4XYLB

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
225
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
molecule tags Ligase
source organism Korarchaeum cryptofilum (strain opf8)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
total genus 66
structure length 225
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xylB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xylB02
2XD4A 1C3OA 1IOWA 4XYMB 3U9SA 3RFCA 4TV9F 1Z2OX 4O7SA 5CA1F 4FFLA 4C5AA 2I80A 5C1OA 5HV6A 4YAJB 2YRWA 4YJ3F 2CNUA 5LXTF 4O86A 1DIKA 3UFXB 5JQGF 2V58A 2W70A 2YW2A 2ZDGA 5JVDF 2FPIB 5BPFA 3ETJA 4NYEA 1Z2NX 4FFNA 1M0TA 3LP8A 2J9GA 2NUAB 3WO0A 1GSHA 3G8CA 5EZYF 2GPSA 3V4ZA 2X0SA 3SE7A 1GSAA 4MV7A 3RUPA 2R7MA 5LYJF 2WYOA 1KJQA 2CNQA 5BMVF 1CQJB 1PK8A 4O7RA 4MV3A 3QFFA 3R5HA 4HR7A 1Z2PX 3G8DA 4O84A 1KJ8A 4O7ZA 4I55F 4IZOA 4MV1A 1JLLB 4WD3A 4EGQA 2CNVA 2YRXA 1KUTA 4WBNF 3KAJA 2I8CA 1CE8A 2GQSA 5J2UF 1ULZA 1KJ9A 5K2MA 4I4TF 3GIDA 3MJFA 2NU7B 1BXRA 5JQWA 3R5XA 4O4LF 3V4SA 5BPHA 4ME6A 4IHJF 5JVLA 2IP4A 5JH7F 1I7NA 5CA0F 2DIKA 4HNVA 1JDEA 2R7LA 3K5HA 4EGJA 2DWCA 4Y8VB 3K5IA 4DLKA 3Q2OA 3HO8A 2NU8B 2R7KA 2YZGA 2W6ZA 1KJIA 3HB9A 2HGSA 1UC9A 2PBZA 3JRWA 1VKZA 4FE2A 3TINA 1DV1A 4FGRA 2VR1A 4O7TA 4O82A 4ZHQF 3MWDA 1E4EA 2R85A 1T36A 2GQRA 3OUZA 1AUXA 2PN1A 4L1KA 4MA5A 2W71A 3E5NA 1B6SA 3VPCA 3JZFA 4O83A 2HJWA 1EUCB 1B6RA 2VPQA 1CS0A 5CB4F 1VBHA 1DV2A 3TIGA 1A9XA 1GSOA 1JKJB 2W6PA 2R7NA 3HBLA 1WR2A 5I47A 1PX2A 3VMMA 4MA0A 2I87A 3Q1KA 2Z02A 4QSHA 2W6MA 4O7YA 3K3PA 2W6NA 3R9RA 1JDBB 4MV4A 1EZ1A 2YYAA 3AX6A 4HNUA 2QK4A 2DLNA 4HQ6A 2GLTA 4ZI7F 1IOVA 3JZIA 5C1PA 2PVPA 4YJ2F 5LOVF 2Z04A 5LP6F 1KBLA 4O7LA 2FB9A 5KKNB 3TIIA 2YZMA 5KX5F 2ZDHA 1C30A 2W6OA 2CZGA 3MWEA 2R87A 4XX0B 2GPWA 3ORQA 1GLVA 4O7NA 3ORRA 2R84A 2YS6A 5J2TF 2P0AA 4TV8F 2XCLA 4DIMA 2DZDA 4C5BA 4FU0A 1OBDA 5LA6F 1BNCA 1M0WA 3N8DA 3DF7A 2NU6B 5H80A 1AUVA 3WO1A 4O4HF 4IIJF 4YB8B 3JRXA 2OLSA 2YWVA 2SCUB 3RV4A 1KJJA 4XZ3B 2YL2A 2R82A 4FFOA 4FFMA 4XYLB 4MV6A 4RZQA 2YZLA 3VPBA 1GGOA 3R5FA 3WNZA 4I50F 4HNTA 4FFRA 2FP4B 4O4IF 4C5CA 3ETHA 3NUAA 4O7WA 4M9UA 2CQYA 2C00A 1W96A 1EHIA 1KEEA 3U55A 3KALA 2R6FA 3GLKA 3LWBA 4IWYA 5C8YF 3TQTA 5IYZF 2ZDQA 1KC7A 1EUDB 4MAMA 3RV3A 1OBGA 4O7VA 1M6VA 4ZOLF 3N6RA 1CQIB 4EG0A 4O81A 2YZNA 2V59A 5D8DA 1E4EB 3U9TA 1UC8A 4IWXA 4YBZB 2YS7A 2FPGB 5FNVF 4O2BF 5HBRB 2R86A 3U54A 3AW8A 4MV8A 4MV9A 2FPPB 5CAEB 3KREA 2W6QA 5DMXA 1EYZA 3OUUA 3VOTA 1A48A 5GONF 2NU9B 3VPDA 4TUYF 3I12A 1I7LA 4FFPA 3R23A 1VBGA 1SCUB 4E4TA 3BG5A 3TW6A 2VQDA 4YAKB 3KAKA 2V5AA 2QF7A 4O2AF 4O4JF 4ZQIA 1W93A 3VA7A
chains in the Genus database with same CATH superfamily
1HNXH 2XD4A 3T9AA 4EFEA 3CVZA 5KT5A 1C3OA 1IOWA 4XYMB 3EPIA 3L4JA 3U9SA 2QYZA 3RFCA 4QWBA 1OWTA 5KFTA 2BQUA 2R92A 3EPGA 4TV9F 1TA8A 1Z2OX 1K83A 4O7SA 4RUCA 1N56A 5CA1F 2R8GA 5KFUA 3Q8RB 4ETSA 2AU0A 5D1OB 4AQYH 1WCMG 4FFLA 4ECSA 3SI8A 2AGQA 5LMNH 4JI1H 5DISC 3N44B 4DV3H 4C5AA 4QIWA 2I80A 4ED0A 3I4NG 5C1OA 5HV6A 5LMUH 4YAJB 2YRWA 1EKFA 2Y0SA 2R8JA 4IRDA 2EJ0A 4YJ3F 4RB1A 4YR3A 4ECXA 2CNUA 3LMLA 5FPOA 3RJ0A 2OH2A 3N6XA 2UUAH 1Y1WG 3PN1A 3W1BA 4O3NA 4M7EA 1HR0H 5DQIA 3H40A 5DGIA 1P8LA 2JA7G 5LXTF 4O86A 4X62H 2RGRA 1DIKA 2C22A 4Q8EA 2HGXA 1RK6A 5FD6A 3UFXB 2J6SA 5FR9A 5JQGF 4G3IA 3OSPA 2V58A 1UNNC 3JZ6A 2JA6A 2W70A 4X64H 5KFGA 1JX4A 1ZHSA 5C3EG 3MFIA 3UQ8A 2R93G 3OTOH 3L4KA 1MZBA 3HOUG 2R8IA 1S0NA 3HOXG 2YW2A 3NGDA 2ZDGA 4J9QA 5JVDF 4F4YA 2FPIB 3PR4A 3MWMA 4JI7H 5BPFA 3ETJA 1N48A 4NYEA 4NZMA 5BWWA 4IR1A 5BYAA 1Z2NX 5CR5A 4FFNA 2YCHA 2XCPA 4JI0H 4DUZH 4IRCA 4RB2C 1M0TA 1FVIA 4FS2A 3LP8A 4CHIA 2J9GA 2NUAB 3WO0A 2FLLA 1GSHA 3G8CA 3HXLA 4PWQA 5EZYF 3TY5A 2FLNA 5KFHA 4CC5A 5KFMA 4DL2A 2XGQA 1L2ZA 2WTFA 2ASJA 2GPSA 3V4ZA 1TWCA 5I5YA 4JV2A 3T99A 4DV7H 4ED8A 5BWUA 4O3QA 2X0SA 4DR7H 5IP7G 5D1PA 