3R23A

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
304
structure length
304
Chain Sequence
b'AMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Ligase
total genus 78
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r23A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r23A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r23A01
4O7WA 2YZGA 5C8YF 2VPQA 3K3PA 4FFNA 4MV1A 3V4ZA 1E4EA 2ZDHA 4MA0A 2V5AA 3RFCA 4O2BF 3TIGA 4ME6A 1EHIA 1JLLB 5D8DA 1DIKA 4YB8B 2NU6B 3AX6A 1Z2OX 4MV4A 2PN1A 1JDBB 4M9UA 1IOWA 1WR2A 4XYMB 4EA8A 2W6QA 1KC7A 1OBGA 1KJ9A 1BNCA 4FFLA 2YZNA 2R7MA 2V58A 4MV8A 2IP4A 1DV2A 2W6PA 4IHJF 3TIIA 2QF7A 4HQ6A 4O7RA 4O83A 2CNQA 4YBZB 1C30A 4O7SA 1AUXA 4I55F 4J6EA 5CAEB 4MA5A 3R5XA 1KBLA 3KREA 1PK8A 3KAJA 4HR7A 4FFRA 4XYLB 1M0TA 1T36A 2W70A 4O7ZA 1UC8A 1GSOA 4YJ3F 3MWDA 3BSSA 3BSYA 4DLKA 2FPPB 2YYAA 3MWEA 5LXTF 1A9XA 3JZFA 3MJFA 2W71A 1KJJA 4IWYA 3HBLA 1B6SA 4EAAA 1A48A 4WBNF 5LA6F 2R7NA 3BSWA 3RV3A 4ZHQF 2W6ZA 4MAMA 4EGJA 1KJQA 1VKZA 3R5FA 4QSHA 3U54A 4O4JF 5BPFA 2XCLA 2CNUA 5BMVF 5J2UF 2WYOA 1KJIA 4IIJF 2PVPA 3VPCA 4IWXA 5HV6A 3TQTA 4HNUA 2CQYA 1M0WA 4TV9F 3TW6A 4O84A 4RZQA 2R7LA 3ORRA 1ULZA 5JVDF 2OLSA 4EABA 4FE2A 1PX2A 4I50F 2NU9B 2J9GA 3OUZA 2YS7A 3GIDA 2P0AA 2GPSA 1W96A 3OUUA 2I87A 1GSHA 4FFPA 5C1PA 3ETJA 4XZ3B 3G8CA 2YWVA 2FPIB 1OBDA 3JZIA 1CQJB 3SE7A 5FNVF 5EZYF 1CE8A 2XD4A 3V4SA 3WO1A 5CA1F 4O82A 5LOVF 3DF7A 3LP8A 3BFPA 1Z2NX 5I47A 2NU8B 1IOVA 1GGOA 1KEEA 3HO8A 3JRWA 4ZQIA 3KAKA 3U55A 2R7KA 3U9SA 3K5HA 2YS6A 4C5CA 4ZI7F 2R6FA 1GLVA 2W6OA 4MV6A 3GLKA 4O7VA 2W6MA 1JKJB 5JQGF 5H80A 2I80A 4C5BA 3ETHA 5J2TF 3VPDA 2CZGA 1EUCB 3JRXA 4MV9A 2PBZA 1E4EB 5IYZF 2W6NA 5DMXA 2CNVA 4EG0A 2R82A 5LYJF 2FB9A 1I7LA 4GGMX 3VMMA 4O4IF 4C5AA 4FFOA 2GPWA 2NUAB 3E5NA 5BPHA 1B6RA 3Q2OA 5K2MA 2VQDA 3R5HA 3TINA 3R23A 1CS0A 2NU7B 1EYZA 3U9TA 3WO0A 1DV1A 1VBGA 4HNTA 1EZ1A 3KALA 1AUVA 2DLNA 2Z02A 4E4TA 4XX0B 3ORQA 4YJ2F 3QFFA 2GQSA 4O2AF 4WD3A 1EUDB 1CQIB 2FPGB 2R87A 4O7YA 2X0SA 2GLTA 1KJ8A 4ZOLF 3VPBA 5KKNB 2HGSA 5JH7F 1GSAA 4O7TA 4I4TF 4O4LF 2QK4A 5JVLA 2DZDA 2YZLA 4FFMA 4TUYF 4O4HF 4EA7A 2FP4B 3Q1KA 5CB4F 4EGQA 2I8CA 1KUTA 1M6VA 3RV4A 2VHEA 2R84A 1JDEA 5KX5F 2DIKA 5LP6F 3VA7A 2ZDQA 5JQWA 2YRXA 4M99A 4M9CA 1UC9A 4DIMA 2HJWA 2C00A 4O81A 3RUPA 4O7LA 2DWCA 2YW2A 1W93A 1C3OA 4O7NA 3LWBA 3BG5A 5C1OA 3K5IA 4TV8F 4IZOA 2GQRA 3N8DA 3N6RA 1Z2PX 4L1KA 1SCUB 2SCUB 5CA0F 4YAKB 2VR1A 1BXRA 4FGRA 3VOTA 1VBHA 2V59A 3HB9A 4O86A 1I7NA 3WNZA 2ZDGA 3I12A 4HNVA 2YRWA 2R86A 2NPOA 4M98A 4EA9A 5HBRB 2R85A 4YAJB 3UFXB 5GONF 2Z04A 3R9RA 2YZMA 4MV7A 3NUAA 4Y8VB 3G8DA 4NYEA 3AW8A 4FU0A 4MV3A 2YL2A
chains in the Genus database with same CATH superfamily
2FW1A 2NZWA 4OI4A 3BHNA 5F1OA 4I55A 2X5XA 3H7AA 2AMJA 4OX9Y 1CB0A 5A03A 4Y0AA 1U99A 1S6YA 1G66A 3KLNA 3QBJA 4KQKA 4Y2UA 3TLGB 4QATA 4KTVE 4FE3A 1V5WA 2AD5A 1NE7A 3D54D 4F9EA 2WT9A 4B84A 4LHVA 1NE2A 4L07A 1JR3E 1BJKA 3EXHC 5JZSA 4L75A 1MX5A 3MD9A 3PXXA 4X0EA 2KSWA 2ASLA 3I09A 5AI5A 1BHO1 2ATCA 1CUIA 4R8VA 1U9CA 1D04A 3JARA 1CKMA 4BJ1A 2WJHA 3F2VA 4EGFA 3N7TA 4HG2A 2Y1XA 1PSZA 1N5RA 1J23A 2DFPA 1EH5A 4BY1G 1ZX1A 4KBFA 1TJ3A 2JBAA 3SVLA 1PVOA 3DR3A 3VR4A 3KLMX 4BLWA 3DNFA 1JHYA 4RKYA 3JQ8B 4Z9YA 3PEYA 3SYLA 4ZDJA 1UXIA 4Y6QA 2HD4A 4JXXA 5LU8A 1TVEA 1R8XA 5F7OA 3ZNNA 3OEWA 4B4VA 3ZGOA 2JI4A 2W8KA 3JQ7A 3FDXA 3KWJA 2VDPB 2HFJA 2ZW9A 3G17A 3L6UA 3M70A 2DPLA 3LGAA 4PLPA 4NEQA 3CONA 2W2OA 2WM3A 4IVQA 3JCZA 4HNSA 3WLFA 3DB2A 5D87A 5AM4A 5T57A 4YYEA 5JYBA 4FKMA 1HK7A 2I3DA 3BAZA 3AF1A 1A4XA 4MEAA 4MKZA 5MHTA 4PLFA 4JX8A 1Y3DE 1JJ7A 1FL9A 2XCSB 4MR7A 1EXDA 1H42A 3LYAA 5KG1A 1TU3A 1H2XA 2GPNA 3BGWA 3PGMA 2I7DA 3DQQA 3JRWA 2PX8A 3ZWXA 2AFIB 2EJCA 1RK6A 2VHCA 3N70A 4QNMA 5AD1A 3D2LA 3L2OB 1MAUA 1ST3A 3F8WA 4A1OA 1BHQ1 4LDNA 1QFJA 1B2LA 1VHWA 1U80A 3TL3A 2A9QA 2OQRA 5AO9A 4GXNA 4QOIA 4DCSA 4KI7A 1S3FA 4O2AA 4IKOA 2FI1A 4C88A 1FYVA 2AS0A 2E4XA 2B3DA 2PUJA 1XEFA 4EMUA 7MHTA 1L7OA 3SKXA 4F4WA 1RJWA 4WFQA 3HKEB 4AMVA 3QEAZ 1JPNA 1RMQA 1N6RA 1KORA 3AI2A 4RABA 4MICA 4Q3AA 3EARA 2BR3A 4KG7A 2G5CA 2OCDA 4BS9A 3QWIA 3KQNA 4FTWA 1KDVA 1MLDA 1XF1A 3HCFA 3D59A 2E0IA 4IZ6A 4ETMA 3FCUB 2W2XA 4TKUA 3B6KA 2H9YA 2FOXA 1NVKA 621PA 1Y1TA 4OQMA 3L8FA 4GUDA 3RGWS 1VYHA 1PR4A 5AKZA 2W9BA 1S2LA 1M1YE 3GGPA 2JIOA 2CNDA 3R9KA 2ZUEA 4BVLA 1DU4A 3GIKA 3NTOA 1N5MA 4B7ZA 3F3YA 1K89A 2GN6A 3REOA 2OR3A 4RCZA 5AM1A 4N40A 1G5FA 1QTRA 3UM9A 2QTTA 4ZTBA 1HT3A 3SC2B 1AZWA 5H5JA 5TJ9A 3LLVA 2PBFA 5HHTA 1CP2A 1G5HA 2G82A 3GV8B 1AQ6A 2JFFA 3OJEA 1YE8A 1WKVA 1O94D 2LKCA 2JKYA 2KI5A 5CB4A 4E6PA 4W9RA 5EKUA 2B4RO 1Y3FE 1EK1A 3W5JA 4IJ5A 3G9ZA 1DCKA 3PQ5A 4EKEA 3EW9A 3RFCA 1R4AA 4KJXA 5F64A 4EQ6A 4GPD1 1YIDA 2A4KA 3ICPA 1LFAA 2O8DA 2J9FB 2WF5A 4HYQA 5D8DA 2A9OA 4HWTA 1MJNA 2OMEA 4QGHA 1MABB 2Z8ZA 1EUZA 1J2YA 1L4LA 4V2UA 3IEKA 4RB3C 3KOMA 5KOYA 1H0KA 4LY0A 4OPMA 1WZIA 1A88A 5JCOA 1K83A 1NLZA 2VSQA 1CF2O 2LV8A 5DHPA 4MR9A 4JLVA 3BB1A 9ATCA 3Q40A 4EY5A 3CPSA 2GVNA 5KTKA 4TQ9A 1C29B 3OFSA 3DR5A 3VR5D 3A1EA 4QUBA 3H4MA 5HQ3A 4YJ3F 