1A0IA

Atp-dependent dna ligase from bacteriophage t7 complex with atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
348
structure length
332
Chain Sequence
VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDGVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFHRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQAAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWWKMKPENEADGIIQGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFDACTINPYDGWACQISYMEETPDGSLRHPSFVMFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Crystal structure of an ATP-dependent DNA ligase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Ligase
total genus 89
structure length 332
sequence length 348
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF17879 DNA_ligase_C DNA ligase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a0iA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1a0iA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1a0iA01
3VNNA 4DNIA 3E0EA 3S17H 3W1BA 1PH7A 1BVSA 5C44G 1Q12A 3M3YH 2N78A 1NE3A 2I5LX 2I5MX 2GVBA 3K7UC 4JBWA 2IHFA 4UP8A 3JSLA 2JE6I 5FJ8G 4DV4L 4IFDJ 3CCRA 4NB3A 4HIKA 4OONA 3PUWA 3S2DH 2VY3A 5HGQA 1L0WA 4DR4L 1XMQQ 4CC6A 4UCSA 4DUZQ 4JYAQ 4CC5A 5JEAG 5GAEC 2HVSA 4BA2I 2UXDL 3TY9A 2NVYH 1S72A 1Q82C 3PO2H 4AIMA 4DR6Q 4J15A 2NZOA 1VQKA 1K83H 1H95A 1TWAH 1UEBA 1VCIA 4HIDA 1I94L 3ULJA 3M4PA 5DISC 3CCMA 3PF5A 3RN2A 1N33Q 4GS3A 3PO3G 3PO2G 4A76A 1VQFA 1Z47A 1WI5A 1KC8C 3NENA 1X55A 1PVOA 2VS1A 4C3JH 3OYYA 1YIJA 1PV4A 4OO1G 2AKWB 1SN8A 3KF6B 4AYBG 4HIOA 4GKJL 3CCSA 1L1OA 4P75A 1BKBA 1V1QA 2Y0SE 1KRTA 4EEQA 1YHQA 4K0KL 1CKMA 2YTXA 3A74A 1QVFA 4POFA 2OTJA 1I5FA 3PUZA 4DR4Q 4EFBA 3UQ8A 3CCJA 2JK8A 4DV1L 4DV5L 4A3EH 1X9NA 1OXSC 1XNRQ 4ALPA 4R4CA 4R1JA 4KLKA 4BBRG 3PUYA 2ASBA 2KCTA 4DKAC 1AE3A 1Q1BA 3MEFA 4DV2Q 3K8AA 4GKKL 1TAEA 5FLMH 1BBUA 4A3EG 4EQ5A 2VUMG 4BY7H 1I94Q 1NMFA 4QIWE 3KJPA 4YWMA 4A3MH 5M3FG 1QVCA 5BR8L 4A3JH 5LMNQ 3I2ZA 4JI3L 2ZJPA 3KDFA 5FLMG 4L5TA 1E1OA 3AFQA 1X6OA 1YNXA 2Q2HA 1J6QA 3F8TA 4DR3L 1PH2A 2K50A 4BY7G 1LTLA 2UUBL 1EWIA 1GM5A 4A3MG 4JI2L 4A3JG 4A3KH 3FP9A 3UDXA 1IZ6A 2XGTA 3U4VA 5GAGC 5C0XJ 4HIMA 2ZTCA 1IBKL 3H15A 2PQAB 1CKNB 4DV5Q 4OX9L 3CXCA 1OXVA 4A3KG 5M3MG 1ASZA 1XMOQ 1MIUA 2CWAA 3HKZG 3LGJA 4LF7Q 4KI0A 2YYZA 2R93G 3CPFA 3ICEA 4P73A 4L5SA 3KOJA 4B3SQ 5GQOA 4X65Q 5BR8Q 2R7FA 3CCEA 2HT1A 2KHJA 2JA7H 2KCMA 1XNQL 1TWFH 1Q46A 1WFQA 2BA1A 1M1KC 3ZJYC 3IRBA 2E2HH 4HJ5A 4DR7L 1OXXK 2QGQA 4DK6C 1Z9FA 4DR3Q 4JI7Q 4B3RL 1SRUA 2UUBQ 5ELOA 2YV5A 4O0AA 4DV3L 4DR1L 1O7IA 4UCTA 3HOVH 4DV6Q 2AHOB 1OXUA 4OWTB 4DR2Q 4FDBA 2VUGA 4JI4L 4IO9A 4GOPA 1IBKQ 1NMGA 4BA1I 2NVQH 5H1SE 4OX9Q 1S68A 2HVRA 3H3VH 1KAWA 4A3DH 2R92G 1A0IA 2K52A 1HNZL 4UPAA 5IYBH 4R4QA 3GJXB 2A8VA 3CF5A 4QGUA 1YJWA 3GTLH 1N32L 5JJLA 4NXMQ 4AQYL 5HY6A 3I4OA 1XDNA 1HNWQ 4PZ6A 3KYHC 5IYBG 1XNQQ 3J81c 2JJQA 1IYJB 2E8GA 1HR0L 2OQKA 2MQHA 3L2PA 4A93H 4HJ8A 4DAMA 1D7QA 5D1OA 2UUCL 4DV3Q 4A3GH 4DR1Q 2XTIA 1MKHA 1XTDA 1PH8A 2B63H 1QUQB 2D0PA 1WYDA 1U0LA 2Z6KC 4LFCL 1T9HA 3RLOA 3JAMi 1FJGL 1YJ9A 3NBHB 4A3BG 2ALYB 4LUOA 1XPOA 3FHWA 2WFWA 1KXLA 2EIFA 2Z0SA 5IP7G 1Q8KA 2HIVA 3RZDH 3F1ZA 1QZGA 2B63G 4UY8C 1AH9A 4DRFA 5EAYA 4YWLA 4DV7Q 1K8GA 4LFAL 4JI5Q 1X56A 2Q2UA 3HFZB 3CCLA 4E6NA 2IX0A 4MZ9A 3M4OH 4X64L 4HJAA 2B29A 4IOAA 3BZCA 3E9HA 4PG3A 4LH7A 2IHEA 3S1NH 4JV5L 3OTOL 2HHHL 2K5HA 3TS0A 1S40A 1HR0W 2WAQE 2OTLA 3GTOH 1IBML 5JEAJ 4LNQA 3U58A 4IFDI 1E24A 2A19A 2MO1A 1G291 2VW9A 1EIFA 4BY1H 2HQLA 5JJIA 4OWXB 1EIYB 2JA8H 3RN5A 4DPGA 2VQFQ 1JJ2A 4A3LH 1PH9A 4LFCQ 5C4XH 4JBKA 1FJGQ 2NVXH 4BY1G 4A3FH 3NBZB 3DLLA 2UU9Q 4IJHA 4JI8L 3OW2A 3KF8B 3CC7A 1HJPA 2HIXA 4ME3A 4DUYL 3EBEA 1EUJA 2K5VA 2NVTH 5FPOA 5C4XG 1Q7YC 4PZ8A 3HOXH 3AEVA 1V9PA 4A3FG 1E22A 4WJ3M 1EQRA 1WJJA 3RR5A 3TEHB 3G4SA 3A5ZB 3S14H 4DV4Q 4B3ML 2LXJA 1L1OB 1S3OA 3L0OA 3J81j 3OTOQ 4GNXA 3A0JA 1EOVA 3K0XA 4DK3C 2ZM6L 4LF9L 3TRZA 1YEZA 2VNUD 3DM3A 1KHIA 5DLQE 5FPRA 1GVPA 1VQNA 1VQPA 1XK5A 3KJOA 4LH6A 1VQOA 2UXDQ 3RTXA 1NBWA 5C3EH 3J7ZC 1K3RA 5GADC 4HJ7A 5ELNA 4HJ9A 1YHBA 1I3QH 3EN2A 4JI6L 2ZJQA 4P71A 1D8LA 3CC4A 1B04A 3PIPA 1L1OC 2PMZE 1QZHA 2WB1G 1Q86C 5C3EG 3NC0B 2QEXA 1VQ6A 4AYBE 3UE0A 1GD7A 3M4QA 3I55A 4DUYQ 3BAAA 3PSIA 1TWHH 4QJFA 4POGA 4GKJQ 1I6HH 1Y1VH 3GTGH 1FVIA 1G6PA 2JA5H 2ID0A 3NELA 3BA9A 4X62L 2RHSB 3T1YL 4B3MQ 2ZTEA 4K0KQ 2VQEL 3T1HL 2E2IH 1SE8A 2D62A 3CAMA 4JG2A 4MTNA 4LF9Q 1GO3E 3NEMA 4DV1Q 3GTQH 4P72A 3ULPA 1HZAA 1GKHA 4KHZA 4JI1L 1K8AC 1VQLA 2JA5G 2EQSA 2JEBI 5C0XI 3TY8A 3S2HH 4BBSH 3GO5A 3S16H 1X3GA 4X66L 2PNHA 5M5YH 4GKKQ 2JA6H 4QQBX 1LUZA 3AQQA 3WWVA 4EFEA 3J7A5 2AWOA 2BH8A 3CD6A 2OCEA 4RMFA 3BA8A 4YHHL 2RF4A 4APVA 1VQMA 2OWOA 4JI3Q 2NZHA 2R6GA 1NJIC 3GTPH 3HOWH 2KHIA 4NXNL 1A63A 2PQAA 4R4TA 3J80c 3S15H 3PIOA 4LFBL 3G71A 1LM0A 2N3SA 5IT9c 4JI2Q 2CQOA 1KQSA 2GVAA 4UCOA 2JA7G 3G48A 4UCVA 1UWVA 4X62Q 4XIGS 3F2BA 3T1YQ 1EQQA 1KIXA 3MXNB 3T1HQ 3HOZH 1P16A 3PCOB 2H5XA 5JJKA 1C9OA 2F3IA 5IE8A 3U4ZA 3JC66 2ES2A 3UDGA 1IL2A 3AFPA 4JI1Q 1K73C 3HKZE 5M5XH 1UE7A 3HOVG 2L15A 1VQAA 4XTCS 2UXBL 4WJ4A 4BXXH 4Y52H 4X66Q 2AWNA 5AJ3L 1VQ5A 1XPRA 1N9WA 5J3BA 4QL5A 3KLWA 1TA8A 4A3IH 4L5RC 2E5LL 2I0QA 1OXTA 1IBLL 4A3DG 3CCUA 4LF8L 2MNAA 4UFZA 1WCMH 4GN5A 4BXXG 4C3HH 5LMUL 4DR7Q 1SFOH 1PH1A 2CFMA 5IWAL 4DV0L 1B8AA 1PH5A 4TVAB 3UDFA 4B3RQ 4KHPL 4LF5L 1LYLA 3PGZA 1WCMG 2UU9L 2Z6KA 2IX1A 2MFIA 1E7ZA 2NN6I 3PUVA 4DR5L 1J5EL 1KRSA 3AYHB 4MNOA 1VQCA 2BA0A 2LXKA 1SROA 4JOIC 2UUAL 4IPGA 1N34L 4A93G 1AE2A 2JEAI 1FL0A 1C7YA 4JI4Q 1YZ6A 3BJUA 2IY5B 2ATWA 4A3GG 2VL6A 3HOUH 1UE1A 3J81i 1RL2A 4JC0A 4IOCA 2QA4A 4GN4B 2UXBQ 1XMQL 1PH3A 1HNZQ 2R7ZH 4DUZL 4JBJA 2GN5A 4GLAC 2UXCL 1N32Q 3ULLA 1VQ8A 1Q1EA 1OTCA 4AQYQ 3GTMH 1IBLQ 4P74A 1EFWA 1C0AA 3SGIA 4B3TL 1B70B 2EXDA 3D0FA 1YITA 1N36L 3HOYH 3F2DA 5C44H 1HR0Q 1L2FA 3TY5A 1VQIA 1CSPA 5IWAQ 4DV0Q 1YVCA 4KHPQ 3GB8B 2UUCQ 1MJCA 5GAHC 2PI2A 3STBD 1U5KA 1JB7A 4DR5Q 1J5EQ 2CCZA 3TQYA 1X3EA 2N49A 3GDEA 4C2MH 3HOYG 2UUAQ 1N34Q 3CW2C 4UCRA 3U50C 3PN1A 3E9IA 4LWCA 4TQUS 1VQ7A 2JA8G 3K81C 2JQOA 2AMCB 4LFAQ 1YI2A 2Y0SG 4A3LG 1Q81C 4IFDG 3CP0A 4IPCA 1VQ9A 4X64Q 1B7YB 3CQZH 4OO1I 3I7FA 1XNRL 2UXCQ 3UE1A 5E7NA 4JI0L 3I4NH 4JV5Q 1JJCB 2DUDA 3PO3H 2HHHQ 3M9BA 3GD7A 1ASYA 3W5OA 1PFSA 4DV2L 3HOXG 2ZTDA 1IBMQ 5IYDH 4B3TQ 3W1GA 4GNXB 1N36Q 5C4JH 1W2BA 1KL9A 3FKIH 1UE6A 2Q2TA 1HNXL 4A4IA 3I4NG 3L7ZC 3D31A 1N8RC 2K14A 3GTKH 5LMNL 3UDIA 2V1CC 3S1MH 3KF6A 5IYDG 4PMWA 1XJVA 4A3CH 2JA9A 4DAYB 3PV0A 1W3SA 2N8NA 1TWGH 3FKIG 1E3PA 1HZBA 3I56A 1HZCA 4YCUA 1PA6A 3H0GH 4JI8Q 4YY3L 4BBRH 5M5WH 4LF5Q 3TS2A 2HVQA 1TWCH 3STBC 4A3CG 1VQBA 1YBYA 2A1AA 4LUVA 4GNXC 3RZOH 3I4MH 3KDFB 2YU9H 4OWWB 3K7AH 1DGSA 4GLXA 4Y7NH 2VUMH 3CMAA 3H0GG 2PI2E 1X54A 1XMOL 4JI0Q 3BU2A 5M3FH 1TXYA 3EIVA 2FXQA 2F52A 2ZM6Q 4LF7L 2C35B 4IPHA 2CKZB 2K5NA 1SMXA 2RHQB 3I4MG 1Y1VG 3ERSX 5LMNW 3TREA 1YJNA 3GTJH 1K9MC 1Y1WH 4B3SL 1HNXQ 2BH2A 4X65L 3A5UA 5GROA 5FLXc 3PUXA 4LF4L 1NTGA 4OXPA 4JI6Q 1CKOA 4JCVE 2WB1E 4JI7L 1PYSB 1Y1WG 4O2DA 1JE5A 2LSSA 3BZKA 4BBSG 1EYGA 3CMEA 4GN3B 4LW1A 4YY3Q 5M3MH 1CSQA 4L5QA 4YCVA 4DV6L 1VQDA 1FGUA 3CCVA 4DR2L 2JA6G 1CKNA 2DGYA 3ER0A 1E1TA 3K80C 1NY4A 4YCWA 4AH6A 4X6AH 5D1PA 4NPSA 2B3GA 4QY7A 5C0XG 4H02A 1PYBA 2Q2IA 3S1RH 2R93H 3HOWG 3PF4A 2VQEQ 3M85A 2F4VL 1KD1C 1P8LA 3F2CA 2E2JH 2IT1A 4LF6L 3BABA 2YTVA 4NXML 1UE5A 1V43A 4GOPB 3JSNA 2R7DA 4RG1A 3RNUA 3HOZG 3B6YA 1HNWL 3J80i 1PH4A 5IY0A 3CC2A 2RCNA 1X3FA 2I5HA 1PH6A 4LF4Q 3S24A 4YWKA 4UP7A 1MJEA 4YHHQ 3H3VI 1SR3A 1XPUA 1A8VA 2R92H 5K36G 1JT8A 4NXNQ 4IJLA 3KFUA 4A3IG 1PHJA 1VQEA 1M90C 4LFBQ 4LUZA 5IP9H 3NBYB 3RLNA 4GOPC 3VDYA 4IPDA 4PZ7A 1RIPA 1VQ4A 4DV7L 5D1OB 1VQHA 4JI5L 3S1QH 2ZJRA 1HH2P 4JOIA 3CPWA 1CUKA 2F4VQ 3RLFA 3M7NA 3HKSA 3CCQA 4GLVB 3JAMc 1IXRA 5IP9G 4LF6Q 4R4IA 2OQ0A 4UP9A 2CWPA 1I50H 2VZAA 4R4OA 1R9TH 3QWUA 1K0RA 2KBNA 3G6EA 1A62A 5AJ3Q 1G51A 1WOCA 2WAQG 4JBMA 2MO0A 4A75A 4C3IH 4JYAL 4A3BH 3HOUG 2KENA 5IYCH 1QUQA 1VQGA 1HZ9A 4EX5A 2E5LQ 5IP7H 2NN6G 2WP8J 4LF8Q 4DR6L 1JJGA 2R7ZG 2VQFL 2K4KA 5LMUQ 1QVGA 1JMCA 1BBWA 4UCUA 1SLJA 3Q8DA 2D0OA 1Y14B 1VQJA 2K75A 1N33L 5IYCG 1YHAA 1X65A 1VS0A 5FJ8H 2YTYA
chains in the Genus database with same CATH superfamily
1FGBD 1LTID 4YAKB 4K14A 1BVSA 2ZXPA 4R8UA 3M3YH 1UAPA 5KRUA 2N78A 1NE3A 2I5MX 2IHFA 2JE6I 1RJPA 5FJ8G 1WTHA 4HN7A 5EQ0A 4NB3A 3CCRA 3TN2A 4IFDJ 5EKKA 3S2DH 1B3AA 2DN8A 3MXPA 1L0WA 1QE6A 4CKEA 4PQXA 2F0VA 1XMQQ 1IBLH 1IKMA 2R8GA 3QQMA 5G3LD 4CC5A 5GAEC 5KG6A 4IUQA 4A3EB 1MBYA 4DL5A 5IWAH 1DCZA 4BA2I 1S72A 1Q82C 1O7ZA 1H95A 1TWAH 1UEBA 2J4XA 1KT8A 1TWGA 4HIDA 1PZKD 3M4PA 5DISC 3PF5A 3PO3G 4A76A 2F0NA 1WI5A 4O2BF 3NENA 4A3JB 3PW4A 3TQTA 5HBRB 5KFVA 3HP3A 1T94A 3KF6B 1Y1VA 4RGNA 1V8QA 2R85A 1BKBA 4HAEA 4HNVA 3VPCA 4K0KL 4QWCA 2EYFA 2YTXA 1QVFA 4POFA 1TQOA 3GTQA 4CGYB 4EYIB 2B2UA 1EYDA 3HG9A 3C1EA 5JPNC 3EFXD 4DV1L 1X9NA 1GLVA 1XNRQ 2W71A 2A6HD 4BBRG 4KLKA 2BR0A 1I4HA 5IGDA 1AP0A 3JRXA 3M9NB 1TT2A 4KKSA 4GKKL 4O82A 3BDCA 4IHJF 4E4TA 4BY7H 1NMFA 4IUNA 4YWMA 2YZNA 5BR8L 2EJ3A 3N42B 2M2LA 5LMNQ 3I2ZA 4JVZA 2JA7B 4XYMB 1E1OA 1CTMA 1X6OA 2Q2HA 3K5LA 4BY7G 1HTPA 4DR3L 2VPQA 1LTLA 5CV4A 1GM5A 4LSXA 3FP9A 1A2UA 1IZ6A 3HOVB 2AUKA 2AQ4A 3Q1KA 4HIMA 3K5HA 1A3VA 4CJ2C 1U4MA 2PQAB 1DAAA 2CNQA 2W8KA 2V5AA 1ASZA 4QWEA 1HNXH 1MIUA 1SYEA 3LGJA 5BN3A 5LL6X 4LF7Q 2YYZA 3GV8B 4M0JA 3GTLB 3CPFA 4B08A 2R93G 4J9KA 4L5SA 5DNFA 2VA2A 4P2CB 5GQOA 5BR8Q 1D5ZC 3QZ7A 4YY3H 1XNQL 4YQWA 1M1KC 1Q46A 3T53B 1KJIA 1V1OA 1CI3M 3ZJYC 1OO9B 3HT5A 1STAA 3M7GA 4ODGA 4WD3A 2QGQA 4CMDA 1Z9FA 1KDCA 4DR3Q 4JI7Q 4B3RL 4DV3L 2YV5A 3MXNA 3QO2A 4UCTA 1T5EA 2G5DA 3TW7A 5E4WC 2WAQA 5BWUA 4IO9A 4B9WA 5H1SE 4RNNA 3I4LA 3RZDB 2HVRA 4A3DH 2F0PA 2R7ZA 1A0IA 2NYZD 3CU7A 1R9TA 2K52A 1CFMA 2A8VA 4OEMB 2X0SA 1DOLA 1EYCA 3CF5A 1DONA 2KOLA 2LKVA 3HEJA 5EWGA 4AQYL 1WRVA 2GA4B 1A0GA 2N55A 4PZ6A 1LABA 1XNQQ 1T3NA 1SNMA 3K5NA 5DMXA 4NXNH 3VYUA 2F0SA 3L2PA 4DAMA 4BY1B 3K0YA 1D7QA 5D1OA 2L0CA 4DV3Q 2B63H 3H94A 1MKHA 1XTDA 2YL2A 1QUQB 2CQYA 3RB3A 1U0LA 3VYRA 5I5YA 4I65A 3NBHB 4LUOA 2C00A 1S5ED 2QEJC 2NWGA 1NR4A 2NVXB 1EZ6A 3NE5B 2EIFA 1QZGA 3I91A 4LF6H 2B63G 5EAYA 1K8GA 1LT6D 3OWEB 3CCLA 2Q2UA 2V58A 1B33N 3CQZA 4RB2C 2IX0A 4X64L 4HJAA 4TVIA 2B29A 4ZQ3A 1JB3A 4TRDA 1Y8NB 5IGBA 2R7KA 3PMFA 4QIWB 4LNQA 1E24A 1M8AA 1G291 3LP8A 1F9QA 4Q4CA 1STNA 5I47A 2HQLA 2E2DC 3GTKA 2TMPA 4KMUC 2ASLA 4O81A 3LNNA 1CZWA 5C3EB 4N9PA 3SHLA 1R4PB 4IFDH 3P1HA 1JE4A 4O2AF 1JDEA 3CC7A 2HIXA 5JVG3 3I73A 1O80A 1EUJA 2QKIC 3EBEA 