1A0GA 4A3KG 3EYYA 3SE7A 1CKMA 5EOYA 5D1OA 1GSAA 4MV7A 4IR9A 4JXUA 3RUPA 2R7MA 5LYJF 1KJQA 1CKNA 2CNQA 2WAQE 4ED2A 3PVXA 1J5EH 2JEGA 5DG8A 4CKBA 1I6UA 1V4YA 5BMVF 1CQJB 1PK8A 4EYIB 1S97A 1N32H 3VNNA 4EFBA 1ET0A 3NBYB 4O7RA 4RB3C 3M9OB 4MV3A 3QFFA 3R5HA 2HG8A 4AYBE 4U7CA 4RCNA 2DPIA 3N41B 2AGOA 4HR7A 1FKAH 2C2RA 4J9PA 2V9WA 4A2AA 2CW7A 1Z2PX 3G8DA 5KFWA 4JI3H 4O84A 3WWIA 4B3TH 1KJ8A 3N40P 3OHAA 1I2LA 4O7ZA 4UCOA 5E25A 4RAYA 2RDJA 5CM0A 4I55F 5KFDA 1N34H 4F4XA 4HN2A 4IZOA 4MV1A 1SEIA 4DR3H 1JLLB 1V51A 4LF4H 5CE8A 4PZ7A 3N42B 4WD3A 4JI8H 1O75A 4LFAH 3GTMA 5F9LA 2CNVA 4EGQA 2Q2UA 3KXYT 3T5LA 2YRXA 1KUTA 3RB4A 4YR2A 4WBNF 4FBUA 3RIZA 4ED1A 5EWEA 3BACA 3MR3A 4E6NA 3KAJA 2FK1A 2VQFH 4LFCH 1XMQH 5DG7A 1B33N 5IYDG 3QQMA 2AGPA 2KSWA 3PZPA 2VA2A 4LH7A 5BWXA 2RF4A 4R7RA 3W5OA 2B63A 3GB8B 2I8CA 2HHHH 2B63G 5F9NA 1I50A 4ECUA 2ALZA 2R8KA 1KT8A 4GLXA 2XCAA 1CE8A 3MR5A 4CC6A 2M05A 4A3BG 5IYBG 2GQSA 5J2UF 4UCSA 2Q2TA 2VA3A 1ULZA 3GTOA 1KJ9A 5K2MA 4I4TF 3GIDA 4ZQIA 3QZ8A 3MJFA 3SGIA 4J9KA 3RGXA 3T54A 3Q8PB 2NU7B 4Q4DA 4Q44A 2XC9A 4RAZA 4ECZA 1BXRA 5KG7A 5JQWA 1DGSA 3R5XA 2HVSA 4O4LF 2HDKA 3H4DA 3NBZB 5EWGA 3V4SA 4A3FG 5BPHA 4ME6A 1I1MA 4Q8FA 3N43B 4DV0H 2V4QA 3T9DA 4O3SA 5KFNA 5KFBA 4IHJF 4DV5H 2COJA 4C2MA 5FLMG 5JVLA 2FK2A 2IP4A 4EBCA 5JH7F 1I7NA 4ECYA 5CA0F 3QWUA 2DIKA 3GDEA 2JEIA 4PZ8A 4HNVA 1JDEA 4RU9A 4DL3A 2HIXA 2R7LA 3BA8A 3K5HA 4EGJA 2DWCA 4Y8VB 3RB0A 3V6JA 2BR0A 2C2DA 4UCVA 3GIIA 5I5XA 4DV2H 3T5JA 3RR5A 2IA6A 1WRVA 4FBTA 1IBMH 4EEQA 2VUMG 3HOVG 3UYYA 3T1HH 3H20A 5I5TA 2VUMA 4YP3A 2Y4RA 2W57A 5A2QW 3K5IA 2FKLA 4I7HA 4DLKA 3TW7A 3Q2OA 3SNOA 3M4IA 5IP9G 1S10A 2DAAA 3HO8A 2R7KA 2NU8B 1HNWH 1K1SA 2YZGA 3GV5B 4QW8A 3JSNA 4A3EG 5KFEA 2ZGIA 3I4MG 2W6ZA 1EKPA 5KFAA 1KJIA 1ZQ7A 5KFQA 5DQGA 2ABJA 3HB9A 2HGSA 4RNOA 5KG5A 2R7ZG 1UC9A 2IMWP 2UVUA 2PBZA 3UZOA 3JRWA 1VKZA 3GV7B 4FE2A 3TINA 1DV1A 4FGRA 2VR1A 4O7TA 4O82A 4RUAA 3PFFA 4ZHQF 5FD5A 3GV8B 3MWDA 4EEYA 1E4EA 2R85A 2AQ4A 2EJ2A 4QWDA 3PW7A 4BY1G 4X66H 3QZ7A 1RYSA 1CKNB 3W1GA 4LFBH 1T36A 1IBLH 3G6YA 3RAQA 2GQRA 4A93G 2W8LA 2UVRA 2W8KA 1XDNA 3OUZA 5I5SA 5BWTA 1RJPA 4FS1A 4Q45A 1AUXA 5IWAH 2PN1A 4L1KA 4ECVA 4MA5A 1FJGH 2W71A 4B3SH 3GJXB 4CKCA 1T3NA 3FMAA 5KG0A 3E5NA 1B6SA 4RNMA 1I1LA 3VPCA 2E2IA 3TY8A 3HOWG 1B04A 2X5RA 1CKOA 2RDIA 4JV1A 4QWCA 1I94H 3JZFA 4O83A 4CMDA 2VUGA 2UUCH 2HJWA 1EUCB 1TAEA 5KG6A 5KT2A 4F50A 1B6RA 1S9FA 4BBSG 2VPQA 1CS0A 3GIKA 5CB4F 3LULA 4NXNH 1VBHA 3H0GG 3HOYG 1DV2A 3TIGA 3T9FA 2ATLA 2FLPA 5FPRA 3M9NB 4LH6A 1A9XA 1GSOA 4EBDA 2FMAA 2W7PA 1JKJB 2W6PA 1A0IA 3OSNA 3HOZG 4ECWA 1GYFA 2R7NA 3HBLA 1WR2A 4DV6H 3RBEA 5IYCG 4ED6A 2CW8A 4B3RH 1S03G 3CSWA 5HNEA 5I47A 1M7JA 1PX2A 1T94A 2Y0SE 3KHRA 4DL4A 3RAXA 1I1KA 3VMMA 4HYKA 4MA0A 3T5KA 4DL7A 4PBCA 3GQCA 3TQ1A 1R9TA 2WB1E 2JEJA 3BA9A 2I87A 4A3JG 4QJFA 3Q1KA 2UVWA 4JI2H 2Z02A 5JUMA 4DR1H 3DAAA 2JA6G 1WH2A 4QSHA 4NZOA 1TWAA 2W6MA 4O7YA 5I5VA 3BQ2A 4ECQA 3K3PA 1ZAUA 2EJ3A 2W6NA 4F4WA 3R9RA 2F4VH 1JDBB 2R7ZA 4MV4A 2QB5A 4DRFA 1VAJA 4A3CG 1IYDA 5DG9A 1EZ1A 2W9CA 2YYAA 3AX6A 4HNUA 5KFVA 2Q7DA 3F8NA 5DGBA 4GKJH 2QK4A 5KT4A 2WDTA 3BABA 1K1QA 3MFHA 4A3MG 2DLNA 2UXDH 4HQ6A 4DQNA 2CFMA 5KFJA 2GLTA 4ZI7F 4A2BA 4TQSA 1IOVA 3JSLA 3JZIA 4LF9H 5C1PA 1WSCA 3HT5A 5KT6A 3PW5A 4TM5A 2COIA 2PVPA 4YHHH 4YJ2F 5LOVF 3HKZE 1I2KA 2EIYA 2WAQA 4FM9A 1Y14B 3FKIG 1JIHA 3S24A 4IRKA 3FKIA 5I60A 4PDBA 2BQRA 2Z04A 5LP6F 1KBLA 5DAAA 4GC6A 4O7LA 1I3QA 2FB9A 5BYBA 5KKNB 4ED3A 3TIIA 2R93A 2YZMA 3PW4A 5BWRA 5KS8A 3GTLA 4J9NA 5KFKA 2JA5A 4BBRG 4JI5H 5DQHA 5KX5F 5KFPA 1WCMA 3T9BA 2ZDHA 1N36H 2J6UA 2E2HA 1C30A 2W6OA 5KG3A 2CZGA 5KFIA 4A3GG 5BWVA 3MWEA 1ZETA 4A3DG 2R87A 5KFFA 4NXMH 1BJTA 2IBKA 3G6XA 4YY3H 2J6TA 4XX0B 4MTDA 1XNRH 2GPWA 1Y1WA 3ORQA 2DABA 1AN7A 2BQ3A 1GO3E 1GLVA 3KTMA 4O7NA 3PR5B 3RB6A 3ORRA 2R84A 2YS6A 