2Q2TA

Structure of chlorella virus dna ligase-adenylate bound to a 5' phosphorylated nick
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
293
Chain Sequence
MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase/dna
total genus 75
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2tA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2tA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2tA01
4AIMA 2UUCL 4EX5A 1VQKA 4JI0Q 1SROA 2WB1G 4JI6L 5JJKA 4JI2Q 3HKSA 5IT9c 1YVCA 2MO1A 1N36L 4A3MG 4LF6Q 3STBD 4YCVA 1PH9A 4UCTA 4APVA 1LM0A 2K50A 4LWCA 3ZJYC 1CKOA 1UE6A 1HR0W 4B3ML 3TQYA 1WFQA 4LH7A 3CP0A 4J15A 1WCMG 2HIXA 3W1GA 1RL2A 2YV5A 3OTOL 1PH7A 3CCJA 4B3RL 4DV2Q 4JI4L 2B63G 1XNQQ 3AYHB 4OX9L 4JV5Q 3HOWG 5C44G 3PIOA 2I5MX 3HOYG 1HZBA 1NE3A 3GB8B 3GDEA 3G4SA 5C0XI 3S2HH 2DGYA 4L5QA 3S15H 2UXDQ 2ZTCA 4OWWB 3I4OA 2LXJA 2PQAB 1EIFA 2Y0SE 3S2DH 4DR4L 3S24A 1XPRA 4L5TA 4EFBA 1K9MC 2UU9Q 2N3SA 4MTNA 3HKZE 1EQQA 4A3GG 1SRUA 1YNXA 4AYBE 5GADC 1FVIA 1N9WA 1MKHA 2JEBI 4B3SQ 1HJPA 1VCIA 1FJGQ 2EXDA 4OO1I 5IYCG 3OW2A 3GD7A 5IP9G 1EIYB 2VUMG 1IL2A 1PH5A 1Z9FA 1TWCH 3PUYA 3TY9A 1HZCA 4BXXH 1A8VA 1B7YB 2BA0A 2HHHQ 2ALYB 2Q2IA 4JI3L 3KJOA 3D0FA 5J3BA 4HJ9A 1G291 3ULLA 1E24A 5IP7H 4LF4Q 2EIFA 3PUWA 2VQFL 2Q2HA 3F1ZA 2K5NA 3RLFA 3H15A 4A3EH 3BAAA 4UCSA 4GNXC 1N8RC 1N32Q 2QA4A 1VQCA 3K81C 2CWPA 4OXPA 1MJCA 5HGQA 3CCMA 3U58A 4DV2L 4X65Q 2JA5H 3UQ8A 4LF8L 4DR6L 1YIJA 1KL9A 3UE0A 3BU2A 4NB3A 3JAMi 4DV4Q 1K83H 5ELOA 2OQ0A 1DGSA 2V1CC 4R4CA 2GVAA 1JE5A 3STBC 1VQBA 3U50C 3CCSA 3KF6B 3T1HQ 4TVAB 4YY3Q 1Y1WH 2HT1A 2JEAI 1X54A 3PF4A 4CC5A 1OTCA 1E1OA 4B3SL 1XPUA 3ULJA 5C4XH 1FJGL 3PO3H 4UFZA 2F52A 2R7ZG 5IYBH 3DM3A 3MXNB 1C9OA 4UP9A 3J80c 4IOAA 4LF7Q 3PUXA 4GKKQ 4DV6Q 1VQPA 1SR3A 1O7IA 3LGJA 3HOZH 1YHQA 1EFWA 2UXCQ 1HZAA 1BKBA 1X55A 4PZ8A 2F4VQ 2ASBA 1GVPA 4LFCL 1SMXA 3EN2A 3A5UA 1UWVA 2C35B 2K52A 2WAQG 4QJFA 1N32L 1EYGA 1TAEA 2YTYA 4LF5Q 3UDXA 3I7FA 4LF9Q 1PYBA 1XMQQ 4GNXA 3NEMA 1PH1A 2R92H 2AHOB 3L0OA 3A74A 4DV4L 4A3MH 3NBYB 3M9BA 4B3TQ 2UUCQ 4IPHA 1I6HH 5BR8L 4JBJA 1VQ7A 1Y1VG 5FLXc 3PO2G 3T1HL 4O2DA 1Q8KA 3TREA 3EIVA 1WJJA 4A4IA 3KOJA 3J81i 3JSLA 4HJ8A 1N36Q 4BA1I 4QIWE 4BY1G 3BZCA 2PNHA 3VDYA 1GD7A 2B63H 1JJGA 4IFDJ 1CSPA 3HOWH 4DKAC 1OXSC 1PYSB 5C44H 3TS0A 2ZTEA 1HNXQ 4B3MQ 3HOYH 1X65A 1NBWA 2R6GA 2R93G 4KI0A 3KLWA 3AFQA 4GKKL 1KD1C 1VQHA 4JI4Q 2RF4A 4OX9Q 4FDBA 5C0XG 2JA8G 1EQRA 1Q46A 3GO5A 2N49A 2F4VL 3S1MH 3RLOA 3RR5A 4A3GH 4LFBQ 4ME3A 1XDNA 1UEBA 1TWFH 3HFZB 3PV0A 4DPGA 1MIUA 4YWKA 4DR3Q 5IYCH 1VQ4A 1IYJB 5IP9H 1L0WA 1Q81C 2VUMH 5JEAJ 4LF9L 4EEQA 5GAGC 4OO1G 3M3YH 5C3EG 1B8AA 3F8TA 1W2BA 2JA6G 1J5EQ 4GKJQ 1JT8A 2H5XA 4DR7Q 3I4NH 1S68A 1D8LA 4HJAA 4A3JG 1OXVA 1PV4A 3CC4A 1D7QA 5C4JH 2NVXH 4DR5Q 1SE8A 4GN5A 1TWGH 2YYZA 1PH6A 4JI3Q 1V43A 3PF5A 1XTDA 1BVSA 5LMUQ 1VQMA 4HJ5A 4UCOA 4PZ6A 2VQFQ 2VL6A 4P75A 4ALPA 5D1OA 4MNOA 1CKNB 1VQEA 4GS3A 2D62A 3SGIA 3L2PA 1JJ2A 1HNXL 1G6PA 2HVRA 1K8GA 1X56A 1Y14B 4A3FH 4UCRA 4A3BG 3H3VI 4AH6A 4LF8Q 2WFWA 4C3IH 4DR6Q 3M4PA 2PQAA 1C7YA 5D1OB 4LFBL 4JOIA 5IWAL 4A76A 1E7ZA 2Z0SA 4GOPB 2IX1A 3ICEA 2IY5B 3CCRA 2KCTA 3CCQA 4DR3L 2R7FA 3ER0A 3NBHB 4GN3B 4L5RC 2R7ZH 3I4MG 4DR2Q 1VQIA 5IYDG 4YCUA 4LUOA 4DAMA 4NXMQ 4A3DG 5M3FG 2MNAA 4GKJL 3QWUA 1I3QH 1J5EL 5FLMG 4DR7L 5FPOA 1Z47A 3G71A 3MEFA 4UCVA 3HOVG 1FGUA 4DR5L 4HIDA 3BZKA 4A3CG 3S1QH 1VQAA 4HIKA 2UUAQ 4A3KG 4UPAA 1S72A 2OWOA 4GN4B 4R4TA 4K0KQ 4C2MH 5LMUL 4JI8L 1Q82C 4LFCQ 1VQDA 4WJ4A 2BH2A 3G48A 1NY4A 3F2DA 1KHIA 4QY7A 2I5HA 2LSSA 1A63A 4BBRG 2Q2UA 1YJWA 1PH3A 1OXUA 1Q1EA 2JA9A 3PO2H 3TS2A 3KF6A 3RZOH 1I5FA 1QVGA 4LNQA 4BY1H 2WP8J 4AQYQ 1VQOA 3CXCA 1PH2A 3T1YL 3E0EA 1T9HA 2HIVA 1M1KC 1YJ9A 4UY8C 1XNRL 1X3GA 4DRFA 4YWMA 4R4IA 5BR8Q 4JI7L 2Y0SG 2I0QA 1YHAA 1E22A 3H3VH 4EFEA 5E7NA 4X64L 4DR2L 3A0JA 4LW1A 4POGA 1XPOA 2R93H 3HKZG 2AWOA 5JJIA 5D1PA 4AYBG 3TY8A 3L7ZC 1PHJA 4P71A 4NXML 3EBEA 2NZOA 3CMAA 4DV1L 2ZJPA 2QEXA 2VZAA 2EQSA 2YTXA 3KF8B 3S16H 1WI5A 4QQBX 1YEZA 1UE1A 2I5LX 2DUDA 1Q1BA 1OXXK 5GAHC 2UUBQ 3GTLH 2UUAL 4BA2I 1RIPA 2VW9A 1CKMA 3KYHC 4JG2A 4JC0A 3JAMc 2E5LL 4K0KL 5GROA 5C3EH 3FP9A 2JA6H 4DAYB 2R7DA 4QGUA 4A3IG 4IJLA 2ATWA 2RHQB 4JI1L 1SLJA 1LTLA 4LUZA 2XGTA 3D31A 2GN5A 1VQ9A 5K36G 1X9NA 1PH8A 4X66L 2AKWB 1VQJA 3OYYA 1G51A 3KDFA 3B6YA 3GJXB 2BA1A 4AQYL 1S40A 5M5YH 2VQEL 2ZM6L 4UP7A 1N34L 4DUZQ 1JMCA 1WCMH 1U5KA 2ZJQA 2MO0A 3KDFB 5IY0A 4A3BH 4A3LG 3K80C 1KRTA 4OWXB 2MQHA 4EQ5A 4GOPC 5FPRA 1N33L 1KIXA 4UP8A 2Z6KC 4QL5A 2A1AA 3J7A5 2GVBA 2N8NA 4GLAC 3H0GG 5LMNL 1YJNA 2KENA 1XMOL 4IPGA 1PH4A 2E2IH 3IRBA 1VQ6A 3I4MH 2UUBL 1IZ6A 2K75A 3RNUA 1K73C 1K3RA 4JI5Q 1JJCB 3F2CA 4A3EG 2YTVA 5IYDH 5DISC 3I2ZA 3HOXG 2PI2E 2E2JH 4A3DH 5IWAQ 1AE2A 1AE3A 3RZDH 5FLMH 1KQSA 3HOUG 1JB7A 1BBUA 1L1OB 2E8GA 4PZ7A 3CW2C 3JC66 5AJ3L 3J81c 2RCNA 3CCUA 2WB1E 3HOVH 3M7NA 4BY7G 1P16A 1QVCA 2NVYH 4DK6C 1B70B 1YITA 4A3CH 3E9IA 2PI2A 1E3PA 1CUKA 1ASZA 3DLLA 2VUGA 1J6QA 1KC8C 2K4KA 4IOCA 4JYAL 2IT1A 4X62Q 1K0RA 3ULPA 3PUZA 3S1RH 3KFUA 4IPDA 5JJLA 4DK3C 1ASYA 3CCLA 4KLKA 1TA8A 1I94Q 1CKNA 4DUZL 2FXQA 2JA7G 3NC0B 4BBRH 1GM5A 4JI8Q 4KHPQ 1V1QA 3K8AA 3J7ZC 1TWAH 3CF5A 4LH6A 1W3SA 4RMFA 1NMGA 2JK8A 2RHSB 1V9PA 2OTLA 1C0AA 3CPWA 3NBZB 4GOPA 2VS1A 4WJ3M 3VNNA 3W5OA 1EUJA 4PG3A 2A8VA 4IPCA 5H1SE 1A62A 3I55A 4JI5L 4HIOA 4P74A 3PGZA 4TQUS 1X3EA 4HJ7A 2VNUD 1LUZA 1LYLA 4DV7Q 5M3MG 3TEHB 1XNRQ 4DUYQ 3T1YQ 2E2HH 1KAWA 4LUVA 4JBMA 4BBSG 1HNWL 3RTXA 2OCEA 3FKIG 4JI7Q 2F3IA 1XK5A 4PMWA 1X6OA 2VY3A 1H95A 4X64Q 3RLNA 2R92G 2D0OA 3CMEA 2JE6I 1EOVA 3U4ZA 3CCEA 4DV1Q 1IBMQ 3GTJH 2A19A 4E6NA 2LXKA 3M4OH 4XIGS 2CFMA 4X62L 2CQOA 1HNZQ 1PFSA 4A3IH 2MFIA 1TXYA 4DV0L 2QGQA 1HZ9A 4DV3L 2N78A 3AEVA 3PUVA 4DR1L 1I94L 1HR0L 1QVFA 3S14H 1B04A 3TRZA 4LFAQ 4JBWA 5C0XJ 3BJUA 2BH8A 2E5LQ 1XJVA 2UXBQ 1A0IA 4JCVE 4KHPL 3JSNA 3AFPA 1Q12A 3CPFA 3J81j 3CD6A 1S3OA 4JI1Q 3UDFA 1KXLA 4R4OA 5M5XH 3PSIA 1SN8A 1WYDA 2K5VA 4RG1A 3GTQH 1E1TA 1VQ8A 1Y1VH 1WOCA 2ZTDA 1M90C 4OWTB 4X66Q 4A3LH 4R1JA 4DV7L 1VQFA 1FL0A 3S17H 4DUYL 1IBKL 2VQEQ 4DNIA 1PA6A 4GLVB 4JI0L 2ZM6Q 1N34Q 3KJPA 3PN1A 4JI2L 3H0GH 4CC6A 2NVTH 4A93G 1HH2P 1I50H 2NN6G 5FJ8G 3CAMA 3M4QA 5GAEC 4LF6L 3CQZH 2ZJRA 3I4NG 1OXTA 1N33Q 1EWIA 1CSQA 4A75A 1IBML 4IFDG 2JA8H 3RN2A 1L1OC 2IHFA 3HOXH 1TWHH 1HNZL 3HOUH 3TY5A 3BA8A 5LMNQ 1XMOQ 1MJEA 2WAQE 4P73A 3S1NH 3J80i 4POFA 2JJQA 1QUQA 1XNQL 2KBNA 4BY7H 2D0PA 4JV5L 2B3GA 3FHWA 4LFAL 1NTGA 3GTKH 1KRSA 2UXBL 3GTOH 5DLQE 4NXNQ 1NJIC 4UCUA 3BA9A 1UE5A 2KHJA 3K0XA 1VQLA 4A3FG 1QUQB 1YZ6A 2OTJA 4A3JH 5AJ3Q 2UXDL 5JEAG 2PMZE 2JQOA 3E9HA 2UU9L 4C3JH 2JA7H 3UDGA 4YWLA 2ID0A 1IBLQ 1VQ5A 4JBKA 3NELA 3Q8DA 2CWAA 3GTMH 2HVQA 3G6EA 1QZGA 2HHHL 4KHZA 1X3FA 1IXRA 4LF4L 4Y7NH 2IHEA 1U0LA 5LMNW 4H02A 2NN6I 3PCOB 3U4VA 2L15A 4O0AA 3NENA 5M3MH 4BXXG 2HVSA 1PVOA 4BBSH 4IFDI 4YHHQ 3GTGH 2XTIA 3FKIH 3K7UC 3WWVA 5ELNA 2HQLA 5IP7G 4X65L 4DV5Q 1L1OA 1YBYA 4X6AH 2NZHA 4NXNL 4R4QA 1BBWA 4MZ9A 5M3FH 4XTCS 3ERSX 4YCWA 2NVQH 1HNWQ 3UDIA 1YHBA 3I56A 1NMFA 4GNXB 4JI6Q 2JA5G 5GQOA 4Y52H 4YY3L 1GKHA 1Q7YC 3GTPH 4L5SA 3M85A 3A5ZB 3F2BA 2K5HA 4A3KH 1R9TH 1Q86C 3RN5A 4IJHA 1VQNA 5EAYA 2IX0A 1IBLL 3CC2A 2KCMA 2Q2TA 3OTOQ 4GLXA 2ES2A 2YU9H 3BABA 4JOIC 4DV0Q 4DV3Q 1Y1WG 4LF7L 4B3RQ 4DV6L 1VQGA 4P72A 4DR1Q 1QZHA 1HR0Q 2UXCL 4IO9A 2B29A 5C4XG 2OQKA 3PO3G 3CCVA 1VS0A 4HIMA 5IYBG 5IE8A 1P8LA 4C3HH 2AWNA 1L2FA 4OONA 4LF5L 2AMCB 2KHIA 3HOZG 3K7AH 4YHHL 1SFOH 3UE1A 3CC7A 4DR4Q 1GO3E 3AQQA 1XMQL 1K8AC 4DV5L 5HY6A 2Z6KA 3W1BA 3PIPA 4JYAQ 1YI2A 4A93H 5FJ8H 1UE7A 1AH9A 5M5WH 2K14A 2CKZB 4B3TL 2CCZA 4NPSA 1IBKQ
chains in the Genus database with same CATH superfamily
3BVMA 4AIMA 3MWDA 4JI0Q 1SE2A 1SROA 2WB1G 4JI6L 5JJKA 3GIPA 1WD1A 1DYQA 1TS2A 4L1KA 5BYBA 4B3MH 3KUPA 4BBSB 3STBD 1PH9A 4APVA 1LM0A 4B3RH 3ZJYC 5IGBA 5KFIA 1WFQA 4J15A 3BVZA 5M3FB 1L2ZA 1JCKB 1XNQQ 3NWSA 5DNFA 2VOBA 2HGSA 4RGOS 1BF4A 5C44G 3PIOA 2W6NA 4KY7A 1KJJA 3GDEA 2NVYB 4RB3C 4UHVA 4MV9A 1FYCA 1RK5A 3SK8A 1WR2A 3D4RA 4IQZA 1R9TB 4J1MA 4O81A 5CAEB 1TWGA 1KTKA 1VDZA 3G6YA 1TS4A 2ZTCA 4OWWB 4Q4DA 1PZID 5E4WC 3V2TA 4EFBA 4MTNA 2X6LA 4JYAL 1YNXA 1FJGQ 4OO1I 2A68C 2JEBI 1VCIA 1DONA 1Z2PX 2XCPA 1WTOA 5IYCG 1EIYB 1MGSA 4BBRB 5DGHA 1PH5A 1Z9FA 3G6XA 3PUYA 2W6QA 1HZCA 2VQFH 1A8VA 4JI3L 2A73B 5KT7A 2IJ0A 4JV2A 2EIFA 4ABNA 1CFMA 3H15A 2E2HA 3SR1A 5A2QW 4UCSA 4LF8H 1CTMA 2X0SA 3MWYW 3TW6A 3HKZB 1STHA 1CQIB 5KNBA 1HQRD 2CWPA 3GIJA 3O13A 4O7TA 4DK0A 3UQ8A 4Q45A 1EEID 4FFMA 3UE0A 4KN7C 4RHSA 4FBUA 1WTRA 1DGSA 2V1CC 4MV6A 1JE5A 2WAQA 4ZI7F 1PRTB 1IW7D 1Y8PB 3NPPA 4IR9A 4C3IG 3VOTA 2F03A 4QCLA 4Q4CA 4FNFA 3M9OB 5KFJA 1F9RA 4B3SL 1XPUA 3ULJA 5C4XH 1QNUA 1EY6A 4QUFA 3WWHA 1R4PB 3C1EA 4IOAA 1H9KA 1PTOD 3SNOA 2KQ3A 2UXCQ 1HZAA 2F0LA 2F4VQ 5BYAA 1I6VC 3VPBA 3QJYA 3U9TA 2C35B 1TAEA 2WAQG 1N32L 3H0GA 2W7PA 2AUJD 3UDXA 2NU8B 2MJ8A 3RMHA 3KHGA 3CQZA 3K5IA 4GC6A 1B33N 1PH1A 3HEJA 2W9AA 1DZ1A 4FE2A 4WBNF 3L0OA 2K05A 4IWYA 3OHXC 1I50B 3LP8A 5BR8L 3S9WA 5DM73 2FPGB 1CQFA 3HOXB 3MFGA 2ZDGA 3I12A 4HJ8A 4QIWE 4BY1G 2PNHA 1JJGA 2R8GA 4ECQA 4GKKH 3Q23A 3Q24A 5C44H 1PYSB 5C1PA 4ED3A 1LTBD 1LLRD 2KOLA 2ZTEA 3GTKB 2R93G 5KG5A 2M00A 2ZDHA 3HP3A 1SJHD 3RB3A 3GTMA 1LV9A 5IYCH 4O7ZA 4EEQA 1SNOA 3M3YH 4BWSC 1HRJA 4ED8A 3F8TA 1HTLD 4L6TB 4N9TA 2JA6G 4GKJQ 5LL6b 4RB1A 1X3QA 3ORQA 3IFDA 1PV4A 4QWDA 5M9OA 2Y4RA 4DR5Q 4O3OA 1TWGH 1PH6A 4JI3Q 2F0KA 3PF5A 3UFXB 1XTDA 1HNXH 1BVSA 5LMUQ 1VQMA 5KIXA 4ALPA 4KV6A 4MNOA 1VQEA 1MBYA 3GTPA 2XNAC 4KHVA 2P5ZX 4UCRA 2SCUB 4CDDC 3H3VI 4A3BG 2BQ3A 4AH6A 4C3IH 1AN7A 1Q90A 2ENBA 4ED7A 2YU9A 2B8FA 2BR0A 2IX1A 2Z0SA 1BUVT 5FD6A 3CCQA 4DR3L 1EU3A 1J5EH 2B2TC 5C44B 1VQIA 1B53A 1LO5D 1C48A 3JAML 5KFOA 3NK9A 4DAMA 2MNAA 1I3QH 2EYFA 2WACA 2HDKA 4O3PA 3OPOA 3OUZA 3T9FA 3TIGA 3E5SA 2UUAQ 3ITPA 2OWOA 4GN4B 2IW3A 5C4HA 4R4TA 4K0KQ 4R8UB 2R61A 4FXGC 4YAJB 2PW7A 3R9RA 4WJ4A 2BH2A 5LOVF 1CQJB 3A7AB 5LYJF 4LJZC 5KKNB 3EPIA 4DUYH 4OIKA 3TS2A 3KF6A 1J8IA 4BY1H 2DLNA 1XNRL 3S1QH 4MTEA 4F7XA 5KFUA 2HIVA 4DRFA 5EDWA 2CH4A 5BR8Q 2Y0SG 3H3VH 1YHAA 4NW2A 4DR2L 4POGA 3TP6A 1EZ1A 3PW4A 1WTWA 2R93H 2AWOA 3RB0A 3DWPA 3EFXD 4AYBG 3L7ZC 1E2ZA 1PHJA 4NXML 2NZOA 2B2TA 2VZAA 2EQSA 3MXUA 1BNCA 2JYOA 4C3IB 1UE1A 2E5LH 5F9NA 1BXTA 5GAHC 3DAAA 2WTFA 2UUBQ 2KCNA 3E0JA 2I8CA 3M4IA 4BA2I 5HNEA 5FLXE 3TP8A 2VW9A 5FR9A 2B39A 2JA6H 1TWCA 4DAYB 2R7DA 4A3IG 5BPFA 4IJLA 4J9QA 2JEIA 2ZGIA 2RHQB 4Q0YA 3RBEA 1SLJA 5C5LA 2CHBD 1I3QB 3D31A 2GPSA 1JB3A 4FF4A 5K36G 4AQYH 1PX2A 5KT3A 4R7RA 3MR3A 