3GJXB

Crystal structure of the nuclear export complex crm1-snurportin1-rangtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
362
structure length
274
Chain Sequence
b'GSMEELSQALASSFSVSQDLNSTAAPHPRLSQKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGHSPDHPGCLMEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snurportin-1
publication title Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 64
structure length 274
sequence length 362
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3gjxB00
5D1OA 4PZ6A 2HIVA 2HVRA 3W1GA 4UCVA 4EFBA 3GB8B 1XK5A 3TY9A 5FPOA 5DISC 1X9NA 5D1PA 1TAEA 3NBZB 3BABA 3BA8A 4E6NA 3BAAA 5D1OB 2HVSA 3S24A 1XDNA 2Q2UA 4DRFA 4LH7A 1TA8A 3GJXB 3UQ8A 3BA9A 1DGSA 3W1BA 4PZ8A 3TY5A 1P8LA 3JSNA 3NC0B 2OWOA 4GLXA 1VS0A 1B04A 2CFMA 3GDEA 1FVIA 1V9PA 4UCRA 1CKNB 2HVQA 2HIXA 3VNNA 3KYHC 3RR5A 1CKNA 3NBYB 4EEQA 3TY8A 1S68A 3PN1A 4UCOA 1P16A 1CKOA 4UFZA 5FPRA 3JSLA 4CC6A 4UCTA 4PZ7A 4EFEA 4EQ5A 2VUGA 3L2PA 4LH6A 1CKMA 4CC5A 3RTXA 4UCUA 1A0IA 3W5OA 2Q2TA 4UCSA 3QWUA
chains in the Genus database with same CATH superfamily
1KT8A 2HDKA 2DZDA 4O4JF 4YAJB 4WBNF 4MA0A 2HIVA 2HVRA 4TM5A 3W1GA 5HBRB 4TUYF 3GB8B 3BACA 3LWBA 2COGA 3N6RA 1X9NA 1A48A 2W6PA 4HR7A 2ABJA 5I60A 2HHFB 2EJ0A 2NU6B 3G8DA 2FP4B 4O84A 4DIMA 1KJQA 4E6NA 4YJ2F 5I47A 1CS0A 2R7KA 4O7VA 3T9FA 2R82A 2Q2UA 2R87A 4DRFA 4LH7A 4O4IF 4HNUA 2CNQA 5BPFA 3BA9A 2YZGA 3QQMA 5C8YF 1JLLB 2XD4A 4K6NA 4PZ8A 4NZMA 1CE8A 2V5AA 4ME6A 1OBDA 4TV8F 3NC0B 2OWOA 3V4ZA 5LA6F 4MV9A 1B04A 1VS0A 3OUZA 2X0SA 3RUPA 4C5BA 4CHIA 1EUDB 5HNEA 1E4EB 1JDBB 1EYZA 3HT5A 4RZQA 5J2TF 1EZ1A 2GQRA 2VPQA 3MWDA 1VBGA 3U9TA 4UCOA 2W6OA 3RFCA 1P16A 3WNZA 4DAAA 1B6RA 5CA0F 1DAAA 3K5IA 2FPPB 1DV2A 3JSLA 4NYEA 3U0GA 2PN1A 3TEKA 1UC8A 2YRWA 4GLWA 5I5UA 4ZOLF 4MV8A 1SCUB 5LOVF 1PK8A 1A9XA 3UFXB 1A0GA 4DQNA 5I5VA 2COIA 3NUAA 1C3OA 5CM0A 1JKJB 3DAAA 5JQWA 3E5NA 4O2AF 1CKMA 3WWIA 1GSOA 4UCUA 2W6ZA 4O81A 3KAJA 5LXTF 1WRVA 4IIJF 4E4TA 2OLSA 4XZ3B 1KEEA 5CAEB 3U55A 