4O84A

Saicar synthetase (type-1) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
total genus 71
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o84A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o84A02
2X9EA 3QXOA 4JRVA 3B2WA 4BDEA 3BHUA 3NZ0A 5FBOA 5AUZA 4ANSA 4QQTA 4DTBA 4ZY4A 5JKGA 2CZGA 3R23A 4F9WA 4ZS4A 4FEUA 2E9NA 4C2WA 2ITPA 2DS1A 3QTXA 4RX9A 4NCTC 2ZMCA 4YPSA 4MTAA 5HORA 3ACJA 5IU2A 4MWHA 1GAGA 4PTCA 4FTTA 4AOIA 1FGIA 1WAKA 3LFBA 4HYHA 2Z7SA 4FV9A 4DIMA 3NGAA 2VTIA 3FKOA 4PMTA 4E4XA 4QYEA 1JSTA 5FGKA 4KBAA 3PZEA 2C5NA 4YTHA 3MJFA 2BZIB 5BPFA 2XKCA 3AG9A 4FVPA 3MFUA 4IWOA 4K11A 3K54A 5AX9A 2GNFA 4MQ2A 2HGSA 5IH5A 2R7MA 3SAYA 5EYCA 4BTKA 1JKLA 1J7LA 5DWRA 2W1GA 3C51A 3ORIA 3ORNA 5IH4A 3B8QA 4QYFA 3QZGA 4UYAA 1U46A 3GC0A 4XG2A 5GJFA 2QK4A 4YJOA 3ALOA 3HV4A 3LMHA 2A2AA 4FTOA 4FIGA 4DH1A 5B2MA 3OEFX 3PVGA 4MYGA 3HMNA 4K18A 3GU4A 3PXFA 2UVYA 3I6UA 3QTIA 2W5HA 5HO7A 5GJDA 3PSBA 4BCGA 4C4JA 3LJ2A 2RG6A 4YUQA 5IPJA 2OXXA 4IZYA 1B39A 3VUHA 4JBQA 4EBWA 4DGMA 2YCRA 4GV1A 5GHVA 4QQCA 3UGCA 4YJVA 1PX2A 2OIBA 3EHAA 3C4XA 4RA5A 4IZ5A 1PXIA 4J8NA 4TXCA 3SXRA 5A54A 5BMSA 3TNQB 5HIBA 1UKHA 2YISA 3BWJA 4DT9A 3HBLA 4M12A 1DI8A 2ITUA 3QQJA 4D4VA 4CKRA 3KXNA 3CQEA 4I0SA 2J9MA 3O8UA 2VUWA 2ZM4A 1FVTA 2EB3A 1WMKA 3FMJA 4U7ZA 4CMOA 4EQCA 1B6RA 1MQ4A 3CXWA 3DA6A 4ZJJA 2XK8A 4R3PA 3EMGA 5GONF 4DFXE 2XUUA 3E5AA 3FQHA 3CTHA 2Y4IB 4DLIA 3F5GA 1JOWB 4AGCA 2WD1A 4IBMA 3QQGA 2W6MA 1QPEA 5IA0A 3FE3A 3TWJA 3UYTA 3T3UA 4FG7A 1F3MC 3GQLA 4M68A 5AM6A 5JMSA 1H1SA 4CT2A 2QLUA 3DBQA 3LWBA 3BEAA 3MTFA 4WUNA 5IQEA 4TWOA 2XNPA 3WIGA 4BB4A 3CJFA 3AMYA 3CEKA 4ARKA 5DIAA 4ALVA 2ITWA 5JGDA 5JGAA 3WZUA 3AOXA 3O96A 1XH9A 3FMMA 4PDOA 3OBGA 4FIFA 4I1ZA 2HOGA 2VTPA 3PIYA 4NIFB 4EGJA 3A2CA 4HCUA 2R7BA 2Q0BA 4R7BA 3VA7A 5CAEB 2OLSA 2WTCA 4CTCA 3S2PA 3OXTA 3ROYA 1MQBA 2HCKA 5IMEA 5KBRA 3OOMA 3S00A 3I81A 4C4IA 4IANA 4TNBA 2C6EA 2P0CA 3ZU7A 4FTLA 4JQ7A 1XH4A 4FV6A 3ZM9A 3OT3A 3RPRA 2R84A 2VQDA 2VWVA 5KO1A 1TKIA 4ZP5A 2B52A 4IZOA 4EOKA 3MI9A 1SVGA 4FG8A 5FUTA 3VS3A 1WFCA 4RA4A 2WTIA 5I9XA 3UE4A 3KRXA 4ZEGA 4FI1A 4QP4A 3MPAA 1H01A 3ZLWA 2C5YA 4FZ6A 4FL1A 4ITIA 2XKDA 4V05A 4CEGA 3BGQA 3F82A 1Y6AA 3ACKA 3R8MA 5I9YA 3HRCA 3RNIA 3MFRA 4FV7A 4AA0A 5FXRA 4BIDA 2BR1A 1IA8A 5DVRA 5AP7A 4AW2A 5M44A 1LEZA 4JG8A 2J51A 4IX6A 4YZMA 3DAKA 3EN4A 1VYZA 3AT3A 3CPCA 4A9RA 5GNKA 4FZDB 3RMFA 1F0QA 4MD8E 5FM2A 2CKOA 3NW5A 5J1WA 2VTRA 4BDIA 4IC7A 4L68A 4XG7A 4X3FC 4ZSAA 2WXVA 3VBQA 4UN0C 3GI3A 1W96A 5ANIA 5F1ZA 5TT7A 3LXNA 5AADA 2R7LA 4NUSA 3BV2A 4QMLA 3NUUA 3QQHA 3P79A 5DA3A 4GCJA 4NKSA 1XH6A 5LMKC 4YP8A 4MQ1A 3W16A 4AX8A 1E9HA 1RQQA 4FSMA 2VWIA 3BYVA 1W0XC 4ITHA 2QKRA 3HV6A 2RFDA 4UEUA 1XH7A 3VS1A 5KHWA 5HNBA 5FQDC 4HOKA 5EH0A 1NVRA 4UX9A 3ZRLA 5EM6A 4BCIA 2W6NA 4M69B 3Q53A 3FSKA 3PDTA 1URWA 4JX7A 4O6EA 5AV2A 3U6JA 4ZSLA 2HK5A 3E8CA 1OL6A 4LM5A 5HVKA 4ZOGA 2R3MA 3DK3A 5KBQA 3V4ZA 4BF2A 4QTCA 4C4EA 4FVQA 3MWEA 2UZTA 5AIRA 3FV8A 5KZ0A 5DRBA 4LOOA 5H3QA 4FK3A 2X8EA 1IOVA 3I0OA 3PA3A 4KIOA 4O0RA 4G5JA 4O4IF 3R30A 3VBTA 4JX3A 3QTZA 3G0FA 4JNWA 4O86A 4APPA 4EH4A 3LJ0A 5LOHA 5CZIA 5LVLA 3CQUA 3OCBA 1Q97A 4O2ZA 5FDPA 3JUHA 3K5UA 5JZJA 2WGJA 4EWHA 2Z60A 1SM2A 2WNTA 4J95A 3ORZA 3R63A 3E62A 3RK5A 1YI4A 3H0ZA 3BLQA 1IR3A 3R2BA 5L3AA 4CSVA 2X2LA 5CB4F 2C47A 2CKEA 4F9YA 2EUFB 1T36A 4FOCA 2X4FA 5H80A 3HV5A 4Z16A 4HQ6A 3L8VA 1W84A 4RBLA 3W2PA 4FTNA 2IW6A 3DPKA 3I4BA 4G3DA 2HY0A 4E6AA 2B9FA 2IZRA 2WPAA 1ZZLA 4WG4A 5CAVA 2YRXA 4D0WA 4XV3A 3HUCA 4EH6A 3EB0A 1OIYA 2GQRA 4RFMA 1H27A 2ZYBA 4BC6A 2GLTA 4J52A 3FYJX 3JPVA 3VUKA 4U45A 3E87A 3D2KA 2BKKA 5IQDA 3QBNA 4GJ2A 3MIYA 4OR5A 2UZLA 1YXVA 2BALA 3AXWA 4I6QA 3L9MA 2W6PA 4IQ6A 1AUVA 3EQGA 2GS7A 4RWKA 2PUIA 2XJ0A 2XM9A 4JG6A 4X6RA 1PKGA 4IJPA 5AIKA 3PIXA 2QODA 4RRVA 4CLIA 3OWPA 4I5PA 2OJGA 3LCSA 3LQ5A 3TINA 2B9HA 1FINA 1Q8ZA 4K1BA 3NDMA 3BHHA 4FGRA 3NVMB 4E93A 3TNPC 4DLKA 1T45A 4FKJA 4XLIA 3LXLA 3V51A 4D5HA 1DI9A 3EL8A 4J97A 4N4SA 3U87A 2VX3A 3PRIA 4IX4A 4O38A 5FXQA 2ONLA 3MTLA 4XG8A 3PG3A 4C33A 3BX5A 1AGWA 1K2PA 1R1WA 5CEQA 4AFEA 4M13A 2UV2A 3UIUA 4C37A 4PDYA 4YJTA 2ZOQA 2VWXA 2JKOA 3DXQA 3FLNC 3IONA 4IJ9A 4JL9A 5E7RA 4J8MA 5K3YA 3TUBA 1BI7A 4TV9F 3WNZA 3GIDA 4IVAA 3QD0A 5HE3A 3IDBA 3C4EA 4NTTA 4YURA 2CJMA 3GU8A 2UW4A 4QRCA 5CI6A 4ZSGA 4MH7A 2BROA 3U9NA 4A9TA 4Q9ZA 3ORQA 1H07A 2C5VA 4I94A 3ATTA 4JIKA 4O7NA 5BUEA 4V0GA 5F9EA 4IHPA 1XBCA 4IW0A 4U5JA 4ANMA 3AC1A 1KC7A 5HD7A 2ZM1A 4AAAA 1LEWA 4YJNA 3DZQA 3CE3A 2KULA 4NKAA 2UZUE 4CTBA 3VUIA 4YR8A 3UQCA 3GOPA 4HNTA 4YJSA 4FSUA 4FKPA 4A7CA 3PXKA 4FKQA 4YO6A 3MY5A 4AZSA 2QOKA 4CFWA 4HVDA 3VW8A 4F9CA 3F3TA 5IEVA 1H0VA 3PXZA 4YAJB 3HKOA 2ITYA 4HZRA 4RJ8A 4MV3A 3IW7A 3D5VA 3IW4A 3VUMA 3K2LA 4QQ5A 4BI1A 4FTAA 1ZMUA 2R3NA 3MW1A 4QNYA 4QTAA 3OY1A 4EZ3A 3UOJA 5FTOA 1OL2A 4KUJA 5H8BA 4EEVA 3ROCA 4MV8A 2HZ0A 2ZJWA 4CQEA 4HVSA 4BDBA 3IOPA 1EHIA 3D0EA 2QCSA 3TXOA 1Q4LA 1OECA 4AU8A 4MVFA 5EOLA 4F08A 2Z7LA 2C30A 4X7QA 2VGPA 3GC7A 3KVXA 5AMNA 2CCHA 2RF9A 4ZMFA 3VBVA 2VTQA 4XBRA 5E90A 