2Q2TA

Structure of chlorella virus dna ligase-adenylate bound to a 5' phosphorylated nick
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
293
Chain Sequence
b'MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase/dna
total genus 75
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2tA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2tA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2tA01
4QJFA 1WOCA 3PO2G 2NVXH 4JG2A 3RN2A 3HKZG 5LMUQ 2E5LL 1YNXA 1QVCA 3BA9A 1N8RC 1HZAA 3NBYB 2DGYA 3ERSX 3RNUA 3I4NG 2UXDL 1B7YB 3PUVA 4X6AH 3U4VA 5FJ8G 1VQMA 1N34Q 3TREA 2IX0A 2WAQG 1KHIA 2PQAB 4DV6Q 1QZHA 1QVFA 4DV4Q 1YBYA 3KYHC 3GO5A 4DV3L 3S1NH 4DR1L 2UXCL 1Q46A 5M3MH 3MEFA 3WWVA 1SMXA 3PV0A 2E2IH 1GKHA 3CC7A 5JJIA 1PH3A 2OQ0A 1HNXL 2KCMA 4A4IA 1VQEA 1YHAA 2R7ZG 2R93G 1PH9A 2OCEA 4LF5Q 4P71A 2K5HA 3UDGA 5IYBH 3F2CA 4HIDA 5C4XG 5M5WH 4DK6C 3CCVA 1Q1EA 1L2FA 4YWKA 2LXKA 5M5YH 1PVOA 1RIPA 3S17H 1C7YA 4LFAL 4GOPB 1HZCA 4TQUS 4GNXB 3KF8B 3B6YA 3KLWA 2WB1G 5HGQA 3AEVA 2K75A 4YCVA 1K9MC 2HT1A 2JEBI 4A3FG 2AHOB 3Q8DA 5FJ8H 2ID0A 2ALYB 1W2BA 3A5ZB 1E3PA 4A3CG 4C3HH 1JT8A 2MO1A 4B3ML 4DRFA 1EYGA 3ER0A 3K7AH 4DR4Q 3CQZH 1A62A 1PYBA 2ZJPA 1VQBA 3MXNB 1VQ4A 4GLXA 4DUYQ 4MTNA 1R9TH 2QEXA 2UUAQ 1GO3E 4DV0Q 1Q86C 3L0OA 3GB8B 4KHPQ 3K7UC 5IT9c 1IXRA 1G51A 4JOIA 4P73A 4DK3C 5C4XH 4DV7L 4APVA 1PA6A 1BBWA 1I50H 1YIJA 4KI0A 4HIMA 1YJWA 4WJ3M 4POFA 1CKMA 4JI6Q 2Z0SA 2LSSA 4JI0L 1NMFA 2UUBQ 1N34L 4IOCA 4AQYQ 1X54A 4JBKA 4DV6L 1XNRQ 1N32Q 4A3FH 2VUMG 4DV4L 2NVYH 4BBSH 5GROA 3BU2A 3J81j 4A3CH 1VQ7A 4A3IH 1K3RA 4OWXB 4BBRG 4JBJA 3F2BA 1XDNA 2PI2A 3CCRA 3G48A 4XTCS 2JA8H 3M4OH 2OWOA 3KF6B 4A75A 3GTQH 4JI7Q 1E7ZA 1EQQA 3M3YH 2CWPA 5IE8A 3D0FA 3S2DH 4LUZA 3CMEA 1VQ6A 1TWFH 2HHHL 4L5TA 1KRSA 2Z6KA 4QY7A 3PSIA 1VQ5A 1VCIA 4L5RC 4OX9L 4OWTB 2D0OA 3W5OA 5C4JH 3PF5A 4JCVE 5IYDH 1NTGA 1EIFA 2YTXA 4LF6Q 1P16A 1TWGH 4H02A 3M9BA 3CCJA 2NVTH 5FPOA 3FKIH 2VQFQ 3RZDH 1AE2A 1TA8A 5C3EG 2KBNA 3S1RH 4HJAA 1XMOQ 4BBRH 4GOPC 2XGTA 2R6GA 2E8GA 4TVAB 3T1YQ 1XTDA 2UUAL 2EQSA 4JYAL 3HOXG 4J15A 4R4IA 1HNXQ 1EIYB 1L1OA 2JK8A 2ZTCA 3CCUA 4KHPL 2L15A 1JJ2A 1S68A 4L5SA 4HJ5A 5C44H 1E22A 5EAYA 4A3JH 1Q82C 1KQSA 4NB3A 4JI6L 1LTLA 4IPCA 4DUZL 4L5QA 2HVRA 4AYBG 1S3OA 2BH8A 2OQKA 4LFAQ 5GADC 2JEAI 3JSLA 2VQEQ 3HKZE 4AQYL 1XNRL 1S40A 1YJ9A 4R4OA 2AWNA 3UQ8A 1T9HA 1VQLA 3VNNA 2RHQB 5K36G 3E0EA 3S2HH 1W3SA 3W1BA 2VW9A 2WAQE 2GN5A 5M3MG 5C3EH 4B3MQ 1XNQQ 1PH2A 4IO9A 1FGUA 4MZ9A 1KXLA 2MNAA 4JI7L 1E1TA 5J3BA 1K8GA 1XPOA 1MJEA 2JJQA 1XMQL 1VQKA 3GTLH 2C35B 5FLMH 1DGSA 2IHEA 1CUKA 1E1OA 3I2ZA 5ELOA 3RLNA 1LM0A 1HR0W 3AFQA 3NC0B 4LH6A 4DV7Q 2AWOA 1I5FA 4PG3A 3GTMH 1FJGQ 2D0PA 2Q2UA 3RN5A 3M7NA 2PMZE 4QQBX 1LUZA 4EFBA 3PO3G 2FXQA 5IP9G 4JI0Q 4LF6L 1HJPA 1V1QA 1X55A 2UU9Q 3TRZA 1X65A 2I5HA 3G71A 2PI2E 2VUGA 2WB1E 4QL5A 3PIOA 2VQFL 1Q7YC 4ME3A 4OO1G 3L2PA 2CKZB 5LMNW 2K14A 2QGQA 4AH6A 1XMOL 3M4PA 1VQCA 3T1YL 1IZ6A 3OYYA 4IFDG 1D8LA 2HIXA 4YCUA 4B3RL 4R1JA 3NELA 3GD7A 3G4SA 3CC4A 5IWAL 2UUCQ 3STBD 1TAEA 3TY5A 4DR5L 2VZAA 1U0LA 1Q81C 1QUQB 2OTLA 4B3TQ 2CWAA 1MIUA 1KRTA 4Y7NH 2HHHQ 3CCEA 2VL6A 1CSQA 1YJNA 4IJLA 4A3KH 3I4MH 4DV2L 4OX9Q 2VQEL 1GM5A 4E6NA 3BAAA 4RG1A 4NXMQ 2A1AA 3PO3H 5IP9H 3K8AA 2AMCB 2CQOA 1YI2A 5IYCG 5DLQE 4BBSG 1HNZQ 3F2DA 1IL2A 1LYLA 1OXUA 4A3IG 2R7FA 1XNQL 4JI4L 2YV5A 4JI2Q 3HOWH 4IOAA 3M85A 2OTJA 4GKJL 1UWVA 2VS1A 2JA8G 3JSNA 1XJVA 2E2HH 1VQGA 1MKHA 1Q12A 4NPSA 4DPGA 4LF7Q 2EIFA 1OXTA 3IRBA 5ELNA 4QGUA 5LMNQ 4JYAQ 4PMWA 1A63A 4JOIC 1D7QA 3S15H 1PV4A 3KFUA 2K50A 3UDFA 1TWHH 1PH5A 1EOVA 2ZTDA 1TXYA 1O7IA 1YZ6A 3K80C 3PUWA 3TEHB 4YHHL 1BKBA 1FJGL 4NXNQ 2RHSB 2LXJA 1FVIA 3GDEA 5BR8Q 1FL0A 2VY3A 4X65Q 1TWAH 4DUZQ 4JI5Q 4C3JH 4YY3Q 5IYDG 4IFDJ 4UCOA 2UU9L 1EFWA 1I6HH 1PFSA 3EIVA 5M3FH 1NMGA 1UE7A 2K4KA 1WCMG 3STBC 1S72A 3FKIG 1ASZA 1WI5A 5IYCH 3CAMA 1SFOH 2B63G 5GQOA 4C3IH 1AH9A 2N3SA 3CPWA 3BA8A 1VQJA 4DV5Q 3PUZA 5M5XH 3G6EA 2MQHA 3GJXB 3H15A 4X66L 1KC8C 2DUDA 4DR6L 2WP8J 3S24A 2RF4A 2IY5B 1CKNA 4DR7Q 4OO1I 2UUCL 2JA6G 3RTXA 2I5MX 1XMQQ 4B3TL 3QWUA 4AIMA 3CPFA 4A3EG 3GTPH 2Z6KC 1X3EA 5C44G 3PCOB 4A3JG 4IFDI 5D1OA 1BBUA 3ULJA 1XPRA 4POGA 2Y0SG 2E2JH 4NXML 4WJ4A 1HR0L 1EQRA 3PIPA 3E9IA 3I55A 1IBLQ 3AFPA 1EWIA 1L0WA 4AYBE 2N8NA 1WCMH 2NN6G 1HNZL 1GD7A 3PUXA 4YWMA 1X9NA 2KENA 1M90C 2B63H 3TY9A 4JI2L 1WYDA 5IY0A 2N49A 2BA1A 1XK5A 2YU9H 1KD1C 1OXXK 3GTJH 4A3DG 2R7DA 4LF7L 5HY6A 4B3RQ 1JJGA 1L1OC 1CSPA 2BA0A 4X64Q 5LMNL 4YWLA 2I0QA 3J81c 2JA6H 5FLMG 5IWAQ 1U5KA 3HOYG 1Q8KA 4GN5A 4DR5Q 1ASYA 3ZJYC 4A3EH 1HNWL 1B04A 4BY1G 4O0AA 1VQNA 1K83H 1EUJA 3JC66 1NY4A 4NXNL 5BR8L 2K52A 1WJJA 2GVAA 3JAMc 3U50C 4X65L 3GTGH 1A0IA 4JI5L 3H3VH 4GLAC 4YY3L 4DV2Q 4UP8A 2KCTA 4UY8C 4BA2I 3A74A 1Z47A 4A3BH 3HOZH 3RLOA 3KDFA 4B3SL 4K0KL 4DV5L 3TY8A 2Q2IA 1VQOA 1K8AC 2WFWA 4GLVB 1K0RA 4DR3Q 4GOPA 2IX1A 1NE3A 1HZ9A 1X56A 2V1CC 3UDXA 4GNXA 4OONA 3T1HQ 1VQ9A 4JI4Q 4LNQA 2JA7G 1C9OA 3GTOH 4A3DH 1Y1WG 2Q2TA 4DR7L 4GKJQ 2JA5H 4IPGA 4UFZA 1PH6A 3J81i 5IP7H 3L7ZC 3E9HA 2F4VQ 4IJHA 3H0GG 3KOJA 3HOYH 1YITA 1V9PA 1OXSC 1N9WA 4BY1H 4IPHA 2PNHA 4JI8Q 4YHHQ 1NJIC 3DM3A 4A3KG 3CCSA 3JAMi 3I4MG 1CKNB 4LUOA 1SRUA 2UXBQ 1VQDA 4LF9Q 4JBMA 1IBLL 1C0AA 4UP9A 1BVSA 3CW2C 1X6OA 4QIWE 4EQ5A 3HOUH 1KAWA 4UCUA 1X3GA 3KJPA 1M1KC 3FHWA 3HOWG 3PUYA 4R4CA 3TS2A 4HIOA 4CC5A 4R4TA 1Y14B 3KJOA 2JA7H 1Z9FA 1SR3A 4LUVA 2ASBA 4X66Q 3RLFA 2B3GA 1J6QA 2NN6I 4X64L 1XPUA 1Y1WH 4DR6Q 4JV5Q 3FP9A 1YVCA 3LGJA 5H1SE 1SN8A 2AKWB 1HZBA 2YTVA 2K5NA 2R92H 5GAGC 3J7A5 3S14H 1UE6A 3H0GH 2YTYA 3M4QA 3J80c 3BZCA 4A3MG 3UE1A 3UDIA 3CCLA 4JI3Q 1HNWQ 1Y1VG 1VQHA 4JI1Q 3A5UA 2ZM6L 3S1QH 3KF6A 1JMCA 5M3FG 1L1OB 1X3FA 1HR0Q 3OTOL 1VQ8A 4KHZA 1N33Q 5DISC 2JA9A 2K5VA 3HKSA 4PZ8A 3EN2A 2Q2HA 1YEZA 2YYZA 3D31A 1HH2P 1A8VA 2NZOA 4DR3L 3HOVG 3K81C 4GN3B 4HJ9A 3T1HL 1YHBA 2BH2A 2KHIA 4CC6A 4BA1I 3DLLA 4LF8Q 3I56A 1UE1A 1YHQA 4OXPA 4Y52H 1I94Q 2IT1A 3KDFB 2F4VL 3PO2H 1CKOA 1IBMQ 4YCWA 1IBKL 1SLJA 3AYHB 1VQPA 1QZGA 2CCZA 2A19A 4JI8L 3J80i 1JB7A 4LF4Q 4GKKL 1VS0A 4DAYB 4A3MH 4UCTA 5AJ3L 1NBWA 1V43A 3I4NH 2UXBL 1Y1VH 4LF9L 1PH1A 3NBZB 3AQQA 3S16H 4EX5A 2H5XA 1OXVA 2Y0SE 4A3LG 4BY7G 4P75A 3SGIA 4UCVA 3CP0A 3ICEA 5E7NA 3W1GA 4DR2Q 4UCRA 4LFCQ 1QVGA 4EFEA 1K73C 3U4ZA 4B3SQ 4K0KQ 1KL9A 1I3QH 4DKAC 4DAMA 5C0XG 3HOVH 4LFBQ 2JE6I 4A76A 3CF5A 2R7ZH 1PH4A 2MFIA 3BJUA 4JV5L 2R93H 2EXDA 2D62A 3F1ZA 3CD6A 2NZHA 5JEAG 2F3IA 2XTIA 3GTKH 2MO0A 5LMUL 4LW1A 4A3GG 2NVQH 4JI3L 3VDYA 3K0XA 4O2DA 2A8VA 4OWWB 2ZTEA 4UP7A 4JI1L 4LH7A 1KIXA 1G6PA 3A0JA 1N36Q 1JE5A 1SE8A 3NEMA 4DV1Q 1N33L 3CCQA 4R4QA 4A3BG 4A3LH 4BY7H 3CMAA 4X62Q 3HOZG 4ALPA 2ZJQA 1UEBA 2ZJRA 4DNIA 3I4OA 3TQYA 2F52A 4HIKA 1TWCH 3PGZA 4RMFA 3ULPA 2HIVA 4LF5L 3S1MH 1J5EQ 4XIGS 4LF8L 4UCSA 2JA5G 2HVQA 1I94L 2HVSA 5GAHC 2QA4A 4IPDA 5IP7G 1PH8A 3RZOH 5D1PA 2PQAA 5FLXc 1IBML 3PF4A 2KHJA 4A3GH 4LF4L 2E5LQ 4GN4B 5C0XJ 2RCNA 3NENA 2UXDQ 3CXCA 2B29A 1SROA 2ZM6Q 2VUMH 2I5LX 1IYJB 4BXXG 2IHFA 1P8LA 2JQOA 3OTOQ 2ATWA 5JEAJ 1QUQA 4UPAA 4DR2L 3HOUG 1AE3A 4LFCL 4A93G 3U58A 4DR4L 4DV3Q 4DR1Q 3TS0A 2UXCQ 1Q1BA 4LFBL 4C2MH 4GNXC 3OW2A 4P74A 3BZKA 1GVPA 4JBWA 4EEQA 3J7ZC 3F8TA 4DUYL 3UE0A 4FDBA 1PH7A 4LWCA 4DV0L 1VQIA 3BABA 5GAEC 1PYSB 2HQLA 1PHJA 2R92G 1B70B 1OTCA 5C0XI 1WFQA 2VNUD 5JJKA 5FPRA 1UE5A 1VQAA 2N78A 1IBKQ 1VQFA 3NBHB 4P72A 4GKKQ 3RR5A 2UUBL 1N36L 5AJ3Q 1N32L 4HJ8A 4HJ7A 4MNOA 3ULLA 4DV1L 1B8AA 4JC0A 5JJLA 1JJCB 3HFZB 4X62L 4BXXH 3I7FA 3H3VI 1G291 3EBEA 4A93H 5D1OB 1H95A 2CFMA 4KLKA 1J5EL 4GS3A 3PN1A 3HOXH 3CCMA 3CC2A 4PZ7A 1RL2A 1MJCA 5IYBG 2ES2A 4PZ6A 1E24A 2GVBA
chains in the Genus database with same CATH superfamily
2D9UA 5KG4A 3RN2A 3DUZA 3HKZG 2XIWA 2F0SA 2FFKB 2K01A 5LMUQ 1PTOC 5BPHA 2RVLA 1EWHA 2RDIA 2CVRA 3L3OC 3LWEA 1WCMB 1M4VA 1ET0A 4B9XA 3FKIB 4O3SA 1QVFA 2B63B 1B33N 4G3IA 5CB4F 5JH7F 2K33A 3VYUA 5KG2A 3TIGA 3MEFA 2FK3A 1SMXA 3PV0A 3CC7A 2M9VA 4QF4A 2OQ0A 2R7ZG 4A4IA 1VQEA 2R93G 4LF5Q 3MJFA 2W6PA 4P71A 1RCVD 4QUFA 2N88A 4A3EB 4YJ3F 4FBUA 4ZUJA 1K83B 4DK6C 5KFRA 1SJED 3CCVA 1L2FA 2A69C 3OIQA 4GOPB 4O3NA 5KT3A 4GNXB 1V1PB 3KF8B 3KLSA 3AEVA 2WB1G 2XN9C 3CKIB 1AN7A 2HT1A 3HEJA 4A3FG 1O80A 3Q8DA 2MPMA 4KMUC 1XYIA 1UC9A 3JRXA 3HKZA 3T51B 5A2QW 2B2YC 2W8KA 1EY9A 4WJWA 1HA6A 3T4AC 4IFDH 2BDNA 2A68D 1VQ4A 4KKUA 5KG1A 4DUYQ 1B4OA 2E74C 4KTAA 4MTNA 4E6IA 2QEXA 2F0IA 4KHPQ 3K7UC 1GJXA 4MN3A 4DV7L 5K3WA 4BY1B 3A55A 2EYPA 1A15A 4S3SA 1KDBA 3EFXD 1I3QA 4OELB 4JI6Q 3N52A 2LSSA 2R7ZA 4U6PA 2R93A 1NMFA 5DG7A 2AQ2B 1N34L 4AQYQ 4JBKA 1X54A 3TN2A 2VUMG 2NVYH 4RGOS 5GROA 5J39A 5KFSA 1VQ7A 4ABNA 1B6SA 1I2KA 2W70A 1K3RA 3Q1KA 4OGQC 2RGRA 1O7ZA 4HMJA 2WB1A 4O42A 3M4OH 2KJXA 2IBKA 4A75A 2CH4W 4JI7Q 2HDMA 3M3YH 3DMUA 3W3AA 3PR5B 2HHHL 2CW7A 1A3GA 2C22A 2VQEH 4QY7A 1SE4A 4OX9L 5IGBA 2D0OA 5C4JH 3PW7A 4JCVE 1BF4A 5IYDH 4YP3A 4CDDC 1GUTA 4RNMA 3M9BA 1TWFA 3TZUA 4MIUA 4JV2A 4JI4H 1HHVA 3NPPA 3DM1A 5CORA 2KSWA 3PVXA 1JLLB 3AU7A 2ASLA 3H3VC 3JZIA 4GZYC 2E8GA 2RDGA 2K05A 4OHJA 4QWEA 1PRTD 2A74C 4R4IA 4ZUIA 1L1OA 2VUMA 1FJGH 5HNEA 1DV1A 4FBTA 4L5SA 2UXBH 2I80A 5C44H 4KY6A 4JV0A 3GILA 5EPJA 3K3VA 4WORA 4E4TA 4F4ZA 1KNAA 1I4XA 2AWNA 1T9HA 2WINB 4C3IB 2RHQB 2HDKA 5KX5F 4RA8A 3W1BA 4RWSC 4JV5H 4X3SA 3GIIA 2WAQE 2GN5A 1O75A 1WR2A 4O3OA 3D6CA 4TQSA 4DAYA 1FGUA 2K6AA 1S5ED 3RF2A 2MP1A 5GONF 3U55A 1SNDA 5J3BA 2BQRA 1XPOA 4B3TH 2JJQA 2PMZB 1VQKA 5E3FA 5A2QL 3GTPB 3NC0B 1CUKA 4O7RA 2JEIA 1LM0A 2HGSA 4DV7Q 1SCUB 2CHBD 1I5FA 3I72A 4PG3A 2RBMA 3GTMH 2D0PA 2PMZE 4QQBX 2B2WA 2R3ZA 1LUZA 1IYEA 1UC8A 2W6MA 5D8DA 1HJPA 1F77A 1ESRA 2I5HA 2VUGA 3K5LA 5CA0F 4M0JA 1Q7YC 5KFAA 5LMNW 5K36H 2PVPA 2QGQA 1BUVT 3M4PA 3GQCA 5LMNH 1ESFA 4IFDG 5KFIA 2HIXA 3NELA 4J9LA 2QKIC 5EGTA 1HNWH 1ZXTA 2UUCQ 1SE2A 3QB3A 3STBD 2L4NA 1TAEA 5KFZA 2VZAA 5BWTA 2R61A 5BR8H 1RYSA 3I73A 2OTLA 4NXNH 4X65H 2HHHQ 1BOSA 4YY3H 4ED0A 3I4MH 2JXMB 1EHIA 4OX9Q 2R8IA 2VQEL 4E6NA 1T5XD 4I65A 3Q22A 4NXMQ 5J22A 2NUCA 4B3SH 1SEBD 2E75C 4CDEC 1SYCA 3HOZB 2FJZA 1Y69U 1EY6A 1LYLA 1OXUA 2G5DA 2SNSA 2YZGA 2R7FA 4JI4L 5CBAE 3HOWH 4HAEA 1ENFA 3M9NB 1LTSD 2Z4HA 1VQGA 1EWCA 1Q12A 4M1UB 5D65A 4DPGA 2E2HH 1WSCA 3KK7A 5ELNA 3RUPA 1D7QA 1DONA 5JQGF 3W2DA 2O4XA 1PV4A 1JOKA 4LSAA 3D4RA 1TXYA 2ZTDA 3D6WA 5I9PA 1FJGL 1D1IA 3TEHB 2AQ4A 1BKBA 2D5DA 2LXJA 1FL0A 5LL6X 4C3JH 5IYDG 4UCOA 1EFWA 1PFSA 2D2CC 1NMGA 3BDLA 1TWHA 2EYFA 3X3MA 3CPWA 2EJFC 5KG5A 3OSPA 2F0QA 3NXWA 5M5XH 3G6EA 4X64H 4RUAA 1A48A 4QIWA 3NBHA 2HUGA 4XT3B 1S5FD 2K32A 5KT6A 2JA6G 2R92B 