5FPRA

Structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 104
structure length 307
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fprA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fprA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fprA02
4JI0B 1I94B 1TA8A 1XMOB 3NC0B 4LFBB 4JI2B 1TAEA 4X62B 4UFZA 5D1PA 4X66B 5LMNB 1CKNA 4UCUA 4LF8B 1FVIA 1J5EB 3L2PA 2VUGA 3TY5A 2OWOA 1S68A 1FJGB 4LH7A 1VS0A 4JYAB 3BAAA 4JI5B 3TY9A 2HIXA 1P8LA 2VQEB 2HIVA 3VNNA 3T1HB 5D1OB 1N34B 3W1GA 4KHPB 4UCRA 4JV5B 1V9PA 5IWAB 4JI7B 4LF5B 2VQFB 1A0IA 4EFBA 1DGSA 4CC6A 4LFAB 4DRFA 3BABA 4DV3B 4B3SB 2HVRA 4DR3B 4DV7B 4DR2B 3NBZB 3PN1A 4JI8B 4E6NA 4OX9B 4JI4B 2UUAB 1N32B 1HNXB 1P16A 2UUCB 2CFMA 4GLXA 3JSNA 2UU9B 1XNRB 3OTOB 1N36B 2Q2UA 4DR7B 3BA9A 4LF7B 4K0KB 4JI1B 1IBKB 2UXCB 1IBMB 4B3TB 2F4VB 2HVSA 4UCSA 4LH6A 1IBLB 1CKOA 1CKNB 3W1BA 3GDEA 4LF6B 4LF4B 3S24A 4DV4B 4YY3B 4DUZB 2Q2TA 4EQ5A 1HR0B 4DR4B 4X64B 4CC5A 4LF9B 3RTXA 3BA8A 1HNWB 2UXBB 4DV5B 2ZM6B 1N33B 4LFCB 3JSLA 4DV0B 3T1YB 4UCTA 5BR8B 4TOIA 5FPOA 4DUYB 4DV1B 4X65B 4DR1B 2E5LB 4AQYB 4B3MB 4PZ6A 3SGIA 5D1OA 4JI6B 4NXMB 5FPRA 4UCOA 2HVQA 1XK5A 4GKKB 2UXDB 3GJXB 4PZ8A 3RR5A 1XNQB 3KYHC 1ZAUA 4UCVA 1B04A 3W5OA 2UUBB 4GKJB 1CKMA 2HHHB 1XDNA 1X9NA 4JI3B 4DV2B 4DV6B 4DR5B 4B3RB 3TY8A 4DR6B 4EEQA 4YHHB 1HNZB 3NBYB 1XMQB 4PZ7A 4NXNB 5LMUB 3QWUA 5DISC 3UQ8A 3GB8B 4EFEA
chains in the Genus database with same CATH superfamily
4JI6H 2WTFA 4JI0B 1A9XA 2Z02A 2QSAA 4QIWA 4P9OA 4JV2A 1J5EO 1M56B 1VIBA 3JATA 3CP1A 4GX2A 5H9CA 3L2PA 4EBCA 3RVYA 2E2HA 3UO2A 5EOYA 5KFGA 3RYFB 4NTYA 4IRCA 3GIKA 4GC7A 4NR1A 1JOYA 3BQ2A 4GX5A 2PYJA 3U9TA 1IBKO 1YIJV 2NVXA 4LSXA 2VWKA 3GIPA 3HXLA 3G6VA 2WLHA 4JV5H 2V9WA 3UO3A 1WRVA 2JA8G 2W0FC 5KFDA 4YR2A 1SYXB 3STLC 1CPYA 2YSUB 3W7TA 1JJ2U 3K79A 2YWVA 2EZOA 1Z2PX 4DV3H 4JI2H 4X62H 3SYAA 2W6OA 2F1MA 3PN1A 4EYIB 4O82A 3BHPA 2ZM6O 2R9RB 1QHTA 3Q4HB 4HBNA 5KHHA 2X5RA 1GAXA 2QE7G 4E4TA 4FS2A 4LCUC 4NXMO 3T1HH 1BT8A 1DV2A 3DTUB 4B7EA 4B08A 5KG3A 3CYOA 1VEWA 2V59A 2F4VB 2XCLA 1WCMA 4XDLA 1I08A 1Q6UA 3U0GA 5H6RA 4QPJA 4FPPA 4YBZB 3BRCA 2ZR3A 5DGAA 4N23A 4YY3H 1M57C 3GIDA 3G6BA 4O4LA 1I7NA 3ZHSA 1PM9A 2BCCH 2WLKA 1OBDA 2UVWA 1JDEA 4YHHO 1H38A 1XMQO 3OSPA 3D36A 1K7DA 4UCTA 1XNRH 3HB3B 4DR7H 3OEHG 3AG2C 3RAQA 5D5PA 4B3MB 1LUWA 2P0AA 1I94O 4MAMA 5EBLC 5CA0F 3WB1A 3K5OA 2QKAA 2W0XA 3ZHTA 2X6CA 5CN0A 2DE0X 1Q3EA 5BWWA 3KG2A 3N2GB 5JUMA 3DC5A 3F7YC 4DR4H 2JIZG 4YB8B 2OYQA 3Q8QB 2FK3A 3HKDB 3IJ4A 1K34A 2DW4A 5K1PA 2EX3A 3RW0A 3G4SV 5DGBA 4B3RH 3TY8A 4GLWA 4O3PA 3RGXA 1JVMA 2Q6AA 4K8XA 1ZL8B 2ALZA 4RB3C 2YS7A 5CA1A 5DG7A 4A3LG 4XZ3B 2H94A 1D5NA 1XMOO 3K0DA 3LNNA 4WBNB 4RAZA 2W8LA 4OXSA 2R9IA 3VBBA 2V4RA 5KFJA 2RGRA 4O84A 5LL6Y 5LMNB 1BCCH 5KT5A 1CS0A 5CB4A 5FNVB 3VMMA 2KG7B 3MDSA 5I5TA 1K73W 5EBMC 4QWEA 3PZPA 1EUCB 2JEGA 5IJ9B 1VQ5V 4X89A 2Q4PA 2YCHA 4LF5H 3N44B 2EILB 5IT9W 2QM7A 4LF4O 4K3AA 3SYCA 2W6PA 4B3SB 2XD4A 3STZC 1L0LH 4CS3A 2CDYA 4X1YA 1AR4A 2JJ1G 2NNUA 3AG4B 2ZNIA 1FPOA 2EIKC 4KUMA 4O4IF 5BXZA 4X65O 1WP7A 1FFTB 2DJVA 5JCOC 2UU9B 2W9AA 3GILA 4LC1A 1N36B 1VQ4V 4PDRA 5JJNB 3MR3A 1FFXA 3TJTA 3J81N 2GV9A 3AG1B 2FMAA 3OUFA 1IBMH 1OCZC 4FM1A 3WWIA 3Q8SB 5L3CA 1M5IA 2CH7A 4UCSA 2A7WA 1K83A 1A3GA 2HJWA 2ZQMA 4CH6A 5BWTA 1GSOA 5LYJB 3RYCB 5L1JA 4FJCC 4IHJF 3ETEA 3RYHA 2R7ZG 2PUSA 5KA6A 4JI8H 2Y0SA 2DN9A 1Y6XA 1JLLB 3PO3G 4X1KA 1PX2A 1N4CA 1HNWB 2ZDIA 2RN9A 5KT3A 1I2KA 4FZ1A 1UFIA 5LMUO 1KT8A 1WJZA 4O4JA 1DAAA 4RU9A 4DV1H 1TUBA 2DOSA 4F4LA 3L70H 1OHHG 2FLLA 2EINB 3JRWA 3ABLC 5DG8A 4KP4A 3MWEA 4FLVA 2CKZB 2P6JA 2OCHA 5JQGB 1MZBA 2PVPA 5KHKA 5H80A 2I8CA 3LQSA 1Y74B 4TQSA 4O4HF 3ABTA 3J80N 3L75H 2CNQA 2Q69A 1M90W 3VPBA 2Q73A 2LW7A 4A3EG 3JCZA 2GPWA 4DV6H 2CGNA 4A93G 2BSKB 3CRQA 3OUZA 1AJNA 5B1BC 1PV0A 4TQFA 2ZXWC 3K06A 1FXKC 1S3JA 4HAMA 1XEQA 3M9MB 4DV7O 1K1SA 2FE3A 1KUTA 4HZ3A 4X1IB 4ECQA 3ETQA 3QTCA 3F5TA 4LFBB 1SKVA 3LSUA 2LP7A 2MW2B 1BZKA 3I5DA 4RB1A 1G8MA 1YJ9V 2PYLA 2VUGA 4Y8VB 5KHIA 1VQ6V 2QTOA 4K35A 4A3JG 4DIMA 4LH7A 1T5EA 1WA8B 5B1OA 3ZRVA 3OTOO 1UC8A 1I1MA 2ZINA 2HIXA 3MWDA 2W6IG 5GW7A 5FD6A 2WE6A 1HWYA 4J7JA 3BQ0A 4B3TO 1C30A 1Y76A 1JKJB 2R85A 2FJZA 2D2CB 2NVYA 4BIZA 5IYDO 3T9EA 2E74B 1IOWA 1M56C 2YS6A 4O2BA 1GSHA 4ZQIA 1S9FA 2QGNA 5J2UF 1VQNV 2DLNA 1GM7A 3SPIA 4MTEA 2FPPB 3HBLA 1E1RG 4OX9H 1BSMA 2UUAB 1HNXH 3W7UA 3V4ZA 4ICGA 2RNBA 1IXBA 4DUYO 1P16A 4Q8EA 4BBSG 1KP2A 4I0XB 4AQYO 1Y1VG 2GUZB 5BWRA 3RB0A 1Z5WA 3PR4A 1EFRG 2VPSA 4AILC 4LF7B 1XL6A 2VPQA 1AJPA 2DYRC 2VOBA 3UZBA 2SCUB 3SPHA 4ECWA 2Y69B 1YI2V 1AROP 5B5EZ 2UUBO 3CD6V 1YF2A 3CXCU 3OTFA 3GDEA 1CEZA 3TIIA 3WO1A 4DV4H 4WF9V 4G3IA 3CVZA 4DW0A 1KJIA 1HR0H 4X64B 4JZ2A 4MVMA 2JJ2G 1VF6C 1BE3H 1IOVA 4NXNO 3KTMA 4IIJF 4EGQA 4BBRG 1KECA 3JALA 3RWRD 4JZGA 3ORRA 4TV8B 2Q7GA 3E8BA 5C8YB 5D1OA 2Z04A 3RR5A 4YJ2F 1XK5A 2UXDH 2JA6A 4H44B 2QB5A 3ASOB 4O4LF 1KD1W 2B5UA 4ZHQA 3E22B 4UCVA 1B04A 4F6RA 4I50B 4DL2A 5EYPB 4JYYA 2J6SA 4ECZA 5KT6A 3E86A 2HG5C 4MV9A 5HNEA 3B2EE 5IWAO 4EBEA 2CTPA 4IGGA 1RSOB 1HNZB 1E4EB 4I55F 1OCCB 1RK6A 5B1AB 2QA4V 1S0MA 4YJ3A 3F7VC 2BTQB 4PV1B 3BACA 4QPKA 4RQEA 3GTJA 5BMVB 5LMNO 3T5HA 3HOXG 3CB2A 2A1HA 3WG7B 2C2RA 5CAEB 3OGIB 4JYBA 4U3JA 4JYAB 4JI5H 1Q8IA 1QLNA 4EB6B 4CH3A 3LUTB 3H9VA 4DYLA 1SERA 2VQEB 1ZHSA 2R8HA 3DAAA 2R7LA 4K6NA 2ZDHA 5HBRB 5BYAA 4QJFB 4RAIA 2EJ7A 3T9AA 2CTWA 5I5XA 4LP8A 1VQLV 1AUXA 4QE7A 3CC2V 1A0GA 2OCCB 4W4KA 1KJJA 4PBCA 4TSFG 4DR3H 1V51A 4MTOA 4DR2H 2AZ2A 4FBTA 4BY7G 3T5JA 1AR5A 3THOA 3P30A 4DV0O 2HHFB 2UU9O 5BR8O 2E3CA 1DF4A 2YXLA 3UCSC 1XHXA 1GRJA 2Q2UA 4JI6O 4GZRB 1IBKB 4J0MA 4NZNA 1UC9A 3U55A 4LSAA 4J9ZB 3HKCA 4H37A 3FKIA 2YZMA 2GTAA 1SA0B 1G1XB 2RQ6A 5CBHA 1XHZA 1AB3A 1QNMA 3AG4C 4LF6H 3R5HA 4I5SA 2IBZH 3TCUA 3VQYA 4CS4A 4QWDA 4LF9H 2XTAA 1B06A 3ZHUA 3FKSG 3GTOA 5DMXA 2PZSA 4DAAA 2ZM6B 5KFSA 2B63G 1N33H 3X2QB 2AQ4A 4YP3A 3T1YH 3T4ZA 4UVBA 3AG1C 3TXSA 4MVOA 3RT3C 5GONF 3KCYA 4F50A 4C5CA 3SJAC 4JI1H 3K5NA 4NXMB 2HJFC 2FPIB 3DTGA 2IJJA 4JI2O 4X62O 3R5XA 4YAKB 3R66A 4WFFA 4MTDA 5I5WA 2N04A 2JS3A 3V6KA 2F23A 3JARB 1FJGO 5D8DA 4R8UB 1Z2NX 3N6RA 2FK1A 2FKLA 2W9BB 5ITZA 5CA0A 5L3FA 2W6MA 3NUAA 1X9NA 2QWNB 2VWJA 1AN7A 3UKMA 4IR9A 2CTRA 1AP5A 4P30A 3JD1A 5DLGA 2EINC 3ZMVA 4EEQA 4YHHB 2Q7DA 1XMQB 3M4IA 4YXWG 4NLGA 5KX5F 4H0LB 2W71A 3CCVV 4JAUA 4FMTA 2ZD9A 5LOVF 1I94B 1A48A 1MSWD 4XDKA 5KT7A 4NTWA 3KAJA 3K9SA 1JCHA 2ODTX 3PFFA 4J80A 1PD3A 5IYBO 1OCRB 3JAWB 4GKJH 3L4JA 4CBCA 4ME6A 4NVPA 2DMXA 4QW8A 1JX9A 2R87A 4K0KO 2BR0A 2UXCO 3TINA 1FKAH 2AXTZ 1CQJB 5KG1A 3P3NA 3B8NA 1V9PA 3G6EV 5KFZA 3IAYA 5DLFA 1ULZA 3N8DA 4O3RA 2QWRB 1BGYH 3GWKC 3L72H 1M4UA 2YW2A 2R92A 1B6SA 1P7BA 3ETGA 1QLEB 4TUYF 4ASUG 2YYAA 5KUKA 4Q0YA 1K92A 3EPIA 1XI1A 2HJDA 4DR1O 2UUCB 1VF5B 4UB6Z 1RP3B 4O7TA 4I4TB 2ZE8A 1S10A 1GK9A 4FLWA 1Q6HA 4MV1A 4IT5A 2R72A 2BOBC 4IAJA 2K1EA 4MVQA 4AI8A 2F4VH 3RYIA 3HT5A 5JH7F 3SPJA 3Q8PB 4GX1A 5BYBA 5KG2A 1S5JA 2ZR2A 4MVRA 4LFAH 1ORQC 5KFWA 3S24A 4LF4B 1I7FA 2Y0SE 2ZE5A 3V6JA 1L0NH 4ZOLF 3G8CA 4DV2O 2CW8A 1KMIZ 4UXNA 3E5NA 5I60A 4IHJA 2FP4B 2Y4UA 1BMFG 3CCUV 5KG6A 4X65B 2E5LO 2QEXV 5I5UA 3CJHA 3MD0A 3FYEB 1NH2D 4B3MH 2EIJB 3OMNB 2EIMC 1Q81W 5L1KA 4RB0A 2R7MA 2FLNA 2LFRA 1KYOF 3K08A 1NTMH 3SYPA 1KTAA 1N0JA 2XASA 4JF3A 3CX5F 5JJJB 5IYCO 3ZMTA 2GQRA 5J9PC 1XDNA 3OM3B 4FLZA 3K3VA 2ADQB 4E4EA 2HGWA 4HR7A 1RFYA 4O2AB 4O4HA 1N0NA 3SNOA 2Z0AA 1BHAA 5J2TB 3BEHA 5LMUB 4RZRA 4ZHQF 3OR7C 4UUGA 2OIEA 1KUQA 4A2AA 2BQ3A 3ASOC 1R6KA 3I55V 1S0NA 1VQ8V 2R7ZA 2ZXWB 3JASB 4BWAA 3WNZA 4JI8O 1XNQH 4NB5A 1VAJA 4ZBMA 2F66C 1TAEA 4UFZA 4JI4O 1UJWB 3ZJZA 4PA6A 3ETDA 4F6EA 3IG0A 2HFEC 4JYAO 2M05A 2J6UA 2I87A 1AVMA 4NKGB 3JZFA 2X0LA 3TY9A 2FYUH 3RFRA 2NU9B 4DLKA 1LUVA 5EDWA 4RO2A 3VNNA 1OCCC 4JI3H 3FB5C 5B1AC 1WB7A 4HNAB 1WH2A 3RV4A 1VKZA 4JI7B 4LNUB 4J9PA 3ZRWA 4FFMA 3J7AK 