5BPFA

Crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
291
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHESVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine-D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 89
structure length 291
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bpfA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bpfA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bpfA01
5IYZF 4MV1A 1OBGA 1PK8A 2FPIB 2GPWA 2C00A 4RZQA 4O2AF 4O86A 2WYOA 5CB4F 4HNTA 4MAMA 5BPFA 4XYLB 1W93A 2CNUA 3R5HA 3OUUA 2NUAB 4ZQIA 1IOWA 1EYZA 4EG0A 4O7TA 4O4IF 5LOVF 3GLKA 1GSAA 2W6PA 4EA7A 3Q1KA 4ME6A 2FPGB 2W6ZA 2YZMA 1KJQA 1WR2A 4O7LA 3BSYA 1GLVA 4TUYF 3U54A 1SCUB 4FFRA 2FP4B 3QFFA 1GSHA 2W70A 2CNVA 2XCLA 3WNZA 2W6QA 3MWDA 4HNUA 3R9RA 5LP6F 2GQSA 2Z02A 4O81A 2W6OA 1EZ1A 1JKJB 2CZGA 4IZOA 5KKNB 4C5CA 4FFMA 3TINA 1CQJB 3KREA 2P0AA 4YAKB 4EABA 1Z2NX 5CA1F 4O7ZA 3JZIA 3BFPA 4O4HF 2NU8B 5C1OA 5BPHA 4QSHA 1KC7A 4J6EA 5LA6F 2R7LA 1UC8A 1JDBB 2OLSA 2XD4A 4IHJF 3AX6A 3HB9A 4IWYA 4O7SA 4M9UA 1KJIA 1Z2OX 4TV8F 4M9CA 4I4TF 3U9TA 3JRXA 1KEEA 1I7LA 2R6FA 3G8DA 3E5NA 1EUCB 4FFNA 1DV2A 2ZDHA 5JVLA 3R5FA 3MJFA 3ORQA 5JQGF 3VA7A 2I8CA 4FFLA 2NU7B 3JZFA 2PN1A 3N8DA 1DIKA 2R82A 3BSWA 4XX0B 2IP4A 4Y8VB 2FB9A 2X0SA 4O4LF 3K3PA 1UC9A 2R7KA 3RV3A 5HBRB 1M0WA 1E4EB 4MV4A 3SE7A 2W6NA 4YJ3F 3BG5A 5CA0F 4O84A 2YW2A 1KBLA 1EUDB 3RFCA 1CS0A 2YS7A 2W71A 2DLNA 3NUAA 4YB8B 3BSSA 4MA0A 3ETJA 4GGMX 2FPPB 4EA8A 3Q2OA 4IWXA 3VOTA 4TV9F 3OUZA 3WO1A 4EGQA 5BMVF 5J2UF 2YZLA 2GPSA 3KAJA 1KJ9A 3I12A 4MV7A 2I80A 4YBZB 1BXRA 4HNVA 1DV1A 2DZDA 2R86A 2R7MA 2R7NA 4NYEA 5FNVF 1CE8A 2VPQA 3R23A 5LXTF 2HJWA 1KJ8A 5GONF 3K5HA 2QK4A 3HBLA 4EGJA 3KALA 3TIIA 2J9GA 1C3OA 3HO8A 2SCUB 2ZDQA 1E4EA 2QF7A 3V4SA 1A9XA 3DF7A 4O7RA 4C5BA 3U55A 3U9SA 4O7NA 4IIJF 1PX2A 4WBNF 3VPDA 5JH7F 4MA5A 1KJJA 2YRXA 3K5IA 2NU9B 3UFXB 3RV4A 4YAJB 2ZDGA 1OBDA 1A48A 5H80A 1VBGA 3VPCA 5D8DA 2R85A 3VPBA 3LP8A 2YZNA 4O7YA 1BNCA 4L1KA 4MV3A 3R5XA 4I50F 4EAAA 1JDEA 4MV9A 4DLKA 2V59A 3MWEA 2VR1A 1VBHA 5JQWA 4YJ2F 2Z04A 1M6VA 2HGSA 4ZHQF 3JRWA 2YYAA 1AUVA 1T36A 4ZI7F 4FU0A 4O2BF 4MV6A 2R84A 2V5AA 4O7VA 4M98A 1M0TA 5KX5F 5C8YF 3VMMA 3GIDA 5CAEB 2R87A 5C1PA 1B6RA 1EHIA 2DIKA 3G8CA 4XZ3B 4C5AA 2V58A 1IOVA 4FFOA 4O82A 3RUPA 1KUTA 1W96A 5LYJF 3AW8A 4M99A 3WO0A 1B6SA 3KAKA 3N6RA 5EZYF 2PVPA 5K2MA 1VKZA 2CNQA 2W6MA 2YL2A 1JLLB 4FGRA 3TW6A 1AUXA 4HQ6A 1GGOA 2I87A 4ZOLF 5DMXA 1C30A 2GQRA 2PBZA 1I7NA 2NU6B 1ULZA 5HV6A 2YRWA 1CQIB 2YWVA 3LWBA 2DWCA 1Z2PX 4EA9A 2YZGA 3ORRA 4MV8A 4O83A 4FE2A 4WD3A 1GSOA 4DIMA 4HR7A 2CQYA 5I47A 2VHEA 2VQDA 3TQTA 4O4JF 4FFPA 4O7WA 2YS6A 2GLTA 3TIGA 4I55F 4XYMB 2NPOA 5JVDF 4E4TA 5J2TF 3V4ZA 3ETHA
chains in the Genus database with same CATH superfamily
4ID3A 3L6EA 4JYZA 3LP6A 4K6MA 5DPMA 3GROA 2FEPA 5EZYA 2WIGA 2ZPUA 2Y71A 3QU7A 3HR8A 1IN6A 2QIOA 1JQBA 4MAMA 2WIDA 1H2HA 3WIDA 5IVDA 2PZEA 3EXG1 1J99A 1KETA 4P4GA 1WMEA 1L4BA 2WM9B 3HPRA 3OZWA 1JHDA 3E3LA 5T4FA 1TKAA 1CETA 4FOLA 1BVUA 1JAIA 1EA5A 3N8IA 1TUIA 3OHPA 2AQ4A 2O5CA 3UM9A 2HRQA 3RU9A 4WACA 1J56A 2FG6C 3G1TA 1W44A 3KZCA 9MHTA 1X13A 4K2AA 2ZAOA 1JMKC 3PUZA 4H4CA 3A7DA 3SEZA 2XH8A 1WRVA 3MJHA 2ZUFA 4O3SA 2H7VA 5JTTA 1GLNA 3L6OO 3DOHA 4F9EA 1YQGA 2I29A 2BKEA 2JFYA 4PG4A 1CNFA 3KKQA 2GNOA 4IO1A 4J2OA 4QVIA 1HZZA 1UJ4A 2QN3A 3D8RA 3HL0A 1EG7A 2Z5GA 2HK7A 2FQXA 3GCWA 4INZA 1MIOA 4A36A 4Z9YA 2JIBA 1C8KA 1B73A 5FOVA 4UOEA 2YFHA 2PX0A 2WM8A 5KHAA 2I5PO 1S3SA 2BR0A 3BPSA 3BTUA 1O57A 1JG1A 1OYVA 3QFCA 3A32A 4RJJA 4JGBA 2YZ2A 3T99A 5L4NA 1GDTA 3E0XA 3A1TA 1FLAA 2ZBUA 4GI7A 3QXCA 1IJKA 3J7TA 1QQ6A 1C3LA 4HGZA 1XIVA 4E09A 4J49A 2GTIA 4JC4A 4DL3A 2X9NA 4OP1A 1N2JA 5JANA 1GYFA 4BCCA 4G25A 3KSUA 2I4OA 2JLZA 3LRXA 3F74A 2QJTA 2YJ4A 4GVLA 3VISA 2IEZA 1V4VA 4GSYA 1FXWF 1Z4MA 4KR6A 5JNUA 2PUTA 1L5FA 4BFXA 2VYNA 3I8XA 3PIIA 1A7KA 1U7UA 1FRZA 3B12A 4WNCA 4CLXA 3K6JA 3PJEA 5FWAA 2G83A 1O96B 1LJLA 4DR5B 5JSZA 2QVBA 3PDHA 3D8NA 4LDPA 1U8TA 3QELB 3KEQA 1XJQA 4JQZA 1J0DA 4FK8A 4QEZA 4MQUA 3ESYA 3DDSA 3V4SA 3FDIA 1ML4A 2BONA 3RHSA 2ZJ5A 1RZRA 4IRKA 2OV8A 1WG8A 1QR2A 3JD2A 4ZAXA 1JFVA 3B3AA 4XXHA 2NVXA 3I0MA 1N4AA 1EUZA 2XYPA 3LWZA 3K5IA 3D5TA 2EC5A 2H1SA 3FKIG 4L28A 1OILA 5I5EA 1L7XA 4P7BA 2A3RA 3W5VA 4DM7A 4P5PA 3WYNA 3D3WA 1WDMA 1UINA 3GTGA 2FSSA 2SNIE 3QE9Y 1N2IA 1XZAA 2V59A 5DYTA 2QY6A 3OPYA 5DOVA 3TEKA 1GUYA 1HM5A 2Y1OA 1Q21A 1EX7A 2QV0A 4NLLA 4OJKA 1CB0A 2CD9A 2EYQA 2QRJA 1D04A 1QE5A 4I3FA 1EXNA 3RIXA 2HXGA 2X2EA 3CFYA 1GU0A 3RBDA 1R8YA 3LYUA 1E2BA 3KR2A 4JI6B 5BUQA 1J21A 4QGHA 3GZNB 2I1LA 5DTEA 3TL6A 3T1TA 3U7GA 1B6SA 2QTRA 5B3AA 2DLDA 3MT0A 4ES6A 3ECAA 4Q34A 1KYQA 1A3GA 3HCCA 2QVCA 1KZHA 2AF4C 2O8CB 3VKHA 1WIWA 3CLUC 1OXSC 2I87A 2WT4A 4BC1A 1VKNA 4AICA 4XGQA 4CKWB 3DC2A 1NLYA 4QOIA 4PYJA 3S2IA 1JDSA 3GAAA 2JFWA 1KAOA 4KZPA 4LH7A 1Y4DE 2RCNA 1MFPA 2AD1A 3LQFA 4X64B 3U0VA 3GZTB 3N0VA 4LC0A 3WLKX 2CDNA 1PYOA 4X94A 1JV2B 2X8WA 1TJYA 3EB9A 4Y6LA 1RLJA 3EVTA 3H17A 2XWJI 2CWDA 3ZWXA 1A9RA 4OX9H 4RU1A 3LD9A 1O9HA 2BKVA 