1PH8A 2C2EA 3NHHA 1N34H 1QJOA 4F4XA 1G8ZD 1VQJA 3URYA 5KFCA 1HCZA 2BA1A 4Z9CB 2EY6A 2JA5A 5KYIA 2FMCA 1NCVA 1HFGA 5T14A 1G91A 3MFHA 1VAJA 3KDFB 3DWAA 5KNDA 4A3BH 4A3LG 3T9EA 4XDXA 4OWXB 4RB2C 5CE8A 3OWFA 1KIXA 3BQ1A 2A5HA 2F1MA 2HHFA 3MAQA 2C2DA 4QL5A 2A1AA 2F0EA 2GVBA 2L9HA 4K6LA 1PH4A 4DXFA 1EHIA 2A6HD 1K83B 2B2YC 3RNUA 4O3QA 4ECSA 2YTVA 3K0YA 2SDFA 5TSSA 2R93B 4EGVA 3PW0A 3HOUG 1AE3A 4DL5A 4PZ7A 4BY7G 3PVXA 2L5TA 5FPRA 3M9NB 2NYZD 1P16A 1QVCA 4DK6C 4O7NA 5L1KA 5HURA 1E3PA 2EZVA 1ASZA 1J6QA 2RGVA 4QMGA 1KC8C 3L4KA 2K4KA 4DUZH 2EJFC 5KGUA 1K0RA 3ULPA 5JJLA 3E5NA 1FNVA 5JPNC 2R7KA 4KLKA 2HJWA 5EKIA 1CKNA 1GUSA 3KAKA 4C3JG 3BQ2A 2R92A 2JA7G 2V4RA 1KJQA 2ASJA 2FLPA 2C5CA 1DM0B 5JVH3 1NR2A 1TWAH 1IKLA 3ND9A 3J7ZC 3T54A 3T9AA 1NMGA 1C0AA 5KFYA 2VS1A 4WJ3M 3VNNA 4YR3A 2J6UA 2GLTA 2R3ZA 5H1SE 2HGWA 3T9DA 1HNWH 1O80A 4ZLTF 3PGZA 4TQUS 1I4RA 1X3EA 2BE5C 4K5WA 4KD3A 3Q2OA 1LUZA 3NTIA 5M3MG 2B2YA 4YP3A 1XNRQ 4CDEC 2B63B 2LKVA 1FNWA 3NQTA 3RLNA 2R92G 2NU6B 3SK5A 5BN5A 3CMEA 1EY5A 3LX0A 4IZOA 1EOVA 3U4ZA 3GIQA 1H9SA 2EYMA 3CCEA 5LXTF 3GTJH 2A19A 2LXKA 3M4OH 2CFMA 4X62L 5D14A 1PFSA 4A3IH 3R5HA 4DV0L 1CZWA 4DV3L 1UAPA 4A3GB 4KHPH 3S14H 1B04A 1TWFB 2X69A 1ONLA 5C0XJ 5K36H 1EY7A 3HB9A 4FYDA 2QILA 1KEEA 3JZIA 3JSNA 3AFPA 2A6EC 3CD6A 4U68A 1KXLA 4R4OA 4J0MA 5KFGA 3A56A 5HV6A 4DV7H 3GTQH 1MI2A 4MHEA 2QCPX 1EEFD 4XZ3B 2PPBC 1M90C 4FFLA 4A3LH 4R1JA 3K5NA 3BVGA 4R9WA 3JAME 1N56A 1IBKL 3K5HA 4LF6H 2QDBA 2OXPA 3KJPA 2HD3A 3KF8A 5KG2A 4CC6A 1HH2P 2EJGC 3CAMA 3QG1A 2ZJRA 1PK8A 4HCEA 1EIHA 5T1IA 3GV8B 1L1OC 3F8NA 1VMPA 1CS0A 4N9PA 4MIUA 1HNZL 4YJ2F 4G7ZC 3HOUH 4LFAH 5A2QL 5DQGA 1MJEA 4J9MA 4RUAA 2E76C 4BY7H 4O7SA 5JH7F 3R2TA 4NMZA 2UXBL 5JUMA 1S0MA 3SE7A 4DL4A 3HRZC 1JQYD 1BQQT 2KHJA 3K0XA 2LY7A 1QWYA 2F0DA 4RKBA 3D8GA 1HXYD 2UXDL 3M7GA 4ODGA 3GTJB 3CHBD 1HUNA 2FB9A 5BWTA 1ZHQA 3JRXA 5JEAG 1S5ED 3E9HA 4A3IB 3OMCA 2UU9L 4C3JH 2XRQD 2WE6A 4RUCA 2JA7H 4H13C 3LULA 1PFNA 2W6OA 3ZYYX 5DG9A 1AP0A 1EUDB 4LF4H 1WRVA 4JBKA 1KJIA 2DWCA 3RGXA 5JVDF 3BYTB 1T36A 2PQEA 4Y7NH 3I73A 1SEIA 2IHEA 2F0QA 1MZBA 5LMNW 3GTQB 1MSHA 1HFNA 3PO2B 4O0AA 1JXLA 5M3MH 4BS9A 4ZYSA 4YHHQ 1QG7A 2XTIA 5EJWA 2HDMA 1L1OA 1RJTA 1W6KA 1G2TA 3A7LA 4KKTA 1BCPD 1BBWA 2DN8A 2EY1A 2SEBD 3ERSX 4XTCS 5LHY1 3OW7A 2HVRA 3GTLA 3FDTA 1NMFA 2W71A 4YY3L 1IBLH 2RVLA 2MCTA 4NZNA 1PFMA 3M85A 3A5ZB 1DOKA 2I46A 2AQ2B 4IJHA 1F2YA 4RCNA 4DAPA 4BY7B 2VPSA 2C2RA 2IX0A 3R3OA 4IHJF 2QW7A 5FNVF 2Q2TA 2W57A 3U9SA 3OTOQ 3K5MA 1S5DD 4GLXA 1HQMC 4DV0Q 2Z04A 4DV3Q 1Y1WG 2A68D 4DV6L 4B3RQ 5K5PA 4IO9A 2OQKA 3PO3G 4LF5H 2J4XA 2A69C 5L9XA 4C3JB 3G6JB 4DV5H 2JA7B 1TS5A 4OONA 1VF7A 4YB8B 1RYSA 3HOZG 4EG0A 4IZ8A 4U673 4DR4Q 4NYEA 1GO3E 4B3TH 5M5YB 4K5XA 5HY6A 3QOJA 2BOSA 3PIPA 1PTOH 4O4LF 3NTKA 5I9OA 1B2TA 4CE5A 3A54A 5I47A 3MJFA 1IBKQ 2C9OA 1N36H 2UUCL 1A0GA 4JV1A 1Y8OB 2BCOA 4NP5A 2JEFA 4ETSA 5M3MB 1YVCA 4ZK9B 2Z6BA 3TP7A 4XXEA 4ZKBB 5KFLA 3HS0C 4ZRZA 1W96A 2WDTA 4OX9H 2Q7DA 4DK1A 3NWTA 1RL2A 2RCFA 2YV5A 3RAQA 2EYHA 4JI4L 4I65A 1EWCA 4DR3H 5E4XA 4CKEA 5JEAH 2I5MX 3PW2A 2HCCA 5C0XI 3PR5B 2DGYA 4L5QA 3OIQA 2UXDQ 1PLFA 3V6JA 3I4OA 1UC9A 1KBLA 2PQAB 3S2DH 4EQNA 3S24A 5I6YA 2UU9Q 3HKZE 4M1UB 1AW7A 1SRUA 3MZ5A 1EQQA 5A35A 1FVIA 1N9WA 1MKHA 3A8JE 2F0MA 1HJPA 4O2AF 3OHAA 2VUMG 1ET6A 1T5XD 4P2CB 1CA5A 3HKZA 3I3CA 3D0FA 2YWVA 1E24A 4FGRA 3ORRA 4ED2A 5KFKA 3PUWA 2M9VA 4E6IA 2K5NA 3RLFA 2W6ZA 5L1IA 4MTKA 2DY8A 4CJ2C 4DV2H 3BAAA 5F2DA 5KG7A 3RZDB 4DR6H 1PTOB 3AB9A 5I5YA 1PZKD 4YBZB 4OXPA 5HGQA 4RZRA 3EQLC 4F4YA 3T4AC 5KYLA 1YIJA 1IOVA 3N43B 1E2WA 2W8KA 3BU2A 3JAMi 3MTSA 2B2WC 1PXUA 1KUTA 3U50C 2C00A 3U0GA 3T1HQ 2ATLA 2OT2A 4YY3Q 1Y1WH 4Y8VB 4K6DA 1OTCA 3MR6A 1UC8A 2RA4A 2F0JA 4ECTA 1ZETA 1FJGL 3PO3H 2F52A 3HBLA 2KSWA 3MXNB 4HMIA 1EKVA 3J80c 1Y1VA 3PUXA 4GKKQ 4LFCH 3K6OA 4DV6Q 2PMZA 5KS8A 3V6HA 3LGJA 3J7AV 2PNRC 3HOZH 1YHQA 4HNTA 2CW7A 2W9BA 3BJYA 5JPMC 5A2QE 1F9SA 2HUGA 3PIO3 3EN2A 1I4PA 3A5UA 4I55F 2K52A 2AGPA 1EYGA 4J6HA 2YTYA 3OSOA 3N8DA 3IL8A 4DV4H 4LF9Q 1LT3D 1D5MC 2DJFC 1RHPA 2EXZA 4FP5D 2XRSD 1KNAA 3A74A 2Q8TA 3M9BA 5H80A 2UUCQ 1I6HH 2BQRA 2K5WA 4JBJA 4HN2A 1VQ7A 1Y1VG 5D3IB 4ZAIA 5KNCA 1NNXA 3KLSX 1TWHB 3JSLA 2B2WA 4DAAA 1RODA 1V1OA 3BZCA 3CRLC 1GD7A 2NU9B 4FFPA 5JAVA 4DU9A 1OXSC 3N6XA 1SCUB 2FKLA 1HNXQ 4IN3A 5D3DA 3KLWA 1WVLA 4RNMA 4JI4Q 1ZHSA 4RAYA 4TM5A 2EIYA 1EQVA 4FDBA 1Q46A 3GO5A 2F4VL 3S1MH 1XDNA 3QR8A 3RD4A 1RCVD 1UEBA 3HFZB 1VQ4A 1MIUA 4YWKA 4FF1A 3WWIA 1L0WA 2VUMH 3PO3B 1H9MA 3RUPA 3R2IA 4NZMA 4OO1G 4O7RA 1A2UA 1B8AA 2K28A 1W2BA 1J5EQ 1GJXA 5IOCA 3I4NH 2MPMA 1JLLB 3MC0B 1S68A 4HJAA 4A3JG 1OXVA 3CC4A 1D7QA 4JXUA 4IFDH 3FKIA 4DGZA 4GN5A 4WORA 3T13A 3G8CA 2EY2A 1V43A 2COIA 2R8JA 1H9RA 2NTSA 2EJ2A 1O7ZA 2TMPA 4HJ5A 2UVRA 4K2KA 5GONF 4GS3A 2D62A 3SGIA 4EEYA 2D2CC 1I4GA 1X56A 4LFBH 4TSSA 5IWAH 4ECWA 2NVQB 5I6WA 1I6HB 1SYDA 4Q8FA 4G4KA 2RDFA 4RWSC 3M4PA 2A1HA 1PZJD 5J39A 1C7YA 5D1OB 3FMAA 3J80W 4JW0A 2X5RA 1E7ZA 2EE1A 4HSPA 4GOPB 2IY5B 3CCRA 2KCTA 4O4IF 4GN3B 3T53B 3I4MG 5KFDA 4JPBW 1JOKA 2RKSA 4HMJA 4DR7H 1GSOA 1NAPA 2JN4A 4A3DG 4DR4H 4GKJL 1MD2D 4HR7B 5FLMG 3G71A 4GC7A 3AU7A 4OEMB 1ESRA 3TQTA 2DY7A 3S1MB 1SE3A 2F0IA 1EY9A 4HIDA 4DR5L 4A3CG 1ESFA 1VQAA 4C3HB 4A3KG 4UPAA 2VUMB 4C2MH 5LMUL 4JI8L 1TY0A 1SFOB 4DLKA 4RGMA 2CW8A 3H4BA 5IODA 3MXGA 1NY4A 3F2DA 1I1MA 4CKCA 4A93B 5FLXL 3I4NB 1F2MA 1CQVA 3RBDA 2Q2UA 2YCHA 1YJWA 5C4ZA 1LT6D 1Q1EA 1A15A 5AFWA 3RZOH 4JI7H 5EQ0A 5IGCA 4AQYQ 3T1YL 3E0EA 1T9HA 1M1KC 4OELB 4DV1H 1EIGA 5E7NA 1IHZA 4LW1A 4X64L 4YJ3F 5KFRA 2Z1CA 2IPKD 4P71A 4F8MA 3EBEA 4WJWA 4ED1A 3S16H 1C3OA 2XD4A 1YEZA 3K3VA 2ZXOA 4DAYA 5L37A 4HN7A 5DAAA 3Q8SB 2ZDQA 3U9OA 2UUAL 5KFZA 4OO1H 4JC0A 4K0KL 3GV6A 2ATWA 3JRWA 4MA5A 3H6MA 4JI1L 1ET0A 2OF1A 5C8YF 2W70A 2O5IC 1GSAA 2IL8A 2DNEA 4I7AA 2N88A 1X9NA 1II3A 3MA2B 3P75A 4X66L 5DGIA 1GHJA 2ZM6H 1C4QA 4KD4A 4ME5A 1G51A 3KDFA 4RNOA 1YNJD 2VQEL 4C2MB 2C22A 4ME6A 1KC7A 4UP7A 4PQXA 2BE5D 4ZOLF 4DUZQ 4KJNA 1V1PB 1U5KA 3GTOA 2ZJQA 2MO0A 3Q6SA 5IY0A 1DV2A 4TVIA 5IGFA 1XMOH 4FF2A 4EQ5A 1N33L 4UP8A 1STYA 3QQMA 5EPLA 3RZOB 2N8NA 2K04A 3H0GG 5FOBB 5LMNL 2KENA 2E2IH 4IPGA 5KFVA 1F77A 4FFOA 4A2AA 3I4MH 2UUBL 1IZ6A 4QIWA 1JJCB 2AQ4A 4A3EG 1CE8A 4ID6A 4IR1A 5I5VA 3I2ZA 4A3DH 2E2JH 2V58A 1JDBB 4MV4A 5FLMH 5IGDA 5KRUA 4K6NA 5C4XB 3J81c 2RCNA 3M7NA 4DFAA 4ILWA 1Z2NX 2A6ED 3LWEA 4A3CH 5JQGF 3Q1KA 1SEBD 2R8IA 3DLLA 3GP7A 3GV5B 2K5QA 4JVZA 2IT1A 3TP5A 1E4EA 4IPDA 3GTGA 1ASYA 1GUTA 4K8IA 2FXQA 1Y8NB 3NC0B 3T51B 1KLGD 4JI8Q 4KHPQ 1STGA 2WB1B 1RDPD 2COGA 2RHSB 1JWUD 3N40P 2B2UC 3UZOA 4JI5H 1A3GA 1RD9D 3MEHA 1BOSA 3TQ1A 3H4DA 2DJGC 3TZDA 2BDNA 3NBHA 3C3LA 4HIOA 1QE6A 2PVPA 4DV7Q 1LYLA 1KTAA 5FO8B 2QB5A 3T1YQ 2E2HH 4JBMA 1TVXA 1I4XA 1X6OA 1H95A 2K01A 4X64Q 3P1HA 2JE6I 4O1NA 2E2IB 4O7LA 1SYEA 3LWBA 3BQ0A 1I94H 4E6NA 1HR0H 2CQOA 4O3SA 1C8CA 1TXYA 2E2JB 1GYFA 2RDIA 3PUVA 4DR1L 1K3BC 4LFAQ 2K5DA 3MFIA 1XJVA 3R23A 1RYRA 5ELCA 3CPFA 3IAYA 3KAJA 2NVXA 3M3YB 1S3OA 4JI1Q 3UDFA 1SYGA 2EYLA 2K6AA 5M5XH 1K0SA 5KG1A 1WYDA 1F9QA 3I72A 1VQ8A 5ELDA 5EWEA 2R85A 2MP1A 1TY2A 1MSGA 4JI0H 2B2UA 3A8KE 4X66Q 1I6UA 4I4TF 2PZTA 1TWGB 5COYA 4DN4M 3BS1A 3S17H 5C5MA 4C5CA 2W9CA 5DMXA 2VQEQ 2FFKB 2F4IA 4JI2L 3T5LA 1SDFA 3H0GH 2O03A 1IBMH 2L11A 5LL6S 5J2TF 1KDAA 1Q3LA 3CQZH 4F87A 2GQSA 1VF5C 3D4WA 4IUNA 1N33Q 3J81W 1CSQA 4A75A 1SMYC 1SE4A 1XNQH 2R7ZA 3TIIA 4Q5VA 5KG0A 2KJXA 4FU0A 5LMNQ 1JE4A 4LMYA 1QILA 3S1NH 4XX0B 3N6RA 2E2HB 1ZEQX 2YW2A 4JV5L 4TKOB 3GTOH 5DLQE 4RCOA 4UCUA 1RTNA 1UE5A 5DLGA 2R86A 2DPJA 4A3FG 1QUQB 3GLKA 4ZQIA 2OTJA 2Z4IA 1S0OA 1W6JA 4PNYA 4H0LC 2YZGA 3IFTA 5G3LD 4ECYA 3NUCA 4CKBA 5EZYF 2JQOA 1BCPB 3N52A 2WAQB 4G57A 2ID0A 1IBLQ 2K1BA 2F3WA 3GTMH 1RF2D 2CWAA 4DL7A 1QZGA 2HHHL 4KHZA 2ZXRA 1X3FA 1IXRA 2XIGA 3MR2A 5M5XB 1U0LA 4J9PA 4H02A 1QCBD 2L15A 5BWRA 4YR2A 4BXXG 2HVSA 4RB0A 1LTAD 4J9OA 4BY1B 4NXNH 3S17B 3EA6A 3K7UC 3GTGH 4X65L 3WWVA 5ELNA 2HQLA 4K2LA 5CGKA 1B1ZA 4KY5A 4DV5Q 1TIID 3T5KA 1YBYA 1EY4A 1HA5A 1STAA 3H0GB 2ICEC 5J1ZA 4R4QA 4X6AH 4MZ9A 4YCWA 2WKCA 3CQZB 5DEHA 3UDIA 2P0AA 2R82A 1PMRA 5I9PA 3QB3A 5JVG3 2JA5G 4Y52H 4QWAA 1Q7YC 3GTPH 1G2SA 3S1NB 2K5HA 1Q86C 1DD2A 2OEOA 3N41B 3TINA 1VQNA 4IUQA 5EAYA 1T3NA 3CC2A 2UXCH 2R7NA 2YU9H 2ES2A 3W3AA 2F4VH 4CDFC 4JOIC 4LF7L 5FD5A 2JA6B 1VQGA 4DR1Q 1QZHA 1S03G 3PR4A 5DQIA 1IW7C 3DMUA 4QF4A 2LFNA 4XYMB 1CA6A 3BDCA 1S5BD 1L2FA 1WCMA 3T7AA 4YHHL 5CR3A 3UE1A 3CC7A 3DWQA 1XMQL 1K8AC 2EJ0A 2HGXA 4MV1A 5CBAE 2WYOA 1BJTA 1UE7A 5M5WH 5KX5F 4JI6H 2CKZB 1K28A 4B08A 1GUNA 2XN9C 4NPSA 4ZUJA 4A3BB 4UAIA 2FHTA 3DF7A 4RA8A 4JI2Q 1EYAA 3HKSA 4O4HF 4IAJA 1D5XC 5IT9c 4A3MG 4YCVA 4M8AA 4UCTA 2PZUA 2K50A 1UE6A 1BO0A 2B8GA 3VR2A 1S5CD 4B3ML 3KALA 4LH7A 2EVBA 3OTOL 1WCMG 3DTFA 1PH7A 2RDGA 1D5ZC 3CCJA 4B3RL 4DV2Q 2HG8A 3AYHB 4JV5Q 5I4DA 3HOWG 1ZYRD 1EQTA 2PCFB 1A3UA 4RGTA 3HOYG 1HZBA 3GTPB 3G4SA 3J80L 4I50F 3K57A 1L0XB 3S15H 4TV8F 4JYAH 4CGYB 1EIFA 4DR4L 1A6XA 4RZQA 5DLFA 1XPRA 2YU9B 5IIFA 2BDOA 5GADC 2XWJB 4JI3H 2G9DA 2CW0C 3HGBA 1IL2A 1TWCH 4CMFA 1E2VA 4BXXH 1B7YB 1TWAB 2HHHQ 1RTOA 3KJOA 5J3BA 4BWGB 1G291 3ULLA 5J22A 1OWTA 4YR0A 4KKSA 2VQFL 3F1ZA 1M0WA 2W6MA 4DIMA 2Y0SB 2XWBB 3TSSA 2F0OA 4HNVA 2V4QA 4GNXC 2QA4A 4AYBB 2KHSA 1VQCA 3K81C 3U58A 1K1SA 1MJCA 1B3QA 4X65Q 2JA5H 4LF8L 2KUMA 2BQUA 1PRTF 2NWGA 1KL9A 2KA7A 2I80A 4DV4Q 2CNQA 5CYUA 5ELOA 3C1FA 4WHXA 2G5DA 4X3UA 2SNSA 4R4CA 5EPJA 1VQBA 2HDLA 1BXRA 4F50A 2AGOA 4B3SH 3KF6B 1C30A 1ENFA 3M4OB 1FGBD 3PF4A 2WINB 4FM9A 5KG3A 3S14B 5D8DA 1PYWD 5J2UF 1NR4A 5BMVF 1DOMA 1Z6HA 1C9OA 1VBGA 4K0KH 4LF7Q 1WTVA 1X3PA 1PDQA 1SR3A 1O7IA 2B2VC 2L4NA 3DUZA 3S15B 1BKBA 4RKLA 5KT4A 1X55A 1SYXB 1N32H 2ASBA 1GVPA 3I4LA 2UVUA 1TQOA 3GIMA 5IT9W 2VB3X 1UWVA 2JEJA 3G8DA 1A9XA 3J7YW 1XMQQ 1DCZA 4GNXA 3NEMA 3QIAA 3BZDB 2R92H 2K03A 4IWXA 1E4GT 3AX6A 3RJ0A 5BR8H 4A3MH 4PBCA 3NBYB 2E2DC 5KEEA 4O2BF 1DXMA 3TN2A 5KFXA 4C5BA 3T1HL 4C5AA 1Q8KA 3TREA 2CZGA 1WJJA 4A4IA 1Q8IA 3GJXB 3HOUB 1KLUD 1CSPA 4IFDJ 3HOWH 5C6AA 2JA5B 3E3XA 4B3MQ 3HOYH 1NBWA 2VQDA 4KI0A 4GKKL 2YRXA 1KD1C 5DG7A 2HHFB 1EL0A 5C0XG 3KLRA 2JA8G 3L3OC 2LS01 4MTDA 2XCAA 4LFBQ 3RLOA 3RR5A 1KJ8A 3PV0A 4DPGA 2R7LA 4I7HA 1B9MA 2NUCA 4ULLA 1EUCB 1IYJB 3KREA 1HHVA 1KABA 4LF9L 5GAGC 2FLLA 4MN3A 2M2LA 3T5JA 5E25A 3GV7B 2H5XA 3BDLA 4DR7Q 5KFPA 4Y7NB 1ULZA 5C4JH 1TU2B 3TDQA 1RJRA 2MUYA 1HTPA 1ICFB 4NDXA 4OIJA 4JV0A 4ECRA 5KG4A 5ELFA 2VQFQ 1CM9A 2VL6A 4HNUA 5I5WA 1PRTC 3HG9A 5D1OA 1CKNB 3L2PA 3EVQA 1F2ZA 1SXTA 1WTQA 2F0TA 1JJ2A 1HNXL 2R92B 