2OZKA 2WUGA 3AUTA 4P7FA 1OHHD 4KPYA 2WTMA 4OYHA 1BVYF 1GN9A 2R6AA 4NFLA 4U7PB 4EH1A 4J90A 3WL7A 1K86A 2C96A 5FOXA 1QIKA 4IRXA 3LGXA 1OLXA 2IV3A 3F7NA 3ID6C 1OT3A 2PKYX 1H22A 3NS7A 4FINA 3WOHA 1VRCA 4PAQA 5CITA 3DLCA 2C5BA 3QKRB 4D8TA 5TF0A 4WZAE 3UAVA 1E7SA 1U1IA 2QP4A 4OSOA 3NWOA 4XDHA 2YN2A 3GUYA 3N7UA 1YVEI 4WKNA 2EIHA 1Y37A 4Q7QA 1LPMA 3RABA 3VYSB 4BWFB 1M10A 3SMVA 4GC9A 1P0MA 3TUIC 4UAUA 3EQ6A 1ACJA 4BO4A 5HIKA 4BO1A 1G6OA 5EP3A 4GNRA 4U0KA 1JG7A 1YDHA 1RJ9A 3HACA 3UPDA 2P3SA 3B9PA 2V97A 1CJTC 1YQQA 1D8TA 1JDTA 4LGCA 4GHWA 3OD1A 4DEYA 1ZR4A 2F59A 2OZLA 1G60A 4YREA 4YRBA 4QICA 3GNSA 3CGWA 3DE3X 2A1IA 3ADBA 4NARA 2WYVA 1HEIA 4CLRA 4YLGA 2RIRA 2EBWA 1WXQA 1X38A 4YP7A 3PENA 2W48A 4HX5A 4CKXA 1H3NA 2Z08A 4PZPA 1RYDA 4ERNA 4RQTA 4WGFA 3ELUA 4LXUA 4YR2A 3CLTC 1I1KA 4K6GA 2IYXA 4L5BA 5BPHA 5FKJA 1J49A 1RJGA 3CF6R 2F9MA 3RUCA 1H2FA 4TYYA 1EYZA 3T38A 4L5IA 3PPYA 4ECXA 1GGEA 2PKQO 3HVUA 4KSYA 1II9A 3STWA 1KH3A 1NM5C 5IXSA 1FQJA 4Y0NA 1Y5RA 2JS7A 5EZSA 2WD7A 3P52A 1BA3A 4JOSA 3BABA 1RI3A 2A84A 3U7GA 3J7AK 1P77A 1FP4B 5EJ9A 2VHEA 1JDEA 2PA0A 3EOZA 1KFJB 3S27A 3FTCA 3MPUA 1GQOA 4O2LA 3HU5A 5JCOC 4HQFA 5E6UB 1E64A 1V6AA 4S1OA 3ICCA 4ZQGA 4RIEA 5C51B 3WHPA 1CUGA 4DCTA 4G5YA 5F33A 5JSKA 2O3QA 2W6IA 5A7GA 2AH5A 5HUJA 3V8QA 4DLWA 2ZIXA 1GM5A 3GLSA 5BRJA 5BY2A 1N8TA 1OT5A 1KOGA 3LFUA 3AR2A 2QZZA 4R68A 4XD7D 3P9PA 1P6XA 3DOFA 3O8OB 4POOA 3ZVKA 2ZUBA 1YH3A 3R9WA 4Z4EA 3FAKA 3ADOA 2GA9A 4U6QA 4U6NA 4YUVA 2VZLA 2V7XA 1Q0RA 5JY6A 3UANA 3MOSA 5I7FA 2WMNB 4FCTA 4P1ZA 1BC5A 1R5JA 3K09A 4NHOA 4V0RA 4HEJA 2V9CA 2ETVA 2D0PB 4LC0A 4JI0B 4BZXA 1LK7A 2GLXA 4YT5A 2BKAA 5L95A 1PBNA 1CUAA 1LPOA 3EAFA 5KJ1A 1R0SA 3B1JA 5F12A 3A3OA 1AZLA 4URUR 2O3RA 3DBHB 3C8HA 3VUEA 4H08A 1PYGA 3TFOA 4X95A 4G36A 1TEVA 4R8SA 4DDHA 2NNLD 2YN4A 3ZCVA 1JPUA 1HQYE 3NTRA 2VF8A 1LX7A 3BWVA 5J4LA 1WSBA 1F6WA 1SQSA 2H4XA 4EWLA 3A0UA 2Q3EA 3RIGA 1DCFA 4XIFA 3E9NA 5ER6A 4P53A 5PNTA 1O77A 4M83A 4YUZA 4CEJA 1AH2A 5KTSA 4C03A 1XSEA 3GVXA 5E7QA 3BSWA 4I50A 1GG5A 1SBYA 1FXWA 1ZH0A 2QB5A 2DQKA 4MAMA 2Q3FA 1T2UA 1TRHA 4OQQA 4BQPA 1P72A 3U54A 5BPFA 1BJRE 2XCLA 2V6BA 2IIQA 1HPLA 5EMJA 3PDCA 4US2R 3QPBA 5EI5A 2V0NA 5ITSA 4APMA 3KL2A 4OHYA 4J0JA 5HF6A 4QYIA 4YAJA 3HHEA 4RV9A 3EA4A 2PS9A 3VI4B 1KC3A 4MVJI 3GUCA 1GZ3A 1WCWA 4FFWA 1AA9A 1DUVG 2HCBA 4BQSA 5JS2A 1Y5LA 4LBWA 4B8YA 3X1DA 4DLAA 2IYFA 4IOJA 3VKUA 2L18A 1GN8A 1Z6TA 1W96A 3OUUA 2QLMA 1SKAA 2H1WA 1JEYB 2HK9A 4WY2A 3O8CA 4G0XA 1CVLA 5HM8A 2K87A 4I8IA 1NONA 2FRVA 4TL7A 2BFCB 2V3WA 3LYLA 3HOWG 2FWNA 3AEZA 4X7MA 1TUBB 5BOVA 3WIVA 3LDHA 3DWGA 1EB9A 3BRQA 2AG0A 2B2XA 1LPSA 2HA3A 1QHSA 3QEKA 3WKCA 4GYKA 2VBIA 4IKPA 1LZLA 2Y71A 2YXDA 4MIEA 2WUDA 1X8XA 1U5BB 1Z13A 3L7DA 2X0IA 1X1EA 1US8B 3V2IA 2QR2A 3RB8A 4R2XA 4BFVA 3L1KA 1OROA 4YYZA 1JSRA 4LXYA 3GF4A 2NXJA 1QCYA 1Y9ZA 3GZJA 1VA5A 4F5YA 3T9BA 3E3AA 4PRKA 3EK2A 3PUHA 3RG2A 1ZNWA 4UOQA 2A5JA 2G88A 3F0TA 4LVCA 4X8LA 4U7HA 3UNXA 3O4HA 5K0SA 3C6XA 1BA2A 1VIVA 2QE6A 2ZXUA 5JH7F 3QMVA 5ADWA 2FWAA 4ZAZA 3WDSA 4Z3KA 3FHOA 3OCVA 3NHYA 1H2ZA 3K09C 1T15A 4FZJA 4GOOD 4PHFA 4I66A 1LFDB 1DZIA 2W58A 2X5RA 3H97A 4WCFB 5AW7A 2YJ6A 4Z7NB 1N3IA 1WEKA 2PLFA 4ED9A 5K6AA 1C3OA 1ZRNA 4C7XA 1Z73A 1A0GA 1GITA 3OZEA 4CM8B 4LQDA 5F7ZA 4L76A 4NU5A 4O8CA 4QT4A 2DR2A 2FWJA 1JUDA 5JOQA 1VGVA 3H17A 1QH8A 1BXRA 4KK3A 5LKRA 4P35A 1KFEB 3FYCA 1VPWA 4IDOA 4NV1A 3WTBA 3SD7A 1EKPA 4DXHA 2Q50A 2XCRB 1ZZEA 3ZLJA 3W7AA 4NS4A 3H19A 4UQPA 1YUMA 3EEOA 3D4OA 1KQNA 3PTAA 3IURA 4KWEA 4WRRA 1R4NB 4ZDWA 3R77A 4C08A 2JKZA 5IAOA 4RC9A 4MMYB 2HBRA 3M3HA 1DIKA 4JI6H 1L5VA 2VAMA 3RT1A 1N56A 3DV2A 1JLRA 3Q3HA 3B3QA 5FO0A 2RI1A 4EATA 5JNWA 1KI6A 5EHGA 5FUXA 4V0MA 1K1EA 4JXUA 3GIPA 1V1RA 4L4XA 2O3UA 3O9ZA 3NDIA 2G77B 3L6CA 1VYTA 3EXIA 4F6LA 4NH0A 2PX0A 4Y2PA 1R9JA 4RPLA 3FCAA 3KHUA 2YIDA 4P4TA 1UP4A 5K01A 1P7CA 3IAHA 5GAJA 4KE7A 1XBTA 4E6EA 4DLKA 3VKFA 2AD1A 2OXIA 2D7CA 3TLCA 2PA3A 3Q2KA 4E5YA 1HR0B 2A0FA 4JDUA 2G6TA 4J9MA 1G98A 4LDZA 4ZARA 4BQFA 3THXA 2OV3A 4NMXB 2DR3A 5JEEA 5DM1A 2FYTA 2HBYA 4Z54A 1BD4A 2WYUA 2ZE7A 3I52A 2UKDA 5C9ZA 5C7OO 3M1IA 4MYSA 1U2TA 1CDDA 1UMBA 1Q7EA 3U3ZA 2BGNA 4E7OA 4F8EA 3RBZA 3PHHA 3PGXA 3EUAA 4W8HA 3L9WA 3VBCA 4OK5A 3G82C 4X54A 4PM4A 1DTSA 2EF0A 4Q5IA 3BK2A 2XD9A 4E2FA 3BOSA 3QYPA 4JH0A 4OYYA 2R8OA 2IYSA 4RS4A 4YRFA 1TPYA 1SURA 3KFXA 1O8CA 2F4NA 4G09A 2YWXA 1OLOA 1KMHA 1GFSA 2O52A 1ZIYA 1P3JA 4ZAYA 1ZW6A 1A2KC 3KQYA 3TY8A 3PQ7A 3UG6A 3A4LA 3JZDA 3NTQA 5L40A 2ZM6B 4D43A 4ZIRB 2O54A 1THGA 4O2BB 2EBUA 3FFAA 4IJWA 2GF9A 3FD8A 2VFAA 1HTWA 2YQ5A 2O1SA 1QYVA 4HDMB 1ZHFA 5M5BA 4MV0A 5B36A 2Z83A 1U7DA 1EFPA 2I4OA 5K6AC 1BCSA 2BFMA 5MGBA 5GV7A 2H0QA 4G2NA 4IGIA 2Q8NA 1DKNA 2DMRA 3EIXA 2IL1A 4NKRA 5LWQA 2GNOA 3CZCA 1WMBA 3T99A 3I4NG 3T61A 1NNLA 5IHXA 1WPGA 3A10A 1NVXQ 1HE8B 3U6KA 1H1LB 4QARA 3HN6A 1WUJS 2P7IA 4Q7KA 3SXJA 3N43B 5MFZA 4P6VF 1HR0H 1A8IA 1I36A 2NXCA 4OHOA 1DIOB 2ZJOA 3UK7A 1K5GA 1KI2A 3WLMA 3KD2A 3IQWA 4IXTA 2Q8QA 3U48A 1RLJA 3E1SA 4WA8A 3DBLB 1OXTA 1QZZA 2ONYA 1N2ZA 4QHTA 1KPGA 3TSAA 5JNTA 