4O84A

Saicar synthetase (type-1) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-1) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 71
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o84A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o84A02
2VTJA 3BBTB 5G1XA 3V8SA 3PE2A 4EKKA 4HCVA 3W32A 3BRBA 3O7LB 1IG1A 2ZAZA 3EKNA 4IC7A 4TNBA 4ZSJA 3TL8A 4FIIA 5HIBA 4O4LF 1IA9A 5CASA 2W06A 1CKIA 5AV4A 4WUNA 3PLAE 2XM9A 3EMGA 3NUYA 4MQ2A 1W8CA 2PYWA 4QMQA 2F2CB 4EOOA 4RVKA 2I7QA 4KS7A 4CCBA 4RIYA 4YO4A 3V5WA 1I7NA 3MB6A 4I0SA 5EW8A 3F7WA 3NNVA 3FEGA 4RT7A 4FKJA 4WNPA 3WYYA 4APCA 2W6OA 3HBLA 2HY0A 4F7NA 5HIDA 3GEQA 4FKQA 3IQ7A 5DH3A 3U4UA 4QP4A 3PP0A 2GLTA 3TINA 5ANJA 3LJ1A 3ZUVA 4AOTA 2JKOA 3C4XA 4EHZA 3Q32A 3ULZA 5AA8A 2ERZE 1XQZA 3TXOA 3Q5ZA 3C7QA 4IX4A 3ZCLA 5M06A 5KO1A 3I1AA 2C30A 3LFSA 3IOPA 3OTUA 4FV6A 5CZHA 2HW7A 1TQPA 2YA9A 1JWHA 5CT7A 2PL0A 3TJCA 3N8DA 3NMUF 1X8BA 5M56A 2HZIA 3A60A 3QCYA 4O81A 5KHXA 5KHWA 2C68A 4AZWA 1GLVA 4QMPA 2YAKA 3ZSIA 4O0TA 4CFWA 3TZ9A 2QOHA 4EH4A 4A06A 3KB7A 4E1ZA 4GEOA 4FU0A 2QOCA 4FSZA 4D28A 3KF4A 3QLGA 4XLIA 1Y91A 5D12A 4MF1A 2O64A 3FQHA 2BTRA 4RC4A 2ITWA 3UOKA 3D5XA 3EYGA 3LCTA 2OU7A 5AX9A 4RJ7A 3SV0A 3VRZA 4ZTQA 4DT9A 3MJFA 3WZEA 3NYXA 2BZKB 4Q2AA 2YACA 2YCQA 2E9OA 2ZDQA 3O50A 4ENYA 3DNDA 4MTAA 4F9CA 5FBOA 5DT0A 2FP4B 4U6RA 2JKKA 5GJDA 4YJOA 3D5VA 2JIUA 1I44A 2BAJA 1Y6AA 3AC2A 4EK3A 4KD1A 4BDBA 2XNPA 2ETRA 3OS3A 5J9ZA 4HNTA 5JKGA 3Q5IA 3GGFA 2C3LA 4CRSA 1VBHA 3R7YA 1CQIB 4O0YA 3D5UA 2Y6OA 3TZ8A 4CD0A 5IH6A 2J0JA 3C50A 2ZDHA 4Y73A 5I0BA 4PNKA 3BU3A 5E1EA 3HV6A 3KA0A 4PTCA 5TR6A 5IG1A 1RE8A 2W4JA 2OH4A 4PF4A 4PDYA 3O96A 2J5FA 3P1AA 2YEXA 4NCTA 4TXCA 1S9IA 1A06A 4E7WA 3UPZA 5IA3A 3UOLA 2X7OA 3FQEA 3C4ZA 3H3CA 4FIJA 3SHEA 4EYMA 1M2PA 4AA0A 3FLWA 4WO5A 4MAMA 3PXYA 4HYHA 2P2IA 4LUEA 3FMLA 4I23A 4NK9A 4CFFA 4USEA 3KK8A 2B55A 3LM0A 1JQHA 3U4WA 3QRTA 4AOJA 3UODA 2YWPA 4FIHA 5CEOA 5FRIA 3NW5A 3F69A 1U5QA 4RZQA 1PY5A 2OF2A 4RQVA 4W4YA 2VD5A 3TNQB 3CD3A 5HTCA 3G2FA 5KUPA 1CTPE 2ITQA 3E64A 5HHWA 4ZJVA 4QP9A 4ACMA 4M67A 2R3KA 4RC2A 3LP8A 3RVGA 3VF9A 4FK3A 4FL3A 5B2LA 4TNDA 5C8MA 2GNHA 4HZRA 5IDNA 2YJRA 2OIDA 5JGDA 4L00A 4G6LA 4PDOA 4C2WA 3KXHA 4RWIA 1C3OA 1J7UA 3ETJA 4XV1A 4I5PA 4BIDA 4F65A 2VTOA 1M52A 5CEMA 4ACCA 4WIHA 3C1XA 1E1XA 5CQUA 1WBNA 3AOXA 4KBAA 2C6KA 1OKYA 2VTMA 3MFTA 2I40A 4RG0A 2W6QA 2R7IA 1IR3A 2GHLA 3E3PA 4ID7A 5C01A 4CTCA 3QQUA 4XV9A 4BCMA 1B39A 1MRYA 3RNIA 3VS2A 4MXAA 4QQTA 5JGAA 4WA9A 1BL7A 4G16A 5LMAA 2WQMA 3A7IA 3PSCA 1W84A 3DBDA 5A4CA 2ZV8A 5CA0F 4IVBA 4OUCA 4DT8A 2R3IA 5D9HA 4FFLA 5EZYF 2FSMX 3R9NA 3R6XA 5E9EA 4BBMA 4DIMA 1PXJA 3OWLA 5E8XA 2CKPA 5IUHA 3PVGA 4DFZE 4FSTA 4L8MA 1FINA 4TN6A 3TUBA 5A4TA 1KE7A 4WG3A 3G0EA 4RFYA 3SOCA 5CTPA 4E5WA 3ROCA 2X2LA 3I12A 2QOIA 3ZOSA 1PKGA 2X4ZA 3VS0A 3E93A 4YAKB 4AP7A 4ZOGA 1NVRA 1VYWA 2VGPA 3FKOA 4G1WA 5EH0A 5J2UF 2VX3A 2AUHA 5ETFA 2VV9A 4HCUA 4JBPA 3MIAA 3QXPA 3R2YA 1REKA 4UZHA 3FXZA 3AD5A 4HPTE 4EJNA 4DAWA 3H30A 4JAJA 4FSUA 3FKLA 4A07A 3NNXA 2C5XA 5BVEA 4MV4A 1VKZA 3DQWA 5EM7A 2XNOA 4ASEA 4UX9A 1FPUA 2ITVA 5IQCA 5CF8A 2C5NA 1PRYA 4GT3A 3HV5A 5AA9A 2R3PA 1GGOA 5FTOA 2VNYA 5AAGA 1OKZA 3KAJA 2UW8A 3VOTA 1Q8UA 4C37A 5AUYA 2HELA 4QTAA 5CXHA 2WOTA 2CCHA 4YPSA 3LFEA 4GK4A 5CT0A 4DGMA 3DLZA 4MXYA 3R2BA 2WXVA 4G9CA 3GC7A 5BYYA 3MFSA 4GKIA 3FPMA 3H9OA 2BIKB 3II5A 3NR9A 4H05A 1M2QA 4NM7A 5LMBA 1YWNA 3P7CA 3D2KA 2W99B 4K1BA 2VAGA 3D4QA 3HLLA 2F9GA 1TQMA 5EI6A 4EOMA 3ENHA 5C26A 3MWEA 1U54A 2XCHA 3NYNA 4GUBA 4AZSA 2GNGA 1UKHA 3QGYA 2CN8A 3PZEA 3D2IA 4N0SA 2LGCA 3TIZA 4K2RA 2BKKA 3R8VA 4JIAA 4HVGA 3QF9A 5IH5A 3WZDA 4Y8DA 5HTBA 2C5OA 4B6LA 5LXTF 4ZTRA 4FTQA 4IAFA 3VBYA 3NPCA 5LWNA 3PXQA 1EUDB 3H9FA 4D55A 2WQNA 4GK3A 1H0WA 4YC8A 1YWVA 3RWPA 4EOIA 1KJQA 5HCXA 1PMEA 4MV6A 3UVQA 3MH3A 3B2WA 2REIA 1Z2PX 4W4VA 2YM7A 4KB8A 5GNKA 5HD4A 4QYFA 3L8PA 3QAME 1SMHA 1R78A 3HA6A 5CU3A 2HCKA 3NIEA 5EFQA 4FTOA 2GNIA 3OEZA 4I5HA 3VHKA 4G5PA 4O86A 4YSJA 4G6OA 1YXTA 2F57A 3DOGA 4JS8A 1EZ1A 4ZZMA 4CZUA 4IACA 4I4FA 3CCNA 3F5UA 4RA5A 4QMYA 2A4LA 3HMMA 2JD5A 4CKJA 3TKUA 3DB8A 4GRBA 2QCSA 4Q5EA 4CFNA 2WTIA 3RHKA 2J9GA 4N57A 2J2IB 2VUWA 4OTHA 5D7VA 2X2KA 3VULA 1H25A 5KMLA 3E5AA 3EQHA 5E8TA 4D4VA 2VTIA 3IW5A 3I7CA 4DA5A 3RAWA 1G5SA 1RJBA 3GCSA 2BMCA 4XOZA 4JT3A 1G3NA 2R85A 1IEPA 1JLUE 1CM8A 2ETMA 2IVUA 1OB3A 2QNJA 2WGJA 4NSTA 5FQDC 4M9UA 1URWA 4JNWA 3HB9A 2C5YA 3T9TA 4IZOA 4CCUA 1J7IA 2DYLA 3LJ2A 3U54A 2YM6A 1FVRA 1ZYSA 2BKZA 3E92A 3HMNA 4DFXE 1Q8TA 3HV7A 3WNZA 1BYGA 4B8MA 2FA2A 4XJ0A 1Q4LA 2ZM4A 3CE3A 3R02A 5BVKA 3KCFA 5TF9A 3HGKA 4JDHA 3MH1A 3POOA 4WNKA 4CKIA 4RFMA 3EFKA 2OJ9A 3IDCA 4F0FA 5A9UA 5AV1A 4XX0B 1H07A 5KMMA 3DKOA 3DPKA 2UW9A 3ZDUA 3C51A 4O7SA 4O0UA 3FAAA 5J7HA 4BCOA 2GPWA 1K2PA 4D4SA 5CF6A 5GJGA 3RK5A 2XKDA 4G6NA 4YJUA 4ACGA 4HNVA 2W1DA 5KBRA 1Q62A 4GK2A 3VNTA 2GS7A 2W1FA 3UGCA 4QQ5A 2C6LA 3E88A 4U3ZA 4BHNA 5BQ0A 2GS6A 5J2TF 3HDMA 2C47A 1B6SA 2VX1A 3RV4A 3FLNC 3W2CA 1EYZA 3R83A 1HOWA 4X2GA 1P4FA 1UA2A 3LM5A 3EQCA 4RJ3A 4YBJA 3TTIA 