4XYLB

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
225
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 66
structure length 225
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xylB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xylB02
5GONF 2W6QA 2Z02A 1IOVA 1GGOA 2R82A 4MV4A 4FFMA 4MV6A 4MV7A 3DF7A 1JDEA 3GIDA 3VPDA 4O4LF 5JH7F 1DV2A 3ORQA 4ZHQF 3TIIA 3MJFA 1DV1A 5FNVF 2C00A 3JZFA 4M9UA 5C1PA 3R9RA 5KKNB 5J2TF 2V59A 4XYLB 1GSHA 3U9SA 1PX2A 3TQTA 2YL2A 1KJJA 2ZDGA 2GQSA 3HBLA 3R23A 1BNCA 3U54A 2QK4A 5EZYF 4WD3A 4O7LA 5LYJF 5C1OA 2NU8B 4I4TF 4E4TA 2V5AA 1JKJB 3Q2OA 2NUAB 1Z2NX 3N8DA 3KAJA 4FFNA 2XCLA 3U9TA 4I55F 4O86A 1Z2OX 5I47A 2CQYA 3RFCA 1OBDA 3UFXB 2ZDHA 2YRWA 3LWBA 3RV4A 5CA0F 1KJIA 2I8CA 4O7WA 4IWXA 3RUPA 2YZNA 2GPWA 4FFOA 4C5CA 4MV9A 1EHIA 3JRXA 4TV8F 3MWEA 1EUDB 4EGQA 1KEEA 1CQJB 4O7ZA 4O83A 4IHJF 5HV6A 2R6FA 4YJ2F 4YB8B 1JDBB 2IP4A 1AUVA 3N6RA 2CZGA 3K5IA 4DLKA 1CQIB 3V4ZA 3VMMA 2YRXA 2W6OA 4TV9F 3RV3A 3Q1KA 2FPPB 1CS0A 1C3OA 2NU9B 3I12A 5JVDF 1A48A 1B6RA 5BPFA 2Z04A 1CE8A 4DIMA 5IYZF 2P0AA 2R85A 2GQRA 3AW8A 1GSAA 4O7RA 1B6SA 2NU6B 2I87A 4O4JF 1W93A 4O7SA 3V4SA 3ORRA 5LP6F 2CNQA 2I80A 1PK8A 2PBZA 2W71A 3TW6A 1BXRA 4XYMB 3ETJA 3VOTA 1KBLA 4O7NA 4HNVA 4ME6A 1I7LA 1JLLB 4MA5A 1VKZA 2OLSA 4O2BF 2YS6A 4YAKB 4MV8A 3AX6A 2R7NA 1VBHA 4RZQA 1I7NA 2FB9A 3KALA 4IZOA 4FFPA 4WBNF 4QSHA 1GSOA 4MA0A 1GLVA 4O7VA 4O82A 1Z2PX 4MV3A 4C5AA 1EUCB 2J9GA 2YYAA 4O4IF 4HR7A 5LA6F 2W6MA 4FE2A 2SCUB 2YZGA 3VA7A 2VR1A 2R7MA 4FFLA 5JQWA 2FPGB 2YZLA 2W6PA 2QF7A 3LP8A 3MWDA 4TUYF 2GLTA 5BPHA 5CA1F 1UC9A 1M0TA 1AUXA 3HB9A 1OBGA 4O7TA 2FPIB 3R5XA 1DIKA 3SE7A 4HNUA 4YAJB 1E4EA 1C30A 5C8YF 1A9XA 5KX5F 1KUTA 4O4HF 4XX0B 1M0WA 4MV1A 5LXTF 3R5FA 2R84A 2DIKA 3TINA 3NUAA 2W6ZA 2CNVA 1T36A 4ZQIA 2HGSA 3K5HA 2VPQA 2VQDA 1W96A 1KC7A 1EZ1A 1WR2A 1M6VA 5H80A 3G8DA 3K3PA 4O2AF 5LOVF 2CNUA 2WYOA 3WO1A 1KJ9A 5JQGF 3KREA 1ULZA 2DWCA 5K2MA 1KJ8A 3G8CA 2YW2A 5CB4F 3GLKA 3TIGA 5JVLA 1SCUB 4IWYA 3QFFA 4Y8VB 3OUZA 4FFRA 4ZOLF 2R7KA 2V58A 5CAEB 2W70A 4EGJA 5J2UF 4O7YA 2PN1A 3E5NA 2R7LA 4FU0A 3JZIA 2ZDQA 4HNTA 4O84A 4O81A 4HQ6A 3WNZA 3JRWA 5DMXA 4FGRA 4C5BA 4MAMA 4NYEA 3ETHA 2DLNA 1E4EB 3U55A 3BG5A 2PVPA 2YWVA 3OUUA 5D8DA 4IIJF 2R87A 5HBRB 5BMVF 4I50F 1IOWA 4XZ3B 2YS7A 1EYZA 4L1KA 4YBZB 4EG0A 3VPCA 2X0SA 3HO8A 1UC8A 2FP4B 2R86A 2NU7B 1VBGA 1KJQA 4YJ3F 2XD4A 2YZMA 3R5HA 4ZI7F 2DZDA 2W6NA 3WO0A 2HJWA 3VPBA 2GPSA 3KAKA
chains in the Genus database with same CATH superfamily
5GONF 4DV7H 2W6QA 3L4JA 2Z02A 4RNNA 1IOVA 4U7CA 1GGOA 4LF5H 4JI2H 3MFIA 4DV5H 5KT7A 4YQWA 4LH7A 2R82A 3LMLA 5FD5A 3H40A 3DTGA 2FK2A 4MV4A 4GKKH 4FFMA 4I7HA 4MV6A 5KFIA 3EPIA 1G2WA 2AGQA 2C28A 5DQHA 4X62H 5JUMA 2X5RA 1ZAUA 2ABJA 4LH6A 4MV7A 3BQ1A 3DF7A 1JDEA 1RK6A 2JEJA 3GIDA 3VPDA 2V9WA 4LF6H 4O4LF 3MWMA 3EYYA 4LF9H 1XNQH 4WHXA 5JH7F 1R9TA 1DV2A 2W7OA 3ORQA 3QZ8A 4ZHQF 3TIIA 1TWFA 3HKZA 5EWFA 3MJFA 1KT8A 1DV1A 1I2KA 4DV0H 4GLXA 4ED0A 3RAQA 5L1LA 5FNVF 5F9NA 3UYYA 3TW7A 4QJFA 5EOYA 3T5JA 1N33H 2C00A 5KFDA 4LMYA 5DG8A 1Y14B 1Y1VG 4PZ6A 2AGOA 2AQ4A 3JZFA 1TWCA 1IBLH 2W9BB 2C2EA 2AU0A 4RNOA 4A3GG 3QZ7A 3J7AK 2PMZE 4M9UA 2FK1A 2C2RA 1XMOH 3AYHB 5C1PA 4B3RH 2E2IA 5KG5A 5BWRA 3R9RA 5KKNB 2R8IA 5J2TF 4JV2A 3RB0A 4J9OA 2VA3A 5K3WA 4Q44A 2FKLA 2JEGA 2V59A 5F9LA 4X66H 4XYLB 3PZPA 2YCHA 4Q43A 1GSHA 3U9SA 4J0MA 1PX2A 4TM5A 1N36H 4JV5H 3S24A 1I94H 4M0JA 1RJRA 3TQTA 1S10A 2RF4A 2YL2A 1KJJA 2ZDGA 2HG8A 4PBCA 2EJ2A 2GQSA 2Q7DA 3HBLA 3R23A 5KFPA 4DR2H 4K6NA 5BWVA 4HYKA 2UU9H 1BNCA 2ATLA 3U54A 4BBRG 3CEBA 4TVIA 2QK4A 3WWIA 2C35B 3T9EA 3RJ0A 5C44G 4GC6A 5D1OB 5EZYF 3VNNA 3RAXA 1FKAH 3W5OA 4CC5A 4DR5H 1IBMH 1IBKH 4Q45A 4WD3A 3PVXA 1EKPA 4O7LA 5LYJF 3H0GG 5C1OA 2NU8B 4I4TF 1I1KA 2V5AA 4CKBA 4E4TA 1JKJB 3Q2OA 1ZQ7A 4DL6A 