5KT3A 5J2TF 3V6HA 2P0AA 4U6PA 4BXXG 3DTFA 4J9MA 1DAAA 5KFSA 4R8UB 2HGWA 4TV8F 3RBDA 1Y1VG 2XCLA 5FJ8G 3BAAA 4K6NA 4DIMA 4EQ5A 4EBEA 2DZDA 3WWJA 2RGVA 2WE6A 1N33H 4C5BA 4FU0A 2HHFB 5KFZA 4AYBA 5DLFA 3MR6A 3KHLA 1OBDA 3RTXA 3MR2A 2VOBA 4RB0A 5LA6F 2PMZA 5L1JA 2VPSA 3IN5A 1SFOA 1BNCA 4DAAA 3TY9A 4ECTA 1M0WA 3BJYA 4QW9A 1XMOH 5KFOA 3N8DA 3DF7A 1E4FT 1HNZH 4LF7H 2PMZE 2NU6B 2ODTX 5H80A 1AUVA 4OX9H 3WO1A 4O4HF 5DGHA 4IIJF 4YB8B 5C5JA 3JRXA 5L1KA 2OLSA 2VQEH 2YU9A 2YWVA 2SCUB 3C0FB 1TWGA 5T14A 3RV4A 3Q8QB 2V4RA 2ASLA 1S0OA 2UUBH 1KJJA 4XZ3B 2YL2A 3T1YH 4EYHB 4GKKH 4UCRA 4DR2H 2R82A 4FFOA 4FFMA 5C4XG 4XYLB 4MV6A 4RZQA 2YZLA 4M0JA 4DR4H 4F4ZA 3JAMW 3VPBA 5FLXW 3M9MB 1GGOA 1RJRA 2FK3A 2W7OA 1VS0A 2UVVA 3UZBA 3R5FA 3WNZA 1Y1VA 4APMA 4K0KH 4I50F 5I5WA 4HNTA 5L1LA 2DPJA 1EKVA 3DTGA 2FP4B 4FFRA 4DV1H 4O4IF 4NZNA 4J9SA 2R92G 3H3VH 2HVQA 4C5CA 2C35B 4UCUA 1XK5A 2C28A 5IT9W 1IYEA 3ETHA 3NUAA 4O7WA 4TVIA 4JV0A 4M9UA 2CQYA 5I5UA 2C00A 2A1HA 5L1IA 4JUZA 3NC0B 1W96A 4GLWA 2MCTA 1EHIA 3GIQA 5KG2A 3OHBA 2R8HA 1KEEA 3U55A 3KALA 4CKEA 4UCTA 2R6FA 2CKZB 3T9CA 3GLKA 3LWBA 2ZJTA 4KHPH 3RB3A 4QWAA 1ZHQA 1S68A 4IWYA 4J9LA 5DGAA 4LSAA 2E5LH 4LF5H 5C8YF 4DR6H 3TQTA 3GIPA 5KT7A 5KG4A 4PZ6A 5IYZF 4YR0A 3KHGA 1S0MA 2JA8G 3KHHA 4Q0YA 5LL6b 5L9XA 2C2EA 2ZDQA 1X9NA 4LF8H 1KC7A 1EUDB 4MAMA 3RV3A 1OBGA 4O7VA 5KG1A 2XIGA 3L2PA 4BWSC 3GTGA 5KFRA 4YQWA 5BR8H 3V6KA 2W9CB 1M6VA 4ZOLF 3N6RA 1CQIB 4CE5A 5KFLA 5DLGA 1P16A 4RNNA 3WWHA 2W9AA 2FE3A 4EG0A 4JV5H 4O81A 2YZNA 4ECRA 2V59A 4DL6A 2ASDA 3H4BA 3GTKA 2JA5G 4J0MA 3GIJA 4J9RA 3PW2A 4QIWE 5D8DA 2HVRA 1E4EB 3U9TA 3GTPA 4WHXA 1KTAA 2WB1A 3GTJA 1JXLA 4J9OA 5KFYA 1UC8A 4IWXA 4CMFA 3J7AK 4YBZB 4O3OA 3TEKA 2UXBH 2YS7A 3H0GA 4DV4H 3BQ0A 2FPGB 1TWHA 3T9EA 3K3VA 5FNVF 3HKZA 4QWEA 4O2BF 3GILA 4NLGA 4UUGA 5HBRB 3RGZA 2R86A 3U54A 3AW8A 3G6VA 4MV8A 3CQZA 4LMYA 1RJQA 4MV9A 2NVYA 2FPPB 2ZM6H 3LQSA 5CAEB 3KREA 4ED7A 1IBKH 2UXCH 2W6QA 5DMXA 3T7AA 1EYZA 2JA7A 4RZRA 3T5HA 3OUUA 1XNQH 4DL5A 4LSXA 4DR5H 4A3IG 2W9BB 5EDWA 3VOTA 4MTEA 4X65H 4O3RA 3RF2A 4LF6H 5C44G 4A3LG 3GIMA 5K3WA 1A48A 3CEBA 3U0GA 3KYHC 1TWFA 2HIVA 4IAJA 3PW0A 5GONF 3AYHB 2NU9B 4B3MH 3J80W 4GC7A 1RK5A 3VPDA 4Q4CA 3PO3G 3BQ1A 1RYRA 3PO2G 1V9PA 2NVXA 3J81W 2FJZA 2XGPA 2O03A 1SYXB 4TQRA 2UU9H 4JYAH 4TUYF 4O3PA 3I12A 3FDSA 2OWOA 5EWFA 4DUYH 4JI4H 1I7LA 3GTQA 2W9BA 4FFPA 2COGA 3R23A 1E4GT 3Q8SB 1VBGA 4JI6H 1SCUB 4E4TA 5KFCA 1G2WA 3BG5A 2HHFA 4Q43A 3TW6A 1BGWA 2VQDA 4BY7G 2JEFA 4UFZA 3KAKA 4YAKB 5KFXA 2V5AA 2QF7A 3IG0A 4O2AF 4O4JF 2WYOA 1W93A 4R8UA 3VA7A 1A3GA
chains in the Genus database with same CATH topology
2XD4A 1C3OA 1IOWA 4XYMB 3U9SA 3RFCA 4TV9F 1Z2OX 4O7SA 5CA1F 4FFLA 4C5AA 2I80A 5C1OA 5HV6A 4YAJB 2YRWA 4YJ3F 2CNUA 5LXTF 4O86A 1DIKA 3UFXB 5JQGF 2V58A 2W70A 2YW2A 2ZDGA 5JVDF 2FPIB 5BPFA 3ETJA 4NYEA 1Z2NX 4FFNA 1M0TA 3LP8A 2J9GA 2NUAB 3WO0A 1GSHA 3G8CA 5EZYF 2GPSA 3V4ZA 2X0SA 3SE7A 1GSAA 4MV7A 3RUPA 2R7MA 5LYJF 2WYOA 1KJQA 2CNQA 5BMVF 1CQJB 1PK8A 4O7RA 4MV3A 3QFFA 3R5HA 4HR7A 1Z2PX 3G8DA 4O84A 1KJ8A 4O7ZA 4I55F 4IZOA 4MV1A 1JLLB 4WD3A 4EGQA 2CNVA 2YRXA 1KUTA 4WBNF 3KAJA 2I8CA 1CE8A 2GQSA 5J2UF 1ULZA 1KJ9A 5K2MA 4I4TF 3GIDA 3MJFA 2NU7B 1BXRA 5JQWA 3R5XA 4O4LF 3V4SA 5BPHA 4ME6A 4IHJF 5JVLA 2IP4A 5JH7F 1I7NA 5CA0F 2DIKA 4HNVA 1JDEA 2R7LA 3K5HA 4EGJA 2DWCA 4Y8VB 3K5IA 4DLKA 3Q2OA 3HO8A 2NU8B 2R7KA 2YZGA 2W6ZA 1KJIA 3HB9A 2HGSA 1UC9A 2PBZA 3JRWA 1VKZA 4FE2A 3TINA 1DV1A 4FGRA 2VR1A 4O7TA 4O82A 4ZHQF 3MWDA 1E4EA 2R85A 1T36A 2GQRA 3OUZA 1AUXA 2PN1A 4L1KA 4MA5A 2W71A 3E5NA 1B6SA 3VPCA 3JZFA 4O83A 2HJWA 1EUCB 1B6RA 2VPQA 1CS0A 5CB4F 1VBHA 1DV2A 3TIGA 1A9XA 1GSOA 1JKJB 2W6PA 2R7NA 3HBLA 1WR2A 5I47A 1PX2A 3VMMA 4MA0A 2I87A 3Q1KA 2Z02A 4QSHA 2W6MA 4O7YA 3K3PA 2W6NA 3R9RA 1JDBB 4MV4A 1EZ1A 2YYAA 3AX6A 4HNUA 2QK4A 2DLNA 4HQ6A 