4A 1SFOH 5IT9c 1I6HH 1IYJB 5HY6A 3TREA 4LFCL 4YWKA 3DLLA 5C3EH 1PH7A 1QUQA 2MO1A 3U4VA 4OWXB 3GTQH 3PN1A 2AWNA 4X62Q 4YWMA 3PIPA 4A3MG 1IBLQ 4NXMQ 3PO3G 4LF8Q 3PF5A 3DM3A 1U0LA 4QL5A 1A8VA 2YYZA 3M3YH 2WAQE 3TY8A 4BA2I 4C3HH 4OONA 3M85A 1HNXL 2HIXA 3M4OH 5IP7H 4DAYB 3S1RH 5FLMG 4GN3B 4DV7L 2N49A 2UXCQ 1GVPA 4UFZA 4DV3L 4GLXA 3F8TA 4XIGS 2VW9A 5IP9G 4DV6L 4DNIA 1CKNB 1SRUA 3PCOB 4DPGA 1NBWA 1XMOQ 2E2JH 2B63H 3BAAA 3L0OA 2JA6H 3TRZA 3HOWG 3ULJA 4B3SQ 2KCMA 3HKZG 4A3IG 1EQQA 4DV2Q 1J6QA 4DV4Q 1K9MC 4X66Q 2ZJPA 1L1OA 5GQOA 5FPOA 1L1OC 3GTKH 5C44H 4DUYL 4JI6L 2HHHL 1AH9A 3CCEA 1XNRQ 1WYDA 4O2DA 3ULPA 1PH3A 3RTXA 2BA1A 2B3GA 4DR7Q 4JV5L 3K80C 1X56A 4X65L 3I4MH 3FKIH 4Y7NH 2UUAL 1TWCH 1VQMA 1T9HA 4A3JG 1LTLA 1VQHA 3HOZH 1KXLA 4UCRA 1N9WA 2K5NA 3A0JA 1EUJA 4JBWA 1SROA 3I2ZA 5C4XH 3CCMA 1YIJA 2R92H 4AQYL 3CPFA 3UE1A 2ASBA 4NB3A 4JI3Q 3ER0A 3OW2A 4YCWA 1XPRA 2IHFA 3TQYA 1A0IA 2UUBQ 4BXXH 3VDYA 4DR1Q 1XMOL 4X64Q 3OYYA 1S72A 5M3MH 2V1CC 4DR6Q 3H15A 1I50H 4JBJA 5H1SE 5C4JH 2HVRA 1YVCA 2VNUD 5IYCH 5LMNW 4JI7Q 2JA7G 4R4TA 2VS1A 4DAMA 3CCUA 1YJNA 4EFBA 3CXCA 1X6OA 4A3EH 1KD1C 4B3MQ 1EOVA 4JI8Q 3RR5A 5FJ8G 1OXTA 1G291 2D62A 1EFWA 1XDNA 2HIVA 1A62A 5IWAL 1VQCA 5BR8Q 4DR5L 1QZHA 4UCOA 1ASZA 5IE8A 1XNRL 1HR0W 2HVSA 1Q1EA 3GTJH 5HGQA 1M1KC 1N34L 4BY1G 1I94Q 2ZM6Q 1P16A 4BBSH 3EIVA 1EQRA 1X3GA 3PSIA 1I5FA 2A1AA 4JI1L 3L2PA 1UE6A 4B3TL 4UCUA 2IY5B 5M3FG 4Y52H 1B70B 2VUMG 3NELA 3PUVA 4FDBA 3HOXG 2R6GA 4MNOA 4JI3L 3F2DA 4JI2L 4A3DG 1VQEA 5M5XH 4DR1L 4GKJQ 4A3BG 2LXKA 1JT8A 4WJ3M 1CKNA 1VQ8A 2NN6G 1PH4A 1WJJA 2DUDA 1X55A 2QGQA 3KFUA 1OXVA 2MQHA 3HOVG 3CCRA 2HT1A 2CFMA 2B29A 1L0WA 1EYGA 4RMFA 4KHPL 4LF4Q 4P71A 5AJ3L 1KIXA 4L5RC 1KRTA 4LF6Q 4JOIA 3AYHB 1QZGA 1Q1BA 4JOIC 3GB8B 3CCQA 1X3FA 4HIOA 3L7ZC 1SE8A 2NZHA 2E5LQ 5D1OB 3PUWA 2GN5A 1WCMG 2PNHA 4HIKA 2E8GA 1FVIA 1YJ9A 3F2BA 4GN5A 1Q86C 3TS2A 5IYDG 5C0XG 2A19A 3E9IA 3GTGH 4LH7A 4UP7A 1PH1A 1IBMQ 3KF8B 2OTLA 4A3LH 4PZ8A 3CC4A 4JYAQ 4OWTB 4PZ6A 4PZ7A 2I5MX 3KOJA 2ZTEA 2WB1E 3TEHB 1B04A 2LSSA 3CCVA 3CC2A 4GKJL 2YTYA 2JA8H 3K81C 4DV1L 1UE5A 3BA9A 4DV0L 1MJEA 1Z9FA 3LGJA 3UDIA 3TY5A 3K7AH 2F52A 4IOAA 3NBHB 3PO3H 2ZTCA 3UDFA 3NC0B 1Y1WG 3CMAA 3T1YQ 3PUXA 1S40A 2F4VL 4IJLA 2UXDQ 1N36L 4OO1I 3B6YA 1K8GA 4HJAA 1BVSA 1VQ5A 3PV0A 4QQBX 1E1TA 1UE1A 2PQAA 2VUGA 4K0KL 3OTOL 1UE7A 3H0GG 2EXDA 5FLMH 2OCEA 3F1ZA 2IX1A 1PH6A 4JI0Q 2CCZA 4A3CG 4JCVE 2D0OA 2JQOA 2BH8A 4AYBE 5M5WH 1GD7A 4DR4L 2JA5G 5IP9H 1EIFA 4JYAL 2Y0SE 5LMUL 5JJKA 2NZOA 4C2MH 4GNXB 4R4QA 3J7A5 3S24A 3BABA 4JI5Q 3I4OA 5D1PA 4JI4Q 3PGZA 4A3IH 4P75A 4DUZQ 3HOUG 3K8AA 3KJPA 4A3GG 3NEMA 3KYHC 1Q8KA 2NVXH 4DV5Q 2MFIA 3UDXA 4HJ7A 1SLJA 3K7UC 1E22A 4UP9A 2VQEQ 3AFPA 4HJ9A 3M7NA 4POFA 2JE6I 4X62L 4GLVB 3RLOA 1IBLL 3MXNB 4LF9Q 1PH8A 4LF8L 4NXML 4GN4B 1WI5A 3HKSA 4KHZA 4KI0A 2VZAA 3T1HQ 4A3KG 5D1OA 1KAWA 2ZTDA 3IRBA 1K73C 1Z47A 2RF4A 2KBNA 2YV5A 4ME3A 1DGSA 4YCVA 4TVAB 4DR2Q 1FL0A 4NXNQ 1SR3A 4QGUA 1XNQQ 4YY3Q 1K0RA 4GOPB 1ASYA 3QWUA 3HOYG 2UXCL 4B3RQ 2RHQB 4A75A 2B63G 2VL6A 2H5XA 4UPAA 2YU9H 1HNWQ 4JI4L 2CKZB 2R7DA 3STBD 3ULLA 2K75A 4DUZL 1XMQQ 4JBMA 4DRFA 4A3FG 4LF7Q 1KHIA 3I4NG 1OXSC 3A5ZB 3A5UA 5FJ8H 5IYBG 1HZBA 1UEBA 3U50C 4DR3Q 4B3SL 5K36G 3J81c 4A4IA 3RN2A 2Q2HA 4DV2L 3D0FA 3PUYA 4DV4L 4OX9Q 2JEBI 3KF6B 4X66L 2BH2A 1HZAA 1RL2A 1M90C 2EQSA 3JSNA 4R4OA 3GTPH 1KQSA 2PI2E 3I56A 4BY1H 2CWPA 1PV4A 3UDGA 3GDEA 2ALYB 2VQFQ 1N33Q 4IFDJ 4E6NA 1HNZQ 1IZ6A 4JG2A 1VQPA 4BBRH 4DR7L 5M3FH 4A93G 4LUVA 1N8RC 2R92G 1LUZA 3RLNA 2ES2A 5C4XG 3UQ8A 1JJ2A 4A3DH 2OWOA 3KLWA 4PMWA 3M4QA 1D7QA 3HKZE 4IFDI 1YJWA 1VS0A 2UUCQ 1VQFA 2UU9Q 1IBKQ 3RZDH 1CSQA 1OXXK 2GVBA 1C7YA 3CF5A 4GNXA 5EAYA 1MIUA 2UUBL 1W3SA
chains in the Genus database with same CATH superfamily
5GAEC 2WE6A 1VQAA 4B08A 3S1RB 5I47A 3GV3A 2FFKB 2XWBB 4KLKA 4GKKQ 1LTBD 1UC9A 3WNZA 3E9HA 5JJIA 4O1NA 3VPBA 1PRTC 1XXGA 3BJUA 4OEMB 4J1MA 4JI7L 2B63B 4UAIA 1NE3A 1TWFH 3K0XA 4O2BF 1O7ZA 5M5YH 5CAEB 4CHTB 3RZOH 2PMZA 5BR8L 3NENA 3D4DA 4JXUA 5KT7A 4ECSA 1STEA 3I70A 4HN7A 2AMCB 1KT8A 3GJXB 2EY5A 1QCBD 4DR5H 3OOCA 1HR0Q 2QCPX 5C44B 4HJ5A 3RV4A 4RU9A 4F4XA 5DAUA 3QOJA 2Z6BA 1VCIA 2F0IA 1QILA 3R3OA 1QNUA 3RB0A 4DK3C 4LFBQ 1STBA 2ZDQA 1L1OB 3FKIB 4CDCC 2F0UA 4B3TH 3FPPA 4QW9A 1S0MA 4J15A 3PO2G 4KMUC 5C4XB 5CR5A 5IT9E 3N52A 1CQFA 4I65A 2LMCB 1I4RA 3OIQA 1Y1WH 4O82A 3VR4A 2CQYA 3NGDA 4EX5A 5FO8B 2JA5A 2K32A 4IUPA 4LF4L 3D3RA 2K50A 2RQXA 3K5NA 4HIDA 5JEAJ 1OBDA 1SYXB 1I50B 1PHJA 3S16H 5IY0A 5DM63 1Y69U 4XX0B 3I55A 5I5XA 1MBYA 3HP3A 4FFOA 4H0LC 1VQJA 2F3VA 4P72A 1RYSA 1O7YA 2RBMA 3V96A 5E4XA 4H02A 5D14A 3A55A 2O5JC 3IFDA 1IKMA 2F0NA 1X3EA 3T9AA 5I4DA 5C3WA 2WAQB 3T99A 2FKLA 1L2ZA 3TN2A 3KREA 2HHHQ 4J9MA 3G8CA 4DAAA 1BBUA 2F1MA 3C2PA 5CM0A 1V1QA 5M5XB 1MHWC 4JV5Q 2R7KA 1B44D 1WTHA 3H6MA 5JEAG 1T5XD 4X65Q 4A76A 4L5QA 1VQLA 1ULZA 1UWVA 4G4KA 4A3KH 1PZKD 2UXDL 2DY7A 4B9XA 4ECZA 2N8NA 5G3LF 4FF3A 2GVAA 3W3AA 4PWQA 5EWGA 2W9AA 2PZTA 2IL8A 2JXMB 4JW0A 1V9PA 4L5TA 5IP7G 3QOLA 3X3MA 2K5HA 1S0NA 1GO3E 2BOSA 1TA8A 4DAPA 3S9WA 1PFMA 3RJ0A 3MFIA 1S68A 3OWEB 5JAVA 4K2KA 4A3FH 4J9QA 3I4NH 1JJCB 2DPJA 4PNYA 2IT1A 2JA6G 2W57A 4JPBW 1DJRD 2QEXA 2ICIA 2FLLA 1A6XA 1SBBB 1STHA 4C3JH 4DV5L 4F7XA 2MP1A 3OSOA 4QJFA 1C3OA 2R61A 2WFWA 3J7AV 1N34Q 1BJTA 2Q8RE 4O81A 2VQEL 3S1QH 5GADC 3G4SA 2WP8J 4DL6A 1CFMA 5L9XA 4ZKCB 1H95A 2XIGA 1EWIA 5D65A 3EBEA 3HOZG 3BS1A 3D31A 3M4PA 2MUYA 3OWFA 2VUMH 2KOLA 3MR2A 2IX0A 2XCAA 3N44B 2UVRA 2R7MA 1KBLA 1PYWD 1PFSA 1BCPB 2XTIA 4A3BH 1RD9D 2Z02A 1K83H 4KHPQ 4R8UA 1QUQB 1J5EL 1A9XA 1IXRA 3WOEA 1K3RA 2ZT9C 4FNFA 5M5WB 2UXCH 1ENAA 3G48A 1AUXA 5BWTA 1CI3M 4MZ9A 3G6EA 1N48A 1GHKA 2PQAB 4O7VA 4JC0A 4A3EG 2SDFA 2AWOA 1RKNA 3H09A 2FK3A 4A3IB 4ETSA 3M9OB 2XSCA 3I7FA 1Y1VA 2Q2IA 3FP9A 2N88A 3IAYA 4NKLA 1T36A 2A8VA 4O86A 2FE3A 4IFDG 1TQOA 3Q22A 5IYDH 1Y8NB 1VQNA 4ZYSA 3ICEA 3RNUA 4GLAC 2K5VA 1PVOA 3BG3A 5I5VA 3G71A 1R9TA 1XK5A 2IMWP 2AGOA 1CQIB 2J6TA 1BKBA 3CD6A 1KLGD 4FP5D 4LSAA 2OH2A 4EGJA 2Y0SG 2EY6A 3JZ6A 4TV8F 4LW1A 1WTQA 2A73B 2OTJA 4QY7A 2ATLA 3T16A 4IRDA 1N36Q 1E4FT 4JI2H 1RF2D 1CQJB 2K52A 1E4GT 3NPPA 5I5WA 2YU9B 2UUBH 3EN2A 4DR1H 4OXPA 5JH7F 5KT2A 2AHOB 4DR6H 1EIYB 2R7ZA 1TAEA 2C2EA 3S1MH 4DR4Q 3JZFA 1YHBA 4B3MH 3WWVA 4JI8H 1R4PB 2QDLA 3N41B 1G51A 1HQMC 2F0EA 1FGUA 1FNWA 1R4QB 1JMCA 3GTPB 4EVOA 3ZJYC 1HH2P 1V1PA 4A3LG 4MTDA 4EQPA 2IWHA 1NUCA 1SYFA 2EJ3A 1WTWA 1TU2B 2XCLA 1SMYD 2V4DA 1SYCA 2IHEA 1N32L 2WTFA 2PI2A 2FPGB 3MWDA 2K7VA 3H4DA 3RGXA 1I6HH 4LFCL 1SDFA 1M4VA 2W8LA 2UVVA 3U4VA 2F0SA 4IRKA 1AZQA 3TSSA 1JCKB 4NXMQ 1PZID 1SJED 4LF8Q 5EDWA 2R3ZA 3DM3A 1IYVA 2CH4W 2FMAA 1A8VA 4ED1A 1FGBD 2YYZA 5I6WA 4C3HH 1HNXL 3J7AF 3KLSX 3M4OH 4Z9CB 3QB3A 5FLMG 4DV7L 2NVXA 4LF6H 3T7AA 1GVPA 1H9MA 1E4EB 3F8TA 2EZVA 2VW9A 4FF1A 2YZNA 5IIFA 2HG8A 5CV9A 1NBWA 2K03A 1XMOQ 1PTOB 4ZRZA 1TIID 4B3SQ 2KCMA 5J22A 4DV4Q 1J6QA 1BGWA 1DOLA 1L1OA 2EY2A 5K36H 5GQOA 1LACA 1T94A 3AB9A 1L1OC 2HHFB 2W9CA 2DJFC 3CRKC 3CCEA 2O03A 2HGSA 3M7GA 1XNRQ 1HQRD 4O2DA 3CU7A 2ASJA 2XNAC 4QWAA 4QIWB 3NK9A 4FXGC 3Q24A 3I4MH 4G7HC 2EJ0A 4I55F 1EEID 1TWCH 1BCPD 1E0BA 3U9SA 3BVMA 4C3IB 3MJFA 2R92H 4I7HA 1EUJA 1YIJA 2NVYB 4DA2A 3G6XA 4IN3A 3ER0A 3OW2A 3H0GB 2IHFA 3VDYA 4FBUA 2K1BA 4X64Q 1TT2A 3VYUA 3H15A 4JBJA 2HVRA 5IGBA 4ECRA 5IYCH 5LMNW 5C6AA 1I7LA 3GTLB 4ZCKA 4G7ZC 2HIVA 4UCOA 1QZHA 4DR5L 3QFFA 3KHLA 5J39A 1ASZA 2EYMA 3NWTA 1I1LA 1Q1EA 3GTJH 1Z6HA 3BDLA 5T1GA 4AYBA 1PK8A 4BY1G 2KSWA 4BBSH 2AQ1B 3EIVA 1EQRA 2FPPB 3J7AK 3GP7A 3RF2A 4ZQ3A 3V05A 1SMYC 4B3TL 2E2IB 5LYJF 4X66H 3GV6A 4CDFC 1TWHB 3NELA 1SNCA 3PUVA 2VUMG 3K5MA 3RAQA 2UVWA 3F2DA 4A3DG 1KTAA 3GTMB 2G5DA 4O3NA 4A3BG 2LXKA 1II3A 4WJ3M 3VA5A 4A3JB 1PH4A 5ELFA 1K0SA 3RIZA 4DR2H 1X55A 1EU3A 2QGQA 5I9PA 3GTOB 1IYDA 2B29A 4DK0A 3MXGA 1B1ZA 3S2DB 4L5RC 3VYRA 3KK7A 5CBEE 1AFPA 4B3RH 1Q1BA 3GB8B 1NNXA 4XQNA 3BDCA 2AUJD 2VPQA 3WWJA 2NZHA 5K3WA 3R5FA 2GN5A 4HSVA 4C5BA 5DG7A 4F8MA 5BPHA 5IYDG 3S1NB 3M9NB 2WACA 3OSNA 1PH1A 1IBMQ 3CEBA 3RB6A 2OTLA 3Q1KA 4ECXA 3CC4A 3A8IE 4PZ6A 3NUCA 1EOTA 3KOJA 5CV6A 1B50A 2VQFH 2F0JA 3EQLC 5JUMA 5T1IA 4FFNA 4MTKA 1Z9FA 2HDMA 3LGJA 5KFEA 1I1MA 3VR6A 1SNDA 2F52A 4IOAA 3MFHA 2ZTCA 1BCPC 3CMAA 3BQ0A 2UUCH 4J9OA 4CBVA 3TINA 2NVTB 4HJAA 5TSSA 4FE2A 2PQAA 5JPMC 2PN1A 2YRWA 1S97A 1UE7A 3FMCA 1C48A 1JWSD 1PTOD 2OCEA 3F1ZA 2Q8IB 4DN4M 1RTNA 2IX1A 1LT6D 4I4TF 3PW0A 1GJXA 2D0OA 2NVQB 5KFBA 1KDCA 3ITPA 5H80A 4JYAL 5JJKA 2R8KA 1SYDA 4JI5Q 3I4OA 4JI4Q 3SK6A 4Y8VB 1MI2A 4Q43A 5FR9A 1JQYD 1WRVA 4I7AA 3FRPB 2PYKA 4C5AA 2DN8A 2E76C 3JRWA 2PMZB 4UP9A 3KALA 3AFPA 2V59A 5EKKA 4POFA 3PO2B 4L1KA 4YQWA 4ULLA 4I7ZC 1WI5A 1WD0A 4KHZA 4O3QA 4C3HG 3RFCA 1RCVD 3K5OA 1TWAB 3IRBA 2GQSA 5C4HA 1SEIA 5KFZA 1DGSA 4YCVA 2JA7A 4NXNQ 1DZ1A 4QGUA 4YY3Q 1ICWA 3HOYG 2UXCL 2RHQB 1HNWQ 4DL7A 1HA5A 4IIJF 1XMQQ 1I6VC 4JBMA 5FNVF 4LF7Q 1LTID 1H9JA 4ED8A 2YW2A 5IYBG 3LWEA 1HZBA 4DR3Q 1MSHA 2JA5B 5K36G 3U55A 3J81c 5KFGA 4KJNA 2A1HA 4ZK9B 2XWJB 3N40P 1DD2A 2W9BA 4IUUA 3I4LA 3JSNA 5EWEA 2JP1A 2FPIB 1PRTF 3N6RA 1VBGA 2CWPA 3HOUB 1Z2PX 4ECWA 1ZKOA 3HZXA 4XXEA 1N33Q 4PMBA 1HNZQ 3CHBD 1QB5D 1DV1A 5KKNB 4A93G 4JI6H 2VPSA 1M0TA 2IBKA 2R92G 1LUZA 2J7ZA 5IGGA 2PO4A 3PW7A 4M1UB 4PMWA 3ORQA 3M4QA 2LY7A 1QG7A 3HKZE 3C1EA 2VQEH 3T5JA 1IBKQ 3RZDH 1J9OA 1OXXK 1C7YA 1E4EA 3J81L 3HOVH 2UUBL 5E1FA 2ID0A 2NU9B 4OHJA 3CCJA 1DYQA 5IYCG 1TWGH 2RDFA 4DR6L 2C22A 1PTOC 4DNRB 2L4NA 4OX9L 1PH2A 3S2HH 2R86A 5KG6A 5EKLA 4B3ML 1GKHA 4JI8L 3MFYA 1WCMH 2JA6B 2JK8A 1JB7A 2I80A 1PH9A 1CHQD 4DU9A 1YNND 4IUNA 4RGNA 3A7LA 3MEFA 1F9RA 5CV4A 4LFAQ 1J5EH 2Z4IA 4BBSG 3MXNA 1QOHA 2V4QA 3NP8A 3GTKB 4ALPA 5HBRB 4O4IF 1QVFA 2UXBQ 1AE2A 1C9OA 5KX5F 2BCOA 1I4QA 5C0XI 3KJOA 3K58A 4IHJF 3SGIA 5JJLA 1A3TA 2EJFC 2Z6KA 3V6JA 2NZ1D 4RB3C 5KEEA 3T56B 1D1IA 2NVYA 3HRZC 3T5HA 2CVRA 3HOZB 1Z7TA 3NBZB 4NMZA 5BN4A 5ELNA 1MKHA 1IW7D 1B3QA 2ZJRA 4A3MH 1B2TA 5LA6F 3WO1A 2P5ZX 4LF6L 2R93G 4CJ0B 1KLUD 5C4JB 2MPMA 3K3VA 4A3CH 4R7RA 1D6EC 