4V190 2W6QA 4NZMA 1EKVA 2ZDGA 1Q7YC 4PZ8A 4MAMA 3V4ZA 1XMQH 2X6GA 1KUTA 1I6HB 4CHTB 2HQEA 4DV4Q 2LXJA 3L0OA 4RAYA 2VNUD 3A0JA 3TRZA 5LYJF 4DK3C 4APMA 3RB4A 5FD5A 1YEZA 2VQFH 2JEIA 4J9SA 3CVZA 1BDOA 1XK5A 4LH6A 1M4VA 1VQOA 4EQOA 2UXDQ 4JUZA 1SE2A 3S2HB 1K3RA 5GADC 3S16B 3EN2A 4JI6L 1AUXA 2CNUA 2JA6B 2W7OA 3PIPA 4K2LA 2WB1G 1VQ6A 2W8LA 1BXTA 3CKIB 4X3SA 3UE0A 4AYBE 3I55A 5KT2A 3GTPB 4YP3A 2IA6A 1LTGD 2C2EA 3OWFA 1Y1VH 4CDEC 1XNRH 2ID0A 3GQBA 3BA9A 5DAUA 4X62L 5KFQA 1QWYA 5DLFA 1SE8A 1R4QB 4Q5VA 4RUCA 3CAMA 3GTQH 4MTNA 3MFHA 3ULPA 4L8JA 4FBTA 1JQYD 1K8AC 2KJXA 3WDNA 3K3VA 5C0XI 3EPGA 2OLSA 4BBSH 1TWFA 2E74C 1CE8A 1CM9A 2OXPA 1LUZA 3WWVA 3BQ0A 3WNZA 1EOTA 5EBCA 1ET9A 4YHHL 4ZUJA 4JI3Q 1TS4A 1I4XA 2KHIA 5EJWA 2I07B 2PQAA 3N6RA 1RJRA 1SFOB 4LFBL 4ECRA 2N3SA 2GVAA 4UCOA 3R2TA 4FXKC 3RMHA 4X62Q 5D65A 1GYFA 3HOZH 5L1LA 1A3GA 1P16A 4HR7B 4LF7H 5JJKA 1KEEA 3NSWA 2WKCA 3JC66 3I90A 3UDGA 5M5XH 2A6EC 3BDLA 1LACA 3ND9A 1TU2B 2UXBL 2KEDA 5BR8H 1AEXA 5L1KA 3FDTA 4IURA 1XPRA 3VMMA 2PQEA 5I6YA 5J3BA 5IGCA 1IYVA 4MN3A 3KLSA 4A3IH 4WRDA 1EQTA 4L5RC 4DR3H 2RA4A 1OXTA 2R87A 5KFXA 2MNAA 2ABJA 3V6JA 1W6KA 5LMUL 4CJ1B 3NXWA 3HOYB 4QW8A 2IPKD 2ICIA 4F88A 1IKLA 1XTCD 3OIPA 2MFIA 4DR5L 3PUVA 2V4DA 2Y0SB 3NTHA 3VPBA 2B2TC 4JOIC 4A93G 1AE2A 3V05A 3KLRA 1H9SB 4RGMA 1YZ6A 4JI4Q 4YBZB 4A3GG 3HS0C 4LK1C 1RL2A 4IOCA 1IYEA 3PW2A 2UXBQ 2R7ZH 2XCAA 1XNQH 4EGQA 1SEIA 3OW7A 4OGQC 4GLAC 4BS9A 5A2QL 4ECXA 3WWIA 4B3RH 4J8QA 1SMYD 4J9NA 4DV3H 3PO3B 1MHWC 3NBHA 1SNDA 1B70B 1YITA 3AB9A 4LAAA 3KHHA 4RB1A 1HR0Q 1L2FA 1VQIA 1ZYRC 3IFDA 4TQRA 2QDBA 3GB8B 3T9FA 2UUCQ 5C3WA 3M4IA 3S1MB 5KT5A 4DR5Q 2CCZA 4JPBW 1X3EA 3GDEA 4JW0A 3FMCA 4N9TA 3BDOA 4UCRA 3CW2C 3U50C 2JA8G 2A68D 3GV5B 5C4HA 1WSCA 4LFAQ 4BBRB 5M5WB 4AQYH 1B44D 2EYMA 3T99A 2QILA 3CQZH 1STBA 2FE3A 3IFTA 1I4QA 2R8HA 3K7AB 3BYTB 3I4NH 4JV5Q 1GSHA 2JEGA 1JJCB 2HHHQ 2YWVA 5LL6S 3GD7A 1PFSA 1IBMQ 3HOXG 1PRTF 1Z2OX 3KAJA 2BE5C 4OO1H 4I7HA 2VA3A 3FKIH 1UE6A 4IZ8A 1HXYD 3GTJB 3I4NG 4WFN3 1NR2A 1Y1WB 3GTKH 3URYA 2V59A 5BYBA 1BXRA 1XJVA 4DAYB 1K28A 1H9KA 3FKIG 1E3PA 2PVPA 1HZCA 4X64H 2AQ1B 4O7SA 3H0GH 3TS2A 1CA6A 4DV4H 4RHSA 3WOEA 1HUMA 2WV6D 4XQNA 1K8OA 4RNMA 3I4MH 3A55A 1BNCA 3D4DA 2NUAB 3CMAA 1PMRA 2PI2E 3H0GG 2KEEA 3HO8A 2R93B 4QWDA 5L1IA 5KFPA 4KHVA 2UXDH 1OBDA 4FXDA 5DQIA 2IMWP 2FXQA 2ZM6Q 1TY2A 2EJ0A 3I4MG 2RHQB 1V1PB 3ERSX 4MHEA 3TREA 5JAVA 3NWTA 1I6VC 4Z9CB 4EVOA 2BH2A 4X65L 1Z7TA 2Z4HA 2E2HA 3GTPA 4ZHQF 4A2BA 1PRTD 4LF4L 1NTGA 1RODA 4OXPA 5I60A 1VBHA 1D6EC 3Q22A 4QF4A 1EYGA 4LW1A 5M3MH 1KJQA 4YCVA 3RBDA 1VQDA 2LS01 5EOYA 1FGUA 4UHVA 1CKNA 2NUCA 2DGYA 4R8IA 3TINA 4UDUC 1NY4A 4R8NA 5KT6A 1XX8A 3S1RH 2H4OA 3SR1A 1ZHQA 2VQEQ 3QR8A 1J9OA 4JK1C 1P8LA 2C9OA 2VB3X 3F2CA 2IT1A 2B2YC 3TBIB 4GZYC 3IL8A 5CR3A 4NXML 5CR5A 4F4XA 1QILA 1I50B 1S4ZA 2JYOA 1PH4A 5IY0A 2PN1A 2XD4A 3CC2A 2RCNA 3R5HA 3FMAA 1Q8IA 4DL2A 1PH6A 4LF4Q 3M4YA 1D2BA 3GLKA 4YWKA 4J9PA 1SR3A 1JWUD 4X62H 1RD9D 1ILPA 4QWBA 4ME6A 3CSWA 4IJLA 2PNRC 5JVDF 4FYDA 1N56A 4FF3A 3HXLA 1BO0A 3NK9A 4PZ7A 4C3HG 1VQ4A 2YRXA 5FLXE 4JI5L 3RJ0A 4JOIA 1JKJB 2K33A 3M7NA 1HHVA 2EYOA 1HCZA 3TP7A 2Z4IA 4H7BA 2Z02A 4JV1A 2BDNA 2OQ0A 5KFOA 2VZAA 1I7NA 3J80E 3QWUA 4YHHH 2BOSA 2KBNA 1A62A 3SDZA 1G51A 1WOCA 2E75C 5AJ3Q 4LMQD 3G6EA 3ETHA 4ED3A 3HOUG 1EU3A 2RVLA 4LFBH 2DJFC 2E5LQ 4EX5A 1JIHA 2MPMA 2NN6G 2WP8J 3QOLA 2WYOA 3PO2B 1M0WA 4RGOS 2Y0SA 1JMCA 5CA1F 1K83B 3EROA 5FO9B 1J8IA 1DJRD 1VQJA 1Y14B 2EVBA 5KFUA 2MP1A 4JI4H 4LF5Q 1WJJA 3W1BA 1S5DD 1CK1A 2F0KA 5C44G 2UXBH 2DWCA 1Q12A 2WINB 2ZDHA 4UP8A 3JSLA 3OHBA 4G57A 2HGWA 4HIKA 5HGQA 4OIJA 4ULLA 4UCSA 4RAZA 5LMUH 2EE1A 2XNAC 2N88A 5JEAG 1EZ1A 2KQ3A 1AFPA 4FFLA 3R23A 4L6TB 3TY9A 4AIMA 3WO1A 2UUCH 2GQSA 2WB1B 5KT3A 3WWJA 4DR5H 1VCIA 1FYCA 1RHPA 4XT3B 3ULJA 3QG1A 3CCMA 3RN2A 2NU8B 4C5CA 4C5BA 4RU9A 1VQFA 1Z47A 4OIKA 1GHKA 3R3OA 1HPCA 1X55A 1PVOA 4C3JH 3OYYA 1PV4A 1TWHA 5JH7F 4AYBG 1PTOH 4GKJL 1L1OA 4IALA 2EIYA 1V1QA 4B9XA 3QWNA 3WOFA 2J0TD 1KRTA 4EEQA 3Q8RB 2E2IA 4JV5H 5KYIA 2XVSA 1CKMA 3A74A 4A3KB 4KN7C 4C3JG 4IR1A 1L0YB 1I5FA 3PUZA 1IBMH 1EYZA 3PVXA 2JK8A 1G8ZD 4DXGA 4DV5L 5ELEA 4ALPA 3ORRA 1Y1WA 2FPIB 3N40P 5KNBA 3DEPA 3ORQA 3GV7B 1EY0A 4NKLA 4Q45A 2W9CB 1CHPD 3K8AA 2EXZA 1ENAA 3U9SA 4O7YA 4G7HC 4EQ5A 2VUMG 3N52A 5CV5A 2NBFA 5M3FG 3VR3A 4EYHB 3TEKA 5ELFA 5K5PA 2W7PA 1YNXA 3CRKC 3VA5A 2UUBL 3VYTA 3TMEA 4XX0B 2AU0A 2NTSA 4DL3A 2OEOA 2EJGC 4DFAA 3LWBA 1IW7C 3U4VA 3HGBA 4KJNA 1VKZA 4DV5Q 4OX9L 1B2TA 1OXVA 3VR5A 2ZGIA 5CMDA 1EY9A 3NP8A 1EY8A 2B2YA 1RYSA 4DAVA 2COIA 1PTOF 1U4LA 5I9PA 3TQ1A 4O4LF 4P73A 4RWSC 4B3SQ 2PCFB 5ISRA 1FNWA 4H13C 5FR9A 3GIDA 2R7FA 1DIKA 2BA1A 2E2HH 4HN2A 3IRBA 4DR7L 1DM0B 1OXXK 4IZOA 2UUBQ 4A93B 4YR2A 4O0AA 3I72A 1O7IA 3BS1A 3H3VC 4A3GB 2CQAA 2AHOB 4PDBA 2WTFA 4DR2Q 1BQQT 2L5TA 1RK6A 1DV2A 2B2WC 3W2DA 1NMGA 1X32A 4QMGA 4BA1I 4OX9Q 1WR2A 1I50A 1SAPA 1KAWA 2R92G 2XN9C 4X65H 1HNZL 3RBEA 3GJXB 1PDQA 5G3LF 4QGUA 1YNJC 1YJWA 1N32L 4NZOA 4LF4H 3GTMA 4MV6A 1F2MA 1SYGA 3S1NB 3R9RA 1XDNA 2B39A 1HNWQ 3G8CA 3BQ1A 1Y8OB 3GTOB 3TP5A 3J81c 1EU4A 4NP5A 1D1IA 4ED8A 3MXUA 3J81W 2XTIA 2JA8B 3DAAA 2D0PA 1WYDA 4LFCL 2R8IA 2FMAA 4FF1A 1YJ9A 4A3BG 1Q90A 2Z6BA 4IRKA 3FHWA 2F0HA 2WFWA 2XC9A 4A3FB 1I4RA 5IP7G 2HIVA 1NCVA 4DRFA 1JCKB 1QB5D 2XSCA 3HFZB 3MJFA 3M4OH 2NVTB 3GILA 3HOXB 4IOAA 2EJFC 4LH7A 3K6OA 3OTOL 2E5LH 2WAQE 2PMZA 4G7OC 1IOWA 1EYAA 2A19A 3MHBA 3FRPB 2DPJA 2VW9A 1EIFA 5JJIA 3MFIA 5BN4A 4OWXB 3NHHA 3W3AA 4LF5H 1WD0A 2VQFQ 1JJ2A 4A3LH 4IUPA 1HQMC 2L55A 2O4XA 1U9RA 4K5WA 1PH9A 4LFCQ 4HMJA 1I3QB 4O83A 2RDFA 5C4XH 4JI5H 1B4OA 3K57A 1UC9A 2UU9Q 5I5XA 4NMZA 1SYBA 4JI8L 1B50A 3RUPA 5D3DA 3KLSX 5KFKA 5C4XG 2YZGA 2EY1A 3AEVA 4WJ3M 3G4SA 3S14H 3GTGB 3A5ZB 3Q8PB 2JA5B 5J2UF 3RAXA 4UUGA 3OTOQ 1IL8A 5L37A 1EOVA 1VDZA 4ECYA 4FXGC 1GVPA 1STGA 4MV7A 3FPUB 2O5IC 1F9RA 5KFWA 3T51B 1NBWA 1RTOA 4ECZA 2W9BA 4P71A 5KFJA 5M5YB 3A8IE 4OELB 1D8LA 1QZHA 1ENCA 3FEWX 4U68A 4XYOA 4ZK9B 3AW8A 3EYYA 3HKZA 3OMCA 1O7LA 5CV8A 3HRZC 3C46A 1TWHH 3EQLC 1FVIA 1A48A 3NELA 3T1YL 2A6ED 4K0KQ 3T1HL 2E2IH 3WWHA 4IUVA 1GO3E 4DV1Q 4P72A 1SJHD 1HZAA 1VQLA 4MV4A 3R5FA 1A15A 2EDGA 2JEBI 3NUAA 2KCCA 1X3GA 3PW0A 4X66L 3KHLA 2PNHA 4GKKQ 2CNVA 2YYAA 2Q8IB 1Z2PX 4QQBX 1KAAA 2JSOA 3J7A5 4CDDC 3CD6A 4EFEA 4U673 5CYUA 2DJGC 2QF7A 3T5KA 1A3TA 3BA8A 3KREA 1FNUA 3HOWH 2K04A 5L1JA 4FVMA 1WCMB 2FINB 2NZHA 3E0JA 4C3HB 3FPPA 1A63A 3J80c 2WE6A 3S15H 1UC8A 5C5MA 1JLLB 2RBMA 1G91A 1XWEA 4DV5H 1UNNC 3G48A 4UCVA 1UWVA 3F2BA 3T1YQ 1EQQA 4DXFA 1MZBA 3T1HQ 4O3QA 4ZAIA 1W96A 5T1GA 3G6XA 4ECVA 1C9OA 4RCOA 5IE8A 1IL2A 4ZRZA 3SE7A 5M9OA 1NUCA 3AFPA 1K73C 4FF2A 1SCUB 3JZFA 1UE7A 4B3SH 2F0JA 2L15A 3HOUB 2OT2A 4XTCS 4UAIA 4IQZA 1JOKA 1SSOA 4X66Q 1VQ5A 2R82A 1BUVT 1ZYRD 1DOKA 4A3DG 2I0QA 4WORA 2UUBH 3CCUA 4LF8L 3G6VA 4GN5A 4CMFA 2FPGB 2QW7A 1PH1A 2NB0A 4DR2H 1S03G 4K5VA 4F87A 5C44B 4DV0L 3MVVA 3SEBA 3UDFA 4B3RQ 2PW5A 2HGSA 4OX9H 4FFMA 1LYLA 5ELCA 2IW3A 1E7ZA 2NN6I 1SNPA 2RQXA 1J5EL 1KRSA 4MNOA 1LO5D 2BA0A 4J1MA 4C2MB 1I2LA 1S5CD 1VMPA 1CQIB 2F0QA 4DN4M 1F2ZA 1HTLD 3V2TA 4DL6A 4FNFA 3GTOA 1HNWH 3KBXA 1PH3A 3G8DA 2ZJTA 4DUZL 1DD2A 2FHTA 2UXCL 5KFZA 2BE5D 1MD2D 1S10A 4TSSA 3C0FB 2KUMA 3ULLA 2NVYA 1FD7D 3OSNA 2W9AA 1K3BC 4AQYQ 3GTMH 4CBVA 1C0AA 1KJ9A 3Q24A 1XXGA 2EXDA 3D0FA 3D8GA 4B3TL 2AUJD 3TY5A 5C4JB 3OUUA 4DV0Q 2XGPA 4AYBB 5C3XA 1YVCA 2JXMB 3VOTA 2CW7A 4FU0A 1J5EQ 5EWFA 1QG7A 3AX6A 2K03A 1HNZH 3T9BA 3DF7A 4GLWA 5C8YF 5EKIA 4TQUS 1VQ7A 3N41B 1N32H 1CHQD 1BOSA 4X3TA 4J9RA 2O2LD 1EKPA 4KTAA 1LT3D 4DNRB 1TWCB 1Q81C 4IFDG 4ZI7F 3N6XA 2ATLA 5E1FA 4K6DA 4S3SA 1VQ9A 4X64Q 1B7YB 5I5WA 1D5XC 3I7FA 2WIIB 2YU9B 1UEAB 2UXCQ 5E7NA 3GP7A 4Y7NB 2VUMB 3L4JA 2DUDA 1B6RA 3M9BA 5M3FB 2JEJA 5IYDH 4DV2L 1I3QA 2ZTDA 4B3TQ 4LFCH 4GNXB 3RUZA 3V6KA 2MUYA 2CW8A 3DHQA 3L7ZC 5IYZF 2K14A 2UU9H 3QZ8A 4O3OA 3KF6A 5IYDG 4A3CH 3BVMA 2JA9A 5DGBA 3PV0A 1W3SA 4XDXA 5KT4A 1TWGH 1LTRD 2UVUA 4QCLA 2JA5A 2WDTA 3Q23A 3QOJA 4ED0A 4A3CG 4ZUIA 3ONAB 3OTOH 4MA0A 1ZXTA 4GNXC 3RZOH 3KDFB 4OWWB 1DGSA 4GLXA 4O1NA 1QNUA 2SEBD 3LULA 1XMOL 1TXYA 3EIVA 1PFMA 4L1KA 2F52A 3BG5A 2C35B 3E5SA 2K5NA 3I8ZA 5A2QE 1Y1VG 2C2DA 2KHSA 5LMNW 5IT9L 2FLNA 1YJNA 2FLLA 4HSPA 4FFNA 3BACA 1B3QA 2JA7A 2IL8A 4TV8F 5FK9C 4F7XA 4JI8H 3PUXA 4JI6Q 1YNNC 4EBDA 1PYWD 4J9LA 4I55F 5GONF 3SK8A 1PYSB 4O2DA 1GGOA 4BBSG 4GN3B 5D8DA 1CSQA 4DV6L 4K0KH 2C22A 2R92B 4X6AH 4ME5A 4DV1H 2LY7A 5EKLA 1EHIA 3PIP3 5BYAA 5EPKA 1RK5A 2XWJB 2F4VL 3GIPA 1KD1C 3GTLA 5EGTA 2C28A 4GKKH 2H1EA 1AZQA 5KFNA 3HB9A 2RDJA 3JSNA 1AN7A 5COYA 3HOZG 1WCMA 1EIHA 1AZPA 3X3MA 2VOBA 4CKBA 1SNOA 2DY7A 4GC7A 2F0MA 3MXGA 1H9RA 3R93A 4A3BB 1STHA 4YHHQ 4ETSA 4RGTA 1XPUA 3P7JA 4H44C 3T1YH 3T1HH 1VF5C 1G6ZA 3KFUA 4A3IG 4LFBQ 5IIFA 1M90C 3DMUA 5KG5A 3RLNA 3VDYA 1RIPA 2RCFA 4DV7L 3IAYA 3S1QH 2KVMA 2F4VQ 3U0GA 4FF4A 3RLFA 4X66H 2PZUA 3CCQA 3M3YB 5FO8B 5DGHA 3KHGA 4R4IA 5FD6A 1FKAH 2SOBA 1DYQA 3S2DB 3MWMA 3VR4A 1R9TH 5KG7A 1K0RA 1SDFA 2QK4A 3RFCA 2WAQG 3RV3A 4C3IH 3MWYW 1KLGD 3M9OB 1ILQA 1QUQA 4ID6A 2R7ZG 1Y8PB 3R2IA 2A1HA 4NZNA 5LMUQ 2Z9HA 4UCUA 1SLJA 3Q8DA 4C2MA 2NVXA 5C4ZA 1TWAB 4F4ZA 4DL7A 1EWHA 2GPSA 1N33L 1DV1A 5JQWA 4F4YA 1YHAA 4HSVA 1VS0A 5IGGA 2YTYA 5LP6F 4DNIA 3S17H 4FP5D 3TIIA 2R7LA 2Z8LA 2PPBC 2BQRA 1HFNA 5EDWA 4MTDA 4G4KA 1E2VA 1TIID 1U4RA 2B8FA 4QWAA 2GVBA 4JBWA 5CBEE 5BWXA 4QIWA 4CC6A 1PFNA 2K05A 5IOCA 1RDPD 2E76C 2HVSA 4DV0H 4X3UA 5CV7A 2NVYH 4J9OA 4J15A 4ED2A 2K5QA 2CHBD 1J5EH 3FDSA 3X3NA 3H20A 3MFGA 5C5LA 1RF2D 4BY7B 5DQHA 4EG0A 1N33Q 2XRQD 3K3PA 2XRSD 4KY6A 1I4PA 4CHIA 1IW7D 4OO1G 2AKWB 1SN8A 1LV9A 3BVGA 4F8MA 2R8JA 2YU9A 3CCSA 5F9LA 4CJ0B 4QUFA 2Y0SE 2UXCH 3OSPA 1K0SA 2OTJA 2D2CC 3NQTA 5KFFA 1QNKA 3I12A 4EFBA 1M6VA 3CCJA 3UQ8A 1SYXB 4B3TH 4QSHA 4A3EH 5KX5F 3GQCA 3PUYA 1HA6A 2ASBA 1JOOA 2KCTA 4DKAC 1Q1BA 1H9MA 2JA6A 4RKBA 4A3EG 2I87A 1WTRA 3KJPA 2YZLA 4A3MH 3SNOA 4A3JH 2L9HA 3QFFA 2F0WA 3DM1A 2ZJPA 5I6WA 3RAQA 3KDFA 4K8JA 4L5TA 3AFQA 3TDQA 1IYUA 3F8TA 3PFFA 2K50A 2K1BA 1GSOA 4JI2L 4A3MG 1E2ZA 2GQRA 1HQRD 2PZWA 3GV6A 4A3JG 4L63B 3JZIA 5GAGC 2M9VA 5C0XJ 2SCUB 4J9QA 1ZETA 1WTQA 3H15A 1YNJD 2A74C 4PNYA 3K59A 4EBCA 1Z2NX 5M3MG 2B2VC 2A69C 1C30A 3NUCA 3OPOA 4A3DB 1BBXC 1K8MA 2TSSA 2YZMA 4JI6H 1CZGA 4IRCA 3KOJA 2L12A 4QB4A 4X65Q 2JP1A 5CV9A 2JA7H 2KHJA 5CB4F 1TWFH 1WFQA 1SFOA 2FJZA 2XGQA 3JAML 3C1FA 4DK6C 4KN4C 5ELOA 3GIKA 3OHAA 2EYPA 4HR7A 2B63B 3HOVH 2HJWA 4Q44A 1OXUA 4OWTB 4IIJF 3J81L 2EZVA 2MCTA 2J6UA 4FDBA 5FOBB 3H09A 1S68A 4ECSA 4IUTA 5F2DA 2B2TA 2Y4RA 1T36A 4I4TF 2R7NA 