3S24A

Crystal structure of human mrna guanylyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
336
structure length
328
Chain Sequence
b'GAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-capping enzyme
publication title Structure of the guanylyltransferase domain of human mRNA capping enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transferase
total genus 70
structure length 328
sequence length 336
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.7.7.50: mRNA guanylyltransferase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain
A PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s24A03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3s24A01
4.10.87.10 Few Secondary Structures Irregular mRNA Capping Enzyme; Chain mRNA Capping Enzyme; domain 3 3s24A02
5JEAG 2A8VA 5J3BA 2A1AA 2K5HA 1WJJA 2L15A 1X55A 4DV1L 1X9NA 2UUBQ 4LUOA 4LF9Q 3H0GG 4GLVB 4YCVA 5IP7H 1KHIA 4B3ML 1TWHH 4AIMA 2QGQA 1XMOL 1K0RA 3T1YQ 4A3DH 3F2BA 3EBEA 4BY1G 3CF5A 4DV0L 1V43A 4JBWA 1LM0A 4LFAL 1YJ9A 1PH6A 2BH2A 3RR5A 2JA5H 3S17H 2KHIA 4A3GG 4UCVA 1VQAA 1HNWL 4JI1L 1PFSA 1GO3E 3H3VI 2WB1E 1KXLA 4LUVA 2GVBA 4X64L 4DR1L 1SFOH 3GTGH 1VQJA 2R7DA 3F2DA 1ASZA 1Q8KA 2VUMG 1OXUA 2ID0A 1CKNA 1MJCA 3I7FA 4LF4L 1PH8A 5IE8A 4HJ9A 1EOVA 3CC2A 3A0JA 2V1CC 1WI5A 1Z47A 2N8NA 4P75A 4YY3L 1PA6A 1LYLA 4LF7L 1D7QA 2ZJRA 1HJPA 1OXTA 1RIPA 1CSQA 2RHSB 1C0AA 1HZBA 1YITA 1VQOA 4DR4Q 4DR2L 4DRFA 4HJ7A 1SN8A 3CMEA 3H3VH 5C44G 2OWOA 1DGSA 3HOZH 5IYCG 1HR0L 3I4NH 2NVQH 4L5QA 3NBZB 1K3RA 3HFZB 3K80C 2UU9L 4LH7A 4BXXG 3MXNB 4JI4L 5IT9c 4LF6L 3BZKA 1EFWA 5C3EH 4JBMA 4R1JA 3M4QA 3GTMH 2D62A 4JI8L 1UE6A 4QJFA 1Q1BA 2CKZB 4X66L 4EQ5A 3JAMc 4O0AA 2ZM6Q 3G4SA 3JC66 3PO3H 1UWVA 3GTKH 1XJVA 3PF4A 4LFBL 2I5HA 3K7UC 3DLLA 1YJNA 4XIGS 1S3OA 5M3MH 3CCQA 3OW2A 4JI3Q 3BZCA 1YIJA 2OQKA 4DV1Q 3F1ZA 4B3MQ 2I0QA 2RCNA 2BA0A 1VQ9A 5D1OB 3PN1A 1VQ8A 1IBML 3S16H 4WJ4A 4PZ7A 2Q2TA 1W2BA 1K83H 4A3IH 3OTOL 5IWAL 2CCZA 2XGTA 1Q86C 1HNWQ 1YJWA 4JBKA 4DV4L 2VQFQ 1JJGA 2IY5B 4JI7L 2R6GA 1YHAA 2F3IA 3PUYA 1WFQA 4DUYQ 4JYAQ 4DV3Q 1L2FA 2KENA 3G71A 4B3RQ 1EQQA 1PH1A 3M4OH 1FVIA 3TRZA 3GO5A 5IYBH 1S40A 4LF9L 4JG2A 2UUBL 2CQOA 3A5ZB 1YVCA 2ZJPA 1VQCA 4R4OA 2JA7G 3CCRA 3G6EA 3K7AH 2ALYB 2I5MX 1Y1VG 5C0XJ 3PIOA 3CPFA 4HIMA 1N33Q 4A3JH 5H1SE 3BA9A 1YZ6A 4DR3Q 3ERSX 1EWIA 4GLAC 4OO1I 2KHJA 1IZ6A 4IOAA 5FPOA 2N3SA 1O7IA 4KI0A 1SMXA 5C4JH 1PH5A 4DPGA 2PI2E 1HR0Q 4NXNQ 1J6QA 1Q46A 3PO3G 2FXQA 2WAQG 3JAMi 4DV2Q 2UU9Q 1X65A 3CD6A 2NVYH 1VQPA 4JI4Q 2PQAA 1IXRA 4A3LH 2Q2UA 5E7NA 3S1QH 1UE7A 2IX1A 1I6HH 3HOUG 1NJIC 1BBWA 1VQEA 4X66Q 4QY7A 1PHJA 2HVQA 1I5FA 3CW2C 3HKZE 4P73A 3RLOA 2KCMA 4DUZQ 3CP0A 3UDFA 1VQMA 1SE8A 1XPRA 1YNXA 2C35B 3KF6A 5M5WH 3PGZA 4B3SQ 4DR4L 3G48A 1GVPA 2Z6KC 3I55A 1L1OC 2LSSA 3A5UA 1TAEA 1Q12A 4DV6L 5IYDG 3CPWA 4DKAC 2WFWA 3UE0A 1NE3A 3CC7A 2YYZA 4ALPA 4B3TL 4CC6A 4DK6C 3OTOQ 1PH4A 1G51A 5C4XH 1HNZL 4BY7G 4R4QA 4NPSA 2GVAA 5ELOA 1TWAH 3KDFA 4EX5A 1M1KC 1N34L 4OONA 2CWAA 2ZM6L 1VQ4A 4BY1H 1LUZA 1CKNB 3PV0A 5JJIA 4R4IA 2OCEA 1Q81C 5AJ3Q 3NELA 1NY4A 4XTCS 4IPCA 4NXML 4A3BG 3E9IA 2HQLA 1N36Q 4A3GH 4JI3L 2UUAQ 3W1GA 1L1OA 2K75A 2AWNA 3Q8DA 3U4VA 4IFDG 4K0KL 2VZAA 2HHHQ 1YBYA 3PO2G 4IO9A 4JCVE 3PUXA 2YTYA 5GROA 3U4ZA 1Q7YC 4DAMA 4GN3B 1E7ZA 2VUMH 4Y7NH 5M5XH 2R93G 2ASBA 3I2ZA 1L0WA 1BVSA 4YCUA 1X54A 3H15A 4UP8A 3RZDH 1QVFA 2VQFL 2JJQA 2YV5A 3F8TA 2F52A 5ELNA 3CXCA 3HOWG 5FJ8G 3JSNA 4J15A 1PYBA 4DV7L 1AE3A 4DUYL 1U0LA 4JYAL 1B70B 1EIFA 1UE1A 4DV3L 5C44H 4B3RL 1H95A 1WYDA 3HKSA 4A76A 5IYCH 1JJ2A 3TY5A 4HJ5A 3EIVA 1A0IA 2ZTCA 4HIOA 4A3MG 1KD1C 1IBKQ 4A93H 4L5SA 4BXXH 4JV5Q 2HT1A 3GTOH 4A75A 2AWOA 3FHWA 1N33L 1S68A 4C2MH 1VQKA 1WOCA 2UXCQ 2N49A 3AFPA 2Y0SG 3CAMA 4DR3L 2E2HH 2JA6G 1XDNA 4A3FH 4BBSG 2WAQE 5IP7G 4DV6Q 2H5XA 1N9WA 4NXNL 4B3TQ 3UDIA 4LWCA 2K50A 4AYBG 3F2CA 1GM5A 4DV2L 4LFCL 5GAEC 4GKJL 1HNZQ 4KHPL 3AYHB 2OQ0A 2K52A 3AEVA 3BU2A 3RLFA 1JJCB 5JJKA 5IP9G 4QGUA 1TWGH 1J5EL 2AMCB 3I4MG 1E22A 3E9HA 4C3IH 4DK3C 1BKBA 4DNIA 3CCUA 4DUZL 4DR5Q 3STBC 4NXMQ 3UQ8A 2VUGA 2JEBI 3M7NA 2JK8A 3D0FA 4OWXB 3ICEA 2JQOA 4B3SL 3EN2A 4K0KQ 1XPOA 4KLKA 3FP9A 1SR3A 4PG3A 2B29A 4A3EG 1KIXA 1VS0A 4E6NA 2Q2HA 2N78A 3M9BA 1GD7A 4DR6Q 4DAYB 4TVAB 4EFEA 3S24A 3T1HQ 3TS0A 1CKMA 3M4PA 1Y1WG 1JE5A 1FJGQ 3BABA 2WP8J 3HOXG 3RNUA 3PUZA 1IYJB 1OXVA 2PQAB 4QL5A 2E2IH 2YU9H 2JA7H 1XTDA 3KJOA 1Y1VH 2F4VQ 4DV7Q 4QIWE 5AJ3L 2HVSA 1VQLA 4RG1A 1N36L 2KCTA 3NEMA 3J7A5 2UUAL 5IY0A 3CMAA 1MIUA 1K8AC 1FGUA 3GD7A 3VDYA 3NBHB 4POFA 4LF5Q 2HHHL 2DGYA 5JEAJ 3S15H 2NN6G 3BA8A 2YTXA 3KF6B 2UXBL 2GN5A 4YWMA 3UDXA 5GADC 1FL0A 3CC4A 1W3SA 3HOUH 2VY3A 4BA2I 3PCOB 3CCVA 1GKHA 1I3QH 1UEBA 3ULLA 1EQRA 1CKOA 4A3CG 4HIDA 3JSLA 2WB1G 2VQEL 5FLXc 4LFCQ 4GKJQ 4IJHA 4KHPQ 1KC8C 3IRBA 3KDFB 4DV5Q 2R7ZG 1MKHA 1SLJA 4A4IA 3S1MH 4IFDI 1J5EQ 4LNQA 1HH2P 3VNNA 1E1TA 5IYDH 3ULPA 2B63G 3NC0B 5FPRA 4IPDA 1Y14B 1IBKL 3BAAA 4YCWA 3W1BA 4BY7H 1SRUA 4JV5L 1E3PA 4OWTB 1L1OB 5DISC 2E5LL 1M90C 4HJAA 4IPGA 2UXCL 1YHBA 1OXSC 4H02A 4EFBA 4EEQA 3KOJA 3CCJA 1VQ7A 4P74A 3S2DH 4A3BH 3TREA 2K5VA 3J7ZC 2RF4A 2MFIA 4OXPA 5LMUQ 5LMNL 4A3JG 3BJUA 3I4OA 4C3HH 1B7YB 3H0GH 3NENA 4LH6A 3PO2H 5BR8L 3ULJA 1E24A 4YHHQ 2QEXA 4GOPC 4JI0Q 1A8VA 4Y52H 1QVGA 4GNXC 1PH3A 5M3FG 3CCEA 2ATWA 2R93H 3TY9A 4DR5L 1G291 3PF5A 2DUDA 2D0OA 5FLMG 2NVXH 3MEFA 1X3FA 2Z6KA 4LF8L 1N32Q 3RTXA 2VL6A 1QVCA 2R7FA 1X3EA 4A3KG 4P71A 2UXDQ 4UCSA 3I56A 4UCRA 1YEZA 4BBRG 1VQ5A 2R92G 3HOWH 4JI6L 5FJ8H 2UXBQ 3KFUA 1WCMG 1QUQA 1VQIA 3ER0A 3S2HH 4P72A 3U50C 2HVRA 4DR7Q 1E1OA 4DR6L 2BH8A 2HIXA 2K4KA 2ES2A 3T1HL 4A3MH 4GOPA 1KAWA 2Q2IA 1FJGL 4NB3A 3HOVG 2VQEQ 4GNXA 1HR0W 1HZAA 5JJLA 3CQZH 3FKIG 5K36G 1P16A 1VQHA 2Z0SA 2F4VL 1XNQQ 4MZ9A 2EXDA 5GQOA 2JA6H 5C4XG 2PNHA 4JI2Q 1YHQA 5C0XG 4BBSH 2JA8G 1C9OA 3L7ZC 4LF5L 4IJLA 2E8GA 3K81C 4O2DA 1I94L 4GN4B 3LGJA 2E5LQ 3DM3A 1IBLQ 2VNUD 4X6AH 1K8GA 5IP9H 2NZOA 3I4MH 1BBUA 1MJEA 2ZTEA 1VQFA 2LXJA 3L0OA 1I50H 1K9MC 1T9HA 4OX9Q 3PSIA 1IL2A 2MO1A 4POGA 4A3DG 2I5LX 4KHZA 4R4CA 1HNXQ 3S1NH 3PUWA 4LW1A 1D8LA 5LMNQ 4GKKL 1V9PA 4JI5Q 1PH7A 3KJPA 4AQYQ 3J81j 4DV5L 2JA5G 5BR8Q 3J81c 3STBD 3NBYB 4A3EH 5DLQE 3W5OA 1NTGA 1TWFH 2CWPA 2NN6I 2EQSA 4R4TA 3HKZG 4JBJA 4JC0A 1EIYB 4QQBX 1XPUA 1B04A 4PZ8A 4X65Q 3RZOH 1Q1EA 1PH9A 4JOIC 2VS1A 1Y1WH 4LF8Q 1AH9A 4WJ3M 3ZJYC 1N32L 3HOXH 4APVA 3GJXB 1OXXK 2B3GA 1XNRQ 1VQ6A 1A63A 1NMFA 4JI6Q 2K5NA 2UUCQ 4A93G 1VCIA 2A19A 2MNAA 1G6PA 2IHEA 3KF8B 4UCUA 5LMUL 1N8RC 3RN5A 1PYSB 1TXYA 3WWVA 4YHHL 3HOZG 2OTJA 1OTCA 2ZTDA 4GN5A 4JI0L 4A3FG 1XMQQ 3TS2A 1HZ9A 1KRSA 1VQDA 3I4NG 1JT8A 1X3GA 3J80c 2NZHA 4UCTA 4JOIA 3AFQA 2IT1A 3K8AA 5C3EG 3S1RH 1X56A 4MTNA 1QZGA 1XMOQ 4A3CH 2RHQB 3HOYG 4BA1I 1P8LA 2UXDL 3TY8A 3CCSA 1JMCA 4DV0Q 4GS3A 1U5KA 3A74A 1I94Q 2E2JH 4UY8C 4IFDJ 4LFAQ 3AQQA 1XK5A 2IHFA 4L5RC 2R7ZH 2AHOB 3TQYA 2JE6I 5M3MG 3GTJH 2ZJQA 3GTPH 1B8AA 4DR7L 4JI1Q 3KLWA 1EYGA 5D1PA 2JA9A 5GAHC 4LUZA 3PIPA 3B6YA 4X62L 2B63H 4X64Q 4DR1Q 5GAGC 1YI2A 3J81i 3CCLA 1RL2A 4UP7A 4ME3A 2QA4A 1V1QA 1JB7A 2CFMA 4CC5A 4IPHA 3GTQH 4LF4Q 4GKKQ 1SROA 1XNQL 1N34Q 3QWUA 5LMNW 4A3IG 4OWWB 4UP9A 1Z9FA 1ASYA 4UCOA 3L2PA 4JI2L 4YWLA 2OTLA 3GTLH 2XTIA 4YY3Q 2AKWB 1PVOA 4LF7Q 1K73C 4C3JH 3UDGA 1AE2A 3OYYA 3PUVA 3T1YL 2YTVA 5D1OA 1EUJA 1NMGA 2PMZE 4RMFA 2Y0SE 5HY6A 2IX0A 4DR2Q 1IBLL 3M3YH 1TWCH 4HJ8A 3HOYH 4L5TA 1X6OA 4MNOA 3SGIA 1R9TH 5IYBG 1CSPA 1QUQB 4PZ6A 4AYBE 5M3FH 3GB8B 1KQSA 1PV4A 4OX9L 2KBNA 4TQUS 4LF6Q 5EAYA 4UPAA 4AH6A 5FLMH 1HNXL 4FDBA 2HIVA 2BA1A 4JI8Q 4GOPB 4JI5L 3J80i 4GNXB 4AQYL 4A3KH 5C0XI 2JEAI 3K0XA 3U58A 1LTLA 4BBRH 2R92H 1VQBA 1HZCA 4GLXA 2VW9A 4LFBQ 1WCMH 4HIKA 1S72A 2K14A 4A3LG 1VQNA 2EIFA 4UFZA 1NBWA 2MO0A 4X65L 4IOCA 4YWKA 1CUKA 3HOVH 2NVTH 3TEHB 1IBMQ 1PH2A 3FKIH 1Q82C 1XNRL 3M85A 2UUCL 1C7YA 2LXKA 5IWAQ 2PI2A 3D31A 3KYHC 3CCMA 1VQGA 3S14H 4DV4Q 4OO1G 3GDEA 5HGQA 1KL9A 3UE1A 2JA8H 1UE5A 4PMWA 1KRTA 4X62Q 3RN2A 2MQHA 1A62A 2D0PA 1TA8A 4JI7Q 3E0EA 1XMQL 3RLNA 5M5YH 1QZHA
chains in the Genus database with same CATH superfamily
2W6QA 4XQQA 3CEBA 3TINA 2A8VA 1VMPA 4LUOA 3H0GG 3A8IE 3NE5B 1XMOL 1K0RA 3T1YQ 3F2BA 3EBEA 3FDTA 1X3PA 4DV0L 1V43A 5A2QE 1R4QB 2G9DA 4XT1B 3S17H 3BACA 4ZQ3A 2KHIA 3R23A 1VF5C 1HNWL 1AUXA 1EQVA 1KXLA 3UFXB 4MV7A 4LUVA 4X64L 2ICIA 3GTGH 4HSVA 4WRDA 5EPLA 2I8CA 3PIP3 1OXUA 3KAJA 1DOKA 4ZUJA 5IYZF 3DWQA 3GTJB 2QDBA 4HJ9A 3GTPB 1EOVA 1PTOF 3CC2A 2F0FA 2V1CC 3OW7A 1PA6A 4YY3L 3IFDA 5G3LD 1D7QA 2ZJRA 2IWHA 2O5JC 3GTQB 1E2VA 1QNUA 1EHIA 3H3VH 3HOZH 5KEEA 5C44G 1DGSA 2F1MA 4OIJA 1XWEA 3A8JE 4L5QA 4LF6L 5IT9c 5JQGF 4H7BA 3M4QA 1U4LA 3MAQA 3TEKA 2D62A 5I2XA 4QJFA 3JAMc 4MV9A 1UC8A 1KJ9A 5C5MA 2DY7A 1M0TA 4E6IA 3I8ZA 3OIPA 4IZOA 3SR1A 2B8GA 2F0KA 3PN1A 1IBML 1KC7A 4PZ7A 4C3IG 5T1IA 1CZWA 4JK1C 5IWAL 2RA4A 2CCZA 1Q86C 3TIGA 1YJWA 4TM5A 1GUSA 1RTNA 2ZXRA 1EZ1A 2VQFQ 5CV7A 4JI7L 3PUYA 2HG8A 2EJ0A 1PZID 5ELFA 4IWYA 4FXDA 1L2FA 4C1NK 3GP7A 2CQOA 5C5LA 1GUWA 4Q5VA 2ZJPA 1VQCA 2MJ8A 3DXJC 4HIMA 1LTGD 1N33Q 3PIOA 3CPFA 4A3JH 3ND8A 3T9CA 1YZ6A 1EOTA 4GLAC 1IZ6A 2KJXA 4ZRZA 4KI0A 1PH5A 5A2QL 5EBDA 4A3DB 2IJ0A 1LTID 1X65A 2PQAA 1B4OA 2ABJA 2Q2UA 5JH7F 3S1QH 1UE7A 5BPFA 2F0IA 4FXKC 1NJIC 1V1OA 3CRLC 1HQRD 2EYLA 2HVQA 5I6WA 5IGEA 5KYIA 3HKZE 3R5FA 5IOCA 3UDFA 2HGSA 1YNXA 4KKUA 4O4LF 1X32A 1VKZA 1LABA 1U9RA 1Q12A 4DV6L 5IYDG 3Q24A 1Y8NB 2QF7A 2SOBA 3MWYW 5JEAH 5C4XH 1HNZL 4BY7G 1CA5A 1SSOA 2YS7A 3OWFA 2Z6BA 5ELOA 4QSHA 4KN4C 2ZM6L 1TY2A 3PV0A 2MHVA 4ZLTF 2NVQB 3V4SA 1Q81C 5AJ3Q 3UI2A 3K5IA 4NXML 4IPCA 3E9IA 5JOBA 1A2TA 3URYA 5JVG3 4HNTA 2UUAQ 3JRXA 4C3HG 4UCSA 1BNZA 3PO2G 4IO9A 4JCVE 4QUCA 5GROA 3T4AC 3DMUA 2VUMH 2RDHA 2XRSD 2F0TA 1L0WA 1BVSA 3ETJA 1OO9B 3RZDH 1QVFA 1EKPA 3T53B 4XT3B 2FHTA 5BMVF 3TZDA 2YV5A 2F52A 3NTIA 3CXCA 3JSNA 1KNAA 4J15A 4H0LC 2E2JB 2W70A 4DUYL 2OT2A 4JYAL 1B70B 1UE1A 4DV3L 3NWTA 3MXUA 1RKNA 1ZYRC 1JJ2A 4HJ5A 2YZNA 4HIOA 1A0IA 4A3MG 1KD1C 2B63B 3N8DA 3EQLC 4MV6A 3WO0A 4DAPA 2AWOA 5HNEA 5EKLA 5FO8B 1VQKA 1WOCA 3V96A 1V8QA 2EYOA 4V0BA 3K0YA 3AFPA 3CAMA 4DR3L 3M4OB 2CHBD 2LS01 3QFFA 1K28A 1N9WA 4NXNL 4B3TQ 4LWCA 4DXGA 2EIYA 3JZ6A 2F0GA 4DV2L 1IL8A 1CQFA 3K7AB 4FF3A 4GKJL 1UAPA 3E5SA 3T9DA 3O13A 3AEVA 2K5QA 3UYYA 3MFGA 5IP9G 3SDZA 1TWGH 1E22A 4DK3C 4DNIA 4TSSA 5DMXA 2JSOA 1RDPD 1LO5D 2JK8A 1I6HB 3RD4A 4CDCC 3ICEA 2JQOA 3E3XA 3NWSA 5I5YA 4A3KB 3HGBA 1BNCA 3HT5A 5IODA 1GJXA 1GOZA 3G7LA 2EPBA 1VS0A 2NU8B 3T9AA 4CDFC 4DR6Q 1YNND 1EY7A 2DY8A 2EY6A 3T1HQ 1CKMA 3I90A 3M4PA 4YIJA 1Y1WG 4O7RA 4ZHQF 3HOXG 3RNUA 2E2IH 2NVTB 2PQAB 2AQ1B 1BUVT 3KJOA 1Z6HA 1SEBD 1A3UA 4DV7Q 