1A0IA

Atp-dependent dna ligase from bacteriophage t7 complex with atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
348
structure length
332
Chain Sequence
VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDGVRGNICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFHRKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLLMQEHVKNMLPLLQEYFPEIEWQAAESYEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRGKKSGWWKMKPENEADGIIQGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFDACTINPYDGWACQISYMEETPDGSLRHPSFVMFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an ATP-dependent DNA ligase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 89
structure length 332
sequence length 348
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF17879 DNA_ligase_C DNA ligase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a0iA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1a0iA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1a0iA01
2ES2A 1EIFA 3RLNA 2Q2UA 3EIVA 5IP9H 1IL2A 3A74A 5D1OB 1RIPA 1V9PA 1LUZA 4LF6L 3LGJA 1WCMG 3CMEA 1NMGA 5IY0A 3F2BA 3I4MG 1CKOA 4JI5L 2NVYH 4APVA 1NJIC 5FJ8G 1QZGA 3PN1A 3NBYB 3D0FA 1PH9A 4DV7L 5C4JH 2E5LL 2IX1A 1E7ZA 4OWXB 4WJ4A 1UWVA 3CW2C 1OXSC 2ZJRA 1QUQA 1VQ9A 2DGYA 4YCWA 1IBLQ 1Z47A 4AIMA 2R6GA 2BH2A 5IYCH 5JJLA 1NBWA 2K5VA 4J15A 4DKAC 1FVIA 3PUWA 3JAMc 2Z0SA 3VDYA 4IJLA 4UCRA 3D31A 2IT1A 2XTIA 2ZTDA 3NBZB 4UCTA 4QGUA 5GQOA 1HNXQ 2MFIA 2JA6G 3S1MH 4OXPA 3EBEA 3UE1A 4UP7A 2UU9Q 1NTGA 1VQLA 4JI6L 2RHSB 2Z6KA 1FJGQ 4OONA 4UCSA 4IOCA 3FKIG 1OXUA 3ERSX 5ELNA 4AQYL 2YYZA 4LF4Q 2E8GA 4JI0Q 4IPCA 3CQZH 5IYDG 4L5SA 4IFDI 5DISC 3PO2H 3STBD 1N33L 4LF5Q 4UP9A 1JJGA 2HVSA 2JEAI 2ZM6L 3GB8B 4B3SL 2OQKA 2VNUD 5FLMG 3CCRA 4PZ7A 4BY1G 1K0RA 2Q2HA 1N32Q 4X65L 4NXNQ 3F1ZA 3PCOB 3GO5A 3KYHC 5IP9G 1VQIA 1SLJA 2A8VA 2KHIA 4JYAL 1WOCA 2I5HA 4X62L 5GAGC 1K83H 2JQOA 2E2JH 2UUCQ 2AMCB 2KENA 3BZCA 4JCVE 1L0WA 4A93H 2UUAQ 1B8AA 1Q81C 1X54A 4GNXB 2Z6KC 4X64L 1G51A 1HH2P 3SGIA 5C0XJ 2UXCQ 2VS1A 1VQ4A 2DUDA 4DUZQ 4KI0A 1TWAH 1E24A 5FLXc 4HIMA 1Y14B 1OXTA 1YZ6A 2N8NA 1PH4A 4EQ5A 2MNAA 3G6EA 2HIXA 2ZTCA 3CCUA 3S2HH 1H95A 2K75A 1TAEA 3UDGA 1L1OC 4A4IA 3TY5A 1HR0W 3DM3A 4EEQA 4LFAQ 4WJ3M 1CUKA 1XMOQ 2VUGA 1SROA 4GNXC 3CCEA 5M5XH 1XMQQ 1M1KC 4DR2Q 2OWOA 3S1QH 4O0AA 2RHQB 2R93G 4P73A 1PYSB 2ASBA 1Q7YC 1VQBA 2N49A 4RG1A 1KQSA 1YNXA 3PUVA 1N9WA 5IYBH 2IHEA 4PG3A 3CD6A 1LYLA 3ULPA 4GLVB 2WB1G 5D1PA 1XTDA 5JEAJ 3ULLA 1Z9FA 4GN5A 1KC8C 1VQJA 1Y1WH 4GKJL 3CCVA 5LMUQ 4DV7Q 2K5HA 1K73C 1QUQB 2KBNA 4PZ6A 4JI7Q 4JI8Q 3S15H 4QL5A 4IJHA 2LXKA 4IPHA 4YWMA 3S24A 4B3ML 1U5KA 4P75A 4R4OA 2VW9A 3T1YQ 1HR0L 3G71A 2PNHA 4R4TA 5IP7H 4BA1I 5GADC 3TS2A 3PUXA 1N34Q 3S2DH 2JA5H 5LMNL 1WI5A 3DLLA 5C0XG 2JJQA 4GLXA 4GOPB 4JV5L 2LSSA 3PF5A 4A3LG 4A3IG 1QZHA 2A19A 2R7DA 2EQSA 3K7AH 4A3FG 1VQ8A 4JI4L 3I56A 4NXMQ 2JA7G 4BBSH 4A3CG 3JC66 2CCZA 3GTKH 3HOVG 4LF9L 4LFCL 5M5YH 4DR5Q 2JA9A 1VQCA 5GAHC 4DV1Q 1VQ6A 2K14A 3M7NA 4A3BH 3OTOQ 4DK3C 4LF4L 3E0EA 2WFWA 1VQHA 4IO9A 4DV5Q 5C44H 3U50C 1N33Q 1K8AC 1K8GA 1I6HH 1TA8A 1X56A 1YEZA 4B3SQ 1MJCA 4LWCA 3PIPA 1PH1A 4PZ8A 3T1HQ 4C3IH 1XNQL 1X3GA 1JJ2A 3Q8DA 3HKZE 2VUMH 4UFZA 4XIGS 3B6YA 2I0QA 2KHJA 5IYCG 4BBRH 4A3DH 3FP9A 3H0GG 3NBHB 4QIWE 3CC4A 1Y1VG 1Q8KA 3UE0A 1XPOA 5IE8A 2R7ZH 3TEHB 1RL2A 3HOYH 4LF7L 1J5EL 2VL6A 2JA6H 1C0AA 4JI1Q 3AQQA 3U4VA 2XGTA 4TQUS 1N36L 5M5WH 2UXBL 5GAEC 2E2HH 2QGQA 3KDFA 3GTJH 1XDNA 2V1CC 4DUYQ 2RCNA 1O7IA 3BABA 5AJ3L 1D8LA 1VQFA 4X66Q 2A1AA 3ULJA 4LFBL 2R92G 3JSNA 2OTLA 4DV0Q 4OX9L 4JI2L 4ALPA 4DR2L 2AWOA 3A5ZB 5JEAG 3G4SA 4DR7L 2B63H 2BA0A 1P8LA 2K50A 4R4IA 3H3VI 1EQRA 1GD7A 2UUBQ 3KJPA 3GTMH 1SN8A 1XPUA 3NC0B 4CC5A 4X6AH 4GKKQ 1C9OA 1YJ9A 1KHIA 4DV4L 4B3TL 3PF4A 1PH5A 2R7FA 4A3DG 3I55A 4AH6A 5C3EG 1XPRA 3S14H 4DR6Q 3GD7A 4OWTB 1Y1VH 3F2CA 1V43A 5IWAQ 4GKJQ 2CWAA 4A3MH 1VQEA 2JA8G 4HJ9A 4LF6Q 3S1RH 3HOUG 3F8TA 2F4VL 4AYBG 3PSIA 3J80i 4B3RL 1HR0Q 1MIUA 5K36G 2FXQA 3CCSA 3PIOA 4GOPA 1EFWA 4BY1H 3UQ8A 4A3CH 4DV3L 3W1GA 5LMNQ 1YJNA 3PO3G 2CKZB 1EUJA 1PVOA 1YHAA 2OCEA 1S3OA 4LH7A 3CP0A 1AH9A 1GO3E 5BR8Q 1X3EA 3H0GH 1PA6A 1KIXA 3STBC 1YVCA 4JI4Q 4NXML 1UE1A 5ELOA 5IP7G 1VQNA 5IYDH 1SRUA 3RR5A 3PO2G 1FGUA 4LUVA 4JI3L 2WAQG 2NZOA 2NVQH 3S16H 2HHHL 4A3IH 1HZ9A 1Q12A 2B29A 2D0PA 3UDFA 1ASZA 4A3FH 3RLOA 3WWVA 3AEVA 2JA7H 4HJ7A 1VQDA 3HOXG 1JE5A 4HJ8A 1K3RA 2E2IH 1Y1WG 2Q2TA 4DV2Q 3E9HA 5M3MG 1U0LA 1MKHA 2GN5A 5E7NA 3L2PA 4A3BG 2K4KA 2YTYA 3NENA 5FPOA 2NVXH 3T1HL 3HOUH 4FDBA 4O2DA 5C4XG 1GVPA 4LNQA 1Q1EA 1YIJA 2R93H 2JA5G 1CSPA 4MNOA 3UDIA 4A3EG 3UDXA 1IBKL 4LF5L 3BJUA 3CCLA 1CKNA 5C0XI 1BVSA 1A8VA 3KDFB 3PUYA 3KF8B 3KLWA 2ZM6Q 1HNZL 3W5OA 2HT1A 4UCOA 3KF6A 3CCMA 3J81j 1IYJB 1VQKA 1V1QA 3J80c 1S40A 2ZJQA 5C3EH 1LM0A 1Q1BA 1PH6A 3K0XA 4LF7Q 2NVTH 4X65Q 4JBMA 4RMFA 1N36Q 1IZ6A 5J3BA 4A3MG 4JYAQ 4DAYB 1DGSA 4H02A 1BBWA 1JJCB 2I5LX 4X62Q 2KCTA 3CCQA 5AJ3Q 1XNRQ 1VQMA 3GTGH 3K7UC 4X66L 2B63G 3GTLH 2IY5B 3BA9A 2NN6G 3W1BA 3CPFA 3PGZA 3ZJYC 1B7YB 2YU9H 2VY3A 4L5RC 4DR4Q 4Y7NH 4IOAA 2UXCL 4LH6A 3VNNA 3OYYA 1UE5A 1AE3A 3HKZG 1A0IA 1GM5A 2I5MX 4DR7Q 5EAYA 5M3FG 1HNWQ 1EIYB 2IX0A 2HVRA 1PV4A 3M9BA 2R92H 1OXVA 1PH7A 2E5LQ 3H15A 4BBRG 1X55A 2N3SA 1EQQA 4B3TQ 1PH8A 1UEBA 2VQEQ 1FL0A 1NMFA 2ZJPA 1HZAA 3MXNB 3J81i 4A3JH 4DR6L 4DAMA 4KHPQ 3HFZB 1AE2A 2F3IA 2MQHA 4EX5A 4DR1Q 5D1OA 2HIVA 3U58A 1C7YA 3AFPA 4DR4L 3ER0A 1EOVA 3BU2A 1L1OB 2IHFA 1EYGA 4DV6Q 2ATWA 1HZCA 2LXJA 3TY9A 1TXYA 3OW2A 1G291 3I2ZA 2VUMG 1OXXK 4A3GH 1G6PA 3RN5A 3BAAA 4HJAA 1TWGH 3TQYA 4DPGA 2RF4A 2UU9L 4LFBQ 1S72A 2JE6I 5BR8L 4B3MQ 1FJGL 1Q86C 3RZDH 1W2BA 3I4NG 2ID0A 4YY3L 5C44G 3FHWA 4JI0L 4JI3Q 4A3KG 1A62A 4A3LH 3RTXA 1JMCA 2Y0SG 1SMXA 4OO1I 5FPRA 3M4QA 4BBSG 4L5QA 2C35B 4NPSA 1YHBA 4IFDG 3I4MH 2HQLA 4NB3A 3L0OA 2WB1E 1VS0A 1X9NA 1X65A 1SR3A 1I3QH 4JOIA 4DR5L 2MO1A 2YV5A 4GNXA 4UP8A 1PHJA 1IBMQ 2PQAA 3KOJA 5HY6A 4K0KQ 1VQ5A 1X6OA 3OTOL 4EFEA 1KRTA 4YWLA 1ASYA 3GTPH 2EIFA 4C3JH 3TRZA 4JOIC 1VCIA 1QVFA 3CXCA 3A0JA 5M3FH 1MJEA 1PYBA 1OTCA 2EXDA 2H5XA 1K9MC 2Y0SE 4DUZL 2PI2E 2VQFQ 3S1NH 1TWCH 2K5NA 1HNZQ 4A3GG 1A63A 1KXLA 2ZTEA 4UPAA 3I7FA 4LW1A 1IXRA 4HIKA 1I94L 2UXDL 2GVBA 1VQAA 5FJ8H 1XNQQ 4BY7G 3TY8A 4YHHQ 1VQPA 4JC0A 2K52A 3I4NH 3L7ZC 2JA8H 2PI2A 3J7ZC 4LFAL 3NELA 4OO1G 3CCJA 4GLAC 4UCUA 1L2FA 4EFBA 2PMZE 2YTXA 2OTJA 1XNRL 2Q2IA 3H3VH 3HOWH 4DR3L 3BZKA 1NY4A 2L15A 4TVAB 1VQ7A 2MO0A 3PO3H 1J5EQ 1E22A 4P71A 1M90C 4QY7A 3MEFA 2UXBQ 4YCUA 2CFMA 1KRSA 3RNUA 1Q82C 3KF6B 4LF8L 4DV0L 3GDEA 1N8RC 4GOPC 1HNWL 1B70B 3NEMA 5LMUL 4HIDA 3CPWA 4ME3A 4JI7L 1P16A 4JI8L 3HOZG 4IPDA 2ALYB 5IT9c 1YBYA 3CC7A 1XK5A 4HIOA 1L1OA 4JG2A 4JI2Q 2VQEL 3T1YL 3TS0A 1TWHH 2YTVA 2AKWB 4JI5Q 1SE8A 4KHPL 1N34L 4MZ9A 4IPGA 4DR1L 3ICEA 4POGA 1YI2A 4GS3A 3A5UA 2UUBL 3RZOH 4BY7H 3E9IA 5LMNW 1KL9A 2AHOB 4GKKL 4JV5Q 4BXXG 1J6QA 1PH3A 3G48A 3TREA 4DNIA 4DV6L 1R9TH 1E3PA 3RN2A 3F2DA 1UE7A 5GROA 3IRBA 4C3HH 3M85A 1JB7A 1IBLL 3S17H 1VQOA 3GTQH 5IWAL 1S68A 4R4QA 4KHZA 4LF9Q 4LFCQ 3HKSA 3HOWG 2HVQA 3GJXB 3K81C 4QQBX 2B3GA 1WFQA 3AFQA 4DV1L 4P74A 2JK8A 3JAMi 1SFOH 2F4VQ 3HOVH 4MTNA 4BA2I 3JSLA 4B3RQ 3K8AA 4A93G 3EN2A 5H1SE 3KJOA 4YCVA 4YY3Q 2D0OA 4DV3Q 1YITA 1W3SA 1HNXL 4A76A 4DV5L 2WP8J 4OWWB 2CWPA 4Y52H 4JI6Q 1D7QA 4LUOA 1NE3A 1WYDA 2F52A 1HZBA 1UE6A 4L5TA 4XTCS 4PMWA 3U4ZA 2NZHA 4JBWA 5C4XH 5FLMH 1CKNB 2QA4A 1HJPA 1PFSA 4AQYQ 4A3JG 3M4PA 3M3YH 4A3KH 1Q46A 2AWNA 2BA1A 1QVCA 3I4OA 4R4CA 4DRFA 1EWIA 2OQ0A 2JEBI 3CF5A 1IBML 4UY8C 1YHQA 2HHHQ 3J81c 2PQAB 4K0KL 1E1OA 3HOXH 1QVGA 3FKIH 4BXXH 1BKBA 4HJ5A 4R1JA 5M3MH 1I5FA 4IFDJ 1T9HA 2N78A 1N32L 1WCMH 4JI1L 4NXNL 5JJKA 4DV2L 2CQOA 3GTOH 5IYBG 3CMAA 2VQFL 1B04A 1LTLA 3KFUA 1CKMA 1E1TA 2WAQE 4C2MH 1WJJA 2QEXA 4DUYL 1KAWA 2UUCL 1I94Q 2UXDQ 3J7A5 1YJWA 4JBJA 5HGQA 4A3EH 2UUAL 5DLQE 4YHHL 1X3FA 2VZAA 4X64Q 3K80C 4UCVA 1XJVA 1IBKQ 4LUZA 3CAMA 4DK6C 4YWKA 4CC6A 4OX9Q 2GVAA 2NN6I 1PH2A 1TWFH 4GN4B 3CC2A 4QJFA 4DR3Q 5JJIA 4P72A 1CSQA 1VQGA 3RLFA 1I50H 3PUZA 4A75A 4AYBE 2R7ZG 3HOYG 2KCMA 3AYHB 4GN3B 3M4OH 2D62A 1BBUA 3PV0A 4JBKA 3HOZH 4DV4Q 1JT8A 1XMOL 3BA8A 4E6NA 4POFA 1XMQL 1GKHA 1KD1C 4LF8Q 2BH8A 4KLKA 3QWUA
chains in the Genus database with same CATH superfamily
5D1OB 1Y1WA 2PN1A 2JN4A 1RIPA 2NVTB 3LGJA 1S10A 1CQFA 4U673 4FFPA 5BWWA 4ZLTF 1IBMH 2HDKA 3PN1A 2V9WA 3U9TA 5KG6A 3NBYB 4APMA 3CVZA 1PH9A 1Z2NX 1XNQH 4CDEC 4BY7B 2IX1A 4JI1H 1I1MA 1DM0B 1CTMA 2C00A 2COGA 1UWVA 3CW2C 4QF4A 3RB4A 1XYIA 4X3SA 1VQ9A 3TP8A 3JZFA 4RB0A 2D9UA 4AIMA 1KLUD 2W7PA 1STNA 5IYCH 4ECWA 5JJLA 4J15A 3KBXA 2Z0SA 4I55F 4UCRA 1XNRH 5KYIA 2EJGC 3U9SA 3PW5A 2F0MA 4WBNF 1KC7A 4QWEA 3NBZB 4H44C 5EPJA 2MFIA 4DN4M 1E4GT 2LS01 4R8NA 3T54A 4MA5A 1B3AA 3IFDA 4X65H 4O82A 1CA6A 1VQLA 2RDIA 4OELB 1I7NA 3J7AV 1GSOA 4OX9H 3ERSX 2YYZA 4RA8A 4G7HC 3CQZH 5IYDG 4L5SA 2HVSA 4OGQC 2ZM6L 3GB8B 1JE4A 3KAJA 2OQKA 3FMCA 4B3TH 5M5WB 3CCRA 1I1KA 5KFRA 4BY1G 1NUCA 1SMYC 2Z4IA 1K0RA 1N32Q 4NXNQ 3F1ZA 3PCOB 1JR0D 3KYHC 2ICIA 2WKCA 1SLJA 2A8VA 2YU9B 3MWEA 2UUCQ 1V8QA 1EY7A 2A6HC 3CRLC 1KDCA 4FE2A 1X54A 4LF6H 4GNXB 3A55A 5A2QW 2Z6KC 4X64L 1G51A 3SGIA 3VYRA 1Y8NB 2VS1A 2DUDA 4DUZQ 3J7AK 2COIA 4KI0A 1EY5A 5FLXc 2EJFC 3J81E 1Y14B 2H1EA 1JQYD 3MFGA 3JAML 2W8KA 3CCUA 2ZTCA 2KHSA 4U68A 3S2HH 2K75A 4I7HA 1LT4D 2YS6A 2PZUA 4UAIA 5KFUA 2WTFA 2HGSA 3DM3A 1EQVA 1ICWA 1NNXA 1XMOQ 1SROA 2HHHH 1M1KC 2XD4A 2RVLA 1J9OA 3U55A 5CR3A 2QEJC 2E2DC 1EOTA 1FNUA 1PYSB 1XTCD 4FP5D 1VQBA 1KQSA 4RG1A 4X3UA 4RUCA 1DIKA 1GOZA 1XTDA 4B3SH 4DV2H 5L9XA 4IUTA 3HZXA 5LMUQ 2K5HA 1B2TA 1QUQB 1SYBA 4YR0A 4JI8Q 3RAXA 4QL5A 1YNND 3QJYA 2IY5B 2LXKA 1IBKH 4YWMA 3S24A 2UUAH 3HOZB 1X32A 4I7ZC 2PNHA 5EQ0A 4R4TA 1WD0A 4Q5VA 4LFBH 1N33H 4DR2H 3V6KA 2UXBH 5LMNL 2R8GA 5C0XG 2JJQA 1B4OA 2F0UA 4JV5L 4ZHQF 5KFZA 2AQ4A 2A19A 2M9VA 4RB1A 4HN2A 4A3BB 3K7AH 4NXMQ 5EOYA 2JA7G 3MR2A 3FEWX 2HJWA 3JC66 4RZRA 2CCZA 4KJOA 5C4XB 5DLGA 2Z1CA 5M5YH 1VQCA 4RCOA 2QILA 4A3IB 1VQ6A 3GIKA 1M7JA 3LWUA 2XSCA 3S2HB 1S0OA 2F0JA 3E0EA 3K5NA 4HAEA 1M0TA 1GUSA 3HEJA 4DFAA 5KEEA 3OSPA 2AQ2B 2BE5D 3K3PA 3PO2B 1N33Q 1KTKA 3CQZB 1IW7C 1YEZA 1MJCA 4NZNA 2OEOA 3ERQA 2B63B 1XNQL 4DV7H 2ASDA 2VUMH 2UVRA 3B6YA 2KHJA 5IYCG 2NBFA 4BBRH 4A3DH 4NP5A 3RJ0A 5DQIA 2KCNA 4U7CA 1RL2A 3CRKC 4IALA 1J5EL 2JA6H 2ENBA 4JI1Q 3SHLA 3U4VA 1N36L 1XWEA 3SK5A 2QGQA 5KFHA 4ECRA 2V1CC 1OBGA 1SNMA 1D8LA 5FKAC 4HNTA 1VQFA 2AUKA 5I5WA 3T1HH 2D2CC 3ULJA 5JH7F 2L11A 1I7LA 3JSNA 1W96A 4JI2L 1JB3A 3WO1A 2B39A 2K5WA 2AWOA 5JEAG 3G4SA 4DR7L 2DWCA 1UUPA 1S0MA 