4O84A

Saicar synthetase (type-1) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
227
Chain Sequence
b'AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
molecule tags Ligase
source organism Pyrococcus horikoshii
publication title SAICAR synthetase (Type-1) in complex with GMP
rcsb
total genus 71
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o84A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o84A02
4D4SA 4FFMA 1M2QA 2XJ0A 2VTNA 3IGOA 3MESA 2J2IB 1G3NA 3FQEA 3QQKA 5FP6A 4BTJA 5HCYA 3TDWA 1KJ8A 3R5FA 3Q1KA 2YAKA 2HXQA 2XNEA 3QD0A 1KSWA 2ONLC 5IPJA 3A2CA 4NKSA 3C4EA 4I0SA 5LMBA 3S3IA 3EQCA 3MS9A 5DYJA 1YWRA 4X6RA 5I9YA 5EI6A 3RCDA 4YU2A 4O0YA 2C6KA 1M6VA 4BY9E 3DBFA 2PVLA 4JQEA 2VWZA 3FI3A 3V04A 5AM6A 1WBTA 3R73A 4OTIA 1AD5A 4RWJA 3LCSA 4MBJA 4M97A 5HI2A 5KE0A 3P7CA 4A9RA 5EZYF 3NUNA 5K4JA 2PUUA 2BIYA 4XLVA 1SVEA 4FTUA 2YM5A 3KFAA 2GQGA 2XIXA 4O0WA 5GIPE 4MA5A 2XCKA 3K5VA 1WFCA 4IJ9A 4IX4A 4MBLA 4DG2E 3WF8A 5BVNA 2FPIB 4QQ5A 1KE9A 2WAJA 3I0OA 3R8MA 2XNOA 1Q24A 2I0EA 3NNVA 4K1BA 5AP6A 4FE2A 2OFUA 5EOLA 3SXRA 1DV2A 1GGOA 5CXHA 3O8TA 4NW5A 5IQHA 1J1CA 2GLTA 5C1PA 2PUIA 4EUUA 4ORKA 2GPSA 2RKUA 3IK3A 3PIZA 3F7ZA 2DWBA 3NYVA 4EK6A 1BYGA 3A7FA 3LXNA 3AX6A 4EBVA 4TL0A 4FKVA 4PTEA 3RAIA 1YI6A 5DE2A 1PHKA 3VAPA 4HVGA 5B2MA 5C4LA 3PXYA 4WBOA 3QYZA 4FOCA 5CY3A 4PY1A 4FTRA 4RX7A 4HW7A 3Q4ZA 4EK4A 5HVKA 4JI9A 3OROA 5I9WA 3MVMA 3VJOA 3BYVA 3QKLA 4DFBA 2ITWA 4O2PA 3TV7A 2GDOA 5JRQA 5M4IA 3BHUA 2GNIA 1I09A 2OJ9A 3OVVA 1PKGA 3SRVB 4FGBA 1KJ9A 3MBLA 2SRCA 2XK8A 3BU5A 3ETJA 4FKQA 2V7AA 3P23A 5JVDF 3HV4A 4MQ2A 5AUVA 4O7NA 5DR9A 3QGYA 2J0MB 4CTCA 2BIKB 4JX7A 1M0WA 2I0VA 1KJIA 4N70A 3ORNA 1WBWA 1QPJA 4G3EA 4XV3A 1OITA 5CANA 1LUFA 1OL2A 4AP7A 3MIAA 4GEOA 4ALWA 4FKRA 2AYPA 5ETFA 2UZDA 4IAYA 1H8FA 3TCPA 1KOBA 4EH3A 3I7BA 4KRDA 3A7GA 4J1RA 4G2FA 4YJVA 4C7TA 4G1WA 4JRVA 3SKCA 2QOHA 3ZLYA 3G5DA 3U6IA 5K5NA 1MRYA 1URCA 1PXLA 2ITQA 2UZOA 3LHJA 5CALA 5M09A 5HVJA 4AA4A 3DAKA 3PDTA 5GJFA 4D2RA 3LAUA 4MV7A 5F20A 3BGZA 2BRMA 2FB8A 3U51A 2R5TA 5KX5F 3PA3A 5IMXA 2VU3A 5BMMA 1ZMUA 1JWHA 2BTSA 4Z16A 1WCCA 5FXRA 4FSQA 2PN1A 3VMMA 3E8NA 4PQNA 1Q8ZA 1W96A 2B53A 5KMMA 3KAJA 3AC4A 4RX8A 4IM3A 4AW2A 3I12A 3P5KA 2BRGA 1OKZA 3PJ1A 4ME6A 2C30A 3DQXA 3UVQA 4RC2A 1JKJB 3RWPA 3R8LA 2P3GX 4V0GA 4FTLA 4HGEA 4CKIA 4CQEA 1T46A 4IX6A 5JMSA 5K4IA 4AACA 3DTWA 2PMIA 2VTAA 2F9GA 4ZS0A 2OU7A 4QMMA 1GLVA 4KAOA 2C6TA 4D2SA 3W16A 4BCHA 2R7LA 2PVMA 4GL9A 3NR9A 4O7WA 3SHEA 1T45A 3DKGA 4E5AX 4DAWA 1AUVA 4NWMA 3IO7A 5HO8A 1ZMWA 3BEGA 4F9WA 4G6LA 4L3JA 4PF4A 3TM0A 1IEPA 3AW8A 1DI9A 5AFVA 5BUJA 4ZTHA 1KE8A 2FSMX 4DFZE 4IX3A 5CEQA 2A27A 4BTFA 2C00A 4ALVA 2XNPA 1CE8A 4MHAA 3MVJA 2RFNA 2W1EA 3W18A 3UC4A 5HTBA 4J97A 4J98A 2ZDGA 5A6OA 5J95A 1OBGA 5M08A 1EUDB 2BZJA 3CXWA 4K9YA 4G3GA 3LM0A 5LCJA 2VRXA 4DG0E 4XBRA 2R3LA 1LEZA 4BDGA 3CC6A 3ORLA 4XNEA 4F9AA 2ETKA 2RGPA 2X2KA 3HDMA 3PP0A 3W2RA 2W4JA 4DFNA 4XEYA 5EM7A 4LM5A 4K77A 2QKWB 4GSBA 3TKUA 4X3JA 3VBXA 3KQ7A 1KE6A 3LPBA 3K2LA 3UZTA 4YB8B 2PVPA 3QWKA 3BHHA 2W05A 3BRBA 3H30A 2XM9A 1BNCA 4RIYA 1R0EA 4DH8A 3F3TA 5DNRA 3VW6A 1O6LA 4KINA 4I23A 1REKA 3F2AA 4U97A 3I81A 4TWPA 4EUTA 3BWJA 3PWYA 4GK4A 5TT7A 1VBGA 5FM3A 3RHKA 3FY0A 1U46A 3R7VA 4FT3A 2C6LA 4UYAA 4WO5A 3O8PA 4X2NA 4ZSLA 2C3JA 3GENA 4YZ9A 3I1AA 3VBYA 5AUZA 4TV9F 2BTRA 4U43A 2IWIA 1JVPP 3HKOA 2NUAB 4MA0A 4AWIA 4IFGA 4E73A 2BFYA 2R3KA 4EGQA 1OPLA 4FSRA 4Y5HA 5LVNA 5LVOA 2ITYA 4QYHA 2ITNA 3MPMA 4L67A 4YJOA 3KN6A 5FM2A 3A7JA 3F6XA 3PPZA 4G6OA 2OIDA 3DXPA 2RL5A 3DQWA 3UE4A 5AP1A 1YQJA 1Y57A 4DGLC 2W6PA 4QMOA 4G5JA 4NFMA 3GCSA 4YJ3F 4AT4A 2OF4A 4H3BA 3IPHA 4L9IA 4KIQA 4EH5A 5FEQA 5E92A 3GOPA 3GT8A 3KMUA 4ZLZA 3JYAA 4XX0B 1FOTA 4YJTA 3E62A 2YA9A 2I40A 4EL9A 3PA4A 4QMUA 4PDYA 5EYKA 2DWCA 3VS6A 2X8EA 2LGCA 5BX0A 4O7SA 4WKQA 4GIIA 2I0HA 3FE3A 5D10A 5ANIA 4DEAA 4U44A 2ERZE 4DEGA 3KRJA 4EWQA 2PUPA 2VWVA 3PY1A 4I55F 4FTKA 4R5SA 4JNWA 3ZDIA 4M0YA 1Q3WA 2PE0A 1ZY4A 4F63A 1EZ1A 2R0IA 4XJ0A 4FSTA 1H27A 4FX3A 1ZZLA 3LKMA 3L1SA 4NUSA 1J1BA 5LVLA 4E6CA 2Z7RA 4ENYA 4N0SA 5KMLA 2UW9A 2YCSA 3QLFA 3T9TA 1H25A 3OW4A 5H9BA 3VVHA 3PRFA 2C0TA 3HMMA 3CCNA 4QMXA 1IA8A 5LCKA 3VIDA 2BR1A 4BI2A 5BMSA 5EOBA 3TG1A 4BCQA 3KRXA 2V58A 2WTWA 3F3WA 4Y83A 3EQHA 2C5NA 3MA3A 5CNOA 2BILB 1WMKA 5L6OA 2ZV8A 2X9FA 3KGAA 4P7EA 3UYSA 1ZLTA 4V04A 4X2GA 5GINE 5CT0A 4C2VA 1H1PA 3AD4A 1Y6BA 2J0LA 3N8DA 2FPPB 3P4KA 3VBVA 4JAIA 2ZDUA 3IDCA 4U9AA 2CJMA 3IW4A 3FSKA 4CGAA 4EHVA 2O8YA 2YZLA 3E5AA 5CU4A 3R63A 2VX3A 3D7TB 4FKLA 5EM5A 1AQ1A 2UW8A 3TZ9A 3FQHA 2VTTA 3PIYA 4UN0C 2R82A 5HLWA 4OBOA 4C5AA 4X6QC 3W2PA 4AGDA 4F4PA 3LFBA 3S00A 2XYNA 4S2ZA 3KF4A 3CEKA 2GFCA 4FVPA 4FV2A 5HG9A 4AA0A 2B55A 1R1WA 4FTOA 4XCUA 2NU6B 3UBDA 2HY81 3W2SA 4U8ZA 2BFXA 3HUBA 4AW1A 5HO7A 4UXQA 2X6DA 2XRWA 3VS3A 1K2PA 3VO3A 4BIEA 4L8MA 1PRYA 4X3FC 2J0IA 5IUHA 1YXXA 5CEIA 3GIDA 5AV2A 2OFVA 1JQHA 4AN2A 3OEFX 4JR7A 2CGXA 3MJ1A 2WQNA 4JG8A 4U5JA 3KVWA 4OT5A 4V05A 4WT6A 2VTQA 1NXKA 2R3QA 4U81A 3Q4TA 1VZOA 4FSUA 3FYKX 3MFTA 5CF5A 1V1KA 2CMWA 5HBHA 5LOHA 