5E25A

Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
290
structure length
290
Chain Sequence
b'SELLVYMNGEFVPESQAKVSVFDHGFLYGDGVFEGIRAYNGKVFKLYEHIDRLYDCARVIDLKIPLSKEEFAEAILETLRRNNLRDAYIRPIVTRGAGDLGLDPRKCPSPNVIIITKPWGKLYGDLYEKGLKAITVAIRRNAIDSLPPNIKSLNYLNNILAKIEANAKGGDEAIFLDHNGYISEGSGDNIFIVKNGTITTPPTLNNLKGITRQVVIELINELEIPFREANIGLFDLYSADEIFVTGTAAEIAPVTYIDGRTVGNGKPGKVTKMLMEKFRERTENEGVEIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords branched-chain aminotransferase
publication title Crystal structure of branched-chain aminotransferase from thermophilic archaea Geoglobus acetivorans complexed with alpha-ketoglutarate.
rcsb
source organism Geoglobus acetivorans
molecule tags Transferase
total genus 91
structure length 290
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2015-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 5e25A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 5e25A01
2EJ3A 1I2KA 2ZGIA 4DAAA 4K6NA 3SNOA 4JXUA 5I5YA 2HGWA 1G2WA 2COJA 2DAAA 3UYYA 3UZOA 5I5SA 3WWJA 5FR9A 1I1KA 2HDKA 5BWRA 1EKVA 5HNEA 5K3WA 4UUGA 5CM0A 4M0JA 2A1HA 5I60A 2HGXA 3WWHA 5E25A 5I5TA 5I5VA 1WRVA 2EJ2A 3LQSA 1I1LA 1I2LA 3DAAA 3DTGA 2EIYA 4WHXA 5BWVA 2DABA 4CMFA 3LULA 1KTAA 4CHIA 5I5UA 2HG8A 1IYEA 1ET0A 1KT8A 5BWTA 2Y4RA 5BWWA 1IYDA 2ABJA 2HHFA 1EKFA 3UZBA 1I1MA 3JZ6A 1A0GA 1EKPA 3QQMA 2COIA 5CR5A 3WWIA 3CEBA 4TM5A 4PBCA 5I5WA 2HHFB 2COGA 3U0GA 3HT5A 2EJ0A 4DQNA 5I5XA 3CSWA 5DAAA 5CE8A 3DTFA 5BWUA 1DAAA 4TVIA 5BWXA 4CE5A 1A3GA 4CMDA
chains in the Genus database with same CATH superfamily
2IP4A 5HV6A 2QB5A 4O7RA 3SE7A 1IOVA 4IWXA 2ZGIA 3ORQA 3AW8A 3VMMA 3SNOA 3JZFA 1KJ9A 4PZ7A 1JLLB 4MV6A 4XYMB 2PBZA 4O4JF 5DISC 3VPBA 5DGIA 2Q2TA 2R87A 5I5SA 3WWJA 1V9PA 2HVSA 4Q4DA 5CB4F 1I7NA 3GIDA 2HVRA 1EKVA 3K5HA 4FU0A 3V4SA 4FE2A 1EUCB 4RCNA 5K3WA 4UUGA 1DV1A 1GSHA 2V59A 2Q7DA 4C5CA 2A1HA 2C00A 3VPCA 4C5BA 