4HCSA 3NTKA 4A3EB 4DV3Q 1L0YB 3KBGA 3M9BA 2L1BA 2KCCA 1SNQA 4DK6C 3GIJA 4EGQA 2ABJA 5JVH3 1MJCA 1I7NA 5C8YF 1VF5C 5I6YA 2MO0A 4R8UB 4A3GH 4P73A 2X5RA 3HOWH 2K28A 4RH6A 3EYYA 4RG1A 4BY7G 3OHAA 3GTMA 1X3QA 4BWGB 2AQ2B 5KFPA 4DUYQ 2KEEA 1AZPA 4G7OC 1FD7D 5C3EG 1WTOA 2E2HH 3C1FA 4FYDA 4XYMB 2Y0SB 3GTOA 4KY7A 1EKFA 3D4RA 1ML0D 3LP8A 3T53B 1GOZA 2VOBA 4DV0H 3T1YL 1RIPA 3R93A 4UCRA 3OHBA 2UUAQ 1NTGA 1N32H 5A2QL 1PX2A 4RKLA 4JBKA 1B7YB 3J80W 3JSLA 1VQDA 4AQYQ 5DAAA 2F4VH 5GAHC 4DL3A 3VYTA 3KUPA 2J9GA 1VMPA 1EQTA 1S3OA 3OTOH 3Q6SA 4HMIA 2N78A 2K14A 1VQIA 3GIQA 1FJGQ 4DIMA 1Y8OB 2KEDA 1PYBA 2HQEA 2NWGA 3CQZH 4KY5A 5J2TF 5IWAQ 1PA6A 1P8LA 4MV8A 4L8JA 1NY4A 3S17H 3UE0A 2QEJC 2M00A 4K8IA 5AFWA 5JQGF 5M9OA 2JA8B 4K6LA 3Q23A 1E24A 5I60A 4JI1Q 4L6TB 5NUCA 5CV7A 3A54A 1SXTA 2QW7A 4IOCA 3HG9A 3PUZA 1U5KA 1V1PB 4JI2Q 1IL2A 1IBLH 4UCTA 4GC7A 3OSPA 1BBWA 4DR2L 2O5IC 1O80A 4IUQA 4YWLA 2YL2A 2V4RA 1GHJA 4GS3A 2W6OA 3JAMW 1ESFA 4B3RL 5FLXc 3QO2A 4F4YA 1BXRA 3MFGA 4BXXG 1U4RA 2KJXA 5ELBA 5M3MG 1CT1D 2F0PA 3E5SA 3CAMA 1KC8C 2WKCA 5CMDA 4TQUS 1XPOA 3EJIA 1EQVA 1KJIA 1A63A 4EBDA 1OBGA 3HS0C 4PMCA 3ZYYX 2CQOA 2XGTA 1HFNA 2RDIA 1JJGA 2NUAB 4IALA 4RFBA 1O7IA 1JDEA 3AFQA 1IYUA 1EZ1A 4POGA 2NVXB 4K6DA 2F0QA 3BAAA 1JWMD 1G6PA 1YHAA 2VQFL 3SI8A 1KJQA 3T9FA 4XQQA 3GIPA 1JIHA 1Y1VH 2ICEC 2NU8B 5FLXL 4H13C 1TWAA 1CKMA 4UCVA 4DR7H 4KK7A 1IL8A 4DV1Q 4O7YA 1PH5A 1BR9A 2UUCL 3DWPA 1OTCA 4PV1C 2VQDA 5KFIA 3Q0AA 3H94A 4FXDA 2YZGA 4UP8A 2ALZA 1BUVT 4CC6A 1R9TH 1FR3A 2W9CB 1CKOA 4HR7A 1G6ZA 2K05A 1Q12A 2F0GA 2LFNA 4K5VA 1WTVA 1A15A 2X69A 5BWWA 4K0KQ 4L5SA 3CCSA 3TS0A 2QB5A 5LMNL 1Q8IA 4MN3A 1GSAA 3U54A 3GV5B 3N42B 1YI2A 1WOCA 1RJRA 5KT3A 1LO5D 4JUZA 5GROA 4O3PA 3W5OA 3PR5B 1EYDA 3EFXD 4LF5L 1S5FD 5LMUQ 3RB4A 5C3XA 1Q7YC 2JJQA 3MWYW 4RZRA 3EA6A 4DXGA 3S15H 4BY1B 2R7ZH 4DV6Q 2ENBA 3Q8DA 1W2BA 1HJPA 3HGBA 1I94H 1HZ9A 4BBRB 2ZM6H 1D2BA 4JV1A 3TREA 4IR9A 4YWKA 1PH7A 4A3DB 1ET9A 2Y4RA 4OL7A 4TSSA 4OWXB 5CBAE 3GTQH 4X62Q 4YWMA 3I3CA 4A3MG 4FFPA 1BOSA 3E3XA 5CV8A 1UAPA 4AYBB 2XRSD 3PO3G 4FBTA 4C2MA 1F9QA 3OUZA 3M3YH 2WAQE 2AGQA 1J8IA 2F4IA 1FNUA 2JA6A 3IL8A 3S1RH 4O83A 4J8QA 2RVLA 4J9KA 4GLXA 5KFSA 1DONA 1EIHA 1EY8A 1DAAA 4QWDA 2E5LH 2PNRC 4DNIA 3T9CA 1SRUA 4DPGA 2B63H 3GTKA 2K04A 3L0OA 1T5EA 3HOWG 3TRZA 4YR0A 5FOBB 2PVPA 3T5LA 5FO7B 3HKZG 2IW3A 2Q8TA 4DV2Q 4X66Q 2Z9HA 3J81E 1F2LA 4NW2A 4JYAH 5CB4F 5C44H 4JI6L 1EY4A 4V0BA 4EBCA 2CQAA 3BG5A 3PQIA 3ULPA 2RGVA 1A3GA 3Q8QB 3FKIH 3R2TA 3QR8A 3E5NA 1VQMA 1F77A 5EGTA 2K5NA 5C4XH 3EVQA 4Q44A 1SROA 3I2ZA 1V8QA 1JXLA 2OF1A 3CPFA 1N56A 1TS4A 4ECTA 2A74C 2RKSA 4OGQC 4O2AF 4JI3Q 4YCWA 2CNQA 3TQYA 2EYHA 2MHVA 1EWCA 1XMOL 4ZKBB 1S72A 4U6PA 3PW2A 1I50H 2PZUA 4TQRA 3VR2A 4JI7Q 4EFBA 2EJGC 3CCUA 1YJNA 4LAAA 1X6OA 1S5ED 3VR5A 1EOVA 1A0GA 3CKIB 1OXTA 5DLGA 1KJ8A 1A62A 1F2YA 5BR8Q 4H44C 1I3QB 3QIAA 1XNRL 1M7JA 1HR0W 1VF7A 2F0FA 5HGQA 5KFTA 4YR2A 4JV0A 2Y0SA 3G6VA 2FJ2A 2SNMA 1LT4D 4DFAA 4UCUA 3OW7A 4ED3A 2IY5B 5M3FG 5DQGA 4Y52H 4TQSA 4YBZB 4CHIA 1EKPA 3UFXB 1JKJB 4DAYA 2B2WA 1XWEA 2KQ3A 4O7ZA 1KC7A 2B2WC 4LF9H 5M5XH 2B2TA 4RKBA 4GKJQ 4Q0YA 2B2TC 3T1HH 3NXWA 4KKTA 2NN6G 2DUDA 1KTKA 2MQHA 1SAPA 3HOYB 3TP7A 5IOCA 1XNQH 4LF4Q 4P71A 5AJ3L 1CE8A 4X3KA 2UVUA 3AYHB 4RNMA 1QZGA 4BWSC 2EYPA 2VXWA 4J9PA 3L7ZC 1QJOA 1SE8A 3QWNA 2W6ZA 1BCPF 2F0VA 2E8GA 3SHLA 1H9RA 2OLSA 2JA7B 3H20A 1Q86C 4LH7A 2A19A 3VPCA 4OX9H 1ZXTA 4HN2A 1O7LA 3MTSA 5A2QE 3N6XA 1D5XC 4R8NA 2M2LA 1KAAA 4WJWA 2GPWA 2YRXA 4PZ7A 1AP0A 2A69C 4QB4A 4EGVA 1S5CD 3K59A 1XYIA 2HJWA 4A93B 1PXUA 2WB1E 4XYQA 4IAJA 3TEHB 1B04A 3K81C 1EZ6A 5IODA 4DV0L 1MJEA 3TY5A 3UDIA 5CA1F 1EWHA 3TMEA 2W9BB 3GQBA 3PFFA 3UDFA 3HOXB 1B9MA 2A6EC 1Y1WG 2F4VL 3PUXA 1S4ZA 2UXDQ 2XVSA 2UU9H 4OO1I 4HQ6A 3B6YA 2W6QA 4GZYC 1K8GA 1BVSA 1I2LA 5DG8A 2GPSA 3PVXA 3OTOL 4JK1C 1GUOA 2EXDA 2D2CC 4GKKH 2RDHA 1PH6A 1BBXC 3UZBA 4F50A 5C1OA 4MHEA 2JQOA 5M5WH 5IP9H 1GUTA 4CDEC 1EIFA 2VB2X 4TKOB 3I12A 2PCFB 5E25A 1B9NA 3E0JA 2NZOA 4N9PA 5EKIA 2M05A 5F9NA 4A3IH 5HNEA 4P75A 4DUZQ 3K8AA 3S14B 3NEMA 1JOOA 4YR3A 1Z2NX 4LMYA 1AN8A 4DV5Q 3G6YA 3FPUB 1HR0H 1MGSA 3UDXA 2DLNA 3FVQA 1X3PA 1SLJA 4HSPA 4XT3B 1S0OA 1PLFA 4NZMA 4LFBH 2VQEQ 3KTMA 4HJ9A 1ILPA 2JE6I 4GLVB 3RLOA 1IBLL 3MXNB 2XCPA 1PH8A 1VAJA 5I9OA 1VKZA 3R8BA 3Q8RB 4A3KG 2KCNA 1KAWA 5IYZF 2ZTDA 3KAJA 4XYLB 1K73C 1Z47A 2RF4A 1SYEA 2KBNA 4ME3A 4QUFA 5IGDA 4TVAB 1DV2A 1GLVA 4X3UA 1FL0A 5DGIA 5ELEA 3MA2B 2R93B 4C1NK 5T14A 4GOPB 3WWIA 4EEYA 4IZ8A 3T1YH 2XIWA 4A75A 2B63G 1I4HA 2YU9H 1LLRD 2FP4B 4JI4L 2CKZB 3STBD 3ULLA 5FLXE 1U4MA 4A3FG 4K5XA 3I4NG 2C2DA 5D3DA 5DM73 5FJ8H 2DNCA 1UEAB 3ONAB 4A4IA 3RN2A 1RYRA 2BH2A 3D0FA 3ND8A 4Q4CA 1O78A 1BO0A 4ECUA 1RODA 4C3JG 1M90C 2VUMA 5IGFA 3GTPH 3LQSA 3U9OA 4BY7B 2VA3A 2AQ4A 1LTSD 2VB3X 1PV4A 1GXDC 2IJ0A 3GDEA 4M8AA 3UDGA 1SFOB 4L63B 3I90A 1LTTD 4DR7L 5C3EB 4FS1A 2HHHH 1N8RC 5C4XG 2ES2A 4EG0A 3UQ8A 4DLKA 2JSOA 2EY1A 2PW7A 5EQ0A 2OWOA 3A56A 4JV5H 1D7QA 4X65H 1VS0A 1VQFA 3I91A 1V4YA 3NQTA 4UHVA 5EAYA 1MIUA 3ORRA 1F2ZA 2FB9A 3BZCA 3CMEA 2NU7B 2I0QA 4MV4A 1PFBA 5BWVA 4NZNA 2OQKA 4IJHA 3LULA 4N8FA 1D8LA 1V1OA 2E2JB 1EY9A 3RN5A 1E2WA 3R23A 3GIMA 3JAMc 2BA0A 2YS7A 5CC4A 3SNOA 3LWUA 1LTRD 2C5CA 1PTOH 5C0XH 1A48A 2AQ3B 2XGQA 2CNUA 4RB1A 2N3SA 5L1KA 2YTXA 5J3BA 2VY3A 2EIFA 1I94L 2EXZA 2ZM6L 2EYFA 2WAQG 1BNCA 3V4SA 4FVMA 1HFGA 1IKLA 5GAGC 1QE6A 1YHQA 4NDXA 5DLQE 1N34H 3U4ZA 4AIMA 5LL6X 4LMQD 1TXYA 4Y7NB 3D6WA 4LFCQ 3DTGA 1EY0A 2F3WA 4E4TA 1WH2A 1FKAH 4RGTA 2VR1A 4HYKA 2K4KA 3GD7A 4C3IH 3CRLC 2XRQD 3JAML 1NR4A 2NVYH 4R4IA 2KUMA 1HZCA 5M3MB 4O42A 1HNXQ 2YS6A 3H0GH 3CC7A 4M0JA 2X6LA 4YJ3F 1SE4A 4IO9A 2XD4A 4A2AA 2EYOA 4DV7Q 2E5LL 2FMMA 1I3QA 5I2YA 4RUCA 2FK2A 4KKSA 2COGA 4TUYF 3STBC 1B6SA 2YYAA 1JE4A 4LH6A 2DAAA 3GTLH 2FLPA 3HT5A 3RBDA 3ERSX 3G6JB 4EEQA 5LMNH 1D5ZC 4RGOS 3TEKA 1M0WA 1E1OA 3TY9A 5CR3A 3FHWA 1HTPA 2LXJA 5DGBA 4LF5H 5CA0F 2DY8A 2AUKA 4C1NI 1HUNA 4RHRA 2E2IH 1G2SA 2ZDGA 4ED2A 3BQ1A 1PFNA 4YHHQ 1TWHH 1WFQA 1S10A 1Q82C 1LTGD 4UDUC 3T4AC 1KNAA 1YNJC 3TZUA 5F9LA 2R6FA 4LSXA 3L4KA 3GTMH 2B2YA 2C35B 1HRJA 1VBHA 5HGTA 2AU0A 2EOTA 2B2YC 3RBEA 1L2FA 1PZJD 5FD6A 4A3JH 3PIOA 2W6NA 3D4WA 1KDBA 1N36H 2PMZE 3GTOH 4MV6A 3CVZA 3LNNA 1UNSA 3CPWA 4JI0L 3O13A 5EBCA 4FU0A 1TVXA 3AQQA 1T3NA 5K5PA 2X6GA 3S2DH 1HPCA 1CQVA 3RD4A 1HHVA 4MV1A 5LXTF 4Q8EA 1K8AC 4DF7A 4TV9F 3SE0A 3QG1A 4DR4H 4LUOA 2A68D 3GTGB 4O3SA 4HR7B 3Q8PB 5CORA 1TWCA 2L5TA 3FDSA 4O0AA 1K3BC 2QKIC 3J7ZC 3S1NH 2RHSB 4DR5Q 4QWCA 2R92A 2EDGA 1KABA 3MZ5A 4FXKC 2B8FA 1JB3A 4IQZA 1GUGA 1BDOA 1X54A 3AX6A 1LYLA 4MV9A 1M8AA 5DISC 3BVZA 2M9VA 3SR1A 4LF9L 4B3TQ 2Z0SA 1ET0A 2D9UA 3K7AB 4IUVA 3I4MG 3PO3B 1ICFB 1NCVA 3T1HL 2QA4A 2H4OA 5CYUA 4NXMH 3M9MB 1YITA 4LF8H 1VQ9A 3SXHA 1D1KA 1I4XA 1XNQL 2EJMA 5DLFA 2EYJA 4CC5A 2BR0A 2NVTH 3GTJA 1FJGL 3MVVA 2D0PA 2RSOA 1K1SA 2TSSA 2KCTA 4XTCS 4RZQA 2R8GA 1XTDA 2WB1G 1V43A 3T13A 5J1ZA 1IOVA 3DUZA 4C2MB 1LM0A 1K28A 2NVQH 4RNNA 1XMOH 3ERQA 3HKZB 4K2LA 1SN8A 1JX4A 4B3SH 2OQ0A 4RA8A 3J81i 5KFDA 3U58A 4YAKB 4HIMA 5C0XJ 3H40A 4JV2A 2JA9A 3KDFA 2ATWA 2DIKA 3E0EA 5EPJA 3ETHA 2C00A 1LABA 1Y14B 3PF4A 2CWAA 4UUGA 1ENFA 2ZJQA 4RB2C 2AKWB 3C3LA 3F2CA 1S5DD 3NBYB 1XNRH 1I1KA 5KS8A 1OWTA 5LP6F 5KFYA 2R93A 3PO2H 4GOPA 2UU9L 2W6MA 4GOPC 3NTHA 2Z6KC 2G9DA 1EYZA 2KENA 4IPDA 1EY5A 4LNQA 4RAZA 3H3VC 3HFZB 4FGRA 1TWAH 5KG4A 3WWHA 4HNTA 4GKKL 3URYA 1ZHQA 4P74A 5E7NA 3VOTA 1EU4A 1VMCA 2JEAI 3M4IA 1S03G 2PQEA 1H9SA 4ID6A 3PZPA 2F0LA 2F0KA 4I50F 4OWWB 4CJ1B 3N43B 1EL0A 3NBIA 2EIYA 1I4PA 2E2DC 5C5LA 3MEHA 1KRSA 4FO2A 2V58A 2A68C 3KHGA 3H3VI 1SFOA 2JA5H 1RTOA 4Q4DA 4O84A 1HR0L 5KT6A 2Z1CA 3KHHA 3JC66 4A2BA 1I2KA 2R8JA 1NMFA 2HQLA 2L0CA 2DABA 5M3FB 3HOUH 4LFBL 2HVQA 3SK5A 1VQ4A 3GV7B 1CTMA 1IYJB 3P20A 5HY6A 5CE8A 3DLLA 3UYYA 2QYZA 3PN1A 4BS9A 3PIPA 4DL5A 3E6ZX 5BN3A 2R85A 4RAUC 3PF5A 1ZEQX 4DK1A 1IYEA 4MV7A 4DXFA 4QL5A 3T51B 3R9RA 5KFMA 3TY8A 3VPDA 2B8GA 1TY0A 2W7PA 2HIXA 3MWMA 4IZOA 1DM0B 1AEXA 5IP7H 4DAYB 4GN3B 1QWYA 2UXCQ 3V6KA 3T9DA 2PBZA 3HBLA 1TWFB 4XDXA 3UZOA 5M5YB 3RZOB 5KFJA 4DV6L 2OXPA 3AW8A 2WKDA 2WV6D 2V5AA 4H7BA 2JA6H 3LMLA 3ULJA 3NTIA 1ZYRD 5KFKA 1K9MC 1CS0A 2ZJPA 4KTAA 4OIKA 3TP5A 5FPOA 3GTKH 2HHHL 1AH9A 4J9SA 2QK4A 1WYDA 1PH3A 2FJZA 4JV5L 3K80C 4XZ3B 4X65L 2BDNA 2KVMA 1GUWA 3TW7A 3HOZH 4A3JG 1Y1WB 1SE2A 1A2UA 1N9WA 3CCMA 3BDOA 4MIUA 4ZHQF 3UE1A 1G91A 3DEPA 4O7WA 1HXYD 1MD2D 4NB3A 1XPRA 3BZDB 1A0IA 2UUBQ 3S16B 4DR1Q 5KG1A 2B39A 2B2VA 3OYYA 4KD4A 4J9LA 1GSOA 4DR6Q 2L55A 5C4JH 3WO0A 2VNUD 4ZOLF 4R4TA 4B3MQ 4A3EH 1KD1C 4JI8Q 4XT1B 3RR5A 1G291 2D62A 1EFWA 1OO9B 1XDNA 3IKJA 3DWQA 1JORA 3L3OC 3BQ2A 4JI4H 5IE8A 3DHQA 3JAME 1WTPA 2HVSA 4IFDH 1N34L 1P16A 3KAKA 3PSIA 1GYFA 4J9RA 2A1AA 5BMVF 5C5MA 2V9WA 3L2PA 1L0XB 3NUAA 2BQUA 1TWGA 1M6VA 1B70B 3TDQA 1EIGA 4K8JA 4FDBA 2CZGA 3K5IA 5J2UF 4JI3L 3DEOA 4A3KB 3DAAA 1VQEA 2JN4A 3KLRA 5BPFA 4GC6A 2ASLA 1JT8A 3AMUA 1CKNA 4KN7C 3GIIA 2BQRA 1WJJA 3RAXA 3KFUA 3HOVG 2CW0C 4NXNH 1L0WA 4KHPL 4RMFA 1KIXA 4YY3H 1ILQA 1EY7A 4KJOA 1KRTA 4LF6Q 3TIGA 3NE5B 1STYA 3GTGA 4XQJA 3Q8SB 1HNWH 4A3FB 1X3FA 2ZXOA 4HIOA 3SDZA 3I4NB 3K57A 1XMQH 3K6OA 3MHBA 1WCMG 3PUWA 2KA7A 4LF7H 1A3VA 1FVIA 2IPKD 5IGCA 3PIO3 5EPKA 5IT9W 4DR3H 1HCZA 3TS2A 4RHSA 4C3JB 1ZQ7A 5BWRA 3VYSA 2EYLA 5KGUA 1ZYRC 4CMFA 3KF8B 1SNPA 4ED0A 4A3LH 2YZMA 2I5MX 3PW4A 3S1QB 4TVIA 4N9TA 1N33H 1MSGA 1HNZH 5K2MA 2LSSA 2F0WA 3CCVA 4GKJL 4O7NA 2YTYA 4X3TA 2WIIB 2JA8H 3T54A 1UE5A 5BYAA 1KNEA 1JICA 3A8JE 5DNFA 4OO1H 4ECVA 4O7TA 1ZHSA 1WD1A 5DG9A 2VUMB 1TY2A 4G3IA 3NC0B 3OUUA 3T1YQ 2ZXPA 2HDKA 5KRUA 1IBKH 1N36L 5IGEA 5KT4A 1B4OA 4A3BB 1VQ5A 1CA6A 1K83B 3PV0A 1UE1A 2VUGA 1KEEA 3RMHA 4NZOA 2K6AA 1GSHA 5FLMH 4ZQIA 2HGWA 3HKZA 1HA6A 1IHZA 5KFQA 4A3CG 3EROA 2DJGC 2BH8A 4AYBE 4DR4L 2LS01 2FINB 5ISRA 2JA5G 5KYIA 3H4BA 3MWEA 2E2HA 3L9AX 4O3RA 3BABA 3IN5A 4LFAH 2DZDA 2F03A 4IURA 3PGZA 5LOVF 3HOUG 3ND9A 3KJPA 5BN5A 4A3GG 3KYHC 3MXPA 2RSNA 1LV9A 3K3PA 2NVXH 2UXBH 2A6HC 4HTHA 2CW7A 5JJZA 