3KK7A 2FP4B 2AGQA 2W70A 3GTLH 5IODA 4R9WA 4DAAA 4NXMQ 4WBNF 5JUMA 5AFWA 5IGFA 1ULZA 3RB6A 3I4OA 2J6SA 4ZCKA 2YS7A 2JJQA 1F9SA 4MA5A 3GIQA 3IN5A 1I2KA 4OL7A 3ND8A 3TP8A 3CHBD 5FKAC 1ENFA 3JAMi 1H9SA 1FJGL 2L11A 1XPOA 2F4VH 1DZ1A 1GUWA 1SE4A 3RZDH 2W6MA 3MWEA 1F9PA 5KG4A 3T5JA 1SBBB 4JI5Q 1EEFD 1X56A 4TM5A 4E6NA 2VPSA 3PZPA 4R8UB 5HV6A 3E9HA 1O7YA 2IHEA 4F50A 4HCEA 4BWGB 3MR2A 2K5HA 2OTLA 1HR0W 3E5NA 2EPBA 3VA7A 3RGXA 2BCOA 4IFDI 1KJJA 2MO1A 1GSAA 2DPIA 1S97A 4BY1H 3ERQA 3VYSA 1JORA 4YJ3F 4DPGA 1N48A 2RSOA 4DQNA 2DY8A 1VBGA 4CDCC 1E4EB 2XCLA 2PYKA 5CE8A 4JBKA 1FJGQ 3LWEA 2NVXH 4BY1G 4PWQA 5E25A 1Y69U 4DU9A 4V0BA 1HJPA 4ME3A 2V4RA 2EY6A 1I6UA 1WD1A 1MGSA 3DXJC 2K5VA 5BPFA 5FPOA 1G2TA 3BG3A 1EQRA 3RR5A 1Y1VB 4B3ML 3T5LA 4M9UA 3K0XA 4O3RA 1L2ZA 1NAPA 4K5XA 4LF9L 2R86A 5KFDA 4JV2A 1BCPB 3DM3A 1KHIA 3GTJA 3GTQB 1VQPA 3OHXC 3KJOA 4FE2A 1EY6A 1DOMA 4YR3A 3RTXA 1N33H 1I4GA 4DAYA 5C3EH 3J7ZC 4HJ7A 4BBSB 4HJ9A 1YHBA 4RB0A 4ECUA 1C3OA 2B8GA 2W6PA 5FO7B 2WACA 3NGDA 3CC4A 5CORA 1B04A 2PMZE 3NC0B 4LSAA 5C3EG 4KKUA 2XWBB 1E4FT 1EUDB 4YIJA 3VR2A 3M4QA 4FS2A 1BCPC 2F1MA 1HRJA 3BAAA 4QJFA 4GKJQ 1I6HH 2B2UC 2R93A 1SYFA 1G6PA 1OWTA 1TS5A 3CEBA 2R84A 4B3MQ 2ZTEA 1ZAUA 4O7WA 2W6NA 5EPJA 2I8CA 1V1PA 3HOZB 2DNCA 3EA6A 5JJZA 2D62A 4JG2A 4LF9Q 1PK8A 4ZQIA 2BQ3A 5BMVF 3Q6SA 1V4YA 2CH4W 4EGVA 4J9MA 3A8KE 3TY8A 1UNSA 3S2HH 5M5XB 1WTVA 2COGA 3GO5A 3S16H 4FFRA 4ZKCB 4O4HF 2ZDQA 1E2WA 5I5VA 4IR9A 2JA6H 5KEEA 3AQQA 1WH2A 2AWOA 4QW9A 4Q0YA 3A8JE 3BYYB 4A3IB 2GPWA 2OCEA 3ITPA 4RMFA 5BWTA 2OWOA 1NJIC 1UUPA 2R6GA 3C2PA 3GTPH 3ETJA 2M05A 4NXNL 3BQ2A 5KS8A 4J6HA 3PIOA 1LM0A 2CZGA 1KQSA 1PX2A 3KBGA 3K5IA 1TY0A 3U9OA 4XIGS 3MXNB 3SK4A 1LTAD 3DEOA 5JVH3 3S1QB 1GXDC 4K2KA 4EGJA 2F3IA 2WAQB 3NBIA 5KFBA 2C2RA 3HKZE 3T9AA 4WJ4A 4BXXH 4Y52H 3TZUA 3PQIA 2F4IA 2R7ZB 5KFHA 1N9WA 1ICFB 5KNCA 1TA8A 1KBLA 3PR4A 2B63A 3GIMA 4BXXG 5KFCA 1KDBA 4DR7Q 1SFOH 4XXEA 2FMCA 4HMIA 2CFMA 5J39A 1PH5A 4TVAB 2VXWA 4KHPL 3H4BA 1F2LA 2MHVA 2PBZA 2HG8A 2IBKA 4IRDA 3LX0A 1PLFA 5KFIA 2LXKA 2UUAL 1SROA 3T9DA 4IPGA 1N34L 2JEAI 4O7NA 5LOVF 3MTSA 1FL0A 1EY5A 1JICA 3R8BA 5KGUA 1C7YA 2ATWA 1RCVD 3F8NA 4EEYA 1PZID 4NXMH 1B53A 5KFTA 4GN4B 5BWWA 1XMQL 1HNZQ 3S9WA 1N32Q 2HCCA 3CQZB 1Q3LA 2RDGA 1U4PA 1VQ8A 4HQ6A 3L3OC 3I4NB 4P74A 4E6IA 4A2AA 1K83A 2P0AA 3HOYH 1N36L 5KNDA 3GIJA 1QJOA 4NYEA 4O4JF 2QYZA 1CSPA 3FKIB 5EWEA 4KHPQ 1QOHA 5GAHC 3GTKB 1LTBD 1U5KA 4I7ZC 3HOYG 5HNEA 3TQYA 2N49A 1C8CA 1LTSD 5KFRA 2UUAQ 5DM63 1N34Q 1ZHSA 5DLGA 3E9IA 4LWCA 5LHY1 1GUNA 5KFLA 1ESRA 1WVLA 2NU7B 3H0GB 1YI2A 4A3LG 2Y0SG 5CC4A 1FR3A 2CW0C 3CP0A 1SJED 4IPCA 1M0TA 1EUCB 4OO1I 3KTMA 3I4MB 3GIIA 1EQVA 1XNRL 4HYKA 5LL6b 3T5HA 3LMLA 4JI0L 5JQGF 2WB1A 3PO3H 5KIXA 2KCNA 1E4EA 2K5DA 4O7ZA 4LJZC 3K58A 2F3VA 1YNND 1N36Q 2ICEC 1RYRA 1W2BA 4PV1C 1GOZA 1FJGH 4CKCA 3WO0A 4WJWA 3UFXB 1GUTA 4DLKA 3D31A 1N8RC 3S1MH 5LMNL 4A3MB 2NTTA 5I2YA 5KKNB 4PMWA 1CS0A 2DNEA 2LMCB 2N8NA 4Q8FA 4XYLB 1HZBA 5CM0A 3H40A 4YCUA 3KHRA 4M1UB 2AGPA 4JI8Q 4BBRH 5M5WH 5CBAE 3STBC 5M3MB 5BPHA 5KFYA 2KSWA 1CQVA 2Z04A 3K7AH 4YAJB 1X54A 4O3PA 3S1RB 2W9CA 4JI0Q 4LF7L 4IPHA 2CKZB 1PXUA 3GTJH 1K9MC 2VR1A 3N8DA 1Y1WH 1EKFA 3H91A 3G6JB 5IGEA 1V51A 3NTIA 1S5BD 2HCIA 5GROA 3A5UA 5FLXc 1TWFB 1CKOA 4JCVE 2PO4A 4JI7L 4GKJH 1Y1WG 3BJYA 4ILWA 3BZKA 5FLXW 4DNTB 3CMEA 4B3MH 3Q2OA 1C4QA 3CCVA 4DGZA 1ZKOA 2K01A 4AH6A 1E1TA 3FVQA 5D1PA 4LF9H 4Q0FA 4QY7A 2B3GA 3JRWA 2Q8RE 4H02A 2R93H 2A5HA 2QDLA 3HOWG 2UVVA 3J80W 3PF4A 4N8X1 2B2WA 4FO2A 3JZ6A 4ABNA 2E2JH 2AQ3B 2K5WA 3BABA 3AMUA 5DG8A 1UE5A 1OBGA 4GOPB 5C1OA 2R7DA 1SNCA 4HEDA 1ESFA 1TKWB 1Z6HA 4RG1A 3ZYYX 1JR0D 4FS1A 1X3FA 2I5HA 5K3WA 2Q8TA 3S24A 1BGWA 1KC7A 4UP7A 1JDBB 2C5CA 3SVMA 1MJEA 4KKTA 3MA2B 2I80A 1A8VA 2HUGA 4YR0A 1VQEA 2L1BA 4LUZA 5IP9H 3MWDA 4GOPC 3MEHA 4G3IA 3NPPA 4ED7A 2EY5A 1VQHA 1JX4A 1BF4A 5BWRA 4KD3A 4TUYF 4GLVB 1IXRA 5IP9G 2FK2A 2RDIA 1EZ8A 2J7ZA 4FBUA 1MSGA 4UP9A 5JVLA 1I50H 4C1NI 3V6HA 3D6WA 1A3UA 4PMCA 2K7VA 4JYAL 4JBMA 5IT9E 2J6TA 4A75A 3SK5A 4DR7H 1I1LA 1VF7A 4MIUA 4O4IF 2FK3A 1C48A 1HZ9A 4DR6L 4RFBA 4LF8Q 1JJGA 2FK1A 3T13A 1QVGA 5KFMA 2D0OA 1ML0D 1MI2A 3D4WA 3CCEA 3VNNA 2NU6B 3E0EA 1PH7A 5LXTF 2PW7A 3QIAA 2K28A 2QCPX 1NSNS 2ENBA 4C3JB 2I5LX 3K7UC 1PTOB 5CAEB 3T54A 2AGOA 4DV4L 1K1QA 3T9EA 2IP4A 1WTOA 4OONA 3PUWA 2BDOA 4HTHA 2VY3A 4RZQA 4DR4L 4DUZQ 4JYAQ 3V96A 5I5SA 3FKIA 2RDHA 5CA0F 2R6FA 5CV6A 2UXDL 3PO2H 4DR6Q 4KHPH 1EIGA 2NZOA 1VQKA 2X5RA 1K83H 5HURA 2EJMA 4NDXA 1I94L 3RGZA 1PTOC 2UUAH 3OUZA 5DAAA 1N34H 1A6XA 2ASDA 3H0GA 4GS3A 3PO2G 1KC8C 3HBLA 4O7VA 4DIMA 2VS1A 4XQQA 3DUZA 1YIJA 1S0NA 2OH2A 4HIOA 2HGXA 3GTGA 5EBDA 3U55A 4O3SA 4P75A 1B9MA 5DQGA 4EBEA 1YHQA 2A69D 5EPLA 1G2WA 2MJ8A 4DR4Q 1LTTD 5KFAA 3OIQA 2X69A 4WHXA 2W57A 3TZDA 3MZ5A 1I7LA 2G9HD 4Q43A 1OXSC 1I1MA 1N36H 1LT4D 1EEID 4R4CA 4R1JA 1EWCA 1RTNA 1AE3A 5NUCA 4QUCA 3MEFA 4DV2Q 1TAEA 5FLMH 5KFGA 3MAQA 1BBUA 2D5DA 1I94Q 4QIWE 1AN8A 4RH6A 3M9MB 1HFGA 2KA7A 1QVCA 2IX3A 4KJOA 4JI3L 2YRWA 4RHRA 3A7LA 4JXUA 4DL4A 5FLMG 4KY5A 2E2HB 3H4DA 4ED6A 1B1ZA 4MV9A 1J6QA 1PH2A 2F3WA 2DZDA 1ET6A 1EWIA 1E0BA 4Q4DA 3J7AF 4A3KH 5DG9A 3EJIA 2SNMA 3UDXA 4R7RA 4JI0H 2XGTA 3V4SA 2ODTX 4JV0A 3J7AK 3T56B 3RF2A 2ZTCA 1IBKL 1WTPA 1CKNB 1TVXA 3HZXA 3CXCA 2ALZA 4A3KG 1XMOQ 4KK7A 2CWAA 3HKZG 4XYQA 5LMNH 4DK0A 3D4RA 2F0TA 2I46A 4KI0A 4ECTA 2A6HC 5ELDA 3ICEA 2W6ZA 4NW2A 2HT1A 2KCMA 2O03A 5JPMC 4HJ5A 3TP6A 1LLRD 4IN3A 4C56C 4PBCA 2Z1CA 1SRUA 1I1KA 4DR1L 5BN5A 1BJTA 4DV6Q 2GLTA 1E4GT 5H80A 2FB9A 3Q8QB 2VUGA 4JI4L 4GOPA 1IBKQ 2NVQH 5K2MA 1BNZA 4I50F 3SI8A 3H3VH 3NQIA 1ONLA 4UPAA 4R4QA 5IYBH 1A9XA 3M4OB 4YJ2F 5JJLA 4Y8VB 3UZOA 4JI7H 5HY6A 4MV1A 2SDFA 1ZQ7A 1CT1D 4FGRA 3KYHC 4EQPA 5IYBG 1IYJB 1BCPF 2E8GA 2A73B 1HR0L 2OQKA 2MQHA 4A93H 4HJ8A 1NNXA 1JWSD 3OSOA 2UUCL 4DA2A 4DR1Q 1JWMD 4A3GH 1PH8A 4ECQA 5I9OA 2Z6KC 3P75A 1STYA 1T9HA 2FMMA 2G9DA 3RLOA 4C3IG 1S0OA 2ALYB 5KG3A 4F4WA 5C4XB 2F0IA 1KXLA 3G6YA 2Z0SA 4TV9F 1Q8KA 3MR3A 2UVWA 3F1ZA 1AH9A 4UY8C 4LFAL 4YWLA 4DV7Q 1KTAA 3MC0B 4MZ9A 3BZCA 3Q0AA 3TW6A 4NLGA 4PG3A 5C6AA 3S14B 3S1NH 4JV5L 4ZLTF 4H0LC 2HHHL 3TS0A 1S40A 4LF8H 2RGVA 3GTOH 1IBML 5JEAJ 5A35A 3U58A 3A54A 2VQDA 4AYBA 3E3XA 4GC6A 4HNUA 1EIYB 1HUNA 2JA8H 4G7ZC 3RN5A 4RKLA 5HGTA 2COJA 3JAME 1S5FD 1BCPD 2NZ1D 3KUPA 3L9AX 4KV6A 2R8KA 4A3FH 1W6JA 3NBZB 3DLLA 1RJQA 2FKLA 4IJHA 1TWCA 3OW2A 3KF8B 5LA6F 2EYHA 1GJXA 2P5ZX 4M7EA 3J81E 4DUYL 2ZXOA 2NVTH 3DWAA 2YW2A 4U6PA 1F77A 1D5MC 3HOXH 4DUZH 1V9PA 4A3FG 3LQSA 1E22A 1TWHB 4JYAH 2VUMA 3TEHB 2QB5A 3MR5A 4KD4A 1L1OB 1S3OA 3J81j 1JC7A 1KDAA 5T1IA 3IG0A 4DR6H 3A7AB 4GNXA 2ZM6L 2BQUA 2E2IB 1RJTA 5DLQE 5FPRA 2XIWA 1VQNA 3N43B 4U7CA 1S9FA 2R7MA 5I2XA 2XCPA 5ELNA 1IHZA 1I3QH 2ZJQA 4MTEA 4EQNA 1KABA 4HNTA 1L1OC 1BR9A 1Q86C 5I5TA 3RB0A 4CDFC 4O7LA 2QEXA 3N44B 3HOWB 1GD7A 4DUYQ 2F0LA 5C1PA 3O13A 3PSIA 4POGA 4HCSA 4DR4H 3T7AA 1GUOA 3GTGH 3S15B 2CVRA 4YB8B 3NWSA 2JA5H 3Q8SB 3SK6A 2RHSB 3U9TA 3VPDA 2VQEL 3G7LA 2CH4A 5KT7A 2AQ2B 3D3RA 4DV2H 3VR6A 1ET0A 4K8IA 3NEMA 1O75A 2UVRA 4KHZA 1GKHA 4JI1L 2JA5G 1KNEA 2E2JB 1I94H 2EQSA 1TS3A 4FM9A 3PW7A 1VAJA 4IAJA 5M5YH 1GHJA 1L0XB 4TQSA 2NU9B 2BH8A 1AW7A 3BVZA 5ELBA 2RF4A 4APVA 1VQMA 4PMBA 2R92A 5TSSA 2IWHA 3DTFA 2HHFB 1JXLA 4R4TA 3PR5B 3G71A 3QJYA 2YCHA 5IT9c 4JI2Q 2CQOA 5EZYF 2ZT9C 2JA7G 3J7AV 2ZXRA 1KIXA 1XMOH 1G2SA 3L4KA 5IT9W 3PCOB 2H5XA 2MGSA 1X3QA 3KXYT 2XIGA 3U4ZA 2ES2A 2YS6A 4JI1Q 2F03A 2W6OA 3HOVG 4J0MA 1VQAA 5KFEA 2F0DA 4MTKA 4ZOLF 4Q8EA 1B6SA 2AWNA 5AJ3L 4JI3H 3QB3A 2X6LA 1SXTA 3KLWA 3AU7A 4QL5A 4I7AA 2E5LL 2DAAA 1WTXA 1IBLL 2M00A 3GTMB 4FFPA 1WCMH 4UFZA 4C3HH 4KY7A 4DAPA 5L9XA 4DV6H 4O7TA 2V4QA 5IWAL 1D1KA 4C5AA 1M7JA 1B8AA 1IBKH 4LF5L 5KG1A 5DGIA 4XT1B 2K6AA 1EY4A 3PGZA 1WCMG 2Z6KA 2IX1A 4O7RA 2VB2X 2FFKB 3AYHB 4N8FA 3MR6A 1VQCA 2HD3A 2CW0D 4M8AA 4O42A 2IY5B 3BJUA 2VL6A 1B9NA 3I70A 3HOUH 1UE1A 3UYYA 3J81i 2RSNA 4JC0A 1CA5A 2NN6H 2QA4A 4CE5A 4O84A 4ZYSA 1STEA 4JBJA 2GN5A 2R3ZA 5C5JA 2OF1A 2PZTA 1KLUD 2SNSA 2O5JC 3TIGA 2RGRA 2V9WA 1Q1EA 3UI2A 1OTCA 3OOCA 4IWXA 1IBLQ 1EFWA 4RAUC 3SGIA 4DR1H 1TWAA 3DTGA 3TSSA 3NTKA 2PMZB 3T16A 5C44H 3F2DA 1AUVA 1XYIA 5IWAQ 4LMYA 4RNOA 2RKSA 1MJCA 4BWSC 4RZRA 2PI2A 3STBD 1JB7A 4DV7H 1SNQA 4C2MH 2R61A 3PN1A 1TWGB 4ZKBB 5JEAH 3K81C 3IKJA 4O3NA 1MSHA 2JQOA 2AMCB 4RCNA 5T14A 3I3CA 1PFBA 5D3IB 1DXMA 5A2QW 3EVQA 2JEFA 2K32A 2LFNA 3RZOB 5F9NA 1WTWA 1T5XD 3BZDB 3UE1A 1HR0H 1ZEQX 1CQFA 4MV8A 1ASYA 4RA8A 3W5OA 1KJ8A 1II3A 2D9UA 3W1GA 5C4JH 1KL9A 2Q2TA 2Q7DA 1SE3A 3A56A 4K6LA 1SYDA 3KF8A 4A4IA 1HNXL 5I5UA 1SMYC 3UDIA 2V1CC 5J1ZA 1EFID 5DGAA 4LFAH 3RV4A 2JN4A 3RD4A 3RIZA 2W9BB 3I56A 2F0GA 3T4AC 1GUGA 4X3KA 3D6CA 1PA6A 4YY3L 1EY7A 2F0EA 5CGKA 4XQJA 2FPPB 1H9JA 1TWCH 2F0FA 2HVQA 1VQBA 1SYCA 5FLXL 1YBYA 2HHHH 2A1AA 4LUVA 3HKZB 2YU9H 1W93A 2A68C 3SXHA 4C1NK 1A2TA 3F2UA 4Y7NH 2VUMH 3KAKA 1O78A 3R5XA 3BU2A 5M3FH 2DABA 4ED1A 4OHJA 4DK1A 1SMXA 3J80L 2B2VA 2HDLA 4RUAA 1HA5A 2EYLA 4B3SL 1HNXQ 2ASJA 1RKNA 2EY2A 1KTKA 4MV3A 1K1SA 3OMGA 5DG7A 2HDKA 2IJ0A 4DUYH 3K5MA 1TS2A 3PW5A 4O86A 2WB1E 3K5OA 1JE5A 2LSSA 5KYLA 5C0XH 4IWYA 2WKDA 4YY3Q 4L5QA 2FLPA 3EPIA 4DR2L 2JA6G 3K80C 3ER0A 2ZM6H 4YCWA 4NPSA 3J7YW 4FFOA 5C0XG 2FJ2A 1PYBA 2Q2IA 5I4DA 2NVQB 1CQJB 3UZBA 5J2TF 2DIKA 1PRTB 3M85A 1IOVA 4ECWA 1PZJD 4LF6L 2YTVA 1QCBD 1IYDA 1V43A 2HDMA 3RNUA 1F2YA 2F0UA 3B6YA 1HNWL 3J80i 1ICWA 2HHFA 1LT5D 5DM73 3U54A 1R9TB 2EYJA 5K36H 3KALA 2J9GA 4DF7A 4C3IB 3P20A 4XZ3B 4TKOB 4JI2H 3DWQA 1SEBD 3H3VI 2EJ2A 1PRTC 2R92H 3LWUA 5K36G 1JT8A 2VQEH 4NXNQ 1GUSA 2L4NA 1X3PA 1PHJA 1EL0A 1TR5A 3NBYB 4K6NA 2KECA 4IPDA 4JI1H 5D1OB 3C3LA 4RB3C 3CRLC 3S17B 2ZJRA 1HH2P 5KG2A 3CPWA 1CUKA 5E4XA 3HKSA 3PIO3 2F0OA 1VMCA 3JAMc 4LF6Q 5KFSA 5E3FA 2CWPA 1FNVA 2EOTA 5D14A 4R4OA 3H6MA 1KNAA 1S0MA 3DWPA 3JAMW 3E6ZX 2MO0A 5KG0A 4A3BH 2DLNA 3MFYA 1PTOD 2KENA 4IUUA 5BWVA 5IYCH 3T9CA 1VQGA 5IP7H 2NVYB 1JOQA 2VQFL 5DEHA 2K4KA 5FNVF 1BBWA 3SE0A 2K75A 3GV3A 5IYCG 5JOBA 1X65A 2UU9L 5FJ8H 5J22A
chains in the Genus database with same CATH topology
