4O84A

Saicar synthetase (type-1) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o84A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o84A02
1OBGA 1Q8WA 4O0XA 2VR1A 4IEBA 1URWA 4BBEA 3BHHA 3QHRA 5M09A 3OCSA 4EH9A 5IQGA 4X0MA 3UOHA 4G16A 1RE8A 4IW0A 1M17A 5CAPA 3BWJA 4YZMA 3PSBA 3HB9A 3FAAA 4EYMA 3VBWA 5KX8A 2VX1A 3ZS5A 1OZ1A 3ENHA 4UY9A 1YXUA 5HVKA 4RZVA 2A0CX 1FPUA 3G6HA 3ORTA 4FTAA 3RPYA 4CCBA 2HZ0A 1U54B 5GINE 3MY0A 5CSPA 4Y72A 3O23A 4QYHA 2XK9A 3DGKA 4BCIA 3NZ0A 2CGXA 5IEYA 1H8FA 4GT4A 2Y0AA 2X7GA 4EOQA 4PMTA 4E4MA 2E9OA 4FTUA 1OKWA 2GQSA 2OLSA 3SOAA 2PULA 4U80A 2QCSA 3AC3A 3E5AA 3NUUA 3OEFX 4FG7A 4GK2A 4HGLA 4AOTA 1C3OA 3PVUA 4GK3A 2I80A 1YI3A 2LGCA 2VX3A 3GP0A 3RALA 3TJDA 2CZGA 3UG1A 5CAUA 3V4SA 3DZQA 4WNOA 4EH8A 1ZY5A 3UG2A 4DEIA 2Y7JA 3CTQA 3O0GA 3IQ7A 4EHEA 5KE0A 3CE3A 2I8CA 2YAAA 2H6DA 3R7YA 4DBXA 1Z2OX 4EJ7A 5LXTF 1OPLA 3FKNA 4FFLA 4YUQA 2PTKA 4C0TA 2R7MA 4I41A 4C61A 2PUUA 5CEKA 2XMYA 4DITA 4FIFA 4O4IF 1U5RA 2OFVA 5IYZF 3P79A 4P4CA 5FQDC 3VUIA 1YW2A 3FL4A 3O2MA 4BIEA 4E93A 3PY3A 1P14A 2O65A 4UWBA 1JDEA 3MPAA 3UMXA 2YISA 2ERZE 2V7AA 2ITOA 3KXGA 4IIRA 3R8UA 2FPGB 2JDRA 2PUNA 4BI1A 4C4HA 3FXZA 5H3QA 4FSNA 3VAPA 3QWKA 4XV2A 4HCUA 1OB3A 2J0MB 4FTKA 3DOGA 3EMGA 3LFCA 4YJSA 2NU6B 1H27A 5CT0A 3FLQA 4I6HA 2C0TA 4E5AX 3ATSA 1NY3A 1MP8A 3DB6A 4AW5A 3VUKA 1E4EA 3U4UA 2W1ZA 1KJ8A 2QURA 2CCIA 4RX7A 2OW3A 5ACBC 5L2IA 5DRBA 1OKZA 2X1NA 2OSCA 4W4VA 4Z9LA 3FXWA 3ORZA 5TT7A 4YAKB 4Y73A 4AT3A 4M7IA 3Q6UA 2WOTA 1CSNA 5I9YA 4JL9A 3HAVA 3MSSA 3R73A 3E62A 2WU7A 5FTQA 4AOIA 4EQCA 4L1KA 4QOXA 2CMWA 5FP6A 3TZ7A 3FMJA 3BIZA 2QOHA 5IQAA 3AMBA 3F82A 5DPVA 1KJJA 4XNEA 2XJ2A 1ZYDA 4ZY5A 2NPQA 2VPQA 2YN8A 5G1XA 5J9YA 4MNEB 5KNJA 5DT4A 3L9NA 2YIYA 1YWVA 4X6RA 4FK6A 1WMKA 3GENA 5FEEA 5IDPA 1EZ1A 5DMXA 3MESA 3F7ZA 5JRQA 2PL0A 4RX5A 4FVQA 4V0GB 4L3PA 1KE7A 4Y5HA 5AP1A 5AV2A 3R83A 4P90A 4Y83A 2GQRA 2VV9A 2FYSA 3DV3A 3OW4A 4S30A 3L9LA 3EQDA 5AA9A 3D14A 4EBVA 2Z60A 5EDRA 2RG6A 4F09A 1W83A 5CX9A 2OJIA 4Y8DA 1Q4LA 4OTWA 3RTPA 2C00A 5JVLA 4YAJB 4QMZA 5M56A 4JAIA 4QQJA 3RMFA 1UNLA 3E93A 3FLWA 4C3FA 4NKSA 3C4EA 4J7BA 1V0BA 1WCCA 4TYHB 4XYFA 4R7BA 1IR3A 4AFJA 1REJA 5LCJA 3QA0A 4HCVA 2Y4PA 1APME 3TIGA 4O4HF 2XUUA 1M14A 1Y57A 3HRCA 3BYUA 2UW7A 5DWRA 1BL7A 3HDMA 2B7AA 1H25A 4NKAA 2Y6MA 4L6QA 3F69A 4L45A 3ZXTA 4RVMA 1GOLA 3G9LX 3OUKA 5M44A 2F9GA 2NU9B 4HNIA 2C6TA 1XHAA 4WUAA 3LFDA 3VS2A 1WVWA 5H2UA 4M14A 4LM5A 3PVGA 3SC1A 3V5PA 4UX9A 3MPMA 3POZA 3DCVA 2VWUA 5C1OA 2C5OA 1Q61A 3UODA 3ZCLA 3QQKA 3GIDA 3GFEA 5JGAA 1IOWA 3TW6A 3EB0A 3WBLA 2QKWB 4JG8A 4ZSEA 2QLUA 2QNJA 4BYJA 5HNBA 5HX8A 4RLKA 3F6XA 3OZ6A 4YHFA 2H96A 4FL3A 5D7VA 4DTBA 4ID7A 3QLFA 3W1FA 2NRYA 2R3OA 1WVXA 3NUYA 1B6CB 5EQPA 4DN5A 3ULZA 3LP8A 1JVPP 4YMJA 5HI2A 4FGBA 3KGAA 3PDTA 2YEXA 4G3FA 3NNVA 4RFMA 4USFA 2F7ZE 5I9XA 3AD5A 4RWIA 3THBA 3P23A 2IVUA 2WMRA 3KY2A 4FIJA 5AX9A 2UZDA 5CI6A 2QR7A 3QC9A 2JAMA 2XIZA 1ULZA 3TI1A 3OWPA 1FVVA 3GBZA 2CPKE 4AE9A 3FZSA 2Y6OA 4TV8F 3GC9A 4FGRA 4V04A 4ZJJA 1W93A 5CU4A 2A19B 2GPSA 3OXIA 1UKIA 4FI1A 4EH4A 1Q41A 2RKUA 3FYJX 3VOTA 2YM7A 4OW8A 4ERKA 2QOCA 3LXLA 4IFCA 4IAYA 4FX3A 4ASEA 4C36A 5AV4A 2QI8A 3MVJA 4GU6A 5AMNA 5IQBA 4KBAA 3U9CA 4HGTA 2E9VA 4YJQA 3V3VA 3MH0A 4I92A 3K2LA 4QP1A 5JQ5A 2W6MA 2VRXA 3MH1A 3M11A 3RWQA 1Y91A 3FLZA 3K3JA 2PN1A 4FSTA 5CNOA 5DGZA 4HVIA 4IC7A 3SV0A 1KUTA 4XOYA 3QUDA 4RIXB 1UKHA 3OVVA 5CU6A 2WMAA 4DGMA 4AZVA 2QU6A 3PXQA 3KVXA 2J2IB 2H8HA 2UW5A 2WO6A 4HNFA 3R2YA 4MXAA 3WO0A 3LMGA 3TIZA 4IHPA 5IDNA 3AC4A 5CTPA 3PY0A 3OG7A 1KJQA 2HW6A 2XRUA 2PPQA 3DBFA 2WMSA 3L9MA 4LUEA 4QYGA 2IZSA 3TZ9A 3ZUVA 4CFMA 4KS8A 4G9RA 1OIRA 1JKLA 2C6KA 2OG8A 3G0FA 4IE9A 3WIGA 4DLKA 3U55A 1J7UA 3OBGA 4CFFA 2P2IA 2HZ4A 1CMKE 3SXSA 4AOJA 5K5XA 4J96A 3RCDA 2DWCA 4QPSA 2YERA 5EW3A 2UZWE 3OROA 5CS6A 3SRVA 4FKVA 2YDKA 2BCJA 3KQ7A 5C1QB 4YNOA 2VTRA 4HJOA 1UU8A 3KMMA 4AQCA 3HUBA 2BPMA 3DKOA 4IX4A 4NYEA 2P3GX 3SX9A 3OD6X 2FPIB 4I5PA 4MAOA 2YCSA 4RRVA 3VUGA 4M8TA 3CGOA 4OBQA 4QYYA 5CU2A 5IQCA 4ZJIA 1B6RA 2WMBA 3D7ZA 1H0WA 3LE6A 1BYGA 5HKMA 4AXAA 2CGUA 3C4ZA 5IMXA 2WTJA 4S32A 3DK7A 2WGJA 1L8TA 5DA3A 4EQMA 2DQ7X 4LQMA 2IVSA 3WYYA 4M68A 2W6PA 1ND4A 4ITJA 4KKGA 3NS9A 3TTJA 4QMYA 2P2HA 2PUIA 4L42A 1JOWB 1YDTE 4O81A 3TDVA 2QOBA 4FSWA 4Z16A 3UNJA 5IISA 4DCEA 4IMYA 4FYNA 3UOJA 4J1RA 1OIUA 3HMIA 2VTJA 3L8VA 3CS9A 2JIUA 2B9HA 2JKOA 3DDPA 1PRYA 4IJPA 4FIEA 3VF8A 3AC1A 3ZM4A 3AX6A 5BNJA 2Y8OA 3FHIA 5GJGA 2GNLA 4EOKA 3UGCA 4FSYA 4XP3A 4QO9A 5HIBA 5D41A 4ALVA 4EEVA 4L44A 4FYOA 4LGGA 4BBMA 3RV4A 3DBCA 4TYGA 4G3DA 4G6NA 1WFCA 3BU5A 3ZDIA 5EKNA 1H0VA 4C02A 4BY9E 3DTWA 2W71A 3MJFA 3SQQA 4R3RA 4GCJA 3ELJA 4ACGA 5LOHA 5E1SA 5LP6F 5CXHA 4DEGA 3EQGA 3QL8A 3NUNA 5HORA 4HCTA 1U59A 2UZLA 3SG8A 4JXFA 4C4IA 4CLJA 2O64A 4FZAB 4RC4A 4HQ6A 3W8QA 3FL5A 2ETRA 1R0PA 1GZNA 2ZDTA 2PBZA 2FVDA 5IA2A 4B99A 4ZTLA 4AN2A 4BDDA 4FR4A 4E4LA 3T3VA 5EYDA 1AQ1A 2BIKB 4LMUA 2I1MA 2PZ5A 2PE2A 3EFWA 2GMXA 5FLFA 3I7BA 5AAFA 3KCFA 4FV8A 3KK9A 4R3PA 2ACXA 3R8MA 4H39A 5DBXA 5BVFA 