3R23A

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
304
structure length
304
Chain Sequence
AMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 78
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r23A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r23A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r23A01
1OBGA 2PVPA 5K2MA 1VBHA 4HNTA 1KC7A 3BG5A 2I87A 3MJFA 5JH7F 1B6RA 2CNVA 2I80A 4QSHA 1C30A 1JDEA 3LWBA 2ZDGA 1BXRA 2R86A 4O7LA 1DIKA 1SCUB 4EA7A 2GLTA 3SE7A 3K3PA 3V4SA 2ZDHA 4O4JF 4WD3A 4EAAA 3U9SA 2P0AA 2FPIB 4ZOLF 2CNUA 4IZOA 5KKNB 1IOWA 3JRXA 2W71A 3E5NA 1GGOA 3VPDA 4MA5A 1UC9A 1DV1A 3I12A 1Z2NX 3AX6A 3KALA 2V59A 1IOVA 1E4EA 2W6MA 1ULZA 4O4IF 4FFMA 4FFOA 2YZMA 3R9RA 4E4TA 5C1PA 4MV7A 3VOTA 3TINA 4MV3A 4YBZB 4C5CA 5JVLA 3ORQA 2VHEA 1EUCB 5KX5F 1C3OA 4FFNA 2OLSA 1KJ8A 3BSYA 4ZI7F 2Z02A 3RUPA 1CE8A 3WNZA 3OUZA 3N6RA 1M0TA 4MV9A 1JDBB 3JRWA 2W6NA 4YAKB 2YWVA 1A48A 3ETJA 2NU9B 2R6FA 3RV4A 5CA1F 3GLKA 4MA0A 4XYMB 3LP8A 2QK4A 2SCUB 3MWDA 4MV1A 3TW6A 4HR7A 4IWXA 4EA9A 4EABA 5LYJF 1DV2A 1EYZA 1WR2A 4HNUA 2J9GA 3HO8A 3R5HA 3UFXB 3K5HA 4XZ3B 2VPQA 1KJIA 3RFCA 2W6OA 3ETHA 1JLLB 4O81A 3KAKA 2R7MA 4IIJF 5H80A 2YS6A 4FFRA 4TV8F 2R82A 3V4ZA 4XX0B 5D8DA 5LA6F 2XCLA 5HBRB 5J2UF 1KJJA 3VMMA 2FB9A 4O7YA 2CZGA 1KJ9A 5HV6A 4WBNF 2C00A 3DF7A 2YZGA 3G8DA 4J6EA 2W6QA 4C5BA 3JZIA 4I4TF 3ORRA 4FFLA 2PN1A 4HQ6A 2YYAA 3WO0A 4EGQA 4O86A 1E4EB 3R23A 3G8CA 2YRXA 2HGSA 3Q2OA 3U54A 2QF7A 1JKJB 2GQRA 3K5IA 2DLNA 4IHJF 2NPOA 1BNCA 5FNVF 4HNVA 3TIIA 1VKZA 4M98A 4O7VA 5IYZF 3VA7A 4M9CA 4O2AF 1EHIA 1KBLA 2NU6B 1A9XA 1PK8A 5JQGF 5GONF 5LXTF 4YAJB 2XD4A 4O4LF 2ZDQA 2YZNA 2X0SA 1GSOA 1Z2PX 4Y8VB 2IP4A 4FGRA 2YL2A 4YJ3F 5BPFA 2YRWA 3MWEA 2R7NA 3U9TA 1KEEA 3BSSA 1I7LA 5JVDF 3RV3A 4O7SA 2DIKA 4FFPA 1AUXA 2NUAB 2W6PA 2R84A 3TIGA 1W93A 3TQTA 4YJ2F 1KUTA 2PBZA 3U55A 5DMXA 2W70A 4EA8A 3VPCA 5CAEB 3NUAA 2DZDA 4ME6A 4TV9F 4EGJA 2DWCA 4O7RA 3BSWA 4O84A 2GQSA 5CA0F 3BFPA 1T36A 4O82A 3VPBA 3QFFA 4IWYA 2VR1A 2YZLA 3R5FA 1W96A 4I55F 2W6ZA 3AW8A 1AUVA 1GLVA 1B6SA 4M9UA 4O7NA 5C1OA 2NU7B 2VQDA 4O7TA 3KREA 2CNQA 1OBDA 4TUYF 4FE2A 4ZHQF 2YS7A 5I47A 1EZ1A 5BPHA 3Q1KA 4O2BF 5J2TF 4DLKA 5EZYF 4MV8A 2FPPB 2R7LA 2NU8B 1EUDB 1Z2OX 4MV4A 1I7NA 4MAMA 2WYOA 2YW2A 4XYLB 3JZFA 4NYEA 2CQYA 2V58A 2FP4B 1KJQA 3KAJA 1CQIB 2FPGB 4RZQA 2R87A 4O83A 1UC8A 1PX2A 1VBGA 2V5AA 4M99A 5C8YF 4EG0A 4MV6A 5CB4F 3N8DA 2HJWA 2I8CA 3GIDA 1GSAA 5JQWA 1M0WA 3R5XA 5LP6F 5LOVF 1CQJB 4FU0A 2R85A 2GPWA 4ZQIA 5BMVF 4YB8B 3HB9A 4GGMX 3WO1A 1M6VA 4L1KA 4O7WA 2Z04A 3OUUA 2GPSA 4DIMA 2R7KA 1CS0A 4I50F 4O7ZA 1GSHA 3HBLA 4C5AA 4O4HF
chains in the Genus database with same CATH superfamily
1JG2A 1UKZA 2PD4A 2JIBA 1XZBA 5F51A 4LDZA 4C0LA 4FC7A 4U7WA 3W9UA 4JYPA 4GRIA 2I66A 2OC9A 5HIAA 4YCMA 1JDEA 1NP6A 1QNFA 3S24A 1LTHR 3WMXA 5BT8A 4AUNA 3TPZA 1PLKA 3C5VA 3PT5A 1LX6A 2QBYB 4UCQA 3JS5A 3KHGA 3TGPA 2IYAA 1GD1O 3EIFA 3SC3A 1DJMA 4K6CA 4TRMA 3AUTA 3HVIA 1CD5A 3A6FA 4AUKA 2DR2A 1VJ1A 4PHCA 1X0XA 2OCYC 5HNKA 2P77A 4B3XA 4MS1A 2BCEA 3B6KA 4Z7OB 2RHMA 3BA6A 4KLCA 3W9SA 3JQGB 5MGBA 2HGWA 4LX8A 2GYVA 4FFMA 2LZ0A 1GL6A 3GPLA 2LW7A 2A6PA 4MV3A 4Q8FA 1W4LA 3IR5A 3RSGA 4MB2A 2W98A 4O02B 3EVCA 3GIPA 5EGSA 4MRMB 4XH9B 3HZOA 1SQGA 1PTKA 2FP4A 4UASA 4CFZA 3T35A 3ECCA 1UBUS 1WUJS 3MCTA 4IS3A 1U0GA 1V7PC 3U7HB 3GJ8A 1GV0A 1K97A 1Y98A 5JYBA 3IVCA 5CHEA 4GKJH 1KOLA 2QK4A 1WVGA 4F3KA 3ESXA 1DBWA 4XB6B 1RI2A 1HE8B 3UPTA 3BABA 2PZAA 1ZK3A 2AC4A 4MAAA 5EWJA 2B3DA 1UWVA 4BMSA 3GJZA 4UZEA 1GNRA 4U2FA 1YJ5A 1DX6A 1YR7A 2ECQA 4RLFA 1KSHA 1GPJA 1PT5A 3WLAA 4FFLA 3PC6A 3NWPA 1RBYA 1RKUA 1XCOA 1QGUA 5DTMA 4PIPA 1AK2A 2GGSA 3GLGE 3RVOA 5ER9A 4G5QA 2FETA 2O8EA 3FHLA 3OSZA 4ACBA 3IEPA 5I9LA 2IELA 2PX4A 4FIZA 4QU8A 3WOHA 1L4EA 3GHHA 5KOYA 2QF7A 2ZUWA 1OGJA 1IATA 1E2EA 3QRWA 3GJQA 3WGJA 3S2UA 3DEYX 3Q2KA 3L8EA 3OEED 3W3AD 1P4GA 1XL1A 4PO9A 4DBLC 3LXMA 3EPLA 4AZ3B 2R92A 1JE1A 1Q1BA 1I4WA 4NBRA 2G70A 2GO7A 5CDTA 3DE1X 3FFBA 4MRSA 1U4OA 2CL5A 2G9ZA 5IJ0B 2V9PA 4V0LA 5E6SB 2EWVA 1RQXA 1XZCA 3EISA 4GLJA 5I3ZA 3VZBA 3S70A 4DA0A 3O83A 1ICIA 4YRFA 3VMFA 1FDTA 4JJ6A 2HA3A 4EARA 4QASA 2VDUE 2VHUA 4Y1EA 1S5PA 5K8CA 4O84A 4C7KA 2CB9A 3CUUA 1VL0A 1PU2A 2FQYA 2J8ZA 5AK4A 2VN8A 5D84A 1IUOA 2J5RA 1WWKA 4P38A 5GIOE 1V39A 2WMDA 4K26A 2RHBA 2XITA 1Q77A 2GESA 1W88A 1JH9A 4K9MA 3E18A 1RJEA 1XDZA 3NTXA 1DGSA 1R4AA 4ENTA 3P0IA 1J97A 4AWAA 3LBIA 4OJQA 2FJ0A 4OMFG 5IJWA 3A31A 2GVDC 4B6EA 4RWZA 5CFLA 4INJA 4FB5A 3MVEA 2VJNA 4L02A 5G40A 4CDRA 1FRZA 5G41A 4DANA 4KLAA 1XVAA 5ENZA 2FMFA 3R5JA 3G68A 4KQHA 2Q5JA 1P9LA 4BNJA 5AM2A 3TQCA 1AXRA 2HJWA 2ZJYA 1V1JA 5FT9A 3E61A 3D54D 5ANRB 1KMCA 1B76A 2GDJA 2HADA 1YASA 3X44A 1R6BX 3H4BA 1QZ3A 2OILA 4CT5A 1VLZA 3K92A 3L0SA 2J41A 4BHTA 4GBJA 4PAWA 2B5VA 2ZQ5A 3EAQA 1MC1A 4A6EA 2X0KA 3Q7RA 4B32A 1N5JA 1R37A 3U7GA 3AM1A 1WXFA 3OQPA 3RKRA 1X7WA 2B8JA 3CBQA 5GM1A 4YH1A 3AIOA 4IIDA 1YGPA 2EYUA 3GOQA 2RGUA 4LXUA 3EZXA 3SOPA 2WC1A 3W8RA 5JSZB 4EA7A 1HYQA 5CXQA 4Z7NB 4BL5A 3GJ4A 1P0PA 4YCLA 3PVZA 1XKLA 