3K59A 4M7EA 1H8EG 5LP6B 4EGJA 4ED6A 2P67A 4B3SH 2JEUA 3WG7C 3RJ0A 4DV7B 1I5XA 1AJQA 1SRYA 1H8HG 4O3OA 4X20A 5H6QA 1JJOA 3FB8C 3N41B 3K5LA 2PMZA 2WLJA 5J2UA 4I9QA 3JSNA 4IR1A 5JVDF 3OTOB 1N36H 2YIBA 2VA2A 1I6UA 3HOWG 5KFYA 5KG0A 4B3TB 5IY5C 3JATB 2R8KA 2UVUA 4LH6A 2OCCC 1AI6A 2FTKA 1ZWIC 2DYRB 2LGQA 2R9AA 4KL1A 1Z2OX 4Q4CA 4ED2A 3QG5A 3UT5A 3CC4V 4YR3A 1XL4A 1NR7A 3CCJV 1W59A 4E2LA 3OHAA 1IXMA 5KFAA 3FD9A 4DR5O 3AK1A 1HNWH 2RDCA 2GPSA 4QSHA 2JGDA 4NYEA 1JIHA 4DUYB 1IYEA 3HOUG 4AQYB 2ADPA 2W70A 4ED0A 2Z5UA 3AEIA 4WFBV 4PZ8A 3RV3A 4IIJA 3TQTA 2R86A 5IYZF 3E2EA 2CNVA 3JZIA 1IBLH 2GLTA 1RPRA 3A0BZ 3GV5B 5B1NA 4FM2A 2N74A 3DTFA 2ASLA 3D8CA 2IJIA 2UUBB 4YJ2A 4C2MA 3HKEA 3X2QC 2EJRA 4UVAA 4TV9F 3U54A 5L3BA 3AW8A 3BFRA 3G6YA 4PELA 3QZ8A 1N48A 3T9DA 3GTKA 3CSWA 2EULA 1VMGA 4UV8A 1QR8A 4NXNB 2VA3A 2QF7A 2E76B 3WFVA 2WA3A 2VRZA 1I2LA 4WFHA 2JS5A 3SR2C 4I55A 4JTDB 4LFBH 3SE7A 4HYOA 1CKNA 4CH5A 5LXTF 2HLDG 2V58A 4YR0A 4MSWC 4NYKA 2VUMA 2C00A 4KFMA 4DL5A 4J9YB 4Q43A 1S03G 3GTPA 3K3WA 5HFMA 3ZIAG 3OSNA 4DR6H 2Y0PA 3RBZA 4QW9A 1X4TA 5IWAB 1THZA 3HOVG 5BWVA 2IU0A 3ZRSA 4PA4A 1V4YA 3C90A 1ZLZA 2PTMA 1Q82W 3A0RA 1SQPH 3T9BA 1OCRC 4XYMB 2UUCO 2WPDG 2OT5A 1XREA 2ATLA 5FNVA 2JGUA 5KG4A 5KAIZ 4FLXA 3CSXA 4MS2A 5LHHA 2WLIA 4O7ZA 4A3KG 3CRMA 2B1IA 5CA1B 4TWKA 1JA8A 5KT2A 4LF7H 4FBUA 2IMWP 1JQ0A 2VQFH 1DK1A 2GBOA 3E83A 4A5UB 4RUCA 3RBDA 1QLEC 5CB4B 4QWCA 3J81W 4I7ZB 2C2EA 2NU8B 2QDOA 4X64H 4PI0A 3RTXA 3WWHA 5KFTA 4M9UA 5DEDA 4I7HA 3DXRA 1P84F 4DL3A 2ODMA 1V55B 4DV0B 5BR8B 2KB1A 3HO8A 4FM9A 1H2MA 4R7RA 3H1IH 4H33A 4X9QA 1JPXA 5LA6F 3UM7A 4O7VA 4JI6B 4A3IG 4UCOA 3GTMA 4LBEC 2XGQA 4X66O 4X1YB 1OV9A 1NT2B 5GONA 3L73H 3RGZA 2FB9A 2YC0A 2BTOA 4A3CG 3IC9A 4CKEA 1AP6A 5IT9N 5C1OA 1FFXB 3LDCA 4DV5H 2GSMB 4J42A 5KFOA 5EZYF 4FM0A 2XUMA 2IU3A 1HNZH 4RAYA 2EIJC 2CH7B 3ZCCA 3J80W 2LJ2A 3LSSA 2YIDA 3GB8B 5CMUA 3PW0A 1NQTA 5JQWA 4GKKH 1KB9F 3RYHB 2ASJA 5TISZ 2FL4A 4J7ZA 3LWBA 1TWCA 3A0HZ 3CHXA 3KKYA 5DAAA 4JI2B 4X62B 1N32O 2GDSA 4X1KB 5KX5A 2QM4A 4ED8A 3KREA 2FLPA 2B63A 1FJGB 4ECUA 2FB5A 4O4JB 3FFQA 5LOVA 2HHHH 4ECXA 4WHXA 1TUBB 1W96A 5JVLA 3KZIZ 1P8LA 4TQDA 3H0GG 2VQEH 2ITCC 1O9GA 3DC6A 4JI1O 3T1HB 4NZMA 4JI7O 2XAHA 2ZIOA 3W1GA 4MV6A 2BSKA 3Q1KA 4IRDA 1Q43A 1VBGA 1Q6IA 3HKBA 1VQOV 1G6UA 4EEYA 2XAJA 4FE2A 2LW1A 3ZMUA 1MSDA 4E6NA 4ZI7F 1J5EH 1YTFD 4LFCO 3LULA 2RDIA 1M0TA 1JDBB 4J9RA 2ETNA 5IYDG 1UPGA 3CCRV 4HNTA 4TUYA 1XNRB 1TWFA 3ABUA 4TQRA 3ZN0A 4U3FH 4DR7B 1N34H 3OUSA 2JEXA 3F5WC 3KHLA 4K0KB 3KHRA 1IBKH 2UXCB 1B3QA 2YU9A 4JUZA 2C22A 3JD0A 5LP6C 2JVDA 1VQKV 4ED7A 5DQIA 3SI8A 5EIBD 3B40A 3FMAA 4MW3A 2C28A 4GKJO 4F4ZA 2HDKA 3T54A 2HP8A 5JH7A 4DR4B 3ZX6A 2AGQA 2GHYA 1K33A 3ASNB 5A9GA 2ZM6H 3OT7A 4U6PA 4MTXA 4FLYA 1BQZA 1Z5VA 1WPBA 1I5YA 4J7KA 4DR1B 5F9NA 4RNOA 1GMGA 2PGGA 4ZOLA 2ZIMA 1GSAA 2YXYA 5DGHA 2JA5A 4MV3A 5FD5A 4W4LA 4O2BB 4NXMH 1P7GA 2HVQA 2YXHA 3G8DA 2WSSG 4LF8O 3K58A 2EIMB 4WFAV 4J10A 4O3SA 1WCMG 1W93A 1RK5A 3IC7A 2G38A 3H01A 4MV7A 2W8KA 3JAKA 2QTSA 3CRAA 2XT9A 1R6NA 2R7KA 3H4BA 3CRCA 3MHSC 1EYZA 4PWQA 2HVKC 2XCAA 4KHPO 1S72V 4Z2WA 4RQFA 4DV2B 1WSCA 3DGEA 3OMAB 1NBMG 3RN4A 2QYZA 1AILA 1B6RA 4YHHH 4A3FG 2HG8A 1XMQH 2ZNJA 1XOUA 4LFAO 1T36A 2E5LB 2PI5A 2DPIA 4QNHB 4CKCA 3JRXA 3E8FA 5KA5A 1U97A 1I94H 4PDVA 5KFVA 2Q0OC 3BVOA 1BXRA 3R23A 3EHBB 1S0OA 2A0LA 1T3NA 3CQZA 4O7YA 4IWYA 1W2BU 2OLSA 3JALB 2Q9LA 4BXXG 2F95B 1V54B 1FAFA 5KFHA 4LWSA 3UZOA 5D1OB 4GCZA 2OTLV 1Q90D 2WAMA 4F6RB 3VQXA 2YEVA 3OR6C 1PP9H 2BTQA 4DUZO 1XMOH 5KAFZ 3D36C 1YTFB 2QK4A 4JI8B 5KFNA 1RYSA 2WLLA 4JI4B 1KBLA 1GO3F 1KJ9A 3T9FA 1SESA 2PMZE 5DQGA 4J9SA 3C0FB 3CS5A 3WWJA 3TGUH 5DM6V 1BHBA 2ZE6A 5CE8A 2HKOA 4N21A 4YJ3B 2ATKC 2PF4E 3FDSA 2PN1A 3GV7B 4O86A 1KQSU 1XNQO 3JD2A 4WBNF 3MHHC 5EWFA 4DL4A 3L4KA 1Y1WA 2DYSC 2P4KA 3MFHA 4JV1A 1GN6A 5JVDA 3GV8B 1CXZB 3SPCA 5IY5B 1EBOA 3FB6C 2JA7G 3CWBH 2ZCEA 1K5QA 5FNVF 2KSDA 3EYYA 4TT3G 2PY5A 4LF4H 4U3JB 3H4DA 1GKFA 3HKZA 4QWAA 2K9PA 2R93A 3N42B 5EBWC 4CMFA 4WFGA 1E79G 2ZT9B 5KG7A 4YIPA 1IX9A 5H2FZ 4M0JA 4WD3A 1N56A 2KKWA 5B3SB 4X65H 3CE2A 2Q0AA 1WPXA 3RB3A 1TUEB 4HNUA 2Y0IA 4RCNA 2C2DA 2W7PA 5EWEA 1QVGU 4GYCB 4HNVA 2YIAA 4CS2A 5AG2A 1PNMA 2FMLA 5I5VA 4JAAA 2W9CA 1M6VA 3SPGA 4A3GG 3OGCC 3N2KA 1QVFU 1S77D 3R9RA 3ZMZA 5IYZA 1V55C 2FKXA 5FLXW 4DRXA 1AI4A 2V5AA 4JGSA 3OW2U 3G71V 2UXBH 3R5FA 4JV5O 4DR5B 4HYKA 4RB2C 4DL7A 5DISC 5LMUH 3HKCB 3ETHA 2DZDA 4RNNA 4TV9A 4QGPA 5DECA 2E2IA 2YUAA 4DV3O 5LYJF 1G4YB 2P06A 1F4MA 3LSQA 1SQQH 2DWDC 4UCUA 3S3XA 5L3GA 4PI2A 1MZEA 3OHBA 4IRKA 4JPRA 2CQYA 1SZTA 2A9HA 2IH3C 5FL7G 2R6FA 3K3PA 3T1HO 1I50A 1GM9A 1SZXA 1GO3E 1WP8A 3O65A 2XNDG 5LXTA 3U9SA 4G2KA 1BGWA 1IBLO 3MJFA 2ILMA 3FAVA 4MW8A 5JQGF 1BJTA 4JV0A 1JFFA 5IYBG 3IN5A 1OZ0A 1PPJH 4JI0H 2R8JA 4CC6A 4D7SA 2IJHA 4YY3O 3H1LH 2XOKG 3WB0A 3RB6A 2HR3A 2ZDIC 3K5HA 4DV7H 5ITZB 5CA0B 5K3WA 4BY1G 3T1CA 3VQVA 5FR9A 2AGPA 2P5OA 1EN4A 2YRWA 3ZBHA 1QCEA 1KKCA 1XNRO 4O7RA 5DG9A 5KMGA 1B33N 3M7MX 2CFMA 3JAWA 4J9OA 3FB7C 3K0GA 4DR7O 1NI8A 1KKDA 3OTOH 1CQIB 4U7CA 2LFSA 4PHZA 5EC2C 2AZ0A 5K2MA 4R6ZA 1KU9A 4B3TH 3MFIA 4Q20A 3JAMN 1H2GA 5KFRA 4LMYA 2L6LA 3W1BA 1EN6A 4DR4O 3P3PA 1GN4A 3HPLC 3CPWU 1ZHQA 1NKDA 3A2FA 4B3RO 3DF7A 4DR6O 3JSLA 2XAQA 5FPOA 5FLMG 5IP7G 4AQYH 4ABMA 5KFLA 2F43G 3F8NA 5JCOA 1WN7A 2E75B 3A8TA 1S5HC 3GB7C 5B66Z 3JYCA 5GTHZ 3GLKA 5LA6A 3VOUA 5KUMA 3B77A 1QBZA 2UUBH 1LNQA 3G67A 1SCUB 3BG5A 3ASNC 4O83A 1TWAA 5CR5A 5HV6A 4L8JA 1TVKA 5KFFA 3NXSA 1EZVH 4O4IB 5F9LA 2YIBD 2XGPA 4DK1A 1R3KC 2X7RB 2YICA 4LF5O 1TWHA 3NBYB 3RYIB 5A2QN 4NXNH 4A3DG 4FLUA 2EIYA 2BQRA 3ZHQA 5IYCG 1RJPA 1FD9A 5EZYA 2IW5A 3VPCA 5IJ0A 2JA6G 4ECYA 2UXNA 5I5YA 4X66B 1HP8A 3GVMA 2CUGA 2LO1A 4FFLA 3TY5A 3OUUA 3PVXA 1RJQA 4IHJB 1I0HA 3EPGA 2GQSA 4FIPC 1JX4A 3CJHB 3RGBA 5CBGA 1IBMO 4TV8F 5C8YF 3UFXB 3WB2A 2QKCA 2PI4A 5IWAH 3RB4A 5BPHA 4MVSA 2PBZA 2V4QA 1K9MW 2CNUA 5KFXA 1R73A 1AI7A 3C3TA 1KBHA 1OBGA 2QJ1A 4P2ZA 1QR9A 3RVZA 4I50F 4DRFA 5KT4A 4IYIA 1FXKA 3LDDA 3M8AA 2RF4A 3NBZB 1H2LA 4OGQB 5LMNH 1KEEA 4DV5O 5KKNB 1M0WA 4RWUA 1N32B 1R9TA 2AU0A 4O4HB 4DV1O 1V54C 1OJHA 2QWQB 1ZTEA 4ETSA 2DAAA 3BQ1A 1BL8A 1AR1B 5L3DA 4ZI7A 4GKKO 3CRRA 4FFBA 5CBFA 4WCEV 4JI1B 2Q67A 2YS8A 2JRIA 3VQWA 2A3QA 5BMVF 4R7CA 4DO2A 2CAZC 2L35A 3AYHB 3CEIA 4CHIA 2FK2A 3BY6A 4YAJB 2COGA 2HHHO 4CE5A 2WB1A 3QF7A 3GIMA 4I9WA 4PA9A 3HB9A 4DV6O 5LGUA 5BWUA 1PNKA 5H5NA 3KAKA 1H2NA 4LFCB 3RYFA 4DV0H 3U0ZA 1IYDA 2CE4A 3JD3A 2COJA 2R8GA 1T94A 1E4GT 2UU9H 2LQTA 4L87A 3ETJA 3ZRWB 2P4VA 3CCLV 2VS0A 2KQXA 5EIBC 2QR4A 1K5SA 3E8GA 1YJWV 1DTOA 4WFEA 4OPAA 2QWPB 1HDJA 4NZOA 3KYHC 4AYBE 4XBFA 3K9AA 2C35B 1M9NA 4X20B 5D5QA 4ZKIA 3FKIG 4UV9A 4FGRA 3PW5A 2DIKA 1XUQA 5J2UB 4GKJB 5BWXA 2EJ0A 3N27A 4B7KA 1N34O 1G2WA 4ECRA 4FVMA 5B3SC 3Q4HA 1PKXA 4JAVA 3QWUA 5C44G 1NH2B 2WDTA 1VF6A 1R3IC 1MMMA 2D3OW 4XDJA 3UT5B 1S5LZ 5KFBA 4MA5A 3RF2A 5BPFA 1KP3A 4CZZA 4OX9O 4FFKA 1HNXO 1RYRA 4LF8B 3GIQA 2JGDB 4KXRA 3ZMSA 1Y1VA 1FJGH 1ZSPA 1I1KA 2UVRA 5EK0A 4O7LA 1X59A 1NR1A 1EKVA 1Y66A 3MR2A 4UB8Z 3ZHRA 3I4NG 4KHPB 4TM5A 1YSCA 4IIJB 3GIJA 1K4CC 1R1BA 5HFLA 2YRXA 1NZ6A 3Q2OA 2FPGB 5IE9A 4XX0B 4DV4O 4LFAB 5KFUA 1D5AA 4Z1VA 4YJ2B 1HR0O 4GX0A 4O4LB 1I1LA 3GTQA 3HKEB 1DLBA 4BIOA 3CC7V 1BQ0A 4JTAB 5EWGA 2I80A 3CCQV 4FK5C 1XDCA 3W7XA 2VR1A 4A3MG 3H20A 2KSWA 2X6AA 3N2GA 5DN6G 3ZS8C 3QNEA 2OH2A 4NTXA 3HKDA 2UXDO 4K0KH 2UXCH 3L71H 3V4SA 4I55B 3D3IA 4PDBA 1ZL8A 1VARA 1CKNB 4MV4A 2ASDA 2Q5ZA 2DYSB 1C3OA 3HKZE 4DL6A 4WBNA 4FZ0A 3RAXA 4DUZB 2R92G 4K8ZA 1F4NA 3ZRXA 3RUPA 4JXUA 2UUAH 3K5IA 5KFIA 3BPZA 2RMKB 3H1KH 5LHGA 5LBQA 1EKFA 5KFQA 1GN2A 2KG7A 1AI5A 4DR1H 1FXHA 2X0SA 1U96A 3APOA 1EUDB 4J9NA 1MOFA 5IJ9A 3GQCA 3GJXB 3ICXA 1GM8A 2NU7B 2WLNA 1XNQB 2AHYA 2CTQA 3BCCH 3LDEA 4IWXA 1I7LA 4JI5O 1R3JC 2W6QA 3OFNG 2WLIB 4I4TF 1H2KA 4Q4DA 4JI3B 4DV2H 3ZN1A 1S97A 2EZPA 1PK8A 