1S68A

Structure and mechanism of rna ligase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYCDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA Ligase 2
publication title Structure and mechanism of RNA ligase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase
total genus 67
structure length 233
sequence length 233
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1s68A02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s68A01
5FPOA 4EFEA 4GLXA 3TY5A 4CC5A 3BA8A 4LH6A 3BAAA 1V9PA 2HIVA 4UCTA 5FPRA 4E6NA 1CKMA 1CKNB 1P8LA 4PZ6A 1B04A 4LH7A 1CKOA 2HVRA 4UCRA 3S24A 2OWOA 1VS0A 2HVSA 4UCVA 1TA8A 1DGSA 4UCOA 4PZ8A 3NBZB 5DISC 2CFMA 3PN1A 3RR5A 5D1OB 4EFBA 4UCUA 3BABA 3NBYB 3TY9A 3JSLA 3RTXA 1S68A 3UQ8A 1X9NA 2VUGA 1XK5A 2HIXA 3QWUA 1CKNA 4UFZA 4EQ5A 3GB8B 3KYHC 1TAEA 3GDEA 3W1BA 3BA9A 1FVIA 5D1PA 3JSNA 2Q2UA 4UCSA 3W5OA 4PZ7A 4CC6A 3GJXB 3NC0B 1A0IA 3VNNA 2HVQA 1P16A 1XDNA 4DRFA 3L2PA 5D1OA 3W1GA 4EEQA 2Q2TA 3TY8A
chains in the Genus database with same CATH superfamily
3GILA 5EZYF 3L4JA 4O7ZA 2UUAH 2CNUA 2UVVA 3KALA 2ZDHA 3JRWA 2COJA 4NZMA 4JV0A 2R82A 4JUZA 4DUYH 2HHFA 4J9QA 4J9MA 1I7NA 2GQSA 4CC5A 2XCAA 4DV0H 3EPIA 1EUCB 1BXRA 4F4ZA 5FLXW 1W96A 4PBCA 3WWHA 2CW7A 4O7LA 1OWTA 1ET0A 2HIVA 4EYHB 1SYXB 1IBLH 3M9OB 2GQRA 4ETSA 4LFBH 3QZ8A 2R7LA 3I12A 2R7KA 2COIA 4M7EA 4QW9A 2V5AA 3HOYG 4DV4H 2E2HA 2QB5A 4K6NA 3T5JA 3EPGA 4PZ6A 4DR7H 1B04A 3VPCA 4QIWA 1S03G 5IWAH 1N48A 5KFWA 1Z2OX 1FKAH 2HVRA 2YZGA 3MFIA 2ODTX 1Z2NX 5LMUH 4FBUA 2YZMA 2WAQE 3RIZA 3HOZG 2IP4A 3K5HA 5KT5A 1N32H 2UUBH 1ULZA 3JRXA 4O7WA 4C5AA 5F9LA 4ECUA 5KFPA 2DPJA 4GKKH 5HBRB 3U0GA 4TV9F 2AGPA 1VAJA 2R7ZA 4JV2A 5KT7A 4F4XA 4LMYA 1UNNC 3HT5A 4YB8B 2XC9A 3NBZB 1V51A 1IOVA 4DR3H 3Q2OA 3GIPA 2ASLA 2C22A 2Q7DA 3HOUG 2QF7A 3LULA 4FU0A 4JXUA 1WCMG 2AU0A 2DPIA 1KJJA 3BQ0A 2R92A 3UFXB 5KFUA 3J80W 3NBYB 2ALZA 3E5NA 3JSLA 3UYYA 4AQYH 4RAZA 3GIDA 3ETJA 5CAEB 4NLGA 5JQWA 1S68A 4LF8H 4XYLB 4LFCH 4O3PA 2ZDQA 2W7OA 2RF4A 1RK5A 2VUGA 4JV1A 5JVLA 4A3JG 5DG8A 3N41B 1XK5A 2HIXA 1VBHA 4L1KA 3V4SA 3RJ0A 3U55A 4RUCA 1OBGA 4EQ5A 2W8KA 4Q44A 2Y0SA 3TIGA 2HG8A 4FGRA 4TV8F 2WYOA 4QJFA 4O3OA 1RYRA 2B63A 1EHIA 1ZAUA 1CS0A 1PK8A 2BQ3A 2HHFB 1ZQ7A 5CB4F 3QQMA 4KHPH 5C4XG 2R93G 3GTOA 2HGSA 2FE3A 4O7TA 4TM5A 4UCSA 2W9BA 1CQJB 2C28A 2HJWA 3Q8SB 3SGIA 4IR1A 1KBLA 3G6YA 1JDEA 3NGDA 3V4ZA 2DAAA 2NVXA 4A3MG 3AW8A 1I2KA 5KG5A 2CZGA 2JEFA 2UXBH 1GSAA 2WB1A 1V4YA 4RB0A 3GIJA 3L4KA 3TIIA 4A93G 2FLLA 2W57A 4DRFA 4EBCA 1UC8A 5K3WA 2ATLA 4UUGA 2FLPA 2AGQA 5L1JA 3L2PA 2AQ4A 4BBRG 5KFHA 4IRDA 4EGQA 4TQRA 4LF9H 2JA5A 2JA7A 4O7NA 1B6SA 4IWYA 1WH2A 2R7NA 1I2LA 3VMMA 4B3SH 5LP6F 3RBEA 1T36A 4RB3C 4J9LA 2RDJA 3CEBA 3I4MG 4JI7H 5DLGA 1JIHA 1HNXH 1XMOH 4A2AA 3MR6A 4X64H 2R85A 3KHHA 4ED1A 3H3VH 2RGVA 2XCPA 2NU6B 3KAJA 3GIIA 2Q2TA 4IWXA 3BG5A 4QW8A 4IR9A 1GO3E 4YR0A 4WBNF 4J0MA 3DF7A 3LWBA 4YAKB 4GLXA 3N8DA 3LMLA 3GV8B 2R8IA 1Y1WA 2YZNA 1GGOA 5BWWA 5I5SA 3PZPA 3UZOA 4JV5H 3PW5A 2CW8A 2W6QA 3N40P 4O3QA 4YQWA 5DGIA 3TY5A 5KFZA 3OTOH 5LMNH 5CM0A 3T5LA 4JYAH 2VQFH 4ECZA 5CE8A 4LH6A 4Q4CA 5KT3A 1IOWA 1CE8A 1V9PA 2XGQA 1RJRA 3FDSA 5KFVA 2UXCH 3HOVG 2V4QA 