3ZO1A 1WBOA 2JAMA 2XP2A 3DAKA 4YJVA 4ZTLA 2CJMA 1OITA 3R8LA 2WZJA 1NY3A 5EDPA 2WMQA 2X39A 3ZRKA 4E6DA 4TYJA 1H1RA 5EOBA 4OGRA 3DKCA 4BN1A 5LP6F 4WNOA 3QKKA 2G2FA 4TWCA 2QD9A 4UEUA 2OIBA 2CCIA 3BYOA 4I4TF 1LP4A 2E9PA 1FMOE 3GC0A 5HG9A 5I9ZA 5H80A 5AP1A 4C4GA 4CXAA 3T9IA 4F08A 1WVXA 4EHGA 5AWMA 3EZRA 2A2AA 3MN3A 4O4HF 3FYJX 1J7LA 1M6VA 2P0AA 3RK9A 4DHFA 1KJJA 3R30A 4RJ5A 1Z5MA 1UU9A 3OBJA 3QLFA 3DCVA 4E4MA 2R86A 2WTDA 1V1KA 5DHJA 4I41A 4RX8A 4L68A 2WHBA 4C3FA 4FSRA 5IDPA 4YBZB 3BU6A 4U3YA 4S31A 5DR9A 1SVGA 5E91A 5LVOA 1JSVA 2W5AA 5E8YA 5HBEA 5AUUA 4LL0A 3OW3A 4J53A 1U59A 3R28A 1V0PA 2JLDA 4DG0E 2B9FA 2XS0A 2UW0A 3AQVA 3PJ3A 4WD5A 3R8MA 3LHJA 3RI1A 2GNJA 4G3DA 2GSFA 2GCDA 3TNWA 3IW4A 4M7IA 4KSPA 4U7ZA 4U9AA 3MTFA 2ZB1A 2OICA 3MVLA 5E8ZA 4Z7GA 2FPGB 3OUNB 3U87A 1B38A 2YFXA 3EYHA 4HVDA 4QPAA 3H10A 5B2MA 3HMOA 1OL5A 4A9UA 5HBHA 2GPSA 4DITA 4QMZA 2FSLX 4HVSA 2JC6A 3VWAA 3HX4A 2YL2A 1ZOGA 3M11A 3L9LA 2W1CA 4XMOA 3V5TA 3FHRA 4J97A 5DIAA 3R8UA 3TWJA 4DCEA 4YJSA 4L67A 1KV1A 3PXRA 3NUAA 4RBLA 4B0GA 4C4HA 5KX5F 5H8BA 3MIYA 4FTAA 1FVVA 4H1JA 4RIXB 5CU0A 2ITYA 1KV2A 4RWKA 4DEIA 4S30A 3KY2A 2HJWA 1U4DA 1U5RA 4KABA 4ALUA 1ZWSA 2I0HA 2HZ0A 2YCSA 3OY1A 4XP0A 3AG9A 1YI4A 3MPTA 4AW5A 2WIPA 4FT0A 3REPA 3RJCA 4ASXA 2QKRA 3OCTA 2WMVA 3GXLA 4A4XA 5LARA 4ERWA 4E4NA 1XH8A 4EK6A 2BR1A 1W96A 4YSMA 3KK9A 4D1XA 4MVFA 4WKQA 2IVTA 5C1OA 3D7TA 1G8SA 3LFDA 4X3FC 4EZ3A 4FTRA 3KMWA 2C0TA 4DFYA 3LW0A 4YC3A 5EDRA 2UUEA 2G2HA 1SVHA 3LLAA 2QO7A 3FYKX 3QTIA 4MH7A 5J1WA 3EQDA 1YRPA 5BPFA 3D94A 5IA2A 3UO5A 3DJ7A 3PA5A 3BEAA 2R7BA 3LCKA 4B8LA 5DR2A 4O6EA 4TKSA 4EH3A 5ETCA 2B53A 4K8AA 1JKTA 1Y8YA 5IA5A 4M84A 3F5PA 1T36A 2B9IA 2YIYA 1TVOA 2PULA 3F2AA 1CKPA 3PY0A 4YLJA 2W17A 4AFJA 1T46A 3SD0A 1U54B 4DGNA 3MS9A 4JVGA 4XG9A 3OC1A 5C4LA 2EB3A 4PTEA 3QGWA 3F66A 1H08A 4X6QC 5K5XA 2W6ZA 3F82A 4MD7E 3DA6A 5CEQA 3Q2MA 4EL9A 2NU6B 5LXMA 4OT5A 1RDQE 4BI1A 4AZTA 3L8VA 2R3GA 2QHMA 3FZTA 4J71A 4MXXA 2X6DA 3R1SA 4QSHA 4OR5A 4BDEA 4O7RA 4APPA 3QQJA 2JDVA 4JRVA 4BCIA 3VMMA 3PG1A 4IIJF 2YM5A 3PIXA 5JFVA 5FXQA 4TWOA 5KX8A 2NRUA 1UKIA 3H9RA 1MQ4A 2IZUA 2W9FB 3IW7A 3UG1A 5JZJA 2XBJA 4O21A 1V0OA 2VWVA 4F70A 5ANEA 4RIOA 3DS6A 3PJ1A 1MRVA 4TYGA 1H01A 3OWPA 1J1CA 2DS1A 2JAVA 3QWKA 5EM5A 2IZTA 4F63A 2UZWE 2IVSA 4PV0A 3RM6A 3F5XA 3PFQA 4GL9A 3OCSA 4FTLA 4TT7A 3ORRA 4AAAA 3SQQA 4ORKA 4EGQA 4FT5A 2R3LA 2CN5A 3QX2A 3ZLXA 1E1VA 1ND4A 1XR1A 1ZYDA 4YB8B 4L9IA 2CDZA 2UZUE 4CZTA 3PSDA 5H8GA 3PIZA 5DN3A 4TYIA 1XH5A 3LZBA 4YNOA 4ZMEA 5JH7F 5JT2A 4TL0A 4RX7A 3KEXA 5IEVA 4FKUA 4HNFA 5HD7A 3RHXA 3CQWA 5D7AA 3COKA 3M1SA 3MPAA 3DKFA 4JG8A 4GFGA 4HPUE 5L2TA 1KOBA 1GOLA 4XCUA 3Q60A 5CF5A 2NP8A 4FTUA 4H3QA 5C8YF 4K0YA 3O2MA 4QMUA 3V8TA 3VVHA 5HG5A 2BAQA 2PMLX 3E7VA 4L3LA 4MEDA 4ZSLA 2PZYA 5LCJA 4O4JF 1JBPE 1YI3A 3PJCA 3FY2A 3H0ZA 4MBIA 1PF8A 4QNAA 2PZ5A 2H96A 4EK4A 3EN4A 5CWZA 5BYZA 1Q61A 5D41A 2PTKA 3BQRA 4PMTA 2X9FA 4A4LA 4DH7A 3HA8A 3LMIA 3U9NA 1DAWA 4K33A 2OJGA 4O7LA 4ACHA 3DFAA 2B1PA 1H1WA 3HAMA 1O6KA 3FI2A 3R00A 3NW7A 4BYIA 3SXSA 3PXFA 4I93A 4J1RA 4BDHA 3O23A 2QU6A 3FUPA 4IIRA 4FFOA 4UYAA 4BCKA 1CS0A 4XYMB 4W8EA 1PKDA 2A19B 3AT4A 3D83A 2PVFA 3PA3A 4C4IA 3SE7A 2IZRA 2XEZA 1L3RE 3JR1A 4UB7A 4BDIA 4ALVA 4NIFB 3KL8A 4C3PA 4DBXA 3VUGA 5IEYA 3UNZA 3R04A 4JQEA 4YURA 4DG3E 4EQCA 3D7ZA 2V62A 3V3VA 3TT0A 5EYMA 3BLRA 3F3UA 3F2NA 3KMMA 3ODZX 5BVDA 1Z2OX 4MNEA 3DNEA 1XKKA 2G15A 2Q0BA 1GSHA 4Q9ZA 1UV5A 5DGZA 2PVJA 5KKRC 1WVWA 4IAIA 3DTCA 2YN8A 3NW6A 4IX3A 3G9LX 2YIXA 4L7FA 4UXLA 4Z9LA 2VNWA 5EM8A 5C27A 3DQXA 4QTDA 4BCPA 4JIKA 3NS9A 1NXKA 3PJ2A 4GFOA 4KNBA 1OL7A 5FLFA 2AYPA 3TJDA 4IJPA 5FG8A 5AJQA 5KBQA 2XM8A 3R8ZA 2XK4A 3NAYA 4ZSGA 2B4SB 2G1TA 4CT1A 5EDQA 4PMSA 3SG8A 4EH2A 3IDBA 3ZU7A 4EZ7A 4A9TA 3TNPC 3I0QA 4B9DA 4D58A 3JS2A 4NKAA 2ITOA 4ASZA 2P55A 4YZMA 5T3QA 4ITJA 5HO8A 4AWIA 4EOKA 2V7AA 2B7AA 4BICA 5KMKA 1R1WA 2I80A 5GIOE 4ZS4A 3EQFA 3QRIA 3SA0A 3C4FA 3OTVA 4MV9A 5AV0A 2GNFA 5H2UA 3OWJA 4USFA 5GONF 2GQGA 2QOFA 4ZTHA 5CVHA 1NT2A 3D5WA 4ZY5A 4XBRA 4FIFA 2IWIA 4JBVA 5DWRA 5FM2A 3MWUA 3LFQA 4ZY4A 3FMNA 4O96A 1M14A 2FVDA 2HY81 2QU5A 3CIKA 4JXFA 4C3RA 4BDFA 2XIYA 3QUEA 2ZV9A 5CB4F 3AMBA 2GTNA 3BCEA 5HLPA 3OCBA 4AZEA 3AW8A 1T45A 4D4YA 3F3TA 3VPBA 5AP2A 3ORXA 4LGGA 5BNJA 4DH5A 3POZA 1FGKA 4RPVA 3A7HA 4EBWA 4F0GA 3JVRA 3G33A 4G3GA 5HGIA 3A8WA 3KRWA 3P7BA 4P5QA 2I1MA 2V5QA 4RGJA 4BZOA 3DF7A 5ANKA 4J8MA 4O38A 2R3FA 4G3CA 4I94A 3SAYA 5ANOA 2BALA 3A62A 1RW8A 2ZDUA 4LV8A 3OW4A 4DG2E 4B99A 3Q6UA 3JY0A 4IWOA 3MJ2A 1P14A 2R3RA 3NYVA 4QTCA 4DE4A 4ZLZA 5G6VA 2LAVA 2ITPA 2RG6A 4F6WA 5JFWA 2QVSE 4R7HA 4BIEA 3M2WA 2YZMA 3VUKA 5J9YA 4FL1A 4TWNA 3UDBA 2F2UA 3UIBA 5A3XA 2OW3A 5IUIA 4RIYB 4GW8A 4O0VA 4P2KA 3VS4A 4BHZA 2W1EA 4GG7A 4WOVA 3LPBA 2FSTX 2VWZA 2YABA 4ZTMA 1JKJB 1HCLA 3HMPA 1Z9XA 5CYIA 5L8JA 2E9UA 2GFSA 4GT4A 4B7TA 4IAAA 4C33A 5L6OA 4G9RA 3ZC6A 4GKHA 3PSBA 2UV2A 4OBPA 3UQCA 1YXUA 2A1AB 3DBCA 1UNLA 4IVDA 4FEQA 3MY5A 5IU2A 3CTHA 3CP9A 4OTGA 2CKQA 3PXKA 3EH9A 3BHVA 4AT5A 2ESMA 2C1BA 3H4JA 4GYIA 4GFMA 5BYLA 