5LMKC 4CKJA 4WSYA 3TW6A 1UVRA 3K5UA 1HCKA 2W1HA 3KL8A 3TEIA 2GU8A 4HNIA 4F7LA 2NNWB 2J4ZA 2GNJA 3KU2A 1OVEA 3UNKA 3V4ZA 3HP5A 4FEXA 3QRKA 4DFXE 2VWXA 2E9OA 3ZLWA 3V4SA 4D55A 3LM5A 1SNXA 3F2RA 2WZJA 4FTJA 2BAJA 5DWRA 3FZ1A 3BLHA 3GC7A 3Q52A 5ETAA 1E1XA 2X7FA 1M17A 4FKUA 4W4WA 5BPFA 5I5ZA 3WILA 4WNPA 1Q99A 1KUTA 2HCKA 2Y7JA 5CNNA 2JGZA 2F7ZE 1OL7A 4C2WA 4HVIA 3SRVA 3QHRA 4DC2A 2JKKA 4YZDA 4F1OA 5K5XA 2CKEA 3ZZEA 2HAKA 5LMKA 5C4KA 2KTYA 4P5QA 3QRIA 3TNWA 2AC5A 4EWHA 3ZLXA 2WFYA 3ZUVA 3GU8A 3FHIA 2UVZA 4GYIA 3MJ2A 2HY0A 1Q41A 4DN5A 3BQRA 2WGJA 1Z9XA 3PY0A 2VNYA 4LGGA 5FG8A 1E9HA 3SX9A 4U6RA 3RPRA 4DBNA 4DEHA 2BMCA 3E64A 3R30A 3PYYA 4BDHA 5LARA 2ESMA 3RMFA 4HGLA 4BBMA 4G17A 4CSVA 3G90X 4J53A 2VWYA 4IDTA 4R7IA 4YAJB 3QBNA 3S2PA 3U9SA 1P14A 4TWOA 2J5FA 5M06A 3IOPA 3OOMA 5C8KA 1TQPA 4E6AA 1SCUB 4HJOA 3ROYA 2QOCA 2XRUA 4M12A 4YJUA 1OKYA 3UYTA 3HRFA 3VA7A 4QQJA 2CKPA 3ET7A 4EJ7A 4ARKA 2FUMA 1Q4LA 2QG5A 3DJ5A 3VS5A 4DYMA 2HJWA 4X0MA 2CLXA 2PU8A 2Y6OA 2R85A 3LCDA 4MV4A 4CFVA 3LXPA 2RFEA 2XF0A 1HCLA 3F5GA 3Q9WA 4I21A 5DT0A 4B8MA 3QTSA 5T3QA 1CKIA 3JZIA 1XBAA 3VULA 4OLIA 4DFUA 4HYUA 2QCSA 4RQVA 5BVKA 4EQMA 2JAVA 4K0YA 4W4YA 5L2SA 3VBQA 2YYAA 4BIBA 2HZNA 1W7HA 4NCTA 3OWLA 3VHEA 2Y6MA 4CFMA 5BMVF 3DTCA 2Y4IC 4U79A 3VOTA 1Q8YA 4WA9A 4IM2A 3WZDA 2JIUA 5JN2A 4F9YA 2WOUA 1U54A 3QXOA 3HX4A 3UNJA 4D4VA 2EVAA 2C6MA 2HELA 5DRBA 4FTQA 3OWJA 3W1FA 3ZFMA 4HCUA 4IADA 2Z7LA 3TIGA 3KULB 4IZOA 3UQFA 5DLSA 5EHYA 3MDYA 4GV1A 2Z2WA 5DVRA 4KBAA 2ACXA 2W1FA 4LRJA 5FLFA 3F66A 3FLNC 1H4LA 4EOQA 3R7OA 5LWNA 3K5HA 4QTCA 1GIJA 5CASA 3QD4A 1JPAA 5B2KA 5C8NA 2REIA 3QKMA 4Z55A 4CXAA 3GFWA 4GG7A 3NLBA 2YW2A 4E7WA 3ZO1A 2VZ6A 4DITA 5EW3A 4FC0A 5ANEA 5AAGA 4BDIA 4FYOA 2I6LA 5LVMA 4FNYA 4MBIA 2YS7A 3Q6UA 3CD3A 4FIIA 4USEA 5HESA 3OUZA 2I80A 4M67A 4EH8A 3EL8A 3F5PA 2F2CB 1I7NA 2WTJA 3A4PA 4BDKA 2YAAA 2HW6A 3V3VA 4DFYA 3EZVA 2V59A 2GQSA 2YIYA 2B9IA 2VTIA 2QOOA 3GP0A 4XP2A 4NZWB 3UODA 3B8RA 4BC6A 4FG8A 4I5CA 4PMTA 3F69A 4MXXA 4O27B 4H39A 4AZTA 5E8VA 2BZIB 3BYSA 4PL5A 3KC3A 5EM6A 2JIVA 3JS2A 4BHNA 4O7LA 3ZTXA 4Y85A 2EUFB 4FGRA 4O0SA 3R5XA 4F65A 1UKIA 5HCZA 3F3UA 2YWPA 5ANOA 2QLUA 3BKBA 3WF5A 2GPHA 3KXMA 4IX5A 3R2BA 3VRYA 1YKRA 1F3MC 4QP7A 1MRVA 5I9VA 4O4IF 3A99A 2Z04A 1MP8A 2WHBA 3E7VA 5FGKA 4L53A 3R9OA 3VS0A 4AZVA 5IA4A 3QGWA 2OJGA 4UX9A 4HQ6A 3GU5A 4C4JA 2G1TA 4O7YA 2JFLA 2OXYA 3WZUA 1GOLA 1APME 5LXTF 1ZAOA 4MQ1A 4L1KA 4FNZA 2SCUB 5LVPA 4YBJA 5AP7A 2OI4X 3D5XA 5KHXA 3QUPA 2VNWA 3Q9YA 4WIHA 4U45A 4FKSA 4CFNA 3UFXB 5E90A 3KB7A 2BROA 2EWAA 1OIRA 4ACHA 4DINA 3PJCA 4MWHA 4RIYB 5HE1A 3C4FA 4BDEA 2GTMA 5JZNA 5C8YF 4ZJIA 4FV4A 3OY1A 4C3FA 2IJMA 4RC4A 4J52A 4E8AA 1OGUA 3OOGA 5IQDA 4XG3A 2CCIA 1H1SA 3GCUA 3Q4UA 3GCQA 1P5EA 4JDIA 2R3MA 2Z8CA 4UBAA 4YP8A 4EONA 1IR3A 2EXCX 4C33A 3RKBA 4QMQA 3MV5A 1GJOA 3HMPA 1XH6A 4ZZOA 5A4QA 3CTJA 4GFMA 2VQDA 5LYJF 5JQ8A 3AT3A 1UKHA 1W98A 1STCE 1UV5A 3MSSA 4RA4A 3KALA 4Q5EA 1Y6AA 3TZMA 5AUXA 4EOSA 3FI4A 2A2AA 4O0UA 3LMHA 4U3ZA 1LPUA 5J8IA 5CB4F 3QHWA 2CKQA 4Z9LA 4ASEA 3PP1A 4BF2A 3LFNA 1CDKA 3GCVA 4NYEA 3FMHA 2YCQA 2XCLA 2RIOA 2PMNX 2WTVA 3OT3A 3RUPA 2QOQA 2BZHB 4WRSA 4ASXA 3QF9A 4J8MA 5DRDA 4APPA 4LGHA 4IVAA 3H4JA 3QD3A 4ACGA 4LOQA 2OLSA 5F94A 4JIKA 3VHKA 4IC7A 3FZPA 3FSFA 3QC9A 5DOSA 3L8XA 4IAZA 2DIKA 2R3PA 4RFYA 4XYMB 5I9UA 1XR1A 2R64A 3PXZA 1CKPA 4RVTA 2WKMA 2R3IA 5EG3A 4GJ3A 4KIOA 4PNIA 3NRMA 3TV4A 3CTQA 3Q60A 2BRHA 3ZOSA 3EQIA 4EC8A 3I5ZA 3DT1A 3E92A 4GUEA 2ETMA 3PSCA 3DLSA 5HE3A 3QCSA 3W2OA 2OLCA 4BI0A 2DZDA 4EKLA 2PVYA 3O7LD 3RTPA 4GT4A 3THBA 3FEGA 3DS6A 3JZFA 4I20A 5H8EA 1RQQA 3JY9A 1OM1A 3C0HA 3OBJA 2R7KA 4O4JF 3NIZA 2QC6A 3G15A 2PL0A 4ZAUA 3SXFA 4O22A 3UP7A 3R7YA 4G34A 4L7SA 2GNFA 4MXOA 2YITA 4RBLA 3SC1A 1ZYSA 4LFIA 3UO6A 3R7IA 3W55A 3ZMMA 4AU8A 1CS0A 5D7AA 3A4OX 4TYHB 5AUWA 4CNHA 1RJBA 3G9LX 4UYNA 3LLTA 1DAWA 2IZTA 2P55A 3KCKA 4FEVA 4JVGA 3R7UA 3JRWA 4A4LA 3BHYA 2H9VA 4USFA 3M2WA 4YNEA 3ODZX 3BHVA 2W0JA 3IONA 3VW8A 4PDOA 3NYNA 1IOWA 1GZNA 3SE7A 3Q53A 2XK7A 5KNJA 1M2PA 2OIQA 3F3VA 5IF1A 3D5UA 4E5BA 5JQGF 1ZY5A 3GI3A 4ANSA 3PVWA 3NW5A 3ZFXA 5EI8A 2E9PA 4I4EA 5C03A 4BCNA 4BCJA 2C6EA 3B2TA 1YDTE 2FA2A 5TF9A 2PMLX 5KMJA 3S4QA 3PJ8A 4N6ZA 3O17A 1NVRA 4JJRA 4TYEA 5B2LA 2DYLA 3ATSA 5J7HA 3H10A 4Q9SA 3NMUF 4RJ6A 3SDJA 4JDKA 3OEZA 2PVRA 2WMXA 1FBNA 3CP9A 3W8LA 3E3BX 1KOAA 5H80A 3F5UA 4KS8A 4FTIA 3SA0A 5KKRB 1U59A 4U0IA 1UWJA 4NM3A 3V5QA 4RLLA 5KMKA 1YDRE 3U9TA 2OSCA 3DY7A 4E20A 5DPVA 3V8SA 5H8GA 4P4CA 5CSVA 1MUOA 4S30A 4OBQA 5GJGA 1YRPA 5J87A 4F64A 3DKOA 3HV3A 5J9LA 1ZYDA 3OBGA 2NO3A 4EK5A 5F95A 3TXOA 3UG1A 4D5KA 4EOMA 2R84A 2NRYA 3GQLA 4L68A 4YLLA 4IMYA 1UNHA 2FPGB 4YNOA 4CEGA 1ZYJA 3BHTA 3HV5A 4HCVA 3SLSA 3F88A 4USDA 1PX2A 5M4CA 3LFEA 1E1VA 3FZTA 4GG5A 5DBXA 3R5HA 1GNGA 4GMYA 3V5JA 4RLKA 3CQWA 3BE2A 4I50F 4ERKA 4WUAA 3ANRA 3N51A 4QYFA 4DGGA 4MXZA 1H26A 2J5EA 4ZMFA 1R0PA 4V0GB 2YIRA 3QQHA 3WO1A 3E8EA 3KXNA 4FEUA 2XD4A 3GLKA 3VPBA 5ANGA 2FO0A 4OTRA 5CA1F 2P4IA 4S33A 3W33A 4APCA 3A61A 4HYSA 4FODA 4MD8E 4DF3A 1UWHA 3DGKA 3O51A 4RIWA 4IAFA 4LMNA 