5FPRA

Structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 307
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fprA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fprA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fprA02
4JI7B 2UU9B 3GJXB 2UXBB 2UUCB 4LF6B 1N34B 1CKMA 3L2PA 1XMQB 4JYAB 4JI2B 4NXNB 4DR6B 2E5LB 3W5OA 1CKNB 5D1PA 1IBKB 4DV0B 4TOIA 4YY3B 4OX9B 3RTXA 5LMNB 4UCRA 1XMOB 4GKJB 1CKOA 4DUYB 3SGIA 4UCVA 4EFEA 4E6NA 4LFBB 4PZ7A 4DV4B 4DV5B 4B3RB 3VNNA 4DR5B 4X62B 4JI0B 1HR0B 2F4VB 4EFBA 4B3MB 4JI3B 4LF8B 2HHHB 2HIVA 1IBLB 4EEQA 4JV5B 1N33B 1ZAUA 4DV7B 4K0KB 4GKKB 2HVQA 4KHPB 5LMUB 3NBZB 1X9NA 2HVSA 5BR8B 4YHHB 4DV1B 2OWOA 3UQ8A 3KYHC 4X64B 4DUZB 4AQYB 2ZM6B 5D1OA 4DV2B 4EQ5A 5IWAB 3TY9A 1V9PA 3TY8A 4DR4B 3S24A 2Q2UA 4GLXA 1I94B 1XK5A 3RR5A 1VS0A 1J5EB 4UCTA 2UUAB 1CKNA 3W1GA 4LH7A 3PN1A 3BA9A 1P8LA 3OTOB 4DR3B 4JI4B 4X66B 4UFZA 4X65B 1HNWB 1XNRB 2Q2TA 5FPRA 3NBYB 4PZ6A 1N36B 1XDNA 2HIXA 3T1HB 1DGSA 3GDEA 1B04A 3TY5A 4UCOA 1FJGB 2VUGA 2UXCB 3BABA 5FPOA 4NXMB 2UXDB 4PZ8A 4LFAB 5DISC 3W1BA 1A0IA 4UCSA 3GB8B 2VQEB 3NC0B 5D1OB 1TAEA 4B3TB 2UUBB 4JI1B 4B3SB 4DR1B 1FVIA 4DV3B 4DR2B 1HNXB 3JSLA 1P16A 4LF5B 4JI6B 1IBMB 2VQFB 4UCUA 4LF7B 4CC6A 4LH6A 2CFMA 3T1YB 4LFCB 3JSNA 4CC5A 3QWUA 4DV6B 1HNZB 1N32B 2HVRA 4JI5B 1S68A 4DR7B 4DRFA 4LF4B 4LF9B 3BAAA 1TA8A 1XNQB 4JI8B 3BA8A
chains in the Genus database with same CATH superfamily
2LO1A 3U10A 2OCCB 1EN4A 1H38A 3RYHB 2NU7B 2J9GA 1JA8A 2Y4RA 4LFCO 5CN0A 2JIZG 3T4DA 3FMAA 2DIKA 1XREA 4WFBV 1UJWB 4UCRA 3ZHVA 3WO0A 4GKJB 5HV6A 1KEEA 4DUYB 1K73W 3BFRA 2DPJA 3OUFA 5JJJB 3SDLA 2ZIMA 4LF6O 4X20B 4Q4DA 2F4VB 2DYRB 1VQ6V 1TVKB 5IDJA 3ABKB 5ITZB 3Q2OA 3ZJZA 1BNCA 3JARA 1RJPA 4DV7B 3HXLA 1AN7A 1DAAA 4Z1MG 3ABLC 3J7AU 3OHAA 4YR0A 2QKCA 3SR2C 3AK2A 3N41B 1FYJA 4B3MO 4LF8O 2W9CB 4AYBA 4DL7A 3A0HZ 1NU1H 4GLXA 2HJWA 3ASNC 2JA8G 3O9OA 5LMUO 4IRKA 1ZWIC 3TIIA 3CCSV 5DGAA 5C8YA 1LR1A 1PNKA 3LDEA 4DO2A 4GCZA 4X64O 1JJOA 1Q3EA 4YJ3F 4DR4H 3KHGA 3HR0A 2WLLA 2HIXA 3G67A 3T9CA 4MA5A 4FLZA 5C1PA 1B04A 2PTMA 4ZOLB 2JJ2G 1MZBA 2BQRA 5LHGA 2C22A 1G4YB 3R9RA 4JI4H 4A93G 5I5TA 4M9UA 3W1BA 4UCSA 1N33O 5E25A 1C3OA 2PGGA 3QFFA 5KHJA 4I0XB 4B3TB 1DV1A 4B3SB 5B1NA 5J2TF 3RAQA 1VQ9V 4K6NA 3EPIA 1I0HA 4CBCA 3WO1A 2JA7A 1ZL8B 1JJ2U 1AROP 3RB4A 4HNVA 2VQFB 1WA8A 4RWUA 2XAJA 4O81A 2CDYA 3F5TA 4CC6A 2I8CA 2HVKC 5KMGB 4MV6A 2ADQB 3QWUA 1WP8A 3L73H 4DL2A 3T99A 1S76D 2Q8VA 1VF5B 5I5SA 2YI9A 1XNQB 1KP2A 4YAJB 4QIWA 5KUKA 1IBMO 5DM6V 3L2PA 1R9TA 5KFCA 3N27A 2OLSA 1IBKB 2FLNA 4TOIA 3LP8A 1F51A 3L72H 2R86A 2M7WA 4UCVA 2AZ2A 4LF9O 1W59A 2HLDG 1ULZA 3OE7G 5B1AB 2GUZB 1SS3A 2YC0A 4LF6H 3LDDA 1G8MA 3K3WA 4D6TH 2WA4A 1HR0B 2HDKA 2IP4A 1IBLB 3RYIA 2IBZH 4O4IA 2E5LO 5C44G 4FK5C 2W0FC 4TV8B 3GV8B 1B3QA 4JYBA 5KFQA 1QR9A 4FFLA 3JALA 2ZXWC 4I9WA 5BR8B 4DV5O 4YR3A 2WLIB 4X62O 1DF5A 2A9HA 2ARHA 4B3MH 4LF8H 3H1KH 5IWAB 4WFAV 4ECXA 4IL6Z 3RF2A 4DW0A 1QLEC 3I55V 2Q2UA 5CE8A 4U3FH 2C2DA 1OHHG 1I94B 4O2AB 3KCXA 3H1IH 2E2HA 5LMUH 4O4HB 1XMQH 5KT7A 4LNUA 4NYEA 1MSDA 1Q43A 3BA9A 1P8LA 2SCUB 4X64H 5GONF 4DV2O 2N04A 5KG3A 3DGEA 3G6EV 1WCMA 1N48A 4FGRA 4O86A 4TV9B 2CW7A 1SQXH 1VF6A 1JIHA 4IWYA 2L35A 3DF7A 3K9AA 2P6JA 1OCZB 3C3TA 5BY1A 4I7ZB 4LFAB 2YCHA 4J9KA 1XUQA 3HKBA 1SERA 1N33H 1A0IA 3UFXB 4J9QA 1QNMA 2Q0OC 2GPWA 1QVFU 2BQ3A 1PX2A 4C5CA 3HKCB 4JAUA 2PYLA 2OT5A 1FVIA 5FNVF 3WWIA 5KFKA 3G80A 2NNUA 1HP8A 3CQZA 1KECA 4FFKA 3BVOA 1HNXB 2YRWA 1KC7A 5KFNA 3K0DA 2PMZA 1FXHA 1SCUB 3MWEA 2IA6A 3QF7A 4UVBA 1VBHA 3DC6A 2JJ1G 3RB0A 4QIWE 4X1YB 2YZNA 2K9PA 2RJZA 1P7BA 2WLJA 4ZHQA 5LP6F 4BW9A 2Q9LA 4EB6B 3LUTB 1M9NA 1IX9A 4PA6A 3UCSC 4LF4B 4A3MG 3N8DA 3BG5A 2R82A 5A9GA 3T54A 3T9FA 4KUMA 4LF5O 2UU9B 1I08A 5GW7A 3RVZA 2ZD9A 3OGCC 1LNQA 4TT3G 2CNUA 2GQSA 1GN3A 3E2EA 4GX5A 1E4EB 1SQQH 1PPJH 2XIGA 1Q6HA 5KFBA 4H37A 1R3JC 2RMKB 4MV1A 1BGYH 5LA6B 3SJBC 3J7AK 2VQEO 4CKCA 3IN5A 3R5FA 5KFIA 1GRJA 3ZHTA 4LF9H 3OUZA 2FTKA 4PDRA 5L3DA 5B1BB 4XYMB 1E1RG 3MFHA 4EYIB 4NTXA 3K5NA 2J6UA 1M57C 3JD1A 2E5LH 2MCTA 4FE2A 3B09A 4FFBA 5LOVA 1VQKV 4JV5B 5BWVA 3MWMA 2BSKA 2KQXA 4FFNA 2FK1A 3H40A 2ASLA 2NVXA 5KFUA 5I5UA 5HBRB 5B66Z 4LFBO 3SYPA 4DV5H 3K5LA 2PZSA 3TGUH 1F23A 1RK5A 4X62H 3DTUB 5I5WA 2VQDA 2O03A 3CRAA 4JI3O 2JGDA 2HKOA 2OIGA 5JJEB 1MSWD 2QM4A 3QG5A 5BYBA 2JGUA 3PVXA 5KG1A 2EINC 5B1OA 2UUAB 1Q90D 2WAQE 1R6NA 2AXTZ 1KQSU 4DR3B 5IJ0A 1YI2V 4X66B 2EILC 5JQGA 4DV2H 1XNRB 2OTLV 1NS1A 4BY7G 1VQPV 1Y74A 4O7WA 4PA7A 2FLLA 4PD4F 5IY5C 3K03A 5L3BA 1FJGB 1LUVA 4H44B 2W6ZA 3ZRSA 1Y1WA 2R8KA 5CA1F 4BBRG 5KT3A 2HJFC 5KFJA 5BPFA 2HR3A 4I4TB 5EK0A 1JKJB 1NZ6A 4X65O 3MR2A 4BAYA 1HNWO 3OUSA 5DECA 4KHPH 3H4BA 2V7QG 1N4CA 3KAJA 2B5UA 1N36O 5K1XA 4XX0B 5KHHA 4ZI7B 2VA3A 1VQOV 3OMAB 4EBDA 1OBGA 1B6QA 3HB3B 2Z0AA 4YJ3B 1AP5A 4NXMO 4B7KA 2RGVA 5C8YB 1R3LC 4CH5A 3T5HA 4ED2A 3F7VC 3PO3G 4MTGA 1GM8A 4CC5A 4ECSA 3RYFA 3SJAC 1AUXA 4O3RA 1TUEB 2CE4A 3FB6C 4JTCB 2RNBA 4J42A 1I2KA 2EIMB 4O4JF 3BAAA 1YSCA 4WBNA 3K59A 4JGSA 4CS3A 4X1KB 4ECWA 5DGHA 2CTWA 3DC5A 4PV1B 1JLLB 1O9GA 5KHIA 3ZHUA 4HQ6A 1GSAA 3VPDA 1RP3B 3W5OA 1Y1VG 4JI5O 3QZ7A 2JRIA 5B3SB 2W7OA 1XMOB 2VQEH 1Q6UA 2J6TA 4RU9A 4MTOA 1BGWA 1ENVA 5CBFA 1AR4A 1FAFA 4JAVA 3RWRD 2HJDA 3CHXA 4DR1O 2W9AA 4GC7A 4HNUA 4HNTA 1MZEA 1WA8B 3OMNB 2HG5C 4DIMA 1MABG 2QM8A 4MVQA 3CRQA 4GKKB 1AI7A 3FAVA 4DUYO 3NBZB 1H2SB 1U97A 4LFBH 2ZE5A 1NJIW 4I50A 5BMVB 3HKZA 4FM0A 2R92A 3VBBA 2F4VO 4UUJC 4X88A 2AZ0A 2EZPA 1PL0A 4DV7O 5I60A 2DPIA 3FKSG 5DG9A 1VS0A 4RNOA 4UCTA 3FD9A 5KFLA 2V9WA 4LH7A 4GZRB 1I2LA 2FPGB 2Y0SA 1GO3E 3TINA 3I5DA 5KG7A 3Q8RB 3JD2A 4IHJB 3RYIB 3EHBB 1S0VA 4IWXA 4YP3A 4DQNA 3J80W 5KG6A 2DABA 1M56C 3JALB 1G6UA 1I5XA 1AJPA 2EZOA 1DF4A 4MVMA 4A3IG 2M05A 4O7TA 2QTSA 2KKWA 5CMUA 2CQYA 5JH7B 3O65A 3RVYA 4X65H 2WB1E 3JZ6A 3BQ0A 3E22A 3HOZG 2Q69A 4YHHH 4X1IA 5FL7G 3J80N 1I1LA 4DV3B 1KJIA 2IJKA 4PDVA 2B63G 3L74H 1H2MA 4J10A 4DR2B 3RB3A 4NXMH 3ORQA 4TQRA 3T5KA 4J9PA 4DW1A 1L0NH 4J80A 1GLVA 3H0GG 4B3TO 2E75B 1MZFA 2NUAB 3JSNA 5EBLC 4B3SO 1G1XB 3KTMA 2HVRA 4RNMA 5IJ9A 2OCCC 5KHKA 4F6EA 5KFGA 3T1CA 1ZX3A 4O7RA 3T5LA 4ZBMA 4A3CG 3GTGA 4F4WA 3CE2A 1XILA 3WB1A 3HKBB 3GIJA 2VOBA 5BWUA 1OCOB 2VQFO 2F93B 3JAKA 1GN4A 3AG2B 3OUUA 5EDWA 2C35B 3OT7A 1CKNB 1ZTEA 5D1PA 3RV3A 3T9AA 1FS0G 2QWRB 1YTFD 1YTFB 2ZE8A 2DYRC 2FYUH 1XNQO 1H8HG 1US6A 3CSWA 5LP6B 1CQIB 3VNNA 4DR1H 4FS1A 5EZYF 3R65A 3OHBA 5I5YA 2R7ZA 2P4VA 3QQMA 2Q73A 2HHHB 3QNEA 1IURA 1YEWA 3V6KA 1IBKO 4O82A 4ZHQB 2VPQA 4TV8F 4JUZA 2ABJA 2WSSG 4DYLA 2P06A 1RFYA 4IIJA 2PI5A 2OTJV 4WD3A 4Q45A 1Y76A 1X59A 1PKXA 4LP8A 1UNNC 3T1YH 3JAWA 2Y48A 4M7EA 4ECVA 4R8CA 2ZM6B 3V6HA 2AHZA 2F4VH 3GWOA 1HR0O 3LSUA 3SPJA 5J9PC 2DWEC 4FLWA 2XAQA 1IBLO 5DLFA 5C3EG 2D3OW 3L75H 3OGIB 4DLKA 3LSSA 1XK5A 4GX2A 1SQFA 1DV2A 2JEGA 4O2AF 2CAZC 4O4HF 1PNLA 5BR8O 2Y0IA 4CH3A 2YWVA 2IJIA 1JDBB 2ZCEA 4IYHA 5KG0A 2W8LA 5IWAO 5K3WA 3E83A 4ED0A 4FFBB 3MR6A 4O83A 4TV9F 2DYSC 1I94O 1I5YA 2LJ2A 1PK8A 2XCPA 2ASDA 3ZRXA 2R84A 3NR7A 3HT5A 4A3LG 2FB5A 1X4TA 4R7CA 3JD0A 3PO2G 1GK9A 4PA3A 4QSHA 3E8BA 4XBFA 3VPCA 4UUGA 1GMGA 5CA0A 1NTKH 4ME6A 1QBZA 4DL4A 3HOVG 5JVDA 1RPRA 2R87A 5FR9A 4LFAO 5IJ0B 2RCVA 4C5BA 4C5AA 3TXQA 5JQGB 2EBOA 1VQNV 1YZBA 4B3TH 4BWAA 3RV4A 4B3SH 4ZIBA 1Y74B 1K83A 5F2VO 2YI8A 1S68A 1E1QG 4BW5A 3T9BA 5DN6G 2XAFA 1K8AW 1TA8A 1HNXO 4C2MA 4J0MA 2W6PA 1Y4MA 3DAAA 4YR2A 2UUCB 2WYOA 2VQFH 2EJ3A 1T3NA 2ZGIA 4GLWA 5B1AC 2AGOA 2DLNA 1OZ0A 3GTOA 3B8MA 1OCCB 4YY3B 2XASA 1K7DA 3UO3A 2W6JG 4I55A 2KSDA 4LF4O 2KG7A 3SGIA 1RM1C 4J9LA 1XNQH 1V54B 3QO5A 2Z5UA 2OIEA 4DV4B 4YJ2A 4CKEA 5KAFZ 2UU9O 3VA7A 2HVJC 4DR5B 2UXNA 1N56A 2HG8A 4AILC 3RBDA 1WR2A 3H9VA 3K3PA 4JYYA 2V4RA 2YS7A 1KKCA 1IBKH 3LWBA 3VOTA 4ECUA 3RB6A 3RYFB 1ZAUA 2ODMA 2YSUB 4WHXA 3Q1KA 1CS0A 1I1KA 2RDJA 2JS3A 5KFXA 4RZQA 1KMIZ 5L3FA 3KALA 1M90W 