3AO0B 5K3FA 3W5AA 4TS1A 3E8XA 4IF4A 2WT8A 2IKSA 1Q7TA 4G9EA 5E8JA 1NXXA 3W1VA 3DMNA 3LRTA 4CV1A 3COJA 1DLJA 4DGQA 2GQRA 2M6SA 1IM2A 1KO1A 4NEGA 5BWNA 4BNZA 2SCUB 2YV5A 3TJRA 2NAPA 5JWHA 2X3YA 2WY2D 2DF8A 2A8YA 1E2LA 3JVIA 4ECYA 3LHSA 4JR2A 2ZM6H 1MPTA 2WOJA 3MELA 3N2KB 2QJTA 3AY3A 2JVJA 1U3FA 2AW3A 3QWUA 3DE6X 1X9NA 4HGZA 2M32A 4YH1A 4FIDA 3PD7A 2QAJA 4ZKDA 2JGJA 2YCLA 1J9GA 4GZMA 2ZJ3A 1NVMB 3E81A 1FXUA 2EKQA 2J3LA 3U3KA 1YSCA 1ZOSA 3UT6A 4E5SA 5LMCA 3KPWA 6ADHA 4PSAA 4K46A 2C9YA 2C42A 2J9XB 2LTAA 3FJ1A 3DDOA 5JADA 1HY3A 1N2OA 1DCMA 2Q21A 5BMOA 3SQDA 3MGBA 4C06A 2XYHA 1DEKA 1RLTA 3ZIDA 4RVHA 4KR3A 2Z6AA 2CHGA 1XPJA 5FJJA 1DEXA 4LF5H 3MIIA 3GRRA 1CC1S 2Q5FA 4P36A 1IMOA 4K0KB 2YUIA 2QQEA 3KSAC 4MWTA 5GQSA 4Q00A 3TY5A 2R8HA 1B6SA 5G1PA 3IVGA 1JPJA 1QYWA 1E69A 5FLEX 4V0SA 1L8XA 1QCDA 4FKZA 4P5EA 2GK7A 3P2MA 4YT4A 4P0PB 3ZDAA 2P68A 2I6QA 2V3VA 4PFSA 3HB0A 2JLYA 2AKAB 1OXXK 4F38A 1RFGE 1B0PA 2X86A 2WYOA 5IARA 3AC0A 1XU4A 3VX3A 3URMA 2W6CX 5TEVA 5K0LA 2PWPA 1CVRA 3UUWA 2JBHA 4L2IA 1IRXA 5IJZA 1VE5A 2FEXA 3LYUA 1E7RA 1OWMA 1N5LA 3GGJA 2XF2A 1VJDA 5FJ8G 2V8OA 3BMCB 1I2AA 2QR3A 2OORA 4M0KA 4WLVA 4NDZA 1RACA 5A04A 3RGXA 4ZC1A 2WB1E 1XMPA 2VBCA 5CT9A 1VDMA 2BOVA 3C1UA 3LHDA 1NBHA 1RXUA 2VXYA 2FPUA 4X9XA 4EOGA 1DRKA 1WA5A 1XCOA 3ZWAA 3B38A 1QMGA 4KOAA 1S96A 5HKOA 4FILA 1PT7A 2YVKA 4J0KA 2O03A 4D9JA 3FWKA 1DC5A 4NFHA 4N6OA 4TKLA 2WT4A 2ZR8A 3OOJA 1SC6A 3LTEA 5HRUA 5H70A 2VI5A 4BX2A 3AJ8A 1GU1A 3UJBA 4KOEC 4A3IG 3FCCA 3ICQB 3O6VA 2R6HA 3I01A 2R6ZA 1MIOB 2C4WA 2HHCA 4UU0A 3MBIA 3P94A 3QE9Y 4HRXA 3C4JA 5KYWB 3I9JA 3TCKA 5JTTA 4R7GA 1ZHOA 4HVLA 4EJSB 4OP1A 4NESA 4DCUA 5CFQA 1KS2A 5DTMA 5CA1A 2V4QA 5FL3A 4PDBA 1Z5GA 4TXMA 1PZEA 4Z4HA 3HKZA 3OX2A 1YRYE 2WJAA 1U0TA 3OI7A 4TWZA 5D2CA 3OIUA 1PFGA 4UHHA 2WG1A 3HHPA 2BDEA 5EWJA 4J7UA 4Y6RA 4CNQA 3RU9A 2HZ7A 1MRZA 3F5QA 1QHFA 1BHSA 3PR1A 4JLNA 1X1AA 4YCBA 1TJYA 5I4BA 2E3JA 4RIGA 4ZCLA 3ROMA 1FJHA 5EJ8A 4FWTA 5CNJA 1M3SA 4ZK2A 4U5QA 4WOPA 5DRYA 5BN3A 3EPHA 1WUHS 1OX4B 4M8LA 1M0EA 1G8PA 1NC3A 3VHXB 2YW2A 1AM4D 4OUDB 3DTGA 3O31A 2XLCA 4YAUA 2XWQA 4XZ3A 4MWZA 2ZWAA 4XYGA 5AI9A 1HLPA 3GLHB 5EAIA 2ODTX 4DR5B 1GDHA 2A5FA 2W90A 1VB3A 3RWOA 1KSHA 1Z2AA 2JAUA 2PG3A 1M1NB 4S04A 3KLOA 4NXMB 3B6EA 2VKQA 2R48A 3PXGA 4G1BA 3D1LA 2PUDA 2P4HX 3RREA 2HCFA 1K63A 3F6EX 1EDZA 3NHMA 1T5OA 5IH7A 4OUKX 4YJFB 5C8YF 3A9RA 1R16A 2G08A 4G0WA 2IGBA 4PC1A 3M6XA 4ZPJA 1I01A 1FPQA 3DV0B 1KSGA 5UKDA 3WWCA 5B4TA 1NNEA 2IIVA 3WWZA 2R1UA 2TECE 2AX4A 2IV7A 1TO6A 3GJYA 1Q1QA 3RT9A 3TLXA 2R7MA 1JFSA 4XVUA 5DE3A 1NF3A 1XZNA 3QE0A 5LBIA 3CQ9A 2OXEA 4GZ3A 2YZKA 2J0UA 2ZVDA 2FPGA 4CKWA 2OORC 4P08A 5DHFA 2C3OA 2FF5A 4A3BG 4BYMA 4TLLB 3CH7A 2FR8C 3NEPX 4EFLA 3DS8A 4GD3Q 2VOJA 2O8FA 4EI8A 3O8NA 1GGJA 1FLNA 3A3KA 5L3SA 1NSYA 3V8MA 2C4NA 3F9RA 3FKQA 3PNPA 4J0CA 4YT8A 3C97A 3QU2A 2AUNA 3UAOA 1NI4B 4BBRG 3GIQA 4OEHA 1SVUA 1PKEA 4Q3EA 1TAHA 4TQAA 2WJIA 3K1TA 4GOXA 1WQ3A 4WY5A 4JBGA 4AI6A 4QOFA 1V11A 2IEIA 2IZ0A 4K81B 1F0KA 2JA6A 5A3RA 5A4AA 3G7NA 1LD3A 1K9VF 3ER9A 3CRZA 3K92A 1NDHA 3T1TA 4KO4S 1BROA 5CTJA 1OTXA 3QSGA 3L7NA 2QE7A 1ZJ5A 4YRCA 2JA8G 5JAOA 4H18A 4LQ4A 4X92A 4D81A 3KKEA 1DJOA 5DBOA 2I87A 1IZZA 4NXMH 1M2HA 1WOYA 1IDN1 1X0VA 4OXQA 2H3HA 1W0JD 2YIMA 1T0PA 4AWAA 4JAVC 3WMRA 4KR9A 3ZGYA 2WJWA 3DJFA 1XMJA 4UE2A 1XAGA 2ZAIA 4WEQA 7MDHA 1T8PA 3P1JA 1P0FA 3COVA 2RBGA 2B1QA 5DLQC 4XH9B 4YP5A 2QM3A 1XPRA 4OBBA 1QWOA 2IYVA 1NMZA 2JIDA 5FWAA 1HEUA 1MBZA 1BJTA 4PPQA 2NV6A 1M2NA 1E3LA 4ZVRA 4PSCA 4MJ3A 5KFGA 5C53B 4BV9A 4ZKEA 5F51A 2J6HA 4YGXB 3KQWA 1JR3D 1MAWA 3X1XA 4LJAA 5KNBA 2JDIA 5TS2A 4EHBA 1Y3AA 1HDYA 4RUAA 2OK8A 2P6MA 5BOSB 4JLWA 5DQHA 3FHCB 2PD6A 4R40A 1XNGA 1ZI6A 1JQ3A 1G8SA 3SDZA 3DTFA 3PFCA 3MXTA 3ETGA 3KZ1E 4BE9A 1L3BA 3VPBA 3S2IA 5KFEA 2GBFA 1ML3A 1J8YF 1PCXA 4GI3A 2CHQA 1OXKB 2R65A 2MCFA 3IKJA 1F8UA 5LP6F 1HNXH 1F0YA 3ACDA 3HP1A 4NMWA 3FYTA 3TZLA 3PC8A 4A0HA 1MXFA 4XQEA 3LUBA 3NM4A 2DHCA 2QX4A 3OPMA 4BY9E 2P0EA 5EQFA 3T5GA 4PANA 3SSNA 4IXWA 2H2HA 3HKCB 1VSVA 2REXB 1CP3A 4ITRC 4ZGGA 2PX3A 1T9AA 3EY4A 2VF5X 3G59A 2GUWA 3G8YA 4UC0A 1BKYA 5CJJA 1MV5A 5FDFA 2ZDGA 3EVAA 1LW7A 2Q5CA 5DBEX 5IN5A 1Y82A 1DXOA 3LX4A 4I46A 1L5YA 5LB4A 2JAQA 2ZK7A 3MQ4A 1UIRA 4BHTA 5CEJA 3RGZA 3ZCUA 4WLNA 1G63A 3UKDA 3BREA 2OWDA 4G0VA 2Q4BA 4K9QA 4KZPA 3CGGA 3TI9A 3CR7A 1O4VA 1QIHA 3NGLA 2HG8A 1L9XA 4GICA 2FWRA 1MO3A 3CG4A 4ER5A 3KJZA 2YXEA 4Q3CA 4B3RB 1EX6A 1UR5A 3C43A 2JH3A 4YCNA 5DVZA 3ZEAA 1MN6A 2FSFA 4PZ9A 1WCIB 2VPSA 5BNFA 5DXJA 1L5LA 3PHBE 4RZXA 4ECEA 3ET4A 1QIJA 5AQ1A 3AUYA 2ZYHA 3VHQA 3WZ2A 3NYRA 3PB3A 3TUJC 3SFZA 2Q4DA 1NXOA 2QD3A 3PJRA 3VAYA 2NUTB 1RXVA 1XCBA 4R5MA 3S6JA 1Q50A 1ZIPA 4TLEA 1Y1RA 2Z6QA 2FE4A 2OPHA 4MRNA 2WTEA 2FZLA 1BU8A 2IUFA 3RSLA 1D2HA 3OY7A 2WICA 5JCXA 3E7FA 3ZIAA 4W6QA 1LBEA 3OCXA 1F4PA 4MDEA 2XNDD 3BIFA 4YR0A 1EFVB 3H3VH 2BLLA 2VH2A 5AW3A 2OAQ1 1E77A 5BQPA 4Q8EA 1NQOA 5EJAA 2XNSA 4Y1RB 3FUTA 2YKGA 1VHTA 5LOVA 1LRKA 3S5UA 1X7DA 3N76A 1KIMA 4LSAA 1T25A 4M9ZA 3SYMA 2I8AA 2NWQA 5IMBA 3NBYC 3ICOA 3I5XA 1DGQA 4YRMA 