3S24A

Crystal structure of human mrna guanylyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
336
structure length
328
Chain Sequence
GAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the guanylyltransferase domain of human mRNA capping enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transferase
molecule keywords mRNA-capping enzyme
total genus 70
structure length 328
sequence length 336
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 2.7.7.50: mRNA guanylyltransferase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain
A PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s24A03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3s24A01
4.10.87.10 Few Secondary Structures Irregular mRNA Capping Enzyme; Chain mRNA Capping Enzyme; domain 3 3s24A02
4HIDA 1BKBA 1RIPA 4A3EG 2H5XA 2KBNA 3CCEA 1W2BA 4DV4L 1HNZQ 1ASYA 4KHZA 5BR8Q 4HIKA 1VCIA 1IBML 1X3EA 4YCVA 2R92G 3H0GG 3L0OA 1PFSA 5GADC 1XNQL 1TWCH 2MO1A 2B63H 1UE5A 4DUYQ 4A3GG 4L5QA 5ELOA 4A3IH 5IYBG 5FPRA 3ER0A 1AE2A 4DAMA 1VQ4A 3HOVG 3K7UC 4C3HH 1QVFA 4BBSH 4ME3A 3U50C 5HY6A 5D1OA 1XNRL 4APVA 3F2CA 3CCSA 2UXDL 1UE1A 5M5YH 4JI4Q 1N8RC 1Q1BA 2F52A 3J7A5 3VDYA 1S40A 4UP7A 3EBEA 3TQYA 2VL6A 5LMUL 4IPGA 3GTJH 3S14H 1K0RA 3S24A 4JI7Q 1L1OC 4DV3Q 2XTIA 4GOPC 4KI0A 3TREA 4C3IH 3M85A 1VQLA 2YU9H 4LFCQ 4JI1L 4R4CA 1FJGQ 4UPAA 3S2DH 1VQCA 1LYLA 1XK5A 1XTDA 1NE3A 1IBMQ 1CKMA 3GDEA 4LWCA 1HNZL 1VQMA 1KC8C 4LF4L 1IBLL 4GNXC 3HOUH 4A3DG 1HZ9A 4B3RQ 2WP8J 4UY8C 3BA9A 3RNUA 2Z6KC 2I5MX 4JYAL 1SRUA 3GTPH 4BBSG 2Q2TA 1A0IA 3TY5A 4DR6Q 5C4JH 4HJ7A 1NMFA 4HIOA 5M3FH 4EX5A 1VQPA 1CSPA 3STBC 3HOYG 1CSQA 5EAYA 4UP9A 1N34Q 3AQQA 5FJ8H 3AFPA 1XMOQ 1X9NA 1EOVA 4UP8A 2OQKA 4FDBA 2JA6H 1A63A 1TA8A 5M3FG 3UDIA 3HOYH 4A3FG 4PG3A 3AFQA 2E5LL 1JMCA 4IOAA 4GN3B 4NPSA 4BBRH 1LTLA 1WFQA 4A3KH 2E2IH 4LF5Q 2IHFA 1VQGA 4JI5L 2UUBL 3WWVA 3CC2A 1YEZA 1CUKA 1PH4A 1NJIC 2RHSB 2YYZA 3W1GA 4POGA 2VUMG 4UCUA 1J6QA 2CWPA 2HVSA 2ZJRA 5LMNL 2B29A 5K36G 4AQYQ 4WJ3M 4X66L 2Z0SA 4DV2Q 3PUZA 1XPOA 4LF4Q 2JA5G 2ALYB 1PH2A 3I4MH 2LXKA 1IBKL 4GKJL 5D1OB 4LF9Q 4DV2L 1QZHA 1PH3A 3IRBA 3UDFA 1PHJA 2R7FA 4LFCL 1B8AA 3J81j 4DV3L 1HR0W 2JEAI 3CCVA 4A3LG 4DPGA 2JEBI 3I4MG 1DGSA 1I94Q 2R7ZG 4RG1A 2F3IA 2VW9A 4R4IA 2UUCL 4X65Q 3A0JA 3CW2C 4JC0A 3DM3A 4QIWE 4NXMQ 1WOCA 3OW2A 3A5UA 3HOWH 1HNWQ 2ZTEA 4DV1Q 2K52A 5IP9G 1V1QA 4NB3A 5ELNA 3G48A 4DR2Q 1Y1VG 2JJQA 3KDFB 4C2MH 3RR5A 1D7QA 4DAYB 1TXYA 1I50H 4LW1A 1Y14B 3K8AA 4YWKA 2VUGA 3U4VA 2Q2IA 2PMZE 1N34L 1EUJA 3BZCA 4DV5Q 2KCTA 5FJ8G 1YBYA 3CPWA 1M90C 4JI3L 3OTOQ 2VUMH 3TS2A 2R6GA 3BZKA 4X66Q 3DLLA 4DR1Q 1OXXK 5BR8L 4GLXA 4A93H 5C0XJ 4O0AA 4OX9Q 4AYBE 1UE6A 4B3SQ 3E0EA 1Q12A 3EN2A 3PV0A 1X3GA 3GTOH 2BA0A 2PQAA 4P75A 1V9PA 4L5TA 2VQFQ 1R9TH 2UXBQ 1X65A 3TS0A 2K75A 1HR0L 2Q2UA 4B3TL 3S1NH 2EIFA 2EQSA 3J80c 2LSSA 2CKZB 1K73C 2ZJQA 2UUAQ 1E1OA 5M5WH 2VNUD 1HZCA 2RCNA 1IBKQ 1VQEA 4DR2L 4BY7G 3I4NG 1EIYB 2ZTCA 4A4IA 4DR4L 3D0FA 1SE8A 3BA8A 3FKIG 1P8LA 1L1OB 1RL2A 5DLQE 2E2HH 1YHQA 3NEMA 1EFWA 3M4OH 4JCVE 3MEFA 5C0XI 3ICEA 1IL2A 1Q81C 2OTJA 4EFBA 4A3MG 1XNRQ 1NY4A 2Q2HA 3PIPA 1NBWA 4DK6C 1ASZA 1FL0A 2BA1A 4R4TA 1PH5A 2I0QA 4R4QA 3K0XA 1G291 4YHHQ 1YIJA 4DUYL 4P73A 4A75A 1PYSB 1XDNA 1MKHA 1NTGA 4OWTB 4A93G 1WI5A 3CC4A 2V1CC 2NN6I 2JK8A 5IP9H 1VQFA 4LF7Q 4JOIA 3U58A 2BH2A 1HR0Q 4X62L 5E7NA 1HH2P 1N9WA 4LUOA 2UXDQ 5D1PA 1VS0A 3PO3G 4PZ6A 2E2JH 1B04A 2NVXH 1X54A 5IWAL 3H15A 3PF4A 3CXCA 3Q8DA 3ULPA 1EIFA 1VQ7A 2HVRA 2UU9Q 3J7ZC 2N78A 4LFBQ 1T9HA 1LUZA 4DNIA 4X64Q 3G4SA 3HOZG 3EIVA 4CC5A 3E9IA 2CWAA 2VQFL 4LF9L 4DR7L 2A1AA 1H95A 2R92H 3RZOH 1JJGA 2R93G 2QA4A 4A3EH 3M9BA 1EYGA 3PCOB 3M3YH 4WJ4A 3PUXA 2ZM6Q 4IPDA 3I56A 4HJAA 1B70B 1OXUA 1KAWA 2ZM6L 1XPUA 1YHAA 4A3FH 1VQ8A 4UCTA 3HOXG 2Y0SG 2PNHA 1QUQA 1W3SA 4YY3Q 1VQOA 3STBD 1OXTA 1Y1WH 2K5NA 3FP9A 3OYYA 1MJCA 1YI2A 3GTGH 1CKNA 1XMOL 3H3VI 4BA2I 3ERSX 1OXSC 1I94L 3H3VH 1TAEA 3RTXA 2ID0A 5C4XG 4L5SA 2IX0A 1GM5A 1K9MC 2KCMA 3CC7A 4JI2L 3GJXB 5JJKA 2HT1A 5C44H 5AJ3L 1VQBA 4A3CH 2AWOA 3L2PA 2K4KA 3CQZH 2UU9L 2HIVA 2JA8G 3TY9A 1XNQQ 5JEAJ 1KIXA 2OWOA 2JA7G 3JSLA 1HZAA 2YTYA 1L2FA 2E8GA 3CMEA 4B3SL 3HOZH 4LF7L 1C0AA 4JI8Q 3KJOA 4JI7L 4OXPA 4JI0L 3PO2G 5IYCG 4B3TQ 1VQ6A 4GKJQ 1PH6A 3ZJYC 1KL9A 3M4QA 2HHHL 4JBKA 2R7DA 4O2DA 2RF4A 2N49A 4AYBG 4DV0L 4DV6L 1N32L 3PIOA 4OX9L 5JEAG 4X64L 5LMUQ 2GN5A 3RN2A 2I5LX 4GN4B 2QGQA 2QEXA 4XTCS 3TEHB 2IHEA 3K80C 2B63G 3RLFA 4DV1L 3S16H 1BBUA 4IFDI 3UQ8A 2MQHA 2ATWA 4EFEA 3TRZA 5IP7H 3KFUA 1I6HH 2JA7H 1HNXQ 1IZ6A 4HJ9A 2UUAL 4A76A 4GOPA 1MIUA 4K0KQ 4BXXH 4IFDG 1IYJB 1WYDA 4J15A 2KHJA 4PZ7A 1J5EQ 4NXNQ 1E24A 4P74A 4PZ8A 2PI2E 4LFAQ 3BAAA 3FHWA 3JSNA 3NELA 4QY7A 1N36Q 4X6AH 4A3BG 3KLWA 1Y1WG 2VQEQ 5C44G 5LMNQ 2WFWA 4MTNA 4DK3C 1UWVA 1BVSA 2CQOA 2VQEL 4A3GH 3E9HA 1CKOA 3M7NA 2KENA 1IXRA 4LH7A 4H02A 4YWLA 1CKNB 2A8VA 1G51A 5M3MH 1QUQB 1TWHH 2WB1E 3GTQH 3GB8B 3GD7A 4DUZQ 1VQAA 4LNQA 3S17H 2WAQE 3CCUA 1VQ5A 5H1SE 4E6NA 5GQOA 1HNXL 4OO1G 1I3QH 1HZBA 5IYBH 4CC6A 4GLAC 4YWMA 4EQ5A 2Y0SE 4GNXA 1HNWL 1PYBA 1C9OA 1FGUA 1X56A 4IJHA 4DR6L 5M3MG 1HJPA 5GAEC 1LM0A 2UXCQ 3RLNA 3NBZB 4A3BH 2AKWB 1SN8A 1QZGA 1PVOA 3A5ZB 4UCOA 4JV5Q 2AWNA 4GLVB 1SFOH 2HVQA 3KOJA 4DV5L 4KHPQ 2WB1G 1GKHA 3OTOL 4R1JA 3CMAA 4BBRG 4JI3Q 1TWGH 1N33L 4POFA 1K83H 2CFMA 3J81i 2JA9A 3UE0A 4LFBL 1PH9A 4K0KL 3UE1A 5LMNW 4EEQA 1TWAH 4UFZA 1QVGA 1S3OA 1PH7A 4A3JH 2JA6G 3KF6B 4JOIC 1AH9A 3A74A 3K7AH 3K81C 1YHBA 2ASBA 4LF5L 3NBHB 1M1KC 3CCLA 2ZTDA 2Z6KA 5FLMG 1NMGA 3HKZG 3I4NH 1VQJA 1JJ2A 3S1QH 5IT9c 2JA8H 4DR5Q 5C0XG 3HFZB 2NZHA 4IJLA 2N8NA 2ZJPA 2PI2A 3HKSA 5HGQA 5FLMH 3CAMA 3F2BA 1Q86C 1K8GA 1SLJA 1OXVA 2I5HA 4YY3L 3HKZE 1VQDA 1KRSA 2N3SA 4JBMA 2D62A 5IYDH 3RLOA 3FKIH 3S1RH 3GTMH 1L1OA 3NENA 1XMQQ 1GVPA 3S1MH 4NXML 2UXBL 5JJIA 1AE3A 3CCJA 3LGJA 3W5OA 4OO1I 3F1ZA 2NN6G 3CP0A 4YCWA 1JT8A 4QJFA 4DRFA 4JI6L 4OWWB 1IBLQ 1Q7YC 4HIMA 4B3RL 2RHQB 3CPFA 1JB7A 2IY5B 1O7IA 2NVTH 2MFIA 4JBWA 4R4OA 3J80i 2K50A 3I7FA 3KF6A 2DUDA 4AIMA 3T1YQ 4LF8Q 3CCQA 2PQAB 3W1BA 5IE8A 4A3JG 4NXNL 1J5EL 4HJ8A 4DKAC 3L7ZC 5IP7G 2OQ0A 4TQUS 4HJ5A 1YJNA 4QQBX 2D0OA 5IWAQ 5C3EG 1GD7A 4AH6A 5IYCH 2K5VA 4DR5L 1XJVA 5DISC 4L5RC 5IYDG 3PUVA 1E7ZA 4BY1G 3MXNB 4GKKL 4IPHA 4P71A 3UDGA 2E5LQ 4OONA 4JI4L 4DV7Q 1N32Q 4IPCA 5JJLA 2AMCB 1E3PA 1JE5A 2K14A 2K5HA 4UCSA 3SGIA 1VQIA 4LUVA 1D8LA 1X6OA 4GN5A 2FXQA 2NVYH 1YZ6A 3KDFA 3G71A 3PF5A 1YVCA 4GNXB 4LH6A 4JBJA 4YCUA 4A3KG 4AQYL 4DUZL 3VNNA 1VQ9A 1U0LA 3JAMi 4IOCA 3QWUA 1L0WA 3F8TA 1V43A 1E1TA 1EQRA 1JJCB 3PSIA 4GS3A 1X55A 2KHIA 5M5XH 2NZOA 1EQQA 3JC66 1KRTA 4LFAL 1SROA 4A3IG 4DR4Q 5C3EH 1SMXA 3CD6A 4TVAB 3GO5A 2D0PA 3HOWG 2HIXA 4BA1I 2XGTA 5C4XH 2F4VL 2YV5A 4JI2Q 5AJ3Q 1SR3A 3CCRA 2IX1A 1I5FA 1EWIA 1KQSA 2F4VQ 1WCMG 3T1YL 3PO3H 3TY8A 1PH1A 4BY1H 1MJEA 1P16A 2JQOA 3NBYB 1PA6A 2VY3A 4BXXG 2HQLA 4GOPB 2JA5H 1Q1EA 3CCMA 4KLKA 1VQHA 2GVBA 3G6EA 4UCVA 4BY7H 3F2DA 3B6YA 3PUWA 3KJPA 1YJ9A 1N33Q 4IFDJ 4B3ML 2R7ZH 4DV0Q 3PGZA 3AEVA 3I55A 1PV4A 1GO3E 3HOUG 1Q82C 4A3DH 4DR7Q 3NC0B 3KYHC 4UCRA 4JI1Q 1FJGL 5GAGC 1YNXA 1X3FA 5FPOA 1KHIA 1UEBA 3AYHB 5GAHC 1XPRA 2BH8A 3BU2A 4JI8L 3UDXA 1Q8KA 4QL5A 4Y7NH 2CCZA 2ES2A 4JI0Q 2AHOB 2C35B 1Y1VH 3U4ZA 4IO9A 2YTXA 4DR3L 4C3JH 3T1HQ 3PN1A 2UXCL 1A62A 1E22A 2YTVA 4X65L 1YJWA 3PO2H 3H0GH 3S15H 3ULJA 3T1HL 3ULLA 2MO0A 1G6PA 3GTKH 1VQKA 2OCEA 2A19A 1C7YA 3BABA 4X62Q 1KD1C 2VS1A 3KF8B 3CF5A 3M4PA 3I2ZA 2JE6I 1Z47A 1KXLA 4LF8L 1K8AC 4A3CG 4ALPA 1N36L 1PH8A 4Y52H 1Z9FA 2WAQG 3S2HH 2OTLA 4YHHL 2LXJA 2MNAA 1S68A 5FLXc 4A3MH 2IT1A 1WJJA 1WCMH 3BJUA 4LUZA 3HOXH 1QVCA 3RZDH 4DR1L 2L15A 2UUBQ 4JI5Q 1VQNA 3HOVH 1FVIA 4XIGS 4DV7L 1UE7A 1XMQL 4QGUA 5J3BA 1B7YB 1TWFH 2VZAA 1K3RA 1U5KA 4MZ9A 1OTCA 4OWXB 4A3LH 3JAMc 3PUYA 4P72A 4JG2A 4PMWA 5IY0A 3J81c 4DR3Q 2R93H 1YITA 2GVAA 4LF6Q 4DV6Q 2DGYA 2NVQH 1Q46A 3D31A 4B3MQ 4LF6L 2HHHQ 5GROA 1A8VA 3RN5A 4GKKQ 1S72A 1BBWA 2EXDA 4JYAQ 4RMFA 2UUCQ 2B3GA 4MNOA 4KHPL 4DV4Q 3GTLH 4JV5L 4JI6Q 3I4OA
chains in the Genus database with same CATH superfamily
2PZUA 1RIPA 4YJ3F 1BXTA 2EXZA 3MXUA 1HNZQ 1WTOA 4XZ3B 1VCIA 1TWGB 1X3EA 1IBML 2PW7A 3L0OA 1XNQL 5GADC 4DUYQ 5ELOA 5FPRA 4DAMA 2KUMA 1JE4A 3HOVG 3K7UC 3N6RA 3K5OA 1RHPA 2IW3A 1EYDA 2L4NA 1PRTD 1Q1BA 3A55A 2FB9A 2K1BA 3J7A5 3Q6SA 1SDFA 4O4HF 1A9XA 1QWYA 2WIIB 3S14H 3A7LA 3KF8A 4R9WA 3T54A 4KI0A 1ZYRC 4JI1L 4R4CA 4OELB 1LYLA 1CM9A 1HNZL 1CHPD 1CQJB 4FFLA 1IBLL 3V4ZA 4B3RQ 4UY8C 3H09A 4S3SA 3KBGA 3BA9A 2KCNA 3NBIA 1FGBD 3GTPH 3RUZA 1JOQA 1G2WA 1A0IA 4DR6Q 2V5AA 5I5XA 3ORRA 1NMFA 4HIOA 1VQPA 3HOYG 4C56C 1EIGA 1I4HA 5FJ8H 1XMOQ 1A63A 1ET9A 1TA8A 1PK8A 4A3FG 2L1BA 2E5LL 1JMCA 4IOAA 4BBRH 2B39A 2E2IH 5K3WA 2H1EA 1STAA 1PH4A 2CZGA 4EEQA 3K5NA 2VUMG 1J6QA 5FR9A 1W96A 2B29A 3T16A 2VUMB 2EIYA 3KREA 5LL6S 2I80A 4XXEA 4EQOA 3S2DB 4HN7A 2YU9B 3A7AB 3NK9A 3UDFA 4CKEA 3PQIA 4A3LG 5BPHA 1TS3A 2JEBI 4A3BB 3GTKB 3TW6A 5BWUA 4RG1A 4HEDA 4X3UA 1C30A 4R4IA 3I90A 3BVGA 2BE5D 3LWEA 4QIWE 1B53A 1I6HB 3HOWH 3A5UA 1NAPA 2K52A 4IQZA 4NB3A 3G48A 4FXKC 4BS9A 5TSSA 3RR5A 2DY8A 1TXYA 1Y14B 2XWBB 4YWKA 4A3IB 2VUGA 3UZOA 1ESFA 4A3DB 2A68C 1WTWA 4ZK9B 1M90C 3VPCA 4I7ZC 4FFOA 5BR8L 2EYOA 4RKLA 5C0XJ 5IIFA 3E0EA 4HSPA 3P1HA 3PV0A 3GTOH 5EQ0A 4K14A 1WRVA 1ONLA 2RDHA 4Z9CB 4MV6A 1DD2A 1R9TH 2DAAA 2F0OA 3TS0A 2K75A 2Q2UA 1G91A 5C44B 2EQSA 3J80c 2ZJQA 2VNUD 4C3JG 2EZVA 4IUQA 4OIKA 4DF7A 3BS1A 4DR2L 4DR4L 1LTBD 1L1OB 3HP3A 5DLQE 2E2HH 1YHQA 1EFWA 4XX0B 4A3JB 1Q81C 4A3MG 1RD9D 1NY4A 1SJED 2BA1A 2F0JA 4A3MB 1PH5A 1A48A 4R4QA 1D5MC 1LABA 4I4TF 1GXDC 5HV6A 3SK6A 1C3OA 1WI5A 4JW0A 3J7AV 1RF2D 2JK8A 5C5MA 1AFPA 4JOIA 2IWHA 1HR0Q 4X62L 1S5FD 3S15B 1VS0A 2EY6A 3PO3G 2EE1A 5IGFA 1MI2A 4NKLA 4H7BA 5ELCA 2NVXH 1QG7A 1X54A 4KY7A 1LTID 4FFNA 3H15A 3CXCA 3TMEA 2F0DA 1EIFA 1VQ7A 1I1KA 3T99A 5KX5F 2C5CA 1A2TA 3QG1A 3NQTA 1HTPA 5FLXL 1LUZA 2XVSA 3MWDA 1FD7D 1WTVA 2A1AA 2R92H 2R7ZB 1DYQA 1UC8A 3SK8A 4TRDA 1EUCB 1EWHA 3I56A 2HQEA 1KAWA 1STNA 2ZM6L 1XPUA 1VQ8A 4UCTA 1OXTA 1CZGA 1UNSA 3MWEA 1MJCA 2K5QA 1CKNA 3BVMA 1TQOA 5EGTA 1SMYD 1I94L 1TAEA 5D8DA 2ID0A 5C4XG 1CT1D 2IX0A 2MPMA 2KCMA 3CC7A 2A6HD 3K5LA 2JA6B 2R93B 2X0SA 5C44H 4H0LC 3L2PA 4XQNA 3T4AC 1XNQQ 5M3FB 2DZDA 3JZIA 1XTCD 4Q5VA 2FHTA 2E8GA 3CMEA 1C0AA 4JI8Q 3UFXB 2KEDA 4N9PA 2HCIA 4OXPA 5IYCG 4CGYB 3ZJYC 3OSOA 4ILWA 3UI2A 3K58A 4JBKA 4EVOA 5EBDA 5EKLA 5C4ZA 4DV0L 3GIDA 2L9HA 4OX9L 3VR2A 2GN5A 1GHJA 3DHQA 1SXTA 3OHXC 2QGQA 4GN4B 4BBRB 2FPGB 1JDBB 5IYZF 3K80C 5BWXA 3CQZB 2ATWA 1M8AA 2I87A 5ELDA 1I6HH 4FP5D 3JRWA 1A3VA 1Y1VB 1HNXQ 1IZ6A 3A8IE 1GUGA 2EJ2A 5LOVF 2GQRA 