4EWHA 4ZLOA 5JSMA 3JZIA 3CLYA 2IG7A 4KWPA 4UN0C 4IB5A 2V58A 4IMYA 3FWQA 1R0EA 3U51A 4Y5HA 1REJA 3FLSA 5BVOA 3LVPA 4BCHA 3AC3A 5HZNA 4A9YA 4PDPA 3JRWA 4O7TA 3F7ZA 1IAJA 3KAKA 1XWSA 4FKPA 4CG9A 3ZC5A 1E9HA 5CZIA 5M51A 2VPQA 3OD6X 1GIIA 4XG7A 3NZ0A 2W96B 3WOWA 5JVDF 4AF3A 5FDXA 4Q5HA 3U9TA 3O8TA 4QMXA 4BGQA 3QYZA 4C36A 4NZWB 4ARKA 5CAOA 5FEEA 3IK3A 3TZ7A 3I5NA 2NU8B 3R9HA 3F3VA 4FKVA 3VUHA 2P4IA 4D0WA 3BHYA 3EQBA 5IQHA 2CPKE 3FPQA 4I55F 4I20A 4M69B 4E8AA 3RP9A 3ZEWA 3Q04A 3CJGA 4EKLA 5IYZF 2RFDA 3MBLA 3QHRA 5AMNA 5K5NA 3UYTA 4UXQA 5I9WA 2VQDA 2VTTA 5KKNB 2BHEA 1AGWA 4ZTSA 2A27A 3OP5A 4FEWA 1YWRA 2WTKB 3D7TB 3HUBA 3MESA 2O8YA 2IW9A 3MPMA 3NAXA 5DLSA 3RK7A 4FYOA 1CQJB 2R82A 4F7JA 3ZM9A 3AMAA 5JK3A 2UZNA 4BI0A 3BV2A 2OI4X 1URCA 4YTCA 1BNCA 5HNGA 2PVLA 5KE0A 2HOGA 3Q4CA 2C6IA 2B54A 4I3ZA 4D1ZA 4E4XA 5DEYA 3SRVB 2ZYBA 5DNRA 5JQ8A 4S2ZA 5C9CA 4RZVA 4L6QA 3P08A 3Q2JA 4YTFA 2I87A 3ELJA 1FGIA 3A2CA 4UZDA 3QC9A 5HIEA 2BHHA 3GNIB 3OEFX 4FI1A 4OTIA 2CLQA 4MX9A 2G2IA 2ZMDA 3SXRA 1PXLA 3LQ8A 2ITNA 3QX4A 1ZXEA 4JRNA 5IH4A 4HYUA 3TM0A 4NYEA 2YDIA 4JDIA 3HP2A 4LL5A 4YLLA 3QC4A 3WE4A 2QO9A 5CSPA 3S1HA 4H3BA 3UVRA 2PY3A 3SG9A 3KXNA 1M17A 2PUIA 4Y72A 3QRKA 4DEGA 3EQPA 1GZOA 2I8CA 5AP4A 2Z8CA 3VO3A 5K4JA 1KBLA 2BDJA 3KALA 3NCGA 4II5A 4UALA 4IZYA 5E90A 3UMXA 1JVPP 3COMA 4HYIA 3VUMA 3ZFXA 5AADA 4DLJA 4BKJA 4FVQA 5L6PA 5HCZA 3PWDA 2C6DA 1K3AA 3P9JA 3PP1A 4MV7A 1XBAA 4HNIA 4R1VA 1XBBA 3F6XA 2X4FA 2C00A 2DZDA 5D8DA 5HBRB 2CGWA 3ID6C 5FNVF 2PZRA 2FB8A 4UBAA 5CU6A 2NO3A 2CMWA 2OSCA 2QO2A 2IW8A 1XHAA 4CV9A 4FTMA 2UZBA 2DWCA 3FMHA 4FT3A 4FKGA 1J3HA 3MSSA 3EN6A 5F94A 4FC0A 4HW7A 4NTTA 2ETKA 2VWXA 4MKCA 3ZEPA 2EUFB 4PP9A 3EWHA 4MA0A 2R3NA 3BZ3A 4TV8F 4DBNA 4EYJA 5K3YA 1UNHA 4O22A 3DK7A 4E6CA 2FSOX 1CSNA 4H36A 4FV4A 4U42A 4TRLA 4MV3A 4E93A 1SVEA 4E5BA 4LYNA 3VBTA 3HECA 2XJ1A 3MA3A 2EB2A 4XBUA 3W18A 3CPBA 4AT3A 4FV3A 5KZIA 4F6UA 5HX6A 1JOWB 2JDSA 3CTQA 3CKXA 3BPRA 4IB1A 4USDA 3R7OA 3NUXA 4AA4A 1WZYA 4QP2A 1QCFA 4BDAA 2YYAA 5F9EA 1R39A 2XJ2A 4NTSA 1GY3A 3V5QA 3KRLA 5L8LA 3KN5A 4BI2A 4EC9A 4YJQA 1QL6A 4QPSA 4PWNA 1H8FA 1G8AA 2XZSA 3VJOA 2I0VA 4NWMA 4O84A 1E4EA 3VBVA 4O0RA 3QUPA 3TDVA 3G5DA 3PUPA 4M0ZA 3QD0A 5I9VA 4FKWA 3FI8A 3LXPA 4BR3A 4EBVA 3LMHA 3MFUA 3UC4A 3W2RA 1WBTA 2VWYA 3O0GA 3BYMA 3CR0A 5AP6A 3IPHA 3SOAA 3HZTA 4EGJA 4MNEB 2XIXA 3E63A 4MBLA 4E20A 1A9UA 3G15A 2QF7A 4A9RA 3CSVA 4RLKA 1BLXA 3RPOA 4CT2A 3QALE 3VIDA 5CALA 2GTMA 2BRHA 4CFMA 4XNEA 4AGCA 2C1AA 3EOCA 4GS6A 5L2WA 2Q0NA 1DI9A 4C7TA 5CNOA 2GS2A 2Y8OA 4X2JA 4FZFB 2X8EA 3PLSA 3EN5A 3HL7A 3QA0A 4IVAA 4C0TA 4ZLYA 4L1KA 3C13A 3QTXA 4DTBA 4X2NA 5M09A 5J95A 4GVAA 4C35A 3QKLA 4WNMA 3DBFA 1O9UA 4UWCA 4XYFA 4RC3A 4P5ZA 4EEVA 2X1NA 4L42A 3QQGA 1Q3WA 4V05A 3OUKA 4O7NA 2JIVA 3U9SA 3HV4A 5TKDA 3UMWA 3AD4A 2UZEA 2XUUA 4XEYA 4XG8A 4YJNA 3I6UA 2W1ZA 3K5VA 1ULZA 3L8SA 2WELA 4IH8A 5LYJF 3FSKA 3PG3A 4PL5A 5J8IA 5C8NA 3OUZA 2R7NA 3QTZA 5LQFA 3JY9A 3LCDA 5KNJA 5DE2A 1JLLB 2R3MA 4DTKA 1WAKA 5I9XA 2R84A 4O4IF 3JZFA 3IGGA 4OBOA 5IQAA 4I4EA 4D9TA 3ZO2A 4EH7A 5LVPA 3Q1KA 2C0OA 3GOPA 2OLSA 4H3PA 2QC6A 3HUCA 4FKOA 4DTAA 4I1ZA 2VN9A 3FC2A 4X2KA 3BHTA 3QD2B 1ZZLA 1PXKA 3P0MA 4YUQA 4OTWA 3ATTA 5B2KA 3U6JA 4MK0A 4NM3A 2PVPA 3EJ1A 3Q9ZA 4DEEA 2Z7RA 4E26A 2XCKA 1KE5A 4KRDA 2J51A 4AX8A 3LLTA 2CNQA 3BX5A 3HAVA 4HR7A 4IFGA 3QCSA 4FBXA 3QTQA 2R9SA 3VS3A 3AMYA 4F7SA 2Z7LA 1ZY5A 1JSTA 1Q5KA 1UU8A 3FJQE 4KKHA 4QTBA 1GJOA 4FV8A 4BBFA 4FG8A 3OBGA 3UO4A 2O0UA 4QP3A 3TV6A 4YJTA 2QOKA 3KF7A 2WMWA 3OXIA 5LWMA 2R0IA 4L7SA 2HIWA 3HRFA 4WUAA 2DIKA 3I60A 2RG5A 2BDWA 4TUYF 4XG4A 3LXNA 2WNTA 5HORA 5JQGF 3CTJA 1W7HA 3IECA 4FV7A 3A7JA 4MAOA 5TO8A 4AGUA 5IQEA 3F3WA 3HO8A 3KXXA 2V0DA 5M44A 1ATPE 2C4GA 3FL5A 4D2RA 2W71A 2J5EA 5T6KA 2HXLA 1MP8A 3W10A 3CQEA 5JMSA 3S4QA 4ALWA 4O0SA 3NWWA 4AGWA 2J6MA 1Q3DA 4DFLA 3K3IA 3AC5A 1QPCA 5BPYA 2FO0A 2IPXA 2YW2A 4UV0A 2X8IA 4ZS0A 2QG7A 2J9MA 5IA0A 1BI7A 5EKNA 3FHIA 3G0FA 4KIQA 4DEAA 4X0MA 4N6ZA 4XLVA 5CF4A 5IPJA 5GINE 4ENXA 5KCVA 4NUSA 2VGOA 3BI6A 4PNIA 3BEGA 2QLUA 2UZVA 2B9JA 4XRLA 5AM7A 2FGIA 3UPXA 5IQDA 2YIWA 4FG7A 4L46A 4FSWA 4I6HA 3DB6A 4BDCA 2QURA 3E3BX 4IHJF 2I6LA 4ZHQF 3L8XA 3FE3A 3BGPA 4KKGA 3TUCA 3BLHA 2DWBA 2ZM3A 3LFCA 4L3PA 4A7CA 4CV8A 3ZSGA 4F09A 1AQ1A 2E2BA 4JR7A 3FZSA 4RVLA 3WZUA 4PMPA 3ZYAA 4FGBA 4FV2A 4RZWA 2JKMA 2ZDTA 4BC6A 3DJ6A 2WMXA 3BV3A 3O17A 1FMKA 3G90X 3O8UA 3KKVA 2J0MB 5E7RA 3MDYA 1W0XC 2ZV2A 3W16A 3ZFYA 2BCJA 4FG9A 4PUZA 4U0IA 2X6EA 1YHVA 4YJRA 3Q9YA 2XIRA 4J98A 4ZQIA 3DXQA 3GCPA 2UVZA 3AXWA 3DAJA 2JGZA 2RIOA 3U6IA 3Q4ZA 2CGXA 3MFRA 1WMKA 2GMXA 4GJ3A 4AN2A 5CSXA 2Z7QA 2VTPA 4FIGA 3LXLA 4IB3A 4ZZNA 4DLIA 1V0BA 4XZ3B 3FMEA 3KQ7A 4QMOA 3GU4A 1AD5A 5DBXA 3LFNA 3NVKI 2J50A 3NUSA 4QNYA 3TDWA 3V51A 2WQOA 4FEXA 3BQCA 2WD1A 4HGTA 4D5HA 3VRYA 1ZRZA 2ZVAA 4QMSA 3F5GA 3HP5A 1OECA 4FUYA 4U5JA 3AGMA 1OIRA 5E4HA 1APME 4EWQA 3G8DA 4NU1A 3VHEA 4EOSA 3HEGA 3C0IA 2BIYA 4I0RA 3FZ1A 1PMUA 2C6TA 2ITXA 4C2VA 2BFYA 2J4ZA 4J96A 2YZAA 3ZRMA 3ZRLA 4Z55A 5HE0A 5C03A 3ZUUA 4GJ2A 2FPPB 