1GPNA 3E5HA 4Z1OA 3RUHA 2YV3A 4BVGA 1GG8A 3GFQA 3KKMA 3RSZA 3H2YA 5KTMA 4QW9A 5ERXA 2N75A 5CURA 5C7YA 1V5FA 5EIXA 2PEZA 4LOJA 3DDHA 5CH8A 4Z5XA 3FNHA 3C1TA 3KR1A 5AVQA 4LE0A 4B3RH 1E9VA 4QA9A 3ITKA 4C5BA 3FUVA 4AG5A 4CR8A 1F12A 3K70D 4F4IA 1E4EB 1R50A 5L3VA 5CMLA 4LSGA 3KKQA 4BAZA 1QDEA 5FBZA 4YY3B 2FVXA 2F8TA 1USVA 2X9QA 3QF7A 3BGVA 1CNMA 1MJGA 4B6RA 1VMKA 3TQQA 3RK4A 5A62A 1QC5B 3H20A 5MDHA 1E1LA 1V7PC 3O2JA 2QVBA 2E5FA 4F4FA 2Q27A 2NTYC 3ZY5A 2ZT5A 3UOAB 4ZK6A 2C0QA 4WX2B 3OP1A 1UBOS 3SIPA 2B1RA 4UOEA 2IIPA 1QDUA 2EAUA 4LZOA 3MA0A 3MAJA 2NM0A 3ETCA 1W5AA 3L8HA 2DECA 3O74A 1UKVY 1XWWA 1WPXA 1ARZA 4FMDF 1UQRA 4G07A 5KVQA 1TT5A 2ZUFA 1UDCA 4FMBB 1VI5A 3OAAA 5E0OA 2PRSA 4M87A 1W581 1VKJA 1KVUA 1K4YA 1ODLA 4KNWA 4YAKB 4O08A 3QEMA 4UCTA 1Z9BA 4R31A 1O8BA 2VJQA 4TM8A 3CRNA 3DVAA 2JZCA 1E2BA 1FU7A 2XUJA 5EZ6B 1U81A 2Q0SA 4TTJA 4AJ1A 2H7VA 2HREA 4OVKA 1FRZA 2Z6VA 1VXRA 2I2AA 1Y5MA 4ZANA 1ZUNB 1FKAH 1IZ8A 1G5IA 1DC7A 5CT4A 4R7TA 1EVJA 5C5EA 3AVXA 5DAAA 3FPSA 4R4JA 1EGQA 2XXBA 2JGDA 2JJ2D 2SKCA 1UPTA 4BVHA 4KO8A 1C50A 1T9HA 1Q6ZA 4RVOA 1IHOA 4TXJA 4MRPA 1EP2B 1AVTA 4HP8A 4LZLA 1LQ2A 4CIAA 1UT8A 3EUFA 1HSZA 3ISJA 4BWYA 4IEEA 2OV2A 4IJKA 1JJFA 2VATA 1FYDA 2X6RA 4B6GA 3FOAA 2QRMA 4YY3H 5IKOA 1IDOA 5JSQA 3VVLA 3VJKA 3JQGA 2P6PA 4B76A 5SY4A 4PBTA 4RTJA 2YNMC 2ZTLA 1VRVA 2FPPB 2PMFA 5D3MA 2FPSA 3GYBA 3HJAA 4AAYA 2IY8A 1SZJG 1B3RA 4ZV9A 1QU2A 3N87A 1CY2A 1FVOA 4HQLA 4X90A 2XXAB 4N01A 2CKZB 3DKRA 2H59A 1CW2B 1FYEA 2ZPUA 3AR8A 1X9HA 2IA6A 1GA1A 2WHEA 3IEMA 2BEJA 5JAQA 1N6PA 2AOUA 1XGKA 1V2GA 1I3KA 3EAGA 3MFYA 1EKVA 3SE0A 1DX4A 3AF6A 4LRQA 1QK4A 4AZ0A 1XQWA 2OLSA 2GUGA 5L9AA 3L0SA 4DL9A 2Y99A 5FR9A 3ESQA 3IJ5A 5K8UA 1QRSA 1XZPA 2CBZA 2E4ZA 1G7TA 4ZI7A 2HAEA 4DHEA 3WWEA 4YALA 1DC8A 5ADHA 4UHDA 2Q1YA 1WZ2A 4RE5A 5IUNC 2HSGA 2GN4A 2GM9A 4N6GA 3BAFA 3BL8A 3PWTA 1VLQA 3PQFA 4B3JA 4U7JA 1P7PA 3OPYB 3GLGA 4DDVA 1Y8CA 3MT0A 4E1AA 4E2YA 3DHYA 1BWSA 1KP9A 2LDXA 5K0GA 3DWIA 1FMLA 1QVZA 3G6KA 2AMVA 2IEZA 3F6CA 3WGUA 3UMFA 1N2HA 4BNMA 4L57A 3LY7A 4F6RA 3R5HA 5DLGA 2E6UX 1JMKC 1NM5A 4M9QA 3K8ZA 2FN3A 2JFHA 1Z5NA 2NO6A 2FLKA 2IX9A 2H2AA 2PV0A 3R75A 4Z6KA 2PUHA 2G72A 4I1VA 2VT2A 2XTZA 4DF3A 1WSCA 2X0SA 5HILA 4DARA 5KFNA 4HB4A 4RKQA 4OIFA 4KQFA 4OKNA 4U2EA 4DCOA 4GE0A 3WLRA 4MCHA 4XM0A 2EQAA 4YCAA 1NU6A 4B4WA 3AIMA 3WBKA 2ZDQA 3G88A 3MILA 3TZQA 3AESB 4MVCA 3F8TA 2PUCA 1OZHA 2O2GA 1VJRA 2QN9A 4D0NA 2VJMA 4DIDA 1L5MA 1N2JA 2AFHA 3WQRA 5IP5A 3DKKA 3ESZA 3U56A 3QMWA 4A92A 5E3HA 1N7GA 2WV7A 3CTPA 3ZW9A 2HR1A 1XLVA 5CNIA 3C3XA 3BIOA 3SWWA 3A1UA 2BJVA 4ED2A 1XAIA 2DH5A 1H8HA 4JQCA 1E20A 3G8BA 1QORA 6ABPA 4MV3A 2XWJI 1P5HA 2H1FA 1KZ9A 1MOZA 4ZYZA 2HIHA 4ME6A 3KSUA 5FFNA 4YUAA 1CKOA 1QAMA 1XL1A 2C7BA 2A5GA 2EGHA 2VDRB 3HGQA 2C58A 1NBEA 4JLBA 5TPZA 4H1VA 1H85A 3TLJA 3LG2A 1IONA 1N2EA 1WQ1R 1H2WA 2BELA 1X1QA 4AKTA 3TVTA 3SF8A 4Y6OA 1SMKA 4R9UC 1L8AA 3FH0A 3EC1A 1DUIA 3FMVA 5CAEB 1II0A 3TL6A 5H83A 4BIMA 1MC8A 3R5XA 4G5GA 4IUBS 1JHDA 1HE3A 1O97D 3UOGA 2MOKA 1WO8A 2O7SA 5T4FA 1ITZA 4L95C 2ALJA 3SC3A 2P9BA 4IBOA 2XOXA 4BYGA 2ZSBA 3W7BA 5IJ9A 4G3XA 1UL1X 2OUIA 3MWEA 1NHGA 5KWIA 3SQXA 4KR0A 2RC5A 3TR0A 2PTGA 3DP9A 2I6TA 3CNHA 5JYCA 4P2GA 2IYQA 3PD1A 2FN7A 2VYVA 2CMKA 5EESA 1QKJA 2ZJ8A 3NNDA 4FSXA 1HL7A 4Q47A 2MINA 4YQEA 1HG0A 5J2UF 4LN1A 3T41A 3QBVA 3HA5A 2HMWA 4BEVA 3VOAA 2ZYVX 3ENWA 1E59A 4L27A 4R2KA 4RZQA 4F4HA 2Q3DA 2YOHA 4A10A 4CFZA 3FHLA 1FYFA 5LUBA 1SVNA 3AL2A 5BV0A 5J4VA 3GLFA 2FWIA 3ZE9A 5LZ4A 3W9UA 2P6UA 1YR1A 2CDCA 4LKRA 5EJEA 3RRBA 1I0ZA 1Q91A 1SCAA 1SHKA 3O84A 2XQKA 3DPIA 5TMPA 5BVGB 1YZUA 3PXEA 1GXSB 4L4SA 3T35A 1KT8A 2PANA 5MFPA 1NF9A 1UBGA 1W1UA 5BSRA 4EB0A 1IE3A 1GOTA 3ZHSA 1RJDA 2ISQA 4HAXA 2ZRMA 2AGPA 2H3EA 1XQXA 1CJSA 3KWMA 4F3NA 2VP5A 3UMBA 1SB8A 2CE7A 4GIBA 4DRZA 2GO7A 2XVYA 3QVSA 3KDSE 5KVSA 1VB5A 1P39A 2DVMA 4QJIA 3EDYA 1AMUA 5KG4A 3J81A 2P6OA 3WK4A 2YJZA 3LP5A 3M89A 1QVWA 2ZB4A 3MBKA 1J5EB 1UFVA 4D4IA 3NPMA 1MJFA 2EDAA 5I8PA 2RHHA 4HUTA 2JIQA 5JCZA 1ST2A 4HSEA 2VN8A 3TS1A 3D64A 3ITDA 4TS3A 3DAYA 1T9GS 1G20A 1Y9DA 3TZBA 1DIBA 2F4VB 1NVGA 4G63A 3SGIA 3R7LA 1JA0A 3F4BA 1RDFA 2WQZA 5REQA 4GPAA 1MG0A 5GV8A 1Y7LA 1IVYA 4IXDA 4LEIA 1UZAA 3F5FA 3F2IA 1PJQA 1RMYA 3SX4A 5CR5A 1KEWA 3KC2A 1WNTA 2BBSA 3H18A 2XIJA 3MTQA 3WHKA 6REQA 3E9MA 4AG3A 1SBHA 4XWYA 3MIZA 5FXMA 1E2MA 5IXYA 3QEJA 3EIHA 1B7GO 2FHSA 2GZDA 1S3SA 1E6LA 1PFYA 4JU8A 2OEPA 2ZR0A 4R98A 3OCUA 2I1QA 2HU7A 1TO1E 2XGMA 4PAWA 1T34A 4TM5A 5DLEA 4J9LA 1DJPA 4DDKA 2OBXA 5IW8A 2W2LD 4GOJA 3AF0A 5LYYA 1GEGA 4BVFA 2GFHA 4A73A 4WK4B 4RHXA 4IJUA 4V0ME 1OTHA 4TM7A 5L4SA 4DL3A 4FFNA 2D2VA 4BX3A 3ETDA 4JKYA 2F00A 2PO7A 1JLLB 4QDUA 2WVGA 4BMNA 5D51S 1KAEA 3OZWA 2VBFA 5EYPB 2ZYAA 4L7QA 3SK0A 2BN4A 1GPYA 1A4RA 2IPLA 5AUQA 5IYZB 1MQ9A 3PWKA 1F60A 5DHSA 7ADHA 2XJ9A 1UBFA 4ZYWA 1PNQA 3KX2A 1CLUA 4C14A 4LXQA 2JEIA 4BUZA 3G8AA 1RSZA 3TDNA 4E5VA 1B04A 2ZGVA 4MA5A 4P3PA 3C39A 3KPUA 4LGVA 3SSAA 3IXQA 1TU0A 5DGHA 3D3EA 3OX3A 4TT3A 1S9FA 2HJSA 3PHCA 4AQYB 4GT1A 3CNNA 1XFDA 2E4WA 5BMVA 1IWBB 2YUTA 2JASA 