2OO8X 4BRXA 3KFAA 2J51A 4CTBA 1ZMVA 4DGNA 2BTSA 2W9ZB 3ETAA 1J91A 1QMZA 3NEWA 1ZZ2A 2ZV7A 3WF7A 1GSHA 4MYGA 4GU9A 3E7VA 4XLVA 1DI8A 1FBNA 2EWAA 2PVRA 3NYVA 2ZB0A 5GJFA 3VS3A 2HIWA 3N51A 4AU8A 1XH6A 4CRSA 3EQHA 3OXZA 2QG7A 3LCSA 4U5JA 4FEXA 3PXKA 5AAGA 4TWCA 2HZNA 1G8SA 4PMMA 3R63A 3GU6A 2J9MA 1UV5A 4LI5A 5HLWA 4DE4A 2PSQA 3Q4ZA 2XKFA 3G6GA 4GT5A 5GONF 2C6MA 2G2FA 3RAIA 2BHHA 1JSVA 4YO4A 3Q04A 4GJ2A 3BV3A 5KKRB 4NIFB 3Q60A 4JLCA 3PG3A 5AP5A 4F9CA 2IZTA 3QFVA 3P08A 1PXNA 3MJ1A 4KRDA 3CIKA 2QF7A 3SW4A 1GIIA 4A07A 4RQVA 1OPJA 4HNTA 5L6OA 3N8DA 2R86A 4YTCA 5M08A 3JZFA 3BE2A 4PRJA 3MGYA 2GTMA 3RPSA 2IZRA 5LVLA 5BVOA 2FH9A 2QLQA 3F2RA 1PXMA 3HYHA 2GNGA 3W2CA 4ANBA 5LVOA 3COIA 5DEYA 5E8SA 4FT9A 3LWBA 3WILA 4CNHA 4YLKA 4IM0A 4BTJA 5L6PA 1TQMA 2QOOA 4L01A 2ONLA 5IQFA 2XCHA 3ENMA 2XZSA 4GKHA 3QCXA 3Q1KA 1VJYA 3FI4A 1Q8TA 2WELA 4U41A 2GQGA 4GKIA 4CFVA 2XD4A 2PZYA 1NT2A 4F08A 2P4IA 1YQJA 2X4FA 3E8DA 5DFPA 4ZLYA 1Q97A 3CR0A 2KULA 4UALA 2HJWA 4AF3A 4RJ4A 1K9AA 4C4JA 4DGOA 2WZJA 4R7IA 2C5YA 3OTUA 3MIAA 3ZO1A 1XH8A 2QO9A 3FLNC 5AX3A 3U8WA 2NU8B 4GUBA 1WBOA 2ZB1A 5KMKA 4ALUA 3UPZA 4OT6A 5L6WL 3WZDA 3MVHA 4BZDA 3UPXA 2QD9A 4AFEA 4JIAA 3I6WA 3MJ2A 4JG6A 4DTKA 5HNGA 4FFOA 4FKWA 5ANIA 3DT1A 3N4UA 1REKA 2PMNX 3G0EA 4EOMA 3QZGA 2RIOA 3LFFA 4G1WA 3ORMA 1OL6A 4DAWA 3GQLA 2QQ7A 2GFSA 4XV3A 2ZM3A 2FB9A 2XCKA 4BCMA 2OKRA 2PMLX 4M15A 4IACA 2EB2A 4CSVA 1HCKA 1JSTA 3FQEA 5ANJA 1M52A 2OIBA 4EYJA 3RM7A 4IANA 3L8XA 4DEBA 4N6YA 2C5VA 3RVGA 4A9RA 2OXDA 4I21A 5IUHA 5HTBA 1H1SA 3DJ5A 4IX6A 3NVMB 4FICA 4IZ7A 2FSMX 3JPVA 4PWNA 3RPOA 3C7QA 4IM2A 5IQHA 2JGZA 3GU8A 3F3TA 5HNIX 5BVDA 4G31A 2JFLA 3HECA 3OCBA 4RWLA 3TG1A 3NCGA 4U0IA 4NM5A 3RPVA 5KX5F 5FXQA 4YC8A 5DRDA 4FKRA 3U87A 3C0IA 4IB0A 4YC3A 4O7SA 1YVJA 2A1AB 2J6MA 2YACA 3G9NA 4K9YA 3NDMA 4LRMA 5L8KA 3BGPA 3NYNA 3R6XA 3GU7A 2J5EA 2YHVA 3ALOA 3NIEA 4X3JA 5LMBA 1PMVA 3QKLA 4L3JA 2XK3A 1Q24A 3Q4TA 2XK7A 3FMDA 4DFUA 3WNZA 2NUAB 4PP9A 4WG5A 3FMEA 4ZAUA 4NJ3A 4YJNA 4D9TA 5F20A 4O0SA 3DF7A 2Y9QA 3IS5A 3ZSIA 3R5FA 4YBKA 4D4RA 5E9EA 3DA6A 3LLAA 3R8LA 4FKIA 4K33A 4FV5A 4F6UA 3BRBA 2HXLA 3U51A 3EL8A 2BROA 1EUCB 2YCQA 4NFMA 1IAHA 3V8WA 4BCNA 4BKJA 4TNDA 4OBOA 3P9JA 4E5WA 4H3PA 1XH9A 1JQHA 4XZ3B 1WBVA 2XM9A 5BVEA 3TZ8A 4G17A 4GVJA 4FT5A 3QKMA 3WZJA 4EONA 4EKLA 4L9IA 5CAOA 3LW0A 1OECA 4J8MA 1W8CA 4IWPA 5HE2A 3ZO3A 3ZSHA 5K4JA 3KF7A 1PJKA 2ZV2A 1DM2A 1UU9A 3HV7A 4MXOA 4RGJA 4FL1A 3UC4A 5FDPA 5FXRA 4CRLA 2J0JA 4QMSA 4JBQA 3OWJA 5CQWA 3R02A 4KD1A 5CLPA 3UO4A 5C8KA 5JFVA 3RHKA 2R3JA 2AYPA 1QL6A 3F88A 3OWLA 1TKIA 4FBXA 2WAJA 5DVRA 2C47A 2HYYA 4D2RA 2PHKA 1NXKA 4IX5A 4O83A 2W5AA 2FSTX 3CJGA 3CQUA 4ANLA 3ULIA 2H34A 3LXNA 3PWDA 3DXQA 3VQHA 5FNVF 5CY3A 1H01A 4CVAA 5JQWA 3W32A 2GNFA 1MRUA 2Z04A 4CFWA 3QQFA 3FC1X 4ONAA 5AUZA 3A4OX 3CBLA 2BFYA 4IVCA 4FT0A 5M4IA 2XNGA 4ACDA 5LVMA 2I0YA 2R5TA 3TZMA 3MFUA 3L8SA 5KHXA 2VWVA 4WSYA 4IAIA 2XCLA 3LCOA 4FC0A 3W2QA 4CV9A 1NVRA 3OP5A 4FSUA 1W84A 4TN6A 5DEWA 4NTTA 3TN8A 3GFWA 3TV6A 2XH5A 5D8DA 3QZFA 2GS7A 3VWAA 2WYOA 3BV2A 3LM0A 4I5CA 4EQUA 1U54A 4XV1A 5H8EA 1FINA 4DF3A 5GNKA 2WQOA 4EH5A 4I5HA 5I9WA 4OLIA 4G3GA 4RIWA 3KRWA 2XVDA 3AQVA 1IA8A 2JITA 2X9EA 1ZOGA 3C9WA 2Z7SA 3F3ZA 3LFAA 3QTUA 4FK3A 3PRFA 5E91A 3S3IA 4AT5A 4H1JA 5AV0A 3ZONA 1LPUA 3CC6A 3R8PA 3EL7A 2C0OA 1KJIA 4IZOA 4RSSA 3FYKX 1OM1A 4IB1A 2XIKA 4G3EA 5CEQA 5I9UA 2ONLC 2WMWA 1LEZA 3E8CA 3PJ3A 4U97A 3LZBA 4F1TA 5DR2A 3BU6A 2RG5A 4K77A 2F7EE 4R1YA 1M2PA 4HZRA 4MH7A 3U4WA 3CP9A 3D0EA 5HLPA 4ARKA 3R22A 4BDEA 2VQDA 1IAJA 2ZAZA 4I0RA 4Y5QA 2DIKA 4RT7A 3OC1A 3QLGA 3FZOA 5J9LA 2GNJA 1MQBA 2C6DA 5DE2A 3COHA 1YHWA 2XYNA 3BG5A 1ZWSA 3UIMA 3DY7A 5G6VA 3U9NA 4B9DA 2OIDA 1VEBA 2V59A 4OTDA 3ET7A 1E9HA 2GCDA 5FXSA 2FGIA 3ZRKA 4BDKA 3PE2A 3QTIA 3UQCA 1OMWA 4PQNA 5AM6A 4C5AA 4UXQA 3PFQA 4BCPA 1H28A 3QD4A 4X2FA 3DQXA 2YRXA 4LV5A 4GEOA 2ZDHA 4YZ9A 1KE9A 5M07A 3D83A 3TTIA 2YZGA 2QHMA 4LV8A 5J1WA 5CSWA 3D5XA 4QMQA 3H9FA 5KKNB 4LOPA 4FMQA 3ACKA 4JIKA 3KULA 5BUEA 3D7TA 2PWLA 2HOGA 3LJ2A 2I0VA 4FNZA 4IQ6A 5JZNA 4DTAA 4FEQA 4EWHA 4A9TA 3CPBA 4I55F 5M06A 2J0LA 3FEGA 4GS6A 3I81A 2HCKA 4P5QA 4WRGA 2C4GA 4HNUA 1JPAA 1ZYSA 1QPDA 4C58A 1K2PA 2R0UA 3EN5A 2C3LA 4MXXA 5CENA 5CZHA 3ZC6A 4AUAA 1EUDB 4DEEA 1F0QA 1R1WA 2CKOA 3K5VA 4JRVA 3EKKA 4Q5HA 5JSMA 1BXRA 2WQEA 1R3CA 4JBOA 4B8LA 4ZOLF 4MKCA 3FDNA 3PPKA 4UWCA 4AA5A 3FZ1A 4GFOA 2GU8A 3ZM9A 3R23A 3RAHA 3NUPA 3TIIA 2J0IA 3P0MA 4O38A 3PG1A 4GT3A 3QQLA 3EQRA 4G5JA 3VRZA 3TNIA 2WTCA 3QUPA 1PYEA 2ZM1A 3QTRA 5CWZA 3ZZEA 3WF6A 3B2TA 3ZLSA 2ZMCA 2PE0A 2VO6A 3F5XA 4O7NA 2ETKA 3QRTA 4FG8A 3GXLA 4L7SA 5EM7A 3T9TA 1P5EA 2X8DA 4IIJF 5ANDA 2BUJA 4EOIA 4AW2A 5HO8A 3PXRA 3Q2OA 2FSLX 2NU7B 5EHYA 4BIDA 1HCLA 3HZTA 5AA8A 3BBWA 3AT2A 3IGGA 4JDIA 5L8LA 2DZDA 3A7GA 2ZV8A 3HA6A 4MA0A 4QMLA 3UFXB 4J52A 2UVZA 4BI2A 5FEQA 3W2RA 5JFSA 4O6EA 3HV6A 4MV8A 3MBLA 2JBOA 3IONA 3Q4CA 3Q53A 4TYHA 1CDKA 4E4NA 3N4VA 1OL2A 3GU4A 3R1QA 3SD0A 5AADA 5LA6F 3PXFA 3FQHA 4KKHA 3MPTA 4W4XA 4BYIA 5GIOE 1XH7A 1OGUA 2R3PA 4O82A 2BZHB 