2NVYA 1LTID 3S14B 4B3TL 4YIJA 5I6WA 3TP6A 5C44G 3CU7A 3UZBA 1T5EA 3A8KE 3ULJA 5KFKA 2IJ0A 1XPRA 4POGA 4J9KA 2W6ZA 4DN4M 2A68C 3PIPA 3E9IA 1EEFD 1Z2NX 3Q24A 2NN6G 1I4HA 3PUXA 3HZXA 1X9NA 4K6DA 2E2IB 1RJQA 3TY9A 3A7AB 3TINA 4RHRA 3AW8A 3KALA 3KHGA 5IGFA 3IFTA 2BA1A 3UZOA 2F4VH 3QR8A 4DL6A 1L1OC 4R8NA 5LMNL 2I0QA 3J81c 4IWXA 4DQNA 3PO2B 1JX4A 4JI8H 4GKKH 1BXTA 1AP0A 4XDXA 3ZJYC 1HNWL 4KJOA 4K6NA 4O0AA 3T5LA 1M0WA 4NXNL 1L2ZA 2I8CA 5BR8L 4FFRA 2K52A 3VOTA 4X65L 3ORRA 4GLAC 4YY3L 1N48A 3OUUA 2KCTA 2JA6A 3GV7B 4ZKBB 2PZUA 3A74A 4ED8A 4A3BH 4YAJB 4ED6A 2ATLA 1TVXA 3RLOA 3CQZB 4B3SL 3GTGA 4CDFC 1WTVA 1SYBA 1K0RA 4DAVA 4JI4Q 1QILA 4O2BF 2M2LA 4YJ2F 1C9OA 2UVUA 2IA6A 2R84A 4IPGA 3TZDA 4UFZA 1KBLA 1RK5A 1I50B 3L7ZC 3MZ5A 1KUTA 4FE2A 2HHFB 2L1BA 1YITA 3RV4A 3KHLA 1OXSC 2PNHA 1HTPA 1CFMA 2I07B 4ECTA 3DM3A 3I4MG 3CCSA 1ET9A 3JAMi 2XCPA 4LUOA 2UXBQ 3HT5A 5CR3A 2OXPA 4ZLTF 4JBMA 1KNEA 3EPIA 3CW2C 4G57A 3FPPA 1PRTC 2W6NA 4EQ5A 1KAWA 1SNPA 3D8GA 4WHXA 3GTMA 1M1KC 3FHWA 2X0SA 3HOWG 4R4CA 5KT7A 3E5NA 3KHRA 2JA7H 2ZXRA 2W9BB 1Z9FA 1SR3A 4LUVA 1PTOH 3U54A 4X64L 4JV5Q 2DPIA 5AFWA 1Y1WH 4U7CA 1YVCA 4QWDA 1HZBA 2K5NA 3H0GH 1GUOA 4A3MG 4IQZA 1W96A 3MFHA 4EBDA 2EXZA 2NVTB 4C3JG 5C5MA 4MV1A 3GV5B 2NTSA 5L9XA 2PN1A 1H9SA 1X3FA 4DR4H 2RDHA 1VQ8A 1T36A 1S03G 4LFBH 2JA9A 2K5VA 2RSOA 2EJ3A 4O86A 4BBRB 2YYZA 3C1EA 4DV0H 3HOVG 2L11A 1WH2A 4HJ9A 1YHBA 3N40P 2KHIA 4UHVA 3N8DA 3DLLA 1UE1A 1YNJD 3N42B 3BQ0A 5D3DA 4MV6A 4Y52H 2C2RA 4IRCA 2IT1A 3GLKA 3KDFB 2F4VL 3OW7A 5C3WA 1E4GT 5KFYA 3GIKA 1CKOA 4YR0A 4YCWA 2F0PA 3I70A 5L1LA 1O7LA 4CJ0B 2UUBH 2Y0SB 4JI8L 3J80i 4GKKL 1NNXA 1VS0A 1TIID 4KN7C 5AJ3L 1NBWA 1V43A 3I4NH 4IHJF 1EQVA 4FFPA 4KKTA 5KFPA 5CV4A 3V05A 4RU9A 3S2HB 2H5XA 1OXVA 1BGWA 2Y0SE 3SGIA 5C3EB 3QOJA 5E7NA 1ZEQX 2C9OA 4EFEA 1J5EH 1CA6A 4B3SQ 1ML0D 1KL9A 4DKAC 4DAMA 1SYXB 1E4EA 3CF5A 1WRVA 3CVZA 4HYKA 4IAJA 3GTLB 5F9LA 3C0FB 2MFIA 4HTHA 2OH2A 3F1ZA 2FMMA 3M4IA 2A5HA 2E5LH 2XTIA 1G6ZA 2MO0A 2CW0D 4LW1A 2R7MA 4A3GG 2NVQH 4HR7A 3NTKA 3HXLA 3G6VA 2AQ3B 3Q0AA 1VF5C 4O2DA 2F3WA 1ONLA 2ZTEA 4LH7A 2VQFH 1ENAA 1KIXA 2F0UA 3KREA 3QIAA 1JE5A 1E0BA 3CCQA 4A3BG 3NTIA 4A3LH 5KFEA 3CMAA 4X62Q 1UEBA 4DNIA 3I4OA 3R5XA 4HIKA 1GUNA 1TWCH 3ULPA 4TUYF 5I47A 5C0XH 2HIVA 4C1NI 1M0TA 1SNCA 4UCSA 5KFVA 5GAHC 4LFAH 5JEAH 3DAAA 2PQAA 5DNFA 5KFLA 1GGOA 4ZI7F 4J6HA 2J9GA 5KFOA 3PO3B 2WKCA 1UAPA 3KBXA 1WTXA 1IL8A 5H80A 2UXDQ 1KTAA 4FFOA 4LAAA 4B3MH 2L55A 2I5LX 5FR9A 2JQOA 2P0AA 1TQOA 4ZQ3A 4A93G 3MA2B 3J7YW 4DR4L 2V59A 3MHBA 5FO9B 1HA5A 1Q1BA 5JOBA 4LFBL 4C2MH 3NTHA 5FO8B 2BQ3A 3G8CA 1D5ZC 2R7LA 4LWCA 4DV0L 1X3QA 4O4IF 4O7SA 5C0XI 2Q7DA 1KAAA 4XQNA 3U9TA 5C4ZA 2OT2A 1TWAB 5DQIA 2N78A 2W71A 4CKEA 4IRKA 4GKKQ 2UUBL 1WTRA 2YZNA 1I4QA 5AJ3Q 1N36L 4HJ8A 4ZAIA 4MNOA 3ULLA 1SFOB 3SNOA 5JJLA 3OWFA 3HFZB 4BXXH 2ZDGA 1V51A 1D1KA 3H3VI 4IUPA 4I55F 2JA8B 1KLUD 2NU6B 3E3XA 1J5EL 5E1FA 5L1JA 3HOXH 4F88A 5HURA 1D5XC 1MJCA 1B3QA 1E24A 2GVBA 1IYJB 4PZ6A 2AGOA 2DZDA 1GHJA 2Z9HA 3V6JA 5EKLA 2SDFA 2DWCA 2E5LL 2E2DC 1N8RC 4O2AF 2DGYA 3ERSX 3I4NG 1TWGB 1B7YB 1R4PB 3PUVA 3N44B 1BQQT 4RKBA 3TREA 2IX0A 4DL5A 4MV9A 3MC0B 2NVXA 1YBYA 4RGTA 3GO5A 3S1NH 1SNQA 1Q46A 2HGWA 3GTJB 3WWVA 2PCFB 3LWBA 1KT8A 3IL8A 1KC7A 4KHPH 2F0LA 5KFQA 3K58A 1PH9A 2B2UA 2K5HA 3UDGA 5IYBH 3VYRA 4HIDA 5M5WH 4PMCA 5C4XG 5L1IA 4A3JB 4YWKA 2LXKA 1PLFA 3SI8A 1RIPA 3S17H 3DWPA 1C7YA 1STGA 5ELDA 4LFAL 3B6YA 3KLWA 1IHZA 4O3RA 5EJWA 3M7GA 1ENCA 1K0SA 2NU9B 2ZDHA 5BWRA 2ID0A 1EKVA 4A3CG 3DTGA 3G7LA 1A3VA 1JT8A 1KDAA 4B3ML 4DR7H 3T9CA 4JI7H 3K7AH 2O2LD 1HFGA 3K5OA 4DR4Q 1E4FT 3GTOB 2ZJPA 4A3DB 4GC7A 3MXNB 2JA5B 5CE8A 3EYYA 3E5SA 1EU4A 1I6UA 4RCNA 4RAUC 1DOMA 2EYMA 2F0JA 4LK1C 2QB5A 1GO3E 4DV0Q 3HOYB 2Z4IA 1YNND 5FD5A 4F4YA 1WD0A 4APVA 2PBZA 1BBWA 3TDQA 4HIMA 1IBLH 1EUCB 2Z0SA 1JDBB 2HGXA 3BACA 1R9TA 2SEBD 2UVVA 2PW5A 4FP5D 2UUBQ 4IOCA 1XNRQ 4A3FH 1YNJC 4BBSH 1QCBD 3L9AX 3J81j 3TQTA 5FLXW 1N56A 4B3RH 4KK7A 1W93A 1D5MC 1BCPD 2PI2A 2ASDA 3SXHA 2EYLA 3SHLA 4Q0FA 4DR5H 1I6VC 3KF6B 5NUCA 3PW5A 2QEJC 1E7ZA 1BNCA 1JICA 4XT1B 5CM0A 4HEDA 1VQ6A 5IIFA 5KG7A 1TWFH 1EYDA 4DV2H 2Z6KA 3O13A 3U0GA 1KJJA 4BWSC 1VCIA 3W5OA 2XGQA 3MFYA 1NTGA 5E4XA 3RBDA 1P16A 2NUAB 4H02A 1DJRD 3FDTA 3MAQA 1S4ZA 5FPOA 3T1HH 1F9PA 3FKIH 4FFLA 2VQFQ 3RZDH 1RF2D 1TA8A 3PZPA 1S0MA 3S1RH 1SDFA 2CW0C 4O7LA 2XGTA 4TVAB 4YB8B 2FINB 5L37A 1EIHA 3D4WA 3HOXG 4J15A 1EIYB 5F9NA 4KHPL 3ERQA 3TIIA 2L15A 2RCFA 1S68A 1SEIA 5I9OA 1Q82C 4BS9A 4DXGA 1Y1VB 4NB3A 4JI6L 4ZKCB 4AYBG 2BH8A 4LFAQ 5GADC 3JSLA 5KYLA 3RV3A 2FLPA 3OUZA 1CI3M 1STAA 3HKZE 3MR5A 1F2MA 4AQYL 2EZVA 1PDQA 4R4OA 3VNNA 1U4LA 1I3QB 4DR6H 1F9RA 4O7NA 4B3MQ 2R7ZB 1PH2A 2UUCH 2R93B 2LFNA 4IO9A 2RQXA 1KDCA 3MTSA 4ED1A 1EQTA 1Y8NB 2MNAA 4JI7L 1K8GA 1Y8PB 4IRDA 1LT6D 3R8BA 2IHEA 4CMFA 1E1OA 5ELOA 3IN5A 1X3PA 4MTEA 5KKNB 5ELCA 4F7XA 1VDZA 5I5TA 5DGBA 2WB1B 4NXMH 4HMIA 3NUCA 3M7NA 1F9SA 2FXQA 5IP9G 1OWTA 4QW8A 1V1QA 1X32A 2UU9Q 4BY7B 1B50A 3G71A 2EY5A 2DPJA 2WB1E 3PIOA 1PZJD 4AH6A 1II3A 2WKDA 3QZ7A 4AYBA 5CV7A 2A73B 5TSSA 1VQCA 1H9JA 4B3RL 4YCUA 1I4GA 1PFNA 3TBIB 2IW3A 4I7AA 4IN3A 2KEDA 5FLXL 1ICWA 2B2UC 3CC4A 4XYLB 5K2MA 5I5XA 3TY5A 3S9WA 4DR5L 3GV6A 1U0LA 4X3TA 1AN8A 1QUQB 1RTOA 4O3QA 1DXMA 3PR4A 2ASJA 1KRTA 1V1OA 4Y7NH 4JXUA 3CCEA 5J2UF 1CSQA 1MD2D 4IJLA 4DV2L 4Q8FA 5KFNA 4DR2H 2WYOA 1L0XB 1RODA 3A54A 4K0KH 1AZQA 2CQOA 4R8UA 1YI2A 1K1QA 4MV7A 5CV9A 1UEAB 5DLQE 4BBSG 1VAJA 3J7AF 1H9MA 1Q8IA 4JI2Q 2WDTA 1K1SA 1XJVA 3K57A 5DAAA 1T3NA 4LF7Q 5C1PA 5JVDF 2BQUA 1OXTA 4ID6A 3KFUA 2DJGC 2K50A 5DGHA 1TWHH 3PUWA 2BOSA 1RTNA 5BN3A 2XIGA 1JORA 4APMA 1JE4A 2RHSB 3R3OA 3LP8A 2VY3A 3R93A 4XZ3B 3NGDA 1F2ZA 1I6HH 3MR3A 4PQXA 1SYGA 3SK5A 2RSNA 2K4KA 1WCMG 1S72A 1KJIA 4GLWA 4Q4CA 3FKIG 5ELBA 1ASZA 2B63G 4C3IH 1AH9A 3BA8A 1NSNS 4FU0A 2W57A 3K5NA 2K03A 4C56C 3SK4A 4IWYA 3H15A 1KC8C 1F2LA 4DR6L 5J2TF 2IY5B 2RF4A 1CKNA 4BWGB 4G4KA 4DR7Q 5DM73 2UUCL 1PRTB 2MUYA 2I5MX 4B08A 1LTGD 4A3EG 5KFXA 2DY7A 3GTPH 2Z6KC 1X3EA 2Z6BA 1LLRD 5I6YA 2ZGIA 4IFDI 3FDSA 5I5YA 2FHTA 3OTOH 3S1QB 1C30A 4NXML 2GQRA 4JVZA 1Y8OB 1EQRA 3DXJC 4HNTA 3I55A 1IBLQ 3AFPA 1IYDA 5LL6b 1YNNC 2K04A 4QUCA 4XYQA 1EZ1A 4O7ZA 1IYUA 3DTFA 2QW7A 1OXXK 2R7DA 4B3RQ 1DCZA 1CSPA 5BWWA 1WCMA 2DJFC 3Q8SB 3M9OB 4YWLA 1I7NA 4CHIA 3FKIA 1IBKH 2JA6H 2B63A 3RB3A 4DR5Q 1ASYA 5KFUA 3RBEA 1WTWA 3SE7A 1B04A 4BY1G 4N9TA 1VQNA 1B6RA 3GTGH 2GVAA 1BCPC 1STNA 3U50C 1XX8A 2EY6A 2K7VA 1VBGA 3NK9A 4DV2Q 3S16B 1Z2OX 2WAQB 4QWBA 1K83A 2NN6H 2Z1CA 3HOZH 4K0KL 3EPGA 3TY8A 1VQOA 1K8AC 5DG8A 4GOPA 4V190 2IX1A 4C5AA 1X56A 4GNXA 1V1PA 3KF8A 4OONA 3T1HQ 1NR4A 4FGRA 2WIIB 4EEYA 5BYAA 3G8DA 2F0HA 5DGAA 3J81i 3GTKB 5A2QE 4IJHA 1G2TA 4IR1A 1V9PA 3JZ6A 1N9WA 3BVZA 4FF2A 2F0MA 2ZT9C 4H13C 1SRUA 1R4QB 4UP9A 1BVSA 1X6OA 4QIWE 1LV9A 5C4HA 3HOUH 4RAYA 3BVGA 3URYA 5IYZF 4YR3A 3T5KA 1K3BC 5JAVA 3M4OB 3GIJA 4HN2A 3PUYA 3SR1A 3TS2A 3M3YB 5LOVF 3KJOA 1CTMA 4TM5A 3MXGA 1XPUA 2NN6I 4DR6Q 1RYRA 4U673 2PPBC 3FP9A 2A6EC 2ICIA 2R92H 1STHA 2YTVA 5GAGC 3J7A5 3BYTB 3S14H 1SMYD 5C4JB 2YTYA 3M4QA 4FF1A 1BO0A 3UDIA 2L5TA 4FYDA 5CR5A 5KG3A 4XYOA 2QF7A 2WACA 2ZXOA 3OTOL 4NZMA 3FVQA 1N33Q 1SJHD 5DISC 4PZ8A 4A2BA 2L0CA 1U4MA 3EN2A 4RKLA 4C3IG 1K8OA 1HH2P 5BWUA 4GN3B 2XCLA 1UNNC 2BH2A 3NWSA 2W7OA 3HB9A 2G9DA 3R9RA 5EWEA 3VR2A 4BA1I 4LF8Q 4HNUA 5KFTA 3TMEA 1OO9B 1PFMA 4N9PA 5C44B 2MGSA 4NYEA 1SSOA 5EBCA 5D14A 3PO2H 2X5RA 4ZQIA 2F0WA 4ILWA 1SLJA 1VQPA 1IBKL 2A1HA 2A19A 2F4IA 3RB6A 5I4DA 4ECXA 4A3MH 2UXBL 3FMCA 1JCKB 3NBZB 4X62H 2L9HA 4J1MA 2BDOA 1SYFA 5M9OA 2YCHA 2VB3X 4K2KA 3OPOA 5IGCA 5DQGA 4DR2Q 2V5AA 1K73C 3U4ZA 2VXWA 4K0KQ 3A7LA 1K28A 1I1MA 3HOVH 1RJRA 3VA7A 4A76A 1WTQA 2COGA 4JV5L 5C8YF 1ZETA 1EL0A 2EXDA 4CGYB 2D62A 4F8MA 4G7ZC 4QW9A 2H1EA 4F50A 4ECRA 3DF7A 2UXDH 4WRDA 3KHHA 4J9QA 1EFID 3K0XA 1AFPA 2A8VA 4UP7A 3V6HA 2J6UA 4O83A 3NQIA 1XMOH 3NEMA 5FO7B 4DV1Q 3FEWX 2I46A 3GTPA 2EJGC 4PMBA 4DNTB 1CQFA 4O1NA 3HOZG 5M3MB 5BWVA 3RJ0A 5JUMA 2L12A 3X3NA 3TQYA 3PGZA 4RMFA 3JAMW 2FPPB 3N6XA 3I12A 1C4QA 3I4LA 4XIGS 4J0MA 4A2AA 2HVQA 3K5IA 2HVSA 1S5BD 2QA4A 3MFIA 2IMWP 5D1PA 4ECSA 1JQYD 2CNVA 2O03A 4RNOA 3PF4A 4R8IA 3I4MB 4A3GH 3MWDA 2XRQD 4GN4B 5C0XJ 4RB0A 2RCNA 4MA0A 5KFDA 2OEOA 1IOWA 4KY5A 3R23A 3HOUG 3CHBD 3OTOQ 5JEAJ 4UPAA 4DLKA 3V96A 4XXEA 1RD9D 5D3IB 4DV3Q 3VPBA 4DR1Q 2UXCQ 1QE6A 3GIQA 2E2HB 3OW2A 4GNXC 5HV6A 3BZKA 4U68A 5C5LA 1FKAH 3OHAA 2HD3A 5GAEC 1DZ1A 4K8IA 2UVWA 1M8AA 1PHJA 1H9RA 4KKSA 5E4WC 2R92G 1B70B 3DWQA 4JI0H 5JJKA 2VNUD 1S9FA 3R5FA 1IBKQ 1VQFA 1B2TA 2B2WC 3RR5A 2VQDA 4IUTA 4EVOA 1MHWC 4X62L 4A3IB 5M5XB 4Q4DA 2B39A 3EBEA 4A93H 3ORQA 5D1OB 3J80W 2CFMA 4KLKA 3NE5B 1RJTA 3KBGA 5DEHA 4UUGA 4RZRA 4TSSA 3CCMA 2F1MA 4PZ7A 1RL2A 4DL2A 2KCCA 2M00A 4QJFA 4UAIA 1W6KA 3PO2G 2NVXH 4JG2A 5COYA 3GIMA 1S0NA 4HQ6A 2VA3A 3BA9A 1YNXA 3NBYB 1HFNA 2OLSA 1HZAA 1XTCD 3RNUA 1Q90A 1HNZH 2UXDL 1LT5D 5FJ8G 2FMCA 1VQMA 4DV6Q 1STYA 3TEKA 2PQAB 2R92A 1QZHA 4DV4Q 3NBIA 4Y8VB 3KYHC 2RGVA 5EOYA 2IPKD 4XYMB 1ZHSA 2KVMA 1GKHA 5JJIA 1PH3A 3PW4A 1JB3A 2KCMA 1YHAA 2OCEA 3V4ZA 5FK9C 3F2CA 2WV6D 3JAML 3VR3A 2N55A 1C8CA 5M5YH 1PVOA 2E2IA 1HZCA 1XNRH 5HGQA 3VA5A 3QG1A 4YCVA 4A3BB 1K9MC 1Z2PX 1JWSD 5LA6F 5IGEA 3AX6A 1W2BA 2ALYB 3OOCA 1LTAD 3A5ZB 4OO1H 4C3HH 1I4RA 2R8KA 4QB4A 2F0OA 3ER0A 2YRXA 1LABA 3H20A 1SMYC 2VA2A 1A62A 5KFCA 3V4SA 1AZPA 3L4KA 2FLLA 4CBVA 1R9TH 2UUAQ 5KFGA 4NZNA 4MTDA 2KQ3A 2W9CB 1VMPA 3ZYYX 1G51A 4P73A 4DK3C 5C4XH 3CQZA 1GHKA 4JPBW 4KI0A 4WJ3M 4POFA 1CKMA 4R9WA 4ECVA 4JI0L 3JZFA 4J9SA 1MZBA 2F0NA 1A3TA 1I1LA 1I50A 3VPDA 3TP8A 3T5HA 3KAJA 4A3CH 1SNOA 2HHFA 4MV4A 2GA4B 1B3AA 4OWXB 4BBRG 4JBJA 2JA7B 4NZOA 1PTOB 3CCRA 3G48A 4XTCS 2JA8H 1Y1WB 1LTRD 2OWOA 3GTQH 3T5JA 3S2DH 2CWPA 1STBA 5IE8A 1I7LA 2XWJB 4LUZA 4QWCA 3H0GB 5BN4A 1S97A 4L5TA 4RUCA 1JOQA 3GQBA 3PSIA 2MCTA 1VQ5A 2C28A 4MAMA 4DA2A 1EKPA 3LMLA 1EIFA 2YTXA 4TKOB 1TWGH 4LF6Q 3QFFA 2QDBA 3CCJA 4Q5VA 2EYJA 3HBLA 1AE2A 5T1IA 5C3EG 2KBNA 1S5DD 4HJAA 1XMOQ 1F9QA 3VYSA 1G91A 4MA5A 2R6GA 3T1YQ 1T94A 4ZK9B 1XTDA 1C3OA 1TS3A 4K5VA 2EQSA 2XSCA 1DOLA 1IOVA 3HS0C 2JK8A 3S15B 5EQ0A 3CCUA 4YHHH 1JJ2A 3UFXB 3NHHA 1E22A 1NR2A 4KN4C 4A3JH 1KQSA 4LF9H 4H7BA 1LTLA 2NU7B 2HVRA 4L5QA 4RCOA 2UU9H 2JEAI 2OQKA 2BE5D 5EZYF 5M3FB 3KLRA 1XNRL 1YJ9A 5KGUA 3R5HA 1VQLA 2KCNA 5CV6A 4X66H 2VW9A 4RNNA 1XNQQ 4YAKB 5LYJF 2ALZA 2FB9A 4MZ9A 1Z7TA 2CW8A 4DL7A 1KXLA 4QWAA 1E1TA 2LS01 1MJEA 4JI3H 5EDWA 1PTOF 2NVQB 4LH6A 2P5ZX 5BYBA 5JVLA 2JEGA 3AFQA 4JI1H 1I1KA 5J1ZA 1NAPA 3DEOA 3GV3A 