4LK3A 4XB6B 5EIXA 4QDKA 4DRXB 2VP2A 3D6HA 2HPVA 1L7MA 5TPZD 1DAAA 3T1QA 3ADKA 2Z1DA 2COUA 2VRNA 4QFBA 1ZH8A 1WLSA 1AC5A 1CEQA 5CFLA 2EF1A 2FP4B 2C20A 4JBWA 4XQCA 5ISMA 3BH7A 3LW8A 1XA0A 3DUWA 1MDFA 3PXBA 3D4NA 3C97A 2YH2A 4FUTA 1XCGB 1PR0A 5EN4A 4ZT3A 2A9FA 1K75A 5TGZA 4B8ZA 2FEXA 2CXTA 1BD3A 2H4JA 3CRRA 3TCXB 4LF9H 1VE3A 5LVAA 1E92A 4AMZA 4I4TF 2YIDA 1JVSA 3G0IA 4C0HA 4Y2PA 4I0WB 2B1RA 4OQDA 2ZBRA 3PSHA 3IPXA 4KMOA 4LY3A 1GFSA 3KT6A 4I5EA 1EUCB 2BI8A 3F67A 3DE2X 4GWGA 1YIDA 4O4LB 4UFPA 3TJRA 1T5IA 4BY9E 3PCXA 1CR1A 5CEFA 3PVCA 3VNAA 1XYGA 4R9SA 2FE3A 1RWMA 3ISVA 2OLJA 5FA8A 2HBQA 3BG5A 5GAJA 5C8YB 9GPBA 1C9MA 4LHWA 3RS4A 4OGWA 4N5HX 1KYYA 4X6LA 5ILGA 3VYRB 1U9IA 3A70A 4U2BA 2QUZA 1OAOC 4H1TA 5FPOA 1BZYA 1TQ6A 2PLAA 4C6SA 1N57A 4F4WA 2F8TA 5FPQA 2B2XA 1BW9B 3TLCA 5KTNA 4GR4A 3BOSA 3KOYA 4X20B 1HXHA 3OU6A 3R0IA 2J0QA 3PNLA 3U4GA 3OX2A 1M7JA 4M0UA 4KV9A 2XUHA 2ZSFA 3NYRA 4IR7A 3DBLA 3GELA 5EHGA 2A1UB 2MSCB 3S2UA 2J9GA 2VHZA 2AHRA 2XUKA 3PUWA 1DELA 1UM9A 4NRDA 4II7A 3IAXA 4P4LA 3S2YA 1O5IA 4S3MA 2B7CA 4NCJA 2GLUA 1ZQ1A 2XMQA 3IB3A 5IBRA 1Z35A 3L0ZA 2BSAA 2GSDA 3KHHA 1C30B 3H97A 4AJHA 3H9JA 3RNOA 2NO0A 5DBHX 2I99A 3TRKA 4FGUA 4GO1A 4FQ5A 1A9XB 4WI1A 1RKXA 1VMIA 3G9XA 2ONJA 4C4AA 3I9KA 4F7WA 1L3BA 3MG9A 4ZC1A 3TEJA 1Q84A 1BDHA 4H3VA 2M98A 2UVWA 3ZD6A 2HVQA 4NJOA 3BJYA 4S1VA 1Q2UA 2IYZA 4FHDA 2VYCA 3VMMA 1SUEA 1R4AA 2VFAA 3PITA 3ICOA 4P7GA 1G2IA 3O1IC 2I6GA 3M9LA 1SB9A 3VX4A 1GZVA 1JEDA 4X62H 5KOJB 4M1QA 2QM7A 4C07A 1O94A 1H2ZA 4WZAB 3ZJ4A 1E62A 3Q8MA 2JFZA 1TZBA 1K8XB 3N0XA 2Z2IA 2J6TA 4RZRA 5B4VA 3KHLA 2ZQ5A 3BWCA 2XCPA 3EOAI 3I1FA 2GHTA 2PX3A 4L57A 4U8HA 4IUCS 1K9SA 1KFBB 2FHSA 2QUKA 3PTZA 1WSAA 1GA4A 1WY7A 3MB5A 1XTUA 4HYYA 3BMCB 4S35A 4IIVA 5AW9A 1JAZA 4DUGA 3UPTA 2QTFA 1NXOA 5J5AA 3C8DA 4WXPA 4AS3A 5F5XA 3R40A 3EQ9A 5KJFA 1RBQA 2C54A 3LVQE 2VWPA 5DCWA 4GBED 1XZKA 4JLUA 5TQ0A 5IDQA 2Z6VA 1GA1A 2ZYAA 1LI5A 3W90A 4D2IA 5JTUA 1LRKA 4NCKA 1RM4A 3OCYA 2VCEA 3EF1A 4MXDA 4YRJA 2QZ9A 5JD6A 1ZD9A 4KCGA 3ELWA 1LSOA 4QXQA 1SXGA 1TD1A 3OFNA 5KFIA 3AVTA 2PSFA 4OFXA 1ZXBA 1PG5A 4KQHA 1Q0HA 2W4QA 2HZ7A 2X14A 1ONSA 4ENUA 4B17A 2P41A 3T41A 3LOUA 3F3YA 4QZVA 4WRRA 3R9RA 4MVJG 3PQDA 4YCDA 1HBJA 1IEWA 4GUAA 2H9AA 3E6AA 1O0SA 3WRYC 2M1XA 2Z2XA 1GRCA 2DR2A 5A4JA 3K73O 1PK7A 3DZIA 1LK5A 4X5OA 4YMUA 1Y1SA 3GX1A 1WMBA 4HGRA 1LCIA 3MTBA 5C5DA 3PN1A 4R2LA 3VDMA 3IULA 4BS9A 4D4MA 3M4ZA 3HHPA 1DAGA 1JDVA 2GPYA 3LUAA 4DTIA 3NJ8A 1TK2A 4GMXA 3RAPR 4G26A 5ALTA 3O5AA 5C3MA 1P44A 3OJXA 4EPTA 4ZIRB 2A5GA 4CV3A 1J0BA 1F6BA 5FHQA 3NPMA 3X2FA 4LFAH 1ZU5A 4FEGA 4M9RA 2HXYA 1SQSA 2EKBA 3QEAZ 1XVTA 5DMHA 2PRJA 1PNOA 4O1MA 2HWYA 5B1SA 2IP4A 2JHGA 5ARBA 1WMAA 5JS7A 3B89A 2IQ5A 3DOCA 3QYPA 1X1BA 3ESDA 3PWKA 2XKAA 2NNLD 1ZW1A 2XRZA 2VSQA 3N43B 4B81A 4FIDA 3E9ZA 3HYSA 1R50A 3I1JA 1X2EA 3LECA 2ZITA 4GZ3A 5K01A 1UBKS 4MRNA 1H94A 2FX3A 3LT5A 2ZSAA 5B55A 1NJ1A 4TQSA 4HEQA 1DKLA 2DUJA 4C08A 1GN9A 4HFNA 5F33A 2A84A 5JQGA 1WMDA 2R751 4Z9FA 3I4FA 3ICVA 1ONOA 4PR0A 4ZJUA 4NF2A 5EY5B 3A6PC 4EUEA 4WOBA 5I60A 6GPBA 3WV4A 5J5VA 1L9KA 3NDRA 4YAGA 1O97D 5FUYA 5JNLA 3HBLA 1O03A 3UTDA 4FEAA 3OPMA 1B04A 4NS1A 1KDVA 3VI3B 4PWQA 3QJYA 3BSFA 3AEYA 3WIVA 4HSGA 3ZWWA 3SM9A 5ECGC 2YHAA 2BM0A 5LP1A 5LM3A 1IK6A 2V6MA 2RD2A 3FA2A 4K9KA 3OZFA 1E99A 5BV8A 3GT4A 5A6SB 2J6HA 5H80A 4R68A 3FPGA 3MOSA 4I6GA 2ZJ7A 1UOQA 4UMEA 1J8FA 2E4AA 1RACA 4LF5B 4CM3A 3SC2B 4HSEA 4GOND 3MXTA 3EMVA 2GAOA 1ZK1A 1LEHA 1FQWA 1XL1A 1P2SA 2BKXA 2PA3A 4YIKA 4O7VA 1NKVA 1PSWA 5C8YF 1PQ4A 3VHQA 1H3NA 2G04A 1FFDA 3LPAA 3VPGA 5CYFA 1C81A 2JAHA 1Y89A 4CTNA 2WWFA 4GPZA 4H3HB 1KO8A 2Q6OA 2IV7A 1DT3A 2WABA 1R6TA 2H31A 1XG5A 3ZHVA 3VR4D 2C9CA 5EJEA 5BQPA 4ZV7A 3QLEA 3KHSA 5G53C 1S2GA 2DOKA 4L3VA 3OJFA 1GNVA 1WB9A 1RP1A 2PUDA 5IK2A 3VPHA 3I9V1 4Q15A 4Q8EA 3SG0A 5AQEA 3HLTA 2HQOA 1ZL0A 3ZCPA 2C4VA 3TUIC 3UAGA 3FIUA 4MRMA 2JS7A 4J1TC 1WZIA 2W11A 3ZKWA 4ZQEA 5I3ZA 2VF8A 1RWOA 1GITA 1JR3D 1OX4B 3ITKA 3AEKA 3KB2A 1TMKA 2J59A 2NG1A 4RZQA 1VCNA 2PM8A 5JNSA 1TD9A 4EENA 3KOUA 1NATA 1XJWA 3V8RA 3ZV6A 4C0QC 1HYBA 5LZ4A 3NNNA 2GESA 1X1QA 4Y9SA 1U3DA 4Z54A 4DANA 3HDHA 1PUJA 2YZMA 4NJMA 3LNTA 4TM8A 5DNEA 7REQA 3TQCA 4DXHA 4DQDA 3UWOA 3MTQA 2FMXA 2IELA 2IZ7A 3NTVA 3WDMA 2R8JA 2HA5A 1L3CA 1E9VA 1M6YA 4F72A 5IBCA 1NVWQ 3A26A 4OMCA 5HKLA 4PEVA 2GCEA 4YMVA 4LJRA 3PO2G 5KYUA 1AD2A 1CHDA 1EHCA 4BUCA 2C4UA 3BA6A 4CIYA 1OSNA 4Y9UA 4EABA 3RNLA 5CBKA 1LLUA 2J0VA 1QAQA 3SZRA 1NG9A 3VO8A 1T0HB 3VVMA 2E4XA 3GFGA 5DM2A 1O95C 1ZOPA 2GPNA 1SCNE 3ZZTA 1T26A 4O59O 3QVWA 4PS1A 1YC5A 2AGQA 4NCIA 5D1NA 3REQB 1HG0A 5HA5A 4KN6A 3DPUA 4WFQA 4WGGA 3DV2A 2G36A 5FCDA 1QS0B 5C4MA 4AB1A 1F8FA 3BZUA 6LDHA 4MVJD 2P9HA 5BR8H 2ZT7A 3E9DA 1A27A 3T61A 4P7JA 4Y8VB 3E7XA 4FBTA 3L6BA 1TF5A 3GVIA 5EE0A 3RV3A 1PS0A 1V43A 5D87A 4QPNA 3G0GA 2H92A 1Z2CA 3TW0A 4JUDX 2BMWA 5BW8A 1V3UA 5CT8A 5AKXA 4QBHA 3BSSA 4NBWA 1TO1E 3QVLA 2RGBA 2NZVG 2FPPB 4IIJA 2W37A 1Y8QB 4LNUA 3FNRA 1XZMA 4JB0A 1ZI8A 4IIDA 5K09A 1Z7EA 2FE4A 1FVFA 4J8PA 1ZH6A 1I36A 4LCBA 4F85A 3CF0A 5B5SA 2DABA 3JAKB 