5FPRA

Structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 104
structure length 307
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fprA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fprA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fprA02
3T1HB 1HNZB 2CFMA 3KYHC 1HNWB 3NC0B 2ZM6B 4DV1B 3GJXB 3RTXA 4DV6B 4X64B 4JI2B 4JI3B 4DR1B 4LH6A 4OX9B 4DR4B 3PN1A 3UQ8A 4JYAB 1A0IA 4AQYB 3NBYB 3OTOB 4CC6A 1N36B 3BABA 4LF4B 4DR7B 5BR8B 4LF8B 1IBMB 4CC5A 4PZ6A 4GLXA 3W1GA 1P16A 5FPOA 4K0KB 5D1OB 2VQFB 1X9NA 4NXNB 4LFCB 4X62B 5D1PA 2HIVA 4X65B 4LFBB 4UCSA 1IBLB 4B3SB 2Q2UA 3TY9A 2HVRA 1CKOA 1HR0B 1V9PA 4DUYB 4DV3B 4JI7B 4EFEA 4DV0B 1TAEA 2UXDB 4B3TB 5DISC 4UCOA 2OWOA 4NXMB 1N33B 5LMUB 5FPRA 4GKJB 4PZ8A 4LFAB 4UCUA 4UCVA 4DV2B 4JI4B 3BAAA 4YHHB 1TA8A 3L2PA 4JI5B 4TOIA 4JI1B 1CKNA 4LF5B 2UUAB 2UUBB 1FVIA 3T1YB 5LMNB 4DV4B 1P8LA 4UCRA 4UCTA 1HNXB 1FJGB 4JI8B 4KHPB 2HIXA 1CKNB 4DR3B 1VS0A 1N32B 4DR5B 2VQEB 1I94B 2UXCB 3TY8A 4EFBA 4DUZB 3NBZB 3VNNA 2Q2TA 4GKKB 4JI6B 4JV5B 4LH7A 3JSLA 4JI0B 1B04A 3RR5A 1S68A 1XMOB 3TY5A 3S24A 4E6NA 1ZAUA 2HHHB 4UFZA 1XDNA 2HVSA 4DV7B 1XNRB 1N34B 4LF9B 1DGSA 1CKMA 4B3MB 3W5OA 3BA8A 4LF6B 4DR2B 1IBKB 3JSNA 5IWAB 4PZ7A 5D1OA 4EEQA 1XNQB 2HVQA 3BA9A 4YY3B 1J5EB 4X66B 2UUCB 3QWUA 2VUGA 4EQ5A 2UXBB 1XK5A 3W1BA 2UU9B 4DR6B 3GB8B 4DV5B 3GDEA 4LF7B 1XMQB 2E5LB 4DRFA 2F4VB 3SGIA 4B3RB
chains in the Genus database with same CATH superfamily
4DW0A 3CCEV 2GQSA 2CW7A 3H4DA 3ASNC 3HKCB 4TUYB 3E8HA 4OX9B 4BBSG 2OT5A 4E4TA 1WB8A 3MR6A 1VF6A 1VQPV 4BXXG 1HWYA 4NZOA 4CC6A 5CB4F 2EILB 1BJTA 1K3EA 2V1DA 4LF8B 4MTGA 4OGQB 4GLXA 5DG8A 2FKLA 3ZHSA 3GWKC 3JAWB 3OE7G 1ULZA 5FR9A 5B1NA 1HNZO 2IJHA 1AROP 2Q7HA 2JS3A 3RV3A 2GV9A 1N34H 1OHHG 2W7PA 5D5QA 4DLKA 3KHHA 4LWSB 4FGRA 4O7WA 3RYFA 3V6HA 2R8JA 3T1CA 1ET0A 4NYEA 3RGZA 1E4EB 5LYJF 3TJTA 1J95A 1E1RG 3JD2A 5DM6V 5EK0A 1BZKA 4NXMB 3TQ1A 4ZI7A 1CP9A 4RAYA 3QO5A 1JX4A 2FTKA 3AG3B 4ECSA 3G6BA 4RQFA 3V4ZA 2R8IA 2WLJA 5H5NA 4I9WA 1AN7A 2UUBB 3CXHF 3JARB 1WSCA 4JTAB 1OCZB 3UZOA 2H3OA 4HNUA 1B06A 4RNOA 1HNXB 1Y74B 2ZE5A 3JD1A 4GX1A 5IYDG 1AJQA 1QLNA 4R8UA 5CB4A 3BFRA 2XAGA 2ZD9A 3OHBA 3BHPA 5KFXA 4DR4O 5FJ8G 4FLTA 2XAFA 2UXDH 2CGOA 4JI6B 2AGQA 1NR1A 3CRCA 1XNRO 4A3KG 2X6AA 3L74H 4BAYA 1JFFB 2Q9LA 2QDOA 2UXCH 3K79A 4ECVA 2ZCEA 2DPIA 5KFRA 3ML0A 3JRXA 3FB5C 1R6TA 1K73W 1N34B 4CMDA 2E2IA 1GSOA 3CCSV 2YDEA 1QVGU 3G8CA 5JQGF 1IXBA 3K3PA 5JQGB 5KG5A 4X1KA 1IBKB 3ORRA 4O4LF 1KBLA 4PZ7A 4PDLA 3M9NB 3SNOA 2ZQMA 3IFXA 4JYYA 1XEQA 4LF6O 4X20A 4O7VA 4I0XB 3T1HH 4QIWA 2RF4A 1W96A 1XK5A 4MS2A 3TQTA 1OCCC 3DXRA 4LF4H 4XX0B 1WR2A 4WFEA 1M7JA 2V4RA 3SGIA 3ZMVA 1IBLH 4XBFA 4O2AA 2ILMA 3T1HB 1KT8A 4YIPA 2B1GA 4UV8A 2Q0AA 4ZIBA 3RTXA 2HR3A 1LNQA 4PDRA 2ODTX 5KMGA 1B6RA 4LCUC 5H2FZ 2OH2A 3UT5A 4TV9F 4JI2O 3F7YC 1JOYA 4H13B 4DR3H 2A1HA 2JA6G 4DRXA 2ZE6A 4DRXB 3TIIA 1XILA 3ZMZA 3CP1A 1GM9A 4PDBA 2P4VA 1X9NA 4ED3A 1YXBA 1XUQA 2NUAB 1X59A 2VWJA 1SS3A 5IWAH 3PW5A 3OUUA 4JI3H 4X1YA 3AK1A 3Q4HA 4PV1B 5KAFZ 1DF4A 4DV0B 1TAEA 5IDJA 1HNXH 4B3SO 4I7ZB 2P6JA 3JD0A 4UB8Z 5KFDA 1HR0O 1S0OA 4HBNA 3JAKB 3QFFA 3Q8RB 4MTDA 1M1KW 4PHZA 4JI4B 2VQEH 4ED6A 2FMAA 4YBZB 1MA1A 2C35B 3L4KA 3AG1B 3JZIA 3UKMA 4UUJC 2YW2A 3ZHTA 3O9OA 5HBRB 4TM5A 1RSOA 1YTFB 5J9PC 3FKIA 5CAEB 4TUYF 2DYSC 5LYJB 2Z04A 2HHHH 2QTOA 4YJ2B 2DAAA 4WFGA 2GHYA 3SJCC 4CS4A 4HYKA 4DUZO 3MHSC 3PW7A 3VPDA 2W6JG 2DQ0A 4TV8A 1VARA 1H2KA 3ZHRA 4N23A 3JAMW 4R7CA 4G2KA 4X62O 3AK2A 2YZMA 5LGNA 4DR7O 3TY5A 1K1SA 1SKVA 4JASA 4KXRA 4BWAA 5KFYA 1T36A 2HJFC 1Y6XA 1XNRB 1KJIA 4R8UB 2WB1E 3BRCA 3TW7A 2R93A 3E8FA 4DR5O 3LMLA 5CA3A 4IR9A 2WLNA 3L9DA 3SPIA 4EEYA 4MVSA 4BBRG 3CSXA 3LQSA 4EB6A 3EPIA 4J9MA 3R9RA 1R3KC 3DC5A 5IT9W 5EYPA 5KHKA 4O4JF 4FLUA 3JZ6A 4GC6A 3OMAB 3G4SV 5KG4A 1FFXB 3QQMA 4FM0A 3N2KA 2YS8A 3Q8SB 1E4EA 2JVDA 1WCMG 5IY5C 1WA8B 3FAVA 2LGWA 3GTPA 3KYHC 4HQ6A 2R84A 1NS1A 1KJ8A 2W6OA 1H2NA 1ZHQA 4WFFA 5LA6F 3L72H 1RJRA 1JXLA 2UU9O 5AG2A 1EZVH 5L1LA 2CNUA 3PW0A 3HOUG 2W8LA 2H8PC 1KP3A 4DIMA 2WE6A 3UQ8A 4JYAB 4XYLB 5CMUA 2QWOB 4JZ2A 2E2HA 4A2BA 2BQRA 5LP6A 4MV7A 1F4MA 2HLDG 5L3DA 3ABLC 3TGUH 1ZQ7A 3ABUA 4ICGA 5L3BA 2HHHO 4C2MA 2JEIA 3CC7V 3CCMV 3RBEA 4MA5A 4ECQA 1Y14B 3KHLA 2R92A 1M9NA 4O4IB 4JGSA 3KHGA 4YB8B 2JGDA 3VMMA 4I4TF 5IWAO 3TY9A 4RZRA 4PA4A 5H9CA 3QNEA 1V51A 1AI6A 3OSNA 3FB8C 2DZDA 5DMXA 2ZINA 4FFBB 4B3TB 3OD4A 1QR9A 4O84A 4A3GG 4DK1A 4UCUA 2W0XA 3HB3B 3U0ZA 2W70A 4QPJA 2R8KA 2JEGA 5KG7A 3IC7A 2K1EA 3O65A 2EJRA 1SESA 5BZBA 5CBHA 1Q7YW 4HNVA 4GT1A 1NVPB 1FVIA 1P84F 2CTPA 1NTZH 5CBGA 5C4XG 4JI6O 3TXSA 4FFRA 3G6YA 1P8LA 4CH5A 4FLZA 4FLVA 2GBOA 4DR7H 4F6EA 3ZIAG 1K7DA 3E8BA 1CKNB 1FXKA 4FLXA 4PA6A 4I50A 3GIKA 1PL0A 1RSOB 3W7XA 4KHPO 4DQNA 4NXNO 3SJAC 4UVCA 2PI5A 3HKZE 4IZOA 4JI0B 5FD6A 1GN4A 4PA3A 5L3CA 4JAUA 1HR0H 1VMGA 2CTRA 3RYIB 1ZAUA 5CA0A 4LSXA 4I4TA 4LWSA 4JI5O 4NVPA 1NVPD 2W9BA 2E5LH 3P3NA 1UC9A 2BE3A 2EILC 2X6CA 4QJFB 5LHHA 4DUYH 5LP6C 2JK5C 4O7NA 4LF6B 1JDBB 1RK6A 4DV4H 3JAWA 1SZTA 3JSNA 1Z2OX 3RAXA 4LFAO 3T5LA 2Q67A 3ZMUA 2HEPA 1EZ1A 1N0JA 4IAJA 5KFGA 3PO2G 3J80N 2HVJC 2P4KA 3MR3A 4O3QA 2YEVB 2ZNJA 4FS1A 4IIJA 2R7LA 4DR6H 2BSKA 3LNNA 2PUSA 5I5TA 2M7WA 1CE8A 1HNZB 2C00A 4DV0H 1BHAA 1AP6A 4DV6H 4KL1A 3AEIA 5KMGB 3KZIZ 4LH6A 5B1AB 3U11A 3C3SA 2V5AA 2R7ZA 2V4QA 5HFMA 1VF6C 1H2GA 2AGAA 2IU3A 1BMFG 2VPQA 5FPOA 2ZXWB 4PDMA 3OM3B 4P30A 3KCYA 3MFIA 1SZXA 5J2TA 2R82A 5H80A 4B3SB 1MZEA 4MVOA 5B1BC 5KHIA 1IURA 2PMZA 1BQ0A 3TW6A 4ZBMA 5JQGA 1FKAH 4RAIA 4NZMA 1RJPA 1N36O 5KFEA 4RUEA 2OWOA 2W9CA 1FYJA 4O7YA 4OX9H 1N4CA 5EC2C 3GIIA 2B63A 3N6RA 5GONA 4G27B 5KHJA 4QW9A 4A3JG 2LW7A 3J81N 1VAJA 4IL6Z 5L3FA 4QSHA 4BIUA 4PELA 2QM4A 2EIJB 3D36C 3HKEB 2XIGA 3V4SA 4IRDA 2I80A 5I60A 4F6RA 2UXCO 1I1MA 3GVMA 3U9SA 2R72A 2OIGA 2XNDG 1N32B 4DR5B 1WCMA 1WPBA 2UXCB 2VUMG 3T9AA 4I50F 4K3AA 2QE7G 3T4ZA 4Q4CA 3VNNA 4JI6H 4E4EA 3OMIB 3HKEA 3MD0A 3ABKC 2DN9A 2Y0PA 4MAMA 5JVDA 2YWVA 2HJWA 5CB4B 1B6QA 4MV9A 3GV5B 2A06H 3R23A 4RNMA 1XMQH 3H40A 4QWEA 2IM9A 2HVKC 3K06A 3KAKA 4R8CA 4U3JB 3BY6A 4XDLA 2JA6A 4ECWA 3CB2A 1G2WA 1ZLZA 3BA9A 3OUZA 5I5VA 3PW4A 3ZJZA 4LFAH 5IYDO 4HNAB 3WB2A 1Y76B 4O4HA 4XDJA 5KFZA 2WYOA 3FKSG 2JEXA 1JA8A 4FFPA 1XQ8A 2MK3A 3B4SA 1PX2A 4ED7A 3K5MA 4CZZA 2YIDA 3RN4A 3RBZA 3ETGA 1I5XA 1M56B 1IVSA 1Z5VA 1XMOH 4QE9A 5HFLA 1OBGA 5FNVA 5DN6G 4DV6B 3SYOA 1YJNV 4TUYA 3OTOO 5IYCG 3AG3C 3LSUA 5IP7G 1F4NA 3DAAA 4A3LG 2ZXWC 1S97A 2ZIOA 1A0IA 5E25A 3E89A 4UVBA 1UFIA 2GPSA 2F1MA 1KYOF 3TETA 1B33N 3OMNB 1P7GA 2Q0OC 3K0DA 1PD3A 1I50A 1J5EH 4Q8EA 1IOVA 4TT3G 2VA2A 5LHGA 4MA0A 4I55B 3ASOB 4J9OA 3S3WA 5KFKA 2Q2UA 1BE3H 3LDDA 4B08A 2HVRA 2KG7A 3AG2B 1D5NA 4JI0H 3CS5A 3CYOA 2ADPA 4UCOA 5DGBA 4A3EG 4RNNA 4LFAB 1SQGA 2Q7EA 3ZN0A 5KFLA 2G38A 3L2PA 2FP4B 4YQWA 4TWKA 4JI5B 4H0LB 3T5KA 4GUNA 2IJJA 4YJ3F 3T1YB 1RYSA 1ZHSA 2F66C 3LP8A 4CMFA 1N36H 1EFRG 3KHRA 4UCRA 4DL7A 3JATB 2PY5A 1IBMH 2RN9A 3CCUV 3ABTA 2Y69B 3LSQA 3S3XA 4DYLA 2HIXA 2EZPA 4O3PA 2EJ0A 4U6PA 1R3JC 3H1JH 3KALA 4CH4A 2J6UA 3T54A 2CE4A 1CS0A 5LGTA 4X1IB 3GV8B 4DR1H 5F9NA 4GC7A 3N27A 3C0FB 2XCPA 4MV8A 4CE5A 1Q3EA 3F8NA 4RQEA 5JVLA 3OAAG 1IOWA 5CN0A 2JIZG 2W71A 2IW5A 4WF9V 4GCZA 3CEIA 3K59A 4KFMA 2BR0A 3H1LH 1SQBH 3IC9A 4K35A 4F4LA 3PR4A 3GTQA 1MABG 4J9RA 1JX9A 3ABLB 2F23A 3H1HH 3K5NA 2VRZA 4NR1A 3RVZA 2ZDQA 3TIGA 4Y8VB 2LP7A 1NH2B 2YC0A 4B3MO 1Q6HA 1M56C 4BIZA 3MHHC 2PMZE 3G6EV 4DV5B 2JA5A 3I56V 3GDEA 1N56A 2XD4A 3T1YH 3SR2C 4H44B 2UUBO 4RB0A 1M90W 4Q8FA 4JXUA 4DV1B 4X62H 4ED2A 2EULA 4BY7G 4Z1VA 3KKYA 4O4LA 3V6KA 5L9XA 1H38A 3JYCA 2RDJA 2KB1A 4BIOA 3WWJA 1JLLB 1ORQC 1M4UA 2QGNA 2KSWA 2AXTZ 1XMOO 1L0NH 4Q4DA 4X88A 3J7AK 4K6NA 4PZ6A 3CRAA 3W1GA 5EZYB 2F43G 4ZOLF 4QWBA 1DF5A 2R86A 1NJIW 4FBUA 4BWSC 1XL6A 2BTQB 5JH7A 5LHIA 4LFBB 3MDSA 3FB6C 2HG5C 3HOZG 3RWRD 2FK2A 4NXMO 2RDIA 5KFHA 