1S68A

Structure and mechanism of rna ligase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYCDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA Ligase 2
publication title Structure and mechanism of RNA ligase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
total genus 67
structure length 233
sequence length 233
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1s68A02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s68A01
5D1OB 5FPRA 1CKNB 1VS0A 4CC6A 4EQ5A 3JSNA 2HVRA 3W1BA 1FVIA 3W5OA 3L2PA 4PZ8A 3TY9A 2HIVA 3TY5A 4UCVA 1CKOA 2OWOA 2CFMA 4UCSA 1S68A 4UFZA 1DGSA 1B04A 4DRFA 2VUGA 3GB8B 2Q2TA 4UCRA 3NC0B 3KYHC 3W1GA 4EFEA 4UCUA 3TY8A 5D1PA 4EEQA 4GLXA 1XK5A 4LH6A 3VNNA 3QWUA 5DISC 4LH7A 3BAAA 3NBZB 2HVSA 1P8LA 4UCOA 1X9NA 4EFBA 3GDEA 1TA8A 3S24A 3BABA 2HIXA 4UCTA 1A0IA 5D1OA 4PZ6A 3RTXA 1CKNA 1V9PA 1TAEA 3UQ8A 3RR5A 4E6NA 3GJXB 3BA9A 1XDNA 3JSLA 1CKMA 3PN1A 2HVQA 3BA8A 4CC5A 5FPOA 1P16A 4PZ7A 2Q2UA 3NBYB
chains in the Genus database with same CATH superfamily
4CKCA 2YRXA 4J9QA 1B6SA 1CE8A 3ORRA 4QIWE 5FPRA 1S9FA 2FB9A 2FK1A 3U9SA 1MZBA 2WDTA 5DG7A 4Q8EA 5IYZF 3G8DA 3PFFA 4CC6A 3MFIA 3EYYA 5LMNH 4Q0YA 5KG3A 2AU0A 4EQ5A 1FKAH 3RGXA 2NUAB 1Y1WG 4JV2A 3GTKA 4ECQA 3H0GA 5JQWA 2V4RA 3GV8B 2ALZA 4HNVA 2UXDH 3GTQA 4MV1A 2W9BB 4JI7H 3L4JA 1E4FT 2QK4A 4PZ8A 4XYLB 5KT4A 4YR0A 3VPDA 3H3VH 2DABA 2HDKA 4HQ6A 2V5AA 2AQ4A 4GKKH 5D8DA 2W6OA 3OUZA 4O7LA 3RGZA 2R7NA 3T9BA 5BR8H 3BQ2A 2HIVA 2GPWA 3FKIA 2R86A 4J9RA 1UC9A 2ASDA 2J6TA 4B3SH 1GSHA 3HKZE 1CKOA 5KG1A 4YY3H 2R8KA 4IWXA 5KT2A 3R5XA 3V6KA 2HGXA 5HBRB 4FS2A 4UCSA 3LQSA 4F4XA 2A1HA 4O84A 1OWTA 4CMDA 3T9CA 4Q45A 2JA6G 3R9RA 5KFFA 2W70A 2I80A 2OH2A 5KFYA 4JI3H 2R92A 5BWUA 3PR5B 4FU0A 4MV3A 2E2IA 2OLSA 4ZHQF 3L4KA 2UVUA 2ZDQA 2NU8B 5DQGA 2XCLA 1M7JA 5KFPA 2JEFA 4QWBA 3UFXB 2W6ZA 4UCRA 3RUPA 5I5UA 5FD5A 3NC0B 4A3EG 3KYHC 1SCUB 2YZLA 5C8YF 3W1GA 2V4QA 1JX4A 4J9NA 5IYBG 4RU9A 1S10A 4YP3A 4PWQA 4DL3A 3Q1KA 3U54A 2AGQA 5KFQA 4O7TA 4UCUA 2UVVA 1Z2OX 2HHFA 4DL7A 1OBGA 2GLTA 3C0FB 4GLXA 2QYZA 1XK5A 4A3KG 3VNNA 5DISC 3TEKA 3SGIA 5KT7A 3MR6A 5LYJF 5KFUA 4C2MA 2FMAA 4DL4A 1TWFA 2R7ZA 5KFJA 2HVSA 2R7KA 1EUDB 1SFOA 4NZMA 3MWMA 5IYDG 4MTDA 1I1LA 1P8LA 3E5NA 3T9DA 4O3QA 3IG0A 3MR2A 4JUZA 3SE7A 3TIGA 4ECVA 4ED8A 1PX2A 2R87A 5EZYF 1I1MA 4DV4H 2DLNA 3Q8QB 5L1IA 2QF7A 4J9LA 2RGRA 4B3RH 2R8IA 3PO3G 4EYHB 4XZ3B 3T54A 2HIXA 5L1KA 2R8GA 5KFTA 2NVXA 2Q7DA 1A0IA 4FM9A 4YR2A 4EEYA 4QW9A 2P0AA 5C5JA 2DPIA 2DZDA 4C5BA 3K5HA 5K2MA 3I4NG 1K1SA 4A3DG 3HOXG 3MWDA 3T7AA 3PW2A 1TAEA 3BQ1A 4ECXA 2V59A 4FFRA 5BYBA 5CE8A 2FLPA 1I6UA 1K1QA 5FD6A 4E6NA 4Q43A 4ZOLF 4LF8H 5IWAH 5J2TF 2NVYA 3QZ7A 1CKMA 4DL6A 5IT9W 3BG5A 4FFMA 4FGRA 4YAKB 5CA0F 1CQJB 3H40A 3BQ0A 4ED7A 2UXCH 2V58A 2C00A 4C5CA 3R5FA 4I7HA 4GKJH 1T36A 4ZQIA 2FJZA 4APMA 4MA5A 4DR2H 1P16A 2R93A 4JXUA 1T94A 3GV5B 3M9NB 1A3GA 1JDEA 4A2BA 3BJYA 2I8CA 2W8LA 5H80A 1N56A 3VMMA 3ETHA 3OSNA 4R7RA 2XCPA 3RAXA 3RJ0A 4YQWA 3TW6A 4ED3A 1EYZA 3R5HA 3TQ1A 5CAEB 3MR5A 3PO2G 1I2LA 3V4SA 4LMYA 2DAAA 5IYCG 5KFEA 5IP9G 2ZDHA 2VPQA 3JSNA 5KFCA 2JEJA 5LL6b 3T1YH 1DV2A 3U55A 2RF4A 3PW0A 2ASLA 2Z04A 3T5KA 4LSAA 4FBUA 