3VR3A 4HJ7A 4TM5A 3K0YA 2A69D 3KHRA 1E22A 3AU7A 3IG0A 1Q90A 3DTFA 3M7NA 4MTEA 4NXML 1F2MA 4LF8L 2W70A 4ZUJA 1F9PA 3J81W 5D1OA 4M9UA 1EEFD 2BE5D 1WVLA 4B9WA 4DR2Q 4CGYB 1CK1A 1QNKA 2F0DA 4ILWA 4FFLA 3CQZA 1SR3A 2A6ED 2GA4B 4QW8A 1K0RA 5JVDF 2PPBC 4B3RQ 4HNVA 4UPAA 1BF4A 3FDTA 5I5UA 2HUGA 3S1MB 2R7DA 1DOMA 1UUPA 2HDLA 4DUZL 3D8GA 2QDBA 3BJYA 1ZAUA 1KHIA 4CDDC 3QJYA 1CHPD 3U0GA 3A5ZB 4DV3H 3A5UA 2R82A 2C28A 1UEBA 3U50C 4B3SL 4JI0H 2CHBD 3GV8B 2Q2HA 4DV4L 5DQHA 3PUYA 3KF6B 5KG3A 1ZETA 1U9RA 3HEJA 3NBHA 2EQSA 4X3SA 3SK4A 4ABNA 1I6UA 1KQSA 5KFXA 2I07B 1S9FA 4BY1H 4E6NA 2ALYB 2VQFQ 3F2UA 4IFDJ 1I6HB 1IZ6A 5KG7A 1VQPA 4BBRH 3OHXC 3V2TA 4DUYH 4EQOA 4QMGA 1Z2OX 4ZUIA 3RLNA 1RHPA 1GUNA 1JJ2A 3TP8A 1G8ZD 4A3DH 4MA5A 3P1HA 2D5DA 1CZWA 2R87A 1EZ8A 5EJWA 4IFDI 5DGHA 1YJWA 2UUCQ 5I2XA 2UUAH 3GIKA 2GVBA 4C3HB 1LT5D 3CF5A 4GNXA 1TWFA 1W3SA 5KFNA 3M4OB 4AQYH 4GNXC 4X64L 1RJPA 4EBEA 2JEFA 2EJ2A 1W6KA 5ELDA 3R2IA 1JLLB 5KFLA 3QQMA 3PIP3 4WHXA 2JEIA 3T9BA 2NN6I 3W1GA 4O7SA 2RDJA 5KG0A 4IPHA 4R4CA 4U673 2AGPA 1E3PA 2L15A 2EVBA 5LMNQ 5DGAA 1BQQT 3PMFA 1XPUA 3PR4A 5E4WC 2YZLA 4MTNA 3V4ZA 4EFEA 5DQIA 2W7OA 1FJGH 1YZ6A 3J7YW 4U68A 3NHHA 4LF5Q 1EY6A 1SSOA 5IWAH 2BQ3A 1Q46A 5G3LD 4IPGA 1JWUD 4ME5A 2F0HA 3IFTA 1TKWB 1W96A 1FNVA 4APVA 2J6SA 2K33A 5C4ZA 3TIIA 2DGYA 2L12A 3I72A 1Y1WA 2XC9A 1Y1VG 2P0AA 4DKAC 1B33N 4CJ2C 3I4MB 4JI1H 1CSPA 1PYSB 1TWCB 3BYYB 2MNAA 1VQ6A 1JDBB 5A2QW 2R92B 2SCUB 5KNBA 2VA2A 4O3OA 2CW8A 1Q3LA 4IUTA 5EZYF 2Z4HA 1JE5A 3MR5A 2SEBD 1QVCA 2BE5C 3GQCA 1DOKA 2GLTA 1OXUA 4KD3A 4R9WA 4HEDA 3RUZA 5KFFA 4FFMA 2WB1B 4F4ZA 1RK5A 4UCSA 4YCUA 1VQKA 3GIDA 4UY8C 5JOBA 4NPSA 1Q81C 1ET6A 2ZGIA 3M4YA 3GTQA 4LUZA 2F0MA 1XJVA 1X65A 1VQGA 1IBML 2HGXA 3GTJB 2CNVA 5KG2A 1I3QH 2XGPA 2R7ZG 1AN7A 1SYGA 4BBSB 4MA0A 2E75C 2JA8G 1TS2A 5I5SA 3A8KE 4RGMA 1E2VA 2I5HA 4OO1G 1STNA 1KJJA 4JI6Q 3HO8A 4Q5VA 5L1IA 1F9SA 5F2DA 1RJTA 1V51A 1SCUB 1B8AA 4DV1H 2I8CA 1CM9A 5ELOA 3MC0B 2B63A 3KDFB 1EFID 2N55A 5A35A 2L11A 1KL9A 4MV3A 4PBCA 1LT3D 4RCOA 2JYOA 3H91A 5FKAC 2RA4A 4CKCA 2Z8LA 3CW2C 3HOYH 1YEZA 4ZI7F 3RGZA 3QZ8A 4K0KH 5GONF 3BU2A 5KNDA 3CSWA 4KHVA 3KF8A 4QIWE 2ASDA 4HAEA 3AEVA 5IYBH 2R7NA 1UNNC 1J5EQ 4P2CB 4JI5L 2RGRA 3FKIA 3A7AB 4ZAIA 2KHIA 2JA7H 1B53A 5LMUH 3W1BA 4J6HA 3J80c 1H9SB 3SE7A 4QF4A 4DV6H 5FLXW 5HV6A 5C44G 2K5WA 4YHHL 1GM5A 3BACA 3FMAA 4U7CA 3PW5A 4BA1I 1DXMA 1SMXA 4A93H 4O4HF 2QF7A 4CKBA 1PTOF 2Q2TA 1E7ZA 1I50A 3FKIG 1KUTA 1K83A 4Q0FA 4KKUA 4X62H 2RDGA 2COJA 5KFCA 1ONLA 4NXNL 1YNJD 3HOXH 3VNNA 3WDNA 4YY3L 2OEOA 2R7FA 5JPNC 3HXLA 1HNWL 2HCIA 3J80L 3CCLA 5AJ3Q 1X32A 2FK1A 3EPIA 1XMQL 1JOKA 4LF7L 2R8HA 2F3IA 5D8DA 3D6CA 1VQBA 3OIPA 2WAQA 1U4LA 4DR3L 3C0FB 1JC7A 5KG5A 2C9OA 3F8NA 3C46A 4MAMA 3J80i 4WD3A 2HCCA 3DWAA 3ETJA 1XX8A 2RCNA 1NJIC 4G57A 4KV6A 1VQ7A 4TRDA 4DV2H 4FM9A 4BBRG 4PG3A 1N33L 1NR2A 3S14H 2KHJA 1HNZL 2I5LX 3JZIA 2R84A 2QILA 2FXQA 5KFHA 4DAVA 1Y8PB 3FEWX 5DEHA 4DNTB 4X6AH 4O7LA 5I5TA 1TS5A 3MR3A 3V6HA 1AE3A 1PDQA 4AYBG 1NMGA 4DV0Q 4AH6A 1TR5A 1C0AA 1N32Q 1WR2A 2H1EA 1IBKL 3BA8A 1NAPA 5FPRA 1EHIA 5DMXA 3GO5A 4WJ4A 2F4VQ 1JR0D 2NTSA 4R1JA 3MAQA 2HD3A 1G2TA 4JI3H 3JRXA 3BYTB 4HJ8A 2R93H 3TZDA 1YNXA 1AW7A 1QVGA 1CUKA 3DXJC 3OTOQ 1PMRA 3RLFA 2YTVA 4YAJB 3H3VH 1YBYA 2NBFA 3KF6A 3OMCA 5C5JA 5KIXA 1A3UA 4HMJA 3CP0A 5COYA 4JI7H 4KHPH 4LFAL 4LWCA 2DPIA 3JAMi 1K1QA 3DM1A 4EQ5A 5BR8H 3KBXA 2E74C 2UXBL 3A74A 2Z04A 3DF7A 1STAA 3BZKA 3J81j 1VQOA 4DQNA 3X3NA 1X9NA 2Q2UA 2Q7DA 5LL6b 4YB8B 5EWFA 4JVZA 5KFOA 4BY7H 1BXTA 4ED6A 4IPCA 1SFOH 4EYHB 5IT9c 5C3EH 1QUQA 2MO1A 2WDTA 2W8KA 2AWNA 4EQNA 1EKVA 3KLSA 1IBLQ 4ME6A 2IP4A 2PW5A 2C2RA 3RZDB 3T9EA 1U0LA 5CV5A 4GKJH 3HOVB 5EOYA 4OIJA 4BA2I 3TQTA 1VDZA 4OONA 3M85A 1TWGB 3LX0A 2BDOA 1DIKA 4LF4H 3G7LA 4F4WA 3S2HB 2N49A 4J9NA 3TBIB 4UFZA 4DV3L 1WCMB 1ESRA 4XIGS 5FD5A 2JEJA 5IP9G 4DGZA 3PCOB 1CKNB 5IT9L 1U4PA 2E2JH 1RJQA 1PRTB 4K6NA 4C56C 1WTRA 4A3IG 2FHTA 1EQQA 4RCNA 2FLNA 2FMCA 2EPBA 4DUYL 2B2UA 3OMGA 4Q8FA 4F88A 2B2UC 1S5BD 4WRDA 5JVG3 3RTXA 2BA1A 2B3GA 2J0TD 3P75A 4DR7Q 2YU9A 1X56A 5EPLA 3MR6A 4Y7NH 3UI2A 5L1LA 2F0TA 2UUAL 4HCEA 1T9HA 1B6RA 1LTLA 1SYBA 1VQHA 2LKVA 5FK9C 1KXLA 3N8DA 3A0JA 4JBWA 2WB1A 4A3MB 4WFN3 3T5KA 2G9HD 4AQYL 2ASBA 1HTLD 1RDPD 2UXDH 4FS2A 5I5YA 2K5QA 3VA7A 2ZJTA 3GTPA 4BXXH 3LWBA 5M3MH 3R5HA 2JEGA 2V1CC 1GUSA 5H1SE 1YVCA 2JA7G 4DAMA 2VS1A 1FYCA 4NP5A 3CXCA 5FJ8G 1K8OA 4RAYA 3K5LA 5IWAL 1VQCA 4A3GB 3HOWB 1G2WA 4DUZH 1STGA 2KHSA 2L9HA 3GILA 5BYBA 1TS3A 1M1KC 2ZXRA 5FO9B 1W6JA 2DNEA 1I94Q 2ZM6Q 1KJ9A 2ZDHA 4DV5H 5EBDA 1X3GA 2I46A 3SEBA 1I5FA 3SK8A 4JI1L 3Q2OA 4DV4H 1UE6A 4IWYA 5JQWA 4EYIB 2CH4A 2E2HB 3KXYT 3TW6A 1EUDB 4RNOA 2YCHA 3I8ZA 4WORA 2OT2A 5KNCA 2YWVA 4GLWA 3HOXG 2R6GA 4MNOA 1SNOA 4JI2L 4V190 2GQRA 4FF2A 1WTXA 1EUCB 4DR1L 3OPOA 1VQ8A 2K5DA 2F0OA 1OXVA 3CCRA 2HT1A 2CFMA 1EYGA 5C1PA 4IRCA 3RV3A 4YP3A 4NYEA 4JOIA 4QWBA 4KN4C 2J4XA 1EYCA 4JOIC 3NQIA 3CCQA 4IWXA 2HHFA 2E5LQ 5D1OB 5KFWA 2PNHA 4HIKA 3VMMA 4X64H 5BWXA 5CGKA 2R8IA 1YJ9A 3DMUA 2IX3A 3CQZB 3F2BA 1IOWA 1RK6A 5KFAA 4GN5A 4PDBA 5C0XG 2ODTX 3E9IA 3GTGH 2NUCA 4QIWA 4RUAA 5KFRA 3S17B 4UP7A 2I87A 1GGOA 5JVLA 4QWEA 4PZ8A 4R8IA 4JYAQ 4OWTB 4ECYA 4ZLTF 3NWSA 5KYLA 1A2TA 2ZTEA 2TMPA 3I73A 5KT5A 4CMDA 3CC2A 4LK1C 3H0GA 5E3FA 4DV1L 3BA9A 3P7JA 1MZBA 2NB0A 2W6PA 4WBNF 4FF4A 3K7AH 1EYAA 1NSNS 3NBHB 3NSWA 3PO3H 4Q45A 4IR1A 1E2ZA 4C3IG 4PQXA 1S40A 3K5HA 5KFVA 4IJLA 3GTLA 3WOFA 1CA5A 4S3SA 5JEAH 1AUVA 4LJZC 4E6IA 4QQBX 4N8X1 2X0SA 1E1TA 4K14A 4K0KL 4APMA 2SOBA 3H0GG 1PRTD 2CW0D 2K01A 4JI0Q 2CCZA 4JCVE 3TQ1A 1GD7A 4ODGA 2NTTA 1O75A 2MGSA 4QCLA 4YJ2F 1SJHD 5KFUA 3EPGA 2Y0SE 3SVMA 5LMUL 2E2IA 4C2MH 4QUCA 4GNXB 4R4QA 2KECA 3J7A5 1TWHA 3S24A 5D1PA 3RUPA 2DWCA 1ENCA 2PZWA 5LL6S 3QZ7A 2J6UA 1Q8KA 1XTCD 4XYOA 2IA6A 5BWUA 2MFIA 1Y1VB 4ECQA 4O4JF 3K7UC 3J80E 3TP6A 2XN9C 5HURA 1IBMH 4CE5A 2MCTA 4X62L 4LF9Q 1JOQA 4LFCH 3W2DA 4GN4B 4K5WA 4KY6A 3HKSA 2R7LA 2WYOA 4KI0A 2O2LD 2A5HA 2VZAA 3GLKA 3T1HQ 4RB0A 2MJ8A 4CKEA 4J0MA 1R9TB 3U9TA 4O7RA 1WSCA 2YV5A 1C30A 3G8DA 5D3IB 4QSHA 1XNQQ 2W71A 1ASYA 3QWUA 4NLGA 2COIA 4O4LF 1HNXH 2VL6A 2H5XA 2RCFA 4DL4A 1H9KA 2WINB 1C8CA 4DV7H 1CZGA 4DRFA 2K75A 1YNNC 1C4QA 3MXUA 5L37A 4RWSC 2SNSA 3RB3A 1OXSC 2B2VC 4DL2A 4FFRA 4DV2L 3L4JA 4OX9Q 3S15B 2JEBI 4X66L 1LTAD 2R7ZB 1D5MC 1HZAA 1RL2A 5LHY1 1I4GA 4R4OA 1KDAA 1B3AA 1SNMA 2PI2E 3I56A 1UC8A 3HB9A 3BVGA 4JI5H 1HUMA 2NU6B 4JG2A 1SE3A 2A6HD 5M3FH 1W93A 4C5CA 3GTQB 4LUVA 1SEBD 1K8MA 2O4XA 4ED7A 4F87A 1BNZA 5L1JA 1DCZA 4YIJA 3R5XA 1IW7C 4M7EA 3KLWA 4YHHH 2NYZD 4HNUA 3M3YB 2UU9Q 5ELCA 2NN6H 1CSQA 1WCMA 2EE1A 4OELB
chains in the Genus database with same CATH topology
5GAEC 2WE6A 1VQAA 4KLKA 4GKKQ 3E9HA 5JJIA 3BJUA 4JI7L 1NE3A 1TWFH 3K0XA 5M5YH 3RZOH 5BR8L 3NENA 2AMCB 3GJXB 4DR5H 1HR0Q 4HJ5A 1VCIA 4DK3C 4LFBQ 1L1OB 4B3TH 4J15A 3PO2G 1Y1WH 4EX5A 4LF4L 2K50A 4HIDA 5JEAJ 1SYXB 1PHJA 3S16H 5IY0A 3I55A 1VQJA 4P72A 4H02A 1X3EA 1L2ZA 2HHHQ 1BBUA 1V1QA 4JV5Q 5JEAG 4X65Q 4A76A 4L5QA 1VQLA 1UWVA 4A3KH 2UXDL 2N8NA 2GVAA 1V9PA 4L5TA 5IP7G 2K5HA 1GO3E 1TA8A 3RJ0A 1S68A 4A3FH 3I4NH 1JJCB 2IT1A 2JA6G 2W57A 2QEXA 4C3JH 4DV5L 4QJFA 2WFWA 1N34Q 1BJTA 2VQEL 3S1QH 5GADC 3G4SA 2WP8J 1H95A 2XIGA 1EWIA 3EBEA 3HOZG 3D31A 3M4PA 2VUMH 2IX0A 3N44B 1PFSA 2XTIA 4A3BH 1K83H 4KHPQ 1QUQB 1J5EL 1IXRA 1K3RA 2UXCH 3G48A 3G6EA 4MZ9A 2PQAB 4JC0A 4A3EG 2AWOA 4ETSA 3I7FA 2Q2IA 3FP9A 2A8VA 2FE3A 4IFDG 5IYDH 1VQNA 3ICEA 3RNUA 4GLAC 2K5VA 1PVOA 3G71A 1XK5A 1BKBA 3CD6A 4LSAA 2Y0SG 4LW1A 2OTJA 4QY7A 1N36Q 1E4FT 4JI2H 1E4GT 2K52A 2UUBH 3EN2A 4DR1H 4OXPA 2AHOB 4DR6H 1EIYB 1TAEA 3S1MH 4DR4Q 1YHBA 4B3MH 3WWVA 4JI8H 3N41B 1G51A 1JMCA 1FGUA 3ZJYC 1HH2P 4A3LG 4MTDA 2IHEA 1N32L 2PI2A 3RGXA 1I6HH 4LFCL 3U4VA 4NXMQ 4LF8Q 3DM3A 1A8VA 2YYZA 4C3HH 1HNXL 3M4OH 5FLMG 4DV7L 4LF6H 1GVPA 3F8TA 2VW9A 1XMOQ 1NBWA 4B3SQ 2KCMA 4DV4Q 1J6QA 1BGWA 1L1OA 5GQOA 1L1OC 3CCEA 2O03A 2HGSA 1XNRQ 4O2DA 3I4MH 1TWCH 4I7HA 2R92H 1EUJA 1YIJA 3ER0A 3OW2A 2IHFA 3VDYA 4X64Q 3H15A 4JBJA 2HVRA 5IYCH 5LMNW 2HIVA 4UCOA 1QZHA 4DR5L 1ASZA 1Q1EA 3GTJH 4BY1G 2KSWA 4BBSH 3EIVA 1EQRA 3J7AK 3RF2A 4B3TL 4X66H 2VUMG 3NELA 3PUVA 3F2DA 4A3DG 4A3BG 2LXKA 4WJ3M 1PH4A 3RIZA 4DR2H 1X55A 2QGQA 2B29A 4L5RC 4B3RH 1Q1BA 3GB8B 2NZHA 2GN5A 5IYDG 1PH1A 1IBMQ 2OTLA 3CC4A 4PZ6A 3KOJA 2VQFH 1Z9FA 3LGJA 2F52A 4IOAA 2ZTCA 3CMAA 2UUCH 4HJAA 2PQAA 1UE7A 2OCEA 3F1ZA 2IX1A 2D0OA 4JYAL 5JJKA 4JI5Q 3I4OA 4JI4Q 4UP9A 3KALA 3AFPA 4POFA 1WI5A 4KHZA 3IRBA 1SEIA 1DGSA 4YCVA 4NXNQ 4QGUA 4YY3Q 3HOYG 2UXCL 2RHQB 1HNWQ 1XMQQ 4JBMA 4LF7Q 5IYBG 1HZBA 4DR3Q 5K36G 3J81c 3N40P 3JSNA 2CWPA 1Z2PX 1N33Q 1HNZQ 4A93G 4JI6H 2VPSA 1M0TA 2R92G 1LUZA 4PMWA 3M4QA 3HKZE 2VQEH 1IBKQ 3RZDH 1OXXK 1C7YA 3HOVH 2UUBL 2ID0A 3CCJA 5IYCG 1TWGH 4DR6L 4OX9L 3S2HH 1PH2A 4B3ML 1GKHA 4JI8L 1WCMH 2JK8A 1JB7A 1PH9A 1J5EH 3MEFA 4LFAQ 4BBSG 4ALPA 1QVFA 2UXBQ 1AE2A 1C9OA 5C0XI 3KJOA 3SGIA 5JJLA 2Z6KA 3NBZB 5ELNA 1MKHA 2ZJRA 4A3MH 4LF6L 2R93G 3K3VA 4A3CH 4R7RA 4DV3Q 3M9BA 4DK6C 1MJCA 2MO0A 4A3GH 4P73A 3HOWH 3EYYA 4RG1A 4BY7G 4DUYQ 5C3EG 2E2HH 2VOBA 4DV0H 3T1YL 1RIPA 4UCRA 1N32H 2UUAQ 1NTGA 4JBKA 1B7YB 3J80W 3JSLA 1VQDA 4AQYQ 2F4VH 5GAHC 1S3OA 3OTOH 2N78A 2K14A 1VQIA 1FJGQ 1PYBA 3CQZH 5IWAQ 1PA6A 1P8LA 1NY4A 3S17H 3UE0A 1E24A 4JI1Q 4IOCA 3PUZA 1U5KA 4JI2Q 1IL2A 1IBLH 4UCTA 1BBWA 4DR2L 4YWLA 4GS3A 3JAMW 4B3RL 5FLXc 4BXXG 5M3MG 3CAMA 1KC8C 4TQUS 1XPOA 1A63A 2CQOA 2XGTA 1JJGA 1O7IA 3AFQA 4POGA 3BAAA 1G6PA 1YHAA 2VQFL 1Y1VH 1CKMA 4UCVA 4DR7H 4DV1Q 1PH5A 2UUCL 1OTCA 4UP8A 4CC6A 1R9TH 1CKOA 1Q12A 4K0KQ 4L5SA 3CCSA 3TS0A 5LMNL 3N42B 1YI2A 1WOCA 5GROA 3W5OA 4LF5L 5LMUQ 1Q7YC 2JJQA 3S15H 2R7ZH 4DV6Q 3Q8DA 1W2BA 1HJPA 1I94H 1HZ9A 2ZM6H 3TREA 4YWKA 1PH7A 4OWXB 3GTQH 4X62Q 4YWMA 4A3MG 4RB3C 3PO3G 3M3YH 2WAQE 3S1RH 4GLXA 2E5LH 4DNIA 1SRUA 4DPGA 2B63H 3L0OA 3TRZA 3HOWG 3HKZG 4DV2Q 4X66Q 4JYAH 5C44H 4JI6L 3ULPA 2RGVA 3FKIH 1VQMA 2K5NA 5C4XH 1SROA 3I2ZA 3CPFA 4JI3Q 4YCWA 3TQYA 1XMOL 1S72A 1I50H 4JI7Q 