1P4RA 4J9OA 5LYJA 4AQYB 1HR0H 4FM2A 2CH7A 2WAMA 3VQYA 5LGTA 1U96A 1XL4A 3TY8A 2WTFA 3APOA 1Y1WG 4JV5O 3BRCA 4CH4A 2PY5A 2VUMA 1JVMA 3HKEA 2X7RB 2HHFA 3AG3B 1H2KA 4NXNH 3BY6A 5KA5A 2IJHA 3OTOB 2NU9B 3R66A 3GB7C 1FFXA 3FB8C 1OCZC 5H5NA 4LR3A 5KFPA 1NTMH 1JX4A 5KFFA 2LFSA 1AR1B 2R72A 3CXHF 4DRXB 1XDNA 5BPHA 2W6MA 1I94H 1BMFG 4BR6A 3T1HB 4H13B 4R50A 3FAVB 2DWDC 2QWNB 2UUAO 2GQRA 3V6JA 4MS2A 3C0FB 2X6CA 4DR3O 1YJNV 3OFNG 4I50B 3MFIA 3ETQA 4XYLB 4X66O 4P9OA 4I4TF 3M4IA 3TQ1A 1XNRO 5IYBO 1L0LH 1RYRA 4UVAA 2FLPA 2CTQA 4ZI7F 1ZQ7A 3GIMA 1FJGO 4EGJA 2PF4E 4JTDB 4YIOA 4J7JA 1XDCA 2RGRA 1SZTA 5C8YF 2JEIA 1UC9A 2YIBA 2LGWA 2XAHA 3R23A 4PDMA 3C90A 3SPCA 1EN6A 2QJ1A 4FFRA 1SA0A 4IGGA 1JDEA 1KJ9A 4DR7B 2YZGA 4JTAB 1SESA 1HNXH 2C00A 4XZ3B 3EXAA 4JI8B 4TM5A 4TUYA 4CMDA 3HKDA 1Z2NX 1JXLA 4JI7B 2UXBB 5L9XA 2LFRA 3JD4A 2ZNJA 4JI2B 5L3GA 5B1BC 5KLVH 4PDLA 1ZHQA 2F66C 4TVIA 4OX9B 1P49A 4TSFG 5EC2C 4LF4H 3E5NA 4A2BA 1YVWA 1K92A 5J2TA 5C1OA 3AG1B 4B3RB 3GWKC 2UU9H 3JATA 3G6BA 2R8GA 4RZRA 2DW4A 4JI0B 4LC1A 3FKIA 2LW7A 1CP9A 2HIVA 4J9RA 4WCEV 4NTWA 3KHLA 3U0ZA 3LNMB 5IJ9B 3PR5B 1L2ZA 2O57A 2BTOA 2HVSA 3IC9A 4QJFA 1TGOA 2CUGA 3CS5A 2GTSA 4LFCH 1NR7A 1I50A 5BMVF 4F6RA 4QIWF 3DXRB 1EZ1A 4Q0YA 1AI4A 3CCEV 2BTQB 4FBUA 1V9PA 3S24A 4HR7A 3DTGA 2GLTA 4GKKO 5EZYB 2QM7A 1MNGA 2H94A 5BWTA 3WNZA 4FS2A 5JQWA 2ZE7A 2H3OA 3PN1A 4PI0A 2YL2A 5KFTA 3N2GB 4MVZA 5CM0A 4RB1A 5EBWC 1A0GA 1M7JA 5JCOC 5J2UA 1K34A 1FXKA 1TUBA 3PW2A 4PZ6A 4IHJF 3U9SA 3ZHQA 2ZE6A 4DK0A 2UUAH 2G38A 2PYJA 2VUGA 1IOVA 3GTKA 1Y76B 3OR7C 5EYPB 1KP3A 5KFWA 2YIDA 3LSQA 4X66H 3WU2Z 5IYZA 5BZBA 1AUVA 1XHXA 5JH7F 1XNRH 3EFFK 2XCAA 4QGPA 4EGQA 3GV5B 2UUBB 2DQ0A 3ZMZA 1YXBA 1T36A 2BOCC 4A3GG 1FJGH 1YCIA 1NI8A 2P67A 3JSLA 3X2QB 4MVRA 3WB0A 3B8NA 1I7NA 4O7VA 2WAQA 4HYKA 5FLXW 3SNOA 2ZT9B 2IU0A 3RFRA 2X6AA 3CRRA 2Z3YA 4MTFA 5DQIA 3QO7A 2ODTX 4DV3O 3SI8A 1R1BA 1K5SA 3L70H 2JA6A 4DR2O 3ETHA 5IP7G 4BIZA 4E2LA 5DG7A 5B3SC 3G6YA 1KC8W 3LQSA 2LW1A 3B2EE 4EBEA 4PA4A 2OCHA 4TQFA 1W0KG 4HZ3A 3G4SV 5LMNB 2R7MA 4QW8A 4GUNA 5LL6b 3V4ZA 3TW7A 1SC5B 3ABLB 3HOWG 3U54A 4CE5A 1AVMA 1M93A 2VR1A 4QWAA 5JVDB 4PZ7A 3OAAG 4J7ZA 2BQUA 3QZ8A 4CHIA 5KFYA 2GTAA 3H1LH 3CEBA 4K8ZA 3OEEG 3GLKA 1KTAA 1Y66A 1FFTB 4ZHQF 3CRCA 1IBMH 1JFFA 3N2KA 1X9NA 1RSOA 2VA2A 3KYHC 3RN4A 1M6VA 5FD5A 4EQ5A 2NLJC 1NKDA 2XUMA 1ZLZA 1GSHA 5KFRA 3C3SA 1WP7A 4I55B 3RYCB 4PDBA 4CS2A 2WPDG 3UO2A 4YJ2B 3ZN1A 1YHQV 2ASJA 2QA4V 2XHBA 5CB4A 2ZM6O 3NUAA 3KHHA 3AK3A 1ORQC 1K1QA 2IW5A 3MWDA 5LOVF 3ABMB 1XQ8A 3K5IA 5FPOA 3ZCCA 4C7UA 3MHSC 4J9MA 3H3VH 2PN1A 5L1JA 3RGZA 5LYJB 3AG4B 2GPSA 3FYIB 4UXNA 3UM7A 3ZRWA 4PWQA 2CH7B 4JI1B 1GH6A 2A7WA 1ZUQA 3JAMW 4RUFA 5JVLA 4K3AA 3IFXA 4I5SA 1T94A 2RF4A 2ZDIC 4IR1A 2HHFB 3WG7B 3NGDA 5KKNB 1VF6C 3RW0A 4YBZB 3JARB 5IYCG 1VMGA 1FFXB 5KX5A 3ASOB 4BY1G 2DAAA 5JQGF 2QWPB 3STZC 4U3JA 1EKFA 1Q86W 4KL1A 1OCOC 2BR0A 2R9RB 3JAMN 2VS0A 2A79B 2ILMA 3AG2C 1VBGA 4DR2H 2FJZA 3K58A 1BQZA 3DSQA 3K3VA 1HDJA 2AW9A 5JWPA 4O7LA 3D3QA 5T14A 2R85A 4QE7A 1XMQB 4X9QA 1AJNA 1BHBA 1VF7A 2ATLA 4FLXA 2WB1A 2COIA 5LP6C 2DMXA 5C93A 4RUAA 4PJ0Z 4FIPC 5KFVA 1ZETA 2ATKC 2E76B 2YXHA 3JCZA 2ZXWB 5CBGA 3CD6V 1B6SA 3N40P 3KREA 5LHIA 4O4LA 2UUCO 2OH2A 2WLLB 3CSXA 2R9AA 1BSMA 2YIBD 3NXSA 4WFGA 2VUMG 1QLEB 4O3SA 1BHAA 4YY3O 1N33B 2W9BA 4LF5H 4K0KB 2X6BA 4Q6GA 5LGUA 4LF7O 1SETA 5HFMA 1YF2A 4DV1B 1FXVA 3H01A 1Q6IA 2QKAA 3HKDB 4TUYB 4DV4O 4DR5O 4RB2C 2QWOB 3THOA 3I4NG 3GTJA 4YIPA 1GKFA 4FM1A 1TWCA 4IAJA 3RFCA 1HWYA 1WB8A 3MD0A 2Q7HA 2UVRA 1XOUA 4AHCA 1S03G 3JATB 2X0SA 2IU3A 3UYYA 2ZM6H 1H2LA 3KG2A 4AQYO 1B6RA 4EYHB 1YITV 1K9MW 1EFRG 4GKJO 2Q2TA 5FPRA 2AQ4A 1K5QA 4MVOA 2QF7A 3QO8A 2YUAA 5IYDG 4YQWA 1PD3A 4A3BG 4WFHA 3UT5A 3RIZA 2NR5A 3TY5A 5FJ8G 2Y4UA 4CZZA 4ETSA 4UCOA 2FPPB 5C5JA 3BABA 1JMKC 2CW8A 3L4KA 4JI3H 3ZHRA 2EJ2A 1RJQA 3OTOO 4A3JG 1K3EA 1S97A 2QK4A 5EIBD 4I50F 4F6RB 1HW7A 4WFFA 2DOSA 4EKWA 1JCHA 4Q20A 3TQTA 2C28A 3AEIA 1KBHA 5H2FZ 1IYDA 4FLYA 2Z04A 3HBLA 4KXRA 2C2AA 4PI2A 3H1JH 2RDIA 4O2BA 4O4IB 5EC1C 3M9NB 1KT8A 2JA7G 4QPKA 4NZOA 2ZINA 1FXKB 2C2RA 3W7TA 1PL4A 1Q82W 1SQVH 3FDSA 1HNWH 3TEKA 1OCCC 3VQVA 4P9PA 1N36H 4FLUA 5C4XG 3P3NA 4ZOLA 1THZA 5IYZB 1I1MA 5KT6A 3GTPA 1Y14B 1V54C 4D7TA 5LL6Y 3CCVV 4OPHA 4LNUB 4DV0B 4FZ1A 3BHPA 1WPBA 5TISZ 2Q0AA 3TJTA 2WDTA 2YXYA 5F9NA 4JI8O 2KB1A 5LXTA 4JI7O 2UXBO 3F5WC 3K79A 4QPJA 3G8DA 2RDCA 2EULA 4JI2O 2AGPA 1ZL8A 1F4MA 1SKVA 3ZIAG 4YY3H 4J9SA 3OM3B 3ZMSA 4OX9O 4F4XA 1WH2A 2XNDG 5EWFA 5KMGA 4LF7H 4KHPB 3M9OB 4RUCA 1UPGA 4MVSA 3K08A 4B3RO 3GIDA 4DR5H 4JI5H 4JI0O 4DUZB 4R8UA 1BZKA 2F1MA 3AG3C 3ABKC 2H8PC 2LP7A 1CE8A 2P22C 4JPRA 4TQSA 5DMXA 4HBNA 1J5EB 4QWBA 2R7KA 1K97A 1Z2GA 3M7MX 2FKXA 4P30A 2A0LA 2BCCH 3RBZA 1ZHSA 1VAJA 4O3QA 5IT9W 3PFFA 4GKJH 4DUYH 2F95B 2CZGA 1D5AA 2GUZA 3ZS8C 1A48A 3NBYB 3J81W 3OEHG 3GIQA 2RN9A 1EUDB 4YB8B 1T5EA 5KA6A 1WCMG 4HAMA 4O3NA 3GIIA 3KCYA 2CNVA 3N2KB 1Y6XA 2UXCB 4TV8A 1RSOB 1SQBH 4E4TA 3OTOH 1GSOA 5IT9N 2JEJA 1JX9A 3CC2V 4DV7H 1NQTA 2Y69B 2VQEB 3CC4V 3NC0B 5D8DA 2CTPA 1XBLA 2FMLA 3FYEB 2W8KA 5I5XA 3J81N 2W7PA 3K5OA 4R7RA 2P90A 5H6QA 4RUEA 2NVYA 2R93A 3SPHA 3U11A 1VQ4V 3GVMA 4NYKA 2EIJB 4JI6B 3KKYA 2YZMA 2HGXA 5LOVB 1BCCH 1SYXB 4U6PA 5CB4B 5H80A 3WWJA 5L1KA 2BSKB 5F9LA 1M1KW 1AI6A 2UUBO 4DV6B 1HNZB 3JASA 4Q44A 2ZDHA 3PW4A 4LSAA 2FK2A 2FMAA 2QDOA 4RAZA 4MV8A 5BWWA 2JGDB 4UVCA 1VIBA 5AG2A 4F4LA 1VQMV 1N34B 1GYFA 4JYAB 1V55B 4DR6B 3I12A 2EIKB 3LULA 1IZ3A 1TWGA 1CKOA 5CA0F 3JZFA 5KUMA 2QTOA 4E6NA 4A2AA 4JI7H 2R8JA 5JVDF 2EX3A 5DLGA 4Q43A 4F4YA 4ECRA 2UXBH 4WFEA 1KYOF 3ML0A 2GHYA 5KX5B 5KFOA 3K5MA 3BEHA 4OPAA 1TWFA 4JI2H 3JD3A 5L1IA 4EBCA 1W93A 1IXMA 4U3JB 4OX9H 5LMNO 3A8TA 2QB5A 3MHHC 4X8AA 4X1YA 4L1KA 4YHHB 4B3RH 4EB6A 1O9HA 1XI1A 2OWOA 2BE3A 4JI0H 3CCLV 1KB9F 1KD1W 3B40A 1PV0A 3SYQA 3S3XA 3QTCA 1MG1A 4NZNA 1EM1A 3G6VA 2W6IG 3ZX6A 5L1LA 1B06A 4I55F 2YICA 3N6RA 3W1GA 2ADPA 2R9IA 3D36C 4BBSG 2LGQA 4JYCA 5LA6A 4O4LB 3K57A 1A9XA 4YJ2F 2UVUA 4F50A 4EEYA 3HPLC 3TIGA 1CEZA 4TQDA 1IVSA 1GAXA 4J41A 2PI4A 2V59A 4ED1A 1Q8IA 4WBNB 2W9BB 4A3FG 3VMMA 3N42B 2YIAA 4O7YA 4FFOA 1OCRB 1IBLH 5K2MA 4JZGA 1QCEA 4BWSC 3GQCA 1WB7A 1Y67A 4PHZA 5LYJF 1TAEA 3X2QC 4ED8A 1I3QA 5BR8H 5K1PA 4DR1B 4QWEA 4ABMA 1QHTA 5HFLA 3SE7A 5IWAH 4ECZA 1H8EG 1P16A 1W96A 4H33A 3HOYG 1SEIA 3PZPA 2GBOA 1NT2B 3OSNA 2UUBH 3SYAA 4JI1O 3T1YB 1ET0A 3OR6C 4MW8A 2XGQA 1N32B 1JR9A 4K35A 2JK5C 3UT5B 4J9ZB 1SZXA 4HN2A 4NTYA 5KFAA 3T4ZA 2YU9A 2VWJA 3G71V 2FB9A 5JCOA 1JOYA 1Y1VA 5KT4A 1DTOA 4NKGB 1WAZA 1PM9A 4I4TA 4LFAH 5DEDA 4QWCA 3W7WA 1Z2OX 1WSCA 2YS8A 1D2DA 5B5EZ 4IZOA 4ZI7A 2P7TC 5L3EA 3G8CA 4O2BB 3BPZA 5H6RA 1E4FT 2HEPA 2I87A 4YJ3A 1XMQO 2DE0X 1KKDA 3CJHA 4EEQA 1B33N 1KJQA 5LMNH 1EYZA 1XHZA 3CCMV 2IH1C 1FKAO 3CEIA 5IYDO 4LWSA 1M0WA 1R6KA 2CKZB 1S0MA 2QWQB 2A1HA 3E22B 3AX6A 5DGBA 4TUYF 4X1IB 5E1AC 5D1OA 1CQJB 1VQ8V 5EWGA 2N05A 4PBCA 2D2CB 3TY9A 2W6QA 1S10A 2R92G 2HGSA 4X1KA 4K0KO 2DYSB 1QU7A 5KG2A 3SYOA 2DQ3A 2JS5A 1GM9A 5IE9A 1EHIA 3T7AA 1S0OA 2K1EA 3E89A 4O7NA 3UZBA 5KFSA 4DV1O 4DL3A 5LXTB 4MTDA 3PW0A 2XT9A 3ABMC 4UFZA 3CCRV 2WLMA 1XMOO 4UB6Z 5CAEB 2W70A 4FFMA 4MTXA 1EZJA 3AG4C 2X0LA 2Q7DA 3JAKB 3K04A 2UXDB 1Q7YW 3GILA 3GTLA 4HNAA 1COWG 4JV5H 2IJJA 4ZQIA 4R8UB 3WG7C 4RNNA 5FD6A 4OGQB 5BMVA 3I56V 1EUCB 2B63A 2XAGA 2E74B 1XL6A 1A32A 3ASOC 4N21A 5KS8A 4ECYA 3CMAV 2AU0A 4OXSA 2HGWA 3WB2A 2W6NA 3CWBH 2QE7G 3HB9A 2EJRA 3L4JA 4U7NA 5IP9G 2EIYA 4BXXG 2A3QA 3T2MA 4FVMA 3H0GA 4O4IF 1F4NA 1S5HC 3H1HH 2R8HA 2NU8B 4D7SA 2VWKA 1C30A 4IIJB 5EBMC 5J2UF 4U7CA 4JI1H 3ZN0A 4K8XA 1AP6A 2F23A 1S5JA 5D5QA 3T9DA 4DR3H 2FK3A 3MR5A 3JAWB 5KT2A 4A3EG 4DRFA 4JF3A 4ASUG 1RM1B 4IHJA 4FBTA 2W57A 1IDSA 4LSXA 1BQ0A 3RBEA 2XOKG 3GJXB 1GM7A 3B77A 3ETGA 4AYBE 5IYZF 1K1SA 4NXNB 5FLMG 1KJJA 3TK1A 5LBQA 1GTOA 1KU9A 1VQ7V 3ABUA 5JH7A 4ED6A 2Q68A 3ETEA 3RTXA 