2Q2TA

Structure of chlorella virus dna ligase-adenylate bound to a 5' phosphorylated nick
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
293
Chain Sequence
MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase/dna
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
total genus 75
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2tA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2tA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2tA01
1PH5A 2I5HA 1PH4A 3G6EA 1SE8A 4DRFA 3M4QA 3T1YQ 4UCUA 4QY7A 4OWTB 4DV3Q 3S1MH 4H02A 1X55A 1CKNB 3S2DH 2R7FA 5IWAQ 4ALPA 3TY8A 2EQSA 4DR6Q 2ID0A 3ULJA 1ASZA 1P8LA 4X66L 1VQNA 3A5ZB 1CKMA 2RF4A 1YHQA 4DAMA 4EX5A 1A63A 3RZOH 4NXNL 4BY1G 3RR5A 4LF6Q 1VCIA 4JI6L 4R1JA 5DISC 1KAWA 2K5NA 4A3BG 4DR5L 4B3RL 2ES2A 1JJCB 2K50A 1E24A 4JI5Q 5C4XH 1UE7A 3FHWA 4LUOA 4TQUS 1NBWA 4EFBA 2AMCB 3AEVA 1XMOQ 4A75A 2QEXA 4HIKA 1TA8A 2IT1A 1GKHA 4BBRG 1NMFA 1WCMG 3EIVA 3L2PA 3M4OH 1TWHH 3W5OA 2VQEL 1IBKL 3DLLA 4IPCA 4DV1L 1EFWA 3RZDH 4UCTA 1UE1A 2A19A 4GKKQ 4LFAQ 5M3MG 1U5KA 2HVQA 1KL9A 1B8AA 3PGZA 1CSPA 2ZTEA 1L0WA 3CC7A 4DV0L 1VQ7A 1H95A 2KHIA 2CQOA 2ZM6Q 3RTXA 1EWIA 3TQYA 2XTIA 4C3JH 1QZGA 5AJ3Q 4JI2Q 2HT1A 5LMUQ 3BU2A 1XPRA 1C9OA 3PO2H 1VQOA 4YWMA 4OX9Q 1XDNA 2WB1E 3F1ZA 5D1PA 3FP9A 3AYHB 4CC5A 1IBLL 4YHHQ 2DGYA 2UUCL 4OWWB 2AWNA 4B3TL 3L7ZC 4A3LH 3PUXA 4JI3L 1K8GA 1GM5A 2HIVA 3NBHB 4DPGA 1Y1WG 1YJ9A 1LM0A 3CQZH 2DUDA 3F2DA 1E1TA 3HOUG 1FGUA 3S2HH 2CWPA 4LF8L 1FVIA 3CCJA 1J5EL 4JYAL 1TAEA 3E9IA 3TS0A 3ZJYC 3ULPA 5IP7G 1I94L 2B63G 2PI2A 1JJ2A 1I50H 4JI1L 5HY6A 3S16H 4HIMA 2JA8H 2HHHQ 2VL6A 3CCUA 4R4OA 1WCMH 3HOZH 4DR2L 4UFZA 5H1SE 1XNRQ 1N9WA 3S17H 3B6YA 4YCVA 5D1OB 5LMNL 4AQYQ 4JI0L 3NBZB 2JJQA 3KLWA 4IPDA 4JCVE 4OONA 5JEAG 3UE0A 1HZBA 5FPOA 2RHQB 3TREA 1VQEA 1N33L 3FKIG 2UXCL 3J81c 1IZ6A 4DV6L 4A3EG 2Z6KA 4L5RC 4JOIA 1XNQL 3CF5A 1EOVA 3GJXB 1KHIA 2F3IA 3NENA 4QJFA 3E9HA 4GN5A 2ALYB 5FLMG 3U58A 4LF7Q 3JAMc 3H15A 1N8RC 2L15A 1R9TH 4LUVA 4PG3A 4HIOA 3M3YH 4QQBX 4WJ4A 2IHFA 2OQ0A 3LGJA 4DR4L 1NMGA 3M85A 4DV4L 2F4VL 2VUGA 4A3JG 4A3MH 3QWUA 3RLNA 1VQ4A 1E7ZA 1K8AC 3GTKH 3F2CA 2CCZA 3OTOQ 1SRUA 4IPHA 3TEHB 2JA6G 3S15H 4K0KQ 1WJJA 2OTJA 3CPFA 4IOCA 4MNOA 4OO1I 2KENA 4DUYL 2K52A 2PMZE 1PYSB 4RG1A 3I4NG 2LXJA 1HNXL 5C4XG 2BA1A 5C3EH 2H5XA 5GADC 4UCRA 2WFWA 1MJCA 4NXML 2PI2E 2K4KA 3DM3A 4DR1Q 4DR3L 3BA8A 3RNUA 3GTQH 1YJWA 1PH1A 2JEAI 2GN5A 1KRTA 2IY5B 1OTCA 1VQPA 2Z6KC 1IXRA 1VQ6A 4C2MH 1XJVA 3A5UA 4LF6L 3L0OA 2VNUD 4JI7L 2YU9H 1A62A 3RLFA 2UXBL 4AIMA 2E8GA 4YCUA 1K9MC 1VQBA 4LFBL 1Q12A 3D0FA 4P71A 3CCEA 1JMCA 5C4JH 5GAGC 2E5LQ 4A3BH 4NB3A 4LWCA 4Y7NH 1WFQA 2A1AA 1EYGA 3HOWH 4IFDJ 4A3CG 4OO1G 4UP7A 4LNQA 4HJAA 3HKZE 3CCRA 3I55A 4GNXB 3F2BA 3TRZA 1E3PA 2R93G 1X6OA 3RN2A 4DV7L 3ER0A 2JA9A 2JE6I 1XMQQ 1N36Q 4EFEA 4A3GG 2UXDL 1QUQA 4JI8L 3M4PA 3CW2C 1HR0W 4LH6A 3ULLA 1QVCA 1OXVA 1CKOA 1NY4A 2KCMA 2Y0SE 1HNWQ 2F52A 5FJ8G 3STBD 2NVQH 3T1HL 4JV5L 3T1YL 4YY3Q 4HJ8A 3FKIH 1OXUA 3M9BA 3W1BA 2VUMG 4BBSH 3NBYB 1RL2A 1SMXA 4DUZQ 4UY8C 5LMUL 3KF8B 3K7UC 2VW9A 4A76A 2Q2TA 1XK5A 1IBMQ 2JEBI 4P74A 3U50C 2JA5G 1N32Q 2V1CC 3PV0A 2Y0SG 2KHJA 2N78A 1K3RA 1Y1VH 3KF6B 4JBJA 4EQ5A 1SROA 3OW2A 3HKZG 3CC2A 3J7A5 1FL0A 4B3TQ 2Z0SA 2Q2UA 3TS2A 3TY9A 4LFCQ 1QZHA 2ZTDA 1Z9FA 1PH7A 4POGA 4DV2L 1MIUA 4JI5L 1Q86C 5GAHC 4GN3B 3CMAA 3KFUA 4BA1I 4BA2I 4L5TA 4A4IA 2R92H 4IJLA 1I3QH 4JYAQ 3ERSX 1KC8C 2MFIA 5M3FH 1Y14B 3PN1A 2EIFA 2JA6H 2OCEA 1UEBA 3H3VI 2QA4A 3HOWG 4X64L 2VY3A 1S68A 5IWAL 4QIWE 2HHHL 4DV1Q 1L1OC 1V9PA 3HOXH 1X54A 1Z47A 4LFAL 3I56A 4BY1H 5BR8L 3VDYA 2D0PA 1VQ5A 2UU9Q 4LF5Q 4NXNQ 3E0EA 3I4MG 4KI0A 4GKJL 1PH2A 4JG2A 5IE8A 4A3KG 4X62Q 4LF9L 1YEZA 1OXSC 1PH6A 4LF4L 2FXQA 1HNZL 4JI2L 1GD7A 1VQDA 1Q1EA 1WI5A 3UDXA 2R7ZG 1BVSA 1YI2A 4YWLA 5LMNW 4OX9L 3GTMH 2K5VA 3KOJA 4RMFA 3HOVG 1HR0L 4UCVA 1IBLQ 2LXKA 2B29A 2NZHA 2B63H 1VQ8A 2JQOA 3H0GG 1C0AA 1B04A 4DV5L 1OXTA 3K8AA 3PF5A 2RCNA 2OWOA 1NE3A 3CCQA 1DGSA 4JI4Q 1S3OA 4BY7H 4DR7L 4KHPQ 4DK3C 1LUZA 3CD6A 1A8VA 1KQSA 2R6GA 2D0OA 3I7FA 4O0AA 4IO9A 5JJIA 5ELOA 3KYHC 4ME3A 4R4TA 3UE1A 5M5YH 3BABA 3PSIA 4JI1Q 3PIPA 1EIYB 1GO3E 3U4VA 2N49A 5DLQE 3JC66 2ATWA 2R7ZH 4A3IG 1SFOH 4R4CA 2JA8G 4OXPA 1VQJA 4DR2Q 2NN6G 4NXMQ 1L1OB 4P72A 5JEAJ 4APVA 4X66Q 3CCVA 2IX0A 3CAMA 3BZKA 3I4OA 4A3CH 2E2IH 1EIFA 1K83H 5M3MH 4GOPB 1HZAA 5IP7H 1CKNA 4OWXB 1N34L 3F8TA 2AHOB 2EXDA 4JI3Q 4B3RQ 4LH7A 4C3HH 4JI6Q 3OYYA 1HJPA 5GQOA 3GTLH 4DR5Q 5C44H 1O7IA 2NVYH 4DNIA 3CPWA 4UPAA 1XPUA 1WOCA 2UUAQ 1D7QA 1BKBA 1TWGH 3PUVA 1FJGQ 2E5LL 1E22A 4AYBE 2MNAA 3KJOA 3EBEA 5FJ8H 3PF4A 4A3DH 3KJPA 3CCLA 2VQEQ 1W3SA 1TWFH 1IBKQ 1Q1BA 5IP9H 5M5WH 1XMQL 1N36L 3GDEA 2N8NA 3UDFA 1E1OA 1W2BA 3HOUH 2MO1A 4DAYB 3H3VH 4BXXH 1UE5A 2WAQE 4LW1A 5J3BA 4XIGS 5FLMH 4EEQA 1Y1VG 2BH8A 5IYCH 1YBYA 4X65L 2VQFL 4HIDA 4GN4B 1LTLA 2I5MX 1QVFA 4BY7G 3J80c 1YHBA 1VQKA 2BH2A 3A74A 3Q8DA 3S14H 3IRBA 3PO2G 1HNXQ 5HGQA 2E2JH 3GD7A 1VQAA 3BJUA 4A3KH 2NVXH 1SR3A 1P16A 1YNXA 4LF7L 4AYBG 1CSQA 2YV5A 1VQCA 2YYZA 1V1QA 2QGQA 4AH6A 4HJ7A 1HZ9A 1M1KC 3NC0B 4IPGA 1PYBA 1KD1C 4JOIC 4B3ML 4DV4Q 3GTJH 4C3IH 4LFCL 3AFQA 3CCSA 2A8VA 3CXCA 5IYBG 3UQ8A 1I6HH 1MKHA 2GVBA 4LFBQ 4LF8Q 2VQFQ 4CC6A 3G71A 1KRSA 1XMOL 2ZJPA 1S40A 3JAMi 5GROA 1I94Q 2I5LX 1IL2A 3PO3H 3PUZA 2K5HA 3HOXG 4TVAB 4DV3L 1XPOA 4A3IH 1X3FA 3S1NH 4JC0A 5IYDG 1M90C 4DR6L 1TWCH 3RLOA 4A3JH 1EQQA 1I5FA 2AKWB 4PZ6A 4DR3Q 3J81j 4JBMA 4JI8Q 5FLXc 4J15A 2N3SA 1TXYA 1X56A 1PVOA 1EQRA 5IT9c 4E6NA 5LMNQ 4AQYL 4JI0Q 2UU9L 5M3FG 4LF5L 2NZOA 3SGIA 2UUBL 4DV0Q 4JI7Q 3PCOB 5K36G 5EAYA 3GO5A 1VQLA 2PQAB 1JE5A 1BBUA 4DUZL 1N33Q 1J6QA 5AJ3L 5GAEC 2UXCQ 5E7NA 1HNZQ 2R93H 2NN6I 4JBKA 4P75A 1L2FA 2PNHA 4A3DG 1JJGA 1T9HA 4BBRH 5IYCG 4A3FH 1QVGA 2CWAA 2KCTA 2JA5H 4B3SL 4GNXC 2ZJQA 3M7NA 2PQAA 2VS1A 5IYDH 1B7YB 4DV7Q 3PIOA 1Q46A 3KDFB 1L1OA 4GKKL 3OTOL 4R4IA 1NTGA 1X3GA 4QL5A 4GOPA 2LSSA 3UDGA 1YZ6A 2D62A 2R7DA 2CKZB 4FDBA 2VZAA 1XTDA 1PH8A 2ZM6L 1VS0A 5JJLA 4PZ7A 3K7AH 3S1RH 3J81i 4A3EH 1CUKA 2YTVA 4IFDI 2K14A 4KLKA 5JJKA 1A0IA 1VQ9A 3AFPA 1IBML 5FPRA 5BR8Q 1PHJA 3U4ZA 4YHHL 1K73C 2WB1G 3PUYA 3CCMA 3JSLA 3D31A 4UP8A 2K75A 1N34Q 1UE6A 1B70B 1G51A 3MEFA 2JK8A 2RHSB 3G48A 3HOZG 1HH2P 4WJ3M 4X6AH 1VQIA 3TY5A 1C7YA 2Q2HA 1J5EQ 1XNQQ 3GTOH 3EN2A 4UCSA 1D8LA 3G4SA 5C0XG 4Y52H 4P73A 1Q82C 5C0XI 3GTGH 1JT8A 2HVSA 1SN8A 1PFSA 3NEMA 4GOPC 2JA7G 1GVPA 1JB7A 4DR4Q 5C3EG 3RN5A 1G6PA 2B3GA 4MTNA 4L5SA 1PV4A 2UXDQ 2JA7H 4YCWA 5C0XJ 1XNRL 4JBWA 3I4MH 4K0KL 3ICEA 3CP0A 4IOAA 4UCOA 2R92G 2WAQG 3HOVH 4A93H 4GKJQ 4UP9A 3S24A 4YY3L 4QGUA 5ELNA 1QUQB 2HQLA 1U0LA 4A3MG 5IP9G 2HVRA 5IYBH 1WYDA 1Q8KA 3HKSA 2Q2IA 3J80i 3K80C 1VQFA 1YHAA 4MZ9A 2ZJRA 4DR1L 1KIXA 1Q7YC 1Q81C 3H0GH 2C35B 2XGTA 1K0RA 2I0QA 1N32L 5M5XH 4HJ5A 4GS3A 2CFMA 3UDIA 2UUCQ 3VNNA 1BBWA 4NPSA 3A0JA 4DV5Q 4GLXA 2HIXA 1X9NA 3GB8B 4B3MQ 1PA6A 3CC4A 4DV2Q 4GLVB 4L5QA 3JSNA 1YIJA 2BA0A 2YTYA 3PO3G 3KF6A 4PMWA 4DR7Q 3AQQA 1VQMA 4KHPL 1AE2A 3I4NH 3I2ZA 4GLAC 1X3EA 1V43A 2MQHA 3BZCA 2YTXA 2GVAA 1YJNA 3BA9A 2WP8J 4IJHA 3S1QH 2ASBA 2KBNA 4BXXG 1KXLA 4X64Q 1UWVA 2IHEA 1LYLA 3WWVA 3NELA 4R4QA 3W1GA 1SLJA 1G291 4A3FG 5D1OA 1EUJA 4O2DA 1X65A 1HNWL 2OTLA 2UUBQ 3T1HQ 4JV5Q 3STBC 2IX1A 4X62L 4LF9Q 2UXBQ 3K0XA 3KDFA 4LF4Q 1S72A 3CMEA 4DV6Q 4IFDG 2UUAL 3GTPH 2VUMH 4BBSG 1PH3A 3K81C 4PZ8A 4DK6C 4HJ9A 4DKAC 4POFA 1FJGL 4A3LG 5IY0A 3HFZB 1VQHA 1HR0Q 4XTCS 1TWAH 4LUZA 2MO0A 1YITA 1IYJB 1AH9A 2ZTCA 4B3SQ 1RIPA 4KHZA 1ASYA 2OQKA 2F4VQ 2AWOA 1NJIC 3HOYH 1OXXK 4A3GH 1HZCA 3BAAA 2NVTH 4YWKA 1Y1WH 5C44G 1AE3A 4GNXA 1PH9A 3HOYG 3J7ZC 4JI4L 2E2HH 1VQGA 4A93G 3MXNB 3PUWA 4DUYQ 4X65Q 1MJEA 1YVCA
chains in the Genus database with same CATH superfamily
2I5HA 1SE8A 1HUMA 3P20A 2YS7A 3NE5B 5ELEA 4QIWA 2W6PA 4LF7H 3S2DH 1NSNS 5IWAQ 4ALPA 4DR6Q 4O2AF 1ASZA 1A2TA 4RFBA 3HKZB 3DWAA 4NXMH 1VCIA 2ICEC 2HGSA 2K5NA 4B3RL 4YJ3F 3N52A 4DR5L 3PIO3 1E24A 4JI5Q 4RB3C 2WV6D 1UE7A 1EOTA 3S1MB 1NBWA 5KFKA 4EFBA 2AU0A 2F0VA 3KK7A 2LFNA 2G5DA 2QEXA 4HIKA 3KLSX 1TA8A 2W9CB 3TN2A 4BBRG 1B50A 1TWHH 3IL8A 2VQEL 3DLLA 3JZFA 5C1PA 1RJQA 1WCMA 2R61A 4ZYSA 2GPSA 4YY3H 1S5CD 1S0OA 2W57A 2W9CA 2Z6BA 3PR5B 5DGIA 1CSPA 3CC7A 4DV0L 3UFXB 4O4JF 5ELFA 4C3JH 3J7AK 1RK5A 1N32H 1XPRA 3GILA 5J22A 5BPHA 1XDNA 3NWSA 5EWGA 4XQNA 1IBLL 2A69D 1A0GA 2AWNA 2R3ZA 1SFOB 5I47A 2FMMA 2XVSA 4JI3L 3GTGH 2HIVA 4DPGA 1Y1WG 5JOBA 2V4RA 3MZ5A 2DUDA 1TWGB 3S2HH 5FK9C 4XZ3B 1FGBD 2XC9A 2VA2A 3CCJA 4IUUA 4KMUC 2FPGB 2WTFA 3K57A 1I94L 5JPMC 3MFYA 3WO0A 5KFJA 3T5KA 5KFSA 2K5QA 3E5SA 3CQZB 2VL6A 5IODA 1WCMH 3HOZH 4DR2L 4FXGC 2W6QA 4UFZA 5H1SE 4EBDA 3GTKA 1XNRQ 3OSOA 2DAAA 3TW6A 2ICIA 1TWHB 5D1OB 4X64H 1FKAH 1CZGA 2AQ1B 3UE0A 3J80L 1ILPA 5FPOA 3TREA 2CNQA 4MV9A 1N33L 4DV6L 2Z6KA 1STAA 2VOBA 5D1OA 1KHIA 3NENA 5DNFA 2OLSA 5FLMG 2IMWP 4MV7A 4NYEA 3H15A 1N8RC 4QQBX 3ORRA 2OQ0A 2B39A 2YW2A 4DV4L 2VUGA 3NUAA 4A3MH 1IBMH 3VPDA 5DM73 3RB3A 4DFAA 1K8AC 2OEOA 4O86A 4RHSA 3OTOQ 4CGYB 2JA6G 3S15H 1I2LA 4K0KQ 2ZDHA 1BCPC 3CPFA 1PLFA 3OIQA 2CZGA 2K52A 1PYSB 5JQGF 4QW9A 2C2DA 4O42A 2J6TA 4X66H 1XXGA 4JV1A 2M00A 2UVUA 2H5XA 4HNUA 5GADC 2C00A 4UCRA 1MJCA 4C5CA 2M05A 2PI2E 2K4KA 2W9BA 1PH1A 4APMA 4YAJB 2L9HA 2K7VA 1KTKA 2WDTA 2BQUA 3V05A 3HGBA 3A5UA 4LF6L 3S14B 3PR4A 2VNUD 4JI7L 3CEBA 2RA4A 5KX5F 2UXBL 4IUTA 3PW0A 1PRTC 4TKOB 2R8HA 2VR1A 4YCUA 2W6MA 3BYYB 3TDQA 4CKBA 2E5LQ 2P5ZX 3PVXA 4Y7NH 3MA2B 1WSCA 1F9PA 3KLSA 3GIDA 2NTSA 1AW7A 4LNQA 2HJWA 3HKZE 2CW0C 1PDQA 3F2BA 4O83A 4O3RA 1A9XA 2R93G 3QB3A 1X6OA 1XMQQ 4DV7L 3ER0A 5I6YA 2JE6I 5IIFA 4EFEA 4A3GG 4WD3A 5BMVF 2RGVA 1EEFD 4I65A 1OXVA 5JEAH 4DL7A 1XMQH 2V59A 3STBD 3T1YL 2RVLA 3PIP3 2Z4HA 1OXUA 3M9BA 4TV8F 4TV9F 1NUCA 1SMXA 4X3KA 2PW7A 3S1NB 3OMGA 3HKZA 4HMJA 2QYZA 1LT3D 3SR1A 4LMQD 4R8UA 2JEBI 3U50C 1N32Q 2FK3A 3PV0A 1ENAA 2V1CC 4UCUA 2N78A 4EQ5A 3EYYA 3FPPA 3HKZG 2Z0SA 3K6OA 3J80E 1SYXB 1WTVA 2ZTDA 4WBNF 4DV2L 1Q86C 1WVLA 4GN3B 3CMAA 1A3GA 2SNMA 2HCIA 2NU8B 4L5TA 1I3QA 4MV6A 3ERSX 3GTMA 2OCEA 3HOWG 2QA4A 2F0DA 5KRUA 5KFQA 5LMNH 4RA8A 2EYJA 2W8KA 2JA7A 1L1OC 3KTMA 5KG4A 1Z47A 4ECXA 3I56A 2FJ2A 5BR8L 4IUNA 1VQ5A 3VMMA 4C5AA 4LF5Q 3MFGA 5T1GA 1H9KA 4FM9A 3VYTA 4A3KG 4X62Q 4LF4L 2NTTA 5KEEA 1HNZL 2R7ZG 3H4BA 1SNQA 2DWCA 4YWLA 3M9MB 5KFIA 4RMFA 3HOXB 4LJZC 2GQSA 3GQCA 2B29A 1EKPA 3OIPA 4YR0A 3H0GG 3UYYA 3I73A 4DV5L 1OXTA 1U4PA 3Q8PB 1TWFB 2RCNA 5C44B 2C22A 3U54A 2YZMA 4DGZA 3CCQA 5EQ0A 3HB9A 1PMRA 5IOCA 4DK3C 1LUZA 5KGUA 1A8VA 1CQIB 1KQSA 2R6GA 4KTAA 5JJIA 1XX8A 2HHFB 3OTOH 