5FPRA

Structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
b'DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
molecule tags Ligase
source organism Staphylococcus aureus
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
total genus 104
structure length 307
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fprA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fprA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fprA02
4JI5B 5LMUB 4YHHB 4OX9B 2HVQA 4PZ6A 3BAAA 4UCSA 4DV5B 1I94B 3SGIA 4JI4B 4B3RB 2HVRA 5D1PA 4PZ7A 3QWUA 4UCVA 4B3TB 4DRFA 4DR2B 4X64B 4B3MB 3KYHC 4GKKB 4JI2B 4KHPB 1N33B 4DV1B 3UQ8A 4NXMB 4DV2B 2Q2UA 4EQ5A 2VQEB 2F4VB 5D1OA 3VNNA 3NBYB 4GKJB 2HIVA 4LF6B 2UU9B 3TY5A 4DR4B 3S24A 3BA8A 4EFEA 2HIXA 4UCRA 4DUZB 3GJXB 4TOIA 2UUCB 2OWOA 3W1BA 1B04A 1FVIA 1J5EB 1XNQB 4UCTA 1XMOB 5DISC 1CKNA 4JI1B 3TY8A 2UXDB 1XK5A 2E5LB 4LF8B 3BABA 3W1GA 1N36B 4LFCB 3TY9A 5FPOA 4UCOA 1S68A 2VQFB 1IBKB 4GLXA 1CKNB 4JI7B 4DUYB 4DV7B 4JI8B 2HHHB 1VS0A 4LFBB 4YY3B 3W5OA 1CKOA 4CC6A 4JI0B 4X66B 4JI6B 1HNXB 4DR7B 1TA8A 4LF7B 4DR1B 4EEQA 3NC0B 2UXCB 1N34B 1V9PA 1N32B 4UFZA 4B3SB 1P8LA 1XDNA 1HNWB 1XNRB 3L2PA 4JV5B 2HVSA 3GB8B 1CKMA 2Q2TA 3PN1A 4JYAB 1ZAUA 4EFBA 3JSLA 1HNZB 4X62B 4DV0B 4NXNB 5IWAB 4DR3B 4LH7A 3OTOB 4DR6B 4PZ8A 1TAEA 4DV4B 4K0KB 1A0IA 5D1OB 1HR0B 2VUGA 2UXBB 1DGSA 1X9NA 4AQYB 4UCUA 3NBZB 4LH6A 4CC5A 5FPRA 3RTXA 4DR5B 4E6NA 3T1HB 1XMQB 3RR5A 1P16A 3T1YB 4X65B 2ZM6B 4DV6B 4DV3B 4LF5B 4LF9B 4LF4B 3GDEA 4JI3B 1IBLB 2UUBB 3JSNA 1FJGB 5LMNB 4LFAB 2UUAB 2CFMA 1IBMB 5BR8B 3BA9A
chains in the Genus database with same CATH superfamily
2CK3G 4A3BG 1RFYA 1N36H 4DV4H 1JPXA 3SGIA 3ML0A 1SQPH 2ZDHA 1QU7A 2L6LA 1RK5A 1KJJA 4UCVA 1C3OA 2XD4A 1EBOA 1BS3A 1TWAA 4O3NA 4MVUA 4GZRB 4XDKA 4RB3C 3TJTA 1L2ZA 4NXMB 3DTUB 4O84A 5JCOC 5DM6V 2QKSA 3HOZG 2QDOA 1WB7A 1X4TA 3JYCA 2HIVA 3H0GA 3CX5F 4PD4F 2ZD9A 3RYIB 3H4DA 2NNUA 1YSCA 2D3OW 2WTFA 4U3FH 4ZOLF 1M5IA 3LDDA 4LF4H 4JI0O 4JV5O 1BE3H 3CXHF 4P9OA 2JJ1G 3E22B 2COGA 2HKOA 2PTMA 4A3EG 2N04A 2ILMA 3LP8A 3HB3B 5BR8O 4DV0H 4I4TB 1V4YA 1W93A 2ZINA 1F51A 3JARB 4B3SO 2X6CA 3KALA 4R7CA 3J80W 1HNZH 1Y76B 4YY3B 1XMOO 4C2MA 3SR2C 5L3BA 2JA7A 1T36A 2LGWA 4LWSA 4CH5A 4DR7B 1VEWA 3QVNA 1VQKV 5FL7G 4O86A 5LMUO 3T5LA 5KG0A 4PA7A 2R82A 4JPRA 3RWRD 4BIUA 3TXSA 4B3SB 4LFAO 1M4UA 2WLIB 3CCEV 2W8LA 3L9DA 4JASA 5EBWC 2YDEA 3M9OB 3QTCA 5HFMA 4R7RA 1FKAH 3AG2C 4MV3A 3E89A 4LFAH 3JAMW 4PA9A 3QZ7A 1D5AA 1H2LA 4DR2H 1N48A 2AU0A 2RN9A 1SA0B 1GM9A 3OTOB 2XIGA 4DV1O 2GQRA 4O3OA 3ZN0A 1EZJA 3GIJA 4CBCA 1IOVA 5LMNO 1XMQB 5I5YA 1GSOA 2YI8A 5L1KA 1AI4A 3KXYT 3AG4B 4K6NA 4O2AA 4NLGA 1IURA 1I94O 4C5CA 1F4MA 1Y1WA 3KCYA 2W9AA 3L74H 4G27B 2JEIA 4QWEA 4O7ZA 5LGUA 1A9XA 2NU7B 3CCUV 1ZSPA 1Z5VA 4RQFA 3T2MA 1IBLO 3OTOH 3JAWB 2CNQA 2YXLA 3DXRA 5D1PA 1AB3A 4EGQA 4IWYA 2P90A 4MTGA 5ITZA 1GMGA 3N2GB 2ALZA 2BQ3A 1AR1B 5L9XA 1NTZH 3AW8A 4DLKA 4P30A 4A3GG 2MW2B 1BJTA 1TVKA 3MAQA 3B4SA 2FLLA 1XUQA 3ZHUA 2G38A 2JEXA 1KT8A 3J7AK 2F4VB 5D1OA 3AK3A 2E2HA 5FNVA 1EZVH 1G2WA 4B3MO 2UXBO 2WE6A 4LF9H 3P3PA 1HNXH 2PMZE 2ITCC 4LF7H 4DO2A 3WWHA 3CC4V 1QR9A 2AZ0A 2X0SA 4BIOA 2PBZA 3RYFB 4DRXA 2LO1A 3H3VH 2ODMA 5CA1F 3ZRXA 3K5OA 4MTXA 2CW8A 4QWBA 1XNRH 3SPCA 1NT2B 2ODTX 1Y14B 5C5JA 4WFFA 3TY9A 1EN4A 2RCVA 2C2RA 2JA8G 4X1IB 1K4CC 4NXMH 5KFZA 2UXCO 4MVRA 4J9YB 1FXKC 5FD6A 2EIYA 5LYJB 4OPHA 1TA8A 3M7MX 1SC5B 3LSSA 3NC0B 1MA1A 5KHKA 4LCUC 1N34B 4LNUB 2Q6AA 4RUCA 1V9PA 1N32B 4TV9F 4IR9A 1V55B 3Q4HB 3GTGA 4FFNA 2QF7A 4J9RA 3WNZA 3L2PA 3E22A 4O4IB 2EZOA 2OT5A 3LWBA 4FFRA 1NH2D 1IBKH 3OEEG 1KBHA 1ZAUA 2W71A 1FXKB 3K3PA 2A7WA 2RQ6A 2DPIA 2Y4RA 2ZXWB 1XMQO 3DSQA 1DF5A 2W6MA 3MWDA 4PV1B 4YJ2B 3H1KH 2R7ZA 4YJ3A 4HNAB 4ABMA 1WP8A 4Q4DA 2R72A 3TGUH 1VF5B 5FPRA 5K1XA 1BXRA 4MVMA 3FD9A 3UZBA 5BZBA 2IBKA 5I5WA 3G67A 4NZNA 5J2UB 3GDEA 2E76B 5DMXA 4BY7G 1XL4A 2FLPA 2BE3A 3BCCH 1JDEA 1BGWA 3C3TA 4LFAB 1TWHA 1I0HA 3VQYA 4MT8A 3NR7A 4WD3A 1RPOA 1M57B 4AQYO 3JARA 3ZHTA 2CH7A 1RSOA 2E5LH 4FPPA 2UUCH 2FKXA 1Q6HA 5KFHA 4JAAA 1R6NA 2YCHA 5B5EZ 1QLEB 4B3RB 2HVRA 1HW7A 5H9CA 2EINB 3W7SA 3U9SA 1V54C 2YSUB 5EK0A 5IY5B 3SPGA 3GLKA 4LF8H 5F2VO 4ECYA 3TETA 1K1SA 3CWBH 3HKEB 3MHHC 1Q8IA 2SCUB 3RYCA 2DQ3A 2A0LA 4DV2B 1BHBA 4R8CA 2NLJC 1S0OA 3WWIA 3OMNB 5KT7A 2A06H 3GIPA 1Y6XA 1B6SA 4X1YB 5LL6b 3UYYA 1TVKB 5KFPA 3HKCB 3G8DA 3PZPA 3CJHA 1NS1A 1TWCA 3SYAA 3W1BA 1YJNV 4I55B 3PO2G 4TWKA 1AILA 3T5KA 2JIZG 3IC9A 2JA5G 3N43B 2AGAA 2OIEA 4YP3A 5BWUA 1SQXH 2FPGB 3F5TA 2BSKB 2CTRA 5IJ0B 3SJQC 4DAAA 1S0NA 2UVVA 2RNBA 2ASLA 3KAJA 2O03A 2PN1A 4DL6A 2CQYA 2YIDA 1VS0A 4PWQA 2AXTZ 2GDSA 1H2KA 4DW1A 3G71V 4I7ZB 2NU6B 4O2AB 5CMUA 3ORRA 3K3WA 4CS4A 1E4GT 4EG0A 4JI6B 2JDIG 1I7LA 5KG1A 1I2KA 3JRWA 2QTSA 2VRZA 3E86A 3HXLA 4F6RB 3AK2A 3LSUA 3ASOB 3T99A 3LUTB 1XDNA 4GT1A 3A0HZ 4JGSA 4XYMB 5DQHA 4I55A 5FLXN 3U10A 1SFOA 1RPRA 2MCTA 4EFBA 4FLXA 4RUAA 5KFNA 1JVMA 4RB0A 3G6XA 1GH6A 2PI4A 1GN6A 2PUSA 1RJPA 3ZMZA 4GKJO 4DR6B 2ZXWC 3G4SV 5C93A 3M99B 4CH6A 2P6JA 5EIBC 1S76D 2ZDGA 2W9BB 3L75H 3ABUA 4FVMA 4PI0A 2V9WA 1PM9A 4F50A 3CYOA 1GLVA 2RF4A 4HNVA 1KP3A 3RAXA 4DV6B 4DV3B 4PA4A 5CB4F 4ZKIA 5TISZ 1SQQH 1PNMA 4GX1A 2Y0PA 2QJ1A 2YZGA 2CFMA 4NYKA 2X6BA 3JAWA 4M7EA 4JYBA 3ZS8C 2HVQA 3HPLC 3QO7A 1JJOA 3NXSA 4UCSA 4RB1A 2CDYA 3BY6A 4J10A 2Q7DA 4W4KA 4CZZA 1KKCA 3ZMVA 1FJGO 3ZX6A 3T9CA 4EYHB 4UUJC 4FJCC 3U55A 2Y0SA 1R3KC 3Q2OA 4ZHQB 2HVJC 1N36O 3GIMA 5C3EG 4I50B 2BSKA 5IJ0A 3T9BA 1JJ2U 2XTAA 1AP5A 4O4IF 4YIPA 4DV6H 3KHHA 1QBZA 1S97A 1R3IC 3RVZA 4DUZB 1TWGA 4H13B 4YIOA 4FK5C 5A9GA 2UUCB 4RNNA 4O7SA 3ZHVA 5EWGA 3K9AA 5JQWA 4YJ2F 3GV7B 5BY1A 3RGZA 4B3TH 2UXDB 3THOA 1N34O 1PX2A 1OBDA 4JF3A 4R6ZA 2NN4A 1NU1H 5HV6A 2XAJA 1FAFA 5IT9W 1FFTB 2VPSA 4NVPA 2XAGA 2WA4A 3ZHSA 2W8KA 2R8IA 3TQ1A 3RB4A 3J80N 1NBMG 4X20A 3JZFA 2WDTA 4ZI7A 3LDEA 3J81W 1L1FA 2QGNA 3EYYA 2WLKA 1MMMA 2JEFA 5DG8A 4O4HA 5KX5A 2F93B 2M05A 2ZE6A 3ABLB 4MA0A 5I5TA 3NGDA 2GSMB 3S3XA 4X20B 3FAVA 2V4QA 3OTOO 1IBLH 5BWVA 4J9MA 1F23A 1BNCA 2CH7B 4KXRA 4FS2A 1YHQV 4WBNF 4D7TA 1WJZA 2R8GA 5C1OA 3T5JA 1XNQO 5JQGB 4GCZA 4HNUA 3JD4A 1P4RA 4FFLA 2R92G 1PD3A 3JD2A 5KFEA 4X62B 4J41A 1K9MW 2AGOA 1XI1A 1PL0A 5B3SC 5FNVB 4N21A 1OHHG 3DC5A 4PZ8A 2X7RB 4K0KB 3GV5B 1BSMA 1WB8A 1XEQA 4UCUA 4DV1H 2LQTA 1Q82W 2RDJA 3L4JA 3ASNC 4KUMA 2YL2A 3Q1KA 4G3IA 4JI2H 4NTYA 5KHHA 5JVDF 2Y0IA 1IBLB 2PY5A 1W59A 4ED8A 1WH2A 4JAVA 5D5QA 3N41B 2E74B 3QO5A 4TQDA 2R87A 3OSPA 3BHPA 5C8YA 4EKWA 5L1JA 3U54A 2P5OA 2EZPA 1RJRA 2UUAO 3JD0A 4J7KA 4DRFA 1Y76A 3RBEA 4DR2B 2QA4V 2GV9A 2FMLA 3WWJA 2DN9A 2YIBA 4L87A 5GONF 2ARHA 5B1OA 1H38A 2Q9LA 3RIZA 2OTLV 3H1JH 4IRCA 2ZM6H 5DG7A 3WO0A 3OSNA 4DV1B 4LF5H 1OCCB 2Q8VA 3F5WC 5DGAA 4FIPC 1OBGA 1RYRA 2Z3YA 4AHCA 1GN4A 3CEBA 5D8DA 5BYBA 3S24A 3CXCU 2Z04A 4UCRA 2B63A 3JASB 1RYSA 3GJXB 1HNWH 2UVUA 3VA7A 1Y1WG 5IY5C 1PKXA 5KG3A 3N44B 3HKCA 2R84A 1G4YB 4YR0A 1K1QA 3AG3B 4J42A 4X64H 3BABA 4C7UA 2J6UA 2WLLB 2ZDQA 4JV5H 1I5YA 2FB5A 3K5MA 4R8UA 2FTKA 1HNXO 1CKNB 4QWDA 4JI8B 3WU2Z 4X65O 3M9MB 2D2CB 4YAKB 2XGPA 4GKKH 2IM9A 2GPWA 4A3KG 5FNVF 3PW5A 1IYDA 2NU8B 1K97A 4CE5A 2NVXA 1P7GA 3AK1A 2FPPB 2QM4A 4DUYO 2Q68A 3PW7A 2FK1A 4MW3A 2N74A 4XDLA 3KAKA 4O2BA 4RQEA 3QQMA 1XHZA 4JV5B 2IJHA 1JMKC 1FD9A 3B8MA 1OCRC 3T5HA 5IYZA 4DV5H 4I5SA 2QSAA 4DL2A 4JV2A 2E3CA 3GWKC 2HG5C 2YUAA 2Q4PA 3HKBB 4LF6O 5KFVA 5KFTA 5D1OB 1EFRG 3HBLA 1I6UA 2VUGA 2W7PA 4DQNA 4AQYB 5LHHA 2EIKC 2ADQB 3RTXA 4O7LA 1EUDB 2YI9A 5LYJF 2E2IA 2OIGA 1N8RW 1SQBH 4PHZA 3PR4A 3P32A 5GTIZ 2A79B 2Q69A 3RVYA 4CKCA 4ECRA 5LOVA 2Q67A 1H2MA 3JASA 3O65A 4YJ3F 5DLFA 4QE9A 1ORQC 3N27A 3V4SA 1D5NA 3BA9A 2EIKB 1VMGA 5IYBO 3IG0A 5CN0A 3IC7A 2R70A 2AZ2A 5CBGA 5IYZF 2HHFA 4IIJF 1YCIA 3GIDA 2XCAA 3BRCA 4MVQA 1KD1W 4JI7H 1ZL8A 4IHJA 2WAMA 4TUYF 1COWG 1QR8A 4EBDA 4LSAA 3RF2A 2W0XA 1HWYA 2OLSA 2HHFB 4AQYH 5JH7B 5FJ8G 5KT6A 