3HO1A 2YYAA 5KNDD 2YIVX 4INPA 3T7DA 1KHHA 3QA3E 1RC0A 1B8UA 2VTBA 4AY3A 1UBEA 3WZMA 1WZCA 5FEMA 4YP0A 4JI0H 2NO5A 1KF0A 4XD2A 3IVRA 1EMDA 5KYYB 3LL4A 1PGQA 2VDQB 3S4YA 3RV3A 2R7ZA 4ZHQF 5ICCA 5DHQA 2CD7A 3T7KA 3CRW1 2R9VA 3KJIA 3HJNA 3GFSA 5IJXA 1FP2A 3IKLA 2AK2A 3BA8A 2VZ0A 4EPVA 2DU8A 4J43A 3WLLA 1XAHA 1DAKA 1P1RA 4B5KA 4D4MA 5B55A 2CW5A 2VP0A 3AP1A 3Q3IA 1PT9A 4Q0MA 5DNYB 4LZWA 4F92B 4GKBA 2Y8EA 1YC5A 4MPDA 3BWXA 3KU4A 2IEDA 3HH8A 1WB9A 4B4KA 2J9YB 1NQTA 4D41A 4URHA 2VUTA 2LVBA 4TLCA 5C1PA 1SBIA 1G2WA 3KKKA 3HKDA 3HLKA 3EXEA 4N3NA 4WK6A 2FGJA 1RR6A 1CUXA 3BRWA 2ZVQX 3WDMA 4MQ4A 1KVRA 1CV2A 3ER6A 1E2IA 4UZSA 1A9XB 4MUEA 3EEFA 4YV1A 1W2GA 2JATA 2AI2A 2CF5A 1Z4OA 4YBZA 1BE6A 5F4ZA 2Q9BA 4B3GA 1K5DA 2B3TA 2Y1DA 3F5MA 5KOHA 5DCWA 5FQNA 4C0SA 1ESMA 3NVDA 2JJ1A 4W5WA 1CJVC 2QPOA 3IP7A 1XRPA 5GGXA 2H17A 5JJBA 2Q3LA 2FW7A 1JXOA 3L8MA 4KHPB 1IOLA 3THOA 1H1TA 4E0BA 2IH5A 4GVPA 2IDJA 3O8QB 3FPBA 4UVEA 3PGA1 2EFJA 1BKDR 4E1BA 2F3UA 2GPWA 2AR7A 4P3OA 5HNEA 3BJYA 5JEDA 2QD4A 1YKSA 3RYHA 3QG5A 1OFGA 2QIPA 1P2FA 4DY6A 4BNDA 2HQOA 1Y6GA 1W6RA 3MTAA 2W4QA 5BVHB 4EYQA 1NDUA 3HXPA 1B0AA 3GX1A 2GJAA 2PX5A 4A8TA 1MO6A 1GRQA 4PYLA 4R6WA 5CIWA 4Q16A 2AZDA 1BAPA 5F7JA 5HKAA 1ZVVA 5GINE 2CC2A 3DMTA 2P35A 3SU8A 4NV3A 1CIJA 2GAAA 1M5UA 1Z35A 3RE1A 3FBWA 3OIFA 3W7VA 3RJ9A 4PLHA 1E0AA 3D6VA 4DIKA 2RH8A 1TQDA 4JR0A 2NUBA 3CVXA 4WJZA 4XOIA 1O96A 1RXCA 2HA7A 3M9MB 5ALUA 2B7BA 1SUCA 3QF4B 3HBMA 1TAGA 3F1KA 4RV4A 1A8HA 2YIJA 4ZMBA 4FQ7A 1FRFS 4P3NA 3FWPA 1K7YA 2XDAA 1JH8A 2QD2A 1FX0A 2YV1A 2VWHA 2FX5A 3J7AC 4R1OA 4BFSA 5A6SA 4XRRA 1UWCA 1XMSA 1QGAA 5BQ3A 1HDIA 3QNWA 4OHWA 3L7JA 4JV2A 5LJLA 2UZIR 1AHNA 4KIUA 4BEBA 2BSXA 1IY9A 3N74A 2RCYA 221PA 4YRIA 4N3GA 1MD9A 4Q7JB 5JQGB 3Q3JB 2X9VA 2WK1A 2OSBA 1I1OA 3TVDA 5BWMA 1SUAA 2NZUG 3VZQA 4KHPH 1KZYC 1XEAA 2WM2A 4C7BA 4XX0A 3G2OA 2OUKA 3CLRD 4QU9A 5LZ9A 1M2GA 1UQUA 3HEMA 1B8VA 1OQAA 4IRDA 1XQVA 3BRSA 3LPNA 1P5FA 2G63A 3RTDA 3CLSC 4EKIA 2ZJ4A 5KOJA 4TX1A 1TC1A 3ZV3A 3T3IA 3DOIA 2WF7A 5EE9A 2ADOA 2E89A 1P9WA 3TTXA 1CNFA 3PQ3A 4ENQA 1MO5A 5I8WA 5EXTA 1C1HA 3HYSA 4S35A 2VPZA 3F6PA 5H9VA 3EZFA 1UK8A 5CEFA 4ZOLB 5B7PA 4LYGA 3D6TB 1IMJA 3BB4A 2WJZB 4BEWA 3PXCX 4DIUA 2XUQA 3TNDA 1OFIA 2V7BA 2Y68A 2XYQA 3IV9A 3A2LA 4N49A 1ECLA 2ZTSA 1OSNA 2OYCA 3JYLA 3CO5A 4AMYA 1SYXB 1N8NA 4Y2SA 4R41A 3DFZA 5D1OA 1WCYA 2P65A 2WSSA 2Z5LA 2PLWA 1V95A 5KIAA 3W8RA 5HFJA 3Q5GA 2X23A 1E5VA 3D4PA 3WYNA 1WX1A 4UNRA 2CJXA 3PNMA 1C0LA 5KG2A 5JMOA 2H5EA 3GFOA 3S1AA 3HXLA 1AMNA 2CLSA 5J9FA 4C21A 3D8TA 2CXPA 3IRVA 1CVIA 5DJ5A 3TDKA 5HKBA 1USIA 1OJLA 4FGLA 1L7MA 4N65A 5JAZA 3SE7A 4XJSA 5IBRA 1TQ8A 5AKEA 1H5UA 2Z30A 3DMTC 5DGBA 4IICA 1F7VA 4B5LA 3WLHA 3DHEA 3D3KA 5LVAA 1V51A 5HIIA 3U3OA 3HM9A 2G6BA 3L1IA 1CIVA 3TK1A 3OZSA 3KZNA 1GFZA 3VR1A 1MB4A 3L7OA 3HKZE 3D0QA 4HC4A 2CNVA 3E3MA 2R82A 1ZAUA 3HFGA 4KR6A 1FEZA 2YWHA 5KFKA 4Z9BA 3SJ7A 5M29A 3MWKA 3VR6A 2AKYA 2VTVA 2P9CA 3TW8A 3V6MA 3O73A 4G0UA 3PCXA 1LGYA 1A72A 3SIWA 3GT4A 3TE6A 4DL4A 3QUBA 3F1LA 3TMYA 5HFAA 2B94A 4EJ6A 1J97A 4CTMA 4UU8A 1UKAA 2LXNA 1G4AE 1RI4A 4Z0PA 3E9ZA 1GQFA 2YZLA 2BFEB 1X77A 5F9MA 2G9QA 4EHLA 5EHZA 1I6UA 4FFBA 4K9RA 3D7LA 4GR9A 4R8MA 2DG2A 1RBYA 1HDOA 4RNMA 2OM6A 3U4AA 4D0SA 3KHKA 4CV2A 4FLEA 4O4IA 2ZWMA 2PXAA 2Y1GA 5H59A 4BDTA 2PTHA 5A3SA 5CBPB 3X1KA 3W2HA 2RKWA 1Q83A 4XVCA 3NTLA 3H0EA 3W6ZA 3GTKA 5MF6A 5ECYA 5IEJA 3ZZTA 1GCAA 1UXOA 2A0XA 2EZ8A 2EQ5A 2Z9BA 1RM5A 3S3TA 3H40A 4JB2A 5ICGA 4KIWA 1TNDA 2FMUA 2WFZA 4R1UA 4D99A 3QG1A 3HOZG 1ZJ4A 5EWGA 4DLBA 3A7DA 4DOMA 4IDQA 1DINA 3F46A 1E6MA 3N0WA 1P5RA 3SPXA 3BSFA 1PE0A 2QRVA 3FKSA 4Q1VA 3TY9A 4I1UA 1VBMA 2OP1A 4B3HA 2UVWA 1ZL2A 4MIKA 4DUYB 3OZGA 3KETA 3TTSA 2JFPA 2NU6B 3D81A 4CQLB 1WJGA 3F4LA 4FD3A 2RCNA 1L1EA 4OATA 5HF8A 1XCJA 4PZCA 3ICWA 3MJRA 7GPBA 4XQGA 3BMOA 3M6FA 2IVZA 2PMEA 3ASVA 3UN1A 1OVMA 2QRLA 5FL7D 4MCAA 4K0RA 3SEZA 4M86A 3LOPA 2K2QB 3UGKA 1F0NA 1Y8QA 2FR8A 5TE9A 2AXQA 3BQ2A 2HDKA 4MYRA 1MW8X 2VRWA 2B8NA 4Q9LA 2DOKA 2A9RA 5DTEA 3HVIA 3ZWVA 3T9EA 4JJGA 1RQ2A 1CJCA 3A9SA 3H8SA 1KTIA 4IWYA 4Z4GA 3SHVA 5A9SB 1ZEJA 3PEVA 2EERA 1GUZA 3MC1A 4UMDA 1D4ZA 2V7WA 2Z3ZA 4K9SA 1PR5A 3GRPA 1DDGA 4W4TA 1ZPDA 4JJAA 5EWLB 5CHEA 5D84A 4TN1A 3NUGA 4FI3F 1WUKS 3NANA 1G8HA 2GHTA 4B40A 3FYSA 3MG9A 3AR6A 3PGLA 4FCVA 2P4UA 2IA5A 2EL9A 4EHDA 1XKXA 4N76A 2IIBA 3E9RA 5CVCA 4BN4A 4N39A 3P9ZA 2VDUE 4A0RA 1KMIY 3G89A 5HSGA 3ORRA 1IY1A 1GVHA 2YHSA 4YJGA 2ALZA 2PJRA 4K0KH 4MUHA 3S28A 5GJWC 3JAMA 4KQCA 3ETNA 2XUOA 3HC7A 2ACEA 3WDLA 3KEMA 3IUSA 3A1TA 4TL8A 2X4LA 1E2NA 3EIFA 5G53C 3FB1A 2JGIA 3HV2A 2XZLA 1KYIA 1GZ4A 4FYKA 1P2SA 1JKXA 2ZEJA 3LDAA 4A3GG 1HETA 4K6MA 4UUOA 1IBCA 5IBCA 1CERA 5HQJA 4KWHA 4KC0A 3ZHBA 4DUYH 4E5MA 4RY0A 4ALLA 3AEUA 5EERA 1TF2A 5AJZA 1UF9A 5BW4A 4RQAA 5FH9A 4MDHA 1R0CA 3GVPA 1IJKA 2P8JA 1THTA 1AKNA 1JYFA 3IVCA 5C3MA 4PLWA 2GZ3A 5KC8A 3OAAD 2ZLBA 3V8EA 1VKNA 3VPDA 2Y1CA 4MGHA 3U39A 5B7NA 5B4UA 5KU7A 4C0QC 1U0LA 5EE5B 3Q72A 1N8KA 5E6SA 1N9KA 5G0VA 4FGJA 4DKJA 3VR4D 5JMPA 4PS0A 2A0UA 3F47A 2VQDA 2JA1A 1ANKA 2Q49A 