1S68A

Structure and mechanism of rna ligase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYCDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords RNA Ligase 2
publication title Structure and mechanism of RNA ligase.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 67
structure length 233
sequence length 233
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1s68A02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s68A01
3RTXA 1TAEA 3UQ8A 1X9NA 2HVSA 4E6NA 4PZ6A 3W1GA 5D1PA 4EFEA 1B04A 3TY9A 4EFBA 3TY8A 3KYHC 4UCTA 3GB8B 4EEQA 4CC5A 1P16A 5FPOA 4UCUA 3NBYB 3BA9A 4GLXA 1A0IA 2HIVA 1S68A 3W5OA 3TY5A 2HIXA 4UCVA 3GJXB 5D1OB 1XDNA 2Q2TA 1CKNA 3QWUA 2HVQA 3BAAA 2VUGA 3GDEA 1CKNB 3PN1A 3JSLA 1V9PA 5FPRA 1P8LA 1CKMA 3NC0B 1DGSA 3L2PA 4PZ8A 5DISC 4UFZA 5D1OA 4UCSA 2Q2UA 2CFMA 4EQ5A 3NBZB 1TA8A 2OWOA 2HVRA 4CC6A 4UCRA 3S24A 1XK5A 3VNNA 3RR5A 3W1BA 1CKOA 3BA8A 3JSNA 1FVIA 4LH6A 1VS0A 4DRFA 4UCOA 3BABA 4LH7A 4PZ7A
chains in the Genus database with same CATH superfamily
4M0JA 4FFMA 3RBDA 3RTXA 3GV5B 5KFNA 4CHIA 2FPIB 2R7NA 1RJQA 2HGSA 2FMAA 2ASLA 3DAAA 4FS2A 4NXMH 2DPIA 1EKFA 3T7AA 1T3NA 2VQFH 4YQWA 4JYAH 1N33H 2RF4A 5L1LA 1BNCA 1I1MA 3R23A 3W1GA 1M7JA 3L4JA 5I5XA 2E5LH 4I4TF 5KFUA 4A3LG 4C5CA 4DL5A 4LF7H 4EBEA 5L1KA 2AGPA 3RAXA 1N36H 5I5VA 4RZRA 1BXRA 4DAAA 3BQ2A 4TM5A 3WO1A 4Q4CA 3H40A 4RUAA 3JZIA 2HHFB 3K5HA 5DMXA 2RDJA 1E4EA 1N34H 2W7OA 1IYDA 4NYEA 3TY8A 4EEQA 2YCHA 4O4IF 3EPIA 2JA5A 3HOYG 3H0GA 4O3PA 1WCMA 5F9NA 1RYSA 1I7LA 4UCUA 4J9MA 1EUCB 3ETHA 5KG0A 2W9CB 2COGA 3R5FA 3RFCA 4GLXA 5KFYA 4R8UB 2UXDH 4B3TH 2GPWA 3HXLA 1DV1A 2JEIA 4BBRG 5LL6b 4ED3A 3SNOA 2GQSA 3PFFA 4DUZH 4O82A 5KFQA 3TINA 2JA7G 1CE8A 3HO8A 3KTMA 5KFEA 3T9FA 4Q44A 4F4WA 4ETSA 3RGZA 2ZDGA 2J6SA 3GTMA 5IYBG 3RGXA 3HOXG 2XC9A 4X65H 4O7ZA 3W5OA 4JV2A 3UYYA 3T5LA 3GTKA 4MV7A 5KFFA 4UCVA 4RUCA 2XCAA 4IWYA 3OHAA 4E4TA 2EJ0A 3JAMW 4GKJH 3KHLA 1Z2NX 5KFLA 2OLSA 4GC7A 4BY7G 3OUUA 3OSNA 5BWWA 4A3EG 3BAAA 2VUGA 3VPDA 3HOUG 4FM9A 3RJ0A 2W7PA 1GSHA 1JX4A 3WNZA 4CKBA 3PN1A 2M05A 4ECXA 3JSLA 2C22A 5K3WA 1WR2A 4G3IA 3PW4A 1TWHA 1P8LA 4YJ3F 3TIGA 1Y1WA 5I5YA 3TIIA 2COIA 3NC0B 3KHRA 5C44G 1WSCA 4A3CG 4CE5A 1FJGH 2VQDA 3Q8RB 1C3OA 2FLPA 3L2PA 5I5TA 4EBDA 4GLWA 4BXXG 4HQ6A 3LWBA 5KT7A 4CKCA 2VUMG 5CA1F 5KFZA 2F4VH 5CR5A 4QIWE 4O2BF 2WB1A 3V4SA 4U6PA 2EIYA 4QWCA 3RB3A 4O84A 4IR9A 5D1OA 5C5JA 2IP4A 1EUDB 4O7TA 4EG0A 2RGVA 4IAJA 5KG1A 3SE7A 5IYDG 2YWVA 5IYZF 2W9BB 4K6NA 4XYMB 1KJ9A 3GTGA 1TA8A 3VPBA 1OBGA 3RBEA 4DR1H 5LOVF 4EBCA 1RYRA 3DF7A 1L2ZA 2YS6A 2CNQA 4FE2A 3VPCA 4CC6A 5JVDF 4GKKH 3N40P 2C2RA 4O7WA 3VNNA 2B63A 1AN7A 1VBHA 1XNRH 3GIDA 2HDKA 1KJIA 5HBRB 4HNVA 1ZHQA 2W70A 5KG2A 2YZLA 2NU9B 5C8YF 3HKZE 1S9FA 2Z04A 1ULZA 2NU8B 3RV3A 4LH6A 2YL2A 5KG5A 4L1KA 4J9QA 1DV2A 3G8CA 4YR2A 4M7EA 3TW6A 2DZDA 1K1SA 2AGQA 4A3GG 4A3DG 4F50A 1I3QA 4O7LA 4B3SH 4XZ3B 4Q8EA 5EDWA 3VMMA 4OX9H 4DQNA 5DLFA 1IBLH 2ASJA 2IBKA 3MJFA 5LXTF 2YRWA 1A9XA 2HGXA 2FP4B 3H0GG 5LMUH 4XYLB 3J80W 5BPHA 4JI8H 4LF5H 3N42B 3QZ7A 3I4MG 1TAEA 3FKIA 3T9AA 1KTAA 4ME6A 3ETJA 2VA3A 2R7ZA 4QWAA 5LMNH 1S10A 2W6MA 3JZFA 4O4JF 4PZ6A 4EGQA 5KG3A 2RGRA 3TQTA 