4HNAA 2C2AA 1CQIB 4FPPA 4J42A 1F23A 4B3RH 4FU0A 2DYRB 1MSDA 4ASUG 4GX0A 4A3MG 1H2LA 1BHBA 3FD9A 1VEWA 1CPYA 2IJIA 2FB9A 2Y4UA 2ITDC 2FPGB 3PJSK 3BACA 4FFNA 2IMWP 2LW1A 3D8CA 2C2DA 1K5SA 4UCTA 2GUZA 3BG5A 1GLVA 5BWXA 4GX5A 2QWRB 4LR3A 5DEDA 1RYRA 3ZEDA 5KFQA 5E1AC 4IGGA 2VQEB 1KTAA 3X2QC 3T9EA 2N05A 4DUYO 4FFKA 4DUZB 3JARA 3CC4V 2W6NA 3ZN1A 4F6RB 4X1IA 5JVDF 5DQHA 4KHPH 1H8EG 3VBBA 5KT2A 1B04A 1WB7A 5JH7F 4WBNF 2E76B 3RW0A 2EJ7A 3CE2A 4IHJB 3VOUA 3SYPA 3I55V 1KJQA 3RT3C 3HOWG 4NTYA 1WRVA 2QB5A 1EM1A 4HR7A 4EYHB 2RCVA 5CA1F 2UVVA 4LF7O 3ETJA 4DR4H 4NZNA 2NNUA 4IYHA 1Q8IA 1QBZA 3A8TA 5KX5F 1VQ5V 4BR6A 1XNQB 3CRQA 4M7EA 2D2CB 2QKAA 4FJCC 3MAQA 3ORQA 5C5JA 3G6XA 4TQRA 1E1QG 4RU9A 5LL6b 4AYBA 2W8KA 2J9GA 4CKEA 1S0NA 4A3IG 2UU9B 3Q4HB 1KUQA 4LC1A 2UVRA 1YITV 5KHGA 3M8AA 4CKBA 1VQNV 1TUBA 5IT9N 2VQDA 4YAKB 1FAFA 1AR1B 1TVKA 4A93G 4DR1B 2BQUA 1XNQO 3NR7A 3E86A 1WH2A 2KQXA 2JA7A 2YEVA 3M99B 2B63G 3K9AA 4ZI7F 4IHJF 1SA0A 1N36B 4LF9H 3WO0A 4ED1A 3LUTB 2ETNA 2NN4A 1IBMB 4ABMA 4GX2A 4JV5H 4OPAA 1VKZA 4AQYH 2R9RB 3A2FA 5D1PA 3R5XA 4TSFG 1Q86W 1ZUQA 4DV5O 5C1PA 2FK1A 2DABA 4PJ0Z 2C22A 4RB1A 1S03G 2HGWA 2CH7B 1BT8A 1CKOA 2LFSA 2YZLA 3E35A 4JF3A 4M0JA 4Q44A 4JI7B 3RYIA 2JGUA 2IH1C 1VQ9V 1V54B 2R93G 3JRWA 2AW9A 3GIMA 2VUMA 5DAAA 4I0XA 1FXKC 4JPRA 5JCOA 3CSWA 3ZMSA 2UXDB 4MW8A 5FPRA 4C5AA 5A9GA 2Q68A 1A9XA 5KT3A 1DTOA 2NU9B 4O3NA 1Y76A 2ZDGA 4DL4A 4FK5C 2QYZA 1AILA 4JYCA 4JI1H 2Q6AA 2Z02A 1EHIA 4X66H 2P0AA 3ZBHA 1XREA 2NLJC 3APOA 2FK3A 3VA7A 4EBCA 5KFOA 2UXXA 3B8MA 4Q43A 2JA5G 1FJGB 2WTFA 4IHJA 5K2MA 1VQOV 5GTHZ 3GTJA 3M4IA 3WFVA 1MSWD 5EDWA 4QIWF 3I4MG 4LFBH 3G71V 1SFOA 5ITZB 2JEFA 5L3GA 5FL7G 3GILA 3RR5A 1HNWH 1XMOB 1Q5OA 4CHIA 2ASJA 1FD9A 1KUTA 3SJQC 3GTGA 1XMQO 2J6SA 1I2KA 2ZDIA 4K8ZA 1CKMA 2ZGIA 1FJGO 3CCJV 3W5OA 2UUCO 5B66Z 3MR2A 4PDVA 2DMXA 4JUZA 3RJ0A 4RO2A 4J7JA 4TV9A 2ATKC 1AUVA 3BPZA 4YY3B 4FFBA 5EBWC 2EIYA 3EVKA 2UUCB 4O4JB 2BTQA 5JH7B 4EQ5A 3AX6A 2FLNA 4H37A 2DQ3A 2P06A 2CTQA 2AQ4A 5J2UA 2XTAA 1XMQB 3J80W 2EINC 1TWAA 4J41A 4F4ZA 2EIKB 3SYAA 3JALA 1VIBA 1V55B 2GSMB 2ZM6B 5CBFA 4K8XA 4DV3H 1DV1A 3ABKB 4JTDB 1SRYA 4EBEA 4FZ0A 2R8HA 3GIDA 2GTSA 1WN7A 3CWBH 3H0GA 1SF9A 2W57A 5C44G 4DR5H 5LXTF 3UM7A 1SC5B 5KT7A 5KFVA 1QNMA 1R1BA 3H01A 3K04A 3E8GA 4X8AA 5KFIA 3HKCA 4P9OA 1OCOC 5KLVH 4O83A 5I5WA 4LNUB 2XOKG 3E83A 2XAQA 1WA8A 1SQVH 3FAVB 3BQ1A 4O86A 5EWGA 1XNQH 1RPOA 2QM8A 3MWDA 3ZHUA 4JYAO 1IBLB 3CCRV 2ZIMA 3VPBA 2Y0SA 1YSCA 2YI9A 3BJYA 4JI4O 3K58A 4HZ3A 4J9LA 1OJHA 3SYCA 5IYCO 3F7VC 3U0GA 4LFCO 4J9YB 3DF7A 4ECXA 4WFAV 3A0RA 2JRIA 5KA5A 2FMLA 1I6UA 2UUAB 5BR8H 2IH3C 4M9UA 5I5XA 4FBTA 3C90A 2ZNIA 4LF5O 3ZRSA 1R3LC 1XDCA 1VQMV 4QJFA 5CM0A 4BW5A 4AQYO 4JI2H 4JV1A 3CJHA 1XHZA 4U7OA 4TV8B 1VS0A 2ZDIC 2DYSB 4ZKIA 2EIMB 3CJHB 2IA6A 1VBGA 4RAZA 5LOVB 4WFHA 3AG2C 4DV4O 1ROPA 1WNSA 3GIQA 2XCLA 2DWEC 4LF8O 3WG7C 1XNRH 5E79Z 1B6SA 2E5LO 2YS6A 4RZQA 2R7ZG 2WLIB 3RB0A 2Q73A 5EBLC 4O7TA 1I2LA 1I7FA 4MVZA 4LF6H 1KEEA 3OSPA 3PW2A 2YCHA 3GTLA 2XCAA 3JCUZ 4JAAA 5JQWA 4XDKA 5JCOC 4X66B 2CZGA 4DAAA 1K33A 1Y4MA 2B9ZA 3W1BA 4CKCA 3ETDA 3HR0A 4ECYA 5JUMA 4J9SA 1VQ8V 2V4DA 1Y1WA 1NKDA 3DGEA 1Q82W 2CFMA 4FZ1A 2XGPA 2GTAA 4MV6A 2PZSA 3HT5A 3VQYA 3V6JA 1VQKV 3T9DA 4ETSA 1TVKB 3SI8A 3CRMA 4PWQA 1OCOB 3DXRB 5IY5B 3M9OB 2O03A 1CEZA 4J7ZA 1I08A 1QLEB 1R9TA 2VPSA 4NKGB 1TUBB 5L1JA 2XUMA 1BNCA 3UYYA 1M57C 2YIBD 2ADQB 3OUSA 2D3OW 4WCEV 1P16A 1W93A 2ZR3A 1QHTA 4K0KB 5IE9A 2L35A 4O7ZA 3RUPA 1JQ0A 2Y69C 3QG5A 5EOYA 1K83A 3BCCH 2YI8A 5BWUA 3OGIB 4IRCA 4WBNA 1YF2A 5BMVF 3AK3A 4B3TH 1U96A 1PNKA 1N32H 2AZ2A 1NTKH 4U3JA 1N33O 3ETEA 3UZBA 4EFEA 4GLWA 3FYIB 1JFFA 2NVYA 3OTFA 4ZHQF 1OZ0A 3N2KB 5DISC 4UVAA 3B2EE 4DV3O 5KX5A 1AI7A 3OEEG 5L1IA 1K1QA 4YHHB 1E4FT 5JJEB 1PL4A 3E22A 5B1OA 1A0GA 3T9BA 4BY1G 3UCSC 3HOYG 4EB6B 1W0JG 3THOA 1K9MW 4J10A 2WA3A 5TISZ 5LMUO 2GLTA 3VPCA 3D3QA 1D2DA 2OTJV 1KJ9A 4KHPB 2VA3A 2CNQA 1WAZA 3HKBB 4GKJO 4AILC 4ECTA 4DUZH 3W7SA 1M93A 1OBDA 3JAMN 2COIA 2IJKA 4FLWA 3RFCA 2COGA 3NBZB 4UXNA 4ZI7B 2K9PA 2LGQA 2Q2TA 5IYBG 1M0TA 2X0LA 3JSLA 2YRWA 4MTFA 5B5EZ 1Z5WA 2Q4PA 2UVUA 2Y4TA 4MV1A 3KREA 2L6LA 1N8RW 4Z2WA 3N44B 2YIBA 2QJ1A 2E74B 4DR2B 4NB5A 5KHHA 3QVNA 1JR9A 3L70H 5LGUA 2ZM6O 1HNXO 4FVMA 3K08A 4JI8H 4QIWE 3KTMA 3JZFA 5IP9G 4DR6B 1YVWA 2CH7A 2COJA 1WLEA 3N41B 2YYAA 3ZHQA 5JJNB 1XHXA 2DJVA 1Q43A 1JDEA 4LF9O 2RGVA 4FM9A 2Z0AA 2WAMA 2HHFA 2NU6B 2CQYA 4B7EA 2JDIG 4O3OA 3NUAA 5I5SA 5F2VO 4U7NA 3E5NA 1KKDA 5H6RA 5I5YA 1EKFA 2ZT9B 2AGPA 3HKZA 1SA0B 1Z2NX 4X89A 5BYAA 1IX9A 1AJPA 2FKXA 5GONF 2SCUB 5B1AC 3RGBA 1YJWV 1URFA 2ATLA 2VQFB 1IYEA 5KG6A 4NXNB 3B40A 3I12A 4LFCB 4X62B 5C8YA 2FB5A 1ZWIC 2XAHA 1DAAA 3RYHA 4A3CG 4P9PA 1AR5A 4UCSA 3MJFA 4AYBE 2W6ZA 4ZQIA 3BQ0A 5LA6B 4LF7H 1G8MA 1RM1B 3D3IA 2YXYA 1HP8A 2MCTA 3OFNG 2R92G 4DR2O 1SEIA 3K03A 3CPWU 4CS3A 3CRRA 5I5UA 4DV5H 2R7MA 3K9SA 2ZE7A 2QR4A 3N40P 5IJ9B 1E79G 1F7YA 4O7LA 1R3IC 1AP5A 4OXSA 5C93A 4ECZA 2EJ3A 4PI0A 1A48A 4W4KA 1KQSU 4DO2A 1S77D 4FFMA 1RP3B 4DR3B 3RB4A 3GTKA 2VR1A 2DE0X 2LFRA 4J80A 2UVWA 5FLXW 3FYEB 2JJ1G 5LXTA 4LP8A 3CCLV 4EKWA 3P3PA 5KKNB 1SQFA 1Y1VG 4I50B 5LBQA 3G80A 3CD6V 3UO2A 4W4LA 3K3WA 4JV5O 1MG1A 1S3JA 1EBOA 4I9QA 5KFJA 2LQTA 3RFRA 3VQWA 2A0LA 2JA8G 1QQCA 3H0GG 3IJ4A 1KB9F 5IJ0B 2WAQE 4RWUA 2DPJA 4B3SH 4HYOA 3ZRXA 1N32O 4IR1A 1PNMA 1THZA 1BS3A 1COWG 3OUFA 5IYBO 1PK8A 4YY3H 2Q5ZA 1U97A 1BCCH 1AB3A 3QWUA 4Q6GA 1IBKH 1O9HA 3A0BZ 4JI5H 2UXNA 1UNNC 3GB8B 4TQFA 1AUXA 3T1YO 3FMAA 3GTMA 2W9AA 2WLLA 2JEUA 1XOUA 4DR6O 1OCRC 1GTOA 1GH6A 1HNWB 3CQZA 1PNLA 3LDEA 3H9VA 5KFCA 4U7CA 1MOFA 2YXLA 2WPDG 2R7NA 3EYYA 1BSMA 4DV2O 2KKWA 1EKVA 3WNZA 4DL3A 1Y1WG 5KFFA 1EYZA 3NBYB 3STLC 1DIKA 4YP3A 1I3QA 3BEHA 5KUKA 1OCZC 1JVMA 2Z5UA 2UUBH 2YUAA 4CC5A 2JA7G 4IIJF 3ZS8C 1JMKC 5LOVF 2QWPB 2WDTA 4X1KB 5BMVA 1Z2PX 2R6FA 4LFCH 1S5JA 5EYPB 1S0VA 3L75H 4YJ3B 1V9PA 4DUYB 5GTIZ 4PA7A 2BOCC 2ZJTA 3BVOA 1VBHA 4KP4A 4H33A 4CBCA 4NXMH 1ZETA 3JASA 4PI2A 1IBKO 5LMUB 1SYXB 3HKDB 2N04A 3P32A 1SQPH 1GKFA 3LSSA 4O7SA 1TA8A 3PVXA 4DV7O 3HKBA 3FX7A 4FE2A 4RUCA 3T4DA 1BQZA 3L4JA 2YS7A 3FDSA 1RFYA 4JI4H 5FLXN 3G6VA 2VS0A 2Q7DA 5C3EG 3CMEV 1K8AW 4L87A 2CTWA 3CXCU 2WWWA 3WB1A 1KU9A 5KFAA 2CGNA 4L8JA 2NU8B 4NYKA 4JI8B 2YSUB 1JIHA 4YJ2A 3SDLA 2X0SA 3E22B 4UUGA 5LYJA 1NI8A 4UB6Z 2PN1A 1JCHA 3TY8A 2XC9A 5A2QN 5KX5B 3W7UA 1NTMH 5LOVA 1V55C 2VWKA 3HBLA 2IBKA 3HPLC 4G28B 4JI7H 5GONB 3S24A 2RDCA 1SCUB 2CUGA 1IYDA 1DLBA 1XDNA 3JAKA 2W7OA 5B3SB 2W9CB 1EN6A 2FJZA 3OT7A 2DOSA 1KC8W 4B3MB 3N42B 3AG1C 5LA6A 5KFTA 3T9CA 3IG0A 4O7RA 1I94H 1ZL8A 3EHBB 4A3BG 3R5HA 5LP6F 5IYZB 4ZHQA 2XT9A 3MWEA 3RIZA 2W0FC 3T9FA 3ASNB 2XGQA 4DV1O 4AI8A 4PBCA 2EIMC 4D6TH 1YI2V 3DC6A 5DLFA 1H8HG 1MZFA 3B77A 3UT5B 5KFBA 4MVMA 1KJJA 5L3EA 3MR5A 3G67A 1GMGA 3PFFA 1QR8A 3LWBA 3H3VH 2HDKA 1L8DA 4O81A 3RYCB 3QZ8A 4O4HF 4NXNH 1K97A 3BABA 1KKCA 3T5HA 4J7KA 4FM1A 5EWFA 1RPRA 5J2UF 4IIJB 1GYFA 2DLNA 2C28A 1AI5A 3WWIA 1NR7A 3UFXB 5KFUA 4HNTA 4J9ZB 4Q20A 4X65B 2PYJA 3X2QB 4DV7H 1XBLA 5DLGA 1VQ7V 5CR5A 1WP7A 1JJ2U 2X6BA 1OCCB 3ZCCA 3DTGA 2QKCA 1FFTB 4A2AA 2E3CA 2CNVA 1N33B 1YDXA 4GKJB 4DV2B 3BAAA 1I5YA 4FFOA 2KSDA 3JD4A 5DGHA 2BOBC 5LMNO 5DQGA 5DG7A 4JI1B 3RAQA 3VQVA 1GN2A 4LFBO 2QTSA 2DW4A 4DV4B 1VQ4V 2GQRA 2PGGA 2FE3A 2AU0A 1WP8A 4NLGA 5GW7A 4ED0A 2V9WA 4YIOA 4F4YA 2F95B 4IWYA 4YR0A 4C5CA 3L73H 1GO3E 2GDSA 4Q0YA 4GKKH 3OTOH 2W6PA 3BQ2A 4XYMB 5KT6A 4DV2H 1QCEA 3TINA 4D7TA 5FD5A 2RQ6A 1IDSA 2WB1A 2WLKA 1VF5B 2AHYA 1VF7A 1O75A 4JV5B 4DL6A 2WAQA 2AZ0A 1O9GA 4J9QA 1W2BU 3K5OA 2DYRC 1SQQH 4DV7B 2N74A 1US6A 5JWPA 2QWNB 4LF9B 1Z2GA 3A0HZ 1Y74A 2EJ2A 1GN3A 1QLEC 4TQDA 1FXVA 1P7BA 4B3TO 5D8DA 2UXDO 1PKXA 2BTOA 3OGCC 5IWAB 4O3SA 2A9HA 4HAMA 4ECRA 3FB7C 4WBNB 4DV6O 2B1IA 5DECA 1VQLV 5IYZF 1GSHA 4FS2A 1SQXH 4TVIA 5BPHA 1P4RA 4YHHH 1SERA 5BWVA 5FLMG 3VOTA 2O57A 4LBEC 