2Q2TA

Structure of chlorella virus dna ligase-adenylate bound to a 5' phosphorylated nick
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
293
Chain Sequence
MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase/dna
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
total genus 75
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2tA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2tA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2tA01
4OWWB 4P72A 3J81i 4ME3A 3PV0A 1NJIC 3HOWG 3JC66 1HNXL 4JYAQ 2Q2UA 1BVSA 1Z47A 1K8AC 4B3RL 1VQGA 1JJGA 1XNRQ 4JV5Q 4CC6A 3S1MH 4GKKQ 2OTJA 4DV0L 1Q81C 1N32Q 4LF8L 2HT1A 3QWUA 4DV6L 3J80c 5GAEC 2R92H 1HNWL 2B63G 1K0RA 1VQJA 3F2BA 1RIPA 4BA2I 4DV2Q 2DUDA 2ID0A 4L5RC 2VUMH 2Q2HA 1IBKQ 2B29A 4JI0L 1YNXA 3PIPA 1KL9A 5FJ8G 1CKOA 1PH5A 2UUAL 1UE1A 4AYBG 1VQ6A 3CCVA 3RTXA 3NBZB 1KRSA 3EBEA 4O2DA 4EEQA 1YJ9A 3UDXA 1XMOL 2R7FA 3E0EA 3U4ZA 4L5TA 4DR2L 4JI3L 2IX1A 3BAAA 1Y1VH 2R92G 1FGUA 1I5FA 2MO1A 1IBKL 4YCUA 4FDBA 3RLFA 3K7UC 3PIOA 2ZTDA 3H15A 1XMOQ 5ELNA 4A3MH 1E3PA 3F2DA 4HIKA 4X65Q 3I55A 1PH6A 3PUWA 1Q82C 1N36Q 4HIMA 2D0OA 2AWNA 2RHSB 3GD7A 2NN6I 4KLKA 4DV2L 5LMNL 2NVTH 4QY7A 2NN6G 1I50H 2UUCL 2UU9Q 4A3IG 2KCMA 4PZ8A 1KD1C 2QGQA 3HOUH 1A63A 2LXKA 3HOXG 1HNXQ 3HOYH 1VQCA 1VQBA 4JC0A 1R9TH 2CWPA 4XTCS 3JAMi 3I56A 3ULPA 1C7YA 1OTCA 1VQFA 3CAMA 2UU9L 2Q2IA 4DV4Q 1H95A 4HJAA 3PUXA 3TEHB 4DR5L 3I2ZA 2F52A 2EIFA 4KHZA 4GN5A 2I5LX 1HZ9A 1M1KC 3RLOA 2ZTCA 2A1AA 1Z9FA 1EOVA 1GKHA 2AMCB 3UDIA 1IZ6A 1CSPA 3OTOQ 3A5UA 2ZJRA 1IBLL 4P75A 4JI6L 3S1RH 4OO1I 1KRTA 2HVRA 5BR8L 1NMFA 1VQAA 3I4MH 1WYDA 3CCSA 1X54A 5GADC 3VNNA 4IO9A 2JA5H 1K83H 4POGA 5HY6A 2MQHA 3NELA 4A3GG 4A3DG 3FP9A 1N33Q 4YWKA 3CCJA 3UQ8A 4DUYQ 4A75A 1P16A 3HOVH 1HZCA 1WJJA 4LF4Q 4OX9L 1FJGL 2VZAA 1MJCA 3CQZH 4A3BH 2UXCQ 3HOZH 2CQOA 3AFQA 3PO2H 3CPWA 1HNZL 3F8TA 2YYZA 1E1OA 5GROA 3CC4A 1SE8A 2KENA 4A3JG 4B3TL 4YWMA 4A3EG 3S2HH 1N32L 2R7ZG 4R4OA 2KHIA 5C0XJ 1L0WA 3D31A 2HHHL 5C44H 1PH1A 5M5WH 2K52A 3EIVA 4YY3L 1YHAA 2PMZE 2WFWA 3A5ZB 5IE8A 3PF5A 2K5HA 5IT9c 2GVAA 1E7ZA 3TQYA 4A3FH 4A3IH 4LF6L 1JT8A 4B3TQ 1XNQL 4BXXH 5M3FH 5IYCG 3L7ZC 1VCIA 1X3FA 1YI2A 5FJ8H 1Y1WH 3M4OH 1PH3A 2A19A 1OXVA 3KF6A 4JI5L 4APVA 1XDNA 1G6PA 2OQ0A 5IYDH 3BA9A 1I3QH 3STBD 3AEVA 4BY7G 1K3RA 1N9WA 3IRBA 4GLXA 5GAHC 4JI7L 3KDFA 4LFBQ 1WFQA 4JBKA 1KAWA 2E8GA 3J81j 4UCRA 5D1OB 4IJHA 2JA5G 4DV3L 2NVYH 2Q2TA 2LSSA 4GOPC 1PFSA 4IPGA 2JA7G 4YCVA 1O7IA 3PF4A 3RLNA 3PO3H 2OQKA 5EAYA 2GVBA 5D1OA 4DV5L 1X9NA 2JA6G 4GNXA 1TXYA 5GAGC 1X3EA 1QVCA 4DPGA 1NE3A 2K4KA 4BBSG 4X65L 1XPOA 2K5VA 4C3IH 3GTJH 2OWOA 3U58A 2L15A 4UPAA 1N34L 4E6NA 4HIDA 2CWAA 2JA9A 4A93H 3SGIA 1YITA 4A3EH 3NC0B 4LH7A 1TWHH 2JA8H 5H1SE 1WOCA 1X6OA 2ATWA 5C0XG 1EQQA 3RZDH 2E2IH 4WJ3M 5JEAG 1Y14B 4LF7L 4WJ4A 3DLLA 5BR8Q 5D1PA 2BH8A 1CKNA 3AYHB 1N36L 2UUAQ 1P8LA 4BA1I 5C0XI 4JI0Q 3TRZA 4IPHA 4JYAL 2EXDA 2NVXH 4LUZA 3OTOL 4LFCL 5HGQA 5M3FG 4LNQA 1GO3E 3U50C 3G6EA 4A3KG 3CW2C 4DR2Q 3K8AA 1SR3A 3RN5A 4DAMA 4JV5L 1G291 2UXBQ 2MNAA 1SRUA 2B3GA 1UEBA 1FL0A 1D7QA 3CC2A 3TREA 4DR3Q 5GQOA 1G51A 2AHOB 3STBC 1VQMA 2PI2E 4J15A 1PH2A 1LYLA 1Q7YC 2B63H 1S72A 1MKHA 2R7DA 5M5XH 2WB1E 1KIXA 5LMNQ 4DR6Q 2UXDL 1LUZA 2CCZA 3M4QA 4JOIA 4GKKL 5LMNW 2R7ZH 2N49A 5FLXc 4HJ7A 4DKAC 3BZCA 4POFA 4EX5A 4KI0A 1AE3A 4RMFA 1KXLA 2H5XA 4GN4B 3E9HA 4B3MQ 3E9IA 2D62A 1OXUA 3MXNB 4LWCA 1U5KA 1UE5A 3W5OA 2VQEL 2NZHA 2EQSA 2VNUD 5JEAJ 1AE2A 1VS0A 2RHQB 3ERSX 2C35B 1UE7A 2N78A 4PZ6A 4C3JH 3BJUA 2I5MX 1IBLQ 4JI5Q 4JI6Q 5M5YH 3HKSA 3I4NG 3UE1A 1BBUA 3CXCA 2YU9H 1K9MC 5JJLA 3S17H 3JAMc 1C9OA 1W3SA 4DR1L 1EIFA 3PUVA 4X62L 4B3RQ 3LGJA 4HJ8A 1PV4A 3FHWA 4GKJL 2A8VA 4JCVE 1EWIA 3M3YH 2E5LL 1E22A 2ALYB 1PVOA 3BU2A 4JI2L 3PSIA 5C44G 4P73A 3I4NH 3L0OA 2LXJA 1ASZA 4IOCA 1UWVA 2NZOA 3CCLA 4JI2Q 4MZ9A 2QA4A 2YTYA 1IXRA 2VQFL 4LF4L 4Y52H 5IYBH 3K7AH 1SROA 3NEMA 4A3CG 5FPOA 1TA8A 1TWCH 2HQLA 3I4MG 4A3LG 3FKIH 4A3DH 3J7A5 1L1OA 1HJPA 1QUQA 4DV1L 3H0GG 5IP7H 3A74A 1LM0A 4YWLA 2VW9A 3HOWH 3L2PA 3CC7A 4A76A 5IP9G 1IL2A 2F4VQ 5E7NA 3JSNA 2JQOA 3AQQA 4YHHQ 2JEBI 3D0FA 4P74A 3UDGA 1XMQQ 1KQSA 5IWAL 4DR7L 3TY9A 3VDYA 1HR0Q 1XPRA 2V1CC 3A0JA 2KBNA 5IYBG 1XTDA 3S16H 2ZJQA 2ZM6Q 2JEAI 4K0KQ 2OCEA 3BABA 1J5EQ 4DUZQ 1YZ6A 4R4CA 4NB3A 4JI8L 4DV0Q 1B8AA 1LTLA 3K81C 4JOIC 4CC5A 1SN8A 2JJQA 1YEZA 4Y7NH 3CCEA 3T1HL 1Q86C 4DRFA 1QUQB 3S2DH 1YBYA 4XIGS 4LF9L 4JI1L 3H3VH 4OWXB 1EIYB 4QQBX 3JSLA 5J3BA 4UP8A 3PN1A 1YJNA 1L2FA 5C4XH 5C4JH 4HIOA 4QJFA 4JI1Q 1SMXA 4IFDI 3GDEA 3UDFA 3F1ZA 1XPUA 4IFDG 4R4IA 5FLMG 1PYBA 3CMEA 3G4SA 2UUCQ 1Q12A 1AH9A 5LMUQ 4DR7Q 2Y0SE 4PG3A 4PZ7A 2GN5A 4JI4L 2AKWB 2ZM6L 4K0KL 3PUYA 3OW2A 3HOYG 4HJ5A 3NBYB 3HOUG 3TS2A 4DV1Q 2F3IA 5C4XG 4BBRH 1N33L 1WI5A 1V9PA 4JG2A 4YHHL 3S15H 2BA1A 1IBMQ 3I7FA 5FLMH 3GTKH 4A3LH 3GTLH 1KC8C 4UCTA 2PQAB 3OYYA 2VUMG 4IFDJ 1TAEA 3ER0A 4DAYB 4UCUA 4OONA 4LF5L 4DV6Q 1VQ4A 1HNZQ 1HNWQ 1J6QA 1X3GA 1NY4A 4A4IA 1CSQA 2YTVA 4GNXC 1XJVA 4NXNQ 2JA6H 4IOAA 2PNHA 3T1YL 3CCRA 3W1BA 1WCMG 4IJLA 1XK5A 4DK3C 1VQ9A 2RCNA 3PCOB 2MFIA 4QGUA 4C2MH 4P71A 4LF6Q 1JMCA 4A93G 1DGSA 1YIJA 4GLAC 3ULJA 1EQRA 4TQUS 4DR3L 4GOPA 4YY3Q 3TS0A 1EYGA 2NVQH 2VL6A 3BZKA 3J81c 4DR1Q 2WB1G 2XGTA 1GD7A 3NENA 3KJOA 4JI7Q 3WWVA 4OXPA 2XTIA 3HOVG 1X65A 3ZJYC 1E1TA 2DGYA 3HOZG 2R6GA 1J5EL 3BA8A 1V43A 1BKBA 1WCMH 4DR4Q 3J80i 1HR0W 3GB8B 2Z0SA 1NMGA 1A0IA 3HOXH 2VS1A 2Y0SG 4DNIA 4A3CH 3EN2A 4LUVA 3HKZG 4DV3Q 3PUZA 3S1QH 1D8LA 2YTXA 4LF5Q 4KHPQ 2UXCL 2PQAA 1VQOA 4R4QA 5C3EG 3M9BA 5JJIA 2HIVA 3CCUA 2WAQG 4BY1G 2PI2A 4OO1G 1B04A 1CUKA 1Q1BA 3RR5A 2R93G 3CPFA 1SFOH 2JK8A 5FPRA 4MTNA 4PMWA 1PYSB 1MIUA 1QVGA 4DV7Q 4LFAL 4O0AA 4EFBA 4BBRG 4A3MG 2ZTEA 5IY0A 5LMUL 4X64L 3M4PA 5IYCH 4DV5Q 5C3EH 1PH7A 1VQKA 1PH4A 3GO5A 1Y1WG 2HVQA 1XNQQ 4A3GH 2JA8G 2JE6I 3S14H 2IHEA 4AH6A 4LF8Q 4QL5A 4LUOA 4NPSA 2R93H 2ASBA 5IYDG 2UUBL 4A3BG 4DR6L 4GOPB 2OTLA 1JJCB 2IT1A 2E5LQ 1S3OA 1I94L 2HHHQ 2UXBL 4IPCA 2N8NA 1B70B 1JE5A 3NBHB 4R4TA 4BY7H 1YHBA 1K73C 1EFWA 1PA6A 5DLQE 4X6AH 3TY8A 2MO0A 4AYBE 3CF5A 2D0PA 4HJ9A 4L5SA 4AQYL 3RNUA 3PGZA 3M7NA 4OWTB 3HKZE 1HZBA 3S1NH 3H0GH 5IP7G 1M90C 4QIWE 1VQPA 3KF6B 2KCTA 1C0AA 4KHPL 3KF8B 3GTMH 2K50A 2I0QA 3GJXB 1B7YB 4AQYQ 1FVIA 3AFPA 1QZHA 1A8VA 3J7ZC 4B3ML 3GTPH 5K36G 2HVSA 4NXNL 2VY3A 1PHJA 2I5HA 1I94Q 3RN2A 4ALPA 4JI4Q 4H02A 2UUBQ 1OXTA 1VQIA 1S40A 1A62A 1VQNA 1YVCA 2QEXA 2WP8J 1YHQA 3B6YA 2CKZB 5AJ3Q 1SLJA 4DR5Q 2YV5A 3G48A 1JJ2A 3TY5A 1NTGA 1XNRL 3CCQA 4YCWA 1V1QA 1VQ7A 3H3VI 5JJKA 4UCVA 4JBJA 4OX9Q 1TWFH 3MEFA 1E24A 4NXMQ 4LFBL 4L5QA 5IWAQ 3G71A 1IYJB 1W2BA 2HIXA 1IBML 3I4OA 4X62Q 4GNXB 2BA0A 3PO3G 1I6HH 1NBWA 1U0LA 3K0XA 1RL2A 5IP9H 3F2CA 3CP0A 4A3FG 4LFCQ 1CKMA 5DISC 4R1JA 4JI8Q 3RZOH 4RG1A 1QZGA 4GS3A 4LW1A 5M3MG 3CD6A 1Y1VG 4BXXG 1OXSC 1YJWA 1UE6A 4LH6A 3KFUA 4UCOA 2CFMA 3HFZB 4B3SQ 1HR0L 1PH9A 4LF7Q 4IPDA 2VQFQ 1XMQL 2VUGA 1K8GA 4JI3Q 3GTQH 1L1OB 2AWOA 2VQEQ 1L1OC 3KOJA 3KYHC 2K5NA 1N34Q 1VQ5A 4DV4L 3GTGH 2N3SA 3GTOH 5M3MH 4MNOA 1EUJA 2K14A 1VQEA 2WAQE 2ZJPA 2E2HH 4LF9Q 1HZAA 4NXML 3KDFB 1VQHA 4A3JH 1GVPA 3T1HQ 4A3KH 3FKIG 2RF4A 1Q1EA 1OXXK 2JA7H 3T1YQ 1S68A 2E2JH 1Q8KA 5AJ3L 2Z6KA 3U4VA 4X66Q 3S24A 3CCMA 4UP9A 4DUZL 2UXDQ 1N8RC 4LFAQ 4DV7L 4EFEA 4UP7A 1TWAH 3KLWA 3CMAA 4DUYL 4X64Q 1VQ8A 1VQLA 4GKJQ 1CKNB 3DM3A 2FXQA 1PH8A 2IHFA 1JB7A 4GN3B 3M85A 3UE0A 4BBSH 1QVFA 3W1GA 1BBWA 1FJGQ 1KHIA 2F4VL 1MJEA 2IX0A 4JBMA 1X56A 2BH2A 2ES2A 5ELOA 1X55A 2KHJA 4UFZA 2K75A 4BY1H 4UY8C 3ULLA 4DK6C 1Q46A 4B3SL 3Q8DA 4JBWA 4EQ5A 3ICEA 4GLVB 3K80C 4TVAB 1GM5A 4X66L 3KJPA 4AIMA 2IY5B 1HH2P 4UCSA 3PO2G 1TWGH 1VQDA 2Z6KC 4C3HH 1ASYA 4DR4L 1T9HA
chains in the Genus database with same CATH superfamily
2CW7A 4EYIB 2VPQA 3HOWG 3KBGA 4J9NA 3JC66 4JYAQ 4RNNA 2Q2UA 1Z47A 4QWDA 4FS2A 3NQIA 4ECWA 5JH7F 2JYOA 4PMBA 3S1MH 5NUCA 2IWHA 1Q81C 3MWEA 4HN7A 2R92H 1HNWL 4K8IA 5GAEC 2N55A 1VQJA 4F8MA 1VMPA 2ID0A 2R8GA 2EJMA 5DNFA 4ECQA 2B29A 3PIPA 4ZUIA 4LMQD 4AYBG 5HURA 3CCVA 1KRSA 4O2DA 3UDXA 3R23A 3E0EA 2IX1A 3ND8A 4X3SA 4FXKC 1JDEA 1FGUA 1EU4A 1I5FA 1TWHB 4EQOA 1IBKL 2V58A 3PIOA 1XMOQ 3H15A 4QIWA 4NDXA 3QIAA 1E3PA 4HIKA 4O7VA 3PUWA 1A3TA 3VR2A 5K3WA 1LABA 4HIMA 4QWAA 1RTNA 1EYAA 1I6HB 4O2BF 5DLGA 3RMHA 4QY7A 3QOJA 1I50H 4WJWA 2UU9Q 3BACA 2K32A 1I4RA 1U4RA 1KD1C 2ZDGA 3TINA 1Q3LA 2LXKA 3HOYH 1C7YA 4JC0A 1R9TH 3I56A 1VQFA 5DQIA 2Q2IA 5KFLA 4CGYB 5KFJA 1Q8IA 1GSHA 3OMGA 4LF9H 1FJGH 3I2ZA 2F52A 1GUOA 3GIPA 4EBCA 4KHZA 4R8IA 2BCOA 2EJ3A 4GN5A 1M1KC 1F77A 1HZ9A 3H0GA 2RDJA 3UDIA 4KY6A 4OO1I 5FO9B 1RCVD 2HVRA 4IRCA 4K6NA 2F0EA 4O4IF 2J9GA 1WSCA 1X54A 3SVMA 2PPBC 3AX6A 3OOCA 3NELA 1M0WA 1Z2NX 4YWKA 4DUYQ 1HQMC 3HOVH 4WBNF 1KEEA 3HOZH 2HCIA 3D6CA 3VPCA 2HUGA 3AFQA 5KNBA 1LO5D 5DG9A 2F0UA 2FLNA 3F8TA 4IWYA 5GROA 3CC4A 3L4JA 1SE8A 2VPSA 4A3EG 1NAPA 4R4OA 3T16A 4RB0A 2KHIA 1N48A 3D31A 2HHHL 5A2QW 3T13A 1PH1A 1XNRH 4ZOLF 2K52A 3EIVA 2PO4A 1S5BD 4YY3L 3W2DA 3A5ZB 1F2YA 2Y4RA 1JT8A 5IT9c 4A3IH 1IBKH 1AFPA 5C3WA 1XNQL 5DQGA 2PCFB 4O7SA 4DR2H 3NSWA 2PN1A 1W6KA 2RQXA 1VCIA 1U4PA 3PW7A 4B9XA 2J7ZA 1Y1WH 3U54A 3KF6A 1BXTA 1JE4A 2J4XA 4JI5L 4U673 5C8YF 5IYDH 3GTMA 1BCPB 4LFBQ 4JI7L 1TVXA 4UCRA 2ATLA 2E8GA 1C3OA 3E0JA 4IJHA 3RZOB 3UZOA 1A6XA 2JA5A 3C46A 4IPGA 5CC4A 3PF4A 3RLNA 1B50A 5CV7A 4J8QA 4DV5L 2BQ3A 3EQLC 4GNXA 3WWHA 1TXYA 1H9SA 4HSPA 5GAGC 2COIA 3MR5A 1DOKA 2K4KA 3PW0A 4X65L 1XPOA 4HIDA 4RNMA 1S9FA 1YITA 4DL4A 1GLVA 4A3EH 4DAPA 4IALA 1WOCA 5C0XG 2E2IH 4RCOA 1RJPA 5L1KA 1E2ZA 4R7RA 1CA6A 3DLLA 1EYCA 5JQGF 3H94A 1CKNA 2F0VA 3NUCA 4YJ2F 2EYHA 4LUZA 4C3HG 4I4TF 4AYBA 4LFCL 5EKKA 2L12A 1SJED 4ZAIA 4ZKBB 2Z8LA 3JAML 2DNEA 4DR2Q 4GZYC 4QCLA 3D6WA 2XC9A 4ED0A 4KTAA 4DNRB 2UXCH 2HQEA 1FL0A 2F0MA 1G51A 3SK5A 1DD2A 1AW7A 2A1HA 1PH2A 4X65H 3BVGA 3GIMA 2R7DA 3ITPA 5M5XH 5LMNQ 3M4QA 4GKKL 1HA5A 3OWEB 1Z7TA 2F1MA 2SNMA 3T51B 3TP5A 4O3OA 3RUPA 2QEJC 1PTOC 4GN4B 3NTKA 4B3MQ 2D62A 1OXUA 3MXNB 4CKCA 3Q0AA 3A54A 3W5OA 2DIKA 4LF5H 1EKFA 2C35B 2RHQB 4O4JF 3I72A 1PFNA 4PZ6A 2AGOA 5M5YH 5KT2A 1GHJA 2B8GA 3TZDA 2BE5D 2BE5C 3UE1A 4KD3A 1QJOA 3RUZA 5KFNA 2ICEC 1HTPA 5DM73 4JK1C 3IFTA 4YY3H 5DMXA 2A6EC 5I5YA 4B3RQ 1JICA 4I7HA 4A3KB 4HJ8A 3ETHA 4C56C 4GKJL 4J9OA 2A8VA 2YU9A 3TIIA 3EPIA 1KJIA 2EOTA 2F0DA 2XRSD 2DN8A 5IOCA 3I4NH 1DJRD 3LX0A 2E2DC 3IKJA 2A6HD 1AP0A 4MZ9A 4O3NA 4C2MA 1V1PB 1J8IA 4FU0A 4JV1A 1TA8A 2X0SA 2HQLA 1A3GA 3TBIB 4M7EA 4A3DH 2HJWA 4G4KA 1Z2PX 1STGA 4DV1L 5IP7H 1G2WA 3TQTA 1IL2A 5IP9G 4A3BB 2JQOA 3R2IA 1OO9B 3VYRA 4KY7A 5IWAL 