3I70A 5FO9B 4PZ7A 5IT9E 1E24A 4P74A 3BAAA 4ZQIA 1RTNA 5C4HA 3GTPB 5JVH3 3D4DA 2EYFA 4X6AH 1SYGA 2NB0A 3KLWA 1HXYD 3AMUA 4C3IG 5LMNQ 1IYEA 4GZYC 4DK3C 1UWVA 1BVSA 4A3GH 4KY5A 1Y69U 2QEJC 1CKNB 3NP8A 5D3DA 1IYVA 1TWHH 3MFGA 1JQYD 3GTQH 3GD7A 4Q0FA 1VQAA 1KTAA 5JPMC 4FF4A 4E6NA 5GQOA 1I3QH 1RKNA 5IYBH 4EQ5A 2Y0SE 4GNXA 2E2JB 1EY4A 4H44C 1U4RA 4DR6L 1HJPA 4QMGA 3NBZB 1PFMA 1SN8A 5IGEA 3MJFA 3ONAB 1U9RA 4GLVB 1SFOH 3HKZB 5JVDF 3MWYW 1GKHA 2IJ0A 4DFAA 2MGSA 3CMAA 4BBRG 1TWGH 1ICFB 1GUWA 3C1FA 3J81i 2JA9A 3I12A 1Q90A 3I73A 4IUNA 1AW7A 2RBMA 1QVGA 2C9OA 3A74A 3S14B 3T9CA 3K81C 1FNVA 3PO2B 3NBHB 3CCLA 5FLMG 1VQJA 5IT9c 1I3QB 4MN3A 4IURA 3QO2A 1B6SA 5FLMH 1A6XA 1SLJA 5I5TA 1OXVA 4YY3L 3J81E 3GTQB 2ZDGA 4JBMA 1KRSA 1L1OA 1BQQT 5JAVA 1AE3A 3SHLA 3CCJA 3LGJA 1OBDA 2NN6G 5CR3A 2K7VA 2RCFA 3EQLC 4XDXA 4R8IA 1TR5A 4DN4M 3T9DA 1O7IA 5CA1F 1Z7TA 2MFIA 3J80i 2K50A 1MSGA 3CCQA 5A2QL 5KNDA 4DKAC 3L7ZC 1STYA 1Z2PX 4HJ5A 1SNQA 2D0OA 2JA8B 4AH6A 4C3JB 5I5SA 1A2UA 1C8CA 3PUVA 2CH4A 1E7ZA 5EPLA 4GKKL 2BOSA 4IPHA 3UDGA 2E5LQ 4OONA 3K59A 4IPCA 2AQ3B 1U4PA 4ZKCB 3MC0B 4BWGB 3BYYB 1GOZA 3CKIB 4TKOB 1IKLA 1SYDA 4DAYA 2FXQA 2WYOA 2B63B 2Y4RA 4DUZL 5CV9A 3VNNA 3JAMi 1L0WA 1V43A 2R86A 5CR5A 3OIQA 1JJCB 1STGA 3T7AA 2DNCA 3HBLA 1F77A 2NZOA 5D14A 1KRTA 1IYUA 1GSAA 2HUGA 4A3IG 1CTMA 1KUTA 1U4MA 3HEJA 4TVAB 5A2QE 1VMCA 1RTOA 2HIXA 4BA1I 5C4XH 2QKIC 2YRWA 1DOKA 3TP8A 1K8OA 1EWIA 1KQSA 4M0JA 3WWHA 3DXJC 4OEMB 3T1YL 3JZFA 4BY1H 1MJEA 3LWBA 3H94A 1CA6A 2VY3A 4GOPB 1D1KA 2B8FA 1WCMB 2W71A 3WO1A 5BWVA 1VQHA 4FE2A 2D9UA 3F2DA 1E4EA 4O4LF 5CC4A 3PUWA 3P7JA 1YJ9A 1N33Q 1MD2D 1IKMA 4B3ML 2W6MA 2R7ZH 1PV4A 1LTRD 1PFBA 1SYBA 3LWUA 2F0HA 3NC0B 3I8ZA 1PLFA 1I4QA 4KKTA 3WO0A 1YNXA 1UEBA 3AYHB 5GAHC 2YS6A 2CCZA 3BU2A 2A69C 4JI0Q 1V1PB 4QL5A 2ES2A 4JI7Q 1G2SA 2AHOB 4DR3L 2YTXA 5M5YB 3S9WA 3PN1A 1A62A 3LULA 4KHVA 3S15H 3T1HL 2J7ZA 4RZQA 2MO0A 4HCEA 4YIJA 4FFRA 1VQKA 1C7YA 1LT5D 2A5HA 4X62Q 1AN8A 2VS1A 4K5WA 3CF5A 5M5XB 1KJ9A 3HT5A 1K8AC 1PH8A 3QFFA 1TWCB 1Z9FA 5CV8A 3S2HH 4IUTA 4YHHL 1TS4A 5FLXc 1KLUD 4A3MH 3NQIA 1WCMH 4M8AA 5BN4A 4LUZA 3HOXH 1H9MA 4O7SA 1S4ZA 4DV7L 1XMQL 1EYCA 3V4SA 2HHFB 2ZGIA 4O7YA 1B7YB 1TWFH 1OTCA 1LT3D 2VB3X 4OWXB 1EKPA 4IZOA 5FOBB 4PMWA 4DK1A 2GVAA 4XYMB 1MGSA 2ABJA 2NVQH 2F0MA 4CJ1B 1HUNA 1HFNA 4KN4C 3VYTA 5C4JB 3VA5A 4JYAQ 1V8QA 2B3GA 2K6AA 3D8GA 4OO1H 1GLVA 5KGUA 4LFAQ 4A3EG 2H5XA 2RSNA 5I9PA 3CCEA 1W2BA 1ASYA 5BR8Q 4HIKA 2DABA 2MO1A 3SE0A 1UE5A 2B63H 4WJWA 1SCUB 4A3IH 5IYBG 4Q4CA 5G3LD 1VQ4A 1EQVA 4DIMA 1PRTB 3A8JE 2F0EA 1S5ED 4JXUA 4DA2A 4ME3A 3MXPA 3U50C 1F9PA 4APVA 3F2CA 2SOBA 1UE1A 1ML0D 4MHEA 3OIPA 3VDYA 1S40A 4O7RA 1ZKOA 4FXDA 2BDOA 3TQYA 5LMUL 3V2TA 3GTJH 3K7AB 4F87A 1SNOA 3WWJA 4LFCQ 2XTIA 2YU9H 4C3IH 1FJGQ 3S2DH 4TSSA 1EOTA 1XK5A 1X32A 1NE3A 1CKMA 3GDEA 2MJ8A 1WR2A 1OBGA 4A3DG 3DAAA 1HZ9A 2A1HA 3GTLB 5I47A 2Z6KC 1SYFA 1SRUA 4MV8A 5K5PA 1SE4A 1F9RA 2Q2TA 3OPOA 5BWTA 2QCPX 5DAUA 4PMCA 1N34Q 4UP9A 2NUCA 1EOVA 1WTRA 2G9HD 4IUUA 1C48A 3HOYH 4EGJA 2FJ2A 2RVLA 4I65A 3W3AA 2F0KA 1H9SA 5I4DA 4NPSA 2EYLA 2JP1A 4LF5Q 3HOVB 4JI5L 2UUBL 2K03A 1ET0A 1YEZA 4POGA 2RHSB 4G7ZC 4UCUA 1NSNS 1I7NA 4F88A 4AQYQ 4XQJA 3O13A 2Z0SA 4DV2Q 1XPOA 2ALYB 1PH2A 3I4MH 1IBKL 4LF9Q 4KJOA 1QZHA 1SFOB 3IRBA 1DCZA 4LFCL 1B8AA 3J81j 1HR0W 4AYBB 1I94Q 1VMPA 5IODA 2VW9A 3AW8A 4JC0A 4DNTB 2N88A 1D2BA 5ELNA 1Z2NX 4DR2Q 2JJQA 3G8CA 3KDFB 5BWRA 4DAYB 1I50H 3K8AA 2YS7A 3WWIA 3VOTA 1TY0A 1UAPA 2B2WA 2ZXOA 4DV5Q 2KCTA 3MXNA 3CPWA 3OTOQ 3TS2A 4O7LA 4FF2A 1JC7A 2EVBA 2PCFB 3FPPA 4GLXA 4A93H 2HGSA 1STEA 1UE6A 2HD3A 4B3SQ 5IGDA 1Z2OX 5KYIA 4P75A 4HNTA 1V9PA 5DGHA 2Z6BA 2VB2X 4RFBA 1A3TA 1HR0L 4B3TL 3IKJA 4G4KA 2IP4A 4IN3A 1M4VA 1E1OA 2B2UA 3DEPA 5M5WH 2VXWA 1SNCA 2RCNA 1SBBB 1EIYB 2ZTCA 1J8IA 1K28A 1SE8A 2J0TD 3FKIG 5IGGA 1HPCA 1GSOA 4JCVE 5C0XI 5HNEA 1IL2A 1XNRQ 1KLGD 3PIPA 1NBWA 3GV3A 4DK6C 1ULZA 4QSHA 3TW7A 2I0QA 1G291 1D1IA 4YHHQ 1YIJA 3ETHA 2RDFA 3MA2B 4A93G 4K6NA 3L3OC 1EYAA 1EEID 3D6WA 4K2LA 3JAML 3U58A 4B08A 4LUOA 2B2YC 3JAME 5DEHA 1NUCA 1B04A 1PRTC 5IWAL 4ULLA 4C3HG 1BUVT 4CDEC 3Q8DA 3PF4A 2NBFA 4FF1A 2N78A 2F0TA 1HA5A 1T9HA 4DNIA 4X64Q 3G4SA 1VBGA 5D3IB 4PMBA 2OEOA 4UHVA 5IT9L 1H95A 5JQGF 3AB9A 3RZOH 2R93G 2RA4A 2QA4A 3K3PA 1CI3M 4A3EH 1EY0A 1EYGA 3SEBA 3M3YH 4K8IA 3PUXA 4WJ4A 4IPDA 3J80L 4HJAA 1B70B 1JDEA 4DXGA 1EU3A 3R8BA 1B4OA 4A3FH 2HHFA 1VQOA 2Y0SG 4CMFA 1SNDA 3CRLC 3FEWX 3GTGH 4BA2I 1HRJA 1OXSC 4NZNA 3DM1A 4JI2L 3GJXB 4DAVA 3V05A 2F0UA 1VQBA 3E6ZX 2HIVA 5CM0A 3TY9A 4EQNA 1WTHA 5JEAJ 2V4DA 3JSLA 2NU6B 1L2FA 1L0XB 3MEHA 3TP7A 4YAJB 2LFNA 1VQ6A 2GPSA 1UEAB 3S2HB 1E0BA 2SDFA 4LK1C 2B2UC 3M7GA 2R7DA 4QB4A 2EJ0A 4DV6L 4O7TA 2NTSA 4ZRZA 3BDOA 5JEAG 4CKCA 1G2TA 4LAAA 5E4XA 3RN2A 3NTHA 4C2MB 2QEXA 4XTCS 1SYEA 1VBHA 3ND9A 3KBXA 1KDCA 2A73B 2L0CA 4DV1L 3S16H 2MQHA 3TRZA 3TEKA 3FVQA 2K28A 3NWTA 4GOPA 4BBSB 4X3SA 4K0KQ 3GTGB 5DAAA 1BDOA 2KHJA 5GONF 4KKSA 2YRXA 4UDUC 2NVTB 3GTOB 1DV1A 5CB4F 3NELA 4QY7A 3NUAA 3G6JB 4A3BG 2B2YA 1BXRA 3M3YB 3CRKC 2E74C 1U4LA 2CQOA 3M7NA 4MA0A 1IXRA 1GUNA 2R7KA 4H02A 4YWLA 1GGOA 2A8VA 3JRXA 1NNXA 1QUQB 4BY1B 1E2WA 3TP5A 3GB8B 3S17H 5H1SE 4RH6A 4YWMA 1H9KA 1C9OA 3BZDB 5CBAE 5M3MG 3VR5A 3RLNA 2UXCQ 4A3BH 5KNBA 4UCOA 1B3AA 2AWNA 2QB5A 1DOLA 3DTFA 2Z4IA 4YJ2F 4JI3Q 2GA4B 1K83H 4XYLB 4ZCKA 3UE0A 1PH9A 4K0KL 3UE1A 5LMNW 4NZMA 2JA6G 2AQ2B 3KF6B 4JOIC 4ZYSA 3QQMA 1YHBA 2YZLA 4LF5L 1M1KC 2Y0SB 2D2CC 3BDLA 1I4PA 2JA8H 2B2TC 1F2LA 3IL8A 4IJLA 2NZHA 2V59A 1G8ZD 5HGQA 1Q86C 3CAMA 1LTSD 3HKZE 3IAYA 3X3NA 2N3SA 5D65A 1ZYRD 1Y1WB 3FKIH 3S1RH 3GTMH 3HGBA 2BDNA 3S1MH 2UXBL 5JJIA 1EFID 3R5XA 4O4JF 2TSSA 4A93B 3W5OA 3F1ZA 1JT8A 3CP0A 1NR2A 3MXGA 4DRFA 3K5HA 4MV4A 1IBLQ 2RHQB 2VPQA 3NTKA 2EDGA 1EWCA 3Q24A 1CQIB 3I7FA 3KF6A 2DUDA 4AIMA 2DLNA 4LF8Q 3CHBD 3W1BA 5IE8A 2YL2A 4NXNL 4E6IA 1PRTF 5IP7G 2OQ0A 2ZDHA 4NDXA 5C3EG 1GD7A 3R3OA 4G7HC 4L5RC 2W6QA 4ID6A 3GV6A 3MXNB 4ABNA 4P71A 5JJLA 3MVVA 4I55F 3HO8A 4ZHQF 1JE5A 3EA6A 2G5DA 4UCSA 4LUVA 4TVIA 2E2DC 2NWGA 5ELFA 1X6OA 5DMXA 3K5MA 3PF5A 4RGOS 4GNXB 4JBJA 4UUGA 4AQYL 1VQ9A 3TDQA 1EZ1A 4IOCA 3BDCA 4OL7A 3D4RA 1BNCA 3PSIA 1X55A 1BBXC 1STHA 2XSCA 1JLLB 1TS2A 4LFAL 2VR1A 1SROA 5CMDA 3H0GB 3CD6A 1GUSA 2FMCA 2F4VL 2YV5A 3CCRA 1SR3A 4Y7NB 5J1ZA 1HFGA 5LP6F 3TBIB 1WCMG 4RKBA 3TY8A 2DJGC 5A35A 2EJGC 2B2VC 2CNVA 2JA5H 3RZDB 3RV4A 3C1EA 2KVMA 2EJFC 1M0TA 4TV8F 1AZQA 1FYCA 4IFDJ 1N32Q 3AEVA 3HOUG 1Q82C 4DR7Q 2E76C 2W6OA 2PZTA 1EYZA 1IW7D 3GTJB 5FPOA 1KHIA 4X3TA 1XPRA 2HVRA 4MV1A 3U4ZA 1Y1VH 1GUOA 4FFPA 2Q8RE 3T1HQ 2AQ1B 1X3PA 1E22A 1I4GA 1R4QB 1L0YB 1DV2A 2OCEA 3KF8B 5AFWA 1KNEA 2JE6I 4IUVA 1KXLA 1SMYC 4O42A 3U54A 1N36L 4Y52H 4MV3A 5I5YA 2N55A 3CSWA 1O7ZA 3FPUB 3MFYA 1CE8A 4BY7B 2PN1A 2B8GA 1QVCA 1EY6A 2UUBQ 4JI5Q 4KTAA 1VQNA 1FVIA 1ZEQX 1XX8A 4A3KB 2HDKA 3PIP3 4MZ9A 2EY5A 1O7YA 4ZOLF 3H3VC 2R93H 3S1QB 4L6TB 3RD4A 3S17B 3J81L 1RDPD 3D3RA 2HHHQ 1TWFB 1A8VA 5C3EB 5CORA 1BBWA 1II3A 5JOBA 4RMFA 3T53B 4MNOA 4KHPL 1Q8IA 4JV5L 4JI6Q 4HIDA 1BKBA 1JWSD 3I3CA 3R5HA 4DV4L 2CNUA 2XCLA 4KHZA 2YZNA 3R5FA 2R92G 3TP6A 1TWCH 1A3UA 1HTLD 1PZJD 3KAKA 4A3GG 1DOMA 3BACA 3VR3A 2F0IA 3ER0A 1AE2A 2M9VA 1B1ZA 2COGA 5ELEA 4BBSH 5D1OA 1IL8A 4YAKB 4L1KA 1KT8A 3QOJA 3CCSA 4XT1B 5CV7A 5M5YH 5EPJA 2EJ3A 5I5WA 5IGBA 1N8RC 3S16B 1JICA 4UP7A 3EBEA 4IPGA 5JPNC 1MHWC 4OIJA 2XIWA 1K0RA 2X5RA 5E3FA 4IHJF 4GOPC 3TREA 3E3XA 1DXMA 1KABA 1VQCA 3ITPA 5K36H 3ETJA 2HDLA 4Q4DA 4LF4L 1Y8NB 4GNXC 2WP8J 2F0QA 2EYMA 3N52A 2E2HB 3SXHA 4EX5A 1CSPA 3STBC 1CSQA 4IIJF 3QIAA 1X9NA 3AFPA 2OT2A 1T5XD 1E4EB 3F2UA 4O2BF 4CE5A 2QILA 5M3FG 4HMJA 1I2LA 4TM5A 4PG3A 3AFQA 2PW5A 2YYAA 4GN3B 4A3KH 2IHFA 3WWVA 3CC2A 1Q3LA 1NJIC 3W1GA 2CWPA 3T9BA 4B9XA 4WJ3M 4U673 3PUZA 4WBNF 2JA5G 4MAMA 5NUCA 4DV2L 4OGQC 1PHJA 5JH7F 2R7FA 5FK9C 4FXGC 2NZ1D 4DPGA 3I4MG 2R7ZG 5C6AA 2F3IA 1EY5A 4X65Q 3A0JA 3CW2C 4RCNA 3DM3A 4NXMQ 3QJYA 1WOCA 4N8FA 4DV1Q 5IP9G 3C46A 1Y1VG 3DF7A 2CQAA 2Q8TA 4C3HB 1D7QA 4LW1A 5M3MB 5L37A 3U4VA 3BZCA 4OHJA 1YBYA 1NCVA 3KLRA 1CS0A 2VUMH 2R6GA 3DLLA 1STBA 1BO0A 4AYBE 2HG8A 1Q12A 3EN2A 4CDFC 1X3GA 3G7LA 1SJHD 1TIID 4O7VA 4QCLA 2EYHA 4HR7B 2VQFQ 2UXBQ 1X65A 3S1NH 4G57A 2EIFA 5M5WB 2LSSA 4RA8A 4O7ZA 2NN6H 1HZCA 3NWSA 4A4IA 3BA8A 1RL2A 4QUFA 1KJ8A 2W6ZA 3J7AF 3M4OH 3MEFA 2X69A 1PMRA 3K57A 3SK4A 1S5BD 4FVMA 3K0XA 2ZDQA 1F9QA 4C5AA 4KN7C 3W2DA 4P73A 2PZWA 2A6HC 1PYSB 2O2LD 2FPPB 1MKHA 4DK0A 4OWTB 2V1CC 2CHBD 2JN4A 2NN6I 4NYEA 1JOKA 3M4OB 1PZKD 2BH2A 1ZXTA 2UXDQ 2V58A 2LS01 5D1PA 4PZ6A 2E2JH 3VPDA 4GLWA 5G3LF 1IHZA 2R84A 4NP5A 4FF3A 1EEFD 1W93A 4O84A 1JR0D 2L12A 4CC5A 3EIVA 3E9IA 2CWAA 2VQFL 1PX2A 4LF9L 4DR7L 4RGNA 3M9BA 4JVZA 2ZM6Q 5CV5A 2F03A 3KK7A 4K8JA 1OXUA 4WORA 1XXGA 3J80E 4RHRA 3HOXG 2ICIA 1W3SA 4K6LA 1Y1WH 2PO4A 2EJMA 3CU7A 1XMOL 2PBZA 3H3VH 3RTXA 3KAJA 2CVRA 1I4XA 5CBEE 5JJZA 1GM5A 1K9MC 3L9AX 5M9OA 4HNUA 2HT1A 5AJ3L 2AWOA 2K4KA 3CQZH 4U68A 3S1NB 5BYBA 2JA8G 2XRSD 2OWOA 2JA7G 5KKNB 2YTYA 2WACA 3WDNA 2IL8A 1GUTA 3HOZH 4LF7L 4JI7L 1SNMA 5I6YA 1EHIA 1RCVD 3I91A 2DWCA 1H9RA 3I4LA 4B3TQ 4GKJQ 1PH6A 2WV6D 4CMDA 2W6PA 2HHHL 1V1PA 2RF4A 2N49A 2NVYB 4C3IB 1N32L 2HGWA 3NSWA 2A68D 1IOVA 4F8MA 5LMUQ 3SK5A 3SNOA 2I5LX 2WINB 5H80A 2IHEA 2B63G 4IFDI 4RGTA 3RLFA 3UQ8A 5J39A 2WB1B 4EFEA 2JA7H 1KBLA 4ZQ3A 5LXTF 2UUAL 4A76A 1MIUA 4L8JA 4BXXH 4J15A 2QF7A 1J5EQ 2I8CA 3K6OA 3FHWA 1N36Q 2FPIB 3DWPA 1Y1WG 2VQEQ 5C44G 3T9AA 4WHXA 1Z6HA 5E4WC 1KJQA 2VQEL 3U0GA 3E9HA 2KENA 4LH7A 4IUPA 4IALA 1G51A 2YW2A 1I7LA 2SNSA 4DLKA 3TZUA 4M9UA 2E75C 2WAQE 4ME6A 3CCUA 1VQ5A 2EY1A 4KK7A 1KC7A 1HNXL 2M00A 1HZBA 3FRPB 2O5JC 1T5EA 3D6CA 4PNYA 4WRDA 4R8NA 4DGZA 3PIO3 1HNWL 3C3LA 1PYBA 1X56A 4IJHA 4WFN3 2ODTX 1TU2B 2JSOA 1LM0A 3UYYA 1PVOA 1QZGA 1I1LA 1MBYA 1W6KA 2HVQA 4DV5L 2WB1G 2R87A 2D5DA 2K01A 5HGTA 2SEBD 4LJZC 3Q0AA 2K5DA 1DJRD 4LFBL 2AUJD 1TWAH 3DWAA 4UFZA 1S3OA 4A3JH 2Q8IB 1AH9A 5C3XA 1ENCA 1B6RA 2ASBA 1Y8OB 5C3WA 3Q2OA 2RDGA 2Z6KA 5ELBA 3LX0A 1CQVA 1QE6A 2J4XA 1YNJC 3S1QH 4DR5Q 3U9TA 2TMPA 3HFZB 2N8NA 1TKWB 2PI2A 1O80A 3HKSA 3F2BA 5HURA 1XWEA 1R9TB 4UAIA 2VQDA 2XN9C 3R2TA 3MHBA 3RLOA 3NENA 4A3FB 1YNNC 1QB5D 4LMQD 4NXML 1IW7C 3NXWA 5FKAC 1GJXA 5BMVF 4NW2A 3T9FA 4YCWA 4ZUIA 4QJFA 4JI6L 5E1FA 2JYOA 2Z1CA 4B3RL 5CYUA 1FNUA 4YB8B 3OUUA 4R4OA 4RGMA 4HR7A 3T1YQ 2PVPA 2PQAB 1J5EL 1DZ1A 2EPBA 4HJ8A 2Q7DA 2I07B 4EQPA 5IOCA 2PYKA 4TQUS 4QQBX 1LV9A 5IWAQ 2WAQB 3JZ6A 4MV7A 5C4XB 5DISC 2K5VA 3QB3A 1XJVA 4K5VA 1K8MA 1YNND 3SE7A 3X3MA 3Q1KA 5KRUA 4JPBW 1ENFA 5IGCA 5I5UA 2K5HA 2QW7A 2F0FA 1VQIA 2QDBA 1D8LA 4GN5A 4HQ6A 2NVYH 3KDFA 3G71A 4K2KA 1YVCA 1YNJD 4FFMA 2X6LA 