2NUAB 4Q4DA 4UCUA 1K1SA 3UZOA 3I4MG 4Q8FA 1Z2NX 3N8DA 2V4RA 4LF7H 3KAJA 4F4ZA 3TQ1A 4PDBA 1A0IA 4FFNA 4ECXA 4RB1A 3FMAA 4YY3H 2XCLA 3KHRA 1TWGA 3GTGA 4A3BG 1Y1WG 3U9TA 2KSWA 2EJ3A 1EKVA 4I55F 4O86A 4RB2C 5KFCA 3H0GA 1CKNA 1Z2OX 5I47A 1K1QA 2VUGA 2CQYA 3KHLA 2E2HA 3RFCA 1V9PA 3T9BA 3L2PA 1OBDA 4J9KA 3UFXB 2ZDHA 1VS0A 2YRWA 3LWBA 4ED7A 3T9DA 1ET0A 5BYAA 3RV4A 5KFMA 3NC0B 2RGRA 5CA0F 3V6KA 1Y1WA 3GTOA 4ED3A 3FDSA 3GIQA 5DQGA 5I60A 4YR2A 4B3MH 1KJIA 2I8CA 4O7WA 4QWBA 3KTMA 5KFEA 4IWXA 3T7AA 5KG6A 2JA6G 3RUPA 4O3NA 2YZNA 1RK5A 5KFVA 2COJA 2GPWA 2J6UA 4FFOA 2HDKA 4A3DG 4C5CA 4A3JG 3T1HH 3K3VA 5IT9W 3GIKA 4MV9A 5KFZA 1EHIA 3JRXA 1ZHSA 2FLLA 1I6UA 4TV8F 3KHGA 4BBSG 4NLGA 1E4FT 1L2ZA 5KFLA 3MWEA 1EUDB 4EGQA 1KEEA 4ECZA 1S0OA 1XNRH 2UXBH 1CQJB 1B04A 4QWEA 4A3KG 4O7ZA 4O83A 2WE6A 4BY1G 4O3OA 4JI0H 5DGHA 4RAYA 4IHJF 2JA6A 4DQNA 5HV6A 4J9PA 2R6FA 4YJ2F 4J9SA 4YB8B 3LULA 1T94A 1JDBB 2IP4A 3J81W 1ZHQA 4UCRA 4AYBA 5IP9G 1AUVA 3N6RA 2CZGA 3K5IA 4DLKA 1CQIB 1I1LA 3V4ZA 3VMMA 3H4BA 3BQ2A 4EBEA 2YRXA 3NBYB 5FLXW 2HVQA 5DGBA 2W6OA 3PW0A 1HNXH 3T9AA 4A93G 4TV9F 2B63G 3RV3A 3TEKA 3Q1KA 4Q8EA 2WAQA 4F50A 2FPPB 5A2QW 1CS0A 5DLGA 3NGDA 4FBUA 4BXXG 4BWSC 1GO3E 4M7EA 3PR5B 3PW5A 4JI1H 4APMA 3Q8RB 3G6YA 4EFEA 1C3OA 2NU9B 4RUAA 1RJQA 4NXNH 1TA8A 3I12A 1S0MA 3WWJA 1IYEA 4KHPH 3CQZA 4A3IG 5JVDF 4A3FG 2IBKA 4JI7H 2B63A 1A48A 3L4KA 1B6RA 1P8LA 4DV1H 5BPFA 3UZBA 2R93G 2NVXA 4RUCA 2Z04A 1CE8A 4DIMA 5KFWA 2J6TA 3V6JA 3N44B 5IYZF 2P0AA 2R85A 2GQRA 3AW8A 4CMDA 1GSAA 4O7RA 1MZBA 3T1YH 1I50A 1B6SA 3OSNA 3GTMA 2NU6B 2I87A 4O4JF 3OSPA 3FKIG 1W93A 4MTDA 4O7SA 3V4SA 2R8KA 1S0NA 3ORRA 5LP6F 1SEIA 5KFJA 2CNQA 3HT5A 4EQ5A 3N40P 2I80A 5IYCG 2R93A 4Q4CA 4A3MG 4K0KH 1Y1VA 1PK8A 2VPSA 5D1PA 3F8NA 1I3QA 2PBZA 4DAAA 1I1MA 4TQSA 2HGXA 2ASDA 3HOYG 1DAAA 2W71A 3GJXB 3JZ6A 3T5HA 3TW6A 3DAAA 1BXRA 3N42B 4XYMB 3FKIA 3ETJA 5L9XA 4J9QA 2R8GA 3VOTA 1KBLA 4O7NA 1WH2A 3GTKA 1V4YA 5LMUH 4HNVA 2C2DA 3OTOH 3HOZG 1XK5A 3T99A 4QWCA 4ME6A 3IG0A 5LL6b 2FJZA 3JSNA 4F4YA 2Q2UA 1I7LA 4B3TH 4LFCH 2WB1A 1JLLB 2QYZA 4PZ8A 4NZOA 2DABA 4MA5A 4EYIB 3H20A 1S03G 2UVVA 2R92G 5EDWA 1X9NA 1VKZA 2CFMA 4UCTA 2OWOA 2OLSA 3MR6A 4O2BF 3PW7A 1HNZH 5I5UA 4C2MA 5KFUA 5I5SA 5I5XA 3OHBA 4RB3C 4RAZA 5DG9A 2YS6A 4DUZH 4JI6H 4YAKB 4J9RA 3M4IA 4FS2A 4MV8A 3AX6A 2XCAA 2HHHH 2R7NA 4RNMA 4QW9A 2XC9A 1VBHA 4A2AA 2DPIA 2W8LA 1RYSA 3GTJA 4JV0A 4RZQA 4CC6A 4FS1A 2BQ3A 1I7NA 4DR4H 1V51A 1TWAA 2FB9A 3M9MB 2Y0SE 5IYDG 1RJPA 4OX9H 2MCTA 3HOUG 4LFAH 4DR6H 5KFNA 4NXMH 3KALA 5I5WA 4IZOA 3PFFA 4FFPA 2YU9A 1N48A 2FLPA 4WBNF 2R7ZG 5CM0A 3C0FB 3SGIA 4QSHA 3HOXG 1GSOA 5KG4A 4MA0A 4JXUA 4QWDA 2ALZA 3EPGA 4LF4H 3GTQA 1GLVA 4DL2A 3GTLA 4O7VA 4O82A 4DUYH 1KTAA 1Z2PX 5FR9A 4JUZA 1S97A 4JI8H 1K83A 4MV3A 3TY8A 1TWHA 2F4VH 4C5AA 1EUCB 2J9GA 3RR5A 4PWQA 3M9OB 3T5LA 4LSAA 4A3EG 3GV5B 3Q8QB 4ED2A 1RYRA 2R7ZA 2YYAA 4O4IF 3BA9A 4HR7A 1T3NA 5LA6F 4AYBE 3GV8B 3I4NG 2W6MA 2Y0SA 4FE2A 2HHFA 2SCUB 3IN5A 2CW7A 2YZGA 3KHHA 3VA7A 5KG0A 2VR1A 2R7MA 4FFLA 2VQEH 5L1KA 3RBEA 2EJ0A 3LQSA 5KT4A 5JQWA 2FPGB 4X65H 2UVUA 2FLNA 2YZLA 2W6PA 2QF7A 5KG2A 3LP8A 3MWDA 4TUYF 4DV6H 2GLTA 5BPHA 2W7PA 1UC9A 5CA1F 1M0TA 2WAQE 4EEYA 5KFTA 1AUXA 1N32H 3HB9A 1CKOA 4DRFA 1WCMG 4UUGA 3N6XA 4DV2H 5FPRA 5FLMG 1OBGA 4O7TA 4ED6A 4O3SA 5KT6A 4DV3H 1N34H 1SYXB 2FPIB 3R5XA 3WWHA 4ETSA 4DR1H 1DIKA 4O3QA 4F4WA 3T9FA 4DL7A 2UUBH 2COGA 2C22A 3SE7A 4HNUA 4YAJB 1E4EA 1C30A 5C8YF 4YR3A 1A9XA 4ECQA 5KX5F 2IA6A 3SI8A 2QB5A 1HNWH 1KUTA 4EEQA 5KFFA 3BJYA 4AQYH 4O4HF 1WCMA 4XX0B 1M0WA 4MV1A 4NZMA 2Q2TA 3RGZA 4IR9A 2AGPA 4MTEA 2CKZB 5KT3A 5LXTF 3GV7B 2CW8A 1SFOA 3R5FA 4R8UA 2JA5G 2R84A 3CVZA 4QIWA 2W8KA 5FPOA 1B33N 4FBTA 3OHAA 3G6VA 4DL5A 5KG7A 3GIIA 4GLWA 1BJTA 3GB8B 2DIKA 3QQMA 2ZGIA 3NUAA 3TINA 2V4QA 2EIYA 5KFYA 2NVYA 3BACA 