4EFBA 3CCUA 1YJNA 1X6OA 1EOVA 1OXTA 1A62A 5BR8Q 1XNRL 1HR0W 5HGQA 4UCUA 2IY5B 5M3FG 4Y52H 4LF9H 5M5XH 4GKJQ 4Q0YA 3T1HH 2NN6G 2DUDA 2MQHA 1XNQH 4LF4Q 4P71A 5AJ3L 3AYHB 1QZGA 4BWSC 3L7ZC 1SE8A 2E8GA 3H20A 1Q86C 4LH7A 2A19A 4OX9H 3N6XA 4PZ7A 2WB1E 4IAJA 3TEHB 1B04A 3K81C 4DV0L 1MJEA 3TY5A 3UDIA 3UDFA 1Y1WG 2F4VL 3PUXA 2UXDQ 2UU9H 4OO1I 3B6YA 1K8GA 1BVSA 3OTOL 2EXDA 4GKKH 1PH6A 2JQOA 5M5WH 5IP9H 1EIFA 2NZOA 4A3IH 4P75A 4DUZQ 3K8AA 3NEMA 1Z2NX 4LMYA 4DV5Q 1HR0H 3UDXA 1SLJA 4LFBH 2VQEQ 4HJ9A 2JE6I 4GLVB 3RLOA 1IBLL 3MXNB 1PH8A 4A3KG 1KAWA 2ZTDA 3KAJA 1K73C 1Z47A 2RF4A 2KBNA 4ME3A 4TVAB 1FL0A 4GOPB 3T1YH 4A75A 2B63G 2YU9H 4JI4L 2CKZB 3STBD 3ULLA 4A3FG 3I4NG 5FJ8H 4A4IA 3RN2A 2BH2A 3D0FA 1M90C 3GTPH 1PV4A 3UDGA 3GDEA 4DR7L 2HHHH 1N8RC 5C4XG 2ES2A 3UQ8A 2OWOA 4JV5H 1D7QA 4X65H 1VS0A 1VQFA 5EAYA 1MIUA 3BZCA 3CMEA 2I0QA 2OQKA 4IJHA 1D8LA 3RN5A 3JAMc 2BA0A 4RB1A 2N3SA 2YTXA 5J3BA 2VY3A 2EIFA 1I94L 2ZM6L 2WAQG 1YHQA 5GAGC 5DLQE 1N34H 3U4ZA 4AIMA 1TXYA 4LFCQ 1WH2A 1FKAH 2K4KA 3GD7A 4C3IH 2NVYH 4R4IA 1HZCA 1HNXQ 3H0GH 3CC7A 4IO9A 4A2AA 4DV7Q 2E5LL 3STBC 4LH6A 3GTLH 3ERSX 4EEQA 5LMNH 1M0WA 1E1OA 3TY9A 3FHWA 2LXJA 4LF5H 2E2IH 4YHHQ 1TWHH 1WFQA 1Q82C 4LSXA 3L4KA 3GTMH 2C35B 1L2FA 5FD6A 4A3JH 3PIOA 1N36H 2PMZE 3GTOH 3CVZA 3CPWA 4JI0L 3AQQA 3S2DH 1K8AC 4DR4H 4LUOA 4O0AA 3J7ZC 3S1NH 2RHSB 4DR5Q 1X54A 1LYLA 4MV9A 5DISC 4LF9L 4B3TQ 2Z0SA 3I4MG 3T1HL 2QA4A 4NXMH 1YITA 4LF8H 1VQ9A 1XNQL 4CC5A 2NVTH 1FJGL 2D0PA 2KCTA 4XTCS 4RZQA 1XTDA 2WB1G 1V43A 1LM0A 2NVQH 1XMOH 1SN8A 4B3SH 2OQ0A 3J81i 3U58A 4HIMA 5C0XJ 2JA9A 3KDFA 2ATWA 3E0EA 1Y14B 3PF4A 2CWAA 2ZJQA 4RB2C 2AKWB 3F2CA 3NBYB 1XNRH 3PO2H 4GOPA 2UU9L 4GOPC 2Z6KC 2KENA 4IPDA 4LNQA 4RAZA 3HFZB 1TWAH 4GKKL 1ZHQA 4P74A 5E7NA 3M4IA 2JEAI 1S03G 4OWWB 3N43B 1KRSA 3H3VI 2JA5H 1HR0L 3JC66 4A2BA 1NMFA 2HQLA 4LFBL 3HOUH 2HVQA 1VQ4A 1IYJB 5HY6A 3DLLA 3PN1A 3PIPA 3PF5A 4MV7A 4QL5A 3TY8A 2HIXA 3MWMA 5IP7H 4DAYB 4GN3B 2UXCQ 4DV6L 2JA6H 3LMLA 3ULJA 1K9MC 2ZJPA 5FPOA 3GTKH 2HHHL 1AH9A 1WYDA 1PH3A 4JV5L 3K80C 4X65L 3HOZH 4A3JG 1N9WA 3CCMA 3UE1A 4NB3A 1XPRA 2UUBQ 1A0IA 4DR1Q 3OYYA 4DR6Q 5C4JH 2VNUD 4R4TA 4B3MQ 4A3EH 1KD1C 4JI8Q 3RR5A 1G291 2D62A 1EFWA 1XDNA 4JI4H 5IE8A 2HVSA 1N34L 1P16A 3KAKA 3PSIA 1GYFA 2A1AA 3L2PA 1B70B 4FDBA 4JI3L 1VQEA 1JT8A 1CKNA 1WJJA 3KFUA 3HOVG 4NXNH 1L0WA 4KHPL 4RMFA 1KIXA 4YY3H 1KRTA 4LF6Q 1HNWH 1X3FA 4HIOA 1XMQH 3PUWA 1WCMG 4LF7H 1FVIA 5IT9W 4DR3H 3TS2A 3KF8B 4A3LH 2I5MX 1N33H 1HNZH 2LSSA 3CCVA 4GKJL 2YTYA 2JA8H 1UE5A 1ZHSA 3NC0B 3T1YQ 1IBKH 1N36L 1VQ5A 3PV0A 1UE1A 2VUGA 5FLMH 4A3CG 2BH8A 4AYBE 4DR4L 2JA5G 3BABA 4LFAH 3PGZA 3HOUG 3KJPA 4A3GG 3KYHC 2NVXH 2UXBH 2CW7A 4HJ7A 1E22A 3IG0A 4MTEA 3M7NA 4NXML 4LF8L 3J81W 5D1OA 4DR2Q 1SR3A 1K0RA 4B3RQ 4UPAA 2R7DA 4DUZL 1KHIA 4DV3H 3A5ZB 3A5UA 1UEBA 3U50C 4B3SL 4JI0H 2Q2HA 4DV4L 3PUYA 3KF6B 2EQSA 1I6UA 1KQSA 4BY1H 4E6NA 2ALYB 2VQFQ 4IFDJ 1IZ6A 1VQPA 4BBRH 4DUYH 1Z2OX 3RLNA 1JJ2A 4A3DH 4IFDI 1YJWA 2UUCQ 2UUAH 2GVBA 3CF5A 4GNXA 1W3SA 4AQYH 4GNXC 4X64L 2NN6I 3W1GA 4IPHA 4R4CA 1E3PA 2L15A 5LMNQ 1XPUA 1FJGH 4MTNA 4EFEA 1YZ6A 4LF5Q 5IWAH 1Q46A 4IPGA 4APVA 2DGYA 1Y1VG 4DKAC 4JI1H 1CSPA 1PYSB 2MNAA 1VQ6A 5A2QW 2CW8A 1JE5A 1QVCA 1OXUA 4UCSA 4YCUA 1VQKA 4UY8C 4NPSA 1Q81C 4LUZA 1XJVA 1X65A 1VQGA 1IBML 1I3QH 2R7ZG 1AN7A 2JA8G 2I5HA 4OO1G 4JI6Q 4DV1H 1B8AA 5ELOA 3KDFB 1KL9A 3HOYH 3CW2C 1YEZA 3RGZA 4K0KH 3BU2A 4QIWE 3AEVA 5IYBH 1J5EQ 4JI5L 2RGRA 2KHIA 2JA7H 5LMUH 3W1BA 3J80c 4DV6H 5FLXW 5C44G 4YHHL 3FMAA 1GM5A 4BA1I 1SMXA 4A93H 2Q2TA 1E7ZA 3FKIG 4X62H 4NXNL 3HOXH 3VNNA 4YY3L 3HXLA 2R7FA 1HNWL 3CCLA 5AJ3Q 1XMQL 4LF7L 2F3IA 1VQBA 3C0FB 4DR3L 3F8NA 3J80i 2RCNA 1NJIC 4FM9A 1VQ7A 4DV2H 4BBRG 4PG3A 1N33L 3S14H 2KHJA 1HNZL 2I5LX 2FXQA 4X6AH 1AE3A 4AYBG 1NMGA 4DV0Q 4AH6A 1C0AA 1N32Q 1IBKL 3BA8A 5FPRA 3GO5A 4WJ4A 2F4VQ 4R1JA 4JI3H 4HJ8A 2R93H 1YNXA 1QVGA 1CUKA 3OTOQ 3RLFA 2YTVA 3H3VH 1YBYA 3KF6A 3CP0A 4JI7H 4KHPH 4LFAL 4LWCA 3JAMi 4EQ5A 5BR8H 2UXBL 3A74A 3DF7A 1VQOA 3BZKA 3J81j 1X9NA 2Q2UA 5LL6b 4BY7H 4IPCA 1SFOH 5IT9c 5C3EH 1QUQA 2MO1A 2WDTA 2AWNA 1IBLQ 1U0LA 4GKJH 5EOYA 4BA2I 4OONA 3M85A 4LF4H 2N49A 4UFZA 4DV3L 4XIGS 5FD5A 5IP9G 1CKNB 3PCOB 2E2JH 4A3IG 1EQQA 4DUYL 3RTXA 2BA1A 2B3GA 4DR7Q 1X56A 4Y7NH 2UUAL 1T9HA 1LTLA 1VQHA 1KXLA 3A0JA 4JBWA 4AQYL 2ASBA 2UXDH 2ZJTA 4BXXH 5M3MH 2V1CC 5H1SE 1YVCA 2JA7G 4DAMA 2VS1A 3CXCA 5FJ8G 4RAYA 5IWAL 1VQCA 4DUZH 1M1KC 1I94Q 2ZM6Q 4DV5H 1X3GA 1I5FA 4JI1L 4DV4H 1UE6A 3KXYT 2YCHA 3HOXG 2R6GA 4MNOA 4JI2L 4DR1L 1VQ8A 1OXVA 3CCRA 2HT1A 2CFMA 1EYGA 4JOIA 4JOIC 3CCQA 2E5LQ 5D1OB 2PNHA 4HIKA 4X64H 1YJ9A 3F2BA 4PDBA 4GN5A 5C0XG 3E9IA 3GTGH 4UP7A 4PZ8A 4JYAQ 4OWTB 2ZTEA 3CC2A 4DV1L 3BA9A 1MZBA 3K7AH 3NBHB 3PO3H 1S40A 4IJLA 4QQBX 1E1TA 4K0KL 4APMA 3H0GG 4JI0Q 2CCZA 4JCVE 1GD7A 1O75A 2Y0SE 5LMUL 4C2MH 4GNXB 4R4QA 3J7A5 3S24A 5D1PA 1Q8KA 2MFIA 3K7UC 1IBMH 2MCTA 4X62L 4LF9Q 4LFCH 4GN4B 2WYOA 3HKSA 4KI0A 4J0MA 2VZAA 3T1HQ 4RB0A 2YV5A 1XNQQ 1ASYA 3QWUA 1HNXH 2VL6A 2H5XA 4DV7H 4DRFA 2K75A 1OXSC 4DV2L 3L4JA 4OX9Q 2JEBI 4X66L 1HZAA 1RL2A 4R4OA 2PI2E 3I56A 4JI5H 4JG2A 5M3FH 4LUVA 4M7EA 3KLWA 4YHHH 2UU9Q 1CSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE C;  1VQA A;  2ID0 A;  4X64 L;  4GNX C;  3CCJ A;  3BZC A;  4KLK A;  5IYC G;  3CME A;  4GKK Q;  1TWG H;  4DR6 L;  3E9H A;  2I0Q A;  5JJI A;  2NN6 I;  3W1G A;  3BJU A;  2OQK A;  4IJH A;  4JI7 L;  1PH2 A;  4OX9 L;  3S2H H;  1D8L A;  4B3M L;  4IPH A;  1NE3 A;  1GKH A;  1TWF H;  1E3P A;  1WCM H;  2L15 A;  3K0X A;  4R4C A;  4JI8 L;  2JK8 A;  5M5Y H;  5LMN Q;  3RN5 A;  1PH9 A;  1JB7 A;  1XPU A;  3RZO H;  3JAM c;  2BA0 A;  4MTN A;  3NEN A;  5BR8 L;  4EFE A;  3MEF A;  1YZ6 A;  4LFA Q;  4BBS G;  2AMC B;  4LF5 Q;  3GJX B;  2N3S A;  1Q46 A;  2YTX A;  2VY3 A;  2EIF A;  4IPG A;  5J3B A;  2ZM6 L;  4ALP A;  2WAQ G;  4HJ5 A;  1I94 L;  1AE2 A;  1C9O A;  1HR0 Q;  1QVF A;  2UXB Q;  4APV A;  1VCI A;  5C0X I;  5GAG C;  3KJO A;  1YHQ A;  2DGY A;  5DLQ E;  1Y1V G;  3U4Z A;  4AIM A;  4DK3 C;  3SGI A;  4DKA C;  4LFB Q;  5JJL A;  2Z6K A;  1L1O B;  1TXY A;  1CSP A;  1PYS B;  4LFC Q;  2MNA A;  4J15 A;  1VQ6 A;  3NBZ B;  5ELN A;  3PO2 G;  1MKH A;  2K4K A;  3GD7 A;  4C3I H;  1Y1W H;  1JE5 A;  4EX5 A;  2ZJR A;  1QVC A;  4A3M H;  4LF4 L;  2NVY H;  1OXU A;  4R4I A;  4LF6 L;  2K50 A;  4HID A;  1HZC A;  5JEA J;  2R93 G;  1HNX Q;  3H0G H;  3CC7 A;  1PHJ A;  4IO9 A;  3S16 H;  4UCS A;  4A3C H;  5IY0 A;  4DV7 Q;  2E5L L;  4YCU A;  1VQK A;  4UY8 C;  3I55 A;  4DV3 Q;  4NPS A;  3STB C;  3M9B A;  1Q81 C;  1VQJ A;  4LH6 A;  4DK6 C;  3GTL H;  4P72 A;  4LUZ A;  3ERS X;  1MJC A;  1XJV A;  1X65 A;  1VQG A;  1IBM L;  4EEQ A;  2MO0 A;  3HOV H;  4H02 A;  1I3Q H;  4A3G H;  2R7Z G;  1E1O A;  4P73 A;  3HOW H;  3TY9 A;  2JA8 G;  3FHW A;  2LXJ A;  1X3E A;  4RG1 A;  4BY7 G;  2I5H A;  4OO1 G;  4DUY Q;  4JI6 Q;  2HHH Q;  1BBU A;  2E2I H;  5C3E G;  1V1Q A;  2E2H H;  4JV5 Q;  4YHH Q;  1TWH H;  1WFQ A;  1B8A A;  5JEA G;  1Q82 C;  4X65 Q;  5ELO A;  4L5Q A;  1RIP A;  4A76 A;  3T1Y L;  1UWV A;  4A3K H;  1NTG A;  3KDF B;  1VQL A;  2C35 B;  2UUA Q;  3GTM H;  2UXD L;  2N8N A;  1KL9 A;  1L2F A;  4JBK A;  2GVA A;  1B7Y B;  3JSL A;  1VQD A;  4AQY Q;  4A3J H;  3PIO A;  5GAH C;  2PMZ E;  3GTO H;  1V9P A;  4L5T A;  5IP7 G;  3CW2 C;  3CPW A;  4JI0 L;  1YEZ A;  3HOY H;  3AQQ A;  2K5H A;  1S3O A;  1GO3 E;  3S2D H;  1TA8 A;  1S68 A;  3BU2 A;  4A3F H;  2N78 A;  2K14 A;  1K8A C;  1VQI A;  3I4N H;  4QIW E;  1JJC B;  1FJG Q;  4LUO A;  3AEV A;  5IYB H;  1J5E Q;  2IT1 A;  4JI5 L;  1PYB A;  2JA6 G;  2QEX A;  2KHI A;  3CQZ H;  2JA7 H;  4O0A A;  3W1B A;  5IWA Q;  1PA6 A;  3J7Z C;  3S1N H;  1P8L A;  2RHS B;  4C3J H;  3J80 c;  4DR5 Q;  1NY4 A;  4DV5 L;  3S17 H;  3UE0 A;  4QJF A;  5C44 G;  1X54 A;  2WFW A;  4YHH L;  1N34 Q;  1LYL A;  1GM5 A;  5DIS C;  2VQE L;  4BA1 I;  1E24 A;  3S1Q H;  1SMX A;  4JI1 Q;  5GAD C;  4A93 H;  4LF9 L;  3G4S A;  2Z0S A;  2WP8 J;  4B3T Q;  2Q2T A;  1E7Z A;  3I4M G;  1H95 A;  3FKI G;  4IOC A;  3T1H L;  1EWI A;  3PUZ A;  2QA4 A;  3EBE A;  3HOZ G;  3D31 A;  1U5K A;  4JI2 Q;  3M4P A;  1IL2 A;  4UCT A;  1YIT A;  1BBW A;  4DR2 L;  1VQ9 A;  2VUM H;  4NXN L;  2IX0 A;  4YWL A;  3HOX H;  1XNQ L;  3VNN A;  4GS3 A;  4YY3 L;  4CC5 A;  4B3R L;  1PFS A;  5FLX c;  2XTI A;  2NVT H;  4A3B H;  2R7F A;  1FJG L;  4BXX G;  1K83 H;  2D0P A;  4KHP Q;  1HNW L;  2KCT A;  1QUQ B;  4XTC S;  5AJ3 Q;  1J5E L;  5M3M G;  1IXR A;  3CAM A;  1K3R A;  3CCL A;  1XMQ L;  1XTD A;  1KC8 C;  2WB1 G;  4TQU S;  1XPO A;  1V43 A;  3G48 A;  4LF7 L;  1A63 A;  2F3I A;  4MZ9 A;  3G6E A;  1VQB A;  2PQA B;  4DR3 L;  1LM0 A;  4JC0 A;  4A3E G;  2CQO A;  2NVQ H;  2AWO A;  2XGT A;  1JJG A;  3I7F A;  1SN8 A;  1O7I A;  2Q2I A;  3J80 i;  3FP9 A;  2OQ0 A;  3AFQ A;  2RCN A;  3J81 i;  1NJI C;  3U58 A;  1VQ7 A;  4POG A;  4HIM A;  5C0X J;  4BBR G;  2A8V A;  4PG3 A;  2JA9 A;  4IFD G;  1YHA A;  3KDF A;  2ATW A;  1G6P A;  1N33 L;  2VQF L;  3E0E A;  2KHJ A;  3S14 H;  1HNZ L;  5IYD H;  2I5L X;  1VQN A;  3ICE A;  1Y14 B;  2FXQ A;  4GLA C;  3RNU A;  2K5V A;  2CWA A;  3PF4 A;  1Y1V H;  1PVO A;  3G71 A;  2ZJQ A;  4X6A H;  2AKW B;  3F2C A;  1XK5 A;  3NBY B;  1CKM A;  4UCV A;  1AE3 A;  4AYB G;  1NMG A;  4DV1 Q;  1BKB A;  4DV0 Q;  3CD6 A;  4AH6 A;  1PH5 A;  3PO2 H;  1C0A A;  2UUC L;  4GOP A;  1N32 Q;  2Y0S G;  2UU9 L;  1IBK L;  1OTC A;  3BA8 A;  4GOP C;  2Z6K C;  5FPR A;  4UP8 A;  2KEN A;  4IPD A;  3GO5 A;  4WJ4 A;  4LW1 A;  4LNQ A;  4CC6 A;  1R9T H;  3HFZ B;  2F4V Q;  1CKO A;  1TWA H;  4QY7 A;  2OTJ A;  4R1J A;  1N36 Q;  4GKK L;  2K52 A;  1Q12 A;  4HJ8 A;  4P74 A;  5E7N A;  2R93 H;  1YNX A;  2JEA I;  3EN2 A;  1QVG A;  1CUK A;  4K0K Q;  3OTO Q;  4L5S A;  4OXP A;  3CCS A;  3RLF A;  2YTV A;  3TS0 A;  2AHO B;  4OWW B;  3H3V H;  1YBY A;  3KF6 A;  5LMN L;  1EIY B;  1YI2 A;  1WOC A;  3CP0 A;  3S1M H;  4DR4 Q;  1TAE A;  1YHB A;  5GRO A;  1KRS A;  3W5O A;  4LFA L;  3WWV