5JFXA 1O6KA 3JY0A 5DR6A 4YPSA 4CGAA 3ZFXA 3BLRA 3KXHA 5F1ZA 3D94A 1OUYA 3WYXA 3AGMA 3ZZWA 2J9GA 1B38A 2CCHA 3LVPA 1AUXA 2PUPA 2XK8A 4D0WA 2PVYA 2QC6A 4ENYA 4FTCA 1YHVA 3VS0A 5JGDA 2OI4X 3NR9A 3R21A 2AC5A 1UWHA 2PZRA 3MH3A 2ZDUA 3RKBA 1WR2A 3HP5A 3NIZA 4QRCA 3ZO4A 4F6SA 3ID6C 1DIKA 2HWOA 4G9CA 3LHJA 4JQEA 4KBCA 1GJOA 1F3MC 1PXLA 2QKRA 2W96B 3JR1A 4IZAA 2C6LA 4PMSA 3KU2A 3ZUUA 1Q8YA 2O3PA 3EIDA 3I60A 4RWJA 4UZHA 4KA3A 5HZNA 1XBBA 4IWDA 4I6BA 4MAMA 3PXYA 3TUCA 5CF8A 2JDTA 4HGEA 4OR5A 3VS7A 1YHSA 3V8SA 3KXNA 3P1AA 4MV1A 4EH2A 4MWIA 3GC7A 4IZYA 3ORPA 5EM5A 3OFMA 4O0UA 3FMHA 4QP6A 2GS2A 4JI9A 4XV9A 5A4QA 3T9IA 3R01A 5CASA 3UIBA 2WOUA 4EK8A 4IAFA 4XMOA 3CTJA 2PVMA 1GGOA 5IF1A 2C0IA 3FI3A 3MFSA 3PYYA 5BPFA 1PW2A 4PX6A 2XK6A 3LQ3A 5FM3A 5EI6A 2C1AA 3ZC5A 3Q2JA 2VTOA 5D12A 2JDSA 2XNNA 4EL9A 4DH5A 4Q9ZA 1B39A 5FG8A 1RQQA 4M69B 3RPRA 2XNEA 5HESA 2CKPA 4FT7A 2PY3A 2UZEA 2PZPA 4MXZA 5JKGA 3K3PA 2X81A 3MH2A 4AACA 2SCUB 4AZWA 5I0BA 2W70A 4F0IA 3M42A 2YM3A 2R3IA 3F66A 3FI2A 4DFLA 5LVPA 1T45A 4RIXA 4NWMA 1S9IA 4Y85A 1Z2PX 3KAJA 4RBLA 4CMOA 5KMMA 3RI1A 2OU7A 2WMVA 2WIHA 4ZTNA 4EH7A 3QGYA 3DBDA 1XJDA 1Y8YA 5LOVF 3PA5A 2PMIA 4ZY4A 5LCKA 4K0YA 3LFQA 4W4YA 4XG9A 4AE6A 3TCPA 3G15A 3OS3A 1W98A 4DH1A 5B2MA 5A4TA 4YB8B 1PXPA 4AP7A 4EOPA 5E4HA 2WXVA 4NM0A 4GMYA 4L46A 4AS0A 1H1WA 3PP1A 4K11A 5ETAA 4EK6A 1YWNA 4N70A 1JBPE 4DCAA 4EKKA 3TNWA 2XM8A 3A2CA 1WZYA 4APCA 3C50A 4XG8A 5C8NA 4ZTHA 1OL1A 3VMMA 5CYIA 2Z8CA 3LFBA 4WD5A 2QR8A 2A2AA 2F7XE 4BDJA 3DNDA 5M4CA 3OY1A 5BMMA 4KIQA 4WHZA 3TXOA 4ZTRA 1JDBB 4IHJF 3SVVA 3I4BA 3VUDA 4TWOA 2UUEA 3PIXA 2C69A 4F63A 2QVSE 4C37A 4EBWA 3KCKA 4PTEA 1H07A 1H1RA 3DTCA 1RJBA 2VNWA 4GYGA 4FUXA 4CD0A 1FQ1B 2YJSA 4OTIA 2WTKB 2J90A 2B54A 3IGOA 3A8XA 1M2RA 4W4WA 3VBQA 3RGFA 5JMSA 3DKFA 2FPPB 3UZRA 2B4SB 3BLQA 4WBOA 2QODA 2QU5A 5J1VA 3PA4A 3S95A 3GVUA 4PY1A 3BYMA 2YA9A 4O21A 1ZMUA 3QCQA 1FVTA 3DS6A 1R39A 2J0KA 3QTXA 4QYFA 5AP6A 2O2UA 2W7XA 4X6QC 5EH0A 4ASZA 3RK9A 4Z55A 2G1TA 3LOKA 4YTIA 3EN6A 5KBRA 2VGOA 2XA4A 4CTCA 5HE0A 3HO8A 5JK3A 1BL6A 4F7SA 3DZOA 3IKAA 4ITHA 4JX7A 4MWHA 1K3AA 2YIXA 2VWYA 3PPZA 5F94A 2RFSA 1MRVA 5ANGA 5AV3A 5BUIA 5IA1A 4D5HA 4FV1A 3BGZA 3MFTA 3AD6A 2W17A 3PE1A 1YXSA 2YZAA 2ZVAA 4XUFA 4MBJA 1Z5MA 3ZXZA 5KUPA 2GDOA 3JYAA 3QXOA 5CSXA 5M51A 1W96A 1KBLA 1WBPA 4RIYB 2NO3A 2PU8A 3GGFA 3QBNA 4ZEGA 3D9VA 4AGCA 2IP4A 3CGFA 2ZV9A 1IOVA 1Z2NX 4UEUA 4S2ZA 4BZNA 3R9NA 4CG8A 3F7WA 3ORQA 3EYHA 2I87A 4KKEA 4F6WA 4F7JA 5IA3A 4HYIA 1QPEA 3EQFA 2Q0BA 5J87A 2YM6A 3QD2B 3N6RA 2BRNA 2IW6A 2WMQA 3QCSA 4CV8A 2IO6A 4BGQA 4EZ5A 3UE4A 2ITZA 1I09A 4W8DA 4M3QA 3RNIA 3OTVA 5FM2A 2V55A 5CEMA 1LP4A 3KEXA 4EGQA 2B52A 3TNPC 2HK5A 4PMPA 2JDOA 3P7AA 4NSTA 1PXJA 2I40A 3EZVA 3QRJA 5IUIA 4UZDA 4YZCA 3NYXA 3W10A 3VRYA 2BALA 2VTMA 4U79A 3V6RA 4NCTA 3R28A 4HGSA 2R3FA 3FPMA 2SRCA 5TKDA 4DC2A 5EW8A 5BQ0A 2JAVA 2XNBA 4JAJA 2JC6A 4AX8A 3H0YA 4FNXA 3V8TA 1YDSE 3G33A 4DFXE 3QXPA 2XIXA 4YJ2F 3P7BA 2YM4A 2X2LA 4JNWA 3TQTA 3PJ2A 3C0GA 3QKKA 4HPUE 3Q9YA 3A60A 4S34A 3OWKA 4KS7A 4PTCA 4I94A 3JVRA 2XJ0A 4QSHA 4ORKA 5HVJA 5H9BA 5CU0A 4ZI7F 3FWQA 3ZSGA 4F99A 1OPKA 1GAGA 5CF6A 1OIQA 4CKRA 1STCE 3FY2A 3E88A 3TACA 2VWZA 4NH1A 4O91A 1U5QA 4TZRA 3RINA 1W7HA 4BGGA 5A54A 3BQCA 3R8VA 2WQMA 3DLSA 1TQIA 5EOLA 2CNVA 4WT6A 4MVFA 1ZOHA 2FSOX 2IG7A 4KSPA 3UP7A 3NNWA 1DI9A 3O7LB 4LRKA 3Q96A 4OTQA 3PJ1A 1FGKA 4I5MA 4AW0A 2CHLA 5KMNA 5FUTA 3I79A 5GIPE 1M7NA 3PJCA 2QOFA 4FKLA 5BYLA 4D55A 3I1AA 5M4FA 3RJCA 5J9ZA 4M9UA 3QZIA 3V5QA 4TL0A 4XHKB 5A14A 2ITXA 1EH4A 3FZTA 3NRMA 1Q3WA 4FV4A 4X2GA 3VHKA 3BEGA 4C2VA 2AC3A 3A61A 2ITNA 4U40A 4XYLB 4MA5A 5E8TA 5TF9A 3H9RA 4PP7A 2HELA 5EDPA 4LMNA 1E1VA 5AUVA 4KNBA 4XEYA 1VBGA 5J2TF 4XRLA 1P2AA 2OJGA 3B2WA 3FMNA 2GPWA 3S00A 4X3FB 2B9JA 2EVAA 2VTHA 4KIPA 5TO8A 4ZMEA 2X6EA 4Y46A 3QZHA 4GIHA 4J8NA 3MN3A 4UBAA 2P0CA 4X21A 4FKOA 5CXZA 2R7KA 4RJ8A 1PMUA 5EQEA 4FV6A 4ITIA 2X9FA 3FC2A 3JRWA 3FSKA 4X2KA 3IDPA 1E1XA 5E8ZA 3HA8A 4E6DA 3KN5A 4YZDA 3U9TA 5KHWA 2OIQA 5E8WA 4RJ3A 2CLXA 4O84A 2JFMA 3LJ0A 4II5A 2BZJA 3KVWA 2OXYA 4M67A 4AZTA 4Z7HA 1ZARA 1G5SA 1EYZA 2GHGA 1DV2A 4K1BA 2CNQA 4RZQA 2PE1A 4FE2A 2FP4B 2IW8A 5IA4A 2HAKA 5CT7A 1DAYA 3VS1A 3NX8A 2R87A 2P33A 2FB8A 2HXQA 2XYUA 2C68A 3A99A 3KXMA 4PTGA 3R7UA 2JKMA 4BGHA 4KUJA 4BB4A 1KV1A 1Z9XA 4GG7A 4YP8A 4I4EA 3PTGA 2W1FA 4RX8A 4ACMA 3R9OA 4B0GA 1CTPE 4YZNA 3S0OA 2WTIA 2UZOA 3FV8A 4O7RA 4YJPA 1MUOA 4C33A 4L52A 4DH3A 4CKJA 4BCQA 4O0WA 3ZHPC 4WG3A 4U45A 4DEAA 2C6OA 1JAMA 2ERKA 4YO6A 4RC2A 4E26A 3MTFA 5CAVA 5DHJA 2ITWA 4GUEA 4QMOA 1FMOE 3ZEWA 4NFNA 4FEWA 3BELA 3AT3A 4CMUA 3V5TA 4C5CA 1OL5A 3UQGA 3BPRA 3AD4A 3QALE 2PMOX 5EG3A 3ALNA 4CFXA 5LARA 2VO3A 5EHOA 5A6OA 3FE3A 4A4OA 2YDJA 2VX0A 1YXTA 2DLNA 3VN9A 1M7QA 3VA7A 4XG2A 1H1QA 2UZNA 3QUEA 4EK5A 4G3CA 3SKCA 4EHZA 4FFPA 2BFXA 2JBPA 4NM7A 5B0XA 2R64A 5LWNA 3QTWA 3HLLA 4FZ7A 5F9EA 4I22A 4TYEA 4XOZA 2W9FB 3ITZA 5AP4A 1WAKA 3TNHA 3KMUA 3LXPA 3VHEA 3AC5A 1OUKA 4XH6A 4I3ZA 2W1GA 4BF2A 1GNGA 5KO1A 4YJ3F 2IWIA 4C4FA 3ZYAA 3OBJA 