5E25A 2NU8B 2E2JB 3MWYW 5LL6S 3KAKA 2LKVA 3PO3G 2CQYA 4ED2A 1EZ6A 5JPMC 4JI0Q 3GTLA 4JK1C 3TRZA 1X55A 1RKNA 1X65A 2LY7A 2PI2E 1G8ZD 1TR5A 1IYVA 2JSOA 2VQFL 4OO1G 4JI2H 4C3HG 1TWCB 5JJZA 1J9OA 4LF7H 4F4XA 3RIZA 2YU9B 1IZ6A 2MJ8A 3OYYA 1IBMH 5I5VA 2EOTA 3G4SA 1AUVA 1KEEA 5DG9A 4X3UA 1OBDA 4LF4H 3RB4A 2R82A 2PW7A 3QJYA 2CWAA 1MIUA 5KT4A 2TMPA 4LMQD 3VR5A 4A3KH 3BS1A 4DF7A 1GM5A 1JWMD 2Z04A 4RG1A 3OMGA 4OL7A 1TS5A 3BG3A 5IP9H 3R2TA 5IYCG 4EBCA 2HDLA 4L1KA 1HNZQ 3PIP3 1HQRD 4C2MB 2Z02A 1IL2A 2FPGB 2Y4RA 1D6EC 4FS1A 4EGVA 2YV5A 1BCPB 4L6TB 2OTJA 3JSNA 2VS1A 2JA8G 3MXPA 5FOBB 1EU3A 2EIFA 3IRBA 2AUJD 4O84A 1A63A 1EY8A 4PMWA 4CJ1B 4ZHQF 3WDNA 3H6MA 2R86A 3UDFA 1RJPA 4TRDA 1O7IA 1PXUA 4YHHL 4IUNA 1PYWD 1FVIA 3GDEA 3ITPA 4FVMA 5EKKA 4JI5Q 4IFDJ 2UU9L 3EIVA 4DXFA 1CA5A 5HBRB 1NCVA 1WI5A 1TY2A 1C48A 3CAMA 2N3SA 2B2VA 3FPUB 4DV5Q 1EYZA 3P75A 3PUZA 1KABA 3GJXB 4X66L 4L8JA 2WP8J 4EG0A 1WTPA 3U9SA 3RGZA 3NQTA 4XX0B 4IUQA 3BDCA 3RTXA 3Q23A 3QWUA 4FXKC 4AIMA 3CPFA 1U9RA 4AYBB 4A3JG 2ZM6H 1BBUA 3Q8PB 3GTQA 2EPBA 4AYBE 1EWIA 1L0WA 2QILA 3UYYA 1WCMH 3H09A 1GD7A 4YWMA 2AUKA 2RDJA 1BR9A 1MSHA 2AQ1B 2B63H 4TV8F 3J7AK 1FGBD 3E0JA 4Z9CB 4WD3A 2JEFA 4JI2L 4C5CA 1FYCA 1JIHA 2E76C 3QO2A 2N49A 3NSWA 2XRSD 4A3DG 1TWGA 4LF7L 3TW7A 5CYUA 2KUMA 5CBEE 1JJGA 2JP1A 1EY4A 3K59A 1H9KA 1WTOA 1VKZA 2JEJA 3S17B 1U5KA 3HOYG 4GN5A 1SNMA 2KOLA 3HKZB 1FR3A 4A3EH 1K83H 3EVQA 1EUJA 3JC66 1ZKOA 1WJJA 2XCAA 3OWEB 1I4PA 1KJ9A 4UP8A 5DMXA 3FMAA 4PBCA 4EYHB 4N8X1 3BZDB 4UY8C 3MXUA 2A6ED 1BBXC 4BA2I 4DL3A 1Z47A 1LACA 5I5SA 3FRPB 2EDGA 4JW0A 5IODA 2F03A 5KYIA 4R7RA 4GLVB 5I5UA 4DR3Q 2V1CC 1TT2A 1KTKA 3P20A 1HTLD 4I7HA 2V4RA 2B2TA 3MFGA 2Q2TA 4DR7L 5KS8A 2GQSA 4ME6A 1ZYRD 1PH6A 1TS4A 5IP7H 3E9HA 1GLVA 1SE3A 4QCLA 3KOJA 5EBDA 2ICEC 4F4WA 4P2CB 4BY1H 2COJA 4YHHQ 1NJIC 4Q43A 3CRLC 4A3KG 3GTOA 1N33H 1AW7A 1CKNB 4KJNA 2R8HA 3MXNA 1EZ8A 4A3FB 4NW2A 4DGZA 4LF9Q 2YYAA 1IBLL 1EY7A 4O4LF 5G3LF 1X3GA 3DWAA 5CV8A 4LF8H 1DV2A 1CZWA 3S1MB 2V9WA 4HIOA 4CC5A 4R4TA 1UNSA 3BDOA 4MTKA 3Q8QB 1S10A 3DHQA 2BE5C 4X66Q 1J6QA 2FK2A 2R6FA 1TWFB 3RZOB 5FLXE 5H1SE 1SXTA 3RAXA 1QJOA 2AKWB 3T99A 3BJYA 1UE6A 4OIKA 2EE1A 3BZCA 4JI3Q 3UE1A 3GIDA 1GSHA 2EYHA 5EWFA 1Y1VG 4H0LC 1VQHA 4JI1Q 3A5UA 1SBBB 3GP7A 2ZM6L 3S1QH 2WTFA 3KF6A 4QSHA 2VUMB 1PFBA 1L1OB 1E2VA 3RZDB 4WFN3 1BDOA 3AMUA 3D4DA 3S1RB 3HKSA 5KNDA 5IT9W 2EY2A 2I87A 3D31A 3OSOA 3AB9A 1U4RA 1DIKA 3K81C 1A2TA 3T1HL 1VF7A 2YS7A 4ZCKA 3PW2A 1GXDC 5ELFA 5KG0A 1YHQA 2GPSA 3TW6A 1I94Q 1CE8A 4J9PA 3EROA 3NWTA 1CQJB 1XXGA 1IBMQ 1CM9A 3AYHB 4L63B 3SDZA 5DGIA 2CCZA 5BPFA 1N32H 1B9MA 3OHXC 5KIXA 4LF4Q 1DM0B 4DAYB 4PWQA 4DV1H 3VR4A 1PH1A 3AQQA 5EKIA 3S16H 4GC6A 2W9AA 4H44C 4BY7G 3H40A 4P75A 3CP0A 3SEBA 2B2VC 4ME5A 1DD2A 4UCRA 4LFCQ 4KD3A 3BG5A 3MWMA 3RUZA 3T7AA 4PDBA 1Y1VA 4RB1A 3RFCA 5I5WA 2V4QA 3BJUA 3WWIA 4J8QA 3OHBA 3I3CA 3CD6A 2NZHA 3VYTA 2F3IA 1D2BA 3GTKH 4EGQA 3H94A 4CHTB 2CZGA 4WBNF 5BMVF 4ECYA 2K5DA 4F87A 3VDYA 3ND9A 4OWWB 1O7YA 2K5WA 1VBHA 1QOHA 4DV3H 1SE8A 3OMCA 1N33L 1M7JA 4DR1H 2UXCH 3J81W 3WO1A 2B8FA 3IG0A 4ALPA 2ZJQA 1HNXH 3MVVA 1A0GA 5JQWA 2VOBA 2PYKA 4LF8L 3EJIA 1PK8A 1ULZA 2F3VA 4Y7NB 5IP7G 1PH8A 4MV3A 5FLXc 4IURA 3CSWA 2KHJA 2HQEA 5DM63 1JKJB 5DLGA 2ZM6Q 3ONAB 2HCCA 3QWNA 1ZAUA 2QYZA 5C5JA 2ATWA 1QUQA 2EJMA 1E2ZA 1AE3A 4DR2L 4HNVA 3U58A 4ED3A 1GSAA 3GV8B 4MV8A 2R7KA 1ZQ7A 5C6AA 1JWUD 4P74A 3T13A 1MSGA 4JBWA 3J7ZC 2W7PA 2B2TC 3UE0A 4TV9F 5IT9E 2SOBA 5IT9L 3BABA 1PYSB 1TWHB 3MR2A 3M4YA 5KFMA 1OTCA 2W6QA 3PQIA 4FFMA 3T9BA 5FD6A 1WFQA 4J9OA 1UE5A 2FE3A 2KEEA 4QIWB 3NBHB 4O4HF 4P72A 1I6HB 4DV6H 1PRTF 1OBGA 5CGKA 1JXLA 4DV4H 1N32L 2HJWA 4ECQA 1CHPD 5KFWA 1FNVA 4DV1L 2NVYB 1JJCB 3T53B 3A56A 4DAAA 3MR6A 3I7FA 2ODTX 5BWXA 4K5WA 4M9UA 4FNFA 4GS3A 3HRZC 1XWEA 5KNBA 3P7JA 5LXTF 1F2YA 1WOCA 2V58A 5KEEA 2CNUA 3HO8A 1QVCA 2EVBA 4FM9A 3CRKC 4CKBA 3IKJA 5ELEA 1S0OA 4DL4A 3G6JB 5ISRA 4X6AH 3U4VA 1N34Q 1KJ8A 5L1KA 2WAQG 1KHIA 2M05A 1ZYRC 3I8ZA 3WO0A 1QNKA 4LMYA 2NBFA 4DV3L 3T9FA 4DR1L 5A35A 2UXCL 2Q8RE 4EQNA 1TU2B 5M3MH 2UUAH 4V0BA 1EY0A 2E2IH 2YW2A 4DIMA 4JYAH 3J81E 2IL8A 3J81L 1HNXL 3N6RA 2V4DA 2JA6B 4N8FA 4K8JA 2PZWA 5BN5A 2FP4B 4RFBA 4DUZH 1Q1EA 3Q6SA 4OEMB 3GTGB 1SAPA 3IAYA 1IKLA 2J7ZA 4TQUS 2K75A 2AU0A 2W8LA 2JEBI 3ETHA 3HP3A 2AHOB 5FJ8H 4MHEA 3NUAA 4IUVA 1E3PA 3LWUA 1I2LA 2MO1A 1A2UA 1GOZA 4DRFA 1EYGA 2Z8LA 1QB5D 1U4PA 4IUUA 1L0YB 1EOTA 3CQZH 1PYBA 1BJTA 2G9HD 1VQBA 4HSPA 1XMQH 3C1FA 1PX2A 4GLXA 1GUSA 1HXYD 1EUDB 2DNEA 3BYYB 2WAQA 4RHSA 3EQLC 3L0OA 1Q86C 3GB8B 5IT9c 2R87A 3T9EA 1IXRA 5JVG3 4JOIA 1PA6A 3GTMB 1I50H 5CC4A 1YIJA 1HPCA 5LHY1 1YJWA 4LF6H 1B44D 4KV6A 3N41B 4TQRA 4O7TA 2PO4A 3K3PA 3HOUB 3I91A 1GSOA 2EIYA 1N32Q 2K5QA 4DV6L 3RGXA 2LMCB 2XVSA 4DV4L 2PMZA 3GTKA 3CEBA 3BU2A 3T1YH 4CKCA 4DNRB 4NP5A 4A3IH 5IGGA 1XDNA 3F2BA 4EBEA 3IFDA 5IWAH 4FXGC 1H9SB 1EQQA 3D0FA 3H4BA 3CMEA 3RB0A 2COIA 4DK0A 5EWGA 4Q8EA 1KRSA 4IALA 4I7ZC 4L5RC 1ILPA 1LT3D 2F0FA 4OWTB 3PF5A 1TS2A 4J9NA 2VB2X 2CH4A 3D3RA 1B9NA 3OSNA 2NVTH 5HGTA 2X69A 1XNQH 4DU9A 2FKLA 4I50F 4GKJH 3HOWB 2HCIA 4XQQA 3PIO3 2X6GA 4BBRH 3RD4A 4GOPC 2YWVA 3LQSA 2A6HD 2UUAL 4JYAL 1HNXQ 4CJ2C 2K28A 2ZTCA 4RH6A 4ECUA 2FJ2A 4HJ5A 3JRWA 5EAYA 2AGQA 4A3MB 5CA1F 4O4JF 4IPCA 2YZLA 4DUZL 4YBZB 1S3OA 4C3JB 1E4EB 1LT4D 3Q8RB 2VQEQ 1QWYA 2TSSA 1S40A 3UQ8A 1DYQA 5K36G 3E0EA 2B8GA 3S2HH 1W3SA 2J6TA 3HOVB 1IKMA 4HR7B 3NP8A 5M3MG 5C3EH 2KA7A 2GLTA 2QCPX 3LNNA 1W6JA 4DAPA 3BQ1A 1XMQL 3GTLH 1CT1D 2R7NA 1LO5D 1B1ZA 2C35B 5FLMH 1DGSA 3I2ZA 3RLNA 4O82A 1HR0W 2X6LA 2AWOA 3QQMA 3QZ8A 3L4JA 2Q8TA 1MBYA 1FJGQ 1HR0H 2Q2UA 3BVMA 3RN5A 3BQ2A 2H4OA 2C00A 4EFBA 3TP5A 4LF6L 3OIPA 3I90A 4UDUC 1QG7A 4QL5A 4DFAA 4EGJA 2OF1A 4ME3A 3L2PA 2CKZB 3VR6A 3SK8A 2K14A 3WNZA 2RKSA 1XMOL 3A8JE 1ZHQA 3V6KA 3DEPA 1CQIB 3T1YL 2PNRC 2MHVA 1O78A 4HCEA 1D8LA 3H4DA 4R1JA 3C3LA 1B53A 1RK6A 3GD7A 2IWHA 3KTMA 1TY0A 5IWAL 1EY5A 4HCSA 1E2WA 1Q81C 1MGSA 3VMMA 4FXDA 4B3TQ 4A3GB 1HUMA 3JAME 4JI5H 2VL6A 1AUXA 1YJNA 2EJ0A 1NUCA 4HN7A 4K6LA 5KFBA 1HUNA 4IIJF 3BAAA 2A1AA 3PO3H 5KFFA 5CMDA 4FO2A 2XWBB 3K8AA 5KNCA 4I4TF 4DV5H 2AMCB 4PNYA 1DOKA 1BNZA 1RDPD 2NZ1D 2HG8A 4RAZA 2VR1A 1CS0A 3F2DA 3N43B 4A3IG 4EQPA 1XNQL 1RHPA 4IOAA 3M85A 4GKJL 1UWVA 1MKHA 4NPSA 4QGUA 5LMNQ 5FNVF 4JYAQ 4JOIC 5IOCA 3S15H 4JUZA 5KFHA 1MI2A 1PH5A 1EOVA 3HG9A 1YZ6A 3K80C 1HNWQ 1N36H 3T9DA 4NXNQ 2E2HA 5BR8Q 4NLGA 1J8IA 4X65Q 1TWAH 4DUZQ 4YY3Q 1GUGA 3T9AA 2QK4A 5EPLA 5M3FH 3C46A 1UE7A 4Q44A 3STBC 4A93B 2ZDQA 5IYCH 1SFOH 2R8GA 5GQOA 1VQJA 4PV1C 2MQHA 2JN4A 1A9XA 1LTBD 2DUDA 1M6VA 3S24A 2Q8IB 2R8JA 3T56B 4OO1I 2NVXB 4RZQA 1XMQQ 1DAAA 3J80E 2EJ2A 3J80L 4FS2A 3LX0A 1PZID 3PCOB 5D1OA 3RMHA 2Y0SG 2O5JC 2E2JH 4WJ4A 4LSXA 1HR0L 5LP6F 2PQEA 2W9BA 5IGDA 4RGNA 4O7WA 2N8NA 2NWGA 4DR3H 1HNZL 5T14A 4TVIA 1IW7D 1V8QA 2KENA 1M90C 4C1NK 1HCZA 1GYFA 4YR2A 2RDFA 3K5MA 1WYDA 5JPNC 5IY0A 4ED7A 1XK5A 2YU9H 1KD1C 3GTJH 4RGMA 2NB0A 4ZYSA 5HY6A 1BXRA 5I2XA 2BA0A 4X64Q 3Q2OA 4FF4A 2O5IC 2SNMA 5FLMG 5M5YB 5IWAQ 4ECWA 2YZMA 3PW0A 1Q8KA 1EYAA 3U9OA 1CK1A 4ZOLF 2VPQA 1FNWA 1NY4A 3I4NB 3VPCA 1A3UA 2ENBA 3JAMc 3H3VH 1V4YA 1A0IA 4JI5L 3UI2A 4O7YA 4FFNA 4K2LA 4C3HB 1WD1A 1FD7D 3KUPA 4ODGA 2FLNA 3KDFA 1KJQA 4DV5L 1PTOD 2JYOA 1JOOA 2Q2IA 2WFWA 4RB3C 2Y0SA 1NE3A 1HZ9A 3UDXA 2JA7G 1R9TB 1VQ9A 4LNQA 2AGPA 2R85A 3GTOH 4A3DH 4KHVA 1Y1WG 4GKJQ 2JA5H 1A6XA 5C4XB 1FNUA 2FMAA 5LMUH 3WWHA 1HQMC 2F4VQ 4DK1A 3H0GG 3HOYH 3G6YA 2YS6A 2SCUB 4IPHA 4JI8Q 1SYEA 3TQ1A 2ZJTA 1JDEA 1VQDA 4K5XA 1C0AA 2C5CA 2A6HC 4FF3A 5C1OA 2ABJA 2W9CA 4UCUA 3KJPA 4NDXA 2A69D 4J9MA 4LF5H 3ND8A 4IR9A 2BCOA 2DABA 5KFJA 3GTQB 3S2DB 4IZ8A 1I94H 1Y14B 2ASBA 3RLFA 2B3GA 3MWEA 2EY1A 2J4XA 3LGJA 1SN8A 1CHQD 4M7EA 2K1BA 5I60A 3J80c 1CZGA 1STEA 3CCLA 2JA7A 3K6OA 3J7AV 2FK1A 4O3PA 1ICFB 2F0GA 1Y1WA 2DLNA 1JMCA 3V2TA 5M3FG 3K5HA 2VPSA 4LFCH 1HR0Q 1EYCA 3KLSX 4KHZA 2IP4A 3PMFA 1QNUA 3H0GA 4XQJA 4G7OC 2Q2HA 4J9RA 4G7HC 1YEZA 4DUYH 2CNQA 1A8VA 2NZOA 4DR3L 5DQHA 1Z6HA 1TKWB 3F2UA 4IZOA 3SE0A 4CC6A 4O7VA 3H91A 3C2PA 1CQVA 3I56A 2XGPA 4C5BA 4JI6H 4OXPA 5KT5A 3P1HA 4KY7A 3WWJA 1QZGA 4AQYH 1JB7A 4QMGA 3TP7A 4UCTA 2DIKA 1Y1VH 4Q0YA 4LF9L 2XC9A 3KXYT 1KLGD 4EX5A 3GIPA 4NKLA 4CE5A 3T54A 5K5PA 4A3LG 4X3KA 3ICEA 1K8MA 3W1GA 1QVGA 2FPIB 3M9MB 2F0DA 1I3QH 5C0XG 4LFBQ 2B2YA 1TWAA 2JE6I 3T16A 3HOXB 1PH4A 2R7ZH 3RAQA 2NTTA 2R93H 3WOFA 5JEAG 1SFOA 2CQAA 2XD4A 3K0YA 2J6SA 1JR0D 3EA6A 5LMUL 1G2SA 4ETSA 4EYIB 4JI3L 3WOEA 1SYDA 4JI1L 3E6ZX 4M8AA 1Q3LA 1WTHA 3A8IE 5KRUA 1G6PA 2DNCA 3A0JA 1N36Q 3TSSA 5C3XA 2PZTA 2YL2A 4HSVA 4RB2C 1VMCA 4R4QA 5FKAC 4BY7H 2WE6A 1ET6A 1UUPA 3S1NB 2GPWA 4OIJA 5DLFA 2ZJRA 2F52A 2F0EA 2F0TA 4LF5L 3S1MH 4ULLA 1J5EQ 2ZXPA 4NMZA 2JA5G 2YRWA 4R8UB 4Q45A 5M5WB 1I94L 3RZOH 2F0KA 4IPDA 1HRJA 1LTTD 1BCPF 1IBML 1TWCA 4A3KB 5KG6A 4B9WA 4LF4L 2E5LQ 3G6XA 2F0VA 2YU9A 4ZRZA 1WVLA 3GTJA 3NENA 4CDCC 5CV5A 3LULA 2DN8A 3MEHA 3CXCA 2B29A 1SROA 4CMDA 2VUMH 4BXXG 2IHFA 1P8LA 5DAUA 4UCVA 3PFFA 4KD4A 4LFCL 4ECZA 3K7AB 1EKFA 3TS0A 3ETJA 5I2YA 1GVPA 4EEQA 4JV1A 4K14A 4DUYL 3F8TA 4FDBA 1PH7A 3HGBA 2DAAA 1VQIA 2IX3A 1PMRA 1GUWA 4DV7H 2UVRA 5JVH3 2HQLA 2KHSA 3R2IA 3F8NA 2W6OA 2RA4A 4EQOA 5F2DA 4C2MA 2QDLA 5FPRA 1IW7C 5G3LD 1EEID 1VQAA 1N34H 1AEXA 3SK6A 2JA5A 1S5CD 4HJ7A 5KT2A 3QOLA 1B8AA 4JC0A 4BBSB 2BR0A 5T1GA 5EPKA 3SVMA 2KECA 5CAEB 2J0TD 1ILQA 1G2WA 1G291 1H95A 2NYZD 2C2DA 4O81A 2XNAC 4YQWA 2EYOA 3PN1A 2HHHH 1PZKD 4LJZC 3CC2A 2C2EA 2DY8A 5IYBG 2ES2A 1EIGA 1JC7A 4OX9H
chains in the Genus database with same CATH topology
