1A0IA

Atp-dependent dna ligase from bacteriophage t7 complex with atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
348
structure length
332
Chain Sequence
VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDGVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFHRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQAAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWWKMKPENEADGIIQGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFDACTINPYDGWACQISYMEETPDGSLRHPSFVMFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an ATP-dependent DNA ligase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 89
structure length 332
sequence length 348
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF17879 DNA_ligase_C DNA ligase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a0iA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1a0iA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1a0iA01
5FJ8H 1N32Q 1E3PA 1KRSA 3GTOH 5DLQE 2JA6H 3JSLA 1L1OB 1N34L 5DISC 3HKSA 1JJCB 3KDFB 4NXNL 4BBRG 1XJVA 1PHJA 4B3TQ 2Y0SG 3HOVH 4R4OA 4DR3Q 4LF4L 1TWGH 3PO2H 1G6PA 1X56A 3PUXA 1VQFA 2AWNA 4P74A 2BH2A 3TY8A 1K83H 1QZHA 3H3VI 2R7DA 3CC2A 4BY1H 1UE1A 2UXBQ 2AMCB 4A76A 4X64L 3I2ZA 4HIMA 3OYYA 1CSQA 3UE0A 4YWMA 4DV3Q 1XNQQ 4K0KQ 4LF6Q 1GO3E 4X62Q 2VW9A 4X66Q 1PH3A 4L5RC 2D62A 3U50C 1UE6A 3CF5A 4UCUA 2B63H 2UUAL 2JA8H 3CAMA 4JI3L 2KENA 1CKNB 1MJCA 2PI2A 4IJLA 3S1MH 1XK5A 1S3OA 3PCOB 1MKHA 3M4PA 4P73A 3U4ZA 5C4XH 4DV5L 2UUBL 2R7ZH 3T1YL 3HFZB 2VQFQ 1OTCA 4GS3A 5AJ3Q 2WB1G 3ER0A 1L2FA 2GVBA 3E9IA 2NN6G 3J80i 3VDYA 3SGIA 1TXYA 2DUDA 3AQQA 1Y1WH 4P72A 1M90C 4NXML 4A3CG 4UP9A 4B3RL 2EIFA 1XMOL 1VQ9A 3FKIG 4B3SL 4KHPL 4EFBA 1YITA 4KI0A 1UE5A 1GD7A 2PMZE 5M3MG 1J5EL 2MO0A 2ZM6L 4EFEA 4EEQA 4JI4L 1QUQA 1Q1EA 3PUYA 4A3JH 3W1BA 3CCLA 4IPCA 3HOZG 4OX9L 2K50A 1VQIA 1OXXK 2IHEA 2HIXA 4IO9A 2LSSA 1HR0L 3KYHC 1QVFA 2KBNA 3M85A 4KLKA 4DUYQ 1XPRA 3L0OA 4JI5Q 1VQCA 4LFAQ 3PUWA 1CKNA 2XTIA 4PZ7A 3RZDH 4NB3A 2NVXH 3CC4A 4JV5Q 3M4OH 3F1ZA 5C44H 1Y1VH 2F52A 3PV0A 1HZCA 1NTGA 3I55A 1WI5A 5M3FH 3A5ZB 4Y52H 2WAQE 1K73C 1PH2A 4QGUA 4UFZA 3EBEA 3I4NG 2I5MX 1W2BA 5FLMH 4A3GG 1YBYA 4GNXA 2CCZA 5IY0A 1X9NA 4C3IH 1YIJA 4IJHA 1PA6A 1D8LA 2VUMG 3PF5A 4JI6L 2NVQH 1S72A 2JA7H 4R1JA 1Y14B 4GKJL 3NEMA 4A3DG 2CWPA 4UCVA 1YNXA 4DV7L 2Z6KA 4O0AA 3UDGA 3ULPA 1MIUA 4TVAB 4MNOA 1NE3A 2R93H 4LUZA 4X6AH 4R4TA 1G51A 1SR3A 1KXLA 2K5VA 2HHHQ 1UWVA 1Q7YC 4PZ8A 2ZTDA 1OXSC 1X3EA 3F2DA 4JYAL 1O7IA 1YZ6A 1YHAA 2B29A 4QQBX 1OXTA 3UDFA 4UY8C 3UE1A 3GJXB 3EIVA 4YCWA 4DV1Q 2A1AA 2WB1E 1TWAH 3CQZH 3I4OA 4LFCQ 3GTLH 3K8AA 2VZAA 3CW2C 3S2HH 1NMFA 1VQLA 1FGUA 1Q46A 1YHBA 5GAGC 4B3RQ 1A8VA 2YV5A 2N8NA 1Z9FA 2B63G 1X6OA 2IHFA 1HNXL 1XDNA 3CPWA 5C0XI 2LXKA 1QUQB 1GM5A 2K5HA 2IY5B 4RMFA 4OX9Q 3PO3H 4DR4L 4OWXB 1VQGA 5JJIA 5IYDH 5FPRA 1I3QH 3BZCA 1EFWA 4LF9L 5EAYA 4DUYL 3HOUG 4A3LG 4A3CH 1VQ5A 4C3JH 1PH5A 5JEAG 5IYDG 2UXCL 4LH7A 3TREA 3BJUA 4JBWA 4JI7Q 4GKKQ 3CD6A 4BBSH 2Y0SE 1UE7A 3I56A 3PSIA 4LF8Q 3GTGH 2AWOA 2PQAB 2C35B 3STBC 4YY3Q 4DUZQ 2YTXA 1EQQA 1HZ9A 4IPDA 4NPSA 2OWOA 4POGA 1X65A 4P75A 2ZJRA 4OO1I 1B70B 1AE3A 1LYLA 2HQLA 4JI8L 1GVPA 2RCNA 3ERSX 4H02A 1XMQL 1PH1A 1IYJB 1IBML 4B3TL 3FKIH 3LGJA 1HZBA 4QY7A 5C44G 1Y1VG 4E6NA 2E8GA 3CMAA 5BR8Q 2BA0A 1Q1BA 4UCSA 1LM0A 3CCUA 1JT8A 2QEXA 4A3JG 1LUZA 4IPHA 4DV7Q 1U0LA 2VS1A 4DR2Q 4JI0L 4A3GH 2K5NA 2VY3A 1NMGA 1HNZL 4A3EG 5M5WH 1XNQL 4X65L 4YWLA 5IWAQ 4DR5L 1VQAA 3PN1A 1BBWA 3PUZA 1WOCA 3G4SA 1RL2A 3ZJYC 3PUVA 4X62L 4BA2I 2E5LQ 4R4IA 1NY4A 2HVQA 1E22A 3RTXA 3RLFA 2R7FA 3TY9A 1KRTA 4YHHL 1Q82C 3RZOH 4R4CA 3E9HA 5GADC 1X3GA 4AH6A 1TWFH 1IBLQ 1E1TA 2UUBQ 3K7UC 4HJ8A 5C0XJ 1IBKQ 2R93G 2GVAA 1K3RA 4AQYQ 3GTPH 4DNIA 1AE2A 4A3MH 3L7ZC 2ID0A 4DV2L 5ELOA 1CSPA 1MJEA 1VQ7A 2MFIA 4JCVE 3HOWH 4DR7L 1HH2P 5D1PA 2JA7G 5M5YH 1N32L 4O2DA 1CKOA 4JG2A 3OTOQ 1Q8KA 4IFDG 5D1OA 2ASBA 1NJIC 4A3DH 3B6YA 5ELNA 3KJOA 3CC7A 1P16A 3G48A 4JI4Q 1HNWQ 4A3IG 2I5HA 2FXQA 4QIWE 3RR5A 2EXDA 3NBYB 4BBRH 2ZTEA 5GROA 3HOVG 3S1QH 4AYBG 4RG1A 2JEAI 4JV5L 4X64Q 1A0IA 3OW2A 3BA8A 3M4QA 1N9WA 4DR6Q 1HR0W 4DAMA 1S40A 4GN3B 4TQUS 1N8RC 1EWIA 4A3LH 1TAEA 3HKZE 2NZHA 1XPOA 1KIXA 1C9OA 1K9MC 3J81j 4LNQA 1HJPA 3AYHB 5GAEC 4DR1Q 1N36Q 4BBSG 3GO5A 4GOPA 3TRZA 2VQEQ 4QJFA 3BABA 3E0EA 4JI2Q 1XMOQ 4B3SQ 4KHPQ 3CCJA 1YJWA 3HOXG 5D1OB 2JA8G 2JA9A 4GN4B 3J81c 2N78A 4J15A 1EQRA 2ZM6Q 3NBZB 4JI1L 1K0RA 4AIMA 5E7NA 5LMNL 1I94Q 2UUCQ 2R7ZG 3S14H 5IWAL 4DR5Q 4DK6C 4DK3C 4B3MQ 2KCMA 1IZ6A 2A19A 4XTCS 2PNHA 1XPUA 3KF6A 1FVIA 2IT1A 4Y7NH 1Y1WG 3M3YH 4LUOA 2UXDL 4LF7L 4JOIC 1C0AA 4UCOA 4LFAL 1V1QA 3L2PA 3RN2A 2BH8A 2RHSB 1P8LA 3TEHB 1VQPA 4JYAQ 2VNUD 1G291 4R4QA 3S16H 5M3MH 2NN6I 2HIVA 3H0GH 4K0KL 1W3SA 3F2BA 3GTQH 3NC0B 4JI5L 1VQJA 2CKZB 3FP9A 4AQYL 4BY7G 1VQMA 1OXVA 2DGYA 3STBD 3A5UA 4HJ9A 4GN5A 3HOZH 1JMCA 1WCMH 3CCRA 2UUAQ 2D0OA 3KOJA 2QA4A 4LFBL 1TWCH 1QVGA 1FJGL 1FL0A 1VQNA 4A3KH 1A63A 2F3IA 4JOIA 2L15A 1B7YB 3KF8B 4EX5A 5AJ3L 3CCSA 3J7A5 2RHQB 2OQKA 5M3FG 1EYGA 3I7FA 2YU9H 1E1OA 2IX0A 4NXMQ 4A3MG 1LTLA 2JEBI 3JC66 4WJ4A 1WFQA 1UEBA 2K75A 3PGZA 5FLMG 3DLLA 5LMUL 3GTMH 3W1GA 1PYSB 3S1NH 2ZTCA 4IOAA 3G6EA 3D0FA 3J7ZC 3T1HL 1HNZQ 1PYBA 2RF4A 1QZGA 1TA8A 3WWVA 2OCEA 1SLJA 4OXPA 3A0JA 4GOPC 1VCIA 2UU9L 2PI2E 1YVCA 3CCVA 3M9BA 1YHQA 4UP7A 4XIGS 1VS0A 1WYDA 4HJ7A 3BAAA 1KAWA 4JC0A 1EIYB 1B8AA 1N33Q 3HOYG 1VQ4A 4JI2L 3W5OA 1I6HH 1L1OA 4MTNA 5FJ8G 3M7NA 3JAMc 4LFCL 2JA6G 4DV0L 3JAMi 3ULLA 2VL6A 3HOYH 1IXRA 4JI1Q 5IP7H 2Z6KC 3PIPA 3UDIA 1Q12A 5M5XH 4DR2L 4JI0Q 3GTJH 5IP9H 1EUJA 1N34Q 3AFPA 3TQYA 3H3VH 4BXXG 2NVYH 1HNXQ 1I5FA 1SROA 2N49A 5IP9G 2ATWA 2NZOA 1KC8C 1K8AC 3HOXH 1Q81C 2ZJPA 4DR4Q 1HZAA 1TWHH 3S15H 5IYBG 1E24A 3NELA 4P71A 4DV6Q 1KL9A 3ULJA 4JI6Q 2KHIA 2Z0SA 3CP0A 3RN5A 2HT1A 1VQEA 4DR6L 4DV3L 1PH9A 4GKKL 3HOUH 4UPAA 5C0XG 4JI7L 1VQHA 4UP8A 4HIDA 1FJGQ 3U4VA 4LW1A 1RIPA 4YY3L 1BVSA 3IRBA 5C4XG 2OTJA 2JQOA 1SMXA 1VQKA 3H0GG 3UDXA 4DR1L 4BY7H 2Q2HA 1VQBA 1VQOA 1SFOH 2F4VL 3KDFA 4LF5L 4C2MH 3T1YQ 1J6QA 4A3BG 4DV5Q 3I4MG 3G71A 2YYZA 3TS0A 1C7YA 4HJ5A 4YWKA 3K0XA 4GNXB 2R6GA 4JI3Q 3T1HQ 4A3BH 3MEFA 4L5QA 3K7AH 3S1RH 2E5LL 3S2DH 2HVRA 2E2IH 3CCMA 4YCUA 1GKHA 3RLOA 2Q2IA 1J5EQ 5HGQA 4YHHQ 2CQOA 4A75A 1X55A 4X65Q 3RNUA 4DR3L 4LF4Q 2K14A 1IL2A 3BA9A 4A4IA 1CKMA 4YCVA 4JBKA 5IYCH 1WCMG 1SN8A 4JBJA 4HJAA 2ZJQA 2JE6I 2MNAA 3JSNA 3AEVA 4DKAC 3FHWA 3KF6B 1ASZA 1X3FA 1N36L 4DR7Q 4GOPB 4A3KG 4IPGA 1L0WA 4C3HH 2R92H 3KFUA 4FDBA 3EN2A 1IBKL 5LMNW 1NBWA 2OTLA 2GN5A 1JB7A 4OWWB 1JE5A 4X66L 1D7QA 2NVTH 2VUMH 5JJKA 3RLNA 4LF8L 5FLXc 4IFDJ 3QWUA 5GQOA 2KHJA 4L5TA 2VUGA 1PH8A 1XTDA 5C3EH 2YTYA 2N3SA 4IOCA 4HIKA 5IE8A 4DV4L 4A93H 3GB8B 4APVA 4CC6A 3K81C 4JI8Q 5IP7G 4GKJQ 3J80c 2CFMA 3DM3A 3S24A 1PH7A 5JEAJ 4A93G 2WP8J 4LWCA 2IX1A 4DAYB 3CCEA 3CCQA 4BXXH 2E2JH 4LF9Q 2XGTA 4A3IH 2AHOB 1R9TH 2UU9Q 2K4KA 2UXCQ 2HHHL 1S68A 2I5LX 5FPOA 4OONA 2JA5H 2PQAA 4LF6L 3AFQA 1XMQQ 2HVSA 4PMWA 3U58A 3GDEA 4LF5Q 4HIOA 1Q86C 1HR0Q 3S17H 1U5KA 2JA5G 1YEZA 2CWAA 3ICEA 4UCRA 1QVCA 3Q8DA 4DV0Q 4QL5A 1YJ9A 1DGSA 2AKWB 3PIOA 1KHIA 1YJNA 1XNRL 3PO2G 1PH4A 1B04A 3KLWA 3H15A 5LMUQ 2V1CC 2VQFL 2JK8A 1X54A 1V9PA 5C4JH 1PH6A 3PO3G 4KHZA 4BA1I 3VNNA 5HY6A 4ALPA 5IYBH 1ASYA 1T9HA 3HKZG 4CC5A 4A3FH 3KJPA 2Q2TA 2QGQA 3J81i 1AH9A 3I4MH 4WJ3M 5K36G 3F2CA 4LUVA 4GNXC 4A3FG 4NXNQ 5GAHC 4JBMA 4AYBE 4OO1G 1Z47A 1KQSA 3A74A 1IBLL 1EIFA 1BKBA 2WAQG 5JJLA 2MO1A 4GLXA 1JJ2A 4ME3A 1V43A 2UXBL 4GLVB 1YI2A 1VQ6A 2MQHA 4PG3A 1WJJA 5J3BA 4BY1G 4DUZL 2F4VQ 4DPGA 1KD1C 3NBHB 2B3GA 2E2HH 3GD7A 3CXCA 3CMEA 1K8GA 1VQ8A 4LFBQ 3TS2A 3K80C 1E7ZA 1BBUA 4DV4Q 3PF4A 1HNWL 4UCTA 2R92G 2JJQA 3BZKA 1VQDA 1L1OC 1M1KC 4GLAC 3OTOL 1H95A 4A3EH 4L5SA 4DV6L 2OQ0A 3F8TA 2ALYB 1IBMQ 1PVOA 5IYCG 4DRFA 5IT9c 5H1SE 4LF7Q 4EQ5A 1PFSA 1PV4A 5BR8L 4LH6A 2D0PA 2LXJA 5LMNQ 2EQSA 1SE8A 4PZ6A 1I94L 2UUCL 2K52A 1JJGA 1EOVA 4B3ML 4MZ9A 3D31A 2Q2UA 3MXNB 3NENA 2A8VA 2YTVA 2KCTA 1SRUA 2I0QA 4IFDI 2UXDQ 2VQEL 3I4NH 2H5XA 1A62A 3HOWG 1XNRQ 4OWTB 4POFA 4DV1L 2WFWA 1N33L 3TY5A 3UQ8A 1I50H 5C3EG 4DV2Q 3CPFA 1CUKA 2BA1A 3GTKH 1OXUA 2ES2A 3BU2A
chains in the Genus database with same CATH superfamily
5FJ8H 1N32Q 3BDOA 2PQEA 3JSLA 4YBZB 3GTLA 3N43B 1N34L 3CHBD 2EJGC 1K83A 3KDFB 4NXNL 2K04A 3K5IA 3GTGA 2Y0SG 4LJZC 1G6PA 5JQWA 1F77A 1S5CD 1VQFA 1U4MA 4QIWB 2B63B 1QZHA 3CC2A 4F50A 1UE1A 3GQBA 4GZYC 4A2BA 2JN4A 4O3NA 5L1KA 4HIMA 2W8LA 2BE5C 1XNQQ 3TDQA 4DV3Q 4YWMA 2WTFA 3M4OB 4EBEA 4ED8A 5KFGA 4KK7A 2F0JA 1PH3A 4L5RC 4CBVA 5KFLA 1XX8A 5CM0A 1TS4A 1M8AA 2UUAL 4Q4CA 4JI3L 3SHLA 2KENA 2A6HC 1MJCA 1XK5A 5FLXL 4IJLA 2CNQA 1S3OA 2EY2A 5EDWA 3T1YL 3HFZB 1ULZA 3CEBA 1OTCA 2F0FA 3NWTA 3URYA 2WB1G 4DAYA 2AUKA 2GVBA 3VDYA 4C1NI 1M90C 4O2AF 5BPFA 2R7ZA 4B3RL 4B08A 4RHRA 3DTFA 1VQ9A 4K0KH 3FKIG 2C2RA 3J7YW 1YITA 2VPSA 4RU9A 4KI0A 3VMMA 2PMZE 5M3MG 1JWUD 4EFEA 4JV5H 1QOHA 1QUQA 1Q1EA 1G2SA 3PUYA 4JI4L 2B2YC 1W96A 2RDFA 4IPCA 4MA0A 3R2TA 4H13C 2JA5B 2J7ZA 4DUYQ 3MA2B 4O2BF 2WAQB 3S2DB 4LFAQ 3MXGA 3PUWA 3CC4A 4H0LC 4JV5Q 3IFDA 4QUFA 4IRCA 3M4OH 5KG6A 1BO0A 4K8JA 2XWJB 4RAUC 2YRWA 1HPCA 3F1ZA 5C44H 5EWFA 5M3FH 3QZ8A 1NTGA 1WI5A 2NVYA 2MHVA 2WAQE 1K73C 2HJWA 3V6KA 2AQ2B 2ENBA 1WRVA 1YBYA 4GNXA 3K59A 1X9NA 1YIJA 5DAAA 1EWCA 4IJHA 3NHHA 4J9NA 1ZHSA 5KFWA 4NXNH 1PFNA 3HOUB 2WV6D 4EGQA 1D5XC 2B2VA 4TUYF 2E2HB 4C3HB 3L9AX 1CQVA 4FFMA 1YNXA 3UDGA 1MIUA 1XNQH 1K1QA 1NE3A 4R4TA 1I2KA 2K5VA 1UWVA 3NBHA 5KFFA 2F1MA 1V8QA 3F2DA 1O7IA 2B29A 2Y0SA 4UY8C 3UE1A 2W57A 5FOBB 4MV8A 3S2HH 3RV3A 3N6XA 4O3SA 1VQLA 5GAGC 4MV1A 4LMYA 2E75C 1A8VA 1PDQA 5KFQA 5EPLA 1JDEA 2N8NA 2FJ2A 1HCZA 2ZXRA 1LABA 5CR5A 1J5EH 1HNXL 2EDGA 1I6HB 1HHVA 2LXKA 4J9KA 5LMUH 3PO3H 5KFKA 1CHPD 2HDMA 5IYDH 2R8HA 2CH4W 3BZCA 4HCEA 1H9KA 1SXTA 4H7BA 3G6XA 4C5BA 4O7WA 1PH5A 2UXCL 1SYFA 5IYDG 4O84A 3BJUA 2LS01 4JI7Q 1V1OA 5CBEE 1GOZA 5IGCA 2Y0SE 1RF2D 2XGQA 1NAPA 2C35B 3KALA 1RK6A 1HZ9A 1OBGA 1UC9A 1T3NA 4P75A 4DR2H 1Y1WA 1XMQL 4BY1H 3CD6A 3GTGH 2RCNA 4ZQ3A 4L63B 2TMPA 1HZBA 2EJFC 2G9HD 3GTJB 1Q3LA 2BA0A 4X3KA 1F2LA 3CCUA 1JT8A 2QEXA 2HGSA 4A3JG 4G57A 1LUZA 3HOZB 4ECTA 5KFZA 1NMGA 1I4RA 2CH4A 4R8UA 4YWLA 5KFPA 3L4KA 1VQAA 2F0SA 3ZJYC 1HUNA 1DIKA 4IUNA 3KBXA 4BA2I 1JC7A 4R4IA 4XYLB 3MR2A 3GTQA 1E22A 4TSSA 3TY9A 4YHHL 1DV2A 1CHQD 2K5QA 3E9HA 4R4CA 4MV6A 3MTSA 1ZYRC 1E1TA 5C0XJ 1VBGA 1I1KA 1K3RA 3EPGA 4AQYQ 3GTPH 4A3MH 4G7OC 3L7ZC 3MWEA 1MJEA 5ELOA 1CSPA 4DR7L 4DV7H 1NNXA 1A6XA 4X62H 5D1PA 2W7OA 2GLTA 1N32L 5D1OA 4FO2A 2ASBA 1EYZA 5C5LA 