4XYLB

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
225
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 66
structure length 225
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xylB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xylB02
3JRWA 2PN1A 2FPGB 5J2UF 4HNUA 2YRWA 4EG0A 3TINA 4TV8F 4O84A 1KEEA 5LXTF 1DV2A 2YZGA 3N8DA 1EYZA 4O7ZA 3I12A 4I55F 3JRXA 1Z2NX 1C3OA 2NU8B 2CNVA 4YB8B 2R84A 5K2MA 4QSHA 2R7NA 1A9XA 2QK4A 1VKZA 1WR2A 2X0SA 1GLVA 4FU0A 2DZDA 2XD4A 1I7NA 4L1KA 2YS7A 4YBZB 1KJIA 1OBGA 1BNCA 1KC7A 4MV9A 3R5HA 1VBGA 2YW2A 3TIGA 2GQRA 3RUPA 2V58A 1JLLB 4MV1A 3R5XA 3ORRA 5HV6A 4XX0B 1KUTA 2HGSA 3BG5A 1B6SA 3K3PA 5BPHA 3U9SA 5I47A 3OUZA 4O4HF 2YZNA 4NYEA 4IIJF 2I8CA 4IZOA 3U54A 5DMXA 1PX2A 1EUCB 1CS0A 3GIDA 4ZQIA 2NUAB 5CB4F 4EGJA 3WO0A 3KAKA 4O7NA 4FFLA 2NU7B 1KJ9A 2YL2A 2YS6A 4XYMB 4XZ3B 3JZFA 4FFOA 1EUDB 4YJ2F 4FGRA 4FFNA 2R86A 2OLSA 3GLKA 5BPFA 2DIKA 2I87A 2R85A 4O7RA 2PVPA 3E5NA 4IHJF 3WO1A 4XYLB 3U9TA 4O83A 3KREA 4O7WA 3VOTA 1SCUB 4ZOLF 4DIMA 3LP8A 5KX5F 1I7LA 1PK8A 4YJ3F 3TQTA 4Y8VB 4EGQA 3Q2OA 5IYZF 3MWDA 2VR1A 1KJ8A 3VPBA 2R7MA 4O7LA 1AUXA 5EZYF 2GPWA 2FPIB 2DLNA 1T36A 5JQWA 4ZI7F 3LWBA 5JQGF 4YAKB 1DIKA 4MV6A 4O7YA 3NUAA 4MV3A 3AX6A 2V59A 4MV7A 2PBZA 5C1OA 2W6ZA 3Q1KA 1EZ1A 3ORQA 3RV3A 1E4EA 1CE8A 5D8DA 2W6MA 1M6VA 2NU6B 3V4ZA 1W96A 4HQ6A 3TIIA 4HNTA 3ETHA 4FE2A 5JVLA 5LP6F 4C5BA 1Z2PX 2W6PA 4C5CA 1M0WA 2R6FA 1CQJB 1Z2OX 2NU9B 2CNQA 2YWVA 4HNVA 1IOVA 2SCUB 3MJFA 3RFCA 2C00A 2Z02A 2QF7A 3SE7A 1GSHA 4FFRA 5LA6F 4O4IF 4M9UA 2VPQA 2YRXA 2W6NA 5C8YF 4HR7A 4TV9F 5KKNB 5FNVF 2ZDGA 1EHIA 2GLTA 3VMMA 2GQSA 2HJWA 3ETJA 3R5FA 3V4SA 3HO8A 3U55A 5LYJF 1GSOA 3N6RA 2CZGA 1UC9A 5CAEB 5J2TF 2R7KA 2ZDHA 1VBHA 2YZLA 2CQYA 3DF7A 4O7SA 1E4EB 1GSAA 4IWXA 2R87A 4WD3A 3UFXB 2DWCA 1M0TA 3HB9A 4MAMA 3VPCA 1DV1A 2V5AA 4O4LF 4I50F 1OBDA 2XCLA 4O7VA 1UC8A 4O86A 4O7TA 5HBRB 4RZQA 1ULZA 5JVDF 2GPSA 2FB9A 1IOWA 2I80A 5CA0F 5JH7F 2R82A 3G8DA 2W6OA 1B6RA 4YAJB 1A48A 5BMVF 5GONF 2P0AA 1KJQA 3K5HA 1AUVA 2WYOA 3TW6A 4MA0A 4C5AA 4DLKA 3G8CA 1BXRA 3VA7A 3AW8A 2ZDQA 3KALA 2W70A 3R23A 3VPDA 1GGOA 5CA1F 4FFPA 2Z04A 4MA5A 5LOVF 2IP4A 4E4TA 4ME6A 4MV4A 1KJJA 4ZHQF 2FPPB 4O82A 5C1PA 1CQIB 2FP4B 1JDBB 5H80A 2YZMA 1C30A 1KBLA 4FFMA 4I4TF 2CNUA 1JKJB 1W93A 2W71A 3KAJA 4O2AF 4O81A 4TUYF 3OUUA 4IWYA 3MWEA 3QFFA 4MV8A 4WBNF 2VQDA 3JZIA 2YYAA 3WNZA 4O2BF 1JDEA 2J9GA 3K5IA 2R7LA 3RV4A 3HBLA 2W6QA 3R9RA 4O4JF
chains in the Genus database with same CATH superfamily
2W7OA 3JRWA 1XK5A 4LSXA 4RB3C 2PN1A 4GC7A 1FKAH 2FPGB 1P16A 1I6UA 4NZOA 5J2UF 2VUMA 1Y14B 4HNUA 1XDNA 1IBLH 4J9NA 3PO3G 2YRWA 4A2AA 4EG0A 3OHAA 4DV4H 4EBDA 3S24A 4A3FG 1I1KA 4BBRG 2X5RA 5DGAA 3TINA 2UVWA 4TV8F 5KFAA 5CE8A 4JI8H 4O84A 4DUYH 2R93G 4NLGA 4A3GG 3LQSA 1KEEA 1WRVA 5LXTF 1E4GT 3CVZA 4A2BA 4YP3A 1DV2A 2YZGA 5KFNA 2DABA 5KFRA 3J81W 1S10A 3GB8B 3N8DA 1G2WA 4GLXA 2W7PA 1EYZA 1I2KA 3I12A 4I55F 3JRXA 4O7ZA 3N43B 3RB6A 1S97A 3TQ1A 1Z2NX 1C3OA 2NU8B 1MZBA 5DQGA 2R8GA 2CNVA 2ZM6H 2MCTA 2VUMG 5IP9G 4LF5H 4PWQA 2O03A 4YB8B 1RK5A 5F9LA 1JX4A 5KFCA 1J5EH 4ED6A 2R84A 4RAZA 5K2MA 4C2MA 4QSHA 5F9NA 1RYSA 2R7NA 2C28A 3GIQA 2IBKA 1A9XA 4K6NA 2QK4A 2W9BA 3NBZB 2CFMA 3BABA 3QQMA 3W1BA 1SEIA 3JAMW 4QWCA 2R8IA 4LFAH 4BXXG 1VKZA 4ECYA 4PZ8A 1WR2A 1TAEA 2X0SA 3T5LA 4NZNA 4EBEA 1WSCA 5FJ8G 3T5HA 3SGIA 3HOXG 1GLVA 4ED0A 3V6HA 4FU0A 2DZDA 2Y0SE 5KFHA 3GTMA 2JA5A 3GIIA 3RBDA 2XD4A 3HOUG 5FR9A 1I7NA 1KT8A 4L1KA 5BWTA 1HR0H 4IRDA 2YS7A 4RB0A 4YBZB 1XNRH 1XMOH 1KJIA 4CC6A 4JV2A 4A3JG 1S0MA 2B63G 2W8KA 1OBGA 4A3DG 5KFTA 5L1JA 3LULA 3PW7A 4WHXA 1BNCA 3T9EA 5IYDG 1KC7A 2ASDA 4MV9A 1JXLA 3BA9A 3R5HA 3KTMA 4Q0YA 1VBGA 2YW2A 3TIGA 4J0MA 2GQRA 4M7EA 2RF4A 4DV2H 2V58A 3RUPA 1JLLB 1N48A 5KFYA 2HG8A 4MV1A 1ZETA 3R5XA 3ORRA 5HV6A 