2C2RA 3H4DA 3PO2G 4YAJB 3K3VA 4X66H 1RK6A 4DV2H 4DR5H 4GLWA 4ED6A 2J9GA 2FJZA 3T9EA 3F8NA 4B3MH 2ZGIA 5C1PA 5KFFA 1SEIA 3GV5B 4RCNA 3Q8RB 1JXLA 1MZBA 5EWFA 4LFAH 2CKZB 4DV5H 4DL2A 4EEYA 4G3IA 5KG4A 2R7MA 3GIKA 1C30A 4JI0H 2R8GA 4EYIB 5HNEA 2EJ3A 2FPGB 2OWOA 1VS0A 4RZQA 4ZI7F 4O7RA 2C35B 2W9BB 3AX6A 4ECTA 4MTEA 1M6VA 2HVSA 5KFGA 5DG7A 4RUAA 2XGPA 1E4EA 5KT4A 4FFOA 2XIGA 2J6UA 4R8UA 4NZNA 4JI5H 4MTDA 1GYFA 5CA1F 5KG3A 1KT8A 5I5WA 2SCUB 2I80A 3M4IA 3H40A 3KAKA 4O3SA 3N44B 4PZ8A 5CA0F 5IP7G 4M9UA 2ZM6H 3FMAA 4JI8H 3J7AK 5DISC 3TW6A 4F4WA 4ECSA 2V59A 1L2ZA 5KFSA 5KG2A 3KHRA 4BBSG 3BJYA 3PN1A 3RR5A 3RV4A 4LF5H 1N56A 4A3EG 4FFNA 4EFBA 4JI2H 1ZETA 1TWAA 4ZQIA 3PR5B 5KG1A 3V6KA 3BABA 2WAQA 3R9RA 3HKZE 1IYDA 3RTXA 4C2MA 4J9SA 2IBKA 3HO8A 5KFTA 3GIMA 2Y4RA 4TQSA 1I6UA 4EGJA 5KFCA 4O81A 2QYZA 1TWHA 4YY3H 3PR4A 4A3CG 4IHJF 2JA8G 4IIJF 3MR3A 5BR8H 1M7JA 2A1HA 2YU9A 2ZJTA 4Q0YA 2YRWA 4ECYA 5T14A 1B33N 1O75A 3R5HA 2X0SA 1K83A 2NU8B 4LF7H 5BPHA 1ZHQA 3BA9A 4RB1A 1FVIA 3JSNA 1M0TA 4E4TA 5IYDG 1WCMA 1JDBB 2OH2A 3T9FA 5KFQA 3JZ6A 1KJ8A 3U9TA 2FB9A 2PMZA 2R8JA 4CC6A 3GJXB 3U54A 3WO0A 4QWEA 2VA3A 5KT2A 5DGAA 3K3PA 4Y8VB 1PX2A 1Y14B 3VOTA 4Q45A 4O7SA 4FFMA 2HVQA 3ORQA 1W93A 3T9DA 4R7RA 1IYEA 3HBLA 2C2DA 2JEGA 2PMZE 1FJGH 3H20A 3DTGA 4TUYF 4X65H 2AGOA 4O4IF 3M9NB 4DR6H 3KHGA 3V6HA 4DL7A 4DAAA 2BQUA 3GTLA 2FK2A 4CMFA 3PVXA 3H0GG 3RAQA 3VPDA 1B6RA 4EG0A 4I55F 4O2AF 4WHXA 3BQ2A 1E4EB 5E25A 4A3GG 4A3DG 3KREA 3WWJA 4R8UB 2COGA 4QSHA 2R8KA 5LOVF 4TVIA 2R92G 3PW2A 4B3RH 3C0FB 4RNNA 5JQGF 5KG7A 4O4JF 2EIYA 2R93A 1BNCA 4HN2A 4ECVA 2HHHH 3OUZA 4U7CA 3KHLA 3ORRA 2YRXA 4DL4A 3RAXA 5FPOA 3CSWA 3J81W 2HDKA 4ZHQF 5I5XA 4IAJA 1S10A 3SE7A 4ZOLF 1SFOA 2YWVA 5H80A 4YR2A 4IZOA 4NZOA 1BGWA 3GIQA 4FM9A 2ZDGA 2FPPB 3BA8A 4A2BA 3RB6A 5KFYA 2VQEH 2WE6A 4MA5A 4YJ3F 3N6XA 3TEKA 5JUMA 3BAAA 4YBZB 3T9BA 5A2QW 3U9SA 1DV1A 4Q8EA 3GTGA 2MCTA 5FPRA 3HB9A 2FLNA 1KJQA 4CKEA 1CKMA 3RUPA 1JLLB 3PW0A 1N36H 3DTFA 3JZIA 3QFFA 5LA6F 5L1IA 4EBEA 3G8CA 1EKFA 1SCUB 2EJ2A 3PFFA 3R5XA 3T99A 4HNTA 3MWMA 3VPBA 1S97A 2JEIA 2FP4B 1CKOA 3OHBA 1JX4A 2UU9H 1DIKA 2W6ZA 1DAAA 3GTPA 1Y1VG 4IRKA 2W9CA 4I7HA 1HNWH 2FKLA 3GTQA 3RV3A 1AN7A 4DL5A 5FD5A 4O86A 5DQIA 4UCVA 3H4BA 4DV6H 1TA8A 5C1OA 4AYBA 1DGSA 5C5JA 2PBZA 3CVZA 2DLNA 4C5CA 2ASJA 4CMDA 2NUAB 1UC9A 2UVUA 2CFMA 5I60A 2JEJA 1J5EH 5BPFA 5IP9G 3MR2A 3OUUA 5IYBG 4AYBE 1S9FA 1EUDB 3R5FA 4UCUA 3UZBA 4EBDA 3RGZA 2GPSA 3EYYA 5EWGA 4DR2H 5DG9A 2JA7G 2V4RA 5C8YF 3T5HA 3TQ1A 1TWGA 2VOBA 4O84A 4HNUA 2CNQA 2FPIB 3VA7A 1TWFA 3QZ7A 4J9RA 1X9NA 4RZRA 5LXTF 1WR2A 4J9KA 3GLKA 5FNVF 1EKVA 5I5VA 1T94A 2VA2A 5LYJF 4FS1A 4O82A 4APMA 5KG6A 5C44G 4ED2A 1XNQH 5JH7F 2JA6G 3QWUA 1RJPA 1CKNA 3BACA 4UFZA 2I8CA 2W6OA 2W70A 1RJQA 3GB8B 5DAAA 5KFBA 3MR5A 2IMWP 1KC7A 4QWAA 5L1KA 4QWBA 5KFLA 3KYHC 4CE5A 1IBKH 1TAEA 1C3OA 3FKIG 5KFEA 4XYMB 3W1BA 2VUMG 4MV7A 2YS7A 3HKZA 4LF4H 2GLTA 5KT6A 5F9NA 5I5TA 2DIKA 5C3EG 4O83A 1E4FT 4F4YA 3N43B 2VPQA 4MA0A 3W5OA 4QWDA 4DR1H 2J6SA 1KEEA 3BQ1A 5DQHA 5BYAA 1E4GT 4K0KH 3MWDA 4LSAA 4Q8FA 1A0IA 1IBMH 4PDBA 4MV6A 2FMAA 3N42B 3Q1KA 2V58A 2Z04A 1BJTA 1S0OA 1XDNA 4ECXA 5HV6A 4FFLA 5BWXA 3Q8PB 4MV3A 