5FPRA

Structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 104
structure length 307
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fprA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fprA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fprA02
1FJGB 4GKKB 4UCOA 2HVQA 4X65B 2UXCB 4UCRA 1I94B 1IBKB 1P16A 3RR5A 1TA8A 4LF8B 4DR5B 4AQYB 4DR6B 4TOIA 4GLXA 5FPRA 5LMNB 4DR2B 4JI1B 1XNQB 2HVRA 2UXDB 3BABA 3T1HB 3JSNA 4LF5B 1XNRB 4DV0B 2UUCB 2VQFB 4LF7B 2OWOA 4LFBB 2E5LB 1CKNA 4YHHB 4DR4B 4EQ5A 4DRFA 1HNZB 3OTOB 4JYAB 4JI3B 5D1OA 5D1OB 3JSLA 3VNNA 5DISC 1X9NA 1CKOA 1ZAUA 4NXNB 4DV1B 1P8LA 4X62B 5LMUB 5FPOA 4PZ6A 4EFEA 4B3MB 1HNWB 2UUAB 1CKNB 4DUZB 3GJXB 4GKJB 4JI2B 1CKMA 4DR3B 2HIXA 5IWAB 4OX9B 4DV4B 1S68A 3T1YB 2HVSA 4DV6B 1IBMB 4B3TB 4JI6B 3UQ8A 2UXBB 4LFAB 1N33B 2Q2UA 4DR1B 4X64B 1V9PA 4LF4B 4K0KB 1XMOB 1HR0B 4LF6B 3TY5A 2ZM6B 4JI4B 2UU9B 2F4VB 4DUYB 3TY8A 4UFZA 3GB8B 1XK5A 4LH7A 1N36B 1XDNA 3QWUA 5D1PA 4LFCB 2HIVA 4X66B 1TAEA 3BAAA 4UCVA 1N34B 4UCTA 4EEQA 4JI8B 2VUGA 3W5OA 3RTXA 4JI0B 4EFBA 4JI7B 4DV2B 5BR8B 4B3SB 4PZ8A 4CC5A 2Q2TA 4DR7B 1DGSA 3BA9A 4UCUA 1HNXB 4JV5B 4CC6A 3S24A 4PZ7A 3L2PA 1N32B 3NC0B 1A0IA 1B04A 3SGIA 4UCSA 1FVIA 1J5EB 3TY9A 1VS0A 4YY3B 2VQEB 3W1BA 4B3RB 4LH6A 2CFMA 3PN1A 2UUBB 3NBZB 4KHPB 4LF9B 4NXMB 3GDEA 4DV3B 4E6NA 4DV5B 4DV7B 1XMQB 3NBYB 1IBLB 4JI5B 2HHHB 3KYHC 3BA8A 3W1GA
chains in the Genus database with same CATH superfamily
4Q6GA 4JYAO 1PNKA 5JCOC 1HNZO 3BFRA 3RW0A 4J9PA 4DR5B 4O4LF 4X64H 4FM2A 2DE0X 2GBOA 2LFSA 4IWXA 3HKDA 3QZ8A 3I55V 1H2MA 2XCAA 2COJA 1I7NA 1TGOA 3V6JA 2VQFB 2W6OA 4I55B 3HBLA 4AQYO 2LW1A 1CP9A 4YHHB 4JUZA 2GLTA 3TINA 4DR7H 3RYIA 1SESA 5L1JA 4LF5H 1WJZA 2R93A 2EILC 5KLVH 4JI6H 4FBUA 3ZN0A 1FYJA 1T94A 1BQ0A 4DR6H 3ETQA 1YZBA 1YI2V 3N8DA 4ETSA 4JAUA 1BT8A 1GLVA 4B3MB 4O81A 4CKEA 2YI9A 1JJOA 5I5SA 4H13B 4PHZA 3BRCA 5KUKA 5IWAB 4OX9B 4FU0A 2CUGA 3LDEA 4HN2A 2IJKA 1W0KG 1VQ5V 1JMKC 4BY7G 3GILA 4JYCA 3STZC 1NKDA 4A93G 1GTOA 2GTSA 4JI6B 1KD1W 4B3TB 4WBNA 3OTOH 3RB6A 3H4BA 4QIWE 4F50A 3MJFA 3QO5A 2CE4A 3RT3C 1ZHSA 3NXSA 5KFPA 2ZDQA 4I7ZB 2NN4A 4LF6B 1N33O 2UU9B 3GTGA 4KL1A 4QE7A 4BWAA 2FP4B 1Y14B 2HLDG 5B1OA 2GUZB 1TAEA 4UCTA 4HNTA 2R7ZG 4EFBA 4NXMO 1VBHA 1CQIB 1W0JG 1BE3H 4UV8A 4MTFA 1JX9A 2ZDHA 3ASNC 4DR7B 5KFRA 1YTFB 3MHSC 5KUMA 4PA9A 1N48A 4JI3O 5C5JA 1TUBA 4DL7A 5KAIZ 3TXQA 5JUMA 2H94A 2UXXA 1E1RG 4DK1A 3WB1A 4QPKA 4XDJA 1BHAA 4QJFB 1PL4A 1K8AW 3P3NA 4MAMA 3ABLB 3QO7A 1H38A 4GT1A 4FLVA 1MOFA 2J6UA 5CB4B 4TSFG 3EVKA 1I2KA 3ABMB 1WH2A 1OCOB 3QG5A 4ZKIA 4RZQA 2HEPA 3K03A 1YITV 2J6SA 4ED0A 2UUBH 3LP8A 1TA8A 4YHHO 1AR4A 3H1KH 4J9KA 4PA6A 1YIJV 1XNQB 2ZR2A 5B3SB 5L1IA 2WLKA 4P9OA 1C3OA 3ETJA 3T9DA 1TWAA 4LFAO 2M05A 2DYSB 2COGA 2EULA 3QQMA 4I0XB 4U3JB 3BCCH 5IYZB 5KFBA 2W6QA 2VQFH 4IHJB 4ZHQB 5FJ8G 2UXCO 4ED7A 2QSAA 3E8BA 4AYBE 2EIYA 1Y1VG 2B1IA 1EN6A 1Y76B 2XAJA 1O9GA 1IBLO 3PW0A 1G2WA 2P22C 4F6RA 5CA0F 3L73H 5LGTA 4RQEA 4FFLA 5EZYF 3G6BA 1BJTA 1CKOA 1WAZA 4YJ3B 2QB5A 4DIMA 5EIBD 2ZXWC 4HNAA 4DUZB 2EIJB 1NBMG 2HHHH 3RBZA 4TQFA 1BGWA 4IR1A 2MCTA 3ZEDA 3I12A 4C7UA 2AXTZ 4YAKB 4O3PA 3CCQV 2XT9A 5JQGB 3CS5A 3E2EA 3SNOA 5J2UF 2JA5G 5KS8A 4B3TO 1YTFD 3OM3B 4MV4A 3FYEB 1VKZA 2W57A 1RP3B 4RQFA 3ZX6A 3ABKC 4Q0YA 5GW7A 2PTMA 3QWUA 4RWUA 3BAAA 1I94O 1GGOA 2AHYA 3G4SV 2F66C 3KAJA 3VOTA 4EKWA 2X7RB 4DO2A 4BBSG 3GTJA 1V54B 4R7RA 3A0HZ 3U11A 4U7CA 4CS3A 2JS3A 3T7AA 1R3IC 4JV5B 4DV7H 2DW4A 4CC6A 3MWEA 3RBDA 1E79G 1N32B 4A3FG 1L0NH 4CH5A 2WAQA 3JAWB 1SQXH 1A0IA 2AZ2A 3W7TA 3ZRWB 3DTGA 2KSDA 3PO2G 4DR4O 5LXTA 1OZ0A 5I5YA 5LXTF 4JI7O 3NR7A 1XEQA 2JGDB 1M57C 5DM6V 1EUDB 5DN6G 4DK0A 1IBLB 3NBYB 1JXLA 1FFXA 1THZA 3BA8A 2Q7GA 3G80A 1KJQA 3T5KA 4MV6A 5LP6B 4X65B 1XI1A 1BCCH 3IG0A 1Z2PX 3AK1A 1DF5A 2XIGA 2B1GA 3ML0A 1VQ7V 1P16A 5KT3A 4X1YB 2BCCH 3K3WA 5KFXA 2EZPA 4O86A 2OIGA 3D36C 2EIMC 3D8CA 3U10A 1EZ1A 4KP4A 1WP8A 3CXCU 5KFEA 4FLZA 3CYOA 3ZMSA 2J9GA 5BWVA 5TISZ 5H6RA 4JI7H 5CBHA 5KG0A 4K3AA 5A2QW 3T1YH 1QBZA 2R85A 2EIJC 2FJZA 1Q6UA 4M9UA 4E4TA 4IZOA 3HB9A 2LO1A 2Q0OC 3U54A 3WNZA 5KG2A 2CTQA 4RB3C 4BW9A 1D5AA 4PI2A 1SA0B 1VF7A 1URFA 4LF7H 1NTMH 4QW9A 4J7KA 4O3QA 1BQZA 3JARA 4XX0B 5B66Z 4O3NA 4O7SA 4I4TA 2LFRA 2YDEA 3BVOA 2JA5A 3E35A 2GPWA 3OGIB 1FKAH 4RNNA 2KQXA 1R3LC 5L3BA 5LYJA 4HNVA 1WPXA 1FFTB 1QNMA 3IGAC 2EJRA 3ZMZA 1GH6A 3TEKA 4K6NA 2BTQA 1ZTEA 5J2TF 2PZSA 4JI1H 3UO2A 2WLIA 1B6SA 3RV4A 4ECVA 4HBNA 4O4JA 3H01A 1EYZA 5FR9A 2HVJC 5HFLA 2GV9A 4GX2A 4DV5O 3PW2A 4UB6Z 4E4EA 4F4XA 1UNNC 2A06H 4BIZA 4JI5O 2VOBA 1WSCA 5LP6F 5EWGA 1XOUA 2Q7HA 3VQYA 4XBFA 2W0FC 4I4TF 2W9BA 5H80A 5C3EG 2OTJV 3L70H 4O4HF 4B3SH 1J5EH 4PA3A 1M6VA 2P0AA 2JA7G 4J7JA 1KJJA 1MABG 1I94H 4DV3B 2R86A 3B4SA 5CBGA 1SQBH 1YEWA 3CJHA 3PO3G 4FK5C 2ITCC 5DAAA 4BY1G 3UM7A 4RAYA 1W59A 3LNNA 5LYJB 4YBZB 2KB1A 4RAZA 1UPGA 4UCOA 5A2QN 1JA8A 5BYBA 3KHHA 4JI4H 3CWBH 4J41A 4B08A 4JI4O 4TV8B 1DLBA 4MVUA 3BQ1A 3CD6V 3Q8SB 4ECRA 1IBMH 3EPIA 4YP3A 4MTGA 1XNRB 3OGCC 5LBQA 3JAKB 4DV0B 3K5OA 5KFNA 2FPGB 3SJAC 1K4CC 2UUAH 5KX5B 4YY3O 5LMUH 2GPSA 4LSAA 4Q8FA 4H33A 2Y4TA 1JIHA 3WFVA 5KG1A 2QM7A 4DV6H 4BXXG 2YL2A 2Q7EA 2JA6A 2QE7G 3FB8C 1GM7A 2Y4RA 2EZOA 4FPPA 1OCCC 3JCZA 3B8MA 3NUAA 5KFMA 5KFQA 5KX5F 4NXNB 4YXWG 2DN9A 5B1BB 3PFFA 3NGDA 3L71H 2HJWA 3GWKC 2NR5A 2HDKA 4JI0O 3C90A 1T3NA 4LF6H 3ZCCA 4CKCA 1CKMA 3ETDA 2ITDC 4FM0A 3BJYA 4H0LB 2AU0A 3ETGA 3ZMVA 1MA1A 4X1YA 1KTAA 2LP7A 1W96A 4X9QA 4DR1B 3BEHA 5DQGA 5C1OA 2RGRA 3V6HA 3RN4A 1Q81W 5KG5A 3OSPA 3GV5B 1DTOA 3OMIB 2QDOA 2XAGA 2CW8A 1FFXB 4TQDA 1XK5A 1F51A 5EIBC 5BPFA 4UUJC 4A3DG 4C2MA 4LBEC 4UXNA 3UCSC 5IWAO 4OX9O 4WFEA 1S77D 2R8HA 2C2RA 3CVZA 3OR6C 5EBWC 5EDWA 4IT5A 4TQRA 3TCUA 1XL6A 2DOSA 1T36A 3R65A 2PUSA 4QPJA 5I5XA 2ZDIC 2W6ZA 4FZ1A 1HNXB 2EX3A 5EYPB 1OCRC 2NU6B 4J42A 4X20B 1XNRH 1AILA 1XBLA 4UUGA 3FAVA 4LFAH 3KCYA 4X62O 3CCMV 3AK3A 4QSHA 3TJTA 2CH7B 2HGXA 3SPGA 5KFIA 4O7RA 4P30A 2RDCA 3VMMA 3E89A 4IIJF 2E2IA 3AEIA 3LSUA 4NXMB 3RYHA 3N2KB 1O75A 3N43B 5IWAH 2OH2A 3B2EE 4OX9H 5CA0B 4MVZA 1MNGA 1Q90D 1O9HA 3AG2C 4QWCA 4DV2H 1I94B 2VS0A 3OE7G 1EZVH 2XAFA 4X1KA 4R6ZA 3ORRA 4TOIA 5LMNB 1P7BA 2HG5C 2JVDA 4EGQA 3BABA 1JOYA 3CCLV 4YB8B 3KXYT 2J6TA 4A2AA 5K3WA 1VEWA 5IDJA 4HNAB 5JH7F 2X6AA 4YJ3A 4IIJA 3SPJA 5JJEB 3MHHC 3ZHVA 1NU1H 5H9CA 4JYAB 4OXSA 5IYCO 1WRVA 4JI3B 3FB5C 3JD3A 3K9AA 3GV8B 5K1PA 4K8XA 1XMQO 5C8YF 4DR5H 3UT5A 2YEVB 4JI2H 3SDLA 4FIPC 4O4JF 2BR0A 3GQCA 2X6CA 4AHCA 4Q4DA 1RSOA 2F23A 3Q8RB 4U3JA 5IYZA 2UUAB 4NXNH 3T9BA 1US6A 1AR1B 3FKIG 1QLEC 4ECWA 3K9SA 2ZR3A 2VUMA 4Z1MG 4O7LA 1B3QA 2W8KA 2H3OA 2BQRA 1SFOA 1I08A 1K73W 1I1KA 4FFOA 4O2AB 1CS0A 4XYMB 2WE6A 1UFIA 4E2LA 1JVMA 3SE7A 1SQPH 1QVFU 1S3JA 2QTOA 1EBOA 1RK6A 1NT2B 4J11A 3EPGA 4DV0H 4DUYB 2EJ7A 1M93A 3DTFA 1Z2OX 5E1AC 4UCVA 5KAFZ 1GSHA 1FPOA 4FFNA 4FM9A 4GC6A 4UV9A 4JGSA 4RZRA 1S5HC 3OTFA 5F9LA 5KA5A 4J9LA 3VQWA 4GKJO 1N33H 1J5EB 3T9FA 3JATA 5KHHA 2BSKA 4YQWA 2QJ1A 2I80A 3EXAA 4ABMA 4MV9A 2ALZA 1NR7A 5GONF 4LF9B 3GIIA 4RB2C 1HDJA 4CS2A 1VIBA 1P84F 2WLJA 1FJGB 3N42B 4EBEA 1ZX3A 1GKFA 2UXCB 2HGWA 3SYPA 2XOKG 4FS1A 4J9YB 4LF4H 1ORQC 4FBTA 2V4DA 4OGQB 4LF4O 3DXRB 5CB4F 5L1LA 2R70A 2UXDB 2YCHA 2QM4A 3M99B 5B5EZ 5KFOA 4ED1A 1H2KA 1K4DC 2NVYA 3FFQA 5JWPA 4DV7O 3AW8A 3VPBA 2R8GA 4LF7B 3K5NA 5I5WA 3HT5A 5KFUA 3N41B 3RYFB 1ZWIC 4QE9A 3DF7A 2QWNB 2L35A 2YEVA 3E8FA 1RK5A 4BAYA 1NH2D 5DGIA 3UT5B 4J9QA 3SYQA 4NXNO 3T1CA 4JV0A 4DV3O 4MVOA 4IYHA 4R8UB 1NH2B 5IT9N 1VMGA 3J80W 4WFHA 2FMAA 5LGNA 4RUAA 2YZMA 2F4VH 2O57A 4I50B 1BZKA 4LFCO 5KFDA 3GTKA 1N36O 2KSWA 3W7XA 3G71V 4DRXB 1DF4A 3JASB 2OIEA 5C4XG 4TT3G 5CA1B 1JKJB 4WFGA 2ZNIA 1S97A 4X1KB 4O3RA 4ECXA 1YSCA 4ICGA 2RN9A 1S5LZ 2HG8A 2JEXA 5KFFA 5KFTA 3G6VA 3O9OA 5FLXW 3PR5B 3UZBA 3AG1C 1VQ6V 3KZIZ 1XNQO 3GB8B 5KT2A 2DQ3A 4DL3A 5CA0A 4G3IA 4X1IB 2ZE6A 2AGAA 1N36B 