1A0IA

Atp-dependent dna ligase from bacteriophage t7 complex with atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
348
structure length
332
Chain Sequence
b'VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDGVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFHRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQAAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWWKMKPENEADGIIQGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFDACTINPYDGWACQISYMEETPDGSLRHPSFVMFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Crystal structure of an ATP-dependent DNA ligase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Ligase
total genus 89
structure length 332
sequence length 348
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF17879 DNA_ligase_C DNA ligase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a0iA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1a0iA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1a0iA01
4DV6Q 4PZ8A 1U5KA 2EIFA 1EQRA 4C3IH 1CKMA 1L1OC 3GTJH 2UUBQ 2E2HH 3HOWG 4AYBG 3PN1A 4GNXB 3UE0A 4KHPL 5AJ3L 3SGIA 4LF8Q 2UUBL 3S2HH 1JJCB 2NVYH 1Q82C 4JOIA 4HJ7A 2CCZA 1FVIA 1C7YA 4B3MQ 4C3JH 1X54A 4UCRA 3J81i 5LMNW 2DUDA 4DUZQ 5DISC 4B3ML 3HOUG 1VQEA 2K5NA 2HIXA 4DUZL 3GTKH 4AYBE 2JA7G 4PZ7A 4A75A 3CCLA 1X6OA 4GKJQ 1C0AA 3K7UC 1X55A 4DNIA 2HT1A 1AE3A 3F2CA 4APVA 5GADC 3CCMA 5GROA 4QGUA 3ERSX 2I5HA 4R4OA 1VS0A 2CFMA 1K73C 1KQSA 1OTCA 4UY8C 3PCOB 5GAGC 3GTOH 4GKJL 4P74A 3UDGA 5ELNA 2UUCQ 3EIVA 1LYLA 4NB3A 4A3DH 1S68A 5D1PA 3PUWA 1WCMH 4R4TA 4GKKQ 1PH2A 1W3SA 2ID0A 4IPCA 4IOAA 2JQOA 3OTOQ 2UUCL 2UXBL 4BXXH 2CWAA 4YCUA 2Q2TA 3KDFB 2B29A 3I2ZA 4PMWA 1L1OB 4YWLA 1N33Q 5IY0A 2DGYA 3LGJA 2ALYB 1XPUA 2HHHL 1JJ2A 1SLJA 1GM5A 1N33L 5GAEC 4LNQA 1NTGA 4DK3C 4DV3L 1Q7YC 2HIVA 3PUXA 3EN2A 4GS3A 2ZTDA 4HJ5A 4JI7Q 2OQ0A 4JCVE 4O0AA 4LF5L 3CC7A 2UXCQ 3RR5A 1OXVA 4L5SA 3CCUA 4OWWB 3I4NG 1YEZA 4IFDJ 1E22A 1KRSA 1KD1C 4AQYL 1ASZA 3I4MH 4FDBA 5M5YH 1VQAA 1WCMG 3RN2A 3RN5A 4BY1H 3DLLA 3CAMA 3I7FA 1E1TA 4QQBX 1RIPA 1HNXL 1XK5A 1I5FA 3UE1A 1S72A 5IYDH 3BZCA 1YJWA 4B3RQ 5FLMH 1Y14B 4OXPA 4DPGA 4A3FG 2NZHA 1K3RA 1K0RA 5EAYA 1YIJA 4KLKA 4RMFA 4LFCL 1L0WA 4X65Q 4NXML 3TRZA 3F1ZA 1PH6A 2JA6H 1Y1VH 2R7FA 4YWMA 1D7QA 1E24A 4X65L 5JEAJ 5JEAG 3ICEA 4JBMA 1VQJA 3TS2A 2Z6KC 4GLAC 4DR7L 1X3GA 1YZ6A 2JEAI 1VQBA 2MQHA 4DV7L 4IPDA 3CCEA 4DR4Q 2R93G 3RNUA 1I94L 3L0OA 2QEXA 1NE3A 4A3BG 3UQ8A 4OX9Q 4CC5A 1XMOQ 4DR4L 1Q1EA 3CF5A 3MXNB 2MNAA 3GO5A 2VUGA 1Y1WG 2B3GA 2VZAA 1UEBA 1AE2A 2VW9A 1XMOL 1P16A 3I56A 3CD6A 1OXUA 5M3MH 4Y7NH 4PZ6A 2UUAL 1GO3E 1TXYA 3HKZG 2KHJA 1B8AA 3S1QH 1YHBA 3NEMA 1GD7A 1FL0A 1SE8A 4DV2L 4P71A 4JI2Q 3CCRA 1J5EQ 5C0XI 4HIMA 2OWOA 4UCVA 3PIPA 2K52A 5AJ3Q 1TWAH 5C44H 3K81C 1VQ7A 2R7ZG 5J3BA 1EYGA 4JI2L 1J5EL 5IP7G 2VQEQ 1LTLA 2UXDQ 1I50H 1BKBA 3HOWH 2YYZA 4J15A 1V9PA 3HKZE 2VQEL 3BAAA 2RHQB 1B70B 2JA9A 4A3LG 1CKNB 3HOZG 1TWFH 1Q46A 1EOVA 4EEQA 2ZJPA 4LF9Q 3RZOH 2K50A 2LSSA 2JA8G 4JOIC 3JSNA 4ALPA 4B3TQ 4KI0A 2RHSB 3CXCA 2F3IA 1PH9A 4QIWE 3HOUH 2MFIA 2K75A 1G291 3E9IA 3RLNA 4JBWA 4R4QA 4B3TL 2GN5A 4A3MH 2JA7H 5BR8Q 4X6AH 4OO1I 4UCOA 2KCMA 2BH8A 4JI5Q 3I4OA 4JI3L 4DV5Q 1A8VA 5BR8L 1HZBA 1S3OA 1VQMA 3HOXG 1XNQQ 3NC0B 4X62Q 3S14H 1WFQA 2QGQA 4DV5L 3CPWA 3JSLA 3PF5A 5IE8A 2D0OA 4YHHL 4X64Q 4DV6L 4GLXA 1XNQL 1QVCA 3M9BA 5D1OB 3G71A 1N36Q 1VQGA 2ZTCA 2WB1E 3GTQH 2ZTEA 5M5XH 4X64L 2EXDA 4LF8L 1VQ5A 4DV4Q 4B3SQ 1Q8KA 4NPSA 3GTPH 4A3GH 3FKIG 1SFOH 1EIYB 1YJ9A 1RL2A 1BBWA 4DV0Q 1QZHA 4X66Q 3KYHC 4A3JG 4A3KG 1BBUA 4DV4L 1Q81C 1PA6A 1FJGQ 3GJXB 4YY3Q 3I55A 2UUAQ 2GVBA 4JI1Q 4QL5A 1KC8C 4ME3A 2AWNA 4X66L 4LF4Q 3S1MH 4A3MG 1FJGL 3D31A 4YY3L 1CUKA 4JI1L 2VUMG 1TAEA 5IWAQ 4LF4L 1CSQA 1VQOA 2PQAA 3K8AA 1X3EA 2E2JH 2WAQE 3A5ZB 5IWAL 2D62A 2Z0SA 3A5UA 1A63A 3CCVA 3I4NH 3G48A 2ZM6Q 4XIGS 1JE5A 3FHWA 3K80C 3PUYA 3M4OH 4EX5A 3G6EA 1VQKA 4A3GG 2ZM6L 1MJEA 3E9HA 4IJLA 3KJOA 1WOCA 3CP0A 4OONA 3H15A 4GKKL 2F4VQ 4WJ4A 1SROA 3M85A 1H95A 1KXLA 2WP8J 2N78A 3QWUA 3OTOL 4A3FH 2XTIA 4L5TA 2JK8A 2F4VL 2UU9Q 4MTNA 2BA1A 2OQKA 2AMCB 2I5MX 1E7ZA 1FGUA 1KHIA 1T9HA 2MO0A 2OCEA 2PMZE 1VQLA 2JA5H 1HNZL 2K5VA 1KIXA 1I3QH 4HJ9A 4A76A 1SN8A 4H02A 3G4SA 2R93H 3ULJA 3CCJA 5IYBH 5E7NA 1IBKQ 4JI7L 4A3BH 1YBYA 3U4ZA 4R1JA 3J81c 3RLOA 1TA8A 2UXCL 3TREA 1IBLQ 3PO2H 2VY3A 1Y1WH 4JG2A 4DR6Q 3H0GG 4UP9A 4HJ8A 1VQPA 4C3HH 4DR2Q 3E0EA 1IBLL 2ASBA 4EFEA 3D0FA 4EQ5A 4GN5A 4GOPA 4B3RL 1HR0Q 3H3VH 2AWOA 4POGA 4P72A 2H5XA 3CC4A 2IX1A 2K14A 1P8LA 4BY7G 1PFSA 1UE7A 2JA5G 4A3IG 2R7ZH 4RG1A 2LXKA 4YWKA 3ULLA 5IP7H 2VNUD 1QUQA 3KF6A 5C4XG 5IYBG 4BA2I 3L2PA 4EFBA 2KBNA 3UDXA 5C0XG 5C0XJ 2JJQA 1WI5A 4DAYB 1M90C 4JI6Q 3KLWA 3AYHB 4A3LH 4DUYQ 1HNWQ 3HOZH 4DK6C 4JI6L 4OX9L 2NZOA 3F8TA 4YCVA 4DUYL 2JA8H 3HKSA 4JC0A 4AIMA 4DR1Q 3S16H 2FXQA 3K7AH 3RZDH 5FJ8G 1WJJA 3L7ZC 4KHZA 1VQ4A 3NELA 4UCUA 4HJAA 2Q2HA 1Q86C 3GD7A 4IOCA 1Q12A 4O2DA 1VQ9A 4BBSG 1PV4A 4K0KQ 2QA4A 3M4PA 1V43A 1EFWA 2R92G 4QJFA 1VQ8A 4LF7Q 1KRTA 3PIOA 2N49A 2A8VA 1YJNA 2NVTH 2IY5B 1XNRQ 1MKHA 4K0KL 1XTDA 4BBRG 3U58A 3HOXH 1IL2A 4P73A 5DLQE 3CPFA 1V1QA 2YTXA 1ASYA 4OO1G 1U0LA 4LUVA 2UXDL 2KCTA 4JI8Q 1EUJA 1O7IA 3CW2C 2ZJRA 1PH1A 3HOVH 4MZ9A 1XDNA 1I6HH 2IHFA 3AEVA 2XGTA 2EQSA 1VCIA 4LUZA 3FKIH 5JJLA 3UDFA 4JV5Q 3F2DA 3CCSA 4LF9L 5H1SE 4A3JH 3J80i 1SR3A 4A3KH 3NENA 3HFZB 2N3SA 1JMCA 1X56A 2NVXH 4LF6Q 3PO3G 2WB1G 1K83H 1IYJB 3KOJA 1VQFA 4HIOA 1VQ6A 1NMFA 1OXXK 1PH5A 2VUMH 4CC6A 1IXRA 1DGSA 1R9TH 3W1GA 3NBZB 5C3EG 3JAMi 3PV0A 2N8NA 4GN4B 1K8GA 4JI5L 1BVSA 2GVAA 1YNXA 4R4IA 1A62A 1X3FA 2NN6I 3S2DH 4TVAB 1LM0A 4DR5Q 3GTMH 4JYAQ 4X62L 1K8AC 3HOVG 2ES2A 4HIKA 4GNXA 4E6NA 4DR5L 3CMEA 1SRUA 4JYAL 5C4JH 2WAQG 2HVQA 3A74A 1Z9FA 1C9OA 5LMNQ 3TY5A 4JI4Q 4UCTA 1UE5A 3VNNA 4L5RC 3T1YQ 5LMUQ 4B3SL 1N34Q 1NJIC 3PF4A 3BA8A 4LH6A 5LMNL 4DR3Q 3GDEA 1PYSB 4DV0L 4PG3A 3T1HQ 5ELOA 4A93G 3T1YL 5LMUL 1XJVA 1N34L 4KHPQ 5JJIA 2A1AA 3BJUA 4DR3L 1UE1A 3B6YA 4DKAC 1JB7A 3IRBA 3T1HL 1X65A 1W2BA 3S17H 1YHAA 1CKOA 3KF8B 2HQLA 2K5HA 3RTXA 4JI0Q 5HGQA 1HZAA 1YI2A 3TY9A 2R7DA 3BA9A 4JI0L 3J80c 2KHIA 1HZCA 2Y0SE 3J81j 5JJKA 1VQHA 4A3CG 3H0GH 4OWXB 2YTVA 1E3PA 1TWHH 4AH6A 4DRFA 4A93H 4IFDG 2CKZB 3AQQA 5M3FG 2PQAB 3JC66 3ER0A 5FLXc 2E2IH 1SMXA 4A3EG 3KDFA 1IBMQ 3JAMc 1WYDA 1MJCA 1Z47A 2JEBI 3W1BA 1L1OA 4TQUS 2L15A 3MEFA 5HY6A 3S24A 5M5WH 1HJPA 3HOYG 1KAWA 4BY7H 2UU9L 3EBEA 1OXSC 4A3IH 1IBML 1N36L 4LFAQ 4LFBQ 2UXBQ 3AFQA 2F52A 5C4XH 3AFPA 1N9WA 1VQNA 3M7NA 3STBD 1GVPA 4LFAL 3ZJYC 1EWIA 4LFBL 2WFWA 2YTYA 1VQIA 3PUVA 2OTLA 2ATWA 3PGZA 1IBKL 3S15H 1OXTA 3M3YH 3J7A5 2HHHQ 3BZKA 1QVFA 5GQOA 2V1CC 1EIFA 1GKHA 1HH2P 5FJ8H 4DR6L 1MIUA 1PH4A 1IZ6A 1PYBA 2JE6I 4R4CA 4DR2L 1QZGA 2LXJA 2Q2IA 2YU9H 4LF5Q 1AH9A 2HVRA 4P75A 3OYYA 1L2FA 4BBSH 2R92H 4AQYQ 1N32Q 3BABA 1QVGA 1HR0L 2KENA 3W5OA 4DV1Q 3J7ZC 3K0XA 1XMQQ 4A3DG 4BBRH 1HNXQ 4POFA 1N32L 3F2BA 1PH7A 4UCSA 1VQDA 1HZ9A 4DV1L 1N8RC 1NBWA 4Y52H 1HNZQ 1XMQL 2A19A 2IHEA 5GAHC 4NXMQ 4BXXG 2PNHA 2VS1A 4XTCS 4GOPB 1S40A 4LFCQ 5IYCH 4IO9A 4LUOA 4HIDA 5K36G 4MNOA 1HNWL 1PHJA 1LUZA 4GN3B 4DR7Q 1HR0W 2CQOA 1NMGA 1G51A 1E1OA 4IFDI 2AHOB 3PSIA 4DV7Q 3KFUA 3PO3H 4LWCA 1QUQB 3KF6B 1PVOA 1I94Q 2RF4A 1UE6A 4GLVB 4OWTB 3WWVA 5IP9H 4DR1L 1X9NA 3GTLH 2VL6A 3CQZH 3CCQA 2MO1A 1Q1BA 2IX0A 2K4KA 5C3EH 3I4MG 3TY8A 4LF7L 2I5LX 4BY1G 2E8GA 4A4IA 1YVCA 1K9MC 2E5LQ 1KL9A 3TQYA 1VQCA 4LW1A 1XNRL 2OTJA 3BU2A 2HVSA 2B63H 3GTGH 2E5LL 4JBJA 5IYDG 5IYCG 3GB8B 4QY7A 5FLMG 2BA0A 1D8LA 2PI2E 4DV2Q 1CSPA 3OW2A 3VDYA 1XPOA 2NVQH 1YITA 1JJGA 1UWVA 1TWGH 2R6GA 4JI8L 2IT1A 1CKNA 1Y1VG 4GNXC 3ULPA 2JA6G 3RLFA 4WJ3M 1B04A 2D0PA 2NN6G 4L5QA 3UDIA 3NBYB 5IT9c 1PH3A 2CWPA 2Z6KA 4JV5L 4NXNQ 5IP9G 1M1KC 4BA1I 4GOPC 1PH8A 3M4QA 4UPAA 2RCNA 3NBHB 4IPGA 3STBC 3U50C 1XPRA 1EQQA 4LF6L 2I0QA 4LH7A 3DM3A 2PI2A 4NXNL 1JT8A 3Q8DA 3TEHB 3KJPA 2AKWB 2VQFQ 4IPHA 2BH2A 2Q2UA 3H3VI 3U4VA 2YV5A 2B63G 3S1NH 2VQFL 4DAMA 5M3MG 3CC2A 3PO2G 3A0JA 2C35B 1A0IA 3PUZA 3S1RH 4UP8A 4A3CH 5D1OA 1G6PA 3FP9A 4UP7A 4JI3Q 4IJHA 5FPRA 4DV3Q 4C2MH 5M3FH 5FPOA 4UFZA 3CMAA 4A3EH 4JI4L 1TWCH 2Y0SG 5C44G 2ZJQA 1J6QA 4JBKA 1B7YB 3TS0A 4YCWA 1YHQA 1NY4A 3HOYH 4YHHQ
chains in the Genus database with same CATH superfamily
2XGQA 4DV6Q 2EIFA 4C3IH 2UUBQ 2DNEA 4K5WA 2HGSA 1PTOD 5EKIA 4RNNA 3H94A 3P1HA 3GIPA 4N9PA 3D6WA 4LF9H 3V2TA 4FXKC 5IT9W 3W3AA 2K5DA 2RGRA 2R82A 4NLGA 3V6KA 3Q22A 1JOKA 5DISC 3PO3B 1VQEA 2K5NA 1K1SA 2WDTA 5KIXA 4AYBE 4DL3A 3QOLA 4A75A 1GUSA 1X6OA 5LXTF 1AN7A 1AE3A 1G91A 3DEPA 3CCMA 5I4DA 5C3EB 4O83A 2HVRA 1OTCA 1VS0A 4GKJL 3PCOB 3GTOH 1EZ1A 4P74A 2I87A 2ALZA 2K7VA 2B63B 5ELNA 5I2XA 3EIVA 1S68A 2B2TC 5M3MB 1WCMH 1N48A 1F9SA 1DOKA 1W3SA 2YRWA 2CQAA 2ID0A 4DV4H 4OGQC 2AGQA 2F4IA 2JQOA 3OTOQ 1TWGB 3IKJA 2UXBL 5LMNH 1I4RA 5FKAC 2R8HA 2B29A 1HXYD 4L63B 1L1OB 2IJ0A 2F0JA 4YB8B 3LGJA 3GV5B 2Y0SB 2XRQD 3BDLA 3I72A 1N33L 5I5VA 1TKWB 3DEOA 1IOVA 2ZTDA 2C28A 3SVMA 4JI0H 5JVDF 1FNWA 3OSOA 3CC7A 4OWWB 2J9GA 4WHXA 2ZM6H 1B2TA 1YEZA 1S5BD 2A74C 3RN5A 2X6GA 4NP5A 2MJ8A 5KG5A 1E1TA 1HQRD 1A9XA 2NTTA 3GTMA 2YZNA 1I5FA 5IYDH 5T1IA 2HDLA 2AQ4A 1RYRA 1F9RA 1YJWA 5L9XA 1Y14B 3GTPA 4M1UB 1K0RA 5EAYA 1YIJA 4NXML 4IHJF 3TRZA 4LFCL 4O4HF 1SFOA 2UU9H 1Y1VH 2NN6H 2O5JC 1PTOF 4H13C 4MN3A 3R5XA 4GC7A 3GTJB 3WO0A 2E2HB 3TS2A 4XQQA 1BNCA 4G3IA 3D4WA 2MQHA 3NSWA 2EPBA 4IPDA 2HGXA 1I94L 1IBKH 2JEGA 5LL6S 5EBDA 2PW5A 2W57A 1Q1EA 5KYIA 3MXNB 2AQ1B 2MNAA 3K3VA 2F0MA 4MAMA 2K01A 3R3OA 4DR6H 2VZAA 1UEBA 4ZI7F 1AE2A 1XMOL 1EEID 2K05A 3CD6A 1OXUA 5M3MH 4PZ6A 3Q2OA 2R7KA 3T13A 1GO3E 5JJZA 4O7NA 4G7ZC 4HNTA 3RJ0A 1SCUB 4TQRA 3MA2B 4F4ZA 1GD7A 2PW7A 2FJ2A 2HHFB 3SK6A 3AMUA 4JI2Q 1J5EQ 4Q8EA 2E2JB 2OWOA 4KV6A 4X3UA 1KDAA 3ND8A 3K81C 4RFBA 2ASDA 2JA5A 1BKBA 3N43B 4JI6H 3HOWH 2YYZA 4TQSA 3HKZE 5CB4F 4ED1A 2RHQB 1B70B 3HOZG 5HNEA 3T7AA 2ZJPA 3H6MA 1H9JA 4XT3B 4MTDA 3PW7A 1WTQA 1DONA 4HYKA 3HOUH 5JJKA 1G291 4B3TL 4JBWA 4K0KH 2GN5A 4N8X1 4A3MH 1TY0A 4OO1I 3OHAA 3NK9A 1PYWD 4JI5Q 1DYQA 1XNRH 4JI3L 4ZQIA 1Q90A 1HZBA 1JIHA 5E3FA 4ZUIA 1LTTD 1S3OA 2M9VA 2KECA 3HOXG 1VQMA 1XNQQ 1VBGA 4ECXA 2FPPB 2UVUA 1WFQA 2R7ZA 4DV5L 2WINB 3PF5A 4F4XA 4YHHL 4X64Q 4O4IF 4QIWA 1QJOA 3MFIA 1PFBA 1D5MC 2EZVA 1DV1A 1VQGA 2WB1E 5I5WA 3EYYA 1EKFA 1ZKOA 4EQPA 2EXDA 4LF8L 1VQ5A 2JA6B 1EIYB 1YJ9A 1BBWA 4DV0Q 1QZHA 4X66Q 1V51A 4A3JG 4A3KG 1Q81C 3J7YW 4TM5A 2R8JA 4LF6H 4QL5A 2W6MA 5IYZF 4O2BF 2DNCA 5KRUA 4JXUA 2K5QA 1FJGL 3D31A 4YY3L 4RGMA 5L1JA 2VUMG 1RJQA 4LF4L 1CSQA 5KG0A 1VQOA 1VF5C 2PQAA 3BYTB 3K8AA 