4FNYA 3WBLA 5H3QA 4FEVA 3Q96A 4YJPA 3ROYA 1J91A 2B52A 4JG6A 3RPSA 4AOIA 5IISA 3F9NA 2H9VA 2VX0A 4I50F 4AW2A 4ASDA 5CAUA 3GU6A 4IW0A 3OOGA 5CENA 3TI1A 5KMOA 4DEBA 2C3IB 4XH6A 3UTOA 4BDDA 3QQKA 1FQ1B 1VBGA 2G9XA 3DKGA 3QCQA 2UW6A 2PUNA 4RVTA 3W8LA 5BX0A 4FTNA 4RSSA 3UZTA 3PA4A 1E4EB 3E62A 4PX6A 5A4LA 5GIPE 4M8TA 5CSHA 4BCGA 2FH9A 4TV9F 4A4OA 4CLIA 3OFMA 4D2SA 5ICPA 2JIIA 3PZHA 1YHSA 2O63A 4K18A 3L1SA 3GC8A 1WBSA 3FV8A 4UY9A 4PDSA 4XP3A 4FK6A 2QOQA 2WMSA 4YAJB 2CLXA 3W2OA 3UZRA 2ZDGA 1M2RA 5HU9A 2XKEA 2WKMA 3B2TA 3MTLA 4I24A 3ANQA 3LKMA 3UO6A 4O2AF 3IW8A 3E87A 4IZAA 5E8WA 1DI8A 3OHTA 4ZAUA 5CEIA 3SX9A 3RKBA 4F6SA 2VWIA 5FDPA 2JBOA 4JBOA 4J95A 1W83A 4I92A 2YRXA 3AX6A 1P4OA 4BTKA 1P5EA 5F1ZA 3TN8A 5IQGA 5J9LA 4YJ3F 2WPAA 3QD3A 4MQ1A 3R21A 2CGUA 3ALOA 3GP0A 3PIYA 5HV6A 3QBNA 5BVNA 4YHFA 5AX3A 5IZFA 2YDKA 4DFNA 5JRQA 4NT4A 4FZ6A 2OGVA 3GIDA 3KFAA 2JKQA 1P2AA 4MCVA 4R7BA 4XX9A 2BZIB 1KJ9A 2XKFA 2WEIA 4LGHA 4M13A 4R5SA 2XRWA 3GT8A 4LQMA 4QMTA 3LWBA 3ORQA 2WU7A 4G17A 5EQPA 1XBCA 5HCYA 3FSFA 2XIKA 3MY0A 3TZMA 2IVVA 2I0EA 4M15A 2QOBA 2WTCA 3E8NA 3L9MA 3VW6A 4D0XA 3V6RA 1PHKA 3WILA 2W0JA 1H27A 1NA7A 4AFEA 4CQEA 4S34A 5J87A 2WTJA 5DG5A 5DPVA 2UW4A 4PL4A 5IMXA 5M4CA 2PMNX 2JITA 3G6GA 3Q4TA 4YTHA 5DVRA 4QO9A 4ACDA 3P78A 4ZJJA 4PTGA 3RGFA 2VTSA 4P90A 1JKKA 2VO0A 3OVVA 3PVBA 1DM2A 4YZBA 4YZDA 5AUZA 4DFUA 4TY1A 3ZLWA 3ZM4A 4MNFA 4IDTA 4BRXA 3F3ZA 3RINA 5AV2A 2RFEA 3PXZA 3LFAA 3Q9WA 2IZSA 4I6QA 4JI9A 2WQEA 4RRVA 3D15A 4YNEA 5EM6A 3UNJA 4BCJA 3FLZA 4CNHA 2CZGA 4E5AX 3QFFA 3LE6A 3TV4A 3TIIA 4J8NA 3KGAA 4NM0A 3K3PA 5JH6A 1GSOA 2GNLA 1H1PA 3QWJA 4DH1A 4E6AA 4NKSA 3CKWA 4FSQA 4F7LA 3MH0A 3SW4A 3DLSA 4E73A 2BILB 3LQ5A 1SYKA 3QZGA 3FLYA 4S33A 2R3OA 3WF6A 2YM3A 3WF9A 3CEKA 3SDJA 2X0GA 4UWYA 2YITA 1Y6BA 3F61A 1CE8A 4BB4A 4R1YA 2Y0AA 4OBQA 4X6RA 1DV2A 3VBXA 1LEWA 5CLPA 3IGOA 5AAEA 4ANLA 4FKRA 2CHLA 3BYVA 4HGEA 1OIQA 2CNVA 4CSVA 2GHGA 5L2SA 3KN6A 1PK8A 2VTHA 3NLBA 1STCE 1GNGA 3WZKA 4JQ8A 4W8DA 1XH4A 3QQHA 4P7EA 4RJ8A 2HXQA 1JNKA 2SRCA 5AIKA 4X3JA 5AEPA 1WBWA 1KWPA 4M12A 2UW5A 4IX6A 4Y83A 2R5TA 4IHPA 4G3EA 3ORLA 5I9YA 1UVRA 2WMUA 3WF8A 4AQCA 3GC9A 1ZAOA 2RFSA 4GSBA 3DK3A 5EKOA 4QP6A 3BWFA 3ZONA 2YM4A 2GDOA 4V04A 4EHVA 4EI4A 3MYGA 2PPQA 2IO6A 2PVNA 2VWUA 5JN2A 5L3AA 5M4UA 4R7IA 4ZSAA 4Z7HA 2BUJA 4PL3A 4TTHB 4F9YA 3V4SA 1Q24A 1JSUA 1PYXA 4F1OA 3AC1A 1SNXA 3HVCA 4FL2A 4TYHB 4ANBA 2J7TA 3ETAA 4BZNA 1LPUA 1JKLA 1I09A 3WE8A 2XVDA 3EN7A 5K9IA 3ZXZA 4DINA 2QK4A 2W1HA 2QLQA 4Z16A 4X3FA 4F9BA 1ZARA 3WYXA 3KVWA 3P5KA 4G3FA 2RL5A 2B0QA 5DEWA 3MY1A 1Y57A 5EYDA 4BDKA 4ZJIA 3V8WA 4BGGA 3ZHPC 4GG5A 2RFNA 3CD8A 4F99A 2SCUB 2R2PA 4IAYA 4C59A 4YU2A 5CXZA 3HKOA 4O2BF 1O6YA 3HRBA 3UYSA 3GLKA 2PVHA 3A7FA 3BELA 3WO0A 3MI9A 5CY3A 2OZAB 2UZDA 3EFWA 4NW6A 4C61A 4B4LA 4OW8A 3NNWA 3C0HA 3ANRA 4UYNA 4TZRA 3SW7A 4BF2A 2R4BA 3NVMB 2CGVA 4AW0A 3I4BA 5CVGA 2OXYA 5HKMA 3GI3A 4CGAA 1KEEA 4U8ZA 3K54A 3ZBXA 4I5MA 3ULIA 3D9VA 3WI6A 2X8DA 3RPRA 5DFPA 3V4ZA 4JOAA 5E1SA 1ZOHA 2NPQA 5BVWA 3W55A 4C38A 4FGRA 2OWBA 5EQYA 3UP7A 4AN9A 4C4FA 2Z02A 3O8PA 4M14A 4BGHA 5BPHA 3BKBA 2O3PA 3E5NA 1L8TA 1HCKA 3K5UA 3L9NA 5AUWA 3ZO4A 5BUIA 4KIPA 3E8CA 4R3PA 3KC3A 1ZOEA 2JBPA 4KS8A 3BIZA 3NIZA 1WCCA 4CMUA 5JFXA 2P0CA 1OVEA 3FI3A 4QP1A 5EHYA 3N4TA 3WIKA 5DA3A 1KJ8A 3VPCA 2JFLA 4EOJA 2FB9A 3RTPA 3OZ6A 4EHEA 5TOZA 2VO3A 2IN6A 3ZMMA 2PE2A 4AN3A 4FFPA 2W1GA 5E8SA 3THBA 1IOWA 4FFMA 4G31A 1O6LA 3RAKA 2QOOA 2YERA 4F4PA 1EH4A 4IANA 1LEZA 5AM6A 4CFVA 5ANIA 4EH8A 4FYNA 4IE9A 5KMNA 3ORKA 3T3VA 2WU6A 2XRUA 1OUYA 3NCZA 4FV1A 2Y4IC 4YZNA 4D5KA 2R7LA 1QPDA 4JBQA 1BXRA 5HLWA 2EU9A 3R0TA 4D4RA 2C6MA 4AACA 3GQIA 1XJDA 1R3CA 5JEBA 5C1QB 3WZJA 2YIQA 3WARA 4TW9A 3NUNA 2PWLA 4U81A 4IADA 2NUAB 3R7IA 4ME6A 1JDBB 3OCGA 2UZTA 1WVYA 5CI7A 3NDMA 3IONA 4BZDA 3QTSA 5I4NA 4Y46A 3BG5A 1PYEA 2RF9A 5CI6A 4YP8A 3QYWA 5LCKA 3V6SA 4HNUA 4XG6A 4YTIA 3DBQA 2DUVA 3QQFA 1VZOA 2E9VA 4OLIA 3KREA 1IAHA 2ACXA 4C02A 5FD2A 2PVRA 1YXVA 5HG8A 4LOOA 3N9XA 4FX3A 2VTAA 4O2ZA 2EXCX 3AC8A 1YHWA 5C1PA 3BGZA 3IKAA 4RWJA 2IJMA 4FA2A 4KA3A 3QD4A 4MV8A 3UIXA 1PXNA 1J1BA 1H0VA 2C6EA 3KU2A 1OL6A 3NX8A 3QZHA 1JAMA 1UU3A 4QTEA 5D11A 3PTGA 3WO1A 3I81A 3DZQA 4QMVA 5LMKC 5M4FA 2X0SA 4FSMA 2R7KA 4BVUA 4BDJA 3HRCA 5FP6A 3IG7A 4GMYA 4PP7A 4FVPA 1QPJA 1YXSA 5BUEA 4WG4A 4FZDB 3GCUA 4N4SA 3C4EA 3FXXA 1WBPA 5KKRB 3CS9A 2PSQA 2XK8A 3ET7A 2R64A 1JKSA 3R1YA 4O7VA 4AW1A 4CRLA 3CXWA 3VUIA 2W6MA 2EXMA 3EIDA 2C69A 3IOKA 3FZOA 4TYEA 2X2MA 5HE3A 3FY0A 4R6VA 3ZO3A 3DTWA 2X81A 1SM2A 2AC3A 2OBJA 4DYMA 1H1QA 4S32A 4ANSA 5HQ0A 3R5HA 4CTBA 4PRJA 4OTRA 2BZHB 4ITHA 5JFSA 1WR2A 3QTWA 4AZFA 1MQBA 2WMTA 3DBEA 1OBDA 4JDJA 5CVFA 1EUCB 3PPJA 1ZMVA 2J0IA 5HVJA 3GU8A 2NU9B 4AXAA 1CKJA 1YDTE 3BBWA 3ZLSA 4AA5A 4BCQA 1PMNA 4L52A 2QOLA 3NGAA 3SC1A 4C4JA 4MA5A 2R0UA 3RAHA 3NEWA 2OFVA 1TKIA 2J0LA 3DXPA 5DT4A 3ORTA 2V55A 1OIYA 5BMSA 3UVPA 4HQ6A 3F88A 3W8QA 2OJFE 3KRXA 1GZKA 4LOPA 1Q97A 4PY1A 3GQLA 5BVFA 4GVJA 4BDGA 4IZ7A 3EFLA 3VBQA 2VU3A 1H1SA 1JPAA 1KOAA 3QZFA 5AV3A 5KMJA 3EL7A 4L44A 