2IPXA 3OWJA 2NU9B 4H1MA 1WVWA 1KE7A 2PZRA 5EQYA 2XK9A 4H3PA 4DC2A 3FKNA 1V0BA 1ZYDA 3RPVA 3R04A 5BVNA 1FMOE 2ITTA 1H1RA 2ZV2A 3ZO4A 4C61A 3H4JA 3PA4A 4IAIA 3S95A 1WBVA 3A60A 3PIZA 4PTEA 5J87A 4CZTA 3SW4A 4YC8A 3PFQA 2QI8A 3QC9A 2W1EA 3M2WA 5IISA 1YDSE 2OF4A 4P2KA 5DT4A 4EC8A 4AE6A 2F7EE 3DK6A 3GFWA 5L2WA 5M56A 5FP5A 5HNGA 5CEKA 3ANQA 3OF0A 5CEOA 4YBZB 1XWSA 3F3VA 2GSFA 2OH0E 5ETIA 5JQ5A 4EGQA 2I0VA 3D15A 4QPAA 4C4HA 4JBPA 4BIEA 5HCYA 4EONA 5CANA 5JZNA 4ASEA 3EQIA 1O9UA 4FODA 2BFYA 2P4IA 2VWZA 3AX6A 4KABA 2J90A 2OO8X 4IX3A 4EC9A 1PXOA 4TYJA 5I9WA 3TDWA 3ORTA 4LQMA 4IIJF 2QO7A 4KSPA 5CSVA 2OZOA 4IEBA 4R7HA 1WR2A 1H28A 2CLQA 3LMGA 3DLZA 1WVYA 3IECA 5HV6A 1OZ1A 5HGIA 5HIDA 1H25A 1GNGA 3E93A 4Y46A 5LJJA 3P4KA 1SZMA 3KXXA 4FL3A 2WELA 3E8EA 3NAYA 3P5KA 4O0UA 1BI8A 5AP6A 1S9IA 2Y6OA 4F1TA 2PVPA 4X6QC 1M2QA 2X2KA 1A06A 1PYXA 1PXKA 4OTQA 3NUAA 3S1HA 3FMNA 4FV1A 1QMZA 3FY0A 4H36A 4RX7A 3PY3A 2VTSA 1ZMWA 3NCGA 1ZYJA 3DBFA 3HL7A 1YOJA 4AT4A 3O71A 5CVFA 4RVTA 4J98A 5C9CA 4F7NA 2X7GA 3HMIA 3LZBA 2UUEA 4FTKA 3UZPA 1H8FA 2JEDA 5BVKA 4I55F 2IVUA 4HVIA 4BGHA 4NM3A 4Y72A 4M97A 2HYYA 2QR7A 3R00A 4OTWA 4YZNA 3N4TA 3ZFXA 1YKRA 4IE9A 5LCKA 2BPMA 2P2IA 5BMMA 2REIA 3ZBFA 2JKQA 2WMQA 2W1HA 3HGKA 3KRJA 4QYYA 4RIXA 4C38A 4DN5A 4EH2A 2QF7A 4WSYA 2I80A 1YXUA 4USEA 4D2SA 3R28A 4QTDA 4KSQA 2JBPA 3GEQA 2YCSA 3HDNA 2W9FB 3TV7A 2PULA 1FVVA 4I92A 4ANQA 2XBAA 4KBCA 1P4FA 4YNOA 2WMAA 4IAAA 2W4JA 5E91A 4F7LA 5AAGA 1U4DA 2B53A 3DK7A 3EQCA 4L01A 3TJCA 1PK8A 5CU3A 3S3IA 3BE9A 2DLNA 2JIVA 5C8NA 1Q61A 2GFCA 3LFDA 3KAKA 4ZSJA 2BHEA 3ZS5A 5BNJA 2IW9A 2FUMA 2WQNA 1DS5A 3N9XA 4NJ3A 3UC3A 4AOJA 4EH8A 1Z57A 2EB2A 3BQRA 5HCZA 3UG2A 3GCQA 4AGWA 1Q8TA 3ORMA 3NW6A 3FUPA 3NSZA 4WKQA 5AP4A 3O8TA 4E4TA 2OWBA 4GW8A 4P7EA 4RC3A 2CPKE 3ZDIA 3ZLXA 3OWKA 1MUOA 3DKOA 3NUXA 5CA0F 4IAZA 2BCJA 3TDVA 3OY3A 4U6RA 5M08A 3U9CA 2VTTA 5EQEA 4E6CA 2ZV7A 3ORKA 4HYSA 3ANRA 2BRGA 2J0JA 5HG8A 2WOUA 2GCDA 3PWYA 1EYZA 5BVFA 3QCQA 3NMUF 3TKUA 3TL8A 5FEEA 5LARA 2P33A 4G3EA 4L8MA 4RG0A 3OWLA 2WAJA 3KALA 3QZIA 1KJIA 2R3FA 4YO4A 4HVGA 4RJ5A 2HJWA 3RALA 3F88A 5HEZA 3UJGA 4LGHA 1OKZA 3KMUA 4W8DA 4ZAUA 4IB5A 1GSOA 1YOMA 2JKMA 3OOGA 4CFNA 2VTNA 3NIEA 3QKKA 3HMOA 4NH1A 1KWPA 2PZIA 3FXXA 4FV8A 5IQGA 4I0RA 1FGKA 4DCEA 5CS6A 3ZO3A 3Q9ZA 4FTUA 4QMXA 3KXHA 1GZKA 1WBOA 4N70A 2C6TA 3O51A 4TTHB 3POOA 2RFNA 3UP2A 3ZC5A 2V7AA 3ZFMA 1WVXA 4AN2A 3U6IA 4FSNA 4O2PA 3FLSA 4NYEA 4U41A 3NX8A 3PXRA 1WBPA 5EW3A 4G3GA 2VWYA 4L3LA 2E9UA 4FVRA 4IIRA 5HIEA 5HZNA 3PSDA 3A8XA 4GYIA 3SVVA 4MXXA 2XMYA 2GHMA 2BZKB 3R02A 3U51A 3TACA 4B7TA 2G01A 1T46A 4BTFA 2YIYA 2R3OA 4C2VA 5HX8A 3MFTA 3W55A 5AUWA 2CGXA 3L8XA 5EDPA 3UDBA 4DF3A 2C0OA 3A4OX 4HR7A 4RIOA 3R8ZA 4FT5A 2VNYA 4BYJA 4DEHA 2UVXA 3NNWA 4HCVA 3WO1A 5DNRA 2XIRA 4P5ZA 4EORA 4FA2A 3PJ3A 4C4GA 3HRBA 4G17A 4CNHA 5HTBA 3ERKA 2UW8A 3ENMA 3O17A 2IN6A 1ZOEA 1YOLA 4RC4A 3AW8A 4BCNA 2IVSA 5HU3A 4J7BA 3LW0A 3A7HA 4NU1A 2E9VA 3PE1A 3MH0A 3WF8A 2WHBA 5DFPA 3Q4CA 5HBRB 4BCPA 1UWHA 3Q9YA 3R7UA 3ODYX 1GIJA 4WBOA 4BZNA 4HPUE 1DIKA 2R5TA 2WTWA 4AE9A 4KNBA 4JRNA 1MRVA 4DBNA 1XJDA 4DFBA 3H9RA 4PX6A 5LWNA 4RC2A 3Q4ZA 4II5A 1YW2A 2FPGB 4XG3A 3CGFA 4C3FA 2IZSA 1JKTA 2YN8A 3G15A 3G9LX 3ZYAA 5JQ8A 2YM6A 5CF5A 4FEQA 3NPCA 2GNIA 2ZDHA 2BDJA 3SLSA 3CTJA 3KREA 4ID7A 4U97A 1YDTE 3II5A 3VPCA 3B8RA 3RCJA 5CQUA 3TTJA 3WZKA 4O7WA 3R21A 3COKA 3RAWA 5K5XA 4MAMA 4H3BA 2C6MA 3CS9A 4RIWB 3MN3A 2YAAA 5EHOA 2ACXA 1JKSA 4FTMA 2ZDGA 2C6KA 4FIJA 2XNOA 4M0YA 3COMA 2XCLA 4E7WA 3WZDA 3DCVA 5JT2A 2CMWA 5L6WL 4CD0A 5IQHA 1SMHA 3H9FA 4CV9A 4L45A 3UP7A 3LJ1A 4B99A 3GC8A 2R0UA 3LOKA 3E7VA 3PTGA 4O83A 3OC1A 1KV1A 4P4CA 3WF9A 2G2HA 2J6MA 4TKSA 3ZFYA 5IA2A 3Q5IA 5F4NA 3N4UA 1XHAA 2OW3A 3BIZA 2B55A 5CQWA 2PK9A 2BHHA 2ITXA 4CMUA 3KRLA 3WO0A 4PY1A 1ZRZA 3KAJA 4EK8A 3VOTA 3QQKA 4MV1A 2I0YA 3R2YA 5E4HA 5AWMA 5CNOA 4LUEA 3QWJA 4Y5QA 5CTPA 3NS9A 1GOLA 4EHZA 4EOSA 2R3RA 4PP7A 4YJ2F 1Y8YA 1NXKA 2FPPB 1CKPA 3BYUA 4IAYA 4TYHB 5IDNA 2XF0A 4RQVA 1OKYA 4N6ZA 3W8QA 1GY3A 5KMKA 1Y57A 2CHLA 2X1NA 2HZIA 3GGFA 3ZTXA 3HVCA 4MBLA 1ND4A 1HOWA 2I0EA 3DOGA 4OBOA 5LVPA 4I50F 4RQKA 4WBNF 2J0IA 1G8SA 2BTRA 3EN9A 1Q8WA 4GJ3A 4XBUA 3SA0A 2JKKA 5EHLA 5I9UA 1FOTA 3DTWA 4L3JA 3VJOA 3BLHA 2VO0A 4P5QA 4I24A 5DG5A 4EHEA 3VF8A 3QX2A 5B2KA 5IG1A 3OFMA 1IASA 3Q60A 3D5XA 2YCQA 3MVHA 3FLWA 2ZB1A 4JVGA 2R64A 5JFSA 4CMTA 5AA9A 4FKWA 3SOAA 2C1AA 4BHNA 4CCBA 5EYMA 4AZTA 2YZGA 3KY2A 2R7IA 4YAKB 2GFSA 4FSYA 2C6OA 4O0YA 3ZUUA 3Q52A 3VBXA 3F6XA 1OITA 2OI4X 3ATSA 5M4UA 5G6VA 3P78A 4CCUA 1DV1A 4HNUA 4DFLA 2C3LA 2YFXA 2F7XE 3MESA 4YU2A 1YI6A 5M06A 1EZ1A 3QHWA 2F9GA 2PWLA 2C0IA 4DH8A 4CFUA 3BU3A 3S0OA 5AX3A 3HMPA 2QU6A 1DAYA 2UW6A 1G8AA 1HCLA 3NNVA 3MA3A 1PXNA 4XRLA 3ZLYA 4DLJA 5C1PA 3G33A 1IOWA 4H58A 5IQBA 1FMKA 2XBJA 4HNFA 4B9DA 4S2ZA 4F0IA 3ZO2A 2W1ZA 4DGNA 2B4SB 2HWOA 2VU3A 4Y5HA 2YM4A 3AT2A 3PJCA 2C3JA 3HA6A 3FI2A 3F2RA 3BU5A 4NW6A 5AV0A 4GIIA 1TQPA 4DFUA 1ZAOA 4MA0A 3QQFA 1H26A 4FGBA 4MNEB 3RHXA 1M7QA 4GMYA 4H1JA 3DZOA 3R1NA 2KTYA 3CKWA 2A4LA 2W6QA 