5FPRA

Structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 307
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fprA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fprA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fprA02
1TA8A 4DUYB 4JI4B 2HIXA 4JI7B 4LH7A 3QWUA 2F4VB 4CC5A 4EEQA 4EFBA 2UUAB 4JV5B 4LH6A 4DR6B 1P8LA 1I94B 4B3MB 3NC0B 1XDNA 4EFEA 2Q2TA 5D1PA 4B3SB 1XK5A 4DV7B 4LFBB 4DR3B 3T1HB 2HVSA 3BA8A 2UUCB 4UCSA 3JSLA 4DV6B 5FPOA 4JI1B 1HNWB 2UXCB 4UCUA 3W1GA 2HVQA 4DV5B 3UQ8A 4PZ7A 4UCOA 1TAEA 1HNXB 4LF4B 1VS0A 4LF6B 1CKOA 1X9NA 4JI3B 4LF8B 4GKKB 4PZ8A 4E6NA 5D1OA 4TOIA 4GKJB 2VUGA 3PN1A 3BAAA 4UCTA 4CC6A 1XMQB 2UU9B 4JI8B 1N33B 2UXBB 4LF9B 3TY5A 4DV1B 1N32B 2HVRA 4DV3B 3GB8B 3NBYB 4LFCB 4B3TB 4K0KB 1CKNA 1XNRB 4DR5B 4DR2B 4LF5B 1S68A 5BR8B 4DV0B 1B04A 1DGSA 1FVIA 1XMOB 3RR5A 4UCRA 4DUZB 5FPRA 4DR7B 4NXMB 5LMNB 4OX9B 1N36B 2E5LB 4JI2B 3L2PA 1V9PA 4GLXA 1A0IA 4DV2B 4LFAB 2HHHB 4NXNB 1CKMA 3KYHC 2UXDB 2VQEB 4X64B 1ZAUA 3S24A 4X62B 4DR1B 4EQ5A 3VNNA 4KHPB 3TY9A 3GDEA 4PZ6A 1IBKB 1HR0B 2UUBB 5IWAB 2OWOA 3GJXB 1IBMB 1FJGB 3NBZB 4AQYB 3RTXA 5DISC 2Q2UA 4YHHB 4LF7B 3T1YB 2VQFB 5LMUB 1XNQB 3TY8A 3SGIA 5D1OB 4UCVA 1P16A 1HNZB 2HIVA 4X65B 1J5EB 3W1BA 2CFMA 3BA9A 4YY3B 4DRFA 2ZM6B 1N34B 4UFZA 4DV4B 4JYAB 3BABA 4JI5B 4DR4B 3W5OA 4B3RB 4JI6B 1CKNB 3JSNA 1IBLB 4JI0B 4X66B 3OTOB
chains in the Genus database with same CATH superfamily
4U7CA 3CP1A 4JI7B 4TUYB 2R9AA 1W2BU 3RJ0A 2EIJB 3L72H 2IJJA 2YIBA 5IYZA 1XK5A 4RNMA 4HAMA 3W7SA 4A2AA 2ASLA 1QLEC 3T1HB 2HGWA 4HR7A 3MFIA 3JAMW 3JSLA 3N6RA 1M6VA 1MOFA 4ZOLF 5EBMC 4JI8O 2UXCB 4JV5H 5LGNA 4FLUA 1IYDA 3JD1A 3B4SA 1NTKH 1AUVA 4O4IF 2C00A 3RBDA 5KMGA 4FM0A 2W6ZA 4I50F 1Y4MA 1DTOA 4IIJB 1AP6A 4PDRA 1ZLZA 1FPOA 2BTQB 3RB3A 2C2RA 1XNRH 5LYJF 4FZ1A 3FFQA 3KHLA 2HVJC 2PMZE 4PJ0Z 2CGNA 2D2CB 3BHPA 4WCEV 3JD4A 2R7KA 3CRCA 3GTPA 5K3WA 2DQ3A 2JGDA 3GTJA 3T5HA 1THZA 5EYPA 3G8CA 2CK3G 3K9AA 3M4IA 4NZMA 4O7SA 4O4LF 4YY3O 2JA7A 4FLYA 2W71A 3VOUA 4O86A 3CQZA 4QE7A 4PHZA 1VQMV 4FFNA 1BGWA 5CA3A 3L75H 1EBOA 5JH7B 4DV1H 4IHJB 3MWDA 3SNOA 1YF2A 3ORQA 2P4VA 1SQPH 2Z04A 1N36B 3CEBA 4K6NA 4DR2H 1F23A 1L0NH 1QHTA 4NXNB 2P6JA 1KC8W 3T7AA 4EG0A 1OCZC 2W8LA 3PW4A 1JFFA 2KG7B 4O82A 3J7AU 5FLXN 2HGXA 3EHBB 1VQ8V 2Y0PA 1CE8A 3QG5A 1ZHSA 3FB7C 3VOTA 3GDEA 4DAAA 4DV2H 5KG7A 2GLTA 1A9XA 4O2AB 1XEQA 4TQDA 3N40P 2B5UA 3F7YC 3NBZB 5I5UA 1I2KA 4A2BA 3E2EA 4QIWF 3KTMA 3HB3B 2FP4B 3HOYG 4O7NA 4DR4H 3H4DA 1KJQA 2LQTA 1TVKA 2HG8A 1B6RA 1U96A 3OR6C 1OBGA 2UXNA 3T1YH 5JUMA 1N56A 3OGIB 3U10A 1RM1B 1YVWA 2WLJA 2BTOA 1KUQA 2HR3A 1SZTA 3AG2B 4H13B 4X1KA 4B3RB 4O2BB 5LHIA 2CAZC 5EDWA 3ZX6A 4LFBH 1RSOA 3CSWA 5H9CA 5A2QW 3SJAC 1K9MW 4PDBA 5KFPA 3RWRD 5DG8A 3ETEA 2R9IA 3CXHF 4CH5A 4DRXB 2NVXA 1N34H 2UUAB 2H94A 4JI3O 5KFVA 4JI6H 3STLC 4NXMO 3K04A 2UXBH 2JA6A 3WB1A 2P90A 1YITV 4PA4A 2HHHO 3BA8A 3HKEA 5JQWA 4J9OA 3GIIA 4JF3A 1JJOA 3UT5A 1YSCA 2B9ZA 2YI8A 2N74A 5BWRA 5FNVB 3K5LA 1M93A 2FKXA 4U3JB 4MW8A 3N2KA 3QO7A 4I4TB 2CW7A 1NH2D 1KJJA 4F6RA 4DV7H 5C3EG 3CVZA 2UUCH 4GKKB 1KTAA 4E6NA 4DV3H 1AN7A 4CS2A 5CBGA 2E75B 3T99A 4BY7G 1EZVH 4I5SA 4FZ0A 1AILA 2A9HA 2VQFO 1G6UA 1CXZB 1V54B 3SYPA 2ZIMA 1JKJB 2QGNA 4RB1A 2W9BA 1KMIZ 2RF4A 3R23A 3GIJA 1XNRB 2ILMA 1Y66A 3SR2C 4HNAB 4CH4A 1ZSPA 3I4NG 1M9NA 3T9BA 4DR1H 4P30A 5FPRA 2P67A 5LMNB 4JV2A 3N42B 3CCEV 3D3IA 3TCUA 4LFAB 2EBOA 2UXDB 5I5YA 3TW7A 1Q86W 2V4QA 2DOSA 1BZKA 5KT7A 5EC2C 1CP9A 3D8CA 5IYZB 1ZAUA 4O3QA 1XMOH 4IYHA 1PNMA 2YYAA 4R50A 1F51A 1ZQ7A 4QGPA 5KFHA 2PYJA 4JYAO 4C5BA 5KMGB 2Q2UA 4ME6A 4WFBV 4O7RA 4YB8B 4JPRA 3PR5B 1KP2A 3SJBC 4FJCC 1XHXA 3OR7C 1P16A 3GV5B 1FJGH 5KFUA 3BA9A 4J10A 4YHHH 1MSDA 4DRFA 2AXTZ 4I55F 2JGDB 4Q8FA 4C5AA 4LR3A 3BABA 4DR4B 1R3LC 5KFGA 3WU2Z 1HNWO 3BQ1A 2R8HA 5BMVA 2V1DA 3ICXA 5EBLC 4DUYB 5IY5C 4APMA 2FYUH 4LF4O 1S9FA 1SQQH 2COGA 3QWUA 2VS0A 1AI4A 4JI1H 5DM6V 2R86A 1YJNV 2XCAA 4A3DG 4KXRA 2CTRA 1G8MA 1AJQA 3JZIA 5KT2A 3DSQA 4BWAA 5DQGA 2VQDA 2NU8B 3WB0A 4NKGB 4LFBB 1SS3A 3APOA 2CUGA 2OCCC 1ZTEA 2CTPA 3CWBH 1JFFB 4G28B 2ASJA 4ETSA 1IXMA 4PZ7A 2W6JG 1TAEA 1N32O 1NI8A 3QO5A 4AYBA 4EGJA 2HKOA 2DIKA 3MAQA 1DIKA 2LO1A 2UUBO 4M7EA 1ULZA 4YP3A 4DV0O 1Q8IA 1FS0G 4WBNA 2AGQA 1VQOV 2DWDC 4DV3B 4K8XA 4B08A 3NBYB 5JVDA 1OBDA 4TUYF 2JEUA 5LL6b 2PVPA 1RJPA 3LDDA 4IR9A 3I12A 2W6PA 4X1KB 1B04A 4N23A 1WNSA 4PBCA 2IA6A 3PJSK 5BYBA 5F9LA 3G80A 1RSOB 4J42A 2KKWA 4LFCH 4B3TH 5KFFA 3ZJZA 4L1KA 1T3NA 1NR7A 4AQYO 1DV2A 1VQKV 1QQCA 3DTFA 2VQEB 4IIJF 4KUMA 5JJNB 1EM1A 3DC5A 4X1IA 3LWBA 4DR1B 2Q8VA 1HNZO 5KFNA 4M9UA 3HKEB 2DJVA 1H2GA 2QF7A 3UT5B 1JLLB 3H0GG 1CQIB 2QWRB 1OCRC 3WG7C 2OWOA 4ZQIA 3DGEA 2JA5A 2FMLA 3AK1A 4LF7B 3CD6V 1SRYA 4F6RB 1UPGA 5EIBD 4KHPH 5E1AC 3AK3A 1TUEB 2Q68A 3KG2A 1K1SA 1J5EB 4PI0A 1ZL8A 4C2MA 5IYDO 3HKBA 4IHJF 5JH7F 1NTMH 5B66Z 1VMGA 4NVPA 1JIHA 4UFZA 2XTAA 5FR9A 3T9EA 4DV6O 4D7TA 3JSNA 3OW2U 3M9OB 4QE9A 1AI7A 3MDSA 1I0HA 1SQFA 4XBFA 2HIXA 1AB3A 2ZDHA 5BYAA 1EFRG 1MZEA 1JVMA 5IT9N 3B2EE 4LH6A 4B3MB 3U54A 3RVZA 5KFYA 1Y1WA 1S0NA 1Y74A 4X8AA 4O2AF 3U9TA 4ZHQA 3AG1B 3OTOH 2HEPA 1M7JA 3TQ1A 1SA0A 1AR4A 4MVUA 2FJZA 5BXZA 3RYHA 4JI1B 4EBCA 1I94H 1BMFG 3UM7A 5AG2A 4LWSA 1P7BA 1VS0A 3K3WA 2ZE5A 1CKOA 3MFHA 2YC0A 5C8YA 2R87A 2ODMA 3GVMA 2PY5A 5D1OA 4DR5H 4Q4CA 1WR2A 5CE8A 4NTYA 1E1RG 1XL6A 4PDLA 4O2BF 1O9GA 2PZSA 2C22A 3FB8C 5BPFA 3THOA 4JI8B 3R65A 3H1JH 3QTCA 1H2NA 2HJDA 3FKIG 4O4JA 5EBWC 3RUPA 1WP8A 4ZBMA 3E8GA 3JRXA 1COWG 2J6UA 4H37A 2UXXA 5B1AB 1NVPB 1SQXH 1XILA 4DL6A 2X0SA 5DG9A 1FVIA 4WFHA 5L1LA 3QFFA 5BWTA 5BMVB 5KFOA 2GBOA 4GCZA 3IAYA 5IY5B 5FNVF 2M7WA 3KYHC 1EHIA 3E8HA 4I4TF 4O7VA 3T5KA 5BY1A 2QKAA 4BBRG 4QPJA 2AHYA 4DR7H 1XOUA 5IYBG 2KSWA 2E5LH 4I0XA 3MR6A 2R93A 2RCVA 2OCCB 4UB8Z 4JZ2A 4LSAA 1E79G 4RNNA 3LDEA 1VQLV 4FBTA 4RUAA 1K4CC 4P9OA 4X66O 2DPJA 1T94A 1SYXB 1LR1A 1YDXA 2YRWA 3BACA 4RUCA 2QWOB 3K5NA 3ZEDA 2L35A 4DR6O 3BPZA 1BHAA 3WFVA 4WBNB 1I08A 4X88A 4J9NA 1JDBB 5L1JA 4NR1A 5L3EA 1H2KA 4DR3O 4MV9A 4DV1O 1SESA 2XUMA 1YEWA 1Q6HA 4B3SH 4FFBA 1AP5A 3X2QC 5FJ8G 4A3LG 1N48A 1H2MA 5LHHA 4DV5O 5IYZF 4PELA 4CKEA 2ZM6H 4LF6O 5CB4A 4LF8O 1QVGU 5I5TA 2Q2TA 2V58A 3WWIA 2LFRA 2ZQMA 3J80N 1RPRA 3T4DA 3KREA 5KG6A 2W9CA 1QLNA 4AHCA 3RW0A 2W6QA 4PWQA 4JI7H 1FFXA 2WLHA 2VRZA 3NXSA 2ETNA 2BE3A 3WNZA 2ADQB 5CAEB 4NLGA 5LXTA 4X1IB 1Z2PX 3IN5A 4X62O 4M0JA 4UVAA 4MSWC 5LGUA 1QCEA 4Q0YA 1HDJA 4JV0A 2JEJA 4JI3B 3T1HH 4PZ8A 4FFKA 1OCRB 3D3QA 3VQYA 2B63A 2UXCH 2V59A 2C2EA 2Q7HA 4UCTA 1DV1A 1JQ0A 3R5XA 5LMUO 2EZPA 3VQWA 2ZDIC 2R7ZG 2ZDIA 3L71H 4J9RA 3OSPA 4ECRA 5D5PA 3WWJA 1BSMA 1ZL8B 4DR5B 3HKBB 5I5XA 1AI5A 1IDSA 1YTFD 3O65A 1S68A 2BOCC 2HFEC 4DV4O 1KKDA 3RYIA 1MABG 3CCRV 3CCUV 1AR5A 2QWQB 2X0LA 1KC7A 2WYOA 5JJJB 4ABMA 3K58A 5KFRA 1IBKH 1E1QG 2DWEC 3U9SA 3OM3B 3LSUA 2JDIG 4YXWG 2FB9A 2MK3A 5LL6Y 3GV7B 3G6YA 2IJHA 2QM7A 1ZWIC 4WFAV 3CB2A 1VAJA 5KG4A 1Y74B 2FPPB 2W6MA 4ZHQB 1W0KG 5KAFZ 1SA0B 1XUQA 3RYHB 4NXNH 3SJCC 3GTLA 2ITCC 1ORQC 4LWSB 3FX7A 1IOVA 3ZHSA 3U0ZA 4HBNA 3C0FB 5C8YB 4CKCA 5KFLA 1IBLO 3CSXA 3LQSA 3MHSC 2ARHA 3SGIA 3ETHA 5DGBA 5D1OB 2RN9A 1Y1VG 3SYAA 1Y14B 2XGPA 3MD0A 4MVQA 4JI0H 2RGRA 4RU9A 5CMUA 2FTKA 4MVRA 1OCCC 2N04A 4Z2WA 4DL3A 5L3DA 1VKZA 4Z1MG 2YZLA 4JYAB 1H2LA 4O4JB 3W5OA 3APQA 4BAYA 3JAWA 3RB6A 2QSAA 1V55C 3J81N 3ETDA 3STZC 3GTOA 1AJNA 2IH3C 1P7GA 1Q7YW 2OT5A 1BHBA 1ET0A 1P8LA 1SKVA 3ABKC 3Q2OA 2FKLA 4FBUA 1V4YA 5KKNB 3E83A 4B3SB 1ZX3A 4TV9A 3LNNA 3JZFA 3BFRA 1GN6A 2EIMC 4ZI7A 4DO2A 1HNWB 2UUAH 1S5JA 3H1KH 1SFOA 3H9VA 3E86A 2CDYA 2NN4A 1XMQH 5HNEA 3TXSA 4LF4B 4O3RA 4X20A 4I0XB 4J7KA 1YHQV 4JASA 1I1LA 1VBHA 2EINC 3OUSA 5D5QA 3BQ2A 3KCXA 4C7UA 2Q4PA 5BZBA 3ASNC 2AZ2A 4TV8A 3CE2A 2OCHA 2C2AA 4RAIA 3C90A 1DK1A 1OCOC 1P49A 1FFTB 1NR1A 3FB6C 4GKKH 1N32B 2A3QA 2Q7GA 1WLEA 4MTGA 2R8IA 4U3FH 5I60A 2E74B 5DMXA 1VF6C 