1C3OA 4NZOA 5KKNB 2KCTA 3J7A5 2WACA 3VDYA 4POFA 1Q8IA 2DGYA 5JEAJ 2GN5A 4YWMA 5GADC 5JPNC 4BA2I 3PCOB 2R82A 1KTKA 3CCVA 1D5ZC 2B2WC 2ICEC 1EQRA 2R7KA 3LWEA 1SNOA 4PNYA 3SVMA 4HIDA 2R84A 4IUNA 5CGKA 2WB1G 5BWVA 4LFCQ 1KC8C 3KAKA 3NUCA 4RHRA 5M5XB 5I5UA 2EJFC 4A4IA 1G2SA 5FNVF 2X69A 5CM0A 1S5CD 1LACA 1B1ZA 3LNNA 3DAAA 3NHHA 3W1BA 1SFOB 3J7YW 1SRUA 1E3PA 4OGQC 1CFMA 2B2WA 2UXCL 1I4HA 1SYEA 1NR2A 1OXSC 1D5XC 2V58A 4EEQA 4HCEA 1SYGA 1KABA 2PZTA 4P74A 4A93B 1QNKA 2K5VA 3EJIA 1G2WA 5LMNL 4K8JA 4A3JG 3BJUA 1PXUA 1SCUB 2QEXA 3BYTB 3VYRA 1EY6A 2GPWA 3R2TA 1G291 2D0OA 2F0UA 3IL8A 2XVSA 3OUZA 5FLMG 1SYFA 2Q8IB 2Z6KA 1QVCA 2MP1A 3I56A 3LP8A 4CKCA 5KIXA 2VPQA 1EU3A 4HR7A 2HVRA 3HO8A 2XN9C 1LT3D 2HIXA 2J4XA 2A69D 4MTKA 1KAWA 2L5TA 1FJGL 3FKIG 5K36G 1VQHA 2F4VL 4YJ2F 4ULLA 5C4XG 3VR4A 5C0XG 4KMUC 3KLRA 3DHQA 3ND9A 2NZ1D 4R8IA 1GLVA 3K81C 1I94L 4QF4A 5CR5A 2ZTEA 1VQFA 2LXJA 4QMGA 4CBVA 1ICWA 1V1PA 3S15B 5KGUA 2W6PA 4A3DG 4KHZA 1HNXQ 3A54A 4DLKA 3Q1KA 3G6JB 4GKKL 1Z2OX 4H13C 1EUDB 3TSSA 3V2TA 4DV5L 5BR8Q 1TY0A 5EKIA 4A3EH 5DLQE 5C4JB 2R87A 3WWJA 2PW7A 2LMCB 3HZXA 2GA4B 4PZ8A 4FGRA 4JOIC 1B9MA 4CDEC 3ZJYC 2I07B 3S1MB 4WJ3M 4IIJF 1KDAA 2RSOA 2PYKA 3S9WA 2K5NA 4UCUA 5LMUL 1KUTA 4ODGA 1N8RC 2MGSA 4FNFA 3MFYA 1PYSB 4HAEA 3RN5A 4NKLA 5C8YF 1KRSA 3T51B 1JDBB 1JT8A 2NZHA 4JOIA 5FLXE 2EY1A 3AFQA 3V4ZA 2PQEA 3H0GB 3Q0AA 3T7AA 3C1FA 3T56B 1PRTC 2RHQB 3BDCA 3TY8A 1EYCA 1XK5A 2R93B 4X3SA 2KOLA 2IHFA 5M3MG 2ZJQA 3MXNA 5ELBA 1EYGA 5D1PA 2ZXPA 2JA9A 4LUZA 3QJYA 1YI2A 3CCLA 1D5MC 4UP7A 2QA4A 3WDNA 1JB7A 4ZKCB 3HOWB 3BS1A 5H80A 1SROA 5EKKA 4RHSA 3L2PA 1JOKA 4O1NA 3OWEB 5BN5A 2XWJB 1K73C 3T1YL 2W71A 1AE2A 4Q4DA 3RV3A 4I7ZC 1K0SA 2Q8TA 5D1OA 1TS3A 2L11A 4DR2Q 1HA5A 3OMGA 5EPJA 4KKSA 4L5TA 1ZXTA 3SGIA 1EZ6A 3R3OA 5M3FH 1Q3LA 4HR7B 2XRQD 3FRPB 2KBNA 3OHXC 1PV4A 1EYDA 1SNCA 4OX9L 4AH6A 2F0PA 3MJFA 3PMFA 3H09A 4BBRH 2C00A 2R92H 1HZCA 1I50B 2D9UA 1GSOA 3H94A 1S5FD 3S1NB 1NBWA 2MO0A 4X65L 4IOCA 3GV3A 5JVLA 3HOVH 1Q82C 4HTHA 2WKCA 2G5DA 1SJHD 3D31A 3Q23A 5EPKA 3RZOB 1V1PB 4PMWA 4X62Q 1TIID 1EFID 2BOSA 1TA8A 4I4TF 3E0EA 3TMEA 2B2TC 2I0QA 3H3VC 1QZHA 3CC4A 2DAAA 1I4PA 4XX0B 2BDOA 5J3BA 2A1AA 2K5HA 1WJJA 1GXDC 2UUBQ 1WTPA 5DAAA 1KHIA 4KY7A 4PQXA 4AIMA 2O5IC 1MGSA 5FLXL 2JXMB 4BY1G 4DAAA 4JBWA 4O7WA 1YJ9A 1PH6A 3RR5A 2JA5H 1VQAA 1Y8PB 4JI1L 1KTAA 3S1RB 2EYPA 3KLSA 3H3VI 2WB1E 2GVBA 4DR1L 2B2TA 1B6RA 2OXPA 5FKAC 3F2DA 1CKNA 4LF4L 5IE8A 4FFNA 2V59A 1DCZA 3JAME 4FO2A 3KALA 4O86A 1F2LA 3QB3A 3K5HA 3QOJA 4RH6A 3ZYYX 4DR4Q 3VPBA 3J80E 1SN8A 4O4IF 3PIO3 2OWOA 4XDXA 5FR9A 1WTRA 3I4NH 1G2TA 5BYAA 4KD3A 3NBZB 3MXNB 3BZKA 1BCPC 3R2IA 1JLLB 1WTHA 3GTMH 3D6WA 1TWCB 2FB9A 4EQ5A 1N34Q 2PO4A 3FMCA 4TV8F 1R9TB 1WTQA 3K5NA 2QW7A 2I5HA 3MHBA 3PF4A 4LFBL 3LULA 1L0YB 1D1KA 1SNDA 1PRTB 3BZCA 4JI3Q 1LTTD 2A68C 1RCVD 4C3HB 3VA5A 5A35A 2BA0A 5D1OB 3S16H 1EUCB 1PFBA 3D4RA 1WCMB 1W2BA 1K83H 4A3IH 4CKBA 1O80A 4JBKA 3DEPA 1B44D 4FU0A 2IY5B 5CBAE 1STAA 5DNFA 1YHAA 1MI2A 2NU6B 1JWMD 1DZ1A 1CTMA 3G71A 1ULZA 2HVSA 4UDUC 4F87A 5IYBH 4LF9L 4JG2A 2JA8B 3A5ZB 2EYJA 1AZPA 2Q7DA 2PZUA 3G6EA 5M5YB 5CE8A 3HS0C 1EWIA 5HV6A 1SDFA 2KHJA 4IOAA 1ENAA 4QUFA 5LXTF 1Y8OB 2N3SA 2PI2E 1Q46A 2FXQA 2UU9Q 2DN8A 4JI4Q 5CYUA 2PW5A 4TVIA 5E7NA 1EIHA 3S17B 1EY5A 3HOUG 1LTBD 4X66Q 1BCPF 1I5FA 4P73A 4DUZQ 4G57A 3NBHA 3KF6A 5M5WH 3SK6A 2LY7A 3VPDA 1GVPA 4TUYF 4JW0A 1L1OC 3A5UA 1TAEA 1DXMA 3CPWA 3UE0A 3LX0A 3SXHA 4ALPA 4B3TL 3OTOQ 1G51A 5TSSA 4J1MA 3EROA 3VR6A 1C4QA 1Y1WB 2XNAC 2Z9HA 3KDFA 4EX5A 4IUQA 3SE0A 1M1KC 1B9NA 3HOXB 3HOZB 3LQSA 2BE5C 1CKNB 1LUZA 1G8ZD 4KJNA 2DLNA 4IUTA 4CDDC 2A5HA 1ZKOA 3I3CA 1TT2A 4A3GH 2A74C 1JC7A 3QWNA 1EKVA 2WINB 4R9WA 1CA6A 1L1OA 3U4VA 3Q8DA 4ZAIA 1TQOA 1YBYA 1HTLD 4DQNA 2YTYA 2B2VC 1RJTA 5I9OA 1Q7YC 4GN3B 2QILA 4Y7NH 3ONAB 1AW7A 2R93G 4DIMA 3QR8A 4ZK9B 2DZDA 2WB1B 3HOWG 5L37A 4KV6A 1PYBA 4DV7L 1AE3A 4L8JA 3I12A 1U0LA 1Y69U 1EIFA 1A9XA 4B3RL 1H95A 5IYCH 3EIVA 1RTOA 1EEFD 2B2VA 1PX2A 1IBKQ 3P1HA 4L5SA 4BXXH 4JV5Q 4ID6A 1LV9A 3FHWA 4HNUA 5C6AA 2Y0SG 5C1PA 1I2KA 1JOOA 1Z7TA 4A3FH 2WAQE 1VMCA 1BCPB 1GUNA 5J39A 4LFCL 2Z04A 2OQ0A 4A3JB 2K52A 3SNOA 3RLFA 1JJCB 5JJKA 1FYCA 4LAAA 3I4MG 3E9HA 3OMCA 2VXWA 3CCUA 1EYZA 1CZGA 1SYDA 1W6JA 1CHPD 3M7NA 1BO0A 3GQBA 1AEXA 4OWXB 3S1QB 3KBXA 1XYIA 4B3SL 4K0KQ 3A7AB 1XPOA 5C4ZA 4KLKA 1I4XA 4PG3A 2B29A 1JICA 2PZWA 1K3BC 1FR3A 4M0JA 2F0HA 2N78A 2NTSA 4TVAB 3S24A 1RHPA 3AX6A 3BABA 3PUZA 1IYJB 3U9SA 2JA7H 2YU9H 1XTDA 3FKIB 1Y1VH 4XQNA 1II3A 5DGIA 1U4PA 4F7XA 2R85A 3A8KE 5J2TF 1VQLA 5C4XB 4RG1A 4B9XA 1N36L 1D1IA 1ESFA 3NEMA 5I2YA 1MIUA 2WKDA 1K8AC 3C1EA 3GD7A 3NBHB 4M1UB 3PO3H 1IW7D 2HHHL 3JRWA 4HN2A 2YTXA 3KF6B 4FE2A 4JXUA 3UDXA 1FL0A 1DIKA 4I55F 1W3SA 2VY3A 2HCIA 2PNRC 1G6ZA 3N52A 1CKOA 1PTOB 3JSLA 1EEID 2L55A 4FF2A 4IALA 4CJ0B 2VUMB 2D5DA 4KHPQ 3TP5A 4YBZB 4O83A 3KDFB 1JORA 1J8IA 2YZGA 3P75A 1JWSD 2I80A 3RZDB 3IFTA 2E75C 3ULPA 4IPDA 5C1OA 4FFPA 1EY4A 1L1OB 4DFAA 4EVOA 4HJAA 5JPMC 4LMQD 3MA2B 1YHBA 4RGNA 2F0DA 3DWPA 3KOJA 2R61A 3MVVA 4L1KA 2RKSA 4A3BH 3RV4A 2RF4A 2MFIA 2Z02A 4IFDH 1B7YB 3K59A 2OLSA 4LH6A 3QOLA 5BR8L 5M9OA 4RAUC 4YHHQ 3TP8A 1EZ8A 1QVGA 4GNXC 4MV3A 3D4WA 3TY9A 4DR5L 1IOWA 3PF5A 2DUDA 3TP7A 2EYFA 2NVXH 1EL0A 1N32Q 2EXZA 1X3EA 1TWGB 1YEZA 5FJ8H 4G4KA 3KFUA 1WCMG 4N9PA 1KLGD 4MIUA 3U50C 5HURA 1O78A 5M3MB 4DR7Q 4MHEA 1PZKD 4RZQA 2BH8A 2K4KA 2QKIC 4RGOS 2ES2A 2Q2IA 5JJLA 2VQEQ 4GNXA 1CS0A 5IGFA 2NUAB 1STNA 1F77A 5GQOA 2JA6H 1YHQA 5CV6A 3Q6SA 4BBSH 2HJWA 1MSGA 1C9OA 4IN3A 2JA8G 2YW2A 1J9OA 1QJOA 2E2IB 4LF5L 1UUPA 3MEHA 4O7LA 3DM3A 4I50F 1Z2NX 1K8GA 1HUNA 4KHVA 1I4QA 1IYEA 1BOSA 1GUGA 4O7YA 3TIIA 3P20A 1K9MC 2SNMA 2WAQB 3PSIA 2MO1A 1KDBA 2O4XA 2I5LX 4POGA 3D8GA 2F0MA 1B50A 1HUMA 1V9PA 3J81j 3STBD 4EQPA 1FGBD 1SNMA 3W5OA 1F9SA 2EQSA 3E0JA 4JC0A 2L9HA 1EY8A 3NK9A 3F2UA 3FEWX 4B08A 1E4EA 1Q1EA 1KBLA 3NQTA 2VS1A 4LF8Q 4DK0A 5C3WA 2ZT9C 3TQTA 1OXXK 2B3GA 1A63A 4JI6Q 2L1BA 3CU7A 1XTCD 2UUCQ 2OEOA 1QCBD 3BG3A 2MNAA 1F9PA 1G6PA 2RBMA 1HHVA 1UNSA 3KLSX 3WWVA 3G8CA 2NN6H 2NWGA 1MSHA 3HOZG 5ELDA 3T13A 4A3FG 1XMQQ 3HG9A 4JI0L 3TS2A 2QK4A 1VQDA 2VQDA 1I1LA 1PRTD 2IT1A 3K8AA 1A2UA 3CSWA 3SE7A 4A3CH 1XMOQ 1IHZA 1TWAB 1P8LA 2UXDL 2K04A 3D4DA 4BY1B 4DV0Q 3A74A 4IFDJ 1ZEQX 2E2JH 1E2WA 4RCNA 3RMHA 2R7ZH 2AHOB 3BG5A 1KEEA 2R3ZA 1SYBA 5E4WC 3PIPA 1KJIA 4X62L 2B63H 2PVPA 4X64Q 5GAGC 4ME3A 5DAUA 1DOLA 4G7OC 1XNQL 4DGZA 4OWWB 1Z9FA 1ASYA 2HUGA 4JI2L 4XXEA 1E0BA 1AP0A 2OTLA 3GTLH 4B9WA 4FFRA 2XTIA 4YY3Q 4WBNF 4X3TA 1GGOA 1PVOA 5D8DA 4C3JH 1H9SA 3OYYA 2Y0SE 3Q22A 1IBLL 2PPBC 2NBFA 4HJ8A 1VBGA 1K8OA 5K5PA 1JOQA 2XWBB 1STHA 1ENFA 4PZ6A 5G3LF 4CMDA 2C9OA 4TQUS 4LF6Q 1F9RA 1KT8A 5EAYA 4FDBA 4JI5L 1NNXA 3J80i 4GNXB 4AQYL 4A3KH 5I5WA 3WNZA 5CC4A 4EQNA 1X3QA 2A6HD 5FO9B 4CMFA 4GLXA 3QIAA 2EJ2A 5I5SA 2K14A 5T1GA 1EWCA 4FP5D 2EIFA 2EYHA 1PYWD 1DAAA 1JKJB 2NVTH 3VOTA 1M0WA 1IBMQ 2IP4A 4A3EB 5DM73 1XNRL 3HP3A 3NSWA 3VYSA 1C7YA 2LXKA 5IWAQ 3KYHC 4FFLA 5I5VA 2HQEA 3OIQA 3CCMA 3S14H 3GDEA 5HGQA 1KL9A 1KRTA 4FXGC 4CHTB 4JI7Q 2FP4B 3BYYB 5JEAG 2L15A 1X9NA 3DTGA 4GLVB 1AN8A 5C3XA 5IP7H 1TWHH 3KBGA 2QGQA 4O7ZA 3J81E 1IYVA 1E4EB 3CF5A 1LTRD 4HN7A 1SE4A 2P0AA 4V190 5GONF 4LFAL 2BH2A 4EGQA 5HBRB 1YNJC 1PFSA 1GO3E 2PCFB 3I91A 3MXPA 1SFOH 2R7DA 2VUMG 2ID0A 2J7ZA 2YYAA 3HOUB 3A0JA 1WI5A 4P75A 1LYLA 4LF7L 2HDLA 1HJPA 1OXTA 1RIPA 1CSQA 1C0AA 2YZMA 1HZBA 5CB4F 1VQOA 1A3GA 4IWXA 4DRFA 4HJ7A 4MA5A 5COYA 3HFZB 2UU9L 2P5ZX 4JI4L 3AU7A 3AW8A 5C3EH 1WTXA 4R1JA 3ERQA 4JI8L 1BXRA 3HOYH 4X66L 3G4SA 3T9FA 2ZM6Q 2QB5A 2OF1A 3GLKA 2KEDA 4DU9A 1XXGA 3GTKH 2A68D 5M3FB 1XJVA 3K7UC 3DLLA 1YJNA 1CT1D 1S3OA 2F0VA 3OW2A 2CW0D 4BS9A 1YIJA 4DV1Q 2HHFA 2X5RA 4O84A 4B3MQ 1H9SB 3R8BA 1PDQA 1VQ9A 4BBRB 1GSHA 2R92B 2K7VA 4WJ4A 2AUJD 4FYDA 4RGTA 3PQIA 1ILQA 4IURA 3OTOL 3SEBA 1H9KA 1LT6D 5BWTA 4DV4L 3TW6A 1JJGA 5BWRA 3LWUA 4O4JF 1A15A 5D14A 2F3IA 2F3VA 4DUYQ 4JYAQ 4DV3Q 1S5DD 3H6MA 1EQQA 1PH1A 4UCVA 3TRZA 1S40A 2PBZA 2B39A 4LJZC 4EG0A 2F0JA 4R4OA 2Z4IA 3CCRA 2ALYB 4NYEA 1JWUD 4HEDA 4BWGB 5H1SE 4O7TA 4DR3Q 3ERSX 2Y0SB 3J81L 4G7HC 4DAYA 1PTOD 1O7IA 5C4JH 1SMXA 1BXTA 1HR0Q 4NXNQ 2KVMA 2WAQG 4DV2Q 4A3LH 1PFNA 3CD6A 2NVYH 1VQPA 1IXRA 2JA5B 1BBWA 2GPSA 1VQEA 4QY7A 4K14A 1SAPA 5NUCA 3I4MB 4PBCA 3CW2C 4C5CA 3IAYA 1IKLA 3RLOA 2KCMA 2RVLA 1E2ZA 1ENCA 1VQMA 1A3TA 1SE8A 4FF4A 3ETHA 1XPRA 5I6YA 4OO1H 2B2UC 1I4RA 1KJQA 1F9QA 2JP1A 3K5MA 3W3AA 2WFWA 4DK6C 1PH4A 4R4QA 4LK1C 4NPSA 4JPBW 3T99A 5FK9C 2EJ3A 3DM1A 1QB5D 1VQ4A 3I4NB 5JJIA 4R4IA 2OCEA 1ILPA 1CHQD 2IPKD 2EOTA 2J0TD 4XTCS 2B2UA 2HQLA 1HCZA 1I4GA 2E2DC 5JQWA 3GTMB 3W1GA 2AWNA 2K75A 1M4VA 3FPUB 4K0KL 4KY5A 3UZBA 3U4ZA 3PUXA 2VB3X 4ZKBB 1WD1A 1E7ZA 4NMZA 1ZAUA 3NXWA 4NZNA 2YS6A 2K28A 1W93A 4UP8A 4UUGA 2VQFL 3MTSA 1F2MA 4KK7A 3S16B 3F8TA 5EBCA 2A69C 4TRDA 1K83B 5KNDA 4A3IB 2CNQA 5C44H 5IT9E 1HA6A 5E3FA 5I9PA 3EFXD 4A76A 1AUVA 2YL2A 3HEJA 2HT1A 3GTOH 2HHFB 1N33L 1S68A 4C2MH 1EQTA 4XYMB 2K03A 2UXCQ 1EKFA 2E2HH 3C2PA 1H9MA 5IP7G 2QDLA 2K50A 3F2CA 4KHPL 3AYHB 4K6LA 3BU2A 5DM63 2NYZD 2Z4HA 4OHJA 3M3YB 4QGUA 3G8DA 4IUPA 2AMCB 1F2ZA 2CQAA 4C3IH 1IOVA 2W6MA 2K5DA 2EJGC 4O7NA 3D0FA 4IUVA 2EDGA 3EN2A 1IYDA 1EU4A 1NSNS 4A3EG 2XCLA 1LTAD 4E6NA 4DAYB 5M5WB 4CKEA 4EFEA 1G91A 4NDXA 4C5AA 4K2KA 1FJGQ 2WP8J 4K2LA 2L12A 1UEAB 2F4VQ 4QIWE 5AJ3L 3ORQA 5BWWA 3A56A 1JR0D 2W6ZA 1TU2B 4O42A 2UUAL 5IY0A 3CMAA 3SK4A 1N32L 3E5NA 1HQMC 1NCVA 5JJZA 3CHBD 1LT5D 4A3GB 2A73B 2C5CA 1I3QH 3ULLA 3KUPA 5LA6F 3RUZA 4DF7A 2VQEL 5FLXc 5JVDF 4IJHA 4Y7NB 3IRBA 1Z2PX 4DV5Q 2X6LA 2XSCA 1MKHA 1SLJA 3K57A 4IFDI 1J5EQ 4LNQA 1HH2P 2B8FA 4PMCA 2KUMA 3T16A 5IYDH 2K5WA 3D3RA 4WFN3 5FPRA 4GZYC 2KEEA 4YCWA 3GTGB 4BY7H 5IT9L 5IGGA 5DISC 2DIKA 3VR2A 5FOBB 2SDFA 4IPGA 3JAML 1Q90A 2RDFA 5K2MA 2F03A 3S2DH 3J80L 5CR3A 3J7ZC 5LMUQ 3I4OA 4C3HH 1T5XD 3PO2H 3DF7A 1CK1A 3K5OA 2VB2X 2GQRA 1A8VA 4A3FB 4Y52H 1CI3M 5M3FG 1STYA 4S3SA 3CCEA 2ATWA 1W96A 1DOMA 3MEFA 2ZGIA 2R7MA 4LF8L 3RTXA 2R7FA 4RKBA 2NU7B 1ET9A 4UCRA 4BBRG 2R92G 2UXBQ 4DAVA 4JI6L 5KYLA 1VQIA 3S2HH 1I7NA 1E1OA 1RD9D 2IL8A 4DR6L 2FINB 4TKOB 1B6SA 3TN2A 4GLWA 5KX5F 3T1HL 4A3MH 3HOVG 2R7NA 3CQZH 4NW2A 1I2LA 1ZYRD 1HFGA 3WO1A 4HCSA 4MZ9A 2F0SA 2EXDA 4QCLA 2DNEA 2PNHA 3J7AF 5CMDA 5ELCA 3HBLA 1NR4A 3U9OA 3L7ZC 2BCOA 3BDOA 2JA7B 2FPIB 2E8GA 2YU9B 3NPPA 3OSOA 4IHJF 1Y1VB 3AB9A 3CRKC 3LGJA 2E5LQ 3NTKA 4X6AH 5IP9H 2KCCA 2NZOA 3EVQA 2KQ3A 1MJEA 1PFMA 3L0OA 2J9GA 3PO3B 4IZ8A 1T9HA 4OX9Q 4Y8VB 3P7JA 1WRVA 3PUWA 4LW1A 2E76C 2CVRA 4ZI7F 2JA5G 3NBYB 3JZIA 1HXYD 3SK5A 1NTGA 2H4OA 1TWFH 2NN6I 3TP6A 4I7AA 4CJ2C 1KDCA 5FO7B 2HCCA 5I4DA 