1JIHA 2M05A 5BWTA 2W6ZA 4UCSA 2CNVA 3GIPA 1T36A 1BGWA 4ZQIA 2HGSA 2JA5A 3K5HA 2VPQA 2VQDA 3GIMA 1W96A 1KC7A 1EZ1A 1WR2A 2UXCH 1M6VA 2W9CA 4PZ7A 3KXYT 1UNNC 5KFRA 2W9AA 4DL3A 3RB3A 5H80A 3G8DA 3RGXA 4A3CG 3K3PA 2UUAH 5HNEA 3N43B 4EBCA 4O2AF 5LOVF 4IR1A 3GTPA 2WB1E 2FK3A 4QW8A 2VA2A 5L1IA 1FJGH 3V6HA 4O3RA 2CNUA 2WYOA 5DISC 5KG1A 5KFKA 1CKMA 3WO1A 2BQRA 4JYAH 3PO2G 1KJ9A 3T9CA 4YP3A 4IRDA 5JQGF 5IWAH 4X64H 4ECRA 1ZETA 3KREA 4F4XA 1TAEA 3J80W 3TY9A 3W1GA 2HVSA 1VAJA 1ULZA 2DWCA 1DGSA 2Y4RA 5K2MA 4JI5H 4U6PA 1KJ8A 3MR5A 3G8CA 3RB6A 4UFZA 2YW2A 5I5VA 4TQRA 5C3EG 5CB4F 4CHIA 4CKEA 5L1JA 1OWTA 2OH2A 3GLKA 3TIGA 5JVLA 3JAMW 5C5JA 2BQUA 4R7RA 5KFXA 1SCUB 5I5YA 3MR2A 4J9MA 4IWYA 5KFHA 2JA7G 4DR7H 1EKFA 3BAAA 3QFFA 4Y8VB 3OUZA 3MFHA 4RU9A 4QWAA 4NZNA 4FFRA 3Q8PB 4CKCA 2VQFH 3KYHC 3HXLA 4A2BA 5KFOA 4ECYA 4ZOLF 5DLFA 3PW4A 1CKNB 3RBDA 3CSWA 1N56A 2JEFA 4IRCA 2R7KA 2V58A 5CR5A 3PW2A 5DGAA 1HR0H 4CE5A 5DQIA 3DTFA 3PR4A 4B3SH 5BR8H 5CAEB 4ECTA 2UUCH 3TY5A 2VUMG 3UQ8A 2W70A 4EGJA 2RDIA 2R8HA 2JA7A 5J2UF 2VOBA 1S68A 4O7YA 2PN1A 2J6SA 2UVRA 3E5NA 2R7LA 4E6NA 2R92A 2HHFB 4FU0A 3JZIA 2HIXA 2W9BA 5KS8A 2ZDQA 3RTXA 4HNTA 4HN2A 3U0GA 5EWGA 1XMQH 4O84A 2PMZA 2UVWA 3HOVG 5BWWA 4J9NA 1A0GA 4DV4H 5EWEA 1JX4A 3RIZA 4EYHB 4O81A 2E5LH 4HQ6A 3WNZA 3JRWA 3N41B 5DMXA 3M9NB 3QWUA 4ECVA 2ODTX 5BYBA 3GQCA 5FJ8G 4LF8H 5DG7A 4FGRA 4C5BA 4MAMA 5KFSA 5KFGA 4NYEA 3ETHA 2ZJTA 2DLNA 5KFQA 3RF2A 2VUMA 2ZM6H 2DPJA 3H3VH 5CE8A 1E4EB 4UCOA 2WDTA 5T14A 4ED1A 3T5KA 3U55A 3BG5A 5FD6A 2PVPA 2YWVA 1E4GT 4EBDA 4YR0A 1WSCA 2BR0A 2IMWP 2UXDH 2A1HA 2HIVA 3OUUA 5D8DA 4EFBA 2HVRA 2RGVA 5KT2A 4YHHH 4A3LG 2JA8G 5KFBA 4GKJH 4IIJF 3GILA 1M7JA 2HGWA 2R87A 2XGPA 2XGQA 5HBRB 5BMVF 4R8UB 4FM9A 4IRKA 4UCVA 4RCNA 4I50F 1IOWA 5BWXA 5KG3A 4XZ3B 4ECSA 4ECWA 2ASLA 1GYFA 4J9LA 4QIWE 1I2LA 5D1OA 3W1BA 2RDJA 1P16A 3H4DA 3BQ0A 2YS7A 1EYZA 4L1KA 5DGIA 4Q0YA 1O75A 3JSLA 3NBZB 4YBZB 4EG0A 1WRVA 2XCPA 3VPCA 5LMNH 5I5TA 3BA8A 2XIGA 4RZRA 4G3IA 5E25A 2R8JA 4JI3H 3HOWG 5KT5A 2COIA 4JI4H 1XDNA 4BY7G 2WTFA 4LFBH 2X0SA 3RB4A 1IYDA 1UC8A 2FP4B 3HO8A 2W57A 4RB0A 5IYBG 2R86A 2ASJA 2NU7B 2W9CB 1FVIA 4JV1A 1VBGA 2DAAA 3GIJA 3G6XA 3PO3G 4LSXA 3BABA 1S9FA 3SNOA 2O03A 2FMAA 1AN7A 1KJQA 4DL4A 4ECUA 4GC7A 4YJ3F 5IP7G 3MR3A 2XD4A 2JEIA 1J5EH 2YZMA 3R5HA 4ZI7F 3T54A 1JXLA 2DZDA 2W6NA 5C4XG 3WO0A 2FE3A 3GDEA 2HJWA 3PN1A 3VPBA 4CMFA 5BWUA 3HKZE 4O3PA 5KFAA 3Q8SB 4DR3H 4ED8A 2GPSA 3KAKA 5DAAA 4IAJA 1A3GA
chains in the Genus database with same CATH topology
5GONF 2W6QA 2Z02A 1IOVA 1GGOA 2R82A 4MV4A 4FFMA 4MV6A 4MV7A 3DF7A 1JDEA 3GIDA 3VPDA 4O4LF 5JH7F 1DV2A 3ORQA 4ZHQF 3TIIA 3MJFA 1DV1A 5FNVF 2C00A 3JZFA 4M9UA 5C1PA 3R9RA 5KKNB 5J2TF 2V59A 4XYLB 1GSHA 3U9SA 1PX2A 3TQTA 2YL2A 1KJJA 2ZDGA 2GQSA 3HBLA 3R23A 1BNCA 3U54A 2QK4A 5EZYF 4WD3A 4O7LA 5LYJF 5C1OA 2NU8B 4I4TF 4E4TA 2V5AA 1JKJB 3Q2OA 2NUAB 1Z2NX 3N8DA 3KAJA 4FFNA 2XCLA 3U9TA 4I55F 4O86A 1Z2OX 5I47A 2CQYA 3RFCA 1OBDA 3UFXB 2ZDHA 2YRWA 3LWBA 3RV4A 5CA0F 1KJIA 2I8CA 4O7WA 4IWXA 3RUPA 2YZNA 2GPWA 4FFOA 4C5CA 4MV9A 1EHIA 3JRXA 4TV8F 3MWEA 1EUDB 4EGQA 1KEEA 1CQJB 4O7ZA 4O83A 4IHJF 5HV6A 2R6FA 4YJ2F 4YB8B 1JDBB 2IP4A 1AUVA 3N6RA 2CZGA 3K5IA 4DLKA 1CQIB 3V4ZA 3VMMA 2YRXA 2W6OA 4TV9F 3RV3A 3Q1KA 2FPPB 1CS0A 1C3OA 2NU9B 3I12A 5JVDF 1A48A 1B6RA 5BPFA 2Z04A 1CE8A 4DIMA 5IYZF 2P0AA 2R85A 2GQRA 3AW8A 1GSAA 4O7RA 1B6SA 2NU6B 2I87A 4O4JF 1W93A 4O7SA 3V4SA 3ORRA 5LP6F 2CNQA 2I80A 1PK8A 2PBZA 2W71A 3TW6A 1BXRA 4XYMB 3ETJA 3VOTA 1KBLA 4O7NA 4HNVA 4ME6A 1I7LA 1JLLB 4MA5A 1VKZA 2OLSA 4O2BF 2YS6A 4YAKB 4MV8A 3AX6A 2R7NA 1VBHA 4RZQA 1I7NA 2FB9A 3KALA 4IZOA 4FFPA 4WBNF 4QSHA 1GSOA 4MA0A 1GLVA 4O7VA 4O82A 1Z2PX 4MV3A 4C5AA 1EUCB 2J9GA 2YYAA 4O4IF 4HR7A 5LA6F 2W6MA 4FE2A 2SCUB 2YZGA 3VA7A 2VR1A 2R7MA 4FFLA 5JQWA 2FPGB 2YZLA 