2IA6A 3N8DA 2Z02A 4DV1H 4YBZB 1BJTA 3BACA 1S0MA 5BWVA 1K83A 3L2PA 4LF7H 3GTOA 5FLXW 1ZAUA 4O2AF 3GIMA 4L1KA 3WWIA 4KHPH 4RZRA 2J6UA 2HJWA 3TY9A 1KUTA 3KALA 3WWJA 5KFWA 3ORQA 2CZGA 4NZNA 3TY5A 2YS6A 3K3PA 4TM5A 4QJFA 5KFKA 3J81W 4CE5A 4UCVA 1RYSA 4O7YA 5BWTA 2OWOA 1Y14B 4X66H 2BQ3A 4O4LF 3EPGA 4IWYA 3KXYT 4A3BG 1M6VA 1ET0A 1S68A 4YAJB 1SYXB 3RIZA 4XYMB 5E25A 5CA1F 5FLMG 2UUAH 1GLVA 2VR1A 2R7LA 1DGSA 2W7PA 2R8JA 2V9WA 1B04A 2JA7A 2XIGA 1N36H 2FE3A 2Q2TA 2JA6A 1I7NA 4FE2A 5JVLA 2R7MA 2JA5G 5DGAA 4EBEA 3JZIA 2WYOA 3TQTA 4Q4CA 2JA7G 3Q2OA 2PMZA 1IYEA 3SI8A 4EFEA 1KT8A 1KEEA 1JIHA 4J9PA 5F9NA 1S0OA 3TW7A 4K6NA 1ZHSA 4EBDA 3RB0A 3GLKA 1BXRA 3HBLA 1RJPA 4FS1A 4ECUA 2CQYA 2FPPB 3KHGA 4LFBH 3N43B 4WBNF 5HV6A 1IYDA 5KG4A 5DGHA 1EHIA 4DV7H 4O3PA 2CNUA 4LH7A 2FKLA 1TWAA 4I55F 2JEGA 1GGOA 1L2ZA 1A0GA 4A2AA 2ODTX 3JRXA 4MV6A 5I60A 3K3VA 2XCAA 2R6FA 5KFLA 3ETJA 3MR3A 3DTGA 2FK3A 2YS7A 2YYAA 2W57A 4J0MA 3PVXA 4BWSC 5JQGF 1Z2NX 2WTFA 4MV7A 1TA8A 5KFXA 5K3WA 5C3EG 3Q8RB 4A3IG 4CMFA 3S24A 2VOBA 5DLGA 1W96A 4CKEA 1RK5A 4DV2H 4G3IA 1TWHA 1RK6A 5EWFA 2E5LH 4GLWA 2YRWA 3N44B 5KT6A 2XC9A 1OBDA 5C1OA 2UU9H 4DR7H 4PZ6A 3CSWA 4O3NA 4QWAA 5KFMA 4FFPA 1S03G 4F4YA 1VAJA 1I1KA 3GJXB 3FMAA 3DTFA 4BBSG 1KJIA 3VPBA 3NGDA 2C28A 1HR0H 2FLNA 3JSLA 3KHRA 2PBZA 1M0WA 3PN1A 3N6XA 4RB0A 4RUCA 4F50A 2UUCH 3J7AK 5C1PA 4FBTA 1V51A 4QW8A 1WRVA 2JA8G 4PBCA 5KG5A 4LFCH 3G8CA 4JI2H 5FPOA 3N6RA 1A9XA 1TWGA 5F9LA 1IOWA 2UVWA 3VA7A 2R85A 4ECRA 2R92G 3FDSA 4M0JA 2ASJA 2Q2UA 3IN5A 1Y1VG 1ULZA 3RV3A 4RB2C 4DLKA 4Y8VB 2AGPA 4RB1A 4NLGA 5D1OB 3RB6A 4TV8F 4DV6H 4X64H 2XD4A 3OTOH 4I4TF 5KFDA 3N40P 4BY1G 1IBLH 4F4WA 2YZNA 5FNVF 5I47A 3GTGA 4DR5H 1E4EB 1UC8A 2ZGIA 5LA6F 3RB4A 4JYAH 1UNNC 4YR3A 2HVRA 1JKJB 1HNXH 4FFOA 2VUMG 3NUAA 1FVIA 3M9OB 2W9BA 3CQZA 5DQIA 5BWWA 3AX6A 4O82A 1ZHQA 4O2BF 4RAZA 2W6MA 3G6XA 2MCTA 1KJQA 1RYRA 2RDIA 4O81A 3UYYA 4IHJF 4EG0A 2X0SA 2X5RA 4DIMA 4TQSA 3QQMA 2XGQA 4ECWA 1S97A 5KFSA 3KAKA 4O7RA 3G6YA 3HOYG 4BY7G 4CHIA 2WAQA 4HR7A 4ZI7F 1WCMG 4RUAA 1I94H 4LFAH 4DL5A 2W9CB 5DMXA 3V6JA 4R8UB 1XNQH 4QWEA 3K5IA 1O75A 2J9GA 4RCNA 4DV3H 4X65H 2HGSA 2C2DA 4O3SA 5LXTF 4FFNA 4M9UA 3WNZA 5I5WA 1B33N 3PR4A 3J80W 3AYHB 5DLFA 2VA3A 4ME6A 3HOVG 4LF6H 3JAMW 4TQRA 5C4XG 4RNOA 2E2HA 5LMUH 2WB1A 2W71A 1SEIA 3GTLA 3LWBA 1IBMH 2VUGA 3JRWA 3M4IA 1I50A 4AYBE 5JUMA 4TV9F 3PW4A 4IRCA 3F8NA 2FK2A 5EWGA 2BQRA 3H20A 4O86A 4A3GG 3TIIA 4MTEA 1EUCB 3LP8A 3HO8A 3U0GA 4YB8B 2C2RA 1KJ9A 3MJFA 5KG7A 1Y1WA 2JEIA 2J6SA 3RF2A 5D1PA 4DR1H 5IP7G 2BR0A 2F4VH 3R23A 5HNEA 2COIA 4YJ3F 3N42B 4DL2A 2VA2A 5C44G 3T9EA 1C30A 3KTMA 2CW7A 2CW8A 1VKZA 2W6QA 3GIIA 3GIPA 1ZQ7A 2PMZE 1C3OA 1PK8A 1KBLA 3LMLA 4AYBA 2ZM6H 3V6HA 4A93G 4JV0A 4MV9A 5KT3A 5DG8A 1N48A 2YU9A 1CS0A 5L1JA 5DG9A 2C22A 3WO1A 4JV1A 3KHLA 5JH7F 1HNZH 4UCOA 1X9NA 4QSHA 4RNNA 1ZETA 4MV4A 2C2EA 3VPCA 3RBEA 2EJ0A 5KG0A 2R82A 4O83A 3SNOA 4HNUA 5L9XA 4WD3A 4IR9A 2B63G 3HT5A 3GDEA 4O7SA 3KAJA 3PW7A 5KFIA 2I87A 3BABA 4ED0A 5BWRA 1B6RA 4EYIB 4ECYA 3CEBA 3I12A 2ZJTA 4I50F 5D1OA 2DWCA 5L1LA 4UUGA 5DQHA 1DIKA 4DUYH 3HOZG 5BPFA 2VQFH 1GO3E 1G2WA 2R84A 4MV8A 3T5JA 3UQ8A 4EGQA 1E4EA 3U9TA 3RR5A 3CVZA 