5KFQA 3GILA 5JCOC 5JCOA 3CPWU 5I5WA 3SPIA 4DV0B 5H5NA 2BCCH 1H38A 1TGOA 5JJEB 2YW2A 3X2QB 2W6OA 4B7KA 4NYEA 2VWJA 1WSCA 3GIMA 1W0JG 2P22C 4DYLA 1I6UA 4MTOA 2WAQA 1J95A 1G4YB 2K9PA 1RK5A 4KL1A 2Q9LA 1XNQO 5CB4B 4FFPA 3Q8PB 1EN6A 4A93G 1GH6A 3VBBA 4OPAA 2RNBA 1CQJB 2W9CB 4X65O 4CH3A 2YL2A 3G6VA 5LMNH 4RAZA 4DL2A 2CNQA 3TY9A 1FFXB 4NB5A 2ATLA 4YQWA 4LFAH 1IBKB 3T4ZA 5H2FZ 3GTQA 2UXDH 5LXTB 5ITZA 1RPOA 5C93A 3QZ7A 2GHYA 1MA1A 3HPLC 4CZZA 4AQYB 1FXKC 4CBCA 1FXKA 4G27B 3ABMC 2W57A 3FKSG 3RV4A 5F9NA 4ECVA 3SDLA 3K9SA 3T2MA 2NU7B 1ZHQA 1Q43A 2WWWA 5EIBC 1FKAH 1HNZB 3AG4C 4JI4H 4NZOA 5KX5A 2UU9O 5EC1C 1H8EG 4TVIA 5BMVF 2ADPA 3N2GA 5J2TA 4DW1A 4C5CA 4JGSA 2YXYA 3HOWG 3CRAA 5KA6A 2P7TC 4UUJC 4JI0B 3BG5A 1K73W 2FK2A 4ECWA 1HNXO 1IX9A 5IYBO 3RYIB 1AROP 3N6XA 2WLLA 4QWCA 4XDKA 5BWXA 3ASOC 4BW5A 2E2HA 5KA5A 4GKJO 5C5JA 5LHGA 5L3FA 4DUYH 2AGAA 4EYIB 4UCSA 4G3IA 4DV6B 3W1GA 2AGPA 4NYKA 4ED3A 4DIMA 5DLGA 2H3OA 2LFSA 3HBLA 1M57C 4K3AA 4IRKA 3N27A 4WBNF 4IZOA 2WB1E 2Z0AA 5BR8O 4D7SA 5BWUA 2VUGA 3T9FA 3H1HH 1P84F 3ZRVA 3VQVA 4FLWA 4NZNA 2IMWP 1B3QA 3GB7C 1QNMA 1NU1H 4CC6A 1XMQB 4U7OA 2EJ2A 4HNVA 3ZRXA 3ZIAG 4DUZH 2XIGA 4HNTA 4OX9H 2GTAA 4J41A 2VOBA 1JXLA 1MMMA 2XAFA 2NLJC 2V9WA 1YXBA 1OCCB 5GONB 2QE7G 4I7ZB 4OXSA 3S3WA 3FD9A 5LGTA 3CMAV 2COIA 4X64H 2F66C 3JAWB 5KG2A 1I5YA 2FLNA 1VP7A 2V4DA 2WLIA 1V55B 2RMKB 1Z2NX 4YR0A 1TWHA 5L9XA 1IBMO 2FPGB 3HT5A 4A3IG 2Z5UA 3ABUA 5CBHA 2QK4A 3E5NA 3T9DA 3ABKB 2XD4A 1S03G 1KYOF 3ZMSA 5FLMG 2YSUB 2QKCA 2F1MA 1NT2B 4TV9B 3H0GA 4ZI7B 3F5TA 2IJIA 4ED0A 3JRWA 4FVMA 2VQEH 2LW1A 5L3CA 4YR2A 2OH2A 4JYBA 4X20B 3FYIB 4JI5O 3PO3G 2A7WA 3VPCA 2XCLA 4DLKA 3E22A 2DMXA 3TY8A 1FD9A 2EINB 3BCCH 2ZKOA 4UCVA 2WAMA 1EKFA 4ECTA 5B3SC 1NQTA 4O4HA 4TV8B 2WTFA 3GWOA 2WE6A 4LF7H 1Q81W 3B8NA 3JCUZ 4LF9O 2B1IA 2ZDGA 1QLEB 2LW7A 1US6A 4MV7A 2R72A 4IWYA 4J0MA 1TWFA 5KG0A 3RAQA 4X66B 3JAMN 2PN1A 2FB5A 1J5EH 4JI4B 1VQNV 4GX5A 1GKFA 3TETA 4ZHQF 1S3JA 3HKDA 3HOUG 4DR6B 2R9RB 5K1PA 2Z3YA 4QWDA 1AI6A 2E3CA 4DR3B 1XI1A 5C8YF 1SQVH 4RWUA 1V51A 2O03A 4B3MH 2JA7G 4DV5B 2N05A 3K08A 3EPIA 3FB5C 5EYPB 1GM7A 1VQ9V 1N33H 4K0KO 4LF6B 1KKCA 4ZIBA 2R8JA 1G2WA 1SEIA 4BXXG 4R7CA 1U97A 4LF8B 2QYZA 1K92A 1RP3B 5ITZB 3RB4A 4CH6A 4GUNA 4TOIA 5IYCO 4O4JF 2BQUA 3H4BA 1FXKB 4YBZB 5CN0A 3SPGA 5BWVA 2PI4A 3U0GA 5IP9G 4PV1B 1C3OA 4MV8A 2NUAB 3ABMB 4JI2O 4PDVA 5CA1A 3FKIA 1GM9A 2I80A 2Q73A 3EVKA 1OJHA 4R8CA 3AG4B 3H1LH 1XDCA 5KUKA 1OCZB 5KX5B 1RJRA 2W8KA 3W7TA 4UB6Z 2OLSA 5J2TB 2I87A 2OTLV 3KXYT 2MW2B 2JVDA 3UZBA 4JI8H 2DZDA 2Q67A 4DUZB 1HR0O 4WHXA 2ZNJA 3KAJA 3K59A 4A3BG 4OX9B 5BWWA 1K3EA 5IE9A 2Q7DA 2WLLB 5KFBA 3K5OA 2A06H 3MHHC 4FS2A 3DC6A 2R6FA 3JARA 4X64B 1MZFA 1EKPA 1MSWD 4QWAA 4IR1A 1TVKB 3ASOB 3DTGA 3VNNA 2QA4V 1R1BA 3SYOA 3N41B 3QF7A 2ATKC 2P06A 2XAQA 4LMYA 5IDJA 4EB6A 1MG1A 2F23A 1PP9H 2RDCA 2QB5A 4LC1A 3RTXA 5IP7G 2L6LA 4W4KA 2X6AA 3RFCA 3G6EV 3MJFA 3UO3A 3K03A 4RZRA 2JK5C 5CM0A 4ICGA 4JTDB 2F4VO 3ZRSA 5A2QN 1PKXA 1I2LA 3W1BA 3R5HA 4LP8A 3U11A 1SQBH 3P3PA 3HKCA 3D36C 5LBQA 1EYZA 3DXRA 3KZIZ 3D36A 3PVXA 4MTXA 2QEXV 2Y4TA 1S0MA 5DECA 3LDCA 1WB7A 2QTSA 4FLXA 2Y69C 5CB4F 3TK1A 1IBLB 3G8DA 2IBZH 4RQEA 2QR4A 4O84A 4E4TA 3IC7A 2C2DA 4DXWA 3N2KB 2ODTX 4TWKA 4D6TH 2WLIB 3VA7A 4PA7A 4QNHB 4IAJA 1CEZA 5KFDA 1N36O 1T5EA 5LXTF 1XHZA 1WPBA 4F4ZA 2DQ0A 2Y0SA 1S97A 4GLWA 3ABLC 2V5AA 1JOYA 5IJ9A 3T54A 1B6QA 2Y0IA 4IRCA 3LSSA 3T1CA 2W9BB 2ZCEA 2ZR2A 4HNUA 1D5AA 2Q6AA 3KHRA 1K5QA 5LA6A 3PO2G 1KUTA 1MNGA 2QM8A 4FK5C 3Q1KA 3PW0A 1DF4A 4OPHA 5KAIZ 3MR5A 1N0NA 1GRJA 2DLNA 2PBZA 3E22B 1UC9A 4J9QA 3CRQA 1N33B 4RQFA 4JI3H 1QBZA 4NXMH 4MTFA 5B3SB 4O4HB 3LUTB 4LF5B 3K3PA 2HHHH 1KJIA 5B1OA 4J7JA 3K0GA 2KQXA 1WCMG 1GYFA 4FM2A 4B3RO 3RBEA 3TGUH 2CQYA 4I9QA 2Y48A 5IWAO 2VUMG 2GQRA 4A3KG 2EILC 2G38A 3HKDB 3OEHG 1KECA 2OIEA 4O3OA 4MS2A 4GX0A 2IP4A 2VQFH 3GIKA 2R7LA 4P9PA 1GN4A 3JATA 2PI5A 4DW0A 4PZ6A 3G67A 3Q8QB 4MV3A 5A9GA 1Z5VA 5D8DA 3MWMA 4ED8A 2PTMA 1S5LZ 2XAHA 2CE4A 1XNQB 3IC9A 4MW3A 2ZE7A 1AUXA 3M99B 3B77A 3ZRWA 1Y1VA 4FFOA 4IYIA 2P5OA 1EZ1A 1BS3A 5GONF 4F4WA 4JV5O 3HB9A 4X65B 3RYCA 4FGRA 5LOVA 4YY3B 4YJ2A 3OHAA 3CC4V 4AYBE 2C35B 3HXLA 1BNCA 5CA1B 4RAYA 3P30A 2YXHA 5HV6A 3RGXA 1O9HA 1XNRO 1M0TA 2WLKA 2ITDC 3ZN0A 1TA8A 2PF4E 3CRRA 3U55A 4LH7A 2CNUA 2YS7A 4QJFA 4TV9F 1BGYH 4MT8A 4QW8A 5I47A 4JYAH 4BW9A 4FS1A 3CC2V 3OUFA 4ZI7F 2ZD9A 3ML0A 2X6BA 5KFSA 2QWNB 3JZ6A 3KAKA 4ASUG 3IG0A 1JPXA 2IH1C 2QM4A 3JARB 3OSNA 4Q44A 4JYYA 2CW8A 4RO2A 3ZMUA 3RFRA 3UQ8A 2AU0A 1HNXB 4TQSA 1SCUB 3T5LA 1FAFA 5JVDB 3M8AA 3R5FA 2F43G 3FAVA 4DR2O 4TV8F 1PX2A 5KFMA 1AJPA 4EB6B 1F4NA 3UFXB 1HNWH 4GKJB 2YICA 2COJA 4F4XA 1VQPV 3G71V 3BAAA 2BSKA 3N43B 4JV1A 4LF4H 2FK1A 1FXVA 5GTHZ 4R6ZA 1D2DA 1NTZH 4PA6A 4DV2O 5DEDA 4J9LA 2W7OA 4JTAB 5KHJA 3HKCB 3R9RA 1NS1A 2Q0OC 3AEIA 3DXRB 3BEHA 5BR8B 3OEEG 1ENVA 2CGOA 2HLDG 2JA5G 1YJWV 4DR4O 3FDSA 4ECZA 1ZUQA 1I7FA 3HOXG 1N32H 4A3CG 2Y69B 3ZMVA 2XHBA 4NXMB 3WG7B 5KT3A 2RJZA 2XC9A 4GLXA 2ZIOA 2EULA 2UUBH 2HHHB 2GDSA 3T1YO 4MV6A 3CCVV 4O3SA 2Z02A 1C30A 2FMAA 1S76D 4DV0H 3T5JA 3ABTA 2PMZA 4KFMA 1R3KC 5J2UA 3S24A 5B1NA 4LFBO 4E2LA 5IJ9B 5KT4A 3TXQA 5EOYA 3C3SA 1N34O 1IBMB 2YIAA 1GTOA 3IJ4A 4JI6O 2FE3A 2VQFB 5LA6B 5FLXW 5HFLA 2UXBO 3K5HA 2LGQA 1K34A 4O3PA 4YAKB 3T9AA 1Q6UA 3OMNB 5J2TF 3RBZA 2DABA 2IJKA 3GTMA 4O3NA 5F2VO 3V4SA 4AQYH 4JZGA 2YDEA 5KFJA 4HQ6A 1Q3EA 2VR1A 2GTSA 5DG7A 2W6NA 4DV7O 3TQTA 2UUCO 1EN5A 2JRIA 4JI5B 4KP4A 4DV3O 2R7MA 4ECYA 1K33A 1GO3F 1HNZH 3A8TA 4YR3A 1E4EA 4QWEA 4FFRA 4WD3A 4CC5A 4EFBA 3ZHQA 1UNNC 4EFEA 4Q20A 4XYMB 1PPJH 3B8MA 4IRDA 1L0LH 2EILB 3F8NA 5B5EZ 1IXBA 4Q45A 4WFEA 3ETJA 3P32A 4GX1A 4UCOA 2V7QG 4DR1O 1F4MA 1B33N 2VPSA 3JATB 1N0JA 1NBMG 3IGAC 2RGVA 5KT5A 1X4TA 4FE2A 1PNKA 5C1OA 1YCIA 1Z2GA 4DV6H 4ECQA 3K5MA 1XMOO 3GWKC 5JWPA 4CMFA 2EJRA 4TSFG 4DK1A 3ZRWB 2LGWA 5H80A 1XL4A 3CS5A 3H20A 4EBEA 4HYOA 3K3VA 2HVRA 3RYCB 4K0KB 5IJ0A 5LOVB 4YJ2B 4O7TA 2R92G 2QJ1A 3AX6A 5CA0A 2Q5ZA 4EGQA 1X59A 1HWYA 5H6RA 3WB2A 1I50A 3UCSC 1K83A 4TQFA 4UVCA 1FJGO 4JI2B 2ZE6A 2W0XA 1A0IA 1VQ6V 1N8RW 4QJFB 4YHHO 1CKMA 3B09A 4IL6Z 1N4CA 2NR5A 4N21A 3QQMA 1S0OA 2D3OW 3PW7A 2PUSA 2XNDG 3JD0A 5I5VA 4CS3A 4O7LA 2VPQA 2PYLA 4LBEC 3SJQC 1VF6A 1HR0B 4JI1O 1TWAA 2UUBB 3L4JA 1M4UA 4ED2A 3FYEB 3FMAA 4DL5A 2V4RA 4FFBB 2CTWA 4O4HF 3FAVB 3K57A 2NU9B 2IW5A 4LCUC 3UYYA 1A0GA 1K5SA 1LUVA 5BPHA 2DWCA 2HIVA 2B1GA 2BSKB 5KHHA 1GLVA 3OT7A 1WA8A 2FLLA 1GN2A 2I8CA 3CXCU 4QW9A 4ZKIA 3AYHB 3B40A 2WA4A 2CNVA 1R3IC 1VARA 4H44B 1VBGA 4CS4A 1RJQA 3ETQA 5EWFA 2F4VB 2B63G 2M05A 2KSDA 1EUCB 4DQNA 5EK0A 5FD5A 1A48A 4YIOA 4BIZA 1VEWA 4BY1G 1NH2B 4X66H 3QVNA 4O81A 2HVSA 2HJWA 1IURA 1FXHA 2GV9A 3OUUA 2QTOA 3A0RA 2JS5A 5FPOA 1NJIW 3J7AK 1SERA 4DR6H 1KB9F 4FLZA 2HVQA 5J2UB 3CX5F 3CMEV 4FU0A 4LFCO 4R7RA 4B3TO 2XT9A 3GV8B 2BR0A 4MTEA 4DR3H 4AI8A 3RB0A 2R84A 5DQHA 5B1BC 4NTXA 5IYDG 2XASA 3EFFK 1PK8A 2YRXA 5CA1F 2J6SA 4DV5H 1W93A 2M6YA 2JEXA 1Y6XA 4H33A 3OMAB 3CCJV 3EXAA 4LF6H 4JUZA 3GLKA 4RZQA 4LF8H 2W0FC 5KS8A 4MTDA 1Z5WA 1F7YA 1YZBA 2A79B 1M56C 2OYQA 4HZ3A 1I1KA 5TISZ 4ECSA 4O83A 1PL0A 3OAAG 3ZN1A 2JGUA 4X1YA 4KHPO 3GIPA 2HVKC 4E4EA 1JDEA 4X62H 3L70H 3HOZG 2EJ3A 4XDJA 4J80A 1E4EB 1DLBA 1V9PA 2R8GA 5JVDF 5E79Z 4JYCA 5LP6C 1Y67A 2UVWA 5LP6A 1QU7A 5LMUH 1VF5B 2IU3A 5GW7A 3LNMB 2ZJTA 3L74H 4JAVA 3SYQA 3H01A 2XGQA 5IWAB 2YZMA 2PGGA 2J6TA 5L1IA 1SQGA 4MAMA 3C3TA 3AG7A 4DV4H 2W7PA 4EYHB 3OTOO 1B6SA 2VWKA 1AR1B 2W70A 3W7UA 1OZ0A 3TW6A 2KB1A 1I94O 3UKMA 2RDJA 1S10A 2CH7A 3A0HZ 3HO8A 5JQGA 4UV9A 1Q90D 3PFFA 1R73A 5IJ0B 1WPXA 3A0BZ 3JAKA 2EIMB 1WP7A 4DR5O 4O7YA 3EYYA 4J9KA 2OTJV 2RDIA 4YJ3A 1DAAA 5EZYA 5CA0B 3EPGA 4JV5B 4EBDA 5FL7G 1A3GA 4FM9A 4A3JG 1JA8A 5DGHA 3I4MG 1XDNA 1KJ8A 1JX4A 1ZETA 3ZHRA 2ZXWC 1W96A 1IBLH 3ASNB 1UC8A 3TJTA 2FPIB 4HN2A 4XYLB 2R70A 2F95B 3AW8A 3NR7A 5LA6F 1HW7A 4RB0A 