4C1NK 1EZ8A 4F7XA 1F2YA 1EQRA 5CV4A 2KQ3A 4GS3A 4CDDC 5KS8A 3HOZB 4DR4Q 5C1PA 2KOLA 1SMXA 2F0LA 3GO5A 5LYJF 3WOEA 2D0PA 4HN2A 5C8YF 4JI2Q 5AJ3Q 1Y8PB 2IX1A 1DONA 3VPBA 2K33A 2F4VQ 3KLSX 2CW0C 1P16A 2JQOA 1PA6A 2G9DA 4H13C 1K0SA 1Q1EA 3CCMA 1T36A 4UCVA 4QUCA 1IOWA 2EYPA 1TS5A 4HNVA 5I5VA 3KJPA 3H91A 3HG9A 2A6ED 1B44D 3OMGA 2DY7A 3PGZA 1GO3E 5I9OA 3I55A 2PPBC 1CFMA 4CJ2C 3KYHC 3DWQA 3KALA 4UCRA 1D5XC 1FJGL 5GAGC 1X3FA 2BH8A 4JI8L 3UDXA 1AZPA 1EU4A 1Q8KA 4Y7NH 2MHVA 1R4PB 1GSHA 1JKJB 2K5WA 5BPFA 5BN5A 4X65L 3PO2H 1KAAA 2FFKB 3H0GH 4HSVA 4K6DA 3ULJA 3ULLA 1G6PA 3LP8A 2B2WC 3RV3A 2X6GA 4B9WA 2J9GA 5KNCA 3BABA 1BCPF 2SCUB 4N9TA 3M4PA 4O86A 4LF8L 4P2CB 2KA7A 4N8X1 2RSOA 3P75A 2LXJA 2XRQD 2COJA 2IT1A 1HHVA 1KEEA 2W70A 3BJUA 1EY8A 2DJFC 4DR1L 2L15A 2K05A 1I1MA 2MUYA 3HOVH 2R7LA 1KTKA 2Z02A 2PQEA 5J3BA 2XNAC 2VZAA 1K3RA 1U5KA 1WTPA 4A3LH 5LHY1 4P72A 5IY0A 2F0SA 3J81c 4DV6Q 3NHHA 1Q46A 1SE3A 3D31A 4B3MQ 5GROA 4GKKQ 1TWHB 1S72A 3DUZA 2UUCQ 1B50A 2R3ZA 3AU7A 5J2TF 3E5SA 5HBRB 3GTLH 3TZDA 5LA6F 5T1IA 4A3GB 2KBNA 1F9SA 3NTIA 4ZLTF 5EZYF 4YCVA 2FP4B 3H0GG 1PFSA 5I2XA 2A74C 1HQMC 1CA5A 3S1MB 4L5QA 3FKIB 3GQBA 3P20A 5I2YA 4C3HH 4E4TA 2FMMA 1QVFA 2NYZD 3EFXD 5HY6A 1XNRL 1M6VA 2F4IA 1S5CD 2UXDL 5J2UF 4JI4Q 2F52A 4IFDH 3KLSA 1WVLA 2VL6A 2R82A 3VR6A 2GLTA 2K04A 3GP7A 3S24A 3TINA 2PMZB 5COYA 1L1OC 5FLXE 4DV3Q 3M85A 1VQLA 2F0PA 4UPAA 2LKVA 3J7YW 1AUVA 1XTDA 2EYJA 1IBMQ 4LWCA 4CHTB 4DU9A 3T56B 3SVMA 1VQMA 4I7AA 2EY2A 3T13A 1KC8C 1E2VA 3HOUH 2GQSA 4O2AF 1B2TA 3RNUA 2I5MX 1F2ZA 4JYAL 4BBSG 4EGQA 5C0XH 1CK1A 5CA0F 2BCOA 3TY5A 3QR8A 3K5IA 2QK4A 5C4JH 4HJ7A 5M3FH 4FGRA 1ET6A 4O82A 5CV6A 5EAYA 4O83A 3AQQA 2M2LA 1KNAA 2HJWA 3Q23A 4UP8A 2JA6H 2OQKA 4FDBA 1TVXA 4C5CA 3UDIA 3NUCA 4QIWB 1O7LA 1PTOB 2EOTA 5JVG3 5ISRA 3TN2A 1LTLA 1WFQA 4FU0A 3IFDA 1VQGA 1JB3A 3EVQA 1PZID 1TWAB 1VF5C 3QWNA 1CUKA 3VYSA 2YYZA 5EPKA 2HVSA 3DTGA 2CH4W 2ZJRA 5LMNL 5K36G 2WKDA 2CNQA 3N8DA 4X66L 4LF4Q 4C1NI 5E25A 5D1OB 4GKJL 2LXKA 4KV6A 1TY2A 1PH3A 1SEBD 4DV3L 2JEAI 4O7NA 1JWMD 3CCVA 1DGSA 2RQXA 3ORQA 4YBZB 2UUCL 4HMIA 2XD4A 2Z9HA 3OW2A 1HNWQ 1EKFA 1RJTA 2ZTEA 1V1QA 1PTOD 1BCPB 4C2MH 3DMUA 2B2TA 1M0WA 2Q2IA 2DNEA 2PMZE 1N34L 1EUJA 2C00A 5FJ8G 1E2ZA 2SNMA 4CJ0B 5EKIA 4JI3L 1LLRD 3BZKA 4ODGA 4KD3A 4X66Q 1OXXK 3MAQA 4DR1Q 3G8DA 4O0AA 4OX9Q 3PFFA 4RCOA 4CBVA 2YZGA 4DAAA 2BA0A 3U9SA 2PQAA 3EJIA 4L5TA 3EROA 1PFNA 1K73C 2CKZB 4O4IF 2UUAQ 2JA7B 4HTHA 2W6NA 3I4NB 4QF4A 1IBKQ 4IWYA 1VQEA 2KEEA 3QOLA 4BY7G 3I4NG 3GLKA 1JORA 3D0FA 1P8LA 2AUKA 3R23A 3BVZA 3NEMA 2OTJA 5LL6X 3ICEA 2R85A 3TQTA 4EFBA 1SAPA 1DIKA 2Q2HA 1ASZA 2IPKD 1FL0A 3DEOA 4R4TA 3HOUB 2NTTA 2F3VA 4JK1C 4A3EB 3K0YA 4NZOA 4DUYL 2L55A 4CDCC 4A75A 1XDNA 4M1UB 3RZOB 1NTGA 2KJXA 3CC4A 1D5ZC 3A8KE 4XYQA 2IX3A 4DQNA 5IP9H 1VQFA 4K5XA 3LNNA 2BE5C 5F2DA 4MIUA 4LF7Q 3OMCA 5E7NA 1HH2P 1N9WA 2NU8B 3HOWB 3VR4A 1CQFA 3ULPA 4FO2A 2UU9Q 3HS0C 1WD1A 3J7ZC 4G7OC 4LFBQ 4V190 2OF1A 3HOZG 4ZAIA 1EQTA 4TUYF 1I2KA 1JJGA 2ICEC 3FMCA 4ME5A 4L63B 3PCOB 4J1MA 1ZAUA 2JA5B 1C4QA 3RMHA 2O4XA 1YHAA 1DM0B 4J8QA 2NU9B 5CGKA 2PNHA 1QUQA 4YY3Q 2R7MA 3T9EA 3STBD 3OYYA 3FP9A 2K5NA 1YI2A 3H3VI 4MA5A 3ERSX 3NE5B 2MP1A 4L5SA 1BCPD 2ZT9C 5JJKA 4A3CH 4J6HA 1UUPA 1F2MA 2UU9L 1VDZA 1KIXA 1ENAA 3IFTA 1G6ZA 4MV9A 4DXFA 1HZAA 2F0WA 4B3SL 1PDQA 1PTOC 2ZXPA 3KJOA 4O7WA 1AEXA 2F0GA 4KMUC 4JI0L 1EL0A 3PO2G 2Z04A 1MSHA 2COIA 5JEAH 3OWFA 3BYTB 1KL9A 3M4QA 4ZI7F 4Y8VB 4O2DA 4AYBG 3PIOA 3WNZA 4X3KA 4X64L 1I50B 3TEHB 1QJOA 2HDMA 4FYDA 1BBUA 1V1OA 3HOYB 3Q22A 5IP7H 3KFUA 4RWSC 4HJ9A 4EG0A 4IFDG 2XWJB 3ERQA 1IYJB 1RODA 1EY7A 1WYDA 2HCCA 1A15A 2GPWA 4NXNQ 4PZ8A 5T1GA 3E0JA 2PI2E 3JSNA 3RFCA 1BCPC 4V0BA 1OO9B 1UC9A 1WTXA 5C1OA 3I4MB 3HRZC 2WFWA 4MTNA 1CKOA 2DN8A 4KY6A 3S1RB 3GTMB 5EKKA 5M3MH 5EJWA 2WB1E 3M4YA 4DUZQ 4LNQA 2Z8LA 3VYRA 2KHSA 1GHKA 1HQRD 4OO1G 1A3GA 2JXMB 1LO5D 3D4WA 1ILQA 1A0GA 4CC6A 1W6JA 4GLAC 4XT3B 3VA7A 1DAAA 2B2VA 2P0AA 1FGUA 1IYDA 4HCSA 5GAEC 2Z4HA 2AKWB 3A5ZB 4JV5Q 1ESRA 2KCCA 3KOJA 4FNFA 4KHPQ 4XYOA 1K83B 3MZ5A 3BG5A 2KECA 3OTOL 4R1JA 1N33L 1LACA 3NPPA 4POFA 2CFMA 4PQXA 1BNZA 1LTGD 2OXPA 4KD4A 3ND8A 1PH7A 1VKZA 3K7AH 3MTSA 5I60A 3E5NA 1CHQD 2QDLA 2ZTDA 1NMGA 2NVQB 3HKZG 1CZWA 3I4NH 1XYIA 3OOCA 1JJ2A 5DGIA 5C0XG 2LMCB 3U9OA 2ZJPA 1BR9A 1H9JA 5DM73 1D6EC 4KJNA 2PNRC 4RAUC 4DAPA 2NUAB 1K8GA 2I5HA 3AX6A 1VQDA 2RKSA 5IYDH 2D62A 4KKUA 3PMFA 2WKCA 5I6WA 1XMQQ 1GVPA 3HZXA 1EZ6A 4OO1I 1WD0A 1AUXA 5BYAA 4OWWB 1Q7YC 3NBHA 3RUPA 4HIMA 1JOOA 5DNFA 3CPFA 1B3QA 1JB7A 2IY5B 2R92B 2NVTH 4JBWA 2LY7A 1QOHA 4XQQA 2YZMA 2A6EC 4A3JG 5CE8A 3PO3B 5K2MA 3I72A 1YJNA 1LT4D 4O81A 1BF4A 1QNKA 1KJIA 1I4RA 5IYCH 3VYUA 3TSSA 4DR5L 1ICWA 5IYDG 5J22A 1J9OA 2NVXB 4BY1G 4JI4L 3TIGA 1LT6D 4DV7Q 4TV9F 3R93A 2AMCB 1E3PA 2K14A 3SGIA 4ZUJA 2YWVA 2OLSA 3HOXB 3TIIA 1YZ6A 2F3WA 3SDZA 4LH6A 3FDTA 4YCUA 1HUMA 4A3KG 4NMZA 1KJJA 1QNUA 1SYCA 1U0LA 4PV1C 3QWUA 1QILA 3F8TA 2R61A 1E1TA 2KHIA 5M5XH 1EQQA 3URYA 3JC66 5FO7B 2F0VA 2F1MA 3SR1A 5C3EH 1NR4A 1LTAD 1PTOH 2R7NA 3HOWG 2XGTA 1JCKB 1O78A 1SNPA 1I5FA 5BN3A 1VF7A 2K32A 1HCZA 3PO3H 1EKVA 1PH1A 3OW7A 1JWUD 2DIKA 4C5BA 3NBYB 4IWXA 5BWWA 5JQWA 4BXXG 2HQLA 4HAEA 3WOFA 4KLKA 3G6EA 2GVBA 5C5LA 1EUDB 4BY7H 1PYWD 4O1NA 1KDBA 3B6YA 3OWEB 4CHIA 3A54A 1S5DD 4DV0Q 4A3DH 3LQSA 1X3QA 1FR3A 1EY9A 4JI1Q 1SE2A 5KIXA 5KYLA 2H4OA 2I46A 5EBCA 1TT2A 2C35B 2L11A 2A69D 4MTKA 4RHSA 4IO9A 2NU7B 4C3JH 4IZ8A 1I6VC 2UXCL 3OUZA 2YTVA 2ZXRA 2F0NA 1YJWA 5JVLA 1FNWA 3R2IA 1EIHA 3GTKH 4PBCA 3T51B 2A19A 1KD1C 4ZKBB 1QCBD 3I2ZA 1Z47A 3KUPA 4A3CG 3A56A 4ALPA 3HB9A 1B9NA 3V96A 4I50F 2WAQG 2HGXA 2OTLA 1BOSA 2MNAA 3VMMA 1S68A 2ENBA 1WJJA 4DNRB 3RZDH 3CEBA 5FNVF 4XIGS 1LTTD 1UE7A 3ZYYX 4CKBA 1WTQA 2E2IB 4QGUA 1PXUA 3JAMc 3PUYA 1HA6A 4JG2A 5DM63 1ILPA 3R9RA 4DR3Q 1K3BC 1YITA 3UZBA 4LF6Q 2O5IC 1KDAA 2DGYA 2CW0D 3H6MA 5FO8B 2P5ZX 5KEEA 1B9MA 4LF6L 3U55A 1PTOF 5CAEB 3RN5A 2EXDA 3C2PA 1AP0A 4EGVA 2L5TA 1SSOA 4DV4Q 1H9SB 3BG3A 2FINB 3I4OA
chains in the Genus database with same CATH topology
4HIDA 1BKBA 1RIPA 4A3EG 2H5XA 2KBNA 3CCEA 1W2BA 4DV4L 1HNZQ 1ASYA 4KHZA 5BR8Q 4HIKA 1VCIA 1IBML 1X3EA 4YCVA 2R92G 3H0GG 3L0OA 1PFSA 5GADC 1XNQL 1TWCH 2MO1A 2B63H 1UE5A 4DUYQ 4A3GG 4L5QA 5ELOA 4A3IH 5IYBG 5FPRA 3ER0A 1AE2A 4DAMA 1VQ4A 3HOVG 3K7UC 4C3HH 1QVFA 4BBSH 4ME3A 3U50C 5HY6A 5D1OA 1XNRL 4APVA 3F2CA 3CCSA 2UXDL 1UE1A 5M5YH 4JI4Q 1N8RC 1Q1BA 2F52A 3J7A5 3VDYA 1S40A 4UP7A 3EBEA 3TQYA 2VL6A 5LMUL 4IPGA 3GTJH 3S14H 1K0RA 3S24A 4JI7Q 1L1OC 4DV3Q 2XTIA 4GOPC 4KI0A 3TREA 4C3IH 3M85A 1VQLA 2YU9H 4LFCQ 4JI1L 4R4CA 1FJGQ 4UPAA 3S2DH 1VQCA 1LYLA 1XK5A 1XTDA 1NE3A 1IBMQ 1CKMA 3GDEA 4LWCA 1HNZL 1VQMA 1KC8C 4LF4L 1IBLL 4GNXC 3HOUH 4A3DG 1HZ9A 4B3RQ 2WP8J 4UY8C 3BA9A 3RNUA 2Z6KC 2I5MX 4JYAL 1SRUA 3GTPH 4BBSG 2Q2TA 1A0IA 3TY5A 4DR6Q 5C4JH 4HJ7A 1NMFA 4HIOA 5M3FH 4EX5A 1VQPA 1CSPA 3STBC 3HOYG 1CSQA 5EAYA 4UP9A 1N34Q 3AQQA 5FJ8H 3AFPA 1XMOQ 1X9NA 1EOVA 4UP8A 2OQKA 4FDBA 2JA6H 1A63A 1TA8A 5M3FG 3UDIA 3HOYH 4A3FG 4PG3A 3AFQA 2E5LL 1JMCA 4IOAA 4GN3B 4NPSA 4BBRH 1LTLA 1WFQA 4A3KH 2E2IH 4LF5Q 2IHFA 1VQGA 4JI5L 2UUBL 3WWVA 3CC2A 1YEZA 1CUKA 1PH4A 1NJIC 2RHSB 2YYZA 3W1GA 4POGA 2VUMG 4UCUA 1J6QA 2CWPA 2HVSA 2ZJRA 5LMNL 2B29A 5K36G 4AQYQ 4WJ3M 4X66L 2Z0SA 4DV2Q 3PUZA 1XPOA 4LF4Q 2JA5G 2ALYB 1PH2A 3I4MH 2LXKA 1IBKL 4GKJL 5D1OB 4LF9Q 4DV2L 1QZHA 1PH3A 3IRBA 3UDFA 1PHJA 2R7FA 4LFCL 1B8AA 3J81j 4DV3L 1HR0W 2JEAI 3CCVA 4A3LG 4DPGA 2JEBI 3I4MG 1DGSA 1I94Q 2R7ZG 4RG1A 2F3IA 2VW9A 4R4IA 2UUCL 4X65Q 3A0JA 3CW2C 4JC0A 3DM3A 4QIWE 4NXMQ 1WOCA 3OW2A 3A5UA 3HOWH 1HNWQ 2ZTEA 4DV1Q 2K52A 5IP9G 1V1QA 4NB3A 5ELNA 3G48A 4DR2Q 1Y1VG 2JJQA 3KDFB 4C2MH 3RR5A 1D7QA 4DAYB 1TXYA 1I50H 4LW1A 1Y14B 3K8AA 4YWKA 2VUGA 3U4VA 2Q2IA 2PMZE 1N34L 1EUJA 3BZCA 4DV5Q 2KCTA 5FJ8G 1YBYA 3CPWA 1M90C 4JI3L 3OTOQ 2VUMH 3TS2A 2R6GA 3BZKA 4X66Q 3DLLA 4DR1Q 1OXXK 5BR8L 4GLXA 4A93H 5C0XJ 4O0AA 4OX9Q 4AYBE 1UE6A 4B3SQ 3E0EA 1Q12A 3EN2A 3PV0A 1X3GA 3GTOH 2BA0A 2PQAA 4P75A 1V9PA 4L5TA 2VQFQ 1R9TH 2UXBQ 1X65A 3TS0A 2K75A 1HR0L 2Q2UA 4B3TL 3S1NH 2EIFA 2EQSA 3J80c 2LSSA 2CKZB 1K73C 2ZJQA 2UUAQ 1E1OA 5M5WH 2VNUD 1HZCA 2RCNA 1IBKQ 1VQEA 4DR2L 4BY7G 3I4NG 1EIYB 2ZTCA 4A4IA 4DR4L 3D0FA 1SE8A 3BA8A 3FKIG 1P8LA 1L1OB 1RL2A 5DLQE 2E2HH 1YHQA 3NEMA 1EFWA 3M4OH 4JCVE 3MEFA 5C0XI 3ICEA 1IL2A 1Q81C 2OTJA 4EFBA 4A3MG 1XNRQ 1NY4A 2Q2HA 3PIPA 1NBWA 4DK6C 1ASZA 1FL0A 2BA1A 4R4TA 1PH5A 2I0QA 4R4QA 3K0XA 1G291 4YHHQ 1YIJA 4DUYL 4P73A 4A75A 1PYSB 1XDNA 1MKHA 1NTGA 4OWTB 4A93G 1WI5A 3CC4A 2V1CC 2NN6I 2JK8A 5IP9H 1VQFA 4LF7Q 4JOIA 3U58A 2BH2A 1HR0Q 4X62L 5E7NA 1HH2P 1N9WA 4LUOA 2UXDQ 5D1PA 1VS0A 3PO3G 4PZ6A 2E2JH 1B04A 2NVXH 1X54A 5IWAL 3H15A 3PF4A 3CXCA 3Q8DA 3ULPA 1EIFA 1VQ7A 2HVRA 2UU9Q 3J7ZC 2N78A 4LFBQ 1T9HA 1LUZA 4DNIA 4X64Q 3G4SA 3HOZG 3EIVA 4CC5A 3E9IA 2CWAA 2VQFL 4LF9L 4DR7L 2A1AA 1H95A 2R92H 3RZOH 1JJGA 2R93G 2QA4A 4A3EH 3M9BA 1EYGA 3PCOB 3M3YH 4WJ4A 3PUXA 2ZM6Q 4IPDA 3I56A 4HJAA 1B70B 1OXUA 1KAWA 2ZM6L 1XPUA 1YHAA 4A3FH 1VQ8A 4UCTA 3HOXG 2Y0SG 2PNHA 1QUQA 1W3SA 4YY3Q 1VQOA 3STBD 1OXTA 1Y1WH 2K5NA 3FP9A 3OYYA 1MJCA 1YI2A 3GTGH 1CKNA 1XMOL 3H3VI 4BA2I 3ERSX 1OXSC 1I94L 3H3VH 1TAEA 3RTXA 2ID0A 5C4XG 4L5SA 2IX0A 1GM5A 1K9MC 2KCMA 3CC7A 4JI2L 3GJXB 5JJKA 2HT1A 5C44H 5AJ3L 1VQBA 4A3CH 2AWOA 3L2PA 2K4KA 3CQZH 2UU9L 2HIVA 2JA8G 3TY9A 1XNQQ 5JEAJ 1KIXA 2OWOA 2JA7G 3JSLA 1HZAA 2YTYA 1L2FA 2E8GA 3CMEA 4B3SL 3HOZH 4LF7L 1C0AA 4JI8Q 3KJOA 4JI7L 4OXPA 4JI0L 3PO2G 5IYCG 4B3TQ 1VQ6A 4GKJQ 1PH6A 3ZJYC 1KL9A 3M4QA 2HHHL 4JBKA 2R7DA 4O2DA 2RF4A 2N49A 4AYBG 4DV0L 4DV6L 1N32L 3PIOA 4OX9L 5JEAG 4X64L 5LMUQ 2GN5A 3RN2A 2I5LX 4GN4B 2QGQA 2QEXA 4XTCS 3TEHB 2IHEA 3K80C 2B63G 3RLFA 4DV1L 3S16H 1BBUA 4IFDI 3UQ8A 2MQHA 2ATWA 4EFEA 3TRZA 5IP7H 3KFUA 1I6HH 2JA7H 1HNXQ 1IZ6A 4HJ9A 2UUAL 4A76A 4GOPA 1MIUA 4K0KQ 4BXXH 4IFDG 1IYJB 1WYDA 4J15A 2KHJA 4PZ7A 1J5EQ 4NXNQ 1E24A 4P74A 4PZ8A 2PI2E 4LFAQ 3BAAA 3FHWA 3JSNA 3NELA 4QY7A 1N36Q 4X6AH 4A3BG 3KLWA 1Y1WG 2VQEQ 5C44G 5LMNQ 2WFWA 4MTNA 4DK3C 1UWVA 1BVSA 2CQOA 2VQEL 4A3GH 3E9HA 1CKOA 3M7NA 2KENA 1IXRA 4LH7A 4H02A 4YWLA 1CKNB 2A8VA 1G51A 5M3MH 1QUQB 1TWHH 2WB1E 3GTQH 3GB8B 3GD7A 4DUZQ 1VQAA 4LNQA 3S17H 2WAQE 3CCUA 1VQ5A 5H1SE 4E6NA 5GQOA 1HNXL 4OO1G 1I3QH 1HZBA 5IYBH 4CC6A 4GLAC 4YWMA 4EQ5A 2Y0SE 4GNXA 1HNWL 1PYBA 1C9OA 1FGUA 1X56A 4IJHA 4DR6L 5M3MG 1HJPA 5GAEC 1LM0A 2UXCQ 3RLNA 3NBZB 4A3BH 2AKWB 1SN8A 1QZGA 1PVOA 3A5ZB 4UCOA 4JV5Q 2AWNA 4GLVB 1SFOH 2HVQA 3KOJA 4DV5L 4KHPQ 2WB1G 1GKHA 3OTOL 4R1JA 3CMAA 4BBRG 4JI3Q 1TWGH 1N33L 4POFA 1K83H 2CFMA 3J81i 2JA9A 3UE0A 4LFBL 1PH9A 4K0KL 3UE1A 5LMNW 4EEQA 1TWAH 