4XYLB

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
225
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 66
structure length 225
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xylB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xylB02
4HNTA 3MJFA 4MV4A 4O7YA 4O84A 2QF7A 3OUUA 2DLNA 2R7LA 2YW2A 4YAJB 4C5AA 2R82A 5I47A 2YRWA 4Y8VB 1DIKA 5LYJF 5JQWA 2HJWA 3Q2OA 3JRWA 4O2AF 3R9RA 1VKZA 3VA7A 2YYAA 4WBNF 2YZLA 1B6RA 4XX0B 4O2BF 1GSOA 2CNUA 2VR1A 1KC7A 2YWVA 3VMMA 2YS6A 2R86A 2VPQA 4IIJF 1EUCB 2HGSA 2R7KA 1I7LA 4FGRA 2Z02A 5J2TF 4I4TF 1W96A 5J2UF 5BPHA 1KEEA 1OBGA 2NU9B 4MAMA 3KAKA 2DZDA 4FFRA 3RUPA 2I80A 2VQDA 4O81A 3Q1KA 3WO0A 1KUTA 5KX5F 2W6ZA 2NUAB 4O82A 4C5BA 3ETJA 1KJIA 3V4ZA 3AW8A 3JRXA 2FPIB 4EGQA 2XD4A 4FU0A 2J9GA 3KAJA 3R5HA 4DLKA 3R5FA 1KJQA 2X0SA 2ZDHA 3TW6A 4RZQA 4EG0A 4FFLA 2ZDQA 1E4EB 2Z04A 4WD3A 3UFXB 3QFFA 1PK8A 5CB4F 2V58A 4FE2A 3JZFA 1M0WA 2P0AA 1CE8A 1JDEA 2GPSA 5HV6A 2W6OA 4O7TA 4MV6A 1E4EA 3K5HA 5EZYF 2V59A 4FFPA 2YRXA 1M6VA 4L1KA 2R7MA 1I7NA 4C5CA 4FFMA 2GPWA 3U54A 3GIDA 2SCUB 1C30A 4YJ2F 3VPCA 1B6SA 3I12A 1UC8A 1C3OA 4YJ3F 4IWYA 3HBLA 4XZ3B 1Z2NX 5C1PA 2CNVA 3DF7A 3LP8A 4O86A 1GSAA 2GQRA 1EYZA 4FFOA 2R7NA 3KALA 2FB9A 4MV7A 1KJ9A 4TUYF 4NYEA 3G8CA 2NU8B 2PBZA 4HQ6A 5C8YF 2OLSA 2FPPB 2YS7A 3NUAA 3MWEA 5LXTF 2R6FA 4O7ZA 3TINA 3K3PA 4M9UA 3TIIA 2W6MA 2W70A 2ZDGA 3GLKA 3KREA 1OBDA 1ULZA 1JKJB 5LP6F 5GONF 3U9TA 4TV8F 2DWCA 4O7VA 3R5XA 3WO1A 2CNQA 4ZHQF 2C00A 5CA0F 2YZNA 3VPBA 5JQGF 1Z2PX 3ORRA 1EUDB 5DMXA 5KKNB 3ETHA 3U9SA 1KBLA 4MV8A 1A48A 1IOVA 4I50F 4O7NA 2W6PA 2W71A 4O7RA 4O4HF 1M0TA 4YB8B 3RV3A 1IOWA 2I87A 4O7WA 3K5IA 1CQIB 4MV1A 4DIMA 5D8DA 2R87A 2R85A 3VOTA 5JH7F 3JZIA 1T36A 3R23A 1BNCA 2YZMA 4FFNA 4XYMB 4EGJA 4MV3A 2NU6B 1DV1A 1A9XA 2DIKA 5H80A 2R84A 5BMVF 1EHIA 3RFCA 1WR2A 5C1OA 3TIGA 4HNVA 1AUXA 1JDBB 2I8CA 5FNVF 2GLTA 1PX2A 3ORQA 1KJ8A 4HR7A 4HNUA 1GGOA 2V5AA 1GLVA 4IHJF 1CQJB 2GQSA 1W93A 1EZ1A 5IYZF 3RV4A 3MWDA 4ZOLF 3TQTA 2FP4B 3N6RA 1VBGA 2WYOA 5HBRB 3OUZA 1AUVA 3U55A 1DV2A 2NU7B 2PN1A 4MV9A 5BPFA 3BG5A 3AX6A 1VBHA 4O4JF 3LWBA 4ZI7F 4ME6A 2CQYA 4O7SA 3V4SA 4E4TA 2W6NA 4IZOA 3SE7A 2FPGB 4XYLB 4O7LA 4YAKB 3HO8A 3G8DA 3WNZA 4YBZB 4TV9F 5LA6F 5CAEB 2IP4A 2W6QA 2YZGA 4MA5A 2PVPA 4ZQIA 2YL2A 4O4IF 2XCLA 4MA0A 5JVDF 2QK4A 1UC9A 3HB9A 4I55F 3VPDA 4QSHA 2CZGA 5CA1F 1KJJA 4IWXA 1CS0A 1BXRA 3E5NA 4O83A 1JLLB 5JVLA 3N8DA 5K2MA 1GSHA 1SCUB 1Z2OX 4O4LF 5LOVF
chains in the Genus database with same CATH superfamily
2NVXA 4NXMH 4OX9H 5KFNA 2R8GA 4HNTA 3MJFA 4X66H 3HOUG 4GC7A 4DR1H 2BQ3A 2JEFA 5KFRA 5DGBA 1S0MA 4MV4A 4O7YA 5KG4A 4UCTA 3DTFA 3VNNA 2C28A 1K1QA 4JV2A 3SI8A 5KFQA 4O84A 2ASDA 2QF7A 3OTOH 3OUUA 2DLNA 2R7LA 2YW2A 5KFIA 4YAJB 3MFHA 2COGA 4C5AA 2R8IA 2ASLA 5DGHA 2R82A 4J9QA 1S0NA 2IBKA 3LULA 1RK6A 2WTFA 2FLNA 5HNEA 4LH6A 5E25A 4CC5A 2FLPA 1I6UA 4LF9H 5I47A 2YRWA 2Q2UA 1OWTA 2FK3A 4Y8VB 1DIKA 5LYJF 4GKKH 5JQWA 3N42B 5BYAA 5KFJA 2HJWA 3Q2OA 5LL6b 3M9OB 4DUZH 3JRWA 3W1BA 1ZQ7A 4CKBA 4IAJA 2C2DA 4O2AF 3R9RA 4LSAA 1VKZA 5I5UA 2YYAA 4WBNF 3VA7A 5DG9A 3Q8PB 2YZLA 1B6RA 4ETSA 4ED3A 2BQRA 2M05A 4XX0B 1RJPA 5FJ8G 4O2BF 3RTXA 4B3MH 2JA8G 3GTOA 3S24A 1M7JA 2W7OA 1GSOA 4WHXA 2CNUA 2VR1A 2VPSA 4J9MA 1KC7A 3GTPA 4CHIA 2YWVA 3VMMA 3PW2A 4PDBA 2YS6A 2R86A 3NBYB 2VPQA 4ECUA 4DR6H 4IIJF 3GIKA 1EUCB 3NC0B 1SEIA 5KFBA 4GC6A 2RGRA 2B63A 4U7CA 2HGSA 2R7KA 1N34H 4CMFA 1I7LA 1N32H 4DV0H 3RIZA 3CSWA 4FGRA 2VQEH 4DUYH 2JA6G 4DL7A 2IA6A 2Z02A 2ALZA 4JI3H 3BACA 5J2TF 5I5TA 4I4TF 5KFKA 2O03A 4AYBA 3J80W 1XNRH 1W96A 5J2UF 5KFCA 2VUMA 3T7AA 1A0IA 5BPHA 3C0FB 4DV6H 2PMZA 3N43B 3PW0A 2HG8A 1KT8A 1JX4A 3KXYT 1KEEA 1OBGA 4J9RA 4M7EA 2NU9B 4O3PA 3T9AA 4O3SA 5KT7A 4MAMA 3KHHA 2JEGA 5BYBA 3KAKA 4EFEA 4JI2H 2DZDA 3LMLA 4FM9A 5DG7A 2XGPA 4FFRA 