5FPRA

Structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 104
structure length 307
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fprA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fprA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fprA02
4DR7B 3TY8A 2E5LB 4UCOA 4DUYB 4DV2B 4KHPB 4DV5B 5D1PA 4JI2B 3NBZB 1XNQB 4DR6B 1XMOB 3RTXA 1IBKB 4EEQA 4X62B 4PZ6A 4TOIA 4DV4B 2HHHB 4B3MB 4LF5B 3NBYB 4JI3B 4X64B 1XDNA 5LMUB 4DV3B 1VS0A 4LF9B 3W5OA 1XMQB 1XNRB 4GKJB 4EFBA 4GKKB 1I94B 3W1BA 2HVRA 4LF6B 2HIXA 5LMNB 1P16A 3GDEA 3T1HB 2VQEB 4DV1B 4E6NA 4LFAB 4X66B 1TAEA 3BA9A 4NXMB 1N36B 2UXDB 3OTOB 4JI4B 1N32B 4DRFA 1CKMA 4DR2B 4LFCB 4EFEA 2CFMA 4JI6B 3JSNA 4B3RB 3TY9A 1HNZB 5IWAB 4DV6B 2UUCB 5D1OA 1HR0B 2VUGA 4X65B 4UCRA 2VQFB 2F4VB 3BAAA 4DR4B 4CC6A 4DR5B 4JI8B 5FPRA 2UXBB 4LF7B 5FPOA 4OX9B 2Q2UA 3PN1A 1N33B 3GJXB 3BA8A 3GB8B 1IBLB 4CC5A 4K0KB 1A0IA 3W1GA 2HIVA 3L2PA 4JV5B 4EQ5A 4DR1B 3SGIA 1HNXB 4DV0B 2UUBB 2UXCB 4UCVA 4LFBB 5D1OB 4NXNB 4DV7B 4PZ7A 2OWOA 1HNWB 2UU9B 3BABA 4JI5B 1FJGB 4YHHB 3VNNA 4LH6A 4LH7A 1XK5A 4JI1B 4AQYB 4PZ8A 3RR5A 1TA8A 5BR8B 3T1YB 1IBMB 2UUAB 1FVIA 3QWUA 3UQ8A 4DR3B 4B3SB 1N34B 4UCSA 1X9NA 2Q2TA 4LF8B 4UCUA 1CKNB 1CKNA 1DGSA 4JI0B 4GLXA 4YY3B 4JYAB 4B3TB 4JI7B 3KYHC 3TY5A 2HVSA 1V9PA 3S24A 1B04A 4DUZB 5DISC 2ZM6B 1P8LA 4UFZA 1J5EB 1CKOA 4LF4B 1ZAUA 4UCTA 3JSLA 2HVQA 3NC0B 1S68A
chains in the Genus database with same CATH superfamily
1GSOA 1KJ9A 4JI0O 3KHLA 4WHXA 2DYSB 4DUYB 1AJPA 3AEIA 1IBMO 4KHPB 1UNNC 1UC8A 4AYBA 1PV0A 2VRZA 1N34O 4MV1A 5EWFA 1OJHA 5JH7B 1WB8A 4X62B 2ZD9A 3OSPA 1SQFA 4EYIB 4FM1A 1E1QG 3ABKB 3QO8A 4DUYH 4ICGA 5KT6A 1FFXA 2WLIB 2UUCO 2W6IG 1Q43A 2AGAA 3JD4A 4YJ2B 4X66O 3UM7A 1N36O 5IT9N 3IG0A 1TVKB 5L1KA 4PELA 2VWJA 4C5AA 1T94A 4FFBB 3T9EA 4PWQA 4PD4F 4W4LA 5FNVA 3CWBH 5KT2A 2R7NA 2YZGA 4X65O 2PY5A 3RWRD 4ED1A 1AUXA 2VQEB 4MA0A 1AJNA 3TETA 1KBHA 2C28A 4UUJC 4DRFA 5EZYF 4WBNA 2Q8VA 4JZGA 3E35A 4UUGA 5DECA 4I5SA 3K5HA 2CNUA 3R9RA 1K97A 4DQNA 3CRMA 4FLZA 2VUGA 1QLEC 2HJWA 4DV1O 4YR0A 2PUSA 1AVMA 1V55C 1VEWA 3D36A 4EBCA 1SFOA 5L1JA 1N0NA 4MA5A 2DYRB 5L9XA 5DGAA 2C00A 4FZ0A 3TINA 2UU9O 1A3GA 4CC5A 1J95A 2EJ0A 5LMNH 2QWOB 2GLTA 2EJ2A 2BSKB 1MOFA 3FKSG 4GLWA 4RCNA 5IYBG 2QR4A 2YZNA 3JZIA 3ZMSA 1JFFA 3H1JH 1Z2GA 4N21A 5DGHA 3L71H 4QWAA 3H20A 1S72V 4FM9A 1TWFA 3APOA 2UUAO 3R23A 2OWOA 1RJRA 2Z02A 3SNOA 3RYFA 2M7WA 1Q82W 3PW4A 2ASJA 2E5LH 5LXTF 1T5EA 2NU9B 2DE0X 2X6CA 1EUDB 2DABA 4WFGA 3AG1C 3TIIA 1HNZH 3CRAA 4LH7A 2CTQA 2GUZA 3RR5A 1AI5A 4P2ZA 1NVPD 4JXUA 1FXKC 4UCSA 4FFRA 2ZJTA 5KMGB 2XAFA 3MR5A 3BQ2A 4NB5A 4F6RA 2D3OW 1OV9A 1IOWA 1NTKH 1SS3A 2DJVA 3SDLA 5KHIA 2Y4UA 1KMIZ 2W9BA 5LGUA 4EGJA 1W93A 4U7OA 4MVQA 2Q68A 4LF8H 2DQ0A 3C3TA 3ETHA 1TUEB 4X8AA 1S5LZ 1S03G 4WFHA 4JF3A 2RMKB 5KFZA 1EZVH 3CCSV 2DZDA 3HOUG 5KUMA 4FFMA 3HBLA 3D3IA 1IBKH 3ZN0A 1V54C 1XMOB 2YC0A 1PX2A 4E4EA 1VF7A 2Z04A 2XUMA 4PZ6A 4MV3A 4KXRA 2FP4B 2VS0A 5LMUH 1HP8A 4JI3B 3WO1A 1XBLA 4LR3A 2CW7A 3STLC 2P22C 4KUMA 4MVRA 2QA4V 3DTFA 1VS0A 2P5OA 3PR4A 4DR7H 1ZHQA 2UXNA 3FB7C 5B1BB 4LMYA 3AG4C 1SQXH 1L1FA 3CCVV 4Q44A 5GW7A 1EHIA 3HT5A 4U7NA 3HKBA 5D5QA 1GKFA 4DUYO 1TWGA 3K9AA 5JWPA 4LFAB 3ASOB 4EKWA 1N32B 5BWXA 4J7KA 2Y69B 2UVVA 2W9CB 2R7LA 1IBMH 1M0TA 4WCEV 3ZJZA 3UFXB 2W8LA 4J42A 4JI0H 2W9BB 3V6KA 4J9LA 1E4EA 2CH7A 3H01A 4RB2C 1XL4A 3HOVG 5KFIA 4M0JA 3ZMUA 1IOVA 1BT8A 1MSDA 5FJ8G 5KFTA 4MV4A 5ITZB 3ZIAG 3CJHA 1YHQV 2EZPA 3JD2A 2ABJA 3RFCA 4RWUA 1Q5OA 4LNUB 4FE2A 2Y0SA 1B06A 1LUWA 5I5VA 2UXCH 1M9NA 3A0RA 1VBHA 2HVJC 1MZFA 4BY7G 1O9HA 2XAHA 4CS3A 1COWG 4X20B 1UC9A 5LHGA 3EPGA 4JI8H 1EBOA 3CB2A 4A2AA 2QTOA 3K79A 2RDJA 3T4DA 4MVOA 3CEBA 2WLLB 3E8BA 2GHYA 3BHPA 2HHFA 4JV5O 2B63A 1RSOA 2Q7HA 3A0BZ 1M93A 5L3GA 5BMVF 5B66Z 3KXYT 3VNNA 2Q7EA 4O4IB 3QO7A 2ZNIA 1TA8A 1B6SA 3QWUA 2V4RA 4NZOA 1I7LA 2Y0PA 2Q2TA 2JS5A 3T1HH 3ZEDA 3JATA 2ILMA 3TY5A 5KFWA 2CDYA 4DUZB 3L4JA 5DISC 1A0GA 3CVZA 1A9XA 4D7SA 5IDJA 3G6EV 1C3OA 1ZAUA 2P7TC 2J9GA 2HVQA 1I2KA 5KG7A 2FE3A 2JA7G 1R9TA 2OIEA 4LF8O 2IA6A 3TY8A 2EULA 4LFBH 4IIJB 1BHBA 1AJQA 2NR5A 3ZRSA 5CB4B 1RK5A 4ECVA 2Q0OC 2LO1A 1H2KA 2QWPB 4I4TB 1YZBA 3ZRVA 4A3DG 3O9OA 2HHHB 1H8HG 4A3BG 2EJ7A 2UXXA 4RB1A 2W8KA 2QK4A 1R6KA 2BCCH 4ED7A 3K3WA 1FFXB 2WLIA 3UCSC 2DIKA 3MD0A 1XMQB 3M4IA 4U6PA 3T7AA 2R8JA 3ZHTA 2RJZA 2BQ3A 1P4RA 1N36H 1GN2A 4X89A 1P16A 2R92A 1N8RW 2XTAA 3CE2A 3K0GA 3HKEA 1OZ0A 1UPGA 5JCOA 5ITZA 2QE7G 5E25A 1I94O 5BPFA 2WB1A 3Q4HB 1I50A 1JMKC 2CH7B 4YR3A 3T2MA 3VOUA 2J6TA 4MT8A 2BSKA 5J2TA 4DR6H 2BOBC 2CGNA 1M57B 5LHIA 3U0ZA 2DWEC 3CCQV 1KEEA 1N33B 3GIDA 4DV4H 4B3MH 5FL7G 4L87A 4I0XB 4DV6O 4Q45A 4LF9H 2E74B 2X6BA 3HOYG 4RUEA 3DGEA 1JDBB 1DF4A 2YICA 4Z2WA 2QTSA 1OCOC 3I5DA 1DLBA 3QVNA 4RNNA 3ML0A 3BABA 5BWWA 3RB3A 5KFGA 4I9QA 2DPIA 1K7DA 3UZBA 1GN4A 1IDSA 1WA8B 1EZJA 1WPBA 3OMNB 4J9NA 2AGOA 4LH6A 4QW8A 3WWHA 2FK3A 4J9OA 5KG5A 4B3SH 3HKDB 1RM1B 3H0GG 2EINC 1JVMA 2C2EA 1SETA 4FFLA 3L70H 4AQYH 2E5LO 5B5EZ 1EN4A 4PJ0Z 2GSMB 2ODTX 1N34H 3TW7A 3OAAG 4J9QA 4GC7A 4GX2A 1B04A 2ZM6B 1FXVA 2PBZA 1VP7A 3S3XA 1ZL8A 2QKSA 1GK9A 2LQTA 1KKDA 3M9OB 3FFQA 4O4LF 5CBFA 1H2MA 3W7WA 1HNWH 2Q5ZA 4DV2H 5FD5A 4JYCA 4JI4O 4EEQA 4YY3O 4NTXA 4DL4A 2RNBA 3H0GA 2NU7B 2GV9A 4DUZO 4AHCA 2QJ1A 3HB9A 3WNZA 2F43G 1BJTA 1KBLA 5KFVA 4DL5A 3GTJA 1PL0A 5D5PA 2IU0A 1Y1VG 4Z1MG 2W7OA 4QIWA 3L4KA 4MW8A 2IU3A 5IYZB 2EJ3A 4K6NA 5J2UF 1M1KW 2KSDA 1RPOA 2YIDA 4FFOA 1L0NH 3PVXA 1WCMG 4J9PA 2Q7DA 2R8KA 3K04A 1WLEA 4W4KA 1W59A 3R66A 4GKJO 3K06A 2HHHO 4IHJF 1FS0G 4ZI7F 1XNRH 4HNUA 1WAZA 4O3RA 3JSNA 4JTDB 5KHGA 3TY9A 4J7ZA 3I4NG 1CPYA 3LDEA 4FS2A 1I08A 1Q3EA 1S3JA 2W6PA 1WCMA 3BAAA 1TGOA 4RUCA 2AXTZ 2YS8A 4DLKA 4LSAA 1JJOA 2LGQA 4WBNB 1EKFA 3T9CA 1KT8A 5C44G 5JUMA 2G38A 5EYPB 3CXHF 1R3JC 2YIAA 3E86A 1G1XB 4BBRG 5EWGA 3T1HO 2NU6B 3EVKA 3AYHB 3W1GA 2GDSA 2HIVA 3UKMA 3E2EA 3JAMN 3PW5A 4TWKA 3VOTA 4DR4O 1OHHG 4B3RO 2OIGA 4IGGA 2RGVA 4O4HF 2Y69C 3ABTA 2ZDHA 2R70A 5DN6G 5LL6Y 1VBGA 4MVSA 4JV5H 3UT5B 4FGRA 5H5NA 3JASA 3CEIA 1I1MA 2FMLA 2R7MA 2ZCEA 3LNMB 4R7RA 1S97A 3N40P 2QM8A 2YYAA 1P49A 2RN9A 3C90A 3T1YB 1E4GT 5H9CA 1CKNB 1CKNA 4GCZA 3SYOA 4DV4O 4B3MO 3RAQA 4WFAV 3W7UA 4NXNH 3G71V 1NJIW 3CRCA 3G8CA 4UCTA 2AHZA 2FPPB 3NC0B 3BCCH 4O86A 2ITCC 4PA9A 1NH2B 1S68A 4QWEA 4QJFB 3OGCC 4QPJA 4B7EA 4ECUA 2ZR3A 4IT5A 4YIOA 4HNAB 3MWMA 4YXWG 1XI1A 3ETEA 4IWXA 2ETNA 4O4LB 5KAFZ 4LFCO 5CB4A 3OM3B 3KAKA 2FK2A 4X64B 2C2DA 4ZHQA 4JAVA 4RB3C 5H2FZ 5JVDB 2W0FC 1I0HA 1HNXH 4JYAH 5C8YF 2HG8A 4R7CA 3ABKC 4LF7O 2XASA 4PDRA 3MAQA 1M56B 1K5QA 2HLDG 1R3KC 1R1BA 3SPHA 1XILA 1ZHSA 1IXBA 3FX7A 3FMAA 3GIKA 3GV5B 4RNMA 2CTRA 4BIZA 4JI4B 2RDIA 3GIJA 5BPHA 2KKWA 2QB5A 2PYLA 2D2CB 1HW7A 3TXSA 4LFBO 5GONF 3L9DA 4CZZA 3P30A 4UCRA 1Y14B 1GTOA 2XCAA 2IJHA 5BY1A 4BBSG 2UXCO 3K3VA 1ULZA 1XOUA 5HFLA 2NN4A 3ZCCA 3B2EE 5FNVF 4JI4H 5KFRA 1SA0B 5LXTA 5LOVA 1P84F 4MTDA 4U3FH 5IWAO 4JUZA 3X2QC 5CBHA 3E8GA 2UUBH 1ENVA 3ASOC 3L2PA 4DXWA 5KFJA 4DR1B 2ODMA 1HNXB 3ABMB 3G6BA 4FFKA 2VOBA 2GPSA 1U96A 4CH5A 4GX5A 5BWRA 1ZL8B 3RB6A 5GTIZ 2HGSA 2EJRA 3QG5A 4GX1A 2XHBA 3VPBA 2ZM6H 3V6HA 4JI6H 4C7UA 3J80N 2WWWA 5EC1C 2ZKOA 1GLVA 4O4JA 1KJIA 1QU7A 1BXRA 5KFKA 4AQYB 2LFSA 4ECTA 2OTLV 3PR5B 1WP8A 1VQ4V 1HWYA 3UQ8A 4B3SB 2XGPA 3ZMVA 5KHKA 2FPGB 5DM6V 4D6TH 4DR7O 2R7ZG 3NGDA 1BMFG 1TWCA 4B3TB 2P90A 2WAQE 2HVSA 3H3VH 4BW5A 5H80A 1YF2A 5IYCO 2PYJA 4O7ZA 1R6TA 4EB6A 1NU1H 2IJIA 1MABG 2CW8A 1FJGO 4I0XA 3VMMA 3E83A 2XAGA 3NXSA 4LF9O 4TVIA 4JI7O 2ZDGA 4YQWA 4OX9H 1AP5A 3CCLV 5J2TB 3LNNA 3Q1KA 3ZMZA 3DAAA 3T54A 3JZFA 4ZIBA 2A06H 4NYKA 4DV4B 4B3MB 5KFSA 3GTMA 3NBYB 3VPDA 1XDNA 3QFFA 1YVWA 3CC2V 3RW0A 3JD0A 3H40A 3ZRXA 1N48A 4E4TA 4X1YB 1N56A 4RUFA 4DR2O 4GKKB 5FD6A 2W9AA 4A3MG 2X7RB 3ETGA 4ED0A 4YAKB 2I80A 2F4VH 4KHPO 2ARHA 2WAQA 5L3EA 4ME6A 3JASB 1VQKV 3Q2OA 1E79G 3CD6V 