1EY7A 4ME3A 3UE1A 4O7YA 4JI1Q 3PIPA 2AUKA 3T4AC 1G91A 3MWMA 3RV3A 4OIKA 4G3IA 2R7ZH 1L0YB 5C8YF 4NXMQ 1SAPA 2IX0A 2XWJB 3CAMA 3W2DA 4A3CH 5M3MH 4GOPB 2I80A 2VQEH 1N34L 2RQXA 1MHWC 3I72A 1GLVA 5KG2A 4MV4A 3GTLH 4DR5Q 3CSWA 1RJRA 2K1BA 4RAZA 4UPAA 3NTKA 1XPUA 1RYRA 1R4QB 3QFFA 5FLXE 5HGTA 1BKBA 2AUJD 1U9RA 1E22A 1B6SA 2PBZA 3PF4A 2EJ3A 3SK5A 5FD6A 5M5WH 1FNVA 3ORQA 2C5CA 1N36L 4JI6H 3UDFA 1RF2D 1E1OA 5KG6A 3HOUH 1DCZA 4BXXH 3NP8A 2JYOA 2XGQA 5FLMH 4EEQA 2Z04A 4X65L 5IYCH 2VQFL 5K5PA 4HIDA 1S4ZA 3BDOA 3M7GA 2HT1A 4CHIA 3J80c 4K5WA 1K8OA 3Q8DA 4I4TF 2B2TA 1T5EA 4JXUA 4IN3A 5L1KA 4EBEA 5CA1F 1TR5A 1VQAA 3BJUA 1I6UA 2B2YA 1P16A 1YNXA 4LSXA 2IBKA 2J6UA 2YV5A 1BQQT 1LO5D 1V1QA 4AH6A 4HJ7A 1M1KC 2EYHA 4RHRA 3URYA 4LFCL 2F0MA 5IYBG 1CE8A 5M5WB 3NTHA 1GGOA 4CC6A 1WH2A 1KRSA 3N40P 2RDHA 4C1NK 5KT4A 1DOKA 2KECA 1Q90A 3H91A 3PO3H 3PUZA 4DV3L 4DV6H 4JC0A 1AP0A 3WWHA 4ME6A 1TWCH 1EQQA 4U673 2XNAC 4J15A 1EQRA 1IYVA 3NQTA 4MV3A 4BY1B 1UUPA 3SGIA 2UUBL 4NZMA 2PO4A 3DEPA 1B33N 5K36G 1B1ZA 1PRTB 5EAYA 4WFN3 4B9WA 3DWPA 2R93H 3Q8RB 4KV6A 1EUCB 5E7NA 3BQ1A 2J7ZA 2NN6I 2NUCA 4QUFA 2FK1A 4A3DG 2F0PA 1JJGA 1T9HA 1K83A 4A3FH 3Q22A 4RNOA 1S5DD 1RCVD 2EPBA 2JA5H 2RDFA 2CW0D 3RB4A 3M7NA 2PQAA 3N42B 4ETSA 4RAYA 2GLTA 4U68A 3T9DA 3PIOA 1EHIA 4GKKL 1I4RA 5C5MA 4J9KA 4R4IA 1PTOB 1R4PB 3UDGA 2LSSA 3U9SA 5KFXA 3T9FA 5COYA 2R7DA 3MAQA 4EBCA 3HOWB 1SXTA 2CKZB 4C5BA 1XTDA 3E6ZX 4PZ7A 4O7TA 3K7AH 3S1RH 4CKCA 2B2WC 2EYPA 4PNYA 3J81i 5FLXW 3HBLA 1SDFA 1KDAA 4O4IF 1E2VA 1WD1A 5BR8Q 2G9HD 1WTQA 2UVVA 2K04A 2ATLA 4FO2A 4CDEC 2C2EA 3D31A 2E5LH 2HGWA 2F0UA 1IKLA 1ZHSA 2JK8A 5EPJA 1HH2P 4WJ3M 1EWCA 2QDLA 1KJ9A 1B9MA 2Q2HA 1XNQQ 4UCSA 2ZXPA 1VF7A 1O75A 4P73A 4M9UA 1PZKD 2JA5A 5KNDA 5C4JB 5KYLA 2AGOA 3NEMA 1G6PA 3RN5A 1EQTA 2EY2A 2B3GA 2UXDQ 1MBYA 4YCWA 3Q1KA 3I4MH 4ED3A 3ICEA 2HGXA 1D2BA 2HDKA 3MWDA 4UCOA 4GKJQ 1JOOA 3I91A 2JEGA 3S24A 4QGUA 2K32A 2QCPX 5IT9E 1U0LA 1BO0A 1ZAUA 1WYDA 1PK8A 3J80i 3K80C 1QWYA 4MAMA 4DV0H 1YHAA 4DR1L 5EKKA 4F87A 3H0GH 2C35B 4ED2A 3NXWA 3U0GA 1N32L 4GS3A 2EY5A 1TWAA 3VNNA 5DGAA 1RD9D 4C2MA 3G7LA 4GLXA 3GB8B 1D1KA 2E2DC 3CC4A 1QJOA 2BA0A 2WB1B 2B8GA 3PO3G 3BDCA 4K6NA 1I2KA 1R9TB 4GKJH 2RDIA 2AGQA 3I4NH 1X3EA 4F4WA 4N8X1 1SBBB 1STEA 1JCKB 2WP8J 1ZYRD 4KJNA 3C46A 1B9NA 3I70A 3KHLA 3NELA 4R4QA 5T1IA 5G3LF 4Q4CA 1KNAA 1G291 2A5HA 1EUJA 1U4RA 2WIIB 5FNVF 5C6AA 1HNWL 1S5ED 4V190 1IKMA 2R8KA 5L1JA 3KAJA 5CV6A 4IFDG 1JWMD 4C3JG 5BN3A 1WTWA 2VUMH 3D8GA 4O7LA 3K81C 3IKJA 1FJGL 2NVQB 5KFDA 1JX4A 4B3SH 4A3LG 4A2AA 2RSOA 3HFZB 1VQHA 4PMBA 1KABA 1TWAH 2O2LD 4XTCS 3VYSA 3SI8A 2X6GA 5EWFA 4BWSC 2ZTCA 4B3SQ 5KT7A 4A3FB 2OQKA 2PZUA 3MWYW 2AWOA 3BVGA 3VR3A 2R7ZA 3R5HA 2W7OA 4OHJA 4YWKA 2NVTH 4U7CA 4LF9H 1AE3A 3DXJC 3RBDA 4GZYC 3OHBA 2E2HH 1YNNC 4X65Q 3SE0A 2VQFQ 1MJEA 3VR4A 1EKFA 4DRFA 4QMGA 4G7OC 1JORA 2JA6A 3BS1A 4UDUC 5KFCA 1JDBB 1X55A 2EE1A 1K1SA 3T5JA 1M7JA 3DHQA 4KKTA 4J6HA 2ID0A 2K03A 3A5ZB 2VB3X 4X3SA 1S0NA 4DR7H 4ECWA 4I7ZC 5LHY1 4JI6L 1EY6A 4R1JA 1D5XC 1KAWA 1Z6HA 2ES2A 1JJCB 2K50A 1M0TA 5C4XH 1KBLA 4HAEA 4TQUS 3VR6A 3LP8A 3QQMA 1XMOQ 3WOFA 4J9MA 3EJIA 1FNWA 2NU9B 1IYEA 3NPPA 1I3QB 1XNRH 1NMFA 3M4OH 2DJFC 3W5OA 5EBDA 3S2HB 4DV1L 3RZDH 4UCTA 4H13C 4GKKQ 3CU7A 1S0MA 1U5KA 3LMLA 1EIGA 4TM5A 3I3CA 4B3MH 4O7WA 1D1IA 1ZXTA 1KEEA 2HCCA 2KHIA 2F0SA 3TQYA 1F9RA 4JI2Q 5F2DA 2O4XA 3PW5A 1XMOH 4L1KA 2M9VA 5LMUQ 3T1HH 1C9OA 4JV5H 3T1YH 4OX9Q 4YWMA 4F50A 1BNCA 2WB1E 3F1ZA 3AYHB 3FP9A 3LULA 5CM0A 4CC5A 2DGYA 4C56C 2UVRA 2R6FA 3OMCA 1K28A 1EQVA 5C3XA 3C3LA 5LMUH 3T5LA 4GC7A 1JC7A 3ETJA 4ECRA 3HOUG 4Q4DA 2L12A 4ZUJA 1DOMA 2CWPA 4O7ZA 3A54A 1JDEA 1U4MA 2UUBH 3E9IA 3TS0A 2JP1A 3A55A 5IP7G 3H20A 4DV2H 1BDOA 2PI2A 5LL6S 2OF1A 4KN4C 5HY6A 3S16H 4O4LF 2JA8H 3TQ1A 3MR2A 3PO3B 3CCUA 4EYHB 3DF7A 1E4FT 1VDZA 2X69A 1N9WA 5DGHA 5C0XH 5LMNL 5I2XA 4OONA 5D14A 3WO1A 1S03G 3DAAA 1FR3A 3CHBD 2RHQB 3GTGA 3RD4A 4NZNA 3CRKC 3VR5A 1F2LA 4L5RC 3A8IE 3CF5A 5I5TA 4HR7A 2B63H 4LF7Q 1T36A 4LF4H 3JAMc 3M3YH 4PG3A 4HIOA 3JZ6A 2XD4A 2IP4A 2IHFA 2YCHA 1BXRA 3RAXA 2F4VL 1A15A 4J8QA 4A3JG 3QWUA 3RLNA 2EIYA 3PW2A 1VQ4A 4ED8A 1E7ZA 3GTKH 3KHRA 2CCZA 1SRUA 4IPHA 3TEHB 1S10A 2R87A 4IOCA 3Q8SB 4MNOA 4OO1I 4HNTA 2QDBA 2I07B 2E2IA 4J1MA 3D4RA 1ZKOA 5HURA 2JEFA 4C1NI 4K14A 1I1LA 4O3PA 5A2QE 2BA1A 1Z2NX 4O3SA 4Z9CB 1XWEA 4DR3L 4XXEA 1DONA 4ECSA 2EYLA 1KRTA 1Z2PX 2IY5B 3SNOA 2AQ2B 1VQ6A 3IN5A 3S17B 2W6ZA 1O7LA 3L0OA 1C3OA 1KC7A 3LQSA 2JEJA 3RF2A 4AIMA 2E8GA 2CNVA 2JXMB 2KEDA 4P71A 4FF2A 1CT1D 1AZPA 4LWCA 4QB4A 1WFQA 2A1AA 4IFDJ 1Z2OX 4EYIB 2Y0SA 1IL8A 2IWHA 1HQMC 1GUGA 5CV9A 4YBZB 2PNRC 1KAAA 5D3DA 2VUMB 2F3WA 3RN2A 1N36Q 3E3XA 2UXDL 4ZKCB 1QUQA 4I50F 4XYMB 4JI8L 3M4PA 1RJTA 1HR0W 4LH6A 4TUYF 1PTOD 2HG8A 1QVCA 1STNA 1CKOA 5C4ZA 1RJPA 5J1ZA 1Y1VA 1N36H 2F52A 5FJ8G 4DK0A 3SE7A 2NVQH 4K6LA 4HJ8A 2G9DA 2WACA 2WINB 3J7AF 2E75C 2YWVA 1CK1A 2ALZA 1OO9B 4NDXA 3RZDB 4JI3H 4A76A 1XK5A 1IBMQ 2EYFA 4DAYA 4F88A 1ZETA 1XJVA 3MXUA 3HG9A 3MXPA 3I4NB 1BNZA 4K0KH 3OW2A 5FOBB 3ZYYX 2Q2UA 3TS2A 5KG3A 1PTOF 1QZHA 4LFCQ 1GUNA 4TQSA 1FD7D 3Q0AA 4BA2I 2L1BA 2JN4A 4BA1I 2GPWA 4JI1H 1FYCA 4OELB 1G2WA 2F3VA 4A4IA 2BQ3A 3JAML 1B3AA 1KC8C 3BG5A 4LFCH 3L9AX 3PN1A 5CE8A 1UEBA 3AB9A 4DNTB 1EIHA 4X64L 1S68A 4DV1Q 2QB5A 1X54A 3TINA 3TZDA 1EYZA 2KQ3A 3VDYA 1VBHA 2XCLA 3H0GB 2ZDQA 5I9PA 1JE4A 3E0EA 5CBAE 1PH2A 3PW4A 4JG2A 5IE8A 2B2UA 4KY5A 1YEZA 4LF9L 1OXSC 3HEJA 2E2HB 4IAJA 4MA5A 2SCUB 1H9RA 4JI2L 4BWGB 1GD7A 1VQDA 1WI5A 3F8NA 3UDXA 2CH4A 3MR6A 4OX9L 1OBGA 3GTMH 2K5VA 3HOVG 1TS2A 4UCVA 5EPLA 2XRQD 2YS6A 3RUZA 3I4MB 2Z1CA 1I50B 1SE2A 3PF5A 3GTJB 5KNCA 2OWOA 3R9RA 4RCNA 5ELDA 1NE3A 5EDWA 1QE6A 5JH7F 1DGSA 3PFFA 4XX0B 2E74C 4HMIA 4DR7L 2I8CA 5DAAA 1EKVA 3R2TA 2B2YC 2UUAH 4RAUC 5IT9L 3I7FA 2RDGA 4O0AA 1K83B 4IO9A 4IWXA 2YZLA 4PV1C 1I4QA 4IUQA 2XSCA 4F4XA 1H9MA 1GO3E 4XDXA 1TWFA 2ATWA 5IYZF 2R8GA 2KA7A 3TP6A 3K7AB 3S1RB 2NN6G 3HOZB 1L1OB 5JEAJ 4JI7H 4NW2A 3CCVA 3BZKA 3FMCA 2F0WA 1K83H 4IUPA 4IR1A 4LAAA 1CQJB 3F8TA 2EXDA 1OWTA 4C3HH 4JI6Q 5GQOA 2NVYH 1B4OA 4HSVA 1TT2A 4J9OA 4QUCA 2UUAQ 2YYAA 4A3IB 1TWGH 2E5LL 2V4DA 3IFDA 4AYBE 3KJOA 3L4KA 1O78A 2WB1A 4DV7H 3EBEA 3PMFA 1G2SA 4MIUA 1MD2D 1IBKQ 1EWHA 3K3PA 4RGMA 1XMQL 5KG7A 1E4GT 1W2BA 4B3RH 3RFCA 3H3VH 2F0JA 1W93A 2NUAB 5IGCA 3I12A 1JICA 4PBCA 1Y1VG 3GTQB 1S97A 4OO1H 5BN4A 1LTLA 2RCFA 3GP7A 2ZJTA 5BYAA 3A74A 1HNXQ 5HGQA 2E2JH 5BWRA 3ETHA 2NVXH 4A3KH 1SR3A 2PMZB 4LF7L 4NZOA 1CSQA 1VQCA 2YYZA 4FYDA 1DD2A 4YR2A 4BY7B 3NC0B 3IG0A 4IPGA 1LTBD 1PYBA 4DF7A 4JOIC 1KD1C 2Y4RA 4DR1H 1VBGA 5E3FA 2JA7B 4QSHA 1RKNA 1TIID 3AFQA 2L11A 2IJ0A 4C3IH 3CXCA 3CCSA 2A8VA 1I6HH 1O7YA 4XQQA 4LFBQ 1JWUD 2GA4B 5KFVA 2ZJPA 1CZWA 4FF1A 4QW8A 5GROA 5IWAH 2WKCA 4HSPA 4EGJA 4LFAH 5EGTA 3GLKA 5BWTA 2JA6B 1M90C 4DR6L 3RLOA 4QIWB 4PZ6A 3GTOA 3M4IA 4JI8Q 4O3OA 2N3SA 1PVOA 1TVXA 4E6NA 1SYFA 5IT9c 5A2QL 4JI0Q 1S5BD 1RDPD 4HR7B 1HQRD 2F4VH 3MEHA 3R93A 5CV5A 5C1OA 1I50A 1KDBA 4JUZA 5EPKA 2PQAB 1JE5A 1BBUA 1C48A 1PXUA 1HNZQ 4ZUIA 1EZ6A 5GONF 4DV5H 3LWUA 5KFLA 2PNHA 2FFKB 4TVIA 4DR2H 3OUZA 5EWEA 5DG7A 2X0SA 4KHVA 4B3SL 1LTGD 3S16B 2FMAA 2VS1A 1ET0A 3AW8A 4CJ0B 3GIKA 1XYIA 1L1OA 1F9QA 3GTLB 3OTOL 5BWWA 2RDJA 3N44B 3QZ7A 2R93B 5IGFA 1YZ6A 4MV8A 5KT3A 1TKWB 3OUUA 3T9BA 2Z4IA 4O3NA 5KFFA 2DZDA 1BUVT 1GSOA 2VZAA 4RKLA 4P2CB 3M9NB 1PH8A 5I5VA 1VS0A 5BPFA 4CHTB 4A3EH 2YTVA 4BBSB 5JJKA 1A0IA 1N34H 4XQJA 4K6DA 3K5MA 4NLGA 4ZKBB 4A3BB 3RUPA 3S1QB 1ILQA 3PZPA 2WB1G 3PUYA 2W71A 1F2MA 5L9XA 4UP8A 1N34Q 2K75A 4DK1A 2NBFA 5I5XA 5CV8A 2UXDH 2EZVA 3HT5A 2VPSA 1G51A 1VF5C 3TY5A 1SFOA 3HOZG 1VQIA 1STYA 1LT6D 2IX3A 1C7YA 2PPBC 2A73B 5KFEA 2RBMA 4QWDA 2N55A 1D8LA 3G4SA 4G7HC 4OGQC 5JVH3 3N41B 1AN8A 1B2TA 2B63B 1KJIA 1DJRD 1SJHD 2KCCA 4GOPC 2JA7G 4DR4Q 5LL6X 1TU2B 2EJ2A 4L5SA 4MTNA 3T5HA 4O82A 3RBEA 2UXBH 1PZID 3DUZA 2CVRA 4K0KL 3RZOB 2QW7A 4RCOA 5EKLA 4QWEA 3KAKA 2AQ3B 2KHSA 2WAQG 1CTMA 4O84A 1CQVA 5C3WA 1W6KA 5BWVA 4O7SA 1QUQB 5C3EB 4A3MG 5IP9G 2HVRA 4RB0A 1MSGA 3EQLC 3HKSA 2JA8B 4WHXA 3FKIB 4MZ9A 4BS9A 2XGTA 4AYBA 1K0RA 1R9TA 3ERQA 2NB0A 1SYBA 1WR2A 2ASJA 5J2TF 1X9NA 2HIXA 4HTHA 3V96A 1PA6A 4TQRA 2MP1A 4DV2Q 1CS0A 3D4WA 3JSNA 2OT2A 2F0LA 1F9SA 2E2JB 3KF6A 4PMWA 3LNNA 1VQMA 4KHPL 1AE2A 1LV9A 2B2VC 4GLAC 3QWNA 1V43A 2MQHA 2YTXA 1A3VA 1KUTA 4J9RA 4M8AA 3BA9A 2F03A 3P75A 4BXXG 2KBNA 1J5EH 2D5DA 5BWXA 4AQYH 2IHEA 3WWVA 1LTAD 1ICWA 3FDTA 3W1GA 1SEIA 3K5LA 1LT4D 2HD3A 1DAAA 1ZYRC 1W96A 5KFMA 3NBIA 4DXGA 1B6RA 5I60A 4FS2A 2OTLA 3VYUA 3H94A 2J6SA 3KDFA 4LF4Q 1S72A 3CMEA 1SJED 2UUAL 5DG9A 1NCVA 5JPNC 2LS01 4BBSG 4KY6A 4PZ8A 4DK6C 2SNSA 4EG0A 4E4TA 5IY0A 4N8FA 2PW5A 3CKIB 3OW7A 3K5NA 5ELCA 1YITA 3QIAA 5CA0F 2GQRA 1EU4A 3K5HA 4F4ZA 1HZCA 3I8ZA 4RUCA 5C44G 1KJ8A 1PH9A 3HOYG 4JI4L 1VKZA 4DIMA 2XRSD 3MXNB 1PRTD 2C2RA 4ZLTF 1PH5A 4Y7NB 5EKIA 2XIWA 3T1YQ 4OWTB 3OWFA 4H02A 4RB1A 1CKNB 1GSAA 4ZOLF 3P1HA 4PWQA 2QK4A 3TY8A 4FFRA 5KT2A 1NNXA 1O7ZA 1P8LA 1VQNA 1CKMA 4A93B 2ASLA 4A3KB 1YHQA 4EX5A 4QF4A 2COIA 4DN4M 2EY6A 3RR5A 4DR3H 5DISC 4N9PA 2NVTB 3W3AA 4O4HF 3T13A 3FHWA 4LUOA 2R84A 3X3NA 2AMCB 1I4HA 1PZJD 3AEVA 2DPJA 2ENBA 5CMDA 4FNFA 1EL0A 2IT1A 1GKHA 4OIJA 1I7NA 5KFAA 2EXZA 1WCMG 3EIVA 4K8JA 5KT5A 2MPMA 1IBKL 2LMCB 4IPCA 1UC9A 2R93A 4IRKA 3TBIB 1K1QA 2UVWA 1UE1A 2NVXA 4LFAQ 4FFPA 1WTOA 1QG7A 1QNKA 1KL9A 2M2LA 2WAQA 3PGZA 1L0WA 5KFUA 5J39A 1V1PB 2R82A 1VQ7A 4HNVA 4JI8H 1OBDA 3PO2B 1STGA 1EWIA 1E2WA 2XTIA 1WCMB 5JAVA 4MHEA 5AJ3Q 1QOHA 3BU2A 3TP8A 3RB0A 1HFGA 4UAIA 4ODGA 3CRLC 1NAPA 1WTPA 4PQXA 5D1PA 3OWEB 2UUCL 1QILA 4LK1C 3N8DA 4B3TL 2H1EA 4DL6A 3L7ZC 4A3LH 3PUXA 4DL5A 1SSOA 3NBHB 3J81L 1YJ9A 1LM0A 3CQZH 3R5FA 1FGUA 3R3OA 4L8JA 5DAUA 4HCSA 4EVOA 1TAEA 3T54A 1L0XB 4H7BA 1S9FA 3ULPA 2MHVA 4ZK9B 1JJ2A 1I50H 2Q7DA 4JI1L 3U9TA 3BDLA 3R5XA 4R4OA 1GXDC 3EPGA 2YU9B 1TS3A 3ITPA 3B6YA 5BYBA 4YCVA 5C5LA 4AQYQ 2CNUA 3NBZB 2L0CA 4JCVE 2FE3A 3A8JE 4ED1A 5IGEA 4WRDA 4A3JB 3IFTA 3DWQA 3X3MA 4FS1A 1JKJB 3FKIG 3J81c 1IZ6A 3SHLA 3JRXA 3U58A 4KN7C 1QCBD 1SNOA 2L15A 2X5RA 4ABNA 4QWCA 4MTEA 4DR4L 4EGQA 4HYKA 1NMGA 4X3UA 1DV2A 4FFMA 3V6JA 2ASDA 1HCZA 2NVYA 4KY7A 1BCPD 1MZBA 2OTJA 1SYEA 5CR5A 2R8JA 1WJJA 1C4QA 4K2KA 4DUYL 2RKSA 4RG1A 2K5WA 2K28A 4FFNA 2LXJA 3KBXA 2O5IC 1GYFA 4JW0A 3MTSA 2XGPA 3OHXC 4MN3A 4ECVA 1HXYD 5C3EH 3TQTA 1SYGA 1E2ZA 1T3NA 1YJWA 2JEAI 2GN5A 3DMUA 2B2VA 3BACA 1OTCA 3QZ8A 1VQPA 2Z6KC 1IXRA 3U55A 1HPCA 2FHTA 5I4DA 3H3VC 2FK2A 2YU9H 1Y8NB 1JR0D 1DYQA 3RLFA 4G7ZC 1ENFA 1HFNA 1AN7A 4A3GB 1K9MC 1Q12A 1JMCA 