5EWGA 2EIYA 5DGIA 3G48A 4KY6A 2I5HA 2FXQA 5BYBA 3SEBA 1WTRA 2EXDA 4F88A 3NBYB 2ZTEA 3GILA 4ZQIA 1E2ZA 3JRWA 4RH6A 2D9UA 2L1BA 3WWHA 3CVZA 4X64Q 1SMYC 5BPHA 4LF7H 1D5MC 2F0EA 1N9WA 2R86A 2C2EA 1K8OA 5C5MA 1B33N 3SE7A 1XMOH 4TQUS 3UYYA 2NZHA 1B9MA 3QIAA 1GYFA 1C9OA 2PZWA 2L9HA 3VPDA 3BDLA 4ZUIA 1M0WA 3QQMA 1F2ZA 4BBSG 3BABA 1IYVA 4KHPQ 1XXGA 3CCJA 1YJWA 5KEEA 4LFBH 1SDFA 2K1BA 2JA8G 3SK5A 3ETHA 3GP7A 3J81c 1EFID 4J15A 1B50A 2VQDA 4JI1L 1KEEA 1LTGD 1I94Q 3S14H 5CA1F 5IWAL 4DR5Q 4DK6C 1Y8PB 4B3MQ 4A3BB 1IZ6A 2A19A 3KF6A 3J80E 4Y7NH 3ND8A 1Y1WG 3M3YH 5D3IB 4LUOA 4KMUC 4RKLA 1TQOA 3G8CA 4JYAQ 2NU7B 1W3SA 3AB9A 3GTQH 1G91A 3I12A 2CKZB 1EU3A 1IW7C 4UCUA 1EUCB 1VQMA 3BQ2A 1OXVA 2DGYA 1IKLA 3E0JA 4HJ9A 3HOZH 2PVPA 5BWTA 5EBCA 5CV7A 2ALZA 5CYUA 1B6SA 1SE2A 4NDXA 2UXCH 1CZWA 1I4XA 1VQNA 1VDZA 2W6PA 4JOIA 4BY1B 3KF8B 4KY7A 4EX5A 5LYJF 4DV0H 3PFFA 2RHQB 2ATLA 2K6AA 2X6LA 4RGNA 2YU9H 1E1OA 4NXMQ 2X5RA 2A6HD 3CSWA 4YJ2F 1S0MA 3I73A 3JC66 4WJ4A 1UEBA 3GTMH 1JOKA 3DLLA 5LMUL 2YZGA 4O82A 3GTPB 4MA5A 2YU9A 3G6EA 1XYIA 5HV6A 1TA8A 4C3JB 4OXPA 3A0JA 5FO7B 4LSXA 4RGTA 1JWSD 4O3OA 2QDBA 4QIWA 1D2BA 1YHQA 3BVZA 4DV1H 4GKJH 3BAAA 4I55F 3U9OA 2RSOA 1TWHB 1VQ4A 3S15B 1I6HH 1N36H 2KECA 5FJ8G 4PQXA 4IIJF 4ED0A 2ASLA 1PLFA 5E4WC 4CE5A 2V59A 3FMAA 2Z6KC 3UDIA 4IRDA 1IBKH 1HNZH 3AFPA 3N8DA 3H3VH 3RD4A 4BXXG 2UVVA 5I5SA 5I2XA 3H09A 3PIO3 5HURA 2NZOA 2ATWA 1K8AC 2XSCA 4FU0A 1DXMA 4ULLA 4DR4Q 2AGQA 2EE1A 3MR5A 5I5WA 2B8FA 4JI6Q 3RB3A 4O86A 1DZ1A 3TQTA 1JOQA 2NTSA 5CV5A 4XYQA 1D6EC 1S5ED 2F0TA 5JVG3 5C0XG 4JI7L 1VQHA 3FRPB 4I4TF 2F0OA 4PMCA 5L1LA 4RB1A 4N8X1 1Z6HA 4LW1A 3EYYA 5DG8A 1RIPA 4YY3L 4YR0A 5DMXA 2SNMA 4WFN3 4O7ZA 3GIQA 1BUVT 3IAYA 1JOOA 4L8JA 1SFOH 4LF5L 1G2TA 1YNND 3P20A 3BQ0A 1EIHA 1SYGA 2E2IA 5DAUA 4FF3A 5BN5A 5M5YB 1S0OA 5KFCA 2R7LA 3D3RA 1N56A 2QF7A 3MEFA 3K7AH 1C4QA 2E5LL 1WTPA 5IGDA 3F8NA 3RLOA 5HGQA 1FD7D 1X55A 4X65Q 4DU9A 1CKMA 2XWBB 4K2KA 1S03G 4KY5A 3LX0A 2HHFA 4DAAA 1J9OA 1NR4A 1O80A 3HP3A 1X3FA 4HSVA 4IALA 1ASZA 5BWUA 4MTDA 3RAXA 4C5CA 4G7ZC 4IHJF 4IPGA 4FDBA 4XT1B 4OWWB 5JJKA 3QWUA 5FLXc 5GQOA 4QWCA 2I87A 1XTDA 5C3EH 2YTYA 5JPNC 4JI2H 4MTKA 3JZFA 4CC6A 4DL3A 2BDNA 1EY8A 1PTOC 2J0TD 1S9FA 4ZLTF 2OLSA 2SEBD 3S24A 1Q90A 1I4GA 1NUCA 4DAYB 1S10A 3OIPA 1VF7A 3ONAB 3OIQA 2E2JH 2XGTA 3N42B 4B3MH 2AHOB 1AEXA 2W7PA 2K4KA 2SOBA 1TS3A 2I5LX 4X3SA 4M7EA 3HZXA 4MV4A 3RZOB 3GDEA 4BS9A 1Q86C 3SDZA 4DK1A 2VB2X 3EJIA 4UCRA 2CWAA 3ICEA 1M6VA 2NU9B 4HNTA 1SYXB 5KNBA 2FLPA 3FKIB 2R8IA 2M05A 1YJ9A 1DGSA 3PIOA 1YJNA 1KHIA 2LFNA 3PO2G 5I5XA 3PR5B 2V1CC 2JK8A 5KFTA 5C4JH 1PH6A 3PO3G 5F9NA 3MFGA 3HKZA 1ASYA 2QKIC 3HKZG 2UXBH 4A3FH 3KJPA 2RDIA 2O4XA 3KBGA 2Q2TA 4YQWA 4R8UB 3I4MH 4BBSB 2WKCA 3AMUA 1IBLH 4A3FG 1DD2A 3LWBA 4JBMA 4ID6A 4K5VA 3V6HA 4ECWA 1EIFA 2WAQG 5JJLA 4ME6A 1S5BD 5COYA 2YW2A 1PZJD 3H0GB 4DR1H 3C1EA 3Q8PB 4PG3A 5J3BA 1WJJA 4HTHA 4BY1G 1BXRA 4DUZL 2F4VQ 1KD1C 3M7GA 2YWVA 2ZDHA 3RF2A 3CMEA 3CXCA 1K8GA 2AU0A 3Q2OA 1E7ZA 3PF4A 4UCTA 3KUPA 2NVXA 4C3HG 4EQPA 3A7AB 3QO2A 3HGBA 1KABA 2OH2A 1VQDA 1L1OC 3BJYA 5JVLA 3OTOL 2WE6A 1SNMA 4WRDA 4RB0A 5KFVA 1RCVD 4FFPA 2OQ0A 2RQXA 1EZ1A 1GUSA 1CE8A 4EQ5A 1PFSA 2EYOA 3SE0A 2R93B 3WNZA 2EQSA 1SE8A 1JJGA 3R5XA 2NYZD 4MTEA 4J9QA 5HNEA 4B3ML 4MZ9A 3SK6A 2Q2UA 5BR8H 2R8KA 3G8DA 3T16A 1I3QA 1CQIB 5D65A 2I0QA 1KJ9A 3J7AK 3I4NH 2IL8A 4O4JF 3EVQA 4OWTB 1N33L 2GPSA 2WFWA 3TY5A 4ECXA 3QOLA 1IKMA 3H4BA 2B2TA 1B1ZA 1STYA 4DV2Q 3ORRA 2UU9H 1BR9A 1HA5A 2ES2A 1CI3M 3T5KA 3I8ZA 1KRSA 3GTOH 3MFYA 1L1OB 5DISC 4U7CA 3T5JA 3R5FA 1JJCB 5KYIA 4ECZA 3TP5A 1D5ZC 1NSNS 4R4OA 1L2ZA 1X56A 3PUXA 4DFAA 3BVMA 1CZGA 2AWNA 2O5IC 3OSPA 2R7DA 5I60A 1IYUA 2UXBQ 3SNOA 4HEDA 4RZRA 3GTMA 3RFCA 2KVMA 1SJED 3OYYA 4Q5VA 2FK3A 4K0KQ 1O7YA 1EY0A 1GO3E 2A69D 3I3CA 4O7TA 4X66Q 1PFMA 2D62A 3CF5A 2B63H 2JA8H 4N8FA 3CAMA 5CGKA 1CKNB 1I4QA 3PCOB 1MKHA 5C4XH 1LTBD 4DV5L 3WWIA 1A48A 4GS3A 5I6WA 5AJ3Q 1L2FA 3E9IA 3J80i 2KCNA 5KG5A 1Y1WH 4P72A 4A3CG 4UP9A 1U9RA 4KHPL 2V4QA 1ZKOA 1J5EL 1SJHD 2MO0A 1ILPA 2R7ZB 1SNPA 2Z9HA 3HOZG 4OX9L 2W70A 4QWDA 2IHEA 2KEDA 2RDJA 2BE5D 2CNUA 2KBNA 1XPRA 2LY7A 2DZDA 3NQIA 1CKNA 2XTIA 3TBIB 4C1NK 4HSPA 5CV6A 3RB6A 1Y1VH 1EQVA 3R93A 1KLUD 3A5ZB 1ZETA 5ELCA 2FK2A 4J9SA 4J9RA 3D4RA 1RHPA 1SBBB 4LF9H 2FMCA 1JLLB 1GHJA 4TV9F 2YZLA 1PA6A 4JI6L 4CMFA 1SFOA 5J1ZA 2JA7H 4R1JA 1A3GA 4FE2A 4Q8EA 5DGBA 1R4QB 1SSOA 1WVLA 4RB3C 5KX5F 3T13A 2Z6KA 4O0AA 4O3QA 4TVAB 5KG3A 2HD3A 2GA4B 4X6AH 2P0AA 1G51A 1WTOA 2HHHQ 1BCPF 5EBDA 2EY5A 4PZ8A 1OXSC 3DTGA 4JYAL 2FE3A 3TQ1A 3GJXB 3T9CA 5FD6A 1CT1D 4DL6A 3LULA 1WTHA 2NVYB 4YCWA 3J81E 1S0NA 4LSAA 3TIGA 3GTLH 3N6RA 2J6TA 1I4PA 3GQCA 1FJGH 4B3RQ 5EWEA 1G2WA 1CQFA 3KREA 3GTOB 1GUGA 1STBA 1X6OA 3CPWA 2PCFB 1QUQB 2XVSA 1GM5A 4A3EB 2IY5B 5BMVF 5M3FB 5JJIA 5FPRA 3CU7A 4LF9L 4X3TA 4O1NA 1FKAH 2C22A 4TQRA 3VYUA 1KDCA 1VQ5A 3PZPA 4C3JH 2SDFA 5KFOA 4LH7A 4JBWA 2K5WA 1JKJB 3T54A 1FYCA 5LMNH 3WDNA 1UE7A 3I56A 2W71A 4A3FB 5GONF 3N41B 5K36G 1JB3A 3K58A 4IPDA 1IBMH 4ETSA 1LYLA 3HG9A 2HQLA 4JI8L 3ERSX 1PH1A 1QE6A 2KOLA 3AW8A 1IYJB 3FKIH 2K03A 3LGJA 2COJA 1LTID 2E8GA 5CV4A 1K8MA 1Q1BA 1LM0A 1AP0A 1B44D 5D8DA 5KFNA 2A1HA 4DR2Q 4JI0L 4XT3B 4A3GH 1Y8OB 2YL2A 4EQOA 4HR7B 1HFGA 5M5WH 2Q8IB 5A35A 3PN1A 3PUZA 5DG9A 2C28A 3PUVA 3LWEA 4CDFC 4O81A 4WD3A 4FF1A 2HVQA 1SMYD 3RLFA 4UDUC 1SEBD 3RZOH 1X3GA 2DABA 2VXWA 1TWFH 1IBLQ 1X3QA 2UUBQ 4CDDC 2R93G 1XWEA 3DUZA 3NK9A 1O75A 4MIUA 1AE2A 2R3ZA 4IFDH 1BBXC 1VQ7A 3HOWH 4JCVE 4B9XA 2F0IA 1H9JA 4R8IA 2BDOA 4JG2A 2R8GA 1Q8KA 3C46A 4IFDG 1TY2A 1PZID 3B6YA 4TM5A 1P16A 2DY7A 4RKBA 4JI5H 3G7LA 4QIWE 3GTJA 4J9LA 4FBUA 3RR5A 4DIMA 1V1PA 3A8JE 4DK0A 4BBRH 3HOVG 3NBIA 3HBLA 3S1QH 2UUCH 2XN9C 5KT4A 3OOCA 3WO0A 2K7VA 3BA8A 4DR6Q 2WACA 2JEGA 2HQEA 3E5NA 4B3SH 1QNKA 3S1RB 2J4XA 1EWIA 3K7AB 1C8CA 4A3LH 4XYMB 1XPOA 4ED6A 1KIXA 4A3DB 3WOEA 3J81j 4WHXA 4F4ZA 2F0MA 1GUTA 3AYHB 1BCPB 3QWNA 3MHBA 2QB5A 3E0EA 4JI2Q 1XMOQ 1SFOB 3HOXG 1EY6A 2BOSA 2GQSA 1UNNC 5KFRA 4GN4B 4EBCA 2N78A 1EQRA 2ZM6Q 1W93A 5E7NA 2R7ZG 1AUXA 3U55A 4RFBA 4DK3C 2KCMA 2NU8B 4XTCS 2PNHA 4JI1H 3D4DA 2Q8TA 4WORA 3W2DA 3H0GA 2UXDL 4LF7L 3L2PA 1P8LA 2BH8A 1I1MA 5IGFA 4R4QA 2WAQA 2DAAA 4L1KA 2A73B 4JI5L 1VQJA 3NC0B 3E5SA 1KTKA 3A5UA 1DONA 1JMCA 1WCMH 5DGAA 2UUAQ 4TVIA 1H9SA 1BCPC 1TWCH 4LFBL 4XYOA 4XQQA 1FJGL 2F3WA 1PTOH 4A3KH 1A63A 4QF4A 2L15A 2ASJA 5ELEA 3J7A5 1KJIA 2AQ3B 4RB2C 3P7JA 2F0HA 1LTLA 4TKOB 1WFQA 4IQZA 3PGZA 1WR2A 2I8CA 5F2DA 3W1GA 1K28A 3H6MA 3VYSA 1RYSA 2ZTCA 3D0FA 3J7ZC 1PYBA 4EVOA 2MGSA 2DY8A 3WWVA 2OCEA 4FFOA 1B3AA 2KCCA 4PWQA 1YVCA 4K14A 4FS2A 4IN3A 4UP7A 2WIIB 1WYDA 3S1NB 4QWAA 3BZDB 2CZGA 1HTLD 3W3AA 1KAWA 5CBAE 4HJ7A 4O7RA 1B6RA 3GTMB 3Q24A 2QDLA 5M5WB 4NLGA 2QEJC 2HGWA 3JAMc 4F8MA 4DV0L 2L11A 4A2AA 4UHVA 3FDTA 4IR9A 3ULLA 3MR6A 4JI1Q 5IP7H 4A3KB 2FK1A 2W9CB 1Q12A 4RGOS 3HKZB 3TZDA 2W6OA 5C3EB 4RCNA 1W6KA 4ZHQF 1MSGA 3DM1A 1HNXQ 1O7ZA 4RCOA 1Z2OX 1D1IA 2NUCA 5E3FA 2G5DA 3K5NA 2ZJPA 2HHFB 1HZAA 4TQSA 5IYBG 3OUUA 1E24A 3NELA 4DV6Q 3ULJA 5DEHA 2UXDH 2KHIA 4DF7A 4FM9A 3RN5A 2HT1A 1HTPA 4RZQA 4DR6L 4DV3L 5I5TA 1MD2D 1PH9A 4GKKL 3HOUH 5KNCA 5LHY1 1G8ZD 2EYFA 3O13A 4TRDA 2ICEC 1C30A 4YIJA 2CHBD 1HFNA 2RA4A 3MXPA 1BVSA 3RUZA 5C4XG 4FGRA 1F9RA 1SMXA 3H0GG 3UDXA 5CR3A 3BYYB 3GV5B 2KQ3A 2FLNA 3T99A 4C2MH 4DR3H 3G71A 1RJTA 3TS0A 1C7YA 5EOYA 1BNCA 1F9QA 3K0XA 1NR2A 1GGOA 1SNOA 4JI3Q 1PTOF 2X6GA 3Q1KA 2NVXB 4A93B 2OEOA 3RB4A 5BWRA 4YCUA 1GKHA 3GTLB 2UVUA 4EBDA 2CQOA 2ZDQA 3RNUA 1KJQA 1BDOA 2F0QA 1U4RA 3Q8RB 4HJAA 1B4OA 1E4EB 2MNAA 2PW7A 3KF6B 2EYPA 3T7AA 4GOPB 1L0WA 2R92H 4LF6H 4FNFA 3PW4A 4YP3A 1RJQA 3DWPA 1JB7A 2W6QA 3QB3A 3RLNA 4CHTB 3MFHA 4CKCA 3BG5A 2NWGA 4JPBW 2R7NA 1UUPA 5IIFA 4E6IA 2N3SA 2CW0D 3C0FB 4IUQA 3SVMA 5IE8A 4DV4L 3GTKA 3K81C 4JI8Q 1A15A 2Z1CA 4GKJQ 2VR1A 1O78A 3OSNA 2C5CA 2HDLA 4EEYA 3OTOH 2KA7A 4A3IH 5A2QE 3RV4A 2V58A 4A3MB 2M00A 2UXCQ 4WBNF 4OONA 2JA5H 4K8IA 3OPOA 1TWFB 4I7AA 2HVSA 2KEEA 1BCPD 1X32A 2B2UA 3U58A 2DJFC 3RUPA 3HOVB 4NXMH 4KV6A 1U5KA 4ZUJA 2JA5G 5I47A 1IYEA 4DV0Q 4MV7A 1JX4A 4JI8H 2AKWB 3VA7A 1XNRL 2HGXA 1FR3A 1BJTA 2V4DA 1FNWA 4OEMB 4ABNA 1WSCA 2H1EA 4YR2A 1E4FT 2R8JA 2B63A 4ALPA 4DL2A 3MZ5A 3N40P 4B3RH 4AQYH 4JV2A 4WJ3M 3NGDA 5LL6X 2RKSA 3S2HB 1MI2A 3FDSA 1ZAUA 3M4IA 4NXNQ 4KHVA 4OO1G 4JI4H 1IBLL 1PRTD 5K36H 4DNTB 4HR7A 2DPIA 4GLXA 4OO1H 1JJ2A 3RIZA 5I6YA 1VKZA 1VQ6A 2MQHA 1XTCD 1O7LA 3NBHB 2A6ED 2E2HH 1K0SA 3GD7A 3TEKA 4F4YA 4J1MA 2UUBH 3MXNA 1EY4A 3TS2A 1I2LA 2Z4HA 2IMWP 3TZUA 4JI3H 2JJQA 3WOFA 1DOLA 2XD4A 1Y1VA 4GLAC 1YNJC 2JXMB 5LP6F 2RGVA 2Z4IA 3BG3A 3J7AF 5KFIA 4L5SA 2DLNA 1PVOA 2YYAA 4FP5D 4DRFA 5EPKA 1A3UA 2QK4A 5IT9c 5JQGF 1EKFA 1PV4A 4XDXA 4DL4A 2W9BB 2UUCL 5C5JA 1H9MA 4PZ6A 4OIKA 1CFMA 1Z2PX 4ED2A 1S5FD 4ZOLF 3MEHA 3I4LA 2A8VA 5FKAC 3MWMA 2R61A 1SRUA 2D5DA 4IFDI 2UXDQ 4KTAA 2VQEL 3DWQA 2JA7B 3NUCA 2H5XA 4O7SA 1WTVA 5IYZF 4Q44A 4DV6H 1A62A 3HOWG 3FPUB 3U9SA 4POFA 4DV1L 5C4ZA 3PO3B 5C3EG 1DAAA 3CPFA 2HCCA 2W9AA 2BA1A 4JV0A 2XIWA 3KTMA 1ENFA 2XGPA 5K5PA 5DLQE 4EGVA 3P75A 2JA6H 2R82A 1BNZA 1TWAA 3GIMA 2F0GA 1JQYD 1ONLA 1TWCA 1PHJA 1EY5A 4BBRG 3HOVH 5KRUA 1FNVA 1PMRA 4DR3Q 1TWGH 2K05A 4LF4L 5IT9W 2F0WA 2XRSD 4P74A 1ESRA 3TIIA 4IAJA 1EZ6A 1K83H 5I4DA 1OWTA 3V6JA 1K3BC 4A3JB 1EL0A 4A3IB 2BQUA 4A76A 5C3XA 4N9PA 1GSOA 4PV1C 4DAVA 5KFUA 1PRTF 3QR8A 5H80A 3UE0A 1CSQA 1UNSA 2G9DA 1Y69U 2F4VH 3FVQA 1A2UA 4AYBB 2QCPX 2ICIA 2HCIA 3RGZA 1RD9D 5KFDA 4CJ1B 3NP8A 4ZYSA 2EZVA 1XMQH 2R7ZH 2UUBL 3T9FA 4P73A 4NP5A 4X65H 5KT2A 3T51B 2WB1A 4IR1A 1H9SB 2NTTA 2PZUA 3ER0A 3RBEA 3SGIA 4NXML 3NSWA 4OL7A 1TT2A 1XMOL 4RAZA 5JVDF 4JI7H 4K6NA 1ML0D 1IOWA 5C1OA 1ZHQA 4ED1A 1GD7A 2X69A 2PMZB 4LFAH 3HT5A 1XNRH 2Q8RE 4ECQA 1VQIA 1OXXK 2C2DA 2EVBA 4ZK9B 3CKIB 1WTWA 1QVFA 2SCUB 4WJWA 4S3SA 4I7HA 2I07B 2Z04A 3EFXD 4KLKA 3V05A 3M85A 3L0OA 1VQCA 1PK8A 2NVXH 1CS0A 4HN2A 1I3QB 1MHWC 4DV3H 3PV0A 2F52A 4Y52H 1HZCA 5J2TF 3NTHA 1EQTA 5EGTA 4QGUA 4DR7H 2I5MX 4IURA 1RODA 1M4VA 3S9WA 2FKLA 2L4NA 1KNEA 1D8LA 4KD3A 3A8KE 5A2QW 2JP1A 1S72A 3FPPA 4YHHH 1Y14B 4GKJL 3NEMA 5KG4A 5KFJA 1PXUA 3KLRA 3K0YA 4A3DG 2CWPA 5I9PA 3ULPA 4DV7L 3QOJA 3GTKB 1I6UA 4LUZA 4IUVA 1V1PB 5ELBA 1J8IA 2FPGB 1Q7YC 2E2HA 4U6PA 3L3OC 2ZTDA 1VMCA 3KLSX 3HOXB 1X3EA 2O5JC 1OXTA 3UDFA 3H20A 3EIVA 1GXDC 1PRTC 2A1AA 2MP1A 2WB1E 3ITPA 4DV1Q 3CQZH 4LFCQ 1ET0A 1GSHA 1LTSD 2VZAA 3CW2C 3K8AA 1NMFA 1FGUA 1Q46A 4JV1A 4YAKB 1Z9FA 5C4JB 4QSHA 1LTAD 3KAJA 5C0XI 1EKPA 2EY6A 3BACA 3LP8A 2TSSA 4NZMA 2K28A 4RMFA 4C56C 4OX9Q 4OWXB 1ET9A 5JEAH 4PBCA 