2Q2TA

Structure of chlorella virus dna ligase-adenylate bound to a 5' phosphorylated nick
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
293
Chain Sequence
MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase/dna
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
total genus 75
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2tA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2tA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2tA01
1N8RC 2EXDA 3I7FA 1VS0A 4DV1L 3PUVA 5IYCH 1Y1WH 1R9TH 1N34L 4LF7Q 4LF9L 4A3EH 4B3RQ 1IBML 4DRFA 2RHSB 4NXNQ 4HIKA 2AMCB 2A19A 1MJCA 5IT9c 4X66L 2MO1A 3RN5A 2E5LL 1VQHA 2JA8H 2E2JH 4A3BH 2KHJA 5IYBH 1GVPA 2CWAA 1XNQQ 4GLVB 1UE5A 3GTJH 4DR7Q 4IPGA 1PH9A 3G48A 2ES2A 4LF5Q 4LF8L 2NN6G 3W1GA 1X54A 1KD1C 1S68A 1XPUA 3KDFA 1O7IA 4B3ML 2ZTEA 1OXTA 1P16A 1CKMA 4IJHA 4JI3L 3S2HH 2B29A 2Y0SG 2K75A 4UPAA 4AYBE 2GN5A 4NXNL 1N33L 2AHOB 4KHPL 3PV0A 4UCRA 4JYAL 2UXCL 4CC6A 1SE8A 5EAYA 3HOWG 3BU2A 1K9MC 4JI3Q 3VDYA 3A5UA 1C0AA 2QGQA 2ASBA 3S16H 4GN5A 1JT8A 3HOZH 2R6GA 2UUCL 1KXLA 1E3PA 4DV7L 5M5XH 1KRSA 3PSIA 4LF8Q 4OWXB 3GTPH 4ALPA 4A4IA 4LFAQ 2B63H 2R92G 3A5ZB 4JI2Q 1IBLQ 2JQOA 2EQSA 3M4QA 4DPGA 4X62Q 1EYGA 1YJNA 4LUOA 3AEVA 4DR6L 4DV5L 1Q1BA 4GKKL 3JSLA 1FJGL 1TWAH 1G51A 3PO3G 5D1OA 5GROA 2JA8G 5FLMH 3BABA 2K50A 5ELOA 3NELA 2BA1A 3RNUA 2QA4A 1K73C 4X66Q 4APVA 1VQEA 2UUBL 1E24A 2VS1A 5M3FG 1OXSC 4A3CG 3MXNB 1JB7A 2I5MX 3E9HA 4LF7L 4BBSH 1N34Q 2MO0A 3HOXH 4LNQA 4JI1Q 2RCNA 1CSQA 1L1OC 3I4OA 3HOVH 3UQ8A 4UCTA 3STBD 1HH2P 5C0XG 1MJEA 3CAMA 3CPFA 4L5TA 4CC5A 2ATWA 4KI0A 3PIPA 4JI7L 4A3KH 1EWIA 5DISC 4IFDI 2NN6I 3F2BA 2JA5G 2IHEA 4AH6A 4JI0Q 2NVQH 2PI2E 3E9IA 2Y0SE 1RL2A 4BY7H 2PQAA 1E22A 3VNNA 2ZJRA 1PYSB 2JEAI 1IBKL 1OXUA 2AWNA 3FKIG 3SGIA 1YZ6A 3BZCA 2IX0A 2JK8A 2VY3A 3ULJA 3TS2A 1HR0W 1WCMH 2PMZE 2E8GA 4KHZA 3ICEA 1D8LA 2FXQA 4YHHQ 4YY3Q 1X3GA 2HIXA 2ZM6Q 1WYDA 1PH8A 2JA7G 1I6HH 1HNWQ 2LXKA 3J81c 2F52A 3H0GG 1PVOA 1TWHH 1HZCA 4QIWE 4LFCL 3BAAA 1X55A 1N33Q 3CMEA 3PO2G 4BA1I 4LF6L 4Y52H 1FL0A 1UWVA 1VQLA 3HOZG 3GDEA 3CQZH 1AE2A 2JA9A 4P73A 3TY5A 2LXJA 4IOCA 4DR3Q 2R7ZG 4JV5Q 3EBEA 4LH7A 3HKZG 4YY3L 3GO5A 3JAMc 3RZDH 4JI6L 2R92H 1QVFA 4GOPB 3RLNA 4LF4Q 2IHFA 3AQQA 3EIVA 5K36G 1YHAA 3S1MH 4IO9A 4B3SQ 3PO3H 1AE3A 5DLQE 4DR2L 4A3FG 5C0XI 1L1OB 3J81j 3CF5A 1M1KC 1BBUA 1JMCA 2UUAL 4WJ3M 3JC66 1SROA 1HJPA 4EEQA 3D31A 1OXXK 3G71A 4QY7A 4BBRG 1X3FA 1NBWA 4PZ6A 5FPRA 3CCVA 5JEAJ 3UDXA 1VQBA 5C3EG 4UY8C 1QVCA 4JBJA 3TY8A 4BBRH 1XDNA 2HVQA 2Z0SA 2MNAA 2CCZA 3K81C 4DR4L 2F3IA 1PH4A 2D0PA 1VQKA 1HNWL 1D7QA 4RG1A 4YWKA 3WWVA 4DK3C 3F2CA 1PHJA 3CC4A 1IL2A 2JA7H 3RLFA 4WJ4A 4TVAB 2IT1A 3KOJA 3S24A 3I4NH 2Q2TA 1Q86C 2WB1G 1P8LA 2PQAB 3PCOB 4GKJQ 3U4ZA 2I0QA 2WP8J 4JI0L 4DR6Q 1VQ9A 1TXYA 4JBWA 1VQFA 2YTYA 1Z47A 1HZBA 4DR7L 4OX9Q 3KLWA 4L5SA 2CFMA 1K8AC 4LWCA 2KBNA 4HJ5A 1JJCB 5E7NA 2ID0A 2E5LQ 2GVBA 4JI4L 5LMNL 1VQAA 4R4QA 3DM3A 3KJOA 3EN2A 3UE0A 4YCVA 1VQMA 1TA8A 3NBZB 5FLMG 1VQ6A 1E1OA 4R1JA 3HOUH 4DR4Q 1VQOA 1GKHA 5GADC 4A76A 4LFCQ 2D0OA 2VNUD 4AQYQ 4A3JG 2PNHA 3U4VA 3H3VH 4A3GG 2IY5B 4A3MG 3F2DA 3PGZA 4GN3B 3PIOA 3KF6B 4A3GH 4UP9A 3BA8A 3S1QH 4DV6L 4NB3A 4OXPA 1NMFA 1LUZA 1J6QA 4H02A 1VQJA 4UCOA 1V1QA 4DR5L 1HR0Q 4LF5L 2XTIA 4LUZA 3CC2A 2JJQA 3Q8DA 4MTNA 4A3KG 1PH3A 4MNOA 2ZTCA 2K4KA 3MEFA 5J3BA 4HJ7A 1M90C 5IYBG 4IPHA 4A3LG 1QZHA 4OWWB 3TY9A 1EIYB 3PF4A 1V43A 1X6OA 2H5XA 4DV4L 2CKZB 4P72A 3S1RH 2VL6A 3K8AA 3M7NA 1MKHA 1L0WA 4DR5Q 1HR0L 1NTGA 1BBWA 1L1OA 1U0LA 3ERSX 1Y14B 1LM0A 5C0XJ 4UCVA 5C4XG 1YBYA 5HY6A 5GAGC 5C4JH 4JYAQ 5AJ3L 4QJFA 4IFDJ 5IP7G 4LF6Q 3GJXB 2KHIA 3J7ZC 1XK5A 1KL9A 3K7UC 2OQKA 4C3HH 1UE1A 4GOPA 4DV1Q 3AFQA 5M5WH 4A93G 2XGTA 4JI5Q 3AFPA 4L5RC 2YYZA 5C44G 3I4NG 3H0GH 1VQPA 2YV5A 3ULPA 4NXML 1NJIC 4DUYL 4AIMA 2UXBL 3PN1A 2N49A 3KF6A 1I50H 1IBKQ 5LMUL 2ZJQA 3CXCA 4PZ7A 1XMQL 5C44H 3HFZB 4R4OA 4DR1L 4GKJL 3H15A 3RLOA 3FP9A 3J7A5 1XNRL 3M4OH 1T9HA 2EIFA 4J15A 2K5NA 3K0XA 4JOIC 3CCQA 4HIOA 2KENA 4A3EG 1B04A 1K0RA 2WAQG 3S14H 5LMNW 4A3MH 4B3TL 1SRUA 4DUYQ 2UXBQ 3PUXA 3RTXA 1E1TA 4R4TA 1I3QH 3CCUA 2QEXA 2OWOA 1Q1EA 1Q46A 2CWPA 4X65L 4DR3L 1KC8C 1HNZQ 4P74A 3NBYB 4GNXA 1QVGA 4OONA 3T1HQ 1PV4A 3FHWA 1Q82C 3TS0A 2AWOA 1SR3A 1UE6A 5AJ3Q 2RF4A 4UP8A 5BR8Q 1HNXQ 3I2ZA 1PH5A 4JI4Q 1DGSA 2DUDA 2Q2HA 2K52A 3UDIA 5FJ8H 1X65A 1VQ5A 1VQ4A 1AH9A 1S3OA 2N8NA 1S40A 2WB1E 1FJGQ 5JEAG 2JA5H 5IWAQ 3TRZA 4A3DG 4IOAA 4QQBX 5FLXc 4EFEA 1W3SA 3BZKA 3M3YH 2R7DA 3I55A 4IFDG 1K3RA 4JI2L 2YU9H 3TREA 1WCMG 4TQUS 4UCUA 2NZHA 1CSPA 1LTLA 1X56A 1YJWA 1XMQQ 4A75A 4JI7Q 2A8VA 3CP0A 1JJGA 1VQGA 2PI2A 3PUYA 4X64L 5IP7H 2OCEA 1N36L 4PZ8A 4GS3A 3T1HL 3GTMH 3I4MG 5IYCG 1Y1WG 2YTVA 4AQYL 4BXXH 4X6AH 1TAEA 5BR8L 4QGUA 1HNXL 4YWLA 2BA0A 4ME3A 4MZ9A 5FPOA 1XJVA 2VUGA 4YHHL 3GD7A 1X9NA 1N9WA 2F4VQ 2KCMA 4X64Q 4UFZA 3M4PA 2OTLA 1L2FA 1XPRA 5IYDH 2OQ0A 1KAWA 4PMWA 4NPSA 3J81i 2VQEL 4JOIA 4BBSG 3GB8B 4GN4B 2VQFQ 1SMXA 4A3CH 1CKNA 1B7YB 2WAQE 1TWFH 2VZAA 3BA9A 3RN2A 4LFBQ 4DAMA 1XNQL 3DLLA 3NC0B 3UDFA 1V9PA 4GNXC 3JAMi 5C3EH 1I94L 3G6EA 1KIXA 2VQEQ 1Q81C 4A3BG 1Q7YC 2RHQB 3GTKH 4C3IH 3A0JA 1CUKA 4FDBA 4AYBG 4DKAC 4K0KL 3D0FA 5IY0A 1EFWA 1X3EA 4JI5L 1PH7A 1YVCA 4LF9Q 3F1ZA 4O2DA 4JI1L 1PH6A 1LYLA 4UCSA 2AKWB 1K83H 4O0AA 4POFA 4POGA 3RZOH 3W1BA 4GNXB 1XPOA 4Y7NH 1HZ9A 4DAYB 2R93G 2ZJPA 1RIPA 1TWCH 1U5KA 4R4CA 5C4XH 4DV3Q 1PH2A 1FVIA 1G291 1Q12A 3BJUA 4RMFA 3L7ZC 1N32L 3QWUA 4E6NA 5LMNQ 2CQOA 2MQHA 4DV4Q 3CCSA 3UE1A 4DV5Q 3KFUA 3J80i 4LH6A 4JBKA 2UUAQ 3T1YL 3OTOQ 2UU9Q 1VQNA 1I94Q 1PA6A 3HKZE 4OX9L 1JE5A 1ASYA 2HT1A 4PG3A 2HVRA 4HJ8A 3CMAA 5D1PA 5H1SE 4LFAL 2JA6H 4P75A 2UXDQ 3HOYG 5JJIA 5LMUQ 3L2PA 3K7AH 1IBLL 4YCWA 1N32Q 3UDGA 3F8TA 3W5OA 4DUZL 1J5EQ 1EUJA 1BVSA 1VCIA 3CCLA 3IRBA 4BXXG 2UUCQ 3HOYH 1A8VA 3TEHB 1PFSA 3PF5A 3STBC 1NY4A 4A3JH 3NEMA 2BH2A 1KHIA 5IYDG 4KHPQ 4GLAC 1UE7A 4KLKA 4YCUA 4HJAA 2UXCQ 4K0KQ 1K8GA 4YWMA 1KQSA 3S15H 4C2MH 3S17H 1SLJA 1HNZL 1EOVA 4JC0A 4X65Q 3A74A 1PYBA 4OO1I 2ZM6L 1YJ9A 1FGUA 2ZTDA 3B6YA 1ASZA 3GTOH 4XIGS 2HVSA 1VQ7A 2NZOA 1Z9FA 2B3GA 5D1OB 5M3FH 2VW9A 2UXDL 2VUMG 1XMOQ 2K5HA 4LW1A 1YITA 4B3MQ 2HIVA 3H3VI 1VQDA 3HOVG 4DR2Q 4BY1H 1SN8A 3RR5A 4DR1Q 1GO3E 3GTLH 3GTGH 1NMGA 3CCRA 3T1YQ 4A3IG 3I4MH 1JJ2A 4BA2I 5IWAL 4A3LH 1YNXA 3HOWH 2Q2IA 1WJJA 3NENA 1KRTA 3L0OA 1VQCA 2L15A 1VQ8A 3CW2C 4JCVE 4DV3L 1YIJA 1S72A 3ZJYC 4A3IH 3GTQH 4DV2L 5IP9H 3CCMA 1A0IA 4JI8L 2F4VL 4JG2A 1C9OA 2BH8A 1UEBA 1YEZA 3E0EA 1QZGA 5JJKA 4B3RL 5HGQA 1A63A 1CKOA 4LUVA 1WFQA 3OW2A 1N36Q 2NVTH 2R7ZH 3KYHC 2N3SA 4DNIA 1QUQA 1WOCA 2Z6KA 1XTDA 5M3MH 4DV2Q 1PH1A 2B63G 2E2HH 2NVYH 2I5LX 1YI2A 2K5VA 3TQYA 4DUZQ 1J5EL 5IE8A 3KDFB 2D62A 2N78A 4HJ9A 3K80C 3HOUG 3U58A 4GKKQ 2JA6G 4LFBL 4IPDA 1A62A 1H95A 1IYJB 2JEBI 3ER0A 1TWGH 5GAHC 4A3FH 1XNRQ 2LSSA 2JE6I 2A1AA 4UP7A 4LF4L 5M5YH 2NVXH 2IX1A 4L5QA 4DV0Q 2Q2UA 2VQFL 1CKNB 3CCEA 2I5HA 3CPWA 1XMOL 2GVAA 1NE3A 1C7YA 3I56A 4QL5A 4HIDA 1YHQA 4JV5L 1GD7A 4P71A 4XTCS 5GAEC 3HOXG 3CCJA 4DV6Q 2HHHL 2VUMH 1QUQB 4EX5A 3M9BA 1HZAA 1EIFA 1IBMQ 4OWTB 4C3JH 2MFIA 4GOPC 5GQOA 2DGYA 3U50C 2K14A 3S1NH 4A3DH 3PUWA 1VQIA 3ULLA 3J80c 1Q8KA 2C35B 2YTXA 3KF8B 2R7FA 3LGJA 1WI5A 4R4IA 1EQQA 2UUBQ 1G6PA 1YHBA 4JI8Q 1BKBA 1IXRA 1B8AA 2HHHQ 3G4SA 1MIUA 4HIMA 1OTCA 4IPCA 1SFOH 1B70B 3S2DH 3M85A 2HQLA 2OTJA 4JBMA 4BY1G 3PUZA 3FKIH 4DV0L 4GLXA 1W2BA 4B3TQ 4BY7G 2ALYB 3NBHB 5FJ8G 1E7ZA 4B3SL 3JSNA 2R93H 4EQ5A 3AYHB 4X62L 3KJPA 1Y1VH 3CD6A 2E2IH 5JJLA 3OTOL 2UU9L 1GM5A 4JI6Q 2WFWA 3PO2H 2Z6KC 3CC7A 4DV7Q 5IP9G 5ELNA 1I5FA 1Y1VG 2V1CC 4DK6C 4EFBA 4IJLA 1IZ6A 4NXMQ 2KCTA 4OO1G 4A93H 1OXVA 1EQRA 5M3MG 3HKSA 3OYYA
chains in the Genus database with same CATH superfamily
4HMIA 3FPPA 3I7FA 4DR2H 5KNDA 1AN8A 1RHPA 3K0YA 2EJ2A 5IYCH 1Y1WH 5I5SA 1TY0A 3GIQA 4ED3A 3KHLA 4A3EH 4B3RQ 4DRFA 1Z2PX 4HCEA 3QR8A 1AZPA 2W9BB 5KGUA 3I91A 2JA7A 4JV5H 1Y1WA 1CA6A 1MJCA 4I7AA 4PNYA 2EJFC 3RJ0A 3T9EA 1A6XA 4O3PA 1LTSD 5EPLA 4R9WA 4DGZA 3GV8B 3E0JA 1HR0H 3GTQA 3IG0A 3TBIB 4OEMB 3K5LA 4ETSA 1D5XC 3S14B 1Y8PB 2K03A 2ES2A 1MBYA 4YHHH 3T56B 4A3IB 3KDFA 3GTQB 2X0SA 3NTIA 2CVRA 2QK4A 1KLUD 1XTCD 3H94A 4K14A 2K75A 3BDOA 3R3OA 5KYIA 3U9SA 4U68A 1QILA 4JYAL 2F0IA 4CC6A 5EAYA 3FMAA 1CQJB 2ASBA 3S16H 4B3MH 1G2SA 2FJ2A 2I07B 1JT8A 1BUVT 3HOZH 4O7RA 3DXJC 2K05A 1CZGA 1E3PA 2COIA 4OWXB 4XX0B 4A4IA 3V6JA 1IL8A 5HV6A 4JI2Q 3S1MB 1IBLQ 4G7OC 1JKJB 5DMXA 4FU0A 3M4QA 4LFCH 3NBHA 1YJNA 4LUOA 2CQYA 4UHVA 2DIKA 1Q1BA 4GKKL 1HUMA 1FJGL 1TWAH 5EGTA 3FDTA 4MIUA 1B2TA 5EPJA 4LMYA 4R8UA 2JA8G 3BABA 1OWTA 3OHXC 4EQNA 3G6XA 4FFMA 3RNUA 4DF7A 4X66Q 4H7BA 3JAML 2QCPX 3HRZC 2F0PA 4F87A 1PRTD 2PNRC 2TSSA 3MXNB 4KY6A 1JB7A 5ELDA 4BBSH 2XCPA 1N34Q 2MO0A 5DNFA 3HOXH 4JI1Q 2RCNA 4MV4A 1TWFB 5KT7A 2PW5A 4UCTA 2V9WA 4JI3H 1HH2P 5C0XG 4L5TA 2YL2A 4KI0A 1A3UA 4FF2A 2F4VH 2IPKD 1QOHA 3PIPA 5JOBA 5IGGA 4JI7L 5CAEB 3GTPA 4IFDI 2JA5G 5KG4A 3CKIB 4O7LA 4IUQA 2Y0SE 4A3KB 1PTOC 2JN4A 2ASDA 1KJ9A 2SDFA 4UAIA 4DN4M 3SGIA 2JK8A 3TDQA 4ZYSA 3R8BA 4KHZA 2E8GA 1HR0W 2Z4HA 2MJ8A 1SFOB 4WHXA 4RCOA 3MAQA 1PH8A 1WYDA 3RBEA 2LXKA 5C4ZA 3PO2G 2SOBA 1TWAA 2UU9H 2EJ0A 1FL0A 1H9SB 1UWVA 1SJED 2PYKA 3P20A 1G2WA 3V4SA 2C28A 1S0OA 3FKIA 1JOQA 3EBEA 2HQEA 3HKZG 4YY3L 3JAMc 3MR3A 2R92H 2EE1A 2N55A 5KT4A 4GOPB 1S5BD 3EIVA 3U9OA 5K36G 3M4OB 2RGRA 1F2MA 5C0XI 2EYLA 2UUAL 2B8FA 4J9PA 1JMCA 4JI6H 2F0OA 1HNWH 1JDEA 2C2DA 5KT2A 2UXBH 3LMLA 3LULA 2J4XA 3D31A 1ZQ7A 3QOJA 3VR2A 3G71A 4NLGA 1NBWA 4Y8VB 5FLXE 1SCUB 4IAJA 4J9RA 2XWBB 1VQBA 4LFAH 5E3FA 1U4PA 3V96A 5BWUA 5DGBA 5J22A 1GHJA 1PH4A 1O78A 5KFFA 3WWVA 2IW3A 2XRSD 1BXTA 3CVZA 2DPIA 3A7LA 3OWFA 4JI5H 3RV3A 4DV1H 2OT2A 2HGWA 2PQAB 5D14A 3G6YA 4C1NK 2I0QA 2K33A 4JI0L 5JVH3 2NVQB 1I1KA 1VQ9A 2W6OA 1LT6D 3GIIA 1VQFA 5A2QW 2KVMA 2CFMA 1HUNA 4LWCA 2HGXA 2KBNA 5E4WC 4F50A 2VB3X 2E5LQ 4JI4L 3KJOA 4U673 1TA8A 1VQ6A 1E1OA 3HOUH 3K57A 1JORA 1VQOA 3QG1A 4LFCQ 4IHJF 4V0BA 3GTMB 1UC9A 1Z2NX 4A3JG 3T9BA 4EBDA 4KHVA 3U4VA 3H3VH 4A3GG 5KFMA 2HUGA 2ZXPA 5LL6S 3HOZB 4ECZA 3BA8A 4JUZA 1EYAA 4XXEA 4DV6L 2CQAA 2WDTA 1L2ZA 4OXPA 3UZBA 1NMFA 4K8IA 4NMZA 1J6QA 2V59A 1YNND 1V1QA 1HR0Q 5L9XA 2XTIA 3Q2OA 4MTNA 4HMJA 5C1OA 1EUCB 2R61A 2K4KA 4KD4A 4O4HF 4CDEC 4EG0A 1A3GA 2DY7A 1ZAUA 1E4GT 4RAZA 1G91A 3JZFA 3PF4A 2CW8A 4MTKA 1B53A 3MWDA 3HKZA 1L0WA 4R8UB 2CNQA 1U0LA 5C44B 3H0GB 2NVYA 1YBYA 2SNMA 3CQZA 5DQGA 4IFDJ 2LY7A 2KHIA 3J7ZC 2QKIC 4DV0H 1PMRA 3TZDA 1Y69U 4A3GB 5KFNA 2XGTA 3T5LA 3R5FA 2YYZA 1SE3A 5C44G 1RTOA 1RYSA 3TIGA 1A0GA 