4A3MB 5I60A 2LMCB 5BWUA 2NVYA 5DG8A 1Y14B 2EPBA 3QZ8A 1R9TA 3ETHA 5F9LA 4LF8Q 2WFWA 3GQCA 4NZOA 4PMCA 3ETJA 3Q8RB 1GOZA 1JOQA 3RGZA 1O7YA 3DM1A 3ICEA 3TW7A 1FD7D 4ZUIA 2R7FA 3PMFA 4L5RC 3VYTA 1RKNA 4K8JA 3RV4A 4LSXA 5IYDG 2O2LD 4YCUA 4L8JA 4QSHA 5M3FG 2FLNA 2A6HC 3QWUA 5CM0A 1J5EL 2NZ1D 1CT1D 2QK4A 3BZKA 3K58A 2F0UA 1S72A 3PQIA 2CNUA 1Q82C 1GUOA 3HZXA 4ZQ3A 4N8X1 1JORA 1SNCA 1VQDA 1AZPA 1EKPA 2GPWA 1SBBB 3QZ7A 4QY7A 2J6SA 1B3AA 1JC7A 1U4MA 1A63A 4BBRG 1XNRH 1AEXA 3J80E 3R8BA 4ZHQF 4O3NA 3OMGA 1I5FA 1SNPA 1QVGA 4LNQA 4IRCA 4DR2H 2WP8J 3GIDA 3CXCA 3HT5A 4NXMH 4EFEA 2I0QA 1NUCA 1E22A 2FK3A 3X3NA 3A0JA 4RGNA 4R8NA 1XPOA 3HKZG 2EJ3A 2YZLA 2PN1A 5D1PA 2WV6D 4WRDA 4M9UA 3IN5A 2ZXPA 4O42A 5C0XH 2ZJPA 2QEXA 4QQBX 2YTXA 3KF8B 4HSVA 1ZAUA 1WI5A 2FK2A 4QWCA 5CC4A 2F0WA 4TRDA 2DUDA 3CRKC 2QKIC 1Q1BA 2L0CA 1OXXK 3J81L 2W7OA 1IYEA 3GTLH 1RIPA 5C3WA 2E5LL 4JG2A 1O7LA 3FP9A 3S2DB 4FXKC 1BCPF 4QGUA 4LUZA 3V6KA 1JICA 1GLVA 2GN5A 1D1KA 1I50A 4XYQA 2AKWB 4ECXA 2IP4A 3B6YA 4AQYL 3RFCA 1S40A 4CJ0B 1EYCA 1N34L 4CBVA 5LP6F 3M9MB 1JMCA 1A2TA 3GTKA 4ECZA 1UNSA 2ASLA 3LMLA 1STEA 1K8MA 2Z6KC 3J7A5 1WTHA 4GLAC 4LK1C 4J9NA 4ZCKA 5EWGA 5KT2A 2XCLA 1K3RA 2D5DA 4JI5Q 3F2CA 5DISC 5IYDH 3HOXG 4HAEA 3EPGA 2AUKA 5DGAA 1Y1WB 1AE2A 1KQSA 5KFNA 2FMAA 1L1OB 5AJ3L 2K7VA 3CW2C 4N8FA 3CCUA 2WB1E 2NVYH 1B70B 3E9IA 2L55A 1CUKA 2VUGA 3NSWA 1CHQD 2MHVA 1EOTA 3C2PA 3P20A 4IOCA 3HOZB 1UEAB 3S1RH 2FJZA 2YYAA 4RHRA 3KFUA 1G2WA 4K14A 4DK3C 1KT8A 4EYIB 2R87A 1TA8A 2TSSA 5CV5A 1I94Q 2MGSA 4DUZL 4PV1C 4FS2A 2Q8IB 2YZMA 5JQWA 4BBRH 1GM5A 1JR0D 3K8AA 4LH6A 4Q8EA 3CF5A 3P7JA 1W3SA 4B9XA 2JK8A 3WDNA 2J0TD 4G7OC 4TV9F 1V9PA 3CPWA 5I5XA 1YNNC 2J6TA 1SMYD 3SHLA 3W5OA 4HQ6A 2PZWA 1EUJA 1L0YB 2EYJA 4PG3A 2A8VA 3I55A 2PO4A 1LABA 2QF7A 2Z02A 2VNUD 3L9AX 3K5OA 3TEHB 4F4ZA 4OL7A 4DUYQ 1IYVA 2RBMA 4O3RA 1HNWL 3FKIG 2KEDA 1AFPA 2F0FA 2VY3A 1UNNC 3J7AF 1CK1A 1U4LA 2D0OA 2R8KA 4X62H 1DV1A 3K5LA 3LQSA 3OTOH 5CMDA 2CQYA 4DV0H 4DV3H 1IBMQ 4R8UA 5NUCA 3D6WA 1EY0A 5KFEA 2QGQA 1BCPC 3AEVA 1QVFA 4APMA 1LTRD 3TRZA 4R8IA 3MVVA 4JBWA 2FP4B 2V5AA 2E5LQ 3QFFA 3V4ZA 3NQIA 2FPPB 5DQHA 4JCVE 4KHPL 1Q12A 1GUWA 3J81j 3UYYA 1LT4D 1S5FD 4XT1B 3OSNA 2W8LA 1D6EC 2D9UA 3PSIA 4RG1A 2K5VA 3S1RB 1E1TA 1Y1VH 1IBKH 2F0NA 1ML0D 4KKUA 4DV7L 2UVVA 1VQFA 1FL0A 2EY5A 5CV9A 4DNIA 5D65A 5BN3A 1N34Q 4F4WA 3TZUA 2VR1A 4H7BA 1CHPD 3H3VC 3WO1A 2NVTH 1I50H 2NN6G 5FJ8G 5GAEC 3M4QA 1HNZH 4LF6L 5JJZA 2IHFA 3HOXH 1I7NA 3UI2A 4QWEA 5BN4A 3TY5A 2UXBH 3BA8A 1K1QA 1DOLA 1EFID 2WAQE 3NBIA 4P73A 4QB4A 3J80i 2JJQA 1QUQA 2EJMA 4POFA 1JIHA 1RJPA 3SE0A 1I3QA 2D0PA 3OHBA 2ASDA 3FHWA 4LFAL 2ODTX 3GTKH 2UXDH 2H1EA 4NXNQ 3NXWA 2JXMB 3BYYB 2L1BA 1M6VA 3BA9A 4S3SA 3ERQA 1U9RA 3BACA 1PFBA 2AQ1B 2UU9H 4A3JH 5AJ3Q 4EGQA 2X6GA 4Q44A 1AZQA 1HUMA 4RAUC 3WNZA 3UDGA 1SNDA 3I8ZA 3PZPA 5LL6X 1VQ5A 1BR9A 4ED0A 3NELA 3Q8DA 1M8AA 4TUYF 2EYOA 3SVMA 3T16A 2JP1A 1TKWB 1FNUA 1G6ZA 4LF4L 3J81E 1GHKA 1K83A 2NN6I 1Y1VB 4XT3B 4O86A 2PMZB 3U4VA 4GLWA 3QOLA 3UZBA 2R93A 2W9BB 1Z2OX 1SYBA 5IT9L 2KEEA 5IP7G 3FKIH 3VYSA 2R84A 4IUTA 5CR5A 1EWHA 3BDOA 3T1HH 4XQQA 5KFSA 4YY3H 2NVTB 4DL3A 1HNWQ 1LACA 2Z4HA 3I56A 4JI6Q 3RV3A 1T94A 4DA2A 4U6PA 2NUAB 4ZKCB 2HQEA 3S16B 4L5SA 2JA6A 3F2BA 4A3KH 3KTMA 4DV6H 1EYZA 1S10A 1QNKA 1IBLL 4O7YA 2VA2A 3BABA 3GIIA 5BWXA 5CV7A 4LSAA 2CW0D 4MV3A 3T99A 1FR3A 2VXWA 2NBFA 3MFYA 3KBGA 4A3JB 2YS6A 1VS0A 5IYBG 4LF9H 5IE8A 1I1KA 1WD0A 2Z9HA 3DXJC 4LF5L 2XSCA 2KHIA 2SOBA 3K7AH 3WO0A 1SJED 2B63A 4XQJA 1ZKOA 4DV5L 3MWMA 2R8HA 2UUCH 4JYAQ 1YI2A 2NN6H 4YIJA 5FJ8H 2DABA 1TT2A 3FVQA 4B3TL 2EOTA 3NGDA 3PW7A 4FBTA 4EX5A 1VQKA 2RSOA 3C0FB 5EPKA 1S97A 3SK6A 4U7CA 3KHLA 2MO1A 3GIKA 1N36L 4LF6Q 3Q8PB 2UVWA 1TWFA 3FKIB 3CVZA 4LWCA 3I4MB 2DIKA 4JI4H 1CKOA 3IKJA 1HR0W 3TQYA 3R93A 4M0JA 3CP0A 3W1GA 2HIXA 2WIIB 2V9WA 4A3DB 3H94A 4DL6A 3V05A 4WD3A 2B63G 4OX9L 3KK7A 5ELBA 4HEDA 1WH2A 2FINB 3GB8B 1NE3A 3S2HH 4IALA 3VPCA 4A3KB 1IYDA 4PMBA 3W2DA 2I07B 1XX8A 3PW5A 5K2MA 2LXJA 2Y0SE 4JUZA 4TQSA 4IURA 3KXYT 4L5TA 5KFWA 5C3XA 1K9MC 2N3SA 1TWAA 3VR4A 4A3GG 4AYBE 4B3SQ 2EXDA 1IL8A 3OW2A 3GD7A 1SYCA 5IP9G 1D1IA 3E6ZX 2XGQA 2Y0SA 3TY9A 4EVOA 5KFBA 2AGQA 2BA0A 4JK1C 2ALYB 2Q2IA 1ZQ7A 2WKDA 1PTOF 4HJ9A 4AYBA 4LF4Q 5IP7H 1E0BA 2H4OA 1KDBA 5FO9B 3K7AB 5IGGA 2Q2HA 2F0VA 4J9KA 2DNCA 4A3EH 2M05A 1N8RC 1N32Q 5KT5A 1K8OA 2R7MA 2DAAA 3CCMA 4DV2L 1U4RA 3MHBA 4DR6L 1EY8A 3GTJA 4J8QA 4NB3A 2A74C 5EBCA 1K83H 5CBEE 2OQ0A 5LA6F 4FVMA 1DJRD 2GVAA 2O4XA 3STBC 3CCSA 3OSPA 1FJGH 4LMQD 4ED6A 2A69D 4UDUC 2AQ3B 4TVAB 2JEAI 1X54A 4DNTB 2FK1A 2JSOA 2NU7B 3R5XA 4CC5A 1E1OA 2J7ZA 2SNMA 3S1QB 4Q0FA 4UFZA 1DIKA 1EU4A 1STNA 5IYBH 2R7ZG 3V4SA 3D3RA 3DM3A 4UP9A 3GTQA 5KFHA 2V4DA 3SK4A 1VQPA 3S2HB 1EFWA 3GILA 5CORA 4PZ8A 4A2BA 3MWEA 4LFCL 1SMXA 3N44B 4PWQA 1CI3M 3T56B 4QJFA 4LF5Q 2FPIB 3LWUA 4O82A 3I7FA 3K59A 1EZ6A 1U4PA 1PYBA 1ENAA 1PRTD 2COJA 3VYUA 1GGOA 2AHOB 4DV4L 3CU7A 3Q22A 5C1OA 4B3TQ 4MAMA 1WSCA 4IPHA 4K5VA 1FKAH 5CV8A 5FLXc 4A3EB 3PO2G 4O2DA 3JZ6A 1V8QA 3J81i 3EIVA 3KOJA 4EQPA 4PDBA 1EZ8A 4BA1I 3VDYA 1N36Q 2B63H 4O83A 3I70A 4O4JF 4DKAC 2O5JC 3TS0A 2G9HD 1X65A 2R6GA 2RDHA 3GTOB 2R6FA 5DM63 3PFFA 3AFQA 1I4QA 2IX3A 3TMEA 1VQHA 2JA7A 2RF4A 2L12A 4OX9Q 1EQRA 5IT9E 2N49A 4A3GH 3FRPB 4ME3A 4DQNA 1TWFH 4DR3Q 1Q81C 5ELEA 2HT1A 5HBRB 5DGBA 4QIWB 5IP9H 1OBGA 2PYKA 3KLSA 1JKJB 5JEAJ 2IBKA 1XTCD 1N48A 4QW8A 5C3EG 3M4YA 3GTMB 3H20A 1E4FT 3CKIB 1A3VA 4GZYC 1JT8A 4MV7A 1PTOC 2VB2X 1JWSD 1S9FA 1D8LA 1F9PA 1R4QB 1CZGA 2F3VA 2NVXH 1KJ9A 1SE8A 5KFMA 2XVSA 2YYZA 2IMWP 1KNEA 3D4DA 4B9WA 2RSNA 2FJ2A 2C28A 5I2XA 1E4EB 4PZ6A 3DHQA 5E3FA 2PBZA 3NE5B 4UCOA 4P75A 3GTGB 4C56C 2PW5A 1I1LA 5I5SA 1G6PA 1K8GA 4FS1A 4A3FH 1I2KA 1YNJC 4MA0A 5EBDA 4O7WA 2CH4W 4DR6Q 2PQAA 4HCSA 2QEJC 1ILQA 2XGPA 5I5UA 4LFBL 4JOIA 1T5EA 2CVRA 5IWAL 4A76A 2EYPA 4C1NI 4IRDA 5BWVA 5CA1F 1S4ZA 2R7ZH 2F0HA 3ER0A 3NBHB 2DZDA 4RNNA 3RB4A 4IUVA 3I91A 4DR2Q 4GKJH 4RH6A 4LUOA 2VA3A 4NXMQ 4DR5H 4WFN3 3R5FA 4DR7L 5FPOA 1Z47A 1TR5A 3MEFA 1XXGA 4KJOA 3RUZA 4UCVA 5KFTA 4M7EA 3HOVG 1FGUA 4ECVA 3ONAB 5LMUH 4JI8H 4HIKA 1A48A 1VKZA 3LNNA 2KVMA 1H9JA 2VPQA 5FLXW 4LFCQ 1VMCA 3BG5A 3G48A 1QB5D 1KHIA 2I5HA 4YAKB 4CHIA 5M5WB 2LSSA 1J9OA 3VYRA 3IG0A 3T1YH 1B4OA 5G3LF 1PH3A 1OXUA 2JA9A 3PO2H 2NVXB 4MV8A 2ZT9C 3PIP3 4X64H 1VQOA 4DNRB 1PH2A 4UY8C 2Q8RE 5DAUA 1YJ9A 4J9RA 1X3GA 3J7AK 4YWMA 4R4IA 4LAAA 3WOFA 4JI7L 2NTTA 3HXLA 3T5HA 3MXNA 3H09A 5JJIA 4YQWA 3TBIB 4FFNA 3TY8A 3H91A 4H44C 5BWWA 5EOYA 2W9CB 5BPHA 3CMAA 4DV1L 4A3FB 1M0TA 1KAAA 2UUAH 3SEBA 3VR5A 2I5LX 1LT5D 3CEBA 3CSWA 4X3KA 4JI1H 2R7ZB 2ICIA 1CKMA 3KYHC 3JAMc 2J9GA 4EBCA 3OIPA 3HO8A 5GROA 5C3EH 3D6CA 3QO2A 3N42B 5EKLA 2E74C 2ABJA 1LTLA 2XGTA 2OLSA 1SNMA 3GV3A 4X66H 5L1LA 1VQ9A 4QWBA 3EYYA 3FPUB 3FDSA 5L1JA 4DAVA 1X32A 2VQEH 1TWCB 2RGRA 1JOOA 3T9BA 3OYYA 1TWHA 4HYKA 1YNND 1SNQA 4DXGA 4KTAA 1ILPA 5M5YH 4RAZA 1XWEA 2ZM6L 2I87A 5K3WA 1N33H 3RIZA 1AN8A 1LTTD 1WCMH 1V51A 1BDOA 5CV6A 4ECUA 1O75A 3K80C 1KRTA 4GOPC 2MQHA 5LMNH 1D2BA 5I5TA 2UUBH 1M7JA 1F2LA 5KFFA 2FMMA 1XMOL 4NLGA 1YJNA 1Y1WA 3K3PA 3IRBA 1VQ6A 2JEGA 2K75A 1K73C 1IYUA 4TQRA 2PI2E 1QOHA 1DAAA 5IWAQ 2B2VA 4NKLA 4UUGA 1JB7A 1JX4A 1M4VA 1BBUA 2E8GA 3SDZA 1BBXC 3JC66 3HOVH 3KBXA 1YITA 3G6VA 4KY6A 2PI2A 3VA7A 1GSHA 2OH2A 4EQOA 4X3SA 2W6PA 4X62Q 4J9LA 3PUZA 3OUUA 1B6SA 5C3EB 3CCLA 2Z8LA 4CHTB 4FXDA 4IRKA 1ICWA 4KK7A 1V1QA 1LTGD 1V4YA 5KFQA 4RMFA 4XQNA 2OTLA 3VR6A 3V96A 3NBZB 5ISRA 5IYZF 4KN4C 4GOPA 3RF2A 4C1NK 1JDEA 4IPCA 3RZDH 1A62A 4JI5L 4HJ7A 4P74A 1I4HA 1I7LA 5CV4A 1WCMB 1EYDA 2XC9A 4OHJA 4BBSG 1KAWA 4LUVA 3RTXA 1HA6A 4HR7A 3JAMW 4J9SA 2OCEA 2F0SA 4JI7Q 2F3IA 1XK5A 4PMWA 3HOWB 2IA6A 2N55A 3NTHA 3HOYB 2NB0A 4FFRA 4DV1Q 5EGTA 1GXDC 3EJIA 2EDGA 2QDLA 5T1GA 4CDCC 4XIGS 4DR1H 4G3IA 2VUMA 4X3TA 1HNZQ 1SFOA 2MFIA 3OWEB 3VR3A 3I90A 1HZ9A 3WOEA 2N78A 1I94L 1SSOA 1HR0L 2CNVA 1H9SB 3AW8A 5IGEA 3BJUA 2BH8A 2UXBQ 1O78A 3HOVB 1A0IA 1I2LA 3U55A 2K33A 3TEKA 4EBEA 5EKKA 3VPDA 3RB6A 3OOCA 3KHRA 1EKFA 1B9NA 1SN8A 2E75C 4F88A 2KCCA 1WOCA 5C4JB 2ZTDA 4OWTB 1ET9A 4C3HG 4JI2H 1ENCA 2DPIA 1WTPA 2GQRA 4Q43A 1OBDA 4DUYL 2AU0A 2CQAA 4GLVB 3Q0AA 1PA6A 2ZM6Q 4JI0L 4IIJF 4HTHA 3PN1A 2F0PA 4G7HC 3KHHA 2YS7A 3C46A 4RFBA 4A93G 3I4NG 1KDCA 1LTSD 3BG3A 3MR5A 3DEPA 1OXTA 2HCIA 3FPPA 1EWIA 1IBML 4CJ1B 4IFDG 2JA8H 3RN2A 1SYFA 4JV5H 1TWHH 1XMOQ 5FKAC 1Z7TA 1Y69U 1B6RA 5KFAA 1XNQL 2KBNA 3EROA 5HGTA 4I7ZC 2B3GA 4V190 3Q8QB 3NUAA 1NTGA 1KRSA 4OGQC 2GA4B 4FO2A 1NJIC 1XYIA 1AUXA 1OO9B 1VQLA 1MHWC 4L63B 1YZ6A 5CB4F 3ND8A 4IUPA 4C2MA 2PMZE 1HPCA 5C5JA 2FE3A 1AUVA 1VBHA 1V1PA 3AMUA 3JZFA 4YWLA 2HHHH 2XIWA 5KG6A 4XYOA 1ZYRC 2RDJA 2HVQA 3SXHA 2YRWA 3G6EA 4FF3A 3A8IE 2F0GA 4EGJA 3RAXA 5EWFA 4QW9A 3FMCA 3DTGA 5JOBA 4X65H 3PCOB 3FEWX 4CMDA 3NENA 4RU9A 4XYLB 1PVOA 3H40A 4BBSH 4IFDI 3VA5A 4E4TA 3QWNA 1STBA 2IWHA 1B50A 4DL2A 3T9CA 1LTID 1WTXA 2K32A 1IKMA 3U54A 2YZNA 2NZHA 1BGWA 4NXNL 3NP8A 2KECA 5M3FH 4O84A 2NVQH 1GUGA 5FO7B 1YHBA 3GQBA 2V59A 4GNXB 2ALZA 1S0NA 5GQOA 2JA8B 1RJQA 1GKHA 4EBDA 3X3MA 5E1FA 3WWJA 5CA0F 2RQXA 1R9TH 4LF7H 3RN5A 4V0BA 4IUUA 3GTLB 3A55A 2YL2A 2KCMA 3G7LA 2WB1A 1NSNS 1A3TA 4DF7A 3DEOA 4P72A 4KMUC 1HR0Q 1B44D 5FK9C 2UXCL 1UUPA 2B29A 1JWMD 5C4XG 3CCVA 5KT6A 4HIMA 1TS3A 1W93A 1ZXTA 2QYZA 4YHHH 3L4JA 3VMMA 3SI8A 1P8LA 1SAPA 2AWNA 4C3HH 3MXPA 2ZJTA 1XMQH 1BNZA 4EYHB 2AMCB 4O7VA 5JVLA 1SFOH 3AQQA 3F2UA 4QUCA 2Z6KA 3W1BA 1RK6A 5I2YA 4A93H 1AH9A 1IOWA 2K14A 2E2IA 2CCZA
chains in the Genus database with same CATH topology