1EIYB 1XPUA 2F0OA 4RKLA 1B04A 4X65Q 4XQJA 1Y1WH 2COJA 4YAJB 1AH9A 2VR1A 3HOXH 4CJ1B 4APVA 3GJXB 3VMMA 1VQ6A 2AQ2B 1MHWC 4ZOLF 5CV4A 4IUUA 5BN3A 2IHEA 5LL6S 3JZFA 2K05A 3GIDA 1OTCA 3BVGA 1HZ9A 4FFMA 3I4NG 2K32A 2KHSA 1X3GA 2M2LA 3J80c 1KLUD 4A3BB 4UCTA 4QIWB 1DM0B 1X56A 4E4TA 4BA1I 4U673 3PFFA 2CH4A 5I60A 4CE5A 1GSAA 1JMCA 1A3VA 1U5KA 2M00A 3OUUA 3AQQA 3TW7A 4L5RC 3TQYA 3GTJH 2JE6I 2Z1CA 1C8CA 3GTPH 4JI1Q 2NVXB 3KLWA 2Y4RA 2A6EC 1TKWB 5GAHC 1OBDA 1O7YA 2SNSA 4OL7A 2K01A 2TSSA 3I4LA 5CORA 4EGVA 3J81i 2IW3A 4DR1Q 3DTFA 4KJOA 4FFOA 4IPHA 3GTQH 4LF4Q 3QWUA 4OEMB 4A3IG 4UP9A 2NUCA 4Z9CB 1SMYC 3L9AX 1QE6A 4YWLA 1ML0D 3Q2OA 2AKWB 3DUZA 1FNWA 3WOFA 3UDGA 3PUVA 2ZDGA 2YTVA 2WIIB 2NTTA 4F8MA 1NMGA 4RMFA 5HY6A 2PMZB 4WHXA 1JB3A 2JA6B 2FMMA 4MNOA 4BBSB 5IYBG 1CSPA 3GB8B 1JDEA 2CZGA 4AYBB 1U4RA 4UPAA 3X3NA 5FLMH 1HNXL 1KJ8A 1HPCA 1WVLA 3BZDB 2GLTA 5D65A 2YRXA 3QG1A 1H9RA 3K0XA 1VQBA 4LFBQ 2VW9A 4HIKA 5I47A 1VQNA 4YWKA 4WJWA 3HB9A 4N8X1 3TEHB 3FKIH 1WTVA 5K36H 5KS8A 2E74C 3A7LA 1BR9A 1VQGA 2FMCA 4HSPA 4UAIA 5C0XH 1TS4A 2HGXA 3UE1A 1SE3A 4DNTB 5EGTA 2D0PA 3K58A 1JE4A 1BBXC 4UFZA 4R8NA 1O7ZA 3RLNA 4O81A 4ZUIA 4UHVA 1B53A 2YRWA 1DONA 4LF9Q 1X55A 4DV1L 4RA8A 4C1NI 4YCVA 1PTOH 4B3ML 2SCUB 3OPOA 5CV8A 3M4YA 4M8AA 4A3DH 1YNJD 1IYUA 1TS5A 2K33A 4Q0FA 1LM0A 4A3GG 2MUYA 5CBEE 1ONLA 3E6ZX 4L63B 2N88A 4MV1A 3K5LA 3R9RA 1VQJA 1ASZA 1Q8KA 3I7FA 1MJCA 2DABA 1LLRD 1PH8A 2NB0A 2R7ZB 2O2LD 2L0CA 5JVH3 1Z47A 4K5XA 2N8NA 2RHSB 3K6OA 1YITA 2W6NA 4DR2L 1VBHA 4NZMA 3CMEA 1SJED 1I6VC 3U9TA 5IYCG 3GTLB 4DN4M 1HR0L 3FPPA 2NVQH 2WV6D 4HMJA 4G7ZC 1K3RA 4C3JB 3K80C 4LH7A 4EQOA 4BXXG 1EFWA 3U55A 1C48A 4JBMA 1WTOA 4RGMA 3VR3A 1UE6A 3I70A 1Q1BA 2CKZB 3KREA 4HMIA 4O0AA 3JC66 2YZLA 1UWVA 5D3IB 1I7LA 4H44C 5LOVF 4XIGS 1SNPA 3CCQA 5M3MH 1GUOA 1EWHA 2OQKA 2Q8RE 4KTAA 3F1ZA 3K3PA 4Q4CA 4I65A 4MV4A 2RCNA 5BWXA 3L3OC 4FVMA 1VQ8A 4EGJA 2Q2TA 4XZ3B 2TMPA 1CE8A 5CAEB 4YJ3F 2HDMA 2XGTA 5KNBA 1HNWQ 1B2TA 1ET0A 1M8AA 1DV2A 4MN3A 2RDGA 1PZJD 3I73A 3MZ5A 3W2DA 1S4ZA 2R6GA 1WFQA 2KENA 2N55A 4B3RQ 3M4OH 3S14B 1FVIA 3GO5A 2F4IA 2UUBL 5BYBA 1YVCA 1BDOA 2L4NA 2JA7G 3K7AH 2I5MX 1Y1VG 5C0XJ 2F0WA 1A0GA 3BA9A 1IW7C 5E1FA 3R93A 1O7LA 1L0XB 4OO1I 5BN4A 5FPOA 1S5ED 1EIGA 5KNCA 4DPGA 1NAPA 3PO3G 1TWHB 1J6QA 2ENBA 3JAMi 1STGA 5JAVA 1CQJB 5DGHA 3VPCA 1I6HH 2BDNA 2IX1A 1FNUA 1PHJA 2COIA 2F0QA 2R86A 3HKZB 3CP0A 4CGYB 5EQ0A 2C35B 4RCOA 1DYQA 3PGZA 4B3SQ 4DR4L 3G48A 4KY6A 2Z6KC 3I55A 1IKMA 2LSSA 2EZVA 4K5WA 2HDKA 4MA0A 2X0SA 3RUPA 3ITPA 4DKAC 3CC7A 1NE3A 2YYZA 4ABNA 3J7AV 4CC6A 1T5EA 4MAMA 1RF2D 2EY2A 2GVAA 3MXGA 4IQZA 1TWAH 3FVQA 1N34L 3R5HA 4OONA 1M6VA 2CWAA 3LWBA 4BY1H 2PN1A 4FF1A 1PK8A 3NELA 1NY4A 4A3BG 5CV9A 1JCKB 1N36Q 1BF4A 1DD2A 5C3EB 4JI3L 1FD7D 4J8QA 4IFDG 1A48A 2EJMA 3HOYB 2VZAA 2HHHQ 4QB4A 3GTKB 4DAMA 4ILWA 5KRUA 3U54A 5BPHA 3ORRA 5M5XH 1SE2A 2ASBA 3I2ZA 4K6DA 4YCUA 1X54A 4O7VA 3H15A 3TDQA 2HD3A 1TVXA 3TBIB 4N8FA 2JJQA 5K3WA 1EYAA 5ELNA 5FJ8G 4C56C 2AQ3B 2QEJC 2X6GA 4HQ6A 1SBBB 1WYDA 3HKSA 2V4DA 3TY5A 1SYCA 2ZTCA 1KAAA 4X3UA 1QILA 4A93H 1STBA 4A75A 5IGBA 2R7LA 4YAKB 2N49A 1LTSD 2JA6G 3GV6A 1XDNA 1VDZA 4BBSG 1BCPD 4DV6Q 2H5XA 1FNVA 3KK7A 3UDIA 4AYBG 1GM5A 5GAEC 1HNZQ 3N6RA 3NTHA 2A1HA 2FPPB 1W6KA 1GHKA 3EA6A 3OOCA 5BWUA 2I46A 2SEBD 1J5EL 1BKBA 2ZDQA 3MWEA 3U0GA 4DUZL 4DR5Q 1LT4D 4RFBA 3STBC 1WD0A 4NXMQ 2VUGA 1DJRD 2NVYB 3UQ8A 2JEBI 3BVZA 1CQVA 1GHJA 1H9JA 2F0LA 2I87A 3QQMA 3FP9A 5LYJF 1SR3A 1KIXA 2HGWA 2H1EA 3WOEA 2Q2HA 3M9BA 1GD7A 1EY9A 1JQYD 3VA7A 2B2YC 3NP8A 3TS0A 1JE5A 5EJWA 4DK1A 3HOVB 5HGTA 4QL5A 1OXVA 2FPGB 4K6NA 4KKTA 1YNNC 4YB8B 3I72A 5J22A 4C5BA 2XD4A 1FGUA 4LF5Q 3S15H 2EY5A 2NN6G 3BA8A 1SNQA 2UXBL 3CKIB 1D6EC 4ME6A 3HOUH 2B2YA 1GKHA 1UEBA 2D2CC 1K8MA 3KF8A 4J6HA 4A3CG 5IGCA 5CA1F 4DNRB 3WWIA 2CH4W 1BQQT 4GKJQ 5I5XA 1C30A 2R7ZG 3SHLA 3S1MH 4ZYSA 3VNNA 1E1TA 2ZXOA 4XYQA 2B63G 3NC0B 1IBKL 1Y14B 3BAAA 2EE1A 4JV5L 4OWTB 1MD2D 2E5LL 1M90C 1S5BD 5C44B 4H02A 1UC9A 4EFBA 3CCJA 1VQ7A 3WWHA 2EVBA 4C3JG 3TREA 3GTOB 1I1MA 4XYOA 4OXPA 2BE5D 4C2MB 3NENA 3H0GH 1HRJA 3QO2A 4N9TA 4XYLB 3ULJA 1E24A 2E2HB 4GOPC 4JI0Q 1QWYA 1PH3A 4DXFA 3X3MA 2R93H 2A6HC 3RFCA 4PMBA 1X3FA 1U4MA 5C4HA 2VL6A 4A3KG 2UXDQ 4P71A 3DEOA 3DWAA 1VQ5A 4OIKA 4C3IB 3HOWH 3T9EA 1PRTF 1QUQA 2KECA 3ER0A 4P72A 1GUTA 3NBIA 1PLFA 1T36A 5IGDA 3SK8A 2DWCA 5J1ZA 4GOPA 2RQXA 2K1BA 4NB3A 2WYOA 1HR0W 1HZAA 4ZCKA 1P16A 2JYOA 4NP5A 4OELB 1R4PB 2Z0SA 1XNQQ 3AMUA 2NU9B 2XIWA 4JI2Q 5CV5A 4ZQIA 5CA0F 5J2UF 3NQIA 4IJLA 1VF7A 1WR2A 3NUAA 3V05A 4O2DA 2FFKB 4GN4B 2F3WA 5F2DA 1IBLQ 2VNUD 1XX8A 3I4MH 1BBUA 5EZYF 3C46A 4KN7C 2KA7A 1I50H 1MBYA 1QG7A 2DJGC 1IL2A 4R4CA 4F88A 3S1NH 2V5AA 1D8LA 5LMNQ 4P2CB 1TR5A 4JI5Q 1PH7A 3KJPA 4AQYQ 5IIFA 4KD4A 3J81c 1I3QB 1ET6A 5LP6F 3BDLA 2CWPA 4R4TA 4O7SA 2F0NA 3IKJA 4PV1C 3HKZG 4JBJA 2YWVA 4QQBX 1ESRA 2GQSA 3RZOH 5D3DA 1PH9A 3T54A 3HRZC 4MV8A 2LFNA 3A55A 1XNRQ 1NMFA 1HTPA 3VYTA 4A93G 1VCIA 4DA2A 2A19A 3H91A 4BY7B 3KF8B 2K6AA 1CM9A 3M7GA 4O2BF 1DV1A 1RODA 1WTWA 1TXYA 4YHHL 2OTJA 2ZTDA 4GN5A 5LL6X 2M9VA 5ELEA 5E25A 3S2DB 1CQIB 4CHIA 2Z8LA 1QOHA 5C3EG 4X3KA 2RSNA 2QCPX 3S1RH 4MTNA 1QZGA 1AZQA 3PO2B 1A6XA 4U68A 3HOYG 2CW0C 4ME5A 3CCSA 3C3LA 2F0EA 3R5XA 4GS3A 4RWSC 2A6ED 1I94Q 4UY8C 4LFAQ 2COGA 3BVMA 1B8AA 4DR7L 5LHY1 4HNVA 3B6YA 2IX3A 2RCFA 1RL2A 2LKVA 2KCNA 1V1QA 1SMYD 2CFMA 1TS2A 1D2BA 2W6OA 4CC5A 1KJJA 4GKKQ 3S2HB 5LMNW 2CNUA 2MPMA 4UCOA 4A3MB 4K8IA 1F2YA 4LF7Q 1B3AA 3CQZB 3MC0B 1EUJA 2FJ2A 2PMZE 2IX0A 3M3YH 1I1KA 4TV9F 4O4HF 1TWCH 5I5TA 5ISRA 5AFWA 1X6OA 1PMRA 3TZUA 4M9UA 1R9TH 1QUQB 4AYBE 3MWDA 2DJFC 1KQSA 4WORA 4L6TB 1PTOC 2CNVA 2HIVA 2BA1A 4JI8Q 4GOPB 1EY0A 2JN4A 2JEAI 5C0XI 3VYUA 3U58A 1LTLA 3D6CA 3VR5A 1ICFB 1NUCA 2ODTX 1HFNA 1WCMH 1S72A 5DEHA 1SXTA 4A3LG 4O82A 3T9BA 4K5VA 1STEA 1KNEA 5E4XA 1CUKA 2G9HD 2ZDHA 1PH2A 4O2AF 1AFPA 1B3QA 1TWFB 3UZOA 3M85A 2AUKA 4JVZA 2DNCA 2UUCL 2PI2A 2EYMA 4DV4Q 4OO1G 2JA8H 1OBGA 1UE5A 3RN2A 2MQHA 1A62A 1XMQL 5M5YH
chains in the Genus database with same CATH topology
5JEAG 2A8VA 5J3BA 2A1AA 2K5HA 1WJJA 2L15A 1X55A 4DV1L 1X9NA 2UUBQ 4LUOA 4LF9Q 3H0GG 4GLVB 4YCVA 5IP7H 1KHIA 4B3ML 1TWHH 4AIMA 2QGQA 1XMOL 1K0RA 3T1YQ 4A3DH 3F2BA 3EBEA 4BY1G 3CF5A 4DV0L 1V43A 4JBWA 1LM0A 4LFAL 1YJ9A 1PH6A 2BH2A 3RR5A 2JA5H 3S17H 2KHIA 4A3GG 4UCVA 1VQAA 1HNWL 4JI1L 1PFSA 1GO3E 3H3VI 2WB1E 1KXLA 4LUVA 2GVBA 4X64L 4DR1L 1SFOH 3GTGH 1VQJA 2R7DA 3F2DA 1ASZA 1Q8KA 2VUMG 1OXUA 2ID0A 1CKNA 1MJCA 3I7FA 4LF4L 1PH8A 5IE8A 4HJ9A 1EOVA 3CC2A 3A0JA 2V1CC 1WI5A 1Z47A 2N8NA 4P75A 4YY3L 1PA6A 1LYLA 4LF7L 1D7QA 2ZJRA 1HJPA 1OXTA 1RIPA 1CSQA 2RHSB 1C0AA 1HZBA 1YITA 1VQOA 4DR4Q 4DR2L 4DRFA 4HJ7A 1SN8A 3CMEA 3H3VH 5C44G 2OWOA 1DGSA 3HOZH 5IYCG 1HR0L 3I4NH 2NVQH 4L5QA 3NBZB 1K3RA 3HFZB 3K80C 2UU9L 4LH7A 4BXXG 3MXNB 4JI4L 5IT9c 4LF6L 3BZKA 1EFWA 5C3EH 4JBMA 4R1JA 3M4QA 3GTMH 2D62A 4JI8L 1UE6A 4QJFA 1Q1BA 2CKZB 4X66L 4EQ5A 3JAMc 4O0AA 2ZM6Q 3G4SA 3JC66 3PO3H 1UWVA 3GTKH 1XJVA 3PF4A 4LFBL 2I5HA 3K7UC 3DLLA 1YJNA 4XIGS 1S3OA 5M3MH 3CCQA 3OW2A 4JI3Q 3BZCA 1YIJA 2OQKA 4DV1Q 3F1ZA 4B3MQ 2I0QA 2RCNA 2BA0A 1VQ9A 5D1OB 3PN1A 1VQ8A 1IBML 3S16H 4WJ4A 4PZ7A 2Q2TA 1W2BA 1K83H 4A3IH 3OTOL 5IWAL 2CCZA 2XGTA 1Q86C 1HNWQ 1YJWA 4JBKA 4DV4L 2VQFQ 1JJGA 2IY5B 4JI7L 2R6GA 1YHAA 2F3IA 3PUYA 1WFQA 4DUYQ 4JYAQ 4DV3Q 1L2FA 2KENA 3G71A 4B3RQ 1EQQA 1PH1A 3M4OH 1FVIA 3TRZA 3GO5A 5IYBH 1S40A 4LF9L 4JG2A 2UUBL 2CQOA 3A5ZB 1YVCA 2ZJPA 1VQCA 4R4OA 2JA7G 3CCRA 3G6EA 3K7AH 2ALYB 2I5MX 1Y1VG 5C0XJ 3PIOA 3CPFA 4HIMA 1N33Q 4A3JH 5H1SE 3BA9A 1YZ6A 4DR3Q 3ERSX 1EWIA 4GLAC 4OO1I 2KHJA 1IZ6A 4IOAA 5FPOA 2N3SA 1O7IA 4KI0A 1SMXA 5C4JH 1PH5A 4DPGA 2PI2E 1HR0Q 4NXNQ 1J6QA 1Q46A 3PO3G 2FXQA 2WAQG 3JAMi 4DV2Q 2UU9Q 1X65A 3CD6A 2NVYH 1VQPA 4JI4Q 2PQAA 1IXRA 4A3LH 2Q2UA 5E7NA 3S1QH 1UE7A 2IX1A 1I6HH 3HOUG 1NJIC 1BBWA 1VQEA 4X66Q 4QY7A 1PHJA 2HVQA 1I5FA 3CW2C 3HKZE 4P73A 3RLOA 2KCMA 4DUZQ 3CP0A 3UDFA 1VQMA 1SE8A 1XPRA 1YNXA 2C35B 3KF6A 5M5WH 3PGZA 4B3SQ 4DR4L 3G48A 1GVPA 2Z6KC 3I55A 1L1OC 2LSSA 3A5UA 1TAEA 1Q12A 4DV6L 5IYDG 3CPWA 4DKAC 2WFWA 3UE0A 1NE3A 3CC7A 2YYZA 4ALPA 4B3TL 4CC6A 4DK6C 3OTOQ 1PH4A 1G51A 5C4XH 1HNZL 4BY7G 4R4QA 4NPSA 2GVAA 5ELOA 1TWAH 3KDFA 4EX5A 1M1KC 1N34L 4OONA 2CWAA 2ZM6L 1VQ4A 4BY1H 1LUZA 1CKNB 3PV0A 5JJIA 4R4IA 2OCEA 1Q81C 5AJ3Q 3NELA 1NY4A 4XTCS 4IPCA 4NXML 4A3BG 3E9IA 2HQLA 1N36Q 4A3GH 4JI3L 2UUAQ 3W1GA 1L1OA 2K75A 2AWNA 3Q8DA 3U4VA 4IFDG 4K0KL 2VZAA 2HHHQ 1YBYA 3PO2G 4IO9A 4JCVE 3PUXA 2YTYA 5GROA 3U4ZA 1Q7YC 4DAMA 4GN3B 1E7ZA 2VUMH 4Y7NH 5M5XH 2R93G 2ASBA 3I2ZA 1L0WA 1BVSA 4YCUA 1X54A 3H15A 4UP8A 3RZDH 1QVFA 2VQFL 2JJQA 2YV5A 3F8TA 2F52A 5ELNA 3CXCA 3HOWG 5FJ8G 3JSNA 4J15A 1PYBA 4DV7L 1AE3A 4DUYL 1U0LA 4JYAL 1B70B 1EIFA 1UE1A 4DV3L 5C44H 4B3RL 1H95A 1WYDA 3HKSA 4A76A 5IYCH 1JJ2A 3TY5A 4HJ5A 3EIVA 1A0IA 2ZTCA 4HIOA 4A3MG 1KD1C 1IBKQ 4A93H 4L5SA 4BXXH 4JV5Q 2HT1A 3GTOH 4A75A 2AWOA 3FHWA 1N33L 1S68A 4C2MH 1VQKA 1WOCA 2UXCQ 2N49A 3AFPA 2Y0SG 3CAMA 4DR3L 2E2HH 2JA6G 1XDNA 4A3FH 4BBSG 2WAQE 5IP7G 4DV6Q 2H5XA 1N9WA 4NXNL 4B3TQ 3UDIA 4LWCA 2K50A 4AYBG 3F2CA 1GM5A 4DV2L 4LFCL 5GAEC 4GKJL 1HNZQ 4KHPL 3AYHB 2OQ0A 2K52A 3AEVA 3BU2A 3RLFA 1JJCB 5JJKA 5IP9G 4QGUA 1TWGH 1J5EL 2AMCB 3I4MG 1E22A 3E9HA 4C3IH 4DK3C 1BKBA 4DNIA 3CCUA 4DUZL 4DR5Q 3STBC 4NXMQ 3UQ8A 2VUGA 2JEBI 3M7NA 2JK8A 3D0FA 4OWXB 3ICEA 2JQOA 4B3SL 3EN2A 4K0KQ 1XPOA 4KLKA 3FP9A 1SR3A 4PG3A 2B29A 4A3EG 1KIXA 1VS0A 4E6NA 2Q2HA 2N78A 3M9BA 1GD7A 4DR6Q 4DAYB 4TVAB 4EFEA 3S24A 3T1HQ 3TS0A 1CKMA 3M4PA 1Y1WG 1JE5A 1FJGQ 3BABA 2WP8J 3HOXG 3RNUA 3PUZA 1IYJB 1OXVA 2PQAB 4QL5A 2E2IH 2YU9H 2JA7H 1XTDA 3KJOA 1Y1VH 2F4VQ 4DV7Q 4QIWE 5AJ3L 2HVSA 1VQLA 4RG1A 1N36L 2KCTA 3NEMA 3J7A5 2UUAL 5IY0A 3CMAA 1MIUA 1K8AC 1FGUA 3GD7A 3VDYA 3NBHB 4POFA 4LF5Q 2HHHL 2DGYA 5JEAJ 3S15H 2NN6G 3BA8A 2YTXA 3KF6B 2UXBL 2GN5A 4YWMA 3UDXA 5GADC 1FL0A 3CC4A 1W3SA 3HOUH 2VY3A 4BA2I 3PCOB 3CCVA 1GKHA 1I3QH 1UEBA 3ULLA 1EQRA 1CKOA 4A3CG 4HIDA 3JSLA 2WB1G 2VQEL 5FLXc 4LFCQ 4GKJQ 4IJHA 4KHPQ 1KC8C 3IRBA 3KDFB 4DV5Q 2R7ZG 1MKHA 1SLJA 4A4IA 3S1MH 4IFDI 1J5EQ 4LNQA 1HH2P 3VNNA 1E1TA 5IYDH 3ULPA 2B63G 3NC0B 5FPRA 4IPDA 1Y14B 1IBKL 3BAAA 4YCWA 3W1BA 4BY7H 1SRUA 4JV5L 1E3PA 4OWTB 1L1OB 5DISC 2E5LL 1M90C 4HJAA 4IPGA 2UXCL 1YHBA 1OXSC 4H02A 4EFBA 4EEQA 3KOJA 3CCJA 1VQ7A 4P74A 3S2DH 4A3BH 3TREA 2K5VA 3J7ZC 2RF4A 2MFIA 4OXPA 5LMUQ 5LMNL 4A3JG 3BJUA 3I4OA 4C3HH 1B7YB 3H0GH 3NENA 4LH6A 3PO2H 5BR8L 3ULJA 1E24A 4YHHQ 2QEXA 4GOPC 4JI0Q 1A8VA 4Y52H 1QVGA 4GNXC 1PH3A 5M3FG 3CCEA 2ATWA 2R93H 3TY9A 4DR5L 1G291 3PF5A 2DUDA 2D0OA 5FLMG 2NVXH 3MEFA 1X3FA 2Z6KA 4LF8L 1N32Q 