1S68A

Structure and mechanism of rna ligase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
b'MFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYCDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA Ligase 2
publication title Structure and mechanism of RNA ligase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
total genus 67
structure length 233
sequence length 233
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1s68A02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s68A01
3GJXB 1FVIA 2HIVA 3TY8A 2HIXA 3QWUA 4UCRA 4EQ5A 3GDEA 4UCSA 3RTXA 1P8LA 4E6NA 1CKNA 3RR5A 4GLXA 4CC6A 5D1OA 4EFBA 3BA9A 5D1PA 3W5OA 3L2PA 3GB8B 2CFMA 1A0IA 1DGSA 4PZ8A 4UCTA 2HVSA 4LH7A 1S68A 1CKNB 2VUGA 4UCUA 5FPOA 1V9PA 3TY9A 2HVQA 2HVRA 3W1GA 3W1BA 3S24A 3UQ8A 4EFEA 3TY5A 1XK5A 3KYHC 3VNNA 4DRFA 4UCVA 4EEQA 4UFZA 2OWOA 3BABA 3JSLA 5DISC 1X9NA 5D1OB 1P16A 1XDNA 2Q2TA 4CC5A 3PN1A 1B04A 1CKOA 2Q2UA 3BAAA 3NBYB 4PZ7A 3BA8A 3NC0B 1CKMA 3NBZB 1VS0A 4PZ6A 4LH6A 1TAEA 1TA8A 3JSNA 5FPRA 4UCOA
chains in the Genus database with same CATH superfamily
5JVDF 1B6SA 1BGWA 4RB0A 2HDKA 2JEGA 3WWHA 4MA5A 1KBLA 5KT2A 5LMUH 4TV9F 3TY8A 4QW8A 1S03G 2NVYA 3PO3G 4WD3A 2WB1A 3Q8RB 5JUMA 4DR3H 2JA6G 3KAJA 3T9CA 5DGHA 5I5TA 3ORQA 3GV5B 5L1KA 3T5JA 4FFLA 3GDEA 5IYZF 4ECQA 4WHXA 2A1HA 5EZYF 5KG7A 3OSPA 3ETHA 1P8LA 5IP7G 1EUCB 2IP4A 2R8JA 4PDBA 2XGQA 1IYEA 5F9LA 5KFTA 2W7OA 5BWUA 5CA0F 3SNOA 3PFFA 3RJ0A 4FGRA 4C5BA 5KFGA 2R87A 2FK3A 2WDTA 2EJ0A 3FKIA 5A2QW 1G2WA 4X66H 3KHGA 4J9MA 4DL3A 2DPIA 4DV1H 1R9TA 4JI2H 3M4IA 4ETSA 4EFBA 4ECSA 3HKZE 1I2LA 4B3TH 4HN2A 1K1QA 5EDWA 5D1PA 5KFHA 4LF9H 3W5OA 5BWRA 2Z02A 2R84A 5FNVF 2AGPA 2FLNA 2XGPA 4YQWA 4O3PA 2CFMA 2VA3A 3WO0A 2EJ3A 4F50A 4JI3H 1I1KA 2O03A 1GSAA 3RGXA 1A0GA 3VPDA 2QK4A 1RJPA 1DV2A 3T5HA 1CQIB 4QWBA 2C28A 2V58A 1CKNB 3RBDA 5GONF 4DR4H 1I7LA 4RAZA 2XCPA 5FLMG 3HOYG 1VBGA 3WNZA 3RB6A 2W9CA 2UU9H 1GYFA 5I5XA 1EZ1A 3GIPA 5KFVA 5EWGA 3PVXA 4ZHQF 5BWVA 5BWXA 4LF7H 3N43B 2YS7A 1I1LA 3S24A 4IRKA 3U54A 3ETJA 2YRWA 3MR5A 4YR2A 4EFEA 3T9DA 2HGSA 2F4VH 5DGAA 1WH2A 5BYAA 3R5XA 3LP8A 3I4MG 5F9NA 3GTMA 1CQJB 3BG5A 2W7PA 1XK5A 2FPIB 5D8DA 2RGVA 4QWCA 5KFQA 1GSHA 3QZ8A 2FPGB 3RUPA 4DR6H 3HOVG 1KEEA 4J9NA 5IT9W 2QF7A 3RV3A 1EHIA 4UFZA 3GIQA 2OWOA 2WE6A 3Q8PB 4RNMA 5KFPA 4JI4H 2B63A 5L1LA 3N8DA 3U55A 3TW7A 1N33H 3HOXG 5KFUA 5KT7A 2X5RA 1N36H 4WBNF 2FMAA 4L1KA 3MWMA 3JZ6A 2CW8A 4PBCA 3VPBA 3OHAA 4F4YA 2AQ4A 4LFBH 4X64H 4Q43A 1B33N 4FFNA 4FU0A 4C2MA 1CKOA 4TQSA 2Q2UA 4DV0H 1ULZA 1T36A 5CM0A 3GIKA 3NC0B 3ORRA 3U9TA 3PR5B 1CKMA 3RB4A 4O7RA 3DAAA 2C35B 4O83A 4HR7A 2XCAA 4YR3A 2JA7G 5I5YA 3BQ1A 3GQCA 2C2DA 4IRCA 2FJZA 4RZRA 1TAEA 3R23A 2JA8G 5K2MA 1HNZH 5KG6A 4DV7H 4JV5H 1L2ZA 3JSNA 1WCMG 4ED7A 3TW6A 2V4QA 2COGA 4UCOA 4BBRG 1BNCA 5DLFA 2GLTA 1IBLH 3GJXB 2R7NA 1FVIA 4TVIA 4NXMH 1HNWH 1RJRA 5CR5A 3T9EA 4EEYA 4O81A 2ASJA 2ASDA 4M0JA 4ME6A 4I50F 3R5HA 5JQWA 2HIXA 3QWUA 4AYBE 5IP9G 2YWVA 5FJ8G 3Q8SB 4B3SH 2UXDH 4O4IF 3Q1KA 3Q8QB 2I80A 2PVPA 1B6RA 3GV8B 2R8HA 2UVUA 4LF5H 3J7AK 3GTLA 2CNQA 2PMZA 3N6XA 4DR1H 2AGOA 2JEIA 4MTDA 4E6NA 3T99A 4Q4CA 2FK1A 2ZGIA 2R82A 2EIYA 4JXUA 5I5SA 1CKNA 