A;  4LWC A;  4LF5 L;  5LMU Q;  1G51 A;  3H3V I;  1Q7Y C;  2JA5 H;  1JMC A;  1FGU A;  2JJQ A;  3JAM i;  4EQ5 A;  1HR0 L;  3ZJY C;  2UXB L;  3S15 H;  3A74 A;  1HH2 P;  3JC6 6;  1VQO A;  3BZK A;  3J81 j;  4DV6 Q;  2R7Z H;  4A3L G;  1X9N A;  1NMF A;  2Q2U A;  2HQL A;  3Q8D A;  1W2B A;  1HJP A;  4BY7 H;  1HZ9 A;  2IHE A;  4LFB L;  3HOU H;  1N32 L;  2PI2 A;  2HVQ A;  4IPC A;  1VQ4 A;  1SFO H;  5IT9 c;  1I6H H;  1IYJ B;  5HY6 A;  3TRE A;  4LFC L;  4YWK A;  3DLL A;  5C3E H;  1PH7 A;  1QUQ A;  2MO1 A;  3U4V A;  4OWX B;  3GTQ H;  3PN1 A;  2AWN A;  4X62 Q;  4YWM A;  3PIP A;  4A3M G;  1IBL Q;  4NXM Q;  3PO3 G;  4LF8 Q;  3PF5 A;  3DM3 A;  1U0L A;  4QL5 A;  1A8V A;  2YYZ A;  3M3Y H;  2WAQ E;  3TY8 A;  4BA2 I;  4C3H H;  4OON A;  3M85 A;  1HNX L;  2HIX A;  3M4O H;  5IP7 H;  4DAY B;  3S1R H;  5FLM G;  4GN3 B;  4DV7 L;  2N49 A;  2UXC Q;  1GVP A;  4UFZ A;  4DV3 L;  4GLX A;  3F8T A;  4XIG S;  2VW9 A;  5IP9 G;  4DV6 L;  4DNI A;  1CKN B;  1SRU A;  3PCO B;  4DPG A;  1NBW A;  1XMO Q;  2E2J H;  2B63 H;  3BAA A;  3L0O A;  2JA6 H;  3TRZ A;  3HOW G;  3ULJ A;  4B3S Q;  2KCM A;  3HKZ G;  4A3I G;  1EQQ A;  4DV2 Q;  1J6Q A;  4DV4 Q;  1K9M C;  4X66 Q;  2ZJP A;  1L1O A;  5GQO A;  5FPO A;  1L1O C;  3GTK H;  5C44 H;  4DUY L;  4JI6 L;  2HHH L;  1AH9 A;  3CCE A;  1XNR Q;  1WYD A;  4O2D A;  3ULP A;  1PH3 A;  3RTX A;  2BA1 A;  2B3G A;  4DR7 Q;  4JV5 L;  3K80 C;  1X56 A;  4X65 L;  3I4M H;  3FKI H;  4Y7N H;  2UUA L;  1TWC H;  1VQM A;  1T9H A;  4A3J G;  1LTL A;  1VQH A;  3HOZ H;  1KXL A;  4UCR A;  1N9W A;  2K5N A;  3A0J A;  1EUJ A;  4JBW A;  1SRO A;  3I2Z A;  5C4X H;  3CCM A;  1YIJ A;  2R92 H;  4AQY L;  3CPF A;  3UE1 A;  2ASB A;  4NB3 A;  4JI3 Q;  3ER0 A;  3OW2 A;  4YCW A;  1XPR A;  2IHF A;  3TQY A;  1A0I A;  2UUB Q;  4BXX H;  3VDY A;  4DR1 Q;  1XMO L;  4X64 Q;  3OYY A;  1S72 A;  5M3M H;  2V1C C;  4DR6 Q;  3H15 A;  1I50 H;  4JBJ A;  5H1S E;  5C4J H;  2HVR A;  1YVC A;  2VNU D;  5IYC H;  5LMN W;  4JI7 Q;  2JA7 G;  4R4T A;  2VS1 A;  4DAM A;  3CCU A;  1YJN A;  4EFB A;  3CXC A;  1X6O A;  4A3E H;  1KD1 C;  4B3M Q;  1EOV A;  4JI8 Q;  3RR5 A;  5FJ8 G;  1OXT A;  1G29 1;  2D62 A;  1EFW A;  1XDN A;  2HIV A;  1A62 A;  5IWA L;  1VQC A;  5BR8 Q;  4DR5 L;  1QZH A;  4UCO A;  1ASZ A;  5IE8 A;  1XNR L;  1HR0 W;  2HVS A;  1Q1E A;  3GTJ H;  5HGQ A;  1M1K C;  1N34 L;  4BY1 G;  1I94 Q;  2ZM6 Q;  1P16 A;  4BBS H;  3EIV A;  1EQR A;  1X3G A;  3PSI A;  1I5F A;  2A1A A;  4JI1 L;  3L2P A;  1UE6 A;  4B3T L;  4UCU A;  2IY5 B;  5M3F G;  4Y52 H;  1B70 B;  2VUM G;  3NEL A;  3PUV A;  4FDB A;  3HOX G;  2R6G A;  4MNO A;  4JI3 L;  3F2D A;  4JI2 L;  4A3D G;  1VQE A;  5M5X H;  4DR1 L;  4GKJ Q;  4A3B G;  2LXK A;  1JT8 A;  4WJ3 M;  1CKN A;  1VQ8 A;  2NN6 G;  1PH4 A;  1WJJ A;  2DUD A;  1X55 A;  2QGQ A;  3KFU A;  1OXV A;  2MQH A;  3HOV G;  3CCR A;  2HT1 A;  2CFM A;  2B29 A;  1L0W A;  1EYG A;  4RMF A;  4KHP L;  4LF4 Q;  4P71 A;  5AJ3 L;  1KIX A;  4L5R C;  1KRT A;  4LF6 Q;  4JOI A;  3AYH B;  1QZG A;  1Q1B A;  4JOI C;  3GB8 B;  3CCQ A;  1X3F A;  4HIO A;  3L7Z C;  1SE8 A;  2NZH A;  2E5L Q;  5D1O B;  3PUW A;  2GN5 A;  1WCM G;  2PNH A;  4HIK A;  2E8G A;  1FVI A;  1YJ9 A;  3F2B A;  4GN5 A;  1Q86 C;  3TS2 A;  5IYD G;  5C0X G;  2A19 A;  3E9I A;  3GTG H;  4LH7 A;  4UP7 A;  1PH1 A;  1IBM Q;  3KF8 B;  2OTL A;  4A3L H;  4PZ8 A;  3CC4 A;  4JYA Q;  4OWT B;  4PZ6 A;  4PZ7 A;  2I5M X;  3KOJ A;  2ZTE A;  2WB1 E;  3TEH B;  1B04 A;  2LSS A;  3CCV A;  3CC2 A;  4GKJ L;  2YTY A;  2JA8 H;  3K81 C;  4DV1 L;  1UE5 A;  3BA9 A;  4DV0 L;  1MJE A;  1Z9F A;  3LGJ A;  3UDI A;  3TY5 A;  3K7A H;  2F52 A;  4IOA A;  3NBH B;  3PO3 H;  2ZTC A;  3UDF A;  3NC0 B;  1Y1W G;  3CMA A;  3T1Y Q;  3PUX A;  1S40 A;  2F4V L;  4IJL A;  2UXD Q;  1N36 L;  4OO1 I;  3B6Y A;  1K8G A;  4HJA A;  1BVS A;  1VQ5 A;  3PV0 A;  4QQB X;  1E1T A;  1UE1 A;  2PQA A;  2VUG A;  4K0K L;  3OTO L;  1UE7 A;  3H0G G;  2EXD A;  5FLM H;  2OCE A;  3F1Z A;  2IX1 A;  1PH6 A;  4JI0 Q;  2CCZ A;  4A3C G;  4JCV E;  2D0O A;  2JQO A;  2BH8 A;  4AYB E;  5M5W H;  1GD7 A;  4DR4 L;  2JA5 G;  5IP9 H;  1EIF A;  4JYA L;  2Y0S E;  5LMU L;  5JJK A;  2NZO A;  4C2M H;  4GNX B;  4R4Q A;  3J7A 5;  3S24 A;  3BAB A;  4JI5 Q;  3I4O A;  5D1P A;  4JI4 Q;  3PGZ A;  4A3I H;  4P75 A;  4DUZ Q;  3HOU G;  3K8A A;  3KJP A;  4A3G G;  3NEM A;  3KYH C;  1Q8K A;  2NVX H;  4DV5 Q;  2MFI A;  3UDX A;  4HJ7 A;  1SLJ A;  3K7U C;  1E22 A;  4UP9 A;  2VQE Q;  3AFP A;  4HJ9 A;  3M7N A;  4POF A;  2JE6 I;  4X62 L;  4GLV B;  3RLO A;  1IBL L;  3MXN B;  4LF9 Q;  1PH8 A;  4LF8 L;  4NXM L;  4GN4 B;  1WI5 A;  3HKS A;  4KHZ A;  4KI0 A;  2VZA A;  3T1H Q;  4A3K G;  5D1O A;  1KAW A;  2ZTD A;  3IRB A;  1K73 C;  1Z47 A;  2RF4 A;  2KBN A;  2YV5 A;  4ME3 A;  1DGS A;  4YCV A;  4TVA B;  4DR2 Q;  1FL0 A;  4NXN Q;  1SR3 A;  4QGU A;  1XNQ Q;  4YY3 Q;  1K0R A;  4GOP B;  1ASY A;  3QWU A;  3HOY G;  2UXC L;  4B3R Q;  2RHQ B;  4A75 A;  2B63 G;  2VL6 A;  2H5X A;  4UPA A;  2YU9 H;  1HNW Q;  4JI4 L;  2CKZ B;  2R7D A;  3STB D;  3ULL A;  2K75 A;  4DUZ L;  1XMQ Q;  4JBM A;  4DRF A;  4A3F G;  4LF7 Q;  1KHI A;  3I4N G;  1OXS C;  3A5Z B;  3A5U A;  5FJ8 H;  5IYB G;  1HZB A;  1UEB A;  3U50 C;  4DR3 Q;  4B3S L;  5K36 G;  3J81 c;  4A4I A;  3RN2 A;  2Q2H A;  4DV2 L;  3D0F A;  3PUY A;  4DV4 L;  4OX9 Q;  2JEB I;  3KF6 B;  4X66 L;  2BH2 A;  1HZA A;  1RL2 A;  1M90 C;  2EQS A;  3JSN A;  4R4O A;  3GTP H;  1KQS A;  2PI2 E;  3I56 A;  4BY1 H;  2CWP A;  1PV4 A;  3UDG A;  3GDE A;  2ALY B;  2VQF Q;  1N33 Q;  4IFD J;  4E6N A;  1HNZ Q;  1IZ6 A;  4JG2 A;  1VQP A;  4BBR H;  4DR7 L;  5M3F H;  4A93 G;  4LUV A;  1N8R C;  2R92 G;  1LUZ A;  3RLN A;  2ES2 A;  5C4X G;  3UQ8 A;  1JJ2 A;  4A3D H;  2OWO A;  3KLW A;  4PMW A;  3M4Q A;  1D7Q A;  3HKZ E;  4IFD I;  1YJW A;  1VS0 A;  2UUC Q;  1VQF A;  2UU9 Q;  1IBK Q;  3RZD H;  1CSQ A;  1OXX K;  2GVB A;  1C7Y A;  3CF5 A;  4GNX A;  5EAY A;  1MIU A;  2UUB L;  1W3S A; 
#chains in the Genus database with same CATH topology
 5GAE C;  2WE6 A;  1VQA A;  4B08 A;  3S1R B;  5I47 A;  3GV3 A;  2FFK B;  2XWB B;  4KLK A;  4GKK Q;  1LTB D;  1UC9 A;  3WNZ A;  3E9H A;  5JJI A;  4O1N A;  3VPB A;  1PRT C;  1XXG A;  3BJU A;  4OEM B;  4J1M A;  4JI7 L;  2B63 B;  4UAI A;  1NE3 A;  1TWF H;  3K0X A;  4O2B F;  1O7Z A;  5M5Y H;  5CAE B;  4CHT B;  3RZO H;  2PMZ A;  5BR8 L;  3NEN A;  3D4D A;  4JXU A;  5KT7 A;  4ECS A;  1STE A;  3I70 A;  4HN7 A;  2AMC B;  1KT8 A;  3GJX B;  2EY5 A;  1QCB D;  4DR5 H;  3OOC A;  1HR0 Q;  2QCP X;  5C44 B;  4HJ5 A;  3RV4 A;  4RU9 A;  4F4X A;  5DAU A;  3QOJ A;  2Z6B A;  1VCI A;  2F0I A;  1QIL A;  3R3O A;  1QNU A;  3RB0 A;  4DK3 C;  4LFB Q;  1STB A;  2ZDQ A;  1L1O B;  3FKI B;  4CDC C;  2F0U A;  4B3T H;  3FPP A;  4QW9 A;  1S0M A;  4J15 A;  3PO2 G;  4KMU C;  5C4X B;  5CR5 A;  5IT9 E;  3N52 A;  1CQF A;  4I65 A;  2LMC B;  1I4R A;  3OIQ A;  1Y1W H;  4O82 A;  3VR4 A;  2CQY A;  3NGD A;  4EX5 A;  5FO8 B;  2JA5 A;  2K32 A;  4IUP A;  4LF4 L;  3D3R A;  2K50 A;  2RQX A;  3K5N A;  4HID A;  5JEA J;  1OBD A;  1SYX B;  1I50 B;  1PHJ A;  3S16 H;  5IY0 A;  5DM6 3;  1Y69 U;  4XX0 B;  3I55 A;  5I5X A;  1MBY A;  3HP3 A;  4FFO A;  4H0L C;  1VQJ A;  2F3V A;  4P72 A;  1RYS A;  1O7Y A;  2RBM A;  3V96 A;  5E4X A;  4H02 A;  5D14 A;  3A55 A;  2O5J C;  3IFD A;  1IKM A;  2F0N A;  1X3E A;  3T9A A;  5I4D A;  5C3W A;  2WAQ B;  3T99 A;  2FKL A;  1L2Z A;  3TN2 A;  3KRE A;  2HHH Q;  4J9M A;  3G8C A;  4DAA A;  1BBU A;  2F1M A;  3C2P A;  5CM0 A;  1V1Q A;  5M5X B;  1MHW C;  4JV5 Q;  2R7K A;  1B44 D;  1WTH A;  3H6M A;  5JEA G;  1T5X D;  4X65 Q;  4A76 A;  4L5Q A;  1VQL A;  1ULZ A;  1UWV A;  4G4K A;  4A3K H;  1PZK D;  2UXD L;  2DY7 A;  4B9X A;  4ECZ A;  2N8N A;  5G3L F;  4FF3 A;  2GVA A;  3W3A A;  4PWQ A;  5EWG A;  2W9A A;  2PZT A;  2IL8 A;  2JXM B;  4JW0 A;  1V9P A;  4L5T A;  5IP7 G;  3QOL A;  3X3M A;  2K5H A;  1S0N A;  1GO3 E;  2BOS A;  1TA8 A;  4DAP A;  3S9W A;  1PFM A;  3RJ0 A;  3MFI A;  1S68 A;  3OWE B;  5JAV A;  4K2K A;  4A3F H;  4J9Q A;  3I4N H;  1JJC B;  2DPJ A;  4PNY A;  2IT1 A;  2JA6 G;  2W57 A;  4JPB W;  1DJR D;  2QEX A;  2ICI A;  2FLL A;  1A6X A;  1SBB B;  1STH A;  4C3J H;  4DV5 L;  4F7X A;  2MP1 A;  3OSO A;  4QJF A;  1C3O A;  2R61 A;  2WFW A;  3J7A V;  1N34 Q;  1BJT A;  2Q8R E;  4O81 A;  2VQE L;  3S1Q H;  5GAD C;  3G4S A;  2WP8 J;  4DL6 A;  1CFM A;  5L9X A;  4ZKC B;  1H95 A;  2XIG A;  1EWI A;  5D65 A;  3EBE A;  3HOZ G;  3BS1 A;  3D31 A;  3M4P A;  2MUY A;  3OWF A;  2VUM H;  2KOL A;  3MR2 A;  2IX0 A;  2XCA A;  3N44 B;  2UVR A;  2R7M A;  1KBL A;  1PYW D;  1PFS A;  1BCP B;  2XTI A;  4A3B H;  1RD9 D;  2Z02 A;  1K83 H;  4KHP Q;  4R8U A;  1QUQ B;  1J5E L;  1A9X A;  1IXR A;  3WOE A;  1K3R A;  2ZT9 C;  4FNF A;  5M5W B;  2UXC H;  1ENA A;  3G48 A;  1AUX A;  5BWT A;  1CI3 M;  4MZ9 A;  3G6E A;  1N48 A;  1GHK A;  2PQA B;  4O7V A;  4JC0 A;  4A3E G;  2SDF A;  2AWO A;  1RKN A;  3H09 A;  2FK3 A;  4A3I B;  4ETS A;  3M9O B;  2XSC A;  3I7F A;  1Y1V A;  2Q2I A;  3FP9 A;  2N88 A;  3IAY A;  4NKL A;  1T36 A;  2A8V A;  4O86 A;  2FE3 A;  4IFD G;  1TQO A;  3Q22 A;  5IYD H;  1Y8N B;  1VQN A;  4ZYS A;  3ICE A;  3RNU A;  4GLA C;  2K5V A;  1PVO A;  3BG3 A;  5I5V A;  3G71 A;  1R9T A;  1XK5 A;  2IMW P;  2AGO A;  1CQI B;  2J6T A;  1BKB A;  3CD6 A;  1KLG D;  4FP5 D;  4LSA A;  2OH2 A;  4EGJ A;  2Y0S G;  2EY6 A;  3JZ6 A;  4TV8 F;  4LW1 A;  1WTQ A;  2A73 B;  2OTJ A;  4QY7 A;  2ATL A;  3T16 A;  4IRD A;  1N36 Q;  1E4F T;  4JI2 H;  1RF2 D;  1CQJ B;  2K52 A;  1E4G T;  3NPP A;  5I5W A;  2YU9 B;  2UUB H;  3EN2 A;  4DR1 H;  4OXP A;  5JH7 F;  5KT2 A;  2AHO B;  4DR6 H;  1EIY B;  2R7Z A;  1TAE A;  2C2E A;  3S1M H;  4DR4 Q;  3JZF A;  1YHB A;  4B3M H;  3WWV A;  4JI8 H;  1R4P B;  2QDL A;  3N41 B;  1G51 A;  1HQM C;  2F0E A;  1FGU A;  1FNW A;  1R4Q B;  1JMC A;  3GTP B;  4EVO A;  3ZJY C;  1HH2 P;  1V1P A;  4A3L G;  4MTD A;  4EQP A;  2IWH A;  1NUC A;  1SYF A;  