5I5YA 4K0KH 2UVRA 3QZ8A 1KTAA 4EBCA 4A3FG 1BNCA 4O3RA 1VBGA 4NYEA 3OSPA 2CKZB 4ETSA 4A3JG 4RZQA 4O4JF 2DIKA 2GQRA 4ECTA 1T3NA 1XNRH 2PVPA 3I4MG 5KFRA 2HVQA 2CNQA 1WSCA 4RB3C 3M9MB 1IBKH 3PW5A 1EZ1A 3Q8SB 2YWVA 4U7CA 1FJGH 4TVIA 4QIWA 4XX0B 4JI8H 5DAAA 4O3OA 4O7VA 4GC7A 1R9TA 4O7NA 4B3MH 4JI1H 2W9CA 1N32H 1VBHA 4DR4H 4R8UA 3HB9A 1AUXA 3NBYB 5J2UF 5EDWA 4RAYA 2RDJA 4FFLA 2COJA 3H0GG 1E4GT 2R8HA 2W8KA 1RJRA 2AGOA 2IMWP 2UXBH 1V4YA 1CKNB 5LP6F 4NXNH 4CKBA 5KFNA 2YW2A 4LF4H 4RNMA 1VS0A 4GC6A 4O7ZA 5KFAA 1JLLB 1I3QA 1KJ8A 4O4IF 4WHXA 3WO0A 1Y1VA 5T14A 1I2KA 4HN2A 4ED6A 4X62H 5KKNB 2W6PA 5EOYA 4HYKA 3FKIG 2ABJA 3OUUA 5JVDF 2FP4B 5KFOA 3W1BA 4O7WA 4J9OA 3W5OA 3HKZA 3PZPA 3JZ6A 5DGIA 2FPGB 5I5VA 4JI5H 4E4TA 4ECSA 1HNWH 5EWEA 5KX5F 2O03A 3TINA 2RGVA 2Y0SE 2W6NA 1EKFA 4YJ2F 4DAAA 2VQEH 5FR9A 3VOTA 2VUMA 2YCHA 4NZOA 1AUVA 4DV5H 3GQCA 3DAAA 3H4BA 2CFMA 2NU6B 1XMQH 2EJ2A 3QFFA 3GTPA 1WH2A 4UFZA 1RJQA 2IP4A 5I5TA 2M05A 1GYFA 4A3LG 1EKVA 2WAQE 2QB5A 2WE6A 2EIYA 3RV4A 1WCMA 4IRKA 4IAJA 3RBDA 2YZGA 3GIQA 4Q8FA 1Z2PX 4DRFA 3GB8B 2Y0SA 5A2QW 3H4DA 3T5LA 2XGPA 4JI6H 1GSOA 4OX9H 3RAQA 4IIJF 5KFBA 4O4HF 4U6PA 1CQIB 5KFZA 4AQYH 2GPSA 3GILA 3KHHA 3RB3A 1XMOH 4IZOA 1TWCA 2WB1E 2R7ZG 3KREA 3GIDA 4A3MG 3UZOA 3AW8A 4ED2A 3TY8A 4EGJA 2ZDGA 2C35B 3MFHA 2ATLA 4EEQA 5FJ8G 2FLLA 4A3CG 5BWXA 4LH6A 5KT5A 2IBKA 3QWUA 1BGWA 4NXMH 5I5SA 1KJJA 3UZBA 5KG2A 4DR3H 3GIJA 1DAAA 3BAAA 3NBZB 3HOWG 3MWEA 3V4ZA 3JZFA 5BMVF 2W7OA 2UUBH 3RFCA 4JI0H 5KG6A 4LSXA 2COGA 1AN7A 4B3TH 3N41B 4IR1A 4DR6H 4HNTA 3T5HA 1J5EH 3EPIA 3GTJA 4Q44A 1DV1A 1KC7A 4LF5H 2GQSA 5BYAA 1JXLA 1N33H 4EFBA 2Y4RA 5KFVA 2HHHH 2BQUA 3DF7A 4QWDA 4TUYF 4C5AA 2VQDA 3T9FA 3GV7B 4UCTA 2NU7B 1WR2A 4DUZH 5KFHA 4BXXG 3LULA 4F4ZA 5KFGA 5DGBA 4BBRG 2NU9B 4DV0H 4ED1A 2FPIB 2B63A 2YZMA 2HHFB 4YHHH 3RTXA 4DQNA 1CKNA 4QWCA 2EJ3A 3Q8PB 2YL2A 1V9PA 4JI4H 2JA5A 4MA0A 2PN1A 1JDBB 2HG8A 5CR5A 2CNVA 3WWHA 3GIKA 1S0NA 2KSWA 5CM0A 4ECZA 3OHBA 1IOVA 3OHAA 3T1HH 2DPJA 2R93G 3HXLA 3BA9A 1XDNA 5LOVF 5GONF 1EKPA 3G6VA 5KS8A 5BPHA 4J9MA 1W93A 4LF9H 3HOUG 3BA8A 3T99A 2W9AA 3T9AA 5I5XA 4JV5H 4CC5A 1N34H 2HGWA 2VPSA 4J9KA 4Q4DA 1I7LA 4IRDA 4PDBA 4PZ7A 4J9SA 1GSAA 4MAMA 3GTMA 2SCUB 4M7EA 5CB4F 1A48A 1M0TA
chains in the Genus database with same CATH topology
5D1OB 3RJ0A 4DV6H 1E4GT 2UXBH 5FPRA 4X64H 1MZBA 3OTOH 2WDTA 1IBLH 1CKNB 3N40P 4NXNH 4LMYA 4LF4H 5LMNH 1VS0A 4CC6A 3EYYA 4Q0YA 4EQ5A 4DR5H 1FKAH 3RGXA 3JSNA 4X62H 4JYAH 5EOYA 5LL6b 3T1YH 2HVRA 1HNXH 3W1BA 1FVIA 4LSAA 2UXDH 3W5OA 4DV1H 4JI7H 1BJTA 1ZHQA 3L4JA 1E4FT 4RAZA 3L2PA 4LF7H 4PZ8A 5FLXW 2MCTA 4JI5H 4KHPH 1HNWH 2O03A 2RGVA 4GKKH 3TY9A 3RGZA 3KALA 5BR8H 3KAKA 2HIVA 3TY5A 4B3SH 2VQEH 3J81W 1I94H 4UCVA 2YCHA 4YY3H 1CKOA 4LFAH 2OWOA 4DV5H 4X66H 1XNQH 2CFMA 1XMQH 1O75A 4UCSA 4DV3H 3KXYT 1WH2A 2HGSA 4X65H 1S68A 4UFZA 1GYFA 1SYXB 3RIZA 3J80W 2UUAH 2WE6A 4LF6H 3JAMW 4JI3H 1DGSA 5LMUH 4IAJA 1SEIA 1B04A 1Z2PX 4DRFA 2VUGA 3GB8B 2XIGA 3M4IA 2FE3A 5A2QW 3L4KA 1N36H 3F8NA 2Q2TA 4JI6H 4UCRA 5FD5A 4OX9H 3H20A 4AQYH 3NC0B 4MTEA 3KYHC 2WYOA 1XMOH 3W1GA 4EFEA 4UCUA 3TY8A 3RF2A 5D1PA 1Z2OX 1ZHSA 4DR1H 4LFBH 4EEQA 3C0FB 2F4VH 4GLXA 3N42B 3N43B 