5BPFA

Crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
291
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHESVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine-D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 89
structure length 291
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bpfA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bpfA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bpfA01
2GPSA 4O7RA 2V59A 4O7LA 4I55F 1B6RA 1M0TA 4EA9A 3TQTA 1A9XA 3VMMA 1E4EB 4GGMX 4XZ3B 2R6FA 4QSHA 4TUYF 2NU6B 2R7NA 2QK4A 4M99A 3R23A 3VPDA 2PBZA 3BSSA 4ZHQF 4ZQIA 2PN1A 3WO1A 1BNCA 3V4SA 2GQRA 2DWCA 5EZYF 2W6MA 4O86A 5CA1F 4O4JF 3TINA 3MWDA 5JVDF 1KJIA 3RV3A 1GGOA 4C5AA 5H80A 2YZLA 4O4IF 1GSAA 4MV1A 2YRXA 4FFPA 2NU7B 2CNQA 5C1PA 2C00A 4MA0A 4C5BA 5LYJF 4MA5A 5JQWA 4ME6A 2P0AA 2FB9A 2J9GA 1M0WA 3OUZA 4O84A 3U9TA 5KX5F 2Z04A 2XCLA 1CQIB 4O81A 4XX0B 4FE2A 2Z02A 3R5XA 4NYEA 5J2UF 3GIDA 3ORQA 2HJWA 3MJFA 3G8DA 2R7MA 1Z2PX 3AX6A 4O7VA 3ORRA 4MV3A 2NPOA 4ZOLF 5KKNB 4FFMA 4MAMA 4RZQA 5DMXA 3JRWA 4EAAA 4FU0A 3ETHA 4EGQA 4I50F 4EA7A 3K5HA 3WO0A 2R82A 2WYOA 4FGRA 2OLSA 4FFLA 2W70A 4MV9A 3BSWA 4FFRA 4O82A 1KJQA 1GSHA 3K5IA 4O7WA 2VR1A 4MV6A 2YL2A 4HQ6A 4E4TA 2GPWA 2GQSA 1IOVA 5BPHA 4XYLB 2W6QA 2CQYA 4O2BF 2VPQA 5CA0F 3LWBA 4O7YA 2W71A 2ZDGA 1KC7A 3HB9A 2R87A 2W6OA 2VHEA 2ZDQA 1EZ1A 2YZMA 2YYAA 2X0SA 2DZDA 1OBDA 2XD4A 1CQJB 1EUCB 2NUAB 3N8DA 1B6SA 3KALA 2W6ZA 3AW8A 1EYZA 1KBLA 2FPGB 4FFNA 1SCUB 4IZOA 2CNUA 1A48A 5J2TF 3NUAA 1E4EA 2DIKA 5LP6F 1EUDB 3U54A 4YJ2F 4J6EA 5JH7F 3MWEA 5JQGF 1UC8A 1GLVA 4MV7A 4HR7A 2YZGA 2R7KA 1PK8A 4I4TF 1JDBB 3ETJA 3HBLA 4EABA 2PVPA 1KJ8A 3OUUA 1WR2A 4IWXA 1Z2NX 2CZGA 2FP4B 3R5HA 1W96A 1KJJA 2R7LA 5FNVF 4IWYA 4O2AF 3KAKA 4YAKB 5CB4F 2QF7A 1EHIA 3WNZA 1DV1A 2CNVA 5LOVF 3N6RA 2R86A 3Q1KA 3GLKA 2YS6A 2YS7A 5HBRB 4YBZB 3TIGA 1VBHA 1VBGA 4EGJA 2YRWA 4HNTA 3U55A 1KJ9A 2R85A 3I12A 3JZFA 5JVLA 1BXRA 2V58A 4IIJF 3RUPA 2R84A 1C30A 3E5NA 2I87A 