1XQ8A 3NGDA 5KG5A 3UQ8A 2JA7A 2DWEC 2E5LH 4O7SA 3ABMB 3JZ6A 2A06H 3K57A 1F7YA 1YZBA 4DR3O 1DIKA 1YCIA 3JD4A 4DR2O 3NC0B 5E79Z 1NVPD 4PJ0Z 1K8AW 3DXRB 1RM1B 4ECSA 2B1GA 4QE9A 1SFOA 2AHZA 1S68A 5LYJA 1K97A 2DPJA 5KLVH 3RYCA 1HW7A 1VS0A 3VOTA 2DQ0A 3L9DA 1Q7YW 1SQVH 1VBHA 3OEEG 1GGOA 2R84A 2HIVA 1GH6A 2JK5C 2ZE7A 4PA7A 2NN4A 5KHJA 3WU2Z 3Q8RB 2GTSA 2EJ2A 3QZ7A 4JV5B 1SEIA 3PO2G 5GONB 4X8AA 2ITDC 3M9NB 4LF6O 1YVWA 4EFBA 2HGSA 1DGSA 1Z2GA 3D3QA 4MTGA 3BABA 4DV3B 1N8RW 2QKSA 4LF9O 2HVRA 3EVKA 5JQGA 3QO8A 2UXBO 3E89A 2XAFA 3CMAV 1N33O 4JI4H 4J9QA 3T1YO 1Y74A 4O2AF 4O7NA 4JYAH 4BW5A 1YITV 5J2TF 1RJRA 3RBEA 1D2DA 4APMA 1FYJA 5DQHA 3EFFK 3SDLA 4EBDA 4G27B 3WO0A 5KX5B 1IBLB 5IDJA 3SYOA 1YDXA 4FFNA 1TWGA 1RPOA 5LOVB 1BS3A 4X1IA 3SYQA 1GTOA 4YY3B 4EYHB 3LMLA 1QQCA 4R50A 3TQ1A 2WAQA 4CH4A 1WA8A 1EHIA 2RDJA 1EN5A 1MZFA 1SETA 4JI0O 3TW6A 3HKBB 4ED1A 4MA0A 1E4FT 5LP6F 5FPRA 1EM1A 2F93B 1OCOB 1YJNV 2YL2A 3O9OA 1ZAUA 3PR5B 4Z1MG 5C93A 4O81A 1WR2A 2IP4A 2NUAB 2UVVA 1EZJA 1MA1A 2J9GA 5FJ8G 1K4DC 3AG3B 4TUYB 1ZQ7A 3CCMV 1FKAO 4PDLA 3CCEV 1Y76B 2ABJA 4DR5H 4G28B 1K3EA 4B3RB 4DR6B 4QIWF 3K03A 1IVSA 4I0XA 1F23A 2GUZA 1YHQV 3T5LA 1JR9A 2R82A 2ZGIA 4GUNA 4IZOA 4J9LA 4UVCA 2YI8A 4XYLB 1Y67A 2EJ3A 5JWPA 1GYFA 1NVPB 3T5KA 4A3BG 5JH7B 1YEWA 2Y48A 5D1PA 4AYBA 1SQGA 4Q45A 2XHBA 1VQPV 1NJIW 2OWOA 4DW1A 2XC9A 2OIGA 2YZLA 2CK3G 5L9XA 2JEIA 2AGOA 4ZOLB 3G6XA 4L1KA 5T14A 3OAAG 5IP9G 3CEBA 2F4VO 4YQWA 3L74H 3VA7A 4LF5B 2VQFB 2C2AA 1W0JG 1EKPA 3CXHF 3W7WA 3KXYT 3B8MA 4TV8A 1Y4MA 5C8YA 3JAKB 5BZBA 5LL6b 2Z3YA 3ML0A 1TGOA 3I12A 2J6TA 1ZUQA 3EXAA 4C5AA 3E22A 3APQA 3N43B 4BAYA 1R3LC 4U7NA 4U7OA 4I50A 5EYPA 4GT1A 2YZGA 5CM0A 4GLXA 4MT8A 4B3MO 2VUMG 1XILA 4J9KA 4MVUA 2DWCA 2YZNA 2MK3A 2ZDGA 1SF9A 1P49A 3LNMB 4J41A 2WA4A 3CMEV 1IBMB 4O3NA 3TXQA 1RSOA 1FS0G 3T4DA 2LGWA 1E4EA 3GIIA 3PW7A 4ZHQB 1S76D 3S3WA 2RGVA 3U11A 3TW7A 5GTIZ 2WB1E 4RUAA 4O7WA 2ARHA 4RUFA 3SJCC 4D6TH 2Q7HA 5BMVA 3TETA 4EQ5A 2O57A 2HEPA 4CC5A 3ABKB 4FS1A 3OMIB 3KHGA 4LWSB 3U10A 4DV5B 2UUCH 2IH1C 4FFOA 1L2ZA 2NR5A 4EB6A 4DV1B 3H3VH 2V7QG 2COIA 1KC7A 5K1XA 2YEVB 4FU0A 4EKWA 1FXVA 4A2BA 1I3QA 1UNNC 3H1JH 4QIWE 4GKKB 2W6NA 5L1IA 4QJFA 5C5JA 2WLLB 1MNGA 5E25A 2V1DA 3OE7G 1ZX3A 4J11A 2W7OA 3HOYG 5LGTA 3MR6A 2H3OA 5BY1A 4D7TA 2HHHB 1E1QG 2DABA 1L1FA 4JI3O 5CA1F 2W6JG 1ZETA 5L1LA 4FLTA 3KALA 3PW4A 2HHFA 4DV6B 1SS3A 2XAGA 2UXXA 5I47A 3H40A 1SQXH 2BE3A 4X88A 1VF7A 5JVDB 3TIGA 4R8CA 1M7JA 4B3SO 1KJ8A 1IZ3A 5CB4F 3M9OB 1WAZA 5KFCA 1IURA 2XIGA 4H13B 4X66H 3AG7A 2M6YA 1J5EB 1CP9A 1SA0A 1ENVA 3GTLA 1N36O 2MCTA 3AK2A 3VPDA 4P9PA 3E35A 2YDEA 1JXLA 1L8DA 1YXBA 2IM9A 1N34B 2EILC 1SC5B 5DGIA 1NTZH 3AX6A 3E8HA 4ZIBA 3RFCA 3ABMC 3SJQC 1WB8A 4C7UA 1A0IA 2W6ZA 2EBOA 1AUVA 2HVJC 3GTGA 3IGAC 2W9CB 3FYIB 2O03A 1RM1C 3N2KB 1BNCA 2WWWA 5IYZB 4C5BA 1SQFA 4DRXB 4ED3A 1HNWO 4CMDA 2QM8A 5F2VO 3CCSV 4OX9B 3JARA 4MV8A 4CKBA 1N32H 1M57B 4PD4F 1HNXB 4R8UA 1PL4A 3MR5A 1O75A 4JTCB 2W9BA 1NS1A 1Y14B 2OTJV 3QVNA 4PDMA 4TV9B 4ECTA 4JASA 5KFEA 4Q44A 3IFXA 3R65A 4JI7H 3AG2B 3NR7A 2HVSA 2M7WA 1WNSA 4TVIA 5FLXN 2Q8VA 4BWSC 2R8IA 1DV1A 1P4RA 4FFPA 1US6A 1M93A 4IYHA 4DV4B 4O4JF 2BOCC 2Q2TA 3JAMW 2Q7EA 1PL0A 1HR0B 4EG0A 2WYOA 4RNMA 3HOZG 1WLEA 4Q6GA 5LXTB 4LFCH 1IDSA 1W0KG 3FAVB 1O9HA 4TOIA 1SQBH 1JFFB 2ZJTA 3PJSK 2R7NA 3QO7A 3SGIA 4PZ6A 4LFBO 2UXDB 3SJBC 1A32A 4F4XA 1LR1A 2ZKOA 5KFMA 3T9CA 3QO5A 4PA3A 4F4WA 3W5OA 5KFPA 3JCUZ 1EZ1A 5KMGB 3MWMA 3TEKA 4LR3A 1B6QA 3ORQA 1KC8W 4BR6A 1MABG 3HR0A 1PNLA 4DUYH 3C3SA 3K5MA 3PW2A 1M1KW 4I4TA 4DXWA 4BW9A 1OCOC 1NU1H 4EFEA 2Y4RA 3N6XA 2N05A 2JA5G 4HQ6A 2Q68A 1TA8A 1XMOB 5A2QW 3KHHA 2RCVA 3ZEDA 3B4SA 2H8PC 2UUAO 4IL6Z 1FVIA 4LF8H 3AG3C 1H2SB 4MVZA 3BAAA 2EIKB 4JI5B 4UUJC 4LF7O 3QQMA 4ECVA 4O2BF 4KHPH 4O4IA 2VQFO 1R6TA 5LHIA 4UCRA 1VQMV 4HN2A 4J9MA 3B09A 4MTFA 3MAQA 4Q8FA 3GWOA 1OCZB 5C1PA 4O3QA 5LA6B 5CA3A 1VQ9V 2CZGA 3K04A 3T99A 1ROPA 4RUEA 2Y4TA 4X64O 2DQ3A 4DR3B 3FX7A 4AHCA 4DR2B 1GN3A 1TVKB 2NLJC 2ZDQA 2WLMA 3UYYA 3V6HA 2JEFA 4BIUA 5KHGA 1URFA 1CE8A 3T2MA 3LP8A 3G80A 1KJQA 2X6BA 3QFFA 5I5SA 3BA9A 4O2AA 5EZYB 2Y69C 5EC1C 5IJ0B 4FFRA 5C4XG 3ABLB 5J2TA 3P32A 3OD4A 2A79B 3KCXA 3M99B 1CKOA 1VP7A 1S0VA 1QU7A 2W57A 2P22C 4LF6B 1NTKH 3JASA 4DUZH 1JMKC 1MG1A 4LF9B 2XCPA 3BA8A 4RZQA 2UXBB 3T7AA 2CGOA 2WAQE 2AGAA 1HNZO 2YI9A 2R70A 1N33B 4YIOA 2V4DA 2IJKA 3T1YB 3BJYA 1Q86W 2NU6B 4JYCA 2P90A 1ET0A 3DSQA 3I4MG 1F51A 5E1AC 3AK3A 3N40P 4QWBA 2AW9A 3ZHVA 2P7TC 5B1BB 4HNAA 3W7SA 3I56V 3J7AU 1OWTA 4F4YA 3RIZA 1FXKB 1XBLA 1J95A 3TK1A 5KS8A 4LNUA 4GC6A 1Y1WG 4DQNA 5LP6A 1COWG 5KFKA 3ABKC 3H1HH 1K1QA 2QWOB 2CW7A 1DF5A 1CKMA 3H0GA 2HGXA 2B9ZA 2VQEO 4DK0A 5L3EA 2IBKA 4ZI7B 4YJ3F 2JDIG 4FFBB 2VQDA 5C3EG 2R93G 2IA6A 4OPHA 5BR8H 5JJEB 1VQ7V 4PZ7A 2RJZA 1GLVA 5LGNA 1Q5OA 2BQUA 2JEJA
chains in the Genus database with same CATH topology
4JI6H 3K57A 4JI0B 1I94H 1I94B 3NC0B 3JATA 3KAJA 3L2PA 5EOYA 1S68A 5LYJA 3RYFB 3RYCA 1HW7A 3JAWB 4GKJH 3L4JA 1VS0A 4NVPA 3JALB 2PYJA 2F95B 2HIVA 1FKAH 5D1OB 5KHJA 4LSXA 2VWKA 3HXLA 4JV5H 4JV5B 1V9PA 3IAYA 1SEIA 5GONB 4F6RB 3VQXA 4EFBA 1SYXB 2HGSA 1DGSA 1M4UA 2BTQA 3BABA 4DV3H 4DV3B 1XMOH 1Z2PX 2HVRA 4JI2H 4X62H 5JQGA 2F1MA 3PN1A 4JI8B 3BHPA 4Q0YA 4JI4B 4JI4H 1QHTA 1XI1A 4HBNA 3C0FB 2UUCB 4JYAH 5KHHA 4I4TB 4YJ3B 4APMA 3T1HH 4FLWA 4IAJA 2R72A 4B08A 3L4KA 2F4VH 3RYIA 2F4VB 5JVDA 5KX5B 1IBLB 1S5JA 4LFAH 2ZCEA 3BRCA 4LF4B 3S24A 5LOVB 2PY5A 3EYYA 4U3JB 4LF4H 1I7FA 4X1IA 4YY3H 4YY3B 3LMLA 1QQCA 4O4LA 2CW8A 3N42B 1KMIZ 4IHJA 4CH4A 4UCTA 1XNRH 2KKWA 4X65H 4X65B 4DR7H 2Q0AA 3HKBB 4B3MH 5D5PA 4B3MB 1E4FT 5FPRA 4RB0A 2F93B 4GYCB 2YIAA 3WB1A 3K5OA 4CS2A 1ZAUA 1Q3EA 5JJJB 3N2GB 3N2KA 1XDNA 4TUYB 5IYZA 4DR4H 5FLXW 4DRXA 4FLZA 2OYQA 3K3VA 2UXBH 3HKDB 5K1PA 2EX3A 4DR5H 4O2AB 4DR5B 4O4HA 4B3RB 3TY8A 4RB2C 4B3RH 4DR6B 5DISC 3RGXA 5J2TB 4K8XA 5LMUH 5LMUB 3HKCB 4RB3C 5CA1A 4A2AA 4TV9A 2YI8A 3LNNA 1GYFA 4WBNB 3JASB 4RAZA 4BWAA 1XNQH 5JH7B 1YEWA 1TAEA 2F66C 4UFZA 5D1PA 2RGRA 1SQGA 5LMNB 4UCUA 4PI2A 3IG0A 2XHBA 5CB4A 5FNVB 2OWOA 3TY9A 3RFRA 4ZOLB 3VNNA 4JI3H 5LXTA 4HNAB 5IJ9B 1WH2A 1BGWA 2YCHA 4JI7B 1BJTA 4LNUB 2VQFB 4LF5B 1JFFA 3N44B 4LF5H 3KXYT 5IT9W 3J7AK 3K59A 4M7EA 4JI0H 4TV8A 5LP6B 4CC6A 4D7SA 5C8YA 3JAKB 3WB0A 5LL6b 4B3SH 4B3SB 3RJ0A 1TGOA 4CS3A 5ITZB 5CA0B 4DV7B 4DV7H 4X1YA 3VQVA 2P5OA 2ZNIA 3E22A 4X20A 3N43B 1JJOA 4I50A 3N41B 3K5LA 5EYPA 5KMGA 5J2UA 3M7MX 4I9QA 3JAWA 2CFMA 4GLXA 5JCOC 3JSNA 2UU9B 3OTOH 3OTOB 1N36H 1N36B 5JJNB 4PHZA 2YIBA 1FFXA 1I6UA 2GV9A 1P49A 1KU9A 1IBMH 1IBMB 4B3TH 4B3TB 4FM1A 1RSOA 1M5IA 3JATB 4UCSA 4ZHQB 4LH6A 2R9AA 4KL1A 4CH6A 1Z2OX 2RGVA 4LMYA 3U11A 5LYJB 3W1BA 3RYCB 3QG5A 3UT5A 3RYHA 3SJCC 2Q7HA 2PUSA 5BMVA 4EQ5A 1ZHQA 4JI8H 2HEPA 4CC5A 4X1KA 3A2FA 1HNWH 1HNWB 3U10A 3DF7A 4DV5B 2UUCH 3JSLA 4O4JA 1L2ZA 5FPOA 4EB6A 4DUYB 4DV1B 4DV1H 1TUBA 4AQYH 4AQYB 5K1XA 4A2BA 3F8NA 5JCOA 1WN7A 4FLVA 4GKKB 4PZ8A 4IIJA 5JQGB 1IBLH 1MZBA 4FM2A 5KHKA 5LA6A 2UUBH 2UUBB 4YJ2A 4D7TA 2HHHB 3HKEA 4L8JA 1TVKA 4FLTA 3KALA 4O4IB 2YIBD 4DV6B 4DV6H 4DK1A 3NBYB 3RYIB 4NXNH 4NXNB 1VF7A 4TQFA 5JVDB 4FLUA 2JS5A 2FE3A 5EZYA 4X1IB 3SR2C 3ETQA 4I55A 3QTCA 5IJ0A 4LFBH 4LFBB 1SKVA 2XIGA 4RB1A 4X66H 4X66B 1CKNA 4CH5A 1J5EB 2PYLA 2VUGA 3TY5A 5KHIA 1SA0A 4IHJB 4LH7A 1T5EA 2MCTA 2ZINA 2HIXA 5FD6A 1S03G 3RGBA 2WE6A 1L8DA 2IM9A 1N34B 4DR6H 3WB2A 4ZIBA 5IWAH 1X4TA 5IWAB 1A0IA 2QJ1A 4O2BA 4DRFA 2O03A 2PTMA 3N2KB 5IYZB 1SQFA 4DRXB 3NBZB 4MTEA 5LMNH 4OX9H 4OX9B 1M0WA 3JARA 1N32H 2UUAB 1N32B 1HNXB 1HNXH 4O4HB 5FNVA 1P16A 2JGUA 1O75A 4FLXA 3CSXA 4ETSA 5CA1B 4TV9B 4ZI7A 1Z5WA 2VPSA 4FFBA 4AILC 4LF7B 4LF7H 4JI1B 2VOBA 4JI7H 3VQWA 2VQFH 2HVSA 1WNSA 4BWSC 2CAZC 5CB4B 3J81W 3OTFA 1M93A 3GDEA 4DV4H 3QF7A 4DV4B 3CVZA 2Q2TA 3JAMW 1HR0H 2Q7EA 1HR0B 4X64B 4PI0A 4X64H 3RTXA 2WYOA 4Q6GA 4I7HA 5LXTB 3KAKA 4LFCH 4LFCB 