2EJ3A

Crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with gabapentin
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
305
structure length
297
Chain Sequence
b'QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Branched-chain amino acid aminotransferase
publication title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase Complexed with Gabapentin
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 98
structure length 297
sequence length 305
chains with identical sequence B, C
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2ej3A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2ej3A01
2Y4RA 5BWTA 5DAAA 5K3WA 2EIYA 1KT8A 5I5UA 2COJA 4UUGA 2HDKA 2ZGIA 5FR9A 1A3GA 3UZOA 2EJ0A 5E25A 5I5TA 1KTAA 2DAAA 5HNEA 3JZ6A 2DABA 1EKVA 4CMFA 3U0GA 5I5YA 5I5VA 2HGWA 3HT5A 4JXUA 5BWXA 3UZBA 4CMDA 3DAAA 3DTGA 3SNOA 2COGA 1I1LA 5BWWA 5I5SA 2EJ3A 4CE5A 4DQNA 4WHXA 3UYYA 1I1KA 2A1HA 4PBCA 5CE8A 2EJ2A 4TM5A 2ABJA 5I60A 1IYDA 3WWIA 1I1MA 2HG8A 4CHIA 1I2LA 1DAAA 3LULA 1G2WA 1A0GA 1EKPA 3CSWA 2HGXA 5BWVA 2HHFB 5I5WA 3WWJA 3LQSA 4TVIA 4M0JA 1I2KA 2HHFA 5CM0A 1IYEA 1ET0A 3WWHA 3CEBA 4DAAA 5CR5A 3DTFA 1WRVA 5BWRA 1EKFA 3QQMA 4K6NA 5BWUA 5I5XA 2COIA
chains in the Genus database with same CATH superfamily
1E4EA 3VNNA 2Y4RA 3ORRA 5BWTA 4IWXA 4YAJB 1KJ9A 3R5FA 1GLVA 1EZ1A 5CA0F 3TY9A 5LP6F 5GONF 2W6QA 5I5UA 2COJA 1C30A 3BG5A 5J2TF 5LXTF 3L2PA 5JH7F 4TV9F 2HDKA 2ZGIA 1VKZA 1JKJB 5FR9A 1A3GA 3GB8B 4NZOA 2HVSA 1Z2NX 3RUPA 2I87A 4XZ3B 2ZDQA 1M0TA 5JQGF 3JRXA 1AUXA 5IYZF 1GGOA 1KJ8A 3WO1A 4UCSA 3TINA 5I5VA 1KJIA 3HT5A 4O7RA 3HO8A 3K5HA 4O7NA 2GLTA 2HIVA 3W1GA 3VPCA 1A0IA 4EFEA 3DTGA 4CC5A 2QB5A 2R86A 4HNTA 2COGA 3RV4A 2HGSA 1KEEA 3U54A 4MV4A 5LOVF 1BNCA 4WHXA 5FPOA 2YZLA 3KYHC 3T9DA 4DLKA 2CNQA 4RCNA 3WO0A 2YRWA 1VS0A 3T99A 5I60A 1DV1A 4QSHA 5EZYF 1I1MA 1EUDB 1CKNB 5LA6F 1FVIA 1E4EB 2R7NA 2XCLA 1I2LA 3GDEA 1S68A 3NC0B 3JRWA 2P0AA 3VMMA 2ZDHA 1TAEA 1W96A 4HNUA 5KS8A 1KJQA 4EG0A 1ZAUA 2HHFB 1JDEA 4O84A 3OUZA 1X9NA 5JVDF 2DLNA 2CNVA 2CZGA 1ET0A 2Z02A 4YAKB 5BMVF 3N6RA 4YJ2F 2X5RA 3QQMA 4K6NA 2W6NA 2YRXA 4O7YA 4UCTA 4UCRA 5DGHA 4EEQA 3HBLA 1C3OA 4ZI7F 5I47A 2DWCA 4UFZA 