2UXDH 3H4BA 4CKEA 3RJ0A 1UNNC 2EIYA 1I3QA 3V6KA 3PO3G 4LH7A 2W8KA 4Q8FA 3RUPA 2I80A 2VQDA 4O81A 4AYBE 5FPRA 5KG5A 2BR0A 3LQSA 1DAAA 4X65H 2HGWA 4RNNA 3GTMA 3N40P 3Q1KA 4Q0YA 5DGAA 4UUGA 3WO0A 3QZ7A 3PZPA 1KUTA 3W1GA 5KX5F 2R93A 2W6ZA 5KFHA 4A3LG 2NUAB 4LSXA 5FR9A 4DR2H 1RYRA 4MTEA 4EYIB 4O82A 3TY8A 4ECTA 4C5BA 4ED0A 3ETJA 3KHGA 4DR7H 3PR4A 1RYSA 2W9CA 1KJIA 5DISC 3V4ZA 3AW8A 3GDEA 3JRXA 2FPIB 1I50A 4YP3A 4F4YA 4EGQA 4A2BA 3PR5B 2Y0SA 2XD4A 4FU0A 2J9GA 3KAJA 4PZ6A 3R5HA 1I2KA 3UZBA 5KT4A 5KT3A 2HHFA 3RB6A 1FKAH 4DLKA 4PZ7A 2JA7G 3HOZG 3R5FA 3RR5A 1S10A 1KJQA 4U6PA 2X0SA 2ZDHA 3TY5A 3TW6A 3V6JA 4RZQA 4EG0A 4ECSA 4UCOA 3KTMA 4FFLA 2ZDQA 1E4EB 2Z04A 4WD3A 4Q43A 3GIJA 3UFXB 3F8NA 2UUAH 3QFFA 1PK8A 5CB4F 2V58A 1GO3E 3H3VH 2UXCH 4FE2A 1E4GT 3JZFA 3T5HA 2VQFH 1M0WA 1N56A 4NLGA 3MR6A 3HKZA 5I5SA 4B3RH 2P0AA 3SNOA 2ODTX 5DG8A 1Y1VG 4A3JG 1CE8A 1JDEA 5K3WA 3TW7A 4CC6A 4QW9A 1XMQH 5DLGA 2Y0SE 2GPSA 4JUZA 1XDNA 5BWXA 2Q7DA 5FD6A 3FDSA 4YY3H 1EKPA 3T1HH 4G3IA 5HV6A 2W6OA 4IR1A 1Y1WA 3QZ8A 4O7TA 3KHRA 1I1MA 4MV6A 1E4EA 3DAAA 4LFCH 3J7AK 2BQUA 5KT5A 2R92A 1IBLH 4QWBA 5I5XA 3K5HA 5EZYF 3U0GA 4IR9A 5L1LA 2R8KA 2V59A 2W57A 4PBCA 3RF2A 1I1KA 4TM5A 4FFPA 2JA5G 2YRXA 3UYYA 3HKZE 5BR8H 1M6VA 4L1KA 1Y14B 4BBSG 2R7MA 2VOBA 1P8LA 3HT5A 1I7NA 2W9BA 1IYDA 3Q8SB 3NBZB 3RGZA 4C5CA 1HNWH 2R7ZA 4R8UB 2OWOA 4NZOA 2KSWA 2DABA 1JXLA 1K83A 3JZ6A 4FFMA 5KFSA 2GPWA 4BBRG 1CKOA 3U54A 3H0GG 3GIDA 1N33H 1S97A 1TA8A 2SCUB 1S03G 1C30A 1WH2A 2RDIA 3JAMW 4O3NA 2HIVA 5KFXA 3M9NB 4YJ2F 3WWHA 1AN7A 4K6NA 5L1IA 3VPCA 1J5EH 3JSLA 1B6SA 1UC8A 1C3OA 4IWYA 3I12A 4UCSA 3GJXB 3HBLA 4XZ3B 1Z2NX 4YJ3F 4E6NA 5C1PA 1O75A 2ZGIA 3UQ8A 4RAYA 4FS1A 2AGPA 2CNVA 3DF7A 3LP8A 4O86A 4CKCA 2CKZB 1GSAA 2GQRA 1EYZA 4FFOA 4LMYA 4R8UA 4X62H 4RUCA 4RB3C 5FPOA 2UVVA 2R7NA 4A2AA 3KALA 1A0GA 3QQMA 4GLXA 4ED7A 2FB9A 2ASJA 3G6YA 2HDKA 1DGSA 4J9NA 4J9LA 3T5KA 4ECQA 1R9TA 1MZBA 4TQSA 1VAJA 2FMAA 3OHBA 2AQ4A 2FJZA 2IMWP 3FMAA 2DPIA 4JI8H 3CEBA 2CFMA 4MV7A 1WCMG 5BWTA 3KHLA 1XNQH 5BWVA 2XIGA 5KG2A 4DR5H 4HYKA 3T1YH 1KJ9A 4TUYF 3WWJA 5KG0A 5DLFA 4NYEA 3G8CA 3T54A 2NU8B 2PBZA 3TY9A 4HQ6A 5C8YF 2OLSA 5JUMA 5KG7A 2HVQA 2FPPB 1WSCA 2HVSA 4R7RA 5IYCG 4DV4H 4LF4H 2YS7A 2DAAA 1I94H 3FKIG 4EFBA 2X5RA 3BA9A 3NUAA 3MWEA 5DQIA 5LXTF 5A2QW 2HVRA 1FJGH 2R6FA 5FLMG 4O7ZA 3M4IA 3TINA 3K3PA 4M9UA 3TIIA 5IYBG 4Q8EA 2W6MA 2W70A 4ECXA 2ZDGA 5F9NA 3BJYA 4ED8A 2E5LH 2ZJTA 3GLKA 3HOYG 2COIA 4F4XA 4QWEA 3KREA 3T9DA 4RUAA 5KFYA 4YR3A 3GTJA 1OBDA 1TWHA 1ULZA 2ZM6H 3H4DA 3OSNA 1JKJB 5LP6F 5CR5A 4YHHH 4BXXG 5GONF 1X9NA 5KFGA 5KFEA 5KFZA 1HNXH 1V4YA 4JV0A 3GQCA 4IRDA 2AU0A 2QYZA 4O3RA 3U9TA 4TV8F 4RNOA 5L9XA 2PMZE 4Q44A 2NVYA 2DWCA 2EJ2A 3MR2A 4DR4H 4EBEA 3Q8QB 4O7VA 3R5XA 3WO1A 4Q4CA 5I5VA 4YQWA 3WWIA 1VS0A 1RJQA 2FE3A 3KYHC 3T9FA 4MTDA 2CNQA 4LF7H 4ZHQF 2C00A 1TWAA 5CA0F 5EWEA 3IN5A 2JA6A 3L4JA 3L2PA 2YZNA 5CM0A 3VPBA 5KT6A 3GV8B 1JIHA 5JQGF 1BJTA 5KFUA 1ET0A 1Z2PX 1L2ZA 3ORRA 1EUDB 4NZMA 4UFZA 5DMXA 5I60A 5KKNB 3ETHA 5DQHA 3U9SA 4EBCA 2AGOA 1KBLA 2UXBH 4PZ8A 3IG0A 4J9SA 3GTQA 3GTKA 5KFMA 4MV8A 1A48A 4JYAH 1IOVA 4UCUA 3MWMA 3N41B 3GV5B 1IBMH 4I50F 2ATLA 4APMA 4HN2A 4O7NA 3J81W 5DGIA 2W6PA 4DV7H 2XC9A 2W71A 4O7RA 3I4MG 2WB1A 1TAEA 4O4HF 4J9PA 5C3EG 1M0TA 3PW5A 5IYDG 4YB8B 2R8HA 2C2RA 3RAQA 1T3NA 3GV7B 1N36H 3BABA 3RV3A 3EPGA 1EKVA 2UVRA 1IOWA 2I87A 4O7WA 4ECVA 3K5IA 4F4ZA 1CQIB 5BWWA 1CKNB 1B33N 3K3VA 4A3GG 4MV1A 4K0KH 1CKMA 2ABJA 4BY1G 2COJA 3H40A 2UUBH 4X64H 4DL5A 4DIMA 1S9FA 3GB8B 5D8DA 2V9WA 3HXLA 4EQ5A 2WDTA 1EKFA 2R87A 2R85A 3VOTA 5JH7F 4JI0H 4KHPH 4RB2C 2XCPA 3BQ0A 3JZIA 1T36A 5D1OB 2MCTA 2CW7A 5KFOA 3R23A 1SYXB 1BNCA 3T9BA 2WB1E 2YZMA 4FFNA 4JXUA 5KFVA 3RB3A 4XYMB 4EGJA 4QWCA 4RAZA 4MV3A 4O3OA 2NU6B 4QWAA 2JA7A 3PFFA 1DV1A 4EBDA 1WRVA 5KFTA 1A9XA 