2W6PA 2QF7A 3LP8A 3MWDA 4TUYF 2GLTA 5BPHA 5CA1F 1UC9A 1M0TA 1AUXA 3HB9A 1OBGA 4O7TA 2FPIB 3R5XA 1DIKA 3SE7A 4HNUA 4YAJB 1E4EA 1C30A 5C8YF 1A9XA 5KX5F 1KUTA 4O4HF 4XX0B 1M0WA 4MV1A 5LXTF 3R5FA 2R84A 2DIKA 3TINA 3NUAA 2W6ZA 2CNVA 1T36A 4ZQIA 2HGSA 3K5HA 2VPQA 2VQDA 1W96A 1KC7A 1EZ1A 1WR2A 1M6VA 5H80A 3G8DA 3K3PA 4O2AF 5LOVF 2CNUA 2WYOA 3WO1A 1KJ9A 5JQGF 3KREA 1ULZA 2DWCA 5K2MA 1KJ8A 3G8CA 2YW2A 5CB4F 3GLKA 3TIGA 5JVLA 1SCUB 4IWYA 3QFFA 4Y8VB 3OUZA 4FFRA 4ZOLF 2R7KA 2V58A 5CAEB 2W70A 4EGJA 5J2UF 4O7YA 2PN1A 3E5NA 2R7LA 4FU0A 3JZIA 2ZDQA 4HNTA 4O84A 4O81A 4HQ6A 3WNZA 3JRWA 5DMXA 4FGRA 4C5BA 4MAMA 4NYEA 3ETHA 2DLNA 1E4EB 3U55A 3BG5A 2PVPA 2YWVA 3OUUA 5D8DA 4IIJF 2R87A 5HBRB 5BMVF 4I50F 1IOWA 4XZ3B 2YS7A 1EYZA 4L1KA 4YBZB 4EG0A 3VPCA 2X0SA 3HO8A 1UC8A 2FP4B 2R86A 2NU7B 1VBGA 1KJQA 4YJ3F 2XD4A 2YZMA 3R5HA 4ZI7F 2DZDA 2W6NA 3WO0A 2HJWA 3VPBA 2GPSA 3KAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GON F;  2W6Q A;  2Z02 A;  1IOV A;  1GGO A;  2R82 A;  4MV4 A;  4FFM A;  4MV6 A;  4MV7 A;  3DF7 A;  1JDE A;  3GID A;  3VPD A;  4O4L F;  5JH7 F;  1DV2 A;  3ORQ A;  4ZHQ F;  3TII A;  3MJF A;  1DV1 A;  5FNV F;  2C00 A;  3JZF A;  4M9U A;  5C1P A;  3R9R A;  5KKN B;  5J2T F;  2V59 A;  4XYL B;  1GSH A;  3U9S A;  1PX2 A;  3TQT A;  2YL2 A;  1KJJ A;  2ZDG A;  2GQS A;  3HBL A;  3R23 A;  1BNC A;  3U54 A;  2QK4 A;  5EZY F;  4WD3 A;  4O7L A;  5LYJ F;  5C1O A;  2NU8 B;  4I4T F;  4E4T A;  2V5A A;  1JKJ B;  3Q2O A;  2NUA B;  1Z2N X;  3N8D A;  3KAJ A;  4FFN A;  2XCL A;  3U9T A;  4I55 F;  4O86 A;  1Z2O X;  5I47 A;  2CQY A;  3RFC A;  1OBD A;  3UFX B;  2ZDH A;  2YRW A;  3LWB A;  3RV4 A;  5CA0 F;  1KJI A;  2I8C A;  4O7W A;  4IWX A;  3RUP A;  2YZN A;  2GPW A;  4FFO A;  4C5C A;  4MV9 A;  1EHI A;  3JRX A;  4TV8 F;  3MWE A;  1EUD B;  4EGQ A;  1KEE A;  1CQJ B;  4O7Z A;  4O83 A;  4IHJ F;  5HV6 A;  2R6F A;  4YJ2 F;  4YB8 B;  1JDB B;  2IP4 A;  1AUV A;  3N6R A;  2CZG A;  3K5I A;  4DLK A;  1CQI B;  3V4Z A;  3VMM A;  2YRX A;  2W6O A;  4TV9 F;  3RV3 A;  3Q1K A;  2FPP B;  1CS0 A;  1C3O A;  2NU9 B;  3I12 A;  5JVD F;  1A48 A;  1B6R A;  5BPF A;  2Z04 A;  1CE8 A;  4DIM A;  5IYZ F;  2P0A A;  2R85 A;  2GQR A;  3AW8 A;  1GSA A;  4O7R A;  1B6S A;  2NU6 B;  2I87 A;  4O4J F;  1W93 A;  4O7S A;  3V4S A;  3ORR A;  5LP6 F;  2CNQ A;  2I80 A;  1PK8 A;  2PBZ A;  2W71 A;  3TW6 A;  1BXR A;  4XYM B;  3ETJ A;  3VOT A;  1KBL A;  4O7N A;  4HNV A;  4ME6 A;  1I7L A;  1JLL B;  4MA5 A;  1VKZ A;  2OLS A;  4O2B F;  2YS6 A;  4YAK B;  4MV8 A;  3AX6 A;  2R7N A;  1VBH A;  4RZQ A;  1I7N A;  2FB9 A;  3KAL A;  4IZO A;  4FFP A;  4WBN F;  4QSH A;  1GSO A;  4MA0 A;  1GLV A;  4O7V A;  4O82 A;  1Z2P X;  4MV3 A;  4C5A A;  1EUC B;  2J9G A;  2YYA A;  4O4I F;  4HR7 A;  5LA6 F;  2W6M A;  4FE2 A;  2SCU B;  2YZG A;  3VA7 A;  2VR1 A;  2R7M A;  4FFL A;  5JQW A;  2FPG B;  2YZL A;  2W6P A;  2QF7 A;  3LP8 A;  3MWD A;  4TUY F;  2GLT A;  5BPH A;  5CA1 F;  1UC9 A;  1M0T A;  1AUX A;  3HB9 A;  1OBG A;  4O7T A;  2FPI B;  3R5X A;  1DIK A;  3SE7 A;  4HNU A;  4YAJ B;  1E4E A;  1C30 A;  5C8Y F;  1A9X A;  5KX5 F;  1KUT A;  4O4H F;  4XX0 B;  1M0W A;  4MV1 A;  5LXT F;  3R5F A;  2R84 A;  2DIK A;  3TIN A;  3NUA A;  2W6Z A;  2CNV A;  1T36 A;  4ZQI A;  2HGS A;  3K5H A;  2VPQ A;  2VQD A;  1W96 A;  1KC7 A;  1EZ1 A;  1WR2 A;  1M6V A;  5H80 A;  3G8D A;  3K3P A;  4O2A F;  5LOV F;  2CNU A;  2WYO A;  3WO1 A;  1KJ9 A;  5JQG F;  3KRE A;  1ULZ A;  2DWC A;  5K2M A;  1KJ8 A;  3G8C A;  2YW2 A;  5CB4 F;  3GLK A;  3TIG A;  5JVL A;  1SCU B;  4IWY A;  3QFF A;  4Y8V B;  3OUZ A;  4FFR A;  4ZOL F;  2R7K A;  2V58 A;  5CAE B;  2W70 A;  4EGJ A;  5J2U F;  4O7Y A;  2PN1 A;  3E5N A;  2R7L A;  4FU0 A;  3JZI A;  2ZDQ A;  4HNT A;  4O84 A;  4O81 A;  4HQ6 A;  3WNZ A;  3JRW A;  5DMX A;  4FGR A;  4C5B A;  4MAM A;  4NYE A;  3ETH A;  2DLN A;  1E4E B;  3U55 A;  3BG5 A;  2PVP A;  2YWV A;  3OUU A;  5D8D A;  4IIJ F;  2R87 A;  5HBR B;  5BMV F;  4I50 F;  1IOW A;  4XZ3 B;  2YS7 A;  1EYZ A;  4L1K A;  4YBZ B;  4EG0 A;  3VPC A;  2X0S A;  3HO8 A;  1UC8 A;  2FP4 B;  2R86 A;  2NU7 B;  1VBG A;  1KJQ A;  4YJ3 F;  2XD4 A;  2YZM A;  3R5H A;  4ZI7 F;  2DZD A;  2W6N A;  3WO0 A;  2HJW A;  3VPB A;  2GPS A;  3KAK A; 