5JH7F 2FK2A 2J6TA 3RB4A 2R8GA 2Z02A 3IN5A 5LYJF 2AGOA 2O03A 4RB0A 4EFEA 4DR6H 4ED0A 2V4RA 2FLNA 4IRDA 2ZGIA 3TY9A 5BWTA 2VUMA 4LFAH 4LMYA 1TWCA 3PW7A 5HV6A 3HBLA 5I47A 3KYHC 2FJZA 4O3SA 4O3OA 1S97A 5IP7G 4F4ZA 4RB3C 4JV1A 5CAEB 3R5HA 4A93G 3NBYB 4I7HA 4FFRA 4LF4H 4IRKA 4K0KH 2W6QA 2R7KA 4ED2A 2R8HA 4LFCH 2R87A 2NUAB 4FU0A 1Y1WG 2W57A 2E2IA 4ED1A 5BPFA 4O7YA 2GPSA 1B6SA 3U54A 3LMLA 3PR4A 2YW2A 5T14A 1A0GA 1S68A 3BACA 3T99A 1PX2A 2PN1A 3U55A 3V6JA 2HHFA 2BR0A 3G8DA 3UZBA 4ZQIA 4DUYH 4ED7A 2UUBH 4A3IG 5BWRA 2JA6A 2XGPA 4O86A 1DAAA 2W71A 1JXLA 1KJQA 3TQ1A 5LA6F 2C2DA 2JA5G 5I5UA 2V58A 4LFBH 1XDNA 4LSXA 3QWUA 4IR1A 4O7RA 4ECZA 3KXYT 2W6OA 2YZNA 4FBTA 2W9CA 4J9RA 3MWDA 4JUZA 4R8UA 5I60A 1M6VA 4EGJA 4F4XA 2CW8A 2BQRA 1IOWA 1ET0A 3SGIA 1VAJA 4TVIA 5KX5F 2ODTX 1HR0H 2JEFA 2R82A 1W96A 2FB9A 1CKMA 2PBZA 3AW8A 3Q1KA 1WRVA 2WAQE 5FD5A 2UU9H 2SCUB 2V5AA 1DGSA 5EZYF 1EYZA 4DR5H 4CMFA 3T5JA 3JRXA 3T54A 4YR3A 4PZ8A 1VBGA 3GIJA 2R8JA 4NLGA 1CS0A 5CM0A 4DR3H 1Y1VA 2XGQA 5KT5A 4FFPA 1S0OA 3V6HA 1Z2PX 1J5EH 4LF9H 1AUVA 2DIKA 1N56A 3R5XA 1R9TA 4QW8A 5BYBA 1E4FT 2CFMA 4EQ5A 4O2AF 3NBZB 3T5HA 5FLXW 5HNEA 5CA0F 3KALA 3N6RA 3RF2A 5KG4A 4RAZA 2FE3A 4Q45A 5KFRA 1EKVA 2HVRA 2EJ2A 5CB4F 2FK1A 4QWDA 3PVXA 4RNNA 4YAKB 4DL2A 2AU0A 2X0SA 4A3MG 1RK6A 1KJJA 1S0MA 5L1JA 3BQ1A 1MZBA 1XK5A 3QFFA 3W1BA 3RR5A 3I12A 3NGDA 2UVVA 3GQCA 4MV1A 4IHJF 1KC7A 3MR2A 1FKAH 3H20A 3JSNA 4MV8A 5EOYA 2CQYA 4AYBA 4RCNA 4O81A 2FKLA 5JUMA 3G6YA 1SEIA 1VS0A 2V9WA 4NZOA 3WO0A 4QW9A 3RB0A 3M9OB 2W9BA 1SYXB 5K2MA 4QWBA 2UVUA 5DQGA 2WYOA 4J9LA 4O7SA 5J2TF 4DR4H 3CEBA 3GLKA 5GONF 1JLLB 2ZDQA 1RJRA 3CQZA 3H4DA 4F4YA 5FJ8G 5JVLA 4LF6H 2I87A 5DGBA 2JEJA 1BGWA 2HHHH 3LP8A 1TWGA 5KT6A 2JA8G 4Q4DA 1X9NA 2HVSA 4A3BG 5KFBA 1IOVA 3CSWA 2CNVA 2VPQA 4DV4H 5D1PA 4YP3A 4JXUA 2JEGA 5JQWA 3HOVG 5KFDA 5IYCG 2J6UA 5KFCA 4JI7H 3V6KA 1Z2OX 2R6FA 4R7RA 2C35B 1HNZH 2PMZA 2YS7A 1B04A 4ZHQF 3K5IA 2GLTA 2R86A 5BWUA 4DV7H 3HOZG 5FNVF 2ZM6H 1GYFA 2JA6G 3H3VH 3N8DA 4XX0B 3Q2OA 4HN2A 4O7VA 3BJYA 4HYKA 5CE8A 3MWEA 4ZI7F 4YAJB 4O3NA 3LQSA 5BWVA 2R8IA 3QQMA 3T1YH 4JI0H 4ECSA 4A2BA 4IIJF 1WCMG 2OH2A 4FFLA 5BWXA 4DV0H 3G6XA 4ECWA 4DV2H 1A0IA 4NXNH 4MV4A 2R7LA 4DIMA 3EYYA 3FMAA 3SI8A 3OTOH 3RAQA 1I1LA 2BQUA 4RB1A 2R8KA 2JA7A 4FS1A 2W6PA 3GIMA 3GV8B 3WWIA 2Y4RA 2WB1E 2HGWA 5EWGA 4JI1H 4BWSC 4BY1G 5KFTA 4TQSA 3TY5A 4RZQA 5A2QW 3QZ8A 4ED8A 1Y1VG 4O83A 4MTDA 3PR5B 1EKPA 4MA0A 3GJXB 3J81W 4ECQA 1TWAA 5KFIA 2FPPB 2UUAH 2ZDHA 3BG5A 1KBLA 4QJFA 4YHHH 2R84A 1KT8A 4ZOLF 4IZOA 5KT3A 2UXCH 4PBCA 5DAAA 3RIZA 2W8KA 1B33N 3V4ZA 4O3RA 1CQJB 3ORRA 1JDEA 3GDEA 4MV9A 4FFNA 4TUYF 5KG6A 4A2AA 4KHPH 5D8DA 4DR2H 5DGIA 4GC6A 1UNNC 2W6NA 2DLNA 3AYHB 1HNXH 5I5WA 5C1PA 3PW2A 4JI4H 3MFIA 3GTQA 1VKZA 4X66H 4O4LF 3J7AK 5E25A 4RNMA 3PW0A 1JIHA 2W9AA 3HT5A 5IWAH 4CMDA 1KUTA 4DL6A 2QK4A 4B3MH 2J9GA 2V59A 5KFVA 3AX6A 3G6VA 5KFJA 3KHGA 1B6RA 5DISC 5H80A 1JDBB 4QSHA 3WWJA 1ZHSA 2WDTA 3K3VA 4O3QA 2BQ3A 3MR3A 4Q8FA 1N32H 2WTFA 4UUGA 5KFAA 1S03G 4FGRA 2EJ3A 3H4BA 3MWMA 1M0TA 4C2MA 5L9XA 5KT2A 3T9BA 3MR5A 2W8LA 4AQYH 2UUCH 2UVRA 4X62H 5BR8H 4NZMA 1KEEA 4LSAA 3GIKA 1K83A 4JI3H 3KREA 3JRWA 3RV4A 5FLMG 1T36A 