3M9MB 1OCOB 1KEEA 5H6QA 5IT9W 2Q7EA 3E35A 2YZNA 1EUDB 1PM9A 1QVFU 3HKZA 2BQ3A 1Q82W 1X9NA 2R7NA 2A0LA 4B7EA 4ZOLA 3DAAA 1L1FA 1ROPA 4W4LA 5JVLA 2WAQE 1WB8A 2AHZA 2ZT9B 5GTIZ 3V4ZA 3AG1C 4O4IA 4I50A 2EIYA 3ETGA 4F4LA 4TM5A 2IU0A 1Z2OX 3ZBHA 4Q6GA 4DR7O 1KT8A 4U6PA 3GQCA 2E5LO 1GM8A 4FFMA 3TY5A 4DV1B 1SF9A 1RYRA 5LYJA 4QPKA 5J9PC 4MVSA 2RQ6A 4DR2B 1WA8B 5KG1A 2F93B 3OD4A 4YIPA 2DYRC 1WCMA 2YUAA 3G6BA 3OGCC 1LUWA 3K06A 5HBRB 2QDOA 2EJ0A 4O4LA 1T36A 3R66A 2VUMA 4UV8A 1GAXA 4K8ZA 3RIZA 4LF5H 4DV2B 1M90W 2MCTA 2HGSA 3MWEA 3BRCA 5B1AC 4EKWA 4U7NA 4B3SO 1S72V 3LULA 3RYFA 2J9GA 4X62B 2JIZG 4K35A 5KLVH 4EQ5A 5FD6A 5CR5A 4A3EG 3AG3C 4GZRB 2AQ4A 2YZGA 4LNUA 1BE3H 3QNEA 2LJ2A 3K0DA 2VA2A 2ZM6O 3N2GB 3KKYA 3L73H 5KUMA 1TUBA 1VQ4V 1GO3E 1BCCH 5KFKA 5DISC 1AVMA 4PDMA 1BJTA 3T1YB 5LMUB 4FLTA 5LOVF 4YJ2F 2YCHA 3PZPA 2LP7A 4FPPA 2ASDA 3ZHVA 5B1BB 4JI7O 4WF9V 4QIWA 2ZDQA 1JJ2U 1L2ZA 4Q8EA 3E8BA 4MV1A 3K79A 1JR9A 1R3JC 1KP3A 5KFAA 1XNQH 1M5IA 1N34B 2WSSG 4UVBA 5KHKA 4DV4B 4FFLA 3T1HO 2UVVA 1M0WA 2XAGA 2IBKA 4JI6B 3RAXA 1TWGA 1PNLA 4MVOA 2JA8G 1R9TA 2UXCO 3W7XA 4X65H 2UXBB 3TINA 1M56B 3ZCCA 2XCPA 3V6JA 2YIBD 2NU6B 4YY3H 4J9ZB 4AILC 4X1YB 2UVUA 4X9QA 2R82A 1M57B 3NUAA 4R8UA 4DL4A 4MV4A 1K7DA 4GT1A 4MVMA 1Q6IA 4XX0B 3OMIB 2E2IA 1P4RA 4DV7B 2JA6G 1Q5OA 2FLPA 2UUCB 4IGGA 1R6NA 1EN4A 3PW2A 3GTKA 5EWGA 1LNQA 4X89A 2XOKG 5LP6B 4A3FG 3JALA 2UU9H 2DYSC 3G4SV 3CCQV 1WAZA 3N44B 1I7NA 3J80W 3GIQA 2YS8A 1IBKO 2QKSA 5KFIA 5KHIA 4ECXA 4OGQB 2E76B 1BQ0A 1BXRA 3PN1A 2DN9A 2YU9A 1HNXH 2ZINA 2K1EA 3S3XA 3W7WA 2HDKA 5C4XG 5T14A 5EWEA 4NXNO 2O57A 2ZR3A 4FMTA 1RK6A 1PL4A 4GKJH 1WN7A 2CH7B 1KD1W 4XZ3B 3I55V 4NTWA 3WO1A 1NKDA 1QR9A 5JQGB 4QWBA 3DTUB 1Y76A 1GGOA 1XMOB 4DL7A 5KHGA 4UCRA 2YEVA 1R6KA 3CJHA 3JAKB 2EJ7A 4JI0O 3CCLV 1WRVA 4YJ3B 3WWHA 5EZYB 5J2UF 2EIKC 1S0VA 2R8KA 1SETA 3CEIA 3RV3A 5BR8H 2GUZA 1IZ3A 1VIBA 2R7ZA 4WFFA 2Q69A 1RFYA 3JASA 3CC7V 2WLMA 3HKZE 4L87A 2ZXWB 1A32A 3LSQA 3CYOA 1OV9A 3SPJA 1HP8A 2EX3A 4JAUA 1L8DA 3GJXB 1FJGB 3NGDA 2NVYA 4QSHA 3CCMV 4ED7A 2H8PC 2Y4RA 4YHHB 5KFTA 2WDTA 4ZOLB 2HHFA 5KT6A 2JEGA 4Q4DA 3VPBA 3RGBA 5KFWA 1PV0A 3JD2A 1K4DC 3L4KA 4O4IB 4IT5A 2UUAO 4I50B 2A1HA 4A5UB 1IBMH 3Q8RB 2CFMA 1O75A 1XMQO 4JXUA 1PD3A 4CKBA 2AZ0A 3VMMA 3Q4HA 3O9OA 3MR3A 4GC6A 2AGOA 1H2SB 3F5WC 5LYJB 1IYEA 4CE5A 2IM9A 2JS3A 3TEKA 4UUGA 5I5SA 1XREA 3SPHA 1FYJA 4F6EA 3E8FA 4JTCB 2GPWA 5L1KA 4I55A 3MR2A 3H40A 2DYRB 3F7VC 4BWSC 4EEQA 4F4YA 2ALZA 4FLVA 1BQZA 3NC0B 2JJ1G 4O4LB 4BR6A 3T9CA 4JI5H 4GKKO 2FK3A 2GPSA 4Z1VA 2ZGIA 3JYCA 5KG5A 4PD4F 2W9AA 4GC7A 3J81W 3KHHA 3BY6A 2DW4A 4UCUA 5KG3A 4F50A 3RYFB 1CS0A 1XQ8A 1GSAA 4ED6A 3CRMA 3SPCA 4LF9H 4LNUB 3AG3B 2YWVA 4RB2C 3OE7G 1EZJA 1TUBB 4QIWE 1I1MA 4O7WA 3UO2A 1RYSA 1NZ6A 4J7ZA 1YTFB 4XDLA 2UU9B 5KFXA 4O7ZA 1GSHA 5LMNO 1BT8A 4LFAO 5CA0F 3LMLA 4BIOA 3ORRA 5DGIA 4FIPC 2UXDO 4LFCB 4J9MA 4B3TB 1CKNA 1JX9A 4YAJB 5DLFA 3TIGA 1M1KW 4Y8VB 3ZHTA 3RGZA 2R92A 4MA5A 3ZS8C 4EEYA 1VF7A 1VQ7V 3JD3A 3RR5A 2EIJC 4TUYA 5DAAA 1R6TA 3PR4A 4HYKA 2W6IG 2Q0AA 2WPDG 1FKAO 4K0KH 3RVYA 4DK0A 4JI4O 3KALA 3GIDA 1KQSU 4JAAA 2NNUA 1KJ9A 2SCUB 1E4FT 4R8UB 3BVOA 5DQIA 5K2MA 1SZXA 2ABJA 2CZGA 3ZHUA 4KHPB 4JI2H 4IIJA 3I56V 4PA3A 3RF2A 2BTQA 2HG5C 2AW9A 3JALB 4G2KA 3AK2A 3OHBA 3VQXA 3SE7A 5C44G 3Q8SB 3OTFA 3TIIA 2DYSB 2HP8A 2EZOA 3HOVG 1I3QA 3QZ8A 3BJYA 4DUYO 2Y0SE 1UFIA 1WJZA 5CBFA 1I7LA 4WFGA 5L3BA 3DF7A 4PI2A 3GTGA 4P2ZA 1HR0H 4A3MG 4I9WA 1NVPD 3I5DA 5E25A 3VPDA 1YJ9V 2P0AA 1OHHG 5DGAA 3UZOA 4I7HA 1GN3A 2ZE8A 3SYCA 3ABLB 2YIDA 5JH7A 4IHJA 3OTOB 4J9YB 1K1QA 3PW5A 4J9SA 3V6HA 1Y76B 4UXNA 1I94B 4DUZO 2YEVB 3CJHB 1IOWA 5KX5F 2YXLA 3E89A 1G1XB 1Y1WG 2KG7A 2WA3A 5D1PA 2GSMB 4OX9O 2JEFA 4A3GG 2EIKB 2CKZB 3SI8A 3A2FA 2GUZB 5KFZA 2F4VH 4ED1A 3G6XA 4X64O 4O2AA 2Y4UA 3JASB 4PA9A 4ECUA 4L8JA 4MA0A 1YI2V 3ZMZA 4RCNA 2P4KA 1I5XA 2DPIA 3RN4A 2R85A 1H8HG 1W59A 2CTQA 3JCZA 3CCSV 4TQRA 2BOBC 5KFEA 4RB3C 4Q43A 3V6KA 3OFNG 2WLNA 4RNOA 3IFXA 2BQRA 1BL8A 3M7MX 1B06A 5HFMA 1XBLA 2HHFB 1OWTA 4LSXA 3HR0A 1S77D 1RM1C 4LF9B 1GMGA 3M9NB 3AG2C 5DN6G 4J9PA 3GB8B 2X5RA 1N36H 4O2BA 3OUZA 2VQEO 3P3NA 1SC5B 3H1IH 3L9DA 3Q4HB 3LP8A 2DAAA 4FM1A 1DF5A 2JEIA 4IWXA 2JJ2G 4CHIA 1CPYA 4DRXA 1DGSA 1K8AW 3RT3C 1UJWB 1GSOA 2UVRA 4DR7B 4I55B 3QO8A 5LP6F 2E5LB 3L2PA 4BIUA 3K5IA 2WB1A 1KU9A 1JMKC 5C1PA 5KFCA 4LF7O 5K1XA 1D5NA 2OIGA 4RUEA 5FNVA 1MZBA 5GONA 2ZNIA 1J5EO 3CHXA 3WO0A 4U3JA 5IYCG 3KHGA 2QWPB 4TT3G 2FL4A 4I4TA 2R93G 2VA3A 5L3GA 3H3VH 4GX2A 2C28A 1K97A 2X7RB 2X6CA 3KCYA 1KBLA 1VQ5V 1GK9A 2HJFC 1V54C 2YS6A 3BQ0A 4B3RH 4BBSG 5JQGF 3ZMTA 2XAJA 1IVSA 5IWAH 1YIJV 4B3MO 2DE0X 1E4GT 4CMDA 1WH2A 1S5HC 4GYCB 2ZM6B 1N33O 1EKVA 4YJ3F 4HNAA 2YI9A 4J11A 1KBHA 5EZYF 1TWCA 1JCHA 4H0LB 4RUFA 1CKNB 3N8DA 1QR8A 4MVZA 2GQSA 4LF5O 1URFA
chains in the Genus database with same CATH topology
4YJ3A 5EZYA 4JI7B 5CA0B 2ZM6H 3N2KB 4JV5B 4TUYB 5CB4A 2R9AA 4FM9A 3RJ0A 4IAJA 1XDNA 2Q2TA 2YIBA 5IYZA 1T5EA 1XK5A 1XHZA 1WPBA 4A2AA 1IBLH 3T1HB 2R70A 4AHCA 5IJ9A 3JSLA 2F95B 3JAMW 1FFXA 4JI7H 1HW7A 4RB0A 2UXCB 4JV5H 4FLUA 5LXTA 5IT9W 4X1IB 1Z2PX 2Q7EA 2ZCEA 5KMGA 4FM0A 1D5AA 4Q0YA 4IIJB 1X9NA 5LA6A 4ZOLA 4JI3B 3T1HH 4PZ8A 2BTQB 3VQYA 1XNRH 2UXCH 4O4IA 2Q7HA 4I50A 3FFQA 4UCTA 3E22B 3VQWA 1Z2OX 3BHPA 4Q6GA 1N33B 4JI3H 3TY5A 4DV1B 5LYJA 4NXMH 5EYPA 5D5PA 4O4HB 3M4IA 2RQ6A 4DR5B 3HKBB 4DR2B 4LF5B 2HHHH 2F93B 4FLYA 1S68A 1GYFA 4PHZA 3RYIA 1BGWA 4FM2A 5JH7B 4DV1H 4IHJB 4O4LA 4I9QA 2WYOA 5JJJB 3K58A 1N36B 4K8ZA 3RIZA 4DR2H 4LF5H 1IBKH 4DV2B 3HKDB 4NXNB 1QHTA 2MCTA 2HGSA 3BRCA 1JFFA 3CB2A 2VQFH 3RYFA 4ZHQB 4X62B 4EQ5A 5FD6A 3QG5A 1ZHSA 3JATA 1SA0B 3GDEA 4LNUA 4DV2H 3RYHB 4PZ6A 4NXNH 4O2AB 4TQDA 3N2GB 3SJCC 3N40P 1Z5VA 3NBZB 3MWMA 2PTMA 1TUBA 3U0ZA 4HBNA 4A2BA 5DISC 3C0FB 1BJTA 3T1YB 5C8YB 5LMUB 1XNQB 3CSXA 4FLTA 4DR4H 2YCHA 3SGIA 5D1OB 1TVKA 2P5OA 4JI0H 4X65B 3RYCA 2RGRA 1L2ZA 5LOVA 4YY3B 4YJ2A 3T1YH 1XNQH 1M5IA 1N34B 3U10A 5KHKA 4DV4B 3HXLA 5CA1B 4JYAB 4RAYA 4O4JB 2BTOA 1M0WA 4X1KA 3W5OA 4B3RB 4O2BB 3JAWA 4JI6B 3RGXA 2CAZC 1O9HA 1M0TA 4LFBH 1RSOA 4X65H 2UXBB 5A2QW 1TA8A 3SJAC 4PDBA 2YIBD 3RWRD 4YY3H 4LH7A 4AILC 4CH5A 4X1YB 4DRXB 1N34H 2UUAB 1P8LA 1SKVA 4JYAH 4BW9A 4JI6H 4B3SB 4DV7B 2UXBH 3WB1A 1Q5OA 4TV9A 3BA8A 3LNNA 3HKEA 2UUCB 3KAKA 3IG0A 1JJOA 3UT5A 2QM4A 3JARB 4ZI7A 1HNWB 2YI8A 2UUAH 2CW8A 1S5JA 5LP6B 3RFRA 3JALA 3UQ8A 5FNVB 1XMQH 3K5LA 1HNXB 4LF4B 2UU9H 1M93A 4X20A 4U3JB 5JVDB 3N2KA 4I4TB 2CW7A 4DV7H 3N44B 4F6RA 3J80W 3CVZA 2UUCH 4GKKB 4E6NA 5D5QA 4EB6B 5KHIA 1AN7A 4DV3H 4CS2A 1HNWH 4GKJB 3PN1A 3BAAA 3N43B 4TV8A 1HNXH 4LF4H 1G6UA 2ZINA 1P49A 2ZIMA 4GKKH 1N32B 2Q7GA 4RB1A 1KMIZ 5KHJA 4GKJH 1WN7A 1XNRB 3HKCB 5JQGB 5JCOC 3SR2C 4HNAB 5BR8B 5JCOA 4CH4A 4DV0B 1XMOB 1TGOA 5KHGA 4UCRA 5JJEB 1I7FA 3JAKB 4DR1H 1N32H 2XHBA 5FPRA 2VWJA 4NXMB 5LMNB 4YJ3B 2P22C 2RJZA 5EZYB 3N42B 4GLXA 1I6UA 2ZIOA 2UUBH 4LFAB 2HHHB 4KL1A 5CB4B 5BR8H 2UXDB 4DV0H 1XMOH 5IYZB 1ZAUA 3JASA 5J2UA 3S24A 5LMNH 4CH3A 4RAZA 5IJ9B 3TY9A 1FFXB 4LFAH 1IBKB 5EOYA 2EX3A 2UXDH 5LXTB 1L8DA 5ITZA 3GJXB 1IBMB 1FJGB 2PYJA 2YIAA 4AQYB 5KMGB 2Q2UA 4YHHB 2FE3A 2VQFB 5LA6B 4ZOLB 2WDTA 5FLXW 2W57A 3RGBA 3SJBC 3L4KA 4O4IB 1ZHQA 1XHXA 1Q43A 1P16A 5EIBC 1FKAH 4I50B 1HNZB 1IBMH 1FJGH 4JI4H 2CFMA 4AQYH 3BA9A 1O75A 5KX5A 4YHHH 1Q3EA 4DRFA 3N2GA 5J2TA 1H2SB 4LR3A 5LYJB 3BABA 4JI5B 4DR4B 2IM9A 5BMVA 1HNZH 4JI0B 3ICXA 4DUYB 4I55A 4APMA 3RYIB 3QWUA 4BWSC 4JI1H 4CC5A 4EEQA 4EFBA 4FLVA 3N6XA 3NC0B 4O4LB 4JI5H 3DSQA 4BWAA 4EFEA 3WB0A 4LFBB 3J81W 4DUYH 3F8NA 4UCSA 4DV6B 3W1GA 1JFFB 4UCUA 4ETSA 3RYFB 4PZ7A 4UCOA 1TAEA 1XQ8A 2VPSA 3JATB 3MAQA 4LF9H 4LNUB 2RGVA 1X4TA 4OX9H 4RB2C 4M7EA 4DV6H 1TUBB 4D7SA 2VUGA 1Q8IA 3K5MA 3VQVA 4FLWA 4WBNA 4CC6A 1XMQB 2UU9B 4DK1A 4DUZH 3H20A 2XIGA 3K3VA 2HVRA 3LMLA 4DV3B 3RYCB 4B08A 4K8XA 4LFCB 3NBYB 5JVDA 4B3TB 4K0KB 