3TY9A 5IWAH 2V1CC 4FGRA 1PLFA 2RSOA 1XTDA 3BABA 4APMA 1JWSD 2JA5B 4O3SA 4DUZQ 3PW5A 3HS0C 1BDOA 3K81C 2F0LA 3I4MB 1OBDA 4ECVA 4RCNA 3A55A 2JJQA 4DRFA 1EIHA 4Y7NH 5FK9C 1QUQB 4XIGS 4LF9L 1TWAB 3H3VH 4QQBX 2R7KA 1YJNA 1KC7A 5KX5F 3T7AA 1SMXA 4R9WA 3GDEA 4IFDI 2PZTA 2I87A 1TWFA 1LTTD 1M6VA 1Y1VB 1O80A 1BCPF 5JOBA 1AH9A 1LV9A 2KSWA 4O84A 4DR7Q 2CNVA 2I8CA 4PG3A 3K3PA 4JI4L 3K57A 2ZM6L 1O7YA 5DGIA 5KT6A 2FK3A 4RKBA 4HJ5A 4FBTA 1PFMA 3HOUG 3TS2A 3S1NB 2F3IA 4DQNA 4WORA 5C1OA 4FXDA 4YHHL 5LXTF 3IN5A 1ENCA 1BF4A 5FLMH 3GTKH 4MHEA 4KMUC 2PQAB 2VUMG 4IFDJ 1FYCA 1QILA 3ER0A 4BY7B 4DAAA 4DAYB 1MZBA 2J6TA 1NCVA 4YAKB 1F2LA 4LF5L 1HNWH 4A4IA 2Z1CA 2YTVA 1XJVA 4GNXC 4IOAA 2NVYA 2HCCA 5KG5A 3CCRA 4HN2A 1D5XC 1MD2D 1WCMG 2W9CA 1XK5A 3T9FA 3PCOB 4CJ1B 3OMCA 2HHFB 1A15A 1JMCA 1B4OA 2B8FA 4GOPA 1EQRA 2F4IA 4FBUA 2W57A 5FOBB 4RWSC 3G7LA 2SCUB 1TS4A 4DR1Q 3J81c 2WB1G 1GD7A 3HOVG 4JI7Q 4OXPA 2XTIA 1EU3A 3ZJYC 1I1KA 4LMYA 1V43A 4OIJA 3J80i 5E1FA 2Z0SA 1E4FT 1A0IA 3NP8A 2VS1A 2Y0SG 5C4ZA 3HOXH 3EN2A 4A3CH 1HHVA 1K28A 2AUKA 1CHPD 3S1QH 4KHPQ 2P0AA 5J2UF 2WE6A 2IPKD 2IW3A 1O7ZA 4JV0A 3M9BA 5D3IB 5I5UA 1RK6A 4KHVA 2PI2A 2K01A 4J9MA 2IMWP 1AUXA 1DV2A 4LFCH 1H9MA 4JUZA 3BQ1A 1BUVT 1E0BA 2JK8A 2AQ2B 4BY1B 1EY8A 2KECA 3BG3A 5KFAA 2K6AA 1PZJD 2EYFA 5M3FB 5IYCH 5JVDF 4MV8A 1B1ZA 4ED8A 2X6LA 5DG7A 4FFOA 4QL5A 4YR3A 1JCKB 2IL8A 1IYEA 3IAYA 4A3BG 1WTVA 1JJCB 1S3OA 4QF4A 2E2JB 1VF7A 1JE5A 4R4TA 4BY7H 5CV4A 5LL6S 3CF5A 3M7NA 3S1NH 1KJ8A 1XMQH 1IL8A 3QJYA 3GTGB 3AB9A 4KHPL 1SBBB 2K50A 4JI7H 2A6ED 2UVRA 1ZYRD 2JEGA 1D5ZC 1K83B 4QWEA 3J7YW 4JI5H 4FP5D 4B3ML 1DIKA 1XXGA 5CA0F 2AQ4A 2VY3A 1PHJA 1I94Q 3VR6A 1JX4A 2BDOA 1PFBA 4JI2H 2PVPA 4Q8EA 4UDUC 1VQNA 2LFNA 5JEAH 2QEXA 2F0QA 4HR7B 4IURA 3RB4A 2MHVA 3BYYB 1YHQA 5FLXL 3U0GA 4EVOA 5AJ3Q 1JJ2A 3G48A 1B53A 2C00A 2PZWA 5FD5A 2V4QA 3TP8A 3LWBA 1E24A 1RK5A 2F0NA 1N32H 4B3TH 2K04A 3WDNA 3MWMA 2O2LD 3K0XA 1ULZA 1ESRA 2EZVA 2WIIB 3CP0A 3VPDA 2B2VA 4R1JA 2Q7DA 1EWHA 1RF2D 3DUZA 2P5ZX 4LW1A 3CD6A 2YZLA 4G7OC 1Y1VG 4KKSA 4ECRA 4OX9H 2HGSA 3JZIA 2VQFQ 5L1LA 3CVZA 4WRDA 4WD3A 2XD4A 4F50A 1ENAA 5BR8H 1L1OC 3KOJA 2K5NA 1VQ5A 1RJQA 4DV4L 3DWAA 4K5WA 3VPBA 5BN4A 2VUMB 1EUJA 3GLKA 3VOTA 4NXML 1YNJD 4EG0A 1SYXB 3DM1A 2VB2X 1VQHA 3KDFB 1GVPA 3A8JE 3EA6A 5IGEA 4A3KH 3TP6A 4HYKA 5T1GA 3FKIA 1UUPA 4IFDH 1OXXK 1ZAUA 3T1YQ 1DZ1A 4JV5H 2Z6KA 1J9OA 3U4VA 2IBKA 4DUZL 4UP9A 4X3TA 2NTTA 2UXDQ 2WAQA 4DV7L 1TWAH 3CMAA 1EWCA 3Q2OA 3N40P 4L6TB 5M5YB 2WACA 1V4YA 4ABNA 3M4OB 2W6ZA 4RGTA 3X3NA 1BBWA 4K2LA 3S1QB 1KABA 2MP1A 3OHAA 3HOXB 2DJFC 2KEDA 2GQSA 1X55A 2KHJA 3NE5B 3R3OA 3QB3A 3MFIA 1SFOB 4MV6A 4A3FB 2BR0A 5FD6A 4FFLA 3K80C 1BXRA 3I4LA 3RBEA 1FGBD 4ILWA 3PO2G 2AGQA 3IRBA 1AZPA 3FMAA 3H6MA 1T9HA 3S1RB 4OWWB 2HT1A 2FPIB 1J5EH 4RB2C 1LTAD 1HUNA 4I7ZC 1EIGA 2CQAA 1HNXL 4KJOA 1BVSA 2PQEA 2JXMB 3T9EA 2SEBD 2R8HA 4K14A 1JC7A 1EKPA 4GKKQ 2OTJA 3T1YH 2Q8IB 3J80W 5EZYF 1RIPA 3DTFA 3SDZA 2ZGIA 1CS0A 4JXUA 4C2MB 1H9RA 3M4YA 1YNXA 5C0XH 5FJ8G 3PW2A 2UUAL 3MWDA 1UE1A 1AZQA 1VQ6A 3RTXA 3J7AV 3LP8A 4NMZA 4EEQA 3GILA 4XT3B 3GIDA 1Y1WA 3U4ZA 4DR2L 2FINB 1Y1VH 1XNQH 1PRTB 2R92G 2CZGA 4YCUA 4FDBA 3RLFA 2GPSA 2ZTDA 5ELNA 3BYTB 3S15B 1LTSD 3F2DA 3IL8A 1SYFA 5CV9A 4MV1A 4EBDA 1SXTA 3BS1A 3QQMA 2NVTH 3RF2A 4DV2L 1S0OA 5LMNL 3N41B 2NN6G 2XVSA 2J6UA 3K0YA 1EEFD 2KCMA 4KKUA 4PZ8A 1LACA 2QGQA 5LL6X 1HNXQ 1TWFB 3HOXG 1A63A 1VQCA 1VQBA 4WJ3M 5EWFA 4XTCS 3JAMi 4MV9A 1QOHA 2LS01 3WWJA 1EQTA 5IT9L 2UU9L 4OIKA 2Y0SA 1I6VC 5DGAA 4HJAA 4LAAA 3MFYA 2W6MA 3R2TA 1D1KA 1TKWB 3RLOA 5C1PA 1VDZA 2CVRA 4V190 4TQRA 1CSPA 4EBEA 1DCZA 3DEOA 1BO0A 2A6HC 4P75A 3S1RH 2RDFA 4KD4A 3EROA 5J1ZA 4A3DB 1EKVA 1NMFA 1VQAA 1WYDA 1SNCA 3VNNA 3OSPA 4POGA 4DV1H 5KFFA 2KCNA 3E5NA 2TMPA 2XWBB 3FP9A 4ZQ3A 3U9OA 5EJWA 3UI2A 4A75A 2W9CB 1P16A 1HZCA 2Y0SB 2V59A 1FJGL 3TSSA 2HD3A 5EBDA 3J80E 2NVQB 4S3SA 1S5DD 2VB3X 2E2IB 4NYEA 1SEBD 1IBMH 1E1OA 2W8LA 2R7ZG 1KAAA 1I50A 1SE3A 4XDXA 3G6VA 3WO0A 1LT6D 2KJXA 2AGPA 2DAAA 3SE7A 4LF6L 1SYEA 4B3TQ 2M05A 2EY1A 3M3YB 4DL5A 3PR4A 5IYCG 4R8UB 3GTOA 3MAQA 3L7ZC 1XMOH 4NP5A 4DAVA 3NPPA 2A19A 3S17B 1F9SA 3C1FA 1G6PA 3I8ZA 2OQ0A 3FVQA 1PX2A 1W96A 3VA7A 4I55F 1QE6A 4NLGA 4JBKA 2B2WC 5D1OB 5M5XB 2NVYH 1PRTD 4FFNA 3KLRA 4GOPC 1PFSA 1FNVA 1JORA 4JVZA 5IGGA 1EZ8A 1GUNA 1SMYC 1EUDB 4AQYH 4FE2A 1PTOH 1X9NA 1F9QA 2JA6G 2C2EA 3G6XA 4K6DA 2VOBA 4BBSG 3GTJH 4YIJA 2L15A 2RGVA 3SGIA 4C3JG 5HGTA 2NZ1D 4LH7A 1TWHH 1L2ZA 1X6OA 3E3XA 2ATWA 3DTGA 2YS6A 4DNTB 4LF7L 1Y14B 5FO7B 2BH8A 3AYHB 2UUAQ 1SFOA 5KT7A 2ZXPA 4BA1I 5C0XI 4JI0Q 5I5SA 2EDGA 2XWJB 5DEHA 2ZXOA 5HGQA 5M3FG 4LNQA 2B2UC 3S9WA 1GO3E 1RKNA 4A3KG 3CW2C 1RDPD 3K8AA 1HQRD 2NVXB 4HR7A 3CHBD 4R8NA 4DAMA 2UXBQ 1BJTA 2B3GA 3A8KE 4QIWB 5F9LA 1UEBA 1NNXA 2F0PA 1D7QA 4DR3Q 5GQOA 1VQMA 4DK0A 2PI2E 2W8KA 3PMFA 4J15A 1ICWA 4DXGA 1S72A 1KIXA 2UXDL 4RA8A 1A48A 1LUZA 3HEJA 5EKIA 1BR9A 1D6EC 1WTPA 2R7ZH 5KFZA 3TN2A 4QW9A 4KI0A 1KXLA 3PO3B 1I1LA 2JA6A 1LTGD 2O4XA 5E4WC 4G7ZC 4X3KA 2R86A 5KFCA 3LWEA 5IGFA 5CBAE 3QFFA 2J6SA 4OL7A 5JQWA 2ASJA 3ERSX 5DAUA 1UE7A 1SYBA 1LT3D 5E4XA 4C3JH 5LHY1 3PIO3 4JI5Q 4EQPA 4A3IB 1SE2A 5CR3A 5C5MA 4Q43A 3KLSA 1BBUA 3CXCA 2YU9H 4O7YA 3OW7A 5JJLA 5FKAC 1W3SA 4ED1A 3Q8PB 4G7HC 2QILA 2XGPA 1G91A 1RYSA 2ALYB 2HG8A 3I91A 5AFWA 3KHGA 4IOCA 1UWVA 3N44B 1CM9A 5M5WB 1E4EA 1IXRA 4LF4L 5IYBH 1JQYD 2WAQB 5I4DA 1X32A 2F0FA 3K5IA 5EQ0A 3I70A 5K5PA 1JWMD 5K2MA 4I65A 3J81E 2V5AA 3DMUA 4JI8H 1LM0A 3HOWH 4RUCA 3CC7A 4A76A 2CW0D 2YWVA 4TV9F 3AQQA 4PWQA 3D0FA 4P74A 1XMQQ 1KQSA 2BQRA 4RAUC 3VDYA 2XRQD 1HR0Q 3A0JA 3LULA 1RYRA 2O5JC 3S16H 5LA6F 4K0KQ 2M2LA 4C3IB 4A2BA 5LP6F 1B8AA 1LTLA 3NHHA 3N52A 4JOIC 2FE3A 4DR5H 1S0NA 4CC5A 1SN8A 5FLXE 1Q86C 3M7GA 2XNAC 3T1HL 1I4QA 4UAIA 3V05A 1YBYA 1LTRD 4JI1L 4F4ZA 1CHQD 3L3OC 3QOLA 1EHIA 1EIYB 3TW6A 4O3QA 4CDCC 1IYUA 2A69C 2FK2A 2F0TA 4B9WA 1G8ZD 2JA7B 2OLSA 5E25A 4F88A 5JUMA 3C3LA 4R8UA 3G4SA 2PBZA 3TP7A 2E2HB 4O86A 4CDFC 3X3MA 4X62H 4K0KL 4O7TA 1HFNA 2MCTA 3PUYA 2UVUA 3NBYB 3BZDB 4FFPA 2WKDA 5C4XG 1V51A 1WI5A 1HUMA 1V9PA 4U6PA 2BA1A 2F3WA 5KG1A 2WKCA 4KK7A 4RZQA 1KC8C 1F9RA 2A74C 1D1IA 5BWXA 3RJ0A 3GTPA 2YZGA 2DJGC 1U9RA 4DV6Q 2Q8RE 1Y8PB 3W1BA 4IJLA 3ZYYX 3EJIA 1VQ9A 3GV3A 2MFIA 4DL3A 1IW7C 4EGVA 5DM63 4ECTA 2PNRC 3ULJA 1EYGA 2SDFA 4WHXA 3SEBA 2A68D 4XQJA 5CV6A 2B2TA 3ORQA 3BZKA 3CQZB 2XGTA 4QSHA 4O3PA 4J9RA 3WWVA 1X65A 2YRWA 1SYDA 5T1IA 1E1TA 3MVVA 5C6AA 1PRTF 1WCMH 3FPPA 4MV3A 3GB8B 5BWTA 2W9BA 2SNSA 1IHZA 5BPHA 4IUVA 3HKZG 1K8MA 3DEPA 3PUZA 2YTXA 4LF5Q 1ZXTA 4RKLA 5KNDA 1E4EB 5FR9A 5JJIA 2HIVA 4XT1B 3EFXD 1Y8NB 4BY1G 4ECZA 3KLSX 2NVXA 3ERQA 2RKSA 1Q1BA 3BVZA 3NQTA 2R93G 4YP3A 4Q0YA 2F4VH 2TSSA 2GQRA 1QVGA 4LFAL 5HV6A 4EFBA 2LY7A 4ECUA 2ZTEA 5IY0A 5LMUL 5I2YA 4X64L 5HBRB 2WB1A 1PH7A 2R85A 1I4PA 1PH4A 1VQKA 2JA8G 5ELBA 3S14H 1KDAA 5D65A 2IHEA 4AH6A 4LF8Q 3TW7A 1GUTA 5JVLA 4NPSA 2HDKA 1TS5A 2R7ZA 1WCMA 3K5LA 2NN6H 2IT1A 2BOSA 2HHHQ 1CE8A 2UXBL 3KHRA 5ELCA 1QCBD 5M9OA 1EFWA 5DLQE 3Q8QB 1WTXA 3TY8A 4C3JB 2MO0A 4AYBE 3WO1A 2D0PA 4RGNA 3LWUA 3PGZA 3D4RA 3J80L 1JWUD 1OWTA 1HR0H 5L1JA 3H0GH 2QCPX 4RGOS 3KAJA 3KF8B 2I0QA 4NZMA 5ELEA 1LLRD 2L0CA 4AQYQ 1I7NA 4ZRZA 1FVIA 3HKZA 2V4RA 1R9TA 2RDHA 1QZHA 1A8VA 3GTPH 4NXNL 2R7ZB 3FPUB 4O4LF 4FM9A 3Q1KA 2MGSA 2ODTX 1BGWA 1OXTA 2E5LH 2K7VA 1A62A 2ZDQA 1JDBB 1STNA 2HGWA 1C4QA 4M1UB 2CKZB 4K5VA 3DXJC 4N9PA 2ASLA 3HGBA 1SLJA 4ID6A 5DQHA 1NR4A 5JJKA 2R7MA 4JBJA 1EOTA 2F0HA 4IR1A 2O5IC 4LFBL 1MBYA 5G3LF 5I47A 4DL2A 3D3RA 1JOKA 3PO3G 1SE4A 1MHWC 2B2YC 4DV5H 5DISC 4A3FG 3F2CA 4LFCQ 2R6FA 3CQZA 1CKMA 4JI8Q 3RZOH 4RG1A 5EKLA 1H9KA 4FNFA 2R92A 1KDCA 4B3SQ 5I5XA 3FDSA 4IPDA 4BBRB 2AQ1B 2OEOA 1ILQA 1ML0D 4O1NA 1NUCA 1L1OB 3LNNA 3HBLA 1SMYD 5KFPA 4OGQC 2C28A 1PTOB 4EGJA 2LMCB 3GTOH 2JP1A 5M3MH 4J9KA 4FF2A 1VQEA 2K5QA 4LF9Q 3UZBA 5DG8A 2NVYB 3RD4A 4ZLTF 3M4IA 5D14A 4RHRA 1SSOA 3GTOB 1I6UA 3S24A 4RZRA 2F0KA 3ND9A 4EFEA 3E6ZX 4UP7A 3KLWA 4JYAH 5LMUH 1EL0A 2FXQA 4PBCA 3J81L 2W6PA 4GN3B 3M85A 1RTOA 3R8BA 2UUCH 2X6GA 2F4VL 3U9TA 1Z6HA 1EEID 4YJ3F 5EBCA 5IGDA 5I5WA 2BH2A 4OO1H 4UUGA 3WOFA 4UY8C 3ULLA 4B3SL 2FK1A 4QW8A 4GLVB 2CH4W 4TVAB 3LQSA 4JI3H 1VMCA 3UFXB 4XYQA 4X66L 2A69D 5DGBA 2X69A 1TWGH 4CKBA 2ZJPA 1SNQA 1ASYA 4DR4L 1GJXA 4P72A 1VBHA 1ZKOA 1TS3A 1NJIC 4ZKCB 3M9MB 1ENFA 4KY5A 4B3RL 1VQGA 2EIYA 3SHLA 1JJGA 2JEIA 2XIWA 3KF8A 4LF8H 4DV0L 1G2SA 2GLTA 1F9PA 1VBGA 3G8CA 4DV6L 3J80c 3GTPB 1HPCA 2B63G 4Q45A 3F2BA 4DV2Q 1HXYD 2K5DA 2DUDA 5L1IA 1V8QA 4PV1C 5I6YA 3CKIB 5M3MB 1IBKQ 2BDNA 4JI0L 2FPPB 4UHVA 1UNNC 1CKOA 1PH5A 3H4DA 1S5CD 4DR4H 3GV6A 4FFRA 2ASDA 2YZNA 3NBZB 1TY0A 1K1SA 1MSGA 1YJ9A 5KFYA 2COJA 1CQVA 4L5TA 4JI3L 4IN3A 1WTWA 1N33H 1FD7D 2MO1A 3J7AF 2JA8B 3BDOA 4ZK9B 4A3MH 2FP4B 4K0KH 2RDGA 1K1QA 1PH6A 1Q82C 4CJ0B 3VYTA 3H20A 2AWNA 3GD7A 2GPWA 4H13C 2MPMA 5KGUA 5D3DA 5JVG3 4ECYA 4A3IG 1B44D 4JYAL 3KTMA 2CWPA 3ULPA 2WYOA 3R5XA 1TWHA 1H95A 3DF7A 4TRDA 3CU7A 2NYZD 2F0OA 3OHXC 4M0JA 3BDLA 1BCPD 3L9AX 4H0LC 4O7WA 3MJFA 3K5NA 2EIFA 2R8IA 3GTJA 2I5LX 1PTOD 2F03A 5A35A 1EOVA 2I80A 1IZ6A 1KJ9A 3OPOA 4EQNA 1HA6A 1TS2A 2ZT9C 1IBLL 4JI6L 3RB3A 3MR3A 5BPFA 3V6HA 1C8CA 3CCSA 5GADC 2W6OA 5HY6A 3C0FB 2B2YA 3F2UA 3RGXA 1N33Q 3CCJA 4DFAA 5DGHA 1WJJA 4LF4Q 1X3PA 2VZAA 1CQJB 3CQZH 1WD0A 1B9NA 3H0GB 3PIP3 2RCFA 3FRPB 5IIFA 4O7RA 3CPWA 2VQFH 1HNZL 4BBSB 4Q44A 4JV2A 4LJZC 3LMLA 4YWMA 4A93B 4LFBH 4OEMB 3PO2B 1LTBD 5C44H 2V4DA 2EY2A 3K5MA 4PNYA 5M5WH 3MHBA 3K58A 4FYDA 1YHAA 2PMZE 3PF5A 5IE8A 4NXNQ 2K5HA 2Z4HA 1E7ZA 3TQYA 4A3FH 3S14B 4DR1H 1HFGA 3GQCA 4LSXA 3TEKA 3BVMA 2EYLA 2E76C 4N8X1 1HTLD 2L4NA 1X3FA 1RHPA 1GUGA 3T54A 3Q8SB 2PZUA 3M4OH 1PH3A 4C5BA 4CMFA 1OXVA 4Q0FA 2BQUA 2L5TA 4KV6A 3GTQB 4APVA 1XDNA 3L4KA 2C2RA 3V4SA 1DAAA 1F2ZA 3BA9A 4F7XA 2XCAA 3AEVA 2MUYA 1K3RA 1N9WA 5HNEA 4GLXA 3K3VA 4DV0H 3KDFA 1KAWA 4H7BA 4XZ3B 4Q4CA 1QNKA 3O13A 2B63B 4PDBA 4DV3L 2Q2TA 2LSSA 1YNND 1WCMB 4Z9CB 4K2KA 2JA7G 1O7IA 3PO3H 2OQKA 1B33N 2GVBA 5D1OA 1T5XD 1K0SA 4Q4DA 3CRLC 1EZ1A 4DPGA 5BYAA 4C3IH 2OWOA 3U58A 4UPAA 1N34L 1DYQA 3S16B 1GUWA 2CWAA 4E6NA 2CQYA 2R3ZA 3S2HB 1STYA 4O83A 5KFDA 3SI8A 1S03G 2R61A 5H1SE 1CK1A 1EQQA 3R93A 1KLGD 1Q90A 3MR2A 1UC8A 1I1MA 3OTOH 5BR8Q 5D1PA 1N36L 3RZDB 1P8LA 3QZ7A 3TRZA 2NVXH 4JI4H 4JW0A 3VR3A 1T5EA 4ME5A 4MTKA 3CRKC 5I9PA 3U50C 3G6EA 4E6IA 4Q8FA 1B3AA 4IUTA 3RN5A 3OIPA 3HKZB 1G291 5KFTA 1IKMA 1SRUA 3NWSA 2SOBA 4IUPA 4ECSA 3CC2A 2AHOB 2A73B 3STBC 3PZPA 3T9CA 1LYLA 1Q7YC 3SXHA 1AUVA 2W9BB 2WB1E 2FB9A 2HGXA 1VKZA 4O3RA 