2PVPA 3H0GH 3VR3A 2UXBL 4AIMA 3PN1A 2R86A 1ENAA 3KF6A 1I50H 5J2UF 5LMUL 1IKLA 3CXCA 4PZ7A 3HFZB 4LSAA 1N36H 4GKJL 3TW6A 3FP9A 1T9HA 4J15A 5T1IA 1NNXA 2KENA 1FYCA 1I3QB 3CRLC 2UXBQ 4DR4H 4ECTA 4R4TA 5EJWA 1QJOA 2BDNA 4YJ2F 1T94A 1GYFA 3K58A 2OWOA 5DG8A 1KC8C 5C0XH 1F2LA 3FMCA 1WTWA 4P74A 4QW8A 1JR0D 3WDNA 1G8ZD 4YAKB 1B1ZA 5CV5A 5K36H 3A54A 4Q5VA 4OONA 5DQIA 3T1HQ 4J0MA 3FEWX 4OX9H 5F9LA 5AJ3Q 1KJJA 2RF4A 2J6TA 2V4QA 5EBDA 1PH5A 1GGOA 1CQVA 1UEAB 4O7YA 4RB0A 5C5JA 4XYMB 1B44D 1AH9A 1VQ5A 5KFCA 2K1BA 1S3OA 3TRZA 2N88A 5I5TA 1TWFA 4BBRB 5FO9B 4IOAA 4QQBX 4X65H 2M2LA 4DLKA 2F0VA 2NU6B 2XNAC 2R7DA 5IGCA 4JV2A 1SNDA 2JA5B 4IURA 3TREA 1WCMG 1ESRA 2A69D 2MHVA 5CR3A 2GPWA 4M1UB 1CSPA 2NZHA 4LAAA 2PZUA 3SEBA 4A75A 2B63A 3CP0A 3MFYA 1MSGA 4XZ3B 1EHIA 1FKAH 2FPIB 3PUYA 4X64L 2O03A 2K01A 2OCEA 4DR1H 4OELB 4GS3A 1AEXA 3M4YA 4RKLA 4BS9A 5BR8L 4QGUA 1HNXL 4YWLA 5KFAA 1V51A 1XJVA 2VUGA 4O3RA 2K5DA 4O2AF 2KCMA 4UFZA 2OQ0A 2YRXA 5DG7A 3W2DA 1F77A 1B6RA 1KDAA 1JLLB 3GB8B 5BMVF 3D4WA 1N34H 3ONAB 1SYDA 4FXKC 2JA5A 1S5ED 1EQTA 3RUZA 4BWGB 3RN2A 1PFBA 1DIKA 3L3OC 5DGIA 1XNQL 3PVXA 3CU7A 3RMHA 3UDFA 4GNXC 3JAMi 5C3EH 3G6EA 4FVMA 3KLSX 2W6MA 2RHQB 4NP5A 5HGTA 3GTKH 2NVXA 3A0JA 1CUKA 1SYFA 4K0KL 4HR7A 4X62H 1JB3A 3D0FA 3FPUB 4LF9Q 4IUTA 1CHPD 2W57A 2V4DA 4UCSA 1KJIA 4CMFA 1E4EB 3W1BA 1K8MA 4Y7NH 4DAYB 3LWEA 2VB2X 2R87A 5KFOA 4QWDA 3GTOA 2VQFH 2I80A 3C1FA 1Q8IA 4EYIB 2V5AA 3M4IA 2RSOA 3T1YL 2UU9Q 1I3QA 2HDKA 1I94Q 5JVLA 1PA6A 4CMDA 1UUPA 4FYDA 3Q8QB 1JE5A 1ASYA 2HT1A 4PG3A 4K0KH 4EYHB 4P75A 2UXDQ 5JJIA 2FJZA 2ZM6H 2QW7A 3D4DA 1IBLL 3I4MB 5DM73 1AZQA 3F8TA 3W5OA 5ELEA 1BVSA 1VCIA 3K5NA 3CCLA 3JZ6A 1S0NA 1STYA 4RH6A 3H40A 3HOYH 1X3PA 3VA7A 2YS7A 3PF5A 3TEKA 5BN3A 1NY4A 2ASLA 3JAMW 2EOTA 1KHIA 4KHPQ 5G3LD 4YCUA 4HJAA 2R8KA 1K8GA 1KQSA 4C2MH 2RA4A 1HNZL 3I4LA 3A74A 4Q44A 1DAAA 1YJ9A 1ASZA 3H0GA 1I50B 3GQBA 1DZ1A 2FMAA 1R9TA 2B3GA 2VXWA 3HG9A 4DA2A 1OO9B 5K5PA 5CV7A 1WTXA 1XMOQ 4EGJA 5TSSA 1SN8A 1PFNA 4A3IG 3BYTB 3H91A 4XQJA 1SE4A 4BA2I 1IYVA 4A3LH 2UVVA 1PFMA 4JV0A 3RGZA 4A3IH 3GTQH 4DV2L 2EJMA 4CDDC 4AYBB 3GIKA 1A0IA 4JI8L 3H4BA 2BQRA 2F4VL 3NP8A 4FF3A 1I7NA 1UEBA 4LFBH 3T54A 2PN1A 4LUVA 4GC7A 3KYHC 3GTKB 4JI4H 5KFDA 1S10A 2C5CA 5CA1F 4ID6A 2W9CB 2F0HA 2W9AA 4J6HA 3KDFB 4HJ9A 3HOUG 4A3BB 2HCIA 4ED1A 2JA6G 1FGBD 4IPDA 4O4IF 3PW2A 1DXMA 3DEPA 2Q7DA 2ZJTA 1JE4A 2LSSA 1DOLA 3HOVB 2B2VC 4KJNA 1CKNB 3K59A 5KG1A 3CPWA 1XMOL 2GVAA 3J80E 3OHAA 1C7YA 4K6NA 3I56A 4ECWA 3DF7A 4IUPA 5GAEC 2IX3A 2VUMH 1EWHA 1IW7C 2MP1A 3M9BA 1HZAA 4TV9F 4K6LA 4NXMH 1IBMQ 1T5XD 2LKVA 2F0MA 2DGYA 4G7HC 2K14A 4O83A 3NTHA 5C4JB 3J80c 1Q8KA 4NDXA 3TINA 1EQQA 2L1BA 3SE7A 4A3EB 4JI8Q 1EIHA 1ZHQA 4HIMA 4ECVA 3F2UA 4QB4A 4F4XA 2E2DC 1B70B 3S2DH 1L0XB 2HQLA 1NAPA 4F8MA 4JBMA 4BY1G 4DV0L 3LWUA 2VPQA 4KK7A 3GTJA 3NSWA 5C6AA 4I4TF 4CGYB 1GUNA 3AYHB 1Y1VH 2RDFA 4C3JB 1GJXA 3T99A 2UU9L 4ZK9B 3CC7A 4DV7Q 3C3LA 2V1CC 4DK6C 5NUCA 4TKOB 5L37A 2IBKA 1OXVA 1C30A 1DM0B 2EXDA 1VS0A 3GQCA 4DV1L 1EQVA 2F0FA 2ICIA 2PMZB 5I9OA 5KFIA 2EPBA 1I6UA 1CE8A 1TR5A 2A5HA 2A19A 4HIKA 4X66L 1L0YB 2MO1A 5ELFA 2E5LL 4R7RA 5FLXL 1W6JA 3WNZA 4NKLA 5IYBH 4I55F 1GVPA 1SNCA 1A9XA 1EEID 4GLVB 1UE5A 4DR7Q 3H20A 2RGVA 1KJ8A 2W6QA 4FM9A 3KUPA 1R4QB 1KD1C 3EPIA 1XPUA 4B3ML 3NWTA 1KAAA 1OXTA 1P16A 5CV8A 2FP4B 2HHFB 2B29A 3I4NB 3TP8A 1SYBA 4MA5A 1SE2A 5BPFA 4H44C 3X3MA 1KC7A 4NXNL 4A3EG 2AHOB 3HP3A 3KHGA 3R93A 1BQQT 4TSSA 1FD7D 2UXCL 1EZ1A 1SE8A 2IMWP 1K9MC 2W7OA 4RKBA 5KFVA 1LABA 4FBTA 2R6GA 2RBMA 3DTGA 4DV7L 1KRSA 2A69C 2AQ1B 1EKFA 3GTPH 4ALPA 2B63H 4B9XA 4LK1C 4ED2A 2RQXA 1GSAA 5BN5A 2AU0A 4MV1A 1PYWD 3JSLA 3T51B 1G51A 2EYJA 3K5OA 4JW0A 2EJ3A 2BOSA 5I4DA 2PO4A 4O3NA 2F0EA 3NELA 4FP5D 1F9RA 1FNWA 2BA1A 4C56C 4B3SH 3HOUB 1LTTD 3VYTA 1GLVA 5FO7B 4IWXA 5FD5A 5KFBA 2UUBL 1E24A 1Q3LA 5M3FG 2JEGA 4N8X1 3GIMA 5EBCA 4LF7L 2C2EA 2UVUA 4APMA 4LNQA 4GKJH 3UQ8A 3CAMA 5I5XA 1AW7A 3A8KE 4YAJB 4CC5A 2ATWA 1LT5D 4YR0A 1ICFB 1K83B 2NTSA 2YU9A 1EWIA 3F2BA 2PI2E 3UZOA 3OHBA 2ZJRA 5ISRA 2IJ0A 5JVDF 1EL0A 2AWNA 4KV6A 1YZ6A 3BZDB 2QILA 4RAUC 1YNJD 3R9RA 1XMQH 2WV6D 1D8LA 1I6HH 3R2TA 3TN2A 1HNWQ 5C4XB 2JA7G 2P0AA 1C48A 2F52A 1PVOA 1O7LA 1TWHH 3A55A 4O7WA 1HZCA 5LYJF 1X3QA 3Q8RB 4BA1I 3OTOH 2AUKA 3HOZG 3GDEA 3TY5A 1AE2A 2AGQA 4P73A 4LH7A 1S4ZA 4JV5Q 2F0WA 4O2BF 3VYSA 5I6YA 3EPGA 3NWSA 2ATLA 1VF7A 2XVSA 3RZDH 3SNOA 3TW7A 3L9AX 5IIFA 1QVFA 3RFCA 3T4AC 4MV3A 3L4KA 4LF9H 1HRJA 3MFGA 4B3SQ 3N6RA 4DR2L 1G6ZA 4RA8A 1STGA 4X3UA 3NGDA 1BBUA 3T5KA 1A2UA 4WJ3M 3M9NB 1SROA 2XD4A 4DUYH 1BNCA 1UAPA 1DV2A 4QY7A 2Y4RA 2SNSA 3QQMA 5C3EG 1I4QA 4JBJA 4HEDA 2UVWA 4LF5H 2Z0SA 4RGTA 1HNWL 1IBKH 1VQKA 1PK8A 3PR4A 1PHJA 1GUWA 4HTHA 3G8CA 4HYKA 1FJGH 4C3HG 4WJ4A 4IUVA 3KOJA 4TVAB 4DXGA 3GTGB 2Q2TA 1Q86C 4Q43A 2WB1G 3QZ8A 1VBHA 1EU3A 1P8LA 3WOFA 2B2WC 4DR6Q 4ZOLF 3ETJA 4LF6H 1TXYA 2YTYA 3Q23A 4NW2A 3VYUA 3WWJA 3CRKC 3GP7A 1I1MA 4MV7A 5E7NA 4FS2A 4RNNA 2EZVA 1B4OA 3S17B 2L12A 3EN2A 3UE0A 4YCVA 5FLMG 4DR4Q 1EY7A 3ND9A 2X6GA 3EQLC 1IW7D 2EYMA 2PNHA 2X69A 1EY6A 5FO8B 5HURA 4A93B 2IY5B 1LT4D 4HR7B 3F2DA 4MA0A 5EZYF 4A3GH 5JUMA 2L5TA 1SEIA 2Y0SA 4NB3A 4QUFA 1Y1WB 3NPPA 4H02A 1SSOA 4DR5L 1DCZA 4J9OA 3CC2A 4GZYC 2JJQA 2K04A 2FMCA 4KMUC 4A3KG 3M3YB 4Q0YA 5J3BA 4HJ7A 3MEFA 4RUAA 1TIID 2ODTX 3TY9A 5M5YB 4ZUIA 2RCFA 1WCMB 2H5XA 4P72A 4DV4L 3S1RH 1DOKA 2VL6A 4FBUA 2IL8A 3K8AA 5CR5A 1M7JA 2E5LH 1HR0L 1WSCA 5C0XJ 1L1OA 3ERSX 3WO0A 3G8DA 5HY6A 4N9TA 1I2LA 5F2DA 4WJWA 1XWEA 4LF6Q 4PDBA 2HDMA 1XK5A 2C2RA 3WO1A 4JI7H 3MWEA 3PO2B 1EYZA 2KEDA 4GOPA 2R85A 4A93G 4IRKA 3PIO3 4CKEA 2H1EA 2CW0D 5T14A 2E2HA 1GOZA 4XYLB 1ET6A 3I4NG 4CBVA 1VQPA 2YV5A 1Y1VA 3ULPA 2CH4W 4DUYL 3CSWA 2EYPA 4QWBA 2N49A 1IBKQ 4DL7A 2D2CC 4I65A 2JEIA 1PX2A 5C44H 5C3WA 4C5BA 4R4OA 2VA3A 1RJRA 3RLOA 1LO5D 4ZCKA 1KTAA 4XYOA 3VPBA 2EIFA 4ECRA 4XDXA 4HIOA 2IP4A 1K0RA 5BPHA 4HNTA 4A3MH 1N32H 4DUYQ 2GLTA 4PMCA 3VYRA 5EWGA 5D3DA 2D9UA 2FK3A 3VMMA 2CWPA 1Q46A 4MTDA 4X65L 5I9PA 4DR3L 4TQRA 3NBYB 3DAAA 3H4DA 5C4HA 1WD0A 1K83A 1TWAB 1PRTC 4ZLTF 2B2WA 4DUZH 5EKLA 4QWAA 1Q82C 2XCLA 3PO3B 4Q4DA 2WACA 1SR3A 1UE6A 1RK5A 1PZJD 2HGSA 4AYBA 3FDSA 2M00A 2W8LA 4JI4Q 4KN7C 2DUDA 1C8CA 3UDIA 1EKVA 4X3TA 2YS6A 2HVSA 3V2TA 5JEAG 5IWAQ 3U54A 1BDOA 1RODA 5KT3A 4G3IA 4IFDG 3EFXD 4K2KA 4JI2L 2YU9H 2PBZA 2ZDQA 3PW7A 1V8QA 2VUMA 2D5DA 1YJWA 4JI7Q 2O5JC 2A8VA 1MSHA 1JJGA 1HHVA 3T9FA 3KXYT 1N36L 2FKLA 1HQMC 5LL6X 2H4OA 4DR5H 2YTVA 4AQYL 4BXXH 3T53B 2UXDH 5M3FB 1Y8OB 5JAVA 3QB3A 4ME3A 4MZ9A 5D65A 2VA2A 1X9NA 2F4VQ 3PZPA 4X64Q 2RVLA 3T9CA 3IKJA 4ULLA 3PIP3 1XPRA 5IYDH 5AFWA 1Z6HA 2JP1A 5DAAA 2F0SA 3EA6A 4NPSA 3VOTA 3GTLA 4JOIA 4GN4B 2VQFQ 2WAQE 2DJGC 2G5DA 3P1HA 3BA9A 5JVG3 4YR3A 4DAMA 3NC0B 4AQYH 2KUMA 1V9PA 5M9OA 1I94L 2RDIA 1KJQA 5KFYA 3SK8A 3MA2B 2W6NA 4MN3A 1KIXA 4C2MA 3AU7A 1DV1A 3AX6A 2QEJC 3LX0A 1Q7YC 1HTLD 4O7VA 4C3IH 3QFFA 1I6HB 4AYBG 4BY7B 3GTMA 5FR9A 2EYOA 1X3EA 5IGEA 1PH7A 3HS0C 1YVCA 3U9TA 5CMDA 2L55A 4V190 2AKWB 3RZOH 3BVMA 3N40P 1XPOA 4KKUA 2B2TA 2R93G 3I4MG 4DV3Q 1W93A 4JVZA 1PH2A 2G9HD 4RMFA 4K2LA 4E6NA 3BJUA 1N32L 3QWUA 4ED7A 2AGOA 4DQNA 2AQ2B 3KLSA 2MQHA 4O1NA 3CCSA 3KFUA 3E5NA 5KFZA 3BJYA 1SDFA 3J80i 4LH6A 3TQTA 3OTOQ 3LP8A 4FFLA 3P75A 1JIHA 4NYEA 1PTOD 1HFNA 5I5UA 3CMAA 5D1PA 5H1SE 5K2MA 5LMUQ 3L2PA 1PTOF 2W6PA 1N32Q 3UDGA 3QWNA 3X3NA 4QIWA 4P2CB 4CJ1B 1RK6A 1DD2A 4Q8FA 3RGXA 1O7YA 3A56A 4X66H 1A8VA 1PFSA 2P5ZX 5DAUA 1V4YA 2FHTA 1BCPC 3DHQA 3KBXA 2JSOA 4G57A 1O7ZA 4LSXA 1KDBA 5CYUA 3GTJB 1PZID 4X65Q 5A2QL 1FGUA 5BWVA 3B6YA 4DU9A 1TWCA 5F9NA 2NZOA 2BDOA 4RCNA 4IZOA 5D1OB 5M3FH 2ZXOA 4L1KA 2KOLA 3E5SA 1YITA 1VQDA 4YBZB 5BN4A 4DR1Q 2E2IB 3H09A 1JOOA 1AN7A 2WKCA 2FFKB 1YNXA 5I2XA 3HOWH 2Q2IA 3P7JA 1WJJA 2L15A 1VQ8A 2BQ3A 4Q8EA 4DV3L 2PPBC 4N9PA 3ZJYC 2CNVA 3BG3A 4DAVA 4DL6A 1DJRD 1IBLH 2ZT9C 1C9OA 5KG5A 1H9KA 3E0EA 5JJKA 1KABA 1O75A 2K32A 3DUZA 4K5XA 1N36Q 2R7ZH 4HN2A 4DK1A 2N3SA 4DNIA 4QSHA 4R8NA 1MI2A 1QUQA 1XTDA 1PH1A 1QCBD 4DV2Q 1XNQH 2E2HH 3TQYA 3T1HH 4JI8H 3VA5A 5IE8A 2N78A 1KDCA 3J7AV 3OUZA 2YZLA 1ULZA 4FFRA 2NUCA 4LFBL 1A62A 4X64H 1IYJB 3ER0A 3OMCA 1TWGH 2A6HC 4KKTA 2JE6I 1WRVA 5CGKA 5A2QE 3GTPB 5M5YH 2NVXH 4DV0Q 1YNNC 2Q2UA 2R7NA 3CCEA 1NCVA 5KT5A 1WTVA 1YHQA 2GQRA 3V6HA 4JV5L 1GD7A 4P71A 5I5VA 2GPSA 2HHHL 2CW0C 4ZHQF 5CA0F 4EX5A 4E6IA 5CC4A 3OPOA 1ILQA 1JX4A 2KCCA 4DAPA 4H13C 2WKDA 3D6WA 1MHWC 1A2TA 5I5WA 4OHJA 4DL3A 3KF8B 4XQNA 4M0JA 1LTGD 1WI5A 2UUBQ 1IOVA 3E6ZX 3URYA 4PBCA 1JXLA 1BKBA 3T13A 1B8AA 3ZYYX 1WD1A 1HQRD 5FOBB 4G4KA 1TWCB 4IPCA 1SFOH 1H9MA 2OTJA 2XN9C 4K5WA 3U55A 4B3TQ 4BY7G 5C1PA 1E7ZA 1ZYRD 2R93H 4X62L 2R3ZA 3OWEB 2F0TA 1K1QA 1E2VA 2EYFA 3OTOL 1GM5A 3EYYA 5CV4A 2Z6KC 1GHKA 1Y1VG 2HG8A 3KAKA 4FE2A 4EFBA 1WH2A 4GC6A 4NXMQ 2KCTA 1N56A 2A6ED 1BGWA 5M3MG 1ML0D 1N8RC 4A3JB 3S1QB 3HT5A 5L1JA 4LF9L 2V58A 1AUVA 2A6EC 2RHSB 3D4RA 2E76C 4NXNQ 4ZI7F 3K7AB 1TT2A 4J8QA 5IT9c 1XNRH 1EY8A 3I70A 3DTFA 3UFXB 2JA8H 1N33H 3MTSA 2KHJA 4WRDA 2A1HA 2KECA 3V4ZA 2CWAA 1XNQQ 2HJWA 2B8GA 1SNQA 2AQ3B 5EPKA 5KFWA 2KJXA 5BWTA 2F0QA 1O7IA 2J6SA 1M4VA 4Q45A 2VPSA 1K3BC 1CKMA 3MWYW 2QDBA 3LNNA 4IJHA 4JI3L 1LTAD 3AMUA 2Y0SG 3NUCA 3S2HH 1CM9A 5DGHA 4MAMA 4UPAA 4K5VA 4O42A 5M5WB 3GTKA 3T16A 4CHTB 2JA7B 4KY5A 5IGBA 1N33L 5KS8A 1B3QA 1TS3A 3PV0A 4UCRA 1NSNS 4RGMA 3HOWG 4JI3Q 3D3RA 3VDYA 4FFPA 5LMNH 1C0AA 2QGQA 4RNOA 3TIIA 4GN5A 4ABNA 1JC7A 5I6WA 5M5XH 4LF8Q 4F4YA 3I90A 1CI3M 4LFAQ 4J9NA 1SXTA 2ZGIA 1EUDB 2R92G 3A5ZB 2XGQA 3AB9A 4KTAA 3PW0A 4IRDA 1IKMA 4CKBA 4O3QA 4TVIA 3PO3G 1H9JA 3K5MA 1S0MA 5GROA 2K50A 5ELOA 2PZTA 3HKZB 4HCSA 2W70A 5KG3A 1GUTA 2QA4A 2R7ZB 2MPMA 4IWYA 2ABJA 2ZXRA 2E74C 2VS1A 3KF8A 1F2YA 1OXSC 3HEJA 3KLRA 3BVZA 1ENFA 3E9HA 4L8JA 1SMYC 1OBGA 1S5FD 3NQIA 2OF1A 2NN6H 3I4OA 5KRUA 3OIPA 1SFOA 1MJEA 1HA5A 3V05A 4KJOA 4WORA 1K8OA 2BR0A 2RSNA 2JEJA 2FLLA 3C1EA 2EY6A 4A3KH 1E2ZA 3CCQA 5DISC 5LA6F 2UXCH 2IHEA 3OMGA 4JI0Q 2NVQH 4ED0A 5KFJA 1XYIA 2BCOA 1ICWA 1E22A 2FK1A 3VNNA 1JWSD 2NTTA 2JEAI 1OXUA 2YZMA 5EOYA 2XIWA 3NBIA 3BZCA 2YYAA 3TS2A 2DNCA 4O4LF 1MZBA 4RUCA 1WCMH 3S1RB 2PMZE 5JH7F 2FXQA 4YHHQ 3PQIA 2HIXA 1V1PB 3J81c 2HCCA 3VPCA 4C1NI 4QIWE 3H6MA 4LFCL 5HNEA 1EEFD 2MCTA 1I1LA 4Y52H 1GSHA 5I5YA 3ND8A 1VQLA 5BWRA 2JA9A 5KFPA 3A7AB 2LXJA 4IOCA 2R7ZG 4J9MA 4O3OA 1SYCA 3J81E 4FFOA 1MD2D 3CHBD 2B2VA 4M8AA 3S15B 4DIMA 4QMGA 2IHFA 2Q8TA 1YHAA 3S1MH 4IO9A 5GONF 1AFPA 4FS1A 1EZ8A 1LT3D 3HOYB 3RUPA 1L1OB 3CF5A 1CTMA 4ECXA 5EQ0A 3IFDA 1HJPA 2DWCA 2EVBA 3HXLA 1OBDA 3WWHA 4BBRG 4G7ZC 