1XLUA 3LPNA 5KFVA 4N18A 1ZHFA 2G5CA 1UBGA 4TYPA 1BOOA 1V8BA 4P6VF 4UEQA 2BGMA 2A3RA 4WZBB 2WF8A 1DWPA 3LKBA 4FXOA 4KBGA 2CCGA 1MP0A 2Z9CA 2C1ZA 1ZITA 1XXHE 4JV5H 4E2ZA 1C14A 2PX6A 4LECA 4WJZA 3GC6A 4YIKA 2EFEB 3KXIA 4CM6A 3DLCA 1DUSA 4FE7A 2E7ZA 1T1SA 3I9KA 1NVAA 1YR3A 4EUHA 2E87A 4Q3LA 3CTPA 3LP8A 3MJSA 2NZYA 1T24A 3EVAA 4E5VA 2PV0A 2XGSA 1NXOA 1QAOA 4US0R 1G8YA 3PL5A 1UKVY 2SNIE 2C2DA 3TBKA 3CHYA 3CA8A 1ESZA 4O4LA 1R50A 1BIFA 3CZCA 3K09C 2EWMA 3CIFA 3KU4A 1WF3A 2IKSA 3KJNA 5BQXA 2C00A 2J32A 5TPWA 4D57A 4EQZA 3FDFA 1WXWA 1Z08A 3JQ8B 1UDXA 5ULLA 1NUHA 1AUQA 4IPTA 3CVYA 4A7PA 1BS1A 3VPGA 1V16A 5B4TA 1S0UA 2O7NA 3OF2A 4FYYA 1WCXA 2RH9B 1T43A 4E12A 4NU6A 1EU1A 3BB1A 2O5CA 2VDWA 3V5NA 3KG2A 3EXAA 2C3YA 3RC3A 4Z3OA 2KBEA 4NV1A 3O1LA 10MHA 4X7MA 3KK0A 1APBA 3L6DA 5D5QA 2W22A 1N5KA 2DHRA 3OMLA 2OR3A 3EIWA 2YYYA 4JEMA 5IKOA 3VH4A 2INGX 4Y8VB 1JHZA 1F4LA 2ANCA 2E85A 3C48A 4HAZA 1DXHA 4Y9UA 2FLLA 2ZYTX 5DN9A 5JEEA 2TRSB 4HDRB 3ZXUB 1T8WA 5FOTA 5JJLA 1I7QB 4KQCA 2XLCA 4KTTE 3TQTA 4BATA 2PBZA 4TSFD 2HK6A 2G0NA 4ESVA 2NUTA 5EFOA 3MUOA 5FFMA 3X2SA 4ME6A 5JSKA 3OSPA 4WDRA 4HEQA 5CA0F 4O5OA 1DCTA 3AIKA 3BF8A 2B8WA 2J85A 3ICOA 2YN0A 1EZ4A 3G0BA 1SBZA 4D3DA 4HXYA 1C9EA 1JKFA 1E2IA 1QE3A 2HMAA 3SQDA 1VJRA 3I0NA 3OZAA 2W2KA 3GLVA 1QZTA 2WJ3A 4D1YA 1TVMA 4WIAA 1W6RA 3H42B 4UDNA 3SMVA 2JRCA 2Y3IA 1K88A 1USWA 3AR7A 1G9TA 3GLQA 3STTA 2OD9A 1U02A 2JI6A 3A32A 2JA7G 1FLDA 1GZSA 2BFWA 1JBEA 3C7AA 4ECUA 4A82A 4FSHA 1J0CA 3PKJA 3V2IA 1ZI9A 4D6YA 4NU0A 4LZZA 2NZXA 1DQRA 3C3XA 4DXHA 1G66A 4KXNA 4EQ5A 4X1YB 2R00C 3P0JA 4JYCA 4RGQA 3BH6A 1S2DA 5E4YA 2QENA 4UD6A 2CF6A 2VUUA 4HGQA 4Y3UA 4P84A 5JSYA 1DEAA 4OHZA 1SVWA 5AHWA 3MB5A 2ZPUA 3UWMA 1TA9A 2EFDB 3DHNA 1ZKDA 3GJRA 2Q5CA 1E92A 5B36A 2AZDA 2IYZA 4OH7A 4YJ3B 5K2MA 4KAXA 1B6RA 5ADHA 4DIUA 3GFRA 3GRUA 1JEQA 1X1AA 3NONA 5LQDA 1T8SA 3F7OA 3M2PA 3MGAA 4E2YA 3M6AA 4GR9A 3KHLA 5CNKA 4KQGA 1J2JA 4MQ4A 1Z0ZA 3IMKA 4GLLA 1YQ9A 2VPTA 1N1MA 1T6BY 3N7AA 4DCJA 2AI1A 5AOVA 1UAYA 1VMDA 4CM5A 3UMJA 1TAEA 2EFHB 3SQWA 3WBFA 3BCUA 1Z12A 3CKMA 2WDTA 4EW1A 3V32A 4AZWA 3BMCB 5HE9A 4ESEA 1SK9A 1X92A 3LSTA 3KQTA 1AQ6A 3RFTA 3QM1A 3M9LA 2NVUB 4XSVA 3W3ZB 4DA4A 3M1AA 3VDMA 3DE0X 1IZ9A 2PLAA 1T5HX 3AZPA 2X0RA 2IYOA 4QWWA 3LZ6A 2HJGA 2AOVA 3DWEX 2IUEA 4CG0A 1XD2A 1HFKA 1BW9B 1Q74A 2XE4A 4XWGA 2HDHA 5D6OA 2ZTSA 2Q6KA 3ZGOA 1RJRA 3GMDA 4F60A 3DSRA 2FJUA 4GMDA 5GVRA 1N78A 3BHIA 3WBKA 4K03A 1YBHA 3OIUA 4OX9H 2ISCA 3EDQA 5G53C 3LECA 5JXHA 4TQGA 2CZQA 3B9RA 3GEBA 1HOTA 4H9GA 3SZOA 3FSRA 2IW3A 1OE0A 4B3MB 4IZHA 3HPRA 5AHRA 3AY7A 4II7A 5AQEA 1IC6A 3UJBA 1XVUA 3RASA 3CRMA 3DMNA 3FCUB 3BXGA 3O8LA 1PEKE 2AYZA 3QA9A 2QRHA 1X8JA 4OGKA 3RC1A 3ENQA 4CN8A 3D2CA 3URMA 3WGNA 3B3FA 3HABA 4F56A 3A6GA 3CX6A 3V8EA 1NJGA 5CM8B 4RZ2A 4U2GA 3JQFA 5E7QA 5BSKA 4FLMA 4I4TA 3NTVA 3ZDXB 5IWAB 1XTJA 3QUQA 4B2LA 3M1IA 3UXHA 4ZHQA 2EGGA 1I1OA 1IWBB 3Q3JB 5H59A 1O58A 3FXAA 2BQ3A 1ZL2A 1JHAA 4PYQA 2QL9A 4LBWA 4EEZA 1VFNA 1Z45A 2VSXA 3LUJA 5ECGC 4QD3A 2NX2A 3USCS 3RBXA 4L51A 1MPTA 1XX6A 3OE7D 4RZHA 3AF6A 3O2NA 2R7NA 2R5WA 1C29B 4KITB 4P08A 5JVDF 3AEKA 2ZJ1A 3P9KA 5CYOA 5I3CA 2K4MA 4FHGA 2GZDA 4L15A 4Y2JA 5LP6A 2D5BA 3GFOA 2GTHA 1YRBA 4J4HA 4WESB 3JQDA 4QAQA 5JFTA 1XTIA 3ZY2A 4QXMA 4XVQA 1A69A 4A0QA 2BM8A 5CD9A 1M2VB 2V6MA 3RC7A 1K1SA 4ED3A 2JJ8A 4MVWA 2BKAA 2NTYC 4LOHA 4MPPA 4RDHA 5DYYA 1PT8A 1R5JA 2C3PA 1S0MA 1KRXA 3X1MA 5K45A 4IQ8A 5IBQA 3NNSA 1QAMA 2NU8B 3R0XA 5IDWA 4ZCSA 3EZYA 2LDXA 1KQOA 4FBTA 2Y1DA 1QC5A 3NDPA 3PVSA 3IODA 4I4LA 2QM8A 3RBVA 3JZFA 1OFIA 2HCBA 3ZTWA 1UMCB 3WNBA 4NAUA 2D5CA 4FKBA 1ZONA 3ZWMA 3CF4A 1DU4A 3ZVMA 2VQFB 2ZYDA 2WU0A 3FFAA 5CB4F 3TJZA 3K05A 3PE4A 5JZOA 2UXBH 3FYCA 2ZTLA 4FU0A 3N44B 4UNSA 4L8FA 5JMPA 3L84A 3JQEA 3AU9A 3I30X 5DISC 1U9ZA 2C9OA 4MO9A 2AJLI 4UBKA 3IQDB 1UK8A 2O2IA 3M3HA 2WAMA 2C92A 1UK9A 2O7RA 2HYDA 5KT5A 3W2EA 2AQ4A 3UNXA 4DVGA 5KO2A 1DIHA 1JFVA 5AKZA 4BBAA 1WQ3A 4TTQA 3PC7A 4F4ZA 1DDGA 3C41J 4RD6A 3KQLA 1I7PA 4CCAA 2J9FA 3IOYA 3U7RA 4Z0PA 5JO0A 3K0SA 3EEBA 4YRLA 1QO9A 1VA4A 2RI0A 1YTLA 2JJ1D 5KKNB 3EVNA 1DHTA 2ANBA 3EQZA 5LQAA 1NW8A 4F38A 3G9TA 4L0QA 2X41A 2UZ1A 3LSYA 4LSAA 3TZEA 2HV8A 5C1PA 2V4RA 1N2CA 3CZMA 4DV3H 1VRVA 3PR4A 3C4JA 2QMQA 1TF5A 2WSMA 3VU9B 4KWIA 3AJRA 1XA4A 4JI8B 2ZSBA 2O6HA 3ETGA 1BG6A 2JEOA 1L1QA 2Q9AA 4BV3A 2GKSA 1RJGA 1A9QA 5DG7A 2R68A 4YAKB 1ZIOA 1HQDA 1A48A 2ZZKA 2YFQA 2BHLA 4GC9A 4HTAA 1WL8A 2P8JA 4JCOA 4O3MA 4TXNA 4TQSA 2Y4RA 3FPCA 4LUCA 1RIFA 4YUVA 1T3GA 1PR0A 2GPJA 5K0EA 1ODSA 3I4LA 1Z6TA 3PWSA 4LTMA 3P9ZA 3K9LA 3IB3A 3R3JA 3VR3D 3D8BA 3RJMA 2XADA 3DLIA 3B53X 1NXSA 3B7WA 5DNDA 4BXOB 1FYWA 1GJRA 1QH8A 4UBIA 3JVVA 1N5DA 2VK2A 2GPBA 2Q41A 2EFCB 3W7AA 4JKOA 2EOAA 3OM0A 1PS9A 1AQNA 5ES3A 2BY4A 3HCCA 3IPCA 2IDZA 1H6CA 3G2IA 3FCYA 1EBUA 3TG8A 4QYMA 2GTPA 5I6DA 3H7AA 1YONA 4GIBA 3VPFA 1CZHA 4AM8A 4X6YA 4XLTA 4ISCA 1N1EA 3N43B 1KYZA 1G5HA 2IPOA 4UFPA 3AVYA 4FVTA 4IOJA 5FPTA 2BKVA 8LDHA 1E6MA 1IIRA 1E5VA 2IJGX 4PG7A 5T4EA 2W7TA 5SY9A 1G18A 1K7FB 1EGHA 3E5RA 1R27A 1Y1QA 2YC2C 3AUJB 3M6WA 