2FLLA 2N49A 5FLXc 2W7OA 4DV3H 4F4XA 4HJ7A 4MTEA 3BZCA 4EX5A 2PMZA 4DR3H 2Q8TA 1I7LA 1AE3A 3HOUB 2H5XA 4C1NI 4RAYA 4FF3A 2LKVA 3E9IA 3D4DA 1WRVA 5KG2A 1N56A 2PYKA 2QKIC 1UE5A 2B39A 1TY2A 1C30A 1SNDA 5KFKA 2VQEL 2EQSA 4WFN3 2CNUA 5KG7A 3OIQA 4ZUJA 1AE2A 1PYWD 1VS0A 2N78A 3Q8RB 2A68C 2JSOA 2QYZA 4ZYSA 4XQNA 5E3FA 1XTCD 1T36A 3RGZA 5F9NA 2JN4A 2FLPA 2FMMA 4AYBB 1ZETA 3G8DA 1K9MC 3S17H 3U9SA 1C9OA 4DR1L 4X62L 3PUVA 5A2QE 3KHHA 1EY5A 4YR0A 4DGZA 4JCVE 3M3YH 3CSWA 3T5LA 2OH2A 2E5LL 1E22A 1BQQT 4L8JA 3GIJA 5KT3A 1A9XA 4O82A 2LXJA 1L0YB 1HNZH 2KCCA 2NZOA 3CCLA 2UVVA 4JI2Q 2YTYA 2VQFL 3EPGA 4Y52H 1UNSA 3K7AH 1SROA 3NEMA 4A3CG 5A2QL 4G3IA 2E2IA 2CNQA 3FKIH 1U4LA 3MFHA 4XYMB 2W7PA 1HJPA 1QUQA 4C3HB 3HT5A 3H0GG 5KFMA 3A74A 2R87A 2VW9A 4YWLA 4YQWA 3JSNA 1M8AA 5CMDA 3WOEA 5J2TF 1E2WA 5E7NA 4YHHQ 2JEBI 1KDBA 4DR7L 2D5DA 1XPRA 5JPMC 1TT2A 5IYBG 2ZM6Q 2JEAI 1FR3A 1J5EQ 1YZ6A 4R4CA 2UVWA 4DV0Q 3CEBA 3GIIA 4CJ2C 1EY4A 4HAEA 3S2DH 3C2PA 4LF4H 4RGMA 5KFOA 3PVXA 4CMDA 5J3BA 2DPJA 1TIID 3E5SA 4J0MA 3M9OB 1L2FA 5C4XH 5C4JH 4HIOA 4QUFA 4QJFA 4JI1Q 4CDEC 5C4HA 4M9UA 3UDFA 3MXGA 2E75C 4IFDG 4GLWA 1PYBA 2UUCQ 2NU8B 1PXUA 1Q12A 1V1OA 1H9JA 1KTKA 1S5FD 2Y0SE 1O78A 4PZ7A 5BWWA 2GN5A 2NUAB 3P7JA 3H09A 3GIKA 4ECXA 4YBZB 3OW2A 3HOYG 1IOWA 4DV1Q 2R7NA 4BWSC 2M00A 1N33L 4JG2A 3S15H 1IBMQ 3I7FA 1JOQA 4CKEA 3GTLH 4ETSA 4J6HA 1B3QA 3OYYA 3VYSA 1TAEA 4YR2A 1RJRA 4UCUA 3RAXA 2UUAH 1ICFB 4OONA 3I3CA 5KYLA 2G9DA 1VQ4A 1X3GA 4DV6H 1CSQA 4EGQA 2JA6H 2VQEH 2PNHA 4IR9A 1MI2A 4DK3C 1Z2OX 4XYLB 4A3GB 1R4PB 3SK4A 4C2MH 2OT2A 4LF6Q 4K5XA 4CHTB 4A93G 5ISRA 2ZDHA 3GTJB 3GV7B 4DR3L 4YY3Q 2NVQH 1UAPA 1XX8A 4RUAA 2VXWA 2EJ2A 4MN3A 4XXEA 3OUUA 3HOZG 2R6GA 1HCZA 1J5EL 3BA8A 5CM0A 4DR4Q 1WTRA 4PMCA 1ZHSA 2W9AA 1EY7A 3P75A 1D8LA 2PQAA 1SDFA 1B2TA 2KQ3A 2R7LA 3R9RA 1VQOA 4R4QA 5C3EG 4RNOA 5CGKA 2W70A 3CCUA 4OO1G 1STBA 4RHSA 1TWCA 4PQXA 2R82A 1CUKA 3D4WA 1K8OA 1SFOH 4HMIA 1KJJA 4DUYH 3GV8B 2DLNA 1PYSB 1D2BA 3VR4A 1N36H 1OBGA 4RFBA 4IAJA 4NZNA 2ICIA 2YS7A 5EOYA 5CA1F 4DV5Q 4Y8VB 1ILPA 1Y1WG 2HVQA 2K05A 1XNQQ 4A3GH 2JE6I 3N6XA 3K5HA 1ZHQA 4IUNA 4LUOA 4TM5A 2R93H 2JA6B 2EYMA 2ASBA 2B2TC 5IYDG 2UUBL 4GOPB 2OTLA 2R93B 3RV4A 4XYOA 1II3A 4NXMH 4IPCA 1ZYRC 2N8NA 1NR2A 1B70B 3JAME 1K73C 2OF1A 3TZUA 3NBHA 2QDBA 1I4XA 4L5SA 3RIZA 5KFBA 3MXNA 1HZBA 2QF7A 5GONF 4QIWE 1VQPA 3KF6B 4GC6A 1SYCA 4TQSA 5DLFA 1NSNS 1A3UA 3Q6SA 3GJXB 2RSNA 5BWVA 3T9AA 5CV5A 4C3IG 3AFPA 5K36G 3RBDA 2HVSA 5EWGA 4RH6A 3N43B 1EZ6A 2I5HA 4IUQA 5C4XB 3GTKA 4H02A 2UUBQ 4CE5A 1AN8A 2DWCA 3HRZC 1SYGA 1VQIA 1S40A 3JZFA 4ED6A 4YAJB 3BQ0A 3ETJA 5FO8B 1DOMA 2WP8J 1JB3A 3K59A 5COYA 3TIGA 4KN7C 3B6YA 3KBXA 1G6ZA 2KUMA 3MC0B 4DR5Q 3SE0A 3TY5A 1A0GA 1NTGA 1PK8A 1SCUB 3H3VI 1V1QA 1DV1A 5L9XA 2IP4A 1TWFH 2Z6BA 3J81W 4NXMQ 3NK9A 5IWAQ 3G71A 1W2BA 2HIXA 1KNAA 1VAJA 1CTMA 4X62Q 4GNXB 3A8IE 4E4TA 1KLUD 5I2XA 1U0LA 5IP9H 2NVTB 2QB5A 2VUMA 1MSHA 5KFVA 3VYUA 2XIGA 4BXXG 5M3MG 1YJWA 1UE6A 4LH6A 3KFUA 3FKIB 4UCOA 2CFMA 4J1MA 1QNUA 1HR0L 1I3QB 4KHPH 2G5DA 1FNWA 2VUGA 5LL6b 1K8GA 5ELDA 2KVMA 5KFWA 3BJYA 1EY6A 3GTGH 3HG9A 1SEIA 2UUBH 3QZ8A 4FF1A 4F4WA 4XQQA 1HZAA 4DXFA 3HO8A 1T3NA 1S10A 3FKIG 3A7AB 5J39A 1SNOA 2EE1A 1UC9A 3G6JB 4P2CB 2E2JH 1Q8KA 5AJ3L 1HRJA 1E4GT 4X64H 2RBMA 4X66Q 3CCMA 2WDTA 3D8GA 4IQZA 2UU9H 4LFAQ 5KG4A 3MFGA 2NB0A 1I4HA 2Z4IA 4MA0A 5H80A 3MA2B 2CW0C 2PW5A 4X64Q 3NTIA 3DM3A 1W6JA 4DUYL 1VQ8A 2IHFA 1VQLA 2COGA 4I7AA 1QVFA 3W1GA 1FJGQ 1KHIA 2CH4A 3QWNA 2EJGC 3KHLA 4JBMA 1X3QA 1CI3M 5EWEA 2XSCA 2ES2A 2OXPA 5ELOA 4UFZA 1EY9A 4ZQIA 1KJQA 4BY1H 3M9NB 1Y1VA 4ZHQF 1Q46A 4MA5A 3Q8DA 3FEWX 4EQ5A 3T5KA 3ICEA 3W3AA 2EYPA 1GM5A 1ET9A 5LOVF 4H44C 4UCSA 1RJTA 5KG0A 1VQDA 4C3HH 2DNCA 2EYJA 5IT9E 4U68A 4KLKA 2DZDA 1S0MA 2VA2A 3J81i 4ME3A 3PV0A 1RD9D 2FHTA 4HMJA 5KKNB 4J9LA 3K7AB 3MXUA 2FJ2A 1O7LA 1I2LA 1M4VA 1K8AC 4OELB 5C5LA 3SK8A 5EPKA 5CE8A 4DL6A 1PDQA 3P1HA 1XNRQ 4JV5Q 4CC6A 3HOVB 1N32Q 4LF8L 3QWUA 4ME6A 1W93A 1K0RA 5I60A 4BA2I 3VMMA 1KT8A 4L5RC 2VUMH 2Q2HA 2JEJA 2B2WA 3AU7A 1KL9A 3RB6A 4B08A 2KEEA 4MV7A 3EBEA 1XMOL 4DK1A 2R7FA 2K03A 3BAAA 3OUZA 5KT4A 4B3SH 3V96A 3K7UC 2ZM6H 2KOLA 5C4JB 5JPNC 4X65Q 3G6YA 3I55A 1N36Q 4ZI7F 1STAA 2KHSA 2D0OA 4N8FA 2RHSB 3HOYB 2HDLA 2NN6I 2RA4A 3KAKA 2ZJTA 2UUCL 4M8AA 1TWAA 3T4AC 2F0WA 2DY7A 4DN4M 3HOUH 3PFFA 4DLKA 3DWQA 3WWIA 1JLLB 1OTCA 1PZID 2D9UA 2I46A 3CAMA 3JRXA 4DV4Q 3T1HH 4J9QA 2IJ0A 3PUXA 3TEHB 4DR5L 4LSAA 2YZMA 4RAZA 5CB4F 2ZTCA 1Z9FA 2A1AA 2AMCB 1GKHA 2D2CC 3OTOQ 3A5UA 1HNZQ 2Z02A 3PR5B 4DR7H 2ZJRA 4IRDA 1KRTA 3Q22A 3U55A 2IX3A 5BR8L 3I4MH 1IBLH 4JI6H 1ET0A 4IO9A 1EY0A 2JA5H 1K83H 3MTSA 2MQHA 4A3GG 4A3DG 2HHFA 4KKTA 3UQ8A 3V4ZA 2J0TD 3RB0A 1FNUA 4OX9L 3R5HA 1A3VA 1MJCA 2EY6A 4A3BH 2UXCQ 2CQOA 3N6RA 5C44B 2A5HA 2DY8A 2C2DA 3PO2H 4DU9A 3HXLA 1PRTC 2YYZA 2KENA 4A3JG 4B3TL 1Y69U 5CBEE 3S2HH 5LMNH 1N32L 4O7LA 1GOZA 5C0XJ 4MIUA 1L0WA 4GC7A 2HDMA 1SNMA 3GV5B 3H4BA 2JA7A 4RB3C 2WFWA 5IT9W 5D8DA 2GVAA 3F8NA 1A2TA 2E2HA 5BWUA 3EVQA 5KFRA 4BXXH 3NXWA 5M3FH 1YI2A 2EVBA 5FJ8H 5JVH3 2ZXRA 4JI0H 3Q24A 4NXNH 1EYZA 5IYZF 2F0IA 4NW2A 4ZCKA 2VQDA 1I3QH 3STBD 4FFMA 2K28A 4BY7G 2I07B 5GAHC 1WFQA 5I5TA 2F0SA 3J81j 1I3QA 2XCLA 2JA5G 4B3RH 2Z9HA 4A3JB 4IWXA 1WTOA 1HNXH 5JJZA 1WTQA 4YCVA 3I12A 4O2AF 1BOSA 5EAYA 1XYIA 2YCHA 5KFHA 4BWGB 2N88A 3MZ5A 1S5ED 1QVCA 1X3EA 1NE3A 3KXYT 4GKKH 4K6LA 1ONLA 2K5VA 1TWGA 3T99A 2JA9A 4A3MB 4A93H 4DAYA 5KNCA 3NC0B 2JA8H 4TVIA 3A7LA 4FS1A 3RZDH 5JEAG 4QMGA 1G2TA 4WJ4A 5I9OA 2DABA 2WINB 2K33A 3I90A 1AN7A 2L1BA 1GUSA 5KRUA 4IPHA 5BMVF 2FJZA 2EXDA 3OTOL 3GTKB 4LF7H 4J9SA 4TV8F 5LYJF 1E2VA 5C5JA 1O75A 1YNNC 4C1NK 2L9HA 1SR3A 4JV5L 2MNAA 1N34H 4IZOA 3C1EA 3TREA 4FF4A 1STHA 3DHQA 2VA3A 4IZ8A 2B63H 1MKHA 4DR6Q 4QWBA 3OSNA 2NU7B 2CCZA 1WH2A 4JOIA 5LMNW 2XGQA 2C9OA 2F0GA 2PW7A 2WTFA 1B9MA 4DKAC 4POFA 4RMFA 3E9HA 2XCPA 4Y7NB 1IOVA 3VA5A 4LWCA 1U5KA 2NZHA 1WTHA 4N9TA 3URYA 5IODA 2VNUD 1PMRA 5JEAJ 1WD1A 5BWRA 3A56A 1IBLQ 4JI6Q 4DL7A 3BJUA 2I5MX 5BN5A 3T5JA 2EXZA 5T14A 4K8JA 1GHKA 1LTID 2H4OA 3BDCA 3HKSA 4F87A 3I4NG 4C5CA 3FMCA 4YHHH 1STEA 4RU9A 3N8DA 3JAMW 5I5VA 3JAMc 3TMEA 3SK6A 4DF7A 1EIFA 3LGJA 2K1BA 4LF6H 1ET6A 1PV4A 3FHWA 4C5AA 3NTHA 4CBVA 1EWIA 2R84A 3K5OA 3P20A 4NZOA 1PVOA 3BU2A 4JI2L 4J9PA 3PSIA 1XWEA 4P73A 5C44G 2HHHH 4KN4C 1RODA 3L0OA 1ASZA 2QW7A 2NU6B 1DXMA 3I4NB 3KALA 4CHIA 1ZEQX 2QA4A 2W6NA 1TQOA 4HNUA 2KA7A 3I73A 4LK1C 3AMUA 5FPOA 4QUCA 1TWCH 3I4MG 4A3LG 1BCPC 3NWTA 3J7A5 4RB1A 1S97A 1L1OA 5L37A 1TWGB 4ODGA 5KG6A 3L2PA 2F4VQ 2RGRA 5CORA 5KS8A 4V0BA 3UDGA 3KK7A 3Q23A 3FDTA 3WNZA 4I50F 4A3EB 3GTLB 1CA5A 2KBNA 1PTOF 2ZJQA 3PW4A 3GTQA 2OCEA 2V9WA 3EYYA 4NB3A 1BNCA 4JI8L 1Y8OB 2B2VC 4HTHA 1M0TA 3SNOA 3NUAA 5BYBA 4HQ6A 1YEZA 3CCEA 3GIQA 3DAAA 2CW8A 1MGSA 4G57A 4O7ZA 4TSSA 4O81A 4OWXB 1IYVA 3JSLA 2IA6A 1WVLA 4UP8A 3PN1A 3NBIA 2FMAA 4IRKA 4DV2H 1KBLA 3RAQA 3F1ZA 1XPUA 4R4IA 5FLMG 4Q5VA 3CMEA 1EUCB 2AQ3B 4FVMA 4GKJH 5LMUQ 3S2DB 5KT5A 2L11A 3TDQA 2G9HD 1JOOA 2AKWB 1Y1WB 1IW7D 1CT1D 4BBRH 4L1KA 4MAMA 1CZWA 3IG0A 4UCTA 4A3LH 4OHJA 5C3XA 3GTGA 4KJNA 4TUYF 1CQFA 4NKLA 1GGOA 2EJ0A 1M7JA 1HNWQ 4ED2A 3NGDA 1J6QA 4HCSA 1NY4A 4IHJF 1K3BC 3GQBA 1ZQ7A 3T1YL 1BBXC 2EJFC 1GSOA 2R8JA 2RCNA 4QGUA 1R4QB 5KIXA 4P71A 1DGSA 1YIJA 4GLAC 2NUCA 3TS0A 4TQUS 2EY5A 3MEHA 3V6JA 3QO2A 1QG7A 2MJ8A 2VL6A 1F2MA 3HOZB 3NENA 4HCEA 3KJOA 2FMCA 2YL2A 5EGTA 2QK4A 2UXDH 2DGYA 3H3VC 4X66H 5CAEB 5KFXA 4YB8B 4A2AA 1BKBA 2C22A 1HR0W 4ULLA 1NMGA 5EPLA 4DNIA 1GSAA 4LUVA 4DV3Q 1T94A 2UXCL 2FPGB 1BNZA 3QR8A 4IIJF 3T9BA 1B6RA 5KFGA 2WV6D 1D5MC 3DWPA 3OHBA 1TWCB 2WAQG 5KYIA 2YRXA 5G3LD 5KFEA 1U4MA 1JXLA 1B04A 2FKLA 2ENBA 3RR5A 2ABJA 3CPFA 3JRWA 5FPRA 4MTNA 2GA4B 4PMWA 3BG5A 3PQIA 4QWCA 1DOLA 1MIUA 4DV7Q 4U7CA 3ONAB 4O0AA 2L55A 3SR1A 2RVLA 4BBRG 3J7AK 4A3MG 4DUZH 1R9TB 5DAAA 3M4PA 4JI1H 1SJHD 5KEEA 5C3EH 3GO5A 5TSSA 4DV7H 4FO2A 4EEYA 3ORRA 1DONA 1CZGA 3KUPA 2R8KA 5CV8A 2W71A 1GYFA 4FXGC 2FFKB 4DR6L 2NTSA 5KFQA 5BN3A 2E5LQ 1I94L 1B6SA 2B63A 3JZ6A 3NBHB 5F2DA 1YHBA 2AU0A 1TR5A 2EYOA 1PA6A 4X6AH 4ED7A 4DV4H 4QB4A 4HJ9A 2RDIA 4AQYL 3RNUA 2R93A 4OWTB 3HKZE 3AW8A 5IP7G 3MR6A 1M90C 1S4ZA 3T5HA 3VR5A 1C0AA 2KCTA 5KFUA 3GTMH 1A2UA 1V1PA 3HZXA 1B7YB 1I2KA 4HNVA 1LT4D 2WB1B 3J7ZC 2R92B 5KG3A 1CQIB 2EPBA 1JR0D 1L0XB 3S1MB 3RN2A 4L63B 3T9DA 4ALPA 1SAPA 4JI4Q 5CYUA 3MWYW 2XN9C 1YVCA 1KUTA 4IUUA 3HB9A 3V6KA 2JEFA 3RV3A 4O4HF 3T53B 2YV5A 4HEDA 5K36H 4HNTA 2CHBD 1DM0B 1XNRL 3CCQA 1EFID 1ESFA 3MXPA 4YCWA 1VQ7A 2F3VA 1QB5D 4UCVA 4OX9Q 3MEFA 4L5QA 1IYJB 4DIMA 1I50B 4B3MH 4X3UA 1GXDC 1IBML 3I4OA 1I6HH 2BA0A 3KREA 1NBWA 1RL2A 3HP3A 3HOWB 1JIHA 1QZGA 1KTAA 4GS3A 2YW2A 4XX0B 1OXSC 2E74C 5EDWA 1JKJB 4F4YA 2NU9B 3HFZB 2PMZB 3H40A 1C48A 1PH9A 1H9SB 4LF7Q 5FLXW 2F0JA 1XMQL 1I4GA 5ELFA 4JI3Q 5JAVA 3GTQH 2AUJD 2NBFA 3R5FA 2AWOA 1QWYA 3GTMB 2VQEQ 1FKAH 3BQ2A 1N34Q 3KYHC 2H1EA 3H91A 2UXBH 3GTLA 2W6QA 3UYYA 2N3SA 1PZKD 1AEXA 4MNOA 2QDLA 2K14A 3QG1A 2WAQE 2E2HH 5EPJA 4MTDA 1I94H 1YNJC 5IGBA 4A3JH 3T1HQ 4DR6H 5J22A 2RF4A 3TQ1A 1Q1EA 2JA7H 1S68A 1SNPA 4MV4A 1CFMA 5KFSA 2YU9B 1N8RC 1UEAB 1EQVA 4LFAH 4ED3A 1VF5C 2Z04A 3N42B 1IKLA 4GKJQ 1CKNB 2K5WA 3GP7A 1PH8A 1JB7A 4O7NA 3RFCA 2DPIA 1TU2B 3UE0A 4BBSH 2C5CA 4DA2A 5IGCA 5C3EB 5FNVF 1MJEA 2IX0A 5CR5A 1X56A 2NWGA 1EYDA 3OWFA 5KFIA 3V2TA 4JPBW 2M9VA 2B2UA 2K75A 4O42A 2X5RA 1WR2A 4DK6C 4EYHB 4JBWA 1K83A 3IFDA 3OSOA 3K6OA 3T56B 2ALZA 2VR1A 5I6WA 4TKOB 3KJPA 1LT5D 4AIMA 1KNEA 1HH2P 4CDDC 4HSVA 2IY5B 1IYDA 2Z6KC 4BS9A 2O03A 2YYAA
chains in the Genus database with same CATH topology
