1A0IA

Atp-dependent dna ligase from bacteriophage t7 complex with atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
348
structure length
332
Chain Sequence
VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDGVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFHRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQAAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWWKMKPENEADGIIQGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFDACTINPYDGWACQISYMEETPDGSLRHPSFVMFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Crystal structure of an ATP-dependent DNA ligase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Ligase
total genus 89
structure length 332
sequence length 348
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF17879 DNA_ligase_C DNA ligase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a0iA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1a0iA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1a0iA01
4OONA 1EIFA 1Z47A 5JJKA 2CFMA 1JJCB 3CMAA 4JI6Q 3BJUA 3KFUA 2WFWA 4B3MQ 1OXVA 1Q1BA 3JSNA 5DISC 4A3CG 3HKSA 1K8AC 1X56A 4B3SQ 2NVYH 4LUVA 4BBRH 3H3VH 3I4MH 4UCRA 4GOPC 2B3GA 1KL9A 1K3RA 4IPGA 5C0XG 4EFBA 1VQOA 1YIJA 1XMQQ 1B70B 2QEXA 3CCEA 3RN5A 5LMNL 1V1QA 3RNUA 1CKNA 4DR2Q 1HR0W 4X64Q 2BH8A 4BBRG 3L7ZC 2VY3A 3CP0A 3PIPA 5K36G 4JI2Q 4H02A 3DLLA 1I94Q 1E22A 5C44H 5FLMH 3RZOH 1NMFA 3CMEA 4EEQA 4JBMA 3CAMA 2ZM6Q 2E2JH 4A3DG 4JI4L 4KHPL 1Y1VH 1N34Q 3RN2A 2I0QA 1WCMH 4JYAQ 4DR7L 3NC0B 1W2BA 2D0OA 5FLMG 3K81C 1VQFA 1G51A 3L0OA 4A3LH 2ALYB 3UE0A 3K0XA 3QWUA 2MO1A 2B63H 1X54A 2K50A 4DV4L 3GTLH 3PUVA 1FVIA 1HZAA 4BA2I 2L15A 5M3FH 4GOPB 3TS0A 3EBEA 1TWHH 3KF6B 1VQLA 4JI0L 3FKIG 4EQ5A 4UP9A 5C4XH 4A3LG 4R4CA 2N78A 2I5MX 4APVA 2QA4A 3PUYA 2PI2E 3GTJH 4FDBA 4MNOA 3H3VI 3J80i 1B04A 1VQEA 1QZGA 3D31A 5GAGC 1E24A 3KOJA 4NXMQ 1EYGA 4LFBL 1HNWQ 3CPWA 5BR8L 1SMXA 2NVXH 2Z6KA 3WWVA 5E7NA 3HFZB 2UUCL 3T1HQ 4IOAA 3UDFA 1JT8A 2E5LQ 1GD7A 3TS2A 3M85A 1EIYB 5C0XJ 4DUZL 2A1AA 1MJEA 4YWLA 4LW1A 2NVTH 2D62A 1WJJA 4OWTB 1LUZA 3S2HH 4GN3B 1N33Q 1BBWA 1OXSC 4DR5L 1VQDA 2CQOA 1YHAA 2ZTDA 1Y14B 4L5SA 4B3RQ 4LUOA 3K80C 2LXJA 2ZTEA 1VQCA 4GNXB 3BU2A 1K9MC 3CPFA 3HOUG 4IFDG 3GJXB 4BY1H 3G48A 1BBUA 3H0GH 5FPRA 2AWNA 2MQHA 1IBKL 1VQHA 4A3KG 1I5FA 3HOZH 2VZAA 4LH7A 5GROA 1D8LA 3J80c 4AYBG 1N9WA 3F1ZA 3H15A 1GKHA 3L2PA 4POGA 3JAMc 4JC0A 1JJGA 1NE3A 2BA0A 3AEVA 1EOVA 3S2DH 4LUZA 1N36L 4DV7Q 4PG3A 2RCNA 5M5WH 4HJ7A 4DV5L 3HOUH 1QVCA 3I7FA 1OXUA 2LXKA 4A3FG 4L5RC 4YCWA 3PO2H 1D7QA 1DGSA 4LF8L 1IBMQ 4YHHL 1X3GA 2CKZB 1K73C 2ZJRA 2JA6G 2K14A 4RMFA 3U50C 4KHZA 1G6PA 4A3IH 4KHPQ 1N32L 4P73A 3M4QA 5ELNA 4LH6A 4A3GG 2R93H 1YVCA 1HZ9A 1VQGA 2VQFL 3JC66 1KRTA 3RZDH 4GKKL 1RIPA 5M3MG 1YNXA 5IP7H 4HJ9A 2WAQG 1PV4A 4UCUA 4DV4Q 1XNRL 3G4SA 1VQNA 4X65L 1VQJA 2R93G 3VNNA 1YJWA 2R92G 3BABA 2CCZA 2EIFA 2K4KA 3G71A 4DV3Q 3CCRA 5IP7G 4ME3A 4C2MH 3CCUA 1KQSA 3HOYH 4C3HH 3FP9A 3ULLA 5GAHC 2R6GA 4K0KL 2OQKA 1PA6A 4WJ3M 4GN5A 1UE5A 4PMWA 1Q8KA 1JJ2A 1QUQB 1M1KC 4IFDJ 1AH9A 5IYDH 4OWXB 5D1OB 2JEBI 4HIDA 1X3EA 2RHQB 1E3PA 3KDFB 3CC7A 5BR8Q 1FJGL 3HOYG 3U4ZA 2OTLA 1L0WA 1TXYA 4GLVB 2UUCQ 3W1GA 3PO3H 2I5HA 5IYDG 5GQOA 3CCSA 3SGIA 2ZTCA 3B6YA 1UWVA 3NBZB 4DUZQ 4BXXG 4J15A 2ES2A 3GTGH 4BBSG 3NBYB 3AFQA 4YWMA 3TQYA 2JJQA 3S17H 2K5VA 4JBJA 4A93H 2KBNA 4LFAQ 2K75A 1XPOA 2OTJA 1YBYA 1VQ4A 4DR5Q 1VQKA 2JA7G 4UCSA 4UP7A 4POFA 2BH2A 1B8AA 5J3BA 1GO3E 1YI2A 2NN6I 3CCJA 4GN4B 4DV6L 1YJ9A 4KI0A 1HNZQ 1LM0A 2AWOA 1IBKQ 5GAEC 1XMOL 2VNUD 3STBC 3RTXA 2UXBL 2XTIA 1TWAH 3OTOL 2ASBA 3I4MG 1XNQL 3S16H 3UQ8A 4QL5A 3PGZA 1OXTA 3PN1A 1QVGA 1JMCA 3CCQA 1N36Q 1MIUA 2JA5H 2IT1A 4DV5Q 2YYZA 4XIGS 1JB7A 2VUGA 2HHHL 4P72A 5C44G 2HVQA 2MO0A 2OCEA 1L2FA 4LF8Q 3S14H 1SN8A 2KCMA 3A0JA 4JI1L 4PZ6A 5FPOA 4QY7A 2JA5G 1Y1VG 3ICEA 1PVOA 5IWAL 4CC5A 1WCMG 4Y52H 1CKNB 4LF4L 2ID0A 1N32Q 3GTKH 2AMCB 1I6HH 3W1BA 4MZ9A 3PF4A 4DR3L 1VQ7A 1VQIA 1YZ6A 1R9TH 1YHQA 1TA8A 1M90C 4JI5L 3GDEA 3TEHB 2VQFQ 5D1PA 4GKKQ 3ULPA 2B63G 2Z6KC 3ULJA 4GNXC 1KIXA 2Q2TA 5FJ8H 4QGUA 3E9HA 5M3FG 3PIOA 4AQYL 1I50H 1XNRQ 4X62L 4X65Q 3UDIA 1X6OA 1A63A 5C4XG 1VCIA 3JAMi 1MJCA 4UCVA 1Q1EA 3NENA 4P75A 4NXNL 2HIXA 4DR4L 1QVFA 3KF8B 3UE1A 2N49A 3PSIA 2VUMH 3J81c 4JI3L 2K5NA 3RR5A 2HVRA 3KJPA 2VQEQ 1VQPA 2AHOB 1Z9FA 1VQ8A 2A8VA 1W3SA 4DK6C 1K83H 3AYHB 4XTCS 3J7ZC 1FJGQ 1L1OA 4HJ8A 2KHIA 2NZHA 3I4NH 2EXDA 5EAYA 1C7YA 3RLFA 2RF4A 1UEBA 3M4PA 2UXDL 3HKZE 3GTMH 1EQQA 5HY6A 1SRUA 2YV5A 3T1YL 4DR1L 1KD1C 1V9PA 1HJPA 3CW2C 3VDYA 3ER0A 4DAMA 1TWGH 2EQSA 4LWCA 5GADC 3F2DA 3BA9A 3RLNA 3LGJA 3PCOB 2PQAA 2ZJQA 2UUAL 4JBKA 4DV1L 4LF6L 4BY7H 1C0AA 2N8NA 5IYBH 1WI5A 4KLKA 1SLJA 5IE8A 2VW9A 3STBD 4BY1G 3H0GG 1CKMA 2IHFA 4DV6Q 4BY7G 3HOZG 2DUDA 2HIVA 2Y0SE 3HOVH 3CC4A 4JBWA 3K7UC 4JI7L 1XMOQ 4OWWB 2DGYA 2XGTA 1SR3A 5LMNQ 2UXBQ 4DR6L 1PH4A 1XNQQ 3U58A 2E2IH 3NBHB 1HR0L 1IYJB 3D0FA 2NVQH 1SFOH 1Q12A 4CC6A 4JI4Q 3PO2G 1IZ6A 1MKHA 4IPDA 3GTOH 4DR7Q 4A3JH 3TY5A 4YY3L 5IP9H 5C4JH 3S1RH 2HHHQ 4LF9L 3PV0A 1KC8C 1OTCA 3NELA 2QGQA 4JOIA 3HOXH 2E8GA 4A3IG 3Q8DA 4O2DA 3G6EA 3M3YH 1WFQA 3CCLA 2GVBA 4LF4Q 4YCVA 2R7FA 4A3EH 4DR3Q 4JI0Q 3PF5A 2IX1A 1LYLA 3BZKA 4JI5Q 3J7A5 4OO1I 2NN6G 3HOXG 1ASZA 4PZ7A 3J81j 4QIWE 2JK8A 1FL0A 4UP8A 3CCMA 4WJ4A 4AQYQ 1T9HA 4X62Q 1EQRA 1U5KA 4UCOA 2B29A 1LTLA 1NY4A 4LFBQ 1KRSA 1UE6A 1OXXK 4IPCA 3M4OH 4DV2L 1EWIA 3EN2A 1PH5A 1HNXL 1Y1WH 4NXNQ 4LFCL 3OW2A 4YCUA 4DR4Q 4A3MH 4JI3Q 4R4TA 1SE8A 4DNIA 2PMZE 2F4VL 2R7ZH 1VQAA 2F52A 2Q2UA 4R4OA 4Y7NH 3A5ZB 1XPUA 4JI8L 4X6AH 3AQQA 3PO3G 4A76A 4B3TL 2IHEA 2ZJPA 4A3MG 4EFEA 1K0RA 1BKBA 1CSPA 2YTVA 3E0EA 3F2CA 1PH3A 2UXCL 2UXDQ 2JEAI 2Z0SA 3A5UA 1KAWA 1EUJA 2V1CC 3T1YQ 4A93G 4C3JH 2KENA 1YHBA 4LF5L 2K52A 1PFSA 3W5OA 3KJOA 4UY8C 3OYYA 4JG2A 5DLQE 4LF6Q 4RG1A 3HOWH 2Q2IA 2NZOA 4DV1Q 1K8GA 4IPHA 1HH2P 4AYBE 3AFPA 1X3FA 1HZBA 2HVSA 2CWAA 1Q82C 2OQ0A 4DK3C 4GLAC 1YJNA 3M7NA 4A3CH 2C35B 4DV0L 3HOWG 4DUYL 2OWOA 4O0AA 1TAEA 1Q7YC 1XK5A 3K8AA 3J81i 1TWFH 4JI7Q 3BZCA 3S15H 3S1MH 3A74A 1IBLL 3GB8B 3CXCA 5IT9c 4LF7L 1NMGA 1UE7A 4DR6Q 3GO5A 4GLXA 4YHHQ 1HR0Q 5JJLA 2Y0SG 3CCVA 2A19A 1H95A 4DV7L 3KLWA 3EIVA 1YITA 4UCTA 3DM3A 4A3DH 3IRBA 4YY3Q 2CWPA 5AJ3L 4GOPA 4LF9Q 4A3BH 1IBML 3KF6A 4X66L 3F2BA 2YTXA 3F8TA 1GVPA 3RLOA 3UDXA 1HZCA 1PH2A 1J5EL 3CQZH 5JEAG 2WAQE 2UUBL 2JA8H 2JQOA 1A62A 1X55A 4HIOA 4NB3A 1XPRA 4A3BG 5M5XH 2KCTA 4UFZA 5LMUL 2GN5A 4OX9L 3FKIH 1BVSA 5FJ8G 4K0KQ 1Q86C 1L1OC 3UDGA 2UU9L 5IY0A 2JA8G 4L5TA 3U4VA 3S1QH 3M9BA 4L5QA 4P74A 5C3EH 2MNAA 1J6QA 1E7ZA 4HIMA 5HGQA 4JV5L 1GM5A 4GKJL 4DV3L 4P71A 5C0XI 2IY5B 1CSQA 2WB1E 4HIKA 4DKAC 2I5LX 3TY9A 2VUMG 1P8LA 4DV2Q 1HNXQ 1V43A 4LFCQ 3BAAA 5C3EG 2VS1A 3GTQH 1E1TA 2HQLA 1IXRA 2AKWB 4NPSA 4IO9A 1NJIC 3I4OA 2F4VQ 4E6NA 2H5XA 3GTPH 4OO1G 3FHWA 5H1SE 4JI8Q 4IOCA 3CF5A 3KYHC 3I4NG 1NBWA 4GNXA 1S40A 4B3TQ 3S1NH 1KXLA 2F3IA 4AH6A 1PH7A 4JCVE 2UXCQ 2LSSA 2PNHA 1AE3A 1XJVA 2BA1A 5IYCH 4AIMA 4TVAB 3JSLA 1WYDA 1X65A 1TWCH 1L1OB 3CC2A 2JA9A 3E9IA 2MFIA 4TQUS 1PH6A 1VQMA 4DRFA 1A0IA 3I56A 4JI6L 4LFAL 1C9OA 2R7DA 4R4IA 1U0LA 2KHJA 5M5YH 4ALPA 4LF5Q 4B3ML 5IYBG 5IYCG 4LNQA 1E1OA 3S24A 4A3KH 3OTOQ 1N8RC 1S3OA 2IX0A 3MXNB 4B3SL 1JE5A 5JEAJ 1FGUA 1X9NA 4MTNA 1IL2A 1VQ9A 2WP8J 2PQAB 5LMNW 3HOVG 1HNZL 4DV0Q 2FXQA 2D0PA 4DUYQ 1B7YB 4QJFA 4JOIC 3ZJYC 4EX5A 1XMQL 4UPAA 3I2ZA 1VS0A 4DR2L 4X64L 1IBLQ 1KHIA 1S68A 4LF7Q 4IJHA 4A3FH 5FLXc 1I94L 2N3SA 4GS3A 4JI2L 3PUZA 2K5HA 1P16A 4JI1Q 1NTGA 4QQBX 4PZ8A 2ZM6L 4BA1I 5IWAQ 1A8VA 2JE6I 1CUKA 1N34L 4A3JG 2JA6H 3TREA 5IP9G 4JYAL 4OXPA 4R1JA 5AJ3Q 4A3GH 2GVAA 3TY8A 2YU9H 3GD7A 4X66Q 2YTYA 3I55A 4HJAA 1QZHA 2HT1A 5M3MH 1PH1A 1Q81C 1J5EQ 4A3EG 4YWKA 1UE1A 2UUBQ 3TRZA 4DAYB 1PH8A 1EFWA 1QUQA 4IFDI 5D1OA 5JJIA 2R92H 5LMUQ 5ELOA 3K7AH 4OX9Q 1AE2A 3KDFA 3MEFA 1PHJA 1PYBA 2UU9Q 3PUWA 1WOCA 1VQBA 4DPGA 2Q2HA 4C3IH 3CD6A 1I3QH 1CKOA 4A75A 4NXML 4JV5Q 1HNWL 4GKJQ 1Y1WG 2VL6A 1Q46A 3T1HL 2RHSB 1VQ5A 2R7ZG 1PH9A 3PUXA 1VQ6A 4A4IA 2E5LL 2E2HH 1S72A 3BA8A 2VQEL 1PYSB 1SROA 4IJLA 4DR1Q 1YEZA 1RL2A 1G291 3ERSX 3NEMA 2WB1G 4BBSH 1ASYA 4BXXH 1N33L 1XTDA 2UUAQ 1O7IA 2PI2A 3HKZG 2ATWA 4B3RL 4R4QA 2JA7H 1XDNA 4HJ5A
chains in the Genus database with same CATH superfamily
2RDFA 1ICWA 4OONA 5JJKA 3PIO3 3DTFA 3R5FA 2YRWA 1RK6A 1ZEQX 3LWUA 3SVMA 4EBCA 1H9JA 2EJMA 2N55A 5DISC 2MUYA 2NWGA 2B3GA 2CVRA 2B2YA 4XYQA 3GV6A 1VQOA 1SNDA 2O5IC 4EFBA 2V4RA 4O2BF 1BUVT 3OWFA 1MI2A 3U0GA 2LS01 5LMNL 3RMHA 3U9TA 1PLFA 4X64Q 2BH8A 1MGSA 1PFBA 3J81L 2VY3A 3CP0A 4RCNA 2NVYA 4H02A 4O7WA 1XNQH 1E22A 5LL6S 4JBMA 1GYFA 1RJTA 2I0QA 1TWAA 5E4WC 3NC0B 1F9QA 2W6NA 4RZQA 1KLUD 2OT2A 1T3NA 3UE0A 3R93A 2MO1A 4DV4L 3PUVA 3VYSA 5KFIA 2NVYB 2L15A 4ZI7F 5KFCA 4LF4H 1RHPA 2W9BB 3KF6B 3TIGA 1V1OA 4Q5VA 2Q8TA 5I60A 1CZGA 2PO4A 3MWMA 4FP5D 3GTJH 2LFNA 3GV7B 1MD2D 4FBTA 2WACA 3H3VI 1MSGA 1VQEA 2DIKA 4C5CA 2DY8A 4RUAA 2B2TC 4NXMQ 4Y8VB 5BR8L 1SMXA 3D4RA 2Z6KA 1ZHQA 1A3TA 2UUCL 4NMZA 2GQRA 3BVGA 4RKLA 3RBEA 1GD7A 4FO2A 1B4OA 3M85A 1WTPA 1MJEA 5CV5A 1WJJA 2SDFA 4J9NA 1I7NA 1CHQD 5ELBA 2XIWA 5M3FB 4Q8EA 5FLXL 4DR5L 1VQDA 4Q4CA 4LUOA 2L11A 2UXDH 2ZTEA 3HO8A 4IFDG 3CU7A 2XSCA 3T1YH 1BCPC 3GILA 3GJXB 5FPRA 3G48A 4Q44A 3GP7A 1PK8A 1VQHA 4I55F 3LULA 3HOZH 2AQ1B 4AYBG 2NVXB 5FO8B 1VMCA 2RQXA 3H15A 5IGDA 1EQTA 2N88A 5EPJA 3SE7A 4OELB 1EOVA 3S2DH 3N6XA 3CVZA 2H1EA 3NXWA 3I7FA 4YCWA 1I1LA 2VOBA 1SYFA 3OSOA 4A3KB 1E4GT 5D65A 1G6PA 5BN5A 1Y8OB 2IPKD 1N32L 4IUVA 4MIUA 3M4QA 4RWSC 4MV3A 1BCPB 2FE3A 3T54A 1YVCA 1HZ9A 1VQGA 4CHTB 4YY3H 3J7YW 5M3MG 3T51B 4LF9H 5IP7H 3EPGA 3DTGA 1RTNA 2WAQG 1C30A 5ELDA 3K3VA 2K33A 3PW4A 4L1KA 3SNOA 4R8UA 1I4GA 3G8CA 2K4KA 3G71A 5IP7G 5E4XA 3E6ZX 5M5WB 4WJ3M 2C00A 5CBAE 2OLSA 1H9KA 3J7AF 1Q8KA 4JV2A 5D1OB 3T9DA 4FS1A 4HIDA 3JAMW 1X3EA 3OPOA 1DXMA 3J80E 3LQSA 3FPPA 2OTLA 3DF7A 2PYKA 3W1GA 3PO3H 3KK7A 4RNNA 2A68D 2R93B 5KT3A 2R92B 1UWVA 2VR1A 4DUZQ 3HBLA 4TM5A 3GTGH 4GC6A 3AFQA 2R8KA 5I5YA 3UFXB 5J2UF 2W6ZA 3BQ2A 4V190 2OTJA 1YBYA 2VA2A 1SMYC 1B8AA 1LACA 1Q8IA 5J3BA 2DNEA 3HOYB 3T53B 4IRCA 2F0EA 3CCJA 4GN4B 4DV6L 1YJ9A 4E4TA 1HNZQ 1CFMA 2PVPA 4MN3A 4O81A 1XMOL 4RA8A 3QWNA 4CJ2C 5I5WA 3OTOL 3KLSA 2ASBA 1HRJA 3CEBA 1K1SA 3S16H 3OTOH 4QCLA 2Z4HA 3ND8A 3PGZA 1QVGA 1JMCA 3V6KA 2JEGA 2JA7B 2RVLA 2JA5H 4DUYH 1E4EA 3TINA 4JK1C 1PZJD 3T9BA 5L1JA 4IALA 1I4HA 1IBLH 3I91A 1X3PA 5C44G 2NU6B 4FU0A 4LF8Q 1CQIB 1SN8A 4HEDA 3QZ7A 4JI1L 4PZ6A 1ZAUA 4QY7A 2JA5G 1PVOA 4YAJB 2CW8A 1H9SA 5IWAL 4JI1H 5IWAH 3GTKH 3QIAA 3RGZA 1TA8A 3OHAA 1AP0A 4JI5L 