4AIMA 4JI0Q 1SROA 2WB1G 4JI6L 5JJKA 4B3MH 3STBD 1PH9A 4APVA 1LM0A 4B3RH 3ZJYC 1WFQA 4J15A 1L2ZA 1XNQQ 2VOBA 2HGSA 5C44G 3PIOA 4DR4H 3GDEA 4RB3C 4MV9A 2ZTCA 4OWWB 4EFBA 4MTNA 4JYAL 1YNXA 1FJGQ 4OO1I 2JEBI 1Z2PX 1VCIA 5IYCG 1EIYB 1PH5A 1Z9FA 3PUYA 1HZCA 2VQFH 1A8VA 4JI3L 2EIFA 3H15A 5A2QW 4UCSA 4LF8H 2CWPA 3UQ8A 3UE0A 1DGSA 2V1CC 1JE5A 4B3SL 1XPUA 3ULJA 5C4XH 4IOAA 2UXCQ 1HZAA 2F4VQ 2C35B 1TAEA 2WAQG 1N32L 3UDXA 1PH1A 3L0OA 5BR8L 4HJ8A 4QIWE 4BY1G 2PNHA 1JJGA 4GKKH 5C44H 1PYSB 2ZTEA 2R93G 5IYCH 4EEQA 3M3YH 4BWSC 3F8TA 2JA6G 4RB1A 4GKJQ 5LL6b 1PV4A 4DR5Q 1TWGH 1PH6A 4JI3Q 3PF5A 1XTDA 1HNXH 1BVSA 5LMUQ 1VQMA 4ALPA 4MNOA 1VQEA 4UCRA 4A3BG 3H3VI 4AH6A 4C3IH 1AN7A 2IX1A 2Z0SA 5FD6A 3CCQA 4DR3L 1J5EH 1VQIA 4DAMA 2MNAA 1I3QH 2UUAQ 2OWOA 4GN4B 4R4TA 4K0KQ 4WJ4A 2BH2A 4DUYH 3TS2A 3KF6A 4BY1H 4MTEA 3S1QH 1XNRL 2HIVA 4DRFA 5BR8Q 2Y0SG 3H3VH 1YHAA 4DR2L 4POGA 2R93H 2AWOA 4AYBG 3L7ZC 1PHJA 4NXML 2NZOA 2VZAA 2EQSA 1UE1A 2E5LH 5GAHC 2UUBQ 3M4IA 4BA2I 2VW9A 2JA6H 4DAYB 2R7DA 4A3IG 4IJLA 2RHQB 4Q0YA 1SLJA 3D31A 5K36G 4AQYH 4R7RA 1PH8A 1N34H 1VQJA 2BA1A 3KDFB 4A3BH 4A3LG 4OWXB 4RB2C 1KIXA 4QL5A 2A1AA 2GVBA 1PH4A 3RNUA 2YTVA 3HOUG 1AE3A 4PZ7A 4BY7G 5FPRA 1P16A 1QVCA 4DK6C 1E3PA 1ASZA 1J6QA 2RGVA 1KC8C 3L4KA 2K4KA 4DUZH 1K0RA 3ULPA 5JJLA 4KLKA 1CKNA 3KAKA 2JA7G 3J7ZC 1TWAH 1NMGA 1C0AA 2VS1A 4WJ3M 3VNNA 5H1SE 1HNWH 3PGZA 4TQUS 1X3EA 1LUZA 5M3MG 1XNRQ 3RLNA 2R92G 3CMEA 1EOVA 3U4ZA 3CCEA 3GTJH 2A19A 2LXKA 3M4OH 2CFMA 4X62L 1PFSA 4A3IH 4DV0L 4DV3L 4KHPH 3S14H 1B04A 5C0XJ 3JSNA 3AFPA 3CD6A 1KXLA 4R4OA 4J0MA 4DV7H 3GTQH 1M90C 4A3LH 4R1JA 1IBKL 4LF6H 3KJPA 4CC6A 1HH2P 3CAMA 2ZJRA 1L1OC 3F8NA 4LFAH 1HNZL 3HOUH 1MJEA 4BY7H 2UXBL 2KHJA 3K0XA 1ZHQA 2UXDL 5JEAG 3E9HA 2UU9L 2WE6A 4C3JH 2JA7H 4LF4H 4JBKA 3RGXA 4Y7NH 1SEIA 2IHEA 1MZBA 5LMNW 4O0AA 5M3MH 4YHHQ 2XTIA 1L1OA 1BBWA 4XTCS 3ERSX 1NMFA 4YY3L 1IBLH 2MCTA 3M85A 3A5ZB 4IJHA 2VPSA 2IX0A 2W57A 2Q2TA 3OTOQ 4GLXA 4DV0Q 4DV3Q 1Y1WG 4B3RQ 4DV6L 4IO9A 2OQKA 3PO3G 4LF5H 4DV5H 4OONA 3HOZG 4DR4Q 1GO3E 4B3TH 5HY6A 3PIPA 1IBKQ 1N36H 2UUCL 4ETSA 1YVCA 2WDTA 4OX9H 1RL2A 2YV5A 4JI4L 4DR3H 2I5MX 5C0XI 2DGYA 4L5QA 2UXDQ 3I4OA 2PQAB 3S2DH 3S24A 2UU9Q 3HKZE 1EQQA 1SRUA 1FVIA 1N9WA 1MKHA 1HJPA 2VUMG 3D0FA 1E24A 3PUWA 2K5NA 3RLFA 4DV2H 3BAAA 4DR6H 4OXPA 5HGQA 1YIJA 3N43B 3BU2A 3JAMi 3U50C 3T1HQ 4YY3Q 1Y1WH 1OTCA 1FJGL 3PO3H 2F52A 2KSWA 3MXNB 3J80c 3PUXA 4GKKQ 4LFCH 4DV6Q 3LGJA 3HOZH 1YHQA 2CW7A 3EN2A 3A5UA 2K52A 1EYGA 2YTYA 4DV4H 4LF9Q 3A74A 3M9BA 2UUCQ 1I6HH 4JBJA 1VQ7A 1Y1VG 3JSLA 3BZCA 1GD7A 1OXSC 3N6XA 1HNXQ 3KLWA 4JI4Q 1ZHSA 4RAYA 4FDBA 1Q46A 3GO5A 2F4VL 3S1MH 1XDNA 1UEBA 3HFZB 1VQ4A 1MIUA 4YWKA 1L0WA 2VUMH 4OO1G 1B8AA 1W2BA 1J5EQ 3I4NH 1S68A 4HJAA 4A3JG 1OXVA 3CC4A 1D7QA 4GN5A 1V43A 4HJ5A 4GS3A 2D62A 3SGIA 1X56A 4LFBH 5IWAH 3M4PA 3J80W 1C7YA 5D1OB 3FMAA 1E7ZA 4GOPB 2IY5B 3CCRA 2KCTA 4GN3B 3I4MG 4DR7H 4A3DG 4GKJL 5FLMG 3G71A 4DR5L 4HIDA 4A3CG 1VQAA 4A3KG 4UPAA 4C2MH 5LMUL 4JI8L 2CW8A 1NY4A 3F2DA 2Q2UA 2YCHA 1YJWA 1Q1EA 3RZOH 4JI7H 4AQYQ 3T1YL 3E0EA 1T9HA 1M1KC 4DV1H 5E7NA 4X64L 4LW1A 4P71A 3EBEA 3S16H 1YEZA 3K3VA 2UUAL 4JC0A 4K0KL 2ATWA 4JI1L 1X9NA 2ZM6H 4X66L 1G51A 3KDFA 2VQEL 4UP7A 4DUZQ 1U5KA 2ZJQA 2MO0A 5IY0A 1XMOH 4EQ5A 1N33L 4UP8A 2N8NA 3H0GG 5LMNL 2KENA 2E2IH 4IPGA 4A2AA 3I4MH 2UUBL 1IZ6A 1JJCB 4A3EG 3I2ZA 4A3DH 2E2JH 5FLMH 3J81c 2RCNA 3M7NA 1Z2NX 4A3CH 3DLLA 2IT1A 4IPDA 1ASYA 2FXQA 3NC0B 4JI8Q 4KHPQ 2RHSB 3N40P 4JI5H 4HIOA 4DV7Q 1LYLA 3T1YQ 2E2HH 4JBMA 1X6OA 1H95A 4X64Q 2JE6I 1I94H 4E6NA 1HR0H 2CQOA 1TXYA 1GYFA 3PUVA 4DR1L 4LFAQ 1XJVA 3CPFA 3KAJA 1S3OA 4JI1Q 3UDFA 5M5XH 1WYDA 1VQ8A 4JI0H 1I6UA 4X66Q 3S17H 2VQEQ 4JI2L 1IBMH 3H0GH 2O03A 3CQZH 1N33Q 3J81W 1CSQA 4A75A 1XNQH 5LMNQ 4LMYA 3S1NH 4JV5L 3GTOH 5DLQE 4UCUA 1UE5A 4A3FG 1QUQB 2OTJA 2JQOA 2ID0A 1IBLQ 3GTMH 2CWAA 1QZGA 2HHHL 4KHZA 1X3FA 1IXRA 2XIGA 1U0LA 4H02A 2L15A 4BXXG 2HVSA 4RB0A 4NXNH 3GTGH 3K7UC 4X65L 3WWVA 5ELNA 2HQLA 4DV5Q 1YBYA 4X6AH 4R4QA 4MZ9A 4YCWA 3UDIA 2JA5G 4Y52H 1Q7YC 3GTPH 2K5HA 1Q86C 3N41B 1VQNA 5EAYA 3CC2A 2UXCH 2YU9H 2ES2A 2F4VH 5FD5A 4JOIC 4LF7L 1VQGA 4DR1Q 1QZHA 1S03G 1L2FA 4YHHL 3UE1A 3CC7A 1XMQL 1K8AC 2WYOA 1BJTA 1UE7A 5M5WH 4JI6H 2CKZB 4NPSA 3DF7A 4JI2Q 3HKSA 4IAJA 5IT9c 4A3MG 4YCVA 4UCTA 2K50A 1UE6A 4B3ML 4LH7A 3KALA 3OTOL 1WCMG 1PH7A 3CCJA 4B3RL 4DV2Q 3AYHB 4JV5Q 3HOWG 3HOYG 1HZBA 3G4SA 3S15H 4JYAH 1EIFA 4DR4L 4RZQA 1XPRA 5GADC 4JI3H 1IL2A 1TWCH 4BXXH 1B7YB 2HHHQ 3KJOA 5J3BA 1G291 3ULLA 2VQFL 3F1ZA 1M0WA 4GNXC 2QA4A 1VQCA 3K81C 3U58A 1MJCA 4X65Q 2JA5H 4LF8L 1KL9A 4DV4Q 5ELOA 4R4CA 1VQBA 4B3SH 3KF6B 3PF4A 4FM9A 1C9OA 4K0KH 4LF7Q 1SR3A 1O7IA 1BKBA 1N32H 1X55A 1SYXB 2ASBA 1GVPA 5IT9W 1UWVA 1XMQQ 4GNXA 3NEMA 1E4GT 2R92H 5BR8H 3RJ0A 4A3MH 3NBYB 3T1HL 1Q8KA 3TREA 1WJJA 4A4IA 3GJXB 4IFDJ 1CSPA 3HOWH 4B3MQ 3HOYH 1NBWA 4KI0A 4GKKL 1KD1C 5C0XG 2JA8G 4MTDA 4LFBQ 3RLOA 3RR5A 3PV0A 4DPGA 4I7HA 1IYJB 4LF9L 5GAGC 2H5XA 4DR7Q 5C4JH 2VQFQ 2VL6A 5D1OA 1CKNB 3L2PA 1HNXL 2HVRA 1JJ2A 1Y14B 4LF8Q 2WFWA 3RGZA 3ICEA 2R7FA 4L5RC 4LSXA 5IYDG 4YCUA 5M3FG 3QWUA 1J5EL 3BZKA 1S72A 1Q82C 1VQDA 4QY7A 1A63A 4BBRG 1XNRH 1I5FA 1QVGA 4LNQA 4DR2H 2WP8J 3CXCA 4NXMH 4EFEA 2I0QA 1E22A 3A0JA 1XPOA 3HKZG 5D1PA 2ZJPA 2QEXA 4QQBX 2YTXA 3KF8B 1WI5A 2DUDA 1Q1BA 1OXXK 3GTLH 1RIPA 2E5LL 4JG2A 3FP9A 4QGUA 4LUZA 2GN5A 2AKWB 3B6YA 4AQYL 1S40A 1N34L 1JMCA 3LMLA 2Z6KC 3J7A5 4GLAC 1K3RA 4JI5Q 5DISC 3F2CA 5IYDH 3HOXG 1AE2A 1KQSA 1L1OB 5AJ3L 3CW2C 3CCUA 2WB1E 2NVYH 1B70B 3E9IA 1CUKA 2VUGA 4IOCA 3S1RH 3KFUA 4DK3C 1TA8A 1I94Q 4DUZL 4BBRH 1GM5A 3K8AA 4LH6A 3CF5A 1W3SA 2JK8A 1V9PA 3CPWA 3W5OA 1EUJA 4PG3A 2A8VA 3I55A 2VNUD 3TEHB 4DUYQ 1HNWL 3FKIG 2VY3A 2D0OA 4X62H 3OTOH 4DV0H 4DV3H 1IBMQ 2QGQA 3AEVA 1QVFA 4APMA 3TRZA 4JBWA 2E5LQ 4JCVE 4KHPL 1Q12A 3J81j 3PSIA 4RG1A 2K5VA 1E1TA 1Y1VH 1IBKH 4DV7L 1VQFA 1FL0A 4DNIA 1N34Q 2NVTH 1I50H 2NN6G 5FJ8G 5GAEC 3M4QA 1HNZH 4LF6L 2IHFA 3HOXH 3TY5A 2UXBH 3BA8A 2WAQE 4P73A 3J80i 4POFA 2JJQA 1QUQA 2D0PA 3FHWA 4LFAL 3GTKH 2UXDH 4NXNQ 3BA9A 2UU9H 4A3JH 5AJ3Q 3UDGA 1VQ5A 3NELA 3Q8DA 4LF4L 2NN6I 3U4VA 1Z2OX 5IP7G 3FKIH 3T1HH 4YY3H 1HNWQ 3I56A 4JI6Q 4L5SA 3F2BA 4A3KH 4DV6H 1IBLL 3BABA 4LSAA 1VS0A 5IYBG 4LF9H 5IE8A 4LF5L 2KHIA 3K7AH 3MWMA 4DV5L 2UUCH 4JYAQ 1YI2A 5FJ8H 4B3TL 4EX5A 1VQKA 3C0FB 2MO1A 1N36L 4LF6Q 3CVZA 4LWCA 4JI4H 1CKOA 1HR0W 3TQYA 3CP0A 3W1GA 2HIXA 2B63G 4OX9L 1WH2A 3GB8B 1NE3A 3S2HH 2LXJA 2Y0SE 3KXYT 4L5TA 1K9MC 2N3SA 4A3GG 4AYBE 4B3SQ 2EXDA 3OW2A 3GD7A 5IP9G 3TY9A 2BA0A 2ALYB 2Q2IA 4HJ9A 4LF4Q 5IP7H 2Q2HA 4A3EH 1N8RC 1N32Q 3CCMA 4DV2L 4DR6L 4NB3A 1K83H 2OQ0A 2GVAA 3STBC 3CCSA 1FJGH 4TVAB 2JEAI 1X54A 4CC5A 1E1OA 4UFZA 2R7ZG 5IYBH 3DM3A 4UP9A 1VQPA 1EFWA 4A2BA 4PZ8A 4LFCL 1SMXA 3N44B 4QJFA 4LF5Q 3I7FA 1PYBA 2AHOB 4DV4L 4B3TQ 4IPHA 1FKAH 5FLXc 3PO2G 4O2DA 3J81i 3EIVA 3KOJA 4PDBA 1N36Q 4BA1I 3VDYA 2B63H 4DKAC 3TS0A 1X65A 2R6GA 3AFQA 1VQHA 2RF4A 4OX9Q 1EQRA 2N49A 4A3GH 4ME3A 1TWFH 2HT1A 4DR3Q 1Q81C 5IP9H 5JEAJ 5C3EG 3H20A 1E4FT 1JT8A 4MV7A 1D8LA 2NVXH 1SE8A 2YYZA 4UCOA 4PZ6A 4P75A 1G6PA 1K8GA 4A3FH 4DR6Q 2PQAA 4LFBL 4JOIA 5IWAL 4A76A 2R7ZH 3ER0A 3NBHB 4GKJH 4DR2Q 4LUOA 4NXMQ 4DR5H 4DR7L 5FPOA 1Z47A 3MEFA 4UCVA 4M7EA 3HOVG 1FGUA 5LMUH 4JI8H 4HIKA 5FLXW 4LFCQ 3G48A 1KHIA 2I5HA 2LSSA 3IG0A 3T1YH 1PH3A 1OXUA 2JA9A 3PO2H 4X64H 1VQOA 1PH2A 4UY8C 1YJ9A 1X3GA 3J7AK 4YWMA 4R4IA 4JI7L 3HXLA 5JJIA 3TY8A 5EOYA 3CMAA 4DV1L 1M0TA 2UUAH 2I5LX 4JI1H 1CKMA 3KYHC 3JAMc 5GROA 5C3EH 3N42B 1LTLA 2XGTA 4X66H 1VQ9A 3EYYA 2VQEH 2RGRA 3OYYA 4RAZA 5M5YH 2ZM6L 1N33H 3RIZA 1WCMH 1O75A 3K80C 1KRTA 4GOPC 2MQHA 5LMNH 2UUBH 1XMOL 1YJNA 3IRBA 1VQ6A 2K75A 1K73C 2PI2E 5IWAQ 1JB7A 1BBUA 2E8GA 3JC66 3HOVH 1YITA 2PI2A 4X62Q 3PUZA 3CCLA 1V1QA 4RMFA 2OTLA 3NBZB 4GOPA 3RF2A 3RZDH 4IPCA 1A62A 4JI5L 4HJ7A 4P74A 4BBSG 1KAWA 4LUVA 3RTXA 3JAMW 2OCEA 4JI7Q 2F3IA 1XK5A 4PMWA 4DV1Q 4DR1H 4XIGS 1HNZQ 2MFIA 1HZ9A 2N78A 1I94L 1HR0L 3BJUA 2BH8A 2UXBQ 1A0IA 1SN8A 1WOCA 2ZTDA 4OWTB 4JI2H 4DUYL 1PA6A 4GLVB 4JI0L 2ZM6Q 3PN1A 4A93G 3I4NG 1OXTA 1EWIA 1IBML 4IFDG 2JA8H 3RN2A 4JV5H 1TWHH 1XMOQ 1XNQL 2KBNA 2B3GA 1NTGA 1KRSA 1NJIC 1VQLA 1YZ6A 2PMZE 2FE3A 2HHHH 4YWLA 2HVQA 3G6EA 4X65H 3PCOB 3NENA 1PVOA 4BBSH 4IFDI 2NZHA 1BGWA 4NXNL 5M3FH 2NVQH 1YHBA 4GNXB 5GQOA 1GKHA 1R9TH 4LF7H 3RN5A 2KCMA 4P72A 1HR0Q 2UXCL 2B29A 5C4XG 3CCVA 4HIMA 4YHHH 3L4JA 1P8LA 4C3HH 2AWNA 2ZJTA 1XMQH 2AMCB 1SFOH 3AQQA 2Z6KA 3W1BA 4A93H 1AH9A 2K14A 2CCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIM A;  2UUC L;  4EX5 A;  1VQK A;  4JI0 Q;  1SRO A;  2WB1 G;  4JI6 L;  5JJK A;  4JI2 Q;  3HKS A;  5IT9 c;  1YVC A;  2MO1 A;  1N36 L;  4A3M G;  4LF6 Q;  3STB D;  4YCV A;  1PH9 A;  4UCT A;  4APV A;  1LM0 A;  2K50 A;  4LWC A;  3ZJY C;  1CKO A;  1UE6 A;  1HR0 W;  4B3M L;  3TQY A;  1WFQ A;  4LH7 A;  3CP0 A;  4J15 A;  1WCM G;  2HIX A;  3W1G A;  1RL2 A;  2YV5 A;  3OTO L;  1PH7 A;  3CCJ A;  4B3R L;  4DV2 Q;  4JI4 L;  2B63 G;  1XNQ Q;  3AYH B;  4OX9 L;  4JV5 Q;  3HOW G;  5C44 G;  3PIO A;  2I5M X;  3HOY G;  1HZB A;  1NE3 A;  3GB8 B;  3GDE A;  3G4S A;  5C0X I;  3S2H H;  2DGY A;  4L5Q A;  3S15 H;  2UXD Q;  2ZTC A;  4OWW B;  3I4O A;  2LXJ A;  2PQA B;  1EIF A;  2Y0S E;  3S2D H;  4DR4 L;  3S24 A;  1XPR A;  4L5T A;  4EFB A;  1K9M C;  2UU9 Q;  2N3S A;  4MTN A;  3HKZ E;  1EQQ A;  4A3G G;  1SRU A;  1YNX A;  4AYB E;  5GAD C;  1FVI A;  1N9W A;  1MKH A;  2JEB I;  4B3S Q;  1HJP A;  1VCI A;  1FJG Q;  2EXD A;  4OO1 I;  5IYC G;  3OW2 A;  3GD7 A;  5IP9 G;  1EIY B;  2VUM G;  1IL2 A;  1PH5 A;  1Z9F A;  1TWC H;  3PUY A;  3TY9 A;  1HZC A;  4BXX H;  1A8V A;  1B7Y B;  2BA0 A;  2HHH Q;  2ALY B;  2Q2I A;  4JI3 L;  3KJO A;  3D0F A;  5J3B A;  4HJ9 A;  1G29 1;  3ULL A;  1E24 A;  5IP7 H;  4LF4 Q;  2EIF A;  3PUW A;  2VQF L;  2Q2H A;  3F1Z A;  2K5N A;  3RLF A;  3H15 A;  4A3E H;  3BAA A;  4UCS A;  4GNX C;  1N8R C;  1N32 Q;  2QA4 A;  1VQC A;  3K81 C;  2CWP A;  4OXP A;  1MJC A;  5HGQ A;  3CCM A;  3U58 A;  4DV2 L;  4X65 Q;  2JA5 H;  3UQ8 A;  4LF8 L;  4DR6 L;  1YIJ A;  1KL9 A;  3UE0 A;  3BU2 A;  4NB3 A;  3JAM i;  4DV4 Q;  1K83 H;  5ELO A;  2OQ0 A;  1DGS A;  2V1C C;  4R4C A;  2GVA A;  1JE5 A;  3STB C;  1VQB A;  3U50 C;  3CCS A;  3KF6 B;  3T1H Q;  4TVA B;  4YY3 Q;  1Y1W H;  2HT1 A;  2JEA I;  1X54 A;  3PF4 A;  4CC5 A;  1OTC A;  1E1O A;  4B3S L;  1XPU A;  3ULJ A;  5C4X H;  1FJG L;  3PO3 H;  4UFZ A;  2F52 A;  2R7Z G;  5IYB H;  3DM3 A;  3MXN B;  1C9O A;  4UP9 A;  3J80 c;  4IOA A;  4LF7 Q;  3PUX A;  4GKK Q;  4DV6 Q;  1VQP A;  1SR3 A;  1O7I A;  3LGJ A;  3HOZ H;  1YHQ A;  1EFW A;  2UXC Q;  1HZA A;  1BKB A;  1X55 A;  4PZ8 A;  2F4V Q;  2ASB A;  1GVP A;  4LFC L;  1SMX A;  3EN2 A;  3A5U A;  1UWV A;  2C35 B;  2K52 A;  2WAQ G;  4QJF A;  1N32 L;  1EYG A;  1TAE A;  2YTY A;  4LF5 Q;  3UDX A;  3I7F A;  4LF9 Q;  1PYB A;  1XMQ Q;  4GNX A;  3NEM A;  1PH1 A;  2R92 H;  2AHO B;  3L0O A;  3A74 A;  4DV4 L;  4A3M H;  3NBY B;  3M9B A;  4B3T Q;  2UUC Q;  4IPH A;  1I6H H;  5BR8 L;  4JBJ A;  1VQ7 A;  1Y1V G;  5FLX c;  3PO2 G;  3T1H L;  4O2D A;  1Q8K A;  3TRE A;  3EIV A;  1WJJ A;  4A4I A;  3KOJ A;  3J81 i;  3JSL A;  4HJ8 A;  1N36 Q;  4BA1 I;  4QIW E;  4BY1 G;  3BZC A;  2PNH A;  3VDY A;  1GD7 A;  2B63 H;  1JJG A;  4IFD J;  1CSP A;  3HOW H;  4DKA C;  1OXS C;  1PYS B;  5C44 H;  3TS0 A;  2ZTE A;  1HNX Q;  4B3M Q;  3HOY H;  1X65 A;  1NBW A;  2R6G A;  2R93 G;  4KI0 A;  3KLW A;  3AFQ A;  4GKK L;  1KD1 C;  1VQH A;  4JI4 Q;  2RF4 A;  4OX9 Q;  4FDB A;  5C0X