5KZ0A 2X0GA 3FZRA 3P86A 4FVQA 1MRUA 1NVSA 3VQHA 4A9TA 1CSNA 5GNKA 1GZOA 5H8BA 4AOJA 5JKGA 3ZSHA 4CMTA 3C7QA 4MEDA 2YM3A 3H9OA 3B2WA 2W5AA 4FYNA 2XJ1A 4AW0A 4PMPA 3QUDA 2ZDHA 2JC6A 3DJ6A 4FVRA 3ZHPC 2V5AA 2XK4A 3QKKA 4JXFA 1FVVA 3DFCB 3LQ5A 4DE4A 1XBCA 4EZ3A 4CLJA 3D7TA 4QO9A 5E8ZA 3KEXA 3MY0A 3C4ZA 4NM5A 4RX5A 3HRBA 4X2FA 5CF4A 1CQIB 3MFUA 2WU7A 4IZAA 4QTBA 3UQGA 4GU6A 4UY9A 4MV6A 2XH5A 4XLIA 1FMOE 4K18A 2XIYA 2WEVA 3GQIA 5AUYA 4DLIA 3KMWA 4F7NA 2OKRA 4TUYF 5A14A 5BUEA 1WVXA 2A0CX 4O6LA 2GNLA 2PVKA 4U42A 5M44A 2P33A 2QOLA 2R3OA 2ZYBA 4C4IA 1DAYA 2C47A 1WR2A 4QP8A 3PXKA 4FBXA 3KAKA 4TRLA 4FFLA 2VTMA 3DXQA 1LP4A 4NL0A 2PY3A 4C3PA 4MKCA 3FV8A 1OPJA 4RX9A 3COIA 1L8TA 3F3ZA 1UNLA 3R02A 3RK5A 3UZPA 4BZNA 3OS3A 4FMQA 4QP9A 4F7SA 4AAAA 1SVHA 4BCPA 3G6HA 3R9HA 3PG3A 3LCOA 3QLGA 4PMSA 1IG1A 3NUXA 4YPDA 5C26A 3D5VA 3JRXA 5AUTA 4CRLA 1J3HA 3D2IA 4Y95A 2BALA 4GW8A 5DH3A 4E1ZA 2W5BA 5E7RA 3R8VA 4AX8A 3BU6A 2EU9A 4QRCA 1ZWSA 1HOWA 3EN4A 4FICA 3ATTA 2XIZA 3LWBA 3KA0A 1SZMA 3AC5A 1H1RA 4R7HA 4B8LA 3SV0A 3QTWA 3QQFA 4J95A 2OZOA 4QYEA 4YLJA 2QD9A 5BYYA 3E8DA 4M13A 4QTAA 3V5WA 4AFEA 4EH9A 5CZHA 3ZYAA 4EHEA 5KO1A 2G9XA 1CQJB 2W6OA 3VUHA 3DBDA 5JZJA 3Q6WA 3MYGA 5AWMA 2ITZA 2OK1A 3MH1A 1G8AA 2XCHA 2C6IA 2WQOA 3LFQA 4ZTMA 3NNUA 4LV5A 4FNWA 1VYWA 4RJ7A 5J1VA 5HTCA 4FIJA 2NP8A 4NM7A 5DR6A 5EHLA 3FY2A 2OG8A 4ZSJA 3DA6A 1YWNA 3R8PA 3ENHA 5BVEA 4BGQA 4GFOA 2WXVA 1W83A 4YO4A 1Q8UA 4FL3A 2F49A 1XH5A 5L2WA 2G2IA 3TUDA 4WBNF 4FT5A 3QQLA 2WMBA 2O63A 2WMUA 3BI6A 4YTHA 3SD0A 4RT7A 2G2FA 4EK8A 4ZTLA 3RHXA 4TNBA 4MNEA 3MTLA 2PE1A 3ZO2A 5J5SA 3UO5A 4HGTA 3R71A 3FZOA 4O2ZA 2VO6A 3MB7A 5IQAA 3BZ3A 4QTEA 3AQVA 4LQMA 4FIEA 4IWDA 2WTDA 4ZK5A 2W6ZA 2XA4A 4NTTA 5JFXA 2GS7A 5E8YA 3U4UA 3Q32A 4PMMA 4B0GA 5CXZA 3MY5A 4M14A 4HGSA 4EYJA 2QHMA 3QFVA 1ZRZA 3OY3A 3BG5A 5L6PA 4YUQA 3RVGA 2G01A 3S0OA 2JKMA 3BWFA 3C0IA 4EH7A 3U55A 4JS8A 4FZ7A 2BZKB 1IASA 3UIBA 4EOJA 2G15A 2GPWA 4I6HA 4QTDA 3WIGA 2WYOA 4PTGA 5AMNA 3NIEA 4R78A 3ZUUA 3OP5A 3W32A 5AP3A 2YWVA 3FC1X 2F57A 3U9NA 4ANQA 4F9BA 4ERWA 4JL9A 3PZEA 3MN3A 3ACJA 4JQ7A 5DFPA 4ZTSA 3ORZA 3FKNA 5DHJA 4B6LA 4MV8A 2QU6A 5CVGA 1Z2NX 2R3FA 4FSWA 3ORPA 4ZJJA 5ACKA 4DBXA 4C59A 3ZC6A 3IOKA 5CT7A 4KKEA 2VR1A 3R1YA 3BX5A 5JK3A 4BDBA 3HO8A 1PMUA 3ZM4A 4Y5QA 3H9FA 5EYMA 5FUTA 4F09A 3MTFA 2O5KA 4R6VA 4YAKB 2A1AB 2IVVA 1GZ8A 5IZFA 2CDZA 4XBUA 4YC6A 4P5ZA 3MWEA 2GQRA 1O6YA 1R39A 4O7VA 3ZBFA 4AN3A 3KRRA 5C1QB 5CAUA 4RSSA 2VWUA 2XM8A 3EWHA 3KXHA 4IWOA 5EW8A 3RV4A 1W84A 4XH6A 5CSXA 4B9DA 4FFPA 4YTCA 2XIKA 5KHWA 3DB8A 4KABA 5DN3A 3EFLA 4N4SA 3E8CA 1FINA 2AC3A 4XYFA 5KCVA 1WAKA 1QPCA 3IW8A 3M11A 4ITJA 3VBWA 2WPAA 4YMJA 5EDQA 4OTFA 3U54A 5IQGA 2YM8A 3LFFA 5HG7A 3ZXTA 4DGOA 4BN1A 5HIEA 4I5MA 3AMAA 2VX0A 3EHAA 3T3VA 2JLDA 3FHRA 4UWBA 5AEPA 2YEXA 3LP8A 2QOFA 4IIRA 3RJCA 1OKWA 2X81A 4OBPA 4R7BA 5HORA 1VR2A 2J0JA 3MPAA 2ZB0A 2ZB1A 3O96A 2PPQA 2ITOA 4ONAA 2BHHA 2UZNA 2WQMA 1WBNA 4FU0A 4IANA 2IZUA 4UXLA 4LRMA 3AD6A 4G9RA 5B7VA 3DBQA 4RVLA 1OL5A 4AT5A 2BKKA 5M56A 4E26A 4HR7A 3EN5A 4FIFA 2P0AA 3EZRA 3QALE 3B8QA 3VS7A 2O0UA 4E5WA 3UTOA 1FVRA 5A6NA 1XJDA 3COKA 3QC4A 4FTTA 2QOKA 1Q97A 5FEDA 1H01A 4RPVA 5K9IA 3BLQA 4MD7E 4X2KA 4NJ3A 5M51A 3UPXA 5AX3A 5CX9A 4Z7HA 5JT2A 2YISA 3C4CA 4I6BA 5IG1A 4G3CA 4JQ8A 4RJ8A 4XG8A 3CQEA 4I93A 5D1JA 5T6KA 5KZIA 5AA8A 3PJ3A 4FUXA 3DK3A 3NWWA 2WTIA 3EMGA 3RK9A 5D8DA 3ITZA 3Q2JA 4RZWA 4ZXTA 4EH6A 1W82A 3HUCA 4IDVA 3UIMA 5IISA 4YJ2F 3FJQE 4PX6A 4AT3A 3ZUTA 3TIIA 1QMZA 2XKFA 3BU3A 2FSTX 5HD7A 3K3JA 4IJPA 2JDVA 2GNHA 4IAKA 4UZHA 2QOBA 2YDJA 5A4TA 4EORA 3D83A 5C9CA 2RG5A 4LOOA 3QQUA 2JIIA 1J91A 2BCJA 3KY2A 3C1XA 5EQPA 1V0OA 3FMMA 3U9CA 3N4UA 2IN6A 2C3KA 3FXZA 4RZVA 4ZHQF 5F4NA 4W8EA 4R5YA 3Q2MA 2CLQA 4TY1A 4IFCA 1XQZA 4XRLA 3R9DA 4FZDB 5CVHA 2XKCA 4IB0A 3L8VA 4BKJA 2CKOA 5EDRA 2IVUA 4O0XA 5FXSA 3SW7A 3OW3A 1U5QA 1YI3A 3PXFA 1UA2A 2UZBA 3VF9A 2IO6A 3L8PA 5IA0A 4TV8F 2XNNA 4ITHA 4RIWB 2WQBA 4ZS4A 4JR3A 3K3IA 3I60A 2ZM3A 3FL5A 2PULA 4E6QA 4KKGA 3R6XA 1XO2B 3DV3A 2BRBA 3MVHA 4EOPA 2W4OA 4L44A 2CN8A 3LQ8A 4KS7A 4DEEA 4MTAA 5AIKA 4W4XA 3I79A 4F1MA 1M14A 4D9TA 1GIHA 3V8WA 4E4LA 4FTAA 4XOYA 2OJJA 3HMNA 5E1SA 5IDPA 2QKRA 2P2HA 4H3QA 5FTQA 4LL5A 4NSTA 4C5CA 3EN9A 3RAWA 5E8UA 3BCEA 1YXSA 2C5OA 4RC3A 3ZEWA 3FDNA 5F9EA 5LXMA 2HOGA 4TW9A 4JT3A 3QU0A 4BYIA 4F6UA 1R3CA 3R2YA 2V0DA 3FLYA 2RG6A 2I87A 3UPZA 3ALNA 2IG7A 2YZAA 3ZDUA 2QU5A 3OUKA 4PRJA 3BEAA 1YOJA 4IVBA 3TWJA 4A06A 1MQBA 3C9WA 1DIKA 5CI7A 2Z60A 2ITVA 4EQCA 2B7AA 4UV0A 1KV2A 2UW5A 4I0RA 5EM8A 3ANQA 3QTZA 3UVRA 1E4EA 3G0FA 1PY5A 1Y91A 3FLQA 3H9RA 4P2KA 1X8BA 3QTXA 5IMEA 4ZP5A 2OWBA 5BVWA 4UWYA 4WG5A 3BIZA 2C68A 4ITIA 4FKGA 2W99B 3FMEA 1H1QA 1B6CB 4FUYA 3HNGA 3QAME 3CKXA 4H3PA 5CSHA 5HE2A 3RPYA 5J2TF 3DZQA 4RQKA 3CSVA 4LUDA 4DIMA 2HWPA 1UU7A 4NJDA 2Y9QA 4RGJA 5ACBC 2XNMA 2ZM4A 4ANMA 4PL3A 2VD5A 5CAQA 3E3PA 5KKRC 3FPQA 2Z7SA 5KX8A 5C27A 4GH2A 2I8CA 4YO6A 4J8NA 5LA6F 4QP1A 4HNVA 2EXMA 5KKNB 1WBOA 4WBBB 2XEYA 3DK7A 1PJKA 3TNIA 2R3GA 4Q5HA 5BVDA 3FMJA 1OUKA 1FVTA 4I1ZA 2JKOA 5G1XA 4TT7A 