3R23A

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
304
structure length
304
Chain Sequence
AMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Ligase
total genus 78
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r23A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r23A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r23A01
1EUDB 2HJWA 3MWEA 2WYOA 2HGSA 1AUVA 3AW8A 4FGRA 1VKZA 3TINA 2W70A 2CZGA 2V5AA 4FE2A 1VBGA 4IHJF 4M99A 1CS0A 4TV8F 4O83A 5LOVF 3VPBA 1E4EB 3E5NA 5KKNB 2VR1A 2I80A 2W71A 3KALA 3QFFA 4MV3A 1A48A 1M6VA 3G8DA 3AX6A 4I4TF 3ETHA 4IWXA 4HQ6A 3VPDA 2W6NA 2R86A 3R5HA 4M9UA 4YJ2F 1CE8A 3ETJA 5CA0F 4MV4A 1BXRA 4O7TA 2R7MA 4ZQIA 2P0AA 4HR7A 3WNZA 4EGQA 4IIJF 2I87A 5DMXA 5JVLA 4FFOA 3K5HA 4EA9A 3JRXA 2R7KA 2Z02A 2C00A 1EUCB 5C8YF 1EZ1A 3MJFA 4O2AF 2PVPA 2FB9A 3RUPA 5C1PA 1EHIA 3V4ZA 2DZDA 3G8CA 3JZIA 4NYEA 5FNVF 1KBLA 1PK8A 3LWBA 4O7RA 2GPSA 1KC7A 5CB4F 1W93A 3ORRA 4XYLB 4O7NA 1Z2PX 1KEEA 4FFLA 3TW6A 4EA7A 3VMMA 4YJ3F 4MV6A 5LA6F 5JQWA 4O4HF 4IZOA 5CAEB 2NPOA 3NUAA 4MAMA 1WR2A 3LP8A 2R7NA 1GSHA 2YW2A 3U54A 1KUTA 2CNVA 3TQTA 1Z2NX 2YL2A 4FFPA 1E4EA 2W6PA 3K5IA 4O82A 5EZYF 2NU7B 5J2UF 2J9GA 4IWYA 3Q2OA 4C5BA 2YS6A 1KJIA 4MV1A 2GQRA 3KREA 4O7ZA 1CQJB 1KJJA 1KJ8A 1UC9A 2V59A 4XZ3B 1GSOA 4C5CA 3GLKA 4GGMX 5HV6A 2QF7A 2VQDA 2DLNA 5LYJF 2DIKA 5H80A 5LXTF 4ZI7F 1T36A 2FPGB 3WO1A 4J6EA 3TIGA 2FPIB 2DWCA 2NUAB 2SCUB 2ZDQA 3KAJA 4MA0A 4TUYF 4RZQA 4EAAA 3RV4A 3I12A 5BPHA 4I55F 2V58A 2YWVA 1GSAA 3DF7A 3N6RA 4O84A 4EGJA 2VPQA 3TIIA 4FFMA 4O86A 1GGOA 2R82A 5I47A 3VA7A 1W96A 2ZDGA 1JDEA 3RFCA 2YZNA 2W6ZA 4MV7A 3R9RA 3SE7A 2W6QA 3Q1KA 4O7WA 4XYMB 5JH7F 3BSSA 3JRWA 2PN1A 5GONF 1SCUB 4O4LF 1Z2OX 3VOTA 2YRXA 1OBGA 2I8CA 4EABA 4HNVA 4DLKA 4O7VA 5KX5F 5C1OA 4O2BF 4TV9F 3BG5A 3HO8A 3GIDA 1IOWA 1C3OA 3ORQA 4E4TA 3N8DA 4HNUA 1UC8A 4EG0A 3BSYA 4O4JF 1OBDA 4O81A 4HNTA 5JQGF 3BSWA 2QK4A 1AUXA 5BMVF 1EYZA 3OUZA 2X0SA 4O7LA 4XX0B 2NU8B 2GQSA 4QSHA 4YB8B 3V4SA 2XD4A 1CQIB 1B6SA 1JKJB 3WO0A 4WBNF 1JLLB 1B6RA 2YZLA 2GPWA 2R84A 2IP4A 2FP4B 3BFPA 5D8DA 4O7YA 3HBLA 1DV2A 2Z04A 3U55A 1BNCA 1M0WA 2PBZA 2VHEA 4Y8VB 1ULZA 1VBHA 5K2MA 3JZFA 3R5FA 4ZHQF 2YZMA 4MV8A 4C5AA 1JDBB 1DV1A 5HBRB 3RV3A 4I50F 4O4IF 3K3PA 5IYZF 3U9TA 1C30A 1IOVA 3R23A 3R5XA 2FPPB 1DIKA 4MV9A 2R87A 5J2TF 2CNUA 4M98A 3OUUA 2R85A 2YS7A 2CQYA 2R7LA 4O7SA 3HB9A 4YBZB 1A9XA 5CA1F 3U9SA 1M0TA 2YZGA 3UFXB 1GLVA 4L1KA 2OLSA 4DIMA 1I7NA 4EA8A 4M9CA 4FFNA 5LP6F 5JVDF 2YYAA 4ME6A 2CNQA 3KAKA 2GLTA 4ZOLF 2XCLA 2W6OA 2R6FA 1KJ9A 3MWDA 4FFRA 4YAJB 2YRWA 5BPFA 4YAKB 2W6MA 2NU9B 2NU6B 4WD3A 1I7LA 2ZDHA 4MA5A 1KJQA 4FU0A 1PX2A 3VPCA
chains in the Genus database with same CATH superfamily
4YPOA 2PIDA 1FNMA 3GC6A 1T24A 1RAFA 1AKMA 1Z7GA 2CEKA 3DMRA 4EB8A 2OHJA 3RJ5A 2ILTA 5FH9A 4D82A 3EFEA 4DJJA 4BVLA 3CUYA 1HNNA 2JJ2D 3ELUA 2AJTA 3P0IA 4OA5A 5KFDA 5EIXA 3AX6A 4W5QA 4EHLA 1UWCA 1U4NA 4GF5A 5EJMA 4DV5B 2V9CA 3GLTA 4MV4A 3DZDA 4IIJB 4YP9A 1HE1C 3QIAA 1H6BA 2Z8XA 1RJWA 4XDZA 1P5FA 1RT9A 5KKAA 5IYCG 3PL1A 2FPMA 4PAQA 1N77A 3K0AB 4CDRA 1U04A 2DQKA 4FW8A 5TQ0B 1B43A 2DZDA 1N3LA 1DKOA 2HOQA 4L4XA 3GIIA 5ALOA 4QPDA 2IZ1A 3TDKA 3F8WA 4ND8B 3A6PC 3QU4A 3IUMA 4P82A 4DL5A 4P32A 1AO3A 3DFZA 1S1MA 3DZ8A 5IZ4A 3H87A 2EWMA 5IABA 3NUQA 5FRDA 2V0CA 3Q5EA 4RV4A 3H11A 3BJIC 2YXDA 4QXAA 1XAHA 4G8CA 1XMQH 3EYYA 2JHPA 3QVGB 2QRJA 4V0LA 5BQXA 2Z4SA 3PI6A 2OQIA 4KBYA 4P84A 1GZ6A 1MIHA 3S55A 4PNEA 3FBWA 5BR8H 1UIRA 3MB5A 2GBCA 3N0TA 2REOA 3L6CA 4V0ME 1KFKB 3HOZG 5IMBA 4M0KA 2P9EA 1DKLA 3W5HA 3FF1A 2OBXA 4BO4A 2WVGA 5TQ0A 2YWVA 1DQZA 4G4GA 4C78A 3B6ZA 1KQ3A 3HU5A 1YRBA 3CYFA 2DPIA 3UWMA 4ND8A 1FZQA 4S24A 1MCZA 1BIFA 2GYWA 4YHBA 3AESA 1W5SA 1DIHA 3KZMA 2XQKA 3QE3A 1DJQA 1CJTC 3BIWA 2HTFA 1KYTA 1K97A 4HDOB 4I46A 2Z6QA 4ZVVA 2O07A 3OIFA 1QGED 5JXJA 2NO0A 2VWQA 1UBSB 4X8LA 5A6VA 1E66A 3AILA 4OB6A 1SCDA 1YCDA 3GQBB 2YKGA 3CEPB 2DMRA 3N58A 3G2JA 3L0YA 4DOMA 5AVZA 3R1IA 1SC9A 3DEZA 3MLEA 2ZCVA 5JSKA 4OGLA 3D5TA 4G5RA 3QOXA 4EGSA 3E5MA 1KTIA 4HWSA 4M8SA 3WZLA 3EWNA 2VJMA 5DOVA 3PDIB 4MVCA 3RJMA 1L9XA 1S3FA 2X7JA 4IJVA 3P97A 3UANA 2XITA 4K1XA 1CYEA 3G9UA 1ESDA 1DKUA 2A3NA 3GPBA 5AVVA 5F78A 1JPJA 2EEZA 3THRA 1NJ5A 4LPKA 1NGSA 1UXGA 4QYWA 1H23A 3WB0A 3ZY6A 3JQGB 4JXKA 5TIIA 5FTNA 4DIOA 2VUMA 2H1HA 1GLNA 3VAYA 2C1EA 1XP5A 1LDGA 1UT6A 1BVYF 3PT5A 3LH5A 4E1BA 3FOEC 1XKQA 4JVOA 5TF4A 2J3EA 3KELA 1ZJ6A 4G0NA 2HFJA 3QBEA 1L1EA 1US8A 4AJ4A 3BEDA 3OFKA 1BS1A 2ZATA 2YCLA 4UFPA 1OC4A 1U2RA 3T94A 2F3SA 4MEAA 3V4RA 2OXIA 3OSPA 2VOJA 3QVVA 2VDLB 4XTRA 4C6SA 5JI3E 4BL5A 1WM1A 4N76A 1G20E 2ZWVA 3S2SA 5KWJA 1G4HA 1H5QA 5K3SA 4GNKA 2X9LA 1WTAA 2L18A 2O2JA 4JZKA 1KJQA 4TMVA 1OX4B 4BV3A 4U2EA 2BEVB 1TYEB 4WESB 3AFGA 2ODBA 3TEKA 5K45A 2AHOA 4L5CA 2VP3A 2ZUDA 1M8FA 3OE1A 1EVYA 4L78A 5B58T 1XZPA 1J8DA 4TKUA 3H2YA 1U3WA 2W00A 2Q4TA 3JQAB 1L7EA 5DTJA 1KO7A 4ARAA 1WCMG 5HDQA 4HFMA 4IW3B 3N59A 3FNFA 1W88B 4DF3A 5JNWA 3G2LA 3QENA 1Q1NA 3IPLA 3GRKA 4HG2A 2XTNA 4KYIB 4MWGA 3RF6A 1UXIA 1UXOA 4F0JA 2EKDA 1NMSA 1M8JA 4DR4H 