4JXUA 4XX0B 3M9MB 1KUTA 2PMZA 2HGSA 2RDJA 3QZ7A 2V4QA 3BG5A 1B6SA 1RJRA 3C0FB 4DV7H 3K3PA 5BPHA 1I3QA 5KFQA 2FK3A 4Q4CA 2UUAH 1BJTA 3RB4A 4Q44A 4CMDA 2FMAA 3U9SA 5BWWA 5I5UA 3QZ8A 2XCAA 5KT6A 4HN2A 4JI3H 4Q45A 5KFLA 5CR5A 2HGWA 5I47A 1X9NA 1TWCA 4YR3A 3OUZA 1V51A 4O4HF 2HHFB 4DR2H 2YZNA 4NYEA 3GTKA 3GTOA 4IIJF 2I8CA 2Y0SA 1R9TA 4IZOA 4IR1A 4DR1H 4RZRA 3U54A 3SNOA 2C22A 3I4MG 5DMXA 4JI4H 4JV5H 1PX2A 4EBCA 3FMAA 4K0KH 1EUCB 4LFBH 2UUBH 1I50A 4F4WA 2UXCH 3PW5A 2R8HA 3HOYG 4LH7A 5KG7A 1WCMG 4UCVA 3H40A 4LF8H 4JI2H 1CS0A 4YHHH 2WB1E 3GIDA 1ZHQA 4RAYA 4ZQIA 4U6PA 2NVYA 3T9BA 4IR9A 1TWGA 2NUAB 5CB4F 2W9BB 1S03G 4YY3H 4LFCH 2ATLA 4EGJA 2JEGA 3T9CA 1A0IA 3WO0A 3PVXA 4EFEA 3CEBA 3KAKA 4O3QA 3G6YA 2J6TA 4O7NA 5KG0A 5BYBA 4FFLA 3N44B 2NU7B 3EPIA 3H0GA 4R8UA 1WH2A 1KJ9A 2YL2A 4JUZA 2ABJA 5FLXW 3GIJA 2E2HA 2YS6A 4UFZA 4XYMB 1SYXB 1TWFA 2HVSA 3GILA 4A93G 3DTFA 3T1HH 4XZ3B 4QIWA 4O3RA 3JZFA 2UVRA 1CKOA 4BBSG 2DAAA 4DV1H 4JYAH 2W57A 4FFOA 2A1HA 1EUDB 1E4FT 4YJ2F 5KG6A 4DAAA 4FGRA 2YCHA 3K3VA 4FFNA 2R86A 4QW9A 2W8LA 3RGZA 3T9AA 3HOWG 1B33N 1XMQH 2OLSA 3GLKA 5C3EG 3N41B 2UUCH 4CKCA 5BPFA 5KFWA 4MTDA 2DIKA 5KFEA 3JSLA 2I87A 4NXMH 2R85A 4O7RA 2QB5A 2PVPA 1L2ZA 3E5NA 4IHJF 3WO1A 2HVRA 3H4BA 4XYLB 3U9TA 2HHHH 1Y1WA 4O83A 3H0GG 4DR7H 3KREA 4O7WA 3N42B 5KG2A 2VQEH 3VOTA 2COIA 3RTXA 3EYYA 3RB3A 2WB1A 1SCUB 4ZOLF 4DIMA 4QW8A 3LP8A 4DR3H 5KX5F 4ED3A 4UCSA 4TQSA 2UVUA 2WDTA 1I7LA 1PK8A 1EKVA 4YJ3F 5KG1A 5K3WA 2Q7DA 3TQTA 4F4YA 4Y8VB 4EGQA 1XNQH 4RNMA 2COGA 2BQUA 4LF7H 4FM9A 1B04A 3Q2OA 4R7RA 2RGRA 5IYZF 2DPJA 3MWDA 2FE3A 1T94A 3TY8A 4DR5H 4DL5A 2VR1A 3T9FA 1KJ8A 5FPRA 3TW7A 3VPBA 5KFIA 3KHLA 3GTPA 5KT7A 1Y1WG 5KG3A 2JA7A 2R7MA 5LMNH 4ECWA 4O7LA 3HKZE 3N6XA 1A0GA 3T9DA 1AUXA 2WE6A 4ED1A 4Q8EA 4A3MG 5DAAA 5EZYF 3TY5A 4NXNH 2NVXA 3CSWA 2GPWA 2XCPA 1I1LA 2FPIB 2DLNA 2FK1A 3UZBA 3PZPA 2UXDH 1O75A 3PW4A 1ZAUA 1T36A 5DGIA 4O3NA 5JQWA 4IAJA 4J9LA 1CKNA 4CKBA 4ZI7F 3TEKA 3L2PA 3LWBA 5FPOA 3W5OA 2R92A 5BWUA 5JQGF 4YAKB 4Q8FA 5DGBA 2FLNA 1HNXH 2ASLA 4RU9A 1DIKA 2UVVA 1FJGH 5BR8H 4MV6A 4O7YA 4G3IA 5IYCG 3NUAA 5KFJA 3J80W 4F4XA 4KHPH 5D1PA 4CE5A 2J6UA 4MV3A 3AX6A 2EJ2A 3U0GA 4R8UB 4A3EG 2V59A 4NZMA 3Q8PB 4MV7A 2PBZA 5C1OA 4DL4A 4EQ5A 1RJQA 4QWDA 2W6ZA 3Q1KA 1EZ1A 2Q2UA 2EIYA 4BY1G 1IYDA 3ORQA 3RV3A 5L1IA 4JI7H 2JA5G 3RJ0A 1E4EA 3KHGA 1KTAA 3BQ1A 3I4NG 5KFMA 4B3TH 3G6XA 2XGPA 2CW8A 4OX9H 2JA8G 1CE8A 5KFGA 4CKEA 5KFPA 4J9RA 5D8DA 3PN1A 2KSWA 4EYIB 2W6MA 2E5LH 2VA2A 2BQ3A 1M6VA 2NU6B 3V4ZA 1M7JA 4A3IG 1W96A 4HQ6A 3TIIA 4HNTA 3ETHA 4RB1A 4FE2A 5JVLA 3RGXA 4QJFA 4JV1A 5LP6F 5KS8A 4C5BA 3HKZA 2R7ZA 4FBTA 1EKPA 1V4YA 3KHRA 5KFDA 3DTGA 1Z2PX 2W6PA 1N34H 5KFOA 4C5CA 3PR5B 1M0WA 2HIVA 5C44G 2EJ3A 2R6FA 1CQJB 5I5YA 2HGXA 3OSPA 2JEJA 2R8JA 3N40P 1Z2OX 5JUMA 3GIKA 2NU9B 4UCOA 2CNQA 5DQIA 3BQ2A 4GKJH 2YWVA 4HNVA 4X64H 1IOVA 5LMUH 4HYKA 2SCUB 3MJFA 2WAQE 4ECUA 1ZQ7A 3RFCA 4LSAA 2C00A 2Z02A 2QF7A 4ED2A 5I5VA 4UCRA 4DL7A 5BWRA 3SE7A 5I5SA 1OWTA 2VQFH 2ASJA 2Y4RA 3T7AA 2FK2A 1GSHA 5KG4A 2W9CA 5L1LA 2AGOA 1V9PA 3GV5B 4DR6H 4FFRA 5LA6F 4O4IF 3V6KA 4M9UA 2C2EA 3G6VA 2BR0A 3NBYB 2VPQA 1SFOA 4PZ7A 4RCNA 2YRXA 5KFUA 5IYBG 2HDKA 4LF4H 2R7ZG 2W6NA 3OSNA 3RAQA 4O3SA 1S0NA 5C8YF 5KT2A 4PDBA 3PR4A 3GTGA 5KT4A 3RF2A 1ET0A 4PBCA 2HVQA 4HR7A 4TV9F 4AYBE 5FD5A 5KKNB 5KFXA 5FNVF 1CKNB 1EHIA 2GLTA 2ZDGA 4TM5A 1ZHSA 4M0JA 5KFSA 4DL2A 3VMMA 3HT5A 1IYEA 2FLPA 1HNZH 2GQSA 2HJWA 3MR2A 3H3VH 4GKKH 3ETJA 3R5FA 4PZ6A 3V4SA 4ECSA 2ZGIA 4ECXA 5DLGA 2C2DA 3UZOA 3HO8A 3T5JA 3H4DA 3U55A 5LYJF 1GSOA 4YR2A 3N6RA 4FS2A 5C4XG 3KHHA 3WWIA 5KFKA 3L4JA 2CZGA 2EJ0A 2JEFA 3HOZG 1UC9A 3GV8B 3RBEA 5CAEB 5J2TF 2R7KA 2ZDHA 3GQCA 3BQ0A 3PW0A 2OWOA 2R93A 1VBHA 2YZLA 3QWUA 5E25A 2CQYA 3DF7A 3MFHA 2COJA 4CHIA 2WAQA 5KFBA 4O7SA 3PW2A 1VS0A 1E4EB 5D1OA 4EEQA 