3EYYA 2P4KA 2YXLA 2XC9A 5KFDA 4LBEC 1AR5A 1I7FA 2B9ZA 2EIMC 4CH6A 1TWHA 3BQ2A 5GONA 2RQ6A 1SRYA 4RAYA 3B4SA 3H20A 3TXSA 2L6LA 2R7ZG 3FB7C 5I47A 3MJFA 3VQXA 4ZKIA 4DV0O 3ZMTA 3JASB 2E2IA 1FKAH 1W0JG 2ZDIA 5FLXN 4JZ2A 3JRWA 1SF9A 2WA3A 2R7NA 4YXWG 5CA0B 1CXZB 2QYZA 4ED7A 2YEVA 4DR4B 2UXXA 5FNVA 2ZIOA 4K0KH 4Q8EA 1Z2PX 4G28B 3E86A 4KHPO 1CKNA 5CBHA 2CGNA 2IMWP 4ECQA 4DV1H 3EVKA 2R6FA 4JI4B 3UKMA 3ASNB 4DUZO 2NU6B 4J11A 3BJYA 2JA5A 1XMOH 3ZMUA 4JAAA 4O84A 4IRDA 2R93G 4LCUC 3KZIZ 5LP6A 3JRXA 3P3PA 5EIBC 1J5EO 4KP4A 1EKVA 1QR8A 3AYHB 2HHHO 3A0RA 5DISC 4A5UB 3W7SA 4GKKH 3LMLA 1Q81W 4FM9A 2KG7B 5CA3A 4N23A 1M5IA 2AHYA 1RPOA 1FXKC 1SQPH 4NVPA 4CS4A 3P32A 2UXCO 1S9FA 1VEWA 2PVPA 2UVVA 1G2WA 1E4GT 5L3CA 2R70A 3APQA 1P84F 4UB8Z 1OJHA 1PP9H 5JJNB 4MVUA 2COJA 4NZMA 5CB4F 2LQTA 4LH6A 4GX1A 2WE6A 2CFMA 4LFCB 5JUMA 1WJZA 4NR1A 1I6UA 4A3KG 3T9EA 3CCUV 5DQGA 1M4UA 2CGOA 3JYCA 2JVDA 4JV0A 3Q4HA 1NVPD 1NR1A 2B1IA 4UV9A 1NVPB 1K4DC 4JI6O 4LF6B 1CKMA 2CNQA 1M0TA 2VRZA 3HKEB 4XDKA 2DWCA 2FE3A 1LUWA 4DV6O 5KG5A 1HNZO 4FJCC 3STLC 3IG0A 4MT8A 5BYAA 1H2NA 3CRMA 4FZ0A 4P2ZA 4MV7A 4M0JA 1QLNA 1N34O 2F43G 4DV3H 4J9NA 2XD4A 4JYAO 2YW2A 4EFBA 4B3MB 4LF8B 3FFQA 4DR6O 5KX5F 1YIJV 2N74A 4HYOA 2IBKA 2DJVA 1GO3F 4DV0H 1JPXA 2YYAA 3R5XA 5GTHZ 1IXBA 2HVQA 2V58A 4RQFA 1F7YA 2ZNIA 5LMUB 3GTMA 5CA1A 4YAKB 4JV1A 1S72V 4MW3A 3ICXA 1IOWA 3QVNA 2Q67A 3OMIB 2FP4B 3LDCA 4X64B 3KHRA 2XCLA 2V4DA 1L8DA 1EBOA 1K33A 5A2QW 1S0NA 4E4EA 3K06A 3ORRA 2ITCC 2CK3G 1ZSPA 1R73A 3N44B 2QKSA 3OD4A 4I7HA 4APMA 3ETJA 1BJTA 3S3WA 2PMZE 1KUTA 2Z02A 1W2BU 4YHHO 1FPOA 5BXZA 3IAYA 3E35A 3H4DA 2AGQA 1R3KC 1JQ0A 3D3IA 4DUZH 4O4LF 3CC7V 1SA0B 1BL8A 1AB3A 5KFMA 4Q8FA 1L1FA 5A2QN 4RQEA 3HO8A 3CJHB 4MAMA 2Y69C 4B7EA 1J5EH 4BIOA 4WBNF 4FPPA 4O4JA 3T5JA 3IGAC 1MOFA 1MMMA 4O3OA 4Y8VB 1GN2A 4LWSB 2HHHH 3PR4A 1NBMG 5CR5A 3RGBA 3LNNA 3GB8B 3SJCC 5D1OB 3RYHA 5IYBG 2EIJC 1GN6A 1H2GA 1VARA 1YJ9V 2FPIB 3VQWA 5J2TB 1UC8A 3MAQA 2DZDA 4MV3A 1A3GA 1WLEA 4RB0A 2UXCH 2ETNA 2QGNA 2JEFA 3E8FA 4BIUA 3CCQV 2IH3C 3A2FA 5BWXA 1IBMB 2FKLA 4RCNA 4X20A 4DAAA 4RAIA 4F4ZA 1TVKA 5ITZA 4MTEA 2C2EA 3AK1A 4QJFB 4IYIA 1V55C 3EPGA 2ITDC 4WF9V 3DTFA 2EIKC 4LF9B 2V4QA 2ZR2A 2M6YA 4DRXA 1SQGA 3A0BZ 4HNAB 3RUPA 4JI6H 3M8AA 2EJ0A 4G27B 2GSMB 3T1HO 3AW8A 4IT5A 4Q4CA 3N6XA 2W9CA 4JV2A 3OW2U 3T1YO 4GX0A 2E5LB 2OYQA 3Q8QB 4DV6H 4NLGA 3ZMVA 4QWDA 2YRXA 1HNZH 1N32O 5EOYA 2HP8A 1Z5VA 3AG7A 2V1DA 3W7XA 1Q5OA 5J2UB 3GV7B 3SYCA 4UV8A 1TUBB 2VPSA 3I4MG 3CYOA 4DV5B 3M9MB 4X62B 1N34H 3ABTA 4O2BF 3PW7A 4EG0A 4JYAH 5BWRA 5I5VA 1O75A 1E79G 4L8JA 3U55A 4DR6H 2XTAA 3FKIG 3BACA 3RT3C 2COGA 3CP1A 3V4SA 4DXWA 4GC6A 1M57B 1DLBA 4FMTA 4FU0A 1S5LZ 3ZEDA 3FX7A 4DV2B 4I0XA 4DR7O 2W71A 4ZOLF 2PUSA 2YDEA 3G6XA 1NH2D 3TW6A 1NH2B 3CXCU 3U0GA 4G3IA 2UUCH 3E8GA 4DL5A 3TCUA 1XEQA 5KT5A 2GV9A 1P7GA 3L9DA 4Z1VA 3IJ4A 5LXTF 5GONB 2R8IA 4MA0A 1WNSA 2DN9A 2P5OA 3N43B 1OCRC 2EINB 3CX5F 1UFIA 1RK6A 4MV9A 4W4KA 1PNMA 2W6OA 1EN5A 5KFEA 4DV4H 1DGSA 1YDXA 3GDEA 2Q7GA 2EILB 2WLHA 2WWWA 2Q7EA 1KBLA 3K5HA 4PZ8A 4JASA 4GYCB 2Q5ZA 5IY5B 5KAIZ 1GGOA 5E79Z 3CPWU 1WRVA 4JXUA 5DGIA 4CMFA 2YEVB 5KFHA 2Q6AA 3TETA 4IRCA 3GTQA 3DXRA 5FNVB 3E8HA 1DK1A 2QSAA 2HFEC 4AQYH 2BTQA 3K9SA 1S77D 4U7OA 2UXDO 2BOBC 1OBDA 5EZYA 4LF5B 3PW5A 3IC7A 4DL6A 4XDLA 3RJ0A 5GTIZ 4QNHB 1JFFB 3SPGA 3N2GA 3F8NA 2Q4PA 4IIJF 2I80A 5DQHA 3ETDA 4X89A 2CTRA 3W7UA 4O3PA 1EKPA 3Q8SB 4O7SA 4I9QA 4O7ZA 2WLNA 1CPYA 1MA1A 4GT1A 1URFA 3HKZE 3D36A 1RJRA 3BA8A 2JA6G 4J9YB 3JZIA 3HOUG 2WLIA 1ROPA 3MR3A 3T1HH 1AI5A 2ZKOA 1IYEA 2ZDQA 5EYPA 4ICGA 3P30A 3RGXA 1WN7A 2MW2B 4FFPA 1R3IC 2R7LA 3VPBA 4MSWC 5KG4A 1N32H 4H0LB 4QE9A 1OWTA 4O2AA 1K4CC 4O4HA 4RO2A 1BT8A 4EFEA 2Y0SE 3UZOA 2JEXA 3L71H 4LFBB 1BXRA 4R6ZA 5KFZA 4TWKA 2QR4A 4DK1A 2IM9A 4PA9A 4MV4A 4JI3B 4NXNO 4FLTA 1KJ8A 1TWAA 3WFVA 4TV9A 2KSWA 4ECTA 3OSPA 4CKBA 2V5AA 4A3DG 1N8RW 1NTZH 3SJQC 2XGPA 4W4LA 4Z2WA 3RAXA 5LHHA 2JA5G 2GDSA 3ZRWB 3VOUA 3AG1C 3Q4HB 5HNEA 2J6SA 3D8CA 3UQ8A 3CCJV 1DIKA 3U9TA 1EZVH 3OTFA 4DR7H 1WPXA 1BS3A 1N0JA 2WLKA 3F7YC 1OV9A 3ZRVA 3CVZA 3BQ1A 2ZDGA 2JDIG 4JI8H 2YS6A 2ALZA 5EWEA 3HKCA 4QW9A 2ZR3A 3ZBHA 3RR5A 5DG8A 4B08A 1Z5WA 4AI8A 1FD9A 2Y4TA 3CMEV 2ZQMA 5DAAA 3K0GA 5KHGA 3GIPA 4PELA 2MK3A 4X65B 1HNWB 3FB5C 3PJSK 4FLVA 4XDJA 2P0AA 2ZJTA 4DR4O 2NN4A 5LGNA 1N36B 1YJWV 1N0NA 1AJQA 3CB2A 4L87A 2UVWA 2B1GA 4RB3C 2PBZA 3GIKA 5CA1B 4NXMB 1V51A 1V4YA 3M99B 3ZHSA 4JI4O 5D5PA 4J7KA 1KUQA 3SPIA 1M56B 1E4EA 1S3JA 2EJ7A 1SFOA 1AILA 5H9CA 4LMYA 1D5NA 4NB5A 3WWHA 2A06H 2UXDH 4KFMA 2Y0PA 2W0XA 5IYCO 1BE3H 3RYCA 4UCUA 5LA6F 4ED3A 4LF7B 3Q8PB 1RYSA 1R6TA 3R5HA 2QEXV 1QVGU 2X5RA 1I7LA 1J95A 3BCCH 1VQ5V 2YZLA 4JI5B 3MDSA 1VKZA 3JCUZ 1VP7A 2AGAA 4O4JB 2FL4A 2JEUA 1QQCA 1VQLV 4G2KA 3KXYT 3HOXG 3KAKA 4IR9A 2E3CA
chains in the Genus database with same CATH topology
3WB1A 3GJXB 3HKBB 3U10A 2VOBA 2F93B 3JAKA 1XMQB 1VF7A 3RYHB 4NXNB 1KU9A 4FLXA 1CKNB 5D1PA 5LP6C 5JH7A 3FMAA 3RTXA 3EYYA 2YXLA 4UCRA 4GKJB 1I7FA 4DUYB 4CH6A 3N40P 5JJJB 4O4LA 5GONA 2RQ6A 2ZIMA 5LP6B 3VNNA 4DR1H 4X20B 3CSXA 2R9AA 3H20A 4RAYA 2F4VB 2YIBD 1TVKB 2HHHB 5ITZB 1YEWA 3JARA 3VQXA 1N33B 4LF5H 4ZHQB 3JASB 4DV7B 4K0KB 3HXLA 1AN7A 4Q6GA 4IIJA 1FKAH 3T1YH 4DV1B 3JAWA 4TUYB 3HKDB 3SR2C 4RB2C 3N41B 4M7EA 2ZM6B 2F4VH 3THOA 5CA0B 4FLWA 4FM1A 4DR4B 4IAJA 4GLXA 5FNVA 2ZIOA 4K0KH 1XK5A 1Z2PX 2Q7HA 1SQFA 2CAZC 1CKNA 4CH3A 4DV1H 4AHCA 5C8YA 1S03G 4JI4B 3JATB 2ZM6H 1JJOA 2ZCEA 1Q3EA 1XMOH 2Q2TA 5FPRA 4DR4H 5LP6A 2HIXA 4FFBB 5EIBC 3UT5A 3RIZA 4FLZA 1B04A 3TY5A 2PTMA 4ETSA 4ZOLB 4UCOA 1MZBA 3BABA 1JMKC 2CW8A 3L4KA 4JI3H 5DISC 4JI4H 3W1BA 4UCSA 5EIBD 4GKKH 4F6RB 3LMLA 1X4TA 2PGGA 1HW7A 5KHJA 4FM9A 4B3TB 1M5IA 4B3SB 5CA0A 4FLYA 4NVPA 4CS4A 5JVDA 4PI2A 1E4GT 4O2BA 4O4IB 5IJ0B 2R70A 2VQFB 5JJNB 5JQGB 4CC6A 2ZINA 4LH6A 4B3TH 5KMGB 2WE6A 2CFMA 4BWAA 4LFCB 4B3SH 4ZIBA 3QWUA 1I6UA 2YI8A 1S68A 1M4UA 1HNWH 1TA8A 2JVDA 2YI9A 1XNQB 4J0MA 3VQVA 1N36H 4FLUA 2UUCB 2WYOA 4ZOLA 4LF6B 2VQFH 5IYZB 1CKMA 3L2PA 4D7TA 1M0TA 3HKEB 2FE3A 1IBKB 4LNUB 4DV0B 4TOIA 4YY3B 3BHPA 4I55A 1WPBA 2Q0AA 3IG0A 2WDTA 3SGIA 4UCVA 1XNQH 5LXTA 4MV7A 4DV4B 4YJ2A 4LF6H 4DR5B 4DV3H 4AILC 1HR0B 4EFBA 4B3MB 4LF8B 3FFQA 1SKVA 3RYIA 1IBLB 4O4IA 1IBKH 4DV0H 4TV8B 4YY3H 3RYFB 1ZAUA 2HVQA 3JALA 1WH2A 5KMGA 4LF7H 4KHPB 2ZNIA 5LMUB 5CA1A 3ICXA 5BR8B 4RZQA 1KMIZ 3KALA 4DR5H 4X64B 4DUZB 5LYJA 4AQYB 4JI5H 1HR0H 4FM2A 2F1MA 4B3MH 2V4DA 4LF8H 1L8DA 5IWAB 3VQYA 5A2QW 3TY8A 3RF2A 2Q2UA 3BRCA 2P22C 4CH4A 1I94B 2PY5A 3N44B 4HBNA 4O2AB 1J5EB 4I7HA 3HKEA 1BJTA 4APMA 4O4HB 5LMUH 1XMQH 3M7MX 4NXNH 4LNUA 1ZHSA 3BA9A 1Q43A 3IAYA 3OTOB 1P8LA 5IT9W 4X64H 1FFXA 4DUZH 1SA0B 4GKJH 4LR3A 4DUYH 2F95B 1D5AA 3ZS8C 3NBYB 3J81W 2CW7A 2R72A 4TV9B 4DRXB 1XDNA 1I94H 3T1HB 1T5EA 3DF7A 1J5EH 4O4JA 3N2KB 2UXCB 4TV8A 3C0FB 2HHHH 3OTOH 4LFAB 2YCHA 3HKBA 4I50B 3ETQA 3RGBA 1A0IA 1N33H 4DV7H 3LNNA 2VQEB 3GB8B 3SJCC 3M4IA 3NC0B 5D1OB 3RYHA 3HKCB 3K5OA 3VQWA 5J2TB 3MAQA 2PYLA 1FVIA 4R7RA 3U11A 4RB0A 2UXCH 1HNXB 2RGRA 3A2FA 3QF7A 4JI6B 1IBMB 4X20A 5LOVB 1SYXB 5CB4B 2YIBA 1TVKA 5ITZA 4MTEA 4X1YB 2RJZA 4DV6B 1HNZB 4ZHQA 3JASA 2QJ1A 4BW9A 4EB6B 1SA0A 4LSAA 4DR7B 4LF4B 4LF9B 1HNXH 4DRXA 4RAZA 4JI8B 4TUYA 1SQGA 3HKDA 4HNAB 1Z2NX 4JI7B 2UU9B 4JI6H 2UXBB 1N34B 1GYFA 4JYAB 2ZNJA 4JI2B 3N6XA 4DR6B 2E5LB 2OYQA 2XIGA 4DV6H 1HNZH 1ZHQA 2F66C 5EOYA 4OX9B 1Z5VA 1P49A 5LA6B 3SJBC 4LF4H 1CKOA 3J7AK 1Q5OA 4A2BA 4LF9H 5J2UB 4E6NA 4A2AA 5J2TA 1TUBB 2VPSA 4JI7H 2UU9H 4DV5B 4B3RB 2UXBH 2EX3A 3JATA 4X62B 4JI0B 1N34H 5KX5B 4JYAH 3K5MA 4JI2H 3K5NA 1O75A 4DR6H 4L8JA 2E5LH 2HIVA 2MCTA 4U3JB 4FFBA 5LOVA 4JV5B 4OX9H 3U0ZA 3MWMA 5IJ9B 1L2ZA 4X1YA 2BTOA 2HVSA 1TGOA 4YHHB 4DV5H 3K5LA 4EB6A 1O9HA 1XI1A 2PZSA 2OWOA 4LFCH 4B3RH 4X62H 4JI0H 4F6RA 3ZEDA 4DV2B 2O03A 4Q0YA 2BTQB 3QTCA 1V9PA 2PUSA 5JJEB 3S24A 2QM4A 