4O84A

Saicar synthetase (type-1) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
227
Chain Sequence
b'AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o84A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o84A02
2Z7SA 4IEBA 4DEEA 1UU8A 4K2RA 4G34A 4EKLA 4QYFA 4LFIA 1KC7A 3GU5A 3G8CA 3PUPA 4E6DA 4RJ6A 5L8JA 4H3QA 4PRJA 3S4QA 4TT7A 3VBYA 4EOIA 4YR8A 1UKHA 1J7UA 3OEZA 3F3WA 3QD3A 3QC9A 4MWHA 3DPKA 4ERWA 1XBCA 5CEPA 2VTLA 3OBJA 3O71A 4AZTA 1FPUA 3KA0A 4FV6A 1V1KA 2B9FA 3ULZA 3WBLA 4DFZE 4EBWA 5A9UA 4FKJA 3FKOA 3N8DA 3AT3A 4KIPA 3GC9A 1UKIA 3W10A 3DBEA 5FLFA 3AMYA 5G1XA 4O0VA 5JVLA 5GJDA 3P08A 4FV9A 1A9UA 3MIAA 3OD6X 4K77A 2YERA 1PW2A 4YPDA 2W1HA 2NRYA 5CZIA 3PSBA 2BFYA 4IZAA 1BI8A 1BL6A 4LRJA 5EI8A 3DBDA 4FKUA 4YNEA 3ZO4A 4MXXA 2B7AA 3F3ZA 3OCBA 5JEBA 4Q9SA 4I94A 3K5IA 3P4KA 3W2SA 3A8WA 5LMKC 4YB8B 2BCJA 3BX5A 1QCFA 3DK7A 3ZLYA 4MQ2A 3BYUA 1PF8A 4GG5A 4MD9E 5HIEA 2W70A 3DNEA 4L68A 4QMSA 4UBAA 3NUUA 5KX5F 2ITXA 3P9JA 3A7HA 3PE1A 3HV6A 4CNHA 4FSTA 1Z2NX 5CEIA 3BZ3A 1QPEA 3O0GA 1U5RA 3BGQA 4KIQA 4HJOA 2VNWA 3SXSA 4ASZA 4DGMA 3KULB 3V5JA 3VUGA 4DGLC 1GSOA 4FNZA 1W7HA 3B8RA 3LPBA 2J0JA 4R3RA 5EQPA 4PMPA 4L00A 4QMQA 5AEPA 1L3RE 3DCVA 3OY3A 4JBOA 4TYIA 5AV4A 3U6HA 5HU9A 4O2ZA 4PY1A 4IWOA 4CFUA 2R9SA 3DDQA 3TNQB 4EOPA 1ZZ2A 3ZLSA 2B52A 3C4EA 4D55A 5AMNA 3VO3A 2BROA 2V58A 3AT2A 4C4JA 3E64A 3H0YA 4XG9A 3CP9A 4J95A 3WZJA 4O0UA 5JGDA 1XBBA 5KMMA 3R5FA 3A60A 3F3VA 3LLAA 2FPPB 1XH6A 3LHJA 4D5HA 5GINE 1GZOA 2FGIA 4C4HA 5LMBA 4N6ZA 4C3RA 5FBOA 3VRZA 2GPWA 4C35A 2Z7LA 4D4YA 4L3LA 3EN6A 1R1WA 3DY7A 2IZRA 3MTLA 3VRYA 4D4VA 1P4FA 2OJFE 4MXOA 3BPRA 4XBRA 4ALWA 1TKIA 5BX0A 3BU5A 4OTGA 5DMXA 3A7GA 4HZRA 4YZ9A 3L9PA 1OL5A 2YDJA 2GNIA 1PK8A 3OF0A 1BLXA 3E93A 3DXPA 3HVCA 3NPCA 3NR9A 3ORMA 4GEOA 4QQCA 1KOAA 2C68A 2XK8A 3NSZA 5A14A 3EFJA 1XWSA 4QTBA 1GY3A 4I23A 4XG7A 4YJVA 4IFGA 2OXDA 3LZBA 3FPQA 1H25A 4XV3A 1C3OA 1PKGA 3GI3A 3Q6WA 1U4DA 2UW7A 4OT5A 4UV0A 5HI2A 4YHJA 5KMIA 3F5GA 3MPAA 2W9ZB 2HW6A 4FTJA 4WG5A 3FJQE 4MD7E 2OI4X 2W6NA 1YOLA 3RAIA 5FTQA 4MV6A 3E63A 4O86A 4PL5A 5EYMA 4ZY4A 4HVHA 5CYIA 3QQKA 3IDCA 2UVYA 5HD7A 4HNFA 5IYZF 3W18A 2JDVA 3FWQA 3VS7A 3OTVA 4M69B 5DR6A 4QYGA 2Z60A 3GCSA 4BC6A 4RFYA 4GG7A 3ZCLA 2FSOX 4YJPA 4TNBA 3VULA 3WF9A 3UODA 4O7VA 4DGOA 3IONA 5CSWA 4LV8A 3QYWA 2W6ZA 1S9JA 2H6DA 5DI1A 2W1ZA 4DEGA 3RPOA 3C51A 4O2PA 4ZTLA 3DAKA 3MGYA 3PTGA 5F9EA 5DEYA 5HIDA 2YCSA 4EZ3A 3VF9A 5EKNA 4FSQA 3VUKA 4BYIA 2O65A 4BCOA 2QO2A 4P90A 5BYZA 2EVAA 3AOXA 1ZXEA 4O2AF 1OL7A 4EH5A 3G9NA 2ITYA 4JLCA 4KD1A 4EH2A 4YZBA 3EQBA 3GLKA 5HCYA 3OP5A 2IWIA 2VWVA 3R73A 2PU8A 2Q83A 3DKOA 2XCLA 5E8YA 1JLLB 5LP6F 4N57A 4YC8A 4AA4A 1YI3A 3LCDA 4I24A 3UP7A 3F5XA 2PE2A 2WMQA 3LJ2A 2WMWA 3FQHA 2YHVA 3FQEA 1BX6A 5EDPA 3S3IA 4BIEA 4E7WA 5M51A 4YO4A 4RJ7A 3OUKA 3NIEA 3OCGA 2R3OA 2WB8A 5DNRA 5HEZA 5T3QA 2W9FB 1P2AA 3E7OA 4DGNA 4XX9A 4U3YA 4U44A 5EM8A 5F95A 4F63A 3CQUA 5DBXA 4EH7A 5AP6A 3G33A 3HMNA 4A9RA 4CTBA 1EYZA 1DAYA 5KCVA 1FBNA 2E2BA 1FINA 3HMOA 3EFLA 4FKPA 5HORA 4H05A 3PYYA 5HX8A 2WU6A 1E4EB 3QTUA 2VTOA 4NL0A 4BVUA 3FE3A 4I5PA 3FZ1A 3JPVA 1EHIA 5EHYA 4EK3A 2OBJA 3QXPA 5KBQA 1V0BA 3UOJA 3ZFYA 5JMSA 4KUJA 4QYYA 1CMKE 1WCCA 3P0MA 3VBQA 4F6SA 5BYYA 5J1WA 2KULA 4D1ZA 4J8MA 4CKRA 2BAJA 4FEQA 3TIGA 2CKOA 2ZM1A 4N6YA 1Q62A 3QRJA 3PRFA 3UIUA 5A4QA 2R0IA 2FSLX 4FSRA 2QF7A 3P78A 3G5DA 2BDFA 4LGHA 1OIRA 2HZNA 3R83A 4BHZA 4TY1A 1YHSA 4PF4A 4ZS0A 4BICA 3RHXA 1IG1A 1ZLTA 1H26A 1REJA 2I1MA 2WMBA 2XRWA 4WO5A 4EHZA 3VPBA 5BVEA 4MHAA 3SG9A 1E1XA 4PL4A 4I22A 1ND4A 3ALNA 4JBPA 3UP2A 3ALOA 5IZFA 1UU3A 3V4ZA 4C3PA 4M7IA 3R2BA 4CD0A 4ZLZA 4U42A 1FMKA 3EN4A 4MKCA 4FICA 4KKEA 4UX9A 3ETJA 1KE7A 4AFEA 4ZSLA 1SNUA 2G2HA 4Y46A 1OPLA 4RX8A 4HNUA 4FUYA 3D9VA 3ORXA 4Z55A 3BQCA 2WTWA 4IC7A 4L52A 1BYGA 3DJ6A 2YM5A 2C4GA 2A0CX 3GQIA 4HCVA 4I3ZA 4JQ8A 4P5ZA 4DLJA 3DFCB 3BRBA 1XBAA 3QTIA 3RCDA 1UU9A 3KKVA 4FFPA 2ZMDA 5DA3A 3PP1A 2C6LA 3E8EA 3NCZA 2OIBA 2PE0A 1CQJB 3VUHA 5BQ0A 3FZPA 3R8PA 3F2AA 2VN9A 4S34A 3NYVA 5IUIA 3RMFA 2OIQA 1XR1A 3QAME 3S95A 2ZB0A 5L2SA 3COHA 3MWEA 3FXXA 4EOKA 4C62A 3PJCA 2BTRA 2BFXA 4HGTA 3SXFA 3RALA 4AA0A 5KHXA 1T46A 3Q4UA 3QBNA 3ZO1A 4USFA 4I6HA 3ZRLA 4KA3A 3D15A 3AC5A 3RINA 2ERZE 3OUUA 5AUYA 3QC4A 5KMOA 3D7ZA 3L8SA 5E1EA 4J8NA 5FNVF 5JFSA 2WQBA 1Z2PX 2SRCA 4UZHA 2XKFA 4FV4A 3I12A 3MB6A 1CTPE 5C4LA 2PMLX 4FT0A 2J0LA 4IVAA 4TTHB 4YU2A 2WOTA 3O50A 4MH7A 5D9HA 3M1SA 5F94A 3HA8A 5DR2A 3R9DA 4F08A 4YLLA 1M2RA 3WE4A 4MV3A 3ZM9A 2OIDA 4QMUA 4WIHA 2W99B 4E93A 5BUEA 1E9HA 3E62A 5HO7A 3CPBA 1OL6A 2W5AA 4QYHA 1KV2A 4H39A 1XH8A 3O17A 3CCNA 3FI8A 2C3LA 2VTAA 3U4UA 4E5BA 2R5TA 4EG0A 3MJ1A 3EB0A 2PVPA 1B6CB 1WBSA 4FTRA 3WOWA 4E20A 2QLQA 3DS6A 3DGKA 4PQNA 5IQIA 4YHFA 3RP9A 4IZ7A 2YEXA 4M0YA 4EYJA 4YJ3F 3JY9A 5C27A 4DE4A 5HTCA 2A27A 2R3HA 2GMXA 3DTCA 3GQLA 4HZSA 4GVAA 2CSNA 2UZLA 2QONA 4QT1A 4C5AA 2J9MA 3CQEA 3NW6A 1XH9A 3WZDA 5LOVF 5ANDA 3KRLA 3CLYA 2BRHA 2VWXA 3E92A 2QC6A 5AP3A 5A54A 2I80A 4GIIA 4L3JA 2VZ6A 2PSQA 4LRKA 4USDA 3JVRA 5E7RA 4ITJA 