3GDEA 1F2MA 2VQFQ 4I7HA 4LMQD 2B63G 3ULJA 4GNXC 4TRDA 1SYGA 2Q2TA 5EKKA 1G91A 3KHLA 4QGUA 3OUZA 1I50H 3UDIA 1E2VA 4QSHA 3NGDA 3NENA 3WO1A 5LMUH 5IGGA 2WTFA 4JPBW 2KVMA 3RUZA 4NZMA 2VQEQ 1K1QA 4DU9A 1O80A 3KUPA 1PX2A 3DUZA 5JPMC 2QCPX 4N9PA 3WO0A 4I4TF 4O86A 4ED0A 2KHIA 4O2AF 3JAML 3A8IE 5LHY1 1C7YA 1HQMC 2B2VC 3RLFA 5DQGA 1I4QA 2KECA 2QEJC 2F0UA 2EYLA 2YV5A 3VPDA 5BYAA 1ENAA 4LJZC 1V9PA 4HN2A 4DIMA 1S03G 3QR8A 3VDYA 1KABA 3MXNA 4DAMA 3GTJB 4DL5A 4LWCA 1A6XA 4LF6L 3LGJA 4FNFA 4K2LA 4RB0A 2NU8B 2WIIB 4OIKA 2EJ2A 2N8NA 5J2TF 4KLKA 1SLJA 2PPBC 4LSAA 3T7AA 3STBD 3H0GG 1KTKA 1GSHA 2YW2A 2EOTA 1MZBA 5DGBA 3HOVH 2NU7B 4RU9A 3K7UC 1FNUA 2DGYA 3RAXA 1SR3A 5LMNQ 4B3MH 3MA2B 3A7AB 1XNQQ 3NBHB 1HR0L 4QWAA 1IYJB 4U68A 4B3SH 5KFVA 3GTMB 2CW0D 2FFKB 2RDHA 4CC6A 5TSSA 5L9XA 1DAAA 4KHVA 2GQSA 4AYBA 3TY5A 5FR9A 1IOVA 4RB1A 3PV0A 3J81E 1KC8C 3HOZB 1OTCA 4BY7B 4YJ2F 4JI2H 1M6VA 2PNRC 2E8GA 3Q8DA 4O2DA 3QJYA 4Q0YA 3M3YH 2CNQA 3CCLA 2GVBA 4LF4Q 2ZM6H 3GTOA 4RFBA 4JYAH 5CR3A 3GLKA 4YR3A 4MTDA 1LYLA 3BZKA 1JE4A 4RZRA 2YCHA 1GXDC 1ASZA 3AW8A 3PZPA 1PZKD 3ETHA 3J81j 4NYEA 4IR1A 1RYSA 1B53A 4ABNA 1U5KA 1LTLA 4FF4A 3D6CA 4C3HG 4KY5A 3M4OH 2ZXRA 1HNXL 4LFCL 3OW2A 4YCUA 4CDEC 4FFOA 1WTVA 5DGHA 3BDCA 4PQXA 3PIP3 2WAQA 3HS0C 3S1RB 2F4VL 1GLVA 2R7MA 1XPUA 1C48A 2L5TA 1G6ZA 1OWTA 1HNWH 5CR5A 1K0RA 1CSPA 2YTVA 1SAPA 1PH3A 1LTID 2ODTX 3T1HH 2UXDQ 4IRDA 5EZYF 4FYDA 3OIPA 2B2WC 2NUCA 3T1YQ 2FLNA 2KENA 1YHBA 5KS8A 1KDAA 1FD7D 4FXDA 4RGMA 4LF5L 4UY8C 5DLQE 3HOWH 2Q2IA 5FLXE 4Q0FA 4IPHA 1K8GA 5JVLA 3VR6A 4AYBE 3W2DA 4J9RA 3PO3B 2OQ0A 4DK3C 4GLAC 3M7NA 2IX3A 3CRLC 4DV0L 3HOWG 1EOTA 1NCVA 1O7LA 1I1MA 1Q7YC 5C0XH 1L2ZA 3J81i 1TWFH 3BZCA 4OIJA 3S15H 3S1MH 3K5HA 5DNFA 3A7LA 3LX0A 5E1FA 4LF7L 2PQEA 4RH6A 1UE7A 4GLXA 1LTGD 5I5UA 2ZDGA 4DV7L 2W8LA 1AN7A 1YITA 5KFXA 1Z2NX 2VXWA 4C3JB 2JYOA 4DV7H 5ELCA 1EY5A 4YY3Q 1VDZA 2SNSA 4LF9Q 4XZ3B 2YZGA 2CH4A 1S5ED 1S0MA 2BDNA 2YYAA 3CQZH 5JEAG 2WAQE 3MJFA 3S16B 4K2KA 1ZHSA 4JUZA 1G2SA 2KCTA 1BGWA 2KEEA 1V1PB 3FKIH 5FJ8G 4O4LF 1L1OC 2M05A 2UU9L 4IIJF 4DAAA 3S1QH 2DLNA 2F0LA 4P74A 5C3EH 4G7ZC 4HN7A 4BS9A 5HGQA 4C5BA 4GKJL 1EIGA 3H09A 4ZCKA 2VUMG 1CQFA 1E4FT 2F1MA 3BAAA 5C3EG 4A3DB 3GTQH 5EDWA 1IXRA 1EY9A 2AKWB 4J6HA 4NPSA 3I4OA 5C4HA 3Q2OA 4E6NA 5I2XA 1TWHA 1SJED 3KYHC 5CV8A 1PH7A 4JCVE 4ZKBB 2PNHA 1ZETA 4PBCA 3N42B 3JSLA 1VBGA 4O1NA 1L1OB 2MFIA 4TQUS 1WTRA 1LT4D 4HR7A 1AN8A 4DRFA 4K5XA 4WBNF 2UVVA 3U9OA 2R7DA 4R4IA 3MFYA 5M5YH 3HOUH 1V4YA 5KFQA 5IYBG 1QNUA 3GIDA 1GOZA 2J6TA 1YNJC 3JRXA 3OTOQ 2IX0A 1JE5A 1IL2A 1VQ9A 4XXEA 2WP8J 2AU0A 3I4LA 3NWTA 4DUYQ 3OIQA 1QILA 2LKVA 2EYFA 4EX5A 5C1PA 1IBKH 5KGUA 2A73B 1VS0A 1IBLQ 4X64L 1EL0A 4IUNA 5DGAA 1DV1A 1EZ8A 1T5EA 1P16A 2JP1A 4JI1Q 2CZGA 1NTGA 4DF7A 3MFGA 5IWAQ 1Z7TA 5CBEE 1QB5D 4QF4A 4M1UB 4A3GH 2EY6A 3HOVB 1BR9A 2YU9H 4X3SA 3I8ZA 2V9WA 3PMFA 4IWXA 2JA6A 2JN4A 4YWKA 4A3EG 1DZ1A 4DAYB 3G6VA 3M9NB 1QUQA 3I12A 3H4BA 3EYYA 3P7JA 5HGTA 2ZGIA 4B9XA 2V4DA 5LMUQ 3V2TA 1EKPA 3K7AH 3MEFA 2R82A 1IKMA 4IQZA 4O4IF 2GPWA 3PUWA 3ETJA 1ILQA 4NZOA 4B9WA 5KNDA 4DPGA 1XNRH 1SE4A 4A75A 4NXML 3UZOA 4X65H 3C0FB 1Y1WG 3BS1A 3PW5A 3GIQA 5EQ0A 2EIYA 3GQCA 3G6JB 4JXUA 3C1FA 1PYSB 1KC7A 4E6IA 4APMA 1I3QA 3WWHA 4IJLA 1RL2A 3ERSX 4C2MA 1JICA 4GC7A 2E2HA 1Z6HA 2ATWA 4B08A 4FFPA 1XDNA 3M4OB 3GV8B 4X3KA 2QKIC 3BYYB 3MR5A 1EIFA 5BMVF 3JZ6A 5FD5A 2WFWA 4C1NK 2PW7A 4B3MQ 3IKJA 2EPBA 5T1IA 4A3CG 3HKSA 4B3SQ 2NVYH 3I4MH 1KL9A 2XWJB 5K36H 3QQMA 5C6AA 1W93A 3HKZB 4G3IA 1B70B 2F0IA 3L7ZC 5DGIA 3N43B 3PFFA 1LT5D 4JI2Q 5K36G 2YWVA 2HJWA 3TP6A 1QCBD 3MAQA 1NMFA 5JPNC 2ZM6Q 2E75C 3ORQA 4JI4L 1HFNA 5FO7B 1EYDA 1CT1D 4JYAQ 4JI4H 3MXPA 4DR7L 2ASJA 1JB3A 4DR7H 1A0GA 3L0OA 1TWFB 4TSSA 1DYQA 4PWQA 4ETSA 3K0XA 3QWUA 3OHXC 4MAMA 4EQOA 1JIHA 2HCIA 3KF8A 1WCMA 4BBRB 5M3FH 5KT6A 3NE5B 2L0CA 3EBEA 4XYLB 4JI0L 4UP9A 5C4XH 3V6JA 4JI0H 1QJOA 2DWCA 4QUCA 4APVA 3X3MA 3GTLA 4MNOA 2O2LD 5LYJF 5CYUA 3WDNA 1QZGA 3D31A 4AQYH 1R9TA 3FRPB 1E24A 5GAGC 2RBMA 1HNWQ 4X62H 1H9MA 3CPWA 2NVXH 2E2JB 2F0QA 1IYUA 1Y1VB 3T1HQ 2XCPA 1EYAA 4NXNH 2FMAA 3RIZA 1EHIA 1TY0A 3T13A 1BOSA 2OEOA 1EIYB 4DUZL 4K5VA 2A1AA 4YWLA 2NVTH 2D62A 1JDBB 5CAEB 1K0SA 4CE5A 4O42A 1WR2A 5JAVA 1IW7C 3QG1A 1YHAA 2ZTDA 1Y14B 5L37A 4L5SA 4MV9A 1SYDA 3MWEA 1K83A 1VQCA 3BU2A 3QB3A 3Q24A 4BY1H 3GTQB 1ET9A 4A3KG 4LH7A 4ZYSA 2UVWA 4H0LC 3E5SA 1D8LA 3J80c 3I3CA 3GIMA 1KLGD 4ED6A 1ULZA 2K1BA 3JRWA 2Z4IA 2CW7A 4RAUC 1TWGA 1NE3A 2BA0A 3AEVA 2QK4A 1CE8A 1KJIA 4DV7Q 4PG3A 4HJ7A 5M5WH 4ZQIA 4NKLA 2LXKA 4JI7H 1D7QA 4N8X1 5DM73 1JLLB 5M5YB 4LF8L 3GIPA 4DR6H 1NAPA 1X3GA 3RV4A 2ZJRA 4RMFA 4XDXA 1TS5A 4KHZA 4A3IH 1STHA 4P73A 4HSPA 3KHRA 2QDBA 3E5NA 2R93H 2HHFB 2V4QA 5BWVA 1LTSD 2C22A 2VQFL 2WKDA 2IW3A 1DCZA 4XT3B 4J9MA 3H91A 4KMUC 2FLLA 4JW0A 4ZAIA 4XX0B 2R93G 1YJWA 2R92G 2Z02A 2CCZA 3BABA 4J1MA 3IN5A 3O13A 3TBIB 3CCRA 5KFOA 3HOYH 4K0KL 3MWDA 3NTKA 4IFDJ 2Z6BA 1M1KC 1AH9A 5IYDH 4OWXB 2YU9B 5I6WA 4Q8FA 1RD9D 3K59A 2RHQB 1E3PA 3HOYG 4Q43A 4YBZB 3OMCA 1CA6A 2P5ZX 1XYIA 2I5HA 4DV2H 5IYDG 3SGIA 3K58A 1T36A 2V59A 5KG4A 4RHRA 2W6OA 3TQYA 2JJQA 1SNPA 4DK1A 4J9LA 4JI8H 1Y1WA 1STAA 3EVQA 3MC0B 3OUUA 4B3TH 2B2YC 2JA7G 4POFA 3GIKA 3HP3A 1BCPF 1B33N 2PBZA 2YL2A 4KI0A 1XXGA 2O4XA 5CMDA 4HYKA 4RB3C 1IBKQ 5GAEC 1S5DD 2IA6A 2FB9A 4KN4C 3N41B 4IZ8A 1NR4A 2YS7A 3K5IA 3TDQA 1O7YA 1XNQL 3UQ8A 1KJJA 3V6HA 1IKLA 5I9OA 1OXTA 3URYA 3PN1A 4O7NA 4L8JA 3CCQA 4ECUA 1EWCA 2IT1A 2VUGA 4QW9A 1S4ZA 4K8JA 2KEDA 2L55A 4P72A 4A93B 3NK9A 1YNND 1SNOA 4HSVA 5D3DA 5EKLA 2HVQA 2KSWA 5F9LA 1O78A 2KCMA 2Y0SA 5D8DA 3V4SA 4MTKA 4LF4L 3I4MB 1E2WA 4MZ9A 1WSCA 1D6EC 1VQIA 1M90C 4EG0A 2RSOA 1SDFA 2Z6KC 1I4RA 3Q6SA 1KIXA 3RB4A 1TWAB 3E9HA 5CGKA 3PIOA 4O82A 5BWWA 1UAPA 1XNRQ 4X65Q 1X6OA 5KFSA 5CB4F 1XX8A 4ECSA 1W6KA 2HG8A 4UAIA 1QVFA 1D1KA 3J81c 4O7LA 5KT4A 2XRSD 4NLGA 3SK5A 4F50A 5E3FA 1VQ8A 3BG5A 1W3SA 3AYHB 3FEWX 4XTCS 4XYOA 4UUGA 4JV5H 3JZIA 2M9VA 3CKIB 1AZPA 2QB5A 4PMCA 1I6HB 4QIWA 5FKAC 2HDMA 2UXDL 5KFLA 4IUQA 3GTMH 5C4XB 3T1YL 4YJ3F 1KD1C 5IT9W 4TVIA 3ER0A 1EUDB 2F3VA 3F2DA 1EFID 1EY6A 1B9MA 5IGEA 2HDKA 2PQAA 2ZJQA 2UUAL 4BY7H 2RSNA 3K5NA 1C0AA 3PW2A 5DG7A 2UUAH 1WI5A 2EY5A 2ENBA 1GGOA 1KT8A 2VW9A 2W7OA 5DM63 1FGBD 1CKMA 1JOQA 2H4OA 2IHFA 1DIKA 1RK5A 4BY7G 3HOZG 2DUDA 2HIVA 2Y0SE 4RNOA 3VYRA 2NVTB 5KFWA 4H7BA 4DK0A 2HGWA 3K3PA 5KT7A 1TWCA 2SNMA 3P1HA 1MBYA 2VPQA 2WKCA 5KFZA 2ASDA 3D0FA 3GQBA 2EZVA 5C3XA 1GUSA 1PTOD 4JI4Q 1IZ6A 1OO9B 4IPDA 3GTOH 4DR7Q 2DZDA 3KLRA 5IP9H 1LV9A 4YY3L 1JWUD 3S1RH 4BY1B 4LF9L 1C3OA 4YAKB 1Q90A 1SFOA 1I94H 2DJGC 4JOIA 2FLPA 4PNYA 3A8KE 1ONLA 2R7NA 4V0BA 4JI0Q 3TIIA 3J7A5 1NNXA 4F87A 2CNVA 4PZ7A 4QIWE 2SCUB 2XD4A 4AQYQ 4X62Q 3WNZA 1EQRA 5F9NA 2B29A 1IL8A 4F4XA 5J1ZA 1OXXK 1QNKA 4A3IB 4NXNQ 2ZT9C 3VPBA 3EPIA 5KFHA 3ORRA 1STGA 2K01A 4DNIA 1E2ZA 1SE8A 3TN2A 1CHPD 4R8UB 2JEJA 4FBUA 4R4OA 3A5ZB 4XQNA 1CS0A 3AU7A 5KYLA 3HOXB 3AQQA 3PO3G 3CSWA 3V4ZA 1EZ1A 2IHEA 1PMRA 2ZJPA 2XC9A 5CV6A 3W3AA 3MTSA 3F2CA 2R7ZA 5I5SA 2NTTA 4KKUA 1EKFA 1FYCA 3EJIA 2E5LH 5DLFA 1W96A 1SXTA 2A1HA 2FK1A 4C3JH 1V8QA 2R7LA 2WB1A 2K04A 3W5OA 3I73A 1D2BA 4HQ6A 3OYYA 2R8HA 5IODA 1N33H 3TSSA 1TS4A 1RCVD 1M0TA 3VMMA 1RODA 2E76C 4C3JG 4ECWA 3OHBA 1Q82C 1YJNA 1JWSD 4A3MB 5CM0A 4K14A 4DUYL 2R7ZB 1U4PA 4O0AA 1SCUB 2KA7A 3ITPA 4JI7Q 5KRUA 1IBLL 2MCTA 5IT9c 1OBGA 4DR6Q 3VA7A 1F2LA 4ZUIA 1GJXA 4G57A 4CDFC 3KLWA 1EYCA 4UCTA 4A3DH 2R87A 1CZWA 2CWPA 4GOPA 2W70A 3F2BA 1OBDA 3F8TA 4J9QA 3VPCA 4O4JF 1E4EB 1HZCA 1PRTD 3DWPA 1PH2A 4YB8B 5J39A 1B3AA 1A62A 4KHPH 3HT5A 4HIOA 1IYDA 3C2PA 2Z1CA 2K7VA 4H44C 5LMUL 5EGTA 1KUTA 5BWTA 1H9SB 3T5LA 4K0KQ 1Q86C 3A55A 2D9UA 1KBLA 4IR9A 4ZUJA 4L5TA 3M9BA 1W6JA 4L5QA 1K8MA 1B1ZA 3MR2A 2R85A 3DXJC 3NP8A 4DV3L 2D2CC 4P71A 5ELEA 5C0XI 2WB1E 3TY9A 4DKAC 2I5LX 2ABJA 1EY0A 3JZFA 4DV2Q 2FINB 4DV3H 1V43A 5I6YA 3BJYA 1NJIC 2QDLA 4IO9A 4A3BB 3FHWA 3Q8RB 4JI8Q 1C4QA 1RF2D 1KXLA 1GSAA 3KALA 4GNXA 4KD4A 5AFWA 4B3TQ 3TQTA 2F3IA 4AH6A 1RKNA 4HCEA 5IYCH 5LL6X 1JX4A 3SE0A 3GTPA 3ERQA 2EYJA 2JA9A 2KQ3A 2A68C 4LFAL 1B04A 4IUPA 2KHJA 3HXLA 4LFAH 4B3ML 3R5HA 2Y4RA 4CKCA 5IYCG 2QW7A 4KD3A 1EY7A 1Y8PB 3MXNB 4B3SL 5JEAJ 5KFRA 5IGCA 1RJQA 3F8NA 3HOVG 1O7ZA 1JQYD 3MXGA 2HD3A 5KFPA 4YR0A 4UPAA 4FXKC 5KIXA 3NUAA 4A3FH 5A2QW 4JI2L 2MP1A 2N3SA 4GS3A 4PV1C 1JOKA 2JEFA 4RB2C 2ZM6L 1A8VA 2JE6I 2BOSA 2JA6H 1N36H 4JYAL 4OXPA 4DV5H 4R1JA 4O84A 3TY8A 3GD7A 3G8DA 4ED8A 1QZHA 5IGFA 1D5ZC 5FK9C 4OHJA 2ZXPA 2L4NA 3TP8A 4AYBB 1PH8A 4RAZA 1A3UA 3D8GA 4FVMA 4HMJA 3T56B 1SYBA 2I07B 4IUTA 4O7VA 5ELOA 3CRKC 3A54A 3KDFA 1FNWA 2DNCA 4GKKH 3GTOB 1BO0A 1WOCA 1VQBA 4XQJA 1TQOA 5KG7A 1RTOA 2Q2HA 3A8JE 1ENFA 5M9OA 1I3QH 1HNWL 4JV5Q 5HNEA 1V51A 1I2KA 2F0FA 2VL6A 4EGQA 3RBDA 1Q46A 3T1HL 2F0GA 2RHSB 3D4DA 1U9RA 3PUXA 4YIJA 4A4IA 1IYEA 2E2HH 1S72A 3BA8A 3R2IA 1YEZA 5JVDF 4BXXH 4BBSH 2CNUA 5M3MB 1S5BD 2Z9HA 1N48A 1I7LA 2WV6D 4C56C 1FJGH 4F4ZA 2WAQB 3LNNA 2UUAQ 5KG0A 3WWIA 3HKZG 3Q0AA 1GUOA 4FFLA 4R4QA 3LMLA 1DOKA 4M9UA 3P75A 4Z9CB 1JJCB 3BVZA 1IHZA 4K8IA 3U9SA 4ECTA 5L1IA 1OXVA 4R9WA 3GTGA 1K8AC 4LUVA 2GA4B 4BBRH 3E0JA 4IPGA 4DA2A 5C0XG 1AZQA 2J9GA 2F4IA 4O4HF 4YQWA 1YIJA 3CCEA 3M4YA 2B2WA 1CKNA 5IIFA 4BBRG 3PIPA 2UXBH 1FR3A 3RB6A 1I94Q 3OSPA 2HUGA 3X3NA 3FDTA 4G7OC 4KN7C 2YZLA 3RZOH 2AQ2B 5EPKA 4EEQA 3CAMA 2E2JH 2EYPA 1L0XB 1BJTA 1Y1VH 3RN2A 3HGBA 1WCMH 2UVRA 1W2BA 3TZUA 3PR4A 5JVH3 2D0OA 2FPIB 1ZQ7A 2HHHH 3Q8SB 1I4PA 1G51A 4MHEA 4A3LH 2ALYB 2PZTA 2O5JC 1F2ZA 1FNVA 1UUPA 2JA5A 1X54A 2K50A 3GTLH 1FVIA 1HZAA 2IJ0A 3IL8A 4BA2I 1KDBA 3ND9A 3FKIG 1CTMA 4DR3H 4A3LG 2RDIA 2I5MX 2QA4A 2B63A 3PUYA 4FDBA 4HTHA 3U54A 5HV6A 3GTKA 3Q8PB 3U55A 1TR5A 3KOJA 4LFBL 1EYGA 4TUYF 3R9RA 4LFBH 2Q8RE 4R7RA 3HFZB 3NTHA 4DR4H 4DNRB 2E5LQ 5BWRA 1KDCA 3NQIA 3TS2A 2AUKA 1I50A 2FK2A 4O3SA 4LSXA 4JI3H 2W9CA 4LW1A 4DNTB 1WRVA 4IRKA 2B63B 5DLGA 2DAAA 2DPIA 2B2UA 3NWSA 1N33Q 3K0YA 3T5KA 1TWHB 5KFYA 5EWGA 3MEHA 2LXJA 2A69C 2DABA 4CJ1B 1K9MC 3HOUG 2UVUA 1R4PB 3D4WA 1S9FA 2AWNA 2MQHA 1IBKL 4O7SA 1I5FA 1WTQA 1N9WA 4DV1H 4ECXA 4HR7B 4K6LA 3L2PA 4POGA 1EZ6A 1ET0A 5G3LD 3H0GA 5DQHA 1RDPD 2AQ4A 2RCNA 2F0PA 3PO2H 4ULLA 1EY8A 4TQRA 1LTBD 1DGSA 1HUNA 2P0AA 2FMMA 4YHHL 2CKZB 1EU3A 4YHHH 5D14A 3U50C 1S5CD 1KTAA 4KHPQ 5KG5A 1DONA 4G7HC 4LH6A 3T9AA 4A3GG 3KLSX 3SK4A 1F9RA 2I80A 3JC66 1Y8NB 1A2TA 3RZDH 1RIPA 3A56A 5C5LA 1YNXA 1Z2PX 2NN6H 5CA0F 2PW5A 1UC8A 3KTMA 4CGYB 1F2YA 5KNCA 4A3FB 4X65L 1VQJA 1XNRL 2O03A 2OF1A 4C1NI 4FFMA 2F0MA 4DV3Q 4DQNA 5T14A 1I1KA 2COJA 2R84A 3CCUA 1KQSA 2JA6B 1STYA 3FP9A 