#chains in the Genus database with same CATH topology
 5GON F;  4DV7 H;  2W6Q A;  3L4J A;  2Z02 A;  4RNN A;  1IOV A;  4U7C A;  1GGO A;  4LF5 H;  4JI2 H;  3MFI A;  4DV5 H;  5KT7 A;  4YQW A;  4LH7 A;  2R82 A;  3LML A;  5FD5 A;  3H40 A;  3DTG A;  2FK2 A;  4MV4 A;  4GKK H;  4FFM A;  4I7H A;  4MV6 A;  5KFI A;  3EPI A;  1G2W A;  2AGQ A;  2C28 A;  5DQH A;  4X62 H;  5JUM A;  2X5R A;  1ZAU A;  2ABJ A;  4LH6 A;  4MV7 A;  3BQ1 A;  3DF7 A;  1JDE A;  1RK6 A;  2JEJ A;  3GID A;  3VPD A;  2V9W A;  4LF6 H;  4O4L F;  3MWM A;  3EYY A;  4LF9 H;  1XNQ H;  4WHX A;  5JH7 F;  1R9T A;  1DV2 A;  2W7O A;  3ORQ A;  3QZ8 A;  4ZHQ F;  3TII A;  1TWF A;  3HKZ A;  5EWF A;  3MJF A;  1KT8 A;  1DV1 A;  1I2K A;  4DV0 H;  4GLX A;  4ED0 A;  3RAQ A;  5L1L A;  5FNV F;  5F9N A;  3UYY A;  3TW7 A;  4QJF A;  5EOY A;  3T5J A;  1N33 H;  2C00 A;  5KFD A;  4LMY A;  5DG8 A;  1Y14 B;  1Y1V G;  4PZ6 A;  2AGO A;  2AQ4 A;  3JZF A;  1TWC A;  1IBL H;  2W9B B;  2C2E A;  2AU0 A;  4RNO A;  4A3G G;  3QZ7 A;  3J7A K;  2PMZ E;  4M9U A;  2FK1 A;  2C2R A;  1XMO H;  3AYH B;  5C1P A;  4B3R H;  2E2I A;  5KG5 A;  5BWR A;  3R9R A;  5KKN B;  2R8I A;  5J2T F;  4JV2 A;  3RB0 A;  4J9O A;  2VA3 A;  5K3W A;  4Q44 A;  2FKL A;  2JEG A;  2V59 A;  5F9L A;  4X66 H;  4XYL B;  3PZP A;  2YCH A;  4Q43 A;  1GSH A;  3U9S A;  4J0M A;  1PX2 A;  4TM5 A;  1N36 H;  4JV5 H;  3S24 A;  1I94 H;  4M0J A;  1RJR A;  3TQT A;  1S10 A;  2RF4 A;  2YL2 A;  1KJJ A;  2ZDG A;  2HG8 A;  4PBC A;  2EJ2 A;  2GQS A;  2Q7D A;  3HBL A;  3R23 A;  5KFP A;  4DR2 H;  4K6N A;  5BWV A;  4HYK A;  2UU9 H;  1BNC A;  2ATL A;  3U54 A;  4BBR G;  3CEB A;  4TVI A;  2QK4 A;  3WWI A;  2C35 B;  3T9E A;  3RJ0 A;  5C44 G;  4GC6 A;  5D1O B;  5EZY F;  3VNN A;  3RAX A;  1FKA H;  3W5O A;  4CC5 A;  4DR5 H;  1IBM H;  1IBK H;  4Q45 A;  4WD3 A;  3PVX A;  1EKP A;  4O7L A;  5LYJ F;  3H0G G;  5C1O A;  2NU8 B;  4I4T F;  1I1K A;  2V5A A;  4CKB A;  4E4T A;  1JKJ B;  3Q2O A;  1ZQ7 A;  4DL6 A;  2NUA B;  4Q4D A;  4UCU A;  1K1S A;  3UZO A;  3I4M G;  4Q8F A;  1Z2N X;  3N8D A;  2V4R A;  4LF7 H;  3KAJ A;  4F4Z A;  3TQ1 A;  4PDB A;  1A0I A;  4FFN A;  4ECX A;  4RB1 A;  3FMA A;  4YY3 H;  2XCL A;  3KHR A;  1TWG A;  3GTG A;  4A3B G;  1Y1W G;  3U9T A;  2KSW A;  2EJ3 A;  1EKV A;  4I55 F;  4O86 A;  4RB2 C;  5KFC A;  3H0G A;  1CKN A;  1Z2O X;  5I47 A;  1K1Q A;  2VUG A;  2CQY A;  3KHL A;  2E2H A;  3RFC A;  1V9P A;  3T9B A;  3L2P A;  1OBD A;  4J9K A;  3UFX B;  2ZDH A;  1VS0 A;  2YRW A;  3LWB A;  4ED7 A;  3T9D A;  1ET0 A;  5BYA A;  3RV4 A;  5KFM A;  3NC0 B;  2RGR A;  5CA0 F;  3V6K A;  1Y1W A;  3GTO A;  4ED3 A;  3FDS A;  3GIQ A;  5DQG A;  5I60 A;  4YR2 A;  4B3M H;  1KJI A;  2I8C A;  4O7W A;  4QWB A;  3KTM A;  5KFE A;  4IWX A;  3T7A A;  5KG6 A;  2JA6 G;  3RUP A;  4O3N A;  2YZN A;  1RK5 A;  5KFV A;  2COJ A;  2GPW A;  2J6U A;  4FFO A;  2HDK A;  4A3D G;  4C5C A;  4A3J G;  3T1H H;  3K3V A;  5IT9 W;  3GIK A;  4MV9 A;  5KFZ A;  1EHI A;  3JRX A;  1ZHS A;  2FLL A;  1I6U A;  4TV8 F;  3KHG A;  4BBS G;  4NLG A;  1E4F T;  1L2Z A;  5KFL A;  3MWE A;  1EUD B;  4EGQ A;  1KEE A;  4ECZ A;  1S0O A;  1XNR H;  2UXB H;  1CQJ B;  1B04 A;  4QWE A;  4A3K G;  4O7Z A;  4O83 A;  2WE6 A;  4BY1 G;  4O3O A;  4JI0 H;  5DGH A;  4RAY A;  4IHJ F;  2JA6 A;  4DQN A;  5HV6 A;  4J9P A;  2R6F A;  4YJ2 F;  4J9S A;  4YB8 B;  3LUL A;  1T94 A;  1JDB