5KT5A 2QA4V 1IBLO 5J2TB 4DRFA 2F4VB 1RJQA 1AR4A 1OWTA 3RB3A 2X5RA 3B09A 4E2LA 3WO1A 3RBDA 5D5PA 1NZ6A 1TWFA 2QKSA 2OCHA 4QWCA 1M57B 3H20A 3ZRWA 3N8DA 4DR4B 4FIPC 3APQA 3PN1A 3RYCA 5EBMC 4X64O 2P7TC 1AVMA 1G4YB 2F93B 4BW9A 4LF4B 2FPPB 4O4JA 3TEKA 3CHXA 1R73A 4B3RO 3OEHG 4B3MH 4I7HA 3N43B 2QF7A 3QO7A 4GZRB 5EIBD 4D7SA 3SPGA 2IP4A 4RCNA 2J6TA 1B3QA 3CC2V 4ECUA 4IRKA 4DK0A 1HDJA 4IYIA 1FS0G 1EN4A 4RB3C 5BR8O 4YY3O 3JCZA 1MZBA 3OW2U 1C3OA 3ZRVA 5IYZA 1K34A 4NTXA 1ZL8B 5HNEA 4EBDA 2OCCC 2YU9A 4ZOLB 1JJOA 3HOVG 3UO3A 1JKJB 1C30A 2ODMA 3TCUA 4B7KA 2H94A 4MW3A 2Y4RA 5KG1A 4LF5B 1GM7A 4I4TB 3B8NA 4O82A 4DL5A 2CAZC 1K4CC 1VQ6V 1N0NA 2EZOA 4YJ2F 1GM8A 4WD3A 1X4TA 4X64H 5BY1A 3HO8A 3ICXA 5KFSA 4JZGA 4DXWA 4ED8A 2YIAA 4Z1MG 2CK3G 1VP7A 5K1PA 4GKKB 3SYQA 3JATA 3QTCA 4MVUA 3N6XA 5DQIA 4MV3A 3E2EA 1PV0A 3J81W 1XL4A 1S10A 2ZE8A 4GYCB 2HHHB 3F5WC 4QWDA 4GKKO 4O3RA 4P2ZA 3MWMA 3RB6A 3AYHB 4O2AF 5A2QW 4FFLA 4XZ3B 2Q69A 5H6QA 3TK1A 1KMIZ 1Y66A 5KUMA 1YZBA 2C2EA 1T94A 5FNVF 3IGAC 4APMA 4PA9A 3K5LA 3HKDA 5D1OA 3FKIG 4EEQA 1J5EB 3LULA 3RYHB 2UUAH 1Q6UA 5C8YB 1OV9A 1EKPA 1UC8A 2A79B 2CW8A 2YXHA 1L1FA 4O2BB 2HGSA 3W7TA 4YHHO 1RM1C 2QM7A 2RGRA 2M05A 2R70A 5BMVB 5CA0F 5KAIZ 1IBMO 4JV2A 1PPJH 2OCCB 3R65A 1DK1A 1G1XB 1K4DC 3OR7C 4JI2B 2QK4A 4O2BF 4JI3B 1G6UA 1TUEB 3WWHA 1RK5A 1TWGA 5HV6A 1KD1W 5K3WA 2X7RB 5KG2A 4NTWA 2R9IA 1K5QA 1LR1A 4MTXA 2HHFB 3DTFA 2QSAA 5BR8B 2WA4A 4MVRA 5BWTA 3GLKA 3RF2A 3SPJA 4QE7A 3Q8QB 4QPKA 4JI1O 1FFXA 1P49A 1R6NA 2V59A 3JD3A 3R66A 1I94O 5EIBC 4DV3B 5JVDB 3CCVV 4N21A 3GIJA 3QF7A 2ZM6H 3Q1KA 3KCXA 1OCRB 1Q90D 1MNGA 1K92A 2Q8VA 4JI8O 1S76D 2ALZA 5I47A 4UCVA 3SPCA 4TV8F 1TWCA 2WSSG 5IJ0A 2P67A 4QNHB 4KUMA 3CCQV 3PO3G 2UUCH 1NBMG 4TV9B 1L2ZA 1I1LA 3Q2OA 1S72V 2F4VO 4HN2A 5J2TF 1IZ3A 1JPXA 4Q45A 3SPHA 2OTLV 4MTEA 5KFMA 5K1XA 2XAJA 1W0KG 4L1KA 2DIKA 1CQJB 4J11A 4J9NA 2I8CA 2PI4A 4FLYA 2YZGA 4WHXA 5BWRA 1I0HA 3I4NG 4EFBA 4I55F 3NXSA 2DWCA 4RUAA 2A3QA 2CDYA 1ZTEA 2NVXA 4LH7A 3HB9A 3ZX6A 1S68A 4JYBA 2ARHA 2FL4A 2CKZB 2HVSA 3LDCA 4CH6A 1DGSA 4PD4F 3LNMB 3T7AA 5KS8A 3W7WA 1FJGH 1YTFD 1YIJV 2R8GA 3SJBC 2BCCH 1M0WA 4X66O 1M5IA 1EUCB 2NU7B 3RYFB 2W6MA 1SETA 2HGXA 2UXBO 1S5LZ 3KXYT 3KAJA 2HVQA 1HNWO 2EIJC 5LMUH 4C7UA 2VQFH 2NR5A 2YICA 2UUAO 2MW2B 1A3GA 1ZSPA 4ZOLA 1XI1A 3PZPA 5EC1C 2E5LB 2RMKB 4LF4O 1S9FA 3TXQA 3T99A 3K3VA 1NU1H 1W59A 2EBOA 4F4WA 3GWOA 3WB0A 1YJ9V 3C3TA 3CMAV 4EGJA 4X64B 2VQEO 3AW8A 4I55A 4O2BA 2IBZH 3M7MX 4AQYB 4JI3O 2FYUH 3ASOC 1QVFU 4ZHQB 3HXLA 4MV4A 3T2MA 2QEXV 4DR7B 3KG2A 4LF8H 4LF5H 2EX3A 1S0MA 1YEWA 4UV9A 1ZX3A 5D1OB 1UPGA 4DR2H 3IAYA 1GSAA 3R5FA 1R6KA 4O2AB 2DWDC 3T1HO 3ZRWB 3H1KH 2HIVA 2PBZA 5FNVB 1Y1VA 4DR3O 2W9BB 2R7KA 1HR0B 4MVQA 4U3FH 2AHZA 4X20B 4AHCA 4A3DG 2WLIA 3H1IH 4PZ8A 3CX5F 1E4GT 2ZKOA 5KA6A 3RV4A 2HJDA 2WLHA 1BXRA 5CE8A 1GAXA 4G3IA 4TOIA 5KG0A 4EYIB 1FXKB 1CKNA 1NT2B 3M9MB 4EGQA 2P90A 2OIEA 1FKAO 3U9TA 5L1KA 3EXAA 4R50A 4O4IF 2JJ2G 2P5OA 1V4YA 1T3NA 4DV0O 5CA1A 4MTOA 3ABMC 3K0GA 4MT8A 3STZC 4CS2A 4A3FG 4R6ZA 1NH2D 2LO1A 2HG8A 3ZMTA 2ZDHA 3OHAA 4JYAH 1I94B 4LSAA 3PR5B 2Z3YA 2OLSA 4YXWG 5B3SC 1Q6IA 2F4VH 2YL2A 4RB2C 4E6NA 4YR2A 2UU9H 1AI4A 1NQTA 4OPHA 4UFZA 3GQCA 1WJZA 2ASDA 2B5UA 4YJ3A 1FXHA 2JGDB 1D5AA 3DTUB 2GUZB 5LMNH 4QWAA 1F51A 3D36A 1KP2A 3ETQA 3I5DA 4IT5A 3U10A 5KFWA 3BA8A 1J5EO 4YR3A 4RUFA 3N2GA 3RGXA 3ZHVA 1WPXA 2V58A 4WFBV 2V7QG 5BPFA 2C2RA 1PM9A 4FMTA 4I5SA 1HNZH 5LP6B 3RVYA 2VUGA 2UXBB 4K0KH 5LL6Y 1N34O 4LNUA 1LUWA 2QWQB 5EZYA 1GGOA 2W6IG 4LF7B 5C8YF 4O4IA 4JAVA 3ETHA 4B3RB 1BGYH 2A7WA 3K5HA 1L0LH 3NC0B 3IN5A 3GV7B 3EFFK 3P30A 3H4BA 3GJXB 1M6VA 1BGWA 2VOBA 2EINB 2WLLB 1IXMA 1MMMA 3K5IA 2EIKC 1CXZB 2I87A 3L71H 1KBHA 2XHBA 4J9KA 4FM2A 3WU2Z 2ZR2A 3OTOB 2PTMA 3JALB 4O4HB 3HOXG 5T14A 3CVZA 1KECA 1H2SB 5J2UB 1TGOA 1YCIA 3GIPA 1H2MA 3ABMB 4JTCB 4F50A 3QO8A 1TWHA 5EWEA 2E75B 3QZ7A 4QW8A 5DGAA 2R85A 2ASLA 4GKJH 4O4LB 3AG7A 1N33H 1AJNA 4J9PA 1HW7A 2WLMA 1GRJA 3K57A 3F5TA 3J7AU 3SE7A 2Q7GA 1A32A 1BL8A 2LJ2A 3N2GB 3VQXA 4R7RA 1PP9H 2Y0SE 2BSKB 3U55A 1I7NA 5KT4A 1N48A 2UXBH 2M6YA 5LXTB 2PF4E 1GK9A 2GPWA 5EZYF 1DV2A 2YRXA 2HFEC 2PYLA 4QGPA 2VQFO 5KFPA 3DSQA 3GTOA 1GO3F 5ITZA 2ITCC 4X65H 4JI0O 5LMNB 2PVPA 3AG4C 2Y0IA 2ABJA 4JV0A 5BXZA 1I7LA 3OR6C 2BQ3A 1QU7A 3U54A 5F9LA 1ENVA 4DL2A 4ME6A 4LMYA 2XASA 1S5HC 2P22C 1EUDB 3CEBA 5CA1B 5CA0B 4A5UB 3T5JA 4C5BA 5IJ9A 1Y67A 1UJWB 5BWWA 3Q8PB 1KC7A 4DV1H 1Q81W 1I1KA 4DR1O 4F4XA 4EG0A 5B1BB 1GN6A 3G8DA 2RJZA 3NGDA 1V54C 2FLLA 1T5EA 2FPIB 1EZJA 1LUVA 1YHQV 3FFQA 4K0KO 5BYBA 3EPGA 4TQSA 2YZNA 2R9AA 4IWXA 5DGIA 3WG7B 4CH3A 2KG7B 2AGOA 2RNBA 2JEJA 2Y48A 3AG4B 4OX9O 4JI7O 1FPOA 4DW1A 2HP8A 5KFNA 2OYQA 1EN5A 2W6QA 3MFHA 2JS5A 5JJJB 5C1OA 4YAJB 4MSWC 4X1YB 2IU0A 4X65O 2HKOA 4J0MA 3JASB 4X9QA 5DG9A 2FLPA 2R87A 3GB7C 5KG3A
chains in the Genus database with same CATH topology
5D5PA 2CFMA 1XMOH 2CW7A 3HKCB 5FNVA 4DV6B 2PZSA 3VQYA 4TUYA 3H20A 4TUYB 4ETSA 1TVKB 4OX9B 4DR4B 2ZIOA 3PN1A 2O03A 3RYCA 1A0IA 2F1MA 4CC6A 2VPSA 1BJTA 2F93B 1TUBB 4BW9A 4LF4B 1J5EH 4O4JA 2YIBD 3CHXA 4LF8B 4GLXA 1P16A 1QHTA 4K0KB 3JAWB 4B3MH 4I55B 3QG5A 3N43B 4I7HA 5EOYA 2Q7HA 2YI8A 5EIBD 4D7SA 2GV9A 4WBNA 1N34H 4DK0A 5D5QA 4B3TH 2Q2UA 4B08A 1N32H 2HVRA 4RB3C 4U3JA 3RYFA 4EFEA 4JI0H 1JFFA 1MZBA 3RGZA 3OTFA 5IYZA 3N2KB 5DISC 4UCOA 3B2EE 4NXMB 1HNZH 4ZI7A 5KX5A 4LFAB 4ZOLB 1JJOA 1SQGA 2Q7EA 4RAYA 4YHHB 3L2PA 1E4FT 5JJEB 4JI5B 3E22A 1AN7A 4LF5B 2UUBB 4EB6B 3JARB 4I4TB 3T1YB 3THOA 1ZHSA 2CAZC 2F66C 1N36H 4UCRA 3JATB 2PY5A 1IBMH 1HNXB 1X4TA 4KHPB 5CB4A 2HIXA 4X64H 3HKBB 4AILC 3BHPA 3ICXA 3KALA 4DUZH 4CH4A 1M93A 2YIAA 4X1IB 4FLWA 4DR1H 4FLTA 3NBZB 4ZI7B 2UXDH 3C0FB 2Q2TA 5K1PA 4GKKB 4JI6B 3JATA 3QTCA 1M0TA 3N6XA 3JSLA 3F8NA 1Q3EA 1JFFB 2UXCH 3J81W 2ZCEA 1Z5WA 4GYCB 2HHHB 1N34B 3K59A 3MWMA 3N44B 5A2QW 2YIBA 1KMIZ 2QJ1A 5JQGB 4DR2B 4X1KA 5KHHA 1IBKB 4APMA 3K5NA 4PZ7A 3K5LA 3HKDA 5D1OA 4EEQA 1J5EB 3RYHB 4X20A 2UUAH 4FVMA 3T1HH 4JI8H 5C8YB 1XK5A 2CW8A 4DR6B 2HGSA 4O2BB 4DV5B 3N41B 3GDEA 4LF4H 5JJNB 1XHXA 1Q43A 2RGRA 3T1YH 3SGIA 2RGVA 4FM9A 1IBLH 3SR2C 2R70A 4O2AA 5BMVB 3T1HB 4RB0A 2Q0AA 4DV1B 4X62H 4ZIBA 3RTXA 4O4LA 4JI2B 4JI3B 1G6UA 5KMGA 1SA0B 3UT5A 1Z2NX 4DR3H 1M4UA 2KSWA 4DRXA 4DRXB 5BR8B 3J7AK 4PZ6A 3W1GA 3RGBA 5EZYB 3RF2A 2VQFB 4PDBA 1X9NA 4NXNB 4LFCB 4X62B 5C8YA 4BWSC 2BTQB 5JH7A 2VWJA 5IWAH 3RYHA 4LFBB 4UCSA 4JI3H 1FFXA 1P49A 4X1YA 3RWRD 5EIBC 5LA6B 5JVDB 4DV3B 4LF7H 2ZM6H 3QF7A 4DV0B 1TAEA 1HNXH 4HNAA 2MCTA 4B3RH 1SEIA 4HBNA 3JAKB 4MTDA 4CS3A 4PHZA 4UCVA 4JI4B 4DV5H 2VQEH 5IJ0A 3N40P 5IJ9B 3L4KA 2UUCH 4TV9B 1L2ZA 1RSOA 4PI0A 5LYJB 2HHHH 4UCTA 4YJ2B 3SJCC 4MTEA 4LR3A 4CS4A 5K1XA 3ZEDA 4DR3B 2VQEB 4FLYA 4TV8A 5FLXW 4EFBA 4DUZB 3JARA 5LXTA 4F6RB 4X1IA 3JAMW 4LH7A 4KHPH 1B04A 1SQFA 1S68A 4I50B 3TY5A 1SKVA 4IHJB 4BWAA 2HVSA 4I9QA 1XNRB 3RFRA 3BRCA 1DGSA 4CH6A 3VQWA 1FJGH 3LMLA 1QQCA 4DR4H 5IJ0B 3SJBC 1M0WA 1M5IA 1Q8IA 4B3SH 3RYFB 3CSXA 4EB6A 3KXYT 3KAJA 4YY3H 1XNQB 2HVQA 5IT9W 4M7EA 3MAQA 5EYPA 5KHKA 5LMUH 4FLUA 3QWUA 4Q6GA 2VQFH 5LL6b 1IBKH 1O9HA 4JI5H 2UU9B 4ZOLA 4TQFA 1XI1A 3GB8B 1FFXB 5KHGA 3FMAA 4FM0A 2E5LB 3N2KA 2JVDA 1TUBA 3K3VA 3WB0A 3KYHC 1HNWB 1ZHQA 4X64B 1TVKA 2YXLA 4DR1B 3EYYA 2KKWA 1WH2A 2WE6A 4I55A 4O2BA 3UQ8A 4JYAB 3M7MX 4AQYB 3NBYB 1SA0A 4A2BA 1N36B 4LF9H 4ZHQB 5LP6A 3HXLA 4MV7A 4DR7B 2UUBH 1IBMB 4CC5A 4LF8H 4LF5H 2EX3A 1YEWA 3ZS8C 1JMKC 5D1OB 4DR2H 3IAYA 4JV5H 2WDTA 4X1KB 4O2AB 5BMVA 3A2FA 5D1PA 1Z2PX 4AQYH 4LFCH 1S5JA 2HIVA 5EYPB 4O4IB 5FNVB 4RB1A 4YJ3B 1S03G 3TY9A 1CKOA 1HR0B 1V9PA 3RYIA 2JGUA 4DUYB 4JI7B 2ZJTA 4NXMH 4X20B 5JCOA 4AHCA 2ZINA 2UXDB 4FFBB 3JASA 4B3TB 4PI2A 4DK1A 5LMUB 5FPRA 1SYXB 3HKDB 4PZ8A 4UCUA 3U0ZA 1E4GT 1TA8A 3HKBA 4TOIA 4JI1H 1CKNA 1NT2B 3L4JA 4X66H 1FVIA 4JI4H 1P8LA 4CH5A 4FLZA 4FLVA 2P5OA 3WB1A 5CA1A 1KU9A 4DR7H 4CS2A 4L8JA 1FJGB 