5C1OA 4XYMB 3HO8A 4O7SA 1ULZA 3U9SA 3VPBA 3VPCA 1IOWA 5K2MA 5LXTF 3Q2OA 1W93A 3TW6A 4O7TA 1DV2A 2ZDHA 1JDEA 1CE8A 4YB8B 1JKJB 1DIKA 3VOTA 3LP8A 4DLKA 4YJ3F 2V5AA 4ZI7F 2FPPB 3UFXB 1OBGA 3BG5A 4MV4A 4O4HF 1Z2OX 4WD3A 3K3PA 1AUVA 4EA8A 3KREA 1I7NA 2W6NA 5HV6A 3JRXA 3QFFA 5C8YF 5LA6F 2YW2A 2FPIB 5BMVF 4M98A 3KAJA 2DLNA 3R5FA 4TV9F 4IHJF 5GONF 3VA7A 3DF7A 3R9RA 3BSYA 4MV8A 4O83A 2VQDA 4WBNF 1I7LA 4TV8F 4M9CA 3RV4A 4HNUA 5CAEB 1C3OA 2IP4A 2W6PA 2YZNA 5IYZF 2HGSA 4O7NA 4O4LF 4HNVA 1M6VA 1CS0A 5I47A 2I8CA 1GSOA 4C5CA 1AUXA 5BPFA 2YWVA 3JZIA 3V4ZA 1T36A 2I80A 3G8CA 2NU9B 4EG0A 4L1KA 1JLLB 1PX2A 3BFPA 4O7ZA 4FFOA 4DIMA 3RFCA 3TIIA 2SCUB 1UC9A 4M9UA 1KEEA 1VKZA 4Y8VB 2NU8B 5D8DA 4YAJB 1KUTA 2GLTA 3SE7A
chains in the Genus database with same CATH superfamily
3DMTC 1WF6A 4ZVNA 3WMXA 3BWYA 3R8XA 1RYBA 5D6OA 4GPIB 3IQFA 3OSNA 3EUFA 4ENVA 4LF6B 3TNDA 4QT0A 4XOIA 3KYBA 2AOTA 4K6OA 5FBVB 3RK0A 1HLDA 4I3GA 2O8BB 1NF9A 2BEVA 2Y92A 4LY9A 4TKLA 5EQDA 1GZHB 3G9QA 3RV3A 3BK7A 4BEBA 5F9MA 4EUFA 5JDIC 3H5NA 1XDZA 4LE1A 2YHAA 2UYOA 1X39A 4Q1BA 4XWAA 2Z2IA 2YOHA 4JR1A 4AMVA 3VPGA 3H5IA 2NVXA 2J6HA 3K53A 3WY9A 3S24A 3GPDG 4J0QA 2ZREA 2PZGA 3JU3A 3TRDA 1DQNA 2QVCA 3J80A 1ZBQA 4AJ1A 1JWAB 3WK6A 4D8YA 1RWKA 1U8YA 3U7EB 4UBLA 4QC2A 1U2DC 1HT3A 2GNPA 1I94H 3ZZ0A 3P9CA 1WKCA 2O5CA 3WK9A 3Q88A 4FGRA 2G40A 1VL0A 2BONA 1ZUIA 3O9VA 4ER7A 1LPSA 1U3WA 1YUMA 5HIAA 3D1JA 3OC6A 4S1PA 3T94A 3T3EA 1DEAA 4S1NA 3C3MA 1ZQ9A 1MOPA 3VC1A 2IU6A 3ZXYA 4D57A 5B3AA 3TGPA 3L7CA 4M0LA 2H4XA 4CDMA 1CRPA 5FKJA 2H11A 4KV7A 2DH6A 1A9TA 1KYIA 3SS7X 1L7PA 2CDNA 4ON9A 5DMHA 3G17A 7GPBA 1N1EA 2P0EA 1T2VA 4FFVA 4FOPA 2YZMA 4F2WA 2VLIA 4LGYA 3KTAA 2PVSA 4IV8A 5KINB 5B30A 2RHTA 1CJKC 4LXIA 2ID7A 3OJCA 4J4TA 5DHRA 2WJYA 2E82A 3NGLA 2RGEA 4LBWA 4HR7A 4YRNA 1HKHA 3V34A 5CBPA 4PHCA 4DWJA 2Q8QA 4WCDA 3CEBA 2EP8A 4JASB 1MT3A 4RTLA 2ID8A 3I73A 3IIIA 3J80W 5JS2A 1DT5A 1RTKA 4I46A 4JFAA 2ZIZA 2LUOA 4G1UC 3M89A 1DRWA 1K8RA 3F9RA 4KAXA 4QVGA 2P6RA 5DM4A 