1FL9A 2DP4E 2HHJA 1SCQA 1H4QA 4JUDX 4KHPB 3M9NB 3OLYA 3RV3A 2XCSB 2NUAB 5ALVA 5ITZA 2IY7A 2J1LA 1NP7A 1VCMA 3CSUA 1KF0A 2JGLA 5CXXA 3E27A 3ZE0B 2DHCA 3K1AA 4M46A 2J07A 5A3JA 1E7YA 1D6MA 4XZ3A 4Q9JA 2FF5A 3DVSX 2HLDD 3Q72A 4MS1B 5A7FA 3OTHA 1BCRA 1OC2A 4KBYA 2IEYA 3EVTA 5FYDA 4M8SA 4PZLA 4PTLA 2PNJA 3TO5A 2SKCA 5KFEA 4DMRA 5JNSA 2HF9A 4HGZA 5KJEA 1MXFA 2NO4A 4DR4B 3GROA 2FP4B 1VGVA 3M9MB 2UU9H 1YE8A 1WRVA 1V6CA 2FEMA 2WFZA 4S1OA 2VSFA 3RVQA 2PLFA 3ROTA 3OT1A 5ILQA 3DMRA 3FPAA 3UAZA 4BKOA 3D2LA 3U61B 1GYPA 2QWXA 3ENZA 2XUAA 5JCJA 2WIBA 4Z4GA 3LG2A 5FL7A 1KY2A 3F6PA 3RK0A 1IQ0A 4R5MA 4KL8S 3WJ7A 4XB1A 4BWFB 2VSNA 2F9LA 2WVGA 3HBLA 4BZQA 5KYTA 2PH7A 2DFLA 4BX9A 4ZCIA 3VV2A 5D1OA 2V54A 3A1WA 3A4YA 4ZOEA 4WQMA 5FWXB 1R74A 1DNPA 1DKUA 3VDNB 5FR9A 5F5LA 1FW6A 1BU8A 4E03A 2R2GA 1QGUB 4F85A 2EKBA 3ZU3A 1PJSA 1GGFA 5LZ5A 4ARCA 3SE7A 3PNVA 4YT2A 4XKJA 2AEFA 1ZM2A 1YDMA 2B34A 4CDGA 3W8NA 4NDNE 3UPUA 3TSZA 1O96B 3LDGA 4QYSA 3Q88A 4KLZA 4PM4A 3CNHA 3DO6A 1K6MA 3I8XA 1V11B 1H6BA 2IHKA 1TM2A 3A1DA 1Y3DE 4GKJB 2ZYVX 1XYVA 3A6JA 3STYA 4R7GA 3RK4A 1RYZA 2Y0CA 3RGGA 4FILA 1NUTA 1M0SA 2Y66A 3AVWA 4QPJC 2J7PD 5ITVA 2QTFA 4I66A 5H4GA 3GXOA 3NEPX 5DGBA 2R92G 3HOZG 2O0HA 3P32A 4A4DA 4R0MA 4G1BA 1EDDA 4RGBA 1T5LA 3N8KA 1XAJA 1KH1A 4RD4A 3Q8QB 2WI8A 3TCKA 3LCJA 1NT4A 5DRYA 4BUCA 1MIHA 5B1EA 3KLBA 1A4IA 5AJWA 1RWBA 3HO8A 1DAGA 5T5QA 4RTPA 3ZDZB 1E3IA 3EMKA 1RQRA 3TGLA 3PVCA 2PGNA 2ACKA 1CUAA 2XGPA 4Q4DA 1TYZA 3AHCA 2W57A 5IFLA 1U1GA 5ENVA 1W88B 4OLJA 1O7JA 4CE6A 2ZSDA 5E1OA 5E9WA 1AKYA 4YROA 3DMHA 1TUBB 4JR2A 1N6PA 4Z9BA 5CEJA 5JYEA 1YQDA 1DQSA 1NQWA 4AJ1A 3WMRA 2Q4BA 2PZEA 2R8ZA 3H2YA 2VT7A 4BFLA 2DBZA 1CKOA 3GPDG 2IHUA 4EJ0A 2C03A 5CA0A 4JJIA 2YOHA 3R41A 4BMCA 2HQRA 3JSNA 3X2EA 2AKYA 2Q7XA 2VYQA 4R1MA 5JADA 2AN3A 2P9EA 2C57A 3LULA 3UJHA 1O3YA 3G2JA 4EHAA 1R7RA 5A4FS 3OZSA 4AKSA 2I6TA 1QP8A 3QEBZ 1O08A 1EPUA 1YQGA 2IHNA 1R0KA 3H99A 5L3RA 3FSJX 1RAAA 4U4AA 5CVDA 4MUIA 4J16A 4RVFA 1BGVA 3HM2A 4RHUA 2HHHB 4YRMA 5D01A 2I22A 3IXQA 1GPH1 1H2EA 3C3BA 2BEKA 2PA3A 3ST7A 1YOVB 2ZWIA 3BL8A 5GTDA 3F9CA 3HBFA 1QRDA 3NIDB 2X40A 5DM1A 2GQSA 2R8YA 4ZHSA 1OLSB 4XGIA 1JSZA 3ZWYA 5AJHA 4FLFA 3RB6A 3D0OA 1DMSA 1SIBE 2ZIAA 2QP4A 3IQFA 4PC1A 5F52A 4DNPA 1DIAA 1IE3A 1KERA 5EXXA 2QD2A 4MROA 5TRTA 1OB5A 3GBPA 3WYAA 2RGGA 3C6ZA 5H16A 5IN5A 4BP1A 2SKEA 3C5CA 4IUCS 2XWJI 5KSOA 3PJRA 5C2JB 5C53B 2CYCA 4U7PB 4J4BA 3E2IA 1CQIB 3RG2A 4XFJA 3V4FA 1C8LA 2WJYA 4BU1A 1BVHA 3EHEA 5LZ7A 1HLGA 3GIDA 3T9CA 2RGRA 4M1ZA 3WMWA 3RBAA 4A0FA 3QPVA 1JGTA 4R71A 2CKDA 5D3QA 1JG1A 5D1PA 5I4IA 3JY6A 5JQGB 1SXIA 3EYWA 3P52A 3MXTA 5LXTB 2H18A 3H5VA 3L01A 1EE1A 4O4LB 4B48A 3CU5A 1I01A 4E3ZA 3TQFA 4U5XA 1YU6A 3OFND 4FGUA 4DADA 1QNLA 4GPEA 4O3NA 1CDDA 1XLTC 3SIXA 3K4QA 2BM9A 5TPWB 4YV1A 5COAA 1G0OA 3Q8SB 1QFJA 1T9ZA 1E5XA 2VJOA 2ZT7A 4JV5B 5HBRA 1V16B 5JXIA 3B6JA 4M1MA 4LYFA 5DIFA 3KXLA 1G41A 3HCWA 2ZIFA 3BMOA 3HDYA 5JIBA 5TQ2A 2RGVA 3Q7PA 5CIQA 2FN7A 5FUWA 4M9XA 4RHFA 1TNDA 2Q3DA 3PF9A 3H86A 4D56A 4MX8A 2H5EA 5ESWA 3RRMA 5LZ8A 3EMBA 1D0VA 4QNRA 2I54A 5KKCA 3PHGA 4YLYA 2FMXA 2XJ9A 4RTQA 1R1DA 3H8WA 3DZ8A 4U00A 3WK4A 3PCTA 3OO0A 3GAZA 2G1PA 5K3DA 4OP1A 4V0ME 3T3IA 2BEWA 3ACCA 2YJNA 1CY7A 2Y0PA 2R1VA 2RAFA 1XD9A 3C8UA 4PIMA 1JTFA 2UYGA 4BZPA 1X7XA 1SHLA 2I7CA 2R82A 3N0RA 2BP7B 2FF7A 1Q92A 4D3SA 5JVDA 5CT4A 2GEBA 5JFGA 1FMFA 3LBHA 4Q6WA 1ZGJA 2OZLA 3DUWA 1AGXA 4FW8A 1XB2A 3DHVA 3LVBA 1SKBA 3ASYA 2Y77A 4IWNA 2HTFA 2IZ0A 3NNDA 3NJRA 4S0XA 4LHXA 1C1HA 3L7JA 2V9WA 4MPRA 2PZGA 4ZODA 2QZ9A 2CNBA 5I7SA 4BX0A 3QMMA 1ABEA 3CX7A 1QE0A 3I23A 5ED4A 3NATA 3AFHA 3VX4A 4H7JA 4QJ5A 3WY9A 3KKQA 1DUIA 3WGQA 3ADCA 1CY4A 2C8JA 2O0JA 1LV7A 2QGZA 4JVOA 4C7XA 1TQ8A 3A9TA 1I2MA 1D07A 4TVKA 3RYIA 4INZA 1VA5A 5IJ9B 4O3FA 2H16A 4JZYA 3I45A 1OMOA 2E3JA 4KYTA 1LPPA 2FGJA 5IKXA 4DJEC 4M2LA 2VQSA 2RGEA 1Y5NA 8AT1A 2LBPA 3K5WA 3LA8A 4KQMA 1TTPB 3QBJA 2UZ3A 3BSWA 5LYJB 2J59A 3TJMA 4IV5A 2ES4A 1HM5A 1NWHA 1NU6A 2I8LA 5BT9A 5C1OA 1UBTS 2VT3A 3DAHA 2VJCA 4F46A 5EAIA 3KHUA 4RNOA 4TUYF 5JSHA 1YFKA 2VA2A 2XMPA 3IXMA 3VHLB 1I5RA 4D9KA 2GR9A 1ONBA 1T1JA 3QNUA 1UWKA 4MV4A 5HYVA 4H1VA 1YS1X 5CYGA 1H5QA 4LF7H 3BCRA 3TSCA 3QMPA 5KCMA 1LVGA 4D2IA 4PAOA 4HLDA 5A0VA 2P5UA 4MCIA 1M2GA 4J9VA 1U2ZA 3GV8B 4I5FA 2OPHA 5IH3A 3KR2A 4C7OA 3AKCA 2I8CA 3QTBA 2WM2A 3R5XA 4RB2C 5I5EA 2J46A 2N47A 3T7KA 4DV1B 5AJZA 1MJHA 2B36A 3HMKA 1IBRA 1DG3A 2KQUA 2I29A 5FORA 3QBVA 5A9TA 3EODA 2Q27A 3ANYB 4ZVQA 3U39A 4YRBA 4FD3A 2ZVPX 5CB0A 3ONVA 1CULC 2RH4A 3AY0A 1C30A 3PNPA 1M2EA 2ATEA 1DSSG 4YPFA 1T5DX 5ECYA 4NCXA 4JC4A 4JB2A 2G9QA 5K3EA 1IOWA 1DKMA 1R64A 4KLNA 2TECE 4YMGA 3LJKA 2G4CA 1NF3A 4ZHQB 1HK7A 2A86A 1UKBA 3IHWA 5D3KA 3AIMA 3WLTA 2V7WA 4UHCA 4ND1A 1GV1A 4MLPA 3F7NA 4TXLA 4ITRC 1E1KA 4BLTA 2ZULA 4L3OA 1CE8A 2HDNB 1PNRA 4ZA2A 3WHKA 1E94E 1TA0A 1F5SA 1PW7A 1YJ8A 3AFNA 3W1EA 4YLEA 1OXUA 4MRNA 2QYTA 2ZI3A 1BQ3A 3VDXA 3RJ5A 4TRNA 4OQMA 4PZZA 2VWHA 5LP6B 2WB1A 1B1CA 1JWLA 4G67A 1C3VA 1H2ZA 1PFUA 2YCHA 3KT3A 2G06A 4HDKA 1SH7A 2X15A 4CLDA 4TYYA 2ZJ2A 