5GAHC 2GLTA 1T94A 1UE5A 4PMWA 1QUQB 3J80W 3K5OA 2JEBI 1D5XC 1B6RA 5J22A 1JXLA 2FPGB 3BDLA 5EWEA 3CC7A 5JOBA 4J9KA 1TXYA 4GLVB 4I7AA 2TSSA 5GQOA 3JAME 3CCSA 4MV1A 2ZTCA 3NBZB 5EWFA 1HCZA 3NBYB 4L63B 4YWMA 4J8QA 2NYZD 4R8NA 4O3NA 4JBJA 4A93H 2X0SA 2KBNA 4LFAQ 4TV9F 1WH2A 1DOLA 3KBGA 1VQ4A 1I3QB 4UCSA 5IYZF 2UXCH 4UP7A 1DV2A 3D3RA 1TVXA 2BH2A 3T5JA 4C2MB 1GO3E 4C3HB 2RGRA 4CMDA 1II3A 1LT6D 1SNQA 2E2HB 5I47A 5GONF 2AWOA 2DN8A 4ECYA 2VNUD 2YZNA 4BBSB 3RTXA 3I4MG 1TWAH 5CORA 1DJRD 4QL5A 1I2LA 3L4KA 4I65A 1N36Q 2BE5C 4DV5Q 3E3XA 1EY4A 2C2DA 1HQRD 1BQQT 2A6HD 1IYVA 1L2FA 4MA0A 2BQ3A 3A0JA 4EVOA 1WTWA 1M0WA 2MJ8A 4F4YA 4CC5A 5DQIA 2ID0A 2G9HD 1I6HH 3PF4A 1VQ7A 1O75A 1XWEA 3N52A 4DL4A 3UZBA 3VA5A 3GV5B 4GKKQ 3ULPA 1CM9A 4X66H 4QWCA 4RGNA 5DG9A 1B9NA 5M3FG 5KFGA 3TZDA 4AQYL 1J5EH 4X62L 2UUBH 3NBIA 1A63A 1J8IA 5C4XG 2Q8IB 1VCIA 3JAMi 1MJCA 3RZOB 1Q1EA 4UCVA 2RCFA 4NXNL 1MSHA 5EPLA 2HIXA 1JC7A 4BWGB 1WCMB 3KF8B 3M7GA 4X3UA 3UE1A 3CQZA 1LTTD 2Q7DA 1RJRA 4J9SA 4OX9H 3RR5A 2HVRA 5KFTA 1C8CA 2AHOB 4Q45A 5KG1A 5JUMA 3J80L 4NDXA 3J7ZC 4IZOA 1FJGQ 1AUVA 1TKWB 3GTLB 2NZHA 2VUMA 3I4NH 2EXDA 2RF4A 4S3SA 2RGVA 1R9TB 3HKZE 1JKJB 3P20A 5HY6A 3VR4A 1JDEA 4NP5A 4DR1L 3RD4A 4DR1H 2EQSA 3RLNA 2NU9B 1ICFB 5KNBA 2PMZA 2JSOA 5IE8A 5KX5F 4RGTA 4BY1G 2Z8LA 2F0DA 4JI6H 3CC4A 4JBWA 4UHVA 4ZKCB 4JI7L 1D5MC 1K83B 2XGTA 1LT3D 2UXBQ 4DR6L 1BXTA 1PDQA 4M8AA 5KFMA 2XGPA 1SFOH 5KFJA 2AGPA 3S9WA 2F0JA 2F03A 3J81W 1TIID 4GLWA 3KAJA 2J0TD 3BDOA 5D3IB 1XMQH 3J7AV 4A3JH 4J0MA 1ET6A 1TWGB 5C4JH 4DAPA 2HHHQ 4DR2H 2E2IA 4O7YA 3KREA 2F0OA 3NELA 3F2UA 2QGQA 3HOXH 4EGVA 4A3IG 1SYEA 4MV4A 2ASLA 3G6EA 4CMFA 1QG7A 3EQLC 1SEBD 5CC4A 4YCVA 1N34H 1CQVA 3RB3A 2F0TA 4DR3Q 3PF5A 5C3WA 2IX1A 4KK7A 3NTIA 3HOXG 1EQVA 2K28A 2ZJTA 5C4ZA 5K3WA 3PO2B 5C5MA 3BYTB 3CCMA 2EY2A 1T9HA 3EA6A 4LFBQ 1NY4A 2NVQB 1BNCA 1KRSA 2K03A 1HUMA 4DV2L 1EWIA 2B8GA 3EN2A 4DR4Q 4A3MH 2IMWP 4JI3Q 4R4TA 1SE2A 2R7ZH 1S5FD 2PMZE 4ECVA 1VQAA 2F52A 3RZDB 2Q2UA 5I9PA 4JI8L 3C3LA 4O7TA 4J9OA 4B3TL 4A3MG 4DL3A 1BCPD 4A3EB 1BKBA 2W71A 2OH2A 1CI3M 2Z0SA 3A5UA 1KAWA 4EBDA 3Q8QB 2F0VA 3ONAB 1LABA 2XCLA 5FLXW 4ECRA 4EYIB 3KJOA 2DY7A 3K5LA 5CE8A 4DAVA 4DV1Q 1T5XD 3AFPA 1X3FA 1HZBA 4B3RH 3S17B 1B3QA 1Y1WB 4KKTA 3M4IA 1EWHA 4UDUC 3NUCA 4DGZA 2RKSA 2OWOA 1TAEA 5EBCA 3K8AA 3PQIA 3GIJA 4Y7NB 2D5DA 3GB8B 3CXCA 3T9EA 5KFKA 3VYUA 1IOWA 1A9XA 4J9PA 1PYWD 3GO5A 2EDGA 3OWEB 3AB9A 4YHHQ 4U673 2EJGC 3CCVA 3L3OC 5JJLA 1H95A 5BN4A 2IP4A 3RUPA 2EVBA 4MV8A 4ECQA 2CQAA 3EIVA 5EJWA 3DM3A 3IRBA 4OGQC 5LMNH 2R7KA 3DEPA 5T1GA 1KJ8A 4I7ZC 1WD0A 4A3BH 4P2CB 1IBML 3KF6A 2W9BA 4KKSA 1IBMH 3RLOA 3UDXA 4LAAA 1STEA 4U7CA 4ZK9B 4ILWA 2R3ZA 1ZYRC 2JQOA 3G6YA 1X55A 1XPRA 4A3BG 3RF2A 3K5MA 2PZUA 2NB0A 2Y0SB 2CQYA 5LOVF 1PTOH 3UDGA 2K5WA 3T9FA 5IY0A 3U4VA 4QW8A 1TY2A 2MNAA 1F9PA 4DV4H 1J6QA 1E7ZA 4HIMA 3EFXD 4JV5L 1VBHA 4N8FA 2VA3A 3KHHA 2A6EC 4HIKA 2OXPA 1B50A 2VS1A 1E1TA 2HQLA 2FKLA 4TKOB 3GTPH 1SMYD 5H1SE 1SE3A 4IOCA 5DEHA 3CF5A 2ZXOA 5EBDA 4ODGA 1S40A 1KEEA 5BR8H 4QWDA 3SXHA 2JA8B 3I72A 1BNZA 2UUCH 4KY7A 2LSSA 2UXCQ 4X3TA 2XN9C 5M5XB 2BA1A 4O7ZA 2B2TA 4GZYC 1WYDA 5LXTF 1UEAB 1AUXA 3G6XA 2NVXA 1PH6A 2X69A 1Y69U 1A0IA 4QIWB 2V58A 1PFMA 4IFDH 4FM9A 1BBXC 1U0LA 4PMBA 3H6MA 2LMCB 4LNQA 3T16A 2G9DA 2CH4W 3FVQA 4DR5H 3HB9A 5KFUA 1N8RC 1S3OA 4CDCC 3KAKA 3I4NB 4MTNA 3WOEA 1JOOA 2PQAB 2BQUA 1MHWC 3SDZA 1H9RA 3H40A 4QJFA 4JOIC 1KJ9A 3PR5B 3FMAA 5KYIA 3R23A 1GUGA 1KHIA 2X6LA 1LTAD 5HURA 3S1NB 5DAAA 2J6SA 4IJHA 3TP7A 5FLXc 1I94L 4N9TA 3PUZA 5JVG3 3RGXA 3SR1A 4QQBX 2AQ3B 5HBRB 2A5HA 1CUKA 1HTLD 1TWCB 3TREA 5IP9G 4ZOLF 3TMEA 2I8CA 5AJ3Q 2GVAA 4DFAA 4X66Q 1BXRA 2HT1A 4F88A 5M3MH 1Q81C 1PH1A 1J5EQ 3TRZA 1UE1A 3R8BA 2UUBQ 1HA6A 1WTHA 2EJ0A 4F4WA 4FE2A 1EYZA 4RUCA 1YNNC 1N32H 3MWYW 4ME6A 1SFOB 5D1OA 5JJIA 1LTRD 1AEXA 3IFTA 1PTOF 2E2DC 4OX9Q 3QZ8A 2R8GA 2K5DA 1PHJA 1PYBA 4CJ0B 4A3JB 2I46A 5C4JB 5K5PA 2R93A 5CV4A 3HZXA 2WINB 2R92A 3MVVA 2XIGA 1I4XA 5KFEA 2FPPB 3N8DA 1VQ5A 2E5LL 2R6FA 3OW7A 3MFIA 1G8ZD 4EQPA 4K5WA 4R8IA 4DR1Q 2PN1A 3NEMA 5KFAA 2EE1A 1N33L 5BPHA 5IT9L 1XTDA 1R4QB 4ED3A 1L0YB 2PI2A 4EYHB 4WJWA 1EKVA 3L9AX 1TS3A 2YS6A 5JQGF 2HGXA 1JORA 1Z47A 4ID6A 2CFMA 4JI6Q 3CMAA 3KFUA 3BJUA 4QWEA 1ZKOA 2Z04A 3SI8A 1Q1BA 4C3IB 4A2BA 3JSNA 2JA7A 4FGRA 5ELFA 1HHVA 3C1EA 2WB1B 4UCRA 1X56A 3NPPA 3NQTA 3H3VH 3MR6A 2PCFB 4GOPC 4ZRZA 4BWSC 1K3RA 4DV6H 1K28A 2J6UA 1VMPA 1XMQQ 2QEXA 3RN5A 1EFWA 3RNUA 1HR0W 1NUCA 1V1QA 4CHIA 2DJFC 4DR2Q 1XMOH 4CDDC 3DLLA 3TW6A 1RYRA 4TV8F 4EBEA 1NR2A 5FLMH 5C44H 4EGJA 3OSNA 3CMEA 4IN3A 1A15A 4A3DG 4KHPL 2COIA 2LY7A 1N34Q 1ILPA 2VQDA 1A48A 2COGA 2NZ1D 5FLMG 3K81C 1VQFA 2K6AA 1CK1A 1PTOC 1NSNS 2B63H 5KT2A 1GHJA 4GOPB 1JWMD 3TS0A 1TWHH 1VQLA 4MV6A 3TP5A 4EQ5A 3LWBA 2MGSA 4R4CA 2SOBA 3NSWA 2N78A 4JI5H 1ML0D 1UC9A 2PI2E 3J80i 5KFNA 4DL6A 1Z2OX 4U6PA 1SJHD 1EIHA 5KKNB 4FXGC 1PRTF 3RJ0A 3WWVA 5E7NA 4IOAA 3UDFA 3GTJA 2C2RA 1JT8A 3R2TA 4KJNA 1TT2A 5C0XJ 1F77A 1U4RA 1PTOB 2BCOA 4Q4DA 4OWTB 4FF1A 3D6WA 4NZNA 1LUZA 3HEJA 2L12A 3S2HH 4QB4A 4GN3B 1BBWA 1OXSC 1N56A 3T4AC 2CQOA 2K05A 4B3RQ 2AGQA 3K80C 1JR0D 2IL8A 3BZDB 4GNXB 3CPFA 5BYBA 1I6VC 2ATLA 3H0GH 1BBUA 3NBHA 2B2VA 1G2WA 2VZAA 3GTPB 4LF6H 5GROA 3GTMA 1SNMA 1EEFD 2IWHA 3F1ZA 2K32A 1KNAA 2PZWA 1S10A 1GKHA 3JAMc 2JEIA 4JC0A 4RHSA 2J7ZA 1JJGA 2XGQA 3KXYT 4CKBA 5IGBA 2HGSA 4LUZA 4EQNA 5CV9A 1N36L 4DV5L 1QVCA 1OXUA 4A3FG 4L5RC 1B2TA 2W6PA 3KHGA 3WWJA 2F0HA 1IBMQ 1B44D 1K73C 5EOYA 1HR0H 3TEKA 2JA6G 2K14A 3G7LA 3QO2A 1DM0B 5BPFA 2RDGA 2RA4A 5ELNA 1DD2A 1ZXTA 2SEBD 4WHXA 1KRTA 4GKKL 2KJXA 5A35A 4HJ9A 5I4DA 1PV4A 4UCUA 5KEEA 3OOCA 4DV4Q 3BVMA 3G4SA 1VQNA 3CHBD 1EU4A 4HCSA 3VNNA 5L1LA 3RB0A 4ME5A 2EIFA 3S2DB 2L1BA 4ME3A 2XWBB 4XT1B 4C2MH 1PRTC 4C3HH 4KV6A 3ULLA 2F0WA 2R6GA 2OQKA 2VB3X 1PA6A 2CHBD 4GN5A 1JJ2A 5BWXA 4FF3A 2X5RA 1TS2A 5LP6F 2FK3A 3H4DA 3KDFB 4HAEA 5BR8Q 1FJGL 1M4VA 3U4ZA 3TW7A 2C5CA 1L0WA 2UUCQ 1ESFA 3FMCA 4O3RA 1HNXH 1TU2B 1S0NA 4F7XA 3SK6A 4LFCH 3SHLA 3B6YA 4ZHQF 4OL7A 4BXXG 4J15A 2ES2A 4BBSG 3MHBA 1YNJD 4FFRA 2F4VH 1UNNC 5DAUA 2A69D 1K8OA 2K5VA 1LO5D 1XPOA 2K75A 1A3GA 5COYA 4IURA 1VQKA 4DR5Q 2FJZA 5DG8A 5JJZA 3RFCA 2KHSA 1PRTB 3T99A 1YI2A 2NN6I 1KNEA 3H3VC 4O3PA 1SBBB 3AMUA 2TMPA 2AGOA 1LM0A 3R5XA 4LF5H 2F3WA 2HQEA 2ALZA 2EJFC 4HMIA 3STBC 2UXBL 2XTIA 2EJ3A 2ZDHA 1QE6A 1HFGA 3K57A 3IG0A 2YRXA 5KG2A 1F9SA 2XRQD 1GHKA 4FF2A 2F0SA 3BG3A 5A2QL 4ED7A 4DV0H 1MIUA 3GTGB 4OEMB 2YYZA 4XIGS 1JB7A 4O83A 1WVLA 1WTOA 2HHHL 2MO0A 2OCEA 4LF7H 5FO9B 3S14H 2CW0C 2L9HA 1M8AA 5FPOA 4M7EA 1Y1VG 1V1PA 2QF7A 3ICEA 1WCMG 4Y52H 1CKNB 1CQJB 1N32Q 2AMCB 3FPUB 5JEAH 3W1BA 4DR3L 1YZ6A 1R9TH 1YHQA 2W6MA 3TEHB 2WDTA 5D1PA 4PDBA 5FJ8H 1VKZA 4RGOS 3BQ1A 5LL6b 1VF5C 5C44B 3FDSA 1X32A 1SYXB 5FOBB 4G4KA 4P75A 4DR4L 2JA5B 3MR3A 3MFHA 2N49A 3PSIA 2B2UC 2VUMH 1B6SA 4JI3L 2K5NA 2UU9H 3T5HA 3KJPA 1VQPA 1Z9FA 2A8VA 4M0JA 5LA6F 1HTPA 4DK6C 1K83H 4HNUA 1L1OA 4HJ8A 4GKJH 4H13C 3GTKB 5EAYA 3L4JA 2M2LA 2GPSA 5I5VA 1UEBA 3M4PA 4ZQ3A 1EQQA 1SRUA 4O3OA 3K6OA 2NTSA 1HJPA 1EEID 2NUAB 3CW2C 5GADC 1TWGH 2XVSA 3C46A 3BA9A 1QWYA 4DL2A 1I50B 1AW7A 3PCOB 5ISRA 5IT9E 4JBKA 4DV1L 1Q3LA 3MXUA 1AFPA 1U4LA 2W9CB 5IYBH 1SEIA 3VOTA 2HDLA 2W57A 2J4XA 3AX6A 5H80A 4IAJA 4DV6Q 3BACA 1XMOQ 4OWWB 4ED1A 4K6NA 5CA1F 2BE5D 1SSOA 2EYMA 3VYTA 5C5JA 3S2HB 1PH4A 3U58A 2F0NA 2BR0A 2E2IH 1GUNA 4QWBA 2NVQH 4JV1A 4RKBA 2BDOA 4YR2A 1RJPA 1Q12A 3PO2G 1VF7A 1ESRA 1MKHA 2C9OA 4DAYA 3H0GB 4X64H 1UNSA 3VR5A 3DWAA 2ZDQA 3HRZC 3VR3A 5I5XA 4DL7A 2RDJA 3DHQA 4KTAA 2BQRA 2KCNA 4TQSA 1BDOA 1WFQA 3OMGA 2FHTA 1KAAA 2R7FA 5G3LF 1A3VA 4A3EH 4ECZA 1DOMA 3QOJA 3V96A 4CKEA 1PXUA 1WTXA 4OO1I 4JI5Q 4WORA 1GUWA 3PVXA 2NN6G 3TQ1A 3DMUA 3I90A 2WE6A 3M9OB 2JK8A 1FL0A 4QUFA 3N6RA 1GSOA 4UP8A 1EUCB 4WJ4A 2NBFA 3N40P 2X6GA 3ZYYX 1U4MA 4UCOA 2KCCA 2C28A 5BN3A 4MA5A 1UE6A 4IPCA 2VPSA 3S17H 4O3QA 1PH5A 1S0OA 1Y1WH 4KY6A 4CBVA 3H94A 4LMYA 4RAYA 1IW7D 4JV0A 3PW0A 2JXMB 4Y7NH 4X6AH 4K6DA 1BF4A 4A76A 4NXMH 2EYOA 1HPCA 3M3YB 4RNMA 4EFEA 3T9CA 4FFNA 2UXCL 3GV3A 1J9OA 3E0EA 2ICEC 2JEAI 1XTCD 4IWYA 5KT5A 3BQ0A 2A74C 1EUJA 2XNAC 3QFFA 1STNA 2V1CC 5F2DA 4WFN3 4A93G 3QOLA 2KUMA 2K52A 1PFSA 3IAYA 1VAJA 4JG2A 3WOFA 4QMGA 4LF6Q 4WD3A 4RG1A 2W8KA 2NZOA 4IHJF 1PZID 2B39A 5JQWA 3HKZA 1HH2P 1HA5A 4ED2A 2HVSA 2CWAA 4A3CH 5L1KA 2AUJD 2C35B 4FS2A 1SYCA 4HNTA 1XK5A 2QILA 1QOHA 3A74A 2ICIA 1NMGA 3DAAA 1WD1A 4F8MA 3NHHA 1HR0Q 2M00A 2Y0SG 4IUUA 2IBKA 3VR2A 2A19A 2F0KA 1TWFA 3LP8A 2EY1A 2K5QA 2W7PA 5AJ3L 4NW2A 5K2MA 5NUCA 4LK1C 2XCAA 4X66L 3HOWB 2WYOA 2YTXA 5KG6A 1GVPA 4YP3A 1J5EL 5KFBA 2UUBL 1I6UA 2JA8H 1A2UA 4NB3A 5M5XH 4UFZA 2GN5A 4OX9L 1BVSA 3S1MB 3S15B 2JA8G 1Y1VA 5EKIA 3S14B 2B8FA 2R8JA 4WRDA 1D1IA 2E74C 1GM5A 2IY5B 4RCOA 3FKIA 1CSQA 5BWUA 3UI2A 3M9MB 1P8LA 1HNXQ 3KBXA 4LFCQ 2R8IA 3DM1A 4EEYA 2YZMA 2FP4B 2F4VQ 2H5XA 1G2TA 2DPJA 4JVZA 1NBWA 3I4NG 3CQZB 1SNCA 3S1NH 4OO1H 3GTQA 1AE3A 1XJVA 4AIMA 4TVAB 3V05A 1X65A 3FKIB 1TWCH 3CC2A 3DWQA 4DUZH 3E9IA 1VQMA 3I56A 2VUMB 4JI6L 3RAQA 3S1QB 1C9OA 4LF5Q 4OO1G 2FMCA 5C3EB 4ALPA 1GUTA 1CA5A 2HCCA 4HNVA 5E25A 5FD6A 1E1OA 3S24A 1LLRD 4DXFA 3GIIA 4A3KH 5IOCA 2KOLA 1FGUA 1X9NA 3Q22A 5LMNW 3RV3A 4DN4M 1HNZL 4DV0Q 2FXQA 2D0PA 5KFFA 5DMXA 1HNZH 1B7YB 2PMZB 3ZJYC 1XMQL 1KJQA 2W6QA 2QYZA 5KFDA 3I2ZA 4DR2L 3DEOA 1S68A 4I50F 4LF7Q 1JCKB 4L6TB 5I2YA 1FKAH 4XYMB 2HHFA 2C2EA 2K5HA 3H20A 1STBA 2R86A 4PZ8A 1X3QA 4BA1I 5A2QE 4O7RA 1N34L 4A3JG 2I87A 3LWEA 3UYYA 1ZYRD 3HOUB 1ENCA 4XQQA 3I55A 2YTYA 2FJ2A 4HJAA 4MV7A 4C5AA 4LF8H 3Q23A 5JH7F 1M7JA 2EYHA 3SEBA 1S97A 2E2IB 2EXZA 2A6HC 4IFDI 3EROA 3MZ5A 3Q1KA 2YU9A 2R92H 2W9AA 1AE2A 1HXYD 4DLKA 2VQFH 5C1OA 2A6ED 3N44B 2R61A 2UU9Q 1K3BC 5FNVF 3J7AK 5KG3A 4C3IH 2G5DA 2VB2X 3CD6A 1CKOA 2V5AA 3HG9A 5CV7A 4GKJQ 1PFNA 4KJOA 4DXGA 2R7ZG 1PH9A 4ZLTF 1VQ6A 2MHVA 5I5TA 2MPMA 4K0KH 3R3OA 4C3IG 2VQEL 4A3GB 1SROA 2VQEH 4MTEA 1G291 3IFDA 5C8YF 2WB1G 1ASYA 1E0BA 1O7IA 3SK8A 3I70A 4B3RL 2JA7H 3PW7A 4A2AA 3K7AB 4HJ5A
chains in the Genus database with same CATH topology