5KFMA 2R93A 1OWTA 2WE6A 1PK8A 4YY3H 5KFSA 4DL7A 3PW5A 3S24A 3WWHA 5KFKA 2R92A 1GLVA 2YZMA 1I2LA 1CKOA 2Y0SE 3GIPA 3IG0A 1ZQ7A 5KFXA 5DG8A 1GO3E 3HB9A 2V4QA 3BA8A 2C00A 4ED6A 2UVWA 4JI6H 1XNQH 1FVIA 3U9SA 3M9MB 1V4YA 2VA2A 4C5BA 1RJPA 1T94A 2CKZB 4IWXA 2VOBA 4RU9A 2XCPA 3RB6A 2IMWP 1HNWH 4I55F 2AQ4A 4QIWA 3VA7A 2P0AA 5DQHA 2VPSA 2YU9A 1A48A 5KFGA 3R9RA 1E4EB 4O4HF 2KSWA 2ZJTA 4APMA 1W93A 4J9SA 4Q43A 4DV3H 1O75A 3T1HH 2R85A 5IT9W 2UXBH 4RB2C 1I94H 5I5SA 5DGAA 3K3PA 2XIGA 5KKNB 3UQ8A 3T9DA 3RUPA 3FKIG 4DV1H 4J9KA 4Y8VB 3OUZA 4E6NA 5KFPA 1I7NA 3U9TA 1N48A 3UFXB 5EWFA 2R7ZG 2NVXA 1IYEA 3OHBA 5BYAA 4TV9F 5KFHA 3BQ0A 2C28A 4MV6A 3HKZA 4LF8H 4M9UA 2CNUA 2DABA 1EHIA 4JI2H 4EFBA 3DTGA 1RK5A 2DPJA 1DIKA 3JZ6A 5C3EG 1GSOA 2CZGA 4PWQA 4DR7H 3Q8QB 3N43B 1UC9A 4HNTA 2C2EA 2MCTA 4UCTA 3GB8B 4J9OA 1P16A 1A3GA 4MA5A 4CC5A 4DL3A 5FPOA 4U7CA 3GTLA 1I2KA 5KFWA 4NZNA 3LULA 4CKEA 3M9NB 1C30A 1WH2A 1UC8A 1AUXA 3GILA 3BA9A 4YBZB 2A1HA 4A3FG 1CQIB 1GGOA 1G2WA 2XD4A 3FDSA 1V51A 2FPGB 3T9CA 2X5RA 1IBMH 4C5AA 4FFOA 3N44B 3KAKA 2HIVA 4EYHB 3L4KA 2VR1A 2NU6B 4RAYA 3GIIA 4J9NA 3CVZA 3KAJA 4HNUA 3GTPA 2E2HA 4PDBA 2Q7DA 2YRXA 1TWFA 4TV8F 2DAAA 3TW7A 1K1QA 1SCUB 1XMOH 2COJA 2QB5A 5IP9G 5F9LA 2I8CA 2HIXA 2VQEH 4J9PA 2IA6A 1Y14B 5L1IA 4MV3A 2DWCA 4YB8B 4JV0A 5D1OB 5KFOA 4YJ2F 1BJTA 3F8NA 3N6XA 5FD6A 4YR0A 3GTJA 3PO3G 4ECYA 4TQRA 2Q2TA 5DG7A 1CKNA 2HVQA 3I4NG 3GTOA 3MFHA 4A3JG 2R93G 1XMQH 5KG7A 1CKNB 1IBKH 3Q8PB 1V9PA 2HG8A 2R7MA 3E5NA 5FPRA 2CW7A 4DL4A 2R92G 5BMVF 2ABJA 3ORQA 5DQIA 3T9EA 4O7NA 4AYBE 2B63G 4JV5H 2RDIA 2YYAA 4WBNF 2NVYA 4IRCA 4WHXA 1OBDA 4DLKA 3HOWG 1ZETA 4UFZA 5J2UF 2ASDA 3T5KA 3PZPA 4BBSG 5DGHA 4ECRA 3C0FB 1E4GT 1EZ1A 2HJWA 1SFOA 4UCSA 2Q2UA 4Q0YA 2ATLA 1I6UA 3VOTA 4QWEA 2W6ZA 3MR6A 4MTEA 2OWOA 4ECUA 2FLLA 3M4IA 1I1KA 1ZAUA 2NU7B 4X64H 4JI5H 5JQGF 3OSPA 3TEKA 4ECTA 5LP6F 3KHHA 3EPGA 3U0GA 2XCLA 3PO2G 4UCRA 4B3RH 3UZOA 4RNOA 2QF7A 3N41B 4MAMA 2FK3A 4EYIB 4J0MA 2Y0SA 4EEYA 4A3KG 5C4XG 4WD3A 4DV6H 5DG9A 1M0WA 2WAQA 2PMZE 4ECVA 2GQRA 2PVPA 4I50F 1I50A 5DLGA 1JKJB 1S0NA 1KJ8A 3GIQA 4DRFA 5EWEA 4UCOA 3NUAA 5FR9A 5KT4A 2YZGA 4DV5H 4FBUA 2ALZA 3BABA 1GSAA 2I80A 3GV7B 4HR7A 4LH7A 3Q8SB 2QYZA 5KS8A 5C1OA 3DTFA 4PZ7A
chains in the Genus database with same CATH topology
4LF6H 3RTXA 5IT9W 3J80W 2UXBH 4JI8H 2HGSA 4RB2C 1I94H 3N42B 4LF5H 1BGWA 1TAEA 2XIGA 2HHHH 3UQ8A 4NXMH 1X9NA 2HVSA 2VQFH 4DV1H 5LMNH 1N33H 4JYAH 4E6NA 4PZ6A 4DV4H 3W1GA 5D1PA 3L4JA 2RGRA 2E5LH 2O03A 4LF7H 4RB0A 4JI7H 4EFEA 1Z2OX 4DR6H 4R7RA 1N36H 4LF8H 1HNZH 1B04A 3TY9A 4JI2H 4EFBA 4DV7H 1GYFA 4LFAH 2ZM6H 4LMYA 4DR7H 1N34H 3TY8A 3N43B 3KYHC 2MCTA 4UCTA 3GB8B 4EEQA 2YCHA 4CC5A 1P16A 4JI0H 5FPOA 3T1YH 4RB3C 4UCUA 4A2BA 3NBYB 4I7HA 4LF4H 4DV0H 4K0KH 1WH2A 4DV2H 4LFCH 2UXDH 3BA9A 4GLXA 1A0IA 4NXNH 4B3TH 3HXLA 3EYYA 3FMAA 3OTOH 1IBMH 2W57A 5LL6b 4RB1A 3N44B 3KAKA 2HIVA 4DUZH 3L4KA 3LMLA 4RAYA 3CVZA 3KAJA 4ETSA 3RGZA 4PDBA 1S68A 4JI1H 4BWSC 3RGXA 4X65H 3W5OA 3TY5A 4RZQA 5A2QW 1XMOH 4DUYH 4MTDA 4MV7A 2HIXA 4UCVA 2VQEH 2UUBH 3GJXB 3J81W 5D1OB 1BJTA 3N6XA 3F8NA 3JAMW 5FD6A 2UUAH 1Z2NX 4YHHH 4GKJH 4LFBH 1XDNA 4LSXA 2UXCH 2Q2TA 3RIZA 1CKNA 3QWUA 