1M6VA 4IIJF 4MV8A 3UZOA 2XIGA 3GV7B 2R92A 1KT8A 4HNTA 5KG0A 1S10A 1BXRA 5D1OA 1KJQA 5KS8A 2W9BB 3BA9A 5LOVF 4LSAA 3CEBA 2B63G 2FPPB 2NU8B 5I5WA 5KFYA 3N40P 3GTJA 2JA5A 4FFMA 4J9OA 4DR5H 4QWEA 4RUCA 1GSOA 4TM5A 1JX4A 1A3GA 3U0GA 5DQGA 2VUMA 2HHHH 4TV8F 2R93A 5J2TF 3AW8A 2WAQE 1XNRH 3HOZG 5I5UA 4YR0A 5L9XA 2C00A 1E4GT 4O3QA 2W6NA 3CQZA 5KFEA 1I94H 3RBEA 2W71A 1T3NA 3T9BA 5CE8A 4BY7G 3JAMW 5EWFA 5DMXA 3U9SA 1Y1WG 4CMDA 1EKFA 4LSXA 5KFAA 4AQYH 2IA6A 1Z2OX 4ED6A 4EG0A 2VUGA 5DGIA 4A3JG 1A48A 2W6QA 3T1YH 4NZOA 2WTFA 1PX2A 4YAJB 2RDJA 4DL6A 3JRWA 3TY9A 4FM9A 5EOYA 4OX9H 4A3CG 2UVWA 4JV0A 5IYBG 5JQGF 4ZQIA 5KKNB 4RUAA 3GILA 4QWAA 1AUVA 3W1BA 2ATLA 2WB1E 1DIKA 5KFNA 2ZDGA 3RAQA 5KFCA 4A2BA 3H0GA 4KHPH 2AGQA 4U6PA 4YY3H 5DQIA 3MWEA 2BQ3A 4FFRA 3VA7A 3VMMA 1UNNC 4O3NA 2R8GA 2R7KA 4B3RH 5KG1A 5LMNH 3T54A 4J0MA 5CB4F 2UUCH 3E5NA 4Y8VB 4ECXA 2YZLA 1RK5A 2C22A 3QZ7A 2BR0A 4YBZB 4Q44A 4A3MG 4RB1A 3JRXA 3RFCA 4O7YA 3SE7A 4QW9A 1E4FT 4QIWA 1DAAA 2FK2A 4Q45A 4IWYA 1WR2A 4IR1A 3GTKA 4A93G 5C1OA 4DUZH 5DG9A 1HR0H 1Y1VG 1X9NA 4MTEA 3MR3A 5D1OB 3V4SA 3IN5A 4J9LA 1J5EH 1RYSA 2DZDA 2J6TA 1P16A 1XDNA 4E4TA 2Q2TA 2FB9A 1VKZA 3CSWA 4U7CA 3FMAA 2JEJA 4DV3H 2UUAH 4TUYF 2R86A 4CE5A 2ODTX 3F8NA 2VPQA 3PN1A 5BMVF 3PO2G 5KFOA 1IBMH 2EJ2A 2VA2A 4O7ZA 3T5KA 1OWTA 1M0TA 3M9OB 3OUUA 3AYHB 2BQUA 4XZ3B 4DR7H 4DR2H 3NBYB 4O4HF 4A2AA 2AU0A 3KTMA 4GC7A 3G8CA 1UC8A 4EGJA 3V6HA 1I7NA 3NGDA 2C2RA 2UUBH 4BWSC 1M7JA 1K1SA 2YW2A 1ZQ7A 4YJ3F 5KFDA 4ECWA 3TIGA 2W9AA 2IMWP 3TEKA 3KAKA 2GQSA 4ZOLF 5IYDG 2FLPA 2I8CA 4DV2H 1TA8A 5KFSA 5FLXW 5KT3A 5BPHA 5L1JA 4LF6H 4O7SA 2W9BA 4RZQA 2JEFA 3RB3A 3TQ1A 4O7WA 4MV6A 5I47A 3HT5A 1SCUB 1JIHA 1W93A 5KG3A 1BJTA 3DTGA 2Q7DA 2VQFH 4EBCA 4GKJH 4CKBA 4RB2C 3I4NG 1N34H 2SCUB 1UC9A 5H80A 4FBTA 1VAJA 5C44G 3HOWG 4UCRA 4NZNA 4EQ5A 3PW4A 1O75A 1SFOA 3K3PA 3KREA 3RTXA 3JZIA 4DIMA 4RAYA 2WYOA 4ECVA 3T5LA 4QSHA 2MCTA 4O84A 2NU9B 5BWWA 4CKCA 3I12A 2YCHA 4GLXA 4TQRA 4EBEA 2DWCA 1Z2NX 5JH7F 4FS2A 2HG8A 5KFFA 5DAAA 4YHHH 1WRVA 3GLKA 5JVLA 2ZM6H 4J9KA 4JI8H 4FS1A 1E4EB 2W57A 3VPCA 4RB3C 3RV4A 3IG0A 1FJGH 3GB8B 5LYJF 3TIIA 4MAMA 4NXNH 3C0FB 3OSNA 4QJFA 4F4ZA 4O3SA 4PZ8A 1N32H 2GPSA 3T7AA 1JLLB 4UCTA 5IYCG 3MR6A 2ALZA 1HNXH 2HVSA 4LH7A 4BBSG 2P0AA 1S68A 2YL2A 4HYKA 2QYZA 4F4XA 4MV1A 5I5VA 2VQEH 2FKLA 4DL2A 3G6XA 1JKJB 4DV5H 2KSWA 2GPWA 2NVXA 2J6SA 2NUAB 2CNVA 3K5HA 3N6RA 3SI8A 3PW0A 5HV6A 3EYYA 3FDSA 2DAAA 2JA7A 1EUDB 2HVQA 2W8LA 3K5IA 3KHRA 2PN1A 3W1GA 2QB5A 1KJ9A 4BXXG 1ZETA 2OH2A 3UQ8A 4O4LF 4DUYH 1WSCA 4EBDA 2XCLA 1C30A 2V5AA 3Q2OA 1IOVA 4MV3A 4NZMA 4Q4DA 1WCMA 4LFCH 1I1MA 4JI7H 2HHFA 4EGQA 4IRDA 5J2UF 5T14A 4RU9A 2PMZE 3QQMA 3M9NB 2UVVA 2VR1A 4Q8EA 3KYHC 1M0WA 1N56A 3MJFA 3N41B 4JI0H 1IOWA 3FKIG 1GGOA 2X0SA 4O7VA 4DL5A 1KC7A 3VNNA 1KUTA 1S97A 5KT6A 4JI6H 4DRFA 4UCVA 1ZHSA 5KFZA 4YP3A 5BPFA 4EEQA 3H20A 3MFHA 2E2IA 3RIZA 3M9MB 5LA6F 4HNUA 2ZDQA 5KG2A 2R7MA 2YYAA 3BABA 5KT4A 3BACA 4DV4H 2FE3A 1JXLA 4PWQA 4O3RA 5DISC 3PW5A 4FE2A 2W8KA 3UZBA 4ECYA 2YRXA 5BR8H 2W6PA 5HBRB 1I2KA 1EYZA 4ZI7F 4HNVA 1JDBB 3HKZA 4A3FG 4O4JF 1W96A 2VOBA 4O82A 3T9AA 4RNOA 4A3KG 2XD4A 3N42B 1XNQH 4I55F 4NYEA 2FP4B 4M9UA 4UUGA 3OHBA 