1BVSA 3M3YH 2N78A 1NE3A 2I5MX 2IHFA 2JE6I 5FJ8G 4IFDJ 3CCRA 4NB3A 3S2DH 1L0WA 1IBLH 1XMQQ 4CC5A 5GAEC 5IWAH 4BA2I 1S72A 1Q82C 1H95A 1TWAH 1UEBA 4HIDA 3M4PA 5DISC 3PF5A 3PO3G 4A76A 1WI5A 3NENA 3KF6B 1BKBA 4K0KL 2YTXA 1QVFA 4POFA 4DV1L 1X9NA 1XNRQ 4BBRG 4KLKA 4GKKL 4BY7H 1NMFA 4YWMA 5BR8L 3N42B 5LMNQ 3I2ZA 1E1OA 1X6OA 4BY7G 2Q2HA 4DR3L 1LTLA 1GM5A 4LSXA 3FP9A 1IZ6A 4HIMA 2PQAB 1ASZA 1HNXH 1MIUA 3LGJA 4LF7Q 2YYZA 2R93G 3CPFA 4L5SA 5GQOA 5BR8Q 4YY3H 1XNQL 1M1KC 1Q46A 3ZJYC 2QGQA 1Z9FA 4DR3Q 4JI7Q 4B3RL 4DV3L 2YV5A 4UCTA 4IO9A 5H1SE 2HVRA 4A3DH 1A0IA 2K52A 2A8VA 3CF5A 4AQYL 4PZ6A 1XNQQ 4NXNH 3L2PA 4DAMA 1D7QA 5D1OA 4DV3Q 2B63H 1MKHA 1XTDA 1QUQB 1U0LA 3NBHB 4LUOA 2EIFA 1QZGA 4LF6H 2B63G 5EAYA 1K8GA 3CCLA 2Q2UA 4RB2C 2IX0A 4X64L 4HJAA 2B29A 4LNQA 1E24A 1G291 2HQLA 3CC7A 2HIXA 3EBEA 1EUJA 1XMQH 1Q7YC 4PZ8A 4DV4Q 2LXJA 3L0OA 4RAYA 2VNUD 4APMA 3A0JA 3TRZA 4DK3C 5FD5A 1YEZA 2VQFH 3CVZA 1XK5A 4LH6A 1VQOA 2UXDQ 1K3RA 5GADC 3EN2A 4JI6L 3PIPA 2WB1G 1VQ6A 4AYBE 3UE0A 3I55A 1Y1VH 1XNRH 2ID0A 3BA9A 4X62L 1SE8A 3CAMA 3GTQH 4MTNA 3ULPA 1K8AC 3K3VA 5C0XI 4BBSH 1LUZA 3WWVA 4YHHL 4JI3Q 2KHIA 2PQAA 4LFBL 2N3SA 2GVAA 4UCOA 4X62Q 1GYFA 3HOZH 1P16A 4LF7H 5JJKA 3JC66 3UDGA 5M5XH 2UXBL 5BR8H 1XPRA 5J3BA 4A3IH 4L5RC 4DR3H 1OXTA 2MNAA 5LMUL 2MFIA 4DR5L 3PUVA 4JOIC 4A93G 1AE2A 4JI4Q 1YZ6A 4A3GG 1RL2A 4IOCA 2UXBQ 2R7ZH 1XNQH 1SEIA 4GLAC 4B3RH 4DV3H 1B70B 1YITA 4RB1A 1HR0Q 1L2FA 1VQIA 3GB8B 2UUCQ 3M4IA 4DR5Q 2CCZA 1X3EA 3GDEA 4UCRA 3CW2C 3U50C 2JA8G 4LFAQ 4AQYH 3CQZH 2FE3A 3I4NH 4JV5Q 1JJCB 2HHHQ 3GD7A 1PFSA 1IBMQ 3HOXG 3KAJA 1Z2OX 4I7HA 3FKIH 1UE6A 3I4NG 3GTKH 1XJVA 4DAYB 3FKIG 1E3PA 1HZCA 4X64H 3H0GH 3TS2A 4DV4H 3I4MH 3CMAA 3H0GG 2PI2E 2UXDH 2FXQA 2ZM6Q 3I4MG 2RHQB 3ERSX 3TREA 2BH2A 4X65L 4A2BA 4LF4L 1NTGA 4OXPA 1EYGA 4LW1A 5M3MH 4YCVA 1VQDA 5EOYA 1FGUA 1CKNA 2DGYA 1NY4A 3S1RH 1ZHQA 2VQEQ 1P8LA 3F2CA 2IT1A 4NXML 1PH4A 5IY0A 3CC2A 2RCNA 3FMAA 1PH6A 4LF4Q 4YWKA 1SR3A 4X62H 4IJLA 3HXLA 4PZ7A 1VQ4A 4JI5L 3RJ0A 4JOIA 3M7NA 2OQ0A 2VZAA 3QWUA 4YHHH 2KBNA 3G6EA 1A62A 5AJ3Q 1G51A 1WOCA 3HOUG 4LFBH 2E5LQ 4EX5A 2NN6G 2WP8J 2WYOA 1M0WA 1JMCA 1Y14B 1VQJA 4JI4H 4LF5Q 1WJJA 3W1BA 5C44G 2UXBH 1Q12A 4UP8A 3JSLA 4HIKA 5HGQA 4UCSA 4RAZA 5LMUH 5JEAG 3TY9A 4AIMA 2UUCH 4DR5H 1VCIA 3ULJA 3CCMA 3RN2A 1VQFA 1Z47A 1X55A 1PVOA 4C3JH 3OYYA 1PV4A 4AYBG 4GKJL 1L1OA 1V1QA 1KRTA 4EEQA 4JV5H 1CKMA 3A74A 1I5FA 3PUZA 1IBMH 2JK8A 4DV5L 4ALPA 3N40P 3K8AA 4EQ5A 2VUMG 5M3FG 1YNXA 2UUBL 3U4VA 4DV5Q 4OX9L 1OXVA 4P73A 4B3SQ 2R7FA 2BA1A 2E2HH 3IRBA 4DR7L 1OXXK 2UUBQ 4O0AA 1O7IA 2AHOB 4PDBA 4DR2Q 1NMGA 4BA1I 4OX9Q 1KAWA 2R92G 4X65H 1HNZL 3GJXB 4QGUA 1YJWA 1N32L 4LF4H 1XDNA 1HNWQ 3J81c 3J81W 2XTIA 2D0PA 1WYDA 4LFCL 1YJ9A 4A3BG 3FHWA 2WFWA 5IP7G 2HIVA 4DRFA 3HFZB 3M4OH 4IOAA 4LH7A 3OTOL 2E5LH 2WAQE 2A19A 2VW9A 1EIFA 5JJIA 4OWXB 4LF5H 2VQFQ 1JJ2A 4A3LH 1PH9A 4LFCQ 4JI5H 5C4XH 2UU9Q 4JI8L 5C4XG 3AEVA 4WJ3M 3G4SA 3S14H 3A5ZB 3OTOQ 1EOVA 1GVPA 4MV7A 1NBWA 4P71A 1D8LA 1QZHA 3EYYA 1TWHH 1FVIA 3NELA 3T1YL 4K0KQ 3T1HL 2E2IH 1GO3E 4DV1Q 4P72A 1HZAA 1VQLA 2JEBI 1X3GA 4X66L 2PNHA 4GKKQ 1Z2PX 4QQBX 4EFEA 3J7A5 3CD6A 3BA8A 3HOWH 2NZHA 1A63A 3J80c 2WE6A 3S15H 4DV5H 3G48A 4UCVA 1UWVA 3F2BA 3T1YQ 1EQQA 1MZBA 3T1HQ 1C9OA 5IE8A 1IL2A 3AFPA 1K73C 1UE7A 4B3SH 2L15A 4XTCS 4X66Q 1VQ5A 4A3DG 2I0QA 2UUBH 3CCUA 4LF8L 4GN5A 1PH1A 4DR2H 1S03G 4DV0L 3UDFA 4B3RQ 2HGSA 4OX9H 1LYLA 1E7ZA 2NN6I 1J5EL 1KRSA 4MNOA 2BA0A 1HNWH 1PH3A 2ZJTA 4DUZL 2UXCL 3C0FB 3ULLA 4AQYQ 3GTMH 1C0AA 4B3TL 2EXDA 3D0FA 3TY5A 4DV0Q 1YVCA 2CW7A 1J5EQ 1HNZH 3DF7A 4TQUS 1VQ7A 3N41B 1N32H 1Q81C 4IFDG 3N6XA 1VQ9A 4X64Q 1B7YB 3I7FA 2UXCQ 5E7NA 3L4JA 2DUDA 3M9BA 5IYDH 4DV2L 2ZTDA 4B3TQ 4LFCH 4GNXB 2CW8A 3L7ZC 2K14A 2UU9H 3KF6A 5IYDG 4A3CH 2JA9A 3PV0A 1W3SA 1TWGH 2WDTA 4A3CG 3OTOH 4GNXC 3RZOH 3KDFB 4OWWB 1DGSA 4GLXA 1XMOL 1TXYA 3EIVA 2F52A 2C35B 2K5NA 1Y1VG 5LMNW 1YJNA 4JI8H 3PUXA 4JI6Q 1PYSB 4O2DA 4BBSG 4GN3B 1CSQA 4DV6L 4K0KH 4X6AH 4DV1H 2F4VL 1KD1C 4GKKH 3JSNA 1AN7A 3HOZG 2VOBA 4YHHQ 4ETSA 1XPUA 3T1YH 3T1HH 3KFUA 4A3IG 4LFBQ 1M90C 3RLNA 3VDYA 1RIPA 4DV7L 3S1QH 2F4VQ 4X66H 3RLFA 3CCQA 4R4IA 5FD6A 1FKAH 3MWMA 1R9TH 1K0RA 2WAQG 4C3IH 1QUQA 2R7ZG 5LMUQ 4UCUA 1SLJA 3Q8DA 1N33L 1YHAA 1VS0A 2YTYA 4DNIA 3S17H 4MTDA 2GVBA 4JBWA 4CC6A 2HVSA 4DV0H 2NVYH 4J15A 1J5EH 3H20A 1N33Q 4OO1G 2AKWB 1SN8A 3CCSA 2Y0SE 2UXCH 2OTJA 4EFBA 3UQ8A 3CCJA 1SYXB 4B3TH 4A3EH 3PUYA 2ASBA 2KCTA 4DKAC 1Q1BA 4A3EG 3KJPA 4A3MH 4A3JH 2ZJPA 3KDFA 4L5TA 3AFQA 3F8TA 2K50A 4JI2L 4A3MG 4A3JG 5GAGC 5C0XJ 3H15A 1Z2NX 5M3MG 4JI6H 3KOJA 4X65Q 2JA7H 2KHJA 1TWFH 1WFQA 4DK6C 5ELOA 3HOVH 1OXUA 4OWTB 2MCTA 4FDBA 1S68A 3GTLH 4NXMQ 3I4OA 2JJQA 3JAMi 1FJGL 1XPOA 2F4VH 3RZDH 4JI5Q 1X56A 4E6NA 2VPSA 3E9HA 2IHEA 2K5HA 2OTLA 1HR0W 3RGXA 4IFDI 2MO1A 4BY1H 4DPGA 4JBKA 1FJGQ 2NVXH 4BY1G 1HJPA 4ME3A 1I6UA 2K5VA 5FPOA 1EQRA 3RR5A 4B3ML 3K0XA 1L2ZA 4LF9L 3DM3A 1KHIA 1VQPA 3KJOA 3RTXA 1N33H 5C3EH 3J7ZC 4HJ7A 4HJ9A 1YHBA 4RB0A 3CC4A 1B04A 2PMZE 3NC0B 4LSAA 5C3EG 1E4FT 3M4QA 3BAAA 4QJFA 4GKJQ 1I6HH 1G6PA 4B3MQ 2ZTEA 2D62A 4JG2A 4LF9Q 3TY8A 3S2HH 3GO5A 3S16H 2JA6H 3AQQA 1WH2A 2AWOA 4Q0YA 2OCEA 4RMFA 2OWOA 1NJIC 2R6GA 3GTPH 4NXNL 3PIOA 1LM0A 1KQSA 4XIGS 3MXNB 2F3IA 3HKZE 4WJ4A 4BXXH 4Y52H 1N9WA 1TA8A 4BXXG 4DR7Q 1SFOH 2CFMA 1PH5A 4TVAB 4KHPL 2LXKA 2UUAL 1SROA 4IPGA 1N34L 2JEAI 1FL0A 1C7YA 3F8NA 2ATWA 4NXMH 4GN4B 1XMQL 1HNZQ 1N32Q 1VQ8A 4P74A 4A2AA 3HOYH 1N36L 1CSPA 4KHPQ 5GAHC 1U5KA 3HOYG 3TQYA 2N49A 2UUAQ 1N34Q 1ZHSA 3E9IA 4LWCA 1YI2A 4A3LG 2Y0SG 3CP0A 4IPCA 1M0TA 4OO1I 1XNRL 5LL6b 3LMLA 4JI0L 3PO3H 1N36Q 1W2BA 1FJGH 3D31A 1N8RC 3S1MH 5LMNL 4PMWA 2N8NA 1HZBA 4YCUA 4JI8Q 4BBRH 5M5WH 3STBC 2KSWA 3K7AH 1X54A 4JI0Q 4LF7L 4IPHA 2CKZB 3GTJH 1K9MC 1Y1WH 3A5UA 5GROA 5FLXc 1CKOA 4JCVE 4JI7L 4GKJH 1Y1WG 3BZKA 5FLXW 3CMEA 4B3MH 3CCVA 4AH6A 1E1TA 5D1PA 4LF9H 4QY7A 2B3GA 4H02A 2R93H 3HOWG 3J80W 3PF4A 2E2JH 3BABA 1UE5A 4GOPB 2R7DA 4RG1A 1X3FA 2I5HA 3S24A 1BGWA 4UP7A 1MJEA 1A8VA 1VQEA 4LUZA 5IP9H 4GOPC 1VQHA 4GLVB 1IXRA 5IP9G 4UP9A 1I50H 4JYAL 4JBMA 4A75A 4DR7H 1HZ9A 4DR6L 4LF8Q 1JJGA 1QVGA 2D0OA 3CCEA 3VNNA 3E0EA 1PH7A 2I5LX 3K7UC 4DV4L 4OONA 3PUWA 2VY3A 4RZQA 4DR4L 4DUZQ 4JYAQ 2UXDL 3PO2H 4DR6Q 4KHPH 2NZOA 1VQKA 1K83H 1I94L 3RGZA 2UUAH 1N34H 4GS3A 3PO2G 1KC8C 2VS1A 1YIJA 4HIOA 4P75A 1YHQA 4DR4Q 2W57A 1N36H 1OXSC 4R4CA 4R1JA 1AE3A 3MEFA 4DV2Q 1TAEA 5FLMH 1BBUA 1I94Q 4QIWE 1QVCA 4JI3L 5FLMG 4MV9A 1J6QA 1PH2A 1EWIA 4A3KH 3UDXA 4R7RA 4JI0H 2XGTA 3J7AK 3RF2A 2ZTCA 1IBKL 1CKNB 3CXCA 4A3KG 1XMOQ 2CWAA 3HKZG 5LMNH 4KI0A 3ICEA 2HT1A 2KCMA 2O03A 4HJ5A 1SRUA 4DR1L 1BJTA 4DV6Q 1E4GT 2VUGA 4JI4L 4GOPA 1IBKQ 2NVQH 3H3VH 4UPAA 5IYBH 4R4QA 5JJLA 4JI7H 5HY6A 3KYHC 5IYBG 1IYJB 2E8GA 1HR0L 2OQKA 2MQHA 4A93H 4HJ8A 2UUCL 4A3GH 4DR1Q 1PH8A 2Z6KC 1T9HA 3RLOA 2ALYB 1KXLA 2Z0SA 1Q8KA 3F1ZA 1AH9A 4UY8C 4LFAL 4YWLA 4DV7Q 4MZ9A 3BZCA 4PG3A 3S1NH 4JV5L 2HHHL 3TS0A 1S40A 4LF8H 2RGVA 3GTOH 1IBML 5JEAJ 3U58A 1EIYB 2JA8H 3RN5A 4A3FH 3NBZB 3DLLA 4IJHA 3OW2A 3KF8B 4M7EA 4DUYL 2NVTH 3HOXH 4DUZH 1V9PA 4A3FG 1E22A 4JYAH 3TEHB 1L1OB 1S3OA 3J81j 3IG0A 4DR6H 4GNXA 2ZM6L 5DLQE 5FPRA 1VQNA 3N43B 5ELNA 1I3QH 2ZJQA 4MTEA 1L1OC 1Q86C 2QEXA 3N44B 1GD7A 4DUYQ 3PSIA 4DR4H 4POGA 3GTGH 2JA5H 2RHSB 2VQEL 4DV2H 1O75A 3NEMA 4KHZA 1GKHA 4JI1L 2JA5G 1I94H 2EQSA 4FM9A 4IAJA 5M5YH 2BH8A 2RF4A 4APVA 1VQMA 4R4TA 3G71A 2YCHA 5IT9c 4JI2Q 2CQOA 2JA7G 1KIXA 1XMOH 3L4KA 5IT9W 3PCOB 2H5XA 3KXYT 2XIGA 3U4ZA 2ES2A 4JI1Q 3HOVG 4J0MA 1VQAA 2AWNA 5AJ3L 4JI3H 4QL5A 3KLWA 2E5LL 1IBLL 4UFZA 1WCMH 4C3HH 4DV6H 5IWAL 1B8AA 1IBKH 4LF5L 3PGZA 1WCMG 2Z6KA 2IX1A 3AYHB 1VQCA 2IY5B 3BJUA 2VL6A 3HOUH 1UE1A 3J81i 4JC0A 2QA4A 4JBJA 2GN5A 2RGRA 1Q1EA 1OTCA 1IBLQ 1EFWA 4DR1H 3SGIA 3F2DA 5C44H 5IWAQ 4LMYA 1MJCA 4BWSC 2PI2A 3STBD 1JB7A 4DV7H 4C2MH 3PN1A 3K81C 2JQOA 2AMCB 5A2QW 3UE1A 1HR0H 1ASYA 3W5OA 3W1GA 5C4JH 1KL9A 2Q2TA 1HNXL 4A4IA 3UDIA 2V1CC 4LFAH 3RIZA 3I56A 1PA6A 4YY3L 2HVQA 1TWCH 1VQBA 1YBYA 2HHHH 2A1AA 4LUVA 2YU9H 3KAKA 4Y7NH 2VUMH 3BU2A 5M3FH 1SMXA 4B3SL 1HNXQ 4DUYH 2WB1E 1JE5A 2LSSA 4YY3Q 4L5QA 4DR2L 2JA6G 3K80C 3ER0A 2ZM6H 4YCWA 4NPSA 5C0XG 1PYBA 2Q2IA 3M85A 4LF6L 2YTVA 1V43A 3RNUA 3B6YA 1HNWL 3J80i 3KALA 4JI2H 3H3VI 2R92H 5K36G 1JT8A 2VQEH 4NXNQ 1PHJA 3NBYB 4IPDA 4JI1H 5D1OB 4RB3C 2ZJRA 1HH2P 3CPWA 1CUKA 3HKSA 3JAMc 4LF6Q 2CWPA 4R4OA 3JAMW 2MO0A 4A3BH 2KENA 5IYCH 1VQGA 5IP7H 2VQFL 2K4KA 1BBWA 2K75A 5IYCG 1X65A 2UU9L 5FJ8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VNN A;  4DNI A;  3E0E A;  3S17 H;  3W1B A;  1PH7 A;  1BVS A;  5C44 G;  1Q12 A;  3M3Y H;  2N78 A;  1NE3 A;  2I5L X;  2I5M X;  2GVB A;  3K7U C;  4JBW A;  2IHF A;  4UP8 A;  3JSL A;  2JE6 I;  5FJ8 G;  4DV4 L;  4IFD J;  3CCR A;  4NB3 A;  4HIK A;  4OON A;  3PUW A;  3S2D H;  2VY3 A;  5HGQ A;  1L0W A;  4DR4 L;  1XMQ Q;  4CC6 A;  4UCS A;  4DUZ Q;  4JYA Q;  4CC5 A;  5JEA G;  5GAE C;  2HVS A;  4BA2 I;  2UXD L;  3TY9 A;  2NVY H;  1S72 A;  1Q82 C;  3PO2 H;  4AIM A;  4DR6 Q;  4J15 A;  2NZO A;  1VQK A;  1K83 H;  1H95 A;  1TWA H;  1UEB A;  1VCI A;  4HID A;  1I94 L;  3ULJ A;  3M4P A;  5DIS C;  3CCM A;  3PF5 A;  3RN2 A;  1N33 Q;  4GS3 A;  3PO3 G;  3PO2 G;  4A76 A;  1VQF A;  1Z47 A;  1WI5 A;  1KC8 C;  3NEN A;  1X55 A;  1PVO A;  2VS1 A;  4C3J H;  3OYY A;  1YIJ A;  1PV4 A;  4OO1 G;  2AKW B;  1SN8 A;  3KF6 B;  4AYB G;  4HIO A;  4GKJ L;  3CCS A;  1L1O A;  4P75 A;  1BKB A;  1V1Q A;  2Y0S E;  1KRT A;  4EEQ A;  1YHQ A;  4K0K L;  1CKM A;  2YTX A;  3A74 A;  1QVF A;  4POF A;  2OTJ A;  1I5F A;  3PUZ A;  4DR4 Q;  4EFB A;  3UQ8 A;  3CCJ A;  2JK8 A;  4DV1 L;  4DV5 L;  4A3E H;  1X9N A;  1OXS C;  1XNR Q;  4ALP A;  4R4C A;  4R1J A;  4KLK A;  4BBR G;  3PUY A;  2ASB A;  2KCT A;  4DKA C;  1AE3 A;  1Q1B A;  3MEF A;  4DV2 Q;  3K8A A;  4GKK L;  1TAE A;  5FLM H;  1BBU A;  4A3E G;  4EQ5 A;  2VUM G;  4BY7 H;  1I94 Q;  1NMF A;  4QIW E;  3KJP A;  4YWM A;  4A3M H;  5M3F G;  1QVC A;  5BR8 L;  4A3J H;  5LMN Q;  3I2Z A;  4JI3 L;  2ZJP A;  3KDF A;  5FLM G;  4L5T A;  1E1O A;  3AFQ A;  1X6O A;  1YNX A;  2Q2H A;  1J6Q A;  3F8T A;  4DR3 L;  1PH2 A;  2K50 A;  4BY7 G;  1LTL A;  2UUB L;  1EWI A;  1GM5 A;  4A3M G;  4JI2 L;  4A3J G;  4A3K H;  3FP9 A;  3UDX A;  1IZ6 A;  2XGT A;  3U4V A;  5GAG C;  5C0X J;  4HIM A;  2ZTC A;  1IBK L;  3H15 A;  2PQA B;  1CKN B;  4DV5 Q;  4OX9 L;  3CXC A;  1OXV A;  4A3K G;  5M3M G;  1ASZ A;  1XMO Q;  1MIU A;  2CWA A;  3HKZ G;  3LGJ A;  4LF7 Q;  4KI0 A;  2YYZ A;  2R93 G;  3CPF A;  3ICE A;  4P73 A;  4L5S A;  3KOJ A;  4B3S Q;  5GQO A;  4X65 Q;  5BR8 Q;  2R7F A;  3CCE A;  2HT1 A;  2KHJ A;  2JA7 H;  2KCM A;  1XNQ L;  1TWF H;  1Q46 A;  1WFQ A;  2BA1 A;  1M1K C;  3ZJY C;  3IRB A;  2E2H H;  4HJ5 A;  4DR7 L;  1OXX K;  2QGQ A;  4DK6 C;  1Z9F A;  4DR3 Q;  4JI7 Q;  4B3R L;  1SRU A;  2UUB Q;  5ELO A;  2YV5 A;  4O0A A;  4DV3 L;  4DR1 L;  1O7I A;  4UCT A;  3HOV H;  4DV6 Q;  2AHO B;  1OXU A;  4OWT B;  4DR2 Q;  4FDB A;  2VUG A;  4JI4 L;  4IO9 A;  4GOP A;  1IBK Q;  1NMG A;  4BA1 I;  2NVQ H;  5H1S E;  4OX9 Q;  1S68 