3RTXA 2VL6A 1QVCA 2R7FA 1X3EA 4A3KG 4P71A 2UXDQ 4UCSA 3I56A 4UCRA 1YEZA 4BBRG 1VQ5A 2R92G 3HOWH 4JI6L 5FJ8H 2UXBQ 3KFUA 1WCMG 1QUQA 1VQIA 3ER0A 3S2HH 4P72A 3U50C 2HVRA 4DR7Q 1E1OA 4DR6L 2BH8A 2HIXA 2K4KA 2ES2A 3T1HL 4A3MH 4GOPA 1KAWA 2Q2IA 1FJGL 4NB3A 3HOVG 2VQEQ 4GNXA 1HR0W 1HZAA 5JJLA 3CQZH 3FKIG 5K36G 1P16A 1VQHA 2Z0SA 2F4VL 1XNQQ 4MZ9A 2EXDA 5GQOA 2JA6H 5C4XG 2PNHA 4JI2Q 1YHQA 5C0XG 4BBSH 2JA8G 1C9OA 3L7ZC 4LF5L 4IJLA 2E8GA 3K81C 4O2DA 1I94L 4GN4B 3LGJA 2E5LQ 3DM3A 1IBLQ 2VNUD 4X6AH 1K8GA 5IP9H 2NZOA 3I4MH 1BBUA 1MJEA 2ZTEA 1VQFA 2LXJA 3L0OA 1I50H 1K9MC 1T9HA 4OX9Q 3PSIA 1IL2A 2MO1A 4POGA 4A3DG 2I5LX 4KHZA 4R4CA 1HNXQ 3S1NH 3PUWA 4LW1A 1D8LA 5LMNQ 4GKKL 1V9PA 4JI5Q 1PH7A 3KJPA 4AQYQ 3J81j 4DV5L 2JA5G 5BR8Q 3J81c 3STBD 3NBYB 4A3EH 5DLQE 3W5OA 1NTGA 1TWFH 2CWPA 2NN6I 2EQSA 4R4TA 3HKZG 4JBJA 4JC0A 1EIYB 4QQBX 1XPUA 1B04A 4PZ8A 4X65Q 3RZOH 1Q1EA 1PH9A 4JOIC 2VS1A 1Y1WH 4LF8Q 1AH9A 4WJ3M 3ZJYC 1N32L 3HOXH 4APVA 3GJXB 1OXXK 2B3GA 1XNRQ 1VQ6A 1A63A 1NMFA 4JI6Q 2K5NA 2UUCQ 4A93G 1VCIA 2A19A 2MNAA 1G6PA 2IHEA 3KF8B 4UCUA 5LMUL 1N8RC 3RN5A 1PYSB 1TXYA 3WWVA 4YHHL 3HOZG 2OTJA 1OTCA 2ZTDA 4GN5A 4JI0L 4A3FG 1XMQQ 3TS2A 1HZ9A 1KRSA 1VQDA 3I4NG 1JT8A 1X3GA 3J80c 2NZHA 4UCTA 4JOIA 3AFQA 2IT1A 3K8AA 5C3EG 3S1RH 1X56A 4MTNA 1QZGA 1XMOQ 4A3CH 2RHQB 3HOYG 4BA1I 1P8LA 2UXDL 3TY8A 3CCSA 1JMCA 4DV0Q 4GS3A 1U5KA 3A74A 1I94Q 2E2JH 4UY8C 4IFDJ 4LFAQ 3AQQA 1XK5A 2IHFA 4L5RC 2R7ZH 2AHOB 3TQYA 2JE6I 5M3MG 3GTJH 2ZJQA 3GTPH 1B8AA 4DR7L 4JI1Q 3KLWA 1EYGA 5D1PA 2JA9A 5GAHC 4LUZA 3PIPA 3B6YA 4X62L 2B63H 4X64Q 4DR1Q 5GAGC 1YI2A 3J81i 3CCLA 1RL2A 4UP7A 4ME3A 2QA4A 1V1QA 1JB7A 2CFMA 4CC5A 4IPHA 3GTQH 4LF4Q 4GKKQ 1SROA 1XNQL 1N34Q 3QWUA 5LMNW 4A3IG 4OWWB 4UP9A 1Z9FA 1ASYA 4UCOA 3L2PA 4JI2L 4YWLA 2OTLA 3GTLH 2XTIA 4YY3Q 2AKWB 1PVOA 4LF7Q 1K73C 4C3JH 3UDGA 1AE2A 3OYYA 3PUVA 3T1YL 2YTVA 5D1OA 1EUJA 1NMGA 2PMZE 4RMFA 2Y0SE 5HY6A 2IX0A 4DR2Q 1IBLL 3M3YH 1TWCH 4HJ8A 3HOYH 4L5TA 1X6OA 4MNOA 3SGIA 1R9TH 5IYBG 1CSPA 1QUQB 4PZ6A 4AYBE 5M3FH 3GB8B 1KQSA 1PV4A 4OX9L 2KBNA 4TQUS 4LF6Q 5EAYA 4UPAA 4AH6A 5FLMH 1HNXL 4FDBA 2HIVA 2BA1A 4JI8Q 4GOPB 4JI5L 3J80i 4GNXB 4AQYL 4A3KH 5C0XI 2JEAI 3K0XA 3U58A 1LTLA 4BBRH 2R92H 1VQBA 1HZCA 4GLXA 2VW9A 4LFBQ 1WCMH 4HIKA 1S72A 2K14A 4A3LG 1VQNA 2EIFA 4UFZA 1NBWA 2MO0A 4X65L 4IOCA 4YWKA 1CUKA 3HOVH 2NVTH 3TEHB 1IBMQ 1PH2A 3FKIH 1Q82C 1XNRL 3M85A 2UUCL 1C7YA 2LXKA 5IWAQ 2PI2A 3D31A 3KYHC 3CCMA 1VQGA 3S14H 4DV4Q 4OO1G 3GDEA 5HGQA 1KL9A 3UE1A 2JA8H 1UE5A 4PMWA 1KRTA 4X62Q 3RN2A 2MQHA 1A62A 2D0PA 1TA8A 4JI7Q 3E0EA 1XMQL 3RLNA 5M5YH 1QZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA G;  2A8V A;  5J3B A;  2A1A A;  2K5H A;  1WJJ A;  2L15 A;  1X55 A;  4DV1 L;  1X9N A;  2UUB Q;  4LUO A;  4LF9 Q;  3H0G G;  4GLV B;  4YCV A;  5IP7 H;  1KHI A;  4B3M L;  1TWH H;  4AIM A;  2QGQ A;  1XMO L;  1K0R A;  3T1Y Q;  4A3D H;  3F2B A;  3EBE A;  4BY1 G;  3CF5 A;  4DV0 L;  1V43 A;  4JBW A;  1LM0 A;  4LFA L;  1YJ9 A;  1PH6 A;  2BH2 A;  3RR5 A;  2JA5 H;  3S17 H;  2KHI A;  4A3G G;  4UCV A;  1VQA A;  1HNW L;  4JI1 L;  1PFS A;  1GO3 E;  3H3V I;  2WB1 E;  1KXL A;  4LUV A;  2GVB A;  4X64 L;  4DR1 L;  1SFO H;  3GTG H;  1VQJ A;  2R7D A;  3F2D A;  1ASZ A;  1Q8K A;  2VUM G;  1OXU A;  2ID0 A;  1CKN A;  1MJC A;  3I7F A;  4LF4 L;  1PH8 A;  5IE8 A;  4HJ9 A;  1EOV A;  3CC2 A;  3A0J A;  2V1C C;  1WI5 A;  1Z47 A;  2N8N A;  4P75 A;  4YY3 L;  1PA6 A;  1LYL A;  4LF7 L;  1D7Q A;  2ZJR A;  1HJP A;  1OXT A;  1RIP A;  1CSQ A;  2RHS B;  1C0A A;  1HZB A;  1YIT A;  1VQO A;  4DR4 Q;  4DR2 L;  4DRF A;  4HJ7 A;  1SN8 A;  3CME A;  3H3V H;  5C44 G;  2OWO A;  1DGS A;  3HOZ H;  5IYC G;  1HR0 L;  3I4N H;  2NVQ H;  4L5Q A;  3NBZ B;  1K3R A;  3HFZ B;  3K80 C;  2UU9 L;  4LH7 A;  4BXX G;  3MXN B;  4JI4 L;  5IT9 c;  4LF6 L;  3BZK A;  1EFW A;  5C3E H;  4JBM A;  4R1J A;  3M4Q A;  3GTM H;  2D62 A;  4JI8 L;  1UE6 A;  4QJF A;  1Q1B A;  2CKZ B;  4X66 L;  4EQ5 A;  3JAM c;  4O0A A;  2ZM6 Q;  3G4S A;  3JC6 6;  3PO3 H;  1UWV A;  3GTK H;  1XJV A;  3PF4 A;  4LFB L;  2I5H A;  3K7U C;  3DLL A;  1YJN A;  4XIG S;  1S3O A;  5M3M H;  3CCQ A;  3OW2 A;  4JI3 Q;  3BZC A;  1YIJ A;  2OQK A;  4DV1 Q;  3F1Z A;  4B3M Q;  2I0Q A;  2RCN A;  2BA0 A;  1VQ9 A;  5D1O B;  3PN1 A;  1VQ8 A;  1IBM L;  3S16 H;  4WJ4 A;  4PZ7 A;  2Q2T A;  1W2B A;  1K83 H;  4A3I H;  3OTO L;  5IWA L;  2CCZ A;  2XGT A;  1Q86 C;  1HNW Q;  1YJW A;  4JBK A;  4DV4 L;  2VQF Q;  1JJG A;  2IY5 B;  4JI7 L;  2R6G A;  1YHA A;  2F3I A;  3PUY A;  1WFQ A;  4DUY Q;  4JYA Q;  4DV3 Q;  1L2F A;  2KEN A;  3G71 A;  4B3R Q;  1EQQ A;  1PH1 A;  3M4O H;  1FVI A;  3TRZ A;  3GO5 A;  5IYB H;  1S40 A;  4LF9 L;  4JG2 A;  2UUB L;  2CQO A;  3A5Z B;  1YVC A;  2ZJP A;  1VQC A;  4R4O A;  2JA7 G;  3CCR A;  3G6E A;  3K7A H;  2ALY B;  2I5M X;  1Y1V G;  5C0X J;  3PIO A;  3CPF A;  4HIM A;  1N33 Q;  4A3J H;  5H1S E;  3BA9 A;  1YZ6 A;  4DR3 Q;  3ERS X;  1EWI A;  4GLA C;  4OO1 I;  2KHJ A;  1IZ6 A;  4IOA A;  5FPO A;  2N3S A;  1O7I A;  4KI0 A;  1SMX A;  5C4J H;  1PH5 A;  4DPG A;  2PI2 E;  1HR0 Q;  4NXN Q;  1J6Q A;  1Q46 A;  3PO3 G;  2FXQ A;  2WAQ G;  3JAM i;  4DV2 Q;  2UU9 Q;  1X65 A;  3CD6 A;  2NVY H;  1VQP A;  4JI4 Q;  2PQA A;  1IXR A;  4A3L H;  2Q2U A;  5E7N A;  3S1Q H;  1UE7 A;  2IX1 A;  1I6H H;  3HOU G;  1NJI C;  1BBW A;  1VQE A;  4X66 Q;  4QY7 A;  1PHJ A;  2HVQ A;  1I5F A;  3CW2 C;  3HKZ E;  4P73 A;  3RLO A;  2KCM A;  4DUZ Q;  3CP0 A;  3UDF A;  1VQM A;  1SE8 A;  1XPR A;  1YNX A;  2C35 B;  3KF6 A;  5M5W H;  3PGZ A;  4B3S Q;  4DR4 L;  3G48 A;  1GVP A;  2Z6K C;  3I55 A;  1L1O C;  2LSS A;  3A5U A;  1TAE A;  1Q12 A;  4DV6 L;  5IYD G;  3CPW A;  4DKA C;  2WFW A;  3UE0 A;  1NE3 A;  3CC7 A;  2YYZ A;  4ALP A;  4B3T L;  4CC6 A;  4DK6 C;  3OTO Q;  1PH4 A;  1G51 A;  5C4X H;  1HNZ L;  4BY7 G;  4R4Q A;  4NPS A;  2GVA A;  5ELO A;  1TWA H;  3KDF A;  4EX5 A;  1M1K C;  1N34 L;  4OON A;  2CWA A;  2ZM6 L;  1VQ4 A;  4BY1 H;  1LUZ A;  1CKN B;  3PV0 A;  5JJI A;  4R4I A;  2OCE A;  1Q81 C;  5AJ3 Q;  3NEL A;  1NY4 A;  4XTC S;  4IPC A;  4NXM L;  4A3B G;  3E9I A;  2HQL A;  1N36 Q;  4A3G H;  4JI3 L;  2UUA Q;  3W1G A;  1L1O A;  2K75 A;  2AWN A;  3Q8D A;  3U4V A;  4IFD G;  4K0K L;  2VZA A;  2HHH Q;  1YBY A;  3PO2 G;  4IO9 A;  4JCV E;  3PUX A;  2YTY A;  5GRO A;  3U4Z A;  1Q7Y C;  4DAM A;  4GN3 B;  1E7Z A;  2VUM H;  4Y7N H;  5M5X H;  2R93 G;  2ASB A;  3I2Z A;  1L0W A;  1BVS A;  4YCU A;  1X54 A;  3H15 A;  4UP8 A;  3RZD H;  1QVF A;  2VQF L;  2JJQ A;  2YV5 A;  3F8T A;  2F52 A;  5ELN A;  3CXC A;  3HOW G;  5FJ8 G;  3JSN A;  4J15 A;  1PYB A;  4DV7 L;  1AE3 A;  4DUY L;  1U0L A;  4JYA L;  1B70 B;  1EIF A;  1UE1 A;  4DV3 L;  5C44 H;  4B3R L;  1H95 A;  1WYD A;  3HKS A;  4A76 A;  5IYC H;  1JJ2 A;  3TY5 A;  4HJ5 A;  3EIV A;  1A0I A;  2ZTC A;  4HIO A;  4A3M G;  1KD1 C;  1IBK Q;  4A93 H;  4L5S A;  4BXX H;  4JV5 Q;  2HT1 A;  3GTO H;  4A75 A;  2AWO A;  3FHW A;  1N33 L;  1S68 A;  4C2M H;  1VQK A;  1WOC A;  2UXC Q;  2N49 A;  3AFP A;  2Y0S G;  3CAM A;  4DR3 L;  2E2H H;  2JA6 G;  1XDN A;  4A3F H;  4BBS G;  2WAQ E;  5IP7 G;  4DV6 Q;  2H5X A;  1N9W A;  4NXN L;  4B3T Q;  3UDI A;  4LWC A;  2K50 A;  4AYB G;  3F2C A;  1GM5 A;  4DV2 L;  4LFC L;  5GAE C;  4GKJ L;  1HNZ Q;  4KHP L;  3AYH B;  2OQ0 A;  2K52 A;  3AEV A;  3BU2 A;  3RLF A;  1JJC B;  5JJK A;  5IP9 G;  4QGU A;  1TWG H;  1J5E L;  2AMC B;  3I4M G;  1E22 A;  3E9H A;  4C3I H;  4DK3 C;  1BKB A;  4DNI A;  3CCU A;  4DUZ L;  4DR5 Q;  3STB C;  4NXM Q;  3UQ8 A;  2VUG A;  2JEB I;  3M7N A;  2JK8 A;  3D0F A;  4OWX B;  3ICE A;  2JQO A;  4B3S L;  3EN2 A;  4K0K Q;  1XPO A;  4KLK A;  3FP9 A;  1SR3 A;  4PG3 A;  2B29 A;  4A3E G;  1KIX A;  1VS0 A;  4E6N A;  2Q2H A;  2N78 A;  3M9B A;  1GD7 A;  4DR6 Q;  4DAY B;  4TVA B;  4EFE A;  3S24 A;  3T1H Q;  3TS0 A;  1CKM A;  3M4P A;  1Y1W G;  1JE5 A;  1FJG Q;  3BAB A;  2WP8 J;  3HOX G;  3RNU A;  3PUZ A;  1IYJ B;  1OXV A;  2PQA B;  4QL5 A;  2E2I H;  2YU9 H;  2JA7 H;  1XTD A;  3KJO A;  1Y1V H;  2F4V Q;  4DV7 Q;  4QIW E;  5AJ3 L;  2HVS A;  1VQL A;  4RG1 A;  1N36 L;  2KCT A;  3NEM A;  3J7A 5;  2UUA L;  5IY0 A;  3CMA A;  1MIU A;  1K8A C;  1FGU A;  3GD7 A;  3VDY A;  3NBH B;  4POF A;  4LF5 Q;  2HHH L;  2DGY A;  5JEA J;  3S15 H;  2NN6 G;  3BA8 A;  2YTX A;  3KF6 B;  2UXB L;  2GN5 A;  4YWM A;  3UDX A;  5GAD C;  1FL0 A;  3CC4 A;  1W3S A;  3HOU H;  2VY3 A;  4BA2 I;  3PCO B;  3CCV A;  1GKH A;  1I3Q H;  1UEB A;  3ULL A;  1EQR A;  1CKO A;  4A3C G;  4HID A;  3JSL A;  2WB1 G;  2VQE L;  5FLX c;  4LFC Q;  4GKJ Q;  4IJH A;  4KHP Q;  1KC8 C;  3IRB A;  3KDF B;  4DV5 Q;  2R7Z G;  1MKH A;  1SLJ A;  4A4I A;  3S1M H;  4IFD I;  1J5E Q;  4LNQ A;  1HH2 P;  3VNN A;  1E1T A;  5IYD H;  3ULP A;  2B63 G;  3NC0 B;  5FPR A;  4IPD A;  1Y14 B;  1IBK L;  3BAA A;  4YCW A;  3W1B A;  4BY7 H;  1SRU A;  4JV5 L;  1E3P A;  4OWT B;  1L1O B;  5DIS C;  2E5L L;  1M90 C;  4HJA A;  4IPG A;  2UXC L;  1YHB A;  1OXS C;  4H02 A;  4EFB A;  4EEQ A;  3KOJ A;  3CCJ A;  1VQ7 A;  4P74 A;  3S2D H;  4A3B H;  3TRE A;  2K5V A;  3J7Z C;  2RF4 A;  2MFI A;  4OXP A;  5LMU Q;  5LMN L;  4A3J G;  3BJU A;  3I4O A;  4C3H H;  1B7Y B;  3H0G H;  3NEN A;  4LH6 A;  3PO2 H;  5BR8 L;  3ULJ A;  1E24 A;  4YHH Q;  2QEX A;  4GOP C;  4JI0 Q;  1A8V A;  4Y52 H;  1QVG A;  4GNX C;  1PH3 A;  5M3F G;  3CCE A;  2ATW A;  2R93 H;  3TY9 A;  4DR5 L;  1G29 1;  3PF5 A;  2DUD A;  2D0O A;  5FLM G;  2NVX H;  3MEF A;  1X3F A;  2Z6K A;  4LF8 L;  1N32 Q;  3RTX A;  2VL6 A;  1QVC A;  2R7F A;  1X3E A;  4A3K G;  4P71 A;  2UXD Q;  4UCS A;  3I56 A;  4UCR A;  1YEZ A;  4BBR G;  1VQ5 A;  2R92 G;  3HOW H;  4JI6 L;  5FJ8 H;  2UXB Q;  3KFU A;  1WCM G;  1QUQ A;  1VQI A;  3ER0 A;  3S2H H;  4P72 A;  3U50 C;  2HVR A;  4DR7 Q;  1E1O A;  4DR6 L;  2BH8 A;  2HIX A;  2K4K A;  2ES2 A;  3T1H L;  4A3M H;  4GOP A;  1KAW A;  2Q2I A;  1FJG L;  4NB3 A;  3HOV G;  2VQE Q;  4GNX A;  1HR0 W;  1HZA A;  5JJL A;  3CQZ H;  3FKI G;  5K36 G;  1P16 A;  1VQH A;  2Z0S A;  2F4V L;  1XNQ Q;  4MZ9 A;  2EXD A;  5GQO A;  2JA6 H;  5C4X G;  2PNH A;  4JI2 Q;  1YHQ A;  5C0X G;  4BBS H;  2JA8 G;  1C9O A;  3L7Z C;  4LF5 L;  4IJL A;  2E8G A;  3K81 C;  4O2D A;  1I94 L;  4GN4 B;  3LGJ A;  2E5L Q;  3DM3 A;  1IBL Q;  2VNU D;  4X6A H;  1K8G A;  5IP9 H;  2NZO A;  3I4M H;  1BBU A;  1MJE A;  2ZTE A;  1VQF A;  2LXJ A;  3L0O A;  1I50 H;  1K9M C;  1T9H A;  4OX9 Q;  3PSI A;  1IL2 A;  2MO1 A;  4POG A;  4A3D G;  2I5L X;  4KHZ A;  4R4C A;  1HNX Q;  3S1N H;  3PUW A;  4LW1 A;  1D8L A;  5LMN Q;  4GKK L;  1V9P A;  4JI5 Q;  1PH7 A;  3KJP A;  4AQY Q;  