5KFJA 2NU7B 4J9NA 4RU9A 2J6TA 5KFNA 5D1OA 5DMXA 4FFPA 3W1GA 3WO1A 2CNVA 2W9CB 2W6NA 4BY7G 4A3BG 2HGXA 2P0AA 1AUVA 1EZ1A 4O3NA 2RGRA 3GTKA 4YR3A 1AUXA 4HQ6A 2KSWA 1HNZH 5J2TF 1VBGA 3V6JA 1EKPA 5I5UA 2W71A 3R23A 4X62H 4MV4A 5LL6b 1HR0H 2DWCA 5BWVA 4IRCA 1K1SA 2V9WA 2Z02A 4HNVA 4F50A 2E5LH 1GSOA 4O7VA 2UUCH 5CR5A 3TY8A 2F4VH 3GTMA 4EFEA 3M9MB 3RB0A 1I50A 4B3TH 1I7LA 4CKBA 2W7PA 2R84A 2PN1A 5DGHA 3IN5A 3JZFA 4DUZH 4MV8A 4QIWE 5KX5F 4XX0B 2X5RA 2YL2A 2W8LA 3GV7B 1OBDA 4I50F 4ECWA 2NVYA 4A3KG 2R7ZG 3CQZA 2PVPA 3DAAA 3MWEA 2XCLA 3G6XA 3PO3G 1KTAA 4I4TF 5KFXA 4RNOA 3I4NG 4O4HF 3KTMA 5BYBA 4RB2C 1I3QA 3OSNA 4ED3A 4DL6A 5KFKA 4UCTA 4HR7A 4E6NA 4BY1G 4GC6A 5I47A 2C00A 3H0GA 1RYSA 4JI3H 4O2BF 2UVRA 1CKNB 1K1QA 3T7AA 5IYCG 1I1MA 1P8LA 1CQIB 2YYAA 4NYEA 3SNOA 4J9PA 3RFCA 3ETHA 5KFDA 4ED0A 4MAMA 1XMQH 4GKJH 4LH7A 5IYZF 5BMVF 3TQTA 1T3NA 1VKZA 5I5YA 5EWEA 4UCRA 3S24A 4Q43A 4MV9A 2W6PA 2QK4A 5DQGA 4ME6A 4MV1A 5FLMG 4A3FG 1N33H 4CKCA 4DIMA 2UVWA 3GTJA 3OSPA 3MFHA 4DV3H 4LF6H 4NXNH 1JKJB 5GONF 3N6RA 3K5IA 4FE2A 1KJIA 1I1KA 2W9AA 1DV2A 2B63G 2YZLA 4UCOA 1A48A 3RB3A 1S0MA 1G2WA 2FK1A 1WSCA 3RBDA 4GC7A 5KS8A 2ASDA 2EJ0A 4M0JA 2Y0SE 4DV7H 2BR0A 4FBTA 5D1OB 2VPSA 4OX9H 5L1LA 2HGWA 5K2MA 3HXLA 4RAYA 3TY9A 5DGBA 2CQYA 4BWSC 5IT9W 3HOWG 4PWQA 5FD6A 5BWRA 3UQ8A 4U6PA 4YP3A 3WWIA 5KG0A 4HYKA 5KFMA 5KFOA 1I1LA 4RNMA 4J9OA 1Y1VA 4JI1H 3HOXG 3T1YH 3WNZA 5KFRA 2JA5G 4JI6H 3LQSA 2WB1E 3RGXA 3RF2A 4A3IG 3RB4A 3G8DA 1Z2PX 2R86A 4ECQA 1EYZA 2YW2A 3Q8QB 4YHHH 2RDIA 4O7YA 1XNRH 3GDEA 4DL3A 4LSXA 4BXXG 2O03A 2UXDH 5EOYA 2C2EA 2VQDA 5D1PA 3TINA 2Q2UA 1A0GA 3G6VA 3T54A 4DQNA 2R8HA 2ABJA 4PZ7A 4A3LG 4Q4DA 1GSHA 5FR9A 5BWTA 5KFAA 3NC0B 5J2UF 4ECRA 1Y1WG 5DLFA 3VNNA 2I87A 2W6MA 1A9XA 1ZHSA 5L9XA 1WRVA 3T9AA 4DR4H 3SI8A 5D8DA 2NU9B 2YS6A 1P16A 4C5BA 5JVDF 4JI4H 2DABA 3KXYT 5KFIA 4NXMH 1I94H 2WDTA 2GPWA 4O4LF 3T9CA 2OLSA 3NUAA 4ED7A 2R87A 1GLVA 2JA6A 2IA6A 1KJ9A 1TWCA 4DLKA 3MJFA 1S0NA 2M05A 2YCHA 3T1HH 1N34H 4FS2A 4CHIA 2R6FA 4WD3A 3PW4A 3PW7A 1KUTA 3TW7A 4EEQA 2FK3A 3FKIA 1A3GA 2WTFA 5FJ8G 4DV1H 3GQCA 4XZ3B 3T5KA 2DZDA 4YJ2F 4ED8A 3IG0A 2VUMA 5EDWA 4QWCA 1R9TA 2VR1A 2E2IA 3JAMW 5BWUA 1M0WA 3LP8A 3AYHB 5KKNB 3OHAA 2BQRA 4O3RA 2XD4A 4FFRA
chains in the Genus database with same CATH topology
5FPOA 3J81W 4EFEA 4IAJA 4J0MA 3DF7A 4B3TH 4GLXA 3LMLA 3L4JA 2UUAH 4DUZH 3KALA 4JV5H 2CW8A 3N40P 3TY5A 3OTOH 4DUYH 1BGWA 5LMNH 4FM9A 4CC5A 4A2BA 3BA8A 4DV0H 4JYAH 2VQEH 2VQFH 2WE6A 3N6XA 5FLXW 4LH6A 3BAAA 5A2QW 4RB2C 1V9PA 2CW7A 2MCTA 2HIVA 4UCTA 1IBLH 5FPRA 4E6NA 1SYXB 2UXCH 4JI3H 4ETSA 4LFBH 1CKMA 3K3VA 1CKNB 4X66H 4DV2H 4DR5H 1P8LA 4M7EA 3F8NA 4B3MH 4DV4H 1SEIA 1XMQH 4GKJH 4PZ6A 4LFAH 1MZBA 3MWMA 4DR7H 1B04A 4LH7A 4DV5H 1S03G 5IWAH 1CKOA 1Z2OX 2UU9H 2HVRA 4UCRA 3S24A 4JI1H 4MV9A 4JI0H 2OWOA 1Z2NX 1VS0A 4RZQA 5LMUH 1N33H 3RIZA 4I7HA 1HNWH 4MTEA 1N32H 2HVSA 2UUBH 4DV3H 4JI5H 1AN7A 2XIGA 4LF6H 4NXNH 5FD5A 4MTDA 1GYFA 4GKKH 4UCVA 4DV6H 1TA8A 1DGSA 3M4IA 4UCOA 3KAKA 3CVZA 3N44B 4PZ8A 4LMYA 2ZM6H 3J7AK 3NBZB 3FMAA 4DR3H 5DISC 4JI8H 2CFMA 1L2ZA 1J5EH 3PN1A 3RR5A 4DV7H 4LF5H 2F4VH 5D1OB 2VPSA 4EFBA 4JI2H 4UCUA 4OX9H 3BABA 3RGZA 3J80W 