4OWWB 2CW7A 1J5EH 4P72A 3J81i 4ME3A 3PV0A 4RB2C 1NJIC 3HOWG 3JC66 1HNXL 4JYAQ 2Q2UA 1BVSA 1Z47A 1K8AC 4B3RL 1VQGA 1JJGA 4LF8H 1XNRQ 4JV5Q 4CC6A 3S1MH 4GKKQ 2OTJA 4DV0L 3T1YH 1Q81C 1N32Q 4LF8L 2HT1A 3QWUA 3J80W 4DV6L 3J80c 5GAEC 2R92H 1HNWL 2B63G 1K0RA 1VQJA 3F2BA 1RIPA 4BA2I 4DV2Q 2DUDA 2ID0A 4L5RC 2VUMH 2Q2HA 1IBKQ 2B29A 4JI0L 1YNXA 3PIPA 1KL9A 5FJ8G 1CKOA 1PH5A 2UUAL 4DR4H 1UE1A 4AYBG 1VQ6A 3CCVA 3RTXA 3NBZB 1KRSA 3EBEA 4O2DA 4EEQA 1YJ9A 3UDXA 1XMOL 2R7FA 3E0EA 3U4ZA 4L5TA 4DR2L 4JI3L 2IX1A 3BAAA 1Y1VH 1XNQH 4JI4H 2R92G 1FGUA 1I5FA 2MO1A 1N33H 1IBKL 4B3SH 4YCUA 4FDBA 3RLFA 3K7UC 3PIOA 2ZTDA 3H15A 1XMOQ 5ELNA 4A3MH 2ZM6H 4K0KH 1E3PA 3F2DA 4HIKA 4X65Q 3I55A 1PH6A 3PUWA 1Q82C 1N36Q 4HIMA 2D0OA 3H20A 2AWNA 2RHSB 3GD7A 2NN6I 4KLKA 4DV2L 5LMNL 2NVTH 2ZJTA 3KAKA 3N41B 4QY7A 2NN6G 1I50H 2UUCL 2UU9Q 4A3IG 2KCMA 4PZ8A 1KD1C 2QGQA 3HOUH 1A63A 2LXKA 3HOXG 1HNXQ 3HOYH 1VQCA 1VQBA 4JC0A 1R9TH 2CWPA 4XTCS 3JAMi 3I56A 3ULPA 1C7YA 1OTCA 1VQFA 3CAMA 2UU9L 2WYOA 4MV9A 2Q2IA 4DV4Q 1H95A 3DF7A 3T1HH 4HJAA 1FJGH 3PUXA 3TEHB 4DR5L 4LSAA 3I2ZA 4LF9H 2F52A 4RAZA 2EIFA 4KHZA 4GN5A 2I5LX 1HZ9A 1M1KC 3RLOA 2ZTCA 2A1AA 1Z9FA 1EOVA 1GKHA 2AMCB 3UDIA 1IZ6A 1CSPA 3OTOQ 3A5UA 4DR7H 2ZJRA 1IBLL 4P75A 4JI6L 3S1RH 4OO1I 1KRTA 2HVRA 5BR8L 1NMFA 1VQAA 3I4MH 1WYDA 1IBLH 3CCSA 1X54A 5GADC 3VNNA 4IO9A 4JI6H 2JA5H 1K83H 4POGA 5HY6A 3C0FB 4DV1H 3RGXA 2MQHA 3NELA 4A3GG 4A3DG 1M0WA 3FP9A 1N33Q 1Z2NX 4YWKA 3CCJA 3UQ8A 4DUYQ 4A75A 1P16A 3HOVH 1HZCA 1WJJA 4LF4Q 4OX9L 1FJGL 2VZAA 1MJCA 3CQZH 4A3BH 2UXCQ 3HOZH 2CQOA 1HNWH 3AFQA 3PO2H 3CPWA 2VQFH 1HNZL 3HXLA 3F8TA 1IBMH 2YYZA 1E1OA 5GROA 3CC4A 3LMLA 1SE8A 2KENA 4A3JG 4B3TL 4YWMA 4A3EG 3S2HH 1N32L 2VPSA 2R7ZG 4R4OA 5LMNH 4LFBH 4RB0A 2KHIA 5C0XJ 1L0WA 3D31A 2HHHL 5A2QW 5C44H 1PH1A 3L4JA 1XNRH 5M5WH 2K52A 4RB3C 3EIVA 4YY3L 1YHAA 2PMZE 2WFWA 3A5ZB 5IE8A 3PF5A 2K5HA 5IT9c 2GVAA 1E7ZA 3TQYA 4A3FH 4A3IH 4LF6L 1JT8A 4B3TQ 3F8NA 1IBKH 4DR1H 1XNQL 4BXXH 4LSXA 5M3FH 4DR2H 5IYCG 3L7ZC 1XMOH 1VCIA 1X3FA 1YI2A 1ZHSA 3RF2A 5FJ8H 1Y1WH 3M4OH 1PH3A 4JI0H 4NXNH 2A19A 1OXVA 3KF6A 4JI5L 4APVA 1XDNA 1G6PA 3L4KA 2OQ0A 5IYDH 3BA9A 1I3QH 3STBD 3AEVA 4BY7G 1K3RA 1N9WA 3IRBA 4GLXA 5GAHC 4JI7L 3KDFA 4LFBQ 3K3VA 4DV0H 1WFQA 4JBKA 1KAWA 2E8GA 3J81j 4UCRA 5D1OB 4IJHA 2JA5G 4B3RH 4DV3L 2NVYH 2Q2TA 4PDBA 2LSSA 4GOPC 4GKKH 1PFSA 4IPGA 1HNXH 2JA7G 4AQYH 4YCVA 1O7IA 3PF4A 3RLNA 3PO3H 2OQKA 5EAYA 2YCHA 2GVBA 5D1OA 4DV5L 1X9NA 2JA6G 4GNXA 1TXYA 5GAGC 1X3EA 1QVCA 4DPGA 1NE3A 2VOBA 2K4KA 4BBSG 4X65L 3KXYT 1XPOA 2K5VA 4C3IH 3GTJH 2OWOA 2RGRA 3U58A 2L15A 4UPAA 1N34L 4E6NA 4HIDA 2CWAA 2JA9A 4A93H 3SGIA 1YITA 2RGVA 1S03G 4A3EH 3NC0B 4LH7A 1TWHH 2JA8H 5H1SE 1WOCA 1X6OA 2ATWA 5C0XG 1EQQA 3RZDH 2E2IH 4WJ3M 5JEAG 1Y14B 4LF7L 4R7RA 3OTOH 4WJ4A 3DLLA 5BR8Q 5D1PA 2BH8A 1CKNA 3AYHB 1N36L 2UUAQ 1P8LA 1AN7A 4BA1I 5C0XI 4JI0Q 3TRZA 4IPHA 4JYAL 2EXDA 2NVXH 4LUZA 3OTOL 4LFCL 5HGQA 5M3FG 4LF7H 4LNQA 1GO3E 3U50C 3G6EA 4A3KG 3CW2C 1O75A 4DR2Q 3K8AA 1SR3A 3RN5A 4DAMA 4JV5L 1G291 2UXBQ 2MNAA 1SRUA 2B3GA 1BJTA 1N34H 1UEBA 2UXCH 1FL0A 1D7QA 3CC2A 3TREA 4DR3Q 5GQOA 2O03A 1G51A 2AHOB 3STBC 1VQMA 2PI2E 4J15A 1PH2A 1LYLA 1Q7YC 4X65H 2B63H 1S72A 1MKHA 2R7DA 5M5XH 2WB1E 1KIXA 5LMNQ 4DR6Q 2UXDL 1LUZA 1WH2A 2CCZA 3M4QA 4JOIA 4GKKL 5LMNW 2R7ZH 2N49A 5FLXc 4DV3H 4HJ7A 4MTEA 4DKAC 3BZCA 4POFA 4EX5A 4DR3H 4KI0A 1AE3A 4RMFA 1KXLA 2H5XA 4GN4B 3E9HA 4B3MQ 4RAYA 3E9IA 2D62A 1OXUA 3MXNB 4LWCA 1U5KA 1UE5A 3W5OA 2VQEL 2NZHA 2EQSA 2VNUD 4LF5H 5JEAJ 1E4FT 1AE2A 1VS0A 2RHQB 3ERSX 2C35B 1UE7A 2N78A 4PZ6A 4C3JH 3BJUA 2I5MX 1IBLQ 4JI5Q 4JI6Q 5M5YH 3RGZA 3HKSA 3I4NG 4YHHH 3UE1A 1BBUA 3CXCA 2YU9H 1K9MC 5JJLA 3S17H 3JAMW 3JAMc 1C9OA 1W3SA 4DR1L 4YY3H 1EIFA 3PUVA 4X62L 4B3RQ 3LGJA 4I7HA 4LF6H 4HJ8A 1PV4A 3FHWA 4GKJL 2A8VA 4JCVE 1EWIA 3M3YH 2E5LL 1E22A 2ALYB 1PVOA 3BU2A 4JI2L 3PSIA 5C44G 4P73A 3I4NH 2HHHH 3L0OA 2LXJA 1ASZA 4IOCA 1UWVA 1HNZH 3N44B 3KALA 2NZOA 3CCLA 4JI2Q 4MZ9A 2QA4A 2YTYA 1IXRA 2VQFL 4LF4L 4Y52H 5IYBH 3K7AH 1SROA 3NEMA 4A3CG 5FPOA 1TA8A 1TWCH 2HQLA 3I4MG 4A3LG 4RZQA 4M7EA 3FKIH 4A3DH 4RB1A 3J7A5 2VQEH 1L1OA 1HJPA 1QUQA 1Z2PX 4DV1L 3H0GG 5IP7H 3A74A 4JI8H 1LM0A 4YWLA 2VW9A 3HOWH 3L2PA 3CC7A 4A76A 5IP9G 1IL2A 2F4VQ 5E7NA 3JSNA 2JQOA 3AQQA 4YHHQ 2JEBI 3D0FA 4P74A 3UDGA 1XMQQ 1KQSA 5IWAL 4DR7L 3TY9A 3VDYA 1HR0Q 1XPRA 5IWAH 2V1CC 3A0JA 2KBNA 5IYBG 1XTDA 3S16H 2ZJQA 2ZM6Q 2JEAI 4K0KQ 2OCEA 3BABA 1J5EQ 4APMA 3EYYA 4DUZQ 1YZ6A 4R4CA 4NB3A 4JI8L 4A2BA 4DV0Q 1B8AA 1LTLA 3K81C 2FE3A 4JOIC 4DR5H 1M0TA 4CC5A 1SN8A 2JJQA 1YEZA 4Y7NH 3CCEA 3T1HL 1Q86C 4DRFA 1QUQB 3S2DH 2CW8A 1YBYA 4XIGS 4LF9L 4JI1L 3H3VH 4MV7A 4LF4H 4OWXB 1EIYB 4QQBX 3JSLA 5J3BA 4UP8A 3PN1A 1YJNA 4J0MA 1L2FA 5C4XH 5C4JH 4HIOA 4DV2H 4QJFA 4JI1Q 1SMXA 4IFDI 3GDEA 3UDFA 3F1ZA 1XPUA 4IFDG 4R4IA 5FLMG 1PYBA 3CMEA 3G4SA 2UUCQ 1Q12A 1AH9A 4GKJH 2KSWA 5LMUQ 4DR7Q 2Y0SE 4PG3A 4PZ7A 4X62H 2GN5A 4JI4L 2AKWB 2ZM6L 4K0KL 2MCTA 3PUYA 3OW2A 3HOYG 4HJ5A 3NBYB 3HOUG 3TS2A 4DV1Q 2F3IA 5C4XG 4BBRH 1N33L 4BWSC 1WI5A 1V9PA 4JG2A 4YHHL 3S15H 2BA1A 1IBMQ 3I7FA 5FLMH 3GTKH 4A3LH 3GTLH 1KC8C 4UCTA 2PQAB 3IG0A 3OYYA 2VUMG 4IFDJ 1TAEA 4ETSA 3ER0A 3RJ0A 4DAYB 4UCUA 1MZBA 2UUAH 4OONA 4LF5L 4DV6Q 1VQ4A 1HNZQ 1HNWQ 1J6QA 1X3GA 1NY4A 4A4IA 1CSQA 2YTVA 4GNXC 1XJVA 4NXNQ 2JA6H 4IOAA 2PNHA 3T1YL 3CCRA 3W1BA 1WCMG 4IJLA 1XK5A 4DK3C 1VQ9A 2RCNA 3PCOB 2MFIA 4QGUA 1Z2OX 4C2MH 4P71A 4LF6Q 1JMCA 4A93G 1DGSA 1YIJA 4GLAC 3ULJA 1EQRA 4TQUS 4DR3L 4GOPA 4YY3Q 3TS0A 1EYGA 2NVQH 2W57A 2VL6A 5IT9W 3BZKA 3J81c 4DR1Q 2WB1G 2XGTA 1GD7A 3NENA 3KJOA 4JI7Q 3WWVA 4OXPA 2XTIA 3HOVG 1X65A 3ZJYC 4LMYA 2UXDH 1E1TA 2DGYA 3HOZG 2R6GA 1J5EL 3BA8A 4X66H 1V43A 4A2AA 1BKBA 1WCMH 4DR4Q 3J80i 1HR0W 3GB8B 2Z0SA 1NMGA 1A0IA 3HOXH 2VS1A 2Y0SG 4DNIA 4A3CH 3EN2A 4LUVA 3HKZG 4DV3Q 2WE6A 3PUZA 3S1QH 1D8LA 2YTXA 4LF5Q 4KHPQ 2UXCL 2PQAA 1VQOA 4R4QA 5C3EG 3M9BA 5JJIA 2HIVA 3CCUA 2WAQG 4BY1G 2PI2A 4OO1G 1B04A 1CUKA 4LFCH 1Q1BA 3RR5A 2R93G 3CPFA 1SFOH 2JK8A 5FPRA 4Q0YA 4MTNA 4DUYH 4PMWA 2F4VH 1PYSB 1MIUA 1QVGA 4DV7Q 4LFAL 1N36H 4O0AA 4EFBA 3J7AK 4IAJA 4BBRG 4A3MG 2ZTEA 4DUZH 5IY0A 5LMUL 4X64L 3M4PA 5EOYA 4JI1H 5IYCH 4DV5Q 5C3EH 1PH7A 1VQKA 1PH4A 3GO5A 1Y1WG 2HVQA 1XNQQ 4A3GH 4DV7H 2JA8G 2JE6I 3S14H 1L2ZA 3N6XA 2IHEA 4AH6A 4LF8Q 1ZHQA 4DV6H 4QL5A 4LUOA 1GYFA 4NPSA 2R93H 2ASBA 5IYDG 2UUBL 4A3BG 4DR6L 4GOPB 2OTLA 1JJCB 2IT1A 2E5LQ 1S3OA 1I94L 2HHHQ 2UXBL 4IPCA 4NXMH 2N8NA 1B70B 1JE5A 3NBHB 4R4TA 4BY7H 1YHBA 1K73C 1EFWA 1PA6A 5DLQE 4X6AH 3TY8A 2MO0A 4AYBE 3CF5A 2D0PA 4HJ9A 4L5SA 4AQYL 3RIZA 3RNUA 4DV4H 3PGZA 3M7NA 4OWTB 3HKZE 1HZBA 1HR0H 3S1NH 3H0GH 5IP7G 1M90C 4QIWE 1VQPA 1XMQH 3KF6B 2KCTA 1C0AA 4KHPL 3KAJA 3KF8B 3GTMH 2K50A 2I0QA 4JI7H 3GJXB 1B7YB 4AQYQ 1FVIA 3AFPA 4JI5H 1QZHA 1A8VA 3J7ZC 4B3ML 3GTPH 5K36G 2HVSA 4NXNL 2VY3A 1PHJA 2I5HA 1I94Q 3N43B 4FM9A 3RN2A 4ALPA 4JI4Q 4H02A 2UUBQ 1BGWA 4JI2H 1OXTA 1VQIA 1S40A 1A62A 1VQNA 2E5LH 1YVCA 2QEXA 2WP8J 1YHQA 3B6YA 2CKZB 5AJ3Q 1SLJA 4DR5Q 2YV5A 3G48A 1JJ2A 3TY5A 1NTGA 1XNRL 3CCQA 4YCWA 1V1QA 1VQ7A 3H3VI 5JJKA 4UCVA 5FD5A 4JBJA 4OX9Q 1TWFH 3MEFA 1E24A 4NXMQ 3J81W 4LFBL 1N32H 4L5QA 5IWAQ 3G71A 1IYJB 1W2BA 2HIXA 4B3MH 4B3TH 1IBML 3I4OA 4X62Q 4GNXB 2BA0A 3PO3G 1I6HH 3MWMA 1NBWA 1U0LA 3K0XA 1RL2A 5IP9H 3F2CA 3CP0A 4A3FG 4LFCQ 1CKMA 5DISC 4DV5H 4R1JA 4JI8Q 3RZOH 4RG1A 1QZGA 2XIGA 4GS3A 4LW1A 5M3MG 3CD6A 1Y1VG 4BXXG 1OXSC 1YJWA 4OX9H 1UE6A 4LH6A 3KFUA 4UCOA 2CFMA 3HFZB 4B3SQ 1HR0L 1PH9A 4LF7Q 4IPDA 2HGSA 5FLXW 4KHPH 2VQFQ 1XMQL 3CVZA 2VUGA 5LL6b 1K8GA 4JI3Q 3GTQH 1L1OB 2AWOA 2VQEQ 1FKAH 5BR8H 1L1OC 3KOJA 3KYHC 2K5NA 1N34Q 1VQ5A 4DV4L 3GTGH 2UXBH 2N3SA 3GTOH 1SEIA 5M3MH 4MNOA 2UUBH 1EUJA 2K14A 1VQEA 2WAQE 2ZJPA 2E2HH 4LF9Q 1HZAA 4NXML 4MTDA 1I94H 1SYXB 3KDFB 1VQHA 4A3JH 1GVPA 3T1HQ 4A3KH 3M4IA 3FKIG 4DR6H 2RF4A 1Q1EA 1OXXK 2JA7H 3T1YQ 1S68A 2E2JH 1Q8KA 5AJ3L 2Z6KA 4JV5H 3U4VA 1E4GT 4X64H 1I6UA 4X66Q 3S24A 3CCMA 4UP9A 4DUZL 2UXDQ 2WDTA 1N8RC 4LFAQ 4DV7L 4EFEA 2UU9H 4LFAH 4UP7A 1TWAH 3KLWA 3CMAA 3N42B 5LMUH 4JYAH 4DUYL 4X64Q 1VQ8A 1VQLA 4GKJQ 1CKNB 3DM3A 2FXQA 1PH8A 2IHFA 1JB7A 3N40P 4GN3B 3M85A 2UUCH 3UE0A 4BBSH 1QVFA 3W1GA 1BBWA 1FJGQ 1KHIA 2F4VL 1MJEA 2IX0A 4JBMA 1X56A 2BH2A 2ES2A 5ELOA 1X55A 2KHJA 4UFZA 2K75A 4BY1H 4UY8C 3ULLA 4DK6C 1Q46A 4B3SL 3Q8DA 4JBWA 4EQ5A 3ICEA 5FD6A 4GLVB 3K80C 4TVAB 1GM5A 4JI3H 4X66L 3KJPA 4AIMA 2IY5B 1HH2P 4UCSA 3PO2G 1TWGH 1VQDA 2Z6KC 4C3HH 1ASYA 3FMAA 4DR4L 1T9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWW B;  4P72 A;  3J81 i;  4ME3 A;  3PV0 A;  1NJI C;  3HOW G;  3JC6 6;  1HNX L;  4JYA Q;  2Q2U A;  1BVS A;  1Z47 A;  1K8A C;  4B3R L;  1VQG A;  1JJG A;  1XNR Q;  4JV5 Q;  4CC6 A;  3S1M H;  4GKK Q;  2OTJ A;  4DV0 L;  1Q81 C;  1N32 Q;  4LF8 L;  2HT1 A;  3QWU A;  4DV6 L;  3J80 c;  5GAE C;  2R92 H;  1HNW L;  2B63 G;  1K0R A;  1VQJ A;  3F2B A;  1RIP A;  4BA2 I;  4DV2 Q;  2DUD A;  2ID0 A;  4L5R C;  2VUM H;  2Q2H A;  1IBK Q;  2B29 A;  4JI0 L;  1YNX A;  3PIP A;  1KL9 A;  5FJ8 G;  1CKO A;  1PH5 A;  2UUA L;  1UE1 A;  4AYB G;  1VQ6 A;  3CCV A;  3RTX A;  3NBZ B;  1KRS A;  3EBE A;  4O2D A;  4EEQ A;  1YJ9 A;  3UDX A;  1XMO L;  2R7F A;  3E0E A;  3U4Z A;  4L5T A;  4DR2 L;  4JI3 L;  2IX1 A;  3BAA A;  1Y1V H;  2R92 G;  1FGU A;  1I5F A;  2MO1 A;  1IBK L;  4YCU A;  4FDB A;  3RLF A;  3K7U C;  3PIO A;  2ZTD A;  3H15 A;  1XMO Q;  5ELN A;  4A3M H;  1E3P A;  3F2D A;  4HIK A;  4X65 Q;  3I55 A;  1PH6 A;  3PUW A;  1Q82 C;  1N36 Q;  4HIM A;  2D0O A;  2AWN A;  2RHS B;  3GD7 A;  2NN6 I;  4KLK A;  4DV2 L;  5LMN L;  2NVT H;  4QY7 A;  2NN6 G;  1I50 H;  2UUC L;  2UU9 Q;  4A3I G;  2KCM A;  4PZ8 A;  1KD1 C;  2QGQ A;  3HOU H;  1A63 A;  2LXK A;  3HOX G;  1HNX Q;  3HOY H;  1VQC A;  1VQB A;  4JC0 A;  1R9T H;  2CWP A;  4XTC S;  3JAM i;  3I56 A;  3ULP A;  1C7Y A;  1OTC A;  1VQF A;  3CAM A;  2UU9 L;  2Q2I A;  4DV4 Q;  1H95 A;  4HJA A;  3PUX A;  3TEH B;  4DR5 L;  3I2Z A;  2F52 A;  2EIF A;  4KHZ A;  4GN5 A;  2I5L X;  1HZ9 A;  1M1K C;  3RLO A;  2ZTC A;  2A1A A;  1Z9F A;  1EOV A;  1GKH A;  2AMC B;  3UDI A;  1IZ6 A;  1CSP A;  3OTO Q;  3A5U A;  2ZJR A;  1IBL L;  4P75 A;  4JI6 L;  3S1R H;  4OO1 I;  1KRT A;  2HVR A;  5BR8 L;  1NMF A;  1VQA A;  3I4M H;  1WYD A;  3CCS A;  1X54 A;  5GAD C;  3VNN A;  4IO9 A;  2JA5 H;  1K83 H;  4POG A;  5HY6 A;  2MQH A;  3NEL A;  4A3G G;  4A3D G;  3FP9 A;  1N33 Q;  4YWK A;  3CCJ A;  3UQ8 A;  4DUY Q;  4A75 A;  1P16 A;  3HOV H;  1HZC A;  1WJJ A;  4LF4 Q;  4OX9 L;  1FJG L;  2VZA A;  1MJC A;  3CQZ H;  4A3B H;  2UXC Q;  3HOZ H;  2CQO A;  3AFQ A;  3PO2 H;  3CPW A;  1HNZ L;  3F8T A;  2YYZ A;  1E1O A;  5GRO A;  3CC4 A;  1SE8 A;  2KEN A;  4A3J G;  4B3T L;  4YWM A;  4A3E G;  3S2H H;  1N32 L;  2R7Z G;  4R4O A;  2KHI A;  5C0X J;  1L0W A;  3D31 A;  2HHH L;  5C44 H;  1PH1 A;  5M5W H;  2K52 A;  3EIV A;  4YY3 L;  1YHA A;  2PMZ E;  2WFW A;  3A5Z B;  5IE8 A;  3PF5 A;  2K5H A;  5IT9 c;  2GVA A;  1E7Z A;  3TQY A;  4A3F H;  4A3I H;  4LF6 L;  1JT8 A;  4B3T Q;  1XNQ L;  4BXX H;  5M3F H;  5IYC G;  3L7Z C;  1VCI A;  1X3F A;  1YI2 A;  5FJ8 H;  1Y1W H;  3M4O H;  1PH3 A;  2A19 A;  1OXV A;  3KF6 A;  4JI5 L;  4APV A;  1XDN A;  1G6P A;  2OQ0 A;  5IYD H;  3BA9 A;  1I3Q H;  3STB D;  3AEV A;  4BY7 G;  1K3R A;  1N9W A;  3IRB A;  4GLX A;  5GAH C;  4JI7 L;  3KDF A;  4LFB Q;  1WFQ A;  4JBK A;  1KAW A;  2E8G A;  3J81 j;  4UCR A;  5D1O B;  4IJH A;  2JA5 G;  4DV3 L;  2NVY H;  2Q2T A;  2LSS A;  4GOP C;  1PFS A;  4IPG A;  2JA7 