A;  2HVR A;  3H3V H;  1KAW A;  4A3D H;  2R92 G;  1A0I A;  2K52 A;  1HNZ L;  4UPA A;  5IYB H;  4R4Q A;  3GJX B;  2A8V A;  3CF5 A;  4QGU A;  1YJW A;  3GTL H;  1N32 L;  5JJL A;  4NXM Q;  4AQY L;  5HY6 A;  3I4O A;  1XDN A;  1HNW Q;  4PZ6 A;  3KYH C;  5IYB G;  1XNQ Q;  3J81 c;  2JJQ A;  1IYJ B;  2E8G A;  1HR0 L;  2OQK A;  2MQH A;  3L2P A;  4A93 H;  4HJ8 A;  4DAM A;  1D7Q A;  5D1O A;  2UUC L;  4DV3 Q;  4A3G H;  4DR1 Q;  2XTI A;  1MKH A;  1XTD A;  1PH8 A;  2B63 H;  1QUQ B;  2D0P A;  1WYD A;  1U0L A;  2Z6K C;  4LFC L;  1T9H A;  3RLO A;  3JAM i;  1FJG L;  1YJ9 A;  3NBH B;  4A3B G;  2ALY B;  4LUO A;  1XPO A;  3FHW A;  2WFW A;  1KXL A;  2EIF A;  2Z0S A;  5IP7 G;  1Q8K A;  2HIV A;  3RZD H;  3F1Z A;  1QZG A;  2B63 G;  4UY8 C;  1AH9 A;  4DRF A;  5EAY A;  4YWL A;  4DV7 Q;  1K8G A;  4LFA L;  4JI5 Q;  1X56 A;  2Q2U A;  3HFZ B;  3CCL A;  4E6N A;  2IX0 A;  4MZ9 A;  3M4O H;  4X64 L;  4HJA A;  2B29 A;  4IOA A;  3BZC A;  3E9H A;  4PG3 A;  4LH7 A;  2IHE A;  3S1N H;  4JV5 L;  3OTO L;  2HHH L;  2K5H A;  3TS0 A;  1S40 A;  1HR0 W;  2WAQ E;  2OTL A;  3GTO H;  1IBM L;  5JEA J;  4LNQ A;  3U58 A;  4IFD I;  1E24 A;  2A19 A;  2MO1 A;  1G29 1;  2VW9 A;  1EIF A;  4BY1 H;  2HQL A;  5JJI A;  4OWX B;  1EIY B;  2JA8 H;  3RN5 A;  4DPG A;  2VQF Q;  1JJ2 A;  4A3L H;  1PH9 A;  4LFC Q;  5C4X H;  4JBK A;  1FJG Q;  2NVX H;  4BY1 G;  4A3F H;  3NBZ B;  3DLL A;  2UU9 Q;  4IJH A;  4JI8 L;  3OW2 A;  3KF8 B;  3CC7 A;  1HJP A;  2HIX A;  4ME3 A;  4DUY L;  3EBE A;  1EUJ A;  2K5V A;  2NVT H;  5FPO A;  5C4X G;  1Q7Y C;  4PZ8 A;  3HOX H;  3AEV A;  1V9P A;  4A3F G;  1E22 A;  4WJ3 M;  1EQR A;  1WJJ A;  3RR5 A;  3TEH B;  3G4S A;  3A5Z B;  3S14 H;  4DV4 Q;  4B3M L;  2LXJ A;  1L1O B;  1S3O A;  3L0O A;  3J81 j;  3OTO Q;  4GNX A;  3A0J A;  1EOV A;  3K0X A;  4DK3 C;  2ZM6 L;  4LF9 L;  3TRZ A;  1YEZ A;  2VNU D;  3DM3 A;  1KHI A;  5DLQ E;  5FPR A;  1GVP A;  1VQN A;  1VQP A;  1XK5 A;  3KJO A;  4LH6 A;  1VQO A;  2UXD Q;  3RTX A;  1NBW A;  5C3E H;  3J7Z C;  1K3R A;  5GAD C;  4HJ7 A;  5ELN A;  4HJ9 A;  1YHB A;  1I3Q H;  3EN2 A;  4JI6 L;  2ZJQ A;  4P71 A;  1D8L A;  3CC4 A;  1B04 A;  3PIP A;  1L1O C;  2PMZ E;  1QZH A;  2WB1 G;  1Q86 C;  5C3E G;  3NC0 B;  2QEX A;  1VQ6 A;  4AYB E;  3UE0 A;  1GD7 A;  3M4Q A;  3I55 A;  4DUY Q;  3BAA A;  3PSI A;  1TWH H;  4QJF A;  4POG A;  4GKJ Q;  1I6H H;  1Y1V H;  3GTG H;  1FVI A;  1G6P A;  2JA5 H;  2ID0 A;  3NEL A;  3BA9 A;  4X62 L;  2RHS B;  3T1Y L;  4B3M Q;  2ZTE A;  4K0K Q;  2VQE L;  3T1H L;  2E2I H;  1SE8 A;  2D62 A;  3CAM A;  4JG2 A;  4MTN A;  4LF9 Q;  1GO3 E;  3NEM A;  4DV1 Q;  3GTQ H;  4P72 A;  3ULP A;  1HZA A;  1GKH A;  4KHZ A;  4JI1 L;  1K8A C;  1VQL A;  2JA5 G;  2EQS A;  2JEB I;  5C0X I;  3TY8 A;  3S2H H;  4BBS H;  3GO5 A;  3S16 H;  1X3G A;  4X66 L;  2PNH A;  5M5Y H;  4GKK Q;  2JA6 H;  4QQB X;  1LUZ A;  3AQQ A;  3WWV A;  4EFE A;  3J7A 5;  2AWO A;  2BH8 A;  3CD6 A;  2OCE A;  4RMF A;  3BA8 A;  4YHH L;  2RF4 A;  4APV A;  1VQM A;  2OWO A;  4JI3 Q;  2NZH A;  2R6G A;  1NJI C;  3GTP H;  3HOW H;  2KHI A;  4NXN L;  1A63 A;  2PQA A;  4R4T A;  3J80 c;  3S15 H;  3PIO A;  4LFB L;  3G71 A;  1LM0 A;  2N3S A;  5IT9 c;  4JI2 Q;  2CQO A;  1KQS A;  2GVA A;  4UCO A;  2JA7 G;  3G48 A;  4UCV A;  1UWV A;  4X62 Q;  4XIG S;  3F2B A;  3T1Y Q;  1EQQ A;  1KIX A;  3MXN B;  3T1H Q;  3HOZ H;  1P16 A;  3PCO B;  2H5X A;  5JJK A;  1C9O A;  2F3I A;  5IE8 A;  3U4Z A;  3JC6 6;  2ES2 A;  3UDG A;  1IL2 A;  3AFP A;  4JI1 Q;  1K73 C;  3HKZ E;  5M5X H;  1UE7 A;  3HOV G;  2L15 A;  1VQA A;  4XTC S;  2UXB L;  4WJ4 A;  4BXX H;  4Y52 H;  4X66 Q;  2AWN A;  5AJ3 L;  1VQ5 A;  1XPR A;  1N9W A;  5J3B A;  4QL5 A;  3KLW A;  1TA8 A;  4A3I H;  4L5R C;  2E5L L;  2I0Q A;  1OXT A;  1IBL L;  4A3D G;  3CCU A;  4LF8 L;  2MNA A;  4UFZ A;  1WCM H;  4GN5 A;  4BXX G;  4C3H H;  5LMU L;  4DR7 Q;  1SFO H;  1PH1 A;  2CFM A;  5IWA L;  4DV0 L;  1B8A A;  1PH5 A;  4TVA B;  3UDF A;  4B3R Q;  4KHP L;  4LF5 L;  1LYL A;  3PGZ A;  1WCM G;  2UU9 L;  2Z6K A;  2IX1 A;  2MFI A;  1E7Z A;  2NN6 I;  3PUV A;  4DR5 L;  1J5E L;  1KRS A;  3AYH B;  4MNO A;  1VQC A;  2BA0 A;  2LXK A;  1SRO A;  4JOI C;  2UUA L;  4IPG A;  1N34 L;  4A93 G;  1AE2 A;  2JEA I;  1FL0 A;  1C7Y A;  4JI4 Q;  1YZ6 A;  3BJU A;  2IY5 B;  2ATW A;  4A3G G;  2VL6 A;  3HOU H;  1UE1 A;  3J81 i;  1RL2 A;  4JC0 A;  4IOC A;  2QA4 A;  4GN4 B;  2UXB Q;  1XMQ L;  1PH3 A;  1HNZ Q;  2R7Z H;  4DUZ L;  4JBJ A;  2GN5 A;  4GLA C;  2UXC L;  1N32 Q;  3ULL A;  1VQ8 A;  1Q1E A;  1OTC A;  4AQY Q;  3GTM H;  1IBL Q;  4P74 A;  1EFW A;  1C0A A;  3SGI A;  4B3T L;  1B70 B;  2EXD A;  3D0F A;  1YIT A;  1N36 L;  3HOY H;  3F2D A;  5C44 H;  1HR0 Q;  1L2F A;  3TY5 A;  1VQI A;  1CSP A;  5IWA Q;  4DV0 Q;  1YVC A;  4KHP Q;  3GB8 B;  2UUC Q;  1MJC A;  5GAH C;  2PI2 A;  3STB D;  1U5K A;  1JB7 A;  4DR5 Q;  1J5E Q;  2CCZ A;  3TQY A;  1X3E A;  2N49 A;  3GDE A;  4C2M H;  3HOY G;  2UUA Q;  1N34 Q;  3CW2 C;  4UCR A;  3U50 C;  3PN1 A;  3E9I A;  4LWC A;  4TQU S;  1VQ7 A;  2JA8 G;  3K81 C;  2JQO A;  2AMC B;  4LFA Q;  1YI2 A;  2Y0S G;  4A3L G;  1Q81 C;  4IFD G;  3CP0 A;  4IPC A;  1VQ9 A;  4X64 Q;  1B7Y B;  3CQZ H;  4OO1 I;  3I7F A;  1XNR L;  2UXC Q;  3UE1 A;  5E7N A;  4JI0 L;  3I4N H;  4JV5 Q;  1JJC B;  2DUD A;  3PO3 H;  2HHH Q;  3M9B A;  3GD7 A;  1ASY A;  3W5O A;  1PFS A;  4DV2 L;  3HOX G;  2ZTD A;  1IBM Q;  5IYD H;  4B3T Q;  3W1G A;  4GNX B;  1N36 Q;  5C4J H;  1W2B A;  1KL9 A;  3FKI H;  1UE6 A;  2Q2T A;  1HNX L;  4A4I A;  3I4N G;  3L7Z C;  3D31 A;  1N8R C;  2K14 A;  3GTK H;  5LMN L;  3UDI A;  2V1C C;  3S1M H;  3KF6 A;  5IYD G;  4PMW A;  1XJV A;  4A3C H;  2JA9 A;  4DAY B;  3PV0 A;  1W3S A;  2N8N A;  1TWG H;  3FKI G;  1E3P A;  1HZB A;  3I56 A;  1HZC A;  4YCU A;  1PA6 A;  3H0G H;  4JI8 Q;  4YY3 L;  4BBR H;  5M5W H;  4LF5 Q;  3TS2 A;  2HVQ A;  1TWC H;  3STB C;  4A3C G;  1VQB A;  1YBY A;  2A1A A;  4LUV A;  4GNX C;  3RZO H;  3I4M H;  3KDF B;  2YU9 H;  4OWW B;  3K7A H;  1DGS A;  4GLX A;  4Y7N H;  2VUM H;  3CMA A;  3H0G G;  2PI2 E;  1X54 A;  1XMO L;  4JI0 Q;  3BU2 A;  5M3F H;  1TXY A;  3EIV A;  2FXQ A;  2F52 A;  2ZM6 Q;  4LF7 L;  2C35 B;  4IPH A;  2CKZ B;  2K5N A;  1SMX A;  2RHQ B;  3I4M G;  1Y1V G;  3ERS X;  5LMN W;  3TRE A;  1YJN A;  3GTJ H;  1K9M C;  1Y1W H;  4B3S L;  1HNX Q;  2BH2 A;  4X65 L;  3A5U A;  5GRO A;  5FLX c;  3PUX A;  4LF4 L;  1NTG A;  4OXP A;  4JI6 Q;  1CKO A;  4JCV E;  2WB1 E;  4JI7 L;  1PYS B;  1Y1W G;  4O2D A;  1JE5 A;  2LSS A;  3BZK A;  4BBS G;  1EYG A;  3CME A;  4GN3 B;  4LW1 A;  4YY3 Q;  5M3M H;  1CSQ A;  4L5Q A;  4YCV A;  4DV6 L;  1VQD A;  1FGU A;  3CCV A;  4DR2 L;  2JA6 G;  1CKN A;  2DGY A;  3ER0 A;  1E1T A;  3K80 C;  1NY4 A;  4YCW A;  4AH6 A;  4X6A H;  5D1P A;  4NPS A;  2B3G A;  4QY7 A;  5C0X G;  4H02 A;  1PYB A;  2Q2I A;  3S1R H;  2R93 H;  3HOW G;  3PF4 A;  2VQE Q;  3M85 A;  2F4V L;  1KD1 C;  1P8L A;  3F2C A;  2E2J H;  2IT1 A;  4LF6 L;  3BAB A;  2YTV A;  4NXM L;  1UE5 A;  1V43 A;  4GOP B;  3JSN A;  2R7D A;  4RG1 A;  3RNU A;  3HOZ G;  3B6Y A;  1HNW L;  3J80 i;  1PH4 A;  5IY0 A;  3CC2 A;  2RCN A;  1X3F A;  2I5H A;  1PH6 A;  4LF4 Q;  3S24 A;  4YWK A;  4UP7 A;  1MJE A;  4YHH Q;  3H3V I;  1SR3 A;  1XPU A;  1A8V A;  2R92 H;  5K36 G;  1JT8 A;  4NXN Q;  4IJL A;  3KFU A;  4A3I G;  1PHJ A;  1VQE A;  1M90 C;  4LFB Q;  4LUZ A;  5IP9 H;  3NBY B;  3RLN A;  4GOP C;  3VDY A;  4IPD A;  4PZ7 A;  1RIP A;  1VQ4 A;  4DV7 L;  5D1O B;  1VQH A;  4JI5 L;  3S1Q H;  2ZJR A;  1HH2 P;  4JOI A;  3CPW A;  1CUK A;  2F4V Q;  3RLF A;  3M7N A;  3HKS A;  3CCQ A;  4GLV B;  3JAM c;  1IXR A;  5IP9 G;  4LF6 Q;  4R4I A;  2OQ0 A;  4UP9 A;  2CWP A;  1I50 H;  2VZA A;  4R4O A;  1R9T H;  3QWU A;  1K0R A;  2KBN A;  3G6E A;  1A62 A;  5AJ3 Q;  1G51 A;  1WOC A;  2WAQ G;  4JBM A;  2MO0 A;  4A75 A;  4C3I H;  4JYA L;  4A3B H;  3HOU G;  2KEN A;  5IYC H;  1QUQ A;  1VQG A;  1HZ9 A;  4EX5 A;  2E5L Q;  5IP7 H;  2NN6 G;  2WP8 J;  4LF8 Q;  4DR6 L;  1JJG A;  2R7Z G;  2VQF L;  2K4K A;  5LMU Q;  1QVG A;  1JMC A;  1BBW A;  4UCU A;  1SLJ A;  3Q8D A;  2D0O A;  1Y14 B;  1VQJ A;  2K75 A;  1N33 L;  5IYC G;  1YHA A;  1X65 A;  1VS0 A;  5FJ8 H;  2YTY A; 
#chains in the Genus database with same CATH topology
 1FGB D;  1LTI D;  4YAK B;  4K14 A;  1BVS A;  2ZXP A;  4R8U A;  3M3Y H;  1UAP A;  5KRU A;  2N78 A;  1NE3 A;  2I5M X;  2IHF A;  2JE6 I;  1RJP A;  5FJ8 G;  1WTH A;  4HN7 A;  5EQ0 A;  4NB3 A;  3CCR A;  3TN2 A;  4IFD J;  5EKK A;  3S2D H;  1B3A A;  2DN8 A;  3MXP A;  1L0W A;  1QE6 A;  4CKE A;  4PQX A;  2F0V A;  1XMQ Q;  1IBL H;  1IKM A;  2R8G A;  3QQM A;  5G3L D;  4CC5 A;  5GAE C;  5KG6 A;  4IUQ A;  4A3E B;  1MBY A;  4DL5 A;  5IWA H;  1DCZ A;  4BA2 I;  1S72 A;  1Q82 C;  1O7Z A;  1H95 A;  1TWA H;  1UEB A;  2J4X A;  1KT8 A;  1TWG A;  4HID A;  1PZK D;  3M4P A;  5DIS C;  3PF5 A;  3PO3 G;  4A76 A;  2F0N A;  1WI5 A;  4O2B F;  3NEN A;  4A3J B;  3PW4 A;  3TQT A;  5HBR B;  5KFV A;  3HP3 A;  1T94 A;  3KF6 B;  1Y1V A;  4RGN A;  1V8Q A;  2R85 A;  1BKB A;  4HAE A;  4HNV A;  3VPC A;  4K0K L;  4QWC A;  2EYF A;  2YTX A;  1QVF A;  4POF A;  1TQO A;  3GTQ A;  4CGY B;  4EYI B;  2B2U A;  1EYD A;  3HG9 A;  3C1E A;  5JPN C;  3EFX D;  4DV1 L;  1X9N A;  1GLV A;  1XNR Q;  2W71 A;  2A6H D;  4BBR G;  4KLK A;  2BR0 A;  1I4H A;  5IGD A;  1AP0 A;  3JRX A;  3M9N B;  1TT2 A;  4KKS A;  4GKK L;  4O82 A;  3BDC A;  4IHJ F;  4E4T A;  4BY7 H;  1NMF A;  4IUN A;  4YWM A;  2YZN A;  5BR8 L;  2EJ3 A;  3N42 B;  2M2L A;  5LMN Q;  3I2Z A;  4JVZ A;  2JA7 B;  4XYM B;  1E1O A;  1CTM A;  1X6O A;  2Q2H A;  3K5L A;  4BY7 G;  1HTP A;  4DR3 L;  2VPQ A;  1LTL A;  5CV4 A;  1GM5 A;  4LSX A;  3FP9 A;  1A2U A;  1IZ6 A;  3HOV B;  2AUK A;  2AQ4 A;  3Q1K A;  4HIM A;  3K5H A;  1A3V A;  4CJ2 C;  1U4M A;  2PQA B;  1DAA A;  2CNQ A;  2W8K A;  2V5A A;  1ASZ A;  4QWE A;  1HNX H;  1MIU A;  1SYE A;  3LGJ A;  5BN3 A;  5LL6 X;  4LF7 Q;  2YYZ A;  3GV8 B;  4M0J A;  3GTL B;  3CPF A;  4B08 A;  2R93 G;  4J9K A;  4L5S A;  5DNF A;  2VA2 A;  4P2C B;  5GQO A;  5BR8 Q;  1D5Z C;  3QZ7 A;  4YY3 H;  1XNQ L;  4YQW A;  1M1K C;  1Q46 A;  3T53 B;  1KJI A;  1V1O A;  1CI3 M;  3ZJY C;  1OO9 B;  3HT5 A;  1STA A;  3M7G A;  4ODG A;  4WD3 A;  2QGQ A;  4CMD A;  1Z9F A;  1KDC A;  4DR3 Q;  4JI7 Q;  4B3R L;  4DV3 L;  2YV5 A;  3MXN A;  3QO2 A;  4UCT A;  1T5E A;  2G5D A;  3TW7 A;  5E4W C;  2WAQ A;  5BWU A;  4IO9 A;  4B9W A;  5H1S E;  4RNN A;  3I4L A;  3RZD B;  2HVR A;  4A3D H;  2F0P A;  2R7Z A;  1A0I A;  2NYZ D;  3CU7 A;  