2PZTA 4ZRZA 3VR2A 4LMQD 2E2JH 3RB3A 4Q4CA 4FGRA 1B6RA 1NCVA 4IFDH 1JE5A 3FHWA 4NYEA 3PUYA 3M4OH 1ZHSA 4A3GG 2VA2A 1MJEA 2DIKA 2YWVA 3G8DA 4IJLA 2PBZA 4NW2A 2F4VQ 3M85A 4HN2A 3DTGA 4X3KA 3TP8A 3FKIA 4MTNA 2OQKA 4IWXA 4NZNA 2AMCB 2DJFC 2I5MX 2NVXA 4XYMB 1KHIA 2MO0A 2F0WA 4ZKCB 3KLSX 4JV1A 1TS2A 1I3QH 1SEBD 5E25A 2Z8LA 3MXGA 4H02A 4ILWA 3G4SA 1WTWA 3CCJA 1S5ED 4B3MH 3U4ZA 5KFLA 3BQ2A 1KJJA 4J9QA 2UXCL 3ND9A 3SK4A 2F0QA 3ITPA 1Y1WH 4JG2A 1C8CA 1VQPA 2CW0D 2EYOA 1EY8A 4ZAIA 5F9NA 4QWAA 1S10A 1A3TA 5IOCA 5J39A 1HR0Q 2AWOA 2CW8A 1NNXA 1STHA 1ET0A 2H5XA 2LY7A 4J1MA 2K14A 3S14B 2JA5G 2C9OA 3ULLA 3UZOA 5KNDA 3KF6A 4HEDA 4BA2I 3L2PA 1TVXA 4QMGA 1M90C 2JJQA 1WI5A 4DAYB 2L5TA 4C1NI 4A3LH 1EL0A 1K0SA 2HHHH 2IBKA 4MV8A 2FMAA 2RKSA 1BXRA 4DUYL 1PXUA 4QWEA 4K6NA 4ED2A 4CMDA 5KFZA 5COYA 3EPIA 2FXQA 5EQ0A 3H0GA 5FJ8G 1TWHA 5ELFA 1SSOA 3MTSA 2RDFA 3BDCA 5CM0A 3GD7A 1ET9A 4XQNA 4OHJA 1VQ9A 4BBSG 1W93A 4AQYH 1D7QA 3Q1KA 2QA4A 1EFWA 4ECSA 2A8VA 1XMQH 4EQOA 4QWDA 3CKIB 2N55A 3DWPA 1MKHA 1HNXH 4HTHA 4BBRG 3GTOA 2RBMA 1IL2A 4P73A 1JICA 1V1QA 1STAA 3CPFA 3NTKA 1ASYA 1U0LA 1FNUA 4OO1G 1JC7A 4JI8Q 1EUJA 3MR2A 2CQYA 1I6HH 1IYEA 4X65H 3AEVA 4O3SA 5JJLA 4DR7H 4JV5Q 4LF9L 4K2KA 4DL7A 1JMCA 3NENA 3GQCA 4BY7B 3DMUA 5KFJA 2OXPA 4NDXA 3K3PA 4I7AA 1OXXK 1PH5A 3MEHA 1DGSA 5DGHA 4ECQA 1EYDA 4J9NA 4U68A 3R23A 1BVSA 2GVAA 2CW0C 3M3YB 1X3FA 2NN6I 4TVAB 3HP3A 2K04A 4DV2H 1SNCA 3K6OA 4N9TA 4JYAL 5C4JH 4IUNA 4O3PA 4IUPA 4XQJA 2YS6A 2DWCA 2R92B 5LMNL 2UVVA 3GDEA 4L8JA 5IGDA 5K3WA 4EVOA 3T1HQ 5ELOA 2F3WA 4O81A 1NAPA 1EU4A 4FBTA 1MSHA 3B6YA 1WTRA 4FM9A 1H9SB 1SNDA 4CDCC 1CKOA 4WBNF 3MXUA 5H80A 1ZXTA 2KVMA 5T14A 4MV6A 2J6TA 3T5JA 3BA9A 4QWCA 1SJED 5KFMA 1NR2A 1SNOA 3J81E 4JI0L 3J80c 2KHIA 3S16B 2X0SA 3L4JA 3RZDB 4GZYC 2COJA 1EY6A 5C5LA 5KFCA 5KT2A 2B63A 3L9AX 4DRFA 3MR3A 1EZ6A 1L2ZA 4DV3H 2CKZB 4O84A 1TWGA 3ER0A 4A3EG 3OMCA 1NSNS 2NVTB 1KBLA 2ZDGA 2ENBA 1MJCA 4UY8C 2JEBI 5JQGF 1L1OA 5HY6A 3MEFA 3TEKA 5M5WH 5A2QW 1RK6A 3Q8RB 4BY7H 2F1MA 4C3IG 2UU9L 2Y0SA 4DNRB 2EJGC 3PMFA 4LFAQ 1JXLA 5D3DA 2UXBQ 4G7OC 2A6ED 4JUZA 5C4XH 1C48A 1EOTA 4TV9F 3STBD 2GLTA 4MV3A 1CA5A 1WSCA 2WFWA 1AZPA 4O7YA 1IBKL 3S15H 4A3JB 4A3KB 1BOSA 3M3YH 1JOOA 4DA2A 1QVFA 3M9NB 4JI1H 1IYVA 1TR5A 1PZKD 4HCEA 3FMAA 4PV1C 3QB3A 4GKJH 1EIFA 4IUVA 4DR6L 2D5DA 3JAML 2VUMB 1N56A 4R4CA 1KNEA 3R8BA 2OH2A 3TMEA 2R92H 1LTGD 4QSHA 2KHSA 4IRKA 4DV1Q 3J7ZC 2XNAC 2ZJTA 2PMZB 4UCSA 1S97A 4POFA 2FLLA 4IR1A 4IWYA 3GTJA 4GKKH 2E2HA 3U54A 1I4GA 1KABA 4Y52H 3PR5B 2A19A 1C3OA 2QEJC 4IZOA 3FMCA 4NXMQ 4LFCQ 5IYCH 3RF2A 3TP6A 3JAMW 1SYDA 4LUOA 1GUTA 1N33H 5M3FB 2R85A 4MNOA 2A6HC 3MXNA 1V1PB 4GN3B 3HOYB 2CNUA 2VPQA 2O4XA 3Q8QB 4IFDI 2AHOB 4XYLB 3GV7B 1QUQB 3A7LA 5NUCA 1I94Q 3I3CA 3T16A 4JI7H 1STGA 3KBGA 2BOSA 3QG1A 1O75A 2HHFA 5DG9A 5C4HA 2M05A 2I5LX 4WRDA 3N44B 1YVCA 2AGOA 1XNRL 4F4YA 4LW1A 2OTJA 3BU2A 2ABJA 2HVSA 3KREA 5IYDG 1EIHA 4B3RH 1S4ZA 3OW2A 3VDYA 1EIGA 2BCOA 3MVVA 4CJ2C 5KFWA 1G2WA 1Y1VG 3ULPA 2OT2A 2NN6G 1BQQT 1GUWA 2CWPA 4CJ1B 5LOVF 1VDZA 1BR9A 3E3XA 4NXNQ 1B9NA 2A6EC 4QUCA 4F88A 5IP9G 2NU6B 3STBC 1XPRA 2RCNA 5E4XA 3A8IE 1R4QB 1EQQA 4LF6L 1EQTA 2PI2A 1GOZA 1JT8A 3G6YA 1SXTA 4OX9H 4ABNA 3KJPA 5BMVF 2LFNA 2VQFQ 1EWHA 5C1OA 3TSSA 2QDBA 2B63G 3GV8B 1G8ZD 2WYOA 5EKKA 2ZT9C 5M3MG 1SE3A 3PUZA 4L1KA 3NQIA 2DZDA 2O2LD 1ICFB 4TRDA 4EQNA 5C6AA 1G6PA 3FP9A 3SXHA 4UP7A 2Z4HA 4JI3Q 5FPRA 5FPOA 5M3FH 2FINB 2PPBC 2JA6A 1UC8A 5FLXE 1TWCH 2Y0SG 4S3SA 1J6QA 1I4XA 3TS0A 1NY4A 4BBRB 5KGUA 4YHHQ 3HOYH 5M5YB 5D65A 4BY1B 2UXDH 1U5KA 1CKMA 1L1OC 5BYBA 2C2EA 4FBUA 3HOWG 2QDLA 1FYCA 4XYOA 4GNXB 3SGIA 4LF8Q 4RH6A 3NHHA 2PN1A 2EOTA 1JKJB 3S2HH 3PO2B 4ECWA 1Z2OX 4JOIA 4HJ7A 2CCZA 3DTFA 1SJHD 1C7YA 5IIFA 2W8LA 4DUZQ 2F0DA 3I8ZA 4ME6A 4ETSA 4B3ML 4ED7A 1E0BA 2F0HA 3HOUG 4J9SA 1QNUA 2BDOA 1BO0A 4LAAA 4MV1A 3G6JB 3U9SA 4CGYB 3IFDA 1EFID 4K5XA 4DAVA 2I5HA 3J7AV 4XYQA 3QJYA 3TZUA 3UDGA 3KHGA 3PVXA 2SEBD 2SNMA 2UUCQ 5D1PA 1LYLA 4YR2A 3D8GA 3PUWA 4RHRA 4Y7NB 4J9MA 2F0FA 3VR5A 3VYTA 4RUCA 1H9KA 1RJRA 2A73B 2J0TD 4G57A 3MWDA 3H4BA 3T51B 3N41B 3HRZC 4YY3H 3C2PA 4DR3H 5IY0A 2DGYA 4LF4H 2NB0A 1TWAB 3K59A 1XPUA 2HHHL 1JJ2A 3GV6A 2FPGB 3NBIA 1I50B 1NTGA 2HIVA 3PUXA 4GS3A 1AZQA 2RQXA 5I5XA 2IA6A 1KAAA 1ICWA 2OQ0A 2M00A 2KCNA 3ETJA 4FFPA 3R9RA 3RD4A 2R84A 2UXCQ 1JWUD 3QZ7A 3EROA 4IFDG 4AQYL 5M5YH 4BY1H 2V4QA 3DLLA 3J7AK 3ORRA 1HA5A 4QQBX 1RIPA 1HNXL 1Z7TA 5I6WA 3BZCA 3GTQA 5FLMH 3PO2H 3LWUA 4DPGA 1K3RA 2NZHA 3TP7A 1IKLA 1HFNA 2SDFA 4KLKA 5FO7B 2RSOA 4A3EB 1I1LA 2ZDQA 5DGAA 2V59A 4I55F 3NUAA 4EGJA 3H20A 4X65L 3GIIA 4PMCA 4C3IB 2JEFA 4JBMA 1H9MA 1VQJA 2EDGA 2F0SA 3L3OC 4GLAC 4DR7L 4RB1A 4LFBH 4WJWA 3RNUA 1KLGD 3L0OA 2MGSA 3WNZA 4CC5A 4DR4L 4XDXA 3TQ1A 3GO5A 4FO2A 2VUGA 3BVZA 1Y1WG 3T9EA 1I4PA 2B3GA 2X69A 3C1EA 3G6VA 4DR2H 1P16A 2OEOA 3I56A 1EYZA 2P0AA 2I07B 4DQNA 4Y7NH 4YAKB 5C3WA 2H4OA 5BPFA 5EPKA 3K0YA 3LQSA 3T5HA 2KHJA 3S1QH 3I12A 3OHBA 3QQMA 3NEMA 5DEHA 1FL0A 2W6PA 4DV2L 4FYDA 4P71A 5KFOA 1GLVA 3KXYT 2E74C 4HIMA 4PNYA 2EY5A 3MWMA 5JVH3 4UCVA 2XSCA 3NPPA 3OWEB 1VQ7A 1TWAH 3GIJA 2XCAA 1WCMB 2VQEQ 1JWSD 4RU9A 1I50H 1V9PA 1EYCA 4DUYH 3DWAA 3VR4A 3BAAA 1HNWH 4A3LG 1CKNB 5HGTA 2X5RA 4FU0A 4LF9Q 4I50F 1LTRD 1JCKB 4JOIC 4ALPA 3JSNA 3RV4A 5KT7A 4ECYA 4YJ2F 4QIWE 2K75A 4ECTA 3PZPA 3V96A 2JA7H 3DAAA 5BR8Q 4UCOA 4LF7H 4O3OA 2BH8A 2R93B 2YYAA 1A3UA 2DPJA 3HG9A 2FKLA 3MR6A 4BWSC 1A8VA 2R92A 4KKUA 1F2YA 2QGQA 2XN9C 1WTOA 1RHPA 4GLXA 1G2TA 4YR0A 2W9BB 1QVCA 3M9BA 5D1OB 4ZK9B 4O3NA 1H9SA 3SK8A 1HPCA 4XT1B 1CFMA 3ERQA 2GA4B 4DV4Q 1Y1VB 1QB5D 1RL2A 2B8GA 2UUAH 4DL2A 3KYHC 2W7PA 3GJXB 3I55A 4J9KA 2GVBA 3T53B 1VKZA 4EBDA 1B50A 4JI1L 1TAEA 1AFPA 1OBDA 3SE7A 2EY6A 2XCLA 1K28A 3LP8A 1ET6A 2YW2A 5IWAL 2D62A 3CCVA 3G48A 4JYAH 2ZM6Q 4YQWA 2G9HD 3K80C 2E75C 4CKCA 2COIA 3T4AC 4ZUJA 3G6EA 1JE4A 1ZEQX 4H7BA 4GKKL 4JI4H 1H95A 4NZMA 3QWUA 3ZYYX 4EGVA 1IOWA 4UHVA 5D3IB 2WTFA 1CS0A 2NWGA 4C5AA 3Q23A 2UU9Q 5KFRA 4X3TA 4A2BA 5JPNC 2UUBH 1LABA 2OCEA 2Z6BA 5JEAH 1VQLA 3PW0A 3HOWB 2K5VA 4FF3A 1RDPD 4HQ6A 2W6NA 4A76A 1SN8A 2VUMA 2LMCB 2R93H 1R4PB 4DIMA 5E7NA 3KUPA 3K5MA 1IBKQ 5ELEA 4JI7L 1YBYA 3OSNA 1SMYD 3J81c 1L0XB 3MWEA 5KFHA 5CYUA 1CM9A 3TDQA 3K5LA 2RDHA 2VY3A 3D3RA 4OL7A 3H4DA 4DR6Q 2PMZA 3HOUB 1I4QA 1PFNA 2PNRC 3EVQA 4C3HH 3KTMA 4RNMA 4A3MB 4CKBA 1IBLL 3BZDB 5A35A 5DQIA 2ASJA 4EFEA 2KA7A 4EQ5A 5KEEA 2FJZA 4RB2C 4B3RL 1EUDB 3OWFA 2I46A 1PTOC 4P72A 3R2IA 4YBZB 3K57A 3Q24A 4BY7G 1XX8A 2EVBA 2NYZD 2QF7A 4J9LA 4RG1A 4YJ3F 3KAJA 1ZYRD 1BNZA 2VNUD 3BJYA 5KFIA 1QUQA 5C4XG 5IYBG 2QCPX 1WTXA 2L0CA 4JI6Q 3I90A 4C5CA 1T5EA 2EY2A 3X3MA 3HBLA 4MV9A 2F0UA 4OX9L 3D4DA 1SNQA 3F8TA 4PDBA 2CH4W 4JC0A 2GPWA 3L7ZC 4KHZA 1VQ4A 4UCUA 4DXGA 4R8IA 2XRSD 1PV4A 4K0KQ 2R92G 1M7JA 1VQ8A 2R3ZA 2ICIA 4DAPA 4P2CB 1XNRQ 3H3VC 2M2LA 5FK9C 4LK1C 4R9WA 3M4OB 1DOLA 3HXLA 1HNZH 2HD3A 1EUCB 4RCOA 4LUVA 4U7CA 2UXDL 1SYEA 2B39A 2KEDA 2KCTA 4K5VA 3DHQA 3HOVH 4O7WA 2IHFA 1ESRA 1OBGA 4O7ZA 5BPHA 4FS2A 2EQSA 3UDFA 1U4PA 2K03A 3OIPA 4ZQ3A 2W6QA 1SR3A 4DV7H 2N3SA 3AW8A 1X56A 4KK7A 5L1LA 4LF6Q 1EEFD 1K83H 1I3QB 2J4XA 1E4FT 1MBYA 2RDJA 3MR5A 3WWJA 1VQFA 2KCCA 5E4WC 1NMFA 4HIOA 4FFMA 1SMYC 2DPIA 3W1GA 2XWBB 3QO2A 1LO5D 2EJMA 4GN4B 4QF4A 3JAMi 1RTNA 1K8GA 1YNXA 1Y1WB 3TINA 4DR5Q 1EY0A 2RA4A 1K8AC 3JZ6A 3M4IA 2KSWA 4GNXA 4E6NA 1WTPA 1S5FD 1EQVA 1KTAA 3SEBA 1C9OA 3NP8A 1K8MA 3P7JA 4JI2H 1J5EH 1RF2D 3T1YQ 3BA8A 4G4KA 1EY7A 1ZYRC 1PYSB 4PG3A 3UI2A 4RB3C 5LMUL 1XJVA 1N34L 5KFGA 5JJIA 1EU3A 2A1AA 5C5JA 4DR3L 1UE1A 2HG8A 3IRBA 4FXGC 5KFFA 3RB4A 1X65A 1W2BA 2C22A 4K8JA 4TKOB 4CE5A 3RUPA 3KF8B 5CV8A 5HGQA 1IL8A 3SDZA 3N52A 3KLRA 5CA0F 1BCPB 1TT2A 2Y0SE 2HDKA 3J81j 1VQHA 3GTGA 5I47A 5LL6b 4OWXB 2YTVA 4QW8A 4HSVA 2NU8B 2CNQA 1B53A 2Q8IB 5M3FG 5FLXc 4O7SA 1KEEA 3NUCA 3CQZB 1WYDA 2PO4A 1A3VA 4UUGA 3HOYG 3S24A 1CQJB 1HJPA 2LKVA 3EBEA 1IBML 4RZQA 5JQWA 1TWAA 4J9RA 1N36L 4X64H 3E0JA 1A6XA 2HJWA 3AFQA 3DUZA 5KX5F 1I50A 4Q5VA 1I6HB 4ZOLF 4DL5A 3ZJYC 5L1KA 5C0XH 4ODGA 1U4LA 3J80L 4LFBL 2WAQB 1BUVT 5DGBA 5DLFA 1OXTA 1GJXA 3J7A5 2HHHQ 3E5NA 1EYAA 2BR0A 4N8FA 2I80A 4XX0B 4ULLA 4A93B 3BYYB 2V1CC 5EJWA 1MIUA 3EPGA 2YU9H 4DR2L 1XXGA 2AUKA 2LXJA 2Q2IA 5CC4A 3GIMA 2MPMA 5KFDA 2EYFA 1Z2PX 3CHBD 4AQYQ 4FFNA 4IR9A 1QVGA 3J80W 2D2CC 3AB9A 1XMQQ 5KFBA 1HNXQ 1N32L 5JOBA 1N8RC 2ODTX 5C4JB 2SOBA 4XTCS 2F4VH 4GOPB 5BWRA 3KBXA 1HCZA 2MUYA 4HIDA 2WKDA 1B4OA 1SBBB 4EYHB 1HNWL 1A48A 2RDGA 5FR9A 4DR7Q 3TQTA 2CQOA 3UZBA 1ML0D 1Y69U 2F03A 3KFUA 4M0JA 4F87A 4OWTB 2NU7B 3MFGA 2RSNA 2KUMA 5KFNA 3EQLC 1EY5A 3CQZH 3CCQA 1RJPA 3U55A 4LSXA 3Q8SB 1TY2A 3TY8A 4LF7L 4KMUC 3GV3A 4BY1G 1CZWA 1WD0A 1K9MC 1CT1D 1ENCA 1KL9A 1VQCA 4RGOS 3RBDA 1WCMA 2E5LL 3GB8B 3OUZA 4QY7A 3GTKB 4RCNA 5FLMG 2BA0A 1D8LA 2PI2E 4MIUA 2AQ3B 5AFWA 4DV2Q 2NVQH 3PO2G 1JJGA 2WE6A 4J9OA 1UWVA 1S0OA 3H09A 4GNXC 5CE8A 1CKNA 3GIQA 1B04A 5CV4A 1STEA 2HDMA 3UDIA 4C56C 1XTCD 5M5WB 1PH3A 3FPUB 2HGWA 3OPOA 2UUAL 4IUTA 4A93H 1PH8A 3X3NA 3NBHB 1JORA 5KFQA 2DJGC 4DR4H 5C4XB 2I0QA 3GQBA 3DM3A 3Q8DA 4JK1C 2R93A 3GILA 3S15B 4CMFA 3GLKA 3U4VA 2YV5A 2D9UA 4BS9A 3S1NH 2AGPA 3VYUA 5KFTA 1KC7A 1SYBA 4UDUC 1KUTA 4LSAA 4OIKA 2W9BA 5D1OA 1CQVA 4IJHA 4I65A 3VMMA 4DV3Q 4C2MH 1Y1VA 3CMAA 1M0TA 5CGKA 4JI4L 2ZJQA 4FVMA 4JBKA 3N40P 1YHQA 1TS3A 3T5LA 4PZ8A 2W70A 2R87A 3NWTA 4AYBG 1G6ZA 3UE0A 5AJ3L 4L6TB 3VYSA 2UUBL 2YRXA 5IGBA 1JJCB 2NVYH 4KD3A 1RODA 2L1BA 1FVIA 4C3JH 1X54A 2EJ2A 1GSAA 3J81i 2R8IA 5LMNW 2DUDA 2FP4B 3SE0A 3MXPA 4KTAA 3BG3A 5C8YF 1T36A 4E4TA 4K6LA 5BN5A 3GTKH 2HIXA 2JA7G 4GKJQ 2F0GA 3K7UC 1X55A 1D1KA 4DNIA 4I4TF 5GADC 3ETHA 4MA0A 1A2TA 3ERSX 5CBEE 4X62H 5D8DA 1GUNA 1W96A 3PR4A 5F2DA 1CHPD 3CSWA 4A3DH 2DN8A 4GKKQ 2XGPA 4B3SH 1AUXA 4IPCA 4BXXH 1O7YA 2Q2TA 2EE1A 2EYMA 2NZ1D 3BQ0A 3KDFB 2R61A 4ECRA 5KKNB 4RNOA 1ILQA 4YWLA 3BVGA 1N33Q 1EY4A 2ALYB 3T1HH 3HO8A 2XIWA 3C0FB 5GAEC 5IWAH 1EY9A 2RVLA 3SI8A 4HJ5A 1JWMD 3KK7A 4JI7Q 3MC0B 4JCVE 4RAUC 1TWFB 5KFAA 4L5SA 3KALA 4IFDJ 1E22A 3PN1A 2IX3A 1ASZA 4FDBA 3I4MH 1WCMG 3G8CA 3RN2A 1I7NA 2WACA 4PBCA 4WD3A 3CAMA 5KYLA 3PIP3 3WWIA 3UE1A 2NU9B 2K6AA 2DABA 2B2UA 2EY1A 3FPPA 4C1NK 5I6YA 1HNZL 4B3RQ 1L0WA 2ICEC 1TWCB 1DZ1A 1QE6A 1DAAA 4YWMA 1K3BC 5JEAG 5IT9E 5DAAA 3IFTA 1X3GA 3TW6A 5CV7A 4DV7L 3S2HB 5DAUA 2R93G 1SE2A 5M5XB 3GTPB 5BWVA 4OX9Q 3K5OA 2Y4RA 1XMOQ 1E2VA 1C4QA 1UEAB 1LT3D 1F2ZA 3CF5A 1A2UA 3VPDA 3N8DA 3A54A 4APMA 1IBLH 1S0MA 2VW9A 2FLNA 4C3HG 2F0OA 4H44C 3T56B 2EJ0A 3JZFA 1CQFA 1DM0B 3Q8PB 3HKZG 1TS4A 1B8AA 4O2AF 1YHBA 2L12A 4JW0A 3PQIA 4YP3A 4JPBW 