2QLFA 3ESZA 3BX1A 1ZR4A 3DHYA 1SUSA 4Q7LA 4PGMA 1KEPA 2H1VA 3G6KA 4L28A 2ZLBA 2D5AA 2FJ0A 5F2OA 5ILGA 1KZ6A 4A0GA 3H1PA 4ND1A 1Q16A 2Q46A 1C29B 3DBRB 5ENVA 1SOWA 3HEMA 1IBLH 5DHFA 4EUKA 2B8EA 4MVJD 1J9ZA 1W93A 4JMLA 4YNBA 1UOQA 4URYR 4FCCA 3HWRA 1NPTO 3I5XA 1C3OB 2Y68A 1QZUA 2PYZA 5ERGB 1REQB 1W4LA 3E23A 1Z4OA 2QPAA 1XEWY 3LM8A 4XVQA 3BSFA 5BN3A 4UCQA 1GAJA 2AWOA 2R6AA 4IO0A 1J2EA 1RM5A 2GJKA 4LJ8A 2F3UA 4IVRA 2DR2A 3GJ4A 4Q9HA 2VQDA 2JLVA 1G9TA 3VPHA 2F55A 4B3BA 2YNMD 1C50A 3KQYA 1M2VB 1YZTA 2IODA 3GRFA 3NBZB 4DUZH 4K9NA 3FMPB 5K3DA 3CWCA 1EE2A 1NVGA 1DO8A 1ICEA 2X8WA 3GUUA 1Z88A 3RK4A 3PE3A 1AB5A 4XDYA 2ODTX 2CLOB 1PNVA 4JVNA 2INGX 4M4SA 4TS3A 2G83A 3PUIA 4YJ2A 2C42A 2HH9A 2GBIA 4WHXA 1U3VA 5DF1A 2I3GA 3NP9A 2ZJ0A 1E4EB 2QJTA 4DUYH 3TTXA 3VPXA 2FUG6 1JQJC 2CUNA 1WXFA 4FDMA 1SUEA 2I66A 4Y2GA 4GLOA 5IYBG 3ZPXA 1S02A 1PR6A 5KYUB 2WFLA 3GRCA 3TMAA 7YASA 1HE2A 5KQSA 4XTCS 3OY7A 5TJ9A 4XYMA 2XCUA 1RJ9A 1GT91 2GERA 2OD7A 1V1JA 3CG0A 4JB8A 4Y2SA 2H2IA 1E60A 2W42A 1P18A 1VLMA 9ABPA 4C89A 4Q7EA 3FOZA 4PG8A 1JUDA 5HYVA 2W2TA 4QWWA 2A57A 2E55A 3D6NB 5AFSA 6LDHA 1WKBA 1SQSA 5IKEA 1UPFA 3FJ1A 1RBYA 4FFMA 2I4LA 1F2VA 3QVMA 3QF4A 5I9NA 2OBFA 5AVSA 3F73A 2Q6TA 1ORDA 3WO0A 4RM2A 4JJAA 1IYZA 3CZ4A 3L0YA 1OJLA 5COAA 4HUQB 621PA 3DFIA 1N33B 4PZ6A 4X8MA 4AK9A 5KS8A 2CQYA 4R2LA 4ZFNA 2PH3A 1TRKA 5C4GB 1F5NA 2CJXA 1JMKC 4PM4A 5KYTA 4KOEC 2YHIA 2OWOA 2OM6A 2BGIA 3EVEA 5HKAA 5FAXA 1QK3A 3IP1A 4JEHA 4JC0A 4ENUA 1B3BA 4OEHA 1ZUNB 3D8NA 5CH8A 2GH1A 3LT4A 3T0IA 3H4TA 1WUYA 5EHQA 3M9MB 2R25B 4BLVA 4QW8A 4CR7A 2HK8A 3THXA 4G56A 1K7FB 4XYLA 2W2KB 4WX2B 4BBJA 2JI9A 1HDXA 4J9NA 1VOTA 2BYTA 1U28C 3KEFA 1DAFA 4M1SA 1OA1A 1OXSC 4X3PA 3DAYA 2GRUA 2PAAA 4NFYA 4QGBA 3IMKA 1VECA 2IP2A 4NEGA 3AR8A 2CW8A 2PL9A 3KR2A 3GEIA 4M9RA 4KYUA 1ENOA 1U9ZA 1NY5A 3NHZA 3TSCA 2ZWPA 3X1ZA 5DBHX 2HKIA 4ZT3A 1ESZA 5F7OA 4JYZA 4Z4IA 5JR3A 3QVOA 1UKCA 3ER6A 5KG1A 3QZ7A 2R85A 1D9ZA 4L78A 4MYHA 1DTWA 4QBHA 1PGOA 4MWTA 1OI3A 4BC0A 3TD2A 