3OHBA 1GSAA 4IWXA 1UNNC 4YQWA 4B3MH 3T1YH 2R87A 5L1KA 4RUAA 4JI1H 4WD3A 5KFFA 4F4ZA 4TQRA 2DPIA 2AGQA 2V9WA 4ED7A 3L4KA 4J9PA 3UFXB 2DWCA 5BWVA 4ECQA 1M0TA 3HB9A 4MAMA 1A3GA 2M05A 3V6JA 2ALZA 3T99A 3PO2G 4B3RH 3BJYA 3VPCA 1N36H 1I2LA 4DL3A 3JSNA 1GYFA 2CW7A 5DLFA 1DV1A 2V5AA 4O4LF 3JZ6A 5A2QW 4I50F 4J9SA 2UU9H 3TY9A 4AYBA 1OBDA 3GIMA 4A3CG 1DAAA 2XCLA 4UCTA 2HHFA 5I5XA 5KG5A 3MFIA 2R8KA 4X66H 4O7VA 2ODTX 1N56A 4LF9H 3IN5A 3IG0A 2VPSA 4CMFA 1UC8A 3BA8A 3DAAA 4O86A 1GO3E 4LMYA 4DR4H 5KFZA 3M9NB 4RUCA 2W9CB 4O7TA 4QWEA 2UXBH 2RDIA 5HBRB 2PMZE 5EOYA 4RZQA 1ULZA 2HIXA 4EFBA 5JVDF 1VAJA 2XIGA 1N33H 2E2IA 2B63A 2GPSA 2JA6A 1T3NA 2FJZA 4J9OA 2VA3A 2FB9A 1IOWA 5HNEA 2I80A 3PFFA 4IRKA 3Q8QB 5CA0F 4F50A 5JH7F 5IP7G 2C2RA 4DUZH 3W1GA 1CKMA 2R82A 3G8DA 5BYAA 2XGQA 1JIHA 2W6OA 4DL6A 1EKFA 5IWAH 1B6RA 2JA7G 5DG7A 4YAJB 4JV0A 3HXLA 3M4IA 1A48A 2AQ4A 5DQHA 1I1MA 2QYZA 5BMVF 4YR0A 5KFVA 5GONF 5IT9W 3FDSA 5C5JA 3NGDA 2P0AA 5EWFA 1KJQA 3K5HA 4UCUA 3RAXA 2YU9A 1AUVA 2JA6G 2R92G 2WYOA 5L9XA 4J9KA 4DV0H 3TW6A 4MA0A 4C5AA 4DLKA 2W9AA 3G8CA 1TWAA 1IBKH 4UUGA 4LF6H 3J7AK 4MTEA 1RJPA 4A3KG 2IA6A 2F4VH 4O3PA 3RIZA 1BXRA 3VA7A 3AW8A 4BY7G 5D1OB 2ZDQA 2C35B 1BGWA 3BAAA 2RGVA 3KALA 3AYHB 4X62H 2AGPA 2FLLA 4B3SH 4JI6H 3MR3A 5I5TA 4X65H 4GC6A 5DGHA 4J9QA 2IMWP 2W70A 2BQRA 4FBUA 3WWHA 4AQYH 1FVIA 1P8LA 3MWMA 1WCMA 3MR5A 3R23A 5EDWA 4FS1A 3VPDA 5FD6A 1GGOA 2FKLA 1RYRA 3WWJA 5CA1F 1Y1VA 3UYYA 4QIWE 2OH2A 2WTFA 3GV7B 1TWHA 4QWBA 4JI5H 4FFPA 2Z04A 4E6NA 5EWEA 4O3OA 1K1SA 3SI8A 3KYHC 4MA5A 3FKIA 1S0OA 5BWXA 5CM0A 4I7HA 5I5WA 5LL6b 4ECVA 3UQ8A 1HNWH 5LOVF 3KXYT 3EPGA 3NC0B 2IP4A 1S68A 4E4TA 4ME6A 4MV4A 1KJJA 4DV5H 4Q4DA 4O82A 2FPPB 4ZHQF 5C1PA 1CQIB 2FP4B 4ETSA 4RB2C 2AU0A 1JDBB 5H80A 4A3LG 4LH6A 4DV6H 2YZMA 2J6SA 1I94H 1C30A 5FLMG 1KBLA 1RK6A 4FFMA 4I4TF 4RNOA 4EYHB 3RR5A 2CNUA 5EWGA 4ECTA 5DISC 1K1QA 2Q2TA 3T5KA 1JKJB 3GTQA 1W93A 5I60A 2VOBA 5DG8A 3GTLA 3BACA 4U7CA 2W71A 3KAJA 1Y1VG 3MR6A 2ZJTA 3GTJA 4O2AF 5DG9A 4ED8A 4ECZA 4O81A 4TUYF 4DRFA 3GDEA 3OUUA 3FKIG 3GJXB 3F8NA 3RB0A 3T54A 1DGSA 4IWYA 4Q43A 2V4RA 3MWEA 4J9MA 3Q8SB 4IRCA 3QFFA 3OTOH 2XC9A 4ECRA 4EEYA 4MV8A 2VQDA 3JZIA 4WBNF 4CC5A 2YYAA 3WNZA 3VNNA 4O2BF 1IBMH 1JDEA 3H20A 2J9GA 4QWAA 3K5IA 4TVIA 1TA8A 2R7LA 3GIPA 4BWSC 2VUGA 3RV4A 4GLWA 3HBLA 1AN7A 4APMA 5KT3A 4DV3H 1S9FA 3CQZA 2W6QA 3LMLA 1K83A 4A3BG 1N32H 3Q8RB 5T14A 4JI0H 3HOVG 3R9RA 4O4JF 4RNNA 4DQNA 3M9OB 5KT5A 2JEIA 2CKZB
chains in the Genus database with same CATH topology
3JRWA 2PN1A 2FPGB 5J2UF 4HNUA 2YRWA 4EG0A 3TINA 4TV8F 4O84A 1KEEA 5LXTF 1DV2A 2YZGA 3N8DA 1EYZA 4O7ZA 3I12A 4I55F 3JRXA 1Z2NX 1C3OA 2NU8B 2CNVA 4YB8B 2R84A 5K2MA 4QSHA 2R7NA 1A9XA 2QK4A 1VKZA 1WR2A 2X0SA 1GLVA 4FU0A 2DZDA 2XD4A 1I7NA 4L1KA 2YS7A 4YBZB 1KJIA 1OBGA 1BNCA 1KC7A 4MV9A 3R5HA 1VBGA 2YW2A 3TIGA 2GQRA 3RUPA 2V58A 1JLLB 4MV1A 3R5XA 3ORRA 5HV6A 4XX0B 1KUTA 2HGSA 3BG5A 1B6SA 3K3PA 5BPHA 3U9SA 5I47A 3OUZA 4O4HF 2YZNA 4NYEA 4IIJF 2I8CA 4IZOA 3U54A 5DMXA 1PX2A 1EUCB 1CS0A 3GIDA 4ZQIA 2NUAB 5CB4F 4EGJA 3WO0A 3KAKA 4O7NA 4FFLA 2NU7B 1KJ9A 2YL2A 2YS6A 4XYMB 4XZ3B 3JZFA 4FFOA 1EUDB 4YJ2F 4FGRA 4FFNA 2R86A 2OLSA 3GLKA 5BPFA 2DIKA 2I87A 2R85A 4O7RA 2PVPA 3E5NA 4IHJF 3WO1A 4XYLB 3U9TA 4O83A 3KREA 4O7WA 3VOTA 1SCUB 4ZOLF 4DIMA 3LP8A 5KX5F 1I7LA 1PK8A 4YJ3F 3TQTA 4Y8VB 4EGQA 3Q2OA 5IYZF 3MWDA 2VR1A 1KJ8A 3VPBA 2R7MA 4O7LA 1AUXA 5EZYF 2GPWA 2FPIB 2DLNA 1T36A 5JQWA 4ZI7F 3LWBA 5JQGF 4YAKB 1DIKA 4MV6A 4O7YA 3NUAA 4MV3A 3AX6A 2V59A 4MV7A 2PBZA 5C1OA 2W6ZA 3Q1KA 1EZ1A 3ORQA 3RV3A 1E4EA 1CE8A 5D8DA 2W6MA 1M6VA 2NU6B 3V4ZA 1W96A 4HQ6A 3TIIA 4HNTA 3ETHA 4FE2A 5JVLA 5LP6F 4C5BA 1Z2PX 2W6PA 4C5CA 1M0WA 2R6FA 1CQJB 1Z2OX 2NU9B 2CNQA 2YWVA 4HNVA 1IOVA 2SCUB 3MJFA 3RFCA 2C00A 2Z02A 2QF7A 3SE7A 1GSHA 4FFRA 5LA6F 4O4IF 