3X2QB 1BQZA 1ENVA 2Z02A 4MV8A 5KHGA 4LF6B 4QIWE 1AI6A 4YBZB 4H37A 4QIWA 1EHIA 5DLGA 5I47A 1G8MA 1N33O 4TQFA 1RM1B 1T94A 1Q43A 1OCOB 5I60A 1S0MA 5DGIA 3QF7A 1GO3E 2DWDC 3KZIZ 2J9GA 2A3QA 3RYIA 1XREA 2EIJB 3HB9A 3H01A 4QIWF 2ZR3A 1UJWB 4FFOA 1VQ7V 1K33A 1IXBA 2JEUA 3WB2A 5KFGA 2XT9A 4J9LA 3J81N 3DTFA 3FYEB 5LYJA 2XOKG 3JD1A 5ITZB 2YRXA 3GIIA 1JCHA 1ZLZA 3OTFA 2DYSC 2UXNA 4FLVA 2CAZC 1SCUB 4LFBO 4J7JA 2XAQA 3LNNA 3E8HA 5KG5A 4NKGB 4FM1A 2IJKA 3V4ZA 1SERA 4FM2A 3KTMA 5LP6A 5LL6Y 5LMUH 3ASNB 3PVXA 1LUVA 5KLVH 1FYJA 2ZDIA 4O7RA 1HNZB 1JIHA 1PP9H 3L73H 4NXNB 3MFHA 1S5JA 1ZQ7A 1QLNA 5KT2A 1B6QA 4LH7A 3D8CA 1YF2A 4FFBA 5L3DA 3L4KA 4UB8Z 3GTQA 3UZOA 2A9HA 2IH3C 3JATA 4ED7A 4U7OA 2P4VA 4PA3A 5B1AB 4O2AF 4IIJB 3PW2A 1QLEC 3CRAA 3HKDB 1OCZC 5GTHZ 2R7KA 2HFEC 4DK1A 1Z5WA 4U6PA 1MABG 5LMNB 4LNUA 2WLIA 3T1CA 3RB6A 1E4EB 5KFFA 5BR8B 2QM8A 1WLEA 4A3JG 3G8CA 1KP2A 3HT5A 1GYFA 2W70A 1SF9A 5BWRA 1ET0A 3SJCC 5LOVF 5LGTA 1H2GA 5KFMA 4MVSA 4JI1H 3HR0A 2AGQA 1I1MA 2PVPA 1MSDA 1UFIA 4XX0B 1VQ9V 3VQWA 5J2TB 5EBLC 3CHXA 2H3OA 2EJ0A 3CSXA 3UQ8A 2Q2UA 4JTCB 1A32A 3C3SA 3CS5A 3FMAA 4DUYH 3RB3A 3RYFA 4DRXB 2YC0A 5EYPA 1KTAA 3QNEA 3ZN1A 4BW5A 1VQLV 3NUAA 2YICA 1YTFB 1M90W 2FKLA 3ZJZA 5IJ9A 4O7WA 5BMVB 2JK5C 3SPIA 4JI4H 1SQGA 4BW9A 3HOUG 3CJHB 1XMOB 3FDSA 2FYUH 4B3RH 4X8AA 4NXNH 2E5LB 4B3MH 2EULA 5H2FZ 1GKFA 5CBHA 3GTKA 1Q6UA 3A2FA 1S9FA 1VQ6V 3T9DA 4DR6H 1GM8A 1EM1A 2VQFB 3KHLA 2R6FA 4HZ3A 2HHHB 2JVDA 2Q7EA 5KFKA 4UVBA 4MW8A 1CS0A 3RFRA 4JI0B 4JI8O 4DR4H 4Z1VA 1HNXB 3LQSA 1JOYA 2B9ZA 5GONB 5I5SA 3CRRA 4DV3H 3ETEA 1E1RG 2R9IA 1M57C 1YEWA 4Q4CA 2WA3A 3TEKA 2ZJTA 2UUAH 4DUZH 3R5FA 3N6RA 4DK0A 4APMA 1GAXA 1XMOH 1Y67A 1W0JG 3KKYA 4HBNA 3ETQA 1RP3B 4BXXG 5DQGA 3AG4C 4FZ0A 2FK2A 4WBNA 2R8HA 2JA5A 4A2AA 4R8UB 5L3FA 4DV4B 2R93A 4JZ2A 3SPJA 3ASOC 4DL7A 2QE7G 3JD3A 1B6RA 1B3QA 5KFQA 2R85A 2VPQA 4RAYA 4ECUA 1PV0A 1N0JA 2ADPA 4QGPA 3EVKA 3T1YB 1FXKA 2VOBA 4JI3B 2JEJA 5IYCO 1IOWA 4DR2O 1MNGA 4UXNA 2UUAB 4JV0A 1FKAO 3QG5A 3OUZA 2CKZB 4IR1A 2UXDH 2DLNA 1A3GA 3HKEA 2PI5A 5KAFZ 5DGHA 2YZLA 2ASJA 3ICXA 2JGDB 3JZ6A 2NU9B 4DL5A 1HR0H 5KFWA 4ECVA 5CBFA 4JI1O 4LF9O 2R7MA 2VQFH 3T1YO 4O83A 5KFYA 4B3TB 1QHTA 4GYCB 4YR3A 4WBNB 1IZ3A 5JVDA 3OGIB 5L1IA 2ZIMA 4KHPB 4O7NA 5AG2A 4UVAA 1TWFA 4ECSA 4XBFA 4GX0A 4ZI7F 1GN2A 4TQSA 4NTWA 3A0BZ 2ZIOA 3APOA 4GKJB 3RT3C 3H9VA 2UU9B 3CD6V 2X5RA 1M9NA 3TY5A 4DR7H 4P9PA 3FX7A 1ROPA 1FVIA 1XNQB 3TIGA 3CRQA 2QK4A 3LULA 1KYOF 3K58A 2R86A 5DISC 1MG1A 4UV9A 3VOTA 2CNUA 4MTEA 4LF8B 2GQSA 2CW7A 1TUBA 3K3VA 5H6QA 4YJ2A 3JATB 2R7LA 4FU0A 2K9PA 2IW5A 5IYBG 4HNAA 3BEHA 3VPDA 4ECXA 4WHXA 4DV7B 1WAZA 3SNOA 2PZSA 1JFFA 3B09A 2P67A 4LF7O 4LP8A 2LW1A 2QTOA 4AILC 5CE8A 2W6JG 1PNLA 3FFQA 2VWKA 1O75A 4AYBE 2W6OA 1FPOA 3CCVV 2JA6A 2DYRC 1US6A 3UT5A 2L35A 5B1AC 3OFNG 5KAIZ 4I9QA 3I55V 3T9EA 1L0NH 3RYHA 3K06A 2BTOA 5LBQA 4A3IG 1EKVA 4RUFA 5A2QW 2HJDA 1XILA 1GN3A 4TV8F 3A0RA 2FMAA 1XOUA 1SQFA 4K8ZA 2VQEO 2PYLA 1V55C 2KG7A 3J7AU 1N33H 3ZMUA 4RNOA 1Z2PX 2F43G 1AR4A 3CE2A 5F9NA 3W7WA 1GO3F 2WLHA 2YXHA 5IYDO 4O3SA 1KMIZ 1CP9A 2BOBC 4B3RO 4TV8A 3TINA 3HOYG 5CM0A 1M56B 2EILC 3E83A 1J5EH 4U7CA 2HG8A 3MR6A 1SS3A 1KJQA 4Q6GA 3JALB 1NVPB 5T14A 2W6NA 1SKVA 1WA8B 5JCOA 2VWJA 3HOVG 2Z5UA 4PZ6A 2B63G 2N05A 1I94B 2O57A 4LF4O 5KFOA 2V7QG 2WWWA 4PA6A 2GPSA 3GILA 4D7SA 2LJ2A 3CRMA 3VQVA 1YI2V 1VQ4V 2XNDG 4NYEA 4RB2C 5DQIA 1Y74A 2RJZA 4LFBH 4XDJA 1ZETA 2GUZB 3ORQA 1XL6A 2F23A 5JJEB 1N33B 5EDWA 1SYXB 2ZCEA 4ASUG 5LXTA 2OYQA 3MFIA 2YXYA 3RAQA 4WFEA 2B1IA 3S3WA 2OWOA 4U7NA 2DOSA 1B04A 5H5NA 3H1LH 1UC8A 3MJFA 1RK6A 5KG6A 3N8DA 4CH4A 1I7NA 4NZOA 1KBLA 3V6JA 2C28A 1CKNA 4YAJB 3ETGA 5H6RA 2Q73A 1I08A 2QWRB 1H2SB 2W7OA 4EBEA 2C00A 2CTWA 2Q5ZA 2C35B 1HDJA 4IGGA 1SA0A 4ED3A 1W0KG 4RWUA 1M6VA 1QVGU 5BYAA 4UCOA 4DXWA 4QPJA 2WAQE 4F6EA 2W6ZA 3MR3A 4O4JA 4EB6A 1SESA 4MV9A 1ZX3A 3W5OA 4EEYA 2DYSB 1FXVA 1S10A 1VAJA 4QJFA 4WCEV 1PNKA 2VQFO 1YXBA 4DR1B 1HP8A 2IJJA 3CVZA 4TQRA 5KS8A 5B1NA 2JA7G 4HYKA 2KG7B 4UFZA 4BWSC 2Y4UA 1P8LA 4ZHQA 5LXTB 5IYDG 1HR0O 1HNWB 2AHZA 1VIBA 4GX5A 1FFXA 3U11A 2KKWA 2IA6A 3ZRSA 3IJ4A 1FJGH 3AG1B 1I94H 4PDMA 1FFXB 4DV7H 3JSLA 2DABA 5CB4A 1K73W 4E4TA 3SJAC 4LBEC 4DR3B 1KJIA 1I50A 2DE0X 4H0LB 1NJIW 3R9RA 2RDIA 4YHHH 1CXZB 1A0IA 4I4TA 1M7JA 2ZQMA 4YY3H 4F4XA 2XHBA 3KHRA 3ABTA 1OV9A 4J9NA 1T3NA 1BL8A 4X62O 2WYOA 1U96A 4F4WA 5KG7A 5KG2A 3B8NA 3CP1A 2P0AA 2YS7A 4H33A 3WG7C 2XASA 3OUFA 2Y4TA 4K8XA 1DV2A 3HOXG 1Y66A 1IBKO 4CMFA 4Q0YA 1VF6C 5LP6F 1QNMA 1TUBB 3I4MG 3RV3A 4LC1A 4YHHB 2UUBO 4R50A 4K0KH 5KHJA 1YIJV 4E4EA 5L3EA 4X1KB 2YEVA 1SRYA 1YTFD 2CGNA 4J9KA 2HLDG 3JAKB 4B3MB 3E5NA 1Z2GA 4ZQIA 5I5XA 4FM0A 3SDLA 4JI2B 2B5UA 1S3JA 1RSOB 5KFAA 3LSQA 2EIMB 4Q20A 4FS1A 4AYBA 5L1LA 5C8YB 3FAVB 4JUZA 4HNTA 3JCUZ 1CEZA 1YJWV 4LR3A 4DV2O 1Y74B 5BXZA 4TUYA 3GTMA 3K5HA 5KT5A 1KUQA 2ABJA 4IHJF 1AI7A 3UFXB 3VPCA 5CA1A 2JEGA 3HKZA 1Q3EA 4A3CG 4UVCA 2BTQA 1JX9A 1KU9A 4BIZA 2QWNB 4FBTA 4NXNO 1WA8A 1N32H 4O7TA 4RZRA 3SYCA 3VPBA 5C1PA 3AG3C 1S77D 4JI5O 4BAYA 1W2BU 5B1BC 4GLXA 1E4EA 1L0LH 4Q45A 4J9SA 3I5DA 4Z1MG 5K1PA 4O7VA 4DR5H 4ZHQF 4LMYA 4GX2A 1GSAA 1XMQH 2ETNA 3OW2U 3MHSC 4LF7B 2WB1E 5K2MA 4I50A 2EIJC 2JRIA 2UXCB 1I5XA 1VF6A 1N0NA 5DG9A 2EJ7A 2HJWA 4ECZA 4A3FG 3CMEV 1WN7A 2VA3A 4IRDA 1XNRB 3SPHA 2V59A 2WB1A 3AG2B 2BTQB 2CTPA 3GB8B 1DF4A 3G6VA 5CA3A 3G6BA 3EXAA 4I50F 5KA6A 5EC2C 2QM7A 2YRWA 3UT5B 1WPXA 1IBMH 4L8JA 1VARA 3Q8PB 3ZRVA 2EIMC 4HAMA 4MSWC 1M56C 2EILB 4O7YA 2Y69B 3CC7V 1SZTA 4NXMO 2Q7GA 2UXBB 2CNVA 3BACA 4L1KA 4LH6A 1Q6IA 1P84F 2IMWP 3DTGA 4YY3O 4MVZA 3GTOA 4HQ6A 5LGNA 3R66A 2ZDIC 4PELA 3T9AA 4JI4O 2YYAA 1YZBA 3KG2A 3CCLV 4RU9A 4JTAB 3D3IA 3T1HO 3FB6C 2DW4A 1HNWO 4P2ZA 1EKFA 4WF9V 1Q5OA 2LFRA 2W9BA 5L3GA 3WG7B 1GRJA 3KCXA 1SQVH 2KSDA 3Q8SB 5LA6F 4WFGA 4B7EA 2YS8A 4JI6O 1WR2A 2NR5A 3RYCB 1NR1A 1KUTA 3ETHA 1OCZB 4BBSG 1WP7A 3KYHC 4RCNA 2F1MA 3DF7A 2HVKC 1AVMA 3E8GA 1AN7A 4KFMA 4N23A 3BVOA 3UCSC 4MV6A 5KFXA 2AGPA 2I8CA 3MD0A 4WFAV 2QWPB 3OT7A 2ZE7A 5JVDB 4DR1O 2ZE8A 3T1YH 2VUMA 4X66H 4EFEA 1DIKA 3CSWA 3JAKA 2X0LA 1AI5A 5J2UA 5HNEA 2GTSA 5EOYA 4O4HB 5KX5B 4RNMA 1M1KW 1J95A 4JI1B 3WB0A 4QSHA 3W7XA 2WLJA 4DIMA 2R9RB 1IX9A 3CQZA 3PW0A 1S68A 2P4KA 3DGEA 4IYHA 4DUYB 1XQ8A 4FLYA 2Q7HA 4X62H 4QJFB 4IL6Z 3K0GA 4J0MA 4JI3O 1MZFA 1KC7A 1YDXA 4CC6A 1NI8A 4LSXA 3RV4A 3BJYA 4UV8A 2P22C 3QZ8A 3TW6A 3F7VC 2Q0AA 3AG7A 5KMGB 2QWOB 4JI3H 3H1HH 3GB7C 5KUKA 3TK1A 5JH7A 4O3PA 2DJVA 3OUUA 3TIIA 3EHBB 2RGVA 4MTDA 2J6SA 5C4XG 1H2NA 2LGQA 5CA0B 4MV1A 2GHYA 3FKIG 3H4BA 3HKBA 2R7NA 5CB4B 4IHJB 1ZL8B 4CKEA 3AYHB 3DC6A 4JYAB 4RZQA 2VUMG 4DUZO 3JAMN 3UO2A 3PFFA 3HO8A 5IYZB 2DMXA 2XUMA 1EUCB 1URFA 1W96A 4O82A 3Q8QB 1KEEA 2FP4B 4F4ZA 1ZHQA 1K5QA 1X59A 3ZHQA 2I80A 4NB5A 1DGSA 1UPGA 3FB7C 4X88A 5EC1C 1IVSA 5I5UA 2QKCA 4O4JF 1WSCA 4K35A 2FK3A 4DV2H 2X6AA 1YJ9V 4FLUA 2Y69C 2W57A 3OD4A 4O4HF 5KX5F 5FR9A 3ZRWB 1XHXA 2UU9H 3DAAA 4F4LA 5GW7A 2HDKA 2ZM6B 5E25A 3T4ZA 4RO2A 5IDJA 3OR7C 3BQ0A 4LFCO 3OMAB 2ZGIA 2XAFA 3WB1A 5B66Z 4UUGA 5IWAH 3QO8A 4IRKA 2COJA 5IYCG 2OCHA 1Y4MA 4JYCA 1H8HG 1S72V 3FB5C 2Y0SE 3PO3G 5LXTF 1SETA 4TV8B 4JYAH 1R3LC 1E1QG 4J7ZA 5KA5A 5E1AC 2PF4E 1CQIB 4ECQA 4E2LA 4I9WA 4X64B 3ABMB 4O4IA 3T7AA 3C0FB 4O3RA 4UB6Z 2NUAB 4A3LG 2GBOA 2YZMA 4JI6H 2XCPA 3I4NG 4JAUA 1A48A 1VQ8V 2EX3A 3CCMV 5EWFA 2QYZA 2OTJV 1YITV 4X64O 1R73A 4RAIA 3GV8B 3W7UA 1OCRB 4F6RA 1K92A 3AG1C 4G28B 2GUZA 1I2LA 3MWEA 2QB5A 2UXXA 3ABMC 1KJ9A 3GIQA 4KP4A 4D6TH 1KJ8A 3EPIA 4O4LF 1PPJH 4JZGA 4A2BA 3BPZA 4PDBA 5KFRA 1MSWD 1HNZO 1O9GA 1OZ0A 2KB1A 3O9OA 3V6KA 1VQ5V 1PK8A 3G6YA 1N36B 3T4DA 5HFLA 2IP4A 4FM9A 5J2UF 2W9CA 1AR5A 3M9NB 3D3QA 2ZM6O 2JGUA 1KKDA 4GKJH 4LFBB 1OCOC 5KUMA 5EZYB 2IBZH 1EZ1A 2W6QA 2H8PC 2DPJA 2ZR2A 1DAAA 5DN6G 2UUBH 4X1YA 3OMIB 4O4JB 2W0FC 1AUVA 2DWEC 3N40P 2FJZA 5K3WA 1NH2B 4QWCA 2Q0OC 5C8YF 1GGOA 1EN6A 4YXWG 3BQ2A 