5D1PA 3T9AA 3SGIA 5K3WA 5C1PA 5DGIA 4YB8B 3BABA 4O2AF 4O4HF 2NU6B 2I8CA 5BYBA 3KAKA 4MV7A 4IHJF 1XK5A 2EJ0A 3V4ZA 4DIMA 1I7NA 3K3PA 3BA9A 3TIIA 1IOVA 1TA8A 4PZ7A 4E4TA 4IWYA 1P8LA 3JZ6A 2W71A 5H80A 4TUYF 4O2BF 4O4JF 2FPGB 2W70A 4HR7A 3JSNA 4E6NA 3W1BA 5BWXA 3UZBA 4CMDA 3MJFA 3PN1A 2R7KA 3QWUA 1A48A 3JZFA 3SNOA 2R82A 2W6PA 4I50F 3GLKA 4GLXA 4WBNF 2EJ3A 4CE5A 4DQNA 1PK8A 2FP4B 3UYYA 1DIKA 4PBCA 2V58A 2GQRA 5D1OA 1JLLB 2YS7A 4C5BA 1IYDA 4MV3A 4O7ZA 4FFOA 5FPRA 5BPHA 5JQWA 2QF7A 1BXRA 5JVLA 1EYZA 4O4LF 2GQSA 2V5AA 1GSOA 1GSHA 3LULA 2COIA 3TQTA 3ETJA 1G2WA 4TV8F 4NYEA 4UCOA 2V59A 1EKPA 1CS0A 4RZQA 4EFBA 2YL2A 5J2UF 3RR5A 5I5WA 3WWJA 3LQSA 3Q2OA 4FE2A 4M9UA 4XYLB 1B6SA 1P16A 3T7AA 4NZNA 1SCUB 4IZOA 4MV8A 1IYEA 3WWHA 3TW7A 3CEBA 5CR5A 1EKFA 1CE8A 3LP8A 2HVRA 5I5XA 4GLWA 1B04A 4ZOLF 2NU7B 5FNVF 3KALA 3AW8A 3T9BA 1V9PA 5DAAA 5DISC 4I55F 1EUCB 1UC8A 1KT8A 3E5NA 1M6VA 2VPQA 3LWBA 2W6ZA 5K2MA 2R87A 1ULZA 4IIJF 4ZQIA 3U9TA 4DRFA 1WR2A 5CB4F 1PX2A 4UUGA 4FFLA 2GPSA 5DMXA 2Q2TA 5E25A 3I12A 3TIGA 1DV2A 5I5TA 3QFFA 2R85A 1CKMA 2PVPA 4CKBA 1KTAA 1CQIB 4PZ8A 1OBDA 4FFNA 3TY5A 4YBZB 5CAEB 2VUGA 3KAJA 5I5YA 1I7LA 3BA8A 1UC9A 2HGWA 1IOWA 2R84A 1VBGA 1KC7A 5C8YF 3DAAA 4HNVA 3VPBA 3MWDA 2PBZA 2NUAB 2R7LA 4EQ5A 5BWWA 2WYOA 3VOTA 3NUAA 2C00A 2OLSA 3TY8A 3Q1KA 2FPPB 4L1KA 5D8DA 5CE8A 2EJ2A 2YWVA 4EGQA 2ABJA 3JZIA 4MA0A 3WWIA 3JSLA 4CC6A 1KBLA 4FU0A 3R5XA 2HG8A 4Q4DA 3RFCA 5C1OA 2HJWA 2YZMA 3VPDA 3KREA 5CA1F 3BAAA 4O86A 3G8CA 3K5IA 4MAMA 5KX5F 3CSWA 5BWVA 3U55A 1B6RA 3V4SA 4XX0B 5HV6A 4CKCA 2X0SA 1I2KA 1Z2OX 2DZDA 2FPIB 2SCUB 2HHFA 4HN2A 5HBRB 3W5OA 3ORQA 5CM0A 3R23A 2FB9A 2Z04A 2GPWA 2ZDGA 2YS6A 1WRVA 5BWRA 3OUUA 3PFFA 2IP4A 5KKNB 4ZHQF 3T54A 1AUVA 2VR1A 4C5CA 2R7MA 1A9XA 4CKEA 1W93A 3T9FA 2W6MA 2Q7DA 5BYAA 4FFMA 2EIYA 3RV3A 4O7LA 4LH6A 3N8DA 3TEKA 2PN1A 3GIDA 4FFRA 2QK4A 3UZOA 1JDBB 3WNZA 3R9RA 2VQDA 3NBYB 3UFXB 4UCUA 2OWOA 1KJJA 3HB9A 3T9EA 4ME6A 1CKOA 1XDNA 3GJXB 3TW6A 2DAAA 3SE7A 5HNEA 2YYAA 2DABA 1EKVA 3R5HA 2CFMA 2Q2UA 4CMFA 3U0GA 4MA5A 3ETHA 2J9GA 1DGSA 1OBGA 4O7SA 2CNUA 3AX6A 4O7VA 4HQ6A 4JXUA 2DIKA 3S24A 3RTXA 2YW2A 4LH7A 4FFPA 2ODTX 1I1LA 5BPFA 5I5SA 2YZNA 5D1OB 3BACA 2NU8B 