1A9SA 4HS4A 2X42A 2BPOA 1ZZGA 3T1HB 1LC3A 5TEWA 3SR0A 1VBGA 3HV0A 1AUVA 4LW8A 1M8PA 1ZJJA 1N25A 3NBAA 1VKOA 2CJFA 5FRDA 1M6WA 2ZE5A 2JEFA 3EZ9A 2GJKA 1MNQA 1KGSA 3K9GA 2H00A 3A9VA 3UBMA 2VNSA 1H8EA 3PPIA 1JIQA 4MWSA 5KHOC 4CGZA 1T36B 1DDOA 1LX6A 4ZU3A 2BW0A 1XCPA 2ZRNA 5CTAA 2FEMA 1CDEA 2WWRA 2D5BA 1ZOOA 5DHRA 4MZDA 2O06A 2DWCA 2NVUB 5GONA 5C5IA 4TS4A 4CV3A 5HOEA 3OQMA 3K0BA 1N4DA 3SQOA 3F7MA 1XTTA 1TYDE 4E07A 3EXFB 4OXRA 2ACKA 4M6WA 1YHYA 2I34A 5LDDC 3EJ6A 4D82A 4H15A 1T2DA 4BEJA 4M3NA 4PIMA 3WK9A 3BDAA 4BBAA 1DEHA 2PWBA 4LY6A 3S68A 2PKCA 3GJ7A 4ECUA 4XUCA 4WNIA 3MN1A 4PICA 5J47A 4J3FA 2L42A 2R7LA 1VHQA 3FPHA 3R3UA 1IVSA 4MV1A 3HCRA 1JIVA 2R8XA 4G0NA 3LPAA 2EX0A 3M6LA 5IWAB 3GJ8A 4BNKA 4D02A 4QEKA 2XQFA 5E9WA 4D5GA 3KWFA 3DE1X 4NZ9A 1TU4A 2JGFA 4TXLA 1KC7A 5CG1A 1QYCA 1U1FA 4D9IA 4DR5H 4BV3A 2EP5A 1P18A 1IBMB 2V58A 5LXTA 3HNRA 1E1RA 4ZAGA 4YJHA 3OZVA 1KEPA 4AS2A 4MW5A 4LCBA 2ZT8A 5A5DA 1ZLXA 4MQUA 2G76A 1P74A 4ACBA 3VQTA 3W90A 3OLVA 2XKKA 1QQ5A 5SYAA 4UUBA 2ZJFA 4G0OA 4EKYA 5EXEA 3BMXA 2CLIB 4C01A 2XGOA 1GNSA 2F9LA 3QPUA 1Y14B 1E2KA 1WLYA 3F6SA 4QQ8A 4CW7A 3N59A 4I4TB 4RMGA 4P93A 3QFCA 1QRDA 1W9MA 4QQFA 1P4GA 3CLTD 3GJXC 3EQ9A 2XW6A 3MINB 9ABPA 2I7TA 1CUHA 4DSOA 3QHQA 2QBYA 1YGYA 4YQWA 1L9KA 4A2CA 2GN8A 4MGIR 2VDWA 3QU5A 4Y8VA 3JD4A 2GKGA 3PX2A 4FDUA 1JNYA 1R27A 1JI0A 2AJDA 1CPYA 2CFOA 4KIGA 2EATA 4WIAA 2G5PA 1ZUIA 4EZEA 2HIAA 2Z2KA 4NONA 1YU6A 2ZAMA 2AOWA 2BTQB 4R1QA 3V2UA 4XYMA 5I7HA 2IU0A 3PR4A 5FOQA 3VSEA 3PTLA 1YAJA 5DW3A 2GXAA 2AMFA 2AC4A 5FPQA 2FAXA 1FSGA 4K5QA 1GTG1 3DMFA 4MS3A 4XCXA 4ID3A 1U7WA 1GT6A 4M8SA 1Y6RA 3RLFA 4RAYA 1UMDA 2PWZA 1MVNA 5EGSA 3UXHA 5KTNA 2SKDA 3L0DA 4JUBA 1K3FA 2GHQA 1H66A 1XDNA 1A82A 4RV5A 1IBMH 1DTWB 1R4MA 1VFNA 1BX1A 5MN5A 2BI7A 2G8NA 2YX1A 4MCIA 1ZL0A 3NDBB 4EARA 1C4XA 1GTMA 2P27A 1EINA 4C5AA 4JBHA 3A1DA 3UXMA 5DI3B 2FSIA 3LOUA 1X92A 3BE5A 2OXCA 1YQUA 2JRLA 3DL2A 3GDHA 1T6ZA 4QQKA 5FBQB 3ZK9A 4BGVA 1RWOA 3TJMA 4RKEA 4BUJA 2X8JA 3PQ4A 4BY7G 4KRXA 3QFFA 4HEQA 2QL9A 3UUEA 2Y76A 4WBNB 5LA6B 3MB5A 1XRQA 2C9BA 4Y18A 3SF0A 3HKBB 1HT2E 1K6IA 5I9MA 1N2SA 2OP0A 1LF0A 1SUWA 1SXJA 4JDPA 2RHCA 1R5OA 4KW7A 1KK1A 3IMCA 4HNHA 1UC9A 4D42A 3BCSA 2DFNA 1LI5A 5HE8A 3RTBA 4NE9A 5H68A 4U7WA 3EGDB 3KKLA 2QYZA 1U8AA 3ONWA 3ELYA 4W5HA 1SAYA 2ZJ0A 3NEAA 3R4CA 4K9PA 3A1VA 2W2QA 3TSWA 4W5NA 3ZWQA 4CGYA 1JPVA 2J59A 2Y05A 3GJ6A 1UJ4A 1XUOA 1N5IA 5DLDA 2R751 1ORTA 4MUGA 4PW0A 4YLYA 3V34A 3SSOA 3OO0A 2VVTA 1M2FA 1GL9B 3C8MA 4ZU6X 1GSIA 4XWTA 1JBQA 2H63A 3R9RA 3VC3A 3BH0A 1MFZA 1W5BA 4LAFA 5CXUA 1B74A 3SM9A 2XNHA 1R8JA 4QLOA 1XDGA 5GPBA 4NCJA 3W9SA 4CKCA 3BTVA 2ODNA 1N75A 1GEEA 1UPUA 1XZEA 2OOKA 4GI2A 4HVAA 4HX2A 3ZWDA 2ZR7A 3CCCA 4QUHA 1NASA 5LYJB 2GF2A 2C77A 3VHRA 2BH2A 2PWAA 4HQ6A 2QEQA 3OKPA 2LE0A 5AHXA 4K86A 1YCFA 5FPPA 1TIPA 4JC0A 1EGAA 1E1CA 4YRRA 4RA9B 4IUDS 4TYWA 1X7HA 3CNQS 4LUCA 2YNMA 1X7WB 3T3OA 4JIGA 3OBIA 1T5SA 2I71A 4N5LA 4I8XA 2GAFA 4U8GA 1KERA 3CSWA 1SIOA 5FD6A 5KSPA 4XPZA 3AKEA 1VTKA 3MTBA 3AONB 2HNAA 1Z7YA 2QQ5A 1JG3A 4JC4A 4UBMA 3DAHA 3E22A 1XVAA 2W6ID 1WHSA 1UM9A 5KHLB 4KPFC 5KX5B 1GQYA 5LSAA 2IHBA 2KLBA 1F2TA 2FUNB 3ABIA 3LSYA 4Q3OA 1DKOA 3DMRA 1FDOA 5FEUA 4KWCA 2F64A 3KVNA 3DKPA 4JLJA 3WJAA 2RGVA 3L6EA 4IAJA 5LP1A 3W1BA 1UOEA 3UB3A 4DG9A 1UDWA 1XNJA 2HF8A 2JAPA 4IQFA 4LHYA 2VDLB 1G2PA 3LMLA 1G2IA 3JWPA 3V97A 2XA9A 3C1AA 2W8LA 2P9HA 1NUPA 1Z5PA 2UVDA 2JCGA 2G9VA 1YR7A 1GAXA 5F1KA 2QUIA 3GLGE 1XJ5A 1G2QA 3VGPA 3N53A 4PLTA 3ZY3A 1NVFA 5IKMA 3CBGA 3Q3EA 3R41A 2GS9A 2ZRKA 1IXYA 4PNPA 3NR2A 1E18A 4K1LA 3ZZ1A 4NIMA 4NZYA 2QTFA 1B0UA 4Q21A 1MU0A 1SXJC 3PNKA 2JHGA 3A4TA 4JFRA 1OREA 3WSWA 1IHXA 4UUQA 2IV2X 3U55A 2Q4TA 1PJTA 2EEPA 1FRQA 2OV4A 3ZKWB 1F6BA 1VHLA 3FGPA 5JI2E 2CFCA 2WZQA 4QREA 4MTDA 3U3RA 4M0DA 3GVCA 1FLVA 4CMGA 4Q24A 2PLAA 2VSFA 3K9LA 4PYJA 4MO2A 1KI8A 4ZMRA 1QYDA 4UVGA 1E4FT 3OZFA 3E9DA 4S2EA 4NK5A 2H07A 4KQWA 4LWOA 2XMRA 5IP9G 2EDCA 4ND8B 5EGNA 1H6DA 3RIZA 2R5NA 2EFYA 1I14A 3ROQA 5I9BA 1X2BA 3ILSA 2AOTB 2BP7B 1FQOA 4MLCA 3WA6A 4TYMA 1S97A 3DZKA 2NQ2C 1ZD1A 3H16A 3UFBA 2ZJ6A 2F43B 1S10A 5CB6A 2VJYA 2LBPA 3JY6A 2F17A 4J76A 2FMXA 2AFHE 3KCQA 3Q1KA 2JIPA 3O7MA 5ILOA 3SHTA 1XD8A 5DGAA 4J0EA 3LV8A 2L19A 3H1AA 1UJCA 2Q9UA 4FQ8A 1ZCFA 1UKZA 4C78A 2F90A 2GJSA 4LI0A 5CM0A 2VUMG 4H3VA 2XCIA 2OD9A 1T3NA 4GC7A 4HBGA 1LU9A 1CJKC 4EM6A 4A3LG 2H1LA 2BGUA 4TV8F 4MCJA 3M0EA 1D2NA 421PA 1XU7A 2PGIA 3KELA 4UARA 5IASA 4IX1A 1TJ4A 1ORHA 2J3HA 4ZYTA 1OZ0A 2ZBVA 4TWJA 5CEEA 3AI7A 1KOLA 2WILA 5F5LA 1ESEA 3GROA 3UMYA 3B5JA 4EFKA 3Q8QB 2HHHB 1QIDA 2ATVA 1EGVB 4AF8A 1YB4A 2R6DA 1PYDA 2GD6A 4D5EA 2GCGA 5AHWA 3H1EA 1V41E 1WKBA 1EHIA 4MVJA 4JUDX 1G17A 5JZBA 2X15A 3GVHA 1E2QA 1WPRA 2QG4A 4LRUA 2PZBA 2NU7A 3S44A 3G9XA 1C4KA 4ZWNA 3BJZA 4IVRA 4EY4A 1PG2A 3HLYA 1U2SA 1PWHA 1XEXB 4DJJA 2HMTA 1PFVA 4J6EA 4K05A 5KFTA 1W5SA 3D4BA 3OSZA 5KFRA 3IUJA 3ADCA 3OM0A 1E9AA 3K2QA 4EBCA 3U0BA 4C76A 4DSZA 4H6XA 4WQMA 1DQYA 3IE1A 1GRCA 1W5EA 2A67A 5C18A 2CNKA 4X1KB 1WXIA 1RCUA 3UQZA 2A1HA 3T54A 2N1BA 1U3CA 1GARA 1MGPA 