1R9T A;  2K52 A;  1CFM A;  2A8V A;  4OEM B;  2X0S A;  1DOL A;  1EYC A;  3CF5 A;  1DON A;  2KOL A;  2LKV A;  3HEJ A;  5EWG A;  4AQY L;  1WRV A;  2GA4 B;  1A0G A;  2N55 A;  4PZ6 A;  1LAB A;  1XNQ Q;  1T3N A;  1SNM A;  3K5N A;  5DMX A;  4NXN H;  3VYU A;  2F0S A;  3L2P A;  4DAM A;  4BY1 B;  3K0Y A;  1D7Q A;  5D1O A;  2L0C A;  4DV3 Q;  2B63 H;  3H94 A;  1MKH A;  1XTD A;  2YL2 A;  1QUQ B;  2CQY A;  3RB3 A;  1U0L A;  3VYR A;  5I5Y A;  4I65 A;  3NBH B;  4LUO A;  2C00 A;  1S5E D;  2QEJ C;  2NWG A;  1NR4 A;  2NVX B;  1EZ6 A;  3NE5 B;  2EIF A;  1QZG A;  3I91 A;  4LF6 H;  2B63 G;  5EAY A;  1K8G A;  1LT6 D;  3OWE B;  3CCL A;  2Q2U A;  2V58 A;  1B33 N;  3CQZ A;  4RB2 C;  2IX0 A;  4X64 L;  4HJA A;  4TVI A;  2B29 A;  4ZQ3 A;  1JB3 A;  4TRD A;  1Y8N B;  5IGB A;  2R7K A;  3PMF A;  4QIW B;  4LNQ A;  1E24 A;  1M8A A;  1G29 1;  3LP8 A;  1F9Q A;  4Q4C A;  1STN A;  5I47 A;  2HQL A;  2E2D C;  3GTK A;  2TMP A;  4KMU C;  2ASL A;  4O81 A;  3LNN A;  1CZW A;  5C3E B;  4N9P A;  3SHL A;  1R4P B;  4IFD H;  3P1H A;  1JE4 A;  4O2A F;  1JDE A;  3CC7 A;  2HIX A;  5JVG 3;  3I73 A;  1O80 A;  1EUJ A;  2QKI C;  3EBE A;  4V19 0;  2W6Q A;  4NZM A;  1EKV A;  2ZDG A;  1Q7Y C;  4PZ8 A;  4MAM A;  3V4Z A;  1XMQ H;  2X6G A;  1KUT A;  1I6H B;  4CHT B;  2HQE A;  4DV4 Q;  2LXJ A;  3L0O A;  4RAY A;  2VNU D;  3A0J A;  3TRZ A;  5LYJ F;  4DK3 C;  4APM A;  3RB4 A;  5FD5 A;  1YEZ A;  2VQF H;  2JEI A;  4J9S A;  3CVZ A;  1BDO A;  1XK5 A;  4LH6 A;  1M4V A;  1VQO A;  4EQO A;  2UXD Q;  4JUZ A;  1SE2 A;  3S2H B;  1K3R A;  5GAD C;  3S16 B;  3EN2 A;  4JI6 L;  1AUX A;  2CNU A;  2JA6 B;  2W7O A;  3PIP A;  4K2L A;  2WB1 G;  1VQ6 A;  2W8L A;  1BXT A;  3CKI B;  4X3S A;  3UE0 A;  4AYB E;  3I55 A;  5KT2 A;  3GTP B;  4YP3 A;  2IA6 A;  1LTG D;  2C2E A;  3OWF A;  1Y1V H;  4CDE C;  1XNR H;  2ID0 A;  3GQB A;  3BA9 A;  5DAU A;  4X62 L;  5KFQ A;  1QWY A;  5DLF A;  1SE8 A;  1R4Q B;  4Q5V A;  4RUC A;  3CAM A;  3GTQ H;  4MTN A;  3MFH A;  3ULP A;  4L8J A;  4FBT A;  1JQY D;  1K8A C;  2KJX A;  3WDN A;  3K3V A;  5C0X I;  3EPG A;  2OLS A;  4BBS H;  1TWF A;  2E74 C;  1CE8 A;  1CM9 A;  2OXP A;  1LUZ A;  3WWV A;  3BQ0 A;  3WNZ A;  1EOT A;  5EBC A;  1ET9 A;  4YHH L;  4ZUJ A;  4JI3 Q;  1TS4 A;  1I4X A;  2KHI A;  5EJW A;  2I07 B;  2PQA A;  3N6R A;  1RJR A;  1SFO B;  4LFB L;  4ECR A;  2N3S A;  2GVA A;  4UCO A;  3R2T A;  4FXK C;  3RMH A;  4X62 Q;  5D65 A;  1GYF A;  3HOZ H;  5L1L A;  1A3G A;  1P16 A;  4HR7 B;  4LF7 H;  5JJK A;  1KEE A;  3NSW A;  2WKC A;  3JC6 6;  3I90 A;  3UDG A;  5M5X H;  2A6E C;  3BDL A;  1LAC A;  3ND9 A;  1TU2 B;  2UXB L;  2KED A;  5BR8 H;  1AEX A;  5L1K A;  3FDT A;  4IUR A;  1XPR A;  3VMM A;  2PQE A;  5I6Y A;  5J3B A;  5IGC A;  1IYV A;  4MN3 A;  3KLS A;  4A3I H;  4WRD A;  1EQT A;  4L5R C;  4DR3 H;  2RA4 A;  1OXT A;  2R87 A;  5KFX A;  2MNA A;  2ABJ A;  3V6J A;  1W6K A;  5LMU L;  4CJ1 B;  3NXW A;  3HOY B;  4QW8 A;  2IPK D;  2ICI A;  4F88 A;  1IKL A;  1XTC D;  3OIP A;  2MFI A;  4DR5 L;  3PUV A;  2V4D A;  2Y0S B;  3NTH A;  3VPB A;  2B2T C;  4JOI C;  4A93 G;  1AE2 A;  3V05 A;  3KLR A;  1H9S B;  4RGM A;  1YZ6 A;  4JI4 Q;  4YBZ B;  4A3G G;  3HS0 C;  4LK1 C;  1RL2 A;  4IOC A;  1IYE A;  3PW2 A;  2UXB Q;  2R7Z H;  2XCA A;  1XNQ H;  4EGQ A;  1SEI A;  3OW7 A;  4OGQ C;  4GLA C;  4BS9 A;  5A2Q L;  4ECX A;  3WWI A;  4B3R H;  4J8Q A;  1SMY D;  4J9N A;  4DV3 H;  3PO3 B;  1MHW C;  3NBH A;  1SND A;  1B70 B;  1YIT A;  3AB9 A;  4LAA A;  3KHH A;  4RB1 A;  1HR0 Q;  1L2F A;  1VQI A;  1ZYR C;  3IFD A;  4TQR A;  2QDB A;  3GB8 B;  3T9F A;  2UUC Q;  5C3W A;  3M4I A;  3S1M B;  5KT5 A;  4DR5 Q;  2CCZ A;  4JPB W;  1X3E A;  3GDE A;  4JW0 A;  3FMC A;  4N9T A;  3BDO A;  4UCR A;  3CW2 C;  3U50 C;  2JA8 G;  2A68 D;  3GV5 B;  5C4H A;  1WSC A;  4LFA Q;  4BBR B;  5M5W B;  4AQY H;  1B44 D;  2EYM A;  3T99 A;  2QIL A;  3CQZ H;  1STB A;  2FE3 A;  3IFT A;  1I4Q A;  2R8H A;  3K7A B;  3BYT B;  3I4N H;  4JV5 Q;  1GSH A;  2JEG A;  1JJC B;  2HHH Q;  2YWV A;  5LL6 S;  3GD7 A;  1PFS A;  1IBM Q;  3HOX G;  1PRT F;  1Z2O X;  3KAJ A;  2BE5 C;  4OO1 H;  4I7H A;  2VA3 A;  3FKI H;  1UE6 A;  4IZ8 A;  1HXY D;  3GTJ B;  3I4N G;  4WFN 3;  1NR2 A;  1Y1W B;  3GTK H;  3URY A;  2V59 A;  5BYB A;  1BXR A;  1XJV A;  4DAY B;  1K28 A;  1H9K A;  3FKI G;  1E3P A;  2PVP A;  1HZC A;  4X64 H;  2AQ1 B;  4O7S A;  3H0G H;  3TS2 A;  1CA6 A;  4DV4 H;  4RHS A;  3WOE A;  1HUM A;  2WV6 D;  4XQN A;  1K8O A;  4RNM A;  3I4M H;  3A55 A;  1BNC A;  3D4D A;  2NUA B;  3CMA A;  1PMR A;  2PI2 E;  3H0G G;  2KEE A;  3HO8 A;  2R93 B;  4QWD A;  5L1I A;  5KFP A;  4KHV A;  2UXD H;  1OBD A;  4FXD A;  5DQI A;  2IMW P;  2FXQ A;  2ZM6 Q;  1TY2 A;  2EJ0 A;  3I4M G;  2RHQ B;  1V1P B;  3ERS X;  4MHE A;  3TRE A;  5JAV A;  3NWT A;  1I6V C;  4Z9C B;  4EVO A;  2BH2 A;  4X65 L;  1Z7T A;  2Z4H A;  2E2H A;  3GTP A;  4ZHQ F;  4A2B A;  1PRT D;  4LF4 L;  1NTG A;  1ROD A;  4OXP A;  5I60 A;  1VBH A;  1D6E C;  3Q22 A;  4QF4 A;  1EYG A;  4LW1 A;  5M3M H;  1KJQ A;  4YCV A;  3RBD A;  1VQD A;  2LS0 1;  5EOY A;  1FGU A;  4UHV A;  1CKN A;  2NUC A;  2DGY A;  4R8I A;  3TIN A;  4UDU C;  1NY4 A;  4R8N A;  5KT6 A;  1XX8 A;  3S1R H;  2H4O A;  3SR1 A;  1ZHQ A;  2VQE Q;  3QR8 A;  1J9O A;  4JK1 C;  1P8L A;  2C9O A;  2VB3 X;  3F2C A;  2IT1 A;  2B2Y C;  3TBI B;  4GZY C;  3IL8 A;  5CR3 A;  4NXM L;  5CR5 A;  4F4X A;  1QIL A;  1I50 B;  1S4Z A;  2JYO A;  1PH4 A;  5IY0 A;  2PN1 A;  2XD4 A;  3CC2 A;  2RCN A;  3R5H A;  3FMA A;  1Q8I A;  4DL2 A;  1PH6 A;  4LF4 Q;  3M4Y A;  1D2B A;  3GLK A;  4YWK A;  4J9P A;  1SR3 A;  1JWU D;  4X62 H;  1RD9 D;  1ILP A;  4QWB A;  4ME6 A;  3CSW A;  4IJL A;  2PNR C;  5JVD F;  4FYD A;  1N56 A;  4FF3 A;  3HXL A;  1BO0 A;  3NK9 A;  4PZ7 A;  4C3H G;  1VQ4 A;  2YRX A;  5FLX E;  4JI5 L;  3RJ0 A;  4JOI A;  1JKJ B;  2K33 A;  3M7N A;  1HHV A;  2EYO A;  1HCZ A;  3TP7 A;  2Z4I A;  4H7B A;  2Z02 A;  4JV1 A;  2BDN A;  2OQ0 A;  5KFO A;  2VZA A;  1I7N A;  3J80 E;  3QWU A;  4YHH H;  2BOS A;  2KBN A;  1A62 A;  3SDZ A;  1G51 A;  1WOC A;  2E75 C;  5AJ3 Q;  4LMQ D;  3G6E A;  3ETH A;  4ED3 A;  3HOU G;  1EU3 A;  2RVL A;  4LFB H;  2DJF C;  2E5L Q;  4EX5 A;  1JIH A;  2MPM A;  2NN6 G;  2WP8 J;  3QOL A;  2WYO A;  3PO2 B;  1M0W A;  4RGO S;  2Y0S A;  1JMC A;  5CA1 F;  1K83 B;  3ERO A;  5FO9 B;  1J8I A;  1DJR D;  1VQJ A;  1Y14 B;  2EVB A;  5KFU A;  2MP1 A;  4JI4 H;  4LF5 Q;  1WJJ A;  3W1B A;  1S5D D;  1CK1 A;  2F0K A;  5C44 G;  2UXB H;  2DWC A;  1Q12 A;  2WIN B;  2ZDH A;  4UP8 A;  3JSL A;  3OHB A;  4G57 A;  2HGW A;  4HIK A;  5HGQ A;  4OIJ A;  4ULL A;  4UCS A;  4RAZ A;  5LMU H;  2EE1 A;  2XNA C;  2N88 A;  5JEA G;  1EZ1 A;  2KQ3 A;  1AFP A;  4FFL A;  3R23 A;  4L6T B;  3TY9 A;  4AIM A;  3WO1 A;  2UUC H;  2GQS A;  2WB1 B;  5KT3 A;  3WWJ A;  4DR5 H;  1VCI A;  1FYC A;  1RHP A;  4XT3 B;  3ULJ A;  3QG1 A;  3CCM A;  3RN2 A;  2NU8 B;  4C5C A;  4C5B A;  4RU9 A;  1VQF A;  1Z47 A;  4OIK A;  1GHK A;  3R3O A;  1HPC A;  1X55 A;  1PVO A;  4C3J H;  3OYY A;  1PV4 A;  1TWH A;  5JH7 F;  4AYB G;  1PTO H;  4GKJ L;  1L1O A;  4IAL A;  2EIY A;  1V1Q A;  4B9X A;  3QWN A;  3WOF A;  2J0T D;  1KRT A;  4EEQ A;  3Q8R B;  2E2I A;  4JV5 H;  5KYI A;  2XVS A;  1CKM A;  3A74 A;  4A3K B;  4KN7 C;  4C3J G;  4IR1 A;  1L0Y B;  1I5F A;  3PUZ A;  1IBM H;  1EYZ A;  3PVX A;  2JK8 A;  1G8Z D;  4DXG A;  4DV5 L;  5ELE A;  4ALP A;  3ORR A;  1Y1W A;  2FPI B;  3N40 P;  5KNB A;  3DEP A;  3ORQ A;  3GV7 B;  1EY0 A;  4NKL A;  4Q45 A;  2W9C B;  1CHP D;  3K8A A;  2EXZ A;  1ENA A;  3U9S A;  4O7Y A;  4G7H C;  4EQ5 A;  2VUM G;  3N52 A;  5CV5 A;  2NBF A;  5M3F G;  3VR3 A;  4EYH B;  3TEK A;  5ELF A;  5K5P A;  2W7P A;  1YNX A;  3CRK C;  3VA5 A;  2UUB L;  3VYT A;  3TME A;  4XX0 B;  2AU0 A;  2NTS A;  4DL3 A;  2OEO A;  2EJG C;  4DFA A;  3LWB A;  1IW7 C;  3U4V A;  3HGB A;  4KJN A;  1VKZ A;  4DV5 Q;  4OX9 L;  1B2T A;  1OXV A;  3VR5 A;  2ZGI A;  5CMD A;  1EY9 A;  3NP8 A;  1EY8 A;  2B2Y A;  1RYS A;  4DAV A;  2COI A;  1PTO F;  1U4L A;  5I9P A;  3TQ1 A;  4O4L F;  4P73 A;  4RWS C;  4B3S Q;  2PCF B;  5ISR A;  1FNW A;  4H13 C;  5FR9 A;  3GID A;  2R7F A;  1DIK A;  2BA1 A;  2E2H H;  4HN2 A;  3IRB A;  4DR7 L;  1DM0 B;  1OXX K;  4IZO A;  2UUB Q;  4A93 B;  4YR2 A;  4O0A A;  3I72 A;  1O7I A;  3BS1 A;  3H3V C;  4A3G B;  2CQA A;  2AHO B;  4PDB A;  2WTF A;  4DR2 Q;  1BQQ T;  2L5T A;  1RK6 A;  1DV2 A;  2B2W C;  3W2D A;  1NMG A;  1X32 A;  4QMG A;  4BA1 I;  4OX9 Q;  1WR2 A;  1I50 A;  1SAP A;  1KAW A;  2R92 G;  2XN9 C;  4X65 H;  1HNZ L;  3RBE A;  3GJX B;  1PDQ A;  5G3L F;  4QGU A;  1YNJ C;  1YJW A;  1N32 L;  4NZO A;  4LF4 H;  3GTM A;  4MV6 A;  1F2M A;  1SYG A;  3S1N B;  3R9R A;  1XDN A;  2B39 A;  1HNW Q;  3G8C A;  3BQ1 A;  1Y8O B;  3GTO B;  3TP5 A;  3J81 c;  1EU4 A;  4NP5 A;  1D1I A;  4ED8 A;  3MXU A;  3J81 W;  2XTI A;  2JA8 B;  3DAA A;  2D0P A;  1WYD A;  4LFC L;  2R8I A;  2FMA A;  4FF1 A;  1YJ9 A;  4A3B G;  1Q90 A;  2Z6B A;  4IRK A;  3FHW A;  2F0H A;  2WFW A;  2XC9 A;  4A3F B;  1I4R A;  5IP7 G;  2HIV A;  1NCV A;  4DRF A;  1JCK B;  1QB5 D;  2XSC A;  3HFZ B;  3MJF A;  3M4O H;  2NVT B;  3GIL A;  3HOX B;  4IOA A;  2EJF C;  4LH7 A;  3K6O A;  3OTO L;  2E5L H;  2WAQ E;  2PMZ A;  4G7O C;  1IOW A;  1EYA A;  2A19 A;  3MHB A;  3FRP B;  2DPJ A;  2VW9 A;  1EIF A;  5JJI A;  3MFI A;  5BN4 A;  4OWX B;  3NHH A;  3W3A A;  4LF5 H;  1WD0 A;  2VQF Q;  1JJ2 A;  4A3L H;  4IUP A;  1HQM C;  2L55 A;  2O4X A;  1U9R A;  4K5W A;  1PH9 A;  4LFC Q;  4HMJ A;  1I3Q B;  4O83 A;  2RDF A;  5C4X H;  4JI5 H;  1B4O A;  3K57 A;  1UC9 A;  2UU9 Q;  5I5X A;  4NMZ A;  1SYB A;  4JI8 L;  1B50 A;  3RUP A;  5D3D A;  3KLS X;  5KFK A;  5C4X G;  2YZG A;  2EY1 A;  3AEV A;  4WJ3 M;  3G4S A;  3S14 H;  3GTG B;  3A5Z B;  3Q8P B;  2JA5 B;  5J2U F;  3RAX A;  4UUG A;  3OTO Q;  1IL8 A;  5L37 A;  1EOV A;  1VDZ A;  4ECY A;  4FXG C;  1GVP A;  1STG A;  4MV7 A;  3FPU B;  2O5I C;  1F9R A;  5KFW A;  3T51 B;  1NBW A;  1RTO A;  4ECZ A;  2W9B A;  4P71 A;  5KFJ A;  5M5Y B;  3A8I E;  4OEL B;  1D8L A;  1QZH A;  1ENC A;  3FEW X;  4U68 A;  4XYO A;  4ZK9 B;  3AW8 A;  3EYY A;  3HKZ A;  3OMC A;  1O7L A;  5CV8 A;  3HRZ C;  3C46 A;  1TWH H;  3EQL C;  1FVI A;  1A48 A;  3NEL A;  3T1Y L;  2A6E D;  4K0K Q;  3T1H L;  2E2I H;  3WWH A;  4IUV A;  1GO3 E;  4DV1 Q;  4P72 A;  1SJH D;  1HZA A;  1VQL A;  4MV4 A;  3R5F A;  1A15 A;  2EDG A;  2JEB I;  3NUA A;  2KCC A;  1X3G A;  3PW0 A;  4X66 L;  3KHL A;  2PNH A;  4GKK Q;  2CNV A;  2YYA A;  2Q8I B;  1Z2P X;  4QQB