4BDAA 5JKGA 2I40A 3KVXA 2OF2A 4X2JA 5AUXA 4A9YA 4FKIA 3SG8A 3RWQA 2J2IB 4FSWA 4IH8A 3NUAA 1M7QA 2ZAZA 3OFMA 4FV2A 2X0SA 4QQ5A 1I7NA 1YXTA 2E9UA 4CFWA 1GJOA 4A7CA 4XP0A 4TW9A 2VWWA 5AIRA 2ETRA 3CE3A 4U45A 2QOKA 4O7YA 1XJDA 3NS9A 2QOOA 2CJMA 4KBKA 5M4IA 4G6LA 5EW3A 2IVUA 5D1JA 5CF8A 1CQIB 5LYJF 4QQJA 4JS8A 3SX9A 4YPSA 3C9WA 1JPAA 3BYSA 3NW7A 4YTHA 4YZCA 4XYFA 1B6SA 3QRIA 2XKDA 4CFXA 3G6GA 3UZRA 2PBZA 1P14A 5KX8A 3ZBFA 4IWPA 4FL1A 4TYGA 4HGSA 4AT4A 4AU8A 4NT4A 4RIXB 1OKWA 1IA9A 5K4IA 2BPMA 4QP1A 3W33A 3O8TA 4EONA 4IMYA 3UJGA 4O4LF 3Q32A 3ZLXA 5GIOE 5A46A 3R1QA 3HRFA 4UB7A 3KF4A 3TV4A 2WOUA 4FC0A 4UALA 2A2AA 3CSVA 4R3CA 5DE2A 3LM5A 4IX3A 3KRWA 2YIWA 4ZTRA 4Q9ZA 4BN1A 3LCSA 1YXSA 1OBGA 2ZV8A 5CS6A 5LXMA 3Q3BA 3ID6C 4I21A 4Y5HA 2LAVA 3R6XA 3NUPA 4LOPA 1DM2A 1PMVA 2ONLC 3Q9WA 5EM7A 3V8TA 3TUDA 1R39A 2B1PA 4FSNA 5BUJA 1U54A 4PDSA 3UC4A 4D5KA 2JIIA 3I6WA 4G16A 5HE2A 2HIWA 4IZOA 4GKIA 4JDJA 4XG4A 4ZJJA 3E8DA 3FMJA 4RVLA 1OIYA 4ORKA 1CKPA 4J1RA 4FT9A 2JKOA 3E8CA 4KIOA 4RMZA 5AFVA 4PNKA 5IA0A 1M6VA 1PJKA 4LMNA 1WBPA 3I0QA 3QFVA 2CGWA 2WD1A 2C6DA 2GQRA 5H3QA 2YZAA 2BHEA 3MY1A 3TUBA 5CAEB 5ETAA 2Y4IC 3Q2OA 2Y6MA 3NUYA 4YTIA 4O0SA 2PULA 4I20A 2XIYA 2C6OA 4WG4A 1SVHA 2R3RA 2WTKC 3OXTA 4MV8A 3RUPA 2QU5A 2X0GA 2UW6A 3PSCA 3ZSGA 5CENA 4EJNA 2IN6A 3KREA 5IEXA 5IQFA 5H2UA 3QD2B 2FPGB 4BF2A 3Q5ZA 4MV1A 4GU9A 3TWJA 2R4BA 5CAPA 3NYNA 2WIHA 4IVDA 3REPA 3WARA 5H80A 5GJFA 4ZY5A 5LVMA 2RL5A 4OBQA 4HYIA 3EYGA 3BV2A 3KL8A 4C59A 3FSFA 2WFYA 3ZH8A 5CNNA 3MJFA 4PDYA 4JX7A 4U7ZA 3L8PA 4MXAA 3R2YA 4GT5A 2Z7RA 3RK5A 3EHAA 4OW8A 4RX5A 2YJRA 4DHFA 2QLUA 2RFNA 4DA5A 3RCJA 5L6PA 2HZ0A 1YHVA 4EOLA 4IACA 2CGVA 3KXMA 4HVDA 4J53A 2I0VA 3H30A 4X6QC 3T8OA 3VJOA 3KMWA 2XKCA 4WHZA 4M0ZA 1Z5MA 4H58A 2CKPA 3GFWA 4YBKA 1ATPE 1FVVA 3MVMA 2B0QA 2WKMA 4AOJA 1XHAA 3CGOA 1J3HA 3FKLA 3G6HA 3E3PA 5HBHA 3T9TA 4LYNA 3UNKA 4JAJA 1SYKA 1GZNA 2O8YA 1KWPA 3FI3A 1PXLA 4IAKA 4TZRA 5AA9A 5EW9A 2JC6A 5EQYA 2XBAA 3IW4A 4QP7A 1F3MC 4FFLA 2XM8A 3DKCA 2CNUA 2VWBA 3QLFA 4YJ2F 4KSPA 3LIJA 3COMA 3D4QA 5FM3A 2NP8A 3FQSA 3KFAA 2YZNA 3RAWA 4ACCA 4XYLB 1OL2A 2QHNA 2X6EA 3UFXB 5AUZA 3L9LA 2VTNA 2OZAA 1NVRA 1NVSA 2FUMA 4B6LA 2ERKA 2PVHA 2HW7A 2X9EA 3MFTA 2CDZA 1Y8YA 3DZOA 3ODZX 5M06A 3VS3A 1Q99A 3ET7A 2P0CA 2UZOA 3WO0A 3FLYA 1B38A 2PHKA 3F5PA 4G3CA 4O6LA 1Q41A 4U41A 4FSMA 3E5AA 1RE8A 3GCPA 3HMMA 3QGYA 4FIJA 4NKSA 4E8AA 2XP2A 4ENYA 3K2LA 1CE8A 2C69A 2OXYA 4YTCA 2OU7A 4L45A 1BL7A 5FTOA 3O23A 2IP4A 1JSUA 4IAAA 3VIDA 5AAEA 4BZOA 5ETFA 4V0GA 4O0WA 1PX2A 4QMVA 4QPSA 2BVAA 3CY2A 2I0EA 1H1RA 2WMSA 3BV3A 4RC4A 5CU3A 1ERKA 5BUIA 2WAJA 1JKTA 4FIFA 4KS8A 5M44A 1TQIA 2YIXA 3T3VA 2C6EA 3WI6A 4CKJA 3GIDA 2YM3A 1ZOEA 2R3PA 2X6DA 3F7WA 3TZ7A 4U8ZA 5B2KA 4BBEA 3HV7A 4WRSA 2GCDA 3RHKA 1OL1A 4G3GA 1AD5A 4FEWA 4NFNA 4XCUA 5FEQA 3TG1A 3ZRKA 4YZMA 2XK4A 3NZ0A 4RLLA 4V04A 1JBPE 3HB9A 5FEEA 3KK9A 5M55A 3ORNA 2EB3A 2JLDA 2QG7A 3OCTA 3R28A 4O27B 5ANOA 1JSTA 1O6KA 3BGZA 3OUNB 4OTWA 4W4VA 3O7LB 4CKIA 2CMWA 4RWLA 3VUMA 4QP3A 4AW5A 3TEIA 2JKMA 2HJWA 1T36A 3TKUA 4HNVA 3U55A 2VWUA 4XG6A 5L8LA 3TKIA 5C1QB 2VTRA 3LJ0A 1SNXA 4F7SA 1VYZA 4HCTA 2ACXA 4F4PA 2REIA 2WQMA 5E8WA 4TWCA 4E26A 3G90X 4OTHA 2YW2A 1FQ1B 3IOKA 3OC1A 1PY5A 4TPTA 4WOVA 4CV9A 4EUUA 1EUDB 3F88A 5IA3A 5ANGA 3GB2A 3TW6A 4YGAA 2V5AA 4E1ZA 2XEZA 3U9SA 2W1IA 3U4WA 3SE7A 2AUHA 4EQUA 5CVGA 3ITZA 3RV4A 4BGGA 4LUEA 2GNLA 4I0SA 4FG8A 1JKSA 4RC2A 3JS2A 5EYCA 2W7XA 4RJ8A 3V6SA 3R5HA 2OW3A 4X21A 3QTQA 3HV4A 2XK3A 3ORLA 3KC3A 2ITTA 5M4CA 2O5KA 4RJ4A 4EK5A 1YXUA 4XYMB 4D9TA 3NAXA 5FTGA 4MV9A 4M84A 1Q8UA 5IA5A 4O4IF 1G3NA 4DLIA 5HIBA 2UZEA 2YZLA 3OWJA 2PVMA 4IZYA 4ZTQA 3UNJA 5L6OA 2XNBA 3HRCA 2QVSE 4ZOLF 3Q53A 3DBQA 3ZFMA 4MV7A 2QOQA 2CNVA 1J7IA 2WQEA 3NVKI 2W6PA 3A62A 3EIDA 3LM0A 4ACMA 3JUHA 1LEZA 4EORA 4X3FA 2EU9A 3BI6A 3TZ9A 4EUTA 5CT7A 4JDKA 2YM6A 5C8NA 5CSVA 2PPQA 4HVIA 5C8KA 4YBJA 2HAKA 2YS7A 3D5VA 3O8PA 1URWA 3PXQA 2YCRA 3MFRA 4W8DA 3GOPA 3HMIA 2X81A 4BDGA 3MVHA 3R1NA 3VW8A 2R3FA 4U81A 5CAUA 4IM2A 3OOMA 1GIJA 5E92A 3WO1A 4FODA 4K8AA 4R78A 1ZY5A 3ANQA 3PIYA 4D1XA 4YAKB 1H07A 1YW2A 4MNEA 4CSVA 1YDRE 4MQ1A 4NM5A 4JI9A 1GLVA 3DXNA 5HBJA 5KMNA 2R7LA 3AX6A 5D7VA 1HOWA 2B53A 3NNVA 2W5BA 3KXZA 1NY3A 2C6IA 3TTIA 3UG2A 5H8GA 3ULIA 4FZ7A 4OT6A 3HX4A 4RFZA 3AMAA 3V01A 5J87A 5HZNA 4F6WA 4LL5A 3R8VA 2QOHA 4RVKA 3Q6UA 2YDKA 5FBNC 5LARA 2I6LA 3ZDIA 1RW8A 3QQLA 4HPUE 4KBAA 1WR2A 1ZYDA 3FKNA 2J0MB 5D11A 4GRBA 5HBRB 2GDOA 3K3PA 4O22A 3F6XA 1PRYA 4E6QA 4QMMA 4HVGA 4AP7A 4BDEA 3R63A 4R1YA 2VWZA 1PXJA 4C4IA 1WBTA 1OUYA 3KB7A 5DRBA 4GYGA 4FTMA 3VN9A 4DG3E 1EUCB 1VBGA 4XZ3B 2CCHA 2R87A 4RJ5A 2QI8A 4FNWA 2W6OA 1WZYA 1JLUE 2LGCA 3FZRA 3GC0A 4IB0A 4PTGA 5KZ0A 3R8ZA 3VS2A 2BIKB 2DWBA 3RGFA 3UDBA 3ZHPC 2HOGA 2JIVA 3EQFA 3G15A 4RC3A 3GCUA 4ZIMA 2R7MA 5C9CA 4MEDA 4JAIA 3LXKA 2HZ4A 4YC3A 3UVPA 4FTTA 2WQOA 3IGOA 4U40A 4Y8DA 3ZC5A 1UNLA 5HD4A 3EOCA 3ZEWA 3H9FA 5BPYA 4OGRA 5LWMA 5AP1A 2C47A 3PZHA 3RPYA 5DRDA 4YLKA 3RTPA 1M0TA 3UGCA 2UZVA 4FG7A 4B99A 2UW4A 4U97A 3NGAA 3EN9A 4FV8A 