3R23A

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
304
structure length
304
Chain Sequence
AMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Ligase
total genus 78
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r23A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r23A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r23A01
4E4TA 3R5HA 3R5FA 3U54A 3UFXB 3N8DA 4ZI7F 5J2UF 4O4JF 3VA7A 4M9UA 4XYLB 2QF7A 1T36A 2V58A 2GLTA 1GSHA 5JQGF 5C1OA 4HQ6A 2SCUB 4M98A 3TIGA 3VOTA 2YZNA 3RUPA 2YZMA 4MV6A 4XYMB 2R7KA 2FPGB 4XX0B 2PN1A 3RV3A 5H80A 2WYOA 3VPDA 3G8DA 3RFCA 4YB8B 2XCLA 3Q2OA 1KJIA 3K5IA 4O7WA 4O7SA 2YW2A 5LXTF 1KJ9A 5IYZF 3LP8A 2PBZA 3BSWA 1VBHA 4YJ2F 5LP6F 3WNZA 1EHIA 5JVLA 5CAEB 1DV2A 2GPSA 2CZGA 2DWCA 2ZDQA 2VPQA 3V4SA 2QK4A 2W6ZA 4EG0A 4MV9A 4TV8F 5EZYF 1SCUB 2W6MA 1B6RA 4O7LA 4XZ3B 4YBZB 1EUDB 2PVPA 2DZDA 3U55A 5C1PA 4J6EA 2YRWA 3KALA 1KJJA 4QSHA 2R84A 3NUAA 2CNQA 2NU9B 3KAJA 1GSAA 5KX5F 2Z04A 5J2TF 1BXRA 3WO0A 4O4HF 2VR1A 2YL2A 2OLSA 4L1KA 1I7NA 4ZHQF 3V4ZA 4WBNF 3N6RA 4O83A 1DV1A 3BG5A 4O2BF 4YJ3F 2YS7A 3ETHA 3MWEA 4HNUA 3HO8A 2ZDGA 2V59A 2J9GA 1JDBB 4MA0A 4EAAA 1KJQA 2FB9A 5LA6F 3JRXA 4M99A 2W71A 5FNVF 2R87A 4O86A 3MWDA 3VMMA 2NUAB 4DLKA 3G8CA 4I4TF 4FFRA 5K2MA 2YZGA 1KC7A 2X0SA 4O2AF 5D8DA 3LWBA 4FFMA 2R82A 1I7LA 3QFFA 4NYEA 1E4EB 1C30A 2YZLA 4O7NA 4MV4A 3I12A 4O7VA 2IP4A 1IOWA 2I80A 4HNTA 2DLNA 4O7YA 3R9RA 1BNCA 4HR7A 1GSOA 4EGJA 4DIMA 3JZIA 1KJ8A 1W93A 4MV7A 3GIDA 5HV6A 5DMXA 2VQDA 2FPPB 3GLKA 2GPWA 5BMVF 4IHJF 4RZQA 2R6FA 1JKJB 1Z2NX 3E5NA 1M0TA 5BPHA 2ZDHA 2YRXA 2FP4B 3K5HA 4EA9A 4HNVA 2YS6A 2W6PA 4MA5A 3JRWA 3U9TA 1JDEA 3HBLA 1CQJB 1OBDA 4IIJF 5LOVF 3AW8A 4FU0A 2CNUA 4I55F 4FFNA 1CS0A 3U9SA 4EA7A 3ORQA 3MJFA 4IWXA 2NU8B 3TINA 2R86A 2HJWA 3TW6A 4EGQA 3KREA 4ZQIA 2I8CA 4O84A 4IZOA 4C5AA 4YAKB 2VHEA 3BFPA 3BSYA 5GONF 4FGRA 5BPFA 1KBLA 1JLLB 1B6SA 2I87A 2NPOA 1A9XA 1Z2PX 1PK8A 4C5CA 4C5BA 5CB4F 1KUTA 2W6OA 1VKZA 3HB9A 2CQYA 2CNVA 4MV1A 5JH7F 3R5XA 1C3OA 4O81A 2NU6B 2GQSA 3WO1A 5CA0F 1AUXA 2W6QA 3TQTA 3VPCA 5JVDF 3JZFA 2R7LA 1PX2A 4WD3A 1UC8A 2NU7B 3SE7A 2FPIB 3OUUA 5HBRB 3BSSA 2W6NA 4Y8VB 4TUYF 2YYAA 1M0WA 1AUVA 4O7TA 2P0AA 4FFPA 2R7MA 2XD4A 4O7RA 5KKNB 2W70A 1A48A 1UC9A 1Z2OX 1EYZA 1OBGA 3Q1KA 3AX6A 1W96A 1EUCB 4MV3A 4TV9F 1DIKA 1E4EA 3OUZA 4FFLA 1KEEA 5I47A 2HGSA 3RV4A 4GGMX 2YWVA 5C8YF 4ME6A 2DIKA 4MAMA 1GLVA 4YAJB 3TIIA 1IOVA 2Z02A 3ORRA 2GQRA 4I50F 2V5AA 3KAKA 3VPBA 5JQWA 5LYJF 2R7NA 4EABA 4EA8A 3DF7A 3R23A 4ZOLF 1EZ1A 1GGOA 4O4LF 4MV8A 1VBGA 4O7ZA 4M9CA 1WR2A 2C00A 1ULZA 5CA1F 1M6VA 1CE8A 4FFOA 2R85A 3K3PA 4FE2A 4IWYA 1CQIB 4O4IF 3ETJA 4O82A
chains in the Genus database with same CATH superfamily
3A6ZA 2W9AA 5JH7A 1J7KA 4YAJA 1YGPA 1JJVA 3VOAA 2Q27A 2WVHA 1SUDA 3U3ZA 3M9LA 1GGEA 2I1LA 2DTDA 4ZZ2A 3AONB 3CSWA 3KWLA 4ZVMA 3G02A 4HMQA 3ZZTA 3WKBA 1Q12A 4GKKH 1S0MA 1N2CB 3OLVA 3TK1A 1FFYA 4I50B 2VNHA 3PWTA 1SULA 5JJ5A 3OQMA 1NXXA 4J4HA 2YWDA 2CW5A 3E5RA 4FE3A 3DFFA 5M2QA 1U9ZA 4MAFA 3RYFB 4KITB 3E70C 2BI8A 3H5LA 5JAMA 3MWGA 4LF9H 4KSCA 3ZWNA 4D6XA 4HS4A 1FFGA 2A5JA 2P91A 4U7TB 3TLAA 2VJCA 3OPQA 2H4FA 3O5AA 4BB6A 1PK7A 4D4GA 4LDJA 4JJ4A 4R8LA 3WWZA 1E3IA 1TW3A 3E8SA 4K9SA 2ST1A 4U2DA 4Q1AA 3H5NA 2HL6A 3HR8A 1NT2A 5BN5A 1XFDA 2IH2A 1DU4A 1TKCA 2ZJYA 4LC9A 3TW4A 1ORIA 3A1NA 3HO8A 5FOSA 1L7MA 2QMQA 2QWXA 1E6KA 1ZGAA 2FQQA 3GJ4A 2C5GA 1X0XA 2HU7A 5CRIA 2G1UA 4Q8FA 4APMA 1ZLXA 3ZWCA 3ZJ5A 1M2WA 1QJ4A 1E3EA 1X7ZA 3OCJA 1Z7GA 4BLRA 3RANA 3GV7B 1DMSA 3MZ0A 4NV0A 1KEUA 3DTNA 3C3KA 2JD2A 3DR5A 2W8LA 2KPOA 3RJZA 3TN7A 2BTOA 1ZMOA 3AM1A 2GSWA 4I0WB 3HU1A 4H60A 1B8VA 2YVQA 1T1SA 4O2LA 1W73A 4ZAZA 1RHQA 1R10A 3GIDA 2XXAB 4JV5H 2O4CA 1RI1A 3UWKA 4ZQCB 4G4GA 2LPMA 1AQJA 1KC1A 3WR5A 1JIQA 4EA9A 4AX8A 4BQOA 3RSSA 4V39A 3OIWA 3DV9A 3WLKX 3K0CA 4IIJF 1SA0A 4YR9A 2ZUDA 3QPBA 3NAMA 5GJBA 4V0NA 4DEVA 4N5DA 3HYRA 5EC8A 3OP4A 4LEIA 1O1YA 2W8BA 3JXEA 2O20A 3WGVA 2E2HA 1LBHA 1VAJA 1DARA 4PPFA 3GV5B 3KZMA 5JAQA 2YH2A 4CR7A 2HVSA 2PSEA 2IEIA 2HIMA 1PK8A 4F7WA 3KLOA 3MIIA 5EQJB 1AXEA 1A98A 1E9DA 5F4ZA 5T4FA 3E3AA 2IYSA 1NLMA 3U4CA 3LVQE 2GNOA 1JFLA 4W99A 1FOEB 2GXSA 2OCIA 2JK1A 3MUNA 1UMBA 2OG2A 4MGHA 2VHCA 1BYUA 4KXUA 2NTJA 3COSA 4L08A 3NB0A 2LZ0A 2PSFA 1IVYA 3FPGA 2A14A 4F9EA 1YR8A 5AUQA 5LBUA 2HPHA 3F4KA 1X1DA 4U9IS 3BTSA 3M6FA 4E5MA 4O5AA 2XD4A 5H5JA 3E7FA 1PJZA 1U94A 1P5RA 3MAGA 2M1ZA 1A48A 2OGWA 4OHRA 1YB6A 1EUCB 2D4HA 1Q0SA 4FFSA 4LTMA 1TIBA 2A2ZA 3NIWA 2BFOA 5CK5A 1PR9A 2NSYA 1KMCA 5AXCA 4OGKA 1JALA 1Y7LA 4PYOA 5CFMA 1ZOOA 4G4SO 3N75A 4UHFA 4TSFD 2QVXX 4IJUA 3VPBA 2RAVA 3H05A 3VR3A 1KZ6A 1SXGA 5B1HA 3AEQA 3DLTA 3RBZA 3EIUA 1JZSA 3NHKA 2GRAA 5AK0A 2NO4A 3AKEA 4HAIA 1AHHA 1YIOA 2CL5A 4UW9A 1IHPA 3U4QB 4ABYA 2G9NA 1R15A 4BLOA 1R9JA 1ZHFA 1KIFA 2CLSA 3ETJA 4XFJA 4QWDA 2IYOA 3DBOB 4XRGA 2ZSDA 3ER6A 4UUNA 3FDZA 1M2GA 4EEQA 4MGKR 5J2UF 5C8ZA 2NU8A 4LRTB 4UARA 5C4MA 4RPKA 1T0UA 2XVYA 1IBKH 3T3NA 3DP7A 4LF7H 5IVKA 1JHAA 1S0UA 3AP1A 2G17A 4OO3A 3RG8A 1XK6A 5L3SA 5FTWA 1IY9A 3VSCA 1YCGA 2IZ6A 4DJDC 