G;  2JA8 G;  1EQR A;  1Q46 A;  3GO5 A;  2N49 A;  2F4V L;  3S1M H;  3RLO A;  3RR5 A;  4A3G H;  4LFB Q;  4ME3 A;  1XDN A;  1UEB A;  1TWF H;  3HFZ B;  3PV0 A;  4DPG A;  1MIU A;  4YWK A;  4DR3 Q;  5IYC H;  1VQ4 A;  1IYJ B;  5IP9 H;  1L0W A;  1Q81 C;  2VUM H;  5JEA J;  4LF9 L;  4EEQ A;  5GAG C;  4OO1 G;  3M3Y H;  5C3E G;  1B8A A;  3F8T A;  1W2B A;  2JA6 G;  1J5E Q;  4GKJ Q;  1JT8 A;  2H5X A;  4DR7 Q;  3I4N H;  1S68 A;  1D8L A;  4HJA A;  4A3J G;  1OXV A;  1PV4 A;  3CC4 A;  1D7Q A;  5C4J H;  2NVX H;  4DR5 Q;  1SE8 A;  4GN5 A;  1TWG H;  2YYZ A;  1PH6 A;  4JI3 Q;  1V43 A;  3PF5 A;  1XTD A;  1BVS A;  5LMU Q;  1VQM A;  4HJ5 A;  4UCO A;  4PZ6 A;  2VQF Q;  2VL6 A;  4P75 A;  4ALP A;  5D1O A;  4MNO A;  1CKN B;  1VQE A;  4GS3 A;  2D62 A;  3SGI A;  3L2P A;  1JJ2 A;  1HNX L;  1G6P A;  2HVR A;  1K8G A;  1X56 A;  1Y14 B;  4A3F H;  4UCR A;  4A3B G;  3H3V I;  4AH6 A;  4LF8 Q;  2WFW A;  4C3I H;  4DR6 Q;  3M4P A;  2PQA A;  1C7Y A;  5D1O B;  4LFB L;  4JOI A;  5IWA L;  4A76 A;  1E7Z A;  2Z0S A;  4GOP B;  2IX1 A;  3ICE A;  2IY5 B;  3CCR A;  2KCT A;  3CCQ A;  4DR3 L;  2R7F A;  3ER0 A;  3NBH B;  4GN3 B;  4L5R C;  2R7Z H;  3I4M G;  4DR2 Q;  1VQI A;  5IYD G;  4YCU A;  4LUO A;  4DAM A;  4NXM Q;  4A3D G;  5M3F G;  2MNA A;  4GKJ L;  3QWU A;  1I3Q H;  1J5E L;  5FLM G;  4DR7 L;  5FPO A;  1Z47 A;  3G71 A;  3MEF A;  4UCV A;  3HOV G;  1FGU A;  4DR5 L;  4HID A;  3BZK A;  4A3C G;  3S1Q H;  1VQA A;  4HIK A;  2UUA Q;  4A3K G;  4UPA A;  1S72 A;  2OWO A;  4GN4 B;  4R4T A;  4K0K Q;  4C2M H;  5LMU L;  4JI8 L;  1Q82 C;  4LFC Q;  1VQD A;  4WJ4 A;  2BH2 A;  3G48 A;  1NY4 A;  3F2D A;  1KHI A;  4QY7 A;  2I5H A;  2LSS A;  1A63 A;  4BBR G;  2Q2U A;  1YJW A;  1PH3 A;  1OXU A;  1Q1E A;  2JA9 A;  3PO2 H;  3TS2 A;  3KF6 A;  3RZO H;  1I5F A;  1QVG A;  4LNQ A;  4BY1 H;  2WP8 J;  4AQY Q;  1VQO A;  3CXC A;  1PH2 A;  3T1Y L;  3E0E A;  1T9H A;  2HIV A;  1M1K C;  1YJ9 A;  4UY8 C;  1XNR L;  1X3G A;  4DRF A;  4YWM A;  4R4I A;  5BR8 Q;  4JI7 L;  2Y0S G;  2I0Q A;  1YHA A;  1E22 A;  3H3V H;  4EFE A;  5E7N A;  4X64 L;  4DR2 L;  3A0J A;  4LW1 A;  4POG A;  1XPO A;  2R93 H;  3HKZ G;  2AWO A;  5JJI A;  5D1P A;  4AYB G;  3TY8 A;  3L7Z C;  1PHJ A;  4P71 A;  4NXM L;  3EBE A;  2NZO A;  3CMA A;  4DV1 L;  2ZJP A;  2QEX A;  2VZA A;  2EQS A;  2YTX A;  3KF8 B;  3S16 H;  1WI5 A;  4QQB X;  1YEZ A;  1UE1 A;  2I5L X;  2DUD A;  1Q1B A;  1OXX K;  5GAH C;  2UUB Q;  3GTL H;  2UUA L;  4BA2 I;  1RIP A;  2VW9 A;  1CKM A;  3KYH C;  4JG2 A;  4JC0 A;  3JAM c;  2E5L L;  4K0K L;  5GRO A;  5C3E H;  3FP9 A;  2JA6 H;  4DAY B;  2R7D A;  4QGU A;  4A3I G;  4IJL A;  2ATW A;  2RHQ B;  4JI1 L;  1SLJ A;  1LTL A;  4LUZ A;  2XGT A;  3D31 A;  2GN5 A;  1VQ9 A;  5K36 G;  1X9N A;  1PH8 A;  4X66 L;  2AKW B;  1VQJ A;  3OYY A;  1G51 A;  3KDF A;  3B6Y A;  3GJX B;  2BA1 A;  4AQY L;  1S40 A;  5M5Y H;  2VQE L;  2ZM6 L;  4UP7 A;  1N34 L;  4DUZ Q;  1JMC A;  1WCM H;  1U5K A;  2ZJQ A;  2MO0 A;  3KDF B;  5IY0 A;  4A3B H;  4A3L G;  3K80 C;  1KRT A;  4OWX B;  2MQH A;  4EQ5 A;  4GOP C;  5FPR A;  1N33 L;  1KIX A;  4UP8 A;  2Z6K C;  4QL5 A;  2A1A A;  3J7A 5;  2GVB A;  2N8N A;  4GLA C;  3H0G G;  5LMN L;  1YJN A;  2KEN A;  1XMO L;  4IPG A;  1PH4 A;  2E2I H;  3IRB A;  1VQ6 A;  3I4M H;  2UUB L;  1IZ6 A;  2K75 A;  3RNU A;  1K73 C;  1K3R A;  4JI5 Q;  1JJC B;  3F2C A;  4A3E G;  2YTV A;  5IYD H;  5DIS C;  3I2Z A;  3HOX G;  2PI2 E;  2E2J H;  4A3D H;  5IWA Q;  1AE2 A;  1AE3 A;  3RZD H;  5FLM H;  1KQS A;  3HOU G;  1JB7 A;  1BBU A;  1L1O B;  2E8G A;  4PZ7 A;  3CW2 C;  3JC6 6;  5AJ3 L;  3J81 c;  2RCN A;  3CCU A;  2WB1 E;  3HOV H;  3M7N A;  4BY7 G;  1P16 A;  1QVC A;  2NVY H;  4DK6 C;  1B70 B;  1YIT A;  4A3C H;  3E9I A;  2PI2 A;  1E3P A;  1CUK A;  1ASZ A;  3DLL A;  2VUG A;  1J6Q A;  1KC8 C;  2K4K A;  4IOC A;  4JYA L;  2IT1 A;  4X62 Q;  1K0R A;  3ULP A;  3PUZ A;  3S1R H;  3KFU A;  4IPD A;  5JJL A;  4DK3 C;  1ASY A;  3CCL A;  4KLK A;  1TA8 A;  1I94 Q;  1CKN A;  4DUZ L;  2FXQ A;  2JA7 G;  3NC0 B;  4BBR H;  1GM5 A;  4JI8 Q;  4KHP Q;  1V1Q A;  3K8A A;  3J7Z C;  1TWA H;  3CF5 A;  4LH6 A;  1W3S A;  4RMF A;  1NMG A;  2JK8 A;  2RHS B;  1V9P A;  2OTL A;  1C0A A;  3CPW A;  3NBZ B;  4GOP A;  2VS1 A;  4WJ3 M;  3VNN A;  3W5O A;  1EUJ A;  4PG3 A;  2A8V A;  4IPC A;  5H1S E;  1A62 A;  3I55 A;  4JI5 L;  4HIO A;  4P74 A;  3PGZ A;  4TQU S;  1X3E A;  4HJ7 A;  2VNU D;  1LUZ A;  1LYL A;  4DV7 Q;  5M3M G;  3TEH B;  1XNR Q;  4DUY Q;  3T1Y Q;  2E2H H;  1KAW A;  4LUV A;  4JBM A;  4BBS G;  1HNW L;  3RTX A;  2OCE A;  3FKI G;  4JI7 Q;  2F3I A;  1XK5 A;  4PMW A;  1X6O A;  2VY3 A;  1H95 A;  4X64 Q;  3RLN A;  2R92 G;  2D0O A;  3CME A;  2JE6 I;  1EOV A;  3U4Z A;  3CCE A;  4DV1 Q;  1IBM Q;  3GTJ H;  2A19 A;  4E6N A;  2LXK A;  3M4O H;  4XIG S;  2CFM A;  4X62 L;  2CQO A;  1HNZ Q;  1PFS A;  4A3I H;  2MFI A;  1TXY A;  4DV0 L;  2QGQ A;  1HZ9 A;  4DV3 L;  2N78 A;  3AEV A;  3PUV A;  4DR1 L;  1I94 L;  1HR0 L;  1QVF A;  3S14 H;  1B04 A;  3TRZ A;  4LFA Q;  4JBW A;  5C0X J;  3BJU A;  2BH8 A;  2E5L Q;  1XJV A;  2UXB Q;  1A0I A;  4JCV E;  4KHP L;  3JSN A;  3AFP A;  1Q12 A;  3CPF A;  3J81 j;  3CD6 A;  1S3O A;  4JI1 Q;  3UDF A;  1KXL A;  4R4O A;  5M5X H;  3PSI A;  1SN8 A;  1WYD A;  2K5V A;  4RG1 A;  3GTQ H;  1E1T A;  1VQ8 A;  1Y1V H;  1WOC A;  2ZTD A;  1M90 C;  4OWT B;  4X66 Q;  4A3L H;  4R1J A;  4DV7 L;  1VQF A;  1FL0 A;  3S17 H;  4DUY L;  1IBK L;  2VQE Q;  4DNI A;  1PA6 A;  4GLV B;  4JI0 L;  2ZM6 Q;  1N34 Q;  3KJP A;  3PN1 A;  4JI2 L;  3H0G H;  4CC6 A;  2NVT H;  4A93 G;  1HH2 P;  1I50 H;  2NN6 G;  5FJ8 G;  3CAM A;  3M4Q A;  5GAE C;  4LF6 L;  3CQZ H;  2ZJR A;  3I4N G;  1OXT A;  1N33 Q;  1EWI A;  1CSQ A;  4A75 A;  1IBM L;  4IFD G;  2JA8 H;  3RN2 A;  1L1O C;  2IHF A;  3HOX H;  1TWH H;  1HNZ L;  3HOU H;  3TY5 A;  3BA8 A;  5LMN Q;  1XMO Q;  1MJE A;  2WAQ E;  4P73 A;  3S1N H;  3J80 i;  4POF A;  2JJQ A;  1QUQ A;  1XNQ L;  2KBN A;  4BY7 H;  2D0P A;  4JV5 L;  2B3G A;  3FHW A;  4LFA L;  1NTG A;  3GTK H;  1KRS A;  2UXB L;  3GTO H;  5DLQ E;  4NXN Q;  1NJI C;  4UCU A;  3BA9 A;  1UE5 A;  2KHJ A;  3K0X A;  1VQL A;  4A3F G;  1QUQ B;  1YZ6 A;  2OTJ A;  4A3J H;  5AJ3 Q;  2UXD L;  5JEA G;  2PMZ E;  2JQO A;  3E9H A;  2UU9 L;  4C3J H;  2JA7 H;  3UDG A;  4YWL A;  2ID0 A;  1IBL Q;  1VQ5 A;  4JBK A;  3NEL A;  3Q8D A;  2CWA A;  3GTM H;  2HVQ A;  3G6E A;  1QZG A;  2HHH L;  4KHZ A;  1X3F A;  1IXR A;  4LF4 L;  4Y7N H;  2IHE A;  1U0L A;  5LMN W;  4H02 A;  2NN6 I;  3PCO B;  3U4V A;  2L15 A;  4O0A A;  3NEN A;  5M3M H;  4BXX G;  2HVS A;  1PVO A;  4BBS H;  4IFD I;  4YHH Q;  3GTG H;  2XTI A;  3FKI H;  3K7U C;  3WWV A;  5ELN A;  2HQL A;  5IP7 G;  4X65 L;  4DV5 Q;  1L1O A;  1YBY A;  4X6A H;  2NZH A;  4NXN L;  4R4Q A;  1BBW A;  4MZ9 A;  5M3F H;  4XTC S;  3ERS X;  4YCW A;  2NVQ H;  1HNW Q;  3UDI A;  1YHB A;  3I56 A;  1NMF A;  4GNX B;  4JI6 Q;  2JA5 G;  5GQO A;  4Y52 H;  4YY3 L;  1GKH A;  1Q7Y C;  3GTP H;  4L5S A;  3M85 A;  3A5Z B;  3F2B A;  2K5H A;  4A3K H;  1R9T H;  1Q86 C;  3RN5 A;  4IJH A;  1VQN A;  5EAY A;  2IX0 A;  1IBL L;  3CC2 A;  2KCM A;  2Q2T A;  3OTO Q;  4GLX A;  2ES2 A;  2YU9 H;  3BAB A;  4JOI C;  4DV0 Q;  4DV3 Q;  1Y1W G;  4LF7 L;  4B3R Q;  4DV6 L;  1VQG A;  4P72 A;  4DR1 Q;  1QZH A;  1HR0 Q;  2UXC L;  4IO9 A;  2B29 A;  5C4X G;  2OQK A;  3PO3 G;  3CCV A;  1VS0 A;  4HIM A;  5IYB G;  5IE8 A;  1P8L A;  4C3H H;  2AWN A;  1L2F A;  4OON A;  4LF5 L;  2AMC B;  2KHI A;  3HOZ G;  3K7A H;  4YHH L;  1SFO H;  3UE1 A;  3CC7 A;  4DR4 Q;  1GO3 E;  3AQQ A;  1XMQ L;  1K8A C;  4DV5 L;  5HY6 A;  2Z6K A;  3W1B A;  3PIP A;  4JYA Q;  1YI2 A;  4A93 H;  5FJ8 H;  1UE7 A;  1AH9 A;  5M5W H;  2K14 A;  2CKZ B;  4B3T L;  2CCZ A;  4NPS A;  1IBK Q; 
#chains in the Genus database with same CATH topology
 3BVM A;  4AIM A;  3MWD A;  4JI0 Q;  1SE2 A;  1SRO A;  2WB1 G;  4JI6 L;  5JJK A;  3GIP A;  1WD1 A;  1DYQ A;  1TS2 A;  4L1K A;  5BYB A;  4B3M H;  3KUP A;  4BBS B;  3STB D;  1PH9 A;  4APV A;  1LM0 A;  4B3R H;  3ZJY C;  5IGB A;  5KFI A;  1WFQ A;  4J15 A;  3BVZ A;  5M3F B;  1L2Z A;  1JCK B;  1XNQ Q;  3NWS A;  5DNF A;  2VOB A;  2HGS A;  4RGO S;  1BF4 A;  5C44 G;  3PIO A;  2W6N A;  4KY7 A;  1KJJ A;  3GDE A;  2NVY B;  4RB3 C;  4UHV A;  4MV9 A;  1FYC A;  1RK5 A;  3SK8 A;  1WR2 A;  3D4R A;  4IQZ A;  1R9T B;  4J1M A;  4O81 A;  5CAE B;  1TWG A;  1KTK A;  1VDZ A;  3G6Y A;  1TS4 A;  2ZTC A;  4OWW B;  4Q4D A;  1PZI D;  5E4W C;  3V2T A;  4EFB A;  4MTN A;  2X6L A;  4JYA L;  1YNX A;  1FJG Q;  4OO1 I;  2A68 C;  2JEB I;  1VCI A;  1DON A;  1Z2P X;  2XCP A;  1WTO A;  5IYC G;  1EIY B;  1MGS A;  4BBR B;  5DGH A;  1PH5 A;  1Z9F A;  3G6X A;  3PUY A;  2W6Q A;  1HZC A;  2VQF H;  1A8V A;  4JI3 L;  2A73 B;  5KT7 A;  2IJ0 A;  4JV2 A;  2EIF A;  4ABN A;  1CFM A;  3H15 A;  2E2H A;  3SR1 A;  5A2Q W;  4UCS A;  4LF8 H;  1CTM A;  2X0S A;  3MWY W;  3TW6 A;  3HKZ B;  1STH A;  1CQI B;  5KNB A;  1HQR D;  2CWP A;  3GIJ A;  3O13 A;  4O7T A;  4DK0 A;  3UQ8 A;  4Q45 A;  1EEI D;  4FFM A;  3UE0 A;  4KN7 C;  4RHS A;  4FBU A;  1WTR A;  1DGS A;  2V1C C;  4MV6 A;  1JE5 A;  2WAQ A;  4ZI7 F;  1PRT B;  1IW7 D;  1Y8P B;  3NPP A;  4IR9 A;  4C3I G;  3VOT A;  2F03 A;  4QCL A;  4Q4C A;  4FNF A;  3M9O B;  5KFJ A;  1F9R A;  4B3S L;  1XPU A;  3ULJ A;  5C4X H;  1QNU A;  1EY6 A;  4QUF A;  3WWH A;  1R4P B;  3C1E A;  4IOA A;  1H9K A;  1PTO D;  3SNO A;  2KQ3 A;  2UXC Q;  1HZA A;  2F0L A;  2F4V Q;  5BYA A;  1I6V C;  3VPB A;  3QJY A;  3U9T A;  2C35 B;  1TAE A;  2WAQ G;  1N32 L;  3H0G A;  2W7P A;  2AUJ D;  3UDX A;  2NU8 B;  2MJ8 A;  3RMH A;  3KHG A;  3CQZ A;  3K5I A;  4GC6 A;  1B33 N;  1PH1 A;  3HEJ A;  2W9A A;  1DZ1 A;  4FE2 A;  4WBN F;  3L0O A;  2K05 A;  4IWY A;  3OHX C;  1I50 B;  3LP8 A;  5BR8 L;  3S9W A;  5DM7 3;  2FPG B;  1CQF A;  3HOX B;  3MFG A;  2ZDG A;  3I12 A;  4HJ8 A;  4QIW E;  4BY1 G;  2PNH A;  1JJG A;  2R8G A;  4ECQ A;  4GKK H;  3Q23 A;  3Q24 A;  5C44 H;  1PYS B;  5C1P A;  4ED3 A;  1LTB D;  1LLR D;  2KOL A;  2ZTE A;  3GTK B;  2R93 G;  5KG5 A;  2M00 A;  2ZDH A;  3HP3 A;  1SJH D;  3RB3 A;  3GTM A;  1LV9 A;  5IYC H;  4O7Z A;  4EEQ A;  1SNO A;  3M3Y H;  4BWS C;  1HRJ A;  4ED8 A;  3F8T A;  1HTL D;  4L6T B;  4N9T A;  2JA6 G;  4GKJ Q;  5LL6 b;  4RB1 A;  1X3Q A;  3ORQ A;  3IFD A;  1PV4 A;  4QWD A;  5M9O A;  2Y4R A;  4DR5 Q;  4O3O A;  1TWG H;  1PH6 A;  4JI3 Q;  2F0K A;  3PF5 A;  3UFX B;  1XTD A;  1HNX H;  1BVS A;  5LMU Q;  1VQM A;  5KIX A;  4ALP A;  