3S24A

Crystal structure of human mrna guanylyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
336
structure length
328
Chain Sequence
GAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase
molecule keywords mRNA-capping enzyme
publication title Structure of the guanylyltransferase domain of human mRNA capping enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 328
sequence length 336
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.7.7.50: mRNA guanylyltransferase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain
A PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s24A03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3s24A01
4.10.87.10 Few Secondary Structures Irregular mRNA Capping Enzyme; Chain mRNA Capping Enzyme; domain 3 3s24A02
1PYSB 1KRSA 1VCIA 3E9IA 2A19A 4DPGA 1XJVA 3JSNA 2OQKA 1HZBA 3ULPA 4PZ8A 3L0OA 1KRTA 3S2DH 5IT9c 1XMQQ 3RN2A 1U5KA 2QA4A 1VQ5A 3ULJA 2UUAL 3PN1A 4UCTA 3RLOA 3NEMA 4GS3A 4Y52H 1JJGA 3CCQA 5C0XG 3J80i 3CQZH 2Q2TA 1RL2A 4B3MQ 4NPSA 4OWXB 5EAYA 4X6AH 5M5YH 1LTLA 1SROA 4P73A 4DR2Q 1HNXL 4NXMQ 2MFIA 4JI7L 3KF6A 3I4MH 3I4MG 3BU2A 1ASZA 4POFA 4HIKA 2RCNA 2F4VQ 4LF4L 1PH9A 1S40A 1JE5A 1N8RC 3CW2C 1WYDA 2ZTEA 1LM0A 4JYAL 2UXBL 4LFCL 4DV7Q 4C3IH 1Q8KA 3BA9A 3RTXA 4JOIA 1TXYA 3GTQH 4PG3A 3PUYA 2ZM6Q 1H95A 1PYBA 5LMUL 4XTCS 1YIJA 3GTPH 3KFUA 4DV6Q 3D31A 4DR7L 3HOYH 3HOYG 1VQGA 3HKZG 5IY0A 4LF7L 1QVGA 1FVIA 1NBWA 3A5UA 2K5VA 3AFPA 2ATWA 3HOWG 3I4NH 1NY4A 3M4QA 4JI6L 2A1AA 2VW9A 1T9HA 2PI2A 1E24A 2UUAQ 3BAAA 4OO1I 3KF8B 2N8NA 1V9PA 2V1CC 2VNUD 4GOPC 2LSSA 2R7FA 2VUGA 2JE6I 2EIFA 4EEQA 5IYCG 1J6QA 1YNXA 3AYHB 3UDFA 1VQBA 1X65A 5C4XH 4J15A 2VS1A 1N34L 1I3QH 2VUMG 3K8AA 5GAHC 1HNXQ 5C4XG 1M1KC 1R9TH 1MIUA 1WFQA 3CCJA 4IO9A 2HIVA 4JI7Q 1UE7A 1J5EL 3CC7A 3U50C 3MEFA 1VQLA 4HJAA 3FKIH 4GLVB 3W1GA 4GOPB 3QWUA 3CMEA 1Q46A 3AFQA 4IJHA 4LF4Q 1GVPA 5JJIA 4DV4Q 4YCWA 1G6PA 4DAMA 4A3EG 4UCSA 4IPCA 5IYBG 4LF5L 1B8AA 4NXNL 3CD6A 2RHSB 3OYYA 4JYAQ 3L7ZC 4LFCQ 3OW2A 3KJPA 1CKNA 4LF8L 2OTJA 2UXBQ 2NZHA 1X3EA 3Q8DA 4YCVA 1YHQA 4CC5A 4BY7H 4BY7G 3RLNA 2JA7G 5JEAG 2PNHA 2JA7H 3GTJH 4OO1G 4A3JG 5FJ8H 5LMUQ 3NC0B 2PI2E 4E6NA 5GAGC 1PH4A 2R92H 3UE1A 1K83H 3PIPA 2MO1A 2R92G 4DR7Q 4LF7Q 1PH7A 5BR8L 2ZJPA 4JI3L 3LGJA 3UDGA 2WB1G 1PFSA 1HZCA 4GNXC 4A3IH 4A3IG 1A0IA 3U58A 2DGYA 3S16H 1S72A 1U0LA 1RIPA 1IYJB 1Q1BA 2D0OA 2XTIA 4NB3A 5E7NA 3PF5A 4A3CG 4A3CH 1QZHA 1CSPA 2Q2HA 3A5ZB 1AE3A 5LMNL 1X55A 4R4OA 4ALPA 3KDFA 1OXTA 4OXPA 1N34Q 2R7DA 1QUQA 1PH3A 4B3RL 2IT1A 3FHWA 1YI2A 4Y7NH 1K0RA 1KD1C 4POGA 3VNNA 5D1PA 4YHHL 1J5EQ 1N9WA 3IRBA 2IHEA 1VQCA 1Y14B 1VQAA 1PH5A 2ZJRA 4JI8L 2OCEA 3CC2A 3S2HH 1ASYA 1B70B 4EFBA 4DUYQ 2GVAA 4LF5Q 1WI5A 1L2FA 4O0AA 1Q86C 4NXNQ 2HT1A 4YWLA 2VQEQ 1VQ9A 2ID0A 4LF8Q 4A93H 4A93G 4DR1L 3NBHB 1E7ZA 1N33L 3F8TA 2YYZA 2NZOA 3J81j 1G51A 2K50A 3CPFA 3PO2H 3PO2G 3F2BA 3M3YH 2CCZA 3CF5A 3KYHC 2ZTDA 4R1JA 4BA1I 3CCMA 5GROA 3H3VI 3G4SA 4DV0L 5BR8Q 5FLMH 1X56A 3U4VA 5FLMG 3J80c 2HVRA 1OTCA 5M5XH 3BABA 3CCRA 3M7NA 1D8LA 1K9MC 4JI2L 3RR5A 2LXJA 3EIVA 3NENA 1VQPA 4DV5Q 3M85A 4IOCA 2NVXH 5M5WH 1NMGA 5LMNQ 3AQQA 3U4ZA 1SRUA 2KHJA 4DAYB 4JI5L 3NBZB 1Q12A 2D0PA 3F2DA 3D0FA 4B3RQ 2WAQE 4LF6Q 4A3DH 3CCEA 4A3DG 3F2CA 3UDXA 1VQDA 3OTOL 1UWVA 4P74A 4HIMA 1FL0A 5J3BA 4DV2L 4JI8Q 5C0XJ 1FGUA 1XNQL 3TS2A 1YHBA 2PQAB 2F52A 1EUJA 2Z6KC 1XTDA 3I2ZA 4GN3B 4UFZA 4IPDA 1TWHH 2E8GA 1KHIA 1UEBA 1FJGL 2YU9H 3H3VH 1Y1WH 1Y1WG 4OX9L 3JAMi 3TY8A 1Q1EA 3A74A 1VQHA 3J81c 4B3TL 3GTKH 1BVSA 2VQFL 4DR1Q 3PCOB 1E1TA 4IPHA 5C3EG 1CSQA 5C3EH 3PUXA 5DISC 2JJQA 2Q2IA 3BZKA 4AQYL 3CCLA 1N33Q 3PUWA 1VQ7A 1HNZQ 4HJ8A 1PV4A 3CXCA 1KQSA 2FXQA 3J81i 3CCSA 4DV0Q 4JOIC 4HJ5A 4DR3L 3PF4A 4TQUS 4JI4L 4GKJL 4KLKA 3I4NG 5JJKA 2CKZB 4JI2Q 2JK8A 4X65L 1EFWA 2BH8A 4UCVA 1N32L 1XPOA 2XGTA 4DV1L 1L1OC 2RF4A 2NVTH 1XK5A 3JC66 2CWAA 3F1ZA 3RZDH 1LYLA 4HJ9A 1OXSC 2PMZE 2HVQA 5C4JH 1HZ9A 2UXCL 3EN2A 5GADC 3CC4A 1XNRL 1E22A 4X66L 2AHOB 1SR3A 2K5HA 2CFMA 4ME3A 4L5TA 4QIWE 3CCUA 4DV3L 1JB7A 3OTOQ 3FP9A 1IBKL 4DK6C 4L5QA 2K5NA 1EIYB 2VL6A 4DV2Q 1K8GA 1I94L 1YHAA 1XNQQ 1L1OB 5IYDG 4DUZL 3ICEA 5IYDH 2MNAA 3FKIG 4JI0L 3TS0A 1OXVA 5IP7H 5IP7G 2YTXA 3TY5A 2MQHA 4GOPA 1FJGQ 3PO3G 3PO3H 4IFDI 1CKMA 4OX9Q 2GN5A 1I50H 2RHQB 3T1HL 2I5MX 1VQKA 1B04A 4B3TQ 5FPOA 2VQFQ 2ZJQA 3BZCA 1PH1A 4AYBE 4DR4L 5AJ3L 1TA8A 2EQSA 1C9OA 4H02A 1EWIA 3RZOH 2JQOA 4A4IA 1V43A 3ER0A 4DNIA 5IE8A 4A75A 1V1QA 5FJ8G 3GJXB 4PZ7A 1VQOA 3L2PA 2E5LL 1W3SA 1L0WA 3GTGH 4DR3Q 2HQLA 1HH2P 4OWTB 1XMOL 4PMWA 1NE3A 1X6OA 2YTYA 4JI4Q 4LF9L 4GKJQ 4LH6A 4X65Q 4JI6Q 4UCOA 4JI1L 3CCVA 1IBLL 3PUVA 5JEAJ 3BA8A 1N32Q 2ASBA 1MKHA 4DV1Q 3NBYB 1PA6A 2I5HA 3TQYA 3KLWA 1I6HH 3HOXH 1IXRA 1IL2A 2D62A 1XNRQ 4IFDG 1A63A 3E9HA 4X66Q 5C44G 5C44H 4DV3Q 1PH6A 2K14A 2B63H 3ULLA 2B63G 2R7ZH 2R7ZG 2GVBA 4QY7A 1IBKQ 4JV5L 4GNXB 4A76A 4X62L 5JJLA 5D1OB 4R4IA 1I94Q 1VQNA 3DM3A 1HR0W 4LFBL 4DUZQ 4UP7A 2YV5A 1XPUA 3I55A 4QL5A 1VQJA 4JI0Q 1EQRA 2YTVA 4RG1A 1YJ9A 1KL9A 2JA9A 4MNOA 3T1HQ 1Q82C 4MZ9A 4KI0A 2AWOA 2JEAI 5FLXc 4LFAL 1MJCA 1VQ8A 4DR4Q 5IP9H 5IP9G 5AJ3Q 3GDEA 2IY5B 1Z47A 3W1BA 5HY6A 4DKAC 5M3FH 5M3FG 2WAQG 2HIXA 2UU9L 3CAMA 2C35B 1JT8A 3BJUA 4TVAB 1O7IA 2ALYB 4GN4B 2BA1A 3J7A5 3UE0A 2E5LQ 4LNQA 2OQ0A 2KCMA 1C7YA 4P71A 1LUZA 1XMOQ 4LUVA 2WP8J 4LF9Q 4A3BH 4LUOA 3W5OA 4C3HH 4HJ7A 4JI3Q 1HNWL 1HJPA 3K80C 1BBWA 1KAWA 4JI1Q 4R4CA 5HGQA 1JMCA 4GLXA 4WJ3M 2F4VL 4OWWB 5GQOA 4K0KL 1CUKA 2QGQA 3H0GH 5DLQE 4GLAC 1E1OA 4OONA 3GTOH 3A0JA 1W2BA 2HVSA 4UP8A 2N3SA 1PH2A 4YWKA 4A3MG 4A3MH 3K81C 3PGZA 3ERSX 1K8AC 4MTNA 1TAEA 1SN8A 3GO5A 4JV5Q 1XDNA 4JBWA 4BY1H 4BY1G 4APVA 4X62Q 4DR6L 2VZAA 1PVOA 2JA5H 4YHHQ 2N49A 2JA5G 1K73C 3EBEA 3PIOA 3JAMc 4LFBQ 4UY8C 1E3PA 3G6EA 2CWPA 3HFZB 4P75A 4UP9A 4DV6L 1AE2A 2NN6I 4B3SL 1GO3E 3K7AH 4JBMA 2PQAA 1VQEA 4LFAQ 3KJOA 5K36G 4JCVE 1YITA 3S1RH 2I5LX 1TWFH 2UUCL 3RN5A 2Y0SE 2UU9Q 4P72A 2K52A 2NVYH 3STBD 1OXUA 1JJCB 2QEXA 1UE6A 4LW1A 2UUBL 3S1NH 4UCRA 1TWGH 1IZ6A 3KOJA 3I56A 2E2JH 2Z6KA 3NELA 1A8VA 3KF6B 1EIFA 1MJEA 4HIOA 3DLLA 1HNWQ 1WOCA 3K7UC 2JEBI 3STBC 3RNUA 1SFOH 2E2IH 4GKKQ 4R4QA 4UCUA 3T1YL 4K0KQ 1C0AA 1K3RA 1DGSA 4A3GH 1GD7A 3H15A 3HKSA 4DV4L 4AYBG 1Q7YC 4A3GG 1KIXA 1P16A 3G48A 4C2MH 3S15H 4JC0A 2NN6G 2KHIA 1VQMA 2ES2A 2AWNA 4LUZA 4JI5Q 1YZ6A 2K75A 4KHZA 5GAEC 1NTGA 2MO0A 4DK3C 1P8LA 4DR6Q 4AIMA 1EYGA 2B29A 3B6YA 1D7QA 1GM5A 1WJJA 3RLFA 3PUZA 3CP0A 4DR5L 1TWCH 4QJFA 5ELNA 4B3SQ 1VQ6A 1Z9FA 5H1SE 3S24A 3GB8B 2IHFA 1L1OA 4AH6A 3HOWH 1JJ2A 3M9BA 1N36L 1X3FA 3S1QH 4QQBX 2UUCQ 2WFWA 4X64L 3M4PA 3M4OH 2B3GA 4CC6A 4AQYQ 5IYCH 3WWVA 2UUBQ 2OWOA 2VUMH 4KHPL 1UE5A 1VQIA 1S68A 1NMFA 1EQQA 3SGIA 2UXDL 1B7YB 4RMFA 1XPRA 3HOZH 3HOZG 4BBSH 3CPWA 4O2DA 4JBKA 4BBSG 3S17H 4IJLA 2HHHL 3T1YQ 3GTLH 4YY3L 2L15A 1Q81C 2KCTA 3VDYA 1M90C 3HKZE 4LWCA 3E0EA 2BH2A 2CQOA 2F3IA 2H5XA 2AKWB 4A3EH 1GKHA 1X9NA 4EFEA 5IYBH 3UQ8A 2KENA 4DUYL 1CKNB 3TREA 1KC8C 2NVQH 1QZGA 4JBJA 3GTMH 3HOUH 3HOUG 1YVCA 1PH8A 2VQEL 4HIDA 1HR0L 3TRZA 4GKKL 2UXCQ 3I4OA 3HOXG 5IWAL 4L5SA 2JA8H 2JA8G 3J7ZC 4A3JH 2LXKA 4DR5Q 1IBML 4GNXA 2JA6H 2JA6G 2DUDA 5D1OA 4UPAA 1YBYA 1TWAH 4JG2A 2ZTCA 3TEHB 4BBRG 4BBRH 4A3FG 4FDBA 4A3FH 4A3KH 4A3KG 1PHJA 1VQFA 1I5FA 2K4KA 4IFDJ 2IX0A 1XMQL 3S14H 4WJ4A 3HOVH 3HOVG 1QVFA 2AMCB 1N36Q 1X54A 4PZ6A 1A62A 3G71A 3GD7A 4IPGA 4DV5L 4X64Q 3KDFB 4L5RC 4R4TA 3PSIA 2E2HH 4YCUA 1VQ4A 4QGUA 1QUQB 1S3OA 1QVCA 1OXXK 4KHPQ 2IX1A 3TY9A 4B3ML 1EOVA 2VY3A 4LF6L 2OTLA 2A8VA 2UXDQ 4LH7A 4C3JH 2EXDA 4DR2L 2N78A 4NXML 5LMNW 3JSLA 2HHHQ 2Z0SA 4A3BG 4EX5A 1UE1A 4YY3Q 3CMAA 2R93H 1X3GA 2R93G 1IBLQ 2I0QA 5C0XI 3AEVA 1SE8A 1SMXA 1AH9A 1YEZA 2WB1E 3H0GG 5FPRA 1WCMH 1HZAA 1WCMG 2KBNA 3K0XA 4GN5A 2Y0SG 3MXNB 3PV0A 4XIGS 5ELOA 5M3MH 5M3MG 3I7FA 1YJNA 1HR0Q 4BA2I 4EQ5A 3S1MH 4A3LG 1BBUA 4A3LH 4DRFA 5IWAQ 1G291 1SLJA 1YJWA 4IOAA 4DV7L 1CKOA 1VS0A 3ZJYC 1BKBA 4YWMA 1KXLA 2BA0A 1NJIC 1HNZL 1Y1VH 1Y1VG 3UDIA 1IBMQ 2ZM6L 2Q2UA 4BXXG 4BXXH 2R6GA
chains in the Genus database with same CATH superfamily
1SDFA 3N6RA 4A3MB 2OQKA 4QUFA 1NUCA 3L0OA 1XMQQ 4XQQA 1G6ZA 3OMGA 3RN2A 4CHTB 1SBBB 1VDZA 2DNEA 2JA5B 3AB9A 5ISRA 3PMFA 4UCTA 4GS3A 1JJGA 3CCQA 5C0XG 1WD0A 5JVH3 5TSSA 2HG8A 3K7AB 4KJNA 4KMUC 4B3MQ 4OWXB 1I2KA 4O42A 2C00A 2F0MA 2IW3A 4P73A 2PMZB 2SNMA 1HNXL 3S1RB 5J22A 3I4MH 1K8MA 3BU2A 1ASZA 1R4QB 4HIKA 1S4ZA 4ZCKA 2WINB 4LMQD 1EOTA 3S1NB 1PH9A 3E0JA 1PRTD 3FEWX 1SFOB 4DV7Q 2EVBA 4C3IG 1LABA 2YWVA 3BA9A 3GTQH 3BDLA 2G9HD 2PCFB 2ZM6Q 4FFNA 2RSNA 1PYBA 5LMUL 3D4DA 1S5FD 1AW7A 4DV6Q 3D31A 3W2DA 3HOYG 3QOLA 1QVGA 3I4NH 1E4EB 3KAKA 1NY4A 3P7JA 1CQIB 1T9HA 2UUAQ 3DEPA 3KF8B 1YNJD 2N8NA 1UUPA 1TWCB 5D3DA 1EUCB 1F9SA 5IYCG 3AYHB 2KJXA 3OW7A 5C4XH 4J15A 1I3QH 4O86A 3K8AA 2QKIC 1R9TH 1S5CD 3U55A 4DXGA 1J5EL 3CC7A 3M4OB 2L1BA 2AUJD 3FKIH 3QWUA 1SE3A 3CMEA 4IJHA 4LF4Q 1GVPA 4DV4Q 4YCWA 2QF7A 5HNEA 4MV7A 4IPCA 4CMDA 1B6RA 4YIJA 1ZXTA 2OTJA 3HOZB 1DD2A 4LFCQ 2ZDGA 1H9MA 1RDPD 1TY0A 3LQSA 3OMCA 3T9AA 3EFXD 4BY7G 1FYCA 3RLNA 3WWIA 2PNHA 3TMEA 3V4ZA 4FXKC 1JC7A 5FJ8H 1F9QA 5GAGC 1HQMC 4LF7Q 1PH7A 1ESRA 5DM73 3QQMA 1PFSA 1HZCA 4A3IG 1A0IA 2DGYA 1S72A 4EQNA 2XTIA 1XTCD 3PF5A 4A3CH 5DNFA 2JA6B 3I8ZA 1UC9A 1TT2A 2Q2HA 3TQTA 1TWAB 4BBRB 1AE3A 4O83A 3KDFA 2MJ8A 1J9OA 2KQ3A 2FFKB 1N34Q 4B3RL 3FHWA 4POGA 3OHXC 1L0YB 5D1PA 4HNUA 4C3JG 3A54A 4DAVA 4KV6A 1A15A 2ZJRA 1MSGA 3DM1A 1VMPA 1PXUA 1V1OA 4NXNQ 4YWLA 4YAKB 2EJ3A 3V05A 2V5AA 4RGNA 1MGSA 4DN4M 1E2VA 2R93B 1WTWA 1EY7A 3QO2A 1EUDB 1W6KA 3F8TA 4XYMB 2NZOA 1G51A 5I5XA 4C56C 5BMVF 3F2BA 2EYFA 5M3MB 4R1JA 3G4SA 3K5LA 2K7VA 5FLMG 3U4VA 1KABA 2XWJB 3CHBD 4MA5A 3M7NA 1DAAA 3HT5A 4M8AA 4N8X1 3EIVA 3NENA 3VR2A 1RJTA 2JXMB 2R85A 2F0PA 4JI5L 4HMIA 4A3DG 3URYA 1HXYD 1VQDA 5FO8B 3OTOL 4H7BA 4WFN3 1FL0A 2OF1A 2EYLA 2PZWA 2SEBD 3K6OA 5J3BA 5C0XJ 3TIGA 3H6MA 3WDNA 2PQAB 2F52A 4UFZA 4HN2A 4WBNF 1PFNA 1WTPA 1MSHA 5CM0A 1FJGL 1UEBA 2E2JB 2GPWA 1OO9B 3A74A 4B3TL 1BVSA 4EGJA 1E1TA 4IPHA 5C3EH 1CSQA 2JJQA 3IL8A 4P2CB 3PUWA 1VQ7A 2COIA 3P75A 2Z02A 2FXQA 5DAUA 1GUWA 3CCSA 4DV0Q 1V1PA 3UFXB 4DR3L 3JZIA 1CK1A 1I4QA 4MA0A 5D14A 3S9WA 4JI4L 3V2TA 4JI2Q 4X65L 5DGIA 2BH8A 5KEEA 1L1OC 1SXTA 3JC66 3F1ZA 1A48A 2B2UA 4I7AA 1WVLA 1OXSC 3HKZB 4IZOA 4UUGA 3S1MB 3EN2A 3HOWB 4EQPA 1SR3A 3E6ZX 3VR5A 4L5TA 1JB7A 4DQNA 2HJWA 2K5NA 1I94L 1NR4A 1L1OB 2COGA 1X3PA 4KHVA 1VF7A 1LT6D 4XT1B 3TY5A 3SE0A 2XIWA 3PO3G 4IFDI 1CKMA 2GN5A 1TR5A 4N9TA 2I5MX 5FPOA 2WKCA 3CKIB 1WR2A 1LTBD 4B9XA 1TA8A 2EQSA 4O81A 1V43A 2DJFC 3ER0A 4O1NA 5IE8A 1JICA 4A75A 3GJXB 2OT2A 3K58A 2B39A 4JPBW 4GKJQ 2EY6A 3A7AB 