4GG5A 4DH8A 3LLTA 3QQHA 4PL4A 4ZP5A 2W06A 5EK7A 4ERWA 1XH5A 3BCEA 4TT7A 3GI3A 3WE8A 3BYVA 3HRFA 3ETHA 3C5IA 3QRUA 3A62A 3RUPA 2V5AA 4YLJA 4EH6A 1PKDA 3LCDA 3QTQA 2HY81 3DNEA 2XF0A 3K5IA 4UN0C 4J53A 4FTMA 4Q9SA 2OJFE 4L67A 3RM6A 2WPAA 1Q8ZA 4XP2A 4YSMA 1M0TA 4H05A 4Z7GA 1NW1A 2WHBA 2W6QA 1H24A 4P2KA 4DLIA 3PIZA 1PKGA 3PWYA 4NCTC 4FIIA 4IFGA 4YJTA 5H8GA 3WF9A 5CEOA 3PVBA 4FVPA 3ZU7A 3WARA 4BHZA 4FTOA 3D2IA 1AD5A 4BC6A 5KZIA 4XCUA 2VZ6A 3MIYA 3W18A 4XX9A 3KC3A 1IASA 5EW9A 1HOWA 2CNUA 3DBQA 4I0TA 5K3YA 4ACCA 4CG9A 3HEGA 2C1BA 4YGAA 3SHEA 3RP9A 4AZSA 5L2TA 1PXOA 3TDWA 4HNVA 3R0TA 2BAKA 3MFRA 4ZTQA 4F65A 2PVNA 5KKRC 4DT9A 3CTHA 4N57A 1ZOEA 2WMTA 1GZKA 2ZDGA 4ASDA 3EN4A 4FFNA 2IJMA 1H08A 3P7CA 2RFEA 4LYNA 5M53A 4PF4A 3EHAA 3UC3A 4EORA 2B53A 2NRUA 3EN7A 4O7ZA 4YBJA 1ZLTA 2Z7QA 3TV4A 1ZXEA 1Q62A 5HE1A 3E92A 4PL5A 3Q2MA 2XBAA 2DUVA 2GFCA 2RFDA 3AC2A 3FKLA 3LAUA 4K8AA 2V7OA 2IW9A 5BPYA 5CF4A 5L3AA 1H26A 3ANRA 2C3KA 3LFEA 4A7CA 1ZY4A 2X8IA 3IK3A 1MQ4A 2XKCA 4N4SA 4O96A 2J5FA 5CALA 3HRBA 1PY5A 5L2WA 2E9PA 2IVVA 5DT3A 2BRMA 4D9UA 3DJ6A 1GZ8A 3Q3BA 4KABA 3SOCA 1SNUA 4TKSA 2YM5A 2YIRA 3IOPA 2FUMA 3TNQB 3R9DA 5FTGA 3HAMA 5CB4F 1GLVA 5EHLA 5AWMA 4U6RA 3UYTA 4EOJA 4YNEA 3ZO2A 4G34A 2C3JA 4ZS4A 5JH7F 4APPA 1UNHA 2O0UA 4XBRA 3ORNA 4TXCA 5IH5A 4O4JF 1A06A 2C5XA 3PXZA 2XB7A 3HX4A 4K6ZA 5JRSA 4DYMA 1I44A 3TKHA 5EI2A 1JLUE 3OHTA 3K54A 1L3RE 2HZIA 5J2UF 1WVYA 3R1SA 2QHNA 3GB2A 2V22A 5C26A 3MY1A 4GV1A 5C4LA 2YZLA 5A9UA 2P55A 3RK7A 4WO5A 5KZ0A 1W0XC 2XJ1A 1T36A 2W1HA 2CN8A 4IZ5A 5IEXA 4JT3A 2ITPA 3G90X 2V62A 3HMNA 4RFZA 4Z3VA 2GSFA 2Y4IB 1J7LA 1JKSA 3FY0A 2CJMA 2WKMA 3KXXA 2UZUE 3AMYA 3H3CA 5BUJA 4ME6A 2W1CA 3VS5A 4TW9A 3E5NA 2YWPA 5J8IA 5LMAA 3ZTXA 3KK8A 2OGVA 3FLSA 5CEIA 1A48A 4MBLA 5ETIA 1R0EA 4F9BA 2OJJA 2OZAA 2CKQA 5E7RA 4OTRA 4J95A 1U46A 3L9PA 4H3BA 3E8NA 5AIKA 3O71A 4BTFA 3RV3A 5D1JA 2R3GA 4Y8VB 4RJ7A 4RX9A 5FEDA 4ZMFA 1GSOA 3ORRA 3W2PA 2J7TA 1Z57A 2R3RA 3WF5A 4MCVA 4NJDA 4RMZA 2ESMA 4C5BA 4FTQA 1DS5A 3QA8A 1IEPA 1FVRA 2XIYA 4QNYA 3OF0A 4EOSA 1O6LA 4UXLA 5M57A 2W99B 1WBTA 3O8PA 4R5YA 4U42A 2R7NA 3I7CA 4QTCA 1UNGA 1WBWA 3C13A 3PY1A 1J1BA 1H1PA 1KE8A 2ZYBA 5LMKA 3O51A 2G2HA 3MV5A 5HBHA 3K5UA 2X8EA 3PVWA 5FDXA 3C5UA 5AP7A 3UVPA 4HZSA 5AP0A 3IW7A 2X6DA 3NSZA 4FOBA 5DG5A 3UTOA 2VU3A 3NNUA 4DG0E 5L2SA 1Y8GA 4FTJA 5E8VA 4FL2A 4C4GA 4JQ7A 3QTSA 4FG9A 2VWIA 5DN3A 2VAGA 3TV7A 4DHFA 4D2SA 1XR1A 5IA5A 3OOGA 4YHTA 3LJ1A 3SA0A 2R0IA 2X4ZA 3MW1A 2GNIA 1BKXA 3NW7A 4L53A 5ETFA 3UNZA 2RF9A 2GNHA 2OFUA 3DKCA 4FOCA 4QP3A 4TYIA 1T46A 3UOLA 3OMVA 3AMAA 4O0YA 3V51A 4BCGA 2A4LA 3SAYA 3FZPA 4D4YA 5ANEA 5F4NA 4RJ5A 3R7OA 4P5ZA 2F57A 3G8CA 1CKPA 4ZK5A 1GZOA 3MWEA 5AM7A 3ROCA 3TKIA 3V5JA 1GY3A 5K9IA 5EI8A 2XKDA 5CANA 1CKJA 1W82A 3R30A 4U3YA 4FV9A 2G01A 4BHNA 2YFXA 2QK4A 1KJ9A 3IDCA 2I7QA 4DIMA 5FGKA 4IAAA 3BLHA 4RZWA 4XG7A 3ANQA 4O2ZA 4YC6A 5EYKA 1I7NA 4ZY6A 3A8WA 3TJCA 4ASXA 3C1XA 4IB3A 4EHVA 3MB6A 2WNTA 4JDKA 5LXMA 2KTYA 3MA3A 3W55A 4AWIA 4BCOA 2O8YA 2J50A 1SNXA 3HMOA 2CGWA 2IPXA 2ITYA 2VWWA 4IH8A 4RA4A 3CKWA 4TYJA 5CU3A 3UOKA 3WZEA 5FBOA 2X7OA 3FXXA 4WBBB 5HG9A 3FJQE 3NYOA 3KXZA 2BDFA 3LKMA 4JJRA 2IZUA 4PNIA 4WRSA 4YHJA 4RWKA 4MHAA 4MNEA 1YOMA 5BX0A 4TPTA 4FZDB 4I4FA 5E90A 3BEAA 3NWWA 4EUTA 4F70A 4E1ZA 4V0GA 4F64A 1PXKA 2WMUA 5EOBA 3UMWA 4C34A 1YDRE 1VBHA 1CM8A 2WIPA 4F9YA 5IQEA 5M4UA 3ZFMA 3WF8A 5E1EA 2VTIA 3KRLA 2YM8A 1PYXA 2EB3A 4YPDA 4EHGA 5A4LA 3Q52A 2VO0A 3G5DA 3QQGA 3DKGA 1VKZA 2OICA 2PVLA 3QX4A 2G15A 3HMMA 3DBEA 4IX3A 3V04A 4BZOA 1B6SA 4B8MA 4CQEA 3D4QA 4QMNA 4LUDA 5CVFA 3IDBA 1KWPA 2BRGA 2C6EA 4NZWB 1PK8A 4I50F 2BR1A 3IW8A 5A4EA 2W1EA 2W4OA 3TUBA 3COKA 4RIWB 3E8EA 5E92A 3EZRA 3AW8A 1KE6A 3KREA 4XBUA 4YURA 5BYYA 2GLTA 4ZOGA 3IO7A 3RAKA 3D5UA 3HGKA 5HG8A 3ZOSA 4I1ZA 3P5KA 3HUCA 4ZZOA 4BVUA 5EZYF 1SVGA 5LJJA 3W2SA 5B7VA 2BAQA 4MV6A 3A4PA 1ZYJA 4O7YA 4KWPA 2O63A 2W4KA 3MYGA 4YJVA 3VUMA 3F3UA 2G2IA 4F9AA 2UZBA 4FTIA 2BAJA 3BYSA 2OK1A 4NW5A 4RG0A 1KOAA 3C4CA 4BDCA 5I9ZA 3PIYA 1Q3DA 4MV4A 2VO7A 3B8QA 3I5ZA 5DH3A 3KB7A 2PVKA 3PP0A 4E6AA 4ZTMA 4BDAA 3ZLWA 4HYHA 4MD7E 4U43A 5ANOA 5IUGA 3KRJA 4FEVA 4CZTA 2E9UA 2R4BA 4EI4A 3R5XA 4ALWA 3AGLA 3HNGA 4ZTSA 1ERKA 3DFCB 2HW7A 3O96A 4O7TA 3FI8A 3FBVA 5AP2A 4BDHA 5A4CA 1YOLA 5B2KA 3DFAA 2BTRA 2WTVA 4H1MA 1OIYA 3ORKA 2XEYA 2WQNA 3EQBA 2JKQA 2R2PA 4L68A 5A46A 5BMSA 2WFYA 3C0HA 3V4ZA 3M2WA 1XBAA 3RAWA 3WZKA 3BZ3A 1JKTA 3BQRA 1R78A 4KAOA 4O27B 4M84A 4ZQIA 4IVAA 3KULB 2Q0NA 3D7TB 5EM6A 4HYUA 4XRJA 4M12A 5GHVA 4BI0A 1PXIA 1OL7A 4XG4A 3COMA 5HG5A 2QOQA 2Q83A 3D2KA 3DDQA 3CQWA 3LMHA 4GVAA 5D7AA 5JGBA 3R04A 4YJOA 1WBSA 1YI6A 4QQTA 4OTFA 3VC4A 2YYAA 1PF8A 2C3IB 4U8ZA 4E8AA 3KRRA 4FV7A 5A6NA 2C30A 4FSZA 4IVDA 4WUNA 2OF2A 2VTNA 1SMHA 3OXTA 5LMKC 4CEGA 1CS0A 5FD2A 4USEA 2XRWA 4EK4A 5HBEA 2RFNA 5FP5A 4E7WA 3OCGA 3FMKA 4B6LA 1LR4A 4U9AA 4FTLA 3WOWA 3GOKA 5C8MA 4XG3A 3BU3A 4MQ2A 3OUNB 5EDQA 3F9NA 4H36A 1EHIA 3CJFA 4YTFA 4O2AF 5DT0A 3IW5A 3PZHA 5E8UA 2W6ZA 1XBCA 3BHYA 1JKKA 3A7FA 3N4TA 4HYSA 3OUUA 3QCYA 