2HVQA 3BAAA 2VUGA 3KXYT 4FM9A 3RJ0A 4A2AA 3GDEA 4MV9A 1XMQH 1CKNB 4KHPH 2CW8A 4DR2H 1IBKH 3PN1A 1HNXH 3JSLA 1V9PA 5FPRA 4JI4H 1P8LA 2CW7A 4X66H 3J7AK 1CKMA 3NC0B 5IWAH 5FD5A 2UU9H 4JV5H 4DR5H 1DGSA 1FJGH 4B3MH 3L2PA 1HR0H 4PZ8A 5DISC 1ZHSA 2WDTA 3K3VA 1N32H 2F4VH 4UFZA 4DR3H 1S03G 5D1OA 3C0FB 1E4GT 1Z2PX 2RGVA 1J5EH 4IAJA 4LF9H 4UCSA 3MWMA 1M0TA 2Q2UA 1E4FT 4Q0YA 4AQYH 2CFMA 4EQ5A 1I6UA 3NBZB 4MTEA 1TA8A 2OWOA 5FLXW 2UUCH 3KALA 4X62H 3RF2A 3M4IA 4RAZA 5BR8H 2FE3A 4DR1H 4JI3H 4LSAA 2HVRA 3DF7A 4X64H 4JI5H 1L2ZA 4GKKH 4CC6A 2WE6A 4YY3H 4UCRA 3N40P 4B3RH 1MZBA 3S24A 1XK5A 3VNNA 3RR5A 3W1BA 1AN7A 3N41B 1CKOA 3IG0A 4J0MA 1XNRH 1ZHQA 3BA8A 1FKAH 3H20A 3JSNA 5EOYA 1M0WA 1FVIA 4DV6H 4JI6H 1XNQH 1SEIA 4LH6A 2VOBA 1HNWH 1VS0A 4DRFA 4UCOA 4M7EA 2VPSA 4DV5H 1SYXB 3T1HH 3BABA 4LH7A 2KSWA 2ZJTA 4B3SH 2WYOA 4OX9H 1IBLH 4APMA 4DV3H 5LMUH 4DR4H 1O75A 4PZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTX A;  1TAE A;  3UQ8 A;  1X9N A;  2HVS A;  4E6N A;  4PZ6 A;  3W1G A;  5D1P A;  4EFE A;  1B04 A;  3TY9 A;  4EFB A;  3TY8 A;  3KYH C;  4UCT A;  3GB8 B;  4EEQ A;  4CC5 A;  1P16 A;  5FPO A;  4UCU A;  3NBY B;  3BA9 A;  4GLX A;  1A0I A;  2HIV A;  1S68 A;  3W5O A;  3TY5 A;  2HIX A;  4UCV A;  3GJX B;  5D1O B;  1XDN A;  2Q2T A;  1CKN A;  3QWU A;  2HVQ A;  3BAA A;  2VUG A;  3GDE A;  1CKN B;  3PN1 A;  3JSL A;  1V9P A;  5FPR A;  1P8L A;  1CKM A;  3NC0 B;  1DGS A;  3L2P A;  4PZ8 A;  5DIS C;  4UFZ A;  5D1O A;  4UCS A;  2Q2U A;  2CFM A;  4EQ5 A;  3NBZ B;  1TA8 A;  2OWO A;  2HVR A;  4CC6 A;  4UCR A;  3S24 A;  1XK5 A;  3VNN A;  3RR5 A;  3W1B A;  1CKO A;  3BA8 A;  3JSN A;  1FVI A;  4LH6 A;  1VS0 A;  4DRF A;  4UCO A;  3BAB A;  4LH7 A;  4PZ7 A; 
#chains in the Genus database with same CATH topology
 4M0J A;  4FFM A;  3RBD A;  3RTX A;  3GV5 B;  5KFN A;  4CHI A;  2FPI B;  2R7N A;  1RJQ A;  2HGS A;  2FMA A;  2ASL A;  3DAA A;  4FS2 A;  4NXM H;  2DPI A;  1EKF A;  3T7A A;  1T3N A;  2VQF H;  4YQW A;  4JYA H;  1N33 H;  2RF4 A;  5L1L A;  1BNC A;  1I1M A;  3R23 A;  3W1G A;  1M7J A;  3L4J A;  5I5X A;  2E5L H;  4I4T F;  5KFU A;  4A3L G;  4C5C A;  4DL5 A;  4LF7 H;  4EBE A;  5L1K A;  2AGP A;  3RAX A;  1N36 H;  5I5V A;  4RZR A;  1BXR A;  4DAA A;  3BQ2 A;  4TM5 A;  3WO1 A;  4Q4C A;  3H40 A;  4RUA A;  3JZI A;  2HHF B;  3K5H A;  5DMX A;  2RDJ A;  1E4E A;  1N34 H;  2W7O A;  1IYD A;  4NYE A;  3TY8 A;  4EEQ A;  2YCH A;  4O4I F;  3EPI A;  2JA5 A;  3HOY G;  3H0G A;  4O3P A;  1WCM A;  5F9N A;  1RYS A;  1I7L A;  4UCU A;  4J9M A;  1EUC B;  3ETH A;  5KG0 A;  2W9C B;  2COG A;  3R5F A;  3RFC A;  4GLX A;  5KFY A;  4R8U B;  2UXD H;  4B3T H;  2GPW A;  3HXL A;  1DV1 A;  2JEI A;  4BBR G;  5LL6 b;  4ED3 A;  3SNO A;  2GQS A;  3PFF A;  4DUZ H;  4O82 A;  5KFQ A;  3TIN A;  2JA7 G;  1CE8 A;  3HO8 A;  3KTM A;  5KFE A;  3T9F A;  4Q44 A;  4F4W A;  4ETS A;  3RGZ A;  2ZDG A;  2J6S A;  3GTM A;  5IYB G;  3RGX A;  3HOX G;  2XC9 A;  4X65 H;  4O7Z A;  3W5O A;  4JV2 A;  3UYY A;  3T5L A;  3GTK A;  4MV7 A;  5KFF A;  4UCV A;  4RUC A;  2XCA A;  4IWY A;  3OHA A;  4E4T A;  2EJ0 A;  3JAM W;  4GKJ H;  3KHL A;  1Z2N X;  5KFL A;  2OLS A;  4GC7 A;  4BY7 G;  3OUU