1EYGA 2F0HA 4JVZA 3HOWH 4K8IA 4DV1H 4A3CG 5KT6A 4OO1G 4UP7A 2A6ED 2A68D 3OHAA 1Y1VB 5KFWA 2PQEA 3CCRA 4GNXB 1EY4A 4RH6A 3TRZA 4R8NA 1E3PA 3TEKA 4J9QA 2BDNA 3MC0B 2VXWA 4JPBW 2R7KA 3SK4A 2JA5B 4LSAA 1SNDA 3ULLA 5DEHA 2B63A 4FVMA 4RZQA 2TSSA 4K2LA 2ODTX 1NY4A 2KCMA 5CBEE 3WNZA 3T1HL 4JV5L 3GTPB 4BBSH 3W1BA 4C3IG 1TWCB 3OOCA 2PYKA 3WWJA 2E76C 1RYSA 3K5OA 3BG3A 4UY8C 2NZ1D 5LMUL 4J9LA 1A3TA 3KF8B 2Q2TA 4Q8EA 2CH4W 2JA5G 4JBJA 2KHJA 4DNRB 1IW7D 1K3RA 3KF6B 5KKNB 3J7A5 4JYAH 1FL0A 1KTAA 2B2WA 3TY9A 1PH7A 1Z9FA 5JJZA 1STHA 4POGA 4FE2A 1MIUA 4JI5L 3SXHA 3KFUA 5CAEB 1IYDA 2NU7B 1H9SB 4KD4A 1ONLA 4JYAQ 1AFPA 3MHBA 3RIZA 2R92A 1A2UA 1Y14B 1CI3M 3H3VI 1GHKA 3SK6A 4F4YA 4JI0H 3GV5B 5IWAL 3H09A 2A69C 1FNUA 2EYOA 2HHHL 4I55F 5M3FB 3HOXH 4ECUA 4ECTA 4LFAL 2F0FA 5CGKA 4QWAA 5M5XB 2UU9Q 3H4DA 4IWYA 3I4MG 4GKJL 4KI0A 1XNQH 4ZRZA 3V4ZA 3A56A 5KFTA 1PH6A 2FXQA 4IZ8A 1I7LA 3T7AA 2MCTA 2EJGC 3GV6A 1EZ8A 1Q1EA 5C4XB 1YI2A 5LMNW 3H0GA 4FBTA 1O80A 5HNEA 3KOJA 3JZIA 2HDMA 1HR0L 1IBLQ 2B8FA 4ZQIA 2Q8RE 3HOUB 1MI2A 2EVBA 4XT3B 1F2YA 2A6EC 3K8AA 3R8BA 4HQ6A 2FJZA 2K01A 5JUMA 4DL3A 4JI4Q 4BY7H 2F0NA 3CD6A 4YB8B 1HNXH 3K5IA 3KBGA 2K6AA 2D0OA 4DR5H 2D9UA 5ELOA 1YNJC 4R4TA 5M5YH 3PSIA 1T5XD 1F2ZA 2YU9A 5DLQE 3JC66 4A3IG 4R4CA 2F0EA 3D4DA 5LXTF 4OXPA 4DR2Q 2BE5C 4FXKC 4CKEA 1DXMA 4G4KA 4P72A 4DL4A 2L4NA 5CC4A 3G8DA 3NHHA 2VB2X 3I4OA 2AGPA 1EIFA 2A6HD 4PMCA 1HZAA 3BQ2A 1IBKH 2AHOB 5E4WC 4JI3Q 4LH7A 3T53B 3OYYA 1HJPA 1CM9A 5C44H 3BZDB 1O7IA 2XN9C 4DNIA 4C2MB 5FR9A 1JXLA 1D7QA 4U6PA 1SMYC 4IALA 1FJGQ 1AUVA 1JOQA 2MNAA 1U4LA 4BBRB 1D6EC 2KJXA 4ID6A 3CCLA 1TWFH 5CR3A 1Q1BA 5IP9H 4IFDH 4RNNA 3GDEA 4RGOS 5J2UF 4FBUA 2K5DA 1QNUA 3MWEA 4DAYB 5LL6b 1L2ZA 1UE5A 2WAQE 4ED6A 4XIGS 1YBYA 1IOVA 4BY7G 4GN4B 2I5MX 1CFMA 5FKAC 2BH2A 1YHBA 3PO2G 4FFLA 3S14H 4EQNA 5T14A 1H9SA 1EY9A 3GD7A 4CJ1B 2R7MA 2WKDA 2SEBD 4C3IB 1ZHQA 3MFHA 3AU7A 2VPQA 2QGQA 2YZGA 1HZ9A 3TIIA 4KD3A 2MJ8A 5BN5A 4B3ML 5KFPA 4DV4Q 3GTJH 1ICFB 3NWTA 1A48A 5M9OA 1I6VC 2BR0A 1MKHA 3T99A 1X32A 1ET6A 1PTOC 1PX2A 1XMOL 1UNNC 3FMAA 3S15B 3K0YA 1IHZA 3JAMi 1I94Q 2I5LX 1IL2A 2V58A 3RV4A 4ZQ3A 1GUWA 3HOXG 4TVAB 4MTDA 3V6KA 1XPOA 2EJ0A 3KALA 3S1NH 3QJYA 5IYDG 1TY2A 2AQ4A 4A3JH 1I5FA 1VMPA 5I6WA 3J81j 2COJA 3G6VA 1TXYA 4MTKA 1PYWD 5CV4A 4AQYL 3JRWA 5M3FG 4JI7Q 3PCOB 2F1MA 1WRVA 5I5WA 4PDBA 1UEAB 4HN7A 1VQLA 5KFNA 1N33Q 1J6QA 4A3EB 1K0SA 2NVYB 4JBKA 4P75A 1UAPA 2BQRA 2V5AA 1ULZA 1QVGA 5AFWA 1KDCA 4L63B 4RKBA 4I7HA 4GNXC 2JSOA 3BVZA 1SCUB 5IYDH 4M0JA 3OSPA 3M9OB 1B7YB 4DV7Q 1Q46A 3G6JB 4Q43A 2IPKD 1NTGA 1X3GA 5FLXL 4A3DB 3Q6SA 1IYUA 4EQPA 1B44D 5DM63 3H40A 1ESFA 3GV3A 4FDBA 5LOVF 5I5SA 4YQWA 1RHPA 2ZM6L 3GV7B 5JJLA 3EPIA 1HA6A 5IT9W 4FF4A 4IFDI 2A6HC 2K14A 4H44C 4KLKA 1VQ9A 1WTHA 3DTGA 5FPRA 4GC6A 3K59A 4YHHL 1K73C 3MXNA 3CCMA 5FO9B 4QCLA 5F9LA 1WTRA 3LX0A 4IR9A 2XWBB 2RHSB 3G48A 5D65A 1BJTA 4X6AH 1M8AA 4Q0YA 1J5EQ 3GTOH 3EN2A 1BXTA 2YRWA 5C0XG 2A74C 3GTQA 2F4IA 5C0XI 4N9TA 2HVSA 3KXYT 1CHPD 2Z9HA 5C3EG 5L1LA 3L4JA 4IRCA 2EJMA 1PV4A 3GTPA 2JA7H 5C0XJ 2ZXOA 3GQBA 2HHFA 3CP0A 3SK8A 4F8MA 1SNMA 1HUNA 1HA5A 1NR2A 1TS5A 2R92G 4A93H 4DQNA 3LWEA 4YY3L 3DEOA 3DTFA 5IYBH 3UZBA 4ZCKA 1Q8KA 3NSWA 4DAAA 1VQFA 1KIXA 2ZJRA 3C2PA 1Q7YC 4ME5A 1SE4A 2PCFB 2I0QA 2W9AA 3L3OC 2UUCQ 2ZGIA 2JEIA 3UDIA 1WD0A 1BBWA 3S2DB 2R92B 3EFXD 3A0JA 4DV5Q 4ED7A 5HV6A 1JIHA 3ND9A 4R8UB 4L5QA 1IBLH 1BCPF 3GTOB 5BR8H 2YTYA 5I5UA 1EY8A 1JQYD 3VA5A 4AYBB 1Q8IA 3BZCA 2GVAA 3TW7A 4IJHA 2ZDGA 2ASBA 2E2IB 1HNZH 1KXLA 3FEWX 1UWVA 1TS4A 2UU9H 5DMXA 1Q3LA 2N88A 3HS0C 5TSSA 4C3JB 3VOTA 3G8CA 1TWGA 4C3HB 5LYJF 2DN8A 1SMYD 4MV1A 1SLJA 4A3FG 4DUZH 1D5MC 4IHJF 2KUMA 1X65A 4Q0FA 4DU9A 1LTSD 4NMZA 4LF9Q 3P7JA 3RB6A 3GTLA 1EU3A 3CQZA 4DV6Q 2BDOA 3DM1A 2FLPA 1RTOA 4DKAC 4TRDA 4E6IA 4POFA 3R2IA 5E1FA 1CQFA 1N33H 1V4YA 4K5XA 3AMUA 1RIPA 1ASYA 4M1UB 3E5NA 4FP5D 3HOYH 1NJIC 1OXXK 3ONAB 3JAME 1S5FD 1Y1WH 4GNXA 1YNND 2ABJA 4IZOA 3J7ZC 1EYAA 2VUMA 5ELBA 4JI2H 3FVQA 4DUYQ 2C28A 4F7XA 1SNPA 2F0TA 1GUSA 2EDGA 1PH4A 3G6EA 4OX9H 3M4QA 5KFHA 4QY7A 2YL2A 4DV3Q 3S1MH 4B9XA 5H80A 1B53A 4O1NA 2R7FA 1BGWA 3TSSA 2EQSA 3QO2A 5DQGA 3ULJA 2FPIB 3NQIA 4X66L 1RTNA 3S9WA 2RF4A 3TZUA 4DAMA 2LKVA 4XYOA 3RZOH 1A63A 4NXNL 4BY1G 1YNJD 3SEBA 4LF6Q 4DLKA 3M3YB 4A3BG 3GIJA 3N6XA 3V4SA 2I87A 4XYQA 3M4OB 4IURA 3K3VA 4A75A 1V1OA 2Q8IB 3WOEA 3N43B 5LA6F 1HHVA 3L2PA 4O7RA 5L37A 4Q45A 1J8IA 1EFWA 5DLGA 4OEMB 2R85A 4J9SA 2A19A 5KG0A 2W7PA 1KLGD 2I46A 5M3MG 2HVQA 1B8AA 2ZTEA 2EYMA 2Y0SB 5A2QW 1H95A 2H4OA 2CQOA 2ZM6Q 1DIKA 2QEJC 1JLLB 3QOJA 1QZGA 4IUVA 1MSHA 3PO2H 3TIGA 1VQOA 5KFGA 4FU0A 1AUXA 3HO8A 4YHHQ 1LTRD 4OWWB 2R86A 3T51B 2FP4B 1K8GA 3J80W 1GM5A 4RGNA 3F2DA 1E1TA 5NUCA 4LF8L 3G6XA 1EFID 3BJYA 1FVIA 1CA5A 1J5EL 3D6WA 4JYAL 4RUAA 5EBCA 3FDSA 3ZJYC 4O3QA 3HP3A 2B63G 4J9NA 5DG8A 4HCEA 5KG1A 1C8CA 3NGDA 2IL8A 3A7AB 2A68C 2EJFC 4HIMA 1I1KA 5L1IA 2HHHQ 5CB4F 2ZXRA 5C4HA 1X3QA 5KFRA 2FMCA 3S17H 2NU6B 4FGRA 5IGDA 1LT5D 4JI0L 2F0OA 2K05A 5M5YB 2HHHH 2JJQA 2CHBD 3KLWA 4IPDA 2CQYA 5JEAG 4CDFC 3J7YW 3C0FB 1B3QA 1HZBA 5FO7B 5CORA 3FKIA 4GKKH 2PZTA 1VAJA 1KNEA 1VQEA 2UXCL 4FFOA 2L55A 4EEYA 3EVQA 4A3EG 2A1HA 3KREA 1XNQL 4JOIA 5KIXA 1EOVA 3GJXB 2F3IA 4QJFA 2FINB 3E9HA 4GN5A 2ALYB 4DR6H 5EOYA 2V9WA 2V4QA 1R9TH 4LUVA 4WJ4A 4JI4H 4DAPA 4Y8VB 3LGJA 1IW7C 1EZ1A 3M85A 2DABA 1SNCA 4LF5H 4Q8FA 5IGGA 4B08A 2DLNA 3UZOA 1EEID 1DOLA 5JVDF 2F0GA 3LWBA 4EGVA 3F2CA 2DIKA 4O2BF 1GUTA 2PZWA 1LACA 2KENA 2VQDA 1N56A 2W9BB 3TP7A 1KJQA 2PMZE 1STBA 2HQEA 4CE5A 3I4NG 1DV1A 4QWBA 1GOZA 2LY7A 3EROA 1HNXL 5C4XG 3MVVA 2WFWA 4NXML 2BE5D 1ZQ7A 4DR1Q 3DM3A 2DPIA 4A3MB 3BA8A 4ULLA 3I90A 3RNUA 3GTQH 1DZ1A 2YRXA 4DA2A 4LMYA 1GSHA 5I2YA 1CA6A 1RODA 1V8QA 2NN6H 4C2MH 1D5ZC 1A62A 4WORA 5LP6F 3C1FA 4ZHQF 1A6XA 3VPCA 4S3SA 4LFBL 1VQBA 3O13A 3D0FA 3CCEA 3RTXA 5C4JH 5GAGC 4A3BH 2SDFA 4NB3A 1II3A 4M7EA 4CBVA 4CDDC 3RGXA 5KYIA 4ED0A 4HJAA 3V6HA 1ET9A 1HTPA 1ML0D 1LABA 3I55A 4NKLA 1Y8OB 3K58A 1Y1WB 3RGZA 3RJ0A 3NTIA 1M6VA 4IIJF 3BYTB 2JA9A 3NK9A 3HOYB 1TWCA 3HXLA 3PW7A 3CW2C 5E4XA 2Y0SE 4H0LC 3KLRA 1HNWQ 4HN2A 2BOSA 2Z02A 4YY3Q 3FKIH 2VUMG 4XYLB 3NBYB 1RL2A 4DUZQ 1V51A 2UUCH 4X65H 3EA6A 2VQFH 1X3PA 3E0JA 4B3TH 3K7UC 2VW9A 4P74A 3WWIA 1HRJA 2Y0SG 1Y1VH 1SROA 3CC2A 3JAMW 4B3TQ 3VA7A 5JVG3 1I94H 3KF8A 5GAHC 5KG5A 2OXPA 2R92H 1HNWH 4IJLA 1I3QH 4YP3A 2MFIA 3H6MA 5M3FH 2PMZA 4IRDA 2EIFA 2JA6H 1Z7TA 4Q5VA 4FXDA 4CMDA 2VY3A 4EQOA 4ILWA 4QIWE 1WTXA 3TP5A 1V9PA 2F0KA 2WAQB 1DM0B 4BY1H 5G3LD 2KSWA 5DQIA 2D0PA 5K3WA 4NXNQ 4KHPH 3MXGA 4ZI7F 1AEXA 5CYUA 5KNBA 1ZEQX 1UC8A 4DR4H 1BVSA 2CQAA 3KHGA 4G57A 4UHVA 3WDNA 3RMHA 5A35A 2O5JC 2P0AA 2LXKA 1SEBD 2NZHA 1C0AA 1VQ8A 2JQOA 4J0MA 1Y8PB 1B04A 2FKLA 2QILA 4DUYH 2B2TC 4X62H 5KS8A 1MGSA 5KFOA 1VMCA 1S3OA 4KHPQ 4NXNH 1GHJA 2F0IA 3T16A 1LTID 3Q2OA 3KYHC 3BABA 4L6TB 2FLNA 2KEEA 1EIYB 3U4VA 1LTTD 2N49A 4CDCC 3Q23A 3M4YA 2QKIC 4HEDA 4YJ2F 1SFOH 1EYDA 2RGRA 2JA8G 1CHQD 1VQJA 4LF6H 1K8MA 4APVA 4X66Q 3VYRA 1E0BA 5JQWA 2XCPA 2E2IH 5IP7H 1ENCA 1CKNA 3BVMA 4OWXB 2QF7A 4ECQA 2SOBA 2NYZD 4B3RQ 3QOLA 2BCOA 5KFBA 4YHHH 3CPWA 3GIMA 3GV8B 1WOCA 3PUVA 2KVMA 2J9GA 3T9CA 3N6RA 5FJ8H 4KK7A 4A3DH 5EJWA 4R7RA 1M0WA 4JV0A 3KJPA 2DNEA 2VQEQ 1W3SA 2TMPA 1TY0A 1I6HB 1AZQA 1V1PA 3KHHA 2N8NA 1I1MA 2MO1A 3PQIA 4LW1A 5J3BA 1I4XA 5M3MB 1PFMA 4RGTA 4O81A 2KCNA 2BH8A 2YZNA 1SYDA 1QVFA 2W70A 1F77A 4RWSC 1VQKA 2NVXB 4JV2A 1GUOA 3IRBA 5CV7A 4DL2A 2COGA 3VPBA 3QG1A 3TMEA 3GTMB 2CW7A 1PFBA 4AYBG 5DQHA 2KOLA 4JI5H 1EY5A 3J7AV 4UUGA 1QB5D 3MFIA 2EY1A 3UQ8A 2PVPA 5FD5A 2GVBA 3MR3A 4LF8Q 4R9WA 1PRTF 4NP5A 2HDLA 3G71A 2J4XA 1ESRA 5K2MA 1TQOA 1S40A 2WE6A 2PN1A 2RSNA 1E4EB 1W6JA 2K5HA 3HOVB 4IQZA 4V0BA 4A3IH 1X3FA 2DNCA 3I4LA 2R7LA 2Q8TA 2VA3A 2AKWB 2D2CC 4DR3Q 1NR4A 4JBMA 1KLUD 5FLXc 5C5JA 3U9OA 1I4GA 4TSSA 1X56A 2W6NA 5IGBA 5DGBA 5LMNQ 4I7AA 1H9JA 2UU9L 3J81W 4LF5L 2OH2A 2NZOA 3RAQA 4DV0Q 2MGSA 1EUDB 3GO5A 3GTJA 1HR0H 4DUZL 1EY0A 2UXCQ 5AJ3L 5GAEC 5BWUA 5K36H 3HRZC 1L2FA 4BBRH 5IYCG 3A7LA 1EYCA 2CWAA 2KCTA 1PTOH 3T9EA 2ZJQA 1FJGH 4ZAIA 5D8DA 1A3UA 2MUYA 3MR5A 2L5TA 3IAYA 3T56B 3A8KE 3KDFB 5DLFA 2W8LA 3BQ0A 4QL5A 4GOPA 4RZRA 4OL7A 2D62A 1PFNA 2CW8A 3FPUB 5E25A 5FO8B 2XIGA 3D3RA 4LFBH 1CUKA 5HBRB 2WYOA 4YR3A 4DV4H 2FPPB 4CMFA 3AFPA 1IBML 1RK6A 5F9NA 1PHJA 2J0TD 3U4ZA 3CVZA 1UNSA 2X6LA 1SE3A 2IW3A 3J81E 1KJJA 3JSLA 3OPOA 1I4PA 1UE6A 1B70B 1HTLD 3KUPA 3MEFA 4KKUA 3GIIA 1Y1WA 2XCAA 3GIQA 2K33A 4KKSA 2O03A 4Y52H 4GLWA 1Q82C 1C30A 3VR2A 4R8IA 1JT8A 4X3TA 1SN8A 3GIPA 1PFSA 3Q24A 3ND8A 1GVPA 1JB7A 3UI2A 1BR9A 1XTCD 1XNRL 4MA0A 4O7VA 4JBWA 2NWGA 1BCPB 4IOAA 4RNMA 3GTKB 3HOVH 1G8ZD 4UP9A 3G6YA 5ELNA 3Q8QB 1TWHA 4Q44A 3OSNA 5I9OA 2HQLA 5D3IB 1T94A 2W6OA 2Q2IA 4O7NA 4RB2C 2FB9A 2F0QA 3FRPB 3R23A 4KJOA 1Q81C 3D6CA 5JVLA 2B2UC 3NUCA 5M5XH 2C9OA 4HJ5A 2CFMA 1BOSA 2DJGC 4NPSA 2HUGA 4B3MQ 4GLVB 2Z8LA 4C3HG 1YIJA 1BF4A 4ECYA 4DV3H 4DR7Q 1JOKA 3AQQA 4YAKB 1TWAB 4FF3A 3I2ZA 1K3BC 3V2TA 5ISRA 1G2TA 4LF8H 1YJNA 3S1QH 1KT8A 4YIJA 4A2BA 1N48A 4X64Q 2EOTA 3NBHA 4JK1C 4XT1B 5EZYF 1LYLA 5I5YA 4DXFA 4ECZA 4WJWA 4J9PA 2E2HA 4K5VA 4O2DA 1SYCA 2FLLA 3MJFA 1G6ZA 2UUBQ 2ZT9C 3T1HQ 4JV5Q 3STBC 2IX1A 4DAVA 4X62L 1Y69U 2UXBQ 3K0XA 3T9AA 2R7ZB 3GTPH 1PH3A 2IA6A 4HJ9A 5KFZA 1J9OA 2DY8A 1M4VA 1HR0Q 2DY7A 3SDZA 2UXCH 4LUZA 2MO0A 1LLRD 1IYJB 5KFYA 1AH9A 4RU9A 3AX6A 2R7NA 3SVMA 4KHZA 4CJ2C 2F4VQ 4A3GH 1JWSD 3GTGB 1BBXC 3BAAA 3F2UA 1IOWA 2R8IA 2ZM6H 1JB3A 1VQGA 3HZXA 1E4EA 4A93G 3PUWA 1GJXA 3QR8A 3C1EA 1YVCA
chains in the Genus database with same CATH topology