3NTLA 4HZUA 2YJNA 2C57A 5LDHA 3BSWA 5THKA 4ECTA 2IWRA 4LSZA 4EQ6B 4TQ9A 5D1HA 3T1TA 5JNRA 1A97A 2KE5A 2NU7A 4IDHA 5I48A 1PG5A 5K0FA 1NUTA 4QFCA 2GF0A 1FX0A 3TAUA 1PAUA 3ROZA 2ECKA 4DPKA 4IXDA 1XJWA 1WSBA 1JXAA 1NM5A 3OJ0A 3G1TA 3WL4A 2QN3A 4YDQA 1UBOS 5CJPA 5DFAA 2VR1A 4NBKA 2DFDA 3HA3A 1BQ3A 3KNZA 1LJ8A 3RRXA 3DBHB 1DBVO 1YE3A 3COPA 5AVTA 1PO7A 4BC1A 1LBTA 2WP0A 4V0QA 1R18A 4CV1A 1Q92A 5BQOA 2OZPA 4DV2H 3ZE8A 5KFOA 3W6ZA 1DG1G 1P8LA 5CEEA 4M6WB 4NWIA 4F3CA 2ACVA 3RAXA 2TMKA 4RQUA 1K3FA 4DAOA 3MCWA 5IZCA 4A93G 2W4QA 1DXYA 4K0RA 3HADA 2X8WA 2XDWA 4BFVA 2CSXA 1KEEB 2AFIE 4RPJA 3KTAA 4RK7A 4NYMR 1DWPA 3SS9X 2X7JA 5EWJA 4FMBB 1QBGA 2Q5IA 5JV5A 4RXUA 1R6AA 4KXXA 4UAUA 4NFLA 4Q9KA 5D01A 2O0JA 3H2ZA 5HRUA 5CEFA 5KTYA 2RGUA 4OK3A 3W5HA 4RFLA 3KPJA 4M21A 4A91A 1FQKA 5ED4A 3DHWC 5ELMA 4P7GA 2QRHA 1P0QA 2Y2UA 3S2EA 2QGZA 1L4EA 1OZ0A 1UEIA 2PS3A 3L0ZA 4LI0A 2IOYA 3JY6A 3GPDG 3SSMA 2BLNA 4TMKA 4U2CA 4KV7A 2VLBA 4GOND 1WLSA 1JKIA 1PV2A 2EV9A 2A1HA 3NBYC 2EBHX 3SDZA 2WTFA 3NDRA 2R1ZA 4FMCF 4RUKA 3HGQA 5AVSA 5ESRA 3IP9A 3DDWA 2BL4A 3IQIX 3EODA 4QOIA 4DDKA 5MGNA 3SG0A 1I2CA 3TG2A 4ZCSA 2X19A 3WTBA 4IG9A 5FBVB 5TMEA 4HNQA 2EW1A 4FC6A 3KB1A 5KAMA 3QOYA 2QLJA 1QK5A 3E27A 1R9TA 2WFZA 1Z0AA 2GARA 2JHAA 4JC5A 1G7CA 1VMEA 3DAHA 3JW8A 4YN3A 4UPDA 3VHLB 3H75A 3OKFA 5MN5A 4Z49A 2XCRB 3EHDA 4KV9A 1P1IA 1XEWX 3NGLA 3O8QA 4I4CA 1ZA2A 1NDHA 1LQ2A 1WW8A 4E09A 3L4SO 3EXEB 3MUFA 1WQ3A 1HNWH 1GPH1 1LFAA 2CHFA 1PEAA 2XYGA 1H4SA 4H2DA 3WXBA 4PLTA 4I50F 2EJ2A 3S7TA 2GMWA 2JLRA 4HEA6 1XZGA 4LFCB 3KUXA 3RTGA 1P2VA 1X8JA 2A9KA 4O2BA 3KRTA 3S2GA 3ROXA 4M76B 1VBGA 1BJKA 4TM8A 4HSGA 2B36A 3UZBA 4YUAA 5BV2P 1YZLA 1CC1S 2QPTA 5TS2A 6AT1A 3C7CB 4GT1A 4BFYA 3N74A 5JAHA 3DDCA 3T5JA 3EZNA 4V3BA 3PSAA 2FRDC 3JYQA 3O9VA 5HNKA 5IF9A 2ZPAA 3A4YA 2ZS7A 5E9WA 3KB2A 2TMDA 1QHGA 3N7TA 1RXEA 4JUBA 4X62H 1QLWA 5HE9A 4MV6A 3PTAA 2P9HA 3BA9A 1WY5A 1U6IA 2RHCA 4GW3A 3C3AA 1TYZA 3BC1A 4N5NA 2QU7A 2NO0A 1FP4B 1LLQA 1J1ZA 2E1PA 4KZKA 2A9QA 4TMWA 5FORA 4O4LB 1N1DA 3D6NB 3L1VA 1T9BA 2AZTA 4XASA 3HYNA 3O83A 3VR0A 3REQA 1SRRA 1U2DC 3U3XA 1PHPA 2WTBA 5EI5A 1V9LA 3LC1O 1JLHA 1PFWA 2FEMA 2QIPA 3U55A 5JJBA 2XUAA 2V7GA 3SZRA 1N36H 3IE2A 3BAAA 4WA7A 3OFNA 2WG1A 3H42B 3NYWA 2JJMA 3FNHA 5DQIA 1BXRA 1NVTA 5M04A 4UATA 1ORWA 2J0SA 1BCRB 3JYNA 4CKBB 5EEHA 4LYHA 1XOIA 4ZGGA 1A1SA 4MVJI 4MW6A 4JVMA 2AN4A 3T8YA 2FU5C 4CMBA 3QYJA 4XEHA 3WLIA 1MO2A 1CERA 3FUXA 3DL7A 3I04M 4BQRA 1U1GA 5GZ3A 4OMCA 5FI0B 2I55A 3UK0A 1X3LA 3PQCA 1N2IA 3AR9A 10MHA 3U4DA 4E12A 4DFDA 3FF1A 3T5DA 5E7QA 1U3VA 2ZYWX 2DHEA 3N2IA 4V2IA 1WCV1 5I7OA 2EWWA 4MGEA 2QR3A 4TLAA 1G20A 4MW9A 3U1TA 1ZNYA 5ILOA 4DV7H 3OU6A 2ZZMA 1E3WB 2H0RA 4RQAA 4CLXA 1MCZA 4DYHA 3WL5A 3ID6C 3QOWA 3A4LA 3A6EA 4GZMA 4QYIA 1KSJA 3TLMA 5LQJA 2RK4A 3Q7SA 1ZSYA 4QWEA 4RZRA 4TRRA 5LB2A 1C9EA 4FYMA 2CJYA 4MUAA 4OHCA 1AS2A 4F7DA 4AUEA 5MN6A 4HI0E 4ZTBA 1IN8A 4KC0A 4NG5A 1FFAA 3QLEA 1WRBA 1PIWA 4G85A 4BUCA 3S2YA 4WZAB 1PFKA 1AGPA 1HYBA 3GY0A 3HI6A 2R7AA 4MVJM 4D5GA 3SIPA 1VGVA 2V45A 4G8CA 4ARZA 4YI3A 4BNTA 4K0KH 4HVAA 1KU6A 5EE3A 1AUQA 4K03A 3A6GA 5LOVB 1JH8A 1SOMA 1I1MA 4R71A 1PJRA 2UVRA 4HDKA 2AJTA 2MR6A 5AVWA 1UMDA 3LM8A 5ALUA 4DL5A 1MDBA 3PFIA 4M0PA 3PU6A 4B3SB 1IONA 3T5GA 4L07A 1Z28A 5JS1A 4YJHB 4WPGA 2O8DB 3KL4A 3LBIA 3D2LA 1C1XA 2WJGA 4DWVA 3R8CA 3A6FA 1SPBS 5ADUS 4LE1A 4C2UA 3E15A 4JX9A 3N2GB 2Q5HA 1KDVA 2D13A 5DPMA 4KRGA 1WVGA 1Y5RA 2Y6UA 5EMLA 5IDVA 1VA4A 2FP4A 3HUEA 5DCWA 2IZOA 1E3QA 3LVBA 1RM3A 3TM5A 5ALWA 3QNWA 1KPGA 4W8HA 3GQVA 4M38A 3DBVO 2ZRIA 3R74A 1CUJA 1CUHA 3HXTA 4QO8A 2DHQA 1K7FB 3AHDA 4DCGA 4MS1B 1X1QA 3DPIA 2G82A 3ZGZA 2BI7A 3QBJA 3WRYA 4EG3A 5HYVA 1EB8A 1HH4A 2VA2A 3JVEA 2X4LA 3RU3A 1MAWA 3N7UA 3P2MA 1OW3B 5D85A 3CSSA 2ZCJA 4E4RA 4ZDWA 1KH1A 4RLFA 1P1KA 3C1AA 2BJVA 3U13A 1TM1E 4NECA 3DOEA 2Y0SA 1UZUA 1J8YF 1J9ZA 1FP6A 4RSHA 5KWJA 1E1RA 3L1IA 4WEQA 5M3BA 1CRQA 1CZKA 5FV4A 3ITNA 1XJQA 4ZD6A 4EYIB 4J0HA 1VG8A 4EG0A 2JA6G 1WZEA 2KM1A 4HLUA 4O7LA 2YV2A 4EW2A 1NI4B 4BAGA 3KJFA 3WDMA 2WTEA 3I04A 2O7NA 1KJJA 5JD4A 2WTUA 3A3KA 1JDPA 2NT3A 1J5XA 2A9FA 5EA2A 3O38A 3IJPA 1VRVA 1Z4PX 3J80A 4JA0A 4ZAGA 5JG7A 1R1DA 3ZJVA 2P90A 2BV3A 2R8YA 1ODFA 1S5PA 1T4CA 5KB3A 1TQDA 1CUDA 3VR4H 3QVVA 4A27A 4BLVA 4K6CA 1XQXA 1JQLB 2PQ6A 1P29A 2XB9A 3N2ZB 1Y34E 1RYSA 4PGFA 1R5OA 4HDMA 5JCOC 1EFUA 4GEKA 3L7KA 1IQUA 3TL2A 5JHHB 2RBKA 2L17A 3H8SA 4F45A 1CFJA 3SFZA 5AM4A 2R25B 1NI3A 1T4DA 5HQ3B 1SB9A 2CDCA 5ER9A 1M83A 1M6EX 2O59A 1R16A 5ISMA 1GUYA 4AS1A 3AEUB 1OFTA 3LSTA 3RJMA 2VP3A 5C8DA 2FPPB 5K3DA 1KYXA 1L1FA 4IGEA 2JA7G 1G3UA 4FQ5A 3D6FA 5LA6B 3R9WA 4MVJA 3PDCA 1O87A 3I62A 2ZQZA 3F98A 1WSWA 2V1XA 1NRIA 1UM9B 3IDFA 5JUWA 5U1PA 1VCIA 5JXGA 2EZ4A 4Q1EA 1BG6A 3AJEA 1IZYA 3LY7A 4ZZIA 3GLGA 4WHXA 1GLNA 1TJ3A 4MUHA 2FQWA 2PGXA 2FUCA 3DDNA 4R16A 1BC5A 4QPCA 3BVPA 2UZ1B 2ECPA 4HG2A 4D9JA 1UBSB 1U98A 2IPOA 3WGJA 1SC1A 2R4QA 1QF7A 3KUUA 3ADBA 1C3OA 4EGCB 3EB9A 3IDAA 1UFVA 3GUCA 1Q1ZA 1JU4A 3LUHA 3EXHB 4EL5A 5B7GA 1K98A 2A0YA 5CBPA 4H27A 4J0JA 4ITUA 4DUZB 4RORA 3BXGA 