3OM0A 1TA8A 2PUAA 1XZ8A 3WTBA 3WGVA 1DIOB 1Q15A 1E1MA 1WL8A 1MJFA 5FX2A 2REXB 1QX3A 3UK6A 4GYWA 3CEJA 4OQNA 5GZ6A 4FNAA 2H1FA 3KJZA 4NOMA 1GFWA 4A3FG 3DAAA 1QOPB 3PKZA 1XRJA 2VTDA 4HQLA 1VIVA 3M6MD 4ZREA 1WSCA 1DTWA 1EQUA 5LYJA 4KITB 3IIKA 1QIIA 4NBNA 3PHHA 4HDMB 4EPYA 4DN6A 5FNVA 5AXBA 1C0KA 3SI8A 4D79A 2ZJTA 1UM8A 2GTHA 1V39A 3TX6A 3A8TA 4GIBA 1S3GA 5IC6A 9LDBA 2QWXA 3HKBB 3WGHA 3B1ZA 3MCVA 4F3NA 3P9XA 4AVYA 3FGZA 3B5IA 4LX0A 4AURA 4RNOA 3IIJA 5JDIC 5ALYA 3NIFB 4TVOA 4ZQBA 4YHHH 4DV2B 4DV3H 4QDOA 4MQLA 3CUUA 2C98A 1ZM9A 2QTTA 3KQNA 5G0TA 3C6XA 1FPQA 4PC3A 4A5SA 2QQ5A 3FSGA 3I58A 1CZRA 2VAXA 2NVWA 3RYTC 1U0TA 1R8SA 3PTAA 1Z4QA 10MHA 3GHHA 3JQ7B 4A8HA 4O3RA 3QYFA 1AHPA 4EA9A 2VCYA 2JD0A 3HA3A 3OZEA 1NM5C 2H7CA 1JZSA 2P11A 5EJ9A 3QVUA 1KRHA 3IC5A 1E5DA 3Q9NA 3TCKA 2J0UA 4XVQA 1WZUA 2Q5FA 1J0CA 4FFSA 4CDRA 3ZV5A 1Q77A 3ADOA 1IZ7A 4IIUA 1UKEA 4RKEA 4ARAA 2IHKA 2R6R1 2WKPA 1GO2A 3UATA 4C04A 1JPUA 3B6ZA 1L5MA 4KSBA 4PYIA 5KQMA 2IEGA 2IDKA 2E4ZA 2ISCA 3KDAA 1RHQA 4WHMA 4CV1A 5KPJA 3R09A 2W6PA 1RYSA 2B6HA 5REQB 3D7LA 1HE2A 2OXFA 4IGFA 1WXQA 4WDRA 3D3KA 5HE9A 5TMBA 4GLOA 4O08A 4IVQA 1YR3A 2M05A 3EVGA 1KPGA 4YWHA 4R4JA 2WF8A 1ESEA 1U1DA 3SKYA 1NAHA 1MT0A 3DMHA 1Z7BA 1FMFA 2ZR7A 1W6RA 4DLLA 4XWWA 5AIBA 3IYLW 3RASA 1N2BA 3ILHA 4MS4B 1Z0DA 3Q2KA 4R41A 2NTJA 1PKXA 1WQ3A 2HMVA 4N5MA 4RZ3A 2VLIA 4FJ0A 3PO3G 1BQ4A 5FTKA 1BDMA 2BBOA 4YRQA 4P33A 2D7DA 1Z3CA 4R6WA 4BAGA 2D5LA 3O73A 4TKVB 4B3MB 2OESA 4ESHA 5T3YA 4BE7B 4EB0A 4BTLA 4WE3A 4K9SA 3H42B 1EFAA 2AFRA 2E7ZA 5KTYA 2V65A 1IZ8A 4PBCA 2R2AA 1GGKA 1NNI1 4NIMA 1CJBA 4RTOA 1XDWA 5IT0A 1XQ1A 3JW8A 2XCOA 1VECA 3LZDA 3DLAA 4WV3A 4BUJA 4MKHA 2J7PA 1E64A 3P45A 2G17A 4TLDA 3F8WA 4UQLA 1P1IA 2ANCA 4DIOA 2CCJA 5HOEA 2XVMA 3INTA 3Q3CA 1C9EA 3TW4A 1CQWA 4HLNA 1WSBA 1NBMA 3DEHA 1HTTA 3I4NG 3A3KA 2Z4RA 5FPSA 3NC4A 3B1FA 2VXCA 2WVAA 3TLAA 2A88A 3DXFA 4J3FA 4LHVA 2JGMA 2YZLA 4CEIA 3H9EO 2QL5A 1HOTA 1CB7A 4C7BA 4DJEC 2X0NA 3DNFA 4G2NA 1OZHA 2Y0DA 4IHKA 1FYWA 2DECA 1B0UA 4X44A 3D6JA 4EHFA 2VZ8A 3PDJA 4LDJA 1IBLB 4PLTA 1C3OA 3CIFA 4X97A 4C5BA 3DEZA 3D3EA 4KGDA 5P8WA 4S1PA 1LDMA 3GLGB 3TZKA 2EWMA 2E0IA 5CITA 4NEGA 5JYBA 1P1RA 1MVNA 4RSMA 2NZUG 3KB1A 2E85A 1HK7A 4MULA 3ZEIA 2WZBA 5HILA 2W5UA 5EERA 1T0IA 1UDCA 1Z0FA 4L9WA 4PQRA 3CZCA 2HRZA 4EEYA 1WDTA 3NS7A 2W9BB 3MWYW 3CX4A 4YXWA 3FPHA 4YJ2F 1NVVQ 2FSVA 3L8HA 3VYUB 3UGKA 4R54A 5EJ7A 5F64A 1PL7A 2A14A 4EB3A 1GGJA 3QQMA 2SCUA 1R4MB 3GXBA 2I22A 1GIAA 4Y1EA 4FGWA 3TQHA 1R8QA 2JEOA 3PDCA 1UAYA 4GMKA 4Q6WA 4GX2A 4LZPA 5BWOA 2P8JA 1JLLB 2CUNA 1YDFA 1Z4NA 1KO7A 2OC4A 5I9LA 3RS5A 1NUTA 3R3VA 3G0DA 3VR2D 2UUAH 3V33A 1PFVA 4XFJA 4WSOA 1L8LA 1E6WA 1N32H 3BT7A 1OXBB 1GSOA 4D41A 1JYFA 3OFSA 3AESB 3RS8A 5SY6A 1SUPA 3JRNA 5KKAA 3ZPXA 3ASVA 1UT8A 3QNUA 2QD1A 1GYQA 4ITVA 2R7AA 1UKBA 1OJ7A 5ARDA 3NB0A 3CU5A 5TVKA 1U0JA 4GW3A 1JJVA 1N2OA 2AVNA 2VUMA 3H1PA 5AUOB 5FTMA 3ND8A 2VHXA 4V24A 3HY3A 1ICEA 3AFHA 2QQ0A 4I8XA 1WXWA 4XOIA 5DNVA 2MINB 2GMWA 1W4CA 2ZUVA 3Q8WA 4L5JA 1IOLA 2ERCA 3QKSB 3CKYA 3CVZA 1XNRB 1XT6A 5FBHA 3A31A 2BCJQ 5JPDA 2AZMA 4BVLA 1NVTA 4RZXA 2XIQA 2VJDA 4FS3A 4ZPXA 1U3GA 4ECSA 3Q72A 5K0ZA 3V4VB 3SVTA 4XQGA 5K4GA 3RS0A 2BMDA 1C1HA 1SVOA 2QMYA 1MAUA 1J23A 1VJ5A 1KDTA 2C3MA 3DP9A 1BWRA 4YJFB 5FPTA 1EQ2A 3UHJA 3ILVA 4M9CA 1KS2A 3AKDA 4FDAA 1SN7A 3KSAC 1OZ0A 2PXCA 4NY1A 3NGXA 3ZU3A 3V34A 4M0FA 2NSLA 1IMJA 1FSSA 2HK9A 2ZWIA 3BHMA 1BMQA 3RSLA 4X1OA 2RG1A 1J42A 1SZCA 2P65A 4Q7EA 1Q3KA 4LDZA 3V4FA 1E3EA 4AJ4A 1XLUA 4M38A 5I9MA 4A1OA 3AFGA 2AN5A 4B6QA 4J9RA 5BVGB 2PMFA 4TT3A 3IV9A 1Y81A 3H5VA 4BFWA 4EY5A 5KVQA 1H8EA 4UTRA 1PE0A 1EA7A 1XR3A 1ES9A 5KHLB 2ZSUA 1ZICA 1MB9A 2BY4A 2WJAA 2OG1A 3O8DA 2PK3A 2H1LA 5ESRA 2EJ3A 1K0UA 2PIDA 4D98A 5LQUA 4O25A 5DBFA 1H6AA 3PXUA 2N47A 2C2EA 2Q3CA 3OP1A 4P4TA 1K8ZB 4HF7A 2RBKA 2GPSA 1NBHA 3UENA 2P6UA 3P0IA 4PQEA 3CVUA 2BEUB 4AJ2A 1OUMA 1JTFA 3GP3A 4YMLA 4O3FA 4NABA 5ALGA 4HEJA 3AIOA 4K81B 1J5XA 3QZUA 1JQKA 1DE0A 4KFCA 1DPFA 3L7DA 4AIRA 5MHTA 4E5SA 4EO9A 3J81k 5BQFA 4BQNA 3BVPA 2NU9B 1JWAB 2R8EA 3IBCA 4LA4A 4DV0B 5DBEX 5ALXA 1JHXA 2YWJA 3ROKA 5D84A 1RKBA 2ID9A 3G8YA 4KI0A 1YU9A 3MMPA 1YONA 5F5LA 5KYGA 4I4NA 4WDQA 3U3KA 3UIEA 1EX9A 2JA5A 1RBYA 4HY3A 2KB0A 1GTMA 1DXQA 2FK7A 1ENZA 2F3PA 1NW7A 1HO3A 3WDLA 5B3KA 4W1QA 1K3TA 1NP6A 1W0KA 2OD7A 5M3BA 2D5IA 1TEVA 1D1SA 2AR0A 4LQCA 2XE4A 1YS2X 2X0KA 4HTFA 2WVGA 2JHFA 5G4KB 1ZGCA 1TIBA 4CFSA 2QRHA 4UEOA 3PWZA 5EC8A 2RONA 4TYYA 3WO0A 3O3NB 1IE3A 1Y1TA 1HG1A 1LLFA 3KKLA 4QLAA 1LW6E 3DS8A 4MUYA 4UPEA 3TW6A 1Y80A 1LDYA 1UNNC 3PS9A 2VF5X 1RFGE 4O8CA 3II6X 1KQPA 2VNAA 4BTEA 1DEKA 2Q3HA 1ZHSA 3JQ9A 2ZS7A 3ANTA 1VLMA 4UCQA 3SI7A 1CNEA 3QRWA 3P97A 2AOTA 2AS0A 2JLVA 3DFIA 5KX5A 1JFFB 1HZJA 1HDGO 2JFBA 1RQXA 1ZAUA 3JWPA 4PPQA 3VBCA 4Y2HA 1OU0A 5IJ0A 1WOMA 1RDFA 4LXQA 5CB4B 4N0PA 3WYGA 4IM7A 4FKZA 4W5TA 1E5LA 3PENA 4R3NA 1VL6A 1V6AA 3E2PA 3HACA 1G2PA 2CVPA 3Q9LA 1EFHA 1P77A 3V8NA 1YR2A 3S1SA 5J4YA 1DWUA 3R0VA 2QG9A 2VP6A 4DOMA 5AJVB 2R8HA 2JA6G 4JL6A 1IOZA 4JDUA 3TNJA 1F8UA 1KQFA 5CD1A 5FWNA 2FVYA 