B;  2IP4 A;  3J81 W;  1ZHQ A;  4UCR A;  4AYB A;  5IP9 G;  1AUV A;  3N6R A;  2CZG A;  3K5I A;  4DLK A;  1CQI B;  1I1L A;  3V4Z A;  3VMM A;  3H4B A;  3BQ2 A;  4EBE A;  2YRX A;  3NBY B;  5FLX W;  2HVQ A;  5DGB A;  2W6O A;  3PW0 A;  1HNX H;  3T9A A;  4A93 G;  4TV9 F;  2B63 G;  3RV3 A;  3TEK A;  3Q1K A;  4Q8E A;  2WAQ A;  4F50 A;  2FPP B;  5A2Q W;  1CS0 A;  5DLG A;  3NGD A;  4FBU A;  4BXX G;  4BWS C;  1GO3 E;  4M7E A;  3PR5 B;  3PW5 A;  4JI1 H;  4APM A;  3Q8R B;  3G6Y A;  4EFE A;  1C3O A;  2NU9 B;  4RUA A;  1RJQ A;  4NXN H;  1TA8 A;  3I12 A;  1S0M A;  3WWJ A;  1IYE A;  4KHP H;  3CQZ A;  4A3I G;  5JVD F;  4A3F G;  2IBK A;  4JI7 H;  2B63 A;  1A48 A;  3L4K A;  1B6R A;  1P8L A;  4DV1 H;  5BPF A;  3UZB A;  2R93 G;  2NVX A;  4RUC A;  2Z04 A;  1CE8 A;  4DIM A;  5KFW A;  2J6T A;  3V6J A;  3N44 B;  5IYZ F;  2P0A A;  2R85 A;  2GQR A;  3AW8 A;  4CMD A;  1GSA A;  4O7R A;  1MZB A;  3T1Y H;  1I50 A;  1B6S A;  3OSN A;  3GTM A;  2NU6 B;  2I87 A;  4O4J F;  3OSP A;  3FKI G;  1W93 A;  4MTD A;  4O7S A;  3V4S A;  2R8K A;  1S0N A;  3ORR A;  5LP6 F;  1SEI A;  5KFJ A;  2CNQ A;  3HT5 A;  4EQ5 A;  3N40 P;  2I80 A;  5IYC G;  2R93 A;  4Q4C A;  4A3M G;  4K0K H;  1Y1V A;  1PK8 A;  2VPS A;  5D1P A;  3F8N A;  1I3Q A;  2PBZ A;  4DAA A;  1I1M A;  4TQS A;  2HGX A;  2ASD A;  3HOY G;  1DAA A;  2W71 A;  3GJX B;  3JZ6 A;  3T5H A;  3TW6 A;  3DAA A;  1BXR A;  3N42 B;  4XYM B;  3FKI A;  3ETJ A;  5L9X A;  4J9Q A;  2R8G A;  3VOT A;  1KBL A;  4O7N A;  1WH2 A;  3GTK A;  1V4Y A;  5LMU H;  4HNV A;  2C2D A;  3OTO H;  3HOZ G;  1XK5 A;  3T99 A;  4QWC A;  4ME6 A;  3IG0 A;  5LL6 b;  2FJZ A;  3JSN A;  4F4Y A;  2Q2U A;  1I7L A;  4B3T H;  4LFC H;  2WB1 A;  1JLL B;  2QYZ A;  4PZ8 A;  4NZO A;  2DAB A;  4MA5 A;  4EYI B;  3H20 A;  1S03 G;  2UVV A;  2R92 G;  5EDW A;  1X9N A;  1VKZ A;  2CFM A;  4UCT A;  2OWO A;  2OLS A;  3MR6 A;  4O2B F;  3PW7 A;  1HNZ H;  5I5U A;  4C2M A;  5KFU A;  5I5S A;  5I5X A;  3OHB A;  4RB3 C;  4RAZ A;  5DG9 A;  2YS6 A;  4DUZ H;  4JI6 H;  4YAK B;  4J9R A;  3M4I A;  4FS2 A;  4MV8 A;  3AX6 A;  2XCA A;  2HHH H;  2R7N A;  4RNM A;  4QW9 A;  2XC9 A;  1VBH A;  4A2A A;  2DPI A;  2W8L A;  1RYS A;  3GTJ A;  4JV0 A;  4RZQ A;  4CC6 A;  4FS1 A;  2BQ3 A;  1I7N A;  4DR4 H;  1V51 A;  1TWA A;  2FB9 A;  3M9M B;  2Y0S E;  5IYD G;  1RJP A;  4OX9 H;  2MCT A;  3HOU G;  4LFA H;  4DR6 H;  5KFN A;  4NXM H;  3KAL A;  5I5W A;  4IZO A;  3PFF A;  4FFP A;  2YU9 A;  1N48 A;  2FLP A;  4WBN F;  2R7Z G;  5CM0 A;  3C0F B;  3SGI A;  4QSH A;  3HOX G;  1GSO A;  5KG4 A;  4MA0 A;  4JXU A;  4QWD A;  2ALZ A;  3EPG A;  4LF4 H;  3GTQ A;  1GLV A;  4DL2 A;  3GTL A;  4O7V A;  4O82 A;  4DUY H;  1KTA A;  1Z2P X;  5FR9 A;  4JUZ A;  1S97 A;  4JI8 H;  1K83 A;  4MV3 A;  3TY8 A;  1TWH A;  2F4V H;  4C5A A;  1EUC B;  2J9G A;  3RR5 A;  4PWQ A;  3M9O B;  3T5L A;  4LSA A;  4A3E G;  3GV5 B;  3Q8Q B;  4ED2 A;  1RYR A;  2R7Z A;  2YYA A;  4O4I F;  3BA9 A;  4HR7 A;  1T3N A;  5LA6 F;  4AYB E;  3GV8 B;  3I4N G;  2W6M A;  2Y0S A;  4FE2 A;  2HHF A;  2SCU B;  3IN5 A;  2CW7 A;  2YZG A;  3KHH A;  3VA7 A;  5KG0 A;  2VR1 A;  2R7M A;  4FFL A;  2VQE H;  5L1K A;  3RBE A;  2EJ0 A;  3LQS A;  5KT4 A;  5JQW A;  2FPG B;  4X65 H;  2UVU A;  2FLN A;  2YZL A;  2W6P A;  2QF7 A;  5KG2 A;  3LP8 A;  3MWD A;  4TUY F;  4DV6 H;  2GLT A;  5BPH A;  2W7P A;  1UC9 A;  5CA1 F;  1M0T A;  2WAQ E;  4EEY A;  5KFT A;  1AUX A;  1N32 H;  3HB9 A;  1CKO A;  4DRF A;  1WCM G;  4UUG A;  3N6X A;  4DV2 H;  5FPR A;  5FLM G;  1OBG A;  4O7T A;  4ED6 A;  4O3S A;  5KT6 A;  4DV3 H;  1N34 H;  1SYX B;  2FPI B;  3R5X A;  3WWH A;  4ETS A;  4DR1 H;  1DIK A;  4O3Q A;  4F4W A;  3T9F A;  4DL7 A;  2UUB H;  2COG A;  2C22 A;  3SE7 A;  4HNU A;  4YAJ B;  1E4E A;  1C30 A;  5C8Y F;  4YR3 A;  1A9X A;  4ECQ A;  5KX5 F;  