4M9UA 2VPQA 2YRXA 2W6NA 5C8YF 4HR7A 4TV9F 5KKNB 5FNVF 2ZDGA 1EHIA 2GLTA 3VMMA 2GQSA 2HJWA 3ETJA 3R5FA 3V4SA 3HO8A 3U55A 5LYJF 1GSOA 3N6RA 2CZGA 1UC9A 5CAEB 5J2TF 2R7KA 2ZDHA 1VBHA 2YZLA 2CQYA 3DF7A 4O7SA 1E4EB 1GSAA 4IWXA 2R87A 4WD3A 3UFXB 2DWCA 1M0TA 3HB9A 4MAMA 3VPCA 1DV1A 2V5AA 4O4LF 4I50F 1OBDA 2XCLA 4O7VA 1UC8A 4O86A 4O7TA 5HBRB 4RZQA 1ULZA 5JVDF 2GPSA 2FB9A 1IOWA 2I80A 5CA0F 5JH7F 2R82A 3G8DA 2W6OA 1B6RA 4YAJB 1A48A 5BMVF 5GONF 2P0AA 1KJQA 3K5HA 1AUVA 2WYOA 3TW6A 4MA0A 4C5AA 4DLKA 3G8CA 1BXRA 3VA7A 3AW8A 2ZDQA 3KALA 2W70A 3R23A 3VPDA 1GGOA 5CA1F 4FFPA 2Z04A 4MA5A 5LOVF 2IP4A 4E4TA 4ME6A 4MV4A 1KJJA 4ZHQF 2FPPB 4O82A 5C1PA 1CQIB 2FP4B 1JDBB 5H80A 2YZMA 1C30A 1KBLA 4FFMA 4I4TF 2CNUA 1JKJB 1W93A 2W71A 3KAJA 4O2AF 4O81A 4TUYF 3OUUA 4IWYA 3MWEA 3QFFA 4MV8A 4WBNF 2VQDA 3JZIA 2YYAA 3WNZA 4O2BF 1JDEA 2J9GA 3K5IA 2R7LA 3RV4A 3HBLA 2W6QA 3R9RA 4O4JF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRW A;  2PN1 A;  2FPG B;  5J2U F;  4HNU A;  2YRW A;  4EG0 A;  3TIN A;  4TV8 F;  4O84 A;  1KEE A;  5LXT F;  1DV2 A;  2YZG A;  3N8D A;  1EYZ A;  4O7Z A;  3I12 A;  4I55 F;  3JRX A;  1Z2N X;  1C3O A;  2NU8 B;  2CNV A;  4YB8 B;  2R84 A;  5K2M A;  4QSH A;  2R7N A;  1A9X A;  2QK4 A;  1VKZ A;  1WR2 A;  2X0S A;  1GLV A;  4FU0 A;  2DZD A;  2XD4 A;  1I7N A;  4L1K A;  2YS7 A;  4YBZ B;  1KJI A;  1OBG A;  1BNC A;  1KC7 A;  4MV9 A;  3R5H A;  1VBG A;  2YW2 A;  3TIG A;  2GQR A;  3RUP A;  2V58 A;  1JLL B;  4MV1 A;  3R5X A;  3ORR A;  5HV6 A;  4XX0 B;  1KUT A;  2HGS A;  3BG5 A;  1B6S A;  3K3P A;  5BPH A;  3U9S A;  5I47 A;  3OUZ A;  4O4H F;  2YZN A;  4NYE A;  4IIJ F;  2I8C A;  4IZO A;  3U54 A;  5DMX A;  1PX2 A;  1EUC B;  1CS0 A;  3GID A;  4ZQI A;  2NUA B;  5CB4 F;  4EGJ A;  3WO0 A;  3KAK A;  4O7N A;  4FFL A;  2NU7 B;  1KJ9 A;  2YL2 A;  2YS6 A;  4XYM B;  4XZ3 B;  3JZF A;  4FFO A;  1EUD B;  4YJ2 F;  4FGR A;  4FFN A;  2R86 A;  2OLS A;  3GLK A;  5BPF A;  2DIK A;  2I87 A;  2R85 A;  4O7R A;  2PVP A;  3E5N A;  4IHJ F;  3WO1 A;  4XYL B;  3U9T A;  4O83 A;  3KRE A;  4O7W A;  3VOT A;  1SCU B;  4ZOL F;  4DIM A;  3LP8 A;  5KX5 F;  1I7L A;  1PK8 A;  4YJ3 F;  3TQT A;  4Y8V B;  4EGQ A;  3Q2O A;  5IYZ F;  3MWD A;  2VR1 A;  1KJ8 A;  3VPB A;  2R7M A;  4O7L A;  1AUX A;  5EZY F;  2GPW A;  2FPI B;  2DLN A;  1T36 A;  5JQW A;  4ZI7 F;  3LWB A;  5JQG F;  4YAK B;  1DIK A;  4MV6 A;  4O7Y A;  3NUA A;  4MV3 A;  3AX6 A;  2V59 A;  4MV7 A;  2PBZ A;  5C1O A;  2W6Z A;  3Q1K A;  1EZ1 A;  3ORQ A;  3RV3 A;  1E4E A;  1CE8 A;  5D8D A;  2W6M A;  1M6V A;  2NU6 B;  3V4Z A;  1W96 A;  4HQ6 A;  3TII A;  4HNT A;  3ETH A;  4FE2 A;  5JVL A;  5LP6 F;  4C5B A;  1Z2P X;  2W6P A;  4C5C A;  1M0W A;  2R6F A;  1CQJ B;  1Z2O X;  2NU9 B;  2CNQ A;  2YWV A;  4HNV A;  1IOV A;  2SCU B;  3MJF A;  3RFC A;  2C00 A;  2Z02 A;  2QF7 A;  3SE7 A;  1GSH A;  4FFR A;  5LA6 F;  4O4I F;  4M9U A;  2VPQ A;  2YRX A;  2W6N A;  5C8Y F;  4HR7 A;  4TV9 F;  5KKN B;  5FNV F;  2ZDG A;  1EHI A;  2GLT A;  3VMM A;  2GQS A;  2HJW A;  3ETJ A;  3R5F A;  3V4S A;  3HO8 A;  3U55 A;  5LYJ F;  1GSO A;  3N6R A;  2CZG A;  1UC9 A;  5CAE B;  5J2T F;  2R7K A;  2ZDH A;  1VBH A;  2YZL A;  2CQY A;  3DF7 A;  4O7S A;  1E4E B;  1GSA A;  4IWX A;  2R87 A;  4WD3 A;  3UFX B;  2DWC A;  1M0T A;  3HB9 A;  4MAM A;  3VPC A;  1DV1 A;  2V5A A;  4O4L F;  4I50 F;  1OBD A;  2XCL A;  4O7V A;  1UC8 A;  4O86 A;  4O7T A;  5HBR B;  4RZQ A;  1ULZ A;  5JVD F;  2GPS A;  2FB9 A;  1IOW A;  2I80 A;  5CA0 F;  5JH7 F;  2R82 A;  3G8D A;  2W6O A;  1B6R A;  4YAJ B;  1A48 A;  5BMV F;  5GON F;  2P0A A;  1KJQ A;  3K5H A;  1AUV A;  2WYO A;  3TW6 A;  4MA0 A;  4C5A A;  4DLK A;  3G8C A;  1BXR A;  3VA7 A;  3AW8 A;  2ZDQ A;  3KAL A;  2W70 A;  3R23 A;  3VPD A;  1GGO A;  5CA1 F;  4FFP A;  2Z04 A;  4MA5 A;  5LOV F;  2IP4 A;  4E4T A;  4ME6 A;  4MV4 A;  1KJJ A;  4ZHQ F;  2FPP B;  4O82 A;  5C1P A;  1CQI B;  2FP4 B;  1JDB B;  5H80 A;  2YZM A;  1C30 A;  1KBL A;  4FFM A;  4I4T F;  2CNU A;  1JKJ B;  1W93 A;  2W71 A;  3KAJ A;  4O2A F;  4O81 A;  4TUY F;  3OUU A;  4IWY A;  3MWE A;  3QFF A;  4MV8 A;  4WBN F;  2VQD A;  3JZI A;  2YYA A;  3WNZ A;  4O2B F;  1JDE A;  2J9G A;  3K5I A;  2R7L A;  3RV4 A;  3HBL A;  2W6Q A;  3R9R A;  4O4J F; 