1CKNA 5IJ0A 5LOVB 2VOBA 5LL6b 4YJ2B 3RGZA 2QJ1A 5GONB 3ZS8C 4X64H 5CA0A 4X1KB 1B04A 2F66C 1VF7A 1WNSA 3JAWB 3WB2A 3RR5A 4TUYA 2V4DA 4TQFA 2KKWA 2Q0AA 1Z2NX 4B3TH 4LFCH 4K0KH 4DK0A 3KALA 4JI2B 1A0IA 1QQCA 1CKMA 2VQEB 1E4FT 1S03G 5JJNB 2PUSA 4X1IA 2F1MA 1NT2B 4CS3A 4DR1B 4TV9B 3HKEB 2PYLA 4KHPB 4JI2H 4IIJA 3UT5B 3RF2A 4ZI7B 1HR0B 2UUBB 3L4JA 1M4UA 2BTQA 4FVMA 3JALB 2OWOA 3FMAA 2VQEH 3VQXA 3OTFA 4X20B 4FFBB 4LF7B 4F6RB 3E22A 5EIBD 3K57A 3TY8A 4KHPH 3DF7A 4PI2A 1HR0H 4UCVA 2HIVA 1J5EB 4O4HA 4TV8B 5KHHA 4PI0A 2WE6A 3HKBA 4LF7H 4NVPA 4I7HA 4UFZA 4MV7A 2R72A 4J0MA 4D7TA 3JSNA 4IHJA 5JH7A 4CS4A 1J5EH 4X66B 3OTOB 1SQFA 4JI4B 2HIXA 3ETQA 2F4VB 3HKDA 4DR6B 3B2EE 4LH6A 1I94B 4B3MB 5K1PA 2YXLA 5FD5A 5D1PA 2E3CA 4ZHQA 4X66H 4DR3B 3OTOH 2HEPA 2HVSA 1XI1A 3A2FA 2GV9A 1SA0A 2F4VH 2JS5A 5FPOA 4JI1B 3RYHA 3J7AK 4DR6H 4FLZA 2O03A 4O2AA 3JASB 2HVQA 5J2UB 1I94H 4L8JA 4DV5B 4B3MH 5EYPB 1VS0A 1N33H 4R7RA 4LF6B 1CKOA 4ZIBA 5C8YA 1SEIA 4MTEA 4DR3H 4LF8B 4RB3C 2PY5A 5ITZB 4CH6A 5D1OA 4DR5H 4TOIA 3M7MX 4DV5H 1O9GA 2PZSA 4LSXA 3THOA 4JI8B 4LF6H 3QTCA 4LF9B 4RZQA 4LF8H 5CA1A 4O4JA 3GB8B 4MTDA 4O2BA 1N36H 1Z5WA 5KX5B 2OYQA 4FM1A 5J2TB 3KXYT 4JI8H 2JVDA 2JGUA 4DRXA 4X1YA 1DGSA 1FVIA 4DUZB 4X62H 5BMVB 2ZNJA 3KAJA 3K59A 4DR7B 4I55B 4OX9B 2E5LB 3L2PA 3IAYA 1V9PA 1KU9A 1JMKC 3K5OA 3KYHC 5K1XA 3JARA 4X64B 5LP6C 5LP6A 1TVKB 5LMUH 5FNVA 3VNNA 1MZBA 4DR7H 5GONA 2ZNIA 3CHXA 2KSWA 2E5LH 4U3JA 2ZJTA 3N41B 4I4TA 3QF7A 4LSAA 4LMYA 5IWAB 4EB6A 2PGGA 3RTXA 1SQGA 4DV4H 1SYXB 4B3RH 2VWKA 5IWAH 3K5NA 3ZEDA 3BPZA 3W1BA 3U11A 4WBNB 1E4GT 3HKCA 1WH2A 4GYCB 5JQGA 2ZM6B 4HNAA 2YI9A 4MV9A 1YEWA 4B3SH 4FFBA 1CKNB 4FLXA 5IJ0B 3JAKA 1IBLB 3EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TA8 A;  4DUY B;  4JI4 B;  2HIX A;  4JI7 B;  4LH7 A;  3QWU A;  2F4V B;  4CC5 A;  4EEQ A;  4EFB A;  2UUA B;  4JV5 B;  4LH6 A;  4DR6 B;  1P8L A;  1I94 B;  4B3M B;  3NC0 B;  1XDN A;  4EFE A;  2Q2T A;  5D1P A;  4B3S B;  1XK5 A;  4DV7 B;  4LFB B;  4DR3 B;  3T1H B;  2HVS A;  3BA8 A;  2UUC B;  4UCS A;  3JSL A;  4DV6 B;  5FPO A;  4JI1 B;  1HNW B;  2UXC B;  4UCU A;  3W1G A;  2HVQ A;  4DV5 B;  3UQ8 A;  4PZ7 A;  4UCO A;  1TAE A;  1HNX B;  4LF4 B;  1VS0 A;  4LF6 B;  1CKO A;  1X9N A;  4JI3 B;  4LF8 B;  4GKK B;  4PZ8 A;  4E6N A;  5D1O A;  4TOI A;  4GKJ B;  2VUG A;  3PN1 A;  3BAA A;  4UCT A;  4CC6 A;  1XMQ B;  2UU9 B;  4JI8 B;  1N33 B;  2UXB B;  4LF9 B;  3TY5 A;  4DV1 B;  1N32 B;  2HVR A;  4DV3 B;  3GB8 B;  3NBY B;  4LFC B;  4B3T B;  4K0K B;  1CKN A;  1XNR B;  4DR5 B;  4DR2 B;  4LF5 B;  1S68 A;  5BR8 B;  4DV0 B;  1B04 A;  1DGS A;  1FVI A;  1XMO B;  3RR5 A;  4UCR A;  4DUZ B;  5FPR A;  4DR7 B;  4NXM B;  5LMN B;  4OX9 B;  1N36 B;  2E5L B;  4JI2 B;  3L2P A;  1V9P A;  4GLX A;  1A0I A;  4DV2 B;  4LFA B;  2HHH B;  4NXN B;  1CKM A;  3KYH C;  2UXD B;  2VQE B;  4X64 B;  1ZAU A;  3S24 A;  4X62 B;  4DR1 B;  4EQ5 A;  3VNN A;  4KHP B;  3TY9 A;  3GDE A;  4PZ6 A;  1IBK B;  1HR0 B;  2UUB B;  5IWA B;  2OWO A;  3GJX B;  1IBM B;  1FJG B;  3NBZ B;  4AQY B;  3RTX A;  5DIS C;  2Q2U A;  4YHH B;  4LF7 B;  3T1Y B;  2VQF B;  5LMU B;  1XNQ B;  3TY8 A;  3SGI A;  5D1O B;  4UCV A;  1P16 A;  1HNZ B;  2HIV A;  4X65 B;  1J5E B;  3W1B A;  2CFM A;  3BA9 A;  4YY3 B;  4DRF A;  2ZM6 B;  1N34 B;  4UFZ A;  4DV4 B;  4JYA B;  3BAB A;  4JI5 B;  4DR4 B;  3W5O A;  4B3R B;  4JI6 B;  1CKN B;  3JSN A;  1IBL B;  4JI0 B;  4X66 B;  3OTO B; 
#chains in the Genus database with same CATH topology
 4U7C A;  3CP1 A;  4JI7 B;  4TUY B;  2R9A A;  1W2B U;  3RJ0 A;  2EIJ B;  3L72 H;  2IJJ A;  2YIB A;  5IYZ A;  1XK5 A;  4RNM A;  4HAM A;  3W7S A;  4A2A A;  2ASL A;  1QLE C;  3T1H B;  2HGW A;  4HR7 A;  3MFI A;  3JAM W;  3JSL A;  3N6R A;  1M6V A;  1MOF A;  4ZOL F;  5EBM C;  4JI8 O;  2UXC B;  4JV5 H;  5LGN A;  4FLU A;  1IYD A;  3JD1 A;  3B4S A;  1NTK H;  1AUV A;  4O4I F;  2C00 A;  3RBD A;  5KMG A;  4FM0 A;  2W6Z A;  4I50 F;  1Y4M A;  1DTO A;  4IIJ B;  1AP6 A;  4PDR A;  1ZLZ A;  1FPO A;  2BTQ B;  3RB3 A;  2C2R A;  1XNR H;  5LYJ F;  4FZ1 A;  3FFQ A;  3KHL A;  2HVJ C;  2PMZ E;  4PJ0 Z;  2CGN A;  2D2C B;  3BHP A;  4WCE V;  3JD4 A;  2R7K A;  3CRC A;  3GTP A;  5K3W A;  2DQ3 A;  2JGD A;  3GTJ A;  3T5H A;  1THZ A;  5EYP A;  3G8C A;  2CK3 G;  3K9A A;  3M4I A;  4NZM A;  4O7S A;  4O4L F;  4YY3 O;  2JA7 A;  4FLY A;  2W71 A;  3VOU A;  4O86 A;  3CQZ A;  4QE7 A;  4PHZ A;  1VQM V;  4FFN A;  1BGW A;  5CA3 A;  3L75 H;  1EBO A;  5JH7 B;  4DV1 H;  4IHJ B;  3MWD A;  3SNO A;  1YF2 A;  3ORQ A;  2P4V A;  1SQP H;  2Z04 A;  1N36 B;  3CEB A;  4K6N A;  4DR2 H;  1F23 A;  1L0N H;  1QHT A;  4NXN B;  2P6J A;  1KC8 W;  3T7A A;  4EG0 A;  1OCZ C;  2W8L A;  3PW4 A;  1JFF A;  2KG7 B;  4O82 A;  3J7A U;  5FLX N;  2HGX A;  3EHB B;  1VQ8 V;  2Y0P A;  1CE8 A;  3QG5 A;  1ZHS A;  3FB7 C;  3VOT A;  3GDE A;  4DAA A;  4DV2 H;  5KG7 A;  2GLT A;  1A9X A;  4O2A B;  1XEQ A;  4TQD A;  3N40 P;  2B5U A;  3F7Y C;  3NBZ B;  5I5U A;  1I2K A;  4A2B A;  3E2E A;  4QIW F;  3KTM A;  3HB3 B;  2FP4 B;  3HOY G;  4O7N A;  4DR4 H;  3H4D A;  1KJQ A;  2LQT A;  1TVK A;  2HG8 A;  1B6R A;  1U96 A;  3OR6 C;  1OBG A;  2UXN A;  3T1Y H;  5JUM A;  1N56 A;  3OGI B;  3U10 A;  1RM1 B;  1YVW A;  2WLJ A;  2BTO A;  1KUQ A;  2HR3 A;  1SZT A;  3AG2 B;  4H13 B;  4X1K A;  4B3R B;  4O2B B;  5LHI A;  2CAZ C;  5EDW A;  3ZX6 A;  4LFB H;  1RSO A;  3CSW A;  5H9C A;  5A2Q W;  3SJA C;  1K9M W;  4PDB A;  5KFP A;  3RWR D;  5DG8 A;  3ETE A;  2R9I A;  3CXH F;  4CH5 A;  4DRX B;  2NVX A;  1N34 H;  2UUA B;  2H94 A;  4JI3 O;  5KFV A;  4JI6 H;  3STL C;  4NXM O;  3K04 A;  2UXB H;  2JA6 A;  3WB1 A;  2P90 A;  1YIT V;  4PA4 A;  2HHH O;  3BA8 A;  3HKE A;  5JQW A;  4J9O A;  3GII A;  4JF3 A;  1JJO A;  3UT5 A;  1YSC A;  2B9Z A;  2YI8 A;  2N74 A;  5BWR A;  5FNV B;  3K5L A;  1M93 A;  2FKX A;  4U3J B;  4MW8 A;  3N2K A;  3QO7 A;  4I4T B;  2CW7 A;  1NH2 D;  1KJJ A;  4F6R A;  4DV7 H;  5C3E G;  3CVZ A;  2UUC H;  4GKK B;  1KTA A;  4E6N A;  4DV3 H;  1AN7 A;  4CS2 A;  5CBG A;  2E75 B;  3T99 A;  4BY7 G;  1EZV H;  4I5S A;  4FZ0 A;  1AIL A;  2A9H A;  2VQF O;  1G6U A;  1CXZ B;  1V54 B;  3SYP A;  2ZIM A;  1JKJ B;  2QGN A;  4RB1 A;  2W9B A;  1KMI Z;  2RF4 A;  3R23 A;  3GIJ A;  1XNR B;  2ILM A;  1Y66 A;  3SR2 C;  4HNA B;  4CH4 A;  1ZSP A;  3I4N G;  1M9N A;  3T9B A;  4DR1 H;  4P30 A;  5FPR A;  2P67 A;  5LMN B;  4JV2 A;  3N42 B;  3CCE V;  3D3I A;  3TCU A;  4LFA B;  2EBO A;  2UXD B;  5I5Y A;  3TW7 A;  1Q86 W;  2V4Q A;  2DOS A;  1BZK A;  5KT7 A;  5EC2 C;  1CP9 A;  3D8C A;  5IYZ B;  1ZAU A;  4O3Q A;  1XMO H;  4IYH A;  1PNM A;  2YYA A;  4R50 A;  1F51 A;  1ZQ7 A;  4QGP A;  5KFH A;  2PYJ A;  4JYA O;  4C5B A;  5KMG B;  2Q2U A;  4ME6 A;  4WFB V;  4O7R A;  4YB8 B;  4JPR A;  3PR5 B;  1KP2 A;  3SJB C;  4FJC C;  1XHX A;  3OR7 C;  1P16 A;  3GV5 B;  1FJG H;  5KFU A;  3BA9 A;  4J10 A;  4YHH H;  1MSD A;  4DRF A;  2AXT Z;  4I55 F;  2JGD B;  4Q8F A;  4C5A A;  4LR3 A;  3BAB A;  4DR4 B;  1R3L C;  5KFG A;  3WU2 Z;  1HNW O;  3BQ1 A;  2R8H A;  5BMV A;  2V1D A;  3ICX A;  5EBL C;  4DUY B;  5IY5 C;  4APM A;  2FYU H;  4LF4 O;  1S9F A;  1SQQ H;  2COG A;  3QWU A;  2VS0 A;  1AI4 A;  4JI1 H;  5DM6 V;  2R86 A;  1YJN V;  2XCA A;  4A3D G;  4KXR A;  2CTR A;  1G8M A;  1AJQ A;  3JZI A;  5KT2 A;  3DSQ A;  4BWA A;  5DQG A;  2VQD A;  2NU8 B;  3WB0 A;  4NKG B;  4LFB B;  1SS3 A;  3APO A;  2CUG A;  2OCC C;  1ZTE A;  2CTP A;  3CWB H;  1JFF B;  4G28 B;  2ASJ A;  4ETS A;  1IXM A;  4PZ7 A;  2W6J G;  1TAE A;  1N32 O;  1NI8 A;  3QO5 A;  4AYB A;  4EGJ A;  2HKO A;  2DIK A;  3MAQ A;  1DIK A;  2LO1 A;  2UUB O;  4M7E A;  1ULZ A;  4YP3 A;  4DV0 O;  1Q8I A;  1FS0 G;  4WBN A;  2AGQ A;  1VQO V;  2DWD C;  4DV3 B;  4K8X A;  4B08 A;  3NBY B;  5JVD A;  1OBD A;  4TUY F;  2JEU A;  5LL6 b;  2PVP A;  1RJP A;  3LDD A;  4IR9 