3PLSA 2I6LA 5HGIA 3S2PA 2ZMDA 3LQ5A 3OT3A 4LL0A 4UV0A 3BHVA 4RIYA 4TRLA 4C2WA 4DGLC 4ZLOA 2HGSA 1SCUB 2ITTA 3Q4UA 5IPJA 3PUPA 4A9YA 4FSRA 2WQBA 4TV9F 4FUYA 2WEIA 1MRYA 2IVTA 4LFIA 2DS1A 3R7VA 3CLYA 3VNTA 1NA7A 4ZZNA 5HBRB 2HWPA 3K3IA 4C7TA 4YR8A 1C30A 2R85A 5HCZA 2E2BA 3VO3A 4AGDA 1SYKA 1VYZA 1ZRZA 2R3HA 4GYIA 3EH9A 1YRPA 4DFNA 4JR7A 3GUBA 2R7BA 4AG8A 4TWPA 2YAKA 3NVKI 4CCUA 4QP4A 5C4KA 4O6LA 4R7HA 4AN9A 3DAEA 4GH2A 4R1VA 3C4WA 3JS2A 4I93A 5LWMA 5I5ZA 1YI4A 3GEQA 3KL8A 1IA9A 3VPCA 1YOJA 3FMMA 3E7OA 4NU1A 5IEVA 4BDIA 4DGGA 5ITAA 2R82A 1GSAA 4HVDA 2HY0A 1H00A 4M0ZA 3UO6A 1CQJB 3BBTB 3GU5A 3I5NA 4C3PA 2G9XA 3F2NA 4RJ6A 2X0GA 4XJ0A 5HIDA 4DH7A 1I7LA 2R84A 1O9UA 5GJDA 3MTLA 4RVTA 4YSJA 2I0HA 2OF4A 2H9VA 3EFKA 4CLIA 4C4EA 5C8YF 4GSBA 3T3UA 1E4EB 1QPCA 3E3BX 4BDFA 4BCKA 4AGUA 3H9OA 3W8LA 2REIA 4FKQA 5E8XA 1KV2A 4MQ1A 1A9UA 5BMVF 2YIQA 3QU0A 2XS0A 4JX3A 5AV1A 2RL5A 2GTNA 5CQUA 2NP8A 2UW0A 3HKOA 3PJ8A 1DV1A 3EWHA 4A4LA 3QRIA 2P0AA 3BHTA 1XQZA 3O50A 4D1XA 3HV3A 4O7VA 4MBIA 4WG4A 5AUYA 4F0GA 2Z02A 3NMUF 2WD1A 3R71A 4ACHA 3KMWA 4MK0A 2ZM4A 5T3QA 4C38A 4EGJA 2HENA 5IMEA 3QHWA 3A7HA 3ZH8A 4E20A 4YJRA 5EKOA 5BYZA 4DLJA 4BDBA 4MF1A 2W1DA 1UWJA 5H8BA 4LL5A 4GFGA 3UYSA 4A06A 3ERKA 4WOVA 3AOXA 3MS9A 1JLLB 4O2BF 2ZJWA 3QWJA 3DU8A 4R78A 5CSHA 4EG0A 1FGIA 3EOCA 1YXVA 2V5QA 3IECA 4KBKA 5A3XA 5FRIA 3ACJA 4EZ7A 2J4ZA 3GLKA 4X3FA 4CT1A 2F2UA 2BZIB 2WEVA 4HVHA 3LCTA 4EUUA 3ZMMA 1H4LA 4FKSA 3R9HA 3ZDUA 3QQJA 2LAVA 5KMJA 2F2CB 1NVQA 2XBJA 3CY3A 4IWOA 4D1ZA 2UW4A 2UW3A 4OTGA 3M1SA 4WA9A 3V6SA 4EZ3A 2YZMA 3OT8A 4L43A 2ETMA 5T68A 4BDGA 4I24A 3BI6A 3VULA 2V0DA 3GC8A 2W0JA 2E9NA 3BYOA 4IBMA 4JDJA 4OT5A 1JSUA 5DNRA 4G6LA 1G8AA 3QF9A 4ZLZA 4MV9A 5AP3A 4AAAA 4TNBA 4QMTA 3U9SA 3MY5A 2DWBA 2VN9A 4YLLA 3MVMA 4QMXA 3E3PA 4ZSLA 4M0YA 5HD7A 1J1CA 1J7IA 4FKTA 4F4PA 3HBLA 4J98A 1JWHA 4HVSA 1G3NA 4CFNA 2X2KA 4E6QA 4RA5A 5EM8A 3JZIA 4L00A 5AAEA 4BR3A 2BRBA 2VGPA 3UZPA 3E87A 1LUFA 2OZOA 2JDVA 2R9SA 5IA0A 4QQ5A 2PZIA 3DXNA 3U6HA 2ZOQA 3Q32A 4FFRA 3R7EA 2WTKC 4O7LA 5CEPA 3K5HA 2GHLA 2VTAA 5HHWA 3OEZA 2XEZA 4GJ3A 5ACKA 2YJRA 4ENXA 5JQ8A 2C5NA 4UYNA 4Y95A 5HG7A 1CQIB 4TWNA 3FHRA 3CY2A 3MWUA 2UZVA 4QMVA 2R3LA 2RGPA 3KN6A 3RCJA 2EU9A 3QQUA 3MI9A 3HDNA 3EN9A 4KRCA 5AEPA 1U4DA 3A7JA 4D1SA 4QTBA 1P4FA 5AUTA 3VPBA 1YWRA 2B55A 2R7IA 3A7IA 4MEDA 2Z2WA 4JVGA 3UQFA 2CLQA 3DQWA 3PPJA 2ZDQA 2R3MA 3TM0A 4JQ8A 4QQCA 4U7ZA 3MDYA 3UBDA 3VS6A 4DT8A 1PMNA 4YU2A 4EC8A 5DLSA 4GIIA 2B0QA 4OUCA 4KB8A 1QPJA 4IVBA 4MXYA 3TIYA 5B2LA 5H80A 5BVNA 5DYJA 3HL7A 5M55A 3TT0A 4YBZB 5HCYA 3V5LA 2UVXA 5LYJF 4RQKA 3I6UA 4WKQA 4IM3A 5DOSA 4FSQA 3C4FA 4O22A 3VUHA 3VVHA 4IJ9A 4XLIA 4L7FA 3CD3A 4QP9A 4NW6A 5AUXA 4RLLA 3ZLXA 3NGAA 1SZMA 2DYLA 4AA4A 4D4SA 3C4XA 2W4JA 3N9XA 4JBPA 3BKBA 3BE9A 1ZMWA 2BILB 3KA0A 4Q2AA 3VIDA 4A4XA 2VWBA 4C59A 4JBVA 5CI7A 4E6CA 2C6IA 4GRBA 1V1KA 4QNAA 5LQFA 4QP7A 4DINA 4U3ZA 3FMLA 1OVEA 1Q5KA 2R3KA 4V05A 4JDHA 5BVKA 2I0EA 3F3WA 2CKEA 3GC0A 1F5QA 3HMPA 1Q99A 2F49A 3NLBA 3QGWA 4LGHA 4BTKA 3VJNA 3NAXA 3GT8A 3R9RA 5HU3A 4PV0A 4FV2A 4D28A 4QYEA 4E5BA 4P7EA 4BTMA 1JNKA 1OBDA 3P86A 2UZTA 4AZFA 1CE8A 3EQCA 3U6IA 4IC8A 4HR7A 4FKUA 3MA6A 1XWSA 4PUZA 4WNMA 4GK4A 3NNXA 3PA3A 3GOPA 4FTTA 4L3LA 4EWQA 3ODZX 3TKUA 2VTPA 1YKRA 3IOKA 2YZNA 1SVHA 3LFSA 5K4IA 5JQGF 4JR3A 4U81A 2B9FA 4AA0A 3QTZA 2PVJA 4EJNA 3FQSA 2WB8A 4NT4A 4O2PA 3ZFYA 4A9UA 4UYAA 4DFZE 4MV7A 5CVHA 2OWBA 4PDSA 4QTEA 3BGQA 5HX6A 3GQIA 3SLSA 3SRVB 4XX0B 3ZRMA 4JOAA 2O5KA 4QP8A 4FTNA 4X2NA 4AW1A 3U6JA 3KALA 4FFMA 4FKJA 5AUUA 4H3QA 5HIEA 1BMKA 4FV0A 4PDYA 3WIKA 2PYWA 4DFBA 3NW5A 4IDTA 1KEEA 4QTDA 1BUHA 1OKVA 3NCZA 3DAJA 4I23A 3CKXA 3NUXA 5EYMA 3UVQA 1KOBA 5K5NA 5C9CA 1LEWA 3ZBXA 2V58A 3KAKA 2W5HA 2BZKB 3RHXA 3W33A 4FKPA 4FVRA 4ZSAA 5JN2A 2OH4A 3L8PA 4G6OA 4RC3A 4EC9A 1ZYCA 3DAKA 2PVHA 5D10A 3LXKA 4XS2A 2YS6A 3RZBA 4WNPA 5KMLA 4O7WA 3JRXA 1QCFA 3JUHA 1BLXA 5AUWA 3UVRA 4FNWA 5CA1F 4BCFA 4FODA 1KE5A 5DI1A 4FZ6A 3NAYA 3Q6WA 1WBNA 4FNYA 5EQYA 3R00A 4ANQA 1X8BA 3KRXA 4NK9A 4CZUA 2PVPA 4E73A 3BX5A 3DXPA 4X3FC 4L8MA 1KC7A 4YTHA 3H30A 3REPA 3O7LD 4HVGA 4OTHA 2W1IA 3ZLYA 3UO5A 1XKKA 4I20A 2BVAA 4F9WA 5J95A 5JZJA 4ANMA 3IG7A 5HO7A 5HV6A 2CN5A 3P78A 3W16A 4YZBA 1J3HA 5KCVA 1BNCA 4F7LA 3OOMA 3R1NA 4E4XA 4G2FA 4U44A 2PK9A 3EQIA 1NVSA 4LOOA 3VBTA 3LFNA 5JVDF 3PZEA 2JKKA 4CFUA 5IH6A 3EYGA 2UW9A 4RPVA 4TY1A 4B4LA 3PSDA 5IZFA 3NW6A 3QAME 3OUZA 5IG1A 3IW6A 3FSFA 5IQIA 1UU7A 1M2QA 2XIRA 4YJUA 3PLAE 4OGRA 2QOKA 1IRKA 3D5WA 1FOTA 3GCPA 1UVRA 3B8RA 3RFCA 2OBJA 4M97A 4PDPA 4DBNA 4QT1A 4F0FA 5BPHA 3O17A 3FUPA 3VW6A 3EFJA 4MD9E 4G5PA 3VBYA 2YCFA 3H0ZA 1SVEA 5D9HA 3ZEPA 3UZTA 4FV3A 4PNKA 5AIRA 4MX9A 3NPCA 1BI8A 3R8ZA 4O0RA 4USDA 3Q9XA 4FA2A 3FPQA 3QX2A 1XH4A 2XNMA 3JXWA 3O8UA 4O4LF 2BIYA 4D4VA 2VD5A 3Q5ZA 3QYWA 4W8EA 2CGVA 4MXCA 2GHMA 3HV5A 5ICPA 1ATPE 2XP2A 1URCA 2CDZA 1RW8A 2JIIA 3GCQA 4ZHQF 4NM3A 3PSCA 4BN1A 3CD8A 3DB8A 2R3QA 4IDVA 5F95A 3G51A 3UJGA 5TOZA 4DEHA 5IU2A 2YWVA 4XP0A 4D5KA 4GL9A 2EUFB 3AXWA 2JD5A 4I6FA 4FSMA 