2H94A 4W4LA 5FLMG 4IAJA 1Z2NX 2Q2TA 3PN1A 5CA1B 3ZBHA 4J9PA 4LWSB 2P06A 4B3TO 3SE7A 4ETSA 4DV0B 3RYHB 2UVRA 4EYIB 3PJSK 2UUCO 4JI0H 1M0WA 4OX9H 3BG5A 3OM3B 4X1IA 1X9NA 5KFLA 4OGQB 3NBZB 3ETDA 3B77A 3CCRV 1ULZA 1A0GA 4MV7A 3OUSA 4X65B 1CE8A 4X1KA 5EIBD 4LF5B 4Z2WA 3E2EA 4LF4B 1NVPD 4IT5A 4YHHO 2UUBB 3RGBA 3JSNA 4FLZA 1GTOA 4WFHA 1WCMG 1H8EG 4I55F 4WFBV 4DW0A 3L71H 2R93G 5E79Z 4GC7A 3B2EE 5KMGA 4OX9B 2GLTA 3MR5A 3JZIA 3BAAA 1Z2OX 4DV5B 4J9OA 2EJRA 3M8AA 2DIKA 3N6XA 4A93G 1SEIA 3CCJV 4EB6B 4QW8A 4DR4O 4JI8H 4JYAO 2W9CB 2CZGA 3M4IA 4ED1A 2ZE5A 1NTKH 5LHIA 2HGSA 2VR1A 1WNSA 2QWQB 3P3NA 3ZRWA 3R65A 4XYLB 2VQEB 2EJ3A 4DL3A 3H40A 2PGGA 2E5LO 2R7ZG 5KFBA 1D2DA 4CS3A 3E35A 4RUEA 2HGXA 2HIXA 1K8AW 1NKDA 2R8KA 3CMAV 3CCQV 1R9TA 4DR3O 4BWAA 1J5EB 4FE2A 4UCTA 2E75B 2UXCH 2XC9A 1PL4A 2HR3A 4AI8A 5LP6B 5DGBA 1TUEB 3BQ1A 1N56A 5BWXA 2JGDA 4JI5H 4KL1A 3TXQA 3KREA 4DR3H 2UVWA 5LOVB 4JV1A 2FE3A 1F7YA 3TQTA 5DEDA 2WSSG 1XDCA 5JWPA 1I3QA 2KQXA 1MZEA 1IYEA 5FD5A 1GSHA 2BCCH 5LA6B 4BR6A 5BPHA 5LP6C 4CH3A 1GM7A 3A8TA 5KKNB 3JALA 1ZHSA 5LHGA 4RAZA 2UXBH 4O81A 3GTJA 4FFKA 1AP6A 1KQSU 3RJ0A 1K83A 1BGYH 3OR6C 5BMVF 5KG4A 3GTPA 1R3JC 5IP7G 2QKAA 4FFBB 2EINC 3JCZA 3RW0A 4K0KO 1EYZA 5FLXW 3K57A 3B40A 1B33N 5EZYA 4QW9A 4BBRG 1CKMA 3FKSG 1Y1VA 2XGQA 1IDSA 4O2BB 1AJPA 4O4LB 2GTAA 2B1GA 3CPWU 4CMDA 2DAAA 3T9FA 2AQ4A 3U0ZA 3WFVA 2F4VO 1E79G 1MOFA 3OHBA 5IE9A 2LP7A 1OJHA 4F4YA 1IXMA 4GKKO 4DR5B 1DV1A 2RMKB 3T1HB 1LUWA 5H80A 3IN5A 1JXLA 1JX4A 2V4RA 3CB2A 3RR5A 2FLNA 3KHGA 1CPYA 4LF9B 4DV5O 4J80A 3HOWG 5IT9N 1S5HC 5CAEB 1UC9A 3PW4A 2C22A 2LFSA 2EJ2A 1N32O 1LR1A 4JI5B 1JQ0A 3STZC 3TW7A 4ED6A 1JFFB 5DAAA 2WLNA 5EZYF 4ED2A 4PZ7A 2ZKOA 1JLLB 3RUPA 1P7BA 3T1HH 1WCMA 4GKKB 5IJ9B 2YZNA 5CA0F 1QCEA 4X65H 4TSFG 1I1KA 2YS6A 4FLTA 3VNNA 3MDSA 2COIA 4I7HA 3NBYB 4CKBA 1BHAA 1QQCA 2BR0A 2V5AA 1RJQA 1K5SA 4GUNA 4PDLA 4MA5A 2VA2A 4JXUA 2BOCC 4B3SH 4MS2A 5J2TA 2Y48A 3OHAA 4CS2A 3K08A 2YIAA 2R8JA 4HR7A 4ECWA 2FB9A 3OGCC 3GWOA 5JQGF 1L8DA 5BPFA 4TUYB 3N2KB 3ABLC 1XK5A 4FFPA 3RFCA 5BWTA 1VQPV 4EBCA 3K03A 4EGJA 2WAQA 3V6HA 5FPOA 3GQCA 2YU9A 1S5LZ 4PDRA 1IBKB 4JI7B 3WO1A 2VQEH 3F7YC 3SJBC 1AJNA 1THZA 5DECA 5J2TF 1WRVA 4FLWA 1DLBA 3H0GG 4O2BF 1CKOA 5HBRB 4J9QA 1V51A 5F9LA 1P49A 5CA0A 3Q8RB 4DV6O 4EEQA 3E8FA 4PBCA 1AJQA 2AHYA 1VQOV 4LF8O 1VKZA 5B1BB 2QR4A 3ZMSA 2IU0A 4IZOA 4TV9A 4ICGA 4OXSA 1NR7A 5JQGA 3VBBA 5IWAB 5A2QN 5BMVA 2HEPA 4A5UB 3X2QC 3N42B 1AUXA 4Q44A 1XNRO 4I0XB 2IU3A 4JYYA 1HR0B 3PR5B 5KFJA 1NTMH 2UU9O 5KFDA 3IFXA 4ZIBA 2DYRB 4KHPO 3CRCA 4ZOLB 3W7TA 4E6NA 1F4NA 1Q7YW 3R5XA 5KFCA 5KT3A 3RBZA 1P16A 3K79A 4X66O 1Q86W 3HKZE 1V54B 3AX6A 1O9HA 3OEHG 1K4DC 1T5EA 2V1DA 1FJGB 2YEVB 1OWTA 4I4TF 4U3JA 3G6EV 3K5NA 2C2AA 3R23A 1OCCC 1R6KA 3FB8C 5GONA 5JJJB 3ZIAG 1KB9F 2IH1C 1R1BA 5LMUB 2WLLA 2M7WA 4MV4A 4H44B 2VQDA 1E4FT 4JI4B 4QWAA 1YVWA 1I7FA 1Q90D 5IP9G 2WPDG 3H1IH 2ZNJA 2DQ0A 3ABKB 3SYQA 4IWXA 4O3QA 4YB8B 3Q4HA 3ZHRA 4B08A 1BMFG 2HP8A 4DR5O 4IIJA 1FS0G 2MK3A 3MWMA 1N34H 4M0JA 2W6IG 3CCSV 4DR4B 2ATLA 3BA8A 2BQRA 3ZEDA 4JI2O 4TOIA 3IGAC 2PMZA 5KFSA 1XBLA 2XAHA 5LMNH 4M9UA 5EWEA 4CHIA 1G6UA 1JKJB 4Q8FA 1BT8A 4JTDB 3CEIA 1K3EA 4MTFA 4ZOLA 2YWVA 2OCCC 4ECTA 2A1HA 3FKIA 1IBMO 4DR7O 1DTOA 1ZUQA 5KT4A 4LF5O 2F4VH 3K9SA 4I0XA 2I87A 3VOUA 3UM7A 4LF6H 5KFIA 3K59A 4J11A 4PJ0Z 2F66C 3LDCA 1FXHA 3CC2V 1B06A 2BQUA 4FFMA 1Q81W 2HHHO 1I1LA 4XZ3B 2EBOA 5BWWA 1QVFU 4DYLA 5JVLA 3SI8A 3C90A 4YJ3B 4DR6O 4G2KA 2JS3A 2C2EA 4Q43A 4J9ZB 1G1XB 3N2GA 2W6PA 1RM1C 3ABKC 3K0DA 2P7TC 5EBMC 1ZWIC 5KHIA 3DXRB 3D36A 4X9QA 1VQNV 4FZ1A 1VP7A 3QFFA 1R6TA 2RGRA 3T54A 4B7KA 4TM5A 3LMLA 1VBHA 3RN4A 2CTQA 3EFFK 4OPAA 2HGWA 4U3JB 1LNQA 1Y1VG 3E8BA 3VQXA 4KHPH 2ATKC 2XCLA 4QE7A 4TT3G 3OE7G 3R5HA 1WPBA 1BCCH 4OX9O 2FPIB 4ZI7B 2M6YA 1XNQH 1EN5A 3I12A 4DV7O 1IBMB 4Y8VB 1JR9A 3UKMA 4NTXA 5J9PC 5CR5A 4FGRA 4FMTA 2R9AA 1ZTEA 2HJFC 2ZT9B 1N4CA 2LW7A 5IWAO 3D36C 3HKDA 3QWUA 5I5VA 4TVIA 2HHHH 1J5EO 4TV9B 2R92A 3STLC 1AROP 3L72H 3K04A 1NZ6A 4ZBMA 4ED0A 4EQ5A 2IJIA 3LNMB 1M0TA 3SYOA 4FBUA 3ZMTA 4Q8EA 1MZBA 5KFUA 2UXDO 2VS0A 3EPGA 2ZNIA 4MAMA 5BR8H 2Z0AA 1NQTA 2V58A 3VMMA 2F95B 2RDCA 1JA8A 2DZDA 1SZXA 3GVMA 4DV0O 2PYJA 1K34A 4YQWA 4BY1G 3TY8A 5C44G 1C30A 2OCCB 3K5IA 4QPKA 3FYIB 1S03G 3APQA 1BZKA 3W1GA 5EYPB 4LFCB 2QEXV 2CGOA 4O4LA 4HYOA 3P30A 1JDBB 3GTLA 3N2KA 4GLWA 4A3MG 3K5LA 1M93A 1TGOA 2YIBD 4X66B 2NVYA 2K1EA 4HN2A 4MTOA 4C5AA 3TCUA 3MR2A 1KC8W 5B3SB 1S0VA 3BFRA 4QNHB 3JRXA 3ETJA 3ZCCA 1DK1A 4C5BA 2ASDA 3UO3A 3RB0A 3U9TA 2ITDC 5D5PA 2KSWA 4PDVA 4DV4O 4IYIA 2DWCA 4LFCH 2HVSA 4DL4A 4X89A 4DV3O 3OAAG 5LA6A 3G80A 2CUGA 4YR2A 3RGXA 2V4DA 2J6TA 1GK9A 5JH7F 2CE4A 3I56V 2JA6G 1TAEA 4PI2A 4A3DG 4NZMA 1VQMV 2AW9A 2OH2A 2JJ2G 2JS5A 2YW2A 3IAYA 3RBDA 4CC5A 1EKPA 1VBGA 2FL4A 3L70H 2C2DA 5JUMA 1KECA 1U97A 3GIKA 4ME6A 4GC6A 3H20A 4DR1H 3U0GA 1K7DA 4MVOA 1VF7A 3SYPA 4K3AA 3AEIA 4JI7O 1CQJB 3F8NA 4NR1A 1BQ0A 2WLMA 5L3CA 1UNNC 5JJNB
chains in the Genus database with same CATH topology
3BHPA 1SKVA 5C8YA 5JCOA 2VWJA 3B2EE 5KMGA 4OX9B 4PZ6A 4DV4H 3BAAA 1N36H 1Z2OX 4DV5B 1I94B 3SGIA 2P5OA 3N6XA 4D7SA 4RB2C 3VQVA 4DRFA 4UCVA 4EB6B 1SEIA 4DR2B 4JI8H 2GV9A 2RJZA 4LFBH 2YIBA 3M4IA 5JJEB 3RIZA 2HGSA 2ZM6H 1N33B 1WNSA 4RB3C 4DV1B 4LF5H 1L2ZA 4NXMB 1SYXB 5JCOC 2VQEB 2ZCEA 1X4TA 2HIVA 2PGGA 5LXTA 4AHCA 2OYQA 3RYIB 4CS3A 3S24A 2HIXA 4UCRA 1M5IA 3JASB 4LF4H 3GJXB 1HNWH 2OWOA 1B04A 4BWAA 1J5EB 3N44B 4UCTA 3HKCA 4CH4A 2UXCH 3E22B 5LP6B 2PTMA 1CKNA 4JI5H 1H2SB 4DV0H 4KL1A 4I4TB 4X64H 3BABA 4DR3H 4JV5H 1SA0A 3K5MA 2ZINA 5LOVB 3JARB 4UCOA 3KALA 1CKNB 3J80W 2FE3A 1HNZH 4O4JA 4JI8B 4EB6A 4MV9A 4YY3B 3W5OA 4GKKH 3SR2C 2IM9A 5FD5A 5LA6B 4CH5A 4DR7B 5LP6C 4CH3A 4RAZA 1ZHSA 3JALA 2UXBH 4DR1B 3CVZA 2QM4A 3RWRD 3RJ0A 4UFZA 4BWSC 4B3SB 1P8LA 4ZHQA 5LXTB 3KAKA 1M4UA 4O2BA 1HNWB 4FFBB 1XHZA 4JV5B 1FFXA 3U11A 2KKWA 3K57A 1JMKC 5FLXW 5EZYA 1CKMA 1FJGH 3QTCA 5IYZA 4DV5H 1I94H 1FFXB 4R7RA 4DV7H 3JSLA 2E3CA 1FKAH 4LFAH 4O2BB 5CB4A 3JAMW 4O4LB 3SJAC 1D5AA 4DR3B 4DR2H 3HKBB 1SA0B 3OTOB 2XIGA 4YHHH 3U0ZA 1A0IA 5D1OB 4I4TA 1I6UA 2VUGA 4AQYB 4YY3H 2XHBA 3RTXA 4DR5B 3T1HB 1XMQB 2YI9A 2WYOA 2YI8A 3CB2A 3RR5A 3KXYT 4O2AA 4LF9B 4PHZA 5LOVA 3JASA 4K8XA 3BA9A 4Q0YA 3IG0A 4JI5B 1Z5VA 2R70A 1TUBB 4YHHB 3OTOH 3JAWB 4K0KH 5KHJA 1JFFB 2YXLA 5D1PA 4PZ7A 4X1KB 3BRCA 4JI7H 5ITZA 3N2GB 4IHJA 3JAKB 4B3MB 3T1HH 4FM0A 4GKKB 4JI2B 1BJTA 1TVKA 5IJ9B 3RF2A 4LSAA 3MAQA 4X65H 4AQYH 5JH7B 3J7AK 2F4VB 4FLTA 5D1OA 3VNNA 4I7HA 5C8YB 3NBYB 5KHGA 5FNVA 4LF6B 1QQCA 4LR3A 4TUYA 2WE6A 4B3SH 4LF9H 4TQFA 1HNXH 5J2TA 4CS2A 5CA1A 4LF7H 1Q3EA 1Q43A 2YIAA 2BTQA 1KU9A 3QF7A 1L8DA 3RYFB 4TUYB 4DRXA 3N2KB 1N32H 1XK5A 2CW8A 3K5OA 3RYIA 1XNRH 1NT2B 3TY9A 5FPOA 4X1IB 1IBKB 4GLXA 4NXMH 4JI7B 3WB2A 2VQEH 3SJBC 4FLWA 5K1PA 1CKOA 5LYJA 4DR5H 5ITZB 4LMYA 1XMQH 1P49A 5CA0A 5FD6A 3OTFA 5LYJB 4FLVA 1TA8A 2CAZC 3M7MX 4LF7B 4EEQA 5KHKA 3NC0B 4I50A 2UXCB 3LNNA 1N34B 4LNUB 4FM1A 1V9PA 1N32B 4FM2A 1WN7A 1XNRB 3L2PA 3E22A 5LP6A 4O4IB 4TV9A 2BTQB 3GB8B 5LMUH 1IBKH 5JQGA 1ZAUA 1HNZB 2RQ6A 3UT5B 4NXNB 5IWAB 1IBMH 3DSQA 1S5JA 4L8JA 5BMVA 2HEPA 4LH7A 3N42B 4YJ2B 4YJ3A 4FFBA 1HR0B 3L4KA 4HNAB 2UXBB 2Q7GA 3JATA 2R72A 4LH6A 4ZIBA 5FPRA 4IIJB 5K1XA 4ZOLB 4E6NA 1P16A 3HKDB 5J2UB 1O9HA 3GDEA 4DK1A 1Z5WA 1T5EA 1FJGB 5LMNB 4LNUA 4U3JA 1BGWA 4LFAB 1Q5OA 3K5NA 3VQYA 5BR8B 5GONA 5JJJB 3JARA 1RSOA 2E5LH 5LMUB 2UUCH 1GYFA 2YCHA 1E4FT 4JI4B 4B3RB 2HVRA 1I7FA 1HW7A 3RYCB 3SJCC 4JI1H 2ZNJA 4LF8H 3KYHC 2F1MA 3DF7A 3VQWA 5J2TB 3HKEB 1Q8IA 3CHXA 3RYCA 4B08A 3CSXA 3UQ8A 1AN7A 4DV2B 2Q2UA 4DUYH 3FMAA 4IIJA 4Q6GA 3RYFA 4DRXB 5EYPA 3MWMA 1N34H 3T1YH 5JVDB 4DR4B 4X66H 3BA8A 4EFEA 4X1YB 5LL6b 1TVKB 5IJ9A 3HKCB 3ZEDA 4TOIA 5BMVB 3JAKA 3W1BA 5LMNH 4I55B 4JI4H 1SQGA 5EOYA 4BW9A 5J2UA 1XMOB 4B3RH 4O4HB 5KX5B 1G6UA 3N43B 4JI1B 3WB0A 4NXNH 2E5LB 4B3MH 3A2FA 4ZOLA 