5E25A 4E6NA 1EHIA 2EJ2A 3LQSA 3RV4A 3PN1A 1B6RA 2CFMA 2W6OA 1A48A 2FP4B 3HBLA 1CE8A 4PZ6A 5BWVA 3RV3A 4HNTA 3JSNA 3U55A 1B04A 1KTAA 4O4HF 5IYZF 2Q2UA 4C5AA 4CKEA 1FVIA 3BG5A 3G8CA 1KBLA 1KT8A 1CQJB 2VUGA 3NC0B 1IYDA 5BYAA 4L1KA 1KUTA 3QFFA 4HR7A 5C1PA 1M0TA 3R9RA 3HB9A 4NZOA 1UC8A 2R7KA 4XZ3B 1EKFA 4FFNA 3GJXB 3T9AA 5JQGF 2HJWA 4GLWA 2COIA 3WWIA 3W1BA 4NZMA 3S24A 2HHFB 1VS0A 2OWOA 3BAAA 3HT5A 4EG0A 3BABA 3MWDA 3RTXA 3T54A 2GPSA 2R85A 1KJJA 2XCLA 1A9XA 5J2TF 1DV2A 1VKZA 1KJIA 3MJFA 5FPOA 3GLKA 1OBGA 4K6NA 4DLKA 2V58A 3RR5A 4NYEA 4UCOA 4CC6A 3R5FA 4YBZB 3T9DA 5LP6F 4XX0B 4CKBA 3U54A 2CNQA 3R23A 4IZOA 3NBZB 5FR9A 3RFCA 4ZHQF 1XDNA 5C8YF 2YS7A 1I1KA 3MWEA 4O7ZA 1Z2OX 2HDKA 2W6MA 2YRWA 3LWBA 1C30A 2R7MA 3WNZA 3UQ8A 2WYOA 4O82A 2X5RA 2ZDGA 4FFRA 5CM0A 3PFFA 1GGOA 2VR1A 3NUAA 3T9BA 2W6ZA 2HIVA 2GQSA 3TIIA 5LOVF 3V4ZA 3WWHA 5I5VA 4O2AF 5K2MA 5BYBA 1ZAUA 2VPQA 4TUYF 5H80A 1KJ8A 1I1LA 3DTGA 4DRFA 1W96A 4UCVA 5DGHA 2EIYA 1T36A 4I55F 3TY5A 5BPFA 5FPRA 4CMFA 3I12A 2W6PA 2SCUB 2ZDQA 3K3PA 1GSOA 4CHIA 4FFLA 3GDEA 4UCTA 5JVLA 2W6NA 2VQDA 3KYHC 4FFPA 3LP8A 5BWWA 4YB8B 3BA9A 3R5HA 3BA8A 4GLXA 3JZIA 4FFOA 2ABJA 2DZDA 4MV7A 4FFMA 4O81A 2HHFA 3N6RA 2CNUA 3TY9A 2Z02A 1I1MA 3JZ6A 5HBRB 1A0GA 3QWUA 2DIKA 1M6VA 3T9CA 2GQRA 4MV8A 4TM5A 4PBCA 3E5NA 5I5WA 5KX5F 4IHJF 2EJ0A 4DQNA 5I5XA 3ETHA 3N8DA 2QK4A 3U9SA 5BWUA 2OLSA 3DF7A 3TY8A 5CA0F 5LYJF 5BMVF 4TVIA 4CE5A 5C1OA 4MV9A 4CMDA 3TW7A 4MA5A 4HN2A 2R86A 2EJ3A 3W5OA 3JRXA 3T9FA 4EGJA 1P16A 4JXUA 4EEQA 1S68A 5I5YA 5JH7F 1X9NA 4YJ2F 4YAJB 3TW6A 4UFZA 2HGWA 1G2WA 4Q4CA 4EFEA 1AUVA 2Z04A 4O4LF 2COJA 2DAAA 1EYZA 5D1OB 2YZNA 5I47A 5CA1F 4RZQA 4O7WA 1W93A 1BNCA 4YJ3F 4LH6A 2W70A 3KREA 1Z2PX 4TV9F 4UCUA 2R84A 1CKOA 1CS0A 4EFBA 4IWYA 1OBDA 4MAMA 4O7LA 4TV8F 2NUAB 5DMXA 2X0SA 5I60A 1CKNB 4O84A 4FGRA 3OUZA 4IIJF 4I50F 4MV3A 5JVDF 4I4TF 3TEKA 2P0AA 1I2LA 3DAAA 1BXRA 1JKJB 4EGQA 4ZI7F 4O7TA 1EZ1A 5KKNB 