1C14A 1LJLA 4AN0A 2FRVA 2FR8C 4LJSA 4RPGA 4LRQA 3V9PA 2NQTA 1OX4A 4MAMA 2P9ZA 2BEVA 3HKEA 1MOPA 3UHFA 2G40A 5CYPA 5FR2A 4D80A 3RUFA 3GZNB 2X0JA 5DGTA 3RBDA 3W7BA 3AFIA 4A15A 2JIZD 2L2QA 4C5BA 5BSRA 2GLUA 1FP6A 1UC9A 4YMWA 1QZXA 3MHTA 421PA 3S81A 1LSJA 4G5SA 4G23A 3E81A 3NHLA 1ZN2A 2FJZA 5I6DA 1TADA 3T3MB 4TMFA 1IC6A 4DLSA 3UMFA 2PLNA 4PR3A 3E9RA 3L01A 1B04A 3DDNA 2PZ8A 4CLXA 3S68A 3U80A 4RJ2A 1S7GA 3LQ4A 4RB0A 3WGYA 1QV9A 3ZIAD 4YECA 1KK1A 4CRWB 2OYCA 1X9IA 5D5PA 4G0OA 3BAAA 3BFKA 3AJ8A 4NE7A 3W5JA 1S2OA 1GFWA 3NJ8A 1ZXLA 5AOVA 2L69A 3LPMA 2NW6A 3RG8A 3C43A 5EG5A 3CZRA 3NHUA 4GPIB 1HXHA 4GLLA 2FPRA 5GAJA 1R4MA 1PNVA 3UV3A 3WK4A 2RDIA 2OSVA 2VDQB 1L7NA 1ENOA 4NATA 3AYHB 3NHKA 3RVLA 1YDFA 2PGDA 3FLMA 2NGRA 3P5BA 3CKMA 4NJMA 4G2NA 1NXQA 3OQPA 4KVFA 3G5MA 1CQIA 1TWGA 3WNVA 4I0WB 5F64A 3FNGA 4K9QA 4F46A 2BGKA 2FWMX 5K8TA 2CKDA 1TKAA 3RB3A 3C39A 5KOHB 3DC2A 3QG1A 1KWGA 5A4KA 3RC9A 1T4CA 1D4ZA 1PL7A 5IW8A 4FT2A 5K7SA 2OCXA 2HREA 3EWAA 4S1PA 1JJIA 1SEIA 3C3AA 1NQUA 3WFJA 2BFCA 2Q3DA 2DC1A 1JNXX 4XQCA 3ZE6A 1KJWA 2WAYA 4FJ2A 1T9KA 2H17A 1TK3A 1XXHA 2RGVA 4XLTA 3UYLA 3ZGXA 4EY8A 3I5MA 3OY2A 1RP1A 3T9FA 1N5LA 1XWWA 2QVYX 2YBDA 3TI7A 3UHJA 4C1NA 4NQZA 3VTKA 3GGOA 4BYMA 4MYHA 2OP0A 5BWOA 2XE4A 3O74A 2EF0A 2OILA 1C2YA 3U4MA 4ZZIA 3AYZB 2F3UA 4BO2A 3QZ8A 4RJKA 5C4GB 1CULC 1AKVA 1AK2A 1L4KA 2ADOA 4PG7A 2RC6A 1KWKA 3EEYA 2IYVA 1SIUA 5H70A 1FSFA 4A8PA 1GPMA 1V5GA 3AXTA 1V37A 5EE9A 4LGVA 4PZUA 4ZQHA 3UB3A 4FWIB 3AY0A 4YMVA 1A8SA 3Q3IA 3QNUA 2O2HA 4DY4A 1X8KA 2B4KA 2YHIA 3SYNA 1RABA 1HEUA 2QVGA 4TV8B 3TINA 4YUYA 2J0VA 1NF2A 3EBOA 3TOSA 1E6KA 3PVXA 1OQAA 3P9ZA 4A10A 2O8CA 1R0SA 2UYCA 3Q7IA 2ZBDA 1OB2A 5DX0A 3ZXYA 1VSVA 4I4TF 3CINA 5KOIA 2FR0A 2BQUA 1ZQ7A 2F64A 4RMNA 2PJUA 4JYBA 1EB9A 3DE6X 2HO4A 3OJLA 4UAVA 1U5CA 1YIDA 2FZCA 1PGOA 2ZUEA 2A94A 2ZBVA 3FOBA 3RR2A 5KFJA 2ECQA 1ZUNA 2PNJA 3PZRA 4C4AA 3DR5A 4JVLA 3UIEA 3VSBA 3OMXA 3D8SA 4C88A 1G8YA 5KFUA 4I2VA 3QTLA 4KACA 5K6TA 1RAHA 1WMFA 5JSUA 1QOPB 4XVUA 1FYDA 1FU8A 2AR7A 2MR5A 3L6DA 5FWXB 3OZ7A 3CSWA 1KEEB 5LXTA 4J16A 1ZHOA 1E60A 3E84A 2AOUA 2H7CA 3ZG6A 1IEVA 1YB1A 1TD9A 5BRNA 1ZSVA 2W22A 3SF0A 2JLBA 1FDSA 1NA5A 4UBKA 2D62A 1YR2A 3ZHQA 3J7TA 2Q0HA 1EP9A 4Q3EA 1PEYA 4R40A 1XELA 4AO6A 4OHXA 2RHGB 2B92A 3DEIA 2Y93A 1II8B 5AM4A 3A27A 5KTSA 2FRDA 1G21B 1AURA 4JU8A 2BOVA 4FGSA 3A4YA 2IHZA 4MGHA 1XYYA 5E4FA 3RI3A 2FW8A 3GFGA 3UCEA 1XCLA 3DLCA 1FEZA 4FS2A 2QYHA 3V1KA 4K6CA 5F1YA 1XZJA 1E3WA 1KQPA 2YHAA 5ECDA 4OL0A 4Q4JB 1NHGA 3QUBA 5BN3A 3BSSA 3C4VA 2JGKA 2PN1A 5ICEA 3ENZA 1Z0SA 1GG8A 4UVEA 4QOJA 2AD5A 2Z57A 1UQTA 2Z43A 4Z8YA 1I5EA 4ZOAA 3LPAA 4YLYA 4EI8A 1YRWA 1UAAA 2M1ZA 1U2TA 1X8LA 3L4BA 5AVTA 2FW6A 5E25A 1G0NA 3NBMA 3CM0A 5IT9W 2CGEA 4BLWA 3S2GA 3JWIA 3JASA 3NBZB 2DTXA 3LPCA 5T4FA 1SHKA 3IFSA 4HNTA 2R6GA 5EQDA 3MWMA 1TC1A 1OLXB 4BYGA 3AKDA 5ALLA 2RAUA 4QU9A 1I2BA 4CF6A 1HNXH 3O2SB 3WMFA 1BHO1 2FQWA 4JLPA 5H9VA 1RI2A 4XVCA 4EYHB 1I30A 4MIKA 3R4VA 3CUTA 1K6XA 4CR6A 2IP4A 1N2GA 2WIBA 4HMQA 4X20A 1JG2A 4ENRA 2R4TA 4AUMA 4OQNA 2Z0MA 3AOGA 4V0MA 3GDGA 4MJ7A 4A03A 1OXMA 4ENVA 3LZDA 2RHBA 2JD1A 3DHVA 1B23P 1F6WA 2FDRA 1H2HA 2X0KA 4NVRA 4DR5B 4ND4A 3QKUA 2UYGA 3HVRA 4B76A 2Z2YA 2YS7A 1U0SY 2ALJA 3P2YA 4D44A 3VKUA 3NVMB 4NH0A 1O87A 5CX1A 3G6KA 3HKZA 1HLPA 4URWR 5AI8A 2RIRA 4DUGA 1ADYA 4F60A 3RYCB 2Q28A 1VLLA 2DKFA 3CIFA 5LSAA 2NU9A 4TSFD 4TS3A 3FG9A 4FGJA 2JS7A 4JIGA 4LBYA 2RAVA 1KTAA 1EK5A 2ZRCA 4WERA 2XCTB 1I1QB 4YP6A 5LQJA 2QMZA 5CG2A 2O8FB 2OXCA 1N92A 5I8WA 1P80A 3AY3A 1UOEA 3RVSA 3MWEA 1YQTA 3JD3A 1J2RA 1WCXA 3HACA 4E46A 2VJCA 3ZPXA 3NNNA 4RF3A 1L7QA 4IDDA 5HKOA 3TFWA 4BMCA 2BGMA 3LAWA 4ZV4A 3H1FA 3UC5A 1HDIA 1HFEL 4XW2A 3PNOA 4UARA 4OHFA 1GPLA 4GPBA 1GPNA 2EQBA 2DUWA 3FYUB 3A4LA 4JD5A 3TNYA 2E2IA 3E7DA 5BWRA 4A92A 2CWDA 3ET4A 3WRXC 3K96A 3H8JA 3KQPA 3VNUA 3RYIB 1SU6A 13PKA 4LISA 4NXMH 4AS3A 4XARA 2O8FA 4MWDA 2Q46A 1Q7BA 1PG0A 3ID6C 2XRZA 1WULS 4WNIA 4K9SA 4CDNA 3K9HA 5KNCA 3C3PA 3C7DB 4K3UA 1XXLA 4ETWA 1QU2A 4Q05A 4CM9D 1G3QA 5FUXA 3ASVA 4Y7CA 4QBFA 3OIDA 1E32A 4WLNA 3ZHTA 3AZQA 3MSCA 3PK0A 5KTTA 2NSLA 2HU2A 4EL0A 1SQGA 2QHXA 3QYAA 3IURA 2PS9A 4CKWB 4G0WA 4M89A 2FXIA 4W1PA 3WLIA 3DDUA 2WMNB 3MXOA 1MHPA 4IZHA 4TM7A 3OM8A 2FXVA 3TQIA 3KJZA 2X9NA 1NVGA 4GG1A 3F9IA 4NG4A 4EGFA 2V59A 3ZTYA 3I0ZA 1B0AA 3DTGA 3TB6A 4X62H 2D1FA 4ZGBA 4ETNA 4CDMA 4RCVA 3AZOA 1MC8A 1O94D 1C1YA 3K4QA 3AVWA 1XD2B 3UJ7A 4M49A 4B0OA 2HEIA 1P1HA 3RSQA 1OLSB 1ML4A 2C2MA 2BRUC 5DW0A 4WN9B 3HFRA 2IPMA 4HK4A 5EHQA 1MAAA 4I55F 4BAUA 1RWQA 2Q0QA 1DC8A 1HT3A 1Y4UA 1T3LA 5DG7A 4RDIA 5TMPA 1OLUA 1EI9A 2QZSA 5DM70 4M1MA 1LTHR 2VBCA 3G0DA 1ZA2A 3JALB 2VDKB 4UCSA 4LC9A 3T9AA 2NTJA 1BMQA 2BIFA 2MYNA 2WHEA 4IWNA 1JWBB 4PO9A 4NZ9A 2YRXA 2IPXA 3C7KA 5KX5B 3ICOA 3WSVA 5IT0A 4RQBA 3HCDA 3I92A 4PQRA 3RIGA 2FNAA 1QX3A 1DSSG 2O8EA 1MPTA 1YZNA 1TVKA 4R8UB 1XTSA 2B94A 4FEAA 3EVGA 4JA0A 4M7PA 2A5DA 2C3UA 4FE7A 4WBNA 4G81A 2CFMA 9ATCA 2OENG 4O3PA 2P7HA 1Z15A 3O03A 4Q44A 3VNVA 1G9SA 5MN6A 1L7PA 4N5MA 4YK7A 4HX2A 4QDKA 5JNRA 4F5DA 1XPRA 