4LH6A 3K5MA 4JI1L 2EOTA 3KAJA 4MV6A 3NBYB 4KD3A 1PTOC 2R92B 3TW7A 4B08A 1I6HH 1T5XD 1A3UA 1SYGA 3E9HA 4HN7A 5C44H 3ND9A 4WRDA 2IJ0A 3ULLA 2GVBA 4GNXB 4A76A 1VQNA 4FO2A 4UP7A 1PTOB 1EQRA 1EYZA 3JZFA 2EYMA 3Q24A 4DR4Q 5FOBB 4O7TA 2RBMA 2B2WA 2NYZD 3D4RA 4DKAC 3K5OA 3VYUA 4MAMA 4FXDA 3NBHA 2M9VA 2R7KA 2ALYB 2F0EA 2KCMA 1KJJA 1LUZA 2A6EC 4A3BH 3NC0B 1HNWL 5IYZF 1HJPA 1BBWA 1PZID 3AU7A 4R4CA 4V0BA 5HGQA 4WJ3M 2F4VL 1CUKA 3A8KE 3U9OA 3NWSA 4GLAC 3PO2B 5IGGA 2KCCA 2HVSA 4UP8A 4FU0A 1PH2A 4A3MH 3K81C 3PGZA 1TAEA 3TP7A 1SN8A 5J39A 4JV5Q 1XDNA 2BCOA 5FLXE 1EEFD 2CW0C 2JA5H 1CQJB 3PIOA 2F0FA 4LFBQ 5EPKA 3VR6A 3G6EA 2CWPA 1B9NA 3HFZB 4P75A 4UP9A 2BE5C 1TS4A 4E6IA 2PZUA 2X5RA 4HQ6A 3K7AH 4C5AA 4IQZA 4DNRB 4LFAQ 4I65A 3HGBA 5CV5A 3S1RH 2Y0SE 4UDUC 4R8IA 5DGHA 4Q0FA 3JZ6A 5I9OA 5CR5A 1JJCB 1TWHB 4EGVA 4LW1A 2UUBL 3S1NH 2GQSA 1TWGH 1GJXA 3KOJA 2Z6KA 1A8VA 1U4MA 3GTKB 1IL8A 3D8GA 4KJOA 2CH4A 2MPMA 1SFOH 5LL6S 3KBXA 1DGSA 1LT4D 4FFMA 2A68C 1KIXA 4JC0A 2KHIA 1D1IA 1H9JA 5IT9E 4JI5Q 3I4NB 1YZ6A 1K3BC 3D3RA 2MO0A 5C4ZA 4DK3C 5CORA 4AIMA 2B29A 1BCPD 1EEID 5HV6A 1BR9A 4NW2A 1TWCH 2QDLA 5FO7B 3SDZA 1VQ6A 3GB8B 1HCZA 4XYLB 1O7ZA 3Q23A 1E0BA 5DEHA 1ICWA 1KDBA 1JJ2A 4RAUC 3M9BA 4TM5A 4OELB 2M2LA 1N36L 4KKTA 3M4OH 3FKIB 5IYCH 1EFID 1I50B 1NMFA 1ZYRC 3SGIA 1B7YB 1TU2B 1ENFA 1CT1D 1VF5C 3HOZH 4FF4A 4YY3L 3T9EA 1M90C 2DZDA 3A8JE 2F3IA 1X9NA 2BOSA 2W71A 3K5IA 4EFEA 1AEXA 3T13A 3UZBA 4GKKL 2HCCA 3I4OA 3R23A 2EPBA 4TUYF 2F0OA 3F2UA 4O7RA 5I47A 1A3VA 2LXKA 4DR5Q 1IBML 2JA6H 2DUDA 1A0GA 1YBYA 2CNQA 1TWAH 4JG2A 2ZTCA 4BBRH 4K6DA 4A3FG 1G91A 5LP6F 2R7ZB 1PHJA 1VQFA 1I5FA 3HB9A 1XMQL 3R3OA 4PZ6A 1B1ZA 3BDCA 4IPGA 2GA4B 4FYDA 1K8OA 2K32A 2V4DA 4R4TA 3GLKA 4DK1A 5NUCA 5A35A 2IX1A 4B3ML 4ZQIA 5IIFA 1O78A 2OTLA 1JQYD 4RGMA 2A8VA 2UXDQ 5EBCA 4C3JH 2EXDA 5J2TF 2N78A 1AP0A 4JK1C 2HHHQ 4V190 1UE1A 3CMAA 2QILA 2R93H 1BQQT 2AUKA 5C0XI 4GLWA 4PNYA 4GZYC 3GQBA 2WB1E 3H0GG 5BN3A 2EJGC 4GN5A 2Y0SG 5M3MH 2F0NA 4RA8A 1YJNA 4CBVA 1H9SA 4EQ5A 5IWAQ 1QJOA 4IOAA 4DV7L 1CKOA 2EDGA 1A2TA 3H0GB 4BXXH 3G7LA 1BUVT 2ZM6L 1GOZA 2A74C 3RUPA 2R6GA 1PYSB 5IODA 1HZBA 1KRTA 2K5DA 5IT9c 1U5KA 2QA4A 1GLVA 2EYOA 3ULJA 2UUAL 3PN1A 4ZK9B 3J7YW 2I46A 1UNSA 2LMCB 5E25A 3J80i 3FPPA 3WO1A 4DAPA 1LV9A 2RCFA 2BDNA 4NPSA 1CTMA 2VPQA 3KLRA 1PLFA 1SROA 2K6AA 4DR2Q 4NXMQ 4ME5A 4CKCA 1TWFB 3R9RA 1CZGA 2F4VQ 4LF4L 1JE5A 1CS0A 1WYDA 1A9XA 4C5CA 4LFCL 4NZMA 1Q8KA 3RTXA 4JOIA 2JN4A 3K5HA 4A3GB 4ZOLF 1GUNA 1HTLD 5LHY1 4XDXA 3KFUA 2JYOA 1W96A 1VQGA 5IY0A 3C2PA 4LF7L 4CDFC 3S1MH 1AN8A 2K5VA 3AFPA 2Z4IA 3JAML 3BAAA 2PI2A 1E24A 1GUTA 2V1CC 4GOPC 1KTKA 5J1ZA 4FF1A 4IUUA 4OIKA 4ZYSA 1EHIA 3CRLC 1J6QA 1JWSD 1YNXA 3UDFA 1B3QA 1VQBA 4IUPA 3SNOA 1N34L 1EYDA 1EY9A 1M6VA 1MIUA 1M4VA 1WFQA 3K3PA 2A6HC 2HIVA 3SE7A 1B53A 1JB3A 3MHBA 1E2ZA 2L12A 3MEFA 1VQLA 3W1GA 4GOPB 2V59A 1G6PA 5D65A 4HAEA 5JJIA 5BPHA 4K5XA 4QB4A 2HDKA 5IYBG 2Z1CA 1IYEA 4NXNL 1RODA 3HZXA 4K2KA 4KKSA 3KJPA 1CKNA 1SJED 1I6VC 2NZHA 1PRTF 2LS01 4YCVA 4ABNA 2JA7G 4OO1G 1BOSA 2LFNA 1LTAD 4A3JG 2CQAA 2PBZA 2NVQB 4O4HF 3GTMB 2R92H 3HOUB 5I6YA 3PIPA 2MO1A 1I6HB 1KJIA 1K28A 3FPUB 1WTQA 4RH6A 1G2WA 1E2WA 3UDGA 2JA8B 2WB1G 1IYJB 3MWDA 3EROA 3SR1A 1QZHA 3MWEA 1RTNA 5AFWA 1D6EC 1PTOH 2C5CA 3A5ZB 4ALPA 1X55A 4R4OA 1KNEA 4A3KB 4O2AF 4OXPA 1PH3A 3GIDA 3VNNA 3OIPA 1K0RA 1STYA 4YHHL 3VPDA 1F2ZA 4CDDC 1Y14B 1VQAA 2OCEA 1H9RA 2DNCA 4EFBA 2XRQD 3J7AV 4LF5Q 1Y8PB 2QB5A 2KEEA 4O0AA 5BN5A 1IW7D 1VQ9A 4LF8Q 1PFMA 4A3BB 4A93G 2YZLA 4H0LC 2DIKA 1EY0A 1MHWC 1EIGA 4KY6A 3E5NA 2R7NA 1ET9A 3J81j 3WNZA 1C48A 1WCMB 2FHTA 3PO2H 1CHQD 1S5ED 2CCZA 3KYHC 3CCMA 3H3VI 2SCUB 4DV0L 1LO5D 4K8JA 4K5VA 3NE5B 1Y69U 1LT5D 3J80c 4M9UA 2I80A 1D8LA 4JI2L 3RR5A 4JXUA 2L0CA 5KS8A 1VBHA 4FVMA 4KN4C 2COJA 5BWXA 3M85A 1DYQA 3AQQA 5KRUA 5IGEA 4DAYB 1Q12A 2D0PA 3D0FA 2KVMA 3Q1KA 2ZGIA 4DA2A 4MTKA 4F7XA 1SE2A 3ETHA 1FGUA 1LLRD 3TS2A 1XTDA 4GN3B 4ZQ3A 4IALA 1TWHH 2E8GA 1KHIA 3TY8A 1TWGB 5M5YB 1Y1WG 5CV6A 1Q1EA 2F3WA 1VQHA 4TKOB 3J81c 3GTKH 1GHJA 4DR1Q 2FMCA 3PCOB 3RFCA 3RV4A 3PUXA 4YJ3F 2F0DA 5KNDA 1C8CA 2Q2IA 1N33Q 3T53B 1KLGD 1F2LA 2X6GA 3HRZC 2DWCA 1PV4A 3CXCA 4IWYA 3PF4A 2B2TC 4TQUS 4G4KA 4C3IB 4GKJL 1KBLA 5JJKA 2CKZB 4HR7B 5EKIA 5CMDA 4UCVA 2IPKD 5IOCA 5FNVF 3H09A 5IGDA 1TKWB 2RF4A 3KF8A 3NTIA 3X3NA 2CWAA 3HOYB 1LYLA 4HJ9A 1HTPA 2HVQA 4PBCA 2UXCL 2PN1A 2K5HA 2J0TD 4ME3A 4QIWE 1EZ8A 3NK9A 4DK6C 1EIYB 1YHAA 1XNQQ 3FRPB 4RCNA 5IYDH 5DAAA 2EIYA 3TS0A 5IP7H 1Z7TA 4OX9Q 1I50H 4K2LA 2PQEA 1SAPA 2VQFQ 2ZJQA 4E4TA 4AYBE 1DXMA 4DR4L 2YZNA 4X3SA 2FJ2A 3VPCA 5CYUA 4CKEA 1C9OA 5JQGF 2JQOA 4DNIA 4QF4A 1XYIA 5LYJF 5G3LD 1L0WA 2B2YA 1QE6A 1QNUA 4PMWA 3A56A 1JOQA 5CC4A 4BY7B 4UCOA 3CCVA 1IBLL 2F3VA 4O4JF 1XXGA 1PA6A 2I5HA 3RMHA 1K83B 1GSHA 4MN3A 4RZQA 3KLWA 2KHSA 1XNRQ 1IL2A 2D62A 4IFDH 2YS6A 1A63A 4X66Q 5F2DA 1RKNA 4DV3Q 2R7ZH 1W93A 2K14A 4A3IB 2B63G 4ME6A 4JV5L 3TW6A 1IBKQ 2R3ZA 3NBIA 1ILQA 1STHA 3DM3A 1Q3LA 4LFBL 1XPUA 2HHFB 3I55A 4MV9A 1QNKA 2YTVA 1CQFA 3NPPA 2JA9A 1Q82C 4MZ9A 1QOHA 2CNUA 1XX8A 1VQ8A 4C3JB 4LFAL 5IP9G 1YNND 5AJ3Q 2IY5B 5C4HA 1Z47A 3ITPA 5M3FG 1IKMA 1SSOA 4RGOS 2C35B 2F0LA 3LULA 1O7IA 2I8CA 2BA1A 3J7A5 1VBGA 4LNQA 4IUVA 1JOKA 1XMOQ 1SYBA 4LF9Q 4HJ7A 2IX3A 2K5WA 4GLXA 3QIAA 3H0GH 3BYTB 4IUNA 4OONA 3G8CA 3TP6A 1W2BA 1SMYC 2N3SA 4HNVA 3NSWA 3ERSX 3BG5A 4MTNA 3VOTA 3MXGA 4F8MA 3BS1A 3GO5A 5M5XB 1G2SA 2KOLA 1PVOA 1PMRA 4BY1G 1U4LA 4YHHQ 1GXDC 4UY8C 5BWUA 1E3PA 5C5MA 1AE2A 2ICEC 4LAAA 3DAAA 3QFFA 3H3VC 2VQDA 1JDEA 2PQAA 1DV2A 4A3DB 1VQEA 4ID6A 3PFFA 3GV3A 3SHLA 3KJOA 5K36H 2Y4RA 4FP5D 1TWFH 4K6NA 4ZI7F 2UU9Q 1DZ1A 4L8JA 3A8IE 2B8FA 3STBD 1OXUA 2QEXA 4UCRA 2YU9B 3C1EA 3I56A 3KF6B 1EIFA 4M1UB 4HIOA 1MJEA 2AQ2B 2JEBI 1WRVA 4M0JA 3TINA 4Z9CB 4KD4A 4A3GH 2O2LD 4AYBG 2K01A 3OUUA 3EJIA 1BXRA 4NZNA 4DAAA 3MWYW 2NN6G 3MXUA 4LUZA 2A69D 2K75A 4KHZA 1NTGA 3U54A 4DR6Q 1P8LA 5EKKA 4EGQA 1EYGA 3MFYA 4DR5L 3RZDB 2ICIA 5ELNA 3TBIB 1Z9FA 3S24A 1L1OA 3BVGA 3UI2A 3TP5A 4NMZA 2RQXA 1BXTA 1EL0A 2WFWA 3KUPA 2Q8RE 2GLTA 1GHKA 1TVXA 3PO3B 3SK6A 1VQIA 1I1LA 2FB9A 2MGSA 3KK7A 2UXDL 1XPRA 2YS7A 1S5DD 4BBSG 4O2DA 5LOVF 2HHHL 3T1YQ 4S3SA 2G9DA 2ZT9C 2P0AA 3SXHA 1L0XB 3VDYA 1Q81C 1TIID 4LWCA 2BH2A 3WOFA 3SK8A 5IYBH 3DTGA 4DUYL 3ORQA 4FXGC 5EKLA 2NVQH 3A7LA 1QZGA 4JBJA 3GTMH 3D6WA 3HOUH 4Y52H 3LNNA 4OHJA 2UXCQ 3HOXG 2L4NA 5IWAL 4L5SA 2JA8H 3KBGA 4OO1H 4LJZC 4A3JH 3QJYA 1GUOA 4GNXA 1A2UA 2CH4W 1BCPF 1HFGA 4UPAA 1J8IA 4WORA 3WO0A 4RKBA 3TEHB 4A3KH 1MI2A 2LY7A 2M00A 4HNTA 2K4KA 3QOJA 2C9OA 3HOVG 4FFLA 1X54A 2KUMA 1A62A 1PZKD 4DV5L 1ZKOA 4L5RC 1LACA 1QUQB 1ET6A 1OXXK 2B2VA 3R5FA 2B2WC 1UC8A 1TS2A 4XYQA 4HEDA 4LF6L 2X69A 4ZLTF 4LH7A 2HQEA 4DK0A 1ULZA 2G5DA 4DR2L 4NXML 3R2IA 4RHRA 5LMNW 3SEBA 3TZDA 1AUXA 4C3HG 4DU9A 3TZUA 1IBLQ 3R93A 1SE8A 1WCMH 2DY7A 2KBNA 4MHEA 4CJ2C 3PV0A 3MXNB 1U4PA 3I7FA 4A3LG 4XX0B 1G291 3U9SA 3VYSA 1WTXA 4TSSA 1KXLA 2A73B 1NJIC 2DLNA 1Y1VG 2F0GA 3BYYB 1CE8A 2A19A 3JSNA 3ULPA 4XQNA 1IYUA 1G8ZD 4IUTA 4CMFA 3R5XA 4R9WA 1VQ5A 2SDFA 3DUZA 3NUCA 2HGWA 3UZOA 5C0XH 3X3MA 1T36A 1EKFA 1RF2D 5FLXL 5LA6F 2R61A 2K33A 2VB3X 2WIIB 1LTLA 5M5YH 3MJFA 3ONAB 3N8DA 2YZMA 1GSOA 2MFIA 1ESFA 1SNDA 3I4MG 1I1MA 4EG0A 1SNPA 1S40A 1PFBA 2W6PA 2ZTEA 1EQTA 1O80A 4HSVA 4C3IH 3MTSA 1TXYA 1PRTC 1SYEA 5FR9A 4C2MB 1CQVA 4BWGB 3S15B 3GTPH 1YIJA 4XTCS 5C5LA 3WWJA 2QW7A 5EPJA 1LTGD 3KLSX 3HOYH 5JVG3 2ATWA 1FVIA 1NBWA 1WTHA 5KNCA 3RD4A 5K2MA 2W70A 3QB3A 5BYBA 3M4QA 4OO1I 1PRTB 1V9PA 2SNSA 3BACA 3ND8A 5M9OA 2LSSA 2R7FA 4CGYB 5IT9L 2VUGA 2JE6I 2YW2A 2EIFA 5I6WA 1EWHA 1TQOA 2RDHA 2O4XA 3CSWA 1YNJC 5CAEB 3SK4A 1X65A 5C4XG 4QCLA 1I4GA 1M1KC 3DHQA 4JI7Q 2AQ1B 2QK4A 5T1GA 1TY2A 4HJAA 3DWPA 4GLVB 2EE1A 1Q46A 4O7LA 4DAMA 4A3EG 2XNAC 4LF5L 1B8AA 2RHSB 2RDGA 3OYYA 2ZXPA 4JW0A 4JYAQ 2UXBQ 2YZGA 4LF8L 5A2QE 1YHQA 4CC5A 4BY7H 3NQIA 5KYIA 5JEAG 2EJFC 4A3EB 3VA5A 4N8FA 2PI2E 3T56B 4E6NA 4DR7Q 1K83H 3KLSA 5EQ0A 5BYAA 4ZKCB 1KUTA 3LGJA 1F2YA 2F0JA 1ML0D 4NKLA 4A3IH 3U58A 1U0LA 2D0OA 5E7NA 1Q1BA 1BNCA 4K14A 2W6MA 4A3CG 2R82A 4KK7A 3BDOA 3GV6A 4A3FB 4MV3A 5E4WC 2NU8B 5CA1F 2R7DA 1XWEA 1JLLB 3P20A 1YI2A 1STNA 1N9WA 5I5VA 3IRBA 2IHEA 1VQCA 2WKDA 4ULLA 3R8BA 3S2HH 2IP4A 3OWFA 4DUYQ 1QB5D 1WI5A 3RV3A 5C8YF 5CA0F 1SJHD 2HT1A 5IGCA 2ID0A 4C1NI 3FVQA 4DR1L 4O7SA 4KN7C 1N33L 1GUGA 2K50A 3CPFA 2L55A 3Q22A 2Y0SB 2ZXOA 2DN8A 2MP1A 5BR8Q 5FLMH 1X56A 1EIHA 2HVRA 3P1HA 1OTCA 5M5XH 3OSOA 4MV8A 2LXJA 1VQPA 4DFAA 3KREA 4DV5Q 1R4PB 4IOCA 2RDFA 3Q2OA 1NMGA 5LMNQ 1M0TA 2EYHA 5I5TA 3T9BA 1SRUA 2PVPA 3T7AA 5ELEA 3NBZB 2WAQE 4LF6Q 2LKVA 1WD1A 4A3DH 1IYDA 2GPSA 3F2CA 2TMPA 4RCOA 3UDXA 1UWVA 1W6JA 3WOEA 3CQZB 4JI8Q 1XNQL 1YHBA 3I2ZA 4OL7A 1Z2PX 2HD3A 2YU9H 3H3VH 4OX9L 1QG7A 3JAMi 3MAQA 2ZDQA 2VQFL 5C3EG 3J80E 2HUGA 2FINB 5KNBA 3BZKA 3CCLA 1AUVA 3T99A 1WTRA 5I60A 1RHPA 2Z9HA 3IFDA 2F0TA 1KQSA 3J81i 4CHIA 4JOIC 3Q0AA 3I4LA 4KLKA 5JJZA 3R2TA 2XD4A 3JAME 1XPOA 1XK5A 3RZDH 4IUQA 2PMZE 3S14B 1HZ9A 2E76C 3CC4A 4N9PA 1XNRL 1LT3D 4X66L 1I4RA 1DM0B 4DV3L 2K04A 1IBKL 3FDTA 5JAVA 3J81E 4L5QA 2KCNA 4RWSC 4KY7A 2XN9C 3DWAA 4DV2Q 1K8GA 1EYAA 5KX5F 3ICEA 3NHHA 2K1BA 3PIP3 2YTXA 2NU6B 2MQHA 4GOPA 1AZQA 2IWHA 3PO3H 2N88A 4XZ3B 3AMUA 2X0SA 2R84A 1PH1A 2E75C 1EZ1A 1KJQA 5AJ3L 5T1IA 4A4IA 3C46A 2K05A 1Q8IA 5C3XA 1JR0D 4O7NA 4PZ7A 3L2PA 1EYCA 2ZXRA 4ZAIA 4OWTB 1XMOL 1PTOD 4LF9L 4PV1C 1JWUD 2JA7B 5JEAJ 3GTJB 1N32Q 4A3JB 1SNOA 2ASBA 2R7MA 4DV1Q 2ODTX 1S5BD 3MA2B 5BWTA 1KNAA 1B9MA 3TQYA 3VR3A 2MUYA 2Z8LA 3HOXH 4MIUA 2WB1B 5C44G 4O4IF 1PH6A 3NP8A 3S16B 4QY7A 4O82A 5JJLA 1SYFA 5D1OB 1JOOA 4R4IA 1HR0W 1AFPA 4DUZQ 3EVQA 1VQJA 4JI0Q 4ILWA 3SVMA 4XYOA 4IURA 1BBXC 4MV1A 3T1HQ 5E3FA 4Y7NB 4KI0A 1MJCA 4CJ0B 2F0HA 2EJ0A 2R7LA 2NUCA 2KEDA 5D8DA 4L6TB 5EPLA 2WAQG 2NUAB 2A6ED 2UU9L 3OPOA 2OXPA 4TVAB 2F0VA 3UE0A 2E5LQ 2OQ0A 1ENAA 4P71A 2F0KA 4LUVA 2WP8J 3M7GA 4A93B 1KC7A 4LUOA 3D6CA 3W5OA 4C3HH 5G3LF 1JMCA 5ELDA 4NDXA 2FP4B 2P5ZX 2QGQA 1Y8OB 3M3YB 3A0JA 4XQJA 2F0IA 2CW0D 4YWKA 2F0WA 4A3MG 1K8AC 5HURA 5EJWA 1RD9D 3I90A 3T51B 2YYAA 2BE5D 4JBWA 4YBZB 4APVA 1KAAA 4DAYA 4X62Q 4DR6L 4O7ZA 2JA5G 2N49A 1K73C 3JAMc 3V96A 2NVXB 5M5WB 2I87A 1FNVA 2XWBB 4YJ2F 2NN6I 4O4LF 1KJ9A 4QSHA 5I2XA 4JBMA 2FMMA 1HFNA 1WTOA 5CBAE 1YITA 3AW8A 2I5LX 3A55A 2VR1A 1ENCA 4P72A 2K52A 5EZYF 2NVYH 2WYOA 1UE6A 1Y1WB 2ABJA 3BZDB 3NELA 3NTKA 1DOKA 3DMUA 4G7ZC 1HHVA 4DGZA 2A68D 3DLLA 1NCVA 4R4QA 1TS3A 3T1YL 4K0KQ 1LTSD 1C0AA 1E4EA 1KLUD 1GD7A 3H15A 3HKSA 2Z6BA 1P16A 4C2MH 3GTPB 3S15H 4HR7A 1I4PA 3I73A 5H80A 2VB2X 1F2MA 2HGSA 1GGOA 4OIJA 2CNVA 5GAEC 3BVZA 5ELFA 1STAA 5JH7F 1WJJA 2B2TA 