A;  3OSN A;  5BWW A;  4A3E G;  3BAA A;  2VUG A;  3VPD A;  3HOU G;  4FM9 A;  3RJ0 A;  2W7P A;  1GSH A;  1JX4 A;  3WNZ A;  4CKB A;  3PN1 A;  2M05 A;  4ECX A;  3JSL A;  2C22 A;  5K3W A;  1WR2 A;  4G3I A;  3PW4 A;  1TWH A;  1P8L A;  4YJ3 F;  3TIG A;  1Y1W A;  5I5Y A;  3TII A;  2COI A;  3NC0 B;  3KHR A;  5C44 G;  1WSC A;  4A3C G;  4CE5 A;  1FJG H;  2VQD A;  3Q8R B;  1C3O A;  2FLP A;  3L2P A;  5I5T A;  4EBD A;  4GLW A;  4BXX G;  4HQ6 A;  3LWB A;  5KT7 A;  4CKC A;  2VUM G;  5CA1 F;  5KFZ A;  2F4V H;  5CR5 A;  4QIW E;  4O2B F;  2WB1 A;  3V4S A;  4U6P A;  2EIY A;  4QWC A;  3RB3 A;  4O84 A;  4IR9 A;  5D1O A;  5C5J A;  2IP4 A;  1EUD B;  4O7T A;  4EG0 A;  2RGV A;  4IAJ A;  5KG1 A;  3SE7 A;  5IYD G;  2YWV A;  5IYZ F;  2W9B B;  4K6N A;  4XYM B;  1KJ9 A;  3GTG A;  1TA8 A;  3VPB A;  1OBG A;  3RBE A;  4DR1 H;  5LOV F;  4EBC A;  1RYR A;  3DF7 A;  1L2Z A;  2YS6 A;  2CNQ A;  4FE2 A;  3VPC A;  4CC6 A;  5JVD F;  4GKK H;  3N40 P;  2C2R A;  4O7W A;  3VNN A;  2B63 A;  1AN7 A;  1VBH A;  1XNR H;  3GID A;  2HDK A;  1KJI A;  5HBR B;  4HNV A;  1ZHQ A;  2W70 A;  5KG2 A;  2YZL A;  2NU9 B;  5C8Y F;  3HKZ E;  1S9F A;  2Z04 A;  1ULZ A;  2NU8 B;  3RV3 A;  4LH6 A;  2YL2 A;  5KG5 A;  4L1K A;  4J9Q A;  1DV2 A;  3G8C A;  4YR2 A;  4M7E A;  3TW6 A;  2DZD A;  1K1S A;  2AGQ A;  4A3G G;  4A3D G;  4F50 A;  1I3Q A;  4O7L A;  4B3S H;  4XZ3 B;  4Q8E A;  5EDW A;  3VMM A;  4OX9 H;  4DQN A;  5DLF A;  1IBL H;  2ASJ A;  2IBK A;  3MJF A;  5LXT F;  2YRW A;  1A9X A;  2HGX A;  2FP4 B;  3H0G G;  5LMU H;  4XYL B;  3J80 W;  5BPH A;  4JI8 H;  4LF5 H;  3N42 B;  3QZ7 A;  3I4M G;  1TAE A;  3FKI A;  3T9A A;  1KTA A;  4ME6 A;  3ETJ A;  2VA3 A;  2R7Z A;  4QWA A;  5LMN H;  1S10 A;  2W6M A;  3JZF A;  4O4J F;  4PZ6 A;  4EGQ A;  5KG3 A;  2RGR A;  3TQT A;  5JH7 F;  2FK2 A;  2J6T A;  3RB4 A;  2R8G A;  2Z02 A;  3IN5 A;  5LYJ F;  2AGO A;  2O03 A;  4RB0 A;  4EFE A;  4DR6 H;  4ED0 A;  2V4R A;  2FLN A;  4IRD A;  2ZGI A;  3TY9 A;  5BWT A;  2VUM A;  4LFA H;  4LMY A;  1TWC A;  3PW7 A;  5HV6 A;  3HBL A;  5I47 A;  3KYH C;  2FJZ A;  4O3S A;  4O3O A;  1S97 A;  5IP7 G;  4F4Z A;  4RB3 C;  4JV1 A;  5CAE B;  3R5H A;  4A93 G;  3NBY B;  4I7H A;  4FFR A;  4LF4 H;  4IRK A;  4K0K H;  2W6Q A;  2R7K A;  4ED2 A;  2R8H A;  4LFC H;  2R87 A;  2NUA B;  4FU0 A;  1Y1W G;  2W57 A;  2E2I A;  4ED1 A;  5BPF A;  4O7Y A;  2GPS A;  1B6S A;  3U54 A;  3LML A;  3PR4 A;  2YW2 A;  5T14 A;  1A0G A;  1S68 A;  3BAC A;  3T99 A;  1PX2 A;  2PN1 A;  3U55 A;  3V6J A;  2HHF A;  2BR0 A;  3G8D A;  3UZB A;  4ZQI A;  4DUY H;  4ED7 A;  2UUB H;  4A3I G;  5BWR A;  2JA6 A;  2XGP A;  4O86 A;  1DAA A;  2W71 A;  1JXL A;  1KJQ A;  3TQ1 A;  5LA6 F;  2C2D A;  2JA5 G;  5I5U A;  2V58 A;  4LFB H;  1XDN A;  4LSX A;  3QWU A;  4IR1 A;  4O7R A;  4ECZ A;  3KXY T;  2W6O A;  2YZN A;  4FBT A;  2W9C A;  4J9R A;  3MWD A;  4JUZ A;  4R8U A;  5I60 A;  1M6V A;  4EGJ A;  4F4X A;  2CW8 A;  2BQR A;  1IOW A;  1ET0 A;  3SGI A;  1VAJ A;  4TVI A;  5KX5 F;  2ODT X;  1HR0 H;  2JEF A;  2R82 A;  1W96 A;  2FB9 A;  1CKM A;  2PBZ A;  3AW8 A;  3Q1K A;  1WRV A;  2WAQ E;  5FD5 A;  2UU9 H;  2SCU B;  2V5A A;  1DGS A;  5EZY F;  1EYZ A;  4DR5 