2Q2TA

Structure of chlorella virus dna ligase-adenylate bound to a 5' phosphorylated nick
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
293
Chain Sequence
MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/dna
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
total genus 75
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2tA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2tA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2tA01
3UE0A 1VQGA 4LH6A 3M4QA 5JEAG 3I4NG 1CKOA 4OWXB 2PI2E 3H3VI 1X56A 4DV6L 1XMOQ 2E8GA 3TEHB 3S1RH 2R7FA 4GOPA 2LXKA 1AE2A 2K5HA 1N36Q 4B3TQ 1WCMH 1YIJA 2VUMH 4HIMA 4KHPL 1EQRA 4PZ7A 4X64L 1B8AA 4AIMA 1N34Q 4LF9Q 1VQNA 1CUKA 3PO2G 3S24A 2VQEQ 4UCVA 4JI3L 1UE7A 1PYSB 2YV5A 2R93G 2KBNA 3D0FA 4QIWE 1VQOA 1SN8A 5C4JH 1P8LA 5LMNQ 1CSPA 3K80C 5LMUL 2UXBL 2I5LX 2HT1A 2N49A 3UE1A 4GN5A 2UU9Q 1FJGL 2Z6KC 3BJUA 4YCVA 3RR5A 4LF5Q 5M3MG 1RIPA 4QL5A 2UUAL 1Y1VG 4DR2L 4DR7L 4DUZQ 3PUYA 1MJCA 1JT8A 4IJLA 3I4OA 4QGUA 3ICEA 4LUZA 4YHHQ 4RG1A 1KD1C 3PIOA 2BH8A 1HZ9A 1CKNA 3KDFA 2E5LL 1VS0A 3K0XA 1Z9FA 4QJFA 5M5YH 1EQQA 1IBLQ 4B3MQ 2ASBA 4DR5Q 3CC4A 1PH4A 3I2ZA 4GN3B 3U4ZA 1XK5A 4P74A 2AHOB 4A4IA 1N36L 3CC2A 1QVGA 2WP8J 2IX0A 2ZTDA 4UFZA 1VQCA 2VZAA 5JJIA 4YWLA 4A3GH 3UDGA 2VQEL 1NJIC 1V1QA 1I94L 4A3EH 3JSLA 1XNQQ 5IWAL 2IX1A 4LFBQ 5LMNL 1X6OA 3CMEA 1TWGH 4DV1L 2KCTA 4IPGA 4TVAB 3FP9A 1VQ4A 3GTOH 4LF5L 1K73C 2B63H 4DR4Q 3NBHB 5HGQA 2UXCL 3H0GG 2JQOA 4DUZL 5GROA 1TWCH 2MO0A 4YWMA 3S16H 2UUBQ 3CF5A 4DNIA 4YHHL 4DUYL 1BBUA 2JA5G 2HHHQ 3PN1A 4R4TA 3HOXG 1PYBA 1C9OA 4H02A 1JJCB 3S1QH 4B3ML 4A93G 1E3PA 2NZOA 3UDFA 1HZBA 2HIXA 4A3IG 1W2BA 2K14A 1X3FA 5HY6A 4L5SA 3M4OH 4QQBX 1BVSA 2QGQA 5IYBH 2PI2A 1S3OA 2BA0A 2I5MX 4BXXG 3AFPA 3BA8A 4UP7A 4EQ5A 5FLMH 2EQSA 1GKHA 1OXVA 5M5WH 4X62Q 5C0XJ 4JYAL 3CCLA 5GADC 4A3JG 1VQIA 2K5VA 4LUVA 3RLOA 3I56A 3CMAA 1XPOA 4B3RL 1TA8A 3G71A 1KQSA 2BA1A 5EAYA 1I6HH 3M4PA 1XNQL 5IP7H 5C0XG 4GNXC 1YZ6A 1DGSA 3B6YA 2ZJRA 4BBSG 1I3QH 1L1OB 5IP9H 1K8GA 1AH9A 3DM3A 2N78A 1J5EL 4GOPC 1HNXQ 2R7ZH 4GKJQ 3TY9A 4DR4L 1Q46A 3S14H 3J7ZC 1W3SA 4BY7H 2GVAA 4OWTB 1G6PA 4MZ9A 3HKZG 1WFQA 4PG3A 3VDYA 4DV2L 1KXLA 2HHHL 1EWIA 5FJ8H 1K9MC 3GTQH 1XPUA 2JA8H 3A0JA 4NPSA 2OQ0A 4YCUA 2JA6H 1WCMG 2VUMG 4A3DH 3SGIA 2F4VQ 1XPRA 4HIDA 4A3FH 1VQJA 5FLXc 4JI1Q 3G4SA 1XTDA 3A74A 3JSNA 1N33L 2D0OA 4BBRH 2LSSA 1WOCA 3CQZH 3I7FA 4X62L 4UY8C 2E2IH 1PH8A 1KL9A 1V9PA 1HR0Q 3KF6A 3JAMc 3PGZA 2B3GA 4LW1A 1EIFA 4B3RQ 4RMFA 2ATWA 1HNZQ 4OXPA 4GLVB 2Q2UA 5IYDH 4DRFA 1YJWA 5M3FH 4JV5Q 4EFBA 1A8VA 4PZ6A 4C2MH 1SFOH 4AYBG 1XNRQ 5AJ3L 1VQ9A 4B3SQ 4LF4L 1Y1WH 1Q86C 4JI6Q 4GKJL 3HOVH 3J80i 2NN6I 4AQYL 4A3CH 2K75A 1K8AC 2OTJA 1LM0A 5JEAJ 1NTGA 3H15A 1XMQQ 4DV3Q 2OCEA 4O2DA 1PH7A 4R4OA 2YTYA 5K36G 5IT9c 3ZJYC 2CCZA 1OTCA 3PIPA 3BAAA 2HQLA 4JI2Q 3RLFA 4A3GG 1EYGA 5D1PA 3J81i 3T1YL 3ER0A 1E7ZA 2VQFL 2E2HH 2DGYA 1KRTA 1SLJA 1HR0L 4DV5Q 3WWVA 4BY1H 3NEMA 1HNZL 1E22A 2NVYH 2ZJPA 1Q82C 2B63G 5H1SE 1VQKA 3PO3H 4POFA 2KCMA 4JV5L 4MNOA 1R9TH 5C4XH 1X3EA 2ZM6L 4JI6L 4IPCA 1X9NA 5C3EG 4DR3L 2PQAA 4OX9Q 4X6AH 3KF8B 2MFIA 4IPHA 3CCJA 3GJXB 3KFUA 2GVBA 4DV3L 2WAQE 1FVIA 4LFAQ 2NVXH 3GTMH 1JJ2A 4JI0Q 3M85A 4DV0Q 1EFWA 5IYBG 3CCSA 1IBKQ 3UDXA 3CAMA 2JA7G 5FLMG 4IJHA 3NBZB 4ME3A 1PV4A 3AEVA 1XMOL 3HOWH 1A63A 3K7UC 4GLXA 4B3TL 5C44H 2YTXA 3NELA 2I5HA 3CC7A 4PZ8A 5BR8Q 1PH1A 4IFDJ 4BA2I 4A3LG 5IP7G 1TXYA 3CCQA 2NZHA 1N34L 4YWKA 4LF9L 3KOJA 4JCVE 2NN6G 4DAYB 1VQBA 5IP9G 2N8NA 4IFDG 1TAEA 2R7ZG 1E24A 1VQHA 4JOIA 4KI0A 1PVOA 1AE3A 3STBC 2ALYB 5E7NA 2UU9L 3FKIH 3OW2A 1YJ9A 3RZOH 1B7YB 4X66Q 4DV7Q 5FJ8G 4JG2A 3J81j 1VQ5A 1JE5A 1YHBA 3MEFA 2YU9H 1TWFH 4EX5A 2JA6G 4IOAA 4A3DG 2Y0SG 4A3BH 1YI2A 3GTKH 2WB1E 3GDEA 2I0QA 1EUJA 4A3FG 4TQUS 1PHJA 4JI0L 1IBLL 4LFCQ 3HOZG 1X65A 3CPFA 4DR5L 3CPWA 4UPAA 1UE5A 4LWCA 4C3IH 1V43A 5GAGC 2D62A 5LMNW 1L2FA 3T1HQ 2AWNA 4X65Q 5FPRA 2EIFA 2ZTEA 4C3JH 3UDIA 1C0AA 1Q7YC 1HZCA 4JI5Q 4UCOA 4L5RC 5BR8L 4JI7Q 4UCTA 3S1MH 2K50A 1SROA 4GKKQ 3TY5A 3CCUA 1YITA 1K3RA 4LF6Q 2HVQA 3BZCA 5D1OB 4DV4Q 4A3KG 3EBEA 3BABA 2ES2A 4KLKA 4LFBL 1Y1VH 1Y1WG 3PSIA 1KIXA 3HOVG 4A3MH 2PNHA 1ASYA 2PMZE 3BA9A 1PH6A 4A3CG 3PUWA 3CCMA 1OXXK 1QUQB 4GNXB 1X54A 1K83H 4X66L 1FL0A 3ULPA 4DR1Q 2UUBL 3M3YH 2YTVA 1OXTA 4YCWA 3I55A 2RHQB 1YHAA 4HJ5A 4GOPB 1PH5A 4K0KQ 3GTJH 2JA9A 1XJVA 3A5ZB 1N32Q 3RN5A 4LF7Q 1SE8A 2A8VA 2ZTCA 4R4CA 3KJOA 3GTPH 1IBMQ 2D0PA 1Z47A 4DR6Q 2R7DA 4YY3Q 2JEBI 2XTIA 5GAEC 3T1HL 4POGA 1HJPA 4APVA 1H95A 3D31A 3M7NA 2K4KA 2Q2IA 3GTGH 4DKAC 4JBWA 4JI7L 1S72A 4BY1G 4UCSA 3F2BA 1NE3A 2AWOA 5IY0A 3BZKA 2Q2HA 4DV4L 5C4XG 2CQOA 2EXDA 3J7A5 4EFEA 4UCRA 2A1AA 3HKZE 3A5UA 1CKNB 1VQDA 1WYDA 3KDFB 5IYCH 1HNXL 4LF8Q 3VNNA 4AH6A 3J80c 1UEBA 1KHIA 4O0AA 3PCOB 3BU2A 3QWUA 1NBWA 1S40A 2VL6A 4DV6Q 4NXNQ 1QVFA 5ELNA 4EEQA 4DR1L 2JE6I 3RNUA 4A3IH 4OO1I 4KHPQ 2F52A 1PH2A 1KC8C 5IE8A 1VQ7A 1LYLA 4X64Q 4K0KL 1WJJA 1IZ6A 2VW9A 3ULLA 1VQEA 1Q1BA 4DAMA 3HOWG 1U0LA 3S2HH 4KHZA 1X3GA 4JOIC 3TRZA 4NXMQ 3PUVA 4Y7NH 2F4VL 4GLAC 3W1GA 4DR6L 1SR3A 3M9BA 3STBD 4JI1L 3E0EA 2MQHA 4XTCS 2N3SA 1TWAH 2WFWA 3PV0A 4GS3A 4A3EG 1FJGQ 1NMGA 1OXUA 5JJLA 4DR2Q 1SMXA 2AMCB 3KLWA 4P75A 1U5KA 3ERSX 2NVQH 4JI8Q 1QVCA 1UE1A 3CCVA 2RHSB 1B70B 1HZAA 2AKWB 2Z0SA 3FHWA 1L1OA 3FKIG 5GAHC 1J6QA 2IHFA 4HJ9A 2E5LQ 1NMFA 2R92H 1A62A 4C3HH 1XNRL 3TQYA 3W1BA 4B3SL 4LF8L 3CCRA 2JEAI 3CD6A 1VCIA 1HH2P 3HOYH 4QY7A 4IPDA 4NXNL 3S2DH 2JK8A 4A3BG 3GB8B 1YJNA 3TREA 1N8RC 2WAQG 1XMQL 1YNXA 2VNUD 3UQ8A 2ID0A 4A75A 1PH3A 1GM5A 5M5XH 1VQFA 2A19A 3S15H 4LNQA 1HR0W 1NY4A 3HOUH 4R1JA 4PMWA 2R6GA 3F2CA 1I94Q 4NXML 1K0RA 3RLNA 3L7ZC 1VQPA 3U4VA 4P71A 5IWAQ 4JI2L 2LXJA 4OONA 3GTLH 1PH9A 1Q1EA 4DV1Q 4BA1I 1WI5A 4P73A 2OTLA 4HJ7A 4L5QA 1G51A 2UXCQ 3I4MH 1YVCA 4J15A 4LUOA 1HNWQ 3K7AH 4A3MG 4JI8L 5C0XI 3OTOQ 4DV5L 5GQOA 1VQLA 4DUYQ 1IYJB 2RCNA 3TY8A 1MIUA 2E2JH 4OO1G 3AQQA 1B04A 1Q12A 4WJ4A 1Q8KA 4BY7G 2Q2TA 2HVSA 4HIKA 2KHIA 4OX9L 5J3BA 4DPGA 5ELOA 2F3IA 4MTNA 2JA8G 2QA4A 1L0WA 2K5NA 3I4NH 4LFAL 3E9IA 2WB1G 2JJQA 3MXNB 1VQAA 4HJ8A 4JYAQ 2HVRA 2XGTA 4DV0L 1FGUA 2H5XA 4XIGS 3E9HA 1QZHA 1IBKL 1KRSA 4JI4Q 3TS2A 1T9HA 4BBRG 3L0OA 4JC0A 2VY3A 3KF6B 1QZGA 1CSQA 4UP9A 4GNXA 3PO2H 3W5OA 4UP8A 3PUZA 1JB7A 2R93H 3JC66 2QEXA 1J5EQ 2IHEA 1E1OA 1YHQA 1LTLA 2CWAA 5IYDG 1TWHH 1BKBA 4LH7A 1HNWL 1KAWA 3KJPA 1C7YA 4CC6A 3KYHC 5M3FG 3TS0A 3OTOL 3EN2A 5M3MH 2VS1A 3CP0A 5IYCG 1VQ6A 4E6NA 5C3EH 4DV2Q 4FDBA 4DK6C 3CW2C 1D8LA 2Y0SE 3AYHB 2OQKA 3HKSA 4DK3C 4L5TA 1JJGA 3CCEA 3U58A 4P72A 1N9WA 2BH2A 2C35B 3EIVA 4DV7L 2Z6KA 1YBYA 1D7QA 2K52A 2JA7H 4R4IA 1N33Q 1GVPA 1VQ8A 3RTXA 1M90C 3LGJA 1MJEA 3U50C 2VUGA 3F8TA 5DISC 4LFCL 4JI4L 4WJ3M 1L1OC 4IOCA 3RN2A 1S68A 3NC0B 4A3LH 3NBYB 2V1CC 4X65L 2UUCQ 4NB3A 4JI5L 5AJ3Q 4HJAA 4GN4B 4LF4Q 2MO1A 3G6EA 4GKKL 1I5FA 2IT1A 4ALPA 2YYZA 1RL2A 4AQYQ 3PO3G 4CC5A 2R92G 4LF6L 1IL2A 2PQAB 3RZDH 1G291 3Q8DA 4IO9A 1GO3E 1Y14B 2CWPA 3H0GH 3IRBA 4R4QA 1SRUA 3H3VH 2GN5A 3HOYG 2UXDQ 5JJKA 3GD7A 1GD7A 3S1NH 3DLLA 1A0IA 2JA5H 1BBWA 3G48A 4HIOA 2CKZB 1EOVA 2ZJQA 3HOXH 3HOZH 3F1ZA 2NVTH 2KHJA 4A93H 2IY5B 1IXRA 2KENA 3T1YQ 2DUDA 1LUZA 3K81C 3HOUG 1E1TA 5DLQE 2L15A 2VQFQ 1JMCA 4BXXH 3L2PA 1CKMA 4A76A 3F2DA 1N32L 4LF7L 1UE6A 1ASZA 4Y52H 1MKHA 5C44G 3CXCA 4JI3Q 5FPOA 1IBML 3JAMi 4A3JH 3ULJA 4JBMA 3HFZB 4YY3L 1M1KC 1EIYB 2UUCL 3J81c 3I4MG 3K8AA 3PF4A 5LMUQ 2UXBQ 2OWOA 3AFQA 3PF5A 4A3KH 3NENA 1XDNA 1X55A 4AYBE 2ZM6Q 2UUAQ 4OWWB 1VQMA 1UWVA 3PUXA 2CFMA 4DR3Q 1Q81C 1PA6A 4BBSH 1PFSA 4DR7Q 5D1OA 3S17H 1O7IA 2RF4A 4IFDI 1P16A 2FXQA 1YEZA 2B29A 3GO5A 2MNAA 4JBJA 4JBKA 2HIVA 4UCUA 2UXDL 1I50H 1QUQA 3OYYA 1OXSC
chains in the Genus database with same CATH superfamily
5I6WA 1VQGA 1CQJB 2FPIB 1B9MA 5CR3A 1KDAA 3K5LA 1X56A 1XMOQ 3SK5A 2E8GA 2CW0C 3N40P 2CQAA 2K5HA 1YIJA 2WE6A 2VUMH 2RKSA 3NTIA 3SE0A 4PZ7A 4C5AA 4LF9H 1N34Q 3PO2G 2A6HD 3S24A 2VQEQ 4UCVA 4CDEC 4JI3L 4IRKA 4A3EB 1J9OA 4LK1C 3GLKA 5IGGA 4QIWE 1VQOA 4ZUIA 1SN8A 2B2TA 5BN4A 1GLVA 2W6PA 1P8LA 3UFXB 3DUZA 3UE1A 1L0XB 4YCVA 3Q2OA 4QL5A 4FF2A 5KFIA 4QWEA 4DA2A 2BQUA 3PUYA 2J6UA 4QGUA 1KTKA 1A3VA 1MGSA 2NZ1D 1I4HA 2COIA 5DGIA 1CKNA 5IGCA 4JI0H 2EY6A 5F9NA 2K33A 1VS0A 5DG8A 1UNSA 2BE5C 1Z9FA 2WAQB 4QJFA 3HKZA 2MJ8A 5IGDA 1LT4D 4DL3A 5D14A 3I2ZA 4ZAIA 5K36H 3U4ZA 4P74A 2AHOB 2GLTA 2W71A 1WCMA 2WP8J 2IX0A 4UFZA 4RGNA 1U9RA 5M5WB 4A3GH 3RBEA 4E6IA 2EIYA 2QYZA 2VQEL 3T53B 1NJIC 1XNQH 3MR6A 4MTEA 2HGSA 2ICEC 4LFBH 2IL8A 3OSOA 5L1KA 1TWGH 2KCTA 2CZGA 3GTOH 5T14A 3C1EA 5I5UA 1K73C 4QW9A 4DR4Q 5HGQA 2YYAA 2WDTA 5C6AA 1SNOA 2F0OA 5GROA 2EYHA 1H9JA 1TWCH 3K5HA 3HB9A 3BVGA 4DNIA 4DAVA 5JVLA 1K1QA 4NKLA 1IKLA 3I70A 5J1ZA 3PQIA 2IW3A 1JC7A 3GTJB 2B8FA 1JJCB 2JA8B 4IAJA 3UDFA 1W2BA 4NW2A 2K14A 2WB1B 3NQTA 1Y69U 4L5SA 2ODTX 1BVSA 2PI2A 3J80L 4R8NA 2Q8IB 3GTGB 4BBRB 1OXVA 4O3RA 1DOLA 4JYAL 5C3XA 1B2TA 4O84A 1MSHA 1PXUA 1XPOA 2DLNA 3G71A 1PRTB 4X3KA 4DV4H 1I6HH 3K3PA 4K6DA 2R8JA 2RQXA 4DNRB 1ENCA 1L1OB 5IP9H 1AH9A 3A56A 1SFOB 2N78A 2XGQA 4GOPC 2Y4RA 4DR4L 1EZ6A 3DWQA 4YR3A 3S14H 3J7ZC 4BY7H 5CGKA 4MZ9A 3HKZG 3H6MA 4DV2L 1S5FD 1KXLA 1EWIA 1PFMA 3A0JA 1WCMG 4DR6H 1XPRA 5FD5A 1DV1A 4A3FH 1VQJA 4XT3B 4ZKCB 1XTDA 1V1OA 1ZHSA 3JSNA 3MWMA 1TWAB 1GYFA 3TIGA 3A54A 3CQZH 1PH8A 2HDKA 1E2WA 1ZKOA 2VB3X 4F4WA 1Z6HA 1KL9A 1SE4A 3JAMc 2B3GA 4LW1A 1A3UA 1LTID 4XYQA 4LMQD 4DRFA 5M3FH 2R92B 1G2TA 4JV5Q 1CQIB 3LWUA 5H80A 1XNRQ 4EFBA 2OH2A 2H4OA 4B3SQ 3GILA 1E2VA 3HKZB 3SI8A 1ENAA 3P1HA 4NXNH 2VPQA 2K75A 1CHQD 3HOYB 1K8AC 3S2DB 1XMQH 5IODA 5JEAJ 1SMYC 3N42B 4R4OA 3RGXA 1STYA 5IT9c 1U4LA 2Z4IA 1HUMA 3PW7A 1Z2PX 3BAAA 3GV3A 5JQGF 1SYXB 2HQLA 5CE8A 1CFMA 1EYGA 2VOBA 3GV6A 5D1PA 5JJZA 5CR5A 5JPMC 2W9CA 1Q90A 1KRTA 1GUSA 3LX0A 3TQ1A 1VBGA 4CKBA 1ULZA 3BQ0A 3JAME 3SXHA 3WWVA 4BY1H 3NEMA 1C3OA 2NVYH 3PO3H 2PN1A 5H1SE 1S9FA 3X3MA 2E2JB 1CHPD 4JV5L 4MNOA 4C2MA 3OSNA 1Y1WA 4ZK9B 2AGOA 4X3UA 2PQAA 4R8UA 1PTOC 1FD7D 3GJXB 1V1PB 3KFUA 4FFPA 4XZ3B 2LFNA 2WAQE 1FVIA 4LFAQ 1JIHA 2NVXH 2EY2A 1F2LA 2ZXRA 1EY5A 4HSVA 3GTMH 4O7VA 4O2BF 1JJ2A 4JV1A 1EFWA 1IBKQ 3UDXA 2JA7G 2NYZD 3AEVA 3K7UC 4GLXA 3PW0A 3V96A 4CGYB 5KEEA 4WRDA 2R93B 4EQOA 2E2HA 5CV7A 5IP7G 2G5DA 2WIIB 4IRDA 1KDBA 4YWKA 3BJYA 4QW8A 3BQ2A 1H9SA 2IX3A 1QCBD 4IFDG 4KD4A 4RHRA 5KT4A 4FGRA 4JOIA 4KK7A 2MUYA 1AE3A 1R9TA 2F0FA 1D5XC 2K32A 1E4GT 2UU9L 1U4PA 4O83A 3KHRA 1JX4A 3KHLA 1IKMA 2P0AA 1B7YB 2B2WA 2WKCA 4X66Q 4JG2A 1CZGA 3MEFA 1STHA 1NCVA 2JA7B 2R6FA 4APMA 3UYYA 4RUAA 2WB1E 1EWCA 1N48A 1DD2A 