3IG7A 4FKPA 1CKJA 4HPUE 3KRLA 3NCZA 1TQIA 2PVHA 2XYUA 4L01A 5CQUA 4MV3A 1Q62A 3BE9A 3FLZA 4HCTA 4R3CA 3GCPA 3PVBA 3Q5ZA 3TDVA 5IU2A 2PZYA 3UJGA 1P4FA 4M7IA 3ORTA 3TJCA 3V5LA 4ZY4A 3R9RA 3QZFA 2Z7QA 4ZIMA 5C01A 3R04A 3A60A 4FFNA 3KXXA 3TQTA 3U6HA 2OICA 4H58A 3IECA 3VNTA 3ORMA 1KE5A 2X1NA 4M9UA 3PE1A 1PYEA 2R7NA 1JSTA 3R7EA 4C0TA 5M07A 4XG2A 5AJQA 3ZEPA 1KJJA 4BCMA 3K5IA 4OGRA 4ZLOA 1M7NA 2R3RA 3ZBXA 4E4TA 5CEMA 4F0FA 3GC9A 4IC8A 3ZRMA 1JKTA 3F61A 2YZGA 2ITXA 2OBJA 2GCDA 3ID6C 1GSHA 4IW0A 3ETHA 2WD1A 3ZONA 4O7ZA 5KMOA 1OKVA 3PRIA 1LR4A 2X4ZA 3C5IA 3LJ0A 2B1PA 4RJ5A 4YZBA 3QYWA 4XX9A 5HICA 3TKIA 2CZGA 3WZJA 4CTBA 4D1XA 1I7LA 5M4UA 3Q4CA 3H3CA 3R21A 1TVOA 1GSAA 2PWLA 2C4GA 2O64A 4XHKB 3I7CA 3UOLA 3OCBA 3LXLA 4CCBA 1RE8A 3UIUA 4ZEGA 1BUHA 2W1CA 3OMVA 2I1MA 2PHKA 3HLLA 4IIJF 5JGAA 3D5WA 2CNUA 2B54A 4RFMA 2R4BA 4CV8A 3OC1A 2NU7B 3NYOA 3IW6A 5TOZA 4TXCA 3L9PA 3E88A 4CZTA 3RM7A 4O0TA 4AZFA 5F1ZA 5AAFA 4YURA 3R23A 2BRNA 2UZVA 4EKKA 2YRXA 5FDPA 3RPOA 4FKJA 3TT0A 3AGLA 2IW8A 2YFXA 2HK5A 3OCGA 2OIBA 4LRKA 2W1ZA 2XVDA 5FD2A 4KRCA 3WI6A 2JITA 4YZCA 2O65A 2UW3A 4IB3A 1PK8A 3PFQA 2UVXA 4TTHB 3NPCA 2PUNA 1NA7A 3G0EA 5JVLA 2VO0A 3OXIA 3IQ7A 5CAPA 2GSFA 3FXWA 3G8CA 3DKCA 4PV0A 4WNMA 3V6SA 2B52A 3Q9ZA 1JLUE 2J0KA 2KULA 4FSNA 3GOKA 1WVYA 5E8TA 4C35A 4D4RA 3CKWA 3TKHA 2WELA 2FVDA 4JBPA 3SOAA 4QNAA 3UNZA 3BQCA 1B6RA 4RWLA 4D58A 1WZYA 4EBWA 4ASZA 2V22A 5BNJA 4G31A 1JDBB 4OR5A 4PDSA 3HA6A 2OJFE 3G51A 4K6ZA 4A7CA 4C3RA 4I22A 5CSPA 3D14A 3ZZWA 3UOHA 1OECA 1YW2A 2ZV9A 4JDHA 5H3QA 1LEWA 3AOXA 4J71A 3CTHA 4QT1A 1NW1A 3CY2A 2BKZA 4BDDA 3R0TA 2OH4A 1BI8A 1IAHA 2CGVA 3PPKA 4EH4A 4F1TA 3EL7A 4BRXA 2X9EA 3MH0A 1A9XA 2WU6A 5D7VA 4B99A 3BV2A 4C37A 3DXNA 2WB8A 4AA5A 3PPJA 4RIXB 1JOWB 3D4QA 3EFJA 3I6WA 3NDMA 3SG9A 3EOCA 3MB6A 4HNTA 4XMOA 4GT3A 4RFZA 2BDJA 3PVGA 3WBLA 4EHGA 2R86A 5CF6A 2C6OA 2ZDQA 2XIRA 2CSNA 5ANDA 3HZTA 4IH8A 3SGCA 5HX6A 4PTCA 5DEYA 3P7AA 2GS6A 1KWPA 3N4TA 5CAEB 3A8XA 2GS2A 4FK6A 2C1BA 3BPRA 3QXPA 4S32A 5AP4A 3W10A 4DLJA 5I4NA 3G33A 2A4LA 4LMUA 5HGIA 3MVLA 2VTLA 2VX1A 3Q3BA 4XG7A 3R01A 4A9YA 3Q5IA 4GFGA 1PYXA 4J7BA 3WYXA 4GYGA 4O4LF 2VTOA 1J7IA 1PMNA 2CPKE 2W17A 3AD5A 3EQGA 4PDPA 5BQ0A 2X0SA 2PE2A 5A4LA 5CAOA 4DH5A 4NW6A 3POZA 3CQUA 3VS1A 2DLNA 2UW7A 4YLKA 3R9NA 1VJYA 1NY3A 2GFSA 4Y8DA 5DG5A 5HG5A 4D9UA 4AS0A 1XWSA 2H8HA 4GCJA 2C69A 3EKKA 4L00A 4FTNA 4ZZNA 1AUXA 4MXCA 4ANLA 2XUUA 2RFDA 4IB1A 3KXGA 2HZ4A 1YXUA 4FSZA 3BELA 4O38A 3A7IA 4CCUA 2R9SA 3FLSA 4BZDA 2WMRA 3OZ6A 4GVJA 1KE7A 4U3YA 3WZKA 4F70A 2V55A 4RG0A 4QOXA 4OTDA 4EZ7A 4ZY5A 3WARA 5HD4A 1DS5A 1UU9A 3ZCLA 4MNFA 4UB7A 4XS2A 2RF9A 2X2LA 4E6DA 2AUHA 4NU1A 5CA0F 3OCTA 4I5PA 4FFOA 2IVTA 3ZRLA 5EI2A 2UZUE 2FH9A 2X8IA 3TL8A 4O7TA 3PSDA 4O81A 5J9YA 5FDXA 5TO8A 5KMIA 5AP2A 1I44A 3C50A 4DEBA 2O2UA 3UMWA 5HV6A 2ZV2A 4JDJA 3RPSA 5L8KA 2X7GA 1VKZA 3IW5A 1PXMA 3LMGA 3VUMA 4DTAA 4EQUA 3EN6A 3NGAA 1QPEA 3PLSA 5IUGA 3AC1A 3PSBA 4I5HA 4NH1A 5AP0A 5BPHA 2PBZA 2PTKA 1W0XC 3G9NA 2R87A 4DEIA 2X39A 2XS0A 4XG9A 4QQCA 3O7LB 3S1HA 4NK9A 4BBEA 3C4WA 5IH5A 1XHAA 4GK2A 4U80A 4KBKA 5DEWA 4GK3A 5FBOA 4AGWA 4BIDA 4P90A 2B9FA 3ZH8A 2W9ZB 2FB9A 2QO2A 3NAYA 4DCEA 3II5A 2C0OA 4ZOLF 5GHVA 4QMTA 2YRWA 5AX9A 5JH7F 4RZQA 2Q0BA 2EB2A 3O23A 1YOMA 4MCVA 4CD0A 5JFSA 4B4LA 1JKSA 2VAGA 2P0CA 3GEQA 4GU9A 1Q8TA 3EYHA 5D9HA 4IE9A 3COHA 4A9UA 3HRCA 3O0GA 3SG8A 4BB4A 4RRVA 1U4DA 2F7XE 3RK7A 1OIYA 2HZ0A 3VQUA 3PLAE 4OUCA 4DT9A 2B0QA 3EQDA 3ALOA 4C61A 1B38A 4FK3A 4XP0A 5IA5A 2WTCA 3SVVA 4D1SA 4EH2A 4YJSA 1G8SA 1K3AA 2QURA 3AC8A 2VWBA 4YHJA 5HEZA 3GUBA 3U4WA 3VS4A 3ZO4A 4DH1A 4FG9A 2HZIA 2XEZA 5EKNA 1CMKE 1BLXA 2WNTA 3BGQA 4RVKA 3UG2A 4ALUA 4TPTA 4WOVA 5E9EA 2HGSA 5IQIA 4I6FA 3K3PA 4ZQIA 3QZHA 1PKDA 4F6WA 1KJQA 5GIOE 3N6RA 2IP4A 4LG4A 4GVAA 2OH0E 3LCKA 4FKTA 4FSYA 5M55A 4S31A 4ACMA 1KV1A 4AF3A 4E93A 3EJ1A 3CJGA 3G2FA 4X7QA 4HNUA 3ELJA 5FP5A 2UW6A 4FV7A 2YM7A 3ORRA 1H0VA 3NS9A 2ZJWA 3EQPA 4LUEA 3PG1A 2UZWE 3JY0A 3QL8A 2IVSA 2QI8A 4QMWA 1Q5KA 4JOAA 4DG3E 2BDWA 4D0XA 4DGMA 4KBCA 4LOPA 5E1EA 3RAHA 4KB8A 4O84A 1NT2A 3VUKA 3K54A 1JLLB 3BYMA 4AE9A 3CGFA 5D41A 4EK3A 4ZMEA 1YVJA 3FQSA 3MWDA 4HZSA 2VV9A 2FGIA 5EHOA 4ZI7F 4U41A 3NEWA 4DTBA 3OTVA 4EC9A 4V01A 4L45A 2JEDA 5HLNA 3LXKA 5JRSA 2PVFA 1UNGA 2YIQA 1O9UA 3A7HA 4C38A 3UQCA 1VBHA 2ZV7A 4MAOA 4QP3A 3NNXA 5FQDC 3IKAA 5A4CA 3LFDA 3DZOA 1GSOA 3PZHA 3ZRKA 1P2AA 3D15A 3LZBA 4PWNA 1U5RA 1QCFA 5I9XA 4HYHA 3MW1A 2JDOA 4FI1A 3FYJX 3QUEA 4ZOGA 4MYGA 4YJQA 4Y46A 4ZZMA 2ZAZA 3LLAA 4BCIA 5AA9A 4OTHA 3WF7A 5HU3A 3GC8A 4TYHA 3HEGA 3SQQA 5HU9A 4L42A 3EN7A 2CNVA 4XZ3B 1OI9A 5CU3A 1URWA 1M52A 3CR0A 3MPTA 1YWVA 2CCHA 2H6DA 2YIWA 3F9NA 4IEBA 4ENXA 1SMHA 4YJPA 3TZ7A 4QQTA 4XRJA 3E87A 3GGFA 2XB7A 3QX4A 4FZFB 4E4MA 2ONLA 4CFUA 2I0YA 3NUPA 4DFLA 3R00A 3ZS5A 1EUCB 3PA5A 4BTMA 1DM2A 4DTKA 1PMVA 4QMYA 3N9XA 5EKOA 1WBVA 1ZOGA 4II5A 3V5PA 4DEDA 2JDTA 5KBRA 3Q96A 3FKLA 1GAGA 3MH3A 3QTRA 4C62A 1K9AA 1PXOA 1Z57A 4GIHA 2ITTA 5DA3A 4IZ5A 5HLPA 2V7OA 4F9CA 4PNKA 3OD6X 4O83A 2A19B 3VN9A 5AM7A 3WNZA 4JAJA 4BZOA 1O6KA 1JSUA 