2J0UB 3H5RA 2C7VA 4YRQA 2ZREA 621PA 1OXTA 3GFGA 2D3TA 2LDBA 1IJBA 3DE6X 3ZEAA 2XYQA 1N5IA 1S01A 4HVAA 4WKOA 2J9RA 1DC8A 4NZYA 4I4TF 3IUQA 3RU9A 2BFPA 1BH2A 3HOYG 4HAYA 4WKBA 3H1GA 3HP1A 1K4KA 2RD2A 4BJ5A 5FULA 3FKIG 1JU4A 1W19A 1ISRA 3PHJA 3V7NA 1UMBA 3OM1A 1CR6A 3CNNA 4X5OA 3BK2A 3EOBI 3NWEA 1Y1KE 4PPYA 3Q7TA 3CF4G 1GZ6A 3RSFA 2Y1EA 1M6EX 1E3QA 5D5HA 1MH9A 1E3SA 2A5GA 1TWFA 3OZBA 4RZIA 4DMHA 4Y6PA 1QGYA 4X8OA 2R1ZA 2O2HA 3OWHA 2BFDB 2HEIA 4LG1A 5BRJA 1F0NA 2DECA 5BNFA 1COZA 1XMVA 3I9V1 3X1WA 3GTPA 5AKYA 5B58T 2WKPA 5BRNA 1A2QA 1GL9B 5CT8A 1FLVA 5BMOA 1QUFA 4MHSA 3KDAA 1OU0A 1U2PA 1H0SA 1OWOA 2JJ2D 4CM3A 3FNBA 4R8RA 1UP4A 4B4WA 3UC9A 1DBQA 2UZ1B 2IEDA 5K8TA 1W85A 4NCAA 6PFKA 1EXDA 3B6IA 3UHAA 2YJ5A 3I32A 5EE0A 1N2CB 4X20B 3HS3A 4PAQA 3KBOA 3C6QA 3OFJA 3QE2A 3I1FA 3KHRA 2V58A 4Q9NA 4X66H 3N1UA 1KDPA 4CI0B 2CXNA 4Z0NA 3NEYA 2EJCA 3S7ZA 2YN4A 1X70A 2YIMA 4ES6A 4AIRA 1JG4A 5KVSA 4N03A 4BEBA 2VCEA 1NYQA 3PNSA 1XWFA 4P54A 1N1GA 3C0FB 1LKZA 1X8LA 1P7ZA 2X4IA 1GZVA 3RIXA 1UOOA 4ZALA 4CTKA 2QRPA 1YKFA 4NMMA 1EX9A 4G0VA 1WOMA 5J4KA 1G3UA 3D4PA 4JX8A 2H7YA 3EIHA 1QOZA 3H1AA 2Q0XA 4DW8A 3UUWA 2ZIVB 4DYVA 3VTFA 2YRFA 1ZISA 1BKDR 1NHWA 4XVUA 2XYRA 2OAGA 4YO7A 4DV3B 3DVAB 4EJSB 2QRLA 4LOAA 1UBMS 5IK2D 2HJHA 4UHBA 3O38A 3FOCA 4I5EA 4UXHA 2HH9A 2DR0A 4C4TA 3C6BA 3OLCX 1C1YA 2V8OA 1IBSA 2PSHA 4OLAA 1N5OX 1RK5A 4GL4A 4RD0A 3OHSX 1QOQB 1GXSA 1S68A 3IMFA 4L9AA 3HDJA 2ROQA 4O4JA 1U99A 4HG2A 3AGPA 3KHHA 1JMVA 1T15A 3F5MA 4MV7A 4AYBA 2F9MA 2QUZA 1K4YA 1B8VA 3C1AA 2B1RA 5JECA 5ALFA 3EJ6A 2GEDA 2KSQA 2OGTA 2A9VA 2PZLA 5B6IA 1ORVA 4JA0A 2C3OA 3RUPA 4EGAA 1ZUIA 2GJ9A 1WY5A 2UVWA 1EFCA 2JHFA 3WQBA 4PZEA 4V2IA 3KZ1E 1QG2A 3EZGA 2XC9A 5ITZB 4TMWA 5C5DA 3IVRA 4HGNA 3WWEA 2FE1A 5P8WA 5JYCA 3GNSA 3GELA 1K8QA 2YW9A 2O06A 1YBVA 3QA3E 2M6KA 3VKUA 4OGLA 2WKWA 2PU5A 4DNQA 5LBUA 2H85A 4XZ3B 4V0OA 4N01A 4EQ6A 2F67A 4CWAA 3LQ1A 1CZOA 2ZBVA 1H66A 2DEUA 2YFKA 1S03G 3O1IC 1BCRB 2NQ2C 3P0HA 2CZGA 3E22A 3QVJA 1KJZA 3HXMA 4XFKA 3WZLA 3HCDA 1L7RA 1QKJA 4PCAA 2XF8A 3ZBQA 4EMUA 4JL8A 1X1SA 4L5JA 1LNQA 1L5MA 1M9NA 3LBYA 1E9AA 2G1AA 2XE8A 3URKA 3G8CA 1S1CA 2C5BA 3GCXA 5A3SA 4RMJA 1DC4A 5IDVA 3QG1A 1B2RA 4W63A 1YIOA 1RPNA 4WNAB 4PC3A 4U39A 3RAQA 2IYTA 3S29A 4QG7A 1TOAA 1U0SY 2JFHA 3EDYA 1N9KA 4ZOQI 1Y7HA 3AR9A 4FN4A 3ZHSA 1SO8A 2PUAA 2C7PA 1JDSA 2IX9A 5DP2A 5I5GA 1PAUA 4HF7A 1MB4A 5IXJA 2P1DA 3PPYA 1W1IA 1Z63A 5FQOA 2OUIA 1XVIA 5M3BA 5E4TA 3Q4GA 4G4SP 4AX4A 3P4XA 1LDBA 3T5CA 4YRGA 3KWJA 5THQA 1VCOA 1QPBA 1IUNA 5FPSA 2JIDA 2IEBA 3UKDA 2HVSA 1T1EA 1FFGA 2BN4A 4Q15A 2PG3A 5K5EA 5D7BA 5JLJA 5T14A 4MR7A 4H7EA 1DWQA 5JPDA 5ALUA 1BAPA 3BFPA 3HYSA 2UU9B 4MW2A 1BVUA 1NQTA 3QKUA 3GN1A 1INLA 4BO2A 4H7IA 4WACA 4NFLA 4CQMA 4J0QA 4JUFA 4BKPA 1DBPA 2NACA 1S9FA 1NATA 5FBLB 1ZWLA 1C3JA 1NSFA 4UNIA 2JGFA 2J09A 3R8CA 3QWBA 1Q1GA 4JI7H 4JJAA 2H1OA 1E1RD 4KV7A 4BNYA 1OIWA 3SM9A 4ZC1A 3I3SR 4UE3S 4LY3A 4DUGA 3AQ4A 1CUSA 3TLZA 4N48A 3MJHA 4UM9D 3PW7A 1T8PA 3FROA 4NH0A 3BTOA 3EFOB 2MINA 2EF1A 1OX6A 2YHIA 4GXRA 2YJGA 4BQEA 1JBQA 3MAGA 1KDVA 3NHWA 2GM9A 2FFAA 4C4ZA 1DOAA 1NVVQ 3IKVA 3SYLA 4ZDWA 2NU9A 2HNKA 3OUUA 2QN1A 2PRZA 4LMAA 3AVVA 4IAOA 1KK3A 3CLTC 4RL4A 1NM5C 4R7RA 3FYUB 4GXNA 1H5UA 3F8WA 4DF3A 3G0CA 3KTMA 3C1TA 2I7VA 1MZBA 3CZPA 5HW0A 2P2SA 1X6VA 4NG5A 2I6XA 1U11A 5EA2A 2V4MA 5AD1A 1G4UR 4XJTA 1KS9A 1WCWA 3OQOA 4FUTA 4KDFA 3TPFA 4FBGA 4AXXA 2W4IA 3NPMA 4G09A 5CA0B 1J9EA 4ZAVA 3F1LA 3PGLA 2IHBA 2E4UA 1OWLA 4A3KG 2HMWA 4WXEA 3N0WA 5CDHA 2ZIXA 3L6RA 3AF4A 3E15A 3WJ2A 2ATIA 1IRIA 3HB0A 5JD4A 1P29A 4BY7G 3ZJVA 5HMMA 2H0AA 3MS4A 1JAIA 3NBXX 1OZHA 2RCYA 3CR3C 2YICA 3UUEA 1NOIA 3T5AA 3L5OA 1UIMA 3UV3A 3DZDA 4TQRA 3QFCA 2OHHA 3FPHA 4P4GA 4JXZA 1BHSA 4XIIA 5L3QA 1VIAA 5C5IA 4F72A 3FJYA 1JKIA 4QKQA 5I7UA 4AMVA 4KQ9A 1HL7A 2HHLA 5DI9A 3P20A 4L8GA 2P9JA 2XBLA 3JRWA 1Y14B 3IHKA 3AUXA 2RGNA 1Z16A 1A77A 3DLTA 4XWYA 1NURA 5TNXA 1BRMA 2JKZA 2ECKA 4E7OA 2BRUA 1RM4A 3F73A 3DEFA 3QU7A 3C5EA 4FX5A 2X19A 2XRMA 3AP1A 2ACVA 1BCSA 4DA9A 3HVUA 3EDMA 3FCSB 3ZDYB 3OBIA 4HQOA 3ISVA 2Q1YA 4P0QB 2CYAA 4P3OA 4UHHA 4KEAA 2X22A 3ZBUA 1POXA 1V7ZA 1Y6JA 4KUEA 1L5ZA 1J1IA 3JPWA 1XZFA 4D0LB 4WINA 2YV3A 4WOBA 3W2GA 2ATCA 3NGMA 2ZSUA 5DCWA 4BNHA 4HNGA 3I64A 4MVJE 2WKSA 2FOXA 2WINI 2P2LA 1VS0A 2G1KA 5AVVA 3CRZA 3P9YA 3KTAB 2VDOB 3PXBA 2O14A 3ITDA 4BO0A 2VZEA 3W1VA 2A14A 3T3HA 4HWTA 3C6XA 4IEIA 4DWWA 2Q29A 2Q8PA 3MJTA 4IYJA 4H1WA 4EL5A 2NPOA 1XP8A 4ENWA 1PSDA 4TUYA 1TWGA 3JASA 1N3LA 2H1HA 3MEQA 3NM4A 4LYJA 5C8VA 4KGZA 4Z49A 2PD6A 4ZZ3A 2VO1A 1T5BA 4J4TA 5JI2E 4WE3A 2M05A 2WQ7A 3AR4A 1WMDA 4RPLA 3FDXA 3DOEA 4A3SA 3MFQA 4EB6A 5EOYA 4KQWA 2ZRJA 1ZO8A 2CB0A 4A92A 2JBWA 2HIGA 4NE9A 2BH9A 1Y5IA 3O75A 3BSSA 1CUJA 2G3YA 2ZAYA 3VRHA 1YVUA 2GM4A 3UMYA 5A2QA 4OV6B 4OBWA 1D8AA 2XQGA 2C29D 2X8BA 2A58A 3PW2A 1GQFA 1XEWX 4PG8A 3QNMA 2ZYIA 2WVJA 1I8TA 4EYHB 5KFQA 1WSWA 2IT1A 4JUBA 2JCSA 1Y1VA 3BMOB 4BVKA 3U2QA 3JQBA 3TMKA 5TQ2B 4RTLA 5DLEA 1EZ1A 4XUEA 4DSZA 2O8FA 5KWIA 3NTOA 3R6LA 4BNUA 4U2KA 3G5AA 2Y71A 1CRPA 2H4XA 4OQFA 4V38A 