3VDQA 3C3WA 2C2HA 4RF5A 2IH4A 5HZGA 2HNAA 2WINI 4FX2A 2WHXA 1C9JA 2FFQA 2F17A 1U7DA 3VJLA 1XTSA 3ZVLA 5JE8A 4AS2A 1S8FA 4A3FG 3VPFA 4CLRB 3EASA 2H2WA 4UXJA 3ZI4A 2VNJA 1JEJA 3WDKA 1SURA 1KIAA 2NYUA 3UJPA 3SE0A 5EL0A 1RJ9B 1JT2A 1SXQA 1PDOA 1OI2A 4F4WA 4FYXA 2VP0A 2AN5A 2XDQB 4M86A 3VZCA 4LVUA 1C9KA 3LQQA 7YASA 2Y9MB 1F2VA 2DVMA 4PAWA 4DADA 1UJ5A 3GP3A 3IUJA 2H1SA 1V11A 2GN0A 4F8JA 4BP1A 5JMOA 1IPEA 1MRNA 1Y5MA 2UVPA 3Q0EA 4GYKA 2WFLB 2RAPA 2B30A 3IVMA 4FJ2A 4KO3S 4O4LF 2AQKA 2FK8A 4IVQA 1A1VA 1AV6A 3G49A 3FOEC 1DXHA 4WT7A 1MDFA 3G82C 5J4LA 2RJOA 3ZNNA 1ST3A 1MFZA 4IOJA 4ZVSA 4TKLA 1DIGA 2AXNA 3B89A 3TSZA 3VA7A 1A9TA 4IVNA 5DM0A 5KYTA 4DDUA 1ZKMA 3AEZA 3KPUA 3PVXA 4D02A 4V0MA 1NUQA 1I4LD 3MOGA 1DIRA 3RS2A 3J81k 3ZGYA 4AYTA 4FXPA 4L15A 2PQ2A 3JQFC 4DJTA 2NN3C 2BFCB 2F00A 1TJ5A 3F7NA 3V2HA 4BGVA 1T9GR 3PC6A 5JNTA 4QGSA 1SG0A 4L5YA 3PJFA 3C8MA 3EPJA 4E1AA 3VPHA 4QNMA 2EDAA 4IHQA 2R62A 3G2JA 1L8AA 2ATCA 1SBZA 4DVGA 1XHEA 1H2HA 2F8MA 2X3UA 3QW2A 4G8BA 4YALA 3KAJA 2DY0A 2Q2WA 3GDFA 1J97A 2ORIA 4F1WA 3G0OA 1K92A 5IMSA 2QJTA 5CT6A 3DJYA 4IQGA 4N1AA 5DSZA 3JTEA 3NHMA 3TD2A 5IWCA 3OTOB 3I32A 1QXSA 4ALJA 2IYQA 1JG6A 3HEAA 1RXYA 3KJXA 4KH1A 4YMLA 1RJFA 3GDOA 4F56A 3O90A 1UP6A 5K6AC 1KEWA 1WDTA 3NWJA 1RRCA 1P6XA 2Z0MA 1PT7A 3PIIA 5KT3A 4M1KA 2QE7D 1VG9B 4RVNA 1FQJA 4IFTA 5H3LA 1XEWY 1O96B 3RC8A 3DEHA 5FR2A 4DWJA 4EY8A 3BWYA 2WVAA 3DCYA 5K99A 5IP7G 2XSZD 3ZZ0A 4EG5A 4AG3A 3N05A 1R6DA 2O5VA 4PYIA 5E3JA 5E6SB 4DUYH 4OREX 2PXCA 3A06A 1CY4A 3NHRA 2HVRA 1IJEA 2JVJA 1PJ8A 2D0IA 3BQ1A 3VH2A 4NYMQ 2IYEA 2G1JA 3W7BA 5C46F 5FWXA 2RHTA 3AR8A 1I7PA 2AUNA 3IMEA 3FKSD 1DX6A 5C1DA 3D5QA 2WJAA 5IAGA 2VBCA 1XLTA 4K3UA 1ODIA 5LOVF 5UKDA 3RC2A 5CDSA 3K9GA 3O8DA 4UVDA 2VA9A 1BKYA 2VH2A 2F64A 2HO4A 5TVKA 1UP7A 4LHEA 4F84A 3TPZA 3CMCO 4IV5A 1EA7A 4OFWA 4WV3A 4XD7D 3AI7A 4OMFG 3KETA 3C6XA 3R3SA 4EB8A 3F78A 1CQXA 1PP4A 3STXA 3AGPA 3S7ZA 5HGJA 4RFSB 1T3SA 1FNDA 2GTHA 4B17A 1MO4A 4WFJA 3HM2A 5E38A 3ESZA 3U39A 2JCVA 1KYYA 1C41A 2QVCA 1M0EA 2N42A 1LBQA 1PR2A 1G6OA 4FYHA 3UPUA 3DOFA 1QIEA 4CMIB 2C88A 4IWNA 5AT1A 2UDPA 1GAQA 1YQTA 1H05A 3NATA 1JI0A 3O8OA 4B3RB 1YFKA 3PW7A 4BNYA 4MYTA 1XWIA 1WB5A 5LMUB 4DBZA 1UJMA 3T5AA 4ATNA 5K6RA 1ZR4A 4YCNA 4LF5B 3ST7A 3OZWA 1US8A 4TLEA 5HZMA 4W9MC 1HM5A 2QL9A 2WMYA 3GZNA 1J7JA 3AUTA 3V8NA 2J6BA 5CA0B 1ACJA 3PHCA 4GH5A 4BVHA 4EB6A 3FJYA 1U5BA 5AI5A 1R5NA 5LLSA 3E3LA 5CXSA 1NUPA 2AG1A 2ERCA 5B4VA 4BFWA 2FFHA 4C3OB 2QPAA 1JFFB 5IYCG 1WB4A 1I2DA 4M1WA 2PKEA 4KMOA 4UD6A 2PIDA 1EFLA 2FHSA 3MJDA 4M46A 1IAVA 3W6UA 4JODA 1FFCA 4TUYB 4ZHSA 2Z6VA 4TX1A 2XKKA 1YXMA 1N2EA 2W0MA 1QS0B 3G1UA 4DQKA 4X65H 3Q8QB 2MINA 2YJ6A 4JY7A 1YRYE 3OE4A 2J9YB 3LYAA 4YQFA 4IJQA 3CF4A 4XRRA 2HYIC 3SQOA 1XP5A 4CEIB 1ET0A 3L84A 1NRJB 3KZKA 3F73A 3K0SA 5JSFA 3VJKA 2HIXA 1R0SA 2BEVB 3MQ2A 1ZYUA 2FZ4A 4YWJA 1ADYA 1FS5A 2YOFA 3N9IA 2D1YA 1L4HA 3ZHZA 5F7JA 3UENA 3VU9A 2WAOA 5J4HA 2Y1KA 1F8UA 4R0NA 4ZT3A 4TV9A 1VZ3A 1W87A 4YACA 1JWLA 2OCPA 4PS1A 1G8SA 3A0RB 4JLWA 4IVRA 1ECGA 1IWPB 1VP9A 1OAOC 3D8HA 3WOVA 4KI0A 1D2EA 4CQMB 3B3JA 1A9ZA 1X7YA 2Z04A 5KT5A 2OUIA 4EY6A 1OFHA 5F3WB 3ZWOA 3JQBA 4MDYA 4ZHQF 1PJLA 1G4HA 2ZI9A 4R8UB 3AERB 1X0VA 3I9V1 2BF4A 3R0QA 4UM8B 4BWVA 4OX9B 4QUAA 4ENPA 3MFIA 3SGIA 3V5NA 4EKDA 3WB1A 3WJ1A 2IIPA 1V1RB 2WOOA 4AZ3B 5LA6F 3KJGA 2CHVA 5FQOA 3R5TA 4HMOA 3TYXA 4YMUA 3L0BA 5GMOA 1XGKA 1QX3A 5H7XA 1Q77A 3OE7A 3GHYA 4LSWA 1I94B 4CIYA 1GZ6A 1YOBA 3H9GA 1RWPA 4ZEVA 1OTHA 2JAXA 1WNTA 2IP4A 4M0FA 4DR4H 4NSNA 1CQIA 2QTZA 3WGOA 2RHOA 2A7XA 1Z15A 4BDTA 4MQ6A 2FZEA 2ECQA 1OPXA 2ERXA 3EXG2 2C9MA 2PKWA 2X8BA 2NQ8A 2E4AA 4UREA 1RZ3A 3M9XA 1CR0A 4D98A 5G1NA 2IUYA 2A8YA 4HQ0A 1Q7BA 4PZ6A 1JYFA 2JA6A 4AY5A 4YAGA 5AQEA 4Z0PA 3ZWKA 1Z4KA 4C4TA 1QYCA 1V7ZA 1W8DA 1XTPA 4Y6RA 3I2JA 1P0PA 2IHTA 4F4XA 2VYCA 4G81A 3WFIA 3TL6A 3PDWA 3FHOA 1DLIA 1NV9A 5HPYB 3QBDA 2COEA 2BR3A 1EKFA 3PQEA 3F8TA 2ZQYA 1XAJA 3F2IA 3EEFA 5CCXA 3OMWA 4J8PA 3VFDA 3BRCA 2E5LH 2BW0A 1C5KA 2ZYUX 2WLTA 1RCFA 2X9QA 3W77A 3I8OA 1VBKA 1EJ2A 2O8CA 5AI8A 5K8VA 4EHDA 3U80A 1O9HA 3GC6A 2D62A 2Q6KA 1YKSA 2GTIA 1PQ4A 4BWGA 4Q4AB 4NPAA 1JXQA 2L82A 5DDIP 1YNSA 7MHTA 3ABQB 3B1YA 1NSTA 4JUZA 1NPDA 4GOOD 3PXXA 3WLRA 5JI2E 1V4VA 5M34A 3B38A 4PV7A 4IIGA 2RF4A 1P6QA 1OLOA 1OXVA 1P1RA 1TU0A 1F3LA 3ECCA 1EIZA 2HSGA 3K0BA 2VDMB 3T3GA 4CBVA 5B5SA 4ME6A 3G0IA 3IE1A 3COYA 4LHXA 5CT8A 1P4HA 1XTQA 3LBHA 1T9DA 2ONZA 4XUDA 2ID8A 3LL7A 1NT4A 4L5CA 1VL0A 2II6A 2IXDA 4ZVQA 1GT91 3IT0A 2SKCA 2MCFA 1CR6A 2NSJA 3V1TC 3SXUB 2W2XA 1Z8DA 3NBYB 4B3JA 4NZZA 1WWKA 3ILYA 3G68A 4RWEA 4IWYA 1A5AB 4YRBA 2AC7A 4N76A 2QN7A 2QSJA 1A9YA 4HH4A 4QPDA 3E2MA 5CVCA 5P8WA 2AMYA 5HF5A 3ZHQA 5JQGF 2OM6A 1OC4A 3WB2A 2X41A 1OLSB 1GP2A 3M4NA 2FWIA 5IHXA 4R9NA 4GYWA 3ZQ6A 5G53C 1U0GA 2I4MA 2WD7B 3A7EA 1O8CA 4KXNA 3GUYA 4O7WA 3MG9A 4H15A 1EEXB 4HN4B 5JFGA 2QB5A 5TX7A 5CDHA 4L0CA 4PLHA 3IDOA 3EZ7A 4G1EB 3GJTA 2X23A 4O3MA 3KL2A 2PD4A 3HP7A 2GBLC 3JAWB 4KMRA 2Z6UA 1NW8A 4JC4A 4Q5IA 3WY9A 3ILVA 2YHUA 2ZBUA 1NMZA 2YWGA 5K09A 5EAIA 3K1TA 2RAFA 