1XB2A 1J0XO 1P3DA 4O7LA 1VJTA 3W6ZA 4OK6A 1NYRA 1LZKA 1HUQA 2ZJOA 1D4OA 3GFVA 4XDHA 1F1BA 3N2IA 1EVZA 1SWWA 3SJCA 4JQSA 1E1RD 4R6XA 4AKGA 2EGUA 3KKLA 1JFTA 1IBKH 4HQFA 3F3KA 4FGZA 5K8UA 1X7GA 5DDIP 2JEFA 1RKUA 2Z5GA 4CG3A 4IV0A 1IXKA 2UXCB 2XGPA 2IXDA 2BSQA 2Y9PB 1M1XB 2IYRA 3Q2KA 5CA1F 1ECJA 3DV0B 1EK6A 2XCUA 4YAJA 5KFSA 4OMDA 3NASA 1VHDA 4WUVA 4L1KA 1P1IA 1TZKA 4PONA 3K73O 3UTCA 1F8FA 4HEA6 4KMRA 4ZP1A 1JIQA 3KC2A 1PNRA 3ROXA 5E2AA 1R2QA 1JYSA 4D0LB 1Z68A 4CLHA 3HCAA 3L7NA 1A4UA 2WOOA 4B7CA 3W78A 1AS2A 5F1KA 3P2JA 2GF2A 1NR7A 1ODTC 3PNMA 6ADHA 2ZSJA 5I5GA 4E5KA 4HNGA 5HE9A 4C2BA 5AICA 3N2NA 2LV8A 1CY7A 3HM2A 2C2ZA 2HJVA 2DSNA 2YJ5A 2Q45A 1H4VB 1YOVA 1DP4A 3IN5A 3A9VA 3E61A 4DT1A 1JQEA 4XFDA 1ZU4A 2WQ6A 1KP9A 4TRRA 3I1IA 4TTQA 3FW1A 1A8HA 3VU8A 5DMXA 4AYXA 2AOVA 3PNBA 5BSKA 2ZOSA 3E7PA 1RNLA 5INTA 5IWCA 1A9SA 2N46A 4G1EB 1Q77A 1MAHA 1BRMA 1IN6A 3JX9A 1M67A 2Z30A 4KMSA 1RM4A 2YVUA 3RREA 5GOZA 1KRHA 4RE6A 1FF9A 3OFVA 4X3OA 2JAOA 2ATEA 4HPWA 1J2JA 1AUQA 1Y3HA 2NUPB 5FT9A 1BAPA 1U2PA 3TTXA 2RE8A 5JD4A 1BDIA 3NANA 2N42A 1YQWA 3VZPA 4RZHA 1P2GA 4GR9A 2O50A 1PT7A 5U1PA 5CXSA 2K87A 1ZD9A 4DR7B 1JSRA 2ZCJA 3F49S 2RHDA 2OCIA 4C3UA 2HD4A 1S4QA 2FSGA 3GFBA 1IG0A 3WNCA 2HRRA 2CLMB 2Z95A 4JP5A 1S8AA 5BORA 1C41A 4XX1A 1ZNYA 5AM5A 1FTGA 2GBLC 3EOBI 4AZ3B 2E5WA 3DEJA 4HDNB 5EJAA 1H93A 4RD0A 4TYMA 1I6KA 1AS0A 5B6PA 5JH7F 1GQQA 1W29A 2UU9H 2CFIA 3RT9A 3WYAA 1SXIA 5J5AA 4HYYA 5B7QA 1JQBA 2DY1A 3D6HA 5DKFA 4BXOB 2NUPA 1U7DA 4CE6A 1M1NA 3HV0A 1XHFA 3P2IA 3R3HA 4QDXA 1YR8A 2GHTA 2FGKA 2XMCA 4KMMA 3IEUA 2ZTUA 2GPNA 1RYEA 4JUIA 1BG6A 3L8FA 5J5VA 3PFGA 2C42A 4RIFA 5BT8A 1YVUA 1SXJB 4ASUD 3FFBA 1VCIA 2ZI9A 2ZI3A 4IVRA 5DBHX 2FP4A 2FWNA 1RAAA 3GNSA 3M4JA 2IUTA 3EVNA 1DBIA 3UW3A 4YB8B 1RJRA 2H4ZA 3P9RA 4CU2A 4M1YA 5KYGA 3PD0A 5CUQA 1KO8A 1WWKA 4J3NA 3RRZA 3Q88A 4PZ8A 4AI6A 1GZ5A 5FPQA 2IYWA 3QY9A 2V45A 2VSQA 3W6NA 4BWFB 3U55A 4CMFA 4BNDB 4FVTA 1L1FA 4XUCA 5KT6A 2BTQB 1X1TA 3M4YA 1K89A 3IV9A 2ZRDA 4F6LA 4RMGA 1Y7PA 4LSZA 3AEYA 4XKJA 5ICCA 1LK7A 5KSZA 3K6RA 1RIFA 2ASJA 1SKQA 1PQWA 1VHJA 3NWOA 3HXLA 4KPFC 2BV3A 4N5NA 4CG0A 3AUSA 3OCVA 2WHPB 5CT8A 4YDSA 4IICA 2PWYA 1KK0A 1W52X 4MYRA 5HWSA 4LI0A 2Q5EA 4MI1A 1F9AA 3EARA 4EPTA 3RRXA 3WK7A 8MHTA 2VYND 2R7AA 3H9JA 2M98A 1H6DA 1PZMA 4IHJB 1W94A 1M2GA 1OVMA 4BNDA 4Z1MA 1HR0B 1FFXB 3UJAA 1ZZGA 2XXBA 5IULC 4JI7B 3AF4A 3ASZA 4DIUA 1J8VA 3U1TA 3LXRA 3I2IA 3ZYCA 2BTQA 3V1TC 4JI3H 5GIPE 2A84A 2H07A 2XMBA 3UVEA 4DE5A 3CEJA 3OPVA 3GJRA 4YAEA 3AEUA 1EDBA 4HI0E 3Q12A 2XB4A 4DA0A 4R1QA 2CXUA 3RASA 1LDEA 3GGJA 1XJQA 3E9EA 3WE7A 3II6X 2I2BA 2FTKE 1M8GA 3A6JA 3ROPA 4M9XA 2IA6A 1BZYA 2WHPA 4OH7A 3BZUA 1LSOA 2PE5A 2RMKA 4PZ9A 2MIIA 5EVJA 5E6RB 1OH8A 1XMPA 1SD5A 2C9ZA 3SCZA 2SHKA 4DWOA 2NIPA 4C4RA 4QELA 4ZREA 1XTUA 4C7OB 1DBRA 2QN8A 3SN6A 1WMSA 4DBVO 1TJYA 3TZHA 3VH3A 2CZCA 2YIJA 4QPJC 2GPJA 1VI2A 4M0DA 3PXCX 4A3GG 1F5NA 3USES 4RK4A 1TPYA 2PUEA 4LG1A 5TMDA 2CXSA 5BRAA 1Z08A 2ZUFA 1YE8A 4ERNA 2VJQA 2R7ZA 1D2EA 3N5CA 3IQDB 4Z4GA 3W3ZB 1OGYA 4EPRA 1MQ9A 4W7SA 2BH9A 3WNBA 4J0CA 4Q15A 4D8UA 2EJBA 3PCXA 3N6RA 1Z0IA 2B4AA 3HADA 2POCA 4DR2H 2IOQA 3OU6A 2EW2A 4L3OA 4MVJH 1Y6RA 3CF0A 1T1JA 4ED8A 4CI0B 1I24A 4CQMB 2W6ZA 4GWLA 1PZXA 1KZGB 4U2FA 1BQ4A 4RESA 3UCXA 4Y2TA 1ZOOA 1U80A 3FHOA 3MJSA 3JPYA 7REQB 5MHTA 4EO7A 4XDYA 1DG1G 5GP1A 4BNMA 3A6GA 5CLQA 4MPTA 5BN5A 2QQ0A 3HB7A 1M5RA 1ACJA 2R1TB 3EXG1 4MVXA 3NO4A 4N5IX 1DLJA 5CLGA 4C7KA 1NAIA 5JQGF 3JAMW 3I4LA 1W46A 1I01A 4QWBA 4MUKA 4AK9A 3CUVA 3ROTA 1KEKA 2J7PA 2HSWA 4HDKB 4Q1BA 2P79A 1NZFA 1P1RA 4HBZA 4TLCA 1M7BA 4CQMA 1MC5A 5FTMA 1NVBA 5DNAA 2PY6A 1YZHA 4BO5A 5AJHA 3E8MA 1L5HB 1WHSA 2R25B 3R6LA 4MA4A 5I9IA 5CDGA 4L8GA 5IH3A 1UC5B 4W7IA 3ESQA 2R1TA 4UAGA 4Q9JA 1QHEA 2IYXA 2HSZA 1NTRA 1QZUA 2VLIA 2P62A 1VE5A 1D4AA 4QLBA 3ZU2A 1IUKA 3AINA 4F4UA 3CLTD 2PL5A 1L7OA 5DT2A 1KXZA 4JV5B 2IBKA 3DXXA 3MOIA 3NCTA 5FTKA 2YOFA 4AJ9A 3ITEA 3F6RA 3GLIA 4MAAA 2PCLA 2AC2A 3GA0A 2JAHA 4L2IB 3HJGA 1TCVA 3HWRA 3SC2A 3VR5D 3KVRA 4PTZA 4TT3A 3KWJA 1NJSA 3CWQA 2Y66A 4LMBA 3ADPA 3LKBA 4OJMX 4NJOA 4H2DA 4DPKA 5SV2A 2O7NA 2R00C 1H9CA 4B4KA 4N5HX 5CFLA 1K6EA 3ORSA 3EUAA 1XXHE 1R5NA 4H1VA 3JQBA 5A4IS 1AMNA 2AZXA 5BOSB 4OLFA 1V7CA 1PKXA 5AWFC 1VBMA 4ZQIA 3VYSB 2FSFA 1D4FA 1HDCA 1KMHB 1A5SB 3MMSA 4WPGA 4P2GA 1EU1A 4PLYA 3SZUA 2AYYA 3L7DA 5C5IA 2XQJA 4EPVA 2BGRA 4O0LA 2SKDA 2Q9BA 5A7GA 1VMAA 4UAJA 2AQ4A 4GOXA 2Q5FA 4Z0TA 4C14A 2AFHB 1USVA 3QXGA 2WB1A 1CRZA 1C0EA 3CU5A 1IBCA 3BJZA 2J0EA 5FFMA 2I3GA 3RR5A 3RAJA 5CPBA 1E4YA 2PUAA 5DI3A 3IUEA 3D7RA 1Y4SA 4MUNA 2JG3A 3OKAA 1GKIA 2P75A 4CWAA 2IS2A 1WVIA 1ZXXA 1R37A 2IDMA 1NW3A 3G0BA 4E2XA 2YICA 3KE8A 3B9PA 3QI2A 3U0GA 3W9YA 1CUDA 4JEMA 4DR3B 3K30A 1VL8A 2Y05A 2XVMA 3RAGA 2Q2VA 5T5QA 1Z22A 1U0GA 3ZWWA 3ZBTA 3N2KB 1GRRA 1Q2XA 4ZO8A 3IP1A 3N0XA 1MX5A 2BYTA 2BTOA 3SDBA 7MHTA 4EMTA 2FUEA 2CCJA 4QULA 2C9MA 2HW8A 1K3UB 3FCUB 3ME5A 1QPZA 2DBQA 5ISMA 2DKNA 4M1EA 3AIKA 4BNVA 5ER9A 3V48A 3RFCA 4PC3A 2VH2A 5CDSA 4PFJA 5CPFA 5EJ9A 3DUFA 3FIUA 4IIDA 4ZMSA 1JB9A 1JJ7A 