2W6OA 1I1KA 2A1HA 3T9CA 4TM5A 1EHIA 3NBZB 4Y8VB 4MV6A 4EGJA 3U9SA 4XYMB 5LYJF 3DF7A 3UQ8A 4MV1A 4UCVA 4CHIA 1DAAA 2HVQA 1T36A 4NZMA 4O81A 1A0GA 2HGXA 4FGRA 4O7WA 1M0WA 1CQJB 1GSAA 2YZGA 2XD4A 1VBHA 4TVIA 4M0JA 4I4TF 4PZ6A 1Z2PX 4C5AA 3MWEA 2HIXA 4MV9A 4O83A 4Q4CA 4DAAA 4O4IF 3VA7A 3DTFA 4O82A 3G8DA 1KUTA 4YJ3F 2NU9B 2I80A 4O7TA 5BWUA 1CKNA
chains in the Genus database with same CATH topology
4CKEA 5I47A 2Y4RA 3T9FA 5BWTA 4IWXA 3T9AA 4GLWA 2Q7DA 5BYAA 3T9BA 3SGIA 5DAAA 5K3WA 2EIYA 5DGIA 1UC8A 1KT8A 5I5UA 2COJA 3TEKA 5K2MA 5BYBA 4UUGA 2HDKA 2ZGIA 5FR9A 1A3GA 3UZOA 2EJ0A 4NZOA 5E25A 5I5TA 4CKBA 3T9EA 1KTAA 4IWYA 2DAAA 5HNEA 3JZ6A 2DABA 1EKVA 4CMFA 3U0GA 5I5YA 5I5VA 1UC9A 2HGWA 3HT5A 4JXUA 5BWXA 3UZBA 4CMDA 3DAAA 3DTGA 2QB5A 3SNOA 2COGA 2ODTX 1I1LA 5BWWA 5I5SA 2EJ3A 4CE5A 4DQNA 3BACA 4WHXA 3UYYA 1I1KA 2A1HA 4PBCA 5CE8A 3T9DA 2EJ2A 4TM5A 3T9CA 4RCNA 2ABJA 3T99A 5I60A 1IYDA 3WWIA 1I1MA 2HG8A 4CHIA 1I2LA 1DAAA 4Q4DA 3LULA 3VPDA 1G2WA 4NZMA 1A0GA 5KS8A 1EKPA 3CSWA 2HGXA 5BWVA 1ZAUA 2HHFB 5I5WA 3WWJA 3LQSA 4CKCA 4TVIA 4M0JA 1I2KA 2HHFA 4HN2A 3T7AA 4NZNA 5CM0A 1IYEA 1ET0A 3WWHA 3TW7A 4Q4CA 3CEBA 4DAAA 5CR5A 3DTFA 1WRVA 5BWRA 3PFFA 1EKFA 2X5RA 3QQMA 4K6NA 5DGHA 3T54A 5BWUA 5I5XA 2COIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4R A;  5BWT A;  5DAA A;  5K3W A;  2EIY A;  1KT8 A;  5I5U A;  2COJ A;  4UUG A;  2HDK A;  2ZGI A;  5FR9 A;  1A3G A;  3UZO A;  2EJ0 A;  5E25 A;  5I5T A;  1KTA A;  2DAA A;  5HNE A;  3JZ6 A;  2DAB A;  1EKV A;  4CMF A;  3U0G A;  5I5Y A;  5I5V A;  2HGW A;  3HT5 A;  4JXU A;  5BWX A;  3UZB A;  4CMD A;  3DAA A;  3DTG A;  3SNO A;  2COG A;  1I1L A;  5BWW A;  5I5S A;  2EJ3 A;  4CE5 A;  4DQN A;  4WHX A;  3UYY A;  1I1K A;  2A1H A;  4PBC A;  5CE8 A;  2EJ2 A;  4TM5 A;  2ABJ A;  5I60 A;  1IYD A;  3WWI A;  1I1M A;  2HG8 A;  4CHI A;  1I2L A;  1DAA A;  3LUL A;  1G2W A;  1A0G A;  1EKP A;  3CSW A;  2HGX A;  5BWV A;  2HHF B;  5I5W A;  3WWJ A;  3LQS A;  4TVI A;  4M0J A;  1I2K A;  2HHF A;  5CM0 A;  1IYE A;  1ET0 A;  3WWH A;  3CEB A;  4DAA A;  5CR5 A;  3DTF A;  1WRV A;  5BWR A;  1EKF A;  3QQM A;  4K6N A;  5BWU A;  5I5X A;  2COI A; 
#chains in the Genus database with same CATH topology