5C0XI 3OSPA 1KJ8A 3PIPA 2K52A 5C44H 3IL8A 4JI2L 3HEJA 5ELDA 1J5EL 4LMYA 4Q45A 1LTLA 2UXDQ 4HNUA 5K2MA 1I3QA 4J15A 3KHHA 2GPSA 4EBCA 2JA9A 1TWFH 1Q46A 4EEQA 4A3FB 2ZGIA 2O03A 5KS8A 3QR8A 4DR1H 3HS0C 4B3TQ 1Y1WA 2JYOA 4FF1A 4Q8FA 3RGXA 1ENFA 5FD6A 1FGBD 2MFIA 3RLNA 3MZ5A 3WWHA 4R4QA 2EYPA 1PZID 1D1IA 2F0IA 3I4OA 2IMWP 4DV5Q 4A3BB 3QIAA 1GGOA 3NC0B 2PYKA 2QILA 4KJOA 3JSLA 3CPWA 2KQ3A 4Q0YA 2D0OA 2FK1A 1XNQL 5HV6A 4K2LA 5FO8B 3G71A 4O4LF 2ZTCA 4ME5A 1BBXC 2ZTEA 5M5XH 4X64L 4A3GH 3GTPH 2K5WA 3C46A 4NPSA 4MHEA 1SFOH 1STNA 3D4RA 3AX6A 4RKLA 1AEXA 1FJGQ 5I5SA 4YY3Q 4IRCA 4NXNH 4LF4Q 2DY8A 4X66L 3S1MH 4A3MG 3HGBA 3M7GA 1CUKA 4Y8VB 2K28A 1X3EA 3TN2A 3V4ZA 2IW3A 1YNND 3A5ZB 3U9OA 2Z0SA 2MP1A 1QILA 1A63A 4ECVA 3I4NH 3CU7A 1E2WA 4XIGS 1KJIA 3I91A 2F0PA 4EX5A 1FKAH 1JLLB 3K7AB 1VQKA 3S1QB 3E9HA 1U4RA 4OONA 3CP0A 1PDQA 3H15A 4WJ4A 1KXLA 2JEIA 4TV8F 5LMUH 2WP8J 2N78A 1N34H 4A3FH 2XTIA 2HCIA 1J9OA 2B2UC 2WAQA 2R7NA 2HUGA 2A1HA 2JK8A 2F4VL 2BA1A 4KHPH 1HHVA 1E7ZA 1FGUA 1T9HA 2FK3A 1EHIA 2PMZE 2JA5H 3I73A 4AYBB 1E4EB 1KIXA 1I2KA 2PZWA 2B2VA 4M9UA 3EA6A 1BCPD 4A3BH 3T9BA 4R1JA 3URYA 5IGCA 1SEIA 5EWFA 4DUZH 4ECUA 1T5XD 1I2LA 3CRLC 4UP9A 3SR1A 2JP1A 4HJ8A 2W8KA 4DR2Q 4O3QA 3E0EA 4IIJF 4FFOA 4CKEA 2JA7B 1B33N 1DD2A 3RMHA 4MTKA 4DAYA 2V4RA 1IBMH 1R9TB 4GN5A 4GOPA 4R7RA 3OW7A 1N36H 4RUAA 2W9CB 1B6SA 3CC4A 2IX1A 3DM1A 4U673 1PFSA 1UE7A 5JAVA 2R7ZH 3S2DB 2UUCH 2JEJA 2LXKA 3DWQA 3TBIB 2RCFA 5IP7H 5JVG3 3RV3A 3J81L 2NUCA 4EFBA 2KBNA 1WH2A 5C0XG 4QW9A 5KFEA 5LA6F 3U9TA 5CORA 3H40A 2JN4A 3AYHB 4DUYQ 1HNWQ 4DK6C 3DF7A 4J0MA 1MHWC 3QZ8A 2QYZA 4YCVA 2JA8H 3LWBA 3HKSA 5HURA 5KG6A 4ZKBB 3K7AH 2N88A 1WJJA 4LF5H 1I6VC 1KJQA 5D14A 3GTKA 3MAQA 2A69D 3S17B 3V4SA 2CHBD 4IOCA 1YNNC 1Q12A 1N32H 3J81W 3I4LA 3M4PA 1V43A 4QJFA 4LF7Q 4Q43A 2KJXA 1NUCA 1GHJA 2N49A 4OELB 2NTSA 3PIOA 4RA8A 4LJZC 1YJNA 3CVZA 3U58A 2IPKD 4FP5D 1LTBD 4HR7B 1E2ZA 2FHTA 3NBHA 2CNVA 2J6UA 2ZJRA 3CW2C 1KT8A 4Q0FA 5KFYA 4MZ9A 2E2IB 3FKIH 5C5MA 3CCSA 2F0VA 5H1SE 3J80i 2UUAQ 3HFZB 1EKVA 2NVXH 5EWEA 4Q4DA 4A3IB 1TIID 1HA6A 4DXFA 1BCPC 3KOJA 1BCPF 1WRVA 1VQ6A 1D5XC 1B3AA 1R9TH 3LX0A 5LP6F 2N8NA 2E5LH 5C1PA 3T54A 1UC9A 2YZGA 4O3RA 2L4NA 4MA5A 1B9MA 2ZDHA 4O86A 1SE4A 4R4IA 4R8UB 5DG8A 1A62A 3S2DH 1LM0A 4C3HB 3U0GA 4JYAQ 1ZHQA 4X62L 2WIIB 1S5CD 5CV5A 3HKZB 5DGIA 4CDFC 4R8NA 3CMEA 1SRUA 1GUGA 2WAQG 3MFYA 1Z9FA 5LMNQ 2HVQA 5IT9L 4JI4Q 2YCHA 3VNNA 4B3SL 3PF4A 4LH6A 3Q6SA 3RFCA 1W6JA 4A93G 1ZAUA 4IALA 3RGZA 3UYYA 3A55A 3BJUA 1Y8NB 4DKAC 3T1HL 5KFSA 3S17H 2GQSA 5G3LF 1YHAA 2B8FA 2HQEA 2K5HA 1WR2A 4JI0Q 1HZAA 1YI2A 1HTLD 3A56A 3TY9A 1QG7A 2B2VC 1V4YA 5EWGA 5BWWA 3TP5A 4RAZA 2Z02A 1HZCA 3UFXB 2A69C 2ATLA 1ILPA 3H0GH 4AH6A 4IUQA 1E3PA 1TWHH 3RB6A 1DJRD 2WB1B 4TUYF 2CH4A 3C1FA 5BR8H 1B3QA 1VF7A 2EYJA 4ZLTF 3FVQA 1HUNA 3R5HA 2E2IH 5KG1A 3GTLB 3KDFA 1O80A 2G9DA 4GOPC 4DV6H 4TQUS 3A8KE 4RGTA 4FXDA 2MHVA 4FFLA 1FNVA 1TS5A 4A3IH 4IRDA 2WV6D 3BQ1A 3TW7A 2DLNA 1SYFA 3HOVB 1ENAA 4DN4M 3AFPA 1N9WA 3M7NA 1GVPA 4LFAL 2LS01 1EWIA 5DMXA 2PZUA 1AN8A 2YTYA 4C3JG 1VQIA 3PUVA 5IGGA 1D6EC 5I2YA 1K8OA 5EPLA 1TWFA 3A8JE 1PRTB 3BZKA 2V9WA 3K58A 1K83B 4IQZA 5GQOA 1HUMA 5FLXL 5L1IA 5KNBA 2R7MA 1HH2P 1GKHA 3CRKC 1PYBA 4F50A 1QZGA 3K5IA 4P75A 3OYYA 1KLUD 1L2FA 2L55A 4UAIA 3G7LA 4XZ3B 1TWCA 4OEMB 1AP0A 1V1PA 2KENA 3W5OA 2Q7DA 1S9FA 2W7OA 4A3DG 1X32A 3F2BA 2K32A 5I5UA 4DV1L 3OTOH 1NBWA 3S1RB 1HNZQ 1WVLA 5FLXW 1M0WA 4BXXG 2VS1A 4IO9A 3VR3A 4QCLA 1LACA 4HCSA 1NMGA 4K8IA 5I60A 3TIGA 2FMCA 3PSIA 4DV7Q 3PO3H 4UCRA 2RF4A 4DR1L 2RDIA 5EDWA 5IP9H 5EPJA 1JOQA 1X9NA 4O7RA 3GTLH 2L11A 4RKBA 4M8AA 2VL6A 2FFKB 2IX0A 2MO1A 2VB2X 5C3EH 3I4MG 1J8IA 1T94A 2K33A 3TQYA 4O42A 2B63H 5BWXA 5IYCG 1GHKA 5A2QE 4G7HC 5ISRA 5F9LA 1XPOA 1CSPA 2E76C 2P5ZX 1YITA 1TWGH 2R6GA 1UNSA 2IT1A 4WJ3M 1A3GA 3JZIA 2BDNA 2D0PA 4L5QA 4QWBA 5IT9c 1IYDA 3T9DA 2Z6KA 4O82A 1AW7A 1EZ8A 2F0LA 3RAXA 3GIDA 2K1BA 4DL6A 2VR1A 1F2MA 5CV9A 3M4QA 3MHBA 2ZXOA 4LH7A 2VXWA 4NXNL 4ED8A 1F77A 4ED6A 2XD4A 1B1ZA 3N6RA 3TEHB 2XCPA 4EEYA 2Q2UA 4EG0A 1MD2D 4KN7C 3HT5A 2VQFL 4KKSA 4H0LC 5J2TF 3SNOA 1A0IA 2Q8RE 3S1RH 4UP8A 2YU9B 4A3CH 1LT5D 1U4MA 1SDFA 5C44G 1B7YB 4YCWA 4DU9A 3JAME 1EQRA 5C4ZA 3GTJH 2E2HH 1TU2B 4KHPL 1L0YB 1YNJD 1Q82C 1M8AA 1VMPA 2EIYA 4B3MQ 4ZHQF 1RD9D 2BQ3A 4DK0A 3F2UA 1SNPA 4DUZL 3WOEA 2EJFC 1MGSA 4PZ7A 1F2LA 3EFXD 3CCLA 2DAAA 5EGTA 1CQIB 4JI5H 1C0AA 2W6ZA 4I7HA 2HT1A 3F2CA 4APVA 1I1KA 5EKLA 5DLGA 4RB0A 5GROA 3H91A 1SNMA 4QGUA 4R4OA 1K73C 2CFMA 1KQSA 1XNQH 5GAGC 5ELBA 4DR5H 1NR4A 1V1OA 4NB3A 5DNFA 4JVZA 3T99A 1MSGA 4R4TA 1E4EA 1PH2A 4AYBA 5KFVA 2NVQB 3NGDA 1M4VA 4IOAA 2UUCL 3K5HA 3PW2A 5FNVF 2CWAA 4YCUA 4DV0H 4X66H 4IZ8A 3T1YH 3I2ZA 4KY5A 4PMWA 3V05A 2UVWA 3WDNA 3PW4A 3ONAB 5K36H 3LULA 1WTVA 2F0NA 1BDOA 4C5BA 5I5TA 2BQUA 4IN3A 4YIJA 1SLJA 1GM5A 4Z9CB 3MWYW 3KLSA 4LNQA 4DK3C 5DQHA 1Y8OB 1Q7YC 5BWTA 2JA7A 3EN2A 4F8MA 1I1MA 2GQRA 1VMCA 2Q8TA 4O0AA 4LF5L 1R9TA 3RR5A 1OXVA 3OHXC 3CCUA 3S1NB 5I9OA 3I4NG 2YZMA 3RZOB 1KD1C 1KRSA 1BGWA 2W9CA 2C2RA 3LNNA 5KG3A 3K5NA 1VQAA 1ONLA 2O5IC 3I7FA 2WKCA 2I8CA 4EYIB 1XK5A 1S72A 2B2YA 2H1EA 5EZYF 1LTID 3FDSA 4OXPA 4C2MB 4A3FG 1KDCA 1CE8A 4RMFA 4X65Q 5DG7A 1FD7D 3F1ZA 1PH6A 2JA6H 3MJFA 2R7FA 2AQ2B 4IUUA 3VR6A 1AUVA 2QB5A 3KAKA 2RGVA 5M9OA 1LLRD 3VPBA 1E24A 4DLKA 4Q44A 5JEAJ 1YNJC 3ICEA 2Z6KC 1YZ6A 5BN4A 2JEAI 1VQBA 5KT4A 3CCEA 4DR4Q 2R86A 2NVYB 4QUFA 3PW5A 3GTQB 2QEXA 1NE3A 4A3BG 1JDEA 3UQ8A 4C3JB 3E6ZX 2XC9A 2ASLA 3RUZA 5KT6A 4KY7A 4KY6A 1I6UA 2A5HA 3QWNA 1H9RA 3WO1A 2EYHA 1K1QA 4HR7A 1MZBA 1TXYA 1HQMC 1HR0H 3WOFA 1SE8A 4DL4A 4ZYSA 4DK1A 3CCRA 1S5DD 1JDBB 1F9QA 2E2IA 2R7ZG 3T5KA 5EOYA 1Z2NX 5J3BA 1EYGA 4GLWA 4A3DB 1G2SA 3RBEA 5IP7G 2OF1A 4J9PA 2Z1CA 4U6PA 4RGNA 2VQDA 2VQEL 4O7VA 3NXWA 1BXTA 1PTOB 1OO9B 2B2WA 4PMBA 5FOBB 1S0NA 3E5SA 1EOVA 2TSSA 2BE5D 3P20A 2CZGA 4O4JF 3RZOH 3PFFA 2K50A 2LSSA 4HSPA 2JA8G 1BJTA 4R8UA 5KNCA 3IG0A 1GXDC 5GONF 1LV9A 2RHSB 4KI0A 3CXCA 2VOBA 2F3IA 3G6XA 1DXMA 1GSHA 2SCUB 3OIQA 1PH9A 5J2UF 3MFHA 3E9IA 4DAAA 3HKZA 3SHLA 2IWHA 2KCMA 1CTMA 2NBFA 3JRXA 3GP7A 1EWCA 5KFUA 2ZXPA 5BR8L 3I4MB 3I70A 3FRPB 2MCTA 4X62Q 3S14H 3QOJA 3N42B 3LMLA 4B08A 5IE8A 1M6VA 1LT4D 4DV6L 4JI8H 4RWSC 1DOMA 4PQXA 3GTQH 4JV2A 1OWTA 4X6AH 5CMDA 4B3SQ 1GYFA 1Q8KA 4JV5H 3QFFA 3FKIG 1SYXB 2EXZA 2C00A 4V0BA 4F7XA 1CK1A 1JB3A 2JXMB 1BBUA 4DV4L 4J8QA 1PA6A 2DY7A 1SYGA 1KC8C 3R2TA 4JI1Q 2R7LA 4ME3A 2KEEA 2AWNA 5LHY1 4YR3A 3OUUA 4HMJA 2VQEH 1RTOA 4ID6A 2EYLA 2A6HD 3OMGA 2WB1A 4EGQA 2R8GA 1I4HA 1MI2A 3NWSA 5IWAQ 3T9AA 5J22A 3GTLA 2WAQE 3HOZB 5KT5A 3A5UA 5A2QL 1VBHA 2UVRA 4DGZA 1CA6A 3V6HA 5JUMA 5KFKA 2XVSA 1Q8IA 1IW7D 1PZJD 2ZM6L 1C30A 5FD5A 3M9OB 1A15A 3KJOA 1WOCA 1CZGA 4K14A 1PTOH 1SROA 3Q0AA 1QNKA 3NE5B 3OTOL 4L5TA 2B2YC 4EBEA 5DM73 5KG4A 5C44B 1Q3LA 4RAYA 3M9MB 3HOXB 1ZETA 4CBVA 1K83A 5CV6A 3RB0A 4HJ9A 1RCVD 1KNAA 2X6LA 2BE5C 3ULJA 2Z9HA 5IYBH 1RK5A 1ULZA 3IN5A 3RLOA 1TA8A 3TZDA 3TREA 1XWEA 1IBLQ 5CA1F 1PK8A 1UNNC 3H0GG 4O7TA 1Y8PB 3T9CA 4ED0A 2ASBA 2F0KA 3D0FA 4X3SA 4CJ0B 2IL8A 5E1FA 3H3VH 4POGA 1PX2A 2FLPA 1FR3A 2E2DC 3GIKA 1SAPA 1P8LA 3P75A 1HTPA 4A3IG 4LFAH 1CHQD 5KFPA 1SYCA 3GTMB 2C2DA 5ELCA 3L4KA 2UXBH 4YWKA 3KHLA 3NTHA 1LTSD 4A3GB 1E4GT 5C0XJ 3UDXA 1IKMA 1SFOB 1PRTD 3KLWA 2NUAB 3HOZH 2B2WC 4JI6L 5HBRB 1QWYA 4OIJA 2NZOA 1WTHA 1IYUA 4AIMA 3S1MB 4FE2A 4DR1Q 3S16H 3FEWX 2PVPA 1ESFA 3RZDH 3NELA 4HJAA 2Q2HA 2QK4A 1Q86C 3RIZA 4O2DA 2TMPA 2YZLA 4TVIA 4NKLA 2Z04A 1RKNA 1KRTA 4DV1H 2NVTH 2IY5B 3I4NB 4B9WA 2SNSA 4K0KL 1XTDA 1RYSA 1KJ9A 1IW7C 3HOXH 3W2DA 4HN7A 2R6FA 5DLQE 4DNTB 2YTXA 4NXMH 5JVLA 1ZQ7A 4LFCH 1PH1A 1O7IA 1XDNA 4CDEC 2XGTA 3IAYA 1V8QA 3LWEA 4LUZA 1VCIA 1BF4A 5KG2A 3RAQA 1DCZA 4F4WA 4MV4A 4A3JH 4A3KH 2YL2A 1I94H 3PO3G 2JA5B 4DF7A 2WB1G 3OOCA 1IYJB 2YU9A 4FF2A 4CC6A 2VUMH 2JSOA 2F3VA 1IXRA 1A0GA 3BACA 2C5CA 3VA5A 3NBZB 5C3EG 4PWQA 3PV0A 4I7ZC 5IGFA 5KT3A 3BVMA 4JI5L 2COGA 1XMOH 4V190 1XYIA 1HRJA 3GTMH 1O7ZA 5IGEA 3HOVG 2ES2A 4HIKA 4RZRA 4DR5L 3KF8A 3TY5A 2KOLA 3A74A 3NTIA 4UCTA 3CEBA 1UE5A 4BBSB 4FS1A 4L5RC 1O7LA 5LMUQ 4KHVA 1NJIC 3HZXA 4CDDC 1N34Q 4DR3Q 3AU7A 5JH7F 4DV0L 2R7ZB 4A2AA 1EKPA 3T1YL 2VPSA 4KHPQ 4QIWB 3VYRA 2XIGA 4E6IA 1PRTC 1JB7A 1PRTF 1JX4A 1S03G 5EBCA 5BYAA 2VQFH 5K5PA 4MV7A 3RTXA 2HQLA 4MTEA 3KHRA 3CQZA 3T9FA 5BWUA 3D6CA 2R7DA 2VA3A 2JA8B 4CHTB 2F0TA 2W71A 4B3TH 2V58A 4J6HA 5LL6X 4A3CG 5FO9B 2R8KA 4B9XA 4GC6A 3NQTA 1T3NA 3SK5A 4O1NA 4JI3H 2J7ZA 3BG5A 5IODA 4ECZA 3FDTA 3AQQA 2PQAB 3JC66 4IAJA 1SMXA 4ZCKA 4TSSA 4DV5H 1IBMQ 3JAMc 1TQOA 4YHHH 1Z47A 4XXEA 3BS1A 1N36Q 4WORA 3W1BA 4CHIA 2L15A 1STYA 3C3LA 1VAJA 3F8NA 1KAWA 4M7EA 5CR5A 1OXSC 2V4DA 5I5YA 4LF8H 2A68D 3GTGB 4LFBQ 2FE3A 2QW7A 2HCCA 2F52A 3HB9A 1LTAD 1VQNA 3FKIB 1IHZA 2CW7A 2OTLA 2ATWA 3PGZA 1PFMA 2F0EA 5J1ZA 4WFN3 1II3A 1FJGH 3PIO3 2NVXB 2PQEA 4IURA 2AU0A 1HFGA 2ZXRA 4BWGB 5BN3A 5FJ8H 1I7LA 3DXJC 1PH4A 1IZ6A 2JE6I 3J7AF 4LF5Q 1QCBD 1AH9A 3ORQA 3S9WA 4C2MA 5JPMC 4BBSH 1N32Q 3BABA 3VPCA 1UUPA 1HR0L 4QB4A 1KDBA 2B2TA 4NZOA 3K0XA 4BBRH 3BDOA 1PH7A 1VQDA 2FPIB 1STBA 1HZ9A 1PLFA 1D2BA 1XMQL 4OO1H 2IHEA 5GAHC 1WD1A 4FFRA 2PNHA 1S40A 4K6DA 2NVYA 2QKIC 2OLSA 5G3LD 2G5DA 5KFXA 1F9PA 5CR3A 1Z6HA 2L9HA 5K36G 1PHJA 3EJIA 2XWJB 2W6OA 1LUZA 1D5ZC 1HR0W 3N6XA 2Z4IA 1G51A 3O13A 1GSOA 1E1OA 2VB3X 2W9AA 4LWCA 3M4YA 3KF6B 1PVOA 2YS7A 4GLVB 1UE6A 4RHSA 3WWVA 4NMZA 5CBAE 3VA7A 3V6JA 4KJNA 2UXCH 2J6SA 5I9PA 2AUJD 1Q1BA 2K4KA 5TSSA 4YAJB 4KD4A 1QOHA 2E8GA 4A4IA 5L37A 2PCFB 2E5LQ 2V5AA 5LYJF 3H0GB 4DFAA 1TWHB 2IP4A 2BQRA 3GTGH 4HNVA 1GUOA 4JBJA 5T1GA 1B44D 4KN4C 4ED3A 4JI8L 2JA6G 3R93A 1KTKA 2FK2A 1DIKA 3RLFA 3NBYB 1CI3M 4FNFA 1JQYD 2A68C 1JR0D 3GTOB 3JRWA 4HAEA 1X3PA 4JV5L 1PMRA 1M1KC 4O7LA 4BA1I 1DV2A 4UPAA 1RJTA 4IPGA 3U50C 5DQGA 5CAEB 3VOTA 2FMMA 1X3QA 2AKWB 2FB9A 4KKTA 4IPHA 2BH2A 1LT6D 1O78A 2CVRA 3H3VI 3R5FA 5C3XA 4HMIA 2EJ3A 1U9RA 4DAMA 3CC2A 1W6KA 4JV0A 3A0JA 2C35B 3J80E 5DM63 1UAPA 3TIIA 4UFZA 4A3EH 4FF4A 5KG7A 3F2DA 3A7AB 4DV3L 5AJ3Q
chains in the Genus database with same CATH topology