H;  4CMF A;  3T5J A;  3JRX A;  3T54 A;  4YR3 A;  4PZ8 A;  1VBG A;  3GIJ A;  2R8J A;  4NLG A;  1CS0 A;  5CM0 A;  4DR3 H;  1Y1V A;  2XGQ A;  5KT5 A;  4FFP A;  1S0O A;  3V6H A;  1Z2P X;  1J5E H;  4LF9 H;  1AUV A;  2DIK A;  1N56 A;  3R5X A;  1R9T A;  4QW8 A;  5BYB A;  1E4F T;  2CFM A;  4EQ5 A;  4O2A F;  3NBZ B;  3T5H A;  5FLX W;  5HNE A;  5CA0 F;  3KAL A;  3N6R A;  3RF2 A;  5KG4 A;  4RAZ A;  2FE3 A;  4Q45 A;  5KFR A;  1EKV A;  2HVR A;  2EJ2 A;  5CB4 F;  2FK1 A;  4QWD A;  3PVX A;  4RNN A;  4YAK B;  4DL2 A;  2AU0 A;  2X0S A;  4A3M G;  1RK6 A;  1KJJ A;  1S0M A;  5L1J A;  3BQ1 A;  1MZB A;  1XK5 A;  3QFF A;  3W1B A;  3RR5 A;  3I12 A;  3NGD A;  2UVV A;  3GQC A;  4MV1 A;  4IHJ F;  1KC7 A;  3MR2 A;  1FKA H;  3H20 A;  3JSN A;  4MV8 A;  5EOY A;  2CQY A;  4AYB A;  4RCN A;  4O81 A;  2FKL A;  5JUM A;  3G6Y A;  1SEI A;  1VS0 A;  2V9W A;  4NZO A;  3WO0 A;  4QW9 A;  3RB0 A;  3M9O B;  2W9B A;  1SYX B;  5K2M A;  4QWB A;  2UVU A;  5DQG A;  2WYO A;  4J9L A;  4O7S A;  5J2T F;  4DR4 H;  3CEB A;  3GLK A;  5GON F;  1JLL B;  2ZDQ A;  1RJR A;  3CQZ A;  3H4D A;  4F4Y A;  5FJ8 G;  5JVL A;  4LF6 H;  2I87 A;  5DGB A;  2JEJ A;  1BGW A;  2HHH H;  3LP8 A;  1TWG A;  5KT6 A;  2JA8 G;  4Q4D A;  1X9N A;  2HVS A;  4A3B G;  5KFB A;  1IOV A;  3CSW A;  2CNV A;  2VPQ A;  4DV4 H;  5D1P A;  4YP3 A;  4JXU A;  2JEG A;  5JQW A;  3HOV G;  5KFD A;  5IYC G;  2J6U A;  5KFC A;  4JI7 H;  3V6K A;  1Z2O X;  2R6F A;  4R7R A;  2C35 B;  1HNZ H;  2PMZ A;  2YS7 A;  1B04 A;  4ZHQ F;  3K5I A;  2GLT A;  2R86 A;  5BWU A;  4DV7 H;  3HOZ G;  5FNV F;  2ZM6 H;  1GYF A;  2JA6 G;  3H3V H;  3N8D A;  4XX0 B;  3Q2O A;  4HN2 A;  4O7V A;  3BJY A;  4HYK A;  5CE8 A;  3MWE A;  4ZI7 F;  4YAJ B;  4O3N A;  3LQS A;  5BWV A;  2R8I A;  3QQM A;  3T1Y H;  4JI0 H;  4ECS A;  4A2B A;  4IIJ F;  1WCM G;  2OH2 A;  4FFL A;  5BWX A;  4DV0 H;  3G6X A;  4ECW A;  4DV2 H;  1A0I A;  4NXN H;  4MV4 A;  2R7L A;  4DIM A;  3EYY A;  3FMA A;  3SI8 A;  3OTO H;  3RAQ A;  1I1L A;  2BQU A;  4RB1 A;  2R8K A;  2JA7 A;  4FS1 A;  2W6P A;  3GIM A;  3GV8 B;  3WWI A;  2Y4R A;  2WB1 E;  2HGW A;  5EWG A;  4JI1 H;  4BWS C;  4BY1 G;  5KFT A;  4TQS A;  3TY5 A;  4RZQ A;  5A2Q W;  3QZ8 A;  4ED8 A;  1Y1V G;  4O83 A;  4MTD A;  3PR5 B;  1EKP A;  4MA0 A;  3GJX B;  3J81 W;  4ECQ A;  1TWA A;  5KFI A;  2FPP B;  2UUA H;  2ZDH A;  3BG5 A;  1KBL A;  4QJF A;  4YHH H;  2R84 A;  1KT8 A;  4ZOL F;  4IZO A;  5KT3 A;  2UXC H;  4PBC A;  5DAA A;  3RIZ A;  2W8K A;  1B33 N;  3V4Z A;  4O3R A;  1CQJ B;  3ORR A;  1JDE A;  3GDE A;  4MV9 A;  4FFN A;  4TUY F;  5KG6 A;  4A2A A;  4KHP H;  5D8D A;  4DR2 H;  5DGI A;  4GC6 A;  1UNN C;  2W6N A;  2DLN A;  3AYH B;  1HNX H;  5I5W A;  5C1P A;  3PW2 A;  4JI4 H;  3MFI A;  3GTQ A;  1VKZ A;  4X66 H;  4O4L F;  3J7A K;  5E25 A;  4RNM A;  3PW0 A;  1JIH A;  2W9A A;  3HT5 A;  5IWA H;  4CMD A;  1KUT A;  4DL6 A;  2QK4 A;  4B3M H;  2J9G A;  2V59 A;  5KFV A;  3AX6 A;  3G6V A;  5KFJ A;  3KHG A;  1B6R A;  5DIS C;  5H80 A;  1JDB B;  4QSH A;  3WWJ A;  1ZHS A;  2WDT A;  3K3V A;  4O3Q A;  2BQ3 A;  3MR3 A;  4Q8F A;  1N32 H;  2WTF A;  4UUG A;  5KFA A;  1S03 G;  4FGR A;  2EJ3 A;  3H4B A;  3MWM A;  