4OONA 5JJKA 5DISC 2B3GA 4EFBA 1VQOA 5LMNL 4X64Q 2BH8A 2VY3A 3CP0A 4H02A 1XNQH 1E22A 4JBMA 1GYFA 2I0QA 3NC0B 4RZQA 3UE0A 2MO1A 4DV4L 3PUVA 2L15A 4LF4H 3KF6B 3MWMA 3GTJH 3H3VI 1VQEA 4NXMQ 5BR8L 1SMXA 2Z6KA 1ZHQA 2UUCL 1GD7A 3M85A 1MJEA 1WJJA 4DR5L 1VQDA 4LUOA 2UXDH 2ZTEA 4IFDG 3T1YH 3GJXB 5FPRA 3G48A 1VQHA 3HOZH 4AYBG 3H15A 1EOVA 3S2DH 3N6XA 3CVZA 3I7FA 4YCWA 2VOBA 1E4GT 1G6PA 1N32L 2FE3A 3M4QA 1YVCA 1HZ9A 1VQGA 4YY3H 5M3MG 4LF9H 5IP7H 2WAQG 3K3VA 2K4KA 3G71A 5IP7G 4WJ3M 1Q8KA 5D1OB 4HIDA 3JAMW 1X3EA 2OTLA 3DF7A 3W1GA 3PO3H 1UWVA 4DUZQ 3GTGH 3AFQA 2OTJA 1YBYA 1B8AA 5J3BA 3CCJA 4GN4B 4DV6L 1YJ9A 1HNZQ 1XMOL 3OTOL 2ASBA 3S16H 3OTOH 3PGZA 1QVGA 1JMCA 2JA5H 4DUYH 1IBLH 5C44G 4LF8Q 1SN8A 4JI1L 4PZ6A 4QY7A 2JA5G 1PVOA 2CW8A 5IWAL 4JI1H 5IWAH 3GTKH 3RGZA 1TA8A 4JI5L 3GDEA 2VQFQ 4I7HA 2B63G 3ULJA 4GNXC 2Q2TA 4QGUA 1I50H 3UDIA 3NENA 5LMUH 2VQEQ 2KHIA 1C7YA 3RLFA 2YV5A 1S03G 1V9PA 3VDYA 4DAMA 4LWCA 4LF6L 3LGJA 4RB0A 2N8NA 4KLKA 1SLJA 4LSAA 3STBD 3H0GG 1MZBA 3HOVH 3K7UC 2DGYA 4B3MH 1SR3A 5LMNQ 1XNQQ 3NBHB 1HR0L 4B3SH 1IYJB 4CC6A 3TY5A 4RB1A 3PV0A 1KC8C 1OTCA 4JI2H 2E8GA 3Q8DA 4O2DA 4Q0YA 3M3YH 3CCLA 2GVBA 4LF4Q 2ZM6H 4JYAH 4MTDA 1LYLA 3BZKA 2YCHA 1ASZA 3J81j 1U5KA 1LTLA 3M4OH 1HNXL 4LFCL 3OW2A 4YCUA 2F4VL 1XPUA 1HNWH 1K0RA 1CSPA 2YTVA 1PH3A 3T1HH 2UXDQ 3T1YQ 2KENA 1YHBA 4LF5L 4UY8C 5DLQE 3HOWH 2Q2IA 1K8GA 4IPHA 4AYBE 2OQ0A 4DK3C 4GLAC 3M7NA 4DV0L 3HOWG 1Q7YC 1L2ZA 3J81i 1TWFH 3BZCA 3S15H 3S1MH 4LF7L 1UE7A 4GLXA 4DV7L 1AN7A 1YITA 4DV7H 1Z2NX 4YY3Q 4LF9Q 3CQZH 5JEAG 2WAQE 1ZHSA 2KCTA 1BGWA 3FKIH 5FJ8G 1L1OC 2UU9L 3S1QH 4P74A 5C3EH 5HGQA 4GKJL 2VUMG 1E4FT 3BAAA 5C3EG 3GTQH 1IXRA 2AKWB 4NPSA 3I4OA 4E6NA 3KYHC 1PH7A 4JCVE 2PNHA 3N42B 3JSLA 1L1OB 2MFIA 4TQUS 4DRFA 3HOUH 2R7DA 4R4IA 5M5YH 5IYBG 3OTOQ 2IX0A 1JE5A 1IL2A 1VQ9A 2WP8J 4DUYQ 4EX5A 1IBKH 1VS0A 1IBLQ 4X64L 1P16A 4JI1Q 1NTGA 5IWAQ 4A3GH 2YU9H 4A3EG 4YWKA 4DAYB 1QUQA 3EYYA 5LMUQ 3K7AH 3MEFA 3PUWA 4DPGA 1XNRH 4A75A 4NXML 4X65H 3C0FB 1Y1WG 1PYSB 4APMA 4IJLA 1RL2A 3ERSX 2ATWA 1XDNA 1EIFA 5FD5A 2WFWA 4B3MQ 4A3CG 3HKSA 4B3SQ 2NVYH 3I4MH 1KL9A 1B70B 3L7ZC 3N43B 5K36G 4JI2Q 1NMFA 2ZM6Q 4JI4L 4JYAQ 4JI4H 4DR7L 4DR7H 3L0OA 4ETSA 3K0XA 3QWUA 5M3FH 3EBEA 4JI0L 4UP9A 5C4XH 4JI0H 4APVA 4MNOA 1QZGA 3D31A 4AQYH 5GAGC 1E24A 4X62H 1HNWQ 3CPWA 2NVXH 3T1HQ 4NXNH 3RIZA 1EIYB 4DUZL 2A1AA 4YWLA 2NVTH 2D62A 4MV9A 4L5SA 1YHAA 2ZTDA 1Y14B 1VQCA 3BU2A 4BY1H 4A3KG 4LH7A 1D8LA 3J80c 2CW7A 1NE3A 2BA0A 3AEVA 4DV7Q 4PG3A 4HJ7A 5M5WH 2LXKA 4JI7H 1D7QA 4LF8L 4DR6H 1X3GA 2ZJRA 4RMFA 4KHZA 4A3IH 4P73A 2R93H 2VQFL 2R93G 1YJWA 2R92G 3BABA 2CCZA 3CCRA 3HOYH 4K0KL 4IFDJ 1M1KC 1AH9A 5IYDH 4OWXB 2RHQB 1E3PA 3HOYG 2I5HA 4DV2H 5IYDG 3SGIA 3TQYA 2JJQA 4JI8H 4B3TH 2JA7G 4POFA 4KI0A 4RB3C 1IBKQ 5GAEC 3N41B 1XNQL 3UQ8A 1OXTA 3PN1A 3CCQA 2IT1A 2VUGA 4P72A 2HVQA 2KSWA 2KCMA 4LF4L 4MZ9A 1VQIA 1M90C 2Z6KC 1KIXA 3E9HA 3PIOA 1XNRQ 4X65Q 1X6OA 1QVFA 3J81c 1VQ8A 1W3SA 3AYHB 4XTCS 4JV5H 2UXDL 3GTMH 3T1YL 5IT9W 1KD1C 3ER0A 3F2DA 2PQAA 2ZJQA 2UUAL 4BY7H 1C0AA 2UUAH 1WI5A 2VW9A 1CKMA 2IHFA 4BY7G 3HOZG 2DUDA 2HIVA 2Y0SE 3D0FA 4JI4Q 1IZ6A 4IPDA 3GTOH 4DR7Q 4YY3L 5IP9H 3S1RH 4LF9L 1I94H 4JOIA 4JI0Q 3J7A5 4PZ7A 4QIWE 4AQYQ 4X62Q 1EQRA 2B29A 1OXXK 4NXNQ 4DNIA 1SE8A 4R4OA 3A5ZB 3AQQA 3PO3G 2IHEA 2ZJPA 3F2CA 2E5LH 4C3JH 3W5OA 3OYYA 1N33H 1M0TA 1Q82C 1YJNA 4DUYL 4O0AA 4JI7Q 1IBLL 2MCTA 5IT9c 4DR6Q 3KLWA 4UCTA 4A3DH 2CWPA 4GOPA 3F2BA 3F8TA 1HZCA 1PH2A 1A62A 4KHPH 4HIOA 5LMUL 4K0KQ 1Q86C 4L5TA 3M9BA 4L5QA 4DV3L 4P71A 5C0XI 3TY9A 2WB1E 4DKAC 2I5LX 4DV3H 4DV2Q 1V43A 1NJIC 4IO9A 3FHWA 4JI8Q 1KXLA 3KALA 4GNXA 4B3TQ 2F3IA 4AH6A 5IYCH 2JA9A 1B04A 3HXLA 4LFAL 2KHJA 4LFAH 4B3ML 5IYCG 3MXNB 4B3SL 5JEAJ 3F8NA 3HOVG 4UPAA 4A3FH 5A2QW 4JI2L 2N3SA 4GS3A 4RB2C 2ZM6L 1A8VA 2JE6I 2JA6H 1N36H 4JYAL 4OXPA 4DV5H 4R1JA 3TY8A 3GD7A 1QZHA 4RAZA 1PH8A 5ELOA 3KDFA 4GKKH 1WOCA 1VQBA 2Q2HA 1I3QH 1HNWL 4JV5Q 2VL6A 1Q46A 3T1HL 2RHSB 3PUXA 4A4IA 2E2HH 1S72A 3BA8A 1YEZA 4BXXH 4BBSH 1FJGH 2UUAQ 3HKZG 4R4QA 3LMLA 1JJCB 1OXVA 1K8AC 4LUVA 4BBRH 4IPGA 5C0XG 1YIJA 3CCEA 1CKNA 4BBRG 3PIPA 2UXBH 1I94Q 3RZOH 4EEQA 3CAMA 2E2JH 1BJTA 1Y1VH 3RN2A 1WCMH 1W2BA 2D0OA 2HHHH 1G51A 4A3LH 2ALYB 1X54A 2K50A 3GTLH 1FVIA 1HZAA 4BA2I 3FKIG 4DR3H 4A3LG 2I5MX 2QA4A 3PUYA 4FDBA 3KOJA 4LFBL 1EYGA 4LFBH 4R7RA 3HFZB 4DR4H 2E5LQ 3TS2A 4LSXA 4JI3H 4LW1A 1N33Q 2LXJA 1K9MC 3HOUG 2AWNA 2MQHA 1IBKL 1I5FA 1N9WA 4DV1H 3L2PA 4POGA 2RCNA 3PO2H 1DGSA 4YHHL 2CKZB 4YHHH 3U50C 4KHPQ 4LH6A 4A3GG 3JC66 3RZDH 1RIPA 1Z2PX 1YNXA 1XNRL 4X65L 1VQJA 2O03A 4DV3Q 3CCUA 1KQSA 5GAHC 3FP9A 1UE5A 4PMWA 1QUQB 3J80W 2JEBI 3CC7A 1TXYA 4GLVB 5GQOA 3CCSA 2ZTCA 3NBZB 3NBYB 4YWMA 4JBJA 4A93H 2KBNA 4LFAQ 1WH2A 1VQ4A 4UCSA 2UXCH 4UP7A 2BH2A 1GO3E 2RGRA 2AWOA 2VNUD 3RTXA 3I4MG 1TWAH 4QL5A 3L4KA 1N36Q 4DV5Q 1L2FA 3A0JA 1M0WA 4CC5A 2ID0A 1I6HH 3PF4A 1VQ7A 1O75A 4GKKQ 3ULPA 4X66H 5M3FG 1J5EH 4AQYL 4X62L 2UUBH 1A63A 5C4XG 1VCIA 3JAMi 1MJCA 4UCVA 1Q1EA 4NXNL 2HIXA 3KF8B 3UE1A 4OX9H 3RR5A 2HVRA 2AHOB 3J7ZC 1FJGQ 2NZHA 3I4NH 2EXDA 2RF4A 2RGVA 3HKZE 5HY6A 4DR1L 4DR1H 2EQSA 3RLNA 5IE8A 4BY1G 4JI6H 3CC4A 4JBWA 4JI7L 2XGTA 2UXBQ 4DR6L 1SFOH 3J81W 3KAJA 1XMQH 4A3JH 4J0MA 5C4JH 2HHHQ 4DR2H 3NELA 2QGQA 3HOXH 4A3IG 3G6EA 4YCVA 1N34H 4DR3Q 3PF5A 2IX1A 3HOXG 2ZJTA 3CCMA 1T9HA 4LFBQ 1NY4A 1KRSA 4DV2L 1EWIA 3EN2A 4DR4Q 4A3MH 4JI3Q 4R4TA 2R7ZH 2PMZE 1VQAA 2F52A 2Q2UA 4JI8L 4B3TL 4A3MG 1BKBA 2Z0SA 3A5UA 1KAWA 5FLXW 3KJOA 4DV1Q 3AFPA 1X3FA 1HZBA 4B3RH 3M4IA 2OWOA 1TAEA 3K8AA 3GB8B 3CXCA 3GO5A 4YHHQ 5JJLA 3CCVA 1H95A 3EIVA 3DM3A 3IRBA 5LMNH 4A3BH 1IBML 3KF6A 1IBMH 3RLOA 3UDXA 2JQOA 1X55A 1XPRA 4A3BG 3RF2A 3UDGA 5IY0A 3U4VA 2MNAA 4DV4H 1J6QA 1E7ZA 4HIMA 4JV5L 4HIKA 2VS1A 1E1TA 2HQLA 3GTPH 5H1SE 4IOCA 3CF5A 1S40A 5BR8H 2UUCH 2UXCQ 2LSSA 2BA1A 1WYDA 1PH6A 1A0IA 4FM9A 1U0LA 4LNQA 4DR5H 1N8RC 1S3OA 3KAKA 4MTNA 2PQAB 4QJFA 4JOIC 3FMAA 1KHIA 4IJHA 5FLXc 1I94L 3RGXA 3PUZA 4QQBX 1CUKA 3TREA 5IP9G 5AJ3Q 2GVAA 4X66Q 2HT1A 5M3MH 1PH1A 1Q81C 1J5EQ 3TRZA 1UE1A 2UUBQ 1N32H 5D1OA 5JJIA 4OX9Q 1PHJA 1PYBA 2XIGA 1VQ5A 2E5LL 4DR1Q 3NEMA 1N33L 1XTDA 2PI2A 1Z47A 2CFMA 4JI6Q 3CMAA 3KFUA 3BJUA 1Q1BA 4A2BA 3JSNA 4UCRA 1X56A 3H3VH 4GOPC 4BWSC 1K3RA 4DV6H 1XMQQ 2QEXA 3RN5A 1EFWA 3RNUA 1HR0W 1V1QA 4DR2Q 1XMOH 3DLLA 5C44H 5FLMH 3CMEA 4A3DG 4KHPL 1N34Q 5FLMG 3K81C 1VQFA 2B63H 4GOPB 3TS0A 1TWHH 1VQLA 4EQ5A 4R4CA 4JI5H 2N78A 2PI2E 3J80i 1Z2OX 3RJ0A 3WWVA 5E7NA 4IOAA 3UDFA 1JT8A 5C0XJ 4OWTB 1LUZA 3S2HH 4GN3B 1BBWA 1OXSC 2CQOA 4B3RQ 3K80C 4GNXB 3CPFA 3H0GH 1BBUA 2VZAA 4LF6H 5GROA 3F1ZA 1GKHA 3JAMc 4JC0A 1JJGA 3KXYT 2HGSA 4LUZA 1N36L 4DV5L 1QVCA 1OXUA 4A3FG 4L5RC 1IBMQ 1K73C 5EOYA 1HR0H 2JA6G 2K14A 5ELNA 1KRTA 4GKKL 4HJ9A 1PV4A 4UCUA 4DV4Q 3G4SA 1VQNA 3VNNA 2EIFA 4ME3A 4C2MH 4C3HH 3ULLA 2R6GA 2OQKA 1PA6A 4GN5A 1JJ2A 3KDFB 5BR8Q 1FJGL 3U4ZA 1L0WA 2UUCQ 1HNXH 4LFCH 3B6YA 4BXXG 4J15A 2ES2A 4BBSG 2F4VH 2K5VA 1XPOA 2K75A 1VQKA 4DR5Q 1YI2A 2NN6I 1LM0A 4LF5H 3STBC 2UXBL 2XTIA 3IG0A 4DV0H 1MIUA 2YYZA 4XIGS 1JB7A 2HHHL 2MO0A 2OCEA 4LF7H 3S14H 5FPOA 4M7EA 1Y1VG 3ICEA 1WCMG 4Y52H 1CKNB 1N32Q 2AMCB 3W1BA 4DR3L 1YZ6A 1R9TH 1YHQA 3TEHB 2WDTA 5D1PA 4PDBA 5FJ8H 5LL6b 1SYXB 4P75A 4DR4L 2N49A 3PSIA 2VUMH 4JI3L 2K5NA 2UU9H 3KJPA 1VQPA 1Z9FA 2A8VA 4DK6C 1K83H 1L1OA 4HJ8A 4GKJH 5EAYA 3L4JA 1UEBA 3M4PA 1EQQA 1SRUA 1HJPA 3CW2C 5GADC 1TWGH 3BA9A 3PCOB 4JBKA 4DV1L 5IYBH 1SEIA 2W57A 4IAJA 4DV6Q 1XMOQ 4OWWB 1PH4A 3U58A 2E2IH 2NVQH 1Q12A 3PO2G 1MKHA 4X64H 1WFQA 4A3EH 2R7FA 4OO1I 4JI5Q 2NN6G 2WE6A 2JK8A 1FL0A 4UP8A 4WJ4A 3N40P 4UCOA 1UE6A 4IPCA 2VPSA 3S17H 1PH5A 1Y1WH 4LMYA 4RAYA 4Y7NH 4X6AH 4NXMH 4A76A 4EFEA 2UXCL 3E0EA 2JEAI 1EUJA 2V1CC 4A93G 2K52A 1PFSA 4JG2A 4LF6Q 4RG1A 2NZOA 1HH2P 2HVSA 2CWAA 4A3CH 2C35B 1XK5A 3A74A 1NMGA 1HR0Q 2Y0SG 2A19A 5AJ3L 4X66L 2WYOA 2YTXA 1GVPA 1J5EL 2UUBL 1I6UA 2JA8H 4NB3A 5M5XH 4UFZA 2GN5A 4OX9L 1BVSA 2JA8G 1GM5A 2IY5B 1CSQA 1P8LA 1HNXQ 4LFCQ 2F4VQ 2H5XA 3I4NG 1NBWA 3S1NH 1AE3A 1XJVA 4AIMA 4TVAB 1X65A 1TWCH 3CC2A 4DUZH 3E9IA 1VQMA 3I56A 4JI6L 4OO1G 1C9OA 4LF5Q 5FD6A 4ALPA 1E1OA 3S24A 4A3KH 1FGUA 1X9NA 5LMNW 1HNZL 4DV0Q 2FXQA 2D0PA 1HNZH 1B7YB 3ZJYC 1XMQL 3I2ZA 4DR2L 1S68A 4LF7Q 1FKAH 2K5HA 3H20A 4PZ8A 4BA1I 1N34L 4A3JG 3I55A 2YTYA 4MV7A 4HJAA 4LF8H 4IFDI 2R92H 1AE2A 2VQFH 3N44B 2UU9Q 3J7AK 4C3IH 3CD6A 1CKOA 4GKJQ 2R7ZG 1PH9A 1VQ6A 4K0KH 2VQEL 1SROA 2VQEH 4MTEA 1G291 2WB1G 1ASYA 1O7IA 4B3RL 2JA7H 4A2AA 4HJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OON A;  1EIF A;  1Z47 A;  5JJK A;  2CFM A;  1JJC B;  3CMA A;  4JI6 Q;  3BJU A;  3KFU A;  2WFW A;  4B3M Q;  1OXV A;  1Q1B A;  3JSN A;  5DIS C;  4A3C G;  3HKS A;  1K8A C;  1X56 A;  4B3S Q;  2NVY H;  4LUV A;  4BBR H;  3H3V H;  3I4M H;  4UCR A;  4GOP C;  2B3G A;  1KL9 A;  1K3R A;  4IPG A;  5C0X G;  4EFB A;  1VQO A;  1YIJ A;  1XMQ Q;  1B70 B;  2QEX A;  3CCE A;  3RN5 A;  5LMN L;  1V1Q A;  3RNU A;  1CKN A;  4DR2 Q;  1HR0 W;  4X64 Q;  2BH8 A;  4BBR G;  3L7Z C;  2VY3 A;  3CP0 A;  3PIP A;  5K36 G;  4JI2 Q;  4H02 A;  3DLL A;  1I94 Q;  1E22 A;  5C44 H;  5FLM H;  3RZO H;  1NMF A;  3CME A;  4EEQ A;  4JBM A;  3CAM A;  2ZM6 Q;  2E2J H;  4A3D G;  4JI4 L;  4KHP L;  1Y1V H;  1N34 Q;  3RN2 A;  2I0Q A;  1WCM H;  4JYA Q;  4DR7 L;  3NC0 B;  1W2B A;  2D0O A;  5FLM G;  3K81 C;  1VQF A;  1G51 A;  3L0O A;  4A3L H;  2ALY B;  3UE0 A;  3K0X A;  3QWU A;  2MO1 A;  2B63 H;  1X54 A;  2K50 A;  4DV4 L;  3GTL H;  3PUV A;  1FVI A;  1HZA A;  4BA2 I;  2L15 A;  5M3F H;  4GOP B;  3TS0 A;  3EBE A;  1TWH H;  3KF6 B;  1VQL A;  4JI0 L;  3FKI G;  4EQ5 A;  4UP9 A;  5C4X H;  4A3L G;  4R4C A;  2N78 A;  2I5M X;  4APV A;  2QA4 A;  3PUY A;  2PI2 E;  3GTJ H;  4FDB A;  4MNO A;  3H3V I;  3J80 i;  1B04 A;  1VQE A;  1QZG A;  3D31 A;  5GAG C;  1E24 A;  3KOJ A;  4NXM Q;  1EYG A;  4LFB L;  1HNW Q;  3CPW A;  5BR8 L;  1SMX A;  2NVX H;  2Z6K A;  3WWV A;  5E7N A;  3HFZ B;  2UUC L;  3T1H Q;  4IOA A;  3UDF A;  1JT8 A;  2E5L Q;  1GD7 A;  3TS2 A;  3M85 A;  1EIY B;  5C0X J;  4DUZ L;  2A1A A;  1MJE A;  4YWL A;  4LW1 A;  2NVT H;  2D62 A;  1WJJ A;  4OWT B;  1LUZ A;  3S2H H;  4GN3 B;  1N33 Q;  1BBW A;  1OXS C;  4DR5 L;  1VQD A;  2CQO A;  1YHA A;  2ZTD A;  1Y14 B;  4L5S A;  4B3R Q;  4LUO A;  3K80 C;  2LXJ A;  2ZTE A;  1VQC A;  4GNX B;  3BU2 A;  1K9M C;  3CPF A;  3HOU G;  4IFD G;  3GJX B;  4BY1 H;  3G48 A;  1BBU A;  3H0G H;  5FPR A;  2AWN A;  2MQH A;  1IBK L;  1VQH A;  4A3K G;  1I5F A;  3HOZ H;  2VZA A;  4LH7 A;  5GRO A;  1D8L A;  3J80 c;  4AYB G;  1N9W A;  3F1Z A;  3H15 A;  1GKH A;  3L2P A;  4POG A;  3JAM c;  4JC0 A;  1JJG A;  1NE3 A;  2BA0 A;  3AEV A;  1EOV A;  3S2D H;  4LUZ A;  1N36 L;  4DV7 Q;  4PG3 A;  2RCN A;  5M5W H;  4HJ7 A;  4DV5 L;  3HOU H;  1QVC A;  3I7F A;  1OXU A;  2LXK A;  4A3F G;  4L5R C;  4YCW A;  3PO2 H;  1D7Q A;  1DGS A;  4LF8 L;  1IBM Q;  4YHH L;  1X3G A;  2CKZ B;  1K73 C;  2ZJR A;  2JA6 G;  2K14 A;  4RMF A;  3U50 C;  4KHZ A;  1G6P A;  4A3I H;  4KHP Q;  1N32 L;  4P73 A;  3M4Q A;  5ELN A;  4LH6 A;  4A3G G;  2R93 H;  1YVC A;  