2K50A 1VF7A 4R4IA 4RHSA 3DTGA 3I91A 1ZHSA 1EQRA 4Q4CA 1CZWA 3GTMH 2TMPA 1I6UA 1YJ9A 1KHIA 2X0SA 2JA5A 4A93B 2Y0SA 5DMXA 1PH5A 1SBBB 5F9LA 5C3EG 2X5RA 1CM9A 4DR6Q 1Y1VH 4R8IA 5IWAQ 2CWAA 4JYAH 4FF4A 4HNUA 3M9MB 5M3FB 3F8TA 2ZXRA 4DGZA 2Q7DA 5DQHA 1ZAUA 2R8JA 2DAAA 3PIOA 2AQ1B 4BY1H 2NVYB 1I4GA 1V1PB 5HURA 4PQXA 1YJNA 4PMBA 2NU8B 3DF7A 4HYKA 4FF1A 1X3EA 3H0GH 3QOJA 4ME5A 3STBC 1PA6A 1T5EA 3OMCA 4QW9A 3QOLA 5C44B 1TIID 1E2VA 4GZYC 1SRUA 1BQQT 3RR5A 1RTOA 2R61A 4FXGC 1E2WA 5C3EB 2NZOA 1SNQA 3E5NA 5KG0A 1Q12A 3FVQA 1FD7D 1BBXC 1HUNA 3NBIA 5JVH3 4A3FH 2EE1A 3WWVA 1S5FD 1VQDA 2PCFB 2W9AA 1JE5A 1K3RA 1W6KA 3UZOA 2Q2TA 4DA2A 1PRTB 1HUMA 4N9TA 4A3KB 3MFIA 5IT9L 2AGQA 1SAPA 2K4KA 4O7ZA 3EQLC 2FK1A 4O2DA 4PWQA 5JEAH 2EY6A 4LNQA 4TV9F 3Q8QB 1YIJA 3KHLA 4QUFA 2XIGA 4MNOA 4A3EG 5KG2A 1B6RA 1IBKL 4PMCA 1JKJB 4L6TB 5C0XI 3S1MB 3T5LA 4L1KA 2ZM6Q 2BQUA 1AP0A 2K01A 3CCMA 3J81j 1S40A 3T5KA 5IT9W 1LM0A 1I6HB 4MIUA 2R92B 4RMFA 1ILPA 4JV5H 5JQWA 4EYHB 1BBWA 3OIQA 1EIGA 2BOSA 3MVVA 5AJ3Q 5FOBB 4CHIA 4X66L 2B63G 3GTLH 3NUAA 2NN6G 5I9OA 2R93B 3PGZA 2I8CA 3ZJYC 5DM63 4ZCKA 2VY3A 3QB3A 1AE3A 3HKZG 4QWDA 1A0IA 1L0XB 2G9HD 2W9CA 2EY5A 2DY8A 4RGOS 5A35A 1CK1A 2EYHA 3M9BA 2W6QA 4BBRG 4F88A 3NXWA 2UU9H 3M7GA 1GLVA 1UEBA 2YYAA 4C5CA 2VQEQ 2ZJPA 4JXUA 4O7YA 1GUWA 4JI3H 4A3JH 5D1OA 3DTFA 3HP3A 4DK0A 3MR5A 3KHHA 2B8FA 4OO1H 3OHXC 1HFNA 1H9JA 2NU7B 3NHHA 4DR4L 3JZIA 3ER0A 3SE7A 1F2MA 1EOVA 5BWUA 1EYGA 3CEBA 3I8ZA 2LXJA 2O4XA 3I2ZA 1G6PA 4GC7A 4RNMA 4WRDA 4JV2A 1S72A 2RDFA 5BR8L 2ZDGA 2CW8A 5KFCA 3V6HA 2GLTA 3R2TA 3I4NG 4YAJB 1IW7D 1XX8A 4JI3Q 1KNAA 5I2YA 4A3LH 4TRDA 3TP7A 1JMCA 4MV9A 1K28A 4OO1I 1JOQA 4YAKB 3M4QA 3S16B 5FD5A 4ECUA 4LF8H 4K5WA 1VS0A 2W70A 3GIDA 1I3QH 1IBMQ 4G57A 1B53A 4CE5A 2MHVA 1X6OA 3ND9A 1VQ5A 2MUYA 1BCPC 4YWLA 3R8BA 4C3JH 5A2QE 3CXCA 3A0JA 1MJEA 1QE6A 2AU0A 1K9MC 5EBCA 2PI2E 4A3GG 2K5NA 4UPAA 4M9UA 1GUTA 4ZQIA 1O78A 1VQAA 2GVBA 2F4IA 2Z8LA 5NUCA 1XNQQ 5I5YA 5C8YF 2UVWA 4FF2A 1GUOA 2TSSA 4MTEA 2K52A 4FF3A 3L7ZC 4O7NA 2PI2A 1NR2A 3H0GA 1N48A 4DF7A 4OO1G 3CCJA 3OTOH 4UCUA 2O5JC 2PMZE 5KS8A 4RGTA 1VAJA 2Q2IA 4DR3L 1TQOA 2JA5B 5KG4A 4TVAB 1VQ7A 2MO0A 1J5EQ 3PIP3 4P71A 1B6SA 2F3WA 1EWCA 1FNVA 3I72A 2CFMA 4FFRA 1RJRA 1CI3M 2Z6BA 4KY5A 1F9SA 4LF8L 5DGAA 3GDEA 4RCNA 1I50B 1DXMA 1K1QA 5CYUA 5EKKA 5JOBA 4IR1A 2R92A 1IYUA 1QOHA 1AN7A 3IKJA 3CC7A 4HIOA 4JG2A 4JI2Q 2DJFC 2YTVA 1X3PA 4DIMA 1M6VA 1KUTA 2EJ0A 2BQRA 5FO7B 4Q45A 5CM0A 4DUYH 1SMYD 2O2LD 2B2YA 3U9OA 2AHOB 4F4YA 1J6QA 5EKIA 2R84A 5C4HA 4RB3C 1R9TH 1JOKA 5GROA 3IRBA 2FFKB 3M85A 3MEHA 1SE4A 1VQOA 3GTQH 1DCZA 5IWAL 4LF9Q 4LFCQ 3HOWG 4C5BA 4HTHA 3AFQA 4DV1L 3L9AX 4P74A 4M0JA 4MTNA 4A93G 4KN4C 1HHVA 2K5DA 5H1SE 3KJOA 2SEBD 2JEGA 4DV5L 4A3MB 2UXCH 3T99A 2LFNA 3L4JA 2RKSA 5G3LD 2HUGA 5JVLA 1PFBA 3BQ0A 2QB5A 4MV4A 3U4ZA 3OHBA 1SYFA 1ZETA 2JEIA 4LAAA 1PFSA 5I6YA 2F0EA 2VUMB 2MGSA 4FBTA 4MV1A 4DRFA 2OQ0A 4G7OC 4IFDH 2PQAB 2JA7B 1R4QB 1QVGA 1JORA 4R1JA 4TV8F 3I4MB 5CR5A 1I5FA 4IFDJ 1T9HA 1N32L 1SFOA 4NXNL 5K2MA 2W7OA 5C3WA 3M4IA 2VQFL 4G3IA 4J9LA 5FNVF 1CKMA 4C2MH 2UUCL 4DUYL 1CZGA 3DAAA 1I94Q 1EY6A 3ORQA 5CV5A 3R9RA 3J7AF 5DLQE 1X3FA 4X64Q 1G2SA 1I2KA 1IBKQ 4DK6C 1ZYRD 4MAMA 4Q44A 5CAEB 1G8ZD 1TWFH 1HTLD 1STBA 2ZT9C 4QJFA 1JDBB 4P72A 3NWTA 1VQGA 2MP1A 3JZ6A 4ECQA 5JUMA 2C2EA 3PV0A 4DL2A 4NLGA 4NMZA 1TR5A 1BCPF 4DNRB 1XMOL 1JT8A 3BA8A 1Y1VA 4POFA 2PPBC 1KD1C 3Q22A 4DV0Q 2E2HA 4YHHH 1T5XD 3HRZC 1I4HA 3EIVA 5IP9H 3A74A 3J80L 2LMCB 3P20A 1PTOD 1LUZA 4LF6L 3RGXA 4ECXA 1EEFD 5IY0A 3F2BA 5CB4F 3CKIB 2ZXOA 4RU9A 2MCTA 4JI5L 2NVYH 4LMQD 2Q8RE 5C4JH 4WJ4A 2I46A 4IURA 1XMQH 2NVXB 4O3RA 1PXUA 1IBLQ 2FKLA 4O1NA 2WAQA 2CNUA 1NBWA 4DR4Q 3Q0AA 5KFQA 3VDYA 3D31A 3V2TA 4X3KA 2ZTDA 4CDCC 4FXDA 2V59A 4QGUA 1V1PA 4FFMA 3EBEA 3UE1A 3DMUA 4UP7A 1J8IA 1S03G 4DL6A 2RHSB 1TKWB 4DK1A 2N88A 1BXRA 2Z6KA 5KFKA 2A68D 1OXUA 2X6GA 1RYSA 3DWPA 4WFN3 3A8JE 2JYOA 2ZDQA 3OWEB 5DISC 2KVMA 4IUUA 1SYCA 4NDXA 4LF5Q 1N33L 3I4NB 2G9DA 3IFTA 2E2IB 3BVMA 4F7XA 5CV9A 3OSNA 4DR1H 3KHRA 2VXWA 5CA1F 1SYGA 2Q2HA 4X65L 4Q8FA 1BF4A 4B3MH 2ZXPA 4RKLA 3GIJA 1VQIA 4M1UB 2I5HA 4RKBA 5GAGC 1K83H 1SEBD 1VMCA 2JQOA 2AMCB 2KENA 3BZCA 4XXEA 1BXTA 4AQYH 4HCEA 3U54A 3GTLB 4N8X1 4EGVA 2UUAQ 1B8AA 3TZDA 3T56B 3PW4A 4NKLA 2F0QA 3IAYA 3TW7A 1BUVT 2C28A 2K03A 4DV1H 2B2UC 3GTLA 5EPKA 4R8UA 1E24A 1I4XA 3GIMA 1Q3LA 2MNAA 1VMPA 4NXMH 3TW6A 1GUNA 3G6EA 2HIXA 2ZGIA 1TAEA 3HG9A 1UC8A 4A4IA 3TY5A 4IWXA 1Y1WB 4E6IA 4EEQA 1CUKA 4J0MA 2J7ZA 5GONF 3CCEA 1XMQQ 1RJQA 3I73A 4ED6A 1D5XC 5KFYA 2R93G 1EU3A 2NN6H 1Z7TA 3R2IA 5E25A 1YNXA 3PUVA 3AU7A 4PG3A 2W8LA 3E5SA 1LYLA 1C48A 1EEID 4FS1A 2C5CA 4ME6A 5JEAJ 2WDTA 2F0VA 1UC9A 3BG3A 1Z9FA 1Y1WH 2V4RA 4DV7Q 1PTOF 3S15H 2KBNA 2J6UA 4YR2A 4P75A 4KKSA 1DONA 3TS2A 2VOBA 2X6LA 3PVXA 3SK6A 4HNVA 1GGOA 2XGPA 3DLLA 1EWHA 3VR5A 5L1KA 1O7ZA 2RDGA 2A73B 4A3LG 1EZ8A 3GTMA 1QZHA 2EQSA 1VQ8A 5C3XA 3KUPA 4DAVA 1DAAA 2CH4A 4LF9L 2F0OA 2CZGA 4LFCL 2YZGA 4X62H 4DR5Q 3HS0C 5LYJF 2JA9A 5GAHC 4DV1Q 1TWCB 4A3BH 2SNSA 3OTOQ 1MGSA 4X64H 3DUZA 2FMCA 2NWGA 5DQGA 5LMNH 4IO9A 3OIPA 2JP1A 4DV5Q 1QJOA 1J5EH 1AUVA 4B3SQ 3PIPA 3JAME 1PH1A 4UHVA 2F0DA 4C3IH 1X3GA 3H09A 1JJ2A 2QK4A 1WTVA 2W57A 5IGFA 2I0QA 3EYYA 1GXDC 2F0GA 5BMVF 3NBHB 3KF8A 4O7TA 1NSNS 4O86A 1EUCB 2DABA 3EVQA 1A0GA 1X3QA 3BDLA 4DR7H 3HOYH 1IL8A 2MJ8A 3AMUA 4BWGB 1M8AA 3T9FA 2XGTA 1L0YB 5M5WH 5GAEC 2E2HH 1K8OA 3KDFA 1XDNA 4DUYQ 4TUYF 1PTOC 2RCNA 2NU6B 3TQ1A 4N9PA 5AJ3L 1ML0D 5JPMC 4X66Q 3RAQA 3NSWA 2YRXA 3GP7A 2PNRC 1AUXA 2DIKA 2OTLA 5F2DA 4DR2L 5DAAA 5I5VA 2O5IC 1P8LA 2HG8A 1QG7A 2R7NA 4ZUIA 5DGHA 5E3FA 4CKBA 3V96A 1EFID 1SNDA 5LL6b 2XN9C 1C9OA 4RGMA 1PX2A 3HB9A 3LWEA 3PF4A 2FK3A 2J6TA 2WAQB 2R7FA 4A3DG 3I55A 2K7VA 4AH6A 1XPRA 3T4AC 1I2LA 2B2TA 4ABNA 4O4HF 1V43A 4GKJQ 2R7KA 3I3CA 2JA8G 4LF6Q 4JI2H 3T51B 3RZDB 3HO8A 4DL5A 1SE3A 1HR0Q 5K36G 4YJ3F 3J81W 4XYQA 2K05A 1B9NA 3ONAB 4A3CH 3GIQA 1EY4A 4ECSA 4YBZB 4A3GB 5D3IB 4AYBB 4HEDA 4KK7A 1EUJA 1PVOA 2OCEA 1ULZA 4LH7A 5I5SA 3N6XA 1GO3E 5BR8Q 1KIXA 1R4PB 3TY8A 3T16A 4JI4Q 5ELOA 5IP7G 1Z2OX 4XYOA 5IYDH 4IWYA 2E2IA 3PO2G 1FGUA 4LUVA 3UI2A 4JI3L 4ZK9B 3Q23A 2VA3A 2F0KA 2NVQH 4BWSC 3KAKA 1JXLA 2DNCA 3Q24A 1ASZA 1HNZH 4WHXA 3C1EA 5HGTA 1EQTA 2JA7H 1B3QA 1U9RA 3HOXG 4HJ8A 2E2IH 2BR0A 1Y1WG 1GUGA 2R7MA 4DV2Q 3E9HA 1II3A 1B9MA 2GN5A 4YIJA 2FLLA 5DG8A 1Q90A 3OW7A 1STAA 5FPOA 2IPKD 3GTMB 3WNZA 4KD3A 3GV3A 3T1HL 3HOUH 1HA6A 2RGVA 2DY7A 1BJTA 4EBEA 3SK4A 1GVPA 3JRXA 1Q1EA 1SXTA 3LNNA 3LP8A 2R93H 3N8DA 1N34H 1GYFA 2JSOA 5DNFA 3UDIA 4LF5L 1ZEQX 1GHKA 3VA7A 3CCLA 1CKNA 1BVSA 1A8VA 1RDPD 1L2ZA 2PZTA 4A3JB 5CA0F 2JA7A 1IYJB 1GHJA 3J80c 2EYMA 1MBYA 1Q1BA 3MXGA 2NVTH 4JUZA 4IAJA 4X65Q 3IN5A 4ZAIA 2R85A 5J3BA 4O2BF 1FJGH 4G7ZC 1E2ZA 1S5ED 4DU9A 2I5LX 2KCTA 3SNOA 4K2KA 3RV3A 3BA9A 1VQMA 3K7UC 2XWJB 5IGCA 4Q4DA 5D14A 2F03A 4L5RC 4IOAA 4UDUC 4Y7NH 1KT8A 2FK2A 4EEYA 1MZBA 1CA5A 1PFNA 2YZNA 5LA6F 4DAAA 5T1GA 1CS0A 3PQIA 2JEFA 5G3LF 5M3FG 1HQRD 3RFCA 1YNJC 2HVRA 2IX0A 2L12A 1ESRA 1EYZA 2HD3A 1OXVA 2E5LQ 4V190 3H15A 4V0BA 1X55A 4B3TQ 5JAVA 2R3ZA 3A8KE 5BR8H 3LULA 4C1NK 2HDLA 3HFZB 1BNCA 2MQHA 5K3WA 2EYOA 2HIVA 2DLNA 1ONLA 2I07B 1ET0A 1D6EC 1EU4A 1AW7A 4O4LF 1L1OB 3G6XA 2ATWA 2QF7A 5FR9A 4Z9CB 4J9RA 2R86A 1TXYA 1TWHB 5COYA 1UNSA 1TWGH 4KMUC 4HJAA 3TQYA 4DPGA 2RF4A 5KRUA 5KNCA 1CHPD 2UU9L 3GILA 5DGIA 3HXLA 3KREA 1FJGL 4KTAA 2RSOA 4C3HG 3E6ZX 4JI0L 3A54A 4A3KG 5E4XA 1VKZA 2COJA 2EY1A 1SMXA 5CV6A 3OOCA 5FPRA 4BBSG 1LABA 4L8JA 4IFDG 3BVZA 3L0OA 3LMLA 1QNUA 2EVBA 2WB1E 1MI2A 5JJZA 2YWVA 3MHBA 3T9BA 4JOIA 4DR5L 1JWMD 2YV5A 4GNXA 5T14A 4UP8A 3PZPA 1TS5A 3SR1A 3N40P 3OTOL 4KD4A 4FU0A 1KRTA 5KGUA 1ASYA 2WB1A 3GTPH 4KY7A 3TRZA 5M3FH 1OTCA 2H5XA 4B9XA 2N55A 5KG3A 4J9PA 4HSVA 2VQFQ 3S1RB 3RBEA 1HNZQ 2CW7A 1RKNA 2ZTEA 3I7FA 2DN8A 1WCMA 1I94L 1DV1A 4C3JB 2FINB 1TY0A 2WACA 2EPBA 3L4KA 2Z4HA 4JC0A 3I4NH 3K7AB 2JA8H 2PZWA 3MC0B 4LFAL 3KHGA 4MTKA 4EFBA 1MHWC 5DM73 2YTXA 5EWEA 1S97A 1XNRL 5FLXL 3NK9A 2XGQA 1O80A 1NY4A 2AGPA 1E22A 5KFDA 1PZKD 1M90C 2L0CA 4KHVA 3MWYW 1JLLB 4R8UB 1I4QA 4JI6H 2H4OA 2FB9A 4TSSA 4DV0L 1A9XA 1N8RC 4DXGA 2J9GA 4C3JG 1IHZA 4Q0FA 3I4LA 4IPDA 2NU9B 3VMMA 3KALA 1ZQ7A 4EQOA 1ZKOA 3TS0A 4IZ8A 5D3DA 3DM1A 4JI5Q 3VYTA 1ENFA 1N34L 2B2WA 4IPGA 2MPMA 1YI2A 4GS3A 4ULLA 3RZOH 4BY7H 4DV5H 2YZMA 2XIWA 1KL9A 1V1OA 5LMNW 2FJZA 1PH3A 2XVSA 1DD2A 2YW2A 2HHFB 4DNIA 4DV6L 2DPIA 1TS2A 3RB0A 1E3PA 1SDFA 3RN2A 1UE7A 5FO9B 4C3HH 3P1HA 1IKLA 1IBLL 4J9SA 1BDOA 1FR3A 1SYDA 3KLSA 4FNFA 3GJXB 2UXDH 1KJQA 3K81C 3N43B 4KJNA 1SFOH 5CE8A 4RWSC 3JAMi 3WDNA 4NZMA 4K0KH 2NUCA 3EN2A 3BQ2A 4O7WA 2D0OA 4JI5H 4A76A 1LT3D 1TVXA 4EGJA 3T7AA 1TWFB 2CWPA 4Y52H 1D7QA 4HQ6A 1M4VA 5HBRB 2F52A 3GV7B 1HZBA 5C4XH 2NZHA 2QA4A 1CKNB 2PBZA 1HJPA 4A2BA 4EGQA 4O84A 1TY2A 3QO2A 3R23A 1QVCA 3I4OA 3D4DA 5KX5F 1K3BC 4FS2A 1V4YA 4UY8C 3GTGA 3JAMW 4JI8H 1E1OA 3N41B 2V4QA 3EPGA 3FKIH 4DLKA 4EYIB 4HJ5A 2EYPA 1C30A 2PQEA 1ET6A 2CH4W 5JJKA 3D4RA 4DV2L 4QWCA 4TKOB 5C0XH 3D4WA 1LTLA 1AZQA 2WAQE 1E1TA 3KFUA 2UUBH 1RCVD 2EJMA 4XQNA 1KAWA 1WTPA 5J39A 5I5XA 3H0GB 4ED7A 3HOWB 4JBJA 2UUAL 4YHHL 4O3NA 3K80C 5AFWA 4UCVA 1A2TA 1I3QA 1F9RA 2JA8B 4CC6A 4OX9Q 2EJ3A 5FLXW 1CQIB 2QDLA 2XC9A 4GN4B 4MTDA 4Y7NB 4O83A 2XNAC 4NXNH 4AYBE 1E4EA 3FDTA 2K5QA 1LTGD 3AYHB 1A6XA 4B08A 1PK8A 4L63B 2RQXA 1XMQL 3NTHA 1BCPB 3URYA 3QWUA 3U0GA 1EHIA 3RD4A 2ES2A 3RLNA 1IL2A 3NE5B 1V9PA 3F2UA 2BDNA 3P7JA 3X3MA 3SI8A 4O7LA 2KEEA 3I4MG 1CKOA 2FHTA 1NJIC 3MZ5A 1QZGA 4ED2A 3D0FA 2AUJD 3OPOA 4DV7L 4XQJA 1ZHQA 1F9QA 2E5LL 3VPBA 4OWXB 4PDBA 1Z6HA 2FE3A 3EJIA 2ZJRA 4YCWA 4HR7B 1Z47A 1D5MC 1C4QA 5BYBA 2R6GA 2BH2A 2XRSD 1U4MA 5ISRA 2K5VA 2NTSA 2A5HA 4HR7A 5IIFA 4IJLA 2HDMA 5IYZF 2IT1A 2XTIA 4IQZA 1EUDB 2BQ3A 1N32H 1IYVA 3DHQA 5GQOA 1QCBD 3LQSA 2JA6G 3S1MH 4OXPA 3K5LA 2WB1B 2BDOA 2UU9Q 1NTGA 5HNEA 1UNNC 4JI6L 3VOTA 1FJGQ 4UCSA 2HHFA 1PMRA 2OH2A 4IOCA 3FKIG 4AQYL 5ELFA 4JI0Q 5KFSA 4IPCA 3PO2H 4LJZC 3VYSA 3TDQA 1DYQA 4B3SL 3DEOA 2VNUD 1A2UA 1Y8PB 1NR4A 4PZ7A 2VPQA 3S1NB 1SNPA 2NVQB 1A3GA 5CV7A 3BJYA 4A3DB 4JYAL 1DZ1A 2M00A 1WOCA 2KJXA 4X62L 4LFBL 4NZOA 4F4ZA 2E2JH 4LF9H 2W6PA 2WINB 2E5LH 5IT9E 1TWAB 4JCVE 5JVG3 3UFXB 1Q81C 2B63A 1NAPA 3TSSA 1HH2P 4J9QA 5C0XJ 2UXCQ 5I5TA 3TBIB 2L4NA 4O4JF 3VPDA 3VR3A 2OT2A 5BPFA 1OXTA 1E4FT 1YZ6A 1PH4A 4EQ5A 1TT2A 1H95A 4ECTA 4O3PA 2B2UA 1L1OC 3S15B 3BYYB 4R9WA 4LFAQ 2B2VA 2R8IA 3G6JB 2OWOA 5M5XH 1RK6A 2JA6A 4DR2Q 2YL2A 1EKFA 3S1QH 3UYYA 4O0AA 2DNEA 2ASBA 3K58A 1Q7YC 2JA6B 2L1BA 2Y0SB 3S1QB 3RF2A 1DJRD 1KTAA 3I90A 4EBCA 