3HXLA 3NBYB 3EYYA 3TY9A 3JSLA 4RAYA 4DR2H 4AQYH 4BWSC 3RTXA 4RAZA 5IT9W 2VOBA 5FD6A 1S68A 3UQ8A 4LF8H 4LFCH 1X9NA 1I6UA 4YY3H 2VUGA 4APMA 1XNQH 3N41B 1XK5A 2HIXA 3T1YH 3QWUA 5BR8H 1CKNA 3RJ0A 4JI6H 4UFZA 3RGXA 4EQ5A 2ZJTA 3GB8B 4Q0YA 3RF2A 1Z2PX 1O75A 2WYOA 3KYHC 1TAEA 4YHHH 4LF7H 1XNRH 1ZHQA 3GDEA 3W1BA 4LSXA 3BA9A 4MV7A 4LF4H 2O03A 4RB1A 4KHPH 5EOYA 2UXDH 1FVIA 5D1PA 2FE3A 3JSNA 2Q2UA 1M0TA 2HGSA 4UCSA 1E4FT 3N43B 3W5OA 4DR1H 4PZ7A 4CC6A 3GJXB 3NC0B 1E4GT 4K0KH 4LSAA 1A0IA 3VNNA 1IBMH 4DR4H 1ZHSA 4PDBA 4R7RA 2HVQA 4RB0A 1P16A 3N42B 4JI4H 1BJTA 3L4KA 3KXYT 4NXMH 1FJGH 1I94H 3H20A 2W57A 2WDTA 1XDNA 4DRFA 4X65H 3L2PA 4DR6H 4LF9H 5D1OA 3W1GA 1FKAH 1WH2A 2YCHA 3T1HH 1N34H 2E5LH 2RGRA 1HNZH 4B3SH 2KSWA 1IBKH 4EEQA 4DV1H 2UXBH 4RB3C 1N36H 1HR0H 4B3RH 4X62H 5LL6b 3C0FB 1HNXH 1XMOH 3IG0A 4A2AA 4X64H 4JI7H 3JAMW 2HHHH 1M0WA 2RGVA 3KAJA 2Q2TA 2UUCH 3TY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPO A;  4EFE A;  4GLX A;  3TY5 A;  4CC5 A;  3BA8 A;  4LH6 A;  3BAA A;  1V9P A;  2HIV A;  4UCT A;  5FPR A;  4E6N A;  1CKM A;  1CKN B;  1P8L A;  4PZ6 A;  1B04 A;  4LH7 A;  1CKO A;  2HVR A;  4UCR A;  3S24 A;  2OWO A;  1VS0 A;  2HVS A;  4UCV A;  1TA8 A;  1DGS A;  4UCO A;  4PZ8 A;  3NBZ B;  5DIS C;  2CFM A;  3PN1 A;  3RR5 A;  5D1O B;  4EFB A;  4UCU A;  3BAB A;  3NBY B;  3TY9 A;  3JSL A;  3RTX A;  1S68 A;  3UQ8 A;  1X9N A;  2VUG A;  1XK5 A;  2HIX A;  3QWU A;  1CKN A;  4UFZ A;  4EQ5 A;  3GB8 B;  3KYH C;  1TAE A;  3GDE A;  3W1B A;  3BA9 A;  1FVI A;  5D1P A;  3JSN A;  2Q2U A;  4UCS A;  3W5O A;  4PZ7 A;  4CC6 A;  3GJX B;  3NC0 B;  1A0I A;  3VNN A;  2HVQ A;  1P16 A;  1XDN A;  4DRF A;  3L2P A;  5D1O A;  3W1G A;  4EEQ A;  2Q2T A;  3TY8 A; 
#chains in the Genus database with same CATH topology
 3GIL A;  5EZY F;  3L4J A;  4O7Z A;  2UUA H;  2CNU A;  2UVV A;  3KAL A;  2ZDH A;  3JRW A;  2COJ A;  4NZM A;  4JV0 A;  2R82 A;  4JUZ A;  4DUY H;  2HHF A;  4J9Q A;  4J9M A;  1I7N A;  2GQS A;  4CC5 A;  2XCA A;  4DV0 H;  3EPI A;  1EUC B;  1BXR A;  4F4Z A;  5FLX W;  1W96 A;  4PBC A;  3WWH A;  2CW7 A;  4O7L A;  1OWT A;  1ET0 A;  2HIV A;  4EYH B;  1SYX B;  1IBL H;  3M9O B;  2GQR A;  4ETS A;  4LFB H;  3QZ8 A;  2R7L A;  3I12 A;  2R7K A;  2COI A;  4M7E A;  4QW9 A;  2V5A A;  3HOY G;  4DV4 H;  2E2H A;  2QB5 A;  4K6N A;  3T5J A;  3EPG A;  4PZ6 A;  4DR7 H;  1B04 A;  3VPC A;  4QIW A;  1S03 G;  5IWA H;  1N48 A;  5KFW A;  1Z2O X;  1FKA H;  2HVR A;  2YZG A;  3MFI A;  2ODT X;  1Z2N X;  5LMU H;  4FBU A;  2YZM A;  2WAQ E;  3RIZ A;  3HOZ G;  2IP4 A;  3K5H A;  5KT5 A;  1N32 H;  2UUB H;  1ULZ A;  3JRX A;  4O7W A;  4C5A A;  5F9L A;  4ECU A;  5KFP A;  2DPJ A;  4GKK H;  5HBR B;  3U0G A;  4TV9 F;  2AGP A;  1VAJ A;  2R7Z A;  4JV2 A;  5KT7 A;  4F4X A;  4LMY A;  1UNN C;  3HT5 A;  4YB8 B;  2XC9 A;  3NBZ B;  1V51 A;  1IOV A;  4DR3 H;  3Q2O A;  3GIP A;  2ASL A;  2C22 A;  2Q7D A;  3HOU G;  2QF7 A;  3LUL A;  4FU0 A;  4JXU A;  1WCM G;  2AU0 A;  2DPI A;  1KJJ A;  3BQ0 A;  2R92 A;  3UFX B;  5KFU A;  3J80 W;  3NBY B;  2ALZ A;  3E5N A;  3JSL A;  3UYY A;  4AQY H;  4RAZ A;  3GID A;  3ETJ A;  5CAE B;  4NLG A;  5JQW A;  1S68 A;  4LF8 H;  4XYL B;  