3J81 j;  4DV5 L;  2JA5 G;  5BR8 Q;  3J81 c;  3STB D;  3NBY B;  4A3E H;  5DLQ E;  3W5O A;  1NTG A;  1TWF H;  2CWP A;  2NN6 I;  2EQS A;  4R4T A;  3HKZ G;  4JBJ A;  4JC0 A;  1EIY B;  4QQB X;  1XPU A;  1B04 A;  4PZ8 A;  4X65 Q;  3RZO H;  1Q1E A;  1PH9 A;  4JOI C;  2VS1 A;  1Y1W H;  4LF8 Q;  1AH9 A;  4WJ3 M;  3ZJY C;  1N32 L;  3HOX H;  4APV A;  3GJX B;  1OXX K;  2B3G A;  1XNR Q;  1VQ6 A;  1A63 A;  1NMF A;  4JI6 Q;  2K5N A;  2UUC Q;  4A93 G;  1VCI A;  2A19 A;  2MNA A;  1G6P A;  2IHE A;  3KF8 B;  4UCU A;  5LMU L;  1N8R C;  3RN5 A;  1PYS B;  1TXY A;  3WWV A;  4YHH L;  3HOZ G;  2OTJ A;  1OTC A;  2ZTD A;  4GN5 A;  4JI0 L;  4A3F G;  1XMQ Q;  3TS2 A;  1HZ9 A;  1KRS A;  1VQD A;  3I4N G;  1JT8 A;  1X3G A;  3J80 c;  2NZH A;  4UCT A;  4JOI A;  3AFQ A;  2IT1 A;  3K8A A;  5C3E G;  3S1R H;  1X56 A;  4MTN A;  1QZG A;  1XMO Q;  4A3C H;  2RHQ B;  3HOY G;  4BA1 I;  1P8L A;  2UXD L;  3TY8 A;  3CCS A;  1JMC A;  4DV0 Q;  4GS3 A;  1U5K A;  3A74 A;  1I94 Q;  2E2J H;  4UY8 C;  4IFD J;  4LFA Q;  3AQQ A;  1XK5 A;  2IHF A;  4L5R C;  2R7Z H;  2AHO B;  3TQY A;  2JE6 I;  5M3M G;  3GTJ H;  2ZJQ A;  3GTP H;  1B8A A;  4DR7 L;  4JI1 Q;  3KLW A;  1EYG A;  5D1P A;  2JA9 A;  5GAH C;  4LUZ A;  3PIP A;  3B6Y A;  4X62 L;  2B63 H;  4X64 Q;  4DR1 Q;  5GAG C;  1YI2 A;  3J81 i;  3CCL A;  1RL2 A;  4UP7 A;  4ME3 A;  2QA4 A;  1V1Q A;  1JB7 A;  2CFM A;  4CC5 A;  4IPH A;  3GTQ H;  4LF4 Q;  4GKK Q;  1SRO A;  1XNQ L;  1N34 Q;  3QWU A;  5LMN W;  4A3I G;  4OWW B;  4UP9 A;  1Z9F A;  1ASY A;  4UCO A;  3L2P A;  4JI2 L;  4YWL A;  2OTL A;  3GTL H;  2XTI A;  4YY3 Q;  2AKW B;  1PVO A;  4LF7 Q;  1K73 C;  4C3J H;  3UDG A;  1AE2 A;  3OYY A;  3PUV A;  3T1Y L;  2YTV A;  5D1O A;  1EUJ A;  1NMG A;  2PMZ E;  4RMF A;  2Y0S E;  5HY6 A;  2IX0 A;  4DR2 Q;  1IBL L;  3M3Y H;  1TWC H;  4HJ8 A;  3HOY H;  4L5T A;  1X6O A;  4MNO A;  3SGI A;  1R9T H;  5IYB G;  1CSP A;  1QUQ B;  4PZ6 A;  4AYB E;  5M3F H;  3GB8 B;  1KQS A;  1PV4 A;  4OX9 L;  2KBN A;  4TQU S;  4LF6 Q;  5EAY A;  4UPA A;  4AH6 A;  5FLM H;  1HNX L;  4FDB A;  2HIV A;  2BA1 A;  4JI8 Q;  4GOP B;  4JI5 L;  3J80 i;  4GNX B;  4AQY L;  4A3K H;  5C0X I;  2JEA I;  3K0X A;  3U58 A;  1LTL A;  4BBR H;  2R92 H;  1VQB A;  1HZC A;  4GLX A;  2VW9 A;  4LFB Q;  1WCM H;  4HIK A;  1S72 A;  2K14 A;  4A3L G;  1VQN A;  2EIF A;  4UFZ A;  1NBW A;  2MO0 A;  4X65 L;  4IOC A;  4YWK A;  1CUK A;  3HOV H;  2NVT H;  3TEH B;  1IBM Q;  1PH2 A;  3FKI H;  1Q82 C;  1XNR L;  3M85 A;  2UUC L;  1C7Y A;  2LXK A;  5IWA Q;  2PI2 A;  3D31 A;  3KYH C;  3CCM A;  1VQG A;  3S14 H;  4DV4 Q;  4OO1 G;  3GDE A;  5HGQ A;  1KL9 A;  3UE1 A;  2JA8 H;  1UE5 A;  4PMW A;  1KRT A;  4X62 Q;  3RN2 A;  2MQH A;  1A62 A;  2D0P A;  1TA8 A;  4JI7 Q;  3E0E A;  1XMQ L;  3RLN A;  5M5Y H;  1QZH A; 
#chains in the Genus database with same CATH topology
 2W6Q A;  4XQQ A;  3CEB A;  3TIN A;  2A8V A;  1VMP A;  4LUO A;  3H0G G;  3A8I E;  3NE5 B;  1XMO L;  1K0R A;  3T1Y Q;  3F2B A;  3EBE A;  3FDT A;  1X3P A;  4DV0 L;  1V43 A;  5A2Q E;  1R4Q B;  2G9D A;  4XT1 B;  3S17 H;  3BAC A;  4ZQ3 A;  2KHI A;  3R23 A;  1VF5 C;  1HNW L;  1AUX A;  1EQV A;  1KXL A;  3UFX B;  4MV7 A;  4LUV A;  4X64 L;  2ICI A;  3GTG H;  4HSV A;  4WRD A;  5EPL A;  2I8C A;  3PIP 3;  1OXU A;  3KAJ A;  1DOK A;  4ZUJ A;  5IYZ F;  3DWQ A;  3GTJ B;  2QDB A;  4HJ9 A;  3GTP B;  1EOV A;  1PTO F;  3CC2 A;  2F0F A;  2V1C C;  3OW7 A;  1PA6 A;  4YY3 L;  3IFD A;  5G3L D;  1D7Q A;  2ZJR A;  2IWH A;  2O5J C;  3GTQ B;  1E2V A;  1QNU A;  1EHI A;  3H3V H;  3HOZ H;  5KEE A;  5C44 G;  1DGS A;  2F1M A;  4OIJ A;  1XWE A;  3A8J E;  4L5Q A;  4LF6 L;  5IT9 c;  5JQG F;  4H7B A;  3M4Q A;  1U4L A;  3MAQ A;  3TEK A;  2D62 A;  5I2X A;  4QJF A;  3JAM c;  4MV9 A;  1UC8 A;  1KJ9 A;  5C5M A;  2DY7 A;  1M0T A;  4E6I A;  3I8Z A;  3OIP A;  4IZO A;  3SR1 A;  2B8G A;  2F0K A;  3PN1 A;  1IBM L;  1KC7 A;  4PZ7 A;  4C3I G;  5T1I A;  1CZW A;  4JK1 C;  5IWA L;  2RA4 A;  2CCZ A;  1Q86 C;  3TIG A;  1YJW A;  4TM5 A;  1GUS A;  1RTN A;  2ZXR A;  1EZ1 A;  2VQF Q;  5CV7 A;  4JI7 L;  3PUY A;  2HG8 A;  2EJ0 A;  1PZI D;  5ELF A;  4IWY A;  4FXD A;  1L2F A;  4C1N K;  3GP7 A;  2CQO A;  5C5L A;  1GUW A;  4Q5V A;  2ZJP A;  1VQC A;  2MJ8 A;  3DXJ C;  4HIM A;  1LTG D;  1N33 Q;  3PIO A;  3CPF A;  4A3J H;  3ND8 A;  3T9C A;  1YZ6 A;  1EOT A;  4GLA C;  1IZ6 A;  2KJX A;  4ZRZ A;  4KI0 A;  1PH5 A;  5A2Q L;  5EBD A;  4A3D B;  2IJ0 A;  1LTI D;  1X65 A;  2PQA A;  1B4O A;  2ABJ A;  2Q2U A;  5JH7 F;  3S1Q H;  1UE7 A;  5BPF A;  2F0I A;  4FXK C;  1NJI C;  1V1O A;  3CRL C;  1HQR D;  2EYL A;  2HVQ A;  5I6W A;  5IGE A;  5KYI A;  3HKZ E;  3R5F A;  5IOC A;  3UDF A;  2HGS A;  1YNX A;  4KKU A;  4O4L F;  1X32 A;  1VKZ A;  1LAB A;  1U9R A;  1Q12 A;  4DV6 L;  5IYD G;  3Q24 A;  1Y8N B;  2QF7 A;  2SOB A;  3MWY W;  5JEA H;  5C4X H;  1HNZ L;  4BY7 G;  1CA5 A;  1SSO A;  2YS7 A;  3OWF A;  2Z6B A;  5ELO A;  4QSH A;  4KN4 C;  2ZM6 L;  1TY2 A;  3PV0 A;  2MHV A;  4ZLT F;  2NVQ B;  3V4S A;  1Q81 C;  5AJ3 Q;  3UI2 A;  3K5I A;  4NXM L;  4IPC A;  3E9I A;  5JOB A;  1A2T A;  3URY A;  5JVG 3;  4HNT A;  2UUA Q;  3JRX A;  4C3H G;  4UCS A;  1BNZ A;  3PO2 G;  4IO9 A;  4JCV E;  4QUC A;  5GRO A;  3T4A C;  3DMU A;  2VUM H;  2RDH A;  2XRS D;  2F0T A;  1L0W A;  1BVS A;  3ETJ A;  1OO9 B;  3RZD H;  1QVF A;  1EKP A;  3T53 B;  4XT3 B;  2FHT A;  5BMV F;  3TZD A;  2YV5 A;  2F52 A;  3NTI A;  3CXC A;  3JSN A;  1KNA A;  4J15 A;  4H0L C;  2E2J B;  2W70 A;  4DUY L;  2OT2 A;  4JYA L;  1B70 B;  1UE1 A;  4DV3 L;  3NWT A;  3MXU A;  1RKN A;  1ZYR C;  1JJ2 A;  4HJ5 A;  2YZN A;  4HIO A;  1A0I A;  4A3M G;  1KD1 C;  2B63 B;  3N8D A;  3EQL C;  4MV6 A;  3WO0 A;  4DAP A;  2AWO A;  5HNE A;  5EKL A;  5FO8 B;  1VQK A;  1WOC A;  3V96 A;  1V8Q A;  2EYO A;  4V0B A;  3K0Y A;  3AFP A;  3CAM A;  4DR3 L;  3M4O B;  2CHB D;  2LS0 1;  3QFF A;  1K28 A;  1N9W A;  4NXN L;  4B3T Q;  4LWC A;  4DXG A;  2EIY A;  3JZ6 A;  2F0G A;  4DV2 L;  1IL8 A;  1CQF A;  3K7A B;  4FF3 A;  4GKJ L;  1UAP A;  3E5S A;  3T9D A;  3O13 A;  3AEV A;  2K5Q A;  3UYY A;  3MFG A;  5IP9 G;  3SDZ A;  1TWG H;  1E22 A;  4DK3 C;  4DNI A;  4TSS A;  5DMX A;  2JSO A;  1RDP D;  1LO5 D;  2JK8 A;  1I6H B;  3RD4 A;  4CDC C;  3ICE A;  2JQO A;  3E3X A;  3NWS A;  5I5Y A;  4A3K B;  3HGB A;  1BNC A;  3HT5 A;  5IOD A;  1GJX A;  1GOZ A;  3G7L A;  2EPB A;  1VS0 A;  2NU8 B;  3T9A A;  4CDF C;  4DR6 Q;  1YNN D;  1EY7 A;  2DY8 A;  2EY6 A;  3T1H Q;  1CKM A;  3I90 A;  3M4P A;  4YIJ A;  1Y1W G;  4O7R A;  4ZHQ F;  3HOX G;  3RNU A;  2E2I H;  2NVT B;  2PQA B;  2AQ1 B;  1BUV T;  3KJO A;  1Z6H A;  1SEB D;  1A3U A;  4DV7 Q;  1C3O A;  4NZO A;  5KKN B;  2KCT A;  3J7A 5;  2WAC A;  3VDY A;  4POF A;  1Q8I A;  2DGY A;  5JEA J;  2GN5 A;  4YWM A;  5GAD C;  5JPN C;  4BA2 I;  3PCO B;  2R82 A;  1KTK A;  3CCV A;  1D5Z C;  2B2W C;  2ICE C;  1EQR A;  2R7K A;  3LWE A;  1SNO A;  4PNY A;  3SVM A;  4HID A;  2R84 A;  4IUN A;  5CGK A;  2WB1 G;  5BWV A;  4LFC Q;  1KC8 C;  3KAK A;  3NUC A;  4RHR A;  5M5X B;  5I5U A;  2EJF C;  4A4I A;  1G2S A;  5FNV F;  2X69 A;  5CM0 A;  1S5C D;  1LAC A;  1B1Z A;  3LNN A;  3DAA A;  3NHH A;  3W1B A;  1SFO B;  3J7Y W;  1SRU A;  1E3P A;  4OGQ C;  1CFM A;  2B2W A;  2UXC L;  1I4H A;  1SYE A;  1NR2 A;  1OXS C;  1D5X C;  2V58 A;  4EEQ A;  4HCE A;  1SYG A;  1KAB A;  2PZT A;  4P74 A;  4A93 B;  1QNK A;  2K5V A;  3EJI A;  1G2W A;  5LMN L;  4K8J A;  4A3J G;  3BJU A;  1PXU A;  1SCU B;  2QEX A;  3BYT B;  3VYR A;  1EY6 A;  2GPW A;  3R2T A;  1G29 1;  2D0O A;  2F0U A;  3IL8 A;  2XVS A;  3OUZ A;  5FLM G;  1SYF A;  2Q8I B;  2Z6K A;  1QVC A;  2MP1 A;  3I56 A;  3LP8 A;  4CKC A;  5KIX A;  2VPQ A;  1EU3 A;  4HR7 A;  2HVR A;  3HO8 A;  2XN9 C;  1LT3 D;  2HIX A;  2J4X A;  2A69 D;  4MTK A;  1KAW A;  2L5T A;  1FJG L;  3FKI G;  5K36 G;  1VQH A;  2F4V L;  4YJ2 F;  4ULL A;  5C4X G;  3VR4 A;  5C0X G;  4KMU C;  3KLR A;  3DHQ A;  3ND9 A;  2NZ1 D;  4R8I A;  1GLV A;  3K81 C;  1I94 L;  4QF4 A;  5CR5 A;  2ZTE A;  1VQF A;  2LXJ A;  4QMG A;  4CBV A;  1ICW A;  1V1P A;  3S15 B;  5KGU A;  2W6P A;  4A3D G;  4KHZ A;  1HNX Q;  3A54 A;  4DLK A;  3Q1K A;  3G6J B;  4GKK L;  1Z2O X;  4H13 C;  1EUD B;  3TSS A;  3V2T A;  4DV5 L;  5BR8 Q;  1TY0 A;  5EKI A;  4A3E H;  5DLQ E;  5C4J B;  2R87 A;  3WWJ A;  2PW7 A;  2LMC B;  3HZX A;  2GA4 B;  4PZ8 A;  4FGR A;  4JOI C;  1B9M A;  4CDE C;  3ZJY C;  2I07 B;  3S1M B;  4WJ3 M;  4IIJ F;  1KDA A;  2RSO A;  2PYK A;  3S9W A;  2K5N A;  4UCU A;  5LMU L;  1KUT A;  4ODG A;  1N8R C;  2MGS A;  4FNF A;  3MFY A;  1PYS B;  4HAE A;  3RN5 A;  4NKL A;  5C8Y F;  1KRS A;  3T51 B;  1JDB B;  1JT8 A;  2NZH A;  4JOI A;  5FLX E;  2EY1 A;  3AFQ A;  3V4Z A;  2PQE A;  3H0G B;  3Q0A A;  3T7A A;  3C1F A;  3T56 B;  1PRT C;  2RHQ B;  3BDC A;  3TY8 A;  1EYC A;  1XK5 A;  2R93 B;  4X3S A;  2KOL A;  2IHF A;  5M3M G;  2ZJQ A;  3MXN A;  5ELB A;  1EYG A;  5D1P A;  2ZXP A;  2JA9 A;  4LUZ A;  3QJY A;  1YI2 A;  3CCL A;  1D5M C;  4UP7 A;  2QA4 A;  3WDN A;  1JB7 A;  4ZKC B;  3HOW B;  3BS1 A;  5H80 A;  1SRO A;  5EKK A;  4RHS A;  3L2P A;  1JOK A;  4O1N A;  3OWE B;  5BN5 A;  2XWJ B;  1K73 C;  3T1Y L;  2W71 A;  1AE2 A;  4Q4D A;  3RV3 A;  4I7Z C;  1K0S A;  2Q8T A;  5D1O A;  1TS3 A;  2L11 A;  4DR2 Q;  1HA5 A;  3OMG A;  5EPJ A;  4KKS A;  4L5T A;  1ZXT A;  3SGI A;  1EZ6 A;  3R3O A;  5M3F H;  1Q3L A;  4HR7 B;  2XRQ D;  3FRP B;  2KBN A;  3OHX C;  1PV4 A;  1EYD A;  1SNC A;  4OX9 L;  4AH6 A;  2F0P A;  3MJF A;  3PMF A;  3H09 A;  4BBR H;  2C00 A;  2R92 H;  1HZC A;  1I50 B;  2D9U A;  1GSO A;  3H94 A;  1S5F D;  3S1N B;  1NBW A;  2MO0 A;  4X65 L;  4IOC A;  3GV3 A;  5JVL A;  3HOV H;  1Q82 C;  4HTH A;  2WKC A;  2G5D A;  1SJH D;  3D31 A;  3Q23 A;  5EPK A;  3RZO B;  1V1P B;  4PMW A;  4X62 Q;  1TII D;  1EFI D;  2BOS A;  1TA8 A;  4I4T F;  3E0E A;  3TME A;  2B2T C;  2I0Q A;  3H3V C;  1QZH A;  3CC4 A;  2DAA A;  1I4P A;  4XX0 B;  2BDO A;  5J3B A;  2A1A A;  2K5H A;  1WJJ A;  1GXD C;  2UUB Q;  1WTP A;  5DAA A;  1KHI A;  4KY7 A;  4PQX A;  4AIM A;  2O5I C;  1MGS A;  5FLX L;  2JXM B;  4BY1 G;  4DAA A;  4JBW A;  4O7W A;  1YJ9 A;  1PH6 A;  3RR5 A;  2JA5 H;  1VQA A;  1Y8P B;  4JI1 L;  1KTA A;  3S1R B;  2EYP A;  3KLS A;  3H3V I;  2WB1 E;  2GVB A;  4DR1 L;  2B2T A;  1B6R A;  2OXP A;  5FKA C;  3F2D A;  1CKN A;  4LF4 L;  5IE8 A;  4FFN A;  2V59 A;  1DCZ A;  3JAM E;  4FO2 A;  3KAL A;  4O86 A;  1F2L A;  3QB3 A;  3K5H A;  3QOJ A;  4RH6 A;  3ZYY X;  4DR4 Q;  3VPB A;  3J80 E;  1SN8 A;  4O4I F;  3PIO 3;  2OWO A;  4XDX A;  5FR9 A;  1WTR A;  3I4N H;  1G2T A;  5BYA