4XYLB

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
225
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 66
structure length 225
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xylB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xylB02
1IOWA 5JVLA 3ETJA 5LP6F 2R7MA 2V58A 2GPSA 2FPIB 4E4TA 1EUDB 2I8CA 4ZHQF 2W6OA 5KKNB 1B6SA 4EG0A 1KBLA 2I80A 4FFRA 4XYLB 5IYZF 3ORRA 2GPWA 2W6MA 2PBZA 4QSHA 5LXTF 4L1KA 4DLKA 1C3OA 2SCUB 4MV6A 2P0AA 2NUAB 4C5BA 2CQYA 3GIDA 3I12A 5FNVF 3U9TA 3R23A 5CAEB 3RV3A 1BXRA 1OBGA 1AUXA 2J9GA 4YAKB 5LYJF 2R6FA 1AUVA 5LA6F 3JRXA 1WR2A 4O4LF 4MV8A 3RFCA 1VKZA 4XX0B 2PVPA 1GLVA 3AW8A 1I7LA 4FFMA 2VPQA 2HGSA 1M6VA 4O81A 4HNVA 2NU7B 4TUYF 4YBZB 2DIKA 2CZGA 3U9SA 1M0TA 1A48A 3LP8A 4FFLA 1CQJB 2NU9B 4YJ3F 4EGJA 4C5CA 1E4EA 4TV8F 4IHJF 2DZDA 3TINA 4O4HF 1JDBB 4MAMA 4IIJF 4ZI7F 1VBGA 3N6RA 1UC9A 4MV7A 3TW6A 4NYEA 2V59A 2GQSA 4YJ2F 2FB9A 1C30A 3KREA 5J2TF 2Z04A 3Q2OA 2R84A 3N8DA 2XD4A 2ZDQA 4O4IF 2R85A 2QF7A 4YB8B 2YS6A 3QFFA 1KJIA 1W93A 1CS0A 4TV9F 1I7NA 1KC7A 4IWYA 1PK8A 1GSHA 2YWVA 1B6RA 2W6PA 4Y8VB 1Z2PX 2CNQA 3ORQA 4MV1A 3TIIA 3JZFA 1SCUB 4O86A 4FE2A 1GSOA 3TQTA 3V4SA 5CA0F 3JZIA 4FGRA 3HBLA 2FPPB 1EZ1A 3VPCA 2YRWA 1IOVA 2YZNA 1KJJA 4C5AA 2YRXA 2YL2A 3MWEA 1Z2NX 3UFXB 4EGQA 2GQRA 2W6ZA 4HQ6A 2I87A 4I50F 4IWXA 3G8CA 2CNUA 3E5NA 2DWCA 4ZQIA 1T36A 4I55F 3U54A 3Q1KA 3DF7A 2YS7A 3K5IA 1UC8A 3K3PA 2FP4B 3NUAA 4O7YA 2OLSA 4O7VA 5CA1F 3SE7A 3R5XA 3RUPA 5BMVF 1A9XA 2YW2A 2ZDGA 1KJ8A 4FFNA 4FU0A 1EYZA 4RZQA 1DV1A 1ULZA 5JH7F 3KALA 2PN1A 1KUTA 4MV4A 4MV3A 1PX2A 2YZMA 5C1OA 2YZLA 4O2AF 2X0SA 1W96A 5JVDF 1EUCB 1BNCA 1M0WA 4HNUA 4O7ZA 4M9UA 3K5HA 3GLKA 2Z02A 2W70A 2R7NA 3V4ZA 1KEEA 5BPFA 4MA5A 3VPDA 5CB4F 2XCLA 3OUUA 5JQGF 2VR1A 4WD3A 1DV2A 3G8DA 2QK4A 3VOTA 3HO8A 1DIKA 2FPGB 3WNZA 1Z2OX 2R86A 4ZOLF 5HV6A 5D8DA 2DLNA 3R9RA 4I4TF 4O7TA 5I47A 3WO1A 2NU6B 5JQWA 1JDEA 2V5AA 5GONF 1OBDA 4O7RA 5EZYF 2W71A 3AX6A 1JLLB 3LWBA 1CQIB 2YYAA 5DMXA 3JRWA 3HB9A 3ETHA 5H80A 4FFPA 2NU8B 5LOVF 4O7LA 4O7NA 3OUZA 4O7SA 4MV9A 2W6NA 4XYMB 1EHIA 2R82A 5J2UF 2CNVA 3KAKA 1E4EB 3BG5A 1VBHA 4HNTA 1KJQA 2WYOA 4DIMA 4O84A 4O82A 1GGOA 2R87A 5BPHA 4WBNF 3MWDA 4O4JF 5HBRB 4HR7A 3RV4A 3KAJA 4O7WA 2R7LA 4MA0A 3VA7A 4O83A 3U55A 4YAJB 2ZDHA 2W6QA 5KX5F 2VQDA 5C1PA 3MJFA 5K2MA 4IZOA 4O2BF 1GSAA 2GLTA 2YZGA 4FFOA 3R5FA 1KJ9A 3R5HA 2IP4A 1CE8A 2R7KA 3VMMA 4ME6A 1JKJB 2C00A 2HJWA 3WO0A 5C8YF 4XZ3B 3TIGA 3VPBA
chains in the Genus database with same CATH superfamily
1RJQA 2JA8G 1XK5A 4A3CG 5DGHA 2BQUA 1IOWA 5JVLA 3ETJA 2W9BB 3T5JA 3MR6A 5L9XA 5KFOA 4Q4DA 3PR4A 2C2RA 1ZAUA 5LP6F 2Y0SA 3T5KA 4DR7H 2J6TA 2R7MA 2V58A 3GV7B 2NVYA 2GPSA 3KTMA 5D1PA 3BQ0A 2FPIB 1RJRA 4JV1A 3F8NA 4LF9H 4E4TA 1EUDB 2EJ2A 4X66H 2HHFB 4DL2A 4UCUA 5DQHA 5FR9A 4KHPH 2I8CA 4ZHQF 5KFEA 2W6OA 5KKNB 3FMAA 4APMA 1B6SA 2HHHH 4FBTA 3RR5A 4A2AA 5I5YA 5BYAA 4EG0A 2Q7DA 1WCMA 5DG7A 4YR2A 1KBLA 2XCPA 2WAQA 4JI1H 4ED7A 3N44B 2I80A 1JX4A 4FFRA 4XYLB 3TY5A 5IYZF 3G6XA 3ORRA 5E25A 4J9LA 2E5LH 2JEJA 3HOVG 4RNNA 2GPWA 4EYHB 3RB6A 2W6MA 2PBZA 2WB1A 2R8IA 4ECYA 5I5TA 2WDTA 2VA2A 4QSHA 4Q4CA 3PZPA 5LXTF 2R8KA 1TA8A 4RZRA 1I94H 4JI6H 5I5SA 5KFZA 3FDSA 4M7EA 1HNXH 1TWGA 4L1KA 3PVXA 3J7AK 2V9WA 4DLKA 3HOUG 1C3OA 3UQ8A 5IP7G 2C22A 2SCUB 4MV6A 2P0AA 2NUAB 5KFPA 4C5BA 5K3WA 2CQYA 4ED3A 3OSPA 4EEQA 3GIDA 3I12A 5FNVF 3U9TA 2UUAH 3R23A 4DV4H 5CAEB 2AGPA 4JI7H 1TAEA 4J9QA 3RV3A 2V4QA 3GV8B 1BXRA 4GC6A 4A3GG 5FLMG 2W7PA 3G6YA 4A3IG 1OBGA 2VUMA 4R8UA 4QWAA 4LFCH 5KFVA 1SFOA 1AUXA 2J9GA 4YAKB 5LYJF 5KFYA 2R6FA 5LMUH 1IBMH 1AUVA 5LA6F 3JRXA 3NBZB 1KTAA 1B33N 4A3JG 2R7ZA 1WR2A 4PWQA 4DAAA 1DAAA 4DV3H 4ED6A 3QWUA 4O4LF 4MV8A 5IWAH 3GQCA 4OX9H 3RFCA 1S0OA 3T9DA 4A3KG 4ECWA 1T94A 2AU0A 4LFAH 1VKZA 4XX0B 2PVPA 1GLVA 2MCTA 3AW8A 