3RYHB 2B63G 1IYDA 1XQ8A 3JZIA 1AI4A 3GB7C 4NKGB 2UU9O 2V58A 3K06A 3OMNB 2CH7A 3CCVV 1Y66A 4NLGA 1GN3A 2LW7A 1HNWO 2IJIA 4GX5A 5DLFA 1HP8A 1N36H 4CC5A 3JRWA 2Q2TA 3KAKA 2HHHO 4O7TA 1D5NA 2Z5UA 1K97A 5EYPA 2VPQA 3H0GA 1S10A 4RU9A 5J2UB 2E5LH 3S24A 4J80A 5JVDF 1NVPD 3U9TA 4ED2A 1ZL8B 1GRJA 5JJNB 4JI2O 2NU8B 2IJHA 4TV9A 1Z5WA 1SKVA 3SJCC 3GTPA 3FX7A 2IW5A 4O4IA 3W1BA 4TV9B 4I55F 1RPOA 2IA6A 1RFYA 2JRIA 1ZL8A 5IYZF 1A32A 1WNSA 2ZT9B 3ABKB 2VQDA 4X66O 2UXDO 4MVSA 5KKNB 2BQ3A 1S0MA 1LR1A 5L3GA 1IBKB 5GONB 2DYSC 3WG7C 4AYBA 1YF2A 3ZJZA 1CQJB 2R82A 2UXBH 4ZIBA 4ED8A 5IT9W 5KFJA 1W2BU 3WWHA 2Y0SE 1BNCA 3F7VC 3C0FB 1VF5B 2YXHA 1N8RW 3LQSA 2ZJTA 3MD0A 2QWPB 3I4NG 2XNDG 5BY1A 3L72H 1F4NA 3ZIAG 2CTWA 3X2QC 2I87A 4LMYA 3KHLA 2UXDH 5B1BC 1B33N 3JASA 5KFVA 2IU0A 5F2VO 3HKBA 5DISC 1PP9H 3CRAA 1S72V 4JI3H 4I50A 2HP8A 4NYEA 3RB3A 2JEIA 4GKKH 4DW1A 5BR8O 4FLXA 2W7PA 3HR0A 2QKAA 4MSWC 4DR3B 2I8CA 4IRCA 1BHBA 1KBLA 5KFKA 3KALA 4MTOA 4O2BA 1KU9A 3CHXA 2GTAA 4JYAH 4IWYA 2YXYA 3HXLA 2R8JA 2Y0PA 4EEYA 4MV7A 3RYFA 1XMOO 1AI5A 2Q8VA 2C00A 2DZDA 5FNVA 5D8DA 5HBRB 1IDSA 1SC5B 5FNVF 1L2ZA 2OCCB 2X5RA 4B3MH 2DWCA 5KFLA 1ENVA 3AG4C 1LNQA 3WB2A 3K57A 3MWMA 3N2GA 2WDTA 4BW5A 1U96A 1MZBA 1EKFA 3KHRA 3J81W 1R9TA 2W6IG 1Y74A 2WAQE 5DGBA 4TQSA 3DXRA 3KG2A 5KMGA 5C44G 3FB7C 4D7TA 4MA0A 2VUGA 5EZYB 4TV8F 3T9CA 2LJ2A 4DV2B 4QWEA 3CC7V 2E75B 4B3RO 2W9BB 1NR1A 4MV3A 4LR3A 2CW7A 4ED3A 4MVMA 5LL6Y 1WN7A 3SGIA 2JS5A 1M57B 4WD3A 1I6UA 2AW9A 4HYOA 2BSKB 1NS1A 2O03A 4J9SA 2E2HA 1IXBA 2YIBA 1KQSU 2YYAA 3AK2A 3PW5A 4DV5B 1I0HA 3HOVG 3RF2A 2A3QA 4DAAA 1E4EA 2HVQA 4O84A 4DQNA 4DL4A 1S9FA 3KTMA 1X4TA 1PKXA 5BMVB 1YVWA 1JCHA 4I4TB 1FXKA 5CE8A 3APOA 2FLNA 5KFWA 3FKSG 1IYEA 3CX5F 4YIPA 2XHBA 4QNHB 4EGJA 1WPBA 2QF7A 1HW7A 5KHIA 1K9MW 5LP6C 3HPLC 4J9NA 3JD2A 1WP7A 1TWFA 1OWTA 3TQ1A 5BWRA 3JALB 1XREA 4EQ5A 3HOYG 2B63A 2DAAA 2K9PA 4L1KA 5C8YA 4ZOLA 1H8HG 3ZHUA 4JTAB 4O2AA 3OTOB 5GTHZ 2QR4A 4PDVA 5D1OA 2Q7DA 4JI8H 2ODMA 1YJWV 2E76B 5DG9A 5DG8A 3E22B 4QWAA 2Y0SA 4O7NA 3U9SA 4KHPO 3JYCA 4A2BA 1FS0G 1S76D 4DL6A 1ULZA 5LYJF 1Y1WA 2V7QG 4DV2O 4JYBA 2ZCEA 1ZQ7A 3OUZA 1HNWB 4RNOA 2R7NA 4LSXA 3G6XA 1JLLB 1GN2A 4FLWA 1IXMA 2Z0AA 1L1FA 2KG7A 2R84A 4DV4B 1OJHA 4O4IF 3JZFA 2HVSA 5ITZB 1Q6IA 3Q1KA 1Q43A 1IBMB 4ECSA 2UXBB 2P4KA 3GVMA 4LFAB 2OLSA 4BWSC 2YU9A 3W7SA 4X64B 2AZ0A 3IJ4A 3U0ZA 5DGHA 2WLLB 4IIJB 2AGOA 3K79A 5LP6A 4JI8O 2Y69C 3TY5A 4JI4B 1N34O 3JD4A 1HNXH 2ILMA 3TW7A 1K83A 1BGYH 1FD9A 2PVPA 1FXKC 4LH7A 5HNEA 5GTIZ 4GKKO 1VQMV 4AI8A 4F6EA 3HOUG 4X66B 2CNQA 1G6UA 2XUMA 5LXTB 4HR7A 3E86A 3W5OA 1MZEA 3G67A 3ZRWA 1VQ8V 4JI7B 2B5UA 2DQ0A 4B3SB 2WAMA 2W8LA 3W7UA 1P4RA 5KFSA 2Q0AA 1EKPA 2BQUA 2DIKA 5JQGF 2YC0A 4TUYF 4FM1A 4DR4H 4EB6B 1KECA 2UUBO 1I1LA 4KUMA 2R9IA 4N21A 2A1HA 2XC9A 2AGPA 4QW8A 1N32O 3HO8A 3N2KA 3OW2U 2FE3A 3ASNB 1B04A 1FXHA 1H2SB 3Q4HB 2IM9A 4MS2A 2PYLA 4DL5A 1FVIA 2W71A 1ZHQA 3B40A 3OEHG 5BZBA 1H2NA 5JCOA 3X2QB 3I56V 3FAVB 3Q4HA 4Q44A 2YW2A 1K7DA 4X20A 2F93B 4X65H 3UZOA 2R92A 4H44B 2DABA 4EB6A 1SYXB 2GDSA 5KHKA 4PELA 3CRQA 2DPJA 4CH4A 1R3JC 1ROPA 1QU7A 4JI0H 5CBFA 1XMOH 1RYSA 2JA7A 5IJ0A 4LF8B 1AB3A 2R72A 4IHJF 4ZHQF 3MR3A 5FPRA 2XAHA 4JI1B 4K0KO 4RAIA 4F4ZA 1G1XB 2CDYA 2H8PC 5EWFA 1VQ4V 4DV6O 4LFBB 2QA4V 3A2FA 3DTUB 2OYQA 4DRFA 3WG7B 1IBKO 4NZMA 1I3QA 1H8EG 4JXUA 2IU3A 3J80N 4DUZO 1OCCB 4ZQIA 1IX9A 1AROP 3SPHA 5ITZA 1CXZB 3ZMTA 3CSWA 2LGWA 4NZOA 3KHGA 4XZ3B 4G2KA 2YXLA 2R6FA 5FLXN 1ZAUA 2E3CA 2N74A 3CEBA 5E25A 3JAMN 2IMWP 4I0XA 3OUSA 2HKOA 1QCEA 3OSNA 3RAXA 4D6TH 3E22A 2HVKC 1NVPB 1V55B 4EBDA 2JJ2G 2DWDC 2HJDA 5LHGA 5T14A 3F5WC 4I9QA 3FDSA 3M9OB 3G8DA 5KA6A 2PMZE 1KP3A 4LF4B 3HKCA 5C8YB 4M7EA 4CE5A 4BIUA 4PA7A 3MR5A 3HB3B 3ABLC 3CRMA 2FPPB 4DR5O 1YCIA 1IBLH 4LFCB 2HIVA 4QJFA 4I50F 1V51A 2VA3A 4EBCA 1H2GA 4JI0B 1SETA 3C3TA 3SPIA 5BMVA 2ZQMA 1TUBB 1VBGA 4PZ8A 4UVAA 1E4EB 1QLEB 4LP8A 1AP5A 4TV9F 1DGSA 4UCUA 3JZ6A 5KG4A 4ECQA 2FTKA 2ABJA 1G8MA 3L2PA 4DW0A 4FLUA 4UCSA 2NLJC 1S0VA 4YAJB 2ZDGA 2JA8G 2V1DA 2Y0IA 4B3RB 3ZS8C 3TETA 4O2AF 4FS2A 3TXSA 1MG1A 2ARHA 2XTAA 3ASOB 2ZINA 2GUZA 3P3PA 4DV7B 3Q8PB 3K5LA 1SQFA 2M6YA 2YRXA 5B3SC 2VRZA 4JYYA 1KT8A 3AX6A 4CMFA 4O3SA 2YIAA 4YJ3F 2BOBC 5KFGA 2K1EA 3P30A 5HV6A 2IBZH 3BACA 3RR5A 2ZM6O 2YIDA 3WWJA 4J9MA 4U3FH 4O4JB 3GIDA 1SEIA 5KMGB 5CMUA 4DUYO 1KJ9A 1Y74B 5JH7A 3M8AA 1S5JA 2BTQB 2R7ZA 4DUYH 4FLTA 5EC2C 3N2GB 3LWBA 3AYHB 4K8ZA 3OT7A 3ORQA 5DQIA 1KC8W 2C2EA 4DR4B 1ZLZA 2JIZG 5FNVB 4JZ2A 1R6NA 2VQEO 3V6KA 1YJNV 5K2MA 2Q68A 2ZXWB 1UC8A 2ADPA 2KKWA 5EBMC 3K3VA 3JARB 4X88A 5IY5B 2R92G 4P2ZA 4B3MO 5AG2A 3H1IH 4Z2WA 4QIWA 4J9ZB 3RIZA 4A3MG 1Q8IA 2WSSG 4JTDB 1SA0A 3DC5A 4GYCB 1F4MA 2CTRA 4DV1B 2PY5A 3U0GA 2FLPA 4IRDA 2FB5A 2X6BA 1VAJA 4FZ0A 1R3KC 1VQOV 1CKNB 3OTOO 3GJXB 4JAAA 2CZGA 3QFFA 2C2DA 2W0XA 3K3PA 3TIIA 1GSOA 3K04A 1FAFA 2UUCH 3LSSA 2E5LO 4A3LG 1OHHG 2A79B 5CA3A 2WLHA 4A3CG 1N33B 1SZXA 4HZ3A 1CE8A 4DV4H 1YXBA 2JA6G 1M90W 3QVNA 4ED6A 2XGQA 2Q4PA 1DV2A 1L0LH 2HHFA 3GIPA 5BXZA 2WB1E 1PK8A 2CNVA 3H9VA 3GTQA 2A7WA 1XNQH 4YJ2B 2YS8A 3GIJA 2MK3A 5LOVB 4PD4F 2UUAO 1QR8A 5GONA 2ZD9A 5LMUO 4DL2A 3BQ0A 2FK1A 2C28A 4P9PA 1NQTA 1RM1C 4X89A 1OCZB 5IJ9A 4DV5H 3J7AK 1WB7A 3ASOC 4O4LB 3V4SA 4KHPH 2JEUA 3R5XA 5DG7A 3SYOA 3IC9A 4UVCA 1R1BA 2ASJA 1UJWB 2VQEB 2QK4A 5I47A 5C93A 2ZGIA 3SYAA 4MTXA 1SERA 4KFMA 3CEIA 3FD9A 2CQYA 3QZ7A 2FMLA 3KYHC 5I5UA 3MFHA 2SCUB 1I5YA 5J2UA 4CKBA 4UVBA 3W1GA 4NVPA 5L3EA 4O2BF 4GUNA 1HNWH 4W4LA 1WA8A 3CCJV 1Q5OA 3GLKA 1K1SA 1EM1A 4JZGA 4RCNA 1M1KW 3WO0A 3TGUH 2R8KA 4L87A 2WLMA 4BR6A 4PA4A 1FJGO 3RVZA 2HVRA 1QHTA 1K92A 1KEEA 3SJQC 4X1IA 1GAXA 1HNZH 5CR5A 2ZDIA 3HKZE 3V4ZA 3LSQA 2P67A 3I5DA 3FYIB 4FGRA 1AVMA 3AG3B 3THOA 4B7KA 2W9CA 4B7EA 2Z02A 5BPHA 2A0LA 4FFBB 1F7YA 3E5NA 3MFIA 1QR9A 1HNZB 3GIMA 5BWXA 3RB4A 5JQGA 3A0RA 4B3TH 3H40A 1XILA 3S3XA 5L3FA 1CEZA 5CA1A 5I5VA 4RB0A 1S03G 4DRXA 3T99A 1KJ8A 3VPCA 3PW4A 1Z5VA 2FB9A 1Q3EA 2IH3C 3VNNA 1GO3E 2Y4UA 2N05A 2R9RB 2RQ6A 5FL7G 1P8LA 1SQGA 5LMUB 2QKCA 5IY5C 4FFPA 4FFMA 1IOWA 4F4YA 2HR3A 3CE2A 2ADQB 1EN4A 3IAYA 4R8UA 4F6RB 4U7NA 1M4UA 1PD3A 4NTWA 4LF7O 4YR2A 4I5SA 1JFFA 2R7LA 1P7GA 1BXRA 4X8AA 4IRKA 1GM9A 2CGNA 2NNUA 1AI7A 1HWYA 2P7TC 5JVDB 2E74B 5K1XA 1XNRO 1I50A 3OD4A 3K58A 3EHBB 4YIOA 3TY8A 3HOXG 1QVGU 3B77A 2NUAB 4R7CA 5BWWA 1M56C 5B1AB 4K35A 4ME6A 1JDBB 4TM5A 5LHHA 3E83A 2EIKB 5CM0A 3VBBA 2IH1C 1AJNA 4PDRA 5BWUA 3BG5A 1IBKH 2UVRA 1BS3A 1I7FA 3RGXA 4HNUA 4GZRB 2VQEH 4Q4CA 3G6YA 3ZMUA 4WCEV 2VWJA 5D5PA 3KREA 3BQ2A 4GX0A 1VF6A 3BA9A 4PJ0Z 3JD1A 5CB4A 1V55C 3APQA 2WB1A 5D5QA 5KFHA 1R6TA 2R9AA 5C1PA 1X59A 2V9WA 4MV8A 3N44B 1I5XA 2GSMB 5L9XA 3GWOA 4MT8A 1XDCA 4YY3B 1VS0A 4DXWA 3K5MA 2QWQB 2Y48A 3JATB 1Q82W 4LH6A 3SJBC 3QNEA 5H6QA 4LFBO 3WO1A 1S0NA 3AG4B 1I2LA 2X0SA 1BMFG 3CP1A 1K3EA 2R7KA 4DR3H 4A3IG 4A3KG 3ICXA 5HFMA 3IC7A 1KUQA 4LC1A 1PV0A 3M9NB 3OFNG 1NTZH 1TVKA 1BL8A 3MR2A 1ZUQA 5JVDA 3CCSV 4O7VA 2EIMB 4TUYB 1VQKV 2VPSA 1WB8A 2W6MA 1JFFB 5KT4A 4AQYB 4CMDA 2R93G 2JDIG 5EK0A 3R5HA 3VQXA 3T1HB 2QTSA 2Q6AA 4LF5B 4PWQA 1B06A 1WR2A 1EN5A 5LMNO 1OBDA 4YHHH 2FKXA 3HOWG 2Z3YA 1EUCB 4Q45A 2NU9B 2ATKC 1U97A 3F8NA 4MA5A 1E1QG 4WBNB 3LMLA 1KBHA 3GIKA 1KP2A 3RYCA 4HQ6A 3L75H 5IYBO 4LFCH 1AJPA 2EILB 1K5SA 3FB6C 4J9OA 4NYKA 4MVQA 4FFBA 3CRCA 2W9CB 5J2TB 4JASA 2WWWA 2DYRB 4EFEA 1RSOB 3E8GA 3R9RA 1Z2GA 1WLEA 4JTCB 1RM1B 1V4YA 2X0LA 4WFFA 2HIXA 4DV3H 2ZKOA 5EWEA 1S68A 4ASUG 3T1YB 3R23A 5KFYA 1Y67A 5I60A 3WU2Z 3T1HO 3MR6A 4B3SO 1HR0O 1V9PA 4JI1O 4K0KB 3RYIB 3OEEG 2BE3A 1WA8B 4RUFA 2F4VB 3UFXB 2JGUA 4I55A 1MSWD 4O4HB 1SCUB 5FD5A 3RBEA 2C35B 4HYKA 2CTPA 4O7YA 2UVWA 1DV1A 4IAJA 2UVUA 2IBKA 2UXCH 5KG6A 3R66A 4CZZA 4O4LA 3OMAB 4LF9O 1LUWA 4A3GG 2L6LA 4NTXA 4QIWF 1AN7A 4JV5H 4PZ7A 1HR0H 4LF9H 4M0JA 2W70A 2WA4A 3D3QA 2JK5C 1VF6C 3HKEA 5BR8H 2VWKA 5LOVA 2D3OW 1F23A 4Y8VB 4YJ2F 