2GLTA 4ZI7F 1IOVA 3JZIA 5C1PA 2PVPA 4YJ2F 5LOVF 2Z04A 5LP6F 1KBLA 4O7LA 2FB9A 5KKNB 3TIIA 2YZMA 5KX5F 2ZDHA 1C30A 2W6OA 2CZGA 3MWEA 2R87A 4XX0B 2GPWA 3ORQA 1GLVA 4O7NA 3ORRA 2R84A 2YS6A 5J2TF 2P0AA 4TV8F 2XCLA 4DIMA 2DZDA 4C5BA 4FU0A 1OBDA 5LA6F 1BNCA 1M0WA 3N8DA 3DF7A 2NU6B 5H80A 1AUVA 3WO1A 4O4HF 4IIJF 4YB8B 3JRXA 2OLSA 2YWVA 2SCUB 3RV4A 1KJJA 4XZ3B 2YL2A 2R82A 4FFOA 4FFMA 4XYLB 4MV6A 4RZQA 2YZLA 3VPBA 1GGOA 3R5FA 3WNZA 4I50F 4HNTA 4FFRA 2FP4B 4O4IF 4C5CA 3ETHA 3NUAA 4O7WA 4M9UA 2CQYA 2C00A 1W96A 1EHIA 1KEEA 3U55A 3KALA 2R6FA 3GLKA 3LWBA 4IWYA 5C8YF 3TQTA 5IYZF 2ZDQA 1KC7A 1EUDB 4MAMA 3RV3A 1OBGA 4O7VA 1M6VA 4ZOLF 3N6RA 1CQIB 4EG0A 4O81A 2YZNA 2V59A 5D8DA 1E4EB 3U9TA 1UC8A 4IWXA 4YBZB 2YS7A 2FPGB 5FNVF 4O2BF 5HBRB 2R86A 3U54A 3AW8A 4MV8A 4MV9A 2FPPB 5CAEB 3KREA 2W6QA 5DMXA 1EYZA 3OUUA 3VOTA 1A48A 5GONF 2NU9B 3VPDA 4TUYF 3I12A 1I7LA 4FFPA 3R23A 1VBGA 1SCUB 4E4TA 3BG5A 3TW6A 2VQDA 4YAKB 3KAKA 2V5AA 2QF7A 4O2AF 4O4JF 4ZQIA 1W93A 3VA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD4 A;  1C3O A;  1IOW A;  4XYM B;  3U9S A;  3RFC A;  4TV9 F;  1Z2O X;  4O7S A;  5CA1 F;  4FFL A;  4C5A A;  2I80 A;  5C1O A;  5HV6 A;  4YAJ B;  2YRW A;  4YJ3 F;  2CNU A;  5LXT F;  4O86 A;  1DIK A;  3UFX B;  5JQG F;  2V58 A;  2W70 A;  2YW2 A;  2ZDG A;  5JVD F;  2FPI B;  5BPF A;  3ETJ A;  4NYE A;  1Z2N X;  4FFN A;  1M0T A;  3LP8 A;  2J9G A;  2NUA B;  3WO0 A;  1GSH A;  3G8C A;  5EZY F;  2GPS A;  3V4Z A;  2X0S A;  3SE7 A;  1GSA A;  4MV7 A;  3RUP A;  2R7M A;  5LYJ F;  2WYO A;  1KJQ A;  2CNQ A;  5BMV F;  1CQJ B;  1PK8 A;  4O7R A;  4MV3 A;  3QFF A;  3R5H A;  4HR7 A;  1Z2P X;  3G8D A;  4O84 A;  1KJ8 A;  4O7Z A;  4I55 F;  4IZO A;  4MV1 A;  1JLL B;  4WD3 A;  4EGQ A;  2CNV A;  2YRX A;  1KUT A;  4WBN F;  3KAJ A;  2I8C A;  1CE8 A;  2GQS A;  5J2U F;  1ULZ A;  1KJ9 A;  5K2M A;  4I4T F;  3GID A;  3MJF A;  2NU7 B;  1BXR A;  5JQW A;  3R5X A;  4O4L F;  3V4S A;  5BPH A;  4ME6 A;  4IHJ F;  5JVL A;  2IP4 A;  5JH7 F;  1I7N A;  5CA0 F;  2DIK A;  4HNV A;  1JDE A;  2R7L A;  3K5H A;  4EGJ A;  2DWC A;  4Y8V B;  3K5I A;  4DLK A;  3Q2O A;  3HO8 A;  2NU8 B;  2R7K A;  2YZG A;  2W6Z A;  1KJI A;  3HB9 A;  2HGS A;  1UC9 A;  2PBZ A;  3JRW A;  1VKZ A;  4FE2 A;  3TIN A;  1DV1 A;  4FGR A;  2VR1 A;  4O7T A;  4O82 A;  4ZHQ F;  3MWD A;  1E4E A;  2R85 A;  1T36 A;  2GQR A;  3OUZ A;  1AUX A;  2PN1 A;  4L1K A;  4MA5 A;  2W71 A;  3E5N A;  1B6S A;  3VPC A;  3JZF A;  4O83 A;  2HJW A;  1EUC B;  1B6R A;  2VPQ A;  1CS0 A;  5CB4 F;  1VBH A;  1DV2 A;  3TIG A;  1A9X A;  1GSO A;  1JKJ B;  2W6P A;  2R7N A;  3HBL A;  1WR2 A;  5I47 A;  1PX2 A;  3VMM A;  4MA0 A;  2I87 A;  3Q1K A;  2Z02 A;  4QSH A;  2W6M A;  4O7Y A;  3K3P A;  2W6N A;  3R9R A;  1JDB B;  4MV4 A;  1EZ1 A;  2YYA A;  3AX6 A;  4HNU A;  2QK4 A;  2DLN A;  4HQ6 A;  2GLT A;  4ZI7 F;  1IOV A;  3JZI A;  5C1P A;  2PVP A;  4YJ2 F;  5LOV F;  2Z04 A;  5LP6 F;  1KBL A;  4O7L A;  2FB9 A;  5KKN B;  3TII A;  2YZM A;  5KX5 F;  2ZDH A;  1C30 A;  2W6O A;  2CZG A;  3MWE A;  2R87 A;  4XX0 B;  2GPW A;  3ORQ A;  1GLV A;  4O7N A;  3ORR A;  2R84 A;  2YS6 A;  5J2T F;  2P0A A;  4TV8 F;  2XCL A;  4DIM A;  2DZD A;  4C5B A;  4FU0 A;  1OBD A;  5LA6 F;  1BNC A;  1M0W A;  3N8D A;  3DF7 A;  2NU6 B;  5H80 A;  1AUV A;  3WO1 A;  4O4H F;  4IIJ F;  4YB8 B;  3JRX A;  2OLS A;  2YWV A;  2SCU B;  3RV4 A;  1KJJ A;  4XZ3 B;  2YL2 A;  2R82 A;  4FFO A;  4FFM A;  4XYL B;  4MV6 A;  4RZQ A;  2YZL A;  3VPB A;  1GGO A;  3R5F A;  3WNZ A;  4I50 F;  4HNT A;  4FFR A;  2FP4 B;  4O4I F;  4C5C A;  3ETH A;  3NUA A;  4O7W A;  4M9U A;  2CQY A;  2C00 A;  1W96 A;  1EHI A;  1KEE A;  3U55 A;  3KAL A;  2R6F A;  3GLK A;  3LWB A;  4IWY A;  5C8Y F;  3TQT A;  5IYZ F;  2ZDQ A;  1KC7 A;  1EUD B;  4MAM A;  3RV3 A;  1OBG A;  4O7V A;  1M6V A;  4ZOL F;  3N6R A;  1CQI B;  4EG0 A;  4O81 A;  2YZN A;  2V59 A;  5D8D A;  1E4E B;  3U9T A;  1UC8 A;  4IWX A;  4YBZ B;  2YS7 A;  2FPG B;  5FNV F;  4O2B F;  5HBR B;  2R86 A;  3U54 A;  3AW8 A;  4MV8 A;  4MV9 A;  2FPP B;  5CAE B;  3KRE A;  2W6Q A;  5DMX A;  1EYZ A;  3OUU A;  3VOT A;  1A48 A;  5GON F;  2NU9 B;  3VPD A;  4TUY F;  3I12 A;  1I7L A;  4FFP A;  3R23 A;  1VBG A;  1SCU B;  4E4T A;  3BG5 A;  3TW6 A;  2VQD A;  4YAK B;  3KAK A;  2V5A A;  2QF7 A;  4O2A F;  4O4J F;  4ZQI A;  1W93 A;  3VA7 A; 