5BWXA 5EAYA 3EPIA 2FB9A 4DUYL 1LACA 3HOUG 1PFBA 4O4IF 5JEAG 5T1IA 1RJPA 4HCSA 4M1UB 5KFMA 5KFBA 3I4MB 4PNYA 3Q23A 4BBSH 4IUUA 3PSIA 5IWAH 2VPQA 3SK8A 5EQ0A 2XNAC 5KKNB 2AWOA 2E2JB 2YZMA 1R4PB 1PRTB 4NPSA 2OWOA 1VBHA 1R9TA 1U4PA 2ZT9C 2ZJRA 4O4LF 1B70B 1IHZA 3K3PA 4B3TL 4JK1C 2KSWA 1IBML 4O3RA 1DV1A 2NB0A 2B2TC 4QY7A 5C44G 4E6NA 3CMAA 5BR8Q 3GV7B 1WCMB 4UCSA 5FNVF 2Z8LA 4LF4H 4NKLA 2FJZA 1U0LA 2VS1A 2K5NA 2KJXA 4XX0B 3LWUA 5HGTA 3MC0B 1XNQL 4X65L 3KLSA 5JVH3 4ECSA 3IL8A 1BBWA 3DHQA 3JZ6A 1KJJA 1BGWA 4X62L 1RKNA 2E5LQ 3RTXA 4QCLA 4IZ8A 1SCUB 2A68C 1KRTA 1LT5D 3RZDB 1Q82C 3OMGA 5GADC 1GHKA 4AH6A 5ISRA 3HXLA 3K7UC 1IBKQ 2J9GA 2X0SA 3JAMW 2XRQD 2GVAA 2WB1B 1EKVA 3ZYYX 2CNVA 1AFPA 2ID0A 3F2UA 4DV2L 2R85A 1L0YB 3GV6A 2DN8A 3KK7A 2VUMB 2NVTB 1HH2P 1B53A 4XXEA 2PN1A 3U0GA 2JA7A 2JA7G 3GTPA 3OTOQ 1CKOA 5I5UA 4J9PA 3IN5A 1NJIC 4FF2A 3T9BA 3CC7A 1Y1WB 3R2IA 4QB4A 4A3IG 5KG0A 2W6MA 4YR3A 1CK1A 1D1KA 3I70A 1A0GA 5C4XB 2NU6B 3VR3A 4DGZA 4JUZA 4AYBG 3DAAA 4RG1A 4MAMA 2ZM6H 4BWGB 1A0IA 4BBRB 1MZBA 1QILA 1S40A 1JE4A 4GN3B 2O03A 1RJRA 2F3VA 1FGBD 1KJ8A 2V4RA 1K9MC 3PQIA 3HS0C 4BWSC 1STEA 5EPJA 4HMJA 1RTOA 1LT4D 4L6TB 2VQEQ 3TRZA 5NUCA 1N48A 4B3SQ 1IYDA 3PR4A 4FFNA 2F0PA 2JA9A 3NBZB 1TWGB 2H4OA 1T94A 4AIMA 2PO4A 2UUCQ 4FF4A 2AQ4A 5F9LA 4ZCKA 3HEJA 4C3JG 3BQ1A 1UC8A 1ICWA 2F0DA 3OWFA 4ZKBB 5J22A 3VPBA 1LTTD 4DL7A 5FK9C 2R6FA 2JA6A 4JOIC 3DMUA 4UUGA 4IWYA 1V1QA 3RN2A 2RHSB 3TEHB 2PMZA 3VR6A 2VNUD 1TR5A 4KN4C 3S16H 3CRKC 2NN6I 2FHTA 4K0KL 4Z9CB 3F2BA 4AQYL 4QW9A 3FP9A 4RAYA 5FLXE 1EYCA 2W9CA 4CJ2C 1SE3A 5D3DA 2J6UA 2MPMA 4P2CB 2D0OA 2E2IB 2QA4A 3KHRA 1FL0A 2V9WA 4M0JA 2XC9A 4IUTA 4OIJA 2R92A 5AJ3L 3CCSA 3T5LA 2IBKA 2OQKA 1LV9A 2XCPA 3I7FA 2YU9B 2DWCA 5LA6F 4A3MG 2JEBI 2WDTA 2K75A 5FLMG 1DOKA 2CVRA 2KHSA 4R8NA 2GQRA 3DEPA 4IOAA 4C3IG 2F0NA 3SXHA 3T1HL 1N34H 2RF4A 1QZGA 5T14A 2RBMA 4DAPA 1ENAA 1PZKD 4GOPC 4QUCA 1VCIA 3SR1A 4FXKC 2UU9L 2ZDGA 3GTQB 3M9BA 3R5HA 5LL6S 1AZPA 2HDKA 4RNMA 1KTAA 3K5MA 4IWXA 4JI2L 4CMDA 1L1OA 4MTNA 3WWJA 1AUVA 2AGPA 4K2LA 2JA6G 4J0MA 3NUAA 1EY9A 5CAEB 4LF8H 2VL6A 1IXRA 4B3TH 4MHEA 3PIPA 5DQIA 2M9VA 3GTJH 4J9MA 1EUJA 5ELDA 3J80W 1LT6D 2ASDA 4N9TA 4R7RA 2DNEA 2NVYH 1SROA 1KC8C 1SYBA 4K6DA 1Q81C 1HRJA 1HQRD 3NXWA 3T9EA 1TWHH 1EU4A 3E6ZX 3IFTA 5ELFA 3S15H 3S16B 4P71A 3LQSA 1HNWH 4X66H 2Z0SA 3LNNA 4O83A 1B3QA 4RNNA 1VQEA 2BQRA 4UPAA 5C1PA 2EJ2A 2IP4A 4KN7C 3VYTA 4UP8A 1FJGQ 3MFIA 5J2UF 2EJ0A 3M9OB 2JQOA 4X3UA 1VQKA 1EYAA 4MN3A 3KHGA 3GV8B 2ODTX 3T1YH 1VQBA 2FPIB 3BVGA 1VQOA 4RUAA 4I65A 3KDFA 5DQGA 1J6QA 1EEFD 4DV5Q 3I4MG 1EYDA 2YYZA 5BWVA 4HJ5A 4O3PA 1RYRA 2A6EC 3VYRA 1DOMA 4RWSC 3DWAA 3S2DH 3NWSA 2E2IH 3CCMA 4BY7B 3V96A 3CQZB 1M7JA 1J5EQ 2Q2IA 1AN8A 2Z6BA 5C6AA 5L1JA 3EROA 1IL2A 3BA9A 1VMPA 4HMIA 4A4IA 3K6OA 5DM63 2BCOA 4JBKA 5IYCH 1WCMG 3JSNA 4E4TA 3CRLC 1IL8A 3AEVA 4LFCH 3OMCA 3FHWA 1WD1A 2CQYA 3R23A 1N36L 2PW5A 4A3KG 4Q43A 4C3HH 3KFUA 3EN2A 4M8AA 2Z02A 3SI8A 1S5DD 3KAKA 1E2VA 4CDCC 4QWEA 2GN5A 4LK1C 3I90A 3MWDA 4X66L 1D7QA 3HOWB 1W6JA 4LF8L 3J81L 4IFDJ 2KHJA 4L5TA 2VUGA 1PH8A 3OWEB 2W6ZA 1I50A 4IOCA 4HIKA 3GB8B 3QZ7A 4APVA 3GLKA 3J80c 3D4WA 2HUGA 5JOBA 2PYKA 3DM3A 2IX3A 2W6NA 2QW7A 3UZOA 1SNDA 2R7MA 4F4XA 4I50F 3CCQA 4G3IA 4BXXH 1N32H 4C2MB 3GIJA 1T36A 1QCBD 4HNUA 4DR5H 1QB5D 2K33A 4QMGA 2O2LD 2W8KA 5FPOA 4O7LA 5FO9B 4LF6L 3Q0AA 3H4DA 2AUJD 4PMWA 2AQ1B 4QWBA 4LF5Q 4HIOA 4U68A 3VOTA 3X3MA 1YEZA 2K01A 5K3WA 1ZEQX 1F9PA 4QL5A 5C0XH 1IW7D 1VAJA 1KAAA 2L0CA 3KLWA 3H15A 5LMUQ 4B9WA 2VQFL 4ILWA 1X54A 1V9PA 2UUAH 2WYOA 3VNNA 4BA1I 1KC7A 1RK5A 5HY6A 1NCVA 2BR0A 5IYBH 1T9HA 4CC5A 3T5HA 1YNNC 1AW7A 3C3LA 1AZQA 3GV3A 1E4EA 4GNXC 4CDEC 5GAHC 1STGA 2B2WC 2EJ3A 2FMAA 3OHAA 1Z47A 1KQSA 4LF5H 3A74A 3KXYT 1MSHA 2IW3A 1BKBA 2RDGA 4Y8VB 2MO1A 3RBDA 2VB3X 1SEIA 1V51A 3MAQA 1V43A 4DN4M 4GLVB 2UXBL 1B9NA 1CQJB 1U4LA 2IJ0A 2B3GA 1T5XD 3MWYW 3EQLC 1VQ8A 3VR4A 5CMDA 4NZNA 4HN7A 4I7ZC 1E2WA 5FD5A 4AYBA 1HNWL 3H40A 1I1LA 2Y4RA 3A56A 5C8YF 1KT8A 1KBLA 4C3IB 4Q0YA 2L55A 3J80L 1L0XB 1M1KC 3M9NB 1F2YA 3P1HA 3AU7A 4G7HC 4YAJB 2RSNA 3F8TA 1IBMQ 2YZNA 2ZJTA 1I50B 4ZRZA 1Y1VB 2COGA 3D6WA 2EY1A 4V190 1STHA 2D0PA 2LXJA 5IT9E 1F2MA 5J39A 5LMNQ 4KJNA 1LT3D 1SAPA 4DXFA 3R9RA 3KHHA 1EOVA 1TWCB 5FR9A 5CB4F 4FFLA 3MXNB 3T56B 3C2PA 2KCTA 5KG1A 4F4WA 3A8IE 2EYHA 2EPBA 1SYEA 2VUMA 1ILQA 1XNRQ 4O7YA 4DXGA 4ECYA 3UQ8A 1CUKA 3GTKH 2ZXOA 1OO9B 3BU2A 4LAAA 3M3YB 1E3PA 2PPBC 1HA6A 1K1SA 3CQZA 3U54A 3HKSA 2R87A 2B39A 2PZTA 4B3TQ 2NVQB 1XJVA 3S14B 3PO2H 4O42A 3RMHA 1BQQT 1PYWD 2XCAA 5KFSA 1CA5A 2BH2A 3TY8A 3H3VI 3PW7A 3QG1A 1WCMA 2AMCB 4PMBA 1CTMA 3VA5A 3I2ZA 4X64L 2A69C 1M0TA 4LF6Q 5JPMC 4X62Q 2VW9A 1WTXA 5JH7F 3E3XA 2XIGA 3U50C 1UE6A 2PI2A 3S1MH 4JW0A 1Z2NX 3J7AV 2HG8A 3M4PA 3U4ZA 4KKTA 2DPJA 1S4ZA 4CHIA 3J81W 3MR3A 2VQFQ 4BY7G 2NN6G 3UFXB 2DJGC 1TXYA 2DUDA 3AQQA 3RGXA 5I2YA 2I46A 2EIFA 5CORA 4B3SL 3RJ0A 4EFBA 2NN6H 3MVVA 5C44B 1UE5A 1EUDB 4DR6H 1LLRD 2F0LA 2ZM6L 2BQ3A 3V4SA 4EEQA 4H44C 4QW8A 4A3JH 4IUPA 3W1BA 5G3LD 3CCLA 2K50A 1TKWB 3T9AA 2HIXA 4IO9A 5EKIA 5KT3A 2LSSA 1HR0L 3KYHC 2UVWA 3LMLA 5KFHA 3NPPA 1CA6A 4J9OA 4JI5Q 2IA6A 3PO2B 4PZ7A 3RZDH 4NB3A 2RGRA 4ZI7F 3M9MB 1TVXA 4KKUA 2YS7A 3I55A 3A55A 3TW6A 1Z7TA 1PH2A 4UFZA 3EBEA 3I4NG 4K6LA 5BYAA 3EA6A 1W2BA 5FLMH 4A3GG 5FLXW 3X3NA 2CCZA 2EOTA 5IY0A 1ZYRD 5KFXA 4C3IH 3HO8A 3ERQA 2VUMG 3PF5A 2NVQH 4ECUA 1DM0B 1STAA 2R93A 2HHHH 3TP6A 3ETJA 1E0BA 3T4AC 2R92B 1WD0A 3AX6A 4UCVA 3GIIA 3GIKA 1ESFA 2B2YA 3HRZC 3H91A 4MNOA 2R93H 1KXLA 3GIDA 3A54A 3K5LA 1SR3A 1GLVA 3BYTB 4PDBA 4QQBX 1YZ6A 1YHAA 1MGSA 5IT9L 5EZYF 3RAQA 4XQNA 4ED3A 3Q22A 1TWAH 3T9DA 3I4OA 3D8GA 1EHIA 5KT7A 3PW0A 1BOSA 1GSAA 2EJMA 4O7NA 1Y8NB 4YJ3F 5KFEA 1YHBA 2EXZA 4U673 3HOYB 4GLWA 3I91A 2YV5A 2B63G 1XDNA 2IHFA 2JSOA 2R84A 2NZ1D 4YY3H 2DNCA 3OW7A 1TIID 1UEAB 2MUYA 2K5HA 1I6VC 4K5XA 4GKKH 4DR4L 1TS5A 2M2LA 3OHBA 1VQGA 2C00A 1I3QH 5KNDA 1EFWA 4A3LG 4A3CH 3TSSA 3BDCA 5G3LF 4XZ3B 1BXTA 5I9OA 3TREA 1KDBA 3L4JA 4GKKQ 5LOVF 4JXUA 5TSSA 4APMA 2VOBA 4LF8Q 4HYKA 2PQAB 3STBC 4YY3Q 4DUZQ 2F4VL 1EQQA 2YTXA 2NUAB 3FKIA 4POGA 2YRXA 1EWHA 2RDHA 1KDAA 1X65A 4OO1I 2MJ8A 4EG0A 3JAME 1TU2B 4HNVA 5C4HA 1AE3A 1GVPA 4H02A 2JEJA 1A3TA 3G6VA 1Y1VG 2EYMA 1JWMD 2AGOA 4FYDA 3VR2A 3DEOA 4EGJA 4IPHA 4FVMA 4DV7Q 2LKVA 1HNXH 1GJXA 2CW7A 2VY3A 2JA8B 3ORQA 2JA5A 4Q0FA 1HNZL 4A3EG 4ME5A 3TP7A 2LMCB 5E25A 3SK4A 5IWAQ 4DR5L 1II3A 1WOCA 3G4SA 1RL2A 4ZAIA 3DXJC 2B2VC 1NY4A 1H9RA 4DLKA 2R7FA 5KGUA 3ND9A 3N44B 4DQNA 5BWWA 5A2QL 3BS1A 1ENCA 1SE4A 5C3WA 4FXGC 3G6JB 3R8BA 4HJ8A 4NYEA 1K83B 2IPKD 1KUTA 4FFRA 3WO1A 4KKSA 4DNIA 2OF1A 2Q7DA 3D6CA 1GUWA 1EOTA 4O4HF 1A3VA 2MFIA 4CJ0B 1TWFA 4MV3A 1UAPA 4CKBA 5M5YH 3H3VC 4O2DA 1EIGA 2JA6B 4A3DH 4JYAH 5ELNA 3KJOA 4RA8A 5CV8A 4C2MA 4JI6H 4JI4Q 1HNWQ 4LMQD 3UZBA 2ABJA 2DIKA 2J6SA 2K32A 5GROA 1I94H 3S1QB 2JEAI 4JV5L 2B2WA 1QNUA 3OW2A 3M4QA 1HR0W 1R9TB 3H94A 4DAMA 4O7VA 4UAIA 3RB0A 4KHPH 1N8RC 2NBFA 1TAEA 3HKZE 5L9XA 4LNQA 5IGBA 4Y7NB 1HJPA 5KT6A 5GAEC 4DR1Q 3NTIA 1SNQA 2CW0C 1N36Q 5CE8A 4OX9H 4FS1A 3GO5A 4GOPA 4QJFA 2R7KA 4RUCA 5D1OB 2F03A 5DM73 2COIA 4EYHB 1K0RA 5LMNL 5M5XB 4ECVA 4CKEA 1QWYA 2L5TA 1XPUA 3Q8QB 2RVLA 1FVIA 2IT1A 3GTOA 1OBDA 2OT2A 3M4YA 1C0AA 4UCOA 1HQMC 2ZXPA 4LFAL 1VQPA 5E4XA 1I7LA 1G291 5M3MH 3H0GH 2HIVA 4OELB 4MV9A 4DUZH 1IOVA 1E4GT 3STBD 3I4NB 4GN5A 2W9BA 1ZXTA 3CCRA 5LXTF 1DJRD 3KOJA 5AFWA 4OGQC 1QVGA 3HB9A 3OUZA 2F3IA 1B7YB 5IGEA 3TMEA 5M3FG 4Q8FA 1EYGA 1JR0D 1HUMA 2IX0A 1N33H 1ZQ7A 1EY7A 2CQAA 4NZOA 3JAML 5K2MA 3QFFA 1PYSB 3S1NH 4DL5A 5L1IA 5JAVA 1QJOA 3TP8A 1HNZQ 3S17B 1SLJA 3U9TA 4J8QA 3T1HH 2FP4B 2B8GA 1TS2A 3TINA 5HBRB 1STNA 2PI2E 4IRKA 2L12A 3CCVA 4XIGS 2CW8A 1VS0A 1AN7A 2JYOA 4JC0A 1EIYB 1WTQA 1B8AA 1N33Q 3HOYG 3TW7A 1ET6A 3W5OA 5CC4A 5IODA 1V4YA 3M7NA 1PX2A 4LFCL 5KG7A 4ED7A 3JAMi 3K3VA 5M9OA 1HR0H 3HOYH 5M5XH 4DR2L 4JI0Q 5JJZA 5IP9H 1N34Q 3TQYA 1VF5C 1JCKB 1I5FA 2N49A 5IP9G 2P5ZX 4FBTA 3HOXH 4M9UA 4RNOA 2F0UA 2JEIA 4KD4A 3OHXC 2KUMA 3MXUA 4DA2A 5DLGA 2FPPB 2IWHA 1KL9A 2Y0SB 4ODGA 4Q4DA 2VA2A 1GUOA 3CP0A 4FXDA 1SYDA 5IGGA 2WKDA 4JI0H 1RTNA 4DNRB 2QYZA 1SYCA 3UI2A 4HIDA 3U4VA 4Q45A 3NTKA 1MBYA 1A2TA 3IRBA 2OTJA 1HXYD 4DR1L 4BY7H 2Q2HA 5EKKA 1A9XA 3JZIA 1RDPD 1T5EA 3T1YQ 4A3BG 4YWKA 5IOCA 4GNXB 2R6GA 3QJYA 4RHSA 2F4IA 5JUMA 2E5LH 3T1HQ 4A3BH 2YS6A 4L5QA 3S1RH 4F87A 2HVRA 1C48A 2D2CC 1TWAB 1BF4A 2EYJA 3GIPA 4YHHQ 3IG0A 3G6YA 4A75A 4HAEA 4DR3L 4LF4Q 1EEID 2K14A 4ZKCB 3PIP3 1TWGA 1CM9A 4YCVA 2GPWA 4NW2A 1SN8A 3A7LA 4JBJA 2ZJQA 2JE6I 1FNUA 3PW2A 5M3MB 3VPCA 2E2DC 3TN2A 4DKAC 4YB8B 2PBZA 4DR7Q 3PW5A 3T53B 2UVRA 4ECRA 1DCZA 1ICFB 1IBKL 5LMNW 1NBWA 1SNCA 4EQNA 2OTLA 1JE5A 1WH2A 2PNRC 2QILA 2NVTH 2VUMH 3K5HA 1KLGD 3S1MB 2C9OA 4C5AA 1KNAA 4KJOA 1JDBB 3Q8SB 2VQEH 4A93H 5IP7G 2FMMA 4G4KA 1I7NA 5D14A 2CFMA 1JORA 5FO8B 3K57A 2I80A 1PH7A 5JEAJ 4A93G 2WP8J 4LWCA 2IX1A 2XCLA 3CCEA 5DNFA 1TY0A 4LF9Q 2N88A 4NMZA 5EJWA 3I72A 3Q6SA 2A68D 2RCFA 5DG7A 1R9TH 2UU9Q 4DV2H 2HHHL 5DLFA 1S68A 2FLLA 2PQAA 3AFQA 3FEWX 1XMQQ 3N52A 2FINB 3MJFA 5EKLA 2YCHA 1HR0Q 3S17H 1DYQA 1I4HA 1QVCA 4OHJA 3Q8DA 2MCTA 1X3PA 3NE5B 4DV5H 5KYLA 3PVXA 3GTGB 1PH4A 1B04A 2FFKB 3DF7A 1TWHA 3NQTA 4KHZA 2OXPA 1C3OA 4K5WA 1B2TA 5KG2A 2QGQA 3J81i 1AH9A 5L37A 4J6HA 3F2CA 4LUVA 3K5OA 4IZOA 5CV9A 4AYBE 4R9WA 5KS8A 2V5AA 5BN3A 1JIHA 5I5YA 4DR4H 2A5HA 4ME3A 1LTRD 1YI2A 4F7XA 3VR5A 5KIXA 3PMFA 5KT5A 5KFYA 2WINB 4DPGA 2VQFH 3V2TA 2A74C 4JVZA 3KF8A 4A3GB 4LFBQ 3K80C 3R3OA 1BBUA 2K5DA 4DV4Q 4GC6A 1QG7A 2R92G 3C1FA 2ZGIA 5DGHA 4DUYH 3BZKA 4CGYB 2JEFA 1PTOD 5I5VA 3IKJA 2SNSA 3OSOA 1H95A 1JXLA 4A3EH 2VA3A 2E76C 3V4ZA 4DV6L 2ALYB 5CA0F 5IYCG 1JICA 5H1SE 4V0BA 4LF7Q 4X64H 4EYIB 5BR8L 2EYLA 4LH6A 1PTOB 1F9SA 1I94L 4HQ6A 5DQHA 5LL6b 2K52A 1S97A 5BN4A 1G6ZA 3D31A 1GUNA 2E74C 5T1GA 3NENA 3KHLA 4XQJA 2YTVA 2F0VA 4DV4H 1LO5D 4GC7A 2B2UC 4RGMA 1YNJD 5E1FA 2F0KA 5KFAA 1EZ8A 1I50H 3JRXA 3FMCA 1Q8IA 2N55A 1OXUA 4TV8F
chains in the Genus database with same CATH topology