3ULPA 2WB1G 5D1PA 5BN3A 3ULLA 4GN5A 1KC8C 3RV4A 4GKJL 1LTID 3CCVA 3N42B 1H9KA 3GTOB 3TZUA 4EQNA 4C2MB 3QZ7A 4TVIA 5IODA 1GSHA 2UVVA 4IJHA 1HCZA 4IPHA 1U5KA 2VW9A 1GSAA 1WVLA 3TP6A 1HR0L 3G71A 1I1LA 5IP7H 5GADC 2WKDA 1N34Q 1G6ZA 3Q1KA 4O2AF 3GV8B 2JA5H 5JPNC 3RB6A 1B44D 4EQPA 2R8HA 3K5IA 5C6AA 4GOPB 1DOMA 3V4ZA 3T9EA 4K5VA 2GQRA 3K3VA 3WO0A 4JI4L 1PZJD 4BBSH 1EIHA 2V5AA 4BY1B 4CMDA 2NVYA 4ECVA 4O3QA 4X66H 3HOVG 3H40A 2RGRA 3M9NB 4XYLB 2K14A 4H0LC 1CFMA 1ESFA 3LX0A 4MV7A 1ZYRC 5EBDA 4LF4L 3J7YW 4DL4A 1EKVA 1VQHA 3OWFA 2QKIC 3U50C 1O7LA 1A48A 1K8AC 2A6ED 1RTNA 4YQWA 3RUPA 3Q8RB 1X56A 2F0FA 3P75A 4LWCA 5KFPA 4ZYSA 2FPPB 3H4BA 1I3QB 2IL8A 3MXPA 3T1HQ 1PDQA 1PYWD 1D1IA 3K6OA 4XIGS 2I87A 1S0NA 3H91A 3H0GG 3CC4A 4QIWE 2PVPA 5DGBA 2YU9A 4OIJA 1Q8KA 3UE0A 2WV6D 2ASJA 2W9BB 2B2YC 3TEHB 1C0AA 3AQQA 1S4ZA 5IOCA 2CHBD 1KJ9A 1XXGA 2HQEA 2UXBL 3SK8A 2CQAA 1EYCA 3PW0A 2UVUA 5EJWA 3PR4A 1VBGA 4MN3A 2R92G 1R9TB 2RDJA 1H9RA 4OX9L 4K14A 1HQMC 4ALPA 3A5ZB 4C1NI 2CW0D 4RAUC 4XDXA 2B63H 2BA0A 3H3VI 3TQTA 4DV3H 3DEPA 4ZKBB 1SN8A 2EXZA 3D3RA 3VYUA 3H94A 5CBEE 4GKKQ 2AGOA 2HCIA 2CQYA 4B3TL 5I60A 3GIPA 4RFBA 4DAPA 4M7EA 3S14H 5BWTA 4LFCH 1SNOA 4OWTB 5CBAE 1EZ6A 1FYCA 5L1IA 5IGGA 4A3MH 1JCKB 1VQEA 4WORA 4HJ9A 3MXNA 3S1RH 3HOUG 2F4VL 3PSIA 2FXQA 3ZYYX 3CCSA 4XYMB 3JRWA 1ET9A 1H9SB 4JPBW 3PO3G 2CKZB 1PRTF 3SXHA 1YHAA 4JV1A 1S3OA 2VUMA 3CP0A 2GPWA 2IMWP 1RODA 4DXFA 1KEEA 1VQNA 2ASLA 3RZOB 3TIGA 3Q8PB 3NTIA 4O7VA 2CNQA 2EYJA 3S16H 2HHHL 4QCLA 4MV8A 4A3IH 1T94A 1W6JA 4K6LA 3RLOA 4IUVA 3AEVA 4HJ7A 1RHPA 5M9OA 3W2DA 3MFHA 3VA5A 1N56A 1TWAA 2F0TA 4QUCA 3L2PA 3T53B 4A3BG 1TWFA 1WTXA 3NGDA 2A6EC 3AB9A 3NENA 2NVXH 4KKTA 4FDBA 5C4XG 1HA5A 5K36H 4IRDA 4KHPH 1UAPA 1CSPA 2A74C 4ILWA 2JA5G 3G8CA 3A56A 3UDXA 2EIYA 3BJUA 1EZ1A 1HNZL 2HT1A 3PUYA 3KLWA 1OWTA 1U4RA 3W5OA 3AX6A 1VQKA 1V1QA 2ZJQA 5C3EH 1PH6A 4LF7Q 3K0XA 5FK9C 5KG5A 4JBMA 1IZ6A 3TIIA 1WTRA 4B9WA 4A3MG 4JYAQ 2HGWA 3BDCA 4DAYB 3Q2OA 4H02A 4X62Q 1JJCB 1VDZA 5IGEA 3MWDA 1XNRQ 3GTGH 1WD1A 3M3YB 3GTKB 4ED3A 1KJ8A 2E75C 3TEKA 5EPLA 2YU9H 2UXCL 2YZLA 3VNNA 1YNJD 3OYYA 1UE5A 3TN2A 4GLWA 4DNTB 4BBSB 3SVMA 4WD3A 5DEHA 1PH7A 3C0FB 4CDDC 4JV0A 2GQSA 4JW0A 3S17B 1JIHA 1RJTA 4DAMA 5J22A 4EX5A 3EPIA 3VPCA 4JI0H 3U58A 1C7YA 3AFPA 4CMFA 2VPSA 1O7YA 2PW7A 3BU2A 4F8MA 4I50F 2IHFA 4DV6Q 1BGWA 1WTOA 5H80A 1HZCA 1V51A 2R6FA 3TY9A 3OW2A 1G291 2VUMG 3BAAA 4DV0H 2OF1A 3GQBA 4WJWA 5LMUH 3MR6A 2JE6I 1C8CA 4K2LA 4DR3H 1Q86C 4A3FB 3RZDH 4ZI7F 2SOBA 1W2BA 2ID0A 1Q8IA 5C44G 1AZPA 2KEDA 4K6NA 1D1KA 2QDBA 4OEMB 1HFGA 1B1ZA 4L5QA 4CJ2C 2FPGB 2M05A 4ED0A 2K04A 4FFOA 1CT1D 5DLFA 1KNEA 4O3SA 4DV6H 1X65A 3C46A 5E1FA 2JEJA 1SR3A 2QW7A 3BYTB 5KFWA 1FKAH 2MO1A 3OSOA 1PHJA 4YB8B 2I80A 2XCAA 2B2VC 2PQAA 1K83A 5HY6A 4EFEA 1YNNC 4QIWB 3QG1A 1VCIA 1QVFA 2CW0C 3DXJC 2ICEC 2EDGA 4ZRZA 2F0LA 2HCCA 4J9NA 2Y0SE 4EG0A 4QIWA 2HGXA 4LW1A 1STYA 1IXRA 2W6MA 4HN7A 4LMYA 4CDFC 1JWUD 5FJ8H 4BY7G 5LL6S 1G2TA 2F1MA 4YHHQ 4CHTB 1SFOB 3T9AA 4DR5H 3H6MA 1SCUB 3J7ZC 4OL7A 1CQJB 4DR6H 1KJJA 4GLAC 3BACA 5KT4A 1LT5D 4C3HB 3M9OB 2OTJA 2SNMA 3H3VH 2P5ZX 1JICA 2L15A 3BZKA 3QWNA 3PO3H 1LTSD 1WSCA 2UXBQ 1U4PA 3MEFA 3N6RA 5KT2A 2RDHA 1Z2PX 2W9CB 2BE5C 3A7AB 1T3NA 1KRSA 1Q82C 2ODTX 3I70A 5DAUA 4GOPC 1A3TA 1HNWL 3GLKA 2A68C 3HOXB 1B70B 3NEMA 3VR2A 5LXTF 4JI7L 3C3LA 1P16A 1HPCA 4RNNA 2ALYB 5IT9c 1YBYA 1XK5A 4DAYA 3T1YL 1TWHH 4QSHA 2PO4A 4KHPL 5KFBA 4J1MA 4P2CB 4DR1L 2KOLA 4POGA 3FPUB 5FO8B 5C4JB 1TS3A 3E9IA 3GTPB 1FNWA 4GKKL 5KT3A 5KFXA 2NVXA 2JXMB 3TREA 1STGA 3PW7A 5D8DA 4GC6A 4OIKA 1S68A 3M4YA 5DG7A 3TINA 3GTOA 4QQBX 2B3GA 2YS7A 3LWBA 3HOVH 2JK8A 1O75A 2F4VQ 3JSLA 4ED8A 2J4XA 4IRKA 1TS4A 3K8AA 2VA2A 1YITA 1F2ZA 1JWSD 3K0YA 4YY3Q 4DUZH 4H13C 2KUMA 2D5DA 4QWAA 4JI6Q 2GPSA 1NE3A 1WYDA 4XTCS 1UE6A 4AQYQ 1S5CD 4JBWA 4A3JG 2G5DA 1S9FA 3M4PA 4S3SA 3M3YH 4A3KH 4RAYA 3OUZA 1A3VA 2BA1A 1EWIA 2JEBI 5KNBA 3CF5A 2F0NA 1YHQA 1BOSA 3KK7A 2HHHQ 3RGZA 5FLXE 3J81c 4K0KL 5KFEA 5KFLA 3HOXH 4BXXH 2K32A 3QFFA 5M3MH 2PW5A 3S2DB 3GTQB 4I4TF 4HMJA 3TMEA 3V6JA 4CJ0B 2V58A 3MTSA 4HMIA 3GTOH 1TU2B 5IYBG 3CMAA 4IHJF 3QZ8A 4PBCA 3K5HA 4LFBQ 1MD2D 3A7LA 2ALZA 1WJJA 2QEXA 3GTQA 4CKEA 2UXDQ 1YJWA 3R93A 5HGQA 2KECA 4IIJF 1K8MA 1I6VC 5I6WA 5KFMA 3V05A 4IUNA 3HOYB 1Y8OB 4LUZA 2R7ZB 4YWKA 3GV5B 2GVAA 3D8GA 1PH2A 3CC2A 3ETHA 3KTMA 1EYAA 2J6SA 1I50H 2W6NA 4A75A 1WTWA 3BVGA 5EZYF 3M4OH 4JBKA 1PTOB 4DV4Q 2RSNA 4O81A 1DOKA 4KY6A 3S14B 1GKHA 3F8NA 4KLKA 5T1IA 4TQRA 1EIFA 2Q2UA 2Z02A 1I50A 1BR9A 2A6HD 2SDFA 5C5JA 1WCMG 3NUCA 3CMEA 1NMGA 1BCPD 3NPPA 4U6PA 4ODGA 4AYBA 1EY0A 4APVA 5FJ8G 5CC4A 2LKVA 5ELDA 5C5LA 3FDSA 1K1SA 3E3XA 1SSOA 1ENAA 1AFPA 4OHJA 1E7ZA 1IYEA 3MR3A 4DL3A 4Q43A 1WRVA 2VQFH 1OXSC 3ORRA 5KFTA 1SEIA 3N52A 2UUCH 1QUQA 2DGYA 2XRQD 2L5TA 2CVRA 4ZUJA 2VQDA 4FGRA 5J2TF 4DKAC 3JAMc 1FVIA 3PUWA 4KV6A 4O7SA 1S5BD 4UCTA 1HNXQ 4KN7C 1JOOA 3VR4A 5KFVA 4ECYA 2A69C 3MXUA 1LTAD 3HKZA 3OUUA 2F0HA 3EA6A 5CORA 4QWBA 4OONA 4EVOA 5EDWA 5ELNA 4LF4Q 1HNWH 2K28A 3HKZB 2E8GA 5KG7A 4LSAA 4IFDI 2SCUB 3CSWA 5HV6A 3STBD 1JJGA 1C3OA 4UP9A 5BWRA 4ECZA 2JEAI 2IJ0A 2RA4A 1OO9B 3RB3A 4ZKCB 4DV4H 2NYZD 5FLMG 2OXPA 5IGBA 1EL0A 3BS1A 3CQZA 5L37A 4CBVA 5KFIA 3GO5A 1KABA 5IP9G 3W3AA 2C2RA 2KHIA 4RNOA 4YR3A 1BO0A 4F50A 1LO5D 3ETJA 3WOEA 5EWGA 2L9HA 1L0WA 4A93H 2XCLA 4MA0A 3K5OA 5CMDA 4LF4H 2ZM6H 1VQ4A 4MV3A 1VF5C 3CHBD 3O13A 4K8JA 4O3OA 3T9DA 1TWAH 5LOVF 5ELBA 1JC7A 4HIMA 3WWJA 1EY8A 2N8NA 5KFAA 5KFGA 1WTHA 2W71A 4UUGA 3UDGA 5M3MB 3J81L 1HR0W 3FKIB 4WJ3M 3M4OB 2VUGA 4GNXC 1Y1VB 5ELEA 2RBMA 3I12A 3GTPA 1LV9A 4MHEA 2RHQB 4P73A 3GTKA 2V4DA 5EKLA 2N49A 3NQIA 1TWGB 3SDZA 4I7AA 1N9WA 2F0WA 2IHEA 4FXKC 4IUQA 5IYBH 1LT6D 4I65A 2R82A 3V4SA 3CD6A 4GLVB 4CJ1B 2GA4B 3G8DA 1KAAA 2L55A 1AN8A 2E76C 1VQJA 4MV6A 2K1BA 2YCHA 5KT7A 1VBHA 1K73C 4PZ6A 4JI7Q 1HTPA 1IKMA 4B3ML 4R4OA 2F0SA 3T1YQ 4O4IF 5KT5A 3C2PA 4BA1I 3S2DH 3PUXA 1KJIA 4LK1C 2BCOA 1WI5A 4GLXA 4TQSA 5ELCA 3BQ1A 2LSSA 3PF5A 5KFFA 1EY9A 4A3IG 1IOVA 1SJHD 3RIZA 4JVZA 4IR9A 2R7DA 4RH6A 4A3FG 4A3CG 3I56A 4XZ3B 2FP4B 3T5HA 3GTKH 4A2AA 3PR5B 3H20A 4RZQA 2F3VA 3M7NA 2A69D 4IZOA 1EKPA 4DK3C 3WWHA 1F2LA 2WFWA 1U4LA 5C44H 1KDAA 3BG5A 2C22A 2EYLA 1K8GA 1I6HH 1TA8A 4IRCA 1IYDA 1QWYA 4PZ8A 4E4TA 2R7ZA 5LL6X 5I9PA 4RUAA 3Q8DA 3HKZE 4UFZA 3FP9A 3SE0A 1STEA 1LACA 1K83B 1Y1VG 5CV4A 1WTQA 4RGNA 1XPOA 2F0IA 4PNYA 3HOUB 5IE8A 4ZOLF 5I2XA 4ED1A 2R7ZH 3GV6A 4LF7L 2VL6A 4XQQA 2NB0A 4TQUS 3MAQA 3GTJH 4CKCA 1O7IA 3RBDA 5CGKA 3BABA 4GKJH 2DZDA 2A1AA 1JX4A 1UEAB 3C1FA 3MA2B 1K0SA 2FMMA 3FRPB 2R93A 1B33N 4C3IB 1QNKA 2EOTA 1GD7A 5BN4A 2UUBQ 1QILA 3KJPA 1XPUA 3NC0B 4CC5A 4X6AH 4DV4L 4C2MA 1RK5A 3GD7A 5M5XB 3F2CA 3R3OA 2EYFA 3QR8A 5EGTA 3D6CA 2FLPA 1D5ZC 4J9KA 3HT5A 3FKIA 3L3OC 4AYBG 3J80i 4BBRB 1CHQD 5C5MA 4B3RL 1MIUA 3MFYA 4M8AA 1EFWA 4GOPA 3UQ8A 3NQTA 4KKUA 4DV3L 3W1GA 1HRJA 1I94H 5LMNQ 3K59A 1BNZA 4F4WA 5JVDF 2YRWA 1AH9A 5L1JA 1WR2A 4BS9A 1YVCA 3K5MA 4NXML 1UE1A 4Y8VB 1PRTC 3T9CA 1E0BA 2W6OA 1TWHA 2B2TC 2VB3X 2WAQG 4DL7A 3NP8A 2IP4A 4H7BA 2OLSA 1PRTD 1HZ9A 2B29A 2D0PA 5KNDA 3UDFA 1TWCA 3GIIA 5KKNB 2EZVA 2KA7A 1N36H 3R5HA 3IG0A 5M3MG 1U0LA 4O7RA 1MKHA 2C2DA 5E7NA 2VR1A 1RD9D 1SYXB 2B8GA 2YTYA 4LSXA 2VQEH 5KT6A 2KCCA 2FJ2A 5CV8A 2VB2X 2X69A 2W9BA 1RF2D 2K6AA 5C1OA 3HGBA 3KDFB 3NBHA 4Q8EA 3KF8B 1WCMB 1AEXA 2R87A 4UCOA 3KF6A 1B50A 3H4DA 4XT3B 4FFNA 3T5JA 3D6WA 2E74C 2CNVA 1IBLH 1NCVA 2W6ZA 1N36Q 1GJXA 1DOLA 4XT1B 2ABJA 4FM9A 1DGSA 3AW8A 3CCQA 1W93A 2WE6A 2P0AA 1TWGA 2KQ3A 1R9TA 3R5FA 2PYKA 4FFLA 1LLRD 5LHY1 1FGBD 3W1BA 1G91A 3CPFA 1H9MA 1KDBA 2F4VH 1SYEA 1B7YB 4LH6A 4DR4H 4K8IA 4ID6A 1GM5A 5JQGF 5FD6A 2I5MX 4DR7Q 1T36A 4EBDA 5EAYA 2M2LA 1HNWQ 1EIYB 5L1LA 5E4WC 1PV4A 2WYOA 2B2WC 2R92H 1OBDA 5KFNA 3OHAA 3X3NA 2N3SA 1EQQA 1PH8A 3KXYT 1FL0A 1NMFA 1QB5D 2FMAA 1HZAA 3MXNB 3J81i 4DR6L 1ZXTA 4QMGA 2Y4RA 4KHPQ 3G7LA 1AE2A 2F3IA 3FMAA 4DR1Q 3KLRA 2PMZB 3PMFA 1H9SA 3E0JA 4IN3A 4N8FA 5TSSA 2IX3A 4LF5H 1D2BA 4TM5A 4LF7H 4YJ2F 1F2YA 1LTTD 1OXXK 4A3GH 2FPIB 4QW8A 3RN5A 5BPHA 4DQNA 5J1ZA 2R7LA 4CGYB 4B3MQ 3BZDB 2QCPX 4K5XA 4C56C 4FBUA 4PV1C 5BWVA 4YY3L 3FHWA 2A1HA 1Y69U 1A62A 2IA6A 4NW2A 3RTXA 2Y0SG 3KBGA 2NTTA 3WWIA 2EJ2A 4NYEA 2C35B 4NPSA 1YHBA 3I4MH 2O03A 2HQLA 4GKKH 4NB3A 3QIAA 3ITPA 1ENCA 5KFOA 2FLNA 2IBKA 3PIO3 1X9NA 2J0TD 2C9OA 3IL8A 3K57A 4RAZA 5F9NA 4F4XA 1ILQA 2AQ3B 5IWAH 2Q8IB 3RMHA 3G6YA 3KOJA 4K0KQ 5DG9A 1ICFB 5C4ZA 1I4RA 2EIFA 2XWBB 4JOIC 2K33A 5KYLA 4Q0YA 1A3UA 1PYBA 5LP6F 1CE8A 2EXDA 1KLGD 4DUZL 5I5UA 5K5PA 3S1NH 1TWCH 1KXLA 3GTGB 2EY2A 1A63A 4B3RH 1I4PA 4HIKA 3NWSA 2UXDL 1EYDA 1MSGA 1PLFA 2ZDHA 4C5AA 1VQPA 3HOVB 5C1PA 3NELA 1STHA 1RJPA 5BYAA 1L2FA 2DPJA 5BN5A 2WIIB 3HOWH 3N44B 3KLSX 4J9OA 3QQMA 4QY7A 3EROA 4YCUA 3SEBA 3A8IE 3VR6A 3RNUA 5BWXA 2NZ1D 3MWMA 3KF6B 3GQCA 1CQVA 3NTKA 4YP3A 3T13A 1HXYD 3RUZA 4HIDA 2XCPA 5LMUL 1E4EB 5KFJA 3CPWA 4ME3A 3HOZG 4RHRA 4JI8L 3PFFA 2E2HB 3Q8SB 3J80W 1L1OA 3Q6SA 2VQEL 1M0WA 3PW2A 2Z9HA 2AKWB 1SE8A 1LTRD 4R7RA 4MZ9A 3ICEA 2QYZA 3A5UA 1SNCA 2UUBL 1JDEA 4JV5Q 4FYDA 4BXXG 3OMGA 3G48A 1RYRA 2ZJTA 4F87A 5KG1A 3F2DA 1G2WA 1JB7A 1F9PA 1XMOH 4G4KA 2Q8TA 5D65A 3S17H 5IGDA 2HVQA 4JI7H 4R4QA 4KHZA 4ZQ3A 3HKSA 3FPPA 1WFQA 4X3TA 3T1YH 4BA2I 1S5DD 4B3RQ 2Z04A 4LFAH 3UZBA 1A15A 4YCVA 5I4DA 4DV3Q 1HNXL 1W3SA 3HBLA 2KSWA 1PFMA 1PTOH 2WP8J 3H3VC 4OWWB 3ND8A 3S9WA 2ATLA 1F77A 4LUOA 4L5TA 2F0PA 4JK1C 4PMWA 4HCSA 5FLMH 3DWQA 5A2QL 4RB2C 1Q46A 2AWNA 1MSHA 4R4CA 4C3IG 4A3EB 1IBML 4IUPA 4J8QA 4O42A 3MJFA 4J9MA 1IOWA 4XX0B 1WH2A 1LTBD 1BKBA 4ETSA 4HSPA 2N78A 3WOFA 1WCMH 4JI1L 3CU7A 3GTJA 2CQOA 2DJGC 4FVMA 1B04A 5J2UF 3PO3B 2NUAB 3GTJB 3J7A5 5M5YB 1HR0H 4A3EH 1SJED 2VZAA 3EFXD 1XJVA 1DV2A 2IW3A 3CAMA 1SE2A 2IWHA 4J6HA 2NN6I 4FO2A 2E2JB 5EWFA 1KBLA 3BDOA 2R8KA 4YY3H 4DR3Q 5JJIA 1CSQA 3DWAA 3RLFA 4JI4H 3PUZA 2R7ZG 3R5XA 3HOYG 2KCMA 4GN3B 1HNXH 5I47A 2D62A 1BBUA 5KIXA 3J80E 2LY7A 3HOZH 3TP5A 2RCFA 4QB4A 4E6NA 1PZID 2PMZA 4LF8Q 2BH8A 3G6VA 4K6DA
chains in the Genus database with same CATH topology