2DIKA 1FVIA 2Y4RA 5H80A 3AYHB 2R84A 1GYFA 2XGQA 3T99A 1EHIA 3RFCA 5BMVF 2DPJA 4QIWA 2A1HA 4ECRA 1BGWA 2RGVA 5L1KA 5KFDA 4B3SH 1WR2A 5D1OA 5C1OA 1N48A 3TIGA 2B63G 4HNVA 1AUXA 1KTAA 3OHAA 2C22A 2UVWA 3RBDA 1JDBB 3T9CA 2W9AA 3TQ1A 4JI5H 4NXNH 4BWSC 4DRFA 3QWUA 3W5OA 4DV5H 3BA8A 4YR0A 1S68A 1V9PA 5LMNH 2I8CA 3TEKA 1Y1VA 3GIIA 5FNVF 2GLTA 1PX2A 5L1JA 3ORQA 3PW7A 2OH2A 4ECYA 4RZRA 1KJ8A 2WAQA 4YR2A 3G6VA 3N6XA 5KS8A 3GIPA 5IP9G 4HR7A 4HNUA 5LMUH 1GGOA 2V5AA 1GLVA 4EEYA 1I2LA 4IHJF 2YCHA 5KG1A 5C5JA 4TVIA 2VUMG 1CQJB 1P16A 1W93A 2GQSA 1G2WA 1EZ1A 2VUGA 4QIWE 3V6HA 3NGDA 1V51A 3I4NG 3PW4A 5KFPA 5D1PA 4NZNA 5IYZF 2EJ0A 3RV4A 1RJRA 5KFAA 3MWDA 4J0MA 5EDWA 3BQ1A 4ZOLF 4GLWA 1ZHSA 3GIQA 2XCAA 4DL3A 2JA5A 4A3FG 5EWFA 3OSPA 3TQTA 3HOVG 2HGXA 2FP4B 4RU9A 4JV5H 5FD5A 2UVUA 3H20A 2RF4A 4IRCA 1I1LA 3N6RA 2QB5A 1VBGA 4A3KG 4A3DG 2WAQE 2WYOA 4RB0A 5HBRB 5KFLA 4ED2A 4DL6A 3PVXA 4JI1H 1TWGA 2R8JA 3PN1A 3H0GA 3OUZA 4B3TH 5KFWA 4ED6A 5BWRA 4BY7G 4J9OA 2JEIA 4GKJH 4F50A 1AUVA 2FLLA 2WE6A 2R93G 4CMDA 5BWUA 3GIMA 5FLXW 3U55A 3T5LA 5KG3A 1DV2A 2NU7B 3JSNA 5KFFA 2VA2A 3UZOA 3PO2G 3N44B 4RNMA 3MR3A 4ECWA 2PN1A 3T9EA 5C44G 4MV9A 3RAXA 4JI4H 5BPFA 5CE8A 1E4FT 1HNZH 3BG5A 2RDJA 4EYHB 3AX6A 1IBKH 1VBHA 5DAAA 4LF8H 1IYEA 3G6XA 2CW8A 4JV1A 4O4JF 4CE5A 5KG6A 3LWBA 2UUCH 2W8LA 4ZI7F 5I5YA 1TWFA 3RB4A 4ME6A 2CQYA 3Q8RB 2AGQA 2C2EA 4Q45A 1WCMA 4DAAA 1ZETA 2UU9H 5I5WA 4O7SA 3V4SA 4E4TA 4I7HA 2W6NA 4IZOA 3SE7A 4A93G 1T94A 2FPGB 1TWCA 4XYLB 1K1SA 4O7LA 4YAKB 4A3MG 5IP7G 2HIXA 3EYYA 4AQYH 2E2IA 3HO8A 2C35B 3CVZA 2F4VH 3GTGA 3G8DA 2W9CB 4FS2A 4QWDA 5IT9W 3WNZA 2J6TA 4DQNA 4YBZB 4TV9F 3GILA 4FBTA 5LA6F 2FKLA 5CAEB 2IP4A 2W6QA 3FKIA 4PWQA 2YZGA 4DL2A 4MA5A 4QW8A 2FK2A 4M0JA 2PVPA 2HHFB 1Y1WG 2J6SA 4ZQIA 4UCVA 2YL2A 4EEQA 5EOYA 4LF5H 4DV3H 4F4WA 2R92G 1XMOH 3HOXG 2JEJA 5C4XG 3RGXA 4TQRA 4O4IF 1RK5A 2XCLA 4MA0A 5JVDF 4A3EG 2FK1A 3MFIA 1A3GA 1UC9A 2QK4A 4UCRA 5DQGA 4RB1A 3BQ2A 4DV1H 3HB9A 4I55F 2HHHH 3L4KA 5EWGA 3DTGA 2YU9A 5IWAH 3VPDA 3T5JA 2R7ZG 2VA3A 3M9MB 4QSHA 2CZGA 5CA1F 4LFAH 1KJJA 4IWXA 1ZHQA 4ED1A 1XK5A 1CS0A 1SFOA 4FBUA 3HOWG 1BXRA 4LF6H 3E5NA 2Q2TA 4IRKA 2EJ3A 4RCNA 3EPIA 5T14A 3BAAA 4DR3H 2E2HA 4Q4DA 2W7PA 4A3IG 5F9LA 2J6UA 1HR0H 4O83A 1ZAUA 5KT2A 1JLLB 2V4QA 5JVLA 4JI7H 4A3CG 3N8DA 1CKNA 4DV2H 3GTLA 5K2MA 1GSHA 4DL4A 1B04A 1SCUB 2V4RA 3SGIA 3MR5A 3RBEA 3RB0A 4A3BG 1Z2OX 2W9BB 4QJFA 4C2MA 4O3QA 4LFBH 1S0OA 4J9KA 4O4LF 4JI6H 5LOVF 4ECZA 3CQZA
chains in the Genus database with same CATH topology
4HNTA 3MJFA 4MV4A 4O7YA 4O84A 2QF7A 3OUUA 2DLNA 2R7LA 2YW2A 4YAJB 4C5AA 2R82A 5I47A 2YRWA 4Y8VB 1DIKA 5LYJF 5JQWA 2HJWA 3Q2OA 3JRWA 4O2AF 3R9RA 1VKZA 3VA7A 2YYAA 4WBNF 2YZLA 1B6RA 4XX0B 4O2BF 1GSOA 2CNUA 2VR1A 1KC7A 2YWVA 3VMMA 2YS6A 2R86A 2VPQA 4IIJF 1EUCB 2HGSA 2R7KA 1I7LA 4FGRA 2Z02A 5J2TF 4I4TF 1W96A 5J2UF 5BPHA 1KEEA 1OBGA 2NU9B 4MAMA 3KAKA 2DZDA 4FFRA 3RUPA 2I80A 2VQDA 4O81A 3Q1KA 3WO0A 1KUTA 5KX5F 2W6ZA 2NUAB 4O82A 4C5BA 3ETJA 1KJIA 3V4ZA 3AW8A 3JRXA 2FPIB 4EGQA 2XD4A 4FU0A 2J9GA 3KAJA 3R5HA 4DLKA 3R5FA 1KJQA 2X0SA 2ZDHA 3TW6A 4RZQA 4EG0A 4FFLA 2ZDQA 1E4EB 2Z04A 4WD3A 3UFXB 3QFFA 1PK8A 5CB4F 2V58A 4FE2A 3JZFA 1M0WA 2P0AA 1CE8A 1JDEA 2GPSA 5HV6A 2W6OA 4O7TA 4MV6A 1E4EA 3K5HA 5EZYF 2V59A 4FFPA 2YRXA 1M6VA 4L1KA 2R7MA 1I7NA 4C5CA 4FFMA 2GPWA 3U54A 3GIDA 2SCUB 1C30A 4YJ2F 3VPCA 1B6SA 3I12A 1UC8A 1C3OA 4YJ3F 4IWYA 3HBLA 4XZ3B 1Z2NX 5C1PA 2CNVA 3DF7A 3LP8A 4O86A 1GSAA 2GQRA 1EYZA 4FFOA 2R7NA 3KALA 2FB9A 4MV7A 1KJ9A 4TUYF 4NYEA 3G8CA 2NU8B 2PBZA 4HQ6A 5C8YF 2OLSA 2FPPB 2YS7A 3NUAA 3MWEA 5LXTF 2R6FA 4O7ZA 3TINA 3K3PA 4M9UA 3TIIA 2W6MA 2W70A 2ZDGA 3GLKA 3KREA 1OBDA 1ULZA 1JKJB 5LP6F 5GONF 3U9TA 4TV8F 2DWCA 4O7VA 3R5XA 3WO1A 2CNQA 4ZHQF 2C00A 5CA0F 2YZNA 3VPBA 5JQGF 1Z2PX 3ORRA 1EUDB 5DMXA 5KKNB 3ETHA 