X;  1KAA A;  2JSO A;  3J7A 5;  4CDD C;  3CD6 A;  4EFE A;  4U67 3;  5CYU A;  2DJG C;  2QF7 A;  3T5K A;  1A3T A;  3BA8 A;  3KRE A;  1FNU A;  3HOW H;  2K04 A;  5L1J A;  4FVM A;  1WCM B;  2FIN B;  2NZH A;  3E0J A;  4C3H B;  3FPP A;  1A63 A;  3J80 c;  2WE6 A;  3S15 H;  1UC8 A;  5C5M A;  1JLL B;  2RBM A;  1G91 A;  1XWE A;  4DV5 H;  1UNN C;  3G48 A;  4UCV A;  1UWV A;  3F2B A;  3T1Y Q;  1EQQ A;  4DXF A;  1MZB A;  3T1H Q;  4O3Q A;  4ZAI A;  1W96 A;  5T1G A;  3G6X A;  4ECV A;  1C9O A;  4RCO A;  5IE8 A;  1IL2 A;  4ZRZ A;  3SE7 A;  5M9O A;  1NUC A;  3AFP A;  1K73 C;  4FF2 A;  1SCU B;  3JZF A;  1UE7 A;  4B3S H;  2F0J A;  2L15 A;  3HOU B;  2OT2 A;  4XTC S;  4UAI A;  4IQZ A;  1JOK A;  1SSO A;  4X66 Q;  1VQ5 A;  2R82 A;  1BUV T;  1ZYR D;  1DOK A;  4A3D G;  2I0Q A;  4WOR A;  2UUB H;  3CCU A;  4LF8 L;  3G6V A;  4GN5 A;  4CMF A;  2FPG B;  2QW7 A;  1PH1 A;  2NB0 A;  4DR2 H;  1S03 G;  4K5V A;  4F87 A;  5C44 B;  4DV0 L;  3MVV A;  3SEB A;  3UDF A;  4B3R Q;  2PW5 A;  2HGS A;  4OX9 H;  4FFM A;  1LYL A;  5ELC A;  2IW3 A;  1E7Z A;  2NN6 I;  1SNP A;  2RQX A;  1J5E L;  1KRS A;  4MNO A;  1LO5 D;  2BA0 A;  4J1M A;  4C2M B;  1I2L A;  1S5C D;  1VMP A;  1CQI B;  2F0Q A;  4DN4 M;  1F2Z A;  1HTL D;  3V2T A;  4DL6 A;  4FNF A;  3GTO A;  1HNW H;  3KBX A;  1PH3 A;  3G8D A;  2ZJT A;  4DUZ L;  1DD2 A;  2FHT A;  2UXC L;  5KFZ A;  2BE5 D;  1MD2 D;  1S10 A;  4TSS A;  3C0F B;  2KUM A;  3ULL A;  2NVY A;  1FD7 D;  3OSN A;  2W9A A;  1K3B C;  4AQY Q;  3GTM H;  4CBV A;  1C0A A;  1KJ9 A;  3Q24 A;  1XXG A;  2EXD A;  3D0F A;  3D8G A;  4B3T L;  2AUJ D;  3TY5 A;  5C4J B;  3OUU A;  4DV0 Q;  2XGP A;  4AYB B;  5C3X A;  1YVC A;  2JXM B;  3VOT A;  2CW7 A;  4FU0 A;  1J5E Q;  5EWF A;  1QG7 A;  3AX6 A;  2K03 A;  1HNZ H;  3T9B A;  3DF7 A;  4GLW A;  5C8Y F;  5EKI A;  4TQU S;  1VQ7 A;  3N41 B;  1N32 H;  1CHQ D;  1BOS A;  4X3T A;  4J9R A;  2O2L D;  1EKP A;  4KTA A;  1LT3 D;  4DNR B;  1TWC B;  1Q81 C;  4IFD G;  4ZI7 F;  3N6X A;  2ATL A;  5E1F A;  4K6D A;  4S3S A;  1VQ9 A;  4X64 Q;  1B7Y B;  5I5W A;  1D5X C;  3I7F A;  2WII B;  2YU9 B;  1UEA B;  2UXC Q;  5E7N A;  3GP7 A;  4Y7N B;  2VUM B;  3L4J A;  2DUD A;  1B6R A;  3M9B A;  5M3F B;  2JEJ A;  5IYD H;  4DV2 L;  1I3Q A;  2ZTD A;  4B3T Q;  4LFC H;  4GNX B;  3RUZ A;  3V6K A;  2MUY A;  2CW8 A;  3DHQ A;  3L7Z C;  5IYZ F;  2K14 A;  2UU9 H;  3QZ8 A;  4O3O A;  3KF6 A;  5IYD G;  4A3C H;  3BVM A;  2JA9 A;  5DGB A;  3PV0 A;  1W3S A;  4XDX A;  5KT4 A;  1TWG H;  1LTR D;  2UVU A;  4QCL A;  2JA5 A;  2WDT A;  3Q23 A;  3QOJ A;  4ED0 A;  4A3C G;  4ZUI A;  3ONA B;  3OTO H;  4MA0 A;  1ZXT A;  4GNX C;  3RZO H;  3KDF B;  4OWW B;  1DGS A;  4GLX A;  4O1N A;  1QNU A;  2SEB D;  3LUL A;  1XMO L;  1TXY A;  3EIV A;  1PFM A;  4L1K A;  2F52 A;  3BG5 A;  2C35 B;  3E5S A;  2K5N A;  3I8Z A;  5A2Q E;  1Y1V G;  2C2D A;  2KHS A;  5LMN W;  5IT9 L;  2FLN A;  1YJN A;  2FLL A;  4HSP A;  4FFN A;  3BAC A;  1B3Q A;  2JA7 A;  2IL8 A;  4TV8 F;  5FK9 C;  4F7X A;  4JI8 H;  3PUX A;  4JI6 Q;  1YNN C;  4EBD A;  1PYW D;  4J9L A;  4I55 F;  5GON F;  3SK8 A;  1PYS B;  4O2D A;  1GGO A;  4BBS G;  4GN3 B;  5D8D A;  1CSQ A;  4DV6 L;  4K0K H;  2C22 A;  2R92 B;  4X6A H;  4ME5 A;  4DV1 H;  2LY7 A;  5EKL A;  1EHI A;  3PIP 3;  5BYA A;  5EPK A;  1RK5 A;  2XWJ B;  2F4V L;  3GIP A;  1KD1 C;  3GTL A;  5EGT A;  2C28 A;  4GKK H;  2H1E A;  1AZQ A;  5KFN A;  3HB9 A;  2RDJ A;  3JSN A;  1AN7 A;  5COY A;  3HOZ G;  1WCM A;  1EIH A;  1AZP A;  3X3M A;  2VOB A;  4CKB A;  1SNO A;  2DY7 A;  4GC7 A;  2F0M A;  3MXG A;  1H9R A;  3R93 A;  4A3B B;  1STH A;  4YHH Q;  4ETS A;  4RGT A;  1XPU A;  3P7J A;  4H44 C;  3T1Y H;  3T1H H;  1VF5 C;  1G6Z A;  3KFU A;  4A3I G;  4LFB Q;  5IIF A;  1M90 C;  3DMU A;  5KG5 A;  3RLN A;  3VDY A;  1RIP A;  2RCF A;  4DV7 L;  3IAY A;  3S1Q H;  2KVM A;  2F4V Q;  3U0G A;  4FF4 A;  3RLF A;  4X66 H;  2PZU A;  3CCQ A;  3M3Y B;  5FO8 B;  5DGH A;  3KHG A;  4R4I A;  5FD6 A;  1FKA H;  2SOB A;  1DYQ A;  3S2D B;  3MWM A;  3VR4 A;  1R9T H;  5KG7 A;  1K0R A;  1SDF A;  2QK4 A;  3RFC A;  2WAQ G;  3RV3 A;  4C3I H;  3MWY W;  1KLG D;  3M9O B;  1ILQ A;  1QUQ A;  4ID6 A;  2R7Z G;  1Y8P B;  3R2I A;  2A1H A;  4NZN A;  5LMU Q;  2Z9H A;  4UCU A;  1SLJ A;  3Q8D A;  4C2M A;  2NVX A;  5C4Z A;  1TWA B;  4F4Z A;  4DL7 A;  1EWH A;  2GPS A;  1N33 L;  1DV1 A;  5JQW A;  4F4Y A;  1YHA A;  4HSV A;  1VS0 A;  5IGG A;  2YTY A;  5LP6 F;  4DNI A;  3S17 H;  4FP5 D;  3TII A;  2R7L A;  2Z8L A;  2PPB C;  2BQR A;  1HFN A;  5EDW A;  4MTD A;  4G4K A;  1E2V A;  1TII D;  1U4R A;  2B8F A;  4QWA A;  2GVB A;  4JBW A;  5CBE E;  5BWX A;  4QIW A;  4CC6 A;  1PFN A;  2K05 A;  5IOC A;  1RDP D;  2E76 C;  2HVS A;  4DV0 H;  4X3U A;  5CV7 A;  2NVY H;  4J9O A;  4J15 A;  4ED2 A;  2K5Q A;  2CHB D;  1J5E H;  3FDS A;  3X3N A;  3H20 A;  3MFG A;  5C5L A;  1RF2 D;  4BY7 B;  5DQH A;  4EG0 A;  1N33 Q;  2XRQ D;  3K3P A;  2XRS D;  4KY6 A;  1I4P A;  4CHI A;  1IW7 D;  4OO1 G;  2AKW B;  1SN8 A;  1LV9 A;  3BVG A;  4F8M A;  2R8J A;  2YU9 A;  3CCS A;  5F9L A;  4CJ0 B;  4QUF A;  2Y0S E;  2UXC H;  3OSP A;  1K0S A;  2OTJ A;  2D2C C;  3NQT A;  5KFF A;  1QNK A;  3I12 A;  4EFB A;  1M6V A;  3CCJ A;  3UQ8 A;  1SYX B;  4B3T H;  4QSH A;  4A3E H;  5KX5 F;  3GQC A;  3PUY A;  1HA6 A;  2ASB A;  1JOO A;  2KCT A;  4DKA C;  1Q1B A;  1H9M A;  2JA6 A;  4RKB A;  4A3E G;  2I87 A;  1WTR A;  3KJP A;  2YZL A;  4A3M H;  3SNO A;  4A3J H;  2L9H A;  3QFF A;  2F0W A;  3DM1 A;  2ZJP A;  5I6W A;  3RAQ A;  3KDF A;  4K8J A;  4L5T A;  3AFQ A;  3TDQ A;  1IYU A;  3F8T A;  3PFF A;  2K50 A;  2K1B A;  1GSO A;  4JI2 L;  4A3M G;  1E2Z A;  2GQR A;  1HQR D;  2PZW A;  3GV6 A;  4A3J G;  4L63 B;  3JZI A;  5GAG C;  2M9V A;  5C0X J;  2SCU B;  4J9Q A;  1ZET A;  1WTQ A;  3H15 A;  1YNJ D;  2A74 C;  4PNY A;  3K59 A;  4EBC A;  1Z2N X;  5M3M G;  2B2V C;  2A69 C;  1C30 A;  3NUC A;  3OPO A;  4A3D B;  1BBX C;  1K8M A;  2TSS A;  2YZM A;  4JI6 H;  1CZG A;  4IRC A;  3KOJ A;  2L12 A;  4QB4 A;  4X65 Q;  2JP1 A;  5CV9 A;  2JA7 H;  2KHJ A;  5CB4 F;  1TWF H;  1WFQ A;  1SFO A;  2FJZ A;  2XGQ A;  3JAM L;  3C1F A;  4DK6 C;  4KN4 C;  5ELO A;  3GIK A;  3OHA A;  2EYP A;  4HR7 A;  2B63 B;  3HOV H;  2HJW A;  4Q44 A;  1OXU A;  4OWT B;  4IIJ F;  3J81 L;  2EZV A;  2MCT A;  2J6U A;  4FDB A;  5FOB B;  3H09 A;  1S68 A;  4ECS A;  4IUT A;  5F2D A;  2B2T A;  2Y4R A;  1T36 A;  4I4T F;  2R7N A;  3KK7 A;  2FP4 B;  2AGQ A;  2W70 A;  3GTL H;  5IOD A;  4R9W A;  4DAA A;  4NXM Q;  4WBN F;  5JUM A;  5AFW A;  5IGF A;  1ULZ A;  3RB6 A;  3I4O A;  2J6S A;  4ZCK A;  2YS7 A;  2JJQ A;  1F9S A;  4MA5 A;  3GIQ A;  3IN5 A;  1I2K A;  4OL7 A;  3ND8 A;  3TP8 A;  3CHB D;  5FKA C;  1ENF A;  3JAM i;  1H9S A;  1FJG L;  2L11 A;  1XPO A;  2F4V H;  1DZ1 A;  1GUW A;  1SE4 A;  3RZD H;  2W6M A;  3MWE A;  1F9P A;  5KG4 A;  3T5J A;  1SBB B;  4JI5 Q;  1EEF D;  1X56 A;  4TM5 A;  4E6N A;  2VPS A;  3PZP A;  4R8U B;  5HV6 A;  3E9H A;  1O7Y A;  2IHE A;  4F50 A;  4HCE A;  4BWG B;  3MR2 A;  2K5H A;  2OTL A;  1HR0 W;  3E5N A;  2EPB A;  3VA7 A;  3RGX A;  2BCO A;  4IFD I;  1KJJ A;  2MO1 A;  1GSA A;  2DPI A;  1S97 A;  4BY1 H;  3ERQ A;  3VYS A;  1JOR A;  4YJ3 F;  4DPG A;  1N48 A;  2RSO A;  4DQN A;  2DY8 A;  1VBG A;  4CDC C;  1E4E B;  2XCL A;  2PYK A;  5CE8 A;  4JBK A;  1FJG Q;  3LWE A;  2NVX H;  4BY1 G;  4PWQ A;  5E25 A;  1Y69 U;  4DU9 A;  4V0B A;  1HJP A;  4ME3 A;  2V4R A;  2EY6 A;  1I6U A;  1WD1 A;  1MGS A;  3DXJ C;  2K5V A;  5BPF A;  5FPO A;  1G2T A;  3BG3 A;  1EQR A;  3RR5 A;  1Y1V B;  4B3M L;  3T5L A;  4M9U A;  3K0X A;  4O3R A;  1L2Z A;  1NAP A;  4K5X A;  4LF9 L;  2R86 A;  5KFD A;  4JV2 A;  1BCP B;  3DM3 A;  1KHI A;  3GTJ A;  3GTQ B;  1VQP A;  3OHX C;  3KJO A;  4FE2 A;  1EY6 A;  1DOM A;  4YR3 A;  3RTX A;  1N33 H;  1I4G A;  4DAY A;  5C3E H;  3J7Z C;  4HJ7 A;  4BBS B;  4HJ9 A;  1YHB A;  4RB0 A;  4ECU A;  1C3O A;  2B8G A;  2W6P A;  5FO7 B;  2WAC A;  3NGD A;  3CC4 A;  5COR A;  1B04 A;  2PMZ E;  3NC0 B;  4LSA A;  5C3E G;  4KKU A;  2XWB B;  1E4F T;  1EUD B;  4YIJ A;  3VR2 A;  3M4Q A;  4FS2 A;  1BCP C;  2F1M A;  1HRJ A;  3BAA A;  4QJF A;  4GKJ Q;  1I6H H;  2B2U C;  2R93 A;  1SYF A;  1G6P A;  1OWT A;  1TS5 A;  3CEB A;  2R84 A;  4B3M Q;  2ZTE A;  1ZAU A;  4O7W A;  2W6N A;  5EPJ A;  2I8C A;  1V1P A;  3HOZ B;  2DNC A;  3EA6 A;  5JJZ A;  2D62 A;  4JG2 A;  4LF9 Q;  1PK8 A;  4ZQI A;  2BQ3 A;  5BMV F;  3Q6S A;  1V4Y A;  2CH4 W;  4EGV A;  4J9M A;  3A8K E;  3TY8 A;  1UNS A;  3S2H H;  5M5X B;  1WTV A;  2COG A;  3GO5 A;  3S16 H;  4FFR A;  4ZKC B;  4O4H F;  2ZDQ A;  1E2W A;  5I5V A;  4IR9 A;  2JA6 H;  5KEE A;  3AQQ A;  1WH2 A;  2AWO A;  4QW9 A;  4Q0Y A;  3A8J E;  3BYY B;  4A3I B;  2GPW A;  2OCE A;  3ITP A;  4RMF A;  5BWT A;  2OWO A;  1NJI C;  1UUP A;  2R6G A;  3C2P A;  3GTP H;  3ETJ A;  2M05 A;  4NXN L;  3BQ2 A;  5KS8 A;  4J6H A;  3PIO A;  1LM0 A;  2CZG A;  1KQS A;  1PX2 A;  3KBG A;  3K5I A;  1TY0 A;  3U9O A;  4XIG S;  3MXN B;  3SK4 A;  1LTA D;  3DEO A;  5JVH 3;  3S1Q B;  1GXD C;  4K2K A;  4EGJ A;  2F3I A;  2WAQ B;  3NBI A;  5KFB A;  2C2R A;  3HKZ E;  3T9A A;  4WJ4 A;  4BXX H;  4Y52 H;  3TZU A;  3PQI A;  2F4I A;  2R7Z B;  5KFH A;  1N9W A;  1ICF B;  5KNC A;  1TA8 A;  1KBL A;  3PR4 A;  2B63 A;  3GIM A;  4BXX G;  5KFC A;  1KDB A;  4DR7 Q;  1SFO H;  4XXE A;  2FMC A;  4HMI A;  2CFM A;  5J39 A;  1PH5 A;  4TVA B;  2VXW A;  4KHP L;  3H4B A;  1F2L A;  2MHV A;  2PBZ A;  2HG8 A;  2IBK A;  4IRD A;  3LX0 A;  1PLF A;  5KFI A;  2LXK A;  2UUA L;  1SRO A;  3T9D A;  4IPG A;  1N34 L;  2JEA I;  4O7N A;  5LOV F;  3MTS A;  1FL0 A;  1EY5 A;  1JIC A;  3R8B A;  5KGU A;  1C7Y A;  2ATW A;  1RCV D;  3F8N A;  4EEY A;  1PZI D;  4NXM H;  1B53 A;  5KFT A;  4GN4 B;  5BWW A;  1XMQ L;  1HNZ Q;  3S9W A;  1N32 Q;  2HCC A;  3CQZ B;  1Q3L A;  2RDG A;  1U4P A;  1VQ8 A;  4HQ6 A;  3L3O C;  3I4N B;  4P74 A;  4E6I A;  4A2A A;  1K83 A;  2P0A A;  3HOY H;  1N36 L;  5KND A;  3GIJ A;  1QJO A;  4NYE A;  4O4J F;  2QYZ A;  1CSP A;  3FKI B;  5EWE A;  4KHP Q;  1QOH A;  5GAH C;  3GTK B;  1LTB D;  1U5K A;  4I7Z C;  3HOY G;  5HNE A;  3TQY A;  2N49 A;  1C8C A;  1LTS D;  5KFR A;  2UUA Q;  5DM6 3;  1N34 Q;  1ZHS A;  5DLG A;  3E9I A;  4LWC A;  5LHY 1;  1GUN A;  5KFL A;  1ESR A;  1WVL A;  2NU7 B;  3H0G B;  1YI2 A;  4A3L G;  2Y0S G;  5CC4 A;  1FR3 A;  2CW0 C;  3CP0 A;  1SJE D;  4IPC A;  1M0T A;  1EUC B;  4OO1 I;  3KTM A;  3I4M B;  3GII A;  1EQV A;  1XNR L;  4HYK A;  5LL6 b;  3T5H A;  3LML A;  4JI0 L;  5JQG F;  2WB1 A;  3PO3 H;  