A;  4KD3 A;  3NBZ B;  3MXN B;  3BZK A;  1BCP C;  3R2I A;  1JLL B;  1WTH A;  3GTM H;  3D6W A;  1TWC B;  2FB9 A;  4EQ5 A;  1N34 Q;  2PO4 A;  3FMC A;  4TV8 F;  1R9T B;  1WTQ A;  3K5N A;  2QW7 A;  2I5H A;  3MHB A;  3PF4 A;  4LFB L;  3LUL A;  1L0Y B;  1D1K A;  1SND A;  1PRT B;  3BZC A;  4JI3 Q;  1LTT D;  2A68 C;  1RCV D;  4C3H B;  3VA5 A;  5A35 A;  2BA0 A;  5D1O B;  3S16 H;  1EUC B;  1PFB A;  3D4R A;  1WCM B;  1W2B A;  1K83 H;  4A3I H;  4CKB A;  1O80 A;  4JBK A;  3DEP A;  1B44 D;  4FU0 A;  2IY5 B;  5CBA E;  1STA A;  5DNF A;  1YHA A;  1MI2 A;  2NU6 B;  1JWM D;  1DZ1 A;  1CTM A;  3G71 A;  1ULZ A;  2HVS A;  4UDU C;  4F87 A;  5IYB H;  4LF9 L;  4JG2 A;  2JA8 B;  3A5Z B;  2EYJ A;  1AZP A;  2Q7D A;  2PZU A;  3G6E A;  5M5Y B;  5CE8 A;  3HS0 C;  1EWI A;  5HV6 A;  1SDF A;  2KHJ A;  4IOA A;  1ENA A;  4QUF A;  5LXT F;  1Y8O B;  2N3S A;  2PI2 E;  1Q46 A;  2FXQ A;  2UU9 Q;  2DN8 A;  4JI4 Q;  5CYU A;  2PW5 A;  4TVI A;  5E7N A;  1EIH A;  3S17 B;  1EY5 A;  3HOU G;  1LTB D;  4X66 Q;  1BCP F;  1I5F A;  4P73 A;  4DUZ Q;  4G57 A;  3NBH A;  3KF6 A;  5M5W H;  3SK6 A;  2LY7 A;  3VPD A;  1GVP A;  4TUY F;  4JW0 A;  1L1O C;  3A5U A;  1TAE A;  1DXM A;  3CPW A;  3UE0 A;  3LX0 A;  3SXH A;  4ALP A;  4B3T L;  3OTO Q;  1G51 A;  5TSS A;  4J1M A;  3ERO A;  3VR6 A;  1C4Q A;  1Y1W B;  2XNA C;  2Z9H A;  3KDF A;  4EX5 A;  4IUQ A;  3SE0 A;  1M1K C;  1B9N A;  3HOX B;  3HOZ B;  3LQS A;  2BE5 C;  1CKN B;  1LUZ A;  1G8Z D;  4KJN A;  2DLN A;  4IUT A;  4CDD C;  2A5H A;  1ZKO A;  3I3C A;  1TT2 A;  4A3G H;  2A74 C;  1JC7 A;  3QWN A;  1EKV A;  2WIN B;  4R9W A;  1CA6 A;  1L1O A;  3U4V A;  3Q8D A;  4ZAI A;  1TQO A;  1YBY A;  1HTL D;  4DQN A;  2YTY A;  2B2V C;  1RJT A;  5I9O A;  1Q7Y C;  4GN3 B;  2QIL A;  4Y7N H;  3ONA B;  1AW7 A;  2R93 G;  4DIM A;  3QR8 A;  4ZK9 B;  2DZD A;  2WB1 B;  3HOW G;  5L37 A;  4KV6 A;  1PYB A;  4DV7 L;  1AE3 A;  4L8J A;  3I12 A;  1U0L A;  1Y69 U;  1EIF A;  1A9X A;  4B3R L;  1H95 A;  5IYC H;  3EIV A;  1RTO A;  1EEF D;  2B2V A;  1PX2 A;  1IBK Q;  3P1H A;  4L5S A;  4BXX H;  4JV5 Q;  4ID6 A;  1LV9 A;  3FHW A;  4HNU A;  5C6A A;  2Y0S G;  5C1P A;  1I2K A;  1JOO A;  1Z7T A;  4A3F H;  2WAQ E;  1VMC A;  1BCP B;  1GUN A;  5J39 A;  4LFC L;  2Z04 A;  2OQ0 A;  4A3J B;  2K52 A;  3SNO A;  3RLF A;  1JJC B;  5JJK A;  1FYC A;  4LAA A;  3I4M G;  3E9H A;  3OMC A;  2VXW A;  3CCU A;  1EYZ A;  1CZG A;  1SYD A;  1W6J A;  1CHP D;  3M7N A;  1BO0 A;  3GQB A;  1AEX A;  4OWX B;  3S1Q B;  3KBX A;  1XYI A;  4B3S L;  4K0K Q;  3A7A B;  1XPO A;  5C4Z A;  4KLK A;  1I4X A;  4PG3 A;  2B29 A;  1JIC A;  2PZW A;  1K3B C;  1FR3 A;  4M0J A;  2F0H A;  2N78 A;  2NTS A;  4TVA B;  3S24 A;  1RHP A;  3AX6 A;  3BAB A;  3PUZ A;  1IYJ B;  3U9S A;  2JA7 H;  2YU9 H;  1XTD A;  3FKI B;  1Y1V H;  4XQN A;  1II3 A;  5DGI A;  1U4P A;  4F7X A;  2R85 A;  3A8K E;  5J2T F;  1VQL A;  5C4X B;  4RG1 A;  4B9X A;  1N36 L;  1D1I A;  1ESF A;  3NEM A;  5I2Y A;  1MIU A;  2WKD A;  1K8A C;  3C1E A;  3GD7 A;  3NBH B;  4M1U B;  3PO3 H;  1IW7 D;  2HHH L;  3JRW A;  4HN2 A;  2YTX A;  3KF6 B;  4FE2 A;  4JXU A;  3UDX A;  1FL0 A;  1DIK A;  4I55 F;  1W3S A;  2VY3 A;  2HCI A;  2PNR C;  1G6Z A;  3N52 A;  1CKO A;  1PTO B;  3JSL A;  1EEI D;  2L55 A;  4FF2 A;  4IAL A;  4CJ0 B;  2VUM B;  2D5D A;  4KHP Q;  3TP5 A;  4YBZ B;  4O83 A;  3KDF B;  1JOR A;  1J8I A;  2YZG A;  3P75 A;  1JWS D;  2I80 A;  3RZD B;  3IFT A;  2E75 C;  3ULP A;  4IPD A;  5C1O A;  4FFP A;  1EY4 A;  1L1O B;  4DFA A;  4EVO A;  4HJA A;  5JPM C;  4LMQ D;  3MA2 B;  1YHB A;  4RGN A;  2F0D A;  3DWP A;  3KOJ A;  2R61 A;  3MVV A;  4L1K A;  2RKS A;  4A3B H;  3RV4 A;  2RF4 A;  2MFI A;  2Z02 A;  4IFD H;  1B7Y B;  3K59 A;  2OLS A;  4LH6 A;  3QOL A;  5BR8 L;  5M9O A;  4RAU C;  4YHH Q;  3TP8 A;  1EZ8 A;  1QVG A;  4GNX C;  4MV3 A;  3D4W A;  3TY9 A;  4DR5 L;  1IOW A;  3PF5 A;  2DUD A;  3TP7 A;  2EYF A;  2NVX H;  1EL0 A;  1N32 Q;  2EXZ A;  1X3E A;  1TWG B;  1YEZ A;  5FJ8 H;  4G4K A;  3KFU A;  1WCM G;  4N9P A;  1KLG D;  4MIU A;  3U50 C;  5HUR A;  1O78 A;  5M3M B;  4DR7 Q;  4MHE A;  1PZK D;  4RZQ A;  2BH8 A;  2K4K A;  2QKI C;  4RGO S;  2ES2 A;  2Q2I A;  5JJL A;  2VQE Q;  4GNX A;  1CS0 A;  5IGF A;  2NUA B;  1STN A;  1F77 A;  5GQO A;  2JA6 H;  1YHQ A;  5CV6 A;  3Q6S A;  4BBS H;  2HJW A;  1MSG A;  1C9O A;  4IN3 A;  2JA8 G;  2YW2 A;  1J9O A;  1QJO A;  2E2I B;  4LF5 L;  1UUP A;  3MEH A;  4O7L A;  3DM3 A;  4I50 F;  1Z2N X;  1K8G A;  1HUN A;  4KHV A;  1I4Q A;  1IYE A;  1BOS A;  1GUG A;  4O7Y A;  3TII A;  3P20 A;  1K9M C;  2SNM A;  2WAQ B;  3PSI A;  2MO1 A;  1KDB A;  2O4X A;  2I5L X;  4POG A;  3D8G A;  2F0M A;  1B50 A;  1HUM A;  1V9P A;  3J81 j;  3STB D;  4EQP A;  1FGB D;  1SNM A;  3W5O A;  1F9S A;  2EQS A;  3E0J A;  4JC0 A;  2L9H A;  1EY8 A;  3NK9 A;  3F2U A;  3FEW X;  4B08 A;  1E4E A;  1Q1E A;  1KBL A;  3NQT A;  2VS1 A;  4LF8 Q;  4DK0 A;  5C3W A;  2ZT9 C;  3TQT A;  1OXX K;  2B3G A;  1A63 A;  4JI6 Q;  2L1B A;  3CU7 A;  1XTC D;  2UUC Q;  2OEO A;  1QCB D;  3BG3 A;  2MNA A;  1F9P A;  1G6P A;  2RBM A;  1HHV A;  1UNS A;  3KLS X;  3WWV A;  3G8C A;  2NN6 H;  2NWG A;  1MSH A;  3HOZ G;  5ELD A;  3T13 A;  4A3F G;  1XMQ Q;  3HG9 A;  4JI0 L;  3TS2 A;  2QK4 A;  1VQD A;  2VQD A;  1I1L A;  1PRT D;  2IT1 A;  3K8A A;  1A2U A;  3CSW A;  3SE7 A;  4A3C H;  1XMO Q;  1IHZ A;  1TWA B;  1P8L A;  2UXD L;  2K04 A;  3D4D A;  4BY1 B;  4DV0 Q;  3A74 A;  4IFD J;  1ZEQ X;  2E2J H;  1E2W A;  4RCN A;  3RMH A;  2R7Z H;  2AHO B;  3BG5 A;  1KEE A;  2R3Z A;  1SYB A;  5E4W C;  3PIP A;  1KJI A;  4X62 L;  2B63 H;  2PVP A;  4X64 Q;  5GAG C;  4ME3 A;  5DAU A;  1DOL A;  4G7O C;  1XNQ L;  4DGZ A;  4OWW B;  1Z9F A;  1ASY A;  2HUG A;  4JI2 L;  4XXE A;  1E0B A;  1AP0 A;  2OTL A;  3GTL H;  4B9W A;  4FFR A;  2XTI A;  4YY3 Q;  4WBN F;  4X3T A;  1GGO A;  1PVO A;  5D8D A;  4C3J H;  1H9S A;  3OYY A;  2Y0S E;  3Q22 A;  1IBL L;  2PPB C;  2NBF A;  4HJ8 A;  1VBG A;  1K8O A;  5K5P A;  1JOQ A;  2XWB B;  1STH A;  1ENF A;  4PZ6 A;  5G3L F;  4CMD A;  2C9O A;  4TQU S;  4LF6 Q;  1F9R A;  1KT8 A;  5EAY A;  4FDB A;  4JI5 L;  1NNX A;  3J80 i;  4GNX B;  4AQY L;  4A3K H;  5I5W A;  3WNZ A;  5CC4 A;  4EQN A;  1X3Q A;  2A6H D;  5FO9 B;  4CMF A;  4GLX A;  3QIA A;  2EJ2 A;  5I5S A;  2K14 A;  5T1G A;  1EWC A;  4FP5 D;  2EIF A;  2EYH A;  1PYW D;  1DAA A;  1JKJ B;  2NVT H;  3VOT A;  1M0W A;  1IBM Q;  2IP4 A;  4A3E B;  5DM7 3;  1XNR L;  3HP3 A;  3NSW A;  3VYS A;  1C7Y A;  2LXK A;  5IWA Q;  3KYH C;  4FFL A;  5I5V A;  2HQE A;  3OIQ A;  3CCM A;  3S14 H;  3GDE A;  5HGQ A;  1KL9 A;  1KRT A;  4FXG C;  4CHT B;  4JI7 Q;  2FP4 B;  3BYY B;  5JEA G;  2L15 A;  1X9N A;  3DTG A;  4GLV B;  1AN8 A;  5C3X A;  5IP7 H;  1TWH H;  3KBG A;  2QGQ A;  4O7Z A;  3J81 E;  1IYV A;  1E4E B;  3CF5 A;  1LTR D;  4HN7 A;  1SE4 A;  2P0A A;  4V19 0;  5GON F;  4LFA L;  2BH2 A;  4EGQ A;  5HBR B;  1YNJ C;  1PFS A;  1GO3 E;  2PCF B;  3I91 A;  3MXP A;  1SFO H;  2R7D A;  2VUM G;  2ID0 A;  2J7Z A;  2YYA A;  3HOU B;  3A0J A;  1WI5 A;  4P75 A;  1LYL A;  4LF7 L;  2HDL A;  1HJP A;  1OXT A;  1RIP A;  1CSQ A;  1C0A A;  2YZM A;  1HZB A;  5CB4 F;  1VQO A;  1A3G A;  4IWX A;  4DRF A;  4HJ7 A;  4MA5 A;  5COY A;  3HFZ B;  2UU9 L;  2P5Z X;  4JI4 L;  3AU7 A;  3AW8 A;  5C3E H;  1WTX A;  4R1J A;  3ERQ A;  4JI8 L;  1BXR A;  3HOY H;  4X66 L;  3G4S A;  3T9F A;  2ZM6 Q;  2QB5 A;  2OF1 A;  3GLK A;  2KED A;  4DU9 A;  1XXG A;  3GTK H;  2A68 D;  5M3F B;  1XJV A;  3K7U C;  3DLL A;  1YJN A;  1CT1 D;  1S3O A;  2F0V A;  3OW2 A;  2CW0 D;  4BS9 A;  1YIJ A;  4DV1 Q;  2HHF A;  2X5R A;  4O84 A;  4B3M Q;  1H9S B;  3R8B A;  1PDQ A;  1VQ9 A;  4BBR B;  1GSH A;  2R92 B;  2K7V A;  4WJ4 A;  2AUJ D;  4FYD A;  4RGT A;  3PQI A;  1ILQ A;  4IUR A;  3OTO L;  3SEB A;  1H9K A;  1LT6 D;  5BWT A;  4DV4 L;  3TW6 A;  1JJG A;  5BWR A;  3LWU A;  4O4J F;  1A15 A;  5D14 A;  2F3I A;  2F3V A;  4DUY Q;  4JYA Q;  4DV3 Q;  1S5D D;  3H6M A;  1EQQ A;  1PH1 A;  4UCV A;  3TRZ A;  1S40 A;  2PBZ A;  2B39 A;  4LJZ C;  4EG0 A;  2F0J A;  4R4O A;  2Z4I A;  3CCR A;  2ALY B;  4NYE A;  1JWU D;  4HED A;  4BWG B;  5H1S E;  4O7T A;  4DR3 Q;  3ERS X;  2Y0S B;  3J81 L;  4G7H C;  4DAY A;  1PTO D;  1O7I A;  5C4J H;  1SMX A;  1BXT A;  1HR0 Q;  4NXN Q;  2KVM A;  2WAQ G;  4DV2 Q;  4A3L H;  1PFN A;  3CD6 A;  2NVY H;  1VQP A;  1IXR A;  2JA5 B;  1BBW A;  2GPS A;  1VQE A;  4QY7 A;  4K14 A;  1SAP A;  5NUC A;  3I4M B;  4PBC A;  3CW2 C;  4C5C A;  3IAY A;  1IKL A;  3RLO A;  2KCM A;  2RVL A;  1E2Z A;  1ENC A;  1VQM A;  1A3T A;  1SE8 A;  4FF4 A;  3ETH A;  1XPR A;  5I6Y A;  4OO1 H;  2B2U C;  1I4R A;  1KJQ A;  1F9Q A;  2JP1 A;  3K5M A;  3W3A A;  2WFW A;  4DK6 C;  1PH4 A;  4R4Q A;  4LK1 C;  4NPS A;  4JPB W;  3T99 A;  5FK9 C;  2EJ3 A;  3DM1 A;  1QB5 D;  1VQ4 A;  3I4N B;  5JJI A;  4R4I A;  2OCE A;  1ILP A;  1CHQ D;  2IPK D;  2EOT A;  2J0T D;  4XTC S;  2B2U A;  2HQL A;  1HCZ A;  1I4G A;  2E2D C;  5JQW A;  3GTM B;  3W1G A;  2AWN A;  2K75 A;  1M4V A;  3FPU B;  4K0K L;  4KY5 A;  3UZB A;  3U4Z A;  3PUX A;  2VB3 X;  4ZKB B;  1WD1 A;  1E7Z A;  4NMZ A;  1ZAU A;  3NXW A;  4NZN A;  2YS6 A;  2K28 A;  1W93 A;  4UP8 A;  4UUG A;  2VQF L;  3MTS A;  1F2M A;  4KK7 A;  3S16 B;  3F8T A;  5EBC A;  2A69 C;  4TRD A;  1K83 B;  5KND A;  4A3I B;  2CNQ A;  5C44 H;  5IT9 E;  1HA6 A;  5E3F A;  5I9P A;  3EFX D;  4A76 A;  1AUV A;  2YL2 A;  3HEJ A;  2HT1 A;  3GTO H;  2HHF B;  1N33 L;  1S68 A;  4C2M H;  1EQT A;  4XYM B;  2K03 A;  2UXC Q;  1EKF A;  2E2H H;  3C2P A;  1H9M A;  5IP7 G;  2QDL A;  2K50 A;  3F2C A;  4KHP L;  3AYH B;  4K6L A;  3BU2 A;  5DM6 3;  2NYZ D;  2Z4H A;  4OHJ A;  3M3Y B;  4QGU A;  3G8D A;  4IUP A;  2AMC B;  1F2Z A;  2CQA A;  4C3I H;  1IOV A;  2W6M A;  2K5D A;  2EJG C;  4O7N A;  3D0F A;  4IUV A;  2EDG A;  3EN2 A;  1IYD A;  1EU4 A;  1NSN S;  4A3E G;  2XCL A;  1LTA D;  4E6N A;  4DAY B;  5M5W B;  4CKE A;  4EFE A;  1G91 A;  4NDX A;  4C5A A;  4K2K A;  1FJG Q;  2WP8 J;  4K2L A;  2L12 A;  1UEA B;  2F4V Q;  4QIW E;  5AJ3 L;  3ORQ A;  5BWW A;  3A56 A;  1JR0 D;  2W6Z A;  1TU2 B;  4O42 A;  2UUA L;  5IY0 A;  3CMA A;  3SK4 A;  1N32 L;  3E5N A;  1HQM C;  1NCV A;  5JJZ A;  3CHB D;  1LT5 D;  4A3G B;  2A73 B;  2C5C A;  1I3Q H;  3ULL A;  3KUP A;  5LA6 F;  3RUZ A;  4DF7 A;  2VQE L;  5FLX c;  5JVD F;  4IJH A;  4Y7N B;  3IRB A;  1Z2P X;  4DV5 Q;  2X6L A;  2XSC A;  1MKH A;  1SLJ A;  3K57 A;  4IFD I;  1J5E Q;  4LNQ A;  1HH2 P;  2B8F A;  4PMC A;  2KUM A;  3T16 A;  5IYD H;  2K5W A;  3D3R A;  4WFN 3;  5FPR A;  4GZY C;  2KEE A;  4YCW A;  3GTG B;  4BY7 H;  5IT9 L;  