3QU0A 3W55A 3LCTA 2PUIA 3D5UA 1H08A 5DIAA 4FSZA 3MH1A 3RVGA 4ZS4A 1NVQA 3R04A 2PUPA 3BHHA 2XNPA 1KJQA 2O0UA 5HQ0A 3MVLA 4CT2A 4NM3A 2I0YA 4XUFA 2VX1A 4IBMA 5JH6A 3GC8A 2JFLA 4KBCA 2C0OA 3C50A 5E8TA 5BVWA 4DAWA 5KMLA 3HZTA 4HQ6A 5C8YF 3QTRA 5AAFA 3ROYA 5C4KA 3HP5A 4NUSA 4BIBA 3GCQA 4FKOA 3K3JA 4ONAA 2GNFA 3MY5A 3U51A 4R5YA 4DINA 3UPZA 1PXPA 2ZDHA 3MFUA 3PDTA 3FY0A 4DBXA 1A06A 3UO4A 3H9RA 1IAHA 4OR5A 3LCKA 1AQ1A 3PIXA 4EJ7A 2PVJA 3FV8A 1RQQA 4W4WA 5AP2A 3BE2A 3NNWA 4YJTA 1OMWA 3AT4A 3D0EA 4O83A 3FBVA 3JZIA 4YNOA 4NWMA 4E6AA 4EWHA 2VTSA 3MA3A 4LOOA 3Q4ZA 4U0IA 4AN9A 3Q4TA 1JDBB 3HYHA 2Y4IB 2NPQA 3EL8A 1ZZLA 4DYMA 2ZV9A 5IMXA 2WTKB 4FSUA 1SZMA 3BHUA 3MSSA 3ATSA 3BLRA 3VBTA 4FT3A 2XIKA 4CFNA 3D7TA 3KXXA 4I41A 2WU7A 2XK6A 2QOIA 1Q97A 1VEBA 4GK2A 4NSTA 2OH4A 1H27A 1SVGA 2C0IA 3ZRMA 4XV2A 3LMGA 2BRNA 1ZMVA 5HCZA 2Z02A 3BQRA 3R02A 4JQEA 5FP6A 4GV1A 1BMKA 2YACA 3DT1A 4OTQA 4IAFA 1KSWA 2IG7A 4RBLA 1M52A 3N6RA 1DV2A 4OTIA 2BZHB 2HENA 2XZSA 5AP4A 3PJ1A 3OS3A 4MK0A 4PMMA 4UXQA 3U9CA 5LOHA 2FP4B 5AP0A 3UMWA 2G15A 4I93A 3RK7A 4AAAA 3QD0A 5CSHA 3OVVA 3C4ZA 4FKVA 3HA6A 2UZNA 4UWBA 3Q2JA 3ZU7A 3WZKA 4AGDA 3I60A 1JDEA 4FT5A 1CS0A 5AUUA 1K3AA 3S2PA 2YZMA 2JAVA 2CKQA 2JFMA 5JSMA 4C36A 3WILA 1Z9XA 3GU4A 1M17A 3FAAA 3G9LX 3HUCA 2ZDUA 4KKHA 3EFKA 5JN2A 3TIIA 2W1CA 3ZUUA 2PL0A 3MPMA 2QG5A 3L9NA 4X2FA 4WUAA 3CC6A 4QMXA 2PY3A 3FI2A 4PP9A 3U8WA 2XCKA 4BBFA 4LG4A 4BYJA 4Z16A 4XX0B 4R5SA 2IZTA 4M9UA 4J98A 4IAYA 4A4XA 1Y91A 2JKQA 4Z3VA 4C5CA 4MXCA 3NCGA 5C1PA 2JIUA 1KE9A 3PLSA 5KMKA 4RFMA 3GFEA 3GXLA 2PMOX 2V0DA 2XIRA 5I9YA 2C5NA 4K0YA 1PKDA 3EQIA 4O7TA 4NW6A 4ZSGA 4LUDA 5E1SA 1PXKA 3BU6A 4F0FA 3CJGA 2PK9A 4RIWA 2FH9A 5EH0A 4EOSA 5I4NA 3SRVB 1KOBA 4G5JA 4ZP5A 2J0KA 3QQFA 3ENHA 4AW2A 1DI9A 2XNNA 3DTWA 3IQ7A 4BCNA 2R2PA 1UA2A 3FMMA 5HV6A 4S30A 4RRVA 3A99A 4O4JF 4S32A 1JSVA 1OKZA 2V62A 3NVMB 2BILB 4XEYA 4CQEA 3IPHA 5B2MA 2VR1A 4ZEGA 4K33A 5KO1A 2WTVA 2XYUA 3PWYA 4CFMA 5BVFA 1G5SA 1KE6A 5HHWA 2ZDQA 3UOHA 1URCA 4YZDA 2CNQA 4F0GA 4E4TA 1FGIA 3PY3A 4UWCA 5H9BA 3PVUA 3BWJA 4L8MA 4NW5A 5LA6F 4Y8VB 4IB5A 3EYHA 4RWIA 3ZEPA 2FPIB 3D2KA 4TV8F 3R5XA 4ZAUA 4Z9LA 3VUDA 3QZGA 2HGSA 4RIXA 3TM0A 3FY2A 4ANSA 3ZLWA 2ITPA 5CSXA 4I6QA 4BKJA 5CASA 2VX0A 4FKTA 2J51A 5A4CA 1S9IA 3EQHA 2NU8B 3II5A 4J7BA 2XF0A 3UIMA 2BIYA 3LMHA 3LQ3A 2OJJA 3ELJA 5C26A 2RF9A 2Y4PA 4IZ5A 2E9VA 2XEYA 3Q96A 4GUEA 4LMUA 5M4FA 3D5WA 5HNIX 4YJUA 3OEFX 3TINA 4XLIA 3P86A 4BY9E 4ZOGA 4I4TF 3KXHA 4RZWA 5HGIA 1F5QA 4FKLA 5TKDA 2OO8X 3QCSA 3FLSA 3TDWA 3A4OX 5IU2A 4FVPA 3ETAA 4AZWA 3SW4A 5F20A 3Q52A 3GP0A 2C1AA 3F3UA 4CFVA 4CMTA 4GFGA 2W71A 4ASXA 4G9RA 3JRXA 3NYOA 1OKVA 2OG8A 3G2FA 4ALUA 2WTJA 2XRUA 4DH5A 2C5YA 3SVVA 4E73A 5KMJA 2VTTA 4RPVA 2ITOA 3RJCA 2FB9A 3V04A 3AGMA 3CBLA 3H9OA 3KF7A 3QCQA 1H24A 4RJ3A 1WMKA 3OWKA 5DR9A 1OECA 3DF7A 3DV3A 3ENMA 4KB8A 5EI2A 1MQ4A 2IVVA 5AP5A 4RWJA 3OTUA 3EMGA 3RK9A 4UXLA 3NDMA 5L8KA 2YM8A 4ARKA 2WMTA 4LM5A 5JH7F 2X7OA 5T6KA 4FU0A 1H1PA 2RGPA 3KY2A 2HCKA 2VTIA 4N70A 4A9UA 4ALVA 3MESA 4AZFA 2ESMA 2PVKA 4GKHA 4AACA 3QXOA 3W1FA 1DS5A 5TOZA 5CEOA 3OT3A 3P1AA 3PJ2A 4PWNA 3E7VA 4WG3A 2V7AA 3MTFA 3KAKA 4TWNA 5EKOA 2ZV7A 3NIZA 3PVGA 2G2FA 3FEGA 3FHRA 3UMXA 3QRKA 3LFCA 3LFAA 3MH3A 3R8UA 4MD8E 3OWLA 3P7CA 2QKWB 2AYPA 3U87A 4CG9A 4YO6A 3B2WA 2X8EA 3LCOA 3UOLA 2B4SB 4EOOA 1TVOA 5FQDC 2QKRA 3C4CA 1M2QA 4FFOA 2YM4A 4EQCA 1CM8A 3RWPA 3DB8A 4YAJB 3R7OA 2FSMX 5HNGA 4L6QA 3U6JA 4YMJA 1MUOA 4EWQA 4AGWA 5HTBA 3TKHA 5K5XA 4C7TA 4JIKA 4PP7A 2J4ZA 3PXFA 3C0IA 1Z57A 3KU2A 3R9HA 5IMEA 5K5NA 3NYXA 3G8DA 3OUZA 4NU1A 1JQHA 3AC2A 3VWAA 4MNFA 5I0BA 4KSQA 3VBVA 3CQWA 4F1OA 1JNKA 4DFLA 3W2RA 2CGXA 3UYTA 2IW6A 4GW8A 1OZ1A 2VX3A 2XIXA 4GFOA 2J0IA 3BLQA 4FUXA 3VS0A 3BU3A 1ULZA 5HVJA 3PPKA 4DT8A 4XBUA 5EM5A 3AC1A 3ACKA 3KRRA 4ZJIA 4RZQA 1LEWA 2HWPA 5HE1A 1U59A 5BNJA 3O51A 1FVRA 1M7NA 3D5XA 3F2NA 3L8XA 3VBWA 2O3PA 3CTHA 2X1NA 3KXNA 4FTCA 4I4FA 2ZDGA 2ITNA 4ZQIA 3C13A 3BYOA 3IDPA 3KN5A 3LAUA 3ZO2A 2BZIB 3TCPA 3RFCA 4WBNF 1PHKA 2I0HA 4TUYF 3VNTA 4TWOA 1U5QA 3R9NA 4AOTA 4BDHA 4MF1A 4O7NA 4X6RA 4EC9A 5FXSA 5A4TA 2QOCA 1WBWA 3DAEA 2DQ7X 1AGWA 5JGAA 4FKRA 1YOJA 1QPJA 2X4ZA 4NZWB 2Z04A 3QF9A 2CN5A 4C2WA 4XRJA 4BTFA 2FYSA 4U79A 1H1SA 5E8ZA 1YOMA 5BVKA 4DEBA 4GH2A 3VVHA 4CCBA 4ID7A 4J52A 2GS7A 5AUWA 5TT7A 3PG1A 5HLPA 4NJDA 5I9WA 3DBCA 4WNKA 3MN3A 2C1BA 2BAQA 1CSNA 4JBQA 4FG9A 3EZRA 5CEKA 3UPXA 3CXWA 5EYKA 3TACA 3VAPA 2XIZA 4FIHA 1GAGA 2R64A 2WMVA 3QZHA 4HR7A 4BGHA 3ORZA 3SGCA 4BDFA 2R85A 4FV0A 4B8MA 4NH1A 3BGPA 3Q9YA 4JR3A 4PDOA 4E4MA 3TZMA 4KRDA 1PXOA 3FDNA 3F82A 4BR3A 4TV9F 4JDIA 4IE9A 3F7ZA 4TYHB 5EDQA 3KK8A 3OXIA 2BRBA 4F0IA 2JITA 1K2PA 1QPCA 2XMYA 5ANJA 1VKZA 2YZGA 4GJ3A 4M67A 5A6OA 4EHVA 3H4JA 5IEYA 2OLSA 3FYKX 3FL4A 4RIYA 3Q5IA 3KXGA 5AADA 1PMEA 3FC1X 4IC8A 2UZUE 4BCPA 4EI4A 3CJFA 3W8QA 4F6UA 3R7EA 5L2WA 5FGKA 3QRUA 2VRXA 2WELA 4FKGA 5CALA 1WBNA 1YI4A 2GTMA 1ZRZA 3QUEA 4M3QA 3MH0A 4P5QA 4YSJA 3N4TA 3DQWA 4I5MA 4X3JA 2R7IA 3E88A 3POOA 5I5ZA 5KKNB 5CB4F 2PE1A 2QO7A 1RDQE 5DWRA 4DEDA 