4KV6 A;  4MNO A;  1VQE A;  1MBY A;  3GTP A;  2XNA C;  4KHV A;  2P5Z X;  4UCR A;  2SCU B;  4CDD C;  3H3V I;  4A3B G;  2BQ3 A;  4AH6 A;  4C3I H;  1AN7 A;  1Q90 A;  2ENB A;  4ED7 A;  2YU9 A;  2B8F A;  2BR0 A;  2IX1 A;  2Z0S A;  1BUV T;  5FD6 A;  3CCQ A;  4DR3 L;  1EU3 A;  1J5E H;  2B2T C;  5C44 B;  1VQI A;  1B53 A;  1LO5 D;  1C48 A;  3JAM L;  5KFO A;  3NK9 A;  4DAM A;  2MNA A;  1I3Q H;  2EYF A;  2WAC A;  2HDK A;  4O3P A;  3OPO A;  3OUZ A;  3T9F A;  3TIG A;  3E5S A;  2UUA Q;  3ITP A;  2OWO A;  4GN4 B;  2IW3 A;  5C4H A;  4R4T A;  4K0K Q;  4R8U B;  2R61 A;  4FXG C;  4YAJ B;  2PW7 A;  3R9R A;  4WJ4 A;  2BH2 A;  5LOV F;  1CQJ B;  3A7A B;  5LYJ F;  4LJZ C;  5KKN B;  3EPI A;  4DUY H;  4OIK A;  3TS2 A;  3KF6 A;  1J8I A;  4BY1 H;  2DLN A;  1XNR L;  3S1Q H;  4MTE A;  4F7X A;  5KFU A;  2HIV A;  4DRF A;  5EDW A;  2CH4 A;  5BR8 Q;  2Y0S G;  3H3V H;  1YHA A;  4NW2 A;  4DR2 L;  4POG A;  3TP6 A;  1EZ1 A;  3PW4 A;  1WTW A;  2R93 H;  2AWO A;  3RB0 A;  3DWP A;  3EFX D;  4AYB G;  3L7Z C;  1E2Z A;  1PHJ A;  4NXM L;  2NZO A;  2B2T A;  2VZA A;  2EQS A;  3MXU A;  1BNC A;  2JYO A;  4C3I B;  1UE1 A;  2E5L H;  5F9N A;  1BXT A;  5GAH C;  3DAA A;  2WTF A;  2UUB Q;  2KCN A;  3E0J A;  2I8C A;  3M4I A;  4BA2 I;  5HNE A;  5FLX E;  3TP8 A;  2VW9 A;  5FR9 A;  2B39 A;  2JA6 H;  1TWC A;  4DAY B;  2R7D A;  4A3I G;  5BPF A;  4IJL A;  4J9Q A;  2JEI A;  2ZGI A;  2RHQ B;  4Q0Y A;  3RBE A;  1SLJ A;  5C5L A;  2CHB D;  1I3Q B;  3D31 A;  2GPS A;  1JB3 A;  4FF4 A;  5K36 G;  4AQY H;  1PX2 A;  5KT3 A;  4R7R A;  3MR3 A;  1PH8 A;  2C2E A;  3NHH A;  1N34 H;  1QJO A;  4F4X A;  1G8Z D;  1VQJ A;  3URY A;  5KFC A;  1HCZ A;  2BA1 A;  4Z9C B;  2EY6 A;  2JA5 A;  5KYI A;  2FMC A;  1NCV A;  1HFG A;  5T14 A;  1G91 A;  3MFH A;  1VAJ A;  3KDF B;  3DWA A;  5KND A;  4A3B H;  4A3L G;  3T9E A;  4XDX A;  4OWX B;  4RB2 C;  5CE8 A;  3OWF A;  1KIX A;  3BQ1 A;  2A5H A;  2F1M A;  2HHF A;  3MAQ A;  2C2D A;  4QL5 A;  2A1A A;  2F0E A;  2GVB A;  2L9H A;  4K6L A;  1PH4 A;  4DXF A;  1EHI A;  2A6H D;  1K83 B;  2B2Y C;  3RNU A;  4O3Q A;  4ECS A;  2YTV A;  3K0Y A;  2SDF A;  5TSS A;  2R93 B;  4EGV A;  3PW0 A;  3HOU G;  1AE3 A;  4DL5 A;  4PZ7 A;  4BY7 G;  3PVX A;  2L5T A;  5FPR A;  3M9N B;  2NYZ D;  1P16 A;  1QVC A;  4DK6 C;  4O7N A;  5L1K A;  5HUR A;  1E3P A;  2EZV A;  1ASZ A;  1J6Q A;  2RGV A;  4QMG A;  1KC8 C;  3L4K A;  2K4K A;  4DUZ H;  2EJF C;  5KGU A;  1K0R A;  3ULP A;  5JJL A;  3E5N A;  1FNV A;  5JPN C;  2R7K A;  4KLK A;  2HJW A;  5EKI A;  1CKN A;  1GUS A;  3KAK A;  4C3J G;  3BQ2 A;  2R92 A;  2JA7 G;  2V4R A;  1KJQ A;  2ASJ A;  2FLP A;  2C5C A;  1DM0 B;  5JVH 3;  1NR2 A;  1TWA H;  1IKL A;  3ND9 A;  3J7Z C;  3T54 A;  3T9A A;  1NMG A;  1C0A A;  5KFY A;  2VS1 A;  4WJ3 M;  3VNN A;  4YR3 A;  2J6U A;  2GLT A;  2R3Z A;  5H1S E;  2HGW A;  3T9D A;  1HNW H;  1O80 A;  4ZLT F;  3PGZ A;  4TQU S;  1I4R A;  1X3E A;  2BE5 C;  4K5W A;  4KD3 A;  3Q2O A;  1LUZ A;  3NTI A;  5M3M G;  2B2Y A;  4YP3 A;  1XNR Q;  4CDE C;  2B63 B;  2LKV A;  1FNW A;  3NQT A;  3RLN A;  2R92 G;  2NU6 B;  3SK5 A;  5BN5 A;  3CME A;  1EY5 A;  3LX0 A;  4IZO A;  1EOV A;  3U4Z A;  3GIQ A;  1H9S A;  2EYM A;  3CCE A;  5LXT F;  3GTJ H;  2A19 A;  2LXK A;  3M4O H;  2CFM A;  4X62 L;  5D14 A;  1PFS A;  4A3I H;  3R5H A;  4DV0 L;  1CZW A;  4DV3 L;  1UAP A;  4A3G B;  4KHP H;  3S14 H;  1B04 A;  1TWF B;  2X69 A;  1ONL A;  5C0X J;  5K36 H;  1EY7 A;  3HB9 A;  4FYD A;  2QIL A;  1KEE A;  3JZI A;  3JSN A;  3AFP A;  2A6E C;  3CD6 A;  4U68 A;  1KXL A;  4R4O A;  4J0M A;  5KFG A;  3A56 A;  5HV6 A;  4DV7 H;  3GTQ H;  1MI2 A;  4MHE A;  2QCP X;  1EEF D;  4XZ3 B;  2PPB C;  1M90 C;  4FFL A;  4A3L H;  4R1J A;  3K5N A;  3BVG A;  4R9W A;  3JAM E;  1N56 A;  1IBK L;  3K5H A;  4LF6 H;  2QDB A;  2OXP A;  3KJP A;  2HD3 A;  3KF8 A;  5KG2 A;  4CC6 A;  1HH2 P;  2EJG C;  3CAM A;  3QG1 A;  2ZJR A;  1PK8 A;  4HCE A;  1EIH A;  5T1I A;  3GV8 B;  1L1O C;  3F8N A;  1VMP A;  1CS0 A;  4N9P A;  4MIU A;  1HNZ L;  4YJ2 F;  4G7Z C;  3HOU H;  4LFA H;  5A2Q L;  5DQG A;  1MJE A;  4J9M A;  4RUA A;  2E76 C;  4BY7 H;  4O7S A;  5JH7 F;  3R2T A;  4NMZ A;  2UXB L;  5JUM A;  1S0M A;  3SE7 A;  4DL4 A;  3HRZ C;  1JQY D;  1BQQ T;  2KHJ A;  3K0X A;  2LY7 A;  1QWY A;  2F0D A;  4RKB A;  3D8G A;  1HXY D;  2UXD L;  3M7G A;  4ODG A;  3GTJ B;  3CHB D;  1HUN A;  2FB9 A;  5BWT A;  1ZHQ A;  3JRX A;  5JEA G;  1S5E D;  3E9H A;  4A3I B;  3OMC A;  2UU9 L;  4C3J H;  2XRQ D;  2WE6 A;  4RUC A;  2JA7 H;  4H13 C;  3LUL A;  1PFN A;  2W6O A;  3ZYY X;  5DG9 A;  1AP0 A;  1EUD B;  4LF4 H;  1WRV A;  4JBK A;  1KJI A;  2DWC A;  3RGX A;  5JVD F;  3BYT B;  1T36 A;  2PQE A;  4Y7N H;  3I73 A;  1SEI A;  2IHE A;  2F0Q A;  1MZB A;  5LMN W;  3GTQ B;  1MSH A;  1HFN A;  3PO2 B;  4O0A A;  1JXL A;  5M3M H;  4BS9 A;  4ZYS A;  4YHH Q;  1QG7 A;  2XTI A;  5EJW A;  2HDM A;  1L1O A;  1RJT A;  1W6K A;  1G2T A;  3A7L A;  4KKT A;  1BCP D;  1BBW A;  2DN8 A;  2EY1 A;  2SEB D;  3ERS X;  4XTC S;  5LHY 1;  3OW7 A;  2HVR A;  3GTL A;  3FDT A;  1NMF A;  2W71 A;  4YY3 L;  1IBL H;  2RVL A;  2MCT A;  4NZN A;  1PFM A;  3M85 A;  3A5Z B;  1DOK A;  2I46 A;  2AQ2 B;  4IJH A;  1F2Y A;  4RCN A;  4DAP A;  4BY7 B;  2VPS A;  2C2R A;  2IX0 A;  3R3O A;  4IHJ F;  2QW7 A;  5FNV F;  2Q2T A;  2W57 A;  3U9S A;  3OTO Q;  3K5M A;  1S5D D;  4GLX A;  1HQM C;  4DV0 Q;  2Z04 A;  4DV3 Q;  1Y1W G;  2A68 D;  4DV6 L;  4B3R Q;  5K5P A;  4IO9 A;  2OQK A;  3PO3 G;  4LF5 H;  2J4X A;  2A69 C;  5L9X A;  4C3J B;  3G6J B;  4DV5 H;  2JA7 B;  1TS5 A;  4OON A;  1VF7 A;  4YB8 B;  1RYS A;  3HOZ G;  4EG0 A;  4IZ8 A;  4U67 3;  4DR4 Q;  4NYE A;  1GO3 E;  4B3T H;  5M5Y B;  4K5X A;  5HY6 A;  3QOJ A;  2BOS A;  3PIP A;  1PTO H;  4O4L F;  3NTK A;  5I9O A;  1B2T A;  4CE5 A;  3A54 A;  5I47 A;  3MJF A;  1IBK Q;  2C9O A;  1N36 H;  2UUC L;  1A0G A;  4JV1 A;  1Y8O B;  2BCO A;  4NP5 A;  2JEF A;  4ETS A;  5M3M B;  1YVC A;  4ZK9 B;  2Z6B A;  3TP7 A;  4XXE A;  4ZKB B;  5KFL A;  3HS0 C;  4ZRZ A;  1W96 A;  2WDT A;  4OX9 H;  2Q7D A;  4DK1 A;  3NWT A;  1RL2 A;  2RCF A;  2YV5 A;  3RAQ A;  2EYH A;  4JI4 L;  4I65 A;  1EWC A;  4DR3 H;  5E4X A;  4CKE A;  5JEA H;  2I5M X;  3PW2 A;  2HCC A;  5C0X I;  3PR5 B;  2DGY A;  4L5Q A;  3OIQ A;  2UXD Q;  1PLF A;  3V6J A;  3I4O A;  1UC9 A;  1KBL A;  2PQA B;  3S2D H;  4EQN A;  3S24 A;  5I6Y A;  2UU9 Q;  3HKZ E;  4M1U B;  1AW7 A;  1SRU A;  3MZ5 A;  1EQQ A;  5A35 A;  1FVI A;  1N9W A;  1MKH A;  3A8J E;  2F0M A;  1HJP A;  4O2A F;  3OHA A;  2VUM G;  1ET6 A;  1T5X D;  4P2C B;  1CA5 A;  3HKZ A;  3I3C A;  3D0F A;  2YWV A;  1E24 A;  4FGR A;  3ORR A;  4ED2 A;  5KFK A;  3PUW A;  2M9V A;  4E6I A;  2K5N A;  3RLF A;  2W6Z A;  5L1I A;  4MTK A;  2DY8 A;  4CJ2 C;  4DV2 H;  3BAA A;  5F2D A;  5KG7 A;  3RZD B;  4DR6 H;  1PTO B;  3AB9 A;  5I5Y A;  1PZK D;  4YBZ B;  4OXP A;  5HGQ A;  4RZR A;  3EQL C;  4F4Y A;  3T4A C;  5KYL A;  1YIJ A;  1IOV A;  3N43 B;  1E2W A;  2W8K A;  3BU2 A;  3JAM i;  3MTS A;  2B2W C;  1PXU A;  1KUT A;  3U50 C;  2C00 A;  3U0G A;  3T1H Q;  2ATL A;  2OT2 A;  4YY3 Q;  1Y1W H;  4Y8V B;  4K6D A;  1OTC A;  3MR6 A;  1UC8 A;  2RA4 A;  2F0J A;  4ECT A;  1ZET A;  1FJG L;  3PO3 H;  2F52 A;  3HBL A;  2KSW A;  3MXN B;  4HMI A;  1EKV A;  3J80 c;  1Y1V A;  3PUX A;  4GKK Q;  4LFC H;  3K6O A;  4DV6 Q;  2PMZ A;  5KS8 A;  3V6H A;  3LGJ A;  3J7A V;  2PNR C;  3HOZ H;  1YHQ A;  4HNT A;  2CW7 A;  2W9B A;  3BJY A;  5JPM C;  5A2Q E;  1F9S A;  2HUG A;  3PIO 3;  3EN2 A;  1I4P A;  3A5U A;  4I55 F;  2K52 A;  2AGP A;  1EYG A;  4J6H A;  2YTY A;  3OSO A;  3N8D A;  3IL8 A;  4DV4 H;  4LF9 Q;  1LT3 D;  1D5M C;  2DJF C;  1RHP A;  2EXZ A;  4FP5 D;  2XRS D;  1KNA A;  3A74 A;  2Q8T A;  3M9B A;  5H80 A;  2UUC Q;  1I6H H;  2BQR A;  2K5W A;  4JBJ A;  4HN2 A;  1VQ7 A;  1Y1V G;  5D3I B;  4ZAI A;  5KNC A;  1NNX A;  3KLS X;  1TWH B;  3JSL A;  2B2W A;  4DAA A;  1ROD A;  1V1O A;  3BZC A;  3CRL C;  1GD7 A;  2NU9 B;  4FFP A;  5JAV A;  4DU9 A;  1OXS C;  3N6X A;  1SCU B;  2FKL A;  1HNX Q;  4IN3 A;  5D3D A;  3KLW A;  1WVL A;  4RNM A;  4JI4 Q;  1ZHS A;  4RAY A;  4TM5 A;  2EIY A;  1EQV A;  4FDB A;  1Q46 A;  3GO5 A;  2F4V L;  3S1M H;  1XDN A;  3QR8 A;  3RD4 A;  1RCV D;  1UEB A;  3HFZ B;  1VQ4 A;  1MIU A;  4YWK A;  4FF1 A;  3WWI A;  1L0W A;  2VUM H;  3PO3 B;  1H9M A;  3RUP A;  3R2I A;  4NZM A;  4OO1 G;  4O7R A;  1A2U A;  1B8A A;  2K28 A;  1W2B A;  1J5E Q;  1GJX A;  5IOC A;  3I4N H;  2MPM A;  1JLL B;  3MC0 B;  1S68 A;  4HJA A;  4A3J G;  1OXV A;  3CC4 A;  1D7Q A;  4JXU A;  4IFD H;  3FKI A;  4DGZ A;  4GN5 A;  4WOR A;  3T13 A;  3G8C A;  2EY2 A;  1V43 A;  2COI A;  2R8J A;  1H9R A;  2NTS A;  2EJ2 A;  1O7Z A;  2TMP A;  4HJ5 A;  2UVR A;  4K2K A;  5GON F;  4GS3 A;  2D62 A;  3SGI A;  4EEY A;  2D2C C;  1I4G A;  1X56 A;  4LFB H;  4TSS A;  5IWA H;  4ECW A;  2NVQ B;  5I6W A;  1I6H B;  1SYD A;  4Q8F A;  4G4K A;  2RDF A;  4RWS C;  3M4P A;  2A1H A;  1PZJ D;  5J39 A;  1C7Y A;  5D1O B;  3FMA A;  3J80 W;  4JW0 A;  2X5R A;  1E7Z A;  2EE1 A;  4HSP A;  4GOP B;  2IY5 B;  3CCR A;  2KCT A;  4O4I F;  4GN3 B;  3T53 B;  3I4M G;  5KFD A;  4JPB W;  1JOK A;  2RKS A;  4HMJ A;  4DR7 H;  1GSO A;  1NAP A;  2JN4 A;  4A3D G;  4DR4 H;  4GKJ L;  1MD2 D;  4HR7 B;  5FLM G;  3G71 A;  4GC7 A;  3AU7 A;  4OEM B;  1ESR A;  3TQT A;  2DY7 A;  3S1M B;  1SE3 A;  2F0I A;  1EY9 A;  4HID A;  4DR5 L;  4A3C G;  1ESF A;  1VQA A;  4C3H B;  4A3K G;  4UPA A;  2VUM B;  4C2M H;  5LMU L;  4JI8 L;  1TY0 A;  1SFO B;  4DLK A;  4RGM A;  2CW8 A;  3H4B A;  5IOD A;  3MXG A;  1NY4 A;  3F2D A;  1I1M A;  4CKC A;  4A93 B;  5FLX L;  3I4N B;  1F2M A;  1CQV A;  3RBD A;  2Q2U A;  2YCH A;  1YJW A;  5C4Z A;  1LT6 D;  1Q1E A;  1A15 A;  5AFW A;  3RZO H;  4JI7 H;  5EQ0 A;  5IGC A;  4AQY Q;  3T1Y L;  3E0E A;  1T9H A;  1M1K C;  4OEL B;  4DV1 H;  1EIG A;  5E7N A;  1IHZ A;  4LW1 A;  4X64 L;  4YJ3 F;  5KFR A;  2Z1C A;  2IPK D;  4P71 A;  4F8M A;  3EBE A;  4WJW A;  4ED1 A;  3S16 H;  1C3O A;  2XD4 A;  1YEZ A;  3K3V A;  2ZXO A;  4DAY A;  5L37 A;  4HN7 A;  5DAA A;  3Q8S B;  2ZDQ A;  3U9O A;  2UUA L;  5KFZ A;  4OO1 H;  4JC0 A;  4K0K L;  3GV6 A;  2ATW A;  3JRW A;  4MA5 A;  3H6M A;  4JI1 L;  1ET0 A;  2OF1 A;  5C8Y F;  2W70 A;  2O5I C;  1GSA A;  2IL8 A;  2DNE A;  4I7A A;  2N88 A;  1X9N A;  1II3 A;  3MA2 B;  3P75 A;  4X66 L;  5DGI A;  1GHJ A;  2ZM6 H;  1C4Q A;  4KD4 A;  4ME5 A;  1G51 A;  3KDF A;  4RNO A;  1YNJ D;  2VQE L;  4C2M B;  2C22 A;  4ME6 A;  1KC7 A;  4UP7 