2OO5C 3BA8A 1YRQA 3EGEA 3DEHA 3KLOA 2BFAA 2GHRA 2FYTA 2M1ZA 1EVEA 4Q39A 4OBXA 3QV1A 1WJGA 4JMPA 1EE1A 3GJYA 5AIAA 3B38A 3TBHA 3B7PA 3QX7A 1Z28A 5ALYA 1BRMA 3DULA 3AERB 1N25A 5JTUA 4NU8X 2FMUA 4ECAA 3SIRA 1WG8A 1Z36A 1T9CA 4G0VA 1RKUA 2Z6QA 4TWZA 2BIFA 2F9FA 1NQOA 3MYYA 1GN8A 2HOQA 6GPBA 2AMVA 5CDGA 3MZ0A 1EESA 1QAOA 1KFBB 5DYNA 2CL0X 1WVIA 3C8DA 4IYJA 1Z5UA 3GEGA 3PJGA 4A6PA 3NBMA 3QENA 3BMCA 2NO1A 2AF4C 3VC7A 2KX7A 3O8OA 4Q66C 1THZA 5DT2A 2HXGA 4K6MA 1GL9B 3I37X 5TLSA 5ALJA 3T5GA 1IJKA 2QJFA 3GV5B 3A58B 2DCMA 3ANXA 3L7JA 4YRLA 1U81A 1JLSA 4WCVA 4F86A 2WABA 1AHIA 1TW2A 4P4SA 3TX2A 5HK9A 5ESWA 3FGZA 5DGHA 4FHGA 2Q3FA 3ETCA 4OH1A 5IJXA 3PQ3A 1HE4A 4BWVA 3EC1A 2VP4A 4O0LA 2VJBA 2C9DA 1IDOA 2FW9A 4G1BA 3CVZA 4EB3A 3U7IA 1DMRA 4WESB 2B21A 1TIBA 4HMPA 1RP7A 3U3OA 3I9MA 2GR9A 3OO1A 1NMQA 3BRQA 4YDRA 1I4DD 4GOKA 2FVYA 1VM6A 2FG5A 1RAEA 2FMIA 5KFCA 2DFPA 3CUVA 3TLKA 1M0WA 3DWFA 2CV2A 1P9WA 3VYVA 1NIPA 1WU8A 5GM1A 3PVZA 4JP1A 5K0FA 1L1EA 1VJDA 5BY2A 4DW8A 3ME5A 2O8EB 1ZP6A 2NN3C 3HR8A 4WBNB 5DMXA 4P32A 1LSSA 1US8B 1YS2X 1EFLA 1E3WA 3UATA 2XNJA 1JH8A 1GD1O 2FN7A 2QTNA 4DLLA 4OPMA 4HLCA 4HQ0A 3U7QA 3EXHA 2H85A 4WI1A 4W5JA 2PMWB 2PO5A 5C8YA 1P1RA 4Y6PA 4II3A 2H4ZA 4PO9A 3CN7A 3PUXA 3QX9A 2BP7A 1NI3A 4H17A 4EFNA 2Q4RA 4TMTA 6REQA 4YAEA 2R8RA 5HSGA 1J2JA 3THWA 4OQXA 5A2QA 5AI8A 1CKNA 3N1UA 3LHDA 1N75A 1NW9B 5BWWA 4JSYA 2V5VA 4Q3DA 4E6EA 4DPLA 2ZRJA 3VYRB 4DA9A 4UUNA 5L8VA 2NGRA 3I01M 1GYQA 1PLJA 1GSIA 4RAQA 3Q7EA 4AW9A 1FJGH 4J2OA 1Q0ZA 2EWWA 4TS1A 1N7HA 4LNHA 1ZX1A 1GPYA 3AETB 4NHEA 4AL4A 5BSFA 2ATCA 4RMJA 4HEHA 3OLCX 1TZMA 2O8BA 2B1GA 1KEEB 1M0SA 3GZNA 1OFHA 4D9BA 4CM5A 1WR2A 2SICE 4DCPA 2ZBVA 4OI0A 1GA6A 1YOVB 3BE8A 5J4VA 5B6PA 1RBMA 4U8GA 1UWKA 1VHLA 2E9SA 3R0VA 4CQNA 4AVYA 3EAGA 1ZGHA 5FF9A 2RGCA 4IQGA 5H3HA 1Y8QB 1G21E 2D5BA 5GP1A 4OQ4A 1JAZA 2WWHA 1CUXA 3D6JA 1WHTB 3BA1A 3PFHA 1FZTA 1UDCA 4PZ7A 3H4DA 4MKRA 1J06A 1DT3A 2Z3WA 4Y9TA 3A4TA 5JEDA 4Y2UA 1U8AA 1ACLA 5LQCA 2XKKA 5EIWA 4O7SA 