1CE8A 3GIIA 3BJYA 4GC6A 2E5LH 1ZHQA 4IHJF 1TWHA 3LWBA 2DABA 3KHHA 3AX6A 2W6ZA 1Y14B 3BA8A 5KFJA 4ECUA 2ABJA 4MV9A 4JI1H 4C5AA 2JA6A 1PK8A 1VS0A 2COJA 2YZMA 1TWFA 4DAAA 2V4RA 4PZ6A 4K0KH 1AN7A 1RK6A 2W70A 5CAEB 4LF8H 4I7HA 4LMYA 2FLLA 4R7RA 3G6VA 2R8KA 4J9RA 1Y1WA 3JZFA 2YZGA 1C3OA 5LL6b 3R9RA 4IZOA 5KFIA 4CKEA 3V6KA 3G6YA 1E4EA 1ZAUA 4IWXA 4Q8FA 3MWDA 3VOTA 2DPJA 3RGZA 3PW2A 1KJIA 1TWCA 2COIA 3GTGA 2HIVA 2W6MA 4MV7A 4DLKA 3MFIA 3L4JA 2RGRA 2I87A 2HJWA 4MA0A 5LP6F 4M7EA 5C3EG 2CKZB 1Z2PX 3RB0A 1EKPA 4XYMB 2VPSA 4EYIB 1ET0A 4RCNA 3UFXB 1OBDA 3QFFA 2HHFB 4DV6H 3L4KA 5KFBA 1XMQH 4UCSA 5DQHA 2CZGA 4YB8B 3MR2A 4R8UB 1RYRA 4NLGA 1XMOH 1I3QA 3T9FA 3H3VH 1KTAA 5LXTF 4QIWE 4APMA 3T1HH 1N48A 1GLVA 3RR5A 4J9SA 4GKKH 5KFMA 4HQ6A 4CC6A 4MV4A 4A3EG 2R7ZG 1TWAA 4B3MH 1CS0A 5FD6A 2NU6B 4O3OA 4ED3A 1KJJA 2ZDHA 2OLSA 5L1IA 3TINA 5I60A 3L2PA 1TWGA 2GQRA 4X65H 1JDEA 5BWTA 1EKVA 4O7NA 1Y1VA 3HOUG 4O2AF 3OUZA 3PW7A 1IBKH 3G8DA 2ZJTA 2XC9A 1A0IA 4QWDA 1DGSA 1FKAH 2UXBH 3GTOA 5DGBA 1GO3E 4JUZA 4O7TA 3LQSA 3KALA 1S0MA 3HB9A 1SYXB 1V51A 5C4XG 3GIJA 3SGIA 4O7LA 4CMFA 2DLNA 4IR9A 3GTQA 2VQDA 4FFPA 2J9GA 2HGXA 3RF2A 3GIDA 3LMLA 4IAJA 3OTOH 2V9WA 2E2HA 3EPGA 3V6JA 2YS6A 5FD5A 1OBGA 3WO1A 2V59A 2Z04A 3UYYA 1VBHA 4ECZA 4UCUA 2BQRA 5FPOA 1V9PA 4O2BF 2CW7A 5KFLA 4DL7A 1I50A 2R7ZA 3R5FA 2UVRA 4JYAH 2HVRA 2R7LA 1S0OA 4JV1A 4CHIA 2IBKA 5C1PA 4A3LG 4O86A 2R8IA 1S9FA 1IYDA 3DTFA 4RNNA 4GLWA 5DG7A 4LFAH 3BQ2A 2UXCH 3DF7A 1T94A 4AYBA 3N44B 1I6UA 3TY5A 2YU9A 5K3WA 2R92G 3HXLA 5KX5F 4ECRA 3BQ0A 3RAXA 3KHLA 1A9XA 5CA1F 1V4YA 4F4WA 2ASLA 4X62H 4BY1G 2C2EA 2Y4RA 4EYHB 4A3GG 1AUXA 3K3VA 2PBZA 2DIKA 3PR4A 2JA5G 3CVZA 2W9CB 4G3IA 2HGWA 2YZNA 3JSLA 2VUMG 5BYBA 3WWIA 5KG4A 2M05A 1KJ8A 4DQNA 2Y0SA 2RDIA 2R93G 1SEIA 2J6UA 4JI5H 3H4BA 4JV2A 5C5JA 4ED8A 5KFRA 4CC5A 4ECTA 5EWEA 2R85A 4FBUA 3V4ZA 1K83A 4YJ2F 2W6OA 5FR9A 5HNEA 1DV1A 2CQYA 2RF4A 5IWAH 1B04A 2NU7B 4A3IG 5KG5A 5KFKA 2WAQA 1RJQA 4C5CA 3BAAA 3J80W 4PZ7A 5KT5A 3H40A 4ED0A 3H4DA 4ED1A 4Q0YA 2CNUA 4XX0B 4R8UA 3J81W 3NBZB 4J9QA 4J9PA 1S0NA 3GIMA 5E25A 4A3BG 4FFOA 5DLGA 5DG8A 3NUAA 4I4TF 3KXYT 5KFWA 4ED2A 4LF4H 4LH6A 3TQTA 3HBLA 2Y0SE 4DL4A 4K6NA 3WWJA 4A3DG 3LULA 3EPIA 5KFXA 2R6FA 4YAKB 5C8YF 3PZPA 1MZBA 3GTPA 3H0GG 5FPRA 3HO8A 4XYLB
chains in the Genus database with same CATH topology
1BGWA 3GJXB 1BJTA 1FVIA 4RB0A 3RGZA 4NXMH 2VQFH 1HNWH 2HIVA 4MV7A 3L4JA 5LMUH 3TY8A 2RGRA 4GKJH 2ZM6H 4M7EA 4RB2C 1S03G 2HIXA 3QWUA 1Z2PX 1N34H 4B3SH 2VPSA 2UXDH 4DR3H 3KAJA 4DV6H 4UCRA 4EQ5A 3J7AK 3L4KA 1O75A 4LF5H 3GDEA 1XMQH 4UCSA 3RTXA 3N6XA 4DR1H 1P8LA 4MTDA 4E6NA 4RAYA 2WYOA 4PDBA 1XMOH 2MCTA 4APMA 1CKNA 2XIGA 2YCHA 3RJ0A 3T1HH 3RR5A 4GKKH 4GLXA 4X66H 2WDTA 4CC6A 5A2QW 1Z2NX 4DV1H 4YHHH 4B3MH 5D1OA 4JI2H 3M4IA 4ETSA 4EFBA 5FD6A 3BA9A 4LSAA 4JI8H 4B3TH 2W57A 5D1PA 3N40P 4LF9H 3W5OA 4RB3C 4DR5H 3L2PA 3IG0A 1FJGH 4X65H 3GB8B 2HHHH 4NXNH 3C0FB 1IBKH 2CFMA 2ZJTA 1XNRH 1A0IA 1DGSA 4PZ8A 1FKAH 1N32H 4JI3H 2UXBH 1I94H 1E4GT 4UCTA 1HNXH 2HVSA 3KALA 1SYXB 4LH7A 2O03A 3JAMW 1S68A 3RGXA 2VQEH 4LSXA 3OTOH 3RF2A 4AQYH 1Z2OX 3LMLA 4IAJA 4DV5H 1CKNB 2KSWA 4DR4H 2VUGA 4RAZA 5FD5A 3T1YH 2UU9H 4UCUA 5FPOA 