3TEKA 5BR8H 2C2EA 5DQGA 4ETSA 4Q44A 4DR6H 1SEIA 1I7LA 4DR1H 4FFMA 2VPQA 1E4GT 2HGSA 4ECZA 4O3RA 2UVVA 4CMDA 4NZMA 4F50A 4JV5H 1AN7A 3GTLA 1M6VA 5KFRA 1TWFA 4O81A 4HNVA 5BWVA 3Q8QB 4AQYH 3GTPA 2NU7B 4TUYF 4J9OA 1T3NA 4JI3H 2RDJA 4YBZB 2DIKA 2FK1A 2CZGA 5DG8A 2EIYA 5KG0A 3RJ0A 4B3SH 3U9SA 1M0TA 1A48A 3J80W 5KG3A 1Y1WG 2M05A 4BXXG 3LP8A 1S9FA 4PZ6A 4FFLA 3T9AA 1CQJB 1EKPA 2NU9B 3VNNA 3NBYB 5KT2A 1HR0H 5CR5A 4YJ3F 5I60A 5EWFA 4IAJA 4DR3H 4EGJA 2FMAA 2UVWA 1S68A 4C5CA 1E4EA 4QIWE 4NLGA 4TV8F 2W9CA 1HNWH 4IHJF 4A3LG 2DZDA 2B63A 4DR4H 4UCTA 4O4HF 3TINA 3MFIA 2W9BA 4LF5H 4J9PA 4CHIA 4CKBA 4X62H 3GTGA 5BWWA 1JDBB 2W7OA 4MAMA 4J9MA 2COGA 4IIJF 3KHGA 2XCAA 1FVIA 5DISC 4PDBA 2R92A 1S10A 4ZI7F 1IYEA 3T54A 3T9FA 5LMNH 2JA5A 1VBGA 1P8LA 4U7CA 1TWCA 1UC9A 3N6RA 4MV7A 4AYBE 3OSNA 3DTGA 5CM0A 3TW6A 4NXMH 3CVZA 3H0GG 3V6HA 3HT5A 4O3OA 4NYEA 2V59A 4DV1H 4ECXA 3N42B 3PW4A 3SNOA 2WAQE 4IRDA 3SGIA 5KFJA 2FLPA 4NZNA 2UVRA 4QWBA 4IRCA 4AYBA 2GQSA 5F9LA 4R8UB 4K6NA 4YJ2F 2FB9A 1C30A 3KREA 5J2TF 2Z04A 3Q2OA 2R84A 4ECRA 2FLNA 5DG9A 2J6SA 4TVIA 3N8DA 2XD4A 5T14A 4QW9A 1N34H 2E2IA 2ZDQA 4O4IF 4GKKH 3I4MG 5FPRA 4DL5A 4DRFA 2R85A 2OWOA 1TWAA 5KFUA 3GIKA 3PR5B 2QF7A 3OHAA 4FS1A 5BWXA 3H0GA 4YB8B 3NGDA 4LMYA 3Q8PB 5I5UA 4B3TH 2F4VH 4GLXA 1IBLH 2YS6A 4J9SA 4DUZH 3QFFA 3S24A 1KJIA 4QIWA 4F4WA 1W93A 4ECUA 4R7RA 5KG4A 1N33H 5EDWA 2UXCH 3BACA 1CS0A 3GILA 4TV9F 4LSXA 3SI8A 3V6JA 5C44G 5BWRA 5KFSA 1G2WA 1I7NA 4IWYA 1KC7A 2C35B 5KFIA 4LF8H 1PK8A 4CKEA 2CW7A 3T9EA 3HOWG 2FE3A 4GKJH 1GSHA 4RUAA 4MTDA 2YWVA 3GIIA 1B6RA 3N6XA 5KG1A 2W6PA 3BAAA 1N48A 4Y8VB 1XNRH 5EWEA 4ECVA 3MFHA 2ZM6H 1Z2PX 2CNQA 4LH6A 5DLGA 3ORQA 4ED1A 4MV1A 4EYIB 3TIIA 4TQSA 1I3QA 1I50A 2HIVA 3QZ8A 2JEFA 2JA6G 5HNEA 3IG0A 3JZFA 1SCUB 4O86A 2RGVA 2AGOA 4FE2A 3RB4A 2R8GA 1GSOA 3TQTA 3V4SA 5KT4A 5C3EG 3LULA 3CSWA 2Q2TA 1K83A 4LF7H 2VA3A 2ALZA 3GTKA 5CA0F 1IYDA 3JZIA 4FGRA 3HBLA 2WE6A 2FPPB 5DGIA 1EZ1A 4LSAA 3VPCA 3L4KA 3RBEA 1MZBA 2XIGA 1GYFA 3UZBA 2YRWA 1WH2A 5FD6A 1IOVA 2YZNA 4ED0A 1KJJA 4C5AA 4DL7A 2YRXA 5BYBA 1BJTA 2YL2A 3MWEA 1WCMG 3N40P 5L1JA 1Z2NX 4K0KH 3UFXB 4EGQA 1ZQ7A 3H40A 2EJ0A 3EYYA 3W1BA 2GQRA 2W6ZA 1A0GA 4HQ6A 1V51A 2FK2A 4F4ZA 4NZOA 1I2KA 2V4RA 5C4XG 2I87A 4I50F 2VUGA 3G8CA 4IWXA 2FKLA 3N41B 4A3FG 1FJGH 1IBKH 3GTMA 2CNUA 3E5NA 2DWCA 1S0NA 4ZQIA 1T36A 5D1OA 1OWTA 5KFLA 1M7JA 3JAMW 2J6UA 4A3DG 4Q43A 4I55F 2UXDH 3PW5A 4JI5H 3U54A 1K1QA 2OH2A 1XMOH 5IYDG 4DUYH 3PO3G 2X5RA 3U0GA 5KFGA 5JUMA 3Q1KA 3DF7A 1P16A 2CFMA 2YS7A 2KSWA 3K5IA 5KFWA 2R93A 1UC8A 1R9TA 3K3PA 2HVSA 2W9CB 4JI8H 1RJPA 1UNNC 2FP4B 3NUAA 4ECQA 4O7YA 2BR0A 1Y1WA 2OLSA 1A0IA 1KT8A 1Y1VG 5KFMA 5L1IA 4O7VA 5CA1F 3SE7A 2W8LA 3WWIA 4JYAH 3R5XA 4CC5A 1XMQH 2IMWP 2NVXA 4I7HA 4JV2A 2HIXA 3IN5A 1A3GA 3RUPA 5BMVF 1A9XA 4JI4H 4X64H 3RB0A 2UUCH 1V4YA 5DGBA 2YW2A 2ZDGA 1KJ8A 3UZOA 4RNOA 4J9KA 2W8KA 1RK6A 4FFNA 3T5LA 1RYSA 4FU0A 2R7ZG 4GLWA 2Q2UA 1EYZA 4RZQA 2O03A 1DV1A 1ULZA 2XGPA 5JH7F 3KALA 3TY8A 3RF2A 4ECSA 1EKVA 5DGAA 1CKMA 2JEIA 2IBKA 2PN1A 3BA9A 1KUTA 3FKIA 4YQWA 4YR3A 1I6UA 4MV4A 4YHHH 4Q8FA 2JA5G 4MV3A 3LQSA 5I5XA 2IA6A 4Q0YA 4C2MA 1PX2A 2YZMA 3W5OA 5C1OA 1WSCA 5C5JA 1J5EH 3GTJA 3WWJA 3OTOH 1ZHSA 2FJZA 2YZLA 1XNQH 1N32H 4QJFA 2WB1E 2XC9A 4O2AF 4TQRA 3BQ2A 4A3EG 2DABA 2X0SA 4YR0A 4A93G 1W96A 5JVDF 1EUCB 4EBEA 4EEYA 3PN1A 1BNCA 4LH7A 2ZJTA 4DV0H 4LFBH 3MR2A 5L1LA 4UCSA 5FJ8G 3KHLA 2C2DA 2PMZA 3RBDA 2AGQA 2W57A 4IR9A 3DTFA 1E4FT 3FKIG 1BGWA 4J0MA 1M0WA 4JI0H 4HNUA 3PFFA 1RK5A 4O7ZA 4M9UA 3K5HA 1I1MA 2UVUA 3K3VA 3T7AA 4A2BA 2E2HA 4DQNA 2B63G 2HVQA 2JEGA 5FPOA 3GLKA 2Z02A 1I1LA 5KT5A 2W70A 3CEBA 4FS2A 2R7NA 3H4BA 2HG8A 3KHRA 1N56A 4DL3A 1K1SA 4DV5H 1ET0A 2HVRA 5IYCG 4RB2C 1RYRA 1JIHA 5KG6A 4O3QA 5IYBG 2VQFH 3V4ZA 4CC6A 1Y1VA 5FD5A 4DV7H 4WHXA 4F4YA 2UUBH 1VAJA 