5E8YA 5CA0F 2QG5A 3RWPA 5JT2A 4CMTA 3ORXA 3OY3A 1IG1A 3LQ8A 1BX6A 4J99A 5BVWA 5IH4A 2W6OA 2BRHA 3DLZA 2JLDA 3CPCA 1BI7A 3DPKA 2YDIA 2A27A 3LM5A 2JIVA 2UVYA 2YRWA 3GNIB 2WU6A 2F4JA 4F1OA 3SW7A 4X2JA 4O0TA 4BBFA 4QMUA 5IQDA 5EFQA 3OW3A 4QTAA 2OJ9A 2VWXA 2XNOA 2IN6A 3KF4A 2ITQA 4ANSA 2FO0A 3WE4A 2QO2A 1KSWA 2WTDA 3CSVA 5HVYA 2AUHA 2BDJA 4K2RA 3SGCA 5HEZA 3UNKA 3C51A 3SG9A 5HD4A 3QFFA 1Q8UA 2VTTA 4DEDA 3LPBA 3VQUA 2CSNA 3F61A 3QD0A 2W05A 3ZBFA 4H58A 3CQEA 4ZS0A 4CXAA 4UWYA 3R1YA 4KIOA 2UV2A 3PRIA 3VBVA 2R7LA 2OH0E 3MVLA 5I9VA 3UDBA 3DK3A 2OLCA 3CXWA 4N6ZA 5EYCA 2BHEA 4R77A 5CNNA 3BWFA 3ORLA 3TL8A 3IW4A 1GIHA 5CF5A 5J5SA 3II5A 3R2BA 3UIXA 5LVNA 3WO1A 1UU3A 2R3NA 3E64A 4XG6A 2QONA 4D58A 4V01A 1PMEA 4ZIMA 4AZEA 4N0SA 3E63A 4MV3A 4IWQA 2QO7A 2PVFA 1PX2A 3ETJA 4LG4A 1SM2A 2VNYA 4C62A 3SXRA 4KINA 4RVLA 3UIUA 4FKGA 2X39A 3GCUA 4FIGA 4RIOA 5D11A 5L8JA 5CAQA 1M6VA 1UA2A 3GCSA 4I0SA 4TTHB 3NUAA 4J71A 4XYMB 4NUSA 1V0OA 4S33A 2W5BA 3HP2A 3KKVA 1ZAOA 3L1SA 5CSVA 3AT4A 4QPAA 4FU0A 3ODYX 3SDJA 1VYWA 3ATTA 5FBNC 3VS4A 3I0QA 4EH3A 3LIJA 4AT4A 4J97A 2YL2A 4TUYF 4QMWA 2QOLA 3ROYA 2Z7LA 4MTAA 1O6YA 1YXXA 3AC8A 3WZUA 4D0XA 1TVOA 3EQPA 4A9SA 4PDOA 3OCTA 5T6KA 3F5GA 4Q5EA 3ZRLA 4CKIA 1Y6AA 3QYZA 4C3RA 5JFWA 3V01A 3EFLA 4I6QA 4RFYA 1OITA 2BKKA 1PHKA 2Z7RA 3POOA 5KBQA 2QOIA 4LOQA 4ZZMA 3TEIA 3VBXA 4KSQA 3TINA 4NTSA 5ETCA 3LMIA 5JEBA 2X7FA 2GS6A 2EXCX 2YW2A 3SE7A 3F5PA 2JEDA 3I12A 3MB7A 5HTCA 3QC4A 1TQPA 4UB7A 4IAKA 1RDQE 4BCJA 4WBNF 5HE3A 3RK5A 3Q9WA 1V0PA 2X2MA 5DIAA 3R7IA 5KMIA 2YIWA 1CKIA 4FEUA 3H10A 4AGWA 4ZSGA 4PL3A 3HVCA 2VTSA 2YABA 2ITUA 4JG7A 4OBPA 4QP2A 4WNKA 4ZSJA 2VUWA 3TWJA 5CZIA 4DG2E 1M0WA 4I4TF 3JY9A 3U54A 1FMKA 3D15A 3F5UA 2B1PA 3VW8A 4R3CA 4S31A 3DK6A 4AN3A 4O0VA 4QMPA 5HU9A 4IADA 3BHUA 5HBJA 3O8TA 1AGWA 3Q9ZA 4B7TA 4F1MA 5AJQA 5HQ0A 5C01A 3S4QA 4BIBA 5JH6A 3I0OA 3LCKA 1XO2B 3CCNA 4E4TA 2FA2A 5C27A 2ITVA 3ORIA 2XK4A 2EXMA 4FTRA 2B9IA 5HICA 4DA5A 4IAZA 4C35A 3F3VA 4M13A 3UP2A 2W6NA 4FZFB 3MWDA 2GPHA 3FZRA 4MD8E 1S9JA 3WI6A 2VTQA 1DAWA 4K18A 3JVSA 4JS8A 3VF9A 4JRNA 2WMXA 2YITA 3R5HA 1OI9A 4HOKA 3W2OA 4QMMA 4EK3A 5C03A 2UW6A 4MNFA 1OKYA 2BMCA 2UW8A 3CEKA 4R5SA 4RVKA 5ANKA 3SXFA 4HW7A 4FIHA 4X7QA 5DR9A 5HCXA 1ZZLA 3F2AA 5TR6A 4LRJA 3FKOA 3GCVA 2Y4IC 3H4JA 2XNPA 3Q5IA 1JKJB 2BDWA 3IPHA 4DG3E 2YCRA 1Y6BA 3VJOA 3HV4A 4GFMA 4FT3A 5CVGA 3G8DA 3V5WA 1A9XA 3NUSA 1VZOA 2WTWA 4EOLA 4BICA 5I4NA 2NNWB 5C1PA 2YS7A 3EKNA 4F7NA 4GW8A 5KMOA 4BCHA 4HPTE 5AFVA 2OXXA 1P4OA 3QD3A 4R6VA 3EJ1A 4CT2A 1AUVA 2XKEA 4EOOA 3QRKA 2BKZA 4DFYA 3P4KA 5HLNA 2X0SA 3DJ7A 3T8OA 3S1HA 4NL0A 3AG9A 3D5VA 3ZUTA 4ZJVA 1VR2A 5CAEB 3FLYA 1GIJA 4O86A 3TUDA 4IB5A 2VTLA 4WIHA 5FTOA 5J7HA 3G2FA 4ZXTA 2OZAB
chains in the Genus database with same CATH superfamily
1OBGA 1Q8WA 4O0XA 2VR1A 4IEBA 1URWA 4BBEA 3BHHA 3QHRA 5M09A 2ZGIA 3OCSA 4EH9A 5IQGA 4X0MA 3UOHA 4G16A 1RE8A 4IW0A 1M17A 5CAPA 3BWJA 4YZMA 3PSBA 3HB9A 5BWTA 4CC5A 3FAAA 4EYMA 3VBWA 5KX8A 2VX1A 3ZS5A 1OZ1A 3ENHA 4UY9A 1YXUA 5HVKA 4RZVA 2A0CX 1FPUA 3G6HA 3ORTA 4FTAA 3RPYA 4CCBA 2HZ0A 1U54B 5GINE 3MY0A 5CSPA 4Y72A 3O23A 4QYHA 2XK9A 3DGKA 4BCIA 5D1PA 3NZ0A 2CGXA 5IEYA 1H8FA 4GT4A 2Y0AA 2X7GA 4EOQA 4PMTA 4E4MA 2E9OA 4FTUA 1OKWA 2GQSA 2OLSA 3SOAA 2PULA 4U80A 2QCSA 3AC3A 3E5AA 3NUUA 3OEFX 4FG7A 4GK2A 4HGLA 1TFFA 4AOTA 3PVUA 4GK3A 1C3OA 1YI3A 2I80A 2LGCA 2VX3A 3GP0A 3RALA 3TJDA 2CZGA 3UG1A 5CAUA 3V4SA 3DZQA 4WNOA 4EH8A 1ZY5A 3UG2A 4AQKA 4DEIA 4AXCA 2Y7JA 3CTQA 3O0GA 3IQ7A 4EHEA 5KE0A 3CE3A 2I8CA 1CKNA 2YAAA 2H6DA 3R7YA 4DBXA 1Z2OX 4EJ7A 5LXTF 1OPLA 3FKNA 4FFLA 4YUQA 2PTKA 4C0TA 2R7MA 4I41A 4C61A 2PUUA 5CEKA 2XMYA 4DITA 4FIFA 4O4IF 1U5RA 2OFVA 5IYZF 3P79A 4P4CA 5FQDC 3VUIA 1YW2A 3FL4A 3O2MA 4BIEA 4E93A 3PY3A 1P14A 2O65A 4UWBA 5FR9A 1JDEA 3MPAA 3UMXA 2YISA 2ERZE 2V7AA 2ITOA 3KXGA 4IIRA 3R8UA 2FPGB 2JDRA 2PUNA 4BI1A 4C4HA 3FXZA 5H3QA 4FSNA 3VAPA 2HHFB 3QWKA 4XV2A 2ZFYA 1OB3A 2J0MB 4FTKA 4HCUA 3DOGA 3EMGA 3LFCA 4YJSA 2NU6B 1H27A 5CT0A 3FLQA 4I6HA 2C0TA 4E5AX 3ATSA 1NY3A 1MP8A 3DB6A 4AW5A 3VUKA 1E4EA 3U4UA 2W1ZA 1KJ8A 2QURA 2CCIA 3AKKA 2OW3A 4RX7A 5ACBC 5DRBA 5L2IA 1OKZA 2X1NA 2OSCA 4W4VA 4Z9LA 3FXWA 3ORZA 5TT7A 4CMFA 4YAKB 4Y73A 4AT3A 4M7IA 3Q6UA 2WOTA 3TW7A 1CSNA 5I9YA 4JL9A 4PBCA 3HAVA 3MSSA 3R73A 4K6NA 3E62A 2WU7A 5FTQA 4AOIA 4EQCA 4L1KA 4QOXA 2CMWA 5FP6A 3TZ7A 5I5VA 3FMJA 3BIZA 2QOHA 5IQAA 3AMBA 3F82A 5DPVA 1EKPA 4XNEA 1KJJA 2XJ2A 1ZYDA 4ZY5A 2NPQA 2VPQA 2YN8A 5G1XA 5J9YA 4MNEB 5KNJA 5DT4A 3L9NA 2YIYA 1YWVA 4X6RA 4FK6A 1WMKA 5DGHA 3GENA 5FEEA 5IDPA 1EZ1A 5DMXA 3MESA 3F7ZA 5JRQA 2PL0A 4RX5A 4FVQA 4V0GB 4L3PA 1KE7A 4Y5HA 5AP1A 5AV2A 3R83A 4P90A 4Y83A 2GQRA 2VV9A 2FYSA 3DV3A 3OW4A 4S30A 3L9LA 3EQDA 5AA9A 3D14A 4EBVA 2Z60A 5EDRA 2RG6A 4F09A 3T9EA 1W83A 5CX9A 2OJIA 4Y8DA 1Q4LA 4OTWA 3RTPA 2C00A 3PFFA 4YAJB 5JVLA 4QMZA 5M56A 4JAIA 2QB5A 4QQJA 3RMFA 1UNLA 3E93A 3FLWA 4C3FA 4NKSA 3C4EA 4J7BA 1V0BA 1WCCA 4TYHB 4XYFA 4R7BA 4PZ6A 1B04A 1IR3A 4AFJA 1REJA 5LCJA 3QA0A 4HCVA 2Y4PA 1APME 3TIGA 4O4HF 2XUUA 