1V9PA 3TY9A 2CW7A 3EYYA 5EOYA 4FM9A 4OX9H 1GYFA 4JYAH 2HVQA 2HVRA 3W1GA 4LF7H 3N43B 3W1BA 3S24A 1IBLH 3UQ8A 4DUYH 4KHPH 4A2BA 4LFAH 4EFEA 4LFCH 2HGSA 2F4VH 1WH2A 4JI7H 4YY3H 2UXCH 3DF7A 3N44B 1I6UA 3TY5A 1XK5A 3KYHC 1M0WA 3N41B 4JI0H 3HXLA 4B3RH 2RGVA 5LMNH 4J0MA 2UUCH 3VNNA 4JI6H 4DRFA 4UCVA 1ZHSA 4X62H 4DR6H 5IT9W 4EEQA 3H20A 3RIZA 4RB1A 4UFZA 3K3VA 1E4FT 2OWOA 2WE6A 3BABA 3CVZA 4DV4H 2FE3A 3JSLA 4DUZH 4JI4H 1HR0H 5DISC 4MTEA 1X9NA 5D1OB 1N33H 1J5EH 1P16A 1XDNA 1SEIA 5BR8H 4JI5H 2Q2TA 1N36H 3FMAA 4DV3H 3MWMA 2UUAH 4CC5A 2VOBA 1XNQH 3F8NA 2CW8A 3N42B 3PN1A 2E5LH 5IWAH 4X64H 4LFBH 1IBMH 1B04A 1ZHQA 1CKOA 1M0TA 2Q2UA 4DV0H 3J80W 4DR7H 3BAAA 4DR2H 3NBYB 4PZ7A 3BA8A 4A2AA 3NC0B 4Q0YA 4MV9A 1CKMA 3J81W 4JI1H 3NBZB 2UUBH 1VS0A 4BWSC 3KXYT 4PZ6A 4LF4H 1AN7A 3KAKA 4K0KH 4LH6A 4I7HA 4LF8H 1TAEA 4LMYA 4R7RA 4DV2H 1TA8A 5FLXW 1HNZH 4JV5H 5LL6b 4DV7H 4LF6H 1L2ZA 3JSNA 1MZBA 4RZQA 5FPRA 4UCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJX B;  1FVI A;  2HIV A;  3TY8 A;  2HIX A;  3QWU A;  4UCR A;  4EQ5 A;  3GDE A;  4UCS A;  3RTX A;  1P8L A;  4E6N A;  1CKN A;  3RR5 A;  4GLX A;  4CC6 A;  5D1O A;  4EFB A;  3BA9 A;  5D1P A;  3W5O A;  3L2P A;  3GB8 B;  2CFM A;  1A0I A;  1DGS A;  4PZ8 A;  4UCT A;  2HVS A;  4LH7 A;  1S68 A;  1CKN B;  2VUG A;  4UCU A;  5FPO A;  1V9P A;  3TY9 A;  2HVQ A;  2HVR A;  3W1G A;  3W1B A;  3S24 A;  3UQ8 A;  4EFE A;  3TY5 A;  1XK5 A;  3KYH C;  3VNN A;  4DRF A;  4UCV A;  4EEQ A;  4UFZ A;  2OWO A;  3BAB A;  3JSL A;  5DIS C;  1X9N A;  5D1O B;  1P16 A;  1XDN A;  2Q2T A;  4CC5 A;  3PN1 A;  1B04 A;  1CKO A;  2Q2U A;  3BAA A;  3NBY B;  4PZ7 A;  3BA8 A;  3NC0 B;  1CKM A;  3NBZ B;  1VS0 A;  4PZ6 A;  4LH6 A;  1TAE A;  1TA8 A;  3JSN A;  5FPR A;  4UCO A; 
#chains in the Genus database with same CATH topology
 5JVD F;  1B6S A;  1BGW A;  4RB0 A;  2HDK A;  2JEG A;  3WWH A;  4MA5 A;  1KBL A;  5KT2 A;  5LMU H;  4TV9 F;  3TY8 A;  4QW8 A;  1S03 G;  2NVY A;  3PO3 G;  4WD3 A;  2WB1 A;  3Q8R B;  5JUM A;  4DR3 H;  2JA6 G;  3KAJ A;  3T9C A;  5DGH A;  5I5T A;  3ORQ A;  3GV5 B;  5L1K A;  3T5J A;  4FFL A;  3GDE A;  5IYZ F;  4ECQ A;  4WHX A;  2A1H A;  5EZY F;  5KG7 A;  3OSP A;  3ETH A;  1P8L A;  5IP7 G;  1EUC B;  2IP4 A;  2R8J A;  4PDB A;  2XGQ A;  1IYE A;  5F9L A;  5KFT A;  2W7O A;  5BWU A;  5CA0 F;  3SNO A;  3PFF A;  3RJ0 A;  4FGR A;  4C5B A;  5KFG A;  2R87 A;  2FK3 A;  2WDT A;  2EJ0 A;  3FKI A;  5A2Q W;  1G2W A;  4X66 H;  3KHG A;  4J9M A;  4DL3 A;  2DPI A;  4DV1 H;  1R9T A;  4JI2 H;  3M4I A;  4ETS A;  4EFB A;  4ECS A;  3HKZ E;  1I2L A;  4B3T H;  4HN2 A;  1K1Q A;  5EDW A;  5D1P A;  5KFH A;  4LF9 H;  3W5O A;  5BWR A;  2Z02 A;  2R84 A;  5FNV F;  2AGP A;  2FLN A;  2XGP A;  4YQW A;  4O3P A;  2CFM A;  2VA3 A;  3WO0 A;  2EJ3 A;  4F50 A;  4JI3 H;  1I1K A;  2O03 A;  1GSA A;  3RGX A;  1A0G A;  3VPD A;  2QK4 A;  1RJP A;  1DV2 A;  3T5H A;  1CQI B;  4QWB A;  2C28 A;  2V58 A;  1CKN B;  3RBD A;  5GON F;  4DR4 H;  1I7L A;  4RAZ A;  2XCP A;  5FLM G;  3HOY G;  1VBG A;  3WNZ A;  3RB6 A;  2W9C A;  2UU9 H;  1GYF A;  5I5X A;  1EZ1 A;  3GIP A;  5KFV A;  5EWG A;  3PVX A;  4ZHQ F;  5BWV A;  5BWX A;  4LF7 H;  3N43 B;  