4G17A 5ACBC 4AE6A 4DG0E 3IGGA 3G0EA 2RFEA 2HXQA 4IAZA 2OICA 3R23A 5HKMA 3SV0A 2C00A 2WO6A 4H3BA 4BCMA 2YRXA 5B2LA 3TDVA 5GJGA 4PTCA 4Y95A 1XKKA 4WNPA 4IQ6A 1KJ8A 3CKXA 3MV5A 3KQ7A 4ZSAA 3AD4A 4B8LA 2EXMA 4GSBA 5C03A 3A4PA 2E9OA 2FSTX 1JOWB 1ZARA 4FSYA 4U6RA 3DDPA 3LP8A 2W5HA 4G5PA 2IZUA 5CLPA 2J5FA 4I50F 4BDBA 5FXQA 4ITIA 2YAKA 1IOVA 1OITA 1P4OA 2BRMA 4I1ZA 4F9WA 3LOKA 2X9FA 4C58A 3CY3A 5CT0A 4YC6A 4M14A 4ACHA 4EZ7A 2X7GA 3OMVA 3POZA 4HYSA 1UVRA 3DKFA 4FIGA 4H3PA 1IOWA 4RWKA 3H10A 3R21A 2XM9A 4FOBA 3NW5A 3ZZEA 3GT8A 3UIBA 5ITAA 4F9AA 3V6RA 1H01A 3D2IA 5CY3A 2UW8A 5AIKA 3QTZA 3UYSA 2YABA 4E6CA 3WZEA 4RX7A 5M57A 5IISA 1Q4LA 3R01A 2R3LA 4MX9A 4RA5A 3A2CA 3JZFA 1QL6A 2UW0A 5LQFA 2XH5A 3QALE 2X4FA 3ZOSA 2XS0A 3GEQA 2IZSA 4JXFA 2CCIA 4O0YA 2QK4A 4GMYA 2EUFB 2XNEA 5ETCA 5L3AA 3FYJX 5EG3A 2P2IA 3W32A 5DT0A 3AC8A 3PP0A 3ZUTA 2A19B 1IEPA 2OFVA 4X0MA 1JKLA 4E4LA 2C30A 5KE0A 5IQDA 1K9AA 3VF8A 5A4LA 4ZSEA 4X3FC 3I79A 3IKAA 4NCTC 1STCE 2QQ7A 3PA4A 4U9AA 3LVPA 4MTAA 3MW1A 4XOYA 5L2IA 4FTIA 3HP2A 2PN1A 4YHTA 5DH3A 1ZYJA 3HAMA 4P2KA 4Y72A 2BUJA 2G2IA 4V01A 3RAHA 2FB8A 3HRBA 2YISA 4W4XA 1W98A 3ORRA 4PUZA 3NRMA 3SXRA 2HY81 5D7AA 2BTSA 3QA8A 4OBPA 2UUEA 4TXCA 3ZM4A 4AX8A 4ZTMA 5KNJA 4JRNA 5HG8A 3QLGA 1IR3A 4BTMA 2C5VA 3RAKA 3TNHA 1YQJA 4HVSA 3R71A 3V8SA 3QKKA 2YJSA 2OKRA 2UW3A 1H8FA 4UEUA 4XRLA 4DF3A 3LW0A 2BKKA 3RZBA 3QL8A 2YIQA 4P7EA 3ZFXA 4L1KA 3W8LA 2ITZA 4Y5QA 5DVRA 2V59A 3PA3A 2NNWB 4FEUA 4G6OA 1H4LA 3HDMA 3JYAA 1VR2A 5CU2A 1WAKA 4MYGA 1WVXA 3MJ2A 4FZ6A 5HNBA 4FK6A 4ZSJA 3KEXA 5M56A 2W05A 1AUVA 4R77A 2R3QA 3FUPA 2AC5A 4RT7A 4S2ZA 5IQBA 3FXWA 2F7EE 5AJQA 3OXZA 3FC2A 4C4EA 3U6IA 2YFXA 4NIFB 4BZNA 3S1HA 1R0PA 5L6WL 4X2KA 1TQMA 3A7JA 4IX4A 4KRCA 5EW8A 1B39A 5ICPA 4AWIA 3BHYA 1H1QA 1SMHA 2G9XA 3GU7A 4G31A 4ZZOA 2BR1A 3F9NA 2O64A 2WPAA 2W6MA 3LFDA 3PIZA 4Z7HA 1JWHA 4FL2A 4LQMA 2WEIA 3KULA 5TO8A 3D94A 3VUIA 4EGJA 1W0XC 4Q2AA 4AXAA 3K3IA 2PZIA 2VTMA 4BCIA 1UWJA 4I0TA 3SDJA 5CU4A 4B0GA 3RKBA 5BVNA 4L7SA 4QMTA 3FI4A 4DGGA 4X2NA 3FZTA 2QCSA 4JDHA 4FTKA 4RQKA 4D9UA 1OVEA 3LFBA 5G6VA 2ZM4A 4RSSA 2ITQA 2R3MA 3G51A 5J1VA 3EQDA 4QMNA 4QMYA 5C8MA 4BCFA 4BCHA 3EQRA 4QO9A 3S00A 4R7IA 1JKJB 2H96A 3PA5A 2XVDA 2Y0AA 3FZSA 3NUXA 4JNWA 3C0HA 4O21A 5DLSA 3SOCA 5CU0A 5HVKA 2CZGA 3QQUA 3FMEA 4JL9A 3R9RA 4UYAA 3ETHA 4MA5A 4OTRA 1KV1A 1QMZA 2XBJA 2B9HA 2WQNA 2ZOQA 1H1WA 2UZDA 3H3CA 3UNZA 4BHNA 4IWQA 5J9LA 5E8VA 2VD5A 5K3YA 2O63A 3FL5A 3LFFA 3MBLA 4BCKA 4Z7GA 3P5KA 4IX5A 2XNMA 4G9CA 3N51A 2YITA 4U43A 5DFPA 4C4FA 5CEQA 4F7JA 5JZJA 2PZRA 3C4XA 4JG6A 3DOGA 1U54B 3U9NA 5DHJA 4CV8A 3QX2A 4C4GA 5A4EA 4ZJVA 4OTFA 1XH5A 3L1SA 5CVHA 4EHGA 2CGUA 3JRWA 4BB4A 4EK4A 1KUTA 3E5NA 4ZTSA 3MS9A 4IJ9A 2DIKA 5LVOA 4LI5A 3SW7A 1WVYA 4KS7A 3C1XA 3D83A 2QOFA 2YDIA 2OLCA 3TXOA 4YUQA 1Q8ZA 4QMLA 1OBDA 2W1FA 4J99A 4IM3A 4G3EA 4XHKB 5FD2A 3MY0A 3QD4A 3HNGA 3R7VA 1GSAA 3FXZA 4OUCA 1JAMA 2WTIA 4PMTA 5DGZA 5JRSA 3PG3A 5CEMA 4FR4A 5CQUA 2NRUA 4FI1A 3R8LA 4RVMA 4AOIA 4ZTNA 1HCKA 3F61A 4BIDA 4MAMA 3T9IA 4C61A 1ZY4A 4XOZA 4R7HA 5AP7A 3G0FA 3TIZA 4QP4A 4DLKA 3PLAE 3M2WA 3TZ8A 4K11A 5D12A 3R00A 5KBRA 1CKJA 3WYXA 4QP2A 2FO0A 3BYMA 4YJQA 2WZJA 4JIAA 3EJ1A 1I7LA 1M14A 1IRKA 2J7TA 1P5EA 1OGUA 2JKKA 3ATTA 3C7QA 3HLLA 4NK9A 3LJ1A 4QRCA 4RGJA 5DOSA 3PE2A 3ZTXA 5IQGA 5LCJA 4D1SA 3QHRA 5D8DA 1M2PA 3P7BA 4ENXA 1GZ8A 3AD5A 5DN3A 5JQGF 3UQCA 2R7KA 3I81A 3BBWA 4A4LA 1W93A 5C01A 4L3PA 3I0OA 1HCLA 3A8XA 4FKWA 3KVWA 3FLZA 3AXWA 4YBZB 2H8HA 3SRVA 2P55A 3QQHA 4MBLA 1OUKA 2UW5A 4GT3A 4QSHA 1PYXA 4GT4A 1Y8GA 5FXRA 4DFNA 5DT4A 5CI7A 2Y8OA 2DS1A 5F1ZA 4EQMA 4QP8A 2I87A 1GGOA 2YS6A 4JR7A 2KTYA 2GU8A 3CGFA 5HG9A 4AE9A 1W83A 4PMSA 4F9YA 5EM6A 5EZYF 4K6ZA 1NXKA 4U80A 2GQGA 3FSKA 2H9VA 1BXRA 2W1GA 3L9MA 4A4OA 4DCAA 1L8TA 1VZOA 1UWHA 2CLQA 3C4WA 3JY0A 3SC1A 4II5A 4W8EA 2WHBA 3FLWA 4FZFB 1EZ1A 4A9TA 3ZSHA 2GS2A 1E4EA 1QPDA 3QX4A 3KN6A 4F1TA 1KE8A 1MQBA 2OH0E 5JVDF 2V5QA 3IG7A 3QQJA 4BCJA 3PVWA 3R7YA 2P33A 3LMIA 3MFSA 2WIPA 4DG2E 3S0OA 1LUFA 5CWZA 3QCYA 4C5BA 2W4KA 3IDBA 5LVNA 2W17A 4PX6A 4AGUA 2BMCA 2OZAB 4PDPA 4O82A 3UO6A 4ZZNA 3IW5A 4D0XA 3RNIA 3LLTA 4HGEA 1XO2B 3BHTA 2R7NA 4WSYA 2NU9B 3ZONA 2P2HA 2W06A 4EH4A 3VBXA 3O2MA 4HCUA 5LVPA 1YXVA 3TNIA 1YDTE 4BRXA 1OPKA 4XLVA 3R9OA 2VQDA 3VA7A 2Z2WA 5I9VA 4FK3A 3UC3A 1O6LA 2R7BA 4UN0C 5JGBA 4RX9A 5CTPA 4AN2A 4CCUA 3COKA 3V5PA 3U9TA 4ZXTA 4QMZA 4I5CA 4O7WA 3KAJA 3QCXA 4RIOA 3ZS5A 4FL3A 3FMLA 3VC4A 3ERKA 4N4SA 5IQAA 5E8XA 4V0GB 4JJRA 4L42A 2Y6OA 4MV4A 1Q3WA 4BDIA 2PUUA 1GNGA 3ZMMA 4AN3A 4HNIA 3WF8A 5HLNA 4J97A 5D41A 2ZM3A 5CF5A 3VS4A 3CR0A 4YTFA 5JFVA 2Z7QA 4YJNA 4GJ2A 5GIPE 3BLHA 4XV9A 3EQCA 4G1WA 1Q5KA 3HO8A 3BBTB 2VWYA 3KCKA 4W4YA 3BIZA 1G8SA 5DPVA 4D28A 3CKWA 4FGBA 1PMUA 3GBZA 4JG8A 3LFNA 3OHTA 4UZDA 3W2OA 5I9XA 4O7ZA 3DLSA 2IVTA 4HW7A 1X8BA 4IVBA 2C6KA 4M12A 2X2MA 1M0WA 4EGQA 3KMUA 3DK6A 4GU6A 4O6EA 5AV1A 3UQFA 5FDXA 3BG5A 3V5QA 2VTJA 3HKOA 4DIMA 3MVJA 4LOQA 3FMHA 3UVQA 3PSDA 3LXLA 4AZEA 3JXWA 5IA4A 3V3VA 3ZUVA 4TYJA 4FZDB 4LGGA 4NJ3A 4ZTHA 5JFWA 