2IA6 A;  3SI8 A;  2QB5 A;  1HNW H;  1KUT A;  4EEQ A;  5KFF A;  3BJY A;  4AQY H;  4O4H F;  1WCM A;  4XX0 B;  1M0W A;  4MV1 A;  4NZM A;  2Q2T A;  3RGZ A;  4IR9 A;  2AGP A;  4MTE A;  2CKZ B;  5KT3 A;  5LXT F;  3GV7 B;  2CW8 A;  1SFO A;  3R5F A;  4R8U A;  2JA5 G;  2R84 A;  3CVZ A;  4QIW A;  2W8K A;  5FPO A;  1B33 N;  4FBT A;  3OHA A;  3G6V A;  4DL5 A;  5KG7 A;  3GII A;  4GLW A;  1BJT A;  3GB8 B;  2DIK A;  3QQM A;  2ZGI A;  3NUA A;  3TIN A;  2V4Q A;  2EIY A;  5KFY A;  2NVY A;  3BAC A;  1JIH A;  2M05 A;  5BWT A;  2W6Z A;  4UCS A;  2CNV A;  3GIP A;  1T36 A;  1BGW A;  4ZQI A;  2HGS A;  2JA5 A;  3K5H A;  2VPQ A;  2VQD A;  3GIM A;  1W96 A;  1KC7 A;  1EZ1 A;  1WR2 A;  2UXC H;  1M6V A;  2W9C A;  4PZ7 A;  3KXY T;  1UNN C;  5KFR A;  2W9A A;  4DL3 A;  3RB3 A;  5H80 A;  3G8D A;  3RGX A;  4A3C G;  3K3P A;  2UUA H;  5HNE A;  3N43 B;  4EBC A;  4O2A F;  5LOV F;  4IR1 A;  3GTP A;  2WB1 E;  2FK3 A;  4QW8 A;  2VA2 A;  5L1I A;  1FJG H;  3V6H A;  4O3R A;  2CNU A;  2WYO A;  5DIS C;  5KG1 A;  5KFK A;  1CKM A;  3WO1 A;  2BQR A;  4JYA H;  3PO2 G;  1KJ9 A;  3T9C A;  4YP3 A;  4IRD A;  5JQG F;  5IWA H;  4X64 H;  4ECR A;  1ZET A;  3KRE A;  4F4X A;  1TAE A;  3J80 W;  3TY9 A;  3W1G A;  2HVS A;  1VAJ A;  1ULZ A;  2DWC A;  1DGS A;  2Y4R A;  5K2M A;  4JI5 H;  4U6P A;  1KJ8 A;  3MR5 A;  3G8C A;  3RB6 A;  4UFZ A;  2YW2 A;  5I5V A;  4TQR A;  5C3E G;  5CB4 F;  4CHI A;  4CKE A;  5L1J A;  1OWT A;  2OH2 A;  3GLK A;  3TIG A;  5JVL A;  3JAM W;  5C5J A;  2BQU A;  4R7R A;  5KFX A;  1SCU B;  5I5Y A;  3MR2 A;  4J9M A;  4IWY A;  5KFH A;  2JA7 G;  4DR7 H;  1EKF A;  3BAA A;  3QFF A;  4Y8V B;  3OUZ A;  3MFH A;  4RU9 A;  4QWA A;  4NZN A;  4FFR A;  3Q8P B;  4CKC A;  2VQF H;  3KYH C;  3HXL A;  4A2B A;  5KFO A;  4ECY A;  4ZOL F;  5DLF A;  3PW4 A;  1CKN B;  3RBD A;  3CSW A;  1N56 A;  2JEF A;  4IRC A;  2R7K A;  2V58 A;  5CR5 A;  3PW2 A;  5DGA A;  1HR0 H;  4CE5 A;  5DQI A;  3DTF A;  3PR4 A;  4B3S H;  5BR8 H;  5CAE B;  4ECT A;  2UUC H;  3TY5 A;  2VUM G;  3UQ8 A;  2W70 A;  4EGJ A;  2RDI A;  2R8H A;  2JA7 A;  5J2U F;  2VOB A;  1S68 A;  4O7Y A;  2PN1 A;  2J6S A;  2UVR A;  3E5N A;  2R7L A;  4E6N A;  2R92 A;  2HHF B;  4FU0 A;  3JZI A;  2HIX A;  2W9B A;  5KS8 A;  2ZDQ A;  3RTX A;  4HNT A;  4HN2 A;  3U0G A;  5EWG A;  1XMQ H;  4O84 A;  2PMZ A;  2UVW A;  3HOV G;  5BWW A;  4J9N A;  1A0G A;  4DV4 H;  5EWE A;  1JX4 A;  3RIZ A;  4EYH B;  4O81 A;  2E5L H;  4HQ6 A;  3WNZ A;  3JRW A;  3N41 B;  5DMX A;  3M9N B;  3QWU A;  4ECV A;  2ODT X;  5BYB A;  3GQC A;  5FJ8 G;  4LF8 H;  5DG7 A;  4FGR A;  4C5B A;  4MAM A;  5KFS A;  5KFG A;  4NYE A;  3ETH A;  2ZJT A;  2DLN A;  5KFQ A;  3RF2 A;  2VUM A;  2ZM6 H;  2DPJ A;  3H3V H;  5CE8 A;  1E4E B;  4UCO A;  2WDT A;  5T14 A;  4ED1 A;  3T5K A;  3U55 A;  3BG5 A;  5FD6 A;  2PVP A;  2YWV A;  1E4G T;  4EBD A;  4YR0 A;  1WSC A;  2BR0 A;  2IMW P;  2UXD H;  2A1H A;  2HIV A;  3OUU A;  5D8D A;  4EFB A;  2HVR A;  2RGV A;  5KT2 A;  4YHH H;  4A3L G;  2JA8 G;  5KFB A;  4GKJ H;  4IIJ F;  3GIL A;  1M7J A;  2HGW A;  2R87 A;  2XGP A;  2XGQ A;  5HBR B;  5BMV F;  4R8U B;  4FM9 A;  4IRK A;  4UCV A;  4RCN A;  4I50 F;  1IOW A;  5BWX A;  5KG3 A;  4XZ3 B;  4ECS A;  4ECW A;  2ASL A;  1GYF A;  4J9L A;  4QIW E;  1I2L A;  5D1O A;  3W1B A;  2RDJ A;  1P16 A;  3H4D A;  3BQ0 A;  2YS7 A;  1EYZ A;  4L1K A;  5DGI A;  4Q0Y A;  1O75 A;  3JSL A;  3NBZ B;  4YBZ B;  4EG0 A;  1WRV A;  2XCP A;  3VPC A;  5LMN H;  5I5T A;  3BA8 A;  2XIG A;  4RZR A;  4G3I A;  5E25 A;  2R8J A;  4JI3 H;  3HOW G;  5KT5 A;  2COI A;  4JI4 H;  1XDN A;  4BY7 G;  2WTF A;  4LFB H;  2X0S A;  3RB4 A;  1IYD A;  1UC8 A;  2FP4 B;  3HO8 A;  2W57 A;  4RB0 A;  5IYB G;  2R86 A;  2ASJ A;  2NU7 B;  2W9C B;  1FVI A;  4JV1 A;  1VBG A;  2DAA A;  3GIJ A;  3G6X A;  3PO3 G;  4LSX A;  3BAB A;  1S9F A;  3SNO A;  2O03 A;  2FMA A;  1AN7 A;  1KJQ A;  4DL4 A;  4ECU A;  4GC7 A;  4YJ3 F;  5IP7 G;  3MR3 A;  2XD4 A;  2JEI A;  1J5E H;  2YZM A;  3R5H A;  4ZI7 F;  3T54 A;  1JXL A;  2DZD A;  2W6N A;  5C4X G;  3WO0 A;  2FE3 A;  3GDE A;  2HJW A;  3PN1 A;  3VPB A;  4CMF A;  5BWU A;  3HKZ E;  4O3P A;  5KFA A;  3Q8S B;  4DR3 H;  4ED8 A;  2GPS A;  3KAK A;  5DAA A;  4IAJ A;  1A3G A; 