3RN2A 3HKZG 5LMUQ 1QVFA 3MEFA 1SMXA 3PV0A 3CC7A 2OQ0A 2R7ZG 4A4IA 1VQEA 2R93G 4LF5Q 4P71A 4DK6C 3CCVA 1L2FA 4GOPB 4GNXB 3KF8B 3AEVA 2WB1G 1AN7A 2HT1A 4A3FG 3Q8DA 5A2QW 1VQ4A 4DUYQ 4MTNA 2QEXA 4KHPQ 3K7UC 4DV7L 4JI6Q 2LSSA 1NMFA 1N34L 4AQYQ 4JBKA 1X54A 2VUMG 2NVYH 5GROA 1VQ7A 1K3RA 2RGRA 3M4OH 4A75A 4JI7Q 3M3YH 2HHHL 2CW7A 2VQEH 4QY7A 4OX9L 2D0OA 5C4JH 4JCVE 5IYDH 3M9BA 4JI4H 2KSWA 2E8GA 4R4IA 1L1OA 1FJGH 4L5SA 2UXBH 5C44H 3K3VA 2AWNA 1T9HA 2RHQB 3W1BA 4JV5H 2WAQE 2GN5A 1O75A 1FGUA 3RF2A 4B3TH 5J3BA 1XPOA 2JJQA 1VQKA 3NC0B 1CUKA 1LM0A 2HGSA 4DV7Q 1I5FA 4PG3A 3GTMH 2D0PA 2PMZE 4QQBX 1LUZA 1HJPA 2I5HA 2VUGA 1Q7YC 5LMNW 2QGQA 3M4PA 5LMNH 4IFDG 2HIXA 3NELA 1HNWH 2UUCQ 3STBD 1TAEA 2VZAA 4NXNH 5BR8H 2OTLA 4X65H 2HHHQ 4YY3H 3I4MH 4OX9Q 2VQEL 4E6NA 4NXMQ 4B3SH 1LYLA 1OXUA 2R7FA 4JI4L 3HOWH 2E2HH 1VQGA 1Q12A 4DPGA 5ELNA 1D7QA 1PV4A 4LSAA 1TXYA 2ZTDA 1FJGL 3TEHB 1BKBA 2LXJA 1FL0A 4C3JH 5IYDG 4UCOA 1EFWA 1PFSA 1NMGA 3CPWA 5M5XH 4X64H 3G6EA 2JA6G 4B3TL 5C44G 3ULJA 1XPRA 4POGA 3PIPA 3E9IA 1Z2NX 2NN6G 3PUXA 1X9NA 3TY9A 3KALA 2BA1A 2F4VH 1L1OC 5LMNL 2I0QA 3J81c 4JI8H 4GKKH 3ZJYC 1HNWL 4O0AA 1M0WA 4NXNL 1L2ZA 5BR8L 2K52A 4X65L 4GLAC 4YY3L 2KCTA 3A74A 4A3BH 3RLOA 4B3SL 1K0RA 4JI4Q 1C9OA 4IPGA 4UFZA 3L7ZC 1YITA 1OXSC 2PNHA 3DM3A 3I4MG 3CCSA 3JAMi 4LUOA 2UXBQ 4JBMA 3CW2C 4EQ5A 1KAWA 1M1KC 3FHWA 3HOWG 4R4CA 2JA7H 1Z9FA 1SR3A 4LUVA 4X64L 4JV5Q 1Y1WH 1YVCA 1HZBA 2K5NA 3H0GH 4A3MG 1X3FA 4DR4H 1VQ8A 1S03G 4LFBH 2JA9A 2K5VA 2YYZA 4DV0H 3HOVG 1WH2A 4HJ9A 1YHBA 3N40P 2KHIA 3DLLA 1UE1A 3N42B 4Y52H 2IT1A 3KDFB 2F4VL 1E4GT 1CKOA 4YCWA 2UUBH 4JI8L 3J80i 4GKKL 1VS0A 5AJ3L 1NBWA 1V43A 3I4NH 2H5XA 1OXVA 1BGWA 2Y0SE 3SGIA 5E7NA 4EFEA 1J5EH 4B3SQ 1KL9A 4DKAC 4DAMA 1SYXB 3CF5A 3CVZA 4IAJA 3C0FB 2MFIA 3F1ZA 3M4IA 2E5LH 2XTIA 2MO0A 4LW1A 4A3GG 2NVQH 3HXLA 4O2DA 2ZTEA 4LH7A 2VQFH 1KIXA 1JE5A 3CCQA 4A3BG 4A3LH 3CMAA 4X62Q 1UEBA 4DNIA 3I4OA 4HIKA 1TWCH 3ULPA 2HIVA 1M0TA 4UCSA 5GAHC 4LFAH 2PQAA 2UXDQ 4B3MH 2I5LX 2JQOA 4A93G 4DR4L 1Q1BA 4LFBL 4C2MH 4LWCA 4DV0L 5C0XI 2N78A 4GKKQ 2UUBL 1N36L 5AJ3Q 4HJ8A 4MNOA 3ULLA 5JJLA 3HFZB 4BXXH 3H3VI 1J5EL 3HOXH 1MJCA 4PZ6A 1E24A 1IYJB 2GVBA 2E5LL 1N8RC 2DGYA 3ERSX 3I4NG 1B7YB 3PUVA 3N44B 3TREA 2IX0A 4MV9A 1YBYA 3GO5A 3S1NH 1Q46A 3WWVA 4KHPH 1PH9A 2K5HA 3UDGA 5IYBH 4HIDA 5C4XG 5M5WH 4YWKA 2LXKA 1RIPA 3S17H 1C7YA 4LFAL 3B6YA 3KLWA 2ID0A 4A3CG 1JT8A 4B3ML 4DR7H 4JI7H 3K7AH 4DR4Q 1E4FT 2ZJPA 3MXNB 3EYYA 1I6UA 1GO3E 4DV0Q 5FD5A 4APVA 1BBWA 4HIMA 1IBLH 2Z0SA 2UUBQ 4IOCA 1XNRQ 4A3FH 4BBSH 3J81j 5FLXW 4B3RH 2PI2A 4DR5H 3KF6B 1E7ZA 1VQ6A 1TWFH 4DV2H 2Z6KA 4BWSC 1VCIA 3W5OA 1NTGA 1P16A 4H02A 5FPOA 3T1HH 3FKIH 2VQFQ 3RZDH 1TA8A 3S1RH 2XGTA 4TVAB 3HOXG 4J15A 1EIYB 4KHPL 2L15A 1SEIA 1S68A 1Q82C 4NB3A 4JI6L 4AYBG 2BH8A 4LFAQ 5GADC 3JSLA 3HKZE 4AQYL 4R4OA 3VNNA 4DR6H 4B3MQ 1PH2A 2UUCH 4IO9A 2MNAA 4JI7L 1K8GA 2IHEA 1E1OA 5ELOA 4MTEA 4NXMH 3M7NA 2FXQA 5IP9G 1V1QA 2UU9Q 3G71A 2WB1E 3PIOA 4AH6A 1VQCA 4B3RL 4YCUA 3CC4A 3TY5A 4DR5L 1U0LA 1QUQB 1KRTA 4Y7NH 3CCEA 1CSQA 4IJLA 4DV2L 4DR2H 2WYOA 4K0KH 2CQOA 1YI2A 4MV7A 5DLQE 4BBSG 4JI2Q 2WDTA 1XJVA 4LF7Q 1OXTA 3KFUA 2K50A 1TWHH 3PUWA 2XIGA 4APMA 2RHSB 2VY3A 1I6HH 2K4KA 1WCMG 1S72A 3FKIG 1ASZA 2B63G 4C3IH 1AH9A 3BA8A 2W57A 3H15A 1KC8C 4DR6L 2IY5B 2RF4A 1CKNA 4DR7Q 2UUCL 2I5MX 4A3EG 3GTPH 2Z6KC 1X3EA 4IFDI 3OTOH 4NXML 1EQRA 3I55A 1IBLQ 3AFPA 5LL6b 1OXXK 2R7DA 4B3RQ 1CSPA 1IBKH 4YWLA 2JA6H 4DR5Q 1ASYA 1B04A 4BY1G 1VQNA 3GTGH 2GVAA 3U50C 4DV2Q 1Z2OX 3HOZH 4K0KL 3TY8A 1VQOA 1K8AC 4GOPA 2IX1A 1X56A 4GNXA 3T1HQ 4OONA 3J81i 4IJHA 1V9PA 1N9WA 1SRUA 4UP9A 1BVSA 1X6OA 4QIWE 3HOUH 4RAYA 3PUYA 3TS2A 3KJOA 1XPUA 2NN6I 4DR6Q 3FP9A 2R92H 2YTVA 5GAGC 3J7A5 3S14H 2YTYA 3M4QA 3UDIA 3OTOL 1N33Q 5DISC 4PZ8A 4A2BA 3EN2A 1HH2P 4GN3B 2BH2A 4BA1I 4LF8Q 3PO2H 1IBKL 1SLJA 1VQPA 2A19A 4A3MH 2UXBL 3NBZB 4X62H 2YCHA 4DR2Q 1K73C 3U4ZA 4K0KQ 3HOVH 4A76A 4JV5L 2EXDA 2D62A 3DF7A 2UXDH 3K0XA 2A8VA 4UP7A 1XMOH 3NEMA 4DV1Q 3HOZG 3RJ0A 3TQYA 3PGZA 4RMFA 3JAMW 3N6XA 4XIGS 4J0MA 2HVQA 2HVSA 2QA4A 5D1PA 2O03A 3PF4A 4A3GH 4GN4B 5C0XJ 4RB0A 2RCNA 3HOUG 3OTOQ 5JEAJ 4UPAA 4DV3Q 4DR1Q 2UXCQ 3OW2A 4GNXC 3BZKA 1FKAH 5GAEC 1PHJA 2R92G 1B70B 4JI0H 5JJKA 2VNUD 1IBKQ 1VQFA 3RR5A 4X62L 3EBEA 4A93H 5D1OB 3J80W 2CFMA 4KLKA 3CCMA 4PZ7A 1RL2A 4QJFA 3PO2G 2NVXH 4JG2A 3BA9A 1YNXA 3NBYB 1HZAA 3RNUA 1HNZH 2UXDL 5FJ8G 1VQMA 4DV6Q 2PQAB 1QZHA 4DV4Q 2RGVA 3KYHC 5EOYA 1ZHSA 1GKHA 5JJIA 1PH3A 2KCMA 1YHAA 2OCEA 3F2CA 5M5YH 1PVOA 1HZCA 1XNRH 5HGQA 4YCVA 1K9MC 1Z2PX 1W2BA 2ALYB 3A5ZB 4C3HH 3ER0A 3H20A 1A62A 3L4KA 1R9TH 2UUAQ 4MTDA 1G51A 4P73A 4DK3C 5C4XH 4KI0A 4WJ3M 4POFA 1CKMA 4JI0L 1MZBA 3KAJA 4A3CH 4OWXB 4BBRG 4JBJA 3CCRA 3G48A 4XTCS 2JA8H 2OWOA 3GTQH 3S2DH 2CWPA 5IE8A 4LUZA 4L5TA 3PSIA 2MCTA 1VQ5A 3LMLA 1EIFA 2YTXA 4LF6Q 1TWGH 3CCJA 1AE2A 5C3EG 2KBNA 4HJAA 1XMOQ 2R6GA 3T1YQ 1XTDA 2EQSA 2JK8A 4YHHH 3CCUA 1JJ2A 1E22A 4LF9H 4A3JH 1KQSA 2HVRA 1LTLA 2UU9H 4L5QA 2JEAI 2OQKA 1XNRL 1YJ9A 1VQLA 4X66H 2VW9A 1XNQQ 4MZ9A 2CW8A 1KXLA 1E1TA 1MJEA 4JI3H 4LH6A 4JI1H 3AFQA 3KAKA 3PO3G 4JI0Q 3TRZA 1X55A 1X65A 2PI2E 2VQFL 4OO1G 4JI2H 4LF7H 3RIZA 1IZ6A 3OYYA 1IBMH 3G4SA 4LF4H 2CWAA 1MIUA 4A3KH 1GM5A 4RG1A 5IP9H 5IYCG 1HNZQ 1IL2A 2OTJA 2YV5A 3JSNA 2VS1A 2JA8G 2EIFA 3IRBA 1A63A 4PMWA 3UDFA 1O7IA 4YHHL 1FVIA 3GDEA 4JI5Q 4IFDJ 2UU9L 3EIVA 1WI5A 3CAMA 2N3SA 4DV5Q 3PUZA 3GJXB 4X66L 2WP8J 3RGZA 3RTXA 3QWUA 4AIMA 3CPFA 4A3JG 2ZM6H 1BBUA 4AYBE 1EWIA 1L0WA 1WCMH 1GD7A 4YWMA 2B63H 3J7AK 4JI2L 2N49A 4A3DG 4LF7L 1JJGA 1U5KA 3HOYG 4GN5A 4A3EH 1K83H 1EUJA 3JC66 1WJJA 4UP8A 3FMAA 4UY8C 4BA2I 1Z47A 4R7RA 4GLVB 4DR3Q 2V1CC 4I7HA 4DR7L 2Q2TA 1PH6A 5IP7H 3E9HA 3KOJA 4BY1H 4YHHQ 1NJIC 4A3KG 1N33H 1CKNB 4LF9Q 1IBLL 1X3GA 4LF8H 4HIOA 4CC5A 4R4TA 4X66Q 1J6QA 5H1SE 2AKWB 1UE6A 3BZCA 4JI3Q 3UE1A 1Y1VG 1VQHA 4JI1Q 3A5UA 2ZM6L 3S1QH 3KF6A 1L1OB 3HKSA 5IT9W 3D31A 3K81C 3T1HL 1YHQA 1I94Q 1IBMQ 3AYHB 1N32H 2CCZA 4LF4Q 4DAYB 4DV1H 1PH1A 3AQQA 3S16H 4BY7G 4P75A 3CP0A 4UCRA 4LFCQ 3MWMA 4PDBA 4RB1A 3BJUA 3CD6A 2NZHA 2F3IA 3GTKH 3VDYA 4OWWB 4DV3H 1SE8A 1N33L 4DR1H 2UXCH 3J81W 3IG0A 4ALPA 2ZJQA 1HNXH 2VOBA 4LF8L 5IP7G 1PH8A 5FLXc 2KHJA 2ZM6Q 2ATWA 1QUQA 4DR2L 1AE3A 3U58A 4P74A 4JBWA 3J7ZC 3UE0A 3BABA 1PYSB 1OTCA 5FD6A 1WFQA 1UE5A 2FE3A 3NBHB 4P72A 4DV6H 4DV4H 1N32L 4DV1L 1JJCB 3I7FA 4GS3A 1WOCA 1QVCA 4FM9A 4X6AH 3U4VA 1N34Q 2WAQG 1KHIA 4LMYA 4DV3L 4DR1L 2UXCL 5M3MH 2UUAH 4JYAH 2E2IH 1HNXL 4DUZH 1Q1EA 4TQUS 2K75A 2JEBI 2AHOB 5FJ8H 1E3PA 2MO1A 4DRFA 1EYGA 3CQZH 1PYBA 1BJTA 1XMQH 1VQBA 4GLXA 1Q86C 3L0OA 3GB8B 5IT9c 1IXRA 4JOIA 1PA6A 1I50H 1YIJA 1YJWA 4LF6H 3N41B 1N32Q 3RGXA 4DV6L 4DV4L 3BU2A 3T1YH 4A3IH 1XDNA 3F2BA 5IWAH 1EQQA 3D0FA 3CMEA 1KRSA 4L5RC 4OWTB 3PF5A 2NVTH 1XNQH 4GKJH 4BBRH 4GOPC 2UUAL 4JYAL 1HNXQ 2ZTCA 4HJ5A 5EAYA 4IPCA 4DUZL 1S3OA 2VQEQ 1S40A 3UQ8A 5K36G 3E0EA 3S2HH 1W3SA 5M3MG 5C3EH 1XMQL 3GTLH 2C35B 5FLMH 1DGSA 3I2ZA 3RLNA 1HR0W 2AWOA 3L4JA 1FJGQ 1HR0H 2Q2UA 3RN5A 4EFBA 4LF6L 4QL5A 4ME3A 3L2PA 2CKZB 2K14A 1XMOL 1ZHQA 3T1YL 1D8LA 4R1JA 3GD7A 5IWAL 1Q81C 4B3TQ 4JI5H 2VL6A 1YJNA 3BAAA 2A1AA 3PO3H 3K8AA 4DV5H 2AMCB 4RAZA 3F2DA 3N43B 4A3IG 1XNQL 4IOAA 3M85A 4GKJL 1UWVA 1MKHA 4NPSA 4QGUA 5LMNQ 4JYAQ 4JOIC 3S15H 1PH5A 1EOVA 1YZ6A 1HNWQ 3K80C 1N36H 4NXNQ 5BR8Q 4X65Q 1TWAH 4DUZQ 4YY3Q 5M3FH 1UE7A 3STBC 5IYCH 1SFOH 5GQOA 1VQJA 2MQHA 2DUDA 3S24A 4OO1I 4RZQA 1XMQQ 3PCOB 5D1OA 2Y0SG 2E2JH 4WJ4A 4LSXA 1HR0L 2N8NA 4DR3H 1HNZL 2KENA 1M90C 1GYFA 1WYDA 5IY0A 1XK5A 2YU9H 1KD1C 3GTJH 5HY6A 2BA0A 4X64Q 5FLMG 5IWAQ 1Q8KA 1NY4A 3JAMc 3H3VH 1A0IA 4JI5L 3KDFA 4DV5L 2Q2IA 2WFWA 4RB3C 1NE3A 1HZ9A 3UDXA 2JA7G 1VQ9A 4LNQA 3GTOH 4A3DH 1Y1WG 4GKJQ 2JA5H 5LMUH 2F4VQ 3H0GG 3HOYH 4IPHA 4JI8Q 2ZJTA 1VQDA 1C0AA 4UCUA 3KJPA 4LF5H 1I94H 1Y14B 2ASBA 3RLFA 2B3GA 3LGJA 1SN8A 4M7EA 3J80c 3CCLA 1JMCA 5M3FG 4LFCH 2VPSA 1HR0Q 4KHZA 2Q2HA 1YEZA 4DUYH 1A8VA 2NZOA 4DR3L 4CC6A 3I56A 4JI6H 4OXPA 4AQYH 1QZGA 1JB7A 4UCTA 1Y1VH 4Q0YA 4LF9L 3KXYT 4EX5A 4A3LG 3ICEA 3W1GA 1QVGA 1I3QH 5C0XG 4LFBQ 2JE6I 2R7ZH 1PH4A 2R93H 5JEAG 5LMUL 4ETSA 4JI3L 4JI1L 1G6PA 3A0JA 1N36Q 4RB2C 4R4QA 4BY7H 2WE6A 2ZJRA 2F52A 4LF5L 3S1MH 1J5EQ 2JA5G 1I94L 3RZOH 4IPDA 1IBML 4LF4L 2E5LQ 3NENA 3CXCA 2B29A 1SROA 2VUMH 4BXXG 2IHFA 1P8LA 4UCVA 4LFCL 3TS0A 1GVPA 4EEQA 4DUYL 3F8TA 4FDBA 1PH7A 4DV7H 1VQIA 2HQLA 3F8NA 5FPRA 1VQAA 1N34H 4HJ7A 1B8AA 4JC0A 1G291 1H95A 2HHHH 3PN1A 3CC2A 5IYBG 2ES2A 4A2AA 4OX9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJF A;  1WOC A;  3PO2 G;  2NVX H;  4JG2 A;  3RN2 A;  3HKZ G;  5LMU Q;  2E5L L;  1YNX A;  1QVC A;  3BA9 A;  1N8R C;  1HZA A;  3NBY B;  2DGY A;  3ERS X;  3RNU A;  3I4N G;  2UXD L;  1B7Y B;  3PUV A;  4X6A H;  3U4V A;  5FJ8 G;  1VQM A;  1N34 Q;  3TRE A;  2IX0 A;  2WAQ G;  1KHI A;  2PQA B;  4DV6 Q;  1QZH A;  1QVF A;  4DV4 Q;  1YBY A;  3KYH C;  3GO5 A;  4DV3 L;  3S1N H;  4DR1 L;  2UXC L;  1Q46 A;  5M3M H;  3MEF A;  3WWV A;  1SMX A;  3PV0 A;  2E2I H;  1GKH A;  3CC7 A;  5JJI A;  1PH3 A;  2OQ0 A;  1HNX L;  2KCM A;  4A4I A;  1VQE A;  1YHA A;  2R7Z G;  2R93 G;  1PH9 A;  2OCE A;  4LF5 Q;  4P71 A;  2K5H A;  3UDG A;  5IYB H;  3F2C A;  4HID A;  5C4X G;  5M5W H;  4DK6 C;  3CCV A;  1Q1E A;  1L2F A;  4YWK A;  2LXK A;  5M5Y H;  1PVO A;  1RIP A;  3S17 H;  1C7Y A;  4LFA L;  4GOP B;  1HZC A;  4TQU S;  4GNX B;  3KF8 B;  3B6Y A;  3KLW A;  2WB1 G;  5HGQ A;  3AEV A;  2K75 A;  4YCV A;  1K9M C;  2HT1 A;  2JEB I;  4A3F G;  2AHO B;  3Q8D A;  5FJ8 H;  2ID0 A;  2ALY B;  1W2B A;  3A5Z B;  1E3P A;  4A3C G;  4C3H H;  1JT8 A;  2MO1 A;  4B3M L;  4DRF A;  1EYG A;  3ER0 A;  3K7A H;  4DR4 Q;  3CQZ H;  1A62 A;  1PYB A;  2ZJP A;  1VQB A;  3MXN B;  1VQ4 A;  4GLX A;  4DUY Q;  4MTN A;  1R9T H;  2QEX A;  2UUA Q;  1GO3 E;  4DV0 Q;  1Q86 C;  3L0O A;  3GB8 B;  4KHP Q;  3K7U C;  5IT9 c;  1IXR A;  1G51 A;  4JOI A;  4P73 A;  4DK3 C;  5C4X H;  4DV7 L;  4APV A;  1PA6 A;  1BBW A;  1I50 H;  1YIJ A;  4KI0 A;  4HIM A;  1YJW A;  4WJ3 M;  4POF A;  1CKM A;  4JI6 Q;  2Z0S A;  2LSS A;  4JI0 L;  1NMF A;  2UUB Q;  1N34 L;  4IOC A;  4AQY Q;  1X54 A;  4JBK A;  4DV6 L;  1XNR Q;  1N32 Q;  4A3F H;  2VUM G;  4DV4 L;  2NVY H;  4BBS H;  5GRO A;  3BU2 A;  3J81 j;  4A3C H;  1VQ7 A;  4A3I H;  1K3R A;  4OWX B;  4BBR G;  4JBJ A;  3F2B A;  1XDN A;  2PI2 A;  3CCR A;  3G48 A;  4XTC S;  2JA8 H;  3M4O H;  2OWO A;  3KF6 B;  4A75 A;  3GTQ H;  4JI7 Q;  1E7Z A;  1EQQ A;  3M3Y H;  2CWP A;  5IE8 A;  3D0F A;  3S2D H;  4LUZ A;  3CME A;  1VQ6 A;  1TWF H;  2HHH L;  4L5T A;  1KRS A;  2Z6K A;  4QY7 A;  3PSI A;  1VQ5 A;  1VCI A;  4L5R C;  4OX9 L;  4OWT B;  2D0O A;  3W5O A;  5C4J H;  3PF5 A;  4JCV E;  5IYD H;  1NTG A;  1EIF A;  2YTX A;  4LF6 Q;  1P16 A;  1TWG H;  4H02 A;  3M9B A;  3CCJ A;  2NVT H;  5FPO A;  3FKI H;  2VQF Q;  3RZD H;  1AE2 A;  1TA8 A;  5C3E G;  2KBN A;  3S1R H;  4HJA A;  1XMO Q;  4BBR H;  4GOP C;  2XGT A;  2R6G A;  2E8G A;  4TVA B;  3T1Y Q;  1XTD A;  2UUA L;  2EQS A;  4JYA L;  3HOX G;  4J15 A;  4R4I A;  1HNX Q;  1EIY B;  1L1O A;  2JK8 A;  2ZTC A;  3CCU A;  4KHP L;  2L15 A;  1JJ2 A;  1S68 A;  4L5S A;  4HJ5 A;  5C44 H;  1E22 A;  5EAY A;  4A3J H;  1Q82 C;  1KQS A;  4NB3 A;  4JI6 L;  1LTL A;  4IPC A;  4DUZ L;  4L5Q A;  2HVR A;  4AYB G;  1S3O A;  2BH8 A;  2OQK A;  4LFA Q;  5GAD C;  2JEA I;  3JSL A;  2VQE Q;  3HKZ E;  4AQY L;  1XNR L;  1S40 A;  1YJ9 A;  4R4O A;  2AWN A;  3UQ8 A;  1T9H A;  1VQL A;  3VNN A;  2RHQ B;  5K36 G;  3E0E A;  3S2H H;  1W3S A;  