2WB1B 5JEAJ 3CCVA 3UDXA 3GLKA 1WTPA 3HGBA 4O7TA 4LF8H 4UY8C 1QVCA 5CE8A 1PTOB 1U4MA 2HVQA 3T9AA 3TQ1A 2CCZA 3K81C 4I50F 2I46A 4YWKA 3QOLA 3GV7B 3M9MB 3F2CA 5KFXA 4MV9A 5KYLA 5IWAH 2WIIB 4NZNA 3VR5A 1EKPA 1PXUA 2F0DA 2A73B 3S24A 3FVQA 3I12A 5CB4F 1IBMH 2J9GA 1GUOA 4IUUA 5COYA 2FPPB 1K1SA 1DYQA 3PMFA 3NTKA 1II3A 4JBWA 4DR7L 4RB1A 3SI8A 1IHZA 3KLWA 4L5SA 3S9WA 1STHA 1K8AC 1S5CD 3MR2A 2AUJD 2ID0A 3V6KA 4R4QA 1VQMA 3NBZB 2W9BA 2EJGC 1QWYA 4EVOA 5L1LA 2FINB 1GKHA 4A76A 2DLNA 3GIDA 2Z1CA 2D0OA 4WBNF 1SYEA 5C3EB 2WINB 5M5XB 5LHY1 4A3MG 1BF4A 3PIOA 1M6VA 4IZ8A 4UP9A 1I4HA 4JPBW 1IOWA 2EY5A 2PW7A 2R92B 1B33N 4O7NA 1VQJA 4A2BA 4LF5L 4DAAA 4LUZA 3GIJA 4MNOA 1PRTB 2ZTCA 3N52A 1M90C 1A3VA 4IUNA 1CHQD 4K8JA 5IT9E 5IYBG 1VKZA 4IPHA 2L0CA 3J80W 1EFID 3R5XA 2CKZB 1ZKOA 2QDLA 1R4PB 1F9PA 3M7NA 1BJTA 1E4FT 4J9LA 4DR5Q 1EYDA 1JCKB 2F0KA 1BBWA 4HNUA 1Y14B 1LM0A 2DY8A 4NZMA 5C4XG 5C4JH 5AJ3L 4QJFA 4DK0A 5M3MB 3Q6SA 5IP7G 3GJXB 1EZ6A 4DR6H 3RAXA 4QF4A 2B39A 4FGRA 4DV1Q 2KQ3A 5DEHA 3AFPA 4L5RC 1B6SA 1I4PA 4X3SA 4CHIA 4ME6A 3C0FB 2AGPA 3OOCA 4EGQA 3VPDA 4NXML 1NJIC 3EJIA 4C5CA 4E4TA 3RAQA 1E0BA 3FKIB 1QNKA 2ZJQA 4HAEA 1UNSA 1XMQL 5IODA 3JZIA 3K5HA 4N8FA 3J7A5 1XNRL 2J6UA 4UCOA 2KSWA 1B04A 3S14H 1T3NA 4B3TL 4ECYA 1BNZA 3RTXA 1E1TA 4ZQ3A 1I3QH 1STEA 3CCUA 4O81A 2M05A 1IYUA 1Q1EA 3GTOB 5L1KA 4GNXA 5KFSA 2TMPA 1QVGA 2PMZA 5E25A 1WTQA 3RB4A 1HTPA 3TS0A 1RJPA 2EY1A 1LTID 5BR8Q 1HNXQ 4O86A 1VMCA 1DGSA 2NVTB 2R7MA 5FJ8H 3N8DA 1VQ4A 2MGSA 1CQFA 3TMEA 2WB1E 5IOCA 1EWCA 1S40A 2JA5H 1FJGQ 4EFEA 2HHHH 5FLXc 1SBBB 1W3SA 3I55A 2E2IA 4B9WA 4PQXA 2CZGA 3WWIA 2W6ZA 4OIKA 4TQUS 4KHPH 1STAA 4UCUA 1XMQQ 1LTLA 1X56A 2VQEH 1JOKA 2XIGA 2PI2A 4EEYA 2CNUA 3R2IA 3C2PA 1G2TA 4PZ8A 3T1HL 3G7LA 1K0SA 3K3PA 4C3IB 5IYCG 1Y1WG 4X6AH 2IA6A 5CV6A 1A15A 2G9DA 1KNEA 4ECUA 3A8IE 2C22A 4J1MA 3M4PA 2OTLA 1VDZA 3J81i 2VQEL 3IFTA 4BBSG 2K5WA 4JI1H 4RB2C 1CKNA 1B7YB 1TWFH 1FNUA 1T36A 2GA4B 4FO2A 4ZRZA 3MFIA 2X6LA 3DLLA 5DLGA 4MV8A 3Q8PB 4F88A 1HFGA 4RGNA 5T1GA 2VQEQ 1RJTA 5LMUH 1DONA 5JEAH 2A74C 3M7GA 2QYZA 4DKAC 4C3HB 4IN3A 4C3IG 1K28A 5IY0A 4JI5L 3F1ZA 4JI1L 1PH6A 5I60A 1K83H 4O0AA 4POGA 4GNXB 5G3LF 1HZ9A 1M8AA 1RIPA 1TWCH 1U5KA 4R4CA 1XX8A 1FVIA 2DABA 1Q12A 3L7ZC 1EYCA 5LMNQ 2CQOA 4DV5Q 1W6KA 4B08A 2UUAQ 2OXPA 1VQNA 2CH4A 3HKZE 4OX9L 3RIZA 1B9NA 2HVRA 4LFAL 4TV8F 2R8JA 4ED8A 2EYHA 4YCWA 3L4JA 2X5RA 4DUZL 1J5EQ 1EUJA 4RB3C 3IRBA 3SK4A 4BXXG 1PLFA 3BQ0A 3STBC 2K7VA 4A3JH 3NEMA 4OIJA 5I2YA 4EBEA 1LTBD 4GLAC 1D1IA 4K0KQ 3BDLA 4YWMA 3Q0AA 3S17H 1SLJA 1CFMA 1EOVA 3CQZB 2YRWA 4OO1I 1YNJC 1VBGA 4FNFA 1UNNC 1WTRA 5BWWA 3BYYB 2HD3A 1VQ7A 2JA8B 5KFHA 1Z9FA 1BO0A 2VW9A 2JYOA 1UC8A 1WTHA 2CHBD 4OGQC 4DL4A 4IRCA 2VUMG 4F7XA 4B3RH 4LF7H 3H3VI 2HIVA 4O4JF 4DR3H 4C5AA 3HOVG 4DR2Q 3RR5A 1GO3E 1NR4A 3WOEA 4CDCC 1NMGA 3NXWA 3CCRA 3T1YQ 3GTLH 4TUYF 1JJ2A 4MTEA 4U7CA 5IWAL 3QJYA 3GV5B 3OSOA 1KRTA 2B2UA 1SNPA 1VQCA 3L0OA 4JCVE 1Z7TA 2EXZA 2B63B 4EQOA 5IP9H 1E4EA 2F0NA 4JG2A 1JWUD 2BH8A 2R6FA 1YEZA 1QZGA 1RF2D 4B3RL 5HGQA 2KA7A 1D6EC 1CKOA 1CA5A 1A63A 1WFQA 1J8IA 2NVTH 1ILPA 2F03A 1WOCA 5KG0A 5LOVF 2B63G 2NVYH 3Q8SB 2K5VA 4DUZQ 1J5EL 1D1KA 5BYAA 1ENCA 1SYGA 2D62A 1BXRA 3KREA 3U58A 1ESFA 4GKKQ 1LLRD 1H95A 5KFLA 3K3VA 5J39A 4A3FH 1QG7A 3NHHA 4UP7A 4NXNH 4L5QA 5D8DA 2VQFL 3ERQA 2I5HA 4A2AA 4YR2A 2VR1A 4Z9CB 4O7SA 4QL5A 4HIDA 4XTCS 3QO2A 3HOXG 3CCJA 2DNEA 5D3IB 5CBEE 2J7ZA 5FNVF 4RHSA 4PMBA 4R8IA 2E2HB 1EIFA 5A35A 2EY2A 2YZNA 5BWXA 4DV7H 1EIGA 5LXTF 3U50C 3S1NH 4A3DH 1NUCA 5DGAA 3ULLA 5ELBA 3KHHA 2YTXA 1H9RA 1YHBA 2HHHQ 1IXRA 2PZWA 3G4SA 1TKWB 4CKCA 2LS01 1ONLA 1MGSA 4DFAA 3PUZA 3FKIH 2FLNA 3K5IA 1VMPA 2ALYB 2RDHA 5FJ8G 3S2DB 3S1NB 3A8JE 2C00A 5KKNB 4B3SL 3CD6A 2L4NA 5JJLA 2ZDGA 4IFDH 3ORQA 4JI6Q 3R5HA 3MXUA 2WFWA 2F4IA 3PO2H 1HA6A 2DAAA 1KUTA 4IJLA 1IZ6A 4OO1G 3KAJA 3UYYA 3MC0B 2F1MA 3HKSA 1RDPD 3OYYA 4DL2A 1H9SA 2E2JB 3PUVA 1BOSA 3UI2A 1B50A 1CS0A 1N34L 1R9TH 2Z04A 4LF7Q 2KCNA 3MXPA 4B3TH 1IBML 3TP6A 1JICA 3MWMA 4YP3A 3VR6A 2AMCB 2XWJB 2Q8RE 5C8YF 5JQGF 2VOBA 3N44B 5KFGA 3BVGA 3RN5A 5CV9A 5CORA 4GKKH 3N41B 1VQHA 4ZKBB 2E2JH 3MXGA 4A3BH 1A3TA 2COGA 4YQWA 1RYRA 3T5HA 3GTJH 4IPGA 1PH9A 3G48A 4LF5Q 4YJ3F 4LF8L 2NN6G 3W1GA 1X54A 4FXDA 1S68A 3ITPA 4QWEA 2BQUA 2ZTEA 1LV9A 1LTRD 2W71A 1FNVA 2K5QA 3KBGA 4CE5A 4CJ2C 4O82A 3G6JB 4JXUA 4AYBE 3SK5A 4JI0H 2GN5A 1CQIB 4RFBA 3E3XA 1EY4A 1ZEQX 3DEOA 2NZ1D 4WFN3 4KHPL 2R8GA 3VR4A 4BWSC 3MXNA 4M7EA 3SR1A 2F0GA 1STBA 5CM0A 3JRWA 1XXGA 3BU2A 4KKSA 3J80L 1PTOH 1F2ZA 3A5UA 2AQ4A 3GTLB 2UUCL 4FF4A 1HCZA 1KXLA 1I50A 3PSIA 1I7LA 5I47A 4RZRA 1U4LA 3TP7A 4ZUJA 1QE6A 4F4WA 2JQOA 2EQSA 2Z4IA 1GUGA 4DPGA 4X62Q 5C5MA 1EYGA 2C9OA 2O5IC 1JDBB 2WE6A 2DPJA 3AEVA 4DR6L 4DV5L 4S3SA 1TY2A 2R8HA 5D1OA 5KFTA 2K28A 5FLMH 1K73C 2COJA 4APVA 2RDGA 2XRQD 1VQEA 4ME5A 2F0LA 3RF2A 4LF4H 3MHBA 4A3CG 1SMYD 1D2BA 2I5MX 1VAJA 3QIAA 2E75C 5E1FA 5FKAC 3BACA 3CEBA 4KD3A 4ECQA 2FLPA 1CSQA 1L1OC 3HOVH 1I6VC 3STBD 4H0LC 5KIXA 5KG2A 4A3FB 3LWBA 3CPFA 4LMQD 4Q4CA 4ODGA 4Y7NB 2UUAH 2YWVA 2I87A 4F4ZA 2B2TC 2L9HA 4EBCA 4DNTB 2NB0A 2NN6I 2NYZD 4DV2H 4AH6A 2DJFC 1D5MC 3E9IA 5KG7A 1RL2A 1QNUA 4BY7H 2PQAA 3MR5A 1PYSB 4OL7A 1IBKL 4FXGC 3FKIG 4O7ZA 2IX0A 1V1OA 3ULJA 2VY3A 3ICEA 4L63B 4IIJF 4UDUC 2ZM6Q 4YY3Q 1X3GA 3ORRA 4A3DB 1S97A 3H0GG 1GSOA 4RHRA 3BAAA 1X55A 1N33Q 3CMEA 3NUAA 1I94H 5DQHA 4LF6L 3GV6A 4MHEA 4A3MB 3CQZH 2BE5D 3PW4A 4DR3Q 4ED6A 1KLGD 1SNMA 3GO5A 1XMOH 5EWFA 4JI6L 2W8KA 2ENBA 3EROA 1Y8NB 1HXYD 4MV6A 3RLNA 4LF4Q 5DLFA 3KALA 3AQQA 3J7YW 1S03G 2OEOA 3PO3H 1AE3A 3RB6A 5DLQE 2CW7A 4A3FG 2R82A 3MZ5A 4RAYA 1KEEA 1TS5A 3J81j 1M1KC 1Q90A 4PV1C 5C3XA 3JC66 2A68D 3H3VC 3K6OA 4EEQA 1OXXK 4CDFC 3T9DA 1X3FA 4PZ6A 5FPRA 1I4RA 1ZXTA 2UUCH 2YW2A 3MVVA 2FE3A 1CT1D 3TY8A 4DL5A 4BBRH 1XDNA 3RB3A 2EDGA 3I8ZA 2MNAA 4DR4L 1D7QA 2F3IA 2D0PA 3BDCA 4RG1A 4DK3C 3N43B 1I4GA 2WAQA 2LFNA 3CC4A 1AUXA 2Z9HA 1IL2A 2JA7H 1PZKD 3RLFA 2B2UC 2Z6BA 3BG5A 5KFUA 2IT1A 3I4NH 2M9VA 1GUSA 4GKJQ 1C3OA 3PCOB 2NU7B 3U4ZA 5IT9W 2WP8J 5JJZA 3IAYA 4FF1A 3IN5A 1Z47A 1HZBA 5KFEA 2XSCA 4OX9Q 2I8CA 2NUAB 3N6XA 5DG9A 3RBDA 1N48A 2R92A 1QB5D 4HJ5A 2RDJA 1JJCB 1BBXC 2F0JA 2GVBA 1WTOA 5LMNL 1VQAA 4DNRB 3DM3A 3NQTA 4C2MB 4HSPA 2O4XA 1IYEA 1WR2A 1KT8A 4BBSB 2SCUB 3SE0A 4DAYA 5FLXW 5EKIA 4OO1H 4R1JA 3DMUA 3TSSA 4XT1B 5GADC 1JQYD 2VNUD 5FD6A 2K6AA 4AQYQ 2WTFA 4QUCA 1CK1A 1EOTA 3PGZA 4GN3B 4Q0FA 3KF6B 4RZQA 5KX5F 3N42B 3S1QH 3R23A 2W9CA 4HN7A 4TQSA 2ZDHA 3AW8A 1LUZA 2WAQB 3RZDB 5BR8H 1TVXA 1HNXH 4NZOA 4M9UA 1I4XA 4RU9A 1ET9A 3Q8DA 1PH3A 1F9QA 4C3JG 4A3LG 4IALA 1QZHA 4OWWB 1WVLA 1EIYB 1RCVD 1V43A 1X6OA 3KK7A 2WYOA 1MKHA 2R7ZA 1NTGA 4DV6H 4UCVA 5GAGC 1I2KA 4JYAQ 1M0WA 3SK6A 1J9OA 4KN4C 1KBLA 4I7HA 2R7LA 1KL9A 3K7UC 3S2HB 2OQKA 4C3HH 3LQSA 5JQWA 1UE1A 3AFQA 5M5WH 4CJ0B 5K3WA 3MEHA 4JI5Q 3GILA 3TP5A 3BQ1A 1SJHD 1X32A 4ZAIA 1SEBD 4PWQA 2ICEC 1EY5A 4DR1L 3H15A 4I7ZC 3M4OH 5LP6F 2JA6A 2K5NA 3K0XA 4JOIC 3DWQA 4K6DA 1U9RA 1CZWA 2PQEA 2LMCB 2WAQG 3I73A 3IL8A 5J1ZA 5LMNW 3DWPA 1SRUA 2QB5A 3PUXA 4IR9A 2IWHA 2SEBD 2QEXA 2O2LD 4EQPA 1HNZQ 1TS4A 5KFQA 4TRDA 2XGPA 1C4QA 1PV4A 4DV4H 3FHWA 5IGDA 2AWOA 5DM63 1BCPD 1V1PA 3HOWB 4QW9A 4UP8A 1VF5C 3I2ZA 3BS1A 4GLWA 2Q2HA 1Y1VB 3PR5B 2K52A 4RGOS 1X65A 1ZETA 3OSNA 2N8NA 4A3DG 2ASJA 3BZKA 3M3YH 5KG6A 3PW5A 2KEEA 1LACA 1K3RA 2QF7A 4YY3H 2R7KA 2Z02A 4HSVA 1VQGA 1SNOA 5IP7H 3RD4A 3GTMH 3FRPB 1J5EH 1TAEA 1ET0A 4YIJA 5JPMC 2ALZA 1TU2B 2BA0A 5FPOA 4YHHL 1RKNA 3GD7A 1N9WA 1PDQA 5C5LA 2XCAA 1PRTF 2NVYB 5J2TF 3PFFA 1L2FA 1JWMD 1KAWA 2Y0SB 4PMWA 2W7PA 2Q8IB 2L11A 4ILWA 4O3SA 3SHLA 3F8NA 1RTNA 1SMXA 4A3CH 3HBLA 2VUMB 4DV3H 1BR9A 2YCHA 2EIYA 5EWEA 3U0GA 3OSPA 2VZAA 3DM1A 5CBAE 2FPGB 4LFBQ 3QZ7A 3G6VA 2GQSA 1FR3A 3MJFA 2JXMB 4WD3A 1Q81C 4A3BG 3T7AA 2FK2A 2OH2A 2HHFA 1W96A 3M9OB 4FDBA 1M0TA 1D5ZC 1EFWA 4LJZC 1TS2A 4O2DA 3T1YH 4X3KA 4ECSA 2F3VA 1LYLA 5KT6A 1SAPA 5IT9L 5L1IA 4POFA 3RV4A 1TWHB 2HDLA 5E4XA 2ZJPA 3GTGA 1B9MA 5C4XH 1TWGA 2XC9A 1G291 2MUYA 4DXFA 3J7AF 1EY0A 4DV4Q 3UE1A 1KTKA 4JBKA 1TWHA 2A68C 3OW7A 1B3AA 1ZYRC 2B2YA 5KNCA 4EGVA 4HJ8A 2R84A 2JA6H 2FMMA 3HOYG 3ETHA 1EY9A 3K7AH 3HO8A 2V4RA 2J0TD 1F9SA 2NWGA 2NU9B 5EKKA 2UUCQ 4RWSC 3HZXA 3SDZA 3TEHB 4QWCA 2UVRA 2R93A 2BH2A 2PCFB 2BE5C 5IYDG 5JPNC 3NE5B 1UE7A 4KY7A 4KLKA 1A48A 2UXCQ 2F0UA 4JV1A 3S15H 5KFKA 3OUUA 3OIQA 3JRXA 4JC0A 1PYBA 2ZM6L 2ZTDA 1R9TB 5KNBA 3GTOH 1HPCA 4XIGS 3J81W 1U4RA 4DV5H 3J7AK 2Z8LA 1NR2A 5BYBA 4ZQIA 1STNA 3MFHA 2JEFA 2UXDL 1RJQA 3HB9A 2K5HA 4LW1A 1WCMA 4B3MQ 1E2WA 3W3AA 3S16B 2A6HD 4BY1H 1EU4A 3EVQA 3GTGH 3I4MH 1S9FA 1DOMA 4TM5A 4O84A 3O13A 5HBRB 4U6PA 3KTMA 1HNZH 3NENA 1KNAA 3DWAA 5H80A 3CW2C 1YIJA 1S72A 5ELCA 4QIWB 4ZKCB 3CCMA 4L6TB 4XYQA 4BY1B 4UUGA 3BQ2A 3JAME 5EDWA 4IR1A 1T5EA 5IYZF 4HNVA 3OW2A 3D6CA 3RZOB 2YU9B 3I72A 2Z6KA 5M3MH 3GIPA 4J9SA 3D8GA 3HOXB 2VQDA 3J81L 4YB8B 2I5LX 1YI2A 5LL6b 4QCLA 2UUBH 1TWGB 3K80C 5KFRA 1BCPB 2JEBI 3RB0A 3SXHA 1XNRQ 5GAHC 4IQZA 2A1AA 4LF4L 2IX1A 3Q24A 1RD9D 2KHSA 3TZUA 1NE3A 2NVXB 1O80A 1TQOA 4JK1C 4DV6Q 1QUQB 2JA6B 3C46A 4OWTB 4C3JH 2MFIA 3I3CA 4GOPC 5GQOA 4DR7H 2DN8A 1BCPF 3NK9A 5IGFA 2RKSA 3PUWA 1VQIA 4XT3B 2B2YC 2C35B 4R4IA 3LGJA 2R7FA 4J9QA 4FFNA 1G6PA 1AP0A 1IYDA 4JI2H 1MIUA 2DZDA 1OTCA 2NU8B 3M85A 3Q22A 4GLXA 2OLSA 1W2BA 3MR6A 1ZHSA 3NBHB 5KEEA 4JYAH 3JSNA 2NBFA 3SVMA 1S5DD 3KHRA 4EQ5A 3KJPA 1GXDC 2E2IH 3GV3A 3T5JA 3Q1KA 2R93B 2F3WA 2R8IA 2WB1A 4HQ6A 4J9KA 5IP9G 5ELNA 1I5FA 1Z2OX 2FB9A 1SYXB 4XQQA 5FK9C 4A93H 4RNMA 1EQRA 2YZGA
chains in the Genus database with same CATH topology