5KIX A;  2KCN A;  1E4E A;  2K5D A;  4O7Z A;  4LJZ C;  3K58 A;  2F3V A;  1YNN D;  1N36 Q;  2ICE C;  1RYR A;  1W2B A;  4PV1 C;  1GOZ A;  1FJG H;  4CKC A;  3WO0 A;  4WJW A;  3UFX B;  1GUT A;  4DLK A;  3D31 A;  1N8R C;  3S1M H;  5LMN L;  4A3M B;  2NTT A;  5I2Y A;  5KKN B;  4PMW A;  1CS0 A;  2DNE A;  2LMC B;  2N8N A;  4Q8F A;  4XYL B;  1HZB A;  5CM0 A;  3H40 A;  4YCU A;  3KHR A;  4M1U B;  2AGP A;  4JI8 Q;  4BBR H;  5M5W H;  5CBA E;  3STB C;  5M3M B;  5BPH A;  5KFY A;  2KSW A;  1CQV A;  2Z04 A;  3K7A H;  4YAJ B;  1X54 A;  4O3P A;  3S1R B;  2W9C A;  4JI0 Q;  4LF7 L;  4IPH A;  2CKZ B;  1PXU A;  3GTJ H;  1K9M C;  2VR1 A;  3N8D A;  1Y1W H;  1EKF A;  3H91 A;  3G6J B;  5IGE A;  1V51 A;  3NTI A;  1S5B D;  2HCI A;  5GRO A;  3A5U A;  5FLX c;  1TWF B;  1CKO A;  4JCV E;  2PO4 A;  4JI7 L;  4GKJ H;  1Y1W G;  3BJY A;  4ILW A;  3BZK A;  5FLX W;  4DNT B;  3CME A;  4B3M H;  3Q2O A;  1C4Q A;  3CCV A;  4DGZ A;  1ZKO A;  2K01 A;  4AH6 A;  1E1T A;  3FVQ A;  5D1P A;  4LF9 H;  4Q0F A;  4QY7 A;  2B3G A;  3JRW A;  2Q8R E;  4H02 A;  2R93 H;  2A5H A;  2QDL A;  3HOW G;  2UVV A;  3J80 W;  3PF4 A;  4N8X 1;  2B2W A;  4FO2 A;  3JZ6 A;  4ABN A;  2E2J H;  2AQ3 B;  2K5W A;  3BAB A;  3AMU A;  5DG8 A;  1UE5 A;  1OBG A;  4GOP B;  5C1O A;  2R7D A;  1SNC A;  4HED A;  1ESF A;  1TKW B;  1Z6H A;  4RG1 A;  3ZYY X;  1JR0 D;  4FS1 A;  1X3F A;  2I5H A;  5K3W A;  2Q8T A;  3S24 A;  1BGW A;  1KC7 A;  4UP7 A;  1JDB B;  2C5C A;  3SVM A;  1MJE A;  4KKT A;  3MA2 B;  2I80 A;  1A8V A;  2HUG A;  4YR0 A;  1VQE A;  2L1B A;  4LUZ A;  5IP9 H;  3MWD A;  4GOP C;  3MEH A;  4G3I A;  3NPP A;  4ED7 A;  2EY5 A;  1VQH A;  1JX4 A;  1BF4 A;  5BWR A;  4KD3 A;  4TUY F;  4GLV B;  1IXR A;  5IP9 G;  2FK2 A;  2RDI A;  1EZ8 A;  2J7Z A;  4FBU A;  1MSG A;  4UP9 A;  5JVL A;  1I50 H;  4C1N I;  3V6H A;  3D6W A;  1A3U A;  4PMC A;  2K7V A;  4JYA L;  4JBM A;  5IT9 E;  2J6T A;  4A75 A;  3SK5 A;  4DR7 H;  1I1L A;  1VF7 A;  4MIU A;  4O4I F;  2FK3 A;  1C48 A;  1HZ9 A;  4DR6 L;  4RFB A;  4LF8 Q;  1JJG A;  2FK1 A;  3T13 A;  1QVG A;  5KFM A;  2D0O A;  1ML0 D;  1MI2 A;  3D4W A;  3CCE A;  3VNN A;  2NU6 B;  3E0E A;  1PH7 A;  5LXT F;  2PW7 A;  3QIA A;  2K28 A;  2QCP X;  1NSN S;  2ENB A;  4C3J B;  2I5L X;  3K7U C;  1PTO B;  5CAE B;  3T54 A;  2AGO A;  4DV4 L;  1K1Q A;  3T9E A;  2IP4 A;  1WTO A;  4OON A;  3PUW A;  2BDO A;  4HTH A;  2VY3 A;  4RZQ A;  4DR4 L;  4DUZ Q;  4JYA Q;  3V96 A;  5I5S A;  3FKI A;  2RDH A;  5CA0 F;  2R6F A;  5CV6 A;  2UXD L;  3PO2 H;  4DR6 Q;  4KHP H;  1EIG A;  2NZO A;  1VQK A;  2X5R A;  1K83 H;  5HUR A;  2EJM A;  4NDX A;  1I94 L;  3RGZ A;  1PTO C;  2UUA H;  3OUZ A;  5DAA A;  1N34 H;  1A6X A;  2ASD A;  3H0G A;  4GS3 A;  3PO2 G;  1KC8 C;  3HBL A;  4O7V A;  4DIM A;  2VS1 A;  4XQQ A;  3DUZ A;  1YIJ A;  1S0N A;  2OH2 A;  4HIO A;  2HGX A;  3GTG A;  5EBD A;  3U55 A;  4O3S A;  4P75 A;  1B9M A;  5DQG A;  4EBE A;  1YHQ A;  2A69 D;  5EPL A;  1G2W A;  2MJ8 A;  4DR4 Q;  1LTT D;  5KFA A;  3OIQ A;  2X69 A;  4WHX A;  2W57 A;  3TZD A;  3MZ5 A;  1I7L A;  2G9H D;  4Q43 A;  1OXS C;  1I1M A;  1N36 H;  1LT4 D;  1EEI D;  4R4C A;  4R1J A;  1EWC A;  1RTN A;  1AE3 A;  5NUC A;  4QUC A;  3MEF A;  4DV2 Q;  1TAE A;  5FLM H;  5KFG A;  3MAQ A;  1BBU A;  2D5D A;  1I94 Q;  4QIW E;  1AN8 A;  4RH6 A;  3M9M B;  1HFG A;  2KA7 A;  1QVC A;  2IX3 A;  4KJO A;  4JI3 L;  2YRW A;  4RHR A;  3A7L A;  4JXU A;  4DL4 A;  5FLM G;  4KY5 A;  2E2H B;  3H4D A;  4ED6 A;  1B1Z A;  4MV9 A;  1J6Q A;  1PH2 A;  2F3W A;  2DZD A;  1ET6 A;  1EWI A;  1E0B A;  4Q4D A;  3J7A F;  4A3K H;  5DG9 A;  3EJI A;  2SNM A;  3UDX A;  4R7R A;  4JI0 H;  2XGT A;  3V4S A;  2ODT X;  4JV0 A;  3J7A K;  3T56 B;  3RF2 A;  2ZTC A;  1IBK L;  1WTP A;  1CKN B;  1TVX A;  3HZX A;  3CXC A;  2ALZ A;  4A3K G;  1XMO Q;  4KK7 A;  2CWA A;  3HKZ G;  4XYQ A;  5LMN H;  4DK0 A;  3D4R A;  2F0T A;  2I46 A;  4KI0 A;  4ECT A;  2A6H C;  5ELD A;  3ICE A;  2W6Z A;  4NW2 A;  2HT1 A;  2KCM A;  2O03 A;  5JPM C;  4HJ5 A;  3TP6 A;  1LLR D;  4IN3 A;  4C56 C;  4PBC A;  2Z1C A;  1SRU A;  1I1K A;  4DR1 L;  5BN5 A;  1BJT A;  4DV6 Q;  2GLT A;  1E4G T;  5H80 A;  2FB9 A;  3Q8Q B;  2VUG A;  4JI4 L;  4GOP A;  1IBK Q;  2NVQ H;  5K2M A;  1BNZ A;  4I50 F;  3SI8 A;  3H3V H;  3NQI A;  1ONL A;  4UPA A;  4R4Q A;  5IYB H;  1A9X A;  3M4O B;  4YJ2 F;  5JJL A;  4Y8V B;  3UZO A;  4JI7 H;  5HY6 A;  4MV1 A;  2SDF A;  1ZQ7 A;  1CT1 D;  4FGR A;  3KYH C;  4EQP A;  5IYB G;  1IYJ B;  1BCP F;  2E8G A;  2A73 B;  1HR0 L;  2OQK A;  2MQH A;  4A93 H;  4HJ8 A;  1NNX A;  1JWS D;  3OSO A;  2UUC L;  4DA2 A;  4DR1 Q;  1JWM D;  4A3G H;  1PH8 A;  4ECQ A;  5I9O A;  2Z6K C;  3P75 A;  1STY A;  1T9H A;  2FMM A;  2G9D A;  3RLO A;  4C3I G;  1S0O A;  2ALY B;  5KG3 A;  4F4W A;  5C4X B;  2F0I A;  1KXL A;  3G6Y A;  2Z0S A;  4TV9 F;  1Q8K A;  3MR3 A;  2UVW A;  3F1Z A;  1AH9 A;  4UY8 C;  4LFA L;  4YWL A;  4DV7 Q;  1KTA A;  3MC0 B;  4MZ9 A;  3BZC A;  3Q0A A;  3TW6 A;  4NLG A;  4PG3 A;  5C6A A;  3S14 B;  3S1N H;  4JV5 L;  4ZLT F;  4H0L C;  2HHH L;  3TS0 A;  1S40 A;  4LF8 H;  2RGV A;  3GTO H;  1IBM L;  5JEA J;  5A35 A;  3U58 A;  3A54 A;  2VQD A;  4AYB A;  3E3X A;  4GC6 A;  4HNU A;  1EIY B;  1HUN A;  2JA8 H;  4G7Z C;  3RN5 A;  4RKL A;  5HGT A;  2COJ A;  3JAM E;  1S5F D;  1BCP D;  2NZ1 D;  3KUP A;  3L9A X;  4KV6 A;  2R8K A;  4A3F H;  1W6J A;  3NBZ B;  3DLL A;  1RJQ A;  2FKL A;  4IJH A;  1TWC A;  3OW2 A;  3KF8 B;  5LA6 F;  2EYH A;  1GJX A;  2P5Z X;  4M7E A;  3J81 E;  4DUY L;  2ZXO A;  2NVT H;  3DWA A;  2YW2 A;  4U6P A;  1F77 A;  1D5M C;  3HOX H;  4DUZ H;  1V9P A;  4A3F G;  3LQS A;  1E22 A;  1TWH B;  4JYA H;  2VUM A;  3TEH B;  2QB5 A;  3MR5 A;  4KD4 A;  1L1O B;  1S3O A;  3J81 j;  1JC7 A;  1KDA A;  5T1I A;  3IG0 A;  4DR6 H;  3A7A B;  4GNX A;  2ZM6 L;  2BQU A;  2E2I B;  1RJT A;  5DLQ E;  5FPR A;  2XIW A;  1VQN A;  3N43 B;  4U7C A;  1S9F A;  2R7M A;  5I2X A;  2XCP A;  5ELN A;  1IHZ A;  1I3Q H;  2ZJQ A;  4MTE A;  4EQN A;  1KAB A;  4HNT A;  1L1O C;  1BR9 A;  1Q86 C;  5I5T A;  3RB0 A;  4CDF C;  4O7L A;  2QEX A;  3N44 B;  3HOW B;  1GD7 A;  4DUY Q;  2F0L A;  5C1P A;  3O13 A;  3PSI A;  4POG A;  4HCS A;  4DR4 H;  3T7A A;  1GUO A;  3GTG H;  3S15 B;  2CVR A;  4YB8 B;  3NWS A;  2JA5 H;  3Q8S B;  3SK6 A;  2RHS B;  3U9T A;  3VPD A;  2VQE L;  3G7L A;  2CH4 A;  5KT7 A;  2AQ2 B;  3D3R A;  4DV2 H;  3VR6 A;  1ET0 A;  4K8I A;  3NEM A;  1O75 A;  2UVR A;  4KHZ A;  1GKH A;  4JI1 L;  2JA5 G;  1KNE A;  2E2J B;  1I94 H;  2EQS A;  1TS3 A;  4FM9 A;  3PW7 A;  1VAJ A;  4IAJ A;  5M5Y H;  1GHJ A;  1L0X B;  4TQS A;  2NU9 B;  2BH8 A;  1AW7 A;  3BVZ A;  5ELB A;  2RF4 A;  4APV A;  1VQM A;  4PMB A;  2R92 A;  5TSS A;  2IWH A;  3DTF A;  2HHF B;  1JXL A;  4R4T A;  3PR5 B;  3G71 A;  3QJY A;  2YCH A;  5IT9 c;  4JI2 Q;  2CQO A;  5EZY F;  2ZT9 C;  2JA7 G;  3J7A V;  2ZXR A;  1KIX A;  1XMO H;  1G2S A;  3L4K A;  5IT9 W;  3PCO B;  2H5X A;  2MGS A;  1X3Q A;  3KXY T;  2XIG A;  3U4Z A;  2ES2 A;  2YS6 A;  4JI1 Q;  2F03 A;  2W6O A;  3HOV G;  4J0M A;  1VQA A;  5KFE A;  2F0D A;  4MTK A;  4ZOL F;  4Q8E A;  1B6S A;  2AWN A;  5AJ3 L;  4JI3 H;  3QB3 A;  2X6L A;  1SXT A;  3KLW A;  3AU7 A;  4QL5 A;  4I7A A;  2E5L L;  2DAA A;  1WTX A;  1IBL L;  2M00 A;  3GTM B;  4FFP A;  1WCM H;  4UFZ A;  4C3H H;  4KY7 A;  4DAP A;  5L9X A;  4DV6 H;  4O7T A;  2V4Q A;  5IWA L;  1D1K A;  4C5A A;  1M7J A;  1B8A A;  1IBK H;  4LF5 L;  5KG1 A;  5DGI A;  4XT1 B;  2K6A A;  1EY4 A;  3PGZ A;  1WCM G;  2Z6K A;  2IX1 A;  4O7R A;  2VB2 X;  2FFK B;  3AYH B;  4N8F A;  3MR6 A;  1VQC A;  2HD3 A;  2CW0 D;  4M8A A;  4O42 A;  2IY5 B;  3BJU A;  2VL6 A;  1B9N A;  3I70 A;  3HOU H;  1UE1 A;  3UYY A;  3J81 i;  2RSN A;  4JC0 A;  1CA5 A;  2NN6 H;  2QA4 A;  4CE5 A;  4O84 A;  4ZYS A;  1STE A;  4JBJ A;  2GN5 A;  2R3Z A;  5C5J A;  2OF1 A;  2PZT A;  1KLU D;  2SNS A;  2O5J C;  3TIG A;  2RGR A;  2V9W A;  1Q1E A;  3UI2 A;  1OTC A;  3OOC A;  4IWX A;  1IBL Q;  1EFW A;  4RAU C;  3SGI A;  4DR1 H;  1TWA A;  3DTG A;  3TSS A;  3NTK A;  2PMZ B;  3T16 A;  5C44 H;  3F2D A;  1AUV A;  1XYI A;  5IWA Q;  4LMY A;  4RNO A;  2RKS A;  1MJC A;  4BWS C;  4RZR A;  2PI2 A;  3STB D;  1JB7 A;  4DV7 H;  1SNQ A;  4C2M H;  2R61 A;  3PN1 A;  1TWG B;  4ZKB B;  5JEA H;  3K81 C;  3IKJ A;  4O3N A;  1MSH A;  2JQO A;  2AMC B;  4RCN A;  5T14 A;  3I3C A;  1PFB A;  5D3I B;  1DXM A;  5A2Q W;  3EVQ A;  2JEF A;  2K32 A;  2LFN A;  3RZO B;  5F9N A;  1WTW A;  1T5X D;  3BZD B;  3UE1 A;  1HR0 H;  1ZEQ X;  1CQF A;  4MV8 A;  1ASY A;  4RA8 A;  3W5O A;  1KJ8 A;  1II3 A;  2D9U A;  3W1G A;  5C4J H;  1KL9 A;  2Q2T A;  2Q7D A;  1SE3 A;  3A56 A;  4K6L A;  1SYD A;  3KF8 A;  4A4I A;  1HNX L;  5I5U A;  1SMY C;  3UDI A;  2V1C C;  5J1Z A;  1EFI D;  5DGA A;  4LFA H;  3RV4 A;  2JN4 A;  3RD4 A;  3RIZ A;  2W9B B;  3I56 A;  2F0G A;  3T4A C;  1GUG A;  4X3K A;  3D6C A;  1PA6 A;  4YY3 L;  1EY7 A;  2F0E A;  5CGK A;  4XQJ A;  2FPP B;  1H9J A;  1TWC H;  2F0F A;  2HVQ A;  1VQB A;  1SYC A;  5FLX L;  1YBY A;  2HHH H;  2A1A A;  4LUV A;  3HKZ B;  2YU9 H;  1W93 A;  2A68 C;  3SXH A;  4C1N K;  1A2T A;  3F2U A;  4Y7N H;  2VUM H;  3KAK A;  1O78 A;  3R5X A;  3BU2 A;  5M3F H;  2DAB A;  4ED1 A;  4OHJ A;  4DK1 A;  1SMX A;  3J80 L;  2B2V A;  2HDL A;  4RUA A;  1HA5 A;  2EYL A;  4B3S L;  1HNX Q;  2ASJ A;  1RKN A;  2EY2 A;  1KTK A;  4MV3 A;  1K1S A;  3OMG A;  5DG7 A;  2HDK A;  2IJ0 A;  4DUY H;  3K5M A;  1TS2 A;  3PW5 A;  4O86 A;  2WB1 E;  3K5O A;  1JE5 A;  2LSS A;  5KYL A;  5C0X H;  4IWY A;  2WKD A;  4YY3 Q;  4L5Q A;  2FLP A;  3EPI A;  4DR2 L;  2JA6 G;  3K80 C;  3ER0 A;  2ZM6 H;  4YCW A;  4NPS A;  3J7Y W;  4FFO A;  5C0X G;  2FJ2 A;  1PYB A;  2Q2I A;  5I4D A;  2NVQ B;  1CQJ B;  3UZB A;  5J2T F;  2DIK A;  1PRT B;  3M85 A;  1IOV A;  4ECW A;  1PZJ D;  4LF6 L;  2YTV A;  1QCB D;  1IYD A;  1V43 A;  2HDM A;  3RNU A;  1F2Y A;  2F0U A;  3B6Y A;  1HNW L;  3J80 i;  1ICW A;  2HHF A;  1LT5 D;  5DM7 3;  3U54 A;  1R9T B;  2EYJ A;  5K36 H;  3KAL A;  2J9G A;  4DF7 A;  4C3I B;  3P20 A;  4XZ3 B;  4TKO B;  4JI2 H;  3DWQ A;  1SEB D;  3H3V I;  2EJ2 A;  1PRT C;  2R92 H;  3LWU A;  5K36 G;  1JT8 A;  2VQE H;  4NXN Q;  1GUS A;  2L4N A;  1X3P A;  1PHJ A;  1EL0 A;  1TR5 A;  3NBY B;  4K6N A;  2KEC A;  4IPD A;  4JI1 H;  5D1O B;  3C3L A;  4RB3 C;  3CRL C;  3S17 B;  2ZJR A;  1HH2 P;  5KG2 A;  3CPW A;  1CUK A;  5E4X A;  3HKS A;  3PIO 3;  2F0O A;  1VMC A;  3JAM c;  4LF6 Q;  5KFS A;  5E3F A;  2CWP A;  1FNV A;  2EOT A;  5D14 A;  4R4O A;  3H6M A;  1KNA A;  1S0M A