4Y8VB 4O86A 3KAKA 2CNUA 3QFFA 3T9AA 1ULZA 3OUUA 4NZOA 4O7SA 4FE2A 5DISC 5BPHA 5LYJF 1GSHA 2W71A 5D1PA 1TAEA 3DTFA 2XCLA 2NU7B 3CSWA 3PFFA 5C1PA 5JVLA 1KC7A 2PBZA 3GIDA 4O4LF 4YAKB 1I1KA 2DIKA 4C5CA 4C5AA 1WR2A 5JH7F 4YB8B 3UYYA 4CKBA 1CQJB 3UQ8A 3WWJA 4FFMA 2GLTA 4XX0B 5HV6A 4O7WA 2SCUB 3TY5A 1I1MA 3WO1A 1EHIA 4I4TF 5I5WA 1CQIB 5GONF 3TW6A 4XYMB 3DF7A 4GLXA 2YS6A 5E25A 4FFOA 2R7NA 4ZQIA 2WYOA 3RV4A 1DIKA 4O83A 1V9PA 2ZDHA 2I80A 1GSAA 4CKEA 5DAAA 2QF7A 2Z02A 2HVQA 3KYHC 2R85A 2FB9A 1CKNA 5BWUA 3TY8A 2DLNA 1T36A 1IOWA 3UZBA 5I5SA 4EGJA 3DTGA 2YL2A 4O7NA 4YBZB 2CNVA 1EKFA 3K5HA 5BWVA 4IWYA 4O7ZA 2FPGB 4CC6A 5DGIA 1C30A 1KJIA 1ET0A 2YZLA 4O7RA 3TIIA 4EFEA 4HNVA 1G2WA 4EQ5A 2ZGIA 4O7TA 4HN2A 3VPDA 4NZNA 4O7YA 4CC5A 4CMFA 3RTXA 4O4HF 3W5OA 1EKPA 4I50F 5BYAA 3TIGA 1M6VA 3KREA 4M9UA 4HQ6A 2DAAA 2I8CA 4MV6A 3HB9A 3ETHA 4PZ6A 5IYZF 1KJJA 2FPIB 5K2MA 1Z2OX 2V58A 4UCVA 4EFBA 1XK5A 3TY9A 1UC9A 4FFLA 1IYDA 1W96A 3T99A 4IHJF 4TV9F 3NBZB 5BWRA 5JVDF 2QK4A 5EZYF 3BABA 3MJFA 3BA8A 2HHFA 2W6NA 3BAAA 5D1OB 5DMXA 5CE8A 2EJ2A 2W6QA 2YZNA 5LP6F 3GJXB 3VOTA 3U9SA 3JRWA 4CKCA 1DGSA 3W1BA 5J2UF 3LULA 5DGHA 2EIYA 4Q4DA 1GGOA 3R9RA 3WO0A 3T9CA 3JSNA 4DLKA 5D8DA 2J9GA 4O82A 3SNOA 4MAMA 2HJWA 2ZDQA 3LP8A 2I87A 4IWXA 3HBLA 2CFMA 2P0AA 3TW7A 1M0TA 3JZ6A 3I12A 4FGRA 4JXUA 1AUVA 2R7LA 3T7AA 1W93A 1VBHA 4PBCA 3BG5A 3AW8A 4EGQA 5I5YA 1E4EA 2V59A 4MV3A 2VR1A 2HGWA 3NBYB 3SGIA 4MA5A 4EEQA 2A1HA 5KX5F 3ORRA 3PN1A 3K3PA 3VPCA 2W6MA 2HGSA 3T54A 1IYEA 3T9EA 1I2KA 3GLKA 2YYAA 5BWXA 4UFZA 2YZMA 1B6SA 3T9BA 5FPRA 2PVPA 2R84A 2NUAB 1JDEA 1DV1A 3AX6A 3N8DA 2YRXA 4CMDA 4I55F 5JQGF 4L1KA 1Z2PX 4PZ7A 2C00A 2COJA 1KJ9A 2VUGA 4O2BF 2ZDGA 3L2PA 5BWTA 2DABA 1I7LA 2HG8A 4LH6A 4O7LA 2DWCA 5H80A 2Q2TA 3WWHA 2W70A 2EJ3A 4YJ3F 4HNTA 4FFPA 1PX2A 5D1OA 3VA7A 5K3WA 1KTAA 2NU9B 3RV3A 2YS7A 5FPOA 4EG0A 2ODTX 3Q2OA 2GPSA 1KBLA 3ORQA 4XYLB 1GLVA 1BNCA 4Q4CA 2NU8B 1KUTA 2R7MA 3R5HA 1M0WA 5FNVF 4FFRA 1I7NA 1OBGA 2HVSA 3S24A 1KJ8A 1XDNA 3JZIA 4MV4A 4RCNA 1TA8A 