3U9SA 1KBLA 4MV8A 1A48A 1IOVA 4I50F 4O7NA 2W6PA 2W71A 4O7RA 4O4HF 1M0TA 4YB8B 3RV3A 1IOWA 2I87A 4O7WA 3K5IA 1CQIB 4MV1A 4DIMA 5D8DA 2R87A 2R85A 3VOTA 5JH7F 3JZIA 1T36A 3R23A 1BNCA 2YZMA 4FFNA 4XYMB 4EGJA 4MV3A 2NU6B 1DV1A 1A9XA 2DIKA 5H80A 2R84A 5BMVF 1EHIA 3RFCA 1WR2A 5C1OA 3TIGA 4HNVA 1AUXA 1JDBB 2I8CA 5FNVF 2GLTA 1PX2A 3ORQA 1KJ8A 4HR7A 4HNUA 1GGOA 2V5AA 1GLVA 4IHJF 1CQJB 2GQSA 1W93A 1EZ1A 5IYZF 3RV4A 3MWDA 4ZOLF 3TQTA 2FP4B 3N6RA 1VBGA 2WYOA 5HBRB 3OUZA 1AUVA 3U55A 1DV2A 2NU7B 2PN1A 4MV9A 5BPFA 3BG5A 3AX6A 1VBHA 4O4JF 3LWBA 4ZI7F 4ME6A 2CQYA 4O7SA 3V4SA 4E4TA 2W6NA 4IZOA 3SE7A 2FPGB 4XYLB 4O7LA 4YAKB 3HO8A 3G8DA 3WNZA 4YBZB 4TV9F 5LA6F 5CAEB 2IP4A 2W6QA 2YZGA 4MA5A 2PVPA 4ZQIA 2YL2A 4O4IF 2XCLA 4MA0A 5JVDF 2QK4A 1UC9A 3HB9A 4I55F 3VPDA 4QSHA 2CZGA 5CA1F 1KJJA 4IWXA 1CS0A 1BXRA 3E5NA 4O83A 1JLLB 5JVLA 3N8DA 5K2MA 1GSHA 1SCUB 1Z2OX 4O4LF 5LOVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNT A;  3MJF A;  4MV4 A;  4O7Y A;  4O84 A;  2QF7 A;  3OUU A;  2DLN A;  2R7L A;  2YW2 A;  4YAJ B;  4C5A A;  2R82 A;  5I47 A;  2YRW A;  4Y8V B;  1DIK A;  5LYJ F;  5JQW A;  2HJW A;  3Q2O A;  3JRW A;  4O2A F;  3R9R A;  1VKZ A;  3VA7 A;  2YYA A;  4WBN F;  2YZL A;  1B6R A;  4XX0 B;  4O2B F;  1GSO A;  2CNU A;  2VR1 A;  1KC7 A;  2YWV A;  3VMM A;  2YS6 A;  2R86 A;  2VPQ A;  4IIJ F;  1EUC B;  2HGS A;  2R7K A;  1I7L A;  4FGR A;  2Z02 A;  5J2T F;  4I4T F;  1W96 A;  5J2U F;  5BPH A;  1KEE A;  1OBG A;  2NU9 B;  4MAM A;  3KAK A;  2DZD A;  4FFR A;  3RUP A;  2I80 A;  2VQD A;  4O81 A;  3Q1K A;  3WO0 A;  1KUT A;  5KX5 F;  2W6Z A;  2NUA B;  4O82 A;  4C5B A;  3ETJ A;  1KJI A;  3V4Z A;  3AW8 A;  3JRX A;  2FPI B;  4EGQ A;  2XD4 A;  4FU0 A;  2J9G A;  3KAJ A;  3R5H A;  4DLK A;  3R5F A;  1KJQ A;  2X0S A;  2ZDH A;  3TW6 A;  4RZQ A;  4EG0 A;  4FFL A;  2ZDQ A;  1E4E B;  2Z04 A;  4WD3 A;  3UFX B;  3QFF A;  1PK8 A;  5CB4 F;  2V58 A;  4FE2 A;  3JZF A;  1M0W A;  2P0A A;  1CE8 A;  1JDE A;  2GPS A;  5HV6 A;  2W6O A;  4O7T A;  4MV6 A;  1E4E A;  3K5H A;  5EZY F;  2V59 A;  4FFP A;  2YRX A;  1M6V A;  4L1K A;  2R7M A;  1I7N A;  4C5C A;  4FFM A;  2GPW A;  3U54 A;  3GID A;  2SCU B;  1C30 A;  4YJ2 F;  3VPC A;  1B6S A;  3I12 A;  1UC8 A;  1C3O A;  4YJ3 F;  4IWY A;  3HBL A;  4XZ3 B;  1Z2N X;  5C1P A;  2CNV A;  3DF7 A;  3LP8 A;  4O86 A;  1GSA A;  2GQR A;  1EYZ A;  4FFO A;  2R7N A;  3KAL A;  2FB9 A;  4MV7 A;  1KJ9 A;  4TUY F;  4NYE A;  3G8C A;  2NU8 B;  2PBZ A;  4HQ6 A;  5C8Y F;  2OLS A;  2FPP B;  2YS7 A;  3NUA A;  3MWE A;  5LXT F;  2R6F A;  4O7Z A;  3TIN A;  3K3P A;  4M9U A;  3TII A;  2W6M A;  2W70 A;  2ZDG A;  3GLK A;  3KRE A;  1OBD A;  1ULZ A;  1JKJ B;  5LP6 F;  5GON F;  3U9T A;  4TV8 F;  2DWC A;  4O7V A;  3R5X A;  3WO1 A;  2CNQ A;  4ZHQ F;  2C00 A;  5CA0 F;  2YZN A;  3VPB A;  5JQG F;  1Z2P X;  3ORR A;  1EUD B;  5DMX A;  5KKN B;  3ETH A;  3U9S A;  1KBL A;  4MV8 A;  1A48 A;  1IOV A;  4I50 F;  4O7N A;  2W6P A;  2W71 A;  4O7R A;  4O4H F;  1M0T A;  4YB8 B;  3RV3 A;  1IOW A;  2I87 A;  4O7W A;  3K5I A;  1CQI B;  4MV1 A;  4DIM A;  5D8D A;  2R87 A;  2R85 A;  3VOT A;  5JH7 F;  3JZI A;  1T36 A;  3R23 A;  1BNC A;  2YZM A;  4FFN A;  4XYM B;  4EGJ A;  4MV3 A;  2NU6 B;  1DV1 A;  1A9X A;  2DIK A;  5H80 A;  2R84 A;  5BMV F;  1EHI A;  3RFC A;  1WR2 A;  5C1O A;  3TIG A;  4HNV A;  1AUX A;  1JDB B;  2I8C A;  5FNV F;  2GLT A;  1PX2 A;  3ORQ A;  1KJ8 A;  4HR7 A;  4HNU A;  1GGO A;  2V5A A;  1GLV A;  4IHJ F;  1CQJ B;  2GQS A;  1W93 A;  1EZ1 A;  5IYZ F;  3RV4 A;  3MWD A;  4ZOL F;  3TQT A;  2FP4 B;  3N6R A;  1VBG A;  2WYO A;  5HBR B;  3OUZ A;  1AUV A;  3U55 A;  1DV2 A;  2NU7 B;  2PN1 A;  4MV9 A;  5BPF A;  3BG5 A;  3AX6 A;  1VBH A;  4O4J F;  3LWB A;  4ZI7 F;  4ME6 A;  2CQY A;  4O7S A;  3V4S A;  4E4T A;  2W6N A;  4IZO A;  3SE7 A;  2FPG B;  4XYL B;  4O7L A;  4YAK B;  3HO8 A;  3G8D A;  3WNZ A;  4YBZ B;  4TV9 F;  5LA6 F;  5CAE B;  2IP4 A;  2W6Q A;  2YZG A;  4MA5 A;  2PVP A;  4ZQI A;  2YL2 A;  4O4I F;  2XCL A;  4MA0 A;  5JVD F;  2QK4 A;  1UC9 A;  3HB9 A;  4I55 F;  3VPD A;  4QSH A;  2CZG A;  5CA1 F;  1KJJ A;  4IWX A;  1CS0 A;  1BXR A;  3E5N A;  4O83 A;  1JLL B;  5JVL A;  3N8D A;  5K2M A;  1GSH A;  1SCU B;  1Z2O X;  4O4L F;  5LOV F; 