5FJ8H 1N32Q 1E3PA 1KRSA 3GTOH 5DLQE 2JA6H 3JSLA 3N43B 1L1OB 1N34L 5DISC 3HKSA 1JJCB 3KDFB 4NXNL 4BBRG 1XJVA 1PHJA 4B3TQ 2Y0SG 3HOVH 4R4OA 4DR3Q 4LF4L 1TWGH 3PO2H 1G6PA 1X56A 3PUXA 5IT9W 1L2ZA 1VQFA 2AWNA 4P74A 2BH2A 4IAJA 3TY8A 1K83H 1QZHA 3H3VI 2R7DA 3CC2A 4BY1H 1UE1A 2UXBQ 4A2BA 2AMCB 4A76A 4X64L 3I2ZA 4HIMA 3OYYA 1CSQA 3UE0A 4YWMA 4DV3Q 1XNQQ 4K0KQ 1M0TA 4LF6Q 2F4VH 1GO3E 4X62Q 2VW9A 4X66Q 1PH3A 4L5RC 2XIGA 2D62A 3U50C 1UE6A 3CF5A 3RGZA 4UCUA 2B63H 2UUAL 2JA8H 3CAMA 4JI3L 2KENA 1CKNB 1MJCA 2PI2A 4IJLA 3S1MH 1XK5A 1S3OA 1Z2NX 1XMQH 3PCOB 1MKHA 3M4PA 4P73A 3U4ZA 5C4XH 4DV5L 2UUBL 2R7ZH 3T1YL 3HFZB 4X65H 3J81W 2VQFQ 1OTCA 4GS3A 5AJ3Q 2WB1G 3ER0A 1L2FA 2GVBA 3E9IA 2NN6G 3J80i 3VDYA 3SGIA 1TXYA 2DUDA 3AQQA 1Y1WH 4P72A 1M90C 4NXML 4A3CG 4UP9A 4B3RL 2WDTA 3RGXA 2EIFA 1XMOL 1VQ9A 3FKIG 4B3SL 4KHPL 4EFBA 4RAZA 1YITA 1ZHQA 2VPSA 3RJ0A 4KI0A 4JI7H 1UE5A 4DR6H 1GD7A 2PMZE 5M3MG 1J5EL 2MO0A 2ZM6L 4EFEA 4JV5H 4EEQA 4LFAH 4JI4L 1QUQA 1Q1EA 3PUYA 4A3JH 3W1BA 3CCLA 4IPCA 3HOZG 1XNRH 4OX9L 2K50A 1VQIA 1OXXK 2IHEA 2HIXA 4IO9A 2LSSA 1HR0L 3KYHC 1QVFA 3LMLA 4I7HA 2KBNA 3M85A 4KLKA 4DUYQ 1XPRA 3L0OA 4JI5Q 1VQCA 4LFAQ 3PUWA 1CKNA 2XTIA 4PZ7A 3RZDH 4NB3A 2NVXH 3CC4A 4JV5Q 3M4OH 2RGRA 3F1ZA 5C44H 4DV3H 1Y1VH 2F52A 3PV0A 1HZCA 1NTGA 3I55A 1WI5A 5M3FH 3A5ZB 4Y52H 2WAQE 1K73C 1PH2A 4QGUA 4UFZA 3EBEA 3I4NG 4DR7H 2I5MX 1W2BA 5FLMH 4A3GG 5FLXW 1YBYA 4LF9H 4GNXA 2CCZA 5IY0A 4MV9A 1X9NA 4C3IH 1YIJA 4IJHA 1PA6A 4DUZH 1D8LA 2VUMG 3PF5A 4JI6L 5A2QW 2NVQH 1S72A 2JA7H 4R1JA 1Y14B 1ZHSA 4GKJL 4YHHH 2HHHH 3NEMA 4NXNH 4A3DG 2CWPA 4RB3C 4UCVA 1YNXA 4DV7L 2Z6KA 4O0AA 3UDGA 3ULPA 1MIUA 1XNQH 4TVAB 4MNOA 1NE3A 2R93H 4LUZA 4X6AH 4R4TA 1G51A 1SR3A 1KXLA 2K5VA 2HHHQ 1UWVA 1Q7YC 4PZ8A 4PDBA 2ZTDA 1OXSC 1X3EA 3F2DA 4JYAL 1O7IA 1YZ6A 1YHAA 2B29A 4QQBX 1OXTA 3UDFA 4UY8C 3UE1A 3GJXB 2W57A 3EIVA 3H20A 4YCWA 4DV1Q 2A1AA 2WB1E 4LSAA 1TWAH 3CQZH 3I4OA 4LFCQ 3GTLH 3K8AA 2VZAA 3CW2C 3S2HH 3N6XA 1FJGH 1NMFA 1VQLA 1FGUA 1Q46A 1YHBA 5GAGC 4B3RQ 4LMYA 1A8VA 2YV5A 2N8NA 1Z9FA 2B63G 1X6OA 2IHFA 1HNXL 1XDNA 1J5EH 4YY3H 3CPWA 3KAJA 5C0XI 2LXKA 1QUQB 1GM5A 2K5HA 2IY5B 5LMUH 4GKKH 4RMFA 4OX9Q 3PO3H 4DR4L 4OWXB 1VQGA 5JJIA 5IYDH 5FPRA 1I3QH 3BZCA 1EFWA 4LF9L 5EAYA 1FKAH 4DUYL 3HOUG 4A3LG 4A3CH 1VQ5A 4C3JH 1PH5A 5JEAG 5IYDG 2UXCL 4LH7A 3TREA 3BJUA 4JBWA 4JI7Q 3L4JA 4GKKQ 3CD6A 4BBSH 5LMNH 2Y0SE 4APMA 1UE7A 3I56A 3PSIA 2VOBA 5IWAH 4LF8Q 3GTGH 3N41B 2AWOA 2PQAB 2C35B 3STBC 4YY3Q 4DUZQ 2YTXA 1EQQA 1HZ9A 4IPDA 4NPSA 2OWOA 4POGA 3KALA 1IBMH 1X65A 4P75A 2ZJRA 4OO1I 4DR2H 1B70B 4ETSA 1AE3A 1LYLA 2HQLA 4JI8L 1GVPA 2RCNA 3ERSX 4H02A 1XMQL 1PH1A 1IYJB 1IBML 4B3TL 2KSWA 3FKIH 3LGJA 1HZBA 4QY7A 5C44G 1Y1VG 4E6NA 2E8GA 3CMAA 5BR8Q 2BA0A 1Q1BA 4UCSA 1LM0A 3CCUA 1JT8A 2QEXA 2HGSA 4A3JG 4LF4H 1LUZA 4IPHA 4DV7Q 1U0LA 2VS1A 4DR2Q 4JI0L 4A3GH 1HNXH 2K5NA 2CW7A 2VY3A 5FD6A 1NMGA 1HNZL 4A3EG 5M5WH 1XNQL 4X65L 4YWLA 5IWAQ 4DR5L 3L4KA 1VQAA 3PN1A 1BBWA 3PUZA 1WOCA 3G4SA 1RL2A 3ZJYC 3PUVA 4X62L 4BA2I 1BGWA 2E5LQ 4R4IA 1NY4A 2HVQA 1E22A 3RTXA 3RLFA 2R7FA 3TY9A 1KRTA 4YHHL 3N44B 1Q82C 3RZOH 4R4CA 3E9HA 5GADC 1X3GA 4AH6A 1TWFH 1IBLQ 1E1TA 2UUBQ 3K7UC 4HJ8A 5C0XJ 1IBKQ 2R93G 3HXLA 2GVAA 1K3RA 3JAMW 4AQYQ 3GTPH 4DNIA 1O75A 1AE2A 4A3MH 3L7ZC 2ID0A 4DV2L 5ELOA 1CSPA 1MJEA 1VQ7A 2MFIA 4JCVE 3HOWH 4DR7L 1HH2P 4X62H 4DV7H 5D1PA 4JI8H 2JA7G 5M5YH 1N32L 4O2DA 1CKOA 4JG2A 3OTOQ 1Q8KA 4IFDG 5D1OA 2ASBA 1NJIC 4A3DH 4JYAH 3B6YA 5ELNA 3KJOA 3CC7A 4JI6H 1P16A 3G48A 4JI4Q 1HNWQ 4A3IG 4JI5H 2I5HA 2FXQA 4QIWE 3RR5A 2EXDA 3NBYB 4BBRH 2ZTEA 5GROA 3HOVG 3CVZA 3S1QH 1I94H 2UUCH 4AYBG 4RG1A 2JEAI 4JV5L 2ZM6H 4X64Q 4LF7H 1A0IA 3OW2A 3BA8A 3M4QA 1N9WA 4DR6Q 1MZBA 1HR0W 4DAMA 1S40A 1XMOH 4B3SH 4GN3B 4TQUS 2O03A 1N8RC 4KHPH 1EWIA 4A3LH 1TAEA 3HKZE 2NZHA 1GYFA 1XPOA 1KIXA 1C9OA 1K9MC 3J81j 4LNQA 4BWSC 1HJPA 3AYHB 5GAEC 4DR1Q 1M0WA 1N36Q 4OX9H 4BBSG 3GO5A 4GOPA 3TRZA 2VQEQ 4QJFA 3BABA 3E0EA 4JI2Q 1XMOQ 4B3SQ 4KHPQ 3CCJA 1YJWA 4LFBH 3HOXG 5D1OB 2JA8G 2JA9A 4GN4B 3J81c 2N78A 4J15A 1EQRA 2ZM6Q 3NBZB 4JI1L 1K0RA 4AIMA 5E7NA 5LMNL 1I94Q 2UUCQ 2R7ZG 3S14H 5IWAL 4DR5Q 4DK6C 4DK3C 4B3MQ 2KCMA 1IZ6A 2A19A 4XTCS 2PNHA 1XPUA 4JI1H 3KF6A 1FVIA 2IT1A 4Y7NH 1Y1WG 3M3YH 4LUOA 2UXDL 4LF7L 4JOIC 1C0AA 4UCOA 4LFAL 1V1QA 3L2PA 3RN2A 2BH8A 2RHSB 1P8LA 3TEHB 1VQPA 4JYAQ 2VNUD 1G291 4R4QA 3S16H 5M3MH 2NN6I 2HIVA 3H0GH 4K0KL 1W3SA 3F2BA 3GTQH 3NC0B 4JI5L 1VQJA 2CKZB 3FP9A 4AQYL 4BY7G 1VQMA 1E4GT 1OXVA 2DGYA 3STBD 3A5UA 4HJ9A 4GN5A 3HOZH 1JMCA 1WCMH 3CCRA 4RAYA 2UUAQ 2D0OA 3KOJA 2QA4A 4LFBL 1TWCH 1QVGA 2UXCH 1FJGL 1FL0A 1VQNA 4A3KH 1A63A 2F3IA 4JOIA 2L15A 1B7YB 3KF8B 4EX5A 4DV0H 5AJ3L 3CCSA 3J7A5 2RHQB 2OQKA 5M3FG 1EYGA 3I7FA 2YU9H 1E1OA 2IX0A 4NXMQ 4RB2C 1N33H 4A3MG 1LTLA 2JEBI 3JC66 4WJ4A 1WFQA 1UEBA 2K75A 3PGZA 5FLMG 3DLLA 5LMUL 3GTMH 3W1GA 1PYSB 3S1NH 2ZTCA 4IOAA 3G6EA 3D0FA 3J7ZC 3T1HL 1HNZQ 1N34H 1PYBA 2RF4A 1QZGA 1TA8A 3WWVA 2OCEA 1SLJA 4OXPA 3A0JA 4GOPC 1VCIA 4LSXA 3T1HH 2UU9L 2PI2E 1YVCA 3CCVA 3M9BA 1YHQA 4UP7A 4XIGS 2CW8A 1VS0A 1WYDA 1AN7A 4DV1H 4GKJH 4HJ7A 3BAAA 1KAWA 4JC0A 1EIYB 1B8AA 1N33Q 3HOYG 1VQ4A 4JI2L 3W5OA 1I6HH 1L1OA 4MTNA 5FJ8G 1N36H 3M7NA 3JAMc 4LFCL 2JA6G 4DV0L 4J0MA 3JAMi 4A2AA 3K3VA 4LF8H 3ULLA 2VL6A 1HR0H 3HOYH 1IXRA 4JI1Q 5IP7H 3FMAA 4B3TH 2Z6KC 3PIPA 3UDIA 1Q12A 5M5XH 4DR2L 4JI0Q 3GTJH 5IP9H 1EUJA 3J80W 1N34Q 3AFPA 3TQYA 1IBKH 1HNZH 3H3VH 4R7RA 4BXXG 2NVYH 1HNXQ 1I5FA 1SROA 2N49A 5IP9G 1Z2OX 2ATWA 2NZOA 1KC8C 1K8AC 3HOXH 1Q81C 2ZJPA 4DR4Q 1HZAA 1TWHH 3S15H 5IYBG 1E24A 3NELA 4P71A 4DV6Q 1KL9A 1HNWH 4X66H 3ULJA 4JI6Q 2UXDH 2KHIA 2Z0SA 3CP0A 4FM9A 3RN5A 2HT1A 1VQEA 4RZQA 4DR6L 4DV3L 1PH9A 4GKKL 3HOUH 4UPAA 5C0XG 4JI7L 1VQHA 4JI0H 1I6UA 4UP8A 4HIDA 1FJGQ 4RB1A 3U4VA 4LW1A 3EYYA 1RIPA 4YY3L 1BVSA 3IRBA 5C4XG 2OTJA 2JQOA 1SMXA 1VQKA 3H0GG 3UDXA 4DR1L 4BY7H 2Q2HA 3T1YH 1VQBA 1VQOA 1SFOH 2F4VL 3KDFA 4LF5L 4C2MH 4DR3H 3T1YQ 1J6QA 4A3BG 4DV5Q 3I4MG 3G71A 2YYZA 3TS0A 2FE3A 1C7YA 4HJ5A 5EOYA 4YWKA 3K0XA 4GNXB 2R6GA 2E5LH 4JI3Q 3T1HQ 4A3BH 3MEFA 4L5QA 3K7AH 3S1RH 2E5LL 3S2DH 2HVRA 2E2IH 3CCMA 4YCUA 1GKHA 3F8NA 3RLOA 2Q2IA 1J5EQ 5HGQA 4YHHQ 2CQOA 4A75A 3IG0A 1X55A 4X65Q 3RNUA 4DR3L 4LF4Q 2K14A 1IL2A 3BA9A 4A4IA 1CKMA 4YCVA 4JBKA 5IYCH 1WCMG 1SN8A 4JBJA 4HJAA 2ZJQA 2JE6I 2MNAA 3JSNA 1S03G 3AEVA 4K0KH 4LFCH 4DKAC 3FHWA 3KF6B 1ASZA 4MTDA 1X3FA 1N36L 4DR7Q 4GOPB 4A3KG 4IPGA 1L0WA 4C3HH 2R92H 3KFUA 4LF6H 4FDBA 3EN2A 1IBKL 5LMNW 3KAKA 1NBWA 2OTLA 2GN5A 1JB7A 4OWWB 1JE5A 4X66L 1D7QA 1WH2A 2NVTH 2VUMH 5JJKA 3RLNA 4LF8L 5FLXc 4IFDJ 3QWUA 5GQOA 2KHJA 4L5TA 2VUGA 1PH8A 1XTDA 5C3EH 2YTYA 2N3SA 3C0FB 4IOCA 4JI2H 4HIKA 5IE8A 4DV4L 4A93H 3GB8B 4APVA 4CC6A 3K81C 2VQEH 4JI8Q 5IP7G 4GKJQ 3J80c 2CFMA 3DM3A 3S24A 1PH7A 5JEAJ 4A93G 3OTOH 2WP8J 4LWCA 2IX1A 4DAYB 3CCEA 3CCQA 4BXXH 1N32H 4B3MH 2E2JH 4LF9Q 2XGTA 3N42B 4A3IH 4DR5H 2AHOB 1R9TH 2UU9Q 2K4KA 3DF7A 2UXCQ 2HHHL 4DV2H 1S68A 2I5LX 5FPOA 4OONA 2JA5H 4M7EA 2PQAA 4LF6L 3AFQA 1XMQQ 2HVSA 4PMWA 3U58A 3GDEA 4LF5Q 4HIOA 1Q86C 2YCHA 1HR0Q 4NXMH 3S17H 1U5KA 2JA5G 1YEZA 2CWAA 3ICEA 4UCRA 1SYXB 1QVCA 2MCTA 3Q8DA 4DV0Q 4QL5A 4MV7A 4DV5H 1YJ9A 1DGSA 2AKWB 3PIOA 1KHIA 1YJNA 1XNRL 3PO2G 1PH4A 1B04A 3KLWA 3H15A 5LMUQ 2V1CC 2VQFL 1BJTA 2JK8A 1X54A 1V9PA 5C4JH 1PH6A 3PO3G 2WYOA 4KHZA 4BA1I 3VNNA 1E4FT 5HY6A 4ALPA 5IYBH 1ASYA 1T9HA 3HKZG 4CC5A 4A3FH 2UXBH 3KJPA 3N40P 4B3RH 2Q2TA 2QGQA 3J81i 1AH9A 3I4MH 4WJ3M 5K36G 4AQYH 3F2CA 4LUVA 4GNXC 1IBLH 3M4IA 4A3FG 4NXNQ 5GAHC 4JBMA 4AYBE 4OO1G 4JI4H 1Z47A 1KQSA 4LF5H 3A74A 1IBLL 3KXYT 1EIFA 1BKBA 2WAQG 5JJLA 2MO1A 4DR4H 1SEIA 4GLXA 1JJ2A 3RIZA 4ME3A 1V43A 2UXBL 4GLVB 4DR1H 1YI2A 1VQ6A 2MQHA 4PG3A 1WJJA 5J3BA 4BY1G 4DUZL 2F4VQ 4DPGA 1KD1C 2VQFH 3NBHB 2B3GA 2E2HH 3RF2A 3GD7A 3CXCA 3CMEA 1K8GA 1VQ8A 4LFBQ 2UUBH 3TS2A 3K80C 1E7ZA 5FD5A 1BBUA 4DV4Q 3PF4A 1HNWL 4UCTA 4JI3H 2R92G 4DUYH 2JJQA 3BZKA 1VQDA 4Q0YA 1L1OC 1M1KC 4GLAC 3OTOL 1H95A 2WE6A 2RGVA 4A3EH 4RB0A 4L5SA 4DV6L 2OQ0A 3F8TA 2ALYB 1IBMQ 1PVOA 5IYCG 4DRFA 2ZJTA 5IT9c 5H1SE 4LF7Q 4EQ5A 1PFSA 1PV4A 5BR8L 4LH6A 4X64H 2D0PA 2LXJA 5LMNQ 2EQSA 1SE8A 4PZ6A 1I94L 2UUCL 2K52A 1JJGA 1Z2PX 1EOVA 4MTEA 5LL6b 4B3ML 4MZ9A 3D31A 2Q2UA 5BR8H 3MXNB 3NENA 2A8VA 3MWMA 2YTVA 2KCTA 1SRUA 2I0QA 4IFDI 2UXDQ 3J7AK 2VQEL 4DV4H 3I4NH 2H5XA 4DV6H 2UUAH 1A62A 3HOWG 1XNRQ 4OWTB 4POFA 4DV1L 2WFWA 1N33L 3TY5A 3UQ8A 1I50H 5C3EG 4DV2Q 3CPFA 2UU9H 1CUKA 2BA1A 3GTKH 1OXUA 2ES2A 3BU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 H;  1N32 Q;  1E3P A;  1KRS A;  3GTO H;  5DLQ E;  2JA6 H;  3JSL A;  1L1O B;  1N34 L;  5DIS C;  3HKS A;  1JJC B;  3KDF B;  4NXN L;  4BBR G;  1XJV A;  1PHJ A;  4B3T Q;  2Y0S G;  3HOV H;  4R4O A;  4DR3 Q;  4LF4 L;  1TWG H;  3PO2 H;  1G6P A;  1X56 A;  3PUX A;  1VQF A;  2AWN A;  4P74 A;  2BH2 A;  3TY8 A;  1K83 H;  1QZH A;  3H3V I;  2R7D A;  3CC2 A;  4BY1 H;  1UE1 A;  2UXB Q;  2AMC B;  4A76 A;  4X64 L;  3I2Z A;  4HIM A;  3OYY A;  1CSQ A;  3UE0 A;  4YWM A;  4DV3 Q;  1XNQ Q;  4K0K Q;  4LF6 Q;  1GO3 E;  4X62 Q;  2VW9 A;  4X66 Q;  1PH3 A;  4L5R C;  2D62 A;  3U50 C;  1UE6 A;  3CF5 A;  4UCU A;  2B63 H;  2UUA L;  2JA8 H;  3CAM A;  4JI3 L;  2KEN A;  1CKN B;  1MJC A;  2PI2 A;  4IJL A;  3S1M H;  1XK5 A;  1S3O A;  3PCO B;  1MKH A;  3M4P A;  4P73 A;  3U4Z A;  5C4X H;  4DV5 L;  2UUB L;  2R7Z H;  3T1Y L;  3HFZ B;  2VQF Q;  1OTC A;  4GS3 A;  5AJ3 Q;  2WB1 G;  3ER0 A;  1L2F A;  2GVB A;  3E9I A;  2NN6 G;  3J80 i;  3VDY A;  3SGI A;  1TXY A;  2DUD A;  3AQQ A;  1Y1W H;  4P72 A;  1M90 C;  4NXM L;  4A3C G;  4UP9 A;  4B3R L;  2EIF A;  1XMO L;  1VQ9 A;  3FKI G;  4B3S L;  4KHP L;  4EFB A;  1YIT A;  4KI0 A;  1UE5 A;  1GD7 A;  2PMZ E;  5M3M G;  1J5E L;  2MO0 A;  2ZM6 L;  4EFE A;  4EEQ A;  4JI4 L;  1QUQ A;  1Q1E A;  3PUY A;  4A3J H;  3W1B A;  3CCL A;  4IPC A;  3HOZ G;  4OX9 L;  2K50 A;  1VQI A;  1OXX K;  2IHE A;  2HIX A;  4IO9 A;  2LSS A;  1HR0 L;  3KYH C;  1QVF A;  2KBN A;  3M85 A;  4KLK A;  4DUY Q;  1XPR A;  3L0O A;  4JI5 Q;  1VQC A;  4LFA Q;  3PUW A;  1CKN A;  2XTI A;  4PZ7 A;  3RZD H;  4NB3 A;  2NVX H;  3CC4 A;  4JV5 Q;  3M4O H;  3F1Z A;  5C44 H;  1Y1V H;  2F52 A;  3PV0 A;  1HZC A;  1NTG A;  3I55 A;  1WI5 A;  5M3F H;  3A5Z B;  4Y52 H;  2WAQ E;  1K73 C;  1PH2 A;  4QGU A;  4UFZ A;  3EBE A;  3I4N G;  2I5M X;  1W2B A;  5FLM H;  4A3G G;  1YBY A;  4GNX A;  2CCZ A;  5IY0 A;  1X9N A;  4C3I H;  1YIJ A;  4IJH A;  1PA6 A;  1D8L A;  2VUM G;  3PF5 A;  4JI6 L;  2NVQ H;  1S72 A;  2JA7 H;  4R1J A;  1Y14 B;  4GKJ L;  3NEM A;  4A3D G;  2CWP A;  4UCV A;  1YNX A;  4DV7 L;  2Z6K A;  4O0A A;  3UDG A;  3ULP A;  1MIU A;  4TVA B;  4MNO A;  1NE3 A;  2R93 H;  4LUZ A;  4X6A H;  4R4T A;  1G51 A;  1SR3 A;  1KXL A;  2K5V A;  2HHH Q;  1UWV A;  1Q7Y C;  4PZ8 A;  2ZTD A;  1OXS C;  1X3E A;  3F2D A;  4JYA L;  1O7I A;  1YZ6 A;  1YHA A;  2B29 A;  4QQB X;  1OXT A;  3UDF A;  4UY8 C;  3UE1 A;  3GJX B;  3EIV A;  4YCW A;  4DV1 Q;  2A1A A;  2WB1 E;  1TWA H;  3CQZ H;  3I4O A;  4LFC Q;  3GTL H;  3K8A A;  2VZA A;  3CW2 C;  3S2H H;  1NMF A;  1VQL A;  1FGU A;  1Q46 A;  1YHB A;  5GAG C;  4B3R Q;  1A8V A;  2YV5 A;  2N8N A;  1Z9F A;  2B63 G;  1X6O A;  2IHF A;  1HNX L;  1XDN A;  3CPW A;  5C0X I;  2LXK A;  1QUQ B;  1GM5 A;  2K5H A;  2IY5 B;  4RMF A;  4OX9 Q;  3PO3 H;  4DR4 L;  4OWX B;  1VQG A;  5JJI A;  5IYD H;  5FPR A;  1I3Q H;  3BZC A;  1EFW A;  4LF9 L;  5EAY A;  4DUY L;  3HOU G;  4A3L G;  4A3C H;  1VQ5 A;  4C3J H;  1PH5 A;  5JEA G;  5IYD G;  2UXC L;  4LH7 A;  3TRE A;  3BJU A;  4JBW A;  4JI7 Q;  4GKK Q;  3CD6 A;  4BBS H;  2Y0S E;  1UE7 A;  3I56 A;  3PSI A;  4LF8 Q;  3GTG H;  2AWO A;  2PQA B;  2C35 B;  3STB C;  4YY3 Q;  4DUZ Q;  2YTX A;  1EQQ A;  1HZ9 A;  4IPD A;  4NPS A;  2OWO A;  4POG A;  1X65 A;  4P75 A;  2ZJR A;  4OO1 I;  1B70 B;  1AE3 A;  1LYL A;  2HQL A;  4JI8 L;  1GVP A;  2RCN A;  3ERS X;  4H02 A;  1XMQ L;  1PH1 A;  1IYJ B;  1IBM L;  4B3T L;  3FKI H;  3LGJ A;  1HZB A;  4QY7 A;  5C44 G;  1Y1V G;  4E6N A;  2E8G A;  3CMA A;  5BR8 Q;  2BA0 A;  1Q1B A;  4UCS A;  1LM0 A;  3CCU A;  1JT8 A;  2QEX A;  4A3J G;  1LUZ A;  4IPH A;  4DV7 Q;  1U0L A;  2VS1 A;  4DR2 Q;  4JI0 L;  4A3G H;  2K5N A;  2VY3 A;  1NMG A;  1HNZ L;  4A3E G;  5M5W H;  1XNQ L;  4X65 L;  4YWL A;  5IWA Q;  4DR5 L;  1VQA A;  3PN1 A;  1BBW A;  3PUZ A;  1WOC A;  3G4S A;  1RL2 A;  3ZJY C;  3PUV A;  4X62 L;  4BA2 I;  2E5L Q;  4R4I A;  1NY4 A;  2HVQ A;  1E22 A;  3RTX A;  3RLF A;  2R7F A;  3TY9 A;  1KRT A;  4YHH L;  1Q82 C;  3RZO H;  4R4C A;  3E9H A;  5GAD C;  1X3G A;  4AH6 A;  1TWF H;  1IBL Q;  1E1T A;  2UUB Q;  3K7U C;  4HJ8 A;  5C0X J;  1IBK Q;  2R93 G;  2GVA A;  1K3R A;  4AQY Q;  3GTP H;  4DNI A;  1AE2 A;  4A3M H;  3L7Z C;  2ID0 A;  4DV2 L;  5ELO A;  1CSP A;  1MJE A;  1VQ7 A;  2MFI A;  4JCV E;  3HOW H;  4DR7 L;  1HH2 P;  5D1P A;  2JA7 G;  5M5Y H;  1N32 L;  4O2D A;  1CKO A;  4JG2 A;  3OTO Q;  1Q8K A;  4IFD G;  5D1O A;  2ASB A;  1NJI C;  4A3D H;  3B6Y A;  5ELN A;  3KJO A;  3CC7 A;  1P16 A;  3G48 A;  4JI4 Q;  1HNW Q;  4A3I G;  2I5H A;  2FXQ A;  4QIW E;  3RR5 A;  2EXD A;  3NBY B;  4BBR H;  2ZTE A;  5GRO A;  3HOV G;  3S1Q H;  4AYB G;  4RG1 A;  2JEA I;  4JV5 L;  4X64 Q;  1A0I A;  3OW2 A;  3BA8 A;  3M4Q A;  1N9W A;  4DR6 Q;  1HR0 W;  4DAM A;  1S40 A;  4GN3 B;  4TQU S;  1N8R C;  1EWI A;  4A3L H;  1TAE A;  3HKZ E;  2NZH A;  1XPO A;  1KIX A;  1C9O A;  1K9M C;  3J81 j;  4LNQ A;  1HJP A;  3AYH B;  5GAE C;  4DR1 Q;  1N36 Q;  4BBS G;  3GO5 A;  4GOP A;  3TRZ A;  2VQE Q;  4QJF A;  3BAB A;  3E0E A;  4JI2 Q;  1XMO Q;  4B3S Q;  4KHP Q;  3CCJ A;  1YJW A;  3HOX G;  5D1O B;  2JA8 G;  2JA9 A;  4GN4 B;  3J81 c;  2N78 A;  4J15 A;  1EQR A;  2ZM6 Q;  3NBZ B;  4JI1 L;  1K0R A;  4AIM A;  5E7N A;  5LMN L;  1I94 Q;  2UUC Q;  2R7Z G;  3S14 H;  5IWA L;  4DR5 Q;  4DK6 C;  4DK3 C;  4B3M Q;  2KCM A;  1IZ6 A;  2A19 A;  4XTC S;  2PNH A;  1XPU A;  3KF6 A;  1FVI A;  2IT1 A;  4Y7N H;  1Y1W G;  3M3Y H;  4LUO A;  2UXD L;  4LF7 L;  4JOI C;  1C0A A;  4UCO A;  4LFA L;  1V1Q A;  3L2P A;  3RN2 A;  2BH8 A;  2RHS B;  1P8L A;  3TEH B;  1VQP A;  4JYA Q;  2VNU D;  1G29 1;  4R4Q A;  3S16 H;  5M3M H;  2NN6 I;  2HIV A;  3H0G H;  4K0K L;  1W3S A;  3F2B A;  3GTQ H;  3NC0 B;  4JI5 L;  1VQJ A;  2CKZ B;  3FP9 A;  4AQY L;  4BY7 G;  1VQM A;  1OXV A;  2DGY A;  3STB D;  3A5U A;  4HJ9 A;  4GN5 A;  3HOZ H;  1JMC A;  1WCM H;  3CCR A;  2UUA Q;  2D0O A;  3KOJ A;  2QA4 A;  4LFB L;  1TWC H;  1QVG A;  1FJG L;  1FL0 A;  1VQN A;  4A3K H;  1A63 A;  2F3I A;  4JOI A;  2L15 A;  1B7Y B;  3KF8 B;  4EX5 A;  5AJ3 L;  3CCS A;  3J7A 5;  2RHQ B;  2OQK A;  5M3F G;  1EYG A;  3I7F A;  2YU9 H;  1E1O A;  2IX0 A;  4NXM Q;  4A3M G;  1LTL A;  2JEB I;  3JC6 6;  4WJ4 A;  1WFQ A;  1UEB A;  2K75 A;  3PGZ A;  5FLM G;  3DLL A;  5LMU L;  3GTM H;  3W1G A;  1PYS B;  3S1N H;  2ZTC A;  4IOA A;  3G6E A;  3D0F A;  3J7Z C;  3T1H L;  1HNZ Q;  1PYB A;  2RF4 A;  1QZG A;  1TA8 A;  3WWV A;  2OCE A;  1SLJ A;  4OXP A;  3A0J A;  4GOP C;  1VCI A;  2UU9 L;  2PI2 E;  1YVC A;  3CCV A;  3M9B A;  1YHQ A;  4UP7 A;  4XIG S;  1VS0 A;  1WYD A;  4HJ7 A;  3BAA A;  1KAW A;  4JC0 A;  1EIY B;  1B8A A;  1N33 Q;  3HOY G;  1VQ4 A;  4JI2 L;  3W5O A;  1I6H H;  1L1O A;  4MTN A;  5FJ8 G;  3M7N A;  3JAM c;  4LFC L;  2JA6 G;  4DV0 L;  3JAM i;  3ULL A;  2VL6 A;  3HOY H;  1IXR A;  4JI1 Q;  5IP7 H;  2Z6K C;  3PIP A;  3UDI A;  1Q12 A;  5M5X H;  4DR2 L;  4JI0 Q;  3GTJ H;  5IP9 H;  1EUJ A;  1N34 Q;  3AFP A;  3TQY A;  3H3V H;  4BXX G;  2NVY H;  1HNX Q;  1I5F A;  1SRO A;  2N49 A;  5IP9 G;  2ATW A;  2NZO A;  1KC8 C;  1K8A C;  3HOX H;  1Q81 C;  2ZJP A;  4DR4 Q;  1HZA A;  1TWH H;  3S15 H;  5IYB G;  1E24 A;  3NEL A;  4P71 A;  4DV6 Q;  1KL9 A;  3ULJ A;  4JI6 Q;  2KHI A;  2Z0S A;  3CP0 A;  3RN5 A;  2HT1 A;  1VQE A;  4DR6 L;  4DV3 L;  1PH9 A;  4GKK L;  3HOU H;  4UPA A;  5C0X G;  4JI7 L;  1VQH A;  4UP8 A;  4HID A;  1FJG Q;  3U4V A;  4LW1 A;  1RIP A;  4YY3 L;  1BVS A;  3IRB A;  5C4X G;  2OTJ A;  2JQO A;  1SMX A;  1VQK A;  3H0G G;  3UDX A;  4DR1 L;  4BY7 H;  2Q2H A;  1VQB A;  1VQO A;  1SFO H;  2F4V L;  3KDF A;  4LF5 L;  4C2M H;  3T1Y Q;  1J6Q A;  4A3B G;  4DV5 Q;  3I4M G;  3G71 A;  2YYZ A;  3TS0 A;  1C7Y A;  4HJ5 A;  4YWK A;  3K0X A;  4GNX B;  2R6G A;  4JI3 Q;  3T1H Q;  4A3B H;  3MEF A;  4L5Q A;  3K7A H;  3S1R H;  2E5L L;  3S2D H;  2HVR A;  2E2I H;  3CCM A;  4YCU A;  1GKH A;  3RLO A;  2Q2I A;  1J5E Q;  5HGQ A;  4YHH Q;  2CQO A;  4A75 A;  1X55 A;  4X65 Q;  3RNU A;  4DR3 L;  4LF4 Q;  2K14 A;  1IL2 A;  3BA9 A;  4A4I A;  1CKM A;  4YCV A;  4JBK A;  5IYC H;  1WCM G;  1SN8 A;  4JBJ A;  4HJA A;  2ZJQ A;  2JE6 I;  2MNA A;  3JSN A;  3AEV A;  4DKA C;  3FHW A;  3KF6 B;  1ASZ A;  1X3F A;  1N36 L;  4DR7 Q;  4GOP B;  4A3K G;  4IPG A;  1L0W A;  4C3H H;  2R92 H;  3KFU A;  4FDB A;  3EN2 A;  1IBK L;  5LMN W;  1NBW A;  2OTL A;  2GN5 A;  1JB7 A;  4OWW B;  1JE5 A;  4X66 L;  1D7Q A;  2NVT H;  2VUM H;  5JJK A;  3RLN A;  4LF8 L;  5FLX c;  4IFD J;  3QWU A;  5GQO A;  2KHJ A;  4L5T A;  2VUG A;  1PH8 A;  1XTD A;  5C3E H;  2YTY A;  2N3S A;  4IOC A;  4HIK A;  5IE8 A;  4DV4 L;  4A93 H;  3GB8 B;  4APV A;  4CC6 A;  3K81 C;  4JI8 Q;  5IP7 G;  4GKJ Q;  3J80 c;  2CFM A;  3DM3 A;  3S24 A;  1PH7 A;  5JEA J;  4A93 G;  2WP8 J;  4LWC A;  2IX1 A;  4DAY B;  3CCE A;  3CCQ A;  4BXX H;  2E2J H;  4LF9 Q;  2XGT A;  4A3I H;  2AHO B;  1R9T H;  2UU9 Q;  2K4K A;  2UXC Q;  2HHH L;  1S68 A;  2I5L X;  5FPO A;  4OON A;  2JA5 H;  2PQA A;  4LF6 L;  3AFQ A;  1XMQ Q;  2HVS A;  4PMW A;  3U58 A;  3GDE A;  4LF5 Q;  4HIO A;  1Q86 C;  1HR0 Q;  3S17 H;  1U5K A;  2JA5 G;  1YEZ A;  2CWA A;  3ICE A;  4UCR A;  1QVC A;  3Q8D A;  4DV0 Q;  4QL5 A;  1YJ9 A;  1DGS A;  2AKW B;  3PIO A;  1KHI A;  1YJN A;  1XNR L;  3PO2 G;  1PH4 A;  1B04 A;  3KLW A;  3H15 A;  5LMU Q;  2V1C C;  2VQF L;  2JK8 A;  1X54 A;  1V9P A;  5C4J H;  1PH6 A;  3PO3 G;  4KHZ A;  4BA1 I;  3VNN A;  5HY6 A;  4ALP A;  5IYB H;  1ASY A;  1T9H A;  3HKZ G;  4CC5 A;  4A3F H;  3KJP A;  2Q2T A;  2QGQ A;  3J81 i;  1AH9 A;  3I4M H;  4WJ3 M;  5K36 G;  3F2C A;  4LUV A;  4GNX C;  4A3F G;  4NXN Q;  5GAH C;  4JBM A;  4AYB E;  4OO1 G;  1Z47 A;  1KQS A;  3A74 A;  1IBL L;  1EIF A;  1BKB A;  2WAQ G;  5JJL A;  2MO1 A;  4GLX A;  1JJ2 A;  4ME3 A;  1V43 A;  2UXB L;  4GLV B;  1YI2 A;  1VQ6 A;  2MQH A;  4PG3 A;  1WJJ A;  5J3B A;  4BY1 G;  4DUZ L;  2F4V Q;  4DPG A;  1KD1 C;  3NBH B;  2B3G A;  2E2H H;  3GD7 A;  3CXC A;  3CME A;  1K8G A;  1VQ8 A;  4LFB Q;  3TS2 A;  3K80 C;  1E7Z A;  1BBU A;  4DV4 Q;  3PF4 A;  1HNW L;  4UCT A;  2R92 G;  2JJQ A;  3BZK A;  1VQD A;  1L1O C;  1M1K C;  4GLA C;  3OTO L;  1H95 A;  4A3E H;  4L5S A;  4DV6 L;  2OQ0 A;  3F8T A;  2ALY B;  1IBM Q;  1PVO A;  5IYC G;  4DRF A;  5IT9 c;  5H1S E;  4LF7 Q;  4EQ5 A;  1PFS A;  1PV4 A;  5BR8 L;  4LH6 A;  2D0P A;  2LXJ A;  5LMN Q;  2EQS A;  1SE8 A;  4PZ6 A;  1I94 L;  2UUC L;  2K52 A;  1JJG A;  1EOV A;  4B3M L;  4MZ9 A;  3D31 A;  2Q2U A;  3MXN B;  3NEN A;  2A8V A;  2YTV A;  2KCT A;  1SRU A;  2I0Q A;  4IFD I;  2UXD Q;  2VQE L;  3I4N H;  2H5X A;  1A62 A;  3HOW G;  1XNR Q;  4OWT B;  4POF A;  4DV1 L;  2WFW A;  1N33 L;  3TY5 A;  3UQ8 A;  1I50 H;  5C3E G;  4DV2 Q;  3CPF A;  1CUK A;  2BA1 A;  3GTK H;  1OXU A;  2ES2 A;  3BU2 A; 
#chains in the Genus database with same CATH topology
 5FJ8 H;  1N32 Q;  3BDO A;  2PQE A;  3JSL A;  4YBZ B;  3GTL A;  3N43 B;  1N34 L;  3CHB D;  2EJG C;  1K83 A;  3KDF B;  4NXN L;  2K04 A;  3K5I A;  3GTG A;  2Y0S G;  4LJZ C;  1G6P A;  5JQW A;  1F77 A;  1S5C D;  1VQF A;  1U4M A;  4QIW B;  2B63 B;  1QZH A;  3CC2 A;  4F50 A;  1UE1 A;  3GQB A;  4GZY C;  4A2B A;  2JN4 A;  4O3N A;  5L1K A;  4HIM A;  2W8L A;  2BE5 C;  1XNQ Q;  3TDQ A;  4DV3 Q;  4YWM A;  2WTF A;  3M4O B;  4EBE A;  4ED8 A;  5KFG A;  4KK7 A;  2F0J A;  1PH3 A;  4L5R C;  4CBV A;  5KFL A;  1XX8 A;  5CM0 A;  1TS4 A;  1M8A A;  2UUA L;  4Q4C A;  4JI3 L;  3SHL A;  2KEN A;  2A6H C;  1MJC A;  1XK5 A;  5FLX L;  4IJL A;  2CNQ A;  1S3O A;  2EY2 A;  5EDW A;  3T1Y L;  3HFZ B;  1ULZ A;  3CEB A;  1OTC A;  2F0F A;  3NWT A;  3URY A;  2WB1 G;  4DAY A;  2AUK A;  2GVB A;  3VDY A;  4C1N I;  1M90 C;  4O2A F;  5BPF A;  2R7Z A;  4B3R L;  4B08 A;  4RHR A;  3DTF A;  1VQ9 A;  4K0K H;  3FKI G;  2C2R A;  3J7Y W;  1YIT A;  2VPS A;  4RU9 A;  4KI0 A;  3VMM A;  2PMZ E;  5M3M G;  1JWU D;  4EFE A;  4JV5 H;  1QOH A;  1QUQ A;  1Q1E A;  1G2S A;  3PUY A;  4JI4 L;  2B2Y C;  1W96 A;  2RDF A;  4IPC A;  4MA0 A;  3R2T A;  4H13 C;  2JA5 B;  2J7Z A;  4DUY Q;  3MA2 B;  4O2B F;  2WAQ B;  3S2D B;  4LFA Q;  3MXG A;  3PUW A;  3CC4 A;  4H0L C;  4JV5 Q;  3IFD A;  4QUF A;  4IRC A;  3M4O H;  5KG6 A;  1BO0 A;  4K8J A;  2XWJ B;  4RAU C;  2YRW A;  1HPC A;  3F1Z A;  5C44 H;  5EWF A;  5M3F H;  3QZ8 A;  1NTG A;  1WI5 A;  2NVY A;  2MHV A;  2WAQ E;  1K73 C;  2HJW A;  3V6K A;  2AQ2 B;  2ENB A;  1WRV A;  1YBY A;  4GNX A;  3K59 A;  1X9N A;  1YIJ A;  5DAA A;  1EWC A;  4IJH A;  3NHH A;  4J9N A;  1ZHS A;  5KFW A;  4NXN H;  1PFN A;  3HOU B;  2WV6 D;  4EGQ A;  1D5X C;  2B2V A;  4TUY F;  2E2H B;  4C3H B;  3L9A X;  1CQV A;  4FFM A;  1YNX A;  3UDG A;  1MIU A;  1XNQ H;  1K1Q A;  1NE3 A;  4R4T A;  1I2K A;  2K5V A;  1UWV A;  3NBH A;  5KFF A;  2F1M A;  1V8Q A;  3F2D A;  1O7I A;  2B29 A;  2Y0S A;  4UY8 C;  3UE1 A;  2W57 A;  5FOB B;  4MV8 A;  3S2H H;  3RV3 A;  3N6X A;  4O3S A;  1VQL A;  5GAG C;  4MV1 A;  4LMY A;  2E75 C;  1A8V A;  1PDQ A;  5KFQ A;  5EPL A;  1JDE A;  2N8N A;  2FJ2 A;  1HCZ A;  2ZXR A;  1LAB A;  5CR5 A;  1J5E H;  1HNX L;  2EDG A;  1I6H B;  1HHV A;  2LXK A;  4J9K A;  5LMU H;  3PO3 H;  5KFK A;  1CHP D;  2HDM A;  