3QXHA 4KFRA 4JASB 3BC1A 4L0DA 2I2AA 3FNRA 2AK2A 4B3TB 4Z51A 3DPIA 5CDFE 1MGOA 1KDYA 4NYIR 2D59A 4LYEA 4Q4AB 5FBVB 1P60A 3ZHYA 1SFOA 1VPTA 5JALA 3DTVA 4KSBA 3VU1A 1DO2A 2H06A 5JQWA 3UA4A 4W5TA 1OPRA 1P81A 2RI1A 3F5DA 4WOPA 2D0IA 1NT2A 3CEJA 5ALQA 4ZT4A 1SG0A 2A84A 4MTEA 4L1KA 2GVNA 4BO8A 3KOZA 2BGGA 1EBFA 1UBSB 2GASA 3L6EA 2NAPA 3W5DA 5B2FA 3S1AA 5CPFA 5JVDB 3Q2IA 4RY0A 1XZNA 2I80A 3UK2A 4LYHA 3OT4A 2QUBA 2OZLB 1K7EB 2XDWA 1Z35A 1TAQA 3F6SA 3FDJA 4QGFA 4ZMBA 2FLNA 1RVDA 4PX3A 4Z9FA 4GX0A 4ASUA 4BJ1A 3AOEA 3I12A 2BGRA 3L79A 1RHRA 3VFDA 4P33A 4MR8A 1HDYA 5FV7A 4H7HA 2HX1A 2QRVB 1N2GA 3HV0A 1I1LA 1TAGA 3PJGA 4FOLA 4XWWA 2B8NA 1W0KA 3K15A 2CL7X 3PRHA 2N1BA 3ICQB 4YRSA 3ABSB 4CIXA 4OQZA 1G17A 2C35B 3QK7A 1T2EA 1LLFA 2XWSA 5CB4B 1E9VA 2IU6A 2V1XA 3EGDA 3WLOA 4GLWA 5JAHA 1W94A 1C0KA 1K7YA 3SS9X 3PXGA 1ZHSA 3O4RA 2CMKA 2BHSA 4TLEA 1MNQA 1J20A 4XVHA 5F9MA 3U81A 2OCDA 2M98A 2WP8J 3H75A 4URWR 4XQCA 1NC1A 1RFGE 2AFHE 721PA 3IIJA 1BOFA 1CNFA 2WAYA 3PX2A 4BMNA 1CR1A 1QB7A 3EGWA 3AR5A 1RIIA 4FNOA 3L1UA 8GPBA 2CZCA 4RTJA 1E69A 1SZPA 4BKUA 4DAAA 2BBTA 4R54A 1JDTA 4UKDA 4S1PA 3FKIA 2XCIA 3TIVA 3G5UA 4GBMA 4C78A 2IIQA 3IV7A 4F9TA 1C3OB 2DXIA 1V9SA 5GJWC 4KWTA 5IYBG 4C7OB 1QP0A 1JF8A 5HF6A 4C87A 5FNVF 2A5DA 3TTWA 5BN5A 4OHRA 3WV5A 3U3MA 2R6CA 5LR6A 3LY7A 3LL7A 3ZZTA 3E9QA 1MLDA 4N65A 1WRBA 4JOCA 1Z47A 2G77B 1CZNA 3K7EA 4X84A 4YMTA 1KI6A 4F4WA 3D3WA 1CIPA 3TW8A 4DZRA 5IWCA 2B78A 4KGDA 2JA5A 2Z2XA 4JL5A 5EKDA 1NJSA 1PQYA 1C30B 4BO3A 3AINA 1SOVA 1R4MB 1YB5A 5IASA 2HXYA 5DM2A 1GAJA 4YX9A 2QJTA 3PEUA 4B7ZA 3FHJA 3AGQA 4LF7B 4BNNA 4G0OA 2IYYA 1X15A 4XLLA 1GLVA 2C9ZA 2YFYA 4D8XA 3OVMA 2PBFA 1JVNA 3WJAA 3I2YX 1DAEA 3PKZA 2OFPA 2R8HA 3R8FA 1E2FA 2DWPA 1AGPA 5TSDA 1EZZA 3U4IA 4RKRA 1EVQA 3GBVA 1RRMA 1XPJA 4RUCA 3UPDA 3VH1A 4HQNA 5KFSA 1U2QA 3DM9B 3DMGA 4KQFA 1CE8B 1OBHA 2WMNB 5J2TA 3PGKA 5C8ZA 1L8XA 1B7GO 4RADA 4GQIA 5ALDA 5B6JA 4DRFA 3OG9A 3GARA 4YP3A 3FKSD 1GAQA 3E70C 3SJZA 4PFSA 3DB2A 2IE0A 3S2SA 4HDKB 3FVQA 3CSSA 2A1IA 1WDLA 1E79A 1NASA 2HW8A 4HK4A 2GBLA 3L9XA 4Y1RA 2IBSA 1L8LA 5BWMA 2KHZA 3JZ6A 4MW6A 2Z3ZA 1GTJ1 1RWKA 2WYIA 1USUA 1D0IA 4CL3A 1DBRA 1CKNA 3DNMA 4H3VA 4A23A 4D9IA 2RDJA 2JC3A 2KYRA 2C4MA 4UOQA 3DTNA 1BDJA 3QY9A 3JQAA 3JRXA 4L5AA 3JAMW 1Z4PX 2BCJQ 4HVLA 1DV1A 1XOIA 1QO7A 1UMBB 5AW3A 2HD4A 4JI4H 4K9DA 1D4ZA 1RHKA 3WL5A 3PA6A 1OILA 4C14A 2C1XA 1E2KA 4FFNA 5IBPA 3DR5A 4TS3A 2I78A 1E77A 1XZIA 4KO2S 4M0UA 4EO9A 1A95A 2UAGA 1JQEA 2ZJ4A 3PJDA 4CTJA 3P5SA 1KU6A 2H1VA 3ETJA 5KNBD 4RFLA 1V4BA 3LCMA 1HDRA 3WICA 4QJBA 4DJFC 5I9IA 4J0HA 3LLMA 4KXFB 5HNEA 1YA6A 4QTUB 3DA8A 1TU3A 3LF2A 5B6PA 2VF8A 2N0SA 3WAJA 1VLJA 5BWLA 1K8YB 3SCZA 3K1ZA 4DBVO 2Q5EA 2I6GA 3CLSC 1W85B 1NL3A 4UZFA 3VKGA 5AM1A 3PDCA 1KSGA 2G0TA 3CUEF 1BA3A 5DN6D 1Y63A 3A06A 4YRIA 3VNSA 3ORRA 4C3VA 1H8ED 2IPLA 5EXEA 5KAMA 1AV7A 4NLLA 2PEZA 2R97A 3T0GA 5CXUA 1WUHS 3TE6A 4CUKA 3ONEA 4TWAA 4MWTA 1H6AA 5IT9W 2XB4A 2H11A 3T5TA 4UM8B 1M2NA 3VC2A 4BX2A 3L06A 2Z6AA 1UAAA 4J9NA 1U1CA 1L1FA 2XNDD 4BNLA 2PYIA 5ABPA 2PJDA 3W79A 4D0GA 3QVWA 3RJTA 2X1LA 2DHEA 2BH2A 1MTZA 3DQPA 4WZBE 5I9NA 3GLFA 5EWJB 2AOTA 3PXEA 2PPLA 1SQSA 5TMPA 3RTBA 1H4SA 3EAGA 4G9EA 4M83A 4IDDA 1TQDA 3WVNA 4HWPA 3LYLA 1SVMA 1MW9X 1UFQA 2OVFA 1EFKA 1GUZA 3DDZX 2Z09A 2O8EB 1GXSB 2JAXA 1N1DA 3NGXA 3KELA 4NCIA 4F21A 4PLVA 1BKSB 1XHFA 2HSDA 3VV3A 2ZJZA 3GRFA 4E3WA 3DD5A 3K31A 2XT6A 4I5DA 5AICA 2PJUA 4DLZA 1GU7A 4MH0R 3TX6A 1L3CA 1B26A 2ZUVA 1KJYA 2JZCA 1H0KA 2HIMA 2FWMX 2G08A 3HJTA 2EDCA 4LJAA 1PD1A 2XA2A 4LE1A 2FZ4A 3K2QA 1FRFS 2O3SA 1A0OA 1RACA 2VYVD 3E3NA 1JHUA 2BMWA 1W581 5AKLA 3KSAC 1JXAA 3EXFA 5IYCG 1JLKA 3TY5A 1CQZA 4TT3A 4O7ZA 4OA8A 3KVRA 4TKLA 2W2XA 3IP7A 2JIQA 2EWWA 3I8OA 3MNFA 1JJFA 4DLVA 5F9HA 3E22B 2YHBA 2FMAA 3B3JA 2QX8A 1JALA 2QNBA 3FTPA 4QSHA 5CFNA 4RORA 2X77A 3HJGA 4B3RH 1FMCA 2A1TS 2D2EA 4QHSA 3SFZA 1WB9A 1Z8NA 3FSGA 3KD3A 3F8NA 4O4JF 4B5LA 3BQNB 2OE2A 4OA5A 3BE4A 4MVJP 4ERXA 1XC7A 4MJLA 3O7WA 4OJYA 4MKHA 1BFUA 3V7UA 2WAAA 5GJVC 1WXEA 2CJYA 2NXJA 4RK7A 2Y76A 1QVRA 1OH7A 3RSSA 4KGVA 2XY4A 1BJRE 4GOKA 2PT5A 2FPUA 4UM5A 3ZC3A 2PE5A 1T26A 4FZRA 4XD7D 1E4YA 2QSYA 3QWIA 2NADA 3ESBA 2Q3JA 1SUPA 3SLGA 2PS0A 4O0LA 1CJKC 2WK1A 3R3XA 3ZHUA 1TKBA 4AIIA 1Y7LA 2BGUA 5KC9A 4R83A 1Q2XA 2YWXA 1ZM7A 3GUZA 3HCAA 3LHFA 3MXOA 3QX7A 3DGEC 3VBEA 2VOEA 1HZZC 2P30A 2QTWB 2EZTA 5DNVA 4DNOA 4HR7A 2CEAA 4FKZA 1XCLA 4ECAA 2CXUA 4MR7B 2BDTA 3BGVA 4EFNA 1OBCA 1X7WB 3FOAA 2C58A 4OJNA 1PR1A 1NXWA 1JR2A 4Q05A 3KAKA 1MB0A 3UAOA 4GG1A 3KOUA 4HQLA 3KNZA 2D4HA 4CQMB 5B30A 1Y4UA 4D74A 4J9RA 1USVA 1KJ9A 3KXDA 2AGOA 3PO2G 4JYBA 2BFMA 2P6UA 4FMPA 3P4YA 4EUKA 1ZU4A 3OJEA 3IUBA 3BXZA 2YYAA 2DYKA 1SIWA 1Z8HA 4DTCA 4EUEA 5HPYB 3LH5A 1ZKMA 3KXKA 3M4JA 2FPPA 4FWIB 1V0JA 4WFQA 3MJRA 1VCIA 1GTZA 2VA3A 4MUXA 3EA4A 2P9CA 1P7YA 3KD2A 4RESA 4BNDA 3NDJA 3RYHA 2P9TA 4FR5A 4YWHA 4FEGA 4I9FA 5LBIA 5AVQA 3FCXA 3ZWKA 3H2KA 1GA1A 5AM3A 2IH4A 2EEZA 5JHHB 1Y3BE 4RF5A 1OWMA 1USKA 1I14A 2Y1FA 1ACJA 4Z8YA 1A8PA 2WHXA 2GWHA 1N7GA 3HYRA 1W35A 3UHJA 2QXTA 