2AJTA 3RC7A 2JFOA 3V8BA 1SXPA 2ZYUX 3KK0A 1GSHA 1N0UA 3PLNA 5FUWA 4JD5A 4Q1BA 2GTPA 2QS9A 2OM6A 1L1QA 1H23A 3JYPA 4O0MA 4RA6A 5JBNA 1ZVKA 2J3LA 3IBSA 3QV2A 5JBQA 3PKIA 1WW2A 2AKAB 3AX6A 3GUUA 5ELMA 4I1UA 3LXRA 5K03A 1XMPA 4NZYA 3IP3A 3A3OA 3LXMA 3ROQA 2FWIA 5DSTA 3OPQA 4UU8A 4P4UA 3ZGLA 2W2QA 4JV2A 4TS9A 3FSRA 3G8DA 3EIWA 2HA6A 4I5DA 4MYDA 1W85B 2H3EA 4DNFA 5E9QA 5E6RB 1TFRA 4PZUA 4PIVA 6ADHA 1KGSA 1Z7WA 4U5XA 4Q0YA 2BEVA 5CRIA 1FTNA 4HRAA 4ZEWA 3ANNA 1H9AA 2GLXA 4BLWA 5A7HA 1NBME 4NYJQ 2FMFA 3EAFA 5LXTA 4KVZA 4MQ5A 4BQSA 2O5EA 3BACA 1FMTA 4EYGA 2WMYA 1P2BA 1XTVA 1N2GA 1QH9A 3EIQA 3GGPA 5ITSA 3RAFC 4KWEA 1TWHA 1W36B 3DQQA 4IDDA 4I36A 1IUNA 5ALVA 4U8GA 3TLJA 2HDKA 1QQBA 3TLGA 3TLBA 1P9NA 1XCBA 1VE7A 2RIPA 4I5GA 1UBJS 4Y2QA 4AUKA 5JDCA 2VDWB 4MW4A 1Y7HA 4OU4A 1F60A 3WIUA 5KT6A 3H13A 1XZGA 4A0SA 4B79A 3ZQ4A 4EGJA 3SQWA 4RL4A 1S2NA 2QYSA 4OVKA 3HO8A 3MS7A 1M7BA 1ZRHA 1JEAA 4Y3UA 3ZVKA 3F4LA 3B51X 2VWGA 5JSQA 4PC1A 1X0XA 4KN5A 5CNJA 1XQWA 3J7AC 3AVWA 4MI6A 2ZANA 1RC0A 4FBMA 4E6NA 2GYUA 3UQZA 1ATZA 4MR9B 5CM2Z 2PGAA 4PCLA 5TRTA 1TLFA 4DUZB 3WYDA 4P3PA 5B1IA 3N1UA 1NDUA 2DBYA 5FWDA 4O2BB 5KNBA 1G6KA 4YRSA 1F12A 2RKWA 2XJ9A 4HDSA 2AWOA 1MMFB 1JG4A 3P9NA 1YFKA 3UT5A 4Q4HA 3CZ4A 4ZI2A 3O21A 1V7QA 3FZQA 1VGQA 2FSFA 1G5IA 4LTDA 2V0NA 1BKYA 4L76A 3OZGA 3U1VA 2J41A 2Y1CA 5ILQA 2QAGA 2Q2UA 1DC8A 3C7DB 3RRZA 1SPBS 3DL0A 1SVNA 4OATA 1S1MA 3QFSA 5KG3A 3KTAB 4BRWA 3KAQA 2DM6A 3DFMA 1ZI9A 5LZ2A 1QVWA 1QLWA 4OQXA 3KETA 2MCTA 4R1UA 1TT5B 2BQ3A 2NO9A 2ID7A 2I54A 3KVOA 3Q6NA 2B34A 1ORDA 1S89A 3TJZA 2QGNA 2D1QA 2N9UA 4KGZA 1LU9A 4TUYA 2JCBA 2QTMA 2QPTA 3F73A 3GIMA 5J5CA 5H81A 1L5HA 5IYZF 1IM8A 4BGDA 3AR7A 3ZWMA 4DLXA 2WK1A 2GJSA 5HSGA 2HHFB 2C5AA 1WU8A 2FP3A 3D0KA 3F5MA 1PG0A 4WLVA 2FQ1A 3Q6MA 2AQHA 5E7IA 3JALA 3MSXA 2F90A 1PWYE 4DDWA 3PG5A 1YCGA 3TW8B 2CLCX 5IJ9B 1M2VB 1Z13A 4RXTA 3EC7A 5HK8A 2H0AA 2EX0A 2R4TA 1UPAA 4HADA 1CQZA 3L8EA 5KJ6A 4PG8A 4OHRA 4RTMA 2WAMA 2WTAA 3LWNA 5KVCA 1JHYA 1QAOA 3FDZB 1K7XB 2IF2A 4L22A 1DU4A 2JCYA 1TO6A 5JW6A 3KXYT 4J0QA 5KKNB 1BIFA 2LCIA 3GEBA 4BJ5A 2IE0A 2D06A 4B73A 5CEJA 3BJZA 5G41A 4QASA 1T4CB 3FF1A 3E5HA 4R9UC 4NYMQ 5JLJA 3HN2A 1EFPA 4NL4H 4D4IA 3PD0A 1WHTB 3FY4A 5I9TA 2GO7A 2WYVA 1T91A 3DE7X 1PVDA 4K2HA 2Q1UA 3AWDA 1JB9A 4QUAA 4AJKA 5KT4A 4PQYA 2YQZA 1QONA 1U3WA 3HP7A 5EEHA 2ZTUA 2G5CA 2IGBA 4DJTA 4LNAA 2V7XA 1V95A 5T6BA 5L4SA 4EL5A 1N4DA 2D62A 4PZLA 1KZGB 4IOLA 3L92A 3OT5A 4PZEA 1SXQA 3S2GA 1E4EB 1SVIA 1GY8A 1XNJA 5LZ7A 5IAGA 1FLDA 3T9DA 2IUEA 4R1TA 5LQNA 4EHLA 2H52A 1DO2A 4KJXA 1R0CA 3V46A 5EJ4A 3NEJA 1DX9A 2ZIXB 1MQSA 1U2GC 5IZCA 2Y1DA 3TQSA 3THWA 2I4IA 1VIMA 1J5PA 1E6KA 1ECFA 1PFYA 4IZ6A 4HP8A 3CLSD 1GUDA 3JD1A 3ZD9A 1FB5A 1VHTA 4EY4A 4QYTA 2Z30A 3P2KA 4Q1EA 2JGDB 4RDIA 4M0PA 1U2TA 2WWXA 3HY4A 4G5QA 1OAAA 1OWMA 4DG8A 1GNLA 4YUZA 2AOWA 1J7JA 1RPAA 1XWFA 4EYKA 4J9VA 2HSJA 2BMJA 2XOEA 1V9PA 5JR3A 2JEJA 3H0GA 4DR4H 2PQ0A 3AJDA 1SC1A 3PQFA 5FKJA 2RC6A 1ZH0A 1OLXB 1U7DA 3GRVA 4LRYA 2YHBA 2ORWA 4LGMA 5BRJA 4M87A 4EPXA 1ODJA 2GAFA 4CF4A 4LZZA 4BNVA 3TD2A 3NBYC 1H8HD 4R2KA 1YD7A 4KJZA 1GQQA 2AEFA 1QNLA 1YJCA 2VXYA 3N28A 1UMCB 2B82A 3Q0TA 3FHTA 4DMHA 3R9XB 3CRVA 3EQ7A 4YDRA 4U9HS 1QX4A 4V0RA 2M6KA 2VT7A 2XI4A 3IHTA 4CTKA 2G7MC 3BWMA 5DM0A 3WHPA 2A0XA 4M86A 1X80B 3LOPA 4RUKA 4X1KB 3HCPA 3PX3A 4GKKH 3FPSA 1RYEA 2DF8A 3AFOA 4LX8A 4FYMA 2EJUA 4HJXA 3PBKA 2P9QA 2BTQA 4M55A 3PW7A 2I7XA 1V45E 4KIWA 5HV6A 3AR2A 1XTIA 4A8PA 4ALIA 1D5WA 4YGYA 1QQAA 2GA9A 1W2WB 1XFDA 4FI3C 1FFGA 3TOZA 4RZHA 1IXZA 3EXHA 2J33A 3WWZA 1BFUA 2J5XA 4N49A 5DYIA 3SYLA 2AWNA 4P08A 4WKNA 1ORWA 3CT6A 4I9HA 4XJVA 1US8B 3BDAA 3AVVA 3ZWCA 3AH8A 3W77A 3GA5A 4WKCA 2IDJA 1T10A 2GFIA 3OKAA 2OHIA 4D3DA 1R74A 4RSHA 2O1SA 4OFBA 2FWAA 4XYGA 4RO0A 2H2DA 2C5GA 1EB8A 3WL5A 1RXCA 3ROTA 1M54A 3PIRA 4JAVC 4HBZA 4FGSA 1IULA 3KKPA 3HFGA 3RBEA 4MNTA 1XLVA 4QRDA 3VNRA 1M1NB 4Q37A 3GGSA 5CLIA 1EP2B 3E8SA 1P6QA 3FCUB 2XWSA 2HHCA 3UF0A 4NE7A 1FDUA 4X9XA 3JYLA 5THXA 1UWCA 2H6EA 1SPXA 2CVFA 1A9QA 2LV8A 2I7CA 3CR7A 2BZ0A 4KACA 2CBGA 4KXQA 3C3JA 2PCLA 2I78A 2YCBA 1IVNA 1XVLA 4TMZA 3MJEA 3FPLA 1PJ8A 3UN1A 3O8QA 1T6YA 1JR4A 4DLPA 1V16A 2ONZA 2G1KA 3CM0A 4J0DA 2RFLA 4V38A 2D5BA 3D6UA 4W8GA 1SFRA 1H22A 2X42A 3K4HA 4ER3A 2EWWA 3MJFA 5C31A 3H9UA 3EZYA 3NNSA 3VU1A 3TY5A 3ELDA 1HQDA 7YASA 4LCJA 4C3UA 1RNLA 3C5HA 4I4CA 1A7JA 3WGKA 1TX4B 1U2QA 4JI5B 1WW8A 4FD2A 1X9GA 4BNUA 3JVVA 4D80A 5I5YA 1NUSA 4WL0A 4IJQA 3G0BA 3OP4A 1PYGA 3KR0A 4AWAA 2B63G 3N2GB 3L02A 4PXYA 4Z51A 2H3HA 3OJCA 2JIPA 3BJEA 3A6DA 1DRJA 2Z5LA 4OIFA 1T4BA 2VUTA 5C3EG 2A0KA 4KYUA 3VOTA 4LF5H 1LA2A 4MRPA 2JC3A 3WI7A 4EI9A 3LZCA 1KO4A 3O7WA 4B83A 3AI7A 3D4BA 4D74A 2N1BA 3EODA 1DV1A 3OO0A 5IXJA 3A28A 2R7NA 4DSUA 1M34A 4AUEA 2Q6KA 2YJTD 3HJBA 4LI0A 2DX7A 2YXNA 1R0BA 3HO6A 4WBNB 3E53A 3TIIA 3E3OA 3HUTA 4ISBA 4QQRA 1GRQA 2XR1A 1RYZA 3GLSA 4R83A 3TW7A 5HS6A 1E5XA 2Y1GA 3EPLA 1E9BA 4WFIA 3NVKI 2XGSA 2O23A 3N0TA 1BX3A 2GN9A 4D6XA 3H3VH 1F5NA 4QLBA 1L7QA 2QZ4A 5ICCA 1JEYB 1T3NA 2X8JA 2AR7A 4RJIA 2OBXA 4K6KA 4L5IA 2I7DA 