3WQSB 1SKYE 1G2PA 2EZ8A 1K66A 1EH5A 4Q47A 3KVRA 3NRBA 1CEQA 2DBZA 3QLVC 2W8KA 2B6NA 4ZVTA 4LDZA 5DASA 1JFVA 2NXJA 4ONEA 2ZS8A 4ZCRA 4KPGA 2DAPA 2DLDA 1VJGA 3O21A 1CKEA 1RHMA 2EJ3A 4JV1A 1C2TA 5EJEA 3EGVA 4BZXA 4YTEA 3D5TA 5U4QA 2JD1A 1FZTA 3SQDA 4O2AF 1JEAA 1I6WA 4HMPA 3RF2A 1GZSA 2VHJA 1NMSA 3PQ2A 4Z51A 1Y89A 1FF9A 2VYQA 2PT5A 1QGUB 1RWWA 1C3XA 4J0DA 3JD1A 5E2IA 2V7WA 2J5QA 1UJ6A 4ZRNA 1FU8A 3KR2A 5FHRA 5J2TB 5MHTA 4KKXB 5AI4A 2I6UA 2XMGA 4DNFA 2QLNA 1JDZA 3I3OA 3KZVA 1M8GA 3T5LA 5FHQA 5CTJA 2NVBA 3HJUA 4J1QA 4KAXA 4DV3H 2J5RA 1COWA 1ZD5A 1M0TA 4AUMA 4DRXB 2B0JA 4WLUA 3UT0A 4EW3A 2WUGA 5B4UA 5LJLA 1NUAA 1O08A 3MCZA 3QU7A 4YB8A 1KP9A 5SZKB 1P0CA 4XH9B 1AO0A 1W1WA 3ZYCA 2P2YA 2X1VA 2M2IA 1NOJA 2QTNA 5A1JA 4WADA 4PGGA 3SKVA 2VJLA 3WQQA 3QE4A 3QBTA 3IAS1 3QHPA 1VLMA 5KVSA 2VYFA 2QW1A 4OAQA 2NSLA 2UXCH 2PU7A 3RJ0A 4WKNA 1EXVA 4G6ZA 5CA0F 4D42A 2MOKA 3LAWA 4CU5A 1Y63A 4UOQA 2GHIA 3KZ1E 5JNUA 4G3IA 4GECA 1V41E 3MYRA 2YBEA 1FTGA 1DAPA 4LVCA 4XWTA 2VP5A 4TUYF 5HJ2A 5D1OA 1ZI9A 3O4JA 3MN1A 5D1NA 1ZLYA 4F3NA 4IXNA 4A2BA 3CF2A 2AUMA 1FU4A 4I9NA 5KTPA 1BE0A 2AEEA 2R6R1 3O31A 4O29A 4XDHA 3NDJA 1V96A 2QAGA 5KFRA 4H0CA 1LU9A 4GGMX 3JQGA 2BFEA 4QELA 4YV7A 1ZETA 1Y8RB 4IFEA 4YUYA 3KSDO 4PZCA 2F9MA 4HUQA 5I5GA 2HMSA 4DLRA 2VDWB 1VKNA 4OG2A 1GGOA 3NXKA 1SM4A 4YRPA 5EKXA 1UKYA 5KOYA 1BDIA 1PKXA 3EF3A 3U7IA 1UBHS 5I5YA 1PV1A 5DHPA 4F72A 3CUTA 1WSDA 1AT1A 1IYZA 4MS4B 3VDRA 3EYWA 1EGMB 4URVR 4KRYA 1SOUA 4EEXA 4HWSA 2ZM5A 3CX8A 4ZZ1A 3TIGA 3WHLA 5ALVA 2VDQB 1VB3A 3K53A 4M8NE 4KHPB 2WYOA 4FK8A 4MCHA 5ALJA 4JI3H 3MXOA 1GKYA 4NK4A 3WC4A 4MIKA 1QDEA 3HA5A 1I3NA 1SCNE 5DG7A 5AM0A 4RB1A 2IYVA 3QEKA 3ZUGA 3ZV7A 5K0SA 1E5QA 3AEYA 2PKCA 3VNQA 1VKRA 5EE9A 2ZIVB 3FCEA 3DLPX 5DM1A 1HX7A 1X3SA 2XDYA 3KM0A 5D5QA 1FTWA 1ID1A 3NHPA 2JFQA 4N3NA 4DUGD 2O2XA 8ABPA 3K4PA 4G8JA 1LSJA 2JAPA 5CR5A 4DJAA 3DP9A 4FD2A 4LCEA 1SZPA 1KYTA 4EBEA 1DCMA 2G4LA 2YMLA 5JJCA 1H1TA 4J16A 1CUSA 3KAPA 4GSYA 2DKOA 5CDFE 3LA6A 3QIVA 2WB1A 2AYYA 3O6VA 4TSFA 2XZTA 1Y5LA 2NG1A 4WCFC 2FWNA 3MMSA 1NQ5A 2HF8A 4BX3A 4BO4A 3HEBA 3KJHA 5G0TA 3NFYA 2Y1DA 3LIPA 1E0JA 1O95C 3FMOB 1MQAA 2Q62A 4M1YA 2RK3A 1C0LA 4LZPA 2F8TA 4ETWA 2JH3A 5GOZA 1N0IA 2XOXA 4RMNA 1XWFA 1MIHA 5KDDA 3E81A 4WBNB 4LC0A 1I1KA 1AQUA 4CM6A 3UZUA 3A9TA 4PZUA 4KU4A 3EFHA 2PMEA 3G6KA 3HJGA 2V9PA 1RAIA 3AOEC 2AMVA 1IC6A 4RW0A 3SHFA 2Q2UA 2IZZA 1UBUS 3L0DA 1SXJE 4D41A 2VQEB 5ALKA 2CFRA 1MEJA 4YHBA 1OTXA 2O48X 5C80A 2BD0A 2FDXA 2HA3A 1KI3A 5G4LA 1EFVB 4ER0A 5E6RB 4ZALA 3GAZA 3QKRB 2CFSA 4C1NA 2JATA 3TRHA 4IUYA 5HG0A 3GA0A 3P5SA 4X1YA 2H54A 1Y3AA 1DVRA 3B13B 1B6SA 1FC0A 4C5CA 3F7TA 3DB1A 3UHJA 4LJ9A 5L4NA 4MV1A 2EBWA 2WMNB 1KO1A 3I6BA 1JJ7A 1YDEA 4A73A 4KQ9A 3QKIA 2FEWB 3RK0A 5KOHA 2JK0A 3QUCA 3WYAA 1OJLA 1Z82A 4ZJYA 4QZVA 1DX9A 4CFYA 1ABFA 2IXEA 2O8BA 1GPLA 3GMIA 3ESBA 3Q7QA 4GAEA 4LJLA 4Q12A 3LBYA 4J03A 3JSXA 4PG5A 4RZ3A 1VLVA 1JPNA 1G16A 3VHXB 1I2ZA 2CDRA 5IC4A 1J4AA 2H2FA 2AYZA 2X9NA 4Z9YA 5K8IA 1N7IA 1L5VA 3NHWA 1JLKA 3IV7A 1PJSA 1N5MA 4KLCA 5ICMA 2DHDA 4MQEB 4LJKA 4JYAB 1E20A 2OBFA 3EOAI 1P1FA 4B3XA 1NXWA 5H82A 4NONA 2DPHA 4CC6A 1U0SY 4X64B 2PV0A 4A15A 3H18A 3R9XA 4C03A 3PQ4A 3VKWA 3DTTA 1HEYA 1RRPA 3T3IA 4DPMA 1CF2O 4GBGA 1DDGA 1IY8A 1RAGA 2V4RA 3SM3A 1QONA 3T1QA 4QU8A 4FC7A 2BTQB 4FHFA 2VT6A 1R0XA 5FRDA 1AIPA 1K1EA 1JSZA 5I4CA 4AWXA 5GIPE 1HTWA 2OCBA 1ADFA 2RG7A 4U63A 3VR5H 3CQZA 5B1IA 2YY6A 5FUMA 1QQ5A 4BMDA 1XDDA 1X70A 2UUCB 2XMSA 4LFAB 3FPSA 4KAFA 3EQZA 4N40A 5DIZA 2OV8A 3QVMA 3FW1A 4MW7A 1C0KA 3D7NA 3IN5A 1GTG1 2QM3A 5F1YA 1JHRA 5KPJA 4FS8A 1TCUA 1T5SA 1Q3TA 4QFDA 1M6WA 1V26A 2IZ5A 4PLCA 3VH1A 3HKEB 5JMTA 1B15A 4D3XA 4Q9AA 2OP0A 3A26A 1NVMB 4PGAA 3JARB 4OU5A 1V9PA 1R37A 1BE8A 2YTZA 3OCWA 4L78A 5J2TF 1H2WA 2EVWX 3RGWS 1BIFA 1KEVA 5IKOA 5HKLA 4ABTA 5IJ9A 3IDZA 3WL7A 2A94A 4ED9A 2ZRNA 2P40A 3Q11A 1DAHA 1E2EA 2PFKA 3V4PB 1I3QA 1AVTA 4BNGA 2UYCA 3RFFA 3U7RA 5JY6A 2Q5FA 2O9JA 1RIFA 1MRSA 1AHPA 3THXA 1ESDA 1M7GA 2H48A 2H1VA 1WAMA 1QX4A 3IUMA 3LBFA 2Q41A 1P61B 4B32A 2BH2A 4EENA 2E21A 2ZRBA 4LZNA 5CFZA 4UCXA 1BS9A 1QJCA 2OD7A 3UMGA 2IZ1A 5I01A 4HDCA 1KKMA 3L01A 1NVEA 5BORA 2PZLA 2QEQA 4GKBA 4DHEA 4C6SA 5D51S 3S68A 1LV7A 1G8YA 4G1VA 2HQBA 1JLSA 3NW9A 4QM6A 3WDLA 3B82A 1R88A 2D8AA 2VJNA 3W1EA 1JNXX 2COIA 2W6PA 1KYQA 3QEBZ 4AY3A 2AN1A 1FX1A 5IFLA 3DDSA 3SF8A 5FOTA 3D3WB 2Q3JA 3DDHA 1ZM4A 3FNEA 3JYPA 3RIYA 4F4ZA 2VA3A 3M6MD 3TINA 4BY7G 2P7HA 1MP0A 2QQFA 4KMMA 4E5VA 2VWGA 2R68A 3UAZA 3OIYA 2MR5A 2FWRA 5T67A 3GEGA 3P9CA 4MR8B 1NU8A 5BSWA 1N2JA 5I9SA 1D7OA 1AKVA 1T15A 2IOQA 2OC4A 1PG2A 5KQPA 4RAZA 1BHO1 2B3DA 3Q1LA 4X5OA 7ABPA 2FWAA 8ADHA 2WNSA 2BZ1A 2JG3A 2Q2QA 3CN7A 3LHSA 4G0VA 4DXAA 2FW7A 3L8DA 1ZUD1 4ZIRB 4IUCS 3K9QO 4XPIA 1RXVA 1M1YE 1WD5A 3BGDA 1Z33A 2H1IA 3EG9A 2HTFA 2J3LA 4RKFA 3RRZA 2GO1A 4AZ0A 1OH7A 3FNRA 5E6UA 3U19A 1FTNA 1W88A 4ZXPA 3AZPA 1KKLA 4IOMA 2IV3A 2BZGA 3PUZA 1N32B 4X7PA 2R9VA 4DCSA 2XUJA 5KJFA 1CR4A 4JLSA 4PC1A 1CZOA 3A6DA 3A9RA 1QGOA 4N0PA 3KSZO 1X1CA 2E87A 4N5LA 5FI3A 4GPIB 4OQNA 3LGSA 