1EK0A 2W6PA 3I5AA 4PLWA 1SU6A 3SHTA 2XBUA 3NHRA 4MQ5A 4LI3X 1LJUA 5D7NA 4JI7B 5I5VA 5AOBA 1E8DA 3M6XA 3U4AA 2HT6A 3VSEA 2Q99A 5EIFA 1YR2A 4TYQA 4OHXA 3BIWA 1XRNA 2ZIXB 3CNQS 4ETSA 5DYNA 1UINA 3UBTA 3WL8A 3ZU6A 2FCAA 1OFHA 3P2EA 5FOUA 5K4GA 1IMJA 2Q07A 4I7HA 3VM6A 2OV3A 1RKBA 2C97A 2GBPA 4PLYA 3K70D 1P8AA 2YMMA 4Y2HA 2VDWB 1IXYA 1JU3A 5CLQA 4HXFB 2ATXA 2QAIA 1X8KA 2GM3A 4RZQA 3FCEA 5CVVA 3FNGA 2FPMA 3NBMA 3OCZA 1SRQA 1UC8A 1WLSA 2ZBGA 4QLAA 3TW0A 4PYKA 2XRZA 3R3UA 4ND7A 3LRPA 2A5FA 4MV6A 1ADFA 1P1KA 3PRJA 3H0EA 2PMZA 5DFAA 4KNWA 3S28A 3GHYA 2HSGA 1BE1A 3BXOA 3HVHA 3USES 4CQNA 1V6AA 1XHLA 4M60A 3IQIX 3L7CA 2J4FA 1RRFA 4O63O 5ALYA 2NUTB 2ZI6A 4Y9DA 3AB3A 4O81A 4JBWA 3TG2A 3TAXA 1WH2A 4TPKA 1X7DA 1O4WA 3E7XA 3EPHA 4I9UA 4EGCB 4EVIA 3KT8A 2FGKA 1KPHA 2JA8G 2WHYA 4B84A 9MHTA 5DG9A 3C87A 4HO1X 2GJ4A 3TM5A 1XRPA 2W2KB 1ABBA 2E2WA 1UZAA 2Q5LA 1E6CA 4BFZA 2I4MA 1P4SA 2G6BA 3F67A 4P3XA 2E4WA 1FNSA 2QTNA 5DLQC 3DE5X 4HZIA 4MB6A 3EXIA 2QB5A 3ZDFA 4IKOA 5K0NA 1QWOA 4TUYB 1OKKD 3EZLA 4RPCA 2J0EA 3IULA 4J9OA 3I9LA 5JANA 2FLVA 4WXPA 2B99A 4L9WA 4WGGA 2XQIA 1WEHA 4EB6B 3AT1A 5K0GA 1QGED 2HDWA 2WE7A 1TTQB 3BE5A 2QNRA 4NJEA 2HU2A 5KQGA 4LN1A 3KB6A 2WG1A 1ZOSA 1SIOA 2HFJA 5FNVA 3TW6A 4IDCA 3Q15C 4L6IA 4DFDA 4XRRA 2DCMA 3PXDA 1Z0AA 2D7JA 1DV2A 5JJ5A 2VHXA 4YY3H 5LSAA 2XGOA 4K1LA 5H82A 2IL1A 4Q44A 4MJ3A 1JEQB 3QE9Y 2VIIA 3HYCA 1P19A 1EXMA 3L7NA 4RYLA 2OAEA 4X97A 1PVOA 3PE6A 3BHJA 2IS2A 2O8FB 1CZRA 4OX9Y 4I6EA 5DQIA 5EDWA 1Y1VG 3HR7A 3O6VA 4GOXA 4RVSA 4UNNA 4NE2A 2COEA 1IWOA 1TWAA 1IG3A 3T3MB 4LWQA 3KUXA 1FX0A 2RBEA 1UDWA 3EJWA 2WJ6A 3ZNOA 2GCNA 5HILA 1RC0A 3DTVB 1UZMA 4R8VA 4Q24A 3N75A 3C7DB 2Q1XA 1XD2B 2B9EA 3K2IA 4RH3A 3TD6A 4PZ9A 2QOEA 3EDCA 3O47A 2A3NA 1DDIA 3LIIA 3C8HA 1XZKA 1M8FA 3ADPA 2E18A 3TTTA 1R9NA 3C98A 1HLDA 1VLLA 1MH1A 2YRWA 1GRQA 4YRZA 1KFBB 2OTCA 3D6JA 1XI2A 1II0A 5HZKA 1PO7A 3P9RA 1GSIA 3CNLA 3WIDA 2CFRA 2E0IA 1KKLA 2ZJBA 4ALMA 3W9BA 1F7UA 3JR7A 1G5TA 5KFMA 4MIYA 3TEMA 5DOZA 4PBCA 2ZJTA 2JJMA 3GO4A 1JLLA 4NECA 2GO1A 5HKOA 1FXUA 1DKPA 3UYLA 2HVQA 3C39A 2PSJA 1I9CA 2G07A 3EMVA 3AL3A 5BSUA 4C22A 4RMHA 5FIUA 2HF7A 1F4VA 2R7LA 4NDAA 3ZLJA 3QY0A 4I4TB 4AMGA 2PMEA 5FX2A 1MF7A 3BE8A 1Z0JA 1CV2A 2Q50A 1WR8A 2FDXA 3BIJA 1ZRSA 3RSQA 4WY5A 1P2DA 4D4HA 2X2FA 1FQJA 3AV3A 4NI5A 3ORSA 2Y1WA 5A6SA 4J9QA 1Z8DA 4OX9B 2QAGA 5KHAA 1A72A 4RH1A 3WWPA 3U13A 2ARKA 3NBAA 3EGDB 2J6SA 1MO2A 3CW2A 2HC9A 4DA8A 2NU6A 4BWVA 3U62A 2OCPA 5BMVF 4MIOA 3C2QA 3AEKB 4WJKB 4WBSA 3MPOA 3OIWA 2PRYA 2BSQA 1Z4QA 1KHTA 1SXJD 4LIPD 1MC8A 3QZUA 3VTKA 3NJ4A 4CIDA 4JLDA 1J1UA 4KRFA 4MTDA 2ZW9A 1O77A 2EARA 2WFLA 3NHYA 1E9RA 3MGGA 4KNYA 3OI7A 1IHXA 4L7VA 3KL4A 1RZRD 2V0GA 2UZ0A 3KC2A 4ARVA 5FOSA 2GILA 2PJZA 3MSXA 1BQEA 2L69A 2Q6VA 2FE4A 2RHJA 1V5EA 5FF9A 4ZOCA 4YPVA 1IAQA 3SYRA 1X1EA 2WT4A 1BHQ1 2AE2A 2NIPA 3CJRA 3ENKA 3WWHA 6ADHA 4R2KA 5EHGA 3SC4A 4OL0A 4UFOA 1W30A 2EEPA 1QC5B 2ZSIA 3RJZA 4XARA 3N53A 4BNGA 2O7VA 2ZSEA 3DZHA 3UJ3X 3IDAA 3Q3EA 5BORA 3C3PA 2W6MA 3UGTA 2X2PA 1SB8A 3NT5A 1CERA 1TEZA 4XWTA 4BB9A 1E3LA 1RAIA 5BN5B 4DLNA 3ROMA 4B09A 3FGOA 3EZ9A 4JVMA 2UZ4A 4H1TA 4B3CA 1Z5OA 1PWEA 3R20A 4Y2TA 2DHDA 4BLVA 4RELA 2JGEA 1KI6B 2W8ZA 3L46A 2H7CA 5LL6b 3GH1A 3JQ7A 4E4RA 5LMCA 2VNJA 5ALWA 1JNYA 4WTOA 3S5UA 3M5DA 3VUFA 3U26A 3TKLA 2KWIA 1CUEA 3T9AA 2EJ0A 2VWGA 5JJBA 4BP9A 1V43A 3HZRA 1E0KA 2AH5A 3ZR4B 1TAHA 1GHTA 3UW3A 3S99A 4XWKA 5D00A 2JA5G 5JNUA 2H00A 4BEJA 3KPWA 1HZJA 2IUUA 4RV9A 1KA9H 1PT6A 4JJ4A 5GOTA 2BMEA 1Q50A 3G1WA 1QTIA 3BFJA 3CB4A 2JLWA 4JLMA 2J9FB 3BE6A 4DEYA 1J06A 5JD6A 1UBCA 4AKGA 3UWPA 1JEJA 2NYVA 4HSGA 1KAQA 1T9DA 5KTKA 1NG9A 4RH0A 1S2IA 3KKNA 1QRUA 2GCIA 5CLFA 1GITA 4J6FA 1ZESA 1CC1S 1P9WA 2UXBB 3U3RA 1Z4MA 4BVEA 4IJ6A 2VA8A 4KXVA 3DDUA 1ECPA 3M6MD 1QHGA 4W9RA 5DCYA 5HJEA 1WNTA 1VPVA 3DV2A 3LUBA 4HADA 4LE2A 5AJVB 1M6WA 2A9FA 2P69A 3DEJA 3M9WA 4LY9A 3VC3A 1W29A 2C8LA 1OFUX 3P9XA 5BURA 1MMFB 1LF0A 4AS2A 1KXJA 1HBJA 3RTAA 4TM5A 4D99A 2XHZA 1ISSA 1GCOA 4OEHA 1S3FA 4D4LA 4HGOA 3RU7A 1ZNXA 3U6KA 4ZAFA 2QLLA 4J7UA 1LXCA 2FJZA 3RHTA 3PQFA 1OYOA 2HIHA 3T5KA 2J45A 3EH1A 2CW8A 3GLHA 2VHTA 3NH6A 3U3JA 3ZWBA 4MRRA 4J0JA 5AJTA 4B8YA 1CKNB 2ZBEA 1JFLA 1WZUA 5CLHA 4DC0A 1QH8B 2OKCA 1PR6A 1EG7A 1U3CA 3WSWA 2DRIA 1VDMA 1XNRH 1U8UA 3H1TA 3U3OA 4AULA 1NNEA 4MUKA 4NC9A 2OV1A 2Z2KA 1CRZA 1Z6ZA 4BWGA 4UVIA 3PUVA 1BWQA 5J2TF 3RIYA 4H27A 1PG5A 2IXDA 4YMSA 4G89A 1HYGA 2QVCA 3I04A 1JDBC 2W2TA 3OD5A 2ERCA 2CXRA 3RW9A 3TZ6A 4MCJA 4ILKA 2HA7A 4G0WA 4E5PA 4I7EA 5LYYA 5EHZA 3E9MA 3ZDQA 3TI7A 4EW6A 1CWUA 1WHSA 3KEGA 1G7TA 2YV4A 2UUCH 4GI7A 3OJOA 1QP4A 4E1BA 2PVCA 4P4SA 4DCPA 3AU8A 2B92A 5SZKB 1SXQA 4C6RA 1FZTA 2GT1A 4DEXA 4KH0A 4KWEA 1HO3A 1WXQA 2JGDA 2YVAA 5C8YA 4IDBA 2FFJA 3PPVA 1AG9A 5BV1A 4CHGA 2JLCA 3K1AB 3EEQA 2FDCA 1BU5A 4OQQA 3BG5A 1B14A 5JHGB 2C7QA 1E9SA 1NW9B 4JI4B 3UMMA 1TGYA 3VNVA 3GCWA 3JD2A 4O7LA 3KSMA 1ZPDA 3FFTA 3ILVA 2HBRA 5C51B 1PJAA 5IVPA 4ZQFA 3ZWXA 2NG1A 3MIIA 3QKSA 3OZ7A 4NHOA 1BE8A 1AOXA 1QK4A 1PKXA 2CHFA 5EWEA 2IOYA 3CE9A 2J9ZB 4NBWA 4YDHB 1ZU5A 