4RUCA 3KHHA 3EPGA 3L2PA 5KS8A 1KEEA 3NC0B 5BPFA 4TM5A 2CW8A 3T9CA 4MA5A 3VPDA 1X9NA 4UCOA 3C0FB 4RU9A 5CB4F 3GIPA 2BQ3A 2COIA 2XCLA 3OUUA 5DQIA 3G6VA 5JQGF 2VR1A 4WD3A 1DV2A 5KFCA 1L2ZA 4GC7A 5KG5A 5KG7A 3G8DA 3KYHC 5I5VA 3RAXA 2QK4A 2HHFA 3RIZA 2C28A 2JA6A 4J9NA 1ZETA 4A3MG 3VOTA 4JV0A 3HO8A 4RAZA 2JA7A 1EKFA 4UCVA 4BBRG 1DIKA 4RB0A 2FPGB 3HOZG 3WNZA 3T5HA 5KFKA 1Z2OX 4RB3C 2R86A 4ZOLF 3Q8RB 2DAAA 4DR2H 3GB8B 5HV6A 2VOBA 3PW0A 4O3SA 2VUMG 4E6NA 4RNMA 5D8DA 3M4IA 4ED8A 3DAAA 2DLNA 4B3RH 1JXLA 1FKAH 5KFXA 4EFBA 4O3NA 3GIJA 3TY9A 2R8JA 3I4NG 3R9RA 2ASDA 4I4TF 4CE5A 4O7TA 4BY1G 3M9MB 4EBCA 2RDIA 5I47A 4CKCA 3AYHB 4BWSC 5KFBA 3WO1A 4G3IA 3KXYT 3WWHA 3HKZE 3QZ7A 3T1HH 1S0MA 2NU6B 3PW2A 2EJ3A 4NXNH 2JA7G 5I5WA 2AQ4A 2CKZB 2UU9H 1I2LA 4YP3A 5JQWA 2HGXA 4DV2H 1I1KA 5EWGA 1JDEA 2V5AA 2HDKA 4QWDA 3H3VH 3GJXB 5GONF 1OBDA 4RB1A 5DLFA 3LMLA 1CKOA 2DPIA 4Q45A 4O7RA 3T9BA 5EZYF 4FBUA 1S97A 5KFFA 2QB5A 3GIMA 2R93G 3Q8SB 2FLLA 2RGRA 3CQZA 4DL4A 2RF4A 2YCHA 2ATLA 2W71A 2VQEH 3AX6A 1JLLB 2Y4RA 5A2QW 3LWBA 1CQIB 2ABJA 2R8HA 4PZ8A 2VPSA 4RAYA 4ED2A 4JUZA 2YYAA 5DMXA 3JRWA 3HB9A 3ETHA 4HYKA 2PMZE 1SYXB 2UXBH 4QWEA 3M9NB 5BWTA 5H80A 3UYYA 3MWMA 4FFPA 1B04A 3MR3A 2NU8B 5LOVF 3GDEA 2QYZA 5KT7A 4O7LA 4DV6H 4O7NA 1Y14B 3OUZA 4O7SA 5IP9G 1ZHQA 4ECTA 4MV9A 3T99A 5BWUA 4JXUA 2W6NA 3BA8A 4O3PA 5KFQA 4XYMB 1GO3E 3RAQA 3HXLA 3EPIA 5KG2A 5KFDA 2COJA 1EHIA 2HGWA 1XDNA 2R82A 4DL6A 2ODTX 5KT3A 1DGSA 5J2UF 3RGXA 3MR5A 2CNVA 1WRVA 4PZ7A 4A3BG 3KAKA 4J9RA 1TWHA 2ZGIA 4EBDA 1E4EB 3BG5A 4U6PA 5CE8A 1VBHA 3TQ1A 3JZ6A 4UUGA 3JSNA 3RTXA 4HNTA 1KJQA 4QW8A 3GTOA 4EFEA 4LF4H 2WYOA 5KT6A 4DIMA 3T1YH 4O84A 2ASLA 2BQRA 4O82A 3GIQA 4UCRA 1GGOA 2R87A 3QQMA 5BPHA 3RGZA 4UFZA 5LL6b 5KFTA 4WBNF 2Y0SE 4BY7G 3MWDA 4MTEA 5DAAA 4IR1A 4O4JF 5HBRB 4JI2H 4M0JA 3N43B 2WTFA 4LF6H 4DR5H 4HN2A 4F4XA 3BABA 4CMFA 4HR7A 2ASJA 3RV4A 3KAJA 4O7WA 2R7LA 4MA0A 3HKZA 3VA7A 5L1KA 4O83A 5F9NA 3U55A 4YAJB 4B3MH 2FK3A 5IT9W 2ZDHA 2W6QA 3GV5B 2W9AA 2YU9A 3GTQA 5KX5F 2VQDA 1CKNB 5C1PA 3JSLA 3MJFA 1N36H 5K2MA 2XGQA 4IZOA 5KFAA 4O2BF 3RB3A 2R92G 4FM9A 1GSAA 2GLTA 3V6KA 3PO2G 2YZGA 4FFOA 4PBCA 3R5FA 1V9PA 5D1OB 1KJ9A 3J81W 5FLXW 3OHBA 4IRKA 3R5HA 2A1HA 2IP4A 1CE8A 2R7KA 3VMMA 4QWCA 3M9OB 3L4JA 4ME6A 1S03G 4EQ5A 3W1GA 3BJYA 5KFNA 3H4DA 5EOYA 1CKNA 1JKJB 2C00A 4BBSG 2DPJA 2HJWA 3H20A 4RCNA 3WO0A 5C8YF 3TW7A 4YY3H 4XZ3B 3TIGA 3HOXG 3BQ1A 1O75A 5KFHA 4Q8EA 3HOYG 3VPBA 1VS0A 3PW7A 4X65H 1HNZH
chains in the Genus database with same CATH topology
1IOWA 5JVLA 3ETJA 5LP6F 2R7MA 2V58A 2GPSA 2FPIB 4E4TA 1EUDB 2I8CA 4ZHQF 2W6OA 5KKNB 1B6SA 4EG0A 1KBLA 2I80A 4FFRA 4XYLB 5IYZF 3ORRA 2GPWA 2W6MA 2PBZA 4QSHA 5LXTF 4L1KA 4DLKA 1C3OA 2SCUB 4MV6A 2P0AA 2NUAB 4C5BA 2CQYA 3GIDA 3I12A 5FNVF 3U9TA 3R23A 5CAEB 3RV3A 1BXRA 1OBGA 1AUXA 2J9GA 4YAKB 5LYJF 2R6FA 1AUVA 5LA6F 3JRXA 1WR2A 4O4LF 4MV8A 3RFCA 1VKZA 4XX0B 2PVPA 1GLVA 3AW8A 1I7LA 4FFMA 2VPQA 2HGSA 1M6VA 4O81A 4HNVA 2NU7B 4TUYF 4YBZB 2DIKA 2CZGA 3U9SA 1M0TA 1A48A 3LP8A 4FFLA 1CQJB 2NU9B 4YJ3F 4EGJA 4C5CA 1E4EA 4TV8F 4IHJF 2DZDA 3TINA 4O4HF 1JDBB 4MAMA 4IIJF 4ZI7F 1VBGA 3N6RA 1UC9A 4MV7A 3TW6A 4NYEA 2V59A 2GQSA 4YJ2F 2FB9A 1C30A 3KREA 5J2TF 2Z04A 3Q2OA 2R84A 3N8DA 2XD4A 2ZDQA 4O4IF 2R85A 2QF7A 4YB8B 2YS6A 3QFFA 1KJIA 1W93A 1CS0A 4TV9F 1I7NA 1KC7A 4IWYA 1PK8A 1GSHA 2YWVA 1B6RA 2W6PA 4Y8VB 1Z2PX 2CNQA 3ORQA 4MV1A 3TIIA 3JZFA 1SCUB 4O86A 4FE2A 1GSOA 3TQTA 3V4SA 5CA0F 3JZIA 4FGRA 3HBLA 2FPPB 1EZ1A 3VPCA 2YRWA 1IOVA 2YZNA 1KJJA 4C5AA 2YRXA 2YL2A 3MWEA 1Z2NX 3UFXB 4EGQA 2GQRA 2W6ZA 4HQ6A 2I87A 4I50F 4IWXA 3G8CA 2CNUA 3E5NA 2DWCA 4ZQIA 1T36A 4I55F 3U54A 3Q1KA 3DF7A 2YS7A 3K5IA 1UC8A 3K3PA 2FP4B 3NUAA 4O7YA 2OLSA 4O7VA 5CA1F 3SE7A 3R5XA 3RUPA 5BMVF 1A9XA 2YW2A 2ZDGA 1KJ8A 4FFNA 4FU0A 1EYZA 4RZQA 1DV1A 1ULZA 5JH7F 