4LFC H;  4O3P A;  2ZDQ A;  2W7O A;  2RF4 A;  1RK5 A;  2VUG A;  4JV1 A;  5JVL A;  4A3J G;  5DG8 A;  3N41 B;  1XK5 A;  2HIX A;  1VBH A;  4L1K A;  3V4S A;  3RJ0 A;  3U55 A;  4RUC A;  1OBG A;  4EQ5 A;  2W8K A;  4Q44 A;  2Y0S A;  3TIG A;  2HG8 A;  4FGR A;  4TV8 F;  2WYO A;  4QJF A;  4O3O A;  1RYR A;  2B63 A;  1EHI A;  1ZAU A;  1CS0 A;  1PK8 A;  2BQ3 A;  2HHF B;  1ZQ7 A;  5CB4 F;  3QQM A;  4KHP H;  5C4X G;  2R93 G;  3GTO A;  2HGS A;  2FE3 A;  4O7T A;  4TM5 A;  4UCS A;  2W9B A;  1CQJ B;  2C28 A;  2HJW A;  3Q8S B;  3SGI A;  4IR1 A;  1KBL A;  3G6Y A;  1JDE A;  3NGD A;  3V4Z A;  2DAA A;  2NVX A;  4A3M G;  3AW8 A;  1I2K A;  5KG5 A;  2CZG A;  2JEF A;  2UXB H;  1GSA A;  2WB1 A;  1V4Y A;  4RB0 A;  3GIJ A;  3L4K A;  3TII A;  4A93 G;  2FLL A;  2W57 A;  4DRF A;  4EBC A;  1UC8 A;  5K3W A;  2ATL A;  4UUG A;  2FLP A;  2AGQ A;  5L1J A;  3L2P A;  2AQ4 A;  4BBR G;  5KFH A;  4IRD A;  4EGQ A;  4TQR A;  4LF9 H;  2JA5 A;  2JA7 A;  4O7N A;  1B6S A;  4IWY A;  1WH2 A;  2R7N A;  1I2L A;  3VMM A;  4B3S H;  5LP6 F;  3RBE A;  1T36 A;  4RB3 C;  4J9L A;  2RDJ A;  3CEB A;  3I4M G;  4JI7 H;  5DLG A;  1JIH A;  1HNX H;  1XMO H;  4A2A A;  3MR6 A;  4X64 H;  2R85 A;  3KHH A;  4ED1 A;  3H3V H;  2RGV A;  2XCP A;  2NU6 B;  3KAJ A;  3GII A;  2Q2T A;  4IWX A;  3BG5 A;  4QW8 A;  4IR9 A;  1GO3 E;  4YR0 A;  4WBN F;  4J0M A;  3DF7 A;  3LWB A;  4YAK B;  4GLX A;  3N8D A;  3LML A;  3GV8 B;  2R8I A;  1Y1W A;  2YZN A;  1GGO A;  5BWW A;  5I5S A;  3PZP A;  3UZO A;  4JV5 H;  3PW5 A;  2CW8 A;  2W6Q A;  3N40 P;  4O3Q A;  4YQW A;  5DGI A;  3TY5 A;  5KFZ A;  3OTO H;  5LMN H;  5CM0 A;  3T5L A;  4JYA H;  2VQF H;  4ECZ A;  5CE8 A;  4LH6 A;  4Q4C A;  5KT3 A;  1IOW A;  1CE8 A;  1V9P A;  2XGQ A;  1RJR A;  3FDS A;  5KFV A;  2UXC H;  3HOV G;  2V4Q A;  2C2R A;  3H4D A;  3PO2 G;  4YAJ B;  3K3V A;  4X66 H;  1RK6 A;  4DV2 H;  4DR5 H;  4GLW A;  4ED6 A;  2J9G A;  2FJZ A;  3T9E A;  3F8N A;  4B3M H;  2ZGI A;  5C1P A;  5KFF A;  1SEI A;  3GV5 B;  4RCN A;  3Q8R B;  1JXL A;  1MZB A;  5EWF A;  4LFA H;  2CKZ B;  4DV5 H;  4DL2 A;  4EEY A;  4G3I A;  5KG4 A;  2R7M A;  3GIK A;  1C30 A;  4JI0 H;  2R8G A;  4EYI B;  5HNE A;  2EJ3 A;  2FPG B;  2OWO A;  1VS0 A;  4RZQ A;  4ZI7 F;  4O7R A;  2C35 B;  2W9B B;  3AX6 A;  4ECT A;  4MTE A;  1M6V A;  2HVS A;  5KFG A;  5DG7 A;  4RUA A;  2XGP A;  1E4E A;  5KT4 A;  4FFO A;  2XIG A;  2J6U A;  4R8U A;  4NZN A;  4JI5 H;  4MTD A;  1GYF A;  5CA1 F;  5KG3 A;  1KT8 A;  5I5W A;  2SCU B;  2I80 A;  3M4I A;  3H40 A;  3KAK A;  4O3S A;  3N44 B;  4PZ8 A;  5CA0 F;  5IP7 G;  4M9U A;  2ZM6 H;  3FMA A;  4JI8 H;  3J7A K;  5DIS C;  3TW6 A;  4F4W A;  4ECS A;  2V59 A;  1L2Z A;  5KFS A;  5KG2 A;  3KHR A;  4BBS G;  3BJY A;  3PN1 A;  3RR5 A;  3RV4 A;  4LF5 H;  1N56 A;  4A3E G;  4FFN A;  4EFB A;  4JI2 H;  1ZET A;  1TWA A;  4ZQI A;  3PR5 B;  5KG1 A;  3V6K A;  3BAB A;  2WAQ A;  3R9R A;  3HKZ E;  1IYD A;  3RTX A;  4C2M A;  4J9S A;  2IBK A;  3HO8 A;  5KFT A;  3GIM A;  2Y4R A;  4TQS A;  1I6U A;  4EGJ A;  5KFC A;  4O81 A;  2QYZ A;  1TWH A;  4YY3 H;  3PR4 A;  4A3C G;  4IHJ F;  2JA8 G;  4IIJ F;  3MR3 A;  5BR8 H;  1M7J A;  2A1H A;  2YU9 A;  2ZJT A;  4Q0Y A;  