2P06A 3ZHQA 1HNXO 2G38A 1E4FT 3GDEA 3CC2V 3Q2OA 1XMQB 3J7AU 4Q20A 2JEJA 3CRRA 4MTEA 2GQSA 2HHFB 3TIGA 3JAMW 2R87A 3G8CA 2QEXV 3OAAG 5LHIA 1NI8A 4KXRA 2EINB 4K0KH 3SR2C 1YHQV 3EYYA 2XD4A 2N04A 4Q43A 4GLXA 2RGVA 1OCOC 3B09A 3ETEA 2HJFC 4WFAV 3JSNA 3OUFA 4QGPA 4DR2O 2OWOA 2AHZA 4MW8A 1CKNA 3TW6A 1AI6A 2PF4E 4DR3O 4RB1A 3LUTB 3GV7B 2DPIA 4X65O 4PBCA 5H5NA 1AUVA 1H2LA 5H2FZ 3SPCA 5KG3A 2Q69A 1EFRG 3EFFK 1BSMA 2EIKC 3WB0A 3N6XA 3CB2A 1GN4A 5FPOA 1GO3F 3UKMA 2UVVA 4XDKA 2CNUA 2D2CB 1M9NA 1KYOF 1Z2NX 4JI2B 2RF4A 4LFBH 3DAAA 3ETHA 5KFZA 4CH3A 2ZNJA 5JH7B 5LL6b 1TWGA 3RGZA 2PN1A 5KFAA 3AG1B 2R7MA 1GN6A 2CAZC 3K0DA 3F7YC 1N0JA 2FK2A 4QWBA 3KCXA 4JAVA 1XMOB 1AUXA 5DQHA 5KX5A 4DV0O 1MSDA 4CBCA 4GKJH 4LF8O 2GQRA 5L1KA 4G28B 4EG0A 3E8HA 1M7JA 2UXBO 2IP4A 2LQTA 3VQVA 2ETNA 3ZN1A 3JAKA 5CN0A 3CMEV 4DR6O 2COIA 1V54C 2YS7A 1A9XA 4OPAA 3T9AA 2C2AA 4A3EG 1DAAA 2YZGA 2JEFA 2WLNA 1PX2A 4J7ZA 1N34B 4JV1A 5IYDO 4EEQA 5KT7A 4TV8A 3M9MB 2RNBA 4FJCC 4X66H 2W6JG 5IP9G 3GIQA 3RJ0A 1A3GA 1N0NA 5CA1F 5E79Z 3OHBA 3H3VH 4LNUB 3Q8QB 2MW2B 1RJRA 2YIBD 3CJHB 3H0GG 1KUTA 4LNUA 1TWHA 4BIOA 5JJJB 2Q9LA 1Q7YW 3FKIA 1GMGA 3OR7C 1NJIW 3TY9A 3N27A 4N23A 1LUVA 2BOCC 4RUCA 4O7WA 4H37A 3PN1A 1OCRB 5EC1C 3ZRVA 4MW3A 2PYJA 3U55A 4RO2A 2FPIB 4JI5B 3W7WA 1KKDA 2YRWA 3BY6A 1G4YB 2UU9H 2W6PA 2ZM6H 1M0WA 4UCRA 3HKCB 3UO3A 2V59A 4WHXA 4NXMH 2F4VO 4A3JG 1K33A 5EOYA 5FD6A 4NB5A 5B1NA 4F4LA 4JF3A 5IP7G 5DECA 1SS3A 2GHYA 2WLIB 1J95A 3HOZG 4YR0A 3RFCA 3AG2B 4ZI7F 2CK3G 5BWTA 3ABMC 2EBOA 4LWSA 5DMXA 3OHAA 2YI8A 5IE9A 2ODTX 3A8TA 1GSAA 3QF7A 1EHIA 1PNLA 2XASA 1AR5A 3RGBA 1JQ0A 3H1HH 2QWRB 3RWRD 4WF9V 2ZE8A 3RB0A 1VP7A 2IJJA 4DYLA 3VA7A 1FXVA 2Q5ZA 1S0OA 3CC4V 5LMNH 1E4GT 1B6QA 4FVMA 1RPRA 3M7MX 4XDLA 2WYOA 3M4IA 1Y1VA 1IVSA 4NR1A 1D2DA 3RFRA 2DLNA 2ZE7A 3R5FA 1GK9A 4J0MA 2HFEC 1M5IA 2DWEC 4GKJB 3H4DA 1PM9A 1OV9A 4ECYA 4DR1H 3TK1A 2RMKB 4GCZA 3IN5A 4DV6B 2UUCO 3T5LA 1DK1A 4CHIA 5LA6F 3C3SA 3UQ8A 4LF5O 5LA6A 5IJ0B 1AJQA 4UB8Z 3ZHSA 1KMIZ 4XYLB 2V5AA 5IYDG 5DGAA 4PV1B 3ZHTA 2ZM6B 1VQLV 3PZPA 1N4CA 1KKCA 4DV1H 3UYYA 5A9GA 4IL6Z 3T1YO 1COWG 2YWVA 1SQVH 3P32A 2NVXA 3K0GA 1JDEA 1NZ6A 2Q73A 3GTLA 3HKEB 2ASDA 4NZNA 2DYRC 3IFXA 4I7HA 3PJSK 4DR1O 1T5EA 2QWOB 1MZFA 3RUPA 3ZBHA 4JI6O 1ET0A 2QGNA 3CMAV 5CAEB 4DV4O 4O3OA 2YZNA 3NC0B 3ZHRA 2JGDA 4JV2A 4J9RA 5JVLA 4C5CA 3K59A 1RJPA 2OCHA 4ZI7B 2WPDG 4HAMA 1XHXA 1KJIA 4ZBMA 2W6NA 4ZI7A 4IGGA 5FLMG 3CQZA 1L8DA 4KHPB 3JAWA 1R6KA 3ZRXA 3STLC 1VQ9V 2QM8A 1W93A 4E6NA 3GTOA 5KT6A 3D3IA 3DSQA 4O4HA 1VQPV 4CS4A 4ZOLF 3PVXA 2A9HA 4GKKB 3T5HA 2LGQA 4FFKA 3OUUA 2WLLA 3SYCA 5KHJA 3AG3C 4F4WA 2FYUH 3K5HA 2QYZA 1N34H 3KKYA 4DR6B 2V4QA 2FLLA 1OCZC 3CCEV 4DR2B 5DLGA 2ZIMA 1Q86W 2RDIA 5L3DA 2F43G 2KG7B 2AGQA 2UUCB 2E5LB 2EJ2A 4J10A 5J2TA 2JEGA 4PDBA 1XUQA 4AILC 2UXNA 1SQQH 5LA6B 3H1LH 3RYCB 2YUAA 2XAQA 1XHZA 1WCMG 1A0GA 5D1OB 4NTYA 3JSLA 5JQWA 1ZSPA 4I9WA 2BTOA 4A5UB 4CH6A 4ZOLB 5BYAA 1P49A 1VARA 4BBRG 4X62H 3T9EA 5KT5A 4PZ6A 2ZE5A 4R8CA 2W9AA 1Y1WG 3JALA 2YSUB 3PW7A 3T4ZA 4JI5H 4L8JA 4O82A 3QO8A 1JJ2U 1Q6HA 2F1MA 3WWIA 4O83A 5LGUA 2FL4A 3O65A 4D7SA 2Y69B 3MDSA 1SZTA 1Y76A 2VQFO 1M56B 5B1AC 4IYIA 3N40P 2FK3A 1FXKB 2Q2UA 1C30A 1YDXA 4WBNF 1NTKH 3SI8A 2XGPA 2PBZA 5F9NA 4TUYA 3CCRV 3D36A 4IHJA 4ZHQA 4EYIB 1TVKB 3H1JH 3B8NA 5KFCA 1I1MA 4U6PA 1FKAO 1XL4A 2W7OA 1QLNA 1A48A 2WTFA 4LWSB 3J81N 1XDNA 3JCUZ 1UC9A 5D1PA 3VPDA 1Y6XA 4YR3A 4B3RH 3MAQA 2DJVA 1PPJH 5BR8B 1K1QA 1WCMA 2RJZA 4W4KA 3L4KA 5EBLC 4IR9A 4PDLA 4ECUA 2PGGA 1TWCA 3RVYA 3T5JA 5L3CA 1XMQH 1PNMA 1IZ3A 4C5AA 2B9ZA 4GC7A 2V4RA 4Q8EA 2NU7B 4FE2A 3JD0A 5EZYA 3MWDA 2EJ0A 2CFMA 3BPZA 1AP6A 3NBZB 4O7ZA 1N32H 3G6EV 3S3WA 3HKZA 3CCUV 3LNMB 2EINC 1EKVA 4FMTA 2P90A 4MVRA 1RYRA 1QQCA 2P6JA 2DMXA 1YJ9V 3I4MG 1GM8A 2QKSA 3JRXA 3LULA 4U7OA 4APMA 5I5TA 4OPHA 4O2BB 1K5QA 3AG7A 1PL0A 3T54A 1N56A 1IBMO 3PR4A 4A3BG 3K08A 4X64O 1R73A 1B6RA 2VA2A 4FLYA 2OT5A 3FMAA 4MTDA 3HKBB 1RJQA 2P4VA 1ZETA 3L4JA 1EZJA 1TUEB 2PI4A 2CGOA 1X9NA 2CKZB 1JR9A 4DUZH 2RCVA 2XCLA 1DIKA 2M7WA 4X62B 2C22A 4EYHB 1MMMA 3N6RA 3BHPA 3GTMA 4C5BA 5LOVF 1KC7A 3LDCA 4RUEA 4WFBV 1SRYA 4PDMA 2HGSA 3T2MA 3T1HH 1OBGA 5DEDA 4DR2H 1KB9F 4AQYH 2F95B 4MV1A 4TVIA 2YICA 1HR0B 2JJ1G 4RNMA 3RAQA 1IURA 1FJGH 4UFZA 2YS6A 3CXHF 1M0TA 3A0BZ 5IYCG 4FFRA 3QTCA 5IYBG 3T4DA 3HKDB 3DGEA 3ZRSA 4LCUC 2Q67A 4PI0A 3ABTA 4Z1VA 2YZLA 2OCCC 4LF6O 4O4IB 4JI8B 4ECZA 4LF8H 3RTXA 3RV3A 5J9PC 2PMZA 5KG7A 4DV1O 2WA3A 2OTLV 3L9DA 2ZIOA 3TQTA 1SF9A 1JX4A 4G27B 1J5EO 4R50A 1IOVA 5IJ9B 4TWKA 1CPYA 3CSXA 3LDDA 3CPWU 1VQNV 4DLKA 5BMVF 3H20A 2R8IA 2VUMG 2FKLA 3F5TA 1GYFA 2VR1A 4JV5O 2P5OA 2ATLA 4GLWA 4YY3H 4JPRA 4DR7O 2AQ4A 1K34A 5KHGA 3VOUA 3L74H 1JPXA 2PI5A 3DC6A 1I7LA 2UUBB 4YJ2A 4QWDA 2XCPA 3ABUA 2ASLA 4GX1A 4ECTA 3K5IA 2HHHB 2Z04A 1Y4MA 2EJ3A 2RDJA
chains in the Genus database with same CATH topology
1O9HA 4Q6GA 5KHKA 3JAMW 5JCOC 4CH4A 4DV2H 1I94B 4JI0H 1XMOH 4K0KH 4X1KA 5IJ0A 3SR2C 4DR5B 4LF8B 4X64H 3EYYA 4FM2A 2R72A 4TOIA 4GLXA 2RGVA 5FPRA 5LMNB 4JI1B 2JVDA 3HKDA 3BABA 3JSNA 1TGOA 3KXYT 2VQFB 4I55B 2OWOA 4A2AA 4LFBB 3A2FA 2OYQA 1CKNA 4YHHB 4DRFA 4HNAB 4YJ3A 4RB1A 4DR7H 4IIJA 3RYIA 5JJEB 4LF5H 4JI6H 4JYAB 4JI3B 4DR6H 5ITZA 5K1PA 4K8XA 4DR5H 3ETQA 3UT5A 4JI2H 2YXLA 3WB0A 3N6XA 3CB2A 4ETSA 1ZAUA 2E3CA 4AHCA 1RSOA 5FPOA 4B3MB 4U3JA 5IYZA 2UUAB 4NXNH 2YI9A 1JJOA 1Z2NX 4JI2B 4LFBH 4PHZA 3BRCA 5IWAB 4OX9B 4CH3A 2ZNJA 5JH7B 3E22A 5LL6b 1JMKC 3RGZA 4B3TB 4JI6B 4I9QA 4WBNA 3OTOH 2CAZC 4O2AB 4LF4B 3HKCA 2WE6A 5C8YB 1XMOB 4M7EA 1ZHSA 5KX5A 4GKJH 4LF6B 2UU9B 4KL1A 1NT2B 4DV0H 4BWAA 4DUYB 3VQVA 1M93A 3JAKA 1IBLH 1Z2OX 4LFCB 2HIVA 1TAEA 4UCVA 1N34B 4UCTA 4EEQA 4TV8A 4JI0B 4EFBA 4X66H 5BMVA 1TUBB 4PZ8A 3RJ0A 4LNUB 4DR7B 4FM9A 2YIBD 1DGSA 4UCUA 3L2PA 4LNUA 3OTFA 5JJJB 4FLUA 3VQWA 1TUBA 4UCSA 1N33H 1J5EB 3TY9A 3JATA 5KHHA 4DK1A 3WB1A 2QJ1A 4B3RB 3ZS8C 3PN1A 4MV9A 2PYJA 4LF9B 2ZINA 4RB2C 4CS2A 4DV7B 4FLVA 3K5LA 1SQFA 4JI5B 5CB4B 1WH2A 2YIAA 1FJGB 3N42B 3QG5A 4RZQA 2UU9H 2ZM6H 2HEPA 2UXCB 4UCRA 3HKCB 1M0WA 4NXMH 2UUBH 3RR5A 4LF4H 1TA8A 5EOYA 5FD6A 4O4JB 2V4DA 1SEIA 5KMGB 1XNQB 2R70A 2UXDB 2YCHA 2QM4A 5JH7A 1S5JA 2BTQB 3FFQA 4DUYH 4FLTA 2YI8A 3N2GB 4K8ZA 4LF7B 3QF7A 3K5NA 4DR4B 4U3JB 5IYZB 5FNVB 2VQFH 4IHJB 3RGBA 4ZHQB 3N41B 3RWRD 3RYFB 3DF7A 2KKWA 3UT5B 5LMNH 1O9GA 3JARB 3K3VA 1E4GT 2P22C 4FVMA 4F6RA 3M7MX 2WYOA 3RIZA 1BJTA 1Q8IA 1CKOA 3M4IA 1SA0A 4GYCB 4DV1B 2PY5A 4YJ3B 3RFRA 3J80W 5EIBD 4HNAA 2F4VH 1CKNB 4DUZB 4J0MA 3GJXB 1M5IA 4GKJB 2HHHH 4I50B 4TQFA 1BGWA 2UUCH 4DR1H 2KSWA 2MCTA 3ZEDA 4DRXB 4DV6B 3JASB 5CA1B 2ZNIA 3UQ8A 5LA6A 5IJ0B 4X1KB 1N33B 1KMIZ 5JQGB 4DV4H 2ZM6B 5FLXW 3GB8B 4DV1H 2W57A 5CA0A 4X1IB 1N36B 4Q0YA 3RYHB 1XNQH 2PTMA 3QWUA 4YJ2B 1XQ8A 3BAAA 2F66C 5LOVB 3KAJA 3HKEB 5GONA 4I7HA 1N36H 1T5EA 4CC5A 2Q2TA 3KAKA 4R7RA 3U11A 4CS3A 5EYPA 5J2UB 4JV5B 5IJ9A 2E5LH 4DV7H 4DV5H 4CC6A 3S24A 3J7AK 4O4LB 1N32B 3NC0B 4KHPH 5JJNB 4CH5A 3JAWB 1A0IA 4TV9A 1Z5WA 3K59A 1SKVA 4ZI7B 3SJCC 2VQEB 4O4IA 1XHXA 3W1BA 4ZI7A 4TV9B 1L8DA 5LXTA 4KHPB 3JAWA 4E6NA 3NBYB 4DK0A 3DSQA 4O4HA 1IBLB 3KYHC 1FFXA 1WNSA 4CS4A 5J2UA 3BA8A 3W1GA 1HNWH 4NVPA 2Q7GA 4GKKB 1Q5OA 5LP6B 4X65B 1XI1A 3IG0A 1Z2PX 5KHJA 1IBKB 2XIGA 5GONB 1P16A 1N34H 4DR6B 4X1YB 4DR2B 2UXBH 2HVRA 2ZIMA 4ZIBA 1QHTA 5IT9W 4X1IA 3U10A 1HNZH 2UUCB 3C0FB 2E5LB 2ZJTA 5J2TA 3THOA 4FLZA 4PDBA 4FFBB 1HNZB 4AILC 5JQGA 4LMYA 4B3TH 5LA6B 4JI7H 2UXDH 5A2QW 3RYCB 4RB0A 5CA1A 1XHZA 3T1YH 1S03G 3JASA 4DRXA 5D1OB 3JSLA 1Z5VA 3HKBA 1Q3EA 3VNNA 5DISC 4JI3H 2BTOA 4CH6A 4I50A 4ZOLB 2RQ6A 1P8LA 1P49A 1SQGA 4GKKH 4X62H 5LMUB 4PZ6A 4RB3C 4FLXA 4BW9A 1D5AA 3JALA 4PI2A 1SA0B 1VF7A 4JI5H 4L8JA 4DR3B 3IAYA 4LF7H 2F1MA 3KALA 4F6RB 4O2BA 4D7SA 1KU9A 1M4UA 3JARA 3CHXA 4JYAH 1JFFA 3N40P 4I4TA 2Q2UA 3HXLA 4MV7A 3RYFA 4TUYA 4IHJA 4ZHQA 5JVDB 1FKAH 5FNVA 1TVKB 5K1XA 