3KALA 2PN1A 1KUTA 4MV4A 4MV3A 1PX2A 2YZMA 5C1OA 2YZLA 4O2AF 2X0SA 1W96A 5JVDF 1EUCB 1BNCA 1M0WA 4HNUA 4O7ZA 4M9UA 3K5HA 3GLKA 2Z02A 2W70A 2R7NA 3V4ZA 1KEEA 5BPFA 4MA5A 3VPDA 5CB4F 2XCLA 3OUUA 5JQGF 2VR1A 4WD3A 1DV2A 3G8DA 2QK4A 3VOTA 3HO8A 1DIKA 2FPGB 3WNZA 1Z2OX 2R86A 4ZOLF 5HV6A 5D8DA 2DLNA 3R9RA 4I4TF 4O7TA 5I47A 3WO1A 2NU6B 5JQWA 1JDEA 2V5AA 5GONF 1OBDA 4O7RA 5EZYF 2W71A 3AX6A 1JLLB 3LWBA 1CQIB 2YYAA 5DMXA 3JRWA 3HB9A 3ETHA 5H80A 4FFPA 2NU8B 5LOVF 4O7LA 4O7NA 3OUZA 4O7SA 4MV9A 2W6NA 4XYMB 1EHIA 2R82A 5J2UF 2CNVA 3KAKA 1E4EB 3BG5A 1VBHA 4HNTA 1KJQA 2WYOA 4DIMA 4O84A 4O82A 1GGOA 2R87A 5BPHA 4WBNF 3MWDA 4O4JF 5HBRB 4HR7A 3RV4A 3KAJA 4O7WA 2R7LA 4MA0A 3VA7A 4O83A 3U55A 4YAJB 2ZDHA 2W6QA 5KX5F 2VQDA 5C1PA 3MJFA 5K2MA 4IZOA 4O2BF 1GSAA 2GLTA 2YZGA 4FFOA 3R5FA 1KJ9A 3R5HA 2IP4A 1CE8A 2R7KA 3VMMA 4ME6A 1JKJB 2C00A 2HJWA 3WO0A 5C8YF 4XZ3B 3TIGA 3VPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOW A;  5JVL A;  3ETJ A;  5LP6 F;  2R7M A;  2V58 A;  2GPS A;  2FPI B;  4E4T A;  1EUD B;  2I8C A;  4ZHQ F;  2W6O A;  5KKN B;  1B6S A;  4EG0 A;  1KBL A;  2I80 A;  4FFR A;  4XYL B;  5IYZ F;  3ORR A;  2GPW A;  2W6M A;  2PBZ A;  4QSH A;  5LXT F;  4L1K A;  4DLK A;  1C3O A;  2SCU B;  4MV6 A;  2P0A A;  2NUA B;  4C5B A;  2CQY A;  3GID A;  3I12 A;  5FNV F;  3U9T A;  3R23 A;  5CAE B;  3RV3 A;  1BXR A;  1OBG A;  1AUX A;  2J9G A;  4YAK B;  5LYJ F;  2R6F A;  1AUV A;  5LA6 F;  3JRX A;  1WR2 A;  4O4L F;  4MV8 A;  3RFC A;  1VKZ A;  4XX0 B;  2PVP A;  1GLV A;  3AW8 A;  1I7L A;  4FFM A;  2VPQ A;  2HGS A;  1M6V A;  4O81 A;  4HNV A;  2NU7 B;  4TUY F;  4YBZ B;  2DIK A;  2CZG A;  3U9S A;  1M0T A;  1A48 A;  3LP8 A;  4FFL A;  1CQJ B;  2NU9 B;  4YJ3 F;  4EGJ A;  4C5C A;  1E4E A;  4TV8 F;  4IHJ F;  2DZD A;  3TIN A;  4O4H F;  1JDB B;  4MAM A;  4IIJ F;  4ZI7 F;  1VBG A;  3N6R A;  1UC9 A;  4MV7 A;  3TW6 A;  4NYE A;  2V59 A;  2GQS A;  4YJ2 F;  2FB9 A;  1C30 A;  3KRE A;  5J2T F;  2Z04 A;  3Q2O A;  2R84 A;  3N8D A;  2XD4 A;  2ZDQ A;  4O4I F;  2R85 A;  2QF7 A;  4YB8 B;  2YS6 A;  3QFF A;  1KJI A;  1W93 A;  1CS0 A;  4TV9 F;  1I7N A;  1KC7 A;  4IWY A;  1PK8 A;  1GSH A;  2YWV A;  1B6R A;  2W6P A;  4Y8V B;  1Z2P X;  2CNQ A;  3ORQ A;  4MV1 A;  3TII A;  3JZF A;  1SCU B;  4O86 A;  4FE2 A;  1GSO A;  3TQT A;  3V4S A;  5CA0 F;  3JZI A;  4FGR A;  3HBL A;  2FPP B;  1EZ1 A;  3VPC A;  2YRW A;  1IOV A;  2YZN A;  1KJJ A;  4C5A A;  2YRX A;  2YL2 A;  3MWE A;  1Z2N X;  3UFX B;  4EGQ A;  2GQR A;  2W6Z A;  4HQ6 A;  2I87 A;  4I50 F;  4IWX A;  3G8C A;  2CNU A;  3E5N A;  2DWC A;  4ZQI A;  1T36 A;  4I55 F;  3U54 A;  3Q1K A;  3DF7 A;  2YS7 A;  3K5I A;  1UC8 A;  3K3P A;  2FP4 B;  3NUA A;  4O7Y A;  2OLS A;  4O7V A;  5CA1 F;  3SE7 A;  3R5X A;  3RUP A;  5BMV F;  1A9X A;  2YW2 A;  2ZDG A;  1KJ8 A;  4FFN A;  4FU0 A;  1EYZ A;  4RZQ A;  1DV1 A;  1ULZ A;  5JH7 F;  3KAL A;  2PN1 A;  1KUT A;  4MV4 A;  4MV3 A;  1PX2 A;  2YZM A;  5C1O A;  2YZL A;  4O2A F;  2X0S A;  1W96 A;  5JVD F;  1EUC B;  1BNC A;  1M0W A;  4HNU A;  4O7Z A;  4M9U A;  3K5H A;  3GLK A;  2Z02 A;  2W70 A;  2R7N A;  3V4Z A;  1KEE A;  5BPF A;  4MA5 A;  3VPD A;  5CB4 F;  2XCL A;  3OUU A;  5JQG F;  2VR1 A;  4WD3 A;  1DV2 A;  3G8D A;  2QK4 A;  3VOT A;  3HO8 A;  1DIK A;  2FPG B;  3WNZ A;  1Z2O X;  2R86 A;  4ZOL F;  5HV6 A;  5D8D A;  2DLN A;  3R9R A;  4I4T F;  4O7T A;  5I47 A;  3WO1 A;  2NU6 B;  5JQW A;  1JDE A;  2V5A A;  5GON F;  1OBD A;  4O7R A;  5EZY F;  2W71 A;  3AX6 A;  1JLL B;  3LWB A;  1CQI B;  2YYA A;  5DMX A;  3JRW A;  3HB9 A;  3ETH A;  5H80 A;  4FFP A;  2NU8 B;  5LOV F;  4O7L A;  4O7N A;  3OUZ A;  4O7S A;  4MV9 A;  2W6N A;  4XYM B;  1EHI A;  2R82 A;  5J2U F;  2CNV A;  3KAK A;  1E4E B;  3BG5 A;  1VBH A;  4HNT A;  1KJQ A;  2WYO A;  4DIM A;  4O84 A;  4O82 A;  1GGO A;  2R87 A;  5BPH A;  4WBN F;  3MWD A;  4O4J F;  5HBR B;  4HR7 A;  3RV4 A;  3KAJ A;  4O7W A;  2R7L A;  4MA0 A;  3VA7 A;  4O83 A;  3U55 A;  4YAJ B;  2ZDH A;  2W6Q A;  5KX5 F;  2VQD A;  5C1P A;  3MJF A;  5K2M A;  4IZO A;  4O2B F;  1GSA A;  2GLT A;  2YZG A;  4FFO A;  3R5F A;  1KJ9 A;  3R5H A;  2IP4 A;  1CE8 A;  2R7K A;  3VMM A;  4ME6 A;  1JKJ B;  2C00 A;  2HJW A;  3WO0 A;  5C8Y F;  4XZ3 B;  3TIG A;  3VPB A; 