3GJ8A 1MGOA 3R5XA 3IEIA 3H7AA 3GQBB 4XM0A 3T9BA 3S44A 1C50A 2G1AA 2DERA 4UUBA 1XNQB 1I4OA 4PC7A 1DJMA 2IP2A 5FO1A 3EVBA 3ZK8A 2YHIA 4EJ6A 4ITRC 3RTAA 2C9YA 2WHYA 2YUIA 1XCJA 4MCJA 3MGCA 3N3BC 3RSHA 4FD3A 1VKZA 3E05A 5AM5A 1BU5A 2B9VA 3RI3A 3C14C 4GD3Q 3OOJA 2FZGA 3SNKA 3NMUF 1PL6A 3D2CA 8ABPA 3FRJA 1KDRA 4I7EA 2Q5HA 4BN5A 4ZKEA 1C8LA 4WESB 1Z6AA 2HL6A 4XEHA 2CNWA 2N75A 5MGNA 4J9SA 5FOUA 3ZHYA 1ADYA 4U7FA 3AR3A 4BY1G 3MLAA 3AUTA 4J2TA 2W93A 1S10A 3UUEA 2J9FB 1RHRA 4MUIA 4DXDA 4DBZA 1CUVA 3G2QA 3R9WA 5CK5A 4K6HA 4REQB 3WSTA 3HKCB 4Q1DA 2QVXX 1OC2A 3CZ9A 4W5JA 2X6RA 4ZCLA 2YFKA 4MPRA 3DMFA 3C3AA 2Y4RA 1W49A 3I6BA 2BHNA 1UJ5A 4Z0NA 1OLSB 2Q2QA 5H9WA 2FCAA 2G6BA 3LJKA 5JT1A 1TJ4A 2E2HA 3CWCA 4KKXB 3WLNA 5AD1A 4FFRA 3GXOA 3DVAA 1XKQA 4TROA 1E1CB 3TM4A 2PANA 4X93A 2BGJA 4N82A 3GJTA 3LLCA 5D1HA 2OQVA 2VUUA 2CL6X 3SX2A 1AY0A 1VLJA 4AQYB 3GCGA 1OH7A 3EDOA 1QIKA 3EOBI 5AKLA 5JXGA 4N8SA 3OCZA 4K6GA 2WG0A 1QFJA 1CPYA 3RGZA 5L95A 2DSNA 4CM4B 2PAFA 2W22A 2R5WA 3IEXA 3PLAE 1E3DA 4B3RH 5DF1A 2GILA 4MKIA 2C2WA 2QENA 2F8MA 1Q0TA 4M8KA 1X7WA 5G1PA 3PFBA 5HS4A 4XSGA 2YVUA 3KHUA 5KPDA 1Q7TA 4ZT4A 1YNOA 3KTFA 4UEQA 4DL5A 2RHBA 4MQEB 2LR0A 3NAGA 1NPDA 4ZRMA 3SKVA 1U0LA 1Z15A 5CXSA 2VT2A 3PJFA 3W6NA 4Q00A 4RHUA 5CH3A 4Z4HA 4LIPD 2R92G 4MCAA 4H7IA 3LO5A 3N8HA 2DCUA 1RJGA 3IUJA 4LXYA 1BMDA 3RAGA 4O4LF 2ASVA 3HOUG 5EPUA 3ROEA 3BXEA 4YP6A 2O1XA 4LOAA 4KAXA 4EG4A 1VE6A 1T9BA 3LX4A 5EESA 3QTLA 5EMLA 4QQNA 4LXUA 4N65A 4PLCA 4QSMA 2XAAA 1CRQA 6PFKA 2BGUA 4KN9S 5BMVB 3SJCA 5AP9A 4KQCA 4PSKA 4B3CA 2HTFA 2P0EA 4MDYA 2QV7A 2ZBGA 3WQBA 1OYOA 1D0VA 4RB3C 3EGCA 2KLHA 2C8VA 1JSZA 2CFTA 2WZCA 4EVSA 3DB1A 3W2IA 3Q3JB 5K3EA 3FMOB 1RMQA 4KI7A 3OFVA 3ZHSA 3HWRA 2Q1WA 5KOYA 1VGVA 2C1EA 1RADA 5JVDB 1U99A 4A2BA 3BA1A 3KXDA 5DXAA 1QCCA 3E2MA 4JV1A 5BVHB 1C0LA 4Z9BA 3HCRA 4GFDA 1MO6A 5CM8B 3G1UA 2QBYA 3VNSA 1O3YA 4TYQA 5E4YA 5BW6B 3IR7A 1DC7A 5BWXA 1DS6A 2ZBPA 3CEHA 4YYZA 1F7UA 1O9BA 3S1AB 3C1UA 4WBSA 5IYBG 1WULS 3JY6A 5BXYA 1TNDA 1QVRA 5GONA 1UXJA 2ESRA 1EAYA 1TZCA 5HOQA 4KH1A 1Q0LA 3JWGA 2BFDA 1P72A 2PSJA 2QJWA 1YRLA 3UAZA 4UTNA 1CJSA 2GPJA 5CYOA 3RQIA 5FJJA 2QT0A 4TOIA 3CSSA 1OHHA 4US0R 1MZPA 4EO7A 4P82A 1FDIA 4MRAA 2RGEA 3HJRA 1KJYA 1Y1WG 1DWPA 1J2EA 1DI0A 1E77A 5EUBA 2XCAA 4KRXA 4TS3A 3SS8A 4ALLA 4BLRA 4WN9B 2B4AA 3HC7A 2NZ2A 4ZU3A 4B0PA 3NHRA 1U9CA 2Z6UA 1XXHA 1B0PA 2G5GX 1DXHA 5BWTA 1NI4B 4HDNB 2X22A 3HE3A 1H6DA 2EKPA 1E1QD 3DGEC 2GKSA 2YWRA 1VYUA 1GQ2A 3DDCA 3CLUD 1CW2B 4MR7A 1AZWA 2PL3A 4XZ3A 2YV4A 1TFUA 2W2PA 4J0MA 2IHNA 4AF7A 4KLAA 3QVXA 5KMGB 2B37A 1ZN7A 4CMIA 2YYZA 4ME6A 2C2ZA 4KFTA 2TYSB 1N2ZA 5E6SB 1GTL1 3D2BA 1CFZA 3U54A 1YH3A 3SBXA 3GUCA 4BKRA 3S6JA 1W30A 2PMWB 1FJ2A 1YZQA 3BF7A 4L7QA 5HCUA 4YAFA 4PLZA 3NOVA 1A9ZA 2VJQA 3GGOA 4RH0A 1KHTA 1BTOA 1EFDN 1RLUA 2BH9A 4LF6H 3ADPA 1L5SA 3NX4A 3IO3A 3WK6A 4JU8A 1ZNWA 1OTYA 2V0GA 3PYMA 2A67A 2XIJA 3A1DA 1C9JA 4AP6A 1YZTA 4Y98A 5FUQA 2RSLA 3FVVA 4RJTA 2FW7A 4CM5A 2DB3A 1HFEL 5FPKA 1SRRA 2UZ0A 1NUHA 1CTQA 4DC1A 3OE5A 4NXNB 2VBIA 1G9TA 1N6HA 2C5LA 5KAMA 4QDXA 4H35A 2Y93A 2JGNA 4WEQA 5ADUS 5FLKA 1U2DA 3IUBA 1AK9A 3OJLA 2FA9A 3KKKA 1MF7A 2ZDHA 3BWXA 3DE1X 3N75A 4MZXA 4K6NA 1P9OA 3EZGA 4QDUA 1CY4A 1ZNYA 2Z5VA 1GZ7A 4B7AA 1IBLH 4TQRA 2WIKA 1Y48E 4RS4A 2KBEA 3IJ5A 4Q9JA 2XCUA 4MGYR 4MWTA 4F50A 4ZVSA 1A0IA 3O0TA 1KZ7B 4FMCB 1TUBB 3QY0A 4JA2A 2BFMA 2CBXA 4BQFA 2VAVA 4MDFA 1A2KC 4PYKA 4CQNA 4MROA 2ZIFA 4IH4A 3G13A 3V1MA 1ODKA 2DLNA 3NUAA 4Q3NA 4EYHB 3Q8LA 2CUZA 3U3DA 3EPIA 4Y30A 3PSAA 2ZIZA 1CZHA 3HVRA 4JBNA 4PPGA 4OUDB 2X2FA 1EDDA 4M4SA 2AG5A 2PMKA 2E21A 2VP5A 5HQTA 2VDJA 3VTZA 2WIAA 4CKYA 4WZ6A 1MNAA 4ZCIA 2QK4A 3O92A 4TRJA 2G1JA 1M33A 4QEKA 1LPNA 4RNMA 3JVEA 3PZBA 4I19A 2F17A 2XXBA 2CJWB 4PG6A 2CJFA 3QI2A 1DVRA 3Q9SA 1C9DB 4GYYA 3SYMA 1MLDA 1OTXA 4L4SA 4XDYA 1LV8A 1DCTA 1MIHA 3SVLA 3RSFA 2C9OA 1KPHA 2XTZA 3LF2A 5JUMA 4TXNA 3E4DA 2L69A 4JMPA 3UICA 4EG3A 3WK5A 1RJPA 1F7VA 4GWLA 4DYVA 3PRYA 3AQ4A 1R1DA 2MSEB 1ZL2A 4HQKA 3A6JA 1EM8B 4LMPA 1Y8AA 1HNXH 4UBMA 2C4KA 4F2WA 4RV9A 4RPKA 4Q4JB 1MZBA 1IYZA 3DLCA 4I1RA 2C4NA 1JIIA 2RHOA 2PPVA 2I71A 3T7IA 4Q7KA 1M2GA 3T3DA 2POCA 2DUMA 4O4JA 4M54A 1GL9B 1RPZA 5J2TA 3N7TA 1D3AA 2DP4E 1DGQA 4MPJA 1ODCA 1ZNZA 1XRSB 1Y8RB 4B8WA 4AS2A 1S2IA 1IIRA 3CX3A 4OXRA 3MT7A 6ABPA 1FJXA 3PC7A 4MWCA 1VYHA 1T2AA 3S4YA 1BS9A 1KMCA 2G76A 2QSZA 1KI7A 4UXJA 2RGAA 5JO0A 1E1YA 1OYYA 2NTEA 1T1EA 5DQIA 3N6VA 2OCGA 3WX0A 3JVDA 4J9LA 1JDJA 4U7JA 3TNFA 4U2GA 1CERA 4LHYA 2O8EA 1R5NA 1JVNA 1YJQA 4L4ZA 5K3SA 3ZLBA 4E1BA 1QU2A 1QZUA 2GCPA 3M4NA 3M2TA 3TBHA 3HXMA 5JVDF 2WNIA 3H3JA 2CFCA 3M5PA 2EEPA 5FADA 4B2PA 4L8LA 1J6UA 1G5PA 1M6EX 2P9GA 1XNGA 2HA0A 2C2RA 5CA1A 2H1HA 4LV5B 4LZLA 3U48A 3GMTA 4L3OA 3D6FA 4FDMA 1I13A 4DABA 4XR4A 4X66B 2I6XA 2PFGA 1NJ6A 3O0DA 3LE8A 1ZSVA 1DO8A 4PQGA 2VK8A 1ZCFA 1D2AA 3AOEA 5I4BA 4U2FA 1I6MA 3TX2A 1WS6A 2IMWP 4BVEA 3HCWA 4FE3A 1Z6YA 3DDHA 3QE3A 1QRRA 3ICWA 5KB3A 4GC9A 5BT9A 2QRGA 3ZJYA 3FNFA 3W7AA 3E3NA 2Q6VA 1NV9A 3I39X 3MVEA 1C14A 1RRMA 1QM5A 3VOSA 1NT2A 3A4IA 3FR7A 1IY0A 