1PH5A 2I5HA 1PH4A 3G6EA 1SE8A 4DRFA 3M4QA 3T1YQ 4UCUA 4OX9H 4QY7A 4OWTB 4DV3Q 3S1MH 4H02A 1X55A 4RB1A 4LF7H 1CKNB 3S2DH 2R7FA 1BGWA 5IWAQ 4ALPA 3TY8A 2EQSA 4DR6Q 2ID0A 3ULJA 1ASZA 1P8LA 4X66L 1VQNA 3A5ZB 1CKMA 2RF4A 1YHQA 4DAMA 4EX5A 1A63A 3RZOH 4NXNL 4BY1G 4DR7H 3RR5A 4LF6Q 4NXMH 1VCIA 2HGSA 4JI6L 4R1JA 5DISC 1KAWA 2K5NA 4A3BG 4DR5L 4B3RL 2ES2A 1JJCB 2K50A 1M0TA 3N6XA 1E24A 4JI5Q 5C4XH 4RB3C 1UE7A 3FHWA 4LUOA 4TQUS 1NBWA 4EFBA 2AMCB 3AEVA 1XMOQ 3K3VA 4A75A 2QEXA 4HIKA 1TA8A 2IT1A 1GKHA 4BBRG 1XNRH 3N43B 1NMFA 1WCMG 3EIVA 3L2PA 3M4OH 1TWHH 3W5OA 2VQEL 1IBKL 3DLLA 4IPCA 4DV1L 1EFWA 3RZDH 4UCTA 1UE1A 2A19A 4GKKQ 4LFAQ 4YY3H 5M3MG 1U5KA 2HVQA 3LMLA 1KL9A 2W57A 1B8AA 4B3MH 3PGZA 1CSPA 2ZTEA 1L0WA 3CC7A 4DV0L 1VQ7A 1H95A 5A2QW 2KHIA 2CQOA 2ZM6Q 3RTXA 4JI8H 1EWIA 3TQYA 2XTIA 4C3JH 3J7AK 1QZGA 1N32H 5AJ3Q 4JI2Q 2HT1A 1XMOH 5LMUQ 3BU2A 1XPRA 1C9OA 3PO2H 3T1HH 3T1YH 4JV5H 1VQOA 4YWMA 4OX9Q 1XDNA 2WB1E 3F1ZA 5D1PA 3FP9A 3AYHB 4CC5A 1IBLL 4YHHQ 2DGYA 2UUCL 4OWWB 2AWNA 4B3TL 5LMUH 3L7ZC 4A3LH 3PUXA 4JI3L 1K8GA 3J80W 1GM5A 2HIVA 3NBHB 4DPGA 1Y1WG 1YJ9A 1LM0A 3CQZH 2DUDA 3F2DA 1E1TA 3HOUG 1FGUA 3S2HH 2CWPA 4LF8L 1MZBA 1FVIA 3CCJA 1J5EL 4JYAL 1TAEA 2UUBH 3E9IA 3TS0A 3ZJYC 3ULPA 5IP7G 1I94L 2B63G 3H20A 4DV2H 2PI2A 1JJ2A 1I50H 4JI1L 5HY6A 2HHHH 3S16H 4HIMA 2JA8H 2HHHQ 2VL6A 3CCUA 4R4OA 1WCMH 3HOZH 4DR2L 3DF7A 1E4FT 4UFZA 5H1SE 1XNRQ 1N9WA 3S17H 3B6YA 4YCVA 5D1OB 5LMNL 4AQYQ 4JI0L 4X64H 3NBZB 1FKAH 2JJQA 3KLWA 4IPDA 4JCVE 4OONA 5JEAG 3UE0A 2FE3A 3C0FB 1HZBA 1S03G 5FPOA 4GKKH 2RHQB 3TREA 4MV9A 1VQEA 1N33L 3FKIG 2UXCL 3J81c 1IZ6A 4DV6L 4A3EG 2Z6KA 4L5RC 4JOIA 1XNQL 2VOBA 3CF5A 1EOVA 3GJXB 1KHIA 2F3IA 3NENA 4QJFA 3E9HA 4GN5A 2ALYB 5FLMG 3U58A 4LF7Q 4MV7A 5EOYA 3JAMc 3H15A 1N8RC 2L15A 1R9TH 4LUVA 4PG3A 4HIOA 3M3YH 4QQBX 4WJ4A 2YCHA 2IHFA 2OQ0A 3LGJA 4DR4L 1NMGA 4MTEA 4JI4H 3M85A 4LF5H 4DV4L 2F4VL 2VUGA 4A3JG 4A3MH 3QWUA 3RLNA 1IBMH 1VQ4A 1E7ZA 1K8AC 3GTKH 3F2CA 2CCZA 3OTOQ 1SRUA 4IPHA 3TEHB 2JA6G 3S15H 4K0KQ 1WJJA 2OTJA 3CPFA 4IOCA 4MNOA 4OO1I 2KENA 4DUYL 4LF4H 2K52A 2PMZE 1PYSB 4RG1A 3I4NG 4X66H 2LXJA 1GYFA 1HNXL 5C4XG 2BA1A 1Z2NX 5C3EH 2H5XA 5GADC 4UCRA 2WFWA 1MJCA 4NXML 2PI2E 2K4KA 3DM3A 4DR1Q 4DR3L 3BA8A 3RNUA 3GTQH 1YJWA 1PH1A 4LMYA 4APMA 2JEAI 2GN5A 1KRTA 1Z2PX 2IY5B 1OTCA 1VQPA 2Z6KC 1IXRA 1VQ6A 2WDTA 4C2MH 1XJVA 3A5UA 4LF6L 3L0OA 2VNUD 4JI7L 2YU9H 1A62A 3RLFA 2UXBL 3RF2A 4AIMA 2E8GA 4YCUA 1AN7A 1K9MC 1VQBA 4LFBL 1Q12A 3D0FA 4P71A 3CCEA 1JMCA 5C4JH 5GAGC 2E5LQ 4A3BH 4NB3A 4LWCA 4Y7NH 1WFQA 2A1AA 1EYGA 3HOWH 4IFDJ 1Z2OX 4M7EA 4DV1H 4A3CG 4OO1G 4UP7A 3RGXA 4LNQA 4HJAA 3HKZE 3CCRA 3I55A 4GNXB 3RGZA 3F2BA 3TRZA 3RJ0A 1E3PA 2R93G 1X6OA 3RN2A 4DV7L 3ER0A 2JA9A 2JE6I 1XMQQ 1N36Q 4EFEA 4A3GG 2UXDL 3HXLA 1QUQA 4JI8L 3M4PA 2RGVA 3CW2C 1HR0W 4LH6A 3ULLA 4LSAA 1QVCA 4RZQA 1OXVA 1CKOA 1NY4A 2KCMA 2Y0SE 1HNWQ 2F52A 5FJ8G 1XMQH 3STBD 2NVQH 3T1HL 4JV5L 1N36H 3T1YL 4YY3Q 4HJ8A 3FKIH 1OXUA 3M9BA 3W1BA 2VUMG 4BBSH 3NBYB 1RL2A 1SMXA 4DUZQ 4UY8C 2UUCH 4X65H 2VQFH 4B3TH 5LMUL 3KF8B 3K7UC 2VW9A 4JI3H 4A76A 2Q2TA 1XK5A 1IBMQ 2JEBI 4P74A 3U50C 2JA5G 1N32Q 2V1CC 3PV0A 2Y0SG 2KHJA 2N78A 1K3RA 1Y1VH 3KF6B 4JBJA 4EQ5A 3EYYA 1SROA 3OW2A 3HKZG 3CC2A 3J7A5 1FL0A 4B3TQ 2Z0SA 3JAMW 2Q2UA 3TS2A 4JYAH 3TY9A 1SYXB 4LFCQ 1QZHA 2ZTDA 1Z9FA 1PH7A 4POGA 1I94H 4DV2L 1MIUA 4JI5L 1Q86C 5GAHC 4GN3B 3CMAA 3KFUA 4BA1I 4BA2I 4JI1H 4L5TA 4A4IA 2R92H 4IJLA 1I3QH 4JYAQ 3ERSX 3RIZA 1KC8C 1HNWH 4LFCH 2MFIA 5M3FH 1Y14B 3PN1A 2EIFA 2JA6H 2OCEA 1UEBA 3H3VI 2QA4A 3HOWG 4X64L 2VY3A 5LMNH 1S68A 4JI0H 4DR6H 5IWAL 4QIWE 2HHHL 4DV1Q 1L1OC 1V9PA 3HOXH 1X54A 1Z47A 4LFAL 3I56A 4BY1H 5BR8L 3VDYA 2KSWA 2D0PA 1VQ5A 2UU9Q 4LF5Q 4NXNQ 4KHPH 3E0EA 3I4MG 4KI0A 4GKJL 4B3SH 1XNQH 4FM9A 1PH2A 4JG2A 5IE8A 4A3KG 4X62Q 4LF9L 1YEZA 1OXSC 1PH6A 4LF4L 2FXQA 4IAJA 1HNZL 4JI2L 2MCTA 1GD7A 1VQDA 1Q1EA 1WI5A 3UDXA 2R7ZG 1BVSA 3F8NA 4DR4H 1YI2A 4YWLA 5LMNW 4OX9L 3GTMH 2K5VA 3KOJA 4RMFA 3HOVG 1HR0L 4UCVA 1IBLQ 2LXKA 2B29A 2NZHA 2B63H 1VQ8A 2JQOA 3H0GG 1C0AA 1B04A 4J0MA 4DV5L 1OXTA 3K8AA 4DUYH 3PF5A 2RCNA 2OWOA 4X62H 1NE3A 3CCQA 1DGSA 4JI4Q 1S3OA 4BY7H 4DR7L 4KHPQ 4DK3C 1LUZA 3CD6A 1A8VA 1HNXH 1KQSA 2UUAH 2R6GA 2D0OA 3I7FA 4O0AA 4IO9A 5JJIA 4DR5H 5ELOA 3KYHC 4ME3A 4R4TA 3UE1A 5M5YH 3BABA 3PSIA 4JI1Q 3PIPA 3OTOH 1EIYB 1GO3E 3U4VA 2N49A 5DLQE 3MWMA 3JC66 2ATWA 2R7ZH 4A3IG 1SFOH 4R4CA 2RGRA 2JA8G 4OXPA 1VQJA 4DR2Q 2NN6G 4NXMQ 4LF6H 1L1OB 4P72A 5JEAJ 4JI7H 4APVA 4X66Q 3CCVA 2IX0A 3CAMA 3BZKA 3I4OA 4A3CH 2E2IH 1EIFA 1K83H 5M3MH 4GOPB 1HZAA 5IP7H 2VQEH 1IBKH 1CKNA 4OWXB 1N34L 3F8TA 2AHOB 2EXDA 4JI3Q 4B3RQ 4LH7A 4C3HH 4JI6Q 3OYYA 1HJPA 5GQOA 3GTLH 4DR5Q 5C44H 1O7IA 2NVYH 4DNIA 3CPWA 4UPAA 1XPUA 4RAZA 4YHHH 1WOCA 2UUAQ 1D7QA 1BKBA 1TWGH 3PUVA 1FJGQ 2E5LL 1E22A 4AYBE 2MNAA 3KJOA 3L4KA 4DV7H 3EBEA 5FJ8H 3PF4A 4A3DH 4R7RA 1M0WA 3KJPA 3CCLA 2VQEQ 1W3SA 1TWFH 1IBKQ 1Q1BA 5IP9H 5FD6A 5M5WH 1XMQL 1N36L 3GDEA 2N8NA 3UDFA 1E1OA 1W2BA 3HOUH 1E4GT 4JI6H 4B3RH 2MO1A 4DAYB 3H3VH 4BXXH 1UE5A 5LL6b 2WAQE 1L2ZA 4LW1A 5J3BA 4XIGS 5FLMH 4EEQA 1Y1VG 2BH8A 5IYCH 1YBYA 4X65L 2VQFL 4HIDA 4GN4B 1LTLA 2I5MX 1QVFA 4BY7G 2ZJTA 3J80c 1YHBA 1VQKA 2BH2A 3A74A 3Q8DA 3S14H 3IRBA 3PO2G 1HNXQ 5HGQA 2E2JH 3GD7A 1VQAA 3BJUA 4A3KH 2NVXH 1SR3A 2CW7A 1ZHQA 1I6UA 1P16A 1YNXA 4LF7L 4LSXA 4AYBG 1CSQA 2YV5A 1VQCA 2YYZA 1V1QA 2QGQA 4AH6A 4HJ7A 4JI5H 1HZ9A 1M1KC 3NC0B 3IG0A 4IPGA 1PYBA 1KD1C 4JOIC 4DR1H 4B3ML 4DV4Q 3GTJH 4DR3H 4C3IH 4LFCL 3AFQA 3CCSA 2A8VA 3CXCA 5IYBG 3UQ8A 1I6HH 1MKHA 5FD5A 2GVBA 4LFBQ 4LF8Q 2VQFQ 4CC6A 3G71A 1WH2A 1KRSA 3N40P 1XMOL 2ZJPA 2WE6A 3FMAA 1S40A 3JAMi 5GROA 5IWAH 1I94Q 2I5LX 1IL2A 3PO3H 3PUZA 2K5HA 4LFAH 3HOXG 4TVAB 4DV3L 4MTDA 1XPOA 4A3IH 4DV6H 3KALA 1X3FA 3S1NH 4JC0A 5IYDG 1M90C 4DR6L 1TWCH 3RLOA 4A3JH 1EQQA 1I5FA 2AKWB 4PZ6A 4DR3Q 3J81j 4JBMA 4JI8Q 5FLXc 3M4IA 4K0KH 4J15A 2N3SA 1TXYA 1X56A 1PVOA 1EQRA 5IT9c 4E6NA 5LMNQ 4AQYL 4JI0Q 2UU9L 3J81W 5M3FG 4LF5L 2NZOA 3SGIA 2UUBL 2F4VH 4DV0Q 4JI7Q 3PCOB 5K36G 5EAYA 3GO5A 4PDBA 1VQLA 2PQAB 1JE5A 1HR0H 1BBUA 4DUZL 1N33Q 1J6QA 5AJ3L 5GAEC 2UXCQ 5E7NA 1HNZQ 2R93H 4DV5H 2NN6I 4JBKA 4P75A 1L2FA 2PNHA 4A3DG 4DR2H 1JJGA 1T9HA 4BBRH 5IYCG 4A3FH 1QVGA 2CWAA 2KCTA 2JA5H 4B3SL 4I7HA 4GNXC 2ZJQA 3M7NA 2PQAA 1FJGH 3N42B 4ETSA 2VS1A 5IYDH 4RAYA 1B7YB 4DV7Q 3PIOA 1Q46A 3KDFB 1L1OA 4GKKL 3OTOL 3N44B 4R4IA 1NTGA 1X3GA 4QL5A 4GOPA 2LSSA 3UDGA 1YZ6A 2D62A 2R7DA 2CW8A 2XIGA 2CKZB 4FDBA 2VZAA 1XTDA 1PH8A 2ZM6L 1VS0A 5JJLA 4PZ7A 4LFBH 3K7AH 3S1RH 5IT9W 3J81i 4A3EH 1CUKA 2YTVA 4IFDI 5FLXW 2K14A 4KLKA 5JJKA 2WYOA 1A0IA 4DV4H 1N34H 1VQ9A 3AFPA 1IBML 5FPRA 5BR8Q 1PHJA 3U4ZA 3CVZA 4YHHL 1K73C 2WB1G 3PUYA 3CCMA 3JSLA 3D31A 4UP8A 2K75A 1N34Q 2E5LH 1UE6A 1B70B 2UXDH 2VPSA 1G51A 1ZHSA 3MEFA 2JK8A 2RHSB 3G48A 3HOZG 1HH2P 4WJ3M 4X6AH 1VQIA 3TY5A 1BJTA 1C7YA 4Q0YA 2Q2HA 1J5EQ 1XNQQ 3GTOH 3EN2A 4UCSA 1D8LA 3G4SA 5C0XG 1O75A 4Y52H 2O03A 4P73A 1Q82C 5C0XI 3GTGH 3N41B 1JT8A 2HVSA 3KXYT 1SN8A 1PFSA 3NEMA 4GOPC 2JA7G 1GVPA 1JB7A 4DR4Q 5C3EG 3RN5A 1G6PA 3L4JA 2B3GA 4MTNA 4L5SA 4NXNH 1PV4A 2UXDQ 2JA7H 4YCWA 5C0XJ 2UXBH 1XNRL 4JBWA 3I4MH 4K0KL 3ICEA 3CP0A 4IOAA 4UCOA 3KAKA 2R92G 2WAQG 3HOVH 4A93H 4GKJQ 4UP9A 3S24A 4YY3L 4QGUA 5ELNA 1QUQB 2HQLA 1U0LA 4A3MG 5IP9G 2HVRA 5IYBH 1WYDA 4RB0A 1Q8KA 3HKSA 2Q2IA 3J80i 3K80C 1VQFA 4RB2C 4DV0H 1YHAA 4MZ9A 2ZJRA 4DR1L 1KIXA 1Q7YC 1Q81C 3H0GH 2C35B 2XGTA 1K0RA 2I0QA 1N32L 5M5XH 4HJ5A 4GS3A 2CFMA 3UDIA 2UUCQ 3VNNA 1BBWA 4NPSA 3A0JA 4DV5Q 4GLXA 2HIXA 1X9NA 3GB8B 4B3MQ 1PA6A 3CC4A 4DV2Q 4GLVB 4L5QA 3JSNA 1YIJA 2BA0A 2YTYA 5BR8H 1IBLH 3PO3G 4DV3H 3KF6A 4PMWA 4DR7Q 3AQQA 1VQMA 4KHPL 1AE2A 4GKJH 3I4NH 3I2ZA 4GLAC 1X3EA 1V43A 2MQHA 3BZCA 2YTXA 2GVAA 4LF8H 1YJNA 3BA9A 2WP8J 4IJHA 3S1QH 2ASBA 2KBNA 4BXXG 4A2BA 1J5EH 1KXLA 1HNZH 4X64Q 4AQYH 1UWVA 2IHEA 2UU9H 1LYLA 3WWVA 3NELA 4R4QA 3W1GA 1SLJA 1G291 4A3FG 5D1OA 4DUZH 1EUJA 4O2DA 1X65A 1HNWL 2OTLA 2UUBQ 3T1HQ 4JV5Q 3STBC 2IX1A 4X62L 4LF9Q 2UXBQ 3K0XA 3KAJA 3KDFA 4LF4Q 1S72A 3CMEA 4DV6Q 4IFDG 2UUAL 1SEIA 3GTPH 2VUMH 4BBSG 1PH3A 3K81C 4PZ8A 4DK6C 4HJ9A 4DKAC 4POFA 1FJGL 4A3LG 5IY0A 4A2AA 3HFZB 1VQHA 1HR0Q 4XTCS 1TWAH 1N33H 2UXCH 4LUZA 2MO0A 1YITA 1IYJB 1AH9A 4BWSC 2ZTCA 4B3SQ 1RIPA 4KHZA 1ASYA 2OQKA 2F4VQ 2AWOA 1NJIC 3HOYH 1OXXK 4A3GH 1HZCA 3BAAA 2NVTH 4YWKA 1Y1WH 4LF9H 5C44G 1AE3A 4GNXA 1PH9A 3HOYG 2ZM6H 3J7ZC 4JI4L 2E2HH 1VQGA 4A93G 4JI2H 3MXNB 3PUWA 4DUYQ 4X65Q 1MJEA 1YVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH5 A;  2I5H A;  1PH4 A;  3G6E A;  1SE8 A;  4DRF A;  3M4Q A;  3T1Y Q;  4UCU A;  4QY7 A;  4OWT B;  4DV3 Q;  3S1M H;  4H02 A;  1X55 A;  1CKN B;  3S2D H;  2R7F A;  5IWA Q;  4ALP A;  3TY8 A;  2EQS A;  4DR6 Q;  2ID0 A;  3ULJ A;  1ASZ A;  1P8L A;  4X66 L;  1VQN A;  3A5Z B;  1CKM A;  2RF4 A;  1YHQ A;  4DAM A;  4EX5 A;  1A63 A;  3RZO H;  4NXN L;  4BY1 G;  3RR5 A;  4LF6 Q;  1VCI A;  4JI6 L;  4R1J A;  5DIS C;  1KAW A;  2K5N A;  4A3B G;  4DR5 L;  4B3R L;  2ES2 A;  1JJC B;  2K50 A;  1E24 A;  4JI5 Q;  5C4X H;  1UE7 A;  3FHW A;  4LUO A;  4TQU S;  1NBW A;  4EFB A;  2AMC B;  3AEV A;  1XMO Q;  4A75 A;  2QEX A;  4HIK A;  1TA8 A;  2IT1 A;  1GKH A;  4BBR G;  1NMF A;  1WCM G;  3EIV A;  3L2P A;  3M4O H;  1TWH H;  3W5O A;  2VQE L;  1IBK L;  3DLL A;  4IPC A;  4DV1 L;  1EFW A;  3RZD H;  4UCT A;  1UE1 A;  2A19 A;  4GKK Q;  4LFA Q;  5M3M G;  1U5K A;  2HVQ A;  1KL9 A;  1B8A A;  3PGZ A;  1CSP A;  2ZTE A;  1L0W A;  3CC7 A;  4DV0 L;  1VQ7 A;  1H95 A;  2KHI A;  2CQO A;  2ZM6 Q;  3RTX A;  1EWI A;  3TQY A;  2XTI A;  4C3J H;  1QZG A;  5AJ3 Q;  4JI2 Q;  2HT1 A;  5LMU Q;  3BU2 A;  1XPR A;  1C9O A;  3PO2 H;  1VQO A;  4YWM A;  4OX9 Q;  1XDN A;  2WB1 E;  3F1Z A;  5D1P A;  3FP9 A;  3AYH B;  4CC5 A;  1IBL L;  4YHH Q;  2DGY A;  2UUC L;  4OWW B;  2AWN A;  4B3T L;  3L7Z C;  4A3L H;  3PUX A;  4JI3 L;  1K8G A;  1GM5 A;  2HIV A;  3NBH B;  4DPG A;  1Y1W G;  1YJ9 A;  1LM0 A;  3CQZ H;  2DUD A;  3F2D A;  1E1T A;  3HOU G;  1FGU A;  3S2H H;  2CWP A;  4LF8 L;  1FVI A;  3CCJ A;  1J5E L;  4JYA L;  1TAE A;  3E9I A;  3TS0 A;  3ZJY C;  3ULP A;  5IP7 G;  1I94 L;  2B63 G;  2PI2 A;  1JJ2 A;  1I50 H;  4JI1 L;  5HY6 A;  3S16 H;  4HIM A;  2JA8 H;  2HHH Q;  2VL6 A;  3CCU A;  4R4O A;  1WCM H;  3HOZ H;  4DR2 L;  4UFZ A;  5H1S E;  1XNR Q;  1N9W A;  3S17 H;  3B6Y A;  4YCV A;  5D1O B;  5LMN L;  4AQY Q;  4JI0 L;  3NBZ B;  2JJQ A;  3KLW A;  4IPD A;  4JCV E;  4OON A;  5JEA G;  3UE0 A;  1HZB A;  5FPO A;  2RHQ B;  3TRE A;  1VQE A;  1N33 L;  3FKI G;  2UXC L;  3J81 c;  1IZ6 A;  4DV6 L;  4A3E G;  2Z6K A;  4L5R C;  4JOI A;  1XNQ L;  3CF5 A;  1EOV A;  3GJX B;  1KHI A;  2F3I A;  3NEN A;  4QJF A;  3E9H A;  4GN5 A;  2ALY B;  5FLM G;  3U58 A;  4LF7 Q;  3JAM c;  3H15 A;  1N8R C;  2L15 A;  1R9T H;  4LUV A;  4PG3 A;  4HIO A;  3M3Y H;  4QQB X;  4WJ4 A;  2IHF A;  2OQ0 A;  3LGJ A;  4DR4 L;  1NMG A;  3M85 A;  4DV4 L;  2F4V L;  2VUG A;  4A3J G;  4A3M H;  3QWU A;  3RLN A;  1VQ4 A;  1E7Z A;  1K8A C;  3GTK H;  3F2C A;  2CCZ A;  3OTO Q;  1SRU A;  4IPH A;  3TEH B;  2JA6 G;  3S15 H;  4K0K Q;  1WJJ A;  2OTJ A;  3CPF A;  4IOC A;  4MNO A;  4OO1 I;  2KEN A;  4DUY L;  2K52 A;  2PMZ E;  1PYS B;  4RG1 A;  3I4N G;  2LXJ A;  1HNX L;  5C4X G;  2BA1 A;  5C3E H;  2H5X A;  5GAD C;  4UCR A;  2WFW A;  1MJC A;  4NXM L;  2PI2 E;  2K4K A;  3DM3 A;  4DR1 Q;  4DR3 L;  3BA8 A;  3RNU A;  3GTQ H;  1YJW A;  1PH1 A;  2JEA I;  2GN5 A;  1KRT A;  2IY5 B;  1OTC A;  1VQP A;  2Z6K C;  1IXR