4UFZA 1QVGA 1S3OA 1PH7A 4A3JH 2JA6G 3KF6B 4JOIC 1AH9A 3A74A 3K7AH 3K81C 1YHBA 2ASBA 4LF5L 3NBHB 1M1KC 3CCLA 2ZTDA 2Z6KA 5FLMG 1NMGA 3HKZG 3I4NH 1VQJA 1JJ2A 3S1QH 5IT9c 2JA8H 4DR5Q 5C0XG 3HFZB 2NZHA 4IJLA 2N8NA 2ZJPA 2PI2A 3HKSA 5HGQA 5FLMH 3CAMA 3F2BA 1Q86C 1K8GA 1SLJA 1OXVA 2I5HA 4YY3L 3HKZE 1VQDA 1KRSA 2N3SA 4JBMA 2D62A 5IYDH 3RLOA 3FKIH 3S1RH 3GTMH 1L1OA 3NENA 1XMQQ 1GVPA 3S1MH 4NXML 2UXBL 5JJIA 1AE3A 3CCJA 3LGJA 3W5OA 4OO1I 3F1ZA 2NN6G 3CP0A 4YCWA 1JT8A 4QJFA 4DRFA 4JI6L 4OWWB 1IBLQ 1Q7YC 4HIMA 4B3RL 2RHQB 3CPFA 1JB7A 2IY5B 1O7IA 2NVTH 2MFIA 4JBWA 4R4OA 3J80i 2K50A 3I7FA 3KF6A 2DUDA 4AIMA 3T1YQ 4LF8Q 3CCQA 2PQAB 3W1BA 5IE8A 4A3JG 4NXNL 1J5EL 4HJ8A 4DKAC 3L7ZC 5IP7G 2OQ0A 4TQUS 4HJ5A 1YJNA 4QQBX 2D0OA 5IWAQ 5C3EG 1GD7A 4AH6A 5IYCH 2K5VA 4DR5L 1XJVA 5DISC 4L5RC 5IYDG 3PUVA 1E7ZA 4BY1G 3MXNB 4GKKL 4IPHA 4P71A 3UDGA 2E5LQ 4OONA 4JI4L 4DV7Q 1N32Q 4IPCA 5JJLA 2AMCB 1E3PA 1JE5A 2K14A 2K5HA 4UCSA 3SGIA 1VQIA 4LUVA 1D8LA 1X6OA 4GN5A 2FXQA 2NVYH 1YZ6A 3KDFA 3G71A 3PF5A 1YVCA 4GNXB 4LH6A 4JBJA 4YCUA 4A3KG 4AQYL 4DUZL 3VNNA 1VQ9A 1U0LA 3JAMi 4IOCA 3QWUA 1L0WA 3F8TA 1V43A 1E1TA 1EQRA 1JJCB 3PSIA 4GS3A 1X55A 2KHIA 5M5XH 2NZOA 1EQQA 3JC66 1KRTA 4LFAL 1SROA 4A3IG 4DR4Q 5C3EH 1SMXA 3CD6A 4TVAB 3GO5A 2D0PA 3HOWG 2HIXA 4BA1I 2XGTA 5C4XH 2F4VL 2YV5A 4JI2Q 5AJ3Q 1SR3A 3CCRA 2IX1A 1I5FA 1EWIA 1KQSA 2F4VQ 1WCMG 3T1YL 3PO3H 3TY8A 1PH1A 4BY1H 1MJEA 1P16A 2JQOA 3NBYB 1PA6A 2VY3A 4BXXG 2HQLA 4GOPB 2JA5H 1Q1EA 3CCMA 4KLKA 1VQHA 2GVBA 3G6EA 4UCVA 4BY7H 3F2DA 3B6YA 3PUWA 3KJPA 1YJ9A 1N33Q 4IFDJ 4B3ML 2R7ZH 4DV0Q 3PGZA 3AEVA 3I55A 1PV4A 1GO3E 3HOUG 1Q82C 4A3DH 4DR7Q 3NC0B 3KYHC 4UCRA 4JI1Q 1FJGL 5GAGC 1YNXA 1X3FA 5FPOA 1KHIA 1UEBA 3AYHB 5GAHC 1XPRA 2BH8A 3BU2A 4JI8L 3UDXA 1Q8KA 4QL5A 4Y7NH 2CCZA 2ES2A 4JI0Q 2AHOB 2C35B 1Y1VH 3U4ZA 4IO9A 2YTXA 4DR3L 4C3JH 3T1HQ 3PN1A 2UXCL 1A62A 1E22A 2YTVA 4X65L 1YJWA 3PO2H 3H0GH 3S15H 3ULJA 3T1HL 3ULLA 2MO0A 1G6PA 3GTKH 1VQKA 2OCEA 2A19A 1C7YA 3BABA 4X62Q 1KD1C 2VS1A 3KF8B 3CF5A 3M4PA 3I2ZA 2JE6I 1Z47A 1KXLA 4LF8L 1K8AC 4A3CG 4ALPA 1N36L 1PH8A 4Y52H 1Z9FA 2WAQG 3S2HH 2OTLA 4YHHL 2LXJA 2MNAA 1S68A 5FLXc 4A3MH 2IT1A 1WJJA 1WCMH 3BJUA 4LUZA 3HOXH 1QVCA 3RZDH 4DR1L 2L15A 2UUBQ 4JI5Q 1VQNA 3HOVH 1FVIA 4XIGS 4DV7L 1UE7A 1XMQL 4QGUA 5J3BA 1B7YB 1TWFH 2VZAA 1K3RA 1U5KA 4MZ9A 1OTCA 4OWXB 4A3LH 3JAMc 3PUYA 4P72A 4JG2A 4PMWA 5IY0A 3J81c 4DR3Q 2R93H 1YITA 2GVAA 4LF6Q 4DV6Q 2DGYA 2NVQH 1Q46A 3D31A 4B3MQ 4LF6L 2HHHQ 5GROA 1A8VA 3RN5A 4GKKQ 1S72A 1BBWA 2EXDA 4JYAQ 4RMFA 2UUCQ 2B3GA 4MNOA 4KHPL 4DV4Q 3GTLH 4JV5L 4JI6Q 3I4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HID A;  1BKB A;  1RIP A;  4A3E G;  2H5X A;  2KBN A;  3CCE A;  1W2B A;  4DV4 L;  1HNZ Q;  1ASY A;  4KHZ A;  5BR8 Q;  4HIK A;  1VCI A;  1IBM L;  1X3E A;  4YCV A;  2R92 G;  3H0G G;  3L0O A;  1PFS A;  5GAD C;  1XNQ L;  1TWC H;  2MO1 A;  2B63 H;  1UE5 A;  4DUY Q;  4A3G G;  4L5Q A;  5ELO A;  4A3I H;  5IYB G;  5FPR A;  3ER0 A;  1AE2 A;  4DAM A;  1VQ4 A;  3HOV G;  3K7U C;  4C3H H;  1QVF A;  4BBS H;  4ME3 A;  3U50 C;  5HY6 A;  5D1O A;  1XNR L;  4APV A;  3F2C A;  3CCS A;  2UXD L;  1UE1 A;  5M5Y H;  4JI4 Q;  1N8R C;  1Q1B A;  2F52 A;  3J7A 5;  3VDY A;  1S40 A;  4UP7 A;  3EBE A;  3TQY A;  2VL6 A;  5LMU L;  4IPG A;  3GTJ H;  3S14 H;  1K0R A;  3S24 A;  4JI7 Q;  1L1O C;  4DV3 Q;  2XTI A;  4GOP C;  4KI0 A;  3TRE A;  4C3I H;  3M85 A;  1VQL A;  2YU9 H;  4LFC Q;  4JI1 L;  4R4C A;  1FJG Q;  4UPA A;  3S2D H;  1VQC A;  1LYL A;  1XK5 A;  1XTD A;  1NE3 A;  1IBM Q;  1CKM A;  3GDE A;  4LWC A;  1HNZ L;  1VQM A;  1KC8 C;  4LF4 L;  1IBL L;  4GNX C;  3HOU H;  4A3D G;  1HZ9 A;  4B3R Q;  2WP8 J;  4UY8 C;  3BA9 A;  3RNU A;  2Z6K C;  2I5M X;  4JYA L;  1SRU A;  3GTP H;  4BBS G;  2Q2T A;  1A0I A;  3TY5 A;  4DR6 Q;  5C4J H;  4HJ7 A;  1NMF A;  4HIO A;  5M3F H;  4EX5 A;  1VQP A;  1CSP A;  3STB C;  3HOY G;  1CSQ A;  5EAY A;  4UP9 A;  1N34 Q;  3AQQ A;  5FJ8 H;  3AFP A;  1XMO Q;  1X9N A;  1EOV A;  4UP8 A;  2OQK A;  4FDB A;  2JA6 H;  1A63 A;  1TA8 A;  5M3F G;  3UDI A;  3HOY H;  4A3F G;  4PG3 A;  3AFQ A;  2E5L L;  1JMC A;  4IOA A;  4GN3 B;  4NPS A;  4BBR H;  1LTL A;  1WFQ A;  4A3K H;  2E2I H;  4LF5 Q;  2IHF A;  1VQG A;  4JI5 L;  2UUB L;  3WWV A;  3CC2 A;  1YEZ A;  1CUK A;  1PH4 A;  1NJI C;  2RHS B;  2YYZ A;  3W1G A;  4POG A;  2VUM G;  4UCU A;  1J6Q A;  2CWP A;  2HVS A;  2ZJR A;  5LMN L;  2B29 A;  5K36 G;  4AQY Q;  4WJ3 M;  4X66 L;  2Z0S A;  4DV2 Q;  3PUZ A;  1XPO A;  4LF4 Q;  2JA5 G;  2ALY B;  1PH2 A;  3I4M H;  2LXK A;  1IBK L;  4GKJ L;  5D1O B;  4LF9 Q;  4DV2 L;  1QZH A;  1PH3 A;  3IRB A;  3UDF A;  1PHJ A;  2R7F A;  4LFC L;  1B8A A;  3J81 j;  4DV3 L;  1HR0 W;  2JEA I;  3CCV A;  4A3L G;  4DPG A;  2JEB I;  3I4M G;  1DGS A;  1I94 Q;  2R7Z G;  4RG1 A;  2F3I A;  2VW9 A;  4R4I A;  2UUC L;  4X65 Q;  3A0J A;  3CW2 C;  4JC0 A;  3DM3 A;  4QIW E;  4NXM Q;  1WOC A;  3OW2 A;  3A5U A;  3HOW H;  1HNW Q;  2ZTE A;  4DV1 Q;  2K52 A;  5IP9 G;  1V1Q A;  4NB3 A;  5ELN A;  3G48 A;  4DR2 Q;  1Y1V G;  2JJQ A;  3KDF B;  4C2M H;  3RR5 A;  1D7Q A;  4DAY B;  1TXY A;  1I50 H;  4LW1 A;  1Y14 B;  3K8A A;  4YWK A;  2VUG A;  3U4V A;  2Q2I A;  2PMZ E;  1N34 L;  1EUJ A;  3BZC A;  4DV5 Q;  2KCT A;  5FJ8 G;  1YBY A;  3CPW A;  1M90 C;  4JI3 L;  3OTO Q;  2VUM H;  3TS2 A;  2R6G A;  3BZK A;  4X66 Q;  3DLL A;  4DR1 Q;  1OXX K;  5BR8 L;  4GLX A;  4A93 H;  5C0X J;  4O0A A;  4OX9 Q;  4AYB E;  1UE6 A;  4B3S Q;  3E0E A;  1Q12 A;  3EN2 A;  3PV0 A;  1X3G A;  3GTO H;  2BA0 A;  2PQA A;  4P75 A;  1V9P A;  4L5T A;  2VQF Q;  1R9T H;  2UXB Q;  1X65 A;  3TS0 A;  2K75 A;  1HR0 L;  2Q2U A;  4B3T L;  3S1N H;  2EIF A;  2EQS A;  3J80 c;  2LSS A;  2CKZ B;  1K73 C;  2ZJQ A;  2UUA Q;  1E1O A;  5M5W H;  2VNU D;  1HZC A;  2RCN A;  1IBK Q;  1VQE A;  4DR2 L;  4BY7 G;  3I4N G;  1EIY B;  2ZTC A;  4A4I A;  4DR4 L;  3D0F A;  1SE8 A;  3BA8 A;  3FKI G;  1P8L A;  1L1O B;  1RL2 A;  5DLQ E;  2E2H H;  1YHQ A;  3NEM A;  1EFW A;  3M4O H;  4JCV E;  3MEF A;  5C0X I;  3ICE A;  1IL2 A;  1Q81 C;  2OTJ A;  4EFB A;  4A3M G;  1XNR Q;  1NY4 A;  2Q2H A;  3PIP A;  1NBW A;  4DK6 C;  1ASZ A;  1FL0 A;  2BA1 A;  4R4T A;  1PH5 A;  2I0Q A;  4R4Q A;  3K0X A;  1G29 1;  4YHH Q;  1YIJ A;  4DUY L;  4P73 A;  4A75 A;  1PYS B;  1XDN A;  1MKH A;  1NTG A;  4OWT B;  4A93 G;  1WI5 A;  3CC4 A;  2V1C C;  2NN6 I;  2JK8 A;  5IP9 H;  1VQF A;  4LF7 Q;  4JOI A;  3U58 A;  2BH2 A;  1HR0 Q;  4X62 L;  5E7N A;  1HH2 P;  1N9W A;  4LUO A;  2UXD Q;  5D1P A;  1VS0 A;  3PO3 G;  4PZ6 A;  2E2J H;  1B04 A;  2NVX H;  1X54 A;  5IWA L;  3H15 A;  3PF4 A;  3CXC A;  3Q8D A;  3ULP A;  1EIF A;  1VQ7 A;  2HVR A;  2UU9 Q;  3J7Z C;  2N78 A;  4LFB Q;  1T9H A;  1LUZ A;  4DNI A;  4X64 Q;  3G4S A;  3HOZ G;  3EIV A;  4CC5 A;  3E9I A;  2CWA A;  2VQF L;  4LF9 L;  4DR7 L;  2A1A A;  1H95 A;  2R92 H;  3RZO H;  1JJG A;  2R93 G;  2QA4 A;  4A3E H;  3M9B A;  1EYG A;  3PCO B;  3M3Y H;  4WJ4 A;  3PUX A;  2ZM6 Q;  4IPD A;  3I56 A;  4HJA A;  1B70 B;  1OXU A;  1KAW A;  2ZM6 L;  1XPU A;  1YHA A;  4A3F H;  1VQ8 A;  4UCT A;  3HOX G;  2Y0S G;  2PNH A;  1QUQ A;  1W3S A;  4YY3 Q;  1VQO A;  3STB D;  1OXT A;  1Y1W H;  2K5N A;  3FP9 A;  3OYY A;  1MJC A;  1YI2 A;  3GTG H;  1CKN A;  1XMO L;  3H3V I;  4BA2 I;  3ERS X;  1OXS C;  1I94 L;  3H3V H;  1TAE A;  3RTX A;  2ID0 A;  5C4X G;  4L5S A;  2IX0 A;  1GM5 A;  1K9M C;  2KCM A;  3CC7 A;  4JI2 L;  3GJX B;  5JJK A;  2HT1 A;  5C44 H;  5AJ3 L;  1VQB A;  4A3C H;  2AWO A;  3L2P A;  2K4K A;  3CQZ H;  2UU9 L;  2HIV A;  2JA8 G;  3TY9 A;  1XNQ Q;  5JEA J;  1KIX A;  2OWO A;  2JA7 G;  3JSL A;  1HZA A;  2YTY A;  1L2F A;  2E8G A;  3CME A;  4B3S L;  3HOZ H;  4LF7 L;  1C0A A;  4JI8 Q;  3KJO A;  4JI7 L;  4OXP A;  4JI0 L;  3PO2 G;  5IYC G;  4B3T Q;  1VQ6 A;  4GKJ Q;  1PH6 A;  3ZJY C;  1KL9 A;  3M4Q A;  2HHH L;  4JBK A;  2R7D A;  4O2D A;  2RF4 A;  2N49 A;  4AYB G;  4DV0 L;  4DV6 L;  1N32 L;  3PIO A;  4OX9 L;  5JEA G;  4X64 L;  5LMU Q;  2GN5 A;  3RN2 A;  2I5L X;  4GN4 B;  2QGQ A;  2QEX A;  4XTC S;  3TEH B;  2IHE A;  3K80 C;  2B63 G;  3RLF A;  4DV1 L;  3S16 H;  1BBU A;  4IFD I;  3UQ8 A;  2MQH A;  2ATW A;  4EFE A;  3TRZ A;  5IP7 H;  3KFU A;  1I6H H;  2JA7 H;  1HNX Q;  1IZ6 A;  4HJ9 A;  2UUA L;  4A76 A;  4GOP A;  1MIU A;  4K0K Q;  4BXX H;  4IFD G;  1IYJ B;  1WYD A;  4J15 A;  2KHJ A;  4PZ7 A;  1J5E Q;  4NXN Q;  1E24 A;  4P74 A;  4PZ8 A;  2PI2 E;  4LFA Q;  3BAA A;  3FHW A;  3JSN A;  3NEL A;  4QY7 A;  1N36 Q;  4X6A H;  4A3B G;  3KLW A;  1Y1W G;  2VQE Q;  5C44 G;  5LMN Q;  2WFW A;  4MTN A;  4DK3 C;  1UWV A;  1BVS A;  2CQO A;  2VQE L;  4A3G H;  3E9H A;  1CKO A;  3M7N A;  2KEN A;  1IXR A;  4LH7 A;  4H02 A;  4YWL A;  1CKN B;  2A8V A;  1G51 A;  5M3M H;  1QUQ B;  1TWH H;  2WB1 E;  3GTQ H;  3GB8 B;  3GD7 A;  4DUZ Q;  1VQA A;  4LNQ A;  3S17 H;  2WAQ E;  3CCU A;  1VQ5 A;  5H1S E;  4E6N A;  5GQO A;  1HNX L;  4OO1 G;  1I3Q H;  1HZB A;  5IYB H;  4CC6 A;  4GLA C;  4YWM A;  4EQ5 A;  2Y0S E;  4GNX A;  1HNW L;  1PYB A;  1C9O A;  1FGU A;  1X56 A;  4IJH A;  4DR6 L;  5M3M G;  1HJP A;  5GAE C;  1LM0 A;  2UXC Q;  3RLN A;  3NBZ B;  4A3B H;  2AKW B;  1SN8 A;  1QZG A;  1PVO A;  3A5Z B;  4UCO A;  4JV5 Q;  2AWN A;  4GLV B;  1SFO H;  2HVQ A;  3KOJ A;  4DV5 L;  4KHP Q;  2WB1 G;  1GKH A;  3OTO L;  4R1J A;  3CMA A;  4BBR G;  4JI3 Q;  1TWG H;  1N33 L;  4POF A;  1K83 H;  2CFM A;  3J81 i;  2JA9 A;  3UE0 A;  4LFB L;  1PH9 A;  4K0K L;  3UE1 A;  5LMN W;  4EEQ A;  1TWA H;  4UFZ A;  1QVG A;  1S3O A;  1PH7 A;  4A3J H;  2JA6 G;  3KF6 B;  4JOI C;  1AH9 A;  3A74 A;  3K7A H;  3K81 C;  1YHB A;  2ASB A;  4LF5 L;  3NBH B;  1M1K C;  3CCL A;  2ZTD A;  2Z6K A;  5FLM G;  1NMG A;  3HKZ G;  3I4N H;  1VQJ A;  1JJ2 A;  3S1Q H;  5IT9 c;  2JA8 H;  4DR5 Q;  5C0X G;  3HFZ B;  2NZH A;  4IJL A;  2N8N A;  2ZJP A;  2PI2 A;  3HKS A;  5HGQ A;  5FLM H;  3CAM A;  3F2B A;  1Q86 C;  1K8G A;  1SLJ A;  1OXV A;  2I5H A;  4YY3 L;  3HKZ E;  1VQD A;  1KRS A;  2N3S A;  4JBM A;  2D62 A;  5IYD H;  3RLO A;  3FKI H;  3S1R H;  3GTM H;  1L1O A;  3NEN A;  1XMQ Q;  1GVP A;  3S1M H;  4NXM L;  2UXB L;  5JJI A;  1AE3 A;  3CCJ A;  3LGJ A;  3W5O A;  4OO1 I;  3F1Z A;  2NN6 G;  3CP0 A;  4YCW A;  1JT8 A;  4QJF A;  4DRF A;  4JI6 L;  4OWW B;  1IBL Q;  1Q7Y C;  4HIM A;  4B3R L;  2RHQ B;  3CPF A;  1JB7 A;  2IY5 B;  1O7I A;  2NVT H;  2MFI A;  4JBW A;  4R4O A;  3J80 i;  2K50 A;  3I7F A;  3KF6 A;  2DUD A;  4AIM A;  3T1Y Q;  4LF8 Q;  3CCQ A;  2PQA B;  3W1B A;  5IE8 A;  4A3J G;  4NXN L;  1J5E L;  4HJ8 A;  4DKA C;  3L7Z C;  5IP7 G;  2OQ0 A;  4TQU S;  4HJ5 