5HBJA 2J9GA 2ZMDA 1PXNA 2C6DA 3DKFA 4R77A 5EYCA 4KNBA 4AXAA 3MFRA 4FV8A 3QQGA 1FGKA 2WMQA 4MXYA 5M4FA 4OTGA 3DLZA 3QWJA 4F08A 1GZKA 3NW7A 3CPBA 1PF8A 4JRNA 1CTPE 2E9UA 4G9CA 5LWMA 2WO6A 5TKDA 2JBOA 2BHEA 4BCGA 2Y8OA 1OBDA 2YACA 2XK6A 5IYZF 2W6MA 3D0EA 3AT4A 3FI2A 2HYYA 3CIKA 3PVUA 2XBJA 4UWCA 2GTNA 1VYZA 5CTPA 4HVDA 3PJ2A 3OCSA 5LQFA 3WE4A 2JKQA 4EHZA 5BYZA 4EGJA 5AUUA 3TNPC 2Y4PA 3GXLA 4R3PA 3OTUA 4JBOA 4TZRA 5AV1A 4EOIA 2OZAB 4OTWA 1DI8A 1JAMA 4GKIA 4ID7A 3BLRA 3NNWA 3AC2A 4X2JA 4YHTA 2PZ5A 4O6EA 5HKMA 3C13A 4ZY6A 3UC3A 4S34A 3KULA 3ZC5A 4I94A 3DNEA 4CVAA 3RI1A 1ZXEA 2VTPA 3L8SA 3NW6A 2QOIA 4MVFA 5K3YA 3EQFA 4KIPA 3MJFA 2PVJA 5AAEA 2QHNA 3PIXA 2P2IA 1OZ1A 3ERKA 4H05A 3BV3A 3HP2A 5HHWA 1H08A 2DUVA 4U40A 3TNHA 3EKNA 4XG6A 4IVDA 5DT3A 1OIQA 5CU2A 5FNVF 2R7BA 5LMAA 4L6QA 5IUIA 1UU3A 4FT7A 4IHPA 4AZSA 3ENMA 3I0QA 3QCQA 4QPAA 3T8OA 2XZSA 3TZ8A 4Z3VA 3A62A 2NU8B 3E7OA 3V5TA 2PSQA 3DBEA 3BYUA 2HENA 4AG8A 4TYJA 1U54B 4KD1A 3UZRA 4U7ZA 2JFMA 5EK7A 5CEKA 5EQEA 1ZYCA 1JSVA 3G6GA 4R1YA 3QX2A 4TWCA 3IDPA 4DLKA 3TI1A 5HNIX 4K2RA 3GBZA 2VGPA 4BDCA 4AGUA 2XNBA 2PMOX 4DH7A 4QNYA 5EW9A 1H00A 1R78A 3VS2A 3OWKA 1SM2A 2VGOA 4K11A 5DI1A 1EYZA 1M0TA 4A07A 5C8MA 4X3FA 4I6QA 1KEEA 4X3FB 4CG8A 3V51A 4JBQA 5JSMA 4WD5A 3W2CA 3RFCA 2F7EE 3U8WA 3DDQA 2J51A 4MX9A 2BAQA 4DCAA 3Q04A 2E9NA 3PY3A 4NFNA 1SVGA 4PUZA 2PK9A 3DOGA 2VUWA 2W4KA 3VF8A 3HV6A 1PW2A 3LFSA 4H36A 4XUFA 4OW8A 2XMYA 3LFCA 3P78A 1SYKA 3FZSA 3HYHA 4R3RA 4CT2A 2OGVA 4FNXA 3RAKA 4C4HA 1JDEA 4MAMA 1KC7A 2DS1A 3CBLA 4M69B 3WE8A 4EOOA 4KWPA 2W1IA 4YZNA 5CI6A 1IOVA 2Z02A 4GUBA 1H24A 5JQ5A 3TN8A 5JGDA 4RVMA 3QA8A 4XV9A 4YHFA 3ROCA 2QONA 3VUGA 4O82A 3ULZA 5CZIA 3ZM9A 4G3DA 4JBVA 5E91A 4D1ZA 5IA1A 1OPKA 3DK6A 1JBPE 3QQJA 2ZOQA 4DH3A 4L3LA 4MV1A 2C0IA 1C30A 4YBKA 4FSMA 4FR4A 2OJIA 1BKXA 5IQBA 1J7UA 2WMAA 2XKEA 4J99A 4TN6A 2NPQA 3LFAA 4PL4A 5E8XA 5HIDA 5TR6A 4F7JA 2IPXA 2ZM1A 4W4VA 3UP2A 2UW4A 3EIDA 3MGYA 3WF6A 4CT1A 4BGHA 4NIFB 3FC2A 4E4XA 4EJNA 3BGPA 4WNKA 2YM6A 5A54A 1JKLA 1Q61A 1XKKA 5HBRB 4W8DA 1XH4A 4O91A 3FMDA 2F4JA 4AN9A 3DB6A 4GRBA 3KVXA 2WTKB 5L6WL 3UVPA 1OIUA 4AUAA 3AGMA 1AGWA 4M84A 4CV9A 3LW0A 3KREA 3N4VA 4ZSGA 2H96A 3UMXA 2FSOX 1DV1A 1M2RA 3VBTA 4BCKA 5AV3A 2BVAA 2W5HA 1S9JA 2YZNA 4I4TF 1BX6A 4UEUA 4ZTNA 3LVPA 3KN5A 5J2UF 3ORXA 3REPA 3PXQA 1PXIA 2C3IB 2ITUA 2QLQA 2R7MA 3Q2OA 4Y8VB 2ITPA 2FSLX 1A9UA 2BAKA 2C5YA 2E2BA 2GNGA 2HWOA 4JG7A 4O2AF 3W2QA 3MH2A 4HZRA 3EFKA 3MFSA 5GONF 4ZLYA 2W1GA 1H0WA 5EH0A 3IGGA 2UZLA 4IZYA 5HNBA 3HA8A 4FV3A 2QODA 4EOKA 2VO3A 4IB5A 2LAVA 4BR3A 1FPUA 1S9IA 5CF8A 5JFWA 4D5HA 2W9FB 3DU8A 4AOIA 5HZNA 3ETAA 1BI7A 4FIGA 2J7TA 2PVNA 5AV0A 5A4EA 4CMUA 4RJ3A 3AMYA 5DR2A 4IWPA 4FV1A 5IQFA 4YPSA 4C58A 4FZ6A 4BDAA 3I5NA 3BBWA 2G2HA 3GB2A 3QTQA 5IQEA 3QCXA 1GIIA 3ORKA 2W06A 4HYIA 4O0VA 4F0IA 2VTRA 2HIWA 2V62A 4FT0A 3TTJA 4C4GA 4CRSA 3LE6A 3GU7A 1OMWA 4O96A 3A8WA 2GHMA 3LMIA 4LI5A 4BDJA 2GHGA 5M57A 4IZ7A 4C5BA 5CU0A 3ZFYA 4TKSA 3ULIA 3TUBA 4Y72A 4I24A 1BXRA 5FEEA 1WBSA 3L9LA 3QZGA 4AE6A 3IDBA 1YXTA 3HMIA 2R7IA 2C5XA 4BDFA 3VUDA 2B4SB 1PXKA 3FWQA 2R3HA 1YHVA 3TJDA 5HQ0A 5HX8A 4EEVA 3BYOA 2BDFA 3H0YA 4G6NA 4K33A 4L3PA 4NT4A 3WF9A 2QO9A 3Q9XA 4QP4A 4O21A 2UV2A 3ZXZA 2R0UA 4Y73A 3RALA 2OO8X 2YIXA 3GU4A 1IRKA 2JBPA 3DAJA 5I9ZA 3QD2B 5HNGA 3ODYX 5IA2A 2E9VA 2GMXA 1L3RE 4HPTE 4CFXA 2C3LA 4HNFA 1UU8A 2C1AA 1YHWA 4GJ2A 2UVYA 5KUPA 3L9MA 4R1VA 1T36A 2FP4B 3D9VA 4OT6A 4AQCA 3RCJA 2RFSA 4GS6A 5JFVA 2R3NA 1RDQE 4I41A 1NVQA 1PMEA 3HGKA 3KF7A 4MH7A 3RNIA 4I4FA 3WO0A 5T68A 4C02A 4ACCA 2WOTA 2CHLA 3GNIB 2W1DA 4HOKA 5CAVA 4FEWA 3T9IA 4C4EA 5CU6A 3RM6A 1Z2PX 4FV5A 5E4HA 1V0PA 4G3FA 3PUPA 2XK3A 5G6VA 4AZEA 4GT5A 3W8QA 2PZPA 2QR8A 2YERA 4XOZA 5AADA 3NUUA 1QPDA 4ASDA 3V01A 4ZSEA 2YL2A 2CGUA 4BYJA 3QFFA 4QMVA 4TWNA 4FG7A 3UOKA 3C0GA 1YXVA 3CD8A 5CVFA 3F7WA 4OTQA 1ZMVA 2XBAA 1TQMA 3SAYA 3T3UA 2JDSA 4A9SA 4TNDA 3HECA 3QTUA 3R28A 1FQ1B 2YN8A 1W93A 3FL4A 3G8DA 1XBBA 3JUHA 3RGFA 3AXWA 2YZMA 2HXLA 4BGGA 2QVSE 4KKHA 4RWIA 5JQWA 3M1SA 4Z7GA 4O2BF 1ATPE 4EOLA 3HAMA 2YJSA 4RIOA 4ZSAA 3LJ2A 3NCGA 5E8WA 2YCRA 3UIXA 1OL6A 3HB9A 3MY1A 5BPYA 2ETRA 4JX3A 2IW9A 3FPMA 5E8SA 2IZSA 3FUPA 4YBZB 2O3PA 4L46A 1ZOHA 5HVYA 3NUSA 2XP2A 3OUUA 4N6YA 2W70A 5J9ZA 2J6MA 4G5PA 4PP7A 5EFQA 3UDBA 3KMMA 5H2UA 3LQ3A 4CLIA 4YSJA 3R8UA 5KBQA 2VPQA 3CY3A 5A3XA 1A48A 4KUJA 3ZU7A 3QRJA 4FKWA 5IQCA 4EYMA 3E5NA 2VO7A 3TACA 5C1OA 3P1AA 3R1QA 2WMTA 4TYIA 5J1WA 2YS6A 5EQYA 1EH4A 3QCYA 4QYYA 4QP2A 3R83A 3IW7A 3RWQA 3HAVA 3L9NA 2YDKA 4GKHA 1C3OA 2BPMA 4CMOA 3ACKA 1WVWA 3O71A 4FL2A 4ZTRA 1YHSA 2H34A 5CYIA 4J96A 4FZAB 3EB0A 4AOTA 1TKIA 3RP9A 5L2TA 4FV6A 4FIHA 4YJNA 1E4EB 2PYWA 3MI9A 3NAXA 4XV1A 4YTIA 3O50A 3ORQA 3JR1A 4BTKA 3NX8A 4RWKA 4DA5A 1H1WA 2NRUA 4DHFA 5HCXA 3CE3A 3VPCA 3NVMB 3RV3A 3GVUA 1OL1A 2QG7A 4NM0A 4X21A 2WEIA 3LIJA 5D12A 3DJ7A 4MD9E 3PWDA 4M0ZA 4EZ5A 2OXXA 2XK9A 1A06A 2DQ7X 2OZAA 2UZEA 3CS9A 2OXDA 3BBTB 1J7LA 3DNDA 5L8JA 5ICPA 4C4FA 5IEVA 4M15A 1B6SA 2X2MA 4ZTQA 3AC3A 4YR8A 3FMKA 3CGOA 1H28A 3IS5A 5CEOA 3QRTA 2UZTA 3TTIA 