4AI6A 3EDMA 3M3HA 3HGTA 4FSXA 4CIWA 3ND7A 4J0FA 5J4KA 3DYBA 4N5LA 1SXIA 1MB4A 4UD2A 1UC4B 4F11A 1KT8A 2PUEA 2NVUB 3TGPA 5KIAA 3WK8A 1NOKA 4BNGA 4GLWA 3RFVA 2Q27A 1CJVC 1E7RA 4HK4A 3EVZA 3OEHD 3H0KA 5ERYA 1CE8B 3JD0A 1XRPA 3WRXC 4O29A 4PBTA 1V2GA 3KD3A 2WE8A 3QNWA 4ABYA 1DIBA 2FKNA 4FNGA 4Z1MA 3UOGA 2VP9A 3T7EA 1RLTA 1L3IA 2VUGA 2QP9X 3T6KA 1CC1S 4AD8A 4BZQA 3QK7A 4P2BA 2J9ZB 3BXHA 3A1CA 1EB9A 4FSDA 1N6OA 3LLVA 2H16A 2I9KA 3IKJA 2B8JA 4ZD6A 3TMYA 2FG7C 1MR3F 2IW3A 4RPCA 2H4ZA 2O05A 4UCOA 2BFFB 1OIWA 2B69A 3I4LA 1KL7A 3WS7A 3NHFA 3G5MA 4CKEA 1NN1A 4D9NA 1EDOA 4HDKA 2AKEA 2PBRA 1V0JA 2K7FA 1G6OA 3KWMA 3VUEA 4GMDA 1NNEA 5KWVA 5D1OA 2OV3A 2P5UA 3RBZA 3EBPA 3M83A 1OI3A 1UQRA 5AT1A 1NVKA 4AQ7A 2BW0A 4JIMA 1WKVA 5AW4A 2LXNA 2OZPA 1FOEB 2QUBA 1SBQA 4YP9A 4EHKA 4OREX 4YONB 3UB2A 3H65A 3PFIA 4N12A 3VDQA 3FLBA 2YY5A 4ZAVA 3QX9A 2FN3A 1C8BA 1R6AA 5EG5A 5DXFA 4MW6A 4EUHA 1HDXA 4TM5A 4O4IB 4JT4A 3DBVO 2QX7A 3O8OB 1CT9A 5DBOA 3ETGA 4MOWA 3WDKA 3OMWA 3GTJA 1A69A 4LW8A 3KOZA 3R6DA 3W7BA 3CUYA 1XZJA 5MGBA 3INGA 5AXAA 2LKCA 4OAOA 4AP5A 4IJUA 4W8OA 3KHKA 1OROA 3AVOA 4N48A 3W2FA 1G64A 3BL5A 2AV6A 3KL2A 2JAQA 2JIDA 4ARBA 5BOSB 3QW4B 2WV9A 2AI2A 5K9ZA 2HXSA 4M89A 3KP1A 3HSSA 1ZMBA 1QYRA 2PR2A 2EBUA 1CY1A 1J9EA 1T36B 3IHWA 4IQFA 3OE7D 3LK6A 4UHBA 5DSZA 4B40A 1HE5A 5EWGA 1OJLA 4FUQA 1LPAB 5LMNH 1KMHB 4QO8A 1CFJA 1OWLA 1PI3A 4C7OB 1WHSB 3Q5GA 5E2AA 2H8KA 4FE2A 4UHDA 2CBZA 5FR9A 1EKFA 4IP0A 2N46A 4TL9A 1V4NA 1BSVA 1IBKB 2ODWA 2OCLA 5EUCA 4UW9A 3WJ1A 1VJ1A 1BH6A 5K4AA 4BUZA 3U1TA 2F1OA 3MLBA 4CM6A 2E49A 3CWQA 1D0SA 3V3KA 3RVMA 5D01A 4Z2AA 4FB4A 4FGZA 1CEEA 3RRBA 4HT3B 3GLKA 1IHDA 1KEEB 3STXA 3Q1KA 5HPYB 5I5VA 3CYFA 4QKQA 2Z2KA 3IODA 5HM6A 2HIAA 1COZA 1NNLA 3W7VA 5KC8A 1JXLA 5JSFA 3P9QA 1FF9A 4TL8A 1S0NA 2RJNA 1G291 4PV7A 4RMIA 2WKRA 3I2IA 3ZY3A 4MGZR 1NR7A 3UXYA 5AVXA 1I3KA 3FTNA 2FW1A 4EG8A 2ZTVA 3DWIA 5GPBA 3WYCA 1ML3A 3QFRA 3OTOH 4K6FA 2GI4A 2C95A 4U00A 1DADA 3IURA 1H4TA 3HI4A 3FTEA 3PQ4A 5FUXA 3GUHA 4OX9Y 3EVDA 3HB9A 5DCYA 3BE8A 4RZIA 1QGUB 3EZNA 4CETA 4TZTA 4Z4EA 2V98A 1X9IA 2OBYA 4I6EA 1K5DA 2GD0A 4Z2YA 1LDEA 1XZLA 5K51A 3EXEB 1KI6A 2HPHA 3ZDCA 1RXVA 3H2JA 2C5FA 1UK9A 3MINA 1CG6A 1TYCA 1HPLA 4KE6A 1KK3A 1NP7A 2QEQA 2B2NA 2WFZA 3B52X 1FY2A 3GRFA 1O95D 2Y05A 4D6YA 3TZ6A 1DUVG 4QPCA 1FP6A 4LZOA 1AGYA 1I3CA 4D9IA 1D4OA 3DJFA 4KOEC 4RL6A 1Q0UA 3NH6A 2ZI3A 1KK0A 1OXUA 2E18A 2H2FA 2W6ID 1J70A 3U0GA 3HDJA 3KUXA 3K1JA 4QM7A 2H7YA 4ZYWA 5JD5A 5EL0A 3WHKA 5KWJA 1SFOA 3LFTA 4FYIA 3CNOA 1EFUA 5CFRA 3NIBA 4LGCA 1CZKA 2Z9BA 1H69A 3WLMA 5LU8A 4D57A 2AFVA 2GA8A 3WWYA 3VC3A 5A4IS 5F9FA 3OIUA 3NASA 3CHYA 4X6UA 2OHXA 4B75A 4RHYA 2XUDA 4GYJA 5HJEA 4BGEA 3ESQA 1PJSA 3RYFB 1JDPA 4KEAA 4B7CA 5CIQA 3RC2A 1DZIA 3N2EA 3PP8A 2OB1A 4RETA 4GC7A 3ABIA 3G2IA 4CM9A 2F3SA 4UM9B 4MSUA 5IXYA 3DFUA 2O2GA 5BNWA 5L7YA 3IEVA 1FRQA 3N2KB 1T3LA 4BX8A 1AHNA 4BXOB 2OGTA 1JL3A 1GXSB 4EJMA 1I24A 1XTKA 2B1QA 4Q4AA 1N3YA 1VJGA 2C61A 1U5CA 5H68A 5FI0B 4MHSA 4TWAA 4AJ9A 3DEKA 3ZZUA 5SICE 1IDOA 2ZJ0A 3VRHA 3K1ZA 1UJMA 5FLXA 3P2YA 2CL0X 4P83A 4DR7B 4DB4A 3B13B 2P5TB 4JR0A 3AT1A 1FQKA 1GG8A 1R0KA 2QTBA 2IYEA 1RTKA 3HY6A 3KO8A 3JARA 2J4FA 4YWJA 5EXEA 3RHTA 3BCSA 4FZVA 3EISA 3QVOA 1Y37A 3RYHA 5LNK1 3E9NA 3CZ5A 1OXVA 1OH5A 2AUTA 3I9FA 3EMKA 4J29A 1GM5A 4HQ6A 3ZY4A 3V1TC 5C8VA 5HIKA 1XZEA 1Z39A 3DVQX 2OBMA 1U0RA 4ED9A 4WLUA 4EG7A 4QQFA 3IMGA 1NMXA 3W9SA 4L0DA 1IYEA 4BN4A 1XKTA 1XRLA 2ZP1A 1GQFA 2Q9UA 1A8HA 1T8YA 4ARVA 3ZE9A 1S8OA 2RDJA 3JQAD 1YA8A 1P19A 3IOEA 3MT8A 3VR5A 3S7ZA 4JQSA 2NQTA 3LGSA 4GGPA 3F6SA 2WB4A 1GAJA 1WUIS 2GHIA 4BGVA 1VCOA 5DWDA 2ZTHA 3NRCA 4DR5H 4CQLB 5F12A 1P0FA 3HBFA 5C4GB 3TO5A 3G5UA 4JH0A 1O1YA 2QYHA 4U6PA 3V2HA 2PKCA 3H2SA 1UT5A 1V3VA 4O4IF 3AR6A 3SXUB 3TQQA 4PRYA 2H08A 4JLMA 1R8XA 4ZVPA 2UUPA 3IQGX 2ERXA 5JCZA 2I55A 4RK1A 1KMIY 4E08A 3C5EA 3O1LA 4DLRA 3LY9A 1NMYA 1I80A 5LIRA 3JYOA 3ZU4A 1MQAA 1AXEA 2ZI5A 1B23P 4PS0A 5G0VA 3V6LA 4DA8A 4EEKA 1E61A 1LBTA 1X92A 4RIFA 3AY3A 2PDAA 2QYTA 5EQJB 1T43A 3IR5A 5DI3B 4C0WA 3IXMA 1QIDA 4I3GA 5KYWB 4X7RA 4QO7A 4JT8A 1IBSA 4MARA 2NTVA 4KBFA 4HNSA 1M67A 1AX9A 4C4ZA 4KXVA 3FI9A 1EX6A 4KXWA 3ZDBA 4JI6H 3T0IA 1MFZA 1I1QB 5EFOA 1ECJA 5BSRA 4LMBA 1NFQA 2VSOA 4R9NA 4E4RA 2J3IA 3ZGXA 2W9AA 3OT1A 3D6MA 4J0HA 4OGLA 3RTDA 2QTAA 1SKBA 3CPJB 3KYBA 2WJIA 1STOA 4F4ZA 1NUQA 5INTA 4GQBA 1YTLA 3L41A 5TY0A 1S2OA 1DRUA 2COGA 4I5IA 2H1WA 1FSPA 1FIUA 1SXJB 1Z5NA 4YMWA 3EMBA 1ADCA 1IG0A 5KUTA 4M0MA 4X64H 2YW2A 4P0QB 1B4DA 1GQYA 4EKYA 2G4CA 2JHAA 1YGPA 2DT5A 1WLYA 2XE7A 1XC7A 1F2UA 4PAOA 4G0ZA 3HQ4O 2PNFA 5B53A 4EY7A 5NLLA 2UUBB 3ZXSA 3HUDA 1ND5A 1QNFA 4IFIA 3R9IA 4MI1A 2UV8A 3RROA 3RBXA 4JNKA 1AT1A 2OFPA 2OHFA 2RGNA 1PJ2A 3EC2A 3NWBA 5D3MA 3RJTA 1OWOA 4H7PA 1QH1B 2WT8A 4XCVA 2QX6A 1EFVA 2NWQA 2I6SA 4F60A 4QW9A 3O3CA 1C7IA 3F8TA 2A1HA 4UDXX 1G4AE 1VRVA 2MTBA 1TMGE 3IBFA 1KJZA 3BDVA 4ECXA 1ZUNB 5K0BA 1QPZA 1YQQA 1TYZA 1NNUA 4BAUA 2G9VA 1N9GB 4Q9DA 1JLRA 3QKRB 4HVCA 1V8PA 4B6JA 4ECVA 1G2QA 3B9PA 3RANA 1KDOA 3G7NA 3KQTA 4ND5A 4G5HA 2ZYDA 4ZOQI 1RCUA 