1HZ9 A;  1VQG A;  2VQF L;  3JC6 6;  1KRT A;  3RZD H;  4GKK L;  1RIP A;  5M3M G;  1YNX A;  5IP7 H;  4HJ9 A;  2WAQ G;  1PV4 A;  4UCU A;  4DV4 Q;  1XNR L;  3G4S A;  1VQN A;  4X65 L;  1VQJ A;  2R93 G;  3VNN A;  1YJW A;  2R92 G;  3BAB A;  2CCZ A;  2EIF A;  2K4K A;  3G71 A;  4DV3 Q;  3CCR A;  5IP7 G;  4ME3 A;  4C2M H;  3CCU A;  1KQS A;  3HOY H;  4C3H H;  3FP9 A;  3ULL A;  5GAH C;  2R6G A;  4K0K L;  2OQK A;  1PA6 A;  4WJ3 M;  4GN5 A;  1UE5 A;  4PMW A;  1Q8K A;  1JJ2 A;  1QUQ B;  1M1K C;  4IFD J;  1AH9 A;  5IYD H;  4OWX B;  5D1O B;  2JEB I;  4HID A;  1X3E A;  2RHQ B;  1E3P A;  3KDF B;  3CC7 A;  5BR8 Q;  1FJG L;  3HOY G;  3U4Z A;  2OTL A;  1L0W A;  1TXY A;  4GLV B;  2UUC Q;  3W1G A;  3PO3 H;  2I5H A;  5IYD G;  5GQO A;  3CCS A;  3SGI A;  2ZTC A;  3B6Y A;  1UWV A;  3NBZ B;  4DUZ Q;  4BXX G;  4J15 A;  2ES2 A;  3GTG H;  4BBS G;  3NBY B;  3AFQ A;  4YWM A;  3TQY A;  2JJQ A;  3S17 H;  2K5V A;  4JBJ A;  4A93 H;  2KBN A;  4LFA Q;  2K75 A;  1XPO A;  2OTJ A;  1YBY A;  1VQ4 A;  4DR5 Q;  1VQK A;  2JA7 G;  4UCS A;  4UP7 A;  4POF A;  2BH2 A;  1B8A A;  5J3B A;  1GO3 E;  1YI2 A;  2NN6 I;  3CCJ A;  4GN4 B;  4DV6 L;  1YJ9 A;  4KI0 A;  1HNZ Q;  1LM0 A;  2AWO A;  1IBK Q;  5GAE C;  1XMO L;  2VNU D;  3STB C;  3RTX A;  2UXB L;  2XTI A;  1TWA H;  3OTO L;  2ASB A;  3I4M G;  1XNQ L;  3S16 H;  3UQ8 A;  4QL5 A;  3PGZ A;  1OXT A;  3PN1 A;  1QVG A;  1JMC A;  3CCQ A;  1N36 Q;  1MIU A;  2JA5 H;  2IT1 A;  4DV5 Q;  2YYZ A;  4XIG S;  1JB7 A;  2VUG A;  2HHH L;  4P72 A;  5C44 G;  2HVQ A;  2MO0 A;  2OCE A;  1L2F A;  4LF8 Q;  3S14 H;  1SN8 A;  2KCM A;  3A0J A;  4JI1 L;  4PZ6 A;  5FPO A;  4QY7 A;  2JA5 G;  1Y1V G;  3ICE A;  1PVO A;  5IWA L;  4CC5 A;  1WCM G;  4Y52 H;  1CKN B;  4LF4 L;  2ID0 A;  1N32 Q;  3GTK H;  2AMC B;  1I6H H;  3W1B A;  4MZ9 A;  3PF4 A;  4DR3 L;  1VQ7 A;  1VQI A;  1YZ6 A;  1R9T H;  1YHQ A;  1TA8 A;  1M90 C;  4JI5 L;  3GDE A;  3TEH B;  2VQF Q;  5D1P A;  4GKK Q;  3ULP A;  2B63 G;  2Z6K C;  3ULJ A;  4GNX C;  1KIX A;  2Q2T A;  5FJ8 H;  4QGU A;  3E9H A;  5M3F G;  3PIO A;  4AQY L;  1I50 H;  1XNR Q;  4X62 L;  4X65 Q;  3UDI A;  1X6O A;  1A63 A;  5C4X G;  1VCI A;  3JAM i;  1MJC A;  4UCV A;  1Q1E A;  3NEN A;  4P75 A;  4NXN L;  2HIX A;  4DR4 L;  1QVF A;  3KF8 B;  3UE1 A;  2N49 A;  3PSI A;  2VUM H;  3J81 c;  4JI3 L;  2K5N A;  3RR5 A;  2HVR A;  3KJP A;  2VQE Q;  1VQP A;  2AHO B;  1Z9F A;  1VQ8 A;  2A8V A;  1W3S A;  4DK6 C;  1K83 H;  3AYH B;  4XTC S;  3J7Z C;  1FJG Q;  1L1O A;  4HJ8 A;  2KHI A;  2NZH A;  3I4N H;  2EXD A;  5EAY A;  1C7Y A;  3RLF A;  2RF4 A;  1UEB A;  3M4P A;  2UXD L;  3HKZ E;  3GTM H;  1EQQ A;  5HY6 A;  1SRU A;  2YV5 A;  3T1Y L;  4DR1 L;  1KD1 C;  1V9P A;  1HJP A;  3CW2 C;  3VDY A;  3ER0 A;  4DAM A;  1TWG H;  2EQS A;  4LWC A;  5GAD C;  3F2D A;  3BA9 A;  3RLN A;  3LGJ A;  3PCO B;  2PQA A;  2ZJQ A;  2UUA L;  4JBK A;  4DV1 L;  4LF6 L;  4BY7 H;  1C0A A;  2N8N A;  5IYB H;  1WI5 A;  4KLK A;  1SLJ A;  5IE8 A;  2VW9 A;  3STB D;  4BY1 G;  3H0G G;  1CKM A;  2IHF A;  4DV6 Q;  4BY7 G;  3HOZ G;  2DUD A;  2HIV A;  2Y0S E;  3HOV H;  3CC4 A;  4JBW A;  3K7U C;  4JI7 L;  1XMO Q;  4OWW B;  2DGY A;  2XGT A;  1SR3 A;  5LMN Q;  2UXB Q;  4DR6 L;  1PH4 A;  1XNQ Q;  3U58 A;  2E2I H;  3NBH B;  1HR0 L;  1IYJ B;  3D0F A;  2NVQ H;  1SFO H;  1Q12 A;  4CC6 A;  4JI4 Q;  3PO2 G;  1IZ6 A;  1MKH A;  4IPD A;  3GTO H;  4DR7 Q;  4A3J H;  3TY5 A;  4YY3 L;  5IP9 H;  5C4J H;  3S1R H;  2HHH Q;  4LF9 L;  3PV0 A;  1KC8 C;  1OTC A;  3NEL A;  2QGQ A;  4JOI A;  3HOX H;  2E8G A;  4A3I G;  3Q8D A;  4O2D A;  3G6E A;  3M3Y H;  1WFQ A;  3CCL A;  2GVB A;  4LF4 Q;  4YCV A;  2R7F A;  4A3E H;  4DR3 Q;  4JI0 Q;  3PF5 A;  2IX1 A;  1LYL A;  3BZK A;  4JI5 Q;  3J7A 5;  4OO1 I;  2NN6 G;  3HOX G;  1ASZ A;  4PZ7 A;  3J81 j;  4QIW E;  2JK8 A;  1FL0 A;  4UP8 A;  3CCM A;  4WJ4 A;  4AQY Q;  1T9H A;  4X62 Q;  1EQR A;  1U5K A;  4UCO A;  2B29 A;  1LTL A;  1NY4 A;  4LFB Q;  1KRS A;  1UE6 A;  1OXX K;  4IPC A;  3M4O H;  4DV2 L;  1EWI A;  3EN2 A;  1PH5 A;  1HNX L;  1Y1W H;  4NXN Q;  4LFC L;  3OW2 A;  4YCU A;  4DR4 Q;  4A3M H;  4JI3 Q;  4R4T A;  1SE8 A;  4DNI A;  2PMZ E;  2F4V L;  2R7Z H;  1VQA A;  2F52 A;  2Q2U A;  4R4O A;  4Y7N H;  3A5Z B;  1XPU A;  4JI8 L;  4X6A H;  3AQQ A;  3PO3 G;  4A76 A;  4B3T L;  2IHE A;  2ZJP A;  4A3M G;  4EFE A;  1K0R A;  1BKB A;  1CSP A;  2YTV A;  3E0E A;  3F2C A;  1PH3 A;  2UXC L;  2UXD Q;  2JEA I;  2Z0S A;  3A5U A;  1KAW A;  1EUJ A;  2V1C C;  3T1Y Q;  4A93 G;  4C3J H;  2KEN A;  1YHB A;  4LF5 L;  2K52 A;  1PFS A;  3W5O A;  3KJO A;  4UY8 C;  3OYY A;  4JG2 A;  5DLQ E;  4LF6 Q;  4RG1 A;  3HOW H;  2Q2I A;  2NZO A;  4DV1 Q;  1K8G A;  4IPH A;  1HH2 P;  4AYB E;  3AFP A;  1X3F A;  1HZB A;  2HVS A;  2CWA A;  1Q82 C;  2OQ0 A;  4DK3 C;  4GLA C;  1YJN A;  3M7N A;  4A3C H;  2C35 B;  4DV0 L;  3HOW G;  4DUY L;  2OWO A;  4O0A A;  1TAE A;  1Q7Y C;  1XK5 A;  3K8A A;  3J81 i;  1TWF H;  4JI7 Q;  3BZC A;  3S15 H;  3S1M H;  3A74 A;  1IBL L;  3GB8 B;  3CXC A;  5IT9 c;  4LF7 L;  1NMG A;  1UE7 A;  4DR6 Q;  3GO5 A;  4GLX A;  4YHH Q;  1HR0 Q;  5JJL A;  2Y0S G;  3CCV A;  2A19 A;  1H95 A;  4DV7 L;  3KLW A;  3EIV A;  1YIT A;  4UCT A;  3DM3 A;  4A3D H;  3IRB A;  4YY3 Q;  2CWP A;  5AJ3 L;  4GOP A;  4LF9 Q;  4A3B H;  1IBM L;  3KF6 A;  4X66 L;  3F2B A;  2YTX A;  3F8T A;  1GVP A;  3RLO A;  3UDX A;  1HZC A;  1PH2 A;  1J5E L;  3CQZ H;  5JEA G;  2WAQ E;  2UUB L;  2JA8 H;  2JQO A;  1A62 A;  1X55 A;  4HIO A;  4NB3 A;  1XPR A;  4A3B G;  5M5X H;  2KCT A;  4UFZ A;  5LMU L;  2GN5 A;  4OX9 L;  3FKI H;  1BVS A;  5FJ8 G;  4K0K Q;  1Q86 C;  1L1O C;  3UDG A;  2UU9 L;  5IY0 A;  2JA8 G;  4L5T A;  3U4V A;  3S1Q H;  3M9B A;  4L5Q A;  4P74 A;  5C3E H;  2MNA A;  1J6Q A;  1E7Z A;  4HIM A;  5HGQ A;  4JV5 L;  1GM5 A;  4GKJ L;  4DV3 L;  4P71 A;  5C0X I;  2IY5 B;  1CSQ A;  2WB1 E;  4HIK A;  4DKA C;  2I5L X;  3TY9 A;  2VUM G;  1P8L A;  4DV2 Q;  1HNX Q;  1V43 A;  4LFC Q;  3BAA A;  5C3E G;  2VS1 A;  3GTQ H;  1E1T A;  2HQL A;  1IXR A;  2AKW B;  4NPS A;  4IO9 A;  1NJI C;  3I4O A;  2F4V Q;  4E6N A;  2H5X A;  3GTP H;  4OO1 G;  3FHW A;  5H1S E;  4JI8 Q;  4IOC A;  3CF5 A;  3KYH C;  3I4N G;  1NBW A;  4GNX A;  1S40 A;  4B3T Q;  3S1N H;  1KXL A;  2F3I A;  4AH6 A;  1PH7 A;  4JCV E;  2UXC Q;  2LSS A;  2PNH A;  1AE3 A;  1XJV A;  2BA1 A;  5IYC H;  4AIM A;  4TVA B;  3JSL A;  1WYD A;  1X65 A;  1TWC H;  1L1O B;  3CC2 A;  2JA9 A;  3E9I A;  2MFI A;  4TQU S;  1PH6 A;  1VQM A;  4DRF A;  1A0I A;  3I56 A;  4JI6 L;  4LFA L;  1C9O A;  2R7D A;  4R4I A;  1U0L A;  2KHJ A;  5M5Y H;  4ALP A;  4LF5 Q;  4B3M L;  5IYB G;  5IYC G;  4LNQ A;  1E1O A;  3S24 A;  4A3K H;  3OTO Q;  1N8R C;  1S3O A;  2IX0 A;  3MXN B;  4B3S L;  1JE5 A;  5JEA J;  1FGU A;  1X9N A;  4MTN A;  1IL2 A;  1VQ9 A;  2WP8 J;  2PQA B;  5LMN W;  3HOV G;  1HNZ L;  4DV0 Q;  2FXQ A;  2D0P A;  4DUY Q;  1B7Y B;  4QJF A;  4JOI C;  3ZJY C;  4EX5 A;  1XMQ L;  4UPA A;  3I2Z A;  1VS0 A;  4DR2 L;  4X64 L;  1IBL Q;  1KHI A;  1S68 A;  4LF7 Q;  4IJH A;  4A3F H;  5FLX c;  1I94 L;  2N3S A;  4GS3 A;  4JI2 L;  3PUZ A;  2K5H A;  1P16 A;  4JI1 Q;  1NTG A;  4QQB X;  4PZ8 A;  2ZM6 L;  4BA1 I;  5IWA Q;  1A8V A;  2JE6 I;  1CUK A;  1N34 L;  4A3J G;  2JA6 H;  3TRE A;  5IP9 G;  4JYA L;  4OXP A;  4R1J A;  5AJ3 Q;  4A3G H;  2GVA A;  3TY8 A;  2YU9 H;  3GD7 A;  4X66 Q;  2YTY A;  3I55 A;  4HJA A;  1QZH A;  2HT1 A;  5M3M H;  1PH1 A;  1Q81 C;  1J5E Q;  4A3E G;  4YWK A;  1UE1 A;  2UUB Q;  3TRZ A;  4DAY B;  1PH8 A;  1EFW A;  1QUQ A;  4IFD I;  5D1O A;  5JJI A;  2R92 H;  5LMU Q;  5ELO A;  3K7A H;  4OX9 Q;  1AE2 A;  3KDF A;  3MEF A;  1PHJ A;  1PYB A;  2UU9 Q;  3PUW A;  1WOC A;  1VQB A;  4DPG A;  2Q2H A;  4C3I H;  3CD6 A;  1I3Q H;  1CKO A;  4A75 A;  4NXM L;  4JV5 Q;  1HNW L;  4GKJ Q;  1Y1W G;  2VL6 A;  1Q46 A;  3T1H L;  2RHS B;  1VQ5 A;  2R7Z G;  1PH9 A;  3PUX A;  1VQ6 A;  4A4I A;  2E5L L;  2E2H H;  1S72 A;  3BA8 A;  2VQE L;  1PYS B;  1SRO A;  4IJL A;  4DR1 Q;  1YEZ A;  1RL2 A;  1G29 1;  3ERS X;  3NEM A;  2WB1 G;  4BBS H;  1ASY A;  4BXX H;  1N33 L;  1XTD A;  2UUA Q;  1O7I A;  2PI2 A;  3HKZ G;  2ATW A;  4B3R L;  4R4Q A;  2JA7 H;  1XDN A;  4HJ5 A; 
#chains in the Genus database with same CATH topology
 2RDF A;  1ICW A;  4OON A;  5JJK A;  3PIO 3;  3DTF A;  3R5F A;  2YRW A;  1RK6 A;  1ZEQ X;  3LWU A;  3SVM A;  4EBC A;  1H9J A;  2EJM A;  2N55 A;  5DIS C;  2MUY A;  2NWG A;  2B3G A;  2CVR A;  2B2Y A;  4XYQ A;  3GV6 A;  1VQO A;  1SND A;  2O5I C;  4EFB A;  2V4R A;  4O2B F;  1BUV T;  3OWF A;  1MI2 A;  3U0G A;  2LS0 1;  5LMN L;  3RMH A;  3U9T A;  1PLF A;  4X64 Q;  2BH8 A;  1MGS A;  1PFB A;  3J81 L;  2VY3 A;  3CP0 A;  4RCN A;  2NVY A;  4H02 A;  4O7W A;  1XNQ H;  1E22 A;  5LL6 S;  4JBM A;  1GYF A;  1RJT A;  2I0Q A;  1TWA A;  5E4W C;  3NC0 B;  1F9Q A;  2W6N A;  4RZQ A;  1KLU D;  2OT2 A;  1T3N A;  3UE0 A;  3R93 A;  2MO1 A;  4DV4 L;  3PUV A;  3VYS A;  5KFI A;  2NVY B;  2L15 A;  4ZI7 F;  5KFC A;  4LF4 H;  1RHP A;  2W9B B;  3KF6 B;  3TIG A;  1V1O A;  4Q5V A;  2Q8T A;  5I60 A;  1CZG A;  2PO4 A;  3MWM A;  4FP5 D;  3GTJ H;  2LFN A;  3GV7 B;  1MD2 D;  4FBT A;  2WAC A;  3H3V I;  1MSG A;  1VQE A;  2DIK A;  4C5C A;  2DY8 A;  4RUA A;  2B2T C;  4NXM Q;  4Y8V B;  5BR8 L;  1SMX A;  3D4R A;  2Z6K A;  1ZHQ A;  1A3T A;  2UUC L;  4NMZ A;  2GQR A;  3BVG A;  4RKL A;  3RBE A;  1GD7 A;  4FO2 A;  1B4O A;  3M85 A;  1WTP A;  1MJE A;  5CV5 A;  1WJJ A;  2SDF A;  4J9N A;  1I7N A;  1CHQ D;  5ELB A;  2XIW A;  5M3F B;  4Q8E A;  5FLX L;  4DR5 L;  1VQD A;  4Q4C A;  4LUO A;  2L11 A;  2UXD H;  2ZTE A;  3HO8 A;  4IFD G;  3CU7 A;  2XSC A;  3T1Y H;  1BCP C;  3GIL A;  3GJX B;  5FPR A;  3G48 A;  4Q44 A;  3GP7 A;  1PK8 A;  1VQH A;  4I55 F;  3LUL A;  3HOZ H;  2AQ1 B;  4AYB G;  2NVX B;  5FO8 B;  1VMC A;  2RQX A;  3H15 A;  5IGD A;  1EQT A;  2N88 A;  5EPJ A;  3SE7 A;  4OEL B;  1EOV A;  3S2D H;  3N6X A;  3CVZ A;  2H1E A;  3NXW A;  3I7F A;  4YCW A;  1I1L A;  2VOB A;  1SYF A;  3OSO A;  4A3K B;  1E4G T;  5D65 A;  1G6P A;  5BN5 A;  1Y8O B;  2IPK D;  1N32 L;  4IUV A;  4MIU A;  3M4Q A;  4RWS C;  4MV3 A;  1BCP B;  2FE3 A;  3T54 A;  1YVC A;  1HZ9 A;  1VQG A;  4CHT B;  4YY3 H;  3J7Y W;  5M3M G;  3T51 B;  4LF9 H;  5IP7 H;  3EPG A;  3DTG A;  1RTN A;  2WAQ G;  1C30 A;  5ELD A;  3K3V A;  2K33 A;  3PW4 A;  4L1K A;  3SNO A;  4R8U A;  1I4G A;  3G8C A;  2K4K A;  3G71 A;  5IP7 G;  5E4X A;  3E6Z X;  5M5W B;  4WJ3 M;  2C00 A;  5CBA E;  2OLS A;  1H9K A;  3J7A F;  1Q8K A;  4JV2 A;  5D1O B;  