A;  1VQ6 A;  4C2M H;  1XJV A;  3A5U A;  4LF6 L;  3L0O A;  2VNU D;  4JI7 L;  2YU9 H;  1A62 A;  3RLF A;  2UXB L;  4AIM A;  2E8G A;  4YCU A;  1K9M C;  1VQB A;  4LFB L;  1Q12 A;  3D0F A;  4P71 A;  3CCE A;  1JMC A;  5C4J H;  5GAG C;  2E5L Q;  4A3B H;  4NB3 A;  4LWC A;  4Y7N H;  1WFQ A;  2A1A A;  1EYG A;  3HOW H;  4IFD J;  4A3C G;  4OO1 G;  4UP7 A;  4LNQ A;  4HJA A;  3HKZ E;  3CCR A;  3I55 A;  4GNX B;  3F2B A;  3TRZ A;  1E3P A;  2R93 G;  1X6O A;  3RN2 A;  4DV7 L;  3ER0 A;  2JA9 A;  2JE6 I;  1XMQ Q;  1N36 Q;  4EFE A;  4A3G G;  2UXD L;  1QUQ A;  4JI8 L;  3M4P A;  3CW2 C;  1HR0 W;  4LH6 A;  3ULL A;  1QVC A;  1OXV A;  1CKO A;  1NY4 A;  2KCM A;  2Y0S E;  1HNW Q;  2F52 A;  5FJ8 G;  3STB D;  2NVQ H;  3T1H L;  4JV5 L;  3T1Y L;  4YY3 Q;  4HJ8 A;  3FKI H;  1OXU A;  3M9B A;  3W1B A;  2VUM G;  4BBS H;  3NBY B;  1RL2 A;  1SMX A;  4DUZ Q;  4UY8 C;  5LMU L;  3KF8 B;  3K7U C;  2VW9 A;  4A76 A;  2Q2T A;  1XK5 A;  1IBM Q;  2JEB I;  4P74 A;  3U50 C;  2JA5 G;  1N32 Q;  2V1C C;  3PV0 A;  2Y0S G;  2KHJ A;  2N78 A;  1K3R A;  1Y1V H;  3KF6 B;  4JBJ A;  4EQ5 A;  1SRO A;  3OW2 A;  3HKZ G;  3CC2 A;  3J7A 5;  1FL0 A;  4B3T Q;  2Z0S A;  2Q2U A;  3TS2 A;  3TY9 A;  4LFC Q;  1QZH A;  2ZTD A;  1Z9F A;  1PH7 A;  4POG A;  4DV2 L;  1MIU A;  4JI5 L;  1Q86 C;  5GAH C;  4GN3 B;  3CMA A;  3KFU A;  4BA1 I;  4BA2 I;  4L5T A;  4A4I A;  2R92 H;  4IJL A;  1I3Q H;  4JYA Q;  3ERS X;  1KC8 C;  2MFI A;  5M3F H;  1Y14 B;  3PN1 A;  2EIF A;  2JA6 H;  2OCE A;  1UEB A;  3H3V I;  2QA4 A;  3HOW G;  4X64 L;  2VY3 A;  1S68 A;  5IWA L;  4QIW E;  2HHH L;  4DV1 Q;  1L1O C;  1V9P A;  3HOX H;  1X54 A;  1Z47 A;  4LFA L;  3I56 A;  4BY1 H;  5BR8 L;  3VDY A;  2D0P A;  1VQ5 A;  2UU9 Q;  4LF5 Q;  4NXN Q;  3E0E A;  3I4M G;  4KI0 A;  4GKJ L;  1PH2 A;  4JG2 A;  5IE8 A;  4A3K G;  4X62 Q;  4LF9 L;  1YEZ A;  1OXS C;  1PH6 A;  4LF4 L;  2FXQ A;  1HNZ L;  4JI2 L;  1GD7 A;  1VQD A;  1Q1E A;  1WI5 A;  3UDX A;  2R7Z G;  1BVS A;  1YI2 A;  4YWL A;  5LMN W;  4OX9 L;  3GTM H;  2K5V A;  3KOJ A;  4RMF A;  3HOV G;  1HR0 L;  4UCV A;  1IBL Q;  2LXK A;  2B29 A;  2NZH A;  2B63 H;  1VQ8 A;  2JQO A;  3H0G G;  1C0A A;  1B04 A;  4DV5 L;  1OXT A;  3K8A A;  3PF5 A;  2RCN A;  2OWO A;  1NE3 A;  3CCQ A;  1DGS A;  4JI4 Q;  1S3O A;  4BY7 H;  4DR7 L;  4KHP Q;  4DK3 C;  1LUZ A;  3CD6 A;  1A8V A;  1KQS A;  2R6G A;  2D0O A;  3I7F A;  4O0A A;  4IO9 A;  5JJI A;  5ELO A;  3KYH C;  4ME3 A;  4R4T A;  3UE1 A;  5M5Y H;  3BAB A;  3PSI A;  4JI1 Q;  3PIP A;  1EIY B;  1GO3 E;  3U4V A;  2N49 A;  5DLQ E;  3JC6 6;  2ATW A;  2R7Z H;  4A3I G;  1SFO H;  4R4C A;  2JA8 G;  4OXP A;  1VQJ A;  4DR2 Q;  2NN6 G;  4NXM Q;  1L1O B;  4P72 A;  5JEA J;  4APV A;  4X66 Q;  3CCV A;  2IX0 A;  3CAM A;  3BZK A;  3I4O A;  4A3C H;  2E2I H;  1EIF A;  1K83 H;  5M3M H;  4GOP B;  1HZA A;  5IP7 H;  1CKN A;  4OWX B;  1N34 L;  3F8T A;  2AHO B;  2EXD A;  4JI3 Q;  4B3R Q;  4LH7 A;  4C3H H;  4JI6 Q;  3OYY A;  1HJP A;  5GQO A;  3GTL H;  4DR5 Q;  5C44 H;  1O7I A;  2NVY H;  4DNI A;  3CPW A;  4UPA A;  1XPU A;  1WOC A;  2UUA Q;  1D7Q A;  1BKB A;  1TWG H;  3PUV A;  1FJG Q;  2E5L L;  1E22 A;  4AYB E;  2MNA A;  3KJO A;  3EBE A;  5FJ8 H;  3PF4 A;  4A3D H;  3KJP A;  3CCL A;  2VQE Q;  1W3S A;  1TWF H;  1IBK Q;  1Q1B A;  5IP9 H;  5M5W H;  1XMQ L;  1N36 L;  3GDE A;  2N8N A;  3UDF A;  1E1O A;  1W2B A;  3HOU H;  2MO1 A;  4DAY B;  3H3V H;  4BXX H;  1UE5 A;  2WAQ E;  4LW1 A;  5J3B A;  4XIG S;  5FLM H;  4EEQ A;  1Y1V G;  2BH8 A;  5IYC H;  1YBY A;  4X65 L;  2VQF L;  4HID A;  4GN4 B;  1LTL A;  2I5M X;  1QVF A;  4BY7 G;  3J80 c;  1YHB A;  1VQK A;  2BH2 A;  3A74 A;  3Q8D A;  3S14 H;  3IRB A;  3PO2 G;  1HNX Q;  5HGQ A;  2E2J H;  3GD7 A;  1VQA A;  3BJU A;  4A3K H;  2NVX H;  1SR3 A;  1P16 A;  1YNX A;  4LF7 L;  4AYB G;  1CSQ A;  2YV5 A;  1VQC A;  2YYZ A;  1V1Q A;  2QGQ A;  4AH6 A;  4HJ7 A;  1HZ9 A;  1M1K C;  3NC0 B;  4IPG A;  1PYB A;  1KD1 C;  4JOI C;  4B3M L;  4DV4 Q;  3GTJ H;  4C3I H;  4LFC L;  3AFQ A;  3CCS A;  2A8V A;  3CXC A;  5IYB G;  3UQ8 A;  1I6H H;  1MKH A;  2GVB A;  4LFB Q;  4LF8 Q;  2VQF Q;  4CC6 A;  3G71 A;  1KRS A;  1XMO L;  2ZJP A;  1S40 A;  3JAM i;  5GRO A;  1I94 Q;  2I5L X;  1IL2 A;  3PO3 H;  3PUZ A;  2K5H A;  3HOX G;  4TVA B;  4DV3 L;  1XPO A;  4A3I H;  1X3F A;  3S1N H;  4JC0 A;  5IYD G;  1M90 C;  4DR6 L;  1TWC H;  3RLO A;  4A3J H;  1EQQ A;  1I5F A;  2AKW B;  4PZ6 A;  4DR3 Q;  3J81 j;  4JBM A;  4JI8 Q;  5FLX c;  4J15 A;  2N3S A;  1TXY A;  1X56 A;  1PVO A;  1EQR A;  5IT9 c;  4E6N A;  5LMN Q;  4AQY L;  4JI0 Q;  2UU9 L;  5M3F G;  4LF5 L;  2NZO A;  3SGI A;  2UUB L;  4DV0 Q;  4JI7 Q;  3PCO B;  5K36 G;  5EAY A;  3GO5 A;  1VQL A;  2PQA B;  1JE5 A;  1BBU A;  4DUZ L;  1N33 Q;  1J6Q A;  5AJ3 L;  5GAE C;  2UXC Q;  5E7N A;  1HNZ Q;  2R93 H;  2NN6 I;  4JBK A;  4P75 A;  1L2F A;  2PNH A;  4A3D G;  1JJG A;  1T9H A;  4BBR H;  5IYC G;  4A3F H;  1QVG A;  2CWA A;  2KCT A;  2JA5 H;  4B3S L;  4GNX C;  2ZJQ A;  3M7N A;  2PQA A;  2VS1 A;  5IYD H;  1B7Y B;  4DV7 Q;  3PIO A;  1Q46 A;  3KDF B;  1L1O A;  4GKK L;  3OTO L;  4R4I A;  1NTG A;  1X3G A;  4QL5 A;  4GOP A;  2LSS A;  3UDG A;  1YZ6 A;  2D62 A;  2R7D A;  2CKZ B;  4FDB A;  2VZA A;  1XTD A;  1PH8 A;  2ZM6 L;  1VS0 A;  5JJL A;  4PZ7 A;  3K7A H;  3S1R H;  3J81 i;  4A3E H;  1CUK A;  2YTV A;  4IFD I;  2K14 A;  4KLK A;  5JJK A;  1A0I A;  1VQ9 A;  3AFP A;  1IBM L;  5FPR A;  5BR8 Q;  1PHJ A;  3U4Z A;  4YHH L;  1K73 C;  2WB1 G;  3PUY A;  3CCM A;  3JSL A;  3D31 A;  4UP8 A;  2K75 A;  1N34 Q;  1UE6 A;  1B70 B;  1G51 A;  3MEF A;  2JK8 A;  2RHS B;  3G48 A;  3HOZ G;  1HH2 P;  4WJ3 M;  4X6A H;  1VQI A;  3TY5 A;  1C7Y A;  2Q2H A;  1J5E Q;  1XNQ Q;  3GTO H;  3EN2 A;  4UCS A;  1D8L A;  3G4S A;  5C0X G;  4Y52 H;  4P73 A;  1Q82 C;  5C0X I;  3GTG H;  1JT8 A;  2HVS A;  1SN8 A;  1PFS A;  3NEM A;  4GOP C;  2JA7 G;  1GVP A;  1JB7 A;  4DR4 Q;  5C3E G;  3RN5 A;  1G6P A;  2B3G A;  4MTN A;  4L5S A;  1PV4 A;  2UXD Q;  2JA7 H;  4YCW A;  5C0X J;  1XNR L;  4JBW A;  3I4M H;  4K0K L;  3ICE A;  3CP0 A;  4IOA A;  4UCO A;  2R92 G;  2WAQ G;  3HOV H;  4A93 H;  4GKJ Q;  4UP9 A;  3S24 A;  4YY3 L;  4QGU A;  5ELN A;  1QUQ B;  2HQL A;  1U0L A;  4A3M G;  5IP9 G;  2HVR A;  5IYB H;  1WYD A;  1Q8K A;  3HKS A;  2Q2I A;  3J80 i;  3K80 C;  1VQF A;  1YHA A;  4MZ9 A;  2ZJR A;  4DR1 L;  1KIX A;  1Q7Y C;  1Q81 C;  3H0G H;  2C35 B;  2XGT A;  1K0R A;  2I0Q A;  1N32 L;  5M5X H;  4HJ5 A;  4GS3 A;  2CFM A;  3UDI A;  2UUC Q;  3VNN A;  1BBW A;  4NPS A;  3A0J A;  4DV5 Q;  4GLX A;  2HIX A;  1X9N A;  3GB8 B;  4B3M Q;  1PA6 A;  3CC4 A;  4DV2 Q;  4GLV B;  4L5Q A;  3JSN A;  1YIJ A;  2BA0 A;  2YTY A;  3PO3 G;  3KF6 A;  4PMW A;  4DR7 Q;  3AQQ A;  1VQM A;  4KHP L;  1AE2 A;  3I4N H;  3I2Z A;  4GLA C;  1X3E A;  1V43 A;  2MQH A;  3BZC A;  2YTX A;  2GVA A;  1YJN A;  3BA9 A;  2WP8 J;  4IJH A;  3S1Q H;  2ASB A;  2KBN A;  4BXX G;  1KXL A;  4X64 Q;  1UWV A;  2IHE A;  1LYL A;  3WWV A;  3NEL A;  4R4Q A;  3W1G A;  1SLJ A;  1G29 1;  4A3F G;  5D1O A;  1EUJ A;  4O2D A;  1X65 A;  1HNW L;  2OTL A;  2UUB Q;  3T1H Q;  4JV5 Q;  3STB C;  2IX1 A;  4X62 L;  4LF9 Q;  2UXB Q;  3K0X A;  3KDF A;  4LF4 Q;  1S72 A;  3CME A;  4DV6 Q;  4IFD G;  2UUA L;  3GTP H;  2VUM H;  4BBS G;  1PH3 A;  3K81 C;  4PZ8 A;  4DK6 C;  4HJ9 A;  4DKA C;  4POF A;  1FJG L;  4A3L G;  5IY0 A;  3HFZ B;  1VQH A;  1HR0 Q;  4XTC S;  1TWA H;  4LUZ A;  2MO0 A;  1YIT A;  1IYJ B;  1AH9 A;  2ZTC A;  4B3S Q;  1RIP A;  4KHZ A;  1ASY A;  2OQK A;  2F4V Q;  2AWO A;  1NJI C;  3HOY H;  1OXX K;  4A3G H;  1HZC A;  3BAA A;  2NVT H;  4YWK A;  1Y1W H;  5C44 G;  1AE3 A;  4GNX A;  1PH9 A;  3HOY G;  3J7Z C;  4JI4 L;  2E2H H;  1VQG A;  4A93 G;  3MXN B;  3PUW A;  4DUY Q;  4X65 Q;  1MJE A;  1YVC A; 
#chains in the Genus database with same CATH topology
 2I5H A;  1SE8 A;  1HUM A;  3P20 A;  2YS7 A;  3NE5 B;  5ELE A;  4QIW A;  2W6P A;  4LF7 H;  3S2D H;  1NSN S;  5IWA Q;  4ALP A;  4DR6 Q;  4O2A F;  1ASZ A;  1A2T A;  4RFB A;  3HKZ B;  3DWA A;  4NXM H;  1VCI A;  2ICE C;  2HGS A;  2K5N A;  4B3R L;  4YJ3 F;  3N52 A;  4DR5 L;  3PIO 3;  1E24 A;  4JI5 Q;  4RB3 C;  2WV6 D;  1UE7 A;  1EOT A;  3S1M B;  1NBW A;  5KFK A;  4EFB A;  2AU0 A;  2F0V A;  3KK7 A;  2LFN A;  2G5D A;  2QEX A;  4HIK A;  3KLS X;  1TA8 A;  2W9C B;  3TN2 A;  4BBR G;  1B50 A;  1TWH H;  3IL8 A;  2VQE L;  3DLL A;  3JZF A;  5C1P A;  1RJQ A;  1WCM A;  2R61 A;  4ZYS A;  2GPS A;  4YY3 H;  1S5C D;  1S0O A;  2W57 A;  2W9C A;  2Z6B A;  3PR5 B;  5DGI A;  1CSP A;  3CC7 A;  4DV0 L;  3UFX B;  4O4J F;  5ELF A;  4C3J H;  3J7A K;  1RK5 A;  1N32 H;  1XPR A;  3GIL A;  5J22 A;  5BPH A;  1XDN A;  3NWS A;  5EWG A;  4XQN A;  1IBL L;  2A69 D;  1A0G A;  2AWN A;  2R3Z A;  1SFO B;  5I47 A;  2FMM A;  2XVS A;  4JI3 L;  3GTG H;  2HIV A;  4DPG A;  1Y1W G;  5JOB A;  2V4R A;  3MZ5 A;  2DUD A;  1TWG B;  3S2H H;  5FK9 C;  4XZ3 B;  1FGB D;  2XC9 A;  2VA2 A;  3CCJ A;  4IUU A;  4KMU C;  2FPG B;  2WTF A;  3K57 A;  1I94 L;  5JPM C;  3MFY A;  3WO0 A;  5KFJ A;  3T5K A;  5KFS A;  2K5Q A;  3E5S A;  3CQZ B;  2VL6 A;  5IOD A;  1WCM H;  3HOZ H;  4DR2 L;  4FXG C;  2W6Q A;  4UFZ A;  5H1S E;  4EBD A;  3GTK A;  1XNR Q;  3OSO A;  2DAA A;  3TW6 A;  2ICI A;  1TWH B;  5D1O B;  4X64 H;  1FKA H;  1CZG A;  2AQ1 B;  3UE0 A;  3J80 L;  1ILP A;  5FPO A;  3TRE A;  2CNQ A;  4MV9 A;  1N33 L;  4DV6 L;  2Z6K A;  1STA A;  2VOB A;  5D1O A;  1KHI A;  3NEN A;  5DNF A;  2OLS A;  5FLM G;  2IMW P;  4MV7 A;  4NYE A;  3H15 A;  1N8R C;  4QQB X;  3ORR A;  2OQ0 A;  2B39 A;  2YW2 A;  4DV4 L;  2VUG A;  3NUA A;  4A3M H;  1IBM H;  3VPD A;  5DM7 3;  3RB3 A;  4DFA A;  1K8A C;  2OEO A;  4O86 A;  4RHS A;  3OTO Q;  4CGY B;  2JA6 G;  3S15 H;  1I2L A;  4K0K Q;  2ZDH A;  1BCP C;  3CPF A;  1PLF A;  3OIQ A;  2CZG A;  2K52 A;  1PYS B;  5JQG F;  4QW9 A;  2C2D A;  4O42 A;  2J6T A;  4X66 H;  1XXG A;  4JV1 A;  2M00 A;  2UVU A;  2H5X A;  4HNU A;  5GAD C;  2C00 A;  4UCR A;  1MJC A;  4C5C A;  2M05 A;  2PI2 E;  2K4K A;  2W9B A;  1PH1 A;  4APM A;  4YAJ B;  2L9H A;  2K7V A;  1KTK A;  2WDT A;  2BQU A;  3V05 A;  3HGB A;  3A5U A;  4LF6 L;  3S14 B;  3PR4 A;  2VNU D;  4JI7 L;  3CEB A;  2RA4 A;  5KX5 F;  2UXB L;  4IUT A;  3PW0 A;  1PRT C;  4TKO B;  2R8H A;  2VR1 A;  4YCU A;  2W6M A;  3BYY B;  3TDQ A;  4CKB A;  2E5L Q;  2P5Z X;  3PVX A;  4Y7N H;  3MA2 B;  1WSC A;  1F9P A;  3KLS A;  3GID A;  2NTS A;  1AW7 A;  4LNQ A;  2HJW A;  3HKZ E;  2CW0 C;  1PDQ A;  3F2B A;  4O83 A;  4O3R A;  1A9X A;  