G;  4YCV A;  1O7I A;  3PF4 A;  3RLN A;  3PO3 H;  2OQK A;  5EAY A;  2GVB A;  5D1O A;  4DV5 L;  1X9N A;  2JA6 G;  4GNX A;  1TXY A;  5GAG C;  1X3E A;  1QVC A;  4DPG A;  1NE3 A;  2K4K A;  4BBS G;  4X65 L;  1XPO A;  2K5V A;  4C3I H;  3GTJ H;  2OWO A;  3U58 A;  2L15 A;  4UPA A;  1N34 L;  4E6N A;  4HID A;  2CWA A;  2JA9 A;  4A93 H;  3SGI A;  1YIT A;  4A3E H;  3NC0 B;  4LH7 A;  1TWH H;  2JA8 H;  5H1S E;  1WOC A;  1X6O A;  2ATW A;  5C0X G;  1EQQ A;  3RZD H;  2E2I H;  4WJ3 M;  5JEA G;  1Y14 B;  4LF7 L;  4WJ4 A;  3DLL A;  5BR8 Q;  5D1P A;  2BH8 A;  1CKN A;  3AYH B;  1N36 L;  2UUA Q;  1P8L A;  4BA1 I;  5C0X I;  4JI0 Q;  3TRZ A;  4IPH A;  4JYA L;  2EXD A;  2NVX H;  4LUZ A;  3OTO L;  4LFC L;  5HGQ A;  5M3F G;  4LNQ A;  1GO3 E;  3U50 C;  3G6E A;  4A3K G;  3CW2 C;  4DR2 Q;  3K8A A;  1SR3 A;  3RN5 A;  4DAM A;  4JV5 L;  1G29 1;  2UXB Q;  2MNA A;  1SRU A;  2B3G A;  1UEB A;  1FL0 A;  1D7Q A;  3CC2 A;  3TRE A;  4DR3 Q;  5GQO A;  1G51 A;  2AHO B;  3STB C;  1VQM A;  2PI2 E;  4J15 A;  1PH2 A;  1LYL A;  1Q7Y C;  2B63 H;  1S72 A;  1MKH A;  2R7D A;  5M5X H;  2WB1 E;  1KIX A;  5LMN Q;  4DR6 Q;  2UXD L;  1LUZ A;  2CCZ A;  3M4Q A;  4JOI A;  4GKK L;  5LMN W;  2R7Z H;  2N49 A;  5FLX c;  4HJ7 A;  4DKA C;  3BZC A;  4POF A;  4EX5 A;  4KI0 A;  1AE3 A;  4RMF A;  1KXL A;  2H5X A;  4GN4 B;  3E9H A;  4B3M Q;  3E9I A;  2D62 A;  1OXU A;  3MXN B;  4LWC A;  1U5K A;  1UE5 A;  3W5O A;  2VQE L;  2NZH A;  2EQS A;  2VNU D;  5JEA J;  1AE2 A;  1VS0 A;  2RHQ B;  3ERS X;  2C35 B;  1UE7 A;  2N78 A;  4PZ6 A;  4C3J H;  3BJU A;  2I5M X;  1IBL Q;  4JI5 Q;  4JI6 Q;  5M5Y H;  3HKS A;  3I4N G;  3UE1 A;  1BBU A;  3CXC A;  2YU9 H;  1K9M C;  5JJL A;  3S17 H;  3JAM c;  1C9O A;  1W3S A;  4DR1 L;  1EIF A;  3PUV A;  4X62 L;  4B3R Q;  3LGJ A;  4HJ8 A;  1PV4 A;  3FHW A;  4GKJ L;  2A8V A;  4JCV E;  1EWI A;  3M3Y H;  2E5L L;  1E22 A;  2ALY B;  1PVO A;  3BU2 A;  4JI2 L;  3PSI A;  5C44 G;  4P73 A;  3I4N H;  3L0O A;  2LXJ A;  1ASZ A;  4IOC A;  1UWV A;  2NZO A;  3CCL A;  4JI2 Q;  4MZ9 A;  2QA4 A;  2YTY A;  1IXR A;  2VQF L;  4LF4 L;  4Y52 H;  5IYB H;  3K7A H;  1SRO A;  3NEM A;  4A3C G;  5FPO A;  1TA8 A;  1TWC H;  2HQL A;  3I4M G;  4A3L G;  3FKI H;  4A3D H;  3J7A 5;  1L1O A;  1HJP A;  1QUQ A;  4DV1 L;  3H0G G;  5IP7 H;  3A74 A;  1LM0 A;  4YWL A;  2VW9 A;  3HOW H;  3L2P A;  3CC7 A;  4A76 A;  5IP9 G;  1IL2 A;  2F4V Q;  5E7N A;  3JSN A;  2JQO A;  3AQQ A;  4YHH Q;  2JEB I;  3D0F A;  4P74 A;  3UDG A;  1XMQ Q;  1KQS A;  5IWA L;  4DR7 L;  3TY9 A;  3VDY A;  1HR0 Q;  1XPR A;  2V1C C;  3A0J A;  2KBN A;  5IYB G;  1XTD A;  3S16 H;  2ZJQ A;  2ZM6 Q;  2JEA I;  4K0K Q;  2OCE A;  3BAB A;  1J5E Q;  4DUZ Q;  1YZ6 A;  4R4C A;  4NB3 A;  4JI8 L;  4DV0 Q;  1B8A A;  1LTL A;  3K81 C;  4JOI C;  4CC5 A;  1SN8 A;  2JJQ A;  1YEZ A;  4Y7N H;  3CCE A;  3T1H L;  1Q86 C;  4DRF A;  1QUQ B;  3S2D H;  1YBY A;  4XIG S;  4LF9 L;  4JI1 L;  3H3V H;  4OWX B;  1EIY B;  4QQB X;  3JSL A;  5J3B A;  4UP8 A;  3PN1 A;  1YJN A;  1L2F A;  5C4X H;  5C4J H;  4HIO A;  4QJF A;  4JI1 Q;  1SMX A;  4IFD I;  3GDE A;  3UDF A;  3F1Z A;  1XPU A;  4IFD G;  4R4I A;  5FLM G;  1PYB A;  3CME A;  3G4S A;  2UUC Q;  1Q12 A;  1AH9 A;  5LMU Q;  4DR7 Q;  2Y0S E;  4PG3 A;  4PZ7 A;  2GN5 A;  4JI4 L;  2AKW B;  2ZM6 L;  4K0K L;  3PUY A;  3OW2 A;  3HOY G;  4HJ5 A;  3NBY B;  3HOU G;  3TS2 A;  4DV1 Q;  2F3I A;  5C4X G;  4BBR H;  1N33 L;  1WI5 A;  1V9P A;  4JG2 A;  4YHH L;  3S15 H;  2BA1 A;  1IBM Q;  3I7F A;  5FLM H;  3GTK H;  4A3L H;  3GTL H;  1KC8 C;  4UCT A;  2PQA B;  3OYY A;  2VUM G;  4IFD J;  1TAE A;  3ER0 A;  4DAY B;  4UCU A;  4OON A;  4LF5 L;  4DV6 Q;  1VQ4 A;  1HNZ Q;  1HNW Q;  1J6Q A;  1X3G A;  1NY4 A;  4A4I A;  1CSQ A;  2YTV A;  4GNX C;  1XJV A;  4NXN Q;  2JA6 H;  4IOA A;  2PNH A;  3T1Y L;  3CCR A;  3W1B A;  1WCM G;  4IJL A;  1XK5 A;  4DK3 C;  1VQ9 A;  2RCN A;  3PCO B;  2MFI A;  4QGU A;  4C2M H;  4P71 A;  4LF6 Q;  1JMC A;  4A93 G;  1DGS A;  1YIJ A;  4GLA C;  3ULJ A;  1EQR A;  4TQU S;  4DR3 L;  4GOP A;  4YY3 Q;  3TS0 A;  1EYG A;  2NVQ H;  2VL6 A;  3BZK A;  3J81 c;  4DR1 Q;  2WB1 G;  2XGT A;  1GD7 A;  3NEN A;  3KJO A;  4JI7 Q;  3WWV A;  4OXP A;  2XTI A;  3HOV G;  1X65 A;  3ZJY C;  1E1T A;  2DGY A;  3HOZ G;  2R6G A;  1J5E L;  3BA8 A;  1V43 A;  1BKB A;  1WCM H;  4DR4 Q;  3J80 i;  1HR0 W;  3GB8 B;  2Z0S A;  1NMG A;  1A0I A;  3HOX H;  2VS1 A;  2Y0S G;  4DNI A;  4A3C H;  3EN2 A;  4LUV A;  3HKZ G;  4DV3 Q;  3PUZ A;  3S1Q H;  1D8L A;  2YTX A;  4LF5 Q;  4KHP Q;  2UXC L;  2PQA A;  1VQO A;  4R4Q A;  5C3E G;  3M9B A;  5JJI A;  2HIV A;  3CCU A;  2WAQ G;  4BY1 G;  2PI2 A;  4OO1 G;  1B04 A;  1CUK A;  1Q1B A;  3RR5 A;  2R93 G;  3CPF A;  1SFO H;  2JK8 A;  5FPR A;  4MTN A;  4PMW A;  1PYS B;  1MIU A;  1QVG A;  4DV7 Q;  4LFA L;  4O0A A;  4EFB A;  4BBR G;  4A3M G;  2ZTE A;  5IY0 A;  5LMU L;  4X64 L;  3M4P A;  5IYC H;  4DV5 Q;  5C3E H;  1PH7 A;  1VQK A;  1PH4 A;  3GO5 A;  1Y1W G;  2HVQ A;  1XNQ Q;  4A3G H;  2JA8 G;  2JE6 I;  3S14 H;  2IHE A;  4AH6 A;  4LF8 Q;  4QL5 A;  4LUO A;  4NPS A;  2R93 H;  2ASB A;  5IYD G;  2UUB L;  4A3B G;  4DR6 L;  4GOP B;  2OTL A;  1JJC B;  2IT1 A;  2E5L Q;  1S3O A;  1I94 L;  2HHH Q;  2UXB L;  4IPC A;  2N8N A;  1B70 B;  1JE5 A;  3NBH B;  4R4T A;  4BY7 H;  1YHB A;  1K73 C;  1EFW A;  1PA6 A;  5DLQ E;  4X6A H;  3TY8 A;  2MO0 A;  4AYB E;  3CF5 A;  2D0P A;  4HJ9 A;  4L5S A;  4AQY L;  3RNU A;  3PGZ A;  3M7N A;  4OWT B;  3HKZ E;  1HZB A;  3S1N H;  3H0G H;  5IP7 G;  1M90 C;  4QIW E;  1VQP A;  3KF6 B;  2KCT A;  1C0A A;  4KHP L;  3KF8 B;  3GTM H;  2K50 A;  2I0Q A;  3GJX B;  1B7Y B;  4AQY Q;  1FVI A;  3AFP A;  1QZH A;  1A8V A;  3J7Z C;  4B3M L;  3GTP H;  5K36 G;  2HVS A;  4NXN L;  2VY3 A;  1PHJ A;  2I5H A;  1I94 Q;  3RN2 A;  4ALP A;  4JI4 Q;  4H02 A;  2UUB Q;  1OXT A;  1VQI A;  1S40 A;  1A62 A;  1VQN A;  1YVC A;  2QEX A;  2WP8 J;  1YHQ A;  3B6Y A;  2CKZ B;  5AJ3 Q;  1SLJ A;  4DR5 Q;  2YV5 A;  3G48 A;  1JJ2 A;  3TY5 A;  1NTG A;  1XNR L;  3CCQ A;  4YCW A;  1V1Q A;  1VQ7 A;  3H3V I;  5JJK A;  4UCV A;  4JBJ A;  4OX9 Q;  1TWF H;  3MEF A;  1E24 A;  4NXM Q;  4LFB L;  4L5Q A;  5IWA Q;  3G71 A;  1IYJ B;  1W2B A;  2HIX A;  1IBM L;  3I4O A;  4X62 Q;  4GNX B;  2BA0 A;  3PO3 G;  1I6H H;  1NBW A;  1U0L A;  3K0X A;  1RL2 A;  5IP9 H;  3F2C A;  3CP0 A;  4A3F G;  4LFC Q;  1CKM A;  5DIS C;  4R1J A;  4JI8 Q;  3RZO H;  4RG1 A;  1QZG A;  4GS3 A;  4LW1 A;  5M3M G;  3CD6 A;  1Y1V G;  4BXX G;  1OXS C;  1YJW A;  1UE6 A;  4LH6 A;  3KFU A;  4UCO A;  2CFM A;  3HFZ B;  4B3S Q;  1HR0 L;  1PH9 A;  4LF7 Q;  4IPD A;  2VQF Q;  1XMQ L;  2VUG A;  1K8G A;  4JI3 Q;  3GTQ H;  1L1O B;  2AWO A;  2VQE Q;  1L1O C;  3KOJ A;  3KYH C;  2K5N A;  1N34 Q;  1VQ5 A;  4DV4 L;  3GTG H;  2N3S A;  3GTO H;  5M3M H;  4MNO A;  1EUJ A;  2K14 A;  1VQE A;  2WAQ E;  2ZJP A;  2E2H H;  4LF9 Q;  1HZA A;  4NXM L;  3KDF B;  1VQH A;  4A3J H;  1GVP A;  3T1H Q;  4A3K H;  3FKI G;  2RF4 A;  1Q1E A;  1OXX K;  2JA7 H;  3T1Y Q;  1S68 A;  2E2J H;  1Q8K A;  5AJ3 L;  2Z6K A;  3U4V A;  4X66 Q;  3S24 A;  3CCM A;  4UP9 A;  4DUZ L;  2UXD Q;  1N8R C;  4LFA Q;  4DV7 L;  4EFE A;  4UP7 A;  1TWA H;  3KLW A;  3CMA A;  4DUY L;  4X64 Q;  1VQ8 A;  1VQL A;  4GKJ Q;  1CKN B;  3DM3 A;  2FXQ A;  1PH8 A;  2IHF A;  1JB7 A;  4GN3 B;  3M85 A;  3UE0 A;  4BBS H;  1QVF A;  3W1G A;  1BBW A;  1FJG Q;  1KHI A;  2F4V L;  1MJE A;  2IX0 A;  4JBM A;  1X56 A;  2BH2 A;  2ES2 A;  5ELO A;  1X55 A;  2KHJ A;  4UFZ A;  2K75 A;  4BY1 H;  4UY8 C;  3ULL A;  4DK6 C;  1Q46 A;  4B3S L;  3Q8D A;  4JBW A;  4EQ5 A;  3ICE A;  4GLV B;  3K80 C;  4TVA B;  1GM5 A;  4X66 L;  3KJP A;  4AIM A;  2IY5 B;  1HH2 P;  4UCS A;  3PO2 G;  1TWG H;  1VQD A;  2Z6K C;  4C3H H;  1ASY A;  4DR4 L;  1T9H A; 
#chains in the Genus database with same CATH topology
 2CW7 A;  4EYI B;  2VPQ A;  3HOW G;  3KBG A;  4J9N A;  3JC6 6;  4JYA Q;  4RNN A;  2Q2U A;  1Z47 A;  4QWD A;  4FS2 A;  3NQI A;  4ECW A;  5JH7 F;  2JYO A;  4PMB A;  3S1M H;  5NUC A;  2IWH A;  1Q81 C;  3MWE A;  4HN7 A;  2R92 H;  1HNW L;  4K8I A;  5GAE C;  2N55 A;  1VQJ A;  4F8M A;  1VMP A;  2ID0 A;  2R8G A;  2EJM A;  5DNF A;  4ECQ A;  2B29 A;  3PIP A;  4ZUI A;  4LMQ D;  4AYB G;  5HUR A;  3CCV A;  1KRS A;  4O2D A;  3UDX A;  3R23 A;  3E0E A;  2IX1 A;  3ND8 A;  4X3S A;  4FXK C;  1JDE A;  1FGU A;  1EU4 A;  1I5F A;  1TWH B;  4EQO A;  1IBK L;  2V58 A;  3PIO A;  1XMO Q;  3H15 A;  4QIW A;  4NDX A;  3QIA A;  1E3P A;  4HIK A;  4O7V A;  3PUW A;  1A3T A;  3VR2 A;  5K3W A;  1LAB A;  4HIM A;  4QWA A;  1RTN A;  1EYA A;  1I6H B;  4O2B F;  5DLG A;  3RMH A;  4QY7 A;  3QOJ A;  1I50 H;  4WJW A;  2UU9 Q;  3BAC A;  2K32 A;  1I4R A;  1U4R A;  1KD1 C;  2ZDG A;  3TIN A;  1Q3L A;  2LXK A;  3HOY H;  1C7Y A;  4JC0 A;  1R9T H;  3I56 A;  1VQF A;  5DQI A;  2Q2I A;  5KFL A;  4CGY B;  5KFJ A;  1Q8I A;  1GSH A;  3OMG A;  4LF9 H;  1FJG H;  3I2Z A;  2F52 A;  1GUO A;  3GIP A;  4EBC A;  4KHZ A;  4R8I A;  2BCO A;  2EJ3 A;  4GN5 A;  1M1K C;  1F77 A;  1HZ9 A;  3H0G A;  2RDJ A;  3UDI A;  4KY6 A;  4OO1 I;  5FO9 B;  1RCV D;  2HVR A;  4IRC A;  4K6N A;  2F0E A;  4O4I F;  2J9G A;  1WSC A;  1X54 A;  3SVM A;  2PPB C;  3AX6 A;  3OOC A;  3NEL A;  1M0W A;  1Z2N X;  4YWK A;  4DUY Q;  1HQM C;  3HOV H;  4WBN F;  1KEE A;  3HOZ H;  2HCI A;  3D6C A;  3VPC A;  2HUG A;  3AFQ A;  5KNB A;  1LO5 D;  5DG9 A;  2F0U A;  2FLN A;  3F8T A;  4IWY A;  5GRO A;  3CC4 A;  3L4J A;  1SE8 A;  2VPS A;  4A3E G;  1NAP A;  4R4O A;  3T16 A;  4RB0 A;  2KHI A;  1N48 A;  3D31 A;  2HHH L;  5A2Q W;  3T13 A;  1PH1 A;  1XNR H;  4ZOL F;  2K52 A;  3EIV A;  2PO4 A;  1S5B D;  4YY3 L;  3W2D A;  3A5Z B;  1F2Y A;  2Y4R A;  1JT8 A;  5IT9 c;  4A3I H;  1IBK H;  1AFP A;  5C3W A;  1XNQ L;  5DQG A;  2PCF B;  4O7S A;  4DR2 H;  3NSW A;  2PN1 A;  1W6K A;  2RQX A;  1VCI A;  1U4P A;  3PW7 A;  4B9X A;  2J7Z A;  1Y1W H;  3U54 A;  3KF6 A;  1BXT A;  1JE4 A;  2J4X A;  4JI5 L;  4U67 3;  5C8Y F;  5IYD H;  3GTM A;  1BCP B;  4LFB Q;  4JI7 L;  1TVX A;  4UCR A;  2ATL A;  2E8G A;  1C3O A;  3E0J A;  4IJH A;  3RZO B;  3UZO A;  1A6X A;  2JA5 A;  3C46 A;  4IPG A;  5CC4 A;  3PF4 A;  3RLN A;  1B50 A;  5CV7 A;  4J8Q A;  4DV5 L;  2BQ3 A;  3EQL C;  4GNX A;  3WWH A;  1TXY A;  1H9S A;  4HSP A;  5GAG C;  2COI A;  3MR5 A;  1DOK A;  2K4K A;  3PW0 A;  4X65 L;  1XPO A;  4HID A;  4RNM A;  1S9F A;  1YIT A;  4DL4 A;  1GLV A;  4A3E H;  4DAP A;  4IAL A;  1WOC A;  5C0X G;  2E2I H;  4RCO A;  1RJP A;  5L1K A;  1E2Z A;  4R7R A;  