3T9D A;  4FS1 A;  4HID A;  3JAM W;  1X3E A;  3OPO A;  1DXM A;  3J80 E;  3LQS A;  3FPP A;  2OTL A;  3DF7 A;  2PYK A;  3W1G A;  3PO3 H;  3KK7 A;  4RNN A;  2A68 D;  2R93 B;  5KT3 A;  2R92 B;  1UWV A;  2VR1 A;  4DUZ Q;  3HBL A;  4TM5 A;  3GTG H;  4GC6 A;  3AFQ A;  2R8K A;  5I5Y A;  3UFX B;  5J2U F;  2W6Z A;  3BQ2 A;  4V19 0;  2OTJ A;  1YBY A;  2VA2 A;  1SMY C;  1B8A A;  1LAC A;  1Q8I A;  5J3B A;  2DNE A;  3HOY B;  3T53 B;  4IRC A;  2F0E A;  3CCJ A;  4GN4 B;  4DV6 L;  1YJ9 A;  4E4T A;  1HNZ Q;  1CFM A;  2PVP A;  4MN3 A;  4O81 A;  1XMO L;  4RA8 A;  3QWN A;  4CJ2 C;  5I5W A;  3OTO L;  3KLS A;  2ASB A;  1HRJ A;  3CEB A;  1K1S A;  3S16 H;  3OTO H;  4QCL A;  2Z4H A;  3ND8 A;  3PGZ A;  1QVG A;  1JMC A;  3V6K A;  2JEG A;  2JA7 B;  2RVL A;  2JA5 H;  4DUY H;  1E4E A;  3TIN A;  4JK1 C;  1PZJ D;  3T9B A;  5L1J A;  4IAL A;  1I4H A;  1IBL H;  3I91 A;  1X3P A;  5C44 G;  2NU6 B;  4FU0 A;  4LF8 Q;  1CQI B;  1SN8 A;  4HED A;  3QZ7 A;  4JI1 L;  4PZ6 A;  1ZAU A;  4QY7 A;  2JA5 G;  1PVO A;  4YAJ B;  2CW8 A;  1H9S A;  5IWA L;  4JI1 H;  5IWA H;  3GTK H;  3QIA A;  3RGZ A;  1TA8 A;  3OHA A;  1AP0 A;  4JI5 L;  3GDE A;  1F2M A;  2VQF Q;  4I7H A;  4LMQ D;  2B63 G;  3ULJ A;  4GNX C;  4TRD A;  1SYG A;  2Q2T A;  5EKK A;  1G91 A;  3KHL A;  4QGU A;  3OUZ A;  1I50 H;  3UDI A;  1E2V A;  4QSH A;  3NGD A;  3NEN A;  3WO1 A;  5LMU H;  5IGG A;  2WTF A;  4JPB W;  2KVM A;  3RUZ A;  4NZM A;  2VQE Q;  1K1Q A;  4DU9 A;  1O80 A;  3KUP A;  1PX2 A;  3DUZ A;  5JPM C;  2QCP X;  4N9P A;  3WO0 A;  4I4T F;  4O86 A;  4ED0 A;  2KHI A;  4O2A F;  3JAM L;  3A8I E;  5LHY 1;  1C7Y A;  1HQM C;  2B2V C;  3RLF A;  5DQG A;  1I4Q A;  2KEC A;  2QEJ C;  2F0U A;  2EYL A;  2YV5 A;  3VPD A;  5BYA A;  1ENA A;  4LJZ C;  1V9P A;  4HN2 A;  4DIM A;  1S03 G;  3QR8 A;  3VDY A;  1KAB A;  3MXN A;  4DAM A;  3GTJ B;  4DL5 A;  4LWC A;  1A6X A;  4LF6 L;  3LGJ A;  4FNF A;  4K2L A;  4RB0 A;  2NU8 B;  2WII B;  4OIK A;  2EJ2 A;  2N8N A;  5J2T F;  4KLK A;  1SLJ A;  2PPB C;  4LSA A;  3T7A A;  3STB D;  3H0G G;  1KTK A;  1GSH A;  2YW2 A;  2EOT A;  1MZB A;  5DGB A;  3HOV H;  2NU7 B;  4RU9 A;  3K7U C;  1FNU A;  2DGY A;  3RAX A;  1SR3 A;  5LMN Q;  4B3M H;  3MA2 B;  3A7A B;  1XNQ Q;  3NBH B;  1HR0 L;  4QWA A;  1IYJ B;  4U68 A;  4B3S H;  5KFV A;  3GTM B;  2CW0 D;  2FFK B;  2RDH A;  4CC6 A;  5TSS A;  5L9X A;  1DAA A;  4KHV A;  2GQS A;  4AYB A;  3TY5 A;  5FR9 A;  1IOV A;  4RB1 A;  3PV0 A;  3J81 E;  1KC8 C;  3HOZ B;  1OTC A;  4BY7 B;  4YJ2 F;  4JI2 H;  1M6V A;  2PNR C;  2E8G A;  3Q8D A;  4O2D A;  3QJY A;  4Q0Y A;  3M3Y H;  2CNQ A;  3CCL A;  2GVB A;  4LF4 Q;  2ZM6 H;  3GTO A;  4RFB A;  4JYA H;  5CR3 A;  3GLK A;  4YR3 A;  4MTD A;  1LYL A;  3BZK A;  1JE4 A;  4RZR A;  2YCH A;  1GXD C;  1ASZ A;  3AW8 A;  3PZP A;  1PZK D;  3ETH A;  3J81 j;  4NYE A;  4IR1 A;  1RYS A;  1B53 A;  4ABN A;  1U5K A;  1LTL A;  4FF4 A;  3D6C A;  4C3H G;  4KY5 A;  3M4O H;  2ZXR A;  1HNX L;  4LFC L;  3OW2 A;  4YCU A;  4CDE C;  4FFO A;  1WTV A;  5DGH A;  3BDC A;  4PQX A;  3PIP 3;  2WAQ A;  3HS0 C;  3S1R B;  2F4V L;  1GLV A;  2R7M A;  1XPU A;  1C48 A;  2L5T A;  1G6Z A;  1OWT A;  1HNW H;  5CR5 A;  1K0R A;  1CSP A;  2YTV A;  1SAP A;  1PH3 A;  1LTI D;  2ODT X;  3T1H H;  2UXD Q;  4IRD A;  5EZY F;  4FYD A;  3OIP A;  2B2W C;  2NUC A;  3T1Y Q;  2FLN A;  2KEN A;  1YHB A;  5KS8 A;  1KDA A;  1FD7 D;  4FXD A;  4RGM A;  4LF5 L;  4UY8 C;  5DLQ E;  3HOW H;  2Q2I A;  5FLX E;  4Q0F A;  4IPH A;  1K8G A;  5JVL A;  3VR6 A;  4AYB E;  3W2D A;  4J9R A;  3PO3 B;  2OQ0 A;  4DK3 C;  4GLA C;  3M7N A;  2IX3 A;  3CRL C;  4DV0 L;  3HOW G;  1EOT A;  1NCV A;  1O7L A;  1I1M A;  1Q7Y C;  5C0X H;  1L2Z A;  3J81 i;  1TWF H;  3BZC A;  4OIJ A;  3S15 H;  3S1M H;  3K5H A;  5DNF A;  3A7L A;  3LX0 A;  5E1F A;  4LF7 L;  2PQE A;  4RH6 A;  1UE7 A;  4GLX A;  1LTG D;  5I5U A;  2ZDG A;  4DV7 L;  2W8L A;  1AN7 A;  1YIT A;  5KFX A;  1Z2N X;  2VXW A;  4C3J B;  2JYO A;  4DV7 H;  5ELC A;  1EY5 A;  4YY3 Q;  1VDZ A;  2SNS A;  4LF9 Q;  4XZ3 B;  2YZG A;  2CH4 A;  1S5E D;  1S0M A;  2BDN A;  2YYA A;  3CQZ H;  5JEA G;  2WAQ E;  3MJF A;  3S16 B;  4K2K A;  1ZHS A;  4JUZ A;  1G2S A;  2KCT A;  1BGW A;  2KEE A;  1V1P B;  3FKI H;  5FJ8 G;  4O4L F;  1L1O C;  2M05 A;  2UU9 L;  4IIJ F;  4DAA A;  3S1Q H;  2DLN A;  2F0L A;  4P74 A;  5C3E H;  4G7Z C;  4HN7 A;  4BS9 A;  5HGQ A;  4C5B A;  4GKJ L;  1EIG A;  3H09 A;  4ZCK A;  2VUM G;  1CQF A;  1E4F T;  2F1M A;  3BAA A;  5C3E G;  4A3D B;  3GTQ H;  5EDW A;  1IXR A;  1EY9 A;  2AKW B;  4J6H A;  4NPS A;  3I4O A;  5C4H A;  3Q2O A;  4E6N A;  5I2X A;  1TWH A;  1SJE D;  3KYH C;  5CV8 A;  1PH7 A;  4JCV E;  4ZKB B;  2PNH A;  1ZET A;  4PBC A;  3N42 B;  3JSL A;  1VBG A;  4O1N A;  1L1O B;  2MFI A;  4TQU S;  1WTR A;  1LT4 D;  4HR7 A;  1AN8 A;  4DRF A;  4K5X A;  4WBN F;  2UVV A;  3U9O A;  2R7D A;  4R4I A;  3MFY A;  5M5Y H;  3HOU H;  1V4Y A;  5KFQ A;  5IYB G;  1QNU A;  3GID A;  1GOZ A;  2J6T A;  1YNJ C;  3JRX A;  3OTO Q;  2IX0 A;  1JE5 A;  1IL2 A;  1VQ9 A;  4XXE A;  2WP8 J;  2AU0 A;  3I4L A;  3NWT A;  4DUY Q;  3OIQ A;  1QIL A;  2LKV A;  2EYF A;  4EX5 A;  5C1P A;  1IBK H;  5KGU A;  2A73 B;  1VS0 A;  1IBL Q;  4X64 L;  1EL0 A;  4IUN A;  5DGA A;  1DV1 A;  1EZ8 A;  1T5E A;  1P16 A;  2JP1 A;  4JI1 Q;  2CZG A;  1NTG A;  4DF7 A;  3MFG A;  5IWA Q;  1Z7T A;  5CBE E;  1QB5 D;  4QF4 A;  4M1U B;  4A3G H;  2EY6 A;  3HOV B;  1BR9 A;  2YU9 H;  4X3S A;  3I8Z A;  2V9W A;  3PMF A;  4IWX A;  2JA6 A;  2JN4 A;  4YWK A;  4A3E G;  1DZ1 A;  4DAY B;  3G6V A;  3M9N B;  1QUQ A;  3I12 A;  3H4B A;  3EYY A;  3P7J A;  5HGT A;  2ZGI A;  4B9X A;  2V4D A;  5LMU Q;  3V2T A;  1EKP A;  3K7A H;  3MEF A;  2R82 A;  1IKM A;  4IQZ A;  4O4I F;  2GPW A;  3PUW A;  3ETJ A;  1ILQ A;  4NZO A;  4B9W A;  5KND A;  4DPG A;  1XNR H;  1SE4 A;  4A75 A;  4NXM L;  3UZO A;  4X65 H;  3C0F B;  1Y1W G;  3BS1 A;  3PW5 A;  3GIQ A;  5EQ0 A;  2EIY A;  3GQC A;  3G6J B;  4JXU A;  3C1F A;  1PYS B;  1KC7 A;  4E6I A;  4APM A;  1I3Q A;  3WWH A;  4IJL A;  1RL2 A;  3ERS X;  4C2M A;  1JIC A;  4GC7 A;  2E2H A;  1Z6H A;  2ATW A;  4B08 A;  4FFP A;  1XDN A;  3M4O B;  3GV8 B;  4X3K A;  2QKI C;  3BYY B;  3MR5 A;  1EIF A;  5BMV F;  3JZ6 A;  5FD5 A;  2WFW A;  4C1N K;  2PW7 A;  4B3M Q;  3IKJ A;  2EPB A;  5T1I A;  4A3C G;  3HKS A;  4B3S Q;  2NVY H;  3I4M H;  1KL9 A;  2XWJ B;  5K36 H;  3QQM A;  5C6A A;  1W93 A;  3HKZ B;  4G3I A;  1B70 B;  2F0I A;  3L7Z C;  5DGI A;  3N43 B;  3PFF A;  1LT5 D;  4JI2 Q;  5K36 G;  2YWV A;  2HJW A;  3TP6 A;  1QCB D;  3MAQ A;  1NMF A;  5JPN C;  2ZM6 Q;  2E75 C;  3ORQ A;  4JI4 L;  1HFN A;  5FO7 B;  1EYD A;  1CT1 D;  4JYA Q;  4JI4 H;  3MXP A;  4DR7 L;  2ASJ A;  1JB3 A;  4DR7 H;  1A0G A;  3L0O A;  1TWF B;  4TSS A;  1DYQ A;  4PWQ A;  4ETS A;  3K0X A;  3QWU A;  3OHX C;  4MAM A;  4EQO A;  1JIH A;  2HCI A;  3KF8 A;  1WCM A;  4BBR B;  5M3F H;  5KT6 A;  3NE5 B;  2L0C A;  3EBE A;  4XYL B;  4JI0 L;  4UP9 A;  5C4X H;  3V6J A;  4JI0 H;  1QJO A;  2DWC A;  4QUC A;  4APV A;  3X3M A;  3GTL A;  4MNO A;  2O2L D;  5LYJ F;  5CYU A;  3WDN A;  1QZG A;  3D31 A;  4AQY H;  1R9T A;  3FRP B;  1E24 A;  5GAG C;  2RBM A;  1HNW Q;  4X62 H;  1H9M A;  3CPW A;  2NVX H;  2E2J B;  2F0Q A;  1IYU A;  1Y1V B;  3T1H Q;  2XCP A;  1EYA A;  4NXN H;  2FMA A;  3RIZ A;  1EHI A;  1TY0 A;  3T13 A;  1BOS A;  2OEO A;  1EIY B;  4DUZ L;  4K5V A;  2A1A A;  4YWL A;  2NVT H;  2D62 A;  1JDB B;  5CAE B;  1K0S A;  4CE5 A;  4O42 A;  1WR2 A;  5JAV A;  1IW7 C;  3QG1 A;  1YHA A;  2ZTD A;  1Y14 B;  5L37 A;  4L5S A;  4MV9 A;  1SYD A;  3MWE A;  1K83 A;  1VQC A;  3BU2 A;  3QB3 A;  3Q24 A;  4BY1 H;  3GTQ B;  1ET9 A;  4A3K G;  4LH7 A;  4ZYS A;  2UVW A;  4H0L C;  3E5S A;  1D8L A;  3J80 c;  3I3C A;  3GIM A;  1KLG D;  4ED6 A;  1ULZ A;  2K1B A;  3JRW A;  2Z4I A;  2CW7 A;  4RAU C;  1TWG A;  1NE3 A;  2BA0 A;  3AEV A;  2QK4 A;  1CE8 A;  1KJI A;  4DV7 Q;  4PG3 A;  4HJ7 A;  5M5W H;  4ZQI A;  4NKL A;  2LXK A;  4JI7 H;  1D7Q A;  4N8X 1;  5DM7 3;  1JLL B;  5M5Y B;  4LF8 L;  3GIP A;  4DR6 H;  1NAP A;  1X3G A;  3RV4 A;  2ZJR A;  4RMF A;  4XDX A;  1TS5 A;  4KHZ A;  4A3I H;  1STH A;  4P73 A;  4HSP A;  3KHR A;  2QDB A;  3E5N A;  2R93 H;  2HHF B;  2V4Q A;  5BWV A;  1LTS D;  2C22 A;  2VQF L;  2WKD A;  2IW3 A;  1DCZ A;  4XT3 B;  4J9M A;  3H91 A;  4KMU C;  2FLL A;  4JW0 A;  4ZAI A;  4XX0 B;  2R93 G;  1YJW A;  2R92 G;  2Z02 A;  2CCZ A;  3BAB A;  4J1M A;  3IN5 A;  3O13 A;  3TBI B;  3CCR A;  5KFO A;  3HOY H;  4K0K L;  3MWD A;  3NTK A;  4IFD J;  2Z6B A;  1M1K C;  1AH9 A;  5IYD H;  4OWX B;  2YU9 B;  5I6W A;  4Q8F A;  1RD9 D;  3K59 A;  2RHQ B;  1E3P A;  3HOY G;  4Q43 A;  4YBZ B;  3OMC A;  1CA6 A;  2P5Z X;  1XYI A;  2I5H A;  4DV2 H;  5IYD G;  3SGI A;  3K58 A;  1T36 A;  2V59 A;  5KG4 A;  4RHR A;  2W6O A;  3TQY A;  2JJQ A;  1SNP A;  4DK1 A;  4J9L A;  4JI8 H;  1Y1W A;  1STA A;  3EVQ A;  3MC0 B;  3OUU A;  4B3T H;  2B2Y C;  2JA7 G;  4POF A;  3GIK A;  3HP3 A;  1BCP F;  1B33 N;  2PBZ A;  2YL2 A;  4KI0 A;  1XXG A;  2O4X A;  5CMD A;  4HYK A;  4RB3 C;  1IBK Q;  5GAE C;  1S5D D;  2IA6 A;  2FB9 A;  4KN4 C;  3N41 B;  4IZ8 A;  1NR4 A;  2YS7 A;  3K5I A;  3TDQ A;  1O7Y A;  1XNQ L;  3UQ8 A;  1KJJ A;  3V6H A;  1IKL A;  5I9O A;  1OXT A;  3URY A;  3PN1 A;  4O7N A;  4L8J A;  3CCQ A;  4ECU A;  1EWC A;  2IT1 A;  2VUG A;  4QW9 A;  1S4Z A;  4K8J A;  2KED A;  2L55 A;  4P72 A;  4A93 B;  3NK9 A;  1YNN D;  1SNO A;  4HSV A;  5D3D A;  5EKL A;  2HVQ A;  2KSW A;  5F9L A;  1O78 A;  2KCM A;  2Y0S A;  5D8D A;  3V4S A;  4MTK A;  4LF4 L;  3I4M B;  1E2W A;  4MZ9 A;  1WSC A;  1D6E C;  1VQI A;  1M90 C;  4EG0 A;  2RSO A;  1SDF A;  2Z6K C;  1I4R A;  3Q6S A;  1KIX A;  3RB4 A;  1TWA B;  3E9H A;  5CGK A;  3PIO A;  4O82 A;  5BWW A;  1UAP A;  1XNR Q;  4X65 Q;  1X6O A;  5KFS A;  5CB4 F;  1XX8 A;  4ECS A;  1W6K A;  2HG8 A;  4UAI A;  1QVF A;  1D1K A;  3J81 c;  4O7L A;  5KT4 A;  2XRS D;  4NLG A;  3SK5 A;  4F50 A;  5E3F A;  1VQ8 A;  3BG5 A;  1W3S A;  3AYH B;  3FEW X;  4XTC S;  4XYO A;  4UUG A;  4JV5 H;  3JZI A;  2M9V A;  3CKI B;  1AZP A;  2QB5 A;  4PMC A;  1I6H B;  4QIW A;  5FKA C;  2HDM A;  2UXD L;  5KFL A;  4IUQ A;  3GTM H;  5C4X B;  3T1Y L;  4YJ3 F;  1KD1 C;  5IT9 W;  4TVI A;  3ER0 A;  1EUD B;  2F3V A;  3F2D A;  1EFI D;  1EY6 A;  1B9M A;  5IGE A;  2HDK A;  2PQA A;  2ZJQ A;  2UUA L;  4BY7 H;  2RSN A;  3K5N A;  1C0A A;  3PW2 A;  5DG7 A;  2UUA H;  1WI5 A;  2EY5 A;  2ENB A;  1GGO A;  1KT8 A;  2VW9 A;  2W7O A;  5DM6 3;  1FGB D;  1CKM A;  1JOQ A;  2H4O