4RPIA 5FYDA 2V7TA 1RWVA 4YXWA 3JZ6A 1BS1A 5AOVA 4WXYB 5TT0A 2GNAA 3JQPA 2R5WA 3SDBA 5TGDA 1L7QA 3K9FC 5JE8A 1T2CA 3U5ZB 3A11A 1GZHB 3GLFE 4LOKA 5HX7A 1YQTA 4QT0A 5J5CA 2HTFA 2B1IA 1GYQA 3D4NA 3IAUA 3S7TA 1V35A 1O9HA 5JT1A 4MNTA 2JEGA 5DV9A 1ODIA 1XP8A 4I2NA 4TWBA 5DGCA 3O2NA 2HGWA 2I4NA 1GNTA 2CL0X 5EWMA 2ZJAA 4YAGA 2PRYA 2K5UA 2WPNA 5HF9A 4DABA 4UAGA 4BBPA 2BHSA 3Q8MA 5J2TA 4NABA 2BI8A 5GM1A 1F17A 3GK3A 2A1TR 2OOSA 3RYFA 1XZIA 1X1TA 3KXDA 5AI6A 1I2ZA 5E4FA 4LSXA 5EIOA 3MSCA 1PIWA 1W88A 3BERA 2PUAA 3UAXA 3NM6B 3LF2A 2H11A 1Z45A 4KGXA 4QM7A 3OC6A 4HEHA 2UZ1B 2D1FA 3L41A 4S1TA 3PEUA 3EGWA 4WNAA 5AVYA 1DB3A 3KUUA 3LVBA 4IHJB 1X86B 3I92A 1QZXA 1S03G 3DF9A 1RYNA 2C3YA 4RDIA 3SFTA 4JJEA 3DHVA 4OY3A 4AJKA 1OZGA 5ESRA 4HYEA 1UBJS 2VA2A 1TQ2A 2X7JA 4HUQA 3PNVA 4CQMA 1REQB 3DEAA 2Q0QA 1G20E 4GWKA 2FKNA 4RELA 1DRJA 1N5KA 4DZZA 3LKBA 3EMKA 1NULA 5IVDA 2A92A 4EFMA 3Q12A 1IJEA 4M0MA 5CH5A 2NVWA 3CF2A 4ECZA 4JNKA 2DZDA 4OAPA 1KRWA 1I2BA 3R0XA 4LJ7A 1TMYA 4MS1A 1WAMA 4WXRA 3SN6A 3GJQA 4G5QA 1RABA 3PGJA 1OE0A 4ARBA 1RLMA 2FMKA 3EMVA 5JVDB 2CUTA 3BGOS 3IXLA 3KZMA 5BRAA 3DYVA 3CZQA 2RAUA 3AHIA 1EVLA 4MP8A 1J09A 3ZBTA 4Y2HA 4LZNA 2XB4A 3KT0A 5F3WB 3N86A 3H5VA 3IAS6 2DC1A 4QDTA 5DOZA 1KQOA 3AOGA 4I0WB 3K0SA 5I9LA 2EKLA 4MZXA 4BB9A 4BAUA 2WFAA 4ESEA 1PGOA 3H2HA 3RKRA 3TKAA 1I2LA 4MAFA 3F8SA 1IULA 2ZIUB 4OQYA 3RTGA 3S29A 3BF7A 3KNZA 4A2AA 1SOUA 3RC7A 2HUPA 4TZ6A 1OBGA 1BNCA 4FFLA 1EVQA 3EEBA 1QP8A 3IIKA 2YHUA 1UC5B 1UUFA 2AWNA 3M4XA 1BVHA 3OJFA 2WJYA 1CDZA 1Y8ZA 1ZK0A 4CL3A 4AS1A 4D4JA 1DQZA 5BSEA 2CB0A 5BSTA 4GGPA 5JSYA 1GV1A 1L6IA 5EE3A 3G9TA 3H0KA 3PI6A 3P2OA 4S24A 3MOIA 5KYXB 3W5UA 3O9MA 1FTGA 1NFFA 3HZHA 5JSUA 1JDBC 821PA 4YRDA 1H4TA 2R0QC 5BV7A 2HWUA 2BD0A 1E1DA 1R12A 2CY0A 3RVDA 3VNAA 4UTNA 3SXPA 4IINA 2AG6A 4UW9A 3P27A 2HPHA 3TJZA 5JLJA 2BR5A 3AHHA 3QWBA 1SWWA 1Z6PA 3CISA 3U7RA 4KNYA 2P8SA 2NAFA 2GPJA 3S24A 1RI5A 1E6EA 1V43A 4BAGA 2V1XA 3MNFA 2JA5G 3KYHC 1DG9A 3TOSA 4W1RA 1WMEA 1XRLA 3A1WA 3LM8A 4OIMA 1G6Q1 2M2IA 3K4QA 3AERA 5U9CA 2C2EA 5HV6A 1DRWA 3JWIA 4V1CI 2BV3A 2DBYA 2Z09A 2GAIA 1JKFA 4JJFA 1P0CA 3IVMA 3TRJA 1T29A 4HQNA 4E6NA 2E85A 4YCCA 3Q7QA 1IPFA 4GOKA 3AMVA 5ALMA 4XLTA 4EUFA 4IY1A 2ZWIA 3R3JA 3PC7A 1YVRA 3IO3A 2QUHA 2XWPA 4PG5A 1JHOA 3CVOA 4QUIA 3STHA 3B2EA 5BT9A 3RRYA 5CFMA 3UAYA 4OKIA 2FLNA 2Z2YA 2W4IA 3HSKA 4QDXA 3O8BA 3RM3A 4J7AA 3CR8A 3AILA 1GYPA 4CG1A 5A2GA 3DMYA 1H5NA 2CMGA 1Z15A 3H8JA 3TRFA 4K88A 3BZUA 2YJNA 4KPEC 3FTPA 3RTXA 3FYDA 4CU2A 2J5QA 2ILVA 3REQB 3NW9A 2AOVA 2R93A 4W5RA 1L2TA 3TTVA 3WBBA 4RLQA 3QQPA 2BEKA 3MJHA 4B6OA 3NHUA 3TL2A 4P4SA 1YIOA 4LTDA 2Z0MA 3DL7A 3GGSA 3OZXA 5L1KA 2ABJA 3SZOA 4BGDA 1PEAA 4O4LA 4WUVA 3SEQA 3SI7A 4BLSA 3G6XA 4RU9A 4GQIA 4ZEVA 4JP3A 2HUNA 4TL9A 4DR2B 2O19A 2WWGA 4YI3A 3UZUA 4ZXPA 1MB0A 4MYUA 3SOPA 1YU9A 2MYUA 3CUTA 4BC1A 4YJ2F 1LEHA 3O92A 1E98A 2FP3A 2QVYX 3C6YA 3RTCA 4HZUA 4LDPA 2QXTA 3ZXYA 3NP7A 3OMWA 2JL1A 2FP4B 1DC3A 3WI7A 2P7HA 2ISSD 4IIJB 2D06A 4DVJA 1U4OA 3P5SA 2EWWA 1VHDA 2ZE6A 3T3HA 2C8JA 1B0ZA 1AGNA 2QPAA 3S8MA 3T8YA 1D2AA 1YDFA 1J5EH 3JYPA 4KXMA 4EF4A 4QX6A 2P4EA 4M9RA 3LKDA 1D4OA 3OM8A 3PT9A 5I7EA 4MYCA 1PL6A 4JXZA 4MQFA 4WY8A 3VKHA 2F4VH 4NZMA 3OF2A 5JLAA 1LSUA 5EZYB 4B6SA 4KYIB 4Z8YA 4H60A 2JFYA 4NQRA 5I7OA 4G97A 3AW8A 4A2BA 2Q6LA 3MMNA 3NCTA 2A88A 1RRCA 2DHQA 2ZSDA 3DC7A 4W1PA 4RU1A 1TMOA 2QY9A 1C3JA 3FG9A 1P44A 1KI3A 4XGNA 1QKKA 2DHRA 5IM5A 1G7RA 1YK0A 2CMHA 4EHAA 4ECTA 4C6SA 3DA8A 3OHBA 3EPGA 1ZRSA 4LWZA 2P4QA 2R7AA 2P78A 3GVIA 4LJYA 4DYDA 5TJHA 3IOBA 4ND4A 1GZUA 1NPDA 1AUXA 3R8FA 1W8DA 4WA7A 5EP1A 4RJ2A 1NVDA 4LJRA 4RK4A 5SV2A 3EZNA 3BACA 4UAJA 4E5UA 5FWYA 4DR2H 2Q8PA 5CX1B 1S8FA 1GA4A 1OXUA 4HTFB 3RUDA 5A5GA 1NQAO 4H77A 3WV5A 1IG0A 3FPAA 1PV1A 4NAVA 3GTGA 5B53A 3AUXA 1LTQA 2EHDA 2G1KA 1QGOA 1JI3A 5CVUA 2PEYA 3E5MA 1RYFA 1VKZA 1FXSA 4RADA 1R88A 3CLUC 5FOTA 3PFKA 2Y92A 1YOVA 1GPMA 1EK0A 1M6NA 3EGEA 4E3ZA 3EF0A 3I4CA 3LMKA 3IAS1 4BTEA 3WK8A 4ILKA 2WAXA 1RHKA 3IDFA 4ZZ3A 1W85A 4RVGA 3A1FA 4D45A 5JMWA 4ECVA 1MQAA 4GPEA 1NBOA 1YL5A 4AQYH 1KKLA 3WGVA 4JYMA 5ESXA 3EWSA 3GG2A 2C3UA 1OC4A 1ES9A 5BR8B 1LDBA 5HOQA 1SUPA 1RHRA 2Q5HA 1LI7A 4HQRA 4MOWA 3ORSA 2ZCJA 4UHEA 2PBLA 2CD9A 3R5JA 1XN4A 3P96A 3EVDA 3BAAA 2D8MA 3O1LA 2HBZA 1XRRA 4BV8A 4MUFA 1XZDA 3EEIA 1WHTB 2B6HA 3JD1A 1UJNA 2KJQA 3CLHA 5FNVF 2KW5A 4FMCB 2N9UA 2AYYA 2GM5A 2RH9B 1OPRA 1D9ZA 3AM3A 3A2MA 4LNUB 5H8WA 2B0CA 4CC6A 2Q5QA 1OYOA 4AC9A 3NRJA 1GAWA 3SX0A 4C5CA 4URZR 3DFIA 3K8YA 4M0PA 3QZ7A 3H5TA 2RBEA 2PRJA 1OLUA 4BFUA 4MLZA 2LW7A 2GHRA 5KFZA 4YRTA 2I80A 1MAAA 1BFKA 4WSOA 2P4SA 3NBMA 5AVUA 1K7CA 3H3JA 3IULA 2J46A 3B6JA 5JBNA 2UYOA 3MTGA 2O5RA 2ATEA 3U3DA 1P9LA 3Q2OA 1CY4A 4KFSA 4MMZB 4BBZA 1D7AA 3I1FA 1YDGA 4J91A 3LNCA 4UTXA 3NHWA 3KPJA 2DLNA 3VYRB 4I99A 4HDCA 2I1LA 4X94A 3FX2A 2JLSA 1C1DB 1EUDB 1CB7A 1QX4A 1XVVA 2QE7D 1RP1A 3TXXA 1YZVA 2IYTA 1CQXA 5IVIA 4DB4A 2NSYA 5E7JA 3K9BA 1PSDA 3IT0A 3GGCA 1E1RD 2ZBRA 2AFRA 3QLVA 3K70B 1V16B 3FPFA 3EOAI 1A8UA 3RUPA 2R1VA 1VYUA 5K3WA 1GGHA 3IBSA 1W93A 1FUEA 