#chains in the Genus database with same CATH topology
 1RJQ A;  2JA8 G;  1XK5 A;  4A3C G;  5DGH A;  2BQU A;  1IOW A;  5JVL A;  3ETJ A;  2W9B B;  3T5J A;  3MR6 A;  5L9X A;  5KFO A;  4Q4D A;  3PR4 A;  2C2R A;  1ZAU A;  5LP6 F;  2Y0S A;  3T5K A;  4DR7 H;  2J6T A;  2R7M A;  2V58 A;  3GV7 B;  2NVY A;  2GPS A;  3KTM A;  5D1P A;  3BQ0 A;  2FPI B;  1RJR A;  4JV1 A;  3F8N A;  4LF9 H;  4E4T A;  1EUD B;  2EJ2 A;  4X66 H;  2HHF B;  4DL2 A;  4UCU A;  5DQH A;  5FR9 A;  4KHP H;  2I8C A;  4ZHQ F;  5KFE A;  2W6O A;  5KKN B;  3FMA A;  4APM A;  1B6S A;  2HHH H;  4FBT A;  3RR5 A;  4A2A A;  5I5Y A;  5BYA A;  4EG0 A;  2Q7D A;  1WCM A;  5DG7 A;  4YR2 A;  1KBL A;  2XCP A;  2WAQ A;  4JI1 H;  4ED7 A;  3N44 B;  2I80 A;  1JX4 A;  4FFR A;  4XYL B;  3TY5 A;  5IYZ F;  3G6X A;  3ORR A;  5E25 A;  4J9L A;  2E5L H;  2JEJ A;  3HOV G;  4RNN A;  2GPW A;  4EYH B;  3RB6 A;  2W6M A;  2PBZ A;  2WB1 A;  2R8I A;  4ECY A;  5I5T A;  2WDT A;  2VA2 A;  4QSH A;  4Q4C A;  3PZP A;  5LXT F;  2R8K A;  1TA8 A;  4RZR A;  1I94 H;  4JI6 H;  5I5S A;  5KFZ A;  3FDS A;  4M7E A;  1HNX H;  1TWG A;  4L1K A;  3PVX A;  3J7A K;  2V9W A;  4DLK A;  3HOU G;  1C3O A;  3UQ8 A;  5IP7 G;  2C22 A;  2SCU B;  4MV6 A;  2P0A A;  2NUA B;  5KFP A;  4C5B A;  5K3W A;  2CQY A;  4ED3 A;  3OSP A;  4EEQ A;  3GID A;  3I12 A;  5FNV F;  3U9T A;  2UUA H;  3R23 A;  4DV4 H;  5CAE B;  2AGP A;  4JI7 H;  1TAE A;  4J9Q A;  3RV3 A;  2V4Q A;  3GV8 B;  1BXR A;  4GC6 A;  4A3G G;  5FLM G;  2W7P A;  3G6Y A;  4A3I G;  1OBG A;  2VUM A;  4R8U A;  4QWA A;  4LFC H;  5KFV A;  1SFO A;  1AUX A;  2J9G A;  4YAK B;  5LYJ F;  5KFY A;  2R6F A;  5LMU H;  1IBM H;  1AUV A;  5LA6 F;  3JRX A;  3NBZ B;  1KTA A;  1B33 N;  4A3J G;  2R7Z A;  1WR2 A;  4PWQ A;  4DAA A;  1DAA A;  4DV3 H;  4ED6 A;  3QWU A;  4O4L F;  4MV8 A;  5IWA H;  3GQC A;  4OX9 H;  3RFC A;  1S0O A;  3T9D A;  4A3K G;  4ECW A;  1T94 A;  2AU0 A;  4LFA H;  1VKZ A;  4XX0 B;  2PVP A;  1GLV A;  2MCT A;  3AW8 A;  3TEK A;  5BR8 H;  2C2E A;  5DQG A;  4ETS A;  4Q44 A;  4DR6 H;  1SEI A;  1I7L A;  4DR1 H;  4FFM A;  2VPQ A;  1E4G T;  2HGS A;  4ECZ A;  4O3R A;  2UVV A;  4CMD A;  4NZM A;  4F50 A;  4JV5 H;  1AN7 A;  3GTL A;  1M6V A;  5KFR A;  1TWF A;  4O81 A;  4HNV A;  5BWV A;  3Q8Q B;  4AQY H;  3GTP A;  2NU7 B;  4TUY F;  4J9O A;  1T3N A;  4JI3 H;  2RDJ A;  4YBZ B;  2DIK A;  2FK1 A;  2CZG A;  5DG8 A;  2EIY A;  5KG0 A;  3RJ0 A;  4B3S H;  3U9S A;  1M0T A;  1A48 A;  3J80 W;  5KG3 A;  1Y1W G;  2M05 A;  4BXX G;  3LP8 A;  1S9F A;  4PZ6 A;  4FFL A;  3T9A A;  1CQJ B;  1EKP A;  2NU9 B;  3VNN A;  3NBY B;  5KT2 A;  1HR0 H;  5CR5 A;  4YJ3 F;  5I60 A;  5EWF A;  4IAJ A;  4DR3 H;  4EGJ A;  2FMA A;  2UVW A;  1S68 A;  4C5C A;  1E4E A;  4QIW E;  4NLG A;  4TV8 F;  2W9C A;  1HNW H;  4IHJ F;  4A3L G;  2DZD A;  2B63 A;  4DR4 H;  4UCT A;  4O4H F;  3TIN A;  3MFI A;  2W9B A;  4LF5 H;  4J9P A;  4CHI A;  4CKB A;  4X62 H;  3GTG A;  5BWW A;  1JDB B;  2W7O A;  4MAM A;  4J9M A;  2COG A;  4IIJ F;  3KHG A;  2XCA A;  1FVI A;  5DIS C;  4PDB A;  2R92 A;  1S10 A;  4ZI7 F;  1IYE A;  3T54 A;  3T9F A;  5LMN H;  2JA5 A;  1VBG A;  1P8L A;  4U7C A;  1TWC A;  1UC9 A;  3N6R A;  4MV7 A;  4AYB E;  3OSN A;  3DTG A;  5CM0 A;  3TW6 A;  4NXM H;  3CVZ A;  3H0G G;  3V6H A;  3HT5 A;  4O3O A;  4NYE A;  2V59 A;  4DV1 H;  4ECX A;  3N42 B;  3PW4 A;  3SNO A;  2WAQ E;  4IRD