A;  2IHF A;  1DIK A;  1RK5 A;  4BY7 G;  3HOZ G;  2DUD A;  2HIV A;  2Y0S E;  4RNO A;  3VYR A;  2NVT B;  5KFW A;  4H7B A;  4DK0 A;  2HGW A;  3K3P A;  5KT7 A;  1TWC A;  2SNM A;  3P1H A;  1MBY A;  2VPQ A;  2WKC A;  5KFZ A;  2ASD A;  3D0F A;  3GQB A;  2EZV A;  5C3X A;  1GUS A;  1PTO D;  4JI4 Q;  1IZ6 A;  1OO9 B;  4IPD A;  3GTO H;  4DR7 Q;  2DZD A;  3KLR A;  5IP9 H;  1LV9 A;  4YY3 L;  1JWU D;  3S1R H;  4BY1 B;  4LF9 L;  1C3O A;  4YAK B;  1Q90 A;  1SFO A;  1I94 H;  2DJG C;  4JOI A;  2FLP A;  4PNY A;  3A8K E;  1ONL A;  2R7N A;  4V0B A;  4JI0 Q;  3TII A;  3J7A 5;  1NNX A;  4F87 A;  2CNV A;  4PZ7 A;  4QIW E;  2SCU B;  2XD4 A;  4AQY Q;  4X62 Q;  3WNZ A;  1EQR A;  5F9N A;  2B29 A;  1IL8 A;  4F4X A;  5J1Z A;  1OXX K;  1QNK A;  4A3I B;  4NXN Q;  2ZT9 C;  3VPB A;  3EPI A;  5KFH A;  3ORR A;  1STG A;  2K01 A;  4DNI A;  1E2Z A;  1SE8 A;  3TN2 A;  1CHP D;  4R8U B;  2JEJ A;  4FBU A;  4R4O A;  3A5Z B;  4XQN A;  1CS0 A;  3AU7 A;  5KYL A;  3HOX B;  3AQQ A;  3PO3 G;  3CSW A;  3V4Z A;  1EZ1 A;  2IHE A;  1PMR A;  2ZJP A;  2XC9 A;  5CV6 A;  3W3A A;  3MTS A;  3F2C A;  2R7Z A;  5I5S A;  2NTT A;  4KKU A;  1EKF A;  1FYC A;  3EJI A;  2E5L H;  5DLF A;  1W96 A;  1SXT A;  2A1H A;  2FK1 A;  4C3J H;  1V8Q A;  2R7L A;  2WB1 A;  2K04 A;  3W5O A;  3I73 A;  1D2B A;  4HQ6 A;  3OYY A;  2R8H A;  5IOD A;  1N33 H;  3TSS A;  1TS4 A;  1RCV D;  1M0T A;  3VMM A;  1ROD A;  2E76 C;  4C3J G;  4ECW A;  3OHB A;  1Q82 C;  1YJN A;  1JWS D;  4A3M B;  5CM0 A;  4K14 A;  4DUY L;  2R7Z B;  1U4P A;  4O0A A;  1SCU B;  2KA7 A;  3ITP A;  4JI7 Q;  5KRU A;  1IBL L;  2MCT A;  5IT9 c;  1OBG A;  4DR6 Q;  3VA7 A;  1F2L A;  4ZUI A;  1GJX A;  4G57 A;  4CDF C;  3KLW A;  1EYC A;  4UCT A;  4A3D H;  2R87 A;  1CZW A;  2CWP A;  4GOP A;  2W70 A;  3F2B A;  1OBD A;  3F8T A;  4J9Q A;  3VPC A;  4O4J F;  1E4E B;  1HZC A;  1PRT D;  3DWP A;  1PH2 A;  4YB8 B;  5J39 A;  1B3A A;  1A62 A;  4KHP H;  3HT5 A;  4HIO A;  1IYD A;  3C2P A;  2Z1C A;  2K7V A;  4H44 C;  5LMU L;  5EGT A;  1KUT A;  5BWT A;  1H9S B;  3T5L A;  4K0K Q;  1Q86 C;  3A55 A;  2D9U A;  1KBL A;  4IR9 A;  4ZUJ A;  4L5T A;  3M9B A;  1W6J A;  4L5Q A;  1K8M A;  1B1Z A;  3MR2 A;  2R85 A;  3DXJ C;  3NP8 A;  4DV3 L;  2D2C C;  4P71 A;  5ELE A;  5C0X I;  2WB1 E;  3TY9 A;  4DKA C;  2I5L X;  2ABJ A;  1EY0 A;  3JZF A;  4DV2 Q;  2FIN B;  4DV3 H;  1V43 A;  5I6Y A;  3BJY A;  1NJI C;  2QDL A;  4IO9 A;  4A3B B;  3FHW A;  3Q8R B;  4JI8 Q;  1C4Q A;  1RF2 D;  1KXL A;  1GSA A;  3KAL A;  4GNX A;  4KD4 A;  5AFW A;  4B3T Q;  3TQT A;  2F3I A;  4AH6 A;  1RKN A;  4HCE A;  5IYC H;  5LL6 X;  1JX4 A;  3SE0 A;  3GTP A;  3ERQ A;  2EYJ A;  2JA9 A;  2KQ3 A;  2A68 C;  4LFA L;  1B04 A;  4IUP A;  2KHJ A;  3HXL A;  4LFA H;  4B3M L;  3R5H A;  2Y4R A;  4CKC A;  5IYC G;  2QW7 A;  4KD3 A;  1EY7 A;  1Y8P B;  3MXN B;  4B3S L;  5JEA J;  5KFR A;  5IGC A;  1RJQ A;  3F8N A;  3HOV G;  1O7Z A;  1JQY D;  3MXG A;  2HD3 A;  5KFP A;  4YR0 A;  4UPA A;  4FXK C;  5KIX A;  3NUA A;  4A3F H;  5A2Q W;  4JI2 L;  2MP1 A;  2N3S A;  4GS3 A;  4PV1 C;  1JOK A;  2JEF A;  4RB2 C;  2ZM6 L;  1A8V A;  2JE6 I;  2BOS A;  2JA6 H;  1N36 H;  4JYA L;  4OXP A;  4DV5 H;  4R1J A;  4O84 A;  3TY8 A;  3GD7 A;  3G8D A;  4ED8 A;  1QZH A;  5IGF A;  1D5Z C;  5FK9 C;  4OHJ A;  2ZXP A;  2L4N A;  3TP8 A;  4AYB B;  1PH8 A;  4RAZ A;  1A3U A;  3D8G A;  4FVM A;  4HMJ A;  3T56 B;  1SYB A;  2I07 B;  4IUT A;  4O7V A;  5ELO A;  3CRK C;  3A54 A;  3KDF A;  1FNW A;  2DNC A;  4GKK H;  3GTO B;  1BO0 A;  1WOC A;  1VQB A;  4XQJ A;  1TQO A;  5KG7 A;  1RTO A;  2Q2H A;  3A8J E;  1ENF A;  5M9O A;  1I3Q H;  1HNW L;  4JV5 Q;  5HNE A;  1V51 A;  1I2K A;  2F0F A;  2VL6 A;  4EGQ A;  3RBD A;  1Q46 A;  3T1H L;  2F0G A;  2RHS B;  3D4D A;  1U9R A;  3PUX A;  4YIJ A;  4A4I A;  1IYE A;  2E2H H;  1S72 A;  3BA8 A;  3R2I A;  1YEZ A;  5JVD F;  4BXX H;  4BBS H;  2CNU A;  5M3M B;  1S5B D;  2Z9H A;  1N48 A;  1I7L A;  2WV6 D;  4C56 C;  1FJG H;  4F4Z A;  2WAQ B;  3LNN A;  2UUA Q;  5KG0 A;  3WWI A;  3HKZ G;  3Q0A A;  1GUO A;  4FFL A;  4R4Q A;  3LML A;  1DOK A;  4M9U A;  3P75 A;  4Z9C B;  1JJC B;  3BVZ A;  1IHZ A;  4K8I A;  3U9S A;  4ECT A;  5L1I A;  1OXV A;  4R9W A;  3GTG A;  1K8A C;  4LUV A;  2GA4 B;  4BBR H;  3E0J A;  4IPG A;  4DA2 A;  5C0X G;  1AZQ A;  2J9G A;  2F4I A;  4O4H F;  4YQW A;  1YIJ A;  3CCE A;  3M4Y A;  2B2W A;  1CKN A;  5IIF A;  4BBR G;  3PIP A;  2UXB H;  1FR3 A;  3RB6 A;  1I94 Q;  3OSP A;  2HUG A;  3X3N A;  3FDT A;  4G7O C;  4KN7 C;  2YZL A;  3RZO H;  2AQ2 B;  5EPK A;  4EEQ A;  3CAM A;  2E2J H;  2EYP A;  1L0X B;  1BJT A;  1Y1V H;  3RN2 A;  3HGB A;  1WCM H;  2UVR A;  1W2B A;  3TZU A;  3PR4 A;  5JVH 3;  2D0O A;  2FPI B;  1ZQ7 A;  2HHH H;  3Q8S B;  1I4P A;  1G51 A;  4MHE A;  4A3L H;  2ALY B;  2PZT A;  2O5J C;  1F2Z A;  1FNV A;  1UUP A;  2JA5 A;  1X54 A;  2K50 A;  3GTL H;  1FVI A;  1HZA A;  2IJ0 A;  3IL8 A;  4BA2 I;  1KDB A;  3ND9 A;  3FKI G;  1CTM A;  4DR3 H;  4A3L G;  2RDI A;  2I5M X;  2QA4 A;  2B63 A;  3PUY A;  4FDB A;  4HTH A;  3U54 A;  5HV6 A;  3GTK A;  3Q8P B;  3U55 A;  1TR5 A;  3KOJ A;  4LFB L;  1EYG A;  4TUY F;  3R9R A;  4LFB H;  2Q8R E;  4R7R A;  3HFZ B;  3NTH A;  4DR4 H;  4DNR B;  2E5L Q;  5BWR A;  1KDC A;  3NQI A;  3TS2 A;  2AUK A;  1I50 A;  2FK2 A;  4O3S A;  4LSX A;  4JI3 H;  2W9C A;  4LW1 A;  4DNT B;  1WRV A;  4IRK A;  2B63 B;  5DLG A;  2DAA A;  2DPI A;  2B2U A;  3NWS A;  1N33 Q;  3K0Y A;  3T5K A;  1TWH B;  5KFY A;  5EWG A;  3MEH A;  2LXJ A;  2A69 C;  2DAB A;  4CJ1 B;  1K9M C;  3HOU G;  2UVU A;  1R4P B;  3D4W A;  1S9F A;  2AWN A;  2MQH A;  1IBK L;  4O7S A;  1I5F A;  1WTQ A;  1N9W A;  4DV1 H;  4ECX A;  4HR7 B;  4K6L A;  3L2P A;  4POG A;  1EZ6 A;  1ET0 A;  5G3L D;  3H0G A;  5DQH A;  1RDP D;  2AQ4 A;  2RCN A;  2F0P A;  3PO2 H;  4ULL A;  1EY8 A;  4TQR A;  1LTB D;  1DGS A;  1HUN A;  2P0A A;  2FMM A;  4YHH L;  2CKZ B;  1EU3 A;  4YHH H;  5D14 A;  3U50 C;  1S5C D;  1KTA A;  4KHP Q;  5KG5 A;  1DON A;  4G7H C;  4LH6 A;  3T9A A;  4A3G G;  3KLS X;  3SK4 A;  1F9R A;  2I80 A;  3JC6 6;  1Y8N B;  1A2T A;  3RZD H;  1RIP A;  3A56 A;  5C5L A;  1YNX A;  1Z2P X;  2NN6 H;  5CA0 F;  2PW5 A;  1UC8 A;  3KTM A;  4CGY B;  1F2Y A;  5KNC A;  4A3F B;  4X65 L;  1VQJ A;  1XNR L;  2O03 A;  2OF1 A;  4C1N I;  4FFM A;  2F0M A;  4DV3 Q;  4DQN A;  5T14 A;  1I1K A;  2COJ A;  2R84 A;  3CCU A;  1KQS A;  2JA6 B;  1STY A;  3FP9 A;  5GAH C;  2GLT A;  1T94 A;  1UE5 A;  4PMW A;  1QUQ B;  3J80 W;  3K5O A;  2JEB I;  1D5X C;  1B6R A;  5J22 A;  1JXL A;  2FPG B;  3BDL A;  5EWE A;  3CC7 A;  5JOB A;  4J9K A;  1TXY A;  4GLV B;  4I7A A;  2TSS A;  5GQO A;  3JAM E;  3CCS A;  4MV1 A;  2ZTC A;  3NBZ B;  5EWF A;  1HCZ A;  3NBY B;  4L63 B;  4YWM A;  4J8Q A;  2NYZ D;  4R8N A;  4O3N A;  4JBJ A;  4A93 H;  2X0S A;  2KBN A;  4LFA Q;  4TV9 F;  1WH2 A;  1DOL A;  3KBG A;  1VQ4 A;  1I3Q B;  4UCS A;  5IYZ F;  2UXC H;  4UP7 A;  1DV2 A;  3D3R A;  1TVX A;  2BH2 A;  3T5J A;  4C2M B;  1GO3 E;  4C3H B;  2RGR A;  4CMD A;  1II3 A;  1LT6 D;  1SNQ A;  2E2H B;  5I47 A;  5GON F;  2AWO A;  2DN8 A;  4ECY A;  2VNU D;  2YZN A;  4BBS B;  3RTX A;  3I4M G;  1TWA H;  5COR A;  1DJR D;  4QL5 A;  1I2L A;  3L4K A;  4I65 A;  1N36 Q;  2BE5 C;  4DV5 Q;  3E3X A;  1EY4 A;  2C2D A;  1HQR D;  1BQQ T;  2A6H D;  1IYV A;  1L2F A;  4MA0 A;  2BQ3 A;  3A0J A;  4EVO A;  1WTW A;  1M0W A;  2MJ8 A;  4F4Y A;  4CC5 A;  5DQI A;  2ID0 A;  2G9H D;  1I6H H;  3PF4 A;  1VQ7 A;  1O75 A;  1XWE A;  3N52 A;  4DL4 A;  3UZB A;  3VA5 A;  3GV5 B;  4GKK Q;  3ULP A;  1CM9 A;  4X66 H;  4QWC A;  4RGN A;  5DG9 A;  1B9N A;  5M3F G;  5KFG A;  3TZD A;  4AQY L;  1J5E H;  4X62 L;  2UUB H;  3NBI A;  1A63 A;  1J8I A;  5C4X G;  2Q8I B;  1VCI A;  3JAM i;  1MJC A;  3RZO B;  1Q1E A;  4UCV A;  2RCF A;  4NXN L;  1MSH A;  5EPL A;  2HIX A;  1JC7 A;  4BWG B;  1WCM B;  3KF8 B;  3M7G A;  4X3U A;  3UE1 A;  3CQZ A;  1LTT D;  2Q7D A;  1RJR A;  4J9S A;  4OX9 H;  3RR5 A;  2HVR A;  5KFT A;  1C8C A;  2AHO B;  4Q45 A;  5KG1 A;  5JUM A;  3J80 L;  4NDX A;  3J7Z C;  4IZO A;  1FJG Q;  1AUV A;  1TKW B;  3GTL B;  2NZH A;  2VUM A;  3I4N H;  2EXD A;  2RF4 A;  4S3S A;  2RGV A;  1R9T B;  3HKZ E;  1JKJ B;  3P20 A;  5HY6 A;  3VR4 A;  1JDE A;  4NP5 A;  4DR1 L;  3RD4 A;  4DR1 H;  2EQS A;  3RLN A;  2NU9 B;  1ICF B;  5KNB A;  2PMZ A;  2JSO A;  5IE8 A;  5KX5 F;  4RGT A;  4BY1 G;  2Z8L A;  2F0D A;  4JI6 H;  3CC4 A;  4JBW A;  4UHV A;  4ZKC B;  4JI7 L;  1D5M C;  1K83 B;  2XGT A;  1LT3 D;  2UXB Q;  4DR6 L;  1BXT A;  1PDQ A;  4M8A A;  5KFM A;  2XGP A;  1SFO H;  5KFJ A;  2AGP A;  3S9W A;  2F0J A;  2F03 A;  3J81 W;  1TII D;  4GLW A;  3KAJ A;  2J0T D;  3BDO A;  5D3I B;  1XMQ H;  3J7A V;  4A3J H;  4J0M A;  1ET6 A;  1TWG B;  5C4J H;  4DAP A;  2HHH Q;  4DR2 H;  2E2I A;  4O7Y A;  3KRE A;  2F0O A;  3NEL A;  3F2U A;  2QGQ A;  3HOX H;  4EGV A;  4A3I G;  1SYE A;  4MV4 A;  2ASL A;  3G6E A;  4CMF A;  1QG7 A;  3EQL C;  1SEB D;  5CC4 A;  4YCV A;  1N34 H;  1CQV A;  3RB3 A;  2F0T A;  4DR3 Q;  3PF5 A;  5C3W A;  2IX1 A;  4KK7 A;  3NTI A;  3HOX G;  1EQV A;  2K28 A;  2ZJT A;  5C4Z A;  5K3W A;  3PO2 B;  5C5M A;  3BYT B;  3CCM A;  2EY2 A;  1T9H A;  3EA6 A;  4LFB Q;  1NY4 A;  2NVQ B;  1BNC A;  1KRS A;  2K03 A;  1HUM A;  4DV2 L;  1EWI A;  2B8G A;  3EN2 A;  4DR4 Q;  4A3M H;  2IMW P;  4JI3 Q;  4R4T A;  1SE2 A;  2R7Z H;  1S5F D;  2PMZ E;  4ECV A;  1VQA A;  2F52 A;  3RZD B;  2Q2U A;  5I9P A;  4JI8 L;  3C3L A;  4O7T A;  4J9O A;  4B3T L;  4A3M G;  4DL3 A;  1BCP D;  4A3E B;  1BKB A;  2W71 A;  2OH2 A;  1CI3 M;  2Z0S A;  3A5U A;  1KAW A;  4EBD A;  3Q8Q B;  2F0V A;  3ONA B;  1LAB A;  2XCL A;  5FLX W;  4ECR A;  4EYI B;  3KJO A;  2DY7 A;  3K5L A;  5CE8 A;  4DAV A;  4DV1 Q;  1T5X D;  3AFP A;  1X3F A;  1HZB A;  4B3R H;  3S17 B;  1B3Q A;  1Y1W B;  4KKT A;  3M4I A;  1EWH A;  4UDU C;  3NUC A;  4DGZ A;  2RKS A;  2OWO A;  1TAE A;  5EBC A;  3K8A A;  3PQI A;  3GIJ A;  4Y7N B;  2D5D A;  3GB8 B;  3CXC A;  3T9E A;  5KFK A;  3VYU A;  1IOW A;  1A9X A;  4J9P A;  1PYW D;  3GO5 A;  2EDG A;  3OWE B;  3AB9 A;  4YHH Q;  4U67 3;  2EJG C;  3CCV A;  3L3O C;  5JJL A;  1H95 A;  5BN4 A;  2IP4 A;  3RUP A;  2EVB A;  4MV8 A;  4ECQ A;  2CQA A;  3EIV A;  5EJW A;  3DM3 A;  3IRB A;  4OGQ C;  5LMN H;  2R7K A;  3DEP A;  5T1G A;  1KJ8 A;  4I7Z C;  1WD0 A;  4A3B H;  4P2C B;  1IBM L;  3KF6 A;  2W9B A;  4KKS A;  1IBM H;  3RLO A;  3UDX A;  4LAA A;  1STE A;  4U7C A;  4ZK9 B;  4ILW A;  2R3Z A;  1ZYR C;  2JQO A;  3G6Y A;  1X55 A;  1XPR A;  4A3B G;  3RF2 A;  