5IYD H;  2R8H A;  2CH4 W;  3BZC A;  4HCE A;  1H9K A;  1SXT A;  4H7B A;  3G6X A;  4C5B A;  4O7W A;  1PH5 A;  2UXC L;  1SYF A;  5IYD G;  4O84 A;  3BJU A;  2LS0 1;  4JI7 Q;  1V1O A;  5CBE E;  1GOZ A;  5IGC A;  2Y0S E;  1RF2 D;  2XGQ A;  1NAP A;  2C35 B;  3KAL A;  1RK6 A;  1HZ9 A;  1OBG A;  1UC9 A;  1T3N A;  4P75 A;  4DR2 H;  1Y1W A;  1XMQ L;  4BY1 H;  3CD6 A;  3GTG H;  2RCN A;  4ZQ3 A;  4L63 B;  2TMP A;  1HZB A;  2EJF C;  2G9H D;  3GTJ B;  1Q3L A;  2BA0 A;  4X3K A;  1F2L A;  3CCU A;  1JT8 A;  2QEX A;  2HGS A;  4A3J G;  4G57 A;  1LUZ A;  3HOZ B;  4ECT A;  5KFZ A;  1NMG A;  1I4R A;  2CH4 A;  4R8U A;  4YWL A;  5KFP A;  3L4K A;  1VQA A;  2F0S A;  3ZJY C;  1HUN A;  1DIK A;  4IUN A;  3KBX A;  4BA2 I;  1JC7 A;  4R4I A;  4XYL B;  3MR2 A;  3GTQ A;  1E22 A;  4TSS A;  3TY9 A;  4YHH L;  1DV2 A;  1CHQ D;  2K5Q A;  3E9H A;  4R4C A;  4MV6 A;  3MTS A;  1ZYR C;  1E1T A;  5C0X J;  1VBG A;  1I1K A;  1K3R A;  3EPG A;  4AQY Q;  3GTP H;  4A3M H;  4G7O C;  3L7Z C;  3MWE A;  1MJE A;  5ELO A;  1CSP A;  4DR7 L;  4DV7 H;  1NNX A;  1A6X A;  4X62 H;  5D1P A;  2W7O A;  2GLT A;  1N32 L;  5D1O A;  4FO2 A;  2ASB A;  1EYZ A;  5C5L A;  5EWG A;  2EIY A;  5DGI A;  3G48 A;  4KY6 A;  2I5H A;  2FXQ A;  5BYB A;  3SEB A;  1WTR A;  2EXD A;  4F88 A;  3NBY B;  2ZTE A;  3GIL A;  4ZQI A;  1E2Z A;  3JRW A;  4RH6 A;  2D9U A;  2L1B A;  3WWH A;  3CVZ A;  4X64 Q;  1SMY C;  5BPH A;  4LF7 H;  1D5M C;  2F0E A;  1N9W A;  2R86 A;  2C2E A;  1K8O A;  5C5M A;  1B33 N;  3SE7 A;  1XMO H;  4TQU S;  3UYY A;  2NZH A;  1B9M A;  3QIA A;  1GYF A;  1C9O A;  2PZW A;  2L9H A;  3VPD A;  3BDL A;  4ZUI A;  1M0W A;  3QQM A;  1F2Z A;  4BBS G;  3BAB A;  1IYV A;  4KHP Q;  1XXG A;  3CCJ A;  1YJW A;  5KEE A;  4LFB H;  1SDF A;  2K1B A;  2JA8 G;  3SK5 A;  3ETH A;  3GP7 A;  3J81 c;  1EFI D;  4J15 A;  1B50 A;  2VQD A;  4JI1 L;  1KEE A;  1LTG D;  1I94 Q;  3S14 H;  5CA1 F;  5IWA L;  4DR5 Q;  4DK6 C;  1Y8P B;  4B3M Q;  4A3B B;  1IZ6 A;  2A19 A;  3KF6 A;  3J80 E;  4Y7N H;  3ND8 A;  1Y1W G;  3M3Y H;  5D3I B;  4LUO A;  4KMU C;  4RKL A;  1TQO A;  3G8C A;  4JYA Q;  2NU7 B;  1W3S A;  3AB9 A;  3GTQ H;  1G91 A;  3I12 A;  2CKZ B;  1EU3 A;  1IW7 C;  4UCU A;  1EUC B;  1VQM A;  3BQ2 A;  1OXV A;  2DGY A;  1IKL A;  3E0J A;  4HJ9 A;  3HOZ H;  2PVP A;  5BWT A;  5EBC A;  5CV7 A;  2ALZ A;  5CYU A;  1B6S A;  1SE2 A;  4NDX A;  2UXC H;  1CZW A;  1I4X A;  1VQN A;  1VDZ A;  2W6P A;  4JOI A;  4BY1 B;  3KF8 B;  4KY7 A;  4EX5 A;  5LYJ F;  4DV0 H;  3PFF A;  2RHQ B;  2ATL A;  2K6A A;  2X6L A;  4RGN A;  2YU9 H;  1E1O A;  4NXM Q;  2X5R A;  2A6H D;  3CSW A;  4YJ2 F;  1S0M A;  3I73 A;  3JC6 6;  4WJ4 A;  1UEB A;  3GTM H;  1JOK A;  3DLL A;  5LMU L;  2YZG A;  4O82 A;  3GTP B;  4MA5 A;  2YU9 A;  3G6E A;  1XYI A;  5HV6 A;  1TA8 A;  4C3J B;  4OXP A;  3A0J A;  5FO7 B;  4LSX A;  4RGT A;  1JWS D;  4O3O A;  2QDB A;  4QIW A;  1D2B A;  1YHQ A;  3BVZ A;  4DV1 H;  4GKJ H;  3BAA A;  4I55 F;  3U9O A;  2RSO A;  1TWH B;  1VQ4 A;  3S15 B;  1I6H H;  1N36 H;  2KEC A;  5FJ8 G;  4PQX A;  4IIJ F;  4ED0 A;  2ASL A;  1PLF A;  5E4W C;  4CE5 A;  2V59 A;  3FMA A;  2Z6K C;  3UDI A;  4IRD A;  1IBK H;  1HNZ H;  3AFP A;  3N8D A;  3H3V H;  3RD4 A;  4BXX G;  2UVV A;  5I5S A;  5I2X A;  3H09 A;  3PIO 3;  5HUR A;  2NZO A;  2ATW A;  1K8A C;  2XSC A;  4FU0 A;  1DXM A;  4ULL A;  4DR4 Q;  2AGQ A;  2EE1 A;  3MR5 A;  5I5W A;  2B8F A;  4JI6 Q;  3RB3 A;  4O86 A;  1DZ1 A;  3TQT A;  1JOQ A;  2NTS A;  5CV5 A;  4XYQ A;  1D6E C;  1S5E D;  2F0T A;  5JVG 3;  5C0X G;  4JI7 L;  1VQH A;  3FRP B;  4I4T F;  2F0O A;  4PMC A;  5L1L A;  4RB1 A;  4N8X 1;  1Z6H A;  4LW1 A;  3EYY A;  5DG8 A;  1RIP A;  4YY3 L;  4YR0 A;  5DMX A;  2SNM A;  4WFN 3;  4O7Z A;  3GIQ A;  1BUV T;  3IAY A;  1JOO A;  4L8J A;  1SFO H;  4LF5 L;  1G2T A;  1YNN D;  3P20 A;  3BQ0 A;  1EIH A;  1SYG A;  2E2I A;  5DAU A;  4FF3 A;  5BN5 A;  5M5Y B;  1S0O A;  5KFC A;  2R7L A;  3D3R A;  1N56 A;  2QF7 A;  3MEF A;  3K7A H;  1C4Q A;  2E5L L;  1WTP A;  5IGD A;  3F8N A;  3RLO A;  5HGQ A;  1FD7 D;  1X55 A;  4X65 Q;  4DU9 A;  1CKM A;  2XWB B;  4K2K A;  1S03 G;  4KY5 A;  3LX0 A;  2HHF A;  4DAA A;  1J9O A;  1NR4 A;  1O80 A;  3HP3 A;  1X3F A;  4HSV A;  4IAL A;  1ASZ A;  5BWU A;  4MTD A;  3RAX A;  4C5C A;  4G7Z C;  4IHJ F;  4IPG A;  4FDB A;  4XT1 B;  4OWW B;  5JJK A;  3QWU A;  5FLX c;  5GQO A;  4QWC A;  2I87 A;  1XTD A;  5C3E H;  2YTY A;  5JPN C;  4JI2 H;  4MTK A;  3JZF A;  4CC6 A;  4DL3 A;  2BDN A;  1EY8 A;  1PTO C;  2J0T D;  1S9F A;  4ZLT F;  2OLS A;  2SEB D;  3S24 A;  1Q90 A;  1I4G A;  1NUC A;  4DAY B;  1S10 A;  3OIP A;  1VF7 A;  3ONA B;  3OIQ A;  2E2J H;  2XGT A;  3N42 B;  4B3M H;  2AHO B;  1AEX A;  2W7P A;  2K4K A;  2SOB A;  1TS3 A;  2I5L X;  4X3S A;  4M7E A;  3HZX A;  4MV4 A;  3RZO B;  3GDE A;  4BS9 A;  1Q86 C;  3SDZ A;  4DK1 A;  2VB2 X;  3EJI A;  4UCR A;  2CWA A;  3ICE A;  1M6V A;  2NU9 B;  4HNT A;  1SYX B;  5KNB A;  2FLP A;  3FKI B;  2R8I A;  2M05 A;  1YJ9 A;  1DGS A;  3PIO A;  1YJN A;  1KHI A;  2LFN A;  3PO2 G;  5I5X A;  3PR5 B;  2V1C C;  2JK8 A;  5KFT A;  5C4J H;  1PH6 A;  3PO3 G;  5F9N A;  3MFG A;  3HKZ A;  1ASY A;  2QKI C;  3HKZ G;  2UXB H;  4A3F H;  3KJP A;  2RDI A;  2O4X A;  3KBG A;  2Q2T A;  4YQW A;  4R8U B;  3I4M H;  4BBS B;  2WKC A;  3AMU A;  1IBL H;  4A3F G;  1DD2 A;  3LWB A;  4JBM A;  4ID6 A;  4K5V A;  3V6H A;  4ECW A;  1EIF A;  2WAQ G;  5JJL A;  4ME6 A;  1S5B D;  5COY A;  2YW2 A;  1PZJ D;  3H0G B;  4DR1 H;  3C1E A;  3Q8P B;  4PG3 A;  5J3B A;  1WJJ A;  4HTH A;  4BY1 G;  1BXR A;  4DUZ L;  2F4V Q;  1KD1 C;  3M7G A;  2YWV A;  2ZDH A;  3RF2 A;  3CME A;  3CXC A;  1K8G A;  2AU0 A;  3Q2O A;  1E7Z A;  3PF4 A;  4UCT A;  3KUP A;  2NVX A;  4C3H G;  4EQP A;  3A7A B;  3QO2 A;  3HGB A;  1KAB A;  2OH2 A;  1VQD A;  1L1O C;  3BJY A;  5JVL A;  3OTO L;  2WE6 A;  1SNM A;  4WRD A;  4RB0 A;  5KFV A;  1RCV D;  4FFP A;  2OQ0 A;  2RQX A;  1EZ1 A;  1GUS A;  1CE8 A;  4EQ5 A;  1PFS A;  2EYO A;  3SE0 A;  2R93 B;  3WNZ A;  2EQS A;  1SE8 A;  1JJG A;  3R5X A;  2NYZ D;  4MTE A;  4J9Q A;  5HNE A;  4B3M L;  4MZ9 A;  3SK6 A;  2Q2U A;  5BR8 H;  2R8K A;  3G8D A;  3T16 A;  1I3Q A;  1CQI B;  5D65 A;  2I0Q A;  1KJ9 A;  3J7A K;  3I4N H;  2IL8 A;  4O4J F;  3EVQ A;  4OWT B;  1N33 L;  2GPS A;  2WFW A;  3TY5 A;  4ECX A;  3QOL A;  1IKM A;  3H4B A;  2B2T A;  1B1Z A;  1STY A;  4DV2 Q;  3ORR A;  2UU9 H;  1BR9 A;  1HA5 A;  2ES2 A;  1CI3 M;  3T5K A;  3I8Z A;  1KRS A;  3GTO H;  3MFY A;  1L1O B;  5DIS C;  4U7C A;  3T5J A;  3R5F A;  1JJC B;  5KYI A;  4ECZ A;  3TP5 A;  1D5Z C;  1NSN S;  4R4O A;  1L2Z A;  1X56 A;  3PUX A;  4DFA A;  3BVM A;  1CZG A;  2AWN A;  2O5I C;  3OSP A;  2R7D A;  5I60 A;  1IYU A;  2UXB Q;  3SNO A;  4HED A;  4RZR A;  3GTM A;  3RFC A;  2KVM A;  1SJE D;  3OYY A;  4Q5V A;  2FK3 A;  4K0K Q;  1O7Y A;  1EY0 A;  1GO3 E;  2A69 D;  3I3C A;  4O7T A;  4X66 Q;  1PFM A;  2D62 A;  3CF5 A;  2B63 H;  2JA8 H;  4N8F A;  3CAM A;  5CGK A;  1CKN B;  1I4Q A;  3PCO B;  1MKH A;  5C4X H;  1LTB D;  4DV5 L;  3WWI A;  1A48 A;  4GS3 A;  5I6W A;  5AJ3 Q;  1L2F A;  3E9I A;  3J80 i;  2KCN A;  5KG5 A;  1Y1W H;  4P72 A;  4A3C G;  4UP9 A;  1U9R A;  4KHP L;  2V4Q A;  1ZKO A;  1J5E L;  1SJH D;  2MO0 A;  1ILP A;  2R7Z B;  1SNP A;  2Z9H A;  3HOZ G;  4OX9 L;  2W70 A;  4QWD A;  2IHE A;  2KED A;  2RDJ A;  2BE5 D;  2CNU A;  2KBN A;  1XPR A;  2LY7 A;  2DZD A;  3NQI A;  1CKN A;  2XTI A;  3TBI B;  4C1N K;  4HSP A;  5CV6 A;  3RB6 A;  1Y1V H;  1EQV A;  3R93 A;  1KLU D;  3A5Z B;  1ZET A;  5ELC A;  2FK2 A;  4J9S A;  4J9R A;  3D4R A;  1RHP A;  1SBB B;  4LF9 H;  2FMC A;  1JLL B;  1GHJ A;  4TV9 F;  2YZL A;  1PA6 A;  4JI6 L;  4CMF A;  1SFO A;  5J1Z A;  2JA7 H;  4R1J A;  1A3G A;  4FE2 A;  4Q8E A;  5DGB A;  1R4Q B;  1SSO A;  1WVL A;  4RB3 C;  5KX5 F;  3T13 A;  2Z6K A;  4O0A A;  4O3Q A;  4TVA B;  5KG3 A;  2HD3 A;  2GA4 B;  4X6A H;  2P0A A;  1G51 A;  1WTO A;  2HHH Q;  1BCP F;  5EBD A;  2EY5 A;  4PZ8 A;  1OXS C;  3DTG A;  4JYA L;  2FE3 A;  3TQ1 A;  3GJX B;  3T9C A;  5FD6 A;  1CT1 D;  4DL6 A;  3LUL A;  1WTH A;  2NVY B;  4YCW A;  3J81 E;  1S0N A;  4LSA A;  3TIG A;  3GTL H;  3N6R A;  2J6T A;  1I4P A;  3GQC A;  1FJG H;  4B3R Q;  5EWE A;  1G2W A;  1CQF A;  3KRE A;  3GTO B;  1GUG A;  1STB A;  1X6O A;  3CPW A;  2PCF B;  1QUQ B;  2XVS A;  1GM5 A;  4A3E B;  2IY5 B;  5BMV F;  5M3F B;  5JJI A;  5FPR A;  3CU7 A;  4LF9 L;  4X3T A;  4O1N A;  1FKA H;  2C22 A;  4TQR A;  3VYU A;  1KDC A;  1VQ5 A;  3PZP A;  4C3J H;  2SDF A;  5KFO A;  4LH7 A;  4JBW A;  2K5W A;  1JKJ B;  3T54 A;  1FYC A;  5LMN H;  3WDN A;  1UE7 A;  3I56 A;  2W71 A;  4A3F B;  5GON F;  3N41 B;  5K36 G;  1JB3 A;  3K58 A;  4IPD A;  1IBM H;  4ETS A;  1LYL A;  3HG9 A;  2HQL A;  4JI8 L;  3ERS X;  1PH1 A;  1QE6 A;  2KOL A;  3AW8 A;  1IYJ B;  3FKI H;  2K03 A;  3LGJ A;  2COJ A;  1LTI D;  2E8G A;  5CV4 A;  1K8M A;  1Q1B A;  1LM0 A;  1AP0 A;  1B44 D;  5D8D A;  5KFN A;  2A1H A;  4DR2 Q;  4JI0 L;  4XT3 B;  4A3G H;  1Y8O B;  2YL2 A;  4EQO A;  4HR7 B;  1HFG A;  5M5W H;  2Q8I B;  5A35 A;  3PN1 A;  3PUZ A;  5DG9 A;  2C28 A;  3PUV A;  3LWE A;  4CDF C;  4O81 A;  4WD3 A;  4FF1 A;  2HVQ A;  1SMY D;  3RLF A;  4UDU C;  1SEB D;  3RZO H;  1X3G A;  2DAB A;  2VXW A;  1TWF H;  1IBL Q;  1X3Q A;  2UUB Q;  4CDD C;  2R93 G;  1XWE A;  3DUZ A;  3NK9 A;  1O75 A;  4MIU A;  1AE2 A;  2R3Z A;  4IFD H;  1BBX C;  1VQ7 A;  3HOW H;  4JCV E;  4B9X A;  2F0I A;  1H9J A;  4R8I A;  2BDO A;  4JG2 A;  2R8G A;  1Q8K A;  3C46 A;  4IFD G;  1TY2 A;  1PZI D;  3B6Y A;  4TM5 A;  1P16 A;  2DY7 A;  4RKB A;  4JI5 H;  3G7L A;  4QIW E;  3GTJ A;  4J9L A;  4FBU A;  3RR5 A;  4DIM A;  1V1P A;  3A8J E;  4DK0 A;  4BBR H;  3HOV G;  3NBI A;  3HBL A;  3S1Q H;  2UUC H;  2XN9 C;  5KT4 A;  3OOC A;  3WO0 A;  2K7V A;  3BA8 A;  4DR6 Q;  2WAC A;  2JEG A;  2HQE A;  3E5N A;  4B3S H;  1QNK A;  3S1R B;  2J4X A;  1EWI A;  3K7A B;  1C8C A;  4A3L H;  4XYM B;  1XPO A;  4ED6 A;  1KIX A;  4A3D B;  3WOE A;  3J81 j;  4WHX A;  4F4Z A;  2F0M A;  1GUT A;  3AYH B;  1BCP B;  3QWN A;  3MHB A;  2QB5 A;  3E0E A;  4JI2 Q;  1XMO Q;  1SFO B;  3HOX G;  1EY6 A;  2BOS A;  2GQS A;  1UNN C;  5KFR A;  4GN4 B;  4EBC A;  2N78 A;  1EQR A;  2ZM6 Q;  1W93 A;  5E7N A;  2R7Z G;  1AUX A;  3U55 A;  4RFB A;  4DK3 C;  2KCM A;  2NU8 B;  4XTC S;  2PNH A;  4JI1 H;  3D4D A;  2Q8T A;  4WOR A;  3W2D A;  3H0G A;  2UXD L;  4LF7 L;  3L2P A;  1P8L A;  2BH8 A;  1I1M A;  5IGF A;  4R4Q A;  2WAQ A;  2DAA A;  4L1K A;  2A73 B;  4JI5 L;  1VQJ A;  3NC0 B;  