3W1B A;  2VW9 A;  2WAQ E;  2GN5 A;  5M3M G;  5C3E H;  4B3M Q;  1XNQ Q;  1PH2 A;  4IO9 A;  1FGU A;  4MZ9 A;  1KXL A;  2MNA A;  4JI7 L;  1E1T A;  5J3B A;  1K8G A;  1XPO A;  1MJE A;  2JJQ A;  1XMQ L;  1VQK A;  3GTL H;  2C35 B;  5FLM H;  1DGS A;  2IHE A;  1CUK A;  1E1O A;  3I2Z A;  5ELO A;  3RLN A;  1LM0 A;  1HR0 W;  3AFQ A;  3NC0 B;  4LH6 A;  4DV7 Q;  2AWO A;  1I5F A;  4PG3 A;  3GTM H;  1FJG Q;  2D0P A;  2Q2U A;  3RN5 A;  3M7N A;  2PMZ E;  4QQB X;  1LUZ A;  4EFB A;  3PO3 G;  2FXQ A;  5IP9 G;  4JI0 Q;  4LF6 L;  1HJP A;  1V1Q A;  1X55 A;  2UU9 Q;  3TRZ A;  1X65 A;  2I5H A;  3G71 A;  2PI2 E;  2VUG A;  2WB1 E;  4QL5 A;  3PIO A;  2VQF L;  1Q7Y C;  4ME3 A;  4OO1 G;  3L2P A;  2CKZ B;  5LMN W;  2K14 A;  2QGQ A;  4AH6 A;  1XMO L;  3M4P A;  1VQC A;  3T1Y L;  1IZ6 A;  3OYY A;  4IFD G;  1D8L A;  2HIX A;  4YCU A;  4B3R L;  4R1J A;  3NEL A;  3GD7 A;  3G4S A;  3CC4 A;  5IWA L;  2UUC Q;  3STB D;  1TAE A;  3TY5 A;  4DR5 L;  2VZA A;  1U0L A;  1Q81 C;  1QUQ B;  2OTL A;  4B3T Q;  2CWA A;  1MIU A;  1KRT A;  4Y7N H;  2HHH Q;  3CCE A;  2VL6 A;  1CSQ A;  1YJN A;  4IJL A;  4A3K H;  3I4M H;  4DV2 L;  4OX9 Q;  2VQE L;  1GM5 A;  4E6N A;  3BAA A;  4RG1 A;  4NXM Q;  2A1A A;  3PO3 H;  5IP9 H;  3K8A A;  2AMC B;  2CQO A;  1YI2 A;  5IYC G;  5DLQ E;  4BBS G;  1HNZ Q;  3F2D A;  1IL2 A;  1LYL A;  1OXU A;  4A3I G;  2R7F A;  1XNQ L;  4JI4 L;  2YV5 A;  4JI2 Q;  3HOW H;  4IOA A;  3M85 A;  2OTJ A;  4GKJ L;  1UWV A;  2VS1 A;  2JA8 G;  3JSN A;  1XJV A;  2E2H H;  1VQG A;  1MKH A;  1Q12 A;  4NPS A;  4DPG A;  4LF7 Q;  2EIF A;  1OXT A;  3IRB A;  5ELN A;  4QGU A;  5LMN Q;  4JYA Q;  4PMW A;  1A63 A;  4JOI C;  1D7Q A;  3S15 H;  1PV4 A;  3KFU A;  2K50 A;  3UDF A;  1TWH H;  1PH5 A;  1EOV A;  2ZTD A;  1TXY A;  1O7I A;  1YZ6 A;  3K80 C;  3PUW A;  3TEH B;  4YHH L;  1BKB A;  1FJG L;  4NXN Q;  2RHS B;  2LXJ A;  1FVI A;  3GDE A;  5BR8 Q;  1FL0 A;  2VY3 A;  4X65 Q;  1TWA H;  4DUZ Q;  4JI5 Q;  4C3J H;  4YY3 Q;  5IYD G;  4IFD J;  4UCO A;  2UU9 L;  1EFW A;  1I6H H;  1PFS A;  3EIV A;  5M3F H;  1NMG A;  1UE7 A;  2K4K A;  1WCM G;  3STB C;  1S72 A;  3FKI G;  1ASZ A;  1WI5 A;  5IYC H;  3CAM A;  1SFO H;  2B63 G;  5GQO A;  4C3I H;  1AH9 A;  2N3S A;  3CPW A;  3BA8 A;  1VQJ A;  4DV5 Q;  3PUZ A;  5M5X H;  3G6E A;  2MQH A;  3GJX B;  3H15 A;  4X66 L;  1KC8 C;  2DUD A;  4DR6 L;  2WP8 J;  3S24 A;  2RF4 A;  2IY5 B;  1CKN A;  4DR7 Q;  4OO1 I;  2UUC L;  2JA6 G;  3RTX A;  2I5M X;  1XMQ Q;  4B3T L;  3QWU A;  4AIM A;  3CPF A;  4A3E G;  3GTP H;  2Z6K C;  1X3E A;  5C44 G;  3PCO B;  4A3J G;  4IFD I;  5D1O A;  1BBU A;  3ULJ A;  1XPR A;  4POG A;  2Y0S G;  2E2J H;  4NXM L;  4WJ4 A;  1HR0 L;  1EQR A;  3PIP A;  3E9I A;  3I55 A;  1IBL Q;  3AFP A;  1EWI A;  1L0W A;  4AYB E;  2N8N A;  1WCM H;  2NN6 G;  1HNZ L;  1GD7 A;  3PUX A;  4YWM A;  1X9N A;  2KEN A;  1M90 C;  2B63 H;  3TY9 A;  4JI2 L;  1WYD A;  5IY0 A;  2N49 A;  2BA1 A;  1XK5 A;  2YU9 H;  1KD1 C;  1OXX K;  3GTJ H;  4A3D G;  2R7D A;  4LF7 L;  5HY6 A;  4B3R Q;  1JJG A;  1L1O C;  1CSP A;  2BA0 A;  4X64 Q;  5LMN L;  4YWL A;  2I0Q A;  3J81 c;  2JA6 H;  5FLM G;  5IWA Q;  1U5K A;  3HOY G;  1Q8K A;  4GN5 A;  4DR5 Q;  1ASY A;  3ZJY C;  4A3E H;  1HNW L;  1B04 A;  4BY1 G;  4O0A A;  1VQN A;  1K83 H;  1EUJ A;  3JC6 6;  1NY4 A;  4NXN L;  5BR8 L;  2K52 A;  1WJJ A;  2GVA A;  3JAM c;  3U50 C;  4X65 L;  3GTG H;  1A0I A;  4JI5 L;  3H3V H;  4GLA C;  4YY3 L;  4DV2 Q;  4UP8 A;  2KCT A;  4UY8 C;  4BA2 I;  3A74 A;  1Z47 A;  4A3B H;  3HOZ H;  3RLO A;  3KDF A;  4B3S L;  4K0K L;  4DV5 L;  3TY8 A;  2Q2I A;  1VQO A;  1K8A C;  2WFW A;  4GLV B;  1K0R A;  4DR3 Q;  4GOP A;  2IX1 A;  1NE3 A;  1HZ9 A;  1X56 A;  2V1C C;  3UDX A;  4GNX A;  4OON A;  3T1H Q;  1VQ9 A;  4JI4 Q;  4LNQ A;  2JA7 G;  1C9O A;  3GTO H;  4A3D H;  1Y1W G;  2Q2T A;  4DR7 L;  4GKJ Q;  2JA5 H;  4IPG A;  4UFZ A;  1PH6 A;  3J81 i;  5IP7 H;  3L7Z C;  3E9H A;  2F4V Q;  4IJH A;  3H0G G;  3KOJ A;  3HOY H;  1YIT A;  1V9P A;  1OXS C;  1N9W A;  4BY1 H;  4IPH A;  2PNH A;  4JI8 Q;  4YHH Q;  1NJI C;  3DM3 A;  4A3K G;  3CCS A;  3JAM i;  3I4M G;  1CKN B;  4LUO A;  1SRU A;  2UXB Q;  1VQD A;  4LF9 Q;  4JBM A;  1IBL L;  1C0A A;  4UP9 A;  1BVS A;  3CW2 C;  1X6O A;  4QIW E;  4EQ5 A;  3HOU H;  1KAW A;  4UCU A;  1X3G A;  3KJP A;  1M1K C;  3FHW A;  3HOW G;  3PUY A;  4R4C A;  3TS2 A;  4HIO A;  4CC5 A;  4R4T A;  1Y14 B;  3KJO A;  2JA7 H;  1Z9F A;  1SR3 A;  4LUV A;  2ASB A;  4X66 Q;  3RLF A;  2B3G A;  1J6Q A;  2NN6 I;  4X64 L;  1XPU A;  1Y1W H;  4DR6 Q;  4JV5 Q;  3FP9 A;  1YVC A;  3LGJ A;  5H1S E;  1SN8 A;  2AKW B;  1HZB A;  2YTV A;  2K5N A;  2R92 H;  5GAG C;  3J7A 5;  3S14 H;  1UE6 A;  3H0G H;  2YTY A;  3M4Q A;  3J80 c;  3BZC A;  4A3M G;  3UE1 A;  3UDI A;  3CCL A;  4JI3 Q;  1HNW Q;  1Y1V G;  1VQH A;  4JI1 Q;  3A5U A;  2ZM6 L;  3S1Q H;  3KF6 A;  1JMC A;  5M3F G;  1L1O B;  1X3F A;  1HR0 Q;  3OTO L;  1VQ8 A;  4KHZ A;  1N33 Q;  5DIS C;  2JA9 A;  2K5V A;  3HKS A;  4PZ8 A;  3EN2 A;  2Q2H A;  1YEZ A;  2YYZ A;  3D31 A;  1HH2 P;  1A8V A;  2NZO A;  4DR3 L;  3HOV G;  3K81 C;  4GN3 B;  4HJ9 A;  3T1H L;  1YHB A;  2BH2 A;  2KHI A;  4CC6 A;  4BA1 I;  3DLL A;  4LF8 Q;  3I56 A;  1UE1 A;  1YHQ A;  4OXP A;  4Y52 H;  1I94 Q;  2IT1 A;  3KDF B;  2F4V L;  3PO2 H;  1CKO A;  1IBM Q;  4YCW A;  1IBK L;  1SLJ A;  3AYH B;  1VQP A;  1QZG A;  2CCZ A;  2A19 A;  4JI8 L;  3J80 i;  1JB7 A;  4LF4 Q;  4GKK L;  1VS0 A;  4DAY B;  4A3M H;  4UCT A;  5AJ3 L;  1NBW A;  1V43 A;  3I4N H;  2UXB L;  1Y1V H;  4LF9 L;  1PH1 A;  3NBZ B;  3AQQ A;  3S16 H;  4EX5 A;  2H5X A;  1OXV A;  2Y0S E;  4A3L G;  4BY7 G;  4P75 A;  3SGI A;  4UCV A;  3CP0 A;  3ICE A;  5E7N A;  3W1G A;  4DR2 Q;  4UCR A;  4LFC Q;  1QVG A;  4EFE A;  1K73 C;  3U4Z A;  4B3S Q;  4K0K Q;  1KL9 A;  1I3Q H;  4DKA C;  4DAM A;  5C0X G;  3HOV H;  4LFB Q;  2JE6 I;  4A76 A;  3CF5 A;  2R7Z H;  1PH4 A;  2MFI A;  3BJU A;  4JV5 L;  2R93 H;  2EXD A;  2D62 A;  3F1Z A;  3CD6 A;  2NZH A;  5JEA G;  2F3I A;  2XTI A;  3GTK H;  2MO0 A;  5LMU L;  4LW1 A;  4A3G G;  2NVQ H;  4JI3 L;  3VDY A;  3K0X A;  4O2D A;  2A8V A;  4OWW B;  2ZTE A;  4UP7 A;  4JI1 L;  4LH7 A;  1KIX A;  1G6P A;  3A0J A;  1N36 Q;  1JE5 A;  1SE8 A;  3NEM A;  4DV1 Q;  1N33 L;  3CCQ A;  4R4Q A;  4A3B G;  4A3L H;  4BY7 H;  3CMA A;  4X62 Q;  3HOZ G;  4ALP A;  2ZJQ A;  1UEB A;  2ZJR A;  4DNI A;  3I4O A;  3TQY A;  2F52 A;  4HIK A;  1TWC H;  3PGZ A;  4RMF A;  3ULP A;  2HIV A;  4LF5 L;  3S1M H;  1J5E Q;  4XIG S;  4LF8 L;  4UCS A;  2JA5 G;  2HVQ A;  1I94 L;  2HVS A;  5GAH C;  2QA4 A;  4IPD A;  5IP7 G;  1PH8 A;  3RZO H;  5D1P A;  2PQA A;  5FLX c;  1IBM L;  3PF4 A;  2KHJ A;  4A3G H;  4LF4 L;  2E5L Q;  4GN4 B;  5C0X J;  2RCN A;  3NEN A;  2UXD Q;  3CXC A;  2B29 A;  1SRO A;  2ZM6 Q;  2VUM H;  2I5L X;  1IYJ B;  4BXX G;  2IHF A;  1P8L A;  2JQO A;  3OTO Q;  2ATW A;  5JEA J;  1QUQ A;  4UPA A;  4DR2 L;  3HOU G;  1AE3 A;  4LFC L;  4A93 G;  3U58 A;  4DR4 L;  4DV3 Q;  4DR1 Q;  3TS0 A;  2UXC Q;  1Q1B A;  4LFB L;  4C2M H;  4GNX C;  3OW2 A;  4P74 A;  3BZK A;  1GVP A;  4JBW A;  4EEQ A;  3J7Z C;  3F8T A;  4DUY L;  3UE0 A;  4FDB A;  1PH7 A;  4LWC A;  4DV0 L;  1VQI A;  3BAB A;  5GAE C;  1PYS B;  2HQL A;  1PHJ A;  2R92 G;  1B70 B;  1OTC A;  5C0X I;  1WFQ A;  2VNU D;  5JJK A;  5FPR A;  1UE5 A;  1VQA A;  2N78 A;  1IBK Q;  1VQF A;  3NBH B;  4P72 A;  4GKK Q;  3RR5 A;  2UUB L;  1N36 L;  5AJ3 Q;  1N32 L;  4HJ8 A;  4HJ7 A;  4MNO A;  3ULL A;  4DV1 L;  1B8A A;  4JC0 A;  5JJL A;  1JJC B;  3HFZ B;  4X62 L;  4BXX H;  3I7F A;  3H3V I;  1G29 1;  3EBE A;  4A93 H;  5D1O B;  1H95 A;  2CFM A;  4KLK A;  1J5E L;  4GS3 A;  3PN1 A;  3HOX H;  3CCM A;  3CC2 A;  4PZ7 A;  1RL2 A;  1MJC A;  5IYB G;  2ES2 A;  4PZ6 A;  1E24 A;  2GVB A; 
#chains in the Genus database with same CATH topology
 2D9U A;  5KG4 A;  3RN2 A;  3DUZ A;  3HKZ G;  2XIW A;  2F0S A;  2FFK B;  2K01 A;  5LMU Q;  1PTO C;  5BPH A;  2RVL A;  1EWH A;  2RDI A;  2CVR A;  3L3O C;  3LWE A;  1WCM B;  1M4V A;  1ET0 A;  4B9X A;  3FKI B;  4O3S A;  1QVF A;  2B63 B;  1B33 N;  4G3I A;  5CB4 F;  5JH7 F;  2K33 A;  3VYU A;  5KG2 A;  3TIG A;  3MEF A;  2FK3 A;  1SMX A;  3PV0 A;  3CC7 A;  2M9V A;  4QF4 A;  2OQ0 A;  2R7Z G;  4A4I A;  1VQE A;  2R93 G;  4LF5 Q;  3MJF A;  2W6P A;  4P71 A;  1RCV D;  4QUF A;  2N88 A;  4A3E B;  4YJ3 F;  4FBU A;  4ZUJ A;  1K83 B;  4DK6 C;  5KFR A;  1SJE D;  3CCV A;  1L2F A;  2A69 C;  3OIQ A;  4GOP B;  4O3N A;  5KT3 A;  4GNX B;  1V1P B;  3KF8 B;  3KLS A;  3AEV A;  2WB1 G;  2XN9 C;  3CKI B;  1AN7 A;  2HT1 A;  3HEJ A;  4A3F G;  1O80 A;  3Q8D A;  2MPM A;  4KMU C;  1XYI A;  1UC9 A;  3JRX A;  3HKZ A;  3T51 B;  5A2Q W;  2B2Y C;  2W8K A;  1EY9 A;  4WJW A;  1HA6 A;  3T4A C;  4IFD H;  2BDN A;  2A68 D;  1VQ4 A;  4KKU A;  5KG1 A;  4DUY Q;  1B4O A;  2E74 C;  4KTA A;  4MTN A;  4E6I A;  2QEX A;  2F0I A;  4KHP Q;  3K7U C;  1GJX A;  4MN3 A;  4DV7 L;  5K3W A;  4BY1 B;  3A55 A;  2EYP A;  1A15 A;  4S3S A;  1KDB A;  3EFX D;  1I3Q A;  4OEL B;  4JI6 Q;  3N52 A;  2LSS A;  2R7Z A;  4U6P A;  2R93 A;  1NMF A;  5DG7 A;  2AQ2 B;  1N34 L;  4AQY Q;  4JBK A;  1X54 A;  3TN2 A;  2VUM G;  2NVY H;  4RGO S;  5GRO A;  5J39 A;  5KFS A;  1VQ7 A;  4ABN A;  1B6S A;  1I2K A;  2W70 A;  1K3R A;  3Q1K A;  4OGQ C;  2RGR A;  1O7Z A;  4HMJ A;  2WB1 A;  4O42 A;  3M4O H;  2KJX A;  2IBK A;  4A75 A;  2CH4 W;  4JI7 Q;  2HDM A;  3M3Y H;  3DMU A;  3W3A A;  3PR5 B;  2HHH L;  2CW7 A;  1A3G A;  2C22 A;  2VQE H;  4QY7 A;  1SE4 A;  4OX9 L;  5IGB A;  2D0O A;  5C4J H;  3PW7 A;  4JCV E;  1BF4 A;  5IYD H;  4YP3 A;  4CDD C;  1GUT A;  4RNM A;  3M9B A;  1TWF A;  3TZU A;  4MIU A;  4JV2 A;  4JI4 H;  1HHV A;  3NPP A;  3DM1 A;  5COR A;  2KSW A;  3PVX A;  1JLL B;  3AU7 A;  2ASL A;  3H3V C;  3JZI A;  4GZY C;  2E8G A;  2RDG A;  2K05 A;  4OHJ A;  4QWE A;  1PRT D;  2A74 C;  4R4I A;  4ZUI A;  1L1O A;  2VUM A;  1FJG H;  5HNE A;  1DV1 A;  4FBT A;  4L5S A;  2UXB H;  2I80 A;  5C44 H;  4KY6 A;  4JV0 A;  3GIL A;  5EPJ A;  3K3V A;  4WOR A;  4E4T A;  4F4Z A;  1KNA A;  1I4X A;  2AWN A;  1T9H A;  2WIN B;  4C3I B;  2RHQ B;  2HDK A;  5KX5 F;  4RA8 A;  3W1B A;  4RWS C;  4JV5 H;  4X3S A;  3GII A;  2WAQ E;  2GN5 A;  1O75 A;  1WR2 A;  4O3O A;  3D6C A;  4TQS A;  4DAY A;  1FGU A;  2K6A A;  1S5E D;  3RF2 A;  2MP1 A;  5GON F;  3U55 A;  1SND A;  5J3B A;  2BQR A;  1XPO A;  4B3T H;  2JJQ A;  2PMZ B;  1VQK A;  5E3F A;  5A2Q L;  3GTP B;  3NC0 B;  1CUK A;  4O7R A;  2JEI A;  1LM0 A;  2HGS A;  4DV7 