#chains in the Genus database with same CATH topology
 2NVX A;  4NXM H;  4OX9 H;  5KFN A;  2R8G A;  4HNT A;  3MJF A;  4X66 H;  3HOU G;  4GC7 A;  4DR1 H;  2BQ3 A;  2JEF A;  5KFR A;  5DGB A;  1S0M A;  4MV4 A;  4O7Y A;  5KG4 A;  4UCT A;  3DTF A;  3VNN A;  2C28 A;  1K1Q A;  4JV2 A;  3SI8 A;  5KFQ A;  4O84 A;  2ASD A;  2QF7 A;  3OTO H;  3OUU A;  2DLN A;  2R7L A;  2YW2 A;  5KFI A;  4YAJ B;  3MFH A;  2COG A;  4C5A A;  2R8I A;  2ASL A;  5DGH A;  2R82 A;  4J9Q A;  1S0N A;  2IBK A;  3LUL A;  1RK6 A;  2WTF A;  2FLN A;  5HNE A;  4LH6 A;  5E25 A;  4CC5 A;  2FLP A;  1I6U A;  4LF9 H;  5I47 A;  2YRW A;  2Q2U A;  1OWT A;  2FK3 A;  4Y8V B;  1DIK A;  5LYJ F;  4GKK H;  5JQW A;  3N42 B;  5BYA A;  5KFJ A;  2HJW A;  3Q2O A;  5LL6 b;  3M9O B;  4DUZ H;  3JRW A;  3W1B A;  1ZQ7 A;  4CKB A;  4IAJ A;  2C2D A;  4O2A F;  3R9R A;  4LSA A;  1VKZ A;  5I5U A;  2YYA A;  4WBN F;  3VA7 A;  5DG9 A;  3Q8P B;  2YZL A;  1B6R A;  4ETS A;  4ED3 A;  2BQR A;  2M05 A;  4XX0 B;  1RJP A;  5FJ8 G;  4O2B F;  3RTX A;  4B3M H;  2JA8 G;  3GTO A;  3S24 A;  1M7J A;  2W7O A;  1GSO A;  4WHX A;  2CNU A;  2VR1 A;  2VPS A;  4J9M A;  1KC7 A;  3GTP A;  4CHI A;  2YWV A;  3VMM A;  3PW2 A;  4PDB A;  2YS6 A;  2R86 A;  3NBY B;  2VPQ A;  4ECU A;  4DR6 H;  4IIJ F;  3GIK A;  1EUC B;  3NC0 B;  1SEI A;  5KFB A;  4GC6 A;  2RGR A;  2B63 A;  4U7C A;  2HGS A;  2R7K A;  1N34 H;  4CMF A;  1I7L A;  1N32 H;  4DV0 H;  3RIZ A;  3CSW A;  4FGR A;  2VQE H;  4DUY H;  2JA6 G;  4DL7 A;  2IA6 A;  2Z02 A;  2ALZ A;  4JI3 H;  3BAC A;  5J2T F;  5I5T A;  4I4T F;  5KFK A;  2O03 A;  4AYB A;  3J80 W;  1XNR H;  1W96 A;  5J2U F;  5KFC A;  2VUM A;  3T7A A;  1A0I A;  5BPH A;  3C0F B;  4DV6 H;  2PMZ A;  3N43 B;  3PW0 A;  2HG8 A;  1KT8 A;  1JX4 A;  3KXY T;  1KEE A;  1OBG A;  4J9R A;  4M7E A;  2NU9 B;  4O3P A;  3T9A A;  4O3S A;  5KT7 A;  4MAM A;  3KHH A;  2JEG A;  5BYB A;  3KAK A;  4EFE A;  4JI2 H;  2DZD A;  3LML A;  4FM9 A;  5DG7 A;  2XGP A;  4FFR A;  2UXD H;  3H4B A;  4CKE A;  3RJ0 A;  1UNN C;  2EIY A;  1I3Q A;  3V6K A;  3PO3 G;  4LH7 A;  2W8K A;  4Q8F A;  3RUP A;  2I80 A;  2VQD A;  4O81 A;  4AYB E;  5FPR A;  5KG5 A;  2BR0 A;  3LQS A;  1DAA A;  4X65 H;  2HGW A;  4RNN A;  3GTM A;  3N40 P;  3Q1K A;  4Q0Y A;  5DGA A;  4UUG A;  3WO0 A;  3QZ7 A;  3PZP A;  1KUT A;  3W1G A;  5KX5 F;  2R93 A;  2W6Z A;  5KFH A;  4A3L G;  2NUA B;  4LSX A;  5FR9 A;  4DR2 H;  1RYR A;  4MTE A;  4EYI B;  4O82 A;  3TY8 A;  4ECT A;  4C5B A;  4ED0 A;  3ETJ A;  3KHG A;  4DR7 H;  3PR4 A;  1RYS A;  2W9C A;  1KJI A;  5DIS C;  3V4Z A;  3AW8 A;  3GDE A;  3JRX A;  2FPI B;  1I50 A;  4YP3 A;  4F4Y A;  4EGQ A;  4A2B A;  3PR5 B;  2Y0S A;  2XD4 A;  4FU0 A;  2J9G A;  3KAJ A;  4PZ6 A;  3R5H A;  1I2K A;  3UZB A;  5KT4 A;  5KT3 A;  2HHF A;  3RB6 A;  1FKA H;  4DLK A;  4PZ7 A;  2JA7 G;  3HOZ G;  3R5F A;  3RR5 A;  1S10 A;  1KJQ A;  4U6P A;  2X0S A;  2ZDH A;  3TY5 A;  3TW6 A;  3V6J A;  4RZQ A;  4EG0 A;  4ECS A;  4UCO A;  3KTM A;  4FFL A;  2ZDQ A;  1E4E B;  2Z04 A;  4WD3 A;  4Q43 A;  3GIJ A;  3UFX B;  3F8N A;  2UUA H;  3QFF A;  1PK8 A;  5CB4 F;  2V58 A;  1GO3 E;  3H3V H;  2UXC H;  4FE2 A;  1E4G T;  3JZF A;  3T5H A;  2VQF H;  1M0W A;  1N56 A;  4NLG A;  3MR6 A;  3HKZ A;  5I5S A;  4B3R H;  2P0A A;  3SNO A;  2ODT X;  5DG8 A;  1Y1V G;  4A3J G;  1CE8 A;  1JDE A;  5K3W A;  3TW7 A;  4CC6 A;  4QW9 A;  1XMQ H;  5DLG A;  2Y0S E;  2GPS A;  4JUZ A;  1XDN A;  5BWX A;  2Q7D A;  5FD6 A;  3FDS A;  4YY3 H;  1EKP A;  3T1H H;  4G3I A;  5HV6 A;  2W6O A;  4IR1 A;  1Y1W A;  3QZ8 A;  4O7T A;  3KHR A;  1I1M A;  4MV6 A;  1E4E A;  3DAA A;  4LFC H;  3J7A K;  2BQU A;  5KT5 A;  2R92 A;  1IBL H;  4QWB A;  5I5X A;  3K5H A;  5EZY F;  3U0G A;  4IR9 A;  5L1L A;  2R8K A;  2V59 A;  2W57 A;  4PBC A;  3RF2 A;  1I1K A;  4TM5 A;  4FFP A;  2JA5 G;  2YRX A;  3UYY A;  3HKZ E;  5BR8 H;  1M6V A;  4L1K A;  1Y14 B;  4BBS G;  2R7M A;  2VOB A;  1P8L A;  3HT5 A;  1I7N A;  2W9B A;  1IYD A;  3Q8S B;  3NBZ B;  3RGZ A;  4C5C A;  1HNW H;  2R7Z A;  4R8U B;  2OWO A;  4NZO A;  2KSW A;  2DAB A;  1JXL A;  1K83 A;  3JZ6 A;  4FFM A;  5KFS A;  2GPW A;  4BBR G;  1CKO A;  3U54 A;  3H0G G;  3GID A;  1N33 H;  1S97 A;  1TA8 A;  2SCU B;  1S03 G;  1C30 A;  1WH2 A;  2RDI A;  3JAM W;  4O3N A;  2HIV A;  5KFX A;  3M9N B;  4YJ2 F;  3WWH A;  1AN7 A;  4K6N A;  5L1I A;  3VPC A;  1J5E H;  3JSL A;  1B6S A;  1UC8 A;  1C3O A;  4IWY A;  3I12 A;  4UCS A;  3GJX B;  3HBL A;  4XZ3 B;  1Z2N X;  4YJ3 F;  4E6N A;  5C1P A;  1O75 A;  2ZGI A;  3UQ8 A;  4RAY A;  4FS1 A;  2AGP A;  2CNV A;  3DF7 A;  3LP8 A;  4O86 A;  4CKC A;  2CKZ B;  1GSA A;  2GQR A;  1EYZ A;  4FFO A;  4LMY A;  4R8U A;  4X62 H;  4RUC A;  4RB3 C;  5FPO A;  2UVV A;  2R7N A;  4A2A A;  3KAL A;  1A0G A;  3QQM A;  4GLX A;  4ED7 A;  2FB9 A;  2ASJ A;  3G6Y A;  2HDK A;  1DGS A;  4J9N A;  4J9L A;  3T5K A;  4ECQ A;  1R9T A;  1MZB A;  4TQS A;  1VAJ A;  2FMA A;  3OHB A;  2AQ4 A;  2FJZ A;  2IMW P;  3FMA A;  2DPI A;  4JI8 H;  3CEB A;  2CFM A;  4MV7 A;  1WCM G;  5BWT A;  3KHL A;  1XNQ H;  5BWV A;  2XIG A;  5KG2 A;  4DR5 H;  4HYK A;  3T1Y H;  1KJ9 A;  4TUY F;  3WWJ A;  5KG0 A;  5DLF A;  4NYE A;  3G8C A;  3T54 A;  2NU8 B;  2PBZ A;  3TY9 A;  4HQ6 A;  5C8Y F;  2OLS A;  5JUM A;  5KG7 A;  2HVQ A;  2FPP B;  1WSC A;  2HVS A;  4R7R A;  5IYC G;  4DV4 H;  4LF4 H;  2YS7 A;  2DAA A;  1I94 H;  3FKI G;  4EFB A;  2X5R A;  3BA9 A;  3NUA A;  3MWE A;  5DQI A;  5LXT F;  5A2Q W;  2HVR A;  1FJG H;  2R6F A;  5FLM G;  4O7Z A;  3M4I A;  3TIN A;  3K3P A;  4M9U A;  3TII A;  5IYB G;  4Q8E A;  2W6M A;  2W70 A;  4ECX A;  2ZDG A;  5F9N A;  3BJY A;  4ED8 A;  2E5L H;  2ZJT A;  3GLK A;  3HOY G;  2COI A;  4F4X A;  4QWE A;  3KRE A;  3T9D A;  4RUA A;  5KFY A;  4YR3 A;  3GTJ A;  1OBD A;  1TWH A;  1ULZ A;  2ZM6 H;  3H4D A;  3OSN A;  1JKJ B;  5LP6 F;  5CR5 A;  4YHH H;  4BXX G;  5GON F;  1X9N A;  5KFG A;  5KFE A;  5KFZ A;  1HNX H;  1V4Y A;  4JV0 A;  3GQC A;  4IRD A;  2AU0 A;  2QYZ A;  4O3R A;  3U9T A;  4TV8 F;  4RNO A;  5L9X A;  2PMZ E;  4Q44 A;  2NVY A;  2DWC A;  2EJ2 A;  3MR2 A;  4DR4 H;  4EBE A;  3Q8Q B;  4O7V A;  3R5X A;  3WO1 A;  4Q4C A;  5I5V A;  4YQW A;  3WWI A;  1VS0 A;  1RJQ A;  2FE3 A;  3KYH C;  3T9F A;  4MTD A;  2CNQ A;  4LF7 H;  4ZHQ F;  2C00 A;  1TWA A;  5CA0 F;  5EWE A;  3IN5 A;  2JA6 A;  3L4J A;  3L2P A;  2YZN A;  5CM0 A;  3VPB A;  5KT6 A;  3GV8 B;  1JIH A;  5JQG F;  1BJT A;  5KFU A;  1ET0 A;  1Z2P X;  1L2Z A;  3ORR A;  1EUD B;  4NZM A;  4UFZ A;  5DMX A;  5I60 A;  5KKN B;  3ETH A;  5DQH A;  3U9S A;  4EBC A;  2AGO A;  1KBL A;  2UXB H;  4PZ8 A;  3IG0 A;  4J9S A;  3GTQ A;  3GTK A;  5KFM A;  4MV8 A;  1A48 A;  4JYA H;  1IOV A;  4UCU A;  3MWM A;  3N41 B;  3GV5 B;  1IBM H;  4I50 F;  2ATL A;  4APM A;  4HN2 A;  4O7N A;  3J81 W;  5DGI A;  2W6P A;  4DV7 H;  2XC9 A;  2W71 A;  4O7R A;  3I4M G;  2WB1 A;  1TAE A;  4O4H F;  4J9P A;  5C3E G;  1M0T A;  3PW5 A;  5IYD G;  4YB8 B;  2R8H A;  2C2R A;  3RAQ A;  1T3N A;  3GV7 B;  1N36 H;  3BAB A;  3RV3 A;  3EPG A;  1EKV A;  2UVR A;  1IOW A;  2I87 A;  4O7W A;  4ECV A;  3K5I A;  4F4Z A;  1CQI B;  5BWW A;  1CKN B;  1B33 N;  3K3V A;  4A3G G;  4MV1 A;  4K0K H;  1CKM A;  2ABJ A;  4BY1 G;  