5IJ0B 4DR6H 1S68A 2VQFB 2O03A 3KAJA 4DUYB 2F4VH 1XQ8A 4FLYA 2Q7HA 4X62H 2HHHB 2JVDA 1VS0A 2Q7EA 4J0MA 4LF6H 3RFRA 4O2AB 4CC6A 3K59A 4JI0B 4DR4H 4CS4A 1E4GT 4JI6B 4LSXA 1HNXB 5GONB 2P22C 4DV3H 2F66C 2Q0AA 5KMGB 1YEWA 4JI3H 3HXLA 4F6RB 2ZJTA 2UUAH 5JH7A 4DUZH 2RGVA 1XDNA 4YJ3B 4MTDA 4DK0A 5CA0B 3HKBA 4APMA 4I55A 1XMOH 5CB4B 4HBNA 3N2GA 3ETQA 4IHJB 3U10A 4RZQA 4JYAB 5KHIA 4EFBA 4FLXA 2MCTA 5IYZB 4RB0A 4WBNA 2RGRA 2PUSA 4A2AA 3LMLA 4DR6B 1ZHQA 4DV4B 5EIBC 4CH6A 1DGSA 4U3JB 4DV2H 4FVMA 4FLUA 2W57A 4PI0A 4RAYA 3VQXA 1XHXA 2UU9H 4KHPH 3T1YB 2ZM6B 4DV6B 4DV3B 1WPBA 2VOBA 4JI3B 4ZI7B 1XNQH 2QJ1A 3WB1A 2UUAB 2CFMA 3QG5A 1IBMB 5IWAH 3JAWA 2UXDH 4M7EA 3HKEA 3ZS8C 2HVQA 1JJOA 3ICXA 4UCSA 4RB1A 2R9AA 1HR0H 4TV8B 4JYAH 2VQFH 3HKDA 3QWUA 4B3TB 1QHTA 4GYCB 4WBNB 2HHHH 5JVDA 4X64B 4O4IA 4TV9B 3C0FB 2ZIMA 4KHPB 4ZHQB 4JI6H 4EQ5A 1M0TA 2ZIOA 2EX3A 4GKJB 4I50B 5IJ0A 2UU9B 1MZBA 2ZNIA 3TY5A 5BR8H 4DV6H 4F6RA 4DUZB 4DR7H 2F95B 2UUCB 1FVIA 1XNQB 4A2BA 4PDBA 3BPZA 2PYJA 3K58A 5DISC 1O9GA 3TY8A 4MTEA 3RGZA 4B3TH 2UXDB 3THOA 4LF8B 1S03G 2CW7A 1TUBA 3W1GA 1N36B 3K3VA 5EYPB 4LFCB 4YJ2A 3JATB 5IT9W 4O4LA 4FM9A 2VPSA 4HNAA 3N2KA 4NVPA 4DV7B 2JGUA 2PZSA 4GKJH 4X20A 4LFBB 1JFFA 2WDTA 4ZI7A 3J81W 5EZYB 3EYYA 3K5LA 1M93A 4AILC 1TGOA 4O4HA 2YIBD 5KX5A 4X66B 2F93B 3FFQA 2VWKA 1O75A 4X20B 1IBLH 4X1YA 2UUBH 4O4JB 3N40P 4D7TA 3UT5A 5D5PA 2KSWA 4LFCH 5JQGB 2HVSA 4I9QA 4IAJA 3RYHA 1Z2NX 2Q2TA 3PN1A 5CA1B 2BTOA 5LA6A 4ETSA 5A2QW 4X62B 4DV0B 3RYHB 3RGXA 2V4DA 1SQFA 1XI1A 5FNVB 4JI0H 4K8ZA 4PZ8A 1M0WA 1TAEA 4PI2A 4K0KB 4OX9H 2PYLA 4X1IA 1X9NA 2JS5A 1N33H 4UCUA 3NBZB 3IAYA 4DV1H 4CC5A 1Z2PX 3L4JA 4MV7A 4JI2H 5KHHA 4X65B 4X1KA 5EIBD 4LF5B 1KMIZ 3H20A 4DR1H 4TV8A 4LF4B 1IBLB 2UUBB 3RGBA 3JSNA 2PY5A 1VF7A 1WH2A 4FLZA 5D5QA 1J5EH 3N41B 3F8NA 4TQDA 5JJNB 3JALB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 B;  5LMU B;  4YHH B;  4OX9 B;  2HVQ A;  4PZ6 A;  3BAA A;  4UCS A;  4DV5 B;  1I94 B;  3SGI A;  4JI4 B;  4B3R B;  2HVR A;  5D1P A;  4PZ7 A;  3QWU A;  4UCV A;  4B3T B;  4DRF A;  4DR2 B;  4X64 B;  4B3M B;  3KYH C;  4GKK B;  4JI2 B;  4KHP B;  1N33 B;  4DV1 B;  3UQ8 A;  4NXM B;  4DV2 B;  2Q2U A;  4EQ5 A;  2VQE B;  2F4V B;  5D1O A;  3VNN A;  3NBY B;  4GKJ B;  2HIV A;  4LF6 B;  2UU9 B;  3TY5 A;  4DR4 B;  3S24 A;  3BA8 A;  4EFE A;  2HIX A;  4UCR A;  4DUZ B;  3GJX B;  4TOI A;  2UUC B;  2OWO A;  3W1B A;  1B04 A;  1FVI A;  1J5E B;  1XNQ B;  4UCT A;  1XMO B;  5DIS C;  1CKN A;  4JI1 B;  3TY8 A;  2UXD B;  1XK5 A;  2E5L B;  4LF8 B;  3BAB A;  3W1G A;  1N36 B;  4LFC B;  3TY9 A;  5FPO A;  4UCO A;  1S68 A;  2VQF B;  1IBK B;  4GLX A;  1CKN B;  4JI7 B;  4DUY B;  4DV7 B;  4JI8 B;  2HHH B;  1VS0 A;  4LFB B;  4YY3 B;  3W5O A;  1CKO A;  4CC6 A;  4JI0 B;  4X66 B;  4JI6 B;  1HNX B;  4DR7 B;  1TA8 A;  4LF7 B;  4DR1 B;  4EEQ A;  3NC0 B;  2UXC B;  1N34 B;  1V9P A;  1N32 B;  4UFZ A;  4B3S B;  1P8L A;  1XDN A;  1HNW B;  1XNR B;  3L2P A;  4JV5 B;  2HVS A;  3GB8 B;  1CKM A;  2Q2T A;  3PN1 A;  4JYA B;  1ZAU A;  4EFB A;  3JSL A;  1HNZ B;  4X62 B;  4DV0 B;  4NXN B;  5IWA B;  4DR3 B;  4LH7 A;  3OTO B;  4DR6 B;  4PZ8 A;  1TAE A;  4DV4 B;  4K0K B;  1A0I A;  5D1O B;  1HR0 B;  2VUG A;  2UXB B;  1DGS A;  1X9N A;  4AQY B;  4UCU A;  3NBZ B;  4LH6 A;  4CC5 A;  5FPR A;  3RTX A;  4DR5 B;  4E6N A;  3T1H B;  1XMQ B;  3RR5 A;  1P16 A;  3T1Y B;  4X65 B;  2ZM6 B;  4DV6 B;  4DV3 B;  4LF5 B;  4LF9 B;  4LF4 B;  3GDE A;  4JI3 B;  1IBL B;  2UUB B;  3JSN A;  1FJG B;  5LMN B;  4LFA B;  2UUA B;  2CFM A;  1IBM B;  5BR8 B;  3BA9 A; 
#chains in the Genus database with same CATH topology
 2CK3 G;  4A3B G;  1RFY A;  1N36 H;  4DV4 H;  1JPX A;  3SGI A;  3ML0 A;  1SQP H;  2ZDH A;  1QU7 A;  2L6L A;  1RK5 A;  1KJJ A;  4UCV A;  1C3O A;  2XD4 A;  1EBO A;  1BS3 A;  1TWA A;  4O3N A;  4MVU A;  4GZR B;  4XDK A;  4RB3 C;  3TJT A;  1L2Z A;  4NXM B;  3DTU B;  4O84 A;  5JCO C;  5DM6 V;  2QKS A;  3HOZ G;  2QDO A;  1WB7 A;  1X4T A;  3JYC A;  2HIV A;  3H0G A;  3CX5 F;  4PD4 F;  2ZD9 A;  3RYI B;  3H4D A;  2NNU A;  1YSC A;  2D3O W;  2WTF A;  4U3F H;  4ZOL F;  1M5I A;  3LDD A;  4LF4 H;  4JI0 O;  4JV5 O;  1BE3 H;  3CXH F;  4P9O A;  2JJ1 G;  3E22 B;  2COG A;  2HKO A;  2PTM A;  4A3E G;  2N04 A;  2ILM A;  3LP8 A;  3HB3 B;  5BR8 O;  4DV0 H;  4I4T B;  1V4Y A;  1W93 A;  2ZIN A;  1F51 A;  3JAR B;  4B3S O;  2X6C A;  3KAL A;  4R7C A;  3J80 W;  1HNZ H;  1Y76 B;  4YY3 B;  1XMO O;  4C2M A;  3SR2 C;  5L3B A;  2JA7 A;  1T36 A;  2LGW A;  4LWS A;  4CH5 A;  4DR7 B;  1VEW A;  3QVN A;  1VQK V;  5FL7 G;  4O86 A;  5LMU O;  3T5L A;  5KG0 A;  4PA7 A;  2R82 A;  4JPR A;  3RWR D;  4BIU A;  3TXS A;  4B3S B;  4LFA O;  1M4U A;  2WLI B;  3CCE V;  2W8L A;  3L9D A;  4JAS A;  5EBW C;  2YDE A;  3M9O B;  3QTC A;  5HFM A;  4R7R A;  1FKA H;  3AG2 C;  4MV3 A;  3E89 A;  4LFA H;  3JAM W;  4PA9 A;  3QZ7 A;  1D5A A;  1H2L A;  4DR2 H;  1N48 A;  2AU0 A;  2RN9 A;  1SA0 B;  1GM9 A;  3OTO B;  2XIG A;  4DV1 O;  2GQR A;  4O3O A;  3ZN0 A;  1EZJ A;  3GIJ A;  4CBC A;  1IOV A;  5LMN O;  1XMQ B;  5I5Y A;  1GSO A;  2YI8 A;  5L1K A;  1AI4 A;  3KXY T;  3AG4 B;  4K6N A;  4O2A A;  4NLG A;  1IUR A;  1I94 O;  4C5C A;  1F4M A;  1Y1W A;  3KCY A;  2W9A A;  3L74 H;  4G27 B;  2JEI A;  4QWE A;  4O7Z A;  5LGU A;  1A9X A;  2NU7 B;  3CCU V;  1ZSP A;  1Z5V A;  4RQF A;  3T2M A;  1IBL O;  3OTO H;  3JAW B;  2CNQ A;  2YXL A;  3DXR A;  5D1P A;  1AB3 A;  4EGQ A;  4IWY A;  2P90 A;  4MTG A;  5ITZ A;  1GMG A;  3N2G B;  2ALZ A;  2BQ3 A;  1AR1 B;  5L9X A;  1NTZ H;  3AW8 A;  4DLK A;  4P30 A;  4A3G G;  2MW2 B;  1BJT A;  1TVK A;  3MAQ A;  3B4S A;  2FLL A;  1XUQ A;  3ZHU A;  2G38 A;  2JEX A;  1KT8 A;  3J7A K;  2F4V B;  5D1O A;  3AK3 A;  2E2H A;  5FNV A;  1EZV H;  1G2W A;  4B3M O;  2UXB O;  2WE6 A;  4LF9 H;  3P3P A;  1HNX H;  2PMZ E;  2ITC C;  4LF7 H;  4DO2 A;  3WWH A;  3CC4 V;  1QR9 A;  2AZ0 A;  2X0S A;  4BIO A;  2PBZ A;  3RYF B;  4DRX A;  2LO1 A;  3H3V H;  2ODM A;  5CA1 F;  3ZRX A;  3K5O A;  4MTX A;  2CW8 A;  4QWB A;  1XNR H;  3SPC A;  1NT2 B;  2ODT X;  1Y14 B;  5C5J A;  4WFF A;  3TY9 A;  1EN4 A;  2RCV A;  2C2R A;  2JA8 G;  4X1I B;  1K4C C;  4NXM H;  5KFZ A;  2UXC O;  4MVR A;  4J9Y B;  1FXK C;  5FD6 A;  2EIY A;  5LYJ B;  4OPH A;  1TA8 A;  3M7M X;  1SC5 B;  3LSS A;  3NC0 B;  1MA1 A;  5KHK A;  4LCU C;  1N34 B;  4LNU B;  2Q6A A;  4RUC A;  1V9P A;  1N32 B;  4TV9 F;  4IR9 A;  1V55 B;  3Q4H B;  3GTG A;  4FFN A;  2QF7 A;  4J9R A;  3WNZ A;  3L2P A;  3E22 A;  4O4I B;  2EZO A;  2OT5 A;  3LWB A;  4FFR A;  1NH2 D;  1IBK H;  3OEE G;  1KBH A;  1ZAU A;  2W71 A;  1FXK B;  3K3P A;  2A7W A;  2RQ6 A;  2DPI A;  2Y4R A;  2ZXW B;  1XMQ O;  3DSQ A;  1DF5 A;  2W6M A;  3MWD A;  4PV1 B;  4YJ2 B;  3H1K H;  2R7Z A;  4YJ3 A;  4HNA B;  4ABM A;  1WP8 A;  4Q4D A;  2R72 A;  3TGU H;  1VF5 B;  5FPR A;  5K1X A;  1BXR A;  4MVM A;  3FD9 A;  3UZB A;  5BZB A;  2IBK A;  5I5W A;  3G67 A;  4NZN A;  5J2U B;  3GDE A;  2E76 B;  5DMX A;  4BY7 G;  1XL4 A;  2FLP A;  2BE3 A;  3BCC H;  1JDE A;  1BGW A;  3C3T A;  4LFA B;  1TWH A;  1I0H A;  3VQY A;  4MT8 A;  3NR7 A;  4WD3 A;  1RPO A;  1M57 B;  4AQY O;  3JAR A;  3ZHT A;  2CH7 A;  1RSO A;  2E5L H;  4FPP A;  2UUC H;  2FKX A;  1Q6H A;  5KFH A;  4JAA A;  1R6N A;  2YCH A;  5B5E Z;  1QLE B;  4B3R B;  2HVR A;  1HW7 A;  5H9C A;  2EIN B;  3W7S A;  3U9S A;  1V54 C;  2YSU B;  5EK0 A;  5IY5 B;  3SPG A;  3GLK A;  4LF8 H;  5F2V O;  4ECY A;  3TET A;  1K1S A;  3CWB H;  3HKE B;  3MHH C;  1Q8I A;  2SCU B;  3RYC A;  2DQ3 A;  2A0L A;  4DV2 B;  1BHB A;  4R8C A;  2NLJ C;  1S0O A;  3WWI A;  3OMN B;  5KT7 A;  2A06 H;  3GIP A;  1Y6X A;  1B6S A;  4X1Y B;  5LL6 b;  3UYY A;  1TVK B;  5KFP A;  3HKC B;  3G8D A;  3PZP A;  3CJH A;  1NS1 A;  1TWC A;  3SYA A;  3W1B A;  1YJN V;  4I55 B;  3PO2 G;  4TWK A;  1AIL A;  3T5K A;  2JIZ G;  3IC9 A;  2JA5 G;  3N43 