1N8RC 2EXDA 3I7FA 4DR2H 1VS0A 4DV1L 3PUVA 4DR5H 5IYCH 1Y1WH 1R9TH 1N34L 4LF7Q 4LF9L 1I6UA 4A3EH 4B3RQ 1IBML 4DRFA 1Z2PX 2RHSB 4B3TH 4NXNQ 3MWMA 4JV5H 4HIKA 2AMCB 2A19A 1MJCA 5IT9c 2VOBA 4X66L 3N44B 1XNRH 2MO1A 3RN5A 2E5LL 4GKKH 3RJ0A 4R7RA 3N41B 1N33H 1VQHA 2JA8H 2E2JH 4A3BH 2KHJA 5IYBH 3IG0A 1GVPA 2CWAA 1XNQQ 4GLVB 1UE5A 3GTJH 4DR7Q 4IPGA 1PH9A 3G48A 2RGVA 2ES2A 4LF5Q 3H20A 4ETSA 4YHHH 4FM9A 4LF8L 2NN6G 3W1GA 1X54A 1KD1C 1S68A 1XPUA 3KDFA 1O7IA 4B3ML 2ZTEA 2VPSA 1OXTA 1P16A 1CKMA 4IJHA 4JI3L 3S2HH 2B29A 2Y0SG 2K75A 4UPAA 4AYBE 4JI0H 2GN5A 4NXNL 1N33L 2AHOB 4KHPL 3PV0A 4UCRA 4JYAL 4BWSC 4M7EA 2HHHH 2UXCL 4CC6A 1SE8A 5EAYA 3HOWG 3BU2A 1K9MC 4JI3Q 3VDYA 3A5UA 3FMAA 1C0AA 2QGQA 2ASBA 3S16H 5LMNH 4B3MH 4GN5A 1JT8A 3HOZH 2R6GA 2UUCL 1KXLA 1E3PA 4DV7L 5M5XH 1KRSA 3PSIA 4LF8Q 4OWXB 3GTPH 4ALPA 4A4IA 4LFAQ 2B63H 2R92G 3A5ZB 4JI2Q 1IBLQ 2JQOA 2EQSA 3M4QA 4DPGA 4X62Q 2WE6A 1EYGA 1YJNA 4LUOA 4LFCH 3AEVA 4DR6L 4DV5L 1Q1BA 4GKKL 3JSLA 1FJGL 1TWAH 1G51A 3PO3G 5D1OA 4LMYA 5GROA 2JA8G 5FLMH 3BABA 2K50A 5ELOA 3NELA 2BA1A 3RNUA 2QA4A 4B3SH 1K73C 4X66Q 4APVA 1VQEA 5FD5A 2UUBL 3RF2A 4LF4H 1E24A 2VS1A 5M3FG 1OXSC 4A3CG 3MXNB 1JB7A 2I5MX 3E9HA 4LF7L 4BBSH 1N34Q 2MO0A 3HOXH 4APMA 4LNQA 4JI1Q 4GKJH 2RCNA 1CSQA 1L1OC 3I4OA 3HOVH 3UQ8A 4UCTA 4JI3H 3STBD 1HH2P 5C0XG 1MJEA 3CAMA 3CPFA 4L5TA 4CC5A 2ATWA 4KI0A 2UUAH 2F4VH 3PIPA 1Z2OX 4JI7L 4A3KH 1EWIA 5DISC 4IFDI 2NN6I 3F2BA 2JA5G 2IHEA 4AH6A 4JI0Q 2NVQH 2PI2E 4DV2H 3E9IA 2Y0SE 1RL2A 4BY7H 2PQAA 1E22A 3VNNA 2ZJRA 1PYSB 2JEAI 1IBKL 1OXUA 2AWNA 3FKIG 5EOYA 3SGIA 1YZ6A 3BZCA 2IX0A 2JK8A 2VY3A 3ULJA 3TS2A 1MZBA 1HR0W 1WCMH 2PMZE 2E8GA 4KHZA 3ICEA 1D8LA 2FXQA 4YHHQ 4YY3Q 1X3GA 2HIXA 2ZM6Q 1WYDA 1PH8A 2JA7G 1I6HH 1HNWQ 2LXKA 3J81c 2F52A 3H0GG 1PVOA 1TWHH 1HZCA 4QIWE 4LFCL 3BAAA 1X55A 1N33Q 3CMEA 3PO2G 1I94H 4BA1I 2MCTA 3OTOH 2UU9H 4LF6L 4Y52H 1FL0A 1UWVA 1VQLA 3HOZG 3GDEA 3CQZH 1AE2A 2JA9A 4P73A 3TY5A 2LXJA 4IOCA 4DR3Q 2R7ZG 4JV5Q 3EBEA 4LH7A 3HKZG 4YY3L 3GO5A 3JAMc 1XMOH 3RZDH 4JI6L 2R92H 1QVFA 4GOPB 3RLNA 4LF4Q 3KALA 2IHFA 3AQQA 3EIVA 3L4KA 5K36G 1YHAA 4LF9H 3S1MH 4IO9A 1S03G 4B3SQ 3PO3H 1AE3A 5DLQE 2CW7A 4DR2L 4A3FG 2RGRA 5C0XI 4RAYA 1L1OB 3J81j 3CF5A 1M1KC 1BBUA 1JMCA 2UUAL 4JI6H 4WJ3M 3JC66 1HNWH 1SROA 4DUYH 2UXBH 1HJPA 4EEQA 3LMLA 3D31A 1OXXK 3HXLA 3G71A 4QY7A 4BBRG 1X3FA 1NBWA 4PZ6A 5FPRA 3CCVA 5JEAJ 2UUCH 4IAJA 3UDXA 1VQBA 4LFAH 2FE3A 5C3EG 4UY8C 1QVCA 4JBJA 3TY8A 4LF8H 4BBRH 1XDNA 2HVQA 2Z0SA 4LF5H 2MNAA 2CCZA 3K81C 4DR4L 2F3IA 1PH4A 2D0PA 1VQKA 1HNWL 1D7QA 1IBKH 4RG1A 4YWKA 3WWVA 4DK3C 3N43B 3F2CA 1PHJA 4MV9A 3CC4A 5IWAH 3CVZA 1IL2A 2JA7H 3RLFA 1FJGH 4JI5H 4WJ4A 4TVAB 2IT1A 3KOJA 3S24A 3I4NH 2Q2TA 1Q86C 4DV1H 2WB1G 1P8LA 2PQAB 3PCOB 4GKJQ 3U4ZA 2I0QA 2WP8J 4JI0L 4DR6Q 1IBMH 5IT9W 1VQ9A 1TXYA 4LF6H 4JBWA 4RB1A 1VQFA 2YTYA 1Z47A 1HZBA 4DR7L 4OX9Q 5A2QW 3KLWA 4L5SA 3N6XA 2CFMA 1K8AC 4LWCA 2KBNA 4HJ5A 4MV7A 1JJCB 5E7NA 2ID0A 2E5LQ 2GVBA 4JI4L 5LMNL 1VQAA 4R4QA 3DM3A 3KJOA 3EN2A 3UE0A 4YCVA 1VQMA 1TA8A 3NBZB 5FLMG 1VQ6A 5FLXW 1E1OA 4R1JA 3HOUH 4DR4Q 1VQOA 1GKHA 5GADC 4A76A 5FD6A 4LFCQ 2D0OA 2VNUD 1Z2NX 4AQYQ 4A3JG 2PNHA 1HR0H 3U4VA 3H3VH 4A3GG 2IY5B 4A3MG 3F2DA 3PGZA 4GN3B 3PIOA 3KF6B 4A3GH 4UP9A 3BA8A 4RZQA 3N42B 3S1QH 4DV6L 1SEIA 4NB3A 2WDTA 1L2ZA 4OXPA 1NMFA 1LUZA 5BR8H 1HNXH 1J6QA 4H02A 1VQJA 4UCOA 1V1QA 4DR5L 1HR0Q 4LF5L 4A2BA 2XTIA 4LUZA 3CC2A 2JJQA 3Q8DA 4MTNA 4A3KG 1PH3A 4MNOA 2ZTCA 2K4KA 3MEFA 5J3BA 4HJ7A 1M90C 4Q0YA 1E4GT 5IYBG 4RAZA 4IPHA 4A3LG 1QZHA 4OWWB 3TY9A 2CW8A 1EIYB 3PF4A 1V43A 3J80W 1X6OA 2H5XA 4DV4L 2CKZB 4P72A 3S1RH 2VL6A 2WYOA 3K8AA 3M7NA 1MKHA 1BJTA 2E5LH 1E4FT 1L0WA 4DR5Q 1HR0L 1NTGA 1BBWA 1L1OA 1U0LA 3ERSX 1Y14B 1LM0A 5C0XJ 4UCVA 4DV6H 5C4XG 1YBYA 5HY6A 5GAGC 5C4JH 4JYAQ 5AJ3L 4QJFA 1M0WA 4IFDJ 5IP7G 4LF6Q 3GJXB 2KHIA 3J7ZC 1XK5A 4I7HA 4DR6H 4DV0H 4JI7H 1KL9A 4PDBA 3K7UC 2OQKA 4C3HH 1UE1A 4GOPA 4DV1Q 3AFQA 5M5WH 4A93G 2XGTA 4JI5Q 3AFPA 4L5RC 3C0FB 2YYZA 5C44G 3I4NG 3H0GH 1VQPA 2YV5A 3ULPA 4NXML 1NJIC 4DUYL 4AIMA 2UXBL 3PN1A 2N49A 3KF6A 1I50H 1IBKQ 5LMUL 2ZJQA 3CXCA 4PZ7A 1XMQL 5C44H 3HFZB 4R4OA 4LSAA 4DR1L 1N36H 4GKJL 3H15A 3RLOA 3FP9A 3J7A5 1XNRL 3M4OH 1T9HA 2EIFA 4J15A 2K5NA 3K0XA 4JOIC 3CCQA 4HIOA 2KENA 4A3EG 1B04A 1K0RA 2WAQG 3S14H 5LMNW 4A3MH 4B3TL 1N32H 1SRUA 4DUYQ 2UXBQ 3PUXA 4DR4H 3RTXA 1E1TA 4R4TA 1I3QH 3CCUA 1GYFA 2QEXA 2OWOA 1Q1EA 1Q46A 2CWPA 4X65L 4DR3L 1KC8C 1HNZQ 4P74A 3NBYB 4MTDA 4GNXA 2KSWA 1QVGA 4OONA 3T1HQ 1PV4A 4J0MA 3FHWA 1Q82C 3TS0A 4DUZH 2AWOA 4DV4H 4OX9H 1SR3A 1UE6A 5AJ3Q 2RF4A 4UP8A 5BR8Q 1HNXQ 2HGSA 3I2ZA 1PH5A 4JI4Q 1DGSA 2DUDA 2Q2HA 4RB0A 2K52A 3UDIA 5FJ8H 1X65A 1VQ5A 1VQ4A 1AH9A 1S3OA 2N8NA 1S40A 2WB1E 1FJGQ 5JEAG 2JA5H 5IWAQ 3TRZA 4A3DG 4IOAA 4QQBX 5FLXc 4EFEA 1W3SA 4X65H 3BZKA 3M3YH 2R7DA 3I55A 4IFDG 1K3RA 4JI2L 2YU9H 3TREA 1WCMG 4YY3H 4TQUS 4KHPH 4UCUA 2VQEH 2NZHA 1CSPA 1LTLA 1X56A 1YJWA 1XMQQ 4A75A 4JI7Q 2A8VA 3CP0A 1JJGA 2XIGA 1VQGA 2PI2A 3KXYT 1FKAH 3PUYA 4X64L 2O03A 5IP7H 2OCEA 1N36L 4DR1H 4PZ8A 4GS3A 3T1HL 3GTMH 3I4MG 1J5EH 5IYCG 1Y1WG 2YTVA 4AQYL 4BXXH 4X6AH 1TAEA 5BR8L 4QGUA 1HNXL 2UXDH 4YWLA 2BA0A 4ME3A 4MZ9A 5FPOA 1XJVA 2VUGA 4YHHL 3GD7A 1X9NA 1N9WA 2F4VQ 2KCMA 4X64Q 4UFZA 3M4PA 2OTLA 1L2FA 1XPRA 5IYDH 2OQ0A 1KAWA 4PMWA 4NPSA 3J81i 2VQEL 4JOIA 4BBSG 3GB8B 3F8NA 4GN4B 4JI1H 2VQFQ 1N34H 1SMXA 4A3CH 4DV3H 4RB2C 1CKNA 1B7YB 2WAQE 2YCHA 1TWFH 2VZAA 3BA9A 3RN2A 4LFBQ 4DAMA 1XNQL 3DLLA 3NC0B 4AQYH 3UDFA 1V9PA 4GNXC 3JAMi 5C3EH 1I94L 3G6EA 1KIXA 2VQEQ 1Q81C 4A3BG 5LMUH 1Q7YC 2RHQB 3GTKH 4C3IH 3A0JA 1CUKA 4FDBA 4AYBG 4DKAC 4K0KL 1M0TA 4X62H 3D0FA 5IY0A 1EFWA 1X3EA 4JI5L 1PH7A 1YVCA 4LF9Q 3F1ZA 4O2DA 4JI1L 1PH6A 3T1YH 2W57A 1LYLA 4UCSA 2AKWB 1K83H 4O0AA 4POFA 4POGA 3RZOH 3W1BA 4GNXB 3N40P 1XPOA 4Y7NH 1HZ9A 4DAYB 2R93G 2ZJPA 1RIPA 1TWCH 1U5KA 4R4CA 5C4XH 4DV3Q 1PH2A 1FVIA 1G291 1Q12A 3BJUA 4RMFA 3L7ZC 1N32L 3QWUA 4E6NA 5LMNQ 2CQOA 2MQHA 4DV4Q 3CCSA 3UE1A 4DV5Q 3KFUA 3M4IA 3J80i 4LH6A 4JBKA 2UUAQ 3T1YL 3OTOQ 2UU9Q 1VQNA 1I94Q 1PA6A 3HKZE 4OX9L 3RIZA 1JE5A 1ASYA 2HT1A 4PG3A 2HVRA 4HJ8A 3CMAA 5D1PA 5H1SE 4LFAL 2JA6H 4P75A 4K0KH 2UXDQ 3HOYG 5JJIA 5LMUQ 2ZM6H 3L2PA 3K7AH 1IBLL 4YCWA 3L4JA 1N32Q 3UDGA 3F8TA 3W5OA 4DUZL 1J5EQ 1EUJA 4RB3C 3KAKA 1BVSA 1VCIA 3CCLA 3RGXA 3IRBA 4BXXG 4X66H 2UUCQ 3HOYH 1A8VA 3TEHB 1PFSA 3PF5A 3STBC 1NY4A 4A3JH 3NEMA 2BH2A 3JAMW 1KHIA 5IYDG 4KHPQ 4GLAC 1UE7A 4KLKA 4YCUA 4HJAA 2UXCQ 4K0KQ 1K8GA 4YWMA 1KQSA 3S15H 4C2MH 3S17H 4LSXA 1SLJA 1HNZL 1EOVA 4JC0A 4X65Q 3A74A 1PYBA 4OO1I 2ZM6L 1YJ9A 1FGUA 2ZTDA 3B6YA 1ASZA 2UXCH 3GTOH 4XIGS 2HVSA 1VQ7A 3J81W 2NZOA 4DV5H 3J7AK 1Z9FA 2B3GA 5D1OB 5M3FH 2VW9A 2UXDL 4B3RH 2VUMG 1XMOQ 2K5HA 4LF7H 4LW1A 1YITA 4B3MQ 2HIVA 3H3VI 1VQDA 4DR3H 3HOVG 4DR2Q 4BY1H 1SN8A 3RR5A 4DR1Q 1GO3E 3GTLH 3GTGH 1NMGA 3CCRA 3T1YQ 4A3IG 3I4MH 1AN7A 1JJ2A 4MTEA 4BA2I 5IWAL 4A3LH 1YNXA 3HOWH 2VQFH 2Q2IA 1HNZH 1WJJA 3NENA 1KRTA 3L0OA 1VQCA 2L15A 1VQ8A 3RGZA 3CW2C 4JCVE 4DV3L 1YIJA 1S72A 3ZJYC 4A3IH 3GTQH 4DV2L 5IP9H 3CCMA 1A0IA 4JI8L 2F4VL 1IBLH 4JG2A 1C9OA 2BH8A 1UEBA 1YEZA 3E0EA 1QZGA 5JJKA 4B3RL 1O75A 5HGQA 1A63A 4LFBH 1CKOA 4LUVA 1WFQA 3OW2A 1N36Q 2NVTH 2R7ZH 3KYHC 2N3SA 4DNIA 4JI4H 1QUQA 1WOCA 2Z6KA 1XTDA 5M3MH 4DV2Q 1PH1A 2B63G 2E2HH 1XNQH 2NVYH 2I5LX 1YI2A 2K5VA 5LL6b 3TQYA 4DUZQ 1J5EL 3T1HH 5IE8A 4JI8H 3KDFB 2D62A 2N78A 4HJ9A 3K80C 3HOUG 3U58A 2UUBH 4X64H 4GKKQ 2JA6G 4LFBL 4IPDA 1A62A 1H95A 1IYJB 2JEBI 3K3VA 3ER0A 1TWGH 5GAHC 4A3FH 1XNRQ 2ZJTA 2LSSA 2JE6I 2A1AA 4UP7A 4LF4L 5M5YH 2NVXH 2IX1A 4L5QA 4DV0Q 2Q2UA 2VQFL 4NXNH 1CKNB 3CCEA 2I5HA 4A2AA 3CPWA 1XMOL 2GVAA 1XMQH 1NE3A 1C7YA 3I56A 4QL5A 4HIDA 1YHQA 4JV5L 1GD7A 3DF7A 4P71A 4XTCS 5GAEC 3HOXG 3CCJA 4DV6Q 2HHHL 2VUMH 1QUQB 4EX5A 3M9BA 1HZAA 1EIFA 4NXMH 1IBMQ 4OWTB 4C3JH 2MFIA 4GOPC 5GQOA 2DGYA 4DV7H 4DR7H 3U50C 2K14A 3S1NH 4A3DH 3PUWA 1VQIA 3ULLA 3J80c 1Q8KA 2C35B 2YTXA 3KF8B 2R7FA 3LGJA 1WI5A 4R4IA 1EQQA 2UUBQ 1G6PA 1YHBA 4JI8Q 1BKBA 1IXRA 1B8AA 2HHHQ 1ZHQA 4JI2H 3G4SA 1MIUA 4HIMA 1OTCA 4IPCA 1SFOH 1B70B 3S2DH 3M85A 2HQLA 2OTJA 4JBMA 4BY1G 3PUZA 3FKIH 4DV0L 4GLXA 1W2BA 4B3TQ 4BY7G 1ZHSA 2ALYB 3NBHB 5FJ8G 1E7ZA 4JYAH 4B3SL 3JSNA 2R93H 4EQ5A 3AYHB 4X62L 3KJPA 1Y1VH 3CD6A 2E2IH 5JJLA 3OTOL 2UU9L 1GM5A 4JI6Q 3EYYA 2WFWA 3PO2H 2Z6KC 3CC7A 4DV7Q 5IP9G 5ELNA 1I5FA 1Y1VG 2V1CC 4DK6C 1WH2A 4EFBA 4IJLA 1IZ6A 4NXMQ 2KCTA 4OO1G 1SYXB 3KAJA 4A93H 1OXVA 1EQRA 1BGWA 5M3MG 3HKSA 3OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R C;  2EXD A;  3I7F A;  1VS0 A;  4DV1 L;  3PUV A;  5IYC H;  1Y1W H;  1R9T H;  1N34 L;  4LF7 Q;  4LF9 L;  4A3E H;  4B3R Q;  1IBM L;  4DRF A;  2RHS B;  4NXN Q;  4HIK A;  2AMC B;  2A19 A;  1MJC A;  5IT9 c;  4X66 L;  2MO1 A;  3RN5 A;  2E5L L;  1VQH A;  2JA8 H;  2E2J H;  4A3B H;  2KHJ A;  5IYB H;  1GVP A;  2CWA A;  1XNQ Q;  4GLV B;  1UE5 A;  3GTJ H;  4DR7 Q;  4IPG A;  1PH9 A;  3G48 A;  2ES2 A;  4LF5 Q;  4LF8 L;  2NN6 G;  3W1G A;  1X54 A;  1KD1 C;  1S68 A;  1XPU A;  3KDF A;  1O7I A;  4B3M L;  2ZTE A;  1OXT A;  1P16 A;  1CKM A;  4IJH A;  4JI3 L;  3S2H H;  2B29 A;  2Y0S G;  2K75 A;  4UPA A;  4AYB E;  2GN5 A;  4NXN L;  1N33 L;  2AHO B;  4KHP L;  3PV0 A;  4UCR A;  4JYA L;  2UXC L;  4CC6 A;  1SE8 A;  5EAY A;  3HOW G;  3BU2 A;  1K9M C;  4JI3 Q;  3VDY A;  3A5U A;  1C0A A;  2QGQ A;  2ASB A;  3S16 H;  4GN5 A;  1JT8 A;  3HOZ H;  2R6G A;  2UUC L;  1KXL A;  1E3P A;  4DV7 L;  5M5X H;  1KRS A;  3PSI A;  4LF8 Q;  4OWX B;  3GTP H;  4ALP A;  4A4I A;  4LFA Q;  2B63 H;  2R92 G;  3A5Z B;  4JI2 Q;  1IBL Q;  2JQO A;  2EQS A;  3M4Q A;  4DPG A;  4X62 Q;  1EYG A;  1YJN A;  4LUO A;  3AEV A;  4DR6 L;  4DV5 L;  1Q1B A;  4GKK L;  3JSL A;  1FJG L;  1TWA H;  1G51 A;  3PO3 G;  5D1O A;  5GRO A;  2JA8 G;  5FLM H;  3BAB A;  2K50 A;  5ELO A;  3NEL A;  2BA1 A;  3RNU A;  2QA4 A;  1K73 C;  4X66 Q;  4APV A;  1VQE A;  2UUB L;  1E24 A;  2VS1 A;  5M3F G;  1OXS C;  4A3C G;  3MXN B;  1JB7 A;  2I5M X;  3E9H A;  4LF7 L;  4BBS H;  1N34 Q;  2MO0 A;  3HOX H;  4LNQ A;  4JI1 Q;  2RCN A;  1CSQ A;  1L1O C;  3I4O A;  3HOV H;  3UQ8 A;  4UCT A;  3STB D;  1HH2 P;  5C0X G;  1MJE A;  3CAM A;  3CPF A;  4L5T A;  4CC5 A;  2ATW A;  4KI0 A;  3PIP A;  4JI7 L;  4A3K H;  1EWI A;  5DIS C;  4IFD I;  2NN6 I;  3F2B A;  2JA5 G;  2IHE A;  4AH6 A;  4JI0 Q;  2NVQ H;  2PI2 E;  3E9I A;  2Y0S E;  1RL2 A;  4BY7 H;  2PQA A;  1E22 A;  3VNN A;  2ZJR A;  1PYS B;  2JEA I;  1IBK L;  1OXU A;  2AWN A;  3FKI G;  3SGI A;  1YZ6 A;  3BZC A;  2IX0 A;  2JK8 A;  2VY3 A;  3ULJ A;  3TS2 A;  1HR0 W;  1WCM H;  2PMZ E;  2E8G A;  4KHZ A;  3ICE A;  1D8L A;  2FXQ A;  4YHH Q;  4YY3 Q;  1X3G A;  2HIX A;  2ZM6 Q;  1WYD A;  1PH8 A;  2JA7 G;  1I6H H;  1HNW Q;  2LXK A;  3J81 c;  2F52 A;  3H0G G;  1PVO A;  1TWH H;  1HZC A;  4QIW E;  4LFC L;  3BAA A;  1X55 A;  1N33 Q;  3CME A;  3PO2 G;  4BA1 I;  4LF6 L;  4Y52 H;  1FL0 A;  1UWV A;  1VQL A;  3HOZ G;  3GDE A;  3CQZ H;  1AE2 A;  2JA9 A;  4P73 A;  3TY5 A;  2LXJ A;  4IOC A;  4DR3 Q;  2R7Z G;  4JV5 Q;  3EBE A;  4LH7 A;  3HKZ G;  4YY3 L;  3GO5 A;  3JAM c;  3RZD H;  4JI6 L;  2R92 H;  1QVF A;  4GOP B;  3RLN A;  4LF4 Q;  2IHF A;  3AQQ A;  3EIV A;  5K36 G;  1YHA A;  3S1M H;  4IO9 A;  4B3S Q;  3PO3 H;  1AE3 A;  5DLQ E;  4DR2 L;  4A3F G;  5C0X I;  1L1O B;  3J81 j;  3CF5 A;  1M1K C;  1BBU A;  1JMC A;  2UUA L;  4WJ3 M;  3JC6 6;  1SRO A;  1HJP A;  4EEQ A;  3D31 A;  1OXX K;  3G71 A;  4QY7 A;  4BBR G;  1X3F A;  1NBW A;  4PZ6 A;  5FPR A;  3CCV