1M34A 1OIVA 3FZGA 5B6JA 2C4HA 4RVFA 1L5KA 4Q66C 3GP8A 5KYYB 1RPNA 3BIFA 4ZOCA 2E89A 4N8EA 5DWVA 4PC2A 4HV4A 2O5CA 2ID9A 4DMFA 2I65A 1KY4A 3OM1A 4R40A 2Q50A 2Q2TA 3QMMA 5H68A 1PFUA 3BYZA 1WZNA 2XUIA 3AZQA 1G17A 3ESXA 2CMHA 4B35A 1V4YA 2CLOB 3O26A 3IUPA 3N6VA 4L5JA 3OESA 3FUWA 2P3OA 4OQPA 2J6TA 2R79A 3I0MA 3WICA 1AKNA 4YI5A 4ECUA 1QQ6A 2AXQA 4RZUA 4A3EG 5KFUA 3U9LA 4EZBA 1KMHB 3K8ZA 4U7PB 1OV6A 2C84A 3F1LA 2C5EA 4XX0B 3TBFA 3WNVA 5JPDA 3QU2A 4W6ZA 3CIFA 5LYJB 1XTUA 3SYKA 5E7MA 4Z7JA 3IAEA 1JEQA 3HB0A 3QF4B 5CK4A 4FZ5A 1EB9A 4CGZA 4JXKA 3UUEA 4XYLA 3TR6A 1RZVA 5J4KA 3M33A 3UQYS 3WIBA 4HEA1 3JQ9C 3LU1A 4U5QA 2HDHA 4WVLA 4E5DA 5KJCA 4YRTA 1P4JA 1PUIA 3LT4A 3ZDCA 4L75A 4RFVA 1F0YA 2I4OA 2LE0A 2IELA 4FN4A 4BASA 2JJQA 3INNA 3TNJA 1Z4QA 4EYKA 5FNZA 5LFAA 2VEOA 3IP7A 4WBNF 4R31A 2QMUA 5EOVA 2LP4Y 3U0GA 3K2QA 4KBYA 4I5FA 1PR4A 1RZUA 3CVJA 4X8HA 4CQJA 2V7UA 1LS1A 1ZBQA 4ZCMA 4G26A 4CEJA 4F4IA 2GGSA 1HR0B 2N3ZA 1Y1TA 1GYPA 5T8KC 1U3GA 4TKUB 1AHNA 2RH5A 3F1KA 1OYYA 4G56A 4IOLA 1QYXA 3CEHA 3UIEA 1ZCFA 4HLDA 2NUPA 5KSWB 2K2QB 1OXTA 2WA1A 2C58A 3EULA 4BKPA 1SY7A 1QV7A 1L9XA 4BJ5A 1ZHSA 1VJTA 5CJ2A 3MWKA 3IQWA 4OHFA 4Q3BA 4KO4S 3TB4A 2VF4X 3IERA 4OUDA 2PH1A 3MERA 4NMLA 1DO8A 2WIBA 2IIQA 1N9GA 1V1JA 1M6VB 1RJDA 4ID3A 4RD2A 3KEQA 4RPIA 2AC4A 1FMTA 3AVTA 3FBGA 1OWMA 3R3ZA 3ZV4A 1K7EB 4ZO7A 1JHPA 3DWIA 3VRHA 5A3JA 1HDXA 3TW6A 4RA9B 1BWPA 5TSDA 2CF5A 1W75A 1FW8A 1XLUA 4YAWA 3Q3VA 4DSOA 1SFRA 3UAYA 3EVTA 2XR1A 3H1AA 2QRLA 1KBZA 5KT7A 3WAGA 1O0SA 2PMWB 1ISSA 5A6SB 1UBTS 4BXOB 1E4OA 3L06A 2B1JA 2FJ0A 1KOLA 3QVKA 3I1FA 2X15A 4MWZA 5I9IA 3CT6A 2CNVA 3CVOA 4HN9A 3UC9A 2ROQA 1EHYA 3QX3A 4HXGA 5KFFA 3K09C 3KOXA 2IS4A 2FI1A 3CJRA 4LSXA 3OBIA 3OTGA 5BOSB 2P75A 1Z63A 4NNPA 4FB4A 2LD4A 2VJOA 2YZKA 4QG7A 4ECRA 4F96A 1QP7A 4OB6A 4FFPA 3EDCA 1LB1B 4O7RA 3VI3B 2R11A 4IS2A 5A3SA 4CHGA 1HE5A 4ZDKA 4FCVA 4GNRA 2WZDA 5K7SA 4REQA 2NMVA 4JB8A 4ETMA 1J99A 4XXHA 1JIKA 4I9GA 2HGSA 5FD5A 3UN1A 3T3MB 5L4SA 5JOQA 2CEKA 5JSUA 4OKIA 3BX1A 4J0KA 4XTRA 1DRVA 3BKWA 2BGRA 1F2DA 3V00A 1NRWA 2Q7OE 1OYVA 4U6SA 2H17A 4BQEA 1U7PA 4PICA 4FB5A 2FE1A 1CY1A 1RWXA 1ZI8A 1OX6A 4CF5A 4ZK2A 3H99A 3RRJA 1ESMA 1JAYA 3HKCB 3V46A 3GFFA 2VJDA 4BNHA 5KYXB 2WYHA 2ZLBA 3D9QX 1SBTA 3FCXA 4A0HA 5C44G 3GA5A 4MJXA 4AWAA 1L5MA 2W0SA 1XNQH 5CG1A 1WB9A 3I6ZA 3A7DA 4D81A 3JQPA 2HXSA 4WHMA 2DKFA 4DUZH 3CEJA 4E51A 2QRKA 2QX4A 3BFVA 2WJYA 1IBCA 3LOUA 1MJ5A 3DEFA 1CZLA 1RBMA 3RI3A 1UPAA 4V0LA 2VK1A 5I4KA 1NI5A 3PQFA 5EFZA 2HQRA 3DMRA 4P32A 9LDBA 5KFIA 1B33N 3AW9A 1QVVA 4B7ZA 1T2VA 4F3RA 3BMQB 1JRLA 4LY6A 2RJNA 3L8HA 3GRUA 4L4ZA 4NXMH 2FOLA 3EEYA 4ZHQB 3IOCA 4DR3H 2GOYA 1V47A 3FR8A 1U2QA 3QJ5A 4HQOA 1SQ0A 3IUQA 5FXMA 4LJAA 5BQPA 5C8YA 2C99A 1JG7A 3KTMA 2Q3HA 4AMYA 2WJZB 1BVRA 2NNLD 1EUDB 1ULBA 3TFQA 1XDNA 1DWOA 4RA6A 3KIPA 5U9CA 3CJQA 5ICGA 1IWOA 1LF0A 5IJ0A 1QYRA 5AW9A 5IC6A 3HHPA 4PNZA 3MELA 2J0QA 2OPHA 3RR5A 3FNBA 5A4DA 3C3CA 2FX5A 2HFKA 2XMPA 4OJNA 2XBUA 4QLAA 5E1OA 4DHWA 1H5QA 3W3ZB 3WL8A 5BWCA 3VDNB 2R1UA 4FS3A 3WI7A 2W7OA 4PHGA 5KWSA 3O9ZA 3K15A 3W4JA 2P1DA 3HBNA 3L6RA 2F59A 4MKGA 4YHHH 1M6YA 3BH6A 3G2MA 4PG7A 2QYOA 5BT9A 4XM1A 2PLWA 4KL8S 2X0SA 3LWBA 4PXAA 1GNRA 3UBTA 5I9BA 3FUTA 3OZTA 3W3AD 2AXPA 1GARA 3DCIA 1TAQA 4TMXA 3P9SA 3OT1B 5ETJA 4EYEA 1D0VA 2JAQA 5EMKA 3RUDA 4I3GA 5KVVA 2IEYA 1ADCA 1QHSA 4DM7A 3BERA 2LRHA 3TWOA 2HMTA 1NURA 3BH0A 2TECE 1MH9A 3K0HA 3QEOA 4JBIA 4MB2A 3RGXA 3T7KA 3W5SA 2A9RA 4QC2A 1RRGA 4L3OA 1D8TA 2YNMC 3ZN2A 5I7HA 4X94A 2CVFA 5CLGA 4B79A 1ZICA 5KX5A 3UM9A 2C1XA 3HOYG 2FTKE 1FYWA 2R8PA 2PXAA 4LMYA 1AKMA 1XYVA 3FETA 1RLOA 2IF2A 3HKDB 3RVMA 3ORSA 5JYEA 5JS6A 3PKZA 3O2SB 3PEEA 4P1ZA 1KP3A 1D04A 2CFTA 3QKTA 2IPAB 4HVLA 4PFKA 2P2NA 2R4TA 2DR3A 4RKRA 3GQBA 5IJAA 3R6LA 3ZE0B 5PGMA 3Q5DA 2GZ2A 2YIJA 4JQSA 1KFJB 4E14A 3LV8A 4NFSA 1S3FA 4H77A 4D1YA 3WO1A 1U9IA 3NRJA 2HJHA 4JBLA 2JGIA 3LO8A 1GCIA 4ZDIA 2HBYA 4JT9A 4HAZA 3QFTA 4B6EA 3GLFB 3I37X 2AWOA 3NV7A 1EGVB 4F9TA 3RO7A 2PGDA 3FHCB 3MBKA 4GOXA 3RB0A 2ZUEA 1ADGA 3ANXA 1K8RA 1HSOA 1QYIA 1YUBA 3KLPX 4EKYA 2ZCUA 1TQ2A 4ND2A 4Q0MA 2QE7A 1FLNA 1PE0A 2OHHA 3B48A 4Z86A 4JNKA 4ANFA 4UHDA 3A25A 1UOOA 3AINA 4NXNB 2XSZA 3RC7A 1UDAA 1KK0A 3EK2A 1TWGA 2B21A 4Y9UA 5B3JC 1JA1A 3PEYA 4WCVA 2HGWA 2P9ZA 4ADSG 3P2YA 3IRUA 5JQGB 1IM8A 5LYJF 3EWNA 2VK2A 4RZSA 2JFZA 3IUBA 3PR5B 3LE8A 4OM7A 4AQ7A 2DUJA 3ELBA 1WRVA 2QJOA 2C20A 2GSDA 1MB3A 3K3PA 3FKSA 3E84A 1SEIA 2G70A 4R2JA 4LCBA 3EWIA 1TAUA 5I4IA 2ZZNA 2IYTA 3H6KA 3HE3A 1LPMA 2B8NA 3W06A 3PDIB 1FYEA 2W7PA 4JLDA 3CKMA 3ESDA 1G19A 5IM4F 3LRXA 2ZYVX 4NJEA 3NG1A 3HXKA 5EIAA 5CFLA 5SY6A 1O89A 4H9GA 3C14C 3FE2A 3FFBA 4C7MA 3E3MA 4HVCA 2X77A 3TQCA 3W6NA 3EIQA 2GAIA 4LTDA 5LMUH 4UCFA 1JFSA 4W1PA 1MC5A 5JFOA 1G8HA 4ZCTA 1GDTA 4O1HA 4LF5H 2QTCA 4OI2A 3NCHA 3E6AA 3FPCA 1EFDN 2BUCA 2FSHA 4YPOA 2JFXA 2A84A 4R2LA 3TTSA 3O2QB 2IS6A 2NVWA 4OF4A 4DC0A 4G0PA 1O54A 3V4VB 2OSVA 4LHYA 4GMDA 5KYVA 5C7YA 5HR5A 4YBZB 2VZEA 3NUAA 4DEYA 4EKGA 4O2AB 1J9GA 3T54A 3C5VA 5DYWA 2VF8A 2RGYA 4YRKA 4TYQA 2WSBA 1I1OA 5JNWA 