Q;  1SCU B;  2CHB D;  1I5F A;  3I72 A;  4PG3 A;  2RBM A;  3GTM H;  2D0P A;  2PMZ E;  4QQB X;  2B2W A;  2R3Z A;  1LUZ A;  1IYE A;  1UC8 A;  2W6M A;  5D8D A;  1HJP A;  1F77 A;  1ESR A;  2I5H A;  2VUG A;  3K5L A;  5CA0 F;  4M0J A;  1Q7Y C;  5KFA A;  5LMN W;  5K36 H;  2PVP A;  2QGQ A;  1BUV T;  3M4P A;  3GQC A;  5LMN H;  1ESF A;  4IFD G;  5KFI A;  2HIX A;  3NEL A;  4J9L A;  2QKI C;  5EGT A;  1HNW H;  1ZXT A;  2UUC Q;  1SE2 A;  3QB3 A;  3STB D;  2L4N A;  1TAE A;  5KFZ A;  2VZA A;  5BWT A;  2R61 A;  5BR8 H;  1RYS A;  3I73 A;  2OTL A;  4NXN H;  4X65 H;  2HHH Q;  1BOS A;  4YY3 H;  4ED0 A;  3I4M H;  2JXM B;  1EHI A;  4OX9 Q;  2R8I A;  2VQE L;  4E6N A;  1T5X D;  4I65 A;  3Q22 A;  4NXM Q;  5J22 A;  2NUC A;  4B3S H;  1SEB D;  2E75 C;  4CDE C;  1SYC A;  3HOZ B;  2FJZ A;  1Y69 U;  1EY6 A;  1LYL A;  1OXU A;  2G5D A;  2SNS A;  2YZG A;  2R7F A;  4JI4 L;  5CBA E;  3HOW H;  4HAE A;  1ENF A;  3M9N B;  1LTS D;  2Z4H A;  1VQG A;  1EWC A;  1Q12 A;  4M1U B;  5D65 A;  4DPG A;  2E2H H;  1WSC A;  3KK7 A;  5ELN A;  3RUP A;  1D7Q A;  1DON A;  5JQG F;  3W2D A;  2O4X A;  1PV4 A;  1JOK A;  4LSA A;  3D4R A;  1TXY A;  2ZTD A;  3D6W A;  5I9P A;  1FJG L;  1D1I A;  3TEH B;  2AQ4 A;  1BKB A;  2D5D A;  2LXJ A;  1FL0 A;  5LL6 X;  4C3J H;  5IYD G;  4UCO A;  1EFW A;  1PFS A;  2D2C C;  1NMG A;  3BDL A;  1TWH A;  2EYF A;  3X3M A;  3CPW A;  2EJF C;  5KG5 A;  3OSP A;  2F0Q A;  3NXW A;  5M5X H;  3G6E A;  4X64 H;  4RUA A;  1A48 A;  4QIW A;  3NBH A;  2HUG A;  4XT3 B;  1S5F D;  2K32 A;  5KT6 A;  2JA6 G;  2R92 B;  2NVY A;  1LTI D;  3S14 B;  4B3T L;  4YIJ A;  5I6W A;  3TP6 A;  5C44 G;  3CU7 A;  3UZB A;  1T5E A;  3A8K E;  3ULJ A;  5KFK A;  2IJ0 A;  1XPR A;  4POG A;  4J9K A;  2W6Z A;  4DN4 M;  2A68 C;  3PIP A;  3E9I A;  1EEF D;  1Z2N X;  3Q24 A;  2NN6 G;  1I4H A;  3PUX A;  3HZX A;  1X9N A;  4K6D A;  2E2I B;  1RJQ A;  3TY9 A;  3A7A B;  3TIN A;  4RHR A;  3AW8 A;  3KAL A;  3KHG A;  5IGF A;  3IFT A;  2BA1 A;  3UZO A;  2F4V H;  3QR8 A;  4DL6 A;  1L1O C;  4R8N A;  5LMN L;  2I0Q A;  3J81 c;  4IWX A;  4DQN A;  3PO2 B;  1JX4 A;  4JI8 H;  4GKK H;  1BXT A;  1AP0 A;  4XDX A;  3ZJY C;  1HNW L;  4KJO A;  4K6N A;  4O0A A;  3T5L A;  1M0W A;  4NXN L;  1L2Z A;  2I8C A;  5BR8 L;  4FFR A;  2K52 A;  3VOT A;  4X65 L;  3ORR A;  4GLA C;  4YY3 L;  1N48 A;  3OUU A;  2KCT A;  2JA6 A;  3GV7 B;  4ZKB B;  2PZU A;  3A74 A;  4ED8 A;  4A3B H;  4YAJ B;  4ED6 A;  2ATL A;  1TVX A;  3RLO A;  3CQZ B;  4B3S L;  3GTG A;  4CDF C;  1WTV A;  1SYB A;  1K0R A;  4DAV A;  4JI4 Q;  1QIL A;  4O2B F;  2M2L A;  4YJ2 F;  1C9O A;  2UVU A;  2IA6 A;  2R84 A;  4IPG A;  3TZD A;  4UFZ A;  1KBL A;  1RK5 A;  1I50 B;  3L7Z C;  3MZ5 A;  1KUT A;  4FE2 A;  2HHF B;  2L1B A;  1YIT A;  3RV4 A;  3KHL A;  1OXS C;  2PNH A;  1HTP A;  1CFM A;  2I07 B;  4ECT A;  3DM3 A;  3I4M G;  3CCS A;  1ET9 A;  3JAM i;  2XCP A;  4LUO A;  2UXB Q;  3HT5 A;  5CR3 A;  2OXP A;  4ZLT F;  4JBM A;  1KNE A;  3EPI A;  3CW2 C;  4G57 A;  3FPP A;  1PRT C;  2W6N A;  4EQ5 A;  1KAW A;  1SNP A;  3D8G A;  4WHX A;  3GTM A;  1M1K C;  3FHW A;  2X0S A;  3HOW G;  4R4C A;  5KT7 A;  3E5N A;  3KHR A;  2JA7 H;  2ZXR A;  2W9B B;  1Z9F A;  1SR3 A;  4LUV A;  1PTO H;  3U54 A;  4X64 L;  4JV5 Q;  2DPI A;  5AFW A;  1Y1W H;  4U7C A;  1YVC A;  4QWD A;  1HZB A;  2K5N A;  3H0G H;  1GUO A;  4A3M G;  4IQZ A;  1W96 A;  3MFH A;  4EBD A;  2EXZ A;  2NVT B;  4C3J G;  5C5M A;  4MV1 A;  3GV5 B;  2NTS A;  5L9X A;  2PN1 A;  1H9S A;  1X3F A;  4DR4 H;  2RDH A;  1VQ8 A;  1T36 A;  1S03 G;  4LFB H;  2JA9 A;  2K5V A;  2RSO A;  2EJ3 A;  4O86 A;  4BBR B;  2YYZ A;  3C1E A;  4DV0 H;  3HOV G;  2L11 A;  1WH2 A;  4HJ9 A;  1YHB A;  3N40 P;  2KHI A;  4UHV A;  3N8D A;  3DLL A;  1UE1 A;  1YNJ D;  3N42 B;  3BQ0 A;  5D3D A;  4MV6 A;  4Y52 H;  2C2R A;  4IRC A;  2IT1 A;  3GLK A;  3KDF B;  2F4V L;  3OW7 A;  5C3W A;  1E4G T;  5KFY A;  3GIK A;  1CKO A;  4YR0 A;  4YCW A;  2F0P A;  3I70 A;  5L1L A;  1O7L A;  4CJ0 B;  2UUB H;  2Y0S B;  4JI8 L;  3J80 i;  4GKK L;  1NNX A;  1VS0 A;  1TII D;  4KN7 C;  5AJ3 L;  1NBW A;  1V43 A;  3I4N H;  4IHJ F;  1EQV A;  4FFP A;  4KKT A;  5KFP A;  5CV4 A;  3V05 A;  4RU9 A;  3S2H B;  2H5X A;  1OXV A;  1BGW A;  2Y0S E;  3SGI A;  5C3E B;  3QOJ A;  5E7N A;  1ZEQ X;  2C9O A;  4EFE A;  1J5E H;  1CA6 A;  4B3S Q;  1ML0 D;  1KL9 A;  4DKA C;  4DAM A;  1SYX B;  1E4E A;  3CF5 A;  1WRV A;  3CVZ A;  4HYK A;  4IAJ A;  3GTL B;  5F9L A;  3C0F B;  2MFI A;  4HTH A;  2OH2 A;  3F1Z A;  2FMM A;  3M4I A;  2A5H A;  2E5L H;  2XTI A;  1G6Z A;  2MO0 A;  2CW0 D;  4LW1 A;  2R7M A;  4A3G G;  2NVQ H;  4HR7 A;  3NTK A;  3HXL A;  3G6V A;  2AQ3 B;  3Q0A A;  1VF5 C;  4O2D A;  2F3W A;  1ONL A;  2ZTE A;  4LH7 A;  2VQF H;  1ENA A;  1KIX A;  2F0U A;  3KRE A;  3QIA A;  1JE5 A;  1E0B A;  3CCQ A;  4A3B G;  3NTI A;  4A3L H;  5KFE A;  3CMA A;  4X62 Q;  1UEB A;  4DNI A;  3I4O A;  3R5X A;  4HIK A;  1GUN A;  1TWC H;  3ULP A;  4TUY F;  5I47 A;  5C0X H;  2HIV A;  4C1N I;  1M0T A;  1SNC A;  4UCS A;  5KFV A;  5GAH C;  4LFA H;  5JEA H;  3DAA A;  2PQA A;  5DNF A;  5KFL A;  1GGO A;  4ZI7 F;  4J6H A;  2J9G A;  5KFO A;  3PO3 B;  2WKC A;  1UAP A;  3KBX A;  1WTX A;  1IL8 A;  5H80 A;  2UXD Q;  1KTA A;  4FFO A;  4LAA A;  4B3M H;  2L55 A;  2I5L X;  5FR9 A;  2JQO A;  2P0A A;  1TQO A;  4ZQ3 A;  4A93 G;  3MA2 B;  3J7Y W;  4DR4 L;  2V59 A;  3MHB A;  5FO9 B;  1HA5 A;  1Q1B A;  5JOB A;  4LFB L;  4C2M H;  3NTH A;  5FO8 B;  2BQ3 A;  3G8C A;  1D5Z C;  2R7L A;  4LWC A;  4DV0 L;  1X3Q A;  4O4I F;  4O7S A;  5C0X I;  2Q7D A;  1KAA A;  4XQN A;  3U9T A;  5C4Z A;  2OT2 A;  1TWA B;  5DQI A;  2N78 A;  2W71 A;  4CKE A;  4IRK A;  4GKK Q;  2UUB L;  1WTR A;  2YZN A;  1I4Q A;  5AJ3 Q;  1N36 L;  4HJ8 A;  4ZAI A;  4MNO A;  3ULL A;  1SFO B;  3SNO A;  5JJL A;  3OWF A;  3HFZ B;  4BXX H;  2ZDG A;  1V51 A;  1D1K A;  3H3V I;  4IUP A;  4I55 F;  2JA8 B;  1KLU D;  2NU6 B;  3E3X A;  1J5E L;  5E1F A;  5L1J A;  3HOX H;  4F88 A;  5HUR A;  1D5X C;  1MJC A;  1B3Q A;  1E24 A;  2GVB A;  1IYJ B;  4PZ6 A;  2AGO A;  2DZD A;  1GHJ A;  2Z9H A;  3V6J A;  5EKL A;  2SDF A;  2DWC A;  2E5L L;  2E2D C;  1N8R C;  4O2A F;  2DGY A;  3ERS X;  3I4N G;  1TWG B;  1B7Y B;  1R4P B;  3PUV A;  3N44 B;  1BQQ T;  4RKB A;  3TRE A;  2IX0 A;  4DL5 A;  4MV9 A;  3MC0 B;  2NVX A;  1YBY A;  4RGT A;  3GO5 A;  3S1N H;  1SNQ A;  1Q46 A;  2HGW A;  3GTJ B;  3WWV A;  2PCF B;  3LWB A;  1KT8 A;  3IL8 A;  1KC7 A;  4KHP H;  2F0L A;  5KFQ A;  3K58 A;  1PH9 A;  2B2U A;  2K5H A;  3UDG A;  5IYB H;  3VYR A;  4HID A;  5M5W H;  4PMC A;  5C4X G;  5L1I A;  4A3J B;  4YWK A;  2LXK A;  1PLF A;  3SI8 A;  1RIP A;  3S17 H;  3DWP A;  1C7Y A;  1STG A;  5ELD A;  4LFA L;  3B6Y A;  3KLW A;  1IHZ A;  4O3R A;  5EJW A;  3M7G A;  1ENC A;  1K0S A;  2NU9 B;  2ZDH A;  5BWR A;  2ID0 A;  1EKV A;  4A3C G;  3DTG A;  3G7L A;  1A3V A;  1JT8 A;  1KDA A;  4B3M L;  4DR7 H;  3T9C A;  4JI7 H;  3K7A H;  2O2L D;  1HFG A;  3K5O A;  4DR4 Q;  1E4F T;  3GTO B;  2ZJP A;  4A3D B;  4GC7 A;  3MXN B;  2JA5 B;  5CE8 A;  3EYY A;  3E5S A;  1EU4 A;  1I6U A;  4RCN A;  4RAU C;  1DOM A;  2EYM A;  2F0J A;  4LK1 C;  2QB5 A;  1GO3 E;  4DV0 Q;  3HOY B;  2Z4I A;  1YNN D;  5FD5 A;  4F4Y A;  1WD0 A;  4APV A;  2PBZ A;  1BBW A;  3TDQ A;  4HIM A;  1IBL H;  1EUC B;  2Z0S A;  1JDB B;  2HGX A;  3BAC A;  1R9T A;  2SEB D;  2UVV A;  2PW5 A;  4FP5 D;  2UUB Q;  4IOC A;  1XNR Q;  4A3F H;  1YNJ C;  4BBS H;  1QCB D;  3L9A X;  3J81 j;  3TQT A;  5FLX W;  1N56 A;  4B3R H;  4KK7 A;  1W93 A;  1D5M C;  1BCP D;  2PI2 A;  2ASD A;  3SXH A;  2EYL A;  3SHL A;  4Q0F A;  4DR5 H;  1I6V C;  3KF6 B;  5NUC A;  3PW5 A;  2QEJ C;  1E7Z A;  1BNC A;  1JIC A;  4XT1 B;  5CM0 A;  4HED A;  1VQ6 A;  5IIF A;  5KG7 A;  1TWF H;  1EYD A;  4DV2 H;  2Z6K A;  3O13 A;  3U0G A;  1KJJ A;  4BWS C;  1VCI A;  3W5O A;  2XGQ A;  3MFY A;  1NTG A;  5E4X A;  3RBD A;  1P16 A;  2NUA B;  4H02 A;  1DJR D;  3FDT A;  3MAQ A;  1S4Z A;  5FPO A;  3T1H H;  1F9P A;  3FKI H;  4FFL A;  2VQF Q;  3RZD H;  1RF2 D;  1TA8 A;  3PZP A;  1S0M A;  3S1R H;  1SDF A;  2CW0 C;  4O7L A;  2XGT A;  4TVA B;  4YB8 B;  2FIN B;  5L37 A;  1EIH A;  3D4W A;  3HOX G;  4J15 A;  1EIY B;  5F9N A;  4KHP L;  3ERQ A;  3TII A;  2L15 A;  2RCF A;  1S68 A;  1SEI A;  5I9O A;  1Q82 C;  4BS9 A;  4DXG A;  1Y1V B;  4NB3 A;  4JI6 L;  4ZKC B;  4AYB G;  2BH8 A;  4LFA Q;  5GAD C;  3JSL A;  5KYL A;  3RV3 A;  2FLP A;  3OUZ A;  1CI3 M;  1STA A;  3HKZ E;  3MR5 A;  1F2M A;  4AQY L;  2EZV A;  1PDQ A;  4R4O A;  3VNN A;  1U4L A;  1I3Q B;  4DR6 H;  1F9R A;  4O7N A;  4B3M Q;  2R7Z B;  1PH2 A;  2UUC H;  2R93 B;  2LFN A;  4IO9 A;  2RQX A;  1KDC A;  3MTS A;  4ED1 A;  1EQT A;  1Y8N B;  2MNA A;  4JI7 L;  1K8G A;  1Y8P B;  4IRD A;  1LT6 D;  3R8B A;  2IHE A;  4CMF A;  1E1O A;  5ELO A;  3IN5 A;  1X3P A;  4MTE A;  5KKN B;  5ELC A;  4F7X A;  1VDZ A;  5I5T A;  5DGB A;  2WB1 B;  4NXM H;  4HMI A;  3NUC A;  3M7N A;  1F9S A;  2FXQ A;  5IP9 G;  1OWT A;  4QW8 A;  1V1Q A;  1X32 A;  2UU9 Q;  4BY7 B;  1B50 A;  3G71 A;  2EY5 A;  2DPJ A;  2WB1 E;  3PIO A;  1PZJ D;  4AH6 A;  1II3 A;  2WKD A;  3QZ7 A;  4AYB A;  5CV7 A;  2A73 B;  5TSS A;  1VQC A;  1H9J A;  4B3R L;  4YCU A;  1I4G A;  1PFN A;  3TBI B;  2IW3 A;  4I7A A;  4IN3 A;  2KED A;  5FLX L;  1ICW A;  2B2U C;  3CC4 A;  4XYL B;  5K2M A;  5I5X A;  3TY5 A;  3S9W A;  4DR5 L;  3GV6 A;  1U0L A;  4X3T A;  1AN8 A;  1QUQ B;  1RTO A;  4O3Q A;  1DXM A;  3PR4 A;  2ASJ A;  1KRT A;  1V1O A;  4Y7N H;  4JXU A;  3CCE A;  5J2U F;  1CSQ A;  1MD2 D;  4IJL A;  4DV2 L;  4Q8F A;  5KFN A;  4DR2 H;  2WYO A;  1L0X B;  1ROD A;  3A54 A;  4K0K H;  1AZQ A;  2CQO A;  4R8U A;  1YI2 A;  1K1Q A;  4MV7 A;  5CV9 A;  1UEA B;  5DLQ E;  4BBS G;  1VAJ A;  3J7A F;  1H9M A;  1Q8I A;  4JI2 Q;  2WDT A;  1K1S A;  1XJV A;  3K57 A;  5DAA A;  1T3N A;  4LF7 Q;  5C1P A;  5JVD F;  2BQU A;  1OXT A;  4ID6 A;  3KFU A;  2DJG C;  2K50 A;  5DGH A;  1TWH H;  3PUW A;  2BOS A;  1RTN A;  5BN3 A;  2XIG A;  1JOR A;  4APM A;  1JE4 A;  2RHS B;  3R3O A;  3LP8 A;  2VY3 A;  3R93 A;  4XZ3 B;  3NGD A;  1F2Z A;  1I6H H;  3MR3 A;  4PQX A;  1SYG A;  3SK5 A;  2RSN A;  2K4K A;  1WCM G;  1S72 A;  1KJI A;  4GLW A;  4Q4C A;  3FKI G;  5ELB A;  1ASZ A;  2B63 G;  4C3I H;  1AH9 A;  3BA8 A;  1NSN S;  4FU0 A;  2W57 A;  3K5N A;  2K03 A;  4C56 C;  3SK4 A;  4IWY A;  3H15 A;  1KC8 C;  1F2L A;  4DR6 L;  5J2T F;  2IY5 B;  2RF4 A;  1CKN A;  4BWG B;  4G4K A;  4DR7 Q;  5DM7 3;  2UUC L;  1PRT B;  2MUY