4ANLA 4XJ0A 2ZMCA 4LRMA 4MWIA 3FLNC 3SKCA 5TR6A 3GUBA 2YCQA 2JBOA 3ROCA 3KGAA 2ZV2A 2JDRA 3PY1A 5AV3A 3C4FA 3TT0A 2GSFA 4U5JA 4ERKA 3TV7A 3C0GA 3EQPA 3F2RA 3W16A 1REKA 1ZWSA 3AD6A 2B55A 2V7OA 5EHOA 1PXMA 3OWPA 4GCJA 3VOTA 4IJPA 4DH3A 4IB1A 3ZC6A 4WA9A 3ZO3A 2OXXA 4O2BF 4Q5HA 3DB6A 3I5NA 3QKLA 2G01A 4FZAB 3QTXA 5J2UF 2FVDA 4FA2A 4CVAA 4KABA 1YVJA 2E9PA 3HBLA 4CMOA 1XH4A 1W8CA 3B2TA 3VS6A 2GTNA 4EH3A 4IM0A 3ORPA 5K9IA 5EYDA 2QHMA 4NTSA 4B9DA 3F69A 3C5IA 4XNEA 4IIRA 1T45A 3TNPC 4IHJF 3EZVA 2XNOA 4EOJA 5KUPA 2QURA 2VV9A 3MI9A 4X3FB 1FMOE 1U46A 3BHVA 2VU3A 3I5ZA 3ORTA 4YJOA 3O7LD 2XA4A 3DAJA 4B4LA 5FRIA 2W96B 4QP6A 4CZTA 1W96A 4FBXA 4JOAA 5EOBA 2HWOA 2JAMA 3DFAA 3JVSA 4QMWA 4A06A 3UZTA 2OF4A 2YL2A 5CXHA 5CU6A 2WTCA 5E91A 3ZSIA 3KMMA 3BEGA 1BNCA 1RJBA 2QD9A 2QNJA 3K54A 2R3GA 5LJJA 1VYWA 4MNEB 5AV2A 4C34A 4L01A 4E4NA 5HLWA 4D58A 4ITHA 1F0QA 3FZOA 5LVLA 4EEVA 4C33A 2CKEA 2BKZA 4AT3A 2J9GA 4L67A 5FG8A 3DK3A 3RV3A 5LMAA 4AZSA 2DZDA 3WF5A 4DTBA 4IWDA 2VGOA 3VHEA 5LMKA 3W2QA 4FTQA 2F2UA 4R1VA 3WF7A 3E8NA 3ANRA 2C0TA 5ANEA 4DEIA 5AA8A 3SHEA 3D14A 1SCUB 3ORKA 1NW1A 1Y6AA 4N0SA 4QNYA 3EKKA 4WD5A 3H0ZA 3WIKA 4E5AX 4I55F 2J5EA 2VNYA 3QZFA 1VJYA 1Q24A 4J96A 3AC4A 5CNOA 4CLIA 5FDPA 4FEXA 5JK3A 3R30A 4A9SA 2UZTA 4XG8A 2X2KA 3BKBA 3I6UA 4TYHA 3A7IA 4F7LA 4KINA 4ZMFA 4BI0A 4QOXA 2W4JA 5J95A 2PVRA 2VPQA 2YIRA 3UE4A 4DFXE 4EZ5A 4IHPA 4AA5A 2P0AA 4JG7A 4L43A 4WNOA 4RLKA 3LQ8A 1Z2OX 3HV3A 1I09A 2PVYA 3UBDA 2ITUA 4CTCA 4HYUA 5FEDA 3LE6A 3AC3A 3IW8A 4O7RA 5IDPA 2GPHA 4ZK5A 3SA0A 2W1EA 2PVLA 2BDWA 4EYMA 2YYAA 3VHKA 4EH6A 2DLNA 1ZMUA 4NM0A 4O4HF 2X8IA 2XYNA 2Q0BA 4RQVA 5CF6A 1KBLA 1WFCA 5HO8A 2F49A 3QUDA 4S33A 2R82A 5JQWA 2BALA 3EFWA 1PXIA 1KE5A 4HYHA 3DLZA 4IX6A 2AC3A 4F9BA 4K1BA 2BAKA 2IW8A 2WMAA 3TQTA 2RG5A 2GQSA 4DBNA 4EKKA 4QP9A 5BVOA 4BDDA 1BI7A 2F9GA 3A7FA 1B6RA 5KKRC 3V51A 2GNJA 3C5UA 3CPCA 3N4VA 4QPAA 5AX9A 4NYEA 2PZPA 5J5SA 5HE3A 5IPJA 3DA6A 4J71A 3TTJA 3ZBXA 1LPUA 3IK3A 3O96A 4F09A 2F4JA 3GC7A 3PXKA 4Y83A 1YXXA 4EOMA 5JRQA 4DFUA 2JGZA 4WKQA 4CG8A 4K9YA 5E4HA 5GNKA 3SLSA 5BVDA 1ZMWA 3ZDUA 4I6FA 3QWJA 1JKKA 2ETMA 3HECA 5CA1F 4BDCA 4DH1A 1R3CA 1GOLA 2F7XE 4XP2A 4FV1A 5M08A 3B8QA 3QFFA 4ANMA 3GENA 3BCEA 4QMPA 2SCUB 4IIJF 3BE9A 5I9UA 1GIHA 3PPZA 5IF1A 3AMBA 2VO7A 2YAAA 3I7CA 4FV7A 3WE8A 4DN5A 4L9IA 1ZYSA 3OT8A 3PRIA 4CZUA 2C5XA 2DYLA 4QTEA 5JQ8A 3OY1A 5IH6A 2OJGA 2GNGA 4APCA 2RFDA 3VS5A 4CRSA 5HESA 1BKXA 1O6YA 3O8UA 4Y85A 4ACGA 4FNXA 4D4SA 5J9ZA 4BI2A 5DT3A 4KKGA 4X7QA 4DITA 5IH5A 4DT9A 4KWPA 2VTQA 2B9IA 3D7TB 5H8BA 2CHLA 2GFSA 2VO6A 3GVUA 3UQGA 4O7LA 5K4JA 1C30A 2Q0NA 4IANA 2ZVAA 3ACJA 3EL7A 4KNBA 2EWAA 1ZOHA 3K5VA 3NEWA 4FYNA 5E90A 5TF9A 4QQTA 3KALA 4FTLA 4HPTE 2JD5A 5FM2A 2V55A 4ACDA 2QR8A 4I5HA 5I9ZA 3DZQA 3VW6A 4AGCA 4PNIA 2VTHA 3QGWA 4HGLA 3OCSA 4QTCA 4CFFA 3EH9A 5B0XA 4GS6A 4BZDA 5EK7A 5CF4A 3N4UA 3DBFA 5ETIA 5J7HA 2I8CA 4OTDA 4C37A 3UIXA 4M13A 3VMMA 3PJ3A 4YZNA 1A48A 3RI1A 4C02A 2XJ2A 1YKRA 2XJ0A 4FE2A 4ZY6A 4BCQA 5AM7A 3DNDA 4UY9A 3TNWA 5IUGA 1KJJA 2HK5A 3RPRA 3LFQA 1FGKA 4JVGA 5D10A 5KZIA 3UVRA 3PFQA 5KHWA 3KRJA 2C3KA 3RPVA 4H1MA 4NFMA 5LXTF 5IDNA 1A9XA 2C3JA 2ZYBA 1W82A 4FT7A 3W2CA 2A4LA 3Q9ZA 5HCXA 1PXNA 2PYWA 2NU7B 2YM7A 3IECA 3OBGA 4BTKA 4R3PA 3UG1A 1OI9A 1R0EA 1EH4A 4EH8A 4O84A 4H1JA 2HELA 3GU8A 3DXQA 1LR4A 2QOLA 2W0JA 5J9YA 4EH9A 3LFEA 2P3GX 4QMOA 2WMRA 2W4OA 4BGQA 2JBPA 2VAGA 3WNZA 1ZYCA 4RIWB 5DYJA 4TN6A 2XK7A 3PY0A 2QU6A 1IAJA 4GVJA 2QO9A 3OW3A 3OZ6A 3DQXA 3Q2MA 3V5TA 2NUAB 4R7BA 3FMNA 1V0PA 5BPFA 4LL0A 3LXPA 2YN8A 2DUVA 2YCFA 3CEKA 1OIUA 1YWRA 4O0TA 4YSMA 3R7IA 3OROA 2HYYA 3PWDA 4RG0A 4TNDA 1TQPA 4YJSA 2YWVA 5CXZA 4CRLA 3QA0A 5IA1A 2PMNX 3R0TA 5GHVA 3THBA 5BMMA 5T68A 4TL0A 1CKIA 2XJ1A 5GONF 3NX8A 2F7ZE 4GK4A 4QNAA 4BCGA 3F66A 3OW4A 2UW9A 1GZKA 5E8UA 4FGRA 2RIOA 3NUNA 2R3NA 3MPTA 4GIHA 4IDTA 3Q60A 4QTDA 4ZMEA 4YLJA 2OJ9A 2VTPA 4IAIA 1UU7A 5EHLA 3UTOA 2E9NA 4AT5A 3BEAA 4K18A 4OLIA 1Q61A 1MRVA 3ODYX 4FVRA 3L8VA 4NKAA 3TV6A 4USEA 2XD4A 2Z8CA 4O0RA 2B9JA 3QWKA 4FOCA 1J1CA 5HG7A 4AW0A 4XG3A 4MBIA 4F1MA 5M4UA 3SOAA 4TYEA 3AG9A 3M11A 2WEVA 1PMNA 2J90A 4HOKA 4EOQA 3TN8A 4F99A 4GL9A 4U3ZA 4ZI7F 4O0XA 5CZHA 4M8TA 3Q4CA 2HZIA 3BYVA 3GGFA 2W1DA 3DKGA 4Q5EA 3NMUF 3I4BA 3MIYA 4F70A 3QUPA 2C3IB 4MXYA 2OZOA 3FHIA 4FFRA 2XKEA 4F9CA 1XQZA 5JFXA 3QYZA 2HXLA 2PTKA 1KJIA 4FFMA 1GSHA 2JDTA 5BMSA 5BMVF 3MA6A 2QODA 3LQ5A 3PZEA 4IW0A 2CLXA 3F5UA 4MBJA 5BYLA 3SAYA 3V4SA 4JBVA 5EFQA 3QQGA 3TUCA 4FIEA 3QRTA 2ZB1A 3KCFA 3V5LA 3PXZA 1E1VA 4D2SA 1IASA 3ORIA 3HGKA 4PTEA 5EOLA 5AV0A 5AX3A 4BBMA 5CAVA 4FV5A 1YI6A 5IQHA 2YRWA 4ASEA 4IFCA 3ZXTA 4CLJA 2R3JA 2IPXA 2Y7JA 1H0VA 2EXCX 4FYOA 4O38A 3R8MA 4FFNA 1OKYA 2CPKE 3W2PA 3F3TA 1KJ9A 4PV0A 1JVPP 4AF3A 5C1OA 4M97A 5A3XA 3RPSA 2OJIA 1R78A 2VUWA 5CSPA 4IDVA 3R22A 4YURA 5A6NA 4UWYA 2WYOA 1V0OA 3MWDA 3M42A 4H36A 4FTOA 4WBOA 2PMIA 4E4XA 2B54A 2YIYA 3PJ8A 5J8IA 2ZDTA 5HU3A 1OIQA 3BELA 3PXYA 2G1TA 2JEDA 2PZ5A 3FMKA 3HEGA 4L53A 5HE0A 4DEHA 4IVCA 4HNTA 4GUBA 3IS5A 2PVNA 4FEVA 2XUUA 4FV3A 