1KEEA 3RLFA 3PUZA 3CP0A 2K28A 2NVTB 1NR2A 1B44D 2A5HA 4B3SQ 5C4JB 4PQXA 2IHFA 1BCPC 4AH6A 3ORRA 4FFOA 2J9GA 3SK5A 1JE4A 1EKPA 3M4YA 3QR8A 4L63B 3T9CA 4DF7A 3IFTA 1ZYRD 2UUCQ 4QQBX 1KT8A 4O7VA 1O7LA 3M4PA 4CC6A 5CV4A 2OWOA 4HCEA 1BCPB 1UE5A 1EQQA 1ICFB 4B9WA 4RMFA 4CKBA 3HOZG 1STGA 1JKJB 1NSNS 2A1HA 3RZOB 4YAJB 4HTHA 3HKZE 5IGBA 4G57A 2B2YC 4A3EH 2H5XA 2AKWB 2ZDHA 3UQ8A 2KENA 3BG3A 5E1FA 3GTGB 4HCSA 1PH8A 2VQEL 3TRZA 1ILPA 5JVLA 5I2YA 5JEAH 1F9PA 2NB0A 3J7ZC 2F0UA 2EXZA 3NWTA 3WWHA 2JA6G 1SCUB 4A3FH 4BBRG 2HHFA 3CU7A 4H13C 2B63B 3HEJA 2FPIB 2F03A 1PX2A 3G71A 1FNUA 3T9FA 2XSCA 3MZ5A 5K5PA 3U9TA 4X64Q 3KDFB 4QGUA 1S3OA 3S2HB 2DJGC 4KHPQ 4Q5VA 3DF7A 4O84A 3DEOA 4ZRZA 1IKLA 1CFMA 1STEA 2K03A 1PZJD 3JSLA 2Z0SA 5M3FB 1B2TA 4EX5A 2R93G 2I0QA 5CR3A 3AEVA 5K3WA 4DLKA 1SMXA 5FPRA 1HZAA 3K0XA 2PNRC 1D5ZC 4XIGS 5M3MG 1HR0Q 3K5NA 2EJMA 4Q4CA 1SLJA 1YJWA 3K57A 5I4DA 1BKBA 4PMCA 4YWMA 3RUZA 1HNZL 3GTOB 4BXXG 1HPCA 4ODGA 2Q7DA 2H4OA 1KRSA 1VCIA 3E9IA 4RHSA 4DPGA 1XJVA 3VYRA 4PZ8A 5KGUA 3S2DH 2SOBA 2K5QA 2H1EA 4BY1B 1I4HA 4Q4DA 3OWEB 1OBDA 3VYTA 3IAYA 3RLOA 2GQRA 3NEMA 4FF3A 3CQZH 1B50A 2Q2TA 4IHJF 1RL2A 5EAYA 5BPFA 4X6AH 4O2BF 4G7OC 1ZAUA 4CE5A 4JI7L 3KF6A 1EU3A 4QIWB 1KJ8A 4POFA 2RCNA 1JORA 4K6LA 2YRXA 1KDCA 1D2BA 1Y8NB 3CW2C 1N8RC 1F77A 3TIIA 1LM0A 4JYAL 2UXBL 2DABA 2E2IB 4DXFA 2J7ZA 2PW5A 4PG3A 2EY1A 2B2UC 3PUYA 4AYBB 1H95A 4IZ8A 1V1PB 4DR7L 1I7NA 3HKZG 3S14H 3A5UA 1FNWA 3HOWG 4OEMB 3LWUA 2O5JC 1G2TA 4JI6L 1M8AA 2A1AA 2VW9A 3VPBA 4R8NA 3O13A 3U0GA 2VNUD 4NYEA 3NTHA 2A6HD 5CV7A 4EEQA 5CBEE 3JRXA 2VUMG 1EY4A 1U4RA 2VS1A 4I7ZC 5GAHC 1HNXQ 2Z04A 4I50F 3CCJA 2HGXA 4IO9A 3S1QB 5JPMC 1UE7A 2TSSA 2Q8IB 3U50C 5BWWA 2V58A 1CI3M 1D5MC 3AFQA 2VUMB 4UCSA 3ZYYX 3C1FA 5CGKA 5DM63 3CD6A 4F88A 2NBFA 3L7ZC 4BBSB 3TSSA 3OW2A 3S17B 3GTLB 1X3EA 3Q8DA 4F87A 4ZHQF 2JA7H 3GTJH 2EY5A 4KTAA 4X3KA 5LMUQ 5FK9C 1PH4A 3UE1A 2R92G 2QEJC 1DV1A 2HCIA 3HOXB 5BR8L 2ZJPA 5LXTF 3VR4A 1ZEQX 4JI3L 5C3WA 2NZ1D 4GNXC 2PZTA 4HSPA 1BDOA 3S16H 1RIPA 4NB3A 1II3A 1EY5A 3I72A 5CV9A 1SNMA 1CSPA 5LMNL 5BN4A 1OXTA 2PYKA 4ZUIA 1QUQA 3HOVB 2IT1A 2XCLA 4Y7NH 1KD1C 1CM9A 2EY2A 2DAAA 1J5EQ 2B2VC 4CJ1B 3PIO3 2E2HB 1PH5A 4JI8L 2JP1A 4IN3A 3CC2A 5HBRB 1ASYA 1B70B 3HBLA 3L3OC 2GVAA 1Q86C 1L2FA 2W6NA 2VQEQ 1IHZA 1JWMD 5CE8A 4A93H 3MXNA 4C3HB 1SE4A 3NBHB 3UYYA 1E7ZA 1DIKA 1EY6A 2YYZA 1IW7C 5JPNC 2E74C 3PO2G 4FGRA 3M3YH 3CF5A 2ZTDA 4BA1I 5GROA 1QWYA 1X32A 1UEAB 3LWBA 3TP8A 1V8QA 2PO4A 1KTAA 2FPPB 3BABA 3CCRA 1K9MC 2D5DA 3K59A 4QUCA 1Y1VB 1ONLA 2RKSA 4EVOA 2NVXH 2NU7B 5M5WH 1CHPD 3DXJC 5FKAC 3L9AX 3U4ZA 2NTTA 2KHJA 2R86A 4C5BA 3F2DA 4B3RQ 1ET0A 3K0YA 3LP8A 5BWVA 1PDQA 5HGTA 3CCEA 1TS5A 4P74A 4HIMA 5L37A 1CA5A 4DV2L 3I91A 5KKNB 4C1NK 1IOVA 2Z6KC 1EUJA 2NVYB 2WACA 4IPDA 1BO0A 2QCPX 3AX6A 1Y1WH 3HS0C 2KECA 3DWQA 5DISC 5I5UA 3I4MB 1FR3A 3QG1A 4AQYL 1SEBD 4HMJA 1HNZQ 4HJ8A 2QDBA 1SNQA 4U673 2EJ2A 2Z4HA 4HJ5A 1HRJA 4YB8B 3I4NG 3T54A 5I5WA 3I12A 3GTQB 2JK8A 1EFWA 5I5YA 3W3AA 3MXPA 1C4QA 1N32L 2XGTA 1GSAA 4DV1L 5ELCA 4FNFA 2B8GA 1LTTD 2NVTH 2O5IC 1A6XA 1C3OA 1RTOA 5C4JH 1M0WA 5GADC 3C3LA 1OBGA 1E22A 1BNZA 1EKVA 2AHOB 3CCUA 2F0QA 2CFMA 3OTOQ 3FP9A 2EZVA 1SYCA 4NP5A 2VL6A 1DOMA 5JVDF 2RVLA 1C30A 1RCVD 5IYDG 4DUZL 2MNAA 3FKIG 3PQIA 4JI0L 1OXVA 5IP7G 4K8IA 1SYDA 1FJGQ 3OUZA 1EZ6A 4OGQC 1GUSA 5C4XB 1I3QB 2RHQB 4I4TF 3T1HL 1QCBD 2KA7A 1R9TB 1VQKA 4ZUJA 4B3TQ 1B04A 1I1KA 3BZCA 5GONF 1Z2OX 1HA5A 2VXWA 1F9RA 2CVRA 4H02A 1EWIA 1FGBD 3RZOH 4TV8F 4DIMA 1V1QA 3V4SA 2MHVA 3VA7A 5FJ8G 1VQOA 3E3XA 2E5LL 1W3SA 4JVZA 3GTGH 4DR3Q 2HQLA 4TV9F 1HH2P 5CB4F 2JSOA 4JI4Q 1NE3A 1X6OA 1B3AA 2YTYA 5EGTA 4WJWA 4X65Q 4NZOA 4JI6Q 3MC0B 3BA8A 3PUVA 3VMMA 1HQRD 3OIQA 4EQOA 1MKHA 2X6LA 2HDMA 3D4WA 5A2QL 3HG9A 3TN2A 2W6ZA 1IXRA 4IFDG 2R7ZG 2B63H 3R5HA 1U9RA 4X62L 2BDOA 1I94Q 4IIJF 3ETJA 2YV5A 3LX0A 4DNTB 4UAIA 3HP3A 4QL5A 1IYVA 3CEBA 1VKZA 2DY8A 4RG1A 1YJ9A 5DMXA 1KL9A 1B4OA 4MNOA 2JEAI 2AWOA 4UHVA 5FLXc 4ZKBB 5IP9H 5C6AA 3QWNA 3GDEA 4X3TA 3W1BA 5HY6A 5M3FH 1Z6HA 2HIXA 3CAMA 1JT8A 1EY8A 3BJUA 1D1KA 1VMCA 1PK8A 4XXEA 1YNNC 4GN4B 4CDEC 1DCZA 1C7YA 3MEHA 3ERQA 4TVIA 3OOCA 2N55A 4JI3Q 2W6OA 3IKJA 1SMYD 3K80C 1KAWA 4JI1Q 1CZWA 1PTOF 4OWWB 5GQOA 4K0KL 1SNCA 2WV6D 5DLQE 3GTOH 1E1OA 1H9SB 3J7AF 2F0SA 3I3CA 3G6JB 1JDBB 3S2DB 2IL8A 2L5TA 3NUAA 5FO9B 1H9KA 3CRKC 1AZPA 1UAPA 3I70A 4BY1H 2VZAA 1LTID 3EBEA 2YL2A 2AQ3B 2J4XA 4DV6L 5EBDA 3H91A 4G7HC 3MVVA 4B3SL 1I2LA 1GO3E 5KIXA 3EQLC 1Z2NX 4H44C 1T5EA 4RKLA 5COYA 1DOLA 2OLSA 5K36G 4JCVE 1CA6A 4MV4A 3TEKA 2UUCL 3RN5A 1EWCA 2NTSA 2EYPA 4LK1C 1IZ6A 2E2JH 3H94A 1WTVA 3GP7A 5C3EB 1HNWQ 2E2DC 1WOCA 3K7UC 3STBC 2E2IH 3RNUA 1K0SA 4UCUA 2YRWA 1K3RA 4A3GG 4DV4L 1Q7YC 5JQWA 3G48A 1Q90A 4K5WA 3J80L 2NN6H 1HUMA 1VQMA 2ES2A 4TRDA 2AWNA 3HO8A 2W6QA 3MFGA 5J2UF 2FPGB 1BF4A 1D7QA 3B6YA 5LL6X 1IOWA 3EA6A 1GM5A 1DJRD 3JRWA 1QILA 4J6HA 2A69C 4QJFA 3T16A 5H1SE 4X3UA 5KYLA 4RFBA 3HOWH 2D9UA 3NQTA 4CDCC 2CZGA 5IGFA 1X3FA 3S1QH 4X64L 1NNXA 2PW7A 4O7WA 2B3GA 1HA6A 4AQYQ 3KALA 5I5SA 5C1PA 2L9HA 3WWVA 2UUBQ 2VUMH 4KHPL 3J81L 1S68A 4FFRA 1D5XC 3Q6SA 1HUNA 3G8DA 1DONA 4BBSH 3CPWA 4JBKA 3S17H 4IJLA 3GTLH 2Q8TA 3N52A 2L15A 2KCTA 3E0EA 1KDAA 2CQOA 1GKHA 1FD7D 1CKNB 1X3QA 3TREA 1KC8C 3HOUG 1I7LA 1YVCA 1HR0L 2RA4A 4HIDA 2NWGA 1STBA 3T9DA 2R87A 4IWXA 2I07B 2JA8G 3DTFA 4FFPA 4RGTA 1NAPA 1JCKB 5D1OA 4XT3B 4KKUA 1LTRD 5I9PA 4A3KG 4WHXA 2F4IA 4FDBA 5C44B 4IFDJ 5CV8A 1EQVA 2IX0A 4WJ4A 3HOVH 1QVFA 2AMCB 1N36Q 2D2CC 3GD7A 2NU9B 2CHBD 4KY5A 3PSIA 2E2HH 4YCUA 1VQ4A 2HDLA 2PPBC 1A3GA 1O7YA 1QVCA 1MD2D 5E4XA 3TY9A 1EOVA 2F1MA 1MBYA 2VY3A 2EYJA 5D3IB 4FF2A 4PMBA 4L1KA 5C1OA 4J1MA 4FE2A 1B6SA 4O7YA 4A3BG 4YY3Q 2WAQB 1X3GA 4I55F 4Y8VB 2XVSA 3T4AC 3FMCA 3TDQA 1AH9A 1YEZA 3E5SA 4BS9A 3NXWA 1WCMG 4GKKQ 5ELOA 4J8QA 3BVMA 2L11A 4DRFA 4BA2I 4A3LH 1BBUA 1I4XA 2ENBA 2RSOA 3LWEA 5BWRA 1EU4A 2XRSD 1PYWD 1VS0A 2OEOA 4U68A 3ZJYC 5JOBA 2BA0A 1IBMQ 1Y1VH 4QMGA 1A3TA 5ELBA 3UDIA 2Q2UA
chains in the Genus database with same CATH topology
1PYSB 1KRSA 1VCIA 3E9IA 2A19A 4DPGA 1XJVA 3JSNA 2OQKA 1HZBA 3ULPA 4PZ8A 3L0OA 1KRTA 3S2DH 5IT9c 1XMQQ 3RN2A 1U5KA 2QA4A 1VQ5A 3ULJA 2UUAL 3PN1A 4UCTA 3RLOA 3NEMA 4GS3A 4Y52H 1JJGA 3CCQA 5C0XG 3J80i 3CQZH 2Q2TA 1RL2A 4B3MQ 4NPSA 4OWXB 5EAYA 4X6AH 5M5YH 1LTLA 1SROA 4P73A 4DR2Q 1HNXL 4NXMQ 2MFIA 4JI7L 3KF6A 3I4MH 3I4MG 3BU2A 1ASZA 4POFA 4HIKA 2RCNA 2F4VQ 4LF4L 1PH9A 1S40A 1JE5A 1N8RC 3CW2C 1WYDA 2ZTEA 1LM0A 4JYAL 2UXBL 4LFCL 4DV7Q 4C3IH 1Q8KA 3BA9A 3RTXA 4JOIA 1TXYA 3GTQH 4PG3A 3PUYA 2ZM6Q 1H95A 1PYBA 5LMUL 4XTCS 1YIJA 3GTPH 3KFUA 4DV6Q 3D31A 4DR7L 3HOYH 3HOYG 1VQGA 3HKZG 5IY0A 4LF7L 1QVGA 1FVIA 1NBWA 3A5UA 2K5VA 3AFPA 2ATWA 3HOWG 3I4NH 1NY4A 3M4QA 4JI6L 2A1AA 2VW9A 1T9HA 2PI2A 1E24A 2UUAQ 3BAAA 4OO1I 3KF8B 2N8NA 1V9PA 2V1CC 2VNUD 4GOPC 2LSSA 2R7FA 2VUGA 2JE6I 2EIFA 4EEQA 5IYCG 1J6QA 1YNXA 3AYHB 3UDFA 1VQBA 1X65A 5C4XH 4J15A 2VS1A 1N34L 1I3QH 2VUMG 3K8AA 5GAHC 1HNXQ 5C4XG 1M1KC 1R9TH 1MIUA 1WFQA 3CCJA 4IO9A 2HIVA 4JI7Q 1UE7A 1J5EL 3CC7A 3U50C 3MEFA 1VQLA 4HJAA 3FKIH 4GLVB 3W1GA 4GOPB 3QWUA 3CMEA 1Q46A 3AFQA 4IJHA 4LF4Q 1GVPA 5JJIA 4DV4Q 4YCWA 1G6PA 4DAMA 4A3EG 4UCSA 4IPCA 5IYBG 4LF5L 1B8AA 4NXNL 3CD6A 2RHSB 3OYYA 4JYAQ 3L7ZC 4LFCQ 3OW2A 3KJPA 1CKNA 4LF8L 2OTJA 2UXBQ 2NZHA 1X3EA 3Q8DA 4YCVA 1YHQA 4CC5A 4BY7H 4BY7G 3RLNA 2JA7G 5JEAG 2PNHA 2JA7H 3GTJH 4OO1G 4A3JG 5FJ8H 5LMUQ 3NC0B 2PI2E 4E6NA 5GAGC 1PH4A 2R92H 3UE1A 1K83H 3PIPA 2MO1A 2R92G 4DR7Q 4LF7Q 1PH7A 5BR8L 2ZJPA 4JI3L 3LGJA 3UDGA 2WB1G 1PFSA 1HZCA 4GNXC 4A3IH 4A3IG 1A0IA 3U58A 2DGYA 3S16H 1S72A 1U0LA 1RIPA 1IYJB 1Q1BA 2D0OA 2XTIA 4NB3A 5E7NA 3PF5A 4A3CG 4A3CH 1QZHA 1CSPA 2Q2HA 3A5ZB 1AE3A 5LMNL 1X55A 4R4OA 4ALPA 3KDFA 1OXTA 4OXPA 1N34Q 2R7DA 1QUQA 1PH3A 4B3RL 2IT1A 3FHWA 1YI2A 4Y7NH 1K0RA 1KD1C 4POGA 3VNNA 5D1PA 4YHHL 1J5EQ 1N9WA 3IRBA 2IHEA 1VQCA 1Y14B 1VQAA 1PH5A 2ZJRA 4JI8L 2OCEA 3CC2A 3S2HH 1ASYA 1B70B 4EFBA 4DUYQ 2GVAA 4LF5Q 1WI5A 1L2FA 4O0AA 1Q86C 4NXNQ 2HT1A 4YWLA 2VQEQ 1VQ9A 2ID0A 4LF8Q 4A93H 4A93G 4DR1L 3NBHB 1E7ZA 1N33L 3F8TA 2YYZA 2NZOA 3J81j 1G51A 2K50A 3CPFA 3PO2H 3PO2G 3F2BA 3M3YH 2CCZA 3CF5A 3KYHC 2ZTDA 4R1JA 4BA1I 3CCMA 5GROA 3H3VI 3G4SA 4DV0L 5BR8Q 5FLMH 1X56A 3U4VA 5FLMG 3J80c 2HVRA 1OTCA 5M5XH 3BABA 3CCRA 3M7NA 1D8LA 1K9MC 4JI2L 3RR5A 2LXJA 3EIVA 3NENA 1VQPA 4DV5Q 3M85A 4IOCA 2NVXH 5M5WH 1NMGA 5LMNQ 3AQQA 3U4ZA 1SRUA 2KHJA 4DAYB 4JI5L 3NBZB 1Q12A 2D0PA 3F2DA 3D0FA 4B3RQ 2WAQE 4LF6Q 4A3DH 3CCEA 4A3DG 3F2CA 3UDXA 1VQDA 3OTOL 1UWVA 4P74A 4HIMA 1FL0A 5J3BA 4DV2L 4JI8Q 5C0XJ 1FGUA 1XNQL 3TS2A 1YHBA 2PQAB 2F52A 1EUJA 2Z6KC 1XTDA 3I2ZA 4GN3B 4UFZA 4IPDA 1TWHH 2E8GA 1KHIA 1UEBA 1FJGL 2YU9H 3H3VH 1Y1WH 1Y1WG 4OX9L 3JAMi 3TY8A 1Q1EA 3A74A 1VQHA 3J81c 4B3TL 3GTKH 1BVSA 2VQFL 4DR1Q 3PCOB 1E1TA 4IPHA 5C3EG 1CSQA 5C3EH 3PUXA 5DISC 2JJQA 2Q2IA 3BZKA 4AQYL 3CCLA 1N33Q 3PUWA 1VQ7A 1HNZQ 4HJ8A 1PV4A 3CXCA 1KQSA 2FXQA 3J81i 3CCSA 4DV0Q 4JOIC 4HJ5A 4DR3L 3PF4A 4TQUS 4JI4L 4GKJL 4KLKA 3I4NG 5JJKA 2CKZB 4JI2Q 2JK8A 4X65L 1EFWA 2BH8A 4UCVA 1N32L 1XPOA 2XGTA 4DV1L 1L1OC 2RF4A 2NVTH 1XK5A 3JC66 2CWAA 3F1ZA 3RZDH 1LYLA 4HJ9A 1OXSC 2PMZE 2HVQA 5C4JH 1HZ9A 2UXCL 3EN2A 5GADC 3CC4A 1XNRL 1E22A 4X66L 2AHOB 1SR3A 2K5HA 2CFMA 4ME3A 4L5TA 4QIWE 3CCUA 4DV3L 1JB7A 3OTOQ 3FP9A 1IBKL 4DK6C 4L5QA 2K5NA 1EIYB 2VL6A 4DV2Q 1K8GA 1I94L 1YHAA 1XNQQ 1L1OB 5IYDG 4DUZL 3ICEA 5IYDH 2MNAA 3FKIG 4JI0L 3TS0A 1OXVA 5IP7H 5IP7G 2YTXA 3TY5A 2MQHA 4GOPA 1FJGQ 3PO3G 3PO3H 4IFDI 1CKMA 4OX9Q 2GN5A 1I50H 2RHQB 3T1HL 2I5MX 1VQKA 1B04A 4B3TQ 5FPOA 2VQFQ 2ZJQA 3BZCA 1PH1A 4AYBE 4DR4L 5AJ3L 1TA8A 2EQSA 1C9OA 4H02A 1EWIA 3RZOH 2JQOA 4A4IA 1V43A 3ER0A 4DNIA 5IE8A 4A75A 1V1QA 5FJ8G 3GJXB 4PZ7A 1VQOA 3L2PA 2E5LL 1W3SA 1L0WA 3GTGH 4DR3Q 2HQLA 1HH2P 4OWTB 1XMOL 4PMWA 1NE3A 1X6OA 2YTYA 4JI4Q 4LF9L 4GKJQ 4LH6A 4X65Q 4JI6Q 4UCOA 4JI1L 3CCVA 1IBLL 3PUVA 5JEAJ 3BA8A 1N32Q 2ASBA 1MKHA 4DV1Q 3NBYB 1PA6A 2I5HA 3TQYA 3KLWA 1I6HH 3HOXH 1IXRA 1IL2A 2D62A 1XNRQ 4IFDG 1A63A 3E9HA 4X66Q 5C44G 5C44H 4DV3Q 1PH6A 2K14A 2B63H 3ULLA 2B63G 2R7ZH 2R7ZG 2GVBA 4QY7A 1IBKQ 4JV5L 4GNXB 4A76A 4X62L 5JJLA 5D1OB 4R4IA 1I94Q 1VQNA 3DM3A 1HR0W 4LFBL 4DUZQ 4UP7A 2YV5A 1XPUA 3I55A 4QL5A 1VQJA 4JI0Q 1EQRA 2YTVA 4RG1A 1YJ9A 1KL9A 2JA9A 4MNOA 3T1HQ 1Q82C 4MZ9A 4KI0A 2AWOA 2JEAI 5FLXc 4LFAL 1MJCA 1VQ8A 4DR4Q 5IP9H 5IP9G 5AJ3Q 3GDEA 2IY5B 1Z47A 3W1BA 5HY6A 4DKAC 5M3FH 5M3FG 2WAQG 2HIXA 2UU9L 3CAMA 2C35B 1JT8A 3BJUA 4TVAB 1O7IA 2ALYB 4GN4B 2BA1A 3J7A5 3UE0A 2E5LQ 4LNQA 2OQ0A 2KCMA 1C7YA 4P71A 1LUZA 1XMOQ 4LUVA 2WP8J 4LF9Q 4A3BH 4LUOA 3W5OA 4C3HH 4HJ7A 4JI3Q 1HNWL 1HJPA 3K80C 