3TIZA 3GC0A 4ACDA 5FTGA 5FBNC 1VEBA 2FYSA 3V8TA 3AG9A 3F5XA 3C4XA 3FI8A 5IA3A 2WIHA 5BVFA 1ZZ2A 4AGCA 4RA5A 5IH4A 5M53A 3HDNA 4CFFA 4JLCA 4ANBA 4O86A 4M3QA 1Q3DA 2PZIA 3MA6A 2IZRA 3LJ1A 4LL0A 3VJNA 2R2PA 4BICA 5IH6A 2CGWA 5LP6F 4B7TA 2R3JA 2XNGA 2OW3A 3SOCA 3VC4A 2WTKC 1Z2OX 1F0QA 2WQEA 2QR7A 1Y8GA 2Y4IB 3TNQB 3V6RA 1WBPA 2X8DA 3DF7A 5CEPA 5KMNA 3R8ZA 4D4YA 2WMSA 3KRWA 5FTOA 4EG0A 4YC3A 2YM4A 4L52A 4BBFA 3FAAA 4BHZA 2VTHA 4H1MA 2OF2A 1PXPA 4TYGA 5CS6A 3WOWA 5IDNA 1EHIA 3DAEA 2NU9B 3JXWA 1FMKA 1BL7A 2Q0NA 3U87A 1V0BA 2VN9A 5I0BA 3AT2A 4KA3A 5AV4A 1ND4A 3I4BA 3VWAA 3R1NA 3OXTA 4BCFA 1Z5MA 4I0TA 1XH8A 3PXRA 5AIRA 5ITAA 1QL6A 1W8CA 1ZOEA 1BL6A 2QO7A 3CLYA 3NSZA 3SW4A 1YOLA 2YJRA 3DCVA 3R22A 4MWIA 3WYYA 3EQBA 2W96B 2UUEA 2QQ7A 2X4FA 2CNQA 2ZVAA 4IVCA 3WIKA 3ZSIA 3AMBA 2J90A 4MXAA 3LOKA 3FMNA 3QA0A 4QP6A 5L2IA 3UOJA 3O2MA 3OF0A 1B39A 3ORIA 2ZMCA 3JVSA 3TV6A 2BUJA 1FGIA 3MWUA 3VUIA 3DBCA 2I7QA 3KK8A 3LCTA 2B9JA 4AZWA 4ZJVA 2W7XA 1OB3A 3PE2A 5D11A 3P79A 3RZBA 4E4NA 4M8TA 2ZDTA 3UO4A 4L7FA 1F5QA 4KSQA 3P0MA 1KBLA 3CJFA 2CN5A 3FMLA 4WUNA 4YSMA 2WMWA 5AP5A 5B0XA 4IHJF 3TINA 2QF7A 4IQ6A 5JH6A 3I6UA 4IM0A 3QRUA 5BYLA 1H07A 4PP9A 3D7ZA 3P9JA 5LJJA 1ZARA 4IAIA 4WG4A 2JDRA 2J50A 1ERKA 2V5QA 3D2KA 4I92A 2JD5A 3ZLSA 4Q2AA 1OUYA 4O4HF 4YGAA 3NUYA 5CWZA 1YI4A 5EDPA 3GFEA 4IACA 3KXZA 4IWQA 5FRIA 3RPVA 4XV2A 4MV9A 4WHZA 4C34A 5DIAA 1IAJA 5HBEA 2GHLA 2YHVA 4QMPA 5L8LA 4QMLA 3NYXA 5A46A 4H1JA 3OG7A 4IBMA 1RW8A 3D94A 3RINA 4BVUA 4BI1A 3DFAA 5BVOA 1YDSE 5CSWA 4HVSA 2W6QA 4UZDA 4WRGA 5CLPA 4D28A 2ERKA 3CPCA 3NZ0A 5EYDA 4C36A 5ETCA 2W6NA 1XH7A 4YJRA 4Q9ZA 2VWWA 3KKVA 4RIXA 2UW0A 4IAAA 1XH9A 2Y0AA 3HMOA 5DT4A 4QSHA 1P4OA 2QNJA 2YDIA 1GY3A 1M7QA 4F0GA 1IA9A 1SNUA 2VTJA 2VWIA 3HVCA 5ANKA 4LV8A 3FXXA 3NUAA 4QPSA 3HL7A 5BUIA 5ANJA 5IEYA 2WIPA 3E93A 4K8AA 4D0WA 1JNKA 2QK4A 3WZEA 3ZSGA 2YABA 3DPKA 2X7OA 4I3ZA 4O0RA 3POOA 4FFRA 5HE0A 5DGZA 4FKIA 4QMNA 3FBVA 4AFJA 3EQRA 5IEXA 3OWPA 3OHTA 2YCFA 3QTIA 1G5SA 4UALA 3UGCA 5A9UA 5CQWA 4F99A 1CM8A 3OT8A 3EFWA 3NVKI 4KSPA 2XKDA 3JPVA 3SXSA 4MK0A 4WNOA 4QMZA 4A4OA 4L43A 4DGNA 3GU6A 2IW6A 3P7BA 3C51A 4RJ4A 2Q83A 4JIAA 2PZRA 3C5UA 3E63A 3FKOA 3OUNB 4N57A 4RMZA 5L3AA 5LOVF 4NKAA 4EI4A 2F2UA 5DMXA 4XP3A 4CKRA 4FA2A 3F2NA 4FV9A 5JGBA 4AW5A 5CENA 2JAMA 1MQ4A 4LYNA 4FOBA 4A4XA 5ETIA 3TIYA 4F6SA 3OFMA 3HBLA 3F82A 4YTFA 4FTMA 4NCTC 4MNEB 3JVRA 4G16A 2WMVA 2C5VA 3DDPA 3H0ZA 2EB3A 3R1SA 4YC8A 4YZMA 3KK9A 1BMKA 5HG8A 4CZUA 3EH9A 3VRZA 4FTCA 1Q8WA 5GJDA 4CFWA 4QYGA 4DT8A 2HW7A 1ULZA 1Y8YA 3KCFA 2VTSA 3O8UA 3EYGA 3PTGA 2XJ2A 3COMA 3P08A 4FV0A 5FXQA 3S95A 4MF1A 4FEQA 4FL1A 2B9HA 3QZIA 4NTSA 4BCOA 5JEBA 4HVHA 3U6JA 2W71A 2J9MA 3OXZA 1REJA 1JKKA 3HV7A 3M42A 4XYLB 4WG3A 4CG9A 4FT9A 4FKOA 2X6EA 4O7RA 4JG6A 4XG4A 3ZO3A 1PXJA 3TUCA 3MIYA 5HIBA 3FLWA 4M68A 4QMSA
chains in the Genus database with same CATH superfamily
4D4SA 4FFMA 1M2QA 2XJ0A 2VTNA 3IGOA 3MESA 2J2IB 1G3NA 3FQEA 3QQKA 5FP6A 4BTJA 5HCYA 3TDWA 1KJ8A 3R5FA 3Q1KA 2YAKA 2HXQA 2XNEA 3QD0A 3BAAA 1KSWA 2ONLC 5IPJA 3A2CA 4NKSA 3C4EA 4I0SA 4UCSA 5LMBA 3S3IA 3EQCA 3MS9A 5DYJA 3PFYA 1YWRA 4X6RA 5I9YA 5EI6A 3RCDA 4YU2A 4O0YA 2C6KA 1M6VA 4BY9E 3DBFA 2PVLA 4JQEA 2VWZA 3FI3A 3V04A 5AM6A 1WBTA 3R73A 4OTIA 1AD5A 4RWJA 3LCSA 4MBJA 4M97A 5HI2A 5KE0A 3P7CA 4A9RA 5EZYF 3NUNA 5K4JA 2PUUA 2BIYA 4XLVA 1SVEA 4FTUA 2YM5A 5KS8A 3KFAA 2GQGA 2XIXA 4O0WA 5GIPE 4MA5A 2XCKA 3K5VA 1WFCA 4IJ9A 4IX4A 4MBLA 4DG2E 3WF8A 5BVNA 2FPIB 4QQ5A 1KE9A 2WAJA 3I0OA 3R8MA 2XNOA 1Q24A 2I0EA 3NNVA 4K1BA 5AP6A 4FE2A 2OFUA 5EOLA 3SXRA 1DV2A 1GGOA 5CXHA 3O8TA 4NW5A 5IQHA 1J1CA 2GLTA 5C1PA 2PUIA 4EUUA 4ORKA 2GPSA 2RKUA 3IK3A 3PIZA 3F7ZA 2DWBA 3NYVA 4EK6A 1BYGA 3A7FA 3LXNA 3AX6A 3W0OA 4EBVA 4TL0A 4FKVA 3O5AA 4PTEA 3RAIA 1YI6A 5DE2A 1PHKA 3VAPA 4HVGA 5B2MA 5C4LA 3PXYA 4WBOA 3QYZA 4FOCA 5CY3A 4PY1A 4FTRA 4RX7A 4HW7A 3Q4ZA 4EK4A 5HVKA 4JI9A 3OROA 4I6LA 3MVMA 3VJOA 5I9WA 3BYVA 3QKLA 4DFBA 2ITWA 4O2PA 3TV7A 2GDOA 5JRQA 5M4IA 3BHUA 2GNIA 1I09A 2OJ9A 3OVVA 1PKGA 3SRVB 4FGBA 1KJ9A 3MBLA 2SRCA 2XK8A 3BU5A 3ETJA 4FKQA 2V7AA 3P23A 5JVDF 3HV4A 4MQ2A 5AUVA 4O7NA 5DR9A 3QGYA 2J0MB 4CTCA 2BIKB 4JX7A 2XARA 1M0WA 2I0VA 1KJIA 4N70A 4PZ6A 3ORNA 1WBWA 1QPJA 4G3EA 4XV3A 1OITA 5CANA 1LUFA 1OL2A 4AP7A 3MIAA 4GEOA 4ALWA 4FKRA 2AYPA 5ETFA 2UZDA 4IAYA 1H8FA 3TCPA 1KOBA 4EH3A 3I7BA 4KRDA 3GB8B 2NU6B 3A7GA 4J1RA 4G2FA 4YJVA 4C7TA 4G1WA 4JRVA 3SKCA 2QOHA 3ZLYA 3G5DA 3U6IA 5K5NA 3T9DA 1MRYA 1URCA 1PXLA 2ITQA 2UZOA 3LHJA 5CALA 5M09A 5HVJA 4AA4A 3DAKA 3PDTA 5GJFA 4D2RA 3LAUA 4MV7A 5F20A 3BGZA 2BRMA 2FB8A 3U51A 2R5TA 5KX5F 3PA3A 5IMXA 2VU3A 5BMMA 1ZMUA 1JWHA 2BTSA 4Z16A 1WCCA 5FXRA 4FSQA 2PN1A 3KIOC 3VMMA 3E8NA 4PQNA 1Q8ZA 1W96A 2NYAA 2B53A 5KMMA 3KAJA 3AC4A 4RX8A 4IM3A 4AW2A 3I12A 3P5KA 2BRGA 1OKZA 3PJ1A 4ME6A 2C30A 3DQXA 3UVQA 4RC2A 1JKJB 3RWPA 3R8LA 2P3GX 4V0GA 4FTLA 4HGEA 4CKIA 4CQEA 1T46A 4IX6A 5JMSA 5K4IA 4LH7A 4AACA 3DTWA 2PMIA 2VTAA 2F9GA 4ZS0A 2XANA 2OU7A 4QMMA 1GLVA 4KAOA 2C6TA 4D2SA 3W16A 4BCHA 2R7LA 2PVMA 4GL9A 3NR9A 4O7WA 3SHEA 1T45A 3DKGA 