3HOUG 5CD9A 1CIPA 1WPXA 2R6AA 1OXBB 4UUPA 2CLCX 2PMBA 1VCOA 4PCVA 4FR5A 4JYZA 4ZYTA 4ER6A 1JIHA 3DBLA 2JGDA 3QA9A 1O97C 2C35B 1AURA 4BE7B 3CVWA 5REQB 4NYEA 1RMYA 1CF9A 1F0KA 4EI8A 4PU0A 2OECA 5HOQA 4LQLA 3IEVA 3HBAA 3QJYA 4UD2A 2D1SA 2EC5A 1E2QA 2POCA 3FIUA 3M83A 5IXYA 4K6GA 3SI7A 5DLFA 1VYHA 2OORC 2YASA 2HK7A 3KKPA 4AYWA 1UJ4A 4MRNA 3M5WA 4CMJA 1SG9A 1Q95A 3AHJA 4KNYA 3PJDA 3NYIA 2ID4A 4WJZA 1P9WA 3PKJA 1Z2NX 2WV9A 1MXHA 1E8DA 1U81A 1W85B 2CF6A 3OBBA 5BUQA 5HF6A 2YQZA 1T1JA 3D3QA 4Q4LA 1GDDA 3QK7A 1J2JA 1M74A 1L1QA 4DLZA 5I5VA 1B0ZA 2XGSA 1XF1A 3EGCA 3ZWDA 3A3PA 1TYEB 4XGKA 2H11A 3VZRA 3HDTA 1SJ9A 4OX9H 2HLPA 4KPEC 1HOXA 2YJ5A 3NS7A 4QYTA 5DLEA 3FB4A 3D7LA 1G5FA 4JI0H 1OIXA 3RFUA 3RFXA 3LT0A 2F9LA 4ENVA 2QTAA 4K6OA 4NV1A 3BF8A 1IQRA 4WRRA 2W7TA 2HHAA 3QIAA 5FAKA 4IYRA 3EDQA 1RAFA 2G40A 4QXRA 2AFVA 5IAAA 2VFAA 1X8XA 3D1JA 5CCDA 2W2TA 4IDPA 3NNDA 1GLGA 2IIBA 3MWMA 4B7UA 5HBRB 1A0GA 2GJSA 4GX0A 2IU6A 1EWQA 2YWBA 4X1IA 3G79A 4JDUA 3IEPA 1XQ1A 2XUKA 3G9ZA 3GFTA 3SFVA 4LXTA 3PUHA 1UDCA 4DDHA 3JALB 4QIWA 4NBNA 3W5BA 1RI3A 2XMCA 5TGZA 5CLJA 4JBYA 3W2TA 4LZLA 2HT6A 1PGPA 4AFNA 4JKOA 3AM5A 3HY4A 1FTYA 4AN1A 2PUVA 4FNMA 3CLKA 2N1BA 2ZU6A 3RB8A 5JVDB 5IASA 5AKYA 1YZKA 1MIOA 1N5OX 2O2HA 3KYCA 5TGDA 4CDRA 1EJ0A 1QWSA 5DK6A 3U6BA 3BN3A 2WU1A 1WXHA 1B4DA 2JIOA 4AX4A 2B98A 5F33A 3OMLA 5JDIA 5TB5A 1MB2A 1KU0A 1OA1A 1NVXQ 2PRKA 1HLPA 4DR1H 5KFLA 2ZITA 1MAHA 3Q8KA 4WZBB 2PKYX 1AO3A 2DQKA 1M2VA 4KWHA 1QUFA 3BTUA 3LOPA 3HCFA 4NCXA 3IEKA 3N59A 1A72A 3T38A 2HU2A 2W9CB 2J0VA 3QKSA 4FT2A 4S1VA 1ZDMA 4GOKA 4XYMB 4EVRA 3RH0A 1F12A 3JQ8A 4R1TA 1OI3A 1RYEA 4IAJA 3ICPA 2ZJ6A 5EJIA 3JQCA 2PUCA 4MQ4A 4GX5A 1YRBA 4IJKA 3JYOA 4LXGA 4P80A 1NUUA 3T0GA 3UW1A 2ABJA 4JLBA 1DV2A 3W2GA 3ELUA 3GBVA 2FLPA 4YPFA 5DP1A 1XD2B 1GN8A 2QTMA 4BHTA 3GN2A 3PGXA 4NVRA 3U3RA 1LK0A 3GGGA 2B4AA 3KALA 4C0LA 3MTQA 3KJEA 3P5BA 2ZRJA 3DEIA 3SIXA 4BWSC 4I4IA 3CLHA 5IH3A 4I1OA 2Q8PA 5BVGA 2ET6A 3GRFA 4N0EA 5BSMA 4OJQA 2P7IA 5CX1B 4N47A 3I4MG 2CV2A 4GPBA 2D5BA 5HHTA 4O4IA 4LA4A 4AM8A 2IKSA 2LIVA 1NFFA 1LRKA 3TNLA 4BWFB 1S68A 4PNPA 1K1SA 2H63A 1P0MA 5F21A 1ECCA 2NVXA 4W5RA 1AKUA 4RVHA 5GGXA 1XRQA 2BHNA 4AJJA 4HYEA 2F90A 2IPLA 3WLNA 3RVOA 5FP0A 2XA2A 3NP9A 5I9LA 2ZJAA 1J33A 3TIXB 2VT7A 2DT8A 4CG2A 5C1BA 2HNKA 5KFHA 3ELWA 3KJQA 2PK3A 4YJGB 1DEXA 2Y68A 5DHUA 2H7XA 3ULKA 4PLWA 2X8LA 4AJ9A 3IAM1 2HGXA 4AW9A 4MCAA 1XYGA 1IJFA 1Y6RA 1TTHA 1EM8A 2V8BA 3K5HA 2JA7A 3C0KA 3FHTA 4RZXA 4F9GA 2Q07A 3D8UA 1B14A 4O8CA 2ILVA 3Q8SB 4OYLA 3OD5A 3WYFA 3U9SA 1YOVB 2YDXA 1IAQA 2CCGA 5T57A 1LWNA 4FP9A 1VJRA 4IIBA 2OZKA 2HHHH 1OASA 1KP2A 3LRPA 4B82A 3IQHX 1ZNQO 3IEXA 1EFPA 3HUDA 3C41J 2GEBA 2ZYRA 2I22A 4MYSA 3EC7A 3VR2D 3RQSA 1RBQA 1HMPA 5BMVB 4IKPA 2QT9A 3AETA 1CU1A 5MF6A 3VNRA 1ZPDA 3AFOA 4G0OA 4F5EA 3SX2A 4EZIA 3CZPA 3VO9A 3GVCA 2EJWA 3HMKA 1R4AA 1NM5C 3UMJA 1I36A 3QF7A 3ENQA 4OHMA 2ZJOA 3TOZA 1C9NA 4F11A 2FUKA 2XCPA 2MSWA 1R8YA 4FWTA 5COAA 1RE0A 3P0IA 3ZK9A 2WJ6A 3EC1A 2Q4DA 1QH1A 2O19A 4AIIA 1A4UA 3OZUA 1A2OA 1LVUA 3NOOA 6LDHA 3AHEA 5A7FA 5K2OA 2YHAA 2XNDA 3L1HA 3RK4A 1E3TA 2SKEA 1ICIA 3IUEA 2YYSA 2A67A 2VKTA 4IEFB 5BNZA 5KDLA 4WNAA 4KTVE 1N2CE 4GMGA 4OXIA 5LIPA 3MBIA 1BH6A 2C2OA 4DV5H 4PZZA 2PPLA 2A5DA 1TWHA 2Q4RA 2C9BA 4YMHA 2AFRA 1MW8X 3B12A 1XZDA 2GK4A 3OF2A 2Y2VA 3SJAA 3G2HA 2OV1A 4GDFA 3O8CA 5TPWA 1RS0A 3ZD7A 1RWMA 3GEHA 1F9AA 4PC6A 1J00A 2W6JA 3JCZA 4Q4DA 2Z08A 1RJWA 3MF4A 4C4XA 4AYBA 2DG2A 2JBWA 4EHKA 1NQAO 2GBCA 1XTVA 3CKLA 2GZDA 2WF6A 1Z38A 1O58A 3LYHA 4P92A 1B76A 3KLBA 4MOWA 3GAMA 2AW3A 1NX6A 2CLIB 4FOPA 2N75A 2WUVA 3DTFA 2P6UA 1QIJA 3D6HA 3VO1A 1TWFA 1LK7A 2NTNA 1EVLA 3M7IA 3NKVA 2IV7A 3GLIB 3IEUA 1RIIA 2G71A 2CJWA 1ZRHA 4RANA 2IYRA 3O92A 5DX8A 2KHZA 4FGSA 4QECA 4ZCLA 5FLYA 2ZIXB 2JVKA 3CE9A 5JSYA 2E2WA 5JRJA 3CR7A 3DZGA 2IHKA 1SCUB 4YMSA 1KE1A 5BR4A 2VPIA 4BEJA 2PVPA 3U26A 2H31A 2BVNA 3TEMA 5G3ZA 3K20A 3QJGA 4RSRA 2VK4A 2Q9AA 5LN1A 2WU8A 4NENA 1Z7EA 4ZT4A 4R2WA 2YL2A 2ZM6B 1MAAA 2GETA 4DLSA 3IIIA 2Z2YA 1ANKA 5B36A 1KSFX 1N48A 3HO1A 2IP2A 4N82A 1MQSA 1DP4A 3GTMA 3DQZA 1DBPA 3EVCA 1NJ8A 5HKKD 3OSPA 1K4MA 3W7VA 1LBEA 1SPXA 3AXSA 4IDQA 1DHTA 4Y2YA 4KHPH 1A9RA 1EINA 3KR9A 1R5BA 5CDUA 2IDZA 1E4EB 5HX7A 1O4VA 4ARUA 3RSHA 1REQA 3W0LB 2MDTA 2VDRB 3PWZA 4UDOA 3HNOA 4YCDA 1QNFA 3BZUA 4FW9A 5EINA 3CVZA 1JTFA 2K4MA 5LQRA 4Q9DA 2W2NA 5DTRA 3CPEA 5KYWA 1NQUA 2A59A 5IS2A 5DP2A 4NYIR 1RYBA 1Y98A 1G64A 2VAWA 2AJCA 4Q05A 3T5PA 1CQJB 4W5NA 3FM9A 4GOLD 4WNCA 3N40P 4FFNA 1CKOA 2GM5A 1QHNA 3ORQA 2F1HA 1KDRA 4QGBA 3QUSA 1E6WA 2XAUA 3BBLA 1IEXA 2PGAA 2X0FA 4YP7A 3B52X 1PVDA 2YWRA 1FYDA 1HORA 4TWRA 5LJIA 1RAHA 3M6XA 3C6ZA 2XGJA 3FJOA 1E98A 4UBJA 2ZWPA 3M2TA 1Y37A 3GFBA 4RDIA 4ILKA 1Q7RA 3E9QA 4P4TA 4QBIA 4DUGA 4OHWA 5JVDF 5B58T 5AOCA 3ASVA 1KOJA 3AIOA 3OM9A 1C4XA 3LDFA 2PZ8A 3FCAA 1JIXA 2CB0A 2ZAMA 1N5JA 1C7RA 3HDJA 3GWGA 2O3JA 1AZWA 2VTDA 4FNGA 5DM70 4IGKA 5KNDD 1R9NA 2WMDA 1C14A 3A1TA 3Q1KA 3DBRA 2VQEH 5CITA 2VUSA 5FO1A 3DNFA 5TR9A 3FVWA 1K88A 2I8AA 4C06A 1IZ0A 3H4DA 1NZDA 2OKGA 3A6JA 4IFIA 