3E5S A;  1KTK A;  3A5U A;  1DON A;  1JMC A;  1WCM H;  5DGA A;  2UUA Q;  4TVI A;  1H9S A;  1BCP C;  1TWC H;  4LFB L;  4XYO A;  4XQQ A;  1FJG L;  2F3W A;  1PTO H;  4A3K H;  1A63 A;  4QF4 A;  2L15 A;  2ASJ A;  5ELE A;  3J7A 5;  1KJI A;  2AQ3 B;  4RB2 C;  3P7J A;  2F0H A;  1LTL A;  4TKO B;  1WFQ A;  4IQZ A;  3PGZ A;  1WR2 A;  2I8C A;  5F2D A;  3W1G A;  1K28 A;  3H6M A;  3VYS A;  1RYS A;  2ZTC A;  3D0F A;  3J7Z C;  1PYB A;  4EVO A;  2MGS A;  2DY8 A;  3WWV A;  2OCE A;  4FFO A;  1B3A A;  2KCC A;  4PWQ A;  1YVC A;  4K14 A;  4FS2 A;  4IN3 A;  4UP7 A;  2WII B;  1WYD A;  3S1N B;  4QWA A;  3BZD B;  2CZG A;  1HTL D;  3W3A A;  1KAW A;  5CBA E;  4HJ7 A;  4O7R A;  1B6R A;  3GTM B;  3Q24 A;  2QDL A;  5M5W B;  4NLG A;  2QEJ C;  2HGW A;  3JAM c;  4F8M A;  4DV0 L;  2L11 A;  4A2A A;  4UHV A;  3FDT A;  4IR9 A;  3ULL A;  3MR6 A;  4JI1 Q;  5IP7 H;  4A3K B;  2FK1 A;  2W9C B;  1Q12 A;  4RGO S;  3HKZ B;  3TZD A;  2W6O A;  5C3E B;  4RCN A;  1W6K A;  4ZHQ F;  1MSG A;  3DM1 A;  1HNX Q;  1O7Z A;  4RCO A;  1Z2O X;  1D1I A;  2NUC A;  5E3F A;  2G5D A;  3K5N A;  2ZJP A;  2HHF B;  1HZA A;  4TQS A;  5IYB G;  3OUU A;  1E24 A;  3NEL A;  4DV6 Q;  3ULJ A;  5DEH A;  2UXD H;  2KHI A;  4DF7 A;  4FM9 A;  3RN5 A;  2HT1 A;  1HTP A;  4RZQ A;  4DR6 L;  4DV3 L;  5I5T A;  1MD2 D;  1PH9 A;  4GKK L;  3HOU H;  5KNC A;  5LHY 1;  1G8Z D;  2EYF A;  3O13 A;  4TRD A;  2ICE C;  1C30 A;  4YIJ A;  2CHB D;  1HFN A;  2RA4 A;  3MXP A;  1BVS A;  3RUZ A;  5C4X G;  4FGR A;  1F9R A;  1SMX A;  3H0G G;  3UDX A;  5CR3 A;  3BYY B;  3GV5 B;  2KQ3 A;  2FLN A;  3T99 A;  4C2M H;  4DR3 H;  3G71 A;  1RJT A;  3TS0 A;  1C7Y A;  5EOY A;  1BNC A;  1F9Q A;  3K0X A;  1NR2 A;  1GGO A;  1SNO A;  4JI3 Q;  1PTO F;  2X6G A;  3Q1K A;  2NVX B;  4A93 B;  2OEO A;  3RB4 A;  5BWR A;  4YCU A;  1GKH A;  3GTL B;  2UVU A;  4EBD A;  2CQO A;  2ZDQ A;  3RNU A;  1KJQ A;  1BDO A;  2F0Q A;  1U4R A;  3Q8R B;  4HJA A;  1B4O A;  1E4E B;  2MNA A;  2PW7 A;  3KF6 B;  2EYP A;  3T7A A;  4GOP B;  1L0W A;  2R92 H;  4LF6 H;  4FNF A;  3PW4 A;  4YP3 A;  1RJQ A;  3DWP A;  1JB7 A;  2W6Q A;  3QB3 A;  3RLN A;  4CHT B;  3MFH A;  4CKC A;  3BG5 A;  2NWG A;  4JPB W;  2R7N A;  1UUP A;  5IIF A;  4E6I A;  2N3S A;  2CW0 D;  3C0F B;  4IUQ A;  3SVM A;  5IE8 A;  4DV4 L;  3GTK A;  3K81 C;  4JI8 Q;  1A15 A;  2Z1C A;  4GKJ Q;  2VR1 A;  1O78 A;  3OSN A;  2C5C A;  2HDL A;  4EEY A;  3OTO H;  2KA7 A;  4A3I H;  5A2Q E;  3RV4 A;  2V58 A;  4A3M B;  2M00 A;  2UXC Q;  4WBN F;  4OON A;  2JA5 H;  4K8I A;  3OPO A;  1TWF B;  4I7A A;  2HVS A;  2KEE A;  1BCP D;  1X32 A;  2B2U A;  3U58 A;  2DJF C;  3RUP A;  3HOV B;  4NXM H;  4KV6 A;  1U5K A;  4ZUJ A;  2JA5 G;  5I47 A;  1IYE A;  4DV0 Q;  4MV7 A;  1JX4 A;  4JI8 H;  2AKW B;  3VA7 A;  1XNR L;  2HGX A;  1FR3 A;  1BJT A;  2V4D A;  1FNW A;  4OEM B;  4ABN A;  1WSC A;  2H1E A;  4YR2 A;  1E4F T;  2R8J A;  2B63 A;  4ALP A;  4DL2 A;  3MZ5 A;  3N40 P;  4B3R H;  4AQY H;  4JV2 A;  4WJ3 M;  3NGD A;  5LL6 X;  2RKS A;  3S2H B;  1MI2 A;  3FDS A;  1ZAU A;  3M4I A;  4NXN Q;  4KHV A;  4OO1 G;  4JI4 H;  1IBL L;  1PRT D;  5K36 H;  4DNT B;  4HR7 A;  2DPI A;  4GLX A;  4OO1 H;  1JJ2 A;  3RIZ A;  5I6Y A;  1VKZ A;  1VQ6 A;  2MQH A;  1XTC D;  1O7L A;  3NBH B;  2A6E D;  2E2H H;  1K0S A;  3GD7 A;  3TEK A;  4F4Y A;  4J1M A;  2UUB H;  3MXN A;  1EY4 A;  3TS2 A;  1I2L A;  2Z4H A;  2IMW P;  3TZU A;  4JI3 H;  2JJQ A;  3WOF A;  1DOL A;  2XD4 A;  1Y1V A;  4GLA C;  1YNJ C;  2JXM B;  5LP6 F;  2RGV A;  2Z4I A;  3BG3 A;  3J7A F;  5KFI A;  4L5S A;  2DLN A;  1PVO A;  2YYA A;  4FP5 D;  4DRF A;  5EPK A;  1A3U A;  2QK4 A;  5IT9 c;  5JQG F;  1EKF A;  1PV4 A;  4XDX A;  4DL4 A;  2W9B B;  2UUC L;  5C5J A;  1H9M A;  4PZ6 A;  4OIK A;  1CFM A;  1Z2P X;  4ED2 A;  1S5F D;  4ZOL F;  3MEH A;  3I4L A;  2A8V A;  5FKA C;  3MWM A;  2R61 A;  1SRU A;  2D5D A;  4IFD I;  2UXD Q;  4KTA A;  2VQE L;  3DWQ A;  2JA7 B;  3NUC A;  2H5X A;  4O7S A;  1WTV A;  5IYZ F;  4Q44 A;  4DV6 H;  1A62 A;  3HOW G;  3FPU B;  3U9S A;  4POF A;  4DV1 L;  5C4Z A;  3PO3 B;  5C3E G;  1DAA A;  3CPF A;  2HCC A;  2W9A A;  2BA1 A;  4JV0 A;  2XIW A;  3KTM A;  1ENF A;  2XGP A;  5K5P A;  5DLQ E;  4EGV A;  3P75 A;  2JA6 H;  2R82 A;  1BNZ A;  1TWA A;  3GIM A;  2F0G A;  1JQY D;  1ONL A;  1TWC A;  1PHJ A;  1EY5 A;  4BBR G;  3HOV H;  5KRU A;  1FNV A;  1PMR A;  4DR3 Q;  1TWG H;  2K05 A;  4LF4 L;  5IT9 W;  2F0W A;  2XRS D;  4P74 A;  1ESR A;  3TII A;  4IAJ A;  1EZ6 A;  1K83 H;  5I4D A;  1OWT A;  3V6J A;  1K3B C;  4A3J B;  1EL0 A;  4A3I B;  2BQU A;  4A76 A;  5C3X A;  4N9P A;  1GSO A;  4PV1 C;  4DAV A;  5KFU A;  1PRT F;  3QR8 A;  5H80 A;  3UE0 A;  1CSQ A;  1UNS A;  2G9D A;  1Y69 U;  2F4V H;  3FVQ A;  1A2U A;  4AYB B;  2QCP X;  2ICI A;  2HCI A;  3RGZ A;  1RD9 D;  5KFD A;  4CJ1 B;  3NP8 A;  4ZYS A;  2EZV A;  1XMQ H;  2R7Z H;  2UUB L;  3T9F A;  4P73 A;  4NP5 A;  4X65 H;  5KT2 A;  3T51 B;  2WB1 A;  4IR1 A;  1H9S B;  2NTT A;  2PZU A;  3ER0 A;  3RBE A;  3SGI A;  4NXM L;  3NSW A;  4OL7 A;  1TT2 A;  1XMO L;  4RAZ A;  5JVD F;  4JI7 H;  4K6N A;  1ML0 D;  1IOW A;  5C1O A;  1ZHQ A;  4ED1 A;  1GD7 A;  2X69 A;  2PMZ B;  4LFA H;  3HT5 A;  1XNR H;  2Q8R E;  4ECQ A;  1VQI A;  1OXX K;  2C2D A;  2EVB A;  4ZK9 B;  3CKI B;  1WTW A;  1QVF A;  2SCU B;  4WJW A;  4S3S A;  4I7H A;  2I07 B;  2Z04 A;  3EFX D;  4KLK A;  3V05 A;  3M85 A;  3L0O A;  1VQC A;  1PK8 A;  2NVX H;  1CS0 A;  4HN2 A;  1I3Q B;  1MHW C;  4DV3 H;  3PV0 A;  2F52 A;  4Y52 H;  1HZC A;  5J2T F;  3NTH A;  1EQT A;  5EGT A;  4QGU A;  4DR7 H;  2I5M X;  4IUR A;  1ROD A;  1M4V A;  3S9W A;  2FKL A;  2L4N A;  1KNE A;  1D8L A;  4KD3 A;  3A8K E;  5A2Q W;  2JP1 A;  1S72 A;  3FPP A;  4YHH H;  1Y14 B;  4GKJ L;  3NEM A;  5KG4 A;  5KFJ A;  1PXU A;  3KLR A;  3K0Y A;  4A3D G;  2CWP A;  5I9P A;  3ULP A;  4DV7 L;  3QOJ A;  3GTK B;  1I6U A;  4LUZ A;  4IUV A;  1V1P B;  5ELB A;  1J8I A;  2FPG B;  1Q7Y C;  2E2H A;  4U6P A;  3L3O C;  2ZTD A;  1VMC A;  3KLS X;  3HOX B;  1X3E A;  2O5J C;  1OXT A;  3UDF A;  3H20 A;  3EIV A;  1GXD C;  1PRT C;  2A1A A;  2MP1 A;  2WB1 E;  3ITP A;  4DV1 Q;  3CQZ H;  4LFC Q;  1ET0 A;  1GSH A;  1LTS D;  2VZA A;  3CW2 C;  3K8A A;  1NMF A;  1FGU A;  1Q46 A;  4JV1 A;  4YAK B;  1Z9F A;  5C4J B;  4QSH A;  1LTA D;  3KAJ A;  5C0X I;  1EKP A;  2EY6 A;  3BAC A;  3LP8 A;  2TSS A;  4NZM A;  2K28 A;  4RMF A;  4C56 C;  4OX9 Q;  4OWX B;  1ET9 A;  5JEA H;  4PBC A;  5BWX A;  5EAY A;  3EPI A;  2FB9 A;  4DUY L;  1LAC A;  3HOU G;  1PFB A;  4O4I F;  5JEA G;  5T1I A;  1RJP A;  4HCS A;  4M1U B;  5KFM A;  5KFB A;  3I4M B;  4PNY A;  3Q23 A;  4BBS H;  4IUU A;  3PSI A;  5IWA H;  2VPQ A;  3SK8 A;  5EQ0 A;  2XNA C;  5KKN B;  2AWO A;  2E2J B;  2YZM A;  1R4P B;  1PRT B;  4NPS A;  2OWO A;  1VBH A;  1R9T A;  1U4P A;  2ZT9 C;  2ZJR A;  4O4L F;  1B70 B;  1IHZ A;  3K3P A;  4B3T L;  4JK1 C;  2KSW A;  1IBM L;  4O3R A;  1DV1 A;  2NB0 A;  2B2T C;  4QY7 A;  5C44 G;  4E6N A;  3CMA A;  5BR8 Q;  3GV7 B;  1WCM B;  4UCS A;  5FNV F;  2Z8L A;  4LF4 H;  4NKL A;  2FJZ A;  1U0L A;  2VS1 A;  2K5N A;  2KJX A;  4XX0 B;  3LWU A;  5HGT A;  3MC0 B;  1XNQ L;  4X65 L;  3KLS A;  5JVH 3;  4ECS A;  3IL8 A;  1BBW A;  3DHQ A;  3JZ6 A;  1KJJ A;  1BGW A;  4X62 L;  1RKN A;  2E5L Q;  3RTX A;  4QCL A;  4IZ8 A;  1SCU B;  2A68 C;  1KRT A;  1LT5 D;  3RZD B;  1Q82 C;  3OMG A;  5GAD C;  1GHK A;  4AH6 A;  5ISR A;  3HXL A;  3K7U C;  1IBK Q;  2J9G A;  2X0S A;  3JAM W;  2XRQ D;  2GVA A;  2WB1 B;  1EKV A;  3ZYY X;  2CNV A;  1AFP A;  2ID0 A;  3F2U A;  4DV2 L;  2R85 A;  1L0Y B;  3GV6 A;  2DN8 A;  3KK7 A;  2VUM B;  2NVT B;  1HH2 P;  1B53 A;  4XXE A;  2PN1 A;  3U0G A;  2JA7 A;  2JA7 G;  3GTP A;  3OTO Q;  1CKO A;  5I5U A;  4J9P A;  3IN5 A;  1NJI C;  4FF2 A;  3T9B A;  3CC7 A;  1Y1W B;  3R2I A;  4QB4 A;  4A3I G;  5KG0 A;  2W6M A;  4YR3 A;  1CK1 A;  1D1K A;  3I70 A;  1A0G A;  5C4X B;  2NU6 B;  3VR3 A;  4DGZ A;  4JUZ A;  4AYB G;  3DAA A;  4RG1 A;  4MAM A;  2ZM6 H;  4BWG B;  1A0I A;  4BBR B;  1MZB A;  1QIL A;  1S40 A;  1JE4 A;  4GN3 B;  2O03 A;  1RJR A;  2F3V A;  1FGB D;  1KJ8 A;  2V4R A;  1K9M C;  3PQI A;  3HS0 C;  4BWS C;  1STE A;  5EPJ A;  4HMJ A;  1RTO A;  1LT4 D;  4L6T B;  2VQE Q;  3TRZ A;  5NUC A;  1N48 A;  4B3S Q;  1IYD A;  3PR4 A;  4FFN A;  2F0P A;  2JA9 A;  3NBZ B;  1TWG B;  2H4O A;  1T94 A;  4AIM A;  2PO4 A;  2UUC Q;  4FF4 A;  2AQ4 A;  5F9L A;  4ZCK A;  3HEJ A;  4C3J G;  3BQ1 A;  1UC8 A;  1ICW A;  2F0D A;  3OWF A;  4ZKB B;  5J22 A;  3VPB A;  1LTT D;  4DL7 A;  5FK9 C;  2R6F A;  2JA6 A;  4JOI C;  3DMU A;  4UUG A;  4IWY A;  1V1Q A;  3RN2 A;  2RHS B;  3TEH B;  2PMZ A;  3VR6 A;  2VNU D;  1TR5 A;  4KN4 C;  3S16 H;  3CRK C;  2NN6 I;  2FHT A;  4K0K L;  4Z9C B;  3F2B A;  4AQY L;  4QW9 A;  3FP9 A;  4RAY A;  5FLX E;  1EYC A;  2W9C A;  4CJ2 C;  1SE3 A;  5D3D A;  2J6U A;  2MPM A;  4P2C B;  2D0O A;  2E2I B;  2QA4 A;  3KHR A;  1FL0 A;  2V9W A;  4M0J A;  2XC9 A;  4IUT A;  4OIJ A;  2R92 A;  5AJ3 L;  3CCS A;  3T5L A;  2IBK A;  2OQK A;  1LV9 A;  2XCP A;  3I7F A;  2YU9 B;  2DWC A;  5LA6 F;  4A3M G;  2JEB I;  2WDT A;  2K75 A;  5FLM G;  1DOK A;  2CVR A;  2KHS A;  4R8N A;  2GQR A;  3DEP A;  4IOA A;  4C3I G;  2F0N A;  3SXH A;  3T1H L;  1N34 H;  2RF4 A;  1QZG A;  5T14 A;  2RBM A;  4DAP A;  1ENA A;  1PZK D;  4GOP C;  4QUC A;  1VCI A;  3SR1 A;  4FXK C;  2UU9 L;  2ZDG A;  3GTQ B;  3M9B A;  3R5H A;  5LL6 S;  1AZP A;  2HDK A;  4RNM A;  1KTA A;  3K5M A;  4IWX A;  4JI2 L;  4CMD A;  1L1O A;  4MTN A;  3WWJ A;  1AUV A;  2AGP A;  4K2L A;  2JA6 G;  4J0M A;  3NUA A;  1EY9 A;  5CAE B;  4LF8 H;  2VL6 A;  1IXR A;  4B3T H;  4MHE A;  3PIP A;  5DQI A;  2M9V A;  3GTJ H;  4J9M A;  1EUJ A;  5ELD A;  3J80 W;  1LT6 D;  2ASD A;  4N9T A;  4R7R A;  2DNE A;  2NVY H;  1SRO A;  1KC8 C;  1SYB A;  4K6D A;  1Q81 C;  1HRJ A;  1HQR D;  3NXW A;  3T9E A;  1TWH H;  1EU4 A;  3E6Z X;  3IFT A;  5ELF A;  3S15 H;  3S16 B;  4P71 A;  3LQS A;  1HNW H;  4X66 H;  2Z0S A;  3LNN A;  4O83 A;  1B3Q A;  4RNN A;  1VQE A;  2BQR A;  4UPA A;  5C1P A;  2EJ2 A;  2IP4 A;  4KN7 C;  3VYT A;  4UP8 A;  1FJG Q;  3MFI A;  5J2U F;  2EJ0 A;  3M9O B;  2JQO A;  4X3U A;  1VQK A;  1EYA A;  4MN3 A;  3KHG A;  3GV8 B;  2ODT X;  3T1Y H;  1VQB A;  2FPI B;  3BVG A;  1VQO A;  4RUA A;  4I65 A;  3KDF A;  5DQG A;  1J6Q A;  1EEF D;  4DV5 Q;  3I4M G;  1EYD A;  2YYZ A;  5BWV A;  4HJ5 A;  4O3P A;  1RYR A;  2A6E C;  3VYR A;  1DOM A;  4RWS C;  3DWA A;  3S2D H;  3NWS A;  2E2I H;  3CCM A;  4BY7 B;  3V96 A;  3CQZ B;  1M7J A;  1J5E