4MMXB 2YNMC 5D84A 4J4BA 1NRJB 1LJUA 1SPBS 1PGNA 2Y2UA 3ANYB 3PTZA 1SOMA 2C97A 2D8AA 1GGEA 4IZ6A 3DC7A 4ECQA 4FMPA 1SB8A 5JR3A 3ABSB 1I3MA 2BMJA 2QRKA 1M1UA 3THSA 3K4PA 2I7VA 3M5WA 4Y2HA 4CC6A 3L0IB 3OIVA 2J3QA 4MH0R 2HQ1A 1H2XA 1JIHA 3Q87B 2C20A 3L79A 4OA8A 2W9AA 4K6GA 1CY2A 3GNLA 3N2LA 2NO1A 3BULA 4EY4A 1NI4B 1BE6A 3OWXA 1QDEA 2QX8A 3GFRA 2RJNA 4K2HA 1NXSA 4U63A 4EI7A 2WWXA 1QFZA 1D2NA 3OFSA 5D8DA 4ECSA 1WUYA 3MT7A 3UOWA 1T9GS 1IHPA 1LPPA 2F1HA 4G01B 4C6HA 3RUDA 1L7XA 3WYCA 5DPMA 1YR3A 2JA1A 1XOIA 3QZ7A 3C85A 2QJRA 3WRVA 2PYZA 4WFQA 3ZWQA 3FWPA 2JAUA 1KS9A 4QNNA 5JVDA 1V8FA 3CY6A 3MBIA 4E14A 3TN7A 2H1SA 4UHBA 4IXDA 3M5DA 3TD2A 4O0MA 2B1QA 4QLOA 4OCZA 3ANTA 4BDSA 3GJ0A 1OZGA 3GILA 2HLNA 1KBOA 5JCPA 1N33H 5DWVA 1ZJ4A 2V5UA 3BX1A 1GG5A 1Q17A 4LRUA 1SBNE 3K8QA 3IIIA 3SZOA 1VCMA 2ZJBA 1R00A 4DQ0A 1O95A 4EAQA 1ZJJA 4JEIA 3T9DA 3TSOA 1Z83A 1JT2A 3UUEA 1HLDA 4RIIA 4FXPA 3FLBA 3AR7A 2WWWA 1TQDA 5I7UA 4LZJA 3KS9A 3PR2B 4ER0A 3HXMA 1TMKA 3OPNA 2JHCA 1ST3A 1FFCA 4WXYB 2GK6A 5EWEA 5TGDA 2JIQA 4DV3H 2V5AA 3B3FA 5I7SA 2WMOB 2KJQA 4C4OA 4IIJA 4UM9D 1MHTA 2PGXA 3OI7A 1K4YA 2PKQO 9LDBA 1DVRA 4MV3A 5ALHA 2ET6A 2NX2A 1K92A 1RBQA 3HMQA 3K0AA 2BFPA 1PJLA 3UZUA 4FLMA 2G71A 4L50A 4RAYA 4D1YA 2D7JA 3TWOA 3I30X 3RODA 1QG2A 3WP0A 1EUCB 3NG1A 1EKVA 3PUYA 3KLMX 1KZ6A 3BWVA 1IZZA 4Q1VA 3HKZE 1FSPA 3RRMA 2ZYSA 4QHSA 1ZU5A 4KO3S 1WRBA 1RJ9B 4L5BA 1N56A 1KORA 2RHJA 4TKZA 2JFYA 1BKDR 1W9MA 2HBQA 1R0BA 1OPRA 2QJOA 4J1TC 2BKAA 3QVGA 2PX2A 4ENSA 3L8EA 4GP9A 1NDQA 3BCUA 5G1OA 1NNLA 4GKKH 5E0KB 3X2FA 1L3CA 5E7QA 3EXHB 3L43A 4NKRA 2NADA 3FZGA 1SU4A 3WLAA 2H48A 4CIDA 3JWEA 3RFUA 3CZ4A 1Z34A 2VUGA 4QGHA 2ZW9A 3OSNA 1EX7A 2WA2A 5CB6A 2HCJB 3NKVA 1QGOA 2YV2A 5HXAA 1NXVA 1OAOA 2VRWA 4QICA 3S6JA 5JNTA 3SBOA 3HN6A 2CLKB 4HDMB 1AOXA 5ICGA 2ZT6A 1RCUA 1TAUA 3QX3A 3CUSA 1X9HA 1RK5A 3RV4A 1ZC4A 4PC2A 4ZVTA 3BFXA 4NC9A 2V4RA 5DLYA 4YQZA 1ZLXA 3WYGA 5DGCA 1A69A 3VSDA 4CMEA 5GGYA 2JGNA 1UPFA 3DO5A 4BRSA 4XWKA 4WLEA 4WIAA 4BJ6A 1JFFB 5SZIA 5PGMA 2XDAA 3L49A 1G8KA 3MAJA 5IK2A 1TJ3A 2PX0A 4WEOA 3KTAB 1MV5A 3GQVA 1BCRB 3GQBA 4BJ1A 1YO6A 2FMXA 4FOTA 1UDXA 3RVPA 1RPAA 4D8TA 5ED0A 3M8KA 3NMUF 3JSNA 3FJOA 1XL1A 2B5WA 3GJXB 3G2KA 4J2TA 2OZVA 1W36D 3PDIA 1E20A 5AKHA 4P7FA 4IF6A 2COUA 4R1NA 3D0OA 4BNGA 4BO9A 2E4ZA 3IESA 1EVIA 4Q1AA 3JQGA 5MFPA 1QK4A 1DAGA 2X3YA 5B1EA 1N0VC 5KQLA 2CUZA 3L02A 5BR4A 2O3RA 1XX6A 3P5SA 2VO1A 3PFIA 1VGVA 2QY9A 2GZ2A 2RBGA 4IR7A 4ZZ0A 3KTAA 5ARCA 1HFKA 1Y63A 4LDPA 4O4IF 1C8KA 4DC1A 4ACAA 3MBKA 3ZI0A 4JOBA 2PPLA 3KIPA 2R87A 3IXMA 2ZM5A 2OXRA 3ND5A 2Z98A 1D5CA 1NLUA 1LUAA 1W34A 1WCIB 3A25A 3RF7A 4ZQBA 3JTMA 4WW0A 2F4VB 3JQ9C 5FNVB 2ZU0C 4HQ0A 5IZCA 3DKRA 2H8KA 1QFXA 4XIFA 3VYVA 3X3HA 1NJGA 1K5GA 2QTTA 4XB6B 1J8MF 1H2FA 1IQ0A 3JRNA 1N1DA 2AVNA 3GWGA 4E1VA 1F48A 1WV1A 3FXAA 4M0PA 3HGTA 4WESA 2BP7B 3EG9B 2L17A 3FAKA 4GSKA 2ZIVB 1KSJA 3TPCA 4UU8A 1NVVQ 4B3FX 1IYDA 1GAWA 5LOVB 3JQAA 3N6VA 1I3KA 2H11A 3V8NA 4O8ZA 5F1PA 3U39A 4D0RA 2JK1A 4X7PA 2NYUA 1W88A 4J9LA 4KPGA 3DO6A 8ATCA 4KGDA 3T7DA 1SQ5A 3HDQA 4OXRA 1XSEA 2DJIA 1YHYA 1IIBA 3I9JA 3OZRA 4XYBA 2NTVA 4PVDA 3T95A 4KN8A 5LNK6 1U02A 5JFTA 2E3JA 5AW6A 5CTAA 2YR0A 5EJ8A 1U28C 2DEUA 5FOWA 3GZNA 4Q0MA 3ENVA 2DBVO 1K0FA 1ELOA 5I3ZA 1AQYA 1TE2A 2GAAA 1PUIA 3UZBA 4EHAA 5TQVA 1GNLA 1GJRA 3ZWPA 2CZQA 1MVLA 2B5OA 1IK4A 1T26A 2IU3A 2W8BB 2J08A 5FP0A 3NS7A 4DJEC 1J90A 3H84A 1Y5NA 3D4NA 2W6PA 1JX4A 3NGXA 2O8BB 3HSSA 5JAQA 1NJ6A 3GNTA 2MSKA 1HG0A 4ALJA 1GM5A 4LFCH 2Q2QA 4NNOA 1W48A 1S02A 1U0EA 3MWJA 4E0BA 3DZGA 3SC6A 4BUZA 1GD1O 5H80A 3TCKA 4YRRA 1QAMA 4RLQA 3BRSA 3F71A 1NUTA 1HL7A 1YAHA 4OHRA 4EQZA 2GFHA 1R66A 3BWMA 4P80A 3RUCA 2QUIA 1N0IA 2GJ9A 3FPJA 3KLOA 3ZE0B 2BBTA 1FW6A 2Q0SA 3VZBA 1P5HA 2X0RA 3FTEA 3FI0A 4ZVLA 3CLSD 3FUUA 3JAKB 3KM0A 4IAJA 4K03A 2YXLA 4BBJA 2OE2A 1OIXA 1JG3A 3GPIA 4EJMA 4TV9B 3WGVA 1GN9A 4B3XA 1EH5A 4UD6A 1DTWB 1ZCZA 3VV2A 3L82B 2WMDA 4WTOA 3R2JA 2P90A 3PXDA 3GRRA 3LM8A 4E4TA 5KOHA 2K2WA 3B1KA 3BJEA 3HOYG 1RCTE 4QHYA 2YY7A 3K70B 4L73A 3N0WA 1KGSA 3FNHA 3I1JA 3O8LA 4X64B 3K9GA 1SMKA 4ZYWA 1ADBA 5BMVF 1WCMA 3U40A 5IDWA 4NBTA 3GV7B 2GN2A 2GD2A 1IVSA 2NPFA 3DCJA 4RF2A 3VYRB 2JZNA 1LJ8A 1CUFA 3QA9A 2QN1A 2R1UA 2JA2A 1USWA 2AR0A 5HZKA 2Y1GA 4RFSB 4WA7A 1WSDA 4FUQA 4HXEB 5E3HA 5TXGA 2VQEB 3ICQB 3VI4B 1D1QA 4JT4A 2GNOA 1FYVA 2W6ID 1SC3A 2CJFA 1Z07A 5BUZA 1M8PA 5DIZA 3M6WA 2LWIA 2OBYA 1OILA 4EA6A 1R4NB 2XLCA 3V42A 3QXXA 3L8DA 4NE9A 2YZ2A 3LX4A 4KVAA 4DCGA 3F8TA 4J0IA 3NP7A 3CFYA 2LIPA 1NUAA 4AT1A 2XUPA 3OG9A 3HRHA 3A6EA 1O8BA 2ZG6A 3UFXB 1QRDA 4DNOA 3P27A 2J5QA 1L5YA 4UM5A 3QV2A 4BX9A 1XLUA 4BQSA 1XZNA 1EK0A 4FIDA 3NZEA 5ALJA 1GYQA 2FVXA 2O8DB 3SQWA 3KQVA 3IERA 2YWEA 4U9IS 4TV8A 4YAKB 5I4BA 5EHXA 1IY0A 3TK1A 1UKVY 3FWNA 1I7LA 4YASA 3DCIA 3IV7A 1ZL2A 1A04A 2J6CA 2WIKA 1UZUA 5ALIA 4FNMA 2BR5A 3RS9A 4BLRA 1SHLA 1UJ4A 1OBOA 1G16A 3SEAA 4R0NA 3EMBA 4QUDA 1KGDA 2Y2VA 4M99A 3AUJB 2H1OA 2RGBA 2C03A 3JV7A 1ODFA 2W9XA 2O5EA 2HHCA 2I78A 1YZTA 4KV7A 4LJ5A 4OYRA 4RU9A 3EUWA 4Z7OB 4WECA 3REQB 1XZGA 