A;  5JEA J;  3UDX A;  1VQB A;  5C3E G;  4UY8 C;  1QVC A;  4JBJ A;  3TY8 A;  4BBR H;  1XDN A;  2HVQ A;  2Z0S A;  2MNA A;  2CCZ A;  3K81 C;  4DR4 L;  2F3I A;  1PH4 A;  2D0P A;  1VQK A;  1HNW L;  1D7Q A;  4RG1 A;  4YWK A;  3WWV A;  4DK3 C;  3F2C A;  1PHJ A;  3CC4 A;  1IL2 A;  2JA7 H;  3RLF A;  4WJ4 A;  4TVA B;  2IT1 A;  3KOJ A;  3S24 A;  3I4N H;  2Q2T A;  1Q86 C;  2WB1 G;  1P8L A;  2PQA B;  3PCO B;  4GKJ Q;  3U4Z A;  2I0Q A;  2WP8 J;  4JI0 L;  4DR6 Q;  1VQ9 A;  1TXY A;  4JBW A;  1VQF A;  2YTY A;  1Z47 A;  1HZB A;  4DR7 L;  4OX9 Q;  3KLW A;  4L5S A;  2CFM A;  1K8A C;  4LWC A;  2KBN A;  4HJ5 A;  1JJC B;  5E7N A;  2ID0 A;  2E5L Q;  2GVB A;  4JI4 L;  5LMN L;  1VQA A;  4R4Q A;  3DM3 A;  3KJO A;  3EN2 A;  3UE0 A;  4YCV A;  1VQM A;  1TA8 A;  3NBZ B;  5FLM G;  1VQ6 A;  1E1O A;  4R1J A;  3HOU H;  4DR4 Q;  1VQO A;  1GKH A;  5GAD C;  4A76 A;  4LFC Q;  2D0O A;  2VNU D;  4AQY Q;  4A3J G;  2PNH A;  3U4V A;  3H3V H;  4A3G G;  2IY5 B;  4A3M G;  3F2D A;  3PGZ A;  4GN3 B;  3PIO A;  3KF6 B;  4A3G H;  4UP9 A;  3BA8 A;  3S1Q H;  4DV6 L;  4NB3 A;  4OXP A;  1NMF A;  1LUZ A;  1J6Q A;  4H02 A;  1VQJ A;  4UCO A;  1V1Q A;  4DR5 L;  1HR0 Q;  4LF5 L;  2XTI A;  4LUZ A;  3CC2 A;  2JJQ A;  3Q8D A;  4MTN A;  4A3K G;  1PH3 A;  4MNO A;  2ZTC A;  2K4K A;  3MEF A;  5J3B A;  4HJ7 A;  1M90 C;  5IYB G;  4IPH A;  4A3L G;  1QZH A;  4OWW B;  3TY9 A;  1EIY B;  3PF4 A;  1V43 A;  1X6O A;  2H5X A;  4DV4 L;  2CKZ B;  4P72 A;  3S1R H;  2VL6 A;  3K8A A;  3M7N A;  1MKH A;  1L0W A;  4DR5 Q;  1HR0 L;  1NTG A;  1BBW A;  1L1O A;  1U0L A;  3ERS X;  1Y14 B;  1LM0 A;  5C0X J;  4UCV A;  5C4X G;  1YBY A;  5HY6 A;  5GAG C;  5C4J H;  4JYA Q;  5AJ3 L;  4QJF A;  4IFD J;  5IP7 G;  4LF6 Q;  3GJX B;  2KHI A;  3J7Z C;  1XK5 A;  1KL9 A;  3K7U C;  2OQK A;  4C3H H;  1UE1 A;  4GOP A;  4DV1 Q;  3AFQ A;  5M5W H;  4A93 G;  2XGT A;  4JI5 Q;  3AFP A;  4L5R C;  2YYZ A;  5C44 G;  3I4N G;  3H0G H;  1VQP A;  2YV5 A;  3ULP A;  4NXM L;  1NJI C;  4DUY L;  4AIM A;  2UXB L;  3PN1 A;  2N49 A;  3KF6 A;  1I50 H;  1IBK Q;  5LMU L;  2ZJQ A;  3CXC A;  4PZ7 A;  1XMQ L;  5C44 H;  3HFZ B;  4R4O A;  4DR1 L;  4GKJ L;  3H15 A;  3RLO A;  3FP9 A;  3J7A 5;  1XNR L;  3M4O H;  1T9H A;  2EIF A;  4J15 A;  2K5N A;  3K0X A;  4JOI C;  3CCQ A;  4HIO A;  2KEN A;  4A3E G;  1B04 A;  1K0R A;  2WAQ G;  3S14 H;  5LMN W;  4A3M H;  4B3T L;  1SRU A;  4DUY Q;  2UXB Q;  3PUX A;  3RTX A;  1E1T A;  4R4T A;  1I3Q H;  3CCU A;  2QEX A;  2OWO A;  1Q1E A;  1Q46 A;  2CWP A;  4X65 L;  4DR3 L;  1KC8 C;  1HNZ Q;  4P74 A;  3NBY B;  4GNX A;  1QVG A;  4OON A;  3T1H Q;  1PV4 A;  3FHW A;  1Q82 C;  3TS0 A;  2AWO A;  1SR3 A;  1UE6 A;  5AJ3 Q;  2RF4 A;  4UP8 A;  5BR8 Q;  1HNX Q;  3I2Z A;  1PH5 A;  4JI4 Q;  1DGS A;  2DUD A;  2Q2H A;  2K52 A;  3UDI A;  5FJ8 H;  1X65 A;  1VQ5 A;  1VQ4 A;  1AH9 A;  1S3O A;  2N8N A;  1S40 A;  2WB1 E;  1FJG Q;  5JEA G;  2JA5 H;  5IWA Q;  3TRZ A;  4A3D G;  4IOA A;  4QQB X;  5FLX c;  4EFE A;  1W3S A;  3BZK A;  3M3Y H;  2R7D A;  3I55 A;  4IFD G;  1K3R A;  4JI2 L;  2YU9 H;  3TRE A;  1WCM G;  4TQU S;  4UCU A;  2NZH A;  1CSP A;  1LTL A;  1X56 A;  1YJW A;  1XMQ Q;  4A75 A;  4JI7 Q;  2A8V A;  3CP0 A;  1JJG A;  1VQG A;  2PI2 A;  3PUY A;  4X64 L;  5IP7 H;  2OCE A;  1N36 L;  4PZ8 A;  4GS3 A;  3T1H L;  3GTM H;  3I4M G;  5IYC G;  1Y1W G;  2YTV A;  4AQY L;  4BXX H;  4X6A H;  1TAE A;  5BR8 L;  4QGU A;  1HNX L;  4YWL A;  2BA0 A;  4ME3 A;  4MZ9 A;  5FPO A;  1XJV A;  2VUG A;  4YHH L;  3GD7 A;  1X9N A;  1N9W A;  2F4V Q;  2KCM A;  4X64 Q;  4UFZ A;  3M4P A;  2OTL A;  1L2F A;  1XPR A;  5IYD H;  2OQ0 A;  1KAW A;  4PMW A;  4NPS A;  3J81 i;  2VQE L;  4JOI A;  4BBS G;  3GB8 B;  4GN4 B;  2VQF Q;  1SMX A;  4A3C H;  1CKN A;  1B7Y B;  2WAQ E;  1TWF H;  2VZA A;  3BA9 A;  3RN2 A;  4LFB Q;  4DAM A;  1XNQ L;  3DLL A;  3NC0 B;  3UDF A;  1V9P A;  4GNX C;  3JAM i;  5C3E H;  1I94 L;  3G6E A;  1KIX A;  2VQE Q;  1Q81 C;  4A3B G;  1Q7Y C;  2RHQ B;  3GTK H;  4C3I H;  3A0J A;  1CUK A;  4FDB A;  4AYB G;  4DKA C;  4K0K L;  3D0F A;  5IY0 A;  1EFW A;  1X3E A;  4JI5 L;  1PH7 A;  1YVC A;  4LF9 Q;  3F1Z A;  4O2D A;  4JI1 L;  1PH6 A;  1LYL A;  4UCS A;  2AKW B;  1K83 H;  4O0A A;  4POF A;  4POG A;  3RZO H;  3W1B A;  4GNX B;  1XPO A;  4Y7N H;  1HZ9 A;  4DAY B;  2R93 G;  2ZJP A;  1RIP A;  1TWC H;  1U5K A;  4R4C A;  5C4X H;  4DV3 Q;  1PH2 A;  1FVI A;  1G29 1;  1Q12 A;  3BJU A;  4RMF A;  3L7Z C;  1N32 L;  3QWU A;  4E6N A;  5LMN Q;  2CQO A;  2MQH A;  4DV4 Q;  3CCS A;  3UE1 A;  4DV5 Q;  3KFU A;  3J80 i;  4LH6 A;  4JBK A;  2UUA Q;  3T1Y L;  3OTO Q;  2UU9 Q;  1VQN A;  1I94 Q;  1PA6 A;  3HKZ E;  4OX9 L;  1JE5 A;  1ASY A;  2HT1 A;  4PG3 A;  2HVR A;  4HJ8 A;  3CMA A;  5D1P A;  5H1S E;  4LFA L;  2JA6 H;  4P75 A;  2UXD Q;  3HOY G;  5JJI A;  5LMU Q;  3L2P A;  3K7A H;  1IBL L;  4YCW A;  1N32 Q;  3UDG A;  3F8T A;  3W5O A;  4DUZ L;  1J5E Q;  1EUJ A;  1BVS A;  1VCI A;  3CCL A;  3IRB A;  4BXX G;  2UUC Q;  3HOY H;  1A8V A;  3TEH B;  1PFS A;  3PF5 A;  3STB C;  1NY4 A;  4A3J H;  3NEM A;  2BH2 A;  1KHI A;  5IYD G;  4KHP Q;  4GLA C;  1UE7 A;  4KLK A;  4YCU A;  4HJA A;  2UXC Q;  4K0K Q;  1K8G A;  4YWM A;  1KQS A;  3S15 H;  4C2M H;  3S17 H;  1SLJ A;  1HNZ L;  1EOV A;  4JC0 A;  4X65 Q;  3A74 A;  1PYB A;  4OO1 I;  2ZM6 L;  1YJ9 A;  1FGU A;  2ZTD A;  3B6Y A;  1ASZ A;  3GTO H;  4XIG S;  2HVS A;  1VQ7 A;  2NZO A;  1Z9F A;  2B3G A;  5D1O B;  5M3F H;  2VW9 A;  2UXD L;  2VUM G;  1XMO Q;  2K5H A;  4LW1 A;  1YIT A;  4B3M Q;  2HIV A;  3H3V I;  1VQD A;  3HOV G;  4DR2 Q;  4BY1 H;  1SN8 A;  3RR5 A;  4DR1 Q;  1GO3 E;  3GTL H;  3GTG H;  1NMG A;  3CCR A;  3T1Y Q;  4A3I G;  3I4M H;  1JJ2 A;  4BA2 I;  5IWA L;  4A3L H;  1YNX A;  3HOW H;  2Q2I A;  1WJJ A;  3NEN A;  1KRT A;  3L0O A;  1VQC A;  2L15 A;  1VQ8 A;  3CW2 C;  4JCV E;  4DV3 L;  1YIJ A;  1S72 A;  3ZJY C;  4A3I H;  3GTQ H;  4DV2 L;  5IP9 H;  3CCM A;  1A0I A;  4JI8 L;  2F4V L;  4JG2 A;  1C9O A;  2BH8 A;  1UEB A;  1YEZ A;  3E0E A;  1QZG A;  5JJK A;  4B3R L;  5HGQ A;  1A63 A;  1CKO A;  4LUV A;  1WFQ A;  3OW2 A;  1N36 Q;  2NVT H;  2R7Z H;  3KYH C;  2N3S A;  4DNI A;  1QUQ A;  1WOC A;  2Z6K A;  1XTD A;  5M3M H;  4DV2 Q;  1PH1 A;  2B63 G;  2E2H H;  2NVY H;  2I5L X;  1YI2 A;  2K5V A;  3TQY A;  4DUZ Q;  1J5E L;  5IE8 A;  3KDF B;  2D62 A;  2N78 A;  4HJ9 A;  3K80 C;  3HOU G;  3U58 A;  4GKK Q;  2JA6 G;  4LFB L;  4IPD A;  1A62 A;  1H95 A;  1IYJ B;  2JEB I;  3ER0 A;  1TWG H;  5GAH C;  4A3F H;  1XNR Q;  2LSS A;  2JE6 I;  2A1A A;  4UP7 A;  4LF4 L;  5M5Y H;  2NVX H;  2IX1 A;  4L5Q A;  4DV0 Q;  2Q2U A;  2VQF L;  1CKN B;  3CCE A;  2I5H A;  3CPW A;  1XMO L;  2GVA A;  1NE3 A;  1C7Y A;  3I56 A;  4QL5 A;  4HID A;  1YHQ A;  4JV5 L;  1GD7 A;  4P71 A;  4XTC S;  5GAE C;  3HOX G;  3CCJ A;  4DV6 Q;  2HHH L;  2VUM H;  1QUQ B;  4EX5 A;  3M9B A;  1HZA A;  1EIF A;  1IBM Q;  4OWT B;  4C3J H;  2MFI A;  4GOP C;  5GQO A;  2DGY A;  3U50 C;  2K14 A;  3S1N H;  4A3D H;  3PUW A;  1VQI A;  3ULL A;  3J80 c;  1Q8K A;  2C35 B;  2YTX A;  3KF8 B;  2R7F A;  3LGJ A;  1WI5 A;  4R4I A;  1EQQ A;  2UUB Q;  1G6P A;  1YHB A;  4JI8 Q;  1BKB A;  1IXR A;  1B8A A;  2HHH Q;  3G4S A;  1MIU A;  4HIM A;  1OTC A;  4IPC A;  1SFO H;  1B70 B;  3S2D H;  3M85 A;  2HQL A;  2OTJ A;  4JBM A;  4BY1 G;  3PUZ A;  3FKI H;  4DV0 L;  4GLX A;  1W2B A;  4B3T Q;  4BY7 G;  2ALY B;  3NBH B;  5FJ8 G;  1E7Z A;  4B3S L;  3JSN A;  2R93 H;  4EQ5 A;  3AYH B;  4X62 L;  3KJP A;  1Y1V H;  3CD6 A;  2E2I H;  5JJL A;  3OTO L;  2UU9 L;  1GM5 A;  4JI6 Q;  2WFW A;  3PO2 H;  2Z6K C;  3CC7 A;  4DV7 Q;  5IP9 G;  5ELN A;  1I5F A;  1Y1V G;  2V1C C;  4DK6 C;  4EFB A;  4IJL A;  1IZ6 A;  4NXM Q;  2KCT A;  4OO1 G;  4A93 H;  1OXV A;  1EQR A;  5M3M G;  3HKS A;  3OYY A; 
#chains in the Genus database with same CATH topology
 4HMI A;  3FPP A;  3I7F A;  4DR2 H;  5KND A;  1AN8 A;  1RHP A;  3K0Y A;  2EJ2 A;  5IYC H;  1Y1W H;  5I5S A;  1TY0 A;  3GIQ A;  4ED3 A;  3KHL A;  4A3E H;  4B3R Q;  4DRF A;  1Z2P X;  4HCE A;  3QR8 A;  1AZP A;  2W9B B;  5KGU A;  3I91 A;  2JA7 A;  4JV5 H;  1Y1W A;  1CA6 A;  1MJC A;  4I7A A;  4PNY A;  2EJF C;  3RJ0 A;  3T9E A;  1A6X A;  4O3P A;  1LTS D;  5EPL A;  4R9W A;  4DGZ A;  3GV8 B;  3E0J A;  1HR0 H;  3GTQ A;  3IG0 A;  3TBI B;  4OEM B;  3K5L A;  4ETS A;  1D5X C;  3S14 B;  1Y8P B;  2K03 A;  2ES2 A;  1MBY A;  4YHH H;  3T56 B;  4A3I B;  3KDF A;  3GTQ B;  2X0S A;  3NTI A;  2CVR A;  2QK4 A;  1KLU D;  1XTC D;  3H94 A;  4K14 A;  2K75 A;  3BDO A;  3R3O A;  5KYI A;  3U9S A;  4U68 A;  1QIL A;  4JYA L;  2F0I A;  4CC6 A;  5EAY A;  3FMA A;  1CQJ B;  2ASB A;  3S16 H;  4B3M H;  1G2S A;  2FJ2 A;  2I07 B;  1JT8 A;  1BUV T;  3HOZ H;  4O7R A;  3DXJ C;  2K05 A;  1CZG A;  1E3P A;  2COI A;  4OWX B;  4XX0 B;  4A4I A;  3V6J A;  1IL8 A;  5HV6 A;  4JI2 Q;  3S1M B;  1IBL Q;  4G7O C;  1JKJ B;  5DMX A;  4FU0 A;  3M4Q A;  4LFC H;  3NBH A;  1YJN A;  4LUO A;  2CQY A;  4UHV A;  2DIK A;  1Q1B A;  4GKK L;  1HUM A;  1FJG L;  1TWA H;  5EGT A;  3FDT A;  4MIU A;  1B2T A;  5EPJ A;  4LMY A;  4R8U A;  2JA8 G;  3BAB A;  1OWT A;  3OHX C;  4EQN A;  3G6X A;  4FFM A;  3RNU A;  4DF7 A;  4X66 Q;  4H7B A;  3JAM L;  2QCP X;  3HRZ C;  2F0P A;  4F87 A;  1PRT D;  2PNR C;  2TSS A;  3MXN B;  4KY6 A;  1JB7 A;  5ELD A;  4BBS H;  2XCP A;  1N34 Q;  2MO0 A;  5DNF A;  3HOX H;  4JI1 Q;  2RCN A;  4MV4 A;  1TWF B;  5KT7 A;  2PW5 A;  4UCT A;  2V9W A;  4JI3 H;  1HH2 P;  5C0X G;  4L5T A;  2YL2 A;  4KI0 A;  1A3U A;  4FF2 A;  2F4V H;  2IPK D;  1QOH A;  3PIP A;  5JOB A;  5IGG A;  4JI7 L;  5CAE B;  3GTP A;  4IFD I;  2JA5 G;  5KG4 A;  3CKI B;  4O7L A;  4IUQ A;  2Y0S E;  4A3K B;  1PTO C;  2JN4 A;  2ASD A;  1KJ9 A;  2SDF A;  4UAI A;  4DN4 M;  3SGI A;  2JK8 A;  3TDQ A;  4ZYS A;  3R8B A;  4KHZ A;  2E8G A;  1HR0 W;  2Z4H A;  2MJ8 A;  1SFO B;  4WHX A;  4RCO A;  3MAQ A;  1PH8 A;  1WYD A;  3RBE A;  2LXK A;  5C4Z A;  3PO2 G;  2SOB A;  1TWA A;  2UU9 H;  2EJ0 A;  1FL0 A;  1H9S B;  1UWV A;  1SJE D;  2PYK A;  3P20 A;  1G2W A;  3V4S A;  2C28 A;  1S0O A;  3FKI A;  1JOQ A;  3EBE A;  2HQE A;  3HKZ G;  4YY3 L;  3JAM c;  3MR3 A;  2R92 H;  2EE1 A;  2N55 A;  5KT4 A;  4GOP B;  1S5B D;  3EIV A;  3U9O A;  5K36 G;  3M4O B;  2RGR A;  1F2M A;  5C0X I;  2EYL A;  2UUA L;  2B8F A;  4J9P A;  1JMC A;  4JI6 H;  2F0O A;  1HNW H;  1JDE A;  2C2D A;  5KT2 A;  2UXB H;  3LML A;  3LUL A;  2J4X A;  3D31 A;  1ZQ7 A;  3QOJ A;  3VR2 A;  3G71 A;  4NLG A;  1NBW A;  4Y8V B;  5FLX E;  1SCU B;  4IAJ A;  