2ES2A 1EIFA 3RLNA 2Q2UA 3EIVA 5IP9H 1IL2A 3A74A 5D1OB 1RIPA 1V9PA 1LUZA 4LF6L 3RGXA 3LGJA 1WCMG 3CMEA 1NMGA 5IY0A 3F2BA 3I4MG 1CKOA 2MCTA 4JI5L 1IBMH 2NVYH 4APVA 1NJIC 5FJ8G 1QZGA 3PN1A 3NBYB 3D0FA 1PH9A 1Z2NX 3CVZA 1XNQH 4DV7L 1ZHQA 5C4JH 2E5LL 2IX1A 4JI1H 1E7ZA 4OWXB 4WJ4A 1XMQH 4PDBA 2FE3A 1UWVA 3CW2C 2VQFH 1OXSC 2ZJRA 1SEIA 2UUCH 1QUQA 1VQ9A 2DGYA 4YCWA 1IBLQ 1Z47A 4RB0A 4AIMA 2R6GA 2BH2A 5IYCH 5JJLA 1NBWA 2K5VA 4J15A 4DKAC 1FVIA 3PUWA 3JAMc 2Z0SA 3VDYA 4IJLA 4UCRA 3D31A 1XNRH 2IT1A 2XTIA 2ZTDA 1N32H 3NBZB 4UCTA 4QGUA 5GQOA 1HNXQ 2MFIA 2JA6G 1E4GT 3S1MH 4OXPA 3EBEA 3UE1A 4X65H 4UP7A 2UU9Q 1NTGA 1S03G 1VQLA 4JI6L 2RHSB 2Z6KA 1FJGQ 4OONA 4UCSA 4OX9H 4IOCA 3FKIG 1OXUA 3ERSX 5ELNA 4AQYL 2YYZA 4LF4Q 1HNWH 2E8GA 4JI0Q 4LSAA 4IPCA 3CQZH 5IYDG 4L5SA 4IFDI 5DISC 3PO2H 3STBD 1N33L 4LF5Q 4UP9A 1JJGA 2HVSA 2JEAI 2ZM6L 3GB8B 4B3SL 3KAJA 4DV4H 2OQKA 2VNUD 4B3TH 5FLMG 3CCRA 1L2ZA 4DR1H 4PZ7A 4BY1G 1K0RA 2Q2HA 1N32Q 4X65L 4NXNQ 3F1ZA 3PCOB 3GO5A 3KYHC 5IP9G 4B3MH 1VQIA 1SLJA 2A8VA 2KHIA 4JYAL 1WOCA 2I5HA 4X62L 5GAGC 1K83H 2JQOA 2E2JH 2UUCQ 2AMCB 2KENA 3BZCA 4AQYH 2E5LH 4JCVE 1L0WA 4A93H 2UUAQ 1B8AA 1Q81C 1X54A 4LF6H 4GNXB 5A2QW 2Z6KC 4X64L 1G51A 1HH2P 3SGIA 5C0XJ 4LF4H 4DV1H 2UXCQ 2ZM6H 2VS1A 1VQ4A 2DUDA 4DUZQ 3J7AK 4KI0A 1TWAH 1E24A 5FLXc 4HIMA 1Y14B 1OXTA 1E4FT 1YZ6A 2N8NA 1PH4A 4EQ5A 2MNAA 4NXMH 3G6EA 2HIXA 2ZTCA 3CCUA 3S2HH 1H95A 2K75A 1TAEA 4I7HA 3UDGA 1L1OC 4A4IA 3TY5A 1HR0W 2HGSA 3DM3A 4EEQA 4LFAQ 4WJ3M 1CUKA 1XMOQ 2VUGA 1SROA 4GNXC 3CCEA 5M5XH 1XMQQ 1M1KC 4DR2Q 2OWOA 2HHHH 3S1QH 4O0AA 2RHQB 2R93G 4P73A 1PYSB 2ASBA 1Q7YC 1VQBA 2N49A 4RG1A 1KQSA 1YNXA 3PUVA 1N9WA 5IYBH 2IHEA 4PG3A 3RF2A 4APMA 3CD6A 1LYLA 3ULPA 4GLVB 2WB1G 5D1PA 1XTDA 5JEAJ 2WDTA 4B3SH 3ULLA 1Z9FA 4GN5A 1KC8C 1VQJA 1Y1WH 4GKJL 3CCVA 3N42B 5LMUQ 2YCHA 4DV7Q 2K5HA 1K73C 1QUQB 2KBNA 4PZ6A 4JI7Q 4JI8Q 3S15H 4QL5A 4IJHA 2LXKA 4IPHA 4YWMA 3S24A 4B3ML 1U5KA 4P75A 4R4OA 2VW9A 3T1YQ 1IBKH 1HR0L 3G71A 2UUAH 4LFBH 2PNHA 4R4TA 5IP7H 4BA1I 5GADC 3TS2A 3PUXA 1N34Q 3S2DH 2VOBA 4DR2H 1N33H 2JA5H 5LMNL 2UXBH 4LF9H 1WI5A 3DLLA 5C0XG 2JJQA 4GLXA 4RB2C 4GOPB 4JV5L 2LSSA 3PF5A 4A3LG 4A3IG 1QZHA 2A19A 3RIZA 4RB1A 3K3VA 2R7DA 2EQSA 3K7AH 4A3FG 1VQ8A 4JI4L 3I56A 4NXMQ 2JA7G 4BBSH 4A3CG 3JC66 5EOYA 2CCZA 4X66H 3GTKH 3HOVG 4LF9L 4A2AA 4X62H 4LFCL 5M5YH 3H20A 2RGRA 4RZQA 4DR5Q 2JA9A 1VQCA 5GAHC 4DV1Q 1VQ6A 2K14A 3M7NA 4A3BH 3OTOQ 4DK3C 4MV7A 4LF4L 3E0EA 4X64H 2WFWA 5LMNH 1VQHA 4IO9A 1M0TA 4DV5Q 5C44H 3U50C 1J5EH 1N33Q 1K8AC 1K8GA 1I6HH 1TA8A 1X56A 1YEZA 4B3SQ 1MJCA 4LWCA 3PIPA 1PH1A 4PZ8A 3T1HQ 4C3IH 1XNQL 1X3GA 1JJ2A 4DV7H 3Q8DA 3HKZE 2VUMH 4UFZA 4XIGS 3B6YA 2W57A 2I0QA 2KHJA 5IYCG 3EYYA 4BBRH 4A3DH 3FP9A 3H0GG 3NBHB 4QIWE 3CC4A 1Y1VG 3RJ0A 1Q8KA 3UE0A 1XPOA 5IE8A 2R7ZH 3TEHB 4DR7H 1RL2A 3HOYH 4LF7L 1J5EL 2VL6A 2JA6H 1C0AA 4JI1Q 3AQQA 3U4VA 2XGTA 4TQUS 1N36L 5M5WH 2UXBL 5GAEC 2E2HH 2QGQA 3KDFA 3GTJH 1XDNA 2V1CC 4DUYQ 2RCNA 1O7IA 3BABA 5AJ3L 1D8LA 4GKJH 1VQFA 4X66Q 3T1HH 2A1AA 3ULJA 4LFBL 2R92G 3JSNA 2OTLA 4DV0Q 4OX9L 4JI2L 4ALPA 4DR2L 2AWOA 3A5ZB 5JEAG 3G4SA 4DR7L 2B63H 2BA0A 1P8LA 2K50A 4R4IA 3H3VI 1ZHSA 1EQRA 1GD7A 4DV3H 2UUBQ 3KJPA 3GTMH 1SN8A 1XPUA 3NC0B 4CC5A 5LL6b 4X6AH 4GKKQ 1I6UA 1C9OA 1YJ9A 1KHIA 4DV4L 4B3TL 3PF4A 1PH5A 2R7FA 4A3DG 3I55A 4M7EA 4AH6A 5C3EG 1XPRA 3S14H 4DR6Q 3GD7A 4LFCH 4OWTB 1Y1VH 3F2CA 1V43A 5IWAQ 4GKJQ 2CWAA 4JYAH 4A3MH 3J80W 1VQEA 2JA8G 4HJ9A 4LF6Q 4JI2H 3S1RH 3HOUG 3F8TA 2F4VL 4AYBG 3PSIA 3J80i 4B3RL 1HR0Q 1MIUA 5K36G 2FXQA 3CCSA 3PIOA 4GOPA 1EFWA 4BY1H 3UQ8A 4A3CH 3J81W 4DV3L 3W1GA 1I94H 5LMNQ 1YJNA 3PO3G 2CKZB 1EUJA 3DF7A 1PVOA 1YHAA 2OCEA 1S3OA 4LH7A 3CP0A 3N6XA 1AH9A 1GO3E 5BR8Q 1X3EA 3H0GH 1PA6A 1KIXA 3STBC 1YVCA 4JI4Q 4NXML 1UE1A 5ELOA 5IP7G 1VQNA 1Z2OX 5IYDH 1SRUA 3RR5A 3PO2G 1FGUA 4LUVA 4JI3L 2WAQG 2NZOA 2NVQH 3S16H 2HHHL 4BWSC 3KAKA 4A3IH 1HZ9A 1Q12A 2B29A 2D0PA 3UDFA 1ASZA 1HNZH 4A3FH 3RLOA 3WWVA 3AEVA 2JA7H 4HJ7A 1VQDA 3HOXG 1JE5A 4HJ8A 1K3RA 2E2IH 3IG0A 1N36H 1Y1WG 2Q2TA 4DV2Q 3E9HA 5M3MG 1U0LA 1MKHA 2GN5A 5E7NA 3L2PA 4A3BG 1SYXB 2K4KA 2YTYA 3NENA 5FPOA 4LSXA 2NVXH 3T1HL 3HOUH 2VQEH 2RGVA 4FDBA 4O2DA 1BJTA 5C4XG 1GVPA 4LNQA 1Q1EA 1YIJA 2R93H 4KHPH 1N34H 2JA5G 1CSPA 2XIGA 1GYFA 4MNOA 3UDIA 4A3EG 3UDXA 1IBKL 4LF5L 3BJUA 3CCLA 1CKNA 5C0XI 1BVSA 1A8VA 3KDFB 3PUYA 3KF8B 3KLWA 2ZM6Q 1HNZL 3W5OA 2HT1A 4UCOA 3KF6A 3CCMA 3J81j 1IYJB 1VQKA 1V1QA 3J80c 1S40A 5IT9W 2ZJQA 5C3EH 1LM0A 1Q1BA 1PH6A 3K0XA 4LF7Q 2NVTH 4IAJA 4X65Q 1IBLH 4JBMA 4RMFA 4JV5H 1N36Q 1IZ6A 5J3BA 1FJGH 4A3MG 4JYAQ 4DAYB 4FM9A 1DGSA 4H02A 1BBWA 1JJCB 2I5LX 4X62Q 2KCTA 3CCQA 2WE6A 5AJ3Q 1XNRQ 1VQMA 3GTGH 3K7UC 4X66L 2B63G 3GTLH 2IY5B 3BA9A 2NN6G 3W1BA 3F8NA 3CPFA 3PGZA 2F4VH 3ZJYC 1B7YB 2YU9H 2VY3A 4L5RC 4DR4Q 4Y7NH 4IOAA 2UXCL 4LH6A 3VNNA 3OYYA 1UE5A 1AE3A 3HKZG 1MZBA 1A0IA 4DR4H 1GM5A 5FD6A 2I5MX 4DR7Q 5EAYA 5M3FG 1HNWQ 1EIYB 2IX0A 2HVRA 1PV4A 3M9BA 2WYOA 2R92H 1OXVA 1PH7A 2E5LQ 3H15A 4BBRG 3C0FB 1X55A 2N3SA 1EQQA 4B3TQ 1PH8A 2UU9H 1UEBA 3KXYT 2VQEQ 1FL0A 1NMFA 2ZJPA 5BR8H 1HZAA 4JI3H 3MXNB 3J81i 4A3JH 4DR6L 4DAMA 4KHPQ 3HFZB 1AE2A 2F3IA 2MQHA 4EX5A 4DR1Q 5D1OA 3FMAA 2HIVA 4JI0H 3U58A 1C7YA 3AFPA 4DR4L 3ER0A 2VPSA 1EOVA 3BU2A 1L1OB 2IHFA 1EYGA 4LF5H 4DV6Q 2ATWA 1BGWA 1HZCA 4LF7H 2LXJA 3TY9A 1TXYA 3OW2A 1G291 3I2ZA 2VUMG 1OXXK 4A3GH 1G6PA 3RN5A 3BAAA 4DV0H 4HJAA 1TWGH 3TQYA 4DPGA 2RF4A 2UU9L 4LFBQ 5LMUH 1S72A 2JE6I 5BR8L 2CW8A 4B3MQ 3HXLA 1FJGL 4DR3H 1Q86C 3RZDH 1W2BA 3I4NG 2ID0A 4YY3L 5C44G 3FHWA 4JI0L 4JI3Q 4A3KG 1A62A 4A3LH 3RTXA 1JMCA 4MV9A 2Y0SG 1SMXA 4OO1I 5FPRA 3M4QA 4BBSG 5FD5A 4LF8H 4L5QA 2C35B 4NPSA 1YHBA 4IFDG 3I4MH 2O03A 2HQLA 4GKKH 4NB3A 3L0OA 3LMLA 2WB1E 1VS0A 1X9NA 4DV6H 1X65A 1SR3A 4RAZA 1I3QH 4JOIA 4DR5L 1FKAH 5IWAH 2MO1A 2YV5A 4GNXA 4UP8A 1PHJA 1IBMQ 2PQAA 3KOJA 5HY6A 4K0KQ 1VQ5A 1X6OA 3N40P 3OTOL 4EFEA 1KRTA 4YWLA 1ASYA 3GTPH 2EIFA 4C3JH 3TRZA 4JOIC 1VCIA 1QVFA 3CXCA 3A0JA 5M3FH 1MJEA 4Q0YA 1PYBA 1OTCA 2EXDA 2H5XA 1K9MC 2Y0SE 4DUZL 2PI2E 2VQFQ 3S1NH 1TWCH 2K5NA 1HNZQ 4A3GG 1A63A 1KXLA 2ZTEA 4UPAA 3I7FA 4LW1A 2CW7A 1IXRA 4HIKA 1I94L 4LMYA 2UXDL 2GVBA 1VQAA 5FJ8H 1XNQQ 4BY7G 3TY8A 4YHHQ 4MTEA 1VQPA 3L4KA 4JC0A 2K52A 3I4NH 3L7ZC 2JA8H 4DR5H 4JI7H 2PI2A 3J7ZC 4LFAL 3NELA 4OO1G 3CCJA 4GLAC 3OTOH 4UCUA 4DV2H 1L2FA 4EFBA 4DR6H 2PMZE 2YTXA 2OTJA 1XNRL 2Q2IA 3H3VH 3HOWH 4DR3L 3BZKA 1NY4A 2L15A 4TVAB 1VQ7A 2MO0A 3PO3H 1J5EQ 1E22A 3N44B 4P71A 1M90C 4QY7A 3MEFA 2UXBQ 1Z2PX 4YCUA 2CFMA 3MWMA 1KRSA 3RNUA 1Q82C 4JI6H 3KF6B 4LF8L 4DV0L 3GDEA 1N8RC 4GOPC 1HNWL 1B70B 3NEMA 5LMUL 4HIDA 3CPWA 4ME3A 4JI7L 1P16A 4JI8L 3HOZG 4IPDA 2ALYB 1AN7A 5IT9c 1YBYA 3CC7A 1XK5A 3KALA 4HIOA 1L1OA 4JG2A 4JI2Q 2VQEL 3T1YL 3TS0A 1TWHH 2YTVA 1M0WA 2AKWB 4JI5Q 1SE8A 4R7RA 4KHPL 1N34L 4MZ9A 4IPGA 4DR1L 3ICEA 4POGA 1YI2A 4GS3A 3A5UA 2UUBL 3RZOH 4DUYH 4BY7H 3E9IA 4DV5H 5LMNW 1KL9A 2AHOB 4GKKL 4JV5Q 4BXXG 1J6QA 1PH3A 3G48A 3TREA 4DNIA 4DV6L 4RB3C 1R9TH 1E3PA 3RN2A 2ZJTA 3F2DA 1UE7A 5GROA 3IRBA 4C3HH 3M85A 1JB7A 1IBLL 3S17H 1XMOH 1VQOA 3GTQH 5IWAL 1S68A 4R4QA 4KHZA 4LF9Q 4LFCQ 3HKSA 3HOWG 2HVQA 3GJXB 2UXDH 3K81C 4QQBX 4J0MA 2B3GA 3N43B 1WFQA 3AFQA 4DV1L 4P74A 2JK8A 3JAMi 1SFOH 2F4VQ 3HOVH 4MTNA 4BA2I 3JSLA 1O75A 4B3RQ 3K8AA 4A93G 4LFAH 3EN2A 4K0KH 5H1SE 3KJOA 4YCVA 4YY3Q 2D0OA 4DV3Q 1YITA 1W3SA 1HNXL 2KSWA 4DUZH 4A76A 4DV5L 4JI5H 2WP8J 2UXCH 3L4JA 4OWWB 2CWPA 4Y52H 4JI6Q 1D7QA 4LUOA 1NE3A 1WYDA 2F52A 1HZBA 1UE6A 4L5TA 4XTCS 4PMWA 3U4ZA 2NZHA 4JBWA 5C4XH 5FLMH 1CKNB 2QA4A 1HJPA 1PFSA 4AQYQ 4A3JG 3M4PA 4A2BA 3M3YH 4A3KH 4RAYA 1Q46A 2AWNA 2BA1A 1QVCA 3I4OA 4R4CA 4DRFA 1EWIA 2OQ0A 2JEBI 3CF5A 1IBML 4UY8C 1YHQA 2HHHQ 3JAMW 3RGZA 3J81c 2PQAB 4K0KL 4JI8H 1E1OA 3HOXH 3N41B 1QVGA 3FKIH 1WH2A 4BXXH 1BKBA 4HJ5A 4R1JA 5M3MH 4ETSA 1I5FA 4IFDJ 1T9HA 2N78A 1N32L 1WCMH 4JI1L 4NXNL 5JJKA 4DV2L 4B3RH 2CQOA 3GTOH 3T1YH 3M4IA 5IYBG 3CMAA 2VQFL 1B04A 1LTLA 3KFUA 1CKMA 1E1TA 2WAQE 4C2MH 1WJJA 2QEXA 4DUYL 1KAWA 2UUCL 1I94Q 2UUBH 2UXDQ 3J7A5 1YJWA 4JBJA 5HGQA 4A3EH 2UUAL 1HR0H 5DLQE 4YHHL 1X3FA 2VZAA 4X64Q 3K80C 4UCVA 1XJVA 1IBKQ 4LUZA 3CAMA 4DK6C 4YWKA 4CC6A 4OX9Q 5FLXW 2GVAA 2NN6I 1PH2A 1TWFH 4GN4B 3CC2A 4MTDA 4YY3H 4QJFA 4DR3Q 5JJIA 4P72A 1CSQA 1VQGA 3RLFA 1I50H 4JI4H 3PUZA 4A75A 4NXNH 4AYBE 2R7ZG 3HOYG 2KCMA 3AYHB 4GN3B 3M4OH 1HNXH 2D62A 1BBUA 3PV0A 4JBKA 3HOZH 4DV4Q 1JT8A 1XMOL 3BA8A 4E6NA 4POFA 1XMQL 1GKHA 1KD1C 4LF8Q 2BH8A 4KLKA 3QWUA 4YHHH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ES2 A;  1EIF A;  3RLN A;  2Q2U A;  3EIV A;  5IP9 H;  1IL2 A;  3A74 A;  5D1O B;  1RIP A;  1V9P A;  1LUZ A;  4LF6 L;  3LGJ A;  1WCM G;  3CME A;  1NMG A;  5IY0 A;  3F2B A;  3I4M G;  1CKO A;  4JI5 L;  2NVY H;  4APV A;  1NJI C;  5FJ8 G;  1QZG A;  3PN1 A;  3NBY B;  3D0F A;  1PH9 A;  4DV7 L;  5C4J H;  2E5L L;  2IX1 A;  1E7Z A;  4OWX B;  4WJ4 A;  1UWV A;  3CW2 C;  1OXS C;  2ZJR A;  1QUQ A;  1VQ9 A;  2DGY A;  4YCW A;  1IBL Q;  1Z47 A;  4AIM A;  2R6G A;  2BH2 A;  5IYC H;  5JJL A;  1NBW A;  2K5V A;  4J15 A;  4DKA C;  1FVI A;  3PUW A;  3JAM c;  2Z0S A;  3VDY A;  4IJL A;  4UCR A;  3D31 A;  2IT1 A;  2XTI A;  2ZTD A;  3NBZ B;  4UCT A;  4QGU A;  5GQO A;  1HNX Q;  2MFI A;  2JA6 G;  3S1M H;  4OXP A;  3EBE A;  3UE1 A;  4UP7 A;  2UU9 Q;  1NTG A;  1VQL A;  4JI6 L;  2RHS B;  2Z6K A;  1FJG Q;  4OON A;  4UCS A;  4IOC A;  3FKI G;  1OXU A;  3ERS X;  5ELN A;  4AQY L;  2YYZ A;  4LF4 Q;  2E8G A;  4JI0 Q;  4IPC A;  3CQZ H;  5IYD G;  4L5S A;  4IFD I;  5DIS C;  3PO2 H;  3STB D;  1N33 L;  4LF5 Q;  4UP9 A;  1JJG A;  2HVS A;  2JEA I;  2ZM6 L;  3GB8 B;  4B3S L;  2OQK A;  2VNU D;  5FLM G;  3CCR A;  4PZ7 A;  4BY1 G;  1K0R A;  2Q2H A;  1N32 Q;  4X65 L;  4NXN Q;  3F1Z A;  3PCO B;  3GO5 A;  3KYH C;  5IP9 G;  1VQI A;  1SLJ A;  2A8V A;  2KHI A;  4JYA L;  1WOC A;  2I5H A;  4X62 L;  5GAG C;  1K83 H;  2JQO A;  2E2J H;  2UUC Q;  2AMC B;  2KEN A;  3BZC A;  4JCV E;  1L0W A;  4A93 H;  2UUA Q;  1B8A A;  1Q81 C;  1X54 A;  4GNX B;  2Z6K C;  4X64 L;  1G51 A;  1HH2 P;  3SGI A;  5C0X J;  2UXC Q;  2VS1 A;  1VQ4 A;  2DUD A;  4DUZ Q;  4KI0 A;  1TWA H;  1E24 A;  5FLX c;  4HIM A;  1Y14 B;  1OXT A;  1YZ6 A;  2N8N A;  1PH4 A;  4EQ5 A;  2MNA A;  3G6E A;  2HIX A;  2ZTC A;  3CCU A;  3S2H H;  1H95 A;  2K75 A;  1TAE A;  3UDG A;  1L1O C;  4A4I A;  3TY5 A;  1HR0 W;  3DM3 A;  4EEQ A;  4LFA Q;  4WJ3 M;  1CUK A;  1XMO Q;  2VUG A;  1SRO A;  4GNX C;  3CCE A;  5M5X H;  1XMQ Q;  1M1K C;  4DR2 Q;  2OWO A;  3S1Q H;  4O0A A;  2RHQ B;  2R93 G;  4P73 A;  1PYS B;  2ASB A;  1Q7Y C;  1VQB A;  2N49 A;  4RG1 A;  1KQS A;  1YNX A;  3PUV A;  1N9W A;  5IYB H;  2IHE A;  4PG3 A;  3CD6 A;  1LYL A;  3ULP A;  4GLV B;  2WB1 G;  5D1P A;  1XTD A;  5JEA J;  3ULL A;  1Z9F A;  4GN5 A;  1KC8 C;  1VQJ A;  1Y1W H;  4GKJ L;  3CCV A;  5LMU Q;  4DV7 Q;  2K5H A;  1K73 C;  1QUQ B;  2KBN A;  4PZ6 A;  4JI7 Q;  4JI8 Q;  3S15 H;  4QL5 A;  4IJH A;  2LXK A;  4IPH A;  4YWM A;  3S24 A;  4B3M L;  1U5K A;  4P75 A;  4R4O A;  2VW9 A;  3T1Y Q;  1HR0 L;  3G71 A;  2PNH A;  4R4T A;  5IP7 H;  4BA1 I;  