3QG5A 5EZYB 2JGUA 2UUCH 2UUAB 3W1GA 2GV9A 3PN1A 4PI0A 3N2GB 4DR3B 5IJ0A 4RB1A 5LA6A 3K57A 4O4LB 5GONB 4X66B 1WNSA 5JCOC 5JQGA 5J2UA 2P5OA 1XNRB 3N43B 4DV2H 1TUBA 4TQDA 4PZ6A 4MV9A 4DV4H 1Q8IA 4WBNB 1DGSA 3GDEA 2Q7GA 3N42B 4DK0A 2UUAH 2PYJA 1FJGB 2VUGA 2Q7EA 2YIAA 4PZ8A 5EYPB 1IBLH 4X66H 4I4TB 5IYZA 4BWSC 1XHXA 1XNRH 4GYCB 4PHZA 1TAEA 4KHPH 2UUBB 5BR8H 3KAJA 5K1PA 5K1XA 4DR1B 5KHHA 4ZI7B 5FNVB 1QHTA 4AQYH 2BTQA 1FJGH 4YJ3B 5IWAH 3JSLA 1P16A 2RGVA 5EZYA 3WB0A 5C8YB 4LF5B 4CH5A 5FLXW 1SEIA 1NT2B 3RJ0A 1JFFB 3RFRA 2UUBH 3N2GA 3F8NA 3T1YB 4CC5A 3RYFA 3SJAC 1N32B 3UT5B 4I9QA 3BAAA 4WBNA 3BA8A 3K59A 2VWJA 4CS3A 4X1KB 3T1HH 5JCOA 5EYPA 1O9GA 5KHIA 3B2EE 3RGXA 1WN7A 3W5OA 4I4TA 1N32H 4TQFA 4LFAH 5LMNB 4O2AA 1XMOB 4O4HA 1Z2OX 5LL6b 2VQEH 1BGWA 4EFEA 1M93A 4LFBB 4ZI7A 5JVDB 4PZ7A 3RWRD 4O2BB 3BPZA 1E4FT 3CHXA 2HEPA 4YJ3A 4DK1A 2IM9A 4JI3B 4K8ZA 4FLTA 4EEQA 4TV9A 2KSWA 5LMNH 4GKKB 1IBMH 1JFFA 1XHZA 3N2KA 3NBZB 1X9NA 1H2SB 1M0WA 4LFBH 1RSOA 3E22B 4I50A 5BMVB 3UQ8A 3KYHC 4X1IB 4FM0A 5D1OA 3OTFA 4DR7H 5FD5A 4EQ5A 3TY9A 3CVZA 2HGSA 4JI8H 4X1KA 3HKCA 3RR5A 1VS0A 4I55B 3RYCB 4UCTA 4PDBA 4B08A 1Z5WA 2JS5A 4CS2A 4LH7A 5LXTB 4MTDA 4YJ2B 5KHGA 2XHBA 4UFZA 5CB4A 4X65B 1HNWB 4FLVA 2ZJTA 4IHJB 3RYIB 1N36B 3J80W 3CB2A 4RB3C 3JALB 1G6UA 3JAKB 1XQ8A 5FPOA 5CA1B 4NXMB 2UXDB 4HNAA 2KKWA 5D5PA 4JV5H 5JH7B 3RGZA 4X65H 5LYJB 3E22A 4JI1B 5FD6A 5BMVA 4YHHH 4X1IA 3JAMW 4LMYA 4DV3B 3L4JA 3WB2A 4DR2B 4NXMH 2UXDH 4FVMA 3JARB 3RYCA 1FFXB 4UCUA 5KX5A 4LF7B 4D7SA 2VWKA 4IIJB 4JI1H 4U3JA 4K8XA 3JSNA 1S5JA 5D5QA 4KL1A 2HVRA 4DR3H 4JI5B 3JAWB 5IJ9A 4DRFA 5KHKA 4O4JB 3KXYT 4DR2H 1QQCA 4IHJA 3K58A 2W57A 3KAKA 3DSQA 3K3VA 2E3CA 4LSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 B;  2UU9 B;  3GJX B;  2UXB B;  2UUC B;  4LF6 B;  1N34 B;  1CKM A;  3L2P A;  1XMQ B;  4JYA B;  4JI2 B;  4NXN B;  4DR6 B;  2E5L B;  3W5O A;  1CKN B;  5D1P A;  1IBK B;  4DV0 B;  4TOI A;  4YY3 B;  4OX9 B;  3RTX A;  5LMN B;  4UCR A;  1XMO B;  4GKJ B;  1CKO A;  4DUY B;  3SGI A;  4UCV A;  4EFE A;  4E6N A;  4LFB B;  4PZ7 A;  4DV4 B;  4DV5 B;  4B3R B;  3VNN A;  4DR5 B;  4X62 B;  4JI0 B;  1HR0 B;  2F4V B;  4EFB A;  4B3M B;  4JI3 B;  4LF8 B;  2HHH B;  2HIV A;  1IBL B;  4EEQ A;  4JV5 B;  1N33 B;  1ZAU A;  4DV7 B;  4K0K B;  4GKK B;  2HVQ A;  4KHP B;  5LMU B;  3NBZ B;  1X9N A;  2HVS A;  5BR8 B;  4YHH B;  4DV1 B;  2OWO A;  3UQ8 A;  3KYH C;  4X64 B;  4DUZ B;  4AQY B;  2ZM6 B;  5D1O A;  4DV2 B;  4EQ5 A;  5IWA B;  3TY9 A;  1V9P A;  3TY8 A;  4DR4 B;  3S24 A;  2Q2U A;  4GLX A;  1I94 B;  1XK5 A;  3RR5 A;  1VS0 A;  1J5E B;  4UCT A;  2UUA B;  1CKN A;  3W1G A;  4LH7 A;  3PN1 A;  3BA9 A;  1P8L A;  3OTO B;  4DR3 B;  4JI4 B;  4X66 B;  4UFZ A;  4X65 B;  1HNW B;  1XNR B;  2Q2T A;  5FPR A;  3NBY B;  4PZ6 A;  1N36 B;  1XDN A;  2HIX A;  3T1H B;  1DGS A;  3GDE A;  1B04 A;  3TY5 A;  4UCO A;  1FJG B;  2VUG A;  2UXC B;  3BAB A;  5FPO A;  4NXM B;  2UXD B;  4PZ8 A;  4LFA B;  5DIS C;  3W1B A;  1A0I A;  4UCS A;  3GB8 B;  2VQE B;  3NC0 B;  5D1O B;  1TAE A;  4B3T B;  2UUB B;  4JI1 B;  4B3S B;  4DR1 B;  1FVI A;  4DV3 B;  4DR2 B;  1HNX B;  3JSL A;  1P16 A;  4LF5 B;  4JI6 B;  1IBM B;  2VQF B;  4UCU A;  4LF7 B;  4CC6 A;  4LH6 A;  2CFM A;  3T1Y B;  4LFC B;  3JSN A;  4CC5 A;  3QWU A;  4DV6 B;  1HNZ B;  1N32 B;  2HVR A;  4JI5 B;  1S68 A;  4DR7 B;  4DRF A;  4LF4 B;  4LF9 B;  3BAA A;  1TA8 A;  1XNQ B;  4JI8 B;  3BA8 A; 
#chains in the Genus database with same CATH topology
 2LO1 A;  3U10 A;  2OCC B;  1EN4 A;  1H38 A;  3RYH B;  2NU7 B;  2J9G A;  1JA8 A;  2Y4R A;  4LFC O;  5CN0 A;  2JIZ G;  3T4D A;  3FMA A;  2DIK A;  1XRE A;  4WFB V;  1UJW B;  4UCR A;  3ZHV A;  3WO0 A;  4GKJ B;  5HV6 A;  1KEE A;  4DUY B;  1K73 W;  3BFR A;  2DPJ A;  3OUF A;  5JJJ B;  3SDL A;  2ZIM A;  4LF6 O;  4X20 B;  4Q4D A;  2F4V B;  2DYR B;  1VQ6 V;  1TVK B;  5IDJ A;  3ABK B;  5ITZ B;  3Q2O A;  3ZJZ A;  1BNC A;  3JAR A;  1RJP A;  4DV7 B;  3HXL A;  1AN7 A;  1DAA A;  4Z1M G;  3ABL C;  3J7A U;  3OHA A;  4YR0 A;  2QKC A;  3SR2 C;  3AK2 A;  3N41 B;  1FYJ A;  4B3M O;  4LF8 O;  2W9C B;  4AYB A;  4DL7 A;  3A0H Z;  1NU1 H;  4GLX A;  2HJW A;  3ASN C;  2JA8 G;  3O9O A;  5LMU O;  4IRK A;  1ZWI C;  3TII A;  3CCS V;  5DGA A;  5C8Y A;  1LR1 A;  1PNK A;  3LDE A;  4DO2 A;  4GCZ A;  4X64 O;  1JJO A;  1Q3E A;  4YJ3 F;  4DR4 H;  3KHG A;  3HR0 A;  2WLL A;  2HIX A;  3G67 A;  3T9C A;  4MA5 A;  4FLZ A;  5C1P A;  1B04 A;  2PTM A;  4ZOL B;  2JJ2 G;  1MZB A;  2BQR A;  5LHG A;  2C22 A;  1G4Y B;  3R9R A;  4JI4 H;  4A93 G;  5I5T A;  4M9U A;  3W1B A;  4UCS A;  1N33 O;  5E25 A;  1C3O A;  2PGG A;  3QFF A;  5KHJ A;  4I0X B;  4B3T B;  1DV1 A;  4B3S B;  5B1N A;  5J2T F;  3RAQ A;  1VQ9 V;  4K6N A;  3EPI A;  1I0H A;  4CBC A;  3WO1 A;  2JA7 A;  1ZL8 B;  1JJ2 U;  1ARO P;  3RB4 A;  4HNV A;  2VQF B;  1WA8 A;  4RWU A;  2XAJ A;  4O81 A;  2CDY A;  3F5T A;  4CC6 A;  2I8C A;  2HVK C;  5KMG B;  4MV6 A;  2ADQ B;  3QWU A;  1WP8 A;  3L73 H;  4DL2 A;  3T99 A;  1S76 D;  2Q8V A;  1VF5 B;  5I5S A;  2YI9 A;  1XNQ B;  1KP2 A;  4YAJ B;  4QIW A;  5KUK A;  1IBM O;  5DM6 V;  3L2P A;  1R9T A;  5KFC A;  3N27 A;  2OLS A;  1IBK B;  2FLN A;  4TOI A;  3LP8 A;  1F51 A;  3L72 H;  2R86 A;  2M7W A;  4UCV A;  2AZ2 A;  4LF9 O;  1W59 A;  2HLD G;  1ULZ A;  3OE7 G;  5B1A B;  2GUZ B;  1SS3 A;  2YC0 A;  4LF6 H;  3LDD A;  1G8M A;  3K3W A;  4D6T H;  2WA4 A;  1HR0 B;  2HDK A;  2IP4 A;  1IBL B;  3RYI A;  2IBZ H;  4O4I A;  2E5L O;  5C44 G;  4FK5 C;  2W0F C;  4TV8 B;  3GV8 B;  1B3Q A;  4JYB A;  5KFQ A;  1QR9 A;  4FFL A;  3JAL A;  2ZXW C;  4I9W A;  5BR8 B;  4DV5 O;  4YR3 A;  2WLI B;  4X62 O;  1DF5 A;  2A9H A;  2ARH A;  4B3M H;  4LF8 H;  3H1K H;  5IWA B;  4WFA V;  4ECX A;  4IL6 Z;  3RF2 A;  4DW0 A;  1QLE C;  3I55 V;  2Q2U A;  5CE8 A;  4U3F H;  2C2D A;  1OHH G;  1I94 B;  4O2A B;  3KCX A;  3H1I H;  2E2H A;  5LMU H;  4O4H B;  1XMQ H;  5KT7 A;  4LNU A;  4NYE A;  1MSD A;  1Q43 A;  3BA9 A;  1P8L A;  2SCU B;  4X64 H;  5GON F;  4DV2 O;  2N04 A;  5KG3 A;  3DGE A;  3G6E V;  1WCM A;  1N48 A;  4FGR A;  4O86 A;  4TV9 B;  2CW7 A;  1SQX H;  1VF6 A;  1JIH A;  4IWY A;  2L35 A;  3DF7 A;  3K9A A;  2P6J A;  1OCZ B;  3C3T A;  5BY1 A;  4I7Z B;  4LFA B;  2YCH A;  4J9K A;  1XUQ A;  3HKB A;  1SER A;  1N33 H;  1A0I A;  3UFX B;  4J9Q A;  1QNM A;  2Q0O C;  2GPW A;  1QVF U;  2BQ3 A;  1PX2 A;  4C5C A;  3HKC B;  4JAU A;  2PYL A;  2OT5 A;  1FVI A;  5FNV F;  3WWI A;  5KFK A;  3G80 A;  2NNU A;  1HP8 A;  3CQZ A;  1KEC A;  4FFK A;  3BVO A;  1HNX B;  2YRW A;  1KC7 A;  5KFN A;  3K0D A;  2PMZ A;  1FXH A;  1SCU B;  3MWE A;  2IA6 A;  3QF7 A;  4UVB A;  1VBH A;  3DC6 A;  2JJ1 G;  3RB0 A;  4QIW E;  4X1Y B;  2YZN A;  2K9P A;  2RJZ A;  1P7B A;  2WLJ A;  4ZHQ A;  5LP6 F;  4BW9 A;  2Q9L A;  4EB6 B;  3LUT B;  1M9N A;  1IX9 A;  4PA6 A;  3UCS C;  4LF4 B;  4A3M G;  3N8D A;  3BG5 A;  2R82 A;  5A9G A;  3T54 A;  3T9F A;  4KUM A;  4LF5 O;  2UU9 B;  1I08 A;  5GW7 A;  3RVZ A;  2ZD9 A;  3OGC C;  1LNQ A;  4TT3 G;  2CNU A;  2GQS A;  1GN3 A;  3E2E A;  4GX5 A;  1E4E B;  1SQQ H;  1PPJ H;  2XIG A;  1Q6H A;  5KFB A;  4H37 A;  1R3J C;  2RMK B;  4MV1 A;  1BGY H;  5LA6 B;  3SJB C;  3J7A K;  2VQE O;  4CKC A;  3IN5 A;  3R5F A;  5KFI A;  1GRJ A;  3ZHT A;  4LF9 H;  3OUZ A;  2FTK A;  4PDR A;  5L3D A;  5B1B B;  4XYM B;  1E1R G;  3MFH A;  4EYI B;  4NTX A;  3K5N A;  2J6U A;  1M57 C;  3JD1 A;  2E5L H;  2MCT A;  4FE2 A;  3B09 A;  4FFB A;  5LOV A;  1VQK V;  4JV5 B;  5BWV A;  3MWM A;  2BSK A;  2KQX A;  4FFN A;  2FK1 A;  3H40 A;  2ASL A;  2NVX A;  5KFU A;  5I5U A;  5HBR B;  5B66 Z;  4LFB O;  3SYP A;  4DV5 H;  3K5L A;  2PZS A;  3TGU H;  1F23 A;  1RK5 A;  4X62 H;  3DTU B;  5I5W A;  2VQD A;  2O03 A;  3CRA A;  4JI3 O;  2JGD A;  2HKO A;  2OIG A;  5JJE B;  1MSW D;  2QM4 A;  3QG5 A;  5BYB A;  2JGU