2YRW A;  4ECY A;  5T14 A;  1B33 N;  1O75 A;  3R5H A;  2X0S A;  1K83 A;  2NU8 B;  4LF7 H;  5BPH A;  1ZHQ A;  3BA9 A;  4RB1 A;  1FVI A;  3JSN A;  1M0T A;  4E4T A;  5IYD G;  1WCM A;  1JDB B;  2OH2 A;  3T9F A;  5KFQ A;  3JZ6 A;  1KJ8 A;  3U9T A;  2FB9 A;  2PMZ A;  2R8J A;  4CC6 A;  3GJX B;  3U54 A;  3WO0 A;  4QWE A;  2VA3 A;  5KT2 A;  5DGA A;  3K3P A;  4Y8V B;  1PX2 A;  1Y14 B;  3VOT A;  4Q45 A;  4O7S A;  4FFM A;  2HVQ A;  3ORQ A;  1W93 A;  3T9D A;  4R7R A;  1IYE A;  3HBL A;  2C2D A;  2JEG A;  2PMZ E;  1FJG H;  3H20 A;  3DTG A;  4TUY F;  4X65 H;  2AGO A;  4O4I F;  3M9N B;  4DR6 H;  3KHG A;  3V6H A;  4DL7 A;  4DAA A;  2BQU A;  3GTL A;  2FK2 A;  4CMF A;  3PVX A;  3H0G G;  3RAQ A;  3VPD A;  1B6R A;  4EG0 A;  4I55 F;  4O2A F;  4WHX A;  3BQ2 A;  1E4E B;  5E25 A;  4A3G G;  4A3D G;  3KRE A;  3WWJ A;  4R8U B;  2COG A;  4QSH A;  2R8K A;  5LOV F;  4TVI A;  2R92 G;  3PW2 A;  4B3R H;  3C0F B;  4RNN A;  5JQG F;  5KG7 A;  4O4J F;  2EIY A;  2R93 A;  1BNC A;  4HN2 A;  4ECV A;  2HHH H;  3OUZ A;  4U7C A;  3KHL A;  3ORR A;  2YRX A;  4DL4 A;  3RAX A;  5FPO A;  3CSW A;  3J81 W;  2HDK A;  4ZHQ F;  5I5X A;  4IAJ A;  1S10 A;  3SE7 A;  4ZOL F;  1SFO A;  2YWV A;  5H80 A;  4YR2 A;  4IZO A;  4NZO A;  1BGW A;  3GIQ A;  4FM9 A;  2ZDG A;  2FPP B;  3BA8 A;  4A2B A;  3RB6 A;  5KFY A;  2VQE H;  2WE6 A;  4MA5 A;  4YJ3 F;  3N6X A;  3TEK A;  5JUM A;  3BAA A;  4YBZ B;  3T9B A;  5A2Q W;  3U9S A;  1DV1 A;  4Q8E A;  3GTG A;  2MCT A;  5FPR A;  3HB9 A;  2FLN A;  1KJQ A;  4CKE A;  1CKM A;  3RUP A;  1JLL B;  3PW0 A;  1N36 H;  3DTF A;  3JZI A;  3QFF A;  5LA6 F;  5L1I A;  4EBE A;  3G8C A;  1EKF A;  1SCU B;  2EJ2 A;  3PFF A;  3R5X A;  3T99 A;  4HNT A;  3MWM A;  3VPB A;  1S97 A;  2JEI A;  2FP4 B;  1CKO A;  3OHB A;  1JX4 A;  2UU9 H;  1DIK A;  2W6Z A;  1DAA A;  3GTP A;  1Y1V G;  4IRK A;  2W9C A;  4I7H A;  1HNW H;  2FKL A;  3GTQ A;  3RV3 A;  1AN7 A;  4DL5 A;  5FD5 A;  4O86 A;  5DQI A;  4UCV A;  3H4B A;  4DV6 H;  1TA8 A;  5C1O A;  4AYB A;  1DGS A;  5C5J A;  2PBZ A;  3CVZ A;  2DLN A;  4C5C A;  2ASJ A;  4CMD A;  2NUA B;  1UC9 A;  2UVU A;  2CFM A;  5I60 A;  2JEJ A;  1J5E H;  5BPF A;  5IP9 G;  3MR2 A;  3OUU A;  5IYB G;  4AYB E;  1S9F A;  1EUD B;  3R5F A;  4UCU A;  3UZB A;  4EBD A;  3RGZ A;  2GPS A;  3EYY A;  5EWG A;  4DR2 H;  5DG9 A;  2JA7 G;  2V4R A;  5C8Y F;  3T5H A;  3TQ1 A;  1TWG A;  2VOB A;  4O84 A;  4HNU A;  2CNQ A;  2FPI B;  3VA7 A;  1TWF A;  3QZ7 A;  4J9R A;  1X9N A;  4RZR A;  5LXT F;  1WR2 A;  4J9K A;  3GLK A;  5FNV F;  1EKV A;  5I5V A;  1T94 A;  2VA2 A;  5LYJ F;  4FS1 A;  4O82 A;  4APM A;  5KG6 A;  5C44 G;  4ED2 A;  1XNQ H;  5JH7 F;  2JA6 G;  3QWU A;  1RJP A;  1CKN A;  3BAC A;  4UFZ A;  2I8C A;  2W6O A;  2W70 A;  1RJQ A;  3GB8 B;  5DAA A;  5KFB A;  3MR5 A;  2IMW P;  1KC7 A;  4QWA A;  5L1K A;  4QWB A;  5KFL A;  3KYH C;  4CE5 A;  1IBK H;  1TAE A;  1C3O A;  3FKI G;  5KFE A;  4XYM B;  3W1B A;  2VUM G;  4MV7 A;  2YS7 A;  3HKZ A;  4LF4 H;  2GLT A;  5KT6 A;  5F9N A;  5I5T A;  2DIK A;  5C3E G;  4O83 A;  1E4F T;  4F4Y A;  3N43 B;  2VPQ A;  4MA0 A;  3W5O A;  4QWD A;  4DR1 H;  2J6S A;  1KEE A;  3BQ1 A;  5DQH A;  5BYA A;  1E4G T;  