4JI8B 4IHJA 1CKNB 4YJ2A 3E22B 4FLXA 4I50A 5LYJA 3M4IA 4JYAH 1I94B 4LSAA 4LFBH 3TY8A 5KX5B 3SJAC 5LOVA 2F4VH 2VWKA 5ITZB 4RB2C 4JI0B 5FD6A 3RR5A 1HNWH 4JI7H 1XMOB 5GONB 1Q5OA 1HR0H 4E6NA 3S24A 2UU9H 3RYIB 1ZAUA 4UFZA 1XDNA 5CA0A 4LSXA 4I4TA 3JAKA 4NVPA 4YJ3A 1D5AA 2E5LH 4K8ZA 5LMNH 4DUYH 1CKMA 3ETQA 5LP6C 3U10A 4B3MB 3W5OA 3N42B 3BA8A 4LF6B 5LA6A 3N2GA 3RGXA 3RJ0A 4DV4H 3JAWA 3JSNA 1Z2OX 3IG0A 1I94H 4TV9A 3BPZA 4YY3B 4FFBA 2UUCB 5IYZB 2HEPA 5JH7B 2BTQA 4O4JB 4ZHQA 5LP6B 2UXBB 2VUGA 4EQ5A 4IAJA 4K0KH 3RIZA 4LNUA 5EZYA 2ZNJA 5J2UA 4LF7B 4IIJA 1XMQB 3J80W 4DR6H 4O4IA 3LNNA 4B3RB 2PUSA 3JALA 1HNZB 3NC0B 4DV0H 2ZM6B 3UT5B 4K8XA 4DV3H 3GJXB 1BGWA 4DV6H 4KL1A 2VOBA 5KMGB 4LH6A 3U11A 1WN7A 2XHBA 1L8DA 4FM2A 2W57A 4DR5H 3RYCB 3OTOB 2PTMA 4NXNH 3JALB 3BABA 4O4HB 4FM1A 3CVZA 4IIJB 3HKCA 1H2SB 5J2UB 5FPOA 1GYFA 1TGOA 4LNUB 1XNQH 4X65B 5J2TA 2PYJA 4GKJH 4O4LB 1N33H 4DV7H 1IBLB 1HW7A 4B3SB 3K57A 2Q7GA 2ZIMA 4R7RA 3N2GB 3VQXA 5KHIA 2YI9A 5JQGA 1FKAH 3K58A 4A2AA 2E3CA 2UXBH 2OWOA 1N33B 5LXTB 4GKJB 4OX9H 4DV2B 3DF7A 3BAAA 2PYLA 5GONA 3DSQA 5KHJA 5ITZA 4JI1B 1I6UA 3VQVA 2UUAB 4X65H 5BR8H 5LMNB 2ZNIA 2QM4A 4DV4B 2PGGA 2FE3A 3HKEB 2XIGA 4F6RA 4LMYA 2P22C 2F95B 5CA1B 5CA0B 4JI2H 2R72A 1XHZA 4Q0YA 5IJ9A 4TV8B 1N32B 1VS0A 4DR5B 3OTOH 4GKKH 4DV1H 4DV2H 1WPBA 2UXCB 4D7TA 5FD5A 2RQ6A 4RAZA 5LOVB 1VF7A 3VNNA 4JI6H 2RJZA 1WNSA 1O75A 4JV5B 3HKEA 1T5EA 1O9GA 3K5OA 1XNRH 5JVDA 3FFQA 5CB4B 4DV7B 4RZQA 4MV9A 4LF9B 2R9AA 1XMQH 4TQDA 2IM9A 3KAKA 2BTOA 1I7FA 4U3JB 4CH3A 4LF6H 5IWAB 2YCHA 3CB2A 3BA9A 5JCOC 4LFAH 4X66B 4WBNB 4HNAB 2OYQA 3WB2A 4O4HA 2JS5A 5JJJB 2WYOA 3W1BA 4YHHH 1XQ8A 4X1YB 4J0MA 3JASB 3K5MA 5J2TB 4DRFA 2F4VB 2V4DA 1Z5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H B;  1HNZ B;  2CFM A;  3KYH C;  1HNW B;  3NC0 B;  2ZM6 B;  4DV1 B;  3GJX B;  3RTX A;  4DV6 B;  4X64 B;  4JI2 B;  4JI3 B;  4DR1 B;  4LH6 A;  4OX9 B;  4DR4 B;  3PN1 A;  3UQ8 A;  4JYA B;  1A0I A;  4AQY B;  3NBY B;  3OTO B;  4CC6 A;  1N36 B;  3BAB A;  4LF4 B;  4DR7 B;  5BR8 B;  4LF8 B;  1IBM B;  4CC5 A;  4PZ6 A;  4GLX A;  3W1G A;  1P16 A;  5FPO A;  4K0K B;  5D1O B;  2VQF B;  1X9N A;  4NXN B;  4LFC B;  4X62 B;  5D1P A;  2HIV A;  4X65 B;  4LFB B;  4UCS A;  1IBL B;  4B3S B;  2Q2U A;  3TY9 A;  2HVR A;  1CKO A;  1HR0 B;  1V9P A;  4DUY B;  4DV3 B;  4JI7 B;  4EFE A;  4DV0 B;  1TAE A;  2UXD B;  4B3T B;  5DIS C;  4UCO A;  2OWO A;  4NXM B;  1N33 B;  5LMU B;  5FPR A;  4GKJ B;  4PZ8 A;  4LFA B;  4UCU A;  4UCV A;  4DV2 B;  4JI4 B;  3BAA A;  4YHH B;  1TA8 A;  3L2P A;  4JI5 B;  4TOI A;  4JI1 B;  1CKN A;  4LF5 B;  2UUA B;  2UUB B;  1FVI A;  3T1Y B;  5LMN B;  4DV4 B;  1P8L A;  4UCR A;  4UCT A;  1HNX B;  1FJG B;  4JI8 B;  4KHP B;  2HIX A;  1CKN B;  4DR3 B;  1VS0 A;  1N32 B;  4DR5 B;  2VQE B;  1I94 B;  2UXC B;  3TY8 A;  4EFB A;  4DUZ B;  3NBZ B;  3VNN A;  2Q2T A;  4GKK B;  4JI6 B;  4JV5 B;  4LH7 A;  3JSL A;  4JI0 B;  1B04 A;  3RR5 A;  1S68 A;  1XMO B;  3TY5 A;  3S24 A;  4E6N A;  1ZAU A;  2HHH B;  4UFZ A;  1XDN A;  2HVS A;  4DV7 B;  1XNR B;  1N34 B;  4LF9 B;  1DGS A;  1CKM A;  4B3M B;  3W5O A;  3BA8 A;  4LF6 B;  4DR2 B;  1IBK B;  3JSN A;  5IWA B;  4PZ7 A;  5D1O A;  4EEQ A;  1XNQ B;  2HVQ A;  3BA9 A;  4YY3 B;  1J5E B;  4X66 B;  2UUC B;  3QWU A;  2VUG A;  4EQ5 A;  2UXB B;  1XK5 A;  3W1B A;  2UU9 B;  4DR6 B;  3GB8 B;  4DV5 B;  3GDE A;  4LF7 B;  1XMQ B;  2E5L B;  4DRF A;  2F4V B;  3SGI A;  4B3R B; 
#chains in the Genus database with same CATH topology
 4DW0 A;  3CCE V;  2GQS A;  2CW7 A;  3H4D A;  3ASN C;  3HKC B;  4TUY B;  3E8H A;  4OX9 B;  4BBS G;  2OT5 A;  4E4T A;  1WB8 A;  3MR6 A;  1VF6 A;  1VQP V;  4BXX G;  1HWY A;  4NZO A;  4CC6 A;  5CB4 F;  2EIL B;  1BJT A;  1K3E A;  2V1D A;  4LF8 B;  4MTG A;  4OGQ B;  4GLX A;  5DG8 A;  2FKL A;  3ZHS A;  3GWK C;  3JAW B;  3OE7 G;  1ULZ A;  5FR9 A;  5B1N A;  1HNZ O;  2IJH A;  1ARO P;  2Q7H A;  2JS3 A;  3RV3 A;  2GV9 A;  1N34 H;  1OHH G;  2W7P A;  5D5Q A;  4DLK A;  3KHH A;  4LWS B;  4FGR A;  4O7W A;  3RYF A;  3V6H A;  2R8J A;  3T1C A;  1ET0 A;  4NYE A;  3RGZ A;  1E4E B;  5LYJ F;  3TJT A;  1J95 A;  1E1R G;  3JD2 A;  5DM6 V;  5EK0 A;  1BZK A;  4NXM B;  3TQ1 A;  4ZI7 A;  1CP9 A;  4RAY A;  3QO5 A;  1JX4 A;  2FTK A;  3AG3 B;  4ECS A;  3G6B A;  4RQF A;  3V4Z A;  2R8I A;  2WLJ A;  5H5N A;  4I9W A;  1AN7 A;  2UUB B;  3CXH F;  3JAR B;  1WSC A;  4JTA B;  1OCZ B;  3UZO A;  2H3O A;  4HNU A;  1B06 A;  4RNO A;  1HNX B;  1Y74 B;  2ZE5 A;  3JD1 A;  4GX1 A;  5IYD G;  1AJQ A;  1QLN A;  4R8U A;  5CB4 A;  3BFR A;  2XAG A;  2ZD9 A;  3OHB A;  3BHP A;  5KFX A;  4DR4 O;  5FJ8 G;  4FLT A;  2XAF A;  2UXD H;  2CGO A;  4JI6 B;  2AGQ A;  1NR1 A;  3CRC A;  1XNR O;  4A3K G;  2X6A A;  3L74 H;  4BAY A;  1JFF B;  2Q9L A;  2QDO A;  2UXC H;  3K79 A;  4ECV A;  2ZCE A;  2DPI A;  5KFR A;  3ML0 A;  3JRX A;  3FB5 C;  1R6T A;  1K73 W;  1N34 B;  4CMD A;  2E2I A;  1GSO A;  3CCS V;  2YDE A;  1QVG U;  3G8C A;  5JQG F;  1IXB A;  3K3P A;  5JQG B;  5KG5 A;  4X1K A;  1IBK B;  3ORR A;  4O4L F;  1KBL A;  4PZ7 A;  4PDL A;  3M9N B;  3SNO A;  2ZQM A;  3IFX A;  4JYY A;  1XEQ A;  4LF6 O;  4X20 A;  4O7V A;  4I0X B;  3T1H H;  4QIW A;  2RF4 A;  1W96 A;  1XK5 A;  4MS2 A;  3TQT A;  1OCC C;  3DXR A;  4LF4 H;  4XX0 B;  1WR2 A;  4WFE A;  1M7J A;  2V4R A;  3SGI A;  3ZMV A;  1IBL H;  4XBF A;  4O2A A;  2ILM A;  3T1H B;  1KT8 A;  4YIP A;  2B1G A;  4UV8 A;  2Q0A A;  4ZIB A;  3RTX A;  2HR3 A;  1LNQ A;  4PDR A;  2ODT X;  5KMG A;  1B6R A;  4LCU C;  5H2F Z;  2OH2 A;  3UT5 A;  4TV9 F;  4JI2 O;  3F7Y C;  1JOY A;  4H13 B;  4DR3 H;  2A1H A;  2JA6 G;  4DRX A;  2ZE6 A;  4DRX B;  3TII A;  1XIL A;  3ZMZ A;  3CP1 A;  1GM9 A;  4PDB A;  2P4V A;  1X9N A;  4ED3 A;  1YXB A;  1XUQ A;  2NUA B;  1X59 A;  2VWJ A;  1SS3 A;  5IWA H;  3PW5 A;  3OUU A;  4JI3 H;  4X1Y A;  3AK1 A;  3Q4H A;  4PV1 B;  5KAF Z;  1DF4 A;  4DV0 B;  1TAE A;  5IDJ A;  1HNX H;  4B3S O;  4I7Z B;  2P6J A;  3JD0 A;  4UB8 Z;  5KFD A;  1HR0 O;  1S0O A;  4HBN A;  3JAK B;  3QFF A;  3Q8R B;  4MTD A;  1M1K W;  4PHZ A;  4JI4 B;  2VQE H;  4ED6 A;  2FMA A;  4YBZ B;  1MA1 A;  2C35 B;  3L4K A;  3AG1 B;  3JZI A;  3UKM A;  4UUJ C;  2YW2 A;  3ZHT A;  3O9O A;  5HBR B;  4TM5 A;  1RSO A;  1YTF B;  5J9P C;  3FKI A;  5CAE B;  4TUY F;  2DYS C;  5LYJ B;  2Z04 A;  2HHH H;  2QTO A;  4YJ2 B;  2DAA A;  4WFG A;  2GHY A;  3SJC C;  4CS4 A;  4HYK A;  4DUZ O;  3MHS C;  3PW7 A;  3VPD A;  2W6J G;  2DQ0 A;  4TV8 A;  1VAR A;  1H2K A;  3ZHR A;  4N23 A;  3JAM W;  4R7C A;  4G2K A;  4X62 O;  3AK2 A;  2YZM A;  5LGN A;  4DR7 O;  3TY5 A;  1K1S A;  1SKV A;  4JAS A;  4KXR A;  4BWA A;  5KFY A;  1T36 A;  2HJF C;  1Y6X A;  1XNR B;  1KJI A;  4R8U B;  2WB1 E;  3BRC A;  3TW7 A;  2R93 A;  3E8F A;  4DR5 O;  3LML A;  5CA3 A;  4IR9 A;  2WLN A;  3L9D A;  3SPI A;  4EEY A;  4MVS A;  4BBR G;  3CSX A;  3LQS A;  4EB6 A;  3EPI A;  4J9M A;  3R9R A;  1R3K C;  3DC5 A;  5IT9 W;  5EYP A;  5KHK A;  4O4J F;  4FLU A;  3JZ6 A;  4GC6 A;  3OMA B;  3G4S V;  5KG4 A;  1FFX B;  3QQM A;  4FM0 A;  3N2K A;  2YS8 A;  3Q8S B;  1E4E A;  2JVD A;  1WCM G;  5IY5 C;  1WA8 B;  3FAV A;  2LGW A;  3GTP A;  3KYH C;  4HQ6 A;  2R84 A;  1NS1 A;  1KJ8 A;  2W6O A;  1H2N A;  1ZHQ A;  4WFF A;  5LA6 F;  3L72 H;  1RJR A;  1JXL A;  2UU9 O;  5AG2 A;  1EZV H;  5L1L A;  2CNU A;  3PW0 A;  3HOU G;  2W8L A;  2H8P C;  1KP3 A;  4DIM A;  2WE6 A;  3UQ8 A;  4JYA B;  4XYL B;  5CMU A;  2QWO B;  4JZ2 A;  2E2H A;  4A2B A;  2BQR A;  5LP6 A;  4MV7 A;  1F4M A;  2HLD G;  5L3D A;  3ABL C;  3TGU H;  1ZQ7 A;  3ABU A;  4ICG A;  5L3B A;  2HHH O;  4C2M A;  2JEI A;  3CC7 V;  3CCM V;  3RBE A;  4MA5 A;  4ECQ A;  1Y14 B;  3KHL A;  2R92 A;  1M9N A;  4O4I B;  4JGS A;  3KHG A;  4YB8 B;  2JGD A;  3VMM A;  4I4T F;  5IWA O;  3TY9 A;  4RZR A;  4PA4 A;  5H9C A;  3QNE A;  1V51 A;  1AI6 