A;  4PQX A;  2BE5 D;  4ZOL F;  4DUZ Q;  4KJN A;  1V1P B;  1U5K A;  3GTO A;  2ZJQ A;  2MO0 A;  3Q6S A;  5IY0 A;  1DV2 A;  4TVI A;  5IGF A;  1XMO H;  4FF2 A;  4EQ5 A;  1N33 L;  4UP8 A;  1STY A;  3QQM A;  5EPL A;  3RZO B;  2N8N A;  2K04 A;  3H0G G;  5FOB B;  5LMN L;  2KEN A;  2E2I H;  4IPG A;  5KFV A;  1F77 A;  4FFO A;  4A2A A;  3I4M H;  2UUB L;  1IZ6 A;  4QIW A;  1JJC B;  2AQ4 A;  4A3E G;  1CE8 A;  4ID6 A;  4IR1 A;  5I5V A;  3I2Z A;  4A3D H;  2E2J H;  2V58 A;  1JDB B;  4MV4 A;  5FLM H;  5IGD A;  5KRU A;  4K6N A;  5C4X B;  3J81 c;  2RCN A;  3M7N A;  4DFA A;  4ILW A;  1Z2N X;  2A6E D;  3LWE A;  4A3C H;  5JQG F;  3Q1K A;  1SEB D;  2R8I A;  3DLL A;  3GP7 A;  3GV5 B;  2K5Q A;  4JVZ A;  2IT1 A;  3TP5 A;  1E4E A;  4IPD A;  3GTG A;  1ASY A;  1GUT A;  4K8I A;  2FXQ A;  1Y8N B;  3NC0 B;  3T51 B;  1KLG D;  4JI8 Q;  4KHP Q;  1STG A;  2WB1 B;  1RDP D;  2COG A;  2RHS B;  1JWU D;  3N40 P;  2B2U C;  3UZO A;  4JI5 H;  1A3G A;  1RD9 D;  3MEH A;  1BOS A;  3TQ1 A;  3H4D A;  2DJG C;  3TZD A;  2BDN A;  3NBH A;  3C3L A;  4HIO A;  1QE6 A;  2PVP A;  4DV7 Q;  1LYL A;  1KTA A;  5FO8 B;  2QB5 A;  3T1Y Q;  2E2H H;  4JBM A;  1TVX A;  1I4X A;  1X6O A;  1H95 A;  2K01 A;  4X64 Q;  3P1H A;  2JE6 I;  4O1N A;  2E2I B;  4O7L A;  1SYE A;  3LWB A;  3BQ0 A;  1I94 H;  4E6N A;  1HR0 H;  2CQO A;  4O3S A;  1C8C A;  1TXY A;  2E2J B;  1GYF A;  2RDI A;  3PUV A;  4DR1 L;  1K3B C;  4LFA Q;  2K5D A;  3MFI A;  1XJV A;  3R23 A;  1RYR A;  5ELC A;  3CPF A;  3IAY A;  3KAJ A;  2NVX A;  3M3Y B;  1S3O A;  4JI1 Q;  3UDF A;  1SYG A;  2EYL A;  2K6A A;  5M5X H;  1K0S A;  5KG1 A;  1WYD A;  1F9Q A;  3I72 A;  1VQ8 A;  5ELD A;  5EWE A;  2R85 A;  2MP1 A;  1TY2 A;  1MSG A;  4JI0 H;  2B2U A;  3A8K E;  4X66 Q;  1I6U A;  4I4T F;  2PZT A;  1TWG B;  5COY A;  4DN4 M;  3BS1 A;  3S17 H;  5C5M A;  4C5C A;  2W9C A;  5DMX A;  2VQE Q;  2FFK B;  2F4I A;  4JI2 L;  3T5L A;  1SDF A;  3H0G H;  2O03 A;  1IBM H;  2L11 A;  5LL6 S;  5J2T F;  1KDA A;  1Q3L A;  3CQZ H;  4F87 A;  2GQS A;  1VF5 C;  3D4W A;  4IUN A;  1N33 Q;  3J81 W;  1CSQ A;  4A75 A;  1SMY C;  1SE4 A;  1XNQ H;  2R7Z A;  3TII A;  4Q5V A;  5KG0 A;  2KJX A;  4FU0 A;  5LMN Q;  1JE4 A;  4LMY A;  1QIL A;  3S1N H;  4XX0 B;  3N6R A;  2E2H B;  1ZEQ X;  2YW2 A;  4JV5 L;  4TKO B;  3GTO H;  5DLQ E;  4RCO A;  4UCU A;  1RTN A;  1UE5 A;  5DLG A;  2R86 A;  2DPJ A;  4A3F G;  1QUQ B;  3GLK A;  4ZQI A;  2OTJ A;  2Z4I A;  1S0O A;  1W6J A;  4PNY A;  4H0L C;  2YZG A;  3IFT A;  5G3L D;  4ECY A;  3NUC A;  4CKB A;  5EZY F;  2JQO A;  1BCP B;  3N52 A;  2WAQ B;  4G57 A;  2ID0 A;  1IBL Q;  2K1B A;  2F3W A;  3GTM H;  1RF2 D;  2CWA A;  4DL7 A;  1QZG A;  2HHH L;  4KHZ A;  2ZXR A;  1X3F A;  1IXR A;  2XIG A;  3MR2 A;  5M5X B;  1U0L A;  4J9P A;  4H02 A;  1QCB D;  2L15 A;  5BWR A;  4YR2 A;  4BXX G;  2HVS A;  4RB0 A;  1LTA D;  4J9O A;  4BY1 B;  4NXN H;  3S17 B;  3EA6 A;  3K7U C;  3GTG H;  4X65 L;  3WWV A;  5ELN A;  2HQL A;  4K2L A;  5CGK A;  1B1Z A;  4KY5 A;  4DV5 Q;  1TII D;  3T5K A;  1YBY A;  1EY4 A;  1HA5 A;  1STA A;  3H0G B;  2ICE C;  5J1Z A;  4R4Q A;  4X6A H;  4MZ9 A;  4YCW A;  2WKC A;  3CQZ B;  5DEH A;  3UDI A;  2P0A A;  2R82 A;  1PMR A;  5I9P A;  3QB3 A;  5JVG 3;  2JA5 G;  4Y52 H;  4QWA A;  1Q7Y C;  3GTP H;  1G2S A;  3S1N B;  2K5H A;  1Q86 C;  1DD2 A;  2OEO A;  3N41 B;  3TIN A;  1VQN A;  4IUQ A;  5EAY A;  1T3N A;  3CC2 A;  2UXC H;  2R7N A;  2YU9 H;  2ES2 A;  3W3A A;  2F4V H;  4CDF C;  4JOI C;  4LF7 L;  5FD5 A;  2JA6 B;  1VQG A;  4DR1 Q;  1QZH A;  1S03 G;  3PR4 A;  5DQI A;  1IW7 C;  3DMU A;  4QF4 A;  2LFN A;  4XYM B;  1CA6 A;  3BDC A;  1S5B D;  1L2F A;  1WCM A;  3T7A A;  4YHH L;  5CR3 A;  3UE1 A;  3CC7 A;  3DWQ A;  1XMQ L;  1K8A C;  2EJ0 A;  2HGX A;  4MV1 A;  5CBA E;  2WYO A;  1BJT A;  1UE7 A;  5M5W H;  5KX5 F;  4JI6 H;  2CKZ B;  1K28 A;  4B08 A;  1GUN A;  2XN9 C;  4NPS A;  4ZUJ A;  4A3B B;  4UAI A;  2FHT A;  3DF7 A;  4RA8 A;  4JI2 Q;  1EYA A;  3HKS A;  4O4H F;  4IAJ A;  1D5X C;  5IT9 c;  4A3M G;  4YCV A;  4M8A A;  4UCT A;  2PZU A;  2K50 A;  1UE6 A;  1BO0 A;  2B8G A;  3VR2 A;  1S5C D;  4B3M L;  3KAL A;  4LH7 A;  2EVB A;  3OTO L;  1WCM G;  3DTF A;  1PH7 A;  2RDG A;  1D5Z C;  3CCJ A;  4B3R L;  4DV2 Q;  2HG8 A;  3AYH B;  4JV5 Q;  5I4D A;  3HOW G;  1ZYR D;  1EQT A;  2PCF B;  1A3U A;  4RGT A;  3HOY G;  1HZB A;  3GTP B;  3G4S A;  3J80 L;  4I50 F;  3K57 A;  1L0X B;  3S15 H;  4TV8 F;  4JYA H;  4CGY B;  1EIF A;  4DR4 L;  1A6X A;  4RZQ A;  5DLF A;  1XPR A;  2YU9 B;  5IIF A;  2BDO A;  5GAD C;  2XWJ B;  4JI3 H;  2G9D A;  2CW0 C;  3HGB A;  1IL2 A;  1TWC H;  4CMF A;  1E2V A;  4BXX H;  1B7Y B;  1TWA B;  2HHH Q;  1RTO A;  3KJO A;  5J3B A;  4BWG B;  1G29 1;  3ULL A;  5J22 A;  1OWT A;  4YR0 A;  4KKS A;  2VQF L;  3F1Z A;  1M0W A;  2W6M A;  4DIM A;  2Y0S B;  2XWB B;  3TSS A;  2F0O A;  4HNV A;  2V4Q A;  4GNX C;  2QA4 A;  4AYB B;  2KHS A;  1VQC A;  3K81 C;  3U58 A;  1K1S A;  1MJC A;  1B3Q A;  4X65 Q;  2JA5 H;  4LF8 L;  2KUM A;  2BQU A;  1PRT F;  2NWG A;  1KL9 A;  2KA7 A;  2I80 A;  4DV4 Q;  2CNQ A;  5CYU A;  5ELO A;  3C1F A;  4WHX A;  2G5D A;  4X3U A;  2SNS A;  4R4C A;  5EPJ A;  1VQB A;  2HDL A;  1BXR A;  4F50 A;  2AGO A;  4B3S H;  3KF6 B;  1C30 A;  1ENF A;  3M4O B;  1FGB D;  3PF4 A;  2WIN B;  4FM9 A;  5KG3 A;  3S14 B;  5D8D A;  1PYW D;  5J2U F;  1NR4 A;  5BMV F;  1DOM A;  1Z6H A;  1C9O A;  1VBG A;  4K0K H;  4LF7 Q;  1WTV A;  1X3P A;  1PDQ A;  1SR3 A;  1O7I A;  2B2V C;  2L4N A;  3DUZ A;  3S15 B;  1BKB A;  4RKL A;  5KT4 A;  1X55 A;  1SYX B;  1N32 H;  2ASB A;  1GVP A;  3I4L A;  2UVU A;  1TQO A;  3GIM A;  5IT9 W;  2VB3 X;  1UWV A;  2JEJ A;  3G8D A;  1A9X A;  3J7Y W;  1XMQ Q;  1DCZ A;  4GNX A;  3NEM A;  3QIA A;  3BZD B;  2R92 H;  2K03 A;  4IWX A;  1E4G T;  3AX6 A;  3RJ0 A;  5BR8 H;  4A3M H;  4PBC A;  3NBY B;  2E2D C;  5KEE A;  4O2B F;  1DXM A;  3TN2 A;  5KFX A;  4C5B A;  3T1H L;  4C5A A;  1Q8K A;  3TRE A;  2CZG A;  1WJJ A;  4A4I A;  1Q8I A;  3GJX B;  3HOU B;  1KLU D;  1CSP A;  4IFD J;  3HOW H;  5C6A A;  2JA5 B;  3E3X A;  4B3M Q;  3HOY H;  1NBW A;  2VQD A;  4KI0 A;  4GKK L;  2YRX A;  1KD1 C;  5DG7 A;  2HHF B;  1EL0 A;  5C0X G;  3KLR A;  2JA8 G;  3L3O C;  2LS0 1;  4MTD A;  2XCA A;  4LFB Q;  3RLO A;  3RR5 A;  1KJ8 A;  3PV0 A;  4DPG A;  2R7L A;  4I7H A;  1B9M A;  2NUC A;  4ULL A;  1EUC B;  1IYJ B;  3KRE A;  1HHV A;  1KAB A;  4LF9 L;  5GAG C;  2FLL A;  4MN3 A;  2M2L A;  3T5J A;  5E25 A;  3GV7 B;  2H5X A;  3BDL A;  4DR7 Q;  5KFP A;  4Y7N B;  1ULZ A;  5C4J H;  1TU2 B;  3TDQ A;  1RJR A;  2MUY A;  1HTP A;  1ICF B;  4NDX A;  4OIJ A;  4JV0 A;  4ECR A;  5KG4 A;  5ELF A;  2VQF Q;  1CM9 A;  2VL6 A;  4HNU A;  5I5W A;  1PRT C;  3HG9 A;  5D1O A;  1CKN B;  3L2P A;  3EVQ A;  1F2Z A;  1SXT A;  1WTQ A;  2F0T A;  1JJ2 A;  1HNX L;  2R92 B;  4A3M B;  5I60 A;  2LMC B;  5BWU A;  2NVY A;  5DG8 A;  1Y14 B;  2EPB A;  3QZ8 A;  1R9T A;  3ETH A;  5F9L A;  4LF8 Q;  2WFW A;  3GQC A;  4NZO A;  4PMC A;  3ETJ A;  3Q8R B;  1GOZ A;  1JOQ A;  3RGZ A;  1O7Y A;  3DM1 A;  3ICE A;  3TW7 A;  1FD7 D;  4ZUI A;  2R7F A;  3PMF A;  4L5R C;  3VYT A;  1RKN A;  4K8J A;  3RV4 A;  4LSX A;  5IYD G;  2O2L D;  4YCU A;  4L8J A;  4QSH A;  5M3F G;  2FLN A;  2A6H C;  3QWU A;  5CM0 A;  1J5E L;  2NZ1 D;  1CT1 D;  2QK4 A;  3BZK A;  3K58 A;  2F0U A;  1S72 A;  3PQI A;  2CNU A;  1Q82 C;  1GUO A;  3HZX A;  4ZQ3 A;  4N8X 1;  1JOR A;  1SNC A;  1VQD A;  1AZP A;  1EKP A;  2GPW A;  1SBB B;  3QZ7 A;  4QY7 A;  2J6S A;  1B3A A;  1JC7 A;  1U4M A;  1A63 A;  4BBR G;  1XNR H;  1AEX A;  3J80 E;  3R8B A;  4ZHQ F;  4O3N A;  3OMG A;  1I5F A;  1SNP A;  1QVG A;  4LNQ A;  4IRC A;  4DR2 H;  2WP8 J;  3GID A;  3CXC A;  3HT5 A;  4NXM H;  4EFE A;  2I0Q A;  1NUC A;  1E22 A;  2FK3 A;  3X3N A;  3A0J A;  4RGN A;  4R8N A;  1XPO A;  3HKZ G;  2EJ3 A;  2YZL A;  2PN1 A;  5D1P A;  2WV6 D;  4WRD A;  4M9U A;  3IN5 A;  2ZXP A;  4O42 A;  5C0X H;  2ZJP A;  2QEX A;  4QQB X;  2YTX A;  3KF8 B;  4HSV A;  1ZAU A;  1WI5 A;  2FK2 A;  4QWC A;  5CC4 A;  2F0W A;  4TRD A;  2DUD A;  3CRK C;  2QKI C;  1Q1B A;  2L0C A;  1OXX K;  3J81 L;  2W7O A;  1IYE A;  3GTL H;  1RIP A;  5C3W A;  2E5L L;  4JG2 A;  1O7L A;  3FP9 A;  3S2D B;  4FXK C;  1BCP F;  4QGU A;  4LUZ A;  3V6K A;  1JIC A;  1GLV A;  2GN5 A;  1D1K A;  1I50 A;  4XYQ A;  2AKW B;  4ECX A;  2IP4 A;  3B6Y A;  4AQY L;  3RFC A;  1S40 A;  4CJ0 B;  1EYC A;  1N34 L;  4CBV A;  5LP6 F;  3M9M B;  1JMC A;  1A2T A;  3GTK A;  4ECZ A;  1UNS A;  2ASL A;  3LML A;  1STE A;  1K8M A;  2Z6K C;  3J7A 5;  1WTH A;  4GLA C;  4LK1 C;  4J9N A;  4ZCK A;  5EWG A;  5KT2 A;  2XCL A;  1K3R A;  2D5D A;  4JI5 Q;  3F2C A;  5DIS C;  5IYD H;  3HOX G;  4HAE A;  3EPG A;  2AUK A;  5DGA A;  1Y1W B;  1AE2 A;  1KQS A;  5KFN A;  2FMA A;  1L1O B;  5AJ3 L;  2K7V A;  3CW2 C;  4N8F A;  3CCU A;  2WB1 E;  2NVY H;  1B70 B;  3E9I A;  2L55 A;  1CUK A;  2VUG A;  3NSW A;  1CHQ D;  2MHV A;  1EOT A;  3C2P A;  3P20 A;  4IOC A;  3HOZ B;  1UEA B;  3S1R H;  2FJZ A;  2YYA A;  4RHR A;  3KFU A;  1G2W A;  4K14 A;  4DK3 C;  1KT8 A;  4EYI B;  2R87 A;  1TA8 A;  2TSS A;  5CV5 A;  1I94 Q;  2MGS A;  4DUZ L;  4PV1 C;  4FS2 A;  2Q8I B;  2YZM A;  5JQW A;  4BBR H;  1GM5 A;  1JR0 D;  3K8A A;  4LH6 A;  4Q8E A;  3CF5 A;  3P7J A;  1W3S A;  4B9X A;  2JK8 A;  3WDN A;  2J0T D;  4G7O C;  4TV9 F;  1V9P A;  3CPW A;  5I5X A;  1YNN C;  2J6T A;  1SMY D;  3SHL A;  3W5O A;  4HQ6 A;  2PZW A;  1EUJ A;  1L0Y B;  2EYJ A;  4PG3 A;  2A8V A;  3I55 A;  2PO4 A;  1LAB A;  2QF7 A;  2Z02 A;  2VNU D;  3L9A X;  3K5O A;  3TEH B;  4F4Z A;  4OL7 A;  4DUY Q;  1IYV A;  2RBM A;  4O3R A;  1HNW L;  3FKI G;  2KED A;  1AFP A;  2F0F A;  2VY3 A;  1UNN C;  3J7A F;  1CK1 A;  1U4L A;  2D0O A;  2R8K A;  4X62 H;  1DV1 A;  3K5L A;  3LQS A;  3OTO H;  5CMD A;  2CQY A;  4DV0 H;  4DV3 H;  1IBM Q;  4R8U A;  5NUC A;  3D6W A;  1EY0 A;  5KFE A;  2QGQ A;  1BCP C;  3AEV A;  1QVF A;  4APM A;  1LTR D;  3TRZ A;  4R8I A;  3MVV A;  4JBW A;  2FP4 B;  2V5A A;  2E5L Q;  3QFF A;  3V4Z A;  3NQI A;  2FPP B;  5DQH A;  4JCV E;  4KHP L;  1Q12 A;  1GUW A;  3J81 j;  3UYY A;  1LT4 D;  1S5F D;  4XT1 B;  3OSN A;  2W8L A;  1D6E C;  2D9U A;  3PSI A;  4RG1 A;  2K5V A;  3S1R B;  1E1T A;  1Y1V H;  1IBK H;  2F0N A;  1ML0 D;  4KKU A;  4DV7 L;  2UVV A;  1VQF A;  1FL0 A;  2EY5 A;  5CV9 A;  4DNI A;  5D65 A;  5BN3 A;  1N34 Q;  4F4W A;  3TZU A;  2VR1 A;  4H7B A;  1CHP D;  3H3V C;  3WO1 A;  2NVT H;  1I50 H;  2NN6 G;  5FJ8 G;  5GAE C;  3M4Q A;  