1L2ZA 5LYJA 3K58A 4B3MH 3WB2A 3K57A 3TY8A 3MWMA 3N2GA 2WDTA 2BTQA 1MZBA 2PZSA 3J81W 4JI1H 1XDNA 5D1PA 4HBNA 5KMGA 4O4JA 4D7TA 2VUGA 5EZYB 4B3RH 2GV9A 1IBKH 1I7FA 3MAQA 3RGXA 4DV2B 5BR8B 2VQEH 2RJZA 2VOBA 2VWJA 5D5PA 3L4KA 3BA9A 4LR3A 2PGGA 5CB4A 2Q7HA 2CW7A 1XMQH 3VQYA 5D5QA 2R9AA 3N44B 1WN7A 3SGIA 2JS5A 1VS0A 4YY3B 1I6UA 4B3SH 1J5EH 5EZYA 3K5MA 2O03A 3JATB 2CFMA 4LH6A 3SJBC 2YIBA 3BPZA 3NBZB 1N32H 1I94H 4DV3B 4DV5B 4DR3H 1YEWA 3ICXA 4RAYA 3LNNA 5LYJB 3RF2A 4RAZA 1TVKA 4UCOA 2HVQA 1QQCA 5JVDA 4JI4H 1X4TA 4TUYB 2VPSA 5BMVB 4I4TB 4B08A 4TV8B 1JFFB 4AQYB 2XHBA 4APMA 1IBMH 1WPBA 1HW7A 3VQXA 5KHIA 3T1HB 4O2BB 5LP6C 4LF5B 1XNRB 3JAKB 4DV0B 3K5OA 3JALB 4EQ5A 4YHHH 3SJAC 2UUAH 5KX5B 4FLYA 5C8YA 5LMUH 4ZOLA 3FMAA 4O2AA 4LSAA 3OTOB 3F8NA 4MTDA 3HKBB 4WBNB 3LMLA 4DV6H 5D1OA 4JI8H 2Q7EA 3L4JA 3RYCA 3E22B 4OX9H 4LFCH 1X9NA 4A2BA 4NXNB 4DUZH 4FFBA 4X62B 2ZCEA 5J2TB 4EFEA 1HNWB 4LSXA 4LF6H 3BHPA 1CKMA 4FLWA 2HIXA 4DV3H 4FM0A 4DV4B 1S68A 3T1YB 2HGSA 2HVSA 5ITZB 3T1HH 1Q43A 4X1YA 1IBMB 2UXBB 4DR2H 4LFAB 4BWSC 4AQYH 2F95B 4DR1B 2RGRA 4X64B 1V9PA 3U0ZA 4K0KB 4IIJB 3RYIB 5LP6A 1HR0B 3TY5A 4JI4B 1HNXH 2F4VB 2JGUA 1FJGH 4I55A 2CW8A 4UFZA 1FFXB 4TQDA 1M0TA 1XK5A 4O4HB 4LH7A 5EIBC 5FD5A 3QTCA 3HKDB 4X66B 1G6UA 5LXTB 4PI0A 3CVZA 4LF8H 4IAJA 4O4IB 4JI8B 3W5OA 3RTXA 4JI7B 2UXCH 4B3SB 2PUSA 2Q0AA 2ZIOA 4O4LA 4FM1A 5IJ9B 4EB6B 1HNXB 4DR4H 3CSXA 2EX3A 5EYPB 1AN7A 4PZ7A 3H20A 1HR0H 4JV5H 4LF9H 1GYFA 3N2KA 4X20B 2FE3A 4MTEA 1XNRH 1B04A 1H2SB 2IM9A 2PYLA 2P5OA 1FVIA 1ZHQA 4LFAH 4YY3H 3HKEA 5BR8H 2VWKA 5KHGA 5JCOA 5LOVA 2UUBB 4YJ2A 4NXMB 3GDEA 3RYHA 3N2KB 4X20A 1E4FT 1O75A 3N43B 2F93B 3B2EE 5CA0B 1XMQB 5IWAH 4X65H 2HHHB 4EB6A 1SYXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG B;  4GKK B;  4UCO A;  2HVQ A;  4X65 B;  2UXC B;  4UCR A;  1I94 B;  1IBK B;  1P16 A;  3RR5 A;  1TA8 A;  4LF8 B;  4DR5 B;  4AQY B;  4DR6 B;  4TOI A;  4GLX A;  5FPR A;  5LMN B;  4DR2 B;  4JI1 B;  1XNQ B;  2HVR A;  2UXD B;  3BAB A;  3T1H B;  3JSN A;  4LF5 B;  1XNR B;  4DV0 B;  2UUC B;  2VQF B;  4LF7 B;  2OWO A;  4LFB B;  2E5L B;  1CKN A;  4YHH B;  4DR4 B;  4EQ5 A;  4DRF A;  1HNZ B;  3OTO B;  4JYA B;  4JI3 B;  5D1O A;  5D1O B;  3JSL A;  3VNN A;  5DIS C;  1X9N A;  1CKO A;  1ZAU A;  4NXN B;  4DV1 B;  1P8L A;  4X62 B;  5LMU B;  5FPO A;  4PZ6 A;  4EFE A;  4B3M B;  1HNW B;  2UUA B;  1CKN B;  4DUZ B;  3GJX B;  4GKJ B;  4JI2 B;  1CKM A;  4DR3 B;  2HIX A;  5IWA B;  4OX9 B;  4DV4 B;  1S68 A;  3T1Y B;  2HVS A;  4DV6 B;  1IBM B;  4B3T B;  4JI6 B;  3UQ8 A;  2UXB B;  4LFA B;  1N33 B;  2Q2U A;  4DR1 B;  4X64 B;  1V9P A;  4LF4 B;  4K0K B;  1XMO B;  1HR0 B;  4LF6 B;  3TY5 A;  2ZM6 B;  4JI4 B;  2UU9 B;  2F4V B;  4DUY B;  3TY8 A;  4UFZ A;  3GB8 B;  1XK5 A;  4LH7 A;  1N36 B;  1XDN A;  3QWU A;  5D1P A;  4LFC B;  2HIV A;  4X66 B;  1TAE A;  3BAA A;  4UCV A;  1N34 B;  4UCT A;  4EEQ A;  4JI8 B;  2VUG A;  3W5O A;  3RTX A;  4JI0 B;  4EFB A;  4JI7 B;  4DV2 B;  5BR8 B;  4B3S B;  4PZ8 A;  4CC5 A;  2Q2T A;  4DR7 B;  1DGS A;  3BA9 A;  4UCU A;  1HNX B;  4JV5 B;  4CC6 A;  3S24 A;  4PZ7 A;  3L2P A;  1N32 B;  3NC0 B;  1A0I A;  1B04 A;  3SGI A;  4UCS A;  1FVI A;  1J5E B;  3TY9 A;  1VS0 A;  4YY3 B;  2VQE B;  3W1B A;  4B3R B;  4LH6 A;  2CFM A;  3PN1 A;  2UUB B;  3NBZ B;  4KHP B;  4LF9 B;  4NXM B;  3GDE A;  4DV3 B;  4E6N A;  4DV5 B;  4DV7 B;  1XMQ B;  3NBY B;  1IBL B;  4JI5 B;  2HHH B;  3KYH C;  3BA8 A;  3W1G A; 
#chains in the Genus database with same CATH topology
 4Q6G A;  4JYA O;  1PNK A;  5JCO C;  1HNZ O;  3BFR A;  3RW0 A;  4J9P A;  4DR5 B;  4O4L F;  4X64 H;  4FM2 A;  2DE0 X;  2GBO A;  2LFS A;  4IWX A;  3HKD A;  3QZ8 A;  3I55 V;  1H2M A;  2XCA A;  2COJ A;  1I7N A;  1TGO A;  3V6J A;  2VQF B;  2W6O A;  4I55 B;  3HBL A;  4AQY O;  2LW1 A;  1CP9 A;  4YHH B;  4JUZ A;  2GLT A;  3TIN A;  4DR7 H;  3RYI A;  1SES A;  5L1J A;  4LF5 H;  1WJZ A;  2R93 A;  2EIL C;  5KLV H;  4JI6 H;  4FBU A;  3ZN0 A;  1FYJ A;  1T94 A;  1BQ0 A;  4DR6 H;  3ETQ A;  1YZB A;  1YI2 V;  3N8D A;  4ETS A;  4JAU A;  1BT8 A;  1GLV A;  4B3M B;  4O81 A;  4CKE A;  2YI9 A;  1JJO A;  5I5S A;  4H13 B;  4PHZ A;  3BRC A;  5KUK A;  5IWA B;  4OX9 B;  4FU0 A;  2CUG A;  3LDE A;  4HN2 A;  2IJK A;  1W0K G;  1VQ5 V;  1JMK C;  4BY7 G;  3GIL A;  4JYC A;  3STZ C;  1NKD A;  4A93 G;  1GTO A;  2GTS A;  4JI6 B;  1KD1 W;  4B3T B;  4WBN A;  3OTO H;  3RB6 A;  3H4B A;  4QIW E;  4F50 A;  3MJF A;  3QO5 A;  2CE4 A;  3RT3 C;  1ZHS A;  3NXS A;  5KFP A;  2ZDQ A;  4I7Z B;  2NN4 A;  4LF6 B;  1N33 O;  2UU9 B;  3GTG A;  4KL1 A;  4QE7 A;  4BWA A;  2FP4 B;  1Y14 B;  2HLD G;  5B1O A;  2GUZ B;  1TAE A;  4UCT A;  4HNT A;  2R7Z G;  4EFB A;  4NXM O;  1VBH A;  1CQI B;  1W0J G;  1BE3 H;  4UV8 A;  4MTF A;  1JX9 A;  2ZDH A;  3ASN C;  4DR7 B;  5KFR A;  1YTF B;  3MHS C;  5KUM A;  4PA9 A;  1N48 A;  4JI3 O;  5C5J A;  1TUB A;  4DL7 A;  5KAI Z;  3TXQ A;  5JUM A;  2H94 A;  2UXX A;  1E1R G;  4DK1 A;  3WB1 A;  4QPK A;  4XDJ A;  1BHA A;  4QJF B;  1PL4 A;  1K8A W;  3P3N A;  4MAM A;  3ABL B;  3QO7 A;  1H38 A;  4GT1 A;  4FLV A;  1MOF A;  2J6U A;  5CB4 B;  4TSF G;  3EVK A;  1I2K A;  3ABM B;  1WH2 A;  1OCO B;  3QG5 A;  4ZKI A;  4RZQ A;  2HEP A;  3K03 A;  1YIT V;  2J6S A;  4ED0 A;  2UUB H;  3LP8 A;  1TA8 A;  4YHH O;  1AR4 A;  3H1K H;  4J9K A;  4PA6 A;  1YIJ V;  1XNQ B;  2ZR2 A;  5B3S B;  5L1I A;  2WLK A;  4P9O A;  1C3O A;  3ETJ A;  3T9D A;  1TWA A;  4LFA O;  2M05 A;  2DYS B;  2COG A;  2EUL A;  3QQM A;  4I0X B;  4U3J B;  3BCC H;  5IYZ B;  5KFB A;  2W6Q A;  2VQF H;  4IHJ B;  4ZHQ B;  5FJ8 G;  2UXC O;  4ED7 A;  2QSA A;  3E8B A;  4AYB E;  2EIY A;  1Y1V G;  2B1I A;  1EN6 A;  1Y76 B;  2XAJ A;  1O9G A;  1IBL O;  3PW0 A;  1G2W A;  2P22 C;  4F6R A;  5CA0 F;  3L73 H;  5LGT A;  4RQE A;  4FFL A;  5EZY F;  3G6B A;  1BJT A;  1CKO A;  1WAZ A;  4YJ3 B;  2QB5 A;  4DIM A;  5EIB D;  2ZXW C;  4HNA A;  4DUZ B;  2EIJ B;  1NBM G;  2HHH H;  3RBZ A;  4TQF A;  1BGW A;  4IR1 A;  2MCT A;  3ZED A;  3I12 A;  4C7U A;  2AXT Z;  4YAK B;  4O3P A;  3CCQ V;  2XT9 A;  5JQG B;  3CS5 A;  3E2E A;  3SNO A;  5J2U F;  2JA5 G;  5KS8 A;  4B3T O;  1YTF D;  3OM3 B;  4MV4 A;  3FYE B;  1VKZ A;  2W57 A;  1RP3 B;  4RQF A;  3ZX6 A;  3ABK C;  4Q0Y A;  5GW7 A;  2PTM A;  3QWU A;  4RWU A;  3BAA A;  1I94 O;  1GGO A;  2AHY A;  3G4S V;  2F66 C;  3KAJ A;  3VOT A;  4EKW A;  2X7R B;  4DO2 A;  4BBS G;  3GTJ A;  1V54 B;  4R7R A;  3A0H Z;  3U11 A;  4U7C A;  4CS3 A;  2JS3 A;  3T7A A;  1R3I C;  4JV5 B;  4DV7 H;  2DW4 A;  4CC6 A;  3MWE A;  3RBD A;  1E79 G;  1N32 B;  4A3F G;  1L0N H;  4CH5 A;  2WAQ A;  3JAW B;  1SQX H;  1A0I A;  2AZ2 A;  3W7T A;  3ZRW B;  3DTG A;  2KSD A;  3PO2 G;  4DR4 O;  5LXT A;  1OZ0 A;  5I5Y A;  5LXT F;  4JI7 O;  3NR7 A;  1XEQ A;  2JGD B;  1M57 C;  5DM6 V;  1EUD B;  5DN6 G;  4DK0 A;  1IBL B;  3NBY B;  1JXL A;  1FFX A;  1THZ A;  3BA8 A;  2Q7G A;  3G80 A;  1KJQ A;  3T5K A;  4MV6 A;  5LP6 B;  4X65 B;  1XI1 A;  1BCC H;  3IG0 A;  1Z2P X;  3AK1 A;  1DF5 A;  2XIG A;  2B1G A;  3ML0 A;  1VQ7 V;  1P16 A;  5KT3 A;  4X1Y B;  2BCC H;  3K3W A;  5KFX A;  2EZP A;  4O86 A;  2OIG A;  3D36 C;  2EIM C;  3D8C A;  3U10 A;  1EZ1 A;  4KP4 A;  1WP8 A;  3CXC U;  5KFE A;  4FLZ A;  3CYO A;  3ZMS A;  2J9G A;  5BWV A;  5TIS Z;  5H6R A;  4JI7 H;  5CBH A;  5KG0 A;  4K3A A;  5A2Q W;  3T1Y H;  1QBZ A;  2R85 A;  2EIJ C;  2FJZ A;  1Q6U A;  4M9U A;  4E4T A;  4IZO A;  3HB9 A;  2LO1 A;  2Q0O C;  3U54 A;  3WNZ A;  5KG2 A;  2CTQ A;  4RB3 C;  4BW9 A;  1D5A A;  4PI2 A;  1SA0 B;  1VF7 A;  1URF A;  4LF7 H;  1NTM H;  4QW9 A;  4J7K A;  4O3Q A;  1BQZ A;  3JAR A;  4XX0 B;  5B66 Z;  4O3N A;  4O7S A;  4I4T A;  2LFR A;  2YDE A;  3BVO A;  2JA5 A;  3E35 A;  2GPW A;  3OGI B;  1FKA H;  4RNN A;  2KQX A;  1R3L C;  5L3B A;  5LYJ A;  4HNV A;  1WPX A;  1FFT B;  1QNM A;  3IGA C;  2EJR