1XK5A 4LH6A 3VNNA 3QWUA 1BGWA 2CW7A 2CW8A 5DISC 4NXMH 4DV7H 2ZM6H 4LH7A 4DR3H 3LMLA 3BAAA 3NBZB 2UUBH 4MV9A 4JI0H 2HVSA 1L2ZA 4LSXA 1AN7A 3MWMA 4A2AA 1P8LA 3N41B 4MTDA 4B3TH 4DR6H 1J5EH 1HNZH 4UCOA 1X9NA 3IG0A 3K3VA 4RB2C 4LF5H 2W57A 4J0MA 4EFBA 1N33H 4BWSC 4DV4H 2HHHH 3GDEA 1Z2NX 3KAJA 4MV7A 1TA8A 2RGRA 3DF7A 4B3RH 3S24A 3BABA 2VOBA 2HIXA 4UCTA 4DV2H 4DUZH 2E5LH 1A0IA 2ZJTA 4FM9A 5D1OA 3N44B 4DV0H 4DUYH 1IBMH 2UU9H 4YHHH 2VQFH 4PZ6A 4DR7H 3RTXA 4JI4H 1CKNA 1V9PA 1TAEA 3UQ8A 1S03G 3RR5A 1I6UA 3CVZA 2KSWA 4K0KH 5FD6A 4E6NA 3GJXB 3FMAA 3T1HH 4LF8H 3HXLA 3BA9A 1XDNA 4ETSA 5IWAH 1HR0H 4RZQA 3JSLA 1CKMA 3N6XA 3PN1A 1M0WA 2UUCH 4RB0A 1XNRH 3J7AK 5IT9W 2HVQA 1IBKH 4RB3C 2UXCH 4LF9H 1FJGH 4I7HA 4GKJH 3BA8A 4JV5H 4LFCH 4CC5A 4JI2H 5FPOA 4APMA 1N34H 4JI8H 4DR2H 2VPSA 1P16A 4B3MH 4PDBA 4PZ7A 4JI1H 1N32H 4A2BA 4DR4H 2Q2UA 3NBYB 4M7EA 4RAYA 4R7RA 1M0TA 4RB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1O B;  5FPR A;  1CKN B;  1VS0 A;  4CC6 A;  4EQ5 A;  3JSN A;  2HVR A;  3W1B A;  1FVI A;  3W5O A;  3L2P A;  4PZ8 A;  3TY9 A;  2HIV A;  3TY5 A;  4UCV A;  1CKO A;  2OWO A;  2CFM A;  4UCS A;  1S68 A;  4UFZ A;  1DGS A;  1B04 A;  4DRF A;  2VUG A;  3GB8 B;  2Q2T A;  4UCR A;  3NC0 B;  3KYH C;  3W1G A;  4EFE A;  4UCU A;  3TY8 A;  5D1P A;  4EEQ A;  4GLX A;  1XK5 A;  4LH6 A;  3VNN A;  3QWU A;  5DIS C;  4LH7 A;  3BAA A;  3NBZ B;  2HVS A;  1P8L A;  4UCO A;  1X9N A;  4EFB A;  3GDE A;  1TA8 A;  3S24 A;  3BAB A;  2HIX A;  4UCT A;  1A0I A;  5D1O A;  4PZ6 A;  3RTX A;  1CKN A;  1V9P A;  1TAE A;  3UQ8 A;  3RR5 A;  4E6N A;  3GJX B;  3BA9 A;  1XDN A;  3JSL A;  1CKM A;  3PN1 A;  2HVQ A;  3BA8 A;  4CC5 A;  5FPO A;  1P16 A;  4PZ7 A;  2Q2U A;  3NBY B; 
#chains in the Genus database with same CATH topology
 4CKC A;  2YRX A;  4J9Q A;  1B6S A;  1CE8 A;  3ORR A;  4QIW E;  5FPR A;  1S9F A;  2FB9 A;  2FK1 A;  3U9S A;  1MZB A;  2WDT A;  5DG7 A;  4Q8E A;  5IYZ F;  3G8D A;  3PFF A;  4CC6 A;  3MFI A;  3EYY A;  5LMN H;  4Q0Y A;  5KG3 A;  2AU0 A;  4EQ5 A;  1FKA H;  3RGX A;  2NUA B;  1Y1W G;  4JV2 A;  3GTK A;  4ECQ A;  3H0G A;  5JQW A;  2V4R A;  3GV8 B;  2ALZ A;  4HNV A;  2UXD H;  3GTQ A;  4MV1 A;  2W9B B;  4JI7 H;  3L4J A;  1E4F T;  2QK4 A;  4PZ8 A;  4XYL B;  5KT4 A;  4YR0 A;  3VPD A;  3H3V H;  2DAB A;  2HDK A;  4HQ6 A;  2V5A A;  2AQ4 A;  4GKK H;  5D8D A;  2W6O A;  3OUZ A;  4O7L A;  3RGZ A;  2R7N A;  3T9B A;  5BR8 H;  3BQ2 A;  2HIV A;  2GPW A;  3FKI A;  2R86 A;  4J9R A;  1UC9 A;  2ASD A;  2J6T A;  4B3S H;  1GSH A;  3HKZ E;  1CKO A;  5KG1 A;  4YY3 H;  2R8K A;  4IWX A;  5KT2 A;  3R5X A;  3V6K A;  2HGX A;  5HBR B;  4FS2 A;  4UCS A;  3LQS A;  4F4X A;  2A1H A;  4O84 A;  1OWT A;  4CMD A;  3T9C A;  4Q45 A;  2JA6 G;  3R9R A;  5KFF A;  2W70 A;  2I80 A;  2OH2 A;  5KFY A;  4JI3 H;  2R92 A;  5BWU A;  3PR5 B;  4FU0 A;  4MV3 A;  2E2I A;  2OLS A;  4ZHQ F;  3L4K A;  2UVU A;  2ZDQ A;  2NU8 B;  5DQG A;  2XCL A;  1M7J A;  5KFP A;  2JEF A;  4QWB A;  3UFX B;  2W6Z A;  4UCR A;  3RUP A;  5I5U A;  5FD5 A;  3NC0 B;  4A3E G;  3KYH C;  1SCU B;  2YZL A;  5C8Y F;  3W1G A;  2V4Q A;  1JX4 A;  4J9N A;  5IYB G;  4RU9 A;  1S10 A;  4YP3 A;  4PWQ A;  