4DV6Q 2EIFA 4C3IH 2UUBQ 2HGSA 4LF9H 5IT9W 2RGRA 5DISC 1VQEA 2K5NA 2WDTA 4AYBE 4A75A 1X6OA 1AN7A 1AE3A 3CCMA 2HVRA 1OTCA 1VS0A 4GKJL 3PCOB 3GTOH 4P74A 5ELNA 3EIVA 1S68A 1WCMH 1W3SA 2ID0A 4DV4H 2JQOA 3OTOQ 2UXBL 5LMNH 2B29A 1L1OB 3LGJA 1N33L 2ZTDA 4JI0H 3CC7A 4OWWB 2ZM6H 1YEZA 3RN5A 1E1TA 1I5FA 5IYDH 1YJWA 1Y14B 1K0RA 5EAYA 1YIJA 4NXML 3TRZA 4LFCL 2UU9H 1Y1VH 3TS2A 2MQHA 4IPDA 1I94L 1IBKH 2W57A 1Q1EA 3MXNB 2MNAA 3K3VA 4DR6H 2VZAA 1UEBA 1AE2A 1XMOL 3CD6A 1OXUA 5M3MH 4PZ6A 1GO3E 3RJ0A 1GD7A 4JI2Q 1J5EQ 2OWOA 3K81C 1BKBA 3N43B 4JI6H 3HOWH 2YYZA 3HKZE 2RHQB 1B70B 3HOZG 2ZJPA 4MTDA 3HOUH 5JJKA 1G291 4B3TL 4JBWA 4K0KH 2GN5A 4A3MH 4OO1I 4JI5Q 1XNRH 4JI3L 1HZBA 1S3OA 1VQMA 3HOXG 1XNQQ 1WFQA 4DV5L 3PF5A 4YHHL 4X64Q 1VQGA 2WB1E 3EYYA 4LF8L 2EXDA 1VQ5A 1EIYB 1YJ9A 1BBWA 4DV0Q 1QZHA 4X66Q 4A3JG 4A3KG 1Q81C 4LF6H 4QL5A 1FJGL 3D31A 4YY3L 2VUMG 4LF4L 1CSQA 1VQOA 2PQAA 3K8AA 2E2JH 1JE5A 3FHWA 3PUYA 3M4OH 1ZHSA 4A3GG 1MJEA 4IJLA 2F4VQ 3M85A 4MTNA 2OQKA 2AMCB 2I5MX 1KHIA 2MO0A 1I3QH 4H02A 3G4SA 3CCJA 4B3MH 3U4ZA 2UXCL 1Y1WH 4JG2A 1VQPA 1HR0Q 2AWOA 2CW8A 2H5XA 2K14A 2JA5G 3ULLA 3KF6A 4BA2I 3L2PA 1M90C 2JJQA 1WI5A 4DAYB 4A3LH 2HHHH 4DUYL 2FXQA 5FJ8G 3GD7A 1VQ9A 4BBSG 4AQYH 1D7QA 2QA4A 1EFWA 2A8VA 1XMQH 1HNXH 1MKHA 4BBRG 1IL2A 4P73A 3CPFA 1V1QA 1ASYA 4OO1G 1U0LA 4JI8Q 1EUJA 1I6HH 4X65H 3AEVA 5JJLA 4DR7H 4JV5Q 4LF9L 1JMCA 3NENA 1OXXK 1PH5A 1DGSA 1BVSA 2GVAA 1X3FA 2NN6I 4TVAB 4DV2H 4JYAL 5C4JH 5LMNL 3GDEA 3T1HQ 5ELOA 3B6YA 4FM9A 1CKOA 3BA9A 4JI0L 3L4JA 3J80c 2KHIA 4DRFA 1L2ZA 4DV3H 2CKZB 3ER0A 4A3EG 1MJCA 4UY8C 2JEBI 1L1OA 5A2QW 3MEFA 5HY6A 5M5WH 4BY7H 2UU9L 4LFAQ 2UXBQ 5C4XH 3STBD 2WFWA 1IBKL 3S15H 3M3YH 1QVFA 4JI1H 3FMAA 4GKJH 1EIFA 4DR6L 4R4CA 2R92H 4DV1Q 3J7ZC 2ZJTA 4GKKH 4UCSA 4POFA 4Y52H 2A19A 4NXMQ 4LFCQ 5IYCH 3RF2A 3JAMW 4LUOA 1N33H 4MNOA 4GN3B 4IFDI 2AHOB 1QUQB 1I94Q 4JI7H 1O75A 2I5LX 3N44B 1YVCA 1XNRL 4LW1A 2OTJA 3BU2A 2HVSA 5IYDG 4B3RH 3OW2A 3VDYA 1Y1VG 3ULPA 2NN6G 2CWPA 4NXNQ 5IP9G 3STBC 1XPRA 2RCNA 1EQQA 4LF6L 2PI2A 1JT8A 4OX9H 3KJPA 2VQFQ 2B63G 2WYOA 5M3MG 3PUZA 1G6PA 3FP9A 4UP7A 4JI3Q 5FPRA 5FPOA 5M3FH 1TWCH 2Y0SG 1J6QA 3TS0A 1NY4A 3HOYH 4YHHQ 2UXDH 1U5KA 1CKMA 1L1OC 3HOWG 4GNXB 3SGIA 4LF8Q 3S2HH 1Z2OX 4JOIA 4HJ7A 2CCZA 1C7YA 4DUZQ 4ETSA 4B3ML 3HOUG 2I5HA 3UDGA 5D1PA 2UUCQ 1LYLA 3PUWA 3N41B 4YY3H 4DR3H 5IY0A 2DGYA 4LF4H 1XPUA 2HHHL 1JJ2A 1NTGA 2HIVA 3PUXA 4GS3A 2OQ0A 2UXCQ 4IFDG 4AQYL 5M5YH 4BY1H 3DLLA 3J7AK 4QQBX 1RIPA 1HNXL 3BZCA 5FLMH 3PO2H 4DPGA 2NZHA 1K3RA 4KLKA 3H20A 4X65L 4JBMA 1VQJA 4DR7L 4GLAC 4RB1A 4LFBH 3RNUA 3L0OA 4CC5A 4DR4L 3GO5A 2VUGA 1Y1WG 2B3GA 4DR2H 1P16A 3I56A 4Y7NH 2KHJA 3S1QH 3NEMA 1FL0A 4DV2L 4P71A 3KXYT 4HIMA 3MWMA 4UCVA 1VQ7A 1TWAH 2VQEQ 1I50H 1V9PA 4DUYH 3BAAA 1HNWH 4A3LG 1CKNB 4LF9Q 4JOIC 3JSNA 4ALPA 4QIWE 2K75A 2JA7H 5BR8Q 4UCOA 4LF7H 2BH8A 4BWSC 1A8VA 2QGQA 4GLXA 1QVCA 3M9BA 5D1OB 4DV4Q 2UUAH 1RL2A 3KYHC 3GJXB 3I55A 2GVBA 4JI1L 1TAEA 5IWAL 2D62A 3CCVA 3G48A 4JYAH 2ZM6Q 3K80C 3G6EA 4GKKL 4JI4H 1H95A 3QWUA 2UU9Q 4A2BA 2UUBH 2OCEA 1VQLA 2K5VA 4A76A 1SN8A 2R93H 5E7NA 1IBKQ 4JI7L 1YBYA 3J81c 2VY3A 4DR6Q 4C3HH 1IBLL 4EFEA 4EQ5A 4RB2C 4B3RL 4P72A 4BY7G 4RG1A 3KAJA 2VNUD 1QUQA 5C4XG 5IYBG 4JI6Q 4MV9A 4OX9L 3F8TA 4PDBA 4JC0A 3L7ZC 4KHZA 1VQ4A 4UCUA 1PV4A 4K0KQ 2R92G 1VQ8A 1XNRQ 3HXLA 1HNZH 4LUVA 2UXDL 2KCTA 3HOVH 2IHFA 2EQSA 3UDFA 1SR3A 4DV7H 2N3SA 1X56A 4LF6Q 1K83H 1E4FT 1VQFA 4HIOA 1NMFA 3W1GA 3JAMi 4GN4B 1K8GA 1YNXA 4DR5Q 1K8AC 3M4IA 2KSWA 4GNXA 4E6NA 1C9OA 4JI2H 1J5EH 3BA8A 3T1YQ 1PYSB 4PG3A 4RB3C 5LMUL 1XJVA 1N34L 5JJIA 2A1AA 4DR3L 1UE1A 3IRBA 1X65A 1W2BA 3KF8B 5HGQA 2Y0SE 3J81j 1VQHA 5LL6b 4OWXB 2YTVA 5M3FG 5FLXc 1WYDA 3HOYG 3S24A 1HJPA 3EBEA 1IBML 4RZQA 1N36L 4X64H 3AFQA 3ZJYC 4LFBL 1OXTA 3J7A5 2HHHQ 2V1CC 1MIUA 2YU9H 4DR2L 2LXJA 2Q2IA 1Z2PX 4AQYQ 1QVGA 3J80W 1XMQQ 1HNXQ 1N32L 1N8RC 2F4VH 4XTCS 4GOPB 4HIDA 1HNWL 4DR7Q 2CQOA 3KFUA 4OWTB 4LSXA 3CCQA 3CQZH 3TY8A 4LF7L 4BY1G 1K9MC 1KL9A 1VQCA 2E5LL 3GB8B 4QY7A 5FLMG 2BA0A 1D8LA 2PI2E 4DV2Q 2NVQH 2WE6A 3PO2G 1JJGA 1UWVA 4GNXC 1CKNA 1B04A 3UDIA 1PH3A 2UUAL 4A93H 1PH8A 4DR4H 3NBHB 2I0QA 3DM3A 3Q8DA 3U4VA 2YV5A 3S1NH 4LSAA 5D1OA 4IJHA 4DV3Q 4C2MH 3CMAA 1M0TA 4JI4L 2ZJQA 4JBKA 3N40P 1YHQA 4PZ8A 4AYBG 3UE0A 5AJ3L 2UUBL 1JJCB 2NVYH 1FVIA 4C3JH 1X54A 3J81i 5LMNW 2DUDA 3GTKH 2HIXA 2JA7G 4GKJQ 3K7UC 1X55A 4DNIA 5GADC 3ERSX 4X62H 4A3DH 4GKKQ 4B3SH 4IPCA 4BXXH 2Q2TA 3KDFB 4YWLA 1N33Q 2ALYB 3T1HH 3C0FB 5GAEC 5IWAH 4HJ5A 4JI7Q 4JCVE 4L5SA 3KALA 3PN1A 4IFDJ 1E22A 1ASZA 3I4MH 4FDBA 1WCMG 3RN2A 3CAMA 3UE1A 4B3RQ 1HNZL 1L0WA 4YWMA 5JEAG 1X3GA 4DV7L 2R93G 4OX9Q 1XMOQ 3CF5A 1IBLH 4APMA 2VW9A 3HKZG 1B8AA 1YHBA 5C0XI 3PIPA 2K52A 5C44H 4JI2L 1J5EL 4LMYA 1LTLA 2UXDQ 4J15A 2JA9A 1TWFH 1Q46A 4EEQA 2O03A 4DR1H 4B3TQ 3RGXA 5FD6A 2MFIA 3RLNA 4R4QA 3I4OA 4DV5Q 3NC0B 3JSLA 3CPWA 4Q0YA 2D0OA 1XNQL 3G71A 2ZTCA 2ZTEA 5M5XH 4X64L 4A3GH 3GTPH 4NPSA 1SFOH 1FJGQ 4YY3Q 4NXNH 4LF4Q 4X66L 3S1MH 4A3MG 1CUKA 1X3EA 3A5ZB 2Z0SA 1A63A 3I4NH 4XIGS 1FKAH 4EX5A 1VQKA 3E9HA 4WJ4A 4OONA 3CP0A 3H15A 1KXLA 5LMUH 2WP8J 2N78A 1N34H 4A3FH 2XTIA 2JK8A 2F4VL 2BA1A 4KHPH 1E7ZA 1FGUA 1T9HA 2PMZE 2JA5H 1KIXA 4A3BH 4R1JA 1SEIA 4DUZH 4UP9A 4HJ8A 4DR2Q 3E0EA 1IBMH 4GN5A 4GOPA 4R7RA 1N36H 3CC4A 2IX1A 1PFSA 1UE7A 2R7ZH 2UUCH 2LXKA 5IP7H 4EFBA 2KBNA 1WH2A 5C0XG 3AYHB 4DUYQ 1HNWQ 4DK6C 3DF7A 4J0MA 4YCVA 2JA8H 3HKSA 3K7AH 1WJJA 4LF5H 4IOCA 1Q12A 1N32H 3J81W 3M4PA 1V43A 4QJFA 4LF7Q 3PIOA 2N49A 1YJNA 3CVZA 3U58A 2ZJRA 3CW2C 4MZ9A 3FKIH 3CCSA 2UUAQ 5H1SE 3J80i 3HFZB 2NVXH 3KOJA 1VQ6A 1R9TH 2N8NA 2E5LH 4R4IA 1A62A 3S2DH 1LM0A 1ZHQA 4JYAQ 4X62L 3CMEA 1SRUA 2HVQA 2WAQG 1Z9FA 5LMNQ 4JI4Q 2YCHA 3VNNA 4B3SL 3PF4A 4LH6A 4A93G 3RGZA 3BJUA 4DKAC 3T1HL 3S17H 1YHAA 2K5HA 4JI0Q 1HZAA 1YI2A 3TY9A 4RAZA 1HZCA 3H0GH 4AH6A 1E3PA 1TWHH 5BR8H 2E2IH 3KDFA 4GOPC 4DV6H 4TQUS 4A3IH 3AFPA 1N9WA 3M7NA 1GVPA 4LFAL 1EWIA 2YTYA 1VQIA 3PUVA 3BZKA 5GQOA 1HH2P 1GKHA 1PYBA 1QZGA 4P75A 3OYYA 1L2FA 2KENA 3W5OA 4A3DG 3F2BA 3OTOH 4DV1L 1NBWA 1HNZQ 5FLXW 1M0WA 4BXXG 2VS1A 4IO9A 1NMGA 4UCRA 3PSIA 4DV7Q 3PO3H 2RF4A 4DR1L 5IP9H 1X9NA 3GTLH 2VL6A 2MO1A 2IX0A 5C3EH 3I4MG 3TQYA 2B63H 5IYCG 1XPOA 1CSPA 1YITA 1TWGH 2R6GA 4WJ3M 2IT1A 2D0PA 4L5QA 5IT9c 2Z6KA 3M4QA 4LH7A 4NXNL 3TEHB 2Q2UA 2VQFL 1A0IA 3S1RH 4UP8A 4A3CH 5C44G 1B7YB 4YCWA 1EQRA 3GTJH 2E2HH 4KHPL 1Q82C 4B3MQ 4DUZL 4PZ7A 3CCLA 4JI5H 1C0AA 4I7HA 2HT1A 3F2CA 4APVA 4RB0A 5GROA 4QGUA 1K73C 1KQSA 4R4OA 1XNQH 2CFMA 5GAGC 4DR5H 4NB3A 4R4TA 1PH2A 4IOAA 2UUCL 2CWAA 4YCUA 4DV0H 4X66H 3T1YH 3I2ZA 4PMWA 1SLJA 1GM5A 4LNQA 4DK3C 1Q7YC 3EN2A 4O0AA 4LF5L 3RR5A 1OXVA 3CCUA 1BGWA 3I4NG 1KD1C 1KRSA 1VQAA 3I7FA 1XK5A 1S72A 4OXPA 4A3FG 4RMFA 4X65Q 3F1ZA 1PH6A 2JA6H 2R7FA 2RGVA 3KAKA 1E24A 5JEAJ 3ICEA 2Z6KC 1YZ6A 2JEAI 1VQBA 3CCEA 4DR4Q 2QEXA 1NE3A 4A3BG 3UQ8A 1I6UA 1MZBA 1TXYA 1HR0H 1SE8A 3CCRA 2R7ZG 5EOYA 1Z2NX 5J3BA 1EYGA 5IP7G 2VQEL 1EOVA 3RZOH 2K50A 2LSSA 2JA8G 1BJTA 3IG0A 4KI0A 2RHSB 3CXCA 2VOBA 2F3IA 1PH9A 3E9IA 2KCMA 5BR8L 2MCTA 4X62Q 3S14H 3N42B 3LMLA 5IE8A 4DV6L 4JI8H 3GTQH 4X6AH 4B3SQ 1GYFA 1Q8KA 4JV5H 3FKIG 1SYXB 1BBUA 4DV4L 1PA6A 1KC8C 4JI1Q 4ME3A 2AWNA 2VQEH 5IWAQ 2WAQE 3A5UA 2ZM6L 5FD5A 3KJOA 1WOCA 1SROA 3OTOL 4L5TA 4RAYA 4HJ9A 3ULJA 5IYBH 3RLOA 1TA8A 3TREA 1IBLQ 3H0GG 2ASBA 3D0FA 3H3VH 4POGA 1P8LA 4A3IG 4LFAH 2UXBH 3L4KA 4YWKA 1E4GT 5C0XJ 3UDXA 3KLWA 3HOZH 4JI6L 2NZOA 4AIMA 4DR1Q 3S16H 3RZDH 3NELA 4HJAA 2Q2HA 1Q86C 3RIZA 4O2DA 1KRTA 4DV1H 2NVTH 2IY5B 4K0KL 1XTDA 3HOXH 5DLQE 2YTXA 4NXMH 4LFCH 1PH1A 1O7IA 1XDNA 2XGTA 4LUZA 1VCIA 4A3JH 4A3KH 1I94H 3PO3G 2WB1G 1IYJB 4CC6A 2VUMH 1IXRA 3NBZB 5C3EG 1XMOH 3PV0A 4JI5L 3GTMH 3HOVG 2ES2A 4HIKA 4DR5L 3TY5A 3A74A 4UCTA 1UE5A 4L5RC 5LMUQ 1N34Q 1NJIC 4DR3Q 4DV0L 4A2AA 2VPSA 3T1YL 4KHPQ 2XIGA 1JB7A 1S03G 2VQFH 4MV7A 3RTXA 2HQLA 4MTEA 2R7DA 4B3TH 4A3CG 4JI3H 3AQQA 2PQAB 3JC66 4IAJA 1SMXA 4DV5H 1IBMQ 3JAMc 4YHHH 1Z47A 1N36Q 3W1BA 2L15A 3F8NA 1KAWA 4M7EA 1OXSC 4LF8H 4LFBQ 2FE3A 2F52A 1VQNA 2CW7A 2OTLA 2ATWA 3PGZA 1FJGH 5FJ8H 1PH4A 1IZ6A 2JE6I 4LF5Q 1AH9A 4BBSH 1N32Q 3BABA 1HR0L 3K0XA 4BBRH 1PH7A 1VQDA 1HZ9A 1XMQL 2IHEA 5GAHC 2PNHA 1S40A 5K36G 1PHJA 1LUZA 1HR0W 3N6XA 1G51A 1E1OA 4LWCA 3KF6B 1PVOA 4GLVB 1UE6A 3WWVA 2UXCH 1Q1BA 2K4KA 2E8GA 4A4IA 2E5LQ 3GTGH 4JBJA 4JI8L 2JA6G 3RLFA 3NBYB 4JV5L 1M1KC 4BA1I 4UPAA 4IPGA 3U50C 2AKWB 4IPHA 2BH2A 3H3VI 4DAMA 3CC2A 3A0JA 2C35B 4UFZA 4A3EH 3F2DA 4DV3L 5AJ3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 Q;  4PZ8 A;  1U5K A;  2EIF A;  1EQR A;  4C3I H;  1CKM A;  1L1O C;  3GTJ H;  2UUB Q;  2E2H H;  3HOW G;  4AYB G;  3PN1 A;  4GNX B;  3UE0 A;  4KHP L;  5AJ3 L;  3SGI A;  4LF8 Q;  2UUB L;  3S2H H;  1JJC B;  2NVY H;  1Q82 C;  4JOI A;  4HJ7 A;  2CCZ A;  1FVI A;  1C7Y A;  4B3M Q;  4C3J H;  1X54 A;  4UCR A;  3J81 i;  5LMN W;  2DUD A;  4DUZ Q;  5DIS C;  4B3M L;  3HOU G;  1VQE A;  2K5N A;  2HIX A;  4DUZ L;  3GTK H;  4AYB E;  2JA7 G;  4PZ7 A;  4A75 A;  3CCL A;  1X6O A;  4GKJ Q;  1C0A A;  3K7U C;  1X55 A;  4DNI A;  2HT1 A;  1AE3 A;  3F2C A;  4APV A;  5GAD C;  3CCM A;  5GRO A;  4QGU A;  3ERS X;  2I5H A;  4R4O A;  1VS0 A;  2CFM A;  1K73 C;  1KQS A;  1OTC A;  4UY8 C;  3PCO B;  5GAG C;  3GTO H;  4GKJ L;  4P74 A;  3UDG A;  5ELN A;  2UUC Q;  3EIV A;  1LYL A;  4NB3 A;  4A3D H;  1S68 A;  5D1P A;  3PUW A;  1WCM H;  4R4T A;  4GKK Q;  1PH2 A;  1W3S A;  2ID0 A;  4IPC A;  4IOA A;  2JQO A;  3OTO Q;  2UUC L;  2UXB L;  4BXX H;  2CWA A;  4YCU A;  2Q2T A;  3KDF B;  2B29 A;  3I2Z A;  4PMW A;  1L1O B;  4YWL A;  1N33 Q;  5IY0 A;  2DGY A;  3LGJ A;  2ALY B;  1XPU A;  2HHH L;  1JJ2 A;  1SLJ A;  1GM5 A;  1N33 L;  5GAE C;  4LNQ A;  1NTG A;  4DK3 C;  4DV3 L;  1Q7Y C;  2HIV A;  3PUX A;  3EN2 A;  4GS3 A;  2ZTD A;  4HJ5 A;  4JI7 Q;  2OQ0 A;  4JCV E;  4O0A A;  4LF5 L;  3CC7 A;  2UXC Q;  3RR5 A;  1OXV A;  4L5S A;  3CCU A;  4OWW B;  3I4N G;  1YEZ A;  4IFD J;  1E22 A;  1KRS A;  1KD1 C;  4AQY L;  1ASZ A;  3I4M H;  4FDB A;  5M5Y H;  1VQA A;  1WCM G;  3RN2 A;  3RN5 A;  4BY1 H;  3DLL A;  3CAM A;  3I7F A;  1E1T A;  4QQB X;  1RIP A;  1HNX L;  1XK5 A;  1I5F A;  3UE1 A;  1S72 A;  5IYD H;  3BZC A;  1YJW A;  4B3R Q;  5FLM H;  1Y14 B;  4OXP A;  4DPG A;  4A3F G;  2NZH A;  1K3R A;  1K0R A;  5EAY A;  1YIJ A;  4KLK A;  4RMF A;  4LFC L;  1L0W A;  4X65 Q;  4NXM L;  3TRZ A;  3F1Z A;  1PH6 A;  2JA6 H;  1Y1V H;  2R7F A;  4YWM A;  1D7Q A;  1E24 A;  4X65 L;  5JEA J;  5JEA G;  3ICE A;  4JBM A;  1VQJ A;  3TS2 A;  2Z6K C;  4GLA C;  4DR7 L;  1X3G A;  1YZ6 A;  2JEA I;  1VQB A;  2MQH A;  4DV7 L;  4IPD A;  3CCE A;  4DR4 Q;  2R93 G;  3RNU A;  1I94 L;  3L0O A;  2QEX A;  1NE3 A;  4A3B G;  3UQ8 A;  4OX9 Q;  4CC5 A;  1XMO Q;  4DR4 L;  1Q1E A;  3CF5 A;  3MXN B;  2MNA A;  3GO5 A;  2VUG A;  1Y1W G;  2B3G A;  2VZA A;  1UEB A;  1AE2 A;  2VW9 A;  1XMO L;  1P16 A;  3I56 A;  3CD6 A;  1OXU A;  5M3M H;  4Y7N H;  4PZ6 A;  2UUA L;  1GO3 E;  1TXY A;  3HKZ G;  2KHJ A;  1B8A A;  3S1Q H;  1YHB A;  3NEM A;  1GD7 A;  1FL0 A;  1SE8 A;  4DV2 L;  4P71 A;  