A;  3PVX A;  5KG1 A;  2EIN C;  5B1O A;  2UUA B;  1Q90 D;  2WAQ E;  1R6N A;  2AXT Z;  1KQS U;  4DR3 B;  5IJ0 A;  1YI2 V;  4X66 B;  2EIL C;  5JQG A;  4DV2 H;  1XNR B;  2OTL V;  1NS1 A;  4BY7 G;  1VQP V;  1Y74 A;  4O7W A;  4PA7 A;  2FLL A;  4PD4 F;  5IY5 C;  3K03 A;  5L3B A;  1FJG B;  1LUV A;  4H44 B;  2W6Z A;  3ZRS A;  1Y1W A;  2R8K A;  5CA1 F;  4BBR G;  5KT3 A;  2HJF C;  5KFJ A;  5BPF A;  2HR3 A;  4I4T B;  5EK0 A;  1JKJ B;  1NZ6 A;  4X65 O;  3MR2 A;  4BAY A;  1HNW O;  3OUS A;  5DEC A;  4KHP H;  3H4B A;  2V7Q G;  1N4C A;  3KAJ A;  2B5U A;  1N36 O;  5K1X A;  4XX0 B;  5KHH A;  4ZI7 B;  2VA3 A;  1VQO V;  3OMA B;  4EBD A;  1OBG A;  1B6Q A;  3HB3 B;  2Z0A A;  4YJ3 B;  1AP5 A;  4NXM O;  4B7K A;  2RGV A;  5C8Y B;  1R3L C;  4CH5 A;  3T5H A;  4ED2 A;  3F7V C;  3PO3 G;  4MTG A;  1GM8 A;  4CC5 A;  4ECS A;  3RYF A;  3SJA C;  1AUX A;  4O3R A;  1TUE B;  2CE4 A;  3FB6 C;  4JTC B;  2RNB A;  4J42 A;  1I2K A;  2EIM B;  4O4J F;  3BAA A;  1YSC A;  4WBN A;  3K59 A;  4JGS A;  4CS3 A;  4X1K B;  4ECW A;  5DGH A;  2CTW A;  3DC5 A;  4PV1 B;  1JLL B;  1O9G A;  5KHI A;  3ZHU A;  4HQ6 A;  1GSA A;  3VPD A;  1RP3 B;  3W5O A;  1Y1V G;  4JI5 O;  3QZ7 A;  2JRI A;  5B3S B;  2W7O A;  1XMO B;  2VQE H;  1Q6U A;  2J6T A;  4RU9 A;  4MTO A;  1BGW A;  1ENV A;  5CBF A;  1AR4 A;  1FAF A;  4JAV A;  3RWR D;  2HJD A;  3CHX A;  4DR1 O;  2W9A A;  4GC7 A;  4HNU A;  4HNT A;  1MZE A;  1WA8 B;  3OMN B;  2HG5 C;  4DIM A;  1MAB G;  2QM8 A;  4MVQ A;  3CRQ A;  4GKK B;  1AI7 A;  3FAV A;  4DUY O;  3NBZ B;  1H2S B;  1U97 A;  4LFB H;  2ZE5 A;  1NJI W;  4I50 A;  5BMV B;  3HKZ A;  4FM0 A;  2R92 A;  3VBB A;  2F4V O;  4UUJ C;  4X88 A;  2AZ0 A;  2EZP A;  1PL0 A;  4DV7 O;  5I60 A;  2DPI A;  3FKS G;  5DG9 A;  1VS0 A;  4RNO A;  4UCT A;  3FD9 A;  5KFL A;  2V9W A;  4LH7 A;  4GZR B;  1I2L A;  2FPG B;  2Y0S A;  1GO3 E;  3TIN A;  3I5D A;  5KG7 A;  3Q8R B;  3JD2 A;  4IHJ B;  3RYI B;  3EHB B;  1S0V A;  4IWX A;  4YP3 A;  4DQN A;  3J80 W;  5KG6 A;  2DAB A;  1M56 C;  3JAL B;  1G6U A;  1I5X A;  1AJP A;  2EZO A;  1DF4 A;  4MVM A;  4A3I G;  2M05 A;  4O7T A;  2QTS A;  2KKW A;  5CMU A;  2CQY A;  5JH7 B;  3O65 A;  3RVY A;  4X65 H;  2WB1 E;  3JZ6 A;  3BQ0 A;  3E22 A;  3HOZ G;  2Q69 A;  4YHH H;  4X1I A;  5FL7 G;  3J80 N;  1I1L A;  4DV3 B;  1KJI A;  2IJK A;  4PDV A;  2B63 G;  3L74 H;  1H2M A;  4J10 A;  4DR2 B;  3RB3 A;  4NXM H;  3ORQ A;  4TQR A;  3T5K A;  4J9P A;  4DW1 A;  1L0N H;  4J80 A;  1GLV A;  3H0G G;  4B3T O;  2E75 B;  1MZF A;  2NUA B;  3JSN A;  5EBL C;  4B3S O;  1G1X B;  3KTM A;  2HVR A;  4RNM A;  5IJ9 A;  2OCC C;  5KHK A;  4F6E A;  5KFG A;  3T1C A;  1ZX3 A;  4O7R A;  3T5L A;  4ZBM A;  4A3C G;  3GTG A;  4F4W A;  3CE2 A;  1XIL A;  3WB1 A;  3HKB B;  3GIJ A;  2VOB A;  5BWU A;  1OCO B;  2VQF O;  2F93 B;  3JAK A;  1GN4 A;  3AG2 B;  3OUU A;  5EDW A;  2C35 B;  3OT7 A;  1CKN B;  1ZTE A;  5D1P A;  3RV3 A;  3T9A A;  1FS0 G;  2QWR B;  1YTF D;  1YTF B;  2ZE8 A;  2DYR C;  2FYU H;  1XNQ O;  1H8H G;  1US6 A;  3CSW A;  5LP6 B;  1CQI B;  3VNN A;  4DR1 H;  4FS1 A;  5EZY F;  3R65 A;  3OHB A;  5I5Y A;  2R7Z A;  2P4V A;  3QQM A;  2Q73 A;  2HHH B;  3QNE A;  1IUR A;  1YEW A;  3V6K A;  1IBK O;  4O82 A;  4ZHQ B;  2VPQ A;  4TV8 F;  4JUZ A;  2ABJ A;  2WSS G;  4DYL A;  2P06 A;  1RFY A;  4IIJ A;  2PI5 A;  2OTJ V;  4WD3 A;  4Q45 A;  1Y76 A;  1X59 A;  1PKX A;  4LP8 A;  1UNN C;  3T1Y H;  3JAW A;  2Y48 A;  4M7E A;  4ECV A;  4R8C A;  2ZM6 B;  3V6H A;  2AHZ A;  2F4V H;  3GWO A;  1HR0 O;  3LSU A;  3SPJ A;  5J9P C;  2DWE C;  4FLW A;  2XAQ A;  1IBL O;  5DLF A;  5C3E G;  2D3O W;  3L75 H;  3OGI B;  4DLK A;  3LSS A;  1XK5 A;  4GX2 A;  1SQF A;  1DV2 A;  2JEG A;  4O2A F;  2CAZ C;  4O4H F;  1PNL A;  5BR8 O;  2Y0I A;  4CH3 A;  2YWV A;  2IJI A;  1JDB B;  2ZCE A;  4IYH A;  5KG0 A;  2W8L A;  5IWA O;  5K3W A;  3E83 A;  4ED0 A;  4FFB B;  3MR6 A;  4O83 A;  4TV9 F;  2DYS C;  1I94 O;  1I5Y A;  2LJ2 A;  1PK8 A;  2XCP A;  2ASD A;  3ZRX A;  2R84 A;  3NR7 A;  3HT5 A;  4A3L G;  2FB5 A;  1X4T A;  4R7C A;  3JD0 A;  3PO2 G;  1GK9 A;  4PA3 A;  4QSH A;  3E8B A;  4XBF A;  3VPC A;  4UUG A;  1GMG A;  5CA0 A;  1NTK H;  4ME6 A;  1QBZ A;  4DL4 A;  3HOV G;  5JVD A;  1RPR A;  2R87 A;  5FR9 A;  4LFA O;  5IJ0 B;  2RCV A;  4C5B A;  4C5A A;  3TXQ A;  5JQG B;  2EBO A;  1VQN V;  1YZB A;  4B3T H;  4BWA A;  3RV4 A;  4B3S H;  4ZIB A;  1Y74 B;  1K83 A;  5F2V O;  2YI8 A;  1S68 A;  1E1Q G;  4BW5 A;  3T9B A;  5DN6 G;  2XAF A;  1K8A W;  1TA8 A;  1HNX O;  4C2M A;  4J0M A;  2W6P A;  1Y4M A;  3DAA A;  4YR2 A;  2UUC B;  2WYO A;  2VQF H;  2EJ3 A;  1T3N A;  2ZGI A;  4GLW A;  5B1A C;  2AGO A;  2DLN A;  1OZ0 A;  3GTO A;  3B8M A;  1OCC B;  4YY3 B;  2XAS A;  1K7D A;  3UO3 A;  2W6J G;  4I55 A;  2KSD A;  4LF4 O;  2KG7 A;  3SGI A;  1RM1 C;  4J9L A;  1XNQ H;  1V54 B;  3QO5 A;  2Z5U A;  2OIE A;  4DV4 B;  4YJ2 A;  4CKE A;  5KAF Z;  2UU9 O;  3VA7 A;  2HVJ C;  4DR5 B;  2UXN A;  1N56 A;  2HG8 A;  4AIL C;  3RBD A;  1WR2 A;  3H9V A;  3K3P A;  4JYY A;  2V4R A;  2YS7 A;  1KKC A;  1IBK H;  3LWB A;  3VOT A;  4ECU A;  3RB6 A;  3RYF B;  1ZAU A;  2ODM A;  2YSU B;  4WHX A;  3Q1K A;  1CS0 A;  1I1K A;  2RDJ A;  2JS3 A;  5KFX A;  4RZQ A;  1KMI Z;  5L3F A;  3KAL A;  1M90 W;  1P4R A;  4J9O A;  5LYJ A;  4AQY B;  1HR0 H;  4FM2 A;  2CH7 A;  2WAM A;  3VQY A;  5LGT A;  1U96 A;  1XL4 A;  3TY8 A;  2WTF A;  3APO A;  1Y1W G;  4JV5 O;  3BRC A;  4CH4 A;  2PY5 A;  2VUM A;  1JVM A;  3HKE A;  2X7R B;  2HHF A;  3AG3 B;  1H2K A;  4NXN H;  3BY6 A;  5KA5 A;  2IJH A;  3OTO B;  2NU9 B;  3R66 A;  3GB7 C;  1FFX A;  3FB8 C;  1OCZ C;  5H5N A;  4LR3 A;  5KFP A;  1NTM H;  1JX4 A;  5KFF A;  2LFS A;  1AR1 B;  2R72 A;  3CXH F;  4DRX B;  1XDN A;  5BPH A;  2W6M A;  1I94 H;  1BMF G;  4BR6 A;  3T1H B;  4H13 B;  4R50 A;  3FAV B;  2DWD C;  2QWN B;  2UUA O;  2GQR A;  3V6J A;  4MS2 A;  3C0F B;  2X6C A;  4DR3 O;  1YJN V;  3OFN G;  4I50 B;  3MFI A;  3ETQ A;  4XYL B;  4X66 O;  4P9O A;  4I4T F;  3M4I A;  3TQ1 A;  1XNR O;  5IYB O;  1L0L H;  1RYR A;  4UVA A;  2FLP A;  2CTQ A;  4ZI7 F;  1ZQ7 A;  3GIM A;  1FJG O;  4EGJ A;  2PF4 E;  4JTD B;  4YIO A;  4J7J A;  1XDC A;  2RGR A;  1SZT A;  5C8Y F;  2JEI A;  1UC9 A;  2YIB A;  2LGW A;  2XAH A;  3R23 A;  4PDM A;  3C90 A;  3SPC A;  1EN6 A;  2QJ1 A;  4FFR A;  1SA0 A;  4IGG A;  1JDE A;  1KJ9 A;  4DR7 B;  2YZG A;  4JTA B;  1SES A;  1HNX H;  2C00 A;  4XZ3 B;  3EXA A;  4JI8 B;  4TM5 A;  4TUY A;  4CMD A;  3HKD A;  1Z2N X;  1JXL A;  4JI7 B;  2UXB B;  5L9X A;  2LFR A;  3JD4 A;  2ZNJ A;  4JI2 B;  5L3G A;  5B1B C;  5KLV H;  4PDL A;  1ZHQ A;  2F66 C;  4TVI A;  4OX9 B;  1P49 A;  4TSF G;  5EC2 C;  4LF4 H;  3E5N A;  4A2B A;  1YVW A;  1K92 A;  5J2T A;  5C1O A;  3AG1 B;  4B3R B;  3GWK C;  2UU9 H;  3JAT A;  3G6B A;  2R8G A;  4RZR A;  2DW4 A;  4JI0 B;  4LC1 A;  3FKI A;  2LW7 A;  1CP9 A;  2HIV A;  4J9R A;  4WCE V;  4NTW A;  3KHL A;  3U0Z A;  3LNM B;  5IJ9 B;  3PR5 B;  1L2Z A;  2O57 A;  2BTO A;  2HVS A;  3IC9 A;  4QJF A;  1TGO A;  2CUG A;  3CS5 A;  2GTS A;  4LFC H;  1NR7 A;  1I50 A;  5BMV F;  4F6R A;  4QIW F;  3DXR B;  1EZ1 A;  4Q0Y A;  1AI4 A;  3CCE V;  2BTQ B;  4FBU A;  1V9P A;  3S24 A;  4HR7 A;  3DTG A;  2GLT A;  4GKK O;  5EZY B;  2QM7 A;  1MNG A;  2H94 A;  5BWT A;  3WNZ A;  4FS2 A;  5JQW A;  2ZE7 A;  2H3O A;  3PN1 A;  4PI0 A;  2YL2 A;  5KFT A;  3N2G B;  4MVZ A;  5CM0 A;  4RB1 A;  5EBW C;  1A0G A;  1M7J A;  5JCO C;  5J2U A;  1K34 A;  1FXK A;  1TUB A;  3PW2 A;  4PZ6 A;  4IHJ F;  3U9S A;  3ZHQ A;  2ZE6 A;  4DK0 A;  2UUA H;  2G38 A;  2PYJ A;  2VUG A;  1IOV A;  3GTK A;  1Y76 B;  3OR7 C;  5EYP B;  1KP3 A;  5KFW A;  2YID A;  3LSQ A;  4X66 H;  3WU2 Z;  5IYZ A;  5BZB A;  1AUV A;  1XHX A;  5JH7 F;  1XNR H;  3EFF K;  2XCA A;  4QGP A;  4EGQ A;  3GV5 B;  2UUB B;  2DQ0 A;  3ZMZ A;  1YXB A;  1T36 A;  2BOC C;  