#chains in the Genus database with same CATH topology
 1HNX H;  2XD4 A;  3T9A A;  4EFE A;  3CVZ A;  5KT5 A;  1C3O A;  1IOW A;  4XYM B;  3EPI A;  3L4J A;  3U9S A;  2QYZ A;  3RFC A;  4QWB A;  1OWT A;  5KFT A;  2BQU A;  2R92 A;  3EPG A;  4TV9 F;  1TA8 A;  1Z2O X;  1K83 A;  4O7S A;  4RUC A;  1N56 A;  5CA1 F;  2R8G A;  5KFU A;  3Q8R B;  4ETS A;  2AU0 A;  5D1O B;  4AQY H;  1WCM G;  4FFL A;  4ECS A;  3SI8 A;  2AGQ A;  5LMN H;  4JI1 H;  5DIS C;  3N44 B;  4DV3 H;  4C5A A;  4QIW A;  2I80 A;  4ED0 A;  3I4N G;  5C1O A;  5HV6 A;  5LMU H;  4YAJ B;  2YRW A;  1EKF A;  2Y0S A;  2R8J A;  4IRD A;  2EJ0 A;  4YJ3 F;  4RB1 A;  4YR3 A;  4ECX A;  2CNU A;  3LML A;  5FPO A;  3RJ0 A;  2OH2 A;  3N6X A;  2UUA H;  1Y1W G;  3PN1 A;  3W1B A;  4O3N A;  4M7E A;  1HR0 H;  5DQI A;  3H40 A;  5DGI A;  1P8L A;  2JA7 G;  5LXT F;  4O86 A;  4X62 H;  2RGR A;  1DIK A;  2C22 A;  4Q8E A;  2HGX A;  1RK6 A;  5FD6 A;  3UFX B;  2J6S A;  5FR9 A;  5JQG F;  4G3I A;  3OSP A;  2V58 A;  1UNN C;  3JZ6 A;  2JA6 A;  2W70 A;  4X64 H;  5KFG A;  1JX4 A;  1ZHS A;  5C3E G;  3MFI A;  3UQ8 A;  2R93 G;  3OTO H;  3L4K A;  1MZB A;  3HOU G;  2R8I A;  1S0N A;  3HOX G;  2YW2 A;  3NGD A;  2ZDG A;  4J9Q A;  5JVD F;  4F4Y A;  2FPI B;  3PR4 A;  3MWM A;  4JI7 H;  5BPF A;  3ETJ A;  1N48 A;  4NYE A;  4NZM A;  5BWW A;  4IR1 A;  5BYA A;  1Z2N X;  5CR5 A;  4FFN A;  2YCH A;  2XCP A;  4JI0 H;  4DUZ H;  4IRC A;  4RB2 C;  1M0T A;  1FVI A;  4FS2 A;  3LP8 A;  4CHI A;  2J9G A;  2NUA B;  3WO0 A;  2FLL A;  1GSH A;  3G8C A;  3HXL A;  4PWQ A;  5EZY F;  3TY5 A;  2FLN A;  5KFH A;  4CC5 A;  5KFM A;  4DL2 A;  2XGQ A;  1L2Z A;  2WTF A;  2ASJ A;  2GPS A;  3V4Z A;  1TWC A;  5I5Y A;  4JV2 A;  3T99 A;  4DV7 H;  4ED8 A;  5BWU A;  4O3Q A;  2X0S A;  4DR7 H;  5IP7 G;  5D1P A;  1A0G A;  4A3K G;  3EYY A;  3SE7 A;  1CKM A;  5EOY A;  5D1O A;  1GSA A;  4MV7 A;  4IR9 A;  4JXU A;  3RUP A;  2R7M A;  5LYJ F;  1KJQ A;  1CKN A;  2CNQ A;  2WAQ E;  4ED2 A;  3PVX A;  1J5E H;  2JEG A;  5DG8 A;  4CKB A;  1I6U A;  1V4Y A;  5BMV F;  1CQJ B;  1PK8 A;  4EYI B;  1S97 A;  1N32 H;  3VNN A;  4EFB A;  1ET0 A;  3NBY B;  4O7R A;  4RB3 C;  3M9O B;  4MV3 A;  3QFF A;  3R5H A;  2HG8 A;  4AYB E;  4U7C A;  4RCN A;  2DPI A;  3N41 B;  2AGO A;  4HR7 A;  1FKA H;  2C2R A;  4J9P A;  2V9W A;  4A2A A;  2CW7 A;  1Z2P X;  3G8D A;  5KFW A;  4JI3 H;  4O84 A;  3WWI A;  4B3T H;  1KJ8 A;  3N40 P;  3OHA A;  1I2L A;  4O7Z A;  4UCO A;  5E25 A;  4RAY A;  2RDJ A;  5CM0 A;  4I55 F;  5KFD A;  1N34 H;  4F4X A;  4HN2 A;  4IZO A;  4MV1 A;  1SEI A;  4DR3 H;  1JLL B;  1V51 A;  4LF4 H;  5CE8 A;  4PZ7 A;  3N42 B;  4WD3 A;  4JI8 H;  1O75 A;  4LFA H;  3GTM A;  5F9L A;  2CNV A;  4EGQ A;  2Q2U A;  3KXY T;  3T5L A;  2YRX A;  1KUT A;  3RB4 A;  4YR2 A;  4WBN F;  4FBU A;  3RIZ A;  4ED1 A;  5EWE A;  3BAC A;  3MR3 A;  4E6N A;  3KAJ A;  2FK1 A;  2VQF H;  4LFC H;  1XMQ H;  5DG7 A;  1B33 N;  5IYD G;  3QQM A;  2AGP A;  2KSW A;  3PZP A;  2VA2 A;  4LH7 A;  5BWX A;  2RF4 A;  4R7R A;  3W5O A;  2B63 A;  3GB8 B;  2I8C A;  2HHH H;  2B63 G;  5F9N A;  1I50 A;  4ECU A;  2ALZ A;  2R8K A;  1KT8 A;  4GLX A;  2XCA A;  1CE8 A;  3MR5 A;  4CC6 A;  2M05 A;  4A3B G;  5IYB G;  2GQS A;  5J2U F;  4UCS A;  2Q2T A;  2VA3 A;  1ULZ A;  3GTO A;  1KJ9 A;  5K2M A;  4I4T F;  3GID A;  4ZQI A;  3QZ8 A;  