1WTAA 3QUTA 4F9EA 5CM2Z 2J33A 2ZU0C 2IBKA 3STHA 3QSYA 1JYFA 4UCVA 2X5NA 3MLEA 3DP7A 4MRAA 3OT1B 4EWLA 2JFGA 3DZGA 5AI8A 1KJ8A 2HJ9A 2CSUA 1DG9A 3CPJB 4GW3A 4NOLA 3L0CA 2FW0A 5KG4A 4ARSA 4LF4H 5ADUS 3N6XA 3LUFA 2R6FA 4FHFA 2CNOA 1W5TA 7ADHA 3GLFB 4LJ4A 3GP8A 4CLHA 1L4MA 1PNTA 2AOTB 1UKAA 3DXYA 4ER0A 3VOBA 5D1OB 5BNZA 5LLTA 1U3UA 3BH7A 3IDZA 1VL6A 3EUAA 1E0SA 5CNIA 3OQVA 3ANMA 3EGVA 2CDAA 2CE7A 4WOCA 1C3LA 2CFMA 2LD4A 5JAZA 4D46A 1FP4A 1OLOA 3QXSA 1J42A 3COWA 1PVVA 1DHRA 2SICE 1LI4A 4GGPA 2V6BA 3L04A 1I1NA 1UL1X 1NZFA 3QHPA 4EVSA 1BKYA 5B3LA 3C24A 1ECCA 3SZMA 1XTBA 1A27A 4BP3A 4JYMA 3GT3A 3O26A 4NMLA 1Q3KA 2FN4A 2FHSA 1VKNA 1ZXBA 4KPFC 2ETXA 1AC5A 1Q7TA 4TXJA 1QYWA 3K35A 1I24A 1H4TA 5A02A 1R9GA 2NO5A 2D2XA 3K09A 1TZJA 2IXGA 3ZWNA 1LRKA 1K5DA 2BI8A 5IG2A 4ZVSA 4HWSA 2QRQA 4CIYA 1FRNA 4OLHA 3JPYA 4XASA 1QHEA 3AVTA 2VHCA 3HQ4O 3BKXA 2VBFA 4RQUA 3C3EA 5THXA 4P5DA 4YUAA 1U9YA 2CFTA 4MKRA 1B3BA 3VJLA 3WHLA 3ZIUA 4U8GA 1T3ZA 1UZLA 2W9XA 2I67A 4WOJA 5IJAA 2ZRLA 3T95A 4FD2A 5BWWA 4AMBA 3GV7B 4UAVA 3IPAA 1SEVA 3DDNA 2IUFA 2PWAA 2R6JA 4BV8A 3B60A 2YZLA 4AJPA 2H4HA 1ECGA 3CVUA 1C8VB 3FMGA 4JKYA 4AURA 2BGWA 3MWYW 2XDAA 2BLLA 3CUTA 3T7AA 1KZ7B 1ZJ6A 1W5BA 1NVKA 4BQOA 1Q7GA 4N6NA 3M4XA 3SDZA 2N46A 5DGDA 2QVGA 4CPDA 2FN3A 2ZJAA 1XBTA 1RYDA 5FJIA 1DUVG 5JJIA 3LC0A 1CG6A 2PUGA 1T13A 1DGQA 3T5BA 1UBLS 4NH4A 1PL6A 1Z5UA 3KKEA 3PQ2A 3NHJA 2O3RA 1HLPA 2QXUA 1D1TA 4EG0A 1WDMA 2CV2A 2YVLA 3FETA 3PHHA 2OBXA 4LJSA 2RF4A 1YACA 5F9FA 1AKWA 3ONDA 3BFKA 4B3RB 3HB4X 2XSZD 1MCZA 2AXPA 4J9PA 2MCTA 1KVRA 3IQXA 3VI3B 3WL3A 4NTZA 3KOWA 3QFHA 3ETLA 1MNAA 2X0FA 3VYRB 4G63A 1ZYUA 5E9AA 2SCUA 5IDQA 1WP4A 3Q5GA 2QJOA 1F14A 1M76A 3ETNA 3LT4A 1W47A 4YACA 4B6FA 2B8TA 4CV3A 2R00A 4KVGA 4UNPA 4Z86A 2QTCA 1ZSYA 2EJ3A 1RYMA 3HJRA 4ZV7A 3NETA 2FPSA 4UREA 2F4NA 2Y1CA 1K6EA 4R2HA 5DTJA 3RSHA 3OX3A 4LGMA 4MZXA 2AJCA 1PR4A 4UCOA 1FQWA 4F4XA 3F6YA 4BNDB 1TMGE 3D7SA 4QEZA 4ZO7A 3JQCA 2Y1XA 2ONJA 2WPDA 2NT3A 3ZZNA 2E1RA 1FS6A 3K72B 3IG0A 4LWPA 3RF7A 1B41A 4UUPA 2H3HA 4CR6A 4K9LA 3JWGA 4WLEA 3ZDCA 3G2NA 2OHFA 1M3SA 3ILHA 3OP1A 4MUMA 3RVPA 2QTGA 3EGIA 1N9ZA 1Y1RA 4RZUA 1D4OA 3GWZA 3SHOA 3W2IA 4RE6A 3L4SO 3ZS9A 1UODA 2QYZA 3EPJA 4ZU1X 3RODA 5FBQB 2XUZA 5FL3A 3D2BA 2BC9A 3RSZA 1E3MA 4PG4A 1G1MA 2EC5A 1NUUA 3LGSA 5HBRB 3OPXA 3QSGA 4BO4A 1NP3A 5CFMA 1E3JA 3I0ZA 3WL7A 1QRAA 4FCTA 3ZD9A 3E8SA 4NP6A 1MQ9A 1JDZA 5JATA 3A8TA 2B6HA 3A9CA 3TTXA 4KX3A 1OVGA 2ADMA 1J8FA 3Q9NA 1E2LA 4WCDA 1MX3A 4ZVRA 3AHIA 4GE3A 1Z7EA 5KWSA 2R0QC 5CG1A 1PFVA 3IQWA 3A6ZA 3GJYA 2VH2A 4IR7A 1GGJA 2WP0A 3UVEA 1O03A 3I6YA 3LY5A 2AMFA 3PI6A 2O4CA 4JLJA 3ZCXA 3AEYA 4CIWA 3VSAA 3LVQE 3O84A 1GRCA 1JU9A 1QP7A 2NXCA 3W2TA 1JG3A 4UQLA 4F0JA 5B7NA 3T9BA 5IMSA 4A0HA 5JS6A 3F7MA 3GT7A 4F04A 2BEWB 1YAHA 3ETEA 4KOAA 2ZUEA 5BR1A 5HF8A 2I71A 4CMHA 2VUGA 2EGHA 3GP3A 2R1VB 3GEPA 4RIHA 2WDPA 2E21A 4R8LA 4MQBA 4IO0A 2ODPA 4O7SA 4BFVA 5BR4A 1X7XB 2B6NA 1JXMA 1SBIA 1RYHA 3V9AA 2ZVQX 4W9MC 4UHDA 4F97A 1C7FA 4XI9A 2F4VH 2CBGA 4MDFA 4U5QA 1EUYA 2DB3A 4IQ4A 1ISIA 3GEMA 1MX5A 2ODNA 1SB9A 5BMVA 3ZOZA 1T3NA 5J9FA 3UT0A 4JP5A 3PFFA 1VB5A 3KYCA 6GPBA 1Y9EA 4Z54A 1OXKB 1JSLA 4EOGA 3TECE 5DGAA 3UG6A 5CJJA 4GMXA 4DQLA 1K7XB 2VDQB 1YFLA 4FGWA 4CL8A 1ZA1A 3BXHA 3K9GA 2L2QA 2HHFA 5DK6A 2ZUCA 5AI4A 4Z5XA 2OMEA 3D6TB 4YCNA 1SBHA 1L7QA 4G2NA 1YVDA 2CQYA 4C05A 4NENA 4DB4A 1UPAA 1M8PA 5FTWA 1RZVA 4ID3A 2F2TA 3CLUC 3OUTA 3KSZO 4QDOA 1V5FA 3SLRA 3MT9A 4PNPA 1P2TA 1KQGA 4NJEB 1P6XA 3E53A 4HP8A 3RB0A 4Q7MB 5FNVB 2VAVA 3ON5A 3RYIB 1D9XA 2GPNA 3FMPB 1W9MA 2RHWA 3KWMA 4N7RA 1CUFA 1U3DA 1CUIA 1RPTA 1HYHA 2FXIA 4TTAA 1JN0A 2JCYA 3EVFA 4RSRA 4M37A 2PX3A 4TRRA 3ER9A 4CM7A 3FHCB 1AO3A 1PDOA 5DU2A 3P2MA 3D6UA 2JLUA 2BKEA 5DVZA 4QO8A 2VLBA 1XIVA 5FADA 4F4HA 3IELA 3GUCA 4W7IA 1J9GA 1CUGA 4EVQA 2WA1A 1VYVA 2XI4A 1UJNA 3WA6A 4U0JA 3WLNA 4X7RA 3H9UA 1BMDA 1XJQA 2CNUA 3GILA 1SKAA 4QODA 2FW9A 4KIWA 4ZZ2A 2B4YA 2DBYA 5EJMA 3EPGA 5C7OO 3TQQA 4JJEA 4RE5A 1CB7A 3HP4A 4J07A 2OG2A 2W6JD 5BW5A 3P9NA 1NJFA 3L8ZA 5JSUA 4BQFA 3M4ZA 1U04A 5IFKA 3IAXA 2OLSA 1M33A 5LD2B 5FD6A 1BVYF 2PKQO 5AOCA 3PGXA 3MTJA 1TYDE 3SZLA 2GNOA 4MYUA 1S9HA 1DPGA 4Y2UA 2XUDA 2CFOA 3CSDA 2IYSA 1C4OA 3RK1A 2BTQA 1EJ2A 1HDOA 2AQKA 3LL4A 3UAXA 4MS4A 1N2CE 6YASA 1KBZA 1IZ7A 2ZTHA 1IZ0A 1Y48E 1K75A 4J0CA 3DGFC 2D4AA 1JLLB 2A9OA 4W8HA 3QOFA 5C7YA 4H6WA 4CKZA 1U0BB 5A2GA 5FV4A 2YVKA 2VF4X 4JL6A 1U0EA 3ASVA 2AHOA 3SLKA 1XLWA 4PTZA 2JK0A 4RABA 4HYEA 1YRAA 4FEAA 3LGXA 3I04M 2AJTA 4C5BA 4J7CA 4RUKA 5TMBA 1TIPA 3TK1A 5NLLA 1NQXA 4HJRA 3AKZA 3IP6A 3L8YA 4K6GA 4ND5A 4ON9A 1JHOA 3FLAA 3L0PA 2BFFA 1P80A 4GRAA 3F8SA 1IN1A 3EA5A 4K9KA 4PR3A 5A6SB 1O2DA 3LX8A 3EQ7A 5F98A 2QAGB 3JW8A 5DF1A 2EIXA 2GN8A 2G9NA 3ZJ5A 2OHJA 1WVMA 4ZYWA 4YRCA 2CLEB 3FDZA 4GKBA 4W4TA 4D02A 3N3AC 3K1YA 2NU6B 1Z22A 3T7EA 4EYOA 3ODPA 3ZYZA 3L4BC 2Q2QA 1CKMA 4R0VA 2M2IA 3DM5A 4TMXA 3DJYA 1YC2A 3DAOA 1T35A 4YJKA 5IYZA 2WFLB 4EF5A 4MWCA 5AVXA 2BUCA 4MI9A 1IAVA 2WWVD 3GUYA 1YR6A 4L3VA 5DO9A 3LPMA 3E8MA 3T3NA 1LW6E 2PL3A 4B6GA 3STWA 