2COJ A;  3H40 A;  2UUB H;  4X64 H;  4DL5 A;  4DIM A;  1S9F A;  3GB8 B;  5D8D A;  2V9W A;  3HXL A;  4EQ5 A;  2WDT A;  1EKF A;  2R87 A;  2R85 A;  3VOT A;  5JH7 F;  4JI0 H;  4KHP H;  4RB2 C;  2XCP A;  3BQ0 A;  3JZI A;  1T36 A;  5D1O B;  2MCT A;  2CW7 A;  5KFO A;  3R23 A;  1SYX B;  1BNC A;  3T9B A;  2WB1 E;  2YZM A;  4FFN A;  4JXU A;  5KFV A;  3RB3 A;  4XYM B;  4EGJ A;  4QWC A;  4RAZ A;  4MV3 A;  4O3O A;  2NU6 B;  4QWA A;  2JA7 A;  3PFF A;  1DV1 A;  4EBD A;  1WRV A;  5KFT A;  1A9X A;  2DIK A;  1FVI A;  2Y4R A;  5H80 A;  3AYH B;  2R84 A;  1GYF A;  2XGQ A;  3T99 A;  1EHI A;  3RFC A;  5BMV F;  2DPJ A;  4QIW A;  2A1H A;  4ECR A;  1BGW A;  2RGV A;  5L1K A;  5KFD A;  4B3S H;  1WR2 A;  5D1O A;  5C1O A;  1N48 A;  3TIG A;  2B63 G;  4HNV A;  1AUX A;  1KTA A;  3OHA A;  2C22 A;  2UVW A;  3RBD A;  1JDB B;  3T9C A;  2W9A A;  3TQ1 A;  4JI5 H;  4NXN H;  4BWS C;  4DRF A;  3QWU A;  3W5O A;  4DV5 H;  3BA8 A;  4YR0 A;  1S68 A;  1V9P A;  5LMN H;  2I8C A;  3TEK A;  1Y1V A;  3GII A;  5FNV F;  2GLT A;  1PX2 A;  5L1J A;  3ORQ A;  3PW7 A;  2OH2 A;  4ECY A;  4RZR A;  1KJ8 A;  2WAQ A;  4YR2 A;  3G6V A;  3N6X A;  5KS8 A;  3GIP A;  5IP9 G;  4HR7 A;  4HNU A;  5LMU H;  1GGO A;  2V5A A;  1GLV A;  4EEY A;  1I2L A;  4IHJ F;  2YCH A;  5KG1 A;  5C5J A;  4TVI A;  2VUM G;  1CQJ B;  1P16 A;  1W93 A;  2GQS A;  1G2W A;  1EZ1 A;  2VUG A;  4QIW E;  3V6H A;  3NGD A;  1V51 A;  3I4N G;  3PW4 A;  5KFP A;  5D1P A;  4NZN A;  5IYZ F;  2EJ0 A;  3RV4 A;  1RJR A;  5KFA A;  3MWD A;  4J0M A;  5EDW A;  3BQ1 A;  4ZOL F;  4GLW A;  1ZHS A;  3GIQ A;  2XCA A;  4DL3 A;  2JA5 A;  4A3F G;  5EWF A;  3OSP A;  3TQT A;  3HOV G;  2HGX A;  2FP4 B;  4RU9 A;  4JV5 H;  5FD5 A;  2UVU A;  3H20 A;  2RF4 A;  4IRC A;  1I1L A;  3N6R A;  2QB5 A;  1VBG A;  4A3K G;  4A3D G;  2WAQ E;  2WYO A;  4RB0 A;  5HBR B;  5KFL A;  4ED2 A;  4DL6 A;  3PVX A;  4JI1 H;  1TWG A;  2R8J A;  3PN1 A;  3H0G A;  3OUZ A;  4B3T H;  5KFW A;  4ED6 A;  5BWR A;  4BY7 G;  4J9O A;  2JEI A;  4GKJ H;  4F50 A;  1AUV A;  2FLL A;  2WE6 A;  2R93 G;  4CMD A;  5BWU A;  3GIM A;  5FLX W;  3U55 A;  3T5L A;  5KG3 A;  1DV2 A;  2NU7 B;  3JSN A;  5KFF A;  2VA2 A;  3UZO A;  3PO2 G;  3N44 B;  4RNM A;  3MR3 A;  4ECW A;  2PN1 A;  3T9E A;  5C44 G;  4MV9 A;  3RAX A;  4JI4 H;  5BPF A;  5CE8 A;  1E4F T;  1HNZ H;  3BG5 A;  2RDJ A;  4EYH B;  3AX6 A;  1IBK H;  1VBH A;  5DAA A;  4LF8 H;  1IYE A;  3G6X A;  2CW8 A;  4JV1 A;  4O4J F;  4CE5 A;  5KG6 A;  3LWB A;  2UUC H;  2W8L A;  4ZI7 F;  5I5Y A;  1TWF A;  3RB4 A;  4ME6 A;  2CQY A;  3Q8R B;  2AGQ A;  2C2E A;  4Q45 A;  1WCM A;  4DAA A;  1ZET A;  2UU9 H;  5I5W A;  4O7S A;  3V4S A;  4E4T A;  4I7H A;  2W6N A;  4IZO A;  3SE7 A;  4A93 G;  1T94 A;  2FPG B;  1TWC A;  4XYL B;  1K1S A;  4O7L A;  4YAK B;  4A3M G;  5IP7 G;  2HIX A;  3EYY A;  4AQY H;  2E2I A;  3HO8 A;  2C35 B;  3CVZ A;  2F4V H;  3GTG A;  3G8D A;  2W9C B;  4FS2 A;  4QWD A;  5IT9 W;  3WNZ A;  2J6T A;  4DQN A;  4YBZ B;  4TV9 F;  3GIL A;  4FBT A;  5LA6 F;  2FKL A;  5CAE B;  2IP4 A;  2W6Q A;  3FKI A;  4PWQ A;  2YZG A;  4DL2 A;  4MA5 A;  4QW8 A;  2FK2 A;  4M0J A;  2PVP A;  2HHF B;  1Y1W G;  2J6S A;  4ZQI A;  4UCV A;  2YL2 A;  4EEQ A;  5EOY A;  4LF5 H;  4DV3 H;  4F4W A;  2R92 G;  1XMO H;  3HOX G;  2JEJ A;  5C4X G;  3RGX A;  4TQR A;  4O4I F;  1RK5 A;  2XCL A;  4MA0 A;  5JVD F;  4A3E G;  2FK1 A;  3MFI A;  1A3G A;  1UC9 A;  2QK4 A;  4UCR A;  5DQG A;  4RB1 A;  3BQ2 A;  4DV1 H;  3HB9 A;  4I55 F;  2HHH H;  3L4K A;  5EWG A;  3DTG A;  2YU9 A;  5IWA H;  3VPD A;  3T5J A;  2R7Z G;  2VA3 A;  3M9M B;  4QSH A;  2CZG A;  5CA1 F;  4LFA H;  1KJJ A;  4IWX A;  1ZHQ A;  4ED1 A;  1XK5 A;  1CS0 A;  1SFO A;  4FBU A;  3HOW G;  1BXR A;  4LF6 H;  3E5N A;  2Q2T A;  4IRK A;  2EJ3 A;  4RCN A;  3EPI A;  5T14 A;  3BAA A;  4DR3 H;  2E2H A;  4Q4D A;  2W7P A;  4A3I G;  5F9L A;  2J6U A;  1HR0 H;  4O83 A;  1ZAU A;  5KT2 A;  1JLL B;  2V4Q A;  5JVL A;  4JI7 H;  4A3C G;  3N8D A;  1CKN A;  4DV2 H;  3GTL A;  5K2M A;  1GSH A;  4DL4 A;  1B04 A;  1SCU B;  2V4R A;  3SGI A;  3MR5 A;  3RBE A;  3RB0 A;  4A3B G;  1Z2O X;  2W9B B;  4QJF A;  4C2M A;  4O3Q A;  4LFB H;  1S0O A;  4J9K A;  4O4L F;  4JI6 H;  5LOV F;  4ECZ A;  3CQZ A; 