1BBWA 1KAWA 4JI1Q 4R4CA 5HGQA 1JMCA 4GLXA 4WJ3M 2F4VL 4OWWB 5GQOA 4K0KL 1CUKA 2QGQA 3H0GH 5DLQE 4GLAC 1E1OA 4OONA 3GTOH 3A0JA 1W2BA 2HVSA 4UP8A 2N3SA 1PH2A 4YWKA 4A3MG 4A3MH 3K81C 3PGZA 3ERSX 1K8AC 4MTNA 1TAEA 1SN8A 3GO5A 4JV5Q 1XDNA 4JBWA 4BY1H 4BY1G 4APVA 4X62Q 4DR6L 2VZAA 1PVOA 2JA5H 4YHHQ 2N49A 2JA5G 1K73C 3EBEA 3PIOA 3JAMc 4LFBQ 4UY8C 1E3PA 3G6EA 2CWPA 3HFZB 4P75A 4UP9A 4DV6L 1AE2A 2NN6I 4B3SL 1GO3E 3K7AH 4JBMA 2PQAA 1VQEA 4LFAQ 3KJOA 5K36G 4JCVE 1YITA 3S1RH 2I5LX 1TWFH 2UUCL 3RN5A 2Y0SE 2UU9Q 4P72A 2K52A 2NVYH 3STBD 1OXUA 1JJCB 2QEXA 1UE6A 4LW1A 2UUBL 3S1NH 4UCRA 1TWGH 1IZ6A 3KOJA 3I56A 2E2JH 2Z6KA 3NELA 1A8VA 3KF6B 1EIFA 1MJEA 4HIOA 3DLLA 1HNWQ 1WOCA 3K7UC 2JEBI 3STBC 3RNUA 1SFOH 2E2IH 4GKKQ 4R4QA 4UCUA 3T1YL 4K0KQ 1C0AA 1K3RA 1DGSA 4A3GH 1GD7A 3H15A 3HKSA 4DV4L 4AYBG 1Q7YC 4A3GG 1KIXA 1P16A 3G48A 4C2MH 3S15H 4JC0A 2NN6G 2KHIA 1VQMA 2ES2A 2AWNA 4LUZA 4JI5Q 1YZ6A 2K75A 4KHZA 5GAEC 1NTGA 2MO0A 4DK3C 1P8LA 4DR6Q 4AIMA 1EYGA 2B29A 3B6YA 1D7QA 1GM5A 1WJJA 3RLFA 3PUZA 3CP0A 4DR5L 1TWCH 4QJFA 5ELNA 4B3SQ 1VQ6A 1Z9FA 5H1SE 3S24A 3GB8B 2IHFA 1L1OA 4AH6A 3HOWH 1JJ2A 3M9BA 1N36L 1X3FA 3S1QH 4QQBX 2UUCQ 2WFWA 4X64L 3M4PA 3M4OH 2B3GA 4CC6A 4AQYQ 5IYCH 3WWVA 2UUBQ 2OWOA 2VUMH 4KHPL 1UE5A 1VQIA 1S68A 1NMFA 1EQQA 3SGIA 2UXDL 1B7YB 4RMFA 1XPRA 3HOZH 3HOZG 4BBSH 3CPWA 4O2DA 4JBKA 4BBSG 3S17H 4IJLA 2HHHL 3T1YQ 3GTLH 4YY3L 2L15A 1Q81C 2KCTA 3VDYA 1M90C 3HKZE 4LWCA 3E0EA 2BH2A 2CQOA 2F3IA 2H5XA 2AKWB 4A3EH 1GKHA 1X9NA 4EFEA 5IYBH 3UQ8A 2KENA 4DUYL 1CKNB 3TREA 1KC8C 2NVQH 1QZGA 4JBJA 3GTMH 3HOUH 3HOUG 1YVCA 1PH8A 2VQEL 4HIDA 1HR0L 3TRZA 4GKKL 2UXCQ 3I4OA 3HOXG 5IWAL 4L5SA 2JA8H 2JA8G 3J7ZC 4A3JH 2LXKA 4DR5Q 1IBML 4GNXA 2JA6H 2JA6G 2DUDA 5D1OA 4UPAA 1YBYA 1TWAH 4JG2A 2ZTCA 3TEHB 4BBRG 4BBRH 4A3FG 4FDBA 4A3FH 4A3KH 4A3KG 1PHJA 1VQFA 1I5FA 2K4KA 4IFDJ 2IX0A 1XMQL 3S14H 4WJ4A 3HOVH 3HOVG 1QVFA 2AMCB 1N36Q 1X54A 4PZ6A 1A62A 3G71A 3GD7A 4IPGA 4DV5L 4X64Q 3KDFB 4L5RC 4R4TA 3PSIA 2E2HH 4YCUA 1VQ4A 4QGUA 1QUQB 1S3OA 1QVCA 1OXXK 4KHPQ 2IX1A 3TY9A 4B3ML 1EOVA 2VY3A 4LF6L 2OTLA 2A8VA 2UXDQ 4LH7A 4C3JH 2EXDA 4DR2L 2N78A 4NXML 5LMNW 3JSLA 2HHHQ 2Z0SA 4A3BG 4EX5A 1UE1A 4YY3Q 3CMAA 2R93H 1X3GA 2R93G 1IBLQ 2I0QA 5C0XI 3AEVA 1SE8A 1SMXA 1AH9A 1YEZA 2WB1E 3H0GG 5FPRA 1WCMH 1HZAA 1WCMG 2KBNA 3K0XA 4GN5A 2Y0SG 3MXNB 3PV0A 4XIGS 5ELOA 5M3MH 5M3MG 3I7FA 1YJNA 1HR0Q 4BA2I 4EQ5A 3S1MH 4A3LG 1BBUA 4A3LH 4DRFA 5IWAQ 1G291 1SLJA 1YJWA 4IOAA 4DV7L 1CKOA 1VS0A 3ZJYC 1BKBA 4YWMA 1KXLA 2BA0A 1NJIC 1HNZL 1Y1VH 1Y1VG 3UDIA 1IBMQ 2ZM6L 2Q2UA 4BXXG 4BXXH 2R6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYS B;  1KRS A;  1VCI A;  3E9I A;  2A19 A;  4DPG A;  1XJV A;  3JSN A;  2OQK A;  1HZB A;  3ULP A;  4PZ8 A;  3L0O A;  1KRT A;  3S2D H;  5IT9 c;  1XMQ Q;  3RN2 A;  1U5K A;  2QA4 A;  1VQ5 A;  3ULJ A;  2UUA L;  3PN1 A;  4UCT A;  3RLO A;  3NEM A;  4GS3 A;  4Y52 H;  1JJG A;  3CCQ A;  5C0X G;  3J80 i;  3CQZ H;  2Q2T A;  1RL2 A;  4B3M Q;  4NPS A;  4OWX B;  5EAY A;  4X6A H;  5M5Y H;  1LTL A;  1SRO A;  4P73 A;  4DR2 Q;  1HNX L;  4NXM Q;  2MFI A;  4JI7 L;  3KF6 A;  3I4M H;  3I4M G;  3BU2 A;  1ASZ A;  4POF A;  4HIK A;  2RCN A;  2F4V Q;  4LF4 L;  1PH9 A;  1S40 A;  1JE5 A;  1N8R C;  3CW2 C;  1WYD A;  2ZTE A;  1LM0 A;  4JYA L;  2UXB L;  4LFC L;  4DV7 Q;  4C3I H;  1Q8K A;  3BA9 A;  3RTX A;  4JOI A;  1TXY A;  3GTQ H;  4PG3 A;  3PUY A;  2ZM6 Q;  1H95 A;  1PYB A;  5LMU L;  4XTC S;  1YIJ A;  3GTP H;  3KFU A;  4DV6 Q;  3D31 A;  4DR7 L;  3HOY H;  3HOY G;  1VQG A;  3HKZ G;  5IY0 A;  4LF7 L;  1QVG A;  1FVI A;  1NBW A;  3A5U A;  2K5V A;  3AFP A;  2ATW A;  3HOW G;  3I4N H;  1NY4 A;  3M4Q A;  4JI6 L;  2A1A A;  2VW9 A;  1T9H A;  2PI2 A;  1E24 A;  2UUA Q;  3BAA A;  4OO1 I;  3KF8 B;  2N8N A;  1V9P A;  2V1C C;  2VNU D;  4GOP C;  2LSS A;  2R7F A;  2VUG A;  2JE6 I;  2EIF A;  4EEQ A;  5IYC G;  1J6Q A;  1YNX A;  3AYH B;  3UDF A;  1VQB A;  1X65 A;  5C4X H;  4J15 A;  2VS1 A;  1N34 L;  1I3Q H;  2VUM G;  3K8A A;  5GAH C;  1HNX Q;  5C4X G;  1M1K C;  1R9T H;  1MIU A;  1WFQ A;  3CCJ A;  4IO9 A;  2HIV A;  4JI7 Q;  1UE7 A;  1J5E L;  3CC7 A;  3U50 C;  3MEF A;  1VQL A;  4HJA A;  3FKI H;  4GLV B;  3W1G A;  4GOP B;  3QWU A;  3CME A;  1Q46 A;  3AFQ A;  4IJH A;  4LF4 Q;  1GVP A;  5JJI A;  4DV4 Q;  4YCW A;  1G6P A;  4DAM A;  4A3E G;  4UCS A;  4IPC A;  5IYB G;  4LF5 L;  1B8A A;  4NXN L;  3CD6 A;  2RHS B;  3OYY A;  4JYA Q;  3L7Z C;  4LFC Q;  3OW2 A;  3KJP A;  1CKN A;  4LF8 L;  2OTJ A;  2UXB Q;  2NZH A;  1X3E A;  3Q8D A;  4YCV A;  1YHQ A;  4CC5 A;  4BY7 H;  4BY7 G;  3RLN A;  2JA7 G;  5JEA G;  2PNH A;  2JA7 H;  3GTJ H;  4OO1 G;  4A3J G;  5FJ8 H;  5LMU Q;  3NC0 B;  2PI2 E;  4E6N A;  5GAG C;  1PH4 A;  2R92 H;  3UE1 A;  1K83 H;  3PIP A;  2MO1 A;  2R92 G;  4DR7 Q;  4LF7 Q;  1PH7 A;  5BR8 L;  2ZJP A;  4JI3 L;  3LGJ A;  3UDG A;  2WB1 G;  1PFS A;  1HZC A;  4GNX C;  4A3I H;  4A3I G;  1A0I A;  3U58 A;  2DGY A;  3S16 H;  1S72 A;  1U0L A;  1RIP A;  1IYJ B;  1Q1B A;  2D0O A;  2XTI A;  4NB3 A;  5E7N A;  3PF5 A;  4A3C G;  4A3C H;  1QZH A;  1CSP A;  2Q2H A;  3A5Z B;  1AE3 A;  5LMN L;  1X55 A;  4R4O A;  4ALP A;  3KDF A;  1OXT A;  4OXP A;  1N34 Q;  2R7D A;  1QUQ A;  1PH3 A;  4B3R L;  2IT1 A;  3FHW A;  1YI2 A;  4Y7N H;  1K0R A;  1KD1 C;  4POG A;  3VNN A;  5D1P A;  4YHH L;  1J5E Q;  1N9W A;  3IRB A;  2IHE A;  1VQC A;  1Y14 B;  1VQA A;  1PH5 A;  2ZJR A;  4JI8 L;  2OCE A;  3CC2 A;  3S2H H;  1ASY A;  1B70 B;  4EFB A;  4DUY Q;  2GVA A;  4LF5 Q;  1WI5 A;  1L2F A;  4O0A A;  1Q86 C;  4NXN Q;  2HT1 A;  4YWL A;  2VQE Q;  1VQ9 A;  2ID0 A;  4LF8 Q;  4A93 H;  4A93 G;  4DR1 L;  3NBH B;  1E7Z A;  1N33 L;  3F8T A;  2YYZ A;  2NZO A;  3J81 j;  1G51 A;  2K50 A;  3CPF A;  3PO2 H;  3PO2 G;  3F2B A;  3M3Y H;  2CCZ A;  3CF5 A;  3KYH C;  2ZTD A;  4R1J A;  4BA1 I;  3CCM A;  5GRO A;  3H3V I;  3G4S A;  4DV0 L;  5BR8 Q;  5FLM H;  1X56 A;  3U4V A;  5FLM G;  3J80 c;  2HVR A;  1OTC A;  5M5X H;  3BAB A;  3CCR A;  3M7N A;  1D8L A;  1K9M C;  4JI2 L;  3RR5 A;  2LXJ A;  3EIV A;  3NEN A;  1VQP A;  4DV5 Q;  3M85 A;  4IOC A;  2NVX H;  5M5W H;  1NMG A;  5LMN Q;  3AQQ A;  3U4Z A;  1SRU A;  2KHJ A;  4DAY B;  4JI5 L;  3NBZ B;  1Q12 A;  2D0P A;  3F2D A;  3D0F A;  4B3R Q;  2WAQ E;  4LF6 Q;  4A3D H;  3CCE A;  4A3D G;  3F2C A;  3UDX A;  1VQD A;  3OTO L;  1UWV A;  4P74 A;  4HIM A;  1FL0 A;  5J3B A;  4DV2 L;  4JI8 Q;  5C0X J;  1FGU A;  1XNQ L;  3TS2 A;  1YHB A;  2PQA B;  2F52 A;  1EUJ A;  2Z6K C;  1XTD A;  3I2Z A;  4GN3 B;  4UFZ A;  4IPD A;  1TWH H;  2E8G A;  1KHI A;  1UEB A;  1FJG L;  2YU9 H;  3H3V H;  1Y1W H;  1Y1W G;  4OX9 L;  3JAM i;  3TY8 A;  1Q1E A;  3A74 A;  1VQH A;  3J81 c;  4B3T L;  3GTK H;  1BVS A;  2VQF L;  4DR1 Q;  3PCO B;  1E1T A;  4IPH A;  5C3E G;  1CSQ A;  5C3E H;  3PUX A;  5DIS C;  2JJQ A;  2Q2I A;  3BZK A;  4AQY L;  3CCL A;  1N33 Q;  3PUW A;  1VQ7 A;  1HNZ Q;  4HJ8 A;  1PV4 A;  3CXC A;  1KQS A;  2FXQ A;  3J81 i;  3CCS A;  4DV0 Q;  4JOI C;  4HJ5 A;  4DR3 L;  3PF4 A;  4TQU S;  4JI4 L;  4GKJ L;  4KLK A;  3I4N G;  5JJK A;  2CKZ B;  4JI2 Q;  2JK8 A;  4X65 L;  1EFW A;  2BH8 A;  4UCV A;  1N32 L;  1XPO A;  2XGT A;  4DV1 L;  1L1O C;  2RF4 A;  2NVT H;  1XK5 A;  3JC6 6;  2CWA A;  3F1Z A;  3RZD H;  1LYL A;  4HJ9 A;  1OXS C;  2PMZ E;  2HVQ A;  5C4J H;  1HZ9 A;  2UXC L;  3EN2 A;  5GAD C;  3CC4 A;  1XNR L;  1E22 A;  4X66 L;  2AHO B;  1SR3 A;  2K5H A;  2CFM A;  4ME3 A;  4L5T A;  4QIW E;  3CCU A;  4DV3 L;  1JB7 A;  3OTO Q;  3FP9 A;  1IBK L;  4DK6 C;  4L5Q A;  2K5N A;  1EIY B;  2VL6 A;  4DV2 Q;  1K8G A;  1I94 L;  1YHA A;  1XNQ Q;  1L1O B;  5IYD G;  4DUZ L;  3ICE A;  5IYD H;  2MNA A;  3FKI G;  4JI0 L;  3TS0 A;  1OXV A;  5IP7 H;  5IP7 G;  2YTX A;  3TY5 A;  2MQH A;  4GOP A;  1FJG Q;  3PO3 G;  3PO3 H;  4IFD I;  1CKM A;  4OX9 Q;  2GN5 A;  1I50 H;  2RHQ B;  3T1H L;  2I5M X;  1VQK A;  1B04 A;  4B3T Q;  5FPO A;  2VQF Q;  2ZJQ A;  3BZC A;  1PH1 A;  4AYB E;  4DR4 L;  5AJ3 L;  1TA8 A;  2EQS A;  1C9O A;  4H02 A;  1EWI A;  3RZO H;  2JQO A;  4A4I A;  1V43 A;  3ER0 A;  4DNI A;  5IE8 A;  4A75 A;  1V1Q A;  5FJ8 G;  3GJX B;  4PZ7 A;  1VQO A;  3L2P A;  2E5L L;  1W3S A;  1L0W A;  3GTG H;  4DR3 Q;  2HQL A;  1HH2 P;  4OWT B;  1XMO L;  4PMW A;  1NE3 A;  1X6O A;  2YTY A;  4JI4 Q;  4LF9 L;  4GKJ Q;  4LH6 A;  4X65 Q;  4JI6 Q;  4UCO A;  4JI1 L;  3CCV A;  1IBL L;  3PUV A;  5JEA J;  3BA8 A;  1N32 Q;  2ASB A;  1MKH A;  4DV1 Q;  3NBY B;  1PA6 A;  2I5H A;  3TQY A;  3KLW A;  1I6H H;  3HOX H;  1IXR A;  1IL2 A;  2D62 A;  1XNR Q;  4IFD G;  1A63 A;  3E9H A;  4X66 Q;  5C44 G;  5C44 H;  4DV3 Q;  1PH6 A;  2K14 A;  2B63 H;  3ULL A;  2B63 G;  2R7Z H;  2R7Z G;  2GVB A;  4QY7 A;  1IBK Q;  4JV5 L;  4GNX B;  4A76 A;  4X62 L;  5JJL A;  5D1O B;  4R4I A;  1I94 Q;  1VQN A;  3DM3 A;  1HR0 W;  4LFB L;  4DUZ Q;  4UP7 A;  2YV5 A;  1XPU A;  3I55 A;  4QL5 A;  1VQJ A;  4JI0 Q;  1EQR A;  2YTV A;  4RG1 A;  1YJ9 A;  1KL9 A;  2JA9 A;  4MNO A;  3T1H Q;  1Q82 C;  4MZ9 A;  4KI0 A;  2AWO A;  2JEA I;  5FLX c;  4LFA L;  1MJC A;  1VQ8 A;  4DR4 Q;  5IP9 H;  5IP9 G;  5AJ3 Q;  3GDE A;  2IY5 B;  1Z47 A;  3W1B A;  5HY6 A;  4DKA C;  5M3F H;  5M3F G;  2WAQ G;  2HIX A;  2UU9 L;  3CAM A;  2C35 B;  1JT8 A;  3BJU A;  4TVA B;  1O7I A;  2ALY B;  4GN4 B;  2BA1 A;  3J7A 5;  3UE0 A;  2E5L Q;  4LNQ A;  2OQ0 A;  2KCM A;  1C7Y A;  4P71 A;  1LUZ A;  1XMO Q;  4LUV A;  2WP8 J;  4LF9 Q;  4A3B H;  4LUO A;  3W5O A;  4C3H H;  4HJ7 A;  4JI3 Q;  1HNW L;  1HJP A;  3K80 C;  1BBW A;  1KAW A;  4JI1 Q;  4R4C A;  5HGQ A;  1JMC A;  4GLX A;  4WJ3 M;  2F4V L;  4OWW B;  5GQO A;  4K0K L;  1CUK A;  2QGQ A;  3H0G H;  5DLQ E;  4GLA C;  1E1O A;  4OON A;  3GTO H;  3A0J A;  1W2B A;  2HVS A;  4UP8 A;  2N3S A;  1PH2 A;  4YWK A;  4A3M G;  4A3M H;  3K81 C;  3PGZ A;  3ERS X;  1K8A C;  4MTN A;  1TAE A;  1SN8 A;  3GO5 A;  4JV5 Q;  1XDN A;  4JBW A;  4BY1 H;  4BY1 G;  4APV A;  4X62 Q;  4DR6 L;  2VZA A;  1PVO A;  2JA5 H;  4YHH Q;  2N49 A;  2JA5 G;  1K73 C;  3EBE A;  3PIO A;  3JAM c;  4LFB Q;  4UY8 C;  1E3P A;  3G6E A;  2CWP A;  3HFZ B;  4P75 A;  4UP9 A;  4DV6 L;  1AE2 A;  2NN6 I;  4B3S L;  1GO3 E;  3K7A H;  4JBM A;  2PQA A;  1VQE A;  4LFA Q;  3KJO A;  5K36 G;  4JCV E;  1YIT A;  3S1R H;  2I5L X;  1TWF H;  2UUC L;  3RN5 A;  2Y0S E;  2UU9 Q;  4P72 A;  2K52 A;  2NVY H;  3STB D;  1OXU A;  1JJC B;  2QEX A;  1UE6 A;  4LW1 A;  2UUB L;  3S1N H;  4UCR A;  1TWG H;  1IZ6 A;  3KOJ A;  3I56 A;  2E2J H;  2Z6K A;  3NEL A;  1A8V A;  3KF6 B;  1EIF A;  1MJE A;  4HIO A;  3DLL A;  1HNW Q;  1WOC A;  3K7U C;  2JEB I;  3STB C;  3RNU A;  