3UT5A 1N4CA 4X62O 2ZE7A 3H1LH 4O2BF 1NBMG 4QNHB 2YUAA 4JI6B 5KFOA 2AZ0A 4DK0A 4A2BA 2JEIA 2JS3A 3APQA 4O7NA 2UUCB 3LSQA 1MG1A 1DV2A 2HGXA 4F4YA 5BWTA 1T3NA 2HFEC 4DV0O 2UUBO 3ORQA 5FR9A 4TV8F 2FK1A 4PA4A 3I12A 4U7CA 2Q2UA 3MHSC 3RYHA 2PN1A 3PZPA 4F4XA 5DLFA 2J6UA 2VA2A 2MCTA 4RZRA 5DGBA 4X1IB 4A3FG 4F50A 4O7SA 3WU2Z 1K4DC 4LFBB 4K3AA 2R85A 1F51A 3RIZA 4IRDA 1EUCB 4YJ3F 3T9AA 5CA0A 4DR3O 4QWDA 5CA1A 1Q7YW 1I2LA 4Q6GA 2UUAH 4XDKA 4DL3A 5KX5A 1ROPA 1I3QA 1XK5A 5KG1A 1KC8W 5EIBD 2VUMA 3KCYA 3M99B 2PGGA 3EFFK 5LL6b 3AG7A 2RGRA 4GLXA 4JYAB 4IAJA 4TQSA 4XZ3B 4A3JG 2HHFB 1SYXB 1DK1A 1CKOA 4LF4B 5B3SB 4FLXA 3AG3B 5GTHZ 3MWDA 4HNTA 2VWKA 5HV6A 4UCOA 2DQ3A 2WLLA 1WP7A 2ZE8A 3ZN1A 3TEKA 1DV1A 3K3PA 3CCUV 1SQVH 3ABUA 4H13B 4GKKH 4R6ZA 1XNQB 4OGQB 2CKZB 4H0LB 4M9UA 2IH3C 4PDLA 1NKDA 2F93B 4X65H 4CKBA 3RBZA 2VQDA 1SQBH 4UB6Z 5LP6B 1RYRA 4HYKA 5J2TF 2EIJC 3P3NA 5KFHA 4UB8Z 4NKGB 1Q86W 1MMMA 1PD3A 3JRWA 2VQFO 5I5XA 4ASUG 4MW3A 2F66C 1G8MA 3BFRA 3W1BA 1JJ2U 1GM7A 3V4SA 2BTQA 4I9WA 2HVRA 2R8HA 4OPAA 2UXBO 4HYOA 3H1IH 1S10A 1TUBA 4ZI7B 3KCXA 1Q8IA 4AILC 2JGDB 4L1KA 1Y66A 5KKNB 2F1MA 4LFAH 5GONA 2LGWA 2MW2B 4I7ZB 2VPSA 4YBZB 2W9CA 1SQPH 4DRXB 4ECYA 4CH3A 3I56V 1BGYH 1YCIA 2NVXA 4X65B 2YW2A 4PBCA 4O2BB 2HDKA 2COIA 4MSWC 1YXBA 3HKCB 2CZGA 5F9LA 3EPIA 1K4CC 2GBOA 1PL4A 2Q69A 4HBNA 5F2VO 4JI3H 1VMGA 4YHHO 3THOA 3GTQA 3N44B 2H94A 1VQ7V 2QEXV 1ZLZA 5FLXN 5IP7G 4ECSA 5LA6F 4ZKIA 3W7TA 1VQMV 5EIBC 4JI6O 2WPDG 4UCVA 4JTAB 4M7EA 2E76B 4MTXA 3T9FA 2XD4A 2UVUA 2W6QA 2FB9A 5BYBA 3HKZE 1MZBA 3RB4A 3ZX6A 4Q4DA 4LP8A 4RUAA 1DIKA 4MTGA 2X5RA 4TUYF 1B33N 5DG8A 2YU9A 2RF4A 3JAWB 3KHHA 2ZGIA 4CHIA 2C2RA 5LYJF 4HR7A 5JQGB 2UUAB 4X88A 4RAIA 5LP6C 4LBEC 1FD9A 3CMAV 2OCCC 1FVIA 2GQRA 3T5JA 4EBDA 2PVPA 2WLJA 4JI5O 3R5XA 4GC6A 4MTFA 3IC7A 1XMOO 4IRKA 4JV2A 4MAMA 2IH1C 4LCUC 4BWSC 3W7SA 4EGQA 1GAXA 5JH7F 1GSAA 1AR4A 2XNDG 1SKVA 3CRQA 4DV2B 3K5NA 2XOKG 5CA1F 2EX3A 2ZQMA 4JI2B 1GO3F 3DF7A 5KFUA 3DSQA 4YJ2F 3RGZA 2CNQA 4O7YA 1KJQA 1PNKA 4A3GG 4UVAA 4TOIA 1OCRC 4FIPC 1UFIA 4O2AA 4JYAO 3OHBA 3GTOA 4PA6A 5KFNA 3H4BA 3E8HA 2V4DA 1CQJB 2XCLA 2Y0SE 3M7MX 2Q67A 3W5OA 3H1HH 3G8DA 3MFIA 3V6JA 4GUNA 4EFBA 1M56C 2A1HA 1UJWB 3MR2A 3RFRA 1RYSA 4OPHA 2YXYA 1G2WA 3F7YC 1Q90D 3HB3B 4F4WA 3FAVA 3I55V 4XYLB 2ATKC 4CH6A 3JATB 1BS3A 1IX9A 1H8EG 3WWIA 2ALZA 2JGUA 4MTOA 1GM8A 4IR1A 5FNVB 3F5WC 3G67A 2F95B 5FLXW 2NUAB 1GN6A 1ZTEA 5IY5B 2UXDO 3CYOA 2W70A 2FPIB 1N32O 2X0SA 3CCMV 3O65A 2B1IA 4OX9B 2BTOA 2O57A 1NT2B 2I87A 2R7KA 4O4JB 3RT3C 1QR9A 1N33H 1BZKA 4JV5B 2HEPA 5LXTB 5JH7A 5KFLA 2E3CA 5IP9G 2QDOA 4O84A 3BEHA 4NVPA 1ZSPA 5L1LA 3GWOA 5LP6A 1Q81W 1URFA 2BOCC 1CXZB 1I7NA 4MV6A 2JEGA 3LDCA 2CNVA 3TQ1A 4DR4H 2CGOA 5EBWC 4RQEA 1P7BA 1FYJA 3TQTA 2DPJA 1N33O 3TK1A 2AU0A 1I1KA 1M6VA 5T14A 5BWUA 5BR8B 2WB1E 5K1XA 2OYQA 5DQIA 5DG9A 5DAAA 3MWEA 4LF8B 3HXLA 1BE3H 4CMFA 3L75H 1BNCA 5IYCG 4MV8A 1M4UA 4KFMA 5C8YA 4JGSA 4ZOLA 2ZNJA 1A48A 1KC7A 1XMQH 2QSAA 3ZHUA 3FAVB 2IMWP 4PDBA 3E22A 4A3EG 1NTMH 3U11A 4DR1H 1AI7A 2HHHH 3GIIA 2IBZH 4TUYA 3A2FA 3LDDA 2DOSA 5I47A 2W7PA 4J9RA 1O9GA 5CA0B 2YL2A 3HOZG 1Y1WA 2B5UA 1L0LH 4R8UA 4Q8FA 2JA5G 3ABMC 2GQSA 5K3WA 1ZETA 3B8NA 5CA1B 5LHHA 4RNOA 2JEUA 4UVCA 1JR9A 3T9BA 5KAIZ 5A9GA 3GIPA 1YSCA 1JCHA 1I94B 2Q0AA 3B4SA 2KB1A 3RGXA 4A3CG 3ICXA 5KHJA 1WH2A 5LMNB 2AGQA 5B3SC 1SQQH 1ET0A 3D8CA 3IJ4A 4NYEA 3RYHB 2PI5A 1FAFA 4U3JA 3RV3A 1JPXA 1THZA 1I7FA 2JDIG 5BR8H 1QLNA 3T5HA 5KMGA 4TV8B 4WFFA 3UZOA 3BPZA 2DW4A 2GUZB 2ZXWB 4C5BA 2F4VB 2NVYA 2EIKB 3K5IA 3R5FA 5C4XG 3BVOA 4IHJB 3CPWU 1JKJB 3T5LA 4JI8B 3PO2G 1VKZA 2EIJB 5DQGA 1I1LA 4ZHQF 5CMUA 3D36C 4YR2A 2ZINA 2GPWA 3N6RA 2FLNA 1RJQA 4APMA 4LF5H 2I8CA 1SESA 2ZXWC 4WD3A 4YJ3B 4LWSA 2R84A 4EQ5A 3AK1A 3H9VA 1EKVA 2ZT9B 3SGIA 4O7LA 5KLVH 3K5OA 4YP3A 4BWAA 3RF2A 4H37A 4NXNB 1YTFB 2Y0IA 4QGPA 1I5YA 5I5TA 3HOWG 1EN5A 2NNUA 4O4IF 5CBGA 3CHXA 3IGAC 3OTFA 5IYDG 2MK3A 3JARB 1VARA 4CE5A 3CP1A 2V4QA 3WFVA 3G80A 4DV5O 2RQ6A 2PMZA 4PDVA 5KX5F 4I50B 4EB6B 5F9NA 1NZ6A 3ZHQA 1JXLA 5EZYA 1SERA 5LMUO 3PJSK 1T36A 2W57A 2R9IA 4LSXA 2PZSA 4E2LA 3GB7C 4LWSB 1IBKO 3CCRV 4CS4A 5KT5A 1YDXA 5KFYA 1KJJA 3OEHG 1U97A 3J7AK 1D2DA 5I5WA 2JJ2G 1XMOH 4Y8VB 3ETQA 3RYIB 5JCOC 3AW8A 1TVKA 3DTGA 5LP6F 4RZQA 5DLGA 3T1YO 5L3DA 2ZM6O 3NBZB 2N05A 3ETJA 3B40A 3B77A 4DYLA 2OTJV 1DAAA 5KT7A 3KZIZ 4O4HA 1S0OA 3K57A 4JI2H 4XBFA 3MDSA 1VQ8V 1Z2PX 4P9PA 1F4NA 3OD4A 4HAMA 1K34A 4QW9A 4WF9V 1XNRB 3QTCA 4GKJB 4IZOA 1QVFU 3B09A 3BQ1A 4ECZA 1SA0A 4O3OA 4FMTA 4G2KA 3RVYA 4TQRA 5B1NA 4TQFA 3JRXA 4AYBE 2PMZE 4EEYA 1HNZO 3Q8PB 2KQXA 1GRJA 1YTFD 3GIMA 3G6YA 1AILA 3MR3A 3OUSA 1R3LC 4B08A 1MA1A 1OCCB 3WB0A 3K03A 4TSFG 4LFCB 3LP8A 4FK5C 3TGUH 4GT1A 3K58A 3CC4V 3OUFA 3AK2A 2YXHA 4XDLA 2NU8B 4ED6A 3VQYA 1S5HC 2ZDIC 3AK3A 4DV7O 5C3EG 2V9WA 4QWBA 5CAEB 5EZYB 4ECQA 4JAAA 2QM7A 1G4YB 3LSUA 1E1RG 3S3WA 4RAYA 3OTOH 4LF7B 5IE9A 2DLNA 5J2UA 5JVLA 2B1GA 4O3QA 2WLKA 5CR5A 5IYBO 1K33A 5E79Z 1ORQC 5KA6A 3JARA 1F7YA 5JVDA 3ASNB 3UO3A 1BHAA 2W71A 4Q4CA 5KFBA 4ZHQB 1VQNV 5EBMC 2R82A 1W0JG 4DR5O 1XL6A 5IJ9B 1KU9A 4NR1A 2OCHA 4FLWA 3CCJV 2Z0AA 4HNAA 5KS8A 3FD9A 4O81A 3PO3G 3SYAA 3L73H 3SYCA 2V59A 5KT4A 4QJFA 1KJ8A 1AR1B 3RB0A 5LGNA 2R93G 2VUMG 4O4LA 3ORRA 4ECWA 2RCVA 3LWBA 4CH4A 1JDEA 3SJBC 2L35A 3OMAB 2SCUB 5LYJA 4DW1A 3GIQA 4DR1O 2QGNA 3HKEB 2ADQB 4JI0B 4LF5O 1WB7A 3KYHC 3M9NB 1GSHA 1V9PA 1LNQA 3T1YH 5JJNB 3J81W 2GTSA 2HR3A 1W0KG 2HGWA 2P4KA 1KP2A 1N32H 1P7GA 3FDSA 1JX9A 4OXSA 4J41A 4HN2A 4ECXA 4X64O 5L1IA 2R9AA 2GTAA 1SZXA 1CEZA 3HR0A 1IVSA 3TXQA 2JVDA 4X1YA 2A79B 4TV9F 3VA7A 3CRRA 4DV5B 3BJYA 1AB3A 1K5SA 2LJ2A 4A3LG 4J7JA 3CX5F 4DR6B 1AUVA 3OTOO 2YCHA 5LOVF 1JQ0A 5KFXA 2AQ4A 1XNQH 2P4VA 1QBZA 1ZWIC 2ZDIA 3N2GB 3DC5A 4O2AF 3FB6C 5LMUB 2VQEO 1FXKB 1TWAA 1HR0O 4I50A 1H38A 3ZRWB 1GGOA 3AG2C 1K9MW 4LF4H 1L8DA 4O7VA 1JLLB 4J0MA 1EZ1A 4CS2A 1JX4A 2HJDA 3QF7A 2BQRA 4DV1B 1OBGA 1KECA 3BA9A 3SPGA 4X66B 1N36B 4K0KO 2VPQA 2YEVA 1S9FA 1V4YA 4I7HA 2UXDH 2IJJA 2DYSC 3SJCC 4UV9A 4CMDA 1FJGH 4NLGA 1OCOB 3RVZA 4J11A 3RJ0A 4BXXG 1D5NA 4DK1A 5IWAB 2N74A 5D1OA 2Q4PA 5KG3A 1XUQA 2R86A 3KTMA 5IYDO 1OBDA 4O4JF 3CSWA 4PA7A 3CCEV 2Z5UA 2J6SA 5IYZA 1Z2NX 3ZS8C 1S76D 1V55B 4DV7H 3TIGA 2R7ZA 1A0IA 2LW1A 1FFTB 3RAXA 1BQ0A 1X4TA 1YITV 3KREA 4R8CA 1LR1A 1Y76A 4LNUA 2W6OA 1OWTA 4YB8B 4EBEA 2QKCA 4FLUA 1NVPB 2YS6A 3K9SA 4ETSA 4DV7B 2QWRB 3K5LA 1M0WA 5K1PA 3F5TA 3OGIB 1AR5A 2ADPA 1RM1C 1HNWB 4CKCA 2UU9B 4EYHB 2BQUA 3K0DA 4TV9A 3W7XA 1J5EO 5FLMG 4PI2A 3H1KH 5C5JA 2IBKA 5KFMA 1HDJA 2B9ZA 4B3TO 4ZBMA 1E4EB 4CKEA 3BACA 2P67A 2R87A 1D5AA 1B6RA 3Q8SB 4DR2H 1CQIB 3R5HA 4RB0A 4C2MA 5EK0A 5I5UA 5DG7A 1N34B 3DTUB 1OCZB 1X9NA 1X59A 5DGIA 1DGSA 1PNMA 1BCCH 2EIMC 4JI7B 3HKZA 4DV1H 1SRYA 3HKDA 4JPRA 2JA7A 1PM9A 1CP9A 5H6RA 4AQYO 4I55B 3E89A 1WN7A 3SJQC 2R8IA 3H4DA 1S77D 2P6JA 3WG7C 2EIMB 1KQSU 2W6NA 1PPJH 1MNGA 3E22B 1MSWD 2FKLA 4NZNA 3IAYA 5DMXA 4QPKA 4IIJF 2JA8G 5DEDA 5C8YB 2CTWA 5C1PA 1V54B 3RBDA 4JTCB 3VQVA 4LF9B 2DWCA 4LF4O 3SYQA 3FB8C 5KG2A 3QNEA 4O2AB 3GWKC 3OHAA 3KHGA 2O03A 2RDCA 4LF6B 2H3OA 2HIXA 4QE7A 5CM0A 3WWJA 3N41B 1TUBB 4F6RB 4ZI7A 3ZMTA 3GQCA 4B3TH 4PV1B 5DQHA 4FFPA 2K9PA 4RO2A 1TAEA 2JIZG 4X9QA 1AI6A 1XNQO 1J5EH 2QM4A 4UVBA 2CUGA 5IT9W 4IYHA 3BG5A 1Z5VA 4GKKO 2YIBA 3N43B 3ZHRA 4IHJA 2F23A 3LULA 2WTFA 4C5CA 3ZBHA 2AGPA 4IR9A 1BL8A 2VQFB 4TT3G 3SPJA 3KHRA 3T5KA 3SPCA 4LFAO 1NH2D 5KFPA 3AG1B 3ABLB 3CSXA 2KG7B 2UXBB 4BAYA 3B8MA 5B1BC 2WYOA 1RFYA 3E8FA 3Q8QB 3C3SA 4A5UB 1EKPA 3I4MG 3GTKA 4O82A 2YS7A 3U9SA 2VA3A 4IRCA 3IC9A 4JI1O 4K0KB 3U10A 4CBCA 1BQZA 3DXRA 2IJKA 3J80W 3N27A 4DV0B 2C22A 2UUBB 1YJNV 4IIJA 4I4TA 5B1AC 4QSHA 3AG3C 1K3EA 3JCUZ 1KTAA 2YSUB 1SC5B 1RJPA 1WR2A 2JEXA 5KFEA 3RUPA 4FM2A 3OFNG 1QHTA 2FYUH 2WLHA 3WG7B 2ZIOA 4DAAA 4LF7H 2DWDC 2W0XA 3VBBA 1VQLV 4Q8EA 4B3RH 2YI8A 1K1SA 4A93G 2DYRC 3LQSA 