1ZRHA 4DJTA 5LMUB 2C61A 1NLFA 1NW5A 1AN0A 4ZVRA 3LBAA 1FOEB 5J9FA 1M6HA 5FA8A 3AB7A 4K5QA 2B4RO 4JL8A 3DDWA 2RCYA 2E0IA 1CE8B 1LNQA 1XFDA 2OV1A 3SE0A 2A5YB 1E2NA 5FWXA 3FFAA 3R7SA 4Z53A 1KEEA 2ANCA 2C8LA 4GX0A 2J5KA 3OQNA 4LE1A 1ZK1A 5K4GA 4TXJA 3ENQA 4LZAA 1FDVA 1YU6A 2O57A 1A4RA 1XQXA 1UZMA 2XB6A 2C2WA 2VZ9A 4IYRA 4M36A 3O8OB 1AKYA 3NWEA 3R3VA 3OCYA 3UXYA 2Q1YA 1NSFA 5K6RA 1II8A 3RVBA 2FX2A 1G21A 2ZQYA 1XCMA 2W2KB 3TVDA 3WHPA 1KNQA 1DC6A 2H9YA 1OFTA 3TLMA 3WMWA 3CLKA 2V6JA 4J7CA 1WG8A 3O3MB 3QYFA 2CY0A 3L1HA 3ACDA 4Q4JA 3A1WA 3D6NB 3X2EA 2R8ZA 3KZCA 2H9AA 4Z4QA 3IJEB 4XGNA 2HA5A 2YYZA 2Q4EA 1E0JA 2ZJ1A 3IIMA 4J2HA 1R8SA 3DMPA 1O75A 5I9NA 2RHCA 1AZSC 1R3UA 1T0PA 3QEJA 1NXOA 5A0TA 2IOYA 3AVUA 1Z0AA 4L85A 3BG5A 1OAKA 1XJCA 1CJBA 1OLXA 2ORYA 3LQKA 2CXOA 4N40A 4MIEA 4KX5A 3L6RA 3EZGA 1NL3A 4IEFB 1J5XA 4X63A 1LX6A 5KT3A 4S12A 5JSHA 1DKRA 4B71A 3QLEA 2OB2A 1RBZA 4BNTA 4IY1A 1ISMA 4P3OA 4INPA 2F1OA 3C6XA 3V4SA 4UJ5A 2OKGA 4OX9Y 3S5UA 3KHHA 1QIFA 1VMKA 2P27A 2RHWA 2EEPA 4C01A 4LIPD 4L0DA 5B55A 1RVDA 4F3CA 4E07A 2D0PB 2EP8A 3HXKA 1NJ8A 4FONA 1VBHA 3LMKA 2NZXA 4PZLA 4NXNB 3TY5A 2XNKA 4ZKDA 5LJIA 3VNRA 3NDBB 4ZCRA 5GZ6A 3KKOA 1TVMA 3RYCA 4A93G 3EVFA 3THYB 1SKMA 3SYKA 5AQ1A 1Y1PA 3FCCA 1Y3FE 3CNLA 4BXXG 1MAVA 3B1ZA 4RTKA 3BQMB 5CLFA 2NZUG 3M5PA 3OSUA 5AOBA 3T54A 1AHIA 1Q44A 1RMYA 2O03A 1X7HA 3N7TA 2BUAA 2UVQA 1FFSA 4ZT5A 4MVJD 2FSUA 1Y48E 5E1DA 1K8YB 1GA4A 2YV4A 3WGZA 1JZTA 1CDEA 2PKYX 2Z2JA 2Z2XA 3T3PB 1PFGA 4I36A 4EYIB 5D6NA 3A06A 2HNKA 4KFRA 4O1IA 4MQUA 2ECFA 2W2LD 3AW8A 3X44A 3AB3A 5DB4A 3DEFA 3QZUA 5FF9A 4NOKA 4IMRA 2BSXA 4DLBA 4BQEA 2AN9A 2GN0A 1ADGA 3FYUA 5KT4A 3VGPA 4JI5B 2O1XA 3EFOB 3ETHA 2VUUA 1KAOA 3KQSA 2CK3D 1ZHQA 3RYIA 2R96A 2YJ4A 2DQSA 4WY8A 2UUBB 1DC3A 3Q3GE 5D3KA 2DPLA 1Q6ZA 6AT1A 1FUUA 5AJXA 3UXMA 1G5FA 5JIBA 2FEAA 4KUGA 4I8IA 1ESNA 1E9FA 4EX7A 4YP3A 4BY7G 1KC1A 3FFWA 3DUWA 3W1BA 3QFHA 3QX7A 3BBLA 4L8LA 4R84A 3GY0A 2C0CA 4HGYA 4NIMA 4CKWA 5CHYA 2A1TR 3EAFA 1B6TA 3Q11A 3DMDA 2H18A 4BV2A 1HETA 4QLAA 4PTYA 2QTHA 3GLIE 4H7JA 3PC3A 3T0FA 4DUZB 4KVZA 2PH5A 5IT9A 1DLIA 1ADCA 1LSUA 4FE3A 1YTLA 2OB1A 5JZSA 2IOHA 3N7UA 4NMHA 2AZDA 4DV7B 3R3UA 1XD2A 5LNK1 1ZD2P 3DE3X 5LQAA 4Y18A 2PGOA 1OLSA 1KJIA 2AN5A 2EFCB 4Y2QA 4MQFB 1SFRA 4WN9A 1RHKA 1R27A 2IYTA 3WGNA 2EWVA 2F8SA 3WK5A 2I4IA 2JGMA 4RHCA 5C7LO 2FKNA 3T3GA 1DBQA 4GRIA 5FI5A 2YIVX 4J07A 2CNWA 1K9VF 4ZDKA 4PSKA 1E98A 4DREA 3GD5A 3JALA 3HDGA 5I5EA 5AVYA 5I4IA 2I03A 4OXNA 3FCAA 5E3IA 2QW0X 4FFMA 2QZJA 2JFXA 3S2ZA 4YP0A 1RYFA 1XROA 5I47A 1FFYA 3AEZA 3AB8A 5KX5A 1PV4A 2O9JA 2XOKA 4PYMA 5AKIA 2BHNA 1BFUA 1X8JA 4S1WA 2HWKA 3ZWBA 2D13A 3GEEA 4R8UA 1KI3A 2WB1E 1XQ1A 3EZLA 3ZY4A 2C31A 2H1RA 1GEEA 3QUTA 2FPXA 3S2UA 3K1TA 3MWKA 5E9AA 1Y7HA 3RM3A 2X2FA 1I4DD 5HZGA 5B30A 1L4MA 1F14A 4O4JB 3RVKA 1TB4A 1RRGA 1T3SA 1X1QA 5FUQA 4UOQA 1Q1ZA 2PZFA 2W6JD 4X97A 1T8YA 4D99A 2OZKA 5TJ9A 4EHIA 1Z4NA 2I34A 3JVEA 3QWHA 2JA6G 3KOMA 1OU4A 3D8NA 3GAAA 3EF0A 3IYLW 3EDRA 3IOYA 1SQ6A 4CEJB 4OH1A 4NY1A 1KJZA 3UQYS 4OOEA 2YJTD 5E3JA 3HU3A 2A86A 5F3RA 5CCXA 4B2LA 2AD1A 3FMVA 3SSOA 5KJFA 3E82A 4BX0A 2IH5A 2ODPA 4LF4B 4LYEA 1J33A 4LHXA 3VO1A 1RM3A 3D2AA 1E5LA 3PUZA 1DV1A 1DTSA 2B2CA 5B4VA 3GT0A 2WK1A 5DN6A 2DETA 3BIFA 3S7TA 3DV0A 1TL7C 3CXUA 4RKRA 5FBHA 4RTSA 2FPPB 2COJA 1BEEA 1IXSB 4CT5A 4IS2A 4N3GA 1CNFA 2Y92A 1V9LA 2C4KA 2C5AA 3V97A 3U1VA 4QNRA 1LI7A 1JN0A 2QRZA 2I9KA 3O6VA 3ZE2B 2CLFB 5AVSA 1W581 5I5VA 2VLBA 3BBPA 3H5TA 3MFHA 5CGZA 4ZAYA 3TZQA 4ZMBA 1OAAA 5TNXA 3OJCA 1EG2A 4ZOEA 2C28A 2WFAA 1BOFA 1E2IA 1I1MA 2VNAA 4DDKA 4B7ZA 1I2AA 2FW9A 1E7SA 1DADA 1GPAA 3DL4A 4C6TB 2XGOA 3NHJA 3GRPA 4WZAB 3OT5A 3ZK7A 5DTQA 3V33A 4DV2B 2IBMA 2AJLI 1SCNE 1HC7A 1RYDA 2OVBA 5ILGA 3H6KA 4JLAA 2ZYRA 4W82A 4PQYA 5NLLA 1I7QB 3OEHD 1DEXA 2FPPA 5K8IA 3EF1A 4RVFA 1KH2A 2VPXA 2P9FA 2BKUA 1GNQA 4NECA 2Q3CA 4I4NA 4LF9H 2FPWA 4YXWD 4O08A 1U0HC 2Q7OE 1KXJA 1RM5A 4YIHA 3HB0A 3NPAA 1KVQA 1G63A 4N9QA 3MWFA 4MS1B 1P73A 3SYTA 1I94H 3N5KA 2VATA 2QE7D 1PYDA 4O2LA 2WAXA 2P4QA 5AW1A 1RQPA 5E1OA 1DDOA 3NHAA 3RQIA 5H16A 3TAXA 1UBTS 5DX8A 3DO8A 3EZ9A 3BH7A 5ITSA 2ZBFA 3KHUA 1J99A 5KFKA 1H8HA 4JJFA 3FTNA 2GT1A 3YASA 4NL4H 1GVNB 3O3CA 2PLRA 4OUKX 1VIYA 4X7RA 3KVYA 1RWMA 3MPOA 2X0EA 4TWAA 5L3QB 3QLVC 1ZITA 2QN3A 4RVGA 3KPWA 2A9OA 4WCFC 1RI4A 3F47A 2FZVA 4ZI7B 1Q20A 3LCCA 3W8RA 5IVKA 4U7FA 1V95A 4AZ3A 4PC7A 3LNTA 2JVIA 4HDNA 4RY9A 1GUZA 1YE5A 3GROA 2FLNA 5AKGA 2PX5A 2EKQA 5KFGA 3WQSB 1H2WA 1X7DA 1I1LA 2Q8NA 2R82A 3WB2A 4IX1A 4ZEMA 4BXOA 2AB0A 5CM8B 2X6TA 5CNKA 3UJNA 1FYEA 2GD0A 2WJVA 2HWYA 3JSLA 1O03A 3HYLA 4CLOB 1C3XA 5FLKA 2BMEA 3JPWA 4B40A 4LOIA 4MEBA 4DIDA 4WGFA 5J4KA 2QZ9A 4HB2A 1J5EB 1A5ZA 3AY7A 1SXJA 2Y6UA 3L1VA 3BVPA 4XGRA 4Q12A 2P40A 2W98A 1FE8A 1VECA 1LLCA 1Q50A 1LBEA 4YB8A 1S8FA 2A78A 3ONNA 4CHIA 3I83A 3B6KA 3EIOA 3Q6NA 3LF1A 4MTEA 2EJWA 3DL0A 4W5OA 4LMRA 2H2FA 1C3OB 4BMSA 5E2IA 3FUCA 3DLTA 2RG7A 4AS2A 4BEWA 1RHMA 3CH6A 3C8ZA 5LWQA 4BCCA 4TYNA 5FI3A 3R9KA 3I6ZA 3BAFA 2C2EA 1QIIA 1JV2B 3NDIA 3T7TA 3WO0A 2PYDA 1W5TA 1R6BX 