3R9RA 2Y9QA 2VWWA 2XYUA 2YAAA 2NRYA 2HZ4A 4LOQA 1KE8A 4I21A 1ZMUA 3ENMA 3GBZA 2WTVA 4J99A 3ACKA 1NVSA 2UZLA 4E6QA 1ZMWA 3KRRA 5DT3A 1Z57A 5EI2A 3R23A 3P7AA 3KXMA 4I5CA 5CEKA 2C3JA 2OJIA 2OZOA 3A7GA 3DU8A 3MGYA 5EK7A 5EW3A 4HGSA 3SGCA 2W05A 4QRCA 2R3HA 4QYEA 4QQCA 1F3MC 4LUDA 2OZAA 4IM0A 5DRBA 4U45A 2OIQA 2XEYA 5IA4A 5AFVA 3Q4UA 3PRFA 5GJFA 1VJYA 2XK9A 5CANA 3UFXB 4NFMA 5LJJA 3B8RA 2PUPA 1CDKA 4E4TA 4IM3A 4BTFA 4CLJA 1SCUB 4X2FA 2WMAA 1FBNA 1Q8WA 3D0EA 5EYKA 3UBDA 2XNGA 1MRUA 2Y7JA 4O7YA 2GFCA 4X3FB 5IUGA 1DV1A 4UWBA 5A46A 2H8HA 2HYYA 3R7UA 1FOTA 2HK5A 3IS5A 2VO7A 3ALNA 1F0QA 3NUPA 3GCVA 4JR3A 4I22A 3ZLYA 4TYHA 3GU7A 4U40A 3VS6A 2PMOX 4YHTA 3BWJA 4DH3A 1VYZA 3F2RA 4IJ9A 4E4LA 2O65A 1K9AA 4KRCA 5IQBA 3W33A 5M08A 5ETAA 5FTGA 2CKEA 2WOUA 4GCJA 2W70A 4BTJA 5HBJA 3T8OA 1YOLA 3TTJA 4EOPA 3V5JA 2ZM1A 5HNIX 3FZRA 3GVUA 3I79A 4ZP5A 4FTIA 4Y8VB 4YJ2F 4FZ7A 3QRJA 4WG5A 1ERKA 5LVLA 2Z2WA 3NYOA 4MD8E 3BHUA 5JRSA 3Q2OA 3H0YA 1ZYCA 3N4UA 1UNGA 4JL9A 4FTKA 4FNXA 1IASA 5FEDA 5CAPA 4ZK5A 4IM2A 2X9EA 2GQSA 3TIGA 2R87A 3G8CA 2JDOA 3DJ5A 3DDPA 3C0GA 4G34A 1OIUA 4FT7A 2X7GA 4O91A 4KAOA 4V0GB 5FP5A 2VRXA 3UC3A 2XD4A 4ZMFA 3JXWA 4GIIA 1PXOA 5CX9A 5AP3A 4KSQA 4LRMA 2UVYA 3NSZA 2HAKA 3HV3A 4MXCA 3R01A 1WFCA 5ACBC 3ZUTA 2Y4PA 4FVRA 3S00A 3ATSA 3TV7A 4HOKA 4L45A 2G01A 4K11A 3TW6A 4AZVA 2BDFA 3RZBA 3R9OA 3FL4A 4K6ZA 1AUVA 3DZOA 4IC8A 4FV0A 5IQIA 1YI6A 5ACKA 1Q99A 3ZXTA 2XMYA 3OXTA 2C3KA 2QI8A 2PZPA 4HYSA 3KULA 3ZZWA 3BE9A 3OT8A 4X21A 3Q53A 3I0OA 3QHWA 4FODA 3I5ZA 3KXGA 4JG7A 5CSVA 4CMOA 4EK8A 1YVJA 2CNUA 2W4OA 3RMFA 3QA8A 4RIXA 2XNBA 3RPVA 4FEUA 1Z2NX 5HICA 3PPZA 3ETHA 4RFZA 4RIWA 4NJ3A 3HYHA 2OLCA 5ANDA 5HNBA 3LQ3A 3PDTA 2C0IA 4JX7A 4MYGA 4ANQA 4IBMA 3PRIA 2PN1A 3QZIA 3VW8A 3MVMA 3R1NA 4LMNA 4QYGA 4D1SA 3E8DA 3GFWA 4EONA 4RMZA 1OKWA 2W5BA 5EHLA 2R7MA 2EVAA 4KBCA 1SNUA 2ZOQA 3K2LA 5DYJA 2XJ0A 2XH5A 2W1IA 3CBLA 1AUXA 5HEZA 3LOKA 4L3JA 1S9JA 2P3GX 4CG8A 4M68A 3V01A 5C4KA 4RJ4A 1PMVA 2GQRA 4Y85A 4WRSA 4EG0A 3C5IA 1DS5A 1UU7A 4R77A 1PW2A 4AT4A 2IP4A 3KRJA 4FSNA 4LRKA 2KULA 4L01A 4DN5A 2YS7A 1A9XA 4C58A 3OOMA 3SLSA 2BAKA 3CGFA 4BCFA 2YZGA 4LV5A 3FMKA 3L9PA 4XG2A 4RVMA 3TNIA 4X7QA 3UIUA 1PX2A 3DK6A 4IFCA 3O51A 4LRJA 4O0WA 2WO6A 4XS2A 4FKLA 5CSWA 3RM7A 2PMIA 4FUXA 4TWPA 2WMRA 2BVAA 2P2HA 5DOSA 1FVTA 5JZNA 4AGDA 5CA1F 2XK7A 3VS7A 5L2IA 5F95A 4FKSA 5HG7A 5FXSA 4EH5A 3CC6A 1YDRE 3LJ0A 2P33A 3VJNA 1KUTA 3ORPA 4OTFA 3CPCA 4U43A 4YPDA 3GU5A 4KUJA 4EH9A 4JQ7A 2XA4A 2ITZA 2PK9A 4QP8A 3UNKA 4ZTNA 2JDTA 4R5YA 5M07A 5AUXA 4O7WA 5GHVA 5CAVA 4EQMA 2CKOA 1UWHA 2NNWB 3ZZEA 1Q8YA 3COIA 3PPKA 3U55A 3S95A 4EUTA 2XK6A 1H26A 1XH9A 1GIJA 2FPIB 3LFBA 3BYSA 2IW6A 5LMKA 2AC5A 3R22A 5EHOA 2OKRA 3PVUA 5A4QA 2YRWA 2O2UA 4K9YA 5J5SA 3C9WA 1KE6A 4K77A 1M0WA 2W6PA 5FGKA 2V59A 4WBBB 3KCKA 5HI2A 3KVXA 4KBKA 3CGOA 4RA4A 1M7NA 1BMKA 4IAZA 3IW6A 4QP7A 5AUVA 5A14A 4MXOA 2F49A 2O5KA 4I0TA 3UOJA 5H8EA 3UP2A 3RFCA 4ZI7F 4YC6A 3MA6A 3EN9A 3QXOA 4U80A 4WBOA 2UW7A 5I5ZA 2WFYA 1KSWA 4RIWB 5DMXA 2FUMA 4DCAA 1BUHA 3VS1A 1GSAA 4A9SA 1IA8A 2QR7A 1EHIA 4ERKA 1CMKE 1WBVA 4EC8A 3Q9XA 4OTDA 5AP7A 3AC4A 4DC2A 4GYGA 3I7BA 1QPEA 2BRBA 3AGLA 3GOKA 4FZAB 3VA7A 3Q52A 4DEHA 4HVHA 4AG8A 1BL6A 1H00A 3HDNA 3UIMA 4RX9A 2WYOA 3FBVA 4I6FA 5FBNC 3TUDA 3LIJA 4RX5A 2DQ7X 2VWBA 3QTUA 2DLNA 2OXDA 4QMWA 3UE4A 2PVYA 4O6LA 4EK5A 4FOCA 4Y95A 5E8UA 5AUTA 3R5FA 3OT3A 1Y8GA 1U46A 4ZY6A 5AAFA 4KKEA 2XBAA 3TNHA 3ZBFA 4N70A 4FTTA 2JFMA 4BCNA 5LA6F 4G2FA 3DGKA 4IWQA 4V0GA 3WIGA 3A8XA 3UZPA 4XYLB 2V5AA 2UVXA 4P4CA 3V04A 4YZ9A 2QKWB 1BKXA 3QL8A 1GZ8A 2Q83A 2YISA 3EL8A 3MV5A 3N51A 4NW5A 3P4KA 3FI4A 1OKVA 2HWPA 4ANMA 2GPHA 3DAEA 3P79A 2C6OA 4IX5A 3JPVA 4FOBA 3R9DA 3FLQA 1M7QA 3OWKA 1YXXA 2PU8A 2YWVA 3EQRA 3PJ8A 4XV2A 4F9WA 4YLKA 2XB7A 4QQJA 5LOHA 3K3JA 4MD9E 3ZSHA 2QONA 3TKIA 2B9HA 1JDEA 2YHVA 4O0XA 3P86A 4U97A 2RGPA 1OM1A 3DXNA 5A6NA 2GHMA 4AS0A 3RUPA 3ODYX 3LCSA 4YHJA 5HU3A 4MWIA 4DGLC 4HGLA 3ZS5A 4TPTA 4C4EA 4AE6A 4YBKA 5CAEB 2XNMA 5A4EA 4DH8A 4U41A 2F7ZE 3GFEA 3S0OA 2YZNA 2Z60A 3C4WA 5ITAA 2R3QA 4ONAA 2ZMCA 4N6YA 3FMMA 4GU9A 5JVLA 2QHNA 1W82A 4C5CA 3EQIA 1H4LA 2KTYA 2WQBA 3G6HA 4YO6A 4FTJA 4ZSEA 5EG3A 3TEIA 5JQ5A 1KJIA 2W6NA 3EQGA 4QOXA 4XHKB 5D10A 3JYAA 4XRJA 4M0YA 4ZEGA 1W93A 4YMJA 3DFCB 2PVKA 3EB0A 5LVMA 3FXWA 5A54A 2YCRA 4YR8A 4PQNA 4ZOLF 2UW3A 3FZPA 2BFXA 1PXIA 3QFVA 2JEDA 3OUUA 5L6WL 3UQGA 1F5QA 4Q9SA 4RQKA 4XV3A 3SKCA 2WIHA 5CU4A 2BZJA 2YJSA 5HE2A 3K5HA 1YOJA 3TCPA 5HE1A 1OPLA 2H6DA 2HW6A 3FC1X 3VN9A 3SXFA 3ERKA 4JLCA 5CU2A 3CY3A 3UG2A 4KINA 3MJ1A 4U79A 4O2PA 3UOHA 3UQFA 3KXZA 5M55A 4BTMA 4JDKA 1XH6A 2J90A 4GV1A 3VS5A 3DDQA 2ITUA 2WTKC 3OROA 4QMMA 3UJGA 5IMEA 4GUEA 3RALA 3U8WA 2Y6MA 3QKMA 4H58A 2BRNA 2XNNA 2JDRA 2BRMA 2R3JA 4O27B 5H9BA 4H1MA 2WMBA 3WF5A 3GB2A 4IWDA 2OO8X 3OY3A 4EJ7A 3JVSA 3W1FA 5JQWA 1XO2B 3VAPA 3FKNA 1GAGA 5D1JA 2VZ6A 3IDPA 1YKRA 3RCJA 4CFUA 4EH6A 2GU8A 2UZOA 5HLNA 3PE1A 2H34A 4FMQA 4F0IA 3VUDA 5HX8A 2W9ZB 4IDVA 1YQJA 2E9NA 2PUUA 2VTNA 4ZZOA 1OGUA 3W2QA 1ZZ2A 3R1QA 5A6OA 4O82A 2OXXA 