A;  3I12 A;  2W6P A;  4X1K B;  1B04 A;  4N23 A;  1WNS A;  4PBC A;  2IA6 A;  3PJS K;  5BYB A;  5F9L A;  3G80 A;  1RSO B;  4J42 A;  2KKW A;  4LFC H;  4B3T H;  5KFF A;  3ZJZ A;  4L1K A;  1T3N A;  1NR7 A;  4AQY O;  1DV2 A;  1VQK V;  1QQC A;  3DTF A;  2VQE B;  4IIJ F;  4KUM A;  5JJN B;  1EM1 A;  3DC5 A;  4X1I A;  3LWB A;  4DR1 B;  2Q8V A;  1HNZ O;  5KFN A;  4M9U A;  3HKE B;  2DJV A;  1H2G A;  2QF7 A;  3UT5 B;  1JLL B;  3H0G G;  1CQI B;  2QWR B;  1OCR C;  3WG7 C;  2OWO A;  4ZQI A;  3DGE A;  2JA5 A;  2FML A;  3AK1 A;  4LF7 B;  3CD6 V;  1SRY A;  4F6R B;  1UPG A;  5EIB D;  4KHP H;  5E1A C;  3AK3 A;  1TUE B;  2Q68 A;  3KG2 A;  1K1S A;  1J5E B;  4PI0 A;  1ZL8 A;  4C2M A;  5IYD O;  3HKB A;  4IHJ F;  5JH7 F;  1NTM H;  5B66 Z;  1VMG A;  4NVP A;  1JIH A;  4UFZ A;  2XTA A;  5FR9 A;  3T9E A;  4DV6 O;  4D7T A;  3JSN A;  3OW2 U;  3M9O B;  4QE9 A;  1AI7 A;  3MDS A;  1I0H A;  1SQF A;  4XBF A;  2HIX A;  1AB3 A;  2ZDH A;  5BYA A;  1EFR G;  1MZE A;  1JVM A;  5IT9 N;  3B2E E;  4LH6 A;  4B3M B;  3U54 A;  3RVZ A;  5KFY A;  1Y1W A;  1S0N A;  1Y74 A;  4X8A A;  4O2A F;  3U9T A;  4ZHQ A;  3AG1 B;  3OTO H;  2HEP A;  1M7J A;  3TQ1 A;  1SA0 A;  1AR4 A;  4MVU A;  2FJZ A;  5BXZ A;  3RYH A;  4JI1 B;  4EBC A;  1I94 H;  1BMF G;  3UM7 A;  5AG2 A;  4LWS A;  1P7B A;  1VS0 A;  3K3W A;  2ZE5 A;  1CKO A;  3MFH A;  2YC0 A;  5C8Y A;  2R87 A;  2ODM A;  3GVM A;  2PY5 A;  5D1O A;  4DR5 H;  4Q4C A;  1WR2 A;  5CE8 A;  4NTY A;  1E1R G;  1XL6 A;  4PDL A;  4O2B F;  1O9G A;  2PZS A;  2C22 A;  3FB8 C;  5BPF A;  3THO A;  4JI8 B;  3R65 A;  3H1J H;  3QTC A;  1H2N A;  2HJD A;  3FKI G;  4O4J A;  5EBW C;  3RUP A;  1WP8 A;  4ZBM A;  3E8G A;  3JRX A;  1COW G;  2J6U A;  4H37 A;  2UXX A;  5B1A B;  1NVP B;  1SQX H;  1XIL A;  4DL6 A;  2X0S A;  5DG9 A;  1FVI A;  4WFH A;  5L1L A;  3QFF A;  5BWT A;  5BMV B;  5KFO A;  2GBO A;  4GCZ A;  3IAY A;  5IY5 B;  5FNV F;  2M7W A;  3KYH C;  1EHI A;  3E8H A;  4I4T F;  4O7V A;  3T5K A;  5BY1 A;  2QKA A;  4BBR G;  4QPJ A;  2AHY A;  4DR7 H;  1XOU A;  5IYB G;  2KSW A;  2E5L H;  4I0X A;  3MR6 A;  2R93 A;  2RCV A;  2OCC B;  4UB8 Z;  4JZ2 A;  4LSA A;  1E79 G;  4RNN A;  3LDE A;  1VQL V;  4FBT A;  4RUA A;  1K4C C;  4P9O A;  4X66 O;  2DPJ A;  1T94 A;  1SYX B;  1LR1 A;  1YDX A;  2YRW A;  3BAC A;  4RUC A;  2QWO B;  3K5N A;  3ZED A;  2L35 A;  4DR6 O;  3BPZ A;  1BHA A;  3WFV A;  4WBN B;  1I08 A;  4X88 A;  4J9N A;  1JDB B;  5L1J A;  4NR1 A;  5L3E A;  1H2K A;  4DR3 O;  4MV9 A;  4DV1 O;  1SES A;  2XUM A;  1YEW A;  1Q6H A;  4B3S H;  4FFB A;  1AP5 A;  3X2Q C;  5FJ8 G;  4A3L G;  1N48 A;  1H2M A;  5LHH A;  4DV5 O;  5IYZ F;  4PEL A;  4CKE A;  2ZM6 H;  4LF6 O;  5CB4 A;  4LF8 O;  1QVG U;  5I5T A;  2Q2T A;  2V58 A;  3WWI A;  2LFR A;  2ZQM A;  3J80 N;  1RPR A;  3T4D A;  3KRE A;  5KG6 A;  2W9C A;  1QLN A;  4AHC A;  3RW0 A;  2W6Q A;  4PWQ A;  4JI7 H;  1FFX A;  2WLH A;  2VRZ A;  3NXS A;  2ETN A;  2BE3 A;  3WNZ A;  2ADQ B;  5CAE B;  4NLG A;  5LXT A;  4X1I B;  1Z2P X;  3IN5 A;  4X62 O;  4M0J A;  4UVA A;  4MSW C;  5LGU A;  1QCE A;  4Q0Y A;  1HDJ A;  4JV0 A;  2JEJ A;  4JI3 B;  3T1H H;  4PZ8 A;  4FFK A;  1OCR B;  3D3Q A;  3VQY A;  2B63 A;  2UXC H;  2V59 A;  2C2E A;  2Q7H A;  4UCT A;  1DV1 A;  1JQ0 A;  3R5X A;  5LMU O;  2EZP A;  3VQW A;  2ZDI C;  2R7Z G;  2ZDI A;  3L71 H;  4J9R A;  3OSP A;  4ECR A;  5D5P A;  3WWJ A;  1BSM A;  1ZL8 B;  4DR5 B;  3HKB B;  5I5X A;  1AI5 A;  1IDS A;  1YTF D;  3O65 A;  1S68 A;  2BOC C;  2HFE C;  4DV4 O;  1KKD A;  3RYI A;  1MAB G;  3CCR V;  3CCU V;  1AR5 A;  2QWQ B;  2X0L A;  1KC7 A;  2WYO A;  5JJJ B;  4ABM A;  3K58 A;  5KFR A;  1IBK H;  1E1Q G;  2DWE C;  3U9S A;  3OM3 B;  3LSU A;  2JDI G;  4YXW G;  2FB9 A;  2MK3 A;  5LL6 Y;  3GV7 B;  3G6Y A;  2IJH A;  2QM7 A;  1ZWI C;  4WFA V;  3CB2 A;  1VAJ A;  5KG4 A;  1Y74 B;  2FPP B;  2W6M A;  4ZHQ B;  1W0K G;  5KAF Z;  1SA0 B;  1XUQ A;  3RYH B;  4NXN H;  3SJC C;  3GTL A;  2ITC C;  1ORQ C;  4LWS B;  3FX7 A;  1IOV A;  3ZHS A;  3U0Z A;  4HBN A;  3C0F B;  5C8Y B;  4CKC A;  5KFL A;  1IBL O;  3CSX A;  3LQS A;  3MHS C;  2ARH A;  3SGI A;  3ETH A;  5DGB A;  5D1O B;  2RN9 A;  1Y1V G;  3SYA A;  1Y14 B;  2XGP A;  3MD0 A;  4MVQ A;  4JI0 H;  2RGR A;  4RU9 A;  5CMU A;  2FTK A;  4MVR A;  1OCC C;  2N04 A;  4Z2W A;  4DL3 A;  5L3D A;  1VKZ A;  4Z1M G;  2YZL A;  4JYA B;  1H2L A;  4O4J B;  3W5O A;  3APQ A;  4BAY A;  3JAW A;  3RB6 A;  2QSA A;  1V55 C;  3J81 N;  3ETD A;  3STZ C;  3GTO A;  1AJN A;  2IH3 C;  1P7G A;  1Q7Y W;  2OT5 A;  1BHB A;  1ET0 A;  1P8L A;  1SKV A;  3ABK C;  3Q2O A;  2FKL A;  4FBU A;  1V4Y A;  5KKN B;  3E83 A;  4B3S B;  1ZX3 A;  4TV9 A;  3LNN A;  3JZF A;  3BFR A;  1GN6 A;  2EIM C;  4ZI7 A;  4DO2 A;  1HNW B;  2UUA H;  1S5J A;  3H1K H;  1SFO A;  3H9V A;  3E86 A;  2CDY A;  2NN4 A;  1XMQ H;  5HNE A;  3TXS A;  4LF4 B;  4O3R A;  4X20 A;  4I0X B;  4J7K A;  1YHQ V;  4JAS A;  1I1L A;  1VBH A;  2EIN C;  3OUS A;  5D5Q A;  3BQ2 A;  3KCX A;  4C7U A;  2Q4P A;  5BZB A;  3ASN C;  2AZ2 A;  4TV8 A;  3CE2 A;  2OCH A;  2C2A A;  4RAI A;  3C90 A;  1DK1 A;  1OCO C;  1P49 A;  1FFT B;  1NR1 A;  3FB6 C;  4GKK H;  1N32 B;  2A3Q A;  2Q7G A;  1WLE A;  4MTG A;  2R8I A;  4U3F H;  5I60 A;  2E74 B;  5DMX A;  1VF6 C;  5KFQ A;  3GIL A;  5JCO C;  5JCO A;  3CPW U;  5I5W A;  3SPI A;  4DV0 B;  5H5N A;  2BCC H;  1H38 A;  1TGO A;  5JJE B;  2YW2 A;  3X2Q B;  2W6O A;  4B7K A;  4NYE A;  2VWJ A;  1WSC A;  3GIM A;  1W0J G;  2P22 C;  4DYL A;  1I6U A;  4MTO A;  2WAQ A;  1J95 A;  1G4Y B;  2K9P A;  1RK5 A;  4KL1 A;  2Q9L A;  1XNQ O;  5CB4 B;  4FFP A;  3Q8P B;  1EN6 A;  4A93 G;  1GH6 A;  3VBB A;  4OPA A;  2RNB A;  1CQJ B;  2W9C B;  4X65 O;  4CH3 A;  2YL2 A;  3G6V A;  5LMN H;  4RAZ A;  4DL2 A;  2CNQ A;  3TY9 A;  1FFX B;  4NB5 A;  2ATL A;  4YQW A;  4LFA H;  1IBK B;  3T4Z A;  5H2F Z;  3GTQ A;  2UXD H;  5LXT B;  5ITZ A;  1RPO A;  5C93 A;  3QZ7 A;  2GHY A;  1MA1 A;  3HPL C;  4CZZ A;  4AQY B;  1FXK C;  4CBC A;  1FXK A;  4G27 B;  3ABM C;  2W57 A;  3FKS G;  3RV4 A;  5F9N A;  4ECV A;  3SDL A;  3K9S A;  3T2M A;  2NU7 B;  1ZHQ A;  1Q43 A;  2WWW A;  5EIB C;  1FKA H;  1HNZ B;  3AG4 C;  4JI4 H;  4NZO A;  5KX5 A;  2UU9 O;  5EC1 C;  1H8E G;  4TVI A;  5BMV F;  2ADP A;  3N2G A;  5J2T A;  4DW1 A;  4C5C A;  4JGS A;  2YXY A;  3HOW G;  3CRA A;  5KA6 A;  2P7T C;  4UUJ C;  4JI0 B;  3BG5 A;  1K73 W;  2FK2 A;  4ECW A;  1HNX O;  1IX9 A;  5IYB O;  3RYI B;  1ARO P;  3N6X A;  2WLL A;  4QWC A;  4XDK A;  5BWX A;  3ASO C;  4BW5 A;  2E2H A;  5KA5 A;  4GKJ O;  5C5J A;  5LHG A;  5L3F A;  4DUY H;  2AGA A;  4EYI B;  4UCS A;  4G3I A;  4DV6 B;  3W1G A;  2AGP A;  4NYK A;  4ED3 A;  4DIM A;  5DLG A;  2H3O A;  2LFS A;  3HBL A;  1M57 C;  4K3A A;  4IRK A;  3N27 A;  4WBN F;  4IZO A;  2WB1 E;  2Z0A A;  5BR8 O;  4D7S A;  5BWU A;  2VUG A;  3T9F A;  3H1H H;  1P84 F;  3ZRV A;  3VQV A;  4FLW A;  4NZN A;  2IMW P;  1B3Q A;  3GB7 C;  1QNM A;  1NU1 H;  4CC6 A;  1XMQ B;  4U7O A;  2EJ2 A;  4HNV A;  3ZRX A;  3ZIA G;  4DUZ H;  2XIG A;  4HNT A;  4OX9 H;  2GTA A;  4J41 A;  2VOB A;  1JXL A;  1MMM A;  2XAF A;  2NLJ C;  2V9W A;  1YXB A;  1OCC B;  5GON B;  2QE7 G;  4I7Z B;  4OXS A;  3S3W A;  3FD9 A;  5LGT A;  3CMA V;  2COI A;  4X64 H;  2F66 C;  3JAW B;  5KG2 A;  1I5Y A;  2FLN A;  1VP7 A;  2V4D A;  2WLI A;  1V55 B;  2RMK B;  1Z2N X;  4YR0 A;  1TWH A;  5L9X A;  1IBM O;  2FPG B;  3HT5 A;  4A3I G;  2Z5U A;  3ABU A;  5CBH A;  2QK4 A;  3E5N A;  3T9D A;  3ABK B;  2XD4 A;  1S03 G;  1KYO F;  3ZMS A;  5FLM G;  2YSU B;  2QKC A;  2F1M A;  1NT2 B;  4TV9 B;  3H0G A;  4ZI7 B;  3F5T A;  2IJI A;  4ED0 A;  3JRW A;  4FVM A;  2VQE H;  2LW1 A;  5L3C A;  4YR2 A;  2OH2 A;  4JYB A;  4X20 B;  3FYI B;  4JI5 O;  3PO3 G;  2A7W A;  3VPC A;  2XCL A;  4DLK A;  3E22 A;  2DMX A;  3TY8 A;  1FD9 A;  2EIN B;  3BCC H;  2ZKO A;  4UCV A;  