2YS7 A;  1I1L A;  3S24 A;  4IRK A;  3U54 A;  3ETJ A;  2YRW A;  3MR5 A;  4YR2 A;  4EFE A;  3T9D A;  2HGS A;  2F4V H;  5DGA A;  1WH2 A;  5BYA A;  3R5X A;  3LP8 A;  3I4M G;  5F9N A;  3GTM A;  1CQJ B;  3BG5 A;  2W7P A;  1XK5 A;  2FPI B;  5D8D A;  2RGV A;  4QWC A;  5KFQ A;  1GSH A;  3QZ8 A;  2FPG B;  3RUP A;  4DR6 H;  3HOV G;  1KEE A;  4J9N A;  5IT9 W;  2QF7 A;  3RV3 A;  1EHI A;  4UFZ A;  3GIQ A;  2OWO A;  2WE6 A;  3Q8P B;  4RNM A;  5KFP A;  4JI4 H;  2B63 A;  5L1L A;  3N8D A;  3U55 A;  3TW7 A;  1N33 H;  3HOX G;  5KFU A;  5KT7 A;  2X5R A;  1N36 H;  4WBN F;  2FMA A;  4L1K A;  3MWM A;  3JZ6 A;  2CW8 A;  4PBC A;  3VPB A;  3OHA A;  4F4Y A;  2AQ4 A;  4LFB H;  4X64 H;  4Q43 A;  1B33 N;  4FFN A;  4FU0 A;  4C2M A;  1CKO A;  4TQS A;  2Q2U A;  4DV0 H;  1ULZ A;  1T36 A;  5CM0 A;  3GIK A;  3NC0 B;  3ORR A;  3U9T A;  3PR5 B;  1CKM A;  3RB4 A;  4O7R A;  3DAA A;  2C35 B;  4O83 A;  4HR7 A;  2XCA A;  4YR3 A;  2JA7 G;  5I5Y A;  3BQ1 A;  3GQC A;  2C2D A;  4IRC A;  2FJZ A;  4RZR A;  1TAE A;  3R23 A;  2JA8 G;  5K2M A;  1HNZ H;  5KG6 A;  4DV7 H;  4JV5 H;  1L2Z A;  3JSN A;  1WCM G;  4ED7 A;  3TW6 A;  2V4Q A;  2COG A;  4UCO A;  4BBR G;  1BNC A;  5DLF A;  2GLT A;  1IBL H;  3GJX B;  2R7N A;  1FVI A;  4TVI A;  4NXM H;  1HNW H;  1RJR A;  5CR5 A;  3T9E A;  4EEY A;  4O81 A;  2ASJ A;  2ASD A;  4M0J A;  4ME6 A;  4I50 F;  3R5H A;  5JQW A;  2HIX A;  3QWU A;  4AYB E;  5IP9 G;  2YWV A;  5FJ8 G;  3Q8S B;  4B3S H;  2UXD H;  4O4I F;  3Q1K A;  3Q8Q B;  2I80 A;  2PVP A;  1B6R A;  3GV8 B;  2R8H A;  2UVU A;  4LF5 H;  3J7A K;  3GTL A;  2CNQ A;  2PMZ A;  3N6X A;  4DR1 H;  2AGO A;  2JEI A;  4MTD A;  4E6N A;  3T99 A;  4Q4C A;  2FK1 A;  2ZGI A;  2R82 A;  2EIY A;  4JXU A;  5I5S A;  1CKN A;  1M6V A;  4IIJ F;  4MV8 A;  3UZO A;  2XIG A;  3GV7 B;  2R92 A;  1KT8 A;  4HNT A;  5KG0 A;  1S10 A;  1BXR A;  5D1O A;  1KJQ A;  5KS8 A;  2W9B B;  3BA9 A;  5LOV F;  4LSA A;  3CEB A;  2B63 G;  2FPP B;  2NU8 B;  5I5W A;  5KFY A;  3N40 P;  3GTJ A;  2JA5 A;  4FFM A;  4J9O A;  4DR5 H;  4QWE A;  4RUC A;  1GSO A;  4TM5 A;  1JX4 A;  1A3G A;  3U0G A;  5DQG A;  2VUM A;  2HHH H;  4TV8 F;  2R93 A;  5J2T F;  3AW8 A;  2WAQ E;  1XNR H;  3HOZ G;  5I5U A;  4YR0 A;  5L9X A;  2C00 A;  1E4G T;  4O3Q A;  2W6N A;  3CQZ A;  5KFE A;  1I94 H;  3RBE A;  2W71 A;  1T3N A;  3T9B A;  5CE8 A;  4BY7 G;  3JAM W;  5EWF A;  5DMX A;  3U9S A;  1Y1W G;  4CMD A;  1EKF A;  4LSX A;  5KFA A;  4AQY H;  2IA6 A;  1Z2O X;  4ED6 A;  4EG0 A;  2VUG A;  5DGI A;  4A3J G;  1A48 A;  2W6Q A;  3T1Y H;  4NZO A;  2WTF A;  1PX2 A;  4YAJ B;  2RDJ A;  4DL6 A;  3JRW A;  3TY9 A;  4FM9 A;  5EOY A;  4OX9 H;  4A3C G;  2UVW A;  4JV0 A;  5IYB G;  5JQG F;  4ZQI A;  5KKN B;  4RUA A;  3GIL A;  4QWA A;  1AUV A;  3W1B A;  2ATL A;  2WB1 E;  1DIK A;  5KFN A;  2ZDG A;  3RAQ A;  5KFC A;  4A2B A;  3H0G A;  4KHP H;  2AGQ A;  4U6P A;  4YY3 H;  5DQI A;  3MWE A;  2BQ3 A;  4FFR A;  3VA7 A;  3VMM A;  1UNN C;  4O3N A;  2R8G A;  2R7K A;  4B3R H;  5KG1 A;  5LMN H;  3T54 A;  4J0M A;  5CB4 F;  2UUC H;  3E5N A;  4Y8V B;  4ECX A;  2YZL A;  1RK5 A;  2C22 A;  3QZ7 A;  2BR0 A;  4YBZ B;  4Q44 A;  4A3M G;  4RB1 A;  3JRX A;  3RFC A;  4O7Y