3RYFA 4DV0H 3U0ZA 4DV0B 2UU9H 1O9HA 5BR8B 4TOIA 1E4GT 1JFFB 3JALA 2ZJTA 4FM9A 3RWRD 4R7RA 4TV8B 2Q7GA 4PZ6A 3SGIA 5EIBC 5C8YB 5D1OA 4JI6B 4UCOA 3RR5A 1XK5A 2UXDH 2UXDB 3SJBC 4X1YB 1NT2B 3KYHC 5GONA 4ZHQA 3E22B 4X20B 4UCVA 1B04A 4F6RA 3RGZA 4I50B 5D5QA 3W5OA 5EYPB 5KMGB 5J2UB 2BTOA 4GKJB 3MWMA 4LR3A 4MV9A 1FFXB 4FVMA 4DV5H 3B2EE 4FM0A 4DUYH 1HNZB 4RAYA 1HNZH 3QWUA 3K5MA 2WDTA 3J80W 4I4TA 4YJ3A 4BW9A 3GB8B 4EFEA 2BTQB 3N6XA 4GKKH 3UT5B 3RYHB 3RF2A 1TA8A 5BMVB 1XMOB 5A2QW 3CHXA 4JI2B 4X62B 3CB2A 3ZEDA 4X1KB 5KX5A 2QM4A 4LF8H 4LF8B 1FVIA 1H2SB 1FJGH 1FJGB 4O4JB 5LOVA 3FFQA 2HHHH 4U3JA 4JYAB 4JI5H 1Q8IA 3BAAA 4JI5B 4EB6B 4CH3A 1TUBB 1P8LA 4TQDA 2VQEH 2VQEB 1ZHSA 1O9GA 3T1HB 3W1GA 2ZIOA 4KHPB 4O4IA 4KHPH 4UCRA 4IIJB 1Q43A 3MAQA 5LA6B 3HKBA 1G6UA 4LFAB 1D5AA 4YJ2B 4DR3H 4DR3B 4O4LB 4AHCA 4DR2H 4DR2B 3HKEB 4E6NA 1TVKB 1J5EH 3THOA 1M0TA 2E3CA 5KHGA 2KSWA 3H20A 2YXLA 3N2GA 1XHXA 4TUYA 1XNRB 3ZS8C 2Q2UA 4DR7B 3HKDA 1N34H 3BA9A 4K0KH 4K0KB 1IBKH 4O2AA 5EZYB 1IBKB 2UXCB 4J0MA 2UXCH 4I55B 5IJ0B 5LP6C 4LSAA 2JVDA 5J2TA 4PDBA 3HKCA 1CKOA 1CKNB 5EIBD 3FMAA 1SA0B 2RQ6A 2W57A 2P22C 1XHZA 4LF6B 4LF6H 4WBNA 3JASA 4DUZH 3VQYA 4DUZB 4CS4A 4K8ZA 1JMKC 5JH7A 4DR4B 4LF9H 4LF9B 3BA8A 2UUAH 4RZQA 2UXBB 3BPZA 2PZSA 2ZM6H 2YI9A 2R70A 2ZM6B 1N33B 2V4DA 1N33H 4FLYA 3T1YB 3T1YH 1Z5VA 1WPBA 4DR1H 4DR1B 3DSQA 2PGGA 4ZOLA 2ZIMA 3N40P 5FD5A 3SJAC 4O2BB 4JI1H 4HNAA 5IJ9A 3K5NA 4NXMB 2HVQA 3GJXB 4NXMH 3ICXA 3RIZA 4MTDA 1XNQB 3K58A 4LNUA 3JARB 4MV7A 5LP6A 1Z2NX 3JAKA 2CW7A 1CKMA 5ITZA 5CA0A 1X9NA 4DK0A 4ZI7B 2VWJA 1AN7A 4FFBB 4JI3B 4DV2B 4DV2H 5BR8H 1XQ8A 4EEQA 4YHHB 4YHHH 1XMQH 5JJEB 1XMQB 4PZ7A 3M4IA 2ZNJA 2RJZA 1Q5OA 3UQ8A 2E5LH 2E5LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 B;  1I94 B;  1TA8 A;  1XMO B;  3NC0 B;  4LFB B;  4JI2 B;  1TAE A;  4X62 B;  4UFZ A;  5D1P A;  4X66 B;  5LMN B;  1CKN A;  4UCU A;  4LF8 B;  1FVI A;  1J5E B;  3L2P A;  2VUG A;  3TY5 A;  2OWO A;  1S68 A;  1FJG B;  4LH7 A;  1VS0 A;  4JYA B;  3BAA A;  4JI5 B;  3TY9 A;  2HIX A;  1P8L A;  2VQE B;  2HIV A;  3VNN A;  3T1H B;  5D1O B;  1N34 B;  3W1G A;  4KHP B;  4UCR A;  4JV5 B;  1V9P A;  5IWA B;  4JI7 B;  4LF5 B;  2VQF B;  1A0I A;  4EFB A;  1DGS A;  4CC6 A;  4LFA B;  4DRF A;  3BAB A;  4DV3 B;  4B3S B;  2HVR A;  4DR3 B;  4DV7 B;  4DR2 B;  3NBZ B;  3PN1 A;  4JI8 B;  4E6N A;  4OX9 B;  4JI4 B;  2UUA B;  1N32 B;  1HNX B;  1P16 A;  2UUC B;  2CFM A;  4GLX A;  3JSN A;  2UU9 B;  1XNR B;  3OTO B;  1N36 B;  2Q2U A;  4DR7 B;  3BA9 A;  4LF7 B;  4K0K B;  4JI1 B;  1IBK B;  2UXC B;  1IBM B;  4B3T B;  2F4V B;  2HVS A;  4UCS A;  4LH6 A;  1IBL B;  1CKO A;  1CKN B;  3W1B A;  3GDE A;  4LF6 B;  4LF4 B;  3S24 A;  4DV4 B;  4YY3 B;  4DUZ B;  2Q2T A;  4EQ5 A;  1HR0 B;  4DR4 B;  4X64 B;  4CC5 A;  4LF9 B;  3RTX A;  3BA8 A;  1HNW B;  2UXB B;  4DV5 B;  2ZM6 B;  1N33 B;  4LFC B;  3JSL A;  4DV0 B;  3T1Y B;  4UCT A;  5BR8 B;  4TOI A;  5FPO A;  4DUY B;  4DV1 B;  4X65 B;  4DR1 B;  2E5L B;  4AQY B;  4B3M B;  4PZ6 A;  3SGI A;  5D1O A;  4JI6 B;  4NXM B;  5FPR A;  4UCO A;  2HVQ A;  1XK5 A;  4GKK B;  2UXD B;  3GJX B;  4PZ8 A;  3RR5 A;  1XNQ B;  3KYH C;  1ZAU A;  4UCV A;  1B04 A;  3W5O A;  2UUB B;  4GKJ B;  1CKM A;  2HHH B;  1XDN A;  1X9N A;  4JI3 B;  4DV2 B;  4DV6 B;  4DR5 B;  4B3R B;  3TY8 A;  4DR6 B;  4EEQ A;  4YHH B;  1HNZ B;  3NBY B;  1XMQ B;  4PZ7 A;  4NXN B;  5LMU B;  3QWU A;  5DIS C;  3UQ8 A;  3GB8 B;  4EFE A; 
#chains in the Genus database with same CATH topology
 4JI6 H;  2WTF A;  4JI0 B;  1A9X A;  2Z02 A;  2QSA A;  4QIW A;  4P9O A;  4JV2 A;  1J5E O;  1M56 B;  1VIB A;  3JAT A;  3CP1 A;  4GX2 A;  5H9C A;  3L2P A;  4EBC A;  3RVY A;  2E2H A;  3UO2 A;  5EOY A;  5KFG A;  3RYF B;  4NTY A;  4IRC A;  3GIK A;  4GC7 A;  4NR1 A;  1JOY A;  3BQ2 A;  4GX5 A;  2PYJ A;  3U9T A;  1IBK O;  1YIJ V;  2NVX A;  4LSX A;  2VWK A;  3GIP A;  3HXL A;  3G6V A;  2WLH A;  4JV5 H;  2V9W A;  3UO3 A;  1WRV A;  2JA8 G;  2W0F C;  5KFD A;  4YR2 A;  1SYX B;  3STL C;  1CPY A;  2YSU B;  3W7T A;  1JJ2 U;  3K79 A;  2YWV A;  2EZO A;  1Z2P X;  4DV3 H;  4JI2 H;  4X62 H;  3SYA A;  2W6O A;  2F1M A;  3PN1 A;  4EYI B;  4O82 A;  3BHP A;  2ZM6 O;  2R9R B;  1QHT A;  3Q4H B;  4HBN A;  5KHH A;  2X5R A;  1GAX A;  2QE7 G;  4E4T A;  4FS2 A;  4LCU C;  4NXM O;  3T1H H;  1BT8 A;  1DV2 A;  3DTU B;  4B7E A;  4B08 A;  5KG3 A;  3CYO A;  1VEW A;  2V59 A;  2F4V B;  2XCL A;  1WCM A;  4XDL A;  1I08 A;  1Q6U A;  3U0G A;  5H6R A;  4QPJ A;  4FPP A;  4YBZ B;  3BRC A;  2ZR3 A;  5DGA A;  4N23 A;  4YY3 H;  1M57 C;  3GID A;  3G6B A;  4O4L A;  1I7N A;  3ZHS A;  1PM9 A;  2BCC H;  2WLK A;  1OBD A;  2UVW A;  1JDE A;  4YHH O;  1H38 A;  1XMQ O;  3OSP A;  3D36 A;  1K7D A;  4UCT A;  1XNR H;  3HB3 B;  4DR7 H;  3OEH G;  3AG2 C;  3RAQ A;  5D5P A;  4B3M B;  1LUW A;  2P0A A;  1I94 O;  4MAM A;  5EBL C;  5CA0 F;  3WB1 A;  3K5O A;  2QKA A;  2W0X A;  3ZHT A;  2X6C A;  5CN0 A;  2DE0 X;  1Q3E A;  5BWW A;  3KG2 A;  3N2G B;  5JUM A;  3DC5 A;  3F7Y C;  4DR4 H;  2JIZ G;  4YB8 B;  2OYQ A;  3Q8Q B;  2FK3 A;  3HKD B;  3IJ4 A;  1K34 A;  2DW4 A;  5K1P A;  2EX3 A;  3RW0 A;  3G4S V;  5DGB A;  4B3R H;  3TY8 A;  4GLW A;  4O3P A;  3RGX A;  1JVM A;  2Q6A A;  4K8X A;  1ZL8 B;  2ALZ A;  4RB3 C;  2YS7 A;  5CA1 A;  5DG7 A;  4A3L G;  4XZ3 B;  2H94 A;  1D5N A;  1XMO O;  3K0D A;  3LNN A;  4WBN B;  4RAZ A;  2W8L A;  4OXS A;  2R9I A;  3VBB A;  2V4R A;  5KFJ A;  2RGR A;  4O84 A;  5LL6 Y;  5LMN B;  1BCC H;  5KT5 A;  1CS0 A;  5CB4 A;  5FNV B;  3VMM A;  2KG7 B;  3MDS A;  5I5T A;  1K73 W;  5EBM C;  4QWE A;  3PZP A;  1EUC B;  2JEG A;  5IJ9 B;  1VQ5 V;  4X89 A;  2Q4P A;  2YCH A;  4LF5 H;  3N44 B;  2EIL B;  5IT9 W;  2QM7 A;  4LF4 O;  4K3A A;  3SYC A;  2W6P A;  4B3S B;  2XD4 A;  3STZ C;  1L0L H;  4CS3 A;  2CDY A;  4X1Y A;  1AR4 A;  2JJ1 G;  2NNU A;  3AG4 B;  2ZNI A;  1FPO A;  2EIK C;  4KUM A;  4O4I F;  5BXZ A;  4X65 O;  1WP7 A;  1FFT B;  2DJV A;  5JCO C;  2UU9 B;  2W9A A;  3GIL A;  4LC1 A;  1N36 B;  1VQ4 V;  4PDR A;  5JJN B;  3MR3 A;  1FFX A;  3TJT A;  3J81 N;  2GV9 A;  3AG1 B;  2FMA A;  3OUF A;  1IBM H;  1OCZ C;  4FM1 A;  3WWI A;  3Q8S B;  5L3C A;  1M5I A;  2CH7 A;  4UCS A;  2A7W A;  1K83 A;  1A3G A;  2HJW A;  2ZQM A;  4CH6 A;  5BWT A;  1GSO A;  5LYJ B;  3RYC B;  5L1J A;  4FJC C;  4IHJ F;  3ETE A;  3RYH A;  2R7Z G;  2PUS A;  5KA6 A;  4JI8 H;  2Y0S A;  2DN9 A;  1Y6X A;  1JLL B;  3PO3 G;  4X1K A;  1PX2 A;  1N4C A;  1HNW B;  2ZDI A;  2RN9 A;  5KT3 A;  1I2K A;  4FZ1 A;  1UFI A;  5LMU O;  1KT8 A;  1WJZ A;  4O4J A;  1DAA A;  4RU9 A;  4DV1 H;  1TUB A;  2DOS A;  4F4L A;  3L70 H;  1OHH G;  2FLL A;  2EIN B;  3JRW A;  3ABL C;  5DG8 A;  4KP4 A;  3MWE A;  4FLV A;  2CKZ B;  2P6J A;  2OCH A;  5JQG B;  1MZB A;  2PVP A;  5KHK A;  5H80 A;  2I8C A;  3LQS A;  1Y74 B;  4TQS A;  4O4H F;  3ABT A;  3J80 N;  3L75 H;  2CNQ A;  2Q69 A;  1M90 W;  3VPB A;  2Q73 A;  2LW7 A;  4A3E G;  3JCZ A;  2GPW A;  4DV6 H;  2CGN A;  4A93 G;  2BSK B;  3CRQ A;  3OUZ A;  1AJN A;  5B1B C;  1PV0 A;  4TQF A;  2ZXW C;  3K06 A;  1FXK C;  1S3J A;  4HAM A;  1XEQ A;  3M9M B;  4DV7 O;  1K1S A;  2FE3 A;  1KUT A;  4HZ3 A;  4X1I B;  4ECQ A;  3ETQ A;  3QTC A;  3F5T A;  4LFB B;  1SKV A;  3LSU A;  2LP7 A;  2MW2 B;  1BZK A;  3I5D A;  4RB1 A;  1G8M A;  1YJ9 V;  2PYL A;  2VUG A;  4Y8V B;  5KHI A;  1VQ6 V;  2QTO A;  4K35 A;  4A3J G;  4DIM A;  4LH7 A;  1T5E A;  1WA8 B;  5B1O A;  3ZRV A;  3OTO O;  1UC8 A;  1I1M A;  2ZIN A;  2HIX A;  3MWD A;  2W6I G;  5GW7 A;  5FD6 A;  2WE6 A;  1HWY A;  4J7J A;  3BQ0 A;  4B3T O;  1C30 A;  1Y76 A;  1JKJ B;  2R85 A;  2FJZ A;  2D2C B;  2NVY A;  4BIZ A;  5IYD O;  3T9E A;  2E74 B;  1IOW A;  1M56 C;  2YS6 A;  4O2B A;  1GSH A;  4ZQI A;  1S9F A;  2QGN A;  5J2U F;  1VQN V;  2DLN A;  1GM7 A;  3SPI A;  4MTE A;  2FPP B;  3HBL A;  1E1R G;  4OX9 