4DL3 A;  3Q1K A;  3U54 A;  2AGQ A;  5KFQ A;  4O7T A;  4UCU A;  2UVV A;  1Z2O X;  2HHF A;  4DL7 A;  1OBG A;  2GLT A;  3C0F B;  4GLX A;  2QYZ A;  1XK5 A;  4A3K G;  3VNN A;  5DIS C;  3TEK A;  3SGI A;  5KT7 A;  3MR6 A;  5LYJ F;  5KFU A;  4C2M A;  2FMA A;  4DL4 A;  1TWF A;  2R7Z A;  5KFJ A;  2HVS A;  2R7K A;  1EUD B;  1SFO A;  4NZM A;  3MWM A;  5IYD G;  4MTD A;  1I1L A;  1P8L A;  3E5N A;  3T9D A;  4O3Q A;  3IG0 A;  3MR2 A;  4JUZ A;  3SE7 A;  3TIG A;  4ECV A;  4ED8 A;  1PX2 A;  2R87 A;  5EZY F;  1I1M A;  4DV4 H;  2DLN A;  3Q8Q B;  5L1I A;  2QF7 A;  4J9L A;  2RGR A;  4B3R H;  2R8I A;  3PO3 G;  4EYH B;  4XZ3 B;  3T54 A;  2HIX A;  5L1K A;  2R8G A;  5KFT A;  2NVX A;  2Q7D A;  1A0I A;  4FM9 A;  4YR2 A;  4EEY A;  4QW9 A;  2P0A A;  5C5J A;  2DPI A;  2DZD A;  4C5B A;  3K5H A;  5K2M A;  3I4N G;  1K1S A;  4A3D G;  3HOX G;  3MWD A;  3T7A A;  3PW2 A;  1TAE A;  3BQ1 A;  4ECX A;  2V59 A;  4FFR A;  5BYB A;  5CE8 A;  2FLP A;  1I6U A;  1K1Q A;  5FD6 A;  4E6N A;  4Q43 A;  4ZOL F;  4LF8 H;  5IWA H;  5J2T F;  2NVY A;  3QZ7 A;  1CKM A;  4DL6 A;  5IT9 W;  3BG5 A;  4FFM A;  4FGR A;  4YAK B;  5CA0 F;  1CQJ B;  3H40 A;  3BQ0 A;  4ED7 A;  2UXC H;  2V58 A;  2C00 A;  4C5C A;  3R5F A;  4I7H A;  4GKJ H;  1T36 A;  4ZQI A;  2FJZ A;  4APM A;  4MA5 A;  4DR2 H;  1P16 A;  2R93 A;  4JXU A;  1T94 A;  3GV5 B;  3M9N B;  1A3G A;  1JDE A;  4A2B A;  3BJY A;  2I8C A;  2W8L A;  5H80 A;  1N56 A;  3VMM A;  3ETH A;  3OSN A;  4R7R A;  2XCP A;  3RAX A;  3RJ0 A;  4YQW A;  3TW6 A;  4ED3 A;  1EYZ A;  3R5H A;  3TQ1 A;  5CAE B;  3MR5 A;  3PO2 G;  1I2L A;  3V4S A;  4LMY A;  2DAA A;  5IYC G;  5KFE A;  5IP9 G;  2ZDH A;  2VPQ A;  3JSN A;  5KFC A;  2JEJ A;  5LL6 b;  3T1Y H;  1DV2 A;  3U55 A;  2RF4 A;  3PW0 A;  2ASL A;  2Z04 A;  3T5K A;  4LSA A;  4FBU A;  2IA6 A;  3N8D A;  2Z02 A;  4DV1 H;  4YBZ B;  1BJT A;  3BAC A;  1S0M A;  5BWV A;  1K83 A;  3L2P A;  4LF7 H;  3GTO A;  5FLX W;  1ZAU A;  4O2A F;  3GIM A;  4L1K A;  3WWI A;  4KHP H;  4RZR A;  2J6U A;  2HJW A;  3TY9 A;  1KUT A;  3KAL A;  3WWJ A;  5KFW A;  3ORQ A;  2CZG A;  4NZN A;  3TY5 A;  2YS6 A;  3K3P A;  4TM5 A;  4QJF A;  5KFK A;  3J81 W;  4CE5 A;  4UCV A;  1RYS A;  4O7Y A;  5BWT A;  2OWO A;  1Y14 B;  4X66 H;  2BQ3 A;  4O4L F;  3EPG A;  4IWY A;  3KXY T;  4A3B G;  1M6V A;  1ET0 A;  1S68 A;  4YAJ B;  1SYX B;  3RIZ A;  4XYM B;  5E25 A;  5CA1 F;  5FLM G;  2UUA H;  1GLV A;  2VR1 A;  2R7L A;  1DGS A;  2W7P A;  2R8J A;  2V9W A;  1B04 A;  2JA7 A;  2XIG A;  1N36 H;  2FE3 A;  2Q2T A;  2JA6 A;  1I7N A;  4FE2 A;  5JVL A;  2R7M A;  2JA5 G;  5DGA A;  4EBE A;  3JZI A;  2WYO A;  3TQT A;  4Q4C A;  2JA7 G;  3Q2O A;  2PMZ A;  1IYE A;  3SI8 A;  4EFE A;  1KT8 A;  1KEE A;  1JIH A;  4J9P A;  5F9N A;  1S0O A;  3TW7 A;  4K6N A;  1ZHS A;  4EBD A;  3RB0 A;  3GLK A;  1BXR A;  3HBL A;  1RJP A;  4FS1 A;  4ECU A;  2CQY A;  2FPP B;  3KHG A;  4LFB H;  3N43 B;  4WBN F;  5HV6 A;  1IYD A;  5KG4 A;  5DGH A;  1EHI A;  4DV7 H;  4O3P A;  2CNU A;  4LH7 A;  2FKL A;  1TWA A;  4I55 F;  2JEG A;  1GGO A;  1L2Z A;  1A0G A;  4A2A A;  2ODT X;  3JRX A;  4MV6 A;  5I60 A;  3K3V A;  2XCA A;  2R6F A;  5KFL A;  3ETJ A;  3MR3 A;  3DTG A;  