5GAD C;  3TS2 A;  3PUX A;  1N34 Q;  3S2D H;  2JA5 H;  5LMN L;  1WI5 A;  3DLL A;  5C0X G;  2JJQ A;  4GLX A;  4GOP B;  4JV5 L;  2LSS A;  3PF5 A;  4A3L G;  4A3I G;  1QZH A;  2A19 A;  2R7D A;  2EQS A;  3K7A H;  4A3F G;  1VQ8 A;  4JI4 L;  3I56 A;  4NXM Q;  2JA7 G;  4BBS H;  4A3C G;  3JC6 6;  2CCZ A;  3GTK H;  3HOV G;  4LF9 L;  4LFC L;  5M5Y H;  4DR5 Q;  2JA9 A;  1VQC A;  5GAH C;  4DV1 Q;  1VQ6 A;  2K14 A;  3M7N A;  4A3B H;  3OTO Q;  4DK3 C;  4LF4 L;  3E0E A;  2WFW A;  1VQH A;  4IO9 A;  4DV5 Q;  5C44 H;  3U50 C;  1N33 Q;  1K8A C;  1K8G A;  1I6H H;  1TA8 A;  1X56 A;  1YEZ A;  4B3S Q;  1MJC A;  4LWC A;  3PIP A;  1PH1 A;  4PZ8 A;  3T1H Q;  4C3I H;  1XNQ L;  1X3G A;  1JJ2 A;  3Q8D A;  3HKZ E;  2VUM H;  4UFZ A;  4XIG S;  3B6Y A;  2I0Q A;  2KHJ A;  5IYC G;  4BBR H;  4A3D H;  3FP9 A;  3H0G G;  3NBH B;  4QIW E;  3CC4 A;  1Y1V G;  1Q8K A;  3UE0 A;  1XPO A;  5IE8 A;  2R7Z H;  3TEH B;  1RL2 A;  3HOY H;  4LF7 L;  1J5E L;  2VL6 A;  2JA6 H;  1C0A A;  4JI1 Q;  3AQQ A;  3U4V A;  2XGT A;  4TQU S;  1N36 L;  5M5W H;  2UXB L;  5GAE C;  2E2H H;  2QGQ A;  3KDF A;  3GTJ H;  1XDN A;  2V1C C;  4DUY Q;  2RCN A;  1O7I A;  3BAB A;  5AJ3 L;  1D8L A;  1VQF A;  4X66 Q;  2A1A A;  3ULJ A;  4LFB L;  2R92 G;  3JSN A;  2OTL A;  4DV0 Q;  4OX9 L;  4JI2 L;  4ALP A;  4DR2 L;  2AWO A;  3A5Z B;  5JEA G;  3G4S A;  4DR7 L;  2B63 H;  2BA0 A;  1P8L A;  2K50 A;  4R4I A;  3H3V I;  1EQR A;  1GD7 A;  2UUB Q;  3KJP A;  3GTM H;  1SN8 A;  1XPU A;  3NC0 B;  4CC5 A;  4X6A H;  4GKK Q;  1C9O A;  1YJ9 A;  1KHI A;  4DV4 L;  4B3T L;  3PF4 A;  1PH5 A;  2R7F A;  4A3D G;  3I55 A;  4AH6 A;  5C3E G;  1XPR A;  3S14 H;  4DR6 Q;  3GD7 A;  4OWT B;  1Y1V H;  3F2C A;  1V43 A;  5IWA Q;  4GKJ Q;  2CWA A;  4A3M H;  1VQE A;  2JA8 G;  4HJ9 A;  4LF6 Q;  3S1R H;  3HOU G;  3F8T A;  2F4V L;  4AYB G;  3PSI A;  3J80 i;  4B3R L;  1HR0 Q;  1MIU A;  5K36 G;  2FXQ A;  3CCS A;  3PIO A;  4GOP A;  1EFW A;  4BY1 H;  3UQ8 A;  4A3C H;  4DV3 L;  3W1G A;  5LMN Q;  1YJN A;  3PO3 G;  2CKZ B;  1EUJ A;  1PVO A;  1YHA A;  2OCE A;  1S3O A;  4LH7 A;  3CP0 A;  1AH9 A;  1GO3 E;  5BR8 Q;  1X3E A;  3H0G H;  1PA6 A;  1KIX A;  3STB C;  1YVC A;  4JI4 Q;  4NXM L;  1UE1 A;  5ELO A;  5IP7 G;  1VQN A;  5IYD H;  1SRU A;  3RR5 A;  3PO2 G;  1FGU A;  4LUV A;  4JI3 L;  2WAQ G;  2NZO A;  2NVQ H;  3S16 H;  2HHH L;  4A3I H;  1HZ9 A;  1Q12 A;  2B29 A;  2D0P A;  3UDF A;  1ASZ A;  4A3F H;  3RLO A;  3WWV A;  3AEV A;  2JA7 H;  4HJ7 A;  1VQD A;  3HOX G;  1JE5 A;  4HJ8 A;  1K3R A;  2E2I H;  1Y1W G;  2Q2T A;  4DV2 Q;  3E9H A;  5M3M G;  1U0L A;  1MKH A;  2GN5 A;  5E7N A;  3L2P A;  4A3B G;  2K4K A;  2YTY A;  3NEN A;  5FPO A;  2NVX H;  3T1H L;  3HOU H;  4FDB A;  4O2D A;  5C4X G;  1GVP A;  4LNQ A;  1Q1E A;  1YIJ A;  2R93 H;  2JA5 G;  1CSP A;  4MNO A;  3UDI A;  4A3E G;  3UDX A;  1IBK L;  4LF5 L;  3BJU A;  3CCL A;  1CKN A;  5C0X I;  1BVS A;  1A8V A;  3KDF B;  3PUY A;  3KF8 B;  3KLW A;  2ZM6 Q;  1HNZ L;  3W5O A;  2HT1 A;  4UCO A;  3KF6 A;  3CCM A;  3J81 j;  1IYJ B;  1VQK A;  1V1Q A;  3J80 c;  1S40 A;  2ZJQ A;  5C3E H;  1LM0 A;  1Q1B A;  1PH6 A;  3K0X A;  4LF7 Q;  2NVT H;  4X65 Q;  4JBM A;  4RMF A;  1N36 Q;  1IZ6 A;  5J3B A;  4A3M G;  4JYA Q;  4DAY B;  1DGS A;  4H02 A;  1BBW A;  1JJC B;  2I5L X;  4X62 Q;  2KCT A;  3CCQ A;  5AJ3 Q;  1XNR Q;  1VQM A;  3GTG H;  3K7U C;  4X66 L;  2B63 G;  3GTL H;  2IY5 B;  3BA9 A;  2NN6 G;  3W1B A;  3CPF A;  3PGZ A;  3ZJY C;  1B7Y B;  2YU9 H;  2VY3 A;  4L5R C;  4DR4 Q;  4Y7N H;  4IOA A;  2UXC L;  4LH6 A;  3VNN A;  3OYY A;  1UE5 A;  1AE3 A;  3HKZ G;  1A0I A;  1GM5 A;  2I5M X;  4DR7 Q;  5EAY A;  5M3F G;  1HNW Q;  1EIY B;  2IX0 A;  2HVR A;  1PV4 A;  3M9B A;  2R92 H;  1OXV A;  1PH7 A;  2E5L Q;  3H15 A;  4BBR G;  1X55 A;  2N3S A;  1EQQ A;  4B3T Q;  1PH8 A;  1UEB A;  2VQE Q;  1FL0 A;  1NMF A;  2ZJP A;  1HZA A;  3MXN B;  3J81 i;  4A3J H;  4DR6 L;  4DAM A;  4KHP Q;  3HFZ B;  1AE2 A;  2F3I A;  2MQH A;  4EX5 A;  4DR1 Q;  5D1O A;  2HIV A;  3U58 A;  1C7Y A;  3AFP A;  4DR4 L;  3ER0 A;  1EOV A;  3BU2 A;  1L1O B;  2IHF A;  1EYG A;  4DV6 Q;  2ATW A;  1HZC A;  2LXJ A;  3TY9 A;  1TXY A;  3OW2 A;  1G29 1;  3I2Z A;  2VUM G;  1OXX K;  4A3G H;  1G6P A;  3RN5 A;  3BAA A;  4HJA A;  1TWG H;  3TQY A;  4DPG A;  2RF4 A;  2UU9 L;  4LFB Q;  1S72 A;  2JE6 I;  5BR8 L;  4B3M Q;  1FJG L;  1Q86 C;  3RZD H;  1W2B A;  3I4N G;  2ID0 A;  4YY3 L;  5C44 G;  3FHW A;  4JI0 L;  4JI3 Q;  4A3K G;  1A62 A;  4A3L H;  3RTX A;  1JMC A;  2Y0S G;  1SMX A;  4OO1 I;  5FPR A;  3M4Q A;  4BBS G;  4L5Q A;  2C35 B;  4NPS A;  1YHB A;  4IFD G;  3I4M H;  2HQL A;  4NB3 A;  3L0O A;  2WB1 E;  1VS0 A;  1X9N A;  1X65 A;  1SR3 A;  1I3Q H;  4JOI A;  4DR5 L;  2MO1 A;  2YV5 A;  4GNX A;  4UP8 A;  1PHJ A;  1IBM Q;  2PQA A;  3KOJ A;  5HY6 A;  4K0K Q;  1VQ5 A;  1X6O A;  3OTO L;  4EFE A;  1KRT A;  4YWL A;  1ASY A;  3GTP H;  2EIF A;  4C3J H;  3TRZ A;  4JOI C;  1VCI A;  1QVF A;  3CXC A;  3A0J A;  5M3F H;  1MJE A;  1PYB A;  1OTC A;  2EXD A;  2H5X A;  1K9M C;  2Y0S E;  4DUZ L;  2PI2 E;  2VQF Q;  3S1N H;  1TWC H;  2K5N A;  1HNZ Q;  4A3G G;  1A63 A;  1KXL A;  2ZTE A;  4UPA A;  3I7F A;  4LW1 A;  1IXR A;  4HIK A;  1I94 L;  2UXD L;  2GVB A;  1VQA A;  5FJ8 H;  1XNQ Q;  4BY7 G;  3TY8 A;  4YHH Q;  1VQP A;  4JC0 A;  2K52 A;  3I4N H;  3L7Z C;  2JA8 H;  2PI2 A;  3J7Z C;  4LFA L;  3NEL A;  4OO1 G;  3CCJ A;  4GLA C;  4UCU A;  1L2F A;  4EFB A;  2PMZ E;  2YTX A;  2OTJ A;  1XNR L;  2Q2I A;  3H3V H;  3HOW H;  4DR3 L;  3BZK A;  1NY4 A;  2L15 A;  4TVA B;  1VQ7 A;  2MO0 A;  3PO3 H;  1J5E Q;  1E22 A;  4P71 A;  1M90 C;  4QY7 A;  3MEF A;  2UXB Q;  4YCU A;  2CFM A;  1KRS A;  3RNU A;  1Q82 C;  3KF6 B;  4LF8 L;  4DV0 L;  3GDE A;  1N8R C;  4GOP C;  1HNW L;  1B70 B;  3NEM A;  5LMU L;  4HID A;  3CPW A;  4ME3 A;  4JI7 L;  1P16 A;  4JI8 L;  3HOZ G;  4IPD A;  2ALY B;  5IT9 c;  1YBY A;  3CC7 A;  1XK5 A;  4HIO A;  1L1O A;  4JG2 A;  4JI2 Q;  2VQE L;  3T1Y L;  3TS0 A;  1TWH H;  2YTV A;  2AKW B;  4JI5 Q;  1SE8 A;  4KHP L;  1N34 L;  4MZ9 A;  4IPG A;  4DR1 L;  3ICE A;  4POG A;  1YI2 A;  4GS3 A;  3A5U A;  2UUB L;  3RZO H;  4BY7 H;  3E9I A;  5LMN W;  1KL9 A;  2AHO B;  4GKK L;  4JV5 Q;  4BXX G;  1J6Q A;  1PH3 A;  3G48 A;  3TRE A;  4DNI A;  4DV6 L;  1R9T H;  1E3P A;  3RN2 A;  3F2D A;  1UE7 A;  5GRO A;  3IRB A;  4C3H H;  3M85 A;  1JB7 A;  1IBL L;  3S17 H;  1VQO A;  3GTQ H;  5IWA L;  1S68 A;  4R4Q A;  4KHZ A;  4LF9 Q;  4LFC Q;  3HKS A;  3HOW G;  2HVQ A;  3GJX B;  3K81 C;  4QQB X;  2B3G A;  1WFQ A;  3AFQ A;  4DV1 L;  4P74 A;  2JK8 A;  3JAM i;  1SFO H;  2F4V Q;  3HOV H;  4MTN A;  4BA2 I;  3JSL A;  4B3R Q;  3K8A A;  4A93 G;  3EN2 A;  5H1S E;  3KJO A;  4YCV A;  4YY3 Q;  2D0O A;  4DV3 Q;  1YIT A;  1W3S A;  1HNX L;  4A76 A;  4DV5 L;  2WP8 J;  4OWW B;  2CWP A;  4Y52 H;  4JI6 Q;  1D7Q A;  4LUO A;  1NE3 A;  1WYD A;  2F52 A;  1HZB A;  1UE6 A;  4L5T A;  4XTC S;  4PMW A;  3U4Z A;  2NZH A;  4JBW A;  5C4X H;  5FLM H;  1CKN B;  2QA4 A;  1HJP A;  1PFS A;  4AQY Q;  4A3J G;  3M4P A;  3M3Y H;  4A3K H;  1Q46 A;  2AWN A;  2BA1 A;  1QVC A;  3I4O A;  4R4C A;  4DRF A;  1EWI A;  2OQ0 A;  2JEB I;  3CF5 A;  1IBM L;  4UY8 C;  1YHQ A;  2HHH Q;  3J81 c;  2PQA B;  4K0K L;  1E1O A;  3HOX H;  1QVG A;  3FKI H;  4BXX H;  1BKB A;  4HJ5 A;  4R1J A;  5M3M H;  1I5F A;  4IFD J;  1T9H A;  2N78 A;  1N32 L;  1WCM H;  4JI1 L;  4NXN L;  5JJK A;  4DV2 L;  2CQO A;  3GTO H;  5IYB G;  3CMA A;  2VQF L;  1B04 A;  1LTL A;  3KFU A;  1CKM A;  1E1T A;  2WAQ E;  4C2M H;  1WJJ A;  2QEX A;  4DUY L;  1KAW A;  2UUC L;  1I94 Q;  2UXD Q;  3J7A 5;  1YJW A;  4JBJ A;  5HGQ A;  4A3E H;  2UUA L;  5DLQ E;  4YHH L;  1X3F A;  2VZA A;  4X64 Q;  3K80 C;  4UCV A;  1XJV A;  1IBK Q;  4LUZ A;  3CAM A;  4DK6 C;  4YWK A;  4CC6 A;  4OX9 Q;  2GVA A;  2NN6 I;  1PH2 A;  1TWF H;  4GN4 B;  3CC2 A;  4QJF A;  4DR3 Q;  5JJI A;  4P72 A;  1CSQ A;  1VQG A;  3RLF A;  1I50 H;  3PUZ A;  4A75 A;  4AYB E;  2R7Z G;  3HOY G;  2KCM A;  3AYH B;  4GN3 B;  3M4O H;  2D62 A;  1BBU A;  3PV0 A;  4JBK A;  3HOZ H;  4DV4 Q;  1JT8 A;  1XMO L;  3BA8 A;  4E6N A;  4POF A;  1XMQ L;  1GKH A;  1KD1 C;  4LF8 Q;  2BH8 A;  4KLK A;  3QWU A; 
#chains in the Genus database with same CATH topology
 5D1O B;  1Y1W A;  2PN1 A;  2JN4 A;  1RIP A;  2NVT B;  3LGJ A;  1S10 A;  1CQF A;  4U67 3;  4FFP A;  5BWW A;  4ZLT F;  1IBM H;  2HDK A;  3PN1 A;  2V9W A;  3U9T A;  5KG6 A;  3NBY B;  4APM A;  3CVZ A;  1PH9 A;  1Z2N X;  1XNQ H;  4CDE C;  4BY7 B;  2IX1 A;  4JI1 H;  1I1M A;  1DM0 B;  1CTM A;  2C00 A;  2COG A;  1UWV A;  3CW2 C;  4QF4 A;  3RB4 A;  1XYI A;  4X3S A;  1VQ9 A;  3TP8 A;  3JZF A;  4RB0 A;  2D9U A;  4AIM A;  1KLU D;  2W7P A;  1STN A;  5IYC H;  4ECW A;  5JJL A;  4J15 A;  3KBX A;  2Z0S A;  4I55 F;  4UCR A;  1XNR H;  5KYI A;  2EJG C;  3U9S A;  3PW5 A;  2F0M A;  4WBN F;  1KC7 A;  4QWE A;  3NBZ B;  4H44 C;  5EPJ A;  2MFI A;  4DN4 M;  1E4G T;  2LS0 1;  4R8N A;  3T54 A;  4MA5 A;  1B3A A;  3IFD A;  4X65 H;  4O82 A;  1CA6 A;  1VQL A;  2RDI A;  4OEL B;  1I7N A;  3J7A V;  1GSO A;  4OX9 H;  3ERS X;  2YYZ A;  4RA8 A;  4G7H C;  3CQZ H;  5IYD G;  4L5S A;  2HVS A;  4OGQ C;  2ZM6 L;  3GB8 B;  1JE4 A;  3KAJ A;  2OQK A;  3FMC A;  4B3T H;  5M5W B;  3CCR A;  1I1K A;  5KFR A;  4BY1 G;  1NUC A;  1SMY C;  2Z4I A;  1K0R A;  1N32 Q;  4NXN Q;  3F1Z A;  3PCO B;  1JR0 D;  3KYH C;  2ICI A;  2WKC A;  1SLJ A;  2A8V A;  2YU9 B;  3MWE A;  2UUC Q;  1V8Q A;  1EY7 A;  2A6H C;  3CRL C;  1KDC A;  4FE2 A;  1X54 A;  4LF6 H;  4GNX B;  3A55 A;  5A2Q W;  2Z6K C;  4X64 L;  1G51 A;  3SGI A;  3VYR A;  1Y8N B;  2VS1 A;  2DUD A;  4DUZ Q;  3J7A K;  2COI A;  4KI0 A;  1EY5 A;  5FLX c;  2EJF C;  3J81 E;  1Y14 B;  2H1E A;  1JQY D;  3MFG A;  3JAM L;  2W8K A;  3CCU A;  2ZTC A;  2KHS A;  4U68 A;  3S2H H;  2K75 A;  4I7H A;  1LT4 D;  2YS6 A;  2PZU A;  4UAI A;  5KFU A;  2WTF A;  2HGS A;  3DM3 A;  1EQV A;  1ICW A;  1NNX A;  1XMO Q;  1SRO A;  2HHH H;  1M1K C;  2XD4 A;  2RVL A;  1J9O A;  3U55 A;  5CR3 A;  2QEJ C;  2E2D C;  1EOT A;  1FNU A;  1PYS B;  1XTC D;  4FP5 D;  1VQB A;  1KQS A;  4RG1 A;  4X3U A;  4RUC A;  1DIK A;  1GOZ A;  1XTD A;  4B3S H;  4DV2 H;  5L9X A;  4IUT A;  3HZX A;  5LMU Q;  2K5H A;  1B2T A;  1QUQ B;  1SYB A;  4YR0 A;  4JI8 Q;  3RAX A;  4QL5 A;  1YNN D;  3QJY A;  2IY5 B;  2LXK A;  1IBK H;  4YWM A;  3S24 A;  2UUA H;  3HOZ B;  1X32 A;  4I7Z C;  2PNH A;  5EQ0 A;  4R4T A;  1WD0 A;  4Q5V A;  4LFB H;  1N33 H;  4DR2 H;  3V6K A;  2UXB H;  5LMN L;  2R8G A;  5C0X G;  2JJQ A;  1B4O A;  