1X65A 3NQIA 2AUKA 1V43A 5GAGC 1L2FA 1LT5D 3NWSA 3QOLA 3DXJC 5I4DA 4UCOA 4GKKH 4L5RC 2K1BA 1SROA 1Z2NX 3JZFA 4O7RA 2NUAB 3BZCA 3EBEA 1ENFA 2CVRA 2ES2A 3BABA 2W8LA 3VA7A 1Y1WG 3PSIA 3QG1A 4C5BA 3MFIA 1S5ED 5E4XA 4A3CG 3N8DA 3PUWA 1RK5A 4MA5A 5IYZF 2EYMA 3BVZA 4OO1H 2JA5B 4XYMB 4X66L 1FL0A 4DR1Q 2UUBL 2W6OA 2YTVA 1S97A 4A93B 4GOPB 4ECSA 3C1FA 2J7ZA 3PW4A 3GTJH 3T9AA 1SE8A 1JWUD 4R4CA 5A35A 3BACA 3MEHA 1E4EB 4YY3Q 4I7ZC 5GAEC 2XTIA 5DGHA 2XN9C 4APVA 1AUXA 3GTGH 1I6UA 4V190 3JZ6A 1F9SA 2IBKA 4HQ6A 4BBSB 3LWEA 3VA5A 4CDFC 1D5MC 2EXDA 4CMFA 3DM1A 2UVWA 3HKZE 2YZMA 3AU7A 4C3HB 1EIGA 3Q8SB 1TT2A 4TRDA 3J80c 1KHIA 4O0AA 2KECA 3PCOB 2CH4A 3BU2A 1NBWA 1S40A 2VL6A 2OXPA 5ELNA 5KT6A 2EYPA 4IZ8A 4DR1L 2W9BB 3RNUA 4KHPQ 2L5TA 1DV2A 2FK2A 4X64Q 2DY7A 1QNUA 3HOWG 1VQEA 3NE5B 4JI3H 2PW5A 1X3GA 3TRZA 4NXMQ 2PCFB 2IWHA 1NUCA 2F4VL 1SYFA 3W1GA 4IIJF 4Q0YA 2QW7A 1SR3A 3STBD 2IJ0A 2CNVA 2C2RA 4XTCS 1SJHD 2MQHA 1TWAH 1LT3D 1F2ZA 1B9NA 1HQMC 4DR2Q 1SMXA 2AMCB 1F2YA 1EKVA 1U5KA 4FU0A 3HO8A 1HZAA 1FNVA 5I9PA 2R92H 2IHFA 1EYDA 2E5LQ 1A62A 4KJNA 3TSSA 3W1BA 3J80E 3CD6A 5M5YB 4RWSC 1KNEA 1HH2P 3HOYH 3S2DH 4A3BG 3GIPA 3ZYYX 2L9HA 5I6YA 1YJNA 3R9RA 4Q4DA 1PH3A 2M2LA 4H13C 2FP4B 3HGBA 1VF7A 1TKWB 2QK4A 3U54A 3MXPA 1HRJA 1PTOB 2VQEH 4R1JA 4PMWA 1I94Q 4NXML 3RLNA 1U4MA 3L7ZC 4B9WA 5IWAQ 4K5VA 1VQPA 3TIIA 5CM0A 3T99A 4DV1Q 2LMCB 4BA1I 1I1LA 1WI5A 2OTLA 4L5QA 5BMVF 2AGPA 4RKLA 4ZUJA 1YVCA 1HNWQ 2RSOA 4J9PA 5E3FA 4A3MG 5C0XI 3D6CA 4DV5L 3RB0A 2PZTA 3TDQA 2IPKD 4XQQA 2E2JH 3AQQA 2FK1A 3ORQA 4CHTB 1B33N 3R23A 2PZUA 2Q2TA 2VA2A 3TQTA 3M4OB 5J3BA 3H40A 2K03A 5ELOA 4HSPA 2YRWA 4MTNA 1EFID 2QA4A 2K5NA 4NDXA 1DZ1A 4JYAH 4MA0A 1HTPA 4I55F 2XGTA 4DV0L 4LJZC 1AP0A 1KJ8A 2ZDQA 5F2DA 4QUFA 3L0OA 4JC0A 4OIJA 3KF6B 3SEBA 2YRXA 2YZNA 5LHY1 4FFNA 1YNJC 1I3QB 3FRPB 2R93H 3JC66 1J5EQ 1OWTA 4DR4H 2VB2X 2ZT9C 4F87A 2R7ZB 5KFUA 1HNWL 4ECXA 1DOMA 1RTNA 3KYHC 4YIJA 3CP0A 5LL6S 4DV2H 3G6JB 1STGA 2FLNA 2JXMB 4O82A 1QE6A 3MWDA 2JA6B 3KF8A 3CCEA 4A3DB 2BH2A 4O2AF 2Z6KA 1YBYA 1D7QA 3NXWA 2JA7H 1N33Q 1GUTA 4RNMA 3K6OA 4OEMB 5T1IA 1X3PA 1M90C 2HDMA 2VUGA 4FO2A 5DLFA 4KY7A 4DIMA 4UHVA 5CA1F 4XXEA 4R7RA 5KFBA 1SYBA 3DWPA 3JAMW 1I4GA 4JV0A 4JI5L 4O4JF 5AJ3Q 4IFDH 2XCLA 1I5FA 4I4TF 3HOVB 1RL2A 5J39A 2MP1A 3H20A 4HYKA 1HUNA 5KFKA 4IO9A 1E4FT 3S9WA 2R82A 1XWEA 4DK1A 1ZAUA 4TV9F 2AUJD 4IN3A 4IUUA 1A0IA 2JA5H 2O5IC 2F3VA 2CQYA 4O4LF 5IT9W 4DL6A 2ZJQA 4A93H 4PDBA 3VYSA 2KENA 3KAJA 3HOUG 2JSOA 5DLQE 3D3RA 4DF7A 3VOTA 1KBLA 1CKMA 4RAUC 4LF7L 4Y52H 1MKHA 5C44G 5FPOA 3NUCA 1IBML 5IOCA 1BGWA 5LXTF 3TP5A 1M1KC 4JV5H 3K8AA 2UXBQ 5LMUQ 2W6MA 3R8BA 3AFQA 3PF5A 5KKNB 2K5WA 5C4XB 1XDNA 1NNXA 1X55A 3MXUA 1G2WA 5KFEA 1I4PA 1UWVA 5T1GA 4DR3Q 4BBSH 1Q81C 3F2UA 4EBDA 1P16A 2NTTA 1SYEA 2EJFC 4QWDA 2MNAA 2HIVA 4JK1C 5ELDA 4EBCA 1QUQA 2PMZA 4LH6A 4OWXB 1ET6A 3T7AA 1VDZA 4DV6L 4H0LC 1WTPA 2LXKA 1AE2A 2DPJA 4B3TQ 2O03A 2XRSD 1B8AA 4AIMA 4C56C 2HD3A 4B9XA 1SNQA 1G91A 1DONA 3SNOA 2K01A 1HA5A 1PYSB 3D0FA 2BOSA 5LMNQ 2UXBL 5LMUL 1C4QA 2G9DA 2HT1A 2V5AA 3FMAA 2UU9H 1FJGL 3I3CA 3GTOB 1KJQA 5M3MG 1Y1VG 2NB0A 1JT8A 4IJLA 2B39A 4YHHH 2KUMA 1KD1C 3KDFA 1JLLB 4FXDA 3GTKB 4CMDA 4CJ1B 3TN2A 5M5YH 5ISRA 1IBLQ 2ASBA 3N44B 4DR5Q 2XCAA 4P2CB 4F4ZA 1SNMA 4C3IB 4A4IA 4HN2A 5DAAA 4ED2A 1VQCA 2LS01 2VZAA 5JJIA 1B1ZA 4PBCA 1GSOA 1PTOH 2OT2A 1BNZA 5KFWA 2PQEA 3UDGA 4DK0A 1YNND 1IYVA 2EJ2A 4L63B 2IX1A 1Y1VB 5LMNL 3HT5A 1X6OA 3VR5A 1V8QA 1ZEQX 3KHHA 2GPSA 3ETHA 4HTHA 1UEAB 3I12A 5FD6A 2R8KA 4ODGA 3NBHB 1GXDC 2JQOA 2WYOA 1S4ZA 2UUBH 1K83B 2MO0A 4BY7B 3M3YB 4DUYL 1BBUA 2HG8A 2DPIA 2JN4A 1IOWA 2HHHQ 3G6YA 4R4TA 3HOXG 1PYBA 1C9OA 1ZQ7A 3TZUA 2J6TA 1HZBA 1ZYRD 2HIXA 3M4OH 4QQBX 1X3FA 5HY6A 1HA6A 5FR9A 3GTPB 3R3OA 4BXXG 5IYBH 1S3OA 5CV5A 1TY0A 2DJFC 3AFPA 4UP7A 5FLMH 1AEXA 3R2TA 2EQSA 3V4ZA 1GHKA 1GKHA 2I46A 4X62Q 3KXYT 3BDCA 3CCLA 5GADC 4A3JG 2K5VA 4LUVA 1TA8A 1KQSA 1SYGA 1JOOA 1LO5D 2HDLA 1PLFA 3TBIB 1DGSA 1B4OA 1I3QH 1J8IA 1HNXQ 2R7ZH 2B63A 1VMPA 4FF3A 1Q46A 3K5NA 3J80W 4DR1H 3WWJA 1WFQA 2RA4A 3VDYA 1F9PA 2HHHL 5FJ8H 1S10A 2B2TC 2DNEA 1IW7D 4YCUA 4EG0A 2JA6H 2F4VH 4A3DH 1MI2A 4HIDA 1EUDB 4I7AA 4JI1Q 5DEHA 1GGOA 4TUYF 2LSSA 3I7FA 2MGSA 4X62L 3C3LA 3EJIA 4JV2A 1HR0H 1L2ZA 1AFPA 2NVQB 3T9CA 3LP8A 4JVZA 2K5QA 4B3RQ 4RMFA 4OXPA 3PO3B 5BN3A 1KDCA 3WOFA 5NUCA 4NLGA 4LF4L 4IUPA 1W6JA 3FVQA 3HOVH 4KHVA 3OHBA 2NN6I 2EPBA 2A68C 5TSSA 3N43B 4DV3H 2V4QA 3OSPA 3H15A 1LABA 4RH6A 2R7MA 4O2DA 1BR9A 1PH7A 5EOYA 1JICA 2YTYA 3OMGA 4RU9A 3GTQA 3OWFA 3URYA 4RNNA 5DM73 4M7EA 5C5JA 3S15B 4GZYC 1ONLA 4NZOA 4NXMH 2Y0SA 4KY6A 4JI2Q 1RF2D 3I4LA 2I87A 2R61A 3T56B 3T1YL 1EY4A 4TQRA 2COJA 1RDPD 1I6VC 5C1OA 3DEOA 2VQFL 2E2IA 4WFN3 5BYBA 1MHWC 2NTSA 3I4MB 5HNEA 1SLJA 3K7AB 4DV5H 3OOCA 3VYUA 4FFMA 4EYHB 4FF4A 4B3RL 1Q82C 3IFTA 2B63G 1KT8A 4A2BA 5KFXA 1VQKA 2KCMA 5C4XH 2X5RA 1X3EA 2WACA 2ZM6L 4IPCA 3QB3A 1DCZA 3X3NA 5C3EG 4CJ2C 4OX9Q 3BZDB 1BNCA 2GVBA 1T3NA 2F0SA 3OUUA 2XIGA 1BCPF 1WTOA 4DV0H 1I50A 3V6HA 4J9RA 2Q7DA 5EPLA 4HMJA 4ME3A 2EYLA 1XMOL 3BDLA 4HN7A 4RUCA 1A63A 4YR2A 2B2YA 3PO2B 5KFPA 3KHGA 5LL6b 5C44H 5DGBA 3NELA 3T9EA 2I5HA 4FM9A 4PZ8A 5BR8Q 4IFDJ 5KG1A 1FKAH 4BA2I 1N34L 1GHJA 2NN6G 4DAYB 2CW7A 2F0KA 1STAA 1TAEA 5KFFA 1WD0A 1E24A 1DYQA 1VQHA 3A7AB 4O4HF 3MA2B 5IGBA 2ALYB 4XDXA 2Q8RE 2QB5A 1AN8A 2XWBB 3OW2A 3Q24A 1AZPA 4LSXA 4DV7Q 1RYSA 1ET9A 3E5SA 2XC9A 1JE5A 4NP5A 1RTOA 2Y0SG 3HEJA 1YI2A 3GTKH 3GDEA 4N8X1 4TQUS 4LFCQ 1O7YA 1EUCB 5GONF 4PMBA 1STBA 4UPAA 1UE5A 4LWCA 4C3IH 5DQGA 1KNAA 2A6EC 4X65Q 3D4RA 1M6VA 2ZTEA 4EVOA 2L4NA 4TM5A 4JI5H 4IUVA 1HZCA 5BR8L 4K8JA 1SBBB 2RCFA 2W70A 1K3RA 4LF6Q 1SEIA 1F9QA 4A3KG 4KLKA 1Y1VH 2BDOA 3Q0AA 5E4WC 5BWWA 3RF2A 3BA9A 2PMZE 2FLLA 2D5DA 5IGFA 1OXXK 3FKIA 1EZ8A 3J81L 2DZDA 1ILQA 1K83H 5KRUA 3ULPA 2B8GA 3M3YH 2YU9A 4YCWA 3I55A 2CW8A 2RHQB 4KKUA 1TWFA 1ESRA 4K0KQ 3U55A 4YJ2F 4LF7H 1TS2A 3A5ZB 1N32Q 3RN5A 3C46A 4KN7C 1IBMH 2ZTCA 2O4XA 3GTPH 2D0PA 1Z47A 3LMLA 1CM9A 5KFNA 1EKFA 1RK6A 4WD3A 3GQBA 2A1HA 3KALA 1GJXA 1W96A 4QSHA 4UCSA 1TVXA 2UVUA 2AQ3B 4KJOA 1ML0D 2AWOA 4FBUA 1M4VA 4QCLA 3LULA 4CJ0B 5G3LD 1KEEA 2A1AA 3H4BA 2FKLA 1CKNB 1VQDA 4ZCKA 4LF8Q 4C1NI 1SNDA 5KFDA 3NPPA 2KEDA 4DV6H 3QWUA 5CV9A 3RBDA 3S1RB 2HHFA 2JE6I 2PBZA 1WCMB 1SDFA 2F03A 5LOVF 1KC8C 4K0KL 1LYLA 3NUAA 3A8JE 3PFFA 3R5XA 4QWCA 3GIQA 4KHZA 3VPDA 4JOIC 5JQWA 5A2QW 4L8JA 4XQNA 3M9BA 4RB0A 5EDWA 5C4JB 5DQIA 3E0EA 1FJGH 3PV0A 1HCZA 5KFJA 2B2WC 1OXUA 2VXWA 3KLWA 4P75A 2NVQH 3CU7A 2M05A 1PDQA 1ET0A 1QVCA 1I1KA 3FKIG 1LLRD 2AKWB 5GAHC 3VPCA 1NMFA 1XNRL 1B53A 5K3WA 4B3SL 4LF8L 2JEAI 1ESFA 1EWHA 4BWSC 3HRZC 3T13A 2EDGA 4ME6A 1T5EA 2JK8A 3GB8B 3TREA 1YNXA 3K5OA 1Q3LA 2ID0A 5CBAE 1GM5A 2R85A 2N55A 2FJ2A 2QKIC 1HXYD 1BCPC 3S15H 3AW8A 4LNQA 1HR0W 1NY4A 2A69C 3FPPA 2R6GA 3F2CA 4CDCC 3NP8A 3TW7A 1C8CA 2FJZA 4U673 4P71A 4OONA 1GSAA 5KFCA 5LMNH 1MBYA 1PH9A 4DL4A 4O3SA 4HJ7A 1G51A 2UXCQ 1IL8A 3I4MH 1S0MA 1LT6D 3K7AH 2IA6A 3OTOQ 4DUYH 1VQLA 1K1SA 1IYJB 3L3OC 4F8MA 1JDEA 1Q12A 2KJXA 3S1QB 5KS8A 3RFCA 2F3IA 4O42A 3RD4A 1N56A 1L0WA 4LFAL 3E9IA 4BWGB 1VQAA 4NYEA 2F4IA 3R93A 1FGUA 1QZHA 1IBKL 3E9HA 1RKNA 2R8IA 2V4RA 1QZGA 3PO2H 3W5OA 1EHIA 2FPGB 3G6VA 3PUZA 4DXFA 1JB7A 3KTMA 3A7LA 2IHEA 1E1OA 4LH7A 5IYDG 5FLXL 4KTAA 1BKBA 3HXLA 1HTLD 3TS0A 5KG5A 1EIHA 3OTOL 2A6HC 2EYFA 3PR5B 5IYCG 3EPIA 5C3EH 5K2MA 3MWEA 2HHHH 2GQRA 2EJ0A 2F0PA 3CW2C 4WORA 2Y0SE 5KFVA 1FR3A 4DK3C 4NZNA 4KY5A 1V4YA 4P72A 4YQWA 1T5XD 4MHEA 4ED1A 4RZRA 2K52A 4R4IA 1OBDA 3K58A 4X62H 4S3SA 4MV7A 1MJEA 3TMEA 3F8TA 1IYUA 4IOCA 2W9CB 3NC0B 2SOBA 2UUCH 3PW5A 3D6WA 5CAEB 1SYCA 3RMHA 2DN8A 4LF4H 4C2MB 1EY9A 1SSOA 1EL0A 5IGEA 2MO1A 3WDNA 2J9GA 3SK4A 1Y1WB 4ALPA 1TWHA 3HG9A 4AQYQ 5FO9B 2NU6B 2NWGA 2PQAB 4R8UB 5EKLA 2CWPA 1O78A 2UXDH 2L1BA 1EZ1A 2ASJA 1IOVA 2W6NA 1BBWA 2RDHA 2CKZB 3VR6A 1EY6A 3QJYA 3F1ZA 1SNPA 2NVTH 3Q8RB 3T1YH 4YR0A 2VQFH 1M0TA 1JMCA 5J2UF 4A76A 2E2HB 3F2DA 2RBMA 2KCNA 1UE6A 4JXUA 3RB3A 3FPUB 4B3RH 1H9SB 2N88A 3JAMi 3GV5B 4JBMA 4YY3L 3J81c 4I50F 3OIQA 4DLKA 4A3KH 1R9TB 2ZM6H 4RFBA 2QDLA 2F0LA 4OWWB 5E1FA 2UUAQ 1VQMA 4G57A 4DR7Q 5D1OA 1SJED 3MWYW 3KBGA 3H0GA 2FXQA 3EQLC 1YEZA 3E6ZX 4JW0A 3GO5A 4JBJA 3J7YW 4UCUA 1XTCD 1I50H 4GNXA 5I5TA 1M0WA 5JEAG 1BUVT 3I4NG 1CKOA 1UAPA 4HCEA 2PI2E 3H3VI 2AGQA 1XMOH 2JEJA 2SEBD 3TEHB 3Q22A 3S1RH 3HOWB 1WCMH 3M4YA 4KHPL 3VR2A 5I60A 2YS7A 2F0WA 4X64L 3T9DA 1N34H 5JVDF 3TW6A 3G7LA 4LF9Q 1VQNA 1VAJA 2NU8B 2YV5A 2IP4A 4MIUA 2L12A 1L0YB 3GIDA 1SXTA 2ALZA 1BCPB 5C4JH 3J81E 5COYA 2J4XA 2N49A 1B44D 2Z6KC 3BJUA 4LF5Q 5FNVF 1RIPA 2UUAL 4FF1A 1WTHA 4DR2L 4DR7L 4A2AA 1MJCA 3MVVA 1PRTD 3I4OA 3ICEA 1RODA 1A3GA 2HUGA 2F0VA 4RG1A 5KFLA 3PIOA 4OIKA 2BH8A 2E5LL 4A3BB 3IN5A 3K0XA 2VA3A 1GUNA 1EQQA 4B3MQ 3KREA 5DMXA 5KG2A 1PH4A 1DM0B 4K6LA 1E2ZA 2VPSA 5F9LA 1XX8A 3CC2A 2VUMA 1JOQA 5I5SA 2AU0A 2ZTDA 3V4SA 2EY5A 5KG6A 4YWLA 1HQRD 2B2VA 2F0EA 5BN5A 1I94L 2QILA 4ED8A 3GTLA 3L9AX 1XNQQ 2R7NA 4IWYA 5IWAL 4Q43A 4LFBQ 5CC4A 4A3MB 3CMEA 4DV1L 1KC7A 2R7KA 2OLSA 4TVAB 4LF5L 5KFGA 3H0GG 2J0TD 2WKDA 2BR0A 4AYBA 3I91A 4YWMA 3CF5A 3TP8A 5BWTA 1TU2B 2CHBD 5KFZA 1EU3A 2YS6A 4F50A 1QILA 3S1QH 1TY2A 4B3ML 1W93A 4XX0B 2NZOA 4A3IG 5EBDA 1S03G 4J9MA 2I5MX 2BA0A 1X32A 1STNA 2F1MA 3P20A 2DNCA 5CV4A 4EQ5A 3K57A 4HAEA 2D9UA 1V51A 5JVG3 2JEIA 2SCUB 3MAQA 3T5LA 3H09A 1AW7A 2BA1A 5EAYA 1C48A 2MPMA 3M4PA 1XNQL 1OBGA 5IP7H 5C0XG 4O7LA 5BWXA 4ED3A 1YZ6A 1TWGA 1QJOA 4O7WA 4KN4C 4QIWA 1K8GA 2KVMA 5EPKA 3DM3A 4O7NA 1J5EL 1D6EC 1W6KA 3BVMA 2PPBC 4GKJQ 3WNZA 2CW0D 3V2TA 1JORA 1TWCA 5CBEE 1PRTF 1W3SA 5C4HA 5KFAA 4OWTB 1G6PA 1TS4A 2FPPB 4B08A 3ORRA 3KLSX 2HCIA 1K9MC 1T94A 4RCOA 4ZRZA 3S2HB 2O2LD 4NPSA 3QO2A 2XNAC 2VUMG 4RGOS 4Y7NB 3K59A 4TSSA 2WTFA 5EWFA 2L0CA 5FLXc 3G4SA 1N33L 2X6LA 2AQ2B 3MXNA 3KBXA 1JOKA 4Q0FA 4UY8C 3BG5A 4E4TA 1B6RA 3UZBA 4RB3C 1QG7A 1V9PA 4Z9CB 4MV1A 3PGZA 1BXRA 4Q45A 4IHJF 5IYDH 4TVIA 4Q4CA 1YJWA 2BE5D 4TV8F 1XNRH 2BCOA 4YP3A 4PZ6A 4C2MH 4B3SH 4AYBG 4LF8H 5AJ3L 1VQ9A 5KG7A 1Y1WH 2WV6D 4JI6Q 4GKJL 3J80i 3SHLA 4A3CH 2B2UA 1PK8A 1LM0A 5L9XA 1TR5A 1S0OA 1XMQQ 2OCEA 3LQSA 3WOEA 5M5XB 4QWAA 5K36G 2X6GA 4U6PA 1DIKA 3DWAA 3I72A 2KHSA 4N9TA 1NR4A 3HOUB 4DQNA 3PIPA 4JUZA 4ZLTF 3HBLA 3W2DA 4A3GG 1VKZA 4MAMA 5FLXE 2UVVA 5EJWA 5DQHA 3J81i 5C44B 4O4IF 3CQZA 4FE2A 5FO8B 3P7JA 2E2HH 1XXGA 5EBCA 4DL5A 4LAAA 4POFA 1KLUD 1R9TH 3PZPA 2HQEA 4JI6L 3TP7A 1X9NA 4DR3L 3E0JA 1EOTA 2L55A 3KF8B 2MFIA 3BDOA 4K5WA 1Q8IA 3CCJA 4LFAH 3H4DA 2YZLA 1HFGA 5DNFA 3M85A 1IBKH 3SDZA 3H94A 