4FPPA 4R8UB 1K92A 5KX5B 3Q8RB 1DTOA 4YHHB 1EM1A 3JCZA 4DR5H 4PZ8A 2COJA 1EFRG 4ABMA 1M5IA 4TUYB 2X0LA 2V7QG 4UCUA 1HR0H 2VR1A 3OSNA 1K83A 4JI3O 1K8AW 5EWEA 3S24A 1BSMA 5BWVA 1XHZA 4O4IA 4MVMA 3IFXA 5JJJB 3ZRWA 2FMAA 3GILA 3JSLA 4J9SA 1AROP 4GKJH 5A2QW 4JI1H 3K59A 1PK8A 1WPXA 1XMQO 2A3QA 1IYEA 4I55F 4X64H 2YZMA 3DXRB 1YJWV 2LFRA 4FBUA 4JI5H 1NR7A 3U9TA 3IN5A 1RSOB 3RTXA 4FFBA 1Y1WG 4DV3H 1DF5A 2OCCB 1GH6A 5LGTA 3CXCU 2UXBH 2FB5A 4YJ2A 3GTGA 2C2AA 2ITDC 2FLPA 1KYOF 2R6FA 4UV8A 1L2ZA 4XYMB 5JQGA 2C35B 1XHXA 3T9DA 4DW0A 3GTPA 2M05A 2FLLA 3JAWA 1MZEA 2VQEH 4G28B 4F6EA 4BR6A 3GDEA 5EOYA 4DV2O 5C93A 5BYAA 2Q6AA 3HPLC 3G4SV 3QQMA 1QVGU 4O3PA 4JI2O 3GLKA 3OR6C 2A7WA 2EILC 1CKMA 3QZ8A 5KUKA 3JAKB 2COGA 4DV6B 1SQGA 5L3FA 3X2QB 4F4ZA 3JD1A 4Q43A 4DV6H 4MV9A 1RP3B 2OLSA 4X62H 2E75B 2PI4A 4CC6A 1Y74A 1N0JA 4LF6O 2JEJA 2XAJA 2QWQB 2FKXA 2ZE6A 3MJFA 1GO3E 3FKIA 4O7WA 3PN1A 1Q6HA 3KG2A 4MV7A 3BA8A 1IBLB 3WB1A 3HKCA 3CS5A 1Y74B 3HKBB 2Z3YA 4YIPA 1EYZA 1FXHA 4KL1A 1R6NA 4Q20A 1H2GA 2YXLA 4AI8A 5KFDA 4P9OA 3JAKA 1IYDA 3ASNC 1PP9H 3T99A 4I55A 1CE8A 2ASDA 1E4FT 4DR3H 1ZX3A 2WAMA 2PTMA 2JGDA 4JI5B 4MVZA 1Y4MA 4OX9O 3JAMW 4FLTA 5B1AB 2Y4RA 3N6XA 2ATLA 3JYCA 2YDEA 4DL6A 4JI1B 3HOXG 1AP6A 2WSSG 2OT5A 4Q0YA 4PHZA 3KKYA 4ZOLF 1US6A 3RGBA 4O7TA 3EHBB 4QIWE 4ED3A 4WFEA 1OCZC 2JEFA 1VQ9V 1SEIA 4DL2A 1M7JA 4GYCB 4TV9B 3RBEA 4XDJA 4QE9A 1R3IC 4TQDA 1I94H 3JALB 4I4TF 5EDWA 3LUTB 5LOVB 1S0NA 2E5LB 3RYFB 4Z1VA 1S0MA 5BR8O 1GN3A 3SE7A 5KHHA 3V4ZA 2XAQA 3LMLA 1JFFB 4J9YB 1F23A 5HFMA 2EBOA 5JJEB 2WLNA 4KP4A 4DL7A 4ED8A 4RQFA 1AN7A 1QNMA 1SF9A 4A3IG 1NS1A 1RK6A 3L74H 3OE7G 1PNLA 4K0KH 3CC7V 4FLVA 3N2KA 4O83A 1JIHA 4G3IA 1IZ3A 2HJFC 2JJ1G 4E6NA 4K8ZA 2UXDB 4GX0A 2YEVB 2H8PC 2Y4TA 1W2BU 4EFEA 4JZ2A 2KSWA 5KFQA 2A9HA 2EZOA 1LUVA 1FPOA 1IURA 4O2BA 2ZR2A 4PDMA 2YWVA 4NTYA 3M9MB 2PF4E 3N2GA 1M57C 5BXZA 2W6MA 1ZQ7A 1QQCA 3FKIG 3R65A 3GTLA 4DR4B 2Q7GA 3P3PA 2CK3G 5BMVA 2W6JG 5FPRA 3BY6A 5GONB 3TW6A 5FPOA 4J9MA 2UVWA 2HVKC 2QYZA 3GJXB 4MTEA 2HP8A 1Y67A 3K08A 3HO8A 5I5SA 1IBLH 2DN9A 4YJ3A 5KG6A 4O7RA 2IM9A 2BTQB 3ZHVA 1NR1A 4X20A 5A2QN 1A32A 3OR7C 1W96A 2DMXA 1GMGA 4G27B 5HNEA 2YZLA 4BY1G 3OUUA 3VQXA 5I5YA 4KHPH 2F4VO 3VQWA 5E1AC 2FL4A 5LBQA 1BGWA 4HNVA 2XCPA 2CE4A 5LYJB 5KFFA 3CJHB 3F7VC 2KG7A 4FU0A 4IL6Z 3RYCB 3KALA 3BRCA 1YIJV 4PI0A 1IBLO 2YIBD 4O3SA 1VF6A 5KA5A 5KT3A 4J9ZB 1OCCC 5L3BA 3GVMA 1XEQA 3BQ0A 4YY3B 4NXNO 4X1KA 5KFAA 4FLYA 1YJ9V 1VQ5V 1V51A 4DV3O 1KD1W 1KP3A 4JI7H 1XREA 2K1EA 4D7TA 4I50F 1VQPV 1H2NA 3KAJA 2V1DA 2FTKA 3TJTA 4QWCA 2XIGA 1NTZH 5IJ9A 4O3NA 1XQ8A 2JA5A 3ZHSA 5K2MA 1Y1VA 1NI8A 3OEEG 3QO5A 5D1PA 2R8GA 3OMIB 2X6AA 3A8TA 4IYIA 2HG5C 4FVMA 3PW7A 5LA6A 5IYZF 5J2UB 3RN4A 3OUZA 2LP7A 5H6QA 5D8DA 4J10A 3K5MA 1YEWA 2EIYA 3SYPA 4P30A 4HQ6A 2NLJC 2WA4A 2AZ2A 4X1IA 3QZ7A 2JA6G 3EXAA 1H2LA 4DUZH 2N04A 5L3CA 3T1HB 4LFCH 4IWYA 1Z2OX 4NXMB 4JI8O 2Y48A 1VQ6V 3NR7A 3T1CA 2QF7A 2ZE5A 5BZBA 2CAZC 4WFBV 4B3RB 4FJCC 4JYBA 4WBNF 5LMNO 3JZ6A 2JK5C 1K1QA 5IWAH 3MHHC 2R93A 1KUTA 4JYYA 2W6ZA 3FYEB 1GYFA 1KKCA 4K8XA 2V5AA 4DV0H 2R72A 3SR2C 3FYIB 3U0GA 2XGQA 4O4HB 2BR0A 4RAZA 3U55A 3SI8A 3RYCA 5IJ0A 2WLMA 1Y76B 2UXCB 5D1OB 3DC6A 2E2IA 4J80A 5CN0A 2EILB 4PZ7A 4JASA 1VF6C 5JQWA 1Z5WA 4YY3H 3EYYA 4FS1A 3PW2A 5I60A 3RYIA 2YRWA 3WO0A 2IW5A 2ASLA 3L72H 4UXNA 2XT9A 1HNXO 3M8AA 3J81N 4DV5H 1S5JA 1F4MA 2WE6A 2R92G 4JV0A 4FBTA 1I6UA 3MFHA 1IBMB 2A0LA 3CMEV 4BIOA 2E2HA 3RV4A 4LF6H 5BMVB 1QR8A 4EG0A 4GZRB 5KFCA 4HZ3A 3N2KB 4LC1A 3STZC 4MS2A 3GV8B 2B63G 4N23A 2M6YA 4MVUA 3G6XA 1Y6XA 3OW2U 1P8LA 4UFZA 1SZTA 5CA0F 3F8NA 2WDTA 4RU9A 3MR6A 4B7KA 1KUQA 2L6LA 4DR7B 1QCEA 4FM0A 4A3KG 5TISZ 2Q9LA 1XNRO 4BW9A 1FXKA 4NTWA 5JVDF 2OH2A 1O75A 2JRIA 1IBKB 2JA6A 4NZMA 3LSSA 1VAJA 4LF5B 5CA3A 5IJ0B 3PW0A 5CB4F 3PFFA 1PKXA 3Q4HA 1C30A 4DV3B 5HBRB 3UYYA 1R73A 2ZIMA 3AG4B 1M90W 4YAJB 4J9KA 2HKOA 1Q6UA 5KG4A 4TM5A 2LW7A 3G6VA 3T4ZA 2Q73A 4TV8A 3GV7B 3AG2B 3JD3A 1WNSA 2AHYA 1VF5B 2EIKC 2YI9A 1NQTA 1YI2V 3OTOB 5CE8A 3SJAC 4DR2B 3JALA 4H33A 4BIUA 1FKAO 2CFMA 4JAUA 2QKAA 1S0VA 1WJZA 4PA3A 1HNZB 5AG2A 4DIMA 2XC9A 3TCUA 1ZUQA 1EN6A 4QIWF 4U3JB 1HR0B 1WSCA 2UU9H 2IP4A 4NXMH 3WB2A 3AX6A 4DR5B 1JA8A 4FZ1A 4YHHH 1AI4A 1B6QA 1Q6IA 5EYPA 4FFNA 2V58A 3GB8B 2WA3A 4DO2A 4NXMO 3VPCA 1KB9F 1IXMA 1WA8A 4K35A 4B3SO 3E5NA 3U54A 1OCRB 2AW9A 3D3QA 1B3QA 1CS0A 4ECRA 1H2SB 5B1OA 4H44B 4ED2A 4R50A 3ETDA 4XX0B 5C1OA 5EBLC 5LA6B 3C0FB 5IY5C 2FJZA 5KG0A 1G6UA 3CQZA 1JOYA 2R9RB 2UVRA 2CTPA 1FJGB 4ZOLB 3N8DA 3NUAA 4L8JA 3UO2A 4DRXA 3SPIA 1VQOV 1VIBA 4X66H 2UUCH 2QWNB 2BE3A 5J9PC 2P06A 1TWHA 1XDCA 4DR3B 2DAAA 1GM9A 2ZDQA 2VQFH 1I5XA 3P32A 4JV1A 2P0AA 3FB5C 2EINB 5JQGF 1RPRA 1HNWO 5EC2C 1K73W 2YRXA 3OT7A 1WRVA 4DR6O 1J5EB 1QLEB 1SCUB 4X1KB 2CQYA 4F4LA 3N42B 4ZQIA 3J7AU 1FKAH 3ABLC 3A0HZ
chains in the Genus database with same CATH topology
4JI1H 3K59A 4DUYB 1O9GA 5CA0B 4X64H 4KHPB 4HNAB 3MWMA 1XI1A 4JI5H 4O4LB 5JH7B 3RTXA 4X62B 5CB4A 1SQFA 4FM1A 4FFBA 4DV3H 3KAKA 4X64B 4ZHQA 5CA1B 4DUYH 2UXBH 4RB3C 1FFXA 1Q43A 4YJ2A 4YJ2B 5JVDB 3IG0A 1TVKB 3A2FA 2VWJA 1I94B 1L2ZA 2Q0AA 4FFBB 1XHXA 5JQGA 1HNXH 4JYAH 3RGXA 3ICXA 3JAWA 5FNVA 5KHJA 2VQEH 1WH2A 5LMNB 3MAQA 3GDEA 5EOYA 2PY5A 3RWRD 2VQEB 3RYHB 1ZHSA 3FMAA 4U3JA 4JI4B 4DRFA 4WBNA 1CKMA 1I7FA 2KKWA 3JAKB 5BR8H 2PYLA 1HW7A 5KMGA 4TV8B 4DV6B 1SQGA 4FLZA 3BPZA 2VUGA 4DV6H 4UCRA 2F4VB 4MV9A 4X62H 2PUSA 4IHJB 4CC6A 3K3VA 4JI8B 4JI4H 3B2EE 1SA0B 2ZINA 3PN1A 5LXTA 4LF5H 5LOVA 3BA8A 4MV7A 1IBLB 4APMA 4MTDA 4CC5A 3WB1A 3HKCA 5LMNH 2UUBH 3HKBB 4YJ3B 3L2PA 4EQ5A 4DR1B 3SGIA 1HNXB 4KL1A 3K5OA 1JFFA 4BWAA 3RF2A 2YXLA 4NXNB 2VOBA 4CH5A 3H20A 4FM9A 2OWOA 3JAKA 2HGSA 3QG5A 4I55A 3RYFA 2XHBA 2E5LH 1E4FT 4DR3H 2ZM6H 4JI6H 1T5EA 3CHXA 4JI5B 2PTMA 3JAMW 4FLTA 3OTFA 3N6XA 4O4JA 1HNZH 3JARB 4LH7A 4JI1B 4AQYB 4Q0YA 3RR5A 4PHZA 2RQ6A 3UQ8A 4B3SB 4UCSA 2ZJTA 5KMGB 5KHKA 4I50B 3RGBA 4EB6B 4F6RA 4B3TB 2HVSA 5EZYA 2W57A 5KHIA 1SEIA 1KMIZ 4LSXA 4GYCB 2PZSA 4TV9B 2PYJA 4LF8H 4EB6A 4CS4A 4TQDA 2CW8A 1I94H 3JALB 3J7AK 5LOVB 1XMOH 3ETQA 3RYIB 5JCOC 2E5LB 3RYFB 1S03G 1TVKA 4OX9H 4RZQA 5KHHA 5J2TB 3NBZB 1IBKH 3LNNA 1XMOB 3LMLA 1JFFB 4O4HA 4ZIBA 1VF7A 4PZ6A 3K57A 4JI2H 4DV4B 4B3MB 1Z2PX 5LMUH 3NBYB 4JI3B 5JJEB 1XDNA 4LR3A 2CW7A 2P22C 1VS0A 2P5OA 4DR7H 1ZHQA 4X1YB 1AN7A 1XNRB 3QTCA 4GKJB 4GKKB 1SA0A 4LMYA 5FD6A 4TQFA 4K0KH 4FLVA 3HKBA 5D5QA 3N2KA 2F4VH 4E6NA 4K8ZA 4LFAB 4B08A 2UXDB 3JASB 3WB0A 1N32B 3UT5A 4LFCB 4EFEA 2KSWA 3K58A 1IBMH 4JI6B 1M0TA 4O2BA 4DK0A 4A2BA 3VQYA 4JI0H 2UUCB 3N2GA 4RB2C 5EZYB 1QQCA 4DR4B 2Q7GA 5BMVA 5FPRA 3OTOH 4RAYA 5GONB 5ITZB 4LF7B 5J2UA 5FPOA 2Q2UA 3GJXB 4MTEA 3RYHA 1Q5OA 4LNUB 3JARA 5JVDA 1IBLH 2MCTA 2UXCH 4YJ3A 4ZHQB 1O9HA 2IM9A 2BTQB 4X1IB 4CS3A 4X20B 4X20A 4LFBB 4JI8H 5IJ9B 1KU9A 3RIZA 3CB2A 4FLWA 3VQXA 4HNAA 4A2AA 4KHPH 5CA0A 3VQWA 5CA1A 1BGWA 3BHPA 5LYJB 4Q6GA 2UUAH 1RSOA 2Q7HA 4O4LA 3RYCB 1M93A 3BRCA 3KALA 4PI0A 3KXYT 4CH4A 2Q7EA 2YIBD 5KX5A 3VNNA 3SJBC 1XK5A 4O4IB 2ZNIA 1TA8A 5EIBD 5LYJA 3QWUA 2Q2TA 3HKEB 2PGGA 5LL6b 2RGRA 2JS5A 4JI0B 4GLXA 4YY3B 4X1KA 4JYAB 3ZEDA 3JATA 3KYHC 4IAJA 3TY5A 3T1HH 4FLYA 1V9PA 3T1YH 5JJNB 4DUZB 3J81W 3L4JA 5DISC 3CVZA 4JI7H 1SYXB 4D7SA 1N32H 4D7TA 1CKOA 4LF4B 4FLXA 1ZAUA 3KAJA 2HVQA 2FE3A 2R9AA 2XIGA 2VWKA 3TY8A 4UCOA 5IJ9A 4LFBH 1XQ8A 4IIJB 2JVDA 4X1YA 5CB4B 4DV5B 5D1PA 4GKKH 1XNQB 4DR6B 4I4TB 2YCHA 1XNQH 2F93B 3N2GB 2HHHB 4FVMA 4X65H 4RB1A 5LA6A 5LP6B 5J2UB 5LMUB 1FFXB 4I50A 1YEWA 3K5MA 1XMQB 3M4IA 2F66C 2RJZA 3W1BA 4LF4H 1N36H 2BTQA 4X1IA 2HVRA 1L8DA 1P16A 1TUBA 4ZI7B 4DUZH 4J0MA 4CS2A 1Q8IA 4AILC 3T1HB 3QF7A 4LFCH 4DV1B 3HKEA 4X66B 3BA9A 1Z2OX 4NXMB 1N36B 2F1MA 5JCOA 4I7HA 4LFAH 5GONA 3SJCC 5ITZA 2VPSA 2UXDH 1FJGH 3RJ0A 2CAZC 4DRXB 4B3RB 4DK1A 4CH3A 5IWAB 5D1OA 1JMKC 5IWAH 4X65B 4O2BB 5J2TA 4DR6H 3HKCB 5IYZA 4K8XA 1GYFA 1Z2NX 