H;  1BSM A;  2UUA B;  1HNX H;  3W7U A;  3V4Z A;  4ICG A;  2RNB A;  1IXB A;  4DUY O;  1P16 A;  4Q8E A;  4BBS G;  1KP2 A;  4I0X B;  4AQY O;  1Y1V G;  2GUZ B;  5BWR A;  3RB0 A;  1Z5W A;  3PR4 A;  1EFR G;  2VPS A;  4AIL C;  4LF7 B;  1XL6 A;  2VPQ A;  1AJP A;  2DYR C;  2VOB A;  3UZB A;  2SCU B;  3SPH A;  4ECW A;  2Y69 B;  1YI2 V;  1ARO P;  5B5E Z;  2UUB O;  3CD6 V;  1YF2 A;  3CXC U;  3OTF A;  3GDE A;  1CEZ A;  3TII A;  3WO1 A;  4DV4 H;  4WF9 V;  4G3I A;  3CVZ A;  4DW0 A;  1KJI A;  1HR0 H;  4X64 B;  4JZ2 A;  4MVM A;  2JJ2 G;  1VF6 C;  1BE3 H;  1IOV A;  4NXN O;  3KTM A;  4IIJ F;  4EGQ A;  4BBR G;  1KEC A;  3JAL A;  3RWR D;  4JZG A;  3ORR A;  4TV8 B;  2Q7G A;  3E8B A;  5C8Y B;  5D1O A;  2Z04 A;  3RR5 A;  4YJ2 F;  1XK5 A;  2UXD H;  2JA6 A;  4H44 B;  2QB5 A;  3ASO B;  4O4L F;  1KD1 W;  2B5U A;  4ZHQ A;  3E22 B;  4UCV A;  1B04 A;  4F6R A;  4I50 B;  4DL2 A;  5EYP B;  4JYY A;  2J6S A;  4ECZ A;  5KT6 A;  3E86 A;  2HG5 C;  4MV9 A;  5HNE A;  3B2E E;  5IWA O;  4EBE A;  2CTP A;  4IGG A;  1RSO B;  1HNZ B;  1E4E B;  4I55 F;  1OCC B;  1RK6 A;  5B1A B;  2QA4 V;  1S0M A;  4YJ3 A;  3F7V C;  2BTQ B;  4PV1 B;  3BAC A;  4QPK A;  4RQE A;  3GTJ A;  5BMV B;  5LMN O;  3T5H A;  3HOX G;  3CB2 A;  2A1H A;  3WG7 B;  2C2R A;  5CAE B;  3OGI B;  4JYB A;  4U3J A;  4JYA B;  4JI5 H;  1Q8I A;  1QLN A;  4EB6 B;  4CH3 A;  3LUT B;  3H9V A;  4DYL A;  1SER A;  2VQE B;  1ZHS A;  2R8H A;  3DAA A;  2R7L A;  4K6N A;  2ZDH A;  5HBR B;  5BYA A;  4QJF B;  4RAI A;  2EJ7 A;  3T9A A;  2CTW A;  5I5X A;  4LP8 A;  1VQL V;  1AUX A;  4QE7 A;  3CC2 V;  1A0G A;  2OCC B;  4W4K A;  1KJJ A;  4PBC A;  4TSF G;  4DR3 H;  1V51 A;  4MTO A;  4DR2 H;  2AZ2 A;  4FBT A;  4BY7 G;  3T5J A;  1AR5 A;  3THO A;  3P30 A;  4DV0 O;  2HHF B;  2UU9 O;  5BR8 O;  2E3C A;  1DF4 A;  2YXL A;  3UCS C;  1XHX A;  1GRJ A;  2Q2U A;  4JI6 O;  4GZR B;  1IBK B;  4J0M A;  4NZN A;  1UC9 A;  3U55 A;  4LSA A;  4J9Z B;  3HKC A;  4H37 A;  3FKI A;  2YZM A;  2GTA A;  1SA0 B;  1G1X B;  2RQ6 A;  5CBH A;  1XHZ A;  1AB3 A;  1QNM A;  3AG4 C;  4LF6 H;  3R5H A;  4I5S A;  2IBZ H;  3TCU A;  3VQY A;  4CS4 A;  4QWD A;  4LF9 H;  2XTA A;  1B06 A;  3ZHU A;  3FKS G;  3GTO A;  5DMX A;  2PZS A;  4DAA A;  2ZM6 B;  5KFS A;  2B63 G;  1N33 H;  3X2Q B;  2AQ4 A;  4YP3 A;  3T1Y H;  3T4Z A;  4UVB A;  3AG1 C;  3TXS A;  4MVO A;  3RT3 C;  5GON F;  3KCY A;  4F50 A;  4C5C A;  3SJA C;  4JI1 H;  3K5N A;  4NXM B;  2HJF C;  2FPI B;  3DTG A;  2IJJ A;  4JI2 O;  4X62 O;  3R5X A;  4YAK B;  3R66 A;  4WFF A;  4MTD A;  5I5W A;  2N04 A;  2JS3 A;  3V6K A;  2F23 A;  3JAR B;  1FJG O;  5D8D A;  4R8U B;  1Z2N X;  3N6R A;  2FK1 A;  2FKL A;  2W9B B;  5ITZ A;  5CA0 A;  5L3F A;  2W6M A;  3NUA A;  1X9N A;  2QWN B;  2VWJ A;  1AN7 A;  3UKM A;  4IR9 A;  2CTR A;  1AP5 A;  4P30 A;  3JD1 A;  5DLG A;  2EIN C;  3ZMV A;  4EEQ A;  4YHH B;  2Q7D A;  1XMQ B;  3M4I A;  4YXW G;  4NLG A;  5KX5 F;  4H0L B;  2W71 A;  3CCV V;  4JAU A;  4FMT A;  2ZD9 A;  5LOV F;  1I94 B;  1A48 A;  1MSW D;  4XDK A;  5KT7 A;  4NTW A;  3KAJ A;  3K9S A;  1JCH A;  2ODT X;  3PFF A;  4J80 A;  1PD3 A;  5IYB O;  1OCR B;  3JAW B;  4GKJ H;  3L4J A;  4CBC A;  4ME6 A;  4NVP A;  2DMX A;  4QW8 A;  1JX9 A;  2R87 A;  4K0K O;  2BR0 A;  2UXC O;  3TIN A;  1FKA H;  2AXT Z;  1CQJ B;  5KG1 A;  3P3N A;  3B8N A;  1V9P A;  3G6E V;  5KFZ A;  3IAY A;  5DLF A;  1ULZ A;  3N8D A;  4O3R A;  2QWR B;  1BGY H;  3GWK C;  3L72 H;  1M4U A;  2YW2 A;  2R92 A;  1B6S A;  1P7B A;  3ETG A;  1QLE B;  4TUY F;  4ASU G;  2YYA A;  5KUK A;  4Q0Y A;  1K92 A;  3EPI A;  1XI1 A;  2HJD A;  4DR1 O;  2UUC B;  1VF5 B;  4UB6 Z;  1RP3 B;  4O7T A;  4I4T B;  2ZE8 A;  1S10 A;  1GK9 A;  4FLW A;  1Q6H A;  4MV1 A;  4IT5 A;  2R72 A;  2BOB C;  4IAJ A;  2K1E A;  4MVQ A;  4AI8 A;  2F4V H;  3RYI A;  3HT5 A;  5JH7 F;  3SPJ A;  3Q8P B;  4GX1 A;  5BYB A;  5KG2 A;  1S5J A;  2ZR2 A;  4MVR A;  4LFA H;  1ORQ C;  5KFW A;  3S24 A;  4LF4 B;  1I7F A;  2Y0S E;  2ZE5 A;  3V6J A;  1L0N H;  4ZOL F;  3G8C A;  4DV2 O;  2CW8 A;  1KMI Z;  4UXN A;  3E5N A;  5I60 A;  4IHJ A;  2FP4 B;  2Y4U A;  1BMF G;  3CCU V;  5KG6 A;  4X65 B;  2E5L O;  2QEX V;  5I5U A;  3CJH A;  3MD0 A;  3FYE B;  1NH2 D;  4B3M H;  2EIJ B;  3OMN B;  2EIM C;  1Q81 W;  5L1K A;  4RB0 A;  2R7M A;  2FLN A;  2LFR A;  1KYO F;  3K08 A;  1NTM H;  3SYP A;  1KTA A;  1N0J A;  2XAS A;  4JF3 A;  3CX5 F;  5JJJ B;  5IYC O;  3ZMT A;  2GQR A;  5J9P C;  1XDN A;  3OM3 B;  4FLZ A;  3K3V A;  2ADQ B;  4E4E A;  2HGW A;  4HR7 A;  1RFY A;  4O2A B;  4O4H A;  1N0N A;  3SNO A;  2Z0A A;  1BHA A;  5J2T B;  3BEH A;  5LMU B;  4RZR A;  4ZHQ F;  3OR7 C;  4UUG A;  2OIE A;  1KUQ A;  4A2A A;  2BQ3 A;  3ASO C;  1R6K A;  3I55 V;  1S0N A;  1VQ8 V;  2R7Z A;  2ZXW B;  3JAS B;  4BWA A;  3WNZ A;  4JI8 O;  1XNQ H;  4NB5 A;  1VAJ A;  4ZBM A;  2F66 C;  1TAE A;  4UFZ A;  4JI4 O;  1UJW B;  3ZJZ A;  4PA6 A;  3ETD A;  4F6E A;  3IG0 A;  2HFE C;  4JYA O;  2M05 A;  2J6U A;  2I87 A;  1AVM A;  4NKG B;  3JZF A;  2X0L A;  3TY9 A;  2FYU H;  3RFR A;  2NU9 B;  4DLK A;  1LUV A;  5EDW A;  4RO2 A;  3VNN A;  1OCC C;  4JI3 H;  3FB5 C;  5B1A C;  1WB7 A;  4HNA B;  1WH2 A;  3RV4 A;  1VKZ A;  4JI7 B;  4LNU B;  4J9P A;  3ZRW A;  4FFM A;  3J7A K;  3K59 A;  4M7E A;  1H8E G;  5LP6 B;  4EGJ A;  4ED6 A;  2P67 A;  4B3S H;  2JEU A;  3WG7 C;  3RJ0 A;  4DV7 B;  1I5X A;  1AJQ A;  1SRY A;  1H8H G;  4O3O A;  4X20 A;  5H6Q A;  1JJO A;  3FB8 C;  3N41 B;  3K5L A;  2PMZ A;  2WLJ A;  5J2U A;  4I9Q A;  3JSN A;  4IR1 A;  5JVD F;  3OTO B;  1N36 H;  2YIB A;  2VA2 A;  1I6U A;  3HOW G;  5KFY A;  5KG0 A;  4B3T B;  5IY5 C;  3JAT B;  2R8K A;  2UVU A;  4LH6 A;  2OCC C;  1AI6 A;  2FTK A;  1ZWI C;  2DYR B;  2LGQ A;  2R9A A;  4KL1 A;  1Z2O X;  4Q4C A;  4ED2 A;  3QG5 A;  3UT5 A;  3CC4 V;  4YR3 A;  1XL4 A;  1NR7 A;  3CCJ V;  1W59 A;  4E2L A;  3OHA A;  1IXM A;  5KFA A;  3FD9 A;  4DR5 O;  3AK1 A;  1HNW H;  2RDC A;  2GPS A;  4QSH A;  2JGD A;  4NYE A;  1JIH A;  4DUY B;  1IYE A;  3HOU G;  4AQY B;  2ADP A;  2W70 A;  4ED0 A;  2Z5U A;  3AEI A;  4WFB V;  4PZ8 A;  3RV3 A;  4IIJ A;  3TQT A;  2R86 A;  5IYZ F;  3E2E A;  2CNV A;  3JZI A;  1IBL H;  2GLT A;  1RPR A;  3A0B Z;  3GV5 B;  5B1N A;  4FM2 A;  2N74 A;  3DTF A;  2ASL A;  3D8C A;  2IJI A;  2UUB B;  4YJ2 A;  4C2M A;  3HKE A;  3X2Q C;  2EJR A;  4UVA A;  4TV9 F;  3U54 A;  5L3B A;  3AW8 A;  3BFR A;  3G6Y A;  4PEL A;  3QZ8 A;  1N48 A;  3T9D A;  3GTK A;  3CSW A;  2EUL A;  1VMG A;  4UV8 A;  1QR8 A;  4NXN B;  2VA3 A;  2QF7 A;  2E76 B;  3WFV A;  2WA3 A;  2VRZ A;  1I2L A;  4WFH A;  2JS5 A;  3SR2 C;  4I55 A;  4JTD B;  4LFB H;  3SE7 A;  4HYO A;  1CKN A;  4CH5 A;  5LXT F;  2HLD G;  2V58 A;  4YR0 A;  4MSW C;  4NYK A;  2VUM A;  2C00 A;  4KFM A;  4DL5 A;  4J9Y B;  4Q43 A;  1S03 G;  3GTP A;  3K3W A;  5HFM A;  3ZIA G;  3OSN A;  4DR6 H;  2Y0P A;  3RBZ A;  4QW9 A;  1X4T A;  5IWA B;  1THZ A;  3HOV G;  5BWV A;  2IU0 A;  3ZRS A;  4PA4 A;  1V4Y A;  3C90 A;  1ZLZ A;  2PTM A;  1Q82 W;  3A0R A;  1SQP H;  3T9B A;  1OCR C;  4XYM B;  2UUC O;  2WPD G;  2OT5 A;  1XRE A;  2ATL A;  5FNV A;  2JGU A;  5KG4 A;  5KAI Z;  4FLX A;  3CSX A;  4MS2 A;  5LHH A;  2WLI A;  4O7Z A;  4A3K G;  3CRM A;  2B1I A;  5CA1 B;  4TWK A;  1JA8 A;  5KT2 A;  4LF7 H;  4FBU A;  2IMW P;  1JQ0 A;  2VQF H;  1DK1 A;  2GBO A;  3E83 A;  4A5U B;  4RUC A;  3RBD A;  1QLE C;  5CB4 B;  4QWC A;  3J81 W;  4I7Z B;  2C2E A;  2NU8 B;  2QDO A;  4X64 H;  4PI0 A;  3RTX A;  3WWH A;  5KFT A;  4M9U A;  5DED A;  4I7H A;  3DXR A;  1P84 F;  4DL3 A;  2ODM A;  1V55 B;  4DV0 B;  5BR8 B;  2KB1 A;  3HO8 A;  4FM9 A;  1H2M A;  4R7R A;  3H1I H;  4H33 A;  4X9Q A;  1JPX A;  5LA6 F;  3UM7 A;  4O7V A;  4JI6 B;  4A3I G;  4UCO A;  3GTM A;  4LBE C;  2XGQ A;  4X66 O;  4X1Y B;  1OV9 A;  1NT2 B;  5GON A;  3L73 H;  3RGZ A;  2FB9 A;  2YC0 A;  2BTO A;  4A3C G;  