1S5CD 4IJHA 2IMWP 4J6HA 3HOWH 4B3TL 5J2TF 3CC7A 5DAUA 1PH1A 2NBFA 3OTOH 2FHTA 3NSWA 4MV9A 1VQBA 5IP9G 2NVYA 5M3MB 4FFLA 1BO0A 1H9KA 5EKIA 1PVOA 2FE3A 3STBC 1A6XA 4G7HC 4HR7A 4X66H 1WTXA 3J7AF 1IYDA 1PZID 3I73A 3J81j 1YHBA 4G7OC 3P75A 1DOKA 2NVXA 4ED0A 3GTMA 4EX5A 4IOAA 3SE7A 5EPJA 1BF4A 4A3BH 2I0QA 1JB3A 1EUJA 4A3FG 1Z2OX 1IBLL 4DR5L 1K8MA 3RAQA 3M7GA 3T1HQ 2C00A 1HPCA 1VMCA 5J22A 3UDIA 1QB5D 2CNQA 3MFYA 4KMUC 2V9WA 4JI7Q 3S1MH 2K50A 4GKKQ 5LA6F 1I7NA 4OELB 3CCUA 1FGBD 1EQVA 1SMYD 3Q6SA 1YITA 1BJTA 1KTAA 2RDIA 3E3XA 3RV3A 4A3MH 1ASYA 1PH6A 3CCMA 4NMZA 4IUQA 4WJWA 4FYDA 4UUGA 2LKVA 3GQCA 1QUQB 2PMZB 3S1NB 4FFRA 2DIKA 4WHXA 5DG7A 5C3WA 1EY8A 3HOXB 2FMCA 2RDJA 1GSHA 5KYLA 3U9OA 1PH5A 4N8FA 3R5FA 2WAQA 3WO0A 2JA9A 1XJVA 4MTKA 2PVPA 5HURA 3KJOA 4WBNF 4HCSA 4YY3H 4A3JB 1IHZA 2R7DA 5IT9L 3T1HL 5BPFA 1CQFA 2I07B 3D31A 3M7NA 2KA7A 2K4KA 2Q2IA 4DKAC 4JBWA 4ECZA 4JI7L 3VMMA 2A74C 3J81W 2ZDGA 3RUPA 4BY1G 2V59A 5KGUA 1PTOD 4R8IA 3F2BA 2KSWA 3BZKA 5KFMA 5KG3A 2CQOA 5EWEA 3KLSA 1CK1A 1JXLA 2C2DA 4CKCA 3KDFB 1HNXL 2B2YC 1UEBA 3K3VA 2Z1CA 4J9SA 4G4KA 1F9RA 3IL8A 3FDSA 5M9OA 4KHPH 4A3IH 4OO1I 1PH2A 4X64H 1VQ7A 1JKJB 1WTQA 1IZ6A 2VW9A 4DAMA 3S2HH 2TSSA 3UZOA 5I5VA 2V4DA 4XT1B 4KKSA 2WB1A 3I8ZA 5HBRB 2Z9HA 4Y7NH 3PVXA 4GLAC 3MZ5A 4JI1L 1QWYA 1WD1A 3GTGA 1CA5A 2N3SA 2WFWA 2ZXPA 4A3EG 2UUAH 5C0XH 4DR2H 4DR7H 4EQPA 2EE1A 2FMAA 3NGDA 1EYCA 1ZETA 1UE1A 4RCNA 3CCVA 2RGRA 2RHSB 1JDBB 3U9TA 1B70B 2E5LH 1CT1D 2Z0SA 1L1OA 4KD3A 4HJ9A 2F3WA 3SK6A 3QFFA 1PYWD 5C8YF 4EBEA 4DL2A 1SFOA 3N6XA 4J9QA 3TQYA 5FOBB 1VCIA 2QEJC 1PX2A 1SYDA 2DABA 3EFXD 4IPDA 2BQ3A 1EEFD 1K3BC 1FNWA 3NTKA 1RJPA 3IG0A 2AQ4A 2WAQG 2VNUD 4A75A 5M5XH 1GUOA 2XWJB 2O5JC 3TEKA 5FK9C 3T16A 1VQFA 5ELEA 2EVBA 4HNVA 2A19A 4ECQA 1G8ZD 1I94H 3HOUH 2K5DA 4F4XA 2K7VA 1A9XA 1CZWA 5IWAH 1EY0A 3L4JA 4JI2L 3GTLH 3U4VA 4DL7A 2LXJA 2MCTA 4DV1H 5CV6A 1TWAA 1Q1EA 1EY7A 4LF5H 1JWSD 3D8GA 1HNWH 2B63B 1PZJD 4LUOA 1PTOF 3IAYA 3CVZA 5KG0A 2RGVA 4ILWA 3AMUA 3S16B 1WVLA 1B3QA 2EXZA 3TP6A 5C3EB 3TY8A 4OO1G 3BQ1A 2R92A 4WJ4A 1Q8KA 1M7JA 4B3MH 5D65A 2HVSA 4HIKA 2FINB 1H9RA 2KHIA 4OX9L 4DPGA 4ID6A 3L4KA 1KAAA 1MD2D 4ED6A 2JA8G 2EYJA 4Q8EA 5KT5A 3T4AC 3WWIA 2WB1G 3RJ0A 1GUWA 3QR8A 3SR1A 4HJ8A 3ERQA 5D3IB 5ELCA 4JYAQ 4I7HA 4JI4Q 4XIGS 2H5XA 1KRSA 3TS2A 4BBRG 4QWBA 4IWXA 3M9NB 2ZXOA 1CSQA 5I5XA 4RB2C 1A48A 4UP8A 5L1JA 1J5EH 2E2DC 4K5XA 3GV7B 1F77A 1TS5A 3KJPA 1C7YA 4NZMA 4CC6A 1RCVD 3EN2A 5M3MH 1VQ6A 3EA6A 3AX6A 1LTRD 4E6NA 1D1IA 4DV2Q 2KCCA 4YJ3F 2GA4B 4DK6C 4ECWA 1B6SA 3HKSA 3GTQB 4O3QA 1VBHA 3BYYB 3D4WA 3T5JA 3U58A 2Y0SB 2GPWA 1R4PB 1JE4A 4JPBW 4DV7L 1V1PA 2NVTB 1N33H 1GVPA 3MC0B 1O80A 4MN3A 4FS2A 5FLXW 4JI8H 2EY1A 5KFRA 3U50C 1LTSD 3VYTA 5DISC 4ZHQF 3F8NA 4Y8VB 2E2IB 4LFCL 4JI4L 5EZYF 2ATLA 2ICIA 4WJ3M 2DWCA 4PNYA 4DAAA 1IYEA 1S68A 5LYJF 2V1CC 4X65L 4TKOB 4CDDC 1A3TA 4NB3A 2R93A 1STEA 4A3KB 4GKJH 1LTBD 4GN4B 4FVMA 5FKAC 2IT1A 2YYZA 1DXMA 2K28A 2R92G 4LF6L 5HGTA 1IL2A 1AN7A 4RHSA 3R2IA 3T5HA 1GO3E 1YNNC 1SRUA 1TS3A 2GN5A 3BG3A 3HOYG 2DJGC 1I50B 1GD7A 3GD7A 3WWHA 3S1NH 3QIAA 5BWUA 2XSCA 3G48A 3NWTA 4HIOA 3DAAA 3HOXH 3K5MA 2KHJA 2JA7A 2KOLA 1IXRA 2JYOA 2IY5B 4FBTA 1LUZA 1E1TA 2ENBA 4BXXH 3L2PA 4ZOLF 1N32L 4F4YA 1D5ZC 4G3IA 3MJFA 1JCKB 1ZYRC 3ULJA 4A3JH 2CNUA 5DG9A 4H44C 1EIYB 5LMUH 5DGAA 2UXBH 1CA6A 1SE2A 4HEDA 3ETJA 4JI6H 1B50A 1GOZA 3J7AV 4DR3H 5BYAA 3PUXA 2CH4W 2F0NA 1PA6A 1PFSA 5ELBA 1O7IA 4IFDI 4O7SA 4ZQ3A 1O75A 4ABNA 1O7LA 1NSNS 3RB4A 5KG4A 2AQ1B 2DAAA 3UE0A 2JA5A 3M4QA 4O86A 5D3DA 3VR3A 3CSWA 4B3TH 1YNJD 2R7FA 4GOPA 1N36Q 2JEGA 4PV1C 4HIMA 1EQRA 1NAPA 1SE3A 1A0GA 5EWGA 4HNTA 5KFOA 1K0SA 1CUKA 2XGPA 4C3JG 4ECRA 1Z7TA 1D2BA 1UE7A 2F0DA 1IW7C 1WTWA 2KBNA 2R93G 1E4EA 2COGA 3V6JA 4ECVA 3DF7A 5CYUA 4CE5A 1CSPA 3K80C 1I4QA 2I5LX 3OHXC 3QOJA 4IR9A 4GN5A 2UU9Q 3RR5A 3FKIB 4ZI7F 5JVH3 3NK9A 1CQVA 3OIPA 4DU9A 4DUZQ 1I2LA 3RZOB 1CE8A 4LUZA 1LTAD 5JPNC 4YHHQ 4TQSA 2YU9B 3OMCA 5G3LF 4YB8B 2QF7A 2RVLA 3IKJA 1TWFB 4ECTA 3RAXA 1HZ9A 2A5HA 2Q8TA 4FFOA 1IBLH 1AZQA 3KK7A 4RB1A 5IT9E 4DR5H 1EU4A 1DAAA 3CC4A 4GN3B 2W9BA 1XK5A 2OF1A 2Z6BA 2W6QA 1N36L 5K5PA 3EPGA 4C3JB 1QVGA 3DEPA 1MSGA 3C0FB 1DJRD 4O1NA 4MTDA 3T9FA 1V1QA 1OO9B 4A3EH 3JSLA 2K04A 4L1KA 5KT7A 3W3AA 3OW7A 2PW7A 2QDBA 4IPGA 4X3TA 2L11A 3FP9A 1VQ4A 2B63H 3ITPA 4UDUC 2UXCL 1CS0A 4YAJB 3RB6A 1K28A 5L1IA 2YWVA 4DUZL 2FK3A 5JOBA 3S16H 2UUBQ 2HHFB 4YHHL 4K6NA 2JA5G 1K8OA 3PN1A 3V6KA 4H02A 4U68A 4A93G 1E3PA 3EROA 4M9UA 3AB9A 5JUMA 1T36A 1U4RA 2C28A 3T1HH 3QZ8A 2QGQA 4RGTA 3BA8A 2EZVA 5CV8A 1EYZA 4IRCA 4JI7H 4K14A 3ND9A 5C0XJ 1H9MA 5M5WH 3OHAA 2DY8A 2X69A 4O7TA 1VQIA 3RLOA 3CRLC 2VQDA 3I56A 3CMAA 4ETSA 2H1EA 4F88A 3H3VC 4EGQA 1QOHA 1E0BA 4J0MA 1FNUA 4GNXC 4H7BA 2SNMA 1JR0D 1PMRA 3B6YA 1LACA 2ZJRA 1S5BD 2NN6H 1LTGD 4BBSG 1HNXH 3QZ7A 2HJWA 3TY9A 1A2UA 2PO4A 1BOSA 3GP7A 1EEID 1ICWA 3WO1A 1PZKD 1WTRA 5KT3A 4C3HG 2GVAA 2XIWA 5C4ZA 2PNRC 4PG3A 4M1UB 1GUGA 1G2SA 3GTQH 1PFBA 4J9LA 1XPUA 2XRQD 4HMIA 2JA8H 3TINA 2OQ0A 3T51B 4PMCA 3SGIA 2F4VQ 3KAKA 3GIIA 4JI1H 4O3PA 1SCUB 5EKKA 2ASLA 3A74A 1UC8A 2F0UA 3RIZA 2D0OA 4BBRH 1ZHQA 1WOCA 4YBZB 2E2IH 1WRVA 1HR0Q 1RJRA 3KF6A 4J9OA 4PQXA 1TIID 1EIFA 1KJJA 2ATWA 5A2QL 1HNZQ 4GLVB 3HS0C 2Q2UA 2M00A 1I3QA 3JRWA 1A8VA 1SFOH 2R7ZA 2BDNA 4UAIA 1Q86C 4C5CA 4AQYL 5AFWA 3D4DA 3VYRA 1AUVA 2OTJA 4RGMA 5KFTA 1NTGA 4DN4M 4DV3Q 4RNOA 4DFAA 2B2VC 2W8KA 4DXGA 1BDOA 2EJ3A 1QNKA 1ZXTA 2KEEA 4F7XA 4N9PA 2JA6A 2EOTA 3ZJYC 2E75C 3TZDA 3JZIA 2W57A 1A2TA 2CCZA 1OTCA 4PWQA 4JI2H 3G8DA 3T5KA 3RLFA 3GV8B 4IQZA 4BS9A 2LY7A 1SAPA 2PZWA 3Q8QB 4CBVA 1F2MA 4O3OA 3PR4A 3ER0A 1E7ZA 1PFNA 4IALA 2DGYA 1RYRA 2I8CA 2F0HA 3VR4A 1Y8OB 1HR0L 4DV5Q 3KLRA 3OPOA 2C22A 1HNZL 1E22A 1C30A 2ZJPA 3DTFA 3M4IA 3O13A 4IURA 5D8DA 4LMYA 5CB4F 5JAVA 4Q44A 1O7ZA 4OL7A 4OX9H 2ZDHA 3EYYA 2YCHA 2C9OA 4X6AH 3M9MB 4OGQC 5KFYA 4K2KA 4IPHA 4DV3L 1RJTA 3I4NB 2EYOA 2QCPX 4JI0Q 4DV0Q 5IYBG 3CCSA 1II3A 1WR2A 3CAMA 5FLMG 3NBZB 4Q8FA 1PV4A 4KV6A 3A8KE 4EEYA 3ND8A 1D1KA 2HGWA 4MV3A 2YTXA 1EKPA 2M9VA 5BR8H 1KJIA 2ABJA 3BS1A 4A3LG 3S1MB 1TXYA 3CCQA 2NZHA 4LF9L 1TWHB 3KOJA 2RDFA 4JCVE 2ZGIA 5KNBA 4K8IA 1I2KA 2N8NA 3CEBA 2R7ZG 4KI0A 1KJ9A 5HV6A 2YL2A 5E7NA 2NU7B 2Z04A 3FKIH 4ZQIA 4RA8A 1YJ9A 3KUPA 1R4QB 3RZOH 3ONAB 4DV7H 3MFHA 5FJ8G 3JRXA 2ASDA 1VQ5A 1BXTA 2KQ3A 2YU9H 4XQJA 1TWFH 2JA6G 4A3DG 2GQSA 2C5CA 4RAZA 4LFCH 1TQOA 4JI4H 4JI0L 1PHJA 3HOZG 1SEBD 5BPHA 3QWNA 5L37A 3CPFA 1X3QA 3CPWA 4X65H 2R86A 2W6ZA 2D62A 5LMNW 5I5WA 2AWNA 2MHVA 3G6XA 2EIFA 2F0QA 4C3JH 2F0TA 2SNSA 4ULLA 2B2UC 3DHQA 1Q7YC 4JI5Q 1C0AA 4UCTA 4IR1A 2E76C 4XYLB 4RZQA 3TY5A 2A68D 5BWRA 3GIJA 2J6SA 4LF6H 1CTMA 2HVQA 3OUZA 5D1OB 3LNNA 4DV4Q 3RZDB 4LFBL 1KIXA 1VF5C 3H0GB 2Z4HA 3HOVG 2PNHA 3K0YA 2R3ZA 3MR5A 3GTOA 5KFHA 2VR1A 5KNCA 4GNXB 4ME5A 3T54A 1X54A 2PYKA 3R5HA 3BYTB 5JH7F 2SDFA 3HOZB 4ED7A 2R7LA 4YAKB 1OXTA 4EYIB 4K0KH 1YHAA 4HJ5A 4A3IB 3SVMA 4L6TB 3GTKA 3MTSA 3U0GA 1N32H 5KNDA 5C1PA 3FEWX 4LF7Q 2A8VA 5BWVA 1IBMQ 4DR6Q 2JEBI 5ELFA 4POGA 1H95A 4GLWA 1HJPA 3E5NA 1S72A 1I7LA 2X0SA 4DGZA 3FDTA 3VPBA 1NE3A 3S17B 5IY0A 2Q2HA 4DV4L 1ICFB 5C4XG 4X3SA 1Y1VA 3C2PA 3J7A5 4EFEA 4UCRA 3A5UA 2E74C 4EGVA 4G7ZC 1WYDA 5IYCH 3NBHA 4I65A 5KYIA 4AH6A 3VNNA 3U9SA 1UC9A 1S5DD 1K83A 4DV6Q 2F0IA 4NXNQ 1QVFA 1RJQA 2HCCA 3Q8PB 4EEQA 2R8HA 2F52A 2VUMB 3LWBA 3DTGA 3MFGA 5IE8A 5KFSA 2P5ZX 2FB9A 1WJJA 3GIMA 3ULLA 2W9AA 1Q1BA 1U0LA 3MR3A 2ZJTA 3RUZA 3PUVA 1BBXC 3NBIA 2W7PA 3GTPA 3Q23A 1JWMD 3GTLB 4DR6L 1UNNC 4CHIA 1EQTA 4GS3A 1FJGQ 1NMGA 3CKIB 5JJLA 2JP1A 4ZKBB 3ERSX 4JI8Q 3CRKC 4AYBB 2EJGC 5I47A 3FHWA 5LP6F 5FPRA 1J6QA 4FXKC 4C3HH 3CHBD 3H91A 3PIO3 3CCRA 4M8AA 1I4RA 2A6ED 3N41B 2YZGA 3T9BA 4QY7A 4NXNL 4ECYA 1N36H 1N8RC 1XMQL 2NU9B 3UQ8A 4M0JA 1HHVA 4C3IG 4A3GB 1WSCA 1CI3M 2F0MA 1WH2A 4IUNA 1K0RA 5I2XA 4KKTA 3V05A 2FMMA 1B3AA 5C5MA 4GC7A 1TWGB 1BQQT 2YW2A 4P73A 4QIWB 4LSAA 4J9KA 2UXCH 3A55A 2BQRA 3NHHA 4QUCA 4J15A 4DUZH 3EVQA 3RV4A 4O7ZA 4JI8L 1TWCB 5KFQA 5I5YA 1KUTA 5GQOA 4DUYQ 2RCNA 4J9NA 4MV4A 1MIUA 1FYCA 1B04A 5I9OA 4O3NA 4BY7G 4O7YA 5KT2A 3RGZA 5DM63 1S0NA 4MV6A 3MXGA 5JEAH 2XD4A 1SNCA 3I4NH 3MHBA 1KABA 5L1LA 2I80A 2JEFA 1KLGD 2JJQA 3MXNB 2HVRA 3SK8A 2F0GA 5A2QE 1WTVA 2V58A 3MR2A 1NR2A 3FMCA 2Z02A 1M8AA 1T9HA 1I6HB 3J7AK 3PMFA 2VY3A 2F0JA 2FFKB 2Z8LA 4EQNA 3NTHA 5DLGA 4UP9A 2WINB 2K6AA 4C1NK 5CORA 2QEXA 1Y8NB 1YHQA 1LTLA 1LV9A 2CWAA 1TWHH 2R8GA 1KAWA 4QB4A 5M3FG 4J8QA 4CKEA 3S14B 2VS1A 4FP5D 4FDBA 4J1MA 3G8CA 5EQ0A 3JAML 4FXGC 3K5IA 1D8LA 3AYHB 2OQKA 4QMGA 4L5TA 2RDGA 2C2EA 5IIFA 1JJGA 1N9WA 3A8IE 2C35B 3EIVA 4A3FB 1PRTC 1VQ8A 3RTXA 5CA0F 3IFDA 3M9OB 3LGJA 3CQZB 4RAYA 1JQYD 1LTTD 2EJMA 4V0BA 1L1OC 5I2YA 3RN2A 1Y8PB 4A3LH 3PW2A 3NBYB 3HZXA 1RD9D 2UUCQ 1I4XA 2A73B 5M3FB 4MV8A 3HP3A 5KIXA 2R84A 4HJAA 4LF4Q 3G6EA 4GKKL 4EGJA 4AQYH 2NUCA 3PO3G 1XYIA 2FLPA 4CC5A 4DAYA 4ZYSA 2UVRA 3RZDH 1G291 3Q8DA 4Q5VA 4QF4A 3Q1KA 1Y14B 3H0GH 3IRBA 4R4QA 4GC6A 4OHJA 1BCPD 4IZOA 3H3VH 3UI2A 2UXDQ 1G6ZA 2A69D 5JJKA 3DLLA 1UUPA 1EOVA 3HOZH 2TMPA 3N52A 3DMUA 2HGXA 3PIP3 3T1YQ 2DUDA 3K81C 1HFNA 5CMDA 3QQMA 5FO7B 2K05A 1EYAA 3N6RA 4IUTA 2L15A 1I1MA 2VQFQ 3GTJA 1ASZA 5KX5F 5EGTA 4JI3Q 3CXCA 1ILPA 2XVSA 2XCPA 1HNZH 3GIKA 4XYOA 3HFZB 4DNTB 4BY1B 2NVYB 2UUCL 3PF4A 4RKBA 3I4MG 2OEOA 2OWOA 2R87A 2G9HD 4FNFA 3NENA 2D2CC 4HR7B 4AYBE 2ZM6Q 5LL6X 2W7OA 3I90A 2CFMA 3S17H 2RF4A 4R9WA 1MZBA 4U7CA 4DAPA 4O81A 2RSNA 5E25A 4HNUA 4K2LA 2B29A 5C5LA 4JBKA 1RHPA 2NVXB 3GTMB 4FS1A 1A15A 2UXDL 3OWEB 4ECUA 3OYYA 1OXSC
chains in the Genus database with same CATH topology