5KKNB 5BWWA 5CB4F 4UUGA 4TVIA 3JRXA 4QSHA 3U54A 3VMMA 3UZOA 1P8LA 2HGXA 1EUCB 2X5RA 3TQTA 2R86A 3GDEA 5C1OA 1FVIA 3CEBA 4IZOA 3VPBA 4M0JA 3KALA 4UCRA 1CKNB 3R5FA 2QB5A 5I5XA 2HIXA 1A3GA 3VNNA 4MV7A 3RR5A 3G8CA 1ZAUA 1AUXA 4CE5A 2Q7DA 2CZGA 1S68A 3SE7A 5I5TA 5KS8A 2VQDA 1CKOA 3JZFA 3Q1KA 5CR5A 4ZHQF 2GQSA 1EKVA 2Y4RA 5BMVF 3ETJA 4ZI7F 2IP4A 3V4SA 1I2LA 4UCTA 3TINA 4MV1A 2GPWA 3R5XA 1IOVA 1VKZA 3T9DA 3R23A 1Z2NX 3MWEA 5BYBA 4WHXA 2YWVA 2YW2A 5CA1F 2Z04A 1I1LA 5FR9A 1A0IA 4FU0A 4FFNA 4UCSA 3QWUA 3LQSA 3HO8A 1BXRA
chains in the Genus database with same CATH topology
5D1OA 4PZ6A 2HIVA 2HVRA 3W1GA 4UCVA 4EFBA 3GB8B 1XK5A 3TY9A 5FPOA 5DISC 1X9NA 5D1PA 1TAEA 3NBZB 3BABA 3BA8A 4E6NA 3BAAA 5D1OB 2HVSA 3S24A 1XDNA 2Q2UA 4DRFA 4LH7A 1TA8A 3GJXB 3UQ8A 3BA9A 1DGSA 3W1BA 4PZ8A 3TY5A 1P8LA 3JSNA 3NC0B 2OWOA 4GLXA 1VS0A 1B04A 2CFMA 3GDEA 1FVIA 1V9PA 4UCRA 1CKNB 2HVQA 2HIXA 3VNNA 3KYHC 3RR5A 1CKNA 3NBYB 4EEQA 3TY8A 1S68A 3PN1A 4UCOA 1P16A 1CKOA 4UFZA 5FPRA 3JSLA 4CC6A 4UCTA 4PZ7A 4EFEA 4EQ5A 2VUGA 3L2PA 4LH6A 1CKMA 4CC5A 3RTXA 4UCUA 1A0IA 3W5OA 2Q2TA 4UCSA 3QWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1O A;  4PZ6 A;  2HIV A;  2HVR A;  3W1G A;  4UCV A;  4EFB A;  3GB8 B;  1XK5 A;  3TY9 A;  5FPO A;  5DIS C;  1X9N A;  5D1P A;  1TAE A;  3NBZ B;  3BAB A;  3BA8 A;  4E6N A;  3BAA A;  5D1O B;  2HVS A;  3S24 A;  1XDN A;  2Q2U A;  4DRF A;  4LH7 A;  1TA8 A;  3GJX B;  3UQ8 A;  3BA9 A;  1DGS A;  3W1B A;  4PZ8 A;  3TY5 A;  1P8L A;  3JSN A;  3NC0 B;  2OWO A;  4GLX A;  1VS0 A;  1B04 A;  2CFM A;  3GDE A;  1FVI A;  1V9P A;  4UCR A;  1CKN B;  2HVQ A;  2HIX A;  3VNN A;  3KYH C;  3RR5 A;  1CKN A;  3NBY B;  4EEQ A;  3TY8 A;  1S68 A;  3PN1 A;  4UCO A;  1P16 A;  1CKO A;  4UFZ A;  5FPR A;  3JSL A;  4CC6 A;  4UCT A;  4PZ7 A;  4EFE A;  4EQ5 A;  2VUG A;  3L2P A;  4LH6 A;  1CKM A;  4CC5 A;  3RTX A;  4UCU A;  1A0I A;  3W5O A;  2Q2T A;  4UCS A;  3QWU A; 
#chains in the Genus database with same CATH topology