2EJ3 A;  1WTW A;  1TU2 B;  2XCL A;  1SMY D;  2V4D A;  1SYC A;  2IHE A;  1N32 L;  2WTF A;  2PI2 A;  2FPG B;  3MWD A;  2K7V A;  3H4D A;  3RGX A;  1I6H H;  4LFC L;  1SDF A;  1M4V A;  2W8L A;  2UVV A;  3U4V A;  2F0S A;  4IRK A;  1AZQ A;  3TSS A;  1JCK B;  4NXM Q;  1PZI D;  1SJE D;  4LF8 Q;  5EDW A;  2R3Z A;  3DM3 A;  1IYV A;  2CH4 W;  2FMA A;  1A8V A;  4ED1 A;  1FGB D;  2YYZ A;  5I6W A;  4C3H H;  1HNX L;  3J7A F;  3KLS X;  3M4O H;  4Z9C B;  3QB3 A;  5FLM G;  4DV7 L;  2NVX A;  4LF6 H;  3T7A A;  1GVP A;  1H9M A;  1E4E B;  3F8T A;  2EZV A;  2VW9 A;  4FF1 A;  2YZN A;  5IIF A;  2HG8 A;  5CV9 A;  1NBW A;  2K03 A;  1XMO Q;  1PTO B;  4ZRZ A;  1TII D;  4B3S Q;  2KCM A;  5J22 A;  4DV4 Q;  1J6Q A;  1BGW A;  1DOL A;  1L1O A;  2EY2 A;  5K36 H;  5GQO A;  1LAC A;  1T94 A;  3AB9 A;  1L1O C;  2HHF B;  2W9C A;  2DJF C;  3CRK C;  3CCE A;  2O03 A;  2HGS A;  3M7G A;  1XNR Q;  1HQR D;  4O2D A;  3CU7 A;  2ASJ A;  2XNA C;  4QWA A;  4QIW B;  3NK9 A;  4FXG C;  3Q24 A;  3I4M H;  4G7H C;  2EJ0 A;  4I55 F;  1EEI D;  1TWC H;  1BCP D;  1E0B A;  3U9S A;  3BVM A;  4C3I B;  3MJF A;  2R92 H;  4I7H A;  1EUJ A;  1YIJ A;  2NVY B;  4DA2 A;  3G6X A;  4IN3 A;  3ER0 A;  3OW2 A;  3H0G B;  2IHF A;  3VDY A;  4FBU A;  2K1B A;  4X64 Q;  1TT2 A;  3VYU A;  3H15 A;  4JBJ A;  2HVR A;  5IGB A;  4ECR A;  5IYC H;  5LMN W;  5C6A A;  1I7L A;  3GTL B;  4ZCK A;  4G7Z C;  2HIV A;  4UCO A;  1QZH A;  4DR5 L;  3QFF A;  3KHL A;  5J39 A;  1ASZ A;  2EYM A;  3NWT A;  1I1L A;  1Q1E A;  3GTJ H;  1Z6H A;  3BDL A;  5T1G A;  4AYB A;  1PK8 A;  4BY1 G;  2KSW A;  4BBS H;  2AQ1 B;  3EIV A;  1EQR A;  2FPP B;  3J7A K;  3GP7 A;  3RF2 A;  4ZQ3 A;  3V05 A;  1SMY C;  4B3T L;  2E2I B;  5LYJ F;  4X66 H;  3GV6 A;  4CDF C;  1TWH B;  3NEL A;  1SNC A;  3PUV A;  2VUM G;  3K5M A;  3RAQ A;  2UVW A;  3F2D A;  4A3D G;  1KTA A;  3GTM B;  2G5D A;  4O3N A;  4A3B G;  2LXK A;  1II3 A;  4WJ3 M;  3VA5 A;  4A3J B;  1PH4 A;  5ELF A;  1K0S A;  3RIZ A;  4DR2 H;  1X55 A;  1EU3 A;  2QGQ A;  5I9P A;  3GTO B;  1IYD A;  2B29 A;  4DK0 A;  3MXG A;  1B1Z A;  3S2D B;  4L5R C;  3VYR A;  3KK7 A;  5CBE E;  1AFP A;  4B3R H;  1Q1B A;  3GB8 B;  1NNX A;  4XQN A;  3BDC A;  2AUJ D;  2VPQ A;  3WWJ A;  2NZH A;  5K3W A;  3R5F A;  2GN5 A;  4HSV A;  4C5B A;  5DG7 A;  4F8M A;  5BPH A;  5IYD G;  3S1N B;  3M9N B;  2WAC A;  3OSN A;  1PH1 A;  1IBM Q;  3CEB A;  3RB6 A;  2OTL A;  3Q1K A;  4ECX A;  3CC4 A;  3A8I E;  4PZ6 A;  3NUC A;  1EOT A;  3KOJ A;  5CV6 A;  1B50 A;  2VQF H;  2F0J A;  3EQL C;  5JUM A;  5T1I A;  4FFN A;  4MTK A;  1Z9F A;  2HDM A;  3LGJ A;  5KFE A;  1I1M A;  3VR6 A;  1SND A;  2F52 A;  4IOA A;  3MFH A;  2ZTC A;  1BCP C;  3CMA A;  3BQ0 A;  2UUC H;  4J9O A;  4CBV A;  3TIN A;  2NVT B;  4HJA A;  5TSS A;  4FE2 A;  2PQA A;  5JPM C;  2PN1 A;  2YRW A;  1S97 A;  1UE7 A;  3FMC A;  1C48 A;  1JWS D;  1PTO D;  2OCE A;  3F1Z A;  2Q8I B;  4DN4 M;  1RTN A;  2IX1 A;  1LT6 D;  4I4T F;  3PW0 A;  1GJX A;  2D0O A;  2NVQ B;  5KFB A;  1KDC A;  3ITP A;  5H80 A;  4JYA L;  5JJK A;  2R8K A;  1SYD A;  4JI5 Q;  3I4O A;  4JI4 Q;  3SK6 A;  4Y8V B;  1MI2 A;  4Q43 A;  5FR9 A;  1JQY D;  1WRV A;  4I7A A;  3FRP B;  2PYK A;  4C5A A;  2DN8 A;  2E76 C;  3JRW A;  2PMZ B;  4UP9 A;  3KAL A;  3AFP A;  2V59 A;  5EKK A;  4POF A;  3PO2 B;  4L1K A;  4YQW A;  4ULL A;  4I7Z C;  1WI5 A;  1WD0 A;  4KHZ A;  4O3Q A;  4C3H G;  3RFC A;  1RCV D;  3K5O A;  1TWA B;  3IRB A;  2GQS A;  5C4H A;  1SEI A;  5KFZ A;  1DGS A;  4YCV A;  2JA7 A;  4NXN Q;  1DZ1 A;  4QGU A;  4YY3 Q;  1ICW A;  3HOY G;  2UXC L;  2RHQ B;  1HNW Q;  4DL7 A;  1HA5 A;  4IIJ F;  1XMQ Q;  1I6V C;  4JBM A;  5FNV F;  4LF7 Q;  1LTI D;  1H9J A;  4ED8 A;  2YW2 A;  5IYB G;  3LWE A;  1HZB A;  4DR3 Q;  1MSH A;  2JA5 B;  5K36 G;  3U55 A;  3J81 c;  5KFG A;  4KJN A;  2A1H A;  4ZK9 B;  2XWJ B;  3N40 P;  1DD2 A;  2W9B A;  4IUU A;  3I4L A;  3JSN A;  5EWE A;  2JP1 A;  2FPI B;  1PRT F;  3N6R A;  1VBG A;  2CWP A;  3HOU B;  1Z2P X;  4ECW A;  1ZKO A;  3HZX A;  4XXE A;  1N33 Q;  4PMB A;  1HNZ Q;  3CHB D;  1QB5 D;  1DV1 A;  5KKN B;  4A93 G;  4JI6 H;  2VPS A;  1M0T A;  2IBK A;  2R92 G;  1LUZ A;  2J7Z A;  5IGG A;  2PO4 A;  3PW7 A;  4M1U B;  4PMW A;  3ORQ A;  3M4Q A;  2LY7 A;  1QG7 A;  3HKZ E;  3C1E A;  2VQE H;  3T5J A;  1IBK Q;  3RZD H;  1J9O A;  1OXX K;  1C7Y A;  1E4E A;  3J81 L;  3HOV H;  2UUB L;  5E1F A;  2ID0 A;  2NU9 B;  4OHJ A;  3CCJ A;  1DYQ A;  5IYC G;  1TWG H;  2RDF A;  4DR6 L;  2C22 A;  1PTO C;  4DNR B;  2L4N A;  4OX9 L;  1PH2 A;  3S2H H;  2R86 A;  5KG6 A;  5EKL A;  4B3M L;  1GKH A;  4JI8 L;  3MFY A;  1WCM H;  2JA6 B;  2JK8 A;  1JB7 A;  2I80 A;  1PH9 A;  1CHQ D;  4DU9 A;  1YNN D;  4IUN A;  4RGN A;  3A7L A;  3MEF A;  1F9R A;  5CV4 A;  4LFA Q;  1J5E H;  2Z4I A;  4BBS G;  3MXN A;  1QOH A;  2V4Q A;  3NP8 A;  3GTK B;  4ALP A;  5HBR B;  4O4I F;  1QVF A;  2UXB Q;  1AE2 A;  1C9O A;  5KX5 F;  2BCO A;  1I4Q A;  5C0X I;  3KJO A;  3K58 A;  4IHJ F;  3SGI A;  5JJL A;  1A3T A;  2EJF C;  2Z6K A;  3V6J A;  2NZ1 D;  4RB3 C;  5KEE A;  3T56 B;  1D1I A;  2NVY A;  3HRZ C;  3T5H A;  2CVR A;  3HOZ B;  1Z7T A;  3NBZ B;  4NMZ A;  5BN4 A;  5ELN A;  1MKH A;  1IW7 D;  1B3Q A;  2ZJR A;  4A3M H;  1B2T A;  5LA6 F;  3WO1 A;  2P5Z X;  4LF6 L;  2R93 G;  4CJ0 B;  1KLU D;  5C4J B;  2MPM A;  3K3V A;  4A3C H;  4R7R A;  1D6E C;  4HCS A;  3NTK A;  4A3E B;  4DV3 Q;  1L0Y B;  3KBG A;  3M9B A;  2L1B A;  2KCC A;  1SNQ A;  4DK6 C;  3GIJ A;  4EGQ A;  2ABJ A;  5JVH 3;  1MJC A;  1I7N A;  5C8Y F;  1VF5 C;  5I6Y A;  2MO0 A;  4R8U B;  4A3G H;  4P73 A;  2X5R A;  3HOW H;  2K28 A;  4RH6 A;  3EYY A;  4RG1 A;  4BY7 G;  3OHA A;  3GTM A;  1X3Q A;  4BWG B;  2AQ2 B;  5KFP A;  4DUY Q;  2KEE A;  1AZP A;  4G7O C;  1FD7 D;  5C3E G;  1WTO A;  2E2H H;  3C1F A;  4FYD A;  4XYM B;  2Y0S B;  3GTO A;  4KY7 A;  1EKF A;  3D4R A;  1ML0 D;  3LP8 A;  3T53 B;  1GOZ A;  2VOB A;  4DV0 H;  3T1Y L;  1RIP A;  3R93 A;  4UCR A;  3OHB A;  2UUA Q;  1NTG A;  1N32 H;  5A2Q L;  1PX2 A;  4RKL A;  4JBK A;  1B7Y B;  3J80 W;  3JSL A;  1VQD A;  4AQY Q;  5DAA A;  2F4V H;  5GAH C;  4DL3 A;  3VYT A;  3KUP A;  2J9G A;  1VMP A;  1EQT A;  1S3O A;  3OTO H;  3Q6S A;  4HMI A;  2N78 A;  2K14 A;  1VQI A;  3GIQ A;  1FJG Q;  4DIM A;  1Y8O B;  2KED A;  1PYB A;  2HQE A;  2NWG A;  3CQZ H;  4KY5 A;  5J2T F;  5IWA Q;  1PA6 A;  1P8L A;  4MV8 A;  4L8J A;  1NY4 A;  3S17 H;  3UE0 A;  2QEJ C;  2M00 A;  4K8I A;  5AFW A;  5JQG F;  5M9O A;  2JA8 B;  4K6L A;  3Q23 A;  1E24 A;  5I60 A;  4JI1 Q;  4L6T B;  5NUC A;  5CV7 A;  3A54 A;  1SXT A;  2QW7 A;  4IOC A;  3HG9 A;  3PUZ A;  1U5K A;  1V1P B;  4JI2 Q;  1IL2 A;  1IBL H;  4UCT A;  4GC7 A;  3OSP A;  1BBW A;  4DR2 L;  2O5I C;  1O80 A;  4IUQ A;  4YWL A;  2YL2 A;  2V4R A;  1GHJ A;  4GS3 A;  2W6O A;  3JAM W;  1ESF A;  4B3R L;  5FLX c;  3QO2 A;  4F4Y A;  1BXR A;  3MFG A;  4BXX G;  1U4R A;  2KJX A;  5ELB A;  5M3M G;  1CT1 D;  2F0P A;  3E5S A;  3CAM A;  1KC8 C;  2WKC A;  5CMD A;  4TQU S;  1XPO A;  3EJI A;  1EQV A;  1KJI A;  1A63 A;  4EBD A;  1OBG A;  3HS0 C;  4PMC A;  3ZYY X;  2CQO A;  2XGT A;  1HFN A;  2RDI A;  1JJG A;  2NUA B;  4IAL A;  4RFB A;  1O7I A;  1JDE A;  3AFQ A;  1IYU A;  1EZ1 A;  4POG A;  2NVX B;  4K6D A;  2F0Q A;  3BAA A;  1JWM D;  1G6P A;  1YHA A;  2VQF L;  3SI8 A;  1KJQ A;  3T9F A;  4XQQ A;  3GIP A;  1JIH A;  1Y1V H;  2ICE C;  2NU8 B;  5FLX L;  4H13 C;  1TWA A;  1CKM A;  4UCV A;  4DR7 H;  4KK7 A;  1IL8 A;  4DV1 Q;  4O7Y A;  1PH5 A;  1BR9 A;  2UUC L;  3DWP A;  1OTC A;  4PV1 C;  2VQD A;  5KFI A;  3Q0A A;  3H94 A;  4FXD A;  2YZG A;  4UP8 A;  2ALZ A;  1BUV T;  4CC6 A;  1R9T H;  1FR3 A;  2W9C B;  1CKO A;  4HR7 A;  1G6Z A;  2K05 A;  1Q12 A;  2F0G A;  2LFN A;  4K5V A;  1WTV A;  1A15 A;  2X69 A;  5BWW A;  4K0K Q;  4L5S A;  3CCS A;  3TS0 A;  2QB5 A;  5LMN L;  1Q8I A;  4MN3 A;  1GSA A;  3U54 A;  3GV5 B;  3N42 B;  1YI2 A;  1WOC A;  1RJR A;  5KT3 A;  1LO5 D;  4JUZ A;  5GRO A;  4O3P A;  3W5O A;  3PR5 B;  1EYD A;  3EFX D;  4LF5 L;  1S5F D;  5LMU Q;  3RB4 A;  5C3X A;  1Q7Y C;  2JJQ A;  3MWY W;  4RZR A;  3EA6 A;  4DXG A;  3S15 H;  4BY1 B;  2R7Z H;  4DV6 Q;  2ENB A;  3Q8D A;  1W2B A;  1HJP A;  3HGB A;  1I94 H;  1HZ9 A;  4BBR B;  2ZM6 H;  1D2B A;  4JV1 A;  3TRE A;  4IR9 A;  4YWK A;  1PH7 A;  4A3D B;  1ET9 A;  2Y4R A;  4OL7 A;  4TSS A;  4OWX B;  5CBA E;  3GTQ H;  4X62 Q;  4YWM A;  3I3C A;  4A3M G;  4FFP A;  1BOS A;  3E3X A;  5CV8 A;  1UAP A;  4AYB B;  2XRS D;  3PO3 G;  4FBT A;  4C2M A;  1F9Q A;  3OUZ A;  3M3Y H;  2WAQ E;  2AGQ A;  1J8I A;  2F4I A;  1FNU A;  2JA6 A;  3IL8 A;  3S1R H;  4O83 A;  4J8Q A;  2RVL A;  4J9K A;  4GLX A;  5KFS A;  1DON A;  1EIH A;  1EY8 A;  1DAA A;  4QWD A;  2E5L H;  2PNR C;  4DNI A;  3T9C A;  1SRU A;  4DPG A;  2B63 H;  3GTK A;  2K04 A;  3L0O A;  1T5E A;  3HOW G;  3TRZ A;  4YR0 A;  5FOB B;  2PVP A;  3T5L A;  5FO7 B;  3HKZ G;  2IW3 A;  2Q8T A;  4DV2 Q;  4X66 Q;  2Z9H A;  3J81 E;  1F2L A;  4NW2 A;  4JYA H;  5CB4 F;  5C44 H;  4JI6 L;  1EY4 A;  4V0B A;  4EBC A;  2CQA A;  3BG5 A;  3PQI A;  3ULP A;  2RGV A;  1A3G A;  3Q8Q B;  3FKI H;  3R2T A;  3QR8 A;  3E5N A;  1VQM A;  1F77 A;  5EGT A;  2K5N A;  5C4X H;  3EVQ A;  4Q44 A;  1SRO A;  3I2Z A;  1V8Q A;  1JXL A;  2OF1 A;  3CPF A;  1N56 A;  1TS4 A;  4ECT A;  2A74 C;  2RKS A;  4OGQ C;  4O2A F;  4JI3 Q;  4YCW A;  2CNQ A;  3TQY A;  2EYH A;  2MHV A;  1EWC A;  1XMO L;  4ZKB B;  1S72 A;  4U6P A;  3PW2 A;  1I50 H;  2PZU A;  4TQR A;  3VR2 A;  4JI7 Q;  4EFB A;  2EJG C;  3CCU A;  1YJN A;  4LAA A;  1X6O A;  1S5E D;  3VR5 A;  1EOV A;  1A0G A;  3CKI B;  1OXT A;  5DLG A;  1KJ8 A;  1A62 A;  1F2Y A;  5BR8 Q;  4H44 C;  1I3Q B;  3QIA A;  1XNR L;  1M7J A;  1HR0 W;  1VF7 A;  2F0F A;  5HGQ A;  5KFT A;  4YR2 A;  4JV0 A;  2Y0S A;  3G6V A;  2FJ2 A;  2SNM A;  1LT4 D;  4DFA A;  4UCU A;  3OW7 A;  4ED3 A;  2IY5 B;  5M3F G;  5DQG A;  4Y52 H;  4TQS A;  4YBZ B;  4CHI A;  1EKP A;  3UFX B;  1JKJ B;  4DAY A;  2B2W A;  1XWE A;  2KQ3 