4JI2 Q;  3CCR A;  1J5E Q;  5C0X I;  4HIM A;  2OWO A;  4UCV A;  3PIP A;  2K52 A;  5AJ3 Q;  1TWA H;  5C44 H;  3K81 C;  1VQ7 A;  2R7Z G;  5J3B A;  1EYG A;  4JI2 L;  1J5E L;  5IP7 G;  2VQE Q;  1LTL A;  2UXD Q;  1I50 H;  1BKB A;  3HOW H;  2YYZ A;  4J15 A;  1V9P A;  3HKZ E;  2VQE L;  3BAA A;  2RHQ B;  1B70 B;  2JA9 A;  4A3L G;  1CKN B;  3HOZ G;  1TWF H;  1Q46 A;  1EOV A;  4EEQ A;  2ZJP A;  4LF9 Q;  3RZO H;  2K50 A;  2LSS A;  2JA8 G;  4JOI C;  3JSN A;  4ALP A;  4B3T Q;  4KI0 A;  2RHS B;  3CXC A;  2F3I A;  1PH9 A;  4QIW E;  3HOU H;  2MFI A;  2K75 A;  1G29 1;  3E9I A;  3RLN A;  4JBW A;  4R4Q A;  4B3T L;  2GN5 A;  4A3M H;  2JA7 H;  5BR8 Q;  4X6A H;  4OO1 I;  4UCO A;  2KCM A;  2BH8 A;  4JI5 Q;  3I4O A;  4JI3 L;  4DV5 Q;  1A8V A;  5BR8 L;  1HZB A;  1S3O A;  1VQM A;  3HOX G;  1XNQ Q;  3NC0 B;  4X62 Q;  3S14 H;  1WFQ A;  2QGQ A;  4DV5 L;  3CPW A;  3JSL A;  3PF5 A;  5IE8 A;  2D0O A;  4YHH L;  4X64 Q;  4DV6 L;  4GLX A;  1XNQ L;  1QVC A;  3M9B A;  5D1O B;  3G71 A;  1N36 Q;  1VQG A;  2ZTC A;  2WB1 E;  3GTQ H;  2ZTE A;  5M5X H;  4X64 L;  2EXD A;  4LF8 L;  1VQ5 A;  4DV4 Q;  4B3S Q;  1Q8K A;  4NPS A;  3GTP H;  4A3G H;  3FKI G;  1SFO H;  1EIY B;  1YJ9 A;  1RL2 A;  1BBW A;  4DV0 Q;  1QZH A;  4X66 Q;  3KYH C;  4A3J G;  4A3K G;  1BBU A;  4DV4 L;  1Q81 C;  1PA6 A;  1FJG Q;  3GJX B;  4YY3 Q;  3I55 A;  2UUA Q;  2GVB A;  4JI1 Q;  4QL5 A;  1KC8 C;  4ME3 A;  2AWN A;  4X66 L;  4LF4 Q;  3S1M H;  4A3M G;  1FJG L;  3D31 A;  4YY3 L;  1CUK A;  4JI1 L;  2VUM G;  1TAE A;  5IWA Q;  4LF4 L;  1CSQ A;  1VQO A;  2PQA A;  3K8A A;  1X3E A;  2E2J H;  2WAQ E;  3A5Z B;  5IWA L;  2D62 A;  2Z0S A;  3A5U A;  1A63 A;  3CCV A;  3I4N H;  3G48 A;  2ZM6 Q;  4XIG S;  1JE5 A;  3FHW A;  3K80 C;  3PUY A;  3M4O H;  4EX5 A;  3G6E A;  1VQK A;  4A3G G;  2ZM6 L;  1MJE A;  3E9H A;  4IJL A;  3KJO A;  1WOC A;  3CP0 A;  4OON A;  3H15 A;  4GKK L;  2F4V Q;  4WJ4 A;  1SRO A;  3M85 A;  1H95 A;  1KXL A;  2WP8 J;  2N78 A;  3QWU A;  3OTO L;  4A3F H;  2XTI A;  4L5T A;  2JK8 A;  2F4V L;  2UU9 Q;  4MTN A;  2BA1 A;  2OQK A;  2AMC B;  2I5M X;  1E7Z A;  1FGU A;  1KHI A;  1T9H A;  2MO0 A;  2OCE A;  2PMZ E;  1VQL A;  2JA5 H;  1HNZ L;  2K5V A;  1KIX A;  1I3Q H;  4HJ9 A;  4A76 A;  1SN8 A;  4H02 A;  3G4S A;  2R93 H;  3ULJ A;  3CCJ A;  5IYB H;  5E7N A;  1IBK Q;  4JI7 L;  4A3B H;  1YBY A;  3U4Z A;  4R1J A;  3J81 c;  3RLO A;  1TA8 A;  2UXC L;  3TRE A;  1IBL Q;  3PO2 H;  2VY3 A;  1Y1W H;  4JG2 A;  4DR6 Q;  3H0G G;  4UP9 A;  4HJ8 A;  1VQP A;  4C3H H;  4DR2 Q;  3E0E A;  1IBL L;  2ASB A;  4EFE A;  3D0F A;  4EQ5 A;  4GN5 A;  4GOP A;  4B3R L;  1HR0 Q;  3H3V H;  2AWO A;  4POG A;  4P72 A;  2H5X A;  3CC4 A;  2IX1 A;  2K14 A;  1P8L A;  4BY7 G;  1PFS A;  1UE7 A;  2JA5 G;  4A3I G;  2R7Z H;  4RG1 A;  2LXK A;  4YWK A;  3ULL A;  5IP7 H;  2VNU D;  1QUQ A;  3KF6 A;  5C4X G;  5IYB G;  4BA2 I;  3L2P A;  4EFB A;  2KBN A;  3UDX A;  5C0X G;  5C0X J;  2JJQ A;  1WI5 A;  4DAY B;  1M90 C;  4JI6 Q;  3KLW A;  3AYH B;  4A3L H;  4DUY Q;  1HNW Q;  3HOZ H;  4DK6 C;  4JI6 L;  4OX9 L;  2NZO A;  3F8T A;  4YCV A;  4DUY L;  2JA8 H;  3HKS A;  4JC0 A;  4AIM A;  4DR1 Q;  3S16 H;  2FXQ A;  3K7A H;  3RZD H;  5FJ8 G;  1WJJ A;  3L7Z C;  4KHZ A;  1VQ4 A;  3NEL A;  4UCU A;  4HJA A;  2Q2H A;  1Q86 C;  3GD7 A;  4IOC A;  1Q12 A;  4O2D A;  1VQ9 A;  4BBS G;  1PV4 A;  4K0K Q;  2QA4 A;  3M4P A;  1V43 A;  1EFW A;  2R92 G;  4QJF A;  1VQ8 A;  4LF7 Q;  1KRT A;  3PIO A;  2N49 A;  2A8V A;  1YJN A;  2NVT H;  2IY5 B;  1XNR Q;  1MKH A;  4K0K L;  1XTD A;  4BBR G;  3U58 A;  3HOX H;  1IL2 A;  4P73 A;  5DLQ E;  3CPF A;  1V1Q A;  2YTX A;  1ASY A;  4OO1 G;  1U0L A;  4LUV A;  2UXD L;  2KCT A;  4JI8 Q;  1EUJ A;  1O7I A;  3CW2 C;  2ZJR A;  1PH1 A;  3HOV H;  4MZ9 A;  1XDN A;  1I6H H;  2IHF A;  3AEV A;  2XGT A;  2EQS A;  1VCI A;  4LUZ A;  3FKI H;  5JJL A;  3UDF A;  4JV5 Q;  3F2D A;  3CCS A;  4LF9 L;  5H1S E;  4A3J H;  3J80 i;  1SR3 A;  4A3K H;  3NEN A;  3HFZ B;  2N3S A;  1JMC A;  1X56 A;  2NVX H;  4LF6 Q;  3PO3 G;  2WB1 G;  1K83 H;  1IYJ B;  3KOJ A;  1VQF A;  4HIO A;  1VQ6 A;  1NMF A;  1OXX K;  1PH5 A;  2VUM H;  4CC6 A;  1IXR A;  1DGS A;  1R9T H;  3W1G A;  3NBZ B;  5C3E G;  3JAM i;  3PV0 A;  2N8N A;  4GN4 B;  1K8G A;  4JI5 L;  1BVS A;  2GVA A;  1YNX A;  4R4I A;  1A62 A;  1X3F A;  2NN6 I;  3S2D H;  4TVA B;  1LM0 A;  4DR5 Q;  3GTM H;  4JYA Q;  4X62 L;  1K8A C;  3HOV G;  2ES2 A;  4HIK A;  4GNX A;  4E6N A;  4DR5 L;  3CME A;  1SRU A;  4JYA L;  5C4J H;  2WAQ G;  2HVQ A;  3A74 A;  1Z9F A;  1C9O A;  5LMN Q;  3TY5 A;  4JI4 Q;  4UCT A;  1UE5 A;  3VNN A;  4L5R C;  3T1Y Q;  5LMU Q;  4B3S L;  1N34 Q;  1NJI C;  3PF4 A;  3BA8 A;  4LH6 A;  5LMN L;  4DR3 Q;  3GDE A;  1PYS B;  4DV0 L;  4PG3 A;  3T1H Q;  5ELO A;  4A93 G;  3T1Y L;  5LMU L;  1XJV A;  1N34 L;  4KHP Q;  5JJI A;  2A1A A;  3BJU A;  4DR3 L;  1UE1 A;  3B6Y A;  4DKA C;  1JB7 A;  3IRB A;  3T1H L;  1X65 A;  1W2B A;  3S17 H;  1YHA A;  1CKO A;  3KF8 B;  2HQL A;  2K5H A;  3RTX A;  4JI0 Q;  5HGQ A;  1HZA A;  1YI2 A;  3TY9 A;  2R7D A;  3BA9 A;  4JI0 L;  3J80 c;  2KHI A;  1HZC A;  2Y0S E;  3J81 j;  5JJK A;  1VQH A;  4A3C G;  3H0G H;  4OWX B;  2YTV A;  1E3P A;  1TWH H;  4AH6 A;  4DRF A;  4A93 H;  4IFD G;  2CKZ B;  3AQQ A;  5M3F G;  2PQA B;  3JC6 6;  3ER0 A;  5FLX c;  2E2I H;  1SMX A;  4A3E G;  3KDF A;  1IBM Q;  3JAM c;  1WYD A;  1MJC A;  1Z47 A;  2JEB I;  3W1B A;  1L1O A;  4TQU S;  2L15 A;  3MEF A;  5HY6 A;  3S24 A;  5M5W H;  1HJP A;  3HOY G;  1KAW A;  4BY7 H;  2UU9 L;  3EBE A;  1OXS C;  4A3I H;  1IBM L;  1N36 L;  4LFA Q;  4LFB Q;  2UXB Q;  3AFQ A;  2F52 A;  5C4X H;  3AFP A;  1N9W A;  1VQN A;  3M7N A;  3STB D;  1GVP A;  4LFA L;  3ZJY C;  1EWI A;  4LFB L;  2WFW A;  2YTY A;  1VQI A;  3PUV A;  2OTL A;  2ATW A;  3PGZ A;  1IBK L;  3S15 H;  1OXT A;  3M3Y H;  3J7A 5;  2HHH Q;  3BZK A;  1QVF A;  5GQO A;  2V1C C;  1EIF A;  1GKH A;  1HH2 P;  5FJ8 H;  4DR6 L;  1MIU A;  1PH4 A;  1IZ6 A;  1PYB A;  2JE6 I;  4R4C A;  4DR2 L;  1QZG A;  2LXJ A;  2Q2I A;  2YU9 H;  4LF5 Q;  1AH9 A;  2HVR A;  4P75 A;  3OYY A;  1L2F A;  4BBS H;  2R92 H;  4AQY Q;  1N32 Q;  3BAB A;  1QVG A;  1HR0 L;  2KEN A;  3W5O A;  4DV1 Q;  3J7Z C;  3K0X A;  1XMQ Q;  4A3D G;  4BBR H;  1HNX Q;  4POF A;  1N32 L;  3F2B A;  1PH7 A;  4UCS A;  1VQD A;  1HZ9 A;  4DV1 L;  1N8R C;  1NBW A;  4Y52 H;  1HNZ Q;  1XMQ L;  2A19 A;  2IHE A;  5GAH C;  4NXM Q;  4BXX G;  2PNH A;  2VS1 A;  4XTC S;  4GOP B;  1S40 A;  4LFC Q;  5IYC H;  4IO9 A;  4LUO A;  4HID A;  5K36 G;  4MNO A;  1HNW L;  1PHJ A;  1LUZ A;  4GN3 B;  4DR7 Q;  1HR0 W;  2CQO A;  1NMG A;  1G51 A;  1E1O A;  4IFD I;  2AHO B;  3PSI A;  4DV7 Q;  3KFU A;  3PO3 H;  4LWC A;  1QUQ B;  3KF6 B;  1PVO A;  1I94 Q;  2RF4 A;  1UE6 A;  4GLV B;  4OWT B;  3WWV A;  5IP9 H;  4DR1 L;  1X9N A;  3GTL H;  2VL6 A;  3CQZ H;  3CCQ A;  2MO1 A;  1Q1B A;  2IX0 A;  2K4K A;  5C3E H;  3I4M G;  3TY8 A;  4LF7 L;  2I5L X;  4BY1 G;  2E8G A;  4A4I A;  1YVC A;  1K9M C;  2E5L Q;  1KL9 A;  3TQY A;  1VQC A;  4LW1 A;  1XNR L;  2OTJ A;  3BU2 A;  2HVS A;  2B63 H;  3GTG H;  2E5L L;  4JBJ A;  5IYD G;  5IYC G;  3GB8 B;  4QY7 A;  5FLM G;  2BA0 A;  1D8L A;  2PI2 E;  4DV2 Q;  1CSP A;  3OW2 A;  3VDY A;  1XPO A;  2NVQ H;  1YIT A;  1JJG A;  1UWV A;  1TWG H;  2R6G A;  4JI8 L;  2IT1 A;  1CKN A;  1Y1V G;  4GNX C;  3ULP A;  2JA6 G;  3RLF A;  4WJ3 M;  1B04 A;  2D0P A;  2NN6 G;  4L5Q A;  3UDI A;  3NBY B;  5IT9 c;  1PH3 A;  2CWP A;  2Z6K A;  4JV5 L;  4NXN Q;  5IP9 G;  1M1K C;  4BA1 I;  4GOP C;  1PH8 A;  3M4Q A;  4UPA A;  2RCN A;  3NBH B;  4IPG A;  3STB C;  3U50 C;  1XPR A;  1EQQ A;  4LF6 L;  2I0Q A;  4LH7 A;  3DM3 A;  2PI2 A;  4NXN L;  1JT8 A;  3Q8D A;  3TEH B;  3KJP A;  2AKW B;  2VQF Q;  4IPH A;  2BH2 A;  2Q2U A;  3H3V I;  3U4V A;  2YV5 A;  2B63 G;  3S1N H;  2VQF L;  4DAM A;  5M3M G;  3CC2 A;  3PO2 G;  3A0J A;  2C35 B;  1A0I A;  3PUZ A;  3S1R H;  4UP8 A;  4A3C H;  5D1O A;  1G6P A;  3FP9 A;  4UP7 A;  4JI3 Q;  4IJH A;  5FPR A;  4DV3 Q;  4C2M H;  5M3F H;  5FPO A;  4UFZ A;  3CMA A;  4A3E H;  4JI4 L;  1TWC H;  2Y0S G;  5C44 G;  2ZJQ A;  1J6Q A;  4JBK A;  1B7Y B;  3TS0 A;  4YCW A;  1YHQ A;  1NY4 A;  3HOY H;  4YHH Q; 
#chains in the Genus database with same CATH topology
 2XGQ A;  4DV6 Q;  2EIF A;  4C3I H;  2UUB Q;  2DNE A;  4K5W A;  2HGS A;  1PTO D;  5EKI A;  4RNN A;  3H94 A;  3P1H A;  3GIP A;  4N9P A;  3D6W A;  4LF9 H;  3V2T A;  4FXK C;  5IT9 W;  3W3A A;  2K5D A;  2RGR A;  2R82 A;  4NLG A;  3V6K A;  3Q22 A;  1JOK A;  5DIS C;  3PO3 B;  1VQE A;  2K5N A;  1K1S A;  2WDT A;  5KIX A;  4AYB E;  4DL3 A;  3QOL A;  4A75 A;  1GUS A;  1X6O A;  5LXT F;  1AN7 A;  1AE3 A;  1G91 A;  3DEP A;  3CCM A;  5I4D A;  5C3E B;  4O83 A;  2HVR A;  1OTC A;  1VS0 A;  4GKJ L;  3PCO B;  3GTO H;  1EZ1 A;  4P74 A;  2I87 A;  2ALZ A;  2K7V A;  2B63 B;  5ELN A;  5I2X A;  3EIV A;  1S68 A;  2B2T C;  5M3M B;  1WCM H;  1N48 A;  1F9S A;  1DOK A;  1W3S A;  2YRW A;  2CQA A;  2ID0 A;  4DV4 H;  4OGQ C;  2AGQ A;  2F4I A;  2JQO A;  3OTO Q;  1TWG B;  3IKJ A;  2UXB L;  5LMN H;  1I4R A;  5FKA C;  2R8H A;  2B29 A;  1HXY D;  4L63 B;  1L1O B;  2IJ0 A;  2F0J A;  4YB8 B;  3LGJ A;  3GV5 B;  2Y0S B;  2XRQ D;  3BDL A;  3I72 A;  1N33 L;  5I5V A;  1TKW B;  3DEO A;  1IOV A;  2ZTD A;  2C28 A;  3SVM A;  4JI0 H;  5JVD F;  1FNW A;  3OSO A;  3CC7 A;  4OWW B;  2J9G A;  4WHX A;  2ZM6 H;  1B2T A;  1YEZ A;  1S5B D;  2A74 C;  3RN5 A;  2X6G A;  4NP5 A;  2MJ8 A;  5KG5 A;  1E1T A;  1HQR D;  1A9X A;  2NTT A;  3GTM A;  2YZN A;  1I5F A;  5IYD H;  5T1I A;  2HDL A;  2AQ4 A;  1RYR A;  1F9R A;  1YJW A;  5L9X A;  1Y14 B;  3GTP A;  4M1U B;  1K0R A;  5EAY A;  1YIJ A;  4NXM L;  4IHJ F;  3TRZ A;  4LFC L;  4O4H F;  1SFO A;  2UU9 H;  1Y1V H;  2NN6 H;  2O5J C;  1PTO F;  4H13 C;  4MN3 A;  3R5X A;  4GC7 A;  3GTJ B;  3WO0 A;  2E2H B;  3TS2 A;  4XQQ A;  1BNC A;  4G3I A;  3D4W A;  2MQH A;  3NSW A;  2EPB A;  4IPD A;  2HGX A;  1I94 L;  1IBK H;  2JEG A;  5LL6 S;  5EBD A;  2PW5 A;  2W57 A;  1Q1E A;  5KYI A;  3MXN B;  2AQ1 B;  2MNA A;  3K3V A;  2F0M A;  4MAM A;  2K01 A;  3R3O A;  4DR6 H;  2VZA A;  1UEB A;  4ZI7 F;  1AE2 A;  1XMO L;  1EEI D;  2K05 A;  3CD6 A;  1OXU A;  5M3M H;  4PZ6 A;  3Q2O A;  2R7K A;  3T13 A;  1GO3 E;  5JJZ A;  4O7N A;  4G7Z C;  4HNT A;  3RJ0 A;  1SCU B;  4TQR A;  3MA2 B;  4F4Z A;  1GD7 A;  2PW7 A;  2FJ2 A;  2HHF B;  3SK6 A;  3AMU A;  4JI2 Q;  1J5E Q;  4Q8E A;  2E2J B;  2OWO A;  4KV6 A;  4X3U A;  1KDA A;  3ND8 A;  3K81 C;  4RFB A;  2ASD A;  2JA5 A;  1BKB