5K5NA 3D7ZA 2WTKC 3GP0A 5E8VA 4DEIA 3R1SA 5KKRB 3EFWA 1UA2A 4RWLA 5CSWA 3SG8A 2O65A 3DKCA 4DFYA 1KJ9A 3K3PA 2VWWA 4YTCA 1JAMA 4CZUA 3C4FA 5IZFA 2XK7A 2PE1A 3AD4A 3LKMA 4TYGA 2XH5A 2GDOA 1UU7A 3FMKA 5EM7A 5AUXA 3EQPA 3FLZA 4DHFA 3Q2OA 1Q5KA 3G0EA 4RVLA 5HX6A 3G8CA 4TN6A 4KKHA 4KIPA 4FUYA 3QQUA 3RM7A 4MF1A 3V8SA 2WIPA 2QONA 3QRTA 2VR1A 3WZEA 2J0KA 3TCPA 4TRLA 3UBDA 3R1YA 2GNJA 4MA5A 5CYIA 4QO9A 5CU0A 4JBVA 4O21A 3P1AA 5DPVA 3R8UA 3SOCA 4N57A 3VMMA 2RFEA 2WMBA 3V5WA 3GQIA 3OW3A 3FQEA 4FEXA 3GU5A 4IMYA 4PL5A 5CXHA 5C8MA 3UO4A 1PXJA 3K3JA 4ZY6A 4DG3E 1VKZA 2W5AA 3JVSA 4XX0B 2OJ9A 2UW3A 4XP2A 5AAEA 2VGOA 4MXZA 5CWZA 3WF5A 3HO8A 3IKAA 5TO8A 3BQCA 3O50A 4GRBA 4O7RA 3B2TA 2YJRA 5E8UA 4IB3A 5B0XA 2O0UA 1YDRE 3LFCA 4UXQA 5F94A 4UBAA 4EHVA 3BG5A 2GTNA 5CU6A 4F99A 1MP8A 5CA1F 2BILB 2ONLC 5CEPA 3KA0A 4AT5A 3QXPA 2C4GA 5GIOE 2R86A 4RIXB 4AA4A 4H05A 2PZYA 4FT3A 3W2QA 4BCFA 4Y8VB 4O81A 3W1FA 2J5FA 5EI6A 3SG9A 1BMKA 1M7NA 2Z2WA 3DQWA 3QD3A 4W4XA 4BKJA 3JZIA 2PVYA 1GZ8A 3BKBA 3EN5A 1KE5A 3GCPA 1K9AA 3WE4A 4BCQA 4FE2A 2G2IA 4LMUA 4D9UA 5M4FA 3Q1KA 4XYLB 3OVVA 3EQBA 5T68A 2VNWA 3QU0A 4FT0A 4DH3A 1H1PA 4U43A 3GCSA 3LAUA 2XVDA 1JNKA 5M4IA 1C30A 3JRWA 2G1TA 4O7LA 4R6VA 3UPXA 3QA8A 4C35A 4JDKA 1PY5A 4JDHA 3DF7A 2Q0NA 3FZSA 1FQ1B 2PE2A 4KRCA 4PP9A 4XP3A 1I7LA 4RJ7A 2ERZE 2HZ4A 4MEDA 3FXWA 4F70A 3IO7A 1H00A 2CNVA 4IVCA 1RE8A 5D11A 3CJGA 3FDNA 3FPQA 5B7VA 2Z7RA 2I40A 2X0SA 2ETRA 3V01A 3SV0A 4F7JA 4HYUA 2UZNA 5CAOA 2UZWE 1W98A 2C6IA 2XK6A 3RP9A 3TI1A 1XBBA 2YL2A 2DYLA 4Q5HA 5E8XA 3SHEA 3FJQE 3R5XA 3SE7A 1OL1A 5AP2A 5CXZA 3QFVA 4QMZA 1CSNA 4WBBB 3KGAA 3BHVA 1LPUA 1QPDA 4L9IA 3BHTA 3WOWA 3U9TA 3W18A 5EQPA 1DAWA 4AS0A 2ZM3A 3UNJA 3PY1A 1EUCB 1E1XA 3MY0A 3ODZX 3W2SA 1CMKE 2QHNA 1PKDA 4L53A 5HO8A 3TV6A 2WMUA 5ETAA 5CT0A 4F1MA 4F64A 2ZVAA 5FDXA 5AUTA 5HU9A 3R9HA 1BL6A 4W4VA 1WBWA 4EZ7A 4NW5A 4S31A 3H30A 4ITJA 4NK9A 4O7ZA 4A4LA 4FTJA 4I5CA 1NVSA 2DQ7X 3N4VA 5DLSA 2JDVA 3T9TA 5E1EA 4H3QA 1APME 2W1CA 4JQEA 5GINE 2C3IB 2XKEA 2J2IB 1ZARA 4E6DA 4ZTNA 4G6NA 1ZXEA 4OTFA 3GCVA 1CE8A 4IFCA 4IAKA 5E92A 2HIWA 4USFA 3NUYA 4IVBA 4X2GA 2GS6A 4L7SA 3MH2A 3RPOA 1ZLTA 2BUJA 4PDSA 2H8HA 2WU7A 3LFNA 5CVHA 3JYAA 2I6LA 3QYZA 4NSTA 3ORXA 2GQGA 2OICA 3EQFA 5TF9A 4FFLA 1YHVA 1GSHA 1TQIA 4MKCA 4R7IA 3KN5A 3EYHA 2XZSA 4R3RA 5JGBA 4E6QA 4HGSA 4DH5A 5FBNC 4X2KA 1B6CB 5H8GA 2CNUA 3H0YA 4RLLA 4XRJA 5EG3A 3OUNB 4BDGA 3CQWA 2QC6A 3ULZA 2XA4A 1STCE 4Q9SA 1JQHA 3HECA 3SRVB 4BI2A 3KULB 1ZY4A 3E64A 1FPUA 3AGLA 3DAEA 4HGTA 5J95A 4GYGA 5J1VA 4GG7A 3NUNA 4YB8B 5DT0A 3KC3A 3C4CA 5DGZA 3SKCA 1PMNA 3ELJA 2W1IA 4EQMA 2GU8A 5C8YF 3MBLA 5ETCA 4AN9A 4ASZA 2XNEA 3KMWA 5IA5A 4X2NA 4JBOA 3BHYA 3OCSA 4PNKA 2IVVA 5K9IA 2HAKA 2X4ZA 3QUDA 4FSZA 4E26A 4OW8A 3K5VA 4EJ7A 5DBXA 3MIAA 4NL0A 5A6NA 3MY1A 2UZVA 2WTJA 2ZV9A 4K77A 3WBLA 2PZ5A 4A06A 3E8DA 3QTRA 2GNHA 5H8EA 2X0GA 4FNYA 2Y4IC 3O8PA 2BDWA 5F20A 2GHLA 4N6YA 2JITA 3V5LA 4CVAA 2OLCA 4JR3A 1E4EB 4IX5A 2YAKA 4F63A 2YJSA 2YM8A 4XZ3B 4MXYA 4NWMA 3UVRA 3O23A 4GU9A 3UOKA 3DB6A 3FQSA 4JG7A 1GSAA 3AT4A 3QD2B 3C9WA 2QG5A 4LYNA 5DOSA 3QCYA 4ASDA 4ZTRA 3DNEA 4I4TF 3RTPA 2JLDA 3HV7A 4I20A 1JLUE 1OBDA 2R0IA 4FC0A 4YSJA 5AV3A 3FXZA 3VULA 3PLAE 1Y8GA 2EVAA 2NUAB 2B9IA 2XIYA 5KZIA 2QLQA 3QC4A 4FZAB 3UVPA 4EK4A 2X39A 2W9ZB 4RIWA 5BYLA 4YC3A 4QTBA 3H3CA 3ZUVA 1W93A 2YZAA 3C1XA 3D9VA 2W5BA 4PF4A 3V04A 4F1OA 3VC4A 3NRMA 3CPBA 1OUYA 2UVZA 5HVJA 2GNLA 4YC6A 4EH5A 3DJ7A 4FKSA 4G9CA 3WF6A 4AW0A 4YTIA 2J5EA 5I5ZA 5KMLA 2XCHA 5CU4A 4EYJA 4TT7A 3E7OA 2WKMA 3QFFA 1W7HA 1VJYA 1XH8A 4CKJA 3REPA 4GKIA 3AQVA 3MH3A 3AC2A 3R9RA 3HA8A 3PPJA 2HXLA 1BNCA 3TZ7A 4RVKA 3F3WA 3UOHA 3Q9XA 3IDPA 3CY2A 5FLFA 2GS2A 3I12A 1KOBA 4BDDA 4F0FA 2WMSA 1U5QA 3FWQA 3HLLA 3FMHA 4KKEA 4NT4A 3PYYA 3FZPA 1OPJA 4K6ZA 5KUPA 4BCMA 1CQIB 4S34A 1A9UA 3F3ZA 4FTIA 4IDVA 5CENA 3UQGA 1H4LA 4TYHA 3PPZA 2VTMA 2X8DA 4USDA 3PY0A 4GFGA 4H39A 3TZ9A 2BFXA 2XJ2A 1J7IA 2ZMDA 5KMIA 4FKUA 3E8NA 3QTSA 1G5SA 4R1VA 2UW7A 3LE6A 5DT3A 5KCVA 4O2BF 1KSWA 3HP5A 3DKFA 3W32A 5AP3A 3GC9A 4DT8A 3TIIA 2J0LA 4FFMA 4EHGA 2WEIA 4JLCA 3QKMA 3UIXA 2GNGA 4RIYB 3KN6A 4FU0A 1I09A 1VYWA 3D5UA 3V8WA 1GGOA 4GG5A 4BCKA 2R3GA 3Q6UA 4LV8A 3UQFA 3CTQA 4WNKA 5CEMA 2YEXA 4M67A 3ZBXA 4IAFA 5TOZA 1OKWA 4FEWA 4IADA 4X2FA 2IZUA 3KF4A 4L3PA 5HCXA 1O6LA 2PVFA 3EFLA 3LHJA 4BDAA 4EOOA 4QMNA 3AGMA 4X0MA 1SCUB 5AP1A 1AUXA 4FK6A 3KB7A 3LFQA 3UMWA 4HCTA 3BBWA 2OK1A 3DKGA 2X9FA 3AD5A 4YHJA 3SX9A 5L2TA 4GK3A 4DBXA 3C4ZA 1F5QA 2FH9A 3A7FA 4YMJA 4BCOA 3L9NA 4B8LA 3PSCA 2QOQA 5HE2A 4J1RA 5EW8A 4RJ3A 5FEDA 3P9JA 4PDPA 1B38A 4FKTA 2YHVA 3V5JA 4IACA 5JQWA 5BPHA 1I7NA 1E1VA 3CR0A 2QVSE 3CD3A 4FL2A 3MWDA 2O3PA 4JAJA 3VS7A 4NM0A 4EZ5A 5M4CA 1C3OA 4DFNA 5HKMA 3ENHA 3CIKA 4EOQA 3U6HA 3OZ6A 4WT6A 3IS5A 3PG1A 4YBKA 4EUTA 5JH7F 2QOOA 3AD6A 2JDTA 3MJ2A 3WIKA 1H0WA 5D9HA 4XX9A 3UIMA 4FT9A 4AWIA 2B0QA 2B7AA 2O5KA 5CNNA 1Q99A 4D1XA 1JDBB 2PUPA 3BPRA 4S33A 4S32A 3ZONA 3BGPA 5I9ZA 5LYJF 4FKOA 4MNEA 2QHMA 4I22A 4QYHA 3PP0A 3TQTA 3QRUA 4TZRA 4BGQA 4JDIA 1UNLA 2VV9A 