2ZI9A 4DVGA 4WOKA 1E2NA 2OBNA 3LFHA 2PMBA 2P9FA 1NDHA 3RFUA 2JGAA 3LI2A 5FBRB 4BP3A 1WUTA 1M6WA 4DF3A 4GI1A 4RGYA 1RQNA 4R6XA 2FGJA 3OWOA 3EA4A 4ED8A 2Z2ZA 3TWOA 1QHHB 5ERXA 4LGVA 2AXNA 1GA6A 2D1YA 3KLPX 4FLEA 2OO5A 1XEXB 3N7UA 5GIOE 2ZWMA 3DBRA 2O1WA 4KIFA 4BEJA 1XDZA 2FUNB 4KTVE 3T4EA 4RH1A 5KJEA 1H6BA 5AK4A 3W5DA 4AYBA 3K2IA 1I9GA 1G9SA 2WWYA 1ZJJA 5T4EA 4DMFA 3I5MA 2P7IA 2Q2VA 3U7IA 3U3XA 2BMEA 2Q3JA 3L8MA 4RS3A 4OM7A 2H65A 2EIHA 2COKA 3ZXIA 5DRTA 2AF3C 3CVJA 3B6KA 1BOFA 2CQYA 3ABSB 3LKDA 1QAMA 1NE7A 1I3NA 4M7RA 3SEAA 2QLFA 1SCJA 2C29D 1UZLA 3IPLA 2ID8A 3LXUX 1OI2A 4DLWA 2ET6A 1XMVA 1QHXA 4HDRA 3PE4A 5CB4F 3UK7A 4B6EA 5LWHA 4ETWA 3GJ5A 1JLMA 4YAOA 3PTLA 3OPNA 1DCMA 3VDXA 2UUCB 5DP2A 2QXYA 1KJWA 3KCNA 3CZQA 2IY9A 5HXAA 5LMCA 2R68A 5T3UA 3V6MA 5EOVA 4FBGA 1LH0A 3P4XA 4R31A 4F8EA 5GJBA 4ZYZA 2EATA 1DIHA 1OBOA 2YU9A 1ZS9A 4AK9A 4ZQGA 1MHTA 3ZCSA 3FGOA 4Q02A 1GAWA 4D4JA 1G5HA 4WFKA 3PI6A 5GZ3A 3FSJX 1BE8A 3KU4A 1OQAA 2GVDC 2OVFA 3OAAA 4EHDA 4IVPA 3FBWA 1B3RA 2O6HA 1BAPA 5EHZA 3ROPA 3MHTA 4IWYA 1I1LA 3L7BA 2Z57A 1JQDA 1V9LA 4Q19A 3ZYCA 4ZOAA 1OR8A 8MHTA 5DRYA 1ZGAA 4LOHA 4UASA 4RSRA 1BEEA 4OLFA 1BMFD 1RYHA 5EE1A 3TZEA 3PEVA 4GL2A 3HU5A 1X7ZB 2WTMA 4AZ3B 1T3GA 1N9ZA 2HQBA 3A6KA 3ZU6A 5L7TA 1V71A 2DEUA 1SCUA 3HR4A 2I8CA 3L4BC 3FWNA 3P8ZA 3FMPB 4EYEA 1UPTA 4BFCA 4PLHA 2QQGA 4RIIA 2HJGA 3C3XA 1RZUA 2FEAA 1U0NA 4EW1A 2AJCA 4IH9A 3GEPA 5JD4A 3PDWA 3WWIA 3PI7A 4OQ4A 1SUBA 2M6RA 3G7UA 1RJRA 4Q5IA 3C43A 4WUTA 4CWAA 4KAFA 3EYAA 2XNJA 5BN5B 3WL6A 1RVV1 1SHLA 2ACEA 3FZNA 2FZCA 4JVNA 2NX2A 3DTVB 3NHYA 2BKLA 4IIFA 2FWBA 3MYRA 4DDUA 5JHHB 4N8DA 3WNVA 4YBZB 3ER8A 3ZLVA 2JGIA 3L7LA 1ZINA 5FJIA 2WDPA 4QU5A 3W3AA 1HFWA 3KEMA 1U04A 2OFXA 5DHQA 3W1VA 4BLQA 1F4VA 4X7MA 3FWHA 2ADFA 1HSOA 4BP1A 2K5UA 5LIPA 1FS4A 2IP1A 2NZXA 3L7IA 4OG2A 4YACA 2G88A 3NBMA 4LECA 4LMAA 2YWDA 3UHOA 4KDRA 2QMZA 4YB8A 4ZFNA 3QX7A 3LDAA 5KVVA 1B42A 3DBHB 2YNMC 4PICA 2CY0A 3NVMB 2C58A 3OQJA 4DZZA 1UBLS 4KPYA 3WNCA 2RBGA 3HEMA 4CLOA 5KO2A 4O2BF 4V03A 3PKJA 1JFSA 3EXIA 3IDOA 4NYIR 4DTCA 2FHPA 3DKRA 1UDRA 1TC1A 1QPGA 2DHCA 2Y1EA 3FR8A 4D81A 1RWVA 1QHFA 2DKOA 3KBBA 3SF0A 4ZCMA 4EUNA 4R7TA 4OHZA 2FMHA 2HYDA 3L5KA 4QJBA 1ET0A 1UOPA 3L6DA 3HCDA 1GRNA 2R60A 1XDUA 3SF8B 2X2PA 3TAHA 2HNAA 2ZE8A 2WFAA 2W43A 3LBNA 2BSQA 1GCGA 4DYDA 4KX5A 3S2EA 5F1KA 3W5IA 4GSKA 1J07A 4AIIA 1NW8A 3OQOA 4MTLA 5JI3E 5I5WA 3E7DA 5E1DA 4PZPA 3PGVA 4FFPA 3BRWA 2ZE7A 3KELA 4KRFA 3BGSA 4XIGS 2I0FA 4WVFA 5DM70 2HPZA 4KO1S 1QGED 3VOBA 3RW9A 4MHOA 2CLOB 4Y6RA 4AZ0A 5CBPA 3F7TA 3RSOA 4PGFA 2QGZA 2WUVA 2SKEA 2NPIA 1V1JA 4X63A 3TDKA 2IZ6A 1PR6A 5KYXB 5LBUA 3SX4A 2ZROA 5FORA 1ULAA 4RD6A 3OOEA 1ZD3A 5BQOA 2JFPA 3FVTA 1EAMA 2QE6A 1JA9A 1IUPA 1HDEA 5KQSA 1P74A 2R5FA 2HUNA 1F1BA 2ZGIA 1NX6A 4MWGA 1S7GA 1JMYA 3JPYA 1PL0A 2EV9A 4YAKB 2WB1A 5DKFA 4YP3A 5TDHA 3GN2A 4AF8A 5BSWA 3U6KA 3EPHA 4O2LA 2ERYA 2R7LA 1XTTA 4NBUA 1TL7C 2YWHA 5A2QA 4B45A 3GTQA 4JSRA 4OMDA 2NUBA 4YRZA 3SZLA 2YWFA 4FDLA 4G9EA 4QT0A 2ILVA 4JOSA 3H4VA 2PV0A 1W5AA 2PIAA 4V2IA 1U5AA 1IAQA 3EPRA 2O7VA 3F1KA 3QOYA 2E4UA 5BY2A 3FHCB 4PHGA 3E58A 3GIKA 4HYTA 2MYNA 4N7MA 4F86A 4DBVO 4BNZA 5AVOA 3UWSA 3GLIB 3HYNA 1SMKA 4X3OA 1YHZA 3L1IA 1MC4A 1DBVO 4HXFB 2NU8A 1MOSA 1CYEA 2C2GA 3VU3A 2DYKA 2XOKD 1H5NA 2D5AA 3BCRA 4PCVA 5BMOA 2ECQA 5J4LA 3CF6R 3NHUA 2VHCA 3HA5A 1XYYA 3X44A 4GXQA 3IE2A 4GOKA 1RJWA 3G1WA 1VIDA 4P54A 2OOSA 1YBAA 4UTOA 3LF1A 4FFDA 2ZYRA 2ZCVA 1KZ1A 4CVNA 5AUQA 1BCRB 2HLHA 3Q12A 3QVMA 2J09A 1RJQA 3MTAA 4N5NA 1VTKA 3WLHA 2EBFX 2BP7B 1R6UA 1UBNA 3B20A 2JGJA 1QK4A 3DZDA 1BHQ1 3RUAA 2D3WA 1U0HC 5TEWA 4L85A 1CLEA 1R64A 5AK5A 3BMOB 4HX9A 3F98A 4KAJA 4ZDKA 4PW0A 4RYLA 3KBOA 1AURA 2PEYA 4KRGA 3DNMA 2P9EA 3ET5A 4N0MA 3GILA 3A25A 1HH4A 5F52A 2ST1A 1EE2A 5TS3A 3ZJUA 2XUAA 2V7GA 1TVKB 5L1LA 3F7MA 1SKUA 1B8VA 1KI8A 1RABA 1YKSA 2V5AA 2H00A 2OWOA 1LPMA 4MVJM 2DPHA 1X1TA 1F0KA 1KTVA 2C57A 4X92A 3KT0A 4DJAA 2AFIA 3G68A 1JPVA 2Q0QA 2GN2A 3CLKA 4W5RA 3GTMA 4DIUA 3LCRA 3JQCA 2H2IA 4RMGA 4NE9A 2OKGA 1AGRA 4WCFA 1C1DB 3I1IA 2QN6A 3PDIB 2ZQYA 4HZUB 2C7BA 3H99A 2X23A 4DUYB 4LVCA 5AI9A 3LU1A 3STYA 3AO0B 1WNFA 1GSIA 3HDYA 4TKUA 1C7EA 5JALA 2LCQA 1WKCA 1GNRA 2IEIA 4O2AB 3RRXA 1UBMS 5L3VA 2WSBA 1GU7A 2VIIA 3EDQA 3DHYA 4PY2A 1DC5A 3THRA 1WVGA 1YMQA 3MGBA 5IHPA 5BR1A 3EOZA 2BN4A 2CVHA 2GBPA 1ESCA 4CCSA 4LYFA 3OUUA 2GBIA 4BZPA 2IU6A 5TMPA 5KYKA 5LBIA 4G1MB 3AUSA 2PRIA 4WGFA 4IXWA 1SURA 1K97A 4RZUA 4TV8A 1DWOA 3HRIA 2CNOA 4K03A 2QSUA 1GG2A 3Q7IA 4JB3A 2A0UA 1VB3A 4CT4B 2Y3IA 4XDGA 4HN2A 4N7JA 1NPTO 3HWX1 1PDWA 2YJ3A 1IM2A 2H9IA 4L9SA 4CIBA 2H9YA 4C5CA 4NDAA 2GVZC 4DCPA 4LVNA 4AMUA 2R93G 1S9HA 1OB5A 2R11A 1VI5A 1FNSA 5A9SB 2PBFA 1QKJA 1SUCA 2R8RA 4CC5A 1E8NA 2BHTA 2O48X 1THMA 5L9AA 1J8YF 2ORED 3CSWA 3BGDA 3IE0A 3A4NA 2JLWA 1HQKA 4H08A 4YIHA 3ITDA 1JQAA 4G1UC 3CISA 1W5BA 3WLOA 4DV2H 4CQMA 3PUKA 5DK4A 5FWYB 3IUMA 5KOHB 1X42A 4KVFA 4LVOA 2WW8A 1PKEA 2WQZA 2B92A 1RTTA 1CD5A 1GEEA 3E9QA 4KO3S 3NTXA 1AXGA 3VVBA 1TA0A 4YJ3B 4LOJA 4WLOA 2IOFK 4CR8A 1PJLA 2Q7DA 3TSWA 1E4YA 2ZSIA 2R1VB 