4XG3A 3Q6WA 1KE9A 4O83A 5JGBA 4QT1A 4FKIA 2C5VA 4IWPA 3CJFA 3TKHA 3BU5A 4CKRA 4XUFA 1H24A 4L43A 3DV3A 4GIHA 2BPMA 4DGGA 1NW1A 4EORA 2VTLA 1C30A 3ACJA 5KMIA 4WBNF 2CSNA 5HVYA 3JUHA 2PBZA 1YW2A 4FKTA 4QMLA 4JX3A 3ZFMA 1W98A 3G9NA 3LXKA 3SVVA 5F20A 3PY3A 3E8EA 5CQWA 1YOMA 2VTQA 4MHAA 3O71A 4FNWA 3VC4A 2XYNA 3VQUA 3EKKA 3S2PA 1H28A 1A48A 4DGOA 1ZY4A 3B8QA 1OL2A 4J7BA 5EW9A 2ONLC 4KIOA 3ZTXA 2F7EE 2W5HA 4XOYA 3G51A 4FV5A 5E92A 3PVWA 5EI8A 4M97A 5AIRA 2ZV7A 3W2PA 4IEBA 4LG4A 2HENA 4ZXTA 4FT9A 3NNUA 5B0XA 4EOQA 3TACA 4W4WA 3QUDA 4NL0A 2HZNA 4YZCA 5M53A 3PYYA 5DRDA 2YDJA 4MWHA 5FUTA 3QQLA 2EWAA 2OF4A 2ONLA 4QYYA 5B7VA 3QTRA 1OUKA 3GUBA 3QRUA 5CAQA 4ITIA 4R3CA 1VEBA 4C5AA 3VBWA 4Y5QA 2ZB0A 4IQ6A 2QQ7A 2QR8A 3BHHA 3BGQA 3GENA 4AE9A 2PVMA 4EQUA 3FMJA 1ZYJA 2NU7B 1LUFA 2BTSA 3N4VA 4FE2A 4DEDA 3MWDA 1MUOA 5BMMA 5DR6A 3E7OA 3U6HA 3I6WA 4O7ZA 5DI1A 5AP0A 3AT2A 3R8PA 4JJRA 4OTQA 5FTQA 2XIZA 3MW1A 5CEPA 5ANGA 2XNEA 3OMVA 4V01A 3A61A 5BUJA 2OJJA 5L8KA 4HVIA 4PMMA 4WSYA 3RPYA 3LAUA 4F9AA 3BLQA 2YM8A 4M3QA 4WT6A 5EOLA 4LI5A 5ETIA 2A0CX 2F4JA 5T68A 4CMTA 4DF3A 5C8KA 4CVAA 4RJ6A 2WTWA 1Q8ZA 4IB0A 3R73A 5J1VA 4J52A 5FEQA 3JRXA 5IF1A 5EYCA 3R7EA 3MVJA 4GT5A 1IRKA 4BY9E 3GCQA 1OL1A 1SZMA 3CQUA 3TIYA 4WHZA 3LCOA 3U9CA 3M42A 1OZ1A 4AU8A 3QCXA 5IA1A 3PY1A 2Z7SA 4FR4A 3WF7A 4C34A 4F1TA 5M57A 1B6CB 2PE1A 2WAJA 4LMUA 4YGAA 3FMDA 5KZ0A 5HO7A 4GU6A 4U44A 1B6RA 3BYUA 3MB7A 3OXZA 4HZSA 3RCDA 1LR4A 4RWLA 2YIRA 5K4IA 2HWOA 2XK3A 5EQEA 4LM5A 3T3UA 2ZJWA 2V7OA 4RLLA 2WEVA 1PXMA 2RKUA 3ORMA 3HNGA 4MBJA 3Q3BA 1DAYA 2OFUA 3KMUA 4FIEA 4QMNA 3AT3A 4XP2A 2OK1A 4R3RA 1QMZA 2VTRA 3PWYA 5HVKA 2XCLA 4BBEA 1DIKA 2FYSA 3VF8A 4NJDA 1NVQA 4FTCA 5I9UA 4R78A 1TQIA 3SRVA 4EOLA 3N6RA 4NM5A 2VO6A 4FNZA 4C5BA 3FQSA 5LOVF 5IQFA 2J0KA 4EZ5A 1KC7A 3ITZA 3R63A 4GH2A 2XF0A 3C5UA 3KULB 3BE2A 3EFJA 4HJOA 2F7XE 4IVCA 4NH1A 3RAIA 5E8VA 2HGSA 2ERKA 2BROA 4HCTA 1OBGA 5CNNA 4CEGA 1Q41A 2PE0A 4FICA 3VQHA 2W4KA 3LFFA 3DY7A 2I0YA 3DT1A 4OT6A 4I6BA 4MV1A 3S3IA 4ZIMA 5FM3A 2XKCA 1UWJA 2QODA 5LVNA 2WB8A 1RQQA 2Y4IB 3ZDIA 1R0PA 2YS6A 3OF0A 3P23A 3A4PA 3R71A 3EHAA 3NUUA 3W2SA 4BIBA 1M0TA 2PHKA 1PJKA 1OMWA 4FFRA 4LFIA 5CS6A 2ITTA 1XH7A 4IZ5A 2W7XA 4CFXA 2BRGA 2OH0E 4QYHA 4NFNA 3EZVA 4FV9A 2YZLA 5IEXA 4AUAA 4BYJA 3RV3A 3TG1A 2PZIA 5M4IA 3RWQA 3ZH8A 3OG7A 1ZLTA 3A99A 5TT7A 3ORZA 3TQTA 1VR2A 1OPJA 4L53A 2OG8A 4JAIA 3FDNA 3ORIA 4F1MA 4IAKA 3ORNA 1IOVA 3CY2A 5BMVF 3QU0A 2V22A 4NCTC 4DLKA 3A4OX 3MVHA 2QG5A 4FSYA 3V5LA 2VR1A 1GZNA 4C62A 4FFNA 3COHA 1YDSE 4D9UA 1BI8A 2X7FA 3C4CA 4F64A 3LMGA 4MXZA 3HMIA 3D14A 1GIHA 5AP5A 4W4XA 4Z3VA 3AD6A 1I7LA 2YCFA 5F4NA 4H39A 3MH2A 1OPKA 4EUUA 4G5JA 1OI9A 3IO7A 3NRMA 4WRGA 3R5XA 1PXPA 3O7LD 2Z04A 3K5IA 4DFBA 5FXRA 3V5PA 5HESA 3R7VA 1BX6A
chains in the Genus database with same CATH superfamily
2VTJA 3BBTB 5G1XA 3V8SA 3PE2A 4EKKA 4HCVA 3W32A 3BLAA 3BRBA 3O7LB 1IG1A 2ZAZA 3EKNA 4IC7A 4TNBA 4ZSJA 3TL8A 4FIIA 5HIBA 4O4LF 1IA9A 5CASA 2W06A 1CKIA 5AV4A 4WUNA 3PLAE 2XM9A 3EMGA 3NUYA 4MQ2A 1W8CA 4IWXA 2PYWA 4QMQA 2F2CB 4EOOA 4RVKA 2I7QA 2NYAA 4KS7A 4RIYA 4CCBA 3V5WA 4YO4A 3MB6A 1I7NA 2COJA 4I0SA 5EW8A 3F7WA 3NNVA 3FEGA 4RT7A 4FKJA 4WNPA 3WYYA 4APCA 2W6OA 3HBLA 2HY0A 4F7NA 5HIDA 3GEQA 4FKQA 3IQ7A 5DH3A 3U4UA 4QP4A 3PP0A 2GLTA 3TINA 5ANJA 3LJ1A 3ZUVA 4AOTA 2JKOA 3C4XA 4EHZA 3Q32A 3ULZA 5AA8A 2ERZE 1XQZA 3TXOA 3Q5ZA 3C7QA 4IX4A 3ZCLA 5M06A 5KO1A 3I1AA 2C30A 3LFSA 3IOPA 3OTUA 4FV6A 5CZHA 2HW7A 1TQPA 2YA9A 1JWHA 5CT7A 2PL0A 3TJCA 3N8DA 3NMUF 1X8BA 5M56A 2HZIA 3A60A 3QCYA 4O81A 5KHXA 5KHWA 2C68A 4AZWA 1GLVA 4CKEA 4QMPA 2YAKA 5I5SA 3ZSIA 4O0TA 4CFWA 2XAOA 3TZ9A 2QOHA 4EH4A 4A06A 3KB7A 4E1ZA 4GEOA 4FU0A 2QOCA 4HN2A 4FSZA 4D28A 4PZ8A 3KF4A 3QLGA 4XLIA 1Y91A 5D12A 4MF1A 2O64A 3FQHA 2BTRA 4RC4A 2ITWA 3UOKA 3D5XA 3EYGA 3LCTA 2OU7A 5AX9A 4RJ7A 3SV0A 3VRZA 4ZTQA 4DT9A 3MJFA 3WZEA 3NYXA 2BZKB 4Q2AA 2YACA 2YCQA 2E9OA 2ZDQA 3O50A 4ENYA 3DNDA 4MTAA 4F9CA 5FBOA 5DT0A 2FP4B 4U6RA 2JKKA 5GJDA 4YJOA 3D5VA 2JIUA 1I44A 2BAJA 1Y6AA 3AC2A 4EK3A 1TAEA 4KD1A 4BDBA 4UCTA 2XNPA 2ETRA 3OS3A 5J9ZA 4HNTA 5JKGA 3Q5IA 4DHIB 3GGFA 4EFBA 2C3LA 4CRSA 1VBHA 3R7YA 1CQIB 4O0YA 3D5UA 2Y6OA 3TZ8A 4CD0A 5IH6A 2J0JA 3C50A 2ZDHA 4Y73A 5I0BA 4PNKA 3BU3A 5E1EA 3HV6A 1ST4A 3KA0A 4PTCA 5TR6A 5IG1A 1RE8A 2W4JA 2OH4A 4PF4A 4PDYA 3O96A 2J5FA 3P1AA 2YEXA 4NCTA 4TXCA 1S9IA 1A06A 4E7WA 3UPZA 5IA3A 3UOLA 2X7OA 3FQEA 3C4ZA 3H3CA 4FIJA 3SHEA 4EYMA 1M2PA 4AA0A 3FLWA 4WO5A 4MAMA 3PXYA 4HYHA 2P2IA 4LUEA 3FMLA 4I23A 4NK9A 4CFFA 4USEA 3KK8A 2B55A 3LM0A 1JQHA 3U4WA 3QRTA 3W0QA 1I2KA 4AOJA 3UODA 2YWPA 4FIHA 5CEOA 5FRIA 3NW5A 3F69A 1U5QA 4RZQA 1PY5A 2OF2A 4RQVA 4W4YA 2VD5A 3TNQB 3CD3A 5HTCA 3G2FA 5KUPA 3VONA 1CTPE 2ITQA 3E64A 5HHWA 4ZJVA 4QP9A 4ACMA 4M67A 2R3KA 4RC2A 1TA8A 3LP8A 3RVGA 3VF9A 4FK3A 4FL3A 5B2LA 4TNDA 5C8MA 2GNHA 4HZRA 5IDNA 2YJRA 2OIDA 5JGDA 4L00A 4G6LA 4PDOA 4C2WA 1G8KA 3KXHA 4RWIA 1J7UA 1C3OA 3ETJA 3T9DA 4XV1A 4I5PA 1XMLA 4BIDA 4F65A 2VTOA 1M52A 1VLRA 4ACCA 5CEMA 2COGA 4WIHA 3C1XA 3QQMA 1E1XA 5CQUA 