5KU1A 1NX6A 3JQEA 2ZXEA 3WYCA 3K5IA 1XXLA 2BY4A 5HBGA 3VAZA 5DNDA 2FPIA 1R10A 5BR8H 2DT5A 2GEDA 2XGJA 4W7HA 3AINA 4EBDA 1SK9A 4RLFA 4EB6A 3ASZA 1U8FO 3X1ZA 3BD6A 4GZ5A 3RSQA 4AMGA 4JYPA 4DUGA 2O8VA 2EXXA 1SOVA 4G25A 3G5AA 1J5PA 1EK5A 5BNTA 1GKKA 1KKUA 2JBWA 2ZVJA 4UCVA 2B21A 1V8BA 2NXWA 1P7WA 3ER8A 2WJ4A 1A7KA 3A58B 1VHJA 3Q41A 3S8EA 1PJAA 2GI4A 1QIMA 3W6OA 4JBYA 5KNBD 2VJDA 4DCJA 2JDID 3DB1A 4B74A 4A0FA 4REOA 1COZA 1ELOA 1NPTO 3GRZA 3LHIA 1OU4A 3VKVA 2JFOA 5H3HA 1JNXX 3RF7A 4D3SA 2PM8A 5A71A 4Z1MA 1RCTE 5AW1A 1WB5A 2ZJ2A 4OTZA 1S2OA 2EW2A 3R74A 1RZVA 3PIRA 2WKRA 2Z9DA 4B80A 4NECA 1C7RA 2V65A 1X74A 5DTRA 2CDRA 4YRAA 5CHYA 3THYA 3T0GA 1T5DX 4M8IA 4ZAFA 3WS7A 5JFGA 5ED0A 2QDKA 2RJOA 1JSZA 4IH9A 4JXJA 3L0BA 2UVPA 1V3TA 3PW5A 4DA4A 1PVDA 4V0LA 4NJMB 3MJ4A 3NJ4A 1NJ6A 4HDRA 4KGDA 4TVKA 1AF4A 1FB5A 5HEKA 1I32A 2I33A 1KDOA 4IRKA 1JZSA 2HY7A 2CXHA 2EQBA 1R18A 1SCBA 2KS6A 2NMVA 3Q0IA 4UXJA 4IDPA 2NV0A 3VM6A 4R0MA 4CT0A 4EG8A 1CJMA 1PEDA 1R0ZA 2OV1A 1GO3E 4A93G 1ZN7A 5LJIA 1VRWA 3AFIA 3KB1A 1XP5A 1M6VB 4JQZA 4ZTUB 4KVFA 4LNAA 5JROA 1MX3A 2FE1A 4LYDA 4OGLA 4YMGA 2HJHA 2A1UB 1S0MA 3VC7A 1NNI1 4HDSA 2MU1A 4F06A 1JE0A 5DM60 4FCWA 1TA0A 1YZTA 2I2CA 4CEHA 1R64A 5KT3A 2W7TA 2VF7A 3FLAA 2P9EA 4X6YA 2Y0BA 1YVUA 3RRNA 2C2RA 3PIIA 4BWVA 1NL3A 3QEBZ 3KHLA 3E53A 3QLVC 2OCXA 4ZQIA 3B1VA 3DD5A 1DKRA 1VMIA 4B1FA 1XNRB 4C7MA 5J5AA 1A3GA 3B36A 4IR1A 2VOBA 2WLSA 1UJ6A 5AVJA 4ETNA 5JD3A 5DF1A 1TW2A 1D6SA 3OIVA 4ENRA 1EWTA 4GKJB 4KPUB 1RADA 2I67A 2RHGB 3KEQA 4OYRA 1IB0A 1EIZA 1O2DA 4PIPA 4TWRA 2FFAA 2P5TB 3P4UA 1VG0B 4YJDA 3BXZA 5FPHA 1QR2A 1U7TA 4KQHA 5I9IA 2IEBA 2R3SA 1O6GA 3PQ2A 3ZIAD 1FFCA 2JFXA 3E15A 3BN3A 2BAGA 3BXOA 1CS0A 1Z12A 3CH5A 2ZI9A 4LRTB 4ER3A 4XGIA 1EJ2A 4IFTA 1I94B 2P6NA 5I60A 4DXAA 1QOZA 1YUBA 2XGSA 4CHIA 3AK4A 1DBVO 4HN9A 2ZBGA 5IAKA 1SU8A 2D2XA 4RA6A 2GLTA 5AUPB 4UM8B 3OJ0A 3SBXA 5KKNB 1C9MA 4S05A 3L7MA 3QVOA 5L3RA 4LVUA 3LLUA 2GA8A 3JWHA 1JIUA 1RYEA 3PF9A 2B35A 4MTCA 2WVJA 2FEKA 1BS2A 1GAJA 1OY1A 1C7ZA 3SXUB 4DIMA 5F5NA 4N48A 4D98A 5BWOA 2QMEA 8LDHA 4GRDA 4LECA 2ERXA 3BD8A 2DRIA 2YNMD 1SKYE 4BJ5A 3G0DA 3EUEA 2VJPA 1JHMA 2O3JA 4ED6A 2VEDA 2BEVB 5AHOA 3IN5A 4QFCA 4XB1A 1KFCB 5IS2A 1B2RA 1L5OA 2CMDA 2HO4A 3K15A 2PR2A 3K96A 4WGGA 4L7VA 2AQIA 4DG8A 2XUIA 3I1YA 1N92A 5H02A 5AMXA 4QBGB 3HJFA 2XQGA 3K05A 2R2AA 4RUKA 4DLNA 1CULC 2C88A 4QELA 1Q1EA 4JBWA 5EUMA 3RB0A 3LQ1A 4JR1A 1T5TA 2V4UA 3W4IA 4DDWA 2Q4EA 2RHDA 3TIGA 4NBKA 3ZGZA 1XNRH 3ET5A 2WWWA 2NUAA 3KQTA 4BFLA 4RZ2A 1OILA 2JA7G 4GKJH 1TLLA 3ZDFA 2QWXA 1PQWA 4I5GA 1W36C 5BSMA 2ZUVA 3ND6A 4KP7A 4NS1A 2FZGA 4JI8B 5CDYA 3IALA 4BDSA 3BTOA 4URVR 4HR7A 1X3SA 4NENB 4X6LA 1H69A 5TPWA 4UTPA 2ZB8A 1FVHA 4RJLA 3V2GA 4INAA 5E7MA 1I94H 2F1RA 4BKPA 1M6HA 3MFIA 2ODEA 1WDWB 3I2JA 5K8TA 1DFHA 5AJYA 1WM1A 2WHQA 3HFSA 3G2IA 3H3XA 1XWIA 1DAGA 2PSFA 3BHMA 3GLVA 3ELWA 3UJ3X 4BWGA 2VP2A 4U7GA 4LHZA 4KRGA 2ZSEA 2LP4Y 3UCXA 1E2DA 3A6LA 1LVGA 4EI9A 1MAVA 2HHLA 4TLMB 1K97A 5IBPA 4UASA 5EQTA 4GG1A 4H7PA 1A4IA 1DGSA 3L04A 1XVUA 5CA0B 1GDDA 1I3LA 1M34A 1W44A 2OHGA 1VPDA 2XUHA 1YZ3A 1AIPA 2VG8A 2F3QA 4JEUA 5LBUA 2EGGA 2QW1A 1R7RA 1D0IA 3OIWA 4JI5B 1Z4QA 2ATIA 3MHTA 3VNNA 4AN0A 3PYLA 4ZT7A 4Q37A 5EPEA 4B81A 1FTYA 4AM8A 4H0NA 5DDIP 1X7ZB 1Q0UA 2X5OA 3IJRA 4X85A 1KI1A 5HRAA 1PR1A 4CLHA 1AZTA 3DTYA 2XB9A 4BECA 5B7QA 5JYDA 1DJQA 3FBGA 1G41A 5KAMA 3VR5H 3FPGA 5AJXA 4TWAA 3HB5X 5IP7G 1WBBA 1AKUA 4ENPA 2FEPA 5CT5A 3MZ0A 5BN4A 3VVCA 3NKLA 3P0RA 1P2TA 2FOIA 2FPRA 3QK7A 1X9GA 3RS4A 4WTOA 3ZCTA 3AR4A 1U0EA 1MB9A 3OU6A 3WAKA 3BF8A 3O3NB 3Q8KA 2X2PA 2B2CA 1AQJA 3KR9A 1NAHA 3H75A 2XSZA 3H2ZA 2IBTA 3GA7A 1SXJE 1NVWQ 4PCUA 5DLYA 4XE5A 3L7AA 1HMPA 4ARZA 3IX7A 4RKWA 4FHFA 2VA8A 1NVEA 4UCXA 1S9HA 4ZRNA 3WLJA 3E84A 2RF4A 1K6MA 1FP1D 2GYWA 5E1OA 2GCOB 3RYIB 4I9GA 1C3EA 4Q3DA 4CN8A 4MW0A 4QIHA 3FMFA 3ORHA 2FZVA 3OZUA 3ZU3A 2QDXA 1ZISA 1K7SN 1GCUA 4IDNA 4JC8A 3K0AB 4ISBA 4ZQCB 1FDTA 1PWEA 2ZRGA 3D6NB 5JC1A 3V7FA 1H05A 4CMFA 3GRUA 2YFKA 3T1HH 1L5FA 4B7XA 2EW1A 2NO7A 1KO8A 1F4VA 2IWHA 4IFIA 3RIYA 4KIJA 2O20A 1AKMA 4HWPA 3VSDA 4UBNA 5K20A 3ZE2B 2FLLA 5AWFC 3M1LA 4B46A 4RIHA 4QSMA 5LNK6 1K8YB 5CXQA 2XMPA 3D2BA 1OW3B 4LQCA 5EWEA 3U7QA 1JKJA 1PT5A 4KLCA 3KV3O 2PNFA 2BC9A 1P2GA 1S02A 3GDGA 1JG4A 4KCGA 5A4MS 1YKFA 1EBBA 1ZESA 3Q2IA 4YR7A 4L0QA 5I5SA 1KO4A 2BEWA 5ALTA 1AHPA 1XCMA 5AW0A 1WWKA 5LQCA 4JT9A 4ND1A 1VLZA 3R7WB 4CMCA 4GSYA 2EX1A 3TVYA 1Z38A 2P91A 5BN1A 4WN9A 4F4XA 3BWBA 3OE7A 2YWDA 2XGQA 2QW8A 5DBGA 1GKIA 3SVZA 5CIYA 1C30A 2FPOA 1UBKS 2J6UA 1VXOA 3K0FA 5KFQA 3WISA 3C5HA 3HP7A 1DIHA 4E51A 4NICA 2Y27A 2ZJ7A 5KVAA 1RT9A 3IESA 1P9OA 2W2MA 4GPTA 5B1EA 2X3UA 4QYTA 1PS8A 5AVZA 1E89A 1RS0A 4O4JA 5JNUA 3E18A 1K68A 1WD5A 2YBEA 5IWAH 5KQPA 1T9DA 2YVQA 4ZYVA 2IE8A 3V7NA 1NVUQ 3C3KA 1TD1A 5A4IS 2AVNA 2R8EA 4TUYB 3BA6A 4C6TB 3R09A 1GUDA 1GIAA 4PC7A 3JD0A 4ECQA 1DKLA 1BMFA 3B7GA 3LXRA 4TZ0A 3VH2A 1W29A 2QUJA 4HRAA 4A3DG 3MMSA 3WAJA 4JJ4A 5IAJA 2A6PA 4DVGA 5H82A 3V80A 3BC1A 3KJQA 1KY5A 2ZUWA 3HT5A 2IBKA 1CUCA 3W5CA 4GGOA 1H8HD 1BXGA