1IA8A 3R1YA 3GU6A 2V22A 2WMXA 4EC8A 2X8DA 4Y73A 4BTJA 2R84A 3T3UA 4WUNA 5ANKA 1VBHA 5IEVA 2QR7A 1DI8A 3WZUA 3R7UA 4ANBA 1YDSE 5EDRA 5M07A 5M09A 2C6MA 2RKUA 3EKNA 5EQEA 2IVSA 1APME 4QYEA 3ZXZA 4AUAA 4FTNA 2GHGA 3UZPA 3HUBA 1MRUA 1MP8A 4JX3A 5FP5A 2IO6A 4B7TA 1MRYA 1YHWA 5E9EA 3NNXA 1SM2A 5CVFA 3RM7A 2XK9A 1H28A 3U54A 2J50A 2GPSA 4OBOA 4L7FA 2R3KA 2BZJA 4DTAA 5HICA 3DJ7A 4FTAA 4G6NA 1WBVA 2BHHA 5DEWA 2UVXA 2NO3A 3P7AA 1LP4A 4LV5A 2PWLA 3GNIB 4JT3A 4R6VA 2WGJA 4FIIA 3VQUA 3UO5A 2YA9A 4FTUA 4L44A 1Y57A 2VGPA 2WTDA 4X2GA 3FPMA 1NA7A 5AAGA 3NUSA 5JZNA 4DFBA 5JQ5A 4ME6A 3NLBA 2PUNA 2UVZA 2OSCA 3OG7A 3CD8A 4ZZMA 5AUVA 4D0WA 4PL3A 2UV2A 2VO0A 5IUHA 2ZJWA 3PXRA 4TRLA 4CXAA 5B7VA 3A61A 5IA2A 4F7NA 5L2TA 1W84A 4QTAA 5CQWA 3I1AA 1J7LA 3EWHA 5AWMA 4AG8A 4BDKA 2PVFA 4XMOA 4A07A 3NAYA 1PYEA 5CI6A 3CD3A 5LWNA 4AFJA 4GYIA 4WNMA 4UYNA 1YRPA 5HVYA 5ACKA 4P4CA 2ONLA 4M15A 2X7FA 4O96A 2PZYA 2XNGA 3HAVA 3QHWA 4CEGA 5IQCA 3PVBA 1J91A 3IW6A 3MYGA 3WIGA 5JT2A 4IB3A 5CANA 3CIKA 2OWBA 3ZZWA 4DCEA 5AUTA 2R3IA 1O9UA 3FLQA 4NM7A 3UOKA 4DH8A 3P79A 5CAOA 4DTKA 2WNTA 3CTQA 4JQ7A 1H0WA 4XP3A 5ANIA 3Q1KA 2JDSA 2VO3A 2P4IA 1ZAOA 1Y6BA 2BZKB 4E5WA 1SVEA 2RFSA 1DAWA 2OK1A 4DEAA 2GLTA 4APPA 5IQEA 1AUXA 2H34A 4G3FA 3MWUA 4O81A 2CN8A 4KAOA 3DU8A 3RM6A 5KKRB 4ZLOA 4MA0A 5FUTA 2J6MA 4DC2A 2XB7A 4XH6A 3SQQA 4DFYA 2O2UA 2VWIA 3TI1A 1I44A 2FA2A 4RIYB 3EN7A 4BI1A 3Q04A 4YJRA 2A1AB 5LCKA 2DWCA 3EQGA 3LKMA 5IG1A 4ASDA 2I7QA 3AGLA 3ORQA 2GFCA 1J1BA 1FVTA 3IOPA 3SD0A 1DIKA 4I0RA 2EB2A 3TL8A 3K5UA 4XS2A 2ETKA 3NNUA 4ANQA 2BRGA 2ITVA 1G8AA 4XV1A 3KRXA 3VJNA 5H8EA 5M53A 2ITWA 4C38A 3R1SA 4FKSA 2W6QA 1YWVA 4CMUA 3WYYA 1WBOA 3QTSA 2UZWE 2C5OA 4YP8A 3QTWA 3WF6A 5HX6A 3GCVA 2F2CB 2NU6B 5E8SA 4TWPA 3VQHA 4DH7A 4G2FA 4F64A 2WXVA 4F65A 3HL7A 5BPHA 1OB3A 3E3BX 2GHMA 2OFUA 3QZIA 1BUHA 3LWBA 2GHLA 4FVQA 1FOTA 3IO7A 4EK8A 1UNGA 2HY0A 4AW1A 1DV1A 2C6TA 4RA4A 5CAQA 5DG5A 4CGAA 1H00A 1Q8WA 4V05A 4C0TA 4NTTA 1Q8YA 3AW8A 4RZVA 3DJ5A 1Q8TA 3TIYA 2OGVA 2QOBA 1KEEA 4MXZA 4WRGA 4O91A 4TKSA 3HMPA 2BDJA 3COIA 4I4EA 4D2RA 1YWNA 4EBVA 3OOGA 4MAOA 4S31A 4C3FA 3K5HA 4I6BA 3PPJA 4MCVA 4EHEA 3MDYA 4G3DA 4BDJA 4WBBB 2R0UA 2F57A 3VS1A 3LXNA 3JR1A 3N9XA 4FMQA 4GFMA 4O7SA 4WT6A 5F4NA 5HBEA 2IW9A 3NWWA 4NCTA 2Y9QA 4XG2A 4AQCA 2RG6A 2YWPA 4FKQA 3CTJA 4EL9A 4AS0A 1Q3DA 1OPJA 2GS6A 5AM6A 3V8WA 4IADA 5EI6A 3V5WA 4MVFA 5CX9A 2XCHA 3FMDA 3BWFA 1OM1A 5HG5A 1WVWA 2GNHA 4L46A 5J2TF 1ZOGA 3HV5A 2R86A 3CS9A 5CA0F 2JDOA 3QKMA 1UNHA 3MH2A 2X39A 3TJDA 4EK6A 4ZLYA 5IH4A 4CT1A 4ZHQF 1XH7A 3ZYAA 3GOKA 3EN5A 3TJCA 4AZVA 4C2VA 1NT2A 1CDKA 2UZBA 2WMUA 4M68A 4RVTA 3AQVA 2IJMA 3HDNA 3VPCA 3IW7A 3LFSA 4I92A 4JRVA 3E87A 3P23A 4FX3A 4D4RA 3Q9XA 3I7BA 2X2LA 4GK3A 1GIIA 1UV5A 3MB7A 4FNYA
chains in the Genus database with same CATH superfamily
2Z7SA 4IEBA 4DEEA 1UU8A 4K2RA 4EQ5A 4G34A 4EKLA 4QYFA 4LFIA 1KC7A 3GU5A 1XK5A 3PUPA 4E6DA 3G8CA 4RJ6A 5L8JA 4H3QA 4PRJA 3S4QA 4TT7A 3VBYA 4EOIA 4YR8A 1UKHA 1J7UA 3OEZA 3F3WA 3QD3A 3QC9A 4MWHA 3DPKA 4ERWA 1XBCA 5CEPA 2VTLA 2Y4RA 3OBJA 3O71A 4AZTA 1FPUA 3KA0A 4FV6A 1V1KA 2B9FA 3ULZA 3WBLA 4DFZE 4EBWA 5A9UA 4FKJA 3FKOA 3N8DA 3AT3A 4KIPA 3GC9A 1UKIA 3W10A 3DBEA 5FLFA 3AMYA 5G1XA 4O0VA 5JVLA 5GJDA 3P08A 4FV9A 1A9UA 3MIAA 3OD6X 4K77A 3SGIA 2YERA 1PW2A 4YPDA 2W1HA 2NRYA 5CZIA 3PSBA 2BFYA 4IZAA 1BI8A 1BL6A 4LRJA 5EI8A 3DBDA 4FKUA 4YNEA 3ZO4A 4MXXA 2B7AA 4AXFA 3F3ZA 3OCBA 4QDVA 4BJJA 5JEBA 4Q9SA 4I94A 5FPRA 3K5IA 3P4KA 3AKLA 3W2SA 3A8WA 5LMKC 4YB8B 2BCJA 3BX5A 3T9BA 4RCNA 1QCFA 3DK7A 3ZLYA 4MQ2A 4DQNA 3BYUA 1PF8A 4GG5A 4MD9E 5HIEA 5D1OB 3DNEA 4L68A 4QMSA 2W70A 4UBAA 3NUUA 5KX5F 2ITXA 3P9JA 3A7HA 3PE1A 3W0NA 3HV6A 4CNHA 4FSTA 1Z2NX 5CEIA 2HDKA 3BZ3A 1QPEA 3O0GA 1U5RA 3BGQA 4KIQA 4HJOA 2VNWA 3SXSA 4ASZA 4DGMA 3KULB 3V5JA 3VUGA 4DGLC 1GSOA 4FNZA 1W7HA 3B8RA 3LPBA 2J0JA 4R3RA 5EQPA 4PMPA 4L00A 4QMQA 5AEPA 1L3RE 3DCVA 3OY3A 4JBOA 4TYIA 5AV4A 3U6HA 5HU9A 1I2LA 4O2ZA 4PY1A 4IWOA 4CFUA 2R9SA 3DDQA 3TNQB 4EOPA 1ZZ2A 3ZLSA 2B52A 3C4EA 4D55A 1X9NA 5AMNA 3VO3A 2BROA 2V58A 3AT2A 4C4JA 3E64A 3H0YA 4XG9A 3CP9A 4J95A 3WZJA 4O0UA 5JGDA 1XBBA 5KMMA 3R5FA 3A60A 3F3VA 3LLAA 2FPPB 1XH6A 3LHJA 4D5HA 5GINE 1GZOA 2FGIA 4C4HA 5LMBA 4N6ZA 4C3RA 5FBOA 3VRZA 2GPWA 4C35A 2Z7LA 4D4YA 4L3LA 3EN6A 1R1WA 3DY7A 5HNEA 2IZRA 3MTLA 3VRYA 4D4VA 1P4FA 2OJFE 4MXOA 3BPRA 4XBRA 4ALWA 1TKIA 5BX0A 3BU5A 4OTGA 5DMXA 3A7GA 4HZRA 4YZ9A 3L9PA 1OL5A 2YDJA 2GNIA 1PK8A 3OF0A 1BLXA 3E93A 3DXPA 3HVCA 3NPCA 3NR9A 3ORMA 4GEOA 4QQCA 1KOAA 2C68A 2XK8A 3NSZA 5A14A 3EFJA 1XWSA 4QTBA 3WWIA 1GY3A 4I23A 3DTGA 3JSLA 4XG7A 4YJVA 4IFGA 2OXDA 3LZBA 3FPQA 1H25A 4XV3A 1C3OA 1PKGA 3GI3A 3Q6WA 1U4DA 2UW7A 4OT5A 4UV0A 5HI2A 4YHJA 5KMIA 3F5GA 3TY8A 3MPAA 2W9ZB 2HW6A 4FTJA 4WG5A 3FJQE 4MD7E 2HVRA 2OI4X 2W6NA 1YOLA 3RAIA 5FTQA 4MV6A 3E63A 4O86A 4PL5A 5EYMA 4ZY4A 4HVHA 5CYIA 3QQKA 3S24A 3IDCA 2UVYA 5HD7A 4HNFA 5IYZF 3W18A 2JDVA 3FWQA 3VS7A 3OTVA 4M69B 5DR6A 4QYGA 2Z60A 3GCSA 4BC6A 4GLXA 4RFYA 4GG7A 3ZCLA 2FSOX 4YJPA 4TNBA 3VULA 3WF9A 3UODA 2HVSA 