4Z0NA 4O3RA 4O6VA 2Y71A 1RSZA 4E5UA 4FYWA 4GM1A 1Z12A 5A2QW 3KJIA 4DQVA 1V5GA 4EW3A 1E9VA 2REOA 4IJMA 3ENWA 3U60B 5AJXA 2W8BB 4PR3A 2ERYA 5L40A 4UCSA 3I9V6 1FSPA 1EGQA 2QX8A 4LZOA 1V16B 1TCVA 1PEKE 2P2YA 4UCVA 2FCAA 4TLDA 5DE3A 4J2HA 1NOIA 4GZ6A 3V4PB 3JWIA 1KZ4A 1GJRA 3J7AK 1OGIA 3DZGA 2ZIUB 5CJ2A 2JKZA 5LP6C 4MVJH 5IN5A 3SLRA 1G8FA 3L1HA 4MI6A 3D64A 4XOUA 3E7FA 3WYCA 4BNIA 2P2CA 1VKZA 5DLFA 2BFNA 4QARA 2QP3A 1O8CA 1LI5A 2XUQA 2PBLA 2O07A 1WBJB 3AHJA 1JAIA 2BKUA 3A4MA 4AKHA 3GIKA 2AHOA 2I33A 4O59O 3AGQA 3JTEA 1BMDA 3DWIA 2QM7A 1H3FA 1G60A 3RT9A 2R751 4JHLA 5FYQA 3CFYA 1ZBDA 4V1CI 3LPDA 1ZMRA 4Q7JB 3ECSA 2CYCA 5I5TA 1V1MB 4KUEA 3U62A 3RC7A 4LC9A 3NYRA 2NXEA 2BGUA 2K7FA 4EPTA 2BFBB 5JO9A 5F3DA 1UFRA 3OTWA 4YJ3B 3G0DA 3D9QX 3S27A 1O95C 1F48A 1FFHA 4Y0AA 2YV4A 2ES4A 3SQMA 3MELA 1REQA 3U16A 4ZYTA 1U3DA 2HZBA 2WT9A 4Y9DA 3PYLA 1QNFA 1BTOA 4ED3A 2RHOA 3N42B 1UKYA 1TF7A 1TVKB 3W79A 1JXLA 1JHUA 3ZV4A 5FQOA 4MYDA 3OF5A 1T0PA 1TWCA 3G5LA 2PZBA 4K81B 3UZOA 5L9AA 3O9MA 3P2KA 1M2VA 3R75A 2P3SA 4TGLA 4H4CA 3LTEA 4CMHA 4CLXA 1QVVA 3GPCA 5JD6A 3OQBA 4PLPA 1HY3A 1GY8A 2R5WA 2WAAA 3IRVA 2B8NA 2PTHA 2GJ4A 1E6CA 2WWVD 4P2BA 4PICA 5JJLA 2V6FA 1VJCA 4ID9A 1KAEA 2F8TA 4MMZB 2IPLA 3BE4A 3P2IA 3FOCA 1E4EA 4RVOA 4AB1A 4UZSA 4OLFA 4MS3B 1TA9A 2VRNA 2ZSFA 2ISSD 1GCUA 5B58T 5C2JB 4N41A 2IS6A 5JZBA 1IQPA 3HKDB 2OMKA 3VHXB 1N5RA 3GFGA 5K1ZA 3I1IA 3UK1A 4H60A 1TGYA 4JH0A 3TG2A 2ZVPX 1H5QA 4TT3D 3WGNA 4QLOA 3GLHB 3V2UA 1ZRHA 3CR8A 5JYEA 2FW0A 1LBIA 1U4OA 4HJRA 5DHSA 3K70C 2Q62A 2FEMA 1U2ZA 2EJBA 3JD0A 3K0CC 3C5HA 5CD9A 1MP0A 4RA9A 4NZZA 3E6AA 1AXRA 2YUIA 1GR1A 4YAGA 4FEGA 1XVVA 4US1R 5JD4A 3GJQA 2QYZA 5FL7D 3KSMA 2B8TA 4R1QA 2MMGA 4F1WA 4IJWA 3YASA 4C0SA 4B84A 2CMKA 2Y1LA 3IP5A 2AXQA 1QIDA 5HBRA 5HKKD 4EEKA 5EP1A 2WILA 3CPJB 3BXHA 5LWQA 4C3UA 1F7UA 1UK6A 2A78A 2FNAA 4HLDA 4IDEA 4HUQA 5L45A 1IZ8A 1ORRA 3C70A 4DIBA 2VTDA 4OGLA 4ER6A 4G81A 3BTVA 2ADOA 3C4VA 5JATA 1IRIA 2PRIA 4OIMA 4WBNF 4HNUA 4J90A 2DY0A 