3C8MA 2FDCA 4FKZA 5AVKA 2GN9A 1BHQ1 5D1HA 5DBGA 3B8EA 1GKYA 2J07A 5CDTA 4CKZA 3C3BA 4B4WA 3KOYA 2RGYA 3I9NA 3TD6A 2PKEA 2WDPA 3A28A 5HNEA 3IQGX 1IZ7A 1XZDA 3WIUA 3HM9A 1L5VA 2BJHA 1OFUA 3RU3A 2C5HA 4FMDB 4YALA 1WUTA 3U5TA 2QY6A 1NQVA 4UREA 1DT3A 1XAIA 1P5RA 3DOJA 3MTIA 4KQEA 5FD5A 4GE0A 3G5LA 1XD8A 1JG4A 5DAAA 5JATA 3GEMA 7GPBA 3B2EA 3LE8A 4JROA 8ADHA 3H16A 1NN1A 2YYAA 4D97A 5B3JC 1A9XB 1G17A 1HQYE 2WAQA 4IHJA 3IHKA 1PRYA 3VSAA 2P9JA 1JAZA 1SOAA 1FFXA 4JI0B 5AI6A 3IJRA 1L7RA 2HHLA 5H5JA 1THMA 1G19A 5LD2B 5EP2A 2O0JA 3VX3A 1FA9A 1EK2A 3WZMA 4A3IG 3QYPA 4RB1A 5KKNB 1XDSA 1THTA 2A2ZA 4JENA 3U4AA 4XM2A 4HH3C 2AMLA 2VZ8A 4EBDA 3O0TA 1QIMA 1OXXK 4C3OB 2Z6VA 3C8HA 3FYCA 3PTLA 1XI2A 3V2UA 3PUWA 3ETNA 3RGGA 3VJRA 3CONA 4NHEA 2CCKA 2F43B 1DWPA 1R6AA 2P6OA 3U37A 5E6RA 4NOLA 1NR1A 3TTWA 2XIGA 2V8BA 3COJA 1T2AA 3DXFA 1ZA1A 4EUFA 3LDFA 4PO1A 2YQ5A 3VUFA 5G1NA 1GU0A 4C7OA 3G7SA 3TLBA 1FNCA 2FZEA 5JJ5A 1N2OA 2F1RA 4XJSA 1ZUHA 2I7DA 3HDJA 1RYSA 3OOWA 3ZW9A 2ZAGA 4OFZA 3P2OA 2B1GA 3RVRA 3ORHA 1NN3A 4HWRA 3KEFA 3QW2A 1ADJA 3C48A 2VHVA 3ZWOA 1UDRA 5AKYA 4IIXA 3AUYA 1GRNA 3UB4A 2D1TA 4XAQA 2VIIA 3ANMA 4EJ0A 3EYWA 1U2DC 2ZAIA 3ZJUA 2I6XA 1TTHA 3ICEA 2F1JA 1FXSA 4YI3A 3GLKA 4DNXA 4E08A 1VQ1A 1R9JA 4QU0A 3G23A 2R8XA 1K4KA 2J6IA 3V34A 1T9GR 2K7ZA 5K51A 3DGFC 1NTOA 4MJXA 2KYRA 2QM3A 3RVJA 1G0OA 4LVUA 3U0BA 3C4QA 3HJRA 5JCJA 1QXSA 3SS7X 1CKEA 3UQ8A 3WHKA 3GLVA 4P86A 1UOQA 3L6BA 4LF5H 7REQA 5IBQA 3TLAA 4TMWA 3DWFA 2ZRAA 3F5MA 3QA3E 3CLVA 2PUTA 2JIOA 1KSGA 1CIVA 3PHBE 4Q9IA 1COZA 1FSGA 4NFLA 3K0KA 4TVIA 1W2HA 3NLLA 5AK3A 2HEGA 4H0CA 3R3JA 1IQPA 3IKJA 4EUEA 3RS7A 4CMGA 2BD0A 5H4GA 2FA9A 3BMQB 1S0NA 4QBKA 5HKKA 2XOXA 2JI4A 4HDKA 1J42A 2XYHA 2HZBA 3MQFA 1U2GC 5AT1A 5I7VA 4MWSA 3LCMA 2IVFA 3A32A 4EITA 1E9DA 4P3KA 4TTJA 1WZIA 5E7MA 1FXUA 1ZI8A 1L4BA 3OKFA 5JHGB 2V6FA 1BVHA 4L76A 2QT9A 2JEZA 3J81W 1KMNA 1L5HA 4UHHA 2ZE8A 3NHWA 3LQ2A 4KN6A 3AVQA 2BLLA 1XPUA 2JRLA 3GPDG 2QTGA 3VDNB 2ZSEA 3UEOA 1JA1A 1A8PA 3NT2A 2Q4DA 4OQQA 5EHNA 3O7WA 3JCZA 2WICA 3LL7A 2E7ZA 4PN3A 3CVVA 3ABOB 4NRDA 3EPPA 2ASLA 4YRLA 3DVRX 2NN3C 4BZPA 4DR6H 3PE4A 2H3EA 3GTLA 1IBLH 4QSMA 2X0FA 2JLZA 3E9YA 1LBTA 1GFIA 1XMXA 2G4CA 2CQYA 1MDFA 2P0EA 1JR3A 1COWD 1G4UR 5IAKA 4DCVA 4EM6A 1A2QA 3T9EA 4NPCA 4CL8A 3ANNA 4MVJP 2AUTA 4L2IA 4K6NA 2AG5A 2PWZA 2I6TA 2JEIA 4CMIB 3PD7A 3QVKA 4IV5A 4ZARA 4MS4B 3ZCQA 2YRWA 1YXMA 3A4NA 3OX4A 3L06A 4FHDA 4HXYA 1F2UB 4TN5A 2OO3A 3M5CA 3UJ9A 3PR1A 1CJVC 4Q03A 1TW3A 1SVUA 3FDZB 4EUSA 5FDFA 1E5TA 2EHDA 5BOSA 2JCGA 4PANA 4ITUA 3GMTA 2DCUA 1ZW1A 3RUEA 1ZRMA 5F3DA 4AUNA 1KMHA 5JISA 4RSHA 3AM4A 4GBMA 3ZQUA 1VLJA 1V5FA 5HOQA 4EB6B 1SC4A 2CJWB 1Z4QA 1GKKA 2IVZA 4XM0A 4ZO4A 2AFHA 5HYVA 4EF5A 2CMHA 2VG8A 2FW1A 5MF6A 5KYYB 2X23A 2OR3A 3PFWO 1KSHA 4NAUA 1C9KA 1QOZA 4LWPA 3IOEA 1AJEA 3SHFA 2KI5A 3QKIA 4MQBA 1APBA 3RTDA 4RD1A 4QQRA 1Y7LA 3UWOA 4EUKA 1A4XA 2GWRA 1YZFA 2XE8A 4KYUA 1OZFA 4R7GA 2PRZA 4DFDA 3T7SA 2CXQA 4R8VA 1ZOPA 3RQSA 4R8KA 1Z8DA 1U8AA 4H4DA 4F2DA 5KFQA 2H0RA 1V9PA 1M2VB 1XLVA 1IN5A 3W5OA 1DXHA 3N2KA 4BIMA 3Q98A 4B32A 1QHYA 3CG4A 4X71A 3AEXA 2I29A 3WA6A 2GWHA 2WU1A 1U7TA 4IEIA 1WB6A 4HEJA 3JTEA 5DBEX 1XTQA 3FCEA 5DCLA 2X5RA 2H4WA 2E82A 4Q82A 5FBLB 3PNSA 5SYNA 1E7MA 1MO5A 3GR6A 1I51A 2ZZMA 1XRSB 1KE1A 2ZM6B 1T8TA 2JA8G 2P91A 4CMDA 4PRKA 4V0KA 3EIEA 1H3EA 5JI2E 2OC9A 2HNAA 3R0JA 4ZWNA 3MD0A 3SEZA 2A67A 2W6QA 4LTMA 5A62A 3K31A 4OQDA 4I3GA 3K35A 1CS4C 2J32A 4I5FA 3DDSA 1AN9A 1C9YA 1RLJA 1GGHA 1MTZA 3BK7A 6CHYA 3GVIA 4AKTA 3I05A 1M2VA 3ZDRA 4AN4A 5JSQA 1P4AA 3M9WA 5I5YA 3A1TA 3HEAA 3L0BA 1JKMA 3PW0A 1HRDA 3CVJA 2OZLB 2ZBRA 3MUOA 1YBAA 2FUNB 3H1TA 3KJFA 2HA0A 1NI4A 2NVUB 6YASA 3JQ7B 1JHAA 3A6ZA 1YQXA 1G21E 4RA6B 3D0RA 4X6LA 2ZUTA 3G2IA 2YDXA 3G2OA 4NABA 3ZZNA 5LFAA 1CJKC 1T8WA 5E9JA 3G8AA 4DV1B 1GPWB 1XQVA 2O3QA 1EFCA 3N44B 3KD3A 3FHCB 4KLRA 4JFRA 3IB3A 2ZRLA 1FFAA 1B8VA 2FMIA 3COPA 4MGEA 1VFNA 1OWTA 4CMAA 4YRFA 3RYTC 1Z4LA 1P0CA 1W6RA 4AJJA 3ZHXA 3S28A 3F7NA 1HNWH 3DZIA 4MMZB 3KQTA 4LZPA 4PINA 4YRJA 1ESCA 1ZCFA 1L6RA 2DHQA 2IYQA 3RUHA 1OKKA 2VBIA 3AVOA 5GV7A 1HFWA 1C30B 1WDMA 1YC5A 2XE7A 4IGFA 1B7GO 4AJNA 4M1KA 3H9BA 4M9RA 4GKJB 3LGSA 2WPDD 2YOGA 3IBSA 4Y1GA 2H4JA 1NG1A 4L4ZA 4CM4B 2I6GA 2O5VA 4C7JA 1NG9A 2AEEA 3PDCA 3SPXA 2C4UA 1BDMA 3LY8A 3UENA 3OTOB 2PBRA 4OX9H 3T5MA 2RCNA 3AP2A 2AI1A 3UM9A 3UT0A 1DAAA 5REQB 1BC5A 3I39X 3ED5A 4L0QA 3OTHA 2QTLA 5IF3A 5SY4A 1QQ6A 2OL4A 1J25A 4R9RA 1ZR2A 1IATA 2XADA 1Q95A 1M7GA 3CRMA 3A8TA 1JI0A 2J3MA 5EWGA 3IEXA 1JWLA 4I4TB 1NT2A 3ADCA 3CTMA 1A1VA 4HOYA 2D00A 1CP2A 3OP1A 1F20A 5G0WA 1EUCA 1UH5A 3OT1B 4DCPA 5DN9A 3LFHA 3ZNNA 3KJGA 3E35A 1WCWA 3Q1LA 3D02A 3CC8A 1SJ9A 3KOZA 3CT4A 2OCKA 4JLWA 4FFOA 1RJ9A 1U8CB 4DDWA 1WZCA 1EAMA 4RCZA 1MEOA 1R1DA 2XSZA 5IVDA 4QDTA 2HY7A 4LECA 5HTKA 1M54A 3JZIA 1W30A 3I3SR 4Q19A 4IIVA 2GN6A 3WDKA 3EXHA 4XQ0A 4QG3A 5KJCA 5C9ZA 1RU3A 1Z7BA 1NNUA 1WD7A 3P9PA 1PS8A 5HCNA 4I1UA 4GT1A 2WWIA 2D5LA 2VCYA 2FWJA 2GARA 5T8KC 4HJXA 1POWA 2GFIA 4FC7A 4RY2A 1T25A 1EJ6A 3EPLA 3P2KA 4HDMA 4RY8A 5AJYA 