1M0T A;  4C2M A;  5L9X A;  5KT2 A;  3T9B A;  3MR5 A;  2W8L A;  4AQY H;  2UUC H;  2UVR A;  4X62 H;  5BR8 H;  4NZM A;  1KEE A;  4LSA A;  3GIK A;  1K83 A;  4JI3 H;  3KRE A;  3JRW A;  3RV4 A;  5FLM G;  1T36 A;  5KFM A;  2R93 A;  1OWT A;  2WE6 A;  1PK8 A;  4YY3 H;  5KFS A;  4DL7 A;  3PW5 A;  3S24 A;  3WWH A;  5KFK A;  2R92 A;  1GLV A;  2YZM A;  1I2L A;  1CKO A;  2Y0S E;  3GIP A;  3IG0 A;  1ZQ7 A;  5KFX A;  5DG8 A;  1GO3 E;  3HB9 A;  2V4Q A;  3BA8 A;  2C00 A;  4ED6 A;  2UVW A;  4JI6 H;  1XNQ H;  1FVI A;  3U9S A;  3M9M B;  1V4Y A;  2VA2 A;  4C5B A;  1RJP A;  1T94 A;  2CKZ B;  4IWX A;  2VOB A;  4RU9 A;  2XCP A;  3RB6 A;  2IMW P;  1HNW H;  4I55 F;  2AQ4 A;  4QIW A;  3VA7 A;  2P0A A;  5DQH A;  2VPS A;  2YU9 A;  1A48 A;  5KFG A;  3R9R A;  1E4E B;  4O4H F;  2KSW A;  2ZJT A;  4APM A;  1W93 A;  4J9S A;  4Q43 A;  4DV3 H;  1O75 A;  3T1H H;  2R85 A;  5IT9 W;  2UXB H;  4RB2 C;  1I94 H;  5I5S A;  5DGA A;  3K3P A;  2XIG A;  5KKN B;  3UQ8 A;  3T9D A;  3RUP A;  3FKI G;  4DV1 H;  4J9K A;  4Y8V B;  3OUZ A;  4E6N A;  5KFP A;  1I7N A;  3U9T A;  1N48 A;  3UFX B;  5EWF A;  2R7Z G;  2NVX A;  1IYE A;  3OHB A;  5BYA A;  4TV9 F;  5KFH A;  3BQ0 A;  2C28 A;  4MV6 A;  3HKZ A;  4LF8 H;  4M9U A;  2CNU A;  2DAB A;  1EHI A;  4JI2 H;  4EFB A;  3DTG A;  1RK5 A;  2DPJ A;  1DIK A;  3JZ6 A;  5C3E G;  1GSO A;  2CZG A;  4PWQ A;  4DR7 H;  3Q8Q B;  3N43 B;  1UC9 A;  4HNT A;  2C2E A;  2MCT A;  4UCT A;  3GB8 B;  4J9O A;  1P16 A;  1A3G A;  4MA5 A;  4CC5 A;  4DL3 A;  5FPO A;  4U7C A;  3GTL A;  1I2K A;  5KFW A;  4NZN A;  3LUL A;  4CKE A;  3M9N B;  1C30 A;  1WH2 A;  1UC8 A;  1AUX A;  3GIL A;  3BA9 A;  4YBZ B;  2A1H A;  4A3F G;  1CQI B;  1GGO A;  1G2W A;  2XD4 A;  3FDS A;  1V51 A;  2FPG B;  3T9C A;  2X5R A;  1IBM H;  4C5A A;  4FFO A;  3N44 B;  3KAK A;  2HIV A;  4EYH B;  3L4K A;  2VR1 A;  2NU6 B;  4RAY A;  3GII A;  4J9N A;  3CVZ A;  3KAJ A;  4HNU A;  3GTP A;  2E2H A;  4PDB A;  2Q7D A;  2YRX A;  1TWF A;  4TV8 F;  2DAA A;  3TW7 A;  1K1Q A;  1SCU B;  1XMO H;  2COJ A;  2QB5 A;  5IP9 G;  5F9L A;  2I8C A;  2HIX A;  2VQE H;  4J9P A;  2IA6 A;  1Y14 B;  5L1I A;  4MV3 A;  2DWC A;  4YB8 B;  4JV0 A;  5D1O B;  5KFO A;  4YJ2 F;  1BJT A;  3F8N A;  3N6X A;  5FD6 A;  4YR0 A;  3GTJ A;  3PO3 G;  4ECY A;  4TQR A;  2Q2T A;  5DG7 A;  1CKN A;  2HVQ A;  3I4N G;  3GTO A;  3MFH A;  4A3J G;  2R93 G;  1XMQ H;  5KG7 A;  1CKN B;  1IBK H;  3Q8P B;  1V9P A;  2HG8 A;  2R7M A;  3E5N A;  5FPR A;  2CW7 A;  4DL4 A;  2R92 G;  5BMV F;  2ABJ A;  3ORQ A;  5DQI A;  3T9E A;  4O7N A;  4AYB E;  2B63 G;  4JV5 H;  2RDI A;  2YYA A;  4WBN F;  2NVY A;  4IRC A;  4WHX A;  1OBD A;  4DLK A;  3HOW G;  1ZET A;  4UFZ A;  5J2U F;  2ASD A;  3T5K A;  3PZP A;  4BBS G;  5DGH A;  4ECR A;  3C0F B;  1E4G T;  1EZ1 A;  2HJW A;  1SFO A;  4UCS A;  2Q2U A;  4Q0Y A;  2ATL A;  1I6U A;  3VOT A;  4QWE A;  2W6Z A;  3MR6 A;  4MTE A;  2OWO A;  4ECU A;  2FLL A;  3M4I A;  1I1K A;  1ZAU A;  2NU7 B;  4X64 H;  4JI5 H;  5JQG F;  3OSP A;  3TEK A;  4ECT A;  5LP6 F;  3KHH A;  3EPG A;  3U0G A;  2XCL A;  3PO2 G;  4UCR A;  4B3R H;  3UZO A;  4RNO A;  2QF7 A;  3N41 B;  4MAM A;  2FK3 A;  4EYI B;  4J0M A;  2Y0S A;  4EEY A;  4A3K G;  5C4X G;  4WD3 A;  4DV6 H;  5DG9 A;  1M0W A;  2WAQ A;  2PMZ E;  4ECV A;  2GQR A;  2PVP A;  4I50 F;  1I50 A;  5DLG A;  1JKJ B;  1S0N A;  1KJ8 A;  3GIQ A;  4DRF A;  5EWE A;  4UCO A;  3NUA A;  5FR9 A;  5KT4 A;  2YZG A;  4DV5 H;  4FBU A;  2ALZ A;  3BAB A;  1GSA A;  2I80 A;  3GV7 B;  4HR7 A;  4LH7 A;  3Q8S B;  2QYZ A;  5KS8 A;  5C1O A;  3DTF A;  4PZ7 A; 