 1E4E A;  3VNN A;  2Y4R A;  3ORR A;  5BWT A;  4IWX A;  4YAJ B;  1KJ9 A;  3R5F A;  1GLV A;  1EZ1 A;  5CA0 F;  3TY9 A;  5LP6 F;  5GON F;  2W6Q A;  5I5U A;  2COJ A;  1C30 A;  3BG5 A;  5J2T F;  5LXT F;  3L2P A;  5JH7 F;  4TV9 F;  2HDK A;  2ZGI A;  1VKZ A;  1JKJ B;  5FR9 A;  1A3G A;  3GB8 B;  4NZO A;  2HVS A;  1Z2N X;  3RUP A;  2I87 A;  4XZ3 B;  2ZDQ A;  1M0T A;  5JQG F;  3JRX A;  1AUX A;  5IYZ F;  1GGO A;  1KJ8 A;  3WO1 A;  4UCS A;  3TIN A;  5I5V A;  1KJI A;  3HT5 A;  4O7R A;  3HO8 A;  3K5H A;  4O7N A;  2GLT A;  2HIV A;  3W1G A;  3VPC A;  1A0I A;  4EFE A;  3DTG A;  4CC5 A;  2QB5 A;  2R86 A;  4HNT A;  2COG A;  3RV4 A;  2HGS A;  1KEE A;  3U54 A;  4MV4 A;  5LOV F;  1BNC A;  4WHX A;  5FPO A;  2YZL A;  3KYH C;  3T9D A;  4DLK A;  2CNQ A;  4RCN A;  3WO0 A;  2YRW A;  1VS0 A;  3T99 A;  5I60 A;  1DV1 A;  4QSH A;  5EZY F;  1I1M A;  1EUD B;  1CKN B;  5LA6 F;  1FVI A;  1E4E B;  2R7N A;  2XCL A;  1I2L A;  3GDE A;  1S68 A;  3NC0 B;  3JRW A;  2P0A A;  3VMM A;  2ZDH A;  1TAE A;  1W96 A;  4HNU A;  5KS8 A;  1KJQ A;  4EG0 A;  1ZAU A;  2HHF B;  1JDE A;  4O84 A;  3OUZ A;  1X9N A;  5JVD F;  2DLN A;  2CNV A;  2CZG A;  1ET0 A;  2Z02 A;  4YAK B;  5BMV F;  3N6R A;  4YJ2 F;  2X5R A;  3QQM A;  4K6N A;  2W6N A;  2YRX A;  4O7Y A;  4UCT A;  4UCR A;  5DGH A;  4EEQ A;  3HBL A;  1C3O A;  4ZI7 F;  5I47 A;  2DWC A;  4UFZ A;  5D1P A;  3T9A A;  3SGI A;  5K3W A;  5C1P A;  5DGI A;  4YB8 B;  3BAB A;  4O2A F;  4O4H F;  2NU6 B;  2I8C A;  5BYB A;  3KAK A;  4MV7 A;  4IHJ F;  1XK5 A;  2EJ0 A;  3V4Z A;  4DIM A;  1I7N A;  3K3P A;  3BA9 A;  3TII A;  1IOV A;  1TA8 A;  4PZ7 A;  4E4T A;  4IWY A;  1P8L A;  3JZ6 A;  2W71 A;  5H80 A;  4TUY F;  4O2B F;  4O4J F;  2FPG B;  2W70 A;  4HR7 A;  3JSN A;  4E6N A;  3W1B A;  5BWX A;  3UZB A;  4CMD A;  3MJF A;  3PN1 A;  2R7K A;  3QWU A;  1A48 A;  3JZF A;  3SNO A;  2R82 A;  2W6P A;  4I50 F;  3GLK A;  4GLX A;  4WBN F;  2EJ3 A;  4CE5 A;  4DQN A;  1PK8 A;  2FP4 B;  3UYY A;  1DIK A;  4PBC A;  2V58 A;  2GQR A;  5D1O A;  1JLL B;  2YS7 A;  4C5B A;  1IYD A;  4MV3 A;  4O7Z A;  4FFO A;  5FPR A;  5BPH A;  5JQW A;  2QF7 A;  1BXR A;  5JVL A;  1EYZ A;  4O4L F;  2GQS A;  2V5A