1VQGA 1X56A 1XMOQ 2E8GA 3N40P 2K5HA 1YIJA 2WE6A 2VUMH 4PZ7A 4LF9H 1N34Q 3PO2G 3S24A 2VQEQ 4UCVA 4JI3L 4QIWE 1VQOA 1SN8A 1P8LA 3UE1A 4YCVA 4QL5A 3PUYA 4QGUA 1CKNA 4JI0H 1VS0A 1Z9FA 4QJFA 3I2ZA 3U4ZA 4P74A 2AHOB 2WP8J 2IX0A 4UFZA 4A3GH 2VQEL 1NJIC 1XNQH 4MTEA 2HGSA 4LFBH 1TWGH 2KCTA 3GTOH 1K73C 4DR4Q 5HGQA 2WDTA 5GROA 1TWCH 4DNIA 1JJCB 4IAJA 3UDFA 1W2BA 2K14A 4L5SA 1BVSA 2PI2A 1OXVA 4JYAL 1XPOA 3G71A 4DV4H 1I6HH 1L1OB 5IP9H 1AH9A 2N78A 4GOPC 4DR4L 3S14H 3J7ZC 4BY7H 4MZ9A 3HKZG 4DV2L 1KXLA 1EWIA 3A0JA 1WCMG 4DR6H 1XPRA 5FD5A 4A3FH 1VQJA 1XTDA 1ZHSA 3JSNA 3MWMA 1GYFA 3CQZH 1PH8A 1KL9A 3JAMc 2B3GA 4LW1A 4DRFA 5M3FH 4JV5Q 4EFBA 1XNRQ 4B3SQ 4NXNH 2K75A 1K8AC 1XMQH 5JEAJ 3N42B 4R4OA 3RGXA 5IT9c 3BAAA 1SYXB 1Z2PX 2HQLA 1EYGA 2VOBA 5D1PA 4JI8H 1KRTA 3WWVA 4BY1H 3NEMA 2NVYH 3PO3H 5H1SE 4JV5L 4MNOA 2PQAA 3GJXB 3KFUA 2WAQE 1FVIA 4LFAQ 2NVXH 3GTMH 1JJ2A 1EFWA 1IBKQ 3UDXA 2JA7G 3AEVA 3K7UC 4GLXA 5IP7G 4YWKA 4IFDG 4JOIA 1AE3A 1E4GT 2UU9L 1B7YB 4X66Q 4JG2A 3MEFA 4APMA 2WB1E 1X65A 1V43A 5GAGC 1L2FA 4UCOA 4GKKH 4L5RC 1SROA 1Z2NX 3BZCA 3EBEA 3BABA 2ES2A 1Y1WG 3PSIA 4A3CG 3PUWA 4X66L 1FL0A 4DR1Q 2UUBL 2YTVA 4GOPB 3GTJH 1SE8A 4R4CA 4YY3Q 5GAEC 2XTIA 4APVA 3GTGH 1I6UA 2EXDA 3HKZE 3J80c 1KHIA 4O0AA 3PCOB 3BU2A 1NBWA 1S40A 2VL6A 5ELNA 4DR1L 3RNUA 4KHPQ 4X64Q 3HOWG 1VQEA 4JI3H 1X3GA 3TRZA 4NXMQ 2F4VL 3W1GA 4Q0YA 1SR3A 3STBD 4XTCS 2MQHA 1TWAH 4DR2Q 1SMXA 2AMCB 1U5KA 1HZAA 2R92H 2IHFA 2E5LQ 1A62A 3W1BA 3CD6A 1HH2P 3HOYH 3S2DH 4A3BG 1YJNA 1PH3A 2VQEH 4R1JA 4PMWA 1I94Q 4NXML 3RLNA 3L7ZC 1VQPA 5IWAQ 4DV1Q 4BA1I 1WI5A 2OTLA 4L5QA 1YVCA 1HNWQ 4A3MG 5C0XI 4DV5L 2E2JH 3AQQA 2Q2TA 5J3BA 5ELOA 4MTNA 2QA4A 2K5NA 4JYAH 2XGTA 4DV0L 3L0OA 4JC0A 3KF6B 2R93H 3JC66 1J5EQ 4DR4H 1HNWL 3KYHC 3CP0A 4DV2H 3CCEA 2BH2A 2Z6KA 1YBYA 1D7QA 2JA7H 1N33Q 1M90C 2VUGA 4R7RA 3JAMW 4JI5L 5AJ3Q 1I5FA 1RL2A 3H20A 4IO9A 1E4FT 1A0IA 2JA5H 5IT9W 2ZJQA 4A93H 4PDBA 2KENA 3KAJA 3HOUG 5DLQE 1CKMA 4LF7L 4Y52H 1MKHA 5C44G 5FPOA 1IBML 1BGWA 1M1KC 4JV5H 3K8AA 2UXBQ 5LMUQ 3AFQA 3PF5A 1XDNA 1X55A 1UWVA 4BBSH 4DR3Q 1Q81C 1P16A 2MNAA 2HIVA 1QUQA 4LH6A 4OWXB 4DV6L 2LXKA 1AE2A 4B3TQ 2O03A 1B8AA 4AIMA 1PYSB 3D0FA 5LMNQ 2UXBL 5LMUL 2HT1A 2UU9H 3FMAA 1FJGL 5M3MG 1Y1VG 1JT8A 4IJLA 4YHHH 1KD1C 3KDFA 5M5YH 1IBLQ 2ASBA 3N44B 4DR5Q 4A4IA 1VQCA 2VZAA 5JJIA 3UDGA 2IX1A 5LMNL 1X6OA 5FD6A 3NBHB 2JQOA 2WYOA 2UUBH 2MO0A 4DUYL 1BBUA 2HHHQ 4R4TA 3HOXG 1PYBA 1C9OA 1HZBA 2HIXA 3M4OH 4QQBX 1X3FA 5HY6A 4BXXG 5IYBH 1S3OA 3AFPA 4UP7A 5FLMH 2EQSA 1GKHA 4X62Q 3KXYT 3CCLA 5GADC 4A3JG 2K5VA 4LUVA 1TA8A 1KQSA 1DGSA 1I3QH 1HNXQ 2R7ZH 1Q46A 3J80W 4DR1H 1WFQA 3VDYA 2HHHL 5FJ8H 4YCUA 2F4VH 2JA6H 4A3DH 4HIDA 4JI1Q 2LSSA 3I7FA 4X62L 1HR0H 1L2ZA 4B3RQ 4RMFA 4OXPA 4LF4L 3HOVH 2NN6I 3N43B 4DV3H 3H15A 4O2DA 5EOYA 1PH7A 2YTYA 4M7EA 4NXMH 4JI2Q 3T1YL 2VQFL 1SLJA 4DV5H 4B3RL 1Q82C 2B63G 4A2BA 1VQKA 2KCMA 5C4XH 1X3EA 2ZM6L 4IPCA 5C3EG 4OX9Q 2GVBA 2XIGA 4DV0H 4ME3A 1XMOL 1A63A 5LL6b 5C44H 3NELA 2I5HA 4FM9A 4PZ8A 5BR8Q 4IFDJ 1FKAH 4BA2I 1N34L 2NN6G 4DAYB 2CW7A 1TAEA 1E24A 1VQHA 2ALYB 3OW2A 4LSXA 4DV7Q 1JE5A 2Y0SG 1YI2A 3GTKH 3GDEA 4TQUS 4LFCQ 4UPAA 1UE5A 4LWCA 4C3IH 4X65Q 2ZTEA 4JI5H 1HZCA 5BR8L 1K3RA 4LF6Q 1SEIA 4A3KG 4KLKA 1Y1VH 3RF2A 3BA9A 2PMZE 1OXXK 1K83H 3ULPA 3M3YH 4YCWA 3I55A 2CW8A 2RHQB 4K0KQ 4LF7H 3A5ZB 1N32Q 3RN5A 1IBMH 2ZTCA 3GTPH 2D0PA 1Z47A 3LMLA 3KALA 4UCSA 2AWOA 2A1AA 1CKNB 1VQDA 4LF8Q 4DV6H 3QWUA 2JE6I 1KC8C 4K0KL 1LYLA 4KHZA 4JOIC 5A2QW 3M9BA 4RB0A 3E0EA 1FJGH 3PV0A 1OXUA 3KLWA 4P75A 2NVQH 1QVCA 3FKIG 2AKWB 5GAHC 1NMFA 1XNRL 4B3SL 4LF8L 2JEAI 4BWSC 2JK8A 3GB8B 3TREA 1YNXA 2ID0A 1GM5A 3S15H 4LNQA 1HR0W 1NY4A 2R6GA 3F2CA 4P71A 4OONA 5LMNH 1PH9A 4HJ7A 1G51A 2UXCQ 3I4MH 3K7AH 3OTOQ 4DUYH 1VQLA 1IYJB 1Q12A 2F3IA 1L0WA 4LFAL 3E9IA 1VQAA 1FGUA 1QZHA 1IBKL 3E9HA 1QZGA 3PO2H 3W5OA 3PUZA 1JB7A 2IHEA 1E1OA 4LH7A 5IYDG 3HXLA 1BKBA 3TS0A 3OTOL 5IYCG 5C3EH 2HHHH 3CW2C 2Y0SE 4DK3C 4P72A 2K52A 4R4IA 4X62H 4MV7A 1MJEA 3F8TA 4IOCA 3NC0B 2UUCH 4LF4H 2MO1A 4ALPA 4AQYQ 2PQAB 2CWPA 2UXDH 1BBWA 2CKZB 3F1ZA 2NVTH 3T1YH 2VQFH 1M0TA 1JMCA 4A76A 3F2DA 1UE6A 4B3RH 3JAMi 4JBMA 4YY3L 3J81c 4A3KH 2ZM6H 4OWWB 2UUAQ 1VQMA 4DR7Q 5D1OA 2FXQA 1YEZA 3GO5A 4JBJA 4UCUA 1I50H 4GNXA 1M0WA 5JEAG 3I4NG 1CKOA 1XMOH 3H3VI 2PI2E 3TEHB 3S1RH 1WCMH 4KHPL 4X64L 1N34H 1VQNA 4LF9Q 2YV5A 5C4JH 2N49A 2Z6KC 3BJUA 4LF5Q 1RIPA 2UUAL 4DR2L 4DR7L 4A2AA 1MJCA 3I4OA 3ICEA 4RG1A 3PIOA 2BH8A 2E5LL 3K0XA 1EQQA 4B3MQ 1PH4A 2VPSA 3CC2A 2ZTDA 4YWLA 1I94L 1XNQQ 5IWAL 4LFBQ 3CMEA 4DV1L 4TVAB 4LF5L 3H0GG 4YWMA 3CF5A 3S1QH 4B3ML 2NZOA 4A3IG 1S03G 2I5MX 2BA0A 4EQ5A 2BA1A 5EAYA 3M4PA 1XNQL 5IP7H 5C0XG 1YZ6A 1K8GA 3DM3A 1J5EL 4GKJQ 1W3SA 4OWTB 1G6PA 1K9MC 4NPSA 2VUMG 5FLXc 3G4SA 1N33L 4UY8C 4RB3C 1V9PA 3PGZA 5IYDH 1YJWA 1XNRH 4PZ6A 4C2MH 4B3SH 4AYBG 4LF8H 5AJ3L 1VQ9A 1Y1WH 4JI6Q 4GKJL 3J80i 4A3CH 1LM0A 1XMQQ 2OCEA 5K36G 3PIPA 4A3GG 3J81i 2E2HH 4POFA 1R9TH 4JI6L 1X9NA 4DR3L 3KF8B 2MFIA 3CCJA 4LFAH 3M85A 1IBKH 4IJHA 3HOWH 4B3TL 3CC7A 1PH1A 3OTOH 4MV9A 1VQBA 5IP9G 1PVOA 2FE3A 3STBC 4X66H 3J81j 1YHBA 4EX5A 4IOAA 4A3BH 2I0QA 1EUJA 4A3FG 1Z2OX 1IBLL 4DR5L 3T1HQ 3UDIA 4JI7Q 3S1MH 2K50A 4GKKQ 3CCUA 1YITA 1BJTA 4A3MH 1ASYA 1PH6A 3CCMA 1QUQB 1PH5A 2JA9A 1XJVA 3KJOA 4YY3H 2R7DA 3T1HL 3D31A 3M7NA 2K4KA 2Q2IA 4DKAC 4JBWA 4JI7L 3J81W 4BY1G 3F2BA 2KSWA 3BZKA 2CQOA 3KDFB 1HNXL 1UEBA 3K3VA 4KHPH 4A3IH 4OO1I 1PH2A 4X64H 1VQ7A 1IZ6A 2VW9A 4DAMA 3S2HH 4Y7NH 4GLAC 4JI1L 2N3SA 2WFWA 4A3EG 2UUAH 4DR2H 4DR7H 1UE1A 3CCVA 2RGRA 2RHSB 1B70B 2E5LH 2Z0SA 1L1OA 4HJ9A 3N6XA 3TQYA 1VCIA 4IPDA 3IG0A 2WAQG 2VNUD 4A75A 5M5XH 1VQFA 2A19A 1I94H 3HOUH 5IWAH 3L4JA 4JI2L 3GTLH 3U4VA 2LXJA 2MCTA 4DV1H 1Q1EA 4LF5H 1HNWH 4LUOA 3CVZA 2RGVA 3TY8A 4OO1G 4WJ4A 1Q8KA 4B3MH 2HVSA 4HIKA 2KHIA 4OX9L 4DPGA 3L4KA 2JA8G 2WB1G 3RJ0A 4JYAQ 4HJ8A 4I7HA 4JI4Q 4XIGS 2H5XA 1KRSA 3TS2A 4BBRG 1CSQA 4RB2C 4UP8A 1J5EH 3KJPA 1C7YA 4CC6A 3EN2A 5M3MH 1VQ6A 4E6NA 4DV2Q 4DK6C 3HKSA 3U58A 4DV7L 1N33H 1GVPA 5FLXW 3U50C 5DISC 3F8NA 4LFCL 4JI4L 4WJ3M 1S68A 2V1CC 4X65L 4NB3A 4GKJH 4GN4B 2IT1A 2YYZA 2R92G 4LF6L 1IL2A 1AN7A 1GO3E 1SRUA 2GN5A 3HOYG 3GD7A 1GD7A 3S1NH 3G48A 4HIOA 3HOXH 2KHJA 2IY5B 1IXRA 1LUZA 1E1TA 4BXXH 3L2PA 1N32L 4A3JH 3ULJA 2UXBH 1EIYB 5LMUH 4JI6H 4DR3H 3PUXA 1PA6A 1PFSA 1O7IA 4IFDI 1O75A 3UE0A 3M4QA 4B3TH 2R7FA 4GOPA 1N36Q 4HIMA 1EQRA 1CUKA 1UE7A 2R93G 2KBNA 3DF7A 1CSPA 3K80C 2I5LX 4GN5A 2UU9Q 3RR5A 4DUZQ 4LUZA 4YHHQ 1HZ9A 1IBLH 4RB1A 4DR5H 3CC4A 4GN3B 1XK5A 1N36L 1QVGA 3C0FB 4MTDA 1V1QA 4A3EH 3JSLA 4IPGA 3FP9A 1VQ4A 2B63H 2UXCL 4DUZL 3S16H 2UUBQ 4YHHL 2JA5G 3PN1A 4H02A 4A93G 1E3PA 3T1HH 2QGQA 3BA8A 4JI7H 5C0XJ 5M5WH 1VQIA 3RLOA 4ETSA 3I56A 3CMAA 4J0MA 4GNXC 3B6YA 2ZJRA 4BBSG 1HNXH 3TY9A 2GVAA 4PG3A 3GTQH 1XPUA 2JA8H 2OQ0A 3SGIA 2F4VQ 3KAKA 4JI1H 3A74A 3RIZA 2D0OA 4BBRH 1ZHQA 1WOCA 2E2IH 1HR0Q 3KF6A 1EIFA 2ATWA 1HNZQ 2Q2UA 4GLVB 1A8VA 1SFOH 1Q86C 4AQYL 2OTJA 1NTGA 4DV3Q 3ZJYC 2W57A 2CCZA 4JI2H 1OTCA 3RLFA 3ER0A 1E7ZA 2DGYA 1HR0L 4DV5Q 1HNZL 1E22A 2ZJPA 3M4IA 4LMYA 4OX9H 3EYYA 2YCHA 4X6AH 4IPHA 4DV3L 4JI0Q 4DV0Q 5IYBG 3CCSA 3CAMA 5FLMG 3NBZB 1PV4A 2YTXA 5BR8H 4A3LG 1TXYA 3CCQA 2NZHA 4LF9L 3KOJA 4JCVE 2N8NA 2R7ZG 4KI0A 5E7NA 3FKIH 1YJ9A 4DV7H 3RZOH 5FJ8G 1VQ5A 2YU9H 1TWFH 2JA6G 4A3DG 4RAZA 4LFCH 4JI4H 4JI0L 1PHJA 3HOZG 3CPFA 3CPWA 4X65H 2D62A 5LMNW 2AWNA 2EIFA 4C3JH 1C0AA 1Q7YC 4JI5Q 4UCTA 3TY5A 4RZQA 4LF6H 2HVQA 5D1OB 4DV4Q 4LFBL 1KIXA 3HOVG 2PNHA 4GNXB 1X54A 1OXTA 4K0KH 1YHAA 4HJ5A 1N32H 4LF7Q 2A8VA 1IBMQ 4DR6Q 2JEBI 4POGA 1H95A 1HJPA 1S72A 1NE3A 5IY0A 2Q2HA 4DV4L 5C4XG 3J7A5 4EFEA 4UCRA 3A5UA 1WYDA 5IYCH 3VNNA 4AH6A 4DV6Q 4NXNQ 1QVFA 4EEQA 2F52A 5IE8A 1WJJA 3ULLA 1Q1BA 1U0LA 2ZJTA 3PUVA 4DR6L 4GS3A 1FJGQ 1NMGA 5JJLA 3ERSX 4JI8Q 3FHWA 5FPRA 1J6QA 4C3HH 3CCRA 3N41B 4QY7A 4NXNL 1N36H 1N8RC 1XMQL 3UQ8A 1WH2A 1K0RA 4P73A 4LSAA 2UXCH 4J15A 4DUZH 4JI8L 5GQOA 4DUYQ 2RCNA 1MIUA 1B04A 4BY7G 3RGZA 3I4NH 2JJQA 3MXNB 2HVRA 1T9HA 3J7AK 2VY3A 4UP9A 2QEXA 1YHQA 1LTLA 2CWAA 1TWHH 1KAWA 5M3FG 2VS1A 4FDBA 1D8LA 3AYHB 2OQKA 4L5TA 1JJGA 1N9WA 2C35B 3EIVA 1VQ8A 3RTXA 3LGJA 4RAYA 1L1OC 3RN2A 4A3LH 3NBYB 2UUCQ 4HJAA 4LF4Q 3G6EA 4GKKL 4AQYH 3PO3G 4CC5A 3RZDH 1G291 3Q8DA 1Y14B 3H0GH 3IRBA 4R4QA 3H3VH 2UXDQ 5JJKA 3DLLA 1EOVA 3HOZH 3T1YQ 2DUDA 3K81C 2L15A 2VQFQ 1ASZA 4JI3Q 3CXCA 1HNZH 3HFZB 2UUCL 3PF4A 3I4MG 2OWOA 3NENA 4AYBE 2ZM6Q 2CFMA 3S17H 2RF4A 1MZBA 2B29A 4JBKA 2UXDL 3OYYA 1OXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE0 A;  1VQG A;  4LH6 A;  3M4Q A;  5JEA G;  3I4N G;  1CKO A;  4OWX B;  2PI2 E;  3H3V I;  1X56 A;  4DV6 L;  1XMO Q;  2E8G A;  3TEH B;  3S1R H;  2R7F A;  4GOP A;  2LXK A;  1AE2 A;  2K5H A;  1N36 Q;  4B3T Q;  1WCM H;  1YIJ A;  2VUM H;  4HIM A;  4KHP L;  1EQR A;  4PZ7 A;  4X64 L;  1B8A A;  4AIM A;  1N34 Q;  4LF9 Q;  1VQN A;  1CUK A;  3PO2 G;  3S24 A;  2VQE Q;  4UCV A;  4JI3 L;  1UE7 A;  1PYS B;  2YV5 A;  2R93 G;  2KBN A;  3D0F A;  4QIW E;  1VQO A;  1SN8 A;  5C4J H;  1P8L A;  5LMN Q;  1CSP A;  3K80 C;  5LMU L;  2UXB L;  2I5L X;  2HT1 A;  2N49 A;  3UE1 A;  4GN5 A;  2UU9 Q;  1FJG L;  2Z6K C;  3BJU A;  4YCV A;  3RR5 A;  4LF5 Q;  5M3M G;  1RIP A;  4QL5 A;  2UUA L;  1Y1V G;  4DR2 L;  4DR7 L;  4DUZ Q;  3PUY A;  1MJC A;  1JT8 A;  4IJL A;  3I4O A;  4QGU A;  3ICE A;  4LUZ A;  4YHH Q;  4RG1 A;  1KD1 C;  3PIO A;  2BH8 A;  1HZ9 A;  1CKN A;  3KDF A;  2E5L L;  1VS0 A;  3K0X A;  1Z9F A;  4QJF A;  5M5Y H;  1EQQ A;  1IBL Q;  4B3M Q;  2ASB A;  4DR5 Q;  3CC4 A;  1PH4 A;  3I2Z A;  4GN3 B;  3U4Z A;  1XK5 A;  4P74 A;  2AHO B;  4A4I A;  1N36 L;  3CC2 A;  1QVG A;  2WP8 J;  2IX0 A;  2ZTD A;  4UFZ A;  1VQC A;  2VZA A;  5JJI A;  4YWL A;  4A3G H;  3UDG A;  2VQE L;  1NJI C;  1V1Q A;  1I94 L;  4A3E H;  3JSL A;  1XNQ Q;  5IWA L;  2IX1 A;  4LFB Q;  5LMN L;  1X6O A;  3CME A;  1TWG H;  4DV1 L;  2KCT A;  4IPG A;  4TVA B;  3FP9 A;  1VQ4 A;  3GTO H;  4LF5 L;  1K73 C;  2B63 H;  4DR4 Q;  3NBH B;  5HGQ A;  2UXC L;  3H0G G;  2JQO A;  4DUZ L;  5GRO A;  1TWC H;  2MO0 A;  4YWM A;  3S16 H;  2UUB Q;  3CF5 A;  4DNI A;  4YHH L;  4DUY L;  1BBU A;  2JA5 G;  2HHH Q;  3PN1 A;  4R4T A;  3HOX G;  1PYB A;  1C9O A;  4H02 A;  1JJC B;  3S1Q H;  4B3M L;  4A93 G;  1E3P A;  2NZO A;  3UDF A;  1HZB A;  2HIX A;  4A3I G;  1W2B A;  2K14 A;  1X3F A;  5HY6 A;  4L5S A;  3M4O H;  4QQB X;  1BVS A;  2QGQ A;  5IYB H;  2PI2 A;  1S3O A;  2BA0 A;  2I5M X;  4BXX G;  3AFP A;  3BA8 A;  4UP7 A;  4EQ5 A;  5FLM H;  2EQS A;  1GKH A;  1OXV A;  5M5W H;  4X62 Q;  5C0X J;  4JYA L;  3CCL A;  5GAD C;  4A3J G;  1VQI A;  2K5V A;  4LUV A;  3RLO A;  3I56 A;  3CMA A;  1XPO A;  4B3R L;  1TA8 A;  3G71 A;  1KQS A;  2BA1 A;  5EAY A;  1I6H H;  3M4P A;  1XNQ L;  5IP7 H;  5C0X G;  4GNX C;  1YZ6 A;  1DGS A;  3B6Y A;  2ZJR A;  4BBS G;  1I3Q H;  1L1O B;  5IP9 H;  1K8G A;  1AH9 A;  3DM3 A;  2N78 A;  1J5E L;  4GOP C;  1HNX Q;  2R7Z H;  4GKJ Q;  3TY9 A;  4DR4 L;  1Q46 A;  3S14 H;  3J7Z C;  1W3S A;  4BY7 H;  2GVA A;  4OWT B;  1G6P A;  4MZ9 A;  3HKZ G;  1WFQ A;  4PG3 A;  3VDY A;  4DV2 L;  1KXL A;  2HHH L;  1EWI A;  5FJ8 H;  1K9M C;  3GTQ H;  1XPU A;  2JA8 H;  3A0J A;  4NPS A;  2OQ0 A;  4YCU A;  2JA6 H;  1WCM G;  2VUM G;  4A3D H;  3SGI A;  2F4V Q;  1XPR A;  4HID A;  4A3F H;  1VQJ A;  5FLX c;  4JI1 Q;  3G4S A;  1XTD A;  3A74 A;  3JSN A;  1N33 L;  2D0O A;  4BBR H;  2LSS A;  1WOC A;  3CQZ H;  3I7F A;  4X62 L;  4UY8 C;  2E2I H;  1PH8 A;  1KL9 A;  1V9P A;  