4DV0H 3U0ZA 2R72A 3SR2C 4HBNA 3ZS8C 4JI3H 1N33B 4DV4H 4B3MH 3THOA 4DV7H 4O4HB 4RAZA 3N44B 4LF9H 1A0IA 1X4TA 3RYCA 5IJ0A 4LNUA 5EIBC 2UXCB 4UCVA 4FLUA 5D1OB 4M7EA 4ETSA 4DV7B 4PZ7A 3K5LA 1M0WA 5K1PA 1Z5WA 4YY3H 1HNWB 2UU9B 3EYYA 3BABA 1MZBA 4TV9A 4PI2A 3RYIA 4I9QA 1WPBA 4DR2H 1D5AA 4DV5H 1S5JA 4LH6A 2WE6A 3JAWB 1I6UA 4RB0A 3HKDB 1IBMB 4B3SH 5JQGB 2UUAB 1FVIA 5LP6C 1N34B 1X9NA 4AQYH 4LF6H 5BMVB 1DGSA 3N2KB 4JI7B 1N34H 4DV1H 1B04A 3HKDA 2ZM6B 1P8LA 4UFZA 4I55B 2WDTA 3F8NA 1WN7A 4BWSC 3FFQA 4DR7B 4FM0A 1SKVA 4DV2B 3K5NA 1HNWH 2EX3A 4BW9A 4DV2H 4JI2B 5FD5A 3DF7A 3RGZA 3DSQA 1O75A 3E22B 1IBKB 3IAYA 4EEQA 4TOIA 4LF5B 4O2AA 5IJ0B 5C8YB 2GV9A 2V4DA 4DV3B 4AHCA 2QJ1A 2ZIMA 3M7MX 3VQVA 1BJTA 4LF9B 5D5PA 3W5OA 4EFBA 4O2AB 3L4KA 5IYZB 2O03A 3RFRA 4LF6B 2HIXA 4TV8A 3N41B 1TUBB 4F6RB 4ZI7A 1WNSA 4B3TH 1TAEA 2YI9A 4CH6A 3OTOB 1J5EH 3JATB 2QM4A 3SJAC 5IT9W 4DR2B 3JALA 1Z5VA 2CFMA 1XNRH 2YIBA 3N43B 2JGUA 3JSNA 4IHJA 5KHGA 3TY9A 1HNZB 5FNVB 4NXMH 4U3JB 1HR0B 2UU9H 2F95B 1Q3EA 5FLXW 3WB2A 2VQFB 3BAAA 1TGOA 4DR5B 4LSAA 1JJOA 3CSXA 2UXBB 4WBNB 4YHHH 4OX9B 2BTOA 5EYPA 5EYPB 2WYOA 2YIAA 3GB8B 1NT2B 4O4JB 4K0KB 3U10A 3W1GA 2HIVA 1N33H 4JV5B 2HEPA 3J80W 4DV0B 2UUBB 5LXTB 5JH7A 4IIJA 2E3CA 2RGVA 4I4TA 1H2SB 2R70A 4NVPA 4FM2A 4JV5H 5LA6B 3UT5B 1QHTA 2ZIOA 5LP6A 3C0FB 1G6UA 4LF7H 3JASA 4B3RH 4DR4H 2YI8A 1FJGB 4ZOLB 2ZCEA 4R7RA 5KX5B 3N40P 4L8JA 4DRXA 4YHHB 4X66H 2UUCH 1P49A 4DR5H 4PZ8A 5BR8B 3T1YB 5K1XA 2OYQA 1E4GT 4DR3B 1M5IA 4TUYB 2VQFH 3HXLA 4LF8B 4UCUA 1CKNB 1CKNA 1HR0H 1M4UA 5C8YA 4ZOLA 3S24A 2ZNJA 1XMQH 4NXNH 1XHZA 4O4IA 4PDBA 5JJJB 3E22A 1J5EB 4X1KB 3U11A 4DR1H 4UCTA 3JSLA 3N42B 3NC0B 2HHHH 1FKAH 1S68A 4TUYA 4GKJH 5A2QW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 B;  3TY8 A;  2E5L B;  4UCO A;  4DUY B;  4DV2 B;  4KHP B;  4DV5 B;  5D1P A;  4JI2 B;  3NBZ B;  1XNQ B;  4DR6 B;  1XMO B;  3RTX A;  1IBK B;  4EEQ A;  4X62 B;  4PZ6 A;  4TOI A;  4DV4 B;  2HHH B;  4B3M B;  4LF5 B;  3NBY B;  4JI3 B;  4X64 B;  1XDN A;  5LMU B;  4DV3 B;  1VS0 A;  4LF9 B;  3W5O A;  1XMQ B;  1XNR B;  4GKJ B;  4EFB A;  4GKK B;  1I94 B;  3W1B A;  2HVR A;  4LF6 B;  2HIX A;  5LMN B;  1P16 A;  3GDE A;  3T1H B;  2VQE B;  4DV1 B;  4E6N A;  4LFA B;  4X66 B;  1TAE A;  3BA9 A;  4NXM B;  1N36 B;  2UXD B;  3OTO B;  4JI4 B;  1N32 B;  4DRF A;  1CKM A;  4DR2 B;  4LFC B;  4EFE A;  2CFM A;  4JI6 B;  3JSN A;  4B3R B;  3TY9 A;  1HNZ B;  5IWA B;  4DV6 B;  2UUC B;  5D1O A;  1HR0 B;  2VUG A;  4X65 B;  4UCR A;  2VQF B;  2F4V B;  3BAA A;  4DR4 B;  4CC6 A;  4DR5 B;  4JI8 B;  5FPR A;  2UXB B;  4LF7 B;  5FPO A;  4OX9 B;  2Q2U A;  3PN1 A;  1N33 B;  3GJX B;  3BA8 A;  3GB8 B;  1IBL B;  4CC5 A;  4K0K B;  1A0I A;  3W1G A;  2HIV A;  3L2P A;  4JV5 B;  4EQ5 A;  4DR1 B;  3SGI A;  1HNX B;  4DV0 B;  2UUB B;  2UXC B;  4UCV A;  4LFB B;  5D1O B;  4NXN B;  4DV7 B;  4PZ7 A;  2OWO A;  1HNW B;  2UU9 B;  3BAB A;  4JI5 B;  1FJG B;  4YHH B;  3VNN A;  4LH6 A;  4LH7 A;  1XK5 A;  4JI1 B;  4AQY B;  4PZ8 A;  3RR5 A;  1TA8 A;  5BR8 B;  3T1Y B;  1IBM B;  2UUA B;  1FVI A;  3QWU A;  3UQ8 A;  4DR3 B;  4B3S B;  1N34 B;  4UCS A;  1X9N A;  2Q2T A;  4LF8 B;  4UCU A;  1CKN B;  1CKN A;  1DGS A;  4JI0 B;  4GLX A;  4YY3 B;  4JYA B;  4B3T B;  4JI7 B;  3KYH C;  3TY5 A;  2HVS A;  1V9P A;  3S24 A;  1B04 A;  4DUZ B;  5DIS C;  2ZM6 B;  1P8L A;  4UFZ A;  1J5E B;  1CKO A;  4LF4 B;  1ZAU A;  4UCT A;  3JSL A;  2HVQ A;  3NC0 B;  1S68 A; 
#chains in the Genus database with same CATH topology
 1GSO A;  1KJ9 A;  4JI0 O;  3KHL A;  4WHX A;  2DYS B;  4DUY B;  1AJP A;  3AEI A;  1IBM O;  4KHP B;  1UNN C;  1UC8 A;  4AYB A;  1PV0 A;  2VRZ A;  1N34 O;  4MV1 A;  5EWF A;  1OJH A;  5JH7 B;  1WB8 A;  4X62 B;  2ZD9 A;  3OSP A;  1SQF A;  4EYI B;  4FM1 A;  1E1Q G;  3ABK B;  3QO8 A;  4DUY H;  4ICG A;  5KT6 A;  1FFX A;  2WLI B;  2UUC O;  2W6I G;  1Q43 A;  2AGA A;  3JD4 A;  4YJ2 B;  4X66 O;  3UM7 A;  1N36 O;  5IT9 N;  3IG0 A;  1TVK B;  5L1K A;  4PEL A;  2VWJ A;  4C5A A;  1T94 A;  4FFB B;  3T9E A;  4PWQ A;  4PD4 F;  4W4L A;  5FNV A;  3CWB H;  5KT2 A;  2R7N A;  2YZG A;  4X65 O;  2PY5 A;  3RWR D;  4ED1 A;  1AUX A;  2VQE B;  4MA0 A;  1AJN A;  3TET A;  1KBH A;  2C28 A;  4UUJ C;  4DRF A;  5EZY F;  4WBN A;  2Q8V A;  4JZG A;  3E35 A;  4UUG A;  5DEC A;  4I5S A;  3K5H A;  2CNU A;  3R9R A;  1K97 A;  4DQN A;  3CRM A;  4FLZ A;  2VUG A;  1QLE C;  2HJW A;  4DV1 O;  4YR0 A;  2PUS A;  1AVM A;  1V55 C;  1VEW A;  3D36 A;  4EBC A;  1SFO A;  5L1J A;  1N0N A;  4MA5 A;  2DYR B;  5L9X A;  5DGA A;  2C00 A;  4FZ0 A;  3TIN A;  2UU9 O;  1A3G A;  4CC5 A;  1J95 A;  2EJ0 A;  5LMN H;  2QWO B;  2GLT A;  2EJ2 A;  2BSK B;  1MOF A;  3FKS G;  4GLW A;  4RCN A;  5IYB G;  2QR4 A;  2YZN A;  3JZI A;  3ZMS A;  1JFF A;  3H1J H;  1Z2G A;  4N21 A;  5DGH A;  3L71 H;  4QWA A;  3H20 A;  1S72 V;  4FM9 A;  1TWF A;  3APO A;  2UUA O;  3R23 A;  2OWO A;  1RJR A;  2Z02 A;  3SNO A;  3RYF A;  2M7W A;  1Q82 W;  3PW4 A;  2ASJ A;  2E5L H;  5LXT F;  1T5E A;  2NU9 B;  2DE0 X;  2X6C A;  1EUD B;  2DAB A;  4WFG A;  3AG1 C;  3TII A;  1HNZ H;  3CRA A;  4LH7 A;  2CTQ A;  2GUZ A;  3RR5 A;  1AI5 A;  4P2Z A;  1NVP D;  4JXU A;  1FXK C;  4UCS A;  4FFR A;  2ZJT A;  5KMG B;  2XAF A;  3MR5 A;  3BQ2 A;  4NB5 A;  4F6R A;  2D3O W;  1OV9 A;  1IOW A;  1NTK H;  1SS3 A;  2DJV A;  3SDL A;  5KHI A;  2Y4U A;  1KMI Z;  2W9B A;  5LGU A;  4EGJ A;  1W93 A;  4U7O A;  4MVQ A;  2Q68 A;  4LF8 H;  2DQ0 A;  3C3T A;  3ETH A;  1TUE B;  4X8A A;  1S5L Z;  1S03 G;  4WFH A;  4JF3 A;  2RMK B;  5KFZ A;  1EZV H;  3CCS V;  2DZD A;  3HOU G;  5KUM A;  4FFM A;  3HBL A;  3D3I A;  1IBK H;  3ZN0 A;  1V54 C;  1XMO B;  2YC0 A;  1PX2 A;  4E4E A;  1VF7 A;  2Z04 A;  2XUM A;  4PZ6 A;  4MV3 A;  4KXR A;  2FP4 B;  2VS0 A;  5LMU H;  1HP8 A;  4JI3 B;  3WO1 A;  1XBL A;  4LR3 A;  2CW7 A;  3STL C;  2P22 C;  4KUM A;  4MVR A;  2QA4 V;  3DTF A;  1VS0 A;  2P5O A;  3PR4 A;  4DR7 H;  1ZHQ A;  2UXN A;  3FB7 C;  5B1B B;  4LMY A;  3AG4 C;  1SQX H;  1L1F A;  3CCV V;  4Q44 A;  5GW7 A;  1EHI A;  3HT5 A;  4U7N A;  3HKB A;  5D5Q A;  1GKF A;  4DUY O;  1TWG A;  3K9A A;  5JWP A;  4LFA B;  3ASO B;  4EKW A;  1N32 B;  5BWX A;  4J7K A;  2Y69 B;  2UVV A;  2W9C B;  2R7L A;  1IBM H;  1M0T A;  4WCE V;  3ZJZ A;  3UFX B;  2W8L A;  4J42 A;  4JI0 H;  2W9B B;  3V6K A;  4J9L A;  1E4E A;  2CH7 A;  3H01 A;  4RB2 C;  1XL4 A;  3HOV G;  5KFI A;  4M0J A;  3ZMU A;  1IOV A;  1BT8 A;  1MSD A;  5FJ8 G;  5KFT A;  4MV4 A;  5ITZ B;  3ZIA G;  3CJH A;  1YHQ V;  2EZP A;  3JD2 A;  2ABJ A;  3RFC A;  4RWU A;  1Q5O A;  4LNU B;  4FE2 A;  2Y0S A;  1B06 A;  1LUW A;  5I5V A;  2UXC H;  1M9N A;  3A0R A;  1VBH A;  2HVJ C;  1MZF A;  4BY7 G;  1O9H A;  2XAH A;  4CS3 A;  1COW G;  4X20 B;  1UC9 A;  5LHG A;  3EPG A;  4JI8 H;  1EBO A;  3CB2 A;  4A2A A;  2QTO A;  3K79 A;  2RDJ A;  3T4D A;  4MVO A;  3CEB A;  2WLL B;  3E8B A;  2GHY A;  3BHP A;  2HHF A;  4JV5 O;  2B63 A;  1RSO A;  2Q7H A;  3A0B Z;  1M93 A;  5L3G A;  5BMV F;  5B66 Z;  3KXY T;  3VNN A;  2Q7E A;  4O4I B;  3QO7 A;  2ZNI A;  1TA8 A;  1B6S A;  3QWU A;  2V4R A;  4NZO A;  1I7L A;  2Y0P A;  2Q2T A;  2JS5 A;  3T1H H;  3ZED A;  3JAT A;  2ILM A;  3TY5 A;  5KFW A;  2CDY A;  4DUZ B;  3L4J A;  5DIS C;  1A0G A;  3CVZ A;  1A9X A;  4D7S A;  5IDJ A;  3G6E V;  1C3O A;  1ZAU A;  2P7T C;  2J9G A;  2HVQ A;  1I2K A;  5KG7 A;  2FE3 A;  2JA7 G;  1R9T A;  2OIE A;  4LF8 O;  2IA6 A;  3TY8 A;  2EUL A;  4LFB H;  4IIJ B;  1BHB A;  1AJQ A;  2NR5 A;  3ZRS A;  5CB4 B;  1RK5 A;  4ECV A;  2Q0O C;  2LO1 A;  1H2K A;  2QWP B;  4I4T B;  1YZB A;  3ZRV A;  4A3D G;  3O9O A;  2HHH B;  1H8H G;  4A3B G;  2EJ7 A;  2UXX A;  4RB1 A;  2W8K A;  2QK4 A;  1R6K A;  2BCC H;  4ED7 A;  3K3W A;  1FFX B;  2WLI A;  3UCS C;  2DIK A;  3MD0 A;  1XMQ B;  3M4I A;  4U6P A;  3T7A A;  2R8J A;  3ZHT A;  2RJZ A;  2BQ3 