#chains in the Genus database with same CATH homology
 4LF6 H;  3RTX A;  5IT9 W;  3J80 W;  2UXB H;  4JI8 H;  2HGS A;  4RB2 C;  1I94 H;  3N42 B;  4LF5 H;  1BGW A;  1TAE A;  2XIG A;  2HHH H;  3UQ8 A;  4NXM H;  1X9N A;  2HVS A;  2VQF H;  4DV1 H;  5LMN H;  1N33 H;  4JYA H;  4E6N A;  4PZ6 A;  4DV4 H;  3W1G A;  5D1P A;  3L4J A;  2RGR A;  2E5L H;  2O03 A;  4LF7 H;  4RB0 A;  4JI7 H;  4EFE A;  1Z2O X;  4DR6 H;  4R7R A;  1N36 H;  4LF8 H;  1HNZ H;  1B04 A;  3TY9 A;  4JI2 H;  4EFB A;  4DV7 H;  1GYF A;  4LFA H;  2ZM6 H;  4LMY A;  4DR7 H;  1N34 H;  3TY8 A;  3N43 B;  3KYH C;  2MCT A;  4UCT A;  3GB8 B;  4EEQ A;  2YCH A;  4CC5 A;  1P16 A;  4JI0 H;  5FPO A;  3T1Y H;  4RB3 C;  4UCU A;  4A2B A;  3NBY B;  4I7H A;  4LF4 H;  4DV0 H;  4K0K H;  1WH2 A;  4DV2 H;  4LFC H;  2UXD H;  3BA9 A;  4GLX A;  1A0I A;  4NXN H;  4B3T H;  3HXL A;  3EYY A;  3FMA A;  3OTO H;  1IBM H;  2W57 A;  5LL6 b;  4RB1 A;  3N44 B;  3KAK A;  2HIV A;  4DUZ H;  3L4K A;  3LML A;  4RAY A;  3CVZ A;  3KAJ A;  4ETS A;  3RGZ A;  4PDB A;  1S68 A;  4JI1 H;  4BWS C;  3RGX A;  4X65 H;  3W5O A;  3TY5 A;  4RZQ A;  5A2Q W;  1XMO H;  4DUY H;  4MTD A;  4MV7 A;  2HIX A;  4UCV A;  2VQE H;  2UUB H;  3GJX B;  3J81 W;  5D1O B;  1BJT A;  3N6X A;  3F8N A;  3JAM W;  5FD6 A;  2UUA H;  1Z2N X;  4YHH H;  4GKJ H;  4LFB H;  1XDN A;  4LSX A;  2UXC H;  2Q2T A;  3RIZ A;  1CKN A;  3QWU A;  2HVQ A;  3BAA A;  2VUG A;  3KXY T;  4FM9 A;  3RJ0 A;  4A2A A;  3GDE A;  4MV9 A;  1XMQ H;  1CKN B;  4KHP H;  2CW8 A;  4DR2 H;  1IBK H;  3PN1 A;  1HNX H;  3JSL A;  1V9P A;  5FPR A;  4JI4 H;  1P8L A;  2CW7 A;  4X66 H;  3J7A K;  1CKM A;  3NC0 B;  5IWA H;  5FD5 A;  2UU9 H;  4JV5 H;  4DR5 H;  1DGS A;  1FJG H;  4B3M H;  3L2P A;  1HR0 H;  4PZ8 A;  5DIS C;  1ZHS A;  2WDT A;  3K3V A;  1N32 H;  2F4V H;  4UFZ A;  4DR3 H;  1S03 G;  5D1O A;  3C0F B;  1E4G T;  1Z2P X;  2RGV A;  1J5E H;  4IAJ A;  4LF9 H;  4UCS A;  3MWM A;  1M0T A;  2Q2U A;  1E4F T;  4Q0Y A;  4AQY H;  2CFM A;  4EQ5 A;  1I6U A;  3NBZ B;  4MTE A;  1TA8 A;  2OWO A;  5FLX W;  2UUC H;  3KAL A;  4X62 H;  3RF2 A;  3M4I A;  4RAZ A;  5BR8 H;  2FE3 A;  4DR1 H;  4JI3 H;  4LSA A;  2HVR A;  3DF7 A;  4X64 H;  4JI5 H;  1L2Z A;  4GKK H;  4CC6 A;  2WE6 A;  4YY3 H;  4UCR A;  3N40 P;  4B3R H;  1MZB A;  3S24 A;  1XK5 A;  3VNN A;  3RR5 A;  3W1B A;  1AN7 A;  3N41 B;  1CKO A;  3IG0 A;  4J0M A;  1XNR H;  1ZHQ A;  3BA8 A;  1FKA H;  3H20 A;  3JSN A;  5EOY A;  1M0W A;  1FVI A;  4DV6 H;  4JI6 H;  1XNQ H;  1SEI A;  4LH6 A;  2VOB A;  1HNW H;  1VS0 A;  4DRF A;  4UCO A;  4M7E A;  2VPS A;  4DV5 H;  1SYX B;  3T1H H;  3BAB A;  4LH7 A;  2KSW A;  2ZJT A;  4B3S H;  2WYO A;  4OX9 H;  1IBL H;  4APM A;  4DV3 H;  5LMU H;  4DR4 H;  1O75 A;  4PZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...