A;  1YJN A;  4QQB X;  2D0O A;  5IWA Q;  5C3E G;  1GD7 A;  4AH6 A;  5IYC H;  2K5V A;  4DR5 L;  1XJV A;  5DIS C;  4L5R C;  5IYD G;  3PUV A;  1E7Z A;  4BY1 G;  3MXN B;  4GKK L;  4IPH A;  4P71 A;  3UDG A;  2E5L Q;  4OON A;  4JI4 L;  4DV7 Q;  1N32 Q;  4IPC A;  5JJL A;  2AMC B;  1E3P A;  1JE5 A;  2K14 A;  2K5H A;  4UCS A;  3SGI A;  1VQI A;  4LUV A;  1D8L A;  1X6O A;  4GN5 A;  2FXQ A;  2NVY H;  1YZ6 A;  3KDF A;  3G71 A;  3PF5 A;  1YVC A;  4GNX B;  4LH6 A;  4JBJ A;  4YCU A;  4A3K G;  4AQY L;  4DUZ L;  3VNN A;  1VQ9 A;  1U0L A;  3JAM i;  4IOC A;  3QWU A;  1L0W A;  3F8T A;  1V43 A;  1E1T A;  1EQR A;  1JJC B;  3PSI A;  4GS3 A;  1X55 A;  2KHI A;  5M5X H;  2NZO A;  1EQQ A;  3JC6 6;  1KRT A;  4LFA L;  1SRO A;  4A3I G;  4DR4 Q;  5C3E H;  1SMX A;  3CD6 A;  4TVA B;  3GO5 A;  2D0P A;  3HOW G;  2HIX A;  4BA1 I;  2XGT A;  5C4X H;  2F4V L;  2YV5 A;  4JI2 Q;  5AJ3 Q;  1SR3 A;  3CCR A;  2IX1 A;  1I5F A;  1EWI A;  1KQS A;  2F4V Q;  1WCM G;  3T1Y L;  3PO3 H;  3TY8 A;  1PH1 A;  4BY1 H;  1MJE A;  1P16 A;  2JQO A;  3NBY B;  1PA6 A;  2VY3 A;  4BXX G;  2HQL A;  4GOP B;  2JA5 H;  1Q1E A;  3CCM A;  4KLK A;  1VQH A;  2GVB A;  3G6E A;  4UCV A;  4BY7 H;  3F2D A;  3B6Y A;  3PUW A;  3KJP A;  1YJ9 A;  1N33 Q;  4IFD J;  4B3M L;  2R7Z H;  4DV0 Q;  3PGZ A;  3AEV A;  3I55 A;  1PV4 A;  1GO3 E;  3HOU G;  1Q82 C;  4A3D H;  4DR7 Q;  3NC0 B;  3KYH C;  4UCR A;  4JI1 Q;  1FJG L;  5GAG C;  1YNX A;  1X3F A;  5FPO A;  1KHI A;  1UEB A;  3AYH B;  5GAH C;  1XPR A;  2BH8 A;  3BU2 A;  4JI8 L;  3UDX A;  1Q8K A;  4QL5 A;  4Y7N H;  2CCZ A;  2ES2 A;  4JI0 Q;  2AHO B;  2C35 B;  1Y1V H;  3U4Z A;  4IO9 A;  2YTX A;  4DR3 L;  4C3J H;  3T1H Q;  3PN1 A;  2UXC L;  1A62 A;  1E22 A;  2YTV A;  4X65 L;  1YJW A;  3PO2 H;  3H0G H;  3S15 H;  3ULJ A;  3T1H L;  3ULL A;  2MO0 A;  1G6P A;  3GTK H;  1VQK A;  2OCE A;  2A19 A;  1C7Y A;  3BAB A;  4X62 Q;  1KD1 C;  2VS1 A;  3KF8 B;  3CF5 A;  3M4P A;  3I2Z A;  2JE6 I;  1Z47 A;  1KXL A;  4LF8 L;  1K8A C;  4A3C G;  4ALP A;  1N36 L;  1PH8 A;  4Y52 H;  1Z9F A;  2WAQ G;  3S2H H;  2OTL A;  4YHH L;  2LXJ A;  2MNA A;  1S68 A;  5FLX c;  4A3M H;  2IT1 A;  1WJJ A;  1WCM H;  3BJU A;  4LUZ A;  3HOX H;  1QVC A;  3RZD H;  4DR1 L;  2L15 A;  2UUB Q;  4JI5 Q;  1VQN A;  3HOV H;  1FVI A;  4XIG S;  4DV7 L;  1UE7 A;  1XMQ L;  4QGU A;  5J3B A;  1B7Y B;  1TWF H;  2VZA A;  1K3R A;  1U5K A;  4MZ9 A;  1OTC A;  4OWX B;  4A3L H;  3JAM c;  3PUY A;  4P72 A;  4JG2 A;  4PMW A;  5IY0 A;  3J81 c;  4DR3 Q;  2R93 H;  1YIT A;  2GVA A;  4LF6 Q;  4DV6 Q;  2DGY A;  2NVQ H;  1Q46 A;  3D31 A;  4B3M Q;  4LF6 L;  2HHH Q;  5GRO A;  1A8V A;  3RN5 A;  4GKK Q;  1S72 A;  1BBW A;  2EXD A;  4JYA Q;  4RMF A;  2UUC Q;  2B3G A;  4MNO A;  4KHP L;  4DV4 Q;  3GTL H;  4JV5 L;  4JI6 Q;  3I4O A; 
#chains in the Genus database with same CATH topology
 2PZU A;  1RIP A;  4YJ3 F;  1BXT A;  2EXZ A;  3MXU A;  1HNZ Q;  1WTO A;  4XZ3 B;  1VCI A;  1TWG B;  1X3E A;  1IBM L;  2PW7 A;  3L0O A;  1XNQ L;  5GAD C;  4DUY Q;  5ELO A;  5FPR A;  4DAM A;  2KUM A;  1JE4 A;  3HOV G;  3K7U C;  3N6R A;  3K5O A;  1RHP A;  2IW3 A;  1EYD A;  2L4N A;  1PRT D;  1Q1B A;  3A55 A;  2FB9 A;  2K1B A;  3J7A 5;  3Q6S A;  1SDF A;  4O4H F;  1A9X A;  1QWY A;  2WII B;  3S14 H;  3A7L A;  3KF8 A;  4R9W A;  3T54 A;  4KI0 A;  1ZYR C;  4JI1 L;  4R4C A;  4OEL B;  1LYL A;  1CM9 A;  1HNZ L;  1CHP D;  1CQJ B;  4FFL A;  1IBL L;  3V4Z A;  4B3R Q;  4UY8 C;  3H09 A;  4S3S A;  3KBG A;  3BA9 A;  2KCN A;  3NBI A;  1FGB D;  3GTP H;  3RUZ A;  1JOQ A;  1G2W A;  1A0I A;  4DR6 Q;  2V5A A;  5I5X A;  3ORR A;  1NMF A;  4HIO A;  1VQP A;  3HOY G;  4C56 C;  1EIG A;  1I4H A;  5FJ8 H;  1XMO Q;  1A63 A;  1ET9 A;  1TA8 A;  1PK8 A;  4A3F G;  2L1B A;  2E5L L;  1JMC A;  4IOA A;  4BBR H;  2B39 A;  2E2I H;  5K3W A;  2H1E A;  1STA A;  1PH4 A;  2CZG A;  4EEQ A;  3K5N A;  2VUM G;  1J6Q A;  5FR9 A;  1W96 A;  2B29 A;  3T16 A;  2VUM B;  2EIY A;  3KRE A;  5LL6 S;  2I80 A;  4XXE A;  4EQO A;  3S2D B;  4HN7 A;  2YU9 B;  3A7A B;  3NK9 A;  3UDF A;  4CKE A;  3PQI A;  4A3L G;  5BPH A;  1TS3 A;  2JEB I;  4A3B B;  3GTK B;  3TW6 A;  5BWU A;  4RG1 A;  4HED A;  4X3U A;  1C30 A;  4R4I A;  3I90 A;  3BVG A;  2BE5 D;  3LWE A;  4QIW E;  1B53 A;  1I6H B;  3HOW H;  3A5U A;  1NAP A;  2K52 A;  4IQZ A;  4NB3 A;  3G48 A;  4FXK C;  4BS9 A;  5TSS A;  3RR5 A;  2DY8 A;  1TXY A;  1Y14 B;  2XWB B;  4YWK A;  4A3I B;  2VUG A;  3UZO A;  1ESF A;  4A3D B;  2A68 C;  1WTW A;  4ZK9 B;  1M90 C;  3VPC A;  4I7Z C;  4FFO A;  5BR8 L;  2EYO A;  4RKL A;  5C0X J;  5IIF A;  3E0E A;  4HSP A;  3P1H A;  3PV0 A;  3GTO H;  5EQ0 A;  4K14 A;  1WRV A;  1ONL A;  2RDH A;  4Z9C B;  4MV6 A;  1DD2 A;  1R9T H;  2DAA A;  2F0O A;  3TS0 A;  2K75 A;  2Q2U A;  1G91 A;  5C44 B;  2EQS A;  3J80 c;  2ZJQ A;  2VNU D;  4C3J G;  2EZV A;  4IUQ A;  4OIK A;  4DF7 A;  3BS1 A;  4DR2 L;  4DR4 L;  1LTB D;  1L1O B;  3HP3 A;  5DLQ E;  2E2H H;  1YHQ A;  1EFW A;  4XX0 B;  4A3J B;  1Q81 C;  4A3M G;  1RD9 D;  1NY4 A;  1SJE D;  2BA1 A;  2F0J A;  4A3M B;  1PH5 A;  1A48 A;  4R4Q A;  1D5M C;  1LAB A;  4I4T F;  1GXD C;  5HV6 A;  3SK6 A;  1C3O A;  1WI5 A;  4JW0 A;  3J7A V;  1RF2 D;  2JK8 A;  5C5M A;  1AFP A;  4JOI A;  2IWH A;  1HR0 Q;  4X62 L;  1S5F D;  3S15 B;  1VS0 A;  2EY6 A;  3PO3 G;  2EE1 A;  5IGF A;  1MI2 A;  4NKL A;  4H7B A;  5ELC A;  2NVX H;  1QG7 A;  1X54 A;  4KY7 A;  1LTI D;  4FFN A;  3H15 A;  3CXC A;  3TME A;  2F0D A;  1EIF A;  1VQ7 A;  1I1K A;  3T99 A;  5KX5 F;  2C5C A;  1A2T A;  3QG1 A;  3NQT A;  1HTP A;  5FLX L;  1LUZ A;  2XVS A;  3MWD A;  1FD7 D;  1WTV A;  2A1A A;  2R92 H;  2R7Z B;  1DYQ A;  1UC8 A;  3SK8 A;  4TRD A;  1EUC B;  1EWH A;  3I56 A;  2HQE A;  1KAW A;  1STN A;  2ZM6 L;  1XPU A;  1VQ8 A;  4UCT A;  1OXT A;  1CZG A;  1UNS A;  3MWE A;  1MJC A;  2K5Q A;  1CKN A;  3BVM A;  1TQO A;  5EGT A;  1SMY D;  1I94 L;  1TAE A;  5D8D A;  2ID0 A;  5C4X G;  1CT1 D;  2IX0 A;  2MPM A;  2KCM A;  3CC7 A;  2A6H D;  3K5L A;  2JA6 B;  2R93 B;  2X0S A;  5C44 H;  4H0L C;  3L2P A;  4XQN A;  3T4A C;  1XNQ Q;  5M3F B;  2DZD A;  3JZI A;  1XTC D;  4Q5V A;  2FHT A;  2E8G A;  3CME A;  1C0A A;  4JI8 Q;  3UFX B;  2KED A;  4N9P A;  2HCI A;  4OXP A;  5IYC G;  4CGY B;  3ZJY C;  3OSO A;  4ILW A;  3UI2 A;  3K58 A;  4JBK A;  4EVO A;  5EBD A;  5EKL A;  5C4Z A;  4DV0 L;  3GID A;  2L9H A;  4OX9 L;  3VR2 A;  2GN5 A;  1GHJ A;  3DHQ A;  1SXT A;  3OHX C;  2QGQ A;  4GN4 B;  4BBR B;  2FPG B;  1JDB B;  5IYZ F;  3K80 C;  5BWX A;  3CQZ B;  2ATW A;  1M8A A;  2I87 A;  5ELD A;  1I6H H;  4FP5 D;  3JRW A;  1A3V A;  1Y1V B;  1HNX Q;  1IZ6 A;  3A8I E;  1GUG A;  2EJ2 A;  5LOV F;  2GQR A;  3I70 A;  5FO9 B;  4PZ7 A;  5IT9 E;  1E24 A;  4P74 A;  3BAA A;  4ZQI A;  1RTN A;  5C4H A;  3GTP B;  5JVH 3;  3D4D A;  2EYF A;  4X6A H;  1SYG A;  2NB0 A;  3KLW A;  1HXY D;  3AMU A;  4C3I G;  5LMN Q;  1IYE A;  4GZY C;  4DK3 C;  1UWV A;  1BVS A;  4A3G H;  4KY5 A;  1Y69 U;  2QEJ C;  1CKN B;  3NP8 A;  5D3D A;  1IYV A;  1TWH H;  3MFG A;  1JQY D;  3GTQ H;  3GD7 A;  4Q0F A;  1VQA A;  1KTA A;  5JPM C;  4FF4 A;  4E6N A;  5GQO A;  1I3Q H;  1RKN A;  5IYB H;  4EQ5 A;  2Y0S E;  4GNX A;  2E2J B;  1EY4 A;  4H44 C;  1U4R A;  4DR6 L;  1HJP A;  4QMG A;  3NBZ B;  1PFM A;  1SN8 A;  5IGE A;  3MJF A;  3ONA B;  1U9R A;  4GLV B;  1SFO H;  3HKZ B;  5JVD F;  3MWY W;  1GKH A;  2IJ0 A;  4DFA A;  2MGS A;  3CMA A;  4BBR G;  1TWG H;  1ICF B;  1GUW A;  3C1F A;  3J81 i;  2JA9 A;  3I12 A;  1Q90 A;  3I73 A;  4IUN A;  1AW7 A;  2RBM A;  1QVG A;  2C9O A;  3A74 A;  3S14 B;  3T9C A;  3K81 C;  1FNV A;  3PO2 B;  3NBH B;  3CCL A;  5FLM G;  1VQJ A;  5IT9 c;  1I3Q B;  4MN3 A;  4IUR A;  3QO2 A;  1B6S A;  5FLM H;  1A6X A;  1SLJ A;  5I5T A;  1OXV A;  4YY3 L;  3J81 E;  3GTQ B;  2ZDG A;  4JBM A;  1KRS A;  1L1O A;  1BQQ T;  5JAV A;  1AE3 A;  3SHL A;  3CCJ A;  3LGJ A;  1OBD A;  2NN6 G;  5CR3 A;  2K7V A;  2RCF A;  3EQL C;  4XDX A;  4R8I A;  1TR5 A;  4DN4 M;  3T9D A;  1O7I A;  5CA1 F;  1Z7T A;  2MFI A;  3J80 i;  2K50 A;  1MSG A;  3CCQ A;  5A2Q L;  5KND A;  4DKA C;  3L7Z C;  1STY A;  1Z2P X;  4HJ5 A;  1SNQ A;  2D0O A;  2JA8 B;  4AH6 A;  4C3J B;  5I5S A;  1A2U A;  1C8C A;  3PUV A;  2CH4 A;  1E7Z A;  5EPL A;  4GKK L;  2BOS A;  4IPH A;  3UDG A;  2E5L Q;  4OON A;  3K59 A;  4IPC A;  2AQ3 B;  1U4P A;  4ZKC B;  3MC0 B;  4BWG B;  3BYY B;  1GOZ A;  3CKI B;  4TKO B;  1IKL A;  1SYD A;  4DAY A;  2FXQ A;  2WYO A;  2B63 B;  2Y4R A;  4DUZ L;  5CV9 A;  3VNN A;  3JAM i;  1L0W A;  1V43 A;  2R86 A;  5CR5 A;  3OIQ A;  1JJC B;  1STG A;  3T7A A;  2DNC A;  3HBL A;  1F77 A;  2NZO A;  5D14 A;  1KRT A;  1IYU A;  1GSA A;  2HUG A;  4A3I G;  1CTM A;  1KUT A;  1U4M A;  3HEJ A;  4TVA B;  5A2Q E;  1VMC A;  1RTO A;  2HIX A;  4BA1 I;  5C4X H;  2QKI C;  2YRW A;  1DOK A;  3TP8 A;  1K8O A;  1EWI A;  1KQS A;  4M0J A;  3WWH A;  3DXJ C;  4OEM B;  3T1Y L;  3JZF A;  4BY1 H;  1MJE A;  3LWB A;  3H94 A;  1CA6 A;  2VY3 A;  4GOP B;  1D1K A;  2B8F A;  1WCM B;  2W71 A;  3WO1 A;  5BWV A;  1VQH A;  4FE2 A;  2D9U A;  3F2D A;  1E4E A;  4O4L F;  5CC4 A;  3PUW A;  3P7J A;  1YJ9 A;  1N33 Q;  1MD2 D;  1IKM A;  4B3M L;  2W6M A;  2R7Z H;  1PV4 A;  1LTR D;  1PFB A;  1SYB A;  3LWU A;  2F0H A;  3NC0 B;  3I8Z A;  1PLF A;  1I4Q A;  4KKT A;  3WO0 A;  1YNX A;  1UEB A;  3AYH B;  5GAH C;  2YS6 A;  2CCZ A;  3BU2 A;  2A69 C;  4JI0 Q;  1V1P B;  4QL5 A;  2ES2 A;  4JI7 Q;  1G2S A;  2AHO B;  4DR3 L;  2YTX A;  5M5Y B;  3S9W A;  3PN1 A;  1A62 A;  3LUL A;  4KHV A;  3S15 H;  3T1H L;  2J7Z A;  4RZQ A;  2MO0 A;  4HCE A;  4YIJ A;  4FFR A;  1VQK A;  1C7Y A;  1LT5 D;  2A5H A;  4X62 Q;  1AN8 A;  2VS1 A;  4K5W A;  3CF5 A;  5M5X B;  1KJ9 A;  3HT5 A;  1K8A C;  1PH8 A;  3QFF A;  1TWC B;  1Z9F A;  5CV8 A;  3S2H H;  4IUT A;  4YHH L;  1TS4 A;  5FLX c;  1KLU D;  4A3M H;  3NQI A;  1WCM H;  4M8A A;  5BN4 A;  4LUZ A;  3HOX H;  1H9M A;  4O7S A;  1S4Z A;  4DV7 L;  1XMQ L;  1EYC A;  3V4S A;  2HHF B;  2ZGI A;  4O7Y A;  1B7Y B;  1TWF H;  1OTC A;  1LT3 D;  2VB3 X;  4OWX B;  1EKP A;  4IZO A;  5FOB B;  4PMW A;  4DK1 A;  2GVA A;  4XYM B;  1MGS A;  2ABJ A;  2NVQ H;  2F0M A;  4CJ1 B;  1HUN A;  1HFN A;  4KN4 C;  3VYT A;  5C4J B;  3VA5 A;  4JYA Q;  1V8Q A;  2B3G A;  2K6A A;  3D8G A;  4OO1 H;  1GLV A;  5KGU A;  4LFA Q;  4A3E G;  2H5X A;  2RSN A;  5I9P A;  3CCE A;  1W2B A;  1ASY A;  5BR8 Q;  4HIK A;  2DAB A;  2MO1 A;  3SE0 A;  1UE5 A;  2B63 H;  4WJW A;  1SCU B;  4A3I H;  5IYB G;  4Q4C A;  5G3L D;  1VQ4 A;  1EQV A;  4DIM A;  1PRT B;  3A8J E;  2F0E A;  1S5E D;  4JXU A;  4DA2 A;  4ME3 A;  3MXP A;  3U50 C;  1F9P A;  