A;  1P4R A;  1N36 H;  1GN2 A;  4X89 A;  1P16 A;  2R92 A;  1N8R W;  2XTA A;  3CE2 A;  3K0G A;  3HKE A;  1OZ0 A;  1UPG A;  5JCO A;  5ITZ A;  2QE7 G;  5E25 A;  1I94 O;  5BPF A;  2WB1 A;  3Q4H B;  1I50 A;  1JMK C;  2CH7 B;  4YR3 A;  3T2M A;  3VOU A;  2J6T A;  4MT8 A;  2BSK A;  5J2T A;  4DR6 H;  2BOB C;  2CGN A;  1M57 B;  5LHI A;  3U0Z A;  2DWE C;  3CCQ V;  1KEE A;  1N33 B;  3GID A;  4DV4 H;  4B3M H;  5FL7 G;  4L87 A;  4I0X B;  4DV6 O;  4Q45 A;  4LF9 H;  2E74 B;  2X6B A;  3HOY G;  4RUE A;  3DGE A;  1JDB B;  1DF4 A;  2YIC A;  4Z2W A;  2QTS A;  1OCO C;  3I5D A;  1DLB A;  3QVN A;  4RNN A;  3ML0 A;  3BAB A;  5BWW A;  3RB3 A;  5KFG A;  4I9Q A;  2DPI A;  1K7D A;  3UZB A;  1GN4 A;  1IDS A;  1WA8 B;  1EZJ A;  1WPB A;  3OMN B;  4J9N A;  2AGO A;  4LH6 A;  4QW8 A;  3WWH A;  2FK3 A;  4J9O A;  5KG5 A;  4B3S H;  3HKD B;  1RM1 B;  3H0G G;  2EIN C;  1JVM A;  2C2E A;  1SET A;  4FFL A;  3L70 H;  4AQY H;  2E5L O;  5B5E Z;  1EN4 A;  4PJ0 Z;  2GSM B;  2ODT X;  1N34 H;  3TW7 A;  3OAA G;  4J9Q A;  4GC7 A;  4GX2 A;  1B04 A;  2ZM6 B;  1FXV A;  2PBZ A;  1VP7 A;  3S3X A;  1ZL8 A;  2QKS A;  1GK9 A;  2LQT A;  1KKD A;  3M9O B;  3FFQ A;  4O4L F;  5CBF A;  1H2M A;  3W7W A;  1HNW H;  2Q5Z A;  4DV2 H;  5FD5 A;  4JYC A;  4JI4 O;  4EEQ A;  4YY3 O;  4NTX A;  4DL4 A;  2RNB A;  3H0G A;  2NU7 B;  2GV9 A;  4DUZ O;  4AHC A;  2QJ1 A;  3HB9 A;  3WNZ A;  2F43 G;  1BJT A;  1KBL A;  5KFV A;  4DL5 A;  3GTJ A;  1PL0 A;  5D5P A;  2IU0 A;  1Y1V G;  4Z1M G;  2W7O A;  4QIW A;  3L4K A;  4MW8 A;  2IU3 A;  5IYZ B;  2EJ3 A;  4K6N A;  5J2U F;  1M1K W;  2KSD A;  1RPO A;  2YID A;  4FFO A;  1L0N H;  3PVX A;  1WCM G;  4J9P A;  2Q7D A;  2R8K A;  3K04 A;  1WLE A;  4W4K A;  1W59 A;  3R66 A;  4GKJ O;  3K06 A;  2HHH O;  4IHJ F;  1FS0 G;  4ZI7 F;  1XNR H;  4HNU A;  1WAZ A;  4O3R A;  3JSN A;  4JTD B;  5KHG A;  3TY9 A;  4J7Z A;  3I4N G;  1CPY A;  3LDE A;  4FS2 A;  1I08 A;  1Q3E A;  1S3J A;  2W6P A;  1WCM A;  3BAA A;  1TGO A;  4RUC A;  2AXT Z;  2YS8 A;  4DLK A;  4LSA A;  1JJO A;  2LGQ A;  4WBN B;  1EKF A;  3T9C A;  1KT8 A;  5C44 G;  5JUM A;  2G38 A;  5EYP B;  3CXH F;  1R3J C;  2YIA A;  3E86 A;  1G1X B;  4BBR G;  5EWG A;  3T1H O;  2NU6 B;  3EVK A;  3AYH B;  3W1G A;  2GDS A;  2HIV A;  3UKM A;  3E2E A;  3JAM N;  3PW5 A;  4TWK A;  3VOT A;  4DR4 O;  1OHH G;  4B3R O;  2OIG A;  4IGG A;  2RGV A;  4O4H F;  2Y69 C;  3ABT A;  2ZDH A;  2R70 A;  5DN6 G;  5LL6 Y;  1VBG A;  4MVS A;  4JV5 H;  3UT5 B;  4FGR A;  5H5N A;  3JAS A;  3CEI A;  1I1M A;  2FML A;  2R7M A;  2ZCE A;  3LNM B;  4R7R A;  1S97 A;  3N40 P;  2QM8 A;  2YYA A;  1P49 A;  2RN9 A;  3C90 A;  3T1Y B;  1E4G T;  5H9C A;  1CKN B;  1CKN A;  4GCZ A;  3SYO A;  4DV4 O;  4B3M O;  3RAQ A;  4WFA V;  3W7U A;  4NXN H;  3G71 V;  1NJI W;  3CRC A;  3G8C A;  4UCT A;  2AHZ A;  2FPP B;  3NC0 B;  3BCC H;  4O86 A;  2ITC C;  4PA9 A;  1NH2 B;  1S68 A;  4QWE A;  4QJF B;  3OGC C;  4QPJ A;  4B7E A;  4ECU A;  2ZR3 A;  4IT5 A;  4YIO A;  4HNA B;  3MWM A;  4YXW G;  1XI1 A;  3ETE A;  4IWX A;  2ETN A;  4O4L B;  5KAF Z;  4LFC O;  5CB4 A;  3OM3 B;  3KAK A;  2FK2 A;  4X64 B;  2C2D A;  4ZHQ A;  4JAV A;  4RB3 C;  5H2F Z;  5JVD B;  2W0F C;  1I0H A;  1HNX H;  4JYA H;  5C8Y F;  2HG8 A;  4R7C A;  3ABK C;  4LF7 O;  2XAS A;  4PDR A;  3MAQ A;  1M56 B;  1K5Q A;  2HLD G;  1R3K C;  1R1B A;  3SPH A;  1XIL A;  1ZHS A;  1IXB A;  3FX7 A;  3FMA A;  3GIK A;  3GV5 B;  4RNM A;  2CTR A;  4BIZ A;  4JI4 B;  2RDI A;  3GIJ A;  5BPH A;  2KKW A;  2QB5 A;  2PYL A;  2D2C B;  1HW7 A;  3TXS A;  4LFB O;  5GON F;  3L9D A;  4CZZ A;  3P30 A;  4UCR A;  1Y14 B;  1GTO A;  2XCA A;  2IJH A;  5BY1 A;  4BBS G;  2UXC O;  3K3V A;  1ULZ A;  1XOU A;  5HFL A;  2NN4 A;  3ZCC A;  3B2E E;  5FNV F;  4JI4 H;  5KFR A;  1SA0 B;  5LXT A;  5LOV A;  1P84 F;  4MTD A;  4U3F H;  5IWA O;  4JUZ A;  3X2Q C;  5CBH A;  3E8G A;  2UUB H;  1ENV A;  3ASO C;  3L2P A;  4DXW A;  5KFJ A;  4DR1 B;  2ODM A;  1HNX B;  3ABM B;  3G6B A;  4FFK A;  2VOB A;  2GPS A;  1U96 A;  4CH5 A;  4GX5 A;  5BWR A;  1ZL8 B;  3RB6 A;  5GTI Z;  2HGS A;  2EJR A;  3QG5 A;  4GX1 A;  2XHB A;  3VPB A;  2ZM6 H;  3V6H A;  4JI6 H;  4C7U A;  3J80 N;  2WWW A;  5EC1 C;  2ZKO A;  1GLV A;  4O4J A;  1KJI A;  1QU7 A;  1BXR A;  5KFK A;  4AQY B;  2LFS A;  4ECT A;  2OTL V;  3PR5 B;  1WP8 A;  1VQ4 V;  1HWY A;  3UQ8 A;  4B3S B;  2XGP A;  3ZMV A;  5KHK A;  2FPG B;  5DM6 V;  4D6T H;  4DR7 O;  2R7Z G;  3NGD A;  1BMF G;  1TWC A;  4B3T B;  2P90 A;  2WAQ E;  2HVS A;  3H3V H;  4BW5 A;  5H80 A;  1YF2 A;  5IYC O;  2PYJ A;  4O7Z A;  1R6T A;  4EB6 A;  1NU1 H;  2IJI A;  1MAB G;  2CW8 A;  1FJG O;  4I0X A;  3VMM A;  3E83 A;  2XAG A;  3NXS A;  4LF9 O;  4TVI A;  4JI7 O;  2ZDG A;  4YQW A;  4OX9 H;  1AP5 A;  3CCL V;  5J2T B;  3LNN A;  3Q1K A;  3ZMZ A;  3DAA A;  3T54 A;  3JZF A;  4ZIB A;  2A06 H;  4NYK A;  4DV4 B;  4B3M B;  5KFS A;  3GTM A;  3NBY B;  3VPD A;  1XDN A;  3QFF A;  1YVW A;  3CC2 V;  3RW0 A;  3JD0 A;  3H40 A;  3ZRX A;  1N48 A;  4E4T A;  4X1Y B;  1N56 A;  4RUF A;  4DR2 O;  4GKK B;  5FD6 A;  2W9A A;  4A3M G;  2X7R B;  3ETG A;  4ED0 A;  4YAK B;  2I80 A;  2F4V H;  4KHP O;  2ARH A;  2WAQ A;  5L3E A;  4ME6 A;  3JAS B;  1VQK V;  3Q2O A;  1E79 G;  3CD6 V;  3UT5 A;  1N4C A;  4X62 O;  2ZE7 A;  3H1L H;  4O2B F;  1NBM G;  4QNH B;  2YUA A;  4JI6 B;  5KFO A;  2AZ0 A;  4DK0 A;  4A2B A;  2JEI A;  2JS3 A;  3APQ A;  4O7N A;  2UUC B;  3LSQ A;  1MG1 A;  1DV2 A;  2HGX A;  4F4Y A;  5BWT A;  1T3N A;  2HFE C;  4DV0 O;  2UUB O;  3ORQ A;  5FR9 A;  4TV8 F;  2FK1 A;  4PA4 A;  3I12 A;  4U7C A;  2Q2U A;  3MHS C;  3RYH A;  2PN1 A;  3PZP A;  4F4X A;  5DLF A;  2J6U A;  2VA2 A;  2MCT A;  4RZR A;  5DGB A;  4X1I B;  4A3F G;  4F50 A;  4O7S A;  3WU2 Z;  1K4D C;  4LFB B;  4K3A A;  2R85 A;  1F51 A;  3RIZ A;  4IRD A;  1EUC B;  4YJ3 F;  3T9A A;  5CA0 A;  4DR3 O;  4QWD A;  5CA1 A;  1Q7Y W;  1I2L A;  4Q6G A;  2UUA H;  4XDK A;  4DL3 A;  5KX5 A;  1ROP A;  1I3Q A;  1XK5 A;  5KG1 A;  1KC8 W;  5EIB D;  2VUM A;  3KCY A;  3M99 B;  2PGG A;  3EFF K;  5LL6 b;  3AG7 A;  2RGR A;  4GLX A;  4JYA B;  4IAJ A;  4TQS A;  4XZ3 B;  4A3J G;  2HHF B;  1SYX B;  1DK1 A;  1CKO A;  4LF4 B;  5B3S B;  4FLX A;  3AG3 B;  5GTH Z;  3MWD A;  4HNT A;  2VWK A;  5HV6 A;  4UCO A;  2DQ3 A;  2WLL A;  1WP7 A;  2ZE8 A;  3ZN1 A;  3TEK A;  1DV1 A;  3K3P A;  3CCU V;  1SQV H;  3ABU A;  4H13 B;  4GKK H;  4R6Z A;  1XNQ B;  4OGQ B;  2CKZ B;  4H0L B;  4M9U A;  2IH3 C;  4PDL A;  1NKD A;  2F93 B;  4X65 H;  4CKB A;  3RBZ A;  2VQD A;  1SQB H;  4UB6 Z;  5LP6 B;  1RYR A;  4HYK A;  5J2T F;  2EIJ C;  3P3N A;  5KFH A;  4UB8 Z;  4NKG B;  1Q86 W;  1MMM A;  1PD3 A;  3JRW A;  2VQF O;  5I5X A;  4ASU G;  4MW3 A;  2F66 C;  1G8M A;  3BFR A;  3W1B A;  1JJ2 U;  1GM7 A;  3V4S A;  2BTQ A;  4I9W A;  2HVR A;  2R8H A;  4OPA A;  2UXB O;  4HYO A;  3H1I H;  1S10 A;  1TUB A;  4ZI7 B;  3KCX A;  1Q8I A;  4AIL C;  2JGD B;  4L1K A;  1Y66 A;  5KKN B;  2F1M A;  4LFA H;  5GON A;  2LGW A;  2MW2 B;  4I7Z B;  2VPS A;  4YBZ B;  2W9C A;  1SQP H;  4DRX B;  4ECY A;  4CH3 A;  3I56 V;  1BGY H;  1YCI A;  2NVX A;  4X65 B;  2YW2 A;  4PBC A;  4O2B B;  2HDK A;  2COI A;  4MSW C;  1YXB A;  3HKC B;  2CZG A;  5F9L A;  3EPI A;  1K4C C;  2GBO A;  1PL4 A;  2Q69 A;  4HBN A;  5F2V O;  4JI3 H;  1VMG A;  4YHH O;  3THO A;  3GTQ A;  3N44 B;  2H94 A;  1VQ7 V;  2QEX V;  1ZLZ A;  5FLX N;  5IP7 G;  4ECS A;  5LA6 F;  4ZKI A;  3W7T A;  1VQM V;  5EIB C;  4JI6 O;  2WPD G;  4UCV A;  4JTA B;  4M7E A;  2E76 B;  4MTX A;  3T9F A;  2XD4 A;  2UVU A;  2W6Q A;  2FB9 A;  5BYB A;  3HKZ E;  1MZB A;  3RB4 A;  3ZX6 A;  4Q4D A;  4LP8 A;  4RUA A;  1DIK A;  4MTG A;  2X5R A;  4TUY F;  1B33 N;  5DG8 A;  2YU9 A;  2RF4 A;  3JAW B;  3KHH A;  2ZGI A;  4CHI A;  2C2R A;  5LYJ F;  4HR7 A;  5JQG B;  2UUA B;  4X88 A;  4RAI A;  5LP6 C;  4LBE C;  1FD9 A;  