A;  4O7Z A;  1KC7 A;  2B2W C;  4LF9 H;  5M5X H;  2B2T A;  4RKB A;  4GKJ Q;  4Q0Y A;  2B2T C;  3T1H H;  3NXW A;  4KKT A;  2NN6 G;  2DUD A;  1KTK A;  2MQH A;  1SAP A;  3HOY B;  3TP7 A;  5IOC A;  1XNQ H;  4LF4 Q;  4P71 A;  5AJ3 L;  1CE8 A;  4X3K A;  2UVU A;  3AYH B;  4RNM A;  1QZG A;  4BWS C;  2EYP A;  2VXW A;  4J9P A;  3L7Z C;  1QJO A;  1SE8 A;  3QWN A;  2W6Z A;  1BCP F;  2F0V A;  2E8G A;  3SHL A;  1H9R A;  2OLS A;  2JA7 B;  3H20 A;  1Q86 C;  4LH7 A;  2A19 A;  3VPC A;  4OX9 H;  1ZXT A;  4HN2 A;  1O7L A;  3MTS A;  5A2Q E;  3N6X A;  1D5X C;  4R8N A;  2M2L A;  1KAA A;  4WJW A;  2GPW A;  2YRX A;  4PZ7 A;  1AP0 A;  2A69 C;  4QB4 A;  4EGV A;  1S5C D;  3K59 A;  1XYI A;  2HJW A;  4A93 B;  1PXU A;  2WB1 E;  4XYQ A;  4IAJ A;  3TEH B;  1B04 A;  3K81 C;  1EZ6 A;  5IOD A;  4DV0 L;  1MJE A;  3TY5 A;  3UDI A;  5CA1 F;  1EWH A;  3TME A;  2W9B B;  3GQB A;  3PFF A;  3UDF A;  3HOX B;  1B9M A;  2A6E C;  1Y1W G;  2F4V L;  3PUX A;  1S4Z A;  2UXD Q;  2XVS A;  2UU9 H;  4OO1 I;  4HQ6 A;  3B6Y A;  2W6Q A;  4GZY C;  1K8G A;  1BVS A;  1I2L A;  5DG8 A;  2GPS A;  3PVX A;  3OTO L;  4JK1 C;  1GUO A;  2EXD A;  2D2C C;  4GKK H;  2RDH A;  1PH6 A;  1BBX C;  3UZB A;  4F50 A;  5C1O A;  4MHE A;  2JQO A;  5M5W H;  5IP9 H;  1GUT A;  4CDE C;  1EIF A;  2VB2 X;  4TKO B;  3I12 A;  2PCF B;  5E25 A;  1B9N A;  3E0J A;  2NZO A;  4N9P A;  5EKI A;  2M05 A;  5F9N A;  4A3I H;  5HNE A;  4P75 A;  4DUZ Q;  3K8A A;  3S14 B;  3NEM A;  1JOO A;  4YR3 A;  1Z2N X;  4LMY A;  1AN8 A;  4DV5 Q;  3G6Y A;  3FPU B;  1HR0 H;  1MGS A;  3UDX A;  2DLN A;  3FVQ A;  1X3P A;  1SLJ A;  4HSP A;  4XT3 B;  1S0O A;  1PLF A;  4NZM A;  4LFB H;  2VQE Q;  3KTM A;  4HJ9 A;  1ILP A;  2JE6 I;  4GLV B;  3RLO A;  1IBL L;  3MXN B;  2XCP A;  1PH8 A;  1VAJ A;  5I9O A;  1VKZ A;  3R8B A;  3Q8R B;  4A3K G;  2KCN A;  1KAW A;  5IYZ F;  2ZTD A;  3KAJ A;  4XYL B;  1K73 C;  1Z47 A;  2RF4 A;  1SYE A;  2KBN A;  4ME3 A;  4QUF A;  5IGD A;  4TVA B;  1DV2 A;  1GLV A;  4X3U A;  1FL0 A;  5DGI A;  5ELE A;  3MA2 B;  2R93 B;  4C1N K;  5T14 A;  4GOP B;  3WWI A;  4EEY A;  4IZ8 A;  3T1Y H;  2XIW A;  4A75 A;  2B63 G;  1I4H A;  2YU9 H;  1LLR D;  2FP4 B;  4JI4 L;  2CKZ B;  3STB D;  3ULL A;  5FLX E;  1U4M A;  4A3F G;  4K5X A;  3I4N G;  2C2D A;  5D3D A;  5DM7 3;  5FJ8 H;  2DNC A;  1UEA B;  3ONA B;  4A4I A;  3RN2 A;  1RYR A;  2BH2 A;  3D0F A;  3ND8 A;  4Q4C A;  1O78 A;  1BO0 A;  4ECU A;  1ROD A;  4C3J G;  1M90 C;  2VUM A;  5IGF A;  3GTP H;  3LQS A;  3U9O A;  4BY7 B;  2VA3 A;  2AQ4 A;  1LTS D;  2VB3 X;  1PV4 A;  1GXD C;  2IJ0 A;  3GDE A;  4M8A A;  3UDG A;  1SFO B;  4L63 B;  3I90 A;  1LTT D;  4DR7 L;  5C3E B;  4FS1 A;  2HHH H;  1N8R C;  5C4X G;  2ES2 A;  4EG0 A;  3UQ8 A;  4DLK A;  2JSO A;  2EY1 A;  2PW7 A;  5EQ0 A;  2OWO A;  3A56 A;  4JV5 H;  1D7Q A;  4X65 H;  1VS0 A;  1VQF A;  3I91 A;  1V4Y A;  3NQT A;  4UHV A;  5EAY A;  1MIU A;  3ORR A;  1F2Z A;  2FB9 A;  3BZC A;  3CME A;  2NU7 B;  2I0Q A;  4MV4 A;  1PFB A;  5BWV A;  4NZN A;  2OQK A;  4IJH A;  3LUL A;  4N8F A;  1D8L A;  1V1O A;  2E2J B;  1EY9 A;  3RN5 A;  1E2W A;  3R23 A;  3GIM A;  3JAM c;  2BA0 A;  2YS7 A;  5CC4 A;  3SNO A;  3LWU A;  1LTR D;  2C5C A;  1PTO H;  5C0X H;  1A48 A;  2AQ3 B;  2XGQ A;  2CNU A;  4RB1 A;  2N3S A;  5L1K A;  2YTX A;  5J3B A;  2VY3 A;  2EIF A;  1I94 L;  2EXZ A;  2ZM6 L;  2EYF A;  2WAQ G;  1BNC A;  3V4S A;  4FVM A;  1HFG A;  1IKL A;  5GAG C;  1QE6 A;  1YHQ A;  4NDX A;  5DLQ E;  1N34 H;  3U4Z A;  4AIM A;  5LL6 X;  4LMQ D;  1TXY A;  4Y7N B;  3D6W A;  4LFC Q;  3DTG A;  1EY0 A;  2F3W A;  4E4T A;  1WH2 A;  1FKA H;  4RGT A;  2VR1 A;  4HYK A;  2K4K A;  3GD7 A;  4C3I H;  3CRL C;  2XRQ D;  3JAM L;  1NR4 A;  2NVY H;  4R4I A;  2KUM A;  1HZC A;  5M3M B;  4O42 A;  1HNX Q;  2YS6 A;  3H0G H;  3CC7 A;  4M0J A;  2X6L A;  4YJ3 F;  1SE4 A;  4IO9 A;  2XD4 A;  4A2A A;  2EYO A;  4DV7 Q;  2E5L L;  2FMM A;  1I3Q A;  5I2Y A;  4RUC A;  2FK2 A;  4KKS A;  2COG A;  4TUY F;  3STB C;  1B6S A;  2YYA A;  1JE4 A;  4LH6 A;  2DAA A;  3GTL H;  2FLP A;  3HT5 A;  3RBD A;  3ERS X;  3G6J B;  4EEQ A;  5LMN H;  1D5Z C;  4RGO S;  3TEK A;  1M0W A;  1E1O A;  3TY9 A;  5CR3 A;  3FHW A;  1HTP A;  2LXJ A;  5DGB A;  4LF5 H;  5CA0 F;  2DY8 A;  2AUK A;  4C1N I;  1HUN A;  4RHR A;  2E2I H;  1G2S A;  2ZDG A;  4ED2 A;  3BQ1 A;  1PFN A;  4YHH Q;  1TWH H;  1WFQ A;  1S10 A;  1Q82 C;  1LTG D;  4UDU C;  3T4A C;  1KNA A;  1YNJ C;  3TZU A;  5F9L A;  2R6F A;  4LSX A;  3L4K A;  3GTM H;  2B2Y A;  2C35 B;  1HRJ A;  1VBH A;  5HGT A;  2AU0 A;  2EOT A;  2B2Y C;  3RBE A;  1L2F A;  1PZJ D;  5FD6 A;  4A3J H;  3PIO A;  2W6N A;  3D4W A;  1KDB A;  1N36 H;  2PMZ E;  3GTO H;  4MV6 A;  3CVZ A;  3LNN A;  1UNS A;  3CPW A;  4JI0 L;  3O13 A;  5EBC A;  4FU0 A;  1TVX A;  3AQQ A;  1T3N A;  5K5P A;  2X6G A;  3S2D H;  1HPC A;  1CQV A;  3RD4 A;  1HHV A;  4MV1 A;  5LXT F;  4Q8E A;  1K8A C;  4DF7 A;  4TV9 F;  3SE0 A;  3QG1 A;  4DR4 H;  4LUO A;  2A68 D;  3GTG B;  4O3S A;  4HR7 B;  3Q8P B;  5COR A;  1TWC A;  2L5T A;  3FDS A;  4O0A A;  1K3B C;  2QKI C;  3J7Z C;  3S1N H;  2RHS B;  4DR5 Q;  4QWC A;  2R92 A;  2EDG A;  1KAB A;  3MZ5 A;  4FXK C;  2B8F A;  1JB3 A;  4IQZ A;  1GUG A;  1BDO A;  1X54 A;  3AX6 A;  1LYL A;  4MV9 A;  1M8A A;  5DIS C;  3BVZ A;  2M9V A;  3SR1 A;  4LF9 L;  4B3T Q;  2Z0S A;  1ET0 A;  2D9U A;  3K7A B;  4IUV A;  3I4M G;  3PO3 B;  1ICF B;  1NCV A;  3T1H L;  2QA4 A;  2H4O A;  5CYU A;  4NXM H;  3M9M B;  1YIT A;  4LF8 H;  1VQ9 A;  3SXH A;  1D1K A;  1I4X A;  1XNQ L;  2EJM A;  5DLF A;  2EYJ A;  4CC5 A;  2BR0 A;  2NVT H;  3GTJ A;  1FJG L;  3MVV A;  2D0P A;  2RSO A;  1K1S A;  2TSS A;  2KCT A;  4XTC S;  4RZQ A;  2R8G A;  1XTD A;  2WB1 G;  1V43 A;  3T13 A;  5J1Z A;  1IOV A;  3DUZ A;  4C2M B;  1LM0 A;  1K28 A;  2NVQ H;  4RNN A;  1XMO H;  3ERQ A;  3HKZ B;  4K2L A;  1SN8 A;  1JX4 A;  4B3S H;  2OQ0 A;  4RA8 A;  3J81 i;  5KFD A;  3U58 A;  4YAK B;  4HIM A;  5C0X J;  3H40 A;  4JV2 A;  2JA9 A;  3KDF A;  2ATW A;  2DIK A;  3E0E A;  5EPJ A;  3ETH A;  2C00 A;  1LAB A;  1Y14 B;  3PF4 A;  2CWA A;  4UUG A;  1ENF A;  2ZJQ A;  4RB2 C;  2AKW B;  3C3L A;  3F2C A;  1S5D D;  3NBY B;  1XNR H;  1I1K A;  5KS8 A;  1OWT A;  5LP6 F;  5KFY A;  2R93 A;  3PO2 H;  4GOP A;  2UU9 L;  2W6M A;  4GOP C;  3NTH A;  2Z6K C;  2G9D A;  1EYZ A;  2KEN A;  4IPD A;  1EY5 A;  4LNQ A;  4RAZ A;  3H3V C;  3HFZ B;  4FGR A;  1TWA H;  5KG4 A;  3WWH A;  4HNT A;  4GKK L;  3URY A;  1ZHQ A;  4P74 A;  5E7N A;  3VOT A;  1EU4 A;  1VMC A;  2JEA I;  3M4I A;  1S03 G;  2PQE A;  1H9S A;  4ID6 A;  3PZP A;  2F0L A;  2F0K A;  4I50 F;  4OWW B;  4CJ1 B;  3N43 B;  1EL0 A;  3NBI A;  2EIY A;  1I4P A;  2E2D C;  5C5L A;  3MEH A;  1KRS A;  4FO2 A;  2V58 A;  2A68 C;  3KHG A;  3H3V I;  1SFO A;  2JA5 H;  1RTO A;  4Q4D A;  4O84 A;  1HR0 L;  5KT6 A;  2Z1C A;  3KHH A;  3JC6 6;  4A2B A;  1I2K A;  2R8J A;  1NMF A;  2HQL A;  2L0C A;  2DAB A;  5M3F B;  3HOU H;  4LFB L;  2HVQ A;  3SK5 A;  1VQ4 A;  3GV7 B;  1CTM A;  1IYJ B;  3P20 A;  5HY6 A;  5CE8 A;  3DLL A;  3UYY A;  2QYZ A;  3PN1 A;  4BS9 A;  3PIP A;  4DL5 A;  3E6Z X;  5BN3 A;  2R85 A;  4RAU C;  3PF5 A;  1ZEQ X;  4DK1 A;  1IYE A;  4MV7 A;  4DXF A;  4QL5 A;  3T51 B;  3R9R A;  5KFM A;  3TY8 A;  3VPD A;  2B8G A;  1TY0 A;  2W7P A;  2HIX A;  3MWM A;  4IZO A;  1DM0 B;  1AEX A;  5IP7 H;  4DAY B;  4GN3 B;  1QWY A;  2UXC Q;  3V6K A;  3T9D A;  2PBZ A;  3HBL A;  1TWF B;  4XDX A;  3UZO A;  5M5Y B;  3RZO B;  5KFJ A;  4DV6 L;  2OXP A;  3AW8 A;  2WKD A;  2WV6 D;  2V5A A;  4H7B A;  2JA6 H;  3LML A;  3ULJ A;  3NTI A;  1ZYR D;  5KFK A;  1K9M C;  1CS0 A;  2ZJP A;  4KTA A;  4OIK A;  3TP5 A;  5FPO A;  3GTK H;  2HHH L;  1AH9 A;  4J9S A;  2QK4 A;  1WYD A;  1PH3 A;  2FJZ A;  4JV5 L;  3K80 C;  4XZ3 B;  4X65 L;  2BDN A;  2KVM A;  1GUW A;  3TW7 A;  3HOZ H;  4A3J G;  1Y1W B;  1SE2 A;  1A2U A;  1N9W A;  3CCM A;  3BDO A;  4MIU A;  4ZHQ F;  3UE1 A;  1G91 A;  3DEP A;  4O7W A;  1HXY D;  1MD2 D;  4NB3 A;  1XPR A;  3BZD B;  1A0I A;  2UUB Q;  3S16 B;  4DR1 Q;  5KG1 A;  2B39 A;  2B2V A;  3OYY A;  4KD4 A;  4J9L A;  1GSO A;  4DR6 Q;  2L55 A;  5C4J H;  3WO0 A;  2VNU D;  4ZOL F;  4R4T A;  4B3M Q;  4A3E H;  1KD1 C;  4JI8 Q;  4XT1 B;  3RR5 A;  1G29 1;  2D62 A;  1EFW A;  1OO9 B;  1XDN A;  3IKJ A;  3DWQ A;  1JOR A;  3L3O C;  3BQ2 A;  4JI4 H;  5IE8 A;  3DHQ A;  3JAM E;  1WTP A;  2HVS A;  4IFD H;  1N34 L;  1P16 A;  3KAK A;  3PSI A;  1GYF A;  4J9R A;  2A1A A;  5BMV F;  5C5M A;  2V9W A;  3L2P A;  1L0X B;  3NUA A;  2BQU A;  1TWG A;  1M6V A;  1B70 B;  3TDQ A;  1EIG A;  4K8J A;  4FDB A;  2CZG A;  3K5I A;  5J2U F;  4JI3 L;  3DEO A;  4A3K B;  3DAA A;  1VQE A;  2JN4 A;  3KLR A;  5BPF A;  4GC6 A;  2ASL A;  1JT8 A;  3AMU A;  1CKN A;  4KN7 C;  3GII A;  2BQR A;  1WJJ A;  3RAX A;  3KFU A;  3HOV G;  2CW0 C;  4NXN H;  1L0W A;  4KHP L;  4RMF A;  1KIX A;  4YY3 H;  1ILQ A;  1EY7 A;  4KJO A;  1KRT A;  4LF6 Q;  3TIG A;  3NE5 B;  1STY A;  3GTG A;  4XQJ A;  3Q8S B;  1HNW H;  4A3F B;  1X3F A;  2ZXO A;  4HIO A;  3SDZ A;  3I4N B;  3K57 A;  1XMQ H;  3K6O A;  3MHB A;  1WCM G;  3PUW A;  2KA7 A;  4LF7 H;  1A3V A;  1FVI A;  2IPK D;  5IGC A;  3PIO 3;  5EPK A;  5IT9 W;  4DR3 H;  1HCZ A;  3TS2 A;  4RHS A;  4C3J B;  1ZQ7 A;  5BWR A;  3VYS A;  2EYL A;  5KGU A;  1ZYR C;  4CMF A;  3KF8 B;  1SNP A;  4ED0 A;  4A3L H;  2YZM A;  2I5M X;  3PW4 A;  3S1Q B;  4TVI A;  4N9T A;  1N33 H;  1MSG A;  1HNZ H;  5K2M A;  2LSS A;  2F0W A;  3CCV A;  4GKJ L;  4O7N A;  2YTY A;  4X3T A;  2WII B;  2JA8 H;  3T54 A;  1UE5 A;  5BYA A;  1KNE A;  1JIC A;  3A8J E;  5DNF A;  4OO1 H;  4ECV A;  4O7T A;  1ZHS A;  1WD1 A;  5DG9 A;  2VUM B;  1TY2 A;  4G3I A;  3NC0 B;  3OUU A;  3T1Y Q;  2ZXP A;  2HDK A;  5KRU A;  1IBK H;  1N36 L;  5IGE A;  5KT4 A;  1B4O A;  4A3B B;  1VQ5 A;  1CA6 A;  1K83 B;  3PV0 A;  1UE1 A;  2VUG A;  1KEE A;  3RMH A;  4NZO A;  2K6A A;  1GSH A;  5FLM H;  4ZQI A;  2HGW A;  3HKZ A;  1HA6 A;  1IHZ A;  5KFQ A;  4A3C G;  