#chains in the Genus database with same CATH topology
 2W7O A;  3JRW A;  1XK5 A;  4LSX A;  4RB3 C;  2PN1 A;  4GC7 A;  1FKA H;  2FPG B;  1P16 A;  1I6U A;  4NZO A;  5J2U F;  2VUM A;  1Y14 B;  4HNU A;  1XDN A;  1IBL H;  4J9N A;  3PO3 G;  2YRW A;  4A2A A;  4EG0 A;  3OHA A;  4DV4 H;  4EBD A;  3S24 A;  4A3F G;  1I1K A;  4BBR G;  2X5R A;  5DGA A;  3TIN A;  2UVW A;  4TV8 F;  5KFA A;  5CE8 A;  4JI8 H;  4O84 A;  4DUY H;  2R93 G;  4NLG A;  4A3G G;  3LQS A;  1KEE A;  1WRV A;  5LXT F;  1E4G T;  3CVZ A;  4A2B A;  4YP3 A;  1DV2 A;  2YZG A;  5KFN A;  2DAB A;  5KFR A;  3J81 W;  1S10 A;  3GB8 B;  3N8D A;  1G2W A;  4GLX A;  2W7P A;  1EYZ A;  1I2K A;  3I12 A;  4I55 F;  3JRX A;  4O7Z A;  3N43 B;  3RB6 A;  1S97 A;  3TQ1 A;  1Z2N X;  1C3O A;  2NU8 B;  1MZB A;  5DQG A;  2R8G A;  2CNV A;  2ZM6 H;  2MCT A;  2VUM G;  5IP9 G;  4LF5 H;  4PWQ A;  2O03 A;  4YB8 B;  1RK5 A;  5F9L A;  1JX4 A;  5KFC A;  1J5E H;  4ED6 A;  2R84 A;  4RAZ A;  5K2M A;  4C2M A;  4QSH A;  5F9N A;  1RYS A;  2R7N A;  2C28 A;  3GIQ A;  2IBK A;  1A9X A;  4K6N A;  2QK4 A;  2W9B A;  3NBZ B;  2CFM A;  3BAB A;  3QQM A;  3W1B A;  1SEI A;  3JAM W;  4QWC A;  2R8I A;  4LFA H;  4BXX G;  1VKZ A;  4ECY A;  4PZ8 A;  1WR2 A;  1TAE A;  2X0S A;  3T5L A;  4NZN A;  4EBE A;  1WSC A;  5FJ8 G;  3T5H A;  3SGI A;  3HOX G;  1GLV A;  4ED0 A;  3V6H A;  4FU0 A;  2DZD A;  2Y0S E;  5KFH A;  3GTM A;  2JA5 A;  3GII A;  3RBD A;  2XD4 A;  3HOU G;  5FR9 A;  1I7N A;  1KT8 A;  4L1K A;  5BWT A;  1HR0 H;  4IRD A;  2YS7 A;  4RB0 A;  4YBZ B;  1XNR H;  1XMO H;  1KJI A;  4CC6 A;  4JV2 A;  4A3J G;  1S0M A;  2B63 G;  2W8K A;  1OBG A;  4A3D G;  5KFT A;  5L1J A;  3LUL A;  3PW7 A;  4WHX A;  1BNC A;  3T9E A;  5IYD G;  1KC7 A;  2ASD A;  4MV9 A;  1JXL A;  3BA9 A;  3R5H A;  3KTM A;  4Q0Y A;  1VBG A;  2YW2 A;  3TIG A;  4J0M A;  2GQR A;  4M7E A;  2RF4 A;  4DV2 H;  2V58 A;  3RUP A;  1JLL B;  1N48 A;  5KFY A;  2HG8 A;  4MV1 A;  1ZET A;  3R5X A;  3ORR A;  5HV6 A;  4JXU A;  4XX0 B;  3M9M B;  1KUT A;  2PMZ A;  2HGS A;  2RDJ A;  3QZ7 A;  2V4Q A;  3BG5 A;  1B6S A;  1RJR A;  3C0F B;  4DV7 H;  3K3P A;  5BPH A;  1I3Q A;  5KFQ A;  2FK3 A;  4Q4C A;  2UUA H;  1BJT A;  3RB4 A;  4Q44 A;  4CMD A;  2FMA A;  3U9S A;  5BWW A;  5I5U A;  3QZ8 A;  2XCA A;  5KT6 A;  4HN2 A;  4JI3 H;  4Q45 A;  5KFL A;  5CR5 A;  2HGW A;  5I47 A;  1X9N A;  1TWC A;  4YR3 A;  3OUZ A;  1V51 A;  4O4H F;  2HHF B;  4DR2 H;  2YZN A;  4NYE A;  3GTK A;  3GTO A;  4IIJ F;  2I8C A;  2Y0S A;  1R9T A;  4IZO A;  4IR1 A;  4DR1 H;  4RZR A;  3U54 A;  3SNO A;  2C22 A;  3I4M G;  5DMX A;  4JI4 H;  4JV5 H;  1PX2 A;  4EBC A;  3FMA A;  4K0K H;  1EUC B;  4LFB H;  2UUB H;  1I50 A;  4F4W A;  2UXC H;  3PW5 A;  2R8H A;  3HOY G;  4LH7 A;  5KG7 A;  1WCM G;  4UCV A;  3H40 A;  4LF8 H;  4JI2 H;  1CS0 A;  4YHH H;  2WB1 E;  3GID A;  1ZHQ A;  4RAY A;  4ZQI A;  4U6P A;  2NVY A;  3T9B A;  4IR9 A;  1TWG A;  2NUA B;  5CB4 F;  2W9B B;  1S03 G;  4YY3 H;  4LFC H;  2ATL A;  4EGJ A;  2JEG A;  3T9C A;  1A0I A;  3WO0 A;  3PVX A;  4EFE A;  3CEB A;  3KAK A;  4O3Q A;  3G6Y A;  2J6T A;  4O7N A;  5KG0 A;  5BYB A;  4FFL A;  3N44 B;  2NU7 B;  3EPI A;  3H0G A;  4R8U A;  1WH2 A;  1KJ9 A;  2YL2 A;  4JUZ A;  2ABJ A;  5FLX W;  3GIJ A;  2E2H A;  2YS6 A;  4UFZ A;  4XYM B;  1SYX B;  1TWF A;  2HVS A;  3GIL A;  4A93 G;  3DTF A;  3T1H H;  4XZ3 B;  4QIW A;  4O3R