A;  3OSN A;  3FB8 C;  2DZD A;  5DMX A;  2ZIN A;  4FFB B;  4B3T B;  3OD4 A;  1QR9 A;  4O84 A;  4A3G G;  4DK1 A;  4UCU A;  2W0X A;  3HB3 B;  3U0Z A;  2W70 A;  4QPJ A;  2R8K A;  2JEG A;  5KG7 A;  3IC7 A;  2K1E A;  3O65 A;  2EJR A;  1SES A;  5BZB A;  5CBH A;  1Q7Y W;  4HNV A;  4GT1 A;  1NVP B;  1FVI A;  1P84 F;  2CTP A;  1NTZ H;  5CBG A;  5C4X G;  4JI6 O;  3TXS A;  4FFR A;  3G6Y A;  1P8L A;  4CH5 A;  4FLZ A;  4FLV A;  2GBO A;  4DR7 H;  4F6E A;  3ZIA G;  1K7D A;  3E8B A;  1CKN B;  1FXK A;  4FLX A;  4PA6 A;  4I50 A;  3GIK A;  1PL0 A;  1RSO B;  3W7X A;  4KHP O;  4DQN A;  4NXN O;  3SJA C;  4UVC A;  2PI5 A;  3HKZ E;  4IZO A;  4JI0 B;  5FD6 A;  1GN4 A;  4PA3 A;  5L3C A;  4JAU A;  1HR0 H;  1VMG A;  2CTR A;  3RYI B;  1ZAU A;  5CA0 A;  4LSX A;  4I4T A;  4LWS A;  4JI5 O;  4NVP A;  1NVP D;  2W9B A;  2E5L H;  3P3N A;  1UC9 A;  2BE3 A;  2EIL C;  2X6C A;  4QJF B;  5LHH A;  4DUY H;  5LP6 C;  2JK5 C;  4O7N A;  4LF6 B;  1JDB B;  1RK6 A;  4DV4 H;  3JAW A;  1SZT A;  3JSN A;  1Z2O X;  3RAX A;  4LFA O;  3T5L A;  2Q67 A;  3ZMU A;  2HEP A;  1EZ1 A;  1N0J A;  4IAJ A;  5KFG A;  3PO2 G;  3J80 N;  2HVJ C;  2P4K A;  3MR3 A;  4O3Q A;  2YEV B;  2ZNJ A;  4FS1 A;  4IIJ A;  2R7L A;  4DR6 H;  2BSK A;  3LNN A;  2PUS A;  5I5T A;  2M7W A;  1CE8 A;  1HNZ B;  2C00 A;  4DV0 H;  1BHA A;  1AP6 A;  4DV6 H;  4KL1 A;  3AEI A;  5KMG B;  3KZI Z;  4LH6 A;  5B1A B;  3U11 A;  3C3S A;  2V5A A;  2R7Z A;  2V4Q A;  5HFM A;  1VF6 C;  1H2G A;  2AGA A;  2IU3 A;  1BMF G;  2VPQ A;  5FPO A;  2ZXW B;  4PDM A;  3OM3 B;  4P30 A;  3KCY A;  3MFI A;  1SZX A;  5J2T A;  2R82 A;  5H80 A;  4B3S B;  1MZE A;  4MVO A;  5B1B C;  5KHI A;  1IUR A;  2PMZ A;  1BQ0 A;  3TW6 A;  4ZBM A;  5JQG A;  1FKA H;  4RAI A;  4NZM A;  1RJP A;  1N36 O;  5KFE A;  4RUE A;  2OWO A;  2W9C A;  1FYJ A;  4O7Y A;  4OX9 H;  1N4C A;  5EC2 C;  3GII A;  2B63 A;  3N6R A;  5GON A;  4G27 B;  5KHJ A;  4QW9 A;  4A3J G;  2LW7 A;  3J81 N;  1VAJ A;  4IL6 Z;  5L3F A;  4QSH A;  4BIU A;  4PEL A;  2QM4 A;  2EIJ B;  3D36 C;  3HKE B;  2XIG A;  3V4S A;  4IRD A;  2I80 A;  5I60 A;  4F6R A;  2UXC O;  1I1M A;  3GVM A;  3U9S A;  2R72 A;  2OIG A;  2XND G;  1N32 B;  4DR5 B;  1WCM A;  1WPB A;  2UXC B;  2VUM G;  3T9A A;  4I50 F;  4K3A A;  2QE7 G;  3T4Z A;  4Q4C A;  3VNN A;  4JI6 H;  4E4E A;  3OMI B;  3HKE A;  3MD0 A;  3ABK C;  2DN9 A;  2Y0P A;  4MAM A;  5JVD A;  2YWV A;  2HJW A;  5CB4 B;  1B6Q A;  4MV9 A;  3GV5 B;  2A06 H;  3R23 A;  4RNM A;  1XMQ H;  3H40 A;  4QWE A;  2IM9 A;  2HVK C;  3K06 A;  3KAK A;  4R8C A;  4U3J B;  3BY6 A;  4XDL A;  2JA6 A;  4ECW A;  3CB2 A;  1G2W A;  1ZLZ A;  3BA9 A;  3OUZ A;  5I5V A;  3PW4 A;  3ZJZ A;  4LFA H;  5IYD O;  4HNA B;  3WB2 A;  1Y76 B;  4O4H A;  4XDJ A;  5KFZ A;  2WYO A;  3FKS G;  2JEX A;  1JA8 A;  4FFP A;  1XQ8 A;  2MK3 A;  3B4S A;  1PX2 A;  4ED7 A;  3K5M A;  4CZZ A;  2YID A;  3RN4 A;  3RBZ A;  3ETG A;  1I5X A;  1M56 B;  1IVS A;  1Z5V A;  1XMO H;  4QE9 A;  5HFL A;  1OBG A;  5FNV A;  5DN6 G;  4DV6 B;  3SYO A;  1YJN V;  4TUY A;  3OTO O;  5IYC G;  3AG3 C;  3LSU A;  5IP7 G;  1F4N A;  3DAA A;  4A3L G;  2ZXW C;  1S97 A;  2ZIO A;  1A0I A;  5E25 A;  3E89 A;  4UVB A;  1UFI A;  2GPS A;  2F1M A;  1KYO F;  3TET A;  1B33 N;  3OMN B;  1P7G A;  2Q0O C;  3K0D A;  1PD3 A;  1I50 A;  1J5E H;  4Q8E A;  1IOV A;  4TT3 G;  2VA2 A;  5LHG A;  4MA0 A;  4I55 B;  3ASO B;  4J9O A;  3S3W A;  5KFK A;  2Q2U A;  1BE3 H;  3LDD A;  4B08 A;  2HVR A;  2KG7 A;  3AG2 B;  1D5N A;  4JI0 H;  3CS5 A;  3CYO A;  2ADP A;  4UCO A;  5DGB A;  4A3E G;  4RNN A;  4LFA B;  1SQG A;  2Q7E A;  3ZN0 A;  5KFL A;  2G38 A;  3L2P A;  2FP4 B;  4YQW A;  4TWK A;  4JI5 B;  4H0L B;  3T5K A;  4GUN A;  2IJJ A;  4YJ3 F;  3T1Y B;  1RYS A;  1ZHS A;  2F66 C;  3LP8 A;  4CMF A;  1N36 H;  1EFR G;  3KHR A;  4UCR A;  4DL7 A;  3JAT B;  2PY5 A;  1IBM H;  2RN9 A;  3CCU V;  3ABT A;  2Y69 B;  3LSQ A;  3S3X A;  4DYL A;  2HIX A;  2EZP A;  4O3P A;  2EJ0 A;  4U6P A;  1R3J C;  3H1J H;  3KAL A;  4CH4 A;  2J6U A;  3T54 A;  2CE4 A;  1CS0 A;  5LGT A;  4X1I B;  3GV8 B;  4DR1 H;  5F9N A;  4GC7 A;  3N27 A;  3C0F B;  2XCP A;  4MV8 A;  4CE5 A;  1Q3E A;  3F8N A;  4RQE A;  5JVL A;  3OAA G;  1IOW A;  5CN0 A;  2JIZ G;  2W71 A;  2IW5 A;  4WF9 V;  4GCZ A;  3CEI A;  3K59 A;  4KFM A;  2BR0 A;  3H1L H;  1SQB H;  3IC9 A;  4K35 A;  4F4L A;  3PR4 A;  3GTQ A;  1MAB G;  4J9R A;  1JX9 A;  3ABL B;  2F23 A;  3H1H H;  3K5N A;  2VRZ A;  4NR1 A;  3RVZ A;  2ZDQ A;  3TIG A;  4Y8V B;  2LP7 A;  1NH2 B;  2YC0 A;  4B3M O;  1Q6H A;  1M56 C;  4BIZ A;  3MHH C;  2PMZ E;  3G6E V;  4DV5 B;  2JA5 A;  3I56 V;  3GDE A;  1N56 A;  2XD4 A;  3T1Y H;  3SR2 C;  4H44 B;  2UUB O;  4RB0 A;  1M90 W;  4Q8F A;  4JXU A;  4DV1 B;  4X62 H;  4ED2 A;  2EUL A;  4BY7 G;  4Z1V A;  3KKY A;  4O4L A;  3V6K A;  5L9X A;  1H38 A;  3JYC A;  2RDJ A;  2KB1 A;  4BIO A;  3WWJ A;  1JLL B;  1ORQ C;  1M4U A;  2QGN A;  2KSW A;  2AXT Z;  1XMO O;  1L0N H;  4Q4D A;  4X88 A;  3J7A K;  4K6N A;  4PZ6 A;  3CRA A;  3W1G A;  5EZY B;  2F43 G;  4ZOL F;  4QWB A;  1DF5 A;  2R86 A;  1NJI W;  4FBU A;  4BWS C;  1XL6 A;  2BTQ B;  5JH7 A;  5LHI A;  4LFB B;  3MDS A;  3FB6 C;  2HG5 C;  3HOZ G;  3RWR D;  2FK2 A;  4NXM O;  2RDI A;  5KFH A;  4HNA A;  2C2A A;  1CQI B;  4FPP A;  4J42 A;  1F23 A;  4B3R H;  4FU0 A;  2DYR B;  1MSD A;  4ASU G;  4GX0 A;  4A3M G;  1H2L A;  1BHB A;  3FD9 A;  1VEW A;  1CPY A;  2IJI A;  2FB9 A;  2Y4U A;  2ITD C;  2FPG B;  3PJS K;  3BAC A;  4FFN A;  2IMW P;  2LW1 A;  3D8C A;  2C2D A;  1K5S A;  4UCT A;  2GUZ A;  3BG5 A;  1GLV A;  5BWX A;  4GX5 A;  2QWR B;  4LR3 A;  5DED A;  1RYR A;  3ZED A;  5KFQ A;  5E1A C;  4IGG A;  2VQE B;  1KTA A;  3X2Q C;  3T9E A;  2N05 A;  4DUY O;  4FFK A;  4DUZ B;  3JAR A;  3CC4 V;  2W6N A;  3ZN1 A;  4F6R B;  4X1I A;  5JVD F;  5DQH A;  4KHP H;  1H8E G;  3VBB A;  5KT2 A;  1B04 A;  1WB7 A;  5JH7 F;  4WBN F;  2E76 B;  3RW0 A;  2EJ7 A;  3CE2 A;  4IHJ B;  3VOU A;  3SYP A;  3I55 V;  1KJQ A;  3RT3 C;  3HOW G;  4NTY A;  1WRV A;  2QB5 A;  1EM1 A;  4HR7 A;  4EYH B;  2RCV A;  5CA1 F;  2UVV A;  4LF7 O;  3ETJ A;  4DR4 H;  4NZN A;  2NNU A;  4IYH A;  1Q8I A;  1QBZ A;  3A8T A;  5KX5 F;  1VQ5 V;  4BR6 A;  1XNQ B;  3CRQ A;  4M7E A;  2D2C B;  2QKA A;  4FJC C;  3MAQ A;  3ORQ A;  5C5J A;  3G6X A;  4TQR A;  1E1Q G;  4RU9 A;  5LL6 b;  4AYB A;  2W8K A;  2J9G A;  4CKE A;  1S0N A;  4A3I G;  2UU9 B;  3Q4H B;  1KUQ A;  4LC1 A;  2UVR A;  1YIT V;  5KHG A;  3M8A A;  4CKB A;  1VQN V;  1TUB A;  5IT9 N;  2VQD A;  4YAK B;  1FAF A;  1AR1 B;  1TVK A;  4A93 G;  4DR1 B;  2BQU A;  1XNQ O;  3NR7 A;  3E86 A;  1WH2 A;  2KQX A;  2JA7 A;  2YEV A;  3M99 B;  2B63 G;  3K9A A;  4ZI7 F;  4IHJ F;  1SA0 A;  1N36 B;  4LF9 H;  3WO0 A;  4ED1 A;  3LUT B;  2ETN A;  2NN4 A;  1IBM B;  4ABM A;  4GX2 A;  4JV5 H;  4OPA A;  1VKZ A;  4AQY H;  2R9R B;  3A2F A;  5D1P A;  3R5X A;  4TSF G;  1Q86 W;  1ZUQ A;  4DV5 O;  5C1P A;  2FK1 A;  2DAB A;  4PJ0 Z;  2C22 A;  4RB1 A;  1S03 G;  2HGW A;  2CH7 B;  1BT8 A;  1CKO A;  2LFS A;  2YZL A;  3E35 A;  4JF3 A;  4M0J A;  4Q44 A;  4JI7 B;  3RYI A;  2JGU A;  2IH1 C;  1VQ9 V;  1V54 B;  2R93 G;  3JRW A;  2AW9 A;  3GIM A;  2VUM A;  5DAA A;  4I0X A;  1FXK C;  4JPR A;  5JCO A;  3CSW A;  3ZMS A;  2UXD B;  4MW8 A;  5FPR A;  4C5A A;  5A9G A;  2Q68 A;  1A9X A;  5KT3 A;  1DTO A;  2NU9 B;  4O3N A;  1Y76 A;  2ZDG A;  4DL4 A;  4FK5 C;  2QYZ A;  1AIL A;  4JYC A;  4JI1 H;  2Q6A A;  2Z02 A;  1EHI A;  4X66 H;  2P0A A;  3ZBH A;  1XRE A;  2NLJ C;  3APO A;  2FK3 A;  3VA7 A;  4EBC A;  5KFO A;  2UXX A;  3B8M A;  4Q43 A;  2JA5 G;  1FJG B;  2WTF A;  4IHJ A;  5K2M A;  1VQO V;  5GTH Z;  3GTJ A;  3M4I A;  3WFV A;  1MSW D;  5EDW A;  4QIW F;  3I4M G;  4LFB H;  3G71 V;  1SFO A;  5ITZ B;  2JEF A;  5L3G A;  5FL7 G;  3GIL A;  3RR5 A;  1HNW H;  1XMO B;  1Q5O A;  4CHI A;  2ASJ A;  