2WAM A;  1EKF A;  4ECT A;  5B3S C;  1NQT A;  4O4H A;  4TV8 B;  2WTF A;  3GWO A;  2WE6 A;  4LF7 H;  1Q81 W;  3B8N A;  3JCU Z;  4LF9 O;  2B1I A;  2ZDG A;  1QLE B;  2LW7 A;  1US6 A;  4MV7 A;  2R72 A;  4IWY A;  4J0M A;  1TWF A;  5KG0 A;  3RAQ A;  4X66 B;  3JAM N;  2PN1 A;  2FB5 A;  1J5E H;  4JI4 B;  1VQN V;  4GX5 A;  1GKF A;  3TET A;  4ZHQ F;  1S3J A;  3HKD A;  3HOU G;  4DR6 B;  2R9R B;  5K1P A;  2Z3Y A;  4QWD A;  1AI6 A;  2E3C A;  4DR3 B;  1XI1 A;  5C8Y F;  1SQV H;  4RWU A;  1V51 A;  2O03 A;  4B3M H;  2JA7 G;  4DV5 B;  2N05 A;  3K08 A;  3EPI A;  3FB5 C;  5EYP B;  1GM7 A;  1VQ9 V;  1N33 H;  4K0K O;  4LF6 B;  1KKC A;  4ZIB A;  2R8J A;  1G2W A;  1SEI A;  4BXX G;  4R7C A;  1U97 A;  4LF8 B;  2QYZ A;  1K92 A;  1RP3 B;  5ITZ B;  3RB4 A;  4CH6 A;  4GUN A;  4TOI A;  5IYC O;  4O4J F;  2BQU A;  3H4B A;  1FXK B;  4YBZ B;  5CN0 A;  3SPG A;  5BWV A;  2PI4 A;  3U0G A;  5IP9 G;  4PV1 B;  1C3O A;  4MV8 A;  2NUA B;  3ABM B;  4JI2 O;  4PDV A;  5CA1 A;  3FKI A;  1GM9 A;  2I80 A;  2Q73 A;  3EVK A;  1OJH A;  4R8C A;  3AG4 B;  3H1L H;  1XDC A;  5KUK A;  1OCZ B;  5KX5 B;  1RJR A;  2W8K A;  3W7T A;  4UB6 Z;  2OLS A;  5J2T B;  2I87 A;  2OTL V;  3KXY T;  2MW2 B;  2JVD A;  3UZB A;  4JI8 H;  2DZD A;  2Q67 A;  4DUZ B;  1HR0 O;  4WHX A;  2ZNJ A;  3KAJ A;  3K59 A;  4A3B G;  4OX9 B;  5BWW A;  1K3E A;  5IE9 A;  2Q7D A;  2WLL B;  5KFB A;  3K5O A;  2A06 H;  3MHH C;  4FS2 A;  3DC6 A;  2R6F A;  3JAR A;  4X64 B;  1MZF A;  1EKP A;  1MSW D;  4QWA A;  4IR1 A;  1TVK B;  3ASO B;  3DTG A;  3VNN A;  2QA4 V;  1R1B A;  3SYO A;  3N41 B;  3QF7 A;  2ATK C;  2P06 A;  2XAQ A;  4LMY A;  5IDJ A;  4EB6 A;  1MG1 A;  2F23 A;  1PP9 H;  2RDC A;  2QB5 A;  4LC1 A;  3RTX A;  5IP7 G;  2L6L A;  4W4K A;  2X6A A;  3RFC A;  3G6E V;  3MJF A;  3UO3 A;  3K03 A;  4RZR A;  2JK5 C;  5CM0 A;  4ICG A;  4JTD B;  2F4V O;  3ZRS A;  5A2Q N;  1PKX A;  1I2L A;  3W1B A;  3R5H A;  4LP8 A;  3U11 A;  1SQB H;  3P3P A;  3HKC A;  3D36 C;  5LBQ A;  1EYZ A;  3DXR A;  3KZI Z;  3D36 A;  3PVX A;  4MTX A;  2QEX V;  2Y4T A;  1S0M A;  5DEC A;  3LDC A;  1WB7 A;  2QTS A;  4FLX A;  2Y69 C;  5CB4 F;  3TK1 A;  1IBL B;  3G8D A;  2IBZ H;  4RQE A;  2QR4 A;  4O84 A;  4E4T A;  3IC7 A;  2C2D A;  4DXW A;  3N2K B;  2ODT X;  4TWK A;  4D6T H;  2WLI B;  3VA7 A;  4PA7 A;  4QNH B;  4IAJ A;  1CEZ A;  5KFD A;  1N36 O;  1T5E A;  5LXT F;  1XHZ A;  1WPB A;  4F4Z A;  2DQ0 A;  2Y0S A;  1S97 A;  4GLW A;  3ABL C;  2V5A A;  1JOY A;  5IJ9 A;  3T54 A;  1B6Q A;  2Y0I A;  4IRC A;  3LSS A;  3T1C A;  2W9B B;  2ZCE A;  2ZR2 A;  4HNU A;  1D5A A;  2Q6A A;  3KHR A;  1K5Q A;  5LA6 A;  3PO2 G;  1KUT A;  1MNG A;  2QM8 A;  4FK5 C;  3Q1K A;  3PW0 A;  1DF4 A;  4OPH A;  5KAI Z;  3MR5 A;  1N0N A;  1GRJ A;  2DLN A;  2PBZ A;  3E22 B;  1UC9 A;  4J9Q A;  3CRQ A;  1N33 B;  4RQF A;  4JI3 H;  1QBZ A;  4NXM H;  4MTF A;  5B3S B;  4O4H B;  3LUT B;  4LF5 B;  3K3P A;  2HHH H;  1KJI A;  5B1O A;  4J7J A;  3K0G A;  2KQX A;  1WCM G;  1GYF A;  4FM2 A;  4B3R O;  3RBE A;  3TGU H;  2CQY A;  4I9Q A;  2Y48 A;  5IWA O;  2VUM G;  2GQR A;  4A3K G;  2EIL C;  2G38 A;  3HKD B;  3OEH G;  1KEC A;  2OIE A;  4O3O A;  4MS2 A;  4GX0 A;  2IP4 A;  2VQF H;  3GIK A;  2R7L A;  4P9P A;  1GN4 A;  3JAT A;  2PI5 A;  4DW0 A;  4PZ6 A;  3G67 A;  3Q8Q B;  4MV3 A;  5A9G A;  1Z5V A;  5D8D A;  3MWM A;  4ED8 A;  2PTM A;  1S5L Z;  2XAH A;  2CE4 A;  1XNQ B;  3IC9 A;  4MW3 A;  2ZE7 A;  1AUX A;  3M99 B;  3B77 A;  3ZRW A;  1Y1V A;  4FFO A;  4IYI A;  2P5O A;  1EZ1 A;  1BS3 A;  5GON F;  4F4W A;  4JV5 O;  3HB9 A;  4X65 B;  3RYC A;  4FGR A;  5LOV A;  4YY3 B;  4YJ2 A;  3OHA A;  3CC4 V;  4AYB E;  2C35 B;  3HXL A;  1BNC A;  5CA1 B;  4RAY A;  3P30 A;  2YXH A;  5HV6 A;  3RGX A;  1O9H A;  1XNR O;  1M0T A;  2WLK A;  2ITD C;  3ZN0 A;  1TA8 A;  2PF4 E;  3CRR A;  3U55 A;  4LH7 A;  2CNU A;  2YS7 A;  4QJF A;  4TV9 F;  1BGY H;  4MT8 A;  4QW8 A;  5I47 A;  4JYA H;  4BW9 A;  4FS1 A;  3CC2 V;  3OUF A;  4ZI7 F;  2ZD9 A;  3ML0 A;  2X6B A;  5KFS A;  2QWN B;  3JZ6 A;  3KAK A;  4ASU G;  3IG0 A;  1JPX A;  2IH1 C;  2QM4 A;  3JAR B;  3OSN A;  4Q44 A;  4JYY A;  2CW8 A;  4RO2 A;  3ZMU A;  3RFR A;  3UQ8 A;  2AU0 A;  1HNX B;  4TQS A;  1SCU B;  3T5L A;  1FAF A;  5JVD B;  3M8A A;  3R5F A;  2F43 G;  3FAV A;  4DR2 O;  4TV8 F;  1PX2 A;  5KFM A;  1AJP A;  4EB6 B;  1F4N A;  3UFX B;  1HNW H;  4GKJ B;  2YIC A;  2COJ A;  4F4X A;  1VQP V;  3G71 V;  3BAA A;  2BSK A;  3N43 B;  4JV1 A;  4LF4 H;  2FK1 A;  1FXV A;  5GTH Z;  4R6Z A;  1D2D A;  1NTZ H;  4PA6 A;  4DV2 O;  5DED A;  4J9L A;  2W7O A;  4JTA B;  5KHJ A;  3HKC B;  3R9R A;  1NS1 A;  2Q0O C;  3AEI A;  3DXR B;  3BEH A;  5BR8 B;  3OEE G;  1ENV A;  2CGO A;  2HLD G;  2JA5 G;  1YJW V;  4DR4 O;  3FDS A;  4ECZ A;  1ZUQ A;  1I7F A;  3HOX G;  1N32 H;  4A3C G;  2Y69 B;  3ZMV A;  2XHB A;  4NXM B;  3WG7 B;  5KT3 A;  2RJZ A;  2XC9 A;  4GLX A;  2ZIO A;  2EUL A;  2UUB H;  2HHH B;  2GDS A;  3T1Y O;  4MV6 A;  3CCV V;  4O3S A;  2Z02 A;  1C30 A;  2FMA A;  1S76 D;  4DV0 H;  3T5J A;  3ABT A;  2PMZ A;  4KFM A;  1R3K C;  5J2U A;  3S24 A;  5B1N A;  4LFB O;  4E2L A;  5IJ9 B;  5KT4 A;  3TXQ A;  5EOY A;  3C3S A;  1N34 O;  1IBM B;  2YIA A;  1GTO A;  3IJ4 A;  4JI6 O;  2FE3 A;  2VQF B;  5LA6 B;  5FLX W;  5HFL A;  2UXB O;  3K5H A;  2LGQ A;  1K34 A;  4O3P A;  4YAK B;  3T9A A;  1Q6U A;  3OMN B;  5J2T F;  3RBZ A;  2DAB A;  2IJK A;  3GTM A;  4O3N A;  5F2V O;  3V4S A;  4AQY H;  4JZG A;  2YDE A;  5KFJ A;  4HQ6 A;  1Q3E A;  2VR1 A;  2GTS A;  5DG7 A;  2W6N A;  4DV7 O;  3TQT A;  2UUC O;  1EN5 A;  2JRI A;  4JI5 B;  4KP4 A;  4DV3 O;  2R7M A;  4ECY A;  1K33 A;  1GO3 F;  1HNZ H;  3A8T A;  4YR3 A;  1E4E A;  4QWE A;  4FFR A;  4WD3 A;  4CC5 A;  4EFB A;  3ZHQ A;  1UNN C;  4EFE A;  4Q20 A;  4XYM B;  1PPJ H;  3B8M A;  4IRD A;  1L0L H;  2EIL B;  3F8N A;  5B5E Z;  1IXB A;  4Q45 A;  4WFE A;  3ETJ A;  3P32 A;  4GX1 A;  4UCO A;  2V7Q G;  4DR1 O;  1F4M A;  1B33 N;  2VPS A;  3JAT B;  1N0J A;  1NBM G;  3IGA C;  2RGV A;  5KT5 A;  1X4T A;  4FE2 A;  1PNK A;  5C1O A;  1YCI A;  1Z2G A;  4DV6 H;  4ECQ A;  3K5M A;  1XMO O;  3GWK C;  5JWP A;  4CMF A;  2EJR A;  4TSF G;  4DK1 A;  3ZRW B;  2LGW A;  5H80 A;  1XL4 A;  3CS5 A;  3H20 A;  4EBE A;  4HYO A;  3K3V A;  2HVR A;  3RYC B;  4K0K B;  5IJ0 A;  5LOV B;  4YJ2 B;  4O7T A;  2R92 G;  2QJ1 A;  3AX6 A;  5CA0 A;  2Q5Z A;  4EGQ A;  1X59 A;  1HWY A;  5H6R A;  3WB2 A;  1I50 A;  3UCS C;  1K83 A;  4TQF A;  4UVC A;  1FJG O;  4JI2 B;  2ZE6 A;  2W0X A;  1A0I A;  1VQ6 V;  1N8R W;  4QJF B;  4YHH O;  1CKM A;  3B09 A;  4IL6 Z;  1N4C A;  2NR5 A;  4N21 A;  3QQM A;  1S0O A;  2D3O W;  3PW7 A;  2PUS A;  2XND G;  3JD0 A;  5I5V A;  4CS3 A;  4O7L A;  2VPQ A;  2PYL A;  4LBE C;  3SJQ C;  1VF6 A;  1HR0 B;  4JI1 O;  1TWA A;  2UUB B;  3L4J A;  1M4U A;  4ED2 A;  3FYE B;  3FMA A;  4DL5 A;  2V4R A;  4FFB B;  2CTW A;  4O4H F;  3FAV B;  3K57 A;  2NU9 B;  2IW5 A;  4LCU C;  3UYY A;  1A0G A;  1K5S A;  1LUV A;  5BPH A;  2DWC A;  2HIV A;  2B1G A;  2BSK B;  5KHH A;  1GLV A;  3OT7 A;  1WA8 A;  2FLL A;  1GN2 A;  2I8C A;  3CXC U;  4QW9 A;  4ZKI A;  3AYH B;  3B40 A;  2WA4 A;  2CNV A;  1R3I C;  1VAR A;  4H44 B;  1VBG A;  4CS4 A;  1RJQ A;  3ETQ A;  5EWF A;  2F4V B;  2B63 G;  2M05 A;  2KSD A;  1EUC B;  4DQN A;  5EK0 A;  5FD5 A;  1A48 A;  4YIO A;  4BIZ A;  1VEW A;  4BY1 G;  1NH2 B;  4X66 H;  3QVN A;  4O81 A;  2HVS A;  2HJW A;  1IUR A;  1FXH A;  2GV9 A;  3OUU A;  2QTO A;  3A0R A;  2JS5 A;  5FPO A;  1NJI W;  3J7A K;  1SER A;  4DR6 H;  1KB9 F;  4FLZ A;  2HVQ A;  5J2U B;  3CX5 F;  3CME V;  4FU0 A;  4LFC O;  4R7R A;  4B3T O;  2XT9 A;  3GV8 B;  2BR0 A;  4MTE A;  4DR3 H;  4AI8 A;  3RB0 A;  2R84 A;  5DQH A;  5B1B C;  4NTX A;  5IYD G;  2XAS A;  3EFF K;  1PK8 A;  2YRX A;  5CA1 F;  2J6S A;  4DV5 H;  1W93 A;  2M6Y A;  2JEX A;  1Y6X A;  4H33 A;  