1CA6 A;  3DLL A;  1EYC A;  5JQG F;  3H94 A;  1CKN A;  2F0V A;  3NUC A;  4YJ2 F;  2EYH A;  4LUZ A;  4C3H G;  4I4T F;  4AYB A;  4LFC L;  5EKK A;  2L12 A;  1SJE D;  4ZAI A;  4ZKB B;  2Z8L A;  3JAM L;  2DNE A;  4DR2 Q;  4GZY C;  4QCL A;  3D6W A;  2XC9 A;  4ED0 A;  4KTA A;  4DNR B;  2UXC H;  2HQE A;  1FL0 A;  2F0M A;  1G51 A;  3SK5 A;  1DD2 A;  1AW7 A;  2A1H A;  1PH2 A;  4X65 H;  3BVG A;  3GIM A;  2R7D A;  3ITP A;  5M5X H;  5LMN Q;  3M4Q A;  4GKK L;  1HA5 A;  3OWE B;  1Z7T A;  2F1M A;  2SNM A;  3T51 B;  3TP5 A;  4O3O A;  3RUP A;  2QEJ C;  1PTO C;  4GN4 B;  3NTK A;  4B3M Q;  2D62 A;  1OXU A;  3MXN B;  4CKC A;  3Q0A A;  3A54 A;  3W5O A;  2DIK A;  4LF5 H;  1EKF A;  2C35 B;  2RHQ B;  4O4J F;  3I72 A;  1PFN A;  4PZ6 A;  2AGO A;  5M5Y H;  5KT2 A;  1GHJ A;  2B8G A;  3TZD A;  2BE5 D;  2BE5 C;  3UE1 A;  4KD3 A;  1QJO A;  3RUZ A;  5KFN A;  2ICE C;  1HTP A;  5DM7 3;  4JK1 C;  3IFT A;  4YY3 H;  5DMX A;  2A6E C;  5I5Y A;  4B3R Q;  1JIC A;  4I7H A;  4A3K B;  4HJ8 A;  3ETH A;  4C56 C;  4GKJ L;  4J9O A;  2A8V A;  2YU9 A;  3TII A;  3EPI A;  1KJI A;  2EOT A;  2F0D A;  2XRS D;  2DN8 A;  5IOC A;  3I4N H;  1DJR D;  3LX0 A;  2E2D C;  3IKJ A;  2A6H D;  1AP0 A;  4MZ9 A;  4O3N A;  4C2M A;  1V1P B;  1J8I A;  4FU0 A;  4JV1 A;  1TA8 A;  2X0S A;  2HQL A;  1A3G A;  3TBI B;  4M7E A;  4A3D H;  2HJW A;  4G4K A;  1Z2P X;  1STG A;  4DV1 L;  5IP7 H;  1G2W A;  3TQT A;  1IL2 A;  5IP9 G;  4A3B B;  2JQO A;  3R2I A;  1OO9 B;  3VYR A;  4KY7 A;  5IWA L;  3TY9 A;  5IWA H;  2V1C C;  4FGR A;  1PLF A;  2RSO A;  1XTD A;  3BAB A;  4APM A;  1JWS D;  2JA5 B;  4O3S A;  4DUZ Q;  3PW5 A;  3HS0 C;  1BDO A;  3K81 C;  2F0L A;  3I4M B;  1OBD A;  4ECV A;  4RCN A;  3A55 A;  2JJQ A;  4DRF A;  1EIH A;  4Y7N H;  5FK9 C;  1QUQ B;  4XIG S;  4LF9 L;  1TWA B;  3H3V H;  4QQB X;  2R7K A;  1YJN A;  1KC7 A;  5KX5 F;  3T7A A;  1SMX A;  4R9W A;  3GDE A;  4IFD I;  2PZT A;  2I87 A;  1TWF A;  1LTT D;  1M6V A;  1Y1V B;  1O80 A;  1BCP F;  5JOB A;  1AH9 A;  1LV9 A;  2KSW A;  4O84 A;  4DR7 Q;  2CNV A;  2I8C A;  4PG3 A;  3K3P A;  4JI4 L;  3K57 A;  2ZM6 L;  1O7Y A;  5DGI A;  5KT6 A;  2FK3 A;  4RKB A;  4HJ5 A;  4FBT A;  1PFM A;  3HOU G;  3TS2 A;  3S1N B;  2F3I A;  4DQN A;  4WOR A;  5C1O A;  4FXD A;  4YHH L;  5LXT F;  3IN5 A;  1ENC A;  1BF4 A;  5FLM H;  3GTK H;  4MHE A;  4KMU C;  2PQA B;  2VUM G;  4IFD J;  1FYC A;  1QIL A;  3ER0 A;  4BY7 B;  4DAA A;  4DAY B;  1MZB A;  2J6T A;  1NCV A;  4YAK B;  1F2L A;  4LF5 L;  1HNW H;  4A4I A;  2Z1C A;  2YTV A;  1XJV A;  4GNX C;  4IOA A;  2NVY A;  2HCC A;  5KG5 A;  3CCR A;  4HN2 A;  1D5X C;  1MD2 D;  1WCM G;  2W9C A;  1XK5 A;  3T9F A;  3PCO B;  4CJ1 B;  3OMC A;  2HHF B;  1A15 A;  1JMC A;  1B4O A;  2B8F A;  4GOP A;  1EQR A;  2F4I A;  4FBU A;  2W57 A;  5FOB B;  4RWS C;  3G7L A;  2SCU B;  1TS4 A;  4DR1 Q;  3J81 c;  2WB1 G;  1GD7 A;  3HOV G;  4JI7 Q;  4OXP A;  2XTI A;  1EU3 A;  3ZJY C;  1I1K A;  4LMY A;  1V43 A;  4OIJ A;  3J80 i;  5E1F A;  2Z0S A;  1E4F T;  1A0I A;  3NP8 A;  2VS1 A;  2Y0S G;  5C4Z A;  3HOX H;  3EN2 A;  4A3C H;  1HHV A;  1K28 A;  2AUK A;  1CHP D;  3S1Q H;  4KHP Q;  2P0A A;  5J2U F;  2WE6 A;  2IPK D;  2IW3 A;  1O7Z A;  4JV0 A;  3M9B A;  5D3I B;  5I5U A;  1RK6 A;  4KHV A;  2PI2 A;  2K01 A;  4J9M A;  2IMW P;  1AUX A;  1DV2 A;  4LFC H;  1H9M A;  4JUZ A;  3BQ1 A;  1BUV T;  1E0B A;  2JK8 A;  2AQ2 B;  4BY1 B;  1EY8 A;  2KEC A;  3BG3 A;  5KFA A;  2K6A A;  1PZJ D;  2EYF A;  5M3F B;  5IYC H;  5JVD F;  4MV8 A;  1B1Z A;  4ED8 A;  2X6L A;  5DG7 A;  4FFO A;  4QL5 A;  4YR3 A;  1JCK B;  2IL8 A;  1IYE A;  3IAY A;  4A3B G;  1WTV A;  1JJC B;  1S3O A;  4QF4 A;  2E2J B;  1VF7 A;  1JE5 A;  4R4T A;  4BY7 H;  5CV4 A;  5LL6 S;  3CF5 A;  3M7N A;  3S1N H;  1KJ8 A;  1XMQ H;  1IL8 A;  3QJY A;  3GTG B;  3AB9 A;  4KHP L;  1SBB B;  2K50 A;  4JI7 H;  2A6E D;  2UVR A;  1ZYR D;  2JEG A;  1D5Z C;  1K83 B;  4QWE A;  3J7Y W;  4JI5 H;  4FP5 D;  4B3M L;  1DIK A;  1XXG A;  5CA0 F;  2AQ4 A;  2VY3 A;  1PHJ A;  1I94 Q;  3VR6 A;  1JX4 A;  2BDO A;  1PFB A;  4JI2 H;  2PVP A;  4Q8E A;  4UDU C;  1VQN A;  2LFN A;  5JEA H;  2QEX A;  2F0Q A;  4HR7 B;  4IUR A;  3RB4 A;  2MHV A;  3BYY B;  1YHQ A;  5FLX L;  3U0G A;  4EVO A;  5AJ3 Q;  1JJ2 A;  3G48 A;  1B53 A;  2C00 A;  2PZW A;  5FD5 A;  2V4Q A;  3TP8 A;  3LWB A;  1E24 A;  1RK5 A;  2F0N A;  1N32 H;  4B3T H;  2K04 A;  3WDN A;  3MWM A;  2O2L D;  3K0X A;  1ULZ A;  1ESR A;  2EZV A;  2WII B;  3CP0 A;  3VPD A;  2B2V A;  4R1J A;  2Q7D A;  1EWH A;  1RF2 D;  3DUZ A;  2P5Z X;  4LW1 A;  3CD6 A;  2YZL A;  4G7O C;  1Y1V G;  4KKS A;  4ECR A;  4OX9 H;  2HGS A;  3JZI A;  2VQF Q;  5L1L A;  3CVZ A;  4WRD A;  4WD3 A;  2XD4 A;  4F50 A;  1ENA A;  5BR8 H;  1L1O C;  3KOJ A;  2K5N A;  1VQ5 A;  1RJQ A;  4DV4 L;  3DWA A;  4K5W A;  3VPB A;  5BN4 A;  2VUM B;  1EUJ A;  3GLK A;  3VOT A;  4NXM L;  1YNJ D;  4EG0 A;  1SYX B;  3DM1 A;  2VB2 X;  1VQH A;  3KDF B;  1GVP A;  3A8J E;  3EA6 A;  5IGE A;  4A3K H;  3TP6 A;  4HYK A;  5T1G A;  3FKI A;  1UUP A;  4IFD H;  1OXX K;  1ZAU A;  3T1Y Q;  1DZ1 A;  4JV5 H;  2Z6K A;  1J9O A;  3U4V A;  2IBK A;  4DUZ L;  4UP9 A;  4X3T A;  2NTT A;  2UXD Q;  2WAQ A;  4DV7 L;  1TWA H;  3CMA A;  1EWC A;  3Q2O A;  3N40 P;  4L6T B;  5M5Y B;  2WAC A;  1V4Y A;  4ABN A;  3M4O B;  2W6Z A;  4RGT A;  3X3N A;  1BBW A;  4K2L A;  3S1Q B;  1KAB A;  2MP1 A;  3OHA A;  3HOX B;  2DJF C;  2KED A;  2GQS A;  1X55 A;  2KHJ A;  3NE5 B;  3R3O A;  3QB3 A;  3MFI A;  1SFO B;  4MV6 A;  4A3F B;  2BR0 A;  5FD6 A;  4FFL A;  3K80 C;  1BXR A;  3I4L A;  3RBE A;  1FGB D;  4ILW A;  3PO2 G;  2AGQ A;  3IRB A;  1AZP A;  3FMA A;  3H6M A;  1T9H A;  3S1R B;  4OWW B;  2HT1 A;  2FPI B;  1J5E H;  4RB2 C;  1LTA D;  1HUN A;  4I7Z C;  1EIG A;  2CQA A;  1HNX L;  4KJO A;  1BVS A;  2PQE A;  2JXM B;  3T9E A;  2SEB D;  2R8H A;  4K14 A;  1JC7 A;  1EKP A;  4GKK Q;  2OTJ A;  3T1Y H;  2Q8I B;  3J80 W;  5EZY F;  1RIP A;  3DTF A;  3SDZ A;  2ZGI A;  1CS0 A;  4JXU A;  4C2M B;  1H9R A;  3M4Y A;  1YNX A;  5C0X H;  5FJ8 G;  3PW2 A;  2UUA L;  3MWD A;  1UE1 A;  1AZQ A;  1VQ6 A;  3RTX A;  3J7A V;  3LP8 A;  4NMZ A;  4EEQ A;  3GIL A;  4XT3 B;  3GID A;  1Y1W A;  3U4Z A;  4DR2 L;  2FIN B;  1Y1V H;  1XNQ H;  1PRT B;  2R92 G;  2CZG A;  4YCU A;  4FDB A;  3RLF A;  2GPS A;  2ZTD A;  5ELN A;  3BYT B;  3S15 B;  1LTS D;  3F2D A;  3IL8 A;  1SYF A;  5CV9 A;  4MV1 A;  4EBD A;  1SXT A;  3BS1 A;  3QQM A;  2NVT H;  3RF2 A;  4DV2 L;  1S0O A;  5LMN L;  3N41 B;  2NN6 G;  2XVS A;  2J6U A;  3K0Y A;  1EEF D;  2KCM A;  4KKU A;  4PZ8 A;  1LAC A;  2QGQ A;  5LL6 X;  1HNX Q;  1TWF B;  3HOX G;  1A63 A;  1VQC A;  1VQB A;  4WJ3 M;  5EWF A;  4XTC S;  3JAM i;  4MV9 A;  1QOH A;  2LS0 1;  3WWJ A;  1EQT A;  5IT9 L;  2UU9 L;  4OIK A;  2Y0S A;  1I6V C;  5DGA A;  4HJA A;  4LAA A;  3MFY A;  2W6M A;  3R2T A;  1D1K A;  1TKW B;  3RLO A;  5C1P A;  1VDZ A;  2CVR A;  4V19 0;  4TQR A;  1CSP A;  4EBE A;  1DCZ A;  3DEO A;  1BO0 A;  2A6H C;  4P75 A;  3S1R H;  2RDF A;  4KD4 A;  3ERO A;  5J1Z A;  4A3D B;  1EKV A;  1NMF A;  1VQA A;  1WYD A;  1SNC A;  3VNN A;  3OSP A;  4POG A;  4DV1 H;  5KFF A;  2KCN A;  3E5N A;  2TMP A;  2XWB B;  3FP9 A;  4ZQ3 A;  3U9O A;  5EJW A;  3UI2 A;  4A75 A;  2W9C B;  1P16 A;  1HZC A;  2Y0S B;  2V59 A;  1FJG L;  3TSS A;  2HD3 A;  5EBD A;  3J80 E;  2NVQ B;  4S3S A;  1S5D D;  2VB3 X;  2E2I B;  4NYE A;  1SEB D;  1IBM H;  1E1O A;  2W8L A;  2R7Z G;  1KAA A;  1I50 A;  1SE3 A;  4XDX A;  3G6V A;  3WO0 A;  1LT6 D;  2KJX A;  2AGP A;  2DAA A;  3SE7 A;  4LF6 L;  1SYE A;  4B3T Q;  2M05 A;  2EY1 A;  3M3Y B;  4DL5 A;  3PR4 A;  5IYC G;  4R8U B;  3GTO A;  3MAQ A;  3L7Z C;  1XMO H;  4NP5 A;  4DAV A;  3NPP A;  2A19 A;  3S17 B;  1F9S A;  3C1F A;  1G6P A;  3I8Z A;  2OQ0 A;  3FVQ A;  1PX2 A;  1W96 A;  3VA7 A;  4I55 F;  1QE6 A;  4NLG A;  4JBK A;  2B2W C;  5D1O B;  5M5X B;  2NVY H;  1PRT D;  4FFN A;  3KLR A;  4GOP C;  1PFS A;  1FNV A;  1JOR A;  4JVZ A;  5IGG A;  1EZ8 A;  1GUN A;  1SMY C;  1EUD B;  4AQY H;  4FE2 A;  1PTO H;  1X9N A;  1F9Q A;  2JA6 G;  2C2E A;  3G6X A;  4K6D A;  2VOB A;  4BBS G;  3GTJ H;  4YIJ A;  2L15 A;  2RGV A;  3SGI A;  4C3J G;  5HGT A;  2NZ1 D;  4LH7 A;  1TWH H;  1L2Z A;  1X6O A;  3E3X A;  2ATW A;  3DTG A;  2YS6 A;  4DNT B;  4LF7 L;  1Y14 B;  5FO7 B;  2BH8 A;  3AYH B;  2UUA Q;  1SFO A;  5KT7 A;  2ZXP A;  4BA1 I;  5C0X I;  4JI0 Q;  5I5S A;  2EDG A;  2XWJ B;  5DEH A;  2ZXO A;  5HGQ A;  5M3F G;  4LNQ A;  2B2U C;  3S9W A;  1GO3 E;  1RKN A;  4A3K G;  3CW2 C;  1RDP D;  3K8A A;  1HQR D;  2NVX B;  4HR7 A;  3CHB D;  4R8N A;  4DAM A;  2UXB Q;  1BJT A;  2B3G A;  3A8K E;  4QIW B;  5F9L A;  1UEB A;  1NNX A;  2F0P A;  1D7Q A;  4DR3 Q;  5GQO A;  1VQM A;  4DK0 A;  2PI2 E;  2W8K A;  3PMF A;  4J15 A;  1ICW A;  4DXG A;  1S72 A;  1KIX A;  2UXD L;  4RA8 A;  1A48 A;  1LUZ A;  3HEJ A;  5EKI A;  1BR9 A;  1D6E C;  1WTP A;  2R7Z H;  5KFZ A;  3TN2 A;  4QW9 A;  4KI0 A;  1KXL A;  3PO3 B;  1I1L A;  2JA6 A;  1LTG D;  2O4X A;  5E4W C;  4G7Z C;  4X3K A;  2R86 A;  5KFC A;  3LWE A;  5IGF A;  5CBA E;  3QFF A;  2J6S A;  4OL7 A;  5JQW A;  2ASJ A;  3ERS X;  5DAU A;  1UE7 A;  1SYB A;  1LT3 D;  5E4X A;  4C3J H;  5LHY 1;  3PIO 3;  4JI5 Q;  4EQP A;  4A3I B;  1SE2 A;  5CR3 A;  5C5M A;  4Q43 A;  3KLS A;  1BBU A;  3CXC A;  2YU9 H;  4O7Y A;  3OW7 A;  5JJL A;  5FKA C;  1W3S A;  4ED1 A;  3Q8P B;  4G7H C;  2QIL A;  2XGP A;  1G91 A;  1RYS A;  2ALY B;  2HG8 A;  3I91 A;  5AFW A;  3KHG A;  4IOC A;  1UWV A;  3N44 B;  1CM9 A;  5M5W B;  1E4E A;  1IXR A;  4LF4 L;  5IYB H;  1JQY D;  2WAQ B;  5I4D A;  1X32 A;  2F0F A;  3K5I A;  5EQ0 A;  3I70 A;  5K5P A;  1JWM D;  5K2M A;  4I65 A;  3J81 E;  2V5A A;  3DMU A;  4JI8 H;  1LM0 A;  3HOW H;  4RUC A;  3CC7 A;  4A76 A;  2CW0 D;  2YWV A;  4TV9 F;  3AQQ A;  4PWQ A;  3D0F A;  4P74 A;  1XMQ Q;  1KQS A;  2BQR A;  4RAU C;  3VDY A;  2XRQ D;  1HR0 Q;  3A0J A;  3LUL A;  1RYR A;  2O5J C;  3S16 H;  5LA6 F;  4K0K Q;  2M2L A;  4C3I B;  4A2B A;  5LP6 F;  1B8A A;  1LTL A;  3NHH A;  3N52 A;  4JOI C;  2FE3 A;  4DR5 H;  1S0N A;  4CC5 A;  1SN8 A;  5FLX E;  1Q86 C;  3M7G A;  2XNA C;  3T1H L;  1I4Q A;  4UAI A;  3V05 A;  1YBY A;  1LTR D;  4JI1 L;  4F4Z A;  1CHQ D;  3L3O C;  3QOL A;  1EHI A;  1EIY B;  3TW6 A;  4O3Q A;  4CDC C;  1IYU A;  2A69 C;  2FK2 A;  2F0T A;  4B9W A;  1G8Z D;  2JA7 B;  2OLS A;  5E25 A;  4F88 A;  5JUM A;  3C3L A;  4R8U A;  3G4S A;  2PBZ A;  3TP7 A;  2E2H B;  4O86 A;  4CDF C;  3X3M A;  4X62 H;  4K0K L;  4O7T A;  1HFN