4E5AX 4DAWA 1AUVA 4NWMA 3IO7A 1TAEA 5HO8A 1ZMWA 3BEGA 4F9WA 4G6LA 4L3JA 4PF4A 3TM0A 1IEPA 3AW8A 1DI9A 5AFVA 5BUJA 4ZTHA 1KE8A 4DDGA 2FSMX 4DFZE 4IX3A 5CEQA 2A27A 4BTFA 2C00A 4ALVA 3W0PA 2XNPA 1CE8A 4MHAA 3MVJA 1G2WA 2RFNA 2W1EA 3W18A 3UC4A 5HTBA 4J97A 4J98A 2ZDGA 5A6OA 5J95A 1OBGA 5M08A 1EUDB 2BZJA 3CXWA 4K9YA 4G3GA 3LM0A 5LCJA 2VRXA 4DG0E 4XBRA 2R3LA 1LEZA 4BDGA 3CC6A 3ORLA 4XNEA 4F9AA 2ETKA 2RGPA 2X2KA 3HDMA 3PP0A 3W2RA 1ST0A 2W4JA 4DFNA 4XEYA 5EM7A 4EFBA 4LM5A 4K77A 2QKWB 4GSBA 3TKUA 4X3JA 3VBXA 3KQ7A 1KE6A 3LPBA 3K2LA 3UZTA 4YB8B 2PVPA 3QWKA 3BHHA 2W05A 3BRBA 3H30A 2XM9A 1BNCA 4RIYA 1R0EA 4DH8A 3F3TA 5DNRA 3VW6A 1O6LA 4KINA 4I23A 1REKA 3F2AA 4U97A 3I81A 4TWPA 4EUTA 3BWJA 3PWYA 4GK4A 5TT7A 1VBGA 5FM3A 3RHKA 3FY0A 1U46A 3R7VA 4FT3A 2C6LA 4UYAA 4WO5A 3O8PA 3TEKA 4X2NA 4ZSLA 2C3JA 3GENA 4YZ9A 3I1AA 3VBYA 5AUZA 4TV9F 2BTRA 4U43A 2IWIA 1JVPP 3HKOA 2NUAB 4MA0A 4AWIA 4IFGA 4E73A 2BFYA 2R3KA 4EGQA 1OPLA 4FSRA 4Y5HA 5LVNA 5LVOA 2ITYA 4QYHA 2ITNA 3MPMA 4L67A 4YJOA 3KN6A 5FM2A 3A7JA 2XALA 3F6XA 1OGYA 3PPZA 2OIDA 3DXPA 4G6OA 2RL5A 2COIA 3DQWA 3TMOA 3UE4A 5AP1A 1YQJA 1Y57A 4DGLC 2W6PA 4QMOA 4G5JA 4NFMA 3GCSA 4YJ3F 4AT4A 2OF4A 4H3BA 3IPHA 4L9IA 4KIQA 4EH5A 5FEQA 5E92A 3GOPA 3GT8A 3KMUA 4ZLZA 3JYAA 4XX0B 1FOTA 4YJTA 3E62A 2YA9A 2I40A 4EL9A 3PA4A 4QMUA 4PDYA 5EYKA 2DWCA 3VS6A 2X8EA 2LGCA 5BX0A 4O7SA 4EFEA 4WKQA 4GIIA 2I0HA 3FE3A 5D10A 5ANIA 4DEAA 4U44A 2ERZE 4DEGA 3KRJA 3BL9A 2PUPA 2VWVA 3PY1A 4EWQA 4I55F 4FTKA 4R5SA 4JNWA 3ZDIA 4M0YA 1Q3WA 2PE0A 1ZY4A 4F63A 1EZ1A 2R0IA 4XJ0A 4FSTA 1H27A 4FX3A 3W1BA 1ZZLA 3LKMA 3L1SA 4NUSA 1J1BA 5LVLA 4E6CA 2Z7RA 4ENYA 4N0SA 5KMLA 2UW9A 2YCSA 3QLFA 3T9TA 1H25A 3OW4A 5H9BA 3VVHA 3PRFA 2C0TA 3HMMA 3CCNA 4QMXA 1IA8A 5LCKA 3VIDA 2BR1A 4BI2A 5BMSA 1XDNA 4EQ5A 3TYKA 5EOBA 3TG1A 4BCQA 3KRXA 2V58A 2WTWA 3F3WA 4Y83A 3EQHA 2C5NA 3MA3A 5CNOA 2BILB 1WMKA 5L6OA 2ZV8A 2X9FA 3KGAA 4P7EA 3UYSA 1ZLTA 4V04A 4X2GA 5GINE 5CT0A 4C2VA 1H1PA 3AD4A 1Y6BA 2J0LA 3N8DA 2FPPB 3P4KA 3VBVA 4JAIA 2ZDUA 3IDCA 4U9AA 2CJMA 3IW4A 3FSKA 4CGAA 4BJJA 4EHVA 5E25A 2O8YA 2YZLA 2EJ2A 3E5AA 5CU4A 3R63A 2VX3A 3D7TB 4FKLA 5EM5A 1AQ1A 2UW8A 3TZ9A 3FQHA 2VTTA 3PIYA 4JMQA 4UN0C 2R82A 5HLWA 4OBOA 1EKVA 4C5AA 4X6QC 3W2PA 4AGDA 4F4PA 3LFBA 3S00A 2XYNA 4S2ZA 3KF4A 3CEKA 2GFCA 4FVPA 4FV2A 5HG9A 4AA0A 2B55A 1R1WA 4FTOA 4MUQA 4XCUA 3UBDA 2HY81 3W2SA 4U8ZA 2BFXA 3HUBA 4AW1A 5HO7A 4UXQA 2X6DA 2XRWA 3UZBA 3VS3A 1K2PA 3VO3A 4BIEA 4L8MA 1PRYA 4X3FC 2J0IA 5IUHA 1YXXA 5CEIA 3GIDA 4IWXA 5AV2A 2OFVA 1JQHA 4AN2A 3OEFX 4JR7A 2CGXA 3MJ1A 2WQNA 4JG8A 4U5JA 3KVWA 4OT5A 4V05A 4WT6A 2VTQA 1NXKA 2R3QA 4U81A 3Q4TA 1VZOA 4FSUA 2HHFA 3FYKX 3MFTA 5CF5A 1V1KA 2CMWA 5HBHA 5LOHA 5LMKC 4TVIA 4CKJA 4WSYA 3TW6A 1UVRA 3K5UA 1HCKA 2W1HA 3KL8A 3TEIA 2GU8A 4HNIA 5I5YA 4F7LA 2NNWB 2J4ZA 2GNJA 3KU2A 1OVEA 3UNKA 3V4ZA 3HP5A 4FEXA 3QRKA 4DFXE 2VWXA 2E9OA 3ZLWA 3V4SA 4AXFA 4D55A 3LM5A 1SNXA 3F2RA 2WZJA 4FTJA 2BAJA 5DWRA 3FZ1A 3BLHA 3GC7A 3Q52A 5ETAA 1E1XA 2X7FA 1M17A 4FKUA 4W4WA 4RCNA 5BPFA 5I5ZA 3WILA 4WNPA 1Q99A 1KUTA 2HCKA 2Y7JA 5CNNA 2JGZA 2F7ZE 1OL7A 4C2WA 4HVIA 3SRVA 3QHRA 4DC2A 2JKKA 4YZDA 4F1OA 5K5XA 2CKEA 3ZZEA 2HAKA 5LMKA 5C4KA 2KTYA 4P5QA 3QRIA 3TNWA 2AC5A 4EWHA 3ZLXA 2WFYA 3ZUVA 3GU8A 3FHIA 2UVZA 4GYIA 3MJ2A 2HY0A 1Q41A 4DN5A 3BQRA 2WGJA 1Z9XA 3PY0A 2VNYA 4LGGA 5FG8A 1E9HA 3SX9A 4U6RA 3RPRA 4DBNA 4Q4CA 4DEHA 2BMCA 3E64A 3R30A 3PYYA 4BDHA 5LARA 2ESMA 3RMFA 4HGLA 4BBMA 4G17A 4CSVA 3G90X 3TY8A 4J53A 2VWYA 4IDTA 4R7IA 4YAJB 3QBNA 3S2PA 3U9SA 1P14A 4TWOA 2J5FA 5M06A 3IOPA 3OOMA 5C8KA 5I5WA 1TQPA 4E6AA 1SCUB 4HJOA 3ROYA 2QOCA 2XRUA 4M12A 4YJUA 1OKYA 3UYTA 3HRFA 3VA7A 4QQJA 2CKPA 3ET7A 4EJ7A 4ARKA 2FUMA 5DISC 1Q4LA 2QG5A 3DJ5A 3VS5A 4DYMA 2HJWA 4NZOA 4X0MA 2CLXA 2PU8A 2Y6OA 2R85A 3LCDA 4MV4A 4CFVA 3LXPA 2RFEA 2XF0A 1HCLA 3F5GA 3Q9WA 4I21A 5DT0A 4B8MA 3QTSA 5T3QA 1CKIA 3JZIA 1XBAA 3VULA 4OLIA 4DFUA 4HYUA 2QCSA 4RQVA 5BVKA 4EQMA 2JAVA 4K0YA 4W4YA 5L2SA 2ZFYA 3VBQA 2YYAA 4BIBA 2HZNA 1W7HA 4NCTA 3OWLA 3VHEA 2Y6MA 4CFMA 3RR5A 5BMVF 3DTCA 2Y4IC 2Q2TA 4U79A 3VOTA 1Q8YA 4WA9A 3UQ8A 4IM2A 3WZDA 2JIUA 5JN2A 4F9YA 2WOUA 1U54A 3QXOA 3HX4A 3UNJA 4D4VA 2EVAA 2C6MA 2HELA 5DRBA 4FTQA 3OWJA 3W1FA 3ZFMA 4HCUA 4IADA 2Z7LA 3TIGA 3KULB 4IZOA 3UQFA 5DLSA 5EHYA 3MDYA 4GV1A 2Z2WA 5DVRA 4KBAA 2ACXA 2W1FA 4LRJA 5FLFA 3F66A 3FLNC 1H4LA 4EOQA 3R7OA 5LWNA 3JSLA 3K5HA 4QTCA 1GIJA 5CASA 3QD4A 1JPAA 5B2KA 5C8NA 2REIA 3QKMA 3RTXA 4Z55A 4CXAA 3GFWA 3AKJA 3NLBA 4GG7A 2YW2A 4E7WA 3ZO1A 2VZ6A 4DITA 5EW3A 3NFGB 4FC0A 5ANEA 5AAGA 4BDIA 4FYOA 2I6LA 5LVMA 4FNYA 4MBIA 5BWUA 2YS7A 3Q6UA 3CD3A 4FIIA 4GLWA 4USEA 5HESA 3OUZA 3JSNA 2I80A 4M67A 4EH8A 3EL8A 3F5PA 2F2CB 1I7NA 2WTJA 3NBZB 3A4PA 4BDKA 2YAAA 2HW6A 3V3VA 4DFYA 3EZVA 2V59A 2GQSA 2YIYA 2B9IA 2VTIA 2QOOA 3GP0A 4XP2A 4NZWB 3UODA 3B8RA 4BC6A 4FG8A 4I5CA 4PMTA 3F69A 4MXXA 4O27B 4H39A 4AZTA 5E8VA 2BZIB 3BYSA 4PL5A 3KC3A 5EM6A 2JIVA 3JS2A 4BHNA 4O7LA 3ZTXA 4Y85A 2EUFB 4FGRA 4O0SA 3R5XA 4F65A 4CC5A 1UKIA 5HCZA 3F3UA 2YWPA 5ANOA 2QLUA 3BKBA 3WF5A 2GPHA 3KXMA 4IX5A 3R2BA 