B;  2AGA A;  2OIE A;  4YP3 A;  5BWU A;  1SQX H;  2FPG B;  3F5T A;  2BSK B;  2CTR A;  5IJ0 B;  3SJQ C;  4DAA A;  1S0N A;  2UVV A;  2RNB A;  2ASL A;  3KAJ A;  2O03 A;  2PN1 A;  4DL6 A;  2CQY A;  2YID A;  1VS0 A;  4PWQ A;  2AXT Z;  2GDS A;  1H2K A;  4DW1 A;  3G71 V;  4I7Z B;  2NU6 B;  4O2A B;  5CMU A;  3ORR A;  3K3W A;  4CS4 A;  1E4G T;  4EG0 A;  4JI6 B;  2JDI G;  1I7L A;  5KG1 A;  1I2K A;  3JRW A;  2QTS A;  2VRZ A;  3E86 A;  3HXL A;  4F6R B;  3AK2 A;  3LSU A;  3ASO B;  3T99 A;  3LUT B;  1XDN A;  4GT1 A;  3A0H Z;  4JGS A;  4XYM B;  5DQH A;  4I55 A;  5FLX N;  3U10 A;  1SFO A;  1RPR A;  2MCT A;  4EFB A;  4FLX A;  4RUA A;  5KFN A;  1JVM A;  4RB0 A;  3G6X A;  1GH6 A;  2PI4 A;  1GN6 A;  2PUS A;  1RJP A;  3ZMZ A;  4GKJ O;  4DR6 B;  2ZXW C;  3G4S V;  5C93 A;  3M99 B;  4CH6 A;  2P6J A;  5EIB C;  1S76 D;  2ZDG A;  2W9B B;  3L75 H;  3ABU A;  4FVM A;  4PI0 A;  2V9W A;  1PM9 A;  4F50 A;  3CYO A;  1GLV A;  2RF4 A;  4HNV A;  1KP3 A;  3RAX A;  4DV6 B;  4DV3 B;  4PA4 A;  5CB4 F;  4ZKI A;  5TIS Z;  1SQQ H;  1PNM A;  4GX1 A;  2Y0P A;  2QJ1 A;  2YZG A;  2CFM A;  4NYK A;  2X6B A;  3JAW A;  4M7E A;  4JYB A;  3ZS8 C;  2HVQ A;  3HPL C;  3QO7 A;  1JJO A;  3NXS A;  4UCS A;  4RB1 A;  2CDY A;  3BY6 A;  4J10 A;  2Q7D A;  4W4K A;  4CZZ A;  1KKC A;  3ZMV A;  1FJG O;  3ZX6 A;  3T9C A;  4EYH B;  4UUJ C;  4FJC C;  3U55 A;  2Y0S A;  1R3K C;  3Q2O A;  4ZHQ B;  2HVJ C;  1N36 O;  3GIM A;  5C3E G;  4I50 B;  2BSK A;  5IJ0 A;  3T9B A;  1JJ2 U;  2XTA A;  1AP5 A;  4O4I F;  4YIP A;  4DV6 H;  3KHH A;  1QBZ A;  1S97 A;  1R3I C;  3RVZ A;  4DUZ B;  1TWG A;  4H13 B;  4YIO A;  4FK5 C;  5A9G A;  2UUC B;  4RNN A;  4O7S A;  3ZHV A;  5EWG A;  3K9A A;  5JQW A;  4YJ2 F;  3GV7 B;  5BY1 A;  3RGZ A;  4B3T H;  2UXD B;  3THO A;  1N34 O;  1PX2 A;  1OBD A;  4JF3 A;  4R6Z A;  2NN4 A;  1NU1 H;  5HV6 A;  2XAJ A;  1FAF A;  5IT9 W;  1FFT B;  2VPS A;  4NVP A;  2XAG A;  2WA4 A;  3ZHS A;  2W8K A;  2R8I A;  3TQ1 A;  3RB4 A;  3J80 N;  1NBM G;  4X20 A;  3JZF A;  2WDT A;  4ZI7 A;  3LDE A;  3J81 W;  1L1F A;  2QGN A;  3EYY A;  2WLK A;  1MMM A;  2JEF A;  5DG8 A;  4O4H A;  5KX5 A;  2F93 B;  2M05 A;  2ZE6 A;  3ABL B;  4MA0 A;  5I5T A;  3NGD A;  2GSM B;  3S3X A;  4X20 B;  3FAV A;  2V4Q A;  3OTO O;  1IBL H;  5BWV A;  4J9M A;  1F23 A;  1BNC A;  2CH7 B;  4KXR A;  4FS2 A;  1YHQ V;  4WBN F;  4D7T A;  1WJZ A;  2R8G A;  5C1O A;  3T5J A;  1XNQ O;  5JQG B;  4GCZ A;  4HNU A;  3JD4 A;  1P4R A;  4FFL A;  2R92 G;  1PD3 A;  3JD2 A;  5KFE A;  4X62 B;  4J41 A;  1K9M W;  2AGO A;  1XI1 A;  1PL0 A;  5B3S C;  5FNV B;  4N21 A;  1OHH G;  3DC5 A;  4PZ8 A;  2X7R B;  4K0K B;  3GV5 B;  1BSM A;  1WB8 A;  1XEQ A;  4UCU A;  4DV1 H;  2LQT A;  1Q82 W;  2RDJ A;  3L4J A;  3ASN C;  4KUM A;  2YL2 A;  3Q1K A;  4G3I A;  4JI2 H;  4NTY A;  5KHH A;  5JVD F;  2Y0I A;  1IBL B;  2PY5 A;  1W59 A;  4ED8 A;  1WH2 A;  4JAV A;  5D5Q A;  3N41 B;  2E74 B;  3QO5 A;  4TQD A;  2R87 A;  3OSP A;  3BHP A;  5C8Y A;  4EKW A;  5L1J A;  3U54 A;  2P5O A;  2EZP A;  1RJR A;  2UUA O;  3JD0 A;  4J7K A;  4DRF A;  1Y76 A;  3RBE A;  4DR2 B;  2QA4 V;  2GV9 A;  2FML A;  3WWJ A;  2DN9 A;  2YIB A;  4L87 A;  5GON F;  2ARH A;  5B1O A;  1H38 A;  2Q9L A;  3RIZ A;  2OTL V;  3H1J H;  4IRC A;  2ZM6 H;  5DG7 A;  3WO0 A;  3OSN A;  4DV1 B;  4LF5 H;  1OCC B;  2Q8V A;  3F5W C;  5DGA A;  4FIP C;  1OBG A;  1RYR A;  2Z3Y A;  4AHC A;  1GN4 A;  3CEB A;  5D8D A;  5BYB A;  3S24 A;  3CXC U;  2Z04 A;  4UCR A;  2B63 A;  3JAS B;  1RYS A;  3GJX B;  1HNW H;  2UVU A;  3VA7 A;  1Y1W G;  5IY5 C;  1PKX A;  5KG3 A;  3N44 B;  3HKC A;  2R84 A;  1G4Y B;  4YR0 A;  1K1Q A;  3AG3 B;  4J42 A;  4X64 H;  3BAB A;  4C7U A;  2J6U A;  2WLL B;  2ZDQ A;  4JV5 H;  1I5Y A;  2FB5 A;  3K5M A;  4R8U A;  2FTK A;  1HNX O;  1CKN B;  4QWD A;  4JI8 B;  3WU2 Z;  4X65 O;  3M9M B;  2D2C B;  4YAK B;  2XGP A;  4GKK H;  2IM9 A;  2GPW A;  4A3K G;  5FNV F;  3PW5 A;  1IYD A;  2NU8 B;  1K97 A;  4CE5 A;  2NVX A;  1P7G A;  3AK1 A;  2FPP B;  2QM4 A;  4DUY O;  2Q68 A;  3PW7 A;  2FK1 A;  4MW3 A;  2N74 A;  4XDL A;  3KAK A;  4O2B A;  4RQE A;  3QQM A;  1XHZ A;  4JV5 B;  2IJH A;  1JMK C;  1FD9 A;  3B8M A;  1OCR C;  3T5H A;  5IYZ A;  4DV5 H;  4I5S A;  2QSA A;  4DL2 A;  4JV2 A;  2E3C A;  3GWK C;  2HG5 C;  2YUA A;  2Q4P A;  3HKB B;  4LF6 O;  5KFV A;  5KFT A;  5D1O B;  1EFR G;  3HBL A;  1I6U A;  2VUG A;  2W7P A;  4DQN A;  4AQY B;  5LHH A;  2EIK C;  2ADQ B;  3RTX A;  4O7L A;  1EUD B;  2YI9 A;  5LYJ F;  2E2I A;  2OIG A;  1N8R W;  1SQB H;  4PHZ A;  3PR4 A;  3P32 A;  5GTI Z;  2A79 B;  2Q69 A;  3RVY A;  4CKC A;  4ECR A;  5LOV A;  2Q67 A;  1H2M A;  3JAS A;  3O65 A;  4YJ3 F;  5DLF A;  4QE9 A;  1ORQ C;  3N27 A;  3V4S A;  1D5N A;  3BA9 A;  2EIK B;  1VMG A;  5IYB O;  3IG0 A;  5CN0 A;  3IC7 A;  2R70 A;  2AZ2 A;  5CBG A;  5IYZ F;  2HHF A;  4IIJ F;  1YCI A;  3GID A;  2XCA A;  3BRC A;  4MVQ A;  1KD1 W;  4JI7 H;  1ZL8 A;  4IHJ A;  2WAM A;  4TUY F;  1COW G;  1QR8 A;  4EBD A;  4LSA A;  3RF2 A;  2W0X A;  1HWY A;  2OLS A;  2HHF B;  4AQY H;  5JH7 B;  5FJ8 G;  5KT6 A;  3X2Q B;  1BQZ A;  1ENV A;  2Z02 A;  4MV8 A;  5KHG A;  4LF6 B;  4QIW E;  1AI6 A;  4YBZ B;  4H37 A;  4QIW A;  1EHI A;  5DLG A;  5I47 A;  1G8M A;  1N33 O;  4TQF A;  1RM1 B;  1T94 A;  1Q43 A;  1OCO B;  5I60 A;  1S0M A;  5DGI A;  3QF7 A;  1GO3 E;  2DWD C;  3KZI Z;  2J9G A;  2A3Q A;  3RYI A;  1XRE A;  2EIJ B;  3HB9 A;  3H01 A;  4QIW F;  2ZR3 A;  1UJW B;  4FFO A;  1VQ7 V;  1K33 A;  1IXB A;  2JEU A;  3WB2 A;  5KFG A;  2XT9 A;  4J9L A;  3J81 N;  3DTF A;  3FYE B;  5LYJ A;  2XOK G;  3JD1 A;  5ITZ B;  2YRX A;  3GII A;  1JCH A;  1ZLZ A;  3OTF A;  2DYS C;  2UXN A;  4FLV A;  2CAZ C;  1SCU B;  4LFB O;  4J7J A;  2XAQ A;  3LNN A;  3E8H A;  5KG5 A;  4NKG B;  4FM1 A;  2IJK A;  3V4Z A;  1SER A;  4FM2 A;  3KTM A;  5LP6 A;  5LL6 Y;  5LMU H;  3ASN B;  3PVX A;  1LUV A;  5KLV H;  1FYJ A;  2ZDI A;  4O7R A;  1HNZ B;  1JIH A;  1PP9 H;  3L73 H;  4NXN B;  3MFH A;  1S5J A;  1ZQ7 A;  1QLN A;  5KT2 A;  1B6Q A;  4LH7 A;  3D8C A;  1YF2 A;  4FFB A;  5L3D A;  3L4K A;  4UB8 Z;  3GTQ A;  3UZO A;  2A9H A;  2IH3 C;  3JAT A;  4ED7 A;  4U7O A;  2P4V A;  4PA3 A;  5B1A B;  4O2A F;  4IIJ B;  3PW2 A;  1QLE C;  3CRA A;  3HKD B;  1OCZ C;  5GTH Z;  2R7K A;  2HFE C;  4DK1 A;  1Z5W A;  4U6P A;  1MAB G;  5LMN B;  4LNU A;  2WLI A;  3T1C A;  3RB6 A;  1E4E B;  5KFF A;  5BR8 B;  2QM8 A;  1WLE A;  4A3J G;  3G8C A;  1KP2 A;  3HT5 A;  1GYF A;  2W70 A;  1SF9 A;  5BWR A;  1ET0 A;  3SJC C;  5LOV F;  5LGT A;  1H2G A;  5KFM A;  4MVS A;  4JI1 H;  3HR0 A;  2AGQ A;  1I1M A;  2PVP A;  1MSD A;  1UFI A;  4XX0 B;  1VQ9 V;  3VQW A;  5J2T B;  5EBL C;  3CHX A;  2H3O A;  2EJ0 A;  3CSX A;  3UQ8 A;  2Q2U A;  4JTC B;  1A32 A;  3C3S A;  3CS5 A;  3FMA A;  4DUY H;  3RB3 A;  3RYF A;  4DRX B;  2YC0 A;  5EYP A;  1KTA A;  3QNE A;  3ZN1 A;  4BW5 A;  1VQL V;  3NUA A;  2YIC A;  1YTF B;  1M90 W;  2FKL A;  3ZJZ A;  5IJ9 A;  4O7W A;  5BMV B;  2JK5 C;  3SPI A;  4JI4 H;  1SQG A;  4BW9 A;  3HOU G;  3CJH B;  1XMO B;  3FDS A;  2FYU H;  4B3R H;  4X8A A;  4NXN H;  2E5L B;  4B3M H;  2EUL A;  5H2F Z;  1GKF A;  5CBH A;  3GTK A;  1Q6U A;  3A2F A;  1S9F A;  1VQ6 V;  3T9D A;  4DR6 H;  1GM8 A;  1EM1 A;  2VQF B;  3KHL A;  2R6F A;  4HZ3 A;  2HHH B;  2JVD A;  2Q7E A;  5KFK A;  4UVB A;  4MW8 A;  1CS0 A;  3RFR A;  4JI0 B;  4JI8 O;  4DR4 H;  4Z1V A;  1HNX B;  3LQS A;  1JOY A;  2B9Z A;  5GON B;  5I5S A;  3CRR A;  4DV3 H;  3ETE A;  1E1R G;  2R9I A;  1M57 C;  1YEW A;  4Q4C A;  2WA3 A;  3TEK A;  2ZJT A;  2UUA H;  4DUZ H;  3R5F A;  3N6R A;  4DK0 A;  4APM A;  1GAX A;  1XMO H;  1Y67 A;  1W0J G;  3KKY A;  4HBN A;  3ETQ A;  1RP3 B;  4BXX G;  5DQG A;  3AG4 C;  4FZ0 A;  2FK2 A;  4WBN A;  2R8H A;  2JA5 A;  4A2A A;  4R8U B;  5L3F A;  4DV4 B;  2R93 A;  4JZ2 A;  3SPJ A;  3ASO C;  4DL7 A;  2QE7 G;  3JD3 A;  1B6R