5HBRB 1S0UA 4M8NE 1ZBDA 2WHEA 3CRQA 3SS9X 4ZICA 1B0AA 3RS9A 4AN1A 4EUFA 2FSUA 1J4AA 1H2XA 2HMUA 3WKDA 1XVUA 2IYFA 1ZIOA 2XPCA 3W8NA 4NHEA 1X6VA 3OD5A 1H4QA 4EA8A 3HUEA 3AHEA 2WJJA 3BMNA 5JRJA 1V8BA 2FK3A 3O4JA 3IQFA 1LZKA 1WF3A 1JALA 3PU6A 3RG2A 4MDHA 3BJIC 1QP4A 1Z5VA 2D6FA 2DZDA 2ISQA 2WZDA 3T3OA 3EEQA 1AKRA 2F43A 4B76A 3O1JC 1CF2O 4LZJA 2X7XA 5AW3A 4QXRA 4JFRA 4FWIB 1S4QA 2X0RA 3OCUA 3THYB 3QWIA 5IP5A 3FVWA 1F8GA 1CSEE 3VR3A 3BTVA 1D9XA 3GIPA 4QDJA 4WBNF 1Y34E 4JKOA 2EOAA 4IXDA 4J90A 2JL1A 5F1OA 1NBIA 2JLAA 1XMSA 3MR6A 4D4GA 1WCYA 3IXLA 1M5TA 3B85A 3DMPA 4NPCA 3VJRA 3B9BA 3DT9A 3V80A 3O31A 4OKNA 1SVKA 4OUKX 2XB4A 4ZHQB 1QG2A 4B3MH 3BD7A 4OXNA 1UPBA 4B5KA 3ORSA 1J2UA 2ZS8A 1C0PA 2WAQA 1CS4C 4MPTA 4B6GA 3DAPA 1DC3A 1WTCA 3WZ2A 4P5EA 3RDPA 3ON5A 1UMDA 2NV0A 4YCBA 3O6VA 3BMXA 2G28A 3PRKE 2O3RA 1K3FA 2YY7A 2X7HA 1XUOA 4FN5A 1F3OA 1LC0A 4PTLA 4BDSA 4ZT6A 2X5KO 3K16A 2OCAA 2OBBA 3PW0A 4TTPA 3T5MA 3JD3A 3IPYA 2Z3VA 4RMNA 3JAMA 1KP2A 3HOYG 5CIYA 5DJ5A 2VXBA 2HO4A 3TLZA 2VWHA 4ZZIA 5EUQB 4FQ7A 3I5XA 1YL7A 3BERA 5K6AC 4BQQA 4EH1A 3U7JA 4EEZA 2VHYA 4KQWA 3ZCXA 2X5JO 5DZSA 2IYTA 3CLRC 4OA5A 2VZLA 2IUTA 4TVBA 5C18A 1A1VA 4X8LA 2TMYA 3DUFB 4IOKA 4AJLA 1D2EA 1Z63A 4NOJA 1ZN9A 2UXCB 5EQTA 1G8HA 3TVTA 3V97A 5B2EA 3B3QA 1JT2A 3U17A 3GP5A 4LFCB 1YTUA 2VXOA 1CR2A 5AI8A 3IBGA 3N74A 5EKXA 5PGMA 1BQ3A 2VJLA 1MTOA 2AGVA 5F2KA 1EYZA 4MW5A 2IYYA 4IIBA 2AMFA 4PTYA 3MQ2A 2MDTA 5JAUA 5YASA 4K9NA 1CDOA 5TVGA 4KN8A 1EVEA 1EVYA 3RYIA 2WB1E 1WD5A 2IZ5A 2JVJA 2X1VA 3KQUA 3EFEA 4JI7B 4L8FA 1FUEA 3GBSA 3ZTTA 1M34E 4FX2A 3IL2A 3HB4X 3LY7A 3DMTC 2PLFA 4QJFA 1MVOA 1T0BA 4IICA 2OR3A 4ROTA 3IEPA 3VKWA 8GPBA 3FOBA 1UR5A 2QY9A 2ACVA 3WWDA 3IUQA 4CGZA 5EEGA 2R6GA 1F48A 3U7QA 3OFKA 2GH1A 2FJUA 1BA3A 3PGJA 1P4RA 3PW2A 5ICEA 1CCWA 2JLYA 3EGDA 5AOAA 5KT7A 5GTDA 1PCXA 3BCUA 1IVYA 3PIDA 3H4TA 1G38A 3EC1A 1UZNA 4P80A 4BV9A 1XZDA 3R8FA 4MW7A 3KZNA 1HEYA 2W9CA 1T5TA 3CB2A 3KB6A 1RU3A 4Q3KA 2GRUA 4PLFA 4HNAA 3V6KA 2JGKA 3A1EA 1T6ZA 4BU1A 1AU9A 3RVNA 4CCYB 1X7XB 4ZK2A 4A16A 2HWWA 2YIJA 3GK3A 3K09C 5FYDA 4N0QA 3QVGA 4OHCA 3M9XA 2ZS9A 1KY3A 5GM2A 1EDEA 5JJ5A 4HPWA 3OZAA 2R8IA 1O5OA 1DKUA 4QTYA 4DZTA 4EECA 2R7ZG 2FRDC 3IP5A 3B2QA 5BMVF 2VP0A 5EJMA 4UCWA 4RV4A 4IEEA 2XBMA 2WZQA 3R7BA 4BVFA 3ZWQA 5ALZA 3USCS 2OZLB 4E5UA 5KFUA 1FMLA 2IHBA 1GUZA 3PC2A 1BG6A 5BT8A 2Q29A 1XNRH 4Q24A 3GRAA 4NMWA 3MBOA 1U3CA 2JBHA 5KG5A 4ZAGA 4JJ8A 3TR0A 1B7GO 5EHQA 3URMA 4NAVA 3IA7A 3IN5A 1LWOA 3PA8A 4UXHA 4BO4A 2ZSHA 3THXB 3FG9A 1DBWA 2MYPA 1JJAA 1WZ2A 3JASB 1CJKC 5WRFA 3WKBA 1XI2A 3M6LA 1QCZA 9ATCA 2QUHA 2FR8A 4LN1A 3DR5A 3VR6H 3X1KA 3MA0A 3RCBA 2FEWB 4ND3A 5EWFA 2QRMA 2IEDA 1IBKH 5DG7A 4RDHA 3KQYA 3R7NA 4WXEA 2I7TA 1TCCA 2E2IA 2YOHA 5TPZA 3QM1A 5DN6A 2BH2A 4AG5A 1FYXA 2DTEA 2IBKA 4UZSA 4JJIA 1RCFA 4NFSA 1WB6A 3SHVA 4F3TA 2ZCJA 1HL7A 1LBIA 1I94B 2PVPA 4ZOLB 5FPPA 3IAHA 2ZU0C 3NDJA 1VL0A 2XBUA 2GVNA 4MEJA 2Q21A 1GN8A 4ZANA 2OORC 5BRNA 4JUZA 4L0QA 1J7KA 4HC4A 1W36C 4FHFA 2RKBA 4B47A 1E9EA 1QSGA 1W87A 2JRLA 4MLPA 5KYYB 4H77A 1P45A 2HU5A 5HX7A 2Q2OA 1X8LA 1L5RA 2Y8EA 3KU1A 2VK1A 4QLOA 5EGSA 5D5HA 4UNSA 1RRPA 1KAQA 1QV7A 2VEOA 3TQIA 1Z82A 3CKLA 1KF0A 1RIIA 2H2GA 1F0PA 2FPIB 3Q7PA 4EA6A 3RWBA 5TE9A 1YR8A 5C52B 1J2RA 5TF4A 3MJDA 1SQ0A 1BX0A 2BEWA 4MJXA 4QWDA 3JZMA 4OM8A 4W9RA 4E5DA 3W5CA 1JX4A 4DCTA 2WV7A 1CQJA 3TTTA 3AHDA 1MORA 2C07A 4JYPA 1DJNA 2RGVA 3OKCA 5AM2A 3H5WA 4R01A 3IJPA 2X3YA 4KQKA 2C97A 4CV0A 1N6LA 3GDGA 4DV0H 1EJ2A 3N41B 2HVRA 3NHSA 1O75A 3B5EA 1FFWA 2Z02A 3UMYA 3NUZA 3S28A 1AKYA 2DAAA 3NC0B 4V1CA 5JYDA 2GD1O 2VJMB 3FWKA 4FSHA 5ESWA 5B37A 2ZSKA 3I45A 1HDIA 2A9JA 1SY7A 2OV6A 4JB2A 3NRBA 1T2VA 3LQYA 2DFPA 4QHSA 5K05A 4IAJA 4QYIB 1QF9A 2CE2X 3D0QA 4OO3A 5H9VA 3AFIA 3JU3A 2X4DA 4M22A 1PX0A 2EL9A 2W58A 3JX9A 1MX9A 1TAQA 3AUJB 4HS9A 2E89A 4K0RA 2C0QA 4XJSA 2Q2NA 2AHOA 3EF3A 5G3ZA 4J7XA 2ZUDA 1E59A 1ZUD1 1CZLA 5EZSA 4MIOA 1DRKA 4NE2A 4GKVA 3OOWA 1PFGA 3UG7A 2P0YA 1A9TA 3PHJA 4DJ5X 1UFOA 3EXFB 3EIXA 1SD1A 3KIPA 5FUVA 4PBRA 2AC7A 2XQIA 4NHOA 3HJUA 2GK7A 2IUSA 4DRFA 1RJ9A 3WGQA 1Q7CA 4GRDA 4I8DA 2DR3A 2YDXA 1RYNA 3WNBA 2Q5OA 3CUTA 4S1WA 4UEJA 4F4CA 2OFFA 1KH3A 2YV1A 3TQ1A 3GG9A 4FMCF 2VL7A 2PL1A 1XZFA 2GUGA 5LQKA 3SZ3A 4QHTA 4FWTA 5T4HA 3UK1A 4FQ8A 2Z6AA 1NKSA 5BP7A 1VLQA 3CX7A 1OGYA 3QPWA 4BFZA 1GCOA 3E9CA 1DIAA 4URVR 3UZBA 2CKDA 1UF9A 4PCUA 2QUJA 2GCGA 1E3WA 1SD5A 3AKEA 3GHYA 4U6QA 1XXHE 4OF4A 5AMXA 3ZJVA 4ARZA 1Z4JA 1M8PA 1T9GR 4YR9A 2EWVA 4JFAA 2QRNA 4C22A 4N8EA 2X19A 2Q4RA 1Z4LA 1Z0ZA 3CLVA 3RUEA 2APJA 5HYVA 2R8KA 3KNZA 2ZAGA 4LBWA 3CX6A 2MCFA 2DJ5A 4CXMA 2CMKA 1OWNA 5AKGA 5LC1A 1SG0A 2WAQE 2I6QA 3T9AA 2WPDD 3D8SA 2E6UX 2ZRKA 1VJCA 2OCKA 2A9RA 3YASA 4LNHA 4CMHA 4OJNA 4C0JA 1B8OA 2ZKIA 2ID4A 2NSYA 3MN1A 4LG1A 4O8ZA 1UK7A 1K4KA 1XCPA 2LUOA 2C2BA 3QSYA 2E2WA 5KFDA 4GZMA 3PW5A 4R2XA 1D4FA 2ZT8A 1II8B 4HKTA 5ALFA 3KYDA 1NVDA 5ER6A 2CW8A 3EZXA 1ZPDA 3E7WA 1EGQA 1FP2A 4BBPA 2WIBA 2HJVA 5C8ZA 5LB2A 1A5BB 1ZXLA 2JIZD 2YASA 1BGWA 1JHUA 1UBCA 3FF4A 3L79A 4G4JA 1D8TA 1L8AA 1AQNA 2VK2A 2V6GA