A;  2I5M X;  4B08 A;  1LTG D;  4A3E G;  5KFX A;  2DY7 A;  3GTP H;  2Z6K C;  1X3E A;  2Z6B A;  1LLR D;  5I6Y A;  2ZGI A;  4IFD I;  3FDS A;  5I5Y A;  2FHT A;  3OTO H;  3S1Q B;  1C30 A;  4NXM L;  2GQR A;  4JVZ A;  1Y8O B;  1EQR A;  3DXJ C;  4HNT A;  3I55 A;  1IBL Q;  3AFP A;  1IYD A;  5LL6 b;  1YNN C;  2K04 A;  4QUC A;  4XYQ A;  1EZ1 A;  4O7Z A;  1IYU A;  3DTF A;  2QW7 A;  1OXX K;  2R7D A;  4B3R Q;  1DCZ A;  1CSP A;  5BWW A;  1WCM A;  2DJF C;  3Q8S B;  3M9O B;  4YWL A;  1I7N A;  4CHI A;  3FKI A;  1IBK H;  2JA6 H;  2B63 A;  3RB3 A;  4DR5 Q;  1ASY A;  5KFU A;  3RBE A;  1WTW A;  3SE7 A;  1B04 A;  4BY1 G;  4N9T A;  1VQN A;  1B6R A;  3GTG H;  2GVA A;  1BCP C;  1STN A;  3U50 C;  1XX8 A;  2EY6 A;  2K7V A;  1VBG A;  3NK9 A;  4DV2 Q;  3S16 B;  1Z2O X;  2WAQ B;  4QWB A;  1K83 A;  2NN6 H;  2Z1C A;  3HOZ H;  4K0K L;  3EPG A;  3TY8 A;  1VQO A;  1K8A C;  5DG8 A;  4GOP A;  4V19 0;  2IX1 A;  4C5A A;  1X56 A;  4GNX A;  1V1P A;  3KF8 A;  4OON A;  3T1H Q;  1NR4 A;  4FGR A;  2WII B;  4EEY A;  5BYA A;  3G8D A;  2F0H A;  5DGA A;  3J81 i;  3GTK B;  5A2Q E;  4IJH A;  1G2T A;  4IR1 A;  1V9P A;  3JZ6 A;  1N9W A;  3BVZ A;  4FF2 A;  2F0M A;  2ZT9 C;  4H13 C;  1SRU A;  1R4Q B;  4UP9 A;  1BVS A;  1X6O A;  4QIW E;  1LV9 A;  5C4H A;  3HOU H;  4RAY A;  3BVG A;  3URY A;  5IYZ F;  4YR3 A;  3T5K A;  1K3B C;  5JAV A;  3M4O B;  3GIJ A;  4HN2 A;  3PUY A;  3SR1 A;  3TS2 A;  3M3Y B;  5LOV F;  3KJO A;  1CTM A;  4TM5 A;  3MXG A;  1XPU A;  2NN6 I;  4DR6 Q;  1RYR A;  4U67 3;  2PPB C;  3FP9 A;  2A6E C;  2ICI A;  2R92 H;  1STH A;  2YTV A;  5GAG C;  3J7A 5;  3BYT B;  3S14 H;  1SMY D;  5C4J B;  2YTY A;  3M4Q A;  4FF1 A;  1BO0 A;  3UDI A;  2L5T A;  4FYD A;  5CR5 A;  5KG3 A;  4XYO A;  2QF7 A;  2WAC A;  2ZXO A;  3OTO L;  4NZM A;  3FVQ A;  1N33 Q;  1SJH D;  5DIS C;  4PZ8 A;  4A2B A;  2L0C A;  1U4M A;  3EN2 A;  4RKL A;  4C3I G;  1K8O A;  1HH2 P;  5BWU A;  4GN3 B;  2XCL A;  1UNN C;  2BH2 A;  3NWS A;  2W7O A;  3HB9 A;  2G9D A;  3R9R A;  5EWE A;  3VR2 A;  4BA1 I;  4LF8 Q;  4HNU A;  5KFT A;  3TME A;  1OO9 B;  1PFM A;  4N9P A;  5C44 B;  2MGS A;  4NYE A;  1SSO A;  5EBC A;  5D14 A;  3PO2 H;  2X5R A;  4ZQI A;  2F0W A;  4ILW A;  1SLJ A;  1VQP A;  1IBK L;  2A1H A;  2A19 A;  2F4I A;  3RB6 A;  5I4D A;  4ECX A;  4A3M H;  2UXB L;  3FMC A;  1JCK B;  3NBZ B;  4X62 H;  2L9H A;  4J1M A;  2BDO A;  1SYF A;  5M9O A;  2YCH A;  2VB3 X;  4K2K A;  3OPO A;  5IGC A;  5DQG A;  4DR2 Q;  2V5A A;  1K73 C;  3U4Z A;  2VXW A;  4K0K Q;  3A7L A;  1K28 A;  1I1M A;  3HOV H;  1RJR A;  3VA7 A;  4A76 A;  1WTQ A;  2COG A;  4JV5 L;  5C8Y F;  1ZET A;  1EL0 A;  2EXD A;  4CGY B;  2D62 A;  4F8M A;  4G7Z C;  4QW9 A;  2H1E A;  4F50 A;  4ECR A;  3DF7 A;  2UXD H;  4WRD A;  3KHH A;  4J9Q A;  1EFI D;  3K0X A;  1AFP A;  2A8V A;  4UP7 A;  3V6H A;  2J6U A;  4O83 A;  3NQI A;  1XMO H;  3NEM A;  5FO7 B;  4DV1 Q;  3FEW X;  2I46 A;  3GTP A;  2EJG C;  4PMB A;  4DNT B;  1CQF A;  4O1N A;  3HOZ G;  5M3M B;  5BWV A;  3RJ0 A;  5JUM A;  2L12 A;  3X3N A;  3TQY A;  3PGZ A;  4RMF A;  3JAM W;  2FPP B;  3N6X A;  3I12 A;  1C4Q A;  3I4L A;  4XIG S;  4J0M A;  4A2A A;  2HVQ A;  3K5I A;  2HVS A;  1S5B D;  2QA4 A;  3MFI A;  2IMW P;  5D1P A;  4ECS A;  1JQY D;  2CNV A;  2O03 A;  4RNO A;  3PF4 A;  4R8I A;  3I4M B;  4A3G H;  3MWD A;  2XRQ D;  4GN4 B;  5C0X J;  4RB0 A;  2RCN A;  4MA0 A;  5KFD A;  2OEO A;  1IOW A;  4KY5 A;  3R23 A;  3HOU G;  3CHB D;  3OTO Q;  5JEA J;  4UPA A;  4DLK A;  3V96 A;  4XXE A;  1RD9 D;  5D3I B;  4DV3 Q;  3VPB A;  4DR1 Q;  2UXC Q;  1QE6 A;  3GIQ A;  2E2H B;  3OW2 A;  4GNX C;  5HV6 A;  3BZK A;  4U68 A;  5C5L A;  1FKA H;  3OHA A;  2HD3 A;  5GAE C;  1DZ1 A;  4K8I A;  2UVW A;  1M8A A;  1PHJ A;  1H9R A;  4KKS A;  5E4W C;  2R92 G;  1B70 B;  3DWQ A;  4JI0 H;  5JJK A;  2VNU D;  1S9F A;  3R5F A;  1IBK Q;  1VQF A;  1B2T A;  2B2W C;  3RR5 A;  2VQD A;  4IUT A;  4EVO A;  1MHW C;  4X62 L;  4A3I B;  5M5X B;  4Q4D A;  2B39 A;  3EBE A;  4A93 H;  3ORQ A;  5D1O B;  3J80 W;  2CFM A;  4KLK A;  3NE5 B;  1RJT A;  3KBG A;  5DEH A;  4UUG A;  4RZR A;  4TSS A;  3CCM A;  2F1M A;  4PZ7 A;  1RL2 A;  4DL2 A;  2KCC A;  2M00 A;  4QJF A;  4UAI A;  1W6K A;  3PO2 G;  2NVX H;  4JG2 A;  5COY A;  3GIM A;  1S0N A;  4HQ6 A;  2VA3 A;  3BA9 A;  1YNX A;  3NBY B;  1HFN A;  2OLS A;  1HZA A;  1XTC D;  3RNU A;  1Q90 A;  1HNZ H;  2UXD L;  1LT5 D;  5FJ8 G;  2FMC A;  1VQM A;  4DV6 Q;  1STY A;  3TEK A;  2PQA B;  2R92 A;  1QZH A;  4DV4 Q;  3NBI A;  4Y8V B;  3KYH C;  2RGV A;  5EOY A;  2IPK D;  4XYM B;  1ZHS A;  2KVM A;  1GKH A;  5JJI A;  1PH3 A;  3PW4 A;  1JB3 A;  2KCM A;  1YHA A;  2OCE A;  3V4Z A;  5FK9 C;  3F2C A;  2WV6 D;  3JAM L;  3VR3 A;  2N55 A;  1C8C A;  5M5Y H;  1PVO A;  2E2I A;  1HZC A;  1XNR H;  5HGQ A;  3VA5 A;  3QG1 A;  4YCV A;  4A3B B;  1K9M C;  1Z2P X;  1JWS D;  5LA6 F;  5IGE A;  3AX6 A;  1W2B A;  2ALY B;  3OOC A;  1LTA D;  3A5Z B;  4OO1 H;  4C3H H;  1I4R A;  2R8K A;  4QB4 A;  2F0O A;  3ER0 A;  2YRX A;  1LAB A;  3H20 A;  1SMY C;  2VA2 A;  1A62 A;  5KFC A;  3V4S A;  1AZP A;  3L4K A;  2FLL A;  4CBV A;  1R9T H;  2UUA Q;  5KFG A;  4NZN A;  4MTD A;  2KQ3 A;  2W9C B;  1VMP A;  3ZYY X;  1G51 A;  4P73 A;  4DK3 C;  5C4X H;  3CQZ A;  1GHK A;  4JPB W;  4KI0 A;  4WJ3 M;  4POF A;  1CKM A;  4R9W A;  4ECV A;  4JI0 L;  3JZF A;  4J9S A;  1MZB A;  2F0N A;  1A3T A;  1I1L A;  1I50 A;  3VPD A;  3TP8 A;  3T5H A;  3KAJ A;  4A3C H;  1SNO A;  2HHF A;  4MV4 A;  2GA4 B;  1B3A A;  4OWX B;  4BBR G;  4JBJ A;  2JA7 B;  4NZO A;  1PTO B;  3CCR A;  3G48 A;  4XTC S;  2JA8 H;  1Y1W B;  1LTR D;  2OWO A;  3GTQ H;  3T5J A;  3S2D H;  2CWP A;  1STB A;  5IE8 A;  1I7L A;  2XWJ B;  4LUZ A;  4QWC A;  3H0G B;  5BN4 A;  1S97 A;  4L5T A;  4RUC A;  1JOQ A;  3GQB A;  3PSI A;  2MCT A;  1VQ5 A;  2C28 A;  4MAM A;  4DA2 A;  1EKP A;  3LML A;  1EIF A;  2YTX A;  4TKO B;  1TWG H;  4LF6 Q;  3QFF A;  2QDB A;  3CCJ A;  4Q5V A;  2EYJ A;  3HBL A;  1AE2 A;  5T1I A;  5C3E G;  2KBN A;  1S5D D;  4HJA A;  1XMO Q;  1F9Q A;  3VYS A;  1G91 A;  4MA5 A;  2R6G A;  3T1Y Q;  1T94 A;  4ZK9 B;  1XTD A;  1C3O A;  1TS3 A;  4K5V A;  2EQS A;  2XSC A;  1DOL A;  1IOV A;  3HS0 C;  2JK8 A;  3S15 B;  5EQ0 A;  3CCU A;  4YHH H;  1JJ2 A;  3UFX B;  3NHH A;  1E22 A;  1NR2 A;  4KN4 C;  4A3J H;  1KQS A;  4LF9 H;  4H7B A;  1LTL A;  2NU7 B;  2HVR A;  4L5Q A;  4RCO A;  2UU9 H;  2JEA I;  2OQK A;  2BE5 D;  5EZY F;  5M3F B;  3KLR A;  1XNR L;  1YJ9 A;  5KGU A;  3R5H A;  1VQL A;  2KCN A;  5CV6 A;  4X66 H;  2VW9 A;  4RNN A;  1XNQ Q;  4YAK B;  5LYJ F;  2ALZ A;  2FB9 A;  4MZ9 A;  1Z7T A;  2CW8 A;  4DL7 A;  1KXL A;  4QWA A;  1E1T A;  2LS0 1;  1MJE A;  4JI3 H;  5EDW A;  1PTO F;  2NVQ B;  4LH6 A;  2P5Z X;  5BYB A;  5JVL A;  2JEG A;  3AFQ A;  4JI1 H;  1I1K A;  5J1Z A;  1NAP A;  3DEO A;  3GV3 A;  5E25 A;  2NU8 B;  2E2J B;  3MWY W;  5LL6 S;  3KAK A;  2LKV A;  3PO3 G;  2CQY A;  4ED2 A;  1EZ6 A;  5JPM C;  4JI0 Q;  3GTL A;  4JK1 C;  3TRZ A;  1X55 A;  1RKN A;  1X65 A;  2LY7 A;  2PI2 E;  1G8Z D;  1TR5 A;  1IYV A;  2JSO A;  2VQF L;  4OO1 G;  4JI2 H;  4C3H G;  1TWC B;  5JJZ A;  1J9O A;  4LF7 H;  4F4X A;  3RIZ A;  2YU9 B;  1IZ6 A;  2MJ8 A;  3OYY A;  1IBM H;  5I5V A;  2EOT A;  3G4S A;  1AUV A;  1KEE A;  5DG9 A;  4X3U A;  1OBD A;  4LF4 H;  3RB4 A;  2R82 A;  2PW7 A;  3QJY A;  2CWA A;  1MIU A;  5KT4 A;  2TMP A;  4LMQ D;  3VR5 A;  4A3K H;  3BS1 A;  4DF7 A;  1GM5 A;  1JWM D;  2Z04 A;  4RG1 A;  3OMG A;  4OL7 A;  1TS5 A;  3BG3 A;  5IP9 H;  3R2T A;  5IYC G;  4EBC A;  2HDL A;  4L1K A;  1HNZ Q;  3PIP 3;  1HQR D;  4C2M B;  2Z02 A;  1IL2 A;  2FPG B;  2Y4R A;  1D6E C;  4FS1 A;  4EGV A;  2YV5 A;  1BCP B;  4L6T B;  2OTJ A;  3JSN A;  2VS1 A;  2JA8 G;  3MXP A;  5FOB B;  1EU3 A;  2EIF A;  3IRB A;  2AUJ D;  4O84 A;  1A63 A;  1EY8 A;  4PMW A;  4CJ1 B;  4ZHQ F;  3WDN A;  3H6M A;  2R86 A;  3UDF A;  1RJP A;  4TRD A;  1O7I A;  1PXU A;  4YHH L;  4IUN A;  1PYW D;  1FVI A;  3GDE A;  3ITP A;  4FVM A;  5EKK A;  4JI5 Q;  4IFD J;  2UU9 L;  3EIV A;  4DXF A;  1CA5 A;  5HBR B;  1NCV A;  1WI5 A;  1TY2 A;  1C48 A;  3CAM A;  2N3S A;  2B2V A;  3FPU B;  4DV5 Q;  1EYZ A;  3P75 A;  3PUZ A;  1KAB A;  3GJX B;  4X66 L;  4L8J A;  2WP8 J;  4EG0 A;  1WTP A;  3U9S A;  3RGZ A;  3NQT A;  4XX0 B;  4IUQ A;  3BDC A;  3RTX A;  3Q23 A;  3QWU A;  4FXK C;  4AIM A;  3CPF A;  1U9R A;  4AYB B;  4A3J G;  2ZM6 H;  1BBU A;  3Q8P B;  3GTQ A;  2EPB A;  4AYB E;  1EWI A;  1L0W A;  2QIL A;  3UYY A;  1WCM H;  3H09 A;  1GD7 A;  4YWM A;  2AUK A;  2RDJ A;  1BR9 A;  1MSH A;  2AQ1 B;  2B63 H;  4TV8 F;  3J7A K;  1FGB D;  3E0J A;  4Z9C B;  4WD3 A;  2JEF A;  4JI2 L;  4C5C A;  1FYC A;  1JIH A;  2E76 C;  3QO2 A;  2N49 A;  3NSW A;  2XRS D;  4A3D G;  1TWG A;  4LF7 L;  3TW7 A;  5CYU A;  2KUM A;  5CBE E;  1JJG A;  2JP1 A;  1EY4 A;  3K59 A;  1H9K A;  1WTO A;  1VKZ A;  2JEJ A;  3S17 B;  1U5K A;  3HOY G;  4GN5 A;  1SNM A;  2KOL A;  3HKZ B;  1FR3 A;  4A3E H;  1K83 H;  3EVQ A;  1EUJ A;  3JC6 6;  1ZKO A;  1WJJ A;  2XCA A;  3OWE B;  1I4P A;  1KJ9 A;  4UP8 A;  5DMX A;  3FMA A;  4PBC A;  4EYH B;  4N8X 1;  3BZD B;  4UY8 C;  3MXU A;  2A6E D;  1BBX C;  4BA2 I;  4DL3 A;  1Z47 A;  1LAC A;  5I5S A;  3FRP B;  2EDG A;  4JW0 A;  5IOD A;  2F03 A;  5KYI A;  4R7R A;  4GLV B;  5I5U A;  4DR3 Q;  2V1C C;  1TT2 A;  1KTK A;  3P20 A;  1HTL D;  4I7H A;  2V4R A;  2B2T A;  3MFG A;  2Q2T A;  4DR7 L;  5KS8 A;  2GQS A;  4ME6 A;  1ZYR D;  1PH6 A;  1TS4 A;  5IP7 H;  3E9H A;  1GLV A;  1SE3 A;  4QCL A;  3KOJ A;  5EBD A;  2ICE C;  4F4W A;  4P2C B;  4BY1 H;  2COJ A;  4YHH Q;  1NJI C;  4Q43 A;  3CRL C;  4A3K G;  3GTO A;  1N33 H;  1AW7 A;  1CKN B;  4KJN A;  2R8H A;  3MXN A;  1EZ8 A;  4A3F B;  4NW2 A;  4DGZ A;  4LF9 Q;  2YYA A;  1IBL L;  1EY7 A;  4O4L F;  5G3L F;  1X3G A;  3DWA A;  5CV8 A;  4LF8 H;  1DV2 A;  1CZW A;  3S1M B;  2V9W A;  4HIO A;  4CC5 A;  4R4T A;  1UNS A;  3BDO A;  4MTK A;  3Q8Q B;  1S10 A;  3DHQ A;  2BE5 C;  4X66 Q;  1J6Q A;  2FK2 A;  2R6F A;  1TWF B;  3RZO B;  5FLX E;  5H1S E;  1SXT A;  3RAX A;  1QJO A;  2AKW B;  3T99 A;  3BJY A;  1UE6 A;  4OIK A;  2EE1 A;  3BZC A;  4JI3 Q;  3UE1 A;  3GID A;  1GSH A;  2EYH A;  5EWF A;  1Y1V G;  4H0L C;  1VQH A;  4JI1 Q;  3A5U A;  1SBB B;  3GP7 A;  2ZM6 L;  3S1Q H;  2WTF A;  3KF6 A;  4QSH A;  2VUM B;  1PFB A;  1L1O B;  1E2V A;  3RZD B;  4WFN 3;  1BDO A;  3AMU A;  3D4D A;  3S1R B;  3HKS A;  5KND A;  5IT9 W;  2EY2 A;  2I87 A;  3D31 A;  3OSO A;  3AB9 A;  1U4R A;  1DIK A;  3K81 C;  