1SFO H;  2E2I H;  4GKK Q;  4R4Q A;  4UCU A;  3T1Y L;  4K0K Q;  1C0A A;  1K3R A;  1DGS A;  4A3G H;  1GD7 A;  3H15 A;  3HKS A;  4DV4 L;  4AYB G;  1Q7Y C;  4A3G G;  1KIX A;  1P16 A;  3G48 A;  4C2M H;  3S15 H;  4JC0 A;  2NN6 G;  2KHI A;  1VQM A;  2ES2 A;  2AWN A;  4LUZ A;  4JI5 Q;  1YZ6 A;  2K75 A;  4KHZ A;  5GAE C;  1NTG A;  2MO0 A;  4DK3 C;  1P8L A;  4DR6 Q;  4AIM A;  1EYG A;  2B29 A;  3B6Y A;  1D7Q A;  1GM5 A;  1WJJ A;  3RLF A;  3PUZ A;  3CP0 A;  4DR5 L;  1TWC H;  4QJF A;  5ELN A;  4B3S Q;  1VQ6 A;  1Z9F A;  5H1S E;  3S24 A;  3GB8 B;  2IHF A;  1L1O A;  4AH6 A;  3HOW H;  1JJ2 A;  3M9B A;  1N36 L;  1X3F A;  3S1Q H;  4QQB X;  2UUC Q;  2WFW A;  4X64 L;  3M4P A;  3M4O H;  2B3G A;  4CC6 A;  4AQY Q;  5IYC H;  3WWV A;  2UUB Q;  2OWO A;  2VUM H;  4KHP L;  1UE5 A;  1VQI A;  1S68 A;  1NMF A;  1EQQ A;  3SGI A;  2UXD L;  1B7Y B;  4RMF A;  1XPR A;  3HOZ H;  3HOZ G;  4BBS H;  3CPW A;  4O2D A;  4JBK A;  4BBS G;  3S17 H;  4IJL A;  2HHH L;  3T1Y Q;  3GTL H;  4YY3 L;  2L15 A;  1Q81 C;  2KCT A;  3VDY A;  1M90 C;  3HKZ E;  4LWC A;  3E0E A;  2BH2 A;  2CQO A;  2F3I A;  2H5X A;  2AKW B;  4A3E H;  1GKH A;  1X9N A;  4EFE A;  5IYB H;  3UQ8 A;  2KEN A;  4DUY L;  1CKN B;  3TRE A;  1KC8 C;  2NVQ H;  1QZG A;  4JBJ A;  3GTM H;  3HOU H;  3HOU G;  1YVC A;  1PH8 A;  2VQE L;  4HID A;  1HR0 L;  3TRZ A;  4GKK L;  2UXC Q;  3I4O A;  3HOX G;  5IWA L;  4L5S A;  2JA8 H;  2JA8 G;  3J7Z C;  4A3J H;  2LXK A;  4DR5 Q;  1IBM L;  4GNX A;  2JA6 H;  2JA6 G;  2DUD A;  5D1O A;  4UPA A;  1YBY A;  1TWA H;  4JG2 A;  2ZTC A;  3TEH B;  4BBR G;  4BBR H;  4A3F G;  4FDB A;  4A3F H;  4A3K H;  4A3K G;  1PHJ A;  1VQF A;  1I5F A;  2K4K A;  4IFD J;  2IX0 A;  1XMQ L;  3S14 H;  4WJ4 A;  3HOV H;  3HOV G;  1QVF A;  2AMC B;  1N36 Q;  1X54 A;  4PZ6 A;  1A62 A;  3G71 A;  3GD7 A;  4IPG A;  4DV5 L;  4X64 Q;  3KDF B;  4L5R C;  4R4T A;  3PSI A;  2E2H H;  4YCU A;  1VQ4 A;  4QGU A;  1QUQ B;  1S3O A;  1QVC A;  1OXX K;  4KHP Q;  2IX1 A;  3TY9 A;  4B3M L;  1EOV A;  2VY3 A;  4LF6 L;  2OTL A;  2A8V A;  2UXD Q;  4LH7 A;  4C3J H;  2EXD A;  4DR2 L;  2N78 A;  4NXM L;  5LMN W;  3JSL A;  2HHH Q;  2Z0S A;  4A3B G;  4EX5 A;  1UE1 A;  4YY3 Q;  3CMA A;  2R93 H;  1X3G A;  2R93 G;  1IBL Q;  2I0Q A;  5C0X I;  3AEV A;  1SE8 A;  1SMX A;  1AH9 A;  1YEZ A;  2WB1 E;  3H0G G;  5FPR A;  1WCM H;  1HZA A;  1WCM G;  2KBN A;  3K0X A;  4GN5 A;  2Y0S G;  3MXN B;  3PV0 A;  4XIG S;  5ELO A;  5M3M H;  5M3M G;  3I7F A;  1YJN A;  1HR0 Q;  4BA2 I;  4EQ5 A;  3S1M H;  4A3L G;  1BBU A;  4A3L H;  4DRF A;  5IWA Q;  1G29 1;  1SLJ A;  1YJW A;  4IOA A;  4DV7 L;  1CKO A;  1VS0 A;  3ZJY C;  1BKB A;  4YWM A;  1KXL A;  2BA0 A;  1NJI C;  1HNZ L;  1Y1V H;  1Y1V G;  3UDI A;  1IBM Q;  2ZM6 L;  2Q2U A;  4BXX G;  4BXX H;  2R6G A; 
#chains in the Genus database with same CATH topology
 1SDF A;  3N6R A;  4A3M B;  2OQK A;  4QUF A;  1NUC A;  3L0O A;  1XMQ Q;  4XQQ A;  1G6Z A;  3OMG A;  3RN2 A;  4CHT B;  1SBB B;  1VDZ A;  2DNE A;  2JA5 B;  3AB9 A;  5ISR A;  3PMF A;  4UCT A;  4GS3 A;  1JJG A;  3CCQ A;  5C0X G;  1WD0 A;  5JVH 3;  5TSS A;  2HG8 A;  3K7A B;  4KJN A;  4KMU C;  4B3M Q;  4OWX B;  1I2K A;  4O42 A;  2C00 A;  2F0M A;  2IW3 A;  4P73 A;  2PMZ B;  2SNM A;  1HNX L;  3S1R B;  5J22 A;  3I4M H;  1K8M A;  3BU2 A;  1ASZ A;  1R4Q B;  4HIK A;  1S4Z A;  4ZCK A;  2WIN B;  4LMQ D;  1EOT A;  3S1N B;  1PH9 A;  3E0J A;  1PRT D;  3FEW X;  1SFO B;  4DV7 Q;  2EVB A;  4C3I G;  1LAB A;  2YWV A;  3BA9 A;  3GTQ H;  3BDL A;  2G9H D;  2PCF B;  2ZM6 Q;  4FFN A;  2RSN A;  1PYB A;  5LMU L;  3D4D A;  1S5F D;  1AW7 A;  4DV6 Q;  3D31 A;  3W2D A;  3HOY G;  3QOL A;  1QVG A;  3I4N H;  1E4E B;  3KAK A;  1NY4 A;  3P7J A;  1CQI B;  1T9H A;  2UUA Q;  3DEP A;  3KF8 B;  1YNJ D;  2N8N A;  1UUP A;  1TWC B;  5D3D A;  1EUC B;  1F9S A;  5IYC G;  3AYH B;  2KJX A;  3OW7 A;  5C4X H;  4J15 A;  1I3Q H;  4O86 A;  3K8A A;  2QKI C;  1R9T H;  1S5C D;  3U55 A;  4DXG A;  1J5E L;  3CC7 A;  3M4O B;  2L1B A;  2AUJ D;  3FKI H;  3QWU A;  1SE3 A;  3CME A;  4IJH A;  4LF4 Q;  1GVP A;  4DV4 Q;  4YCW A;  2QF7 A;  5HNE A;  4MV7 A;  4IPC A;  4CMD A;  1B6R A;  4YIJ A;  1ZXT A;  2OTJ A;  3HOZ B;  1DD2 A;  4LFC Q;  2ZDG A;  1H9M A;  1RDP D;  1TY0 A;  3LQS A;  3OMC A;  3T9A A;  3EFX D;  4BY7 G;  1FYC A;  3RLN A;  3WWI A;  2PNH A;  3TME A;  3V4Z A;  4FXK C;  1JC7 A;  5FJ8 H;  1F9Q A;  5GAG C;  1HQM C;  4LF7 Q;  1PH7 A;  1ESR A;  5DM7 3;  3QQM A;  1PFS A;  1HZC A;  4A3I G;  1A0I A;  2DGY A;  1S72 A;  4EQN A;  2XTI A;  1XTC D;  3PF5 A;  4A3C H;  5DNF A;  2JA6 B;  3I8Z A;  1UC9 A;  1TT2 A;  2Q2H A;  3TQT A;  1TWA B;  4BBR B;  1AE3 A;  4O83 A;  3KDF A;  2MJ8 A;  1J9O A;  2KQ3 A;  2FFK B;  1N34 Q;  4B3R L;  3FHW A;  4POG A;  3OHX C;  1L0Y B;  5D1P A;  4HNU A;  4C3J G;  3A54 A;  4DAV A;  4KV6 A;  1A15 A;  2ZJR A;  1MSG A;  3DM1 A;  1VMP A;  1PXU A;  1V1O A;  4NXN Q;  4YWL A;  4YAK B;  2EJ3 A;  3V05 A;  2V5A A;  4RGN A;  1MGS A;  4DN4 M;  1E2V A;  2R93 B;  1WTW A;  1EY7 A;  3QO2 A;  1EUD B;  1W6K A;  3F8T A;  4XYM B;  2NZO A;  1G51 A;  5I5X A;  4C56 C;  5BMV F;  3F2B A;  2EYF A;  5M3M B;  4R1J A;  3G4S A;  3K5L A;  2K7V A;  5FLM G;  3U4V A;  1KAB A;  2XWJ B;  3CHB D;  4MA5 A;  3M7N A;  1DAA A;  3HT5 A;  4M8A A;  4N8X 1;  3EIV A;  3NEN A;  3VR2 A;  1RJT A;  2JXM B;  2R85 A;  2F0P A;  4JI5 L;  4HMI A;  4A3D G;  3URY A;  1HXY D;  1VQD A;  5FO8 B;  3OTO L;  4H7B A;  4WFN 3;  1FL0 A;  2OF1 A;  2EYL A;  2PZW A;  2SEB D;  3K6O A;  5J3B A;  5C0X J;  3TIG A;  3H6M A;  3WDN A;  2PQA B;  2F52 A;  4UFZ A;  4HN2 A;  4WBN F;  1PFN A;  1WTP A;  1MSH A;  5CM0 A;  1FJG L;  1UEB A;  2E2J B;  2GPW A;  1OO9 B;  3A74 A;  4B3T L;  1BVS A;  4EGJ A;  1E1T A;  4IPH A;  5C3E H;  1CSQ A;  2JJQ A;  3IL8 A;  4P2C B;  3PUW A;  1VQ7 A;  2COI A;  3P75 A;  2Z02 A;  2FXQ A;  5DAU A;  1GUW A;  3CCS A;  4DV0 Q;  1V1P A;  3UFX B;  4DR3 L;  3JZI A;  1CK1 A;  1I4Q A;  4MA0 A;  5D14 A;  3S9W A;  4JI4 L;  3V2T A;  4JI2 Q;  4X65 L;  5DGI A;  2BH8 A;  5KEE A;  1L1O C;  1SXT A;  3JC6 6;  3F1Z A;  1A48 A;  2B2U A;  4I7A A;  1WVL A;  1OXS C;  3HKZ B;  4IZO A;  4UUG A;  3S1M B;  3EN2 A;  3HOW B;  4EQP A;  1SR3 A;  3E6Z X;  3VR5 A;  4L5T A;  1JB7 A;  4DQN A;  2HJW A;  2K5N A;  1I94 L;  1NR4 A;  1L1O B;  2COG A;  1X3P A;  4KHV A;  1VF7 A;  1LT6 D;  4XT1 B;  3TY5 A;  3SE0 A;  2XIW A;  3PO3 G;  4IFD I;  1CKM A;  2GN5 A;  1TR5 A;  4N9T A;  2I5M X;  5FPO A;  2WKC A;  3CKI B;  1WR2 A;  1LTB D;  4B9X A;  1TA8 A;  2EQS A;  4O81 A;  1V43 A;  2DJF C;  3ER0 A;  4O1N A;  5IE8 A;  1JIC A;  4A75 A;  3GJX B;  2OT2 A;  3K58 A;  2B39 A;  4JPB W;  4GKJ Q;  2EY6 A;  3A7A B;  4LH6 A;  3K5M A;  4JI1 L;  2EOT A;  3KAJ A;  4MV6 A;  3NBY B;  4KD3 A;  1PTO C;  2R92 B;  3TW7 A;  4B08 A;  1I6H H;  1T5X D;  1A3U A;  1SYG A;  3E9H A;  4HN7 A;  5C44 H;  3ND9 A;  4WRD A;  2IJ0 A;  3ULL A;  2GVB A;  4GNX B;  4A76 A;  1VQN A;  4FO2 A;  4UP7 A;  1PTO B;  1EQR A;  1EYZ A;  3JZF A;  2EYM A;  3Q24 A;  4DR4 Q;  5FOB B;  4O7T A;  2RBM A;  2B2W A;  2NYZ D;  3D4R A;  4DKA C;  3K5O A;  3VYU A;  4MAM A;  4FXD A;  3NBH A;  2M9V A;  2R7K A;  2ALY B;  2F0E A;  2KCM A;  1KJJ A;  1LUZ A;  2A6E C;  4A3B H;  3NC0 B;  1HNW L;  5IYZ F;  1HJP A;  1BBW A;  1PZI D;  3AU7 A;  4R4C A;  4V0B A;  5HGQ A;  4WJ3 M;  2F4V L;  1CUK A;  3A8K E;  3U9O A;  3NWS A;  4GLA C;  3PO2 B;  5IGG A;  2KCC A;  2HVS A;  4UP8 A;  4FU0 A;  1PH2 A;  4A3M H;  3K81 C;  3PGZ A;  1TAE A;  3TP7 A;  1SN8 A;  5J39 A;  4JV5 Q;  1XDN A;  2BCO A;  5FLX E;  1EEF D;  2CW0 C;  2JA5 H;  1CQJ B;  3PIO A;  2F0F A;  4LFB Q;  5EPK A;  3VR6 A;  3G6E A;  2CWP A;  1B9N A;  3HFZ B;  4P75 A;  4UP9 A;  2BE5 C;  1TS4 A;  4E6I A;  2PZU A;  2X5R A;  4HQ6 A;  3K7A H;  4C5A A;  4IQZ A;  4DNR B;  4LFA Q;  4I65 A;  3HGB A;  5CV5 A;  3S1R H;  2Y0S E;  4UDU C;  4R8I A;  5DGH A;  4Q0F A;  3JZ6 A;  5I9O A;  5CR5 A;  1JJC B;  1TWH B;  4EGV A;  4LW1 A;  2UUB L;  3S1N H;  2GQS A;  1TWG H;  1GJX A;  3KOJ A;  2Z6K A;  1A8V A;  1U4M A;  3GTK B;  1IL8 A;  3D8G A;  4KJO A;  2CH4 A;  2MPM A;  1SFO H;  5LL6 S;  3KBX A;  1DGS A;  1LT4 D;  4FFM A;  2A68 C;  1KIX A;  4JC0 A;  2KHI A;  1D1I A;  1H9J A;  5IT9 E;  4JI5 Q;  3I4N B;  1YZ6 A;  1K3B C;  3D3R A;  2MO0 A;  5C4Z A;  4DK3 C;  5COR A;  4AIM A;  2B29 A;  1BCP D;  1EEI D;  5HV6 A;  1BR9 A;  4NW2 A;  1TWC H;  2QDL A;  5FO7 B;  3SDZ A;  1VQ6 A;  3GB8 B;  1HCZ A;  4XYL B;  1O7Z A;  3Q23 A;  1E0B A;  5DEH A;  1ICW A;  1KDB A;  1JJ2 A;  4RAU C;  3M9B A;  4TM5 A;  4OEL B;  2M2L A;  1N36 L;  4KKT A;  3M4O H;  3FKI B;  5IYC H;  1EFI D;  1I50 B;  1NMF A;  1ZYR C;  3SGI A;  1B7Y B;  1TU2 B;  1ENF A;  1CT1 D;  1VF5 C;  3HOZ H;  4FF4 A;  4YY3 L;  3T9E A;  1M90 C;  2DZD A;  3A8J E;  2F3I A;  1X9N A;  2BOS A;  2W71 A;  3K5I A;  4EFE A;  1AEX A;  3T13 A;  3UZB A;  4GKK L;  2HCC A;  3I4O A;  3R23 A;  2EPB A;  4TUY F;  2F0O A;  3F2U A;  4O7R A;  5I47 A;  1A3V A;  2LXK A;  4DR5 Q;  1IBM L;  2JA6 H;  2DUD A;  1A0G A;  1YBY A;  2CNQ A;  1TWA H;  4JG2 A;  2ZTC A;  4BBR H;  4K6D A;  4A3F G;  1G91 A;  5LP6 F;  2R7Z B;  1PHJ A;  1VQF A;  1I5F A;  3HB9 A;  1XMQ L;  3R3O A;  4PZ6 A;  1B1Z A;  3BDC A;  4IPG A;  2GA4 B;  4FYD A;  1K8O A;  2K32 A;  2V4D A;  4R4T A;  3GLK A;  4DK1 A;  5NUC A;  5A35 A;  2IX1 A;  4B3M L;  4ZQI A;  5IIF A;  1O78 A;  2OTL A;  1JQY D;  4RGM A;  2A8V A;  2UXD Q;  5EBC A;  4C3J H;  2EXD A;  5J2T F;  2N78 A;  1AP0 A;  4JK1 C;  2HHH Q;  4V19 0;  1UE1 A;  3CMA A;  2QIL A;  2R93 H;  1BQQ T;  2AUK A;  5C0X I;  4GLW A;  4PNY A;  4GZY C;  3GQB A;  2WB1 E;  3H0G G;  5BN3 A;  2EJG C;  4GN5 A;  2Y0S G;  5M3M H;  2F0N A;  4RA8 A;  1YJN A;  4CBV A;  1H9S A;  4EQ5 A;  5IWA Q;  1QJO A;  4IOA A;  4DV7 L;  1CKO A;  2EDG A;  1A2T A;  3H0G B;  4BXX H;  3G7L A;  1BUV T;  2ZM6 L;  1GOZ A;  2A74 C;  3RUP A;  2R6G A;  1PYS B;  5IOD A;  1HZB A;  1KRT A;  2K5D A;  5IT9 c;  1U5K A;  2QA4 A;  1GLV A;  2EYO A;  3ULJ A;  2UUA L;  3PN1 A;  4ZK9 B;  3J7Y W;  2I46 A;  1UNS A;  2LMC B;  5E25 A;  3J80 i;  3FPP A;  3WO1 A;  4DAP A;  1LV9 A;  2RCF A;  2BDN A;  4NPS A;  1CTM A;  2VPQ A;  3KLR A;  1PLF A;  1SRO A;  2K6A A;  4DR2 Q;  4NXM Q;  4ME5 A;  4CKC A;  1TWF B;  3R9R A;  1CZG A;  2F4V Q;  4LF4 L;  1JE5 A;  1CS0 A;  1WYD A;  1A9X A;  4C5C A;  4LFC L;  4NZM A;  1Q8K A;  3RTX A;  4JOI A;  2JN4 A;  3K5H A;  4A3G B;  4ZOL F;  1GUN A;  1HTL D;  5LHY 1;  4XDX A;  3KFU A;  2JYO A;  1W96 A;  1VQG A;  5IY0 A;  3C2P A;  4LF7 L;  4CDF C;  3S1M H;  1AN8 A;  2K5V A;  3AFP A;  2Z4I A;  3JAM L;  3BAA A;  2PI2 