4EVIA 3ZWOA 1DAGA 4NFSA 1EEHA 2JA6A 5EZ5A 4D81A 4YRBA 1ZUNA 2QUAA 2AJLI 3B3GA 2OP1A 4TXJA 3VJKA 2XLBA 2XIQA 4DC1A 3UGQA 3Q3EA 1MB9A 1RZRD 2NU9B 4BRSA 2W2KA 2J4DA 1C7QA 4Z9BA 4WECA 2V6GA 4P5PA 3SQDA 2YINC 2MTBA 5CM9C 2WWRA 4KQIA 3VHRA 2BDEA 5A0FA 1CUHA 5LQKA 4NK4A 3RCBA 3RBEA 3CEPB 2PD6A 1ZW6A 3VMMA 1SBIA 1KU0A 2Q1XA 3ZZ1A 3DOHA 5DTJA 5KG4A 2HWWA 2LPMA 3BCSA 1S01A 2HPHA 3JZMA 5BO5A 3MGGA 4LCEA 3WWPA 1L7OA 1NQVA 3OZIA 4EX6A 5CP8A 4R40A 1U0FA 3ZCTA 3E27A 1VSTA 4YIKA 1BKSB 3KXYT 1S7GA 2QRLA 1EFVB 4GM0A 2QMUA 3GBPA 3CSUA 3OUZA 3DCYA 1C7IA 2ATLA 3AL0C 1DADA 2UV8A 2YBEA 3OLXA 5FULA 1IBMH 1QG6A 1W4RA 2QAGC 1OV4A 4PYQA 3AERA 1CVIA 3P5SA 1N48A 1HMYA 1WUKS 3SKXA 2QVYX 4YJGB 4XW2A 1VLJA 4U6QA 3AB3A 3LECA 3NEJA 1Y80A 2V9PA 3PYMA 3D3EA 1J8VA 5DV9A 2CF6A 4NZYA 2VAPA 4W8GA 3WKAA 2FEXA 2JLAA 2QTRA 5TIIA 4J0GA 3TJRA 3DPSA 3CCBA 2W7PA 4ZANA 1I4OA 3I0MA 1KETA 1SC3A 3D2AA 3HK2A 4BWGA 4WNIA 2BCJQ 3R3ZA 1V39A 4MQEB 2NZ8A 4MOWA 1QIFA 2QE7D 4JP5A 1DPFA 3LY5A 1YQ9A 2AG0A 1G8JA 1YRBA 1XXHB 4YN3A 2WG2A 5EZ6B 1FL9A 3OM9A 3H16A 3QG1A 1SU6A 4JV2A 1FVHA 3SI8A 4CIAA 1OFUX 3ISTA 4AS1A 5REQB 3QX3A 1B8UA 3HCRA 1HE3A 2PTGA 4AO8A 3BJYA 1WVMA 3CKMA 4I1VA 4NRDA 4WESA 4F0JA 4M0DA 3S2IA 2FN8A 3M2TA 1KDVA 4PAGA 1NTRA 1EFUA 4M2LA 1HNXB 2F1RA 2A67A 2VBIA 2WSLA 4EUNA 2O2ZA 1YJCA 3W3AA 1JEOA 1QK5A 1U8EA 4PC7A 3L84A 3C41J 3KCQA 4BGDA 5JOQA 3KUUA 1IQUA 4CUJA 4E1BA 4BKOA 1G66A 1CY1A 2W98A 1QJCA 1XZEA 5BN4B 2HWKA 4F2GA 3U1VA 2BMEA 2ZZMA 2IF0A 2MSNA 1QCCA 4KQHA 2VG8A 2O8EA 2QTVB 2QJOA 2IIBA 2AEMA 4WBNA 3RG8A 3I42A 1US8A 2UXDB 1TLFA 3VPBA 1TRHA 5LSAA 3PNLA 1JB1A 2GB4A 3QMMA 2ZOSA 3TQFA 1O5OA 4G1FA 4LMPA 2FOLA 3FUVA 2ACWA 2PRJA 1ZESA 3H11B 2ZIFA 2A9JA 4YJ3F 2I78A 2V6MA 1PUJA 1V95A 3AHHA 3ZWMA 2O2IA 1VPVA 2KLHA 3CX6A 1P7YA 3TQIA 2COIA 1RYNA 5ICFA 1O58A 4RSMA 4BWYA 1M3SA 5B37A 3A1EA 1I7LA 1FXUA 3R0QA 1B93A 2DR0A 1JG6A 1TVMA 1ZMXA 4QRDA 5JPIA 2VSQA 3N07A 4Q6WA 4UFOA 4CLDA 2QXUA 3BD9A 1C9NA 3R40A 3AETA 2GKSA 2C9YA 2WTAA 4MIOA 1T8PA 