4JUDX 3BAZA 5BNIA 3FUWA 1Y1LA 3QBDA 1CLEA 3RANA 4EFNA 1TTTA 5MGNA 3UUWA 2DECA 3QPUA 4OTZA 1IMOA 1JE1A 3GARA 3VRHA 1NQXA 4UBLA 4RZQA 2O48X 4CL3A 3HDVA 3GDWA 4P0PB 3IOCA 2ZWOA 3OZIA 1VBFA 1JFFA 1MB0A 4LAFA 2I7CA 3BJRA 4G1VA 4PQEA 2RHRA 3GDFA 4XVRA 3AOEA 1BCRA 3H2BA 1KFJB 1U2EA 3UK1A 4UCOA 4D45A 1Y3DE 1L4EA 2C4HA 3UJ3X 3PL5A 2EXXA 3TUJC 1E2BA 4A1OA 1R9TA 3FDIA 1DE0A 4CCSA 2ZJZA 2X42A 4LA4A 4HZUB 1WV0A 4P5EA 2UXDB 1SHZA 3BMCB 3KQNA 4TS9A 1WP9A 4XWAA 3HFGA 2DHEA 4QYXA 4DLAA 2I9PA 3CRVA 4YV2A 1UJ2A 4BOYA 4N7BA 3HB4X 2ODEA 2WM3A 1C7IA 2A4KA 3EB9A 1ISGA 4GM4A 1YZLA 2XUAA 4DLZA 5JYBA 2HXGA 1YBVA 2XIQA 4WFKA 4WOCA 4WOKA 3IDFA 3PIDA 4BNXA 3BE5A 4RC9A 3WTBA 5ALYA 2YZLA 4LFAB 4RANA 4YRDA 2HYDA 2O2CA 1D0VA 4M1OA 5LLSA 4HAOA 1UXJA 5E7IA 4L9WA 3KQYA 3OEEA 4IKEA 1RPTA 1WCIA 4EI9A 2FQXA 2QR3A 1QH0A 3PPIA 4Q66C 5FNVA 2ZFUA 3W3AA 1R6UA 1CR1A 4H1HA 2GHIA 1TQ8A 4D3DA 4OJKA 5HQ3B 1DT5A 3V8MA 4JI8H 2Q1UA 3DTTA 5JC8A 1MGOA 4JH0A 1C50A 1C7EA 2C2GA 1RRKA 2RHHA 1NIJA 1Y9AA 2BP7A 3EG9A 5DF1A 3WHIA 2FG5A 4RJJA 2G72A 2PL3A 1IBSA 2QGFA 3WKEA 1U1DA 1RD4A 1I7NA 5ALTA 5A06A 4NBRA 1YK1A 5HIKA 2W6OA 1MJHA 2PLFA 4L95C 2ZBUA 2XD9A 3R76A 3K0EA 2NT4A 4CM1A 5LOVA 5KTKA 2VDWB 4DKJA 3B60A 1IJKA 3IX7A 5J2UB 5A5EA 3TLJA 2UVVA 2DU8A 2H9IA 3C1OA 2PD3A 2BN4A 2PGLA 1R7RA 4RAZA 5FWDA 3SDZA 4BO3A 1VYUA 2OQRA 5U9CA 4MXDA 2BZGA 3TEFA 4F8JA 4A0GA 1D6SA 4UAUA 1Z6GA 2BKVA 4RFVA 3OVMA 3Q3CA 4F97A 4KO1S 2Y1DA 4G25A 4PZPA 1ZNXA 4LH6A 3DL7A 2G80A 1SCKA 4I9NA 2RK4A 2PDAA 2Z9BA 3P4XA 3GI1A 1U7UA 3T12A 3JQ6A 1Q16A 3V00A 4EATA 4KNYA 1QHHB 3IDAA 1ABFA 4MUXA 1V2GA 3ASYA 2XBMA 3BZBA 3NC0C 2R5FA 4CTNA 4JP3A 2QPOA 5ES4B 1T3HA 2WHQA 3DE4X 2R8OA 4LJRA 1R50A 3V8EA 3L7OA 1IN4A 1B16A 5F23A 1BGWA 3CZQA 1O0BA 2AZ4A 2W8BA 2VEOA 3DDCA 2VI5A 2BW0A 3VHRA 1W19A 2XNDA 2WJYA 2W93A 4IVNA 3CZAA 1R10A 1SKBA 3OCJA 3AJRA 2O8BA 1X3SA 5FA6A 3OZSA 3OHPA 5JAZA 1S2GA 3UV7A 5HFAA 3DEKA 2O0LA 1G8AA 1M2JA 4PHTA 1K8QA 3BHNA 1X9NA 3E9NA 4P35A 1KAHA 3KT6A 3WLPA 2IS4A 1MKYA 4F4FA 4KQ1A 2P4EA 3HA5A 1PJQA 1JU3A 1D04A 1NSYA 3KREA 3OD5A 1UP6A 4TMZA 2JGLA 4MGIR 3O1LA 1ZH8A 3OA2A 1SELA 3WB1A 1DKMA 5ECGC 4QGGA 1MO4A 1RQRA 2YMMA 2ZU6A 2ZWIA 5BWNA 4ED1A 4I55B 3EC1A 1FQJA 3JQFC 3JAKA 2JFWA 4D98A 3B1WA 3LTEA 5DJ5A 2HJSA 2VJYA 4E32A 2GTIA 4ZCPA 2D2VA 4G4SP 4N6NA 4ZYTA 2ZAMA 1JYFA 2FLPA 4TV9A 2IITA 2VHWA 4O7WA 3NIFB 1DTWA 1K9SA 2HT6A 2W2VA 3H18A 2IZ6A 3T5HA 3KR0A 2JCSA 1TA9A 2R68A 3N3AC 3WWDA 5CHEA 1ZI9A 3SYRA 5KFMA 1QP0A 4HPXB 3E4DA 4O59O 2E4VA 2Q2OA 1YRHA 2RKWA 5DCWA 1WSWA 3MHPA 4ERXA 1ZGAA 1YGYA 4N3AA 1TUGA 2B2NA 4O33A 1HQKA 2D06A 5LDGA 1SCIA 3H75A 3TLYA 4RFSA 5ECYA 4KW7A 4D3XA 4MARA 3O75A 4CMCA 4MLCA 2D1QA 1O6GA 5CM2Z 4B6QA 4DCJA 2VK1A 4IRDA 1NIPA 5AJTA 3BUSA 4WK2B 1R4NA 3VNNA 4HBGA 2BELA 1DV2A 3CR7A 3RKUA 4K8RB 3UJ8A 3F6PA 2HQBA 4YCJA 3WADA 1CZRA 3I2FA 1LXCA 4Z3DA 4EDHA 1IXYA 1TM5E 2VSYA 4CLEA 1FRFS 3UFXA 2X2EA 3EHDA 1IZYA 1ZKMA 4MDHA 5CA1B 5ESDA 4EEYA 3UTDA 1RXWA 3KZXA 5I01A 1F7VA 3U9SA 1T0IA 3EDYA 5M5BA 3AHFA 3G2NA 4IIBA 1P8LA 2O8DA 5EZ6B 2REXB 1KO5A 5HFNA 3PPXA 4YAKA 1SXJE 2UXBB 5LUAA 3ZXIA 1CZKA 4H7IA 1VG9B 2R6FA 2E4UA 2Y4OA 3WGLA 1EFPB 1KPIA 3CF4G 3NEYA 1UIMA 2BGLA 1DIAA 2PZMA 4R2MA 2WJZB 3MUEA 4YC7A 5EZYB 3PQDA 4UE6A 5AUOB 1KI2A 3GFPA 4BLTA 2F6RA 1X19A 2Z09A 5AM3A 1LH0A 3RSCA 3ET5A 2VK2A 4RK6A 2Q2WA 2R8GA 1N4AA 2CL5A 3REQA 5J59A 3PHIA 1MAUA 1OYWA 3M6LA 3OZAA 3B85A 4XIGS 4NFSA 4D9JA 4E5YA 3HJFA 2G1KA 4M1TA 1USGA 2QUKA 1UR5A 3AHJA 2JBAB 2EL7A 2GKOA 2ZVDA 3DOOA 1CE8A 1N34B 1DBWA 1D2CA 3FM9A 2QVXX 2IE0A 2ATLA 1QLHA 2PA3A 3L3BA 2B3TA 4AQDA 5IJ0B 3IP3A 2HHJA 1YZKA 2R4QA 1P2UA 4OI4A 3R7NA 1K7FB 4QUEA 4BFLA 3GVPA 1N7GA 3P0FA 4COOA 4IXTA 3PD1A 4GVXA 2G4LA 2GHQA 5DRTA 2Z5LA 3WOVA 2NXEA 3PJFA 1I1KA 5KG0A 1Q91A 2QIOA 3O8OA 4DBLE 3NETA 5A71A 2WAQE 4DA9A 4ND3A 2NV0A 5ALVA 1TLTA 3UAYA 3M6UA 1JQ5A 3LGAA 1HF3A 1P6XA 2PD4A 5FUYA 4RWEA 2W2KA 1JR6A 2I67A 4LOJA 1H42A 3OE5A 3QM1A 3L4KA 3TR0A 3VR4A 5IT5A 2C9DA 3T5JA 3FB4A 3CX4A 4IFBA 2PUHA 5ILQA 1E9VA 4F92B 4Q39A 2PHZA 1OBHA 5ALSA 1OFIA 1WNTA 4ZEWA 4GGMX 4KR6A 2VQDA 3VZRA 5M34A 3PJRA 3EQ6A 3AI3A 3EF3A 3QWBA 1ET0A 4MRVA 2B1RA 4QOHA 5FUBA 2FLWA 3AF2A 3E70C 4UZFA 3UY4A 3IBCA 2PSSA 3WNDA 2IYNA 4UEWA 4MRMB 3T1HH 1QLJA 1K88A 2YJGA 3DOHA 1MXHA 5KWIA 4Y0AA 2PRJA 2RHOA 3LHDA 1NP6A 3OTGA 5L4NA 1GDHA 2OFOA 4RM2A 5JH7B 4JOSA 4B7AA 3Q1KA 3PUHA 1F12A 2PCJA 4AB1A 1UZLA 5FKJA 3F5QA 1MB4A 2CVQA 5JT1A 3UMGA 4UVDA 4ZJYA 1JBKA 4YFYA 1DX9A 2ZSHA 1PJCA 1X6VA 5KG6A 5C32A 3MQ2A 2BZ0A 4EG7A 4IM7A 4KQ9A 3RLFA 2I6FA 2GNAA 3OEYA 2W2PA 3M2TA 4BFVA 3T15A 3G9XA 3ZDQA 2J9RA 3ONVA 3TBKA 2P9GA 3LCRA 2QK4A 1MQSA 4MYUA 2GD1O 4R5HA 1USIA 2QSJA 4KXWA 5HS4A 4UNIA 5F35A 3V6MA 1AXRA 1YUNA 1EJBA 1E58A 5TS2A 2NUTB 1OV4A 2QSYA 4LXIA 1GKLA 2NVBA 2X9GA 2VRCA 1XZEA 3KD2A 5ETJA 2CHGA 1FU4A 1LLDA 2VSNA 1DL5A 2GI4A 1U65A 5GPBA 5LQSA 1LRKA 4DEYA 1BNCA 3UK7A 3TM4A 4I08A 1JDZA 3DWIA 3THYA 3R0IA 5DISC 2O5RA 3J7AC 5EPOA 4CE5A 4OATA 3DAFA 3OZBA 3E1KA 3E9MA 4ZK6A 5J4VA 2I62A 1PJRA 3M6FA 2WTMA 2XCAA 4ZT2A 4KKXB 5IAGA 4POAA 4F8YA 