1WBNA 3AOXA 4KBAA 2C6KA 1OKYA 2VTMA 3MFTA 2I40A 4RG0A 2W6QA 2R7IA 1IR3A 2GHLA 3E3PA 4ID7A 5C01A 4CTCA 3QQUA 4XV9A 4BCMA 1B39A 1MRYA 3RNIA 3VS2A 4MXAA 4QQTA 5JGAA 2EIYA 4WA9A 1BL7A 4G16A 5LMAA 1G2WA 2WQMA 3A7IA 3PSCA 1W84A 3DBDA 5A4CA 2ZV8A 5CA0F 4IVBA 4OUCA 4DT8A 2R3IA 5D9HA 4FFLA 5EZYF 2FSMX 3R9NA 1CKOA 1ZYLA 3R6XA 5E9EA 4BBMA 4DIMA 2QB5A 1PXJA 3OWLA 5E8XA 2CKPA 5IUHA 3PVGA 4DDGA 4FSTA 4DFZE 4L8MA 1FINA 4TN6A 3TUBA 5A4TA 1KE7A 4WG3A 3G0EA 4RFYA 3SOCA 5CTPA 4E5WA 3ROCA 2X2LA 3I12A 2QOIA 3ZOSA 1PKGA 2X4ZA 3VS0A 3E93A 4YAKB 4AP7A 4ZOGA 1NVRA 1VYWA 2VGPA 3FKOA 4G1WA 5EH0A 3SNOA 2VX3A 2AUHA 5J2UF 5ETFA 2VV9A 4HCUA 4JBPA 3MIAA 3QXPA 3R2YA 1REKA 4UZHA 3FXZA 5KS8A 3AD5A 4HPTE 4EJNA 4DAWA 3H30A 4JAJA 4FSUA 3FKLA 4A07A 3NNXA 4AXCA 2C5XA 5BVEA 4MV4A 1VKZA 3DQWA 5EM7A 2XNOA 4ASEA 4UX9A 1FPUA 2ITVA 5IQCA 5CF8A 2C5NA 1PRYA 3QWUA 4GT3A 3HV5A 5AA9A 2R3PA 1GGOA 3BAAA 5FTOA 2VNYA 5AAGA 1OKZA 3KAJA 2UW8A 3VOTA 1Q8UA 4C37A 5AUYA 2HELA 4QTAA 5CXHA 2WOTA 2CCHA 4YPSA 3LFEA 4GK4A 5CT0A 4DGMA 3DLZA 4MXYA 3R2BA 2WXVA 4G9CA 3GC7A 5BYYA 3MFSA 4GKIA 3FPMA 3H9OA 2BIKB 3II5A 3NR9A 3T7AA 4H05A 1M2QA 4NM7A 5LMBA 1YWNA 3P7CA 3D2KA 2W99B 4K1BA 2VAGA 3D4QA 3HLLA 2F9GA 1TQMA 3PUFC 5EI6A 3ENHA 4EOMA 5C26A 3MWEA 4CC6A 1U54A 2XCHA 1A0IA 3NYNA 4GUBA 4AZSA 2GNGA 1UKHA 3QGYA 2CN8A 3PZEA 3D2IA 4N0SA 3DTGA 2LGCA 3TIZA 4K2RA 2BKKA 3R8VA 4JIAA 4HVGA 3QF9A 5IH5A 3WZDA 5I5YA 4Y8DA 5HTBA 2C5OA 4B6LA 5LXTF 4ZTRA 3NBYB 4FTQA 4IAFA 3VBYA 3NPCA 5LWNA 3PXQA 1EUDB 3H9FA 4D55A 2WQNA 4GK3A 1H0WA 4YC8A 1YWVA 3BA8A 3RWPA 4EOIA 1KJQA 5HCXA 1PMEA 4MV6A 3UVQA 3MH3A 3B2WA 2REIA 1Z2PX 4W4VA 2YM7A 4KB8A 5GNKA 5HD4A 1P16A 4QYFA 3L8PA 3QAME 1SMHA 1R78A 3HA6A 5CU3A 2HCKA 3NIEA 5EFQA 4FTOA 2GNIA 3OEZA 4I5HA 3VHKA 4G5PA 4O86A 4YSJA 4G6OA 1YXTA 2F57A 3DOGA 4JS8A 1EZ1A 4ZZMA 4CZUA 4IACA 4I4FA 3CCNA 3F5UA 4RA5A 4QMYA 2A4LA 3HMMA 2JD5A 4CKJA 3TKUA 3DB8A 4GRBA 2QCSA 4Q5EA 1G8JA 4CFNA 2WTIA 3RHKA 2J9GA 4N57A 2J2IB 2VUWA 4OTHA 5D7VA 2X2KA 3VULA 1H25A 5KMLA 3E5AA 3EQHA 5E8TA 4D4VA 2VTIA 3IW5A 3I7CA 4DA5A 3RAWA 1G5SA 1RJBA 3GCSA 2BMCA 4DHZA 4XOZA 4JT3A 1G3NA 2R85A 1IEPA 1JLUE 1CM8A 2ETMA 2IVUA 1OB3A 2QNJA 2WGJA 4NSTA 5FQDC 4M9UA 1URWA 4JNWA 3HB9A 2C5YA 3T9TA 3AKJA 4CCUA 4IZOA 1J7IA 2DYLA 3LJ2A 3U54A 2YM6A 1FVRA 1ZYSA 2BKZA 3E92A 3HMNA 4DFXE 1Q8TA 3HV7A 3WNZA 1BYGA 4B8MA 2XANA 2FA2A 4XJ0A 1Q4LA 2ZM4A 2ZFYA 3CE3A 3R02A 5BVKA 3KCFA 5TF9A 3HGKA 4JDHA 3MH1A 3POOA 4WNKA 4CKIA 4RFMA 2OJ9A 3EFKA 3IDCA 4F0FA 5A9UA 5AV1A 4XX0B 1H07A 5KMMA 3DKOA 3DPKA 2UW9A 3ZDUA 3C51A 4O7SA 4O0UA 3FAAA 4LDTA 5J7HA 4BCOA 2GPWA 1K2PA 4D4SA 5CF6A 5GJGA 3RK5A 2XKDA 4G6NA 4YJUA 4ACGA 4HNVA 2W1DA 5KBRA 3TEKA 1Q62A 4K6NA 4GK2A 3VNTA 2GS7A 2W1FA 3UGCA 4QQ5A 2C6LA 3E88A 4U3ZA 4BHNA 5BQ0A 2GS6A 5J2TF 3HDMA 3PFYA 2C47A 1B6SA 2VX1A 3RV4A 3FLNC 3W2CA 1EYZA 3R83A 5FR9A 1HOWA 4X2GA 1P4FA 1UA2A 4AXFA 3LM5A 3EQCA 4RJ3A 4YBJA 3TTIA 3ZO1A 1WBOA 2JAMA 2XP2A 3DAKA 4YJVA 4ZTLA 2CJMA 1OITA 3R8LA 2WZJA 1NY3A 5EDPA 2WMQA 2X39A 3ZRKA 4E6DA 4TYJA 1H1RA 5EOBA 4OGRA 3DKCA 3W0NA 4BN1A 4WNOA 3QKKA 2G2FA 4TWCA 2QD9A 4UEUA 2OIBA 2CCIA 3BYOA 4I4TF 1LP4A 2E9PA 1FMOE 3GC0A 5HG9A 5I9ZA 5H80A 5AP1A 4C4GA 4CXAA 3T9IA 4F08A 1WVXA 4EHGA 5AWMA 3EZRA 2A2AA 3MN3A 4O4HF 3FYJX 1J7LA 1M6VA 2P0AA 3RK9A 4DHFA 1KJJA 3R30A 4RJ5A 1Z5MA 1UU9A 3OBJA 3QLFA 1WRVA 3DCVA 4E4MA 2R86A 4QEBA 2WTDA 1V1KA 5DHJA 4I41A 5DAAA 4RX8A 4L68A 2WHBA 4C3FA 4FSRA 5IDPA 4YBZB 3BU6A 4UCOA 4U3YA 4S31A 5DR9A 5BYBA 1SVGA 5E91A 5LVOA 1JSVA 2W5AA 5E8YA 5HBEA 5AUUA 4LL0A 3OW3A 4J53A 1U59A 3R28A 1V0PA 2JLDA 4DG0E 2B9FA 2XS0A 2UW0A 3AQVA 3PJ3A 4WD5A 3R8MA 3LHJA 3RI1A 2GNJA 4G3DA 2GSFA 2GCDA 4QDVA 3TNWA 3IW4A 4M7IA 4KSPA 4U7ZA 4U9AA 3MTFA 2ZB1A 3KIOC 2OICA 3MVLA 5E8ZA 4Z7GA 2FPGB 3OUNB 3U87A 1B38A 2YFXA 3EYHA 4HVDA 4QPAA 3H10A 5B2MA 3HMOA 1OL5A 4A9UA 5HBHA 2GPSA 4DITA 4QMZA 2FSLX 4HVSA 2JC6A 3VWAA 3HX4A 2YL2A 1ZOGA 3M11A 3L9LA 2W1CA 4XMOA 3V5TA 2Y4RA 3FHRA 4J97A 5DIAA 3R8UA 3TWJA 3W0MA 4DCEA 4YJSA 4L67A 1KV1A 3PXRA 3NUAA 4RBLA 4B0GA 4C4HA 5KX5F 5H8BA 3MIYA 4FTAA 1FVVA 4H1JA 4RIXB 5CU0A 2ITYA 1KV2A 4RWKA 4DEIA 3PFFA 4S30A 3KY2A 2HJWA 1U4DA 1U5RA 4KABA 4ALUA 2HDKA 1ZWSA 2I0HA 2HZ0A 2YCSA 3OY1A 4XP0A 3AG9A 4CKCA 1CKMA 1YI4A 3MPTA 4AW5A 2WIPA 4FT0A 3REPA 3RJCA 4ASXA 2QKRA 3OCTA 2WMVA 3GXLA 4A4XA 5LARA 4ERWA 1KTAA 4E4NA 1XH8A 4EK6A 2BR1A 1W96A 4YSMA 3KK9A 4D1XA 4MVFA 4WKQA 2IVTA 5C1OA 3D7TA 1G8SA 3LFDA 4X3FC 4EZ3A 4FTRA 3KMWA 2C0TA 4DFYA 3LW0A 4YC3A 5EDRA 2UUEA 2G2HA 1SVHA 3LLAA 2QO7A 3FYKX 3QTIA 4MH7A 5J1WA 3EQDA 1XK5A 1YRPA 5BPFA 3D94A 5IA2A 3UO5A 3DJ7A 3PA5A 3BEAA 2R7BA 3LCKA 4B8LA 5DR2A 4O6EA 4TKSA 4EH3A 5ETCA 2B53A 4K8AA 1JKTA 1Y8YA 5IA5A 4M84A 3F5PA 1T36A 2B9IA 2YIYA 1TVOA 2PULA 3F2AA 1CKPA 3PY0A 4YLJA 2W17A 4AFJA 1T46A 3SD0A 1U54B 4DGNA 3MS9A 4JVGA 4XG9A 3OC1A 5C4LA 5I5XA 2EB3A 4PTEA 3QGWA 3F66A 1H08A 4X6QC 5K5XA 2W6ZA 3F82A 4MD7E 3DA6A 5CEQA 3Q2MA 4EL9A 2NU6B 5LXMA 4OT5A 1RDQE 4BI1A 4AZTA 3L8VA 2R3GA 4UUGA 2QHMA 3FZTA 4J71A 4MXXA 2X6DA 3R1SA 4QSHA 4OR5A 4BDEA 2HGXA 4O7RA 4APPA 