1A2T A;  3T1H L;  1VF7 A;  2YS7 A;  4ZCK A;  3PW2 A;  1GXD C;  5ELF A;  5KG0 A;  1YHQ A;  2GPS A;  3TW6 A;  1I94 Q;  1CE8 A;  4J9P A;  3ERO A;  3NWT A;  1CQJ B;  1XXG A;  1IBM Q;  1CM9 A;  3AYH B;  4L63 B;  3SDZ A;  5DGI A;  2CCZ A;  5BPF A;  1N32 H;  1B9M A;  3OHX C;  5KIX A;  4LF4 Q;  1DM0 B;  4DAY B;  4PWQ A;  4DV1 H;  3VR4 A;  1PH1 A;  3AQQ A;  5EKI A;  3S16 H;  4GC6 A;  2W9A A;  4H44 C;  4BY7 G;  3H40 A;  4P75 A;  3CP0 A;  3SEB A;  2B2V C;  4ME5 A;  1DD2 A;  4UCR A;  4LFC Q;  4KD3 A;  3BG5 A;  3MWM A;  3RUZ A;  3T7A A;  4PDB A;  1Y1V A;  4RB1 A;  3RFC A;  5I5W A;  2V4Q A;  3BJU A;  3WWI A;  4J8Q A;  3OHB A;  3I3C A;  3CD6 A;  2NZH A;  3VYT A;  2F3I A;  1D2B A;  3GTK H;  4EGQ A;  3H94 A;  4CHT B;  2CZG A;  4WBN F;  5BMV F;  4ECY A;  2K5D A;  4F87 A;  3VDY A;  3ND9 A;  4OWW B;  1O7Y A;  2K5W A;  1VBH A;  1QOH A;  4DV3 H;  1SE8 A;  3OMC A;  1N33 L;  1M7J A;  4DR1 H;  2UXC H;  3J81 W;  3WO1 A;  2B8F A;  3IG0 A;  4ALP A;  2ZJQ A;  1HNX H;  3MVV A;  1A0G A;  5JQW A;  2VOB A;  2PYK A;  4LF8 L;  3EJI A;  1PK8 A;  1ULZ A;  2F3V A;  4Y7N B;  5IP7 G;  1PH8 A;  4MV3 A;  5FLX c;  4IUR A;  3CSW A;  2KHJ A;  2HQE A;  5DM6 3;  1JKJ B;  5DLG A;  2ZM6 Q;  3ONA B;  2HCC A;  3QWN A;  1ZAU A;  2QYZ A;  5C5J A;  2ATW A;  1QUQ A;  2EJM A;  1E2Z A;  1AE3 A;  4DR2 L;  4HNV A;  3U58 A;  4ED3 A;  1GSA A;  3GV8 B;  4MV8 A;  2R7K A;  1ZQ7 A;  5C6A A;  1JWU D;  4P74 A;  3T13 A;  1MSG A;  4JBW A;  3J7Z C;  2W7P A;  2B2T C;  3UE0 A;  4TV9 F;  5IT9 E;  2SOB A;  5IT9 L;  3BAB A;  1PYS B;  1TWH B;  3MR2 A;  3M4Y A;  5KFM A;  1OTC A;  2W6Q A;  3PQI A;  4FFM A;  3T9B A;  5FD6 A;  1WFQ A;  4J9O A;  1UE5 A;  2FE3 A;  2KEE A;  4QIW B;  3NBH B;  4O4H F;  4P72 A;  1I6H B;  4DV6 H;  1PRT F;  1OBG A;  5CGK A;  1JXL A;  4DV4 H;  1N32 L;  2HJW A;  4ECQ A;  1CHP D;  5KFW A;  1FNV A;  4DV1 L;  2NVY B;  1JJC B;  3T53 B;  3A56 A;  4DAA A;  3MR6 A;  3I7F A;  2ODT X;  5BWX A;  4K5W A;  4M9U A;  4FNF A;  4GS3 A;  3HRZ C;  1XWE A;  5KNB A;  3P7J A;  5LXT F;  1F2Y A;  1WOC A;  2V58 A;  5KEE A;  2CNU A;  3HO8 A;  1QVC A;  2EVB A;  4FM9 A;  3CRK C;  4CKB A;  3IKJ A;  5ELE A;  1S0O A;  4DL4 A;  3G6J B;  5ISR A;  4X6A H;  3U4V A;  1N34 Q;  1KJ8 A;  5L1K A;  2WAQ G;  1KHI A;  2M05 A;  1ZYR C;  3I8Z A;  3WO0 A;  1QNK A;  4LMY A;  2NBF A;  4DV3 L;  3T9F A;  4DR1 L;  5A35 A;  2UXC L;  2Q8R E;  4EQN A;  1TU2 B;  5M3M H;  2UUA H;  4V0B A;  1EY0 A;  2E2I H;  2YW2 A;  4DIM A;  4JYA H;  3J81 E;  2IL8 A;  3J81 L;  1HNX L;  3N6R A;  2V4D A;  2JA6 B;  4N8F A;  4K8J A;  2PZW A;  5BN5 A;  2FP4 B;  4RFB A;  4DUZ H;  1Q1E A;  3Q6S A;  4OEM B;  3GTG B;  1SAP A;  3IAY A;  1IKL A;  2J7Z A;  4TQU S;  2K75 A;  2AU0 A;  2W8L A;  2JEB I;  3ETH A;  3HP3 A;  2AHO B;  5FJ8 H;  4MHE A;  3NUA A;  4IUV A;  1E3P A;  3LWU A;  1I2L A;  2MO1 A;  1A2U A;  1GOZ A;  4DRF A;  1EYG A;  2Z8L A;  1QB5 D;  1U4P A;  4IUU A;  1L0Y B;  1EOT A;  3CQZ H;  1PYB A;  1BJT A;  2G9H D;  1VQB A;  4HSP A;  1XMQ H;  3C1F A;  1PX2 A;  4GLX A;  1GUS A;  1HXY D;  1EUD B;  2DNE A;  3BYY B;  2WAQ A;  4RHS A;  3EQL C;  3L0O A;  1Q86 C;  3GB8 B;  5IT9 c;  2R87 A;  3T9E A;  1IXR A;  5JVG 3;  4JOI A;  1PA6 A;  3GTM B;  1I50 H;  5CC4 A;  1YIJ A;  1HPC A;  5LHY 1;  1YJW A;  4LF6 H;  1B44 D;  4KV6 A;  3N41 B;  4TQR A;  4O7T A;  2PO4 A;  3K3P A;  3HOU B;  3I91 A;  1GSO A;  2EIY A;  1N32 Q;  2K5Q A;  4DV6 L;  3RGX A;  2LMC B;  2XVS A;  4DV4 L;  2PMZ A;  3GTK A;  3CEB A;  3BU2 A;  3T1Y H;  4CKC A;  4DNR B;  4NP5 A;  4A3I H;  5IGG A;  1XDN A;  3F2B A;  4EBE A;  3IFD A;  5IWA H;  4FXG C;  1H9S B;  1EQQ A;  3D0F A;  3H4B A;  3CME A;  3RB0 A;  2COI A;  4DK0 A;  5EWG A;  4Q8E A;  1KRS A;  4IAL A;  4I7Z C;  4L5R C;  1ILP A;  1LT3 D;  2F0F A;  4OWT B;  3PF5 A;  1TS2 A;  4J9N A;  2VB2 X;  2CH4 A;  3D3R A;  1B9N A;  3OSN A;  2NVT H;  5HGT A;  2X69 A;  1XNQ H;  4DU9 A;  2FKL A;  4I50 F;  4GKJ H;  3HOW B;  2HCI A;  4XQQ A;  3PIO 3;  2X6G A;  4BBR H;  3RD4 A;  4GOP C;  2YWV A;  3LQS A;  2A6H D;  2UUA L;  4JYA L;  1HNX Q;  4CJ2 C;  2K28 A;  2ZTC A;  4RH6 A;  4ECU A;  2FJ2 A;  4HJ5 A;  3JRW A;  5EAY A;  2AGQ A;  4A3M B;  5CA1 F;  4O4J F;  4IPC A;  2YZL A;  4DUZ L;  4YBZ B;  1S3O A;  4C3J B;  1E4E B;  1LT4 D;  3Q8R B;  2VQE Q;  1QWY A;  2TSS A;  1S40 A;  3UQ8 A;  1DYQ A;  5K36 G;  3E0E A;  2B8G A;  3S2H H;  1W3S A;  2J6T A;  3HOV B;  1IKM A;  4HR7 B;  3NP8 A;  5M3M G;  5C3E H;  2KA7 A;  2GLT A;  2QCP X;  3LNN A;  1W6J A;  4DAP A;  3BQ1 A;  1XMQ L;  3GTL H;  1CT1 D;  2R7N A;  1LO5 D;  1B1Z A;  2C35 B;  5FLM H;  1DGS A;  3I2Z A;  3RLN A;  4O82 A;  1HR0 W;  2X6L A;  2AWO A;  3QQM A;  3QZ8 A;  3L4J A;  2Q8T A;  1MBY A;  1FJG Q;  1HR0 H;  2Q2U A;  3BVM A;  3RN5 A;  3BQ2 A;  2H4O A;  2C00 A;  4EFB A;  3TP5 A;  4LF6 L;  3OIP A;  3I90 A;  4UDU C;  1QG7 A;  4QL5 A;  4DFA A;  4EGJ A;  2OF1 A;  4ME3 A;  3L2P A;  2CKZ B;  3VR6 A;  3SK8 A;  2K14 A;  3WNZ A;  2RKS A;  1XMO L;  3A8J E;  1ZHQ A;  3V6K A;  3DEP A;  1CQI B;  3T1Y L;  2PNR C;  2MHV A;  1O78 A;  4HCE A;  1D8L A;  3H4D A;  4R1J A;  3C3L A;  1B53 A;  1RK6 A;  3GD7 A;  2IWH A;  3KTM A;  1TY0 A;  5IWA L;  1EY5 A;  4HCS A;  1E2W A;  1Q81 C;  1MGS A;  3VMM A;  4FXD A;  4B3T Q;  4A3G B;  1HUM A;  3JAM E;  4JI5 H;  2VL6 A;  1AUX A;  1YJN A;  2EJ0 A;  1NUC A;  4HN7 A;  4K6L A;  5KFB A;  1HUN A;  4IIJ F;  3BAA A;  2A1A A;  3PO3 H;  5KFF A;  5CMD A;  4FO2 A;  2XWB B;  3K8A A;  5KNC A;  4I4T F;  4DV5 H;  2AMC B;  4PNY A;  1DOK A;  1BNZ A;  1RDP D;  2NZ1 D;  2HG8 A;  4RAZ A;  2VR1 A;  1CS0 A;  3F2D A;  3N43 B;  4A3I G;  4EQP A;  1XNQ L;  1RHP A;  4IOA A;  3M85 A;  4GKJ L;  1UWV A;  1MKH A;  4NPS A;  4QGU A;  5LMN Q;  5FNV F;  4JYA Q;  4JOI C;  5IOC A;  3S15 H;  4JUZ A;  5KFH A;  1MI2 A;  1PH5 A;  1EOV A;  3HG9 A;  1YZ6 A;  3K80 C;  1HNW Q;  1N36 H;  3T9D A;  4NXN Q;  2E2H A;  5BR8 Q;  4NLG A;  1J8I A;  4X65 Q;  1TWA H;  4DUZ Q;  4YY3 Q;  1GUG A;  3T9A A;  2QK4 A;  5EPL A;  5M3F H;  3C46 A;  1UE7 A;  4Q44 A;  3STB C;  4A93 B;  2ZDQ A;  5IYC H;  1SFO H;  2R8G A;  5GQO A;  1VQJ A;  4PV1 C;  2MQH A;  2JN4 A;  1A9X A;  1LTB D;  2DUD A;  1M6V A;  3S24 A;  2Q8I B;  2R8J A;  3T56 B;  4OO1 I;  2NVX B;  4RZQ A;  1XMQ Q;  1DAA A;  3J80 E;  2EJ2 A;  3J80 L;  4FS2 A;  3LX0 A;  1PZI D;  3PCO B;  5D1O A;  3RMH A;  2Y0S G;  2O5J C;  2E2J H;  4WJ4 A;  4LSX A;  1HR0 L;  5LP6 F;  2PQE A;  2W9B A;  5IGD A;  4RGN A;  4O7W A;  2N8N A;  2NWG A;  4DR3 H;  1HNZ L;  5T14 A;  4TVI A;  1IW7 D;  1V8Q A;  2KEN A;  1M90 C;  4C1N K;  1HCZ A;  1GYF A;  4YR2 A;  2RDF A;  3K5M A;  1WYD A;  5JPN C;  5IY0 A;  4ED7 A;  1XK5 A;  2YU9 H;  1KD1 C;  3GTJ H;  4RGM A;  2NB0 A;  4ZYS A;  5HY6 A;  1BXR A;  5I2X A;  2BA0 A;  4X64 Q;  3Q2O A;  4FF4 A;  2O5I C;  2SNM A;  5FLM G;  5M5Y B;  5IWA Q;  4ECW A;  2YZM A;  3PW0 A;  1Q8K A;  1EYA A;  3U9O A;  1CK1 A;  4ZOL F;  2VPQ A;  1FNW A;  1NY4 A;  3I4N B;  3VPC A;  1A3U A;  2ENB A;  3JAM c;  3H3V H;  1V4Y A;  1A0I A;  4JI5 L;  3UI2 A;  4O7Y A;  4FFN A;  4K2L A;  4C3H B;  1WD1 A;  1FD7 D;  3KUP A;  4ODG A;  2FLN A;  3KDF A;  1KJQ A;  4DV5 L;  1PTO D;  2JYO A;  1JOO A;  2Q2I A;  2WFW A;  4RB3 C;  2Y0S A;  1NE3 A;  1HZ9 A;  3UDX A;  2JA7 G;  1R9T B;  1VQ9 A;  4LNQ A;  2AGP A;  2R85 A;  3GTO H;  4A3D H;  4KHV A;  1Y1W G;  4GKJ Q;  2JA5 H;  1A6X A;  5C4X B;  1FNU A;  2FMA A;  5LMU H;  3WWH A;  1HQM C;  2F4V Q;  4DK1 A;  3H0G G;  3HOY H;  3G6Y A;  2YS6 A;  2SCU B;  4IPH A;  4JI8 Q;  1SYE A;  3TQ1 A;  2ZJT A;  1JDE A;  1VQD A;  4K5X A;  1C0A A;  2C5C A;  2A6H C;  4FF3 A;  5C1O A;  2ABJ A;  2W9C A;  4UCU A;  3KJP A;  4NDX A;  2A69 D;  4J9M A;  4LF5 H;  3ND8 A;  4IR9 A;  2BCO A;  2DAB A;  5KFJ A;  3GTQ B;  3S2D B;  4IZ8 A;  1I94 H;  1Y14 B;  2ASB A;  3RLF A;  2B3G A;  3MWE A;  2EY1 A;  2J4X A;  3LGJ A;  1SN8 A;  1CHQ D;  4M7E A;  2K1B A;  5I60 A;  3J80 c;  1CZG A;  1STE A;  3CCL A;  2JA7 A;  3K6O A;  3J7A V;  2FK1 A;  4O3P A;  1ICF B;  2F0G A;  1Y1W A;  2DLN A;  1JMC A;  3V2T A;  5M3F G;  3K5H A;  2VPS A;  4LFC H;  1HR0 Q;  1EYC A;  3KLS X;  4KHZ A;  2IP4 A;  3PMF A;  1QNU A;  3H0G A;  4XQJ A;  4G7O C;  2Q2H A;  4J9R A;  4G7H C;  1YEZ A;  4DUY H;  2CNQ A;  1A8V A;  2NZO A;  4DR3 L;  5DQH A;  1Z6H A;  1TKW B;  3F2U A;  4IZO A;  3SE0 A;  4CC6 A;  4O7V A;  3H91 A;  3C2P A;  1CQV A;  3I56 A;  2XGP A;  4C5B A;  4JI6 H;  4OXP A;  5KT5 A;  3P1H A;  4KY7 A;  3WWJ A;  1QZG A;  4AQY H;  1JB7 A;  4QMG A;  3TP7 A;  4UCT A;  2DIK A;  1Y1V H;  4Q0Y A;  4LF9 L;  2XC9 A;  3KXY T;  1KLG D;  4EX5 A;  3GIP A;  4NKL A;  4CE5 A;  3T54 A;  5K5P A;  4A3L G;  4X3K A;  3ICE A;  1K8M A;  3W1G A;  1QVG A;  2FPI B;  3M9M B;  2F0D A;  1I3Q H;  5C0X G;  4LFB Q;  2B2Y A;  1TWA A;  2JE6 I;  3T16 A;  3HOX B;  1PH4 A;  2R7Z H;  3RAQ A;  2NTT A;  2R93 H;  3WOF A;  5JEA G;  1SFO A;  2CQA A;  2XD4 A;  3K0Y A;  2J6S A;  1JR0 D;  3EA6 A;  5LMU L;  1G2S A;  4ETS A;  4EYI B;  4JI3 L;  3WOE A;  1SYD A;  4JI1 L;  3E6Z X;  4M8A A;  1Q3L A;  1WTH A;  3A8I E;  5KRU A;  1G6P A;  2DNC A;  3A0J A;  1N36 Q;  3TSS A;  5C3X A;  2PZT A;  2YL2 A;  4HSV A;  4RB2 C;  1VMC A;  4R4Q A;  5FKA C;  4BY7 H;  2WE6 A;  1ET6 A;  1UUP A;  3S1N B;  2GPW A;  4OIJ A;  5DLF A;  2ZJR A;  2F52 A;  2F0E A;  2F0T A;  4LF5 L;  3S1M H;  4ULL A;  1J5E Q;  2ZXP A;  4NMZ A;  2JA5 G;  2YRW A;  4R8U B;  4Q45 A;  5M5W B;  1I94 L;  3RZO H;  2F0K A;  4IPD A;  1HRJ A;  1LTT D;  1BCP F;  1IBM L;  1TWC A;  4A3K B;  5KG6 A;  4B9W A;  4LF4 L;  2E5L Q;  3G6X A;  2F0V A;  2YU9 A;  4ZRZ A;  1WVL A;  3GTJ A;  3NEN A;  4CDC C;  5CV5 A;  3LUL A;  2DN8 A;  3MEH A;  3CXC A;  2B29 A;  1SRO A;  4CMD A;  2VUM H;  4BXX G;  2IHF A;  1P8L A;  5DAU A;  4UCV A;  3PFF A;  4KD4 A;  4LFC L;  4ECZ A;  3K7A B;  1EKF A;  3TS0 A;  3ETJ A;  5I2Y A;  1GVP A;  4EEQ A;  4JV1 A;  4K14 A;  4DUY L;  3F8T A;  4FDB A;  1PH7 A;  3HGB A;  2DAA A;  1VQI A;  2IX3 A;  1PMR A;  1GUW A;  4DV7 H;  2UVR A;  5JVH 3;  2HQL A;  2KHS A;  3R2I A;  3F8N A;  2W6O A;  2RA4 A;  4EQO A;  5F2D A;  4C2M A;  2QDL A;  5FPR A;  1IW7 C;  5G3L D;  1EEI D;  1VQA A;  1N34 H;  1AEX A;  3SK6 A;  2JA5 A;  1S5C D;  4HJ7 A;  5KT2 A;  3QOL A;  1B8A A;  4JC0 A;  4BBS B;  2BR0 A;  5T1G A;  5EPK A;  3SVM A;  2KEC A;  5CAE B;  2J0T D;  1ILQ A;  1G2W A;  1G29 1;  1H95 A;  2NYZ D;  2C2D A;  4O81 A;  2XNA C;  4YQW A;  2EYO A;  3PN1 A;  2HHH H;  1PZK D;  4LJZ C;  3CC2 A;  2C2E A;  2DY8 A;  5IYB G;  2ES2 A