1FD9 A;  1KUT A;  3SJQ C;  3GTG A;  1XMQ O;  2J6S A;  1I2K A;  2ZDI A;  4K8Z A;  1CKM A;  2ZGI A;  1FJG O;  3CCJ V;  3W5O A;  2UUC O;  5B66 Z;  3MR2 A;  4PDV A;  2DMX A;  4JUZ A;  3RJ0 A;  4RO2 A;  4J7J A;  4TV9 A;  2ATK C;  1AUV A;  3BPZ A;  4YY3 B;  4FFB A;  5EBW C;  2EIY A;  3EVK A;  2UUC B;  4O4J B;  2BTQ A;  5JH7 B;  4EQ5 A;  3AX6 A;  2FLN A;  4H37 A;  2DQ3 A;  2P06 A;  2CTQ A;  2AQ4 A;  5J2U A;  2XTA A;  1XMQ B;  3J80 W;  2EIN C;  1TWA A;  4J41 A;  4F4Z A;  2EIK B;  3SYA A;  3JAL A;  1VIB A;  1V55 B;  2GSM B;  2ZM6 B;  5CBF A;  4K8X A;  4DV3 H;  1DV1 A;  3ABK B;  4JTD B;  1SRY A;  4EBE A;  4FZ0 A;  2R8H A;  3GID A;  2GTS A;  1WN7 A;  3CWB H;  3H0G A;  1SF9 A;  2W57 A;  5C44 G;  4DR5 H;  5LXT F;  3UM7 A;  1SC5 B;  5KT7 A;  5KFV A;  1QNM A;  1R1B A;  3H01 A;  3K04 A;  3E8G A;  4X8A A;  5KFI A;  3HKC A;  4P9O A;  1OCO C;  5KLV H;  4O83 A;  5I5W A;  4LNU B;  2XOK G;  3E83 A;  2XAQ A;  1WA8 A;  1SQV H;  3FAV B;  3BQ1 A;  4O86 A;  5EWG A;  1XNQ H;  1RPO A;  2QM8 A;  3MWD A;  3ZHU A;  4JYA O;  1IBL B;  3CCR V;  2ZIM A;  3VPB A;  2Y0S A;  1YSC A;  2YI9 A;  3BJY A;  4JI4 O;  3K58 A;  4HZ3 A;  4J9L A;  1OJH A;  3SYC A;  5IYC O;  3F7V C;  3U0G A;  4LFC O;  4J9Y B;  3DF7 A;  4ECX A;  4WFA V;  3A0R A;  2JRI A;  5KA5 A;  2FML A;  1I6U A;  2UUA B;  5BR8 H;  2IH3 C;  4M9U A;  5I5X A;  4FBT A;  3C90 A;  2ZNI A;  4LF5 O;  3ZRS A;  1R3L C;  1XDC A;  1VQM V;  4QJF A;  5CM0 A;  4BW5 A;  4AQY O;  4JI2 H;  4JV1 A;  3CJH A;  1XHZ A;  4U7O A;  4TV8 B;  1VS0 A;  2ZDI C;  2DYS B;  4ZKI A;  2EIM B;  3CJH B;  2IA6 A;  1VBG A;  4RAZ A;  5LOV B;  4WFH A;  3AG2 C;  4DV4 O;  1ROP A;  1WNS A;  3GIQ A;  2XCL A;  2DWE C;  4LF8 O;  3WG7 C;  1XNR H;  5E79 Z;  1B6S A;  2E5L O;  2YS6 A;  4RZQ A;  2R7Z G;  2WLI B;  3RB0 A;  2Q73 A;  5EBL C;  4O7T A;  1I2L A;  1I7F A;  4MVZ A;  4LF6 H;  1KEE A;  3OSP A;  3PW2 A;  2YCH A;  3GTL A;  2XCA A;  3JCU Z;  4JAA A;  5JQW A;  4XDK A;  5JCO C;  4X66 B;  2CZG A;  4DAA A;  1K33 A;  1Y4M A;  2B9Z A;  3W1B A;  4CKC A;  3ETD A;  3HR0 A;  4ECY A;  5JUM A;  4J9S A;  1VQ8 V;  2V4D A;  1Y1W A;  1NKD A;  3DGE A;  1Q82 W;  2CFM A;  4FZ1 A;  2XGP A;  2GTA A;  4MV6 A;  2PZS A;  3HT5 A;  3VQY A;  3V6J A;  1VQK V;  3T9D A;  4ETS A;  1TVK B;  3SI8 A;  3CRM A;  4PWQ A;  1OCO B;  3DXR B;  5IY5 B;  3M9O B;  2O03 A;  1CEZ A;  4J7Z A;  1I08 A;  1QLE B;  1R9T A;  2VPS A;  4NKG B;  1TUB B;  5L1J A;  2XUM A;  1BNC A;  3UYY A;  1M57 C;  2YIB D;  2ADQ B;  3OUS A;  2D3O W;  4WCE V;  1P16 A;  1W93 A;  2ZR3 A;  1QHT A;  4K0K B;  5IE9 A;  2L35 A;  4O7Z A;  3RUP A;  1JQ0 A;  2Y69 C;  3QG5 A;  5EOY A;  1K83 A;  3BCC H;  2YI8 A;  5BWU A;  3OGI B;  4IRC A;  4WBN A;  1YF2 A;  5BMV F;  3AK3 A;  4B3T H;  1U96 A;  1PNK A;  1N32 H;  2AZ2 A;  1NTK H;  4U3J A;  1N33 O;  3ETE A;  3UZB A;  4EFE A;  4GLW A;  3FYI B;  1JFF A;  2NVY A;  3OTF A;  4ZHQ F;  1OZ0 A;  3N2K B;  5DIS C;  4UVA A;  3B2E E;  4DV3 O;  5KX5 A;  1AI7 A;  3OEE G;  5L1I A;  1K1Q A;  4YHH B;  1E4F T;  5JJE B;  1PL4 A;  3E22 A;  5B1O A;  1A0G A;  3T9B A;  4BY1 G;  3UCS C;  3HOY G;  4EB6 B;  1W0J G;  3THO A;  1K9M W;  4J10 A;  2WA3 A;  5TIS Z;  5LMU O;  2GLT A;  3VPC A;  3D3Q A;  1D2D A;  2OTJ V;  1KJ9 A;  4KHP B;  2VA3 A;  2CNQ A;  1WAZ A;  3HKB B;  4GKJ O;  4AIL C;  4ECT A;  4DUZ H;  3W7S A;  1M93 A;  1OBD A;  3JAM N;  2COI A;  2IJK A;  4FLW A;  3RFC A;  2COG A;  3NBZ B;  4UXN A;  4ZI7 B;  2K9P A;  2LGQ A;  2Q2T A;  5IYB G;  1M0T A;  2X0L A;  3JSL A;  2YRW A;  4MTF A;  5B5E Z;  1Z5W A;  2Q4P A;  2UVU A;  2Y4T A;  4MV1 A;  3KRE A;  2L6L A;  1N8R W;  4Z2W A;  3N44 B;  2YIB A;  2QJ1 A;  2E74 B;  4DR2 B;  4NB5 A;  5KHH A;  3QVN A;  1JR9 A;  3L70 H;  5LGU A;  2ZM6 O;  1HNX O;  4FVM A;  3K08 A;  4JI8 H;  4QIW E;  3KTM A;  3JZF A;  5IP9 G;  4DR6 B;  1YVW A;  2CH7 A;  2COJ A;  1WLE A;  3N41 B;  2YYA A;  3ZHQ A;  5JJN B;  1XHX A;  2DJV A;  1Q43 A;  1JDE A;  4LF9 O;  2RGV A;  4FM9 A;  2Z0A A;  2WAM A;  2HHF A;  2NU6 B;  2CQY A;  4B7E A;  2JDI G;  4O3O A;  3NUA A;  5I5S A;  5F2V O;  4U7N A;  3E5N A;  1KKD A;  5H6R A;  5I5Y A;  1EKF A;  2ZT9 B;  2AGP A;  3HKZ A;  1SA0 B;  1Z2N X;  4X89 A;  5BYA A;  1IX9 A;  1AJP A;  2FKX A;  5GON F;  2SCU B;  5B1A C;  3RGB A;  1YJW V;  1URF A;  2ATL A;  2VQF B;  1IYE A;  5KG6 A;  4NXN B;  3B40 A;  3I12 A;  4LFC B;  4X62 B;  5C8Y A;  2FB5 A;  1ZWI C;  2XAH A;  1DAA A;  3RYH A;  4A3C G;  4P9P A;  1AR5 A;  4UCS A;  3MJF A;  4AYB E;  2W6Z A;  4ZQI A;  3BQ0 A;  5LA6 B;  4LF7 H;  1G8M A;  1RM1 B;  3D3I A;  2YXY A;  1HP8 A;  2MCT A;  3OFN G;  2R92 G;  4DR2 O;  1SEI A;  3K03 A;  3CPW U;  4CS3 A;  3CRR A;  5I5U A;  4DV5 H;  2R7M A;  3K9S A;  2ZE7 A;  2QR4 A;  3N40 P;  5IJ9 B;  1E79 G;  1F7Y A;  4O7L A;  1R3I C;  1AP5 A;  4OXS A;  5C93 A;  4ECZ A;  2EJ3 A;  4PI0 A;  1A48 A;  4W4K A;  1KQS U;  4DO2 A;  1S77 D;  4FFM A;  1RP3 B;  4DR3 B;  3RB4 A;  3GTK A;  2VR1 A;  2DE0 X;  2LFR A;  4J80 A;  2UVW A;  5FLX W;  3FYE B;  2JJ1 G;  5LXT A;  4LP8 A;  3CCL V;  4EKW A;  3P3P A;  5KKN B;  1SQF A;  1Y1V G;  4I50 B;  5LBQ A;  3G80 A;  3CD6 V;  3UO2 A;  4W4L A;  3K3W A;  4JV5 O;  1MG1 A;  1S3J A;  1EBO A;  4I9Q A;  5KFJ A;  2LQT A;  3RFR A;  3VQW A;  2A0L A;  2JA8 G;  1QQC A;  3H0G G;  3IJ4 A;  1KB9 F;  5IJ0 B;  2WAQ E;  4RWU A;  2DPJ A;  4B3S H;  4HYO A;  3ZRX A;  1N32 O;  4IR1 A;  1PNM A;  1THZ A;  1BS3 A;  1COW G;  3OUF A;  5IYB O;  1PK8 A;  4YY3 H;  2Q5Z A;  1U97 A;  1BCC H;  1AB3 A;  3QWU A;  4Q6G A;  1IBK H;  1O9H A;  3A0B Z;  4JI5 H;  2UXN A;  1UNN C;  3GB8 B;  4TQF A;  1AUX A;  3T1Y O;  3FMA A;  3GTM A;  2W9A A;  2WLL A;  2JEU A;  1XOU A;  4DR6 O;  1OCR C;  1GTO A;  1GH6 A;  1HNW B;  3CQZ A;  1PNL A;  3LDE A;  3H9V A;  5KFC A;  4U7C A;  1MOF A;  2YXL A;  2WPD G;  2R7N A;  3EYY A;  1BSM A;  4DV2 O;  2KKW A;  1EKV A;  3WNZ A;  4DL3 A;  1Y1W G;  5KFF A;  1EYZ A;  3NBY B;  3STL C;  1DIK A;  4YP3 A;  1I3Q A;  3BEH A;  5KUK A;  1OCZ C;  1JVM A;  2Z5U A;  2UUB H;  2YUA A;  4CC5 A;  2JA7 G;  4IIJ F;  3ZS8 C;  1JMK C;  5LOV F;  2QWP B;  2WDT A;  4X1K B;  5BMV A;  1Z2P X;  2R6F A;  4LFC H;  1S5J A;  5EYP B;  1S0V A;  3L75 H;  4YJ3 B;  1V9P A;  4DUY B;  5GTI Z;  4PA7 A;  2BOC C;  2ZJT A;  3BVO A;  1VBH A;  4KP4 A;  4H33 A;  4CBC A;  4NXM H;  1ZET A;  3JAS A;  4PI2 A;  1IBK O;  5LMU B;  1SYX B;  3HKD B;  2N04 A;  3P32 A;  1SQP H;  1GKF A;  3LSS A;  4O7S A;  1TA8 A;  3PVX A;  4DV7 O;  3HKB A;  3FX7 A;  4FE2 A;  4RUC A;  3T4D A;  1BQZ A;  3L4J A;  2YS7 A;  3FDS A;  1RFY A;  4JI4 H;  5FLX N;  3G6V A;  2VS0 A;  2Q7D A;  5C3E G;  3CME V;  1K8A W;  4L87 A;  2CTW A;  3CXC U;  2WWW A;  3WB1 A;  1KU9 A;  5KFA A;  2CGN A;  4L8J A;  2NU8 B;  4NYK A;  4JI8 B;  2YSU B;  1JIH A;  4YJ2 A;  3SDL A;  2X0S A;  3E22 B;  4UUG A;  5LYJ A;  1NI8 A;  4UB6 Z;  2PN1 A;  1JCH A;  3TY8 A;  2XC9 A;  5A2Q N;  5KX5 B;  3W7U A;  1NTM H;  5LOV A;  1V55 C;  2VWK A;  3HBL A;  2IBK A;  3HPL C;  4G28 B;  4JI7 H;  5GON B;  3S24 A;  2RDC A;  1SCU B;  2CUG A;  1IYD A;  1DLB A;  1XDN A;  3JAK A;  2W7O A;  5B3S B;  2W9C B;  1EN6 A;  2FJZ A;  3OT7 A;  2DOS A;  1KC8 W;  4B3M B;  3N42 B;  3AG1 C;  5LA6 A;  5KFT A;  3T9C A;  3IG0 A;  4O7R A;  1I94 H;  1ZL8 A;  3EHB B;  4A3B G;  3R5H A;  5LP6 F;  5IYZ B;  4ZHQ A;  2XT9 A;  3MWE A;  3RIZ A;  2W0F C;  3T9F A;  3ASN B;  2XGQ A;  4DV1 O;  4AI8 A;  4PBC A;  2EIM C;  4D6T H;  1YI2 V;  3DC6 A;  5DLF A;  1H8H G;  1MZF A;  3B77 A;  3UT5 B;  5KFB A;  4MVM A;  1KJJ A;  5L3E A;  3MR5 A;  3G67 A;  1GMG A;  3PFF A;  1QR8 A;  3LWB A;  3H3V H;  2HDK A;  1L8D A;  4O81 A;  3RYC B;  3QZ8 A;  4O4H F;  4NXN H;  1K97 A;  3BAB A;  1KKC A;  3T5H A;  4J7K A;  4FM1 A;  5EWF A;  1RPR A;  5J2U F;  4IIJ B;  1GYF A;  2DLN A;  2C28 A;  1AI5 A;  3WWI A;  1NR7 A;  3UFX B;  5KFU A;  4HNT