2F0U A;  4JV5 L;  4ZHQ F;  5KFZ A;  2AQ4 A;  2A19 A;  2M9V A;  4RB1 A;  4HN2 A;  4A3B B;  3K7A H;  4NXM Q;  5EOY A;  2JA7 G;  3MR2 A;  3FEW X;  2HJW A;  3JC6 6;  4RZR A;  2CCZ A;  4KJO A;  5C4X B;  5DLG A;  2Z1C A;  5M5Y H;  1VQC A;  4RCO A;  2QIL A;  4A3I B;  1VQ6 A;  3GIK A;  1M7J A;  3LWU A;  2XSC A;  3S2H B;  1S0O A;  2F0J A;  3E0E A;  3K5N A;  4HAE A;  1M0T A;  1GUS A;  3HEJ A;  4DFA A;  5KEE A;  3OSP A;  2AQ2 B;  2BE5 D;  3K3P A;  3PO2 B;  1N33 Q;  1KTK A;  3CQZ B;  1IW7 C;  1YEZ A;  1MJC A;  4NZN A;  2OEO A;  3ERQ A;  2B63 B;  1XNQ L;  4DV7 H;  2ASD A;  2VUM H;  2UVR A;  3B6Y A;  2KHJ A;  5IYC G;  2NBF A;  4BBR H;  4A3D H;  4NP5 A;  3RJ0 A;  5DQI A;  2KCN A;  4U7C A;  1RL2 A;  3CRK C;  4IAL A;  1J5E L;  2JA6 H;  2ENB A;  4JI1 Q;  3SHL A;  3U4V A;  1N36 L;  1XWE A;  3SK5 A;  2QGQ A;  5KFH A;  4ECR A;  2V1C C;  1OBG A;  1SNM A;  1D8L A;  5FKA C;  4HNT A;  1VQF A;  2AUK A;  5I5W A;  3T1H H;  2D2C C;  3ULJ A;  5JH7 F;  2L11 A;  1I7L A;  3JSN A;  1W96 A;  4JI2 L;  1JB3 A;  3WO1 A;  2B39 A;  2K5W A;  2AWO A;  5JEA G;  3G4S A;  4DR7 L;  2DWC A;  1UUP A;  1S0M A;  2K50 A;  1VF7 A;  4R4I A;  4RHS A;  3DTG A;  3I91 A;  1ZHS A;  1EQR A;  4Q4C A;  1CZW A;  3GTM H;  2TMP A;  1I6U A;  1YJ9 A;  1KHI A;  2X0S A;  2JA5 A;  4A93 B;  2Y0S A;  5DMX A;  1PH5 A;  1SBB B;  5F9L A;  5C3E G;  2X5R A;  1CM9 A;  4DR6 Q;  1Y1V H;  4R8I A;  5IWA Q;  2CWA A;  4JYA H;  4FF4 A;  4HNU A;  3M9M B;  5M3F B;  3F8T A;  2ZXR A;  4DGZ A;  2Q7D A;  5DQH A;  1ZAU A;  2R8J A;  2DAA A;  3PIO A;  2AQ1 B;  4BY1 H;  2NVY B;  1I4G A;  1V1P B;  5HUR A;  4PQX A;  1YJN A;  4PMB A;  2NU8 B;  3DF7 A;  4HYK A;  4FF1 A;  1X3E A;  3H0G H;  3QOJ A;  4ME5 A;  3STB C;  1PA6 A;  1T5E A;  3OMC A;  4QW9 A;  3QOL A;  5C44 B;  1TII D;  1E2V A;  4GZY C;  1SRU A;  1BQQ T;  3RR5 A;  1RTO A;  2R61 A;  4FXG C;  1E2W A;  5C3E B;  2NZO A;  1SNQ A;  3E5N A;  5KG0 A;  1Q12 A;  3FVQ A;  1FD7 D;  1BBX C;  1HUN A;  3NBI A;  5JVH 3;  4A3F H;  2EE1 A;  3WWV A;  1S5F D;  1VQD A;  2PCF B;  2W9A A;  1JE5 A;  1K3R A;  1W6K A;  3UZO A;  2Q2T A;  4DA2 A;  1PRT B;  1HUM A;  4N9T A;  4A3K B;  3MFI A;  5IT9 L;  2AGQ A;  1SAP A;  2K4K A;  4O7Z A;  3EQL C;  2FK1 A;  4O2D A;  4PWQ A;  5JEA H;  2EY6 A;  4LNQ A;  4TV9 F;  3Q8Q B;  1YIJ A;  3KHL A;  4QUF A;  2XIG A;  4MNO A;  4A3E G;  5KG2 A;  1B6R A;  1IBK L;  4PMC A;  1JKJ B;  4L6T B;  5C0X I;  3S1M B;  3T5L A;  4L1K A;  2ZM6 Q;  2BQU A;  1AP0 A;  2K01 A;  3CCM A;  3J81 j;  1S40 A;  3T5K A;  5IT9 W;  1LM0 A;  1I6H B;  4MIU A;  2R92 B;  4RMF A;  1ILP A;  4JV5 H;  5JQW A;  4EYH B;  1BBW A;  3OIQ A;  1EIG A;  2BOS A;  3MVV A;  5AJ3 Q;  5FOB B;  4CHI A;  4X66 L;  2B63 G;  3GTL H;  3NUA A;  2NN6 G;  5I9O A;  2R93 B;  3PGZ A;  2I8C A;  3ZJY C;  5DM6 3;  4ZCK A;  2VY3 A;  3QB3 A;  1AE3 A;  3HKZ G;  4QWD A;  1A0I A;  1L0X B;  2G9H D;  2W9C A;  2EY5 A;  2DY8 A;  4RGO S;  5A35 A;  1CK1 A;  2EYH A;  3M9B A;  2W6Q A;  4BBR G;  4F88 A;  3NXW A;  2UU9 H;  3M7G A;  1GLV A;  1UEB A;  2YYA A;  4C5C A;  2VQE Q;  2ZJP A;  4JXU A;  4O7Y A;  1GUW A;  4JI3 H;  4A3J H;  5D1O A;  3DTF A;  3HP3 A;  4DK0 A;  3MR5 A;  3KHH A;  2B8F A;  4OO1 H;  3OHX C;  1HFN A;  1H9J A;  2NU7 B;  3NHH A;  4DR4 L;  3JZI A;  3ER0 A;  3SE7 A;  1F2M A;  1EOV A;  5BWU A;  1EYG A;  3CEB A;  3I8Z A;  2LXJ A;  2O4X A;  3I2Z A;  1G6P A;  4GC7 A;  4RNM A;  4WRD A;  4JV2 A;  1S72 A;  2RDF A;  5BR8 L;  2ZDG A;  2CW8 A;  5KFC A;  3V6H A;  2GLT A;  3R2T A;  3I4N G;  4YAJ B;  1IW7 D;  1XX8 A;  4JI3 Q;  1KNA A;  5I2Y A;  4A3L H;  4TRD A;  3TP7 A;  1JMC A;  4MV9 A;  1K28 A;  4OO1 I;  1JOQ A;  4YAK B;  3M4Q A;  3S16 B;  5FD5 A;  4ECU A;  4LF8 H;  4K5W A;  1VS0 A;  2W70 A;  3GID A;  1I3Q H;  1IBM Q;  4G57 A;  1B53 A;  4CE5 A;  2MHV A;  1X6O A;  3ND9 A;  1VQ5 A;  2MUY A;  1BCP C;  4YWL A;  3R8B A;  4C3J H;  5A2Q E;  3CXC A;  3A0J A;  1MJE A;  1QE6 A;  2AU0 A;  1K9M C;  5EBC A;  2PI2 E;  4A3G G;  2K5N A;  4UPA A;  4M9U A;  1GUT A;  4ZQI A;  1O78 A;  1VQA A;  2GVB A;  2F4I A;  2Z8L A;  5NUC A;  1XNQ Q;  5I5Y A;  5C8Y F;  2UVW A;  4FF2 A;  1GUO A;  2TSS A;  4MTE A;  2K52 A;  4FF3 A;  3L7Z C;  4O7N A;  2PI2 A;  1NR2 A;  3H0G A;  1N48 A;  4DF7 A;  4OO1 G;  3CCJ A;  3OTO H;  4UCU A;  2O5J C;  2PMZ E;  5KS8 A;  4RGT A;  1VAJ A;  2Q2I A;  4DR3 L;  1TQO A;  2JA5 B;  5KG4 A;  4TVA B;  1VQ7 A;  2MO0 A;  1J5E Q;  3PIP 3;  4P71 A;  1B6S A;  2F3W A;  1EWC A;  1FNV A;  3I72 A;  2CFM A;  4FFR A;  1RJR A;  1CI3 M;  2Z6B A;  4KY5 A;  1F9S A;  4LF8 L;  5DGA A;  3GDE A;  4RCN A;  1I50 B;  1DXM A;  1K1Q A;  5CYU A;  5EKK A;  5JOB A;  4IR1 A;  2R92 A;  1IYU A;  1QOH A;  1AN7 A;  3IKJ A;  3CC7 A;  4HIO A;  4JG2 A;  4JI2 Q;  2DJF C;  2YTV A;  1X3P A;  4DIM A;  1M6V A;  1KUT A;  2EJ0 A;  2BQR A;  5FO7 B;  4Q45 A;  5CM0 A;  4DUY H;  1SMY D;  2O2L D;  2B2Y A;  3U9O A;  2AHO B;  4F4Y A;  1J6Q A;  5EKI A;  2R84 A;  5C4H A;  4RB3 C;  1R9T H;  1JOK A;  5GRO A;  3IRB A;  2FFK B;  3M85 A;  3MEH A;  1SE4 A;  1VQO A;  3GTQ H;  1DCZ A;  5IWA L;  4LF9 Q;  4LFC Q;  3HOW G;  4C5B A;  4HTH A;  3AFQ A;  4DV1 L;  3L9A X;  4P74 A;  4M0J A;  4MTN A;  4A93 G;  4KN4 C;  1HHV A;  2K5D A;  5H1S E;  3KJO A;  2SEB D;  2JEG A;  4DV5 L;  4A3M B;  2UXC H;  3T99 A;  2LFN A;  3L4J A;  2RKS A;  5G3L D;  2HUG A;  5JVL A;  1PFB A;  3BQ0 A;  2QB5 A;  4MV4 A;  3U4Z A;  3OHB A;  1SYF A;  1ZET A;  2JEI A;  4LAA A;  1PFS A;  5I6Y A;  2F0E A;  2VUM B;  2MGS A;  4FBT A;  4MV1 A;  4DRF A;  2OQ0 A;  4G7O C;  4IFD H;  2PQA B;  2JA7 B;  1R4Q B;  1QVG A;  1JOR A;  4R1J A;  4TV8 F;  3I4M B;  5CR5 A;  1I5F A;  4IFD J;  1T9H A;  1N32 L;  1SFO A;  4NXN L;  5K2M A;  2W7O A;  5C3W A;  3M4I A;  2VQF L;  4G3I A;  4J9L A;  5FNV F;  1CKM A;  4C2M H;  2UUC L;  4DUY L;  1CZG A;  3DAA A;  1I94 Q;  1EY6 A;  3ORQ A;  5CV5 A;  3R9R A;  3J7A F;  5DLQ E;  1X3F A;  4X64 Q;  1G2S A;  1I2K A;  1IBK Q;  4DK6 C;  1ZYR D;  4MAM A;  4Q44 A;  5CAE B;  1G8Z D;  1TWF H;  1HTL D;  1STB A;  2ZT9 C;  4QJF A;  1JDB B;  4P72 A;  3NWT A;  1VQG A;  2MP1 A;  3JZ6 A;  4ECQ A;  5JUM A;  2C2E A;  3PV0 A;  4DL2 A;  4NLG A;  4NMZ A;  1TR5 A;  1BCP F;  4DNR B;  1XMO L;  1JT8 A;  3BA8 A;  1Y1V A;  4POF A;  2PPB C;  1KD1 C;  3Q22 A;  4DV0 Q;  2E2H A;  4YHH H;  1T5X D;  3HRZ C;  1I4H A;  3EIV A;  5IP9 H;  3A74 A;  3J80 L;  2LMC B;  3P20 A;  1PTO D;  1LUZ A;  4LF6 L;  3RGX A;  4ECX A;  1EEF D;  5IY0 A;  3F2B A;  5CB4 F;  3CKI B;  2ZXO A;  4RU9 A;  2MCT A;  4JI5 L;  2NVY H;  4LMQ D;  2Q8R E;  5C4J H;  4WJ4 A;  2I46 A;  4IUR A;  1XMQ H;  2NVX B;  4O3R A;  1PXU A;  1IBL Q;  2FKL A;  4O1N A;  2WAQ A;  2CNU A;  1NBW A;  4DR4 Q;  3Q0A A;  5KFQ A;  3VDY A;  3D31 A;  3V2T A;  4X3K A;  2ZTD A;  4CDC C;  4FXD A;  2V59 A;  4QGU A;  1V1P A;  4FFM A;  3EBE A;  3UE1 A;  3DMU A;  4UP7 A;  1J8I A;  1S03 G;  4DL6 A;  2RHS B;  1TKW B;  4DK1 A;  2N88 A;  1BXR A;  2Z6K A;  5KFK A;  2A68 D;  1OXU A;  2X6G A;  1RYS A;  3DWP A;  4WFN 3;  3A8J E;  2JYO A;  2ZDQ A;  3OWE B;  5DIS C;  2KVM A;  4IUU A;  1SYC A;  4NDX A;  4LF5 Q;  1N33 L;  3I4N B;  2G9D A;  3IFT A;  2E2I B;  3BVM A;  4F7X A;  5CV9 A;  3OSN A;  4DR1 H;  3KHR A;  2VXW A;  5CA1 F;  1SYG A;  2Q2H A;  4X65 L;  4Q8F A;  1BF4 A;  4B3M H;  2ZXP A;  4RKL A;  3GIJ A;  1VQI A;  4M1U B;  2I5H A;  4RKB A;  5GAG C;  1K83 H;  1SEB D;  1VMC A;  2JQO A;  2AMC B;  2KEN A;  3BZC A;  4XXE A;  1BXT A;  4AQY H;  4HCE A;  3U54 A;  3GTL B;  4N8X 1;  4EGV A;  2UUA Q;  1B8A A;  3TZD A;  3T56 B;  3PW4 A;  4NKL A;  2F0Q A;  3IAY A;  3TW7 A;  1BUV T;  2C28 A;  2K03 A;  4DV1 H;  2B2U C;  3GTL A;  5EPK A;  4R8U A;  1E24 A;  1I4X A;  3GIM A;  1Q3L A;  2MNA A;  1VMP A;  4NXM H;  3TW6 A;  1GUN A;  3G6E A;  2HIX A;  2ZGI A;  1TAE A;  3HG9 A;  1UC8 A;  4A4I A;  3TY5 A;  4IWX A;  1Y1W B;  4E6I A;  4EEQ A;  1CUK A;  4J0M A;  2J7Z A;  5GON F;  3CCE A;  1XMQ Q;  1RJQ A;  3I73 A;  4ED6 A;  1D5X C;  5KFY A;  2R93 G;  1EU3 A;  2NN6 H;  1Z7T A;  3R2I A;  5E25 A;  1YNX A;  3PUV A;  3AU7 A;  4PG3 A;  2W8L A;  3E5S A;  1LYL A;  1C48 A;  1EEI D;  4FS1 A;  2C5C A;  4ME6 A;  5JEA J;  2WDT A;  2F0V A;  1UC9 A;  3BG3 A;  1Z9F A;  1Y1W H;  2V4R A;  4DV7 Q;  1PTO F;  3S15 H;  2KBN A;  2J6U A;  4YR2 A;  4P75 A;  4KKS A;  1DON A;  3TS2 A;  2VOB A;  2X6L A;  3PVX A;  3SK6 A;  4HNV A;  1GGO A;  2XGP A;  3DLL A;  1EWH A;  3VR5 A;  5L1K A;  1O7Z A;  2RDG A;  2A73 B;  4A3L G;  1EZ8 A;  3GTM A;  1QZH A;  2EQS A;  1VQ8 A;  5C3X A;  3KUP A;  4DAV A;  1DAA A;  2CH4 A;  4LF9 L;  2F0O A;  2CZG A;  4LFC L;  2YZG A;  4X62 H;  4DR5 Q;  3HS0 C;  5LYJ F;  2JA9 A;  5GAH C;  4DV1 Q;  1TWC B;  4A3B H;  2SNS A;  3OTO Q;  1MGS A;  4X64 H;  3DUZ A;  2FMC A;  2NWG A;  5DQG A;  5LMN H;  4IO9 A;  3OIP A;  2JP1 A;  4DV5 Q;  1QJO A;  1J5E H;  1AUV A;  4B3S Q;  3PIP A;  3JAM E;  1PH1 A;  4UHV A;  2F0D A;  4C3I H;  1X3G A;  3H09 A;  1JJ2 A;  2QK4 A;  1WTV A;  2W57 A;  5IGF A;  2I0Q A;  3EYY A;  1GXD C;  2F0G A;  5BMV F;  3NBH B;  3KF8 A;  4O7T A;  1NSN S;  4O86 A;  1EUC B;  2DAB A;  3EVQ A;  1A0G A;  1X3Q A;  3BDL A;  4DR7 H;  3HOY H;  1IL8 A;  2MJ8 A;  3AMU A;  4BWG B;  1M8A A;  3T9F A;  2XGT A;  1L0Y B;  5M5W H;  5GAE C;  2E2H H;  1K8O A;  3KDF A;  1XDN A;  4DUY Q;  4TUY F;  1PTO C;  2RCN A;  2NU6 B;  3TQ1 A;  4N9P A;  5AJ3 L;  1ML0 D;  5JPM C;  4X66 Q;  3RAQ A;  3NSW A;  2YRX A;  3GP7 A;  2PNR C;  1AUX A;  2DIK A;  2OTL A;  5F2D A;  4DR2 L;  5DAA A;  5I5V A;  2O5I C;  1P8L A;  2HG8 A;  1QG7 A;  2R7N A;  4ZUI A;  5DGH A;  5E3F A;  4CKB A;  3V96 A;  1EFI D;  1SND A;  5LL6 b;  2XN9 C;  1C9O A;  4RGM A;  1PX2 A;  3HB9 A;  3LWE A;  3PF4 A;  2FK3 A;  2J6T A;  2WAQ B;  2R7F A;  4A3D G;  3I55 A;  2K7V A;  4AH6 A;  1XPR A;  3T4A C;  1I2L A;  2B2T A;  4ABN A;  4O4H F;  1V43 A;  4GKJ Q;  2R7K A;  3I3C A;  2JA8 G;  4LF6 Q;  4JI2 H;  3T51 B;  3RZD B;  3HO8 A;  4DL5 A;  1SE3 A;  1HR0 Q;  5K36 G;  4YJ3 F;  3J81 W;  4XYQ A;  2K05 A;  1B9N A;  3ONA B;  4A3C H;  3GIQ A;  1EY4 A;  4ECS A;  4YBZ B;  4A3G B;  5D3I B;  4AYB B;  4HED A;  4KK7 A;  1EUJ A;  1PVO A;  2OCE A;  1ULZ A;  4LH7 A;  5I5S A;  3N6X A;  1GO3 E;  5BR8 Q;  1KIX A;  1R4P B;  3TY8 A;  3T16 A;  4JI4 Q;  5ELO A;  5IP7 G;  1Z2O X;  4XYO A;  5IYD H;  4IWY A;  2E2I A;  3PO2 G;  1FGU A;  4LUV A;  3UI2 A;  4JI3 L;  4ZK9 B;  3Q23 A;  2VA3 A;  2F0K A;  2NVQ H;  4BWS C;  3KAK A;  1JXL A;  2DNC A;  3Q24 A;  1ASZ A;  1HNZ H;  4WHX A;  3C1E A;  5HGT A;  1EQT A;  2JA7 H;  1B3Q A;  1U9R A;  