4J9R A;  2XWB B;  1VQB A;  4LFA H;  5E3F A;  1U4P A;  3V96 A;  5BWU A;  5DGB A;  5J22 A;  1GHJ A;  1PH4 A;  1O78 A;  5KFF A;  3WWV A;  2IW3 A;  2XRS D;  1BXT A;  3CVZ A;  2DPI A;  3A7L A;  3OWF A;  4JI5 H;  3RV3 A;  4DV1 H;  2OT2 A;  2HGW A;  2PQA B;  5D14 A;  3G6Y A;  4C1N K;  2I0Q A;  2K33 A;  4JI0 L;  5JVH 3;  2NVQ B;  1I1K A;  1VQ9 A;  2W6O A;  1LT6 D;  3GII A;  1VQF A;  5A2Q W;  2KVM A;  2CFM A;  1HUN A;  4LWC A;  2HGX A;  2KBN A;  5E4W C;  4F50 A;  2VB3 X;  2E5L Q;  4JI4 L;  3KJO A;  4U67 3;  1TA8 A;  1VQ6 A;  1E1O A;  3HOU H;  3K57 A;  1JOR A;  1VQO A;  3QG1 A;  4LFC Q;  4IHJ F;  4V0B A;  3GTM B;  1UC9 A;  1Z2N X;  4A3J G;  3T9B A;  4EBD A;  4KHV A;  3U4V A;  3H3V H;  4A3G G;  5KFM A;  2HUG A;  2ZXP A;  5LL6 S;  3HOZ B;  4ECZ A;  3BA8 A;  4JUZ A;  1EYA A;  4XXE A;  4DV6 L;  2CQA A;  2WDT A;  1L2Z A;  4OXP A;  3UZB A;  1NMF A;  4K8I A;  4NMZ A;  1J6Q A;  2V59 A;  1YNN D;  1V1Q A;  1HR0 Q;  5L9X A;  2XTI A;  3Q2O A;  4MTN A;  4HMJ A;  5C1O A;  1EUC B;  2R61 A;  2K4K A;  4KD4 A;  4O4H F;  4CDE C;  4EG0 A;  1A3G A;  2DY7 A;  1ZAU A;  1E4G T;  4RAZ A;  1G91 A;  3JZF A;  3PF4 A;  2CW8 A;  4MTK A;  1B53 A;  3MWD A;  3HKZ A;  1L0W A;  4R8U B;  2CNQ A;  1U0L A;  5C44 B;  3H0G B;  2NVY A;  1YBY A;  2SNM A;  3CQZ A;  5DQG A;  4IFD J;  2LY7 A;  2KHI A;  3J7Z C;  2QKI C;  4DV0 H;  1PMR A;  3TZD A;  1Y69 U;  4A3G B;  5KFN A;  2XGT A;  3T5L A;  3R5F A;  2YYZ A;  1SE3 A;  5C44 G;  1RTO A;  1RYS A;  3TIG A;  1A0G A;  2PVP A;  3H0G H;  3VR3 A;  2UXB L;  4AIM A;  3PN1 A;  2R86 A;  1ENA A;  3KF6 A;  1I50 H;  5J2U F;  5LMU L;  1IKL A;  3CXC A;  4PZ7 A;  3HFZ B;  4LSA A;  1N36 H;  4GKJ L;  3TW6 A;  3FP9 A;  1T9H A;  4J15 A;  5T1I A;  1NNX A;  2KEN A;  1FYC A;  1I3Q B;  3CRL C;  2UXB Q;  4DR4 H;  4ECT A;  4R4T A;  5EJW A;  1QJO A;  2BDN A;  4YJ2 F;  1T94 A;  1GYF A;  3K58 A;  2OWO A;  5DG8 A;  1KC8 C;  5C0X H;  1F2L A;  3FMC A;  1WTW A;  4P74 A;  4QW8 A;  1JR0 D;  3WDN A;  1G8Z D;  4YAK B;  1B1Z A;  5CV5 A;  5K36 H;  3A54 A;  4Q5V A;  4OON A;  5DQI A;  3T1H Q;  4J0M A;  3FEW X;  4OX9 H;  5F9L A;  5AJ3 Q;  1KJJ A;  2RF4 A;  2J6T A;  2V4Q A;  5EBD A;  1PH5 A;  1GGO A;  1CQV A;  1UEA B;  4O7Y A;  4RB0 A;  5C5J A;  4XYM B;  1B44 D;  1AH9 A;  1VQ5 A;  5KFC A;  2K1B A;  1S3O A;  3TRZ A;  2N88 A;  5I5T A;  1TWF A;  4BBR B;  5FO9 B;  4IOA A;  4QQB X;  4X65 H;  2M2L A;  4DLK A;  2F0V A;  2NU6 B;  2XNA C;  2R7D A;  5IGC A;  4JV2 A;  1SND A;  2JA5 B;  4IUR A;  3TRE A;  1WCM G;  1ESR A;  2A69 D;  2MHV A;  5CR3 A;  2GPW A;  4M1U B;  1CSP A;  2NZH A;  4LAA A;  2PZU A;  3SEB A;  4A75 A;  2B63 A;  3CP0 A;  3MFY A;  1MSG A;  4XZ3 B;  1EHI A;  1FKA H;  2FPI B;  3PUY A;  4X64 L;  2O03 A;  2K01 A;  2OCE A;  4DR1 H;  4OEL B;  4GS3 A;  1AEX A;  3M4Y A;  4RKL A;  4BS9 A;  5BR8 L;  4QGU A;  1HNX L;  4YWL A;  5KFA A;  1V51 A;  1XJV A;  2VUG A;  4O3R A;  2K5D A;  4O2A F;  2KCM A;  4UFZ A;  2OQ0 A;  2YRX A;  5DG7 A;  3W2D A;  1F77 A;  1B6R A;  1KDA A;  1JLL B;  3GB8 B;  5BMV F;  3D4W A;  1N34 H;  3ONA B;  1SYD A;  4FXK C;  2JA5 A;  1S5E D;  1EQT A;  3RUZ A;  4BWG B;  3RN2 A;  1PFB A;  1DIK A;  3L3O C;  5DGI A;  1XNQ L;  3PVX A;  3CU7 A;  3RMH A;  3UDF A;  4GNX C;  3JAM i;  5C3E H;  3G6E A;  4FVM A;  3KLS X;  2W6M A;  2RHQ B;  4NP5 A;  5HGT A;  3GTK H;  2NVX A;  3A0J A;  1CUK A;  1SYF A;  4K0K L;  4HR7 A;  4X62 H;  1JB3 A;  3D0F A;  3FPU B;  4LF9 Q;  4IUT A;  1CHP D;  2W57 A;  2V4D A;  4UCS A;  1KJI A;  4CMF A;  1E4E B;  3W1B A;  1K8M A;  4Y7N H;  4DAY B;  3LWE A;  2VB2 X;  2R87 A;  5KFO A;  4QWD A;  3GTO A;  2VQF H;  2I80 A;  3C1F A;  1Q8I A;  4EYI B;  2V5A A;  3M4I A;  2RSO A;  3T1Y L;  2UU9 Q;  1I3Q A;  2HDK A;  1I94 Q;  5JVL A;  1PA6 A;  4CMD A;  1UUP A;  4FYD A;  3Q8Q B;  1JE5 A;  1ASY A;  2HT1 A;  4PG3 A;  4K0K H;  4EYH B;  4P75 A;  2UXD Q;  5JJI A;  2FJZ A;  2ZM6 H;  2QW7 A;  3D4D A;  1IBL L;  3I4M B;  5DM7 3;  1AZQ A;  3F8T A;  3W5O A;  5ELE A;  1BVS A;  1VCI A;  3K5N A;  3CCL A;  3JZ6 A;  1S0N A;  1STY A;  4RH6 A;  3H40 A;  3HOY H;  1X3P A;  3VA7 A;  2YS7 A;  3PF5 A;  3TEK A;  5BN3 A;  1NY4 A;  2ASL A;  3JAM W;  2EOT A;  1KHI A;  4KHP Q;  5G3L D;  4YCU A;  4HJA A;  2R8K A;  1K8G A;  1KQS A;  4C2M H;  2RA4 A;  1HNZ L;  3I4L A;  3A74 A;  4Q44 A;  1DAA A;  1YJ9 A;  1ASZ A;  3H0G A;  1I50 B;  3GQB A;  1DZ1 A;  2FMA A;  1R9T A;  2B3G A;  2VXW A;  3HG9 A;  4DA2 A;  1OO9 B;  5K5P A;  5CV7 A;  1WTX A;  1XMO Q;  4EGJ A;  5TSS A;  1SN8 A;  1PFN A;  4A3I G;  3BYT B;  3H91 A;  4XQJ A;  1SE4 A;  4BA2 I;  1IYV A;  4A3L H;  2UVV A;  1PFM A;  4JV0 A;  3RGZ A;  4A3I H;  3GTQ H;  4DV2 L;  2EJM A;  4CDD C;  4AYB B;  3GIK A;  1A0I A;  4JI8 L;  3H4B A;  2BQR A;  2F4V L;  3NP8 A;  4FF3 A;  1I7N A;  1UEB A;  4LFB H;  3T54 A;  2PN1 A;  4LUV A;  4GC7 A;  3KYH C;  3GTK B;  4JI4 H;  5KFD A;  1S10 A;  2C5C A;  5CA1 F;  4ID6 A;  2W9C B;  2F0H A;  2W9A A;  4J6H A;  3KDF B;  4HJ9 A;  3HOU G;  4A3B B;  2HCI A;  4ED1 A;  2JA6 G;  1FGB D;  4IPD A;  4O4I F;  3PW2 A;  1DXM A;  3DEP A;  2Q7D A;  2ZJT A;  1JE4 A;  2LSS A;  1DOL A;  3HOV B;  2B2V C;  4KJN A;  1CKN B;  3K59 A;  5KG1 A;  3CPW A;  1XMO L;  2GVA A;  3J80 E;  3OHA A;  1C7Y A;  4K6N A;  3I56 A;  4ECW A;  3DF7 A;  4IUP A;  5GAE C;  2IX3 A;  2VUM H;  1EWH A;  1IW7 C;  2MP1 A;  3M9B A;  1HZA A;  4TV9 F;  4K6L A;  4NXM H;  1IBM Q;  1T5X D;  2LKV A;  2F0M A;  2DGY A;  4G7H C;  2K14 A;  4O83 A;  3NTH A;  5C4J B;  3J80 c;  1Q8K A;  4NDX A;  3TIN A;  1EQQ A;  2L1B A;  3SE7 A;  4A3E B;  4JI8 Q;  1EIH A;  1ZHQ A;  4HIM A;  4ECV A;  3F2U A;  4QB4 A;  4F4X A;  2E2D C;  1B70 B;  3S2D H;  1L0X B;  2HQL A;  1NAP A;  4F8M A;  4JBM A;  4BY1 G;  4DV0 L;  3LWU A;  2VPQ A;  4KK7 A;  3GTJ A;  3NSW A;  5C6A A;  4I4T F;  4CGY B;  1GUN A;  3AYH B;  1Y1V H;  2RDF A;  4C3J B;  1GJX A;  3T99 A;  2UU9 L;  4ZK9 B;  3CC7 A;  4DV7 Q;  3C3L A;  2V1C C;  4DK6 C;  5NUC A;  4TKO B;  5L37 A;  2IBK A;  1OXV A;  1C30 A;  1DM0 B;  2EXD A;  1VS0 A;  3GQC A;  4DV1 L;  1EQV A;  2F0F A;  2ICI A;  2PMZ B;  5I9O A;  5KFI A;  2EPB A;  1I6U A;  1CE8 A;  1TR5 A;  2A5H A;  2A19 A;  4HIK A;  4X66 L;  1L0Y B;  2MO1 A;  5ELF A;  2E5L L;  4R7R A;  5FLX L;  1W6J A;  3WNZ A;  4NKL A;  5IYB H;  4I55 F;  1GVP A;  1SNC A;  1A9X A;  1EEI D;  4GLV B;  1UE5 A;  4DR7 Q;  3H20 A;  2RGV A;  1KJ8 A;  2W6Q A;  4FM9 A;  3KUP A;  1R4Q B;  1KD1 C;  3EPI A;  1XPU A;  4B3M L;  3NWT A;  1KAA A;  1OXT A;  1P16 A;  5CV8 A;  2FP4 B;  2HHF B;  2B29 A;  3I4N B;  3TP8 A;  1SYB A;  4MA5 A;  1SE2 A;  5BPF A;  4H44 C;  3X3M A;  1KC7 A;  4NXN L;  4A3E G;  2AHO B;  3HP3 A;  3KHG A;  3R93 A;  1BQQ T;  4TSS A;  1FD7 D;  2UXC L;  1EZ1 A;  1SE8 A;  2IMW P;  1K9M C;  2W7O A;  4RKB A;  5KFV A;  1LAB A;  4FBT A;  2R6G A;  2RBM A;  3DTG A;  4DV7 L;  1KRS A;  2A69 C;  2AQ1 B;  1EKF A;  3GTP H;  4ALP A;  2B63 H;  4B9X A;  4LK1 C;  4ED2 A;  2RQX A;  1GSA A;  5BN5 A;  2AU0 A;  4MV1 A;  1PYW D;  3JSL A;  3T51 B;  1G51 A;  2EYJ A;  3K5O A;  4JW0 A;  2EJ3 A;  2BOS A;  5I4D A;  2PO4 A;  4O3N A;  2F0E A;  3NEL A;  4FP5 D;  1F9R A;  1FNW A;  2BA1 A;  4C56 C;  4B3S H;  3HOU B;  1LTT D;  3VYT A;  1GLV A;  5FO7 B;  4IWX A;  5FD5 A;  5KFB A;  2UUB L;  1E24 A;  1Q3L A;  5M3F G;  2JEG A;  4N8X 1;  3GIM A;  5EBC A;  4LF7 L;  2C2E A;  2UVU A;  4APM A;  4LNQ A;  4GKJ H;  3UQ8 A;  3CAM A;  5I5X A;  1AW7 A;  3A8K E;  4YAJ B;  4CC5 A;  2ATW A;  1LT5 D;  4YR0 A;  1ICF B;  1K83 B;  2NTS A;  2YU9 A;  1EWI A;  3F2B A;  2PI2 E;  3UZO A;  3OHB A;  2ZJR A;  5ISR A;  2IJ0 A;  5JVD F;  1EL0 A;  2AWN A;  4KV6 A;  1YZ6 A;  3BZD B;  2QIL A;  4RAU C;  1YNJ D;  3R9R A;  1XMQ H;  2WV6 D;  1D8L A;  1I6H H;  3R2T A;  3TN2 A;  1HNW Q;  5C4X B;  2JA7 G;  2P0A A;  1C48 A;  2F52 A;  1PVO A;  1O7L A;  1TWH H;  3A55 A;  4O7W A;  1HZC A;  5LYJ F;  1X3Q A;  3Q8R B;  4BA1 I;  3OTO H;  2AUK A;  3HOZ G;  3GDE A;  3TY5 A;  1AE2 A;  2AGQ A;  4P73 A;  4LH7 A;  1S4Z A;  4JV5 Q;  2F0W A;  4O2B F;  3VYS A;  5I6Y A;  3EPG A;  3NWS A;  2ATL A;  1VF7 A;  2XVS A;  3RZD H;  3SNO A;  3TW7 A;  3L9A X;  5IIF A;  1QVF A;  3RFC A;  3T4A C;  4MV3 A;  3L4K A;  4LF9 H;  1HRJ A;  3MFG A;  4B3S Q;  3N6R A;  4DR2 L;  1G6Z A;  4RA8 A;  1STG A;  4X3U A;  3NGD A;  1BBU A;  3T5K A;  1A2U A;  4WJ3 M;  3M9N B;  1SRO A;  2XD4 A;  4DUY H;  1BNC A;  1UAP A;  1DV2 A;  4QY7 A;  2Y4R A;  2SNS A;  3QQM A;  5C3E G;  1I4Q A;  4JBJ A;  4HED A;  2UVW A;  4LF5 H;  2Z0S A;  4RGT A;  1HNW L;  1IBK H;  1VQK A;  1PK8 A;  3PR4 A;  1PHJ A;  1GUW A;  4HTH A;  3G8C A;  4HYK A;  1FJG H;  4C3H G;  4WJ4 A;  4IUV A;  3KOJ A;  4TVA B;  4DXG A;  3GTG B;  2Q2T A;  1Q86 C;  4Q43 A;  2WB1 G;  3QZ8 A;  1VBH A;  1EU3 A;  1P8L A;  3WOF A;  2B2W C;  4DR6 Q;  4ZOL F;  3ETJ A;  4LF6 H;  1TXY A;  2YTY A;  3Q23 A;  4NW2 A;  3VYU A;  3WWJ A;  3CRK C;  3GP7 A;  1I1M A;  4MV7 A;  5E7N A;  4FS2 A;  4RNN A;  2EZV A;  1B4O A;  3S17 B;  2L12 A;  3EN2 A;  3UE0 A;  4YCV A;  5FLM G;  4DR4 Q;  1EY7 A;  3ND9 A;  2X6G A;  3EQL C;  1IW7 D;  2EYM A;  2PNH A;  2X69 A;  1EY6 A;  5FO8 B;  5HUR A;  4A93 B;  2IY5 B;  1LT4 D;  4HR7 B;  3F2D A;  4MA0 A;  5EZY F;  4A3G H;  5JUM A;  2L5T A;  1SEI A;  2Y0S A;  4NB3 A;  4QUF A;  1Y1W B;  3NPP A;  4H02 A;  1SSO A;  4DR5 L;  1DCZ A;  4J9O A;  3CC2 A;  4GZY C;  2JJQ A;  2K04 A;  2FMC A;  4KMU C;  4A3K G;  3M3Y B;  4Q0Y A;  5J3B A;  4HJ7 A;  3MEF A;  4RUA A;  1TII D;  2ODT X;  3TY9 A;  5M5Y B;  4ZUI A;  2RCF A;  1WCM B;  2H5X A;  4P72 A;  4DV4 L;  3S1R H;  1DOK A;  2VL6 A;  4FBU A;  2IL8 A;  3K8A A;  5CR5 A;  1M7J A;  2E5L H;  1HR0 L;  1WSC A;  5C0X J;  1L1O A;  3ERS X;  3WO0 A;  3G8D A;  5HY6 A;  4N9T A;  1I2L A;  5F2D A;  4WJW A;  1XWE A;  4LF6 Q;  4PDB A;  2HDM A;  1XK5 A;  2C2R A;  3WO1 A;  4JI7 H;  3MWE A;  3PO2 B;  1EYZ A;  2KED A;  4GOP A;  2R85 A;  4A93 G;  4IRK A;  3PIO 3;  4CKE A;  2H1E A;  2CW0 D;  5T14 A;  2E2H A;  1GOZ A;  4XYL B;  1ET6 A;  3I4N G;  4CBV A;  1VQP A;  2YV5 A;  1Y1V A;  3ULP A;  2CH4 W;  4DUY L;  3CSW A;  2EYP A;  4QWB A;  2N49 A;  1IBK Q;  4DL7 A;  2D2C C;  4I65 A;  2JEI A;  1PX2 A;  5C44 H;  5C3W A;  4C5B A;  4R4O A;  2VA3 A;  1RJR A;  3RLO A;  1LO5 D;  4ZCK A;  1KTA A;  4XYO A;  3VPB A;  2EIF A;  4ECR A;  4XDX A;  4HIO A;  2IP4 A;  1K0R A;  5BPH A;  4HNT A;  4A3M H;  1N32 H;  4DUY Q;  2GLT A;  4PMC A;  3VYR A;  5EWG A;  5D3D A;  2D9U A;  2FK3 A;  3VMM A;  2CWP A;  1Q46 A;  4MTD A;  4X65 L;  5I9P A;  4DR3 