3VRYA 1YKRA 1F3MC 4QP7A 1MRVA 5I9VA 4O4IF 3A99A 2Z04A 1MP8A 2WHBA 3E7VA 5FGKA 4L53A 3R9OA 3VS0A 4AZVA 5IA4A 3QGWA 2OJGA 4UX9A 4HQ6A 3GU5A 4C4JA 2G1TA 4O7YA 2JFLA 2OXYA 3WZUA 1GOLA 1APME 5LXTF 1ZAOA 4MQ1A 4L1KA 4FNZA 2SCUB 5LVPA 5K2MA 4YBJA 5AP7A 2OI4X 3D5XA 5KHXA 3QUPA 2VNWA 4IWYA 3Q9YA 4WIHA 4U45A 4FKSA 4CFNA 3UFXB 5E90A 3KB7A 2BROA 2EWAA 1OIRA 4ACHA 4DINA 3PJCA 4MWHA 4RIYB 5HE1A 3C4FA 4BDEA 2GTMA 5JZNA 5C8YF 4ZJIA 4FV4A 3OY1A 4C3FA 2IJMA 4RC4A 4J52A 4E8AA 1OGUA 3OOGA 5IQDA 4XG3A 2CCIA 1H1SA 3GCUA 3Q4UA 3GCQA 1P5EA 4JDIA 2R3MA 2Z8CA 4UBAA 4YP8A 1CKNA 4EONA 1IR3A 2EXCX 4C33A 3W5OA 3RKBA 4QMQA 1X9NA 3MV5A 1GJOA 3HMPA 1XH6A 4ZZOA 5A4QA 3CTJA 4GFMA 1FVIA 2VQDA 5LYJF 5JQ8A 3AT3A 1ZYLA 1UKHA 1W98A 1STCE 1UV5A 3MSSA 1VLRA 4RA4A 2HIXA 4Q5EA 3KALA 1Y6AA 3TZMA 5AUXA 4EOSA 3FI4A 2A2AA 4O0UA 3LMHA 4U3ZA 1LPUA 5J8IA 5CB4F 3QHWA 2CKQA 4Z9LA 4ASEA 3PP1A 4BF2A 3LFNA 1CDKA 3GCVA 4NYEA 3FMHA 2YCQA 2XCLA 2RIOA 2PMNX 2WTVA 3OT3A 3RUPA 2QOQA 2BZHB 4WRSA 4ASXA 3QF9A 4J8MA 5DRDA 4DHIB 4APPA 4LGHA 4IVAA 1KT8A 3H4JA 3QD3A 4ACGA 4LOQA 2OLSA 5F94A 4JIKA 3VHKA 4IC7A 4CKEA 3FZPA 3FSFA 3QC9A 5DOSA 3L8XA 4IAZA 2DIKA 2R3PA 4RFYA 4XYMB 5I9UA 1XR1A 2R64A 3PXZA 1CKPA 4RVTA 2WKMA 2R3IA 5EG3A 4GJ3A 4KIOA 4PNIA 3NRMA 3TV4A 2Q7DA 3CTQA 3Q60A 2BRHA 3ZOSA 3EQIA 4EC8A 3I5ZA 3DT1A 3E92A 4GUEA 2ETMA 3PSCA 3DLSA 5HE3A 3QCSA 3W2OA 2OLCA 4BI0A 2DZDA 4EKLA 2PVYA 3O7LD 3RTPA 3NBYB 4GT4A 2HVQA 3THBA 3FEGA 3DS6A 3JZFA 4I20A 5H8EA 1RQQA 3JY9A 1OM1A 3C0HA 3OBJA 2R7KA 4O4JF 3NIZA 2QC6A 3G15A 2PL0A 4ZAUA 3SXFA 4O22A 3UP7A 3R7YA 4G34A 4L7SA 2GNFA 4MXOA 2YITA 4RBLA 3SC1A 1ZYSA 4LFIA 3UO6A 3R7IA 3W55A 3ZMMA 4AU8A 1CS0A 4CMDA 5D7AA 3A4OX 4TYHB 5AUWA 4CNHA 1XMMA 1RJBA 4DRFA 3G9LX 4UYNA 3LLTA 1DAWA 2IZTA 2P55A 3KCKA 4FEVA 4JVGA 3R7UA 3JRWA 4UCUA 4A4LA 3BHYA 2H9VA 4USFA 3M2WA 4YNEA 3ODZX 3BHVA 2W0JA 3IONA 3VW8A 4PDOA 3NYNA 1IOWA 1GZNA 3SE7A 4UFZA 3Q53A 2XK7A 5KNJA 1M2PA 2OIQA 3F3VA 5IF1A 3D5UA 4E5BA 4DEDA 5JQGF 1ZY5A 5K3WA 3GI3A 4ANSA 3PVWA 3NW5A 3ZFXA 3DTFA 5EI8A 2E9PA 4I4EA 5C03A 4BCNA 4BCJA 2C6EA 3B2TA 1YDTE 2FA2A 5TF9A 2PMLX 5KMJA 2HDKA 3S4QA 3PJ8A 4N6ZA 3O17A 1NVRA 4JJRA 4TYEA 5B2LA 2DYLA 5I5UA 3ATSA 5J7HA 3H10A 4Q9SA 3NMUF 4RJ6A 3SDJA 4JDKA 3OEZA 2PVRA 2WMXA 1FBNA 3CP9A 3W8LA 3E3BX 1KOAA 5H80A 3F5UA 4KS8A 4FTIA 3SA0A 5KKRB 1U59A 4U0IA 1UWJA 4NM3A 3V5QA 4RLLA 5KMKA 2DABA 1YDRE 3U9TA 2OSCA 3DY7A 4E20A 5DPVA 3V8SA 5H8GA 4P4CA 5CSVA 1MUOA 4S30A 4OBQA 5GJGA 1YRPA 5J87A 4F64A 3DKOA 3HV3A 5J9LA 1ZYDA 3OBGA 2NO3A 4EK5A 5F95A 3TXOA 3UG1A 4D5KA 4EOMA 1I2KA 2NRYA 3GQLA 4L68A 2R84A 4YLLA 4IMYA 1UNHA 2FPGB 4YNOA 4CEGA 1ZYJA 3BHTA 3HV5A 4HCVA 3SLSA 3F88A 4USDA 1PX2A 5M4CA 3LFEA 1E1VA 3FZTA 4GG5A 5DBXA 3R5HA 1GNGA 4GMYA 3V5JA 4RLKA 3CQWA 3BE2A 4I50F 4ERKA 4WUAA 3ANRA 3N51A 4QYFA 4DGGA 4MXZA 1H26A 2J5EA 4ZMFA 1R0PA 4V0GB 2YIRA 3QQHA 1WRVA 3WO1A 3E8EA 3KXNA 4FEUA 2XD4A 3GLKA 3VPBA 5ANGA 2FO0A 4OTRA 5CA1F 2P4IA 4S33A 3W33A 4APCA 3A61A 4HYSA 4FODA 4MD8E 4DF3A 1UWHA 3DGKA 3O51A 4RIWA 4IAFA 4LMNA 5KZ0A 2X0GA 3FZRA 3P86A 4FVQA 1MRUA 1NVSA 3VQHA 4A9TA 1CSNA 5GNKA 1GZOA 5H8BA 4AOJA 5JKGA 3ZSHA 4CMTA 3C7QA 4MEDA 2YM3A 3H9OA 3B2WA 2W5AA 4FYNA 2XJ1A 4AW0A 4PMPA 3QUDA 2ZDHA 2JC6A 3DJ6A 4FVRA 3ZHPC 2V5AA 3WWIA 2XK4A 3QKKA 4JXFA 1FVVA 3DFCB 3LQ5A 4DE4A 1XBCA 4EZ3A 4CLJA 3D7TA 4QO9A 3LULA 5E8ZA 5BWTA 3KEXA 3MY0A 3C4ZA 4NM5A 4RX5A 3HRBA 4X2FA 5CF4A 1CQIB 3MFUA 2WU7A 4IZAA 4QTBA 3UQGA 4GU6A 4UY9A 3PFFA 4MV6A 2XH5A 4XLIA 1FMOE 4K18A 2XIYA 2WEVA 1G8KA 3GQIA 5AUYA 3KMWA 4DLIA 4F7NA 2OKRA 4TUYF 5A14A 5BUEA 1WVXA 2A0CX 4O6LA 2GNLA 2PVKA 4U42A 5M44A 2P33A 2QOLA 2R3OA 2ZYBA 4C4IA 1DAYA 2C47A 1WR2A 4QP8A 3PXKA 4FBXA 3KAKA 4TRLA 4FFLA 2VTMA 3DXQA 1LP4A 4NL0A 2PY3A 4C3PA 4MKCA 3FV8A 1OPJA 4RX9A 3COIA 1L8TA 3F3ZA 1UNLA 3R02A 3RK5A 3UZPA 4BZNA 3OS3A 4FMQA 1ZAUA 4QP9A 4F7SA 4AAAA 1SVHA 4BCPA 3G6HA 3R9HA 3PG3A 3LCOA 3QLGA 4PMSA 1IG1A 3NUXA 4YPDA 5C26A 3D5VA 3JRXA 5AUTA 4CRLA 1J3HA 3D2IA 4Y95A 2BALA 4GW8A 5DH3A 4E1ZA 2W5BA 5E7RA 3R8VA 4AX8A 3BU6A 2EU9A 4QRCA 1ZWSA 1HOWA 3EN4A 4FICA 3ATTA 2XIZA 3LWBA 3KA0A 1SZMA 3AC5A 1H1RA 4R7HA 4B8LA 3SV0A 3QTWA 3QQFA 4J95A 2OZOA 4QYEA 4YLJA 2QD9A 5BYYA 3E8DA 4M13A 4QTAA 3V5WA 4AFEA 4EH9A 5CZHA 3ZYAA 4EHEA 5KO1A 3VONA 2G9XA 1CQJB 2W6OA 3VUHA 3DBDA 5JZJA 3Q6WA 3MYGA 5AWMA 1CKOA 3T54A 2ITZA 2OK1A 3MH1A 1G8AA 2XCHA 4CKBA 2C6IA 2WQOA 3LFQA 4ZTMA 3NNUA 4LV5A 4FNWA 1VYWA 4RJ7A 5J1VA 5HTCA 4FIJA 2NP8A 4NM7A 5DR6A 5EHLA 3FY2A 2OG8A 4ZSJA 3DA6A 1YWNA 3R8PA 3ENHA 5BVEA 4BGQA 4GFOA 2WXVA 1W83A 4YO4A 1Q8UA 4FL3A 2F49A 1XH5A 5L2WA 2G2IA 3TUDA 4WBNF 4FT5A 3QQLA 2WMBA 2O63A 2WMUA 3BI6A 4YTHA 3SD0A 4RT7A 2G2FA 4EK8A 4ZTLA 3RHXA 4TNBA 4MNEA 3MTLA 2PE1A 3ZO2A 5J5SA 3UO5A 4HGTA 3R71A 3FZOA 4O2ZA 2VO6A 3MB7A 5IQAA 3BZ3A 4QTEA 3AQVA 4LQMA 4FIEA 4IWDA 2WTDA 4ZK5A 2W6ZA 2XA4A 4NTTA 4LV7A 2GS7A 5JFXA 5E8YA 3U4UA 3Q32A 4PMMA 4B0GA 5CXZA 3MY5A 4M14A 4HGSA 4EYJA 2QHMA 3QFVA 1ZRZA 3OY3A 3BG5A 5L6PA 4YUQA 3RVGA 2G01A 3S0OA 2JKMA 3BWFA 3C0IA 4EH7A 3U55A 4JS8A 4FZ7A 2BZKB 1IASA 3UIBA 4EOJA 3JZ6A 2G15A 2GPWA