4BATA 2GCIA 3QY0A 2FMIA 2ZYDA 1P5FA 1CW2B 3SC3A 1IOVA 1BZYA 4OPMA 1IIRA 1J70A 4E2YA 2UYQA 1FNSA 3FOWA 4H31A 5DRTA 5BOVA 4OHOA 8LDHA 3BHJA 3CLUC 3TQOA 3GCDA 2J5BA 5F73A 4J1SA 2GHTA 4XWKA 3JZDA 1MPXA 4CQLA 5JCZA 2I5PO 1AMUA 2QSUA 1LA2A 4ND5A 1C7ZA 2OWOA 4XUGB 3DLCA 1ZUIA 3LDAA 4D8UA 1FBTA 4LBZA 2Z3VA 3QUAA 4CTOA 5T4BA 3CZ9A 1U1FA 2J0EA 4ZI2A 2HREA 1EQUA 1WMBA 3FY4A 1SIBE 1ODKA 3CNEA 4C08A 3WYEA 3DMTA 4HPWA 1WHTB 4CCAA 1TC2A 4U9UA 3M9WA 2IXTA 4B1FA 3K6JA 2BGGA 5FWYA 2HEGA 4EX7A 4DKXA 4R1MA 5JYBA 2NU6A 3S1AA 3GCXA 3R7BA 5LQDA 4HGNA 3OTIA 1AE1A 5CAEB 2VWPA 3P19A 3K9BA 2BE7A 3GJYA 3JQ7B 3C3MA 4X64H 1TVKB 1T8PA 2B20A 1ZM2A 3CNQS 3GARA 2C94A 4B45A 2Y27A 4FOLA 1PL7A 3QSGA 3ZEAA 1Q1NA 1YS2X 4YAEA 4M53A 2A57A 1J06A 2EJUA 3H5RA 2R1TA 1FQWA 2VPZA 2KBFA 2BQUA 4LJ7A 3ESCA 2C4KA 4DJJA 1DWUA 1HFKA 3DONA 4Z4IA 1I9GA 1KAQA 3DXFA 2OCLA 4BMOB 4CC5A 3C1UA 3P2JA 3KOOA 2Y0BA 1PNRA 1NVUQ 5K8CA 3MEQA 5E7IA 4ER7A 1VYTA 4KIGA 1UJBA 3I8XA 5DNYB 4J0CA 4JVNA 2UUCH 1OH8A 5BYBA 2ZFUA 1XB2A 2FPSA 1K4YA 1U80A 4KPYA 3W5AA 1KY5A 5THQA 3DD5A 3F67A 4D9FA 3BK2A 4ED1A 4NX2A 4Q19A 3AVYA 4UUGA 1WF6A 4U3JB 3NGDA 4LKOA 1MPTA 1IVNA 5K6TA 3B7WA 5BMVF 4PWQA 1V8OA 1NQVA 4R8SA 3S99A 4JT8A 2AEJA 4LG1A 2D2EA 1YF3A 2JCBA 4DYVA 3MTIA 2ONYA 1PS9A 3G59A 5I8ZA 3LLMA 4I4TB 1X1EA 3WRYC 4K9OA 1PLLA 2HWYA 3R20A 2HZBA 3IT3A 1Z4JA 4TKMA 3FBWA 4HBZA 3CLVA 4OKSA 1PEKE 3ZWMA 3EVEA 2PYZA 5IBPA 5BQFA 4UEOA 3PUVA 1PYDA 2IPMA 1OBVA 1EFTA 3N2KA 4AS3A 2FSIA 2CQYA 3AKCA 1I6UA 5AI9A 4C6TB 5EMMA 5EP4A 2XTZA 4U8HA 4EKEA 3FPKA 5EJAA 1TGVA 5BN4B 1DT5A 4OMUA 1RQNA 4NOKA 5G40A 4A8HA 4EECA 4J9KA 3EGXB 1AOXA 4Q8EA 1HQCA 3CFYA 4RV5A 1GTL1 1X87A 2V7TA 2ZSAA 3IL2A 2R7MA 3ZUPA 3KYJB 1JHMA 3PT9A 4UHEA 1L4GA 3K7EA 4NATA 3TJRA 5FOVA 3LXXA 3PQ8A 1W5BA 4Z4GA 2EATA 4E21A 2R8JA 2O8FA 4JJGA 3VJRA 3R77A 2VBGA 1XJCA 2SECE 1T0IA 1X1RA 4DBLE 1S2DA 3EVFA 2EYUA 4DJEC 3EMBA 2D0DA 3BQMB 5F9HA 2DWQA 1APBA 4LFCH 3OE1A 4ZWNA 1YJAA 4LYFA 3LXUX 2GBPA 2ZWIA 3U3KA 2JDID 3AB8A 4UUBA 2A9VA 1YTLA 1EZ1A 5BXYA 4UM5A 4O7ZA 1ONNA 2CNNA 3CXRA 3LCJA 3C48A 4F3KA 1W6RA 3EXIA 2XDAA 2C2DA 4Q6WA 4O82A 3BIXA 4JCCA 4ZICA 1XQ9A 1QE3A 2P9QA 1YD7A 2H3EA 2X7XA 5CVJA 2VP9A 1F1BA 1UJNA 3ZBQA 2DWPA 3DH0A 5IT9A 2ZBDA 5DZSA 1T5LA 3BDAA 5DI3B 1UBFA 4H59A 2AOUB 1RJRA 1EVYA 1UOEA 4BFLA 2R7KA 3AKDA 4AULA 3OOWA 3ORHA 1FFXA 2IU0A 4FS1A 4II7A 5BSFA 1OBFO 4X9XA 2YKGA 2JFVA 2WABA 2EIYA 3L9WA 4TS9A 1XN1A 3ITEA 3GK3A 1VKHA 2OE2A 3D2BA 2WTXA 3GNSA 4XE5A 1XNJA 4MH0R 2GPSA 3TI7A 4TQGA 1HO3A 4HPJB 4NS4A 3WGLA 4OLJA 4XDGA 3AWDA 1ECLA 4UOEA 5EJ8A 3LDGA 3UJCA 1XKTA 3LQFA 2V0NA 2IHZA 3WLMA 1LEHA 3K96A 4R9SA 2OHVA 4PPNA 1MW9X 1G8AA 2FMHA 4PAGA 4Q1VA 3KSMA 1KZ9A 4MLCA 4J94A 2OWDA 5CPBA 1NVWQ 1XMSA 1SKQA 2OLSA 3DAAA 2XXBA 2Y1FA 4KQ6A 3E9EA 4IZIA 1SKBA 4KXMA 4YV2A 3B3QA 3BHNA 2QPOA 1XZNA 1ABBA 2RH4A 5DGIA 4B44A 5IHPA 4K9DA 1X80B 3IPCA 2BEUA 2ZKIA 4HF7A 4R7GA 1UR5A 3DMPA 4A3BG 2DOKA 2V0GA 1SKUA 1YBAA 1T3HA 5D3MB 2ZAOA 5EZYB 3K3VA 3EGWA 4JP2A 2H29A 4UEKA 4Q7MB 5C4GB 3SVLA 1ZGHA 1FIUA 2ZUTA 3HCRA 4GKAA 2JAWA 3HB4X 4FGZA 3IVGA 3E22A 3NU1A 3RS7A 1WKCA 4GS5A 1ENPA 1GQRA 2VSFA 5E0KB 3X1JA 1LTKA 1BXGA 3V97A 3PZPA 5KFQA 2RHDA 1CKMA 3E5NA 4WZAE 4LNHA 3FLAA 3ROTA 2GKOA 5BW6B 1I0IA 1Y3BE 1RHUA 1T43A 3UYLA 1H1LA 1ABEA 1C7IA 4AO7A 2PRYA 3E0QA 4NLLA 3L2OB 1I7SB 1P7PA 4RY0A 1PT6A 3CF0A 3W2HA 4EA6A 1RPJA 4EGQA 3JZAA 3IO3A 1QUEA 2ORYA 3E7PA 3TS1A 1E96A 2QLBA 1BDJA 1VJCA 1FSFA 2ZVJA 1NBOA 4BFSA 5AXDA 4WMLA 1QYWA 4IRMA 3I30X 3TE6A 1A77A 4MPTA 5L4LA 3T95A 1JA9A 1CJCA 4OQZA 3SC6A 2ORVA 5AP9A 1VLJA 1FP2A 221PA 3IQXA 1CB0A 5TS3A 2OQRA 5DWQA 2E4UA 4AICA 1PDVA 4C04A 4IDNA 4ZEOA 4BRWA 1UZAA 1QB7A 3WNCA 1OR8A 2AA3A 2YWHA 3THWB 4DF3A 1JDJA 5KTNA 3E3OA 1SVKA 1GZHB 1X42A 2NZVG 1Y1QA 4K6HA 2CXPA 4OJKA 1JQ3A 1W5AA 4OX9Y 4B3SH 1TDJA 4LZZA 1CIJA 2GB4A 3FYUA 2M6SA 4LY0A 4ZOAA 3KS9A 1GU7A 3OEYA 3EVDA 4MKZA 1Z2OX 4WESA 5ED0A 3N0VA 2G04A 1V7QA 1I7QB 1Q0UA 1T4GA 1T5BA 4KHZA 2IL1A 3ZXYA 3BH7A 1WHSB 4I2NA 3DOJA 1P0IA 4UJ3A 4JJAA 1PBTA 1TYDE 5JH7B 1GLVA 4YAJB 1C3VA 2WU3A 1E3DA 3F6SA 3RBEA 5HIAA 1TZMA 4QDKA 3D31A 2P6MA 1U1CA 3A1WA 3MW8A 5DBHX 1DOAA 2B8EA 3A14A 4FFOA 1JIUA 4PHTA 4OIMA 4WDRA 1RT9A 2OQ2A 2P6PA 3I5YA 3HM9A 1A2QA 4LN1A 4TMVA 3K71B 4DMLA 2HO5A 4DBVO 4EJSA 4WY2A 5T3YA 1H93A 5F1OA 4HQ6A 3PF8A 1UZMA 2BFDA 4GM0A 5C53B 1FYFA 5EIOA 1NFQA 1TM4E 3BGSA 4B85A 5FT9A 4XPZA 4Y2PA 4MIYA 1QV6A 2WHPB 4AUNA 3H2GA 3H1TA 2Q2OA 2G77B 4IF4A 1SD1A 3ZCQA 3OLCX 1XXHA 4B3MB 4LE0A 5BN5B 1W4BA 3GEDA 4FEEA 2E7ZA 3OEHD 3BILA 4Q37A 4Q93A 1JVNA 3NH9A 3H7AA 2ZR9A 4FHZA 1ZUNA 4A3IG 5IEJA 4B09A 1IK6A 1PW7A 4XIIA 2HRCA 1XJ0A 3KOZA 4KUHA 2EP5A 3T06B 1NMQA 4F06A 1Q16A 2XNSA 2QRVB 4O3SA 1I9CA 4JLJA 4XARA 1X7ZB 4JL6A 1UINA 4W5HA 1WCIB 4YA6A 3IALA 4COOA 3RVKA 3ADOA 5FQNA 1EK0A 4YP5A 2J3KA 3OKPA 1CF4A 1WTAA 3UWOA 2GAJA 2X8AA 3BZBA 4U2EA 2O5EA 3TDKA 1Z62A 3TLEA 4ZI7A 3IUNA 2D5AA 2BDTA 3C1OA 4FD3A 4I4TF 1CKNA 1Z4OA 1DIOB 3W5VA 1ZY2A 2EYQA 3Q7TA 3OQNA 2WP8J 4PIMA 5AOVA 1AHIA 2FFBA 1WS6A 3ORFA 3K5PA 4BLQA 1QPGA 2DKNA 3HU3A 1JEOA 