4O7VA 4DGOA 3IONA 5CSWA 4LV8A 3QYWA 2W6ZA 1S9JA 2H6DA 5DI1A 2W1ZA 4DEGA 3RPOA 3C51A 4O2PA 4ZTLA 3DAKA 3MGYA 3PTGA 3BA8A 5F9EA 5DEYA 3TYKA 5HIDA 2YCSA 4EZ3A 3VF9A 5EKNA 4FSQA 3VUKA 4BYIA 2O65A 4BCOA 2QO2A 4P90A 5BYZA 2EVAA 3AOXA 1ZXEA 4O2AF 1OL7A 4EH5A 3G9NA 2ITYA 4JLCA 4KD1A 4EH2A 4YZBA 3EQBA 3GLKA 2EJ0A 5HCYA 3OP5A 2IWIA 2VWVA 3R73A 3T9EA 2PU8A 2Q83A 3DKOA 2XCLA 5E8YA 1JLLB 4Q4CA 5LP6F 4N57A 4YC8A 4AA4A 1YI3A 3LCDA 4I24A 3UP7A 3F5XA 2PE2A 2WMQA 3LJ2A 2WMWA 3FQHA 2YHVA 3FQEA 1BX6A 5EDPA 3S3IA 4BIEA 4E7WA 5M51A 4YO4A 4RJ7A 3OUKA 3NIEA 3OCGA 2R3OA 2WB8A 5DNRA 5HEZA 5T3QA 2W9FB 1P2AA 3E7OA 4DGNA 4XX9A 4U3YA 4U44A 5EM8A 5F95A 4F63A 3T9CA 3GB8B 3CQUA 5DBXA 4EH7A 2A1HA 5AP6A 3G33A 3HMNA 4A9RA 4CTBA 1EYZA 1DAYA 5KCVA 1FBNA 2E2BA 1FINA 3HMOA 3EFLA 4FKPA 5HORA 4CHIA 4H05A 3PYYA 5HX8A 2WU6A 1E4EB 3QTUA 4QEBA 2VTOA 4NL0A 4BVUA 5I5WA 3FE3A 4I5PA 3FZ1A 3JPVA 1EHIA 5EHYA 4EK3A 2OBJA 3QXPA 5KBQA 1V0BA 3UOJA 3DAAA 3ZFYA 5JMSA 4KUJA 3BAAA 4QYYA 1CMKE 1WCCA 3P0MA 3VBQA 4F6SA 3W0SA 5BYYA 5J1WA 2KULA 3W1BA 4D1ZA 4J8MA 4CKRA 2BAJA 4FEQA 3TIGA 2CKOA 2ZM1A 4N6YA 1Q62A 3QRJA 3PRFA 3CSWA 3UIUA 5A4QA 2R0IA 2FSLX 4FSRA 2QF7A 3P78A 3G5DA 2BDFA 4LGHA 1OIRA 2HZNA 3R83A 4BHZA 4TY1A 1YHSA 4PF4A 4ZS0A 4BICA 3RHXA 1IG1A 1ZLTA 1H26A 1REJA 2I1MA 2WMBA 2XRWA 4WO5A 4EHZA 3VPBA 5BVEA 5I5VA 4MHAA 3SG9A 1E1XA 4PL4A 4I22A 1ND4A 3ALNA 4JBPA 3UP2A 3ALOA 5IZFA 1UU3A 3V4ZA 4C3PA 4M7IA 3R2BA 4CD0A 4ZLZA 4U42A 3LQSA 1FMKA 3EN4A 4MKCA 4FICA 4KKEA 4UX9A 3ETJA 1KE7A 4AFEA 4ZSLA 1SNUA 2G2HA 4Y46A 1OPLA 4RX8A 4HNUA 4FUYA 3D9VA 3ORXA 4Z55A 3BQCA 2WTWA 4IC7A 4L52A 1BYGA 3DJ6A 2YM5A 2C4GA 2A0CX 3GQIA 4HCVA 4I3ZA 4JQ8A 4P5ZA 4DLJA 3DFCB 3BRBA 1XBAA 3QTIA 3RCDA 1UU9A 3KKVA 4FFPA 2ZMDA 5DA3A 3PP1A 2C6LA 3E8EA 3NCZA 2OIBA 2PE0A 1CQJB 3VUHA 5BQ0A 3FZPA 3R8PA 3F2AA 2VN9A 1A3GA 4S34A 3NYVA 5IUIA 3RMFA 2OIQA 1XR1A 3QAME 3S95A 2ZB0A 5L2SA 3COHA 3MWEA 3FXXA 4EOKA 4C62A 3PJCA 2BTRA 2BFXA 4HGTA 3SXFA 3RALA 4AA0A 5KHXA 1T46A 3Q4UA 3QBNA 3ZO1A 4USFA 4I6HA 3ZRLA 4KA3A 3D15A 3AC5A 3RINA 2ERZE 3OUUA 5AUYA 3QC4A 5KMOA 3D7ZA 3L8SA 5E1EA 4J8NA 5FNVF 5JFSA 2WQBA 1Z2PX 3T99A 2SRCA 4UZHA 2XKFA 4FV4A 3I12A 3MB6A 1CTPE 5C4LA 2PMLX 4FT0A 2J0LA 4IVAA 4TTHB 4YU2A 2WOTA 3O50A 4MH7A 5D9HA 3M1SA 5F94A 3HA8A 5K3WA 5DR2A 3R9DA 4F08A 2XANA 4YLLA 1M2RA 3WE4A 4MV3A 3ZM9A 2OIDA 4QMUA 4WIHA 2W99B 4E93A 5BUEA 1E9HA 3E62A 5HO7A 3CPBA 1OL6A 2W5AA 4QYHA 1KV2A 4H39A 1XH8A 3O17A 3CCNA 3FI8A 2C3LA 4F78A 2VTAA 3U4UA 4E5BA 2R5TA 4EG0A 3MJ1A 3EB0A 2PVPA 1B6CB 1WBSA 4FTRA 3WOWA 2HHFB 4E20A 2QLQA 3DS6A 3DGKA 4PQNA 5IQIA 4YHFA 3RP9A 2W6MA 4IZ7A 2YEXA 4M0YA 4EYJA 4YJ3F 3JY9A 5C27A 4DE4A 5HTCA 2A27A 2R3HA 2GMXA 3DTCA 3GQLA 4I6LA 4HZSA 4GVAA 3BACA 2CSNA 2UZLA 2QONA 4QT1A 4C5AA 2J9MA 3CQEA 3NW6A 1XH9A 3WZDA 5LOVF 5ANDA 3KRLA 3CLYA 2BRHA 2VWXA 3E92A 2QC6A 5AP3A 5A54A 2HGXA 2I80A 4GIIA 4L3JA 2VZ6A 2PSQA 4LRKA 4USDA 3JVRA 5E7RA 4ITJA 3UDSA 4BDAA 5JKGA 2I40A 3KVXA 2OF2A 4X2JA 5AUXA 4A9YA 4FKIA 3SG8A 3RWQA 2J2IB 4FSWA 4IH8A 3NUAA 1M7QA 2ZAZA 3OFMA 4FV2A 2X0SA 4QQ5A 5I5XA 1I7NA 1YXTA 2E9UA 4CFWA 1GJOA 4A7CA 4XP0A 4TW9A 2VWWA 5AIRA 4EFEA 2ETRA 3CE3A 4U45A 2QOKA 4O7YA 1XJDA 3NS9A 2QOOA 2CJMA 4KBKA 5M4IA 4G6LA 5EW3A 2IVUA 5D1JA 5CF8A 1CQIB 5LYJF 1P16A 4QQJA 4JS8A 3SX9A 4YPSA 3C9WA 1JPAA 3BYSA 3NW7A 4YTHA 4YZCA 4XYFA 1B6SA 3QRIA 2XKDA 4CFXA 3G6GA 3UZRA 2PBZA 1P14A 5KX8A 3ZBFA 4IWPA 4FL1A 4TYGA 4HGSA 4AT4A 4AU8A 4NT4A 1B04A 4RIXB 1OKWA 1IA9A 5K4IA 2BPMA 4QP1A 3W33A 3O8TA 4EONA 4IMYA 3UJGA 4O4LF 3Q32A 3ZLXA 5GIOE 3PN1A 5A46A 3R1QA 3HRFA 4UB7A 3KF4A 3TV4A 2WOUA 4FC0A 4UALA 2A2AA 3CSVA 4R3CA 5DE2A 3LM5A 4IX3A 3KRWA 2YIWA 4ZTRA 4Q9ZA 4TVIA 4BN1A 1TFFA 3LCSA 4DRFA 1YXSA 1OBGA 2ZV8A 5CS6A 5LXMA 3RR5A 3Q3BA 3ID6C 4I21A 4Y5HA 2LAVA 3R6XA 3NUPA 4LOPA 1DM2A 1PMVA 2ONLC 3Q9WA 5EM7A 3V8TA 3TUDA 1R39A 2B1PA 4FSNA 5BUJA 1U54A 4PDSA 3UC4A 4D5KA 2JIIA 3I6WA 4G16A 5HE2A 2HIWA 4IZOA 4GKIA 4JDJA 4XG4A 4ZJJA 3E8DA 3FMJA 4RVLA 1OIYA 4ORKA 1CKPA 4J1RA 4FT9A 2JKOA 3E8CA 4IWXA 4KIOA 4RMZA 5AFVA 4PNKA 5IA0A 1M6VA 1PJKA 4LMNA 1WBPA 3I0QA 3QFVA 2CGWA 2WD1A 2C6DA 2GQRA 5H3QA 4HN2A 2YZAA 2BHEA 3MY1A 3TUBA 5CAEB 5ETAA 2Y4IC 3Q2OA 2Y6MA 3NUYA 4YTIA 4O0SA 2PULA 4I20A 2XIYA 2C6OA 4WG4A 1SVHA 2R3RA 2WTKC 3OXTA 4MV8A 3RUPA 2QU5A 2X0GA 2UW6A 3PSCA 3ZSGA 5CENA 4EJNA 2IN6A 3KREA 5IEXA 5IQFA 5H2UA 3QD2B 2FPGB 4BF2A 3Q5ZA 4MV1A 4GU9A 3TWJA 2R4BA 5CAPA 3NYNA 2WIHA 4IVDA 3REPA 3WARA 5H80A 5GJFA 1G2WA 4ZY5A 5LVMA 3NC0B 2RL5A 4OBQA 4HYIA 3EYGA 3BV2A 3KL8A 4C59A 3FSFA 2WFYA 3ZH8A 5CNNA 2HIVA 3MJFA 4PDYA 4JX7A 4U7ZA 3L8PA 4MXAA 3R2YA 4GT5A 2Z7RA 3RK5A 3EHAA 4OW8A 4RX5A 2YJRA 4DHFA 2QLUA 2RFNA 4DA5A 3RCJA 5L6PA 2HZ0A 1YHVA 4EOLA 4IACA 2CGVA 3KXMA 4HVDA 1S68A 4J53A 2I0VA 3H30A 4X6QC 3T8OA 3VJOA 3KMWA 2XKCA 5DGIA 4WHZA 4M0ZA 1Z5MA 4H58A 2CKPA 3GFWA 4YBKA 1ATPE 1FVVA 3MVMA 2B0QA 2WKMA 5DAAA 3W0RA 4AOJA 1XHAA 3CGOA 1J3HA 4DHZA 3FKLA 3G6HA 3E3PA 5HBHA 4CE5A 3T9TA 3T54A 4LYNA 3UNKA 4JAJA 1SYKA 1GZNA 2O8YA 1KWPA 3FI3A 1PXLA 4IAKA 4TZRA 5AA9A 5EW9A 2JC6A 5EQYA 