3K5M A;  2PZU A;  2NB0 A;  2Y0S B;  2CQY A;  5LOV F;  1PTO H;  3UDG A;  2K5W A;  3T9F A;  5IY0 A;  3U4V A;  4QW8 A;  1TY2 A;  2MNA A;  1F9P A;  4DV4 H;  1J6Q A;  1E7Z A;  4HIM A;  3EFX D;  4JV5 L;  1VBH A;  4N8F A;  2VA3 A;  3KHH A;  2A6E C;  4HIK A;  2OXP A;  1B50 A;  2VS1 A;  1E1T A;  2HQL A;  2FKL A;  4TKO B;  3GTP H;  1SMY D;  5H1S E;  1SE3 A;  4IOC A;  5DEH A;  3CF5 A;  2ZXO A;  5EBD A;  4ODG A;  1S40 A;  1KEE A;  5BR8 H;  4QWD A;  3SXH A;  2JA8 B;  3I72 A;  1BNZ A;  2UUC H;  4KY7 A;  2LSS A;  2UXC Q;  4X3T A;  2XN9 C;  5M5X B;  2BA1 A;  4O7Z A;  2B2T A;  4GZY C;  1WYD A;  5LXT F;  1UEA B;  1AUX A;  3G6X A;  2NVX A;  1PH6 A;  2X69 A;  1Y69 U;  1A0I A;  4QIW B;  2V58 A;  1PFM A;  4IFD H;  4FM9 A;  1BBX C;  1U0L A;  4PMB A;  3H6M A;  2LMC B;  4LNQ A;  3T16 A;  2G9D A;  2CH4 W;  3FVQ A;  4DR5 H;  3HB9 A;  5KFU A;  1N8R C;  1S3O A;  4CDC C;  3KAK A;  3I4N B;  4MTN A;  3WOE A;  1JOO A;  2PQA B;  2BQU A;  1MHW C;  3SDZ A;  1H9R A;  3H40 A;  4QJF A;  4JOI C;  1KJ9 A;  3PR5 B;  3FMA A;  5KYI A;  3R23 A;  1GUG A;  1KHI A;  2X6L A;  1LTA D;  5HUR A;  3S1N B;  5DAA A;  2J6S A;  4IJH A;  3TP7 A;  5FLX c;  1I94 L;  4N9T A;  3PUZ A;  5JVG 3;  3RGX A;  3SR1 A;  4QQB X;  2AQ3 B;  5HBR B;  2A5H A;  1CUK A;  1HTL D;  1TWC B;  3TRE A;  5IP9 G;  4ZOL F;  3TME A;  2I8C A;  5AJ3 Q;  2GVA A;  4DFA A;  4X66 Q;  1BXR A;  2HT1 A;  4F88 A;  5M3M H;  1Q81 C;  1PH1 A;  1J5E Q;  3TRZ A;  1UE1 A;  3R8B A;  2UUB Q;  1HA6 A;  1WTH A;  2EJ0 A;  4F4W A;  4FE2 A;  1EYZ A;  4RUC A;  1YNN C;  1N32 H;  3MWY W;  4ME6 A;  1SFO B;  5D1O A;  5JJI A;  1LTR D;  1AEX A;  3IFT A;  1PTO F;  2E2D C;  4OX9 Q;  3QZ8 A;  2R8G A;  2K5D A;  1PHJ A;  1PYB A;  4CJ0 B;  4A3J B;  2I46 A;  5C4J B;  5K5P A;  2R93 A;  5CV4 A;  3HZX A;  2WIN B;  2R92 A;  3MVV A;  2XIG A;  1I4X A;  5KFE A;  2FPP B;  3N8D A;  1VQ5 A;  2E5L L;  2R6F A;  3OW7 A;  3MFI A;  1G8Z D;  4EQP A;  4K5W A;  4R8I A;  4DR1 Q;  2PN1 A;  3NEM A;  5KFA A;  2EE1 A;  1N33 L;  5BPH A;  5IT9 L;  1XTD A;  1R4Q B;  4ED3 A;  1L0Y B;  2PI2 A;  4EYH B;  4WJW A;  1EKV A;  3L9A X;  1TS3 A;  2YS6 A;  5JQG F;  2HGX A;  1JOR A;  1Z47 A;  4ID6 A;  2CFM A;  4JI6 Q;  3CMA A;  3KFU A;  3BJU A;  4QWE A;  1ZKO A;  2Z04 A;  3SI8 A;  1Q1B A;  4C3I B;  4A2B A;  3JSN A;  2JA7 A;  4FGR A;  5ELF A;  1HHV A;  3C1E A;  2WB1 B;  4UCR A;  1X56 A;  3NPP A;  3NQT A;  3H3V H;  3MR6 A;  2PCF B;  4GOP C;  4ZRZ A;  4BWS C;  1K3R A;  4DV6 H;  1K28 A;  2J6U A;  1VMP A;  1XMQ Q;  2QEX A;  3RN5 A;  1EFW A;  3RNU A;  1HR0 W;  1NUC A;  1V1Q A;  4CHI A;  2DJF C;  4DR2 Q;  1XMO H;  4CDD C;  3DLL A;  3TW6 A;  1RYR A;  4TV8 F;  4EBE A;  1NR2 A;  5FLM H;  5C44 H;  4EGJ A;  3OSN A;  3CME A;  4IN3 A;  1A15 A;  4A3D G;  4KHP L;  2COI A;  2LY7 A;  1N34 Q;  1ILP A;  2VQD A;  1A48 A;  2COG A;  2NZ1 D;  5FLM G;  3K81 C;  1VQF A;  2K6A A;  1CK1 A;  1PTO C;  1NSN S;  2B63 H;  5KT2 A;  1GHJ A;  4GOP B;  1JWM D;  3TS0 A;  1TWH H;  1VQL A;  4MV6 A;  3TP5 A;  4EQ5 A;  3LWB A;  2MGS A;  4R4C A;  2SOB A;  3NSW A;  2N78 A;  4JI5 H;  1ML0 D;  1UC9 A;  2PI2 E;  3J80 i;  5KFN A;  4DL6 A;  1Z2O X;  4U6P A;  1SJH D;  1EIH A;  5KKN B;  4FXG C;  1PRT F;  3RJ0 A;  3WWV A;  5E7N A;  4IOA A;  3UDF A;  3GTJ A;  2C2R A;  1JT8 A;  3R2T A;  4KJN A;  1TT2 A;  5C0X J;  1F77 A;  1U4R A;  1PTO B;  2BCO A;  4Q4D A;  4OWT B;  4FF1 A;  3D6W A;  4NZN A;  1LUZ A;  3HEJ A;  2L12 A;  3S2H H;  4QB4 A;  4GN3 B;  1BBW A;  1OXS C;  1N56 A;  3T4A C;  2CQO A;  2K05 A;  4B3R Q;  2AGQ A;  3K80 C;  1JR0 D;  2IL8 A;  3BZD B;  4GNX B;  3CPF A;  5BYB A;  1I6V C;  2ATL A;  3H0G H;  1BBU A;  3NBH A;  2B2V A;  1G2W A;  2VZA A;  3GTP B;  4LF6 H;  5GRO A;  3GTM A;  1SNM A;  1EEF D;  2IWH A;  3F1Z A;  2K32 A;  1KNA A;  2PZW A;  1S10 A;  1GKH A;  3JAM c;  2JEI A;  4JC0 A;  4RHS A;  2J7Z A;  1JJG A;  2XGQ A;  3KXY T;  4CKB A;  5IGB A;  2HGS A;  4LUZ A;  4EQN A;  5CV9 A;  1N36 L;  4DV5 L;  1QVC A;  1OXU A;  4A3F G;  4L5R C;  1B2T A;  2W6P A;  3KHG A;  3WWJ A;  2F0H A;  1IBM Q;  1B44 D;  1K73 C;  5EOY A;  1HR0 H;  3TEK A;  2JA6 G;  2K14 A;  3G7L A;  3QO2 A;  1DM0 B;  5BPF A;  2RDG A;  2RA4 A;  5ELN A;  1DD2 A;  1ZXT A;  2SEB D;  4WHX A;  1KRT A;  4GKK L;  2KJX A;  5A35 A;  4HJ9 A;  5I4D A;  1PV4 A;  4UCU A;  5KEE A;  3OOC A;  4DV4 Q;  3BVM A;  3G4S A;  1VQN A;  3CHB D;  1EU4 A;  4HCS A;  3VNN A;  5L1L A;  3RB0 A;  4ME5 A;  2EIF A;  3S2D B;  2L1B A;  4ME3 A;  2XWB B;  4XT1 B;  4C2M H;  1PRT C;  4C3H H;  4KV6 A;  3ULL A;  2F0W A;  2R6G A;  2OQK A;  2VB3 X;  1PA6 A;  2CHB D;  4GN5 A;  1JJ2 A;  5BWX A;  4FF3 A;  2X5R A;  1TS2 A;  5LP6 F;  2FK3 A;  3H4D A;  3KDF B;  4HAE A;  5BR8 Q;  1FJG L;  1M4V A;  3U4Z A;  3TW7 A;  2C5C A;  1L0W A;  2UUC Q;  1ESF A;  3FMC A;  4O3R A;  1HNX H;  1TU2 B;  1S0N A;  4F7X A;  3SK6 A;  4LFC H;  3SHL A;  3B6Y A;  4ZHQ F;  4OL7 A;  4BXX G;  4J15 A;  2ES2 A;  4BBS G;  3MHB A;  1YNJ D;  4FFR A;  2F4V H;  1UNN C;  5DAU A;  2A69 D;  1K8O A;  2K5V A;  1LO5 D;  1XPO A;  2K75 A;  1A3G A;  5COY A;  4IUR A;  1VQK A;  4DR5 Q;  2FJZ A;  5DG8 A;  5JJZ A;  3RFC A;  2KHS A;  1PRT B;  3T99 A;  1YI2 A;  2NN6 I;  1KNE A;  3H3V C;  4O3P A;  1SBB B;  3AMU A;  2TMP A;  2AGO A;  1LM0 A;  3R5X A;  4LF5 H;  2F3W A;  2HQE A;  2ALZ A;  2EJF C;  4HMI A;  3STB C;  2UXB L;  2XTI A;  2EJ3 A;  2ZDH A;  1QE6 A;  1HFG A;  3K57 A;  3IG0 A;  2YRX A;  5KG2 A;  1F9S A;  2XRQ D;  1GHK A;  4FF2 A;  2F0S A;  3BG3 A;  5A2Q L;  4ED7 A;  4DV0 H;  1MIU A;  3GTG B;  4OEM B;  2YYZ A;  4XIG S;  1JB7 A;  4O83 A;  1WVL A;  1WTO A;  2HHH L;  2MO0 A;  2OCE A;  4LF7 H;  5FO9 B;  3S14 H;  2CW0 C;  2L9H A;  1M8A A;  5FPO A;  4M7E A;  1Y1V G;  1V1P A;  2QF7 A;  3ICE A;  1WCM G;  4Y52 H;  1CKN B;  1CQJ B;  1N32 Q;  2AMC B;  3FPU B;  5JEA H;  3W1B A;  4DR3 L;  1YZ6 A;  1R9T H;  1YHQ A;  2W6M A;  3TEH B;  2WDT A;  5D1P A;  4PDB A;  5FJ8 H;  1VKZ A;  4RGO S;  3BQ1 A;  5LL6 b;  1VF5 C;  5C44 B;  3FDS A;  1X32 A;  1SYX B;  5FOB B;  4G4K A;  4P75 A;  4DR4 L;  2JA5 B;  3MR3 A;  3MFH A;  2N49 A;  3PSI A;  2B2U C;  2VUM H;  1B6S A;  4JI3 L;  2K5N A;  2UU9 H;  3T5H A;  3KJP A;  1VQP A;  1Z9F A;  2A8V A;  4M0J A;  5LA6 F;  1HTP A;  4DK6 C;  1K83 H;  4HNU A;  1L1O A;  4HJ8 A;  4GKJ H;  4H13 C;  3GTK B;  5EAY A;  3L4J A;  2M2L A;  2GPS A;  5I5V A;  1UEB A;  3M4P A;  4ZQ3 A;  1EQQ A;  1SRU A;  4O3O A;  3K6O A;  2NTS A;  1HJP A;  1EEI D;  2NUA B;  3CW2 C;  5GAD C;  1TWG H;  2XVS A;  3C46 A;  3BA9 A;  1QWY A;  4DL2 A;  1I50 B;  1AW7 A;  3PCO B;  5ISR A;  5IT9 E;  4JBK A;  4DV1 L;  1Q3L A;  3MXU A;  1AFP A;  1U4L A;  2W9C B;  5IYB H;  1SEI A;  3VOT A;  2HDL A;  2W57 A;  2J4X A;  3AX6 A;  5H80 A;  4IAJ A;  4DV6 Q;  3BAC A;  1XMO Q;  4OWW B;  4ED1 A;  4K6N A;  5CA1 F;  2BE5 D;  1SSO A;  2EYM A;  3VYT A;  5C5J A;  3S2H B;  1PH4 A;  3U58 A;  2F0N A;  2BR0 A;  2E2I H;  1GUN A;  4QWB A;  2NVQ H;  4JV1 A;  4RKB A;  2BDO A;  4YR2 A;  1RJP A;  1Q12 A;  3PO2 G;  1VF7 A;  1ESR A;  1MKH A;  2C9O A;  4DAY A;  3H0G B;  4X64 H;  1UNS A;  3VR5 A;  3DWA A;  2ZDQ A;  3HRZ C;  3VR3 A;  5I5X A;  4DL7 A;  2RDJ A;  3DHQ A;  4KTA A;  2BQR A;  2KCN A;  4TQS A;  1BDO A;  1WFQ A;  3OMG A;  2FHT A;  1KAA A;  2R7F A;  5G3L F;  1A3V A;  4A3E H;  4ECZ A;  1DOM A;  3QOJ A;  3V96 A;  4CKE A;  1PXU A;  1WTX A;  4OO1 I;  4JI5 Q;  4WOR A;  1GUW A;  3PVX A;  2NN6 G;  3TQ1 A;  3DMU A;  3I90 A;  2WE6 A;  3M9O B;  2JK8 A;  1FL0 A;  4QUF A;  3N6R A;  1GSO A;  4UP8 A;  1EUC B;  4WJ4 A;  2NBF A;  3N40 P;  2X6G A;  3ZYY X;  1U4M A;  4UCO A;  2KCC A;  2C28 A;  5BN3 A;  4MA5 A;  1UE6 A;  4IPC A;  2VPS A;  3S17 H;  4O3Q A;  1PH5 A;  1S0O A;  1Y1W H;  4KY6 A;  4CBV A;  3H94 A;  4LMY A;  4RAY A;  1IW7 D;  4JV0 A;  3PW0 A;  2JXM B;  4Y7N H;  4X6A H;  4K6D A;  1BF4 A;  4A76 A;  4NXM H;  2EYO A;  1HPC A;  3M3Y B;  4RNM A;  4EFE A;  3T9C A;  4FFN A;  2UXC L;  3GV3 A;  1J9O A;  3E0E A;  2ICE C;  2JEA I;  1XTC D;  4IWY A;  5KT5 A;  3BQ0 A;  2A74 C;  1EUJ A;  2XNA C;  3QFF A;  1STN A;  2V1C C;  5F2D A;  4WFN 3;  4A93 G;  3QOL A;  2KUM A;  2K52 A;  1PFS A;  3IAY A;  1VAJ A;  4JG2 A;  3WOF A;  4QMG A;  4LF6 Q;  4WD3 A;  4RG1 A;  2W8K A;  2NZO A;  4IHJ F;  1PZI D;  2B39 A;  5JQW A;  3HKZ A;  1HH2 P;  1HA5 A;  4ED2 A;  2HVS A;  2CWA A;  4A3C H;  5L1K A;  2AUJ D;  2C35 B;  4FS2 A;  1SYC A;  4HNT A;  1XK5 A;  2QIL A;  1QOH A;  3A74 A;  2ICI A;  1NMG A;  3DAA A;  1WD1 A;  4F8M A;  3NHH A;  1HR0 Q;  2M00 A;  2Y0S G;  4IUU A;  2IBK A;  3VR2 A;  2A19 A;  2F0K A;  1TWF A;  3LP8 A;  2EY1 A;  2K5Q A;  2W7P A;  5AJ3 L;  4NW2 A;  5K2M A;  5NUC A;  4LK1 C;  2XCA A;  4X66 L;  3HOW B;  2WYO A;  2YTX A;  5KG6 A;  1GVP A;  4YP3 A;  1J5E L;  5KFB A;  2UUB L;  1I6U A;  2JA8 H;  1A2U A;  4NB3 A;  5M5X H;  4UFZ A;  2GN5 A;  4OX9 L;  1BVS A;  3S1M B;  3S15 B;  2JA8 G;  1Y1V A;  5EKI A;  3S14 B;  2B8F A;  2R8J A;  4WRD A;  1D1I A;  2E74 C;  1GM5 A;  2IY5 B;  4RCO A;  3FKI A;  1CSQ A;  5BWU A;  3UI2 A;  3M9M B;  1P8L A;  1HNX Q;  3KBX A;  4LFC Q;  2R8I A;  3DM1 A;  4EEY A;  2YZM A;  2FP4 B;  2F4V Q;  2H5X A;  1G2T A;  2DPJ A;  4JVZ A;  1NBW A;  3I4N G;  3CQZ B;  1SNC A;  3S1N H;  4OO1 H;  3GTQ A;  1AE3 A;  1XJV A;  4AIM A;  4TVA B;  3V05 A;  1X65 A;  3FKI B;  1TWC H;  3CC2 A;  3DWQ A;  4DUZ H;  3E9I A;  1VQM A;  3I56 A;  2VUM B;  4JI6 L;  3RAQ A;  3S1Q B;  1C9O A;  4LF5 Q;  4OO1 G;  2FMC A;  5C3E B;  4ALP A;  1GUT A;  1CA5 A;  2HCC A;  4HNV A;  5E25 A;  5FD6 A;  1E1O A;  3S24 A;  1LLR D;  4DXF A;  3GII A;  4A3K H;  5IOC A;  2KOL A;  1FGU A;  1X9N A;  3Q22 A;  5LMN W;  3RV3 A;  4DN4 M;  1HNZ L;  4DV0 Q;  2FXQ A;  2D0P A;  5KFF A;  5DMX A;  1HNZ H;  1B7Y B;  2PMZ B;  3ZJY C;  1XMQ L;  1KJQ A;  2W6Q A;  2QYZ A;  5KFD A;  3I2Z A;  4DR2 L;  3DEO A;  1S68 A;  4I50 F;  4LF7 Q;  1JCK B;  4L6T B;  5I2Y A;  1FKA H;  4XYM B;  2HHF A;  2C2E A;  2K5H A;  3H20 A;  1STB A;  2R86 A;  4PZ8 A;  1X3Q A;  4BA1 I;  5A2Q E;  4O7R A;  1N34 L;  4A3J G;  2I87 A;  3LWE A;  3UYY A;  1ZYR D;  3HOU B;  1ENC A;  4XQQ A;  3I55 A;  2YTY A;  2FJ2 A;  4HJA A;  4MV7 A;  4C5A A;  4LF8 H;  3Q23 A;  5JH7 F;  1M7J A;  2EYH A;  3SEB A;  1S97 A;  2E2I B;  2EXZ A;  2A6H C;  4IFD I;  3ERO A;  3MZ5 A;  3Q1K A;  2YU9 A;  2R92 H;  2W9A A;  1AE2 A;  1HXY D;  4DLK A;  2VQF H;  5C1O A;  2A6E D;  3N44 B;  2R61 A;  2UU9 Q;  1K3B C;  5FNV F;  3J7A K;  5KG3 A;  4C3I H;  2G5D A;  2VB2 X;  3CD6 A;  1CKO A;  2V5A A;  3HG9 A;  5CV7 A;  4GKJ Q;  1PFN A