4APV A;  3F2C A;  2SOB A;  1UE1 A;  1ML0 D;  4MHE A;  3OIP A;  3VDY A;  1S40 A;  4O7R A;  1ZKO A;  4FXD A;  2BDO A;  3TQY A;  5LMU L;  3V2T A;  3GTJ H;  3K7A B;  4F87 A;  1SNO A;  3WWJ A;  4LFC Q;  2XTI A;  2YU9 H;  4C3I H;  1FJG Q;  3S2D H;  4TSS A;  1EOT A;  1XK5 A;  1X32 A;  1NE3 A;  1CKM A;  3GDE A;  2MJ8 A;  1WR2 A;  1OBG A;  4A3D G;  3DAA A;  1HZ9 A;  2A1H A;  3GTL B;  5I47 A;  2Z6K C;  1SYF A;  1SRU A;  4MV8 A;  5K5P A;  1SE4 A;  1F9R A;  2Q2T A;  3OPO A;  5BWT A;  2QCP X;  5DAU A;  4PMC A;  1N34 Q;  4UP9 A;  2NUC A;  1EOV A;  1WTR A;  2G9H D;  4IUU A;  1C48 A;  3HOY H;  4EGJ A;  2FJ2 A;  2RVL A;  4I65 A;  3W3A A;  2F0K A;  1H9S A;  5I4D A;  4NPS A;  2EYL A;  2JP1 A;  4LF5 Q;  3HOV B;  4JI5 L;  2UUB L;  2K03 A;  1ET0 A;  1YEZ A;  4POG A;  2RHS B;  4G7Z C;  4UCU A;  1NSN S;  1I7N A;  4F88 A;  4AQY Q;  4XQJ A;  3O13 A;  2Z0S A;  4DV2 Q;  1XPO A;  2ALY B;  1PH2 A;  3I4M H;  1IBK L;  4LF9 Q;  4KJO A;  1QZH A;  1SFO B;  3IRB A;  1DCZ A;  4LFC L;  1B8A A;  3J81 j;  1HR0 W;  4AYB B;  1I94 Q;  1VMP A;  5IOD A;  2VW9 A;  3AW8 A;  4JC0 A;  4DNT B;  2N88 A;  1D2B A;  5ELN A;  1Z2N X;  4DR2 Q;  2JJQ A;  3G8C A;  3KDF B;  5BWR A;  4DAY B;  1I50 H;  3K8A A;  2YS7 A;  3WWI A;  3VOT A;  1TY0 A;  1UAP A;  2B2W A;  2ZXO A;  4DV5 Q;  2KCT A;  3MXN A;  3CPW A;  3OTO Q;  3TS2 A;  4O7L A;  4FF2 A;  1JC7 A;  2EVB A;  2PCF B;  3FPP A;  4GLX A;  4A93 H;  2HGS A;  1STE A;  1UE6 A;  2HD3 A;  4B3S Q;  5IGD A;  1Z2O X;  5KYI A;  4P75 A;  4HNT A;  1V9P A;  5DGH A;  2Z6B A;  2VB2 X;  4RFB A;  1A3T A;  1HR0 L;  4B3T L;  3IKJ A;  4G4K A;  2IP4 A;  4IN3 A;  1M4V A;  1E1O A;  2B2U A;  3DEP A;  5M5W H;  2VXW A;  1SNC A;  2RCN A;  1SBB B;  1EIY B;  2ZTC A;  1J8I A;  1K28 A;  1SE8 A;  2J0T D;  3FKI G;  5IGG A;  1HPC A;  1GSO A;  4JCV E;  5C0X I;  5HNE A;  1IL2 A;  1XNR Q;  1KLG D;  3PIP A;  1NBW A;  3GV3 A;  4DK6 C;  1ULZ A;  4QSH A;  3TW7 A;  2I0Q A;  1G29 1;  1D1I A;  4YHH Q;  1YIJ A;  3ETH A;  2RDF A;  3MA2 B;  4A93 G;  4K6N A;  3L3O C;  1EYA A;  1EEI D;  3D6W A;  4K2L A;  3JAM L;  3U58 A;  4B08 A;  4LUO A;  2B2Y C;  3JAM E;  5DEH A;  1NUC A;  1B04 A;  1PRT C;  5IWA L;  4ULL A;  4C3H G;  1BUV T;  4CDE C;  3Q8D A;  3PF4 A;  2NBF A;  4FF1 A;  2N78 A;  2F0T A;  1HA5 A;  1T9H A;  4DNI A;  4X64 Q;  3G4S A;  1VBG A;  5D3I B;  4PMB A;  2OEO A;  4UHV A;  5IT9 L;  1H95 A;  5JQG F;  3AB9 A;  3RZO H;  2R93 G;  2RA4 A;  2QA4 A;  3K3P A;  1CI3 M;  4A3E H;  1EY0 A;  1EYG A;  3SEB A;  3M3Y H;  4K8I A;  3PUX A;  4WJ4 A;  4IPD A;  3J80 L;  4HJA A;  1B70 B;  1JDE A;  4DXG A;  1EU3 A;  3R8B A;  1B4O A;  4A3F H;  2HHF A;  1VQO A;  2Y0S G;  4CMF A;  1SND A;  3CRL C;  3FEW X;  3GTG H;  4BA2 I;  1HRJ A;  1OXS C;  4NZN A;  3DM1 A;  4JI2 L;  3GJX B;  4DAV A;  3V05 A;  2F0U A;  1VQB A;  3E6Z X;  2HIV A;  5CM0 A;  3TY9 A;  4EQN A;  1WTH A;  5JEA J;  2V4D A;  3JSL A;  2NU6 B;  1L2F A;  1L0X B;  3MEH A;  3TP7 A;  4YAJ B;  2LFN A;  1VQ6 A;  2GPS A;  1UEA B;  3S2H B;  1E0B A;  2SDF A;  4LK1 C;  2B2U C;  3M7G A;  2R7D A;  4QB4 A;  2EJ0 A;  4DV6 L;  4O7T A;  2NTS A;  4ZRZ A;  3BDO A;  5JEA G;  4CKC A;  1G2T A;  4LAA A;  5E4X A;  3RN2 A;  3NTH A;  4C2M B;  2QEX A;  4XTC S;  1SYE A;  1VBH A;  3ND9 A;  3KBX A;  1KDC A;  2A73 B;  2L0C A;  4DV1 L;  3S16 H;  2MQH A;  3TRZ A;  3TEK A;  3FVQ A;  2K28 A;  3NWT A;  4GOP A;  4BBS B;  4X3S A;  4K0K Q;  3GTG B;  5DAA A;  1BDO A;  2KHJ A;  5GON F;  4KKS A;  2YRX A;  4UDU C;  2NVT B;  3GTO B;  1DV1 A;  5CB4 F;  3NEL A;  4QY7 A;  3NUA A;  3G6J B;  4A3B G;  2B2Y A;  1BXR A;  3M3Y B;  3CRK C;  2E74 C;  1U4L A;  2CQO A;  3M7N A;  4MA0 A;  1IXR A;  1GUN A;  2R7K A;  4H02 A;  4YWL A;  1GGO A;  2A8V A;  3JRX A;  1NNX A;  1QUQ B;  4BY1 B;  1E2W A;  3TP5 A;  3GB8 B;  3S17 H;  5H1S E;  4RH6 A;  4YWM A;  1H9K A;  1C9O A;  3BZD B;  5CBA E;  5M3M G;  3VR5 A;  3RLN A;  2UXC Q;  4A3B H;  5KNB A;  4UCO A;  1B3A A;  2AWN A;  2QB5 A;  1DOL A;  3DTF A;  2Z4I A;  4YJ2 F;  4JI3 Q;  2GA4 B;  1K83 H;  4XYL B;  4ZCK A;  3UE0 A;  1PH9 A;  4K0K L;  3UE1 A;  5LMN W;  4NZM A;  2JA6 G;  2AQ2 B;  3KF6 B;  4JOI C;  4ZYS A;  3QQM A;  1YHB A;  2YZL A;  4LF5 L;  1M1K C;  2Y0S B;  2D2C C;  3BDL A;  1I4P A;  2JA8 H;  2B2T C;  1F2L A;  3IL8 A;  4IJL A;  2NZH A;  2V59 A;  1G8Z D;  5HGQ A;  1Q86 C;  3CAM A;  1LTS D;  3HKZ E;  3IAY A;  3X3N A;  2N3S A;  5D65 A;  1ZYR D;  1Y1W B;  3FKI H;  3S1R H;  3GTM H;  3HGB A;  2BDN A;  3S1M H;  2UXB L;  5JJI A;  1EFI D;  3R5X A;  4O4J F;  2TSS A;  4A93 B;  3W5O A;  3F1Z A;  1JT8 A;  3CP0 A;  1NR2 A;  3MXG A;  4DRF A;  3K5H A;  4MV4 A;  1IBL Q;  2RHQ B;  2VPQ A;  3NTK A;  2EDG A;  1EWC A;  3Q24 A;  1CQI B;  3I7F A;  3KF6 A;  2DUD A;  4AIM A;  2DLN A;  4LF8 Q;  3CHB D;  3W1B A;  5IE8 A;  2YL2 A;  4NXN L;  4E6I A;  1PRT F;  5IP7 G;  2OQ0 A;  2ZDH A;  4NDX A;  5C3E G;  1GD7 A;  3R3O A;  4G7H C;  4L5R C;  2W6Q A;  4ID6 A;  3GV6 A;  3MXN B;  4ABN A;  4P71 A;  5JJL A;  3MVV A;  4I55 F;  3HO8 A;  4ZHQ F;  1JE5 A;  3EA6 A;  2G5D A;  4UCS A;  4LUV A;  4TVI A;  2E2D C;  2NWG A;  5ELF A;  1X6O A;  5DMX A;  3K5M A;  3PF5 A;  4RGO S;  4GNX B;  4JBJ A;  4UUG A;  4AQY L;  1VQ9 A;  3TDQ A;  1EZ1 A;  4IOC A;  3BDC A;  4OL7 A;  3D4R A;  1BNC A;  3PSI A;  1X55 A;  1BBX C;  1STH A;  2XSC A;  1JLL B;  1TS2 A;  4LFA L;  2VR1 A;  1SRO A;  5CMD A;  3H0G B;  3CD6 A;  1GUS A;  2FMC A;  2F4V L;  2YV5 A;  3CCR A;  1SR3 A;  4Y7N B;  5J1Z A;  1HFG A;  5LP6 F;  3TBI B;  1WCM G;  4RKB A;  3TY8 A;  2DJG C;  5A35 A;  2EJG C;  2B2V C;  2CNV A;  2JA5 H;  3RZD B;  3RV4 A;  3C1E A;  2KVM A;  2EJF C;  1M0T A;  4TV8 F;  1AZQ A;  1FYC A;  4IFD J;  1N32 Q;  3AEV A;  3HOU G;  1Q82 C;  4DR7 Q;  2E76 C;  2W6O A;  2PZT A;  1EYZ A;  1IW7 D;  3GTJ B;  5FPO A;  1KHI A;  4X3T A;  1XPR A;  2HVR A;  4MV1 A;  3U4Z A;  1Y1V H;  1GUO A;  4FFP A;  2Q8R E;  3T1H Q;  2AQ1 B;  1X3P A;  1E22 A;  1I4G A;  1R4Q B;  1L0Y B;  1DV2 A;  2OCE A;  3KF8 B;  5AFW A;  1KNE A;  2JE6 I;  4IUV A;  1KXL A;  1SMY C;  4O42 A;  3U54 A;  1N36 L;  4Y52 H;  4MV3 A;  5I5Y A;  2N55 A;  3CSW A;  1O7Z A;  3FPU B;  3MFY A;  1CE8 A;  4BY7 B;  2PN1 A;  2B8G A;  1QVC A;  1EY6 A;  2UUB Q;  4JI5 Q;  4KTA A;  1VQN A;  1FVI A;  1ZEQ X;  1XX8 A;  4A3K B;  2HDK A;  3PIP 3;  4MZ9 A;  2EY5 A;  1O7Y A;  4ZOL F;  3H3V C;  2R93 H;  3S1Q B;  4L6T B;  3RD4 A;  3S17 B;  3J81 L;  1RDP D;  3D3R A;  2HHH Q;  1TWF B;  1A8V A;  5C3E B;  5COR A;  1BBW A;  1II3 A;  5JOB A;  4RMF A;  3T53 B;  4MNO A;  4KHP L;  1Q8I A;  4JV5 L;  4JI6 Q;  4HID A;  1BKB A;  1JWS D;  3I3C A;  3R5H A;  4DV4 L;  2CNU A;  2XCL A;  4KHZ A;  2YZN A;  3R5F A;  2R92 G;  3TP6 A;  1TWC H;  1A3U A;  1HTL D;  1PZJ D;  3KAK A;  4A3G G;  1DOM A;  3BAC A;  3VR3 A;  2F0I A;  3ER0 A;  1AE2 A;  2M9V A;  1B1Z A;  2COG A;  5ELE A;  4BBS H;  5D1O A;  1IL8 A;  4YAK B;  4L1K A;  1KT8 A;  3QOJ A;  3CCS A;  4XT1 B;  5CV7 A;  5M5Y H;  5EPJ A;  2EJ3 A;  5I5W A;  5IGB A;  1N8R C;  3S16 B;  1JIC A;  4UP7 A;  3EBE A;  4IPG A;  5JPN C;  1MHW C;  4OIJ A;  2XIW A;  1K0R A;  2X5R A;  5E3F A;  4IHJ F;  4GOP C;  3TRE A;  3E3X A;  1DXM A;  1KAB A;  1VQC A;  3ITP A;  5K36 H;  3ETJ A;  2HDL A;  4Q4D A;  4LF4 L;  1Y8N B;  4GNX C;  2WP8 J;  2F0Q A;  2EYM A;  3N52 A;  2E2H B;  3SXH A;  4EX5 A;  1CSP A;  3STB C;  1CSQ A;  4IIJ F;  3QIA A;  1X9N A;  3AFP A;  2OT2 A;  1T5X D;  1E4E B;  3F2U A;  4O2B F;  4CE5 A;  2QIL A;  5M3F G;  4HMJ A;  1I2L A;  4TM5 A;  4PG3 A;  3AFQ A;  2PW5 A;  2YYA A;  4GN3 B;  4A3K H;  2IHF A;  3WWV A;  3CC2 A;  1Q3L A;  1NJI C;  3W1G A;  2CWP A;  3T9B A;  4B9X A;  4WJ3 M;  4U67 3;  3PUZ A;  4WBN F;  2JA5 G;  4MAM A;  5NUC A;  4DV2 L;  4OGQ C;  1PHJ A;  5JH7 F;  2R7F A;  5FK9 C;  4FXG C;  2NZ1 D;  4DPG A;  3I4M G;  2R7Z G;  5C6A A;  2F3I A;  1EY5 A;  4X65 Q;  3A0J A;  3CW2 C;  4RCN A;  3DM3 A;  4NXM Q;  3QJY A;  1WOC A;  4N8F A;  4DV1 Q;  5IP9 G;  3C46 A;  1Y1V G;  3DF7 A;  2CQA A;  2Q8T A;  4C3H B;  1D7Q A;  4LW1 A;  5M3M B;  5L37 A;  3U4V A;  3BZC A;  4OHJ A;  1YBY A;  1NCV A;  3KLR A;  1CS0 A;  2VUM H;  2R6G A;  3DLL A;  1STB A;  1BO0 A;  4AYB E;  2HG8 A;  1Q12 A;  3EN2 A;  4CDF C;  1X3G A;  3G7L A;  1SJH D;  1TII D;  4O7V A;  4QCL A;  2EYH A;  4HR7 B;  2VQF Q;  2UXB Q;  1X65 A;  3S1N H;  4G57 A;  2EIF A;  5M5W B;  2LSS A;  4RA8 A;  4O7Z A;  2NN6 H;  1HZC A;  3NWS A;  4A4I A;  3BA8 A;  1RL2 A;  4QUF A;  1KJ8 A;  2W6Z A;  3J7A F;  3M4O H;  3MEF A;  2X69 A;  1PMR A;  3K57 A;  3SK4 A;  1S5B D;  4FVM A;  3K0X A;  2ZDQ A;  1F9Q A;  4C5A A;  4KN7 C;  3W2D A;  4P73 A;  2PZW A;  2A6H C;  1PYS B;  2O2L D;  2FPP B;  1MKH A;  4DK0 A;  4OWT B;  2V1C C;  2CHB D;  2JN4 A;  2NN6 I;  4NYE A;  1JOK A;  3M4O B;  1PZK D;  2BH2 A;  1ZXT A;  2UXD Q;  2V58 A;  2LS0 1;  5D1P A;  4PZ6 A;  2E2J H;  3VPD A;  4GLW A;  5G3L F;  1IHZ A;  2R84 A;  4NP5 A;  4FF3 A;  1EEF D;  1W93 A;  4O84 A;  1JR0 D;  2L12 A;  4CC5 A;  3EIV A;  3E9I A;  2CWA A;  2VQF L;  1PX2 A;  4LF9 L;  4DR7 L;  4RGN A;  3M9B A;  4JVZ A;  2ZM6 Q;  5CV5 A;  2F03 A;  3KK7 A;  4K8J A;  1OXU A;  4WOR A;  1XXG A;  3J80 E;  4RHR A;  3HOX G;  2ICI A;  1W3S A;  4K6L A;  1Y1W H;  2PO4 A;  2EJM A;  3CU7 A;  1XMO L;  2PBZ A;  3H3V H;  3RTX A;  3KAJ A;  2CVR A;  1I4X A;  5CBE E;  5JJZ A;  1GM5 A;  1K9M C;  3L9A X;  5M9O A;  4HNU A;  2HT1 A;  5AJ3 L;  2AWO A;  2K4K A;  3CQZ H;  4U68 A;  3S1N B;  5BYB A;  2JA8 G;  2XRS D;  2OWO A;  2JA7 G;  5KKN B;  2YTY A;  2WAC A;  3WDN A;  2IL8 A;  1GUT A;  3HOZ H;  4LF7 L;  4JI7 L;  1SNM A;  5I6Y A;  1EHI A;  1RCV D;  3I91 A;  2DWC A;  1H9R A;  3I4L A;  4B3T Q;  4GKJ Q;  1PH6 A;  2WV6 D;  4CMD A;  2W6P A;  2HHH L;  1V1P A;  2RF4 A;  2N49 A;  2NVY B;  4C3I B;  1N32 L;  2HGW A;  3NSW A;  2A68 D;  1IOV A;  4F8M A;  5LMU Q;  3SK5 A;  3SNO A;  2I5L X;  2WIN B;  5H80 A;  2IHE A;  2B63 G;  4IFD I;  4RGT A;  3RLF A;  3UQ8 A;  5J39 A;  2WB1 B;  4EFE A;  2JA7 H;  1KBL A;  4ZQ3 A;  5LXT F;  2UUA L;  4A76 A;  1MIU A;  4L8J A;  4BXX H;  4J15 A;  2QF7 A;  1J5E Q;  2I8C A;  3K6O A;  3FHW A;  1N36 Q;  2FPI B;  3DWP A;  1Y1W G;  2VQE Q;  5C44 G;  3T9A A;  4WHX A;  1Z6H A;  5E4W C;  1KJQ A;  2VQE L;  3U0G A;  3E9H A;  2KEN A;  4LH7 A;  4IUP A;  4IAL A;  1G51 A;  2YW2 A;  1I7L A;  2SNS A;  4DLK A;  3TZU A;  4M9U A;  2E75 C;  2WAQ E;  4ME6 A;  3CCU A;  1VQ5 A;  2EY1 A;  4KK7 A;  1KC7 A;  1HNX L;  2M00 A;  1HZB A;  3FRP B;  2O5J C;  1T5E A;  3D6C A;  4PNY A;  4WRD A;  4R8N A;  4DGZ A;  3PIO 3;  1HNW L;  3C3L A;  1PYB A;  1X56 A;  4IJH A;  4WFN 3;  2ODT X;  