A;  3ZMZ A;  1GH6 A;  3TEK A;  4K6N A;  2BTQ A;  1ZTE A;  5J2T F;  2PZS A;  4JI1 H;  3UO2 A;  2WLI A;  1B6S A;  3RV4 A;  4ECV A;  4HBN A;  4O4J A;  3H01 A;  1EYZ A;  5FR9 A;  2HVJ C;  5HFL A;  2GV9 A;  4GX2 A;  4DV5 O;  3PW2 A;  4UB6 Z;  4E4E A;  4F4X A;  1UNN C;  2A06 H;  4BIZ A;  4JI5 O;  2VOB A;  1WSC A;  5LP6 F;  5EWG A;  1XOU A;  2Q7H A;  3VQY A;  4XBF A;  2W0F C;  4I4T F;  2W9B A;  5H80 A;  5C3E G;  2OTJ V;  3L70 H;  4O4H F;  4B3S H;  1J5E H;  4PA3 A;  1M6V A;  2P0A A;  2JA7 G;  4J7J A;  1KJJ A;  1MAB G;  1I94 H;  4DV3 B;  2R86 A;  3B4S A;  5CBG A;  1SQB H;  1YEW A;  3CJH A;  3PO3 G;  4FK5 C;  2ITC C;  5DAA A;  4BY1 G;  3UM7 A;  4RAY A;  1W59 A;  3LNN A;  5LYJ B;  4YBZ B;  2KB1 A;  4RAZ A;  1UPG A;  4UCO A;  5A2Q N;  1JA8 A;  5BYB A;  3KHH A;  4JI4 H;  3CWB H;  4J41 A;  4B08 A;  4JI4 O;  4TV8 B;  1DLB A;  4MVU A;  3BQ1 A;  3CD6 V;  3Q8S B;  4ECR A;  1IBM H;  3EPI A;  4YP3 A;  4MTG A;  1XNR B;  3OGC C;  5LBQ A;  3JAK B;  4DV0 B;  3K5O A;  5KFN A;  2FPG B;  3SJA C;  1K4C C;  2UUA H;  5KX5 B;  4YY3 O;  5LMU H;  2GPS A;  4LSA A;  4Q8F A;  4H33 A;  2Y4T A;  1JIH A;  3WFV A;  5KG1 A;  2QM7 A;  4DV6 H;  4BXX G;  2YL2 A;  2Q7E A;  2JA6 A;  2QE7 G;  3FB8 C;  1GM7 A;  2Y4R A;  2EZO A;  4FPP A;  1OCC C;  3JCZ A;  3B8M A;  3NUA A;  5KFM A;  5KFQ A;  5KX5 F;  4NXN B;  4YXW G;  2DN9 A;  5B1B B;  3PFF A;  3NGD A;  3L71 H;  2HJW A;  3GWK C;  2NR5 A;  2HDK A;  4JI0 O;  3C90 A;  1T3N A;  4LF6 H;  3ZCC A;  4CKC A;  1CKM A;  3ETD A;  2ITD C;  4FM0 A;  3BJY A;  4H0L B;  2AU0 A;  3ETG A;  3ZMV A;  1MA1 A;  4X1Y A;  1KTA A;  2LP7 A;  1W96 A;  4X9Q A;  4DR1 B;  3BEH A;  5DQG A;  5C1O A;  2RGR A;  3V6H A;  3RN4 A;  1Q81 W;  5KG5 A;  3OSP A;  3GV5 B;  1DTO A;  3OMI B;  2QDO A;  2XAG A;  2CW8 A;  1FFX B;  4TQD A;  1XK5 A;  1F51 A;  5EIB C;  5BPF A;  4UUJ C;  4A3D G;  4C2M A;  4LBE C;  4UXN A;  3UCS C;  5IWA O;  4OX9 O;  4WFE A;  1S77 D;  2R8H A;  2C2R A;  3CVZ A;  3OR6 C;  5EBW C;  5EDW A;  4IT5 A;  4TQR A;  3TCU A;  1XL6 A;  2DOS A;  1T36 A;  3R65 A;  2PUS A;  4QPJ A;  5I5X A;  2ZDI C;  2W6Z A;  4FZ1 A;  1HNX B;  2EX3 A;  5EYP B;  1OCR C;  2NU6 B;  4J42 A;  4X20 B;  1XNR H;  1AIL A;  1XBL A;  4UUG A;  3FAV A;  4LFA H;  3KCY A;  4X62 O;  3CCM V;  3AK3 A;  4QSH A;  3TJT A;  2CH7 B;  2HGX A;  3SPG A;  5KFI A;  4O7R A;  4P30 A;  2RDC A;  3VMM A;  3E89 A;  4IIJ F;  2E2I A;  3AEI A;  3LSU A;  4NXM B;  3RYH A;  3N2K B;  1O75 A;  3N43 B;  5IWA H;  2OH2 A;  3B2E E;  4OX9 H;  5CA0 B;  4MVZ A;  1MNG A;  1Q90 D;  1O9H A;  3AG2 C;  4QWC A;  4DV2 H;  1I94 B;  2VS0 A;  3OE7 G;  1EZV H;  2XAF A;  4X1K A;  4R6Z A;  3ORR A;  4TOI A;  5LMN B;  1P7B A;  2HG5 C;  2JVD A;  4EGQ A;  3BAB A;  1JOY A;  3CCL V;  4YB8 B;  3KXY T;  2J6T A;  4A2A A;  5K3W A;  1VEW A;  5IDJ A;  4HNA B;  5JH7 F;  2X6A A;  4YJ3 A;  4IIJ A;  3SPJ A;  5JJE B;  3MHH C;  3ZHV A;  1NU1 H;  5H9C A;  4JYA B;  4OXS A;  5IYC O;  1WRV A;  4JI3 B;  3FB5 C;  3JD3 A;  3K9A A;  3GV8 B;  5K1P A;  4K8X A;  1XMQ O;  5C8Y F;  4DR5 H;  3UT5 A;  2YEV B;  4JI2 H;  3SDL A;  4FIP C;  4O4J F;  2BR0 A;  3GQC A;  2X6C A;  4AHC A;  4Q4D A;  1RSO A;  2F23 A;  3Q8R B;  4U3J A;  5IYZ A;  2UUA B;  4NXN H;  3T9B A;  1US6 A;  1AR1 B;  3FKI G;  1QLE C;  4ECW A;  3K9S A;  2ZR3 A;  2VUM A;  4Z1M G;  4O7L A;  1B3Q A;  2W8K A;  2H3O A;  2BQR A;  1SFO A;  1I08 A;  1K73 W;  1I1K A;  4FFO A;  4O2A B;  1CS0 A;  4XYM B;  2WE6 A;  1UFI A;  4E2L A;  1JVM A;  3SE7 A;  1SQP H;  1QVF U;  1S3J A;  2QTO A;  1EBO A;  1RK6 A;  1NT2 B;  4J11 A;  3EPG A;  4DV0 H;  4DUY B;  2EJ7 A;  1M93 A;  3DTF A;  1Z2O X;  5E1A C;  4UCV A;  5KAF Z;  1GSH A;  1FPO A;  4FFN A;  4FM9 A;  4GC6 A;  4UV9 A;  4JGS A;  4RZR A;  1S5H C;  3OTF A;  5F9L A;  5KA5 A;  4J9L A;  3VQW A;  4GKJ O;  1N33 H;  1J5E B;  3T9F A;  3JAT A;  5KHH A;  2BSK A;  4YQW A;  2QJ1 A;  2I80 A;  3EXA A;  4ABM A;  4MV9 A;  2ALZ A;  1NR7 A;  5GON F;  4LF9 B;  3GII A;  4RB2 C;  1HDJ A;  4CS2 A;  1VIB A;  1P84 F;  2WLJ A;  1FJG B;  3N42 B;  4EBE A;  1ZX3 A;  1GKF A;  2UXC B;  2HGW A;  3SYP A;  2XOK G;  4FS1 A;  4J9Y B;  4LF4 H;  1ORQ C;  4FBT A;  2V4D A;  4OGQ B;  4LF4 O;  3DXR B;  5CB4 F;  5L1L A;  2R70 A;  2UXD B;  2YCH A;  2QM4 A;  3M99 B;  5B5E Z;  5KFO A;  4ED1 A;  1H2K A;  1K4D C;  2NVY A;  3FFQ A;  5JWP A;  4DV7 O;  3AW8 A;  3VPB A;  2R8G A;  4LF7 B;  3K5N A;  5I5W A;  3HT5 A;  5KFU A;  3N41 B;  3RYF B;  1ZWI C;  4QE9 A;  3DF7 A;  2QWN B;  2L35 A;  2YEV A;  3E8F A;  1RK5 A;  4BAY A;  1NH2 D;  5DGI A;  3UT5 B;  4J9Q A;  3SYQ A;  4NXN O;  3T1C A;  4JV0 A;  4DV3 O;  4MVO A;  4IYH A;  4R8U B;  1NH2 B;  5IT9 N;  1VMG A;  3J80 W;  4WFH A;  2FMA A;  5LGN A;  4RUA A;  2YZM A;  2F4V H;  2O57 A;  4I50 B;  1BZK A;  4LFC O;  5KFD A;  3GTK A;  1N36 O;  2KSW A;  3W7X A;  3G71 V;  4DRX B;  1DF4 A;  3JAS B;  2OIE A;  5C4X G;  4TT3 G;  5CA1 B;  1JKJ B;  4WFG A;  2ZNI A;  1S97 A;  4X1K B;  4O3R A;  4ECX A;  1YSC A;  4ICG A;  2RN9 A;  1S5L Z;  2HG8 A;  2JEX A;  5KFF A;  5KFT A;  3G6V A;  3O9O A;  5FLX W;  3PR5 B;  3UZB A;  3AG1 C;  1VQ6 V;  3KZI Z;  1XNQ O;  3GB8 B;  5KT2 A;  2DQ3 A;  4DL3 A;  5CA0 A;  4G3I A;  4X1I B;  2ZE6 A;  2AGA A;  1N36 B;  3RYH B;  2B63 G;  1IYD A;  1XQ8 A;  3JZI A;  1AI4 A;  3GB7 C;  4NKG B;  2UU9 O;  2V58 A;  3K06 A;  3OMN B;  2CH7 A;  3CCV V;  1Y66 A;  4NLG A;  1GN3 A;  2LW7 A;  1HNW O;  2IJI A;  4GX5 A;  5DLF A;  1HP8 A;  1N36 H;  4CC5 A;  3JRW A;  2Q2T A;  3KAK A;  2HHH O;  4O7T A;  1D5N A;  2Z5U A;  1K97 A;  5EYP A;  2VPQ A;  3H0G A;  1S10 A;  4RU9 A;  5J2U B;  2E5L H;  3S24 A;  4J80 A;  5JVD F;  1NVP D;  3U9T A;  4ED2 A;  1ZL8 B;  1GRJ A;  5JJN B;  4JI2 O;  2NU8 B;  2IJH A;  4TV9 A;  1Z5W A;  1SKV A;  3SJC C;  3GTP A;  3FX7 A;  2IW5 A;  4O4I A;  3W1B A;  4TV9 B;  4I55 F;  1RPO A;  2IA6 A;  1RFY A;  2JRI A;  1ZL8 A;  5IYZ F;  1A32 A;  1WNS A;  2ZT9 B;  3ABK B;  2VQD A;  4X66 O;  2UXD O;  4MVS A;  5KKN B;  2BQ3 A;  1S0M A;  1LR1 A;  5L3G A;  1IBK B;  5GON B;  2DYS C;  3WG7 C;  4AYB A;  1YF2 A;  3ZJZ A;  1CQJ B;  2R82 A;  2UXB H;  4ZIB A;  4ED8 A;  5IT9 W;  5KFJ A;  1W2B U;  3WWH A;  2Y0S E;  1BNC A;  3F7V C;  3C0F B;  1VF5 B;  2YXH A;  1N8R W;  3LQS A;  2ZJT A;  3MD0 A;  2QWP B;  3I4N G;  2XND G;  5BY1 A;  3L72 H;  1F4N A;  3ZIA G;  2CTW A;  3X2Q C;  2I87 A;  4LMY A;  3KHL A;  2UXD H;  5B1B C;  1B33 N;  3JAS A;  5KFV A;  2IU0 A;  5F2V O;  3HKB A;  5DIS C;  1PP9 H;  3CRA A;  1S72 V;  4JI3 H;  4I50 A;  2HP8 A;  4NYE A;  3RB3 A;  2JEI A;  4GKK H;  4DW1 A;  5BR8 O;  4FLX A;  2W7P A;  3HR0 A;  2QKA A;  4MSW C;  4DR3 B;  2I8C A;  4IRC A;  1BHB A;  1KBL A;  5KFK A;  3KAL A;  4MTO A;  4O2B A;  1KU9 A;  3CHX A;  2GTA A;  4JYA H;  4IWY A;  2YXY A;  3HXL A;  2R8J A;  2Y0P A;  4EEY A;  4MV7 A;  3RYF A;  1XMO O;  1AI5 A;  2Q8V A;  2C00 A;  2DZD A;  5FNV A;  5D8D A;  5HBR B;  1IDS A;  1SC5 B;  5FNV F;  1L2Z A;  2OCC B;  2X5R A;  4B3M H;  2DWC A;  5KFL A;  1ENV A;  3AG4 C;  1LNQ A;  3WB2 A;  3K57 A;  3MWM A;  3N2G A;  2WDT A;  4BW5 A;  1U96 A;  1MZB A;  1EKF A;  3KHR A;  3J81 W;  1R9T A;  2W6I G;  1Y74 A;  2WAQ E;  5DGB A;  4TQS A;  3DXR A;  3KG2 A;  5KMG A;  5C44 G;  3FB7 C;  4D7T A;  4MA0 A;  2VUG A;  5EZY B;  4TV8 F;  3T9C A;  2LJ2 A;  4DV2 B;  4QWE A;  3CC7 V;  2E75 B;  4B3R O;  2W9B B;  1NR1 A;  4MV3 A;  4LR3 A;  2CW7 A;  4ED3 A;  4MVM A;  5LL6 Y;  1WN7 A;  3SGI A;  2JS5 A;  1M57 B;  4WD3 A;  1I6U A;  2AW9 A;  4HYO A;  2BSK B;  1NS1 A;  2O03 A;  4J9S A;  2E2H A;  1IXB A;  2YIB A;  1KQS U;  2YYA A;  3AK2 A;  3PW5 A;  4DV5 B;  1I0H A;  3HOV G;  3RF2 A;  2A3Q A;  4DAA A;  1E4E A;  2HVQ A;  4O84 A;  4DQN A;  4DL4 A;  1S9F A;  3KTM A;  1X4T A;  1PKX A;  5BMV B;  1YVW A;  1JCH A;  4I4T B;  1FXK A;  5CE8 A;  3APO A;  2FLN A;  5KFW A;  3FKS G;  1IYE A;  