3MJF A;  3SGI A;  4J9K A;  3RGX A;  3T54 A;  3Q8P B;  2NU7 B;  4Q4D A;  4Q44 A;  2XC9 A;  4RAZ A;  4ECZ A;  1BXR A;  5KG7 A;  5JQW A;  1DGS A;  3R5X A;  2HVS A;  4O4L F;  2HDK A;  3H4D A;  3NBZ B;  5EWG A;  3V4S A;  4A3F G;  5BPH A;  4ME6 A;  1I1M A;  4Q8F A;  3N43 B;  4DV0 H;  2V4Q A;  3T9D A;  4O3S A;  5KFN A;  5KFB A;  4IHJ F;  4DV5 H;  2COJ A;  4C2M A;  5FLM G;  5JVL A;  2FK2 A;  2IP4 A;  4EBC A;  5JH7 F;  1I7N A;  4ECY A;  5CA0 F;  3QWU A;  2DIK A;  3GDE A;  2JEI A;  4PZ8 A;  4HNV A;  1JDE A;  4RU9 A;  4DL3 A;  2HIX A;  2R7L A;  3BA8 A;  3K5H A;  4EGJ A;  2DWC A;  4Y8V B;  3RB0 A;  3V6J A;  2BR0 A;  2C2D A;  4UCV A;  3GII A;  5I5X A;  4DV2 H;  3T5J A;  3RR5 A;  2IA6 A;  1WRV A;  4FBT A;  1IBM H;  4EEQ A;  2VUM G;  3HOV G;  3UYY A;  3T1H H;  3H20 A;  5I5T A;  2VUM A;  4YP3 A;  2Y4R A;  2W57 A;  5A2Q W;  3K5I A;  2FKL A;  4I7H A;  4DLK A;  3TW7 A;  3Q2O A;  3SNO A;  3M4I A;  5IP9 G;  1S10 A;  2DAA A;  3HO8 A;  2R7K A;  2NU8 B;  1HNW H;  1K1S A;  2YZG A;  3GV5 B;  4QW8 A;  3JSN A;  4A3E G;  5KFE A;  2ZGI A;  3I4M G;  2W6Z A;  1EKP A;  5KFA A;  1KJI A;  1ZQ7 A;  5KFQ A;  5DQG A;  2ABJ A;  3HB9 A;  2HGS A;  4RNO A;  5KG5 A;  2R7Z G;  1UC9 A;  2IMW P;  2UVU A;  2PBZ A;  3UZO A;  3JRW A;  1VKZ A;  3GV7 B;  4FE2 A;  3TIN A;  1DV1 A;  4FGR A;  2VR1 A;  4O7T A;  4O82 A;  4RUA A;  3PFF A;  4ZHQ F;  5FD5 A;  3GV8 B;  3MWD A;  4EEY A;  1E4E A;  2R85 A;  2AQ4 A;  2EJ2 A;  4QWD A;  3PW7 A;  4BY1 G;  4X66 H;  3QZ7 A;  1RYS A;  1CKN B;  3W1G A;  4LFB H;  1T36 A;  1IBL H;  3G6Y A;  3RAQ A;  2GQR A;  4A93 G;  2W8L A;  2UVR A;  2W8K A;  1XDN A;  3OUZ A;  5I5S A;  5BWT A;  1RJP A;  4FS1 A;  4Q45 A;  1AUX A;  5IWA H;  2PN1 A;  4L1K A;  4ECV A;  4MA5 A;  1FJG H;  2W71 A;  4B3S H;  3GJX B;  4CKC A;  1T3N A;  3FMA A;  5KG0 A;  3E5N A;  1B6S A;  4RNM A;  1I1L A;  3VPC A;  2E2I A;  3TY8 A;  3HOW G;  1B04 A;  2X5R A;  1CKO A;  2RDI A;  4JV1 A;  4QWC A;  1I94 H;  3JZF A;  4O83 A;  4CMD A;  2VUG A;  2UUC H;  2HJW A;  1EUC B;  1TAE A;  5KG6 A;  5KT2 A;  4F50 A;  1B6R A;  1S9F A;  4BBS G;  2VPQ A;  1CS0 A;  3GIK A;  5CB4 F;  3LUL A;  4NXN H;  1VBH A;  3H0G G;  3HOY G;  1DV2 A;  3TIG A;  3T9F A;  2ATL A;  2FLP A;  5FPR A;  3M9N B;  4LH6 A;  1A9X A;  1GSO A;  4EBD A;  2FMA A;  2W7P A;  1JKJ B;  2W6P A;  1A0I A;  3OSN A;  3HOZ G;  4ECW A;  1GYF A;  2R7N A;  3HBL A;  1WR2 A;  4DV6 H;  3RBE A;  5IYC G;  4ED6 A;  2CW8 A;  4B3R H;  1S03 G;  3CSW A;  5HNE A;  5I47 A;  1M7J A;  1PX2 A;  1T94 A;  2Y0S E;  3KHR A;  4DL4 A;  3RAX A;  1I1K A;  3VMM A;  4HYK A;  4MA0 A;  3T5K A;  4DL7 A;  4PBC A;  3GQC A;  3TQ1 A;  1R9T A;  2WB1 E;  2JEJ A;  3BA9 A;  2I87 A;  4A3J G;  4QJF A;  3Q1K A;  2UVW A;  4JI2 H;  2Z02 A;  5JUM A;  4DR1 H;  3DAA A;  2JA6 G;  1WH2 A;  4QSH A;  4NZO A;  1TWA A;  2W6M A;  4O7Y A;  5I5V A;  3BQ2 A;  4ECQ A;  3K3P A;  1ZAU A;  2EJ3 A;  2W6N A;  4F4W A;  3R9R A;  2F4V H;  1JDB B;  2R7Z A;  4MV4 A;  2QB5 A;  4DRF A;  1VAJ A;  4A3C G;  1IYD A;  5DG9 A;  1EZ1 A;  2W9C A;  2YYA A;  3AX6 A;  4HNU A;  5KFV A;  2Q7D A;  3F8N A;  5DGB A;  4GKJ H;  2QK4 A;  5KT4 A;  2WDT A;  3BAB A;  1K1Q A;  3MFH A;  4A3M G;  2DLN A;  2UXD H;  4HQ6 A;  4DQN A;  2CFM A;  5KFJ A;  2GLT A;  4ZI7 F;  4A2B A;  4TQS A;  1IOV A;  3JSL A;  3JZI A;  4LF9 H;  5C1P A;  1WSC A;  3HT5 A;  5KT6 A;  3PW5 A;  4TM5 A;  2COI A;  2PVP A;  4YHH H;  4YJ2 F;  5LOV F;  3HKZ E;  1I2K A;  2EIY A;  2WAQ A;  4FM9 A;  1Y14 B;  3FKI G;  1JIH A;  3S24 A;  4IRK A;  3FKI A;  5I60 A;  4PDB A;  2BQR A;  2Z04 A;  5LP6 F;  1KBL A;  5DAA A;  4GC6 A;  4O7L A;  1I3Q A;  2FB9 A;  5BYB A;  5KKN B;  4ED3 A;  3TII A;  2R93 A;  2YZM A;  3PW4 A;  5BWR A;  5KS8 A;  3GTL A;  4J9N A;  5KFK A;  2JA5 A;  4BBR G;  4JI5 H;  5DQH A;  5KX5 F;  5KFP A;  1WCM A;  