3QQJA 2JDVA 4JRVA 4BCIA 3VMMA 3PG1A 4IIJF 2YM5A 3PIXA 5JFVA 5FXQA 4TWOA 5KX8A 2NRUA 1UKIA 3H9RA 1MQ4A 2IZUA 2W9FB 3IW7A 3UG1A 5JZJA 2XBJA 4O21A 1V0OA 2VWVA 4F70A 5ANEA 4RIOA 3DS6A 3PJ1A 1MRVA 4TYGA 1H01A 3OWPA 1J1CA 3BL9A 2DS1A 2JAVA 3QWKA 5EM5A 2IZTA 4F63A 2UZWE 2IVSA 4PV0A 3RM6A 3F5XA 3PFQA 4GL9A 3OCSA 4FTLA 4TT7A 3ORRA 4AAAA 3SQQA 4ORKA 4EGQA 3W0OA 4FT5A 3BABA 2R3LA 2CN5A 3QX2A 3ZLXA 1E1VA 1ND4A 1XR1A 1ZYDA 4YB8B 4L9IA 2CDZA 2UZUE 4CZTA 5K3WA 3PSDA 5H8GA 3PIZA 5DN3A 4TYIA 1XH5A 3LZBA 4YNOA 4ZMEA 5JH7F 5JT2A 4TL0A 4RX7A 3KEXA 5IEVA 4FKUA 4HNFA 5HD7A 3RHXA 3CQWA 5D7AA 3COKA 3M1SA 3MPAA 3DKFA 4JG8A 4GFGA 4HPUE 4JMQA 5L2TA 1KOBA 1GOLA 4XCUA 3Q60A 5CF5A 2NP8A 4FTUA 4H3QA 5C8YF 4K0YA 3O2MA 4QMUA 3V8TA 3VVHA 5HG5A 2BAQA 2PMLX 3E7VA 4L3LA 4MEDA 4ZSLA 2PZYA 5LCJA 4O4JF 1JBPE 1YI3A 3PJCA 3FY2A 4Q4DA 3H0ZA 4MBIA 1PF8A 4QNAA 2PZ5A 2H96A 4EK4A 3EN4A 5CWZA 3T9BA 5BYZA 1Q61A 5D41A 2PTKA 3BQRA 4PMTA 2X9FA 4A4LA 4DH7A 3HA8A 3LMIA 3U9NA 1DAWA 4K33A 2OJGA 4O7LA 4ACHA 3DFAA 2B1PA 1H1WA 3HAMA 1O6KA 3FI2A 3R00A 3NW7A 4BYIA 3SXSA 3PXFA 4I93A 4J1RA 4BDHA 3O23A 2QU6A 3FUPA 4IIRA 1I1KA 4UYAA 4FFOA 4UFZA 4BCKA 1CS0A 4XYMB 4W8EA 1PKDA 2A19B 3AT4A 3D83A 2PVFA 3PA3A 4C4IA 3SE7A 2IZRA 2XEZA 1L3RE 3JR1A 4UB7A 4BDIA 4ALVA 4NIFB 3KL8A 4C3PA 4DBXA 3VUGA 5IEYA 3UNZA 3R04A 4JQEA 4YURA 4DG3E 4EQCA 3D7ZA 2V62A 3V3VA 3TT0A 3DTFA 5EYMA 3BLRA 3F3UA 3F2NA 3KMMA 3ODZX 5BVDA 1Z2OX 4MNEA 3DNEA 4UCVA 1XKKA 2G15A 2Q0BA 1GSHA 4Q9ZA 1UV5A 5DGZA 2PVJA 5KKRC 1WVWA 4IAIA 3DTCA 2YN8A 3NW6A 4IX3A 3G9LX 2YIXA 4L7FA 4UXLA 4Z9LA 2VNWA 5EM8A 5C27A 3DQXA 4QTDA 4AXDA 4JIKA 4BCPA 3NS9A 1NXKA 3PJ2A 4GFOA 4KNBA 1OL7A 5FLFA 2AYPA 3TJDA 4IJPA 5FG8A 5AJQA 5KBQA 2XM8A 3R8ZA 2XK4A 3NAYA 4ZSGA 2B4SB 2G1TA 4CT1A 5EDQA 4PMSA 3SG8A 4EH2A 3IDBA 3ZU7A 4EZ7A 4A9TA 3TNPC 3I0QA 4B9DA 4D58A 3JS2A 4NKAA 2ITOA 4ASZA 2P55A 3T9FA 4YZMA 5T3QA 4ITJA 5HO8A 4AWIA 4EOKA 2V7AA 2B7AA 4BICA 5KMKA 1R1WA 2I80A 5GIOE 4ZS4A 3EQFA 3QRIA 3SA0A 3C4FA 3OTVA 4MV9A 5AV0A 2GNFA 5H2UA 3OWJA 4USFA 5GONF 2GQGA 3UDZA 2QOFA 4ZTHA 5CVHA 1NT2A 3D5WA 4ZY5A 4XBRA 4FIFA 2IWIA 4JBVA 5DWRA 5FM2A 3MWUA 2HGWA 3LFQA 4ZY4A 3FMNA 4O96A 1M14A 2FVDA 2HY81 2QU5A 3CIKA 4JXFA 4C3RA 4BDFA 2XIYA 3QUEA 2ZV9A 5CB4F 3AMBA 2GTNA 3BCEA 5HLPA 3OCBA 4AZEA 3AW8A 1T45A 4D4YA 3F3TA 3VPBA 5AP2A 3ORXA 4LGGA 5BNJA 4DH5A 3POZA 1FGKA 4RPVA 3A7HA 4EBWA 4F0GA 3JVRA 3G33A 4G3GA 5HGIA 3A8WA 3HT5A 3KRWA 3P7BA 5I5WA 4P5QA 2I1MA 2V5QA 4RGJA 4BZOA 3DF7A 5ANKA 4J8MA 4O38A 5DGIA 2R3FA 4G3CA 4I94A 3SAYA 5ANOA 2BALA 4QDEA 3A62A 1RW8A 2ZDUA 4LV8A 4BJJA 3OW4A 4DG2E 4B99A 3Q6UA 3JY0A 4IWOA 3MJ2A 1P14A 2R3RA 3NYVA 4QTCA 4DE4A 4ZLZA 5G6VA 2LAVA 2ITPA 2RG6A 4F6WA 5JFWA 2QVSE 4R7HA 4BIEA 3M2WA 2YZMA 3VUKA 5J9YA 4FL1A 4TWNA 3UDBA 2F2UA 3UIBA 5A3XA 2OW3A 5IUIA 4RIYB 4GW8A 4O0VA 4P2KA 3VS4A 4BHZA 2W1EA 4GG7A 4WOVA 3LPBA 2FSTX 2VWZA 2YABA 4ZTMA 1JKJB 1HCLA 3HMPA 1Z9XA 5CYIA 5L8JA 2E9UA 2GFSA 4GT4A 4B7TA 4IAAA 4C33A 5L6OA 4G9RA 3ZC6A 4GKHA 2AEGA 3PSBA 2UV2A 4OBPA 3UQCA 2HG8A 1YXUA 2A1AB 3DBCA 1UNLA 4IVDA 4FEQA 3UZBA 3MY5A 5IU2A 3CTHA 3CP9A 4OTGA 3GB8B 2CKQA 3PXKA 3EH9A 3BHVA 4AT5A 2ESMA 2C1BA 3H4JA 2YZGA 4GYIA 4GFMA 5BYLA 4EWHA 4ZLOA 5JSMA 1IYDA 3JZIA 3CLYA 2IG7A 4KWPA 4UN0C 4IB5A 2V58A 4IMYA 3FWQA 1R0EA 3U51A 4Y5HA 1REJA 3FLSA 5BVOA 3LVPA 4BCHA 3AC3A 5HZNA 4A9YA 4PDPA 3JRWA 4CC5A 2Q2TA 4O7TA 3F7ZA 1IAJA 3KAKA 1XWSA 4FKPA 4CG9A 3ZC5A 1E9HA 5CZIA 5M51A 2VPQA 3OD6X 1GIIA 4XG7A 3NZ0A 2W96B 3WOWA 3S24A 4AF3A 5FDXA 4Q5HA 3U9TA 5JVDF 3O8TA 4QMXA 4BGQA 3QYZA 4C36A 4NZWB 4ARKA 5BV3A 5CAOA 5FEEA 3IK3A 3TZ7A 3I5NA 2NU8B 3R9HA 3F3VA 4FKVA 3VUHA 2P4IA 4D0WA 3BHYA 3EQBA 3W1BA 5IQHA 2CPKE 3FPQA 4I55F 4I20A 4M69B 4E8AA 3RP9A 3ZEWA 3Q04A 3CJGA 4EKLA 5IYZF 2RFDA 3MBLA 3QHRA 5AMNA 5K5NA 3UYTA 4UXQA 5I9WA 2VQDA 2VTTA 5KKNB 2BHEA 1AGWA 4ZTSA 3ML1A 2A27A 3OP5A 4FEWA 1YWRA 2WTKB 3D7TB 3HUBA 3MESA 2O8YA 2IW9A 3MPMA 3NAXA 5DLSA 3RK7A 4FYOA 1CQJB 2R82A 4F7JA 3ZM9A 3AMAA 5JK3A 2UZNA 4BI0A 3BV2A 2OI4X 1URCA 4YTCA 3WWHA 1BNCA 5HNGA 2PVLA 5KE0A 2HOGA 3Q4CA 2C6IA 2B54A 4I3ZA 4D1ZA 4E4XA 5DEYA 3LQSA 3SRVB 2ZYBA 5DNRA 5JQ8A 4S2ZA 5C9CA 4RZVA 4L6QA 3P08A 3Q2JA 4YTFA 2I87A 3ELJA 1FGIA 3A2CA 4UZDA 3QC9A 5HIEA 2BHHA 3GNIB 3OEFX 4FI1A 4OTIA 2CLQA 4MX9A 2G2IA 2ZMDA 3SXRA 4I6LA 1PXLA 3LQ8A 2ITNA 3QX4A 1ZXEA 4JRNA 5IH4A 5DISC 4HYUA 3TM0A 4NYEA 2YDIA 4JDIA 3HP2A 4LL5A 4YLLA 3QC4A 3WE4A 2QO9A 5CSPA 3S1HA 4H3BA 3UVRA 2PY3A 3SG9A 3KXNA 1M17A 2PUIA 4Y72A 3QRKA 4DEGA 3EQPA 1GZOA 2I8CA 5AP4A 2Z8CA 3VO3A 5K4JA 1KBLA 2BDJA 3KALA 3NCGA 4II5A 4UALA 4IZYA 5E90A 3UMXA 1JVPP 3COMA 4HYIA 3VUMA 3ZFXA 5AADA 4DLJA 4BKJA 4FVQA 5L6PA 4IWYA 5HCZA 3PWDA 2C6DA 1K3AA 3P9JA 3PP1A 4MV7A 1XBAA 4HNIA 4R1VA 1XBBA 3F6XA 2X4FA 2C00A 2DZDA 5D8DA 5HBRB 2CGWA 3ID6C 5FNVF 2PZRA 2FB8A 2X5RA 4UBAA 5CU6A 2NO3A 2CMWA 2OSCA 2QO2A 2IW8A 1XHAA 4CV9A 4FTMA 2UZBA 2DWCA 3FMHA 4FT3A 4FKGA 1J3HA 3MSSA 3EN6A 5F94A 4FC0A 4HW7A 1EKFA 5JQGF 4NTTA 2ETKA 2VWXA 4MKCA 3ZEPA 2EUFB 4PP9A 3EWHA 4MA0A 2R3NA 3BZ3A 2VUGA 4TV8F 3T9CA 4DBNA 4EYJA 5FPRA