3CX5 F;  4YIP A;  2XHB A;  4QNH B;  4EGJ A;  1WPB A;  2QF7 A;  1HW7 A;  5KHI A;  1K9M W;  5LP6 C;  3HPL C;  4J9N A;  3JD2 A;  1WP7 A;  1TWF A;  1OWT A;  3TQ1 A;  5BWR A;  3JAL B;  1XRE A;  4EQ5 A;  3HOY G;  2B63 A;  2DAA A;  2K9P A;  4L1K A;  5C8Y A;  4ZOL A;  1H8H G;  3ZHU A;  4JTA B;  4O2A A;  3OTO B;  5GTH Z;  2QR4 A;  4PDV A;  5D1O A;  2Q7D A;  4JI8 H;  2ODM A;  1YJW V;  2E76 B;  5DG9 A;  5DG8 A;  3E22 B;  4QWA A;  2Y0S A;  4O7N A;  3U9S A;  4KHP O;  3JYC A;  4A2B A;  1FS0 G;  1S76 D;  4DL6 A;  1ULZ A;  5LYJ F;  1Y1W A;  2V7Q G;  4DV2 O;  4JYB A;  2ZCE A;  1ZQ7 A;  3OUZ A;  1HNW B;  4RNO A;  2R7N A;  4LSX A;  3G6X A;  1JLL B;  1GN2 A;  4FLW A;  1IXM A;  2Z0A A;  1L1F A;  2KG7 A;  2R84 A;  4DV4 B;  1OJH A;  4O4I F;  3JZF A;  2HVS A;  5ITZ B;  1Q6I A;  3Q1K A;  1Q43 A;  1IBM B;  4ECS A;  2UXB B;  2P4K A;  3GVM A;  4LFA B;  2OLS A;  4BWS C;  2YU9 A;  3W7S A;  4X64 B;  2AZ0 A;  3IJ4 A;  3U0Z A;  5DGH A;  2WLL B;  4IIJ B;  2AGO A;  3K79 A;  5LP6 A;  4JI8 O;  2Y69 C;  3TY5 A;  4JI4 B;  1N34 O;  3JD4 A;  1HNX H;  2ILM A;  3TW7 A;  1K83 A;  1BGY H;  1FD9 A;  2PVP A;  1FXK C;  4LH7 A;  5HNE A;  5GTI Z;  4GKK O;  1VQM V;  4AI8 A;  4F6E A;  3HOU G;  4X66 B;  2CNQ A;  1G6U A;  2XUM A;  5LXT B;  4HR7 A;  3E86 A;  3W5O A;  1MZE A;  3G67 A;  3ZRW A;  1VQ8 V;  4JI7 B;  2B5U A;  2DQ0 A;  4B3S B;  2WAM A;  2W8L A;  3W7U A;  1P4R A;  5KFS A;  2Q0A A;  1EKP A;  2BQU A;  2DIK A;  5JQG F;  2YC0 A;  4TUY F;  4FM1 A;  4DR4 H;  4EB6 B;  1KEC A;  2UUB O;  1I1L A;  4KUM A;  2R9I A;  4N21 A;  2A1H A;  2XC9 A;  2AGP A;  4QW8 A;  1N32 O;  3HO8 A;  3N2K A;  3OW2 U;  2FE3 A;  3ASN B;  1B04 A;  1FXH A;  1H2S B;  3Q4H B;  2IM9 A;  4MS2 A;  2PYL A;  4DL5 A;  1FVI A;  2W71 A;  1ZHQ A;  3B40 A;  3OEH G;  5BZB A;  1H2N A;  5JCO A;  3X2Q B;  3I56 V;  3FAV B;  3Q4H A;  4Q44 A;  2YW2 A;  1K7D A;  4X20 A;  2F93 B;  4X65 H;  3UZO A;  2R92 A;  4H44 B;  2DAB A;  4EB6 A;  1SYX B;  2GDS A;  5KHK A;  4PEL A;  3CRQ A;  2DPJ A;  4CH4 A;  1R3J C;  1ROP A;  1QU7 A;  4JI0 H;  5CBF A;  1XMO H;  1RYS A;  2JA7 A;  5IJ0 A;  4LF8 B;  1AB3 A;  2R72 A;  4IHJ F;  4ZHQ F;  3MR3 A;  5FPR A;  2XAH A;  4JI1 B;  4K0K O;  4RAI A;  4F4Z A;  1G1X B;  2CDY A;  2H8P C;  5EWF A;  1VQ4 V;  4DV6 O;  4LFB B;  2QA4 V;  3A2F A;  3DTU B;  2OYQ A;  4DRF A;  3WG7 B;  1IBK O;  4NZM A;  1I3Q A;  1H8E G;  4JXU A;  2IU3 A;  3J80 N;  4DUZ O;  1OCC B;  4ZQI A;  1IX9 A;  1ARO P;  3SPH A;  5ITZ A;  1CXZ B;  3ZMT A;  3CSW A;  2LGW A;  4NZO A;  3KHG A;  4XZ3 B;  4G2K A;  2YXL A;  2R6F A;  5FLX N;  1ZAU A;  2E3C A;  2N74 A;  3CEB A;  5E25 A;  3JAM N;  2IMW P;  4I0X A;  3OUS A;  2HKO A;  1QCE A;  3OSN A;  3RAX A;  4D6T H;  3E22 A;  2HVK C;  1NVP B;  1V55 B;  4EBD A;  2JJ2 G;  2DWD C;  2HJD A;  5LHG A;  5T14 A;  3F5W C;  4I9Q A;  3FDS A;  3M9O B;  3G8D A;  5KA6 A;  2PMZ E;  1KP3 A;  4LF4 B;  3HKC A;  5C8Y B;  4M7E A;  4CE5 A;  4BIU A;  4PA7 A;  3MR5 A;  3HB3 B;  3ABL C;  3CRM A;  2FPP B;  4DR5 O;  1YCI A;  1IBL H;  4LFC B;  2HIV A;  4QJF A;  4I50 F;  1V51 A;  2VA3 A;  4EBC A;  1H2G A;  4JI0 B;  1SET A;  3C3T A;  3SPI A;  5BMV A;  2ZQM A;  1TUB B;  1VBG A;  4PZ8 A;  4UVA A;  1E4E B;  1QLE B;  4LP8 A;  1AP5 A;  4TV9 F;  1DGS A;  4UCU A;  3JZ6 A;  5KG4 A;  4ECQ A;  2FTK A;  2ABJ A;  1G8M A;  3L2P A;  4DW0 A;  4FLU A;  4UCS A;  2NLJ C;  1S0V A;  4YAJ B;  2ZDG A;  2JA8 G;  2V1D A;  2Y0I A;  4B3R B;  3ZS8 C;  3TET A;  4O2A F;  4FS2 A;  3TXS A;  1MG1 A;  2ARH A;  2XTA A;  3ASO B;  2ZIN A;  2GUZ A;  3P3P A;  4DV7 B;  3Q8P B;  3K5L A;  1SQF A;  2M6Y A;  2YRX A;  5B3S C;  2VRZ A;  4JYY A;  1KT8 A;  3AX6 A;  4CMF A;  4O3S A;  2YIA A;  4YJ3 F;  2BOB C;  5KFG A;  2K1E A;  3P30 A;  5HV6 A;  2IBZ H;  3BAC A;  3RR5 A;  2ZM6 O;  2YID A;  3WWJ A;  4J9M A;  4U3F H;  4O4J B;  3GID A;  1SEI A;  5KMG B;  5CMU A;  4DUY O;  1KJ9 A;  1Y74 B;  5JH7 A;  3M8A A;  1S5J A;  2BTQ B;  2R7Z A;  4DUY H;  4FLT A;  5EC2 C;  3N2G B;  3LWB A;  3AYH B;  4K8Z A;  3OT7 A;  3ORQ A;  5DQI A;  1KC8 W;  2C2E A;  4DR4 B;  1ZLZ A;  2JIZ G;  5FNV B;  4JZ2 A;  1R6N A;  2VQE O;  3V6K A;  1YJN V;  5K2M A;  2Q68 A;  2ZXW B;  1UC8 A;  2ADP A;  2KKW A;  5EBM C;  3K3V A;  3JAR B;  4X88 A;  5IY5 B;  2R92 G;  4P2Z A;  4B3M O;  5AG2 A;  3H1I H;  4Z2W A;  4QIW A;  4J9Z B;  3RIZ A;  4A3M G;  1Q8I A;  2WSS G;  4JTD B;  1SA0 A;  3DC5 A;  4GYC B;  1F4M A;  2CTR A;  4DV1 B;  2PY5 A;  3U0G A;  2FLP A;  4IRD A;  2FB5 A;  2X6B A;  1VAJ A;  4FZ0 A;  1R3K C;  1VQO V;  1CKN B;  3OTO O;  3GJX B;  4JAA A;  2CZG A;  3QFF A;  2C2D A;  2W0X A;  3K3P A;  3TII A;  1GSO A;  3K04 A;  1FAF A;  2UUC H;  3LSS A;  2E5L O;  4A3L G;  1OHH G;  2A79 B;  5CA3 A;  2WLH A;  4A3C G;  1N33 B;  1SZX A;  4HZ3 A;  1CE8 A;  4DV4 H;  1YXB A;  2JA6 G;  1M90 W;  3QVN A;  4ED6 A;  2XGQ A;  2Q4P A;  1DV2 A;  1L0L H;  2HHF A;  3GIP A;  5BXZ A;  2WB1 E;  1PK8 A;  2CNV A;  3H9V A;  3GTQ A;  2A7W A;  1XNQ H;  4YJ2 B;  2YS8 A;  3GIJ A;  2MK3 A;  5LOV B;  4PD4 F;  2UUA O;  1QR8 A;  5GON A;  2ZD9 A;  5LMU O;  4DL2 A;  3BQ0 A;  2FK1 A;  2C28 A;  4P9P A;  1NQT A;  1RM1 C;  4X89 A;  1OCZ B;  5IJ9 A;  4DV5 H;  3J7A K;  1WB7 A;  3ASO C;  4O4L B;  3V4S A;  4KHP H;  2JEU A;  3R5X A;  5DG7 A;  3SYO A;  3IC9 A;  4UVC A;  1R1B A;  2ASJ A;  1UJW B;  2VQE B;  2QK4 A;  5I47 A;  5C93 A;  2ZGI A;  3SYA A;  4MTX A;  1SER A;  4KFM A;  3CEI A;  3FD9 A;  2CQY A;  3QZ7 A;  2FML A;  3KYH C;  5I5U A;  3MFH A;  2SCU B;  1I5Y A;  5J2U A;  4CKB A;  4UVB A;  3W1G A;  4NVP A;  5L3E A;  4O2B F;  4GUN A;  1HNW H;  4W4L A;  1WA8 A;  3CCJ V;  1Q5O A;  3GLK A;  1K1S A;  1EM1 A;  4JZG A;  4RCN A;  1M1K W;  3WO0 A;  3TGU H;  2R8K A;  4L87 A;  2WLM A;  4BR6 A;  4PA4 A;  1FJG O;  3RVZ A;  2HVR A;  1QHT A;  1K92 A;  1KEE A;  3SJQ C;  4X1I A;  1GAX A;  1HNZ H;  5CR5 A;  2ZDI A;  3HKZ E;  3V4Z A;  3LSQ A;  2P67 A;  3I5D A;  3FYI B;  4FGR A;  1AVM A;  3AG3 B;  3THO A;  4B7K A;  2W9C A;  4B7E A;  2Z02 A;  5BPH A;  2A0L A;  4FFB B;  1F7Y A;  3E5N A;  3MFI A;  1QR9 A;  1HNZ B;  3GIM A;  5BWX A;  3RB4 A;  5JQG A;  3A0R A;  4B3T H;  3H40 A;  1XIL A;  3S3X A;  5L3F A;  1CEZ A;  5CA1 A;  5I5V A;  4RB0 A;  1S03 G;  4DRX A;  3T99 A;  1KJ8 A;  3VPC A;  3PW4 A;  1Z5V A;  2FB9 A;  1Q3E A;  2IH3 C;  3VNN A;  1GO3 E;  2Y4U A;  2N05 A;  2R9R B;  2RQ6 A;  5FL7 G;  1P8L A;  1SQG A;  5LMU B;  2QKC A;  5IY5 C;  4FFP A;  4FFM A;  1IOW A;  4F4Y A;  2HR3 A;  3CE2 A;  2ADQ B;  1EN4 A;  3IAY A;  4R8U A;  4F6R B;  4U7N A;  1M4U A;  1PD3 A;  4NTW A;  4LF7 O;  4YR2 A;  4I5S A;  1JFF A;  2R7L A;  1P7G A;  1BXR A;  4X8A A;  4IRK A;  1GM9 A;  2CGN A;  2NNU A;  1AI7 A;  1HWY A;  2P7T C;  5JVD B;  2E74 B;  5K1X A;  1XNR O;  1I50 A;  3OD4 A;  3K58 A;  3EHB B;  4YIO A;  3TY8 A;  3HOX G;  1QVG U;  3B77 A;  2NUA B;  4R7C A;  5BWW A;  1M56 C;  5B1A B;  4K35 A;  4ME6 A;  1JDB B;  4TM5 A;  5LHH A;  3E83 A;  2EIK B;  5CM0 A;  3VBB A;  2IH1 C;  1AJN A;  4PDR A;  5BWU A;  3BG5 A;  1IBK H;  2UVR A;  1BS3 A;  1I7F A;  3RGX A;  4HNU A;  4GZR B;  2VQE H;  4Q4C A;  3G6Y A;  3ZMU A;  4WCE V;  2VWJ A;  5D5P A;  3KRE A;  3BQ2 A;  4GX0 A;  1VF6 A;  3BA9 A;  4PJ0 Z;  3JD1 A;  5CB4 A;  1V55 C;  3APQ A;  2WB1 A;  5D5Q A;  5KFH A;  1R6T A;  2R9A A;  5C1P A;  1X59 A;  2V9W A;  4MV8 A;  3N44 B;  1I5X A;  2GSM B;  5L9X A;  3GWO A;  4MT8 A;  1XDC A;  4YY3 B;  1VS0 A;  4DXW A;  3K5M A;  2QWQ B;  2Y48 A;  3JAT B;  1Q82 W;  4LH6 A;  3SJB C;  3QNE A;  5H6Q A;  4LFB O;  3WO1 A;  1S0N A;  3AG4 B;  1I2L A;  2X0S A;  1BMF G;  3CP1 A;  1K3E A;  2R7K A;  4DR3 H;  4A3I G;  4A3K G;  3ICX A;  5HFM A;  3IC7 A;  1KUQ A;  4LC1 A;  1PV0 A;  3M9N B;  3OFN G;  1NTZ H;  1TVK A;  1BL8 A;  3MR2 A;  1ZUQ A;  5JVD A;  3CCS V;  4O7V A;  2EIM B;  4TUY B;  1VQK V;  2VPS A;  1WB8 A;  2W6M A;  1JFF