4K0K H;  3MWD A;  4LSA A;  4Q8F A;  1A0I A;  1IBM H;  4PDB A;  4MV6 A;  2FMA A;  3N42 B;  3Q1K A;  2V58 A;  2Z04 A;  1BJT A;  1S0O A;  1XDN A;  4ECX A;  5HV6 A;  4FFL A;  5BWX A;  3Q8P B;  4MV3 A;  5KFJ A;  2NU7 B;  4J9N A;  4RU9 A;  2J6T A;  5KFN A;  5D1O A;  5DMX A;  4FFP A;  3W1G A;  3WO1 A;  2CNV A;  2W9C B;  2W6N A;  4BY7 G;  4A3B G;  2HGX A;  2P0A A;  1AUV A;  1EZ1 A;  4O3N A;  2RGR A;  3GTK A;  4YR3 A;  1AUX A;  4HQ6 A;  2KSW A;  1HNZ H;  5J2T F;  1VBG A;  3V6J A;  1EKP A;  5I5U A;  2W71 A;  3R23 A;  4X62 H;  4MV4 A;  5LL6 b;  1HR0 H;  2DWC A;  5BWV A;  4IRC A;  1K1S A;  2V9W A;  2Z02 A;  4HNV A;  4F50 A;  2E5L H;  1GSO A;  4O7V A;  2UUC H;  5CR5 A;  3TY8 A;  2F4V H;  3GTM A;  4EFE A;  3M9M B;  3RB0 A;  1I50 A;  4B3T H;  1I7L A;  4CKB A;  2W7P A;  2R84 A;  2PN1 A;  5DGH A;  3IN5 A;  3JZF A;  4DUZ H;  4MV8 A;  4QIW E;  5KX5 F;  4XX0 B;  2X5R A;  2YL2 A;  2W8L A;  3GV7 B;  1OBD A;  4I50 F;  4ECW A;  2NVY A;  4A3K G;  2R7Z G;  3CQZ A;  2PVP A;  3DAA A;  3MWE A;  2XCL A;  3G6X A;  3PO3 G;  1KTA A;  4I4T F;  5KFX A;  4RNO A;  3I4N G;  4O4H F;  3KTM A;  5BYB A;  4RB2 C;  1I3Q A;  3OSN A;  4ED3 A;  4DL6 A;  5KFK A;  4UCT A;  4HR7 A;  4E6N A;  4BY1 G;  4GC6 A;  5I47 A;  2C00 A;  3H0G A;  1RYS A;  4JI3 H;  4O2B F;  2UVR A;  1CKN B;  1K1Q A;  3T7A A;  5IYC G;  1I1M A;  1P8L A;  1CQI B;  2YYA A;  4NYE A;  3SNO A;  4J9P A;  3RFC A;  3ETH A;  5KFD A;  4ED0 A;  4MAM A;  1XMQ H;  4GKJ H;  4LH7 A;  5IYZ F;  5BMV F;  3TQT A;  1T3N A;  1VKZ A;  5I5Y A;  5EWE A;  4UCR A;  3S24 A;  4Q43 A;  4MV9 A;  2W6P A;  2QK4 A;  5DQG A;  4ME6 A;  4MV1 A;  5FLM G;  4A3F G;  1N33 H;  4CKC A;  4DIM A;  2UVW A;  3GTJ A;  3OSP A;  3MFH A;  4DV3 H;  4LF6 H;  4NXN H;  1JKJ B;  5GON F;  3N6R A;  3K5I A;  4FE2 A;  1KJI A;  1I1K A;  2W9A A;  1DV2 A;  2B63 G;  2YZL A;  4UCO A;  1A48 A;  3RB3 A;  1S0M A;  1G2W A;  2FK1 A;  1WSC A;  3RBD A;  4GC7 A;  5KS8 A;  2ASD A;  2EJ0 A;  4M0J A;  2Y0S E;  4DV7 H;  2BR0 A;  4FBT A;  5D1O B;  2VPS A;  4OX9 H;  5L1L A;  2HGW A;  5K2M A;  3HXL A;  4RAY A;  3TY9 A;  5DGB A;  2CQY A;  4BWS C;  5IT9 W;  3HOW G;  4PWQ A;  5FD6 A;  5BWR A;  3UQ8 A;  4U6P A;  4YP3 A;  3WWI A;  5KG0 A;  4HYK A;  5KFM A;  5KFO A;  1I1L A;  4RNM A;  4J9O A;  1Y1V A;  4JI1 H;  3HOX G;  3T1Y H;  3WNZ A;  5KFR A;  2JA5 G;  4JI6 H;  3LQS A;  2WB1 E;  3RGX A;  3RF2 A;  4A3I G;  3RB4 A;  3G8D A;  1Z2P X;  2R86 A;  4ECQ A;  1EYZ A;  2YW2 A;  3Q8Q B;  4YHH H;  2RDI A;  4O7Y A;  1XNR H;  3GDE A;  4DL3 A;  4LSX A;  4BXX G;  2O03 A;  2UXD H;  5EOY A;  2C2E A;  2VQD A;  5D1P A;  3TIN A;  2Q2U A;  1A0G A;  3G6V A;  3T54 A;  4DQN A;  2R8H A;  2ABJ A;  4PZ7 A;  4A3L G;  4Q4D A;  1GSH A;  5FR9 A;  5BWT A;  5KFA A;  3NC0 B;  5J2U F;  4ECR A;  1Y1W G;  5DLF A;  3VNN A;  2I87 A;  2W6M A;  1A9X A;  1ZHS A;  5L9X A;  1WRV A;  3T9A A;  4DR4 H;  3SI8 A;  5D8D A;  2NU9 B;  2YS6 A;  1P16 A;  4C5B A;  5JVD F;  4JI4 H;  2DAB A;  3KXY T;  5KFI A;  4NXM H;  1I94 H;  2WDT A;  2GPW A;  4O4L F;  3T9C A;  2OLS A;  3NUA A;  4ED7 A;  2R87 A;  1GLV A;  2JA6 A;  2IA6 A;  1KJ9 A;  1TWC A;  4DLK A;  3MJF A;  1S0N A;  2M05 A;  2YCH A;  3T1H H;  1N34 H;  4FS2 A;  4CHI A;  2R6F A;  4WD3 A;  3PW4 A;  3PW7 A;  1KUT A;  3TW7 A;  4EEQ A;  2FK3 A;  3FKI A;  1A3G A;  2WTF A;  5FJ8 G;  4DV1 H;  3GQC A;  4XZ3 B;  3T5K A;  2DZD A;  4YJ2 F;  4ED8 A;  3IG0 A;  2VUM A;  5EDW A;  4QWC A;  1R9T A;  2VR1 A;  2E2I A;  3JAM W;  5BWU A;  1M0W A;  3LP8 A;  3AYH B;  5KKN B;  3OHA A;  2BQR A;  4O3R A;  2XD4 A;  4FFR A; 