3HOX G;  4HJ8 A;  2E2I H;  2BR0 A;  1Y1W G;  1GUG A;  2R7M A;  4DV2 Q;  3E9H A;  1II3 A;  1B9M A;  2GN5 A;  4YIJ A;  2FLL A;  5DG8 A;  1Q90 A;  3OW7 A;  1STA A;  5FPO A;  2IPK D;  3GTM B;  3WNZ A;  4KD3 A;  3GV3 A;  3T1H L;  3HOU H;  1HA6 A;  2RGV A;  2DY7 A;  1BJT A;  4EBE A;  3SK4 A;  1GVP A;  3JRX A;  1Q1E A;  1SXT A;  3LNN A;  3LP8 A;  2R93 H;  3N8D A;  1N34 H;  1GYF A;  2JSO A;  5DNF A;  3UDI A;  4LF5 L;  1ZEQ X;  1GHK A;  3VA7 A;  3CCL A;  1CKN A;  1BVS A;  1A8V A;  1RDP D;  1L2Z A;  2PZT A;  4A3J B;  5CA0 F;  2JA7 A;  1IYJ B;  1GHJ A;  3J80 c;  2EYM A;  1MBY A;  1Q1B A;  3MXG A;  2NVT H;  4JUZ A;  4IAJ A;  4X65 Q;  3IN5 A;  4ZAI A;  2R85 A;  5J3B A;  4O2B F;  1FJG H;  4G7Z C;  1E2Z A;  1S5E D;  4DU9 A;  2I5L X;  2KCT A;  3SNO A;  4K2K A;  3RV3 A;  3BA9 A;  1VQM A;  3K7U C;  2XWJ B;  5IGC A;  4Q4D A;  5D14 A;  2F03 A;  4L5R C;  4IOA A;  4UDU C;  4Y7N H;  1KT8 A;  2FK2 A;  4EEY A;  1MZB A;  1CA5 A;  1PFN A;  2YZN A;  5LA6 F;  4DAA A;  5T1G A;  1CS0 A;  3PQI A;  2JEF A;  5G3L F;  5M3F G;  1HQR D;  3RFC A;  1YNJ C;  2HVR A;  2IX0 A;  2L12 A;  1ESR A;  1EYZ A;  2HD3 A;  1OXV A;  2E5L Q;  4V19 0;  3H15 A;  4V0B A;  1X55 A;  4B3T Q;  5JAV A;  2R3Z A;  3A8K E;  5BR8 H;  3LUL A;  4C1N K;  2HDL A;  3HFZ B;  1BNC A;  2MQH A;  5K3W A;  2EYO A;  2HIV A;  2DLN A;  1ONL A;  2I07 B;  1ET0 A;  1D6E C;  1EU4 A;  1AW7 A;  4O4L F;  1L1O B;  3G6X A;  2ATW A;  2QF7 A;  5FR9 A;  4Z9C B;  4J9R A;  2R86 A;  1TXY A;  1TWH B;  5COY A;  1UNS A;  1TWG H;  4KMU C;  4HJA A;  3TQY A;  4DPG A;  2RF4 A;  5KRU A;  5KNC A;  1CHP D;  2UU9 L;  3GIL A;  5DGI A;  3HXL A;  3KRE A;  1FJG L;  4KTA A;  2RSO A;  4C3H G;  3E6Z X;  4JI0 L;  3A54 A;  4A3K G;  5E4X A;  1VKZ A;  2COJ A;  2EY1 A;  1SMX A;  5CV6 A;  3OOC A;  5FPR A;  4BBS G;  1LAB A;  4L8J A;  4IFD G;  3BVZ A;  3L0O A;  3LML A;  1QNU A;  2EVB A;  2WB1 E;  1MI2 A;  5JJZ A;  2YWV A;  3MHB A;  3T9B A;  4JOI A;  4DR5 L;  1JWM D;  2YV5 A;  4GNX A;  5T14 A;  4UP8 A;  3PZP A;  1TS5 A;  3SR1 A;  3N40 P;  3OTO L;  4KD4 A;  4FU0 A;  1KRT A;  5KGU A;  1ASY A;  2WB1 A;  3GTP H;  4KY7 A;  3TRZ A;  5M3F H;  1OTC A;  2H5X A;  4B9X A;  2N55 A;  5KG3 A;  4J9P A;  4HSV A;  2VQF Q;  3S1R B;  3RBE A;  1HNZ Q;  2CW7 A;  1RKN A;  2ZTE A;  3I7F A;  2DN8 A;  1WCM A;  1I94 L;  1DV1 A;  4C3J B;  2FIN B;  1TY0 A;  2WAC A;  2EPB A;  3L4K A;  2Z4H A;  4JC0 A;  3I4N H;  3K7A B;  2JA8 H;  2PZW A;  3MC0 B;  4LFA L;  3KHG A;  4MTK A;  4EFB A;  1MHW C;  5DM7 3;  2YTX A;  5EWE A;  1S97 A;  1XNR L;  5FLX L;  3NK9 A;  2XGQ A;  1O80 A;  1NY4 A;  2AGP A;  1E22 A;  5KFD A;  1PZK D;  1M90 C;  2L0C A;  4KHV A;  3MWY W;  1JLL B;  4R8U B;  1I4Q A;  4JI6 H;  2H4O A;  2FB9 A;  4TSS A;  4DV0 L;  1A9X A;  1N8R C;  4DXG A;  2J9G A;  4C3J G;  1IHZ A;  4Q0F A;  3I4L A;  4IPD A;  2NU9 B;  3VMM A;  3KAL A;  1ZQ7 A;  4EQO A;  1ZKO A;  3TS0 A;  4IZ8 A;  5D3D A;  3DM1 A;  4JI5 Q;  3VYT A;  1ENF A;  1N34 L;  2B2W A;  4IPG A;  2MPM A;  1YI2 A;  4GS3 A;  4ULL A;  3RZO H;  4BY7 H;  4DV5 H;  2YZM A;  2XIW A;  1KL9 A;  1V1O A;  5LMN W;  2FJZ A;  1PH3 A;  2XVS A;  1DD2 A;  2YW2 A;  2HHF B;  4DNI A;  4DV6 L;  2DPI A;  1TS2 A;  3RB0 A;  1E3P A;  1SDF A;  3RN2 A;  1UE7 A;  5FO9 B;  4C3H H;  3P1H A;  1IKL A;  1IBL L;  4J9S A;  1BDO A;  1FR3 A;  1SYD A;  3KLS A;  4FNF A;  3GJX B;  2UXD H;  1KJQ A;  3K81 C;  3N43 B;  4KJN A;  1SFO H;  5CE8 A;  4RWS C;  3JAM i;  3WDN A;  4NZM A;  4K0K H;  2NUC A;  3EN2 A;  3BQ2 A;  4O7W A;  2D0O A;  4JI5 H;  4A76 A;  1LT3 D;  1TVX A;  4EGJ A;  3T7A A;  1TWF B;  2CWP A;  4Y52 H;  1D7Q A;  4HQ6 A;  1M4V A;  5HBR B;  2F52 A;  3GV7 B;  1HZB A;  5C4X H;  2NZH A;  2QA4 A;  1CKN B;  2PBZ A;  1HJP A;  4A2B A;  4EGQ A;  4O84 A;  1TY2 A;  3QO2 A;  3R23 A;  1QVC A;  3I4O A;  3D4D A;  5KX5 F;  1K3B C;  4FS2 A;  1V4Y A;  4UY8 C;  3GTG A;  3JAM W;  4JI8 H;  1E1O A;  3N41 B;  2V4Q A;  3EPG A;  3FKI H;  4DLK A;  4EYI B;  4HJ5 A;  2EYP A;  1C30 A;  2PQE A;  1ET6 A;  2CH4 W;  5JJK A;  3D4R A;  4DV2 L;  4QWC A;  4TKO B;  5C0X H;  3D4W A;  1LTL A;  1AZQ A;  2WAQ E;  1E1T A;  3KFU A;  2UUB H;  1RCV D;  2EJM A;  4XQN A;  1KAW A;  1WTP A;  5J39 A;  5I5X A;  3H0G B;  4ED7 A;  3HOW B;  4JBJ A;  2UUA L;  4YHH L;  4O3N A;  3K80 C;  5AFW A;  4UCV A;  1A2T A;  1I3Q A;  1F9R A;  2JA8 B;  4CC6 A;  4OX9 Q;  2EJ3 A;  5FLX W;  1CQI B;  2QDL A;  2XC9 A;  4GN4 B;  4MTD A;  4Y7N B;  4O83 A;  2XNA C;  4NXN H;  4AYB E;  1E4E A;  3FDT A;  2K5Q A;  1LTG D;  3AYH B;  1A6X A;  4B08 A;  1PK8 A;  4L63 B;  2RQX A;  1XMQ L;  3NTH A;  1BCP B;  3URY A;  3QWU A;  3U0G A;  1EHI A;  3RD4 A;  2ES2 A;  3RLN A;  1IL2 A;  3NE5 B;  1V9P A;  3F2U A;  2BDN A;  3P7J A;  3X3M A;  3SI8 A;  4O7L A;  2KEE A;  3I4M G;  1CKO A;  2FHT A;  1NJI C;  3MZ5 A;  1QZG A;  4ED2 A;  3D0F A;  2AUJ D;  3OPO A;  4DV7 L;  4XQJ A;  1ZHQ A;  1F9Q A;  2E5L L;  3VPB A;  4OWX B;  4PDB A;  1Z6H A;  2FE3 A;  3EJI A;  2ZJR A;  4YCW A;  4HR7 B;  1Z47 A;  1D5M C;  1C4Q A;  5BYB A;  2R6G A;  2BH2 A;  2XRS D;  1U4M A;  5ISR A;  2K5V A;  2NTS A;  2A5H A;  4HR7 A;  5IIF A;  4IJL A;  2HDM A;  5IYZ F;  2IT1 A;  2XTI A;  4IQZ A;  1EUD B;  2BQ3 A;  1N32 H;  1IYV A;  3DHQ A;  5GQO A;  1QCB D;  3LQS A;  2JA6 G;  3S1M H;  4OXP A;  3K5L A;  2WB1 B;  2BDO A;  2UU9 Q;  1NTG A;  5HNE A;  1UNN C;  4JI6 L;  3VOT A;  1FJG Q;  4UCS A;  2HHF A;  1PMR A;  2OH2 A;  4IOC A;  3FKI G;  4AQY L;  5ELF A;  4JI0 Q;  5KFS A;  4IPC A;  3PO2 H;  4LJZ C;  3VYS A;  3TDQ A;  1DYQ A;  4B3S L;  3DEO A;  2VNU D;  1A2U A;  1Y8P B;  1NR4 A;  4PZ7 A;  2VPQ A;  3S1N B;  1SNP A;  2NVQ B;  1A3G A;  5CV7 A;  3BJY A;  4A3D B;  4JYA L;  1DZ1 A;  2M00 A;  1WOC A;  2KJX A;  4X62 L;  4LFB L;  4NZO A;  4F4Z A;  2E2J H;  4LF9 H;  2W6P A;  2WIN B;  2E5L H;  5IT9 E;  1TWA B;  4JCV E;  5JVG 3;  3UFX B;  1Q81 C;  2B63 A;  1NAP A;  3TSS A;  1HH2 P;  4J9Q A;  5C0X J;  2UXC Q;  5I5T A;  3TBI B;  2L4N A;  4O4J F;  3VPD A;  3VR3 A;  2OT2 A;  5BPF A;  1OXT A;  1E4F T;  1YZ6 A;  1PH4 A;  4EQ5 A;  1TT2 A;  1H95 A;  4ECT A;  4O3P A;  2B2U A;  1L1O C;  3S15 B;  3BYY B;  4R9W A;  4LFA Q;  2B2V A;  2R8I A;  3G6J B;  2OWO A;  5M5X H;  1RK6 A;  2JA6 A;  4DR2 Q;  2YL2 A;  1EKF A;  3S1Q H;  3UYY A;  4O0A A;  2DNE A;  2ASB A;  3K58 A;  1Q7Y C;  2JA6 B;  2L1B A;  2Y0S B;  3S1Q B;  3RF2 A;  1DJR D;  1KTA A;  3I90 A;  4EBC A;  3ULP A;  2WB1 G;  5D1P A;  5BN3 A;  3ULL A;  4GN5 A;  1KC8 C;  3RV4 A;  4GKJ L;  1LTI D;  3CCV A;  3N42 B;  1H9K A;  3GTO B;  3TZU A;  4EQN A;  4C2M B;  3QZ7 A;  4TVI A;  5IOD A;  1GSH A;  2UVV A;  4IJH A;  1HCZ A;  4IPH A;  1U5K A;  2VW9 A;  1GSA A;  1WVL A;  3TP6 A;  1HR0 L;  3G71 A;  1I1L A;  5IP7 H;  5GAD C;  2WKD A;  1N34 Q;  1G6Z A;  3Q1K A;  4O2A F;  3GV8 B;  2JA5 H;  5JPN C;  3RB6 A;  1B44 D;  4EQP A;  2R8H A;  3K5I A;  5C6A A;  4GOP B;  1DOM A;  3V4Z A;  3T9E A;  4K5V A;  2GQR A;  3K3V A;  3WO0 A;  4JI4 L;  1PZJ D;  4BBS H;  1EIH A;  2V5A A;  4BY1 B;  4CMD A;  2NVY A;  4ECV A;  4O3Q A;  4X66 H;  3HOV G;  3H40 A;  2RGR A;  3M9N B;  4XYL B;  2K14 A;  4H0L C;  1CFM A;  1ESF A;  3LX0 A;  4MV7 A;  1ZYR C;  5EBD A;  4LF4 L;  3J7Y W;  4DL4 A;  1EKV A;  1VQH A;  3OWF A;  2QKI C;  3U50 C;  1O7L A;  1A48 A;  1K8A C;  2A6E D;  1RTN A;  4YQW A;  3RUP A;  3Q8R B;  1X56 A;  2F0F A;  3P75 A;  4LWC A;  5KFP A;  4ZYS A;  2FPP B;  3H4B A;  1I3Q B;  2IL8 A;  3MXP A;  3T1H Q;  1PDQ A;  1PYW D;  1D1I A;  3K6O A;  4XIG S;  2I87 A;  1S0N A;  3H91 A;  3H0G G;  3CC4 A;  4QIW E;  2PVP A;  5DGB A;  2YU9 A;  4OIJ A;  1Q8K A;  3UE0 A;  2WV6 D;  2ASJ A;  2W9B B;  2B2Y C;  3TEH B;  1C0A A;  3AQQ A;  1S4Z A;  5IOC A;  2CHB D;  1KJ9 A;  1XXG A;  2HQE A;  2UXB L;  3SK8 A;  2CQA A;  1EYC A;  3PW0 A;  2UVU A;  5EJW A;  3PR4 A;  1VBG A;  4MN3 A;  2R92 G;  1R9T B;  2RDJ A;  1H9R A;  4OX9 L;  4K14 A;  1HQM C;  4ALP A;  3A5Z B;  4C1N I;  2CW0 D;  4RAU C;  4XDX A;  2B63 H;  2BA0 A;  3H3V I;  3TQT A;  4DV3 H;  3DEP A;  4ZKB B;  1SN8 A;  2EXZ A;  3D3R A;  3VYU A;  3H94 A;  5CBE E;  4GKK Q;  2AGO A;  2HCI A;  2CQY A;  4B3T L;  5I60 A;  3GIP A;  4RFB A;  4DAP A;  4M7E A;  3S14 H;  5BWT A;  4LFC H;  1SNO A;  4OWT B;  5CBA E;  1EZ6 A;  1FYC A;  5L1I A;  5IGG A;  4A3M H;  1JCK B;  1VQE A;  4WOR A;  4HJ9 A;  3MXN A;  3S1R H;  3HOU G;  2F4V L;  3PSI A;  2FXQ A;  3ZYY X;  3CCS A;  4XYM B;  3JRW A;  1ET9 A;  1H9S B;  4JPB W;  3PO3 G;  2CKZ B;  1PRT F;  3SXH A;  1YHA A;  4JV1 A;  1S3O A;  2VUM A;  3CP0 A;  2GPW A;  2IMW P;  1ROD A;  4DXF A;  1KEE A;  1VQN A;  2ASL A;  3RZO B;  3TIG A;  3Q8P B;  3NTI A;  4O7V A;  2CNQ A;  2EYJ A;  3S16 H;  2HHH L;  4QCL A;  4MV8 A;  4A3I H;  1T94 A;  1W6J A;  4K6L A;  3RLO A;  4IUV A;  3AEV A;  4HJ7 A;  1RHP A;  5M9O A;  3W2D A;  3MFH A;  3VA5 A;  1N56 A;  1TWA A;  2F0T A;  4QUC A;  3L2P A;  3T53 B;  4A3B G;  1TWF A;  1WTX A;  3NGD A;  2A6E C;  3AB9 A;  3NEN A;  2NVX H;  4KKT A;  4FDB A;  5C4X G;  1HA5 A;  5K36 H;  4IRD A;  4KHP H;  1UAP A;  1CSP A;  2A74 C;  4ILW A;  2JA5 G;  3G8C A;  3A56 A;  3UDX A;  2EIY A;  3BJU A;  1EZ1 A;  1HNZ L;  2HT1 A;  3PUY A;  3KLW A;  1OWT A;  1U4R A;  3W5O A;  3AX6 A;  1VQK A;  1V1Q A;  2ZJQ A;  5C3E H;  1PH6 A;  4LF7 Q;  3K0X A;  5FK9 C;  5KG5 A;  4JBM A;  1IZ6 A;  3TII A;  1WTR A;  4B9W A;  4A3M G;  4JYA Q;  2HGW A;  3BDC A;  4DAY B;  3Q2O A;  4H02 A;  4X62 Q;  1JJC B;  1VDZ A;  5IGE A;  3MWD A;  1XNR Q;  3GTG H;  1WD1 A;  3M3Y B;  3GTK B;  4ED3 A;  1KJ8 A;  2E75 C;  3TEK A;  5EPL A;  2YU9 H;  2UXC L;  2YZL A;  3VNN A;  1YNJ D;  3OYY A;  1UE5 A;  3TN2 A;  4GLW A;  4DNT B;  4BBS B;  3SVM A;  4WD3 A;  5DEH A;  1PH7 A;  3C0F B;  4CDD C;  4JV0 A;  2GQS A;  4JW0 A;  3S17 B;  1JIH A;  1RJT A;  4DAM A;  5J22 A;  4EX5 A;  3EPI A;  3VPC A;  4JI0 H;  3U58 A;  1C7Y A;  3AFP A;  4CMF A;  2VPS A;  1O7Y A;  2PW7 A;  3BU2 A;  4F8M A;  4I50 F;  2IHF A;  4DV6 Q;  1BGW A;  1WTO A;  5H80 A;  1HZC A;  1V51 A;  2R6F A;  3TY9 A;  3OW2 A;  1G29 1;  2VUM G;  3BAA A;  4DV0 H;  2OF1 A;  3GQB A;  4WJW A;  5LMU H;  3MR6 A;  2JE6 I;  1C8C A;  4K2L A;  4DR3 H;  1Q86 C;  4A3F B;  3RZD H;  4ZI7 F;  2SOB A;  1W2B A;  2ID0 A;  1Q8I A;  5C44 G;  1AZP A;  2KED A;  4K6N A;  1D1K A;  2QDB A;  4OEM B;  1HFG A;  1B1Z A;  4L5Q A;  4CJ2 C;  2FPG B;  2M05 A;  4ED0 A;  2K04 A;  4FFO A;  1CT1 D;  5DLF A;  1KNE A;  4O3S A;  4DV6 H;  1X65 A;  3C46 A;  5E1F A;  2JEJ A;  1SR3 A;  2QW7 A;  3BYT B;  5KFW A;  1FKA H;  2MO1 A;  3OSO A;  1PHJ A;  4YB8 B;  