5IGG A;  5DIS C;  2DIK A;  3VR2 A;  5FOB B;  2SDF A;  4IPG A;  3JAM L;  1Q90 A;  2RDF A;  5K2M A;  2F03 A;  3S2D H;  3J80 L;  5CR3 A;  3J7Z C;  5LMU Q;  3I4O A;  4C3H H;  1T5X D;  3PO2 H;  3DF7 A;  1CK1 A;  3K5O A;  2VB2 X;  2GQR A;  1A8V A;  4A3F B;  4Y52 H;  1CI3 M;  5M3F G;  1STY A;  4S3S A;  3CCE A;  2ATW A;  1W96 A;  1DOM A;  3MEF A;  2ZGI A;  2R7M A;  4LF8 L;  3RTX A;  2R7F A;  4RKB A;  2NU7 B;  1ET9 A;  4UCR A;  4BBR G;  2R92 G;  2UXB Q;  4DAV A;  4JI6 L;  5KYL A;  1VQI A;  3S2H H;  1I7N A;  1E1O A;  1RD9 D;  2IL8 A;  4DR6 L;  2FIN B;  4TKO B;  1B6S A;  3TN2 A;  4GLW A;  5KX5 F;  3T1H L;  4A3M H;  3HOV G;  2R7N A;  3CQZ H;  4NW2 A;  1I2L A;  1ZYR D;  1HFG A;  3WO1 A;  4HCS A;  4MZ9 A;  2F0S A;  2EXD A;  4QCL A;  2DNE A;  2PNH A;  3J7A F;  5CMD A;  5ELC A;  3HBL A;  1NR4 A;  3U9O A;  3L7Z C;  2BCO A;  3BDO A;  2JA7 B;  2FPI B;  2E8G A;  2YU9 B;  3NPP A;  3OSO A;  4IHJ F;  1Y1V B;  3AB9 A;  3CRK C;  3LGJ A;  2E5L Q;  3NTK A;  4X6A H;  5IP9 H;  2KCC A;  2NZO A;  3EVQ A;  2KQ3 A;  1MJE A;  1PFM A;  3L0O A;  2J9G A;  3PO3 B;  4IZ8 A;  1T9H A;  4OX9 Q;  4Y8V B;  3P7J A;  1WRV A;  3PUW A;  4LW1 A;  2E76 C;  2CVR A;  4ZI7 F;  2JA5 G;  3NBY B;  3JZI A;  1HXY D;  3SK5 A;  1NTG A;  2H4O A;  1TWF H;  2NN6 I;  3TP6 A;  4I7A A;  4CJ2 C;  1KDC A;  5FO7 B;  2HCC A;  5I4D A;  1EIY B;  1XPU A;  2F0O A;  4RKL A;  1B04 A;  4X65 Q;  4XQJ A;  1Y1W H;  2COJ A;  4YAJ B;  1AH9 A;  2VR1 A;  3HOX H;  4CJ1 B;  4APV A;  3GJX B;  3VMM A;  1VQ6 A;  2AQ2 B;  1MHW C;  4ZOL F;  5CV4 A;  4IUU A;  5BN3 A;  2IHE A;  5LL6 S;  3JZF A;  2K05 A;  3GID A;  1OTC A;  3BVG A;  1HZ9 A;  4FFM A;  3I4N G;  2K32 A;  2KHS A;  1X3G A;  2M2L A;  3J80 c;  1KLU D;  4A3B B;  4UCT A;  4QIW B;  1DM0 B;  1X56 A;  4E4T A;  4BA1 I;  4U67 3;  3PFF A;  2CH4 A;  5I60 A;  4CE5 A;  1GSA A;  1JMC A;  1A3V A;  1U5K A;  2M00 A;  3OUU A;  3AQQ A;  3TW7 A;  4L5R C;  3TQY A;  3GTJ H;  2JE6 I;  2Z1C A;  1C8C A;  3GTP H;  4JI1 Q;  2NVX B;  3KLW A;  2Y4R A;  2A6E C;  1TKW B;  5GAH C;  1OBD A;  1O7Y A;  2SNS A;  4OL7 A;  2K01 A;  2TSS A;  3I4L A;  5COR A;  4EGV A;  3J81 i;  2IW3 A;  4DR1 Q;  3DTF A;  4KJO A;  4FFO A;  4IPH A;  3GTQ H;  4LF4 Q;  3QWU A;  4OEM B;  4A3I G;  4UP9 A;  2NUC A;  4Z9C B;  1SMY C;  3L9A X;  1QE6 A;  4YWL A;  1ML0 D;  3Q2O A;  2AKW B;  3DUZ A;  1FNW A;  3WOF A;  3UDG A;  3PUV A;  2ZDG A;  2YTV A;  2WII B;  2NTT A;  4F8M A;  1NMG A;  4RMF A;  5HY6 A;  2PMZ B;  4WHX A;  1JB3 A;  2JA6 B;  2FMM A;  4MNO A;  4BBS B;  5IYB G;  1CSP A;  3GB8 B;  1JDE A;  2CZG A;  4AYB B;  1U4R A;  4UPA A;  3X3N A;  5FLM H;  1HNX L;  1KJ8 A;  1HPC A;  1WVL A;  3BZD B;  2GLT A;  5D65 A;  2YRX A;  3QG1 A;  1H9R A;  3K0X A;  1VQB A;  4LFB Q;  2VW9 A;  4HIK A;  5I47 A;  1VQN A;  4YWK A;  4WJW A;  3HB9 A;  4N8X 1;  3TEH B;  3FKI H;  1WTV A;  5K36 H;  5KS8 A;  2E74 C;  3A7L A;  1BR9 A;  1VQG A;  2FMC A;  4HSP A;  4UAI A;  5C0X H;  1TS4 A;  2HGX A;  3UE1 A;  1SE3 A;  4DNT B;  5EGT A;  2D0P A;  3K58 A;  1JE4 A;  1BBX C;  4UFZ A;  4R8N A;  1O7Z A;  3RLN A;  4O81 A;  4ZUI A;  4UHV A;  1B53 A;  2YRW A;  1DON A;  4LF9 Q;  1X55 A;  4DV1 L;  4RA8 A;  4C1N I;  4YCV A;  1PTO H;  4B3M L;  2SCU B;  3OPO A;  5CV8 A;  3M4Y A;  4M8A A;  4A3D H;  1YNJ D;  1IYU A;  1TS5 A;  2K33 A;  4Q0F A;  1LM0 A;  4A3G G;  2MUY A;  5CBE E;  1ONL A;  3E6Z X;  4L63 B;  2N88 A;  4MV1 A;  3K5L A;  3R9R A;  1VQJ A;  1ASZ A;  1Q8K A;  3I7F A;  1MJC A;  2DAB A;  1LLR D;  1PH8 A;  2NB0 A;  2R7Z B;  2O2L D;  2L0C A;  5JVH 3;  1Z47 A;  4K5X A;  2N8N A;  2RHS B;  3K6O A;  1YIT A;  2W6N A;  4DR2 L;  1VBH A;  4NZM A;  3CME A;  1SJE D;  1I6V C;  3U9T A;  5IYC G;  3GTL B;  4DN4 M;  1HR0 L;  3FPP A;  2NVQ H;  2WV6 D;  4HMJ A;  4G7Z C;  1K3R A;  4C3J B;  3K80 C;  4LH7 A;  4EQO A;  4BXX G;  1EFW A;  3U55 A;  1C48 A;  4JBM A;  1WTO A;  4RGM A;  3VR3 A;  1UE6 A;  3I70 A;  1Q1B A;  2CKZ B;  3KRE A;  4HMI A;  4O0A A;  3JC6 6;  2YZL A;  1UWV A;  5D3I B;  1I7L A;  4H44 C;  5LOV F;  4XIG S;  1SNP A;  3CCQ A;  5M3M H;  1GUO A;  1EWH A;  2OQK A;  2Q8R E;  4KTA A;  3F1Z A;  3K3P A;  4Q4C A;  4I65 A;  4MV4 A;  2RCN A;  5BWX A;  3L3O C;  4FVM A;  1VQ8 A;  4EGJ A;  2Q2T A;  4XZ3 B;  2TMP A;  1CE8 A;  5CAE B;  4YJ3 F;  2HDM A;  2XGT A;  5KNB A;  1HNW Q;  1B2T A;  1ET0 A;  1M8A A;  1DV2 A;  4MN3 A;  2RDG A;  1PZJ D;  3I73 A;  3MZ5 A;  3W2D A;  1S4Z A;  2R6G A;  1WFQ A;  2KEN A;  2N55 A;  4B3R Q;  3M4O H;  3S14 B;  1FVI A;  3GO5 A;  2F4I A;  2UUB L;  5BYB A;  1YVC A;  1BDO A;  2L4N A;  2JA7 G;  3K7A H;  2I5M X;  1Y1V G;  5C0X J;  2F0W A;  1A0G A;  3BA9 A;  1IW7 C;  5E1F A;  3R93 A;  1O7L A;  1L0X B;  4OO1 I;  5BN4 A;  5FPO A;  1S5E D;  1EIG A;  5KNC A;  4DPG A;  1NAP A;  3PO3 G;  1TWH B;  1J6Q A;  2ENB A;  3JAM i;  1STG A;  5JAV A;  1CQJ B;  5DGH A;  3VPC A;  1I6H H;  2BDN A;  2IX1 A;  1FNU A;  1PHJ A;  2COI A;  2F0Q A;  2R86 A;  3HKZ B;  3CP0 A;  4CGY B;  5EQ0 A;  2C35 B;  4RCO A;  1DYQ A;  3PGZ A;  4B3S Q;  4DR4 L;  3G48 A;  4KY6 A;  2Z6K C;  3I55 A;  1IKM A;  2LSS A;  2EZV A;  4K5W A;  2HDK A;  4MA0 A;  2X0S A;  3RUP A;  3ITP A;  4DKA C;  3CC7 A;  1NE3 A;  2YYZ A;  4ABN A;  3J7A V;  4CC6 A;  1T5E A;  4MAM A;  1RF2 D;  2EY2 A;  2GVA A;  3MXG A;  4IQZ A;  1TWA H;  3FVQ A;  1N34 L;  3R5H A;  4OON A;  1M6V A;  2CWA A;  3LWB A;  4BY1 H;  2PN1 A;  4FF1 A;  1PK8 A;  3NEL A;  1NY4 A;  4A3B G;  5CV9 A;  1JCK B;  1N36 Q;  1BF4 A;  1DD2 A;  5C3E B;  4JI3 L;  1FD7 D;  4J8Q A;  4IFD G;  1A48 A;  2EJM A;  3HOY B;  2VZA A;  2HHH Q;  4QB4 A;  3GTK B;  4DAM A;  4ILW A;  5KRU A;  3U54 A;  5BPH A;  3ORR A;  5M5X H;  1SE2 A;  2ASB A;  3I2Z A;  4K6D A;  4YCU A;  1X54 A;  4O7V A;  3H15 A;  3TDQ A;  2HD3 A;  1TVX A;  3TBI B;  4N8F A;  2JJQ A;  5K3W A;  1EYA A;  5ELN A;  5FJ8 G;  4C56 C;  2AQ3 B;  2QEJ C;  2X6G A;  4HQ6 A;  1SBB B;  1WYD A;  3HKS A;  2V4D A;  3TY5 A;  1SYC A;  2ZTC A;  1KAA A;  4X3U A;  1QIL A;  4A93 H;  1STB A;  4A75 A;  5IGB A;  2R7L A;  4YAK B;  2N49 A;  1LTS D;  2JA6 G;  3GV6 A;  1XDN A;  1VDZ A;  4BBS G;  1BCP D;  4DV6 Q;  2H5X A;  1FNV A;  3KK7 A;  3UDI A;  4AYB G;  1GM5 A;  5GAE C;  1HNZ Q;  3N6R A;  3NTH A;  2A1H A;  2FPP B;  1W6K A;  1GHK A;  3EA6 A;  3OOC A;  5BWU A;  2I46 A;  2SEB D;  1J5E L;  1BKB A;  2ZDQ A;  3MWE A;  3U0G A;  4DUZ L;  4DR5 Q;  1LT4 D;  4RFB A;  3STB C;  1WD0 A;  4NXM Q;  2VUG A;  1DJR D;  2NVY B;  3UQ8 A;  2JEB I;  3BVZ A;  1CQV A;  1GHJ A;  1H9J A;  2F0L A;  2I87 A;  3QQM A;  3FP9 A;  5LYJ F;  1SR3 A;  1KIX A;  2HGW A;  2H1E A;  3WOE A;  2Q2H A;  3M9B A;  1GD7 A;  1EY9 A;  1JQY D;  3VA7 A;  2B2Y C;  3NP8 A;  3TS0 A;  1JE5 A;  5EJW A;  4DK1 A;  3HOV B;  5HGT A;  4QL5 A;  1OXV A;  2FPG B;  4K6N A;  4KKT A;  1YNN C;  4YB8 B;  3I72 A;  5J22 A;  4C5B A;  2XD4 A;  1FGU A;  4LF5 Q;  3S15 H;  2EY5 A;  2NN6 G;  3BA8 A;  1SNQ A;  2UXB L;  3CKI B;  1D6E C;  4ME6 A;  3HOU H;  2B2Y A;  1GKH A;  1UEB A;  2D2C C;  1K8M A;  3KF8 A;  4J6H A;  4A3C G;  5IGC A;  5CA1 F;  4DNR B;  3WWI A;  2CH4 W;  1BQQ T;  4GKJ Q;  5I5X A;  1C30 A;  2R7Z G;  3SHL A;  3S1M H;  4ZYS A;  3VNN A;  1E1T A;  2ZXO A;  4XYQ A;  2B63 G;  3NC0 B;  1IBK L;  1Y14 B;  3BAA A;  2EE1 A;  4JV5 L;  4OWT B;  1MD2 D;  2E5L L;  1M90 C;  1S5B D;  5C44 B;  4H02 A;  1UC9 A;  4EFB A;  3CCJ A;  1VQ7 A;  3WWH A;  2EVB A;  4C3J G;  3TRE A;  3GTO B;  1I1M A;  4XYO A;  4OXP A;  2BE5 D;  4C2M B;  3NEN A;  3H0G H;  1HRJ A;  3QO2 A;  4N9T A;  4XYL B;  3ULJ A;  1E24 A;  2E2H B;  4GOP C;  4JI0 Q;  1QWY A;  1PH3 A;  4DXF A;  3X3M A;  2R93 H;  2A6H C;  3RFC A;  4PMB A;  1X3F A;  1U4M A;  5C4H A;  2VL6 A;  4A3K G;  2UXD Q;  4P71 A;  3DEO A;  3DWA A;  1VQ5 A;  4OIK A;  4C3I B;  3HOW H;  3T9E A;  1PRT F;  1QUQ A;  2KEC A;  3ER0 A;  4P72 A;  1GUT A;  3NBI A;  1PLF A;  1T36 A;  5IGD A;  3SK8 A;  2DWC A;  5J1Z A;  4GOP A;  2RQX A;  2K1B A;  4NB3 A;  2WYO A;  1HR0 W;  1HZA A;  4ZCK A;  1P16 A;  2JYO A;  4NP5 A;  4OEL B;  1R4P B;  2Z0S A;  1XNQ Q;  3AMU A;  2NU9 B;  2XIW A;  4JI2 Q;  5CV5 A;  4ZQI A;  5CA0 F;  5J2U F;  3NQI A;  4IJL A;  1VF7 A;  1WR2 A;  3NUA A;  3V05 A;  4O2D A;  2FFK B;  4GN4 B;  2F3W A;  5F2D A;  1IBL Q;  2VNU D;  1XX8 A;  3I4M H;  1BBU A;  5EZY F;  3C46 A;  4KN7 C;  2KA7 A;  1I50 H;  1MBY A;  1QG7 A;  2DJG C;  1IL2 A;  4R4C A;  4F88 A;  3S1N H;  2V5A A;  1D8L A;  5LMN Q;  4P2C B;  1TR5 A;  4JI5 Q;  1PH7 A;  3KJP A;  4AQY Q;  5IIF A;  4KD4 A;  3J81 c;  1I3Q B;  1ET6 A;  5LP6 F;  3BDL A;  2CWP A;  4R4T A;  4O7S A;  2F0N A;  3IKJ A;  4PV1 C;  3HKZ G;  4JBJ A;  2YWV A;  4QQB X;  1ESR A;  2GQS A;  3RZO H;  5D3D A;  1PH9 A;  3T54 A;  3HRZ C;  4MV8 A;  2LFN A;  3A55 A;  1XNR Q;  1NMF A;  1HTP A;  3VYT A;  4A93 G;  1VCI A;  4DA2 A;  2A19 A;  3H91 A;  4BY7 B;  3KF8 B;  2K6A A;  1CM9 A;  3M7G A;  4O2B F;  1DV1 A;  1ROD A;  1WTW A;  1TXY A;  4YHH L;  2OTJ A;  2ZTD A;  4GN5 A;  5LL6 X;  2M9V A;  5ELE A;  5E25 A;  3S2D B;  1CQI B;  4CHI A;  2Z8L A;  1QOH A;  5C3E G;  4X3K A;  2RSN A;  2QCP X;  3S1R H;  4MTN A;  1QZG A;  1AZQ A;  3PO2 B;  1A6X A;  4U68 A;  3HOY G;  2CW0 C;  4ME5 A;  3CCS A;  3C3L A;  2F0E A;  3R5X A;  4GS3 A;  4RWS C;  2A6E D;  1I94 Q;  4UY8 C;  4LFA Q;  2COG A;  3BVM A;  1B8A A;  4DR7 L;  5LHY 1;  4HNV A;  3B6Y A;  2IX3 A;  2RCF A;  1RL2 A;  2LKV A;  2KCN A;  1V1Q A;  1SMY D;  2CFM A;  1TS2 A;  1D2B A;  2W6O A;  4CC5 A;  1KJJ A;  4GKK Q;  3S2H B;  5LMN W;  2CNU A;  2MPM A;  4UCO A;  4A3M B;  4K8I A;  1F2Y A;  4LF7 Q;  1B3A A;  3CQZ B;  3MC0 B;  1EUJ A;  2FJ2 A;  2PMZ E;  2IX0 A;  3M3Y H;  1I1K A;  4TV9 F;  4O4H F;  1TWC H;  5I5T A;  5ISR A;  5AFW A;  1X6O A;  1PMR A;  3TZU A;  4M9U A;  1R9T H;  1QUQ B;  4AYB E;  3MWD A;  2DJF C;  1KQS A;  4WOR A;  4L6T B;  1PTO C;  2CNV A;  2HIV A;  2BA1 A;  4JI8 Q;  4GOP B;  1EY0 A;  2JN4 A;  2JEA I;  5C0X I;  3VYU A;  3U58 A;  1LTL A;  3D6C A;  3VR5 A;  1ICF B;  1NUC A;  2ODT X;  1HFN A;  1WCM H;  1S72 A;  5DEH A;  1SXT A;  4A3L G;  4O82 A;  3T9B A;  4K5V A;  1STE A;  1KNE A;  5E4X A;  1CUK A;  2G9H D;  2ZDH A;  1PH2 A;  4O2A F;  1AFP A;  1B3Q A;  1TWF B;  3UZO A;  3M85 A;  2AUK A;  4JVZ A;  2DNC A;  2UUC L;  2PI2 A;  2EYM A;  4DV4 Q;  4OO1 G;  2JA8 H;  1OBG A;  1UE5 A;  3RN2 A;  2MQH A;  1A62 A;  1XMQ L;  5M5Y H; 
#chains in the Genus database with same CATH homology