A;  1E24 A;  1GUT A;  2V1C C;  4GOP C;  1KTK A;  5J1Z A;  4FF1 A;  4IUU A;  4OIK A;  4ZYS A;  1EHI A;  3CRL C;  1J6Q A;  1JWS D;  1YNX A;  3UDF A;  1B3Q A;  1VQB A;  4IUP A;  3SNO A;  1N34 L;  1EYD A;  1EY9 A;  1M6V A;  1MIU A;  1M4V A;  1WFQ A;  3K3P A;  2A6H C;  2HIV A;  3SE7 A;  1B53 A;  1JB3 A;  3MHB A;  1E2Z A;  2L12 A;  3MEF A;  1VQL A;  3W1G A;  4GOP B;  2V59 A;  1G6P A;  5D65 A;  4HAE A;  5JJI A;  5BPH A;  4K5X A;  4QB4 A;  2HDK A;  5IYB G;  2Z1C A;  1IYE A;  4NXN L;  1ROD A;  3HZX A;  4K2K A;  4KKS A;  3KJP A;  1CKN A;  1SJE D;  1I6V C;  2NZH A;  1PRT F;  2LS0 1;  4YCV A;  4ABN A;  2JA7 G;  4OO1 G;  1BOS A;  2LFN A;  1LTA D;  4A3J G;  2CQA A;  2PBZ A;  2NVQ B;  4O4H F;  3GTM B;  2R92 H;  3HOU B;  5I6Y A;  3PIP A;  2MO1 A;  1I6H B;  1KJI A;  1K28 A;  3FPU B;  1WTQ A;  4RH6 A;  1G2W A;  1E2W A;  3UDG A;  2JA8 B;  2WB1 G;  1IYJ B;  3MWD A;  3ERO A;  3SR1 A;  1QZH A;  3MWE A;  1RTN A;  5AFW A;  1D6E C;  1PTO H;  2C5C A;  3A5Z B;  4ALP A;  1X55 A;  4R4O A;  1KNE A;  4A3K B;  4O2A F;  4OXP A;  1PH3 A;  3GID A;  3VNN A;  3OIP A;  1K0R A;  1STY A;  4YHH L;  3VPD A;  1F2Z A;  4CDD C;  1Y14 B;  1VQA A;  2OCE A;  1H9R A;  2DNC A;  4EFB A;  2XRQ D;  3J7A V;  4LF5 Q;  1Y8P B;  2QB5 A;  2KEE A;  4O0A A;  5BN5 A;  1IW7 D;  1VQ9 A;  4LF8 Q;  1PFM A;  4A3B B;  4A93 G;  2YZL A;  4H0L C;  2DIK A;  1EY0 A;  1MHW C;  1EIG A;  4KY6 A;  3E5N A;  2R7N A;  1ET9 A;  3J81 j;  3WNZ A;  1C48 A;  1WCM B;  2FHT A;  3PO2 H;  1CHQ D;  1S5E D;  2CCZ A;  3KYH C;  3CCM A;  3H3V I;  2SCU B;  4DV0 L;  1LO5 D;  4K8J A;  4K5V A;  3NE5 B;  1Y69 U;  1LT5 D;  3J80 c;  4M9U A;  2I80 A;  1D8L A;  4JI2 L;  3RR5 A;  4JXU A;  2L0C A;  5KS8 A;  1VBH A;  4FVM A;  4KN4 C;  2COJ A;  5BWX A;  3M85 A;  1DYQ A;  3AQQ A;  5KRU A;  5IGE A;  4DAY B;  1Q12 A;  2D0P A;  3D0F A;  2KVM A;  3Q1K A;  2ZGI A;  4DA2 A;  4MTK A;  4F7X A;  1SE2 A;  3ETH A;  1FGU A;  1LLR D;  3TS2 A;  1XTD A;  4GN3 B;  4ZQ3 A;  4IAL A;  1TWH H;  2E8G A;  1KHI A;  3TY8 A;  1TWG B;  5M5Y B;  1Y1W G;  5CV6 A;  1Q1E A;  2F3W A;  1VQH A;  4TKO B;  3J81 c;  3GTK H;  1GHJ A;  4DR1 Q;  2FMC A;  3PCO B;  3RFC A;  3RV4 A;  3PUX A;  4YJ3 F;  2F0D A;  5KND A;  1C8C A;  2Q2I A;  1N33 Q;  3T53 B;  1KLG D;  1F2L A;  2X6G A;  3HRZ C;  2DWC A;  1PV4 A;  3CXC A;  4IWY A;  3PF4 A;  2B2T C;  4TQU S;  4G4K A;  4C3I B;  4GKJ L;  1KBL A;  5JJK A;  2CKZ B;  4HR7 B;  5EKI A;  5CMD A;  4UCV A;  2IPK D;  5IOC A;  5FNV F;  3H09 A;  5IGD A;  1TKW B;  2RF4 A;  3KF8 A;  3NTI A;  3X3N A;  2CWA A;  3HOY B;  1LYL A;  4HJ9 A;  1HTP A;  2HVQ A;  4PBC A;  2UXC L;  2PN1 A;  2K5H A;  2J0T D;  4ME3 A;  4QIW E;  1EZ8 A;  3NK9 A;  4DK6 C;  1EIY B;  1YHA A;  1XNQ Q;  3FRP B;  4RCN A;  5IYD H;  5DAA A;  2EIY A;  3TS0 A;  5IP7 H;  1Z7T A;  4OX9 Q;  1I50 H;  4K2L A;  2PQE A;  1SAP A;  2VQF Q;  2ZJQ A;  4E4T A;  4AYB E;  1DXM A;  4DR4 L;  2YZN A;  4X3S A;  2FJ2 A;  3VPC A;  5CYU A;  4CKE A;  1C9O A;  5JQG F;  2JQO A;  4DNI A;  4QF4 A;  1XYI A;  5LYJ F;  5G3L D;  1L0W A;  2B2Y A;  1QE6 A;  1QNU A;  4PMW A;  3A56 A;  1JOQ A;  5CC4 A;  4BY7 B;  4UCO A;  3CCV A;  1IBL L;  2F3V A;  4O4J F;  1XXG A;  1PA6 A;  2I5H A;  3RMH A;  1K83 B;  1GSH A;  4MN3 A;  4RZQ A;  3KLW A;  2KHS A;  1XNR Q;  1IL2 A;  2D62 A;  4IFD H;  2YS6 A;  1A63 A;  4X66 Q;  5F2D A;  1RKN A;  4DV3 Q;  2R7Z H;  1W93 A;  2K14 A;  4A3I B;  2B63 G;  4ME6 A;  4JV5 L;  3TW6 A;  1IBK Q;  2R3Z A;  3NBI A;  1ILQ A;  1STH A;  3DM3 A;  1Q3L A;  4LFB L;  1XPU A;  2HHF B;  3I55 A;  4MV9 A;  1QNK A;  2YTV A;  1CQF A;  3NPP A;  2JA9 A;  1Q82 C;  4MZ9 A;  1QOH A;  2CNU A;  1XX8 A;  1VQ8 A;  4C3J B;  4LFA L;  5IP9 G;  1YNN D;  5AJ3 Q;  2IY5 B;  5C4H A;  1Z47 A;  3ITP A;  5M3F G;  1IKM A;  1SSO A;  4RGO S;  2C35 B;  2F0L A;  3LUL A;  1O7I A;  2I8C A;  2BA1 A;  3J7A 5;  1VBG A;  4LNQ A;  4IUV A;  1JOK A;  1XMO Q;  1SYB A;  4LF9 Q;  4HJ7 A;  2IX3 A;  2K5W A;  4GLX A;  3QIA A;  3H0G H;  3BYT B;  4IUN A;  4OON A;  3G8C A;  3TP6 A;  1W2B A;  1SMY C;  2N3S A;  4HNV A;  3NSW A;  3ERS X;  3BG5 A;  4MTN A;  3VOT A;  3MXG A;  4F8M A;  3BS1 A;  3GO5 A;  5M5X B;  1G2S A;  2KOL A;  1PVO A;  1PMR A;  4BY1 G;  1U4L A;  4YHH Q;  1GXD C;  4UY8 C;  5BWU A;  1E3P A;  5C5M A;  1AE2 A;  2ICE C;  4LAA A;  3DAA A;  3QFF A;  3H3V C;  2VQD A;  1JDE A;  2PQA A;  1DV2 A;  4A3D B;  1VQE A;  4ID6 A;  3PFF A;  3GV3 A;  3SHL A;  3KJO A;  5K36 H;  2Y4R A;  4FP5 D;  1TWF H;  4K6N A;  4ZI7 F;  2UU9 Q;  1DZ1 A;  4L8J A;  3A8I E;  2B8F A;  3STB D;  1OXU A;  2QEX A;  4UCR A;  2YU9 B;  3C1E A;  3I56 A;  3KF6 B;  1EIF A;  4M1U B;  4HIO A;  1MJE A;  2AQ2 B;  2JEB I;  1WRV A;  4M0J A;  3TIN A;  4Z9C B;  4KD4 A;  4A3G H;  2O2L D;  4AYB G;  2K01 A;  3OUU A;  3EJI A;  1BXR A;  4NZN A;  4DAA A;  3MWY W;  2NN6 G;  3MXU A;  4LUZ A;  2A69 D;  2K75 A;  4KHZ A;  1NTG A;  3U54 A;  4DR6 Q;  1P8L A;  5EKK A;  4EGQ A;  1EYG A;  3MFY A;  4DR5 L;  3RZD B;  2ICI A;  5ELN A;  3TBI B;  1Z9F A;  3S24 A;  1L1O A;  3BVG A;  3UI2 A;  3TP5 A;  4NMZ A;  2RQX A;  1BXT A;  1EL0 A;  2WFW A;  3KUP A;  2Q8R E;  2GLT A;  1GHK A;  1TVX A;  3PO3 B;  3SK6 A;  1VQI A;  1I1L A;  2FB9 A;  2MGS A;  3KK7 A;  2UXD L;  1XPR A;  2YS7 A;  1S5D D;  4BBS G;  4O2D A;  5LOV F;  2HHH L;  3T1Y Q;  4S3S A;  2G9D A;  2ZT9 C;  2P0A A;  3SXH A;  1L0X B;  3VDY A;  1Q81 C;  1TII D;  4LWC A;  2BH2 A;  3WOF A;  3SK8 A;  5IYB H;  3DTG A;  4DUY L;  3ORQ A;  4FXG C;  5EKL A;  2NVQ H;  3A7L A;  1QZG A;  4JBJ A;  3GTM H;  3D6W A;  3HOU H;  4Y52 H;  3LNN A;  4OHJ A;  2UXC Q;  3HOX G;  2L4N A;  5IWA L;  4L5S A;  2JA8 H;  3KBG A;  4OO1 H;  4LJZ C;  4A3J H;  3QJY A;  1GUO A;  4GNX A;  1A2U A;  2CH4 W;  1BCP F;  1HFG A;  4UPA A;  1J8I A;  4WOR A;  3WO0 A;  4RKB A;  3TEH B;  4A3K H;  1MI2 A;  2LY7 A;  2M00 A;  4HNT A;  2K4K A;  3QOJ A;  2C9O A;  3HOV G;  4FFL A;  1X54 A;  2KUM A;  1A62 A;  1PZK D;  4DV5 L;  1ZKO A;  4L5R C;  1LAC A;  1QUQ B;  1ET6 A;  1OXX K;  2B2V A;  3R5F A;  2B2W C;  1UC8 A;  1TS2 A;  4XYQ A;  4HED A;  4LF6 L;  2X69 A;  4ZLT F;  4LH7 A;  2HQE A;  4DK0 A;  1ULZ A;  2G5D A;  4DR2 L;  4NXM L;  3R2I A;  4RHR A;  5LMN W;  3SEB A;  3TZD A;  1AUX A;  4C3H G;  4DU9 A;  3TZU A;  1IBL Q;  3R93 A;  1SE8 A;  1WCM H;  2DY7 A;  2KBN A;  4MHE A;  4CJ2 C;  3PV0 A;  3MXN B;  1U4P A;  3I7F A;  4A3L G;  4XX0 B;  1G29 1;  3U9S A;  3VYS A;  1WTX A;  4TSS A;  1KXL A;  2A73 B;  1NJI C;  2DLN A;  1Y1V G;  2F0G A;  3BYY B;  1CE8 A;  2A19 A;  3JSN A;  3ULP A;  4XQN A;  1IYU A;  1G8Z D;  4IUT A;  4CMF A;  3R5X A;  4R9W A;  1VQ5 A;  2SDF A;  3DUZ A;  3NUC A;  2HGW A;  3UZO A;  5C0X H;  3X3M A;  1T36 A;  1EKF A;  1RF2 D;  5FLX L;  5LA6 F;  2R61 A;  2K33 A;  2VB3 X;  2WII B;  1LTL A;  5M5Y H;  3MJF A;  3ONA B;  3N8D A;  2YZM A;  1GSO A;  2MFI A;  1ESF A;  1SND A;  3I4M G;  1I1M A;  4EG0 A;  1SNP A;  1S40 A;  1PFB A;  2W6P A;  2ZTE A;  1EQT A;  1O80 A;  4HSV A;  4C3I H;  3MTS A;  1TXY A;  1PRT C;  1SYE A;  5FR9 A;  4C2M B;  1CQV A;  4BWG B;  3S15 B;  3GTP H;  1YIJ A;  4XTC S;  5C5L A;  3WWJ A;  2QW7 A;  5EPJ A;  1LTG D;  3KLS X;  3HOY H;  5JVG 3;  2ATW A;  1FVI A;  1NBW A;  1WTH A;  5KNC A;  3RD4 A;  5K2M A;  2W70 A;  3QB3 A;  5BYB A;  3M4Q A;  4OO1 I;  1PRT B;  1V9P A;  2SNS A;  3BAC A;  3ND8 A;  5M9O A;  2LSS A;  2R7F A;  4CGY B;  5IT9 L;  2VUG A;  2JE6 I;  2YW2 A;  2EIF A;  5I6W A;  1EWH A;  1TQO A;  2RDH A;  2O4X A;  3CSW A;  1YNJ C;  5CAE B;  3SK4 A;  1X65 A;  5C4X G;  4QCL A;  1I4G A;  1M1K C;  3DHQ A;  4JI7 Q;  2AQ1 B;  2QK4 A;  5T1G A;  1TY2 A;  4HJA A;  3DWP A;  4GLV B;  2EE1 A;  1Q46 A;  4O7L A;  4DAM A;  4A3E G;  2XNA C;  4LF5 L;  1B8A A;  2RHS B;  2RDG A;  3OYY A;  2ZXP A;  4JW0 A;  4JYA Q;  2UXB Q;  2YZG A;  4LF8 L;  5A2Q E;  1YHQ A;  4CC5 A;  4BY7 H;  3NQI A;  5KYI A;  5JEA G;  2EJF C;  4A3E B;  3VA5 A;  4N8F A;  2PI2 E;  3T56 B;  4E6N A;  4DR7 Q;  1K83 H;  3KLS A;  5EQ0 A;  5BYA A;  4ZKC B;  1KUT A;  3LGJ A;  1F2Y A;  2F0J A;  1ML0 D;  4NKL A;  4A3I H;  3U58 A;  1U0L A;  2D0O A;  5E7N A;  1Q1B A;  1BNC A;  4K14 A;  2W6M A;  4A3C G;  2R82 A;  4KK7 A;  3BDO A;  3GV6 A;  4A3F B;  4MV3 A;  5E4W C;  2NU8 B;  5CA1 F;  2R7D A;  1XWE A;  1JLL B;  3P20 A;  1YI2 A;  1STN A;  1N9W A;  5I5V A;  3IRB A;  2IHE A;  1VQC A;  2WKD A;  4ULL A;  3R8B A;  3S2H H;  2IP4 A;  3OWF A;  4DUY Q;  1QB5 D;  1WI5 A;  3RV3 A;  5C8Y F;  5CA0 F;  1SJH D;  2HT1 A;  5IGC A;  2ID0 A;  4C1N I;  3FVQ A;  4DR1 L;  4O7S A;  4KN7 C;  1N33 L;  1GUG A;  2K50 A;  3CPF A;  2L55 A;  3Q22 A;  2Y0S B;  2ZXO A;  2DN8 A;  2MP1 A;  5BR8 Q;  5FLM H;  1X56 A;  1EIH A;  2HVR A;  3P1H A;  1OTC A;  5M5X H;  3OSO A;  4MV8 A;  2LXJ A;  1VQP A;  4DFA A;  3KRE A;  4DV5 Q;  1R4P B;  4IOC A;  2RDF A;  3Q2O A;  1NMG A;  5LMN Q;  1M0T A;  2EYH A;  5I5T A;  3T9B A;  1SRU A;  2PVP A;  3T7A A;  5ELE A;  3NBZ B;  2WAQ E;  4LF6 Q;  2LKV A;  1WD1 A;  4A3D H;  1IYD A;  2GPS A;  3F2C A;  2TMP A;  4RCO A;  3UDX A;  1UWV A;  1W6J A;  3WOE A;  3CQZ B;  4JI8 Q;  1XNQ L;  1YHB A;  3I2Z A;  4OL7 A;  1Z2P X;  2HD3 A;  2YU9 H;  3H3V H;  4OX9 L;  1QG7 A;  3JAM i;  3MAQ A;  2ZDQ A;  2VQF L;  5C3E G;  3J80 E;  2HUG A;  2FIN B;  5KNB A;  3BZK A;  3CCL A;  1AUV A;  3T99 A;  1WTR A;  5I60 A;  1RHP A;  2Z9H A;  3IFD A;  2F0T A;  1KQS A;  3J81 i;  4CHI A;  4JOI C;  3Q0A A;  3I4L A;  4KLK A;  5JJZ A;  3R2T A;  2XD4 A;  3JAM E;  1XPO A;  1XK5 A;  3RZD H;  4IUQ A;  2PMZ E;  3S14 B;  1HZ9 A;  2E76 C;  3CC4 A;  4N9P A;  1XNR L;  1LT3 D;  4X66 L;  1I4R A;  1DM0 B;  4DV3 L;  2K04 A;  1IBK L;  3FDT A;  5JAV A;  3J81 E;  4L5Q A;  2KCN A;  4RWS C;  4KY7 A;  2XN9 C;  3DWA A;  4DV2 Q;  1K8G A;  1EYA A;  5KX5 F;  3ICE A;  3NHH A;  2K1B A;  3PIP 3;  2YTX A;  2NU6 B;  2MQH A;  4GOP A;  1AZQ A;  2IWH A;  3PO3 H;  2N88 A;  4XZ3 B;  3AMU A;  2X0S A;  2R84 A;  1PH1 A;  2E75 C;  1EZ1 A;  1KJQ A;  5AJ3 L;  5T1I A;  4A4I A;  3C46 A;  2K05 A;  1Q8I A;  5C3X A;  1JR0 D;  4O7N A;  4PZ7 A;  3L2P A;  1EYC A;  2ZXR A;  4ZAI A;  4OWT B;  1XMO L;  1PTO D;  4LF9 L;  4PV1 C;  1JWU D;  2JA7 B;  5JEA J;  3GTJ B;  1N32 Q;  4A3J B;  1SNO A;  2ASB A;  2R7M A;  4DV1 Q;  2ODT X;  1S5B D;  3MA2 B;  5BWT A;  1KNA A;  1B9M A;  3TQY A;  3VR3 A;  2MUY A;  2Z8L A;  3HOX H;  4MIU A;  2WB1 B;  5C44 G;  4O4I F;  1PH6 A;  3NP8 A;  3S16 B;  4QY7 A;  4O82 A;  5JJL A;  1SYF A;  5D1O B;  1JOO A;  4R4I A;  1HR0 W;  1AFP A;  4DUZ Q;  3EVQ A;  1VQJ A;  4JI0 Q;  4ILW A;  3SVM A;  4XYO A;  4IUR A;  1BBX C;  4MV1 A;  3T1H Q;  5E3F A;  4Y7N B;  4KI0 