B;  5KT4 A;  4AQY B;  4CMD A;  2R93 G;  2JDI G;  5EK0 A;  3R5H A;  3VQX A;  3T1H B;  2QTS A;  2Q6A A;  4LF5 B;  4PWQ A;  1B06 A;  1WR2 A;  1EN5 A;  5LMN O;  1OBD A;  4YHH H;  2FKX A;  3HOW G;  2Z3Y A;  1EUC B;  4Q45 A;  2NU9 B;  2ATK C;  1U97 A;  3F8N A;  4MA5 A;  1E1Q G;  4WBN B;  3LML A;  1KBH A;  3GIK A;  1KP2 A;  3RYC A;  4HQ6 A;  3L75 H;  5IYB O;  4LFC H;  1AJP A;  2EIL B;  1K5S A;  3FB6 C;  4J9O A;  4NYK A;  4MVQ A;  4FFB A;  3CRC A;  2W9C B;  5J2T B;  4JAS A;  2WWW A;  2DYR B;  4EFE A;  1RSO B;  3E8G A;  3R9R A;  1Z2G A;  1WLE A;  4JTC B;  1RM1 B;  1V4Y A;  2X0L A;  4WFF A;  2HIX A;  4DV3 H;  2ZKO A;  5EWE A;  1S68 A;  4ASU G;  3T1Y B;  3R23 A;  5KFY A;  1Y67 A;  5I60 A;  3WU2 Z;  3T1H O;  3MR6 A;  4B3S O;  1HR0 O;  1V9P A;  4JI1 O;  4K0K B;  3RYI B;  3OEE G;  2BE3 A;  1WA8 B;  4RUF A;  2F4V B;  3UFX B;  2JGU A;  4I55 A;  1MSW D;  4O4H B;  1SCU B;  5FD5 A;  3RBE A;  2C35 B;  4HYK A;  2CTP A;  4O7Y A;  2UVW A;  1DV1 A;  4IAJ A;  2UVU A;  2IBK A;  2UXC H;  5KG6 A;  3R66 A;  4CZZ A;  4O4L A;  3OMA B;  4LF9 O;  1LUW A;  4A3G G;  2L6L A;  4NTX A;  4QIW F;  1AN7 A;  4JV5 H;  4PZ7 A;  1HR0 H;  4LF9 H;  4M0J A;  2W70 A;  2WA4 A;  3D3Q A;  2JK5 C;  1VF6 C;  3HKE A;  5BR8 H;  2VWK A;  5LOV A;  2D3O W;  1F23 A;  4Y8V B;  4YJ2 F;  2P06 A;  3ZHQ A;  1HNX O;  2G38 A;  1E4F T;  3GDE A;  3CC2 V;  3Q2O A;  1XMQ B;  3J7A U;  4Q20 A;  2JEJ A;  3CRR A;  4MTE A;  2GQS A;  2HHF B;  3TIG A;  3JAM W;  2R87 A;  3G8C A;  2QEX V;  3OAA G;  5LHI A;  1NI8 A;  4KXR A;  2EIN B;  4K0K H;  3SR2 C;  1YHQ V;  3EYY A;  2XD4 A;  2N04 A;  4Q43 A;  4GLX A;  2RGV A;  1OCO C;  3B09 A;  3ETE A;  2HJF C;  4WFA V;  3JSN A;  3OUF A;  4QGP A;  4DR2 O;  2OWO A;  2AHZ A;  4MW8 A;  1CKN A;  3TW6 A;  1AI6 A;  2PF4 E;  4DR3 O;  4RB1 A;  3LUT B;  3GV7 B;  2DPI A;  4X65 O;  4PBC A;  5H5N A;  1AUV A;  1H2L A;  5H2F Z;  3SPC A;  5KG3 A;  2Q69 A;  1EFR G;  3EFF K;  1BSM A;  2EIK C;  3WB0 A;  3N6X A;  3CB2 A;  1GN4 A;  5FPO A;  1GO3 F;  3UKM A;  2UVV A;  4XDK A;  2CNU A;  2D2C B;  1M9N A;  1KYO F;  1Z2N X;  4JI2 B;  2RF4 A;  4LFB H;  3DAA A;  3ETH A;  5KFZ A;  4CH3 A;  2ZNJ A;  5JH7 B;  5LL6 b;  1TWG A;  3RGZ A;  2PN1 A;  5KFA A;  3AG1 B;  2R7M A;  1GN6 A;  2CAZ C;  3K0D A;  3F7Y C;  1N0J A;  2FK2 A;  4QWB A;  3KCX A;  4JAV A;  1XMO B;  1AUX A;  5DQH A;  5KX5 A;  4DV0 O;  1MSD A;  4CBC A;  4GKJ H;  4LF8 O;  2GQR A;  5L1K A;  4G28 B;  4EG0 A;  3E8H A;  1M7J A;  2UXB O;  2IP4 A;  2LQT A;  3VQV A;  2ETN A;  3ZN1 A;  3JAK A;  5CN0 A;  3CME V;  4DR6 O;  2COI A;  1V54 C;  2YS7 A;  1A9X A;  4OPA A;  3T9A A;  2C2A A;  4A3E G;  1DAA A;  2YZG A;  2JEF A;  2WLN A;  1PX2 A;  4J7Z A;  1N34 B;  4JV1 A;  5IYD O;  4EEQ A;  5KT7 A;  4TV8 A;  3M9M B;  2RNB A;  4FJC C;  4X66 H;  2W6J G;  5IP9 G;  3GIQ A;  3RJ0 A;  1A3G A;  1N0N A;  5CA1 F;  5E79 Z;  3OHB A;  3H3V H;  4LNU B;  3Q8Q B;  2MW2 B;  1RJR A;  2YIB D;  3CJH B;  3H0G G;  1KUT A;  4LNU A;  1TWH A;  4BIO A;  5JJJ B;  2Q9L A;  1Q7Y W;  3FKI A;  1GMG A;  3OR7 C;  1NJI W;  3TY9 A;  3N27 A;  4N23 A;  1LUV A;  2BOC C;  4RUC A;  4O7W A;  4H37 A;  3PN1 A;  1OCR B;  5EC1 C;  3ZRV A;  4MW3 A;  2PYJ A;  3U55 A;  4RO2 A;  2FPI B;  4JI5 B;  3W7W A;  1KKD A;  2YRW A;  3BY6 A;  1G4Y B;  2UU9 H;  2W6P A;  2ZM6 H;  1M0W A;  4UCR A;  3HKC B;  3UO3 A;  2V59 A;  4WHX A;  4NXM H;  2F4V O;  4A3J G;  1K33 A;  5EOY A;  5FD6 A;  4NB5 A;  5B1N A;  4F4L A;  4JF3 A;  5IP7 G;  5DEC A;  1SS3 A;  2GHY A;  2WLI B;  1J95 A;  3HOZ G;  4YR0 A;  3RFC A;  3AG2 B;  4ZI7 F;  2CK3 G;  5BWT A;  3ABM C;  2EBO A;  4LWS A;  5DMX A;  3OHA A;  2YI8 A;  5IE9 A;  2ODT X;  3A8T A;  1GSA A;  3QF7 A;  1EHI A;  1PNL A;  2XAS A;  1AR5 A;  3RGB A;  1JQ0 A;  3H1H H;  2QWR B;  3RWR D;  4WF9 V;  2ZE8 A;  3RB0 A;  1VP7 A;  2IJJ A;  4DYL A;  3VA7 A;  1FXV A;  2Q5Z A;  1S0O A;  3CC4 V;  5LMN H;  1E4G T;  1B6Q A;  4FVM A;  1RPR A;  3M7M X;  4XDL A;  2WYO A;  3M4I A;  1Y1V A;  1IVS A;  4NR1 A;  1D2D A;  3RFR A;  2DLN A;  2ZE7 A;  3R5F A;  1GK9 A;  4J0M A;  2HFE C;  1M5I A;  2DWE C;  4GKJ B;  3H4D A;  1PM9 A;  1OV9 A;  4ECY A;  4DR1 H;  3TK1 A;  2RMK B;  4GCZ A;  3IN5 A;  4DV6 B;  2UUC O;  3T5L A;  1DK1 A;  4CHI A;  5LA6 F;  3C3S A;  3UQ8 A;  4LF5 O;  5LA6 A;  5IJ0 B;  1AJQ A;  4UB8 Z;  3ZHS A;  1KMI Z;  4XYL B;  2V5A A;  5IYD G;  5DGA A;  4PV1 B;  3ZHT A;  2ZM6 B;  1VQL V;  3PZP A;  1N4C A;  1KKC A;  4DV1 H;  3UYY A;  5A9G A;  4IL6 Z;  3T1Y O;  1COW G;  2YWV A;  1SQV H;  3P32 A;  2NVX A;  3K0G A;  1JDE A;  1NZ6 A;  2Q73 A;  3GTL A;  3HKE B;  2ASD A;  4NZN A;  2DYR C;  3IFX A;  4I7H A;  3PJS K;  4DR1 O;  1T5E A;  2QWO B;  1MZF A;  3RUP A;  3ZBH A;  4JI6 O;  1ET0 A;  2QGN A;  3CMA V;  5CAE B;  4DV4 O;  4O3O A;  2YZN A;  3NC0 B;  3ZHR A;  2JGD A;  4JV2 A;  4J9R A;  5JVL A;  4C5C A;  3K59 A;  1RJP A;  2OCH A;  4ZI7 B;  2WPD G;  4HAM A;  1XHX A;  1KJI A;  4ZBM A;  2W6N A;  4ZI7 A;  4IGG A;  5FLM G;  3CQZ A;  1L8D A;  4KHP B;  3JAW A;  1R6K A;  3ZRX A;  3STL C;  1VQ9 V;  2QM8 A;  1W93 A;  4E6N A;  3GTO A;  5KT6 A;  3D3I A;  3DSQ A;  4O4H A;  1VQP V;  4CS4 A;  4ZOL F;  3PVX A;  2A9H A;  4GKK B;  3T5H A;  2LGQ A;  4FFK A;  3OUU A;  2WLL A;  3SYC A;  5KHJ A;  3AG3 C;  4F4W A;  2FYU H;  3K5H A;  2QYZ A;  1N34 H;  3KKY A;  4DR6 B;  2V4Q A;  2FLL A;  1OCZ C;  3CCE V;  4DR2 B;  5DLG A;  2ZIM A;  1Q86 W;  2RDI A;  5L3D A;  2F43 G;  2KG7 B;  2AGQ A;  2UUC B;  2E5L B;  2EJ2 A;  4J10 A;  5J2T A;  2JEG A;  4PDB A;  1XUQ A;  4AIL C;  2UXN A;  1SQQ H;  5LA6 B;  3H1L H;  3RYC B;  2YUA A;  2XAQ A;  1XHZ A;  1WCM G;  1A0G A;  5D1O B;  4NTY A;  3JSL A;  5JQW A;  1ZSP A;  4I9W A;  2BTO A;  4A5U B;  4CH6 A;  4ZOL B;  5BYA A;  1P49 A;  1VAR A;  4BBR G;  4X62 H;  3T9E A;  5KT5 A;  4PZ6 A;  2ZE5 A;  4R8C A;  2W9A A;  1Y1W G;  3JAL A;  2YSU B;  3PW7 A;  3T4Z A;  4JI5 H;  4L8J A;  4O82 A;  3QO8 A;  1JJ2 U;  1Q6H A;  2F1M A;  3WWI A;  4O83 A;  5LGU A;  2FL4 A;  3O65 A;  4D7S A;  2Y69 B;  3MDS A;  1SZT A;  1Y76 A;  2VQF O;  1M56 B;  5B1A C;  4IYI A;  3N40 P;  2FK3 A;  1FXK B;  2Q2U A;  1C30 A;  1YDX A;  4WBN F;  1NTK H;  3SI8 A;  2XGP A;  2PBZ A;  5F9N A;  4TUY A;  3CCR V;  3D36 A;  4IHJ A;  4ZHQ A;  4EYI B;  1TVK B;  3H1J H;  3B8N A;  5KFC A;  1I1M A;  4U6P A;  1FKA O;  1XL4 A;  2W7O A;  1QLN A;  1A48 A;  2WTF A;  4LWS B;  3J81 N;  1XDN A;  3JCU Z;  1UC9 A;  5D1P A;  3VPD A;  1Y6X A;  4YR3 A;  4B3R H;  3MAQ A;  2DJV A;  1PPJ H;  5BR8 B;  1K1Q A;  1WCM A;  2RJZ A;  4W4K A;  3L4K A;  5EBL C;  4IR9 A;  4PDL A;  4ECU A;  2PGG A;  1TWC A;  3RVY A;  3T5J A;  5L3C A;  1XMQ H;  1PNM A;  1IZ3 A;  4C5A A;  2B9Z A;  4GC7 A;  2V4R A;  4Q8E A;  2NU7 B;  4FE2 A;  3JD0 A;  5EZY A;  3MWD A;  2EJ0 A;  2CFM A;  3BPZ A;  1AP6 A;  3NBZ B;  4O7Z A;  1N32 H;  3G6E V;  3S3W A;  3HKZ A;  3CCU V;  3LNM B;  2EIN C;  1EKV A;  4FMT A;  2P90 A;  4MVR A;  1RYR A;  1QQC A;  2P6J A;  2DMX A;  1YJ9 V;  3I4M G;  1GM8 A;  2QKS A;  3JRX A;  3LUL A;  4U7O A;  4APM A;  5I5T A;  4OPH A;  4O2B B;  1K5Q A;  3AG7 A;  1PL0 A;  3T54 A;  1N56 A;  1IBM O;  3PR4 A;  4A3B G;  3K08 A;  4X64 O;  1R73 A;  1B6R A;  2VA2 A;  4FLY A;  2OT5 A;  3FMA A;  4MTD A;  3HKB B;  1RJQ A;  2P4V A;  1ZET A;  3L4J A;  1EZJ A;  1TUE B;  2PI4 A;  2CGO A;  1X9N A;  2CKZ B;  1JR9 A;  4DUZ H;  2RCV A;  2XCL A;  1DIK A;  2M7W A;  4X62 B;  2C22 A;  4EYH B;  1MMM A;  3N6R A;  3BHP A;  3GTM A;  4C5B A;  5LOV F;  1KC7 A;  3LDC A;  4RUE A;  4WFB V;  1SRY A;  4PDM A;  2HGS A;  3T2M A;  3T1H H;  1OBG A;  5DED A;  4DR2 H;  1KB9 F;  4AQY H;  2F95 B;  4MV1 A;  4TVI A;  2YIC A;  1HR0 B;  2JJ1 G;  4RNM A;  3RAQ A;  1IUR A;  1FJG H;  4UFZ A;  2YS6 A;  3CXH F;  1M0T A;  3A0B Z;  5IYC G;  4FFR A;  3QTC A;  5IYB G;  3T4D A;  3HKD B;  3DGE A;  3ZRS A;  4LCU C;  2Q67 A;  4PI0 A;  3ABT A;  4Z1V A;  2YZL A;  2OCC C;  4LF6 O;  4O4I B;  4JI8 B;  4ECZ A;  4LF8 H;  3RTX A;  3RV3 A;  5J9P C;  2PMZ A;  5KG7 A;  4DV1 O;  2WA3 A;  2OTL V;  3L9D A;  2ZIO A;  3TQT A;  1SF9 A;  1JX4 A;  4G27 B;  1J5E O;  4R50 A;  1IOV A;  5IJ9 B;  4TWK A;  1CPY A;  3CSX A;  3LDD A;  3CPW U;  1VQN V;  4DLK A;  5BMV F;  3H20 A;  2R8I A;  2VUM G;  2FKL A;  3F5T A;  1GYF A;  2VR1 A;  4JV5 O;  2P5O A;  2ATL A;  4GLW A;  4YY3 H;  4JPR A;  4DR7 O;  2AQ4 A;  1K34 A;  5KHG A;  3VOU A;  3L74 H;  1JPX A;  2PI5 A;  3DC6 A;  1I7L A;  2UUB B;  4YJ2 A;  4QWD A;  2XCP A;  3ABU A;  2ASL A;  4GX1 A;  4ECT A;  3K5I A;  2HHH B;  2Z04 A;  1Y4M A;  2EJ3 A;  2RDJ A; 