A;  3N43 B;  4JI6 H;  3HOW H;  2YYZ A;  4TQS A;  3HKZ E;  5CB4 F;  4ED1 A;  2RHQ B;  1B70 B;  3HOZ G;  5HNE A;  3T7A A;  2ZJP A;  3H6M A;  1H9J A;  4XT3 B;  4MTD A;  3PW7 A;  1WTQ A;  1DON A;  4HYK A;  3HOU H;  5JJK A;  1G29 1;  4B3T L;  4JBW A;  4K0K H;  2GN5 A;  4N8X 1;  4A3M H;  1TY0 A;  4OO1 I;  3OHA A;  3NK9 A;  1PYW D;  4JI5 Q;  1DYQ A;  1XNR H;  4JI3 L;  4ZQI A;  1Q90 A;  1HZB A;  1JIH A;  5E3F A;  4ZUI A;  1LTT D;  1S3O A;  2M9V A;  2KEC A;  3HOX G;  1VQM A;  1XNQ Q;  1VBG A;  4ECX A;  2FPP B;  2UVU A;  1WFQ A;  2R7Z A;  4DV5 L;  2WIN B;  3PF5 A;  4F4X A;  4YHH L;  4X64 Q;  4O4I F;  4QIW A;  1QJO A;  3MFI A;  1PFB A;  1D5M C;  2EZV A;  1DV1 A;  1VQG A;  2WB1 E;  5I5W A;  3EYY A;  1EKF A;  1ZKO A;  4EQP A;  2EXD A;  4LF8 L;  1VQ5 A;  2JA6 B;  1EIY B;  1YJ9 A;  1BBW A;  4DV0 Q;  1QZH A;  4X66 Q;  1V51 A;  4A3J G;  4A3K G;  1Q81 C;  3J7Y W;  4TM5 A;  2R8J A;  4LF6 H;  4QL5 A;  2W6M A;  5IYZ F;  4O2B F;  2DNC A;  5KRU A;  4JXU A;  2K5Q A;  1FJG L;  3D31 A;  4YY3 L;  4RGM A;  5L1J A;  2VUM G;  1RJQ A;  4LF4 L;  1CSQ A;  5KG0 A;  1VQO A;  1VF5 C;  2PQA A;  3BYT B;  3K8A A;  2PZT A;  4ZRZ A;  3VR2 A;  4LMQ D;  2E2J H;  3RB3 A;  4Q4C A;  4FGR A;  1B6R A;  1NCV A;  4IFD H;  1JE5 A;  3FHW A;  4NYE A;  3PUY A;  3M4O H;  1ZHS A;  4A3G G;  2VA2 A;  1MJE A;  2DIK A;  2YWV A;  3G8D A;  4IJL A;  2PBZ A;  4NW2 A;  2F4V Q;  3M85 A;  4HN2 A;  3DTG A;  4X3K A;  3TP8 A;  3FKI A;  4MTN A;  2OQK A;  4IWX A;  4NZN A;  2AMC B;  2DJF C;  2I5M X;  2NVX A;  4XYM B;  1KHI A;  2MO0 A;  2F0W A;  4ZKC B;  3KLS X;  4JV1 A;  1TS2 A;  1I3Q H;  1SEB D;  5E25 A;  2Z8L A;  3MXG A;  4H02 A;  4ILW A;  3G4S A;  1WTW A;  3CCJ A;  1S5E D;  4B3M H;  3U4Z A;  5KFL A;  3BQ2 A;  1KJJ A;  4J9Q A;  2UXC L;  3ND9 A;  3SK4 A;  2F0Q A;  3ITP A;  1Y1W H;  4JG2 A;  1C8C A;  1VQP A;  2CW0 D;  2EYO A;  1EY8 A;  4ZAI A;  5F9N A;  4QWA A;  1S10 A;  1A3T A;  5IOC A;  5J39 A;  1HR0 Q;  2AWO A;  2CW8 A;  1NNX A;  1STH A;  1ET0 A;  2H5X A;  2LY7 A;  4J1M A;  2K14 A;  3S14 B;  2JA5 G;  2C9O A;  3ULL A;  3UZO A;  5KND A;  3KF6 A;  4HED A;  4BA2 I;  3L2P A;  1TVX A;  4QMG A;  1M90 C;  2JJQ A;  1WI5 A;  4DAY B;  2L5T A;  4C1N I;  4A3L H;  1EL0 A;  1K0S A;  2HHH H;  2IBK A;  4MV8 A;  2FMA A;  2RKS A;  1BXR A;  4DUY L;  1PXU A;  4QWE A;  4K6N A;  4ED2 A;  4CMD A;  5KFZ A;  5COY A;  3EPI A;  2FXQ A;  5EQ0 A;  3H0G A;  5FJ8 G;  1TWH A;  5ELF A;  1SSO A;  3MTS A;  2RDF A;  3BDC A;  5CM0 A;  3GD7 A;  1ET9 A;  4XQN A;  4OHJ A;  1VQ9 A;  4BBS G;  1W93 A;  4AQY H;  1D7Q A;  3Q1K A;  2QA4 A;  1EFW A;  4ECS A;  2A8V A;  1XMQ H;  4EQO A;  4QWD A;  3CKI B;  2N55 A;  3DWP A;  1MKH A;  1HNX H;  4HTH A;  4BBR G;  3GTO A;  2RBM A;  1IL2 A;  4P73 A;  1JIC A;  1V1Q A;  1STA A;  3CPF A;  3NTK A;  1ASY A;  1U0L A;  1FNU A;  4OO1 G;  1JC7 A;  4JI8 Q;  1EUJ A;  3MR2 A;  2CQY A;  1I6H H;  1IYE A;  4X65 H;  3AEV A;  4O3S A;  5JJL A;  4DR7 H;  4JV5 Q;  4LF9 L;  4K2K A;  4DL7 A;  1JMC A;  3NEN A;  3GQC A;  4BY7 B;  3DMU A;  5KFJ A;  2OXP A;  4NDX A;  3K3P A;  4I7A A;  1OXX K;  1PH5 A;  3MEH A;  1DGS A;  5DGH A;  4ECQ A;  1EYD A;  4J9N A;  4U68 A;  3R23 A;  1BVS A;  2GVA A;  2CW0 C;  3M3Y B;  1X3F A;  2NN6 I;  4TVA B;  3HP3 A;  2K04 A;  4DV2 H;  1SNC A;  3K6O A;  4N9T A;  4JYA L;  5C4J H;  4IUN A;  4O3P A;  4IUP A;  4XQJ A;  2YS6 A;  2DWC A;  2R92 B;  5LMN L;  2UVV A;  3GDE A;  4L8J A;  5IGD A;  5K3W A;  4EVO A;  3T1H Q;  5ELO A;  2F3W A;  4O81 A;  1NAP A;  1EU4 A;  4FBT A;  1MSH A;  3B6Y A;  1WTR A;  4FM9 A;  1H9S B;  1SND A;  4CDC C;  1CKO A;  4WBN F;  3MXU A;  5H80 A;  1ZXT A;  2KVM A;  5T14 A;  4MV6 A;  2J6T A;  3T5J A;  3BA9 A;  4QWC A;  1SJE D;  5KFM A;  1NR2 A;  1SNO A;  3J81 E;  4JI0 L;  3J80 c;  2KHI A;  3S16 B;  2X0S A;  3L4J A;  3RZD B;  4GZY C;  2COJ A;  1EY6 A;  5C5L A;  5KFC A;  5KT2 A;  2B63 A;  3L9A X;  4DRF A;  3MR3 A;  1EZ6 A;  1L2Z A;  4DV3 H;  2CKZ B;  4O84 A;  1TWG A;  3ER0 A;  4A3E G;  3OMC A;  1NSN S;  2NVT B;  1KBL A;  2ZDG A;  2ENB A;  1MJC A;  4UY8 C;  2JEB I;  5JQG F;  1L1O A;  5HY6 A;  3MEF A;  3TEK A;  5M5W H;  5A2Q W;  1RK6 A;  3Q8R B;  4BY7 H;  2F1M A;  4C3I G;  2UU9 L;  2Y0S A;  4DNR B;  2EJG C;  3PMF A;  4LFA Q;  1JXL A;  5D3D A;  2UXB Q;  4G7O C;  2A6E D;  4JUZ A;  5C4X H;  1C48 A;  1EOT A;  4TV9 F;  3STB D;  2GLT A;  4MV3 A;  1CA5 A;  1WSC A;  2WFW A;  1AZP A;  4O7Y A;  1IBK L;  3S15 H;  4A3J B;  4A3K B;  1BOS A;  3M3Y H;  1JOO A;  4DA2 A;  1QVF A;  3M9N B;  4JI1 H;  1IYV A;  1TR5 A;  1PZK D;  4HCE A;  3FMA A;  4PV1 C;  3QB3 A;  4GKJ H;  1EIF A;  4IUV A;  4DR6 L;  2D5D A;  3JAM L;  2VUM B;  1N56 A;  4R4C A;  1KNE A;  3R8B A;  2OH2 A;  3TME A;  2R92 H;  1LTG D;  4QSH A;  2KHS A;  4IRK A;  4DV1 Q;  3J7Z C;  2XNA C;  2ZJT A;  2PMZ B;  4UCS A;  1S97 A;  4POF A;  2FLL A;  4IR1 A;  4IWY A;  3GTJ A;  4GKK H;  2E2H A;  3U54 A;  1I4G A;  1KAB A;  4Y52 H;  3PR5 B;  2A19 A;  1C3O A;  2QEJ C;  4IZO A;  3FMC A;  4NXM Q;  4LFC Q;  5IYC H;  3RF2 A;  3TP6 A;  3JAM W;  1SYD A;  4LUO A;  1GUT A;  1N33 H;  5M3F B;  2R85 A;  4MNO A;  2A6H C;  3MXN A;  1V1P B;  4GN3 B;  3HOY B;  2CNU A;  2VPQ A;  2O4X A;  3Q8Q B;  4IFD I;  2AHO B;  4XYL B;  3GV7 B;  1QUQ B;  3A7L A;  5NUC A;  1I94 Q;  3I3C A;  3T16 A;  4JI7 H;  1STG A;  3KBG A;  2BOS A;  3QG1 A;  1O75 A;  2HHF A;  5DG9 A;  5C4H A;  2M05 A;  2I5L X;  4WRD A;  3N44 B;  1YVC A;  2AGO A;  1XNR L;  4F4Y A;  4LW1 A;  2OTJ A;  3BU2 A;  2ABJ A;  2HVS A;  3KRE A;  5IYD G;  1EIH A;  4B3R H;  1S4Z A;  3OW2 A;  3VDY A;  1EIG A;  2BCO A;  3MVV A;  4CJ2 C;  5KFW A;  1G2W A;  1Y1V G;  3ULP A;  2OT2 A;  2NN6 G;  1BQQ T;  1GUW A;  2CWP A;  4CJ1 B;  5LOV F;  1VDZ A;  1BR9 A;  3E3X A;  4NXN Q;  1B9N A;  2A6E C;  4QUC A;  4F88 A;  5IP9 G;  2NU6 B;  3STB C;  1XPR A;  2RCN A;  5E4X A;  3A8I E;  1R4Q B;  1EQQ A;  4LF6 L;  1EQT A;  2PI2 A;  1GOZ A;  1JT8 A;  3G6Y A;  1SXT A;  4OX9 H;  4ABN A;  3KJP A;  5BMV F;  2LFN A;  2VQF Q;  1EWH A;  5C1O A;  3TSS A;  2QDB A;  2B63 G;  3GV8 B;  1G8Z D;  2WYO A;  5EKK A;  2ZT9 C;  5M3M G;  1SE3 A;  3PUZ A;  4L1K A;  3NQI A;  2DZD A;  2O2L D;  1ICF B;  4TRD A;  4EQN A;  5C6A A;  1G6P A;  3FP9 A;  3SXH A;  4UP7 A;  2Z4H A;  4JI3 Q;  5FPR A;  5FPO A;  5M3F H;  2FIN B;  2PPB C;  2JA6 A;  1UC8 A;  5FLX E;  1TWC H;  2Y0S G;  4S3S A;  1J6Q A;  1I4X A;  3TS0 A;  1NY4 A;  4BBR B;  5KGU A;  4YHH Q;  3HOY H;  5M5Y B;  5D65 A;  4BY1 B;  2UXD H;  1U5K A;  1CKM A;  1L1O C;  5BYB A;  2C2E A;  4FBU A;  3HOW G;  2QDL A;  1FYC A;  4XYO A;  4GNX B;  3SGI A;  4LF8 Q;  4RH6 A;  3NHH A;  2PN1 A;  2EOT A;  1JKJ B;  3S2H H;  3PO2 B;  4ECW A;  1Z2O X;  4JOI A;  4HJ7 A;  2CCZ A;  3DTF A;  1SJH D;  1C7Y A;  5IIF A;  2W8L A;  4DUZ Q;  2F0D A;  3I8Z A;  4ME6 A;  4ETS A;  4B3M L;  4ED7 A;  1E0B A;  2F0H A;  3HOU G;  4J9S A;  1QNU A;  2BDO A;  1BO0 A;  4LAA A;  4MV1 A;  3G6J B;  3U9S A;  4CGY B;  3IFD A;  1EFI D;  4K5X A;  4DAV A;  2I5H A;  3J7A V;  4XYQ A;  3QJY A;  3TZU A;  3UDG A;  3KHG A;  3PVX A;  2SEB D;  2SNM A;  2UUC Q;  5D1P A;  1LYL A;  4YR2 A;  3D8G A;  3PUW A;  4RHR A;  4Y7N B;  4J9M A;  2F0F A;  3VR5 A;  3VYT A;  4RUC A;  1H9K A;  1RJR A;  2A73 B;  2J0T D;  4G57 A;  3MWD A;  3H4B A;  3T51 B;  3N41 B;  3HRZ C;  4YY3 H;  3C2P A;  4DR3 H;  5IY0 A;  2DGY A;  4LF4 H;  2NB0 A;  1TWA B;  3K59 A;  1XPU A;  2HHH L;  1JJ2 A;  3GV6 A;  2FPG B;  3NBI A;  1I50 B;  1NTG A;  2HIV A;  3PUX A;  4GS3 A;  1AZQ A;  2RQX A;  5I5X A;  2IA6 A;  1KAA A;  1ICW A;  2OQ0 A;  2M00 A;  2KCN A;  3ETJ A;  4FFP A;  3R9R A;  3RD4 A;  2R84 A;  2UXC Q;  1JWU D;  3QZ7 A;  3ERO A;  4IFD G;  4AQY L;  5M5Y H;  4BY1 H;  2V4Q A;  3DLL A;  3J7A K;  3ORR A;  1HA5 A;  4QQB X;  1RIP A;  1HNX L;  1Z7T A;  5I6W A;  3BZC A;  3GTQ A;  5FLM H;  3PO2 H;  3LWU A;  4DPG A;  1K3R A;  2NZH A;  3TP7 A;  1IKL A;  1HFN A;  2SDF A;  4KLK A;  5FO7 B;  2RSO A;  4A3E B;  1I1L A;  2ZDQ A;  5DGA A;  2V59 A;  4I55 F;  3NUA A;  4EGJ A;  3H20 A;  4X65 L;  3GII A;  4PMC A;  4C3I B;  2JEF A;  4JBM A;  1H9M A;  1VQJ A;  2EDG A;  2F0S A;  3L3O C;  4GLA C;  4DR7 L;  4RB1 A;  4LFB H;  4WJW A;  3RNU A;  1KLG D;  3L0O A;  2MGS A;  3WNZ A;  4CC5 A;  4DR4 L;  4XDX A;  3TQ1 A;  3GO5 A;  4FO2 A;  2VUG A;  3BVZ A;  1Y1W G;  3T9E A;  1I4P A;  2B3G A;  2X69 A;  3C1E A;  3G6V A;  4DR2 H;  1P16 A;  2OEO A;  3I56 A;  1EYZ A;  2P0A A;  2I07 B;  4DQN A;  4Y7N H;  4YAK B;  5C3W A;  2H4O A;  5BPF A;  5EPK A;  3K0Y A;  3LQS A;  3T5H A;  2KHJ A;  3S1Q H;  3I12 A;  3OHB A;  3QQM A;  3NEM A;  5DEH A;  1FL0 A;  2W6P A;  4DV2 L;  4FYD A;  4P71 A;  5KFO A;  1GLV A;  3KXY T;  2E74 C;  4HIM A;  4PNY A;  2EY5 A;  3MWM A;  5JVH 3;  4UCV A;  2XSC A;  3NPP A;  3OWE B;  1VQ7 A;  1TWA H;  3GIJ A;  2XCA A;  1WCM B;  2VQE Q;  1JWS D;  4RU9 A;  1I50 H;  1V9P A;  1EYC A;  4DUY H;  3DWA A;  3VR4 A;  3BAA A;  1HNW H;  4A3L G;  1CKN B;  5HGT A;  2X5R A;  4FU0 A;  4LF9 Q;  4I50 F;  1LTR D;  1JCK B;  4JOI C;  4ALP A;  3JSN A;  3RV4 A;  5KT7 A;  4ECY A;  4YJ2 F;  4QIW E;  2K75 A;  4ECT A;  3PZP A;  3V96 A;  2JA7 H;  3DAA A;  5BR8 Q;  4UCO A;  4LF7 H;  4O3O A;  2BH8 A;  2R93 B;  2YYA A;  1A3U A;  2DPJ A;  3HG9 A;  2FKL A;  3MR6 A;  4BWS C;  1A8V A;  2R92 A;  4KKU A;  1F2Y A;  2QGQ A;  2XN9 C;  1WTO A;  1RHP A;  4GLX A;  1G2T A;  4YR0 A;  2W9B B;  1QVC A;  3M9B A;  5D1O B;  4ZK9 B;  4O3N A;  1H9S A;  3SK8 A;  1HPC A;  4XT1 B;  1CFM A;  3ERQ A;  2GA4 B;  4DV4 Q;  1Y1V B;  1QB5 D;  1RL2 A;  2B8G A;  2UUA H;  4DL2 A;  3KYH C;  2W7P A;  3GJX B;  3I55 A;  4J9K A;  2GVB A;  3T53 B;  1VKZ A;  4EBD A;  1B50 A;  4JI1 L;  1TAE A;  1AFP A;  1OBD A;  3SE7 A;  2EY6 A;  2XCL A;  1K28 A;  3LP8 A;  1ET6 A;  2YW2 A;  5IWA L;  2D62 A;  3CCV A;  3G48 A;  4JYA H;  2ZM6 Q;  4YQW A;  2G9H D;  3K80 C;  2E75 C;  4CKC A;  2COI A;  3T4A C;  4ZUJ A;  3G6E A;  1JE4 A;  1ZEQ X;  4H7B A;  4GKK L;  4JI4 H;  1H95 A;  4NZM A;  3QWU A;  3ZYY X;  4EGV A;  1IOW A;  4UHV A;  5D3I B;  2WTF A;  1CS0 A;  2NWG A;  4C5A A;  3Q23 A;  2UU9 Q;  5KFR A;  4X3T A;  4A2B A;  5JPN C;  2UUB H;  1LAB A;  2OCE A;  2Z6B A;  5JEA H;  1VQL A;  3PW0 A;  3HOW B;  2K5V A;  4FF3 A;  1RDP D;  4HQ6 A;  2W6N A;  4A76 A;  1SN8 A;  2VUM A;  2LMC B;  2R93 H;  1R4P B;  4DIM A;  5E7N A;  3KUP A;  3K5M A;  1IBK Q;  5ELE A;  4JI7 L;  1YBY A;  3OSN A;  1SMY D;  3J81 c;  1L0X B;  3MWE A;  5KFH A;  5CYU A;  1CM9 A;  3TDQ A;  3K5L A;  2RDH A;  2VY3 A;  3D3R A;  4OL7 A;  3H4D