 5JEA G;  2A8V A;  5J3B A;  2A1A A;  2K5H A;  1WJJ A;  2L15 A;  1X55 A;  4DV1 L;  1X9N A;  2UUB Q;  4LUO A;  4LF9 Q;  3H0G G;  4GLV B;  4YCV A;  5IP7 H;  1KHI A;  4B3M L;  1TWH H;  4AIM A;  2QGQ A;  1XMO L;  1K0R A;  3T1Y Q;  4A3D H;  3F2B A;  3EBE A;  4BY1 G;  3CF5 A;  4DV0 L;  1V43 A;  4JBW A;  1LM0 A;  4LFA L;  1YJ9 A;  1PH6 A;  2BH2 A;  3RR5 A;  2JA5 H;  3S17 H;  2KHI A;  4A3G G;  4UCV A;  1VQA A;  1HNW L;  4JI1 L;  1PFS A;  1GO3 E;  3H3V I;  2WB1 E;  1KXL A;  4LUV A;  2GVB A;  4X64 L;  4DR1 L;  1SFO H;  3GTG H;  1VQJ A;  2R7D A;  3F2D A;  1ASZ A;  1Q8K A;  2VUM G;  1OXU A;  2ID0 A;  1CKN A;  1MJC A;  3I7F A;  4LF4 L;  1PH8 A;  5IE8 A;  4HJ9 A;  1EOV A;  3CC2 A;  3A0J A;  2V1C C;  1WI5 A;  1Z47 A;  2N8N A;  4P75 A;  4YY3 L;  1PA6 A;  1LYL A;  4LF7 L;  1D7Q A;  2ZJR A;  1HJP A;  1OXT A;  1RIP A;  1CSQ A;  2RHS B;  1C0A A;  1HZB A;  1YIT A;  1VQO A;  4DR4 Q;  4DR2 L;  4DRF A;  4HJ7 A;  1SN8 A;  3CME A;  3H3V H;  5C44 G;  2OWO A;  1DGS A;  3HOZ H;  5IYC G;  1HR0 L;  3I4N H;  2NVQ H;  4L5Q A;  3NBZ B;  1K3R A;  3HFZ B;  3K80 C;  2UU9 L;  4LH7 A;  4BXX G;  3MXN B;  4JI4 L;  5IT9 c;  4LF6 L;  3BZK A;  1EFW A;  5C3E H;  4JBM A;  4R1J A;  3M4Q A;  3GTM H;  2D62 A;  4JI8 L;  1UE6 A;  4QJF A;  1Q1B A;  2CKZ B;  4X66 L;  4EQ5 A;  3JAM c;  4O0A A;  2ZM6 Q;  3G4S A;  3JC6 6;  3PO3 H;  1UWV A;  3GTK H;  1XJV A;  3PF4 A;  4LFB L;  2I5H A;  3K7U C;  3DLL A;  1YJN A;  4XIG S;  1S3O A;  5M3M H;  3CCQ A;  3OW2 A;  4JI3 Q;  3BZC A;  1YIJ A;  2OQK A;  4DV1 Q;  3F1Z A;  4B3M Q;  2I0Q A;  2RCN A;  2BA0 A;  1VQ9 A;  5D1O B;  3PN1 A;  1VQ8 A;  1IBM L;  3S16 H;  4WJ4 A;  4PZ7 A;  2Q2T A;  1W2B A;  1K83 H;  4A3I H;  3OTO L;  5IWA L;  2CCZ A;  2XGT A;  1Q86 C;  1HNW Q;  1YJW A;  4JBK A;  4DV4 L;  2VQF Q;  1JJG A;  2IY5 B;  4JI7 L;  2R6G A;  1YHA A;  2F3I A;  3PUY A;  1WFQ A;  4DUY Q;  4JYA Q;  4DV3 Q;  1L2F A;  2KEN A;  3G71 A;  4B3R Q;  1EQQ A;  1PH1 A;  3M4O H;  1FVI A;  3TRZ A;  3GO5 A;  5IYB H;  1S40 A;  4LF9 L;  4JG2 A;  2UUB L;  2CQO A;  3A5Z B;  1YVC A;  2ZJP A;  1VQC A;  4R4O A;  2JA7 G;  3CCR A;  3G6E A;  3K7A H;  2ALY B;  2I5M X;  1Y1V G;  5C0X J;  3PIO A;  3CPF A;  4HIM A;  1N33 Q;  4A3J H;  5H1S E;  3BA9 A;  1YZ6 A;  4DR3 Q;  3ERS X;  1EWI A;  4GLA C;  4OO1 I;  2KHJ A;  1IZ6 A;  4IOA A;  5FPO A;  2N3S A;  1O7I A;  4KI0 A;  1SMX A;  5C4J H;  1PH5 A;  4DPG A;  2PI2 E;  1HR0 Q;  4NXN Q;  1J6Q A;  1Q46 A;  3PO3 G;  2FXQ A;  2WAQ G;  3JAM i;  4DV2 Q;  2UU9 Q;  1X65 A;  3CD6 A;  2NVY H;  1VQP A;  4JI4 Q;  2PQA A;  1IXR A;  4A3L H;  2Q2U A;  5E7N A;  3S1Q H;  1UE7 A;  2IX1 A;  1I6H H;  3HOU G;  1NJI C;  1BBW A;  1VQE A;  4X66 Q;  4QY7 A;  1PHJ A;  2HVQ A;  1I5F A;  3CW2 C;  3HKZ E;  4P73 A;  3RLO A;  2KCM A;  4DUZ Q;  3CP0 A;  3UDF A;  1VQM A;  1SE8 A;  1XPR A;  1YNX A;  2C35 B;  3KF6 A;  5M5W H;  3PGZ A;  4B3S Q;  4DR4 L;  3G48 A;  1GVP A;  2Z6K C;  3I55 A;  1L1O C;  2LSS A;  3A5U A;  1TAE A;  1Q12 A;  4DV6 L;  5IYD G;  3CPW A;  4DKA C;  2WFW A;  3UE0 A;  1NE3 A;  3CC7 A;  2YYZ A;  4ALP A;  4B3T L;  4CC6 A;  4DK6 C;  3OTO Q;  1PH4 A;  1G51 A;  5C4X H;  1HNZ L;  4BY7 G;  4R4Q A;  4NPS A;  2GVA A;  5ELO A;  1TWA H;  3KDF A;  4EX5 A;  1M1K C;  1N34 L;  4OON A;  2CWA A;  2ZM6 L;  1VQ4 A;  4BY1 H;  1LUZ A;  1CKN B;  3PV0 A;  5JJI A;  4R4I A;  2OCE A;  1Q81 C;  5AJ3 Q;  3NEL A;  1NY4 A;  4XTC S;  4IPC A;  4NXM L;  4A3B G;  3E9I A;  2HQL A;  1N36 Q;  4A3G H;  4JI3 L;  2UUA Q;  3W1G A;  1L1O A;  2K75 A;  2AWN A;  3Q8D A;  3U4V A;  4IFD G;  4K0K L;  2VZA A;  2HHH Q;  1YBY A;  3PO2 G;  4IO9 A;  4JCV E;  3PUX A;  2YTY A;  5GRO A;  3U4Z A;  1Q7Y C;  4DAM A;  4GN3 B;  1E7Z A;  2VUM H;  4Y7N H;  5M5X H;  2R93 G;  2ASB A;  3I2Z A;  1L0W A;  1BVS A;  4YCU A;  1X54 A;  3H15 A;  4UP8 A;  3RZD H;  1QVF A;  2VQF L;  2JJQ A;  2YV5 A;  3F8T A;  2F52 A;  5ELN A;  3CXC A;  3HOW G;  5FJ8 G;  3JSN A;  4J15 A;  1PYB A;  4DV7 L;  1AE3 A;  4DUY L;  1U0L A;  4JYA L;  1B70 B;  1EIF A;  1UE1 A;  4DV3 L;  5C44 H;  4B3R L;  1H95 A;  1WYD A;  3HKS A;  4A76 A;  5IYC H;  1JJ2 A;  3TY5 A;  4HJ5 A;  3EIV A;  1A0I A;  2ZTC A;  4HIO A;  4A3M G;  1KD1 C;  1IBK Q;  4A93 H;  4L5S A;  4BXX H;  4JV5 Q;  2HT1 A;  3GTO H;  4A75 A;  2AWO A;  3FHW A;  1N33 L;  1S68 A;  4C2M H;  1VQK A;  1WOC A;  2UXC Q;  2N49 A;  3AFP A;  2Y0S G;  3CAM A;  4DR3 L;  2E2H H;  2JA6 G;  1XDN A;  4A3F H;  4BBS G;  2WAQ E;  5IP7 G;  4DV6 Q;  2H5X A;  1N9W A;  4NXN L;  4B3T Q;  3UDI A;  4LWC A;  2K50 A;  4AYB G;  3F2C A;  1GM5 A;  4DV2 L;  4LFC L;  5GAE C;  4GKJ L;  1HNZ Q;  4KHP L;  3AYH B;  2OQ0 A;  2K52 A;  3AEV A;  3BU2 A;  3RLF A;  1JJC B;  5JJK A;  5IP9 G;  4QGU A;  1TWG H;  1J5E L;  2AMC B;  3I4M G;  1E22 A;  3E9H A;  4C3I H;  4DK3 C;  1BKB A;  4DNI A;  3CCU A;  4DUZ L;  4DR5 Q;  3STB C;  4NXM Q;  3UQ8 A;  2VUG A;  2JEB I;  3M7N A;  2JK8 A;  3D0F A;  4OWX B;  3ICE A;  2JQO A;  4B3S L;  3EN2 A;  4K0K Q;  1XPO A;  4KLK A;  3FP9 A;  1SR3 A;  4PG3 A;  2B29 A;  4A3E G;  1KIX A;  1VS0 A;  4E6N A;  2Q2H A;  2N78 A;  3M9B A;  1GD7 A;  4DR6 Q;  4DAY B;  4TVA B;  4EFE A;  3S24 A;  3T1H Q;  3TS0 A;  1CKM A;  3M4P A;  1Y1W G;  1JE5 A;  1FJG Q;  3BAB A;  2WP8 J;  3HOX G;  3RNU A;  3PUZ A;  1IYJ B;  1OXV A;  2PQA B;  4QL5 A;  2E2I H;  2YU9 H;  2JA7 H;  1XTD A;  3KJO A;  1Y1V H;  2F4V Q;  4DV7 Q;  4QIW E;  5AJ3 L;  2HVS A;  1VQL A;  4RG1 A;  1N36 L;  2KCT A;  3NEM A;  3J7A 5;  2UUA L;  5IY0 A;  3CMA A;  1MIU A;  1K8A C;  1FGU A;  3GD7 A;  3VDY A;  3NBH B;  4POF A;  4LF5 Q;  2HHH L;  2DGY A;  5JEA J;  3S15 H;  2NN6 G;  3BA8 A;  2YTX A;  3KF6 B;  2UXB L;  2GN5 A;  4YWM A;  3UDX A;  5GAD C;  1FL0 A;  3CC4 A;  1W3S A;  3HOU H;  2VY3 A;  4BA2 I;  3PCO B;  3CCV A;  1GKH A;  1I3Q H;  1UEB A;  3ULL A;  1EQR A;  1CKO A;  4A3C G;  4HID A;  3JSL A;  2WB1 G;  2VQE L;  5FLX c;  4LFC Q;  4GKJ Q;  4IJH A;  4KHP Q;  1KC8 C;  3IRB A;  3KDF B;  4DV5 Q;  2R7Z G;  1MKH A;  1SLJ A;  4A4I A;  3S1M H;  4IFD I;  1J5E Q;  4LNQ A;  1HH2 P;  3VNN A;  1E1T A;  5IYD H;  3ULP A;  2B63 G;  3NC0 B;  5FPR A;  4IPD A;  1Y14 B;  1IBK L;  3BAA A;  4YCW A;  3W1B A;  4BY7 H;  1SRU A;  4JV5 L;  1E3P A;  4OWT B;  1L1O B;  5DIS C;  2E5L L;  1M90 C;  4HJA A;  4IPG A;  2UXC L;  1YHB A;  1OXS C;  4H02 A;  4EFB A;  4EEQ A;  3KOJ A;  3CCJ A;  1VQ7 A;  4P74 A;  3S2D H;  4A3B H;  3TRE A;  2K5V A;  3J7Z C;  2RF4 A;  2MFI A;  4OXP A;  5LMU Q;  5LMN L;  4A3J G;  3BJU A;  3I4O A;  4C3H H;  1B7Y B;  3H0G H;  3NEN A;  4LH6 A;  3PO2 H;  5BR8 L;  3ULJ A;  1E24 A;  4YHH Q;  2QEX A;  4GOP C;  4JI0 Q;  1A8V A;  4Y52 H;  1QVG A;  4GNX C;  1PH3 A;  5M3F G;  3CCE A;  2ATW A;  2R93 H;  3TY9 A;  4DR5 L;  1G29 1;  3PF5 A;  2DUD A;  2D0O A;  5FLM G;  2NVX H;  3MEF A;  1X3F A;  2Z6K A;  4LF8 L;  1N32 Q;  3RTX A;  2VL6 A;  1QVC A;  2R7F A;  1X3E A;  4A3K G;  4P71 A;  2UXD Q;  4UCS A;  3I56 A;  4UCR A;  1YEZ A;  4BBR G;  1VQ5 A;  2R92 G;  3HOW H;  4JI6 L;  5FJ8 H;  2UXB Q;  3KFU A;  1WCM G;  1QUQ A;  1VQI A;  3ER0 A;  3S2H H;  4P72 A;  3U50 C;  2HVR A;  4DR7 Q;  1E1O A;  4DR6 L;  2BH8 A;  2HIX A;  2K4K A;  2ES2 A;  3T1H L;  4A3M H;  4GOP A;  1KAW A;  2Q2I A;  1FJG L;  4NB3 A;  3HOV G;  2VQE Q;  4GNX A;  1HR0 W;  1HZA A;  5JJL A;  3CQZ H;  3FKI G;  5K36 G;  1P16 A;  1VQH A;  2Z0S A;  2F4V L;  1XNQ Q;  4MZ9 A;  2EXD A;  5GQO A;  2JA6 H;  5C4X G;  2PNH A;  4JI2 Q;  1YHQ A;  5C0X G;  4BBS H;  2JA8 G;  1C9O A;  3L7Z C;  4LF5 L;  4IJL A;  2E8G A;  3K81 C;  4O2D A;  1I94 L;  4GN4 B;  3LGJ A;  2E5L Q;  3DM3 A;  1IBL Q;  2VNU D;  4X6A H;  1K8G A;  5IP9 H;  2NZO A;  3I4M H;  1BBU A;  1MJE A;  2ZTE A;  1VQF A;  2LXJ A;  3L0O A;  1I50 H;  1K9M C;  1T9H A;  4OX9 Q;  3PSI A;  1IL2 A;  2MO1 A;  4POG A;  4A3D G;  2I5L X;  4KHZ A;  4R4C A;  1HNX Q;  3S1N H;  3PUW A;  4LW1 A;  1D8L A;  5LMN Q;  4GKK L;  1V9P A;  4JI5 Q;  1PH7 A;  3KJP A;  4AQY Q;  3J81 j;  4DV5 L;  2JA5 G;  5BR8 Q;  3J81 c;  3STB D;  3NBY B;  4A3E H;  5DLQ E;  3W5O A;  1NTG A;  1TWF H;  2CWP A;  2NN6 I;  2EQS A;  4R4T A;  3HKZ G;  4JBJ A;  4JC0 A;  1EIY B;  4QQB X;  1XPU A;  1B04 A;  4PZ8 A;  4X65 Q;  3RZO H;  1Q1E A;  1PH9 A;  4JOI C;  2VS1 A;  1Y1W H;  4LF8 Q;  1AH9 A;  4WJ3 M;  3ZJY C;  1N32 L;  3HOX H;  4APV A;  3GJX B;  1OXX K;  2B3G A;  1XNR Q;  1VQ6 A;  1A63 A;  1NMF A;  4JI6 Q;  2K5N A;  2UUC Q;  4A93 G;  1VCI A;  2A19 A;  2MNA A;  1G6P A;  2IHE A;  3KF8 B;  4UCU A;  5LMU L;  1N8R C;  3RN5 A;  1PYS B;  1TXY A;  3WWV A;  4YHH L;  3HOZ G;  2OTJ A;  1OTC A;  2ZTD A;  4GN5 A;  4JI0 L;  4A3F G;  1XMQ Q;  3TS2 A;  1HZ9 A;  1KRS A;  1VQD A;  3I4N G;  1JT8 A;  1X3G A;  3J80 c;  2NZH A;  4UCT A;  4JOI A;  3AFQ A;  2IT1 A;  3K8A A;  5C3E G;  3S1R H;  1X56 A;  4MTN A;  1QZG A;  1XMO Q;  4A3C H;  2RHQ B;  3HOY G;  4BA1 I;  1P8L A;  2UXD L;  3TY8 A;  3CCS A;  1JMC A;  4DV0 Q;  4GS3 A;  1U5K A;  3A74 A;  1I94 Q;  2E2J H;  4UY8 C;  4IFD J;  4LFA Q;  3AQQ A;  1XK5 A;  2IHF A;  4L5R C;  2R7Z H;  2AHO B;  3TQY A;  2JE6 I;  5M3M G;  3GTJ H;  2ZJQ A;  3GTP H;  1B8A A;  4DR7 L;  4JI1 Q;  3KLW A;  1EYG A;  5D1P A;  2JA9 A;  5GAH C;  4LUZ A;  3PIP A;  3B6Y A;  4X62 L;  2B63 H;  4X64 Q;  4DR1 Q;  5GAG C;  1YI2 A;  3J81 i;  3CCL A;  1RL2 A;  4UP7 A;  4ME3 A;  2QA4 A;  1V1Q A;  1JB7 A;  2CFM A;  4CC5 A;  4IPH A;  3GTQ H;  4LF4 Q;  4GKK Q;  1SRO A;  1XNQ L;  1N34 Q;  3QWU A;  5LMN W;  4A3I G;  4OWW B;  4UP9 A;  1Z9F A;  1ASY A;  4UCO A;  3L2P A;  4JI2 L;  4YWL A;  2OTL A;  3GTL H;  2XTI A;  4YY3 Q;  2AKW B;  1PVO A;  4LF7 Q;  1K73 C;  4C3J H;  3UDG A;  1AE2 A;  3OYY A;  3PUV A;  3T1Y L;  2YTV A;  5D1O A;  1EUJ A;  1NMG A;  2PMZ E;  4RMF A;  2Y0S E;  5HY6 A;  2IX0 A;  4DR2 Q;  1IBL L;  3M3Y H;  1TWC H;  4HJ8 A;  3HOY H;  4L5T A;  1X6O A;  4MNO A;  3SGI A;  1R9T H;  5IYB G;  1CSP A;  1QUQ B;  4PZ6 A;  4AYB E;  5M3F H;  3GB8 B;  1KQS A;  1PV4 A;  4OX9 L;  2KBN A;  4TQU S;  4LF6 Q;  5EAY A;  4UPA A;  4AH6 A;  5FLM H;  1HNX L;  4FDB A;  2HIV A;  2BA1 A;  4JI8 Q;  4GOP B;  4JI5 L;  3J80 i;  4GNX B;  4AQY L;  4A3K H;  5C0X I;  2JEA I;  3K0X A;  3U58 A;  1LTL A;  4BBR H;  2R92 H;  1VQB A;  1HZC A;  4GLX A;  2VW9 A;  4LFB Q;  1WCM H;  4HIK A;  1S72 A;  2K14 A;  4A3L G;  1VQN A;  2EIF A;  4UFZ A;  1NBW A;  2MO0 A;  4X65 L;  4IOC A;  4YWK A;  1CUK A;  3HOV H;  2NVT H;  3TEH B;  1IBM Q;  1PH2 A;  3FKI H;  1Q82 C;  1XNR L;  3M85 A;  2UUC L;  1C7Y A;  2LXK A;  5IWA Q;  2PI2 A;  3D31 A;  3KYH C;  3CCM A;  1VQG A;  3S14 H;  4DV4 Q;  4OO1 G;  3GDE A;  5HGQ A;  1KL9 A;  3UE1 A;  2JA8 H;  1UE5 A;  4PMW A;  1KRT A;  4X62 Q;  3RN2 A;  2MQH A;  1A62 A;  2D0P A;  1TA8 A;  4JI7 Q;  3E0E A;  1XMQ L;  3RLN A;  5M5Y H;  1QZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...