3IC9 A;  4CKE A;  1AP6 A;  5IT9 N;  5C1O A;  1FFX B;  3LDC A;  4DV5 H;  2GSM B;  4J42 A;  5KFO A;  5EZY F;  4FM0 A;  2XUM A;  2IU3 A;  1HNZ H;  4RAY A;  2EIJ C;  2CH7 B;  3ZCC A;  3J80 W;  2LJ2 A;  3LSS A;  2YID A;  3GB8 B;  5CMU A;  3PW0 A;  1NQT A;  5JQW A;  4GKK H;  1KB9 F;  3RYH B;  2ASJ A;  5TIS Z;  2FL4 A;  4J7Z A;  3LWB A;  1TWC A;  3A0H Z;  3CHX A;  3KKY A;  5DAA A;  4JI2 B;  4X62 B;  1N32 O;  2GDS A;  4X1K B;  5KX5 A;  2QM4 A;  4ED8 A;  3KRE A;  2FLP A;  2B63 A;  1FJG B;  4ECU A;  2FB5 A;  4O4J B;  3FFQ A;  5LOV A;  2HHH H;  4ECX A;  4WHX A;  1TUB B;  1W96 A;  5JVL A;  3KZI Z;  1P8L A;  4TQD A;  3H0G G;  2VQE H;  2ITC C;  1O9G A;  3DC6 A;  4JI1 O;  3T1H B;  4NZM A;  4JI7 O;  2XAH A;  2ZIO A;  3W1G A;  4MV6 A;  2BSK A;  3Q1K A;  4IRD A;  1Q43 A;  1VBG A;  1Q6I A;  3HKB A;  1VQO V;  1G6U A;  4EEY A;  2XAJ A;  4FE2 A;  2LW1 A;  3ZMU A;  1MSD A;  4E6N A;  4ZI7 F;  1J5E H;  1YTF D;  4LFC O;  3LUL A;  2RDI A;  1M0T A;  1JDB B;  4J9R A;  2ETN A;  5IYD G;  1UPG A;  3CCR V;  4HNT A;  4TUY A;  1XNR B;  1TWF A;  3ABU A;  4TQR A;  3ZN0 A;  4U3F H;  4DR7 B;  1N34 H;  3OUS A;  2JEX A;  3F5W C;  3KHL A;  4K0K B;  3KHR A;  1IBK H;  2UXC B;  1B3Q A;  2YU9 A;  4JUZ A;  2C22 A;  3JD0 A;  5LP6 C;  2JVD A;  1VQK V;  4ED7 A;  5DQI A;  3SI8 A;  5EIB D;  3B40 A;  3FMA A;  4MW3 A;  2C28 A;  4GKJ O;  4F4Z A;  2HDK A;  3T54 A;  2HP8 A;  5JH7 A;  4DR4 B;  3ZX6 A;  2AGQ A;  2GHY A;  1K33 A;  3ASN B;  5A9G A;  2ZM6 H;  3OT7 A;  4U6P A;  4MTX A;  4FLY A;  1BQZ A;  1Z5V A;  1WPB A;  1I5Y A;  4J7K A;  4DR1 B;  5F9N A;  4RNO A;  1GMG A;  2PGG A;  4ZOL A;  2ZIM A;  1GSA A;  2YXY A;  5DGH A;  2JA5 A;  4MV3 A;  5FD5 A;  4W4L A;  4O2B B;  4NXM H;  1P7G A;  2HVQ A;  2YXH A;  3G8D A;  2WSS G;  4LF8 O;  3K58 A;  2EIM B;  4WFA V;  4J10 A;  4O3S A;  1WCM G;  1W93 A;  1RK5 A;  3IC7 A;  2G38 A;  3H01 A;  4MV7 A;  2W8K A;  3JAK A;  2QTS A;  3CRA A;  2XT9 A;  1R6N A;  2R7K A;  3H4B A;  3CRC A;  3MHS C;  1EYZ A;  4PWQ A;  2HVK C;  2XCA A;  4KHP O;  1S72 V;  4Z2W A;  4RQF A;  4DV2 B;  1WSC A;  3DGE A;  3OMA B;  1NBM G;  3RN4 A;  2QYZ A;  1AIL A;  1B6R A;  4YHH H;  4A3F G;  2HG8 A;  1XMQ H;  2ZNJ A;  1XOU A;  4LFA O;  1T36 A;  2E5L B;  2PI5 A;  2DPI A;  4QNH B;  4CKC A;  3JRX A;  3E8F A;  5KA5 A;  1U97 A;  1I94 H;  4PDV A;  5KFV A;  2Q0O C;  3BVO A;  1BXR A;  3R23 A;  3EHB B;  1S0O A;  2A0L A;  1T3N A;  3CQZ A;  4O7Y A;  4IWY A;  1W2B U;  2OLS A;  3JAL B;  2Q9L A;  4BXX G;  2F95 B;  1V54 B;  1FAF A;  5KFH A;  4LWS A;  3UZO A;  5D1O B;  4GCZ A;  2OTL V;  1Q90 D;  2WAM A;  4F6R B;  3VQX A;  2YEV A;  3OR6 C;  1PP9 H;  2BTQ A;  4DUZ O;  1XMO H;  5KAF Z;  3D36 C;  1YTF B;  2QK4 A;  4JI8 B;  5KFN A;  1RYS A;  2WLL A;  4JI4 B;  1KBL A;  1GO3 F;  1KJ9 A;  3T9F A;  1SES A;  2PMZ E;  5DQG A;  4J9S A;  3C0F B;  3CS5 A;  3WWJ A;  3TGU H;  5DM6 V;  1BHB A;  2ZE6 A;  5CE8 A;  2HKO A;  4N21 A;  4YJ3 B;  2ATK C;  2PF4 E;  3FDS A;  2PN1 A;  3GV7 B;  4O86 A;  1KQS U;  1XNQ O;  3JD2 A;  4WBN F;  3MHH C;  5EWF A;  4DL4 A;  3L4K A;  1Y1W A;  2DYS C;  2P4K A;  3MFH A;  4JV1 A;  1GN6 A;  5JVD A;  3GV8 B;  1CXZ B;  3SPC A;  5IY5 B;  1EBO A;  3FB6 C;  2JA7 G;  3CWB H;  2ZCE A;  1K5Q A;  5FNV F;  2KSD A;  3EYY A;  4TT3 G;  2PY5 A;  4LF4 H;  4U3J B;  3H4D A;  1GKF A;  3HKZ A;  4QWA A;  2K9P A;  2R93 A;  3N42 B;  5EBW C;  4CMF A;  4WFG A;  1E79 G;  2ZT9 B;  5KG7 A;  4YIP A;  1IX9 A;  5H2F Z;  4M0J A;  4WD3 A;  1N56 A;  2KKW A;  5B3S B;  4X65 H;  3CE2 A;  2Q0A A;  1WPX A;  3RB3 A;  1TUE B;  4HNU A;  2Y0I A;  4RCN A;  2C2D A;  2W7P A;  5EWE A;  1QVG U;  4GYC B;  4HNV A;  2YIA A;  4CS2 A;  5AG2 A;  1PNM A;  2FML A;  5I5V A;  4JAA A;  2W9C A;  1M6V A;  3SPG A;  4A3G G;  3OGC C;  3N2K A;  1QVF U;  1S77 D;  3R9R A;  3ZMZ A;  5IYZ A;  1V55 C;  2FKX A;  5FLX W;  4DRX A;  1AI4 A;  2V5A A;  4JGS A;  3OW2 U;  3G71 V;  2UXB H;  3R5F A;  4JV5 O;  4DR5 B;  4HYK A;  4RB2 C;  4DL7 A;  5DIS C;  5LMU H;  3HKC B;  3ETH A;  2DZD A;  4RNN A;  4TV9 A;  4QGP A;  5DEC A;  2E2I A;  2YUA A;  4DV3 O;  5LYJ F;  1G4Y B;  2P06 A;  1F4M A;  3LSQ A;  1SQQ H;  2DWD C;  4UCU A;  3S3X A;  5L3G A;  4PI2 A;  1MZE A;  3OHB A;  4IRK A;  4JPR A;  2CQY A;  1SZT A;  2A9H A;  2IH3 C;  5FL7 G;  2R6F A;  3K3P A;  3T1H O;  1I50 A;  1GM9 A;  1SZX A;  1GO3 E;  1WP8 A;  3O65 A;  2XND G;  5LXT A;  3U9S A;  4G2K A;  1BGW A;  1IBL O;  3MJF A;  2ILM A;  3FAV A;  4MW8 A;  5JQG F;  1BJT A;  4JV0 A;  1JFF A;  5IYB G;  3IN5 A;  1OZ0 A;  1PPJ H;  4JI0 H;  2R8J A;  4CC6 A;  4D7S A;  2IJH A;  4YY3 O;  3H1L H;  2XOK G;  3WB0 A;  3RB6 A;  2HR3 A;  2ZDI C;  3K5H A;  4DV7 H;  5ITZ B;  5CA0 B;  5K3W A;  4BY1 G;  3T1C A;  3VQV A;  5FR9 A;  2AGP A;  2P5O A;  1EN4 A;  2YRW A;  3ZBH A;  1QCE A;  1KKC A;  1XNR O;  4O7R A;  5DG9 A;  5KMG A;  1B33 N;  3M7M X;  2CFM A;  3JAW A;  4J9O A;  3FB7 C;  3K0G A;  4DR7 O;  1NI8 A;  1KKD A;  3OTO H;  1CQI B;  4U7C A;  2LFS A;  4PHZ A;  5EC2 C;  2AZ0 A;  5K2M A;  4R6Z A;  1KU9 A;  4B3T H;  3MFI A;  4Q20 A;  3JAM N;  1H2G A;  5KFR A;  4LMY A;  2L6L A;  3W1B A;  1EN6 A;  4DR4 O;  3P3P A;  1GN4 A;  3HPL C;  3CPW U;  1ZHQ A;  1NKD A;  3A2F A;  4B3R O;  3DF7 A;  4DR6 O;  3JSL A;  2XAQ A;  5FPO A;  5FLM G;  5IP7 G;  4AQY H;  4ABM A;  5KFL A;  2F43 G;  3F8N A;  5JCO A;  1WN7 A;  2E75 B;  3A8T A;  1S5H C;  3GB7 C;  5B66 Z;  3JYC A;  5GTH Z;  3GLK A;  5LA6 A;  3VOU A;  5KUM A;  3B77 A;  1QBZ A;  2UUB H;  1LNQ A;  3G67 A;  1SCU B;  3BG5 A;  3ASN C;  4O83 A;  1TWA A;  5CR5 A;  5HV6 A;  4L8J A;  1TVK A;  5KFF A;  3NXS A;  1EZV H;  4O4I B;  5F9L A;  2YIB D;  2XGP A;  4DK1 A;  1R3K C;  2X7R B;  2YIC A;  4LF5 O;  1TWH A;  3NBY B;  3RYI B;  5A2Q N;  4NXN H;  4A3D G;  4FLU A;  2EIY A;  2BQR A;  3ZHQ A;  5IYC G;  1RJP A;  1FD9 A;  5EZY A;  2IW5 A;  3VPC A;  5IJ0 A;  2JA6 G;  4ECY A;  2UXN A;  5I5Y A;  4X66 B;  1HP8 A;  3GVM A;  2CUG A;  2LO1 A;  4FFL A;  3TY5 A;  3OUU A;  3PVX A;  1RJQ A;  4IHJ B;  1I0H A;  3EPG A;  2GQS A;  4FIP C;  1JX4 A;  3CJH B;  3RGB A;  5CBG A;  1IBM O;  4TV8 F;  5C8Y F;  3UFX B;  3WB2 A;  2QKC A;  2PI4 A;  5IWA H;  3RB4 A;  5BPH A;  4MVS A;  2PBZ A;  2V4Q A;  1K9M W;  2CNU A;  5KFX A;  1R73 A;  1AI7 A;  3C3T A;  1KBH A;  1OBG A;  2QJ1 A;  4P2Z A;  1QR9 A;  3RVZ A;  4I50 F;  4DRF A;  5KT4 A;  4IYI A;  1FXK A;  3LDD A;  3M8A A;  2RF4 A;  3NBZ B;  1H2L A;  4OGQ B;  5LMN H;  1KEE A;  4DV5 O;  5KKN B;  1M0W A;  4RWU A;  1N32 B;  1R9T A;  2AU0 A;  4O4H B;  4DV1 O;  1V54 C;  1OJH A;  2QWQ B;  1ZTE A;  4ETS A;  2DAA A;  3BQ1 A;  1BL8 A;  1AR1 B;  5L3D A;  4ZI7 A;  4GKK O;  3CRR A;  4FFB A;  5CBF A;  4WCE V;  4JI1 B;  2Q67 A;  2YS8 A;  2JRI A;  3VQW A;  2A3Q A;  5BMV F;  4R7C A;  4DO2 A;  2CAZ C;  2L35 A;  3AYH B;  3CEI A;  4CHI A;  2FK2 A;  3BY6 A;  4YAJ B;  2COG A;  2HHH O;  4CE5 A;  2WB1 A;  3QF7 A;  3GIM A;  4I9W A;  4PA9 A;  3HB9 A;  4DV6 O;  5LGU A;  5BWU A;  1PNK A;  5H5N A;  3KAK A;  1H2N A;  4LFC B;  3RYF A;  4DV0 H;  3U0Z A;  1IYD A;  2CE4 A;  3JD3 A;  2COJ A;  2R8G A;  1T94 A;  1E4G T;  2UU9 H;  2LQT A;  4L87 A;  3ETJ A;  3ZRW B;  2P4V A;  3CCL V;  2VS0 A;  2KQX A;  5EIB C;  2QR4 A;  1K5S A;  3E8G A;  1YJW V;  1DTO A;  4WFE A;  4OPA A;  2QWP B;  1HDJ A;  4NZO A;  3KYH C;  4AYB E;  4XBF A;  3K9A A;  2C35 B;  1M9N A;  4X20 B;  5D5Q A;  4ZKI A;  3FKI G;  4UV9 A;  4FGR A;  3PW5 A;  2DIK A;  1XUQ A;  5J2U B;  4GKJ B;  5BWX A;  2EJ0 A;  3N27 A;  4B7K A;  1N34 O;  1G2W A;  4ECR A;  4FVM A;  5B3S C;  3Q4H A;  1PKX A;  4JAV A;  3QWU A;  5C44 G;  1NH2 B;  2WDT A;  1VF6 A;  1R3I C;  1MMM A;  2D3O W;  4XDJ A;  3UT5 B;  1S5L Z;  5KFB A;  4MA5 A;  3RF2 A;  5BPF A;  1KP3 A;  4CZZ A;  4OX9 O;  4FFK A;  1HNX O;  1RYR A;  4LF8 B;  3GIQ A;  2JGD B;  4KXR A;  3ZMS A;  1Y1V A;  1FJG H;  1ZSP