A;  1B3Q A;  5KFQ A;  2R85 A;  2VPQ A;  4RAY A;  4ECU A;  1PV0 A;  1N0J A;  2ADP A;  4QGP A;  3EVK A;  3T1Y B;  1FXK A;  2VOB A;  4JI3 B;  2JEJ A;  5IYC O;  1IOW A;  4DR2 O;  1MNG A;  4UXN A;  2UUA B;  4JV0 A;  1FKA O;  3QG5 A;  3OUZ A;  2CKZ B;  4IR1 A;  2UXD H;  2DLN A;  1A3G A;  3HKE A;  2PI5 A;  5KAF Z;  5DGH A;  2YZL A;  2ASJ A;  3ICX A;  2JGD B;  3JZ6 A;  2NU9 B;  4DL5 A;  1HR0 H;  5KFW A;  4ECV A;  5CBF A;  4JI1 O;  4LF9 O;  2R7M A;  2VQF H;  3T1Y O;  4O83 A;  5KFY A;  4B3T B;  1QHT A;  4GYC B;  4YR3 A;  4WBN B;  1IZ3 A;  5JVD A;  3OGI B;  5L1I A;  2ZIM A;  4KHP B;  4O7N A;  5AG2 A;  4UVA A;  1TWF A;  4ECS A;  4XBF A;  4GX0 A;  4ZI7 F;  1GN2 A;  4TQS A;  4NTW A;  3A0B Z;  2ZIO A;  3APO A;  4GKJ B;  3RT3 C;  3H9V A;  2UU9 B;  3CD6 V;  2X5R A;  1M9N A;  3TY5 A;  4DR7 H;  4P9P A;  3FX7 A;  1ROP A;  1FVI A;  1XNQ B;  3TIG A;  3CRQ A;  2QK4 A;  3LUL A;  1KYO F;  3K58 A;  2R86 A;  5DIS C;  1MG1 A;  4UV9 A;  3VOT A;  2CNU A;  4MTE A;  4LF8 B;  2GQS A;  2CW7 A;  1TUB A;  3K3V A;  5H6Q A;  4YJ2 A;  3JAT B;  2R7L A;  4FU0 A;  2K9P A;  2IW5 A;  5IYB G;  4HNA A;  3BEH A;  3VPD A;  4ECX A;  4WHX A;  4DV7 B;  1WAZ A;  3SNO A;  2PZS A;  1JFF A;  3B09 A;  2P67 A;  4LF7 O;  4LP8 A;  2LW1 A;  2QTO A;  4AIL C;  5CE8 A;  2W6J G;  1PNL A;  3FFQ A;  2VWK A;  1O75 A;  4AYB E;  2W6O A;  1FPO A;  3CCV V;  2JA6 A;  2DYR C;  1US6 A;  3UT5 A;  2L35 A;  5B1A C;  3OFN G;  5KAI Z;  4I9Q A;  3I55 V;  3T9E A;  1L0N H;  3RYH A;  3K06 A;  2BTO A;  5LBQ A;  4A3I G;  1EKV A;  4RUF A;  5A2Q W;  2HJD A;  1XIL A;  1GN3 A;  4TV8 F;  3A0R A;  2FMA A;  1XOU A;  1SQF A;  4K8Z A;  2VQE O;  2PYL A;  1V55 C;  2KG7 A;  3J7A U;  1N33 H;  3ZMU A;  4RNO A;  1Z2P X;  2F43 G;  1AR4 A;  3CE2 A;  5F9N A;  3W7W A;  1GO3 F;  2WLH A;  2YXH A;  5IYD O;  4O3S A;  1KMI Z;  1CP9 A;  2BOB C;  4B3R O;  4TV8 A;  3TIN A;  3HOY G;  5CM0 A;  1M56 B;  2EIL C;  3E83 A;  1J5E H;  4U7C A;  2HG8 A;  3MR6 A;  1SS3 A;  1KJQ A;  4Q6G A;  3JAL B;  1NVP B;  5T14 A;  2W6N A;  1SKV A;  1WA8 B;  5JCO A;  2VWJ A;  3HOV G;  2Z5U A;  4PZ6 A;  2B63 G;  2N05 A;  1I94 B;  2O57 A;  4LF4 O;  5KFO A;  2V7Q G;  2WWW A;  4PA6 A;  2GPS A;  3GIL A;  4D7S A;  2LJ2 A;  3CRM A;  3VQV A;  1YI2 V;  1VQ4 V;  2XND G;  4NYE A;  4RB2 C;  5DQI A;  1Y74 A;  2RJZ A;  4LFB H;  4XDJ A;  1ZET A;  2GUZ B;  3ORQ A;  1XL6 A;  2F23 A;  5JJE B;  1N33 B;  5EDW A;  1SYX B;  2ZCE A;  4ASU G;  5LXT A;  2OYQ A;  3MFI A;  2YXY A;  3RAQ A;  4WFE A;  2B1I A;  3S3W A;  2OWO A;  4U7N A;  2DOS A;  1B04 A;  5H5N A;  3H1L H;  1UC8 A;  3MJF A;  1RK6 A;  5KG6 A;  3N8D A;  4CH4 A;  1I7N A;  4NZO A;  1KBL A;  3V6J A;  2C28 A;  1CKN A;  4YAJ B;  3ETG A;  5H6R A;  2Q73 A;  1I08 A;  2QWR B;  1H2S B;  2W7O A;  4EBE A;  2C00 A;  2CTW A;  2Q5Z A;  2C35 B;  1HDJ A;  4IGG A;  1SA0 A;  4ED3 A;  1W0K G;  4RWU A;  1M6V A;  1QVG U;  5BYA A;  4UCO A;  4DXW A;  4QPJ A;  2WAQ E;  4F6E A;  2W6Z A;  3MR3 A;  4O4J A;  4EB6 A;  1SES A;  4MV9 A;  1ZX3 A;  3W5O A;  4EEY A;  2DYS B;  1FXV A;  1S10 A;  1VAJ A;  4QJF A;  4WCE V;  1PNK A;  2VQF O;  1YXB A;  4DR1 B;  1HP8 A;  2IJJ A;  3CVZ A;  4TQR A;  5KS8 A;  5B1N A;  2JA7 G;  4HYK A;  2KG7 B;  4UFZ A;  4BWS C;  2Y4U A;  1P8L A;  4ZHQ A;  5LXT B;  5IYD G;  1HR0 O;  1HNW B;  2AHZ A;  1VIB A;  4GX5 A;  1FFX A;  3U11 A;  2KKW A;  2IA6 A;  3ZRS A;  3IJ4 A;  1FJG H;  3AG1 B;  1I94 H;  4PDM A;  1FFX B;  4DV7 H;  3JSL A;  2DAB A;  5CB4 A;  1K73 W;  4E4T A;  3SJA C;  4LBE C;  4DR3 B;  1KJI A;  1I50 A;  2DE0 X;  4H0L B;  1NJI W;  3R9R A;  2RDI A;  4YHH H;  1CXZ B;  1A0I A;  4I4T A;  1M7J A;  2ZQM A;  4YY3 H;  4F4X A;  2XHB A;  3KHR A;  3ABT A;  1OV9 A;  4J9N A;  1T3N A;  1BL8 A;  4X62 O;  2WYO A;  1U96 A;  4F4W A;  5KG7 A;  5KG2 A;  3B8N A;  3CP1 A;  2P0A A;  2YS7 A;  4H33 A;  3WG7 C;  2XAS A;  3OUF A;  2Y4T A;  4K8X A;  1DV2 A;  3HOX G;  1Y66 A;  1IBK O;  4CMF A;  4Q0Y A;  1VF6 C;  5LP6 F;  1QNM A;  1TUB B;  3I4M G;  3RV3 A;  4LC1 A;  4YHH B;  2UUB O;  4R50 A;  4K0K H;  5KHJ A;  1YIJ V;  4E4E A;  5L3E A;  4X1K B;  2YEV A;  1SRY A;  1YTF D;  2CGN A;  4J9K A;  2HLD G;  3JAK B;  4B3M B;  3E5N A;  1Z2G A;  4ZQI A;  5I5X A;  4FM0 A;  3SDL A;  4JI2 B;  2B5U A;  1S3J A;  1RSO B;  5KFA A;  3LSQ A;  2EIM B;  4Q20 A;  4FS1 A;  4AYB A;  5L1L A;  5C8Y B;  3FAV B;  4JUZ A;  4HNT A;  3JCU Z;  1CEZ A;  1YJW V;  4LR3 A;  4DV2 O;  1Y74 B;  5BXZ A;  4TUY A;  3GTM A;  3K5H A;  5KT5 A;  1KUQ A;  2ABJ A;  4IHJ F;  1AI7 A;  3UFX B;  3VPC A;  5CA1 A;  2JEG A;  3HKZ A;  1Q3E A;  4A3C G;  4UVC A;  2BTQ A;  1JX9 A;  1KU9 A;  4BIZ A;  2QWN B;  4FBT A;  4NXN O;  1WA8 A;  1N32 H;  4O7T A;  4RZR A;  3SYC A;  3VPB A;  5C1P A;  3AG3 C;  1S77 D;  4JI5 O;  4BAY A;  1W2B U;  5B1B C;  4GLX A;  1E4E A;  1L0L H;  4Q45 A;  4J9S A;  3I5D A;  4Z1M G;  5K1P A;  4O7V A;  4DR5 H;  4ZHQ F;  4LMY A;  4GX2 A;  1GSA A;  1XMQ H;  2ETN A;  3OW2 U;  3MHS C;  4LF7 B;  2WB1 E;  5K2M A;  4I50 A;  2EIJ C;  2JRI A;  2UXC B;  1I5X A;  1VF6 A;  1N0N A;  5DG9 A;  2EJ7 A;  2HJW A;  4ECZ A;  4A3F G;  3CME V;  1WN7 A;  2VA3 A;  4IRD A;  1XNR B;  3SPH A;  2V59 A;  2WB1 A;  3AG2 B;  2BTQ B;  2CTP A;  3GB8 B;  1DF4 A;  3G6V A;  5CA3 A;  3G6B A;  3EXA A;  4I50 F;  5KA6 A;  5EC2 C;  2QM7 A;  2YRW A;  3UT5 B;  1WPX A;  1IBM H;  4L8J A;  1VAR A;  3Q8P B;  3ZRV A;  2EIM C;  4HAM A;  4MSW C;  1M56 C;  2EIL B;  4O7Y A;  2Y69 B;  3CC7 V;  1SZT A;  4NXM O;  2Q7G A;  2UXB B;  2CNV A;  3BAC A;  4L1K A;  4LH6 A;  1Q6I A;  1P84 F;  2IMW P;  3DTG A;  4YY3 O;  4MVZ A;  3GTO A;  4HQ6 A;  5LGN A;  3R66 A;  2ZDI C;  4PEL A;  3T9A A;  4JI4 O;  2YYA A;  1YZB A;  3KG2 A;  3CCL V;  4RU9 A;  4JTA B;  3D3I A;  3T1H O;  3FB6 C;  2DW4 A;  1HNW O;  4P2Z A;  1EKF A;  4WF9 V;  1Q5O A;  2LFR A;  2W9B A;  5L3G A;  3WG7 B;  1GRJ A;  3KCX A;  1SQV H;  2KSD A;  3Q8S B;  5LA6 F;  4WFG A;  4B7E A;  2YS8 A;  4JI6 O;  1WR2 A;  2NR5 A;  3RYC B;  1NR1 A;  1KUT A;  3ETH A;  1OCZ B;  4BBS G;  1WP7 A;  3KYH C;  4RCN A;  2F1M A;  3DF7 A;  2HVK C;  1AVM A;  3E8G A;  1AN7 A;  4KFM A;  4N23 A;  3BVO A;  3UCS C;  4MV6 A;  5KFX A;  2AGP A;  2I8C A;  3MD0 A;  4WFA V;  2QWP B;  3OT7 A;  2ZE7 A;  5JVD B;  4DR1 O;  2ZE8 A;  3T1Y H;  2VUM A;  4X66 H;  4EFE A;  1DIK A;  3CSW A;  3JAK A;  2X0L A;  1AI5 A;  5J2U A;  5HNE A;  2GTS A;  5EOY A;  4O4H B;  5KX5 B;  4RNM A;  1M1K W;  1J95 A;  4JI1 B;  3WB0 A;  4QSH A;  3W7X A;  2WLJ A;  4DIM A;  2R9R B;  1IX9 A;  3CQZ A;  3PW0 A;  1S68 A;  2P4K A;  3DGE A;  4IYH A;  4DUY B;  1XQ8 A;  4FLY A;  2Q7H A;  4X62 H;  4QJF B;  4IL6 Z;  3K0G A;  4J0M A;  4JI3 O;  1MZF A;  1KC7 A;  1YDX A;  4CC6 A;  1NI8 A;  4LSX A;  3RV4 A;  3BJY A;  4UV8 A;  2P22 C;  3QZ8 A;  3TW6 A;  3F7V C;  2Q0A A;  3AG7 A;  5KMG B;  2QWO B;  4JI3 H;  3H1H H;  3GB7 C;  5KUK A;  3TK1 A;  5JH7 A;  4O3P A;  2DJV A;  3OUU A;  3TII A;  3EHB B;  2RGV A;  4MTD A;  2J6S A;  5C4X G;  1H2N A;  2LGQ A;  5CA0 B;  4MV1 A;  2GHY A;  3FKI G;  3H4B A;  3HKB A;  2R7N A;  5CB4 B;  4IHJ B;  1ZL8 B;  4CKE A;  3AYH B;  3DC6 A;  4JYA B;  4RZQ A;  2VUM G;  4DUZ O;  3JAM N;  3UO2 A;  3PFF A;  3HO8 A;  5IYZ B;  2DMX A;  2XUM A;  1EUC B;  1URF A;  1W96 A;  4O82 A;  3Q8Q B;  1KEE A;  2FP4 B;  4F4Z A;  1ZHQ A;  1K5Q A;  1X59 A;  3ZHQ A;  2I80 A;  4NB5 A;  1DGS A;  1UPG A;  3FB7 C;  4X88 A;  5EC1 C;  1IVS A;  5I5U A;  2QKC A;  4O4J F;  1WSC A;  4K35 A;  2FK3 A;  4DV2 H;  2X6A A;  1YJ9 V;  4FLU A;  2Y69 C;  2W57 A;  3OD4 A;  4O4H F;  5KX5 F;  5FR9 A;  3ZRW B;  1XHX A;  2UU9 H;  3DAA A;  4F4L A;  5GW7 A;  2HDK A;  2ZM6 B;  5E25 A;  3T4Z A;  4RO2 A;  5IDJ A;  3OR7 C;  3BQ0 A;  4LFC O;  3OMA B;  2ZGI A;  2XAF A;  3WB1 A;  5B66 Z;  4UUG A;  5IWA H;  3QO8 A;  4IRK A;  2COJ A;  5IYC G;  2OCH A;  1Y4M A;  4JYC A;  1H8H G;  1S72 V;  3FB5 C;  2Y0S E;  3PO3 