A;  1GSO A;  1GSH A;  3LUL A;  2COI A;  3TQT A;  3ETJ A;  1G2W A;  4TV8 F;  4NYE A;  4UCO A;  2V59 A;  1EKP A;  1CS0 A;  4RZQ A;  4EFB A;  2YL2 A;  5J2U F;  3RR5 A;  5I5W A;  3WWJ A;  3LQS A;  3Q2O A;  4FE2 A;  4M9U A;  4XYL B;  1B6S A;  1P16 A;  3T7A A;  4NZN A;  1SCU B;  4IZO A;  4MV8 A;  1IYE A;  3WWH A;  3TW7 A;  3CEB A;  5CR5 A;  1EKF A;  1CE8 A;  3LP8 A;  2HVR A;  5I5X A;  4GLW A;  1B04 A;  4ZOL F;  2NU7 B;  5FNV F;  3KAL A;  3AW8 A;  3T9B A;  1V9P A;  5DAA A;  5DIS C;  4I55 F;  1EUC B;  1UC8 A;  1KT8 A;  3E5N A;  1M6V A;  2VPQ A;  3LWB A;  2W6Z A;  5K2M A;  2R87 A;  1ULZ A;  4IIJ F;  4ZQI A;  3U9T A;  4DRF A;  1WR2 A;  5CB4 F;  1PX2 A;  4UUG A;  4FFL A;  2GPS A;  5DMX A;  2Q2T A;  5E25 A;  3I12 A;  3TIG A;  1DV2 A;  5I5T A;  3QFF A;  2R85 A;  1CKM A;  2PVP A;  4CKB A;  1KTA A;  1CQI B;  4PZ8 A;  1OBD A;  4FFN A;  3TY5 A;  4YBZ B;  5CAE B;  2VUG A;  3KAJ A;  5I5Y A;  1I7L A;  3BA8 A;  1UC9 A;  2HGW A;  1IOW A;  2R84 A;  1VBG A;  1KC7 A;  5C8Y F;  3DAA A;  4HNV A;  3VPB A;  3MWD A;  2PBZ A;  2NUA B;  2R7L A;  4EQ5 A;  5BWW A;  2WYO A;  3VOT A;  3NUA A;  2C00 A;  2OLS A;  3TY8 A;  3Q1K A;  2FPP B;  4L1K A;  5D8D A;  5CE8 A;  2EJ2 A;  2YWV A;  4EGQ A;  2ABJ A;  3JZI A;  4MA0 A;  3WWI A;  3JSL A;  4CC6 A;  1KBL A;  4FU0 A;  3R5X A;  2HG8 A;  4Q4D A;  3RFC A;  5C1O A;  2HJW A;  2YZM A;  3VPD A;  3KRE A;  5CA1 F;  3BAA A;  4O86 A;  3G8C A;  3K5I A;  4MAM A;  5KX5 F;  3CSW A;  5BWV A;  3U55 A;  1B6R A;  3V4S A;  4XX0 B;  5HV6 A;  4CKC A;  2X0S A;  1I2K A;  1Z2O X;  2DZD A;  2FPI B;  2SCU B;  2HHF A;  4HN2 A;  5HBR B;  3W5O A;  3ORQ A;  5CM0 A;  3R23 A;  2FB9 A;  2Z04 A;  2GPW A;  2ZDG A;  2YS6 A;  1WRV A;  5BWR A;  3OUU A;  3PFF A;  2IP4 A;  5KKN B;  4ZHQ F;  3T54 A;  1AUV A;  2VR1 A;  4C5C A;  2R7M A;  1A9X A;  4CKE A;  1W93 A;  3T9F A;  2W6M A;  2Q7D A;  5BYA A;  4FFM A;  2EIY A;  3RV3 A;  4O7L A;  4LH6 A;  3N8D A;  3TEK A;  2PN1 A;  3GID A;  4FFR A;  2QK4 A;  3UZO A;  1JDB B;  3WNZ A;  3R9R A;  2VQD A;  3NBY B;  3UFX B;  4UCU A;  2OWO A;  1KJJ A;  3HB9 A;  3T9E A;  4ME6 A;  1CKO A;  1XDN A;  3GJX B;  3TW6 A;  2DAA A;  3SE7 A;  5HNE A;  2YYA A;  2DAB A;  