4A3G G;  1FJG H;  1YCI A;  1NI8 A;  2P67 A;  3JSL A;  3X2Q B;  4MVR A;  3WB0 A;  3B8N A;  1I7N A;  4O7V A;  2WAQ A;  4HYK A;  5FLX W;  3SNO A;  2ZT9 B;  2IU0 A;  3RFR A;  2X6A A;  3CRR A;  2Z3Y A;  4MTF A;  5DQI A;  3QO7 A;  2ODT X;  4DV3 O;  3SI8 A;  1R1B A;  1K5S A;  3L70 H;  2JA6 A;  4DR2 O;  3ETH A;  5IP7 G;  4BIZ A;  4E2L A;  5DG7 A;  5B3S C;  3G6Y A;  1KC8 W;  3LQS A;  2LW1 A;  3B2E E;  4EBE A;  4PA4 A;  2OCH A;  4TQF A;  1W0K G;  4HZ3 A;  3G4S V;  5LMN B;  2R7M A;  4QW8 A;  4GUN A;  5LL6 b;  3V4Z A;  3TW7 A;  1SC5 B;  3ABL B;  3HOW G;  3U54 A;  4CE5 A;  1AVM A;  1M93 A;  2VR1 A;  4QWA A;  5JVD B;  4PZ7 A;  3OAA G;  4J7Z A;  2BQU A;  3QZ8 A;  4CHI A;  5KFY A;  2GTA A;  3H1L H;  3CEB A;  4K8Z A;  3OEE G;  3GLK A;  1KTA A;  1Y66 A;  1FFT B;  4ZHQ F;  3CRC A;  1IBM H;  1JFF A;  3N2K A;  1X9N A;  1RSO A;  2VA2 A;  3KYH C;  3RN4 A;  1M6V A;  5FD5 A;  4EQ5 A;  2NLJ C;  1NKD A;  2XUM A;  1ZLZ A;  1GSH A;  5KFR A;  3C3S A;  1WP7 A;  4I55 B;  3RYC B;  4PDB A;  4CS2 A;  2WPD G;  3UO2 A;  4YJ2 B;  3ZN1 A;  1YHQ V;  2ASJ A;  2QA4 V;  2XHB A;  5CB4 A;  2ZM6 O;  3NUA A;  3KHH A;  3AK3 A;  1ORQ C;  1K1Q A;  2IW5 A;  3MWD A;  5LOV F;  3ABM B;  1XQ8 A;  3K5I A;  5FPO A;  3ZCC A;  4C7U A;  3MHS C;  4J9M A;  3H3V H;  2PN1 A;  5L1J A;  3RGZ A;  5LYJ B;  3AG4 B;  2GPS A;  3FYI B;  4UXN A;  3UM7 A;  3ZRW A;  4PWQ A;  2CH7 B;  4JI1 B;  1GH6 A;  2A7W A;  1ZUQ A;  3JAM W;  4RUF A;  5JVL A;  4K3A A;  3IFX A;  4I5S A;  1T94 A;  2RF4 A;  2ZDI C;  4IR1 A;  2HHF B;  3WG7 B;  3NGD A;  5KKN B;  1VF6 C;  3RW0 A;  4YBZ B;  3JAR B;  5IYC G;  1VMG A;  1FFX B;  5KX5 A;  3ASO B;  4BY1 G;  2DAA A;  5JQG F;  2QWP B;  3STZ C;  4U3J A;  1EKF A;  1Q86 W;  4KL1 A;  1OCO C;  2BR0 A;  2R9R B;  3JAM N;  2VS0 A;  2A79 B;  2ILM A;  3AG2 C;  1VBG A;  4DR2 H;  2FJZ A;  3K58 A;  1BQZ A;  3DSQ A;  3K3V A;  1HDJ A;  2AW9 A;  5JWP A;  4O7L A;  3D3Q A;  5T14 A;  2R85 A;  4QE7 A;  1XMQ B;  4X9Q A;  1AJN A;  1BHB A;  1VF7 A;  2ATL A;  4FLX A;  2WB1 A;  2COI A;  5LP6 C;  2DMX A;  5C93 A;  4RUA A;  4PJ0 Z;  4FIP C;  5KFV A;  1ZET A;  2ATK C;  2E76 B;  2YXH A;  3JCZ A;  2ZXW B;  5CBG A;  3CD6 V;  1B6S A;  3N40 P;  3KRE A;  5LHI A;  4O4L A;  2UUC O;  2OH2 A;  2WLL B;  3CSX A;  2R9A A;  1BSM A;  2YIB D;  3NXS A;  4WFG A;  2VUM G;  1QLE B;  4O3S A;  1BHA A;  4YY3 O;  1N33 B;  2W9B A;  4LF5 H;  4K0K B;  2X6B A;  4Q6G A;  5LGU A;  4LF7 O;  1SET A;  5HFM A;  1YF2 A;  4DV1 B;  1FXV A;  3H01 A;  1Q6I A;  2QKA A;  3HKD B;  4TUY B;  4DV4 O;  4DR5 O;  4RB2 C;  2QWO B;  3THO A;  3I4N G;  3GTJ A;  4YIP A;  1GKF A;  4FM1 A;  1TWC A;  4IAJ A;  3RFC A;  1HWY A;  1WB8 A;  3MD0 A;  2Q7H A;  2UVR A;  1XOU A;  4AHC A;  1S03 G;  3JAT B;  2X0S A;  2IU3 A;  3UYY A;  2ZM6 H;  1H2L A;  3KG2 A;  4AQY O;  1B6R A;  4EYH B;  1YIT V;  1K9M W;  1EFR G;  4GKJ O;  2Q2T A;  5FPR A;  2AQ4 A;  1K5Q A;  4MVO A;  2QF7 A;  3QO8 A;  2YUA A;  5IYD G;  4YQW A;  1PD3 A;  4A3B G;  4WFH A;  3UT5 A;  3RIZ A;  2NR5 A;  3TY5 A;  5FJ8 G;  2Y4U A;  4CZZ A;  4ETS A;  4UCO A;  2FPP B;  5C5J A;  3BAB A;  1JMK C;  2CW8 A;  3L4K A;  4JI3 H;  3ZHR A;  2EJ2 A;  1RJQ A;  3OTO O;  4A3J G;  1K3E A;  1S97 A;  2QK4 A;  5EIB D;  4I50 F;  4F6R B;  1HW7 A;  4WFF A;  2DOS A;  4EKW A;  1JCH A;  4Q20 A;  3TQT A;  2C28 A;  3AEI A;  1KBH A;  5H2F Z;  1IYD A;  4FLY A;  2Z04 A;  3HBL A;  4KXR A;  2C2A A;  4PI2 A;  3H1J H;  2RDI A;  4O2B A;  4O4I B;  5EC1 C;  3M9N B;  1KT8 A;  2JA7 G;  4QPK A;  4NZO A;  2ZIN A;  1FXK B;  2C2R A;  3W7T A;  1PL4 A;  1Q82 W;  1SQV H;  3FDS A;  1HNW H;  3TEK A;  1OCC C;  3VQV A;  4P9P A;  1N36 H;  4FLU A;  5C4X G;  3P3N A;  4ZOL A;  1THZ A;  5IYZ B;  1I1M A;  5KT6 A;  3GTP A;  1Y14 B;  1V54 C;  4D7T A;  5LL6 Y;  3CCV V;  4OPH A;  4LNU B;  4DV0 B;  4FZ1 A;  3BHP A;  1WPB A;  5TIS Z;  2Q0A A;  3TJT A;  2WDT A;  2YXY A;  5F9N A;  4JI8 O;  2KB1 A;  5LXT A;  4JI7 O;  2UXB O;  3F5W C;  3K79 A;  4QPJ A;  3G8D A;  2RDC A;  2EUL A;  4JI2 O;  2AGP A;  1ZL8 A;  1F4M A;  1SKV A;  3ZIA G;  4YY3 H;  4J9S A;  3OM3 B;  3ZMS A;  4OX9 O;  4F4X A;  1WH2 A;  2XND G;  5EWF A;  5KMG A;  4LF7 H;  4KHP B;  3M9O B;  4RUC A;  1UPG A;  4MVS A;  3K08 A;  4B3R O;  3GID A;  4DR5 H;  4JI5 H;  4JI0 O;  4DUZ B;  4R8U A;  1BZK A;  2F1M A;  3AG3 C;  3ABK C;  2H8P C;  2LP7 A;  1CE8 A;  2P22 C;  4JPR A;  4TQS A;  5DMX A;  4HBN A;  1J5E B;  4QWB A;  2R7K A;  1K97 A;  1Z2G A;  3M7M X;  2FKX A;  4P30 A;  2A0L A;  2BCC H;  3RBZ A;  1ZHS A;  1VAJ A;  4O3Q A;  5IT9 W;  3PFF A;  4GKJ H;  4DUY H;  2F95 B;  2CZG A;  1D5A A;  2GUZ A;  3ZS8 C;  1A48 A;  3NBY B;  3J81 W;  3OEH G;  3GIQ A;  2RN9 A;  1EUD B;  4YB8 B;  1T5E A;  5KA6 A;  1WCM G;  4HAM A;  4O3N A;  3GII A;  3KCY A;  2CNV A;  3N2K B;  1Y6X A;  2UXC B;  4TV8 A;  1RSO B;  1SQB H;  4E4T A;  3OTO H;  1GSO A;  5IT9 N;  2JEJ A;  1JX9 A;  3CC2 V;  4DV7 H;  1NQT A;  2Y69 B;  2VQE B;  3CC4 V;  3NC0 B;  5D8D A;  2CTP A;  1XBL A;  2FML A;  3FYE B;  2W8K A;  5I5X A;  3J81 N;  2W7P A;  3K5O A;  4R7R A;  2P90 A;  5H6Q A;  4RUE A;  2NVY A;  2R93 A;  3SPH A;  3U11 A;  1VQ4 V;  3GVM A;  4NYK A;  2EIJ B;  4JI6 B;  3KKY A;  2YZM A;  2HGX A;  5LOV B;  1BCC H;  1SYX B;  4U6P A;  5CB4 B;  5H80 A;  3WWJ A;  5L1K A;  2BSK B;  5F9L A;  1M1K W;  1AI6 A;  2UUB O;  4DV6 B;  1HNZ B;  3JAS A;  4Q44 A;  2ZDH A;  3PW4 A;  4LSA A;  2FK2 A;  2FMA A;  2QDO A;  4RAZ A;  4MV8 A;  5BWW A;  2JGD B;  4UVC A;  1VIB A;  5AG2 A;  4F4L A;  1VQM V;  1N34 B;  1GYF A;  4JYA B;  1V55 B;  4DR6 B;  3I12 A;  2EIK B;  3LUL A;  1IZ3 A;  1TWG A;  1CKO A;  5CA0 F;  3JZF A;  5KUM A;  2QTO A;  4E6N A;  4A2A A;  4JI7 H;  2R8J A;  5JVD F;  2EX3 A;  5DLG A;  4Q43 A;  4F4Y A;  4ECR A;  2UXB H;  4WFE A;  1KYO F;  3ML0 A;  2GHY A;  5KX5 B;  5KFO A;  3K5M A;  3BEH A;  4OPA A;  1TWF A;  4JI2 H;  3JD3 A;  5L1I A;  4EBC A;  1W93 A;  1IXM A;  4U3J B;  4OX9 H;  5LMN O;  3A8T A;  2QB5 A;  3MHH C;  4X8A A;  4X1Y A;  4L1K A;  4YHH B;  4B3R H;  4EB6 A;  1O9H A;  1XI1 A;  2OWO A;  2BE3 A;  4JI0 H;  3CCL V;  1KB9 F;  1KD1 W;  3B40 A;  1PV0 A;  3SYQ A;  3S3X A;  3QTC A;  1MG1 A;  4NZN A;  1EM1 A;  3G6V A;  2W6I G;  3ZX6 A;  5L1L A;  1B06 A;  4I55 F;  2YIC A;  3N6R A;  3W1G A;  2ADP A;  2R9I A;  3D36 C;  4BBS G;  2LGQ A;  4JYC A;  5LA6 A;  4O4L B;  3K57 A;  1A9X A;  4YJ2 F;  2UVU A;  4F50 A;  4EEY A;  3HPL C;  3TIG A;  1CEZ A;  4TQD A;  1IVS A;  1GAX A;  4J41 A;  2PI4 A;  2V59 A;  4ED1 A;  1Q8I A;  4WBN B;  2W9B B;  4A3F G;  3VMM A;  3N42 B;  2YIA A;  4O7Y A;  4FFO A;  1OCR B;  1IBL H;  5K2M A;  4JZG A;  1QCE A;  4BWS C;  3GQC A;  1WB7 A;  1Y67 A;  4PHZ A;  5LYJ F;  1TAE A;  3X2Q C;  4ED8 A;  1I3Q A;  5BR8 H;  5K1P A;  4DR1 B;  4QWE A;  4ABM A;  1QHT A;  5HFL A;  3SE7 A;  5IWA H;  4ECZ A;  1H8E G;  1P16 A;  1W96 A;  4H33 A;  3HOY G;  1SEI A;  3PZP A;  2GBO A;  1NT2 B;  3OSN A;  2UUB H;  3SYA A;  4JI1 O;  3T1Y B;  1ET0 A;  3OR6 C;  4MW8 A;  2XGQ A;  1N32 B;  1JR9 A;  4K35 A;  2JK5 C;  3UT5 B;  4J9Z B;  1SZX A;  4HN2 A;  4NTY A;  5KFA A;  3T4Z A;  2YU9 A;  2VWJ A;  3G71 V;  2FB9 A;  5JCO A;  1JOY A;  1Y1V A;  5KT4 A;  1DTO A;  4NKG B;  1WAZ A;  1PM9 A;  4I4T A;  4LFA H;  5DED A;  4QWC A;  3W7W A;  1Z2O X;  1WSC A;  2YS8 A;  1D2D A;  5B5E Z;  4IZO A;  4ZI7 A;  2P7T C;  5L3E A;  3G8C A;  4O2B B;  3BPZ A;  5H6R A;  1E4F T;  2HEP A;  2I87 A;  4YJ3 A;  1XMQ O;  2DE0 X;  1KKD A;  3CJH A;  4EEQ A;  1B33 N;  1KJQ A;  5LMN H;  1EYZ A;  1XHZ A;  3CCM V;  2IH1 C;  1FKA O;  3CEI A;  5IYD O;  4LWS A;  1M0W A;  1R6K A;  2CKZ B;  1S0M A;  2QWQ B;  2A1H A;  3E22 B;  3AX6 A;  5DGB A;  4TUY F;  4X1I B;  5E1A C;  5D1O A;  1CQJ B;  1VQ8 V;  5EWG A;  2N05 A;  4PBC A;  2D2C B;  3TY9 A;  2W6Q A;  1S10 A;  2R92 G;  2HGS A;  4X1K A;  4K0K O;  2DYS B;  1QU7 A;  