A;  2MCT A;  3PUY A;  2UVU A;  3NBY B;  3BZD B;  4FFP A;  2WKD A;  5C4X G;  1V51 A;  1WI5 A;  1HUM A;  1V9P A;  4U6P A;  2BA1 A;  2F3W A;  5KG1 A;  2WKC A;  4KK7 A;  4RZQ A;  1KC8 C;  1F9R A;  2A74 C;  1D1I A;  5BWX A;  3RJ0 A;  3GTP A;  2YZG A;  2DJG C;  1U9R A;  4DV6 Q;  2Q8R E;  1Y8P B;  3W1B A;  4IJL A;  3ZYY X;  3EJI A;  1VQ9 A;  3GV3 A;  2MFI A;  4DL3 A;  1IW7 C;  4EGV A;  5DM6 3;  4ECT A;  2PNR C;  3ULJ A;  1EYG A;  2SDF A;  4WHX A;  3SEB A;  2A68 D;  4XQJ A;  5CV6 A;  2B2T A;  3ORQ A;  3BZK A;  3CQZ B;  2XGT A;  4QSH A;  4O3P A;  4J9R A;  3WWV A;  1X65 A;  2YRW A;  1SYD A;  5T1I A;  1E1T A;  3MVV A;  5C6A A;  1PRT F;  1WCM H;  3FPP A;  4MV3 A;  3GB8 B;  5BWT A;  2W9B A;  2SNS A;  1IHZ A;  5BPH A;  4IUV A;  3HKZ G;  1K8M A;  3DEP A;  3PUZ A;  2YTX A;  4LF5 Q;  1ZXT A;  4RKL A;  5KND A;  1E4E B;  5FR9 A;  5JJI A;  2HIV A;  4XT1 B;  3EFX D;  1Y8N B;  4BY1 G;  4ECZ A;  3KLS X;  2NVX A;  3ERQ A;  2RKS A;  1Q1B A;  3BVZ A;  3NQT A;  2R93 G;  4YP3 A;  4Q0Y A;  2F4V H;  2TSS A;  2GQR A;  1QVG A;  4LFA L;  5HV6 A;  4EFB A;  2LY7 A;  4ECU A;  2ZTE A;  5IY0 A;  5LMU L;  5I2Y A;  4X64 L;  5HBR B;  2WB1 A;  1PH7 A;  2R85 A;  1I4P A;  1PH4 A;  1VQK A;  2JA8 G;  5ELB A;  3S14 H;  1KDA A;  5D65 A;  2IHE A;  4AH6 A;  4LF8 Q;  3TW7 A;  1GUT A;  5JVL A;  4NPS A;  2HDK A;  1TS5 A;  2R7Z A;  1WCM A;  3K5L A;  2NN6 H;  2IT1 A;  2BOS A;  2HHH Q;  1CE8 A;  2UXB L;  3KHR A;  5ELC A;  1QCB D;  5M9O A;  1EFW A;  5DLQ E;  3Q8Q B;  1WTX A;  3TY8 A;  4C3J B;  2MO0 A;  4AYB E;  3WO1 A;  2D0P A;  4RGN A;  3LWU A;  3PGZ A;  3D4R A;  3J80 L;  1JWU D;  1OWT A;  1HR0 H;  5L1J A;  3H0G H;  2QCP X;  4RGO S;  3KAJ A;  3KF8 B;  2I0Q A;  4NZM A;  5ELE A;  1LLR D;  2L0C A;  4AQY Q;  1I7N A;  4ZRZ A;  1FVI A;  3HKZ A;  2V4R A;  1R9T A;  2RDH A;  1QZH A;  1A8V A;  3GTP H;  4NXN L;  2R7Z B;  3FPU B;  4O4L F;  4FM9 A;  3Q1K A;  2MGS A;  2ODT X;  1BGW A;  1OXT A;  2E5L H;  2K7V A;  1A62 A;  2ZDQ A;  1JDB B;  1STN A;  2HGW A;  1C4Q A;  4M1U B;  2CKZ B;  4K5V A;  3DXJ C;  4N9P A;  2ASL A;  3HGB A;  1SLJ A;  4ID6 A;  5DQH A;  1NR4 A;  5JJK A;  2R7M A;  4JBJ A;  1EOT A;  2F0H A;  4IR1 A;  2O5I C;  4LFB L;  1MBY A;  5G3L F;  5I47 A;  4DL2 A;  3D3R A;  1JOK A;  3PO3 G;  1SE4 A;  1MHW C;  2B2Y C;  4DV5 H;  5DIS C;  4A3F G;  3F2C A;  4LFC Q;  2R6F A;  3CQZ A;  1CKM A;  4JI8 Q;  3RZO H;  4RG1 A;  5EKL A;  1H9K A;  4FNF A;  2R92 A;  1KDC A;  4B3S Q;  5I5X A;  3FDS A;  4IPD A;  4BBR B;  2AQ1 B;  2OEO A;  1ILQ A;  1ML0 D;  4O1N A;  1NUC A;  1L1O B;  3LNN A;  3HBL A;  1SMY D;  5KFP A;  4OGQ C;  2C28 A;  1PTO B;  4EGJ A;  2LMC B;  3GTO H;  2JP1 A;  5M3M H;  4J9K A;  4FF2 A;  1VQE A;  2K5Q A;  4LF9 Q;  3UZB A;  5DG8 A;  2NVY B;  3RD4 A;  4ZLT F;  3M4I A;  5D14 A;  4RHR A;  1SSO A;  3GTO B;  1I6U A;  3S24 A;  4RZR A;  2F0K A;  3ND9 A;  4EFE A;  3E6Z X;  4UP7 A;  3KLW A;  4JYA H;  5LMU H;  1EL0 A;  2FXQ A;  4PBC A;  3J81 L;  2W6P A;  4GN3 B;  3M85 A;  1RTO A;  3R8B A;  2UUC H;  2X6G A;  2F4V L;  3U9T A;  1Z6H A;  1EEI D;  4YJ3 F;  5EBC A;  5IGD A;  5I5W A;  2BH2 A;  4OO1 H;  4UUG A;  3WOF A;  4UY8 C;  3ULL A;  4B3S L;  2FK1 A;  4QW8 A;  4GLV B;  2CH4 W;  4TVA B;  3LQS A;  4JI3 H;  1VMC A;  3UFX B;  4XYQ A;  4X66 L;  2A69 D;  5DGB A;  2X69 A;  1TWG H;  4CKB A;  2ZJP A;  1SNQ A;  1ASY A;  4DR4 L;  1GJX A;  4P72 A;  1VBH A;  1ZKO A;  1TS3 A;  1NJI C;  4ZKC B;  3M9M B;  1ENF A;  4KY5 A;  4B3R L;  1VQG A;  2EIY A;  3SHL A;  1JJG A;  2JEI A;  2XIW A;  3KF8 A;  4LF8 H;  4DV0 L;  1G2S A;  2GLT A;  1F9P A;  1VBG A;  3G8C A;  4DV6 L;  3J80 c;  3GTP B;  1HPC A;  2B63 G;  4Q45 A;  3F2B A;  4DV2 Q;  1HXY D;  2K5D A;  2DUD A;  5L1I A;  1V8Q A;  4PV1 C;  5I6Y A;  3CKI B;  5M3M B;  1IBK Q;  2BDN A;  4JI0 L;  2FPP B;  4UHV A;  1UNN C;  1CKO A;  1PH5 A;  3H4D A;  1S5C D;  4DR4 H;  3GV6 A;  4FFR A;  2ASD A;  2YZN A;  3NBZ B;  1TY0 A;  1K1S A;  1MSG A;  1YJ9 A;  5KFY A;  2COJ A;  1CQV A;  4L5T A;  4JI3 L;  4IN3 A;  1WTW A;  1N33 H;  1FD7 D;  2MO1 A;  3J7A F;  2JA8 B;  3BDO A;  4ZK9 B;  4A3M H;  2FP4 B;  4K0K H;  2RDG A;  1K1Q A;  1PH6 A;  1Q82 C;  4CJ0 B;  3VYT A;  3H20 A;  2AWN A;  3GD7 A;  2GPW A;  4H13 C;  2MPM A;  5KGU A;  5D3D A;  5JVG 3;  4ECY A;  4A3I G;  1B44 D;  4JYA L;  3KTM A;  2CWP A;  3ULP A;  2WYO A;  3R5X A;  1TWH A;  1H95 A;  3DF7 A;  4TRD A;  3CU7 A;  2NYZ D;  2F0O A;  3OHX C;  4M0J A;  3BDL A;  1BCP D;  3L9A X;  4H0L C;  4O7W A;  3MJF A;  3K5N A;  2EIF A;  2R8I A;  3GTJ A;  2I5L X;  1PTO D;  2F03 A;  5A35 A;  1EOV A;  2I80 A;  1IZ6 A;  1KJ9 A;  3OPO A;  4EQN A;  1HA6 A;  1TS2 A;  2ZT9 C;  1IBL L;  4JI6 L;  3RB3 A;  3MR3 A;  5BPF A;  3V6H A;  1C8C A;  3CCS A;  5GAD C;  2W6O A;  5HY6 A;  3C0F B;  2B2Y A;  3F2U A;  3RGX A;  1N33 Q;  3CCJ A;  4DFA A;  5DGH A;  1WJJ A;  4LF4 Q;  1X3P A;  2VZA A;  1CQJ B;  3CQZ H;  1WD0 A;  1B9N A;  3H0G B;  3PIP 3;  2RCF A;  3FRP B;  5IIF A;  4O7R A;  3CPW A;  2VQF H;  1HNZ L;  4BBS B;  4Q44 A;  4JV2 A;  4LJZ C;  3LML A;  4YWM A;  4A93 B;  4LFB H;  4OEM B;  3PO2 B;  1LTB D;  5C44 H;  2V4D A;  2EY2 A;  3K5M A;  4PNY A;  5M5W H;  3MHB A;  3K58 A;  4FYD A;  1YHA A;  2PMZ E;  3PF5 A;  5IE8 A;  4NXN Q;  2K5H A;  2Z4H A;  1E7Z A;  3TQY A;  4A3F H;  3S14 B;  4DR1 H;  1HFG A;  3GQC A;  4LSX A;  3TEK A;  3BVM A;  2EYL A;  2E76 C;  4N8X 1;  1HTL D;  2L4N A;  1X3F A;  1RHP A;  1GUG A;  3T54 A;  3Q8S B;  2PZU A;  3M4O H;  1PH3 A;  4C5B A;  4CMF A;  1OXV A;  4Q0F A;  2BQU A;  2L5T A;  4KV6 A;  3GTQ B;  4APV A;  1XDN A;  3L4K A;  2C2R A;  3V4S A;  1DAA A;  1F2Z A;  3BA9 A;  4F7X A;  2XCA A;  3AEV A;  2MUY A;  1K3R A;  1N9W A;  5HNE A;  4GLX A;  3K3V A;  4DV0 H;  3KDF A;  1KAW A;  4H7B A;  4XZ3 B;  4Q4C A;  1QNK A;  3O13 A;  2B63 B;  4PDB A;  4DV3 L;  2Q2T A;  2LSS A;  1YNN D;  1WCM B;  4Z9C B;  4K2K A;  2JA7 G;  1O7I A;  3PO3 H;  2OQK A;  1B33 N;  2GVB A;  5D1O A;  1T5X D;  1K0S A;  4Q4D A;  3CRL C;  1EZ1 A;  4DPG A;  5BYA A;  4C3I H;  2OWO A;  3U58 A;  4UPA A;  1N34 L;  1DYQ A;  3S16 B;  1GUW A;  2CWA A;  4E6N A;  2CQY A;  2R3Z A;  3S2H B;  1STY A;  4O83 A;  5KFD A;  3SI8 A;  1S03 G;  2R61 A;  5H1S E;  1CK1 A;  1EQQ A;  3R93 A;  1KLG D;  1Q90 A;  3MR2 A;  1UC8 A;  1I1M A;  3OTO H;  5BR8 Q;  5D1P A;  1N36 L;  3RZD B;  1P8L A;  3QZ7 A;  3TRZ A;  2NVX H;  4JI4 H;  4JW0 A;  3VR3 A;  1T5E A;  4ME5 A;  4MTK A;  3CRK C;  5I9P A;  3U50 C;  3G6E A;  4E6I A;  4Q8F A;  1B3A A;  4IUT A;  3RN5 A;  3OIP A;  3HKZ B;  1G29 1;  5KFT A;  1IKM A;  1SRU A;  3NWS A;  2SOB A;  4IUP A;  4ECS A;  3CC2 A;  2AHO B;  2A73 B;  3STB C;  3PZP A;  3T9C A;  1LYL A;  1Q7Y C;  3SXH A;  1AUV A;  2W9B B;  2WB1 E;  2FB9 A;  2HGX A;  1VKZ A;  4O3R A;  2FLL A;  2N49 A;  5FLX c;  2W7O A;  4DV3 H;  4F4X A;  4HJ7 A;  4MTE A;  3BZC A;  4EX5 A;  2PMZ A;  4DR3 H;  2Q8T A;  1I7L A;  1AE3 A;  3HOU B;  2H5X A;  4C1N I;  4RAY A;  4FF3 A;  2LKV A;  3E9I A;  3D4D A;  1WRV A;  5KG2 A;  1N56 A;  2PYK A;  2QKI C;  1UE5 A;  2B39 A;  1TY2 A;  1C30 A;  1SND A;  5KFK A;  2VQE L;  2EQS A;  4WFN 3;  2CNU A;  5KG7 A;  3OIQ A;  4ZUJ A;  1AE2 A;  1PYW D;  1VS0 A;  2N78 A;  3Q8R B;  2A68 C;  2JSO A;  2QYZ A;  4ZYS A;  4XQN A;  5E3F A;  1XTC D;  1T36 A;  3RGZ A;  5F9N A;  2JN4 A;  2FLP A;  2FMM A;  4AYB B;  1ZET A;  3G8D A;  1K9M C;  3S17 H;  3U9S A;  1C9O A;  4DR1 L;  4X62 L;  3PUV A;  5A2Q E;  3KHH A;  1EY5 A;  4YR0 A;  4DGZ A;  4JCV E;  3M3Y H;  3CSW A;  3T5L A;  2OH2 A;  2E5L L;  1E22 A;  1BQQ T;  4L8J A;  3GIJ A;  5KT3 A;  1A9X A;  4O82 A;  2LXJ A;  1L0Y B;  1HNZ H;  2KCC A;  2NZO A;  3CCL A;  2UVV A;  4JI2 Q;  2YTY A;  2VQF L;  3EPG A;  4Y52 H;  1UNS A;  3K7A H;  1SRO A;  3NEM A;  4A3C G;  5A2Q L;  4G3I A;  2E2I A;  2CNQ A;  3FKI H;  1U4L A;  3MFH A;  4XYM B;  2W7P A;  1HJP A;  1QUQ A;  4C3H B;  3HT5 A;  3H0G G;  5KFM A;  3A74 A;  2R87 A;  2VW9 A;  4YWL A;  4YQW A;  3JSN A;  1M8A A;  5CMD A;  3WOE A;  5J2T F;  1E2W A;  5E7N A;  4YHH Q;  2JEB I;  1KDB A;  4DR7 L;  2D5D A;  1XPR A;  5JPM C;  1TT2 A;  5IYB G;  2ZM6 Q;  2JEA I;  1FR3 A;  1J5E Q;  1YZ6 A;  4R4C A;  2UVW A;  4DV0 Q;  3CEB A;  3GII A;  4CJ2 C;  1EY4 A;  4HAE A;  3S2D H;  3C2P A;  4LF4 H;  4RGM A;  5KFO A;  3PVX A;  4CMD A;  5J3B A;  2DPJ A;  1TII D;  3E5S A;  4J0M A;  3M9O B;  1L2F A;  5C4X H;  5C4J H;  4HIO A;  4QUF A;  4QJF A;  4JI1 Q;  4CDE C;  5C4H A;  4M9U A;  3UDF A;  3MXG A;  2E75 C;  4IFD G;  4GLW A;  1PYB A;  2UUC Q;  2NU8 B;  1PXU A;  1Q12 A;  1V1O A;  1H9J A;  1KTK A;  1S5F D;  2Y0S E;  1O78 A;  4PZ7 A;  5BWW A;  2GN5 A;  2NUA B;  3P7J A;  3H09 A;  3GIK A;  4ECX A;  4YBZ B;  3OW2 A;  3HOY G;  1IOW A;  4DV1 Q;  2R7N A;  4BWS C;  2M00 A;  1N33 L;  4JG2 A;  3S15 H;  1IBM Q;  3I7F A;  1JOQ A;  4CKE A;  3GTL H;  4ETS A;  4J6H A;  1B3Q A;  3OYY A;  3VYS A;  1TAE A;  4YR2 A;  1RJR A;  4UCU A;  3RAX A;  2UUA H;  1ICF B;  4OON A;  3I3C A;  5KYL A;  2G9D A;  1VQ4 A;  1X3G A;  4DV6 H;  1CSQ A;  4EGQ A;  2JA6 H;  2VQE H;  2PNH A;  4IR9 A;  1MI2 A;  4DK3 C;  1Z2O X;  4XYL B;  4A3G B;  1R4P B;  3SK4 A;  4C2M H;  2OT2 A;  4LF6 Q;  4K5X A;  4CHT B;  4A93 G;  5ISR A;  2ZDH A;  3GTJ B;  3GV7 B;  4DR3 L;  4YY3 Q;  2NVQ H;  1UAP A;  1XX8 A;  4RUA A;  2VXW A;  2EJ2 A;  4MN3 A;  4XXE A;  3OUU A;  3HOZ G;  2R6G A;  1HCZ A;  1J5E L;  3BA8 A;  5CM0 A;  4DR4 Q;  1WTR A;  4PMC A;  1ZHS A;  2W9A A;  1EY7 A;  3P75 A;  1D8L A;  2PQA A;  1SDF A;  1B2T A;  2KQ3 A;  2R7L A;  3R9R A;  1VQO A;  4R4Q A;  5C3E G;  4RNO A;  5CGK A;  2W70 A;  3CCU A;  4OO1 G;  1STB A;  4RHS A;  1TWC A;  4PQX A;  2R82 A;  1CUK A;  3D4W A;  1K8O A;  1SFO H;  4HMI A;  1KJJ A;  4DUY H;  3GV8 B;  2DLN A;  1PYS B;  1D2B A;  3VR4 A;  1N36 H;  1OBG A;  4RFB A;  4IAJ A;  4NZN A;  2ICI A;  2YS7 A;  5EOY A;  5CA1 F;  4DV5 Q;  4Y8V B;  1ILP A;  1Y1W G;  2HVQ A;  2K05 A;  1XNQ Q;  4A3G H;  2JE6 I;  3N6X A;  3K5H A;  1ZHQ A;  4IUN A;  4LUO A;  4TM5 A;  2R93 H;  2JA6 B;  2EYM A;  2ASB A;  2B2T C;  5IYD G;  2UUB L;  4GOP B;  2OTL A;  2R93 B;  3RV4 A;  4XYO A;  1II3 A;  4NXM H;  4IPC A;  1ZYR C;  2N8N A;  1NR2 A;  1B70 B;  3JAM E;  1K73 C;  2OF1 A;  3TZU A;  3NBH A;  2QDB A;  1I4X A;  4L5S A;  3RIZ A;  5KFB A;  3MXN A;  1HZB A;  2QF7 A;  5GON F;  4QIW E;  1VQP A;  3KF6 B;  4GC6 A;  1SYC A;  4TQS A;  5DLF A;  1NSN S;  1A3U A;  3Q6S A;  3GJX B;  2RSN A;  5BWV A;  3T9A A;  5CV5 A;  4C3I G;  3AFP A;  5K36 G;  3RBD A;  2HVS A;  5EWG A;  4RH6 A;  3N43 