1M14A 1Y57A 3HRCA 3BYUA 2UW7A 5DWRA 1BL7A 3HDMA 2B7AA 1H25A 4NKAA 2Y6MA 4L6QA 3F69A 4L45A 3ZXTA 4RVMA 1GOLA 3G9LX 3OUKA 5M44A 2F9GA 2NU9B 4HNIA 2C6TA 1XHAA 4WUAA 3LFDA 3VS2A 1WVWA 5H2UA 4M14A 4LM5A 3PVGA 3SC1A 3V5PA 4UX9A 3MPMA 3POZA 3DCVA 2VWUA 5C1OA 2C5OA 1Q61A 3UODA 3ZCLA 3QQKA 3GIDA 3GFEA 5JGAA 1IOWA 3TW6A 3EB0A 3WBLA 2QKWB 4JG8A 4ZSEA 5H80A 2QLUA 2QNJA 4BYJA 5HNBA 5HX8A 4RLKA 3F6XA 3OZ6A 4YHFA 2H96A 4FL3A 5D7VA 4DTBA 4ID7A 3QLFA 3W1FA 4DRFA 2NRYA 1ST4A 2R3OA 1WVXA 3NUYA 1B6CB 5EQPA 4DN5A 3ULZA 3LP8A 1JVPP 4YMJA 3TY8A 5HI2A 4FGBA 3KGAA 3PDTA 2YEXA 4G3FA 3NNVA 4RFMA 4USFA 2F7ZE 5I9XA 3AD5A 4RWIA 3THBA 3P23A 2IVUA 2WMRA 3KY2A 4FIJA 5AX9A 2UZDA 5CI6A 2QR7A 3QC9A 2JAMA 2XIZA 1ULZA 3TI1A 3OWPA 1FVVA 3GBZA 5BYBA 2CPKE 4AE9A 3FZSA 2Y6OA 4TV8F 3GC9A 4FGRA 4V04A 4ZJJA 1W93A 5CU4A 2A19B 2GPSA 3OXIA 1UKIA 4FI1A 4EH4A 1Q41A 2RKUA 3FYJX 3VOTA 2YM7A 4OW8A 3NFFB 4ERKA 2QOCA 3LXLA 4IFCA 4IAYA 4FX3A 4ASEA 4C36A 5AV4A 2QI8A 2XALA 3MVJA 4GU6A 5AMNA 4KBAA 5IQBA 3U9CA 4HGTA 2E9VA 4YJQA 3V3VA 3MH0A 4I92A 3K2LA 4QP1A 5JQ5A 2W6MA 2VRXA 3MH1A 3M11A 3RWQA 1Y91A 3FLZA 3K3JA 2PN1A 4FSTA 5CNOA 5DGZA 4HVIA 4IC7A 3SV0A 1KUTA 4XOYA 3QUDA 4RIXB 1UKHA 3OVVA 5CU6A 2WMAA 4DGMA 4AZVA 2QU6A 3PXQA 3KVXA 2J2IB 2H8HA 2UW5A 2WO6A 4HNFA 3R2YA 4MXAA 3WO0A 3LMGA 3TIZA 4IHPA 5IDNA 3AC4A 5CTPA 3PY0A 3OG7A 1KJQA 2HW6A 2XRUA 2PPQA 3DBFA 2WMSA 3L9MA 4LUEA 4QYGA 2IZSA 3TZ9A 3ZUVA 4CFMA 3HT5A 4KS8A 4G9RA 1OIRA 1JKLA 2C6KA 2OG8A 3G0FA 4IE9A 3WIGA 4DLKA 3U55A 1J7UA 3OBGA 4CFFA 2P2IA 2HZ4A 1CMKE 3SXSA 4AOJA 5K5XA 4J96A 3RCDA 2DWCA 4QPSA 2HVQA 4NZNA 2YERA 5EW3A 2UZWE 1G2WA 3OROA 5CS6A 3SRVA 1DGSA 4FKVA 2EJ0A 2YDKA 2BCJA 3KQ7A 5C1QB 4YNOA 2VTRA 4HJOA 1UU8A 3KMMA 4AQCA 3HUBA 4TVIA 2BPMA 3DKOA 4IX4A 4NYEA 2P3GX 3SX9A 3OD6X 2FPIB 4I5PA 4MAOA 2YCSA 4RRVA 3VUGA 4M8TA 3CGOA 4OBQA 4QYYA 1ET0A 5CU2A 5IQCA 4ZJIA 1B6RA 2WMBA 3D7ZA 1H0WA 3LE6A 1BYGA 5HKMA 4AXAA 2CGUA 3C4ZA 5IMXA 2WTJA 4S32A 3DK7A 2WGJA 1L8TA 5DA3A 4EQMA 2DQ7X 4LQMA 2IVSA 3WYYA 4M68A 2W6PA 1ND4A 4ITJA 4KKGA 3NS9A 3TTJA 2Y4RA 4QMYA 2P2HA 2PUIA 4L42A 1JOWB 1YDTE 4O81A 3TDVA 2QOBA 4FSWA 4Z16A 3UNJA 5IISA 3UDZA 4DCEA 4IMYA 4FYNA 3UOJA 4J1RA 1OIUA 3HMIA 2VTJA 3L8VA 3CS9A 2JIUA 2B9HA 2JKOA 3DDPA 1PRYA 4IJPA 4FIEA 3VF8A 3NBYB 3AC1A 3ZM4A 3AX6A 5BNJA 2Y8OA 3FHIA 5GJGA 2GNLA 4EOKA 3UGCA 4FSYA 4XP3A 4QO9A 5HIBA 5D41A 4ALVA 4EEVA 4L44A 4FYOA 4LGGA 4BBMA 3RV4A 3DBCA 4TYGA 4G3DA 4G6NA 1WFCA 3BU5A 3ZDIA 5EKNA 1H0VA 4C02A 4BY9E 3DTWA 2W71A 3MJFA 3SQQA 4R3RA 4GCJA 3ELJA 4ACGA 5LOHA 5E1SA 5LP6F 5CXHA 4DEGA 3EQGA 3QL8A 2OWOA 3NUNA 5HORA 3UZBA 4HCTA 1U59A 2UZLA 3SG8A 4JXFA 4C4IA 4CLJA 2O64A 4FZAB 4RC4A 4HQ6A 3W8QA 3FL5A 2ETRA 1R0PA 1GZNA 2ZDTA 2PBZA 2FVDA 4LV7A 5IA2A 4B99A 4ZTLA 4AN2A 4BDDA 1S68A 4FR4A 4E4LA 3T3VA 5EYDA 4RCNA 1AQ1A 2BIKB 4LMUA 2I1MA 1G8KA 2PZ5A 2PE2A 3EFWA 2GMXA 5FLFA 3I7BA 5AAFA 1WRVA 3BL7A 3KCFA 4FV8A 3KK9A 4R3PA 2ACXA 3R8MA 4H39A 5DBXA 5BVFA 2OO8X 4BRXA 3KFAA 2J51A 4CTBA 1ZMVA 4DGNA 2BTSA 2W9ZB 3ETAA 1J91A 1QMZA 3NEWA 4UUGA 1ZZ2A 2ZV7A 3WF7A 1GSHA 4MYGA 4GU9A 3E7VA 4XLVA 5DGIA 1DI8A 1FBNA 2EWAA 2PVRA 3NYVA 3UZOA 2ZB0A 5GJFA 3VS3A 2HIWA 3N51A 4AU8A 1XH6A 4CRSA 3EQHA 3OXZA 2QG7A 3LCSA 4U5JA 4FEXA 3PXKA 5AAGA 4TWCA 2HZNA 1G8SA 3T54A 4PMMA 3T9DA 3R63A 3GU6A 2J9MA 1UV5A 4LI5A 5HLWA 4DE4A 2PSQA 3Q4ZA 2XKFA 3G6GA 4GT5A 5GONF 2C6MA 2G2FA 3RAIA 2BHHA 1JSVA 4YO4A 3Q04A 4GJ2A 3BV3A 5KKRB 4NIFB 3Q60A 4JLCA 3PG3A 5AP5A 4F9CA 2IZTA 3QFVA 3P08A 1PXNA 3MJ1A 1ZYLA 3CIKA 4KRDA 3SW4A 1GIIA 4A07A 4RQVA 1OPJA 1V9PA 4HNTA 5L6OA 3N8DA 2R86A 4YTCA 5M08A 3JZFA 3BE2A 4PRJA 3MGYA 2GTMA 3RPSA 3LQSA 2IZRA 5LVLA 5BVOA 2FH9A 2QLQA 3F2RA 1PXMA 3HYHA 2GNGA 3W2CA 4ANBA 5LVOA 3COIA 5DEYA 5E8SA 4FT9A 3LWBA 3WILA 4CNHA 4YLKA 4IM0A 4BTJA 5L6PA 1TQMA 2QOOA 4JMQA 2ONLA 4L01A 5IQFA 2XCHA 3ENMA 2XZSA 4GKHA 3QCXA 3Q1KA 1VJYA 3FI4A 1Q8TA 2WELA 4U41A 2GQGA 4GKIA 4CFVA 2XD4A 2PZYA 1NT2A 4F08A 2P4IA 1YQJA 2X4FA 3E8DA 5DFPA 4ZLYA 1Q97A 3CR0A 2KULA 4UALA 2HJWA 4AF3A 4RJ4A 1K9AA 4BJJA 4C4JA 2WZJA 4R7IA 4DGOA 2C5YA 3OTUA 3MIAA 3ZO1A 1XH8A 2QO9A 3FLNC 5AX3A 3U8WA 2NU8B 4GUBA 1WBOA 2ZB1A 5KMKA 4ALUA 3UPZA 5I47A 4OT6A 5L6WL 3WZDA 3MVHA 4BZDA 3UPXA 2QD9A 4AFEA 4JIAA 3I6WA 3MJ2A 4JG6A 4DTKA 5HNGA 4FFOA 4FKWA 5ANIA 3DT1A 3N4UA 1REKA 2PMNX 3G0EA 4EOMA 3QZGA 2RIOA 3LFFA 4G1WA 3ORMA 1OL6A 2NYAA 4DAWA 3GQLA 2QQ7A 2CFMA 2GFSA 4XV3A 2ZM3A 2FB9A 2XCKA 4BCMA 2OKRA 2PMLX 4M15A 4IACA 2EB2A 4CSVA 1HCKA 1JSTA 3FQEA 5ANJA 1M52A 2OIBA 4EYJA 3RM7A 4IANA 3L8XA 4DEBA 4N6YA 2C5VA 3RVGA 4A9RA 3JSLA 4GLWA 2OXDA 4I21A 5IUHA 5HTBA 1H1SA 3DJ5A 4IX6A 3NVMB 4FICA 4IZ7A 2FSMX 3JPVA 4PWNA 3RPOA 3C7QA 4IM2A 5IQHA 2JGZA 3GU8A 3F3TA 5HNIX 4HN2A 5BVDA 4G31A 2JFLA 3HECA 3OCBA 4RWLA 3TG1A 3NCGA 4U0IA 4NM5A 3RPVA 5KX5F 5FXQA 4YC8A 5DRDA 4FKRA 3U87A 3C0IA 4IB0A 4YC3A 4O7SA 1YVJA 2A1AB 2J6MA 2YACA 1CKMA 3G9NA 4K9YA 3NDMA 4LRMA 5L8KA 3BGPA 3NYNA 3R6XA 3GU7A 2J5EA 2YHVA 3ALOA 3NIEA 4X3JA 3NFGB 1PMVA 3QKLA 5LMBA 4L3JA 2XK3A 1Q24A 3Q4TA 2XK7A 3FMDA 4DFUA 3WNZA 2NUAB 