4NCIA 4MLCA 4TRJA 4IOJA 3P2EA 4EGFA 2JFHA 2J9RA 1KEEA 3QVJA 3MTGA 3LCCA 3PDJA 1NAHA 2QQFA 3C6ZA 3G9TA 2LIPA 4NECA 2X0FA 2GKOA 4MMYB 4WY2A 1XB2A 3TW4A 1L5GB 1A9XA 2ENUA 2QXYA 3FIJA 4W9NA 3HXTA 4I1RA 1Y8QA 1W5FA 3SZMA 3UO8B 3VPAA 5JZ9A 2Z6UA 4MUBA 5CDUA 4LY3A 5KJFA 1WHTA 2VHUA 2HT6A 3AVWA 1KBZA 2PGJA 1GGJA 4B6JA 3LPMA 1JIJA 1ESCA 3PGLA 3CG4A 4ETMA 3FNGA 2C7GA 2WF6A 4YK7A 2FE3A 1J1UA 1JJAA 4EHNA 4MXDA 1HYGA 3C3PA 4JQOA 4DR4H 4GH5A 1IG3A 3DOJA 5AVRA 4FEAA 4ARBA 1LSJA 4FE4A 3K4PA 1V6AA 3GUCA 2E85A 4RHXA 3U19A 3CZQA 5AJVB 4JBIA 2QJRA 1RLOA 3H87A 4RENA 5GONB 2XKAA 1H2RS 4AF8A 2FE1A 3GJTA 4FD2A 1G0OA 2VTVA 4NP6A 4CI0B 4MPJA 1V16A 3CVYA 3VHQA 4M0KA 4TL9A 1H22A 4LAFA 2I0FA 3EDCA 2BLNA 5CNIA 3AUFA 2BSXA 1QTNA 4D4LA 1MD9A 3A3OA 3LQYA 1OI7A 3NV9A 2W6JA 1IYEA 1SVIA 3LK7A 4Y6LA 1OY1A 3TQSA 3CH7A 3VUFA 2J6BA 1F0PA 4KE7A 5DTIA 2K5UA 3R7BA 3AJEA 2K6GA 1EA7A 3WLPA 2AEFA 1V3TA 5F73A 1P6QA 2VF2A 3EXAA 4MGKR 4UBNA 2PKXA 3OURA 3G2JA 1AQIA 3DFFA 5DCYA 3VKFA 1NDUA 3ZGZA 1SHLA 5KWVA 3ZCQA 3EVFA 2IPOA 2Q3LA 3ZHCA 2X13A 4B4UA 3QUSA 1E2QA 3WYFA 1J42A 1NPYA 3QOFA 1Y3FE 4MGZR 3MLAA 2ZJ3A 3Q8MA 4P22A 3L7NA 2CEKA 2Q6OA 5IKPA 2L69A 1FW8A 1IWBB 3PHGA 2XITA 4ZEXA 2WZBA 2R4UA 4RVHA 1YWGO 5IVIA 1U3CA 1TQ2A 4F71A 1V1MA 2RHDA 4WK4B 5KFAA 2AN5A 4RAYA 2UVVA 4NOKA 4GKVA 5IWAB 4Q47A 1JDBC 3C0KA 1AHPA 1TO1E 4JLSA 4RYDA 1UDXA 2QRHA 3VHLB 3P0IA 2OILA 1EPUA 1X1DA 2BFBA 3PC8C 3SFZA 4EG8A 1IOZA 1PKEA 1FXSA 2PS0A 4YJ3A 1KDYA 1L8QA 4NCAA 1P6XA 4M1KA 1YFLA 2IVFA 3CT6A 3QJ5A 2OQ2A 1U0SY 4WOKA 3HQ4O 1LU9A 1X7HA 2XB9A 2C2DA 1Y1PA 3BGVA 1T4DA 4YT2A 3PD7A 4DV7H 1TVKA 2O19A 3W2TA 1TQ6A 1EVZA 4RSRA 4LF7H 1ABBA 4AS2A 2G76A 1N8SA 4U2FA 5BW8A 3M5WA 2IU3A 3MINA 4HSEA 4PGAA 2YC4C 2G9UA 3CO5A 4Z51A 4WKCA 4EKGA 2AX4A 5KAMA 3PXXA 2LKDA 4UQPA 1GQ2A 4CZ2A 4R1MA 1AU9A 2CLHB 3OD1A 5C5CA 3IAEA 4WRRA 2ZB8A 4GGPA 3VC2A 1IZYA 4FYMA 1JTFA 3I6MA 1JIHA 2Q5JA 2R8KA 4HI0E 5F4ZA 4BTEA 1IB6A 5AJHA 3KKMA 5FBWB 3HKDA 2PS9A 4J9RA 1EXMA 3H5WA 4YGXB 3ZBUA 2A5LA 