A;  3SE7 A;  4QW9 A;  1E4F T;  4QIW A;  1DAA A;  2FK2 A;  4Q45 A;  4IWY A;  1WR2 A;  4IR1 A;  3GTK A;  4A93 G;  5C1O A;  4DUZ H;  5DG9 A;  1HR0 H;  1Y1V G;  1X9N A;  4MTE A;  3MR3 A;  5D1O B;  3V4S A;  3IN5 A;  4J9L A;  1J5E H;  1RYS A;  2DZD A;  2J6T A;  1P16 A;  1XDN A;  4E4T A;  2Q2T A;  2FB9 A;  1VKZ A;  3CSW A;  4U7C A;  3FMA A;  2JEJ A;  4DV3 H;  2UUA H;  4TUY F;  2R86 A;  4CE5 A;  2ODT X;  3F8N A;  2VPQ A;  3PN1 A;  5BMV F;  3PO2 G;  5KFO A;  1IBM H;  2EJ2 A;  2VA2 A;  4O7Z A;  3T5K A;  1OWT A;  1M0T A;  3M9O B;  3OUU A;  3AYH B;  2BQU A;  4XZ3 B;  4DR7 H;  4DR2 H;  3NBY B;  4O4H F;  4A2A A;  2AU0 A;  3KTM A;  4GC7 A;  3G8C A;  1UC8 A;  4EGJ A;  3V6H A;  1I7N A;  3NGD A;  2C2R A;  2UUB H;  4BWS C;  1M7J A;  1K1S A;  2YW2 A;  1ZQ7 A;  4YJ3 F;  5KFD A;  4ECW A;  3TIG A;  2W9A A;  2IMW P;  3TEK A;  3KAK A;  2GQS A;  4ZOL F;  5IYD G;  2FLP A;  2I8C A;  4DV2 H;  1TA8 A;  5KFS A;  5FLX W;  5KT3 A;  5BPH A;  5L1J A;  4LF6 H;  4O7S A;  2W9B A;  4RZQ A;  2JEF A;  3RB3 A;  3TQ1 A;  4O7W A;  4MV6 A;  5I47 A;  3HT5 A;  1SCU B;  1JIH A;  1W93 A;  5KG3 A;  1BJT A;  3DTG A;  2Q7D A;  2VQF H;  4EBC A;  4GKJ H;  4CKB A;  4RB2 C;  3I4N G;  1N34 H;  2SCU B;  1UC9 A;  5H80 A;  4FBT A;  1VAJ A;  5C44 G;  3HOW G;  4UCR A;  4NZN A;  4EQ5 A;  3PW4 A;  1O75 A;  1SFO A;  3K3P A;  3KRE A;  3RTX A;  3JZI A;  4DIM A;  4RAY A;  2WYO A;  4ECV A;  3T5L A;  4QSH A;  2MCT A;  4O84 A;  2NU9 B;  5BWW A;  4CKC A;  3I12 A;  2YCH A;  4GLX A;  4TQR A;  4EBE A;  2DWC A;  1Z2N X;  5JH7 F;  4FS2 A;  2HG8 A;  5KFF A;  5DAA A;  4YHH H;  1WRV A;  3GLK A;  5JVL A;  2ZM6 H;  4J9K A;  4JI8 H;  4FS1 A;  1E4E B;  2W57 A;  3VPC A;  4RB3 C;  3RV4 A;  3IG0 A;  1FJG H;  3GB8 B;  5LYJ F;  3TII A;  4MAM A;  4NXN H;  3C0F B;  3OSN A;  4QJF A;  4F4Z A;  4O3S A;  4PZ8 A;  1N32 H;  2GPS A;  3T7A A;  1JLL B;  4UCT A;  5IYC G;  3MR6 A;  2ALZ A;  1HNX H;  2HVS A;  4LH7 A;  4BBS G;  2P0A A;  1S68 A;  2YL2 A;  4HYK A;  2QYZ A;  4F4X A;  4MV1 A;  5I5V A;  2VQE H;  2FKL A;  4DL2 A;  3G6X A;  1JKJ B;  4DV5 H;  2KSW A;  2GPW A;  2NVX A;  2J6S A;  2NUA B;  2CNV A;  3K5H A;  3N6R A;  3SI8 A;  3PW0 A;  5HV6 A;  3EYY A;  3FDS A;  2DAA A;  2JA7 A;  1EUD B;  2HVQ A;  2W8L A;  3K5I A;  3KHR A;  2PN1 A;  3W1G A;  2QB5 A;  1KJ9 A;  4BXX G;  1ZET A;  2OH2 A;  3UQ8 A;  4O4L F;  4DUY H;  1WSC A;  4EBD A;  2XCL A;  1C30 A;  2V5A A;  3Q2O A;  1IOV A;  4MV3 A;  4NZM A;  4Q4D A;  1WCM A;  4LFC H;  1I1M A;  4JI7 H;  2HHF A;  4EGQ A;  4IRD A;  5J2U F;  5T14 A;  4RU9 A;  2PMZ E;  3QQM A;  3M9N B;  2UVV A;  2VR1 A;  4Q8E A;  3KYH C;  1M0W A;  1N56 A;  3MJF A;  3N41 B;  4JI0 H;  1IOW A;  3FKI G;  1GGO A;  2X0S A;  4O7V A;  4DL5 A;  1KC7 A;  3VNN A;  1KUT A;  1S97 A;  5KT6 A;  4JI6 H;  4DRF A;  4UCV A;  1ZHS A;  5KFZ A;  4YP3 A;  5BPF A;  4EEQ A;  3H20 A;  3MFH A;  2E2I A;  3RIZ A;  3M9M B;  5LA6 F;  4HNU A;  2ZDQ A;  5KG2 A;  2R7M A;  2YYA A;  3BAB A;  5KT4 A;  3BAC A;  4DV4 H;  2FE3 A;  1JXL A;  4PWQ A;  4O3R A;  5DIS C;  3PW5 A;  4FE2 A;  2W8K A;  3UZB A;  4ECY A;  2YRX A;  5BR8 H;  2W6P A;  5HBR B;  1I2K A;  1EYZ A;  4ZI7 F;  4HNV A;  1JDB B;  3HKZ A;  4A3F