4PP9A 4WG5A 3FMEA 4ZAUA 4NJ3A 4YJNA 4D9TA 5F20A 4O0SA 3DF7A 2Y9QA 3IS5A 3ZSIA 3R5FA 4YBKA 4D4RA 5E9EA 3BA9A 3DA6A 3LLAA 3R8LA 4FKIA 4K33A 4FV5A 4F6UA 3BRBA 2HXLA 5CM0A 3U51A 3EL8A 2BROA 1EUCB 2YCQA 4NFMA 1IAHA 3V8WA 1IYEA 4BCNA 4BKJA 4TNDA 4OBOA 3P9JA 4E5WA 4H3PA 1XH9A 1JQHA 4XZ3B 1WBVA 2XM9A 5BVEA 3TZ8A 4G17A 4GVJA 4CHIA 4FT5A 3QKMA 3WZJA 4EONA 4EKLA 3KIOC 4L9IA 5CAOA 3LW0A 1OECA 4J8MA 1W8CA 4IWPA 5HE2A 3ZO3A 3ZSHA 5K4JA 4PZ7A 3KF7A 1PJKA 2ZV2A 1DM2A 1UU9A 3HV7A 4MXOA 4RGJA 4FL1A 3UC4A 5FDPA 5FXRA 4CRLA 2J0JA 3O5AA 4QMSA 4JBQA 3OWJA 5CQWA 3R02A 4KD1A 5CLPA 3UO4A 5C8KA 5JFVA 3RHKA 1XK5A 2R3JA 2AYPA 1QL6A 3F88A 3OWLA 1TKIA 4FBXA 1P16A 2WAJA 5DVRA 2C47A 2HYYA 4D2RA 2PHKA 1NXKA 4IX5A 4O83A 2HGWA 2W5AA 2FSTX 3CJGA 3CQUA 3TYKA 4ANLA 3ULIA 2H34A 3LXNA 3PWDA 3TY9A 3DXQA 3VQHA 5FNVF 5CY3A 1H01A 4CVAA 5JQWA 3W32A 2GNFA 1MRUA 2DABA 2Z04A 4CFWA 3QQFA 3FC1X 4ONAA 5AUZA 3A4OX 3CBLA 2BFYA 4IVCA 4FT0A 5M4IA 2XNGA 4ACDA 5LVMA 2I0YA 2R5TA 3TZMA 3MFUA 3L8SA 5KHXA 2VWVA 4WSYA 4IAIA 2HG8A 2XCLA 3LCOA 4FC0A 3W2QA 4CV9A 1NVRA 3OP5A 4FSUA 1W84A 4TN6A 5DEWA 4NTTA 3TN8A 3GFWA 3TV6A 2XH5A 5D8DA 3QZFA 2GS7A 3VWAA 2WYOA 3BV2A 3LM0A 4I5CA 4EQUA 1U54A 4XV1A 5H8EA 1FINA 4DF3A 5GNKA 4CMDA 2WQOA 4EH5A 4I5HA 5I9WA 4OLIA 4G3GA 2XANA 4RIWA 3KRWA 2XVDA 3AQVA 1IA8A 2JITA 2X9EA 1ZOGA 3C9WA 2Z7SA 3F3ZA 3LFAA 3QTUA 4FK3A 3PRFA 5E91A 3S3IA 4AT5A 4H1JA 5AV0A 3ZONA 1LPUA 3CC6A 3R8PA 3EL7A 2C0OA 1KJIA 4IZOA 4RSSA 3T99A 4JXUA 3FYKX 1OM1A 4IB1A 2XIKA 4G3EA 5CEQA 5I9UA 2ONLC 2WMWA 1LEZA 3E8CA 3PJ3A 4U97A 3LZBA 4F1TA 5DR2A 3BU6A 2RG5A 4K77A 2F7EE 4R1YA 1M2PA 4HZRA 4MH7A 3U4WA 3CP9A 3D0EA 5HLPA 4ARKA 3R22A 4BDEA 2VQDA 1IAJA 2ZAZA 4I0RA 4Y5QA 2DIKA 4UCOA 4RT7A 4QEBA 3OC1A 3QLGA 3FZOA 5J9LA 2GNJA 1MQBA 2C6DA 5DE2A 3COHA 5FPRA 1YHWA 2XYNA 3BG5A 1ZWSA 3UIMA 3DY7A 5G6VA 3U9NA 4B9DA 2OIDA 1VEBA 2V59A 4IWYA 4OTDA 3ET7A 1E9HA 2GCDA 5FXSA 2FGIA 3ZRKA 4BDKA 3PE2A 3QTIA 3UQCA 1OMWA 4PQNA 5AM6A 4C5AA 4UXQA 3PFQA 4BCPA 1H28A 3QD4A 4X2FA 3DQXA 2YRXA 4LV5A 4GEOA 2ZDHA 4YZ9A 1KE9A 5M07A 3D83A 3TTIA 2HHFA 2YZGA 2QHMA 4LV8A 3PUFC 5J1WA 5CSWA 3D5XA 4QMQA 3H9FA 5KKNB 4LOPA 4FMQA 3ACKA 4JIKA 3KULA 5BUEA 3D7TA 2PWLA 2HOGA 3LJ2A 2I0VA 4FNZA 4IQ6A 5JZNA 4DTAA 4FEQA 4EWHA 4A9TA 3CPBA 4I55F 5M06A 2J0LA 3FEGA 4GS6A 3I81A 2HCKA 4P5QA 4WRGA 2C4GA 4HNUA 1JPAA 1ZYSA 1QPDA 4C58A 1K2PA 2R0UA 3EN5A 2C3LA 4MXXA 5CENA 5CZHA 3ZC6A 4AUAA 1EUDB 4DEEA 1F0QA 1R1WA 2CKOA 3K5VA 4JRVA 3EKKA 4Q5HA 5JSMA 1BXRA 2WQEA 1R3CA 4JBOA 4B8LA 4ZOLF 4MKCA 3FDNA 3PPKA 4UWCA 4AA5A 3FZ1A 4GFOA 2GU8A 3ZM9A 3R23A 1XMLA 3RAHA 3NUPA 3TIIA 2J0IA 3P0MA 4O38A 3PG1A 4GT3A 3QQLA 3EQRA 4G5JA 3VRZA 1FVIA 5D1OA 3TNIA 2WTCA 3QUPA 1PYEA 2ZM1A 3QTRA 5CWZA 3ZZEA 3WF6A 3B2TA 3ZLSA 2ZMCA 2PE0A 2VO6A 3F5XA 4O7NA 2ETKA 3QRTA 4FG8A 3GXLA 4L7SA 5EM7A 3T9TA 1P5EA 2X8DA 4IIJF 5BYAA 5ANDA 2BUJA 4EOIA 4AW2A 4MUQA 5HO8A 3PXRA 3Q2OA 2FSLX 2NU7B 5EHYA 4BIDA 1HCLA 3HZTA 5AA8A 4IWXA 3BBWA 3AT2A 3IGGA 4JDIA 5L8LA 2DZDA 3A7GA 2ZV8A 3HA6A 4MA0A 4QMLA 3UFXB 4J52A 2UVZA 4BI2A 5FEQA 3W2RA 5JFSA 4O6EA 3HV6A 4MV8A 3MBLA 2JBOA 3UDTA 3IONA 3Q4CA 3Q53A 4TYHA 1CDKA 4E4NA 3N4VA 1OL2A 3GU4A 3R1QA 3SD0A 5AADA 3L2PA 5LA6F 3PXFA 3FQHA 4KKHA 3MPTA 4W4XA 4BYIA 5GIOE 1XH7A 1OGUA 2R3PA 4O82A 2BZHB 5JFXA 1O6KA 3JY0A 5DR6A 4YPSA 4CGAA 3ZFXA 3BLRA 3KXHA 3P5JC 5F1ZA 3D94A 1OUYA 3WYXA 3AGMA 3ZZWA 2J9GA 1B38A 2CCHA 3LVPA 1AUXA 2PUPA 2XK8A 4D0WA 1DAAA 2PVYA 2QC6A 4ENYA 4FTCA 1YHVA 3VS0A 3VNNA 5JGDA 2OI4X 3NR9A 3R21A 2AC5A 1UWHA 2PZRA 3MH3A 2ZDUA 3BABA 3RKBA 1WR2A 3HP5A 1I2KA 3NIZA 4QRCA 3ZO4A 5KS8A 4F6SA 3ID6C 1DIKA 2HWOA 4G9CA 3LHJA 4JQEA 4KBCA 1GJOA 1F3MC 1PXLA 2QKRA 2W96B 3JR1A 4IZAA 2C6LA 4PMSA 3KU2A 3ZUUA 1Q8YA 2O3PA 3EIDA 3I60A 4RWJA 4UZHA 4KA3A 5HZNA 1XBBA 4IWDA 4I6BA 4MAMA 3PXYA 3TUCA 5CF8A 2JDTA 4HGEA 3SNOA 4OR5A 3VS7A 3KYHC 1YHSA 3V8SA 3KXNA 3P1AA 4MV1A 4EH2A 4MWIA 3GC7A 4IZYA 3ORPA 5EM5A 3OFMA 4FJVA 3FMHA 4O0UA 4QP6A 2GS2A 4JI9A 4XV9A 5A4QA 3T9IA 3R01A 5CASA 3UIBA 2WOUA 4EK8A 4IAFA 4XMOA 3CTJA 2PVMA 1GGOA 5IF1A 2C0IA 3FI3A 3MFSA 3PYYA 5BPFA 1PW2A 4PX6A 2XK6A 3LQ3A 5FM3A 5EI6A 2C1AA 3ZC5A 3Q2JA 2VTOA 5D12A 2JDSA 2XNNA 4EL9A 4DH5A 4Q9ZA 1B39A 5FG8A 1RQQA 4M69B 3RPRA 2XNEA 5BWXA 5HESA 2CKPA 4FT7A 2PY3A 2UZEA 1A0IA 2PZPA 4MXZA 3GDEA 5JKGA 3K3PA 2X81A 3MH2A 4AACA 2SCUB 4AZWA 5I0BA 2W70A 4F0IA 3M42A 2YM3A 2R3IA 3F66A 3FI2A 4DFLA 5LVPA 1T45A 4RIXA 4NWMA 1S9IA 4Y85A 1Z2PX 3KAJA 5I5WA 4RBLA 4CMOA 5KMMA 3RI1A 2OU7A 3LULA 2WMVA 2WIHA 4ZTNA 4EH7A 3QGYA 3DBDA 3W1GA 1XJDA 1Y8YA 5LOVF 3PA5A 2PMIA 4ZY4A 5LCKA 1CKOA 3NBZB 4K0YA 3LFQA 4W4YA 4XG9A 4AE6A 3TCPA 3G15A 3OS3A 1W98A 4DH1A 5B2MA 3BACA 5A4TA 4YB8B 1PXPA 4AP7A 4EOPA 5E4HA 2WXVA 4NM0A 4GMYA 4L46A 4DAAA 4AS0A 1H1WA 3PP1A 4K11A 5ETAA 4EK6A 1YWNA 4N70A 1JBPE 4DCAA 4EKKA 3TNWA 3W0OA 2XM8A 3A2CA 1WZYA 4APCA 3C50A 4XG8A 5C8NA 4ZTHA 1OL1A 3VMMA 5CYIA 2Z8CA 3LFBA 4WD5A 2QR8A 2A2AA 2F7XE 4BDJA 3DNDA 5M4CA 3DAAA 3OY1A 5BMMA 4KIQA 4WHZA 3TXOA 4ZTRA 1JDBB 4IHJF 3SVVA 3I4BA 3VUDA 4TWOA 2UUEA 3PIXA 2C69A 4F63A