A;  4J9Z B;  4Q20 A;  4X65 B;  2PYJ A;  3X2Q B;  4DV7 H;  1XBL A;  5DLG A;  1VQ7 V;  5CR5 A;  1WP7 A;  1JJ2 U;  2X6B A;  1OCC B;  3ZCC A;  3DTG A;  2QKC A;  1FFT B;  4A2A A;  2E3C A;  2CNV A;  1N33 B;  1YDX A;  4GKJ B;  4DV2 B;  3BAA A;  1I5Y A;  4FFO A;  2KSD A;  3JD4 A;  5DGH A;  2BOB C;  5LMN O;  5DQG A;  5DG7 A;  4JI1 B;  3RAQ A;  3VQV A;  1GN2 A;  4LFB O;  2QTS A;  2DW4 A;  4DV4 B;  1VQ4 V;  2GQR A;  2PGG A;  2FE3 A;  2AU0 A;  1WP8 A;  4NLG A;  5GW7 A;  4ED0 A;  2V9W A;  4YIO A;  4F4Y A;  2F95 B;  4IWY A;  4YR0 A;  4C5C A;  3L73 H;  1GO3 E;  2GDS A;  4Q0Y A;  4GKK H;  3OTO H;  2W6P A;  3BQ2 A;  4XYM B;  5KT6 A;  4DV2 H;  1QCE A;  3TIN A;  4D7T A;  5FD5 A;  2RQ6 A;  1IDS A;  2WB1 A;  2WLK A;  1VF5 B;  2AHY A;  1VF7 A;  1O75 A;  4JV5 B;  4DL6 A;  2WAQ A;  2AZ0 A;  1O9G A;  4J9Q A;  1W2B U;  3K5O A;  2DYR C;  1SQQ H;  4DV7 B;  2N74 A;  1US6 A;  5JWP A;  2QWN B;  4LF9 B;  1Z2G A;  3A0H Z;  1Y74 A;  2EJ2 A;  1GN3 A;  1QLE C;  4TQD A;  1FXV A;  1P7B A;  4B3T O;  5D8D A;  2UXD O;  1PKX A;  2BTO A;  3OGC C;  5IWA B;  4O3S A;  2A9H A;  4HAM A;  4ECR A;  3FB7 C;  4WBN B;  4DV6 O;  2B1I A;  5DEC A;  1VQL V;  5IYZ F;  1GSH A;  4FS2 A;  1SQX H;  4TVI A;  5BPH A;  1P4R A;  4YHH H;  1SER A;  5BWV A;  5FLM G;  3VOT A;  2O57 A;  4LBE C;  5KT5 A;  2QA4 V;  1IBL O;  5J2T B;  4DRF A;  2F4V B;  1RJQ A;  1AR4 A;  1OWT A;  3RB3 A;  2X5R A;  3B09 A;  4E2L A;  3WO1 A;  3RBD A;  5D5P A;  1NZ6 A;  1TWF A;  2QKS A;  2OCH A;  4QWC A;  1M57 B;  3H20 A;  3ZRW A;  3N8D A;  4DR4 B;  4FIP C;  3APQ A;  3PN1 A;  3RYC A;  5EBM C;  4X64 O;  2P7T C;  1AVM A;  1G4Y B;  2F93 B;  4BW9 A;  4LF4 B;  2FPP B;  4O4J A;  3TEK A;  3CHX A;  1R73 A;  4B3R O;  3OEH G;  4B3M H;  4I7H A;  3N43 B;  2QF7 A;  3QO7 A;  4GZR B;  5EIB D;  4D7S A;  3SPG A;  2IP4 A;  4RCN A;  2J6T A;  1B3Q A;  3CC2 V;  4ECU A;  4IRK A;  4DK0 A;  1HDJ A;  4IYI A;  1FS0 G;  1EN4 A;  4RB3 C;  5BR8 O;  4YY3 O;  3JCZ A;  1MZB A;  3OW2 U;  1C3O A;  3ZRV A;  5IYZ A;  1K34 A;  4NTX A;  1ZL8 B;  5HNE A;  4EBD A;  2OCC C;  2YU9 A;  4ZOL B;  1JJO A;  3HOV G;  3UO3 A;  1JKJ B;  1C30 A;  2ODM A;  3TCU A;  4B7K A;  2H94 A;  4MW3 A;  2Y4R A;  5KG1 A;  4LF5 B;  1GM7 A;  4I4T B;  3B8N A;  4O82 A;  4DL5 A;  2CAZ C;  1K4C C;  1VQ6 V;  1N0N A;  2EZO A;  4YJ2 F;  1GM8 A;  4WD3 A;  1X4T A;  4X64 H;  5BY1 A;  3HO8 A;  3ICX A;  5KFS A;  4JZG A;  4DXW A;  4ED8 A;  2YIA A;  4Z1M G;  2CK3 G;  1VP7 A;  5K1P A;  4GKK B;  3SYQ A;  3JAT A;  3QTC A;  4MVU A;  3N6X A;  5DQI A;  4MV3 A;  3E2E A;  1PV0 A;  3J81 W;  1XL4 A;  1S10 A;  2ZE8 A;  4GYC B;  2HHH B;  3F5W C;  4QWD A;  4GKK O;  4O3R A;  4P2Z A;  3MWM A;  3RB6 A;  3AYH B;  4O2A F;  5A2Q W;  4FFL A;  4XZ3 B;  2Q69 A;  5H6Q A;  3TK1 A;  1KMI Z;  1Y66 A;  5KUM A;  1YZB A;  2C2E A;  1T94 A;  5FNV F;  3IGA C;  4APM A;  4PA9 A;  3K5L A;  3HKD A;  5D1O A;  3FKI G;  4EEQ A;  1J5E B;  3LUL A;  3RYH B;  2UUA H;  1Q6U A;  5C8Y B;  1OV9 A;  1EKP A;  1UC8 A;  2A79 B;  2CW8 A;  2YXH A;  1L1F A;  4O2B B;  2HGS A;  3W7T A;  4YHH O;  1RM1 C;  2QM7 A;  2RGR A;  2M05 A;  2R70 A;  5BMV B;  5CA0 F;  5KAI Z;  1IBM O;  4JV2 A;  1PPJ H;  2OCC B;  3R65 A;  1DK1 A;  1G1X B;  1K4D C;  3OR7 C;  4JI2 B;  2QK4 A;  4O2B F;  4JI3 B;  1G6U A;  1TUE B;  3WWH A;  1RK5 A;  1TWG A;  5HV6 A;  1KD1 W;  5K3W A;  2X7R B;  5KG2 A;  4NTW A;  2R9I A;  1K5Q A;  1LR1 A;  4MTX A;  2HHF B;  3DTF A;  2QSA A;  5BR8 B;  2WA4 A;  4MVR A;  5BWT A;  3GLK A;  3RF2 A;  3SPJ A;  4QE7 A;  3Q8Q B;  4QPK A;  4JI1 O;  1FFX A;  1P49 A;  1R6N A;  2V59 A;  3JD3 A;  3R66 A;  1I94 O;  5EIB C;  4DV3 B;  5JVD B;  3CCV V;  4N21 A;  3GIJ A;  3QF7 A;  2ZM6 H;  3Q1K A;  3KCX A;  1OCR B;  1Q90 D;  1MNG A;  1K92 A;  2Q8V A;  4JI8 O;  1S76 D;  2ALZ A;  5I47 A;  4UCV A;  3SPC A;  4TV8 F;  1TWC A;  2WSS G;  5IJ0 A;  2P67 A;  4QNH B;  4KUM A;  3CCQ V;  3PO3 G;  2UUC H;  1NBM G;  4TV9 B;  1L2Z A;  1I1L A;  3Q2O A;  1S72 V;  2F4V O;  4HN2 A;  5J2T F;  1IZ3 A;  1JPX A;  4Q45 A;  3SPH A;  2OTL V;  4MTE A;  5KFM A;  5K1X A;  2XAJ A;  1W0K G;  4L1K A;  2DIK A;  1CQJ B;  4J11 A;  4J9N A;  2I8C A;  2PI4 A;  4FLY A;  2YZG A;  4WHX A;  5BWR A;  1I0H A;  3I4N G;  4EFB A;  4I55 F;  3NXS A;  2DWC A;  4RUA A;  2A3Q A;  2CDY A;  1ZTE A;  2NVX A;  4LH7 A;  3HB9 A;  3ZX6 A;  1S68 A;  4JYB A;  2ARH A;  2FL4 A;  2CKZ B;  2HVS A;  3LDC A;  4CH6 A;  1DGS A;  4PD4 F;  3LNM B;  3T7A A;  5KS8 A;  3W7W A;  1FJG H;  1YTF D;  1YIJ V;  2R8G A;  3SJB C;  2BCC H;  1M0W A;  4X66 O;  1M5I A;  1EUC B;  2NU7 B;  3RYF B;  2W6M A;  1SET A;  2HGX A;  2UXB O;  1S5L Z;  3KXY T;  3KAJ A;  2HVQ A;  1HNW O;  2EIJ C;  5LMU H;  4C7U A;  2VQF H;  2NR5 A;  2YIC A;  2UUA O;  2MW2 B;  1A3G A;  1ZSP A;  4ZOL A;  1XI1 A;  3PZP A;  5EC1 C;  2E5L B;  2RMK B;  4LF4 O;  1S9F A;  3TXQ A;  3T99 A;  3K3V A;  1NU1 H;  1W59 A;  2EBO A;  4F4W A;  3GWO A;  3WB0 A;  1YJ9 V;  3C3T A;  3CMA V;  4EGJ A;  4X64 B;  2VQE O;  3AW8 A;  4I55 A;  4O2B A;  2IBZ H;  3M7M X;  4AQY B;  4JI3 O;  2FYU H;  3ASO C;  1QVF U;  4ZHQ B;  3HXL A;  4MV4 A;  3T2M A;  2QEX V;  4DR7 B;  3KG2 A;  4LF8 H;  4LF5 H;  2EX3 A;  1S0M A;  1YEW A;  4UV9 A;  1ZX3 A;  5D1O B;  1UPG A;  4DR2 H;  3IAY A;  1GSA A;  3R5F A;  1R6K A;  4O2A B;  2DWD C;  3T1H O;  3ZRW B;  3H1K H;  2HIV A;  2PBZ A;  5FNV B;  1Y1V A;  4DR3 O;  2W9B B;  2R7K A;  1HR0 B;  4MVQ A;  4U3F H;  2AHZ A;  4X20 B;  4AHC A;  4A3D G;  2WLI A;  3H1I H;  4PZ8 A;  3CX5 F;  1E4G T;  2ZKO A;  5KA6 A;  3RV4 A;  2HJD A;  2WLH A;  1BXR A;  5CE8 A;  1GAX A;  4G3I A;  4TOI A;  5KG0 A;  4EYI B;  1FXK B;  1CKN A;  1NT2 B;  3M9M B;  4EGQ A;  2P90 A;  2OIE A;  1FKA O;  3U9T A;  5L1K A;  3EXA A;  4R50 A;  4O4I F;  2JJ2 G;  2P5O A;  1V4Y A;  1T3N A;  4DV0 O;  5CA1 A;  4MTO A;  3ABM C;  3K0G A;  4MT8 A;  3STZ C;  4CS2 A;  4A3F G;  4R6Z A;  1NH2 D;  2LO1 A;  2HG8 A;  3ZMT A;  2ZDH A;  3OHA A;  4JYA H;  1I94 B;  4LSA A;  3PR5 B;  2Z3Y A;  2OLS A;  4YXW G;  5B3S C;  1Q6I A;  2F4V H;  2YL2 A;  4RB2 C;  4E6N A;  4YR2 A;  2UU9 H;  1AI4 A;  1NQT A;  4OPH A;  4UFZ A;  3GQC A;  1WJZ A;  2ASD A;  2B5U A;  4YJ3 A;  1FXH A;  2JGD B;  1D5A A;  3DTU B;  2GUZ B;  5LMN H;  4QWA A;  1F51 A;  3D36 A;  1KP2 A;  3ETQ A;  3I5D A;  4IT5 A;  3U10 A;  5KFW A;  3BA8 A;  1J5E O;  4YR3 A;  4RUF A;  3N2G A;  3RGX A;  3ZHV A;  1WPX A;  2V58 A;  4WFB V;  2V7Q G;  5BPF A;  2C2R A;  1PM9 A;  4FMT A;  4I5S A;  1HNZ H;  5LP6 B;  3RVY A;  2VUG A;  2UXB B;  4K0K H;  5LL6 Y;  1N34 O;  4LNU A;  1LUW A;  2QWQ B;  5EZY A;  1GGO A;  2W6I G;  4LF7 B;  5C8Y F;  4O4I A;  4JAV A;  3ETH A;  4B3R B;  1BGY H;  2A7W A;  3K5H A;  1L0L H;  3NC0 B;  3IN5 A;  3GV7 B;  3EFF K;  3P30 A;  3H4B A;  3GJX B;  1M6V A;  1BGW A;  2VOB A;  2EIN B;  2WLL B;  1IXM A;  1MMM A;  3K5I A;  2EIK C;  1CXZ B;  2I87 A;  3L71 H;  1KBH A;  2XHB A;  4J9K A;  4FM2 A;  3WU2 Z;  2ZR2 A;  3OTO B;  2PTM A;  3JAL B;  4O4H B;  3HOX G;  5T14 A;  3CVZ A;  1KEC A;  1H2S B;  5J2U B;  1TGO A;  1YCI A;  3GIP A;  1H2M A;  3ABM B;  4JTC B;  4F50 A;  3QO8 A;  1TWH A;  5EWE A;  2E75 B;  3QZ7 A;  4QW8 A;  5DGA A;  2R85 A;  2ASL A;  4GKJ H;  4O4L B;  3AG7 A;  1N33 H;  1AJN A;  4J9P A;  1HW7 A;  2WLM A;  1GRJ A;  3K57 A;  3F5T A;  3J7A U;  3SE7 A;  2Q7G A;  1A32 A;  1BL8 A;  2LJ2 A;  3N2G B;  3VQX A;  4R7R A;  1PP9 H;  2Y0S E;  2BSK B;  3U55 A;  1I7N A;  5KT4 A;  1N48 A;  2UXB H;  2M6Y A;  5LXT B;  2PF4 E;  1GK9 A;  2GPW A;  5EZY F;  1DV2 A;  2YRX A;  2HFE C;  2PYL A;  4QGP A;  2VQF O;  5KFP A;  3DSQ A;  3GTO A;  1GO3 F;  5ITZ A;  2ITC C;  4X65 H;  4JI0 O;  5LMN B;  2PVP A;  3AG4 C;  2Y0I A;  2ABJ A;  4JV0 A;  5BXZ A;  1I7L A;  3OR6 C;  2BQ3 A;  1QU7 A;  3U54 A;  5F9L A;  1ENV A;  4DL2 A;  4ME6 A;  4LMY A;  2XAS A;  1S5H C;  2P22 C;  1EUD B;  3CEB A;  5CA1 B;  5CA0 B;  4A5U B;  3T5J A;  4C5B A;  5IJ9 A;  1Y67 A;  1UJW B;  5BWW A;  3Q8P B;  1KC7 A;  4DV1 H;  1Q81 W;  1I1K A;  4DR1 O;  4F4X A;  4EG0 A;  5B1B B;  1GN6 A;  3G8D A;  2RJZ A;  3NGD A;  1V54 C;  2FLL A;  1T5E A;  2FPI B;  1EZJ A;  1LUV A;  1YHQ V;  3FFQ A;  4K0K O;  5BYB A;  3EPG A;  4TQS A;  2YZN A;  2R9A A;  4IWX A;  5DGI A;  3WG7 B;  4CH3 A;  2KG7 B;  2AGO A;  2RNB A;  2JEJ A;  2Y48 A;  3AG4 B;  4OX9 O;  4JI7 O;  1FPO A;  4DW1 A;  2HP8 A;  5KFN A;  2OYQ A;  1EN5 A;  2W6Q A;  3MFH A;  2JS5 A;  5JJJ B;  5C1O A;  4YAJ B;  4MSW C;  4X1Y B;  2IU0 A;  4X65 O;  2HKO A;  4J0M A;  3JAS B;  4X9Q A;  5DG9 A;  2FLP A;  2R87 A;  3GB7 C;  5KG3 A; 