4X45A 1E2UA 3U7JA 5ALDA 1Y6FA 1CVRA 1DBWA 3R9RA 4DIMA 4N65A 3O1JC 3EDYA 2P2DA 2EBUA 2W8BB 4PO3X 3LHIA 2Q1SA 4BZWA 2GCPA 1MO6A 1G66A 3I2YX 4OFBA 5BPHA 4B3BA 2IYYA 5LCXA 3I9KA 5A05A 4DLNA 4JYBA 2PE5A 4DR2B 4H1UA 4UVGA 3M8KA 1JJAA 2R2AA 2XVXA 5KMGB 2BTEA 4NYIQ 2QUBA 1JMKC 5KYGA 2OHXA 5AW4A 3DQPA 2IJGX 1OGJA 4BBZA 1M66A 2QD2A 3DPSA 3M1LA 4OQQA 4CR6A 4Y2UA 2I62A 1I5RA 3N44B 4HDNA 2IXAA 4UAGA 5HP4A 1NQXA 3LCUA 1JXMA 2Q6VA 3EMVA 3I42A 3LG2A 4KLAA 3VU1A 4G0MA 3HP4A 1USKA 4LF4B 2GDJA 2NU9A 2X0NA 2ALJA 1N8KA 4GLLA 2E82A 5HM6A 1DBRA 3TB6A 5FBWB 3PXDA 4MQBA 3VYWA 1GT6A 4YP3A 3LLSA 1BFKA 4CU2A 4WDQA 4X1KA 3VC3A 2Q29A 3L6CA 1R9MA 1E7QA 5EN4A 1W59A 1OI4A 1PJ2A 3AEQB 1RXWA 5T64A 3I2GA 1LKZA 1MBZA 4U7JA 2BFMA 4MJ7A 4J2HA 2W2OA 1K06A 4PZPA 2ALZA 2FAXA 3WZMA 4BB9A 1L6IA 2LXNA 2Z2JA 3ONEA 1P45A 2FG7C 3SCZA 3WSWA 3TTWA 1ESCA 3MCAA 4GE0A 3D4PA 3FDZB 1PDWA 1FNNA 1G291 2QLMA 4GXTA 2FE3A 6CHYA 3O3NB 4RADA 1L8LA 3TQFA 5ENZA 3D64A 1VECA 5ES3A 2HW8A 4KQHA 1QWOA 2AF3C 3A9VA 4PE5B 3D8RA 4A3KG 1EDBA 4PYLA 4XB6B 5L3SB 4F3TA 1P9NA 2FEOA 2H85A 3GJRA 3MS2A 1WTCA 2XOEA 5FNVA 1L4BA 1N2GA 5A9SB 2IEZA 1WL8A 3NVDA 1UDWA 4K88A 2XWBF 3L7CA 2E4VA 1NN3A 2E3JA 1YL5A 5JROA 3DCJA 3VH3A 3VXKA 5FLMG 4DR5B 2RDIA 3G0CA 3DE5X 1UK6A 2VNIA 1MU0A 1KZHA 1M76A 4WXPA 1JJIA 2EX1A 4G9GA 2VBFA 3B5JA 1FX0B 1F5NA 1N33B 4YT5A 1UKZA 1JBEA 3HH8A 2OLEA 3I72A 2QVLA 1XHLA 2IP1A 2Z5VA 3E5HA 1IHOA 1XCJA 4H4DA 1C4KA 2CUTA 4D7AA 3MTDA 1B73A 5DYYA 4BY9E 4NXNH 3N0RA 2ZVDA 1L7NA 3DL0A 3EFOA 4KAAA 1P1CA 2Q4BA 5EZYF 2P30A 4YRMA 3LXRA 1W7AA 3P97A 4TMZA 5JD6A 4MTDA 1BE1A 4QUGA 2A58A 4V03A 4J9OA 2J85A 1NMXA 1B04A 3OTOH 1EI9A 4Z9BA 4CTKA 5HVNA 3RUEA 3QENA 5JAZA 1LCIA 3TW0A 4KQEA 4CEHB 2J3EA 5JWOA 2H1FA 2WDTA 1E1YA 3OE5A 2IHYA 1XZLA 2EKQA 4BRUA 3L7BA 2MYPA 4FS2A 1EGQA 1UEJA 3GLHB 2JI6A 4KXWA 1Z16A 3CX4A 3WMRA 2IPNA 3B36A 3OJLA 2FFJA 5KQRA 3N2YA 5L3QB 4RK1A 4NCJA 3JX9A 3SD7A 1W2WB 3FAZA 4K5QA 3EIHA 5EHXA 2C7RA 4U00A 1WUJS 3AF3A 4QD3A 3PW4A 1D4AA 4WKOA 4BV2A 1Y3IA 1K5DA 3X1WA 1ES9A 3RC9A 4IDCA 3P2IA 4L57A 4N01A 2I7TA 4CL2A 2GCNA 3HCNA 2UUAB 1J8QA 1C7FA 3OJEA 3QPUA 1Z5GA 1P0FA 3HXPA 2AG6A 2XQKA 3I9MA 3RIMA 3BKXA 3UH1A 1I2MA 4Y7DA 4EJ0A 1A8IA 3HYSA 1W1IA 1Z75A 2O07A 4Q7KA 2OG1A 1IHXA 3QWUA 4BYMA 1TQ6A 4F92B 4CMCA 4KJXA 1LK5A 3WSTA 2OV3A 4ZKDA 4IRDA 3B2NA 3M3PA 3GUVA 2BFFA 1KVTA 3IR5A 4QQRA 4B87A 1M8FA 3Q15C 4N6GA 2I7VA 3HLTA 3KPVA 5HS4A 1RXSA 2OCGA 3PC4A 4IDOA 1Q7TA 4WKPA 1RWVA 3VO8A 4CMHA 3V6KA 1GA4A 3TCXB 2DUUA 2D7DA 3DE1X 5JH7F 4HTFA 4EUEA 1K3TA 4ZAFA 1VM6A 4J0FA 3VPCA 3FCUB 4N5MA 2WJJA 1T8RA 3HB5X 1M8PA 1U9CA 1C50A 1SEPA 7MDHA 1NR5A 4HL6A 2PX4A 3OT5A 5HTOA 3T5BA 1Y5NA 2GN6A 2P67A 4B3RH 4XD7A 3PT5A 4LZJA 3DLIA 2PVSA 4MWEA 2HLNA 4US1R 1Y3FE 5CUQA 3UAXA 5K9ZA 1QZUA 5FIUA 1OBGA 3MD0A 4UU1A 4UBOA 3KXPA 2HC9A 1H66A 4NABA 2ZU0C 1OTYA 4KX5A 5DEIA 2HMYB 3BUSA 4JI8B 2HK8A 1YQDA 3IAFA 4G1MB 1UODA 2F1JA 1QHXA 3JASA 4I55A 2B7CA 1AMOA 1VSVA 1XROA 3CIOA 4I14A 5ULLA 2WSLA 3RNOA 3UWMA 2AN9A 3C3PA 2CNDA 4CE6A 5ITZA 3OOEA 2PX0A 5JS8A 1XPRA 4BY1G 3FRJA 1SU4A 4PXYA 3I83A 4L9WA 1YZFA 4EG7A 3H3VH 5LZ8A 5GJVC 5C18A 3I45A 2QT1A 1JKMA 1ZNXA 1F4LA 2YU9A 2Q0QA 3LQ4A 4QE3A 5CH3A 4LWZA 4NYJR 4GWGA 4P22A 2D7CA 2IGBA 4RZ2A 4XIGS 2OV6A 2R60A 2ZSIA 3IH5A 3DUFB 2ENWA 1SIUA 3FOZA 2AB0A 3HDYA 1GFZA 5ECYA 2JGKA 3R5SA 1K7XB 1GPMA 1JG3A 1HDEA 4A3GG 1HLDA 2HIVA 3WK4A 2HI0A 3Q3JB 1K8QA 3V2UA 4ERXA 4KGZA 2QYTA 4AP9A 1CEYA 1Z7BA 1UBGA 1KEZA 3T9DA 1VIDA 5BWVA 4MROA 3GF4A 4KYIB 1WXQA 4FFBB 1DNPA 3AFMA 5B1EA 3PPYA 5HIJA 3MFHA 4CJXA 4D9EA 2BGWA 4YCCA 1JXLA 4ND8B 4HGPA 3KPWA 3GEMA 4N4AA 4XVCA 4KRFA 1VMKA 2QP9X 2TMYA 1I6LA 2B92A 4OQLA 5J1SB 2OHJA 2ZROA 3EVBA 1RC0A 4MVWA 1L4UA 3EZYA 1N57A 1JGTA 3O1HB 4MARA 5EQTA 3HZHA 1Z07A 3HL4A 3G2OA 3VU8A 5DVZA 1BFDA 4PVCA 3RVLA 2FKAA 2XNCA 2YVLA 1RQLA 2JL1A 3JRXA 1U0EA 1XCPA 4TL6A 1GRRA 5AKKA 2QAGC 2OMEA 5A4AA 1I94H 1DEHA 3AOGA 4EG6A 2AR7A 5HMLA 5D8DA 3M6UA 4UQPA 3VKGA 1LPBB 2E1RA 3HKBA 3FCOA 3K8QA 3OKCA 4WCFB 5ICCA 1TX4B 1PGJA 4X93A 1G5RA 3CM0A 1NBME 4IP0A 2VAMA 4P3YA 5EVCA 3J81A 5K0NA 2L18A 3WLSA 2FN4A 1J2TA 1X1TA 2P5UA 1T9KA 3FXAA 3BQ0A 1QZ3A 2YQ4A 3EC2A 3I09A 1AGNA 2JLQA 4BE4A 2W2KA 3WLJA 2PUAA 2ZDHA 3KEMA 1IMJA 3INTA 3VSEA 4MP8A 2P0YA 3K6SA 3Q8LA 3UWSA 1GCOA 2IVFA 4CCSA 2OGSA 4HN2A 1VMAA 1XAIA 4P33A 1A82A 1Z47A 5KDOA 3ROMA 4IKEA 3IBFA 1KGDA 2CNUA 3BE8A 1ENZA 2PUWA 2CKDA 1OYOA 4UHBA 1NN1A 2AYXA 3MGKA 1I3OA 4LNAA 1ZL0A 2QKYA 4HB2A 3THRA 3LH5A 3WWCA 4GU5A 2VZLA 1N6RA 3E03A 1ITZA 3R3YA 1T91A 5KYUB 1RFLA 1W30A 4L2IB 2PS9A 1UMDB 3B1WA 2K5UA 4K8OA 4MV0A 1G21A 5GV8A 3GTJA 4E2XA 4A3JG 1N9KA 1XZQA 3EZXA 1QHFA 4HFNA 3UJHA 3W1BA 1WIWA 4X1OA 1XVUA 1VL2A 4RU1A 2QD5A 3AVWA 2PJZA 1FDRA 4NU0A 4MYHA 5B2FA 1NKSA 3QVTA 3K0CC 4IVPA 4Z4EA 2VEDA 2JFHA 1Z0IA 3ICCA 3HSYA 2CUKA 2DAAA 1AS0A 4DMHA 4Z53A 3KYBA 3FR7A 5DBIA 1EDDA 1O0CA 2F8LA 4LVNA 1ZK1A 3KHKA 4J16C 3FWZA 1FTQA 4YV1A 1RQ2A 3GELA 4KOEC 1QOQB 2ZATA 1LH0A 4QHTA 1RCUA 4ALIA 3FB1A 3L0IB 4Q1DA 1W5FA 1YC5A 2PH3A 3YASA 4DNQA 3JWGA 1M2NA 3MINB 4GNKA 4BAUA 1FDVA