3ERO A;  2DJG C;  2BH8 A;  4AYB E;  4DR4 L;  2LS0 1;  2FIN B;  5ISR A;  2JA5 G;  5KYI A;  3H4B A;  3MWE A;  2E2H A;  3L9A X;  4O3R A;  3BAB A;  3IN5 A;  4LFA H;  2DZD A;  2F03 A;  4IUR A;  3PGZ A;  5LOV F;  3HOU G;  3ND9 A;  3KJP A;  5BN5 A;  4A3G G;  3KYH C;  3MXP A;  2RSN A;  1LV9 A;  3K3P A;  2NVX H;  2UXB H;  2A6H C;  4HTH A;  2CW7 A;  5JJZ A;  3VR3 A;  4HJ7 A;  4TM5 A;  3K0Y A;  2A69 D;  3KHR A;  1E22 A;  3AU7 A;  3IG0 A;  1Q90 A;  3DTF A;  3M7N A;  4MTE A;  4NXM L;  1F2M A;  4LF8 L;  2W70 A;  4ZUJ A;  1F9P A;  3J81 W;  5D1O A;  4M9U A;  1EEF D;  2BE5 D;  1WVL A;  4B9W A;  4DR2 Q;  4CGY B;  1CK1 A;  1QNK A;  2F0D A;  4ILW A;  4FFL A;  3CQZ A;  1SR3 A;  2A6E D;  2GA4 B;  4QW8 A;  1K0R A;  5JVD F;  2PPB C;  4B3R Q;  4HNV A;  4UPA A;  1BF4 A;  3FDT A;  5I5U A;  2HUG A;  3S1M B;  2R7D A;  1DOM A;  1UUP A;  2HDL A;  4DUZ L;  3D8G A;  2QDB A;  3BJY A;  1ZAU A;  1KHI A;  4CDD C;  3QJY A;  1CHP D;  3U0G A;  3A5Z B;  4DV3 H;  3A5U A;  2R82 A;  2C28 A;  1UEB A;  3U50 C;  4B3S L;  4JI0 H;  2CHB D;  3GV8 B;  2Q2H A;  4DV4 L;  5DQH A;  3PUY A;  3KF6 B;  5KG3 A;  1ZET A;  1U9R A;  3HEJ A;  3NBH A;  2EQS A;  4X3S A;  3SK4 A;  4ABN A;  1I6U A;  1KQS A;  5KFX A;  2I07 B;  1S9F A;  4BY1 H;  4E6N A;  2ALY B;  2VQF Q;  3F2U A;  4IFD J;  1I6H B;  1IZ6 A;  5KG7 A;  1VQP A;  4BBR H;  3OHX C;  3V2T A;  4DUY H;  4EQO A;  4QMG A;  1Z2O X;  4ZUI A;  3RLN A;  1RHP A;  1GUN A;  1JJ2 A;  3TP8 A;  1G8Z D;  4A3D H;  4MA5 A;  3P1H A;  2D5D A;  1CZW A;  2R87 A;  1EZ8 A;  5EJW A;  4IFD I;  5DGH A;  1YJW A;  2UUC Q;  5I2X A;  2UUA H;  3GIK A;  2GVB A;  4C3H B;  1LT5 D;  3CF5 A;  4GNX A;  1TWF A;  1W3S A;  5KFN A;  3M4O B;  4AQY H;  4GNX C;  4X64 L;  1RJP A;  4EBE A;  2JEF A;  2EJ2 A;  1W6K A;  5ELD A;  3R2I A;  1JLL B;  5KFL A;  3QQM A;  3PIP 3;  4WHX A;  2JEI A;  3T9B A;  2NN6 I;  3W1G A;  4O7S A;  2RDJ A;  5KG0 A;  4IPH A;  4R4C A;  4U67 3;  2AGP A;  1E3P A;  2L15 A;  2EVB A;  5LMN Q;  5DGA A;  1BQQ T;  3PMF A;  1XPU A;  3PR4 A;  5E4W C;  2YZL A;  4MTN A;  3V4Z A;  4EFE A;  5DQI A;  2W7O A;  1FJG H;  1YZ6 A;  3J7Y W;  4U68 A;  3NHH A;  4LF5 Q;  1EY6 A;  1SSO A;  5IWA H;  2BQ3 A;  1Q46 A;  5G3L D;  4IPG A;  1JWU D;  4ME5 A;  2F0H A;  3IFT A;  1TKW B;  1W96 A;  1FNV A;  4APV A;  2J6S A;  2K33 A;  5C4Z A;  3TII A;  2DGY A;  2L12 A;  3I72 A;  1Y1W A;  2XC9 A;  1Y1V G;  2P0A A;  4DKA C;  1B33 N;  4CJ2 C;  3I4M B;  4JI1 H;  1CSP A;  1PYS B;  1TWC B;  3BYY B;  2MNA A;  1VQ6 A;  1JDB B;  5A2Q W;  2R92 B;  2SCU B;  5KNB A;  2VA2 A;  4O3O A;  2CW8 A;  1Q3L A;  4IUT A;  5EZY F;  2Z4H A;  1JE5 A;  3MR5 A;  2SEB D;  1QVC A;  2BE5 C;  3GQC A;  1DOK A;  2GLT A;  1OXU A;  4KD3 A;  4R9W A;  4HED A;  3RUZ A;  5KFF A;  4FFM A;  2WB1 B;  4F4Z A;  1RK5 A;  4UCS A;  4YCU A;  1VQK A;  3GID A;  4UY8 C;  5JOB A;  4NPS A;  1Q81 C;  1ET6 A;  2ZGI A;  3M4Y A;  3GTQ A;  4LUZ A;  2F0M A;  1XJV A;  1X65 A;  1VQG A;  1IBM L;  2HGX A;  3GTJ B;  2CNV A;  5KG2 A;  1I3Q H;  2XGP A;  2R7Z G;  1AN7 A;  1SYG A;  4BBS B;  4MA0 A;  2E75 C;  2JA8 G;  1TS2 A;  5I5S A;  3A8K E;  4RGM A;  1E2V A;  2I5H A;  4OO1 G;  1STN A;  1KJJ A;  4JI6 Q;  3HO8 A;  4Q5V A;  5L1I A;  1F9S A;  5F2D A;  1RJT A;  1V51 A;  1SCU B;  1B8A A;  4DV1 H;  2I8C A;  1CM9 A;  5ELO A;  3MC0 B;  2B63 A;  3KDF B;  1EFI D;  2N55 A;  5A35 A;  2L11 A;  1KL9 A;  4MV3 A;  4PBC A;  1LT3 D;  4RCO A;  2JYO A;  3H91 A;  5FKA C;  2RA4 A;  4CKC A;  2Z8L A;  3CW2 C;  3HOY H;  1YEZ A;  4ZI7 F;  3RGZ A;  3QZ8 A;  4K0K H;  5GON F;  3BU2 A;  5KND A;  3CSW A;  4KHV A;  3KF8 A;  4QIW E;  2ASD A;  4HAE A;  3AEV A;  5IYB H;  2R7N A;  1UNN C;  1J5E Q;  4P2C B;  4JI5 L;  2RGR A;  3FKI A;  3A7A B;  4ZAI A;  2KHI A;  2JA7 H;  1B53 A;  5LMU H;  3W1B A;  4J6H A;  3J80 c;  1H9S B;  3SE7 A;  4QF4 A;  4DV6 H;  5FLX W;  5HV6 A;  5C44 G;  2K5W A;  4YHH L;  1GM5 A;  3BAC A;  3FMA A;  4U7C A;  3PW5 A;  4BA1 I;  1DXM A;  1SMX A;  4A93 H;  4O4H F;  2QF7 A;  4CKB A;  1PTO F;  2Q2T A;  1E7Z A;  1I50 A;  3FKI G;  1KUT A;  1K83 A;  4Q0F A;  4KKU A;  4X62 H;  2RDG A;  2COJ A;  5KFC A;  1ONL A;  4NXN L;  1YNJ D;  3HOX H;  3VNN A;  3WDN A;  4YY3 L;  2OEO A;  2R7F A;  5JPN C;  3HXL A;  1HNW L;  2HCI A;  3J80 L;  3CCL A;  5AJ3 Q;  1X32 A;  2FK1 A;  3EPI A;  1XMQ L;  1JOK A;  4LF7 L;  2R8H A;  2F3I A;  5D8D A;  3D6C A;  1VQB A;  3OIP A;  2WAQ A;  1U4L A;  4DR3 L;  3C0F B;  1JC7 A;  5KG5 A;  2C9O A;  3F8N A;  3C46 A;  4MAM A;  3J80 i;  4WD3 A;  2HCC A;  3DWA A;  3ETJ A;  1XX8 A;  2RCN A;  1NJI C;  4G57 A;  4KV6 A;  1VQ7 A;  4TRD A;  4DV2 H;  4FM9 A;  4BBR G;  4PG3 A;  1N33 L;  1NR2 A;  3S14 H;  2KHJ A;  1HNZ L;  2I5L X;  3JZI A;  2R84 A;  2QIL A;  2FXQ A;  5KFH A;  4DAV A;  1Y8P B;  3FEW X;  5DEH A;  4DNT B;  4X6A H;  4O7L A;  5I5T A;  1TS5 A;  3MR3 A;  3V6H A;  1AE3 A;  1PDQ A;  4AYB G;  1NMG A;  4DV0 Q;  4AH6 A;  1TR5 A;  1C0A A;  1N32 Q;  1WR2 A;  2H1E A;  1IBK L;  3BA8 A;  1NAP A;  5FPR A;  1EHI A;  5DMX A;  3GO5 A;  4WJ4 A;  2F4V Q;  1JR0 D;  2NTS A;  4R1J A;  3MAQ A;  2HD3 A;  1G2T A;  4JI3 H;  3JRX A;  3BYT B;  4HJ8 A;  2R93 H;  3TZD A;  1YNX A;  1AW7 A;  1QVG A;  1CUK A;  3DXJ C;  3OTO Q;  1PMR A;  3RLF A;  2YTV A;  4YAJ B;  3H3V H;  1YBY A;  2NBF A;  3KF6 A;  3OMC A;  5C5J A;  5KIX A;  1A3U A;  4HMJ A;  3CP0 A;  5COY A;  4JI7 H;  4KHP H;  4LFA L;  4LWC A;  2DPI A;  3JAM i;  1K1Q A;  3DM1 A;  4EQ5 A;  5BR8 H;  3KBX A;  2E74 C;  2UXB L;  3A74 A;  2Z04 A;  3DF7 A;  1STA A;  3BZK A;  3J81 j;  1VQO A;  4DQN A;  3X3N A;  1X9N A;  2Q2U A;  2Q7D A;  5LL6 b;  4YB8 B;  5EWF A;  4JVZ A;  5KFO A;  4BY7 H;  1BXT A;  4ED6 A;  4IPC A;  1SFO H;  4EYH B;  5IT9 c;  5C3E H;  1QUQ A;  2MO1 A;  2WDT A;  2W8K A;  2AWN A;  4EQN A;  1EKV A;  3KLS A;  1IBL Q;  4ME6 A;  2IP4 A;  2PW5 A;  2C2R A;  3RZD B;  3T9E A;  1U0L A;  5CV5 A;  4GKJ H;  3HOV B;  5EOY A;  4OIJ A;  4BA2 I;  3TQT A;  1VDZ A;  4OON A;  3M85 A;  1TWG B;  3LX0 A;  2BDO A;  1DIK A;  4LF4 H;  3G7L A;  4F4W A;  3S2H B;  2N49 A;  4J9N A;  3TBI B;  4UFZ A;  4DV3 L;  1WCM B;  1ESR A;  4XIG S;  5FD5 A;  2JEJ A;  5IP9 G;  4DGZ A;  3PCO B;  1CKN B;  5IT9 L;  1U4P A;  2E2J H;  1RJQ A;  1PRT B;  4K6N A;  4C56 C;  1WTR A;  4A3I G;  2FHT A;  1EQQ A;  4RCN A;  2FLN A;  2FMC A;  2EPB A;  4DUY L;  2B2U A;  3OMG A;  4Q8F A;  4F88 A;  2B2U C;  1S5B D;  4WRD A;  5JVG 3;  3RTX A;  2BA1 A;  2B3G A;  2J0T D;  3P75 A;  4DR7 Q;  2YU9 A;  1X56 A;  5EPL A;  3MR6 A;  4Y7N H;  3UI2 A;  5L1L A;  2F0T A;  2UUA L;  4HCE A;  1T9H A;  1B6R A;  1LTL A;  1SYB A;  1VQH A;  2LKV A;  5FK9 C;  1KXL A;  3N8D A;  3A0J A;  4JBW A;  2WB1 A;  4A3M B;  4WFN 3;  3T5K A;  2G9H D;  4AQY L;  2ASB A;  1HTL D;  1RDP D;  2UXD H;  4FS2 A;  5I5Y A;  2K5Q A;  3VA7 A;  2ZJT A;  3GTP A;  4BXX H;  3LWB A;  5M3M H;  3R5H A;  2JEG A;  2V1C C;  1GUS A;  5H1S E;  1YVC A;  2JA7 G;  4DAM A;  2VS1 A;  1FYC A;  4NP5 A;  3CXC A;  5FJ8 G;  1K8O A;  4RAY A;  3K5L A;  5IWA L;  1VQC A;  4A3G B;  3HOW B;  1G2W A;  4DUZ H;  1STG A;  2KHS A;  2L9H A;  3GIL A;  5BYB A;  1TS3 A;  1M1K C;  2ZXR A;  5FO9 B;  1W6J A;  2DNE A;  1I94 Q;  2ZM6 Q;  1KJ9 A;  2ZDH A;  4DV5 H;  5EBD A;  1X3G A;  2I46 A;  3SEB A;  1I5F A;  3SK8 A;  4JI1 L;  3Q2O A;  4DV4 H;  1UE6 A;  4IWY A;  5JQW A;  4EYI B;  2CH4 A;  2E2H B;  3KXY T;  3TW6 A;  1EUD B;  4RNO A;  2YCH A;  3I8Z A;  4WOR A;  2OT2 A;  5KNC A;  2YWV A;  4GLW A;  3HOX G;  2R6G A;  4MNO A;  1SNO A;  4JI2 L;  4V19 0;  2GQR A;  4FF2 A;  1WTX A;  1EUC B;  4DR1 L;  3OPO A;  1VQ8 A;  2K5D A;  2F0O A;  1OXV A;  3CCR A;  2HT1 A;  2CFM A;  1EYG A;  5C1P A;  4IRC A;  3RV3 A;  4YP3 A;  4NYE A;  4JOI A;  4QWB A;  4KN4 C;  2J4X A;  1EYC A;  4JOI C;  3NQI A;  3CCQ A;  4IWX A;  2HHF A;  2E5L Q;  5D1O B;  5KFW A;  2PNH A;  4HIK A;  3VMM A;  4X64 H;  5BWX A;  5CGK A;  2R8I A;  1YJ9 A;  3DMU A;  2IX3 A;  3CQZ B;  3F2B A;  1IOW A;  1RK6 A;  5KFA A;  4GN5 A;  4PDB A;  5C0X G;  2ODT X;  3E9I A;  3GTG H;  2NUC A;  4QIW A;  4RUA A;  5KFR A;  3S17 B;  4UP7 A;  2I87 A;  1GGO A;  5JVL A;  4QWE A;  4PZ8 A;  4R8I A;  4JYA Q;  4OWT B;  4ECY A;  4ZLT F;  3NWS A;  5KYL A;  1A2T A;  2ZTE A;  2TMP A;  3I73 A;  5KT5 A;  4CMD A;  3CC2 A;  4LK1 C;  3H0G A;  5E3F A;  4DV1 L;  3BA9 A;  3P7J A;  1MZB A;  2NB0 A;  2W6P A;  4WBN F;  4FF4 A;  3K7A H;  1EYA A;  1NSN S;  3NBH B;  3NSW A;  3PO3 H;  4Q45 A;  4IR1 A;  1E2Z A;  4C3I G;  4PQX A;  1S40 A;  3K5H A;  5KFV A;  4IJL A;  3GTL A;  3WOF A;  1CA5 A;  4S3S A;  5JEA H;  1AUV A;  4LJZ C;  4E6I A;  4QQB X;  4N8X 1;  2X0S A;  1E1T A;  4K14 A;  4K0K L;  4APM A;  2SOB A;  3H0G G;  1PRT D;  2CW0 D;  2K01 A;  4JI0 Q;  2CCZ A;  4JCV E;  3TQ1 A;  1GD7 A;  4ODG A;  2NTT A;  1O75 A;  2MGS A;  4QCL A;  4YJ2 F;  1SJH D;  5KFU A;  3EPG A;  2Y0S E;  3SVM A;  5LMU L;  2E2I A;  4C2M H;  4QUC A;  4GNX B;  4R4Q A;  2KEC A;  3J7A 5;  1TWH A;  3S24 A;  5D1P A;  3RUP A;  2DWC A;  1ENC A;  2PZW A;  5LL6 S;  3QZ7 A;  2J6U A;  1Q8K A;  1XTC D;  4XYO A;  2IA6 A;  5BWU A;  2MFI A;  1Y1V B;  4ECQ A;  4O4J F;  3K7U C;  3J80 E;  3TP6 A;  2XN9 C;  5HUR A;  1IBM H;  4CE5 A;  2MCT A;  4X62 L;  4LF9 Q;  1JOQ A;  4LFC H;  3W2D A;  4GN4 B;  4K5W A;  4KY6 A;  3HKS A;  2R7L A;  2WYO A;  4KI0 A;  2O2L D;  2A5H A;  2VZA A;  3GLK A;  3T1H Q;  4RB0 A;  2MJ8 A;  4CKE A;  4J0M A;  1R9T B;  3U9T A;  4O7R A;  1WSC A;  2YV5 A;  1C30 A;  3G8D A;  5D3I B;  4QSH A;  1XNQ Q;  2W71 A;  1ASY A;  3QWU A;  4NLG A;  2COI A;  4O4L F;  1HNX H;  2VL6 A;  2H5X A;  2RCF A;  4DL4 A;  1H9K A;  2WIN B;  1C8C A;  4DV7 H;  1CZG A;  4DRF A;  2K75 A;  1YNN C;  1C4Q A;  3MXU A;  5L37 A;  4RWS C;  2SNS A;  3RB3 A;  1OXS C;  2B2V C;  4DL2 A;  4FFR A;  4DV2 L;  3L4J A;  4OX9 Q;  3S15 B;  2JEB I;  4X66 L;  1LTA D;  2R7Z B;  1D5M C;  1HZA A;  1RL2 A;  5LHY 1;  1I4G A;  4R4O A;  1KDA A;  1B3A A;  1SNM A;  2PI2 E;  3I56 A;  1UC8 A;  3HB9 A;  3BVG A;  4JI5 H