2R93 G;  3QB3 A;  1X6O A;  1XMQ Q;  4DV7 L;  3ER0 A;  5I6Y A;  2JE6 I;  5IIF A;  4EFE A;  4A3G G;  4WD3 A;  5BMV F;  2RGV A;  1EEF D;  4I65 A;  1OXV A;  5JEA H;  4DL7 A;  1XMQ H;  2V59 A;  3STB D;  3T1Y L;  2RVL A;  3PIP 3;  2Z4H A;  1OXU A;  3M9B A;  4TV8 F;  4TV9 F;  1NUC A;  1SMX A;  4X3K A;  2PW7 A;  3S1N B;  3OMG A;  3HKZ A;  4HMJ A;  2QYZ A;  1LT3 D;  3SR1 A;  4LMQ D;  4R8U A;  2JEB I;  3U50 C;  1N32 Q;  2FK3 A;  3PV0 A;  1ENA A;  2V1C C;  4UCU A;  2N78 A;  4EQ5 A;  3EYY A;  3FPP A;  3HKZ G;  2Z0S A;  3K6O A;  3J80 E;  1SYX B;  1WTV A;  2ZTD A;  4WBN F;  4DV2 L;  1Q86 C;  1WVL A;  4GN3 B;  3CMA A;  1A3G A;  2SNM A;  2HCI A;  2NU8 B;  4L5T A;  1I3Q A;  4MV6 A;  3ERS X;  3GTM A;  2OCE A;  3HOW G;  2QA4 A;  2F0D A;  5KRU A;  5KFQ A;  5LMN H;  4RA8 A;  2EYJ A;  2W8K A;  2JA7 A;  1L1O C;  3KTM A;  5KG4 A;  1Z47 A;  4ECX A;  3I56 A;  2FJ2 A;  5BR8 L;  4IUN A;  1VQ5 A;  3VMM A;  4C5A A;  4LF5 Q;  3MFG A;  5T1G A;  1H9K A;  4FM9 A;  3VYT A;  4A3K G;  4X62 Q;  4LF4 L;  2NTT A;  5KEE A;  1HNZ L;  2R7Z G;  3H4B A;  1SNQ A;  2DWC A;  4YWL A;  3M9M B;  5KFI A;  4RMF A;  3HOX B;  4LJZ C;  2GQS A;  3GQC A;  2B29 A;  1EKP A;  3OIP A;  4YR0 A;  3H0G G;  3UYY A;  3I73 A;  4DV5 L;  1OXT A;  1U4P A;  3Q8P B;  1TWF B;  2RCN A;  5C44 B;  2C22 A;  3U54 A;  2YZM A;  4DGZ A;  3CCQ A;  5EQ0 A;  3HB9 A;  1PMR A;  5IOC A;  4DK3 C;  1LUZ A;  5KGU A;  1A8V A;  1CQI B;  1KQS A;  2R6G A;  4KTA A;  5JJI A;  1XX8 A;  2HHF B;  3OTO H;  1EY7 A;  4ME3 A;  3UE1 A;  4O7Y A;  4JI1 Q;  3PIP A;  2AUK A;  3T4A C;  1G91 A;  3MWM A;  3RV3 A;  4OIK A;  4G3I A;  2R7Z H;  1L0Y B;  5C8Y F;  4NXM Q;  1SAP A;  2IX0 A;  2XWJ B;  3CAM A;  3W2D A;  4A3C H;  5M3M H;  4GOP B;  2I80 A;  2VQE H;  1N34 L;  2RQX A;  1MHW C;  3I72 A;  1GLV A;  5KG2 A;  4MV4 A;  3GTL H;  4DR5 Q;  3CSW A;  1RJR A;  2K1B A;  4RAZ A;  4UPA A;  3NTK A;  1XPU A;  1RYR A;  1R4Q B;  3QFF A;  5FLX E;  5HGT A;  1BKB A;  2AUJ D;  1U9R A;  1E22 A;  1B6S A;  2PBZ A;  3PF4 A;  2EJ3 A;  3SK5 A;  5FD6 A;  5M5W H;  1FNV A;  3ORQ A;  2C5C A;  1N36 L;  4JI6 H;  3UDF A;  1RF2 D;  1E1O A;  5KG6 A;  3HOU H;  1DCZ A;  4BXX H;  3NP8 A;  2JYO A;  2XGQ A;  5FLM H;  4EEQ A;  2Z04 A;  4X65 L;  5IYC H;  2VQF L;  5K5P A;  4HID A;  1S4Z A;  3BDO A;  3M7G A;  2HT1 A;  4CHI A;  3J80 c;  4K5W A;  1K8O A;  3Q8D A;  4I4T F;  2B2T A;  1T5E A;  4JXU A;  4IN3 A;  5L1K A;  4EBE A;  5CA1 F;  1TR5 A;  1VQA A;  3BJU A;  1I6U A;  2B2Y A;  1P16 A;  1YNX A;  4LSX A;  2IBK A;  2J6U A;  2YV5 A;  1BQQ T;  1LO5 D;  1V1Q A;  4AH6 A;  4HJ7 A;  1M1K C;  2EYH A;  4RHR A;  3URY A;  4LFC L;  2F0M A;  5IYB G;  1CE8 A;  5M5W B;  3NTH A;  1GGO A;  4CC6 A;  1WH2 A;  1KRS A;  3N40 P;  2RDH A;  4C1N K;  5KT4 A;  1DOK A;  2KEC A;  1Q90 A;  3H91 A;  3PO3 H;  3PUZ A;  4DV3 L;  4DV6 H;  4JC0 A;  1AP0 A;  3WWH A;  4ME6 A;  1TWC H;  1EQQ A;  4U67 3;  2XNA C;  4J15 A;  1EQR A;  1IYV A;  3NQT A;  4MV3 A;  4BY1 B;  1UUP A;  3SGI A;  2UUB L;  4NZM A;  2PO4 A;  3DEP A;  1B33 N;  5K36 G;  1B1Z A;  1PRT B;  5EAY A;  4WFN 3;  4B9W A;  3DWP A;  2R93 H;  3Q8R B;  4KV6 A;  1EUC B;  5E7N A;  3BQ1 A;  2J7Z A;  2NN6 I;  2NUC A;  4QUF A;  2FK1 A;  4A3D G;  2F0P A;  1JJG A;  1T9H A;  1K83 A;  4A3F H;  3Q22 A;  4RNO A;  1S5D D;  1RCV D;  2EPB A;  2JA5 H;  2RDF A;  2CW0 D;  3RB4 A;  3M7N A;  2PQA A;  3N42 B;  4ETS A;  4RAY A;  2GLT A;  4U68 A;  3T9D A;  3PIO A;  1EHI A;  4GKK L;  1I4R A;  5C5M A;  4J9K A;  4R4I A;  1PTO B;  1R4P B;  3UDG A;  2LSS A;  3U9S A;  5KFX A;  3T9F A;  5COY A;  2R7D A;  3MAQ A;  4EBC A;  3HOW B;  1SXT A;  2CKZ B;  4C5B A;  1XTD A;  3E6Z X;  4PZ7 A;  4O7T A;  3K7A H;  3S1R H;  4CKC A;  2B2W C;  2EYP A;  4PNY A;  3J81 i;  5FLX W;  3HBL A;  1SDF A;  1KDA A;  4O4I F;  1E2V A;  1WD1 A;  5BR8 Q;  2G9H D;  1WTQ A;  2UVV A;  2K04 A;  2ATL A;  4FO2 A;  4CDE C;  2C2E A;  3D31 A;  2E5L H;  2HGW A;  2F0U A;  1IKL A;  1ZHS A;  2JK8 A;  5EPJ A;  1HH2 P;  4WJ3 M;  1EWC A;  2QDL A;  1KJ9 A;  1B9M A;  2Q2H A;  1XNQ Q;  4UCS A;  2ZXP A;  1VF7 A;  1O75 A;  4P73 A;  4M9U A;  1PZK D;  2JA5 A;  5KND A;  5C4J B;  5KYL A;  2AGO A;  3NEM A;  1G6P A;  3RN5 A;  1EQT A;  2EY2 A;  2B3G A;  2UXD Q;  1MBY A;  4YCW A;  3Q1K A;  3I4M H;  4ED3 A;  3ICE A;  2HGX A;  1D2B A;  2HDK A;  3MWD A;  4UCO A;  4GKJ Q;  1JOO A;  3I91 A;  2JEG A;  3S24 A;  4QGU A;  2K32 A;  2QCP X;  5IT9 E;  1U0L A;  1BO0 A;  1ZAU A;  1WYD A;  1PK8 A;  3J80 i;  3K80 C;  1QWY A;  4MAM A;  4DV0 H;  1YHA A;  4DR1 L;  5EKK A;  4F87 A;  3H0G H;  2C35 B;  4ED2 A;  3NXW A;  3U0G A;  1N32 L;  4GS3 A;  2EY5 A;  1TWA A;  3VNN A;  5DGA A;  1RD9 D;  4C2M A;  3G7L A;  4GLX A;  3GB8 B;  1D1K A;  2E2D C;  3CC4 A;  1QJO A;  2BA0 A;  2WB1 B;  2B8G A;  3PO3 G;  3BDC A;  4K6N A;  1I2K A;  1R9T B;  4GKJ H;  2RDI A;  2AGQ A;  3I4N H;  1X3E A;  4F4W A;  4N8X 1;  1SBB B;  1STE A;  1JCK B;  2WP8 J;  1ZYR D;  4KJN A;  3C46 A;  1B9N A;  3I70 A;  3KHL A;  3NEL A;  4R4Q A;  5T1I A;  5G3L F;  4Q4C A;  1KNA A;  1G29 1;  2A5H A;  1EUJ A;  1U4R A;  2WII B;  5FNV F;  5C6A A;  1HNW L;  1S5E D;  4V19 0;  1IKM A;  2R8K A;  5L1J A;  3KAJ A;  5CV6 A;  4IFD G;  1JWM D;  4C3J G;  5BN3 A;  1WTW A;  2VUM H;  3D8G A;  4O7L A;  3K81 C;  3IKJ A;  1FJG L;  2NVQ B;  5KFD A;  1JX4 A;  4B3S H;  4A3L G;  4A2A A;  2RSO A;  3HFZ B;  1VQH A;  4PMB A;  1KAB A;  1TWA H;  2O2L D;  4XTC S;  3VYS A;  3SI8 A;  2X6G A;  5EWF A;  4BWS C;  2ZTC A;  4B3S Q;  5KT7 A;  4A3F B;  2OQK A;  2PZU A;  3MWY W;  2AWO A;  3BVG A;  3VR3 A;  2R7Z A;  3R5H A;  2W7O A;  4OHJ A;  4YWK A;  2NVT H;  4U7C A;  4LF9 H;  1AE3 A;  3DXJ C;  3RBD A;  4GZY C;  3OHB A;  2E2H H;  1YNN C;  4X65 Q;  3SE0 A;  2VQF Q;  1MJE A;  3VR4 A;  1EKF A;  4DRF A;  4QMG A;  4G7O C;  1JOR A;  2JA6 A;  3BS1 A;  4UDU C;  5KFC A;  1JDB B;  1X55 A;  2EE1 A;  1K1S A;  3T5J A;  1M7J A;  3DHQ A;  4KKT A;  4J6H A;  2ID0 A;  2K03 A;  3A5Z B;  2VB3 X;  4X3S A;  1S0N A;  4DR7 H;  4ECW A;  4I7Z C;  5LHY 1;  4JI6 L;  1EY6 A;  4R1J A;  1D5X C;  1KAW A;  1Z6H A;  2ES2 A;  1JJC B;  2K50 A;  1M0T A;  5C4X H;  1KBL A;  4HAE A;  4TQU S;  3VR6 A;  3LP8 A;  3QQM A;  1XMO Q;  3WOF A;  4J9M A;  3EJI A;  1FNW A;  2NU9 B;  1IYE A;  3NPP A;  1I3Q B;  1XNR H;  1NMF A;  3M4O H;  2DJF C;  3W5O A;  5EBD A;  3S2H B;  4DV1 L;  3RZD H;  4UCT A;  4H13 C;  4GKK Q;  3CU7 A;  1S0M A;  1U5K A;  3LML A;  1EIG A;  4TM5 A;  3I3C A;  4B3M H;  4O7W A;  1D1I A;  1ZXT A;  1KEE A;  2HCC A;  2KHI A;  2F0S A;  3TQY A;  1F9R A;  4JI2 Q;  5F2D A;  2O4X A;  3PW5 A;  1XMO H;  4L1K A;  2M9V A;  5LMU Q;  3T1H H;  1C9O A;  4JV5 H;  3T1Y H;  4OX9 Q;  4YWM A;  4F50 A;  1BNC A;  2WB1 E;  3F1Z A;  3AYH B;  3FP9 A;  3LUL A;  5CM0 A;  4CC5 A;  2DGY A;  4C56 C;  2UVR A;  2R6F A;  3OMC A;  1K28 A;  1EQV A;  5C3X A;  3C3L A;  5LMU H;  3T5L A;  4GC7 A;  1JC7 A;  3ETJ A;  4ECR A;  3HOU G;  4Q4D A;  2L12 A;  4ZUJ A;  1DOM A;  2CWP A;  4O7Z A;  3A54 A;  1JDE A;  1U4M A;  2UUB H;  3E9I A;  3TS0 A;  2JP1 A;  3A55 A;  5IP7 G;  3H20 A;  4DV2 H;  1BDO A;  2PI2 A;  5LL6 S;  2OF1 A;  4KN4 C;  5HY6 A;  3S16 H;  4O4L F;  2JA8 H;  3TQ1 A;  3MR2 A;  3PO3 B;  3CCU A;  4EYH B;  3DF7 A;  1E4F T;  1VDZ A;  2X69 A;  1N9W A;  5DGH A;  5C0X H;  5LMN L;  5I2X A;  4OON A;  5D14 A;  3WO1 A;  1S03 G;  3DAA A;  1FR3 A;  3CHB D;  2RHQ B;  3GTG A;  3RD4 A;  4NZN A;  3CRK C;  3VR5 A;  1F2L A;  4L5R C;  3A8I E;  3CF5 A;  5I5T A;  4HR7 A;  2B63 H;  4LF7 Q;  1T36 A;  4LF4 H;  3JAM c;  3M3Y H;  4PG3 A;  4HIO A;  3JZ6 A;  2XD4 A;  2IP4 A;  2IHF A;  2YCH A;  1BXR A;  3RAX A;  2F4V L;  1A15 A;  4J8Q A;  4A3J G;  3QWU A;  3RLN A;  2EIY A;  3PW2 A;  1VQ4 A;  4ED8 A;  1E7Z A;  3GTK H;  3KHR A;  2CCZ A;  1SRU A;  4IPH A;  3TEH B;  1S10 A;  2R87 A;  4IOC A;  3Q8S B;  4MNO A;  4OO1 I;  4HNT A;  2QDB A;  2I07 B;  2E2I A;  4J1M A;  3D4R A;  1ZKO A;  5HUR A;  2JEF A;  4C1N I;  4K14 A;  1I1L A;  4O3P A;  5A2Q E;  2BA1 A;  1Z2N X;  4O3S A;  4Z9C B;  1XWE A;  4DR3 L;  4XXE A;  1DON A;  4ECS A;  2EYL A;  1KRT A;  1Z2P X;  2IY5 B;  3SNO A;  2AQ2 B;  1VQ6 A;  3IN5 A;  3S17 B;  2W6Z A;  1O7L A;  3L0O A;  1C3O A;  1KC7 A;  3LQS A;  2JEJ A;  3RF2 A;  4AIM A;  2E8G A;  2CNV A;  2JXM B;  2KED A;  4P71 A;  4FF2 A;  1CT1 D;  1AZP A;  4LWC A;  4QB4 A;  1WFQ A;  2A1A A;  4IFD J;  1Z2O X;  4EYI B;  2Y0S A;  1IL8 A;  2IWH A;  1HQM C;  1GUG A;  5CV9 A;  4YBZ B;  2PNR C;  1KAA A;  5D3D A;  2VUM B;  2F3W A;  3RN2 A;  1N36 Q;  3E3X A;  2UXD L;  4ZKC B;  1QUQ A;  4I50 F;  4XYM B;  4JI8 L;  3M4P A;  1RJT A;  1HR0 W;  4LH6 A;  4TUY F;  1PTO D;  2HG8 A;  1QVC A;  1STN A;  1CKO A;  5C4Z A;  1RJP A;  5J1Z A;  1Y1V A;  1N36 H;  2F52 A;  5FJ8 G;  4DK0 A;  3SE7 A;  2NVQ H;  4K6L A;  4HJ8 A;  2G9D A;  2WAC A;  2WIN B;  3J7A F;  2E75 C;  2YWV A;  1CK1 A;  2ALZ A;  1OO9 B;  4NDX A;  3RZD B;  4JI3 H;  4A76 A;  1XK5 A;  1IBM Q;  2EYF A;  4DAY A;  4F88 A;  1ZET A;  1XJV A;  3MXU A;  3HG9 A;  3MXP A;  3I4N B;  1BNZ A;  4K0K H;  3OW2 A;  5FOB B;  3ZYY X;  2Q2U A;  3TS2 A;  5KG3 A;  1PTO F;  1QZH A;  4LFC Q;  1GUN A;  4TQS A;  1FD7 D;  3Q0A A;  4BA2 I;  2L1B A;  2JN4 A;  4BA1 I;  2GPW A;  4JI1 H;  1FYC A;  4OEL B;  1G2W A;  2F3V A;  4A4I A;  2BQ3 A;  3JAM L;  1B3A A;  1KC8 C;  3BG5 A;  4LFC H;  3L9A X;  3PN1 A;  5CE8 A;  1UEB A;  3AB9 A;  4DNT B;  1EIH A;  4X64 L;  1S68 A;  4DV1 Q;  2QB5 A;  1X54 A;  3TIN A;  3TZD A;  1EYZ A;  2KQ3 A;  3VDY A;  1VBH A;  2XCL A;  3H0G B;  2ZDQ A;  5I9P A;  1JE4 A;  3E0E A;  5CBA E;  1PH2 A;  3PW4 A;  4JG2 A;  5IE8 A;  2B2U A;  4KY5 A;  1YEZ A;  4LF9 L;  1OXS C;  3HEJ A;  2E2H B;  4IAJ A;  4MA5 A;  2SCU B;  1H9R A;  4JI2 L;  4BWG B;  1GD7 A;  1VQD A;  1WI5 A;  3F8N A;  3UDX A;  2CH4 A;  3MR6 A;  4OX9 L;  1OBG A;  3GTM H;  2K5V A;  3HOV G;  1TS2 A;  4UCV A;  5EPL A;  2XRQ D;  2YS6 A;  3RUZ A;  3I4M B;  2Z1C A;  1I50 B;  1SE2 A;  3PF5 A;  3GTJ B;  5KNC A;  2OWO A;  3R9R A;  4RCN A;  5ELD A;  1NE3 A;  5EDW A;  1QE6 A;  5JH7 F;  1DGS A;  3PFF A;  4XX0 B;  2E74 C;  4HMI A;  4DR7 L;  2I8C A;  5DAA A;  1EKV A;  3R2T A;  2B2Y C;  2UUA H;  4RAU C;  5IT9 L;  3I7F A;  2RDG A;  4O0A A;  1K83 B;  4IO9 A;  4IWX A;  2YZL A;  4PV1 C;  1I4Q A;  4IUQ A;  2XSC A;  4F4X A;  1H9M A;  1GO3 E;  4XDX A;  1TWF A;  2ATW A;  5IYZ F;  2R8G A;  2KA7 A;  3TP6 A;  3K7A B;  3S1R B;  2NN6 G;  3HOZ B;  1L1O B;  5JEA J;  4JI7 H;  4NW2 A;  3CCV A;  3BZK A;  3FMC A;  2F0W A;  1K83 H;  4IUP