1VEBA 3QCSA 5KE0A 4RFZA 3ZZWA 2R87A 5JVDF 3DJ5A 1X8BA 4ZIMA 3VIDA 1XO2B 2V62A 1JKJB 1ZY5A 2J9GA 4U8ZA 4C34A 1IA9A 2A19B 3L8PA 2YIRA 3DBDA 5DEYA 2IJMA 3I7BA 3PUPA 3VQHA 4CFFA 3KMMA 5B2LA 2XRUA 2YZLA 4AFJA 4BBMA 4EKLA 2C5XA 1U5RA 3GNIB 1JPAA 4L6QA 1V0OA 4FTRA 5E8ZA 4Y95A 4ZOLF 4ZHQF 3FKLA 4LRMA 5J8IA 1OUKA 5IQAA 3TUDA 1REJA 3QLGA 4EK6A 2XCKA 3H9OA 2WMTA 2VO3A 2C6DA 3PP1A 2PVMA 4IWDA 4K9YA 3QD4A 4OBPA 4EOJA 5K4JA 3F7WA 4JXFA 5JRSA 4GVJA 3ZXZA 1UU9A 3D94A 2WMXA 3PXQA 3WYXA 2DIKA 4XG4A 5JSMA 2PZPA 4LMNA 2VD5A 3NAXA 4OT6A 1YXXA 2GMXA 3GOKA 4NFMA 2NRUA 4L43A 3TT0A 2EXMA 2P2HA 3ALNA 4F6UA 3NVKI 4XP0A 4FICA 5LVMA 3IOKA 4MX9A 4EG0A 3V8TA 3Q32A 2XNNA 3UNZA 3UOLA 1SYKA 1QPJA 1IAHA 3VS4A 4CFXA 4XYMB 4DA5A 4J96A 3ZUTA 1BXRA 5C1QB 5I0BA 4YZCA 3WF7A 3KF7A 4BCJA 4EOPA 2W0JA 3I7CA 3FAAA 4J71A 2R3JA 2BDFA 4ZZOA 4UALA 5IMXA 2JC6A 3R5FA 4WUAA 4ZY5A 2Q83A 1ZMVA 3UFXB 2VWBA 2V22A 4A9YA 4AG8A 5KMOA 2W4OA 3EOCA 5CU2A 3BZ3A 2EXCX 3LXPA 3NNXA 3R83A 2P3GX 4KD1A 3DXNA 3NNUA 4UZHA 2CN8A 3DV3A 4C4FA 2WZJA 4A9UA 4L00A 1CQJB 3LM0A 2ZDTA 4A9SA 3NW7A 3QZHA 4QMMA 4XV9A 2AC3A 3ORLA 4RZQA 2JFMA 3MDYA 4JAIA 3C0GA 5J7HA 3RK9A 1KJJA 4TNDA 4C36A 1TVOA 2GTMA 3HYHA 1KEEA 3VS0A 5DHJA 1HCKA 2A0CX 3O7LB 4G16A 3FBVA 3OD6X 2G9XA 4LL5A 1UVRA 1V1KA 4UWCA 3VNTA 5AJQA 2I7QA 5D10A 3I0QA 4HVHA 3GXLA 4QMUA 3TV4A 4M84A 2W1DA 2BAKA 4FKVA 4RSSA 1VBGA 3ZO1A 3E5NA 2F49A 2PL0A 1NA7A 3RWPA 1TQMA 5HG9A 4AUAA 2W70A 5AUYA 3PWDA 3VHEA 5M55A 2V5QA 3Q2MA 3LQ8A 5DYJA 4DINA 4IM2A 4WOVA 2R82A 4MBJA 2WOTA 3NWWA 3Q4TA 4DITA 4MWIA 3ETAA 1Q24A 3S4QA 3SDJA 4F4PA 1ATPE 3QYWA 4O7YA 4OTHA 3ZM4A 4I4EA 4EYMA 2E9PA 4DFZE 3BYOA 4ENXA 1GIIA 4XOZA 4XYFA 4F9AA 1CS0A 3BI6A 1BL7A 2WB8A 3D5WA 3DGKA 3R71A 5CY3A 3R7VA 4BTJA 2NPQA 1CM8A 3WILA 3Q9WA 2UZDA 4IB0A 4YJPA 1OB3A 5AV1A 2CN5A 4YHFA 2CSNA 3E3PA 1Y6BA 4FV2A 4L67A 2OIQA 5H2UA 4M14A 5EZYF 3LIJA 5ANDA 5EKNA 1OPKA 3DNDA 2X8IA 3R7YA 3FY2A 2ITZA 5JFWA 4LUDA 5BX0A 1XH5A 2OZAB 4UY9A 2AUHA 3A99A 5DEWA 3SRVA 2YWPA 3KULA 4EH9A 4BYIA 4MHAA 3HUBA 1Z9XA 1UNGA 3BGZA 4CXAA 1PF8A 2I1MA 1J7UA 2QNJA 4PRJA 3UYSA 5JVLA 1OPLA 2V55A 3JZFA 5JQGF 3VUGA 4CLJA 4C5CA 3COIA 2OJIA 3EH9A 4PV0A 2QO2A 5CAQA 2H9VA 4MV7A 3C0HA 4YZ9A 3FYKX 3R8LA 3VQUA 3LMIA 3R73A 4B4LA 4ZZMA 3R7OA 3EWHA 3DB8A 4F7SA 1AD5A 3FL4A 3MA6A 4CT1A 3ORRA 2O63A 1M52A 3A8WA 4GT5A 2PU8A 1H08A 3CLYA 1OVEA 3DS6A 3F5XA 4XHKB 5DRDA 3RPSA 3V5TA 3OW4A 4QQJA 5EDQA 3P7CA 3F2AA 2V58A 2DWCA 4FNWA 4O4JF 3LFEA 3V5PA 2QOIA 4RWJA 5CI7A 3RKBA 3GLKA 4PL3A 4OTDA 1OIRA 2BRHA 4EL9A 2RKUA 2A1AB 5DH3A 3NUSA 5AAFA 3OCTA 2XNBA 3UODA 4RT7A 2YW2A 1XKKA 4C3PA 5HHWA 3FI4A 1E4EA 4TWPA 1M0TA 5FEQA 4FV3A 2VO7A 4PMSA 5LCJA 3R5HA 3TM0A 4D4RA 4QP2A 5D7VA 2PMNX 4M15A 4IM3A 2NP8A 3KKVA 4QNAA 1PRYA 2XK3A 4IM0A 4DTKA 3W2RA 4D0XA 1JLLB 2FB8A 3LQ3A 5T3QA 5D8DA 4EK5A 3BYMA 3FLQA 2V5AA 5LP6F 4RWIA 3HX4A 4TYEA 4ACDA 5HG5A 3C13A 4K2RA 4M3QA 3KVWA 3CGOA 4I4FA 3OUKA 4UXLA 4PMPA 2PVJA 4FMQA 1QPCA 4JT3A 4LGGA 4G3FA 1LR4A 2PBZA 4TPTA 3F5PA 1GJOA 2WQMA 4F6SA 5JN2A 3CSVA 4RPVA 4XCUA 3TJDA 3P23A 1M14A 4MD9E 4B8MA 1JBPE 4O82A 1JWHA 1OIQA 2PHKA 2R3HA 5JFXA 1KE6A 3ITZA 5D1JA 2NO3A 2J4ZA 4PMMA 3W33A 2R3QA 4JR7A 4F9BA 3JVRA 3A7JA 3E63A 2B54A 3EZRA 4FFPA 3DT1A 4QP7A 5DR6A 4OTGA 4EWQA 3RPYA 4TL0A 3HV3A 4QPSA 1J91A 1KJQA 4RMZA 4B6LA 4D9TA 2DZDA 5FRIA 2YACA 4O7TA 1OL7A 1A48A 1FVRA 1YQJA 3CP9A 3QLFA 4O91A 4U40A 3IW5A 4UV0A 5CLPA 5BUIA 4HNVA 4FZFB 2FSLX 3C50A 4TYIA 3BBTB 3ZH8A 4E5AX 1GIHA 4IHJF 4O0WA 2XIXA 4GSBA 3SQQA 4JI9A 4YJRA 4BCHA 5CF8A 2ZDQA 1PHKA 5BPYA 2AC5A 2YITA 5KNJA 2WFYA 2HELA 2QKWB 3FHRA 3ID6C 4U9AA 4QMSA 3TNIA 1L8TA 1PMVA 4YNEA 3RAIA 1YI3A 2FA2A 4QP9A 3SC1A 1JKKA 4ZZNA 1XQZA 3UC4A 2PYWA 4AW5A 5AEPA 5AM7A 4GUEA 1L3RE 2UW0A 1OIUA 3R01A 4HPTE 2NU6B 2Y6MA 3VAPA 4J99A 1MRUA 2BRBA 3CD8A 3LVPA 2YZNA 2NRYA 2SCUB 4ZI7F 3T9IA 1B6SA 2YM7A 4KS7A 4GT4A 4RIYA 4ERKA 3R9NA 2XIZA 4FSWA 2BZJA 3SXFA 3RZBA 2ETMA 2J7TA 4WRGA 2ITQA 1WBTA 2X6EA 2WMVA 2FYSA 1Q62A 2RGPA 2G2FA 2CKQA 3QWKA 4QP1A 2R4BA 2YM3A 4X3FB 3RHKA 4A4OA 2Z8CA 4TWCA 5IF1A 5HBJA 5J5SA 4YJ3F 3IQ7A 5A46A 1OMWA 4FR4A 5D12A 2G15A 3TTIA 2QOLA 2WTVA 3K5HA 3QX4A 5CZHA 1UKIA 2GPHA 2RG5A 3L1SA 5LXTF 5LVOA 4I6HA 5H9BA 3U8WA 1M6VA 4ERWA 4ZTQA 2WQEA 3KRWA 4I21A 3L8SA 5EDRA 1ERKA 1RW8A 4KWPA 5LMAA 5ICPA 5DN3A 2FB9A 4LI5A 4DEBA 3U4WA 3DFCB 4FYOA 4LOPA 4G9RA 1J3HA 3TNHA 1NY3A 2H96A 5KMJA 2YDJA 4DTAA 2QG7A 2C69A 3LFSA 1U54B 3M11A 4LV5A 3D7TB 1VZOA 4AGUA 5A3XA 5JEBA 1Z2PX 4FIEA 2WQOA 2R3LA 5L2IA 2PE0A 4Z9LA 4GS6A 5EI2A 2PMOX 4IVDA 3QQLA 4CRSA 1OM1A 3NR9A 4L7FA 4D1SA 3THBA 3P08A 2UW9A 4AT3A 4BY9E 4ALWA 2O64A 1PYEA 3Q5ZA 3DAJA 2WMWA 2YCFA 3AMBA 3MFSA 2YIQA 3MB7A 4PWNA 5A4LA 2Y9QA 3GU7A 4JJRA 3TUCA 3LCTA 1Z2OX 4KA3A 5JRQA 4BZDA 3OCGA 1M17A 5J2TF 2WQBA 2Y8OA 3TIGA 5F95A 4CRLA 4DGGA 2CDZA 2VTOA 2Z04A 3JR1A 5CF4A 3O2MA 4QT1A 4LRKA 3BWFA 4MV6A 3VBWA 5C8KA 3MVLA 3A62A 4FIHA 3OXZA 3OTVA 2BVAA 5HQ0A 5GJGA 3ETJA 5BYZA 2QOBA 5FG8A 3VS6A 3C7QA 3OP5A 4EUUA 5E8WA 3PJ2A 1WCCA 2OH4A 3KK9A 3L9PA 3R22A 3AC4A 5AP0A 4F09A 4FUXA 