A;  1I1K A;  2UVR A;  5EK0 A;  4O7L A;  1X59 A;  1NR1 A;  1EKV A;  1Y66 A;  3MR2 A;  4UB8 Z;  3ZHR A;  3I4N G;  4KHP B;  4TM5 A;  1YSC A;  4IIJ B;  3GIJ A;  1K4C C;  1R1B A;  5HFL A;  2YRX A;  1NZ6 A;  3Q2O A;  2FPG B;  5IE9 A;  4XX0 B;  4DV4 O;  4LFA B;  5KFU A;  1D5A A;  4Z1V A;  4YJ2 B;  1HR0 O;  4GX0 A;  4O4L B;  1I1L A;  3GTQ A;  3HKE B;  1DLB A;  4BIO A;  3CC7 V;  1BQ0 A;  4JTA B;  5EWG A;  2I80 A;  3CCQ V;  4FK5 C;  1XDC A;  3W7X A;  2VR1 A;  4A3M G;  3H20 A;  2KSW A;  2X6A A;  3N2G A;  5DN6 G;  3ZS8 C;  3QNE A;  2OH2 A;  4NTX A;  3HKD A;  2UXD O;  4K0K H;  2UXC H;  3L71 H;  3V4S A;  4I55 B;  3D3I A;  4PDB A;  1ZL8 A;  1VAR A;  1CKN B;  4MV4 A;  2ASD A;  2Q5Z A;  2DYS B;  1C3O A;  3HKZ E;  4DL6 A;  4WBN A;  4FZ0 A;  3RAX A;  4DUZ B;  2R92 G;  4K8Z A;  1F4N A;  3ZRX A;  3RUP A;  4JXU A;  2UUA H;  3K5I A;  5KFI A;  3BPZ A;  2RMK B;  3H1K H;  5LHG A;  5LBQ A;  1EKF A;  5KFQ A;  1GN2 A;  2KG7 A;  1AI5 A;  4DR1 H;  1FXH A;  2X0S A;  1U96 A;  3APO A;  1EUD B;  4J9N A;  1MOF A;  5IJ9 A;  3GQC A;  3GJX B;  3ICX A;  1GM8 A;  2NU7 B;  2WLN A;  1XNQ B;  2AHY A;  2CTQ A;  3BCC H;  3LDE A;  4IWX A;  1I7L A;  4JI5 O;  1R3J C;  2W6Q A;  3OFN G;  2WLI B;  4I4T F;  1H2K A;  4Q4D A;  4JI3 B;  4DV2 H;  3ZN1 A;  1S97 A;  2EZP A;  1PK8 A;  1XQ8 A;  3NGD A;  5KG5 A;  3UQ8 A;  2JA7 A;  2DWE C;  2E5L H;  4O7S A;  3ABM B;  3JZ6 A;  2A06 H;  3K57 A;  1F7Y A;  1YZB A;  4DR3 O;  1DIK A;  1YCI A;  3JD4 A;  4DR2 O;  3NC0 B;  5E79 Z;  1NVP D;  4PJ0 Z;  1K8A W;  3DXR B;  1RM1 B;  4ECS A;  2B1G A;  4QE9 A;  1SFO A;  2AHZ A;  1S68 A;  5LYJ A;  1K97 A;  2DPJ A;  5KLV H;  3RYC A;  1HW7 A;  1VS0 A;  3VOT A;  2DQ0 A;  3L9D A;  1Q7Y W;  1SQV H;  1VBH A;  3OEE G;  1GGO A;  2R84 A;  2HIV A;  1GH6 A;  2JK5 C;  2ZE7 A;  4PA7 A;  2NN4 A;  5KHJ A;  3WU2 Z;  3Q8R B;  2GTS A;  2EJ2 A;  3QZ7 A;  4JV5 B;  1SEI A;  3PO2 G;  5GON B;  4X8A A;  2ITD C;  3M9N B;  4LF6 O;  1YVW A;  4EFB A;  2HGS A;  1DGS A;  1Z2G A;  3D3Q A;  4MTG A;  3BAB A;  4DV3 B;  1N8R W;  2QKS A;  4LF9 O;  2HVR A;  3EVK A;  5JQG A;  3QO8 A;  2UXB O;  3E89 A;  2XAF A;  3CMA V;  1N33 O;  4JI4 H;  4J9Q A;  3T1Y O;  1Y74 A;  4O2A F;  4O7N A;  4JYA H;  4BW5 A;  1YIT V;  5J2T F;  1RJR A;  3RBE A;  1D2D A;  4APM A;  1FYJ A;  5DQH A;  3EFF K;  3SDL A;  4EBD A;  4G27 B;  3WO0 A;  5KX5 B;  1IBL B;  5IDJ A;  3SYO A;  1YDX A;  4FFN A;  1TWG A;  1RPO A;  5LOV B;  1BS3 A;  4X1I A;  3SYQ A;  1GTO A;  4YY3 B;  4EYH B;  3LML A;  1QQC A;  4R50 A;  3TQ1 A;  2WAQ A;  4CH4 A;  1WA8 A;  1EHI A;  2RDJ A;  1EN5 A;  1MZF A;  1SET A;  4JI0 O;  3TW6 A;  3HKB B;  4ED1 A;  4MA0 A;  1E4F T;  5LP6 F;  5FPR A;  1EM1 A;  2F93 B;  1OCO B;  1YJN V;  2YL2 A;  3O9O A;  1ZAU A;  3PR5 B;  4Z1M G;  5C93 A;  4O81 A;  1WR2 A;  2IP4 A;  2NUA B;  2UVV A;  1EZJ A;  1MA1 A;  2J9G A;  5FJ8 G;  1K4D C;  3AG3 B;  4TUY B;  1ZQ7 A;  3CCM V;  1FKA O;  4PDL A;  3CCE V;  1Y76 B;  2ABJ A;  4DR5 H;  4G28 B;  1K3E A;  4B3R B;  4DR6 B;  4QIW F;  3K03 A;  1IVS A;  4I0X A;  1F23 A;  2GUZ A;  1YHQ V;  3T5L A;  1JR9 A;  2R82 A;  2ZGI A;  4GUN A;  4IZO A;  4J9L A;  4UVC A;  2YI8 A;  4XYL B;  1Y67 A;  2EJ3 A;  5JWP A;  1GYF A;  1NVP B;  3T5K A;  4A3B G;  5JH7 B;  1YEW A;  2Y48 A;  5D1P A;  4AYB A;  1SQG A;  4Q45 A;  2XHB A;  1VQP V;  1NJI W;  2OWO A;  4DW1 A;  2XC9 A;  2OIG A;  2YZL A;  2CK3 G;  5L9X A;  2JEI A;  2AGO A;  4ZOL B;  3G6X A;  4L1K A;  5T14 A;  3OAA G;  5IP9 G;  3CEB A;  2F4V O;  4YQW A;  3L74 H;  3VA7 A;  4LF5 B;  2VQF B;  2C2A A;  1W0J G;  1EKP A;  3CXH F;  3W7W A;  3KXY T;  3B8M A;  4TV8 A;  1Y4M A;  5C8Y A;  3JAK B;  5BZB A;  5LL6 b;  2Z3Y A;  3ML0 A;  1TGO A;  3I12 A;  2J6T A;  1ZUQ A;  3EXA A;  4C5A A;  3E22 A;  3APQ A;  3N43 B;  4BAY A;  1R3L C;  4U7N A;  4U7O A;  4I50 A;  5EYP A;  4GT1 A;  2YZG A;  5CM0 A;  4GLX A;  4MT8 A;  4B3M O;  2VUM G;  1XIL A;  4J9K A;  4MVU A;  2DWC A;  2YZN A;  2MK3 A;  2ZDG A;  1SF9 A;  1P49 A;  3LNM B;  4J41 A;  2WA4 A;  3CME V;  1IBM B;  4O3N A;  3TXQ A;  1RSO A;  1FS0 G;  3T4D A;  2LGW A;  1E4E A;  3GII A;  3PW7 A;  4ZHQ B;  1S76 D;  3S3W A;  2RGV A;  3U11 A;  3TW7 A;  5GTI Z;  2WB1 E;  4RUA A;  4O7W A;  2ARH A;  4RUF A;  3SJC C;  4D6T H;  2Q7H A;  5BMV A;  3TET A;  4EQ5 A;  2O57 A;  2HEP A;  4CC5 A;  3ABK B;  4FS1 A;  3OMI B;  3KHG A;  4LWS B;  3U10 A;  4DV5 B;  2UUC H;  2IH1 C;  4FFO A;  1L2Z A;  2NR5 A;  4EB6 A;  4DV1 B;  3H3V H;  2V7Q G;  2COI A;  1KC7 A;  5K1X A;  2YEV B;  4FU0 A;  4EKW A;  1FXV A;  4A2B A;  1I3Q A;  1UNN C;  3H1J H;  4QIW E;  4GKK B;  2W6N A;  5L1I A;  4QJF A;  5C5J A;  2WLL B;  1MNG A;  5E25 A;  2V1D A;  3OE7 G;  1ZX3 A;  4J11 A;  2W7O A;  3HOY G;  5LGT A;  3MR6 A;  2H3O A;  5BY1 A;  4D7T A;  2HHH B;  1E1Q G;  2DAB A;  1L1F A;  4JI3 O;  5CA1 F;  2W6J G;  1ZET A;  5L1L A;  4FLT A;  3KAL A;  3PW4 A;  2HHF A;  4DV6 B;  1SS3 A;  2XAG A;  2UXX A;  5I47 A;  3H40 A;  1SQX H;  2BE3 A;  4X88 A;  1VF7 A;  5JVD B;  3TIG A;  4R8C A;  1M7J A;  4B3S O;  1KJ8 A;  1IZ3 A;  5CB4 F;  3M9O B;  1WAZ A;  5KFC A;  1IUR A;  2XIG A;  4H13 B;  4X66 H;  3AG7 A;  2M6Y A;  1J5E B;  1CP9 A;  1SA0 A;  1ENV A;  3GTL A;  1N36 O;  2MCT A;  3AK2 A;  3VPD A;  4P9P A;  3E35 A;  2YDE A;  1JXL A;  1L8D A;  1YXB A;  2IM9 A;  1N34 B;  2EIL C;  1SC5 B;  5DGI A;  1NTZ H;  3AX6 A;  3E8H A;  4ZIB A;  3RFC A;  3ABM C;  3SJQ C;  1WB8 A;  4C7U A;  1A0I A;  2W6Z A;  2EBO A;  1AUV A;  2HVJ C;  3GTG A;  3IGA C;  2W9C B;  3FYI B;  2O03 A;  1RM1 C;  3N2K B;  1BNC A;  2WWW A;  5IYZ B;  4C5B A;  1SQF A;  4DRX B;  4ED3 A;  1HNW O;  4CMD A;  2QM8 A;  5F2V O;  3CCS V;  4OX9 B;  3JAR A;  4MV8 A;  4CKB A;  1N32 H;  1M57 B;  4PD4 F;  1HNX B;  4R8U A;  1PL4 A;  3MR5 A;  1O75 A;  4JTC B;  2W9B A;  1NS1 A;  1Y14 B;  2OTJ V;  3QVN A;  4PDM A;  4TV9 B;  4ECT A;  4JAS A;  5KFE A;  4Q44 A;  3IFX A;  3R65 A;  4JI7 H;  3AG2 B;  3NR7 A;  2HVS A;  2M7W A;  1WNS A;  4TVI A;  5FLX N;  2Q8V A;  4BWS C;  2R8I A;  1DV1 A;  1P4R A;  4FFP A;  1US6 A;  1M93 A;  4IYH A;  4DV4 B;  4O4J F;  2BOC C;  2Q2T A;  3JAM W;  2Q7E A;  1PL0 A;  1HR0 B;  4EG0 A;  2WYO A;  4RNM A;  3HOZ G;  1WLE A;  4Q6G A;  5LXT B;  4LFC H;  1IDS A;  1W0K G;  3FAV B;  1O9H A;  4TOI A;  1SQB H;  1JFF B;  2ZJT A;  3PJS K;  2R7N A;  3QO7 A;  3SGI A;  4PZ6 A;  4LFB O;  2UXD B;  3SJB C;  1A32 A;  4F4X A;  1LR1 A;  2ZKO A;  5KFM A;  3T9C A;  3QO5 A;  4PA3 A;  4F4W A;  3W5O A;  5KFP A;  3JCU Z;  1EZ1 A;  5KMG B;  3MWM A;  3TEK A;  4LR3 A;  1B6Q A;  3ORQ A;  1KC8 W;  4BR6 A;  1MAB G;  3HR0 A;  1PNL A;  4DUY H;  3C3S A;  3K5M A;  3PW2 A;  1M1K W;  4I4T A;  4DXW A;  4BW9 A;  1OCO C;  1NU1 H;  4EFE A;  2Y4R A;  3N6X A;  2N05 A;  2JA5 G;  4HQ6 A;  2Q68 A;  1TA8 A;  1XMO B;  5A2Q W;  3KHH A;  2RCV A;  3ZED A;  3B4S A;  2H8P C;  2UUA O;  4IL6 Z;  1FVI A;  4LF8 H;  3AG3 C;  1H2S B;  4MVZ A;  3BAA A;  2EIK B;  4JI5 B;  4UUJ C;  4LF7 O;  3QQM A;  4ECV A;  4O2B F;  4KHP H;  4O4I A;  2VQF O;  1R6T A;  5LHI A;  4UCR A;  1VQM V;  4HN2 A;  4J9M A;  3B09 A;  4MTF A;  3MAQ A;  4Q8F A;  3GWO A;  1OCZ B;  5C1P A;  4O3Q A;  5LA6 B;  5CA3 A;  1VQ9 V;  2CZG A;  3K04 A;  3T99 A;  1ROP A;  4RUE A;  2Y4T A;  4X64 O;  2DQ3 A;  4DR3 B;  3FX7 A;  4AHC A;  4DR2 B;  1GN3 A;  1TVK B;  2NLJ C;  2ZDQ A;  2WLM A;  3UYY A;  3V6H A;  2JEF A;  4BIU A;  5KHG A;  1URF A;  1CE8 A;  3T2M A;  3LP8 A;  3G80 A;  1KJQ A;  2X6B A;  3QFF A;  5I5S A;  3BA9 A;  4O2A A;  5EZY B;  2Y69 C;  5EC1 C;  5IJ0 B;  4FFR A;  5C4X G;  3ABL B;  5J2T A;  3P32 A;  3OD4 A;  2A79 B;  3KCX A;  3M99 B;  1CKO A;  1VP7 A;  1S0V A;  1QU7 A;  2W57 A;  2P22 C;  4LF6 B;  1NTK H;  3JAS A;  4DUZ H;  1JMK C;  1MG1 A;  4LF9 B;  2XCP A;  3BA8 A;  4RZQ A;  2UXB B;  3T7A A;  2CGO A;  2WAQ E;  2AGA A;  1HNZ O;  2YI9 A;  2R70 A;  1N33 B;  4YIO A;  2V4D A;  2IJK A;  3T1Y B;  3BJY A;  1Q86 W;  2NU6 B;  4JYC A;  2P90 A;  1ET0 A;  3DSQ A;  3I4M G;  1F51 A;  5E1A C;  3AK3 A;  3N40 P;  4QWB A;  2AW9 A;  3ZHV A;  2P7T C;  5B1B B;  4HNA A;  3W7S A;  3I56 V;  3J7A U;  1OWT A;  4F4Y A;  3RIZ A;  1FXK B;  1XBL A;  1J95 A;  3TK1 A;  5KS8 A;  4LNU A;  4GC6 A;  1Y1W G;  4DQN A;  5LP6 A;  1COW G;  5KFK A;  3ABK C;  3H1H H;  1K1Q A;  2QWO B;  2CW7 A;  1DF5 A;  1CKM A;  3H0G A;  2HGX A;  2B9Z A;  2VQE O;  4DK0 A;  5L3E A;  2IBK A;  4ZI7 B;  4YJ3 F;  2JDI G;  4FFB B;  2VQD A;  5C3E G;  2R93 G;  2IA6 A;  4OPH A;  5BR8 H;  5JJE B;  1VQ7 V;  4PZ7 A;  2RJZ A;  1GLV A;  5LGN A;  1Q5O A;  2BQU A;  2JEJ A; 