3CMA V;  2OCC C;  1FVI A;  2GQR A;  3T5J A;  4EBD A;  2PVP A;  2WLJ A;  4JI5 O;  3R5X A;  4GC6 A;  4MTF A;  3IC7 A;  1XMO O;  4IRK A;  4JV2 A;  4MAM A;  2IH1 C;  4LCU C;  4BWS C;  3W7S A;  4EGQ A;  1GAX A;  5JH7 F;  1GSA A;  1AR4 A;  2XND G;  1SKV A;  3CRQ A;  4DV2 B;  3K5N A;  2XOK G;  5CA1 F;  2EX3 A;  2ZQM A;  4JI2 B;  1GO3 F;  3DF7 A;  5KFU A;  3DSQ A;  4YJ2 F;  3RGZ A;  2CNQ A;  4O7Y A;  1KJQ A;  1PNK A;  4A3G G;  4UVA A;  4TOI A;  1OCR C;  4FIP C;  1UFI A;  4O2A A;  4JYA O;  3OHB A;  3GTO A;  4PA6 A;  5KFN A;  3H4B A;  3E8H A;  2V4D A;  1CQJ B;  2XCL A;  2Y0S E;  3M7M X;  2Q67 A;  3W5O A;  3H1H H;  3G8D A;  3MFI A;  3V6J A;  4GUN A;  4EFB A;  1M56 C;  2A1H A;  1UJW B;  3MR2 A;  3RFR A;  1RYS A;  4OPH A;  2YXY A;  1G2W A;  3F7Y C;  1Q90 D;  3HB3 B;  4F4W A;  3FAV A;  3I55 V;  4XYL B;  2ATK C;  4CH6 A;  3JAT B;  1BS3 A;  1IX9 A;  1H8E G;  3WWI A;  2ALZ A;  2JGU A;  4MTO A;  1GM8 A;  4IR1 A;  5FNV B;  3F5W C;  3G67 A;  2F95 B;  5FLX W;  2NUA B;  1GN6 A;  1ZTE A;  5IY5 B;  2UXD O;  3CYO A;  2W70 A;  2FPI B;  1N32 O;  2X0S A;  3CCM V;  3O65 A;  2B1I A;  4OX9 B;  2BTO A;  2O57 A;  1NT2 B;  2I87 A;  2R7K A;  4O4J B;  3RT3 C;  1QR9 A;  1N33 H;  1BZK A;  4JV5 B;  2HEP A;  5LXT B;  5JH7 A;  5KFL A;  2E3C A;  5IP9 G;  2QDO A;  4O84 A;  3BEH A;  4NVP A;  1ZSP A;  5L1L A;  3GWO A;  5LP6 A;  1Q81 W;  1URF A;  2BOC C;  1CXZ B;  1I7N A;  4MV6 A;  2JEG A;  3LDC A;  2CNV A;  3TQ1 A;  4DR4 H;  2CGO A;  5EBW C;  4RQE A;  1P7B A;  1FYJ A;  3TQT A;  2DPJ A;  1N33 O;  3TK1 A;  2AU0 A;  1I1K A;  1M6V A;  5T14 A;  5BWU A;  5BR8 B;  2WB1 E;  5K1X A;  2OYQ A;  5DQI A;  5DG9 A;  5DAA A;  3MWE A;  4LF8 B;  3HXL A;  1BE3 H;  4CMF A;  3L75 H;  1BNC A;  5IYC G;  4MV8 A;  1M4U A;  4KFM A;  5C8Y A;  4JGS A;  4ZOL A;  2ZNJ A;  1A48 A;  1KC7 A;  1XMQ H;  2QSA A;  3ZHU A;  3FAV B;  2IMW P;  4PDB A;  3E22 A;  4A3E G;  1NTM H;  3U11 A;  4DR1 H;  1AI7 A;  2HHH H;  3GII A;  2IBZ H;  4TUY A;  3A2F A;  3LDD A;  2DOS A;  5I47 A;  2W7P A;  4J9R A;  1O9G A;  5CA0 B;  2YL2 A;  3HOZ G;  1Y1W A;  2B5U A;  1L0L H;  4R8U A;  4Q8F A;  2JA5 G;  3ABM C;  2GQS A;  5K3W A;  1ZET A;  3B8N A;  5CA1 B;  5LHH A;  4RNO A;  2JEU A;  4UVC A;  1JR9 A;  3T9B A;  5KAI Z;  5A9G A;  3GIP A;  1YSC A;  1JCH A;  1I94 B;  2Q0A A;  3B4S A;  2KB1 A;  3RGX A;  4A3C G;  3ICX A;  5KHJ A;  1WH2 A;  5LMN B;  2AGQ A;  5B3S C;  1SQQ H;  1ET0 A;  3D8C A;  3IJ4 A;  4NYE A;  3RYH B;  2PI5 A;  1FAF A;  4U3J A;  3RV3 A;  1JPX A;  1THZ A;  1I7F A;  2JDI G;  5BR8 H;  1QLN A;  3T5H A;  5KMG A;  4TV8 B;  4WFF A;  3UZO A;  3BPZ A;  2DW4 A;  2GUZ B;  2ZXW B;  4C5B A;  2F4V B;  2NVY A;  2EIK B;  3K5I A;  3R5F A;  5C4X G;  3BVO A;  4IHJ B;  3CPW U;  1JKJ B;  3T5L A;  4JI8 B;  3PO2 G;  1VKZ A;  2EIJ B;  5DQG A;  1I1L A;  4ZHQ F;  5CMU A;  3D36 C;  4YR2 A;  2ZIN A;  2GPW A;  3N6R A;  2FLN A;  1RJQ A;  4APM A;  4LF5 H;  2I8C A;  1SES A;  2ZXW C;  4WD3 A;  4YJ3 B;  4LWS A;  2R84 A;  4EQ5 A;  3AK1 A;  3H9V A;  1EKV A;  2ZT9 B;  3SGI A;  4O7L A;  5KLV H;  3K5O A;  4YP3 A;  4BWA A;  3RF2 A;  4H37 A;  4NXN B;  1YTF B;  2Y0I A;  4QGP A;  1I5Y A;  5I5T A;  3HOW G;  1EN5 A;  2NNU A;  4O4I F;  5CBG A;  3CHX A;  3IGA C;  3OTF A;  5IYD G;  2MK3 A;  3JAR B;  1VAR A;  4CE5 A;  3CP1 A;  2V4Q A;  3WFV A;  3G80 A;  4DV5 O;  2RQ6 A;  2PMZ A;  4PDV A;  5KX5 F;  4I50 B;  4EB6 B;  5F9N A;  1NZ6 A;  3ZHQ A;  1JXL A;  5EZY A;  1SER A;  5LMU O;  3PJS K;  1T36 A;  2W57 A;  2R9I A;  4LSX A;  2PZS A;  4E2L A;  3GB7 C;  4LWS B;  1IBK O;  3CCR V;  4CS4 A;  5KT5 A;  1YDX A;  5KFY A;  1KJJ A;  3OEH G;  1U97 A;  3J7A K;  1D2D A;  5I5W A;  2JJ2 G;  1XMO H;  4Y8V B;  3ETQ A;  3RYI B;  5JCO C;  3AW8 A;  1TVK A;  3DTG A;  5LP6 F;  4RZQ A;  5DLG A;  3T1Y O;  5L3D A;  2ZM6 O;  3NBZ B;  2N05 A;  3ETJ A;  3B40 A;  3B77 A;  4DYL A;  2OTJ V;  1DAA A;  5KT7 A;  3KZI Z;  4O4H A;  1S0O A;  3K57 A;  4JI2 H;  4XBF A;  3MDS A;  1VQ8 V;  1Z2P X;  4P9P A;  1F4N A;  3OD4 A;  4HAM A;  1K34 A;  4QW9 A;  4WF9 V;  1XNR B;  3QTC A;  4GKJ B;  4IZO A;  1QVF U;  3B09 A;  3BQ1 A;  4ECZ A;  1SA0 A;  4O3O A;  4FMT A;  4G2K A;  3RVY A;  4TQR A;  5B1N A;  4TQF A;  3JRX A;  4AYB E;  2PMZ E;  4EEY A;  1HNZ O;  3Q8P B;  2KQX A;  1GRJ A;  1YTF D;  3GIM A;  3G6Y A;  1AIL A;  3MR3 A;  3OUS A;  1R3L C;  4B08 A;  1MA1 A;  1OCC B;  3WB0 A;  3K03 A;  4TSF G;  4LFC B;  3LP8 A;  4FK5 C;  3TGU H;  4GT1 A;  3K58 A;  3CC4 V;  3OUF A;  3AK2 A;  2YXH A;  4XDL A;  2NU8 B;  4ED6 A;  3VQY A;  1S5H C;  2ZDI C;  3AK3 A;  4DV7 O;  5C3E G;  2V9W A;  4QWB A;  5CAE B;  5EZY B;  4ECQ A;  4JAA A;  2QM7 A;  1G4Y B;  3LSU A;  1E1R G;  3S3W A;  4RAY A;  3OTO H;  4LF7 B;  5IE9 A;  2DLN A;  5J2U A;  5JVL A;  2B1G A;  4O3Q A;  2WLK A;  5CR5 A;  5IYB O;  1K33 A;  5E79 Z;  1ORQ C;  5KA6 A;  3JAR A;  1F7Y A;  5JVD A;  3ASN B;  3UO3 A;  1BHA A;  2W71 A;  4Q4C A;  5KFB A;  4ZHQ B;  1VQN V;  5EBM C;  2R82 A;  1W0J G;  4DR5 O;  1XL6 A;  5IJ9 B;  1KU9 A;  4NR1 A;  2OCH A;  4FLW A;  3CCJ V;  2Z0A A;  4HNA A;  5KS8 A;  3FD9 A;  4O81 A;  3PO3 G;  3SYA A;  3L73 H;  3SYC A;  2V59 A;  5KT4 A;  4QJF A;  1KJ8 A;  1AR1 B;  3RB0 A;  5LGN A;  2R93 G;  2VUM G;  4O4L A;  3ORR A;  4ECW A;  2RCV A;  3LWB A;  4CH4 A;  1JDE A;  3SJB C;  2L35 A;  3OMA B;  2SCU B;  5LYJ A;  4DW1 A;  3GIQ A;  4DR1 O;  2QGN A;  3HKE B;  2ADQ B;  4JI0 B;  4LF5 O;  1WB7 A;  3KYH C;  3M9N B;  1GSH A;  1V9P A;  1LNQ A;  3T1Y H;  5JJN B;  3J81 W;  2GTS A;  2HR3 A;  1W0K G;  2HGW A;  2P4K A;  1KP2 A;  1N32 H;  1P7G A;  3FDS A;  1JX9 A;  4OXS A;  4J41 A;  4HN2 A;  4ECX A;  4X64 O;  5L1I A;  2R9A A;  2GTA A;  1SZX A;  1CEZ A;  3HR0 A;  1IVS A;  3TXQ A;  2JVD A;  4X1Y A;  2A79 B;  4TV9 F;  3VA7 A;  3CRR A;  4DV5 B;  3BJY A;  1AB3 A;  1K5S A;  2LJ2 A;  4A3L G;  4J7J A;  3CX5 F;  4DR6 B;  1AUV A;  3OTO O;  2YCH A;  5LOV F;  1JQ0 A;  5KFX A;  2AQ4 A;  1XNQ H;  2P4V A;  1QBZ A;  1ZWI C;  2ZDI A;  3N2G B;  3DC5 A;  4O2A F;  3FB6 C;  5LMU B;  2VQE O;  1FXK B;  1TWA A;  1HR0 O;  4I50 A;  1H38 A;  3ZRW B;  1GGO A;  3AG2 C;  1K9M W;  4LF4 H;  1L8D A;  4O7V A;  1JLL B;  4J0M A;  1EZ1 A;  4CS2 A;  1JX4 A;  2HJD A;  3QF7 A;  2BQR A;  4DV1 B;  1OBG A;  1KEC A;  3BA9 A;  3SPG A;  4X66 B;  1N36 B;  4K0K O;  2VPQ A;  2YEV A;  1S9F A;  1V4Y A;  4I7H A;  2UXD H;  2IJJ A;  2DYS C;  3SJC C;  4UV9 A;  4CMD A;  1FJG H;  4NLG A;  1OCO B;  3RVZ A;  4J11 A;  3RJ0 A;  4BXX G;  1D5N A;  4DK1 A;  5IWA B;  2N74 A;  5D1O A;  2Q4P A;  5KG3 A;  1XUQ A;  2R86 A;  3KTM A;  5IYD O;  1OBD A;  4O4J F;  3CSW A;  4PA7 A;  3CCE V;  2Z5U A;  2J6S A;  5IYZ A;  1Z2N X;  3ZS8 C;  1S76 D;  1V55 B;  4DV7 H;  3TIG A;  2R7Z A;  1A0I A;  2LW1 A;  1FFT B;  3RAX A;  1BQ0 A;  1X4T A;  1YIT V;  3KRE A;  4R8C A;  1LR1 A;  1Y76 A;  4LNU A;  2W6O A;  1OWT A;  4YB8 B;  4EBE A;  2QKC A;  4FLU A;  1NVP B;  2YS6 A;  3K9S A;  4ETS A;  4DV7 B;  2QWR B;  3K5L A;  1M0W A;  5K1P A;  3F5T A;  3OGI B;  1AR5 A;  2ADP A;  1RM1 C;  1HNW B;  4CKC A;  2UU9 B;  4EYH B;  2BQU A;  3K0D A;  4TV9 A;  3W7X A;  1J5E O;  5FLM G;  4PI2 A;  3H1K H;  5C5J A;  2IBK A;  5KFM A;  1HDJ A;  2B9Z A;  4B3T O;  4ZBM A;  1E4E B;  4CKE A;  3BAC A;  2P67 A;  2R87 A;  1D5A A;  1B6R A;  3Q8S B;  4DR2 H;  1CQI B;  3R5H A;  4RB0 A;  4C2M A;  5EK0 A;  5I5U A;  5DG7 A;  1N34 B;  3DTU B;  1OCZ B;  1X9N A;  1X59 A;  5DGI A;  1DGS A;  1PNM A;  1BCC H;  2EIM C;  4JI7 B;  3HKZ A;  4DV1 H;  1SRY A;  3HKD A;  4JPR A;  2JA7 A;  1PM9 A;  1CP9 A;  5H6R A;  4AQY O;  4I55 B;  3E89 A;  1WN7 A;  3SJQ C;  2R8I A;  3H4D A;  1S77 D;  2P6J A;  3WG7 C;  2EIM B;  1KQS U;  2W6N A;  1PPJ H;  1MNG A;  3E22 B;  1MSW D;  2FKL A;  4NZN A;  3IAY A;  5DMX A;  4QPK A;  4IIJ F;  2JA8 G;  5DED A;  5C8Y B;  2CTW A;  5C1P A;  1V54 B;  3RBD A;  4JTC B;  