A;  3SGI A;  5KFJ A;  2FLP A;  4NZN A;  2UVR A;  4QWB A;  4IRC A;  4AYB A;  2GQS A;  5F9L A;  4R8U B;  4K6N A;  4YJ2 F;  2FB9 A;  1C30 A;  3KRE A;  5J2T F;  2Z04 A;  3Q2O A;  2R84 A;  4ECR A;  2FLN A;  5DG9 A;  2J6S A;  4TVI A;  3N8D A;  2XD4 A;  5T14 A;  4QW9 A;  1N34 H;  2E2I A;  2ZDQ A;  4O4I F;  4GKK H;  3I4M G;  5FPR A;  4DL5 A;  4DRF A;  2R85 A;  2OWO A;  1TWA A;  5KFU A;  3GIK A;  3PR5 B;  2QF7 A;  3OHA A;  4FS1 A;  5BWX A;  3H0G A;  4YB8 B;  3NGD A;  4LMY A;  3Q8P B;  5I5U A;  4B3T H;  2F4V H;  4GLX A;  1IBL H;  2YS6 A;  4J9S A;  4DUZ H;  3QFF A;  3S24 A;  1KJI A;  4QIW A;  4F4W A;  1W93 A;  4ECU A;  4R7R A;  5KG4 A;  1N33 H;  5EDW A;  2UXC H;  3BAC A;  1CS0 A;  3GIL A;  4TV9 F;  4LSX A;  3SI8 A;  3V6J A;  5C44 G;  5BWR A;  5KFS A;  1G2W A;  1I7N A;  4IWY A;  1KC7 A;  2C35 B;  5KFI A;  4LF8 H;  1PK8 A;  4CKE A;  2CW7 A;  3T9E A;  3HOW G;  2FE3 A;  4GKJ H;  1GSH A;  4RUA A;  4MTD A;  2YWV A;  3GII A;  1B6R A;  3N6X A;  5KG1 A;  2W6P A;  3BAA A;  1N48 A;  4Y8V B;  1XNR H;  5EWE A;  4ECV A;  3MFH A;  2ZM6 H;  1Z2P X;  2CNQ A;  4LH6 A;  5DLG A;  3ORQ A;  4ED1 A;  4MV1 A;  4EYI B;  3TII A;  4TQS A;  1I3Q A;  1I50 A;  2HIV A;  3QZ8 A;  2JEF A;  2JA6 G;  5HNE A;  3IG0 A;  3JZF A;  1SCU B;  4O86 A;  2RGV A;  2AGO A;  4FE2 A;  3RB4 A;  2R8G A;  1GSO A;  3TQT A;  3V4S A;  5KT4 A;  5C3E G;  3LUL A;  3CSW A;  2Q2T A;  1K83 A;  4LF7 H;  2VA3 A;  2ALZ A;  3GTK A;  5CA0 F;  1IYD A;  3JZI A;  4FGR A;  3HBL A;  2WE6 A;  2FPP B;  5DGI A;  1EZ1 A;  4LSA A;  3VPC A;  3L4K A;  3RBE A;  1MZB A;  2XIG A;  1GYF A;  3UZB A;  2YRW A;  1WH2 A;  5FD6 A;  1IOV A;  2YZN A;  4ED0 A;  1KJJ A;  4C5A A;  4DL7 A;  2YRX A;  5BYB A;  1BJT A;  2YL2 A;  3MWE A;  1WCM G;  3N40 P;  5L1J A;  1Z2N X;  4K0K H;  3UFX B;  4EGQ A;  1ZQ7 A;  3H40 A;  2EJ0 A;  3EYY A;  3W1B A;  2GQR A;  2W6Z A;  1A0G A;  4HQ6 A;  1V51 A;  2FK2 A;  4F4Z A;  4NZO A;  1I2K A;  2V4R A;  5C4X G;  2I87 A;  4I50 F;  2VUG A;  3G8C A;  4IWX A;  2FKL A;  3N41 B;  4A3F G;  1FJG H;  1IBK H;  3GTM A;  2CNU A;  3E5N A;  2DWC A;  1S0N A;  4ZQI A;  1T36 A;  5D1O A;  1OWT A;  5KFL A;  1M7J A;  3JAM W;  2J6U A;  4A3D G;  4Q43 A;  4I55 F;  2UXD H;  3PW5 A;  4JI5 H;  3U54 A;  1K1Q A;  2OH2 A;  1XMO H;  5IYD G;  4DUY H;  3PO3 G;  2X5R A;  3U0G A;  5KFG A;  5JUM A;  3Q1K A;  3DF7 A;  1P16 A;  2CFM A;  2YS7 A;  2KSW A;  3K5I A;  5KFW A;  2R93 A;  1UC8 A;  1R9T A;  3K3P A;  2HVS A;  2W9C B;  4JI8 H;  1RJP A;  1UNN C;  2FP4 B;  3NUA A;  4ECQ A;  4O7Y A;  2BR0 A;  1Y1W A;  2OLS A;  1A0I A;  1KT8 A;  1Y1V G;  5KFM A;  5L1I A;  4O7V A;  5CA1 F;  3SE7 A;  2W8L A;  3WWI A;  4JYA H;  3R5X A;  4CC5 A;  1XMQ H;  2IMW P;  2NVX A;  4I7H A;  4JV2 A;  2HIX A;  3IN5 A;  1A3G A;  3RUP A;  5BMV F;  1A9X A;  4JI4 H;  4X64 H;  3RB0 A;  2UUC H;  1V4Y A;  5DGB A;  2YW2 A;  2ZDG A;  1KJ8 A;  3UZO A;  4RNO A;  4J9K A;  2W8K A;  1RK6 A;  4FFN A;  3T5L A;  1RYS A;  4FU0 A;  2R7Z G;  4GLW A;  2Q2U A;  1EYZ A;  4RZQ A;  2O03 A;  1DV1 A;  1ULZ A;  2XGP A;  5JH7 F;  3KAL A;  3TY8 A;  3RF2 A;  4ECS A;  1EKV A;  5DGA A;  1CKM A;  2JEI A;  2IBK A;  2PN1 A;  3BA9 A;  1KUT A;  3FKI A;  4YQW A;  4YR3 A;  1I6U A;  4MV4 A;  4YHH H;  4Q8F A;  2JA5 G;  4MV3 A;  3LQS A;  5I5X A;  2IA6 A;  4Q0Y A;  4C2M A;  1PX2 A;  2YZM A;  3W5O A;  5C1O A;  1WSC A;  5C5J A;  1J5E H;  3GTJ A;  3WWJ A;  3OTO H;  1ZHS A;  2FJZ A;  2YZL A;  1XNQ H;  1N32 H;  4QJF A;  2WB1 E;  2XC9 A;  4O2A F;  4TQR A;  3BQ2 A;  4A3E G;  2DAB A;  2X0S A;  4YR0 A;  4A93 G;  1W96 A;  5JVD F;  1EUC B;  4EBE A;  4EEY A;  3PN1 A;  1BNC A;  4LH7 A;  2ZJT A;  4DV0 H;  4LFB H;  3MR2 A;  5L1L A;  4UCS A;  5FJ8 G;  3KHL A;  2C2D A;  2PMZ A;  3RBD A;  2AGQ A;  2W57 A;  4IR9 A;  3DTF A;  1E4F T;  3FKI G;  1BGW A;  