#chains in the Genus database with same CATH homology
 5GON F;  2W6Q A;  2Z02 A;  1IOV A;  1GGO A;  2R82 A;  4MV4 A;  4FFM A;  4MV6 A;  4MV7 A;  3DF7 A;  1JDE A;  3GID A;  3VPD A;  4O4L F;  5JH7 F;  1DV2 A;  3ORQ A;  4ZHQ F;  3TII A;  3MJF A;  1DV1 A;  5FNV F;  2C00 A;  3JZF A;  4M9U A;  5C1P A;  3R9R A;  5KKN B;  5J2T F;  2V59 A;  4XYL B;  1GSH A;  3U9S A;  1PX2 A;  3TQT A;  2YL2 A;  1KJJ A;  2ZDG A;  2GQS A;  3HBL A;  3R23 A;  1BNC A;  3U54 A;  2QK4 A;  5EZY F;  4WD3 A;  4O7L A;  5LYJ F;  5C1O A;  2NU8 B;  4I4T F;  4E4T A;  2V5A A;  1JKJ B;  3Q2O A;  2NUA B;  1Z2N X;  3N8D A;  3KAJ A;  4FFN A;  2XCL A;  3U9T A;  4I55 F;  4O86 A;  1Z2O X;  5I47 A;  2CQY A;  3RFC A;  1OBD A;  3UFX B;  2ZDH A;  2YRW A;  3LWB A;  3RV4 A;  5CA0 F;  1KJI A;  2I8C A;  4O7W A;  4IWX A;  3RUP A;  2YZN A;  2GPW A;  4FFO A;  4C5C A;  4MV9 A;  1EHI A;  3JRX A;  4TV8 F;  3MWE A;  1EUD B;  4EGQ A;  1KEE A;  1CQJ B;  4O7Z A;  4O83 A;  4IHJ F;  5HV6 A;  2R6F A;  4YJ2 F;  4YB8 B;  1JDB B;  2IP4 A;  1AUV A;  3N6R A;  2CZG A;  3K5I A;  4DLK A;  1CQI B;  3V4Z A;  3VMM A;  2YRX A;  2W6O A;  4TV9 F;  3RV3 A;  3Q1K A;  2FPP B;  1CS0 A;  1C3O A;  2NU9 B;  3I12 A;  5JVD F;  1A48 A;  1B6R A;  5BPF A;  2Z04 A;  1CE8 A;  4DIM A;  5IYZ F;  2P0A A;  2R85 A;  2GQR A;  3AW8 A;  1GSA A;  4O7R A;  1B6S A;  2NU6 B;  2I87 A;  4O4J F;  1W93 A;  4O7S A;  3V4S A;  3ORR A;  5LP6 F;  2CNQ A;  2I80 A;  1PK8 A;  2PBZ A;  2W71 A;  3TW6 A;  1BXR A;  4XYM B;  3ETJ A;  3VOT A;  1KBL A;  4O7N A;  4HNV A;  4ME6 A;  1I7L A;  1JLL B;  4MA5 A;  1VKZ A;  2OLS A;  4O2B F;  2YS6 A;  4YAK B;  4MV8 A;  3AX6 A;  2R7N A;  1VBH A;  4RZQ A;  1I7N A;  2FB9 A;  3KAL A;  4IZO A;  4FFP A;  4WBN F;  4QSH A;  1GSO A;  4MA0 A;  1GLV A;  4O7V A;  4O82 A;  1Z2P X;  4MV3 A;  4C5A A;  1EUC B;  2J9G A;  2YYA A;  4O4I F;  4HR7 A;  5LA6 F;  2W6M A;  4FE2 A;  2SCU B;  2YZG A;  3VA7 A;  2VR1 A;  2R7M A;  4FFL A;  5JQW A;  2FPG B;  2YZL A;  2W6P A;  2QF7 A;  3LP8 A;  3MWD A;  4TUY F;  2GLT A;  5BPH A;  5CA1 F;  1UC9 A;  1M0T A;  1AUX A;  3HB9 A;  1OBG A;  4O7T A;  2FPI B;  3R5X A;  1DIK A;  3SE7 A;  4HNU A;  4YAJ B;  1E4E A;  1C30 A;  5C8Y F;  1A9X A;  5KX5 F;  1KUT A;  4O4H F;  4XX0 B;  1M0W A;  4MV1 A;  5LXT F;  3R5F A;  2R84 A;  2DIK A;  3TIN A;  3NUA A;  2W6Z A;  2CNV A;  1T36 A;  4ZQI A;  2HGS A;  3K5H A;  2VPQ A;  2VQD A;  1W96 A;  1KC7 A;  1EZ1 A;  1WR2 A;  1M6V A;  5H80 A;  3G8D A;  3K3P A;  4O2A F;  5LOV F;  2CNU A;  2WYO A;  3WO1 A;  1KJ9 A;  5JQG F;  3KRE A;  1ULZ A;  2DWC A;  5K2M A;  1KJ8 A;  3G8C A;  2YW2 A;  5CB4 F;  3GLK A;  3TIG A;  5JVL A;  1SCU B;  4IWY A;  3QFF A;  4Y8V B;  3OUZ A;  4FFR A;  4ZOL F;  2R7K A;  2V58 A;  5CAE B;  2W70 A;  4EGJ A;  5J2U F;  4O7Y A;  2PN1 A;  3E5N A;  2R7L A;  4FU0 A;  3JZI A;  2ZDQ A;  4HNT A;  4O84 A;  4O81 A;  4HQ6 A;  3WNZ A;  3JRW A;  5DMX A;  4FGR A;  4C5B A;  4MAM A;  4NYE A;  3ETH A;  2DLN A;  1E4E B;  3U55 A;  3BG5 A;  2PVP A;  2YWV A;  3OUU A;  5D8D A;  4IIJ F;  2R87 A;  5HBR B;  5BMV F;  4I50 F;  1IOW A;  4XZ3 B;  2YS7 A;  1EYZ A;  4L1K A;  4YBZ B;  4EG0 A;  3VPC A;  2X0S A;  3HO8 A;  1UC8 A;  2FP4 B;  2R86 A;  2NU7 B;  1VBG A;  1KJQ A;  4YJ3 F;  2XD4 A;  2YZM A;  3R5H A;  4ZI7 F;  2DZD A;  2W6N A;  3WO0 A;  2HJW A;  3VPB A;  2GPS A;  3KAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...