L;  4TQR A;  3NBY B;  3DAA A;  3H4D A;  5C4H A;  1WD0 A;  1K83 A;  1TWA B;  1PRT C;  4ZLT F;  2B2W A;  4DUZ H;  5EKL A;  4QWA A;  1Q82 C;  2XCL A;  3PO3 B;  4Q4D A;  2WAC A;  1SR3 A;  1UE6 A;  1RK5 A;  1PZJ D;  2HGS A;  4AYB A;  3FDS A;  2M00 A;  2W8L A;  4JI4 Q;  4KN7 C;  2DUD A;  1C8C A;  3UDI A;  1EKV A;  4X3T A;  2YS6 A;  2HVS A;  3V2T A;  5JEA G;  5IWA Q;  3U54 A;  1BDO A;  1ROD A;  5KT3 A;  4G3I A;  4IFD G;  3EFX D;  4K2K A;  4JI2 L;  2YU9 H;  2PBZ A;  2ZDQ A;  3PW7 A;  1V8Q A;  2VUM A;  2D5D A;  1YJW A;  4JI7 Q;  2O5J C;  2A8V A;  1MSH A;  1JJG A;  1HHV A;  3T9F A;  3KXY T;  1N36 L;  2FKL A;  1HQM C;  5LL6 X;  2H4O A;  4DR5 H;  2YTV A;  4AQY L;  4BXX H;  3T53 B;  2UXD H;  5M3F B;  1Y8O B;  5JAV A;  3QB3 A;  4ME3 A;  4MZ9 A;  5D65 A;  2VA2 A;  1X9N A;  2F4V Q;  3PZP A;  4X64 Q;  2RVL A;  3T9C A;  3IKJ A;  4ULL A;  3PIP 3;  1XPR A;  5IYD H;  5AFW A;  1Z6H A;  2JP1 A;  5DAA A;  2F0S A;  3EA6 A;  4NPS A;  3VOT A;  3GTL A;  4JOI A;  4GN4 B;  2VQF Q;  2WAQ E;  2DJG C;  2G5D A;  3P1H A;  3BA9 A;  5JVG 3;  4YR3 A;  4DAM A;  3NC0 B;  4AQY H;  2KUM A;  1V9P A;  5M9O A;  1I94 L;  2RDI A;  1KJQ A;  5KFY A;  3SK8 A;  3MA2 B;  2W6N A;  4MN3 A;  1KIX A;  4C2M A;  3AU7 A;  1DV1 A;  3AX6 A;  2QEJ C;  3LX0 A;  1Q7Y C;  1HTL D;  4O7V A;  4C3I H;  3QFF A;  1I6H B;  4AYB G;  4BY7 B;  3GTM A;  5FR9 A;  2EYO A;  1X3E A;  5IGE A;  1PH7 A;  3HS0 C;  1YVC A;  3U9T A;  5CMD A;  2L55 A;  4V19 0;  2AKW B;  3RZO H;  3BVM A;  3N40 P;  1XPO A;  4KKU A;  2B2T A;  2R93 G;  3I4M G;  4DV3 Q;  1W93 A;  4JVZ A;  1PH2 A;  2G9H D;  4RMF A;  4K2L A;  4E6N A;  3BJU A;  1N32 L;  3QWU A;  4ED7 A;  2AGO A;  4DQN A;  2AQ2 B;  3KLS A;  2MQH A;  4O1N A;  3CCS A;  3KFU A;  3E5N A;  5KFZ A;  3BJY A;  1SDF A;  3J80 i;  4LH6 A;  3TQT A;  3OTO Q;  3LP8 A;  4FFL A;  3P75 A;  1JIH A;  4NYE A;  1PTO D;  1HFN A;  5I5U A;  3CMA A;  5D1P A;  5H1S E;  5K2M A;  5LMU Q;  3L2P A;  1PTO F;  2W6P A;  1N32 Q;  3UDG A;  3QWN A;  3X3N A;  4QIW A;  4P2C B;  4CJ1 B;  1RK6 A;  1DD2 A;  4Q8F A;  3RGX A;  1O7Y A;  3A56 A;  4X66 H;  1A8V A;  1PFS A;  2P5Z X;  5DAU A;  1V4Y A;  2FHT A;  1BCP C;  3DHQ A;  3KBX A;  2JSO A;  4G57 A;  1O7Z A;  4LSX A;  1KDB A;  5CYU A;  3GTJ B;  1PZI D;  4X65 Q;  5A2Q L;  1FGU A;  5BWV A;  3B6Y A;  4DU9 A;  1TWC A;  5F9N A;  2NZO A;  2BDO A;  4RCN A;  4IZO A;  5D1O B;  5M3F H;  2ZXO A;  4L1K A;  2KOL A;  3E5S A;  1YIT A;  1VQD A;  4YBZ B;  5BN4 A;  4DR1 Q;  2E2I B;  3H09 A;  1JOO A;  1AN7 A;  2WKC A;  2FFK B;  1YNX A;  5I2X A;  3HOW H;  2Q2I A;  3P7J A;  1WJJ A;  2L15 A;  1VQ8 A;  2BQ3 A;  4Q8E A;  4DV3 L;  2PPB C;  4N9P A;  3ZJY C;  2CNV A;  3BG3 A;  4DAV A;  4DL6 A;  1DJR D;  1IBL H;  2ZT9 C;  1C9O A;  5KG5 A;  1H9K A;  3E0E A;  5JJK A;  1KAB A;  1O75 A;  2K32 A;  3DUZ A;  4K5X A;  1N36 Q;  2R7Z H;  4HN2 A;  4DK1 A;  2N3S A;  4DNI A;  4QSH A;  4R8N A;  1MI2 A;  1QUQ A;  1XTD A;  1PH1 A;  1QCB D;  4DV2 Q;  1XNQ H;  2E2H H;  3TQY A;  3T1H H;  4JI8 H;  3VA5 A;  5IE8 A;  2N78 A;  1KDC A;  3J7A V;  3OUZ A;  2YZL A;  1ULZ A;  4FFR A;  2NUC A;  4LFB L;  1A62 A;  4X64 H;  1IYJ B;  3ER0 A;  3OMC A;  1TWG H;  2A6H C;  4KKT A;  2JE6 I;  1WRV A;  5CGK A;  5A2Q E;  3GTP B;  5M5Y H;  2NVX H;  4DV0 Q;  1YNN C;  2Q2U A;  2R7N A;  3CCE A;  1NCV A;  5KT5 A;  1WTV A;  1YHQ A;  2GQR A;  3V6H A;  4JV5 L;  1GD7 A;  4P71 A;  5I5V A;  2GPS A;  2HHH L;  2CW0 C;  4ZHQ F;  5CA0 F;  4EX5 A;  4E6I A;  5CC4 A;  3OPO A;  1ILQ A;  1JX4 A;  2KCC A;  4DAP A;  4H13 C;  2WKD A;  3D6W A;  1MHW C;  1A2T A;  5I5W A;  4OHJ A;  4DL3 A;  3KF8 B;  4XQN A;  4M0J A;  1LTG D;  1WI5 A;  2UUB Q;  1IOV A;  3E6Z X;  3URY A;  4PBC A;  1JXL A;  1BKB A;  3T13 A;  1B8A A;  3ZYY X;  1WD1 A;  1HQR D;  5FOB B;  4G4K A;  1TWC B;  4IPC A;  1SFO H;  1H9M A;  2OTJ A;  2XN9 C;  4K5W A;  3U55 A;  4B3T Q;  4BY7 G;  5C1P A;  1E7Z A;  1ZYR D;  2R93 H;  4X62 L;  2R3Z A;  3OWE B;  2F0T A;  1K1Q A;  1E2V A;  2EYF A;  3OTO L;  1GM5 A;  3EYY A;  5CV4 A;  2Z6K C;  1GHK A;  1Y1V G;  2HG8 A;  3KAK A;  4FE2 A;  4EFB A;  1WH2 A;  4GC6 A;  4NXM Q;  2KCT A;  1N56 A;  2A6E D;  1BGW A;  5M3M G;  1ML0 D;  1N8R C;  4A3J B;  3S1Q B;  3HT5 A;  5L1J A;  4LF9 L;  2V58 A;  1AUV A;  2A6E C;  2RHS B;  3D4R A;  2E76 C;  4NXN Q;  4ZI7 F;  3K7A B;  1TT2 A;  4J8Q A;  5IT9 c;  1XNR H;  1EY8 A;  3I70 A;  3DTF A;  3UFX B;  2JA8 H;  1N33 H;  3MTS A;  2KHJ A;  4WRD A;  2A1H A;  2KEC A;  3V4Z A;  2CWA A;  1XNQ Q;  2HJW A;  2B8G A;  1SNQ A;  2AQ3 B;  5EPK A;  5KFW A;  2KJX A;  5BWT A;  2F0Q A;  1O7I A;  2J6S A;  1M4V A;  4Q45 A;  2VPS A;  1K3B C;  1CKM A;  3MWY W;  2QDB A;  3LNN A;  4IJH A;  4JI3 L;  1LTA D;  3AMU A;  2Y0S G;  3NUC A;  3S2H H;  1CM9 A;  5DGH A;  4MAM A;  4UPA A;  4K5V A;  4O42 A;  5M5W B;  3GTK A;  3T16 A;  4CHT B;  2JA7 B;  4KY5 A;  5IGB A;  1N33 L;  5KS8 A;  1B3Q A;  1TS3 A;  3PV0 A;  4UCR A;  1NSN S;  4RGM A;  3HOW G;  4JI3 Q;  3D3R A;  3VDY A;  4FFP A;  5LMN H;  1C0A A;  2QGQ A;  4RNO A;  3TII A;  4GN5 A;  4ABN A;  1JC7 A;  5I6W A;  5M5X H;  4LF8 Q;  4F4Y A;  3I90 A;  1CI3 M;  4LFA Q;  4J9N A;  1SXT A;  2ZGI A;  1EUD B;  2R92 G;  3A5Z B;  2XGQ A;  3AB9 A;  4KTA A;  3PW0 A;  4IRD A;  1IKM A;  4CKB A;  4O3Q A;  4TVI A;  3PO3 G;  1H9J A;  3K5M A;  1S0M A;  5GRO A;  2K50 A;  5ELO A;  2PZT A;  3HKZ B;  4HCS A;  2W70 A;  5KG3 A;  1GUT A;  2QA4 A;  2R7Z B;  2MPM A;  4IWY A;  2ABJ A;  2ZXR A;  2E74 C;  2VS1 A;  3KF8 A;  1F2Y A;  1OXS C;  3HEJ A;  3KLR A;  3BVZ A;  1ENF A;  3E9H A;  4L8J A;  1SMY C;  1OBG A;  1S5F D;  3NQI A;  2OF1 A;  2NN6 H;  3I4O A;  5KRU A;  3OIP A;  1SFO A;  1MJE A;  1HA5 A;  3V05 A;  4KJO A;  4WOR A;  1K8O A;  2BR0 A;  2RSN A;  2JEJ A;  2FLL A;  3C1E A;  2EY6 A;  4A3K H;  1E2Z A;  3CCQ A;  5DIS C;  5LA6 F;  2UXC H;  2IHE A;  3OMG A;  4JI0 Q;  2NVQ H;  4ED0 A;  5KFJ A;  1XYI A;  2BCO A;  1ICW A;  1E22 A;  2FK1 A;  3VNN A;  1JWS D;  2NTT A;  2JEA I;  1OXU A;  2YZM A;  5EOY A;  2XIW A;  3NBI A;  3BZC A;  2YYA A;  3TS2 A;  2DNC A;  4O4L F;  1MZB A;  4RUC A;  1WCM H;  3S1R B;  2PMZ E;  5JH7 F;  2FXQ A;  4YHH Q;  3PQI A;  2HIX A;  1V1P B;  3J81 c;  2HCC A;  3VPC A;  4C1N I;  4QIW E;  3H6M A;  4LFC L;  5HNE A;  1EEF D;  2MCT A;  1I1L A;  4Y52 H;  1GSH A;  5I5Y A;  3ND8 A;  1VQL A;  5BWR A;  2JA9 A;  5KFP A;  3A7A B;  2LXJ A;  4IOC A;  2R7Z G;  4J9M A;  4O3O A;  1SYC A;  3J81 E;  4FFO A;  1MD2 D;  3CHB D;  2B2V A;  4M8A A;  3S15 B;  4DIM A;  4QMG A;  2IHF A;  2Q8T A;  1YHA A;  3S1M H;  4IO9 A;  5GON F;  1AFP A;  4FS1 A;  1EZ8 A;  1LT3 D;  3HOY B;  3RUP A;  1L1O B;  3CF5 A;  1CTM A;  4ECX A;  5EQ0 A;  3IFD A;  1HJP A;  2DWC A;  2EVB A;  3HXL A;  1OBD A;  3WWH A;  4BBR G;  4G7Z C;  2WB1 B;  5JEA J;  3CCV A;  3UDX A;  3GLK A;  1WTP A;  3HGB A;  4O7T A;  4LF8 H;  4UY8 C;  1QVC A;  5CE8 A;  1PTO B;  1U4M A;  2HVQ A;  3T9A A;  3TQ1 A;  2CCZ A;  3K81 C;  4I50 F;  2I46 A;  4YWK A;  3QOL A;  3GV7 B;  3M9M B;  3F2C A;  5KFX A;  4MV9 A;  5KYL A;  5IWA H;  2WII B;  4NZN A;  3VR5 A;  1EKP A;  1PXU A;  2F0D A;  2A73 B;  3S24 A;  3FVQ A;  3I12 A;  5CB4 F;  1IBM H;  2J9G A;  1GUO A;  4IUU A;  5COY A;  2FPP B;  1K1S A;  1DYQ A;  3PMF A;  3NTK A;  1II3 A;  4JBW A;  4DR7 L;  4RB1 A;  3SI8 A;  1IHZ A;  3KLW A;  4L5S A;  3S9W A;  1STH A;  1K8A C;  1S5C D;  3MR2 A;  2AUJ D;  2ID0 A;  3V6K A;  4R4Q A;  1VQM A;  3NBZ B;  2W9B A;  2EJG C;  1QWY A;  4EVO A;  5L1L A;  2FIN B;  1GKH A;  4A76 A;  2DLN A;  3GID A;  2Z1C A;  2D0O A;  4WBN F;  1SYE A;  5C3E B;  2WIN B;  5M5X B;  5LHY 1;  4A3M G;  1BF4 A;  3PIO A;  1M6V A;  4IZ8 A;  4UP9 A;  1I4H A;  4JPB W;  1IOW A;  2EY5 A;  2PW7 A;  2R92 B;  1B33 N;  4O7N A;  1VQJ A;  4A2B A;  4LF5 L;  4DAA A;  4LUZ A;  3GIJ A;  4MNO A;  1PRT B;  2ZTC A;  3N52 A;  1M90 C;  1A3V A;  4IUN A;  1CHQ D;  4K8J A;  5IT9 E;  5IYB G;  1VKZ A;  4IPH A;  2L0C A;  3J80 W;  1EFI D;  3R5X A;  2CKZ B;  1ZKO A;  2QDL A;  1R4P B;  1F9P A;  3M7N A;  1BJT A;  1E4F T;  4J9L A;  4DR5 Q;  1EYD A;  1JCK B;  2F0K A;  1BBW A;  4HNU A;  1Y14 B;  1LM0 A;  2DY8 A;  4NZM A;  5C4X G;  5C4J H;  5AJ3 L;  4QJF A;  4DK0 A;  5M3M B;  3Q6S A;  5IP7 G;  3GJX B;  1EZ6 A;  4DR6 H;  3RAX A;  4QF4 A;  2B39 A;  4FGR A;  4DV1 Q;  2KQ3 A;  5DEH A;  3AFP A;  4L5R C;  1B6S A;  1I4P A;  4X3S A;  4CHI A;  4ME6 A;  3C0F B;  2AGP A;  3OOC A;  4EGQ A;  3VPD A;  4NXM L;  1NJI C;  3EJI A;  4C5C A;  4E4T A;  3RAQ A;  1E0B A;  3FKI B;  1QNK A;  2ZJQ A;  4HAE A;  1UNS A;  1XMQ L;  5IOD A;  3JZI A;  3K5H A;  4N8F A;  3J7A 5;  1XNR L;  2J6U A;  4UCO A;  2KSW A;  1B04 A;  3S14 H;  1T3N A;  4B3T L;  4ECY A;  1BNZ A;  3RTX A;  1E1T A;  4ZQ3 A;  1I3Q H;  1STE A;  3CCU A;  4O81 A;  2M05 A;  1IYU A;  1Q1E A;  3GTO B;  5L1K A;  4GNX A;  5KFS A;  2TMP A;  1QVG A;  2PMZ A;  5E25 A;  1WTQ A;  3RB4 A;  1HTP A;  3TS0 A;  1RJP A;  2EY1 A;  1LTI D;  5BR8 Q;  1HNX Q;  4O86 A;  1VMC A;  1DGS A;  2NVT B;  2R7M A;  5FJ8 H;  3N8D A;  1VQ4 A;  2MGS A;  1CQF A;  3TME A;  2WB1 E;  5IOC A;  1EWC A;  1S40 A;  2JA5 H;  1FJG Q;  4EFE A;  2HHH H;  5FLX c;  1SBB B;  1W3S A;  3I55 A;  2E2I A;  4B9W A;  4PQX A;  2CZG A;  3WWI A;  2W6Z A;  4OIK A;  4TQU S;  4KHP H;  1STA A;  4UCU A;  1XMQ Q;  1LTL A;  1X56 A;  2VQE H;  1JOK A;  2XIG A;  2PI2 A;  4EEY A;  2CNU A;  3R2I A;  3C2P A;  1G2T A;  4PZ8 A;  3T1H L;  3G7L A;  1K0S A;  3K3P A;  4C3I B;  5IYC G;  1Y1W G;  4X6A H;  2IA6 A;  5CV6 A;  1A15 A;  2G9D A;  1KNE A;  4ECU A;  3A8I E;  2C22 A;  4J1M A;  3M4P A;  2OTL A;  1VDZ A;  3J81 i;  2VQE L;  3IFT A;  4BBS G;  2K5W A;  4JI1 H;  4RB2 C;  1CKN A;  1B7Y B;  1TWF H;  1FNU A;  1T36 A;  2GA4 B;  4FO2 A;  4ZRZ A;  3MFI A;  2X6L A;  3DLL A;  5DLG A;  4MV8 A;  3Q8P B;  4F88 A;  1HFG A;  4RGN A;  5T1G A;  2VQE Q;  1RJT A;  5LMU H;  1DON A;  5JEA H;  2A74 C;  3M7G A;  2QYZ A;  4DKA C;  4C3H B;  4IN3 A;  4C3I G;  1K28 A;  5IY0 A;  4JI5 L;  3F1Z A;  4JI1 L;  1PH6 A;  5I60 A;  1K83 H;  4O0A A;  4POG A;  4GNX B;  5G3L F;  1HZ9 A;  1M8A A;  1RIP A;  1TWC H;  1U5K A;  4R4C A;  1XX8 A;  1FVI A;  2DAB A;  1Q12 A;  3L7Z C;  1EYC A;  5LMN Q;  2CQO A;  4DV5 Q;  1W6K A;  4B08 A;  2UUA Q;  2OXP A;  1VQN A;  2CH4 A;  3HKZ E;  4OX9 L;  3RIZ A;  1B9N A;  2HVR A;  4LFA L;  4TV8 F;  2R8J A;  4ED8 A;  2EYH A;  4YCW A;  3L4J A;  2X5R A;  4DUZ L;  1J5E Q;  1EUJ A;  4RB3 C;  3IRB A;  3SK4 A;  4BXX G;  1PLF A;  3BQ0 A;  3STB C;  2K7V A;  4A3J H;  3NEM A;  4OIJ A;  5I2Y