3OMA B;  3CCJ V;  3EXA A;  4LF6 H;  4JUZ A;  3GLK A;  4RZQ A;  4LF8 H;  2W0F C;  5KS8 A;  4MTD A;  1Z5W A;  1F7Y A;  1YZB A;  2A79 B;  1M56 C;  2OYQ A;  4HZ3 A;  1I1K A;  5TIS Z;  4ECS A;  4O83 A;  1PL0 A;  3OAA G;  3ZN1 A;  2JGU A;  4X1Y A;  4KHP O;  3GIP A;  2HVK C;  4E4E A;  1JDE A;  4X62 H;  3L70 H;  3HOZ G;  2EJ3 A;  4XDJ A;  4J80 A;  1E4E B;  1DLB A;  1V9P A;  2R8G A;  5JVD F;  5E79 Z;  4JYC A;  5LP6 C;  1Y67 A;  2UVW A;  5LP6 A;  1QU7 A;  5LMU H;  1VF5 B;  2IU3 A;  5GW7 A;  3LNM B;  2ZJT A;  3L74 H;  4JAV A;  3SYQ A;  3H01 A;  2XGQ A;  5IWA B;  2YZM A;  2PGG A;  2J6T A;  5L1I A;  1SQG A;  4MAM A;  3C3T A;  3AG7 A;  4DV4 H;  2W7P A;  4EYH B;  3OTO O;  1B6S A;  2VWK A;  1AR1 B;  2W70 A;  3W7U A;  1OZ0 A;  3TW6 A;  2KB1 A;  1I94 O;  3UKM A;  2RDJ A;  1S10 A;  2CH7 A;  3A0H Z;  3HO8 A;  5JQG A;  4UV9 A;  1Q90 D;  3PFF A;  1R73 A;  5IJ0 B;  1WPX A;  3A0B Z;  3JAK A;  2EIM B;  1WP7 A;  4DR5 O;  4O7Y A;  3EYY A;  4J9K A;  2OTJ V;  2RDI A;  4YJ3 A;  1DAA A;  5EZY A;  5CA0 B;  3EPG A;  4JV5 B;  4EBD A;  5FL7 G;  1A3G A;  4FM9 A;  4A3J G;  1JA8 A;  5DGH A;  3I4M G;  1XDN A;  1KJ8 A;  1JX4 A;  1ZET A;  3ZHR A;  2ZXW C;  1W96 A;  1IBL H;  3ASN B;  1UC8 A;  3TJT A;  2FPI B;  4HN2 A;  4XYL B;  2R70 A;  2F95 B;  3AW8 A;  3NR7 A;  5LA6 F;  1HW7 A;  4RB0 A;  3M9M B;  1OCO B;  1KEE A;  5H6Q A;  5IT9 W;  2Q7E A;  3E35 A;  2YZN A;  1EUD B;  1PM9 A;  1QVF U;  3HKZ A;  2BQ3 A;  1Q82 W;  1X9N A;  2R7N A;  2A0L A;  4B7E A;  4ZOL A;  3DAA A;  1L1F A;  1ROP A;  4W4L A;  5JVL A;  2WAQ E;  1WB8 A;  2AHZ A;  2ZT9 B;  5GTI Z;  3V4Z A;  3AG1 C;  4O4I A;  4I50 A;  2EIY A;  3ETG A;  4F4L A;  4TM5 A;  2IU0 A;  1Z2O X;  3ZBH A;  4Q6G A;  4DR7 O;  1KT8 A;  4U6P A;  3GQC A;  2E5L O;  1GM8 A;  4FFM A;  3TY5 A;  4DV1 B;  1SF9 A;  1RYR A;  5LYJ A;  4QPK A;  5J9P C;  4MVS A;  2RQ6 A;  4DR2 B;  1WA8 B;  5KG1 A;  2F93 B;  3OD4 A;  4YIP A;  2DYR C;  1WCM A;  2YUA A;  3G6B A;  3OGC C;  1LUW A;  3K06 A;  5HBR B;  2QDO A;  2EJ0 A;  4O4L A;  1T36 A;  3R66 A;  2VUM A;  4UV8 A;  1GAX A;  4K8Z A;  3RIZ A;  4LF5 H;  4DV2 B;  1M90 W;  2MCT A;  2HGS A;  3MWE A;  3BRC A;  5B1A C;  4EKW A;  4U7N A;  4B3S O;  1S72 V;  3LUL A;  3RYF A;  2J9G A;  4X62 B;  2JIZ G;  4K35 A;  5KLV H;  4EQ5 A;  5FD6 A;  5CR5 A;  4A3E G;  3AG3 C;  4GZR B;  2AQ4 A;  2YZG A;  4LNU A;  1BE3 H;  3QNE A;  2LJ2 A;  3K0D A;  2VA2 A;  2ZM6 O;  3N2G B;  3KKY A;  3L73 H;  5KUM A;  1TUB A;  1VQ4 V;  1GO3 E;  1BCC H;  5KFK A;  5DIS C;  1AVM A;  4PDM A;  1BJT A;  3T1Y B;  5LMU B;  4FLT A;  5LOV F;  4YJ2 F;  2YCH A;  3PZP A;  2LP7 A;  4FPP A;  2ASD A;  3ZHV A;  5B1B B;  4JI7 O;  4WF9 V;  4QIW A;  2ZDQ A;  1JJ2 U;  1L2Z A;  4Q8E A;  3E8B A;  4MV1 A;  3K79 A;  1JR9 A;  1R3J C;  1KP3 A;  5KFA A;  1XNQ H;  1M5I A;  1N34 B;  2WSS G;  4UVB A;  5KHK A;  4DV4 B;  4FFL A;  3T1H O;  2UVV A;  1M0W A;  2XAG A;  2IBK A;  4JI6 B;  3RAX A;  1TWG A;  1PNL A;  4MVO A;  2JA8 G;  1R9T A;  2UXC O;  3W7X A;  4X65 H;  2UXB B;  3TIN A;  1M56 B;  3ZCC A;  2XCP A;  3V6J A;  2YIB D;  2NU6 B;  4YY3 H;  4J9Z B;  4AIL C;  4X1Y B;  2UVU A;  4X9Q A;  2R82 A;  1M57 B;  3NUA A;  4R8U A;  4DL4 A;  4MV4 A;  1K7D A;  4GT1 A;  4MVM A;  1Q6I A;  4XX0 B;  3OMI B;  2E2I A;  1P4R A;  4DV7 B;  2JA6 G;  1Q5O A;  2FLP A;  2UUC B;  4IGG A;  1R6N A;  1EN4 A;  3PW2 A;  3GTK A;  5EWG A;  1LNQ A;  4X89 A;  2XOK G;  5LP6 B;  4A3F G;  3JAL A;  2UU9 H;  2DYS C;  3G4S V;  3CCQ V;  1WAZ A;  3N44 B;  1I7N A;  3J80 W;  3GIQ A;  2YS8 A;  1IBK O;  2QKS A;  5KFI A;  5KHI A;  4ECX A;  4OGQ B;  2E76 B;  1BQ0 A;  1BXR A;  3PN1 A;  2DN9 A;  2YU9 A;  1HNX H;  2ZIN A;  2K1E A;  3S3X A;  3W7W A;  2HDK A;  5C4X G;  5T14 A;  5EWE A;  4NXN O;  2O57 A;  2ZR3 A;  4FMT A;  1RK6 A;  1PL4 A;  4GKJ H;  1WN7 A;  2CH7 B;  1KD1 W;  4XZ3 B;  3I55 V;  4NTW A;  3WO1 A;  1NKD A;  1QR9 A;  5JQG B;  4QWB A;  3DTU B;  1Y76 A;  1GGO A;  1XMO B;  4DL7 A;  5KHG A;  4UCR A;  2YEV A;  1R6K A;  3CJH A;  3JAK B;  2EJ7 A;  4JI0 O;  3CCL V;  1WRV A;  4YJ3 B;  3WWH A;  5EZY B;  5J2U F;  2EIK C;  1S0V A;  2R8K A;  1SET A;  3CEI A;  3RV3 A;  5BR8 H;  2GUZ A;  1IZ3 A;  1VIB A;  2R7Z A;  4WFF A;  2Q69 A;  1RFY A;  3JAS A;  3CC7 V;  2WLM A;  3HKZ E;  4L87 A;  2ZXW B;  1A32 A;  3LSQ A;  3CYO A;  1OV9 A;  3SPJ A;  1HP8 A;  2EX3 A;  4JAU A;  1L8D A;  3GJX B;  1FJG B;  3NGD A;  2NVY A;  4QSH A;  3CCM V;  4ED7 A;  2H8P C;  2Y4R A;  4YHH B;  5KFT A;  2WDT A;  4ZOL B;  2HHF A;  5KT6 A;  2JEG A;  4Q4D A;  3VPB A;  3RGB A;  5KFW A;  1PV0 A;  3JD2 A;  1K4D C;  3L4K A;  4O4I B;  4IT5 A;  2UUA O;  4I50 B;  2A1H A;  4A5U B;  1IBM H;  3Q8R B;  2CFM A;  1O75 A;  1XMQ O;  4JXU A;  1PD3 A;  4CKB A;  2AZ0 A;  3VMM A;  3Q4H A;  3O9O A;  3MR3 A;  4GC6 A;  2AGO A;  1H2S B;  3F5W C;  5LYJ B;  1IYE A;  4CE5 A;  2IM9 A;  2JS3 A;  3TEK A;  4UUG A;  5I5S A;  1XRE A;  3SPH A;  1FYJ A;  4F6E A;  3E8F A;  4JTC B;  2GPW A;  5L1K A;  4I55 A;  3MR2 A;  3H40 A;  2DYR B;  3F7V C;  4BWS C;  4EEQ A;  4F4Y A;  2ALZ A;  4FLV A;  1BQZ A;  3NC0 B;  2JJ1 G;  4O4L B;  4BR6 A;  3T9C A;  4JI5 H;  4GKK O;  2FK3 A;  2GPS A;  4Z1V A;  2ZGI A;  3JYC A;  5KG5 A;  4PD4 F;  2W9A A;  4GC7 A;  3J81 W;  3KHH A;  3BY6 A;  2DW4 A;  4UCU A;  5KG3 A;  4F50 A;  3RYF B;  1CS0 A;  1XQ8 A;  1GSA A;  4ED6 A;  3CRM A;  3SPC A;  4LF9 H;  4LNU B;  3AG3 B;  2YWV A;  4RB2 C;  3OE7 G;  1EZJ A;  1TUB B;  4QIW E;  1I1M A;  4O7W A;  3UO2 A;  1RYS A;  1NZ6 A;  4J7Z A;  1YTF B;  4XDL A;  2UU9 B;  5KFX A;  4O7Z A;  1GSH A;  5LMN O;  1BT8 A;  4LFA O;  5CA0 F;  3LML A;  4BIO A;  3ORR A;  5DGI A;  4FIP C;  2UXD O;  4LFC B;  4J9M A;  4B3T B;  1CKN A;  1JX9 A;  4YAJ B;  5DLF A;  3TIG A;  1M1K W;  4Y8V B;  3ZHT A;  3RGZ A;  2R92 A;  4MA5 A;  3ZS8 C;  4EEY A;  1VF7 A;  1VQ7 V;  3JD3 A;  3RR5 A;  2EIJ C;  4TUY A;  5DAA A;  1R6T A;  3PR4 A;  4HYK A;  2W6I G;  2Q0A A;  2WPD G;  1FKA O;  4K0K H;  3RVY A;  4DK0 A;  4JI4 O;  3KAL A;  3GID A;  1KQS U;  4JAA A;  2NNU A;  1KJ9 A;  2SCU B;  1E4F T;  4R8U B;  3BVO A;  5DQI A;  5K2M A;  1SZX A;  2ABJ A;  2CZG A;  3ZHU A;  4KHP B;  4JI2 H;  4IIJ A;  3I56 V;  4PA3 A;  3RF2 A;  2BTQ A;  2HG5 C;  2AW9 A;  3JAL B;  4G2K A;  3AK2 A;  3OHB A;  3VQX A;  3SE7 A;  5C44 G;  3Q8S B;  3OTF A;  3TII A;  2DYS B;  2HP8 A;  2EZO A;  3HOV G;  1I3Q A;  3QZ8 A;  3BJY A;  4DUY O;  2Y0S E;  1UFI A;  1WJZ A;  5CBF A;  1I7L A;  4WFG A;  5L3B A;  3DF7 A;  4PI2 A;  3GTG A;  4P2Z A;  1HR0 H;  4A3M G;  4I9W A;  1NVP D;  3I5D A;  5E25 A;  3VPD A;  1YJ9 V;  2P0A A;  1OHH G;  5DGA A;  3UZO A;  4I7H A;  1GN3 A;  2ZE8 A;  3SYC A;  3ABL B;  2YID A;  5JH7 A;  4IHJ A;  3OTO B;  4J9Y B;  1K1Q A;  3PW5 A;  4J9S A;  3V6H A;  1Y76 B;  4UXN A;  1I94 B;  4DUZ O;  2YEV B;  3CJH B;  1IOW A;  5KX5 F;  2YXL A;  3E89 A;  1G1X B;  1Y1W G;  2KG7 A;  2WA3 A;  5D1P A;  2GSM B;  4OX9 O;  2JEF A;  4A3G G;  2EIK B;  2CKZ B;  3SI8 A;  3A2F A;  2GUZ B;  5KFZ A;  2F4V H;  4ED1 A;  3G6X A;  4X64 O;  4O2A A;  2Y4U A;  3JAS B;  4PA9 A;  4ECU A;  4L8J A;  4MA0 A;  1YI2 V;  3ZMZ A;  4RCN A;  2P4K A;  1I5X A;  2DPI A;  3RN4 A;  2R85 A;  1H8H G;  1W59 A;  2CTQ A;  3JCZ A;  3CCS V;  4TQR A;  2BOB C;  5KFE A;  4RB3 C;  4Q43 A;  3V6K A;  3OFN G;  2WLN A;  4RNO A;  3IFX A;  2BQR A;  1BL8 A;  3M7M X;  1B06 A;  5HFM A;  1XBL A;  2HHF B;  1OWT A;  4LSX A;  3HR0 A;  1S77 D;  1RM1 C;  4LF9 B;  1GMG A;  3M9N B;  3AG2 C;  5DN6 G;  4J9P A;  3GB8 B;  2X5R A;  1N36 H;  4O2B A;  3OUZ A;  2VQE O;  3P3N A;  1SC5 B;  3H1I H;  3L9D A;  3Q4H B;  3LP8 A;  2DAA A;  4FM1 A;  1DF5 A;  2JEI A;  4IWX A;  2JJ2 G;  4CHI A;  1CPY A;  4DRX A;  1DGS A;  1K8A W;  3RT3 C;  1UJW B;  1GSO A;  2UVR A;  4DR7 B;  4I55 B;  3QO8 A;  5LP6 F;  2E5L B;  3L2P A;  4BIU A;  3K5I A;  2WB1 A;  1KU9 A;  1JMK C;  5C1P A;  5KFC A;  4LF7 O;  5K1X A;  1D5N A;  2OIG A;  4RUE A;  5FNV A;  1MZB A;  5GON A;  2ZNI A;  1J5E O;  3CHX A;  3WO0 A;  4U3J A;  5IYC G;  3KHG A;  2QWP B;  4TT3 G;  2FL4 A;  4I4T A;  2R93 G;  2VA3 A;  5L3G A;  3H3V H;  4GX2 A;  2C28 A;  1K97 A;  2X7R B;  2X6C A;  3KCY A;  1KBL A;  1VQ5 V;  1GK9 A;  2HJF C;  1V54 C;  2YS6 A;  3BQ0 A;  4B3R H;  4BBS G;  5JQG F;  3ZMT A;  2XAJ A;  1IVS A;  5IWA H;  1YIJ V;  4B3M O;  2DE0 X;  1E4G T;  4CMD A;  1WH2 A;  1S5H C;  4GYC B;  2ZM6 B;  1N33 O;  1EKV A;  4YJ3 F;  4HNA A;  2YI9 A;  4J11 A;  1KBH A;  5EZY F;  1TWC A;  1JCH A;  4H0L B;  4RUF A;  1CKN B;  3N8D A;  1QR8 A;  4MVZ A;  2GQS A;  4LF5 O;  1URF A; 