4KB8A 4ZLZA 2W71A 4QSHA 3V6RA 5FNVF 3ZCLA 3ZHPC 3FZRA 2B1PA 1R78A 3QRKA 3N6RA 3F66A 4YJUA 3SGCA 3T3VA 5IA1A 2IP4A 5AUVA 4QMTA 3EJ1A 2QD9A 4XEYA 3FMEA 4D58A 5EM8A 4JS8A 1NVQA 2J50A 4L42A 4MNFA 4RX8A 4GT3A 3W8LA 5A9UA 2J0MB 3TG1A 5C4LA 4ZMEA 2Y7JA 4O0XA 4Y85A 2FVDA 2BIYA 4FKGA 4HYIA 4QMVA 5HG7A 4Z55A 5EFQA 4O2AF 5BUJA 3I79A 5LMBA 5E9EA 1LP4A 3FPMA 2QOFA 4MBIA 4MXOA 3JY9A 4U81A 4GU6A 4XG9A 4EQUA 5M51A 2AYPA 4FKLA 3M1SA 4J53A 2PUUA 4GL9A 4NM5A 4GKHA 2LAVA 5CVGA 3FEGA 4WRSA 1R0PA 3RWQA 5L8LA 5ANGA 2JGZA 4V04A 5HBHA 3SXSA 2R7KA 4TY1A 4YPDA 5EOBA 4EOIA 2I87A 5KHXA 2CLXA 4E4MA 1KE9A 3W2OA 4DG2E 3DDQA 4XNEA 1A9XA 1DV2A 3KQ7A 3QHRA 5CF6A 4JIAA 4GK2A 4BDCA 4QP3A 3UO5A 4CG8A 3GVUA 4PTGA 3DBCA 3LFFA 1YHSA 3RM6A 2ZAZA 2ITVA 3WZJA 5A4QA 3VS2A 2ERKA 4QMOA 4FZ7A 2YYAA 4ZS0A 5IQIA 3G90X 4D5KA 4IB1A 3QUPA 4O22A 1PW2A 5K4IA 5ACKA 3OUUA 5LWMA 5ANJA 4I5HA 4PQNA 5BYYA 2W6ZA 3LCDA 3R1QA 4BR3A 3TZMA 3VW6A 2WMRA 2Z02A 4HJOA 5AFVA 4O4LF 4HGEA 2F4JA 1O6YA 2P55A 3Q96A 4AZWA 5KX8A 2BTSA 4KIQA 3KFAA 3KU2A 5HI2A 5KX5F 3UMXA 4YZDA 4NZWB 5HD4A 3R9OA 3POZA 4CKIA 4WG3A 5CSXA 5E8TA 2PY3A 3QRIA 4I6BA 4U3ZA 3RGFA 3NUPA 4FSQA 5I4NA 5A6OA 4ZTMA 3QALE 3EIDA 4O0TA 4OUCA 3SW7A 4UWBA 3UZRA 4I6FA 4BI0A 5A4CA 2YIXA 4QMWA 1K3AA 4U0IA 4YHTA 3QL8A 1G3NA 2YS6A 2BRMA 3HNGA 2UZEA 5FXSA 4E8AA 2EU9A 5AP5A 4AOTA 4E5BA 4NCTA 4O0VA 2OSCA 1QCFA 2PSQA 4QP8A 2UW5A 4G3CA 2WYOA 2BAJA 4EI4A 1R39A 1PMEA 3TW6A 3GT8A 4HW7A 3VJNA 4BDHA 4CFMA 4DG0E 3Q4UA 3BEGA 2O8YA 4R78A 5LQFA 3OMVA 5ANKA 2C1BA 5IYZF 4FIIA 1NT2A 1ZOGA 3F9NA 3I6WA 1JVPP 2HWPA 2IG7A 3KXZA 4RVMA 4WNPA 4HNIA 4KKGA 2PVLA 5CALA 4XMOA 4XS2A 3EQDA 3RFCA 4G6OA 3EFKA 3W10A 3I5ZA 2FP4B 1Z5MA 3RK7A 3EYGA 5GIPE 2PN1A 3V3VA 1W8CA 1YXSA 5J2UF 3EZVA 2JBOA 4E1ZA 4E73A 2OZAA 2FPIB 2I8CA 3VWAA 4HZSA 4I41A 5C03A 3KCFA 4K8AA 5KKRC 3ZOSA 4YLKA 3L9LA 2RIOA 4APCA 1H24A 1U59A 4I3ZA 5C26A 1PXMA 3P7BA 3ZEPA 1EUDB 3I5NA 3QAME 5IUIA 3W2CA 3IDCA 2QURA 4IZAA 4F0GA 3V4SA 3D2IA 3R8VA 3IK3A 1SVHA 2E2BA 3EN7A 4R5SA 4I5MA 4A07A 3GUBA 4L44A 4O7SA 4ZLYA 1IAJA 4ANLA 3RVGA 4XV2A 3LPBA 5EW9A 4Q2AA 3ZEWA 3V6SA 2Y0AA 1CTPE 1KOAA 5LVNA 3GCUA 3QA0A 1YXTA 2JDRA 3RINA 4F6WA 4MCVA 2OU7A 3VN9A 1M2RA 1SNXA 1Y91A 2Z7QA 3K3IA 3NYVA 2XKFA 4WD5A 2W96B 5E1SA 4O6LA 5I9VA 5M53A 4DEGA 5L6PA 4XUFA 4ZTLA 3AC3A 1KBLA 4UYNA 4C58A 5A4TA 2CNQA 3R7EA 4D1ZA 5M57A 5J9YA 2VN9A 2OJJA 4S30A 3TKIA 2XIKA 3UVQA 1ZYSA 3EKNA 5BVEA 3JRXA 3LCOA 3KXMA 4AN3A 3BELA 2OJFE 3NYXA 4FTQA 4WNOA 3PPKA 4GIHA 1WBNA 1IEPA 5FM3A 2DUVA 3DQXA 4EOMA 3G9NA 5HVYA 3VO3A 2CGUA 3Q2JA 4Y73A 3V5QA 2JD5A 4GFMA 4AQCA 1CKJA 4IH8A 3WYYA 2XNMA 5FD2A 4BBFA 4RFYA 1M2PA 2PVKA 2R3PA 1IRKA 3OBJA 3PVWA 4DAWA 4BGGA 1ZZ2A 2VX0A 5LXMA 4LFIA 3IW6A 5IUHA 3FMLA 1YVJA 2YIWA 3E92A 4TWNA 1ZWSA 1V0PA 3PLSA 2I0HA 2GQSA 4FTCA 5HE1A 3R8PA 3TIZA 1W82A 1P14A 2XYNA 4QMPA 4L52A 4FOBA 4PL4A 3D4QA 5ANEA 4D4YA 4YLLA 5C4KA 4QP6A 4K0YA 5CAUA 3PVBA 5CSHA 4CGAA 2YZMA 2VWUA 3HMMA 3RI1A 2HENA 3EN6A 3JY0A 2DWBA 4NTSA 4MXCA 3A7GA 4Z7GA 2JIUA 4LRJA 3OUZA 1UU8A 2W17A 1AQ1A 4WO5A 4FNXA 4GFOA 5LOVF 2VZ6A 3LFAA 3ULIA 4BTMA 4XLVA 1MRYA 1Z2NX 1GZOA 4ZJVA 4FV0A 5HE0A 2C5OA 2C00A 3WE8A 1URCA 3RUPA 1NW1A 2VTAA 2XRWA 4WG5A 5A4EA 3LP8A 5L8JA 3ZC6A 4AA5A 4EH3A 2JAVA 2ETKA 4AXAA 3TN8A 4L46A 3N51A 3RAHA 3O7LD 5DR9A 4JQ8A 3FLYA 4YLJA 1EH4A 4AZVA 3BRBA 3PRFA 3C5IA 3NIZA 4LG4A 2C0TA 3VRYA 4F65A 3BLRA 3MPTA 2LGCA 2R3KA 3D14A 1YRPA 4FKIA 3PXYA 4NM7A 3MWUA 3P0MA 2XD4A 2JIIA 2V0DA 4ASXA 3DJ6A 3BV3A 3QGYA 4WNMA 3F69A 2W06A 2JAMA 4RZWA 4X3FA 4L1KA 3OTUA 2BAQA 2UZBA 4GK4A 4RZVA 3UTOA 3EL7A 3O0GA 4FKRA 3EKKA 5C27A 4YSMA 1H1WA 1YWNA 4MV4A 3RV4A 2A27A 4CG9A 4DEEA 3C0IA 4LL0A 5LMKA 3I1AA 4ONAA 3FZTA 1PXLA 5LA6F 4PUZA 2X81A 4AF3A 2BRNA 4I0TA 1WBSA 2PVHA 3F5UA 5ETFA 2GPSA 5KKNB 3LXKA 3R9DA 4EJNA 2W6OA 4DEDA 3R7IA 2R7NA 2HXQA 1SVEA 2VTHA 3LLAA 2XP2A 4YZBA 4QYGA 5IQCA 3FMDA 4BRXA 3GFEA 4ZQIA 5CT7A 3RAKA 2YDIA 3C4WA 4E20A 4AW1A 5EI8A 5L8KA 4C5BA 4YBJA 1JDEA 1KV2A 4ANBA 1U54A 2PPQA 3D7TA 5EM5A 2OKRA 3HP2A 1OBGA 2FSMX 4BBEA 5CSPA 4I23A 3UO6A 4EBVA 3ZLSA 5BQ0A 5IA4A 2OXYA 4ACMA 1PJKA 2H6DA 1GLVA 4U3YA 3HAMA 4FNZA 4M7IA 2WIHA 3P7AA 5CX9A 3LM5A 3C5UA 3KL8A 3MS9A 5JFVA 2BIKB 3TNWA 5J9LA 2XYUA 4XOYA 3UZTA 1S9JA 3CY3A 1XBAA 2YABA 3NYNA 2R85A 3U9SA 2QOCA 3OROA 5HBEA 1DM2A 4YTFA 5KMMA 3EQHA 4C3RA 1VR2A 3IPHA 4NJDA 2OFVA 5JK3A 4O7VA 5DR2A 5HLWA 4KAOA 2YS7A 4CV8A 4ZXTA 2ITNA 3HAVA 3PVUA 4ACCA 5AV4A 5BVDA 3OS3A 4QMQA 4W4WA 5M07A 2IZTA 4C62A 2PMLX 3QF9A 5CASA 4BN1A 3QUEA 2FGIA 5HESA 1JSUA 5D41A 5ACBC 3DXPA 2HW6A 2QQ7A 2Y4PA 3ZRKA 4D4SA 3LLTA 4FBXA 4U80A 3U55A 4UWYA 1P2AA 4CFVA 5AA8A 5BMVF 4MK0A 4G34A 3FC1X 4X21A 1ZOHA 4NFNA 2UZOA 5C1OA 3E88A 3ZMMA 4DYMA 4Y8DA 3FI3A 5L6OA 5HNIX 2B9JA 2E9OA 1Q8YA 3AC8A 5DMXA 3UG1A 2ZV8A 5IEYA 2NU8B 2NU7B 3DLSA 3DU8A 3QTWA 4O0SA 3HDMA 4O96A 1H1QA 3UPZA 2NNWB 2BKZA 3QKLA 1FBNA 3SD0A 4R77A 5J9ZA 3DFAA 3IG7A 4BDJA 4G6LA 3ET7A 3GBZA 4ACGA 2W4KA 5EK7A 2QO9A 4B0GA 2EWAA 1OL5A 3ZXTA 4YGAA 3UNKA 4AP7A 3GB2A 4UB7A 3NLBA 2PTKA 3MJ1A 4XV1A 4AZFA 4AACA 