G;  4O4J F;  1W96 A;  2VOB A;  4O82 A;  3T9A A;  4RNO A;  4A3K G;  2XD4 A;  3N42 B;  1XNQ H;  4I55 F;  4NYE A;  2FP4 B;  4M9U A;  4UUG A;  3OHB A;  1CE8 A;  3GII A;  3BJY A;  4GC6 A;  2E5L H;  1ZHQ A;  4IHJ F;  1TWH A;  3LWB A;  2DAB A;  3KHH A;  3AX6 A;  2W6Z A;  1Y14 B;  3BA8 A;  5KFJ A;  4ECU A;  2ABJ A;  4MV9 A;  4JI1 H;  4C5A A;  2JA6 A;  1PK8 A;  1VS0 A;  2COJ A;  2YZM A;  1TWF A;  4DAA A;  2V4R A;  4PZ6 A;  4K0K H;  1AN7 A;  1RK6 A;  2W70 A;  5CAE B;  4LF8 H;  4I7H A;  4LMY A;  2FLL A;  4R7R A;  3G6V A;  2R8K A;  4J9R A;  1Y1W A;  3JZF A;  2YZG A;  1C3O A;  5LL6 b;  3R9R A;  4IZO A;  5KFI A;  4CKE A;  3V6K A;  3G6Y A;  1E4E A;  1ZAU A;  4IWX A;  4Q8F A;  3MWD A;  3VOT A;  2DPJ A;  3RGZ A;  3PW2 A;  1KJI A;  1TWC A;  2COI A;  3GTG A;  2HIV A;  2W6M A;  4MV7 A;  4DLK A;  3MFI A;  3L4J A;  2RGR A;  2I87 A;  2HJW A;  4MA0 A;  5LP6 F;  4M7E A;  5C3E G;  2CKZ B;  1Z2P X;  3RB0 A;  1EKP A;  4XYM B;  2VPS A;  4EYI B;  1ET0 A;  4RCN A;  3UFX B;  1OBD A;  3QFF A;  2HHF B;  4DV6 H;  3L4K A;  5KFB A;  1XMQ H;  4UCS A;  5DQH A;  2CZG A;  4YB8 B;  3MR2 A;  4R8U B;  1RYR A;  4NLG A;  1XMO H;  1I3Q A;  3T9F A;  3H3V H;  1KTA A;  5LXT F;  4QIW E;  4APM A;  3T1H H;  1N48 A;  1GLV A;  3RR5 A;  4J9S A;  4GKK H;  5KFM A;  4HQ6 A;  4CC6 A;  4MV4 A;  4A3E G;  2R7Z G;  1TWA A;  4B3M H;  1CS0 A;  5FD6 A;  2NU6 B;  4O3O A;  4ED3 A;  1KJJ A;  2ZDH A;  2OLS A;  5L1I A;  3TIN A;  5I60 A;  3L2P A;  1TWG A;  2GQR A;  4X65 H;  1JDE A;  5BWT A;  1EKV A;  4O7N A;  1Y1V A;  3HOU G;  4O2A F;  3OUZ A;  3PW7 A;  1IBK H;  3G8D A;  2ZJT A;  2XC9 A;  1A0I A;  4QWD A;  1DGS A;  1FKA H;  2UXB H;  3GTO A;  5DGB A;  1GO3 E;  4JUZ A;  4O7T A;  3LQS A;  3KAL A;  1S0M A;  3HB9 A;  1SYX B;  1V51 A;  5C4X G;  3GIJ A;  3SGI A;  4O7L A;  4CMF A;  2DLN A;  4IR9 A;  3GTQ A;  2VQD A;  4FFP A;  2J9G A;  2HGX A;  3RF2 A;  3GID A;  3LML A;  4IAJ A;  3OTO H;  2V9W A;  2E2H A;  3EPG A;  3V6J A;  2YS6 A;  5FD5 A;  1OBG A;  3WO1 A;  2V59 A;  2Z04 A;  3UYY A;  1VBH A;  4ECZ A;  4UCU A;  2BQR A;  5FPO A;  1V9P A;  4O2B F;  2CW7 A;  5KFL A;  4DL7 A;  1I50 A;  2R7Z A;  3R5F A;  2UVR A;  4JYA H;  2HVR A;  2R7L A;  1S0O A;  4JV1 A;  4CHI A;  2IBK A;  5C1P A;  4A3L G;  4O86 A;  2R8I A;  1S9F A;  1IYD A;  3DTF A;  4RNN A;  4GLW A;  5DG7 A;  4LFA H;  3BQ2 A;  2UXC H;  3DF7 A;  1T94 A;  4AYB A;  3N44 B;  1I6U A;  3TY5 A;  2YU9 A;  5K3W A;  2R92 G;  3HXL A;  5KX5 F;  4ECR A;  3BQ0 A;  3RAX A;  3KHL A;  1A9X A;  5CA1 F;  1V4Y A;  4F4W A;  2ASL A;  4X62 H;  4BY1 G;  2C2E A;  2Y4R A;  4EYH B;  4A3G G;  1AUX A;  3K3V A;  2PBZ A;  2DIK A;  3PR4 A;  2JA5 G;  3CVZ A;  2W9C B;  4G3I A;  2HGW A;  2YZN A;  3JSL A;  2VUM G;  5BYB A;  3WWI A;  5KG4 A;  2M05 A;  1KJ8 A;  4DQN A;  2Y0S A;  2RDI A;  2R93 G;  1SEI A;  2J6U A;  4JI5 H;  3H4B A;  4JV2 A;  5C5J A;  4ED8 A;  5KFR A;  4CC5 A;  4ECT A;  5EWE A;  2R85 A;  4FBU A;  3V4Z A;  1K83 A;  4YJ2 F;  2W6O A;  5FR9 A;  5HNE A;  1DV1 A;  2CQY A;  2RF4 A;  5IWA H;  1B04 A;  2NU7 B;  4A3I G;  5KG5 A;  5KFK A;  2WAQ A;  1RJQ A;  4C5C A;  3BAA A;  3J80 W;  4PZ7 A;  5KT5 A;  3H40 A;  4ED0 A;  3H4D A;  4ED1 A;  4Q0Y A;  2CNU A;  4XX0 B;  4R8U A;  3J81 W;  3NBZ B;  4J9Q A;  4J9P A;  1S0N A;  3GIM A;  5E25 A;  4A3B G;  4FFO A;  5DLG A;  5DG8 A;  3NUA A;  4I4T F;  3KXY T;  5KFW A;  4ED2 A;  4LF4 H;  4LH6 A;  3TQT A;  3HBL A;  2Y0S E;  4DL4 A;  4K6N A;  3WWJ A;  4A3D G;  3LUL A;  3EPI A;  5KFX A;  2R6F A;  4YAK B;  5C8Y F;  3PZP A;  1MZB A;  3GTP A;  3H0G G;  5FPR A;  3HO8 A;  4XYL B; 