2FK3 A;  2YS7 A;  2YYA A;  2W57 A;  4J0M A;  3PVX A;  4BWS C;  5JQG F;  1Z2N X;  2WTF A;  4MV7 A;  1TA8 A;  5KFX A;  5K3W A;  5C3E G;  3Q8R B;  4A3I G;  4CMF A;  3S24 A;  2VOB A;  5DLG A;  1W96 A;  4CKE A;  1RK5 A;  4DV2 H;  4G3I A;  1TWH A;  1RK6 A;  5EWF A;  2E5L H;  4GLW A;  2YRW A;  3N44 B;  5KT6 A;  2XC9 A;  1OBD A;  5C1O A;  2UU9 H;  4DR7 H;  4PZ6 A;  3CSW A;  4O3N A;  4QWA A;  5KFM A;  4FFP A;  1S03 G;  4F4Y A;  1VAJ A;  1I1K A;  3GJX B;  3FMA A;  3DTF A;  4BBS G;  1KJI A;  3VPB A;  3NGD A;  2C28 A;  1HR0 H;  2FLN A;  3JSL A;  3KHR A;  2PBZ A;  1M0W A;  3PN1 A;  3N6X A;  4RB0 A;  4RUC A;  4F50 A;  2UUC H;  3J7A K;  5C1P A;  4FBT A;  1V51 A;  4QW8 A;  1WRV A;  2JA8 G;  4PBC A;  5KG5 A;  4LFC H;  3G8C A;  4JI2 H;  5FPO A;  3N6R A;  1A9X A;  1TWG A;  5F9L A;  1IOW A;  2UVW A;  3VA7 A;  2R85 A;  4ECR A;  2R92 G;  3FDS A;  4M0J A;  2ASJ A;  2Q2U A;  3IN5 A;  1Y1V G;  1ULZ A;  3RV3 A;  4RB2 C;  4DLK A;  4Y8V B;  2AGP A;  4RB1 A;  4NLG A;  5D1O B;  3RB6 A;  4TV8 F;  4DV6 H;  4X64 H;  2XD4 A;  3OTO H;  4I4T F;  5KFD A;  3N40 P;  4BY1 G;  1IBL H;  4F4W A;  2YZN A;  5FNV F;  5I47 A;  3GTG A;  4DR5 H;  1E4E B;  1UC8 A;  2ZGI A;  5LA6 F;  3RB4 A;  4JYA H;  1UNN C;  4YR3 A;  2HVR A;  1JKJ B;  1HNX H;  4FFO A;  2VUM G;  3NUA A;  1FVI A;  3M9O B;  2W9B A;  3CQZ A;  5DQI A;  5BWW A;  3AX6 A;  4O82 A;  1ZHQ A;  4O2B F;  4RAZ A;  2W6M A;  3G6X A;  2MCT A;  1KJQ A;  1RYR A;  2RDI A;  4O81 A;  3UYY A;  4IHJ F;  4EG0 A;  2X0S A;  2X5R A;  4DIM A;  4TQS A;  3QQM A;  2XGQ A;  4ECW A;  1S97 A;  5KFS A;  3KAK A;  4O7R A;  3G6Y A;  3HOY G;  4BY7 G;  4CHI A;  2WAQ A;  4HR7 A;  4ZI7 F;  1WCM G;  4RUA A;  1I94 H;  4LFA H;  4DL5 A;  2W9C B;  5DMX A;  3V6J A;  4R8U B;  1XNQ H;  4QWE A;  3K5I A;  1O75 A;  2J9G A;  4RCN A;  4DV3 H;  4X65 H;  2HGS A;  2C2D A;  4O3S A;  5LXT F;  4FFN A;  4M9U A;  3WNZ A;  5I5W A;  1B33 N;  3PR4 A;  3J80 W;  3AYH B;  5DLF A;  2VA3 A;  4ME6 A;  3HOV G;  4LF6 H;  3JAM W;  4TQR A;  5C4X G;  4RNO A;  2E2H A;  5LMU H;  2WB1 A;  2W71 A;  1SEI A;  3GTL A;  3LWB A;  1IBM H;  2VUG A;  3JRW A;  3M4I A;  1I50 A;  4AYB E;  5JUM A;  4TV9 F;  3PW4 A;  4IRC A;  3F8N A;  2FK2 A;  5EWG A;  2BQR A;  3H20 A;  4O86 A;  4A3G G;  3TII A;  4MTE A;  1EUC B;  3LP8 A;  3HO8 A;  3U0G A;  4YB8 B;  2C2R A;  1KJ9 A;  3MJF A;  5KG7 A;  1Y1W A;  2JEI A;  2J6S A;  3RF2 A;  5D1P A;  4DR1 H;  5IP7 G;  2BR0 A;  2F4V H;  3R23 A;  5HNE A;  2COI A;  4YJ3 F;  3N42 B;  4DL2 A;  2VA2 A;  5C44 G;  3T9E A;  1C30 A;  3KTM A;  2CW7 A;  2CW8 A;  1VKZ A;  2W6Q A;  3GII A;  3GIP A;  1ZQ7 A;  2PMZ E;  1C3O A;  1PK8 A;  1KBL A;  3LML A;  4AYB A;  2ZM6 H;  3V6H A;  4A93 G;  4JV0 A;  4MV9 A;  5KT3 A;  5DG8 A;  1N48 A;  2YU9 A;  1CS0 A;  5L1J A;  5DG9 A;  2C22 A;  3WO1 A;  4JV1 A;  3KHL A;  5JH7 F;  1HNZ H;  4UCO A;  1X9N A;  4QSH A;  4RNN A;  1ZET A;  4MV4 A;  2C2E A;  3VPC A;  3RBE A;  2EJ0 A;  5KG0 A;  2R82 A;  4O83 A;  3SNO A;  4HNU A;  5L9X A;  4WD3 A;  4IR9 A;  2B63 G;  3HT5 A;  3GDE A;  4O7S A;  3KAJ A;  3PW7 A;  5KFI A;  2I87 A;  3BAB A;  4ED0 A;  5BWR A;  1B6R A;  4EYI B;  4ECY A;  3CEB A;  3I12 A;  2ZJT A;  