1HR0 Q;  3KF6 A;  3JAM c;  3PGZ A;  2B3G A;  4LW1 A;  1EIF A;  4B3R Q;  4RMF A;  2ATW A;  1HNZ Q;  4OXP A;  4GLV B;  2Q2U A;  5IYD H;  4DRF A;  1YJW A;  5M3F H;  4JV5 Q;  4EFB A;  1A8V A;  4PZ6 A;  4C2M H;  1SFO H;  4AYB G;  1XNR Q;  5AJ3 L;  1VQ9 A;  4B3S Q;  4LF4 L;  1Y1W H;  1Q86 C;  4JI6 Q;  4GKJ L;  3HOV H;  3J80 i;  2NN6 I;  4AQY L;  4A3C H;  2K75 A;  1K8A C;  2OTJ A;  1LM0 A;  5JEA J;  1NTG A;  3H15 A;  1XMQ Q;  4DV3 Q;  2OCE A;  4O2D A;  1PH7 A;  4R4O A;  2YTY A;  5K36 G;  5IT9 c;  3ZJY C;  2CCZ A;  1OTC A;  3PIP A;  3BAA A;  2HQL A;  4JI2 Q;  3RLF A;  4A3G G;  1EYG A;  5D1P A;  3J81 i;  3T1Y L;  3ER0 A;  1E7Z A;  2VQF L;  2E2H H;  2DGY A;  1KRT A;  1SLJ A;  1HR0 L;  4DV5 Q;  3WWV A;  4BY1 H;  3NEM A;  1HNZ L;  1E22 A;  2NVY H;  2ZJP A;  1Q82 C;  2B63 G;  5H1S E;  1VQK A;  3PO3 H;  4POF A;  2KCM A;  4JV5 L;  4MNO A;  1R9T H;  5C4X H;  1X3E A;  2ZM6 L;  4JI6 L;  4IPC A;  1X9N A;  5C3E G;  4DR3 L;  2PQA A;  4OX9 Q;  4X6A H;  3KF8 B;  2MFI A;  4IPH A;  3CCJ A;  3GJX B;  3KFU A;  2GVB A;  4DV3 L;  2WAQ E;  1FVI A;  4LFA Q;  2NVX H;  3GTM H;  1JJ2 A;  4JI0 Q;  3M85 A;  4DV0 Q;  1EFW A;  5IYB G;  3CCS A;  1IBK Q;  3UDX A;  3CAM A;  2JA7 G;  5FLM G;  4IJH A;  3NBZ B;  4ME3 A;  1PV4 A;  3AEV A;  1XMO L;  3HOW H;  1A63 A;  3K7U C;  4GLX A;  4B3T L;  5C44 H;  2YTX A;  3NEL A;  2I5H A;  3CC7 A;  4PZ8 A;  5BR8 Q;  1PH1 A;  4IFD J;  4BA2 I;  4A3L G;  5IP7 G;  1TXY A;  3CCQ A;  2NZH A;  1N34 L;  4YWK A;  4LF9 L;  3KOJ A;  4JCV E;  2NN6 G;  4DAY B;  1VQB A;  5IP9 G;  2N8N A;  4IFD G;  1TAE A;  2R7Z G;  1E24 A;  1VQH A;  4JOI A;  4KI0 A;  1PVO A;  1AE3 A;  3STB C;  2ALY B;  5E7N A;  2UU9 L;  3FKI H;  3OW2 A;  1YJ9 A;  3RZO H;  1B7Y B;  4X66 Q;  4DV7 Q;  5FJ8 G;  4JG2 A;  3J81 j;  1VQ5 A;  1JE5 A;  1YHB A;  3MEF A;  2YU9 H;  1TWF H;  4EX5 A;  2JA6 G;  4IOA A;  4A3D G;  2Y0S G;  4A3B H;  1YI2 A;  3GTK H;  2WB1 E;  3GDE A;  2I0Q A;  1EUJ A;  4A3F G;  4TQU S;  1PHJ A;  4JI0 L;  1IBL L;  4LFC Q;  3HOZ G;  1X65 A;  3CPF A;  4DR5 L;  3CPW A;  4UPA A;  1UE5 A;  4LWC A;  4C3I H;  1V43 A;  5GAG C;  2D62 A;  5LMN W;  1L2F A;  3T1H Q;  2AWN A;  4X65 Q;  5FPR A;  2EIF A;  2ZTE A;  4C3J H;  3UDI A;  1C0A A;  1Q7Y C;  1HZC A;  4JI5 Q;  4UCO A;  4L5R C;  5BR8 L;  4JI7 Q;  4UCT A;  3S1M H;  2K50 A;  1SRO A;  4GKK Q;  3TY5 A;  3CCU A;  1YIT A;  1K3R A;  4LF6 Q;  2HVQ A;  3BZC A;  5D1O B;  4DV4 Q;  4A3K G;  3EBE A;  3BAB A;  2ES2 A;  4KLK A;  4LFB L;  1Y1V H;  1Y1W G;  3PSI A;  1KIX A;  3HOV G;  4A3M H;  2PNH A;  1ASY A;  2PMZ E;  3BA9 A;  1PH6 A;  4A3C G;  3PUW A;  3CCM A;  1OXX K;  1QUQ B;  4GNX B;  1X54 A;  1K83 H;  4X66 L;  1FL0 A;  3ULP A;  4DR1 Q;  2UUB L;  3M3Y H;  2YTV A;  1OXT A;  4YCW A;  3I55 A;  2RHQ B;  1YHA A;  4HJ5 A;  4GOP B;  1PH5 A;  4K0K Q;  3GTJ H;  2JA9 A;  1XJV A;  3A5Z B;  1N32 Q;  3RN5 A;  4LF7 Q;  1SE8 A;  2A8V A;  2ZTC A;  4R4C A;  3KJO A;  3GTP H;  1IBM Q;  2D0P A;  1Z47 A;  4DR6 Q;  2R7D A;  4YY3 Q;  2JEB I;  2XTI A;  5GAE C;  3T1H L;  4POG A;  1HJP A;  4APV A;  1H95 A;  3D31 A;  3M7N A;  2K4K A;  2Q2I A;  3GTG H;  4DKA C;  4JBW A;  4JI7 L;  1S72 A;  4BY1 G;  4UCS A;  3F2B A;  1NE3 A;  2AWO A;  5IY0 A;  3BZK A;  2Q2H A;  4DV4 L;  5C4X G;  2CQO A;  2EXD A;  3J7A 5;  4EFE A;  4UCR A;  2A1A A;  3HKZ E;  3A5U A;  1CKN B;  1VQD A;  1WYD A;  3KDF B;  5IYC H;  1HNX L;  4LF8 Q;  3VNN A;  4AH6 A;  3J80 c;  1UEB A;  1KHI A;  4O0A A;  3PCO B;  3BU2 A;  3QWU A;  1NBW A;  1S40 A;  2VL6 A;  4DV6 Q;  4NXN Q;  1QVF A;  5ELN A;  4EEQ A;  4DR1 L;  2JE6 I;  3RNU A;  4A3I H;  4OO1 I;  4KHP Q;  2F52 A;  1PH2 A;  1KC8 C;  5IE8 A;  1VQ7 A;  1LYL A;  4X64 Q;  4K0K L;  1WJJ A;  1IZ6 A;  2VW9 A;  3ULL A;  1VQE A;  1Q1B A;  4DAM A;  3HOW G;  1U0L A;  3S2H H;  4KHZ A;  1X3G A;  4JOI C;  3TRZ A;  4NXM Q;  3PUV A;  4Y7N H;  2F4V L;  4GLA C;  3W1G A;  4DR6 L;  1SR3 A;  3M9B A;  3STB D;  4JI1 L;  3E0E A;  2MQH A;  4XTC S;  2N3S A;  1TWA H;  2WFW A;  3PV0 A;  4GS3 A;  4A3E G;  1FJG Q;  1NMG A;  1OXU A;  5JJL A;  4DR2 Q;  1SMX A;  2AMC B;  3KLW A;  4P75 A;  1U5K A;  3ERS X;  2NVQ H;  4JI8 Q;  1QVC A;  1UE1 A;  3CCV A;  2RHS B;  1B70 B;  1HZA A;  2AKW B;  2Z0S A;  3FHW A;  1L1O A;  3FKI G;  5GAH C;  1J6Q A;  2IHF A;  4HJ9 A;  2E5L Q;  1NMF A;  2R92 H;  1A62 A;  4C3H H;  1XNR L;  3TQY A;  3W1B A;  4B3S L;  4LF8 L;  3CCR A;  2JEA I;  3CD6 A;  1VCI A;  1HH2 P;  3HOY H;  4QY7 A;  4IPD A;  4NXN L;  3S2D H;  2JK8 A;  4A3B G;  3GB8 B;  1YJN A;  3TRE A;  1N8R C;  2WAQ G;  1XMQ L;  1YNX A;  2VNU D;  3UQ8 A;  2ID0 A;  4A75 A;  1PH3 A;  1GM5 A;  5M5X H;  1VQF A;  2A19 A;  3S15 H;  4LNQ A;  1HR0 W;  1NY4 A;  3HOU H;  4R1J A;  4PMW A;  2R6G A;  3F2C A;  1I94 Q;  4NXM L;  1K0R A;  3RLN A;  3L7Z C;  1VQP A;  3U4V A;  4P71 A;  5IWA Q;  4JI2 L;  2LXJ A;  4OON A;  3GTL H;  1PH9 A;  1Q1E A;  4DV1 Q;  4BA1 I;  1WI5 A;  4P73 A;  2OTL A;  4HJ7 A;  4L5Q A;  1G51 A;  2UXC Q;  3I4M H;  1YVC A;  4J15 A;  4LUO A;  1HNW Q;  3K7A H;  4A3M G;  4JI8 L;  5C0X I;  3OTO Q;  4DV5 L;  5GQO A;  1VQL A;  4DUY Q;  1IYJ B;  2RCN A;  3TY8 A;  1MIU A;  2E2J H;  4OO1 G;  3AQQ A;  1B04 A;  1Q12 A;  4WJ4 A;  1Q8K A;  4BY7 G;  2Q2T A;  2HVS A;  4HIK A;  2KHI A;  4OX9 L;  5J3B A;  4DPG A;  5ELO A;  2F3I A;  4MTN A;  2JA8 G;  2QA4 A;  1L0W A;  2K5N A;  3I4N H;  4LFA L;  3E9I A;  2WB1 G;  2JJQ A;  3MXN B;  1VQA A;  4HJ8 A;  4JYA Q;  2HVR A;  2XGT A;  4DV0 L;  1FGU A;  2H5X A;  4XIG S;  3E9H A;  1QZH A;  1IBK L;  1KRS A;  4JI4 Q;  3TS2 A;  1T9H A;  4BBR G;  3L0O A;  4JC0 A;  2VY3 A;  3KF6 B;  1QZG A;  1CSQ A;  4UP9 A;  4GNX A;  3PO2 H;  3W5O A;  4UP8 A;  3PUZ A;  1JB7 A;  2R93 H;  3JC6 6;  2QEX A;  1J5E Q;  2IHE A;  1E1O A;  1YHQ A;  1LTL A;  2CWA A;  5IYD G;  1TWH H;  1BKB A;  4LH7 A;  1HNW L;  1KAW A;  3KJP A;  1C7Y A;  4CC6 A;  3KYH C;  5M3F G;  3TS0 A;  3OTO L;  3EN2 A;  5M3M H;  2VS1 A;  3CP0 A;  5IYC G;  1VQ6 A;  4E6N A;  5C3E H;  4DV2 Q;  4FDB A;  4DK6 C;  3CW2 C;  1D8L A;  2Y0S E;  3AYH B;  2OQK A;  3HKS A;  4DK3 C;  4L5T A;  1JJG A;  3CCE A;  3U58 A;  4P72 A;  1N9W A;  2BH2 A;  2C35 B;  3EIV A;  4DV7 L;  2Z6K A;  1YBY A;  1D7Q A;  2K52 A;  2JA7 H;  4R4I A;  1N33 Q;  1GVP A;  1VQ8 A;  3RTX A;  1M90 C;  3LGJ A;  1MJE A;  3U50 C;  2VUG A;  3F8T A;  5DIS C;  4LFC L;  4JI4 L;  4WJ3 M;  1L1O C;  4IOC A;  3RN2 A;  1S68 A;  3NC0 B;  4A3L H;  3NBY B;  2V1C C;  4X65 L;  2UUC Q;  4NB3 A;  4JI5 L;  5AJ3 Q;  4HJA A;  4GN4 B;  4LF4 Q;  2MO1 A;  3G6E A;  4GKK L;  1I5F A;  2IT1 A;  4ALP A;  2YYZ A;  1RL2 A;  4AQY Q;  3PO3 G;  4CC5 A;  2R92 G;  4LF6 L;  1IL2 A;  2PQA B;  3RZD H;  1G29 1;  3Q8D A;  4IO9 A;  1GO3 E;  1Y14 B;  2CWP A;  3H0G H;  3IRB A;  4R4Q A;  1SRU A;  3H3V H;  2GN5 A;  3HOY G;  2UXD Q;  5JJK A;  3GD7 A;  1GD7 A;  3S1N H;  3DLL A;  1A0I A;  2JA5 H;  1BBW A;  3G48 A;  4HIO A;  2CKZ B;  1EOV A;  2ZJQ A;  3HOX H;  3HOZ H;  3F1Z A;  2NVT H;  2KHJ A;  4A93 H;  2IY5 B;  1IXR A;  2KEN A;  3T1Y Q;  2DUD A;  1LUZ A;  3K81 C;  3HOU G;  1E1T A;  5DLQ E;  2L15 A;  2VQF Q;  1JMC A;  4BXX H;  3L2P A;  1CKM A;  4A76 A;  3F2D A;  1N32 L;  4LF7 L;  1UE6 A;  1ASZ A;  4Y52 H;  1MKH A;  5C44 G;  3CXC A;  4JI3 Q;  5FPO A;  1IBM L;  3JAM i;  4A3J H;  3ULJ A;  4JBM A;  3HFZ B;  4YY3 L;  1M1K C;  1EIY B;  2UUC L;  3J81 c;  3I4M G;  3K8A A;  3PF4 A;  5LMU Q;  2UXB Q;  2OWO A;  3AFQ A;  3PF5 A;  4A3K H;  3NEN A;  1XDN A;  1X55 A;  4AYB E;  2ZM6 Q;  2UUA Q;  4OWW B;  1VQM A;  1UWV A;  3PUX A;  2CFM A;  4DR3 Q;  1Q81 C;  1PA6 A;  4BBS H;  1PFS A;  4DR7 Q;  5D1O A;  3S17 H;  1O7I A;  2RF4 A;  4IFD I;  1P16 A;  2FXQ A;  1YEZ A;  2B29 A;  3GO5 A;  2MNA A;  4JBJ A;  4JBK A;  2HIV A;  4UCU A;  2UXD L;  1I50 H;  1QUQ A;  3OYY A;  1OXS C; 
#chains in the Genus database with same CATH topology
 5I6W A;  1VQG A;  1CQJ B;  2FPI B;  1B9M A;  5CR3 A;  1KDA A;  3K5L A;  1X56 A;  1XMO Q;  3SK5 A;  2E8G A;  2CW0 C;  3N40 P;  2CQA A;  2K5H A;  1YIJ A;  2WE6 A;  2VUM H;  2RKS A;  3NTI A;  3SE0 A;  4PZ7 A;  4C5A A;  4LF9 H;  1N34 Q;  3PO2 G;  2A6H D;  3S24 A;  2VQE Q;  4UCV A;  4CDE C;  4JI3 L;  4IRK A;  4A3E B;  1J9O A;  4LK1 C;  3GLK A;  5IGG A;  4QIW E;  1VQO A;  4ZUI A;  1SN8 A;  2B2T A;  5BN4 A;  1GLV A;  2W6P A;  1P8L A;  3UFX B;  3DUZ A;  3UE1 A;  1L0X B;  4YCV A;  3Q2O A;  4QL5 A;  4FF2 A;  5KFI A;  4QWE A;  4DA2 A;  2BQU A;  3PUY A;  2J6U A;  4QGU A;  1KTK A;  1A3V A;  1MGS A;  2NZ1 D;  1I4H A;  2COI A;  5DGI A;  1CKN A;  5IGC A;  4JI0 H;  2EY6 A;  5F9N A;  2K33 A;  1VS0 A;  5DG8 A;  1UNS A;  2BE5 C;  1Z9F A;  2WAQ B;  4QJF A;  3HKZ A;  2MJ8 A;  5IGD A;  1LT4 D;  4DL3 A;  5D14 A;  3I2Z A;  4ZAI A;  5K36 H;  3U4Z A;  4P74 A;  2AHO B;  2GLT A;  2W71 A;  1WCM A;  2WP8 J;  2IX0 A;  4UFZ A;  4RGN A;  1U9R A;  5M5W B;  4A3G H;  3RBE A;  4E6I A;  2EIY A;  2QYZ A;  2VQE L;  3T53 B;  1NJI C;  1XNQ H;  3MR6 A;  4MTE A;  2HGS A;  2ICE C;  4LFB H;  2IL8 A;  3OSO A;  5L1K A;  1TWG H;  2KCT A;  2CZG A;  3GTO H;  5T14 A;  3C1E A;  5I5U A;  1K73 C;  4QW9 A;  4DR4 Q;  5HGQ A;  2YYA A;  2WDT A;  5C6A A;  1SNO A;  2F0O A;  5GRO A;  2EYH A;  1H9J A;  1TWC H;  3K5H A;  3HB9 A;  3BVG A;  4DNI A;  4DAV A;  5JVL A;  1K1Q A;  4NKL A;  1IKL A;  3I70 A;  5J1Z A;  3PQI A;  2IW3 A;  1JC7 A;  3GTJ B;  2B8F A;  1JJC B;  2JA8 B;  4IAJ A;  3UDF A;  1W2B A;  4NW2 A;  2K14 A;  2WB1 B;  3NQT A;  1Y69 U;  4L5S A;  2ODT X;  1BVS A;  2PI2 A;  3J80 L;  4R8N A;  2Q8I B;  3GTG B;  4BBR B;  1OXV A;  4O3R A;  1DOL A;  4JYA L;  5C3X A;  1B2T A;  4O84 A;  1MSH A;  1PXU A;  1XPO A;  2DLN A;  3G71 A;  1PRT B;  4X3K A;  4DV4 H;  1I6H H;  3K3P A;  4K6D A;  2R8J A;  2RQX A;  4DNR B;  1ENC A;  1L1O B;  5IP9 H;  1AH9 A;  3A56 A;  1SFO B;  2N78 A;  2XGQ A;  4GOP C;  2Y4R A;  4DR4 L;  1EZ6 A;  3DWQ A;  4YR3 A;  3S14 H;  3J7Z C;  4BY7 H;  5CGK A;  4MZ9 A;  3HKZ G;  3H6M A;  4DV2 L;  1S5F D;  1KXL A;  1EWI A;  1PFM A;  3A0J A;  1WCM G;  4DR6 H;  1XPR A;  5FD5 A;  1DV1 A;  4A3F H;  1VQJ A;  4XT3 B;  4ZKC B;  1XTD A;  1V1O A;  1ZHS A;  3JSN A;  3MWM A;  1TWA B;  1GYF A;  3TIG A;  3A54 A;  3CQZ H;  1PH8 A;  2HDK A;  1E2W A;  1ZKO A;  2VB3 X;  4F4W A;  1Z6H A;  1KL9 A;  1SE4 A;  3JAM c;  2B3G A;  4LW1 A;  1A3U A;  1LTI D;  4XYQ A;  4LMQ D;  4DRF A;  5M3F H;  2R92 B;  1G2T A;  4JV5 Q;  1CQI B;  3LWU A;  5H80 A;  1XNR Q;  4EFB A;  2OH2 A;  2H4O A;  4B3S Q;  3GIL A;  1E2V A;  3HKZ B;  3SI8 A;  1ENA A;  3P1H