3KALA 3LULA 3T9EA 3VNNA 2R82A 3JRWA 3JSLA 5I5UA 5D8DA 2ZDHA 2HG8A 1IYEA 3BACA 3G8DA 4O7VA 2CNVA 5BWTA 2Y4RA 5LA6F 2NU9B 4ME6A 3UFXB 2FB9A 2DLNA 4O83A 1E4EB 5EZYF 1ULZA 3R5XA 1XK5A 4O86A 3T7AA 3ETJA 3VA7A 1IOWA 4HNUA 1PX2A 2I87A 1EKPA 2CZGA 2V5AA 5CR5A 2ODTX 2I80A 4WBNF 3U0GA 2YYAA 4CC5A 3CSWA 5DAAA 4XYLB 1KEEA 4EQ5A 2HGSA 3KAKA 3TQTA 1P8LA 5BWXA 1UC9A 4PZ8A 5LXTF 2XD4A 4DIMA 2YL2A 4CKCA 4MV4A 1I2KA 1I7LA 5D1OA 4DAAA 1A0IA 3Q2OA 1Z2NX 1EUDB 3WO0A 5GONF 3Q1KA 1CKMA 3HO8A 2NU8B 3RUPA 3UYYA 2I8CA 3UZOA 1M0WA 2HIXA 3ORRA 1TAEA 2HVQA 4E4TA 3U9TA 1GLVA 3TINA 5BWRA 1CKNA 1DGSA 1KC7A 1B6SA 5HNEA 1SCUB 4YAKB 3W1GA 5CAEB 2PN1A 2FPPB 4MA0A 4M0JA 1AUXA 3OUUA 2HGXA 5I5TA 1WRVA 2FPGB 2YZGA 4NZNA 3KAJA 1WR2A 2GLTA 4QSHA 2YZLA 4WHXA 2DABA 5J2UF 1GSAA 1E4EA 3K5IA 1VBGA 4UCSA 4Y8VB 2R7LA 3VPDA 1ET0A 4O7SA 5BPHA 1C3OA 2PVPA 1PK8A 1DIKA 4O2BF 3SGIA 1KJQA 2NU7B 4UCRA 4HNVA 2YS6A 2NU6B 3AX6A 2YW2A 4M9UA 3GB8B 4ZQIA 2W71A 1VBHA 5FNVF 4O7YA 3UZBA 3WO1A 2QF7A 1JDEA 3QQMA 2DWCA 2YWVA 3T99A 4HQ6A 3TIGA 3CEBA 4MV1A 4LH7A 2J9GA 3L2PA 2COGA 2R7NA 4ZOLF 5CE8A 2YRXA 1TA8A 2GPWA 3DTFA 2W6QA 1CQIB 3NBYB 5D1PA 5JQWA 2FPIB 2YZMA 3VOTA 1DAAA 1JDBB 5KS8A 4O7NA 4O4IF 1A3GA
chains in the Genus database with same CATH topology
2EJ3A 4CKCA 1I2KA 2QB5A 3T9FA 4IWXA 2ZGIA 4DAAA 4K6NA 3SNOA 4JXUA 5I5YA 3T9DA 2HGWA 1G2WA 4CKBA 4Q4CA 5DGIA 2COJA 2DAAA 3UYYA 5I47A 3UZOA 5I5SA 3WWJA 5FR9A 4Q4DA 1I1KA 2HDKA 5BWRA 1EKVA 5HNEA 4RCNA 5K3WA 4IWYA 2X5RA 4UUGA 5CM0A 3PFFA 2Q7DA 3T9BA 4M0JA 2A1HA 5I60A 2HGXA 3WWHA 5E25A 5I5TA 5I5VA 1WRVA 2EJ2A 5K2MA 3LQSA 4NZNA 5BYBA 1ZAUA 3TEKA 1I1LA 1I2LA 3DAAA 3DTGA 5DGHA 2EIYA 4WHXA 5BWVA 2DABA 4CMFA 3LULA 3T9EA 1KTAA 4CHIA 5I5UA 4CKEA 2HG8A 1IYEA 3BACA 3VPDA 1ET0A 1KT8A 5BWTA 2Y4RA 5BWWA 5BYAA 1IYDA 3SGIA 2ABJA 4NZOA 1UC8A 2HHFA 1EKFA 3UZBA 3T7AA 1I1MA 3JZ6A 1A0GA 1EKPA 3T9AA 3T9CA 3QQMA 2COIA 4GLWA 5CR5A 3WWIA 2ODTX 4NZMA 