#chains in the Genus database with same CATH homology
 1O9H A;  4Q6G A;  5KHK A;  3JAM W;  5JCO C;  4CH4 A;  4DV2 H;  1I94 B;  4JI0 H;  1XMO H;  4K0K H;  4X1K A;  5IJ0 A;  3SR2 C;  4DR5 B;  4LF8 B;  4X64 H;  3EYY A;  4FM2 A;  2R72 A;  4TOI A;  4GLX A;  2RGV A;  5FPR A;  5LMN B;  4JI1 B;  2JVD A;  3HKD A;  3BAB A;  3JSN A;  1TGO A;  3KXY T;  2VQF B;  4I55 B;  2OWO A;  4A2A A;  4LFB B;  3A2F A;  2OYQ A;  1CKN A;  4YHH B;  4DRF A;  4HNA B;  4YJ3 A;  4RB1 A;  4DR7 H;  4IIJ A;  3RYI A;  5JJE B;  4LF5 H;  4JI6 H;  4JYA B;  4JI3 B;  4DR6 H;  5ITZ A;  5K1P A;  4K8X A;  4DR5 H;  3ETQ A;  3UT5 A;  4JI2 H;  2YXL A;  3WB0 A;  3N6X A;  3CB2 A;  4ETS A;  1ZAU A;  2E3C A;  4AHC A;  1RSO A;  5FPO A;  4B3M B;  4U3J A;  5IYZ A;  2UUA B;  4NXN H;  2YI9 A;  1JJO A;  1Z2N X;  4JI2 B;  4LFB H;  4PHZ A;  3BRC A;  5IWA B;  4OX9 B;  4CH3 A;  2ZNJ A;  5JH7 B;  3E22 A;  5LL6 b;  1JMK C;  3RGZ A;  4B3T B;  4JI6 B;  4I9Q A;  4WBN A;  3OTO H;  2CAZ C;  4O2A B;  4LF4 B;  3HKC A;  2WE6 A;  5C8Y B;  1XMO B;  4M7E A;  1ZHS A;  5KX5 A;  4GKJ H;  4LF6 B;  2UU9 B;  4KL1 A;  1NT2 B;  4DV0 H;  4BWA A;  4DUY B;  3VQV A;  1M93 A;  3JAK A;  1IBL H;  1Z2O X;  4LFC B;  2HIV A;  1TAE A;  4UCV A;  1N34 B;  4UCT A;  4EEQ A;  4TV8 A;  4JI0 B;  4EFB A;  4X66 H;  5BMV A;  1TUB B;  4PZ8 A;  3RJ0 A;  4LNU B;  4DR7 B;  4FM9 A;  2YIB D;  1DGS A;  4UCU A;  3L2P A;  4LNU A;  3OTF A;  5JJJ B;  4FLU A;  3VQW A;  1TUB A;  4UCS A;  1N33 H;  1J5E B;  3TY9 A;  3JAT A;  5KHH A;  4DK1 A;  3WB1 A;  2QJ1 A;  4B3R B;  3ZS8 C;  3PN1 A;  4MV9 A;  2PYJ A;  4LF9 B;  2ZIN A;  4RB2 C;  4CS2 A;  4DV7 B;  4FLV A;  3K5L A;  1SQF A;  4JI5 B;  5CB4 B;  1WH2 A;  2YIA A;  1FJG B;  3N42 B;  3QG5 A;  4RZQ A;  2UU9 H;  2ZM6 H;  2HEP A;  2UXC B;  4UCR A;  3HKC B;  1M0W A;  4NXM H;  2UUB H;  3RR5 A;  4LF4 H;  1TA8 A;  5EOY A;  5FD6 A;  4O4J B;  2V4D A;  1SEI A;  5KMG B;  1XNQ B;  2R70 A;  2UXD B;  2YCH A;  2QM4 A;  5JH7 A;  1S5J A;  2BTQ B;  3FFQ A;  4DUY H;  4FLT A;  2YI8 A;  3N2G B;  4K8Z A;  4LF7 B;  3QF7 A;  3K5N A;  4DR4 B;  4U3J B;  5IYZ B;  5FNV B;  2VQF H;  4IHJ B;  3RGB A;  4ZHQ B;  3N41 B;  3RWR D;  3RYF B;  3DF7 A;  2KKW A;  3UT5 B;  5LMN H;  1O9G A;  3JAR B;  3K3V A;  1E4G T;  2P22 C;  4FVM A;  4F6R A;  3M7M X;  2WYO A;  3RIZ A;  1BJT A;  1Q8I A;  1CKO A;  3M4I A;  1SA0 A;  4GYC B;  4DV1 B;  2PY5 A;  4YJ3 B;  3RFR A;  3J80 W;  5EIB D;  4HNA A;  2F4V H;  1CKN B;  4DUZ B;  4J0M A;  3GJX B;  1M5I A;  4GKJ B;  2HHH H;  4I50 B;  4TQF A;  1BGW A;  2UUC H;  4DR1 H;  2KSW A;  2MCT A;  3ZED A;  4DRX B;  4DV6 B;  3JAS B;  5CA1 B;  2ZNI A;  3UQ8 A;  5LA6 A;  5IJ0 B;  4X1K B;  1N33 B;  1KMI Z;  5JQG B;  4DV4 H;  2ZM6 B;  5FLX W;  3GB8 B;  4DV1 H;  2W57 A;  5CA0 A;  4X1I B;  1N36 B;  4Q0Y A;  3RYH B;  1XNQ H;  2PTM A;  3QWU A;  4YJ2 B;  1XQ8 A;  3BAA A;  2F66 C;  5LOV B;  3KAJ A;  3HKE B;  5GON A;  4I7H A;  1N36 H;  1T5E A;  4CC5 A;  2Q2T A;  3KAK A;  4R7R A;  3U11 A;  4CS3 A;  5EYP A;  5J2U B;  4JV5 B;  5IJ9 A;  2E5L H;  4DV7 H;  4DV5 H;  4CC6 A;  3S24 A;  3J7A K;  4O4L B;  1N32 B;  3NC0 B;  4KHP H;  5JJN B;  4CH5 A;  3JAW B;  1A0I A;  4TV9 A;  1Z5W A;  3K59 A;  1SKV A;  4ZI7 B;  3SJC C;  2VQE B;  4O4I A;  1XHX A;  3W1B A;  4ZI7 A;  4TV9 B;  1L8D A;  5LXT A;  4KHP B;  3JAW A;  4E6N A;  3NBY B;  4DK0 A;  3DSQ A;  4O4H A;  1IBL B;  3KYH C;  1FFX A;  1WNS A;  4CS4 A;  5J2U A;  3BA8 A;  3W1G A;  1HNW H;  4NVP A;  2Q7G A;  4GKK B;  1Q5O A;  5LP6 B;  4X65 B;  1XI1 A;  3IG0 A;  1Z2P X;  5KHJ A;  1IBK B;  2XIG A;  5GON B;  1P16 A;  1N34 H;  4DR6 B;  4X1Y B;  4DR2 B;  2UXB H;  2HVR A;  2ZIM A;  4ZIB A;  1QHT A;  5IT9 W;  4X1I A;  3U10 A;  1HNZ H;  2UUC B;  3C0F B;  2E5L B;  2ZJT A;  5J2T A;  3THO A;  4FLZ A;  4PDB A;  4FFB B;  1HNZ B;  4AIL C;  5JQG A;  4LMY A;  4B3T H;  5LA6 B;  4JI7 H;  2UXD H;  5A2Q W;  3RYC B;  4RB0 A;  5CA1 A;  1XHZ A;  3T1Y H;  1S03 G;  3JAS A;  4DRX A;  5D1O B;  3JSL A;  1Z5V A;  3HKB A;  1Q3E A;  3VNN A;  5DIS C;  4JI3 H;  2BTO A;  4CH6 A;  4I50 A;  4ZOL B;  2RQ6 A;  1P8L A;  1P49 A;  1SQG A;  4GKK H;  4X62 H;  5LMU B;  4PZ6 A;  4RB3 C;  4FLX A;  4BW9 A;  1D5A A;  3JAL A;  4PI2 A;  1SA0 B;  1VF7 A;  4JI5 H;  4L8J A;  4DR3 B;  3IAY A;  4LF7 H;  2F1M A;  3KAL A;  4F6R B;  4O2B A;  4D7S A;  1KU9 A;  1M4U A;  3JAR A;  3CHX A;  4JYA H;  1JFF A;  3N40 P;  4I4T A;  2Q2U A;  3HXL A;  4MV7 A;  3RYF A;  4TUY A;  4IHJ A;  4ZHQ A;  5JVD B;  1FKA H;  5FNV A;  1TVK B;  5K1X A;  1L2Z A;  5LYJ A;  3K58 A;  4B3M H;  3WB2 A;  3K57 A;  3TY8 A;  3MWM A;  3N2G A;  2WDT A;  2BTQ A;  1MZB A;  2PZS A;  3J81 W;  4JI1 H;  1XDN A;  5D1P A;  4HBN A;  5KMG A;  4O4J A;  4D7T A;  2VUG A;  5EZY B;  4B3R H;  2GV9 A;  1IBK H;  1I7F A;  3MAQ A;  3RGX A;  4DV2 B;  5BR8 B;  2VQE H;  2RJZ A;  2VOB A;  2VWJ A;  5D5P A;  3L4K A;  3BA9 A;  4LR3 A;  2PGG A;  5CB4 A;  2Q7H A;  2CW7 A;  1XMQ H;  3VQY A;  5D5Q A;  2R9A A;  3N44 B;  1WN7 A;  3SGI A;  2JS5 A;  1VS0 A;  4YY3 B;  1I6U A;  4B3S H;  1J5E H;  5EZY A;  3K5M A;  2O03 A;  3JAT B;  2CFM A;  4LH6 A;  3SJB C;  2YIB A;  3BPZ A;  3NBZ B;  1N32 H;  1I94 H;  4DV3 B;  4DV5 B;  4DR3 H;  1YEW A;  3ICX A;  4RAY A;  3LNN A;  5LYJ B;  3RF2 A;  4RAZ A;  1TVK A;  4UCO A;  2HVQ A;  1QQC A;  5JVD A;  4JI4 H;  1X4T A;  4TUY B;  2VPS A;  5BMV B;  4I4T B;  4B08 A;  4TV8 B;  1JFF B;  4AQY B;  2XHB A;  4APM A;  1IBM H;  1WPB A;  1HW7 A;  3VQX A;  5KHI A;  3T1H B;  4O2B B;  5LP6 C;  4LF5 B;  1XNR B;  3JAK B;  4DV0 B;  3K5O A;  3JAL B;  4EQ5 A;  4YHH H;  3SJA C;  2UUA H;  5KX5 B;  4FLY A;  5C8Y A;  5LMU H;  4ZOL A;  3FMA A;  4O2A A;  4LSA A;  3OTO B;  3F8N A;  4MTD A;  3HKB B;  4WBN B;  3LML A;  4DV6 H;  5D1O A;  4JI8 H;  2Q7E A;  3L4J A;  3RYC A;  3E22 B;  4OX9 H;  4LFC H;  1X9N A;  4A2B A;  4NXN B;  4DUZ H;  4FFB A;  4X62 B;  2ZCE A;  5J2T B;  4EFE A;  1HNW B;  4LSX A;  4LF6 H;  3BHP A;  1CKM A;  4FLW A;  2HIX A;  4DV3 H;  4FM0 A;  4DV4 B;  1S68 A;  3T1Y B;  2HGS A;  2HVS A;  5ITZ B;  3T1H H;  1Q43 A;  4X1Y A;  1IBM B;  2UXB B;  4DR2 H;  4LFA B;  4BWS C;  4AQY H;  2F95 B;  4DR1 B;  2RGR A;  4X64 B;  1V9P A;  3U0Z A;  4K0K B;  4IIJ B;  3RYI B;  5LP6 A;  1HR0 B;  3TY5 A;  4JI4 B;  1HNX H;  2F4V B;  2JGU A;  1FJG H;  4I55 A;  2CW8 A;  4UFZ A;  1FFX B;  4TQD A;  1M0T A;  1XK5 A;  4O4H B;  4LH7 A;  5EIB C;  5FD5 A;  3QTC A;  3HKD B;  4X66 B;  1G6U A;  5LXT B;  4PI0 A;  3CVZ A;  4LF8 H;  4IAJ A;  4O4I B;  4JI8 B;  3W5O A;  3RTX A;  4JI7 B;  2UXC H;  4B3S B;  2PUS A;  2Q0A A;  2ZIO A;  4O4L A;  4FM1 A;  5IJ9 B;  4EB6 B;  1HNX B;  4DR4 H;  3CSX A;  2EX3 A;  5EYP B;  1AN7 A;  4PZ7 A;  3H20 A;  1HR0 H;  4JV5 H;  4LF9 H;  1GYF A;  3N2K A;  4X20 B;  2FE3 A;  4MTE A;  1XNR H;  1B04 A;  1H2S B;  2IM9 A;  2PYL A;  2P5O A;  1FVI A;  1ZHQ A;  4LFA H;  4YY3 H;  3HKE A;  5BR8 H;  2VWK A;  5KHG A;  5JCO A;  5LOV A;  2UUB B;  4YJ2 A;  4NXM B;  3GDE A;  3RYH A;  3N2K B;  4X20 A;  1E4F T;  1O75 A;  3N43 B;  2F93 B;  3B2E E;  5CA0 B;  1XMQ B;  5IWA H;  4X65 H;  2HHH B;  4EB6 A;  1SYX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...