A;  4NXN H;  2VPQ A;  2K75 A;  1CHQ D;  3HOY B;  1K8A C;  3S2D B;  1XMQ H;  5IOD A;  5JEA J;  1SMY C;  3N42 B;  4R4O A;  3RGX A;  1STY A;  5IT9 c;  1U4L A;  2Z4I A;  1HUM A;  3PW7 A;  1Z2P X;  3BAA A;  3GV3 A;  5JQG F;  1SYX B;  2HQL A;  5CE8 A;  1CFM A;  1EYG A;  2VOB A;  3GV6 A;  5D1P A;  5JJZ A;  5CR5 A;  5JPM C;  2W9C A;  1Q90 A;  1KRT A;  1GUS A;  3LX0 A;  3TQ1 A;  1VBG A;  4CKB A;  1ULZ A;  3BQ0 A;  3JAM E;  3SXH A;  3WWV A;  4BY1 H;  3NEM A;  1C3O A;  2NVY H;  3PO3 H;  2PN1 A;  5H1S E;  1S9F A;  3X3M A;  2E2J B;  1CHP D;  4JV5 L;  4MNO A;  4C2M A;  3OSN A;  1Y1W A;  4ZK9 B;  2AGO A;  4X3U A;  2PQA A;  4R8U A;  1PTO C;  1FD7 D;  3GJX B;  1V1P B;  3KFU A;  4FFP A;  4XZ3 B;  2LFN A;  2WAQ E;  1FVI A;  4LFA Q;  1JIH A;  2NVX H;  2EY2 A;  1F2L A;  2ZXR A;  1EY5 A;  4HSV A;  3GTM H;  4O7V A;  4O2B F;  1JJ2 A;  4JV1 A;  1EFW A;  1IBK Q;  3UDX A;  2JA7 G;  2NYZ D;  3AEV A;  3K7U C;  4GLX A;  3PW0 A;  3V96 A;  4CGY B;  5KEE A;  4WRD A;  2R93 B;  4EQO A;  2E2H A;  5CV7 A;  5IP7 G;  2G5D A;  2WII B;  4IRD A;  1KDB A;  4YWK A;  3BJY A;  4QW8 A;  3BQ2 A;  1H9S A;  2IX3 A;  1QCB D;  4IFD G;  4KD4 A;  4RHR A;  5KT4 A;  4FGR A;  4JOI A;  4KK7 A;  2MUY A;  1AE3 A;  1R9T A;  2F0F A;  1D5X C;  2K32 A;  1E4G T;  2UU9 L;  1U4P A;  4O83 A;  3KHR A;  1JX4 A;  3KHL A;  1IKM A;  2P0A A;  1B7Y B;  2B2W A;  2WKC A;  4X66 Q;  4JG2 A;  1CZG A;  3MEF A;  1STH A;  1NCV A;  2JA7 B;  2R6F A;  4APM A;  3UYY A;  4RUA A;  2WB1 E;  1EWC A;  1N48 A;  1DD2 A;  1X65 A;  3NQI A;  2AUK A;  1V43 A;  5GAG C;  1L2F A;  1LT5 D;  3NWS A;  3QOL A;  3DXJ C;  5I4D A;  4UCO A;  4GKK H;  4L5R C;  2K1B A;  1SRO A;  1Z2N X;  3JZF A;  4O7R A;  2NUA B;  3BZC A;  3EBE A;  1ENF A;  2CVR A;  2ES2 A;  3BAB A;  2W8L A;  3VA7 A;  1Y1W G;  3PSI A;  3QG1 A;  4C5B A;  3MFI A;  1S5E D;  5E4X A;  4A3C G;  3N8D A;  3PUW A;  1RK5 A;  4MA5 A;  5IYZ F;  2EYM A;  3BVZ A;  4OO1 H;  2JA5 B;  4XYM B;  4X66 L;  1FL0 A;  4DR1 Q;  2UUB L;  2W6O A;  2YTV A;  1S97 A;  4A93 B;  4GOP B;  4ECS A;  3C1F A;  2J7Z A;  3PW4 A;  3GTJ H;  3T9A A;  1SE8 A;  1JWU D;  4R4C A;  5A35 A;  3BAC A;  3MEH A;  1E4E B;  4YY3 Q;  4I7Z C;  5GAE C;  2XTI A;  5DGH A;  2XN9 C;  4APV A;  1AUX A;  3GTG H;  1I6U A;  4V19 0;  3JZ6 A;  1F9S A;  2IBK A;  4HQ6 A;  4BBS B;  3LWE A;  3VA5 A;  4CDF C;  1D5M C;  2EXD A;  4CMF A;  3DM1 A;  2UVW A;  3HKZ E;  2YZM A;  3AU7 A;  4C3H B;  1EIG A;  3Q8S B;  1TT2 A;  4TRD A;  3J80 c;  1KHI A;  4O0A A;  2KEC A;  3PCO B;  2CH4 A;  3BU2 A;  1NBW A;  1S40 A;  2VL6 A;  2OXP A;  5ELN A;  5KT6 A;  2EYP A;  4IZ8 A;  4DR1 L;  2W9B B;  3RNU A;  4KHP Q;  2L5T A;  1DV2 A;  2FK2 A;  4X64 Q;  2DY7 A;  1QNU A;  3HOW G;  1VQE A;  3NE5 B;  4JI3 H;  2PW5 A;  1X3G A;  3TRZ A;  4NXM Q;  2PCF B;  2IWH A;  1NUC A;  2F4V L;  1SYF A;  3W1G A;  4IIJ F;  4Q0Y A;  2QW7 A;  1SR3 A;  3STB D;  2IJ0 A;  2CNV A;  2C2R A;  4XTC S;  1SJH D;  2MQH A;  1TWA H;  1LT3 D;  1F2Z A;  1B9N A;  1HQM C;  4DR2 Q;  1SMX A;  2AMC B;  1F2Y A;  1EKV A;  1U5K A;  4FU0 A;  3HO8 A;  1HZA A;  1FNV A;  5I9P A;  2R92 H;  2IHF A;  1EYD A;  2E5L Q;  1A62 A;  4KJN A;  3TSS A;  3W1B A;  3J80 E;  3CD6 A;  5M5Y B;  4RWS C;  1KNE A;  1HH2 P;  3HOY H;  3S2D H;  4A3B G;  3GIP A;  3ZYY X;  2L9H A;  5I6Y A;  1YJN A;  3R9R A;  4Q4D A;  1PH3 A;  2M2L A;  4H13 C;  2FP4 B;  3HGB A;  1VF7 A;  1TKW B;  2QK4 A;  3U54 A;  3MXP A;  1HRJ A;  1PTO B;  2VQE H;  4R1J A;  4PMW A;  1I94 Q;  4NXM L;  3RLN A;  1U4M A;  3L7Z C;  4B9W A;  5IWA Q;  4K5V A;  1VQP A;  3TII A;  5CM0 A;  3T99 A;  4DV1 Q;  2LMC B;  4BA1 I;  1I1L A;  1WI5 A;  2OTL A;  4L5Q A;  5BMV F;  2AGP A;  4RKL A;  4ZUJ A;  1YVC A;  1HNW Q;  2RSO A;  4J9P A;  5E3F A;  4A3M G;  5C0X I;  3D6C A;  4DV5 L;  3RB0 A;  2PZT A;  3TDQ A;  2IPK D;  4XQQ A;  2E2J H;  3AQQ A;  2FK1 A;  3ORQ A;  4CHT B;  1B33 N;  3R23 A;  2PZU A;  2Q2T A;  2VA2 A;  3TQT A;  3M4O B;  5J3B A;  3H40 A;  2K03 A;  5ELO A;  4HSP A;  2YRW A;  4MTN A;  1EFI D;  2QA4 A;  2K5N A;  4NDX A;  1DZ1 A;  4JYA H;  4MA0 A;  1HTP A;  4I55 F;  2XGT A;  4DV0 L;  4LJZ C;  1AP0 A;  1KJ8 A;  2ZDQ A;  5F2D A;  4QUF A;  3L0O A;  4JC0 A;  4OIJ A;  3KF6 B;  3SEB A;  2YRX A;  2YZN A;  5LHY 1;  4FFN A;  1YNJ C;  1I3Q B;  3FRP B;  2R93 H;  3JC6 6;  1J5E Q;  1OWT A;  4DR4 H;  2VB2 X;  2ZT9 C;  4F87 A;  2R7Z B;  5KFU A;  1HNW L;  4ECX A;  1DOM A;  1RTN A;  3KYH C;  4YIJ A;  3CP0 A;  5LL6 S;  4DV2 H;  3G6J B;  1STG A;  2FLN A;  2JXM B;  4O82 A;  1QE6 A;  3MWD A;  2JA6 B;  3KF8 A;  3CCE A;  4A3D B;  2BH2 A;  4O2A F;  2Z6K A;  1YBY A;  1D7Q A;  3NXW A;  2JA7 H;  1N33 Q;  1GUT A;  4RNM A;  3K6O A;  4OEM B;  5T1I A;  1X3P A;  1M90 C;  2HDM A;  2VUG A;  4FO2 A;  5DLF A;  4KY7 A;  4DIM A;  4UHV A;  5CA1 F;  4XXE A;  4R7R A;  5KFB A;  1SYB A;  3DWP A;  3JAM W;  1I4G A;  4JV0 A;  4JI5 L;  4O4J F;  5AJ3 Q;  4IFD H;  2XCL A;  1I5F A;  4I4T F;  3HOV B;  1RL2 A;  5J39 A;  2MP1 A;  3H20 A;  4HYK A;  1HUN A;  5KFK A;  4IO9 A;  1E4F T;  3S9W A;  2R82 A;  1XWE A;  4DK1 A;  1ZAU A;  4TV9 F;  2AUJ D;  4IN3 A;  4IUU A;  1A0I A;  2JA5 H;  2O5I C;  2F3V A;  2CQY A;  4O4L F;  5IT9 W;  4DL6 A;  2ZJQ A;  4A93 H;  4PDB A;  3VYS A;  2KEN A;  3KAJ A;  3HOU G;  2JSO A;  5DLQ E;  3D3R A;  4DF7 A;  3VOT A;  1KBL A;  1CKM A;  4RAU C;  4LF7 L;  4Y52 H;  1MKH A;  5C44 G;  5FPO A;  3NUC A;  1IBM L;  5IOC A;  1BGW A;  5LXT F;  3TP5 A;  1M1K C;  4JV5 H;  3K8A A;  2UXB Q;  5LMU Q;  2W6M A;  3R8B A;  3AFQ A;  3PF5 A;  5KKN B;  2K5W A;  5C4X B;  1XDN A;  1NNX A;  1X55 A;  3MXU A;  1G2W A;  5KFE A;  1I4P A;  1UWV A;  5T1G A;  4DR3 Q;  4BBS H;  1Q81 C;  3F2U A;  4EBD A;  1P16 A;  2NTT A;  1SYE A;  2EJF C;  4QWD A;  2MNA A;  2HIV A;  4JK1 C;  5ELD A;  4EBC A;  1QUQ A;  2PMZ A;  4LH6 A;  4OWX B;  1ET6 A;  3T7A A;  1VDZ A;  4DV6 L;  4H0L C;  1WTP A;  2LXK A;  1AE2 A;  2DPJ A;  4B3T Q;  2O03 A;  2XRS D;  1B8A A;  4AIM A;  4C56 C;  2HD3 A;  4B9X A;  1SNQ A;  1G91 A;  1DON A;  3SNO A;  2K01 A;  1HA5 A;  1PYS B;  3D0F A;  2BOS A;  5LMN Q;  2UXB L;  5LMU L;  1C4Q A;  2G9D A;  2HT1 A;  2V5A A;  3FMA A;  2UU9 H;  1FJG L;  3I3C A;  3GTO B;  1KJQ A;  5M3M G;  1Y1V G;  2NB0 A;  1JT8 A;  4IJL A;  2B39 A;  4YHH H;  2KUM A;  1KD1 C;  3KDF A;  1JLL B;  4FXD A;  3GTK B;  4CMD A;  4CJ1 B;  3TN2 A;  5M5Y H;  5ISR A;  1IBL Q;  2ASB A;  3N44 B;  4DR5 Q;  2XCA A;  4P2C B;  4F4Z A;  1SNM A;  4C3I B;  4A4I A;  4HN2 A;  5DAA A;  4ED2 A;  1VQC A;  2LS0 1;  2VZA A;  5JJI A;  1B1Z A;  4PBC A;  1GSO A;  1PTO H;  2OT2 A;  1BNZ A;  5KFW A;  2PQE A;  3UDG A;  4DK0 A;  1YNN D;  1IYV A;  2EJ2 A;  4L63 B;  2IX1 A;  1Y1V B;  5LMN L;  3HT5 A;  1X6O A;  3VR5 A;  1V8Q A;  1ZEQ X;  3KHH A;  2GPS A;  3ETH A;  4HTH A;  1UEA B;  3I12 A;  5FD6 A;  2R8K A;  4ODG A;  3NBH B;  1GXD C;  2JQO A;  2WYO A;  1S4Z A;  2UUB H;  1K83 B;  2MO0 A;  4BY7 B;  3M3Y B;  4DUY L;  1BBU A;  2HG8 A;  2DPI A;  2JN4 A;  1IOW A;  2HHH Q;  3G6Y A;  4R4T A;  3HOX G;  1PYB A;  1C9O A;  1ZQ7 A;  3TZU A;  2J6T A;  1HZB A;  1ZYR D;  2HIX A;  3M4O H;  4QQB X;  1X3F A;  5HY6 A;  1HA6 A;  5FR9 A;  3GTP B;  3R3O A;  4BXX G;  5IYB H;  1S3O A;  5CV5 A;  1TY0 A;  2DJF C;  3AFP A;  4UP7 A;  5FLM H;  1AEX A;  3R2T A;  2EQS A;  3V4Z A;  1GHK A;  1GKH A;  2I46 A;  4X62 Q;  3KXY T;  3BDC A;  3CCL A;  5GAD C;  4A3J G;  2K5V A;  4LUV A;  1TA8 A;  1KQS A;  1SYG A;  1JOO A;  1LO5 D;  2HDL A;  1PLF A;  3TBI B;  1DGS A;  1B4O A;  1I3Q H;  1J8I A;  1HNX Q;  2R7Z H;  2B63 A;  1VMP A;  4FF3 A;  1Q46 A;  3K5N A;  3J80 W;  4DR1 H;  3WWJ A;  1WFQ A;  2RA4 A;  3VDY A;  1F9P A;  2HHH L;  5FJ8 H;  1S10 A;  2B2T C;  2DNE A;  1IW7 D;  4YCU A;  4EG0 A;  2JA6 H;  2F4V H;  4A3D H;  1MI2 A;  4HID A;  1EUD B;  4I7A A;  4JI1 Q;  5DEH A;  1GGO A;  4TUY F;  2LSS A;  3I7F A;  2MGS A;  4X62 L;  3C3L A;  3EJI A;  4JV2 A;  1HR0 H;  1L2Z A;  1AFP A;  2NVQ B;  3T9C A;  3LP8 A;  4JVZ A;  2K5Q A;  4B3R Q;  4RMF A;  4OXP A;  3PO3 B;  5BN3 A;  1KDC A;  3WOF A;  5NUC A;  4NLG A;  4LF4 L;  4IUP A;  1W6J A;  3FVQ A;  3HOV H;  4KHV A;  3OHB A;  2NN6 I;  2EPB A;  2A68 C;  5TSS A;  3N43 B;  4DV3 H;  2V4Q A;  3OSP A;  3H15 A;  1LAB A;  4RH6 A;  2R7M A;  4O2D A;  1BR9 A;  1PH7 A;  5EOY A;  1JIC A;  2YTY A;  3OMG A;  4RU9 A;  3GTQ A;  3OWF A;  3URY A;  4RNN A;  5DM7 3;  4M7E A;  5C5J A;  3S15 B;  4GZY C;  1ONL A;  4NZO A;  4NXM H;  2Y0S A;  4KY6 A;  4JI2 Q;  1RF2 D;  3I4L A;  2I87 A;  2R61 A;  3T56 B;  3T1Y L;  1EY4 A;  4TQR A;  2COJ A;  1RDP D;  1I6V C;  5C1O A;  3DEO A;  2VQF L;  2E2I A;  4WFN 3;  5BYB A;  1MHW C;  2NTS A;  3I4M B;  5HNE A;  1SLJ A;  3K7A B;  4DV5 H;  3OOC A;  3VYU A;  4FFM A;  4EYH B;  4FF4 A;  4B3R L;  1Q82 C;  3IFT A;  2B63 G;  1KT8 A;  4A2B A;  5KFX A;  1VQK A;  2KCM A;  5C4X H;  2X5R A;  1X3E A;  2WAC A;  2ZM6 L;  4IPC A;  3QB3 A;  1DCZ A;  3X3N A;  5C3E G;  4CJ2 C;  4OX9 Q;  3BZD B;  1BNC A;  2GVB A;  1T3N A;  2F0S A;  3OUU A;  2XIG A;  1BCP F;  1WTO A;  4DV0 H;  1I50 A;  3V6H A;  4J9R A;  2Q7D A;  5EPL A;  4HMJ A;  4ME3 A;  2EYL A;  1XMO L;  3BDL A;  4HN7 A;  4RUC A;  1A63 A;  4YR2 A;  2B2Y A;  3PO2 B;  5KFP A;  3KHG A;  5LL6 b;  5C44 H;  5DGB A;  3NEL A;  3T9E A;  2I5H A;  4FM9 A;  4PZ8 A;  5BR8 Q;  4IFD J;  5KG1 A;  1FKA H;  4BA2 I;  1N34 L;  1GHJ A;  2NN6 G;  4DAY B;  2CW7 A;  2F0K A;  1STA A;  1TAE A;  5KFF A;  1WD0 A;  1E24 A;  1DYQ A;  1VQH A;  3A7A B;  4O4H F;  3MA2 B;  5IGB A;  2ALY B;  4XDX A;  2Q8R E;  2QB5 A;  1AN8 A;  2XWB B;  3OW2 A;  3Q24 A;  1AZP A;  4LSX A;  4DV7 Q;  1RYS A;  1ET9 A;  3E5S A;  2XC9 A;  1JE5 A;  4NP5 A;  1RTO A;  2Y0S G;  3HEJ A;  1YI2 A;  3GTK H;  3GDE A;  4N8X 1;  4TQU S;  4LFC Q;  1O7Y A;  1EUC B;  5GON F;  4PMB A;  1STB A;  4UPA A;  1UE5 A;  4LWC A;  4C3I H;  5DQG A;  1KNA A;  2A6E C;  4X65 Q;  3D4R A;  1M6V A;  2ZTE A;  4EVO A;  2L4N A;  4TM5 A;  4JI5 H;  4IUV A;  1HZC A;  5BR8 L;  4K8J A;  1SBB B;  2RCF A;  2W70 A;  1K3R A;  4LF6 Q;  1SEI A;  1F9Q A;  4A3K G;  4KLK A;  1Y1V H;  2BDO A;  3Q0A A;  5E4W C;  5BWW A;  3RF2 A;  3BA9 A;  2PMZ E;  2FLL A;  2D5D A;  5IGF A;  1OXX K;  3FKI A;  1EZ8 A;  3J81 L;  2DZD A;  1ILQ A;  1K83 H;  5KRU A;  3ULP A;  2B8G A;  3M3Y H;  2YU9 A;  4YCW A;  3I55 A;  2CW8 A;  2RHQ B;  4KKU A;  1TWF A;  1ESR A;  4K0K Q;  3U55 A;  4YJ2 F;  4LF7 H;  1TS2 A;  3A5Z B;  1N32 Q;  3RN5 A;  3C46 A;  4KN7 C;  1IBM H;  2ZTC A;  2O4X A;  3GTP H;  2D0P A;  1Z47 A;  3LML A;  1CM9 