G;  5LXT F;  1SET A;  4TV8 B;  4JYA H;  1R3L C;  1E1Q G;  4J7Z A;  5KA5 A;  5E1A C;  2PF4 E;  1CQI B;  4ECQ A;  4E2L A;  4I9W A;  4X64 B;  3ABM B;  4O4I A;  3T7A A;  3C0F B;  4O3R A;  4UB6 Z;  2NUA B;  4A3L G;  2GBO A;  2YZM A;  4JI6 H;  2XCP A;  3I4N G;  4JAU A;  1A48 A;  1VQ8 V;  2EX3 A;  3CCM V;  5EWF A;  2QYZ A;  2OTJ V;  1YIT V;  4X64 O;  1R73 A;  4RAI A;  3GV8 B;  3W7U A;  1OCR B;  4F6R A;  1K92 A;  3AG1 C;  4G28 B;  2GUZ A;  1I2L A;  3MWE A;  2QB5 A;  2UXX A;  3ABM C;  1KJ9 A;  3GIQ A;  4KP4 A;  4D6T H;  1KJ8 A;  3EPI A;  4O4L F;  1PPJ H;  4JZG A;  4A2B A;  3BPZ A;  4PDB A;  5KFR A;  1MSW D;  1HNZ O;  1O9G A;  1OZ0 A;  2KB1 A;  3O9O A;  3V6K A;  1VQ5 V;  1PK8 A;  3G6Y A;  1N36 B;  3T4D A;  5HFL A;  2IP4 A;  4FM9 A;  5J2U F;  2W9C A;  1AR5 A;  3M9N B;  3D3Q A;  2ZM6 O;  2JGU A;  1KKD A;  4GKJ H;  4LFB B;  1OCO C;  5KUM A;  5EZY B;  2IBZ H;  1EZ1 A;  2W6Q A;  2H8P C;  2DPJ A;  2ZR2 A;  1DAA A;  5DN6 G;  2UUB H;  4X1Y A;  3OMI B;  4O4J B;  2W0F C;  1AUV A;  2DWE C;  3N40 P;  2FJZ A;  5K3W A;  1NH2 B;  4QWC A;  2Q0O C;  5C8Y F;  1GGO A;  1EN6 A;  4YXW G;  3BQ2 A;  2H94 A;  4W4L A;  5FLM G;  4IAJ A;  1Z2N X;  2Q2T A;  3PN1 A;  5CA1 B;  3ZBH A;  4J9P A;  4LWS B;  2P06 A;  4B3T O;  3SE7 A;  4ETS A;  4DV0 B;  3RYH B;  2UVR A;  4EYI B;  3PJS K;  2UUC O;  4JI0 H;  1M0W A;  4OX9 H;  3BG5 A;  3OM3 B;  4X1I A;  1X9N A;  5KFL A;  4OGQ B;  3NBZ B;  3ETD A;  3B77 A;  3CCR V;  1ULZ A;  1A0G A;  4MV7 A;  3OUS A;  4X65 B;  1CE8 A;  4X1K A;  5EIB D;  4LF5 B;  4Z2W A;  3E2E A;  4LF4 B;  1NVP D;  4IT5 A;  4YHH O;  2UUB B;  3RGB A;  3JSN A;  4FLZ A;  1GTO A;  4WFH A;  1WCM G;  1H8E G;  4I55 F;  4WFB V;  4DW0 A;  3L71 H;  2R93 G;  5E79 Z;  4GC7 A;  3B2E E;  5KMG A;  4OX9 B;  2GLT A;  3MR5 A;  3JZI A;  3BAA A;  1Z2O X;  4DV5 B;  4J9O A;  2EJR A;  3M8A A;  2DIK A;  3N6X A;  4A93 G;  1SEI A;  3CCJ V;  4EB6 B;  4QW8 A;  4DR4 O;  4JI8 H;  4JYA O;  2W9C B;  2CZG A;  3M4I A;  4ED1 A;  2ZE5 A;  1NTK H;  5LHI A;  2HGS A;  2VR1 A;  1WNS A;  2QWQ B;  3P3N A;  3ZRW A;  3R65 A;  4XYL B;  2VQE B;  2EJ3 A;  4DL3 A;  3H40 A;  2PGG A;  2E5L O;  2R7Z G;  5KFB A;  1D2D A;  4CS3 A;  3E35 A;  4RUE A;  2HGX A;  2HIX A;  1K8A W;  1NKD A;  2R8K A;  3CMA V;  3CCQ V;  1R9T A;  4DR3 O;  4BWA A;  1J5E B;  4FE2 A;  4UCT A;  2E75 B;  2UXC H;  2XC9 A;  1PL4 A;  2HR3 A;  4AI8 A;  5LP6 B;  5DGB A;  1TUE B;  3BQ1 A;  1N56 A;  5BWX A;  2JGD A;  4JI5 H;  4KL1 A;  3TXQ A;  3KRE A;  4DR3 H;  2UVW A;  5LOV B;  4JV1 A;  2FE3 A;  1F7Y A;  3TQT A;  5DED A;  2WSS G;  1XDC A;  5JWP A;  1I3Q A;  2KQX A;  1MZE A;  1IYE A;  5FD5 A;  1GSH A;  2BCC H;  5LA6 B;  4BR6 A;  5BPH A;  5LP6 C;  4CH3 A;  1GM7 A;  3A8T A;  5KKN B;  3JAL A;  1ZHS A;  5LHG A;  4RAZ A;  2UXB H;  4O81 A;  3GTJ A;  4FFK A;  1AP6 A;  1KQS U;  3RJ0 A;  1K83 A;  1BGY H;  3OR6 C;  5BMV F;  5KG4 A;  3GTP A;  1R3J C;  5IP7 G;  2QKA A;  4FFB B;  2EIN C;  3JCZ A;  3RW0 A;  4K0K O;  1EYZ A;  5FLX W;  3K57 A;  3B40 A;  1B33 N;  5EZY A;  4QW9 A;  4BBR G;  1CKM A;  3FKS G;  1Y1V A;  2XGQ A;  1IDS A;  4O2B B;  1AJP A;  4O4L B;  2GTA A;  2B1G A;  3CPW U;  4CMD A;  2DAA A;  3T9F A;  2AQ4 A;  3U0Z A;  3WFV A;  2F4V O;  1E79 G;  1MOF A;  3OHB A;  5IE9 A;  2LP7 A;  1OJH A;  4F4Y A;  1IXM A;  4GKK O;  4DR5 B;  1DV1 A;  2RMK B;  3T1H B;  1LUW A;  5H80 A;  3IN5 A;  1JXL A;  1JX4 A;  2V4R A;  3CB2 A;  3RR5 A;  2FLN A;  3KHG A;  1CPY A;  4LF9 B;  4DV5 O;  4J80 A;  3HOW G;  5IT9 N;  1S5H C;  5CAE B;  1UC9 A;  3PW4 A;  2C22 A;  2LFS A;  2EJ2 A;  1N32 O;  1LR1 A;  4JI5 B;  1JQ0 A;  3STZ C;  3TW7 A;  4ED6 A;  1JFF B;  5DAA A;  2WLN A;  5EZY F;  4ED2 A;  4PZ7 A;  2ZKO A;  1JLL B;  3RUP A;  1P7B A;  3T1H H;  1WCM A;  4GKK B;  5IJ9 B;  2YZN A;  5CA0 F;  1QCE A;  4X65 H;  4TSF G;  1I1K A;  2YS6 A;  4FLT A;  3VNN A;  3MDS A;  2COI A;  4I7H A;  3NBY B;  4CKB A;  1BHA A;  1QQC A;  2BR0 A;  2V5A A;  1RJQ A;  1K5S A;  4GUN A;  4PDL A;  4MA5 A;  2VA2 A;  4JXU A;  2BOC C;  4B3S H;  4MS2 A;  5J2T A;  2Y48 A;  3OHA A;  4CS2 A;  3K08 A;  2YIA A;  2R8J A;  4HR7 A;  4ECW A;  2FB9 A;  3OGC C;  3GWO A;  5JQG F;  1L8D A;  5BPF A;  4TUY B;  3N2K B;  3ABL C;  1XK5 A;  4FFP A;  3RFC A;  5BWT A;  1VQP V;  4EBC A;  3K03 A;  4EGJ A;  2WAQ A;  3V6H A;  5FPO A;  3GQC A;  2YU9 A;  1S5L Z;  4PDR A;  1IBK B;  4JI7 B;  3WO1 A;  2VQE H;  3F7Y C;  3SJB C;  1AJN A;  1THZ A;  5DEC A;  5J2T F;  1WRV A;  4FLW A;  1DLB A;  3H0G G;  4O2B F;  1CKO A;  5HBR B;  4J9Q A;  1V51 A;  5F9L A;  1P49 A;  5CA0 A;  3Q8R B;  4DV6 O;  4EEQ A;  3E8F A;  4PBC A;  1AJQ A;  2AHY A;  1VQO V;  4LF8 O;  1VKZ A;  5B1B B;  2QR4 A;  3ZMS A;  2IU0 A;  4IZO A;  4TV9 A;  4ICG A;  4OXS A;  1NR7 A;  5JQG A;  3VBB A;  5IWA B;  5A2Q N;  5BMV A;  2HEP A;  4A5U B;  3X2Q C;  3N42 B;  1AUX A;  4Q44 A;  1XNR O;  4I0X B;  2IU3 A;  4JYY A;  1HR0 B;  3PR5 B;  5KFJ A;  1NTM H;  2UU9 O;  5KFD A;  3IFX A;  4ZIB A;  2DYR B;  4KHP O;  3CRC A;  4ZOL B;  3W7T A;  4E6N A;  1F4N A;  1Q7Y W;  3R5X A;  5KFC A;  5KT3 A;  3RBZ A;  1P16 A;  3K79 A;  4X66 O;  1Q86 W;  3HKZ E;  1V54 B;  3AX6 A;  1O9H A;  3OEH G;  1K4D C;  1T5E A;  2V1D A;  1FJG B;  2YEV B;  1OWT A;  4I4T F;  4U3J A;  3G6E V;  3K5N A;  2C2A A;  3R23 A;  1OCC C;  1R6K A;  3FB8 C;  5GON A;  5JJJ B;  3ZIA G;  1KB9 F;  2IH1 C;  1R1B A;  5LMU B;  2WLL A;  2M7W A;  4MV4 A;  4H44 B;  2VQD A;  1E4F T;  4JI4 B;  4QWA A;  1YVW A;  1I7F A;  1Q90 D;  5IP9 G;  2WPD G;  3H1I H;  2ZNJ A;  2DQ0 A;  3ABK B;  3SYQ A;  4IWX A;  4O3Q A;  4YB8 B;  3Q4H A;  3ZHR A;  4B08 A;  1BMF G;  2HP8 A;  4DR5 O;  4IIJ A;  1FS0 G;  2MK3 A;  3MWM A;  1N34 H;  4M0J A;  2W6I G;  3CCS V;  4DR4 B;  2ATL A;  3BA8 A;  2BQR A;  3ZED A;  4JI2 O;  4TOI A;  3IGA C;  2PMZ A;  5KFS A;  1XBL A;  2XAH A;  5LMN H;  4M9U A;  5EWE A;  4CHI A;  1G6U A;  1JKJ B;  4Q8F A;  1BT8 A;  4JTD B;  3CEI A;  1K3E A;  4MTF A;  4ZOL A;  2YWV A;  2OCC C;  4ECT A;  2A1H A;  3FKI A;  1IBM O;  4DR7 O;  1DTO A;  1ZUQ A;  5KT4 A;  4LF5 O;  2F4V H;  3K9S A;  4I0X A;  2I87 A;  3VOU A;  3UM7 A;  4LF6 H;  5KFI A;  3K59 A;  4J11 A;  4PJ0 Z;  2F66 C;  3LDC A;  1FXH A;  3CC2 V;  1B06 A;  2BQU A;  4FFM A;  1Q81 W;  2HHH O;  1I1L A;  4XZ3 B;  2EBO A;  5BWW A;  1QVF U;  4DYL A;  5JVL A;  3SI8 A;  3C90 A;  4YJ3 B;  4DR6 O;  4G2K A;  2JS3 A;  2C2E A;  4Q43 A;  4J9Z B;  1G1X B;  3N2G A;  2W6P A;  1RM1 C;  3ABK C;  3K0D A;  2P7T C;  5EBM C;  1ZWI C;  5KHI A;  3DXR B;  3D36 A;  4X9Q A;  1VQN V;  4FZ1 A;  1VP7 A;  3QFF A;  1R6T A;  2RGR A;  3T54 A;  4B7K A;  4TM5 A;  3LML A;  1VBH A;  3RN4 A;  2CTQ A;  3EFF K;  4OPA A;  2HGW A;  4U3J B;  1LNQ A;  1Y1V G;  3E8B A;  3VQX A;  4KHP H;  2ATK C;  2XCL A;  4QE7 A;  4TT3 G;  3OE7 G;  3R5H A;  1WPB A;  1BCC H;  4OX9 O;  2FPI B;  4ZI7 B;  2M6Y A;  1XNQ H;  1EN5 A;  3I12 A;  4DV7 O;  1IBM B;  4Y8V B;  1JR9 A;  3UKM A;  4NTX A;  5J9P C;  5CR5 A;  4FGR A;  4FMT A;  2R9A A;  1ZTE A;  2HJF C;  2ZT9 B;  1N4C A;  2LW7 A;  5IWA O;  3D36 C;  3HKD A;  3QWU A;  5I5V A;  4TVI A;  2HHH H;  1J5E O;  4TV9 B;  2R92 A;  3STL C;  1ARO P;  3L72 H;  3K04 A;  1NZ6 A;  4ZBM A;  4ED0 A;  4EQ5 A;  2IJI A;  3LNM B;  1M0T A;  3SYO A;  4FBU A;  3ZMT A;  4Q8E A;  1MZB A;  5KFU A;  2UXD O;  2VS0 A;  3EPG A;  2ZNI A;  4MAM A;  5BR8 H;  2Z0A A;  1NQT A;  2V58 A;  3VMM A;  2F95 B;  2RDC A;  1JA8 A;  2DZD A;  1SZX A;  3GVM A;  4DV0 O;  2PYJ A;  1K34 A;  4YQW A;  4BY1 G;  3TY8 A;  5C44 G;  1C30 A;  2OCC B;  3K5I A;  4QPK A;  3FYI B;  1S03 G;  3APQ A;  1BZK A;  3W1G A;  5EYP B;  4LFC B;  2QEX V;  2CGO A;  4O4L A;  4HYO A;  3P30 A;  1JDB B;  3GTL A;  3N2K A;  4GLW A;  4A3M G;  3K5L A;  1M93 A;  1TGO A;  2YIB D;  4X66 B;  2NVY A;  2K1E A;  4HN2 A;  4MTO A;  4C5A A;  3TCU A;  3MR2 A;  1KC8 W;  5B3S B;  1S0V A;  3BFR A;  4QNH B;  3JRX A;  3ETJ A;  3ZCC A;  1DK1 A;  4C5B A;  2ASD A;  3UO3 A;  3RB0 A;  3U9T A;  2ITD C;  5D5P A;  2KSW A;  4PDV A;  4DV4 O;  4IYI A;  2DWC A;  4LFC H;  2HVS A;  4DL4 A;  4X89 A;  4DV3 O;  3OAA G;  5LA6 A;  3G80 A;  2CUG A;  4YR2 A;  3RGX A;  2V4D A;  2J6T A;  1GK9 A;  5JH7 F;  2CE4 A;  3I56 V;  2JA6 G;  1TAE A;  4PI2 A;  4A3D G;  4NZM A;  1VQM V;  2AW9 A;  2OH2 A;  2JJ2 G;  2JS5 A;  2YW2 A;  3IAY A;  3RBD A;  4CC5 A;  1EKP A;  1VBG A;  2FL4 A;  3L70 H;  2C2D A;  5JUM A;  1KEC A;  1U97 A;  3GIK A;  4ME6 A;  4GC6 A;  3H20 A;  4DR1 H;  3U0G A;  1K7D A;  4MVO A;  1VF7 A;  3SYP A;  4K3A A;  3AEI A;  4JI7 O;  1CQJ B;  3F8N A;  4NR1 A;  1BQ0 A;  2WLM A;  5L3C A;  1UNN C;  5JJN B; 