3VQV A;  4LF9 B;  2DWC A;  4LF4 O;  3SYQ A;  3FB8 C;  5KG2 A;  3QNE A;  4O2A B;  3GWK C;  3OHA A;  3KHG A;  2O03 A;  2RDC A;  4LF6 B;  2H3O A;  2HIX A;  4QE7 A;  5CM0 A;  3WWJ A;  3N41 B;  1TUB B;  4F6R B;  4ZI7 A;  3ZMT A;  3GQC A;  4B3T H;  4PV1 B;  5DQH A;  4FFP A;  2K9P A;  4RO2 A;  1TAE A;  2JIZ G;  4X9Q A;  1AI6 A;  1XNQ O;  1J5E H;  2QM4 A;  4UVB A;  2CUG A;  5IT9 W;  4IYH A;  3BG5 A;  1Z5V A;  4GKK O;  2YIB A;  3N43 B;  3ZHR A;  4IHJ A;  2F23 A;  3LUL A;  2WTF A;  4C5C A;  3ZBH A;  2AGP A;  4IR9 A;  1BL8 A;  2VQF B;  4TT3 G;  3SPJ A;  3KHR A;  3T5K A;  3SPC A;  4LFA O;  1NH2 D;  5KFP A;  3AG1 B;  3ABL B;  3CSX A;  2KG7 B;  2UXB B;  4BAY A;  3B8M A;  5B1B C;  2WYO A;  1RFY A;  3E8F A;  3Q8Q B;  3C3S A;  4A5U B;  1EKP A;  3I4M G;  3GTK A;  4O82 A;  2YS7 A;  3U9S A;  2VA3 A;  4IRC A;  3IC9 A;  4JI1 O;  4K0K B;  3U10 A;  4CBC A;  1BQZ A;  3DXR A;  2IJK A;  3J80 W;  3N27 A;  4DV0 B;  2C22 A;  2UUB B;  1YJN V;  4IIJ A;  4I4T A;  5B1A C;  4QSH A;  3AG3 C;  1K3E A;  3JCU Z;  1KTA A;  2YSU B;  1SC5 B;  1RJP A;  1WR2 A;  2JEX A;  5KFE A;  3RUP A;  4FM2 A;  3OFN G;  1QHT A;  2FYU H;  2WLH A;  3WG7 B;  2ZIO A;  4DAA A;  4LF7 H;  2DWD C;  2W0X A;  3VBB A;  1VQL V;  4Q8E A;  4B3R H;  2YI8 A;  1K1S A;  4A93 G;  2DYR C;  3LQS A;  4FPP A;  4R8U B;  1K92 A;  5KX5 B;  3Q8R B;  1DTO A;  4YHH B;  1EM1 A;  3JCZ A;  4DR5 H;  4PZ8 A;  2COJ A;  1EFR G;  4ABM A;  1M5I A;  4TUY B;  2X0L A;  2V7Q G;  4UCU A;  1HR0 H;  2VR1 A;  3OSN A;  1K83 A;  4JI3 O;  1K8A W;  5EWE A;  3S24 A;  1BSM A;  5BWV A;  1XHZ A;  4O4I A;  4MVM A;  3IFX A;  5JJJ B;  3ZRW A;  2FMA A;  3GIL A;  3JSL A;  4J9S A;  1ARO P;  4GKJ H;  5A2Q W;  4JI1 H;  3K59 A;  1PK8 A;  1WPX A;  1XMQ O;  2A3Q A;  1IYE A;  4I55 F;  4X64 H;  2YZM A;  3DXR B;  1YJW V;  2LFR A;  4FBU A;  4JI5 H;  1NR7 A;  3U9T A;  3IN5 A;  1RSO B;  3RTX A;  4FFB A;  1Y1W G;  4DV3 H;  1DF5 A;  2OCC B;  1GH6 A;  5LGT A;  3CXC U;  2UXB H;  2FB5 A;  4YJ2 A;  3GTG A;  2C2A A;  2ITD C;  2FLP A;  1KYO F;  2R6F A;  4UV8 A;  1L2Z A;  4XYM B;  5JQG A;  2C35 B;  1XHX A;  3T9D A;  4DW0 A;  3GTP A;  2M05 A;  2FLL A;  3JAW A;  1MZE A;  2VQE H;  4G28 B;  4F6E A;  4BR6 A;  3GDE A;  5EOY A;  4DV2 O;  5C93 A;  5BYA A;  2Q6A A;  3HPL C;  3G4S V;  3QQM A;  1QVG U;  4O3P A;  4JI2 O;  3GLK A;  3OR6 C;  2A7W A;  2EIL C;  1CKM A;  3QZ8 A;  5KUK A;  3JAK B;  2COG A;  4DV6 B;  1SQG A;  5L3F A;  3X2Q B;  4F4Z A;  3JD1 A;  4Q43 A;  4DV6 H;  4MV9 A;  1RP3 B;  2OLS A;  4X62 H;  2E75 B;  2PI4 A;  4CC6 A;  1Y74 A;  1N0J A;  4LF6 O;  2JEJ A;  2XAJ A;  2QWQ B;  2FKX A;  2ZE6 A;  3MJF A;  1GO3 E;  3FKI A;  4O7W A;  3PN1 A;  1Q6H A;  3KG2 A;  4MV7 A;  3BA8 A;  1IBL B;  3WB1 A;  3HKC A;  3CS5 A;  1Y74 B;  3HKB B;  2Z3Y A;  4YIP A;  1EYZ A;  1FXH A;  4KL1 A;  1R6N A;  4Q20 A;  1H2G A;  2YXL A;  4AI8 A;  5KFD A;  4P9O A;  3JAK A;  1IYD A;  3ASN C;  1PP9 H;  3T99 A;  4I55 A;  1CE8 A;  2ASD A;  1E4F T;  4DR3 H;  1ZX3 A;  2WAM A;  2PTM A;  2JGD A;  4JI5 B;  4MVZ A;  1Y4M A;  4OX9 O;  3JAM W;  4FLT A;  5B1A B;  2Y4R A;  3N6X A;  2ATL A;  3JYC A;  2YDE A;  4DL6 A;  4JI1 B;  3HOX G;  1AP6 A;  2WSS G;  2OT5 A;  4Q0Y A;  4PHZ A;  3KKY A;  4ZOL F;  1US6 A;  3RGB A;  4O7T A;  3EHB B;  4QIW E;  4ED3 A;  4WFE A;  1OCZ C;  2JEF A;  1VQ9 V;  1SEI A;  4DL2 A;  1M7J A;  4GYC B;  4TV9 B;  3RBE A;  4XDJ A;  4QE9 A;  1R3I C;  4TQD A;  1I94 H;  3JAL B;  4I4T F;  5EDW A;  3LUT B;  5LOV B;  1S0N A;  2E5L B;  3RYF B;  4Z1V A;  1S0M A;  5BR8 O;  1GN3 A;  3SE7 A;  5KHH A;  3V4Z A;  2XAQ A;  3LML A;  1JFF B;  4J9Y B;  1F23 A;  5HFM A;  2EBO A;  5JJE B;  2WLN A;  4KP4 A;  4DL7 A;  4ED8 A;  4RQF A;  1AN7 A;  1QNM A;  1SF9 A;  4A3I G;  1NS1 A;  1RK6 A;  3L74 H;  3OE7 G;  1PNL A;  4K0K H;  3CC7 V;  4FLV A;  3N2K A;  4O83 A;  1JIH A;  4G3I A;  1IZ3 A;  2HJF C;  2JJ1 G;  4E6N A;  4K8Z A;  2UXD B;  4GX0 A;  2YEV B;  2H8P C;  2Y4T A;  1W2B U;  4EFE A;  4JZ2 A;  2KSW A;  5KFQ A;  2A9H A;  2EZO A;  1LUV A;  1FPO A;  1IUR A;  4O2B A;  2ZR2 A;  4PDM A;  2YWV A;  4NTY A;  3M9M B;  2PF4 E;  3N2G A;  1M57 C;  5BXZ A;  2W6M A;  1ZQ7 A;  1QQC A;  3FKI G;  3R65 A;  3GTL A;  4DR4 B;  2Q7G A;  3P3P A;  2CK3 G;  5BMV A;  2W6J G;  5FPR A;  3BY6 A;  5GON B;  3TW6 A;  5FPO A;  4J9M A;  2UVW A;  2HVK C;  2QYZ A;  3GJX B;  4MTE A;  2HP8 A;  1Y67 A;  3K08 A;  3HO8 A;  5I5S A;  1IBL H;  2DN9 A;  4YJ3 A;  5KG6 A;  4O7R A;  2IM9 A;  2BTQ B;  3ZHV A;  1NR1 A;  4X20 A;  5A2Q N;  1A32 A;  3OR7 C;  1W96 A;  2DMX A;  1GMG A;  4G27 B;  5HNE A;  2YZL A;  4BY1 G;  3OUU A;  3VQX A;  5I5Y A;  4KHP H;  2F4V O;  3VQW A;  5E1A C;  2FL4 A;  5LBQ A;  1BGW A;  4HNV A;  2XCP A;  2CE4 A;  5LYJ B;  5KFF A;  3CJH B;  3F7V C;  2KG7 A;  4FU0 A;  4IL6 Z;  3RYC B;  3KAL A;  3BRC A;  1YIJ V;  4PI0 A;  1IBL O;  2YIB D;  4O3S A;  1VF6 A;  5KA5 A;  5KT3 A;  4J9Z B;  1OCC C;  5L3B A;  3GVM A;  1XEQ A;  3BQ0 A;  4YY3 B;  4NXN O;  4X1K A;  5KFA A;  4FLY A;  1YJ9 V;  1VQ5 V;  1V51 A;  4DV3 O;  1KD1 W;  1KP3 A;  4JI7 H;  1XRE A;  2K1E A;  4D7T A;  4I50 F;  1VQP V;  1H2N A;  3KAJ A;  2V1D A;  2FTK A;  3TJT A;  4QWC A;  2XIG A;  1NTZ H;  5IJ9 A;  4O3N A;  1XQ8 A;  2JA5 A;  3ZHS A;  5K2M A;  1Y1V A;  1NI8 A;  3OEE G;  3QO5 A;  5D1P A;  2R8G A;  3OMI B;  2X6A A;  3A8T A;  4IYI A;  2HG5 C;  4FVM A;  3PW7 A;  5LA6 A;  5IYZ F;  5J2U B;  3RN4 A;  3OUZ A;  2LP7 A;  5H6Q A;  5D8D A;  4J10 A;  3K5M A;  1YEW A;  2EIY A;  3SYP A;  4P30 A;  4HQ6 A;  2NLJ C;  2WA4 A;  2AZ2 A;  4X1I A;  3QZ7 A;  2JA6 G;  3EXA A;  1H2L A;  4DUZ H;  2N04 A;  5L3C A;  3T1H B;  4LFC H;  4IWY A;  1Z2O X;  4NXM B;  4JI8 O;  2Y48 A;  1VQ6 V;  3NR7 A;  3T1C A;  2QF7 A;  2ZE5 A;  5BZB A;  2CAZ C;  4WFB V;  4B3R B;  4FJC C;  4JYB A;  4WBN F;  5LMN O;  3JZ6 A;  2JK5 C;  1K1Q A;  5IWA H;  3MHH C;  2R93 A;  1KUT A;  4JYY A;  2W6Z A;  3FYE B;  1GYF A;  1KKC A;  4K8X A;  2V5A A;  4DV0 H;  2R72 A;  3SR2 C;  3FYI B;  3U0G A;  2XGQ A;  4O4H B;  2BR0 A;  4RAZ A;  3U55 A;  3SI8 A;  3RYC A;  5IJ0 A;  2WLM A;  1Y76 B;  2UXC B;  5D1O B;  3DC6 A;  2E2I A;  4J80 A;  5CN0 A;  2EIL B;  4PZ7 A;  4JAS A;  1VF6 C;  5JQW A;  1Z5W A;  4YY3 H;  3EYY A;  4FS1 A;  3PW2 A;  5I60 A;  3RYI A;  2YRW A;  3WO0 A;  2IW5 A;  2ASL A;  3L72 H;  4UXN A;  2XT9 A;  1HNX O;  3M8A A;  3J81 N;  4DV5 H;  1S5J A;  1F4M A;  2WE6 A;  2R92 G;  4JV0 A;  4FBT A;  1I6U A;  3MFH A;  1IBM B;  2A0L A;  3CME V;  4BIO A;  2E2H A;  3RV4 A;  4LF6 H;  5BMV B;  1QR8 A;  4EG0 A;  4GZR B;  5KFC A;  4HZ3 A;  3N2K B;  4LC1 A;  3STZ C;  4MS2 A;  3GV8 B;  2B63 G;  4N23 A;  2M6Y A;  4MVU A;  3G6X A;  1Y6X A;  3OW2 U;  1P8L A;  4UFZ A;  1SZT A;  5CA0 F;  3F8N A;  2WDT A;  4RU9 A;  3MR6 A;  4B7K A;  1KUQ A;  2L6L A;  4DR7 B;  1QCE A;  4FM0 A;  4A3K G;  5TIS Z;  2Q9L A;  1XNR O;  4BW9 A;  1FXK A;  4NTW A;  5JVD F;  2OH2 A;  1O75 A;  2JRI A;  1IBK B;  2JA6 A;  4NZM A;  3LSS A;  1VAJ A;  4LF5 B;  5CA3 A;  5IJ0 B;  3PW0 A;  5CB4 F;  3PFF A;  1PKX A;  3Q4H A;  1C30 A;  4DV3 B;  5HBR B;  3UYY A;  1R73 A;  2ZIM A;  3AG4 B;  1M90 W;  4YAJ B;  4J9K A;  2HKO A;  1Q6U A;  5KG4 A;  4TM5 A;  2LW7 A;  3G6V A;  3T4Z A;  2Q73 A;  4TV8 A;  3GV7 B;  3AG2 B;  3JD3 A;  1WNS A;  2AHY A;  1VF5 B;  2EIK C;  2YI9 A;  1NQT A;  1YI2 V;  3OTO B;  5CE8 A;  3SJA C;  4DR2 B;  3JAL A;  4H33 A;  4BIU A;  1FKA O;  2CFM A;  4JAU A;  2QKA A;  1S0V A;  1WJZ A;  4PA3 A;  1HNZ B;  5AG2 A;  4DIM A;  2XC9 A;  3TCU A;  1ZUQ A;  1EN6 A;  4QIW F;  4U3J B;  1HR0 B;  1WSC A;  2UU9 H;  2IP4 A;  4NXM H;  3WB2 A;  3AX6 A;  4DR5 B;  1JA8 A;  4FZ1 A;  4YHH H;  1AI4 A;  1B6Q A;  1Q6I A;  5EYP A;  4FFN A;  2V58 A;  3GB8 B;  2WA3 A;  4DO2 A;  4NXM O;  3VPC A;  1KB9 F;  1IXM A;  1WA8 A;  4K35 A;  4B3S O;  3E5N A;  3U54 A;  1OCR B;  2AW9 A;  3D3Q A;  1B3Q A;  1CS0 A;  4ECR A;  1H2S B;  5B1O A;  4H44 B;  4ED2 A;  4R50 A;  3ETD A;  4XX0 B;  5C1O A;  5EBL C;  5LA6 B;  3C0F B;  5IY5 C;  2FJZ A;  5KG0 A;  1G6U A;  3CQZ A;  1JOY A;  2R9R B;  2UVR A;  2CTP A;  1FJG B;  4ZOL B;  3N8D A;  3NUA A;  4L8J A;  3UO2 A;  4DRX A;  3SPI A;  1VQO V;  1VIB A;  4X66 H;  2UUC H;  2QWN B;  2BE3 A;  5J9P C;  2P06 A;  1TWH A;  1XDC A;  4DR3 B;  2DAA A;  1GM9 A;  2ZDQ A;  2VQF H;  1I5X A;  3P32 A;  4JV1 A;  2P0A A;  3FB5 C;  2EIN B;  5JQG F;  1RPR A;  1HNW O;  5EC2 C;  1K73 W;  2YRX A;  3OT7 A;  1WRV A;  4DR6 O;  1J5E B;  1QLE B;  1SCU B;  4X1K B;  2CQY A;  4F4L A;  3N42 B;  4ZQI A;  3J7A U;  1FKA H;  3ABL C;  3A0H Z; 