#chains in the Genus database with same CATH homology
 1BGW A;  3GJX B;  1BJT A;  1FVI A;  4RB0 A;  3RGZ A;  4NXM H;  2VQF H;  1HNW H;  2HIV A;  4MV7 A;  3L4J A;  5LMU H;  3TY8 A;  2RGR A;  4GKJ H;  2ZM6 H;  4M7E A;  4RB2 C;  1S03 G;  2HIX A;  3QWU A;  1Z2P X;  1N34 H;  4B3S H;  2VPS A;  2UXD H;  4DR3 H;  3KAJ A;  4DV6 H;  4UCR A;  4EQ5 A;  3J7A K;  3L4K A;  1O75 A;  4LF5 H;  3GDE A;  1XMQ H;  4UCS A;  3RTX A;  3N6X A;  4DR1 H;  1P8L A;  4MTD A;  4E6N A;  4RAY A;  2WYO A;  4PDB A;  1XMO H;  2MCT A;  4APM A;  1CKN A;  2XIG A;  2YCH A;  3RJ0 A;  3T1H H;  3RR5 A;  4GKK H;  4GLX A;  4X66 H;  2WDT A;  4CC6 A;  5A2Q W;  1Z2N X;  4DV1 H;  4YHH H;  4B3M H;  5D1O A;  4JI2 H;  3M4I A;  4ETS A;  4EFB A;  5FD6 A;  3BA9 A;  4LSA A;  4JI8 H;  4B3T H;  2W57 A;  5D1P A;  3N40 P;  4LF9 H;  3W5O A;  4RB3 C;  4DR5 H;  3L2P A;  3IG0 A;  1FJG H;  4X65 H;  3GB8 B;  2HHH H;  4NXN H;  3C0F B;  1IBK H;  2CFM A;  2ZJT A;  1XNR H;  1A0I A;  1DGS A;  4PZ8 A;  1FKA H;  1N32 H;  4JI3 H;  2UXB H;  1I94 H;  1E4G T;  4UCT A;  1HNX H;  2HVS A;  3KAL A;  1SYX B;  4LH7 A;  2O03 A;  3JAM W;  1S68 A;  3RGX A;  2VQE H;  4LSX A;  3OTO H;  3RF2 A;  4AQY H;  1Z2O X;  3LML A;  4IAJ A;  4DV5 H;  1CKN B;  2KSW A;  4DR4 H;  2VUG A;  4RAZ A;  5FD5 A;  3T1Y H;  2UU9 H;  4UCU A;  5FPO A;  1V9P A;  3TY9 A;  2CW7 A;  3EYY A;  5EOY A;  4FM9 A;  4OX9 H;  1GYF A;  4JYA H;  2HVQ A;  2HVR A;  3W1G A;  4LF7 H;  3N43 B;  3W1B A;  3S24 A;  1IBL H;  3UQ8 A;  4DUY H;  4KHP H;  4A2B A;  4LFA H;  4EFE A;  4LFC H;  2HGS A;  2F4V H;  1WH2 A;  4JI7 H;  4YY3 H;  2UXC H;  3DF7 A;  3N44 B;  1I6U A;  3TY5 A;  1XK5 A;  3KYH C;  1M0W A;  3N41 B;  4JI0 H;  3HXL A;  4B3R H;  2RGV A;  5LMN H;  4J0M A;  2UUC H;  3VNN A;  4JI6 H;  4DRF A;  4UCV A;  1ZHS A;  4X62 H;  4DR6 H;  5IT9 W;  4EEQ A;  3H20 A;  3RIZ A;  4RB1 A;  4UFZ A;  3K3V A;  1E4F T;  2OWO A;  2WE6 A;  3BAB A;  3CVZ A;  4DV4 H;  2FE3 A;  3JSL A;  4DUZ H;  4JI4 H;  1HR0 H;  5DIS C;  4MTE A;  1X9N A;  5D1O B;  1N33 H;  1J5E H;  1P16 A;  1XDN A;  1SEI A;  5BR8 H;  4JI5 H;  2Q2T A;  1N36 H;  3FMA A;  4DV3 H;  3MWM A;  2UUA H;  4CC5 A;  2VOB A;  1XNQ H;  3F8N A;  2CW8 A;  3N42 B;  3PN1 A;  2E5L H;  5IWA H;  4X64 H;  4LFB H;  1IBM H;  1B04 A;  1ZHQ A;  1CKO A;  1M0T A;  2Q2U A;  4DV0 H;  3J80 W;  4DR7 H;  3BAA A;  4DR2 H;  3NBY B;  4PZ7 A;  3BA8 A;  4A2A A;  3NC0 B;  4Q0Y A;  4MV9 A;  1CKM A;  3J81 W;  4JI1 H;  3NBZ B;  2UUB H;  1VS0 A;  4BWS C;  3KXY T;  4PZ6 A;  4LF4 H;  1AN7 A;  3KAK A;  4K0K H;  4LH6 A;  4I7H A;  4LF8 H;  1TAE A;  4LMY A;  4R7R A;  4DV2 H;  1TA8 A;  5FLX W;  1HNZ H;  4JV5 H;  5LL6 b;  4DV7 H;  4LF6 H;  1L2Z A;  3JSN A;  1MZB A;  4RZQ A;  5FPR A;  4UCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...