A;  4DR6 Q;  2PMZ A;  3HOU B;  1I4Q A;  1PFN A;  2PNR C;  3EVQ A;  4C3H H;  3KTM A;  4RNM A;  4A3M B;  4CKB A;  1IBL L;  3BZD B;  5A35 A;  5DQI A;  2ASJ A;  4EFE A;  2KA7 A;  4EQ5 A;  5KEE A;  2FJZ A;  4RB2 C;  4B3R L;  1EUD B;  3OWF A;  2I46 A;  1PTO C;  4P72 A;  3R2I A;  4YBZ B;  3K57 A;  3Q24 A;  4BY7 G;  1XX8 A;  2EVB A;  2NYZ D;  2QF7 A;  4J9L A;  4RG1 A;  4YJ3 F;  3KAJ A;  1ZYR D;  1BNZ A;  2VNU D;  3BJY A;  5KFI A;  1QUQ A;  5C4X G;  5IYB G;  2QCP X;  1WTX A;  2L0C A;  4JI6 Q;  3I90 A;  4C5C A;  1T5E A;  2EY2 A;  3X3M A;  3HBL A;  4MV9 A;  2F0U A;  4OX9 L;  3D4D A;  1SNQ A;  3F8T A;  4PDB A;  2CH4 W;  4JC0 A;  2GPW A;  3L7Z C;  4KHZ A;  1VQ4 A;  4UCU A;  4DXG A;  4R8I A;  2XRS D;  1PV4 A;  4K0K Q;  2R92 G;  1M7J A;  1VQ8 A;  2R3Z A;  2ICI A;  4DAP A;  4P2C B;  1XNR Q;  3H3V C;  2M2L A;  5FK9 C;  4LK1 C;  4R9W A;  3M4O B;  1DOL A;  3HXL A;  1HNZ H;  2HD3 A;  1EUC B;  4RCO A;  4LUV A;  4U7C A;  2UXD L;  1SYE A;  2B39 A;  2KED A;  2KCT A;  4K5V A;  3DHQ A;  3HOV H;  4O7W A;  2IHF A;  1ESR A;  1OBG A;  4O7Z A;  5BPH A;  4FS2 A;  2EQS A;  3UDF A;  1U4P A;  2K03 A;  3OIP A;  4ZQ3 A;  2W6Q A;  1SR3 A;  4DV7 H;  2N3S A;  3AW8 A;  1X56 A;  4KK7 A;  5L1L A;  4LF6 Q;  1EEF D;  1K83 H;  1I3Q B;  2J4X A;  1E4F T;  1MBY A;  2RDJ A;  3MR5 A;  3WWJ A;  1VQF A;  2KCC A;  5E4W C;  1NMF A;  4HIO A;  4FFM A;  1SMY C;  2DPI A;  3W1G A;  2XWB B;  3QO2 A;  1LO5 D;  2EJM A;  4GN4 B;  4QF4 A;  3JAM i;  1RTN A;  1K8G A;  1YNX A;  1Y1W B;  3TIN A;  4DR5 Q;  1EY0 A;  2RA4 A;  1K8A C;  3JZ6 A;  3M4I A;  2KSW A;  4GNX A;  4E6N A;  1WTP A;  1S5F D;  1EQV A;  1KTA A;  3SEB A;  1C9O A;  3NP8 A;  1K8M A;  3P7J A;  4JI2 H;  1J5E H;  1RF2 D;  3T1Y Q;  3BA8 A;  4G4K A;  1EY7 A;  1ZYR C;  1PYS B;  4PG3 A;  3UI2 A;  4RB3 C;  5LMU L;  1XJV A;  1N34 L;  5KFG A;  5JJI A;  1EU3 A;  2A1A A;  5C5J A;  4DR3 L;  1UE1 A;  2HG8 A;  3IRB A;  4FXG C;  5KFF A;  3RB4 A;  1X65 A;  1W2B A;  2C22 A;  4K8J A;  4TKO B;  4CE5 A;  3RUP A;  3KF8 B;  5CV8 A;  5HGQ A;  1IL8 A;  3SDZ A;  3N52 A;  3KLR A;  5CA0 F;  1BCP B;  1TT2 A;  2Y0S E;  2HDK A;  3J81 j;  1VQH A;  3GTG A;  5I47 A;  5LL6 b;  4OWX B;  2YTV A;  4QW8 A;  4HSV A;  2NU8 B;  2CNQ A;  1B53 A;  2Q8I B;  5M3F G;  5FLX c;  4O7S A;  1KEE A;  3NUC A;  3CQZ B;  1WYD A;  2PO4 A;  1A3V A;  4UUG A;  3HOY G;  3S24 A;  1CQJ B;  1HJP A;  2LKV A;  3EBE A;  1IBM L;  4RZQ A;  5JQW A;  1TWA A;  4J9R A;  1N36 L;  4X64 H;  3E0J A;  1A6X A;  2HJW A;  3AFQ A;  3DUZ A;  5KX5 F;  1I50 A;  4Q5V A;  1I6H B;  4ZOL F;  4DL5 A;  3ZJY C;  5L1K A;  5C0X H;  4ODG A;  1U4L A;  3J80 L;  4LFB L;  2WAQ B;  1BUV T;  5DGB A;  5DLF A;  1OXT A;  1GJX A;  3J7A 5;  2HHH Q;  3E5N A;  1EYA A;  2BR0 A;  4N8F A;  2I80 A;  4XX0 B;  4ULL A;  4A93 B;  3BYY B;  2V1C C;  5EJW A;  1MIU A;  3EPG A;  2YU9 H;  4DR2 L;  1XXG A;  2AUK A;  2LXJ A;  2Q2I A;  5CC4 A;  3GIM A;  2MPM A;  5KFD A;  2EYF A;  1Z2P X;  3CHB D;  4AQY Q;  4FFN A;  4IR9 A;  1QVG A;  3J80 W;  2D2C C;  3AB9 A;  1XMQ Q;  5KFB A;  1HNX Q;  1N32 L;  5JOB A;  1N8R C;  2ODT X;  5C4J B;  2SOB A;  4XTC S;  2F4V H;  4GOP B;  5BWR A;  3KBX A;  1HCZ A;  2MUY A;  4HID A;  2WKD A;  1B4O A;  1SBB B;  4EYH B;  1HNW L;  1A48 A;  2RDG A;  5FR9 A;  4DR7 Q;  3TQT A;  2CQO A;  3UZB A;  1ML0 D;  1Y69 U;  2F03 A;  3KFU A;  4M0J A;  4F87 A;  4OWT B;  2NU7 B;  3MFG A;  2RSN A;  2KUM A;  5KFN A;  3EQL C;  1EY5 A;  3CQZ H;  3CCQ A;  1RJP A;  3U55 A;  4LSX A;  3Q8S B;  1TY2 A;  3TY8 A;  4LF7 L;  4KMU C;  3GV3 A;  4BY1 G;  1CZW A;  1WD0 A;  1K9M C;  1CT1 D;  1ENC A;  1KL9 A;  1VQC A;  4RGO S;  3RBD A;  1WCM A;  2E5L L;  3GB8 B;  3OUZ A;  4QY7 A;  3GTK B;  4RCN A;  5FLM G;  2BA0 A;  1D8L A;  2PI2 E;  4MIU A;  2AQ3 B;  5AFW A;  4DV2 Q;  2NVQ H;  3PO2 G;  1JJG A;  2WE6 A;  4J9O A;  1UWV A;  1S0O A;  3H09 A;  4GNX C;  5CE8 A;  1CKN A;  3GIQ A;  1B04 A;  5CV4 A;  1STE A;  2HDM A;  3UDI A;  4C56 C;  1XTC D;  5M5W B;  1PH3 A;  3FPU B;  2HGW A;  3OPO A;  2UUA L;  4IUT A;  4A93 H;  1PH8 A;  3X3N A;  3NBH B;  1JOR A;  5KFQ A;  2DJG C;  4DR4 H;  5C4X B;  2I0Q A;  3GQB A;  3DM3 A;  3Q8D A;  4JK1 C;  2R93 A;  3GIL A;  3S15 B;  4CMF A;  3GLK A;  3U4V A;  2YV5 A;  2D9U A;  4BS9 A;  3S1N H;  2AGP A;  3VYU A;  5KFT A;  1KC7 A;  1SYB A;  4UDU C;  1KUT A;  4LSA A;  4OIK A;  2W9B A;  5D1O A;  1CQV A;  4IJH A;  4I65 A;  3VMM A;  4DV3 Q;  4C2M H;  1Y1V A;  3CMA A;  1M0T A;  5CGK A;  4JI4 L;  2ZJQ A;  4FVM A;  4JBK A;  3N40 P;  1YHQ A;  1TS3 A;  3T5L A;  4PZ8 A;  2W70 A;  2R87 A;  3NWT A;  4AYB G;  1G6Z A;  3UE0 A;  5AJ3 L;  4L6T B;  3VYS A;  2UUB L;  2YRX A;  5IGB A;  1JJC B;  2NVY H;  4KD3 A;  1ROD A;  2L1B A;  1FVI A;  4C3J H;  1X54 A;  2EJ2 A;  1GSA A;  3J81 i;  2R8I A;  5LMN W;  2DUD A;  2FP4 B;  3SE0 A;  3MXP A;  4KTA A;  3BG3 A;  5C8Y F;  1T36 A;  4E4T A;  4K6L A;  5BN5 A;  3GTK H;  2HIX A;  2JA7 G;  4GKJ Q;  2F0G A;  3K7U C;  1X55 A;  1D1K A;  4DNI A;  4I4T F;  5GAD C;  3ETH A;  4MA0 A;  1A2T A;  3ERS X;  5CBE E;  4X62 H;  5D8D A;  1GUN A;  1W96 A;  3PR4 A;  5F2D A;  1CHP D;  3CSW A;  4A3D H;  2DN8 A;  4GKK Q;  2XGP A;  4B3S H;  1AUX A;  4IPC A;  4BXX H;  1O7Y A;  2Q2T A;  2EE1 A;  2EYM A;  2NZ1 D;  3BQ0 A;  3KDF B;  2R61 A;  4ECR A;  5KKN B;  4RNO A;  1ILQ A;  4YWL A;  3BVG A;  1N33 Q;  1EY4 A;  2ALY B;  3T1H H;  3HO8 A;  2XIW A;  3C0F B;  5GAE C;  5IWA H;  1EY9 A;  2RVL A;  3SI8 A;  4HJ5 A;  1JWM D;  3KK7 A;  4JI7 Q;  3MC0 B;  4JCV E;  4RAU C;  1TWF B;  5KFA A;  4L5S A;  3KAL A;  4IFD J;  1E22 A;  3PN1 A;  2IX3 A;  1ASZ A;  4FDB A;  3I4M H;  1WCM G;  3G8C A;  3RN2 A;  1I7N A;  2WAC A;  4PBC A;  4WD3 A;  3CAM A;  5KYL A;  3PIP 3;  3WWI A;  3UE1 A;  2NU9 B;  2K6A A;  2DAB A;  2B2U A;  2EY1 A;  3FPP A;  4C1N K;  5I6Y A;  1HNZ L;  4B3R Q;  1L0W A;  2ICE C;  1TWC B;  1DZ1 A;  1QE6 A;  1DAA A;  4YWM A;  1K3B C;  5JEA G;  5IT9 E;  5DAA A;  3IFT A;  1X3G A;  3TW6 A;  5CV7 A;  4DV7 L;  3S2H B;  5DAU A;  2R93 G;  1SE2 A;  5M5X B;  3GTP B;  5BWV A;  4OX9 Q;  3K5O A;  2Y4R A;  1XMO Q;  1E2V A;  1C4Q A;  1UEA B;  1LT3 D;  1F2Z A;  3CF5 A;  1A2U A;  3VPD A;  3N8D A;  3A54 A;  4APM A;  1IBL H;  1S0M A;  2VW9 A;  2FLN A;  4C3H G;  2F0O A;  4H44 C;  3T56 B;  2EJ0 A;  3JZF A;  1CQF A;  1DM0 B;  3Q8P B;  3HKZ G;  1TS4 A;  1B8A A;  4O2A F;  1YHB A;  2L12 A;  4JW0 A;  3PQI A;  4YP3 A;  4JPB W;  5C0X I;  3OSP A;  1KJ8 A;  3PIP A;  2K52 A;  5C44 H;  3IL8 A;  4JI2 L;  3HEJ A;  5ELD A;  1J5E L;  4LMY A;  4Q45 A;  1LTL A;  2UXD Q;  4HNU A;  5K2M A;  1I3Q A;  4J15 A;  3KHH A;  2GPS A;  4EBC A;  2JA9 A;  1TWF H;  1Q46 A;  4EEQ A;  4A3F B;  2ZGI A;  2O03 A;  5KS8 A;  3QR8 A;  4DR1 H;  3HS0 C;  4B3T Q;  1Y1W A;  2JYO A;  4FF1 A;  4Q8F A;  3RGX A;  1ENF A;  5FD6 A;  1FGB D;  2MFI A;  3RLN A;  3MZ5 A;  3WWH A;  4R4Q A;  2EYP A;  1PZI D;  1D1I A;  2F0I A;  3I4O A;  2IMW P;  4DV5 Q;  4A3B B;  3QIA A;  1GGO A;  3NC0 B;  2PYK A;  2QIL A;  4KJO A;  3JSL A;  3CPW A;  2KQ3 A;  4Q0Y A;  2D0O A;  2FK1 A;  1XNQ L;  5HV6 A;  4K2L A;  5FO8 B;  3G71 A;  4O4L F;  2ZTC A;  4ME5 A;  1BBX C;  2ZTE A;  5M5X H;  4X64 L;  4A3G H;  3GTP H;  2K5W A;  3C46 A;  4NPS A;  4MHE A;  1SFO H;  1STN A;  3D4R A;  3AX6 A;  4RKL A;  1AEX A;  1FJG Q;  5I5S A;  4YY3 Q;  4IRC A;  4NXN H;  4LF4 Q;  2DY8 A;  4X66 L;  3S1M H;  4A3M G;  3HGB A;  3M7G A;  1CUK A;  4Y8V B;  2K28 A;  1X3E A;  3TN2 A;  3V4Z A;  2IW3 A;  1YNN D;  3A5Z B;  3U9O A;  2Z0S A;  2MP1 A;  1QIL A;  1A63 A;  4ECV A;  3I4N H;  3CU7 A;  1E2W A;  4XIG S;  1KJI A;  3I91 A;  2F0P A;  4EX5 A;  1FKA H;  1JLL B;  3K7A B;  1VQK A;  3S1Q B;  3E9H A;  1U4R A;  4OON A;  3CP0 A;  1PDQ A;  3H15 A;  4WJ4 A;  1KXL A;  2JEI A;  4TV8 F;  5LMU H;  2WP8 J;  2N78 A;  1N34 H;  4A3F H;  2XTI A;  2HCI A;  1J9O A;  2B2U C;  2WAQ A;  2R7N A;  2HUG A;  2A1H A;  2JK8 A;  2F4V L;  2BA1 A;  4KHP H;  1HHV A;  1E7Z A;  1FGU A;  1T9H A;  2FK3 A;  1EHI A;  2PMZ E;  2JA5 H;  3I73 A;  4AYB B;  1E4E B;  1KIX A;  1I2K A;  2PZW A;  2B2V A;  4M9U A;  3EA6 A;  1BCP D;  4A3B H;  3T9B A;  4R1J A;  3URY A;  5IGC A;  1SEI A;  5EWF A;  4DUZ H;  4ECU A;  1T5X D;  1I2L A;  3CRL C;  4UP9 A;  3SR1 A;  2JP1 A;  4HJ8 A;  2W8K A;  4DR2 Q;  4O3Q A;  3E0E A;  4IIJ F;  4FFO A;  4CKE A;  2JA7 B;  1B33 N;  1DD2 A;  3RMH A;  4MTK A;  4DAY A;  2V4R A;  1IBM H;  1R9T B;  4GN5 A;  4GOP A;  4R7R A;  3OW7 A;  1N36 H;  4RUA A;  2W9C B;  1B6S A;  3CC4 A;  2IX1 A;  3DM1 A;  4U67 3;  1PFS A;  1UE7 A;  5JAV A;  2R7Z H;  3S2D B;  2UUC H;  2JEJ A;  2LXK A;  3DWQ A;  3TBI B;  2RCF A;  5IP7 H;  5JVG 3;  3RV3 A;  3J81 L;  2NUC A;  4EFB A;  2KBN A;  1WH2 A;  5C0X G;  4QW9 A;  5KFE A;  5LA6 F;  3U9T A;  5COR A;  3H40 A;  2JN4 A;  3AYH B;  4DUY Q;  1HNW Q;  4DK6 C;  3DF7 A;  4J0M A;  1MHW C;  3QZ8 A;  2QYZ A;  4YCV A;  2JA8 H;  3LWB A;  3HKS A;  5HUR A;  5KG6 A;  4ZKB B;  3K7A H;  2N88 A;  1WJJ A;  4LF5 H;  1I6V C;  1KJQ A;  5D14 A;  3GTK A;  3MAQ A;  2A69 D;  3S17 B;  3V4S A;  2CHB D;  4IOC A;  1YNN C;  1Q12 A;  1N32 H;  3J81 W;  3I4L A;  3M4P A;  1V43 A;  4QJF A;  4LF7 Q;  4Q43 A;  2KJX A;  1NUC A;  1GHJ A;  2N49 A;  4OEL B;  2NTS A;  3PIO A;  4RA8 A;  4LJZ C;  1YJN A;  3CVZ A;  3U58 A;  2IPK D;  4FP5 D;  1LTB D;  4HR7 B;  1E2Z A;  2FHT A;  3NBH A;  2CNV A;  2J6U A;  2ZJR A;  3CW2 C;  1KT8 A;  4Q0F A;  5KFY A;  4MZ9 A;  2E2I B;  3FKI H;  5C5M A;  3CCS A;  2F0V A;  5H1S E;  3J80 i;  2UUA Q;  3HFZ B;  1EKV A;  2NVX H;  5EWE A;  4Q4D A;  4A3I B;  1TII D;  1HA6 A;  4DXF A;  1BCP C;  3KOJ A;  1BCP F;  1WRV A;  1VQ6 A;  1D5X C;  1B3A A;  1R9T H;  3LX0 A;  5LP6 F;  2N8N A;  2E5L H;  5C1P A;  3T54 A;  1UC9 A;  2YZG A;  4O3R A;  2L4N A;  4MA5 A;  1B9M A;  2ZDH A;  4O86 A;  1SE4 A;  4R4I A;  4R8U B;  5DG8 A;  1A62 A;  3S2D H;  1LM0 A;  4C3H B;  3U0G A;  4JYA Q;  1ZHQ A;  4X62 L;  2WII B;  1S5C D;  5CV5 A;  3HKZ B;  5DGI A;  4CDF C;  4R8N A;  3CME A;  1SRU A;  1GUG A;  2WAQ G;  3MFY A;  1Z9F A;  5LMN Q;  2HVQ A;  5IT9 L;  4JI4 Q;  2YCH A;  3VNN A;  4B3S L;  3PF4 A;  4LH6 A;  3Q6S A;  3RFC A;  1W6J A;  4A93 G;  1ZAU A;  4IAL A;  3RGZ A;  3UYY A;  3A55 A;  3BJU A;  1Y8N B;  4DKA C;  3T1H L;  5KFS A;  3S17 H;  2GQS A;  5G3L F;  1YHA A;  2B8F A;  2HQE A;  2K5H A;  1WR2 A;  4JI0 Q;  1HZA A;  1YI2 A;  1HTL D;  3A56 A;  3TY9 A;  1QG7 A;  2B2V C;  1V4Y A;  5EWG A;  5BWW A;  3TP5 A;  4RAZ A;  2Z02 A;  1HZC A;  3UFX B;  2A69 C;  2ATL A;  1ILP A;  3H0G H;  4AH6 A;  4IUQ A;  1E3P A;  