3T99A 3CEBA 4TM5A 4PBCA 5I5WA 2HHFB 2COGA 3U0GA 3HT5A 2EJ0A 4DQNA 5I5XA 3CSWA 5DAAA 5CE8A 3T54A 3DTFA 5BWUA 1DAAA 5KS8A 4TVIA 5BWXA 1UC9A 4CE5A 1A3GA 4CMDA 3TW7A 4HN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ3 A;  1I2K A;  2ZGI A;  4DAA A;  4K6N A;  3SNO A;  4JXU A;  5I5Y A;  2HGW A;  1G2W A;  2COJ A;  2DAA A;  3UYY A;  3UZO A;  5I5S A;  3WWJ A;  5FR9 A;  1I1K A;  2HDK A;  5BWR A;  1EKV A;  5HNE A;  5K3W A;  4UUG A;  5CM0 A;  4M0J A;  2A1H A;  5I60 A;  2HGX A;  3WWH A;  5E25 A;  5I5T A;  5I5V A;  1WRV A;  2EJ2 A;  3LQS A;  1I1L A;  1I2L A;  3DAA A;  3DTG A;  2EIY A;  4WHX A;  5BWV A;  2DAB A;  4CMF A;  3LUL A;  1KTA A;  4CHI A;  5I5U A;  2HG8 A;  1IYE A;  1ET0 A;  1KT8 A;  5BWT A;  2Y4R A;  5BWW A;  1IYD A;  2ABJ A;  2HHF A;  1EKF A;  3UZB A;  1I1M A;  3JZ6 A;  1A0G A;  1EKP A;  3QQM A;  2COI A;  5CR5 A;  3WWI A;  3CEB A;  4TM5 A;  4PBC A;  5I5W A;  2HHF B;  2COG A;  3U0G A;  3HT5 A;  2EJ0 A;  4DQN A;  5I5X A;  3CSW A;  5DAA A;  5CE8 A;  3DTF A;  5BWU A;  1DAA A;  4TVI A;  5BWX A;  4CE5 A;  1A3G A;  4CMD A; 
#chains in the Genus database with same CATH topology
 2IP4 A;  5HV6 A;  2QB5 A;  4O7R A;  3SE7 A;  1IOV A;  4IWX A;  2ZGI A;  3ORQ A;  3AW8 A;  3VMM A;  3SNO A;  3JZF A;  1KJ9 A;  4PZ7 A;  1JLL B;  4MV6 A;  4XYM B;  2PBZ A;  4O4J F;  5DIS C;  3VPB A;  5DGI A;  2Q2T A;  2R87 A;  5I5S A;  3WWJ A;  1V9P A;  2HVS A;  4Q4D A;  5CB4 F;  1I7N A;  3GID A;  2HVR A;  1EKV A;  3K5H A;  4FU0 A;  3V4S A;  4FE2 A;  1EUC B;  4RCN A;  5K3W A;  4UUG A;  1DV1 A;  1GSH A;  2V59 A;  2Q7D A;  4C5C A;  2A1H A;  2C00 A;  3VPC A;  4C5B A;  5E25 A;  4E6N A;  1EHI A;  2EJ2 A;  3LQS A;  3RV4 A;  3PN1 A;  1B6R A;  2CFM A;  2W6O A;  1A48 A;  2FP4 B;  3HBL A;  1CE8 A;  4PZ6 A;  5BWV A;  3RV3 A;  4HNT A;  3JSN A;  3U55 A;  1B04 A;  1KTA A;  4O4H F;  5IYZ F;  2Q2U A;  4C5A A;  4CKE A;  1FVI A;  3BG5 A;  3G8C A;  1KBL A;  