2XBAA 3IW4A 4QP7A 1F3MC 4FFLA 2XM8A 3DKCA 2CNUA 2VWBA 3QLFA 3PFFA 4YJ2F 4KSPA 3LIJA 3COMA 3D4QA 5FM3A 2NP8A 3FQSA 3KFAA 2YZNA 3RAWA 4ACCA 4XYLB 1OL2A 2QHNA 1XMMA 2X6EA 3UFXB 5AUZA 3L9LA 2VTNA 2OZAA 1NVRA 1NVSA 2FUMA 4B6LA 2ERKA 2PVHA 2HW7A 2X9EA 3MFTA 2CDZA 1Y8YA 3DZOA 3ODZX 5M06A 1EKFA 3LULA 3TW7A 3VS3A 1Q99A 3ET7A 2P0CA 2UZOA 3WO0A 3FLYA 1B38A 2PHKA 3F5PA 4G3CA 4O6LA 1Q41A 4U41A 4FSMA 3E5AA 1RE8A 3GCPA 3HMMA 3QGYA 4FIJA 4NKSA 1DAAA 4E8AA 2XP2A 4ENYA 3K2LA 1CE8A 2C69A 2OXYA 5FPOA 4YTCA 2OU7A 4L45A 1BL7A 3NBYB 5FTOA 3O23A 2IP4A 1JSUA 4IAAA 3VIDA 5AAEA 4BZOA 5D1OA 5ETFA 4V0GA 4O0WA 1PX2A 4QMVA 4QPSA 2ZGIA 2BVAA 3CY2A 2I0EA 1H1RA 2WMSA 3BV3A 4RC4A 5CU3A 1ERKA 5BUIA 2WAJA 1JKTA 4FIFA 4KS8A 5M44A 1TQIA 2YIXA 3T3VA 2C6EA 3WI6A 4CKJA 3GIDA 2YM3A 1ZOEA 2R3PA 2X6DA 3F7WA 3TZ7A 4U8ZA 5B2KA 4BBEA 3HV7A 4WRSA 2GCDA 3RHKA 1OL1A 4G3GA 1AD5A 4FEWA 4NFNA 4XCUA 5FEQA 3TG1A 3ZRKA 4YZMA 2XK4A 3NZ0A 4RLLA 4V04A 1JBPE 3HB9A 5FEEA 3KK9A 5M55A 3ORNA 2EB3A 2JLDA 2QG7A 3OCTA 3R28A 4O27B 5ANOA 1JSTA 1O6KA 3BGZA 3OUNB 4OTWA 4W4VA 3O7LB 4CKIA 2CMWA 4RWLA 3VUMA 4QP3A 2EIYA 4AW5A 3TEIA 2JKMA 2HJWA 1T36A 3TKUA 4HNVA 3U55A 2VWUA 4XG6A 5L8LA 3TKIA 5C1QB 2VTRA 3LJ0A 1SNXA 4F7SA 1VYZA 4HCTA 2ACXA 4F4PA 2REIA 2WQMA 5E8WA 4TWCA 4E26A 3G90X 4OTHA 2YW2A 1FQ1B 3IOKA 3OC1A 1PY5A 4TPTA 4WOVA 4CV9A 4EUUA 1EUDB 3F88A 5IA3A 5ANGA 3GB2A 3O5AA 3TW6A 4YGAA 2V5AA 3UDTA 4E1ZA 2XEZA 3U9SA 2W1IA 3U4WA 3SE7A 2AUHA 4EQUA 5CVGA 3ITZA 3RV4A 4BGGA 4LUEA 2GNLA 4I0SA 4FG8A 1JKSA 4RC2A 3JS2A 5EYCA 2W7XA 4RJ8A 3V6SA 3R5HA 2OW3A 4X21A 3QTQA 3HV4A 2XK3A 3ORLA 3KC3A 2ITTA 5M4CA 2O5KA 4RJ4A 4EK5A 1YXUA 4XYMB 4D9TA 3NAXA 5FTGA 4MV9A 4M84A 1Q8UA 5IA5A 4O4IF 1G3NA 4DLIA 5HIBA 2UZEA 2YZLA 3OWJA 2PVMA 4IZYA 4ZTQA 3UNJA 5L6OA 2XNBA 3HRCA 2QVSE 4ZOLF 3Q53A 3DBQA 3ZFMA 4MV7A 5BWVA 2QOQA 2CNVA 1J7IA 2WQEA 3NVKI 2W6PA 3A62A 3EIDA 3LM0A 4ACMA 3JUHA 1LEZA 4EORA 4X3FA 2EU9A 3BI6A 3TZ9A 4EUTA 5CT7A 4JDKA 2YM6A 5C8NA 5CSVA 2PPQA 4HVIA 5C8KA 4YBJA 2HAKA 2YS7A 3D5VA 3O8PA 1URWA 3PXQA 2YCRA 3MFRA 4W8DA 3GOPA 2HGWA 4GLWA 3HMIA 2X81A 4BDGA 3MVHA 3R1NA 3VW8A 2R3FA 4U81A 5CAUA 4IM2A 3OOMA 1GIJA 5E92A 3WO1A 4FODA 4K8AA 4R78A 1ZY5A 3ANQA 3PIYA 4D1XA 4YAKB 1XMLA 4K6NA 1H07A 1YW2A 4MNEA 4CSVA 1YDRE 4MQ1A 4NM5A 4JI9A 1GLVA 3DXNA 5HBJA 5KMNA 2R7LA 3AX6A 5D7VA 1HOWA 2B53A 3NNVA 2W5BA 3KXZA 1NY3A 2C6IA 3TTIA 3UG2A 3TMOA 5H8GA 3ULIA 4FZ7A 4OT6A 3HX4A 3VONA 4RFZA 3AMAA 3V01A 5J87A 5HZNA 4F6WA 4LL5A 3R8VA 2Q7DA 2QOHA 4RVKA 3Q6UA 2YDKA 5FBNC 5LARA 2I6LA 3ZDIA 1RW8A 3QQLA 4HPUE 4KBAA 1WR2A 1ZYDA 3FKNA 2J0MB 5D11A 4GRBA 5HBRB 2GDOA 3K3PA 4O22A 3F6XA 1PRYA 4E6QA 4QMMA 4HVGA 4AP7A 4BDEA 3R63A 4R1YA 4CC6A 2VWZA 1PXJA 4C4IA 1WBTA 1OUYA 3KB7A 5DRBA 4GYGA 4FTMA 3VN9A 4DG3E 1EUCB 1VBGA 4XZ3B 2CCHA 2R87A 4RJ5A 2QI8A 4FNWA 2W6OA 1WZYA 1JLUE 2LGCA 3FZRA 3GC0A 4IB0A 4PTGA 5KZ0A 3R8ZA 3VS2A 5FR9A 2BIKB 1VLRA 2DWBA 3RGFA 3UDBA 3ZHPC 2HOGA 2JIVA 3EQFA 3G15A 4RC3A 3GCUA 4ZIMA 2R7MA 5C9CA 4MEDA 4JAIA 3LXKA 2HZ4A 4YC3A 3UVPA 4FTTA 2WQOA 3IGOA 4U40A 4Y8DA 3ZC5A 1UNLA 5HD4A 3EOCA 3ZEWA 3H9FA 3T9DA 5BPYA 4OGRA 3AKKA 5LWMA 5AP1A 2C47A 3PZHA 3RPYA 5DRDA 4YLKA 3RTPA 1M0TA 3UGCA 2UZVA 4FG7A 4B99A 2UW4A 4U97A 3NGAA 3EN9A 4FV8A 3QU0A 3W55A 3LCTA 2PUIA 3D5UA 1H08A 5DIAA 4FSZA 3MH1A 3RVGA 4ZS4A 1NVQA 3R04A 2PUPA 3BHHA 2XNPA 1KJQA 2O0UA 2OWOA 5HQ0A 3MVLA 4CT2A 4NM3A 2I0YA 4XUFA 2VX1A 4IBMA 5JH6A 1A0GA 3GC8A 2JFLA 4KBCA 2C0OA 3C50A 5E8TA 5BVWA 4DAWA 5KMLA 3HZTA 4HQ6A 5C8YF 3QTRA 5AAFA 3ROYA 5C4KA 4NZOA 3HP5A 4NUSA 4BIBA 4DHIB 3GCQA 4FKOA 3K3JA 4ONAA 2GNFA 3MY5A 3U51A 4R5YA 4DINA 3UPZA 1PXPA 2ZDHA 3MFUA 3PDTA 3FY0A 4DBXA 3NBZB 1A06A 3UO4A 3H9RA 1IAHA 4OR5A 3LCKA 1AQ1A 3PIXA 4EJ7A 2PVJA 3FV8A 1RQQA 4W4WA 5AP2A 3BE2A 3NNWA 4YJTA 1OMWA 3AT4A 3D0EA 4O83A 3FBVA 1DGSA 4YNOA 4NWMA 4E6AA 4EWHA 3JZIA 2VTSA 3MA3A 4LOOA 3Q4ZA 4U0IA 2HIXA 4AN9A 3Q4TA 1JDBB 3HYHA 2Y4IB 2NPQA 3EL8A 1ZZLA 4DYMA 2ZV9A 3ML1A 5IMXA 2WTKB 4FSUA 1SZMA 3BHUA 3MSSA 3ATSA 3BLRA 3VBTA 4FT3A 2XIKA 4CFNA 3D7TA 3KXXA 4I41A 2WU7A 2XK6A 2QOIA 1Q97A 1VEBA 4GK2A 4NSTA 2OH4A 1H27A 1SVGA 2C0IA 3ZRMA 4XV2A 3LMGA 2BRNA 1ZMVA 5HCZA 2Z02A 3BQRA 3R02A 4JQEA 5FP6A 4GV1A 1BMKA 2YACA 3DT1A 4OTQA 4IAFA 4NZNA 1KSWA 2IG7A 4RBLA 1M52A 3N6RA 1DV2A 4OTIA 2BZHB 2HENA 2XZSA 5AP4A 3PJ1A 3OS3A 4MK0A 4PMMA 4UXQA 3U9CA 5LOHA 2FP4B 5AP0A 3UMWA 2G15A 4I93A 3RK7A 4AAAA 3QD0A 5CSHA 3OVVA 3C4ZA 4FKVA 3HA6A 2UZNA 4UWBA 3Q2JA 4CKEA 3ZU7A 3WZKA 4AGDA 3I60A 1JDEA 4FT5A 1CS0A 5AUUA 1K3AA 1VS0A 3S2PA 2YZMA 2JAVA 2CKQA 2JFMA 5JSMA 4C36A 3WILA 1Z9XA 3GU4A 1M17A 3FAAA 3G9LX 3HUCA 2ZDUA 3TEKA 4KKHA 3EFKA 5JN2A 3TIIA 2W1CA 3ZUUA 4PZ8A 2PL0A 3MPMA 2QG5A 3L9NA 4X2FA 4WUAA 3CC6A 4QMXA 3UZBA 2PY3A 3FI2A 4PP9A 3U8WA 2XCKA 4BBFA 3NFFB 4LG4A 4BYJA 4Z16A 4XX0B 4R5SA 2IZTA 4M9UA 4J98A 4IAYA 4A4XA 1Y91A 2JKQA 4Z3VA 4C5CA 4MXCA 3NCGA 5C1PA 2JIUA 1KE9A 3PLSA 5KMKA 4RFMA 3GFEA 3GXLA 2PMOX 2V0DA 2XIRA 5I9YA 2C5NA 4K0YA 1PKDA 3EQIA 4O7TA 4NW6A 4NZMA 4ZSGA 4LUDA 5E1SA 1PXKA 3BU6A 4F0FA 3CJGA 2PK9A 4RIWA 2FH9A 5EH0A