A;  3JZF A;  2UVR A;  1CKO A;  4BBS G;  2DAA A;  4DV1 H;  4JYA H;  2W57 A;  4FFO A;  2A1H A;  1EUD B;  1E4F T;  4YJ2 F;  5KG6 A;  4DAA A;  4FGR A;  2YCH A;  3K3V A;  4FFN A;  2R86 A;  4QW9 A;  2W8L A;  3RGZ A;  3T9A A;  3HOW G;  1B33 N;  1XMQ H;  2OLS A;  3GLK A;  5C3E G;  3N41 B;  2UUC H;  4CKC A;  5BPF A;  5KFW A;  4MTD A;  2DIK A;  5KFE A;  3JSL A;  2I87 A;  4NXM H;  2R85 A;  4O7R A;  2QB5 A;  2PVP A;  1L2Z A;  3E5N A;  4IHJ F;  3WO1 A;  2HVR A;  3H4B A;  4XYL B;  3U9T A;  2HHH H;  1Y1W A;  4O83 A;  3H0G G;  4DR7 H;  3KRE A;  4O7W A;  3N42 B;  5KG2 A;  2VQE H;  3VOT A;  2COI A;  3RTX A;  3EYY A;  3RB3 A;  2WB1 A;  1SCU B;  4ZOL F;  4DIM A;  4QW8 A;  3LP8 A;  4DR3 H;  5KX5 F;  4ED3 A;  4UCS A;  4TQS A;  2UVU A;  2WDT A;  1I7L A;  1PK8 A;  1EKV A;  4YJ3 F;  5KG1 A;  5K3W A;  2Q7D A;  3TQT A;  4F4Y A;  4Y8V B;  4EGQ A;  1XNQ H;  4RNM A;  2COG A;  2BQU A;  4LF7 H;  4FM9 A;  1B04 A;  3Q2O A;  4R7R A;  2RGR A;  5IYZ F;  2DPJ A;  3MWD A;  2FE3 A;  1T94 A;  3TY8 A;  4DR5 H;  4DL5 A;  2VR1 A;  3T9F A;  1KJ8 A;  5FPR A;  3TW7 A;  3VPB A;  5KFI A;  3KHL A;  3GTP A;  5KT7 A;  1Y1W G;  5KG3 A;  2JA7 A;  2R7M A;  5LMN H;  4ECW A;  4O7L A;  3HKZ E;  3N6X A;  1A0G A;  3T9D A;  1AUX A;  2WE6 A;  4ED1 A;  4Q8E A;  4A3M G;  5DAA A;  5EZY F;  3TY5 A;  4NXN H;  2NVX A;  3CSW A;  2GPW A;  2XCP A;  1I1L A;  2FPI B;  2DLN A;  2FK1 A;  3UZB A;  3PZP A;  2UXD H;  1O75 A;  3PW4 A;  1ZAU A;  1T36 A;  5DGI A;  4O3N A;  5JQW A;  4IAJ A;  4J9L A;  1CKN A;  4CKB A;  4ZI7 F;  3TEK A;  3L2P A;  3LWB A;  5FPO A;  3W5O A;  2R92 A;  5BWU A;  5JQG F;  4YAK B;  4Q8F A;  5DGB A;  2FLN A;  1HNX H;  2ASL A;  4RU9 A;  1DIK A;  2UVV A;  1FJG H;  5BR8 H;  4MV6 A;  4O7Y A;  4G3I A;  5IYC G;  3NUA A;  5KFJ A;  3J80 W;  4F4X A;  4KHP H;  5D1P A;  4CE5 A;  2J6U A;  4MV3 A;  3AX6 A;  2EJ2 A;  3U0G A;  4R8U B;  4A3E G;  2V59 A;  4NZM A;  3Q8P B;  4MV7 A;  2PBZ A;  5C1O A;  4DL4 A;  4EQ5 A;  1RJQ A;  4QWD A;  2W6Z A;  3Q1K A;  1EZ1 A;  2Q2U A;  2EIY A;  4BY1 G;  1IYD A;  3ORQ A;  3RV3 A;  5L1I A;  4JI7 H;  2JA5 G;  3RJ0 A;  1E4E A;  3KHG A;  1KTA A;  3BQ1 A;  3I4N G;  5KFM A;  4B3T H;  3G6X A;  2XGP A;  2CW8 A;  4OX9 H;  2JA8 G;  1CE8 A;  5KFG A;  4CKE A;  5KFP A;  4J9R A;  5D8D A;  3PN1 A;  2KSW A;  4EYI B;  2W6M A;  2E5L H;  2VA2 A;  2BQ3 A;  1M6V A;  2NU6 B;  3V4Z A;  1M7J A;  4A3I G;  1W96 A;  4HQ6 A;  3TII A;  4HNT A;  3ETH A;  4RB1 A;  4FE2 A;  5JVL A;  3RGX A;  4QJF A;  4JV1 A;  5LP6 F;  5KS8 A;  4C5B A;  3HKZ A;  2R7Z A;  4FBT A;  1EKP A;  1V4Y A;  3KHR A;  5KFD A;  3DTG A;  1Z2P X;  2W6P A;  1N34 H;  5KFO A;  4C5C A;  3PR5 B;  1M0W A;  2HIV A;  5C44 G;  2EJ3 A;  2R6F A;  1CQJ B;  5I5Y A;  2HGX A;  3OSP A;  2JEJ A;  2R8J A;  3N40 P;  1Z2O X;  5JUM A;  3GIK A;  2NU9 B;  4UCO A;  2CNQ A;  5DQI A;  3BQ2 A;  4GKJ H;  2YWV A;  4HNV A;  4X64 H;  1IOV A;  5LMU H;  4HYK A;  2SCU B;  3MJF A;  2WAQ E;  4ECU A;  1ZQ7 A;  3RFC A;  4LSA A;  2C00 A;  2Z02 A;  2QF7 A;  4ED2 A;  5I5V A;  4UCR A;  4DL7 A;  5BWR A;  3SE7 A;  5I5S A;  1OWT A;  2VQF H;  2ASJ A;  2Y4R A;  3T7A A;  2FK2 A;  1GSH A;  5KG4 A;  2W9C A;  5L1L A;  2AGO A;  1V9P A;  3GV5 B;  4DR6 H;  4FFR A;  5LA6 F;  4O4I F;  3V6K A;  4M9U A;  2C2E A;  3G6V A;  2BR0 A;  3NBY B;  2VPQ A;  1SFO A;  4PZ7 A;  4RCN A;  2YRX A;  5KFU A;  5IYB G;  2HDK A;  4LF4 H;  2R7Z G;  2W6N A;  3OSN A;  3RAQ A;  4O3S A;  1S0N A;  5C8Y F;  5KT2 A;  4PDB A;  3PR4 A;  3GTG A;  5KT4 A;  3RF2 A;  1ET0 A;  4PBC A;  2HVQ A;  4HR7 A;  4TV9 F;  4AYB E;  5FD5 A;  5KKN B;  5KFX A;  5FNV F;  1CKN B;  1EHI A;  2GLT A;  2ZDG A;  4TM5 A;  1ZHS A;  4M0J A;  5KFS A;  4DL2 A;  3VMM A;  3HT5 A;  1IYE A;  2FLP A;  1HNZ H;  2GQS A;  2HJW A;  3MR2 A;  3H3V H;  4GKK H;  3ETJ A;  3R5F A;  