#chains in the Genus database with same CATH homology
 4HNT A;  3MJF A;  4MV4 A;  4O7Y A;  4O84 A;  2QF7 A;  3OUU A;  2DLN A;  2R7L A;  2YW2 A;  4YAJ B;  4C5A A;  2R82 A;  5I47 A;  2YRW A;  4Y8V B;  1DIK A;  5LYJ F;  5JQW A;  2HJW A;  3Q2O A;  3JRW A;  4O2A F;  3R9R A;  1VKZ A;  3VA7 A;  2YYA A;  4WBN F;  2YZL A;  1B6R A;  4XX0 B;  4O2B F;  1GSO A;  2CNU A;  2VR1 A;  1KC7 A;  2YWV A;  3VMM A;  2YS6 A;  2R86 A;  2VPQ A;  4IIJ F;  1EUC B;  2HGS A;  2R7K A;  1I7L A;  4FGR A;  2Z02 A;  5J2T F;  4I4T F;  1W96 A;  5J2U F;  5BPH A;  1KEE A;  1OBG A;  2NU9 B;  4MAM A;  3KAK A;  2DZD A;  4FFR A;  3RUP A;  2I80 A;  2VQD A;  4O81 A;  3Q1K A;  3WO0 A;  1KUT A;  5KX5 F;  2W6Z A;  2NUA B;  4O82 A;  4C5B A;  3ETJ A;  1KJI A;  3V4Z A;  3AW8 A;  3JRX A;  2FPI B;  4EGQ A;  2XD4 A;  4FU0 A;  2J9G A;  3KAJ A;  3R5H A;  4DLK A;  3R5F A;  1KJQ A;  2X0S A;  2ZDH A;  3TW6 A;  4RZQ A;  4EG0 A;  4FFL A;  2ZDQ A;  1E4E B;  2Z04 A;  4WD3 A;  3UFX B;  3QFF A;  1PK8 A;  5CB4 F;  2V58 A;  4FE2 A;  3JZF A;  1M0W A;  2P0A A;  1CE8 A;  1JDE A;  2GPS A;  5HV6 A;  2W6O A;  4O7T A;  4MV6 A;  1E4E A;  3K5H A;  5EZY F;  2V59 A;  4FFP A;  2YRX A;  1M6V A;  4L1K A;  2R7M A;  1I7N A;  4C5C A;  4FFM A;  2GPW A;  3U54 A;  3GID A;  2SCU B;  1C30 A;  4YJ2 F;  3VPC A;  1B6S A;  3I12 A;  1UC8 A;  1C3O A;  4YJ3 F;  4IWY A;  3HBL A;  4XZ3 B;  1Z2N X;  5C1P A;  2CNV A;  3DF7 A;  3LP8 A;  4O86 A;  1GSA A;  2GQR A;  1EYZ A;  4FFO A;  2R7N A;  3KAL A;  2FB9 A;  4MV7 A;  1KJ9 A;  4TUY F;  4NYE A;  3G8C A;  2NU8 B;  2PBZ A;  4HQ6 A;  5C8Y F;  2OLS A;  2FPP B;  2YS7 A;  3NUA A;  3MWE A;  5LXT F;  2R6F A;  4O7Z A;  3TIN A;  3K3P A;  4M9U A;  3TII A;  2W6M A;  2W70 A;  2ZDG A;  3GLK A;  3KRE A;  1OBD A;  1ULZ A;  1JKJ B;  5LP6 F;  5GON F;  3U9T A;  4TV8 F;  2DWC A;  4O7V A;  3R5X A;  3WO1 A;  2CNQ A;  4ZHQ F;  2C00 A;  5CA0 F;  2YZN A;  3VPB A;  5JQG F;  1Z2P X;  3ORR A;  1EUD B;  5DMX A;  5KKN B;  3ETH A;  3U9S A;  1KBL A;  4MV8 A;  1A48 A;  1IOV A;  4I50 F;  4O7N A;  2W6P A;  2W71 A;  4O7R A;  4O4H F;  1M0T A;  4YB8 B;  3RV3 A;  1IOW A;  2I87 A;  4O7W A;  3K5I A;  1CQI B;  4MV1 A;  4DIM A;  5D8D A;  2R87 A;  2R85 A;  3VOT A;  5JH7 F;  3JZI A;  1T36 A;  3R23 A;  1BNC A;  2YZM A;  4FFN A;  4XYM B;  4EGJ A;  4MV3 A;  2NU6 B;  1DV1 A;  1A9X A;  2DIK A;  5H80 A;  2R84 A;  5BMV F;  1EHI A;  3RFC A;  1WR2 A;  5C1O A;  3TIG A;  4HNV A;  1AUX A;  1JDB B;  2I8C A;  5FNV F;  2GLT A;  1PX2 A;  3ORQ A;  1KJ8 A;  4HR7 A;  4HNU A;  1GGO A;  2V5A A;  1GLV A;  4IHJ F;  1CQJ B;  2GQS A;  1W93 A;  1EZ1 A;  5IYZ F;  3RV4 A;  3MWD A;  4ZOL F;  3TQT A;  2FP4 B;  3N6R A;  1VBG A;  2WYO A;  5HBR B;  3OUZ A;  1AUV A;  3U55 A;  1DV2 A;  2NU7 B;  2PN1 A;  4MV9 A;  5BPF A;  3BG5 A;  3AX6 A;  1VBH A;  4O4J F;  3LWB A;  4ZI7 F;  4ME6 A;  2CQY A;  4O7S A;  3V4S A;  4E4T A;  2W6N A;  4IZO A;  3SE7 A;  2FPG B;  4XYL B;  4O7L A;  4YAK B;  3HO8 A;  3G8D A;  3WNZ A;  4YBZ B;  4TV9 F;  5LA6 F;  5CAE B;  2IP4 A;  2W6Q A;  2YZG A;  4MA5 A;  2PVP A;  4ZQI A;  2YL2 A;  4O4I F;  2XCL A;  4MA0 A;  5JVD F;  2QK4 A;  1UC9 A;  3HB9 A;  4I55 F;  3VPD A;  4QSH A;  2CZG A;  5CA1 F;  1KJJ A;  4IWX A;  1CS0 A;  1BXR A;  3E5N A;  4O83 A;  1JLL B;  5JVL A;  3N8D A;  5K2M A;  1GSH A;  1SCU B;  1Z2O X;  4O4L F;  5LOV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...