1TU2 B;  2JSO A;  1LM0 A;  3UYY A;  1PVO A;  1QZG A;  1I1L A;  1MBY A;  1W6K A;  2HVQ A;  4DV5 L;  2WB1 G;  2R87 A;  2D5D A;  2K01 A;  5HGT A;  2SEB D;  4LJZ C;  3Q0A A;  2K5D A;  1DJR D;  4LFB L;  2AUJ D;  1TWA H;  3DWA A;  4UFZ A;  1S3O A;  4A3J H;  2Q8I B;  1AH9 A;  5C3X A;  1ENC A;  1B6R A;  2ASB A;  1Y8O B;  5C3W A;  3Q2O A;  2RDG A;  2Z6K A;  5ELB A;  3LX0 A;  1CQV A;  1QE6 A;  2J4X A;  1YNJ C;  3S1Q H;  4DR5 Q;  3U9T A;  2TMP A;  3HFZ B;  2N8N A;  1TKW B;  2PI2 A;  1O80 A;  3HKS A;  3F2B A;  5HUR A;  1XWE A;  1R9T B;  4UAI A;  2VQD A;  2XN9 C;  3R2T A;  3MHB A;  3RLO A;  3NEN A;  4A3F B;  1YNN C;  1QB5 D;  4LMQ D;  4NXM L;  1IW7 C;  3NXW A;  5FKA C;  1GJX A;  5BMV F;  4NW2 A;  3T9F A;  4YCW A;  4ZUI A;  4QJF A;  4JI6 L;  5E1F A;  2JYO A;  2Z1C A;  4B3R L;  5CYU A;  1FNU A;  4YB8 B;  3OUU A;  4R4O A;  4RGM A;  4HR7 A;  3T1Y Q;  2PVP A;  2PQA B;  1J5E L;  1DZ1 A;  2EPB A;  4HJ8 A;  2Q7D A;  2I07 B;  4EQP A;  5IOC A;  2PYK A;  4TQU S;  4QQB X;  1LV9 A;  5IWA Q;  2WAQ B;  3JZ6 A;  4MV7 A;  5C4X B;  5DIS C;  2K5V A;  3QB3 A;  1XJV A;  4K5V A;  1K8M A;  1YNN D;  3SE7 A;  3X3M A;  3Q1K A;  5KRU A;  4JPB W;  1ENF A;  5IGC A;  5I5U A;  2K5H A;  2QW7 A;  2F0F A;  1VQI A;  2QDB A;  1D8L A;  4GN5 A;  4HQ6 A;  2NVY H;  3KDF A;  3G71 A;  4K2K A;  1YVC A;  1YNJ D;  4FFM A;  2X6L A;  4C1N K;  1EZ8 A;  4F7X A;  1F2Y A;  1EQR A;  5CV4 A;  2KQ3 A;  4GS3 A;  4CDD C;  5KS8 A;  3HOZ B;  4DR4 Q;  5C1P A;  2KOL A;  1SMX A;  2F0L A;  3GO5 A;  5LYJ F;  3WOE A;  2D0P A;  4HN2 A;  5C8Y F;  4JI2 Q;  5AJ3 Q;  1Y8P B;  2IX1 A;  1DON A;  3VPB A;  2K33 A;  2F4V Q;  3KLS X;  2CW0 C;  1P16 A;  2JQO A;  1PA6 A;  2G9D A;  4H13 C;  1K0S A;  1Q1E A;  3CCM A;  1T36 A;  4UCV A;  4QUC A;  1IOW A;  2EYP A;  1TS5 A;  4HNV A;  5I5V A;  3KJP A;  3H91 A;  3HG9 A;  2A6E D;  1B44 D;  3OMG A;  2DY7 A;  3PGZ A;  1GO3 E;  5I9O A;  3I55 A;  2PPB C;  1CFM A;  4CJ2 C;  3KYH C;  3DWQ A;  3KAL A;  4UCR A;  1D5X C;  1FJG L;  5GAG C;  1X3F A;  2BH8 A;  4JI8 L;  3UDX A;  1AZP A;  1EU4 A;  1Q8K A;  4Y7N H;  2MHV A;  1R4P B;  1GSH A;  1JKJ B;  2K5W A;  5BPF A;  5BN5 A;  4X65 L;  3PO2 H;  1KAA A;  2FFK B;  3H0G H;  4HSV A;  4K6D A;  3ULJ A;  3ULL A;  1G6P A;  3LP8 A;  2B2W C;  3RV3 A;  2X6G A;  4B9W A;  2J9G A;  5KNC A;  3BAB A;  1BCP F;  2SCU B;  4N9T A;  3M4P A;  4O86 A;  4LF8 L;  4P2C B;  2KA7 A;  4N8X 1;  2RSO A;  3P75 A;  2LXJ A;  2XRQ D;  2COJ A;  2IT1 A;  1HHV A;  1KEE A;  2W70 A;  3BJU A;  1EY8 A;  2DJF C;  4DR1 L;  2L15 A;  2K05 A;  1I1M A;  2MUY A;  3HOV H;  2R7L A;  1KTK A;  2Z02 A;  2PQE A;  5J3B A;  2XNA C;  2VZA A;  1K3R A;  1U5K A;  1WTP A;  4A3L H;  5LHY 1;  4P72 A;  5IY0 A;  2F0S A;  3J81 c;  4DV6 Q;  3NHH A;  1Q46 A;  1SE3 A;  3D31 A;  4B3M Q;  5GRO A;  4GKK Q;  1TWH B;  1S72 A;  3DUZ A;  2UUC Q;  1B50 A;  2R3Z A;  3AU7 A;  5J2T F;  3E5S A;  5HBR B;  3GTL H;  3TZD A;  5LA6 F;  5T1I A;  4A3G B;  2KBN A;  1F9S A;  3NTI A;  4ZLT F;  5EZY F;  4YCV A;  2FP4 B;  3H0G G;  1PFS A;  5I2X A;  2A74 C;  1HQM C;  1CA5 A;  3S1M B;  4L5Q A;  3FKI B;  3GQB A;  3P20 A;  5I2Y A;  4C3H H;  4E4T A;  2FMM A;  1QVF A;  2NYZ D;  3EFX D;  5HY6 A;  1XNR L;  1M6V A;  2F4I A;  1S5C D;  2UXD L;  5J2U F;  4JI4 Q;  2F52 A;  4IFD H;  3KLS A;  1WVL A;  2VL6 A;  2R82 A;  3VR6 A;  2GLT A;  2K04 A;  3GP7 A;  3S24 A;  3TIN A;  2PMZ B;  5COY A;  1L1O C;  5FLX E;  4DV3 Q;  3M85 A;  1VQL A;  2F0P A;  4UPA A;  2LKV A;  3J7Y W;  1AUV A;  1XTD A;  2EYJ A;  1IBM Q;  4LWC A;  4CHT B;  4DU9 A;  3T56 B;  3SVM A;  1VQM A;  4I7A A;  2EY2 A;  3T13 A;  1KC8 C;  1E2V A;  3HOU H;  2GQS A;  4O2A F;  1B2T A;  3RNU A;  2I5M X;  1F2Z A;  4JYA L;  4BBS G;  4EGQ A;  5C0X H;  1CK1 A;  5CA0 F;  2BCO A;  3TY5 A;  3QR8 A;  3K5I A;  2QK4 A;  5C4J H;  4HJ7 A;  5M3F H;  4FGR A;  1ET6 A;  4O82 A;  5CV6 A;  5EAY A;  4O83 A;  3AQQ A;  2M2L A;  1KNA A;  2HJW A;  3Q23 A;  4UP8 A;  2JA6 H;  2OQK A;  4FDB A;  1TVX A;  4C5C A;  3UDI A;  3NUC A;  4QIW B;  1O7L A;  1PTO B;  2EOT A;  5JVG 3;  5ISR A;  3TN2 A;  1LTL A;  1WFQ A;  4FU0 A;  3IFD A;  1VQG A;  1JB3 A;  3EVQ A;  1PZI D;  1TWA B;  1VF5 C;  3QWN A;  1CUK A;  3VYS A;  2YYZ A;  5EPK A;  2HVS A;  3DTG A;  2CH4 W;  2ZJR A;  5LMN L;  5K36 G;  2WKD A;  2CNQ A;  3N8D A;  4X66 L;  4LF4 Q;  4C1N I;  5E25 A;  5D1O B;  4GKJ L;  2LXK A;  4KV6 A;  1TY2 A;  1PH3 A;  1SEB D;  4DV3 L;  2JEA I;  4O7N A;  1JWM D;  3CCV A;  1DGS A;  2RQX A;  3ORQ A;  4YBZ B;  2UUC L;  4HMI A;  2XD4 A;  2Z9H A;  3OW2 A;  1HNW Q;  1EKF A;  1RJT A;  2ZTE A;  1V1Q A;  1PTO D;  1BCP B;  4C2M H;  3DMU A;  2B2T A;  1M0W A;  2Q2I A;  2DNE A;  2PMZ E;  1N34 L;  1EUJ A;  2C00 A;  5FJ8 G;  1E2Z A;  2SNM A;  4CJ0 B;  5EKI A;  4JI3 L;  1LLR D;  3BZK A;  4ODG A;  4KD3 A;  4X66 Q;  1OXX K;  3MAQ A;  4DR1 Q;  3G8D A;  4O0A A;  4OX9 Q;  3PFF A;  4RCO A;  4CBV A;  2YZG A;  4DAA A;  2BA0 A;  3U9S A;  2PQA A;  3EJI A;  4L5T A;  3ERO A;  1PFN A;  1K73 C;  2CKZ B;  4O4I F;  2UUA Q;  2JA7 B;  4HTH A;  2W6N A;  3I4N B;  4QF4 A;  1IBK Q;  4IWY A;  1VQE A;  2KEE A;  3QOL A;  4BY7 G;  3I4N G;  3GLK A;  1JOR A;  3D0F A;  1P8L A;  2AUK A;  3R23 A;  3BVZ A;  3NEM A;  2OTJ A;  5LL6 X;  3ICE A;  2R85 A;  3TQT A;  4EFB A;  1SAP A;  1DIK A;  2Q2H A;  1ASZ A;  2IPK D;  1FL0 A;  3DEO A;  4R4T A;  3HOU B;  2NTT A;  2F3V A;  4JK1 C;  4A3E B;  3K0Y A;  4NZO A;  4DUY L;  2L55 A;  4CDC C;  4A75 A;  1XDN A;  4M1U B;  3RZO B;  1NTG A;  2KJX A;  3CC4 A;  1D5Z C;  3A8K E;  4XYQ A;  2IX3 A;  4DQN A;  5IP9 H;  1VQF A;  4K5X A;  3LNN A;  2BE5 C;  5F2D A;  4MIU A;  4LF7 Q;  3OMC A;  5E7N A;  1HH2 P;  1N9W A;  2NU8 B;  3HOW B;  3VR4 A;  1CQF A;  3ULP A;  4FO2 A;  2UU9 Q;  3HS0 C;  1WD1 A;  3J7Z C;  4G7O C;  4LFB Q;  4V19 0;  2OF1 A;  3HOZ G;  4ZAI A;  1EQT A;  4TUY F;  1I2K A;  1JJG A;  2ICE C;  3FMC A;  4ME5 A;  4L63 B;  3PCO B;  4J1M A;  1ZAU A;  2JA5 B;  1C4Q A;  3RMH A;  2O4X A;  1YHA A;  1DM0 B;  4J8Q A;  2NU9 B;  5CGK A;  2PNH A;  1QUQ A;  4YY3 Q;  2R7M A;  3T9E A;  3STB D;  3OYY A;  3FP9 A;  2K5N A;  1YI2 A;  3H3V I;  4MA5 A;  3ERS X;  3NE5 B;  2MP1 A;  4L5S A;  1BCP D;  2ZT9 C;  5JJK A;  4A3C H;  4J6H A;  1UUP A;  1F2M A;  2UU9 L;  1VDZ A;  1KIX A;  1ENA A;  3IFT A;  1G6Z A;  4MV9 A;  4DXF A;  1HZA A;  2F0W A;  4B3S L;  1PDQ A;  1PTO C;  2ZXP A;  3KJO A;  4O7W A;  1AEX A;  2F0G A;  4KMU C;  4JI0 L;  1EL0 A;  3PO2 G;  2Z04 A;  1MSH A;  2COI A;  5JEA H;  3OWF A;  3BYT B;  1KL9 A;  3M4Q A;  4ZI7 F;  4Y8V B;  4O2D A;  4AYB G;  3PIO A;  3WNZ A;  4X3K A;  4X64 L;  1I50 B;  3TEH B;  1QJO A;  2HDM A;  4FYD A;  1BBU A;  1V1O A;  3HOY B;  3Q22 A;  5IP7 H;  3KFU A;  4RWS C;  4HJ9 A;  4EG0 A;  4IFD G;  2XWJ B;  3ERQ A;  1IYJ B;  1ROD A;  1EY7 A;  1WYD A;  2HCC A;  1A15 A;  2GPW A;  4NXN Q;  4PZ8 A;  5T1G A;  3E0J A;  2PI2 E;  3JSN A;  3RFC A;  1BCP C;  4V0B A;  1OO9 B;  1UC9 A;  1WTX A;  5C1O A;  3I4M B;  3HRZ C;  2WFW A;  4MTN A;  1CKO A;  2DN8 A;  4KY6 A;  3S1R B;  3GTM B;  5EKK A;  5M3M H;  5EJW A;  2WB1 E;  3M4Y A;  4DUZ Q;  4LNQ A;  2Z8L A;  3VYR A;  2KHS A;  1GHK A;  1HQR D;  4OO1 G;  1A3G A;  2JXM B;  1LO5 D;  3D4W A;  1ILQ A;  1A0G A;  4CC6 A;  1W6J A;  4GLA C;  4XT3 B;  3VA7 A;  1DAA A;  2B2V A;  2P0A A;  1FGU A;  1IYD A;  4HCS A;  5GAE C;  2Z4H A;  2AKW B;  3A5Z B;  4JV5 Q;  1ESR A;  2KCC A;  3KOJ A;  4FNF A;  4KHP Q;  4XYO A;  1K83 B;  3MZ5 A;  3BG5 A;  2KEC A;  3OTO L;  4R1J A;  1N33 L;  1LAC A;  3NPP A;  4POF A;  2CFM A;  4PQX A;  1BNZ A;  1LTG D;  2OXP A;  4KD4 A;  3ND8 A;  1PH7 A;  1VKZ A;  3K7A H;  3MTS A;  5I60 A;  3E5N A;  1CHQ D;  2QDL A;  2ZTD A;  1NMG A;  2NVQ B;  3HKZ G;  1CZW A;  3I4N H;  1XYI A;  3OOC A;  1JJ2 A;  5DGI A;  5C0X G;  2LMC B;  3U9O A;  2ZJP A;  1BR9 A;  1H9J A;  5DM7 3;  1D6E C;  4KJN A;  2PNR C;  4RAU C;  4DAP A;  2NUA B;  1K8G A;  2I5H A;  3AX6 A;  1VQD A;  2RKS A;  5IYD H;  2D62 A;  4KKU A;  3PMF A;  2WKC A;  5I6W A;  1XMQ Q;  1GVP A;  3HZX A;  1EZ6 A;  4OO1 I;  1WD0 A;  1AUX A;  5BYA A;  4OWW B;  1Q7Y C;  3NBH A;  3RUP A;  4HIM A;  1JOO A;  5DNF A;  3CPF A;  1B3Q A;  1JB7 A;  2IY5 B;  2R92 B;  2NVT H;  4JBW A;  2LY7 A;  1QOH A;  4XQQ A;  2YZM A;  2A6E C;  4A3J G;  5CE8 A;  3PO3 B;  5K2M A;  3I72 A;  1YJN A;  1LT4 D;  4O81 A;  1BF4 A;  1QNK A;  1KJI A;  1I4R A;  5IYC H;  3VYU A;  3TSS A;  4DR5 L;  1ICW A;  5IYD G;  5J22 A;  1J9O A;  2NVX B;  4BY1 G;  4JI4 L;  3TIG A;  1LT6 D;  4DV7 Q;  4TV9 F;  3R93 A;  2AMC B;  1E3P A;  2K14 A;  3SGI A;  4ZUJ A;  2YWV A;  2OLS A;  3HOX B;  3TII A;  1YZ6 A;  2F3W A;  3SDZ A;  4LH6 A;  3FDT A;  4YCU A;  1HUM A;  4A3K G;  4NMZ A;  1KJJ A;  1QNU A;  1SYC A;  1U0L A;  4PV1 C;  3QWU A;  1QIL A;  3F8T A;  2R61 A;  1E1T A;  2KHI A;  5M5X H;  1EQQ A;  3URY A;  3JC6 6;  5FO7 B;  2F0V A;  2F1M A;  3SR1 A;  5C3E H;  1NR4 A;  1LTA D;  1PTO H;  2R7N A;  3HOW G;  2XGT A;  1JCK B;  1O78 A;  1SNP A;  1I5F A;  5BN3 A;  1VF7 A;  2K32 A;  1HCZ A;  3PO3 H;  1EKV A;  1PH1 A;  3OW7 A;  1JWU D;  2DIK A;  4C5B A;  3NBY B;  4IWX A;  5BWW A;  5JQW A;  4BXX G;  2HQL A;  4HAE A;  3WOF A;  4KLK A;  3G6E A;  2GVB A;  5C5L A;  1EUD B;  4BY7 H;  1PYW D;  4O1N A;  1KDB A;  3B6Y A;  3OWE B;  4CHI A;  3A54 A;  1S5D D;  4DV0 Q;  4A3D H;  3LQS A;  1X3Q A;  1FR3 A;  1EY9 A;  4JI1 Q;  1SE2 A;  5KIX A;  5KYL A;  2H4O A;  2I46 A;  5EBC A;  1TT2 A;  2C35 B;  2L11 A;  2A69 D;  4MTK A;  4RHS A;  4IO9 A;  2NU7 B;  4C3J H;  4IZ8 A;  1I6V C;  2UXC L;  3OUZ A;  2YTV A;  2ZXR A;  2F0N A;  1YJW A;  5JVL A;  1FNW A;  3R2I A;  1EIH A;  3GTK H;  4PBC A;  3T51 B;  2A19 A;  1KD1 C;  4ZKB B;  1QCB D;  3I2Z A;  1Z47 A;  3KUP A;  4A3C G;  3A56 A;  4ALP A;  3HB9 A;  1B9N A;  3V96 A;  4I50 F;  2WAQ G;  2HGX A;  2OTL A;  1BOS A;  2MNA A;  3VMM A;  1S68 A;  2ENB A;  1WJJ A;  4DNR B;  3RZD H;  3CEB A;  5FNV F;  4XIG S;  1LTT D;  1UE7 A;  3ZYY X;  4CKB A;  1WTQ A;  2E2I B;  4QGU A;  1PXU A;  3JAM c;  3PUY A;  1HA6 A;  4JG2 A;  5DM6 3;  1ILP A;  3R9R A;  4DR3 Q;  1K3B C;  1YIT A;  3UZB A;  4LF6 Q;  2O5I C;  1KDA A;  2DGY A;  2CW0 D;  3H6M A;  5FO8 B;  2P5Z X;  5KEE A;  1B9M A;  4LF6 L;  3U55 A;  1PTO F;  5CAE B;  3RN5 A;  2EXD A;  3C2P A;  1AP0 A;  4EGV A;  2L5T A;  1SSO A;  4DV4 Q;  1H9S B;  3BG3 A;  2FIN B;  3I4O A; 
#chains in the Genus database with same CATH homology