5KG2 A;  3SYO A;  2DQ3 A;  2JS5 A;  1GM9 A;  5IE9 A;  1EHI A;  3T7A A;  1S0O A;  2K1E A;  3E89 A;  4O7N A;  3UZB A;  5KFS A;  4DV1 O;  4DL3 A;  5LXT B;  4MTD A;  3PW0 A;  2XT9 A;  3ABM C;  4UFZ A;  3CCR V;  2WLM A;  1XMO O;  4UB6 Z;  5CAE B;  2W70 A;  4FFM A;  4MTX A;  1EZJ A;  3AG4 C;  2X0L A;  2Q7D A;  3JAK B;  3K04 A;  2UXD B;  1Q7Y W;  3GIL A;  3GTL A;  4HNA A;  1COW G;  4JV5 H;  2IJJ A;  4ZQI A;  4R8U B;  3WG7 C;  4RNN A;  5FD6 A;  4OGQ B;  5BMV A;  3I56 V;  1EUC B;  2B63 A;  2XAG A;  2E74 B;  1XL6 A;  1A32 A;  3ASO C;  4N21 A;  5KS8 A;  4ECY A;  3CMA V;  2AU0 A;  4OXS A;  2HGW A;  3WB2 A;  2W6N A;  3CWB H;  2QE7 G;  3HB9 A;  2EJR A;  3L4J A;  4U7N A;  5IP9 G;  2EIY A;  4BXX G;  2A3Q A;  3T2M A;  4FVM A;  3H0G A;  4O4I F;  1F4N A;  1S5H C;  3H1H H;  2R8H A;  2NU8 B;  4D7S A;  2VWK A;  1C30 A;  4IIJ B;  5EBM C;  5J2U F;  4U7C A;  4JI1 H;  3ZN0 A;  4K8X A;  1AP6 A;  2F23 A;  1S5J A;  5D5Q A;  3T9D A;  4DR3 H;  2FK3 A;  3MR5 A;  3JAW B;  5KT2 A;  4A3E G;  4DRF A;  4JF3 A;  4ASU G;  1RM1 B;  4IHJ A;  4FBT A;  2W57 A;  1IDS A;  4LSX A;  1BQ0 A;  3RBE A;  2XOK G;  3GJX B;  1GM7 A;  3B77 A;  3ETG A;  4AYB E;  5IYZ F;  1K1S A;  4NXN B;  5FLM G;  1KJJ A;  3TK1 A;  5LBQ A;  1GTO A;  1KU9 A;  1VQ7 V;  3ABU A;  5JH7 A;  4ED6 A;  2Q68 A;  3ETE A;  3RTX A;  3EYY A;  2P4K A;  2YXL A;  2XC9 A;  5KFD A;  4LBE C;  1AR5 A;  1I7F A;  2B9Z A;  2EIM C;  4CH6 A;  1TWH A;  3BQ2 A;  5GON A;  2RQ6 A;  1SRY A;  4RAY A;  3B4S A;  3H20 A;  3TXS A;  2L6L A;  2R7Z G;  3FB7 C;  5I47 A;  3MJF A;  3VQX A;  4ZKI A;  4DV0 O;  3ZMT A;  3JAS B;  2E2I A;  1FKA H;  1W0J G;  2ZDI A;  5FLX N;  4JZ2 A;  3JRW A;  1SF9 A;  2WA3 A;  2R7N A;  4YXW G;  5CA0 B;  1CXZ B;  2QYZ A;  4ED7 A;  2YEV A;  4DR4 B;  2UXX A;  5FNV A;  2ZIO A;  4K0K H;  4Q8E A;  1Z2P X;  4G28 B;  3E86 A;  4KHP O;  1CKN A;  5CBH A;  2CGN A;  2IMW P;  4ECQ A;  4DV1 H;  3EVK A;  2R6F A;  4JI4 B;  3UKM A;  3ASN B;  4DUZ O;  2NU6 B;  4J11 A;  3BJY A;  2JA5 A;  1XMO H;  3ZMU A;  4JAA A;  4O84 A;  4IRD A;  2R93 G;  4LCU C;  3KZI Z;  5LP6 A;  3JRX A;  3P3P A;  5EIB C;  1J5E O;  4KP4 A;  1EKV A;  1QR8 A;  3AYH B;  2HHH O;  3A0R A;  5DIS C;  4A5U B;  3W7S A;  4GKK H;  3LML A;  1Q81 W;  4FM9 A;  2KG7 B;  5CA3 A;  4N23 A;  1M5I A;  2AHY A;  1RPO A;  1FXK C;  1SQP H;  4NVP A;  4CS4 A;  3P32 A;  2UXC O;  1S9F A;  1VEW A;  2PVP A;  2UVV A;  1G2W A;  1E4G T;  5L3C A;  2R70 A;  3APQ A;  1P84 F;  4UB8 Z;  1OJH A;  1PP9 H;  5JJN B;  4MVU A;  2COJ A;  4NZM A;  5CB4 F;  2LQT A;  4LH6 A;  4GX1 A;  2WE6 A;  2CFM A;  4LFC B;  5JUM A;  1WJZ A;  4NR1 A;  1I6U A;  4A3K G;  3T9E A;  3CCU V;  5DQG A;  1M4U A;  2CGO A;  3JYC A;  2JVD A;  4JV0 A;  3Q4H A;  1NVP D;  1NR1 A;  2B1I A;  4UV9 A;  1NVP B;  1K4D C;  4JI6 O;  4LF6 B;  1CKM A;  2CNQ A;  1M0T A;  2VRZ A;  3HKE B;  4XDK A;  2DWC A;  2FE3 A;  1LUW A;  4DV6 O;  5KG5 A;  1HNZ O;  4FJC C;  3STL C;  3IG0 A;  4MT8 A;  5BYA A;  1H2N A;  3CRM A;  4FZ0 A;  4P2Z A;  4MV7 A;  4M0J A;  1QLN A;  1N34 O;  2F43 G;  4DV3 H;  4J9N A;  2XD4 A;  4JYA O;  2YW2 A;  4EFB A;  4B3M B;  4LF8 B;  3FFQ A;  4DR6 O;  5KX5 F;  1YIJ V;  2N74 A;  4HYO A;  2IBK A;  2DJV A;  1GO3 F;  4DV0 H;  1JPX A;  2YYA A;  3R5X A;  5GTH Z;  1IXB A;  2HVQ A;  2V58 A;  4RQF A;  1F7Y A;  2ZNI A;  5LMU B;  3GTM A;  5CA1 A;  4YAK B;  4JV1 A;  1S72 V;  4MW3 A;  3ICX A;  1IOW A;  3QVN A;  2Q67 A;  3OMI B;  2FP4 B;  3LDC A;  4X64 B;  3KHR A;  2XCL A;  2V4D A;  1L8D A;  1EBO A;  1K33 A;  5A2Q W;  1S0N A;  4E4E A;  3K06 A;  3ORR A;  2ITC C;  2CK3 G;  1ZSP A;  1R73 A;  3N44 B;  2QKS A;  3OD4 A;  4I7H A;  4APM A;  3ETJ A;  1BJT A;  3S3W A;  2PMZ E;  1KUT A;  2Z02 A;  1W2B U;  4YHH O;  1FPO A;  5BXZ A;  3IAY A;  3E35 A;  3H4D A;  2AGQ A;  1R3K C;  1JQ0 A;  3D3I A;  4DUZ H;  4O4L F;  3CC7 V;  1SA0 B;  1BL8 A;  1AB3 A;  5KFM A;  4Q8F A;  1L1F A;  5A2Q N;  4RQE A;  3HO8 A;  3CJH B;  4MAM A;  2Y69 C;  4B7E A;  1J5E H;  4BIO A;  4WBN F;  4FPP A;  4O4J A;  3T5J A;  3IGA C;  1MOF A;  1MMM A;  4O3O A;  4Y8V B;  1GN2 A;  4LWS B;  2HHH H;  3PR4 A;  1NBM G;  5CR5 A;  3RGB A;  3LNN A;  3GB8 B;  3SJC C;  5D1O B;  3RYH A;  5IYB G;  2EIJ C;  1GN6 A;  1H2G A;  1VAR A;  1YJ9 V;  2FPI B;  3VQW A;  5J2T B;  1UC8 A;  3MAQ A;  2DZD A;  4MV3 A;  1A3G A;  1WLE A;  4RB0 A;  2UXC H;  2ETN A;  2QGN A;  2JEF A;  3E8F A;  4BIU A;  3CCQ V;  2IH3 C;  3A2F A;  5BWX A;  1IBM B;  2FKL A;  4RCN A;  4X20 A;  4DAA A;  4RAI A;  4F4Z A;  1TVK A;  5ITZ A;  4MTE A;  2C2E A;  3AK1 A;  4QJF B;  4IYI A;  1V55 C;  3EPG A;  2ITD C;  4WF9 V;  3DTF A;  2EIK C;  4LF9 B;  2V4Q A;  2ZR2 A;  2M6Y A;  4DRX A;  1SQG A;  3A0B Z;  4HNA B;  3RUP A;  4JI6 H;  3M8A A;  2EJ0 A;  4G27 B;  2GSM B;  3T1H O;  3AW8 A;  4IT5 A;  4Q4C A;  3N6X A;  2W9C A;  4JV2 A;  3OW2 U;  3T1Y O;  4GX0 A;  2E5L B;  2OYQ A;  3Q8Q B;  4DV6 H;  4NLG A;  3ZMV A;  4QWD A;  2YRX A;  1HNZ H;  1N32 O;  5EOY A;  2HP8 A;  1Z5V A;  3AG7 A;  2V1D A;  3W7X A;  1Q5O A;  5J2U B;  3GV7 B;  3SYC A;  4UV8 A;  1TUB B;  2VPS A;  3I4M G;  3CYO A;  4DV5 B;  3M9M B;  4X62 B;  1N34 H;  3ABT A;  4O2B F;  3PW7 A;  4EG0 A;  4JYA H;  5BWR A;  5I5V A;  1O75 A;  1E79 G;  4L8J A;  3U55 A;  4DR6 H;  2XTA A;  3FKI G;  3BAC A;  3RT3 C;  2COG A;  3CP1 A;  3V4S A;  4DXW A;  4GC6 A;  1M57 B;  1DLB A;  4FMT A;  4FU0 A;  1S5L Z;  3ZED A;  3FX7 A;  4DV2 B;  4I0X A;  4DR7 O;  2W71 A;  4ZOL F;  2PUS A;  2YDE A;  3G6X A;  1NH2 D;  3TW6 A;  1NH2 B;  3CXC U;  3U0G A;  4G3I A;  2UUC H;  3E8G A;  4DL5 A;  3TCU A;  1XEQ A;  5KT5 A;  2GV9 A;  1P7G A;  3L9D A;  4Z1V A;  3IJ4 A;  5LXT F;  5GON B;  2R8I A;  4MA0 A;  1WNS A;  2DN9 A;  2P5O A;  3N43 B;  1OCR C;  2EIN B;  3CX5 F;  1UFI A;  1RK6 A;  4MV9 A;  4W4K A;  1PNM A;  2W6O A;  1EN5 A;  5KFE A;  4DV4 H;  1DGS A;  1YDX A;  3GDE A;  2Q7G A;  2EIL B;  2WLH A;  2WWW A;  2Q7E A;  1KBL A;  3K5H A;  4PZ8 A;  4JAS A;  4GYC B;  2Q5Z A;  5IY5 B;  5KAI Z;  1GGO A;  5E79 Z;  3CPW U;  1WRV A;  4JXU A;  5DGI A;  4CMF A;  2YEV B;  5KFH A;  2Q6A A;  3TET A;  4IRC A;  3GTQ A;  3DXR A;  5FNV B;  3E8H A;  1DK1 A;  2QSA A;  2HFE C;  4AQY H;  2BTQ A;  3K9S A;  1S77 D;  4U7O A;  2UXD O;  2BOB C;  1OBD A;  5EZY A;  4LF5 B;  3PW5 A;  3IC7 A;  4DL6 A;  4XDL A;  3RJ0 A;  5GTI Z;  4QNH B;  1JFF B;  3SPG A;  3N2G A;  3F8N A;  2Q4P A;  4IIJ F;  2I80 A;  5DQH A;  3ETD A;  4X89 A;  2CTR A;  3W7U A;  4O3P A;  1EKP A;  3Q8S B;  4O7S A;  4I9Q A;  4O7Z A;  2WLN A;  1CPY A;  1MA1 A;  4GT1 A;  1URF A;  3HKZ E;  3D36 A;  1RJR A;  3BA8 A;  2JA6 G;  4J9Y B;  3JZI A;  3HOU G;  2WLI A;  1ROP A;  3MR3 A;  3T1H H;  1AI5 A;  2ZKO A;  1IYE A;  2ZDQ A;  5EYP A;  4ICG A;  3P30 A;  3RGX A;  1WN7 A;  2MW2 B;  4FFP A;  1R3I C;  2R7L A;  3VPB A;  4MSW C;  5KG4 A;  1N32 H;  4H0L B;  4QE9 A;  1OWT A;  4O2A A;  1K4C C;  4O4H A;  4RO2 A;  1BT8 A;  4EFE A;  2Y0S E;  3UZO A;  2JEX A;  3L71 H;  4LFB B;  1BXR A;  4R6Z A;  5KFZ A;  4TWK A;  2QR4 A;  4DK1 A;  2IM9 A;  4PA9 A;  4MV4 A;  4JI3 B;  4NXN O;  4FLT A;  1KJ8 A;  1TWA A;  3WFV A;  4TV9 A;  2KSW A;  4ECT A;  3OSP A;  4CKB A;  2V5A A;  4A3D G;  1N8R W;  1NTZ H;  3SJQ C;  2XGP A;  4W4L A;  4Z2W A;  3RAX A;  5LHH A;  2JA5 G;  2GDS A;  3ZRW B;  3VOU A;  3AG1 C;  3Q4H B;  5HNE A;  2J6S A;  3D8C A;  3UQ8 A;  3CCJ V;  1DIK A;  3U9T A;  1EZV H;  3OTF A;  4DR7 H;  1WPX A;  1BS3 A;  1N0J A;  2WLK A;  3F7Y C;  1OV9 A;  3ZRV A;  3CVZ A;  3BQ1 A;  2ZDG A;  2JDI G;  4JI8 H;  2YS6 A;  2ALZ A;  5EWE A;  3HKC A;  4QW9 A;  2ZR3 A;  3ZBH A;  3RR5 A;  5DG8 A;  4B08 A;  1Z5W A;  4AI8 A;  1FD9 A;  2Y4T A;  3CME V;  2ZQM A;  5DAA A;  3K0G A;  5KHG A;  3GIP A;  4PEL A;  2MK3 A;  4X65 B;  1HNW B;  3FB5 C;  3PJS K;  4FLV A;  4XDJ A;  2P0A A;  2ZJT A;  4DR4 O;  2NN4 A;  5LGN A;  1N36 B;  1YJW V;  1N0N A;  1AJQ A;  3CB2 A;  4L87 A;  2UVW A;  2B1G A;  4RB3 C;  2PBZ A;  3GIK A;  5CA1 B;  4NXM B;  1V51 A;  1V4Y A;  3M99 B;  3ZHS A;  4JI4 O;  5D5P A;  4J7K A;  1KUQ A;  3SPI A;  1M56 B;  1E4E A;  1S3J A;  2EJ7 A;  1SFO A;  1AIL A;  5H9C A;  4LMY A;  1D5N A;  4NB5 A;  3WWH A;  2A06 H;  2UXD H;  4KFM A;  2Y0P A;  2W0X A;  5IYC O;  1BE3 H;  3RYC A;  4UCU A;  5LA6 F;  4ED3 A;  4LF7 B;  3Q8P B;  1RYS A;  1R6T A;  3R5H A;  2QEX V;  1QVG U;  2X5R A;  1I7L A;  1J95 A;  3BCC H;  1VQ5 V;  2YZL A;  4JI5 B;  3MDS A;  1VKZ A;  3JCU Z;  1VP7 A;  2AGA A;  4O4J B;  2FL4 A;  2JEU A;  1QQC A;  1VQL V;  4G2K A;  3KXY T;  3HOX G;  3KAK A;  4IR9 A;  2E3C A; 