2W05A 2ZDUA 2JDSA 3MYGA 4R5YA 3MB6A 4FG9A 4XH6A 3ZSHA 4AGDA 2BZHB 2OGVA 5FP6A 2FSTX 1LUFA 3BYSA 4TW9A 3R6XA 4IZ7A 2CKPA 2C68A 2WO6A 3ZDUA 3MV5A 4ORKA 2RL5A 4FSTA 1R3CA 5HICA 4YJQA 4BHZA 2R3IA 3MVJA 2H34A 3MGYA 1JSVA 4RGJA 2VPQA 3QGWA 5EYDA 4FT7A 4IFGA 4MXAA 3T8OA 3PA5A 2XEZA 4IC8A 2CGVA 4EKKA 2GHGA 3HB9A 4D55A 1BKXA 3H10A 2WEVA 2OIDA 3AC5A 2ZB0A 3EFJA 3MVMA 4R3CA 4WIHA 1UWJA 4XJ0A 5CEIA 5EYKA 3VBYA 2C3KA 4DGOA 5DE2A 4DGLC 3Q3BA 2OG8A 2X7FA 2ESMA 2IO6A 4Z7HA 3PE2A 4FEVA 1XR1A 4RLKA 5AUUA 3CKXA 5DI1A 3RCDA 3ZZEA 2R9SA 4FV4A 5L2SA 3FL5A 4C02A 1ULZA 3R0TA 5A14A 4M8TA 4EH7A 2GPWA 1UV5A 1M0WA 3PJ8A 4ZTHA 3VVHA 5EHYA 3G6HA 4ENYA 4ALUA 4FFRA 4WA9A 2R2PA 4OGRA 1BYGA 3PJ1A 3VRZA 1YWVA 4OTRA 2QR8A 1J1BA 1J1CA 1BX6A 5FTGA 2YRWA 3F61A 4QMYA 5IH6A 4G1WA 3FZ1A 5FTQA 3GU6A 3K5IA 2XS0A 4JDJA 4OBQA 1CKIA 4MD7E 1P4OA 3DBEA 2VTLA 4D2RA 5ITAA 4K33A 4W4YA 3CBLA 3NYOA 1P5EA 2XM8A 4U42A 2V59A 3MSSA 2XNGA 4BIBA 4M0ZA 2OF2A 3QTUA 2PVNA 3FHIA 2V7OA 1QL6A 5KMNA 4ZLOA 5TKDA 2CGWA 4DH7A 3VF9A 4E5WA 2BMCA 2RFSA 4V01A 2X7OA 5M09A 3P86A 2XB7A 4FFOA 1Q3WA 4QTEA 3ZSGA 3A7IA 4UZDA 3N8DA 3VS5A 1RDQE 3IGGA 4OLIA 5HLPA 5IEXA 4XG6A 5BVOA 4BDKA 4GVAA 2QU5A 2IW8A 5T6KA 3OG7A 3FC2A 3U4UA 4GUBA 4DE4A 2OBJA 4O27B 5BVWA 5JH6A 4KBKA 4M9UA 3BCEA 3Q04A 4GH2A 4FYNA 4FFNA 3HRFA 3JXWA 3OXIA 3IGOA 5C01A 3HEGA 5IDPA 3FZOA 3VHKA 4OTIA 1RJBA 1YWRA 2HW7A 3DTCA 4BDFA 1PMUA 2VRXA 2SRCA 4Y83A 1O6KA 4G5PA 1IG1A 2HZNA 4ME6A 4KRDA 3ZSIA 2FO0A 2WTKB 2XK4A 4HGLA 2HY81 2X2MA 1BLXA 3Q6WA 4DEAA 4TV8F 5CAPA 2XJ1A 1KE8A 1Q3DA 2WTDA 2X6DA 3EQRA 5G1XA 3DY7A 4KINA 4ZTSA 4PNIA 1UU3A 4E4LA 1ZYCA 2PVRA 1R0EA 3F2NA 4Q5EA 4RJ6A 4Z3VA 2IWIA 4ACHA 1REKA 3G51A 3F3UA 4EOLA 2W1FA 4IWQA 4ZSEA 3VPBA 2CCIA 4C5AA 3PZHA 2PUNA 4MAOA 1SNUA 4I93A 1GZNA 3ZRMA 4U44A 4A4XA 1I44A 2FSOX 3QCXA 3RJCA 3WI6A 4C7TA 3AMAA 4ZJIA 4BVUA 4RX5A 4GEOA 4C0TA 3U54A 1W83A 5HLNA 3QRJA 3FSFA 2YERA 3OHTA 3IW8A 4FSRA 2F2UA 3TEIA 2F7ZE 2W7XA 2XEYA 4QOXA 2OFUA 4R1YA 1YHWA 1KUTA 4EK3A 3DDPA 3MH1A 3G2FA 4DCAA 3QTQA 2ITOA 3JS2A 4X2JA 5ANOA 1CDKA 3NEWA 4IWPA 2YWVA 3A4PA 3KRRA 4FV5A 3FI8A 3TIYA 3HZTA 3F7ZA 5EKOA 2YDKA 4BZOA 3ETHA 2JFLA 5E8SA 3LCKA 3CC6A 5IUGA 4FX3A 4WHZA 1OKVA 2VAGA 3KEXA 4G31A 4W8EA 2YA9A 3TZ8A 2VX1A 3UIBA 2P0AA 4KS8A 2QOHA 2VO6A 2IVTA 4O84A 3RV3A 3E3BX 3TKHA 4U79A 3A61A 1OGUA 3G8DA 4RJ4A 1VBHA 3ORPA 3WARA 4TUYF 4X3JA 3OT8A 2WU6A 1PXPA 3CCNA 1BUHA 4P90A 2JDOA 2W99B 4C59A 2VTJA 4OT5A 2PMIA 4O4HF 2O2UA 3QZFA 1UNHA 3VUDA 3G6GA 3M42A 2YM5A 4BICA 3KCKA 2C6LA 4IDTA 4V0GB 4N0SA 1Q8UA 5TR6A 1KJ8A 3D83A 2F2CB 3BU6A 4E4NA 3I60A 3G5DA 3OEZA 3MPMA 3KXGA 1Q41A 2OXDA 3COHA 5E8YA 1OI9A 3KK8A 3NCZA 4G2FA 5IQFA 4LOQA 4AZEA 5HTCA 4MV9A 3BE2A 4ZK5A 1WZYA 3GENA 4JOAA 5D7AA 4D28A 2F57A 5IA3A
chains in the Genus database with same CATH superfamily
2X9EA 3QXOA 4JRVA 3B2WA 4BDEA 3BHUA 3NZ0A 5FBOA 5AUZA 4ANSA 4QQTA 4DTBA 4ZY4A 5JKGA 2CZGA 3R23A 4F9WA 4ZS4A 4FEUA 2E9NA 4C2WA 2ITPA 2DS1A 3QTXA 4RX9A 4NCTC 2ZMCA 4YPSA 4MTAA 5HORA 5DGIA 3ACJA 5IU2A 4MWHA 1GAGA 4PTCA 4FTTA 4AOIA 1FGIA 1WAKA 3LFBA 4HYHA 2Z7SA 4FV9A 4DIMA 3NGAA 2VTIA 3FKOA 4PMTA 4E4XA 4QYEA 1JSTA 5FGKA 4KBAA 3PZEA 2C5NA 4YTHA 3MJFA 2BZIB 5BPFA 2XKCA 3AG9A 4FVPA 4AXDA 3MFUA 4IWOA 4K11A 3K54A 5AX9A 2GNFA 3PFYA 4MQ2A 2HGSA 5IH5A 2R7MA 3SAYA 4EFEA 5EYCA 4BTKA 1JKLA 1J7LA 5DWRA 2W1GA 3C51A 3ORIA 3ORNA 5IH4A 3B8QA 4QYFA 3QZGA 4UYAA 1U46A 3GC0A 4XG2A 5GJFA 2QK4A 4YJOA 3ALOA 3HV4A 3LMHA 2A2AA 4FTOA 4FIGA 4DH1A 5B2MA 4E6NA 3OEFX 3PVGA 4MYGA 3HMNA 4K18A 3GU4A 3PXFA 2UVYA 3I6UA 3QTIA 2W5HA 5HO7A 5GJDA 3PSBA 4BCGA 4C4JA 3LJ2A 2RG6A 4YUQA 5IPJA 2HGWA 2OXXA 4IZYA 1B39A 3VUHA 4JBQA 4EBWA 4DGMA 2YCRA 4GV1A 5GHVA 4QQCA 3UGCA 4YJVA 4NZOA 1PX2A 2OIBA 3EHAA 3C4XA 4RA5A 4IZ5A 1PXIA 4J8NA 4TXCA 3SXRA 5A54A 5BMSA 3TNQB 5HIBA 1UKHA 2YISA 3BWJA 4DT9A 4AXCA 3HBLA 4M12A 1DI8A 2ITUA 3QQJA 4D4VA 4CKRA 3KXNA 3CQEA 4I0SA 2J9MA 3O8UA 2VUWA 2ZM4A 1FVTA 3TY9A 2EB3A 1WMKA 3FMJA 4U7ZA 4CMOA 4EQCA 1B6RA 1MQ4A 3CXWA 3DA6A 4ZJJA 5I5SA 2XK8A 4R3PA 3EMGA 5GONF 4DFXE 2XUUA 3E5AA 3FQHA 3CTHA 2Y4IB 4DLIA 3F5GA 1JOWB 4AGCA 2WD1A 4IBMA 3QQGA 2W6MA 1QPEA 5IA0A 3FE3A 3TWJA 3UYTA 3T3UA 4FG7A 1F3MC 3GQLA 4M68A 5AM6A 5JMSA 2Q2TA 1H1SA 4CT2A 2QLUA 3DBQA 3LWBA 3BEAA 3MTFA 4WUNA 5IQEA 4TWOA 2XNPA 3WIGA 4BB4A 3CJFA 3AMYA 3CEKA 4ARKA 5DIAA 4ALVA 2ITWA 5JGDA 5JGAA 3WZUA 3AOXA 3O96A 1XH9A 3FMMA 4PDOA 3OBGA 4FIFA 4I1ZA 2HOGA 2VTPA 3PIYA 3BABA 4NIFB 4EGJA 3A2CA 4HCUA 2R7BA 2Q0BA 4R7BA 3JSLA 5CAEB 3VA7A 2WTCA 4CTCA 2OLSA 3S2PA 3OXTA 3ROYA 3W0OA 1MQBA 2HCKA 5IMEA 5KBRA 3OOMA 3S00A 3I81A 4C4IA 4IANA 4TNBA 2C6EA 2P0CA 3ZU7A 4FTLA 4JQ7A 1XH4A 4FV6A 3ZM9A 3OT3A 3RPRA 2R84A 2VQDA 2VWVA 5KO1A 1TKIA 4ZP5A 2B52A 3GB8B 4IZOA 4UCRA 4EOKA 3MI9A 1SVGA 4FG8A 5FUTA 3VS3A 1WFCA 4RA4A 2WTIA 5I9XA 3UE4A 3KRXA 4ZEGA 4FI1A 4QP4A 3MPAA 1H01A 3ZLWA 2C5YA 4FZ6A 4FL1A 3W0SA 4ITIA 2XKDA 4V05A 4CEGA 3BGQA 3F82A 1Y6AA 3ACKA 3R8MA 5I9YA 3HRCA 3RNIA 3MFRA 4FV7A 4AA0A 5FXRA 4BIDA 2BR1A 1IA8A 5DVRA 5AP7A 4AW2A 1CKNA 5M44A 1LEZA 4JG8A 2J51A 