 1KT8 A;  2HDK A;  2DZD A;  4O4J F;  4YAJ B;  4WBN F;  4MA0 A;  2HIV A;  2HVR A;  4TM5 A;  3W1G A;  5HBR B;  4TUY F;  3GB8 B;  3BAC A;  3LWB A;  2COG A;  3N6R A;  1X9N A;  1A48 A;  2W6P A;  4HR7 A;  2ABJ A;  5I60 A;  2HHF B;  2EJ0 A;  2NU6 B;  3G8D A;  2FP4 B;  4O84 A;  4DIM A;  1KJQ A;  4E6N A;  4YJ2 F;  5I47 A;  1CS0 A;  2R7K A;  4O7V A;  3T9F A;  2R82 A;  2Q2U A;  2R87 A;  4DRF A;  4LH7 A;  4O4I F;  4HNU A;  2CNQ A;  5BPF A;  3BA9 A;  2YZG A;  3QQM A;  5C8Y F;  1JLL B;  2XD4 A;  4K6N A;  4PZ8 A;  4NZM A;  1CE8 A;  2V5A A;  4ME6 A;  1OBD A;  4TV8 F;  3NC0 B;  2OWO A;  3V4Z A;  5LA6 F;  4MV9 A;  1B04 A;  1VS0 A;  3OUZ A;  2X0S A;  3RUP A;  4C5B A;  4CHI A;  1EUD B;  5HNE A;  1E4E B;  1JDB B;  1EYZ A;  3HT5 A;  4RZQ A;  5J2T F;  1EZ1 A;  2GQR A;  2VPQ A;  3MWD A;  1VBG A;  3U9T A;  4UCO A;  2W6O A;  3RFC A;  1P16 A;  3WNZ A;  4DAA A;  1B6R A;  5CA0 F;  1DAA A;  3K5I A;  2FPP B;  1DV2 A;  3JSL A;  4NYE A;  3U0G A;  2PN1 A;  3TEK A;  1UC8 A;  2YRW A;  4GLW A;  5I5U A;  4ZOL F;  4MV8 A;  1SCU B;  5LOV F;  1PK8 A;  1A9X A;  3UFX B;  1A0G A;  4DQN A;  5I5V A;  2COI A;  3NUA A;  1C3O A;  5CM0 A;  1JKJ B;  3DAA A;  5JQW A;  3E5N A;  4O2A F;  1CKM A;  3WWI A;  1GSO A;  4UCU A;  2W6Z A;  4O81 A;  3KAJ A;  5LXT F;  1WRV A;  4IIJ F;  4E4T A;  2OLS A;  4XZ3 B;  1KEE A;  5CAE B;  3U55 A;  4Y8V B;  4O86 A;  3KAK A;  2CNU A;  3QFF A;  3T9A A;  1ULZ A;  3OUU A;  4NZO A;  4O7S A;  4FE2 A;  5DIS C;  5BPH A;  5LYJ F;  1GSH A;  2W71 A;  5D1P A;  1TAE A;  3DTF A;  2XCL A;  2NU7 B;  3CSW A;  3PFF A;  5C1P A;  5JVL A;  1KC7 A;  2PBZ A;  3GID A;  4O4L F;  4YAK B;  1I1K A;  2DIK A;  4C5C A;  4C5A A;  1WR2 A;  5JH7 F;  4YB8 B;  3UYY A;  4CKB A;  1CQJ B;  3UQ8 A;  3WWJ A;  4FFM A;  2GLT A;  4XX0 B;  5HV6 A;  4O7W A;  2SCU B;  3TY5 A;  1I1M A;  3WO1 A;  1EHI A;  4I4T F;  5I5W A;  1CQI B;  5GON F;  3TW6 A;  4XYM B;  3DF7 A;  4GLX A;  2YS6 A;  5E25 A;  4FFO A;  2R7N A;  4ZQI A;  2WYO A;  3RV4 A;  1DIK A;  4O83 A;  1V9P A;  2ZDH A;  2I80 A;  1GSA