2I80 A;  2XCA A;  2B2V C;  2PQA A;  1K83 A;  5HY6 A;  4EFE A;  1YNN C;  4QIW B;  3QG1 A;  1VCI A;  1QVF A;  2CW0 C;  3DXJ C;  2ICE C;  2EDG A;  4ZRZ A;  2F0L A;  2HCC A;  4J9N A;  2Y0S E;  4EG0 A;  4QIW A;  2HGX A;  4LW1 A;  1STY A;  1IXR A;  2W6M A;  4HN7 A;  4LMY A;  4CDF C;  1JWU D;  5FJ8 H;  4BY7 G;  5LL6 S;  1G2T A;  2F1M A;  4YHH Q;  4CHT B;  1SFO B;  3T9A A;  4DR5 H;  3H6M A;  1SCU B;  3J7Z C;  4OL7 A;  1CQJ B;  4DR6 H;  1KJJ A;  4GLA C;  3BAC A;  5KT4 A;  1LT5 D;  4C3H B;  3M9O B;  2OTJ A;  2SNM A;  3H3V H;  2P5Z X;  1JIC A;  2L15 A;  3BZK A;  3QWN A;  3PO3 H;  1LTS D;  1WSC A;  2UXB Q;  1U4P A;  3MEF A;  3N6R A;  5KT2 A;  2RDH A;  1Z2P X;  2W9C B;  2BE5 C;  3A7A B;  1T3N A;  1KRS A;  1Q82 C;  2ODT X;  3I70 A;  5DAU A;  4GOP C;  1A3T A;  1HNW L;  3GLK A;  2A68 C;  3HOX B;  1B70 B;  3NEM A;  3VR2 A;  5LXT F;  4JI7 L;  3C3L A;  1P16 A;  1HPC A;  4RNN A;  2ALY B;  5IT9 c;  1YBY A;  1XK5 A;  4DAY A;  3T1Y L;  1TWH H;  4QSH A;  2PO4 A;  4KHP L;  5KFB A;  4J1M A;  4P2C B;  4DR1 L;  2KOL A;  4POG A;  3FPU B;  5FO8 B;  5C4J B;  1TS3 A;  3E9I A;  3GTP B;  1FNW A;  4GKK L;  5KT3 A;  5KFX A;  2NVX A;  2JXM B;  3TRE A;  1STG A;  3PW7 A;  5D8D A;  4GC6 A;  4OIK A;  1S68 A;  3M4Y A;  5DG7 A;  3TIN A;  3GTO A;  4QQB X;  2B3G A;  2YS7 A;  3LWB A;  3HOV H;  2JK8 A;  1O75 A;  2F4V Q;  3JSL A;  4ED8 A;  2J4X A;  4IRK A;  1TS4 A;  3K8A A;  2VA2 A;  1YIT A;  1F2Z A;  1JWS D;  3K0Y A;  4YY3 Q;  4DUZ H;  4H13 C;  2KUM A;  2D5D A;  4QWA A;  4JI6 Q;  2GPS A;  1NE3 A;  1WYD A;  4XTC S;  1UE6 A;  4AQY Q;  1S5C D;  4JBW A;  4A3J G;  2G5D A;  1S9F A;  3M4P A;  4S3S A;  3M3Y H;  4A3K H;  4RAY A;  3OUZ A;  1A3V A;  2BA1 A;  1EWI A;  2JEB I;  5KNB A;  3CF5 A;  2F0N A;  1YHQ A;  1BOS A;  3KK7 A;  2HHH Q;  3RGZ A;  5FLX E;  3J81 c;  4K0K L;  5KFE A;  5KFL A;  3HOX H;  4BXX H;  2K32 A;  3QFF A;  5M3M H;  2PW5 A;  3S2D B;  3GTQ B;  4I4T F;  4HMJ A;  3TME A;  3V6J A;  4CJ0 B;  2V58 A;  3MTS A;  4HMI A;  3GTO H;  1TU2 B;  5IYB G;  3CMA A;  4IHJ F;  3QZ8 A;  4PBC A;  3K5H A;  4LFB Q;  1MD2 D;  3A7L A;  2ALZ A;  1WJJ A;  2QEX A;  3GTQ A;  4CKE A;  2UXD Q;  1YJW A;  3R93 A;  5HGQ A;  2KEC A;  4IIJ F;  1K8M A;  1I6V C;  5I6W A;  5KFM A;  3V05 A;  4IUN A;  3HOY B;  1Y8O B;  4LUZ A;  2R7Z B;  4YWK A;  3GV5 B;  2GVA A;  3D8G A;  1PH2 A;  3CC2 A;  3ETH A;  3KTM A;  1EYA A;  2J6S A;  1I50 H;  2W6N A;  4A75 A;  1WTW A;  3BVG A;  5EZY F;  3M4O H;  4JBK A;  1PTO B;  4DV4 Q;  2RSN A;  4O81 A;  1DOK A;  4KY6 A;  3S14 B;  1GKH A;  3F8N A;  4KLK A;  5T1I A;  4TQR A;  1EIF A;  2Q2U A;  2Z02 A;  1I50 A;  1BR9 A;  2A6H D;  2SDF A;  5C5J A;  1WCM G;  3NUC A;  3CME A;  1NMG A;  1BCP D;  3NPP A;  4U6P A;  4ODG A;  4AYB A;  1EY0 A;  4APV A;  5FJ8 G;  5CC4 A;  2LKV A;  5ELD A;  5C5L A;  3FDS A;  1K1S A;  3E3X A;  1SSO A;  1ENA A;  1AFP A;  4OHJ A;  1E7Z A;  1IYE A;  3MR3 A;  4DL3 A;  4Q43 A;  1WRV A;  2VQF H;  1OXS C;  3ORR A;  5KFT A;  1SEI A;  3N52 A;  2UUC H;  1QUQ A;  2DGY A;  2XRQ D;  2L5T A;  2CVR A;  4ZUJ A;  2VQD A;  4FGR A;  5J2T F;  4DKA C;  3JAM c;  1FVI A;  3PUW A;  4KV6 A;  4O7S A;  1S5B D;  4UCT A;  1HNX Q;  4KN7 C;  1JOO A;  3VR4 A;  5KFV A;  4ECY A;  2A69 C;  3MXU A;  1LTA D;  3HKZ A;  3OUU A;  2F0H A;  3EA6 A;  5COR A;  4QWB A;  4OON A;  4EVO A;  5EDW A;  5ELN A;  4LF4 Q;  1HNW H;  2K28 A;  3HKZ B;  2E8G A;  5KG7 A;  4LSA A;  4IFD I;  2SCU B;  3CSW A;  5HV6 A;  3STB D;  1JJG A;  1C3O A;  4UP9 A;  5BWR A;  4ECZ A;  2JEA I;  2IJ0 A;  2RA4 A;  1OO9 B;  3RB3 A;  4ZKC B;  4DV4 H;  2NYZ D;  5FLM G;  2OXP A;  5IGB A;  1EL0 A;  3BS1 A;  3CQZ A;  5L37 A;  4CBV A;  5KFI A;  3GO5 A;  1KAB A;  5IP9 G;  3W3A A;  2C2R A;  2KHI A;  4RNO A;  4YR3 A;  1BO0 A;  4F50 A;  1LO5 D;  3ETJ A;  3WOE A;  5EWG A;  2L9H A;  1L0W A;  4A93 H;  2XCL A;  4MA0 A;  3K5O A;  5CMD A;  4LF4 H;  2ZM6 H;  1VQ4 A;  4MV3 A;  1VF5 C;  3CHB D;  3O13 A;  4K8J A;  4O3O A;  3T9D A;  1TWA H;  5LOV F;  5ELB A;  1JC7 A;  4HIM A;  3WWJ A;  1EY8 A;  2N8N A;  5KFA A;  5KFG A;  1WTH A;  2W71 A;  4UUG A;  3UDG A;  5M3M B;  3J81 L;  1HR0 W;  3FKI B;  4WJ3 M;  3M4O B;  2VUG A;  4GNX C;  1Y1V B;  5ELE A;  2RBM A;  3I12 A;  3GTP A;  1LV9 A;  4MHE A;  2RHQ B;  4P73 A;  3GTK A;  2V4D A;  5EKL A;  2N49 A;  3NQI A;  1TWG B;  3SDZ A;  4I7A A;  1N9W A;  2F0W A;  2IHE A;  4FXK C;  4IUQ A;  5IYB H;  1LT6 D;  4I65 A;  2R82 A;  3V4S A;  3CD6 A;  4GLV B;  4CJ1 B;  2GA4 B;  3G8D A;  1KAA A;  2L55 A;  1AN8 A;  2E76 C;  1VQJ A;  4MV6 A;  2K1B A;  2YCH A;  5KT7 A;  1VBH A;  1K73 C;  4PZ6 A;  4JI7 Q;  1HTP A;  1IKM A;  4B3M L;  4R4O A;  2F0S A;  3T1Y Q;  4O4I F;  5KT5 A;  3C2P A;  4BA1 I;  3S2D H;  3PUX A;  1KJI A;  4LK1 C;  2BCO A;  1WI5 A;  4GLX A;  4TQS A;  5ELC A;  3BQ1 A;  2LSS A;  3PF5 A;  5KFF A;  1EY9 A;  4A3I G;  1IOV A;  1SJH D;  3RIZ A;  4JVZ A;  4IR9 A;  2R7D A;  4RH6 A;  4A3F G;  4A3C G;  3I56 A;  4XZ3 B;  2FP4 B;  3T5H A;  3GTK H;  4A2A A;  3PR5 B;  3H20 A;  4RZQ A;  2F3V A;  3M7N A;  2A69 D;  4IZO A;  1EKP A;  4DK3 C;  3WWH A;  1F2L A;  2WFW A;  1U4L A;  5C44 H;  1KDA A;  3BG5 A;  2C22 A;  2EYL A;  1K8G A;  1I6H H;  1TA8 A;  4IRC A;  1IYD A;  1QWY A;  4PZ8 A;  4E4T A;  2R7Z A;  5LL6 X;  5I9P A;  4RUA A;  3Q8D A;  3HKZ E;  4UFZ A;  3FP9 A;  3SE0 A;  1STE A;  1LAC A;  1K83 B;  1Y1V G;  5CV4 A;  1WTQ A;  4RGN A;  1XPO A;  2F0I A;  4PNY A;  3HOU B;  5IE8 A;  4ZOL F;  5I2X A;  4ED1 A;  2R7Z H;  3GV6 A;  4LF7 L;  2VL6 A;  4XQQ A;  2NB0 A;  4TQU S;  3MAQ A;  3GTJ H;  4CKC A;  1O7I A;  3RBD A;  5CGK A;  3BAB A;  4GKJ H;  2DZD A;  2A1A A;  1JX4 A;  1UEA B;  3C1F A;  3MA2 B;  1K0S A;  2FMM A;  3FRP B;  2R93 A;  1B33 N;  4C3I B;  1QNK A;  2EOT A;  1GD7 A;  5BN4 A;  2UUB Q;  1QIL A;  3KJP A;  1XPU A;  3NC0 B;  4CC5 A;  4X6A H;  4DV4 L;  4C2M A;  1RK5 A;  3GD7 A;  5M5X B;  3F2C A;  3R3O A;  2EYF A;  3QR8 A;  5EGT A;  3D6C A;  2FLP A;  1D5Z C;  4J9K A;  3HT5 A;  3FKI A;  3L3O C;  4AYB G;  3J80 i;  4BBR B;  1CHQ D;  5C5M A;  4B3R L;  1MIU A;  3MFY A;  4M8A A;  1EFW A;  4GOP A;  3UQ8 A;  3NQT A;  4KKU A;  4DV3 L;  3W1G A;  1HRJ A;  1I94 H;  5LMN Q;  3K59 A;  1BNZ A;  4F4W A;  5JVD F;  2YRW A;  1AH9 A;  5L1J A;  1WR2 A;  4BS9 A;  1YVC A;  3K5M A;  4NXM L;  1UE1 A;  4Y8V B;  1PRT C;  3T9C A;  1E0B A;  2W6O A;  1TWH A;  2B2T C;  2VB3 X;  2WAQ G;  4DL7 A;  3NP8 A;  2IP4 A;  4H7B A;  2OLS A;  1PRT D;  1HZ9 A;  2B29 A;  2D0P A;  5KND A;  3UDF A;  1TWC A;  3GII A;  5KKN B;  2EZV A;  2KA7 A;  1N36 H;  3R5H A;  3IG0 A;  5M3M G;  1U0L A;  4O7R A;  1MKH A;  2C2D A;  5E7N A;  2VR1 A;  1RD9 D;  1SYX B;  2B8G A;  2YTY A;  4LSX A;  2VQE H;  5KT6 A;  2KCC A;  2FJ2 A;  5CV8 A;  2VB2 X;  2X69 A;  2W9B A;  1RF2 D;  2K6A A;  5C1O A;  3HGB A;  3KDF B;  3NBH A;  4Q8E A;  3KF8 B;  1WCM B;  1AEX A;  2R87 A;  4UCO A;  3KF6 A;  1B50 A;  3H4D A;  4XT3 B;  4FFN A;  3T5J A;  3D6W A;  2E74 C;  2CNV A;  1IBL H;  1NCV A;  2W6Z A;  1N36 Q;  1GJX A;  1DOL A;  4XT1 B;  2ABJ A;  4FM9 A;  1DGS A;  3AW8 A;  3CCQ A;  1W93 A;  2WE6 A;  2P0A A;  1TWG A;  2KQ3 A;  1R9T A;  3R5F A;  2PYK A;  4FFL A;  1LLR D;  5LHY 1;  1FGB D;  3W1B A;  1G91 A;  3CPF A;  1H9M A;  1KDB A;  2F4V H;  1SYE A;  1B7Y B;  4LH6 A;  4DR4 H;  4K8I A;  4ID6 A;  1GM5 A;  5JQG F;  5FD6 A;  2I5M X;  4DR7 Q;  1T36 A;  4EBD A;  5EAY A;  2M2L A;  1HNW Q;  1EIY B;  5L1L A;  5E4W C;  1PV4 A;  2WYO A;  2B2W C;  2R92 H;  1OBD A;  5KFN A;  3OHA A;  3X3N A;  2N3S A;  1EQQ A;  1PH8 A;  3KXY T;  1FL0 A;  1NMF A;  1QB5 D;  2FMA A;  1HZA A;  3MXN B;  3J81 i;  4DR6 L;  1ZXT A;  4QMG A;  2Y4R A;  4KHP Q;  3G7L A;  1AE2 A;  2F3I A;  3FMA A;  4DR1 Q;  3KLR A;  2PMZ B;  3PMF A;  1H9S A;  3E0J A;  4IN3 A;  4N8F A;  5TSS A;  2IX3 A;  4LF5 H;  1D2B A;  4TM5 A;  4LF7 H;  4YJ2 F;  1F2Y A;  1LTT D;  1OXX K;  4A3G H;  2FPI B;  4QW8 A;  3RN5 A;  5BPH A;  4DQN A;  5J1Z A;  2R7L A;  4CGY B;  4B3M Q;  3BZD B;  2QCP X;  4K5X A;  4C56 C;  4FBU A;  4PV1 C;  5BWV A;  4YY3 L;  3FHW A;  2A1H A;  1Y69 U;  1A62 A;  2IA6 A;  4NW2 A;  3RTX A;  2Y0S G;  3KBG A;  2NTT A;  3WWI A;  2EJ2 A;  4NYE A;  2C35 B;  4NPS A;  1YHB A;  3I4M H;  2O03 A;  2HQL A;  4GKK H;  4NB3 A;  3QIA A;  3ITP A;  1ENC A;  5KFO A;  2FLN A;  2IBK A;  3PIO 3;  1X9N A;  2J0T D;  2C9O A;  3IL8 A;  3K57 A;  4RAZ A;  5F9N A;  4F4X A;  1ILQ A;  2AQ3 B;  5IWA H;  2Q8I B;  3RMH A;  3G6Y A;  3KOJ A;  4K0K Q;  5DG9 A;  1ICF B;  5C4Z A;  1I4R A;  2EIF A;  2XWB B;  4JOI C;  2K33 A;  5KYL A;  4Q0Y A;  1A3U A;  1PYB A;  5LP6 F;  1CE8 A;  2EXD A;  1KLG D;  4DUZ L;  5I5U A;  5K5P A;  3S1N H;  1TWC H;  1KXL A;  3GTG B;  2EY2 A;  1A63 A;  4B3R H;  1I4P A;  4HIK A;  3NWS A;  2UXD L;  1EYD A;  1MSG A;  1PLF A;  2ZDH A;  4C5A A;  1VQP A;  3HOV B;  5C1P A;  3NEL A;  1STH A;  1RJP A;  5BYA A;  1L2F A;  2DPJ A;  5BN5 A;  2WII B;  3HOW H;  3N44 B;  3KLS X;  4J9O A;  3QQM A;  4QY7 A;  3ERO A;  4YCU A;  3SEB A;  3A8I E;  3VR6 A;  3RNU A;  5BWX A;  2NZ1 D;  3MWM A;  3KF6 B;  3GQC A;  1CQV A;  3NTK A;  4YP3 A;  3T13 A;  1HXY D;  3RUZ A;  4HID A;  2XCP A;  5LMU L;  1E4E B;  5KFJ A;  3CPW A;  4ME3 A;  3HOZ G;  4RHR A;  4JI8 L;  3PFF A;  2E2H B;  3Q8S B;  3J80 W;  1L1O A;  3Q6S A;  2VQE L;  1M0W A;  3PW2 A;  2Z9H A;  2AKW B;  1SE8 A;  1LTR D;  4R7R A;  4MZ9 A;  3ICE A;  2QYZ A;  3A5U A;  1SNC A;  2UUB L;  1JDE A;  4JV5 Q;  4FYD A;  4BXX G;  3OMG A;  3G48 A;  1RYR A;  2ZJT A;  4F87 A;  5KG1 A;  3F2D A;  1G2W A;  1JB7 A;  1F9P A;  1XMO H;  4G4K A;  2Q8T A;  5D65 A;  3S17 H;  5IGD A;  2HVQ A;  4JI7 H;  4R4Q A;  4KHZ A;  4ZQ3 A;  3HKS A;  3FPP A;  1WFQ A;  4X3T A;  3T1Y H;  4BA2 I;  1S5D D;  4B3R Q;  2Z04 A;  4LFA H;  3UZB A;  1A15 A;  4YCV A;  5I4D A;  4DV3 Q;  1HNX L;  1W3S A;  3HBL A;  2KSW A;  1PFM A;  1PTO H;  2WP8 J;  3H3V C;  4OWW B;  3ND8 A;  3S9W A;  2ATL A;  1F77 A;  4LUO A;  4L5T A;  2F0P A;  4JK1 C;  4PMW A;  4HCS A;  5FLM H;  3DWQ A;  5A2Q L;  4RB2 C;  1Q46 A;  2AWN A;  1MSH A;  4R4C A;  4C3I G;  4A3E B;  1IBM L;  4IUP A;  4J8Q A;  4O42 A;  3MJF A;  4J9M A;  1IOW A;  4XX0 B;  1WH2 A;  1LTB D;  1BKB A;  4ETS A;  4HSP A;  2N78 A;  3WOF A;  1WCM H;  4JI1 L;  3CU7 A;  3GTJ A;  2CQO A;  2DJG C;  4FVM A;  1B04 A;  5J2U F;  3PO3 B;  2NUA B;  3GTJ B;  3J7A 5;  5M5Y B;  1HR0 H;  4A3E H;  1SJE D;  2VZA A;  3EFX D;  1XJV A;  1DV2 A;  2IW3 A;  3CAM A;  1SE2 A;  2IWH A;  4J6H A;  2NN6 I;  4FO2 A;  2E2J B;  5EWF A;  1KBL A;  3BDO A;  2R8K A;  4YY3 H;  4DR3 Q;