 4HID A;  1BKB A;  1RIP A;  4A3E G;  2H5X A;  2KBN A;  3CCE A;  1W2B A;  4DV4 L;  1HNZ Q;  1ASY A;  4KHZ A;  5BR8 Q;  4HIK A;  1VCI A;  1IBM L;  1X3E A;  4YCV A;  2R92 G;  3H0G G;  3L0O A;  1PFS A;  5GAD C;  1XNQ L;  1TWC H;  2MO1 A;  2B63 H;  1UE5 A;  4DUY Q;  4A3G G;  4L5Q A;  5ELO A;  4A3I H;  5IYB G;  5FPR A;  3ER0 A;  1AE2 A;  4DAM A;  1VQ4 A;  3HOV G;  3K7U C;  4C3H H;  1QVF A;  4BBS H;  4ME3 A;  3U50 C;  5HY6 A;  5D1O A;  1XNR L;  4APV A;  3F2C A;  3CCS A;  2UXD L;  1UE1 A;  5M5Y H;  4JI4 Q;  1N8R C;  1Q1B A;  2F52 A;  3J7A 5;  3VDY A;  1S40 A;  4UP7 A;  3EBE A;  3TQY A;  2VL6 A;  5LMU L;  4IPG A;  3GTJ H;  3S14 H;  1K0R A;  3S24 A;  4JI7 Q;  1L1O C;  4DV3 Q;  2XTI A;  4GOP C;  4KI0 A;  3TRE A;  4C3I H;  3M85 A;  1VQL A;  2YU9 H;  4LFC Q;  4JI1 L;  4R4C A;  1FJG Q;  4UPA A;  3S2D H;  1VQC A;  1LYL A;  1XK5 A;  1XTD A;  1NE3 A;  1IBM Q;  1CKM A;  3GDE A;  4LWC A;  1HNZ L;  1VQM A;  1KC8 C;  4LF4 L;  1IBL L;  4GNX C;  3HOU H;  4A3D G;  1HZ9 A;  4B3R Q;  2WP8 J;  4UY8 C;  3BA9 A;  3RNU A;  2Z6K C;  2I5M X;  4JYA L;  1SRU A;  3GTP H;  4BBS G;  2Q2T A;  1A0I A;  3TY5 A;  4DR6 Q;  5C4J H;  4HJ7 A;  1NMF A;  4HIO A;  5M3F H;  4EX5 A;  1VQP A;  1CSP A;  3STB C;  3HOY G;  1CSQ A;  5EAY A;  4UP9 A;  1N34 Q;  3AQQ A;  5FJ8 H;  3AFP A;  1XMO Q;  1X9N A;  1EOV A;  4UP8 A;  2OQK A;  4FDB A;  2JA6 H;  1A63 A;  1TA8 A;  5M3F G;  3UDI A;  3HOY H;  4A3F G;  4PG3 A;  3AFQ A;  2E5L L;  1JMC A;  4IOA A;  4GN3 B;  4NPS A;  4BBR H;  1LTL A;  1WFQ A;  4A3K H;  2E2I H;  4LF5 Q;  2IHF A;  1VQG A;  4JI5 L;  2UUB L;  3WWV A;  3CC2 A;  1YEZ A;  1CUK A;  1PH4 A;  1NJI C;  2RHS B;  2YYZ A;  3W1G A;  4POG A;  2VUM G;  4UCU A;  1J6Q A;  2CWP A;  2HVS A;  2ZJR A;  5LMN L;  2B29 A;  5K36 G;  4AQY Q;  4WJ3 M;  4X66 L;  2Z0S A;  4DV2 Q;  3PUZ A;  1XPO A;  4LF4 Q;  2JA5 G;  2ALY B;  1PH2 A;  3I4M H;  2LXK A;  1IBK L;  4GKJ L;  5D1O B;  4LF9 Q;  4DV2 L;  1QZH A;  1PH3 A;  3IRB A;  3UDF A;  1PHJ A;  2R7F A;  4LFC L;  1B8A A;  3J81 j;  4DV3 L;  1HR0 W;  2JEA I;  3CCV A;  4A3L G;  4DPG A;  2JEB I;  3I4M G;  1DGS A;  1I94 Q;  2R7Z G;  4RG1 A;  2F3I A;  2VW9 A;  4R4I A;  2UUC L;  4X65 Q;  3A0J A;  3CW2 C;  4JC0 A;  3DM3 A;  4QIW E;  4NXM Q;  1WOC A;  3OW2 A;  3A5U A;  3HOW H;  1HNW Q;  2ZTE A;  4DV1 Q;  2K52 A;  5IP9 G;  1V1Q A;  4NB3 A;  5ELN A;  3G48 A;  4DR2 Q;  1Y1V G;  2JJQ A;  3KDF B;  4C2M H;  3RR5 A;  1D7Q A;  4DAY B;  1TXY A;  1I50 H;  4LW1 A;  1Y14 B;  3K8A A;  4YWK A;  2VUG A;  3U4V A;  2Q2I A;  2PMZ E;  1N34 L;  1EUJ A;  3BZC A;  4DV5 Q;  2KCT A;  5FJ8 G;  1YBY A;  3CPW A;  1M90 C;  4JI3 L;  3OTO Q;  2VUM H;  3TS2 A;  2R6G A;  3BZK A;  4X66 Q;  3DLL A;  4DR1 Q;  1OXX K;  5BR8 L;  4GLX A;  4A93 H;  5C0X J;  4O0A A;  4OX9 Q;  4AYB E;  1UE6 A;  4B3S Q;  3E0E A;  1Q12 A;  3EN2 A;  3PV0 A;  1X3G A;  3GTO H;  2BA0 A;  2PQA A;  4P75 A;  1V9P A;  4L5T A;  2VQF Q;  1R9T H;  2UXB Q;  1X65 A;  3TS0 A;  2K75 A;  1HR0 L;  2Q2U A;  4B3T L;  3S1N H;  2EIF A;  2EQS A;  3J80 c;  2LSS A;  2CKZ B;  1K73 C;  2ZJQ A;  2UUA Q;  1E1O A;  5M5W H;  2VNU D;  1HZC A;  2RCN A;  1IBK Q;  1VQE A;  4DR2 L;  4BY7 G;  3I4N G;  1EIY B;  2ZTC A;  4A4I A;  4DR4 L;  3D0F A;  1SE8 A;  3BA8 A;  3FKI G;  1P8L A;  1L1O B;  1RL2 A;  5DLQ E;  2E2H H;  1YHQ A;  3NEM A;  1EFW A;  3M4O H;  4JCV E;  3MEF A;  5C0X I;  3ICE A;  1IL2 A;  1Q81 C;  2OTJ A;  4EFB A;  4A3M G;  1XNR Q;  1NY4 A;  2Q2H A;  3PIP A;  1NBW A;  4DK6 C;  1ASZ A;  1FL0 A;  2BA1 A;  4R4T A;  1PH5 A;  2I0Q A;  4R4Q A;  3K0X A;  1G29 1;  4YHH Q;  1YIJ A;  4DUY L;  4P73 A;  4A75 A;  1PYS B;  1XDN A;  1MKH A;  1NTG A;  4OWT B;  4A93 G;  1WI5 A;  3CC4 A;  2V1C C;  2NN6 I;  2JK8 A;  5IP9 H;  1VQF A;  4LF7 Q;  4JOI A;  3U58 A;  2BH2 A;  1HR0 Q;  4X62 L;  5E7N A;  1HH2 P;  1N9W A;  4LUO A;  2UXD Q;  5D1P A;  1VS0 A;  3PO3 G;  4PZ6 A;  2E2J H;  1B04 A;  2NVX H;  1X54 A;  5IWA L;  3H15 A;  3PF4 A;  3CXC A;  3Q8D A;  3ULP A;  1EIF A;  1VQ7 A;  2HVR A;  2UU9 Q;  3J7Z C;  2N78 A;  4LFB Q;  1T9H A;  1LUZ A;  4DNI A;  4X64 Q;  3G4S A;  3HOZ G;  3EIV A;  4CC5 A;  3E9I A;  2CWA A;  2VQF L;  4LF9 L;  4DR7 L;  2A1A A;  1H95 A;  2R92 H;  3RZO H;  1JJG A;  2R93 G;  2QA4 A;  4A3E H;  3M9B A;  1EYG A;  3PCO B;  3M3Y H;  4WJ4 A;  3PUX A;  2ZM6 Q;  4IPD A;  3I56 A;  4HJA A;  1B70 B;  1OXU A;  1KAW A;  2ZM6 L;  1XPU A;  1YHA A;  4A3F H;  1VQ8 A;  4UCT A;  3HOX G;  2Y0S G;  2PNH A;  1QUQ A;  1W3S A;  4YY3 Q;  1VQO A;  3STB D;  1OXT A;  1Y1W H;  2K5N A;  3FP9 A;  3OYY A;  1MJC A;  1YI2 A;  3GTG H;  1CKN A;  1XMO L;  3H3V I;  4BA2 I;  3ERS X;  1OXS C;  1I94 L;  3H3V H;  1TAE A;  3RTX A;  2ID0 A;  5C4X G;  4L5S A;  2IX0 A;  1GM5 A;  1K9M C;  2KCM A;  3CC7 A;  4JI2 L;  3GJX B;  5JJK A;  2HT1 A;  5C44 H;  5AJ3 L;  1VQB A;  4A3C H;  2AWO A;  3L2P A;  2K4K A;  3CQZ H;  2UU9 L;  2HIV A;  2JA8 G;  3TY9 A;  1XNQ Q;  5JEA J;  1KIX A;  2OWO A;  2JA7 G;  3JSL A;  1HZA A;  2YTY A;  1L2F A;  2E8G A;  3CME A;  4B3S L;  3HOZ H;  4LF7 L;  1C0A A;  4JI8 Q;  3KJO A;  4JI7 L;  4OXP A;  4JI0 L;  3PO2 G;  5IYC G;  4B3T Q;  1VQ6 A;  4GKJ Q;  1PH6 A;  3ZJY C;  1KL9 A;  3M4Q A;  2HHH L;  4JBK A;  2R7D A;  4O2D A;  2RF4 A;  2N49 A;  4AYB G;  4DV0 L;  4DV6 L;  1N32 L;  3PIO A;  4OX9 L;  5JEA G;  4X64 L;  5LMU Q;  2GN5 A;  3RN2 A;  2I5L X;  4GN4 B;  2QGQ A;  2QEX A;  4XTC S;  3TEH B;  2IHE A;  3K80 C;  2B63 G;  3RLF A;  4DV1 L;  3S16 H;  1BBU A;  4IFD I;  3UQ8 A;  2MQH A;  2ATW A;  4EFE A;  3TRZ A;  5IP7 H;  3KFU A;  1I6H H;  2JA7 H;  1HNX Q;  1IZ6 A;  4HJ9 A;  2UUA L;  4A76 A;  4GOP A;  1MIU A;  4K0K Q;  4BXX H;  4IFD G;  1IYJ B;  1WYD A;  4J15 A;  2KHJ A;  4PZ7 A;  1J5E Q;  4NXN Q;  1E24 A;  4P74 A;  4PZ8 A;  2PI2 E;  4LFA Q;  3BAA A;  3FHW A;  3JSN A;  3NEL A;  4QY7 A;  1N36 Q;  4X6A H;  4A3B G;  3KLW A;  1Y1W G;  2VQE Q;  5C44 G;  5LMN Q;  2WFW A;  4MTN A;  4DK3 C;  1UWV A;  1BVS A;  2CQO A;  2VQE L;  4A3G H;  3E9H A;  1CKO A;  3M7N A;  2KEN A;  1IXR A;  4LH7 A;  4H02 A;  4YWL A;  1CKN B;  2A8V A;  1G51 A;  5M3M H;  1QUQ B;  1TWH H;  2WB1 E;  3GTQ H;  3GB8 B;  3GD7 A;  4DUZ Q;  1VQA A;  4LNQ A;  3S17 H;  2WAQ E;  3CCU A;  1VQ5 A;  5H1S E;  4E6N A;  5GQO A;  1HNX L;  4OO1 G;  1I3Q H;  1HZB A;  5IYB H;  4CC6 A;  4GLA C;  4YWM A;  4EQ5 A;  2Y0S E;  4GNX A;  1HNW L;  1PYB A;  1C9O A;  1FGU A;  1X56 A;  4IJH A;  4DR6 L;  5M3M G;  1HJP A;  5GAE C;  1LM0 A;  2UXC Q;  3RLN A;  3NBZ B;  4A3B H;  2AKW B;  1SN8 A;  1QZG A;  1PVO A;  3A5Z B;  4UCO A;  4JV5 Q;  2AWN A;  4GLV B;  1SFO H;  2HVQ A;  3KOJ A;  4DV5 L;  4KHP Q;  2WB1 G;  1GKH A;  3OTO L;  4R1J A;  3CMA A;  4BBR G;  4JI3 Q;  1TWG H;  1N33 L;  4POF A;  1K83 H;  2CFM A;  3J81 i;  2JA9 A;  3UE0 A;  4LFB L;  1PH9 A;  4K0K L;  3UE1 A;  5LMN W;  4EEQ A;  1TWA H;  4UFZ A;  1QVG A;  1S3O A;  1PH7 A;  4A3J H;  2JA6 G;  3KF6 B;  4JOI C;  1AH9 A;  3A74 A;  3K7A H;  3K81 C;  1YHB A;  2ASB A;  4LF5 L;  3NBH B;  1M1K C;  3CCL A;  2ZTD A;  2Z6K A;  5FLM G;  1NMG A;  3HKZ G;  3I4N H;  1VQJ A;  1JJ2 A;  3S1Q H;  5IT9 c;  2JA8 H;  4DR5 Q;  5C0X G;  3HFZ B;  2NZH A;  4IJL A;  2N8N A;  2ZJP A;  2PI2 A;  3HKS A;  5HGQ A;  5FLM H;  3CAM A;  3F2B A;  1Q86 C;  1K8G A;  1SLJ A;  1OXV A;  2I5H A;  4YY3 L;  3HKZ E;  1VQD A;  1KRS A;  2N3S A;  4JBM A;  2D62 A;  5IYD H;  3RLO A;  3FKI H;  3S1R H;  3GTM H;  1L1O A;  3NEN A;  1XMQ Q;  1GVP A;  3S1M H;  4NXM L;  2UXB L;  5JJI A;  1AE3 A;  3CCJ A;  3LGJ A;  3W5O A;  4OO1 I;  3F1Z A;  2NN6 G;  3CP0 A;  4YCW A;  1JT8 A;  4QJF A;  4DRF A;  4JI6 L;  4OWW B;  1IBL Q;  1Q7Y C;  4HIM A;  4B3R L;  2RHQ B;  3CPF A;  1JB7 A;  2IY5 B;  1O7I A;  2NVT H;  2MFI A;  4JBW A;  4R4O A;  3J80 i;  2K50 A;  3I7F A;  3KF6 A;  2DUD A;  4AIM A;  3T1Y Q;  4LF8 Q;  3CCQ A;  2PQA B;  3W1B A;  5IE8 A;  4A3J G;  4NXN L;  1J5E L;  4HJ8 A;  4DKA C;  3L7Z C;  5IP7 G;  2OQ0 A;  4TQU S;  4HJ5 A;  1YJN A;  4QQB X;  2D0O A;  5IWA Q;  5C3E G;  1GD7 A;  4AH6 A;  5IYC H;  2K5V A;  4DR5 L;  1XJV A;  5DIS C;  4L5R C;  5IYD G;  3PUV A;  1E7Z A;  4BY1 G;  3MXN B;  4GKK L;  4IPH A;  4P71 A;  3UDG A;  2E5L Q;  4OON A;  4JI4 L;  4DV7 Q;  1N32 Q;  4IPC A;  5JJL A;  2AMC B;  1E3P A;  1JE5 A;  2K14 A;  2K5H A;  4UCS A;  3SGI A;  1VQI A;  4LUV A;  1D8L A;  1X6O A;  4GN5 A;  2FXQ A;  2NVY H;  1YZ6 A;  3KDF A;  3G71 A;  3PF5 A;  1YVC A;  4GNX B;  4LH6 A;  4JBJ A;  4YCU A;  4A3K G;  4AQY L;  4DUZ L;  3VNN A;  1VQ9 A;  1U0L A;  3JAM i;  4IOC A;  3QWU A;  1L0W A;  3F8T A;  1V43 A;  1E1T A;  1EQR A;  1JJC B;  3PSI A;  4GS3 A;  1X55 A;  2KHI A;  5M5X H;  2NZO A;  1EQQ A;  3JC6 6;  1KRT A;  4LFA L;  1SRO A;  4A3I G;  4DR4 Q;  5C3E H;  1SMX A;  3CD6 A;  4TVA B;  3GO5 A;  2D0P A;  3HOW G;  2HIX A;  4BA1 I;  2XGT A;  5C4X H;  2F4V L;  2YV5 A;  4JI2 Q;  5AJ3 Q;  1SR3 A;  3CCR A;  2IX1 A;  1I5F A;  1EWI A;  1KQS A;  2F4V Q;  1WCM G;  3T1Y L;  3PO3 H;  3TY8 A;  1PH1 A;  4BY1 H;  1MJE A;  1P16 A;  2JQO A;  3NBY B;  1PA6 A;  2VY3 A;  4BXX G;  2HQL A;  4GOP B;  2JA5 H;  1Q1E A;  3CCM A;  4KLK A;  1VQH A;  2GVB A;  3G6E A;  4UCV A;  4BY7 H;  3F2D A;  3B6Y A;  3PUW A;  3KJP A;  1YJ9 A;  1N33 Q;  4IFD J;  4B3M L;  2R7Z H;  4DV0 Q;  3PGZ A;  3AEV A;  3I55 A;  1PV4 A;  1GO3 E;  3HOU G;  1Q82 C;  4A3D H;  4DR7 Q;  3NC0 B;  3KYH C;  4UCR A;  4JI1 Q;  1FJG L;  5GAG C;  1YNX A;  1X3F A;  5FPO A;  1KHI A;  1UEB A;  3AYH B;  5GAH C;  1XPR A;  2BH8 A;  3BU2 A;  4JI8 L;  3UDX A;  1Q8K A;  4QL5 A;  4Y7N H;  2CCZ A;  2ES2 A;  4JI0 Q;  2AHO B;  2C35 B;  1Y1V H;  3U4Z A;  4IO9 A;  2YTX A;  4DR3 L;  4C3J H;  3T1H Q;  3PN1 A;  2UXC L;  1A62 A;  1E22 A;  2YTV A;  4X65 L;  1YJW A;  3PO2 H;  3H0G H;  3S15 H;  3ULJ A;  3T1H L;  3ULL A;  2MO0 A;  1G6P A;  3GTK H;  1VQK A;  2OCE A;  2A19 A;  1C7Y A;  3BAB A;  4X62 Q;  1KD1 C;  2VS1 A;  3KF8 B;  3CF5 A;  3M4P A;  3I2Z A;  2JE6 I;  1Z47 A;  1KXL A;  4LF8 L;  1K8A C;  4A3C G;  4ALP A;  1N36 L;  1PH8 A;  4Y52 H;  1Z9F A;  2WAQ G;  3S2H H;  2OTL A;  4YHH L;  2LXJ A;  2MNA A;  1S68 A;  5FLX c;  4A3M H;  2IT1 A;  1WJJ A;  1WCM H;  3BJU A;  4LUZ A;  3HOX H;  1QVC A;  3RZD H;  4DR1 L;  2L15 A;  2UUB Q;  4JI5 Q;  1VQN A;  3HOV H;  1FVI A;  4XIG S;  4DV7 L;  1UE7 A;  1XMQ L;  4QGU A;  5J3B A;  1B7Y B;  1TWF H;  2VZA A;  1K3R A;  1U5K A;  4MZ9 A;  1OTC A;  4OWX B;  4A3L H;  3JAM c;  3PUY A;  4P72 A;  4JG2 A;  4PMW A;  5IY0 A;  3J81 c;  4DR3 Q;  2R93 H;  1YIT A;  2GVA A;  4LF6 Q;  4DV6 Q;  2DGY A;  2NVQ H;  1Q46 A;  3D31 A;  4B3M Q;  4LF6 L;  2HHH Q;  5GRO A;  1A8V A;  3RN5 A;  4GKK Q;  1S72 A;  1BBW A;  2EXD A;  4JYA Q;  4RMF A;  2UUC Q;  2B3G A;  4MNO A;  4KHP L;  4DV4 Q;  3GTL H;  4JV5 L;  4JI6 Q;  3I4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...