A;  5KFN A;  1EKF A;  1RK6 A;  4WD3 A;  3GQB A;  2A1H A;  3KAL A;  1GJX A;  1W96 A;  4QSH A;  4UCS A;  1TVX A;  2UVU A;  2AQ3 B;  4KJO A;  1ML0 D;  2AWO A;  4FBU A;  1M4V A;  4QCL A;  3LUL A;  4CJ0 B;  5G3L D;  1KEE A;  2A1A A;  3H4B A;  2FKL A;  1CKN B;  1VQD A;  4ZCK A;  4LF8 Q;  4C1N I;  1SND A;  5KFD A;  3NPP A;  2KED A;  4DV6 H;  3QWU A;  5CV9 A;  3RBD A;  3S1R B;  2HHF A;  2JE6 I;  2PBZ A;  1WCM B;  1SDF A;  2F03 A;  5LOV F;  1KC8 C;  4K0K L;  1LYL A;  3NUA A;  3A8J E;  3PFF A;  3R5X A;  4QWC A;  3GIQ A;  4KHZ A;  3VPD A;  4JOI C;  5JQW A;  5A2Q W;  4L8J A;  4XQN A;  3M9B A;  4RB0 A;  5EDW A;  5C4J B;  5DQI A;  3E0E A;  1FJG H;  3PV0 A;  1HCZ A;  5KFJ A;  2B2W C;  1OXU A;  2VXW A;  3KLW A;  4P75 A;  2NVQ H;  3CU7 A;  2M05 A;  1PDQ A;  1ET0 A;  1QVC A;  1I1K A;  3FKI G;  1LLR D;  2AKW B;  5GAH C;  3VPC A;  1NMF A;  1XNR L;  1B53 A;  5K3W A;  4B3S L;  4LF8 L;  2JEA I;  1ESF A;  1EWH A;  4BWS C;  3HRZ C;  3T13 A;  2EDG A;  4ME6 A;  1T5E A;  2JK8 A;  3GB8 B;  3TRE A;  1YNX A;  3K5O A;  1Q3L A;  2ID0 A;  5CBA E;  1GM5 A;  2R85 A;  2N55 A;  2FJ2 A;  2QKI C;  1HXY D;  1BCP C;  3S15 H;  3AW8 A;  4LNQ A;  1HR0 W;  1NY4 A;  2A69 C;  3FPP A;  2R6G A;  3F2C A;  4CDC C;  3NP8 A;  3TW7 A;  1C8C A;  2FJZ A;  4U67 3;  4P71 A;  4OON A;  1GSA A;  5KFC A;  5LMN H;  1MBY A;  1PH9 A;  4DL4 A;  4O3S A;  4HJ7 A;  1G51 A;  2UXC Q;  1IL8 A;  3I4M H;  1S0M A;  1LT6 D;  3K7A H;  2IA6 A;  3OTO Q;  4DUY H;  1VQL A;  1K1S A;  1IYJ B;  3L3O C;  4F8M A;  1JDE A;  1Q12 A;  2KJX A;  3S1Q B;  5KS8 A;  3RFC A;  2F3I A;  4O42 A;  3RD4 A;  1N56 A;  1L0W A;  4LFA L;  3E9I A;  4BWG B;  1VQA A;  4NYE A;  2F4I A;  3R93 A;  1FGU A;  1QZH A;  1IBK L;  3E9H A;  1RKN A;  2R8I A;  2V4R A;  1QZG A;  3PO2 H;  3W5O A;  1EHI A;  2FPG B;  3G6V A;  3PUZ A;  4DXF A;  1JB7 A;  3KTM A;  3A7L A;  2IHE A;  1E1O A;  4LH7 A;  5IYD G;  5FLX L;  4KTA A;  1BKB A;  3HXL A;  1HTL D;  3TS0 A;  5KG5 A;  1EIH A;  3OTO L;  2A6H C;  2EYF A;  3PR5 B;  5IYC G;  3EPI A;  5C3E H;  5K2M A;  3MWE A;  2HHH H;  2GQR A;  2EJ0 A;  2F0P A;  3CW2 C;  4WOR A;  2Y0S E;  5KFV A;  1FR3 A;  4DK3 C;  4NZN A;  4KY5 A;  1V4Y A;  4P72 A;  4YQW A;  1T5X D;  4MHE A;  4ED1 A;  4RZR A;  2K52 A;  4R4I A;  1OBD A;  3K58 A;  4X62 H;  4S3S A;  4MV7 A;  1MJE A;  3TME A;  3F8T A;  1IYU A;  4IOC A;  2W9C B;  3NC0 B;  2SOB A;  2UUC H;  3PW5 A;  3D6W A;  5CAE B;  1SYC A;  3RMH A;  2DN8 A;  4LF4 H;  4C2M B;  1EY9 A;  1SSO A;  1EL0 A;  5IGE A;  2MO1 A;  3WDN A;  2J9G A;  3SK4 A;  1Y1W B;  4ALP A;  1TWH A;  3HG9 A;  4AQY Q;  5FO9 B;  2NU6 B;  2NWG A;  2PQA B;  4R8U B;  5EKL A;  2CWP A;  1O78 A;  2UXD H;  2L1B A;  1EZ1 A;  2ASJ A;  1IOV A;  2W6N A;  1BBW A;  2RDH A;  2CKZ B;  3VR6 A;  1EY6 A;  3QJY A;  3F1Z A;  1SNP A;  2NVT H;  3Q8R B;  3T1Y H;  4YR0 A;  2VQF H;  1M0T A;  1JMC A;  5J2U F;  4A76 A;  2E2H B;  3F2D A;  2RBM A;  2KCN A;  1UE6 A;  4JXU A;  3RB3 A;  3FPU B;  4B3R H;  1H9S B;  2N88 A;  3JAM i;  3GV5 B;  4JBM A;  4YY3 L;  3J81 c;  4I50 F;  3OIQ A;  4DLK A;  4A3K H;  1R9T B;  2ZM6 H;  4RFB A;  2QDL A;  2F0L A;  4OWW B;  5E1F A;  2UUA Q;  1VQM A;  4G57 A;  4DR7 Q;  5D1O A;  1SJE D;  3MWY W;  3KBG A;  3H0G A;  2FXQ A;  3EQL C;  1YEZ A;  3E6Z X;  4JW0 A;  3GO5 A;  4JBJ A;  3J7Y W;  4UCU A;  1XTC D;  1I50 H;  4GNX A;  5I5T A;  1M0W A;  5JEA G;  1BUV T;  3I4N G;  1CKO A;  1UAP A;  4HCE A;  2PI2 E;  3H3V I;  2AGQ A;  1XMO H;  2JEJ A;  2SEB D;  3TEH B;  3Q22 A;  3S1R H;  3HOW B;  1WCM H;  3M4Y A;  4KHP L;  3VR2 A;  5I60 A;  2YS7 A;  2F0W A;  4X64 L;  3T9D A;  1N34 H;  5JVD F;  3TW6 A;  3G7L A;  4LF9 Q;  1VQN A;  1VAJ A;  2NU8 B;  2YV5 A;  2IP4 A;  4MIU A;  2L12 A;  1L0Y B;  3GID A;  1SXT A;  2ALZ A;  1BCP B;  5C4J H;  3J81 E;  5COY A;  2J4X A;  2N49 A;  1B44 D;  2Z6K C;  3BJU A;  4LF5 Q;  5FNV F;  1RIP A;  2UUA L;  4FF1 A;  1WTH A;  4DR2 L;  4DR7 L;  4A2A A;  1MJC A;  3MVV A;  1PRT D;  3I4O A;  3ICE A;  1ROD A;  1A3G A;  2HUG A;  2F0V A;  4RG1 A;  5KFL A;  3PIO A;  4OIK A;  2BH8 A;  2E5L L;  4A3B B;  3IN5 A;  3K0X A;  2VA3 A;  1GUN A;  1EQQ A;  4B3M Q;  3KRE A;  5DMX A;  5KG2 A;  1PH4 A;  1DM0 B;  4K6L A;  1E2Z A;  2VPS A;  5F9L A;  1XX8 A;  3CC2 A;  2VUM A;  1JOQ A;  5I5S A;  2AU0 A;  2ZTD A;  3V4S A;  2EY5 A;  5KG6 A;  4YWL A;  1HQR D;  2B2V A;  2F0E A;  5BN5 A;  1I94 L;  2QIL A;  4ED8 A;  3GTL A;  3L9A X;  1XNQ Q;  2R7N A;  4IWY A;  5IWA L;  4Q43 A;  4LFB Q;  5CC4 A;  4A3M B;  3CME A;  4DV1 L;  1KC7 A;  2R7K A;  2OLS A;  4TVA B;  4LF5 L;  5KFG A;  3H0G G;  2J0T D;  2WKD A;  2BR0 A;  4AYB A;  3I91 A;  4YWM A;  3CF5 A;  3TP8 A;  5BWT A;  1TU2 B;  2CHB D;  5KFZ A;  1EU3 A;  2YS6 A;  4F50 A;  1QIL A;  3S1Q H;  1TY2 A;  4B3M L;  1W93 A;  4XX0 B;  2NZO A;  4A3I G;  5EBD A;  1S03 G;  4J9M A;  2I5M X;  2BA0 A;  1X32 A;  1STN A;  2F1M A;  3P20 A;  2DNC A;  5CV4 A;  4EQ5 A;  3K57 A;  4HAE A;  2D9U A;  1V51 A;  5JVG 3;  2JEI A;  2SCU B;  3MAQ A;  3T5L A;  3H09 A;  1AW7 A;  2BA1 A;  5EAY A;  1C48 A;  2MPM A;  3M4P A;  1XNQ L;  1OBG A;  5IP7 H;  5C0X G;  4O7L A;  5BWX A;  4ED3 A;  1YZ6 A;  1TWG A;  1QJO A;  4O7W A;  4KN4 C;  4QIW A;  1K8G A;  2KVM A;  5EPK A;  3DM3 A;  4O7N A;  1J5E L;  1D6E C;  1W6K A;  3BVM A;  2PPB C;  4GKJ Q;  3WNZ A;  2CW0 D;  3V2T A;  1JOR A;  1TWC A;  5CBE E;  1PRT F;  1W3S A;  5C4H A;  5KFA A;  4OWT B;  1G6P A;  1TS4 A;  2FPP B;  4B08 A;  3ORR A;  3KLS X;  2HCI A;  1K9M C;  1T94 A;  4RCO A;  4ZRZ A;  3S2H B;  2O2L D;  4NPS A;  3QO2 A;  2XNA C;  2VUM G;  4RGO S;  4Y7N B;  3K59 A;  4TSS A;  2WTF A;  5EWF A;  2L0C A;  5FLX c;  3G4S A;  1N33 L;  2X6L A;  2AQ2 B;  3MXN A;  3KBX A;  1JOK A;  4Q0F A;  4UY8 C;  3BG5 A;  4E4T A;  1B6R A;  3UZB A;  4RB3 C;  1QG7 A;  1V9P A;  4Z9C B;  4MV1 A;  3PGZ A;  1BXR A;  4Q45 A;  4IHJ F;  5IYD H;  4TVI A;  4Q4C A;  1YJW A;  2BE5 D;  4TV8 F;  1XNR H;  2BCO A;  4YP3 A;  4PZ6 A;  4C2M H;  4B3S H;  4AYB G;  4LF8 H;  5AJ3 L;  1VQ9 A;  5KG7 A;  1Y1W H;  2WV6 D;  4JI6 Q;  4GKJ L;  3J80 i;  3SHL A;  4A3C H;  2B2U A;  1PK8 A;  1LM0 A;  5L9X A;  1TR5 A;  1S0O A;  1XMQ Q;  2OCE A;  3LQS A;  3WOE A;  5M5X B;  4QWA A;  5K36 G;  2X6G A;  4U6P A;  1DIK A;  3DWA A;  3I72 A;  2KHS A;  4N9T A;  1NR4 A;  3HOU B;  4DQN A;  3PIP A;  4JUZ A;  4ZLT F;  3HBL A;  3W2D A;  4A3G G;  1VKZ A;  4MAM A;  5FLX E;  2UVV A;  5EJW A;  5DQH A;  3J81 i;  5C44 B;  4O4I F;  3CQZ A;  4FE2 A;  5FO8 B;  3P7J A;  2E2H H;  1XXG A;  5EBC A;  4DL5 A;  4LAA A;  4POF A;  1KLU D;  1R9T H;  3PZP A;  2HQE A;  4JI6 L;  3TP7 A;  1X9N A;  4DR3 L;  3E0J A;  1EOT A;  2L55 A;  3KF8 B;  2MFI A;  3BDO A;  4K5W A;  1Q8I A;  3CCJ A;  4LFA H;  3H4D A;  2YZL A;  1HFG A;  5DNF A;  3M85 A;  1IBK H;  3SDZ A;  3H94 A;  1S5C D;  4IJH A;  2IMW P;  4J6H A;  3HOW H;  4B3T L;  5J2T F;  3CC7 A;  5DAU A;  1PH1 A;  2NBF A;  3OTO H;  2FHT A;  3NSW A;  4MV9 A;  1VQB A;  5IP9 G;  2NVY A;  5M3M B;  4FFL A;  1BO0 A;  1H9K A;  5EKI A;  1PVO A;  2FE3 A;  3STB C;  1A6X A;  4G7H C;  4HR7 A;  4X66 H;  1WTX A;  3J7A F;  1IYD A;  1PZI D;  3I73 A;  3J81 j;  1YHB A;  4G7O C;  3P75 A;  1DOK A;  2NVX A;  4ED0 A;  3GTM A;  4EX5 A;  4IOA A;  3SE7 A;  5EPJ A;  1BF4 A;  4A3B H;  2I0Q A;  1JB3 A;  1EUJ A;  4A3F G;  1Z2O X;  1IBL L;  4DR5 L;  1K8M A;  3RAQ A;  3M7G A;  3T1H Q;  2C00 A;  1HPC A;  1VMC A;  5J22 A;  3UDI A;  1QB5 D;  2CNQ A;  3MFY A;  4KMU C;  2V9W A;  4JI7 Q;  3S1M H;  2K50 A;  4GKK Q;  5LA6 F;  1I7N A;  4OEL B;  3CCU A;  1FGB D;  1EQV A;  1SMY D;  3Q6S A;  1YIT A;  1BJT A;  1KTA A;  2RDI A;  3E3X A;  3RV3 A;  4A3M H;  1ASY A;  1PH6 A;  3CCM A;  4NMZ A;  4IUQ A;  4WJW A;  4FYD A;  4UUG A;  2LKV A;  3GQC A;  1QUQ B;  2PMZ B;  3S1N B;  4FFR A;  2DIK A;  4WHX A;  5DG7 A;  5C3W A;  1EY8 A;  3HOX B;  2FMC A;  2RDJ A;  1GSH A;  5KYL A;  3U9O A;  1PH5 A;  4N8F A;  3R5F A;  2WAQ A;  3WO0 A;  2JA9 A;  1XJV A;  4MTK A;  2PVP A;  5HUR A;  3KJO A;  4WBN F;  4HCS A;  4YY3 H;  4A3J B;  1IHZ A;  2R7D A;  5IT9 L;  3T1H L;  5BPF A;  1CQF A;  2I07 B;  3D31 A;  3M7N A;  2KA7 A;  2K4K A;  2Q2I A;  4DKA C;  4JBW A;  4ECZ A;  4JI7 L;  3VMM A;  2A74 C;  3J81 W;  2ZDG A;  3RUP A;  4BY1 G;  2V59 A;  5KGU A;  1PTO D;  4R8I A;  3F2B A;  2KSW A;  3BZK A;  5KFM A;  5KG3 A;  2CQO A;  5EWE A;  3KLS A;  1CK1 A;  1JXL A;  2C2D A;  4CKC A;  3KDF B;  1HNX L;  2B2Y C;  1UEB A;  3K3V A;  2Z1C A;  4J9S A;  4G4K A;  1F9R A;  3IL8 A;  3FDS A;  5M9O A;  4KHP H;  4A3I H;  4OO1 I;  1PH2 A;  4X64 H;  1VQ7 A;  1JKJ B;  1WTQ A;  1IZ6 A;  2VW9 A;  4DAM A;  3S2H H;  2TSS A;  3UZO A;  5I5V A;  2V4D A;  4XT1 B;  4KKS A;  2WB1 A;  3I8Z A;  5HBR B;  2Z9H A;  4Y7N H;  3PVX A;  4GLA C;  3MZ5 A;  4JI1 L;  1QWY A;  1WD1 A;  3GTG A;  1CA5 A;  2N3S A;  2WFW A;  2ZXP A;  4A3E G;  2UUA H;  5C0X H;  4DR2 H;  4DR7 H;  4EQP A;  2EE1 A;  2FMA A;  3NGD A;  1EYC A;  1ZET A;  1UE1 A;  4RCN A;  3CCV A;  2RGR A;  2RHS B;  1JDB B;  3U9T A;  1B70 B;  2E5L H;  1CT1 D;  2Z0S A;  1L1O A;  4KD3 A;  4HJ9 A;  2F3W A;  3SK6 A;  3QFF A;  1PYW D;  5C8Y F;  4EBE A;  4DL2 A;  1SFO A;  3N6X A;  4J9Q A;  3TQY A;  5FOB B;  1VCI A;  2QEJ C;  1PX2 A;  1SYD A;  2DAB A;  3EFX D;  4IPD A;  2BQ3 A;  1EEF D;  1K3B C;  1FNW A;  3NTK A;  1RJP A;  3IG0 A;  2AQ4 A;  2WAQ G;  2VNU D;  4A75 A;  5M5X H;  1GUO A;  2XWJ B;  2O5J C;  3TEK A;  5FK9 C;  3T16 A;  1VQF A;  5ELE A;  2EVB A;  4HNV A;  2A19 A;  4ECQ A;  1G8Z D;  1I94 H;  3HOU H;  2K5D A;  4F4X A;  2K7V A;  1A9X A;  1CZW A;  5IWA H;  1EY0 A;  3L4J A;  4JI2 L;  3GTL H;  3U4V A;  4DL7 A;  2LXJ A;  2MCT A;  4DV1 H;  5CV6 A;  1TWA A;  1Q1E A;  1EY7 A;  4LF5 H;  1JWS D;  3D8G A;  1HNW H;  2B63 B;  1PZJ D;  4LUO A;  1PTO F;  3IAY A;  3CVZ A;  5KG0 A;  2RGV A;  4ILW A;  3AMU A;  3S16 B;  1WVL A;  1B3Q A;  2EXZ A;  3TP6 A;  5C3E B;  3TY8 A;  4OO1 G;  3BQ1 A;  2R92 A;  4WJ4 A;  1Q8K A;  1M7J A;  4B3M H;  5D65 A;  2HVS A;  4HIK A;  2FIN B;  1H9R A;  2KHI A;  4OX9 L;  4DPG A;  4ID6 A;  3L4K A;  1KAA A;  1MD2 D;  4ED6 A;  2JA8 G;  2EYJ A;  4Q8E A;  5KT5 A;  3T4A C;  3WWI A;  2WB1 G;  3RJ0 A;  1GUW A;  3QR8 A;  3SR1 A;  4HJ8 A;  3ERQ A;  5D3I B;  5ELC A;  4JYA Q;  4I7H A;  4JI4 Q;  4XIG S;  2H5X A;  1KRS A;  3TS2 A;  4BBR G;  4QWB A;  4IWX A;  3M9N B;  2ZXO A;  1CSQ A;  5I5X A;  4RB2 C;  1A48 A;  4UP8 A;  5L1J A;  1J5E H;  2E2D C;  4K5X A;  3GV7 B;  1F77 A;  1TS5 A;  3KJP A;  1C7Y A;  4NZM A;  4CC6 A;  1RCV D;  3EN2 A;  5M3M