1TWH H;  3RB6 A;  1DJR D;  2WB1 B;  4TUY F;  2CH4 A;  3C1F A;  5BR8 H;  1B3Q A;  1VF7 A;  2EYJ A;  4ZLT F;  3FVQ A;  1HUN A;  3R5H A;  2E2I H;  5KG1 A;  3GTL B;  3KDF A;  1O80 A;  2G9D A;  4GOP C;  4DV6 H;  4TQU S;  3A8K E;  4RGT A;  4FXD A;  2MHV A;  4FFL A;  1FNV A;  1TS5 A;  4A3I H;  4IRD A;  2WV6 D;  3BQ1 A;  3TW7 A;  2DLN A;  1SYF A;  3HOV B;  1ENA A;  4DN4 M;  3AFP A;  1N9W A;  3M7N A;  1GVP A;  4LFA L;  2LS0 1;  1EWI A;  5DMX A;  2PZU A;  1AN8 A;  2YTY A;  4C3J G;  1VQI A;  3PUV A;  5IGG A;  1D6E C;  5I2Y A;  1K8O A;  5EPL A;  1TWF A;  3A8J E;  1PRT B;  3BZK A;  2V9W A;  3K58 A;  1K83 B;  4IQZ A;  5GQO A;  1HUM A;  5FLX L;  5L1I A;  5KNB A;  2R7M A;  1HH2 P;  1GKH A;  3CRK C;  1PYB A;  4F50 A;  1QZG A;  3K5I A;  4P75 A;  3OYY A;  1KLU D;  1L2F A;  2L55 A;  4UAI A;  3G7L A;  4XZ3 B;  1TWC A;  4OEM B;  1AP0 A;  1V1P A;  2KEN A;  3W5O A;  2Q7D A;  1S9F A;  2W7O A;  4A3D G;  1X32 A;  3F2B A;  2K32 A;  5I5U A;  4DV1 L;  3OTO H;  1NBW A;  3S1R B;  1HNZ Q;  1WVL A;  5FLX W;  1M0W A;  4BXX G;  2VS1 A;  4IO9 A;  3VR3 A;  4QCL A;  1LAC A;  4HCS A;  1NMG A;  4K8I A;  5I60 A;  3TIG A;  2FMC A;  3PSI A;  4DV7 Q;  3PO3 H;  4UCR A;  2RF4 A;  4DR1 L;  2RDI A;  5EDW A;  5IP9 H;  5EPJ A;  1JOQ A;  1X9N A;  4O7R A;  3GTL H;  2L11 A;  4RKB A;  4M8A A;  2VL6 A;  2FFK B;  2IX0 A;  2MO1 A;  2VB2 X;  5C3E H;  3I4M G;  1J8I A;  1T94 A;  2K33 A;  3TQY A;  4O42 A;  2B63 H;  5BWX A;  5IYC G;  1GHK A;  5A2Q E;  4G7H C;  5ISR A;  5F9L A;  1XPO A;  1CSP A;  2E76 C;  2P5Z X;  1YIT A;  1TWG H;  2R6G A;  1UNS A;  2IT1 A;  4WJ3 M;  1A3G A;  3JZI A;  2BDN A;  2D0P A;  4L5Q A;  4QWB A;  5IT9 c;  1IYD A;  3T9D A;  2Z6K A;  4O82 A;  1AW7 A;  1EZ8 A;  2F0L A;  3RAX A;  3GID A;  2K1B A;  4DL6 A;  2VR1 A;  1F2M A;  5CV9 A;  3M4Q A;  3MHB A;  2ZXO A;  4LH7 A;  2VXW A;  4NXN L;  4ED8 A;  1F77 A;  4ED6 A;  2XD4 A;  1B1Z A;  3N6R A;  3TEH B;  2XCP A;  4EEY A;  2Q2U A;  4EG0 A;  1MD2 D;  4KN7 C;  3HT5 A;  2VQF L;  4KKS A;  4H0L C;  5J2T F;  3SNO A;  1A0I A;  2Q8R E;  3S1R H;  4UP8 A;  2YU9 B;  4A3C H;  1LT5 D;  1U4M A;  1SDF A;  5C44 G;  1B7Y B;  4YCW A;  4DU9 A;  3JAM E;  1EQR A;  5C4Z A;  3GTJ H;  2E2H H;  1TU2 B;  4KHP L;  1L0Y B;  1YNJ D;  1Q82 C;  1M8A A;  1VMP A;  2EIY A;  4B3M Q;  4ZHQ F;  1RD9 D;  2BQ3 A;  4DK0 A;  3F2U A;  1SNP A;  4DUZ L;  3WOE A;  2EJF C;  1MGS A;  4PZ7 A;  1F2L A;  3EFX D;  3CCL A;  2DAA A;  5EGT A;  1CQI B;  4JI5 H;  1C0A A;  2W6Z A;  4I7H A;  2HT1 A;  3F2C A;  4APV A;  1I1K A;  5EKL A;  5DLG A;  4RB0 A;  5GRO A;  3H91 A;  1SNM A;  4QGU A;  4R4O A;  1K73 C;  2CFM A;  1KQS A;  1XNQ H;  5GAG C;  5ELB A;  4DR5 H;  1NR4 A;  1V1O A;  4NB3 A;  5DNF A;  4JVZ A;  3T99 A;  1MSG A;  4R4T A;  1E4E A;  1PH2 A;  4AYB A;  5KFV A;  2NVQ B;  3NGD A;  1M4V A;  4IOA A;  2UUC L;  3K5H A;  3PW2 A;  5FNV F;  2CWA A;  4YCU A;  4DV0 H;  4X66 H;  4IZ8 A;  3T1Y H;  3I2Z A;  4KY5 A;  4PMW A;  3V05 A;  2UVW A;  3WDN A;  3PW4 A;  3ONA B;  5K36 H;  3LUL A;  1WTV A;  2F0N A;  1BDO A;  4C5B A;  5I5T A;  2BQU A;  4IN3 A;  4YIJ A;  1SLJ A;  1GM5 A;  4Z9C B;  3MWY W;  3KLS A;  4LNQ A;  4DK3 C;  5DQH A;  1Y8O B;  1Q7Y C;  5BWT A;  2JA7 A;  3EN2 A;  4F8M A;  1I1M A;  2GQR A;  1VMC A;  2Q8T A;  4O0A A;  4LF5 L;  1R9T A;  3RR5 A;  1OXV A;  3OHX C;  3CCU A;  3S1N B;  5I9O A;  3I4N G;  2YZM A;  3RZO B;  1KD1 C;  1KRS A;  1BGW A;  2W9C A;  2C2R A;  3LNN A;  5KG3 A;  3K5N A;  1VQA A;  1ONL A;  2O5I C;  3I7F A;  2WKC A;  2I8C A;  4EYI B;  1XK5 A;  1S72 A;  2B2Y A;  2H1E A;  5EZY F;  1LTI D;  3FDS A;  4OXP A;  4C2M B;  4A3F G;  1KDC A;  1CE8 A;  4RMF A;  4X65 Q;  5DG7 A;  1FD7 D;  3F1Z A;  1PH6 A;  2JA6 H;  3MJF A;  2R7F A;  2AQ2 B;  4IUU A;  3VR6 A;  1AUV A;  2QB5 A;  3KAK A;  2RGV A;  5M9O A;  1LLR D;  3VPB A;  1E24 A;  4DLK A;  4Q44 A;  5JEA J;  1YNJ C;  3ICE A;  2Z6K C;  1YZ6 A;  5BN4 A;  2JEA I;  1VQB A;  5KT4 A;  3CCE A;  4DR4 Q;  2R86 A;  2NVY B;  4QUF A;  3PW5 A;  3GTQ B;  2QEX A;  1NE3 A;  4A3B G;  1JDE A;  3UQ8 A;  4C3J B;  3E6Z X;  2XC9 A;  2ASL A;  3RUZ A;  5KT6 A;  4KY7 A;  4KY6 A;  1I6U A;  2A5H A;  3QWN A;  1H9R A;  3WO1 A;  2EYH A;  1K1Q A;  4HR7 A;  1MZB A;  1TXY A;  1HQM C;  1HR0 H;  3WOF A;  1SE8 A;  4DL4 A;  4ZYS A;  4DK1 A;  3CCR A;  1S5D D;  1JDB B;  1F9Q A;  2E2I A;  2R7Z G;  3T5K A;  5EOY A;  1Z2N X;  5J3B A;  1EYG A;  4GLW A;  4A3D B;  1G2S A;  3RBE A;  5IP7 G;  2OF1 A;  4J9P A;  2Z1C A;  4U6P A;  4RGN A;  2VQD A;  2VQE L;  4O7V A;  3NXW A;  1BXT A;  1PTO B;  1OO9 B;  2B2W A;  4PMB A;  5FOB B;  1S0N A;  3E5S A;  1EOV A;  2TSS A;  2BE5 D;  3P20 A;  2CZG A;  4O4J F;  3RZO H;  3PFF A;  2K50 A;  2LSS A;  4HSP A;  2JA8 G;  1BJT A;  4R8U A;  5KNC A;  3IG0 A;  1GXD C;  5GON F;  1LV9 A;  2RHS B;  4KI0 A;  3CXC A;  2VOB A;  2F3I A;  3G6X A;  1DXM A;  1GSH A;  2SCU B;  3OIQ A;  1PH9 A;  5J2U F;  3MFH A;  3E9I A;  4DAA A;  3HKZ A;  3SHL A;  2IWH A;  2KCM A;  1CTM A;  2NBF A;  3JRX A;  3GP7 A;  1EWC A;  5KFU A;  2ZXP A;  5BR8 L;  3I4M B;  3I70 A;  3FRP B;  2MCT A;  4X62 Q;  3S14 H;  3QOJ A;  3N42 B;  3LML A;  4B08 A;  5IE8 A;  1M6V A;  1LT4 D;  4DV6 L;  4JI8 H;  4RWS C;  1DOM A;  4PQX A;  3GTQ H;  4JV2 A;  1OWT A;  4X6A H;  5CMD A;  4B3S Q;  1GYF A;  1Q8K A;  4JV5 H;  3QFF A;  3FKI G;  1SYX B;  2EXZ A;  2C00 A;  4V0B A;  4F7X A;  1CK1 A;  1JB3 A;  2JXM B;  1BBU A;  4DV4 L;  4J8Q A;  1PA6 A;  2DY7 A;  1SYG A;  1KC8 C;  3R2T A;  4JI1 Q;  2R7L A;  4ME3 A;  2KEE A;  2AWN A;  5LHY 1;  4YR3 A;  3OUU A;  4HMJ A;  2VQE H;  1RTO A;  4ID6 A;  2EYL A;  2A6H D;  3OMG A;  2WB1 A;  4EGQ A;  2R8G A;  1I4H A;  1MI2 A;  3NWS A;  5IWA Q;  3T9A A;  5J22 A;  3GTL A;  2WAQ E;  3HOZ B;  5KT5 A;  3A5U A;  5A2Q L;  1VBH A;  2UVR A;  4DGZ A;  1CA6 A;  3V6H A;  5JUM A;  5KFK A;  2XVS A;  1Q8I A;  1IW7 D;  1PZJ D;  2ZM6 L;  1C30 A;  5FD5 A;  3M9O B;  1A15 A;  3KJO A;  1WOC A;  1CZG A;  4K14 A;  1PTO H;  1SRO A;  3Q0A A;  1QNK A;  3NE5 B;  3OTO L;  4L5T A;  2B2Y C;  4EBE A;  5DM7 3;  5KG4 A;  5C44 B;  1Q3L A;  4RAY A;  3M9M B;  3HOX B;  1ZET A;  4CBV A;  1K83 A;  5CV6 A;  3RB0 A;  4HJ9 A;  1RCV D;  1KNA A;  2X6L A;  2BE5 C;  3ULJ A;  2Z9H A;  5IYB H;  1RK5 A;  1ULZ A;  3IN5 A;  3RLO A;  1TA8 A;  3TZD A;  3TRE A;  1XWE A;  1IBL Q;  5CA1 F;  1PK8 A;  1UNN C;  3H0G G;  4O7T A;  1Y8P B;  3T9C A;  4ED0 A;  2ASB A;  2F0K A;  3D0F A;  4X3S A;  4CJ0 B;  2IL8 A;  5E1F A;  3H3V H;  4POG A;  1PX2 A;  2FLP A;  1FR3 A;  2E2D C;  3GIK A;  1SAP A;  1P8L A;  3P75 A;  1HTP A;  4A3I G;  4LFA H;  1CHQ D;  5KFP A;  1SYC A;  3GTM B;  2C2D A;  5ELC A;  3L4K A;  2UXB H;  4YWK A;  3KHL A;  3NTH A;  1LTS D;  4A3G B;  1E4G T;  5C0X J;  3UDX A;  1IKM A;  1SFO B;  1PRT D;  3KLW A;  2NUA B;  3HOZ H;  2B2W C;  4JI6 L;  5HBR B;  1QWY A;  4OIJ A;  2NZO A;  1WTH A;  1IYU A;  4AIM A;  3S1M B;  4FE2 A;  4DR1 Q;  3S16 H;  3FEW X;  2PVP A;  1ESF A;  3RZD H;  3NEL A;  4HJA A;  2Q2H A;  2QK4 A;  1Q86 C;  3RIZ A;  4O2D A;  2TMP A;  2YZL A;  4TVI A;  4NKL A;  2Z04 A;  1RKN A;  1KRT A;  4DV1 H;  2NVT H;  2IY5 B;  3I4N B;  4B9W A;  2SNS A;  4K0K L;  1XTD A;  1RYS A;  1KJ9 A;  1IW7 C;  3HOX H;  3W2D A;  4HN7 A;  2R6F A;  5DLQ E;  4DNT B;  2YTX A;  4NXM H;  5JVL A;  1ZQ7 A;  4LFC H;  1PH1 A;  1O7I A;  1XDN A;  4CDE C;  2XGT A;  3IAY A;  1V8Q A;  3LWE A;  4LUZ A;  1VCI A;  1BF4 A;  5KG2 A;  3RAQ A;  1DCZ A;  4F4W A;  4MV4 A;  4A3J H;  4A3K H;  2YL2 A;  1I94 H;  3PO3 G;  2JA5 B;  4DF7 A;  2WB1 G;  3OOC A;  1IYJ B;  2YU9 A;  4FF2 A;  4CC6 A;  2VUM H;  2JSO A;  2F3V A;  1IXR A;  1A0G A;  3BAC A;  2C5C A;  3VA5 A;  3NBZ B;  5C3E G;  4PWQ A;  3PV0 A;  4I7Z C;  5IGF A;  5KT3 A;  3BVM A;  4JI5 L;  2COG A;  1XMO H;  4V19 0;  1XYI A;  1HRJ A;  3GTM H;  1O7Z A;  5IGE A;  3HOV G;  2ES2 A;  4HIK A;  4RZR A;  4DR5 L;  3KF8 A;  3TY5 A;  2KOL A;  3A74 A;  3NTI A;  4UCT A;  3CEB A;  1UE5 A;  4BBS B;  4FS1 A;  4L5R C;  1O7L A;  5LMU Q;  4KHV A;  1NJI C;  3HZX A;  4CDD C;  1N34 Q;  4DR3 Q;  3AU7 A;  5JH7 F;  4DV0 L;  2R7Z B;  4A2A A;  1EKP A;  3T1Y L;  2VPS A;  4KHP Q;  4QIW B;  3VYR A;  2XIG A;  4E6I A;  1PRT C;  1JB7 A;  1PRT F;  1JX4 A;  1S03 G;  5EBC A;  5BYA A;  2VQF H;  5K5P A;  4MV7 A;  3RTX A;  2HQL A;  4MTE A;  3KHR A;  3CQZ A;  3T9F A;  5BWU A;  3D6C A;  2R7D A;  2VA3 A;  2JA8 B;  4CHT B;  2F0T A;  2W71 A;  4B3T H;  2V58 A;  4J6H A;  5LL6 X;  4A3C G;  5FO9 B;  2R8K A;  4B9X A;  4GC6 A;  3NQT A;  1T3N A;  3SK5 A;  4O1N A;  4JI3 H;  2J7Z A;  3BG5 A;  5IOD A;  4ECZ A;  3FDT A;  3AQQ A;  2PQA B;  3JC6 6;  4IAJ A;  1SMX A;  4ZCK A;  4TSS A;  4DV5 H;  1IBM Q;  3JAM c;  1TQO A;  4YHH H;  1Z47 A;  4XXE A;  3BS1 A;  1N36 Q;  4WOR A;  3W1B A;  4CHI A;  2L15 A;  1STY A;  3C3L A;  1VAJ A;  3F8N A;  1KAW A;  4M7E A;  5CR5 A;  1OXS C;  2V4D A;  5I5Y A;  4LF8 H;  2A68 D;  3GTG B;  4LFB Q;  2FE3 A;  2QW7 A;  2HCC A;  2F52 A;  3HB9 A;  1LTA D;  1VQN A;  3FKI B;  1IHZ A;  2CW7 A;  2OTL A;  2ATW A;  3PGZ A;  1PFM A;  2F0E A;  5J1Z A;  4WFN 3;  1II3 A;  1FJG H;  3PIO 3;  2NVX B;  2PQE A;  4IUR A;  2AU0 A;  1HFG A;  2ZXR A;  4BWG B;  5BN3 A;  5FJ8 H;  1I7L A;  3DXJ C;  1PH4 A;  1IZ6 A;  2JE6 I;  3J7A F;  4LF5 Q;  1QCB D;  1AH9 A;  3ORQ A;  3S9W A;  4C2M A;  5JPM C;  4BBS H;  1N32 Q;  3BAB A;  3VPC A;  1UUP A;  1HR0 L;  4QB4 A;  1KDB A;  2B2T A;  4NZO A;  3K0X A;  4BBR H;  3BDO A;  1PH7 A;  1VQD A;  2FPI B;  1STB A;  1HZ9 A;  1PLF A;  1D2B A;  1XMQ L;  4OO1 H;  2IHE A;  5GAH C;  1WD1 A;  4FFR A;  2PNH A;  1S40 A;  4K6D A;  2NVY A;  2QKI C;  2OLS A;  5G3L D;  2G5D A;  5KFX A;  1F9P A;  5CR3 A;  1Z6H A;  2L9H A;  5K36 G;  1PHJ A;  3EJI A;  2XWJ B;  2W6O A;  1LUZ A;  1D5Z C;  1HR0 W;  3N6X A;  2Z4I A;  1G51 A;  3O13 A;  1GSO A;  1E1O A;  2VB3 X;  2W9A A;  4LWC A;  3M4Y A;  3KF6 B;  1PVO A;  2YS7 A;  4GLV B;  1UE6 A;  4RHS A;  3WWV A;  4NMZ A;  5CBA E;  3VA7 A;  3V6J A;  4KJN A;  2UXC H;  2J6S A;  5I9P A;  2AUJ D;  1Q1B A;  2K4K A;  5TSS A;  4YAJ B;  4KD4 A;  1QOH A;  2E8G A;  4A4I A;  5L37 A;  2PCF B;  2E5L Q;  2V5A A;  5LYJ F;  3H0G B;  4DFA A;  1TWH B;  2IP4 A;  2BQR A;  3GTG H;  4HNV A;  1GUO A;  4JBJ A;  5T1G A;  1B44 D;  4KN4 C;  4ED3 A;  4JI8 L;  2JA6 G;  3R93 A;  1KTK A;  2FK2 A;  1DIK A;  3RLF A;  3NBY B;  1CI3 M;  4FNF A;  1JQY D;  2A68 C;  1JR0 D;  3GTO B;  3JRW A;  4HAE A;  1X3P A;  4JV5 L;  1PMR A;  1M1K C;  4O7L A;  4BA1 I;  1DV2 A;  4UPA A;  1RJT A;  4IPG A;  3U50 C;  5DQG A;  5CAE B;  3VOT A;  2FMM