4IX6A 4YZMA 3DAKA 3EN4A 1VYZA 3AT3A 3CPCA 4A9RA 1A0IA 5GNKA 4FZDB 3RMFA 1F0QA 4MD8E 5FM2A 2CKOA 3NW5A 5J1WA 2VTRA 4BDIA 4IC7A 4L68A 4XG7A 4X3FC 1VLRA 4ZSAA 2WXVA 3VBQA 4UN0C 3GI3A 1W96A 5ANIA 5F1ZA 5TT7A 3LXNA 5AADA 2R7LA 4NUSA 3BV2A 4QMLA 3NUUA 3QQHA 3P79A 5DA3A 4IWYA 4GCJA 4NKSA 1XH6A 5LMKC 4YP8A 4MQ1A 3W16A 4AX8A 1E9HA 1RQQA 4FSMA 3LULA 2VWIA 3BYVA 1W0XC 4ITHA 2QKRA 3HV6A 2RFDA 4UEUA 1XH7A 3VS1A 5KHWA 5HNBA 5FQDC 4HOKA 5EH0A 3RNYA 1NVRA 2XALA 3ZRLA 4UX9A 2HVRA 5EM6A 4BCIA 2W6NA 4M69B 3Q53A 3FSKA 3PDTA 1URWA 4JX7A 4O6EA 5AV2A 3U6JA 4ZSLA 2HK5A 3E8CA 1OL6A 4LM5A 5HVKA 4ZOGA 2R3MA 3DK3A 5KBQA 3V4ZA 4PZ7A 4BF2A 4QTCA 3NFGB 4FVQA 4C4EA 3MWEA 2UZTA 5AIRA 3FV8A 5KZ0A 3W0MA 5DRBA 1CKOA 4LOOA 5H3QA 4FK3A 2X8EA 1IOVA 3I0OA 3PA3A 4KIOA 4O0RA 4G5JA 4O4IF 3R30A 3VBTA 4JX3A 3QTZA 3G0FA 4JNWA 4O86A 4APPA 4EH4A 3LJ0A 5LOHA 5CZIA 5LVLA 3CQUA 3OCBA 1Q97A 4O2ZA 5FDPA 3JUHA 3K5UA 5JZJA 1ST0A 2WGJA 4EWHA 4UUGA 2Z60A 1SM2A 2WNTA 4J95A 3ORZA 3R63A 3E62A 3RK5A 1YI4A 3H0ZA 3BLQA 1IR3A 3R2BA 5L3AA 4CSVA 2X2LA 5CB4F 2C47A 2CKEA 4F9YA 2EUFB 1T36A 4FOCA 2X4FA 5H80A 3HV5A 4Z16A 4HQ6A 3L8VA 1W84A 3KIOC 4RBLA 3W2PA 4FTNA 2IW6A 3DPKA 3I4BA 4G3DA 2HY0A 4E6AA 2B9FA 2IZRA 2WPAA 1ZZLA 4WG4A 5CAVA 2YRXA 4D0WA 4XV3A 3HUCA 4EH6A 3EB0A 1OIYA 2GQRA 4RFMA 1H27A 2ZYBA 4BC6A 2GLTA 4J52A 3FYJX 3JPVA 3VUKA 4U45A 3E87A 3D2KA 2BKKA 5IQDA 3QBNA 4GJ2A 3MIYA 4OR5A 2UZLA 1YXVA 2BALA 3AXWA 4I6QA 3L9MA 2W6PA 4IQ6A 1AUVA 3EQGA 2GS7A 4RWKA 2PUIA 2XJ0A 2XM9A 4JG6A 4X6RA 1PKGA 4IJPA 5AIKA 5D1OA 3PIXA 2QODA 4RRVA 4CLIA 3OWPA 4I5PA 2OJGA 3LCSA 1TAEA 3W1BA 3LQ5A 3TINA 2B9HA 1FINA 1Q8ZA 4K1BA 3NDMA 3BHHA 4FGRA 3NVMB 4AXFA 4E93A 3TNPC 4DLKA 1T45A 4FKJA 4XLIA 3LXLA 3V51A 2XAMA 4D5HA 1DI9A 3EL8A 4I6LA 4J97A 4N4SA 3U87A 5BWUA 2VX3A 3PRIA 4IX4A 4O38A 3W0PA 5FXQA 2ONLA 3MTLA 4QEBA 3PG3A 4XG8A 4C33A 3BX5A 2HHFA 1AGWA 1K2PA 1R1WA 5CEQA 4AFEA 4M13A 2UV2A 3UIUA 4C37A 4PDYA 4YJTA 2ZOQA 2VWXA 1EKVA 2JKOA 3DXQA 3DAAA 3FLNC 3IONA 4IJ9A 4JL9A 5E7RA 4J8MA 5K3YA 3TUBA 1BI7A 4TV9F 3WNZA 4CHIA 3GIDA 4IVAA 3QD0A 5HE3A 3IDBA 3C4EA 4NTTA 4YURA 2CJMA 3GU8A 2UW4A 4QRCA 5CI6A 4ZSGA 4MH7A 2BROA 3U9NA 4A9TA 4Q9ZA 2COIA 3ORQA 1H07A 2C5VA 4I94A 3ATTA 4JIKA 4O7NA 5BUEA 4V0GA 5F9EA 4IHPA 1XBCA 4IW0A 4U5JA 4ANMA 3AC1A 1KC7A 5HD7A 2ZM1A 4AAAA 1LEWA 4YJNA 3DZQA 3CE3A 2KULA 4NKAA 2UZUE 4CTBA 3VUIA 4YR8A 3UQCA 3GOPA 4BJJB 4YJSA 4FSUA 4FKPA 4HNTA 4A7CA 3PXKA 4FKQA 4YO6A 3MY5A 4AZSA 2QOKA 4CFWA 4HVDA 3VW8A 4F9CA 3F3TA 5IEVA 1H0VA 3PXZA 4YAJB 3HKOA 2ITYA 4HZRA 4RJ8A 4MV3A 3IW7A 3D5VA 3IW4A 3VUMA 3K2LA 3UZBA 3AKJA 4QQ5A 4BI1A 4FTAA 1ZMUA 2R3NA 3MW1A 4QNYA 4QTAA 3OY1A 4EZ3A 3UOJA 5FTOA 1OL2A 4KUJA 5H8BA 4EEVA 2EIYA 3ROCA 4MV8A 2HZ0A 2ZJWA 4CQEA 4HVSA 4BDBA 3IOPA 1EHIA 3D0EA 2QCSA 3TXOA 1Q4LA 4PZ6A 1OECA 4AU8A 4MVFA 5EOLA 4F08A 2Z7LA 2C30A 4X7QA 2VGPA 3GC7A 3KVXA 5AMNA 2CCHA 2RF9A 4ZMFA 5BMVF 3VBVA 2VTQA 4XBRA 5E90A 2IPXA 3OWJA 2NU9B 4H1MA 1WVWA 1KE7A 2PZRA 5EQYA 3QQMA 2XK9A 4H3PA 4DC2A 3FKNA 1V0BA 1ZYDA 3RPVA 3R04A 5BVNA 1FMOE 1P16A 2ITTA 1H1RA 2ZV2A 3ZO4A 4C61A 3H4JA 3PA4A 4IAIA 3S95A 1WBVA 3A60A 3PIZA 4PTEA 5J87A 4CZTA 3SW4A 4YC8A 3PFQA 2QI8A 3QC9A 2W1EA 3M2WA 5IISA 1YDSE 2OF4A 4P2KA 5DT4A 4EC8A 2HDKA 4AE6A 2F7EE 3DK6A 3GFWA 5L2WA 5M56A 5FP5A 5HNGA 5CEKA 3ANQA 3OF0A 5CEOA 4YBZB 1XWSA 3F3VA 2GSFA 2OH0E 5ETIA 5JQ5A 4JXUA 4EGQA 2I0VA 3D15A 4QPAA 4C4HA 4JBPA 4BIEA 5HCYA 4EONA 5CANA 2Y4RA 5JZNA 4ASEA 3EQIA 1O9UA 4FODA 2BFYA 2P4IA 2VWZA 3AX6A 4KABA 2J90A 2OO8X 4IX3A 4EC9A 1PXOA 4TYJA 5I9WA 3TDWA 3ORTA 4LQMA 4IIJF 2QO7A 4KSPA 5CSVA 2OZOA 4IEBA 4R7HA 1WR2A 1H28A 2CLQA 3LMGA 3DLZA 1WVYA 3IECA 5HV6A 1OZ1A 5HGIA 5HIDA 1H25A 1GNGA 3E93A 4Y46A 5LJJA 4UCVA 5BWVA 3P4KA 1SZMA 3KXXA 4FL3A 2WELA 3E8EA 3NAYA 3P5KA 4O0UA 1BI8A 5AP6A 1S9IA 2Y6OA 4F1TA 1XK5A 2PVPA 4X6QC 1M2QA 2X2KA 4JMQA 1A06A 1PYXA 1PXKA 4OTQA 3NUAA 3S1HA 3FMNA 4FV1A 1QMZA 3FY0A 4H36A 4RX7A 3PY3A 2VTSA 1ZMWA 3NCGA 1ZYJA 3DBFA 3HL7A 1YOJA 4AT4A 3O71A 5CVFA 4RVTA 4J98A 5C9CA 4F7NA 2EJ2A 2X7GA 3HMIA 3LZBA 3NBZB 2UUEA 4FTKA 3UZPA 1H8FA 2JEDA 5BVKA 4I55F 2IVUA 4HVIA 1EKPA 4CKCA 4BGHA 4NM3A 4Y72A 4M97A 2HYYA 2QR7A 3R00A 4OTWA 4YZNA 3N4TA 3ZFXA 1YKRA 4IE9A 5LCKA 2BPMA 3BA9A 2P2IA 5BMMA 2REIA 3ZBFA 2JKQA 2WMQA 2W1HA 3HGKA 3KRJA 4QYYA 4RIXA 4C38A 4DN5A 4EH2A 2QF7A 4WSYA 3JSNA 2I80A 1YXUA 4USEA 4D2SA 3R28A 4QTDA 4KSQA 2JBPA 3GEQA 2YCSA 3HDNA 2W9FB 3TV7A 2PULA 1FVVA 4I92A 4ANQA 2XBAA 4KBCA 1P4FA 4YNOA 2WMAA 4IAAA 2W4JA 5E91A 4F7LA 5AAGA 1U4DA 2B53A 3DK7A 3EQCA 4L01A 3TJCA 1PK8A 5CU3A 3S3IA 3BE9A 4PZ8A 2DLNA 2JIVA 5C8NA 1Q61A 2GFCA 3LFDA 4UCOA 3KAKA 4ZSJA 3WWHA 2BHEA 3ZS5A 5BNJA 2IW9A 2FUMA 2WQNA 1DS5A 3N9XA 4NJ3A 3UC3A 4AOJA 4EH8A 1Z57A 2EB2A 3BQRA 5HCZA 3UG2A 1DGSA 1VS0A 3GCQA 4AGWA 1Q8TA 3ORMA 3NW6A 3TMOA 3FUPA 4NZMA 3NSZA 4WKQA 5AP4A 3O8TA 4E4TA 2OWBA 4GW8A 4P7EA 4RC3A 2CPKE 3ZDIA 3ZLXA 3OWKA 1MUOA 3DKOA 3NUXA 5CA0F 4IAZA 2BCJA 3TDVA 3OY3A 4U6RA 5M08A 3U9CA 2VTTA 5EQEA 4E6CA 2ZV7A 3ORKA 4HYSA 3ANRA 4GLXA 2BRGA 2J0JA 5HG8A 2WOUA 2GCDA 3PWYA 1EYZA 