A;  4CKE A;  5DAA A;  2QF7 A;  2Z02 A;  2HVQ A;  3KYH C;  2R85 A;  2FB9 A;  1CKN A;  5BWU A;  3TY8 A;  2DLN A;  1T36 A;  1IOW A;  3UZB A;  5I5S A;  4EGJ A;  3DTG A;  2YL2 A;  4O7N A;  4YBZ B;  2CNV A;  1EKF A;  3K5H A;  5BWV A;  4IWY A;  4O7Z A;  2FPG B;  4CC6 A;  5DGI A;  1C30 A;  1KJI A;  1ET0 A;  2YZL A;  4O7R A;  3TII A;  4EFE A;  4HNV A;  1G2W A;  4EQ5 A;  2ZGI A;  4O7T A;  4HN2 A;  3VPD A;  4NZN A;  4O7Y A;  4CC5 A;  4CMF A;  3RTX A;  4O4H F;  3W5O A;  1EKP A;  4I50 F;  5BYA A;  3TIG A;  1M6V A;  3KRE A;  4M9U A;  4HQ6 A;  2DAA A;  2I8C A;  4MV6 A;  3HB9 A;  3ETH A;  4PZ6 A;  5IYZ F;  1KJJ A;  2FPI B;  5K2M A;  1Z2O X;  2V58 A;  4UCV A;  4EFB A;  1XK5 A;  3TY9 A;  1UC9 A;  4FFL A;  1IYD A;  1W96 A;  3T99 A;  4IHJ F;  4TV9 F;  3NBZ B;  5BWR A;  5JVD F;  2QK4 A;  5EZY F;  3BAB A;  3MJF A;  3BA8 A;  2HHF A;  2W6N A;  3BAA A;  5D1O B;  5DMX A;  5CE8 A;  2EJ2 A;  2W6Q A;  2YZN A;  5LP6 F;  3GJX B;  3VOT A;  3U9S A;  3JRW A;  4CKC A;  1DGS A;  3W1B A;  5J2U F;  3LUL A;  5DGH A;  2EIY A;  4Q4D A;  1GGO A;  3R9R A;  3WO0 A;  3T9C A;  3JSN A;  4DLK A;  5D8D A;  2J9G A;  4O82 A;  3SNO A;  4MAM A;  2HJW A;  2ZDQ A;  3LP8 A;  2I87 A;  4IWX A;  3HBL A;  2CFM A;  2P0A A;  3TW7 A;  1M0T A;  3JZ6 A;  3I12 A;  4FGR A;  4JXU A;  1AUV A;  2R7L A;  3T7A A;  1W93 A;  1VBH A;  4PBC A;  3BG5 A;  3AW8 A;  4EGQ A;  5I5Y A;  1E4E A;  2V59 A;  4MV3 A;  2VR1 A;  2HGW A;  3NBY B;  3SGI A;  4MA5 A;  4EEQ A;  2A1H A;  5KX5 F;  3ORR A;  3PN1 A;  3K3P A;  3VPC A;  2W6M A;  2HGS A;  3T54 A;  1IYE A;  3T9E A;  1I2K A;  3GLK A;  2YYA A;  5BWX A;  4UFZ A;  2YZM A;  1B6S A;  3T9B A;  5FPR A;  2PVP A;  2R84 A;  2NUA B;  1JDE A;  1DV1 A;  3AX6 A;  3N8D A;  2YRX A;  4CMD A;  4I55 F;  5JQG F;  4L1K A;  1Z2P X;  4PZ7 A;  2C00 A;  2COJ A;  1KJ9 A;  2VUG A;  4O2B F;  2ZDG A;  3L2P A;  5BWT A;  2DAB A;  1I7L A;  2HG8 A;  4LH6 A;  4O7L A;  2DWC A;  5H80 A;  2Q2T A;  3WWH A;  2W70 A;  2EJ3 A;  4YJ3 F;  4HNT A;  4FFP A;  1PX2 A;  5D1O