A;  4IR1 A;  4LAA A;  1CQJ B;  3F8T A;  2EXD A;  1OWT A;  4C3H H;  4JI6 Q;  5GQO A;  2NVY H;  1B4O A;  4HSV A;  1TT2 A;  4J9O A;  4QUC A;  2UUA Q;  2YYA A;  4A3I B;  1TWG H;  2E5L L;  2V4D A;  3IFD A;  4AYB E;  3KJO A;  3L4K A;  1O78 A;  2WB1 A;  4DV7 H;  3EBE A;  3PMF A;  1G2S A;  4MIU A;  1MD2 D;  1IBK Q;  1EWH A;  3K3P A;  4RGM A;  1XMQ L;  5KG7 A;  1E4G T;  1W2B A;  4B3R H;  3RFC A;  3H3V H;  2F0J A;  1W93 A;  2NUA B;  5IGC A;  3I12 A;  1JIC A;  4PBC A;  1Y1V G;  3GTQ B;  1S97 A;  4OO1 H;  5BN4 A;  1LTL A;  2RCF A;  3GP7 A;  2ZJT A;  5BYA A;  3A74 A;  1HNX Q;  5HGQ A;  2E2J H;  5BWR A;  3ETH A;  2NVX H;  4A3K H;  1SR3 A;  2PMZ B;  4LF7 L;  4NZO A;  1CSQ A;  1VQC A;  2YYZ A;  4FYD A;  1DD2 A;  4YR2 A;  4BY7 B;  3NC0 B;  3IG0 A;  4IPG A;  1LTB D;  1PYB A;  4DF7 A;  4JOI C;  1KD1 C;  2Y4R A;  4DR1 H;  1VBG A;  5E3F A;  2JA7 B;  4QSH A;  1RKN A;  1TII D;  3AFQ A;  2L11 A;  2IJ0 A;  4C3I H;  3CXC A;  3CCS A;  2A8V A;  1I6H H;  1O7Y A;  4XQQ A;  4LFB Q;  1JWU D;  2GA4 B;  5KFV A;  2ZJP A;  1CZW A;  4FF1 A;  4QW8 A;  5GRO A;  5IWA H;  2WKC A;  4HSP A;  4EGJ A;  4LFA H;  5EGT A;  3GLK A;  5BWT A;  2JA6 B;  1M90 C;  4DR6 L;  3RLO A;  4QIW B;  4PZ6 A;  3GTO A;  3M4I A;  4JI8 Q;  4O3O A;  2N3S A;  1PVO A;  1TVX A;  4E6N A;  1SYF A;  5IT9 c;  5A2Q L;  4JI0 Q;  1S5B D;  1RDP D;  4HR7 B;  1HQR D;  2F4V H;  3MEH A;  3R93 A;  5CV5 A;  5C1O A;  1I50 A;  1KDB A;  4JUZ A;  5EPK A;  2PQA B;  1JE5 A;  1BBU A;  1C48 A;  1PXU A;  1HNZ Q;  4ZUI A;  1EZ6 A;  5GON F;  4DV5 H;  3LWU A;  5KFL A;  2PNH A;  2FFK B;  4TVI A;  4DR2 H;  3OUZ A;  5EWE A;  5DG7 A;  2X0S A;  4KHV A;  4B3S L;  1LTG D;  3S16 B;  2FMA A;  2VS1 A;  1ET0 A;  3AW8 A;  4CJ0 B;  3GIK A;  1XYI A;  1L1O A;  1F9Q A;  3GTL B;  3OTO L;  5BWW A;  2RDJ A;  3N44 B;  3QZ7 A;  2R93 B;  5IGF A;  1YZ6 A;  4MV8 A;  5KT3 A;  1TKW B;  3OUU A;  3T9B A;  2Z4I A;  4O3N A;  5KFF A;  2DZD A;  1BUV T;  1GSO A;  2VZA A;  4RKL A;  4P2C B;  3M9N B;  1PH8 A;  5I5V A;  1VS0 A;  5BPF A;  4CHT B;  4A3E H;  2YTV A;  4BBS B;  5JJK A;  1A0I A;  1N34 H;  4XQJ A;  4K6D A;  3K5M A;  4NLG A;  4ZKB B;  4A3B B;  3RUP A;  3S1Q B;  1ILQ A;  3PZP A;  2WB1 G;  3PUY A;  2W71 A;  1F2M A;  5L9X A;  4UP8 A;  1N34 Q;  2K75 A;  4DK1 A;  2NBF A;  5I5X A;  5CV8 A;  2UXD H;  2EZV A;  3HT5 A;  2VPS A;  1G51 A;  1VF5 C;  3TY5 A;  1SFO A;  3HOZ G;  1VQI A;  1STY A;  1LT6 D;  2IX3 A;  1C7Y A;  2PPB C;  2A73 B;  5KFE A;  2RBM A;  4QWD A;  2N55 A;  1D8L A;  3G4S A;  4G7H C;  4OGQ C;  5JVH 3;  3N41 B;  1AN8 A;  1B2T A;  2B63 B;  1KJI A;  1DJR D;  1SJH D;  2KCC A;  4GOP C;  2JA7 G;  4DR4 Q;  5LL6 X;  1TU2 B;  2EJ2 A;  4L5S A;  4MTN A;  3T5H A;  4O82 A;  3RBE A;  2UXB H;  1PZI D;  3DUZ A;  2CVR A;  4K0K L;  3RZO B;  2QW7 A;  4RCO A;  5EKL A;  4QWE A;  3KAK A;  2AQ3 B;  2KHS A;  2WAQ G;  1CTM A;  4O84 A;  1CQV A;  5C3W A;  1W6K A;  5BWV A;  4O7S A;  1QUQ B;  5C3E B;  4A3M G;  5IP9 G;  2HVR A;  4RB0 A;  1MSG A;  3EQL C;  3HKS A;  2JA8 B;  4WHX A;  3FKI B;  4MZ9 A;  4BS9 A;  2XGT A;  4AYB A;  1K0R A;  1R9T A;  3ERQ A;  2NB0 A;  1SYB A;  1WR2 A;  2ASJ A;  5J2T F;  1X9N A;  2HIX A;  4HTH A;  3V96 A;  1PA6 A;  4TQR A;  2MP1 A;  4DV2 Q;  1CS0 A;  3D4W A;  3JSN A;  2OT2 A;  2F0L A;  1F9S A;  2E2J B;  3KF6 A;  4PMW A;  3LNN A;  1VQM A;  4KHP L;  1AE2 A;  1LV9 A;  2B2V C;  4GLA C;  3QWN A;  1V43 A;  2MQH A;  2YTX A;  1A3V A;  1KUT A;  4J9R A;  4M8A A;  3BA9 A;  2F03 A;  3P75 A;  4BXX G;  2KBN A;  1J5E H;  2D5D A;  5BWX A;  4AQY H;  2IHE A;  3WWV A;  1LTA D;  1ICW A;  3FDT A;  3W1G A;  1SEI A;  3K5L A;  1LT4 D;  2HD3 A;  1DAA A;  1ZYR C;  1W96 A;  5KFM A;  3NBI A;  4DXG A;  1B6R A;  5I60 A;  4FS2 A;  2OTL A;  3VYU A;  3H94 A;  2J6S A;  3KDF A;  4LF4 Q;  1S72 A;  3CME A;  1SJE D;  2UUA L;  5DG9 A;  1NCV A;  5JPN C;  2LS0 1;  4BBS G;  4KY6 A;  4PZ8 A;  4DK6 C;  2SNS A;  4EG0 A;  4E4T A;  5IY0 A;  4N8F A;  2PW5 A;  3CKI B;  3OW7 A;  3K5N A;  5ELC A;  1YIT A;  3QIA A;  5CA0 F;  2GQR A;  1EU4 A;  3K5H A;  4F4Z A;  1HZC A;  3I8Z A;  4RUC A;  5C44 G;  1KJ8 A;  1PH9 A;  3HOY G;  4JI4 L;  1VKZ A;  4DIM A;  2XRS D;  3MXN B;  1PRT D;  2C2R A;  4ZLT F;  1PH5 A;  4Y7N B;  5EKI A;  2XIW A;  3T1Y Q;  4OWT B;  3OWF A;  4H02 A;  4RB1 A;  1CKN B;  1GSA A;  4ZOL F;  3P1H A;  4PWQ A;  2QK4 A;  3TY8 A;  4FFR A;  5KT2 A;  1NNX A;  1O7Z A;  1P8L A;  1VQN A;  1CKM A;  4A93 B;  2ASL A;  4A3K B;  1YHQ A;  4EX5 A;  4QF4 A;  2COI A;  4DN4 M;  2EY6 A;  3RR5 A;  4DR3 H;  5DIS C;  4N9P A;  2NVT B;  3W3A A;  4O4H F;  3T13 A;  3FHW A;  4LUO A;  2R84 A;  3X3N A;  2AMC B;  1I4H A;  1PZJ D;  3AEV A;  2DPJ A;  2ENB A;  5CMD A;  4FNF A;  1EL0 A;  2IT1 A;  1GKH A;  4OIJ A;  1I7N A;  5KFA A;  2EXZ A;  1WCM G;  3EIV A;  4K8J A;  5KT5 A;  2MPM A;  1IBK L;  2LMC B;  4IPC A;  1UC9 A;  2R93 A;  4IRK A;  3TBI B;  1K1Q A;  2UVW A;  1UE1 A;  2NVX A;  4LFA Q;  4FFP A;  1WTO A;  1QG7 A;  1QNK A;  1KL9 A;  2M2L A;  2WAQ A;  3PGZ A;  1L0W A;  5KFU A;  5J39 A;  1V1P B;  2R82 A;  1VQ7 A;  4HNV A;  4JI8 H;  1OBD A;  3PO2 B;  1STG A;  1EWI A;  1E2W A;  2XTI A;  1WCM B;  5JAV A;  4MHE A;  5AJ3 Q;  1QOH A;  3BU2 A;  3TP8 A;  3RB0 A;  1HFG A;  4UAI A;  4ODG A;  3CRL C;  1NAP A;  1WTP A;  4PQX A;  5D1P A;  3OWE B;  2UUC L;  1QIL A;  4LK1 C;  3N8D A;  4B3T L;  2H1E A;  4DL6 A;  3L7Z C;  4A3L H;  3PUX A;  4DL5 A;  1SSO A;  3NBH B;  3J81 L;  1YJ9 A;  1LM0 A;  3CQZ H;  3R5F A;  1FGU A;  3R3O A;  4L8J A;  5DAU A;  4HCS A;  4EVO A;  1TAE A;  3T54 A;  1L0X B;  4H7B A;  1S9F A;  3ULP A;  2MHV A;  4ZK9 B;  1JJ2 A;  1I50 H;  2Q7D A;  4JI1 L;  3U9T A;  3BDL A;  3R5X A;  4R4O A;  1GXD C;  3EPG A;  2YU9 B;  1TS3 A;  3ITP A;  3B6Y A;  5BYB A;  4YCV A;  5C5L A;  4AQY Q;  2CNU A;  3NBZ B;  2L0C A;  4JCV E;  2FE3 A;  3A8J E;  4ED1 A;  5IGE A;  4WRD A;  4A3J B;  3IFT A;  3DWQ A;  3X3M A;  4FS1 A;  1JKJ B;  3FKI G;  3J81 c;  1IZ6 A;  3SHL A;  3JRX A;  3U58 A;  4KN7 C;  1QCB D;  1SNO A;  2L15 A;  2X5R A;  4ABN A;  4QWC A;  4MTE A;  4DR4 L;  4EGQ A;  4HYK A;  1NMG A;  4X3U A;  1DV2 A;  4FFM A;  3V6J A;  2ASD A;  1HCZ A;  2NVY A;  4KY7 A;  1BCP D;  1MZB A;  2OTJ A;  1SYE A;  5CR5 A;  2R8J A;  1WJJ A;  1C4Q A;  4K2K A;  4DUY L;  2RKS A;  4RG1 A;  2K5W A;  2K28 A;  4FFN A;  2LXJ A;  3KBX A;  2O5I C;  1GYF A;  4JW0 A;  3MTS A;  2XGP A;  3OHX C;  4MN3 A;  4ECV A;  1HXY D;  5C3E H;  3TQT A;  1SYG A;  1E2Z A;  1T3N A;  1YJW A;  2JEA I;  2GN5 A;  3DMU A;  2B2V A;  3BAC A;  1OTC A;  3QZ8 A;  1VQP A;  2Z6K C;  1IXR A;  3U55 A;  1HPC A;  2FHT A;  5I4D A;  3H3V C;  2FK2 A;  2YU9 H;  1Y8N B;  1JR0 D;  1DYQ A;  3RLF A;  4G7Z C;  1ENF A;  1HFN A;  1AN7 A;  4A3G B;  1K9M C;  1Q12 A;  1JMC A;  1EYG A;  2F0H A;  4JVZ A;  3HOW H;  4K8I A;  4DV1 H;  4A3C G;  5KT6 A;  4OO1 G;  4UP7 A;  2A6E D;  2A68 D;  3OHA A;  1Y1V B;  5KFW A;  2PQE A;  3CCR A;  4GNX B;  1EY4 A;  4RH6 A;  3TRZ A;  4R8N A;  1E3P A;  3TEK A;  4J9Q A;  2BDN A;  3MC0 B;  2VXW A;  4JPB W;  2R7K A;  3SK4 A;  2JA5 B;  4LSA A;  1SND A;  3ULL A;  5DEH A;  2B63 A;  4FVM A;  4RZQ A;  2TSS A;  4K2L A;  2ODT X;  1NY4 A;  2KCM A;  5CBE E;  3WNZ A;  3T1H L;  4JV5 L;  3GTP B;  4BBS H;  3W1B A;  4C3I G;  1TWC B;  3OOC A;  2PYK A;  3WWJ A;  2E76 C;  1RYS A;  3K5O A;  3BG3 A;  4UY8 C;  2NZ1 D;  5LMU L;  4J9L A;  1A3T A;  3KF8 B;  2Q2T A;  4Q8E A;  2CH4 W;  2JA5 G;  4JBJ A;  2KHJ A;  4DNR B;  1IW7 D;  1K3R A;  3KF6 B;  5KKN B;  3J7A 5;  4JYA H;  1FL0 A;  1KTA A;  2B2W A;  3TY9 A;  1PH7 A;  1Z9F A;  5JJZ A;  1STH A;  4POG A;  4FE2 A;  1MIU A;  4JI5 L;  3SXH A;  3KFU A;  5CAE B;  1IYD A;  2NU7 B;  1H9S B;  4KD4 A;  1ONL A;  4JYA Q;  1AFP A;  3MHB A;  3RIZ A;  2R92 A;  1A2U A;  1Y14 B;  1CI3 M;  3H3V I;  1GHK A;  3SK6 A;  4F4Y A;  4JI0 H;  3GV5 B;  5IWA L;  3H09 A;  2A69 C;  1FNU A;  2EYO A;  2HHH L;  4I55 F;  5M3F B;  3HOX H;  4ECU A;  4ECT A;  4LFA L;  2F0F A;  5CGK A;  4QWA A;  5M5X B;  2UU9 Q;  3H4D A;  4IWY A;  3I4M G;  4GKJ L;  4KI0 A;  1XNQ H;  4ZRZ A;  3V4Z A;  3A56 A;  5KFT A;  1PH6 A;  2FXQ A;  4IZ8 A;  1I7L A;  3T7A A;  2MCT A;  2EJG C;  3GV6 A;  1EZ8 A;  1Q1E A;  5C4X B;  1YI2 A;  5LMN W;  3H0G A;  4FBT A;  1O80 A;  5HNE A;  3KOJ A;  3JZI A;  2HDM A;  1HR0 L;  1IBL Q;  2B8F A;  4ZQI A;  2Q8R E;  3HOU B;  1MI2 A;  2EVB A;  4XT3 B;  1F2Y A;  2A6E C;  3K8A A;  3R8B A;  4HQ6 A;  2FJZ A;  2K01 A;  5JUM A;  4DL3 A;  4JI4 Q;  4BY7 H;  2F0N A;  3CD6 A;  4YB8 B;  1HNX H;  3K5I A;  3KBG A;  2K6A A;  2D0O A;  4DR5 H;  2D9U A;  5ELO A;  1YNJ C;  4R4T A;  5M5Y H;  3PSI A;  1T5X D;  1F2Z A;  2YU9 A;  5DLQ E;  3JC6 6;  4A3I G;  4R4C A;  2F0E A;  3D4D A;  5LXT F;  4OXP A;  4DR2 Q;  2BE5 C;  4FXK C;  4CKE A;  1DXM A;  4G4K A;  4P72 A;  4DL4 A;  2L4N A;  5CC4 A;  3G8D A;  3NHH A;  2VB2 X;  3I4O A;  2AGP A;  1EIF A;  2A6H D;  4PMC A;  1HZA A;  3BQ2 A;  1IBK H;  2AHO B;  5E4W C;  4JI3 Q;  4LH7 A;  3T53 B;  3OYY A;  1HJP A;  1CM9 A;  5C44 H;  3BZD B;  1O7I A;  2XN9 C;  4DNI A;  4C2M B;  5FR9 A;  1JXL A;  1D7Q A;  4U6P A;  1SMY C;  4IAL A;  1FJG Q;  1AUV A;  1JOQ A;  2MNA A;  1U4L A;  4BBR B;  1D6E C;  2KJX A;  4ID6 A;  3CCL A;  1TWF H;  5CR3 A;  1Q1B A;  5IP9 H;  4IFD H;  4RNN A;  3GDE A;  4RGO S;  5J2U F;  4FBU A;  2K5D A;  1QNU A;  3MWE A;  4DAY B;  5LL6 b;  1L2Z A;  1UE5 A;  2WAQ E;  4ED6 A;  4XIG S;  1YBY A;  1IOV A;  4BY7 G;  4GN4 B;  2I5M X;  1CFM A;  5FKA C;  2BH2 A;  1YHB A;  3PO2 G;  4FFL A;  3S14 H;  4EQN A;  5T14 A;  1H9S A;  1EY9 A;  3GD7 A;  4CJ1 B;  2R7M A;  2WKD A;  2SEB D;  4C3I B;  1ZHQ A;  3MFH A;  3AU7 A;  2VPQ A;  2QGQ A;  2YZG A;  1HZ9 A;  3TII A;  4KD3 A;  2MJ8 A;  5BN5 A;  4B3M L;  5KFP A;  4DV4 Q;  3GTJ H;  1ICF B;  3NWT A;  1A48 A;  5M9O A;  1I6V C;  2BR0 A;  1MKH A;  3T99 A;  1X32 A;  1ET6 A;  1PTO C;  1PX2 A;  1XMO L;  1UNN C;  3FMA A;  3S15 B;  3K0Y A;  1IHZ A;  3JAM i;  1I94 Q;  2I5L X;  1IL2 A;  2V58 A;  3RV4 A;  4ZQ3 A;  1GUW A;  3HOX G;  4TVA B;  4MTD A;  3V6K A;  1XPO A;  2EJ0 A;  3KAL A;  3S1N H;  3QJY A;  5IYD G;  1TY2 A;  2AQ4 A;  4A3J H;  1I5F A;  1VMP A;  5I6W A;  3J81 j;  2COJ A;  3G6V A;  1TXY A;  4MTK A;  1PYW D;  5CV4 A;  4AQY L;  3JRW A;  5M3F G;  4JI7 Q;  3PCO B;  2F1M A;  1WRV A;  5I5W A;  4PDB A;  1UEA B;  4HN7 A;  1VQL A;  5KFN A;  1N33 Q;  1J6Q A;  4A3E B;  1K0S A;  2NVY B;  4JBK A;  4P75 A;  1UAP A;  2BQR A;  2V5A A;  1ULZ A;  1QVG A;  5AFW A;  1KDC A;  4L63 B;  4RKB A;  4I7H A;  4GNX