3T9B A;  2ZDH A;  1N36 H;  2J6U A;  2E2H A;  1C30 A;  2W6O A;  5KG3 A;  2CZG A;  5KFI A;  4A3G G;  5BWV A;  3MWE A;  1ZET A;  4A3D G;  2R87 A;  5KFF A;  4NXM H;  1BJT A;  2IBK A;  3G6X A;  4YY3 H;  2J6T A;  4XX0 B;  4MTD A;  1XNR H;  2GPW A;  1Y1W A;  3ORQ A;  2DAB A;  1AN7 A;  2BQ3 A;  1GO3 E;  1GLV A;  3KTM A;  4O7N A;  3PR5 B;  3RB6 A;  3ORR A;  2R84 A;  2YS6 A;  5KT3 A;  5J2T F;  3V6H A;  2P0A A;  4U6P A;  4BXX G;  3DTF A;  4J9M A;  1DAA A;  5KFS A;  4R8U B;  2HGW A;  4TV8 F;  3RBD A;  1Y1V G;  2XCL A;  5FJ8 G;  3BAA A;  4K6N A;  4DIM A;  4EQ5 A;  4EBE A;  2DZD A;  3WWJ A;  2RGV A;  2WE6 A;  1N33 H;  4C5B A;  4FU0 A;  2HHF B;  5KFZ A;  4AYB A;  5DLF A;  3MR6 A;  3KHL A;  1OBD A;  3RTX A;  3MR2 A;  2VOB A;  4RB0 A;  5LA6 F;  2PMZ A;  5L1J A;  2VPS A;  3IN5 A;  1SFO A;  1BNC A;  4DAA A;  3TY9 A;  4ECT A;  1M0W A;  3BJY A;  4QW9 A;  1XMO H;  5KFO A;  3N8D A;  3DF7 A;  1E4F T;  1HNZ H;  4LF7 H;  2PMZ E;  2NU6 B;  2ODT X;  5H80 A;  1AUV A;  4OX9 H;  3WO1 A;  4O4H F;  5DGH A;  4IIJ F;  4YB8 B;  5C5J A;  3JRX A;  5L1K A;  2OLS A;  2VQE H;  2YU9 A;  2YWV A;  2SCU B;  3C0F B;  1TWG A;  5T14 A;  3RV4 A;  3Q8Q B;  2V4R A;  2ASL A;  1S0O A;  2UUB H;  1KJJ A;  4XZ3 B;  2YL2 A;  3T1Y H;  4EYH B;  4GKK H;  4UCR A;  4DR2 H;  2R82 A;  4FFO A;  4FFM A;  5C4X G;  4XYL B;  4MV6 A;  4RZQ A;  2YZL A;  4M0J A;  4DR4 H;  4F4Z A;  3JAM W;  3VPB A;  5FLX W;  3M9M B;  1GGO A;  1RJR A;  2FK3 A;  2W7O A;  1VS0 A;  2UVV A;  3UZB A;  3R5F A;  3WNZ A;  1Y1V A;  4APM A;  4K0K H;  4I50 F;  5I5W A;  4HNT A;  5L1L A;  2DPJ A;  1EKV A;  3DTG A;  2FP4 B;  4FFR A;  4DV1 H;  4O4I F;  4NZN A;  4J9S A;  2R92 G;  3H3V H;  2HVQ A;  4C5C A;  2C35 B;  4UCU A;  1XK5 A;  2C28 A;  5IT9 W;  1IYE A;  3ETH A;  3NUA A;  4O7W A;  4TVI A;  4JV0 A;  4M9U A;  2CQY A;  5I5U A;  2C00 A;  2A1H A;  5L1I A;  4JUZ A;  3NC0 B;  1W96 A;  4GLW A;  2MCT A;  1EHI A;  3GIQ A;  5KG2 A;  3OHB A;  2R8H A;  1KEE A;  3U55 A;  3KAL A;  4CKE A;  4UCT A;  2R6F A;  2CKZ B;  3T9C A;  3GLK A;  3LWB A;  2ZJT A;  4KHP H;  3RB3 A;  4QWA A;  1ZHQ A;  1S68 A;  4IWY A;  4J9L A;  5DGA A;  4LSA A;  2E5L H;  4LF5 H;  5C8Y F;  4DR6 H;  3TQT A;  3GIP A;  5KT7 A;  5KG4 A;  4PZ6 A;  5IYZ F;  4YR0 A;  3KHG A;  1S0M A;  2JA8 G;  3KHH A;  4Q0Y A;  5LL6 b;  5L9X A;  2C2E A;  2ZDQ A;  1X9N A;  4LF8 H;  1KC7 A;  1EUD B;  4MAM A;  3RV3 A;  1OBG A;  4O7V A;  5KG1 A;  2XIG A;  3L2P A;  4BWS C;  3GTG A;  5KFR A;  4YQW A;  5BR8 H;  3V6K A;  2W9C B;  1M6V A;  4ZOL F;  3N6R A;  1CQI B;  4CE5 A;  5KFL A;  5DLG A;  1P16 A;  4RNN A;  3WWH A;  2W9A A;  2FE3 A;  4EG0 A;  4JV5 H;  4O81 A;  2YZN A;  4ECR A;  2V59 A;  4DL6 A;  2ASD A;  3H4B A;  3GTK A;  2JA5 G;  4J0M A;  3GIJ A;  4J9R A;  3PW2 A;  4QIW E;  5D8D A;  2HVR A;  1E4E B;  3U9T A;  3GTP A;  4WHX A;  1KTA A;  2WB1 A;  3GTJ A;  1JXL A;  4J9O A;  5KFY A;  1UC8 A;  4IWX A;  4CMF A;  3J7A K;  4YBZ B;  4O3O A;  3TEK A;  2UXB H;  2YS7 A;  3H0G A;  4DV4 H;  3BQ0 A;  2FPG B;  1TWH A;  3T9E A;  3K3V A;  5FNV F;  3HKZ A;  4QWE A;  4O2B F;  3GIL A;  4NLG A;  4UUG A;  5HBR B;  3RGZ A;  2R86 A;  3U54 A;  3AW8 A;  3G6V A;  4MV8 A;  3CQZ A;  4LMY A;  1RJQ A;  4MV9 A;  2NVY A;  2FPP B;  2ZM6 H;  3LQS A;  5CAE B;  3KRE A;  4ED7 A;  1IBK H;  2UXC H;  2W6Q A;  5DMX A;  3T7A A;  1EYZ A;  2JA7 A;  4RZR A;  3T5H A;  3OUU A;  1XNQ H;  4DL5 A;  4LSX A;  4DR5 H;  4A3I G;  2W9B B;  5EDW A;  3VOT A;  4MTE A;  4X65 H;  4O3R A;  3RF2 A;  4LF6 H;  5C44 G;  4A3L G;  3GIM A;  5K3W A;  1A48 A;  3CEB A;  3U0G A;  3KYH C;  1TWF A;  2HIV A;  4IAJ A;  3PW0 A;  5GON F;  3AYH B;  2NU9 B;  4B3M H;  3J80 W;  4GC7 A;  1RK5 A;  3VPD A;  4Q4C A;  3PO3 G;  3BQ1 A;  1RYR A;  3PO2 G;  1V9P A;  2NVX A;  3J81 W;  2FJZ A;  2XGP A;  2O03 A;  1SYX B;  4TQR A;  2UU9 H;  4JYA H;  4TUY F;  4O3P A;  3I12 A;  3FDS A;  2OWO A;  5EWF A;  4DUY H;  4JI4 H;  1I7L A;  3GTQ A;  2W9B A;  4FFP A;  2COG A;  3R23 A;  1E4G T;  3Q8S B;  1VBG A;  4JI6 H;  1SCU B;  4E4T A;  5KFC A;  1G2W A;  3BG5 A;  2HHF A;  4Q43 A;  3TW6 A;  1BGW A;  2VQD A;  4BY7 G;  2JEF A;  4UFZ A;  3KAK A;  4YAK B;  5KFX A;  2V5A A;  2QF7 A;  3IG0 A;  4O2A F;  4O4J F;  2WYO A;  1W93 A;  4R8U A;  3VA7 A;  1A3G A; 