5BVFA 3QCQA 3NMUF 3TKUA 3TL8A 5FEEA 5LARA 2P33A 4G3EA 4L8MA 4RG0A 3OWLA 2WAJA 3KALA 3QZIA 1KJIA 2R3FA 4YO4A 4HVGA 4RJ5A 1G2WA 3RALA 3F88A 5HEZA 2HJWA 3UJGA 4LGHA 1OKZA 3KMUA 4W8DA 4ZAUA 4IB5A 1GSOA 1YOMA 2JKMA 3OOGA 4CFNA 2VTNA 3NIEA 3QKKA 3HMOA 4NH1A 1KWPA 2PZIA 3FXXA 4FV8A 5IQGA 4I0RA 1FGKA 4DCEA 5CS6A 3ZO3A 3Q9ZA 4FTUA 4QMXA 3KXHA 1GZKA 1WBOA 4N70A 2C6TA 3O51A 4TTHB 3POOA 2RFNA 3UP2A 3ZC5A 3GDEA 2V7AA 3ZFMA 1WVXA 4AN2A 3U6IA 4FSNA 4O2PA 3FLSA 4NYEA 4U41A 3NX8A 3PXRA 1WBPA 5EW3A 4G3GA 2VWYA 4L3LA 2E9UA 4FVRA 4IIRA 5HIEA 5HZNA 3PSDA 3A8XA 4GYIA 3SVVA 1A0GA 4MXXA 2XMYA 2GHMA 2BZKB 3R02A 2ZGIA 3U51A 3TACA 4B7TA 2G01A 1T46A 4BTFA 2YIYA 2R3OA 4C2VA 5HX8A 1P8LA 3MFTA 3W55A 5AUWA 2CGXA 3L8XA 5EDPA 3UDBA 4DF3A 2C0OA 3A4OX 4HR7A 4RIOA 3R8ZA 4FT5A 2VNYA 4BYJA 4DEHA 2UVXA 3NNWA 4HCVA 3WO1A 5DNRA 2XIRA 4P5ZA 4EORA 4FA2A 3PJ3A 4C4GA 3HRBA 4G17A 4CNHA 5HTBA 3ERKA 2UW8A 3ENMA 3O17A 2IN6A 1ZOEA 1YOLA 4RC4A 3AW8A 4BCNA 2IVSA 5HU3A 4J7BA 3LW0A 3A7HA 4NU1A 2E9VA 2XAOA 3MH0A 3PE1A 2WHBA 5DFPA 3WF8A 3Q4CA 5HBRB 4BCPA 1UWHA 3Q9YA 3R7UA 3ODYX 1GIJA 4WBOA 4BZNA 4HPUE 1DIKA 2R5TA 2WTWA 4AE9A 4KNBA 3TYKA 1ZYLA 4JRNA 1MRVA 4DBNA 1XJDA 4DFBA 3H9RA 4PX6A 5LWNA 4RC2A 3Q4ZA 4II5A 1YW2A 2FPGB 4XG3A 3CGFA 4C3FA 2IZSA 1JKTA 2YN8A 3G15A 3G9LX 3ZYAA 5JQ8A 2YM6A 5CF5A 4FEQA 3NPCA 2GNIA 2ZDHA 2BDJA 3SLSA 3CTJA 3KREA 4ID7A 4U97A 1YDTE 3II5A 3VPCA 3B8RA 3RCJA 5CQUA 3TTJA 3WZKA 4O7WA 3R21A 3COKA 3RAWA 5K5XA 4MAMA 4H3BA 4DQNA 2C6MA 2HGXA 3CS9A 4RIWB 3MN3A 2YAAA 5EHOA 2ACXA 1JKSA 4FTMA 2ZDGA 2C6KA 4FIJA 2XNOA 4M0YA 3COMA 4UFZA 2XCLA 4E7WA 3WZDA 3DCVA 5JT2A 2CMWA 5L6WL 4CD0A 5IQHA 1SMHA 3H9FA 4CV9A 4L45A 3UP7A 3LJ1A 4B99A 2EJ3A 3GC8A 2R0UA 3LOKA 3E7VA 3PTGA 4O83A 3OC1A 1KV1A 4P4CA 3WF9A 2G2HA 2J6MA 4TKSA 3ZFYA 5IA2A 3Q5IA 5F4NA 3N4UA 1XHAA 2OW3A 3BIZA 2B55A 5CQWA 2PK9A 2BHHA 2ITXA 4CMUA 3KRLA 3WO0A 4PY1A 1ZRZA 3KAJA 4EK8A 3VOTA 3QQKA 4MV1A 2I0YA 3R2YA 5E4HA 5AWMA 5CNOA 4LUEA 3QWJA 4Y5QA 5CTPA 3NS9A 1GOLA 4EHZA 4EOSA 3HT5A 4QDVA 2R3RA 4PP7A 4YJ2F 1Y8YA 1NXKA 2FPPB 1XMLA 1CKPA 3BYUA 4IAYA 4TYHB 5IDNA 2XF0A 4RQVA 2Q7DA 1OKYA 4N6ZA 3W8QA 1GY3A 5KMKA 1Y57A 2CHLA 2X1NA 2HZIA 3GGFA 3ZTXA 3HVCA 4MBLA 1ND4A 1HOWA 2I0EA 3DOGA 4OBOA 4BJJA 5LVPA 4RQKA 4I50F 4WBNF 2J0IA 1G8SA 2BTRA 3EN9A 1Q8WA 4GJ3A 4XBUA 3SA0A 3BA8A 2JKKA 5EHLA 5I9UA 1FOTA 3DTWA 4L3JA 3VJOA 3BLHA 2VO0A 4P5QA 4I24A 5DG5A 4EHEA 3VF8A 3QX2A 5B2KA 5IG1A 3OFMA 1IASA 3Q60A 3D5XA 2YCQA 3MVHA 3FLWA 2ZB1A 4JVGA 2R64A 5JFSA 3TW7A 4CMTA 5AA9A 2Q2UA 4FKWA 3SOAA 2C1AA 4BHNA 4CCBA 5EYMA 4AZTA 2YZGA 3KY2A 2R7IA 4YAKB 2GFSA 4FSYA 2C6OA 4O0YA 3ZUUA 3Q52A 3VBXA 3F6XA 1OITA 2OI4X 3ATSA 5M4UA 5G6VA 3P78A 4CCUA 1DV1A 4HNUA 4DFLA 2C3LA 2YFXA 2F7XE 3MESA 4YU2A 1YI6A 5M06A 1EZ1A 3QHWA 2F9GA 2PWLA 2C0IA 4DH8A 4CFUA 3BU3A 3S0OA 5AX3A 3HMPA 2QU6A 1DAYA 2UW6A 1G8AA 1HCLA 3NNVA 3MA3A 1PXNA 4XRLA 3ZLYA 4DLJA 5C1PA 3G33A 1IOWA 4H58A 5IQBA 1FMKA 2XBJA 4HNFA 4B9DA 4S2ZA 4F0IA 3ZO2A 2W1ZA 4DGNA 2B4SB 2HWOA 2VU3A 4Y5HA 2YM4A 3AT2A 3PJCA 2C3JA 3HA6A 3FI2A 3F2RA 3BU5A 4NW6A 5AV0A 4GIIA 1TQPA 4DFUA 1ZAOA 4MA0A 4DDGA 3QQFA 1H26A 4FGBA 4MNEB 3RHXA 1M7QA 4GMYA 4H1JA 3DZOA 3R1NA 2KTYA 1EKFA 3CKWA 4PBCA 2A4LA 2W6QA 5K5NA 3D7ZA 2WTKC 3GP0A 5E8VA 4AXEA 3R1SA 4DEIA 5KKRB 3EFWA 1UA2A 4RWLA 5CSWA 3SG8A 2O65A 3DKCA 4DFYA 1KJ9A 3K3PA 2VWWA 4YTCA 1JAMA 4CZUA 3SNOA 3C4FA 5IZFA 5BWTA 2XK7A 2PE1A 3AD4A 3LKMA 4TYGA 2XH5A 3PUFC 2GDOA 1UU7A 3FMKA 5EM7A 5AUXA 4DDIA 3EQPA 3FLZA 4DHFA 3Q2OA 1Q5KA 3G0EA 4RVLA 5HX6A 3G8CA 4TN6A 4FJVA 4KIPA 4KKHA 4FUYA 3QQUA 3RM7A 4MF1A 3V8SA 2WIPA 2QONA 2COGA 3QRTA 2VR1A 3WZEA 2J0KA 3TCPA 4TRLA 3UBDA 3R1YA 2GNJA 4MA5A 5CYIA 1TA8A 4QO9A 5CU0A 4JBVA 4O21A 3P1AA 5DPVA 3R8UA 3SOCA 4N57A 3VMMA 2RFEA 2WMBA 3V5WA 3GQIA 3OW3A 3FQEA 4FEXA 3GU5A 4IMYA 4PL5A 5CXHA 5C8MA 3UO4A 1PXJA 3K3JA 4ZY6A 4DG3E 1VKZA 2W5AA 3JVSA 4XX0B 2OJ9A 2UW3A 4XP2A 5AAEA 2VGOA 4MXZA 5CWZA 3WF5A 3HO8A 3IKAA 1KTAA 5TO8A 3BQCA 3O50A 4GRBA 4O7RA 3B2TA 2YJRA 5E8UA 4IB3A 5B0XA 2O0UA 1YDRE 3LFCA 4UXQA 5F94A 4UBAA 4EHVA 3BG5A 2GTNA 5CU6A 4F99A 1MP8A 5CA1F 2BILB 2ONLC 5CEPA 3KA0A 4AT5A 3QXPA 2C4GA 5GIOE 1FVIA 2R86A 4RIXB 4AA4A 4H05A 2PZYA 4FT3A 3W2QA 4BCFA 4Y8VB 4O81A 3W1FA 2J5FA 5EI6A 3SG9A 1BMKA 1M7NA 2Z2WA 3DQWA 3QD3A 4W4XA 4BKJA 3JZIA 2PVYA 1GZ8A 3BKBA 3EN5A 1KE5A 3GCPA 1K9AA 3WE4A 4BCQA 4FE2A 2G2IA 4LMUA 4D9UA 5M4FA 3Q1KA 4XYLB 5CR5A 3OVVA 3EQBA 5T68A 2VNWA 3QU0A 4FT0A 4DH3A 1H1PA 4U43A 3GCSA 3LAUA 2XVDA 1JNKA 5M4IA 1C30A 3JRWA 2G1TA 4O7LA 4R6VA 3UPXA 3QA8A 4C35A 4JDKA 1PY5A 4JDHA 3DF7A 2Q0NA 3FZSA 1FQ1B 2PE2A 4KRCA 4PP9A 4XP3A 1I7LA 4RJ7A 2ERZE 2HZ4A 4MEDA 3FXWA 4F70A 3IO7A 1H00A 5BYAA 2CNVA 4IVCA 1RE8A 5D11A 3CJGA 3FDNA 3FPQA 5B7VA 2Z7RA 2I40A 2X0SA 3PFFA 2ETRA 3O5AA 3SV0A 3V01A 4HYUA 2UZNA 4F7JA 2UZWE 5CAOA 1W98A 2C6IA 2XK6A 3RP9A 3TI1A 1XBBA 2YL2A 2DYLA 4Q5HA 5E8XA 3SHEA 3FJQE 3R5XA 3SE7A 1OL1A 5AP2A 5CXZA 3QFVA 4QMZA 1CSNA 4WBBB 3KGAA 3BHVA 1LPUA 1QPDA 4L9IA 3BHTA 3WOWA 3U9TA 3W18A 5EQPA 1DAWA 4AS0A 2ZM3A 3UNJA 3PY1A 1EUCB 1E1XA 3MY0A