#chains in the Genus database with same CATH homology
 4YJ3 A;  5EZY A;  4JI7 B;  5CA0 B;  2ZM6 H;  3N2K B;  4JV5 B;  4TUY B;  5CB4 A;  2R9A A;  4FM9 A;  3RJ0 A;  4IAJ A;  1XDN A;  2Q2T A;  2YIB A;  5IYZ A;  1T5E A;  1XK5 A;  1XHZ A;  1WPB A;  4A2A A;  1IBL H;  3T1H B;  2R70 A;  4AHC A;  5IJ9 A;  3JSL A;  2F95 B;  3JAM W;  1FFX A;  4JI7 H;  1HW7 A;  4RB0 A;  2UXC B;  4JV5 H;  4FLU A;  5LXT A;  5IT9 W;  4X1I B;  1Z2P X;  2Q7E A;  2ZCE A;  5KMG A;  4FM0 A;  1D5A A;  4Q0Y A;  4IIJ B;  1X9N A;  5LA6 A;  4ZOL A;  4JI3 B;  3T1H H;  4PZ8 A;  2BTQ B;  3VQY A;  1XNR H;  2UXC H;  4O4I A;  2Q7H A;  4I50 A;  3FFQ A;  4UCT A;  3E22 B;  3VQW A;  1Z2O X;  3BHP A;  4Q6G A;  1N33 B;  4JI3 H;  3TY5 A;  4DV1 B;  5LYJ A;  4NXM H;  5EYP A;  5D5P A;  4O4H B;  3M4I A;  2RQ6 A;  4DR5 B;  3HKB B;  4DR2 B;  4LF5 B;  2HHH H;  2F93 B;  4FLY A;  1S68 A;  1GYF A;  4PHZ A;  3RYI A;  1BGW A;  4FM2 A;  5JH7 B;  4DV1 H;  4IHJ B;  4O4L A;  4I9Q A;  2WYO A;  5JJJ B;  3K58 A;  1N36 B;  4K8Z A;  3RIZ A;  4DR2 H;  4LF5 H;  1IBK H;  4DV2 B;  3HKD B;  4NXN B;  1QHT A;  2MCT A;  2HGS A;  3BRC A;  1JFF A;  3CB2 A;  2VQF H;  3RYF A;  4ZHQ B;  4X62 B;  4EQ5 A;  5FD6 A;  3QG5 A;  1ZHS A;  3JAT A;  1SA0 B;  3GDE A;  4LNU A;  4DV2 H;  3RYH B;  4PZ6 A;  4NXN H;  4O2A B;  4TQD A;  3N2G B;  3SJC C;  3N40 P;  1Z5V A;  3NBZ B;  3MWM A;  2PTM A;  1TUB A;  3U0Z A;  4HBN A;  4A2B A;  5DIS C;  3C0F B;  1BJT A;  3T1Y B;  5C8Y B;  5LMU B;  1XNQ B;  3CSX A;  4FLT A;  4DR4 H;  2YCH A;  3SGI A;  5D1O B;  1TVK A;  2P5O A;  4JI0 H;  4X65 B;  3RYC A;  2RGR A;  1L2Z A;  5LOV A;  4YY3 B;  4YJ2 A;  3T1Y H;  1XNQ H;  1M5I A;  1N34 B;  3U10 A;  5KHK A;  4DV4 B;  3HXL A;  5CA1 B;  4JYA B;  4RAY A;  4O4J B;  2BTO A;  1M0W A;  4X1K A;  3W5O A;  4B3R B;  4O2B B;  3JAW A;  4JI6 B;  3RGX A;  2CAZ C;  1O9H A;  1M0T A;  4LFB H;  1RSO A;  4X65 H;  2UXB B;  5A2Q W;  1TA8 A;  3SJA C;  4PDB A;  2YIB D;  3RWR D;  4YY3 H;  4LH7 A;  4AIL C;  4CH5 A;  4X1Y B;  4DRX B;  1N34 H;  2UUA B;  1P8L A;  1SKV A;  4JYA H;  4BW9 A;  4JI6 H;  4B3S B;  4DV7 B;  2UXB H;  3WB1 A;  1Q5O A;  4TV9 A;  3BA8 A;  3LNN A;  3HKE A;  2UUC B;  3KAK A;  3IG0 A;  1JJO A;  3UT5 A;  2QM4 A;  3JAR B;  4ZI7 A;  1HNW B;  2YI8 A;  2UUA H;  2CW8 A;  1S5J A;  5LP6 B;  3RFR A;  3JAL A;  3UQ8 A;  5FNV B;  1XMQ H;  3K5L A;  1HNX B;  4LF4 B;  2UU9 H;  1M93 A;  4X20 A;  4U3J B;  5JVD B;  3N2K A;  4I4T B;  2CW7 A;  4DV7 H;  3N44 B;  4F6R A;  3J80 W;  3CVZ A;  2UUC H;  4GKK B;  4E6N A;  5D5Q A;  4EB6 B;  5KHI A;  1AN7 A;  4DV3 H;  4CS2 A;  1HNW H;  4GKJ B;  3PN1 A;  3BAA A;  3N43 B;  4TV8 A;  1HNX H;  4LF4 H;  1G6U A;  2ZIN A;  1P49 A;  2ZIM A;  4GKK H;  1N32 B;  2Q7G A;  4RB1 A;  1KMI Z;  5KHJ A;  4GKJ H;  1WN7 A;  1XNR B;  3HKC B;  5JQG B;  5JCO C;  3SR2 C;  4HNA B;  5BR8 B;  5JCO A;  4CH4 A;  4DV0 B;  1XMO B;  1TGO A;  5KHG A;  4UCR A;  5JJE B;  1I7F A;  3JAK B;  4DR1 H;  1N32 H;  2XHB A;  5FPR A;  2VWJ A;  4NXM B;  5LMN B;  4YJ3 B;  2P22 C;  2RJZ A;  5EZY B;  3N42 B;  4GLX A;  1I6U A;  2ZIO A;  2UUB H;  4LFA B;  2HHH B;  4KL1 A;  5CB4 B;  5BR8 H;  2UXD B;  4DV0 H;  1XMO H;  5IYZ B;  1ZAU A;  3JAS A;  5J2U A;  3S24 A;  5LMN H;  4CH3 A;  4RAZ A;  5IJ9 B;  3TY9 A;  1FFX B;  4LFA H;  1IBK B;  5EOY A;  2EX3 A;  2UXD H;  5LXT B;  1L8D A;  5ITZ A;  3GJX B;  1IBM B;  1FJG B;  2PYJ A;  2YIA A;  4AQY B;  5KMG B;  2Q2U A;  4YHH B;  2FE3 A;  2VQF B;  5LA6 B;  4ZOL B;  2WDT A;  5FLX W;  2W57 A;  3RGB A;  3SJB C;  3L4K A;  4O4I B;  1ZHQ A;  1XHX A;  1Q43 A;  1P16 A;  5EIB C;  1FKA H;  4I50 B;  1HNZ B;  1IBM H;  1FJG H;  4JI4 H;  2CFM A;  4AQY H;  3BA9 A;  1O75 A;  5KX5 A;  4YHH H;  1Q3E A;  4DRF A;  3N2G A;  5J2T A;  1H2S B;  4LR3 A;  5LYJ B;  3BAB A;  4JI5 B;  4DR4 B;  2IM9 A;  5BMV A;  1HNZ H;  4JI0 B;  3ICX A;  4DUY B;  4I55 A;  4APM A;  3RYI B;  3QWU A;  4BWS C;  4JI1 H;  4CC5 A;  4EEQ A;  4EFB A;  4FLV A;  3N6X A;  3NC0 B;  4O4L B;  4JI5 H;  3DSQ A;  4BWA A;  4EFE A;  3WB0 A;  4LFB B;  3J81 W;  4DUY H;  3F8N A;  4UCS A;  4DV6 B;  3W1G A;  1JFF B;  4UCU A;  4ETS A;  3RYF B;  4PZ7 A;  4UCO A;  1TAE A;  1XQ8 A;  2VPS A;  3JAT B;  3MAQ A;  4LF9 H;  4LNU B;  2RGV A;  1X4T A;  4OX9 H;  4RB2 C;  4M7E A;  4DV6 H;  1TUB B;  4D7S A;  2VUG A;  1Q8I A;  3K5M A;  3VQV A;  4FLW A;  4WBN A;  4CC6 A;  1XMQ B;  2UU9 B;  4DK1 A;  4DUZ H;  3H20 A;  2XIG A;  3K3V A;  2HVR A;  3LML A;  4DV3 B;  3RYC B;  4B08 A;  4K8X A;  4LFC B;  3NBY B;  5JVD A;  4B3T B;  4K0K B;  1CKN A;  5IJ0 A;  5LOV B;  2VOB A;  5LL6 b;  4YJ2 B;  3RGZ A;  2QJ1 A;  5GON B;  3ZS8 C;  4X64 H;  5CA0 A;  4X1K B;  1B04 A;  2F66 C;  1VF7 A;  1WNS A;  3JAW B;  3WB2 A;  3RR5 A;  4TUY A;  2V4D A;  4TQF A;  2KKW A;  2Q0A A;  1Z2N X;  4B3T H;  4LFC H;  4K0K H;  4DK0 A;  3KAL A;  4JI2 B;  1A0I A;  1QQC A;  1CKM A;  2VQE B;  1E4F T;  1S03 G;  5JJN B;  2PUS A;  4X1I A;  2F1M A;  1NT2 B;  4CS3 A;  4DR1 B;  4TV9 B;  3HKE B;  2PYL A;  4KHP B;  4JI2 H;  4IIJ A;  3UT5 B;  3RF2 A;  4ZI7 B;  1HR0 B;  2UUB B;  3L4J A;  1M4U A;  2BTQ A;  4FVM A;  3JAL B;  2OWO A;  3FMA A;  2VQE H;  3VQX A;  3OTF A;  4X20 B;  4FFB B;  4LF7 B;  4F6R B;  3E22 A;  5EIB D;  3K57 A;  3TY8 A;  4KHP H;  3DF7 A;  4PI2 A;  1HR0 H;  4UCV A;  2HIV A;  1J5E B;  4O4H A;  4TV8 B;  5KHH A;  4PI0 A;  2WE6 A;  3HKB A;  4LF7 H;  4NVP A;  4I7H A;  4UFZ A;  4MV7 A;  2R72 A;  4J0M A;  4D7T A;  3JSN A;  4IHJ A;  5JH7 A;  4CS4 A;  1J5E H;  4X66 B;  3OTO B;  1SQF A;  4JI4 B;  2HIX A;  3ETQ A;  2F4V B;  3HKD A;  4DR6 B;  3B2E E;  4LH6 A;  1I94 B;  4B3M B;  5K1P A;  2YXL A;  5FD5 A;  5D1P A;  2E3C A;  4ZHQ A;  4X66 H;  4DR3 B;  3OTO H;  2HEP A;  2HVS A;  1XI1 A;  3A2F A;  2GV9 A;  1SA0 A;  2F4V H;  2JS5 A;  5FPO A;  4JI1 B;  3RYH A;  3J7A K;  4DR6 H;  4FLZ A;  2O03 A;  4O2A A;  3JAS B;  2HVQ A;  5J2U B;  1I94 H;  4L8J A;  4DV5 B;  4B3M H;  5EYP B;  1VS0 A;  1N33 H;  4R7R A;  4LF6 B;  1CKO A;  4ZIB A;  5C8Y A;  1SEI A;  4MTE A;  4DR3 H;  4LF8 B;  4RB3 C;  2PY5 A;  5ITZ B;  4CH6 A;  5D1O A;  4DR5 H;  4TOI A;  3M7M X;  4DV5 H;  1O9G A;  2PZS A;  4LSX A;  3THO A;  4JI8 B;  4LF6 H;  3QTC A;  4LF9 B;  4RZQ A;  4LF8 H;  5CA1 A;  4O4J A;  3GB8 B;  4MTD A;  4O2B A;  1N36 H;  1Z5W A;  5KX5 B;  2OYQ A;  4FM1 A;  5J2T B;  3KXY T;  4JI8 H;  2JVD A;  2JGU A;  4DRX A;  4X1Y A;  1DGS A;  1FVI A;  4DUZ B;  4X62 H;  5BMV B;  2ZNJ A;  3KAJ A;  3K59 A;  4DR7 B;  4I55 B;  4OX9 B;  2E5L B;  3L2P A;  3IAY A;  1V9P A;  1KU9 A;  1JMK C;  3K5O A;  3KYH C;  5K1X A;  3JAR A;  4X64 B;  5LP6 C;  5LP6 A;  1TVK B;  5LMU H;  5FNV A;  3VNN A;  1MZB A;  4DR7 H;  5GON A;  2ZNI A;  3CHX A;  2KSW A;  2E5L H;  4U3J A;  2ZJT A;  3N41 B;  4I4T A;  3QF7 A;  4LSA A;  4LMY A;  5IWA B;  4EB6 A;  2PGG A;  3RTX A;  1SQG A;  4DV4 H;  1SYX B;  4B3R H;  2VWK A;  5IWA H;  3K5N A;  3ZED A;  3BPZ A;  3W1B A;  3U11 A;  4WBN B;  1E4G T;  3HKC A;  1WH2 A;  4GYC B;  5JQG A;  2ZM6 B;  4HNA A;  2YI9 A;  4MV9 A;  1YEW A;  4B3S H;  4FFB A;  1CKN B;  4FLX A;  5IJ0 B;  3JAK A;  1IBL B;  3EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...