4PZ6 A;  3V4S A;  4ECS A;  2ZGI A;  4ECX A;  5DLG A;  2C2D A;  3UZO A;  3HO8 A;  3T5J A;  3H4D A;  3U55 A;  5LYJ F;  1GSO A;  4YR2 A;  3N6R A;  4FS2 A;  5C4X G;  3KHH A;  3WWI A;  5KFK A;  3L4J A;  2CZG A;  2EJ0 A;  2JEF A;  3HOZ G;  1UC9 A;  3GV8 B;  3RBE A;  5CAE B;  5J2T F;  2R7K A;  2ZDH A;  3GQC A;  3BQ0 A;  3PW0 A;  2OWO A;  2R93 A;  1VBH A;  2YZL A;  3QWU A;  5E25 A;  2CQY A;  3DF7 A;  3MFH A;  2COJ A;  4CHI A;  2WAQ A;  5KFB A;  4O7S A;  3PW2 A;  1VS0 A;  1E4E B;  5D1O A;  4EEQ A;  3OHB A;  1GSA A;  4IWX A;  1UNN C;  4YQW A;  4B3M H;  3T1Y H;  2R87 A;  5L1K A;  4RUA A;  4JI1 H;  4WD3 A;  5KFF A;  4F4Z A;  4TQR A;  2DPI A;  2AGQ A;  2V9W A;  4ED7 A;  3L4K A;  4J9P A;  3UFX B;  2DWC A;  5BWV A;  4ECQ A;  1M0T A;  3HB9 A;  4MAM A;  1A3G A;  2M05 A;  3V6J A;  2ALZ A;  3T99 A;  3PO2 G;  4B3R H;  3BJY A;  3VPC A;  1N36 H;  1I2L A;  4DL3 A;  3JSN A;  1GYF A;  2CW7 A;  5DLF A;  1DV1 A;  2V5A A;  4O4L F;  3JZ6 A;  5A2Q W;  4I50 F;  4J9S A;  2UU9 H;  3TY9 A;  4AYB A;  1OBD A;  3GIM A;  4A3C G;  1DAA A;  2XCL A;  4UCT A;  2HHF A;  5I5X A;  5KG5 A;  3MFI A;  2R8K A;  4X66 H;  4O7V A;  2ODT X;  1N56 A;  4LF9 H;  3IN5 A;  3IG0 A;  2VPS A;  4CMF A;  1UC8 A;  3BA8 A;  3DAA A;  4O86 A;  1GO3 E;  4LMY A;  4DR4 H;  5KFZ A;  3M9N B;  4RUC A;  2W9C B;  4O7T A;  4QWE A;  2UXB H;  2RDI A;  5HBR B;  2PMZ E;  5EOY A;  4RZQ A;  1ULZ A;  2HIX A;  4EFB A;  5JVD F;  1VAJ A;  2XIG A;  1N33 H;  2E2I A;  2B63 A;  2GPS A;  2JA6 A;  1T3N A;  2FJZ A;  4J9O A;  2VA3 A;  2FB9 A;  1IOW A;  5HNE A;  2I80 A;  3PFF A;  4IRK A;  3Q8Q B;  5CA0 F;  4F50 A;  5JH7 F;  5IP7 G;  2C2R A;  4DUZ H;  3W1G A;  1CKM A;  2R82 A;  3G8D A;  5BYA A;  2XGQ A;  1JIH A;  2W6O A;  4DL6 A;  1EKF A;  5IWA H;  1B6R A;  2JA7 G;  5DG7 A;  4YAJ B;  4JV0 A;  3HXL A;  3M4I A;  1A48 A;  2AQ4 A;  5DQH A;  1I1M A;  2QYZ A;  5BMV F;  4YR0 A;  5KFV A;  5GON F;  5IT9 W;  3FDS A;  5C5J A;  3NGD A;  2P0A A;  5EWF A;  1KJQ A;  3K5H A;  4UCU A;  3RAX A;  2YU9 A;  1AUV A;  2JA6 G;  2R92 G;  2WYO A;  5L9X A;  4J9K A;  4DV0 H;  3TW6 A;  4MA0 A;  4C5A A;  4DLK A;  2W9A A;  3G8C A;  1TWA A;  1IBK H;  4UUG A;  4LF6 H;  3J7A K;  4MTE A;  1RJP A;  4A3K G;  2IA6 A;  2F4V H;  4O3P A;  3RIZ A;  1BXR A;  3VA7 A;  3AW8 A;  4BY7 G;  5D1O B;  2ZDQ A;  2C35 B;  1BGW A;  3BAA A;  2RGV A;  3KAL A;  3AYH B;  4X62 H;  2AGP A;  2FLL A;  4B3S H;  4JI6 H;  3MR3 A;  5I5T A;  4X65 H;  4GC6 A;  5DGH A;  4J9Q A;  2IMW P;  2W70 A;  2BQR A;  4FBU A;  3WWH A;  4AQY H;  1FVI A;  1P8L A;  3MWM A;  1WCM A;  3MR5 A;  3R23 A;  5EDW A;  4FS1 A;  3VPD A;  5FD6 A;  1GGO A;  2FKL A;  1RYR A;  3WWJ A;  5CA1 F;  1Y1V A;  3UYY A;  4QIW E;  2OH2 A;  2WTF A;  3GV7 B;  1TWH A;  4QWB A;  4JI5 H;  4FFP A;  2Z04 A;  4E6N A;  5EWE A;  4O3O A;  1K1S A;  3SI8 A;  3KYH C;  4MA5 A;  3FKI A;  1S0O A;  5BWX A;  5CM0 A;  4I7H A;  5I5W A;  5LL6 b;  4ECV A;  3UQ8 A;  1HNW H;  5LOV F;  3KXY T;  3EPG A;  3NC0 B;  2IP4 A;  1S68 A;  4E4T A;  4ME6 A;  4MV4 A;  1KJJ A;  4DV5 H;  4Q4D A;  4O82 A;  2FPP B;  4ZHQ F;  5C1P A;  1CQI B;  2FP4 B;  4ETS A;  4RB2 C;  2AU0 A;  1JDB B;  5H80 A;  4A3L G;  4LH6 A;  4DV6 H;  2YZM A;  2J6S A;  1I94 H;  1C30 A;  5FLM G;  1KBL A;  1RK6 A;  4FFM A;  4I4T F;  4RNO A;  4EYH B;  3RR5 A;  2CNU A;  5EWG A;  4ECT A;  5DIS C;  1K1Q A;  2Q2T A;  3T5K A;  1JKJ B;  3GTQ A;  1W93 A;  5I60 A;  2VOB A;  5DG8 A;  3GTL A;  3BAC A;  4U7C A;  2W71 A;  3KAJ A;  1Y1V G;  3MR6 A;  2ZJT A;  3GTJ A;  4O2A F;  5DG9 A;  4ED8 A;  4ECZ A;  4O81 A;  4TUY F;  4DRF A;  3GDE A;  3OUU A;  3FKI G;  3GJX B;  3F8N A;  3RB0 A;  3T54 A;  1DGS A;  4IWY A;  4Q43 A;  2V4R A;  3MWE A;  4J9M A;  3Q8S B;  4IRC A;  3QFF A;  3OTO H;  2XC9 A;  4ECR A;  4EEY A;  4MV8 A;  2VQD A;  3JZI A;  4WBN F;  4CC5 A;  2YYA A;  3WNZ A;  3VNN A;  4O2B F;  1IBM H;  1JDE A;  3H20 A;  2J9G A;  4QWA A;  3K5I A;  4TVI A;  1TA8 A;  2R7L A;  3GIP A;  4BWS C;  2VUG A;  3RV4 A;  4GLW A;  3HBL A;  1AN7 A;  4APM A;  5KT3 A;  4DV3 H;  1S9F A;  3CQZ A;  2W6Q A;  3LML A;  1K83 A;  4A3B G;  1N32 H;  3Q8R B;  5T14 A;  4JI0 H;  3HOV G;  3R9R A;  4O4J F;  4RNN A;  4DQN A;  3M9O B;  5KT5 A;  2JEI A;  2CKZ B; 