#chains in the Genus database with same CATH homology
 5FPO A;  3J81 W;  4EFE A;  4IAJ A;  4J0M A;  3DF7 A;  4B3T H;  4GLX A;  3LML A;  3L4J A;  2UUA H;  4DUZ H;  3KAL A;  4JV5 H;  2CW8 A;  3N40 P;  3TY5 A;  3OTO H;  4DUY H;  1BGW A;  5LMN H;  4FM9 A;  4CC5 A;  4A2B A;  3BA8 A;  4DV0 H;  4JYA H;  2VQE H;  2VQF H;  2WE6 A;  3N6X A;  5FLX W;  4LH6 A;  3BAA A;  5A2Q W;  4RB2 C;  1V9P A;  2CW7 A;  2MCT A;  2HIV A;  4UCT A;  1IBL H;  5FPR A;  4E6N A;  1SYX B;  2UXC H;  4JI3 H;  4ETS A;  4LFB H;  1CKM A;  3K3V A;  1CKN B;  4X66 H;  4DV2 H;  4DR5 H;  1P8L A;  4M7E A;  3F8N A;  4B3M H;  4DV4 H;  1SEI A;  1XMQ H;  4GKJ H;  4PZ6 A;  4LFA H;  1MZB A;  3MWM A;  4DR7 H;  1B04 A;  4LH7 A;  4DV5 H;  1S03 G;  5IWA H;  1CKO A;  1Z2O X;  2UU9 H;  2HVR A;  4UCR A;  3S24 A;  4JI1 H;  4MV9 A;  4JI0 H;  2OWO A;  1Z2N X;  1VS0 A;  4RZQ A;  5LMU H;  1N33 H;  3RIZ A;  4I7H A;  1HNW H;  4MTE A;  1N32 H;  2HVS A;  2UUB H;  4DV3 H;  4JI5 H;  1AN7 A;  2XIG A;  4LF6 H;  4NXN H;  5FD5 A;  4MTD A;  1GYF A;  4GKK H;  4UCV A;  4DV6 H;  1TA8 A;  1DGS A;  3M4I A;  4UCO A;  3KAK A;  3CVZ A;  3N44 B;  4PZ8 A;  4LMY A;  2ZM6 H;  3J7A K;  3NBZ B;  3FMA A;  4DR3 H;  5DIS C;  4JI8 H;  2CFM A;  1L2Z A;  1J5E H;  3PN1 A;  3RR5 A;  4DV7 H;  4LF5 H;  2F4V H;  5D1O B;  2VPS A;  4EFB A;  4JI2 H;  4UCU A;  4OX9 H;  3BAB A;  3RGZ A;  3J80 W;  3HXL A;  3NBY B;  3EYY A;  3TY9 A;  3JSL A;  4RAY A;  4DR2 H;  4AQY H;  4BWS C;  3RTX A;  4RAZ A;  5IT9 W;  2VOB A;  5FD6 A;  1S68 A;  3UQ8 A;  4LF8 H;  4LFC H;  1X9N A;  1I6U A;  4YY3 H;  2VUG A;  4APM A;  1XNQ H;  3N41 B;  1XK5 A;  2HIX A;  3T1Y H;  3QWU A;  5BR8 H;  1CKN A;  3RJ0 A;  4JI6 H;  4UFZ A;  3RGX A;  4EQ5 A;  2ZJT A;  3GB8 B;  4Q0Y A;  3RF2 A;  1Z2P X;  1O75 A;  2WYO A;  3KYH C;  1TAE A;  4YHH H;  4LF7 H;  1XNR H;  1ZHQ A;  3GDE A;  3W1B A;  4LSX A;  3BA9 A;  4MV7 A;  4LF4 H;  2O03 A;  4RB1 A;  4KHP H;  5EOY A;  2UXD H;  1FVI A;  5D1P A;  2FE3 A;  3JSN A;  2Q2U A;  1M0T A;  2HGS A;  4UCS A;  1E4F T;  3N43 B;  3W5O A;  4DR1 H;  4PZ7 A;  4CC6 A;  3GJX B;  3NC0 B;  1E4G T;  4K0K H;  4LSA A;  1A0I A;  3VNN A;  1IBM H;  4DR4 H;  1ZHS A;  4PDB A;  4R7R A;  2HVQ A;  4RB0 A;  1P16 A;  3N42 B;  4JI4 H;  1BJT A;  3L4K A;  3KXY T;  4NXM H;  1FJG H;  1I94 H;  3H20 A;  2W57 A;  2WDT A;  1XDN A;  4DRF A;  4X65 H;  3L2P A;  4DR6 H;  4LF9 H;  5D1O A;  3W1G A;  1FKA H;  1WH2 A;  2YCH A;  3T1H H;  1N34 H;  2E5L H;  2RGR A;  1HNZ H;  4B3S H;  2KSW A;  1IBK H;  4EEQ A;  4DV1 H;  2UXB H;  4RB3 C;  1N36 H;  1HR0 H;  4B3R H;  4X62 H;  5LL6 b;  3C0F B;  1HNX H;  1XMO H;  3IG0 A;  4A2A A;  4X64 H;  4JI7 H;  3JAM W;  2HHH H;  1M0W A;  2RGV A;  3KAJ A;  2Q2T A;  2UUC H;  3TY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...