1KT8 A;  1CQJ B;  2VUG A;  3NC0 B;  1IYD A;  5BYA A;  4L1K A;  1KUT A;  3QFF A;  4HR7 A;  5C1P A;  1M0T A;  3R9R A;  3HB9 A;  4NZO A;  1UC8 A;  2R7K A;  4XZ3 B;  1EKF A;  4FFN A;  3GJX B;  3T9A A;  5JQG F;  2HJW A;  4GLW A;  2COI A;  3WWI A;  3W1B A;  4NZM A;  3S24 A;  2HHF B;  1VS0 A;  2OWO A;  3BAA A;  3HT5 A;  4EG0 A;  3BAB A;  3MWD A;  3RTX A;  3T54 A;  2GPS A;  2R85 A;  1KJJ A;  2XCL A;  1A9X A;  5J2T F;  1DV2 A;  1VKZ A;  1KJI A;  3MJF A;  5FPO A;  3GLK A;  1OBG A;  4K6N A;  4DLK A;  2V58 A;  3RR5 A;  4NYE A;  4UCO A;  4CC6 A;  3R5F A;  4YBZ B;  3T9D A;  5LP6 F;  4XX0 B;  4CKB A;  3U54 A;  2CNQ A;  3R23 A;  4IZO A;  3NBZ B;  5FR9 A;  3RFC A;  4ZHQ F;  1XDN A;  5C8Y F;  2YS7 A;  1I1K A;  3MWE A;  4O7Z A;  1Z2O X;  2HDK A;  2W6M A;  2YRW A;  3LWB A;  1C30 A;  2R7M A;  3WNZ A;  3UQ8 A;  2WYO A;  4O82 A;  2X5R A;  2ZDG A;  4FFR A;  5CM0 A;  3PFF A;  1GGO A;  2VR1 A;  3NUA A;  3T9B A;  2W6Z A;  2HIV A;  2GQS A;  3TII A;  5LOV F;  3V4Z A;  3WWH A;  5I5V A;  4O2A F;  5K2M A;  5BYB A;  1ZAU A;  2VPQ A;  4TUY F;  5H80 A;  1KJ8 A;  1I1L A;  3DTG A;  4DRF A;  1W96 A;  4UCV A;  5DGH A;  2EIY A;  1T36 A;  4I55 F;  3TY5 A;  5BPF A;  5FPR A;  4CMF A;  3I12 A;  2W6P A;  2SCU B;  2ZDQ A;  3K3P A;  1GSO A;  4CHI A;  4FFL A;  3GDE A;  4UCT A;  5JVL A;  2W6N A;  2VQD A;  3KYH C;  4FFP A;  3LP8 A;  5BWW A;  4YB8 B;  3BA9 A;  3R5H A;  3BA8 A;  4GLX A;  3JZI A;  4FFO A;  2ABJ A;  2DZD A;  4MV7 A;  4FFM A;  4O81 A;  2HHF A;  3N6R A;  2CNU A;  3TY9 A;  2Z02 A;  1I1M A;  3JZ6 A;  5HBR B;  1A0G A;  3QWU A;  2DIK A;  1M6V A;  3T9C A;  2GQR A;  4MV8 A;  4TM5 A;  4PBC A;  3E5N A;  5I5W A;  5KX5 F;  4IHJ F;  2EJ0 A;  4DQN A;  5I5X A;  3ETH A;  3N8D A;  2QK4 A;  3U9S A;  5BWU A;  2OLS A;  3DF7 A;  3TY8 A;  5CA0 F;  5LYJ F;  5BMV F;  4TVI A;  4CE5 A;  5C1O A;  4MV9 A;  4CMD A;  3TW7 A;  4MA5 A;  4HN2 A;  2R86 A;  2EJ3 A;  3W5O A;  3JRX