#chains in the Genus database with same CATH homology
 5D5P A;  2CFM A;  1XMO H;  2CW7 A;  3HKC B;  5FNV A;  4DV6 B;  2PZS A;  3VQY A;  4TUY A;  3H20 A;  4TUY B;  4ETS A;  1TVK B;  4OX9 B;  4DR4 B;  2ZIO A;  3PN1 A;  2O03 A;  3RYC A;  1A0I A;  2F1M A;  4CC6 A;  2VPS A;  1BJT A;  2F93 B;  1TUB B;  4BW9 A;  4LF4 B;  1J5E H;  4O4J A;  2YIB D;  3CHX A;  4LF8 B;  4GLX A;  1P16 A;  1QHT A;  4K0K B;  3JAW B;  4B3M H;  4I55 B;  3QG5 A;  3N43 B;  4I7H A;  5EOY A;  2Q7H A;  2YI8 A;  5EIB D;  4D7S A;  2GV9 A;  4WBN A;  1N34 H;  4DK0 A;  5D5Q A;  4B3T H;  2Q2U A;  4B08 A;  1N32 H;  2HVR A;  4RB3 C;  4U3J A;  3RYF A;  4EFE A;  4JI0 H;  1JFF A;  1MZB A;  3RGZ A;  3OTF A;  5IYZ A;  3N2K B;  5DIS C;  4UCO A;  3B2E E;  4NXM B;  1HNZ H;  4ZI7 A;  5KX5 A;  4LFA B;  4ZOL B;  1JJO A;  1SQG A;  2Q7E A;  4RAY A;  4YHH B;  3L2P A;  1E4F T;  5JJE B;  4JI5 B;  3E22 A;  1AN7 A;  4LF5 B;  2UUB B;  4EB6 B;  3JAR B;  4I4T B;  3T1Y B;  3THO A;  1ZHS A;  2CAZ C;  2F66 C;  1N36 H;  4UCR A;  3JAT B;  2PY5 A;  1IBM H;  1HNX B;  1X4T A;  4KHP B;  5CB4 A;  2HIX A;  4X64 H;  3HKB B;  4AIL C;  3BHP A;  3ICX A;  3KAL A;  4DUZ H;  4CH4 A;  1M93 A;  2YIA A;  4X1I B;  4FLW A;  4DR1 H;  4FLT A;  3NBZ B;  4ZI7 B;  2UXD H;  3C0F B;  2Q2T A;  5K1P A;  4GKK B;  4JI6 B;  3JAT A;  3QTC A;  1M0T A;  3N6X A;  3JSL A;  3F8N A;  1Q3E A;  1JFF B;  2UXC H;  3J81 W;  2ZCE A;  1Z5W A;  4GYC B;  2HHH B;  1N34 B;  3K59 A;  3MWM A;  3N44 B;  5A2Q W;  2YIB A;  1KMI Z;  2QJ1 A;  5JQG B;  4DR2 B;  4X1K A;  5KHH A;  1IBK B;  4APM A;  3K5N A;  4PZ7 A;  3K5L A;  3HKD A;  5D1O A;  4EEQ A;  1J5E B;  3RYH B;  4X20 A;  2UUA H;  4FVM A;  3T1H H;  4JI8 H;  5C8Y B;  1XK5 A;  2CW8 A;  4DR6 B;  2HGS A;  4O2B B;  4DV5 B;  3N41 B;  3GDE A;  4LF4 H;  5JJN B;  1XHX A;  1Q43 A;  2RGR A;  3T1Y H;  3SGI A;  2RGV A;  4FM9 A;  1IBL H;  3SR2 C;  2R70 A;  4O2A A;  5BMV B;  3T1H B;  4RB0 A;  2Q0A A;  4DV1 B;  4X62 H;  4ZIB A;  3RTX A;  4O4L A;  4JI2 B;  4JI3 B;  1G6U A;  5KMG A;  1SA0 B;  3UT5 A;  1Z2N X;  4DR3 H;  1M4U A;  2KSW A;  4DRX A;  4DRX B;  5BR8 B;  3J7A K;  4PZ6 A;  3W1G A;  3RGB A;  5EZY B;  3RF2 A;  2VQF B;  4PDB A;  1X9N A;  4NXN B;  4LFC B;  4X62 B;  5C8Y A;  4BWS C;  2BTQ B;  5JH7 A;  2VWJ A;  5IWA H;  3RYH A;  4LFB B;  4UCS A;  4JI3 H;  1FFX A;  1P49 A;  4X1Y A;  3RWR D;  5EIB C;  5LA6 B;  5JVD B;  4DV3 B;  4LF7 H;  2ZM6 H;  3QF7 A;  4DV0 B;  1TAE A;  1HNX H;  4HNA A;  2MCT A;  4B3R H;  1SEI A;  4HBN A;  3JAK B;  4MTD A;  4CS3 A;  4PHZ A;  4UCV A;  4JI4 B;  4DV5 H;  2VQE H;  5IJ0 A;  3N40 P;  5IJ9 B;  3L4K A;  2UUC H;  4TV9 B;  1L2Z A;  1RSO A;  4PI0 A;  5LYJ B;  2HHH H;  4UCT A;  4YJ2 B;  3SJC C;  4MTE A;  4LR3 A;  4CS4 A;  5K1X A;  3ZED A;  4DR3 B;  2VQE B;  4FLY A;  4TV8 A;  5FLX W;  4EFB A;  4DUZ B;  3JAR A;  5LXT A;  4F6R B;  4X1I A;  3JAM W;  4LH7 A;  4KHP H;  1B04 A;  1SQF A;  1S68 A;  4I50 B;  3TY5 A;  1SKV A;  4IHJ B;  4BWA A;  2HVS A;  4I9Q A;  1XNR B;  3RFR A;  3BRC A;  1DGS A;  4CH6 A;  3VQW A;  1FJG H;  3LML A;  1QQC A;  4DR4 H;  5IJ0 B;  3SJB C;  1M0W A;  1M5I A;  1Q8I A;  4B3S H;  3RYF B;  3CSX A;  4EB6 A;  3KXY T;  3KAJ A;  4YY3 H;  1XNQ B;  2HVQ A;  5IT9 W;  4M7E A;  3MAQ A;  5EYP A;  5KHK A;  5LMU H;  4FLU A;  3QWU A;  4Q6G A;  2VQF H;  5LL6 b;  1IBK H;  1O9H A;  4JI5 H;  2UU9 B;  4ZOL A;  4TQF A;  1XI1 A;  3GB8 B;  1FFX B;  5KHG A;  3FMA A;  4FM0 A;  2E5L B;  3N2K A;  2JVD A;  1TUB A;  3K3V A;  3WB0 A;  3KYH C;  1HNW B;  1ZHQ A;  4X64 B;  1TVK A;  2YXL A;  4DR1 B;  3EYY A;  2KKW A;  1WH2 A;  2WE6 A;  4I55 A;  4O2B A;  3UQ8 A;  4JYA B;  3M7M X;  4AQY B;  3NBY B;  1SA0 A;  4A2B A;  1N36 B;  4LF9 H;  4ZHQ B;  5LP6 A;  3HXL A;  4MV7 A;  4DR7 B;  2UUB H;  1IBM B;  4CC5 A;  4LF8 H;  4LF5 H;  2EX3 A;  1YEW A;  3ZS8 C;  1JMK C;  5D1O B;  4DR2 H;  3IAY A;  4JV5 H;  2WDT A;  4X1K B;  4O2A B;  5BMV A;  3A2F A;  5D1P A;  1Z2P X;  4AQY H;  4LFC H;  1S5J A;  2HIV A;  5EYP B;  4O4I B;  5FNV B;  4RB1 A;  4YJ3 B;  1S03 G;  3TY9 A;  1CKO A;  1HR0 B;  1V9P A;  3RYI A;  2JGU A;  4DUY B;  4JI7 B;  2ZJT A;  4NXM H;  4X20 B;  5JCO A;  4AHC A;  2ZIN A;  2UXD B;  4FFB B;  3JAS A;  4B3T B;  4PI2 A;  4DK1 A;  5LMU B;  5FPR A;  1SYX B;  3HKD B;  4PZ8 A;  4UCU A;  3U0Z A;  1E4G T;  1TA8 A;  3HKB A;  4TOI A;  4JI1 H;  1CKN A;  1NT2 B;  3L4J A;  4X66 H;  1FVI A;  4JI4 H;  1P8L A;  4CH5 A;  4FLZ A;  4FLV A;  2P5O A;  3WB1 A;  5CA1 A;  1KU9 A;  4DR7 H;  4CS2 A;  4L8J A;  1FJG B;  4JI8 B;  4IHJ A;  1CKN B;  4YJ2 A;  3E22 B;  4FLX A;  4I50 A;  5LYJ A;  3M4I A;  4JYA H;  1I94 B;  4LSA A;  4LFB H;  3TY8 A;  5KX5 B;  3SJA C;  5LOV A;  2F4V H;  2VWK A;  5ITZ B;  4RB2 C;  4JI0 B;  5FD6 A;  3RR5 A;  1HNW H;  4JI7 H;  1XMO B;  5GON B;  1Q5O A;  1HR0 H;  4E6N A;  3S24 A;  2UU9 H;  3RYI B;  1ZAU A;  4UFZ A;  1XDN A;  5CA0 A;  4LSX A;  4I4T A;  3JAK A;  4NVP A;  4YJ3 A;  1D5A A;  2E5L H;  4K8Z A;  5LMN H;  4DUY H;  1CKM A;  3ETQ A;  5LP6 C;  3U10 A;  4B3M B;  3W5O A;  3N42 B;  3BA8 A;  4LF6 B;  5LA6 A;  3N2G A;  3RGX A;  3RJ0 A;  4DV4 H;  3JAW A;  3JSN A;  1Z2O X;  3IG0 A;  1I94 H;  4TV9 A;  3BPZ A;  4YY3 B;  4FFB A;  2UUC B;  5IYZ B;  2HEP A;  5JH7 B;  2BTQ A;  4O4J B;  4ZHQ A;  5LP6 B;  2UXB B;  2VUG A;  4EQ5 A;  4IAJ A;  4K0K H;  3RIZ A;  4LNU A;  5EZY A;  2ZNJ A;  5J2U A;  4LF7 B;  4IIJ A;  1XMQ B;  3J80 W;  4DR6 H;  4O4I A;  3LNN A;  4B3R B;  2PUS A;  3JAL A;  1HNZ B;  3NC0 B;  4DV0 H;  2ZM6 B;  3UT5 B;  4K8X A;  4DV3 H;  3GJX B;  1BGW A;  4DV6 H;  4KL1 A;  2VOB A;  5KMG B;  4LH6 A;  3U11 A;  1WN7 A;  2XHB A;  1L8D A;  4FM2 A;  2W57 A;  4DR5 H;  3RYC B;  3OTO B;  2PTM A;  4NXN H;  3JAL B;  3BAB A;  4O4H B;  4FM1 A;  3CVZ A;  4IIJ B;  3HKC A;  1H2S B;  5J2U B;  5FPO A;  1GYF A;  1TGO A;  4LNU B;  1XNQ H;  4X65 B;  5J2T A;  2PYJ A;  4GKJ H;  4O4L B;  1N33 H;  4DV7 H;  1IBL B;  1HW7 A;  4B3S B;  3K57 A;  2Q7G A;  2ZIM A;  4R7R A;  3N2G B;  3VQX A;  5KHI A;  2YI9 A;  5JQG A;  1FKA H;  3K58 A;  4A2A A;  2E3C A;  2UXB H;  2OWO A;  1N33 B;  5LXT B;  4GKJ B;  4OX9 H;  4DV2 B;  3DF7 A;  3BAA A;  2PYL A;  5GON A;  3DSQ A;  5KHJ A;  5ITZ A;  4JI1 B;  1I6U A;  3VQV A;  2UUA B;  4X65 H;  5BR8 H;  5LMN B;  2ZNI A;  2QM4 A;  4DV4 B;  2PGG A;  2FE3 A;  3HKE B;  2XIG A;  4F6R A;  4LMY A;  2P22 C;  2F95 B;  5CA1 B;  5CA0 B;  4JI2 H;  2R72 A;  1XHZ A;  4Q0Y A;  5IJ9 A;  4TV8 B;  1N32 B;  1VS0 A;  4DR5 B;  3OTO H;  4GKK H;  4DV1 H;  4DV2 H;  1WPB A;  2UXC B;  4D7T A;  5FD5 A;  2RQ6 A;  4RAZ A;  5LOV B;  1VF7 A;  3VNN A;  4JI6 H;  2RJZ A;  1WNS A;  1O75 A;  4JV5 B;  3HKE A;  1T5E A;  1O9G A;  3K5O A;  1XNR H;  5JVD A;  3FFQ A;  5CB4 B;  4DV7 B;  4RZQ A;  4MV9 A;  4LF9 B;  2R9A A;  1XMQ H;  4TQD A;  2IM9 A;  3KAK A;  2BTO A;  1I7F A;  4U3J B;  4CH3 A;  4LF6 H;  5IWA B;  2YCH A;  3CB2 A;  3BA9 A;  5JCO C;  4LFA H;  4X66 B;  4WBN B;  4HNA B;  2OYQ A;  3WB2 A;  4O4H A;  2JS5 A;  5JJJ B;  2WYO A;  3W1B A;  4YHH H;  1XQ8 A;  4X1Y B;  4J0M A;  3JAS B;  3K5M A;  5J2T B;  4DRF A;  2F4V B;  2V4D A;  1Z5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...