4J0M A;  1M0W A;  4JI0 H;  4HNU A;  3PFF A;  1RK5 A;  4O7Z A;  4M9U A;  3K5H A;  1I1M A;  2UVU A;  3K3V A;  3T7A A;  4A2B A;  2E2H A;  4DQN A;  2B63 G;  2HVQ A;  2JEG A;  5FPO A;  3GLK A;  2Z02 A;  1I1L A;  5KT5 A;  2W70 A;  3CEB A;  4FS2 A;  2R7N A;  3H4B A;  2HG8 A;  3KHR A;  1N56 A;  4DL3 A;  1K1S A;  4DV5 H;  1ET0 A;  2HVR A;  5IYC G;  4RB2 C;  1RYR A;  1JIH A;  5KG6 A;  4O3Q A;  5IYB G;  2VQF H;  3V4Z A;  4CC6 A;  1Y1V A;  5FD5 A;  4DV7 H;  4WHX A;  4F4Y A;  2UUB H;  1VAJ A;  4RUC A;  3KHH A;  3EPG A;  3L2P A;  5KS8 A;  1KEE A;  3NC0 B;  5BPF A;  4TM5 A;  2CW8 A;  3T9C A;  4MA5 A;  3VPD A;  1X9N A;  4UCO A;  3C0F B;  4RU9 A;  5CB4 F;  3GIP A;  2BQ3 A;  2COI A;  2XCL A;  3OUU A;  5DQI A;  3G6V A;  5JQG F;  2VR1 A;  4WD3 A;  1DV2 A;  5KFC A;  1L2Z A;  4GC7 A;  5KG5 A;  5KG7 A;  3G8D A;  3KYH C;  5I5V A;  3RAX A;  2QK4 A;  2HHF A;  3RIZ A;  2C28 A;  2JA6 A;  4J9N A;  1ZET A;  4A3M G;  3VOT A;  4JV0 A;  3HO8 A;  4RAZ A;  2JA7 A;  1EKF A;  4UCV A;  4BBR G;  1DIK A;  4RB0 A;  2FPG B;  3HOZ G;  3WNZ A;  3T5H A;  5KFK A;  1Z2O X;  4RB3 C;  2R86 A;  4ZOL F;  3Q8R B;  2DAA A;  4DR2 H;  3GB8 B;  5HV6 A;  2VOB A;  3PW0 A;  4O3S A;  2VUM G;  4E6N A;  4RNM A;  5D8D A;  3M4I A;  4ED8 A;  3DAA A;  2DLN A;  4B3R H;  1JXL A;  1FKA H;  5KFX A;  4EFB A;  4O3N A;  3GIJ A;  3TY9 A;  2R8J A;  3I4N G;  3R9R A;  2ASD A;  4I4T F;  4CE5 A;  4O7T A;  4BY1 G;  3M9M B;  4EBC A;  2RDI A;  5I47 A;  4CKC A;  3AYH B;  4BWS C;  5KFB A;  3WO1 A;  4G3I A;  3KXY T;  3WWH A;  3HKZ E;  3QZ7 A;  3T1H H;  1S0M A;  2NU6 B;  3PW2 A;  2EJ3 A;  4NXN H;  2JA7 G;  5I5W A;  2AQ4 A;  2CKZ B;  2UU9 H;  1I2L A;  4YP3 A;  5JQW A;  2HGX A;  4DV2 H;  1I1K A;  5EWG A;  1JDE A;  2V5A A;  2HDK A;  4QWD A;  3H3V H;  3GJX B;  5GON F;  1OBD A;  4RB1 A;  5DLF A;  3LML A;  1CKO A;  2DPI A;  4Q45 A;  4O7R A;  3T9B A;  5EZY F;  4FBU A;  1S97 A;  5KFF A;  2QB5 A;  3GIM A;  2R93 G;  3Q8S B;  2FLL A;  2RGR A;  3CQZ A;  4DL4 A;  2RF4 A;  2YCH A;  2ATL A;  2W71 A;  2VQE H;  3AX6 A;  1JLL B;  2Y4R A;  5A2Q W;  3LWB A;  1CQI B;  2ABJ A;  2R8H A;  4PZ8 A;  2VPS A;  4RAY A;  4ED2 A;  4JUZ A;  2YYA A;  5DMX A;  3JRW A;  3HB9 A;  3ETH A;  4HYK A;  2PMZ E;  1SYX B;  2UXB H;  4QWE A;  3M9N B;  5BWT A;  5H80 A;  3UYY A;  3MWM A;  4FFP A;  1B04 A;  3MR3 A;  2NU8 B;  5LOV F;  3GDE A;  2QYZ A;  5KT7 A;  4O7L A;  4DV6 H;  4O7N A;  1Y14 B;  3OUZ A;  4O7S A;  5IP9 G;  1ZHQ A;  4ECT A;  4MV9 A;  3T99 A;  5BWU A;  4JXU A;  2W6N A;  3BA8 A;  4O3P A;  5KFQ A;  4XYM B;  1GO3 E;  3RAQ A;  3HXL A;  3EPI A;  5KG2 A;  5KFD A;  2COJ A;  1EHI A;  2HGW A;  1XDN A;  2R82 A;  4DL6 A;  2ODT X;  5KT3 A;  1DGS A;  5J2U F;  3RGX A;  3MR5 A;  2CNV A;  1WRV A;  4PZ7 A;  4A3B G;  3KAK A;  4J9R A;  1TWH A;  2ZGI A;  4EBD A;  1E4E B;  3BG5 A;  4U6P A;  5CE8 A;  1VBH A;  3TQ1 A;  3JZ6 A;  4UUG A;  3JSN A;  3RTX A;  4HNT A;  1KJQ A;  4QW8 A;  3GTO A;  4EFE A;  4LF4 H;  2WYO A;  5KT6 A;  4DIM A;  3T1Y H;  4O84 A;  2ASL A;  2BQR A;  4O82 A;  3GIQ A;  4UCR A;  1GGO A;  2R87 A;  3QQM A;  5BPH A;  3RGZ A;  4UFZ A;  5LL6 b;  5KFT A;  4WBN F;  2Y0S E;  4BY7 G;  3MWD A;  4MTE A;  5DAA A;  4IR1 A;  4O4J F;  5HBR B;  4JI2 H;  4M0J A;  3N43 B;  2WTF A;  4LF6 H;  4DR5 H;  4HN2 A;  4F4X A;  3BAB A;  4CMF A;  4HR7 A;  2ASJ A;  3RV4 A;  3KAJ A;  4O7W A;  2R7L A;  4MA0 A;  3HKZ A;  3VA7 A;  5L1K A;  4O83 A;  5F9N A;  3U55 A;  4YAJ B;  4B3M H;  2FK3 A;  5IT9 W;  2ZDH A;  2W6Q A;  3GV5 B;  2W9A A;  2YU9 A;  3GTQ A;  5KX5 F;  2VQD A;  1CKN B;  5C1P A;  3JSL A;  3MJF A;  1N36 H;  5K2M A;  2XGQ A;  4IZO A;  5KFA A;  4O2B F;  3RB3 A;  2R92 G;  4FM9 A;  1GSA A;  2GLT A;  3V6K A;  3PO2 G;  2YZG A;  4FFO A;  4PBC A;  3R5F A;  1V9P A;  5D1O B;  1KJ9 A;  3J81 W;  5FLX W;  3OHB A;  4IRK A;  3R5H A;  2A1H A;  2IP4 A;  1CE8 A;  2R7K A;  3VMM A;  4QWC A;  3M9O B;  3L4J A;  4ME6 A;  1S03 G;  4EQ5 A;  3W1G A;  3BJY A;  5KFN A;  3H4D A;  5EOY A;  1CKN A;  1JKJ B;  2C00 A;  4BBS G;  2DPJ A;  2HJW A;  3H20 A;  4RCN A;  3WO0 A;  5C8Y F;  3TW7 A;  4YY3 H;  4XZ3 B;  3TIG A;  3HOX G;  3BQ1 A;  1O75 A;  5KFH A;  4Q8E A;  3HOY G;  3VPB A;  1VS0 A;  3PW7 A;  4X65 H;  1HNZ H; 