H;  1VQ6 A;  3EA6 A;  3AX6 A;  1LTR D;  4E6N A;  1D1I A;  4DV2 Q;  2KCC A;  4YJ3 F;  2GA4 B;  4DK6 C;  4ECW A;  1B6S A;  3HKS A;  3GTQ B;  4O3Q A;  1VBH A;  3BYY B;  3D4W A;  3T5J A;  3U58 A;  2Y0S B;  2GPW A;  1R4P B;  1JE4 A;  4JPB W;  4DV7 L;  1V1P A;  2NVT B;  1N33 H;  1GVP A;  3MC0 B;  1O80 A;  4MN3 A;  4FS2 A;  5FLX W;  4JI8 H;  2EY1 A;  5KFR A;  3U50 C;  1LTS D;  3VYT A;  5DIS C;  4ZHQ F;  3F8N A;  4Y8V B;  2E2I B;  4LFC L;  4JI4 L;  5EZY F;  2ATL A;  2ICI A;  4WJ3 M;  2DWC A;  4PNY A;  4DAA A;  1IYE A;  1S68 A;  5LYJ F;  2V1C C;  4X65 L;  4TKO B;  4CDD C;  1A3T A;  4NB3 A;  2R93 A;  1STE A;  4A3K B;  4GKJ H;  1LTB D;  4GN4 B;  4FVM A;  5FKA C;  2IT1 A;  2YYZ A;  1DXM A;  2K28 A;  2R92 G;  4LF6 L;  5HGT A;  1IL2 A;  1AN7 A;  4RHS A;  3R2I A;  3T5H A;  1GO3 E;  1YNN C;  1SRU A;  1TS3 A;  2GN5 A;  3BG3 A;  3HOY G;  2DJG C;  1I50 B;  1GD7 A;  3GD7 A;  3WWH A;  3S1N H;  3QIA A;  5BWU A;  2XSC A;  3G48 A;  3NWT A;  4HIO A;  3DAA A;  3HOX H;  3K5M A;  2KHJ A;  2JA7 A;  2KOL A;  1IXR A;  2JYO A;  2IY5 B;  4FBT A;  1LUZ A;  1E1T A;  2ENB A;  4BXX H;  3L2P A;  4ZOL F;  1N32 L;  4F4Y A;  1D5Z C;  4G3I A;  3MJF A;  1JCK B;  1ZYR C;  3ULJ A;  4A3J H;  2CNU A;  5DG9 A;  4H44 C;  1EIY B;  5LMU H;  5DGA A;  2UXB H;  1CA6 A;  1SE2 A;  4HED A;  3ETJ A;  4JI6 H;  1B50 A;  1GOZ A;  3J7A V;  4DR3 H;  5BYA A;  3PUX A;  2CH4 W;  2F0N A;  1PA6 A;  1PFS A;  5ELB A;  1O7I A;  4IFD I;  4O7S A;  4ZQ3 A;  1O75 A;  4ABN A;  1O7L A;  1NSN S;  3RB4 A;  5KG4 A;  2AQ1 B;  2DAA A;  3UE0 A;  2JA5 A;  3M4Q A;  4O86 A;  5D3D A;  3VR3 A;  3CSW A;  4B3T H;  1YNJ D;  2R7F A;  4GOP A;  1N36 Q;  2JEG A;  4PV1 C;  4HIM A;  1EQR A;  1NAP A;  1SE3 A;  1A0G A;  5EWG A;  4HNT A;  5KFO A;  1K0S A;  1CUK A;  2XGP A;  4C3J G;  4ECR A;  1Z7T A;  1D2B A;  1UE7 A;  2F0D A;  1IW7 C;  1WTW A;  2KBN A;  2R93 G;  1E4E A;  2COG A;  3V6J A;  4ECV A;  3DF7 A;  5CYU A;  4CE5 A;  1CSP A;  3K80 C;  1I4Q A;  2I5L X;  3OHX C;  3QOJ A;  4IR9 A;  4GN5 A;  2UU9 Q;  3RR5 A;  3FKI B;  4ZI7 F;  5JVH 3;  3NK9 A;  1CQV A;  3OIP A;  4DU9 A;  4DUZ Q;  1I2L A;  3RZO B;  1CE8 A;  4LUZ A;  1LTA D;  5JPN C;  4YHH Q;  4TQS A;  2YU9 B;  3OMC A;  5G3L F;  4YB8 B;  2QF7 A;  2RVL A;  3IKJ A;  1TWF B;  4ECT A;  3RAX A;  1HZ9 A;  2A5H A;  2Q8T A;  4FFO A;  1IBL H;  1AZQ A;  3KK7 A;  4RB1 A;  5IT9 E;  4DR5 H;  1EU4 A;  1DAA A;  3CC4 A;  4GN3 B;  2W9B A;  1XK5 A;  2OF1 A;  2Z6B A;  2W6Q A;  1N36 L;  5K5P A;  3EPG A;  4C3J B;  1QVG A;  3DEP A;  1MSG A;  3C0F B;  1DJR D;  4O1N A;  4MTD A;  3T9F A;  1V1Q A;  1OO9 B;  4A3E H;  3JSL A;  2K04 A;  4L1K A;  5KT7 A;  3W3A A;  3OW7 A;  2PW7 A;  2QDB A;  4IPG A;  4X3T A;  2L11 A;  3FP9 A;  1VQ4 A;  2B63 H;  3ITP A;  4UDU C;  2UXC L;  1CS0 A;  4YAJ B;  3RB6 A;  1K28 A;  5L1I A;  2YWV A;  4DUZ L;  2FK3 A;  5JOB A;  3S16 H;  2UUB Q;  2HHF B;  4YHH L;  4K6N A;  2JA5 G;  1K8O A;  3PN1 A;  3V6K A;  4H02 A;  4U68 A;  4A93 G;  1E3P A;  3ERO A;  4M9U A;  3AB9 A;  5JUM A;  1T36 A;  1U4R A;  2C28 A;  3T1H H;  3QZ8 A;  2QGQ A;  4RGT A;  3BA8 A;  2EZV A;  5CV8 A;  1EYZ A;  4IRC A;  4JI7 H;  4K14 A;  3ND9 A;  5C0X J;  1H9M A;  5M5W H;  3OHA A;  2DY8 A;  2X69 A;  4O7T A;  1VQI A;  3RLO A;  3CRL C;  2VQD A;  3I56 A;  3CMA A;  4ETS A;  2H1E A;  4F88 A;  3H3V C;  4EGQ A;  1QOH A;  1E0B A;  4J0M A;  1FNU A;  4GNX C;  4H7B A;  2SNM A;  1JR0 D;  1PMR A;  3B6Y A;  1LAC A;  2ZJR A;  1S5B D;  2NN6 H;  1LTG D;  4BBS G;  1HNX H;  3QZ7 A;  2HJW A;  3TY9 A;  1A2U A;  2PO4 A;  1BOS A;  3GP7 A;  1EEI D;  1ICW A;  3WO1 A;  1PZK D;  1WTR A;  5KT3 A;  4C3H G;  2GVA A;  2XIW A;  5C4Z A;  2PNR C;  4PG3 A;  4M1U B;  1GUG A;  1G2S A;  3GTQ H;  1PFB A;  4J9L A;  1XPU A;  2XRQ D;  4HMI A;  2JA8 H;  3TIN A;  2OQ0 A;  3T51 B;  4PMC A;  3SGI A;  2F4V Q;  3KAK A;  3GII A;  4JI1 H;  4O3P A;  1SCU B;  5EKK A;  2ASL A;  3A74 A;  1UC8 A;  2F0U A;  3RIZ A;  2D0O A;  4BBR H;  1ZHQ A;  1WOC A;  4YBZ B;  2E2I H;  1WRV A;  1HR0 Q;  1RJR A;  3KF6 A;  4J9O A;  4PQX A;  1TII D;  1EIF A;  1KJJ A;  2ATW A;  5A2Q L;  1HNZ Q;  4GLV B;  3HS0 C;  2Q2U A;  2M00 A;  1I3Q A;  3JRW A;  1A8V A;  1SFO H;  2R7Z A;  2BDN A;  4UAI A;  1Q86 C;  4C5C A;  4AQY L;  5AFW A;  3D4D A;  3VYR A;  1AUV A;  2OTJ A;  4RGM A;  5KFT A;  1NTG A;  4DN4 M;  4DV3 Q;  4RNO A;  4DFA A;  2B2V C;  2W8K A;  4DXG A;  1BDO A;  2EJ3 A;  1QNK A;  1ZXT A;  2KEE A;  4F7X A;  4N9P A;  2JA6 A;  2EOT A;  3ZJY C;  2E75 C;  3TZD A;  3JZI A;  2W57 A;  1A2T A;  2CCZ A;  1OTC A;  4PWQ A;  4JI2 H;  3G8D A;  3T5K A;  3RLF A;  3GV8 B;  4IQZ A;  4BS9 A;  2LY7 A;  1SAP A;  2PZW A;  3Q8Q B;  4CBV A;  1F2M A;  4O3O A;  3PR4 A;  3ER0 A;  1E7Z A;  1PFN A;  4IAL A;  2DGY A;  1RYR A;  2I8C A;  2F0H A;  3VR4 A;  1Y8O B;  1HR0 L;  4DV5 Q;  3KLR A;  3OPO A;  2C22 A;  1HNZ L;  1E22 A;  1C30 A;  2ZJP A;  3DTF A;  3M4I A;  3O13 A;  4IUR A;  5D8D A;  4LMY A;  5CB4 F;  5JAV A;  4Q44 A;  1O7Z A;  4OL7 A;  4OX9 H;  2ZDH A;  3EYY A;  2YCH A;  2C9O A;  4X6A H;  3M9M B;  4OGQ C;  5KFY A;  4K2K A;  4IPH A;  4DV3 L;  1RJT A;  3I4N B;  2EYO A;  2QCP X;  4JI0 Q;  4DV0 Q;  5IYB G;  3CCS A;  1II3 A;  1WR2 A;  3CAM A;  5FLM G;  3NBZ B;  4Q8F A;  1PV4 A;  4KV6 A;  3A8K E;  4EEY A;  3ND8 A;  1D1K A;  2HGW A;  4MV3 A;  2YTX A;  1EKP A;  2M9V A;  5BR8 H;  1KJI A;  2ABJ A;  3BS1 A;  4A3L G;  3S1M B;  1TXY A;  3CCQ A;  2NZH A;  4LF9 L;  1TWH B;  3KOJ A;  2RDF A;  4JCV E;  2ZGI A;  5KNB A;  4K8I A;  1I2K A;  2N8N A;  3CEB A;  2R7Z G;  4KI0 A;  1KJ9 A;  5HV6 A;  2YL2 A;  5E7N A;  2NU7 B;  2Z04 A;  3FKI H;  4ZQI A;  4RA8 A;  1YJ9 A;  3KUP A;  1R4Q B;  3RZO H;  3ONA B;  4DV7 H;  3MFH A;  5FJ8 G;  3JRX A;  2ASD A;  1VQ5 A;  1BXT A;  2KQ3 A;  2YU9 H;  4XQJ A;  1TWF H;  2JA6 G;  4A3D G;  2GQS A;  2C5C A;  4RAZ A;  4LFC H;  1TQO A;  4JI4 H;  4JI0 L;  1PHJ A;  3HOZ G;  1SEB D;  5BPH A;  3QWN A;  5L37 A;  3CPF A;  1X3Q A;  3CPW A;  4X65 H;  2R86 A;  2W6Z A;  2D62 A;  5LMN W;  5I5W A;  2AWN A;  2MHV A;  3G6X A;  2EIF A;  2F0Q A;  4C3J H;  2F0T A;  2SNS A;  4ULL A;  2B2U C;  3DHQ A;  1Q7Y C;  4JI5 Q;  1C0A A;  4UCT A;  4IR1 A;  2E76 C;  4XYL B;  4RZQ A;  3TY5 A;  2A68 D;  5BWR A;  3GIJ A;  2J6S A;  4LF6 H;  1CTM A;  2HVQ A;  3OUZ A;  5D1O B;  3LNN A;  4DV4 Q;  3RZD B;  4LFB L;  1KIX A;  1VF5 C;  3H0G B;  2Z4H A;  3HOV G;  2PNH A;  3K0Y A;  2R3Z A;  3MR5 A;  3GTO A;  5KFH A;  2VR1 A;  5KNC A;  4GNX B;  4ME5 A;  3T54 A;  1X54 A;  2PYK A;  3R5H A;  3BYT B;  5JH7 F;  2SDF A;  3HOZ B;  4ED7 A;  2R7L A;  4YAK B;  1OXT A;  4EYI B;  4K0K H;  1YHA A;  4HJ5 A;  4A3I B;  3SVM A;  4L6T B;  3GTK A;  3MTS A;  3U0G A;  1N32 H;  5KND A;  5C1P A;  3FEW X;  4LF7 Q;  2A8V A;  5BWV A;  1IBM Q;  4DR6 Q;  2JEB I;  5ELF A;  4POG A;  1H95 A;  4GLW A;  1HJP A;  3E5N A;  1S72 A;  1I7L A;  2X0S A;  4DGZ A;  3FDT A;  3VPB A;  1NE3 A;  3S17 B;  5IY0 A;  2Q2H A;  4DV4 L;  1ICF B;  5C4X G;  4X3S A;  1Y1V A;  3C2P A;  3J7A 5;  4EFE A;  4UCR A;  3A5U A;  2E74 C;  4EGV A;  4G7Z C;  1WYD A;  5IYC H;  3NBH A;  4I65 A;  5KYI A;  4AH6 A;  3VNN A;  3U9S A;  1UC9 A;  1S5D D;  1K83 A;  4DV6 Q;  2F0I A;  4NXN Q;  1QVF A;  1RJQ A;  2HCC A;  3Q8P B;  4EEQ A;  2R8H A;  2F52 A;  2VUM B;  3LWB A;  3DTG A;  3MFG A;  5IE8 A;  5KFS A;  2P5Z X;  2FB9 A;  1WJJ A;  3GIM A;  3ULL A;  2W9A A;  1Q1B A;  1U0L A;  3MR3 A;  2ZJT A;  3RUZ A;  3PUV A;  1BBX C;  3NBI A;  2W7P A;  3GTP A;  3Q23 A;  1JWM D;  3GTL B;  4DR6 L;  1UNN C;  4CHI A;  1EQT A;  4GS3 A;  1FJG Q;  1NMG A;  3CKI B;  5JJL A;  2JP1 A;  4ZKB B;  3ERS X;  4JI8 Q;  3CRK C;  4AYB B;  2EJG C;  5I47 A;  3FHW A;  5LP6 F;  5FPR A;  1J6Q A;  4FXK C;  4C3H H;  3CHB D;  3H91 A;  3PIO 3;  3CCR A;  4M8A A;  1I4R A;  2A6E D;  3N41 B;  2YZG A;  3T9B A;  4QY7 A;  4NXN L;  4ECY A;  1N36 H;  1N8R C;  1XMQ L;  2NU9 B;  3UQ8 A;  4M0J A;  1HHV A;  4C3I G;  4A3G B;  1WSC A;  1CI3 M;  2F0M A;  1WH2 A;  4IUN A;  1K0R A;  5I2X A;  4KKT A;  3V05 A;  2FMM A;  1B3A A;  5C5M A;  4GC7 A;  1TWG B;  1BQQ T;  2YW2 A;  4P73 A;  4QIW B;  4LSA A;  4J9K A;  2UXC H;  3A55 A;  2BQR A;  3NHH A;  4QUC A;  4J15 A;  4DUZ H;  3EVQ A;  3RV4 A;  4O7Z A;  4JI8 L;  1TWC B;  5KFQ A;  5I5Y A;  1KUT A;  5GQO A;  4DUY Q;  2RCN A;  4J9N A;  4MV4 A;  1MIU A;  1FYC A;  1B04 A;  5I9O A;  4O3N A;  4BY7 G;  4O7Y A;  5KT2 A;  3RGZ A;  5DM6 3;  1S0N A;  4MV6 A;  3MXG A;  5JEA H;  2XD4 A;  1SNC A;  3I4N H;  3MHB A;  1KAB A;  5L1L A;  2I80 A;  2JEF A;  1KLG D;  2JJQ A;  3MXN B;  2HVR A;  3SK8 A;  2F0G A;  5A2Q E;  1WTV A;  2V58 A;  3MR2 A;  1NR2 A;  3FMC A;  2Z02 A;  1M8A A;  1T9H A;  1I6H B;  3J7A K;  3PMF A;  2VY3 A;  2F0J A;  2FFK B;  2Z8L A;  4EQN A;  3NTH A;  5DLG A;  4UP9 A;  2WIN B;  2K6A A;  4C1N K;  5COR A;  2QEX A;  1Y8N B;  1YHQ A;  1LTL A;  1LV9 A;  2CWA A;  1TWH H;  2R8G A;  1KAW A;  4QB4 A;  5M3F G;  4J8Q A;  4CKE A;  3S14 B;  2VS1 A;  4FP5 D;  4FDB A;  4J1M A;  3G8C A;  5EQ0 A;  3JAM L;  4FXG C;  3K5I A;  1D8L A;  3AYH B;  2OQK A;  4QMG A;  4L5T A;  2RDG A;  2C2E A;  5IIF A;  1JJG A;  1N9W A;  3A8I E;  2C35 B;  3EIV A;  4A3F B;  1PRT C;  1VQ8 A;  3RTX A;  5CA0 F;  3IFD A;  3M9O B;  3LGJ A;  3CQZ B;  4RAY A;  1JQY D;  1LTT D;  2EJM A;  4V0B A;  1L1O C;  5I2Y A;  3RN2 A;  1Y8P B;  4A3L H;  3PW2 A;  3NBY B;  3HZX A;  1RD9 D;  2UUC Q;  1I4X A;  2A73 B;  5M3F B;  4MV8 A;  3HP3 A;  5KIX A;  2R84 A;  4HJA A;  4LF4 Q;  3G6E A;  4GKK L;  4EGJ A;  4AQY H;  2NUC A;  3PO3 G;  1XYI A;  2FLP A;  4CC5 A;  4DAY A;  4ZYS A;  2UVR A;  3RZD H;  1G29 1;  3Q8D A;  4Q5V A;  4QF4 A;  3Q1K A;  1Y14 B;  3H0G H;  3IRB A;  4R4Q A;  4GC6 A;  4OHJ A;  1BCP D;  4IZO A;  3H3V H;  3UI2 A;  2UXD Q;  1G6Z A;  2A69 D;  5JJK A;  3DLL A;  1UUP A;  1EOV A;  3HOZ H;  2TMP A;  3N52 A;  3DMU A;  2HGX A;  3PIP 3;  3T1Y Q;  2DUD A;  3K81 C;  1HFN A;  5CMD A;  3QQM A;  5FO7 B;  2K05 A;  1EYA A;  3N6R A;  4IUT A;  2L15 A;  1I1M A;  2VQF Q;  3GTJ A;  1ASZ A;  5KX5 F;  5EGT A;  4JI3 Q;  3CXC A;  1ILP A;  2XVS A;  2XCP A;  1HNZ H;  3GIK A;  4XYO A;  3HFZ B;  4DNT B;  4BY1 B;  2NVY B;  2UUC L;  3PF4 A;  4RKB A;  3I4M G;  2OEO A;  2OWO A;  2R87 A;  2G9H D;  4FNF A;  3NEN A;  2D2C C;  4HR7 B;  4AYB E;  2ZM6 Q;  5LL6 X;  2W7O A;  3I90 A;  2CFM A;  3S17 H;  2RF4 A;  4R9W A;  1MZB A;  4U7C A;  4DAP A;  4O81 A;  2RSN A;  5E25 A;  4HNU A;  4K2L A;  2B29 A;  5C5L A;  4JBK A;  1RHP A;  2NVX B;  3GTM B;  4FS1 A;  1A15 A;  2UXD L;