1EKV A;  3R5H A;  2CFM A;  2Q2U A;  4CMF A;  3U0G A;  4MA5 A;  3ETH A;  2J9G A;  1DGS A;  1OBG A;  4O7S A;  2CNU A;  3AX6 A;  4O7V A;  4HQ6 A;  4JXU A;  2DIK A;  3S24 A;  3RTX A;  2YW2 A;  4LH7 A;  4FFP A;  2ODT X;  1I1L A;  5BPF A;  5I5S A;  2YZN A;  5D1O B;  3BAC A;  2NU8 B;  2W6O A;  1I1K A;  2A1H A;  3T9C A;  4TM5 A;  1EHI A;  3NBZ B;  4Y8V B;  4MV6 A;  4EGJ A;  3U9S A;  4XYM B;  5LYJ F;  3DF7 A;  3UQ8 A;  4MV1 A;  4UCV A;  4CHI A;  1DAA A;  2HVQ A;  1T36 A;  4NZM A;  4O81 A;  1A0G A;  2HGX A;  4FGR A;  4O7W A;  1M0W A;  1CQJ B;  1GSA A;  2YZG A;  2XD4 A;  1VBH A;  4TVI A;  4M0J A;  4I4T F;  4PZ6 A;  1Z2P X;  4C5A A;  3MWE A;  2HIX A;  4MV9 A;  4O83 A;  4Q4C A;  4DAA A;  4O4I F;  3VA7 A;  3DTF A;  4O82 A;  3G8D A;  1KUT A;  4YJ3 F;  2NU9 B;  2I80 A;  4O7T A;  5BWU A;  1CKN A; 
#chains in the Genus database with same CATH homology
 4CKE A;  5I47 A;  2Y4R A;  3T9F A;  5BWT A;  4IWX A;  3T9A A;  4GLW A;  2Q7D A;  5BYA A;  3T9B A;  3SGI A;  5DAA A;  5K3W A;  2EIY A;  5DGI A;  1UC8 A;  1KT8 A;  5I5U A;  2COJ A;  3TEK A;  5K2M A;  5BYB A;  4UUG A;  2HDK A;  2ZGI A;  5FR9 A;  1A3G A;  3UZO A;  2EJ0 A;  4NZO A;  5E25 A;  5I5T A;  4CKB A;  3T9E A;  1KTA A;  4IWY A;  2DAA A;  5HNE A;  3JZ6 A;  2DAB A;  1EKV A;  4CMF A;  3U0G A;  5I5Y A;  5I5V A;  1UC9 A;  2HGW A;  3HT5 A;  4JXU A;  5BWX A;  3UZB A;  4CMD A;  3DAA A;  3DTG A;  2QB5 A;  3SNO A;  2COG A;  2ODT X;  1I1L A;  5BWW A;  5I5S A;  2EJ3 A;  4CE5 A;  4DQN A;  3BAC A;  4WHX A;  3UYY A;  1I1K A;  2A1H A;  4PBC A;  5CE8 A;  3T9D A;  2EJ2 A;  4TM5 A;  3T9C A;  4RCN A;  2ABJ A;  3T99 A;  5I60 A;  1IYD A;  3WWI A;  1I1M A;  2HG8 A;  4CHI A;  1I2L A;  1DAA A;  4Q4D A;  3LUL A;  3VPD A;  1G2W A;  4NZM A;  1A0G A;  5KS8 A;  1EKP A;  3CSW A;  2HGX A;  5BWV A;  1ZAU A;  2HHF B;  5I5W A;  3WWJ A;  3LQS A;  4CKC A;  4TVI A;  4M0J A;  1I2K A;  2HHF A;  4HN2 A;  3T7A A;  4NZN A;  5CM0 A;  1IYE A;  1ET0 A;  3WWH A;  3TW7 A;  4Q4C A;  3CEB A;  4DAA A;  5CR5 A;  3DTF A;  1WRV A;  5BWR A;  3PFF A;  1EKF A;  2X5R A;  3QQM A;  4K6N A;  5DGH A;  3T54 A;  5BWU A;  5I5X A;  2COI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...