#chains in the Genus database with same CATH homology
 4JI1 H;  3K59 A;  4DUY B;  1O9G A;  5CA0 B;  4X64 H;  4KHP B;  4HNA B;  3MWM A;  1XI1 A;  4JI5 H;  4O4L B;  5JH7 B;  3RTX A;  4X62 B;  5CB4 A;  1SQF A;  4FM1 A;  4FFB A;  4DV3 H;  3KAK A;  4X64 B;  4ZHQ A;  5CA1 B;  4DUY H;  2UXB H;  4RB3 C;  1FFX A;  1Q43 A;  4YJ2 A;  4YJ2 B;  5JVD B;  3IG0 A;  1TVK B;  3A2F A;  2VWJ A;  1I94 B;  1L2Z A;  2Q0A A;  4FFB B;  1XHX A;  5JQG A;  1HNX H;  4JYA H;  3RGX A;  3ICX A;  3JAW A;  5FNV A;  5KHJ A;  2VQE H;  1WH2 A;  5LMN B;  3MAQ A;  3GDE A;  5EOY A;  2PY5 A;  3RWR D;  2VQE B;  3RYH B;  1ZHS A;  3FMA A;  4U3J A;  4JI4 B;  4DRF A;  4WBN A;  1CKM A;  1I7F A;  2KKW A;  3JAK B;  5BR8 H;  2PYL A;  1HW7 A;  5KMG A;  4TV8 B;  4DV6 B;  1SQG A;  4FLZ A;  3BPZ A;  2VUG A;  4DV6 H;  4UCR A;  2F4V B;  4MV9 A;  4X62 H;  2PUS A;  4IHJ B;  4CC6 A;  3K3V A;  4JI8 B;  4JI4 H;  3B2E E;  1SA0 B;  2ZIN A;  3PN1 A;  5LXT A;  4LF5 H;  5LOV A;  3BA8 A;  4MV7 A;  1IBL B;  4APM A;  4MTD A;  4CC5 A;  3WB1 A;  3HKC A;  5LMN H;  2UUB H;  3HKB B;  4YJ3 B;  3L2P A;  4EQ5 A;  4DR1 B;  3SGI A;  1HNX B;  4KL1 A;  3K5O A;  1JFF A;  4BWA A;  3RF2 A;  2YXL A;  4NXN B;  2VOB A;  4CH5 A;  3H20 A;  4FM9 A;  2OWO A;  3JAK A;  2HGS A;  3QG5 A;  4I55 A;  3RYF A;  2XHB A;  2E5L H;  1E4F T;  4DR3 H;  2ZM6 H;  4JI6 H;  1T5E A;  3CHX A;  4JI5 B;  2PTM A;  3JAM W;  4FLT A;  3OTF A;  3N6X A;  4O4J A;  1HNZ H;  3JAR B;  4LH7 A;  4JI1 B;  4AQY B;  4Q0Y A;  3RR5 A;  4PHZ A;  2RQ6 A;  3UQ8 A;  4B3S B;  4UCS A;  2ZJT A;  5KMG B;  5KHK A;  4I50 B;  3RGB A;  4EB6 B;  4F6R A;  4B3T B;  2HVS A;  5EZY A;  2W57 A;  5KHI A;  1SEI A;  1KMI Z;  4LSX A;  4GYC B;  2PZS A;  4TV9 B;  2PYJ A;  4LF8 H;  4EB6 A;  4CS4 A;  4TQD A;  2CW8 A;  1I94 H;  3JAL B;  3J7A K;  5LOV B;  1XMO H;  3ETQ A;  3RYI B;  5JCO C;  2E5L B;  3RYF B;  1S03 G;  1TVK A;  4OX9 H;  4RZQ A;  5KHH A;  5J2T B;  3NBZ B;  1IBK H;  3LNN A;  1XMO B;  3LML A;  1JFF B;  4O4H A;  4ZIB A;  1VF7 A;  4PZ6 A;  3K57 A;  4JI2 H;  4DV4 B;  4B3M B;  1Z2P X;  5LMU H;  3NBY B;  4JI3 B;  5JJE B;  1XDN A;  4LR3 A;  2CW7 A;  2P22 C;  1VS0 A;  2P5O A;  4DR7 H;  1ZHQ A;  4X1Y B;  1AN7 A;  1XNR B;  3QTC A;  4GKJ B;  4GKK B;  1SA0 A;  4LMY A;  5FD6 A;  4TQF A;  4K0K H;  4FLV A;  3HKB A;  5D5Q A;  3N2K A;  2F4V H;  4E6N A;  4K8Z A;  4LFA B;  4B08 A;  2UXD B;  3JAS B;  3WB0 A;  1N32 B;  3UT5 A;  4LFC B;  4EFE A;  2KSW A;  3K58 A;  1IBM H;  4JI6 B;  1M0T A;  4O2B A;  4DK0 A;  4A2B A;  3VQY A;  4JI0 H;  2UUC B;  3N2G A;  4RB2 C;  5EZY B;  1QQC A;  4DR4 B;  2Q7G A;  5BMV A;  5FPR A;  3OTO H;  4RAY A;  5GON B;  5ITZ B;  4LF7 B;  5J2U A;  5FPO A;  2Q2U A;  3GJX B;  4MTE A;  3RYH A;  1Q5O A;  4LNU B;  3JAR A;  5JVD A;  1IBL H;  2MCT A;  2UXC H;  4YJ3 A;  4ZHQ B;  1O9H A;  2IM9 A;  2BTQ B;  4X1I B;  4CS3 A;  4X20 B;  4X20 A;  4LFB B;  4JI8 H;  5IJ9 B;  1KU9 A;  3RIZ A;  3CB2 A;  4FLW A;  3VQX A;  4HNA A;  4A2A A;  4KHP H;  5CA0 A;  3VQW A;  5CA1 A;  1BGW A;  3BHP A;  5LYJ B;  4Q6G A;  2UUA H;  1RSO A;  2Q7H A;  4O4L A;  3RYC B;  1M93 A;  3BRC A;  3KAL A;  4PI0 A;  3KXY T;  4CH4 A;  2Q7E A;  2YIB D;  5KX5 A;  3VNN A;  3SJB C;  1XK5 A;  4O4I B;  2ZNI A;  1TA8 A;  5EIB D;  5LYJ A;  3QWU A;  2Q2T A;  3HKE B;  2PGG A;  5LL6 b;  2RGR A;  2JS5 A;  4JI0 B;  4GLX A;  4YY3 B;  4X1K A;  4JYA B;  3ZED A;  3JAT A;  3KYH C;  4IAJ A;  3TY5 A;  3T1H H;  4FLY A;  1V9P A;  3T1Y H;  5JJN B;  4DUZ B;  3J81 W;  3L4J A;  5DIS C;  3CVZ A;  4JI7 H;  1SYX B;  4D7S A;  1N32 H;  4D7T A;  1CKO A;  4LF4 B;  4FLX A;  1ZAU A;  3KAJ A;  2HVQ A;  2FE3 A;  2R9A A;  2XIG A;  2VWK A;  3TY8 A;  4UCO A;  5IJ9 A;  4LFB H;  1XQ8 A;  4IIJ B;  2JVD A;  4X1Y A;  5CB4 B;  4DV5 B;  5D1P A;  4GKK H;  1XNQ B;  4DR6 B;  4I4T B;  2YCH A;  1XNQ H;  2F93 B;  3N2G B;  2HHH B;  4FVM A;  4X65 H;  4RB1 A;  5LA6 A;  5LP6 B;  5J2U B;  5LMU B;  1FFX B;  4I50 A;  1YEW A;  3K5M A;  1XMQ B;  3M4I A;  2F66 C;  2RJZ A;  3W1B A;  4LF4 H;  1N36 H;  2BTQ A;  4X1I A;  2HVR A;  1L8D A;  1P16 A;  1TUB A;  4ZI7 B;  4DUZ H;  4J0M A;  4CS2 A;  1Q8I A;  4AIL C;  3T1H B;  3QF7 A;  4LFC H;  4DV1 B;  3HKE A;  4X66 B;  3BA9 A;  1Z2O X;  4NXM B;  1N36 B;  2F1M A;  5JCO A;  4I7H A;  4LFA H;  5GON A;  3SJC C;  5ITZ A;  2VPS A;  2UXD H;  1FJG H;  3RJ0 A;  2CAZ C;  4DRX B;  4B3R B;  4DK1 A;  4CH3 A;  5IWA B;  5D1O A;  1JMK C;  5IWA H;  4X65 B;  4O2B B;  5J2T A;  4DR6 H;  3HKC B;  5IYZ A;  4K8X A;  1GYF A;  1Z2N X;  4DV0 H;  3U0Z A;  2R72 A;  3SR2 C;  4HBN A;  3ZS8 C;  4JI3 H;  1N33 B;  4DV4 H;  4B3M H;  3THO A;  4DV7 H;  4O4H B;  4RAZ A;  3N44 B;  4LF9 H;  1A0I A;  1X4T A;  3RYC A;  5IJ0 A;  4LNU A;  5EIB C;  2UXC B;  4UCV A;  4FLU A;  5D1O B;  4M7E A;  4ETS A;  4DV7 B;  4PZ7 A;  3K5L A;  1M0W A;  5K1P A;  1Z5W A;  4YY3 H;  1HNW B;  2UU9 B;  3EYY A;  3BAB A;  1MZB A;  4TV9 A;  4PI2 A;  3RYI A;  4I9Q A;  1WPB A;  4DR2 H;  1D5A A;  4DV5 H;  1S5J A;  4LH6 A;  2WE6 A;  3JAW B;  1I6U A;  4RB0 A;  3HKD B;  1IBM B;  4B3S H;  5JQG B;  2UUA B;  1FVI A;  5LP6 C;  1N34 B;  1X9N A;  4AQY H;  4LF6 H;  5BMV B;  1DGS A;  3N2K B;  4JI7 B;  1N34 H;  4DV1 H;  1B04 A;  3HKD A;  2ZM6 B;  1P8L A;  4UFZ A;  4I55 B;  2WDT A;  3F8N A;  1WN7 A;  4BWS C;  3FFQ A;  4DR7 B;  4FM0 A;  1SKV A;  4DV2 B;  3K5N A;  1HNW H;  2EX3 A;  4BW9 A;  4DV2 H;  4JI2 B;  5FD5 A;  3DF7 A;  3RGZ A;  3DSQ A;  1O75 A;  3E22 B;  1IBK B;  3IAY A;  4EEQ A;  4TOI A;  4LF5 B;  4O2A A;  5IJ0 B;  5C8Y B;  2GV9 A;  2V4D A;  4DV3 B;  4AHC A;  2QJ1 A;  2ZIM A;  3M7M X;  3VQV A;  1BJT A;  4LF9 B;  5D5P A;  3W5O A;  4EFB A;  4O2A B;  3L4K A;  5IYZ B;  2O03 A;  3RFR A;  4LF6 B;  2HIX A;  4TV8 A;  3N41 B;  1TUB B;  4F6R B;  4ZI7 A;  1WNS A;  4B3T H;  1TAE A;  2YI9 A;  4CH6 A;  3OTO B;  1J5E H;  3JAT B;  2QM4 A;  3SJA C;  5IT9 W;  4DR2 B;  3JAL A;  1Z5V A;  2CFM A;  1XNR H;  2YIB A;  3N43 B;  2JGU A;  3JSN A;  4IHJ A;  5KHG A;  3TY9 A;  1HNZ B;  5FNV B;  4NXM H;  4U3J B;  1HR0 B;  2UU9 H;  2F95 B;  1Q3E A;  5FLX W;  3WB2 A;  2VQF B;  3BAA A;  1TGO A;  4DR5 B;  4LSA A;  1JJO A;  3CSX A;  2UXB B;  4WBN B;  4YHH H;  4OX9 B;  2BTO A;  5EYP A;  5EYP B;  2WYO A;  2YIA A;  3GB8 B;  1NT2 B;  4O4J B;  4K0K B;  3U10 A;  3W1G A;  2HIV A;  1N33 H;  4JV5 B;  2HEP A;  3J80 W;  4DV0 B;  2UUB B;  5LXT B;  5JH7 A;  4IIJ A;  2E3C A;  2RGV A;  4I4T A;  1H2S B;  2R70 A;  4NVP A;  4FM2 A;  4JV5 H;  5LA6 B;  3UT5 B;  1QHT A;  2ZIO A;  5LP6 A;  3C0F B;  1G6U A;  4LF7 H;  3JAS A;  4B3R H;  4DR4 H;  2YI8 A;  1FJG B;  4ZOL B;  2ZCE A;  4R7R A;  5KX5 B;  3N40 P;  4L8J A;  4DRX A;  4YHH B;  4X66 H;  2UUC H;  1P49 A;  4DR5 H;  4PZ8 A;  5BR8 B;  3T1Y B;  5K1X A;  2OYQ A;  1E4G T;  4DR3 B;  1M5I A;  4TUY B;  2VQF H;  3HXL A;  4LF8 B;  4UCU A;  1CKN B;  1CKN A;  1HR0 H;  1M4U A;  5C8Y A;  4ZOL A;  3S24 A;  2ZNJ A;  1XMQ H;  4NXN H;  1XHZ A;  4O4I A;  4PDB A;  5JJJ B;  3E22 A;  1J5E B;  4X1K B;  3U11 A;  4DR1 H;  4UCT A;  3JSL A;  3N42 B;  3NC0 B;  2HHH H;  1FKA H;  1S68 A;  4TUY A;  4GKJ H;  5A2Q W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...