#chains in the Genus database with same CATH homology
 3WB1 A;  3GJX B;  3HKB B;  3U10 A;  2VOB A;  2F93 B;  3JAK A;  1XMQ B;  1VF7 A;  3RYH B;  4NXN B;  1KU9 A;  4FLX A;  1CKN B;  5D1P A;  5LP6 C;  5JH7 A;  3FMA A;  3RTX A;  3EYY A;  2YXL A;  4UCR A;  4GKJ B;  1I7F A;  4DUY B;  4CH6 A;  3N40 P;  5JJJ B;  4O4L A;  5GON A;  2RQ6 A;  2ZIM A;  5LP6 B;  3VNN A;  4DR1 H;  4X20 B;  3CSX A;  2R9A A;  3H20 A;  4RAY A;  2F4V B;  2YIB D;  1TVK B;  2HHH B;  5ITZ B;  1YEW A;  3JAR A;  3VQX A;  1N33 B;  4LF5 H;  4ZHQ B;  3JAS B;  4DV7 B;  4K0K B;  3HXL A;  1AN7 A;  4Q6G A;  4IIJ A;  1FKA H;  3T1Y H;  4DV1 B;  3JAW A;  4TUY B;  3HKD B;  3SR2 C;  4RB2 C;  3N41 B;  4M7E A;  2ZM6 B;  2F4V H;  3THO A;  5CA0 B;  4FLW A;  4FM1 A;  4DR4 B;  4IAJ A;  4GLX A;  5FNV A;  2ZIO A;  4K0K H;  1XK5 A;  1Z2P X;  2Q7H A;  1SQF A;  2CAZ C;  1CKN A;  4CH3 A;  4DV1 H;  4AHC A;  5C8Y A;  1S03 G;  4JI4 B;  3JAT B;  2ZM6 H;  1JJO A;  2ZCE A;  1Q3E A;  1XMO H;  2Q2T A;  5FPR A;  4DR4 H;  5LP6 A;  2HIX A;  4FFB B;  5EIB C;  3UT5 A;  3RIZ A;  4FLZ A;  1B04 A;  3TY5 A;  2PTM A;  4ETS A;  4ZOL B;  4UCO A;  1MZB A;  3BAB A;  1JMK C;  2CW8 A;  3L4K A;  4JI3 H;  5DIS C;  4JI4 H;  3W1B A;  4UCS A;  5EIB D;  4GKK H;  4F6R B;  3LML A;  1X4T A;  2PGG A;  1HW7 A;  5KHJ A;  4FM9 A;  4B3T B;  1M5I A;  4B3S B;  5CA0 A;  4FLY A;  4NVP A;  4CS4 A;  5JVD A;  4PI2 A;  1E4G T;  4O2B A;  4O4I B;  5IJ0 B;  2R70 A;  2VQF B;  5JJN B;  5JQG B;  4CC6 A;  2ZIN A;  4LH6 A;  4B3T H;  5KMG B;  2WE6 A;  2CFM A;  4BWA A;  4LFC B;  4B3S H;  4ZIB A;  3QWU A;  1I6U A;  2YI8 A;  1S68 A;  1M4U A;  1HNW H;  1TA8 A;  2JVD A;  2YI9 A;  1XNQ B;  4J0M A;  3VQV A;  1N36 H;  4FLU A;  2UUC B;  2WYO A;  4ZOL A;  4LF6 B;  2VQF H;  5IYZ B;  1CKM A;  3L2P A;  4D7T A;  1M0T A;  3HKE B;  2FE3 A;  1IBK B;  4LNU B;  4DV0 B;  4TOI A;  4YY3 B;  3BHP A;  4I55 A;  1WPB A;  2Q0A A;  3IG0 A;  2WDT A;  3SGI A;  4UCV A;  1XNQ H;  5LXT A;  4MV7 A;  4DV4 B;  4YJ2 A;  4LF6 H;  4DR5 B;  4DV3 H;  4AIL C;  1HR0 B;  4EFB A;  4B3M B;  4LF8 B;  3FFQ A;  1SKV A;  3RYI A;  1IBL B;  4O4I A;  1IBK H;  4DV0 H;  4TV8 B;  4YY3 H;  3RYF B;  1ZAU A;  2HVQ A;  3JAL A;  1WH2 A;  5KMG A;  4LF7 H;  4KHP B;  2ZNI A;  5LMU B;  5CA1 A;  3ICX A;  5BR8 B;  4RZQ A;  1KMI Z;  3KAL A;  4DR5 H;  4X64 B;  4DUZ B;  5LYJ A;  4AQY B;  4JI5 H;  1HR0 H;  4FM2 A;  2F1M A;  4B3M H;  2V4D A;  4LF8 H;  1L8D A;  5IWA B;  3VQY A;  5A2Q W;  3TY8 A;  3RF2 A;  2Q2U A;  3BRC A;  2P22 C;  4CH4 A;  1I94 B;  2PY5 A;  3N44 B;  4HBN A;  4O2A B;  1J5E B;  4I7H A;  3HKE A;  1BJT A;  4APM A;  4O4H B;  5LMU H;  1XMQ H;  3M7M X;  4NXN H;  4LNU A;  1ZHS A;  3BA9 A;  1Q43 A;  3IAY A;  3OTO B;  1P8L A;  5IT9 W;  4X64 H;  1FFX A;  4DUZ H;  1SA0 B;  4GKJ H;  4LR3 A;  4DUY H;  2F95 B;  1D5A A;  3ZS8 C;  3NBY B;  3J81 W;  2CW7 A;  2R72 A;  4TV9 B;  4DRX B;  1XDN A;  1I94 H;  3T1H B;  1T5E A;  3DF7 A;  1J5E H;  4O4J A;  3N2K B;  2UXC B;  4TV8 A;  3C0F B;  2HHH H;  3OTO H;  4LFA B;  2YCH A;  3HKB A;  4I50 B;  3ETQ A;  3RGB A;  1A0I A;  1N33 H;  4DV7 H;  3LNN A;  2VQE B;  3GB8 B;  3SJC C;  3M4I A;  3NC0 B;  5D1O B;  3RYH A;  3HKC B;  3K5O A;  3VQW A;  5J2T B;  3MAQ A;  2PYL A;  1FVI A;  4R7R A;  3U11 A;  4RB0 A;  2UXC H;  1HNX B;  2RGR A;  3A2F A;  3QF7 A;  4JI6 B;  1IBM B;  4X20 A;  5LOV B;  1SYX B;  5CB4 B;  2YIB A;  1TVK A;  5ITZ A;  4MTE A;  4X1Y B;  2RJZ A;  4DV6 B;  1HNZ B;  4ZHQ A;  3JAS A;  2QJ1 A;  4BW9 A;  4EB6 B;  1SA0 A;  4LSA A;  4DR7 B;  4LF4 B;  4LF9 B;  1HNX H;  4DRX A;  4RAZ A;  4JI8 B;  4TUY A;  1SQG A;  3HKD A;  4HNA B;  1Z2N X;  4JI7 B;  2UU9 B;  4JI6 H;  2UXB B;  1N34 B;  1GYF A;  4JYA B;  2ZNJ A;  4JI2 B;  3N6X A;  4DR6 B;  2E5L B;  2OYQ A;  2XIG A;  4DV6 H;  1HNZ H;  1ZHQ A;  2F66 C;  5EOY A;  4OX9 B;  1Z5V A;  1P49 A;  5LA6 B;  3SJB C;  4LF4 H;  1CKO A;  3J7A K;  1Q5O A;  4A2B A;  4LF9 H;  5J2U B;  4E6N A;  4A2A A;  5J2T A;  1TUB B;  2VPS A;  4JI7 H;  2UU9 H;  4DV5 B;  4B3R B;  2UXB H;  2EX3 A;  3JAT A;  4X62 B;  4JI0 B;  1N34 H;  5KX5 B;  4JYA H;  3K5M A;  4JI2 H;  3K5N A;  1O75 A;  4DR6 H;  4L8J A;  2E5L H;  2HIV A;  2MCT A;  4U3J B;  4FFB A;  5LOV A;  4JV5 B;  4OX9 H;  3U0Z A;  3MWM A;  5IJ9 B;  1L2Z A;  4X1Y A;  2BTO A;  2HVS A;  1TGO A;  4YHH B;  4DV5 H;  3K5L A;  4EB6 A;  1O9H A;  1XI1 A;  2PZS A;  2OWO A;  4LFC H;  4B3R H;  4X62 H;  4JI0 H;  4F6R A;  3ZED A;  4DV2 B;  2O03 A;  4Q0Y A;  2BTQ B;  3QTC A;  1V9P A;  2PUS A;  5JJE B;  3S24 A;  2QM4 A;  3QG5 A;  5EZY B;  2JGU A;  2UUC H;  2UUA B;  3W1G A;  2GV9 A;  3PN1 A;  4PI0 A;  3N2G B;  4DR3 B;  5IJ0 A;  4RB1 A;  5LA6 A;  3K57 A;  4O4L B;  5GON B;  4X66 B;  1WNS A;  5JCO C;  5JQG A;  5J2U A;  2P5O A;  1XNR B;  3N43 B;  4DV2 H;  1TUB A;  4TQD A;  4PZ6 A;  4MV9 A;  4DV4 H;  1Q8I A;  4WBN B;  1DGS A;  3GDE A;  2Q7G A;  3N42 B;  4DK0 A;  2UUA H;  2PYJ A;  1FJG B;  2VUG A;  2Q7E A;  2YIA A;  4PZ8 A;  5EYP B;  1IBL H;  4X66 H;  4I4T B;  5IYZ A;  4BWS C;  1XHX A;  1XNR H;  4GYC B;  4PHZ A;  1TAE A;  4KHP H;  2UUB B;  5BR8 H;  3KAJ A;  5K1P A;  5K1X A;  4DR1 B;  5KHH A;  4ZI7 B;  5FNV B;  1QHT A;  4AQY H;  2BTQ A;  1FJG H;  4YJ3 B;  5IWA H;  3JSL A;  1P16 A;  2RGV A;  5EZY A;  3WB0 A;  5C8Y B;  4LF5 B;  4CH5 A;  5FLX W;  1SEI A;  1NT2 B;  3RJ0 A;  1JFF B;  3RFR A;  2UUB H;  3N2G A;  3F8N A;  3T1Y B;  4CC5 A;  3RYF A;  3SJA C;  1N32 B;  3UT5 B;  4I9Q A;  3BAA A;  4WBN A;  3BA8 A;  3K59 A;  2VWJ A;  4CS3 A;  4X1K B;  3T1H H;  5JCO A;  5EYP A;  1O9G A;  5KHI A;  3B2E E;  3RGX A;  1WN7 A;  3W5O A;  4I4T A;  1N32 H;  4TQF A;  4LFA H;  5LMN B;  4O2A A;  1XMO B;  4O4H A;  1Z2O X;  5LL6 b;  2VQE H;  1BGW A;  4EFE A;  1M93 A;  4LFB B;  4ZI7 A;  5JVD B;  4PZ7 A;  3RWR D;  4O2B B;  3BPZ A;  1E4F T;  3CHX A;  2HEP A;  4YJ3 A;  4DK1 A;  2IM9 A;  4JI3 B;  4K8Z A;  4FLT A;  4EEQ A;  4TV9 A;  2KSW A;  5LMN H;  4GKK B;  1IBM H;  1JFF A;  1XHZ A;  3N2K A;  3NBZ B;  1X9N A;  1H2S B;  1M0W A;  4LFB H;  1RSO A;  3E22 B;  4I50 A;  5BMV B;  3UQ8 A;  3KYH C;  4X1I B;  4FM0 A;  5D1O A;  3OTF A;  4DR7 H;  5FD5 A;  4EQ5 A;  3TY9 A;  3CVZ A;  2HGS A;  4JI8 H;  4X1K A;  3HKC A;  3RR5 A;  1VS0 A;  4I55 B;  3RYC B;  4UCT A;  4PDB A;  4B08 A;  1Z5W A;  2JS5 A;  4CS2 A;  4LH7 A;  5LXT B;  4MTD A;  4YJ2 B;  5KHG A;  2XHB A;  4UFZ A;  5CB4 A;  4X65 B;  1HNW B;  4FLV A;  2ZJT A;  4IHJ B;  3RYI B;  1N36 B;  3J80 W;  3CB2 A;  4RB3 C;  3JAL B;  1G6U A;  3JAK B;  1XQ8 A;  5FPO A;  5CA1 B;  4NXM B;  2UXD B;  4HNA A;  2KKW A;  5D5P A;  4JV5 H;  5JH7 B;  3RGZ A;  4X65 H;  5LYJ B;  3E22 A;  4JI1 B;  5FD6 A;  5BMV A;  4YHH H;  4X1I A;  3JAM W;  4LMY A;  4DV3 B;  3L4J A;  3WB2 A;  4DR2 B;  4NXM H;  2UXD H;  4FVM A;  3JAR B;  3RYC A;  1FFX B;  4UCU A;  5KX5 A;  4LF7 B;  4D7S A;  2VWK A;  4IIJ B;  4JI1 H;  4U3J A;  4K8X A;  3JSN A;  1S5J A;  5D5Q A;  4KL1 A;  2HVR A;  4DR3 H;  4JI5 B;  3JAW B;  5IJ9 A;  4DRF A;  5KHK A;  4O4J B;  3KXY T;  4DR2 H;  1QQC A;  4IHJ A;  3K58 A;  2W57 A;  3KAK A;  3DSQ A;  3K3V A;  2E3C A;  4LSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...