#chains in the Genus database with same CATH homology
 2XD4 A;  1C3O A;  1IOW A;  4XYM B;  3U9S A;  3RFC A;  4TV9 F;  1Z2O X;  4O7S A;  5CA1 F;  4FFL A;  4C5A A;  2I80 A;  5C1O A;  5HV6 A;  4YAJ B;  2YRW A;  4YJ3 F;  2CNU A;  5LXT F;  4O86 A;  1DIK A;  3UFX B;  5JQG F;  2V58 A;  2W70 A;  2YW2 A;  2ZDG A;  5JVD F;  2FPI B;  5BPF A;  3ETJ A;  4NYE A;  1Z2N X;  4FFN A;  1M0T A;  3LP8 A;  2J9G A;  2NUA B;  3WO0 A;  1GSH A;  3G8C A;  5EZY F;  2GPS A;  3V4Z A;  2X0S A;  3SE7 A;  1GSA A;  4MV7 A;  3RUP A;  2R7M A;  5LYJ F;  2WYO A;  1KJQ A;  2CNQ A;  5BMV F;  1CQJ B;  1PK8 A;  4O7R A;  4MV3 A;  3QFF A;  3R5H A;  4HR7 A;  1Z2P X;  3G8D A;  4O84 A;  1KJ8 A;  4O7Z A;  4I55 F;  4IZO A;  4MV1 A;  1JLL B;  4WD3 A;  4EGQ A;  2CNV A;  2YRX A;  1KUT A;  4WBN F;  3KAJ A;  2I8C A;  1CE8 A;  2GQS A;  5J2U F;  1ULZ A;  1KJ9 A;  5K2M A;  4I4T F;  3GID A;  3MJF A;  2NU7 B;  1BXR A;  5JQW A;  3R5X A;  4O4L F;  3V4S A;  5BPH A;  4ME6 A;  4IHJ F;  5JVL A;  2IP4 A;  5JH7 F;  1I7N A;  5CA0 F;  2DIK A;  4HNV A;  1JDE A;  2R7L A;  3K5H A;  4EGJ A;  2DWC A;  4Y8V B;  3K5I A;  4DLK A;  3Q2O A;  3HO8 A;  2NU8 B;  2R7K A;  2YZG A;  2W6Z A;  1KJI A;  3HB9 A;  2HGS A;  1UC9 A;  2PBZ A;  3JRW A;  1VKZ A;  4FE2 A;  3TIN A;  1DV1 A;  4FGR A;  2VR1 A;  4O7T A;  4O82 A;  4ZHQ F;  3MWD A;  1E4E A;  2R85 A;  1T36 A;  2GQR A;  3OUZ A;  1AUX A;  2PN1 A;  4L1K A;  4MA5 A;  2W71 A;  3E5N A;  1B6S A;  3VPC A;  3JZF A;  4O83 A;  2HJW A;  1EUC B;  1B6R A;  2VPQ A;  1CS0 A;  5CB4 F;  1VBH A;  1DV2 A;  3TIG A;  1A9X A;  1GSO A;  1JKJ B;  2W6P A;  2R7N A;  3HBL A;  1WR2 A;  5I47 A;  1PX2 A;  3VMM A;  4MA0 A;  2I87 A;  3Q1K A;  2Z02 A;  4QSH A;  2W6M A;  4O7Y A;  3K3P A;  2W6N A;  3R9R A;  1JDB B;  4MV4 A;  1EZ1 A;  2YYA A;  3AX6 A;  4HNU A;  2QK4 A;  2DLN A;  4HQ6 A;  2GLT A;  4ZI7 F;  1IOV A;  3JZI A;  5C1P A;  2PVP A;  4YJ2 F;  5LOV F;  2Z04 A;  5LP6 F;  1KBL A;  4O7L A;  2FB9 A;  5KKN B;  3TII A;  2YZM A;  5KX5 F;  2ZDH A;  1C30 A;  2W6O A;  2CZG A;  3MWE A;  2R87 A;  4XX0 B;  2GPW A;  3ORQ A;  1GLV A;  4O7N A;  3ORR A;  2R84 A;  2YS6 A;  5J2T F;  2P0A A;  4TV8 F;  2XCL A;  4DIM A;  2DZD A;  4C5B A;  4FU0 A;  1OBD A;  5LA6 F;  1BNC A;  1M0W A;  3N8D A;  3DF7 A;  2NU6 B;  5H80 A;  1AUV A;  3WO1 A;  4O4H F;  4IIJ F;  4YB8 B;  3JRX A;  2OLS A;  2YWV A;  2SCU B;  3RV4 A;  1KJJ A;  4XZ3 B;  2YL2 A;  2R82 A;  4FFO A;  4FFM A;  4XYL B;  4MV6 A;  4RZQ A;  2YZL A;  3VPB A;  1GGO A;  3R5F A;  3WNZ A;  4I50 F;  4HNT A;  4FFR A;  2FP4 B;  4O4I F;  4C5C A;  3ETH A;  3NUA A;  4O7W A;  4M9U A;  2CQY A;  2C00 A;  1W96 A;  1EHI A;  1KEE A;  3U55 A;  3KAL A;  2R6F A;  3GLK A;  3LWB A;  4IWY A;  5C8Y F;  3TQT A;  5IYZ F;  2ZDQ A;  1KC7 A;  1EUD B;  4MAM A;  3RV3 A;  1OBG A;  4O7V A;  1M6V A;  4ZOL F;  3N6R A;  1CQI B;  4EG0 A;  4O81 A;  2YZN A;  2V59 A;  5D8D A;  1E4E B;  3U9T A;  1UC8 A;  4IWX A;  4YBZ B;  2YS7 A;  2FPG B;  5FNV F;  4O2B F;  5HBR B;  2R86 A;  3U54 A;  3AW8 A;  4MV8 A;  4MV9 A;  2FPP B;  5CAE B;  3KRE A;  2W6Q A;  5DMX A;  1EYZ A;  3OUU A;  3VOT A;  1A48 A;  5GON F;  2NU9 B;  3VPD A;  4TUY F;  3I12 A;  1I7L A;  4FFP A;  3R23 A;  1VBG A;  1SCU B;  4E4T A;  3BG5 A;  3TW6 A;  2VQD A;  4YAK B;  3KAK A;  2V5A A;  2QF7 A;  4O2A F;  4O4J F;  4ZQI A;  1W93 A;  3VA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...