#chains in the Genus database with same CATH homology
 4JI6 H;  3K57 A;  4JI0 B;  1I94 H;  1I94 B;  3NC0 B;  3JAT A;  3KAJ A;  3L2P A;  5EOY A;  1S68 A;  5LYJ A;  3RYF B;  3RYC A;  1HW7 A;  3JAW B;  4GKJ H;  3L4J A;  1VS0 A;  4NVP A;  3JAL B;  2PYJ A;  2F95 B;  2HIV A;  1FKA H;  5D1O B;  5KHJ A;  4LSX A;  2VWK A;  3HXL A;  4JV5 H;  4JV5 B;  1V9P A;  3IAY A;  1SEI A;  5GON B;  4F6R B;  3VQX A;  4EFB A;  1SYX B;  2HGS A;  1DGS A;  1M4U A;  2BTQ A;  3BAB A;  4DV3 H;  4DV3 B;  1XMO H;  1Z2P X;  2HVR A;  4JI2 H;  4X62 H;  5JQG A;  2F1M A;  3PN1 A;  4JI8 B;  3BHP A;  4Q0Y A;  4JI4 B;  4JI4 H;  1QHT A;  1XI1 A;  4HBN A;  3C0F B;  2UUC B;  4JYA H;  5KHH A;  4I4T B;  4YJ3 B;  4APM A;  3T1H H;  4FLW A;  4IAJ A;  2R72 A;  4B08 A;  3L4K A;  2F4V H;  3RYI A;  2F4V B;  5JVD A;  5KX5 B;  1IBL B;  1S5J A;  4LFA H;  2ZCE A;  3BRC A;  4LF4 B;  3S24 A;  5LOV B;  2PY5 A;  3EYY A;  4U3J B;  4LF4 H;  1I7F A;  4X1I A;  4YY3 H;  4YY3 B;  3LML A;  1QQC A;  4O4L A;  2CW8 A;  3N42 B;  1KMI Z;  4IHJ A;  4CH4 A;  4UCT A;  1XNR H;  2KKW A;  4X65 H;  4X65 B;  4DR7 H;  2Q0A A;  3HKB B;  4B3M H;  5D5P A;  4B3M B;  1E4F T;  5FPR A;  4RB0 A;  2F93 B;  4GYC B;  2YIA A;  3WB1 A;  3K5O A;  4CS2 A;  1ZAU A;  1Q3E A;  5JJJ B;  3N2G B;  3N2K A;  1XDN A;  4TUY B;  5IYZ A;  4DR4 H;  5FLX W;  4DRX A;  4FLZ A;  2OYQ A;  3K3V A;  2UXB H;  3HKD B;  5K1P A;  2EX3 A;  4DR5 H;  4O2A B;  4DR5 B;  4O4H A;  4B3R B;  3TY8 A;  4RB2 C;  4B3R H;  4DR6 B;  5DIS C;  3RGX A;  5J2T B;  4K8X A;  5LMU H;  5LMU B;  3HKC B;  4RB3 C;  5CA1 A;  4A2A A;  4TV9 A;  2YI8 A;  3LNN A;  1GYF A;  4WBN B;  3JAS B;  4RAZ A;  4BWA A;  1XNQ H;  5JH7 B;  1YEW A;  1TAE A;  2F66 C;  4UFZ A;  5D1P A;  2RGR A;  1SQG A;  5LMN B;  4UCU A;  4PI2 A;  3IG0 A;  2XHB A;  5CB4 A;  5FNV B;  2OWO A;  3TY9 A;  3RFR A;  4ZOL B;  3VNN A;  4JI3 H;  5LXT A;  4HNA B;  5IJ9 B;  1WH2 A;  1BGW A;  2YCH A;  4JI7 B;  1BJT A;  4LNU B;  2VQF B;  4LF5 B;  1JFF A;  3N44 B;  4LF5 H;  3KXY T;  5IT9 W;  3J7A K;  3K59 A;  4M7E A;  4JI0 H;  4TV8 A;  5LP6 B;  4CC6 A;  4D7S A;  5C8Y A;  3JAK B;  3WB0 A;  5LL6 b;  4B3S H;  4B3S B;  3RJ0 A;  1TGO A;  4CS3 A;  5ITZ B;  5CA0 B;  4DV7 B;  4DV7 H;  4X1Y A;  3VQV A;  2P5O A;  2ZNI A;  3E22 A;  4X20 A;  3N43 B;  1JJO A;  4I50 A;  3N41 B;  3K5L A;  5EYP A;  5KMG A;  5J2U A;  3M7M X;  4I9Q A;  3JAW A;  2CFM A;  4GLX A;  5JCO C;  3JSN A;  2UU9 B;  3OTO H;  3OTO B;  1N36 H;  1N36 B;  5JJN B;  4PHZ A;  2YIB A;  1FFX A;  1I6U A;  2GV9 A;  1P49 A;  1KU9 A;  1IBM H;  1IBM B;  4B3T H;  4B3T B;  4FM1 A;  1RSO A;  1M5I A;  3JAT B;  4UCS A;  4ZHQ B;  4LH6 A;  2R9A A;  4KL1 A;  4CH6 A;  1Z2O X;  2RGV A;  4LMY A;  3U11 A;  5LYJ B;  3W1B A;  3RYC B;  3QG5 A;  3UT5 A;  3RYH A;  3SJC C;  2Q7H A;  2PUS A;  5BMV A;  4EQ5 A;  1ZHQ A;  4JI8 H;  2HEP A;  4CC5 A;  4X1K A;  3A2F A;  1HNW H;  1HNW B;  3U10 A;  3DF7 A;  4DV5 B;  2UUC H;  3JSL A;  4O4J A;  1L2Z A;  5FPO A;  4EB6 A;  4DUY B;  4DV1 B;  4DV1 H;  1TUB A;  4AQY H;  4AQY B;  5K1X A;  4A2B A;  3F8N A;  5JCO A;  1WN7 A;  4FLV A;  4GKK B;  4PZ8 A;  4IIJ A;  5JQG B;  1IBL H;  1MZB A;  4FM2 A;  5KHK A;  5LA6 A;  2UUB H;  2UUB B;  4YJ2 A;  4D7T A;  2HHH B;  3HKE A;  4L8J A;  1TVK A;  4FLT A;  3KAL A;  4O4I B;  2YIB D;  4DV6 B;  4DV6 H;  4DK1 A;  3NBY B;  3RYI B;  4NXN H;  4NXN B;  1VF7 A;  4TQF A;  5JVD B;  4FLU A;  2JS5 A;  2FE3 A;  5EZY A;  4X1I B;  3SR2 C;  3ETQ A;  4I55 A;  3QTC A;  5IJ0 A;  4LFB H;  4LFB B;  1SKV A;  2XIG A;  4RB1 A;  4X66 H;  4X66 B;  1CKN A;  4CH5 A;  1J5E B;  2PYL A;  2VUG A;  3TY5 A;  5KHI A;  1SA0 A;  4IHJ B;  4LH7 A;  1T5E A;  2MCT A;  2ZIN A;  2HIX A;  5FD6 A;  1S03 G;  3RGB A;  2WE6 A;  1L8D A;  2IM9 A;  1N34 B;  4DR6 H;  3WB2 A;  4ZIB A;  5IWA H;  1X4T A;  5IWA B;  1A0I A;  2QJ1 A;  4O2B A;  4DRF A;  2O03 A;  2PTM A;  3N2K B;  5IYZ B;  1SQF A;  4DRX B;  3NBZ B;  4MTE A;  5LMN H;  4OX9 H;  4OX9 B;  1M0W A;  3JAR A;  1N32 H;  2UUA B;  1N32 B;  1HNX B;  1HNX H;  4O4H B;  5FNV A;  1P16 A;  2JGU A;  1O75 A;  4FLX A;  3CSX A;  4ETS A;  5CA1 B;  4TV9 B;  4ZI7 A;  1Z5W A;  2VPS A;  4FFB A;  4AIL C;  4LF7 B;  4LF7 H;  4JI1 B;  2VOB A;  4JI7 H;  3VQW A;  2VQF H;  2HVS A;  1WNS A;  4BWS C;  2CAZ C;  5CB4 B;  3J81 W;  3OTF A;  1M93 A;  3GDE A;  4DV4 H;  3QF7 A;  4DV4 B;  3CVZ A;  2Q2T A;  3JAM W;  1HR0 H;  2Q7E A;  1HR0 B;  4X64 B;  4PI0 A;  4X64 H;  3RTX A;  2WYO A;  4Q6G A;  4I7H A;  5LXT B;  3KAK A;  4LFC H;  4LFC B;  3RYF A;  4DV0 H;  3U0Z A;  4DV0 B;  2UU9 H;  1O9H A;  5BR8 B;  4TOI A;  1E4G T;  1JFF B;  3JAL A;  2ZJT A;  4FM9 A;  3RWR D;  4R7R A;  4TV8 B;  2Q7G A;  4PZ6 A;  3SGI A;  5EIB C;  5C8Y B;  5D1O A;  4JI6 B;  4UCO A;  3RR5 A;  1XK5 A;  2UXD H;  2UXD B;  3SJB C;  4X1Y B;  1NT2 B;  3KYH C;  5GON A;  4ZHQ A;  3E22 B;  4X20 B;  4UCV A;  1B04 A;  4F6R A;  3RGZ A;  4I50 B;  5D5Q A;  3W5O A;  5EYP B;  5KMG B;  5J2U B;  2BTO A;  4GKJ B;  3MWM A;  4LR3 A;  4MV9 A;  1FFX B;  4FVM A;  4DV5 H;  3B2E E;  4FM0 A;  4DUY H;  1HNZ B;  4RAY A;  1HNZ H;  3QWU A;  3K5M A;  2WDT A;  3J80 W;  4I4T A;  4YJ3 A;  4BW9 A;  3GB8 B;  4EFE A;  2BTQ B;  3N6X A;  4GKK H;  3UT5 B;  3RYH B;  3RF2 A;  1TA8 A;  5BMV B;  1XMO B;  5A2Q W;  3CHX A;  4JI2 B;  4X62 B;  3CB2 A;  3ZED A;  4X1K B;  5KX5 A;  2QM4 A;  4LF8 H;  4LF8 B;  1FVI A;  1H2S B;  1FJG H;  1FJG B;  4O4J B;  5LOV A;  3FFQ A;  2HHH H;  4U3J A;  4JYA B;  4JI5 H;  1Q8I A;  3BAA A;  4JI5 B;  4EB6 B;  4CH3 A;  1TUB B;  1P8L A;  4TQD A;  2VQE H;  2VQE B;  1ZHS A;  1O9G A;  3T1H B;  3W1G A;  2ZIO A;  4KHP B;  4O4I A;  4KHP H;  4UCR A;  4IIJ B;  1Q43 A;  3MAQ A;  5LA6 B;  3HKB A;  1G6U A;  4LFA B;  1D5A A;  4YJ2 B;  4DR3 H;  4DR3 B;  4O4L B;  4AHC A;  4DR2 H;  4DR2 B;  3HKE B;  4E6N A;  1TVK B;  1J5E H;  3THO A;  1M0T A;  2E3C A;  5KHG A;  2KSW A;  3H20 A;  2YXL A;  3N2G A;  1XHX A;  4TUY A;  1XNR B;  3ZS8 C;  2Q2U A;  4DR7 B;  3HKD A;  1N34 H;  3BA9 A;  4K0K H;  4K0K B;  1IBK H;  4O2A A;  5EZY B;  1IBK B;  2UXC B;  4J0M A;  2UXC H;  4I55 B;  5IJ0 B;  5LP6 C;  4LSA A;  2JVD A;  5J2T A;  4PDB A;  3HKC A;  1CKO A;  1CKN B;  5EIB D;  3FMA A;  1SA0 B;  2RQ6 A;  2W57 A;  2P22 C;  1XHZ A;  4LF6 B;  4LF6 H;  4WBN A;  3JAS A;  4DUZ H;  3VQY A;  4DUZ B;  4CS4 A;  4K8Z A;  1JMK C;  5JH7 A;  4DR4 B;  4LF9 H;  4LF9 B;  3BA8 A;  2UUA H;  4RZQ A;  2UXB B;  3BPZ A;  2PZS A;  2ZM6 H;  2YI9 A;  2R70 A;  2ZM6 B;  1N33 B;  2V4D A;  1N33 H;  4FLY A;  3T1Y B;  3T1Y H;  1Z5V A;  1WPB A;  4DR1 H;  4DR1 B;  3DSQ A;  2PGG A;  4ZOL A;  2ZIM A;  3N40 P;  5FD5 A;  3SJA C;  4O2B B;  4JI1 H;  4HNA A;  5IJ9 A;  3K5N A;  4NXM B;  2HVQ A;  3GJX B;  4NXM H;  3ICX A;  3RIZ A;  4MTD A;  1XNQ B;  3K58 A;  4LNU A;  3JAR B;  4MV7 A;  5LP6 A;  1Z2N X;  3JAK A;  2CW7 A;  1CKM A;  5ITZ A;  5CA0 A;  1X9N A;  4DK0 A;  4ZI7 B;  2VWJ A;  1AN7 A;  4FFB B;  4JI3 B;  4DV2 B;  4DV2 H;  5BR8 H;  1XQ8 A;  4EEQ A;  4YHH B;  4YHH H;  1XMQ H;  5JJE B;  1XMQ B;  4PZ7 A;  3M4I A;  2ZNJ A;  2RJZ A;  1Q5O A;  3UQ8 A;  2E5L H;  2E5L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...