#chains in the Genus database with same CATH homology
 3JRW A;  2PN1 A;  2FPG B;  5J2U F;  4HNU A;  2YRW A;  4EG0 A;  3TIN A;  4TV8 F;  4O84 A;  1KEE A;  5LXT F;  1DV2 A;  2YZG A;  3N8D A;  1EYZ A;  4O7Z A;  3I12 A;  4I55 F;  3JRX A;  1Z2N X;  1C3O A;  2NU8 B;  2CNV A;  4YB8 B;  2R84 A;  5K2M A;  4QSH A;  2R7N A;  1A9X A;  2QK4 A;  1VKZ A;  1WR2 A;  2X0S A;  1GLV A;  4FU0 A;  2DZD A;  2XD4 A;  1I7N A;  4L1K A;  2YS7 A;  4YBZ B;  1KJI A;  1OBG A;  1BNC A;  1KC7 A;  4MV9 A;  3R5H A;  1VBG A;  2YW2 A;  3TIG A;  2GQR A;  3RUP A;  2V58 A;  1JLL B;  4MV1 A;  3R5X A;  3ORR A;  5HV6 A;  4XX0 B;  1KUT A;  2HGS A;  3BG5 A;  1B6S A;  3K3P A;  5BPH A;  3U9S A;  5I47 A;  3OUZ A;  4O4H F;  2YZN A;  4NYE A;  4IIJ F;  2I8C A;  4IZO A;  3U54 A;  5DMX A;  1PX2 A;  1EUC B;  1CS0 A;  3GID A;  4ZQI A;  2NUA B;  5CB4 F;  4EGJ A;  3WO0 A;  3KAK A;  4O7N A;  4FFL A;  2NU7 B;  1KJ9 A;  2YL2 A;  2YS6 A;  4XYM B;  4XZ3 B;  3JZF A;  4FFO A;  1EUD B;  4YJ2 F;  4FGR A;  4FFN A;  2R86 A;  2OLS A;  3GLK A;  5BPF A;  2DIK A;  2I87 A;  2R85 A;  4O7R A;  2PVP A;  3E5N A;  4IHJ F;  3WO1 A;  4XYL B;  3U9T A;  4O83 A;  3KRE A;  4O7W A;  3VOT A;  1SCU B;  4ZOL F;  4DIM A;  3LP8 A;  5KX5 F;  1I7L A;  1PK8 A;  4YJ3 F;  3TQT A;  4Y8V B;  4EGQ A;  3Q2O A;  5IYZ F;  3MWD A;  2VR1 A;  1KJ8 A;  3VPB A;  2R7M A;  4O7L A;  1AUX A;  5EZY F;  2GPW A;  2FPI B;  2DLN A;  1T36 A;  5JQW A;  4ZI7 F;  3LWB A;  5JQG F;  4YAK B;  1DIK A;  4MV6 A;  4O7Y A;  3NUA A;  4MV3 A;  3AX6 A;  2V59 A;  4MV7 A;  2PBZ A;  5C1O A;  2W6Z A;  3Q1K A;  1EZ1 A;  3ORQ A;  3RV3 A;  1E4E A;  1CE8 A;  5D8D A;  2W6M A;  1M6V A;  2NU6 B;  3V4Z A;  1W96 A;  4HQ6 A;  3TII A;  4HNT A;  3ETH A;  4FE2 A;  5JVL A;  5LP6 F;  4C5B A;  1Z2P X;  2W6P A;  4C5C A;  1M0W A;  2R6F A;  1CQJ B;  1Z2O X;  2NU9 B;  2CNQ A;  2YWV A;  4HNV A;  1IOV A;  2SCU B;  3MJF A;  3RFC A;  2C00 A;  2Z02 A;  2QF7 A;  3SE7 A;  1GSH A;  4FFR A;  5LA6 F;  4O4I F;  4M9U A;  2VPQ A;  2YRX A;  2W6N A;  5C8Y F;  4HR7 A;  4TV9 F;  5KKN B;  5FNV F;  2ZDG A;  1EHI A;  2GLT A;  3VMM A;  2GQS A;  2HJW A;  3ETJ A;  3R5F A;  3V4S A;  3HO8 A;  3U55 A;  5LYJ F;  1GSO A;  3N6R A;  2CZG A;  1UC9 A;  5CAE B;  5J2T F;  2R7K A;  2ZDH A;  1VBH A;  2YZL A;  2CQY A;  3DF7 A;  4O7S A;  1E4E B;  1GSA A;  4IWX A;  2R87 A;  4WD3 A;  3UFX B;  2DWC A;  1M0T A;  3HB9 A;  4MAM A;  3VPC A;  1DV1 A;  2V5A A;  4O4L F;  4I50 F;  1OBD A;  2XCL A;  4O7V A;  1UC8 A;  4O86 A;  4O7T A;  5HBR B;  4RZQ A;  1ULZ A;  5JVD F;  2GPS A;  2FB9 A;  1IOW A;  2I80 A;  5CA0 F;  5JH7 F;  2R82 A;  3G8D A;  2W6O A;  1B6R A;  4YAJ B;  1A48 A;  5BMV F;  5GON F;  2P0A A;  1KJQ A;  3K5H A;  1AUV A;  2WYO A;  3TW6 A;  4MA0 A;  4C5A A;  4DLK A;  3G8C A;  1BXR A;  3VA7 A;  3AW8 A;  2ZDQ A;  3KAL A;  2W70 A;  3R23 A;  3VPD A;  1GGO A;  5CA1 F;  4FFP A;  2Z04 A;  4MA5 A;  5LOV F;  2IP4 A;  4E4T A;  4ME6 A;  4MV4 A;  1KJJ A;  4ZHQ F;  2FPP B;  4O82 A;  5C1P A;  1CQI B;  2FP4 B;  1JDB B;  5H80 A;  2YZM A;  1C30 A;  1KBL A;  4FFM A;  4I4T F;  2CNU A;  1JKJ B;  1W93 A;  2W71 A;  3KAJ A;  4O2A F;  4O81 A;  4TUY F;  3OUU A;  4IWY A;  3MWE A;  3QFF A;  4MV8 A;  4WBN F;  2VQD A;  3JZI A;  2YYA A;  3WNZ A;  4O2B F;  1JDE A;  2J9G A;  3K5I A;  2R7L A;  3RV4 A;  3HBL A;  2W6Q A;  3R9R A;  4O4J F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...