A;  4EBE A;  1LTB D;  4GLA C;  1D1I A;  4K0K Q;  3BDL A;  4YWM A;  3Q0A A;  3S17 H;  1SLJ A;  1CFM A;  1EOV A;  3CQZ B;  2YRW A;  4OO1 I;  1YNJ C;  1VBG A;  4FNF A;  1UNN C;  1WTR A;  5BWW A;  3BYY B;  2HD3 A;  1VQ7 A;  2JA8 B;  5KFH A;  1Z9F A;  1BO0 A;  2VW9 A;  2JYO A;  1UC8 A;  1WTH A;  2CHB D;  4OGQ C;  4DL4 A;  4IRC A;  2VUM G;  4F7X A;  4B3R H;  4LF7 H;  3H3V I;  2HIV A;  4O4J F;  4DR3 H;  4C5A A;  3HOV G;  4DR2 Q;  3RR5 A;  1GO3 E;  1NR4 A;  3WOE A;  4CDC C;  1NMG A;  3NXW A;  3CCR A;  3T1Y Q;  3GTL H;  4TUY F;  1JJ2 A;  4MTE A;  4U7C A;  5IWA L;  3QJY A;  3GV5 B;  3OSO A;  1KRT A;  2B2U A;  1SNP A;  1VQC A;  3L0O A;  4JCV E;  1Z7T A;  2EXZ A;  2B63 B;  4EQO A;  5IP9 H;  1E4E A;  2F0N A;  4JG2 A;  1JWU D;  2BH8 A;  2R6F A;  1YEZ A;  1QZG A;  1RF2 D;  4B3R L;  5HGQ A;  2KA7 A;  1D6E C;  1CKO A;  1CA5 A;  1A63 A;  1WFQ A;  1J8I A;  2NVT H;  1ILP A;  2F03 A;  1WOC A;  5KG0 A;  5LOV F;  2B63 G;  2NVY H;  3Q8S B;  2K5V A;  4DUZ Q;  1J5E L;  1D1K A;  5BYA A;  1ENC A;  1SYG A;  2D62 A;  1BXR A;  3KRE A;  3U58 A;  1ESF A;  4GKK Q;  1LLR D;  1H95 A;  5KFL A;  3K3V A;  5J39 A;  4A3F H;  1QG7 A;  3NHH A;  4UP7 A;  4NXN H;  4L5Q A;  5D8D A;  2VQF L;  3ERQ A;  2I5H A;  4A2A A;  4YR2 A;  2VR1 A;  4Z9C B;  4O7S A;  4QL5 A;  4HID A;  4XTC S;  3QO2 A;  3HOX G;  3CCJ A;  2DNE A;  5D3I B;  5CBE E;  2J7Z A;  5FNV F;  4RHS A;  4PMB A;  4R8I A;  2E2H B;  1EIF A;  5A35 A;  2EY2 A;  2YZN A;  5BWX A;  4DV7 H;  1EIG A;  5LXT F;  3U50 C;  3S1N H;  4A3D H;  1NUC A;  5DGA A;  3ULL A;  5ELB A;  3KHH A;  2YTX A;  1H9R A;  1YHB A;  2HHH Q;  1IXR A;  2PZW A;  3G4S A;  1TKW B;  4CKC A;  2LS0 1;  1ONL A;  1MGS A;  4DFA A;  3PUZ A;  3FKI H;  2FLN A;  3K5I A;  1VMP A;  2ALY B;  2RDH A;  5FJ8 G;  3S2D B;  3S1N B;  3A8J E;  2C00 A;  5KKN B;  4B3S L;  3CD6 A;  2L4N A;  5JJL A;  2ZDG A;  4IFD H;  3ORQ A;  4JI6 Q;  3R5H A;  3MXU A;  2WFW A;  2F4I A;  3PO2 H;  1HA6 A;  2DAA A;  1KUT A;  4IJL A;  1IZ6 A;  4OO1 G;  3KAJ A;  3UYY A;  3MC0 B;  2F1M A;  3HKS A;  1RDP D;  3OYY A;  4DL2 A;  1H9S A;  2E2J B;  3PUV A;  1BOS A;  3UI2 A;  1B50 A;  1CS0 A;  1N34 L;  1R9T H;  2Z04 A;  4LF7 Q;  2KCN A;  3MXP A;  4B3T H;  1IBM L;  3TP6 A;  1JIC A;  3MWM A;  4YP3 A;  3VR6 A;  2AMC B;  2XWJ B;  2Q8R E;  5C8Y F;  5JQG F;  2VOB A;  3N44 B;  5KFG A;  3BVG A;  3RN5 A;  5CV9 A;  5COR A;  4GKK H;  3N41 B;  1VQH A;  4ZKB B;  2E2J H;  3MXG A;  4A3B H;  1A3T A;  2COG A;  4YQW A;  1RYR A;  3T5H A;  3GTJ H;  4IPG A;  1PH9 A;  3G48 A;  4LF5 Q;  4YJ3 F;  4LF8 L;  2NN6 G;  3W1G A;  1X54 A;  4FXD A;  1S68 A;  3ITP A;  4QWE A;  2BQU A;  2ZTE A;  1LV9 A;  1LTR D;  2W71 A;  1FNV A;  2K5Q A;  3KBG A;  4CE5 A;  4CJ2 C;  4O82 A;  3G6J B;  4JXU A;  4AYB E;  3SK5 A;  4JI0 H;  2GN5 A;  1CQI B;  4RFB A;  3E3X A;  1EY4 A;  1ZEQ X;  3DEO A;  2NZ1 D;  4WFN 3;  4KHP L;  2R8G A;  3VR4 A;  4BWS C;  3MXN A;  4M7E A;  3SR1 A;  2F0G A;  1STB A;  5CM0 A;  3JRW A;  1XXG A;  3BU2 A;  4KKS A;  3J80 L;  1PTO H;  1F2Z A;  3A5U A;  2AQ4 A;  3GTL B;  2UUC L;  4FF4 A;  1HCZ A;  1KXL A;  1I50 A;  3PSI A;  1I7L A;  5I47 A;  4RZR A;  1U4L A;  3TP7 A;  4ZUJ A;  1QE6 A;  4F4W A;  2JQO A;  2EQS A;  2Z4I A;  1GUG A;  4DPG A;  4X62 Q;  5C5M A;  1EYG A;  2C9O A;  2O5I C;  1JDB B;  2WE6 A;  2DPJ A;  3AEV A;  4DR6 L;  4DV5 L;  4S3S A;  1TY2 A;  2R8H A;  5D1O A;  5KFT A;  2K28 A;  5FLM H;  1K73 C;  2COJ A;  4APV A;  2RDG A;  2XRQ D;  1VQE A;  4ME5 A;  2F0L A;  3RF2 A;  4LF4 H;  3MHB A;  4A3C G;  1SMY D;  1D2B A;  2I5M X;  1VAJ A;  3QIA A;  2E75 C;  5E1F A;  5FKA C;  3BAC A;  3CEB A;  4KD3 A;  4ECQ A;  2FLP A;  1CSQ A;  1L1O C;  3HOV H;  1I6V C;  3STB D;  4H0L C;  5KIX A;  5KG2 A;  4A3F B;  3LWB A;  3CPF A;  4LMQ D;  4Q4C A;  4ODG A;  4Y7N B;  2UUA H;  2YWV A;  2I87 A;  4F4Z A;  2B2T C;  2L9H A;  4EBC A;  4DNT B;  2NB0 A;  2NN6 I;  2NYZ D;  4DV2 H;  4AH6 A;  2DJF C;  1D5M C;  3E9I A;  5KG7 A;  1RL2 A;  1QNU A;  4BY7 H;  2PQA A;  3MR5 A;  1PYS B;  4OL7 A;  1IBK L;  4FXG C;  3FKI G;  4O7Z A;  2IX0 A;  1V1O A;  3ULJ A;  2VY3 A;  3ICE A;  4L63 B;  4IIJ F;  4UDU C;  2ZM6 Q;  4YY3 Q;  1X3G A;  3ORR A;  4A3D B;  1S97 A;  3H0G G;  1GSO A;  4RHR A;  3BAA A;  1X55 A;  1N33 Q;  3CME A;  3NUA A;  1I94 H;  5DQH A;  4LF6 L;  3GV6 A;  4MHE A;  4A3M B;  3CQZ H;  2BE5 D;  3PW4 A;  4DR3 Q;  4ED6 A;  1KLG D;  1SNM A;  3GO5 A;  1XMO H;  5EWF A;  4JI6 L;  2W8K A;  2ENB A;  3ERO A;  1Y8N B;  1HXY D;  4MV6 A;  3RLN A;  4LF4 Q;  5DLF A;  3KAL A;  3AQQ A;  3J7Y W;  1S03 G;  2OEO A;  3PO3 H;  1AE3 A;  3RB6 A;  5DLQ E;  2CW7 A;  4A3F G;  2R82 A;  3MZ5 A;  4RAY A;  1KEE A;  1TS5 A;  3J81 j;  1M1K C;  1Q90 A;  4PV1 C;  5C3X A;  3JC6 6;  2A68 D;  3H3V C;  3K6O A;  4EEQ A;  1OXX K;  4CDF C;  3T9D A;  1X3F A;  4PZ6 A;  5FPR A;  1I4R A;  1ZXT A;  2UUC H;  2YW2 A;  3MVV A;  2FE3 A;  1CT1 D;  3TY8 A;  4DL5 A;  4BBR H;  1XDN A;  3RB3 A;  2EDG A;  3I8Z A;  2MNA A;  4DR4 L;  1D7Q A;  2F3I A;  2D0P A;  3BDC A;  4RG1 A;  4DK3 C;  3N43 B;  1I4G A;  2WAQ A;  2LFN A;  3CC4 A;  1AUX A;  2Z9H A;  1IL2 A;  2JA7 H;  1PZK D;  3RLF A;  2B2U C;  2Z6B A;  3BG5 A;  5KFU A;  2IT1 A;  3I4N H;  2M9V A;  1GUS A;  4GKJ Q;  1C3O A;  3PCO B;  2NU7 B;  3U4Z A;  5IT9 W;  2WP8 J;  5JJZ A;  3IAY A;  4FF1 A;  3IN5 A;  1Z47 A;  1HZB A;  5KFE A;  2XSC A;  4OX9 Q;  2I8C A;  2NUA B;  3N6X A;  5DG9 A;  3RBD A;  1N48 A;  2R92 A;  1QB5 D;  4HJ5 A;  2RDJ A;  1JJC B;  1BBX C;  2F0J A;  2GVB A;  1WTO A;  5LMN L;  1VQA A;  4DNR B;  3DM3 A;  3NQT A;  4C2M B;  4HSP A;  2O4X A;  1IYE A;  1WR2 A;  1KT8 A;  4BBS B;  2SCU B;  3SE0 A;  4DAY A;  5FLX W;  5EKI A;  4OO1 H;  4R1J A;  3DMU A;  3TSS A;  4XT1 B;  5GAD C;  1JQY D;  2VNU D;  5FD6 A;  2K6A A;  4AQY Q;  2WTF A;  4QUC A;  1CK1 A;  1EOT A;  3PGZ A;  4GN3 B;  4Q0F A;  3KF6 B;  4RZQ A;  5KX5 F;  3N42 B;  3S1Q H;  3R23 A;  2W9C A;  4HN7 A;  4TQS A;  2ZDH A;  3AW8 A;  1LUZ A;  2WAQ B;  3RZD B;  5BR8 H;  1TVX A;  1HNX H;  4NZO A;  4M9U A;  1I4X A;  4RU9 A;  1ET9 A;  3Q8D A;  1PH3 A;  1F9Q A;  4C3J G;  4A3L G;  4IAL A;  1QZH A;  4OWW B;  1WVL A;  1EIY B;  1RCV D;  1V43 A;  1X6O A;  3KK7 A;  2WYO A;  1MKH A;  2R7Z A;  1NTG A;  4DV6 H;  4UCV A;  5GAG C;  1I2K A;  4JYA Q;  1M0W A;  3SK6 A;  1J9O A;  4KN4 C;  1KBL A;  4I7H A;  2R7L A;  1KL9 A;  3K7U C;  3S2H B;  2OQK A;  4C3H H;  3LQS A;  5JQW A;  1UE1 A;  3AFQ A;  5M5W H;  4CJ0 B;  5K3W A;  3MEH A;  4JI5 Q;  3GIL A;  3TP5 A;  3BQ1 A;  1SJH D;  1X32 A;  4ZAI A;  1SEB D;  4PWQ A;  2ICE C;  1EY5 A;  4DR1 L;  3H15 A;  4I7Z C;  3M4O H;  5LP6 F;  2JA6 A;  2K5N A;  3K0X A;  4JOI C;  3DWQ A;  4K6D A;  1U9R A;  1CZW A;  2PQE A;  2LMC B;  2WAQ G;  3I73 A;  3IL8 A;  5J1Z A;  5LMN W;  3DWP A;  1SRU A;  2QB5 A;  3PUX A;  4IR9 A;  2IWH A;  2SEB D;  2QEX A;  2O2L D;  4EQP A;  1HNZ Q;  1TS4 A;  5KFQ A;  4TRD A;  2XGP A;  1C4Q A;  1PV4 A;  4DV4 H;  3FHW A;  5IGD A;  2AWO A;  5DM6 3;  1BCP D;  1V1P A;  3HOW B;  4QW9 A;  4UP8 A;  1VF5 C;  3I2Z A;  3BS1 A;  4GLW A;  2Q2H A;  1Y1V B;  3PR5 B;  2K52 A;  4RGO S;  1X65 A;  1ZET A;  3OSN A;  2N8N A;  4A3D G;  2ASJ A;  3BZK A;  3M3Y H;  5KG6 A;  3PW5 A;  2KEE A;  1LAC A;  1K3R A;  2QF7 A;  4YY3 H;  2R7K A;  2Z02 A;  4HSV A;  1VQG A;  1SNO A;  5IP7 H;  3RD4 A;  3GTM H;  3FRP B;  1J5E H;  1TAE A;  1ET0 A;  4YIJ A;  5JPM C;  2ALZ A;  1TU2 B;  2BA0 A;  5FPO A;  4YHH L;  1RKN A;  3GD7 A;  1N9W A;  1PDQ A;  5C5L A;  2XCA A;  1PRT F;  2NVY B;  5J2T F;  3PFF A;  1L2F A;  1JWM D;  1KAW A;  2Y0S B;  4PMW A;  2W7P A;  2Q8I B;  2L11 A;  4ILW A;  4O3S A;  3SHL A;  3F8N A;  1RTN A;  1SMX A;  4A3C H;  3HBL A;  2VUM B;  4DV3 H;  1BR9 A;  2YCH A;  2EIY A;  5EWE A;  3U0G A;  3OSP A;  2VZA A;  3DM1 A;  5CBA E;  2FPG B;  4LFB Q;  3QZ7 A;  3G6V A;  2GQS A;  1FR3 A;  3MJF A;  2JXM B;  4WD3 A;  1Q81 C;  4A3B G;  3T7A A;  2FK2 A;  2OH2 A;  2HHF A;  1W96 A;  3M9O B;  4FDB A;  1M0T A;  1D5Z C;  1EFW A;  4LJZ C;  1TS2 A;  4O2D A;  3T1Y H;  4X3K A;  4ECS A;  2F3V A;  1LYL A;  5KT6 A;  1SAP A;  5IT9 L;  5L1I A;  4POF A;  3RV4 A;  1TWH B;  2HDL A;  5E4X A;  2ZJP A;  3GTG A;  1B9M A;  5C4X H;  1TWG A;  2XC9 A;  1G29 1;  2MUY A;  4DXF A;  3J7A F;  1EY0 A;  4DV4 Q;  3UE1 A;  1KTK A;  4JBK A;  1TWH A;  2A68 C;  3OW7 A;  1B3A A;  1ZYR C;  2B2Y A;  5KNC A;  4EGV A;  4HJ8 A;  2R84 A;  2JA6 H;  2FMM A;  3HOY G;  3ETH A;  1EY9 A;  3K7A H;  3HO8 A;  2V4R A;  2J0T D;  1F9S A;  2NWG A;  2NU9 B;  5EKK A;  2UUC Q;  4RWS C;  3HZX A;  3SDZ A;  3TEH B;  4QWC A;  2UVR A;  2R93 A;  2BH2 A;  2PCF B;  2BE5 C;  5IYD G;  5JPN C;  3NE5 B;  1UE7 A;  4KY7 A;  4KLK A;  1A48 A;  2UXC Q;  2F0U A;  4JV1 A;  3S15 H;  5KFK A;  3OUU A;  3OIQ A;  3JRX A;  4JC0 A;  1PYB A;  2ZM6 L;  2ZTD A;  1R9T B;  5KNB A;  3GTO H;  1HPC A;  4XIG S;  3J81 W;  1U4R A;  4DV5 H;  3J7A K;  2Z8L A;  1NR2 A;  5BYB A;  4ZQI A;  1STN A;  3MFH A;  2JEF A;  2UXD L;  1RJQ A;  3HB9 A;  2K5H A;  4LW1 A;  1WCM A;  4B3M Q;  1E2W A;  3W3A A;  3S16 B;  2A6H D;  4BY1 H;  1EU4 A;  3EVQ A;  3GTG H;  3I4M H;  1S9F A;  1DOM A;  4TM5 A;  4O84 A;  3O13 A;  5HBR B;  4U6P A;  3KTM A;  1HNZ H;  3NEN A;  1KNA A;  3DWA A;  5H80 A;  3CW2 C;  1YIJ A;  1S72 A;  5ELC A;  4QIW B;  4ZKC B;  3CCM A;  4L6T B;  4XYQ A;  4BY1 B;  4UUG A;  3BQ2 A;  3JAM E;  5EDW A;  4IR1 A;  1T5E A;  5IYZ F;  4HNV A;  3OW2 A;  3D6C A;  3RZO B;  2YU9 B;  3I72 A;  2Z6K A;  5M3M H;  3GIP A;  4J9S A;  3D8G A;  3HOX B;  2VQD A;  3J81 L;  4YB8 B;  2I5L X;  1YI2 A;  5LL6 b;  4QCL A;  2UUB H;  1TWG B;  3K80 C;  5KFR A;  1BCP B;  2JEB I;  3RB0 A;  3SXH A;  1XNR Q;  5GAH C;  4IQZ A;  2A1A A;  4LF4 L;  2IX1 A;  3Q24 A;  1RD9 D;  2KHS A;  3TZU A;  1NE3 A;  2NVX B;  1O80 A;  1TQO A;  4JK1 C;  4DV6 Q;  1QUQ B;  2JA6 B;  3C46 A;  4OWT B;  4C3J H;  2MFI A;  3I3C A;  4GOP C;  5GQO A;  4DR7 H;  2DN8 A;  1BCP F;  3NK9 A;  5IGF A;  2RKS A;  3PUW A;  1VQI A;  4XT3 B;  2B2Y C;  2C35 B;  4R4I A;  3LGJ A;  2R7F A;  4J9Q A;  4FFN A;  1G6P A;  1AP0 A;  1IYD A;  4JI2 H;  1MIU A;  2DZD A;  1OTC A;  2NU8 B;  3M85 A;  3Q22 A;  4GLX A;  2OLS A;  1W2B A;  3MR6 A;  1ZHS A;  3NBH B;  5KEE A;  4JYA H;  3JSN A;  2NBF A;  3SVM A;  1S5D D;  3KHR A;  4EQ5 A;  3KJP A;  1GXD C;  2E2I H;  3GV3 A;  3T5J A;  3Q1K A;  2R93 B;  2F3W A;  2R8I A;  2WB1 A;  4HQ6 A;  4J9K A;  5IP9 G;  5ELN A;  1I5F A;  1Z2O X;  2FB9 A;  1SYX B;  4XQQ A;  5FK9 C;  4A93 H;  4RNM A;  1EQR A;  2YZG A; 
#chains in