2JKZA 1QG6A 4C06A 5JXGA 3T3OA 4P6VF 3GA5A 4F3TA 1UKEA 1QGYA 2VYCA 3VKFA 2OH2A 2XBUA 3DBRB 4X85A 1KZ4A 3Q7TA 4ENPA 1GNPA 4K9OA 5TPZA 1Y7IA 4X84A 1XQ9A 3BMXA 1GUFA 3IUSA 1ISSA 4ALNA 5LQKA 1FMTA 2QLNA 3DMGA 1GCIA 1ZEJA 1SHTX 3BXEA 1UP7A 2WVJA 4RIEA 3AKCA 3W9UA 4BB5A 5JZVA 2B9VA 2VXOA 5DW3A 1JX6A 2WYOA 3EFOA 2I76A 1WQ4A 4ECXA 4KL8S 2WKPA 1NVMB 1E3LA 1R18A 3WNQA 3TLEA 3O91A 3WSWA 3ZN2A 4UHKA 1IPHA 2VR1A 1PS0A 3LUFA 5IVPA 4IDOA 3Q3VA 4IBOA 4F56A 2HWUA 3HUTA 2D5CA 1W36C 2P5UA 1E1KA 1ZM3A 4JUFA 2XF2A 5F73A 5KTYA 4X66H 5L7WA 3QMMA 4Q9KA 4BASA 3PUJA 4J94A 3ULKA 2WTXA 1CUYA 3S2IA 1M2OB 2Z5VA 1M10A 3DBRA 3S70A 1TM3E 4ARCA 1XMJA 1XYGA 3IO5A 1IULA 4L4SA 1JR3E 2ZJTA 3BDIA 1BU5A 4AYTA 2V3WA 4UCQA 4ZAXA 4QW8A 1VB3A 3U4QB 3ZGOA 5BNTA 2MCTA 1B8PA 2YVAA 2Q3EA 3HPRA 3I72A 4LC0A 3U56A 4QWMA 4TL7A 2HBRA 5BSMA 4YRZA 4EKEA 4TXNA 2PUFA 5BYKA 4MQFA 1M76A 3TNLA 1OXBB 2HT1A 2C8VA 2VP2A 2YYYA 3EG5A 4KRFA 2K7FA 1SVIA 1VB5A 2P8JA 3W2FA 4YR3A 3HNOA 4TZ6A 1KJ8A 2HF9A 5T64A 1PVOA 4KQMA 1JSLA 5IWAB 1F3OA 5DSXA 3GN2A 4Q9LA 1PW5A 5C0OE 1U8YA 3DD5A 3D6FA 3CRRA 3FWKA 4EFKA 2SCUB 3CISA 3MCUA 3LC7O 1WU8A 2FFHA 2QX6A 3I2HA 3FSJX 4WKBA 3SVLA 1ECBA 3USZA 4CC5A 1LV7A 1RLOA 2AFHE 4JDUA 1QCDA 1ZBDA 3WGTA 3PP8A 1I7PA 4KITB 3DE1X 4WFJA 1XL0A 1IEXA 3F8NA 4E2WA 2XMDA 2WU3A 1A9YA 2ZSBA 1RFGE 4QWAA 1JAHA 3B3JA 5GJBA 4PX3A 1E1QD 3LPDA 4LJ8A 4O4JA 3A6KA 1PNQA 2OUKA 5G02A 4ZVMA 1UM8A 4C0HA 4H31A 4V1CI 2B98A 2CJXA 3V32A 3L05A 4C05A 4G0VA 4U1RA 1M73E 4YAFA 5DM1A 1N8SA 5JQGB 1GRQA 4CEJA 3TMYA 3KR1A 3FDXA 4P53A 5AW8A 4PWZA 2HMSA 1N6KA 4LMYA 2JCYA 4MWTA 4DL6A 3F6YA 2FRXA 5T41A 2J9ZB 5JWRA 4KQIA 2O1WA 4P34A 4PYLA 3C3YA 4KN9S 3LNCA 5C8DA 3JU3A 1PP4A 2OGZA 5ICSA 4FIZA 5L1IA 2X2PA 4YUWA 1BEZA 4KXNA 1X2BA 4Y6GB 2PBZA 3FAZA 5IKPA 3K15A 4GSLA 3JSAA 5JMWA 3CGWA 3M1LA 2W7PA 1WB9A 2C99A 3QE2A 3ZBQA 3LX5A 3H04A 3KT3A 4PIMA 3K2IA 3KJIA 4PYKA 1SN7A 1ST2A 2GO7A 2EVWX 3FCOA 2WYVA 1U8UA 1TO1E 4OSOA 3PQ2A 4C6TA 4EEZA 4WZAA 1E9CA 2VQ6A 4Q6BA 3ODPA 1TECE 1UUFA 2UVDA 5CDUA 2GLXA 3JATB 3OCXA 3TAHA 4JZYA 1EX1A 3AETB 2Y27A 5JXIA 3KQOA 3CLSC 4ZVQA 2A33A 1CP3A 4RW0A 4ETIA 4H6XA 4XUEA 4ER7A 2ODTX 4MA5A 1E3EA 1P3Y1 3H8SA 3L92A 2OP1A 2WJWA 4KQGA 3O38A 3ITNA 4IOMA 4UJ3A 1PAUA 4AJLA 2W9BB 1TLLA 4N18A 2WEKA 4ECRA 5D5HA 2WE6A 2O4CA 1V45E 2J67A 2RGEA 2V98A 4U3JB 4MYDA 3LLUA 4K9PA 3GBSA 4P38A 4DWJA 3HE3A 2OO7A 4WXHA 4ESVA 1VBNA 4MS1A 5G53C 5HK8A 3I2YX 4F9TA 1RXIA 1ZMBA 2GZDA 4HH4A 3NYQA 2XEXA 4ISBA 4CKEB 1PFWA 2BTEA 3CEBA 3K4HA 2XWBF 4NBVA 1VHWA 3T1TA 5B7GA 1XTJA 1R3DA 3JATA 2HMUA 1BXRB 3LOUA 1BOOA 1P6UA 1M3SA 3TKAA 3V8VA 3IRUA 3J80W 2PZBA 3CLRD 3ECAA 2KW5A 1WCV1 4WA8A 2JA6A 4GR4A 3L5KA 5B7PA 4LE2A 1XMVA 3SY8A 4IDPA 3NUAA 5CT4A 2QMEA 2HF2A 1Z6TA 1WKBA 1KDYA 2X41A 5DTEA 2ZWAA 3T3NA 4JC4A 5DLFA 5L3QA 1XEWY 1Y9DA 4XGQA 3E8SA 4FWBA 5DG8A 4ZI7A 4U3JA 1EFDN 2B7BA 4J9QA 1Y1QA 2A9PA 4KMOA 1UEJA 3GGDA 5BY2A 8OHMA 4O02B 1NVEA 1VHQA 4Q7EA 5LMNB 1YRAA 5D6OA 1QNLA 2CB0A 5KTOA 4CKEA 3C70A 1GA6A 4ON9A 3DSRA 4YYEA 1YDWA 3MMXA 1LLQA 1QHGA 3ES9A 3EOAI 3FWYA 2XDQB 3DPUA 4CLRB 4Y1FA 2WINI 4BO8A 3GHHA 2XB9A 4CLOA 4JOQA 1RQLA 7YASA 4IX9A 3C6KA 4J9OA 3AR2A 2QU8A 2FN4A 4BN5A 5CJPA 2GM3A 3DTVB 4QARA 3QX9A 4HN2A 2I2FA 3H1PA 2NTYC 2W90A 1HE5A 4CEIB 4I1IA 5I5XA 4CF3A 1G7SA 4ZT6A 2V7EA 1W87A 3KT0A 3OPQA 3ILSA 5B36A 4HAWA 1YB7A 5EIFA 2EL9A 2ATXA 1Z26A 1C3OA 2VYQA 5KFNA 5A2QW 1FFWA 1U5BB 3AFNA 1H8EA 4X8OA 1H1LB 2RGUA 4ZQCB 2ILVA 2H63A 2A9QA 3E9ZA 4UDOA 3NIDB 1T5TA 3CZ5A 1HNZB 4BMVA 2LP4Y 2PT7A 2AHRA 1GNSA 1XZBA 4RADA 1X15A 2QBYB 1DBSA 1RLIA 3FMGA 2DYKA 2ADMA 1LFDB 2QB5A 2H4FA 1KETA 1EKFA 4DSNA 5ED4A 1ZHFA 4BMXA 1UBFA 2J7KA 4R9NA 4JX9A 3GEHA 3BE4A 3WX0A 2KSWA 3BHIA 1HMPA 3CW2A 1E8DA 3M70A 3Q8RB 2XGJA 5ADUS 1NASA 2R85A 3FFTA 3TO5A 3PQCA 2GAOA 1A9XA 1VFPA 3SNHA 1H1LA 2YHBA 2GRAA 4JVMA 3HNRA 1JHZA 2RJ3A 1KOGA 5B3AA 3T3HA 4FFRA 4BBSG 1QK5A 3M34A 2C2RA 1VRWA 1CY0A 2QPTA 1JHYA 2G7ZA 3EMVA 2MR6A 3W1VA 4O8CA 2OQVA 1Y37A 4EF6A 2O6HA 3PEVA 2HSGA 5ALQA 4UHEA 2QLFA 5CK5A 4E30A 2LBPA 4FE2A 3WL7A 3U4DA 1QONA 3EIWA 1ISFA 2TECE 3M81A 4K28A 2P11A 4AMYA 4ZOQI 2HFKA 1T8SA 3P45A 3KALA 2F43A 3WLQA 4QJ5A 4C04A 2RH4A 1XIVA 1U3DA 2IWRA 4QUJA 3TLGB 1ZBQA 5KFEA 4HS4A 4YR0A 1X1CA 1THGA 5BO5A 4BFYA 1YOBA 1M6VB 3VNQA 4H6VA 3RBEA 2PK3A 2R7KA 5DK6A 1RPJA 2XHZA 1ZQ1A 3UGQA 1EP2B 1JJFA 1NBHA 1UPBA 2FB9A 3IT3A 4BFSA 1XEAA 3KVOA 3EMDA 2N1MA 3LTNC 2X6RA 4TYYA 3NP9A 1ATZA 3PRKE 3QE0A 1N2HA 1N6NA 4F1JA 1JBEA 1SUPA 3LLVA 3WL4A 3AL2A 2FEPA 5KFCA 4RLFA 4Q7LA 3KSUA 5K20A 1RMQA 2PXAA 5K6AC 3I37X 4I4IA 3GEIA 1A82A 4YXFA 2Z2IA 2WTBA 4FC6A 3ENNA 2QLLA 5KJEA 1YUMA 4DZTA 1P2SA 3GWZA 3KOXA 3G6VA 4KUEA 3WAJA 1EPUA 3B70A 2FOIA 3P9XA 3IIEA 2MMCA 4LF8H 2O4UX 3ENWA 1IL0A 1N5JA 5KNDA 1CQJB 4HDCA 1Z39A 5AM0A 3SKXA 2E18A 2GA8A 4GM0A 3MYYA 5CIYA 4RDHA 2PM8A 1OA1A 1NFFA 4GLXA 4KQJA 4PIVA 4EBCA 3GAMA 5I9BA 1Y6JA 2HLDA 1IZ9A 2WJ6A 4L15A 2QM8A 2QSUA 3HZHA 3OX1A 3HYRA 2GBFA 1K83A 5A7FA 4M0MA 2J09A 4IJMA 2OA0A 2H1FA 1DJOA 2PZEA 3WLKX 4FNOA 1T9DA 5DYYA 1SBQA 4G85A 2P4UA 2G25A 3F2VA 2ZZKA