C;  2JSO A;  3BVZ A;  1SCU B;  5IYD H;  4M0J A;  3OSP A;  3M9O B;  1B7Y B;  4DV7 Q;  1Q46 A;  3G6J B;  4Q43 A;  2IPK D;  1NTG A;  1X3G A;  5FLX L;  4A3D B;  3Q6S A;  1IYU A;  4EQP A;  1B44 D;  5DM6 3;  3H40 A;  1ESF A;  3GV3 A;  4FDB A;  5LOV F;  5I5S A;  4YQW A;  1RHP A;  2ZM6 L;  3GV7 B;  5JJL A;  3EPI A;  1HA6 A;  5IT9 W;  4FF4 A;  4IFD I;  2A6H C;  2K14 A;  4H44 C;  4KLK A;  1VQ9 A;  1WTH A;  3DTG A;  5FPR A;  4GC6 A;  3K59 A;  4YHH L;  1K73 C;  3MXN A;  3CCM A;  5FO9 B;  4QCL A;  5F9L A;  1WTR A;  3LX0 A;  4IR9 A;  2XWB B;  2RHS B;  3G48 A;  5D65 A;  1BJT A;  4X6A H;  1M8A A;  4Q0Y A;  1J5E Q;  3GTO H;  3EN2 A;  1BXT A;  2YRW A;  5C0X G;  2A74 C;  3GTQ A;  2F4I A;  5C0X I;  4N9T A;  2HVS A;  3KXY T;  1CHP D;  2Z9H A;  5C3E G;  5L1L A;  3L4J A;  4IRC A;  2EJM A;  1PV4 A;  3GTP A;  2JA7 H;  5C0X J;  2ZXO A;  3GQB A;  2HHF A;  3CP0 A;  3SK8 A;  4F8M A;  1SNM A;  1HUN A;  1HA5 A;  1NR2 A;  1TS5 A;  2R92 G;  4A93 H;  4DQN A;  3LWE A;  4YY3 L;  3DEO A;  3DTF A;  5IYB H;  3UZB A;  4ZCK A;  1Q8K A;  3NSW A;  4DAA A;  1VQF A;  1KIX A;  2ZJR A;  3C2P A;  1Q7Y C;  4ME5 A;  1SE4 A;  2PCF B;  2I0Q A;  2W9A A;  3L3O C;  2UUC Q;  2ZGI A;  2JEI A;  3UDI A;  1WD0 A;  1BBW A;  3S2D B;  2R92 B;  3EFX D;  3A0J A;  4DV5 Q;  4ED7 A;  5HV6 A;  1JIH A;  3ND9 A;  4R8U B;  4L5Q A;  1IBL H;  1BCP F;  3GTO B;  5BR8 H;  2YTY A;  5I5U A;  1EY8 A;  1JQY D;  3VA5 A;  4AYB B;  1Q8I A;  3BZC A;  2GVA A;  3TW7 A;  4IJH A;  2ZDG A;  2ASB A;  2E2I B;  1HNZ H;  1KXL A;  3FEW X;  1UWV A;  1TS4 A;  2UU9 H;  5DMX A;  1Q3L A;  2N88 A;  3HS0 C;  5TSS A;  4C3J B;  3VOT A;  3G8C A;  1TWG A;  4C3H B;  5LYJ F;  2DN8 A;  1SMY D;  4MV1 A;  1SLJ A;  4A3F G;  4DUZ H;  1D5M C;  4IHJ F;  2KUM A;  1X65 A;  4Q0F A;  4DU9 A;  1LTS D;  4NMZ A;  4LF9 Q;  3P7J A;  3RB6 A;  3GTL A;  1EU3 A;  3CQZ A;  4DV6 Q;  2BDO A;  3DM1 A;  2FLP A;  1RTO A;  4DKA C;  4TRD A;  4E6I A;  4POF A;  3R2I A;  5E1F A;  1CQF A;  1N33 H;  1V4Y A;  4K5X A;  3AMU A;  1RIP A;  1ASY A;  4M1U B;  3E5N A;  4FP5 D;  3HOY H;  1NJI C;  1OXX K;  3ONA B;  3JAM E;  1S5F D;  1Y1W H;  4GNX A;  1YNN D;  2ABJ A;  4IZO A;  3J7Z C;  1EYA A;  2VUM A;  5ELB A;  4JI2 H;  3FVQ A;  4DUY Q;  2C28 A;  4F7X A;  1SNP A;  2F0T A;  1GUS A;  2EDG A;  1PH4 A;  3G6E A;  4OX9 H;  3M4Q A;  5KFH A;  4QY7 A;  2YL2 A;  4DV3 Q;  3S1M H;  4B9X A;  5H80 A;  1B53 A;  4O1N A;  2R7F A;  1BGW A;  3TSS A;  2EQS A;  3QO2 A;  5DQG A;  3ULJ A;  2FPI B;  3NQI A;  4X66 L;  1RTN A;  3S9W A;  2RF4 A;  3TZU A;  4DAM A;  2LKV A;  4XYO A;  3RZO H;  1A63 A;  4NXN L;  4BY1 G;  1YNJ D;  3SEB A;  4LF6 Q;  4DLK A;  3M3Y B;  4A3B G;  3GIJ A;  3N6X A;  3V4S A;  2I87 A;  4XYQ A;  3M4O B;  4IUR A;  3K3V A;  4A75 A;  1V1O A;  2Q8I B;  3WOE A;  3N43 B;  5LA6 F;  1HHV A;  3L2P A;  4O7R A;  5L37 A;  4Q45 A;  1J8I A;  1EFW A;  5DLG A;  4OEM B;  2R85 A;  4J9S A;  2A19 A;  5KG0 A;  2W7P A;  1KLG D;  2I46 A;  5M3M G;  2HVQ A;  1B8A A;  2ZTE A;  2EYM A;  2Y0S B;  5A2Q W;  1H95 A;  2H4O A;  2CQO A;  2ZM6 Q;  1DIK A;  2QEJ C;  1JLL B;  3QOJ A;  1QZG A;  4IUV A;  1MSH A;  3PO2 H;  3TIG A;  1VQO A;  5KFG A;  4FU0 A;  1AUX A;  3HO8 A;  4YHH Q;  1LTR D;  4OWW B;  2R86 A;  3T51 B;  2FP4 B;  1K8G A;  3J80 W;  1GM5 A;  4RGN A;  3F2D A;  1E1T A;  5NUC A;  4LF8 L;  3G6X A;  1EFI D;  3BJY A;  1FVI A;  1CA5 A;  1J5E L;  3D6W A;  4JYA L;  4RUA A;  5EBC A;  3FDS A;  3ZJY C;  4O3Q A;  3HP3 A;  2B63 G;  4J9N A;  5DG8 A;  4HCE A;  5KG1 A;  1C8C A;  3NGD A;  2IL8 A;  3A7A B;  2A68 C;  2EJF C;  4HIM A;  1I1K A;  5L1I A;  2HHH Q;  5CB4 F;  2ZXR A;  5C4H A;  1X3Q A;  5KFR A;  2FMC A;  3S17 H;  2NU6 B;  4FGR A;  5IGD A;  1LT5 D;  4JI0 L;  2F0O A;  2K05 A;  5M5Y B;  2HHH H;  2JJQ A;  2CHB D;  3KLW A;  4IPD A;  2CQY A;  5JEA G;  4CDF C;  3J7Y W;  3C0F B;  1B3Q A;  1HZB A;  5FO7 B;  5COR A;  3FKI A;  4GKK H;  2PZT A;  1VAJ A;  1KNE A;  1VQE A;  2UXC L;  4FFO A;  2L55 A;  4EEY A;  3EVQ A;  4A3E G;  2A1H A;  3KRE A;  1XNQ L;  4JOI A;  5KIX A;  1EOV A;  3GJX B;  2F3I A;  4QJF A;  2FIN B;  3E9H A;  4GN5 A;  2ALY B;  4DR6 H;  5EOY A;  2V9W A;  2V4Q A;  1R9T H;  4LUV A;  4WJ4 A;  4JI4 H;  4DAP A;  4Y8V B;  3LGJ A;  1IW7 C;  1EZ1 A;  3M85 A;  2DAB A;  1SNC A;  4LF5 H;  4Q8F A;  5IGG A;  4B08 A;  2DLN A;  3UZO A;  1EEI D;  1DOL A;  5JVD F;  2F0G A;  3LWB A;  4EGV A;  3F2C A;  2DIK A;  4O2B F;  1GUT A;  2PZW A;  1LAC A;  2KEN A;  2VQD A;  1N56 A;  2W9B B;  3TP7 A;  1KJQ A;  2PMZ E;  1STB A;  2HQE A;  4CE5 A;  3I4N G;  1DV1 A;  4QWB A;  1GOZ A;  2LY7 A;  3ERO A;  1HNX L;  5C4X G;  3MVV A;  2WFW A;  4NXM L;  2BE5 D;  1ZQ7 A;  4DR1 Q;  3DM3 A;  2DPI A;  4A3M B;  3BA8 A;  4ULL A;  3I90 A;  3RNU A;  3GTQ H;  1DZ1 A;  2YRX A;  4DA2 A;  4LMY A;  1GSH A;  5I2Y A;  1CA6 A;  1ROD A;  1V8Q A;  2NN6 H;  4C2M H;  1D5Z C;  1A62 A;  4WOR A;  5LP6 F;  3C1F A;  4ZHQ F;  1A6X A;  3VPC A;  4S3S A;  4LFB L;  1VQB A;  3O13 A;  3D0F A;  3CCE A;  3RTX A;  5C4J H;  5GAG C;  4A3B H;  2SDF A;  4NB3 A;  1II3 A;  4M7E A;  4CBV A;  4CDD C;  3RGX A;  5KYI A;  4ED0 A;  4HJA A;  3V6H A;  1ET9 A;  1HTP A;  1ML0 D;  1LAB A;  3I55 A;  4NKL A;  1Y8O B;  3K58 A;  1Y1W B;  3RGZ A;  3RJ0 A;  3NTI A;  1M6V A;  4IIJ F;  3BYT B;  2JA9 A;  3NK9 A;  3HOY B;  1TWC A;  3HXL A;  3PW7 A;  3CW2 C;  5E4X A;  2Y0S E;  4H0L C;  3KLR A;  1HNW Q;  4HN2 A;  2BOS A;  2Z02 A;  4YY3 Q;  3FKI H;  2VUM G;  4XYL B;  3NBY B;  1RL2 A;  4DUZ Q;  1V51 A;  2UUC H;  4X65 H;  3EA6 A;  2VQF H;  1X3P A;  3E0J A;  4B3T H;  3K7U C;  2VW9 A;  4P74 A;  3WWI A;  1HRJ A;  2Y0S G;  1Y1V H;  1SRO A;  3CC2 A;  3JAM W;  4B3T Q;  3VA7 A;  5JVG 3;  1I94 H;  3KF8 A;  5GAH C;  5KG5 A;  2OXP A;  2R92 H;  1HNW H;  4IJL A;  1I3Q H;  4YP3 A;  2MFI A;  3H6M A;  5M3F H;  2PMZ A;  4IRD A;  2EIF A;  2JA6 H;  1Z7T A;  4Q5V A;  4FXD A;  4CMD A;  2VY3 A;  4EQO A;  4ILW A;  4QIW E;  1WTX A;  3TP5 A;  1V9P A;  2F0K A;  2WAQ B;  1DM0 B;  4BY1 H;  5G3L D;  2KSW A;  5DQI A;  2D0P A;  5K3W A;  4NXN Q;  4KHP H;  3MXG A;  4ZI7 F;  1AEX A;  5CYU A;  5KNB A;  1ZEQ X;  1UC8 A;  4DR4 H;  1BVS A;  2CQA A;  3KHG A;  4G57 A;  4UHV A;  3WDN A;  3RMH A;  5A35 A;  2O5J C;  2P0A A;  2LXK A;  1SEB D;  2NZH A;  1C0A A;  1VQ8 A;  2JQO A;  4J0M A;  1Y8P B;  1B04 A;  2FKL A;  2QIL A;  4DUY H;  2B2T C;  4X62 H;  5KS8 A;  1MGS A;  5KFO A;  1VMC A;  1S3O A;  4KHP Q;  4NXN H;  1GHJ A;  2F0I A;  3T16 A;  1LTI D;  3Q2O A;  3KYH C;  3BAB A;  4L6T B;  2FLN A;  2KEE A;  1EIY B;  3U4V A;  1LTT D;  2N49 A;  4CDC C;  3Q23 A;  3M4Y A;  2QKI C;  4HED A;  4YJ2 F;  1SFO H;  1EYD A;  2RGR A;  2JA8 G;  1CHQ D;  1VQJ A;  4LF6 H;  1K8M A;  4APV A;  4X66 Q;  3VYR A;  1E0B A;  5JQW A;  2XCP A;  2E2I H;  5IP7 H;  1ENC A;  1CKN A;  3BVM A;  4OWX B;  2QF7 A;  4ECQ A;  2SOB A;  2NYZ D;  4B3R Q;  3QOL A;  2BCO A;  5KFB A;  4YHH H;  3CPW A;  3GIM A;  3GV8 B;  1WOC A;  3PUV A;  2KVM A;  2J9G A;  3T9C A;  3N6R A;  5FJ8 H;  4KK7 A;  4A3D H;  5EJW A;  4R7R A;  1M0W A;  4JV0 A;  3KJP A;  2DNE A;  2VQE Q;  1W3S A;  2TMP A;  1TY0 A;  1I6H B;  1AZQ A;  1V1P A;  3KHH A;  2N8N A;  1I1M A;  2MO1 A;  3PQI A;  4LW1 A;  5J3B A;  1I4X A;  5M3M B;  1PFM A;  4RGT A;  4O81 A;  2KCN A;  2BH8 A;  2YZN A;  1SYD A;  1QVF A;  2W70 A;  1F77 A;  4RWS C;  1VQK A;  2NVX B;  4JV2 A;  1GUO A;  3IRB A;  5CV7 A;  4DL2 A;  2COG A;  3VPB A;  3QG1 A;  3TME A;  3GTM B;  2CW7 A;  1PFB A;  4AYB G;  5DQH A;  2KOL A;  4JI5 H;  1EY5 A;  3J7A V;  4UUG A;  1QB5 D;  3MFI A;  2EY1 A;  3UQ8 A;  2PVP A;  5FD5 A;  2GVB A;  3MR3 A;  4LF8 Q;  4R9W A;  1PRT F;  4NP5 A;  2HDL A;  3G71 A;  2J4X A;  1ESR A;  5K2M A;  1TQO A;  1S40 A;  2WE6 A;  2PN1 A;  2RSN A;  1E4E B;  1W6J A;  2K5H A;  3HOV B;  4IQZ A;  4V0B A;  4A3I H;  1X3F A;  2DNC A;  3I4L A;  2R7L A;  2Q8T A;  2VA3 A;  2AKW B;  2D2C C;  4DR3 Q;  1NR4 A;  4JBM A;  1KLU D;  5FLX c;  5C5J A;  3U9O A;  1I4G A;  4TSS A;  1X56 A;  2W6N A;  5IGB A;  5DGB A;  5LMN Q;  4I7A A;  1H9J A;  2UU9 L;  3J81 W;  4LF5 L;  2OH2 A;  2NZO A;  3RAQ A;  4DV0 Q;  2MGS A;  1EUD B;  3GO5 A;  3GTJ A;  1HR0 H;  4DUZ L;  1EY0 A;  2UXC Q;  5AJ3 L;  5GAE C;  5BWU A;  5K36 H;  3HRZ C;  1L2F A;  4BBR H;  5IYC G;  3A7L A;  1EYC A;  2CWA A;  2KCT A;  1PTO H;  3T9E A;  2ZJQ A;  1FJG H;  4ZAI A;  5D8D A;  1A3U A;  2MUY A;  3MR5 A;  2L5T A;  3IAY A;  3T56 B;  3A8K E;  3KDF B;  5DLF A;  2W8L A;  3BQ0 A;  4QL5 A;  4GOP A;  4RZR A;  4OL7 A;  2D62 A;  1PFN A;  2CW8 A;  3FPU B;  5E25 A;  5FO8 B;  2XIG A;  3D3R A;  4LFB H;  1CUK A;  5HBR B;  2WYO A;  4YR3 A;  4DV4 H;  2FPP B;  4CMF A;  3AFP A;  1IBM L;  1RK6 A;  5F9N A;  1PHJ A;  2J0T D;  3U4Z A;  3CVZ A;  1UNS A;  2X6L A;  1SE3 A;  2IW3 A;  3J81 E;  1KJJ A;  3JSL A;  3OPO A;  1I4P A;  1UE6 A;  1B70 B;  1HTL D;  3KUP A;  3MEF A;  4KKU A;  3GII A;  1Y1W A;  2XCA A;  3GIQ A;  2K33 A;  4KKS A;  2O03 A;  4Y52 H;  4GLW A;  1Q82 C;  1C30 A;  3VR2 A;  4R8I A;  1JT8 A;  4X3T A;  1SN8 A;  3GIP A;  1PFS A;  3Q24 A;  3ND8 A;  1GVP A;  1JB7 A;  3UI2 A;  1BR9 A;  1XTC D;  1XNR L;  4MA0 A;  4O7V A;  4JBW A;  2NWG A;  1BCP B;  4IOA A;  4RNM A;  3GTK B;  3HOV H;  1G8Z D;  4UP9 A;  3G6Y A;  5ELN A;  3Q8Q B;  1TWH A;  4Q44 A;  3OSN A;  5I9O A;  2HQL A;  5D3I B;  1T94 A;  2W6O A;  2Q2I A;  4O7N A;  4RB2 C;  2FB9 A;  2F0Q A;  3FRP B;  3R23 A;  4KJO A;  1Q81 C;  3D6C A;  5JVL A;  2B2U C;  3NUC A;  5M5X H;  2C9O A;  4HJ5 A;  2CFM A;  1BOS A;  2DJG C;  4NPS A;  2HUG A;  4B3M Q;  4GLV B;  2Z8L A;  4C3H G;  1YIJ A;  1BF4 A;  4ECY A;  4DV3 H;  4DR7 Q;  1JOK A;  3AQQ A;  4YAK B;  1TWA B;  4FF3 A;  3I2Z A;  1K3B C;  3V2T A;  5ISR A;  1G2T A;  4LF8 H;  1YJN A;  3S1Q H;  1KT8 A;  4YIJ A;  4A2B A;  1N48 A;  4X64 Q;  2EOT A;  3NBH A;  4JK1 C;  4XT1 B;  5EZY F;  1LYL A;  5I5Y A;  4DXF A;  4ECZ A;  4WJW A;  4J9P A;  2E2H A;  4K5V A;  4O2D A;  1SYC A;  2FLL A;  3MJF A;  1G6Z A;  2UUB Q;  2ZT9 C;  3T1H Q;  4JV5 Q;  3STB C;  2IX1 A;  4DAV A;  4X62 L;  1Y69 U;  2UXB Q;  3K0X A;  3T9A A;  2R7Z B;  3GTP H;  1PH3 A;  2IA6 A;  4HJ9 A;  5KFZ A;  1J9O A;  2DY8 A;  1M4V A;  1HR0 Q;  2DY7 A;  3SDZ A;  2UXC H;  4LUZ A;  2MO0 A;  1LLR D;  1IYJ B;  5KFY A;  1AH9 A;  4RU9 A;  3AX6 A;  2R7N A;  3SVM A;  4KHZ A;  4CJ2 C;  2F4V Q;  4A3G H;  1JWS D;  3GTG B;  1BBX C;  3BAA A;  3F2U A;  1IOW A;  2R8I A;  2ZM6 H;  1JB3 A;  1VQG A;  3HZX A;  1E4E A;  4A93 G;  3PUW A;  1GJX A;  3QR8 A;  3C1E A;  1YVC A; 
#chains in