Q;  2Q2I A;  1AN8 A;  2Z6B A;  5C6A A;  5L1J A;  3ERO A;  1IL2 A;  3BA9 A;  1VMP A;  4HMI A;  4A4I A;  3K6O A;  5DM6 3;  2BCO A;  4JBK A;  5IYC H;  1WCM G;  3JSN A;  4E4T A;  3CRL C;  1IL8 A;  3AEV A;  4LFC H;  3OMC A;  3FHW A;  1WD1 A;  2CQY A;  3R23 A;  1N36 L;  2PW5 A;  4A3K G;  4Q43 A;  4C3H H;  3KFU A;  3EN2 A;  4M8A A;  2Z02 A;  3SI8 A;  1S5D D;  3KAK A;  1E2V A;  4CDC C;  4QWE A;  2GN5 A;  4LK1 C;  3I90 A;  3MWD A;  4X66 L;  1D7Q A;  3HOW B;  1W6J A;  4LF8 L;  3J81 L;  4IFD J;  2KHJ A;  4L5T A;  2VUG A;  1PH8 A;  3OWE B;  2W6Z A;  1I50 A;  4IOC A;  4HIK A;  3GB8 B;  3QZ7 A;  4APV A;  3GLK A;  3J80 c;  3D4W A;  2HUG A;  5JOB A;  2PYK A;  3DM3 A;  2IX3 A;  2W6N A;  2QW7 A;  3UZO A;  1SND A;  2R7M A;  4F4X A;  4I50 F;  3CCQ A;  4G3I A;  4BXX H;  1N32 H;  4C2M B;  3GIJ A;  1T36 A;  1QCB D;  4HNU A;  4DR5 H;  1QB5 D;  2K33 A;  4QMG A;  2O2L D;  2W8K A;  5FPO A;  4O7L A;  5FO9 B;  4LF6 L;  3Q0A A;  3H4D A;  2AUJ D;  4PMW A;  2AQ1 B;  4QWB A;  4LF5 Q;  4HIO A;  4U68 A;  3VOT A;  3X3M A;  1YEZ A;  2K01 A;  5K3W A;  1ZEQ X;  1F9P A;  4QL5 A;  5C0X H;  1IW7 D;  1VAJ A;  1KAA A;  2L0C A;  3KLW A;  3H15 A;  5LMU Q;  4B9W A;  2VQF L;  4ILW A;  1X54 A;  1V9P A;  2UUA H;  2WYO A;  3VNN A;  4BA1 I;  1KC7 A;  1RK5 A;  5HY6 A;  1NCV A;  2BR0 A;  5IYB H;  1T9H A;  4CC5 A;  3T5H A;  1YNN C;  1AW7 A;  3C3L A;  1AZQ A;  3GV3 A;  1E4E A;  4GNX C;  4CDE C;  5GAH C;  1STG A;  2B2W C;  2EJ3 A;  2FMA A;  3OHA A;  1Z47 A;  1KQS A;  4LF5 H;  3A74 A;  3KXY T;  1MSH A;  2IW3 A;  1BKB A;  2RDG A;  4Y8V B;  2MO1 A;  3RBD A;  2VB3 X;  1SEI A;  1V51 A;  3MAQ A;  1V43 A;  4DN4 M;  4GLV B;  2UXB L;  1B9N A;  1CQJ B;  1U4L A;  2IJ0 A;  2B3G A;  1T5X D;  3MWY W;  3EQL C;  1VQ8 A;  3VR4 A;  5CMD A;  4NZN A;  4HN7 A;  4I7Z C;  1E2W A;  5FD5 A;  4AYB A;  1HNW L;  3H40 A;  1I1L A;  2Y4R A;  3A56 A;  5C8Y F;  1KT8 A;  1KBL A;  4C3I B;  4Q0Y A;  2L55 A;  3J80 L;  1L0X B;  1M1K C;  3M9N B;  1F2Y A;  3P1H A;  3AU7 A;  4G7H C;  4YAJ B;  2RSN A;  3F8T A;  1IBM Q;  2YZN A;  2ZJT A;  1I50 B;  4ZRZ A;  1Y1V B;  2COG A;  3D6W A;  2EY1 A;  4V19 0;  1STH A;  2D0P A;  2LXJ A;  5IT9 E;  1F2M A;  5J39 A;  5LMN Q;  4KJN A;  1LT3 D;  1SAP A;  4DXF A;  3R9R A;  3KHH A;  1EOV A;  1TWC B;  5FR9 A;  5CB4 F;  4FFL A;  3MXN B;  3T56 B;  3C2P A;  2KCT A;  5KG1 A;  4F4W A;  3A8I E;  2EYH A;  2EPB A;  1SYE A;  2VUM A;  1ILQ A;  1XNR Q;  4O7Y A;  4DXG A;  4ECY A;  3UQ8 A;  1CUK A;  3GTK H;  2ZXO A;  1OO9 B;  3BU2 A;  4LAA A;  3M3Y B;  1E3P A;  2PPB C;  1HA6 A;  1K1S A;  3CQZ A;  3U54 A;  3HKS A;  2R87 A;  2B39 A;  2PZT A;  4B3T Q;  2NVQ B;  1XJV A;  3S14 B;  3PO2 H;  4O42 A;  3RMH A;  1BQQ T;  1PYW D;  2XCA A;  5KFS A;  1CA5 A;  2BH2 A;  3TY8 A;  3H3V I;  3PW7 A;  3QG1 A;  1WCM A;  2AMC B;  4PMB A;  1CTM A;  3VA5 A;  3I2Z A;  4X64 L;  2A69 C;  1M0T A;  4LF6 Q;  5JPM C;  4X62 Q;  2VW9 A;  1WTX A;  5JH7 F;  3E3X A;  2XIG A;  3U50 C;  1UE6 A;  2PI2 A;  3S1M H;  4JW0 A;  1Z2N X;  3J7A V;  2HG8 A;  3M4P A;  3U4Z A;  4KKT A;  2DPJ A;  1S4Z A;  4CHI A;  3J81 W;  3MR3 A;  2VQF Q;  4BY7 G;  2NN6 G;  3UFX B;  2DJG C;  1TXY A;  2DUD A;  3AQQ A;  3RGX A;  5I2Y A;  2I46 A;  2EIF A;  5COR A;  4B3S L;  3RJ0 A;  4EFB A;  2NN6 H;  3MVV A;  5C44 B;  1UE5 A;  1EUD B;  4DR6 H;  1LLR D;  2F0L A;  2ZM6 L;  2BQ3 A;  3V4S A;  4EEQ A;  4H44 C;  4QW8 A;  4A3J H;  4IUP A;  3W1B A;  5G3L D;  3CCL A;  2K50 A;  1TKW B;  3T9A A;  2HIX A;  4IO9 A;  5EKI A;  5KT3 A;  2LSS A;  1HR0 L;  3KYH C;  2UVW A;  3LML A;  5KFH A;  3NPP A;  1CA6 A;  4J9O A;  4JI5 Q;  2IA6 A;  3PO2 B;  4PZ7 A;  3RZD H;  4NB3 A;  2RGR A;  4ZI7 F;  3M9M B;  1TVX A;  4KKU A;  2YS7 A;  3I55 A;  3A55 A;  3TW6 A;  1Z7T A;  1PH2 A;  4UFZ A;  3EBE A;  3I4N G;  4K6L A;  5BYA A;  3EA6 A;  1W2B A;  5FLM H;  4A3G G;  5FLX W;  3X3N A;  2CCZ A;  2EOT A;  5IY0 A;  1ZYR D;  5KFX A;  4C3I H;  3HO8 A;  3ERQ A;  2VUM G;  3PF5 A;  2NVQ H;  4ECU A;  1DM0 B;  1STA A;  2R93 A;  2HHH H;  3TP6 A;  3ETJ A;  1E0B A;  3T4A C;  2R92 B;  1WD0 A;  3AX6 A;  4UCV A;  3GII A;  3GIK A;  1ESF A;  2B2Y A;  3HRZ C;  3H91 A;  4MNO A;  2R93 H;  1KXL A;  3GID A;  3A54 A;  3K5L A;  1SR3 A;  1GLV A;  3BYT B;  4PDB A;  4QQB X;  1YZ6 A;  1YHA A;  1MGS A;  5IT9 L;  5EZY F;  3RAQ A;  4XQN A;  4ED3 A;  3Q22 A;  1TWA H;  3T9D A;  3I4O A;  3D8G A;  1EHI A;  5KT7 A;  3PW0 A;  1BOS A;  1GSA A;  2EJM A;  4O7N A;  1Y8N B;  4YJ3 F;  5KFE A;  1YHB A;  2EXZ A;  4U67 3;  3HOY B;  4GLW A;  3I91 A;  2YV5 A;  2B63 G;  1XDN A;  2IHF A;  2JSO A;  2R84 A;  2NZ1 D;  4YY3 H;  2DNC A;  3OW7 A;  1TII D;  1UEA B;  2MUY A;  2K5H A;  1I6V C;  4K5X A;  4GKK H;  4DR4 L;  1TS5 A;  2M2L A;  3OHB A;  1VQG A;  2C00 A;  1I3Q H;  5KND A;  1EFW A;  4A3L G;  4A3C H;  3TSS A;  3BDC A;  5G3L F;  4XZ3 B;  1BXT A;  5I9O A;  3TRE A;  1KDB A;  3L4J A;  4GKK Q;  5LOV F;  4JXU A;  5TSS A;  4APM A;  2VOB A;  4LF8 Q;  4HYK A;  2PQA B;  3STB C;  4YY3 Q;  4DUZ Q;  2F4V L;  1EQQ A;  2YTX A;  2NUA B;  3FKI A;  4POG A;  2YRX A;  1EWH A;  2RDH A;  1KDA A;  1X65 A;  4OO1 I;  2MJ8 A;  4EG0 A;  3JAM E;  1TU2 B;  4HNV A;  5C4H A;  1AE3 A;  1GVP A;  4H02 A;  2JEJ A;  1A3T A;  3G6V A;  1Y1V G;  2EYM A;  1JWM D;  2AGO A;  4FYD A;  3VR2 A;  3DEO A;  4EGJ A;  4IPH A;  4FVM A;  4DV7 Q;  2LKV A;  1HNX H;  1GJX A;  2CW7 A;  2VY3 A;  2JA8 B;  3ORQ A;  2JA5 A;  4Q0F A;  1HNZ L;  4A3E G;  4ME5 A;  3TP7 A;  2LMC B;  5E25 A;  3SK4 A;  5IWA Q;  4DR5 L;  1II3 A;  1WOC A;  3G4S A;  1RL2 A;  4ZAI A;  3DXJ C;  2B2V C;  1NY4 A;  1H9R A;  4DLK A;  2R7F A;  5KGU A;  3ND9 A;  3N44 B;  4DQN A;  5BWW A;  5A2Q L;  3BS1 A;  1ENC A;  1SE4 A;  5C3W A;  4FXG C;  3G6J B;  3R8B A;  4HJ8 A;  4NYE A;  1K83 B;  2IPK D;  1KUT A;  4FFR A;  3WO1 A;  4KKS A;  4DNI A;  2OF1 A;  2Q7D A;  3D6C A;  1GUW A;  1EOT A;  4O4H F;  1A3V A;  2MFI A;  4CJ0 B;  1TWF A;  4MV3 A;  1UAP A;  4CKB A;  5M5Y H;  3H3V C;  4O2D A;  1EIG A;  2JA6 B;  4A3D H;  4JYA H;  5ELN A;  3KJO A;  4RA8 A;  5CV8 A;  4C2M A;  4JI6 H;  4JI4 Q;  1HNW Q;  4LMQ D;  3UZB A;  2ABJ A;  2DIK A;  2J6S A;  2K32 A;  5GRO A;  1I94 H;  3S1Q B;  2JEA I;  4JV5 L;  2B2W A;  1QNU A;  3OW2 A;  3M4Q A;  1HR0 W;  1R9T B;  3H94 A;  4DAM A;  4O7V A;  4UAI A;  3RB0 A;  4KHP H;  1N8R C;  2NBF A;  1TAE A;  3HKZ E;  5L9X A;  4LNQ A;  5IGB A;  4Y7N B;  1HJP A;  5KT6 A;  5GAE C;  4DR1 Q;  3NTI A;  1SNQ A;  2CW0 C;  1N36 Q;  5CE8 A;  4OX9 H;  4FS1 A;  3GO5 A;  4GOP A;  4QJF A;  2R7K A;  4RUC A;  5D1O B;  2F03 A;  5DM7 3;  2COI A;  4EYH B;  1K0R A;  5LMN L;  5M5X B;  4ECV A;  4CKE A;  1QWY A;  2L5T A;  1XPU A;  3Q8Q B;  2RVL A;  1FVI A;  2IT1 A;  3GTO A;  1OBD A;  2OT2 A;  3M4Y A;  1C0A A;  4UCO A;  1HQM C;  2ZXP A;  4LFA L;  1VQP A;  5E4X A;  1I7L A;  1G29 1;  5M3M H;  3H0G H;  2HIV A;  4OEL B;  4MV9 A;  4DUZ H;  1IOV A;  1E4G T;  3STB D;  3I4N B;  4GN5 A;  2W9B A;  1ZXT A;  3CCR A;  5LXT F;  1DJR D;  3KOJ A;  5AFW A;  4OGQ C;  1QVG A;  3HB9 A;  3OUZ A;  2F3I A;  1B7Y B;  5IGE A;  3TME A;  5M3F G;  4Q8F A;  1EYG A;  1JR0 D;  1HUM A;  2IX0 A;  1N33 H;  1ZQ7 A;  1EY7 A;  2CQA A;  4NZO A;  3JAM L;  5K2M A;  3QFF A;  1PYS B;  3S1N H;  4DL5 A;  5L1I A;  5JAV A;  1QJO A;  3TP8 A;  1HNZ Q;  3S17 B;  1SLJ A;  3U9T A;  4J8Q A;  3T1H H;  2FP4 B;  2B8G A;  1TS2 A;  3TIN A;  5HBR B;  1STN A;  2PI2 E;  4IRK A;  2L12 A;  3CCV A;  4XIG S;  2CW8 A;  1VS0 A;  1AN7 A;  2JYO A;  4JC0 A;  1EIY B;  1WTQ A;  1B8A A;  1N33 Q;  3HOY G;  3TW7 A;  1ET6 A;  3W5O A;  5CC4 A;  5IOD A;  1V4Y A;  3M7N A;  1PX2 A;  4LFC L;  5KG7 A;  4ED7 A;  3JAM i;  3K3V A;  5M9O A;  1HR0 H;  3HOY H;  5M5X H;  4DR2 L;  4JI0 Q;  5JJZ A;  5IP9 H;  1N34 Q;  3TQY A;  1VF5 C;  1JCK B;  1I5F A;  2N49 A;  5IP9 G;  2P5Z X;  4FBT A;  3HOX H;  4M9U A;  4RNO A;  2F0U A;  2JEI A;  4KD4 A;  3OHX C;  2KUM A;  3MXU A;  4DA2 A;  5DLG A;  2FPP B;  2IWH A;  1KL9 A;  2Y0S B;  4ODG A;  4Q4D A;  2VA2 A;  1GUO A;  3CP0 A;  4FXD A;  1SYD A;  5IGG A;  2WKD A;  4JI0 H;  1RTN A;  4DNR B;  2QYZ A;  1SYC A;  3UI2 A;  4HID A;  3U4V A;  4Q45 A;  3NTK A;  1MBY A;  1A2T A;  3IRB A;  2OTJ A;  1HXY D;  4DR1 L;  4BY7 H;  2Q2H A;  5EKK A;  1A9X A;  3JZI A;  1RDP D;  1T5E A;  3T1Y Q;  4A3B G;  4YWK A;  5IOC A;  4GNX B;  2R6G A;  3QJY A;  4RHS A;  2F4I A;  5JUM A;  2E5L H;  3T1H Q;  4A3B H;  2YS6 A;  4L5Q A;  3S1R H;  4F87 A;  2HVR A;  1C48 A;  2D2C C;  1TWA B;  1BF4 A;  2EYJ A;  3GIP A;  4YHH Q;  3IG0 A;  3G6Y A;  4A75 A;  4HAE A;  4DR3 L;  4LF4 Q;  1EEI D;  2K14 A;  4ZKC B;  3PIP 3;  1TWG A;  1CM9 A;  4YCV A;  2GPW A;  4NW2 A;  1SN8 A;  3A7L A;  4JBJ A;  2ZJQ A;  2JE6 I;  1FNU A;  3PW2 A;  5M3M B;  3VPC A;  2E2D C;  3TN2 A;  4DKA C;  4YB8 B;  2PBZ A;  4DR7 Q;  3PW5 A;  3T53 B;  2UVR A;  4ECR A;  1DCZ A;  1ICF B;  1IBK L;  5LMN W;  1NBW A;  1SNC A;  4EQN A;  2OTL A;  1JE5 A;  1WH2 A;  2PNR C;  2QIL A;  2NVT H;  2VUM H;  3K5H A;  1KLG D;  3S1M B;  2C9O A;  4C5A A;  1KNA A;  4KJO A;  1JDB B;  3Q8S B;  2VQE H;  4A93 H;  5IP7 G;  2FMM A;  4G4K A;  1I7N A;  5D14 A;  2CFM A;  1JOR A;  5FO8 B;  3K57 A;  2I80 A;  1PH7 A;  5JEA J;  4A93 G;  2WP8 J;  4LWC A;  2IX1 A;  2XCL A;  3CCE A;  5DNF A;  1TY0 A;  4LF9 Q;  2N88 A;  4NMZ A;  5EJW A;  3I72 A;  3Q6S A;  2A68 D;  2RCF A;  5DG7 A;  1R9T H;  2UU9 Q;  4DV2 H;  2HHH L;  5DLF A;  1S68 A;  2FLL A;  2PQA A;  3AFQ A;  3FEW X;  1XMQ Q;  3N52 A;  2FIN B;  3MJF A;  5EKL A;  2YCH A;  1HR0 Q;  3S17 H;  1DYQ A;  1I4H A;  1QVC A;  4OHJ A;  3Q8D A;  2MCT A;  1X3P A;  3NE5 B;  4DV5 H;  5KYL A;  3PVX A;  3GTG B;  1PH4 A;  1B04 A;  2FFK B;  3DF7 A;  1TWH A;  3NQT A;  4KHZ A;  2OXP A;  1C3O A;  4K5W A;  1B2T A;  5KG2 A;  2QGQ A;  3J81 i;  1AH9 A;  5L37 A;  4J6H A;  3F2C A;  4LUV A;  3K5O A;  4IZO A;  5CV9 A;  4AYB E;  4R9W A;  5KS8 A;  2V5A A;  5BN3 A;  1JIH A;  5I5Y A;  4DR4 H;  2A5H A;  4ME3 A;  1LTR D;  1YI2 A;  4F7X A;  3VR5 A;  5KIX A;  3PMF A;  5KT5 A;  5KFY A;  2WIN B;  4DPG A;  2VQF H;  3V2T A;  2A74 C;  4JVZ A;  3KF8 A;  4A3G B;  4LFB Q;  3K80 C;  3R3O A;  1BBU A;  2K5D A;  4DV4 Q;  4GC6 A;  1QG7 A;  2R92 G;  3C1F A;  2ZGI A;  5DGH A;  4DUY H;  3BZK A;  4CGY B;  2JEF A;  1PTO D;  5I5V A;  3IKJ A;  2SNS A;  3OSO A;  1H95 A;  1JXL A;  4A3E H;  2VA3 A;  2E76 C;  3V4Z A;  4DV6 L;  2ALY B;  5CA0 F;  5IYC G;  1JIC A;  5H1S E;  4V0B A;  4LF7 Q;  4X64 H;  4EYI B;  5BR8 L;  2EYL A;  4LH6 A;  1PTO B;  1F9S A;  1I94 L;  4HQ6 A;  5DQH A;  5LL6 b;  2K52 A;