A;  1MJC A;  4CJ0 B;  2F0H A;  2EJ0 A;  2R7L A;  2NUC A;  2KED A;  5D8D A;  4L6T B;  5EPL A;  2WAQ G;  2NUA B;  2A6E D;  2UU9 L;  3OPO A;  2OXP A;  4TVA B;  2F0V A;  3UE0 A;  2E5L Q;  2OQ0 A;  1ENA A;  4P71 A;  2F0K A;  4LUV A;  2WP8 J;  3M7G A;  4A93 B;  1KC7 A;  4LUO A;  3D6C A;  3W5O A;  4C3H H;  5G3L F;  1JMC A;  5ELD A;  4NDX A;  2FP4 B;  2P5Z X;  2QGQ A;  1Y8O B;  3M3Y B;  3A0J A;  4XQJ A;  2F0I A;  2CW0 D;  4YWK A;  2F0W A;  4A3M G;  1K8A C;  5HUR A;  5EJW A;  1RD9 D;  3I90 A;  3T51 B;  2YYA A;  2BE5 D;  4JBW A;  4YBZ B;  4APV A;  1KAA A;  4DAY A;  4X62 Q;  4DR6 L;  4O7Z A;  2JA5 G;  2N49 A;  1K73 C;  3JAM c;  3V96 A;  2NVX B;  5M5W B;  2I87 A;  1FNV A;  2XWB B;  4YJ2 F;  2NN6 I;  4O4L F;  1KJ9 A;  4QSH A;  5I2X A;  4JBM A;  2FMM A;  1HFN A;  1WTO A;  5CBA E;  1YIT A;  3AW8 A;  2I5L X;  3A55 A;  2VR1 A;  1ENC A;  4P72 A;  2K52 A;  5EZY F;  2NVY H;  2WYO A;  1UE6 A;  1Y1W B;  2ABJ A;  3BZD B;  3NEL A;  3NTK A;  1DOK A;  3DMU A;  4G7Z C;  1HHV A;  4DGZ A;  2A68 D;  3DLL A;  1NCV A;  4R4Q A;  1TS3 A;  3T1Y L;  4K0K Q;  1LTS D;  1C0A A;  1E4E A;  1KLU D;  1GD7 A;  3H15 A;  3HKS A;  2Z6B A;  1P16 A;  4C2M H;  3GTP B;  3S15 H;  4HR7 A;  1I4P A;  3I73 A;  5H80 A;  2VB2 X;  1F2M A;  2HGS A;  1GGO A;  4OIJ A;  2CNV A;  5GAE C;  3BVZ A;  5ELF A;  1STA A;  5JH7 F;  1WJJ A;  2B2T A;  1KEE A;  3RLF A;  3PUZ A;  3CP0 A;  2K28 A;  2NVT B;  1NR2 A;  1B44 D;  2A5H A;  4B3S Q;  5C4J B;  4PQX A;  2IHF A;  1BCP C;  4AH6 A;  3ORR A;  4FFO A;  2J9G A;  3SK5 A;  1JE4 A;  1EKP A;  3M4Y A;  3QR8 A;  4L63 B;  3T9C A;  4DF7 A;  3IFT A;  1ZYR D;  2UUC Q;  4QQB X;  1KT8 A;  4O7V A;  1O7L A;  3M4P A;  4CC6 A;  5CV4 A;  2OWO A;  4HCE A;  1BCP B;  1UE5 A;  1EQQ A;  1ICF B;  4B9W A;  4RMF A;  4CKB A;  3HOZ G;  1STG A;  1JKJ B;  1NSN S;  2A1H A;  3RZO B;  4YAJ B;  4HTH A;  3HKZ E;  5IGB A;  4G57 A;  2B2Y C;  4A3E H;  2H5X A;  2AKW B;  2ZDH A;  3UQ8 A;  2KEN A;  3BG3 A;  5E1F A;  3GTG B;  4HCS A;  1PH8 A;  2VQE L;  3TRZ A;  1ILP A;  5JVL A;  5I2Y A;  5JEA H;  1F9P A;  2NB0 A;  3J7Z C;  2F0U A;  2EXZ A;  3NWT A;  3WWH A;  2JA6 G;  1SCU B;  4A3F H;  4BBR G;  2HHF A;  3CU7 A;  4H13 C;  2B63 B;  3HEJ A;  2FPI B;  2F03 A;  1PX2 A;  3G71 A;  1FNU A;  3T9F A;  2XSC A;  3MZ5 A;  5K5P A;  3U9T A;  4X64 Q;  3KDF B;  4QGU A;  1S3O A;  3S2H B;  2DJG C;  4KHP Q;  4Q5V A;  3DF7 A;  4O84 A;  3DEO A;  4ZRZ A;  1IKL A;  1CFM A;  1STE A;  2K03 A;  1PZJ D;  3JSL A;  2Z0S A;  5M3F B;  1B2T A;  4EX5 A;  2R93 G;  2I0Q A;  5CR3 A;  3AEV A;  5K3W A;  4DLK A;  1SMX A;  5FPR A;  1HZA A;  3K0X A;  2PNR C;  1D5Z C;  4XIG S;  5M3M G;  1HR0 Q;  3K5N A;  2EJM A;  4Q4C A;  1SLJ A;  1YJW A;  3K57 A;  5I4D A;  1BKB A;  4PMC A;  4YWM A;  3RUZ A;  1HNZ L;  3GTO B;  4BXX G;  1HPC A;  4ODG A;  2Q7D A;  2H4O A;  1KRS A;  1VCI A;  3E9I A;  4RHS A;  4DPG A;  1XJV A;  3VYR A;  4PZ8 A;  5KGU A;  3S2D H;  2SOB A;  2K5Q A;  2H1E A;  4BY1 B;  1I4H A;  4Q4D A;  3OWE B;  1OBD A;  3VYT A;  3IAY A;  3RLO A;  2GQR A;  3NEM A;  4FF3 A;  3CQZ H;  1B50 A;  2Q2T A;  4IHJ F;  1RL2 A;  5EAY A;  5BPF A;  4X6A H;  4O2B F;  4G7O C;  1ZAU A;  4CE5 A;  4JI7 L;  3KF6 A;  1EU3 A;  4QIW B;  1KJ8 A;  4POF A;  2RCN A;  1JOR A;  4K6L A;  2YRX A;  1KDC A;  1D2B A;  1Y8N B;  3CW2 C;  1N8R C;  1F77 A;  3TII A;  1LM0 A;  4JYA L;  2UXB L;  2DAB A;  2E2I B;  4DXF A;  2J7Z A;  2PW5 A;  4PG3 A;  2EY1 A;  2B2U C;  3PUY A;  4AYB B;  1H95 A;  4IZ8 A;  1V1P B;  4DR7 L;  1I7N A;  3HKZ G;  3S14 H;  3A5U A;  1FNW A;  3HOW G;  4OEM B;  3LWU A;  2O5J C;  1G2T A;  4JI6 L;  1M8A A;  2A1A A;  2VW9 A;  3VPB A;  4R8N A;  3O13 A;  3U0G A;  2VNU D;  4NYE A;  3NTH A;  2A6H D;  5CV7 A;  4EEQ A;  5CBE E;  3JRX A;  2VUM G;  1EY4 A;  1U4R A;  2VS1 A;  4I7Z C;  5GAH C;  1HNX Q;  2Z04 A;  4I50 F;  3CCJ A;  2HGX A;  4IO9 A;  3S1Q B;  5JPM C;  1UE7 A;  2TSS A;  2Q8I B;  3U50 C;  5BWW A;  2V58 A;  1CI3 M;  1D5M C;  3AFQ A;  2VUM B;  4UCS A;  3ZYY X;  3C1F A;  5CGK A;  5DM6 3;  3CD6 A;  4F88 A;  2NBF A;  3L7Z C;  4BBS B;  3TSS A;  3OW2 A;  3S17 B;  3GTL B;  1X3E A;  3Q8D A;  4F87 A;  4ZHQ F;  2JA7 H;  3GTJ H;  2EY5 A;  4KTA A;  4X3K A;  5LMU Q;  5FK9 C;  1PH4 A;  3UE1 A;  2R92 G;  2QEJ C;  1DV1 A;  2HCI A;  3HOX B;  5BR8 L;  2ZJP A;  5LXT F;  3VR4 A;  1ZEQ X;  4JI3 L;  5C3W A;  2NZ1 D;  4GNX C;  2PZT A;  4HSP A;  1BDO A;  3S16 H;  1RIP A;  4NB3 A;  1II3 A;  1EY5 A;  3I72 A;  5CV9 A;  1SNM A;  1CSP A;  5LMN L;  5BN4 A;  1OXT A;  2PYK A;  4ZUI A;  1QUQ A;  3HOV B;  2IT1 A;  2XCL A;  4Y7N H;  1KD1 C;  1CM9 A;  2EY2 A;  2DAA A;  1J5E Q;  2B2V C;  4CJ1 B;  3PIO 3;  2E2H B;  1PH5 A;  4JI8 L;  2JP1 A;  4IN3 A;  3CC2 A;  5HBR B;  1ASY A;  1B70 B;  3HBL A;  3L3O C;  2GVA A;  1Q86 C;  1L2F A;  2W6N A;  2VQE Q;  1IHZ A;  1JWM D;  5CE8 A;  4A93 H;  3MXN A;  4C3H B;  1SE4 A;  3NBH B;  3UYY A;  1E7Z A;  1DIK A;  1EY6 A;  2YYZ A;  1IW7 C;  5JPN C;  2E74 C;  3PO2 G;  4FGR A;  3M3Y H;  3CF5 A;  2ZTD A;  4BA1 I;  5GRO A;  1QWY A;  1X32 A;  1UEA B;  3LWB A;  3TP8 A;  1V8Q A;  2PO4 A;  1KTA A;  2FPP B;  3BAB A;  3CCR A;  1K9M C;  2D5D A;  3K59 A;  4QUC A;  1Y1V B;  1ONL A;  2RKS A;  4EVO A;  2NVX H;  2NU7 B;  5M5W H;  1CHP D;  3DXJ C;  5FKA C;  3L9A X;  3U4Z A;  2NTT A;  2KHJ A;  2R86 A;  4C5B A;  3F2D A;  4B3R Q;  1ET0 A;  3K0Y A;  3LP8 A;  5BWV A;  1PDQ A;  5HGT A;  3CCE A;  1TS5 A;  4P74 A;  4HIM A;  5L37 A;  1CA5 A;  4DV2 L;  3I91 A;  5KKN B;  4C1N K;  1IOV A;  2Z6K C;  1EUJ A;  2NVY B;  2WAC A;  4IPD A;  1BO0 A;  2QCP X;  3AX6 A;  1Y1W H;  3HS0 C;  2KEC A;  3DWQ A;  5DIS C;  5I5U A;  3I4M B;  1FR3 A;  3QG1 A;  4AQY L;  1SEB D;  4HMJ A;  1HNZ Q;  4HJ8 A;  2QDB A;  1SNQ A;  4U67 3;  2EJ2 A;  2Z4H A;  4HJ5 A;  1HRJ A;  4YB8 B;  3I4N G;  3T54 A;  5I5W A;  3I12 A;  3GTQ B;  2JK8 A;  1EFW A;  5I5Y A;  3W3A A;  3MXP A;  1C4Q A;  1N32 L;  2XGT A;  1GSA A;  4DV1 L;  5ELC A;  4FNF A;  2B8G A;  1LTT D;  2NVT H;  2O5I C;  1A6X A;  1C3O A;  1RTO A;  5C4J H;  1M0W A;  5GAD C;  3C3L A;  1OBG A;  1E22 A;  1BNZ A;  1EKV A;  2AHO B;  3CCU A;  2F0Q A;  2CFM A;  3OTO Q;  3FP9 A;  2EZV A;  1SYC A;  4NP5 A;  2VL6 A;  1DOM A;  5JVD F;  2RVL A;  1C30 A;  1RCV D;  5IYD G;  4DUZ L;  2MNA A;  3FKI G;  3PQI A;  4JI0 L;  1OXV A;  5IP7 G;  4K8I A;  1SYD A;  1FJG Q;  3OUZ A;  1EZ6 A;  4OGQ C;  1GUS A;  5C4X B;  1I3Q B;  2RHQ B;  4I4T F;  3T1H L;  1QCB D;  2KA7 A;  1R9T B;  1VQK A;  4ZUJ A;  4B3T Q;  1B04 A;  1I1K A;  3BZC A;  5GON F;  1Z2O X;  1HA5 A;  2VXW A;  1F9R A;  2CVR A;  4H02 A;  1EWI A;  1FGB D;  3RZO H;  4TV8 F;  4DIM A;  1V1Q A;  3V4S A;  2MHV A;  3VA7 A;  5FJ8 G;  1VQO A;  3E3X A;  2E5L L;  1W3S A;  4JVZ A;  3GTG H;  4DR3 Q;  2HQL A;  4TV9 F;  1HH2 P;  5CB4 F;  2JSO A;  4JI4 Q;  1NE3 A;  1X6O A;  1B3A A;  2YTY A;  5EGT A;  4WJW A;  4X65 Q;  4NZO A;  4JI6 Q;  3MC0 B;  3BA8 A;  3PUV A;  3VMM A;  1HQR D;  3OIQ A;  4EQO A;  1MKH A;  2X6L A;  2HDM A;  3D4W A;  5A2Q L;  3HG9 A;  3TN2 A;  2W6Z A;  1IXR A;  4IFD G;  2R7Z G;  2B63 H;  3R5H A;  1U9R A;  4X62 L;  2BDO A;  1I94 Q;  4IIJ F;  3ETJ A;  2YV5 A;  3LX0 A;  4DNT B;  4UAI A;  3HP3 A;  4QL5 A;  1IYV A;  3CEB A;  1VKZ A;  2DY8 A;  4RG1 A;  1YJ9 A;  5DMX A;  1KL9 A;  1B4O A;  4MNO A;  2JEA I;  2AWO A;  4UHV A;  5FLX c;  4ZKB B;  5IP9 H;  5C6A A;  3QWN A;  3GDE A;  4X3T A;  3W1B A;  5HY6 A;  5M3F H;  1Z6H A;  2HIX A;  3CAM A;  1JT8 A;  1EY8 A;  3BJU A;  1D1K A;  1VMC A;  1PK8 A;  4XXE A;  1YNN C;  4GN4 B;  4CDE C;  1DCZ A;  1C7Y A;  3MEH A;  3ERQ A;  4TVI A;  3OOC A;  2N55 A;  4JI3 Q;  2W6O A;  3IKJ A;  1SMY D;  3K80 C;  1KAW A;  4JI1 Q;  1CZW A;  1PTO F;  4OWW B;  5GQO A;  4K0K L;  1SNC A;  2WV6 D;  5DLQ E;  3GTO H;  1E1O A;  1H9S B;  3J7A F;  2F0S A;  3I3C A;  3G6J B;  1JDB B;  3S2D B;  2IL8 A;  2L5T A;  3NUA A;  5FO9 B;  1H9K A;  3CRK C;  1AZP A;  1UAP A;  3I70 A;  4BY1 H;  2VZA A;  1LTI D;  3EBE A;  2YL2 A;  2AQ3 B;  2J4X A;  4DV6 L;  5EBD A;  3H91 A;  4G7H C;  3MVV A;  4B3S L;  1I2L A;  1GO3 E;  5KIX A;  3EQL C;  1Z2N X;  4H44 C;  1T5E A;  4RKL A;  5COY A;  1DOL A;  2OLS A;  5K36 G;  4JCV E;  1CA6 A;  4MV4 A;  3TEK A;  2UUC L;  3RN5 A;  1EWC A;  2NTS A;  2EYP A;  4LK1 C;  1IZ6 A;  2E2J H;  3H94 A;  1WTV A;  3GP7 A;  5C3E B;  1HNW Q;  2E2D C;  1WOC A;  3K7U C;  3STB C;  2E2I H;  3RNU A;  1K0S A;  4UCU A;  2YRW A;  1K3R A;  4A3G G;  4DV4 L;  1Q7Y C;  5JQW A;  3G48 A;  1Q90 A;  4K5W A;  3J80 L;  2NN6 H;  1HUM A;  1VQM A;  2ES2 A;  4TRD A;  2AWN A;  3HO8 A;  2W6Q A;  3MFG A;  5J2U F;  2FPG B;  1BF4 A;  1D7Q A;  3B6Y A;  5LL6 X;  1IOW A;  3EA6 A;  1GM5 A;  1DJR D;  3JRW A;  1QIL A;  4J6H A;  2A69 C;  4QJF A;  3T16 A;  5H1S E;  4X3U A;  5KYL A;  4RFB A;  3HOW H;  2D9U A;  3NQT A;  4CDC C;  2CZG A;  5IGF A;  1X3F A;  3S1Q H;  4X64 L;  1NNX A;  2PW7 A;  4O7W A;  2B3G A;  1HA6 A;  4AQY Q;  3KAL A;  5I5S A;  5C1P A;  2L9H A;  3WWV A;  2UUB Q;  2VUM H;  4KHP L;  3J81 L;  1S68 A;  4FFR A;  1D5X C;  3Q6S A;  1HUN A;  3G8D A;  1DON A;  4BBS H;  3CPW A;  4JBK A;  3S17 H;  4IJL A;  3GTL H;  2Q8T A;  3N52 A;  2L15 A;  2KCT A;  3E0E A;  1KDA A;  2CQO A;  1GKH A;  1FD7 D;  1CKN B;  1X3Q A;  3TRE A;  1KC8 C;  3HOU G;  1I7L A;  1YVC A;  1HR0 L;  2RA4 A;  4HID A;  2NWG A;  1STB A;  3T9D A;  2R87 A;  4IWX A;  2I07 B;  2JA8 G;  3DTF A;  4FFP A;  4RGT A;  1NAP A;  1JCK B;  5D1O A;  4XT3 B;  4KKU A;  1LTR D;  5I9P A;  4A3K G;  4WHX A;  2F4I A;  4FDB A;  5C44 B;  4IFD J;  5CV8 A;  1EQV A;  2IX0 A;  4WJ4 A;  3HOV H;  1QVF A;  2AMC B;  1N36 Q;  2D2C C;  3GD7 A;  2NU9 B;  2CHB D;  4KY5 A;  3PSI A;  2E2H H;  4YCU A;  1VQ4 A;  2HDL A;  2PPB C;  1A3G A;  1O7Y A;  1QVC A;  1MD2 D;  5E4X A;  3TY9 A;  1EOV A;  2F1M A;  1MBY A;  2VY3 A;  2EYJ A;  5D3I B;  4FF2 A;  4PMB A;  4L1K A;  5C1O A;  4J1M A;  4FE2 A;  1B6S A;  4O7Y A;  4A3B G;  4YY3 Q;  2WAQ B;  1X3G A;  4I55 F;  4Y8V B;  2XVS A;  3T4A C;  3FMC A;  3TDQ A;  1AH9 A;  1YEZ A;  3E5S A;  4BS9 A;  3NXW A;  1WCM G;  4GKK Q;  5ELO A;  4J8Q A;  3BVM A;  2L11 A;  4DRF A;  4BA2 I;  4A3L H;  1BBU A;  1I4X A;  2ENB A;  2RSO A;  3LWE A;  5BWR A;  1EU4 A;  2XRS D;  1PYW D;  1VS0 A;  2OEO A;  4U68 A;  3ZJY C;  5JOB A;  2BA0 A;  1IBM Q;  1Y1V H;  4QMG A;  1A3T A;  5ELB A;  3UDI A;  2Q2U A; 
#chains in the Genus database with same CATH homology