A;  3T9F A;  4EGJ A;  1P16 A;  4JXU A;  4EEQ A;  1S68 A;  5I5Y A;  5JH7 F;  1X9N A;  4YJ2 F;  4YAJ B;  3TW6 A;  4UFZ A;  2HGW A;  1G2W A;  4Q4C A;  4EFE A;  1AUV A;  2Z04 A;  4O4L F;  2COJ A;  2DAA A;  1EYZ A;  5D1O B;  2YZN A;  5I47 A;  5CA1 F;  4RZQ A;  4O7W A;  1W93 A;  1BNC A;  4YJ3 F;  4LH6 A;  2W70 A;  3KRE A;  1Z2P X;  4TV9 F;  4UCU A;  2R84 A;  1CKO A;  1CS0 A;  4EFB A;  4IWY A;  1OBD A;  4MAM A;  4O7L A;  4TV8 F;  2NUA B;  5DMX A;  2X0S A;  5I60 A;  1CKN B;  4O84 A;  4FGR A;  3OUZ A;  4IIJ F;  4I50 F;  4MV3 A;  5JVD F;  4I4T F;  3TEK A;  2P0A A;  1I2L A;  3DAA A;  1BXR A;  1JKJ B;  4EGQ A;  4ZI7 F;  4O7T A;  1EZ1 A;  5KKN B;  3KAL A;  3LUL A;  3T9E A;  3VNN A;  2R82 A;  3JRW A;  3JSL A;  5I5U A;  5D8D A;  2ZDH A;  2HG8 A;  1IYE A;  3BAC A;  3G8D A;  4O7V A;  2CNV A;  5BWT A;  2Y4R A;  5LA6 F;  2NU9 B;  4ME6 A;  3UFX B;  2FB9 A;  2DLN A;  4O83 A;  1E4E B;  5EZY F;  1ULZ A;  3R5X A;  1XK5 A;  4O86 A;  3T7A A;  3ETJ A;  3VA7 A;  1IOW A;  4HNU A;  1PX2 A;  2I87 A;  1EKP A;  2CZG A;  2V5A A;  5CR5 A;  2ODT X;  2I80 A;  4WBN F;  3U0G A;  2YYA A;  4CC5 A;  3CSW A;  5DAA A;  4XYL B;  1KEE A;  4EQ5 A;  2HGS A;  3KAK A;  3TQT A;  1P8L A;  5BWX A;  1UC9 A;  4PZ8 A;  5LXT F;  2XD4 A;  4DIM A;  2YL2 A;  4CKC A;  4MV4 A;  1I2K A;  1I7L A;  5D1O A;  4DAA A;  1A0I A;  3Q2O A;  1Z2N X;  1EUD B;  3WO0 A;  5GON F;  3Q1K A;  1CKM A;  3HO8 A;  2NU8 B;  3RUP A;  3UYY A;  2I8C A;  3UZO A;  1M0W A;  2HIX A;  3ORR A;  1TAE A;  2HVQ A;  4E4T A;  3U9T A;  1GLV A;  3TIN A;  5BWR A;  1CKN A;  1DGS A;  1KC7 A;  1B6S A;  5HNE A;  1SCU B;  4YAK B;  3W1G A;  5CAE B;  2PN1 A;  2FPP B;  4MA0 A;  4M0J A;  1AUX A;  3OUU A;  2HGX A;  5I5T A;  1WRV A;  2FPG B;  2YZG A;  4NZN A;  3KAJ A;  1WR2 A;  2GLT A;  4QSH A;  2YZL A;  4WHX A;  2DAB A;  5J2U F;  1GSA A;  1E4E A;  3K5I A;  1VBG A;  4UCS A;  4Y8V B;  2R7L A;  3VPD A;  1ET0 A;  4O7S