4I50 F;  5D1O A;  2DWC A;  5L1L A;  4UUG A;  5DQH A;  1DIK A;  4DUY H;  3HOZ G;  5BPF A;  2VQF H;  1GO3 E;  1G2W A;  2R84 A;  4MV8 A;  3T5J A;  3UQ8 A;  4EGQ A;  1E4E A;  3U9T A;  3RR5 A;  3CVZ A;  5I5Y A;  4K0K H;  2UVR A;  3QZ8 A;  1KTA A;  4EBC A;  4A3F G;  1BNC A;  4O3R A;  1VBG A;  4NYE A;  3OSP A;  2CKZ B;  4ETS A;  4A3J G;  4RZQ A;  4O4J F;  2DIK A;  2GQR A;  4ECT A;  1T3N A;  1XNR H;  2PVP A;  3I4M G;  5KFR A;  2HVQ A;  2CNQ A;  1WSC A;  4RB3 C;  3M9M B;  1IBK H;  3PW5 A;  1EZ1 A;  3Q8S B;  2YWV A;  4U7C A;  1FJG H;  4TVI A;  4QIW A;  4XX0 B;  4JI8 H;  5DAA A;  4O3O A;  4O7V A;  4GC7 A;  1R9T A;  4O7N A;  4B3M H;  4JI1 H;  2W9C A;  1N32 H;  1VBH A;  4DR4 H;  4R8U A;  3HB9 A;  1AUX A;  3NBY B;  5J2U F;  5EDW A;  4RAY A;  2RDJ A;  4FFL A;  2COJ A;  3H0G G;  1E4G T;  2R8H A;  2W8K A;  1RJR A;  2AGO A;  2IMW P;  2UXB H;  1V4Y A;  1CKN B;  5LP6 F;  4NXN H;  4CKB A;  5KFN A;  2YW2 A;  4LF4 H;  4RNM A;  1VS0 A;  4GC6 A;  4O7Z A;  5KFA A;  1JLL B;  1I3Q A;  1KJ8 A;  4O4I F;  4WHX A;  3WO0 A;  1Y1V A;  5T14 A;  1I2K A;  4HN2 A;  4ED6 A;  4X62 H;  5KKN B;  2W6P A;  5EOY A;  4HYK A;  3FKI G;  2ABJ A;  3OUU A;  5JVD F;  2FP4 B;  5KFO A;  3W1B A;  4O7W A;  4J9O A;  3W5O A;  3HKZ A;  3PZP A;  3JZ6 A;  5DGI A;  2FPG B;  5I5V A;  4JI5 H;  4E4T A;  4ECS A;  1HNW H;  5EWE A;  5KX5 F;  2O03 A;  3TIN A;  2RGV A;  2Y0S E;  2W6N A;  1EKF A;  4YJ2 F;  4DAA A;  2VQE H;  5FR9 A;  3VOT A;  2VUM A;  2YCH A;  4NZO A;  1AUV A;  4DV5 H;  3GQC A;  3DAA A;  3H4B A;  2CFM A;  2NU6 B;  1XMQ H;  2EJ2 A;  3QFF A;  3GTP A;  1WH2 A;  4UFZ A;  1RJQ A;  2IP4 A;  5I5T A;  2M05 A;  1GYF A;  4A3L G;  1EKV A;  2WAQ E;  2QB5 A;  2WE6 A;  2EIY A;  3RV4 A;  1WCM A;  4IRK A;  4IAJ A;  3RBD A;  2YZG A;  3GIQ A;  4Q8F A;  1Z2P X;  4DRF A;  3GB8 B;  2Y0S A;  5A2Q W;  3H4D A;  3T5L A;  2XGP A;  4JI6 H;  1GSO A;  4OX9 H;  3RAQ A;  4IIJ F;  5KFB A;  4O4H F;  4U6P A;  1CQI B;  5KFZ A;  4AQY H;  2GPS A;  3GIL A;  3KHH A;  3RB3 A;  1XMO H;  4IZO A;  1TWC A;  2WB1 E;  2R7Z G;  3KRE A;  3GID A;  4A3M G;  3UZO A;  3AW8 A;  4ED2 A;  3TY8 A;  4EGJ A;  2ZDG A;  2C35 B;  3MFH A;  2ATL A;  4EEQ A;  5FJ8 G;  2FLL A;  4A3C G;  5BWX A;  4LH6 A;  5KT5 A;  2IBK A;  3QWU A;  1BGW A;  4NXM H;  5I5S A;  1KJJ A;  3UZB A;  5KG2 A;  4DR3 H;  3GIJ A;  1DAA A;  3BAA A;  3NBZ B;  3HOW G;  3MWE A;  3V4Z A;  3JZF A;  5BMV F;  2W7O A;  2UUB H;  3RFC A;  4JI0 H;  5KG6 A;  4LSX A;  2COG A;  1AN7 A;  4B3T H;  3N41 B;  4IR1 A;  4DR6 H;  4HNT A;  3T5H A;  1J5E H;  3EPI A;  3GTJ A;  4Q44 A;  1DV1 A;  1KC7 A;  4LF5 H;  2GQS A;  5BYA A;  1JXL A;  1N33 H;  4EFB A;  2Y4R A;  5KFV A;  2HHH H;  2BQU A;  3DF7 A;  4QWD A;  4TUY F;  4C5A A;  2VQD A;  3T9F A;  3GV7 B;  4UCT A;  2NU7 B;  1WR2 A;  4DUZ H;  5KFH A;  4BXX G;  3LUL A;  4F4Z A;  5KFG A;  5DGB A;  4BBR G;  2NU9 B;  4DV0 H;  4ED1 A;  2FPI B;  2B63 A;  2YZM A;  2HHF B;  4YHH H;  3RTX A;  4DQN A;  1CKN A;  4QWC A;  2EJ3 A;  3Q8P B;  2YL2 A;  1V9P A;  4JI4 H;  2JA5 A;  4MA0 A;  2PN1 A;  1JDB B;  2HG8 A;  5CR5 A;  2CNV A;  3WWH A;  3GIK A;  1S0N A;  2KSW A;  5CM0 A;  4ECZ A;  3OHB A;  1IOV A;  3OHA A;  3T1H H;  2DPJ A;  2R93 G;  3HXL A;  3BA9 A;  1XDN A;  5LOV F;  5GON F;  1EKP A;  3G6V A;  5KS8 A;  5BPH A;  4J9M A;  1W93 A;  4LF9 H;  3HOU G;  3BA8 A;  3T99 A;  2W9A A;  3T9A A;  5I5X A;  4JV5 H;  4CC5 A;  1N34 H;  2HGW A;  2VPS A;  4J9K A;  4Q4D A;  1I7L A;  4IRD A;  4PDB A;  4PZ7 A;  4J9S A;  1GSA A;  4MAM A;  3GTM A;  2SCU B;  4M7E A;  5CB4 F;  1A48 A;  1M0T A; 