1HNZ H;  4LF6 L;  5JJZ A;  2IHF A;  3HOX H;  1I7N A;  3UI2 A;  4QWE A;  5BN4 A;  3TY5 A;  2UXB H;  3BA8 A;  1K1Q A;  1DOL A;  1EFI D;  2WAQ E;  3NBI A;  4P73 A;  4QB4 A;  3J80 i;  2JJQ A;  1QUQ A;  2EJM A;  4POF A;  1JIH A;  1RJP A;  3SE0 A;  1I3Q A;  2D0P A;  3OHB A;  2ASD A;  3FHW A;  4LFA L;  2ODT X;  3GTK H;  2UXD H;  2H1E A;  4NXN Q;  3NXW A;  2JXM B;  3BYY B;  2L1B A;  1M6V A;  3BA9 A;  4S3S A;  3ERQ A;  1U9R A;  3BAC A;  1PFB A;  2AQ1 B;  2UU9 H;  4A3J H;  5AJ3 Q;  4EGQ A;  2X6G A;  4Q44 A;  1AZQ A;  1HUM A;  4RAU C;  3WNZ A;  3UDG A;  1SND A;  3I8Z A;  3PZP A;  5LL6 X;  1VQ5 A;  1BR9 A;  4ED0 A;  3NEL A;  3Q8D A;  1M8A A;  4TUY F;  2EYO A;  3SVM A;  3T16 A;  2JP1 A;  1TKW B;  1FNU A;  1G6Z A;  4LF4 L;  3J81 E;  1GHK A;  1K83 A;  2NN6 I;  1Y1V B;  4XT3 B;  4O86 A;  2PMZ B;  3U4V A;  4GLW A;  3QOL A;  3UZB A;  2R93 A;  2W9B B;  1Z2O X;  1SYB A;  5IT9 L;  2KEE A;  5IP7 G;  3FKI H;  3VYS A;  2R84 A;  4IUT A;  5CR5 A;  1EWH A;  3BDO A;  3T1H H;  4XQQ A;  5KFS A;  4YY3 H;  2NVT B;  4DL3 A;  1HNW Q;  1LAC A;  2Z4H A;  3I56 A;  4JI6 Q;  3RV3 A;  1T94 A;  4DA2 A;  4U6P A;  2NUA B;  4ZKC B;  2HQE A;  3S16 B;  4L5S A;  2JA6 A;  3F2B A;  4A3K H;  3KTM A;  4DV6 H;  1EYZ A;  1S10 A;  1QNK A;  1IBL L;  4O7Y A;  2VA2 A;  3BAB A;  3GII A;  5BWX A;  5CV7 A;  4LSA A;  2CW0 D;  4MV3 A;  3T99 A;  1FR3 A;  2VXW A;  2NBF A;  3MFY A;  3KBG A;  4A3J B;  2YS6 A;  1VS0 A;  5IYB G;  4LF9 H;  5IE8 A;  1I1K A;  1WD0 A;  2Z9H A;  3DXJ C;  4LF5 L;  2XSC A;  2KHI A;  2SOB A;  3K7A H;  3WO0 A;  1SJE D;  2B63 A;  4XQJ A;  1ZKO A;  4DV5 L;  3MWM A;  2R8H A;  2UUC H;  4JYA Q;  1YI2 A;  2NN6 H;  4YIJ A;  5FJ8 H;  2DAB A;  1TT2 A;  3FVQ A;  4B3T L;  2EOT A;  3NGD A;  3PW7 A;  4FBT A;  4EX5 A;  1VQK A;  2RSO A;  3C0F B;  5EPK A;  1S97 A;  3SK6 A;  4U7C A;  3KHL A;  2MO1 A;  3GIK A;  1N36 L;  4LF6 Q;  3Q8P B;  2UVW A;  1TWF A;  3FKI B;  3CVZ A;  4LWC A;  3I4M B;  2DIK A;  4JI4 H;  1CKO A;  3IKJ A;  1HR0 W;  3TQY A;  3R93 A;  4M0J A;  3CP0 A;  3W1G A;  2HIX A;  2WII B;  2V9W A;  4A3D B;  3H94 A;  4DL6 A;  3V05 A;  4WD3 A;  2B63 G;  4OX9 L;  3KK7 A;  5ELB A;  4HED A;  1WH2 A;  2FIN B;  3GB8 B;  1NE3 A;  3S2H H;  4IAL A;  3VPC A;  4A3K B;  1IYD A;  4PMB A;  3W2D A;  2I07 B;  1XX8 A;  3PW5 A;  5K2M A;  2LXJ A;  2Y0S E;  4JUZ A;  4TQS A;  4IUR A;  3KXY T;  4L5T A;  5KFW A;  5C3X A;  1K9M C;  2N3S A;  1TWA A;  3VR4 A;  4A3G G;  4AYB E;  4B3S Q;  2EXD A;  1IL8 A;  3OW2 A;  3GD7 A;  1SYC A;  5IP9 G;  1D1I A;  3E6Z X;  2XGQ A;  2Y0S A;  3TY9 A;  4EVO A;  5KFB A;  2AGQ A;  2BA0 A;  4JK1 C;  2ALY B;  2Q2I A;  1ZQ7 A;  2WKD A;  1PTO F;  4HJ9 A;  4AYB A;  4LF4 Q;  5IP7 H;  1E0B A;  2H4O A;  1KDB A;  5FO9 B;  3K7A B;  5IGG A;  2Q2H A;  2F0V A;  4J9K A;  2DNC A;  4A3E H;  2M05 A;  1N8R C;  1N32 Q;  5KT5 A;  1K8O A;  2R7M A;  2DAA A;  3CCM A;  4DV2 L;  1U4R A;  3MHB A;  4DR6 L;  1EY8 A;  3GTJ A;  4J8Q A;  4NB3 A;  2A74 C;  5EBC A;  1K83 H;  5CBE E;  2OQ0 A;  5LA6 F;  4FVM A;  1DJR D;  2GVA A;  2O4X A;  3STB C;  3CCS A;  3OSP A;  1FJG H;  4LMQ D;  4ED6 A;  2A69 D;  4UDU C;  2AQ3 B;  4TVA B;  2JEA I;  1X54 A;  4DNT B;  2FK1 A;  2JSO A;  2NU7 B;  3R5X A;  4CC5 A;  1E1O A;  2J7Z A;  2SNM A;  3S1Q B;  4Q0F A;  4UFZ A;  1DIK A;  1EU4 A;  1STN A;  5IYB H;  2R7Z G;  3V4S A;  3D3R A;  3DM3 A;  4UP9 A;  3GTQ A;  5KFH A;  2V4D A;  3SK4 A;  1VQP A;  3S2H B;  1EFW A;  3GIL A;  5COR A;  4PZ8 A;  4A2B A;  3MWE A;  4LFC L;  1SMX A;  3N44 B;  4PWQ A;  1CI3 M;  3T56 B;  4QJF A;  4LF5 Q;  2FPI B;  3LWU A;  4O82 A;  3I7F A;  3K59 A;  1EZ6 A;  1U4P A;  1PYB A;  1ENA A;  1PRT D;  2COJ A;  3VYU A;  1GGO A;  2AHO B;  4DV4 L;  3CU7 A;  3Q22 A;  5C1O A;  4B3T Q;  4MAM A;  1WSC A;  4IPH A;  4K5V A;  1FKA H;  5CV8 A;  5FLX c;  4A3E B;  3PO2 G;  4O2D A;  3JZ6 A;  1V8Q A;  3J81 i;  3EIV A;  3KOJ A;  4EQP A;  4PDB A;  1EZ8 A;  4BA1 I;  3VDY A;  1N36 Q;  2B63 H;  4O83 A;  3I70 A;  4O4J F;  4DKA C;  2O5J C;  3TS0 A;  2G9H D;  1X65 A;  2R6G A;  2RDH A;  3GTO B;  2R6F A;  5DM6 3;  3PFF A;  3AFQ A;  1I4Q A;  2IX3 A;  3TME A;  1VQH A;  2JA7 A;  2RF4 A;  2L12 A;  4OX9 Q;  1EQR A;  5IT9 E;  2N49 A;  4A3G H;  3FRP B;  4ME3 A;  4DQN A;  1TWF H;  4DR3 Q;  1Q81 C;  5ELE A;  2HT1 A;  5HBR B;  5DGB A;  4QIW B;  5IP9 H;  1OBG A;  2PYK A;  3KLS A;  1JKJ B;  5JEA J;  2IBK A;  1XTC D;  1N48 A;  4QW8 A;  5C3E G;  3M4Y A;  3GTM B;  3H20 A;  1E4F T;  3CKI B;  1A3V A;  4GZY C;  1JT8 A;  4MV7 A;  1PTO C;  2VB2 X;  1JWS D;  1S9F A;  1D8L A;  1F9P A;  1R4Q B;  1CZG A;  2F3V A;  2NVX H;  1KJ9 A;  1SE8 A;  5KFM A;  2XVS A;  2YYZ A;  2IMW P;  1KNE A;  3D4D A;  4B9W A;  2RSN A;  2FJ2 A;  2C28 A;  5I2X A;  1E4E B;  4PZ6 A;  3DHQ A;  5E3F A;  2PBZ A;  3NE5 B;  4UCO A;  4P75 A;  3GTG B;  4C56 C;  2PW5 A;  1I1L A;  5I5S A;  1G6P A;  1K8G A;  4FS1 A;  4A3F H;  1I2K A;  1YNJ C;  4MA0 A;  5EBD A;  4O7W A;  2CH4 W;  4DR6 Q;  2PQA A;  4HCS A;  2QEJ C;  1ILQ A;  2XGP A;  5I5U A;  4LFB L;  4JOI A;  1T5E A;  2CVR A;  5IWA L;  4A76 A;  2EYP A;  4C1N I;  4IRD A;  5BWV A;  5CA1 F;  1S4Z A;  2R7Z H;  2F0H A;  3ER0 A;  3NBH B;  2DZD A;  4RNN A;  3RB4 A;  4IUV A;  3I91 A;  4DR2 Q;  4GKJ H;  4RH6 A;  4LUO A;  2VA3 A;  4NXM Q;  4DR5 H;  4WFN 3;  3R5F A;  4DR7 L;  5FPO A;  1Z47 A;  1TR5 A;  3MEF A;  1XXG A;  4KJO A;  3RUZ A;  4UCV A;  5KFT A;  4M7E A;  3HOV G;  1FGU A;  4ECV A;  3ONA B;  5LMU H;  4JI8 H;  4HIK A;  1A48 A;  1VKZ A;  3LNN A;  2KVM A;  1H9J A;  2VPQ A;  5FLX W;  4LFC Q;  1VMC A;  3BG5 A;  3G48 A;  1QB5 D;  1KHI A;  2I5H A;  4YAK B;  4CHI A;  5M5W B;  2LSS A;  1J9O A;  3VYR A;  3IG0 A;  3T1Y H;  1B4O A;  5G3L F;  1PH3 A;  1OXU A;  2JA9 A;  3PO2 H;  2NVX B;  4MV8 A;  2ZT9 C;  3PIP 3;  4X64 H;  1VQO A;  4DNR B;  1PH2 A;  4UY8 C;  2Q8R E;  5DAU A;  1YJ9 A;  4J9R A;  1X3G A;  3J7A K;  4YWM A;  4R4I A;  4LAA A;  3WOF A;  4JI7 L;  2NTT A;  3HXL A;  3T5H A;  3MXN A;  3H09 A;  5JJI A;  4YQW A;  3TBI B;  4FFN A;  3TY8 A;  3H91 A;  4H44 C;  5BWW A;  5EOY A;  2W9C B;  5BPH A;  3CMA A;  4DV1 L;  4A3F B;  1M0T A;  1KAA A;  2UUA H;  3SEB A;  3VR5 A;  2I5L X;  1LT5 D;  3CEB A;  3CSW A;  4X3K A;  4JI1 H;  2R7Z B;  2ICI A;  1CKM A;  3KYH C;  3JAM c;  2J9G A;  4EBC A;  3OIP A;  3HO8 A;  5GRO A;  5C3E H;  3D6C A;  3QO2 A;  3N42 B;  5EKL A;  2E74 C;  2ABJ A;  1LTL A;  2XGT A;  2OLS A;  1SNM A;  3GV3 A;  4X66 H;  5L1L A;  1VQ9 A;  4QWB A;  3EYY A;  3FPU B;  3FDS A;  5L1J A;  4DAV A;  1X32 A;  2VQE H;  1TWC B;  2RGR A;  1JOO A;  3T9B A;  3OYY A;  1TWH A;  4HYK A;  1YNN D;  1SNQ A;  4DXG A;  4KTA A;  1ILP A;  5M5Y H;  4RAZ A;  1XWE A;  2ZM6 L;  2I87 A;  5K3W A;  1N33 H;  3RIZ A;  1AN8 A;  1LTT D;  1WCM H;  1V51 A;  1BDO A;  5CV6 A;  4ECU A;  1O75 A;  3K80 C;  1KRT A;  4GOP C;  2MQH A;  5LMN H;  1D2B A;  5I5T A;  2UUB H;  1M7J A;  1F2L A;  5KFF A;  2FMM A;  1XMO L;  4NLG A;  1YJN A;  1Y1W A;  3K3P A;  3IRB A;  1VQ6 A;  2JEG A;  2K75 A;  1K73 C;  1IYU A;  4TQR A;  2PI2 E;  1QOH A;  1DAA A;  5IWA Q;  2B2V A;  4NKL A;  4UUG A;  1JB7 A;  1JX4 A;  1M4V A;  1BBU A;  2E8G A;  3SDZ A;  1BBX C;  3JC6 6;  3HOV H;  3KBX A;  1YIT A;  3G6V A;  4KY6 A;  2PI2 A;  3VA7 A;  1GSH A;  2OH2 A;  4EQO A;  4X3S A;  2W6P A;  4X62 Q;  4J9L A;  3PUZ A;  3OUU A;  1B6S A;  5C3E B;  3CCL A;  2Z8L A;  4CHT B;  4FXD A;  4IRK A;  1ICW A;  4KK7 A;  1V1Q A;  1LTG D;  1V4Y A;  5KFQ A;  4RMF A;  4XQN A;  2OTL A;  3VR6 A;  3V96 A;  3NBZ B;  5ISR A;  5IYZ F;  4KN4 C;  4GOP A;  3RF2 A;  4C1N K;  1JDE A;  4IPC A;  3RZD H;  1A62 A;  4JI5 L;  4HJ7 A;  4P74 A;  1I4H A;  1I7L A;  5CV4 A;  1WCM B;  1EYD A;  2XC9 A;  4OHJ A;  4BBS G;  1KAW A;  4LUV A;  3RTX A;  1HA6 A;  4HR7 A;  3JAM W;  4J9S A;  2OCE A;  2F0S A;  4JI7 Q;  2F3I A;  1XK5 A;  4PMW A;  3HOW B;  2IA6 A;  2N55 A;  3NTH A;  3HOY B;  2NB0 A;  4FFR A;  4DV1 Q;  5EGT A;  1GXD C;  3EJI A;  2EDG A;  2QDL A;  5T1G A;  4CDC C;  4XIG S;  4DR1 H;  4G3I A;  2VUM A;  4X3T A;  1HNZ Q;  1SFO A;  2MFI A;  3OWE B;  3VR3 A;  3I90 A;  1HZ9 A;  3WOE A;  2N78 A;  1I94 L;  1SSO A;  1HR0 L;  2CNV A;  1H9S B;  3AW8 A;  5IGE A;  3BJU A;  2BH8 A;  2UXB Q;  1O78 A;  3HOV B;  1A0I A;  1I2L A;  3U55 A;  2K33 A;  3TEK A;  4EBE A;  5EKK A;  3VPD A;  3RB6 A;  3OOC A;  3KHR A;  1EKF A;  1B9N A;  1SN8 A;  2E75 C;  4F88 A;  2KCC A;  1WOC A;  5C4J B;  2ZTD A;  4OWT B;  1ET9 A;  4C3H G;  4JI2 H;  1ENC A;  2DPI A;  1WTP A;  2GQR A;  4Q43 A;  1OBD A;  4DUY L;  2AU0 A;  2CQA A;  4GLV B;  3Q0A A;  1PA6 A;  2ZM6 Q;  4JI0 L;  4IIJ F;  4HTH A;  3PN1 A;  2F0P A;  4G7H C;  3KHH A;  2YS7 A;  3C46 A;  4RFB A;  4A93 G;  3I4N G;  1KDC A;  1LTS D;  3BG3 A;  3MR5 A;  3DEP A;  1OXT A;  2HCI A;  3FPP A;  1EWI A;  1IBM L;  4CJ1 B;  4IFD G;  2JA8 H;  3RN2 A;  1SYF A;  4JV5 H;  1TWH H;  1XMO Q;  5FKA C;  1Z7T A;  1Y69 U;  1B6R A;  5KFA A;  1XNQ L;  2KBN A;  3ERO A;  5HGT A;  4I7Z C;  2B3G A;  4V19 0;  3Q8Q B;  3NUA A;  1NTG A;  1KRS A;  4OGQ C;  2GA4 B;  4FO2 A;  1NJI C;  1XYI A;  1AUX A;  1OO9 B;  1VQL A;  1MHW C;  4L63 B;  1YZ6 A;  5CB4 F;  3ND8 A;  4IUP A;  4C2M A;  2PMZ E;  1HPC A;  5C5J A;  2FE3 A;  1AUV A;  1VBH A;  1V1P A;  3AMU A;  3JZF A;  4YWL A;  2HHH H;  2XIW A;  5KG6 A;  4XYO A;  1ZYR C;  2RDJ A;  2HVQ A;  3SXH A;  2YRW A;  3G6E A;  4FF3 A;  3A8I E;  2F0G A;  4EGJ A;  3RAX A;  5EWF A;  4QW9 A;  3FMC A;  3DTG A;  5JOB A;  4X65 H;  3PCO B;  3FEW X;  4CMD A;  3NEN A;  4RU9 A;  4XYL B;  1PVO A;  3H40 A;  4BBS H;  4IFD I;  3VA5 A;  4E4T A;  3QWN A;  1STB A;  2IWH A;  1B50 A;  4DL2 A;  3T9C A;  1LTI D;  1WTX A;  2K32 A;  1IKM A;  3U54 A;  2YZN A;  2NZH A;  1BGW A;  4NXN L;  3NP8 A;  2KEC A;  5M3F H;  4O84 A;  2NVQ H;  1GUG A;  5FO7 B;  1YHB A;  3GQB A;  2V59 A;  4GNX B;  2ALZ A;  1S0N A;  5GQO A;  2JA8 B;  1RJQ A;  1GKH A;  4EBD A;  3X3M A;  5E1F A;  3WWJ A;  5CA0 F;  2RQX A;  1R9T H;  4LF7 H;  3RN5 A;  4V0B A;  4IUU A;  3GTL B;  3A55 A;  2YL2 A;  2KCM A;  3G7L A;  2WB1 A;  1NSN S;  1A3T A;  4DF7 A;  3DEO A;  4P72 A;  4KMU C;  1HR0 Q;  1B44 D;  5FK9 C;  2UXC L;  1UUP A;  2B29 A;  1JWM D;  5C4X G;  3CCV A;  5KT6 A;  4HIM A;  1TS3 A;  1W93 A;  1ZXT A;  2QYZ A;  4YHH H;  3L4J A;  3VMM A;  3SI8 A;  1P8L A;  1SAP A;  2AWN A;  4C3H H;  3MXP A;  2ZJT A;  1XMQ H;  1BNZ A;  4EYH B;  2AMC B;  4O7V A;  5JVL A;  1SFO H;  3AQQ A;  3F2U A;  4QUC A;  2Z6K A;  3W1B A;  1RK6 A;  5I2Y A;  4A93 H;  1AH9 A;  1IOW A;  2K14 A;