A;  5BPH A;  1C3O A;  2PVP A;  1PK8 A;  1DIK A;  4O2B F;  3SGI A;  1KJQ A;  2NU7 B;  4UCR A;  4HNV A;  2YS6 A;  2NU6 B;  3AX6 A;  2YW2 A;  4M9U A;  3GB8 B;  4ZQI A;  2W71 A;  1VBH A;  5FNV F;  4O7Y A;  3UZB A;  3WO1 A;  2QF7 A;  1JDE A;  3QQM A;  2DWC A;  2YWV A;  3T99 A;  4HQ6 A;  3TIG A;  3CEB A;  4MV1 A;  4LH7 A;  2J9G A;  3L2P A;  2COG A;  2R7N A;  4ZOL F;  5CE8 A;  2YRX A;  1TA8 A;  2GPW A;  3DTF A;  2W6Q A;  1CQI B;  3NBY B;  5D1P A;  5JQW A;  2FPI B;  2YZM A;  3VOT A;  1DAA A;  1JDB B;  5KS8 A;  4O7N A;  4O4I F;  1A3G A; 
#chains in the Genus database with same CATH homology
 2EJ3 A;  4CKC A;  1I2K A;  2QB5 A;  3T9F A;  4IWX A;  2ZGI A;  4DAA A;  4K6N A;  3SNO A;  4JXU A;  5I5Y A;  3T9D A;  2HGW A;  1G2W A;  4CKB A;  4Q4C A;  5DGI A;  2COJ A;  2DAA A;  3UYY A;  5I47 A;  3UZO A;  5I5S A;  3WWJ A;  5FR9 A;  4Q4D A;  1I1K A;  2HDK A;  5BWR A;  1EKV A;  5HNE A;  4RCN A;  5K3W A;  4IWY A;  2X5R A;  4UUG A;  5CM0 A;  3PFF A;  2Q7D A;  3T9B A;  4M0J A;  2A1H A;  5I60 A;  2HGX A;  3WWH A;  5E25 A;  5I5T A;  5I5V A;  1WRV A;  2EJ2 A;  5K2M A;  3LQS A;  4NZN A;  5BYB A;  1ZAU A;  3TEK A;  1I1L A;  1I2L A;  3DAA A;  3DTG A;  5DGH A;  2EIY A;  4WHX A;  5BWV A;  2DAB A;  4CMF A;  3LUL A;  3T9E A;  1KTA A;  4CHI A;  5I5U A;  4CKE A;  2HG8 A;  1IYE A;  3BAC A;  3VPD A;  1ET0 A;  1KT8 A;  5BWT A;  2Y4R A;  5BWW A;  5BYA A;  1IYD A;  3SGI A;  2ABJ A;  4NZO A;  1UC8 A;  2HHF A;  1EKF A;  3UZB A;  3T7A A;  1I1M A;  3JZ6 A;  1A0G A;  1EKP A;  3T9A A;  3T9C A;  3QQM A;  2COI A;  4GLW A;  5CR5 A;  3WWI A;  2ODT X;  4NZM A;  3T99 A;  3CEB A;  4TM5 A;  4PBC A;  5I5W A;  2HHF B;  2COG A;  3U0G A;  3HT5 A;  2EJ0 A;  4DQN A;  5I5X A;  3CSW A;  5DAA A;  5CE8 A;  3T54 A;  3DTF A;  5BWU A;  1DAA A;  5KS8 A;  4TVI A;  5BWX A;  1UC9 A;  4CE5 A;  1A3G A;  4CMD A;  3TW7 A;  4HN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...