B;  1EZ6 A;  2I5H A;  4IUQ A;  5C4X B;  3GTK A;  4H02 A;  2UUB Q;  4CE5 A;  1AN8 A;  2DWC A;  3HRZ C;  1SYG A;  1VQI A;  1S40 A;  3JZF A;  4ED6 A;  4YAJ B;  3BQ0 A;  3ETJ A;  5FO8 B;  1DOM A;  2WP8 J;  1JB3 A;  3K59 A;  5COY A;  3TIG A;  4KN7 C;  3B6Y A;  3KBX A;  1G6Z A;  2KUM A;  3MC0 B;  4DR5 Q;  3SE0 A;  3TY5 A;  1A0G A;  1NTG A;  1PK8 A;  1SCU B;  3H3V I;  1V1Q A;  1DV1 A;  5L9X A;  2IP4 A;  1TWF H;  2Z6B A;  3J81 W;  4NXM Q;  3NK9 A;  5IWA Q;  3G71 A;  1W2B A;  2HIX A;  1KNA A;  1VAJ A;  1CTM A;  4X62 Q;  4GNX B;  3A8I E;  4E4T A;  1KLU D;  5I2X A;  1U0L A;  5IP9 H;  2NVT B;  2QB5 A;  2VUM A;  1MSH A;  5KFV A;  3VYU A;  2XIG A;  4BXX G;  5M3M G;  1YJW A;  1UE6 A;  4LH6 A;  3KFU A;  3FKI B;  4UCO A;  2CFM A;  4J1M A;  1QNU A;  1HR0 L;  1I3Q B;  4KHP H;  2G5D A;  1FNW A;  2VUG A;  5LL6 b;  1K8G A;  5ELD A;  2KVM A;  5KFW A;  3BJY A;  1EY6 A;  3GTG H;  3HG9 A;  1SEI A;  2UUB H;  3QZ8 A;  4FF1 A;  4F4W A;  4XQQ A;  1HZA A;  4DXF A;  3HO8 A;  1T3N A;  1S10 A;  3FKI G;  3A7A B;  5J39 A;  1SNO A;  2EE1 A;  1UC9 A;  3G6J B;  4P2C B;  2E2J H;  1Q8K A;  5AJ3 L;  1HRJ A;  1E4G T;  4X64 H;  2RBM A;  4X66 Q;  3CCM A;  2WDT A;  3D8G A;  4IQZ A;  2UU9 H;  4LFA Q;  5KG4 A;  3MFG A;  2NB0 A;  1I4H A;  2Z4I A;  4MA0 A;  5H80 A;  3MA2 B;  2CW0 C;  2PW5 A;  4X64 Q;  3NTI A;  3DM3 A;  1W6J A;  4DUY L;  1VQ8 A;  2IHF A;  1VQL A;  2COG A;  4I7A A;  1QVF A;  3W1G A;  1FJG Q;  1KHI A;  2CH4 A;  3QWN A;  2EJG C;  3KHL A;  4JBM A;  1X3Q A;  1CI3 M;  5EWE A;  2XSC A;  2ES2 A;  2OXP A;  5ELO A;  4UFZ A;  1EY9 A;  4ZQI A;  1KJQ A;  4BY1 H;  3M9N B;  1Y1V A;  4ZHQ F;  1Q46 A;  4MA5 A;  3Q8D A;  3FEW X;  4EQ5 A;  3T5K A;  3ICE A;  3W3A A;  2EYP A;  1GM5 A;  1ET9 A;  5LOV F;  4H44 C;  4UCS A;  1RJT A;  5KG0 A;  1VQD A;  4C3H H;  2DNC A;  2EYJ A;  5IT9 E;  4U68 A;  4KLK A;  2DZD A;  1S0M A;  2VA2 A;  3J81 i;  4ME3 A;  3PV0 A;  1RD9 D;  2FHT A;  4HMJ A;  5KKN B;  4J9L A;  3K7A B;  3MXU A;  2FJ2 A;  1O7L A;  1I2L A;  1M4V A;  1K8A C;  4OEL B;  5C5L A;  3SK8 A;  5EPK A;  5CE8 A;  4DL6 A;  1PDQ A;  3P1H A;  1XNR Q;  4JV5 Q;  4CC6 A;  3HOV B;  1N32 Q;  4LF8 L;  3QWU A;  4ME6 A;  1W93 A;  1K0R A;  5I60 A;  4BA2 I;  3VMM A;  1KT8 A;  4L5R C;  2VUM H;  2Q2H A;  2JEJ A;  2B2W A;  3AU7 A;  1KL9 A;  3RB6 A;  4B08 A;  2KEE A;  4MV7 A;  3EBE A;  1XMO L;  4DK1 A;  2R7F A;  2K03 A;  3BAA A;  3OUZ A;  5KT4 A;  4B3S H;  3V96 A;  3K7U C;  2ZM6 H;  2KOL A;  5C4J B;  5JPN C;  4X65 Q;  3G6Y A;  3I55 A;  1N36 Q;  4ZI7 F;  1STA A;  2KHS A;  2D0O A;  4N8F A;  2RHS B;  3HOY B;  2HDL A;  2NN6 I;  2RA4 A;  3KAK A;  2ZJT A;  2UUC L;  4M8A A;  1TWA A;  3T4A C;  2F0W A;  2DY7 A;  4DN4 M;  3HOU H;  3PFF A;  4DLK A;  3DWQ A;  3WWI A;  1JLL B;  1OTC A;  1PZI D;  2D9U A;  2I46 A;  3CAM A;  3JRX A;  4DV4 Q;  3T1H H;  4J9Q A;  2IJ0 A;  3PUX A;  3TEH B;  4DR5 L;  4LSA A;  2YZM A;  4RAZ A;  5CB4 F;  2ZTC A;  1Z9F A;  2A1A A;  2AMC B;  1GKH A;  2D2C C;  3OTO Q;  3A5U A;  1HNZ Q;  2Z02 A;  3PR5 B;  4DR7 H;  2ZJR A;  4IRD A;  1KRT A;  3Q22 A;  3U55 A;  2IX3 A;  5BR8 L;  3I4M H;  1IBL H;  4JI6 H;  1ET0 A;  4IO9 A;  1EY0 A;  2JA5 H;  1K83 H;  3MTS A;  2MQH A;  4A3G G;  4A3D G;  2HHF A;  4KKT A;  3UQ8 A;  3V4Z A;  2J0T D;  3RB0 A;  1FNU A;  4OX9 L;  3R5H A;  1A3V A;  1MJC A;  2EY6 A;  4A3B H;  2UXC Q;  2CQO A;  3N6R A;  5C44 B;  2A5H A;  2DY8 A;  2C2D A;  3PO2 H;  4DU9 A;  3HXL A;  1PRT C;  2YYZ A;  2KEN A;  4A3J G;  4B3T L;  1Y69 U;  5CBE E;  3S2H H;  5LMN H;  1N32 L;  4O7L A;  1GOZ A;  5C0X J;  4MIU A;  1L0W A;  4GC7 A;  2HDM A;  1SNM A;  3GV5 B;  3H4B A;  2JA7 A;  4RB3 C;  2WFW A;  5IT9 W;  5D8D A;  2GVA A;  3F8N A;  1A2T A;  2E2H A;  5BWU A;  3EVQ A;  5KFR A;  4BXX H;  3NXW A;  5M3F H;  1YI2 A;  2EVB A;  5FJ8 H;  5JVH 3;  2ZXR A;  4JI0 H;  3Q24 A;  4NXN H;  1EYZ A;  5IYZ F;  2F0I A;  4NW2 A;  4ZCK A;  2VQD A;  1I3Q H;  3STB D;  4FFM A;  2K28 A;  4BY7 G;  2I07 B;  5GAH C;  1WFQ A;  5I5T A;  2F0S A;  3J81 j;  1I3Q A;  2XCL A;  2JA5 G;  4B3R H;  2Z9H A;  4A3J B;  4IWX A;  1WTO A;  1HNX H;  5JJZ A;  1WTQ A;  4YCV A;  3I12 A;  4O2A F;  1BOS A;  5EAY A;  1XYI A;  2YCH A;  5KFH A;  4BWG B;  2N88 A;  3MZ5 A;  1S5E D;  1QVC A;  1X3E A;  1NE3 A;  3KXY T;  4GKK H;  4K6L A;  1ONL A;  2K5V A;  1TWG A;  3T99 A;  2JA9 A;  4A3M B;  4A93 H;  4DAY A;  5KNC A;  3NC0 B;  2JA8 H;  4TVI A;  3A7L A;  4FS1 A;  3RZD H;  5JEA G;  4QMG A;  1G2T A;  4WJ4 A;  5I9O A;  2DAB A;  2WIN B;  2K33 A;  3I90 A;  1AN7 A;  2L1B A;  1GUS A;  5KRU A;  4IPH A;  5BMV F;  2FJZ A;  2EXD A;  3OTO L;  3GTK B;  4LF7 H;  4J9S A;  4TV8 F;  5LYJ F;  1E2V A;  5C5J A;  1O75 A;  1YNN C;  4C1N K;  2L9H A;  1SR3 A;  4JV5 L;  2MNA A;  1N34 H;  4IZO A;  3C1E A;  3TRE A;  4FF4 A;  1STH A;  3DHQ A;  2VA3 A;  4IZ8 A;  2B63 H;  1MKH A;  4DR6 Q;  4QWB A;  3OSN A;  2NU7 B;  2CCZ A;  1WH2 A;  4JOI A;  5LMN W;  2XGQ A;  2C9O A;  2F0G A;  2PW7 A;  2WTF A;  1B9M A;  4DKA C;  4POF A;  4RMF A;  3E9H A;  2XCP A;  4Y7N B;  1IOV A;  3VA5 A;  4LWC A;  1U5K A;  2NZH A;  1WTH A;  4N9T A;  3URY A;  5IOD A;  2VNU D;  1PMR A;  5JEA J;  1WD1 A;  5BWR A;  3A56 A;  1IBL Q;  4JI6 Q;  4DL7 A;  3BJU A;  2I5M X;  5BN5 A;  3T5J A;  2EXZ A;  5T14 A;  4K8J A;  1GHK A;  1LTI D;  2H4O A;  3BDC A;  3HKS A;  4F87 A;  3I4N G;  4C5C A;  3FMC A;  4YHH H;  1STE A;  4RU9 A;  3N8D A;  3JAM W;  5I5V A;  3JAM c;  3TME A;  3SK6 A;  4DF7 A;  1EIF A;  3LGJ A;  2K1B A;  4LF6 H;  1ET6 A;  1PV4 A;  3FHW A;  4C5A A;  3NTH A;  4CBV A;  1EWI A;  2R84 A;  3K5O A;  3P20 A;  4NZO A;  1PVO A;  3BU2 A;  4JI2 L;  4J9P A;  3PSI A;  1XWE A;  4P73 A;  5C44 G;  2HHH H;  4KN4 C;  1ROD A;  3L0O A;  1ASZ A;  2QW7 A;  2NU6 B;  1DXM A;  3I4N B;  3KAL A;  4CHI A;  1ZEQ X;  2QA4 A;  2W6N A;  1TQO A;  4HNU A;  2KA7 A;  3I73 A;  4LK1 C;  3AMU A;  5FPO A;  4QUC A;  1TWC H;  3I4M G;  4A3L G;  1BCP C;  3NWT A;  3J7A 5;  4RB1 A;  1S97 A;  1L1O A;  5L37 A;  1TWG B;  4ODG A;  5KG6 A;  3L2P A;  2F4V Q;  2RGR A;  5COR A;  5KS8 A;  4V0B A;  3UDG A;  3KK7 A;  3Q23 A;  3FDT A;  3WNZ A;  4I50 F;  4A3E B;  3GTL B;  1CA5 A;  2KBN A;  1PTO F;  2ZJQ A;  3PW4 A;  3GTQ A;  2OCE A;  2V9W A;  3EYY A;  4NB3 A;  1BNC A;  4JI8 L;  1Y8O B;  2B2V C;  4HTH A;  1M0T A;  3SNO A;  3NUA A;  5BYB A;  4HQ6 A;  1YEZ A;  3CCE A;  3GIQ A;  3DAA A;  2CW8 A;  1MGS A;  4G57 A;  4O7Z A;  4TSS A;  4O81 A;  4OWX B;  1IYV A;  3JSL A;  2IA6 A;  1WVL A;  4UP8 A;  3PN1 A;  3NBI A;  2FMA A;  4IRK A;  4DV2 H;  1KBL A;  3RAQ A;  3F1Z A;  1XPU A;  4R4I A;  5FLM G;  4Q5V A;  3CME A;  1EUC B;  2AQ3 B;  4FVM A;  4GKJ H;  5LMU Q;  3S2D B;  5KT5 A;  2L11 A;  3TDQ A;  2G9H D;  1JOO A;  2AKW B;  1Y1W B;  1IW7 D;  1CT1 D;  4BBR H;  4L1K A;  4MAM A;  1CZW A;  3IG0 A;  4UCT A;  4A3L H;  4OHJ A;  5C3X A;  3GTG A;  4KJN A;  4TUY F;  1CQF A;  4NKL A;  1GGO A;  2EJ0 A;  1M7J A;  1HNW Q;  4ED2 A;  3NGD A;  1J6Q A;  4HCS A;  1NY4 A;  4IHJ F;  1K3B C;  3GQB A;  1ZQ7 A;  3T1Y L;  1BBX C;  2EJF C;  1GSO A;  2R8J A;  2RCN A;  4QGU A;  1R4Q B;  5KIX A;  4P71 A;  1DGS A;  1YIJ A;  4GLA C;  2NUC A;  3TS0 A;  4TQU S;  2EY5 A;  3MEH A;  3V6J A;  3QO2 A;  1QG7 A;  2MJ8 A;  2VL6 A;  1F2M A;  3HOZ B;  3NEN A;  4HCE A;  3KJO A;  2FMC A;  2YL2 A;  5EGT A;  2QK4 A;  2UXD H;  2DGY A;  3H3V C;  4X66 H;  5CAE B;  5KFX A;  4YB8 B;  4A2A A;  1BKB A;  2C22 A;  1HR0 W;  4ULL A;  1NMG A;  5EPL A;  4DNI A;  1GSA A;  4LUV A;  4DV3 Q;  1T94 A;  2UXC L;  2FPG B;  1BNZ A;  3QR8 A;  4IIJ F;  3T9B A;  1B6R A;  5KFG A;  2WV6 D;  1D5M C;  3DWP A;  3OHB A;  1TWC B;  2WAQ G;  5KYI A;  2YRX A;  5G3L D;  5KFE A;  1U4M A;  1JXL A;  1B04 A;  2FKL A;  2ENB A;  3RR5 A;  2ABJ A;  3CPF A;  3JRW A;  5FPR A;  4MTN A;  2GA4 B;  4PMW A;  3BG5 A;  3PQI A;  4QWC A;  1DOL A;  1MIU A;  4DV7 Q;  4U7C A;  3ONA B;  4O0A A;  2L55 A;  3SR1 A;  2RVL A;  4BBR G;  3J7A K;  4A3M G;  4DUZ H;  1R9T B;  5DAA A;  3M4P A;  4JI1 H;  1SJH D;  5KEE A;  5C3E H;  3GO5 A;  5TSS A;  4DV7 H;  4FO2 A;  4EEY A;  3ORR A;  1DON A;  1CZG A;  3KUP A;  2R8K A;  5CV8 A;  2W71 A;  1GYF A;  4FXG C;  2FFK B;  4DR6 L;  2NTS A;  5KFQ A;  5BN3 A;  2E5L Q;  1I94 L;  1B6S A;  2B63 A;  3JZ6 A;  3NBH B;  5F2D A;  1YHB A;  2AU0 A;  1TR5 A;  2EYO A;  1PA6 A;  4X6A H;  4ED7 A;  4DV4 H;  4QB4 A;  4HJ9 A;  2RDI A;  4AQY L;  3RNU A;  2R93 A;  4OWT B;  3HKZ E;  3AW8 A;  5IP7 G;  3MR6 A;  1M90 C;  1S4Z A;  3T5H A;  3VR5 A;  1C0A A;  2KCT A;  5KFU A;  3GTM H;  1A2U A;  1V1P A;  3HZX A;  1B7Y B;  1I2K A;  4HNV A;  1LT4 D;  2WB1 B;  3J7Z C;  2R92 B;  5KG3 A;  1CQI B;  2EPB A;  1JR0 D;  1L0X B;  3S1M B;  3RN2 A;  4L63 B;  3T9D A;  4ALP A;  1SAP A;  4JI4 Q;  5CYU A;  3MWY W;  2XN9 C;  1YVC A;  1KUT A;  4IUU A;  3HB9 A;  3V6K A;  2JEF A;  3RV3 A;  4O4H F;  3T53 B;  2YV5 A;  4HED A;  5K36 H;  4HNT A;  2CHB D;  1DM0 B;  1XNR L;  3CCQ A;  1EFI D;  1ESF A;  3MXP A;  4YCW A;  1VQ7 A;  2F3V A;  1QB5 D;  4UCV A;  4OX9 Q;  3MEF A;  4L5Q A;  1IYJ B;  4DIM A;  1I50 B;  4B3M H;  4X3U A;  1GXD C;  1IBM L;  3I4O A;  1I6H H;  2BA0 A;  3KRE A;  1NBW A;  1RL2 A;  3HP3 A;  3HOW B;  1JIH A;  1QZG A;  1KTA A;  4GS3 A;  2YW2 A;  4XX0 B;  1OXS C;  2E74 C;  5EDW A;  1JKJ B;  4F4Y A;  2NU9 B;  3HFZ B;  2PMZ B;  3H40 A;  1C48 A;  1PH9 A;  1H9S B;  4LF7 Q;  5FLX W;  2F0J A;  1XMQ L;  1I4G A;  5ELF A;  4JI3 Q;  5JAV A;  3GTQ H;  2AUJ D;  2NBF A;  3R5F A;  2AWO A;  1QWY A;  3GTM B;  2VQE Q;  1FKA H;  3BQ2 A;  1N34 Q;  3KYH C;  2H1E A;  3H91 A;  2UXB H;  3GTL A;  2W6Q A;  3UYY A;  2N3S A;  1PZK D;  1AEX A;  4MNO A;  2QDL A;  2K14 A;  3QG1 A;  2WAQ E;  2E2H H;  5EPJ A;  4MTD A;  1I94 H;  1YNJ C;  5IGB A;  4A3J H;  3T1H Q;  4DR6 H;  5J22 A;  2RF4 A;  3TQ1 A;  1Q1E A;  2JA7 H;  1S68 A;  1SNP A;  4MV4 A;  1CFM A;  5KFS A;  2YU9 B;  1N8R C;  1UEA B;  1EQV A;  4LFA H;  4ED3 A;  1VF5 C;  2Z04 A;  3N42 B;  1IKL A;  4GKJ Q;  1CKN B;  2K5W A;  3GP7 A;  1PH8 A;  1JB7 A;  4O7N A;  3RFC A;  2DPI A;  1TU2 B;  3UE0 A;  4BBS H;  2C5C A;  4DA2 A;  5IGC A;  5C3E B;  5FNV F;  1MJE A;  2IX0 A;  5CR5 A;  1X56 A;  2NWG A;  1EYD A;  3OWF A;  5KFI A;  3V2T A;  4JPB W;  2M9V A;  2B2U A;  2K75 A;  4O42 A;  2X5R A;  1WR2 A;  4DK6 C;  4EYH B;  4JBW A;  1K83 A;  3IFD A;  3OSO A;  3K6O A;  3T56 B;  2ALZ A;  2VR1 A;  5I6W A;  4TKO B;  3KJP A;  1LT5 D;  4AIM A;  1KNE A;  1HH2 P;  4CDD C;  4HSV A;  2IY5 B;  1IYD A;  2Z6K C;  4BS9 A;  2O03 A;  2YYA A; 
#chains in