#chains in the Genus database with same CATH homology
 5D1O B;  3RJ0 A;  4DV6 H;  1E4G T;  2UXB H;  5FPR A;  4X64 H;  1MZB A;  3OTO H;  2WDT A;  1IBL H;  1CKN B;  3N40 P;  4NXN H;  4LMY A;  4LF4 H;  5LMN H;  1VS0 A;  4CC6 A;  3EYY A;  4Q0Y A;  4EQ5 A;  4DR5 H;  1FKA H;  3RGX A;  3JSN A;  4X62 H;  4JYA H;  5EOY A;  5LL6 b;  3T1Y H;  2HVR A;  1HNX H;  3W1B A;  1FVI A;  4LSA A;  2UXD H;  3W5O A;  4DV1 H;  4JI7 H;  1BJT A;  1ZHQ A;  3L4J A;  1E4F T;  4RAZ A;  3L2P A;  4LF7 H;  4PZ8 A;  5FLX W;  2MCT A;  4JI5 H;  4KHP H;  1HNW H;  2O03 A;  2RGV A;  4GKK H;  3TY9 A;  3RGZ A;  3KAL A;  5BR8 H;  3KAK A;  2HIV A;  3TY5 A;  4B3S H;  2VQE H;  3J81 W;  1I94 H;  4UCV A;  2YCH A;  4YY3 H;  1CKO A;  4LFA H;  2OWO A;  4DV5 H;  4X66 H;  1XNQ H;  2CFM A;  1XMQ H;  1O75 A;  4UCS A;  4DV3 H;  3KXY T;  1WH2 A;  2HGS A;  4X65 H;  1S68 A;  4UFZ A;  1GYF A;  1SYX B;  3RIZ A;  3J80 W;  2UUA H;  2WE6 A;  4LF6 H;  3JAM W;  4JI3 H;  1DGS A;  5LMU H;  4IAJ A;  1SEI A;  1B04 A;  1Z2P X;  4DRF A;  2VUG A;  3GB8 B;  2XIG A;  3M4I A;  2FE3 A;  5A2Q W;  3L4K A;  1N36 H;  3F8N A;  2Q2T A;  4JI6 H;  4UCR A;  5FD5 A;  4OX9 H;  3H20 A;  4AQY H;  3NC0 B;  4MTE A;  3KYH C;  2WYO A;  1XMO H;  3W1G A;  4EFE A;  4UCU A;  3TY8 A;  3RF2 A;  5D1P A;  1Z2O X;  1ZHS A;  4DR1 H;  4LFB H;  4EEQ A;  3C0F B;  2F4V H;  4GLX A;  3N42 B;  3N43 B;  1XK5 A;  4LH6 A;  3VNN A;  3QWU A;  1BGW A;  2CW7 A;  2CW8 A;  5DIS C;  4NXM H;  4DV7 H;  2ZM6 H;  4LH7 A;  4DR3 H;  3LML A;  3BAA A;  3NBZ B;  2UUB H;  4MV9 A;  4JI0 H;  2HVS A;  1L2Z A;  4LSX A;  1AN7 A;  3MWM A;  4A2A A;  1P8L A;  3N41 B;  4MTD A;  4B3T H;  4DR6 H;  1J5E H;  1HNZ H;  4UCO A;  1X9N A;  3IG0 A;  3K3V A;  4RB2 C;  4LF5 H;  2W57 A;  4J0M A;  4EFB A;  1N33 H;  4BWS C;  4DV4 H;  2HHH H;  3GDE A;  1Z2N X;  3KAJ A;  4MV7 A;  1TA8 A;  2RGR A;  3DF7 A;  4B3R H;  3S24 A;  3BAB A;  2VOB A;  2HIX A;  4UCT A;  4DV2 H;  4DUZ H;  2E5L H;  1A0I A;  2ZJT A;  4FM9 A;  5D1O A;  3N44 B;  4DV0 H;  4DUY H;  1IBM H;  2UU9 H;  4YHH H;  2VQF H;  4PZ6 A;  4DR7 H;  3RTX A;  4JI4 H;  1CKN A;  1V9P A;  1TAE A;  3UQ8 A;  1S03 G;  3RR5 A;  1I6U A;  3CVZ A;  2KSW A;  4K0K H;  5FD6 A;  4E6N A;  3GJX B;  3FMA A;  3T1H H;  4LF8 H;  3HXL A;  3BA9 A;  1XDN A;  4ETS A;  5IWA H;  1HR0 H;  4RZQ A;  3JSL A;  1CKM A;  3N6X A;  3PN1 A;  1M0W A;  2UUC H;  4RB0 A;  1XNR H;  3J7A K;  5IT9 W;  2HVQ A;  1IBK H;  4RB3 C;  2UXC H;  4LF9 H;  1FJG H;  4I7H A;  4GKJ H;  3BA8 A;  4JV5 H;  4LFC H;  4CC5 A;  4JI2 H;  5FPO A;  4APM A;  1N34 H;  4JI8 H;  4DR2 H;  2VPS A;  1P16 A;  4B3M H;  4PDB A;  4PZ7 A;  4JI1 H;  1N32 H;  4A2B A;  4DR4 H;  2Q2U A;  3NBY B;  4M7E A;  4RAY A;  4R7R A;  1M0T A;  4RB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...