 1PYS B;  1KRS A;  1VCI A;  3E9I A;  2A19 A;  4DPG A;  1XJV A;  3JSN A;  2OQK A;  1HZB A;  3ULP A;  4PZ8 A;  3L0O A;  1KRT A;  3S2D H;  5IT9 c;  1XMQ Q;  3RN2 A;  1U5K A;  2QA4 A;  1VQ5 A;  3ULJ A;  2UUA L;  3PN1 A;  4UCT A;  3RLO A;  3NEM A;  4GS3 A;  4Y52 H;  1JJG A;  3CCQ A;  5C0X G;  3J80 i;  3CQZ H;  2Q2T A;  1RL2 A;  4B3M Q;  4NPS A;  4OWX B;  5EAY A;  4X6A H;  5M5Y H;  1LTL A;  1SRO A;  4P73 A;  4DR2 Q;  1HNX L;  4NXM Q;  2MFI A;  4JI7 L;  3KF6 A;  3I4M H;  3I4M G;  3BU2 A;  1ASZ A;  4POF A;  4HIK A;  2RCN A;  2F4V Q;  4LF4 L;  1PH9 A;  1S40 A;  1JE5 A;  1N8R C;  3CW2 C;  1WYD A;  2ZTE A;  1LM0 A;  4JYA L;  2UXB L;  4LFC L;  4DV7 Q;  4C3I H;  1Q8K A;  3BA9 A;  3RTX A;  4JOI A;  1TXY A;  3GTQ H;  4PG3 A;  3PUY A;  2ZM6 Q;  1H95 A;  1PYB A;  5LMU L;  4XTC S;  1YIJ A;  3GTP H;  3KFU A;  4DV6 Q;  3D31 A;  4DR7 L;  3HOY H;  3HOY G;  1VQG A;  3HKZ G;  5IY0 A;  4LF7 L;  1QVG A;  1FVI A;  1NBW A;  3A5U A;  2K5V A;  3AFP A;  2ATW A;  3HOW G;  3I4N H;  1NY4 A;  3M4Q A;  4JI6 L;  2A1A A;  2VW9 A;  1T9H A;  2PI2 A;  1E24 A;  2UUA Q;  3BAA A;  4OO1 I;  3KF8 B;  2N8N A;  1V9P A;  2V1C C;  2VNU D;  4GOP C;  2LSS A;  2R7F A;  2VUG A;  2JE6 I;  2EIF A;  4EEQ A;  5IYC G;  1J6Q A;  1YNX A;  3AYH B;  3UDF A;  1VQB A;  1X65 A;  5C4X H;  4J15 A;  2VS1 A;  1N34 L;  1I3Q H;  2VUM G;  3K8A A;  5GAH C;  1HNX Q;  5C4X G;  1M1K C;  1R9T H;  1MIU A;  1WFQ A;  3CCJ A;  4IO9 A;  2HIV A;  4JI7 Q;  1UE7 A;  1J5E L;  3CC7 A;  3U50 C;  3MEF A;  1VQL A;  4HJA A;  3FKI H;  4GLV B;  3W1G A;  4GOP B;  3QWU A;  3CME A;  1Q46 A;  3AFQ A;  4IJH A;  4LF4 Q;  1GVP A;  5JJI A;  4DV4 Q;  4YCW A;  1G6P A;  4DAM A;  4A3E G;  4UCS A;  4IPC A;  5IYB G;  4LF5 L;  1B8A A;  4NXN L;  3CD6 A;  2RHS B;  3OYY A;  4JYA Q;  3L7Z C;  4LFC Q;  3OW2 A;  3KJP A;  1CKN A;  4LF8 L;  2OTJ A;  2UXB Q;  2NZH A;  1X3E A;  3Q8D A;  4YCV A;  1YHQ A;  4CC5 A;  4BY7 H;  4BY7 G;  3RLN A;  2JA7 G;  5JEA G;  2PNH A;  2JA7 H;  3GTJ H;  4OO1 G;  4A3J G;  5FJ8 H;  5LMU Q;  3NC0 B;  2PI2 E;  4E6N A;  5GAG C;  1PH4 A;  2R92 H;  3UE1 A;  1K83 H;  3PIP A;  2MO1 A;  2R92 G;  4DR7 Q;  4LF7 Q;  1PH7 A;  5BR8 L;  2ZJP A;  4JI3 L;  3LGJ A;  3UDG A;  2WB1 G;  1PFS A;  1HZC A;  4GNX C;  4A3I H;  4A3I G;  1A0I A;  3U58 A;  2DGY A;  3S16 H;  1S72 A;  1U0L A;  1RIP A;  1IYJ B;  1Q1B A;  2D0O A;  2XTI A;  4NB3 A;  5E7N A;  3PF5 A;  4A3C G;  4A3C H;  1QZH A;  1CSP A;  2Q2H A;  3A5Z B;  1AE3 A;  5LMN L;  1X55 A;  4R4O A;  4ALP A;  3KDF A;  1OXT A;  4OXP A;  1N34 Q;  2R7D A;  1QUQ A;  1PH3 A;  4B3R L;  2IT1 A;  3FHW A;  1YI2 A;  4Y7N H;  1K0R A;  1KD1 C;  4POG A;  3VNN A;  5D1P A;  4YHH L;  1J5E Q;  1N9W A;  3IRB A;  2IHE A;  1VQC A;  1Y14 B;  1VQA A;  1PH5 A;  2ZJR A;  4JI8 L;  2OCE A;  3CC2 A;  3S2H H;  1ASY A;  1B70 B;  4EFB A;  4DUY Q;  2GVA A;  4LF5 Q;  1WI5 A;  1L2F A;  4O0A A;  1Q86 C;  4NXN Q;  2HT1 A;  4YWL A;  2VQE Q;  1VQ9 A;  2ID0 A;  4LF8 Q;  4A93 H;  4A93 G;  4DR1 L;  3NBH B;  1E7Z A;  1N33 L;  3F8T A;  2YYZ A;  2NZO A;  3J81 j;  1G51 A;  2K50 A;  3CPF A;  3PO2 H;  3PO2 G;  3F2B A;  3M3Y H;  2CCZ A;  3CF5 A;  3KYH C;  2ZTD A;  4R1J A;  4BA1 I;  3CCM A;  5GRO A;  3H3V I;  3G4S A;  4DV0 L;  5BR8 Q;  5FLM H;  1X56 A;  3U4V A;  5FLM G;  3J80 c;  2HVR A;  1OTC A;  5M5X H;  3BAB A;  3CCR A;  3M7N A;  1D8L A;  1K9M C;  4JI2 L;  3RR5 A;  2LXJ A;  3EIV A;  3NEN A;  1VQP A;  4DV5 Q;  3M85 A;  4IOC A;  2NVX H;  5M5W H;  1NMG A;  5LMN Q;  3AQQ A;  3U4Z A;  1SRU A;  2KHJ A;  4DAY B;  4JI5 L;  3NBZ B;  1Q12 A;  2D0P A;  3F2D A;  3D0F A;  4B3R Q;  2WAQ E;  4LF6 Q;  4A3D H;  3CCE A;  4A3D G;  3F2C A;  3UDX A;  1VQD A;  3OTO L;  1UWV A;  4P74 A;  4HIM A;  1FL0 A;  5J3B A;  4DV2 L;  4JI8 Q;  5C0X J;  1FGU A;  1XNQ L;  3TS2 A;  1YHB A;  2PQA B;  2F52 A;  1EUJ A;  2Z6K C;  1XTD A;  3I2Z A;  4GN3 B;  4UFZ A;  4IPD A;  1TWH H;  2E8G A;  1KHI A;  1UEB A;  1FJG L;  2YU9 H;  3H3V H;  1Y1W H;  1Y1W G;  4OX9 L;  3JAM i;  3TY8 A;  1Q1E A;  3A74 A;  1VQH A;  3J81 c;  4B3T L;  3GTK H;  1BVS A;  2VQF L;  4DR1 Q;  3PCO B;  1E1T A;  4IPH A;  5C3E G;  1CSQ A;  5C3E H;  3PUX A;  5DIS C;  2JJQ A;  2Q2I A;  3BZK A;  4AQY L;  3CCL A;  1N33 Q;  3PUW A;  1VQ7 A;  1HNZ Q;  4HJ8 A;  1PV4 A;  3CXC A;  1KQS A;  2FXQ A;  3J81 i;  3CCS A;  4DV0 Q;  4JOI C;  4HJ5 A;  4DR3 L;  3PF4 A;  4TQU S;  4JI4 L;  4GKJ L;  4KLK A;  3I4N G;  5JJK A;  2CKZ B;  4JI2 Q;  2JK8 A;  4X65 L;  1EFW A;  2BH8 A;  4UCV A;  1N32 L;  1XPO A;  2XGT A;  4DV1 L;  1L1O C;  2RF4 A;  2NVT H;  1XK5 A;  3JC6 6;  2CWA A;  3F1Z A;  3RZD H;  1LYL A;  4HJ9 A;  1OXS C;  2PMZ E;  2HVQ A;  5C4J H;  1HZ9 A;  2UXC L;  3EN2 A;  5GAD C;  3CC4 A;  1XNR L;  1E22 A;  4X66 L;  2AHO B;  1SR3 A;  2K5H A;  2CFM A;  4ME3 A;  4L5T A;  4QIW E;  3CCU A;  4DV3 L;  1JB7 A;  3OTO Q;  3FP9 A;  1IBK L;  4DK6 C;  4L5Q A;  2K5N A;  1EIY B;  2VL6 A;  4DV2 Q;  1K8G A;  1I94 L;  1YHA A;  1XNQ Q;  1L1O B;  5IYD G;  4DUZ L;  3ICE A;  5IYD H;  2MNA A;  3FKI G;  4JI0 L;  3TS0 A;  1OXV A;  5IP7 H;  5IP7 G;  2YTX A;  3TY5 A;  2MQH A;  4GOP A;  1FJG Q;  3PO3 G;  3PO3 H;  4IFD I;  1CKM A;  4OX9 Q;  2GN5 A;  1I50 H;  2RHQ B;  3T1H L;  2I5M X;  1VQK A;  1B04 A;  4B3T Q;  5FPO A;  2VQF Q;  2ZJQ A;  3BZC A;  1PH1 A;  4AYB E;  4DR4 L;  5AJ3 L;  1TA8 A;  2EQS A;  1C9O A;  4H02 A;  1EWI A;  3RZO H;  2JQO A;  4A4I A;  1V43 A;  3ER0 A;  4DNI A;  5IE8 A;  4A75 A;  1V1Q A;  5FJ8 G;  3GJX B;  4PZ7 A;  1VQO A;  3L2P A;  2E5L L;  1W3S A;  1L0W A;  3GTG H;  4DR3 Q;  2HQL A;  1HH2 P;  4OWT B;  1XMO L;  4PMW A;  1NE3 A;  1X6O A;  2YTY A;  4JI4 Q;  4LF9 L;  4GKJ Q;  4LH6 A;  4X65 Q;  4JI6 Q;  4UCO A;  4JI1 L;  3CCV A;  1IBL L;  3PUV A;  5JEA J;  3BA8 A;  1N32 Q;  2ASB A;  1MKH A;  4DV1 Q;  3NBY B;  1PA6 A;  2I5H A;  3TQY A;  3KLW A;  1I6H H;  3HOX H;  1IXR A;  1IL2 A;  2D62 A;  1XNR Q;  4IFD G;  1A63 A;  3E9H A;  4X66 Q;  5C44 G;  5C44 H;  4DV3 Q;  1PH6 A;  2K14 A;  2B63 H;  3ULL A;  2B63 G;  2R7Z H;  2R7Z G;  2GVB A;  4QY7 A;  1IBK Q;  4JV5 L;  4GNX B;  4A76 A;  4X62 L;  5JJL A;  5D1O B;  4R4I A;  1I94 Q;  1VQN A;  3DM3 A;  1HR0 W;  4LFB L;  4DUZ Q;  4UP7 A;  2YV5 A;  1XPU A;  3I55 A;  4QL5 A;  1VQJ A;  4JI0 Q;  1EQR A;  2YTV A;  4RG1 A;  1YJ9 A;  1KL9 A;  2JA9 A;  4MNO A;  3T1H Q;  1Q82 C;  4MZ9 A;  4KI0 A;  2AWO A;  2JEA I;  5FLX c;  4LFA L;  1MJC A;  1VQ8 A;  4DR4 Q;  5IP9 H;  5IP9 G;  5AJ3 Q;  3GDE A;  2IY5 B;  1Z47 A;  3W1B A;  5HY6 A;  4DKA C;  5M3F H;  5M3F G;  2WAQ G;  2HIX A;  2UU9 L;  3CAM A;  2C35 B;  1JT8 A;  3BJU A;  4TVA B;  1O7I A;  2ALY B;  4GN4 B;  2BA1 A;  3J7A 5;  3UE0 A;  2E5L Q;  4LNQ A;  2OQ0 A;  2KCM A;  1C7Y A;  4P71 A;  1LUZ A;  1XMO Q;  4LUV A;  2WP8 J;  4LF9 Q;  4A3B H;  4LUO A;  3W5O A;  4C3H H;  4HJ7 A;  4JI3 Q;  1HNW L;  1HJP A;  3K80 C;  1BBW A;  1KAW A;  4JI1 Q;  4R4C A;  5HGQ A;  1JMC A;  4GLX A;  4WJ3 M;  2F4V L;  4OWW B;  5GQO A;  4K0K L;  1CUK A;  2QGQ A;  3H0G H;  5DLQ E;  4GLA C;  1E1O A;  4OON A;  3GTO H;  3A0J A;  1W2B A;  2HVS A;  4UP8 A;  2N3S A;  1PH2 A;  4YWK A;  4A3M G;  4A3M H;  3K81 C;  3PGZ A;  3ERS X;  1K8A C;  4MTN A;  1TAE A;  1SN8 A;  3GO5 A;  4JV5 Q;  1XDN A;  4JBW A;  4BY1 H;  4BY1 G;  4APV A;  4X62 Q;  4DR6 L;  2VZA A;  1PVO A;  2JA5 H;  4YHH Q;  2N49 A;  2JA5 G;  1K73 C;  3EBE A;  3PIO A;  3JAM c;  4LFB Q;  4UY8 C;  1E3P A;  3G6E A;  2CWP A;  3HFZ B;  4P75 A;  4UP9 A;  4DV6 L;  1AE2 A;  2NN6 I;  4B3S L;  1GO3 E;  3K7A H;  4JBM A;  2PQA A;  1VQE A;  4LFA Q;  3KJO A;  5K36 G;  4JCV E;  1YIT A;  3S1R H;  2I5L X;  1TWF H;  2UUC L;  3RN5 A;  2Y0S E;  2UU9 Q;  4P72 A;  2K52 A;  2NVY H;  3STB D;  1OXU A;  1JJC B;  2QEX A;  1UE6 A;  4LW1 A;  2UUB L;  3S1N H;  4UCR A;  1TWG H;  1IZ6 A;  3KOJ A;  3I56 A;  2E2J H;  2Z6K A;  3NEL A;  1A8V A;  3KF6 B;  1EIF A;  1MJE A;  4HIO A;  3DLL A;  1HNW Q;  1WOC A;  3K7U C;  2JEB I;  3STB C;  3RNU A;  1SFO H;  2E2I H;  4GKK Q;  4R4Q A;  4UCU A;  3T1Y L;  4K0K Q;  1C0A A;  1K3R A;  1DGS A;  4A3G H;  1GD7 A;  3H15 A;  3HKS A;  4DV4 L;  4AYB G;  1Q7Y C;  4A3G G;  1KIX A;  1P16 A;  3G48 A;  4C2M H;  3S15 H;  4JC0 A;  2NN6 G;  2KHI A;  1VQM A;  2ES2 A;  2AWN A;  4LUZ A;  4JI5 Q;  1YZ6 A;  2K75 A;  4KHZ A;  5GAE C;  1NTG A;  2MO0 A;  4DK3 C;  1P8L A;  4DR6 Q;  4AIM A;  1EYG A;  2B29 A;  3B6Y A;  1D7Q A;  1GM5 A;  1WJJ A;  3RLF A;  3PUZ A;  3CP0 A;  4DR5 L;  1TWC H;  4QJF A;  5ELN A;  4B3S Q;  1VQ6 A;  1Z9F A;  5H1S E;  3S24 A;  3GB8 B;  2IHF A;  1L1O A;  4AH6 A;  3HOW H;  1JJ2 A;  3M9B A;  1N36 L;  1X3F A;  3S1Q H;  4QQB X;  2UUC Q;  2WFW A;  4X64 L;  3M4P A;  3M4O H;  2B3G A;  4CC6 A;  4AQY Q;  5IYC H;  3WWV A;  2UUB Q;  2OWO A;  2VUM H;  4KHP L;  1UE5 A;  1VQI A;  1S68 A;  1NMF A;  1EQQ A;  3SGI A;  2UXD L;  1B7Y B;  4RMF A;  1XPR A;  3HOZ H;  3HOZ G;  4BBS H;  3CPW A;  4O2D A;  4JBK A;  4BBS G;  3S17 H;  4IJL A;  2HHH L;  3T1Y Q;  3GTL H;  4YY3 L;  2L15 A;  1Q81 C;  2KCT A;  3VDY A;  1M90 C;  3HKZ E;  4LWC A;  3E0E A;  2BH2 A;  2CQO A;  2F3I A;  2H5X A;  2AKW B;  4A3E H;  1GKH A;  1X9N A;  4EFE A;  5IYB H;  3UQ8 A;  2KEN A;  4DUY L;  1CKN B;  3TRE A;  1KC8 C;  2NVQ H;  1QZG A;  4JBJ A;  3GTM H;  3HOU H;  3HOU G;  1YVC A;  1PH8 A;  2VQE L;  4HID A;  1HR0 L;  3TRZ A;  4GKK L;  2UXC Q;  3I4O A;  3HOX G;  5IWA L;  4L5S A;  2JA8 H;  2JA8 G;  3J7Z C;  4A3J H;  2LXK A;  4DR5 Q;  1IBM L;  4GNX A;  2JA6 H;  2JA6 G;  2DUD A;  5D1O A;  4UPA A;  1YBY A;  1TWA H;  4JG2 A;  2ZTC A;  3TEH B;  4BBR G;  4BBR H;  4A3F G;  4FDB A;  4A3F H;  4A3K H;  4A3K G;  1PHJ A;  1VQF A;  1I5F A;  2K4K A;  4IFD J;  2IX0 A;  1XMQ L;  3S14 H;  4WJ4 A;  3HOV H;  3HOV G;  1QVF A;  2AMC B;  1N36 Q;  1X54 A;  4PZ6 A;  1A62 A;  3G71 A;  3GD7 A;  4IPG A;  4DV5 L;  4X64 Q;  3KDF B;  4L5R C;  4R4T A;  3PSI A;  2E2H H;  4YCU A;  1VQ4 A;  4QGU A;  1QUQ B;  1S3O A;  1QVC A;  1OXX K;  4KHP Q;  2IX1 A;  3TY9 A;  4B3M L;  1EOV A;  2VY3 A;  4LF6 L;  2OTL A;  2A8V A;  2UXD Q;  4LH7 A;  4C3J H;  2EXD A;  4DR2 L;  2N78 A;  4NXM L;  5LMN W;  3JSL A;  2HHH Q;  2Z0S A;  4A3B G;  4EX5 A;  1UE1 A;  4YY3 Q;  3CMA A;  2R93 H;  1X3G A;  2R93 G;  1IBL Q;  2I0Q A;  5C0X I;  3AEV A;  1SE8 A;  1SMX A;  1AH9 A;  1YEZ A;  2WB1 E;  3H0G G;  5FPR A;  1WCM H;  1HZA A;  1WCM G;  2KBN A;  3K0X A;  4GN5 A;  2Y0S G;  3MXN B;  3PV0 A;  4XIG S;  5ELO A;  5M3M H;  5M3M G;  3I7F A;  1YJN A;  1HR0 Q;  4BA2 I;  4EQ5 A;  3S1M H;  4A3L G;  1BBU A;  4A3L H;  4DRF A;  5IWA Q;  1G29 1;  1SLJ A;  1YJW A;  4IOA A;  4DV7 L;  1CKO A;  1VS0 A;  3ZJY C;  1BKB A;  4YWM A;  1KXL A;  2BA0 A;  1NJI C;  1HNZ L;  1Y1V H;  1Y1V G;  3UDI A;  1IBM Q;  2ZM6 L;  2Q2U A;  4BXX G;  4BXX H;  2R6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...