A;  3VA7 A;  5K3W A;  1KTA A;  2NU9 B;  3RV3 A;  2YS7 A;  5FPO A;  4EG0 A;  2ODT X;  3Q2O A;  2GPS A;  1KBL A;  3ORQ A;  4XYL B;  1GLV A;  1BNC A;  4Q4C A;  2NU8 B;  1KUT A;  2R7M A;  3R5H A;  1M0W A;  5FNV F;  4FFR A;  1I7N A;  1OBG A;  2HVS A;  3S24 A;  1KJ8 A;  1XDN A;  3JZI A;  4MV4 A;  4RCN A;  1TA8 A;  5KKN B;  5BWW A;  5CB4 F;  4UUG A;  4TVI A;  3JRX A;  4QSH A;  3U54 A;  3VMM A;  3UZO A;  1P8L A;  2HGX A;  1EUC B;  2X5R A;  3TQT A;  2R86 A;  3GDE A;  5C1O A;  1FVI A;  3CEB A;  4IZO A;  3VPB A;  4M0J A;  3KAL A;  4UCR A;  1CKN B;  3R5F A;  2QB5 A;  5I5X A;  2HIX A;  1A3G A;  3VNN A;  4MV7 A;  3RR5 A;  3G8C A;  1ZAU A;  1AUX A;  4CE5 A;  2Q7D A;  2CZG A;  1S68 A;  3SE7 A;  5I5T A;  5KS8 A;  2VQD A;  1CKO A;  3JZF A;  3Q1K A;  5CR5 A;  4ZHQ F;  2GQS A;  1EKV A;  2Y4R A;  5BMV F;  3ETJ A;  4ZI7 F;  2IP4 A;  3V4S A;  1I2L A;  4UCT A;  3TIN A;  4MV1 A;  2GPW A;  3R5X A;  1IOV A;  1VKZ A;  3T9D A;  3R23 A;  1Z2N X;  3MWE A;  5BYB A;  4WHX A;  2YWV A;  2YW2 A;  5CA1 F;  2Z04 A;  1I1L A;  5FR9 A;  1A0I A;  4FU0 A;  4FFN A;  4UCS A;  3QWU A;  3LQS A;  3HO8 A;  1BXR A; 
#chains in the Genus database with same CATH homology
 5D1O A;  4PZ6 A;  2HIV A;  2HVR A;  3W1G A;  4UCV A;  4EFB A;  3GB8 B;  1XK5 A;  3TY9 A;  5FPO A;  5DIS C;  1X9N A;  5D1P A;  1TAE A;  3NBZ B;  3BAB A;  3BA8 A;  4E6N A;  3BAA A;  5D1O B;  2HVS A;  3S24 A;  1XDN A;  2Q2U A;  4DRF A;  4LH7 A;  1TA8 A;  3GJX B;  3UQ8 A;  3BA9 A;  1DGS A;  3W1B A;  4PZ8 A;  3TY5 A;  1P8L A;  3JSN A;  3NC0 B;  2OWO A;  4GLX A;  1VS0 A;  1B04 A;  2CFM A;  3GDE A;  1FVI A;  1V9P A;  4UCR A;  1CKN B;  2HVQ A;  2HIX A;  3VNN A;  3KYH C;  3RR5 A;  1CKN A;  3NBY B;  4EEQ A;  3TY8 A;  1S68 A;  3PN1 A;  4UCO A;  1P16 A;  1CKO A;  4UFZ A;  5FPR A;  3JSL A;  4CC6 A;  4UCT A;  4PZ7 A;  4EFE A;  4EQ5 A;  2VUG A;  3L2P A;  4LH6 A;  1CKM A;  4CC5 A;  3RTX A;  4UCU A;  1A0I A;  3W5O A;  2Q2T A;  4UCS A;  3QWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...