#chains in the Genus database with same CATH homology
 1IOW A;  5JVL A;  3ETJ A;  5LP6 F;  2R7M A;  2V58 A;  2GPS A;  2FPI B;  4E4T A;  1EUD B;  2I8C A;  4ZHQ F;  2W6O A;  5KKN B;  1B6S A;  4EG0 A;  1KBL A;  2I80 A;  4FFR A;  4XYL B;  5IYZ F;  3ORR A;  2GPW A;  2W6M A;  2PBZ A;  4QSH A;  5LXT F;  4L1K A;  4DLK A;  1C3O A;  2SCU B;  4MV6 A;  2P0A A;  2NUA B;  4C5B A;  2CQY A;  3GID A;  3I12 A;  5FNV F;  3U9T A;  3R23 A;  5CAE B;  3RV3 A;  1BXR A;  1OBG A;  1AUX A;  2J9G A;  4YAK B;  5LYJ F;  2R6F A;  1AUV A;  5LA6 F;  3JRX A;  1WR2 A;  4O4L F;  4MV8 A;  3RFC A;  1VKZ A;  4XX0 B;  2PVP A;  1GLV A;  3AW8 A;  1I7L A;  4FFM A;  2VPQ A;  2HGS A;  1M6V A;  4O81 A;  4HNV A;  2NU7 B;  4TUY F;  4YBZ B;  2DIK A;  2CZG A;  3U9S A;  1M0T A;  1A48 A;  3LP8 A;  4FFL A;  1CQJ B;  2NU9 B;  4YJ3 F;  4EGJ A;  4C5C A;  1E4E A;  4TV8 F;  4IHJ F;  2DZD A;  3TIN A;  4O4H F;  1JDB B;  4MAM A;  4IIJ F;  4ZI7 F;  1VBG A;  3N6R A;  1UC9 A;  4MV7 A;  3TW6 A;  4NYE A;  2V59 A;  2GQS A;  4YJ2 F;  2FB9 A;  1C30 A;  3KRE A;  5J2T F;  2Z04 A;  3Q2O A;  2R84 A;  3N8D A;  2XD4 A;  2ZDQ A;  4O4I F;  2R85 A;  2QF7 A;  4YB8 B;  2YS6 A;  3QFF A;  1KJI A;  1W93 A;  1CS0 A;  4TV9 F;  1I7N A;  1KC7 A;  4IWY A;  1PK8 A;  1GSH A;  2YWV A;  1B6R A;  2W6P A;  4Y8V B;  1Z2P X;  2CNQ A;  3ORQ A;  4MV1 A;  3TII A;  3JZF A;  1SCU B;  4O86 A;  4FE2 A;  1GSO A;  3TQT A;  3V4S A;  5CA0 F;  3JZI A;  4FGR A;  3HBL A;  2FPP B;  1EZ1 A;  3VPC A;  2YRW A;  1IOV A;  2YZN A;  1KJJ A;  4C5A A;  2YRX A;  2YL2 A;  3MWE A;  1Z2N X;  3UFX B;  4EGQ A;  2GQR A;  2W6Z A;  4HQ6 A;  2I87 A;  4I50 F;  4IWX A;  3G8C A;  2CNU A;  3E5N A;  2DWC A;  4ZQI A;  1T36 A;  4I55 F;  3U54 A;  3Q1K A;  3DF7 A;  2YS7 A;  3K5I A;  1UC8 A;  3K3P A;  2FP4 B;  3NUA A;  4O7Y A;  2OLS A;  4O7V A;  5CA1 F;  3SE7 A;  3R5X A;  3RUP A;  5BMV F;  1A9X A;  2YW2 A;  2ZDG A;  1KJ8 A;  4FFN A;  4FU0 A;  1EYZ A;  4RZQ A;  1DV1 A;  1ULZ A;  5JH7 F;  3KAL A;  2PN1 A;  1KUT A;  4MV4 A;  4MV3 A;  1PX2 A;  2YZM A;  5C1O A;  2YZL A;  4O2A F;  2X0S A;  1W96 A;  5JVD F;  1EUC B;  1BNC A;  1M0W A;  4HNU A;  4O7Z A;  4M9U A;  3K5H A;  3GLK A;  2Z02 A;  2W70 A;  2R7N A;  3V4Z A;  1KEE A;  5BPF A;  4MA5 A;  3VPD A;  5CB4 F;  2XCL A;  3OUU A;  5JQG F;  2VR1 A;  4WD3 A;  1DV2 A;  3G8D A;  2QK4 A;  3VOT A;  3HO8 A;  1DIK A;  2FPG B;  3WNZ A;  1Z2O X;  2R86 A;  4ZOL F;  5HV6 A;  5D8D A;  2DLN A;  3R9R A;  4I4T F;  4O7T A;  5I47 A;  3WO1 A;  2NU6 B;  5JQW A;  1JDE A;  2V5A A;  5GON F;  1OBD A;  4O7R A;  5EZY F;  2W71 A;  3AX6 A;  1JLL B;  3LWB A;  1CQI B;  2YYA A;  5DMX A;  3JRW A;  3HB9 A;  3ETH A;  5H80 A;  4FFP A;  2NU8 B;  5LOV F;  4O7L A;  4O7N A;  3OUZ A;  4O7S A;  4MV9 A;  2W6N A;  4XYM B;  1EHI A;  2R82 A;  5J2U F;  2CNV A;  3KAK A;  1E4E B;  3BG5 A;  1VBH A;  4HNT A;  1KJQ A;  2WYO A;  4DIM A;  4O84 A;  4O82 A;  1GGO A;  2R87 A;  5BPH A;  4WBN F;  3MWD A;  4O4J F;  5HBR B;  4HR7 A;  3RV4 A;  3KAJ A;  4O7W A;  2R7L A;  4MA0 A;  3VA7 A;  4O83 A;  3U55 A;  4YAJ B;  2ZDH A;  2W6Q A;  5KX5 F;  2VQD A;  5C1P A;  3MJF A;  5K2M A;  4IZO A;  4O2B F;  1GSA A;  2GLT A;  2YZG A;  4FFO A;  3R5F A;  1KJ9 A;  3R5H A;  2IP4 A;  1CE8 A;  2R7K A;  3VMM A;  4ME6 A;  1JKJ B;  2C00 A;  2HJW A;  3WO0 A;  5C8Y F;  4XZ3 B;  3TIG A;  3VPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...