1ZD8A 2DBVO 2QG9A 1KHHA 5K99A 5H3LA 1KTVA 4M21A 2E37A 4YHBA 3KKKA 3VAAA 2ORYA 4L8YA 4JB0A 5AW9A 4UC0A 4L8LA 4TTSA 4DDWA 3ZCTA 2VKTA 4F2PA 4RQBA 2IUTA 4DR1H 3ZHOA 4B3IA 1WKCA 1MU0A 3PQ4A 1NULA 4HATA 1YZUA 4MAMA 5FLMG 3L8FA 5KOIA 1YDGA 2X0EA 4MV0A 1UEIA 2QUIA 2H4ZA 3IKLA 3AJEA 2WZBA 1QQTA 1CRLA 2P6MA 4O83A 2WE6A 2NVOA 5AJXA 2IH2A 4OHMA 2EKLA 1BA2A 2C3UA 4K9QA 3HJCA 3U31A 1YA4A 2J5KA 4LRWA 3AKYA 1CDZA 2Y1KA 2CVPA 3SJUA 4BO5A 4QBIA 5C0OE 5DNEA 5EJGA 1VZ3A 3HCEA 4JU8A 3B5EA 3EBOA 4EYQA 4U7DA 3MTBA 1NMSA 4D41A 1XF1A 2YVUA 1KK0A 4BO7A 1ENOA 2YNMD 5FRDA 3KHKA 4A8HA 3FPJA 1O94D 5AMXA 1RCUA 1MB9A 5CLGA 2YXLA 2FUCA 2QDKA 3O8CA 2I4OA 4UFZA 2R5NA 2QROA 1EQAA 1I0IA 3BDAA 4EEQA 3TQ1A 3NOVA 2GD2A 3DOCA 1J49A 1WVIA 5BW4A 3JU3A 3DC7A 3DJFA 4IINA 4ZFNA 3IQHX 1IEQA 1DZ3A 1M34A 3IJRA 4U3JA 5ICSA 5JAMA 4FSDA 4R2MA 4Q01A 4OHCA 1EDEA 2R6AA 1GN8A 1IIBA 2I6FA 4U6SA 1EUDA 5YASA 3WTCA 4ZCMA 3SFVA 1L3IA 5DBEX 5KFHA 1HI9A 1WF6A 3TF5A 2YOGA 3PUXA 1PZXA 3KR9A 3C3KA 4GUAA 3JAKA 5C5JA 1P4RA 1Y3FE 1IWPB 1JRLA 1QPZA 4S35A 1QCYA 1P3Y1 1DVRA 5EWGA 5DX1A 1XE3A 3RV4A 1XN1A 2Z1NA 1XL0A 2X0NA 1GTMA 1J23A 1UCFA 4PSCA 4UUMA 2CBXA 3L7LA 1JR3E 3VC1A 3GLSA 2O05A 4J1QA 3MIZA 4V1CI 1KGDA 4UPVA 3OHPA 3L7MA 3WBJA 3WB0A 4KC0A 1B43A 5B5SA 1COWD 4FYIA 4X66B 4RS3A 5EERA 2BGJA 4V2UA 1YD7A 4BMVA 1RJDA 3BXEA 2XUFA 4A0RA 5AVZA 3ZE9A 4YJDA 3WGYA 4IH4A 3WO0A 3WNDA 2JVKA 4O4JB 1T2DA 3OA2A 4NPHA 1TT5A 1BFDA 2ACEA 3TJRA 3TLKA 3PUYA 2R25B 1KIAA 3P96A 4IDHA 2H5IA 5HKBA 3PSHA 4UUOA 1ZJYA 4ZEOA 1GILA 4P3YA 2Y1OA 4P4SB 4F6RA 3RIMA 4D5EA 3DQZA 4Q43A 1ZDMA 1TRHA 1XNRB 1PK7A 3KFLA 1MJNA 1J0BA 1BS9A 4OGGA 3VR5A 4KP7A 1SVIA 5M5BA 2BTEA 1W44A 4ND2A 3F9IA 1J07A 3MT8A 4EQ6B 4Y2QA 4GSYA 2C2BA 2N75A 1ZOLA 1NFQA 3TQOA 3L05A 2BDEA 5K8JB 1ICEA 3KS9A 2PO5A 1XNHA 4ZT3A 1OT5A 2ZP1A 2KMLA 4H16A 1T10A 3IVAA 5FA8A 4WA7A 3AR6A 1H69A 4P5PA 4GC5A 2IYQA 2XVXA 2P4QA 1XPUA 3QUAA 5IVDA 3MJVA 1XNGA 3L41A 3BMNA 1NZJA 3A0RB 1A9TA 4IZ6A 1GAXA 1HH4A 4GLXA 3DHYA 2D1QA 5CTAA 4JJFA 1I3LA 1XDGA 3ZN2A 2A94A 3VPSA 2Q6OA 3DFUA 3K1TA 3RB3A 2DUUA 3UICA 4QVIA 4V0RA 4YRJA 3AFIA 5C8YF 4ROTA 4EVRA 1TF2A 1ZD5A 2ICAA 1K8XB 3FI0A 3PIIA 3RTCA 2R8BA 2HY7A 3IPLA 5F33A 3PWTA 5KJCA 1GPLA 5F12A 4I36A 4GLFA 3WFIA 4AO6A 4IHAA 4GGMX 5HFAA 4NBSA 5DLGA 1O97D 1S2MA 4AVYA 5HOEA 4LPKA 1OZGA 4DQXA 1FP4B 4AS3A 5TQ0A 2P91A 3G5MA 4FWTA 3P45A 1EM6A 3O31A 2G5GX 3K3VA 3AL2A 2DY0A 1R6DA 4ZAZA 5HXAA 3DZFA 2YVQA 1H9CA 3NXSA 1GUYA 4MYDA 5AP9A 4ZVUA 3INTA 3PLAE 4Q39A 1FSPA 4AY5A 1I6MA 5DHFA 4TLDA 3DE7X 3BXFA 3KJXA 4IZOA 4OKIA 4OJTA 4LF4B 3T12A 2PX5A 3MCVA 4AMZA 1X1CA 4ITVA 5BSTA 2R48A 3U7EB 1G5RA 2X14A 3G85A 5B1DA 2ECPA 1GEGA 3LWZA 1XLTA 5IANA 3DH0A 1ZVMA 5JZMA 1E5TA 1PG0A 3GU3A 2AW5A 2Q5QA 1SD5A 3KQYA 2MINB 3GW8A 1SXPA 2NW6A 1RQ7A 3AF3A 4I5GA 3MK31 1WZNA 4Q4JA 4NZMA 2YHIB 4BTVA 4XCVA 2HJSA 3X1JA 4JZKA 2QW8A 4ER3A 3ENWA 4LHSA 2BMJA 3O2JA 1WDWB 4P4LA 5JJKA 1F6WA 1US8A 2NU9B 4MP6A 2KS6A 1ET0A 5I7RA 1GZ4A 1UFVA 1TJ3A 2EZ8A 1KRWA 1KKUA 3TMYA 2UYQA 4G26A 1MJ5A 2ZI9A 3R3VA 1M54A 4QOGA 3GTGA 3EG9A 2P1RA 2GAFA 1V9LA 5JT1A 2R8OA 2P9FA 4LXXA 1C8KA 4JEIA 2GERA 4DQDA 2VZ8A 4NBUA 5EUCA 1Y37A 4Q1BA 1IN7A 3MAAC 4HWRA 3VI4B 5IZ4A 3L3BA 1KJJA 3NX4A 1UT5A 1B0PA 4H15A 2VH5R 1CF4A 5TVKA 3P0RA 2VP3A 2VUMA 1J22A 5AXCA 2J4CA 4HMPA 2ISSD 4HLUC 1P6UA 1CR2A 1WUIS 1KETA 1IBCA 2AMVA 3AESA 1HFEL 3D0QA 3LX4A 1NUPA 2VDPB 4IFIA 3GDWA 5M29A 2HQBA 4OF4A 1JPUA 5L4NA 3D64A 3ZJ4A 5KFGA 4BYMA 5L3QB 4HNHA 3R4CA 2AOXA 4QUHA 2VK8A 2AG8A 2FSIA 3O5AA 2A0UA 2ZGVA 1XR3A 4O2AF 1ONPA 3HDGA 4NCKA 4DRYA 3NBUA 3OAAA 2I62A 3RROA 3UCFA 1AXGA 2OHOA 1O95D 4P7GA 2GB4A 1G60A 4A2WA 1SBYA 2G88A 3LUPA 1DPFA 2AC2A 3RB4A 3BWCA 5AKKA 2ZANA 5CDGA 3BD8A 4CG3A 1T5SA 3E1GA 1HE3A 3B6ZA 2Q4TA 2HDOA 3VNQA 2JBHA 3HT5A 1OYWA 1BCSB 3I6MA 1G7RA 1W36C 5B1IA 3OZRA 4ZQBA 4KK4A 5AKIA 3FUVA 2PR2A 4Q12A 3ZZ1A 3SNOA 3OX1A 1Y7IA 3M4YA 4C4AA 3DOHA 5GV7A 1H42A 4R1NA 2QT0A 4IF6A 4Q45A 1CY2A 2IX3A 2WPNA 3BILA 1C2TA 1IVNA 1P2FA 4MV8A 4C4SA 4B80A 1Z33A 4RS4A 3CUYA 3GF4A 3TDNA 2YWEA 3JASB 2CWWA 3LOQA 4FQ5A 2LIVA 1EB9A 1PV1A 3A6DA 4DCOA 1HMPA 3A4IA 3VSCA 1PSWA 4BFTA 3NRCA 2DR3A 3ZGYA 4NOKA 4Q66C 3IXLA 2WQZA 4ED6A 2ZJFA 2A5YB 1DTEA 3LQYA 3EPKA 5LNK6 2C98A 3FOBA 4X63A 5PGMA 2OA0A 3PYMA 4ND4A 1ZC4A 4RLHA 3UZUA 4X65H 2Q6IA 2DG2A 2B25A 3LA6A 4B82A 4E2FA 2DTEA 3LPCA 5JC8A 3OO1A 4XA8A 4DDUA 4FT4A 4GP7A 4UTNA 4X9XA 3C3WA 4BCCA 5TR9A 5L1LA 2AG5A 3PV0A 4MEBA 1PZNA 3WB9A 4R01A 2P6OA 4P5EA 2DPIA 4QUAA 1YR9A 5KOJA 2A1TR 1BWSA 4Y98A 3QXCA 4LNUA 2B7BA 3RCBA 4O4HA 1QRSA 1II8A 2HA5A 1ZCFA 2QRUA 4X95A 4CDMA 3N76A 2JFOA 4XPZA 1Q1NA 5F76A 4D8YA 1O8CA 4Q7LA 2FSVC 3THYA 3LVFO 1NBMA 3GWGA 3O0TA 3CH5A 5DGIA 5BOSA 4FGJA 3WYNA 1N8TA 4ED0A 4CM9D 4W7SA 2D3WA 5DASA 1SNYA 3L6OO 1GLNA 1YRYE 2XMGA 3WV4A 4Y7DA 5KX5F 3OECA 3WSTA 1VI5A 1MG5A 3JRNA 4ZK2A 1DZIA 3ND6A 2V8BA 4RHCA 3MF4A 1D6NA 3J81A 1NF9A 4Y1FA 2O23A 3L5KA 4R4JA 4ZVNA 2HMVA 1RQGA 1YR8A 5K3FA 4DDHA 4UOEA 1A8QA 1OB2A 4ZEXA 4YQYA 2HK7A 3YASA 1D2AA 1DC7A 4RNNA 4QUGA 1RAFA 3U80A 3W8DA 3S1AB 1NDQA 4HNUA