#chains in the Genus database with same CATH homology
 3BHP A;  1SKV A;  5C8Y A;  5JCO A;  2VWJ A;  3B2E E;  5KMG A;  4OX9 B;  4PZ6 A;  4DV4 H;  3BAA A;  1N36 H;  1Z2O X;  4DV5 B;  1I94 B;  3SGI A;  2P5O A;  3N6X A;  4D7S A;  4RB2 C;  3VQV A;  4DRF A;  4UCV A;  4EB6 B;  1SEI A;  4DR2 B;  4JI8 H;  2GV9 A;  2RJZ A;  4LFB H;  2YIB A;  3M4I A;  5JJE B;  3RIZ A;  2HGS A;  2ZM6 H;  1N33 B;  1WNS A;  4RB3 C;  4DV1 B;  4LF5 H;  1L2Z A;  4NXM B;  1SYX B;  5JCO C;  2VQE B;  2ZCE A;  1X4T A;  2HIV A;  2PGG A;  5LXT A;  4AHC A;  2OYQ A;  3RYI B;  4CS3 A;  3S24 A;  2HIX A;  4UCR A;  1M5I A;  3JAS B;  4LF4 H;  3GJX B;  1HNW H;  2OWO A;  1B04 A;  4BWA A;  1J5E B;  3N44 B;  4UCT A;  3HKC A;  4CH4 A;  2UXC H;  3E22 B;  5LP6 B;  2PTM A;  1CKN A;  4JI5 H;  1H2S B;  4DV0 H;  4KL1 A;  4I4T B;  4X64 H;  3BAB A;  4DR3 H;  4JV5 H;  1SA0 A;  3K5M A;  2ZIN A;  5LOV B;  3JAR B;  4UCO A;  3KAL A;  1CKN B;  3J80 W;  2FE3 A;  1HNZ H;  4O4J A;  4JI8 B;  4EB6 A;  4MV9 A;  4YY3 B;  3W5O A;  4GKK H;  3SR2 C;  2IM9 A;  5FD5 A;  5LA6 B;  4CH5 A;  4DR7 B;  5LP6 C;  4CH3 A;  4RAZ A;  1ZHS A;  3JAL A;  2UXB H;  4DR1 B;  3CVZ A;  2QM4 A;  3RWR D;  3RJ0 A;  4UFZ A;  4BWS C;  4B3S B;  1P8L A;  4ZHQ A;  5LXT B;  3KAK A;  1M4U A;  4O2B A;  1HNW B;  4FFB B;  1XHZ A;  4JV5 B;  1FFX A;  3U11 A;  2KKW A;  3K57 A;  1JMK C;  5FLX W;  5EZY A;  1CKM A;  1FJG H;  3QTC A;  5IYZ A;  4DV5 H;  1I94 H;  1FFX B;  4R7R A;  4DV7 H;  3JSL A;  2E3C A;  1FKA H;  4LFA H;  4O2B B;  5CB4 A;  3JAM W;  4O4L B;  3SJA C;  1D5A A;  4DR3 B;  4DR2 H;  3HKB B;  1SA0 B;  3OTO B;  2XIG A;  4YHH H;  3U0Z A;  1A0I A;  5D1O B;  4I4T A;  1I6U A;  2VUG A;  4AQY B;  4YY3 H;  2XHB A;  3RTX A;  4DR5 B;  3T1H B;  1XMQ B;  2YI9 A;  2WYO A;  2YI8 A;  3CB2 A;  3RR5 A;  3KXY T;  4O2A A;  4LF9 B;  4PHZ A;  5LOV A;  3JAS A;  4K8X A;  3BA9 A;  4Q0Y A;  3IG0 A;  4JI5 B;  1Z5V A;  2R70 A;  1TUB B;  4YHH B;  3OTO H;  3JAW B;  4K0K H;  5KHJ A;  1JFF B;  2YXL A;  5D1P A;  4PZ7 A;  4X1K B;  3BRC A;  4JI7 H;  5ITZ A;  3N2G B;  4IHJ A;  3JAK B;  4B3M B;  3T1H H;  4FM0 A;  4GKK B;  4JI2 B;  1BJT A;  1TVK A;  5IJ9 B;  3RF2 A;  4LSA A;  3MAQ A;  4X65 H;  4AQY H;  5JH7 B;  3J7A K;  2F4V B;  4FLT A;  5D1O A;  3VNN A;  4I7H A;  5C8Y B;  3NBY B;  5KHG A;  5FNV A;  4LF6 B;  1QQC A;  4LR3 A;  4TUY A;  2WE6 A;  4B3S H;  4LF9 H;  4TQF A;  1HNX H;  5J2T A;  4CS2 A;  5CA1 A;  4LF7 H;  1Q3E A;  1Q43 A;  2YIA A;  2BTQ A;  1KU9 A;  3QF7 A;  1L8D A;  3RYF B;  4TUY B;  4DRX A;  3N2K B;  1N32 H;  1XK5 A;  2CW8 A;  3K5O A;  3RYI A;  1XNR H;  1NT2 B;  3TY9 A;  5FPO A;  4X1I B;  1IBK B;  4GLX A;  4NXM H;  4JI7 B;  3WB2 A;  2VQE H;  3SJB C;  4FLW A;  5K1P A;  1CKO A;  5LYJ A;  4DR5 H;  5ITZ B;  4LMY A;  1XMQ H;  1P49 A;  5CA0 A;  5FD6 A;  3OTF A;  5LYJ B;  4FLV A;  1TA8 A;  2CAZ C;  3M7M X;  4LF7 B;  4EEQ A;  5KHK A;  3NC0 B;  4I50 A;  2UXC B;  3LNN A;  1N34 B;  4LNU B;  4FM1 A;  1V9P A;  1N32 B;  4FM2 A;  1WN7 A;  1XNR B;  3L2P A;  3E22 A;  5LP6 A;  4O4I B;  4TV9 A;  2BTQ B;  3GB8 B;  5LMU H;  1IBK H;  5JQG A;  1ZAU A;  1HNZ B;  2RQ6 A;  3UT5 B;  4NXN B;  5IWA B;  1IBM H;  3DSQ A;  1S5J A;  4L8J A;  5BMV A;  2HEP A;  4LH7 A;  3N42 B;  4YJ2 B;  4YJ3 A;  4FFB A;  1HR0 B;  3L4K A;  4HNA B;  2UXB B;  2Q7G A;  3JAT A;  2R72 A;  4LH6 A;  4ZIB A;  5FPR A;  4IIJ B;  5K1X A;  4ZOL B;  4E6N A;  1P16 A;  3HKD B;  5J2U B;  1O9H A;  3GDE A;  4DK1 A;  1Z5W A;  1T5E A;  1FJG B;  5LMN B;  4LNU A;  4U3J A;  1BGW A;  4LFA B;  1Q5O A;  3K5N A;  3VQY A;  5BR8 B;  5GON A;  5JJJ B;  3JAR A;  1RSO A;  2E5L H;  5LMU B;  2UUC H;  1GYF A;  2YCH A;  1E4F T;  4JI4 B;  4B3R B;  2HVR A;  1I7F A;  1HW7 A;  3RYC B;  3SJC C;  4JI1 H;  2ZNJ A;  4LF8 H;  3KYH C;  2F1M A;  3DF7 A;  3VQW A;  5J2T B;  3HKE B;  1Q8I A;  3CHX A;  3RYC A;  4B08 A;  3CSX A;  3UQ8 A;  1AN7 A;  4DV2 B;  2Q2U A;  4DUY H;  3FMA A;  4IIJ A;  4Q6G A;  3RYF A;  4DRX B;  5EYP A;  3MWM A;  1N34 H;  3T1Y H;  5JVD B;  4DR4 B;  4X66 H;  3BA8 A;  4EFE A;  4X1Y B;  5LL6 b;  1TVK B;  5IJ9 A;  3HKC B;  3ZED A;  4TOI A;  5BMV B;  3JAK A;  3W1B A;  5LMN H;  4I55 B;  4JI4 H;  1SQG A;  5EOY A;  4BW9 A;  5J2U A;  1XMO B;  4B3R H;  4O4H B;  5KX5 B;  1G6U A;  3N43 B;  4JI1 B;  3WB0 A;  4NXN H;  2E5L B;  4B3M H;  3A2F A;  4ZOL A;  5IJ0 B;  4DR6 H;  1S68 A;  2VQF B;  2O03 A;  3KAJ A;  4DUY B;  2F4V H;  1XQ8 A;  4FLY A;  2Q7H A;  4X62 H;  2HHH B;  2JVD A;  1VS0 A;  2Q7E A;  4J0M A;  4LF6 H;  3RFR A;  4O2A B;  4CC6 A;  3K59 A;  4JI0 B;  4DR4 H;  4CS4 A;  1E4G T;  4JI6 B;  4LSX A;  1HNX B;  5GON B;  2P22 C;  4DV3 H;  2F66 C;  2Q0A A;  5KMG B;  1YEW A;  4JI3 H;  3HXL A;  4F6R B;  2ZJT A;  2UUA H;  5JH7 A;  4DUZ H;  2RGV A;  1XDN A;  4YJ3 B;  4MTD A;  4DK0 A;  5CA0 B;  3HKB A;  4APM A;  4I55 A;  1XMO H;  5CB4 B;  4HBN A;  3N2G A;  3ETQ A;  4IHJ B;  3U10 A;  4RZQ A;  4JYA B;  5KHI A;  4EFB A;  4FLX A;  2MCT A;  5IYZ B;  4RB0 A;  4WBN A;  2RGR A;  2PUS A;  4A2A A;  3LML A;  4DR6 B;  1ZHQ A;  4DV4 B;  5EIB C;  4CH6 A;  1DGS A;  4U3J B;  4DV2 H;  4FVM A;  4FLU A;  2W57 A;  4PI0 A;  4RAY A;  3VQX A;  1XHX A;  2UU9 H;  4KHP H;  3T1Y B;  2ZM6 B;  4DV6 B;  4DV3 B;  1WPB A;  2VOB A;  4JI3 B;  4ZI7 B;  1XNQ H;  2QJ1 A;  3WB1 A;  2UUA B;  2CFM A;  3QG5 A;  1IBM B;  5IWA H;  3JAW A;  2UXD H;  4M7E A;  3HKE A;  3ZS8 C;  2HVQ A;  1JJO A;  3ICX A;  4UCS A;  4RB1 A;  2R9A A;  1HR0 H;  4TV8 B;  4JYA H;  2VQF H;  3HKD A;  3QWU A;  4B3T B;  1QHT A;  4GYC B;  4WBN B;  2HHH H;  5JVD A;  4X64 B;  4O4I A;  4TV9 B;  3C0F B;  2ZIM A;  4KHP B;  4ZHQ B;  4JI6 H;  4EQ5 A;  1M0T A;  2ZIO A;  2EX3 A;  4GKJ B;  4I50 B;  5IJ0 A;  2UU9 B;  1MZB A;  2ZNI A;  3TY5 A;  5BR8 H;  4DV6 H;  4F6R A;  4DUZ B;  4DR7 H;  2F95 B;  2UUC B;  1FVI A;  1XNQ B;  4A2B A;  4PDB A;  3BPZ A;  2PYJ A;  3K58 A;  5DIS C;  1O9G A;  3TY8 A;  4MTE A;  3RGZ A;  4B3T H;  2UXD B;  3THO A;  4LF8 B;  1S03 G;  2CW7 A;  1TUB A;  3W1G A;  1N36 B;  3K3V A;  5EYP B;  4LFC B;  4YJ2 A;  3JAT B;  5IT9 W;  4O4L A;  4FM9 A;  2VPS A;  4HNA A;  3N2K A;  4NVP A;  4DV7 B;  2JGU A;  2PZS A;  4GKJ H;  4X20 A;  4LFB B;  1JFF A;  2WDT A;  4ZI7 A;  3J81 W;  5EZY B;  3EYY A;  3K5L A;  1M93 A;  4AIL C;  1TGO A;  4O4H A;  2YIB D;  5KX5 A;  4X66 B;  2F93 B;  3FFQ A;  2VWK A;  1O75 A;  4X20 B;  1IBL H;  4X1Y A;  2UUB H;  4O4J B;  3N40 P;  4D7T A;  3UT5 A;  5D5P A;  2KSW A;  4LFC H;  5JQG B;  2HVS A;  4I9Q A;  4IAJ A;  3RYH A;  1Z2N X;  2Q2T A;  3PN1 A;  5CA1 B;  2BTO A;  5LA6 A;  4ETS A;  5A2Q W;  4X62 B;  4DV0 B;  3RYH B;  3RGX A;  2V4D A;  1SQF A;  1XI1 A;  5FNV B;  4JI0 H;  4K8Z A;  4PZ8 A;  1M0W A;  1TAE A;  4PI2 A;  4K0K B;  4OX9 H;  2PYL A;  4X1I A;  1X9N A;  2JS5 A;  1N33 H;  4UCU A;  3NBZ B;  3IAY A;  4DV1 H;  4CC5 A;  1Z2P X;  3L4J A;  4MV7 A;  4JI2 H;  5KHH A;  4X65 B;  4X1K A;  5EIB D;  4LF5 B;  1KMI Z;  3H20 A;  4DR1 H;  4TV8 A;  4LF4 B;  1IBL B;  2UUB B;  3RGB A;  3JSN A;  2PY5 A;  1VF7 A;  1WH2 A;  4FLZ A;  5D5Q A;  1J5E H;  3N41 B;  3F8N A;  4TQD A;  5JJN B;  3JAL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...