1GGNA 2NU8B 2DUJA 3GLHE 2JFUA 1KAHA 1JN0A 1RPZA 5GIPE 4QDXA 3GLHA 3W2HA 2QROA 4QPPA 2MDTA 2QN9A 4AU1A 2P2ZA 3Q8PB 1NFQA 3KVRA 2VJQA 2DH5A 4EB8A 4K9RA 5LJLA 3V32A 2QK4A 2JJ2A 1K63A 4F45A 2RKOA 1IN5A 1Y6RA 1RE0A 1NMZA 5FD5A 4WPGA 3RAXA 1UQTA 5L4SA 1MFPA 3AVYA 4QVIA 1VIAA 5IHPA 5D5PA 4RLHA 2R2GA 5HKOA 5CG1A 2WKSA 2ORYA 1U7TA 1XFDA 3U7JA 2GARA 3NM4A 5T7BA 3S3TA 4O4HB 3HOUG 3SSOA 3LGSA 4P0QB 3ILSA 1H2AS 2BE7A 1KZGB 1HDRA 4FI3F 4MGYR 4HDKB 3IQXA 4L8VA 1HXHA 5F7JA 4RZQA 3HU3A 1H1TA 3WBKA 2AC4A 2O5RA 4Q9NA 4ZVRA 1FQOA 2IWRA 4CIBA 3IDFA 1H8HD 4ED2A 2WD7B 3KLBA 1GV0A 3BMOB 3QOWA 2HHCA 4FFRA 1E5LA 1VLLA 4V0RA 1E62A 1RM4A 1VYUA 3K5IA 5AKYA 4WH0A 2VR1A 3W6ZA 4LISA 1K6XA 3ZS8A 2GQSA 4DV5B 4ED7A 1T5HX 3FHLA 4KMOA 3OFSA 5CR9A 3QSGA 1B2LA 1NJ1A 2QNBA 1RYDA 5FBQB 2MYPA 1YB6A 1SQFA 3DMPA 3S29A 1GGMA 2WJPA 5JXGA 3INRA 3G2QA 2G5GX 2HQ1A 2P1RA 3U4GA 4E15A 3TI7A 5A5DA 2C5EA 4XIJA 1GDDA 2A9VA 5IT4A 1ZN8A 3KTOA 5TNXA 4O4IB 3CISA 4QOHA 5K4HA 2NNWB 3N58A 3Q41A 2I6SA 1OYOA 3DOOA 2ZR0A 4OSPA 4ONEA 4II2A 1VQ1A 2LIVA 5DSZA 5CUQA 3F6EX 5AVUA 2RCNA 1CDDA 1NJSA 1EFVA 5F2KA 1KO4A 1MRZA 4PSKA 1YQTA 3D3WB 5EKDA 3U3KA 3DV0A 2AN9A 1Z6YA 2HJHA 3OQOA 3INTA 1WCMG 4LDQA 4I08A 2HF7A 1MAVA 1TKRA 2X2OA 5FUXA 3NBYC 3NOOA 4AJPA 5CIQA 1N92A 1BVRA 3K7EA 3GY0A 1ZJZA 2Q1TA 4YJGA 1ORWA 2ZVQX 1FFWA 3F74A 4CTKA 3INNA 4YAUA 1X38A 1XDSA 4WT7A 3U7RA 2IW3A 5HW0A 3OHMA 3SQNA 1ZD8A 5BWLA 4FDVA 1S9DA 1V5FA 5K2MA 5BSEA 2Z58A 3FVQA 3UUEA 3Q7TA 3MJRA 1ICIA 4FNMA 4KMRA 4ARUA 4AMZA 3GOQA 1MA3A 3CLKA 3SX4A 2O50A 4OP2A 5JCOA 5JS6A 2ATEA 5AUNB 4FILA 5GONF 4XLTA 3E7WA 1XXHE 1JVNA 4ZIRB 3CF2A 5BSTA 3JD4A 2GDJA 3RF7A 1FTNA 3LF2A 5B3LA 1G21B 1M5TA 3DKKA 4WADA 1QHNA 4EQ5A 4QXQA 1M2EA 4LZNA 4BFYA 3CXRA 1ZW1A 1ONNA 1GZ6A 4XQ0A 5DPMA 3OCCA 5REQA 1B33N 3AFGA 1JMVA 2DG2A 4BFXA 3ANSA 3DNPA 1BAPA 2F48A 2FSIA 4WZAB 1OIWA 2XMDA 1PJSA 2IEBA 2G80A 3CLHA 1RZUA 4M36A 4EBDA 1W29A 4FCVA 2BEWB 2XIGA 4U7WA 5E4JA 3RREA 1U9JA 4N8DA 4J9VA 4AMGA 4MJXA 4D5EA 4Z3KA 4KOAA 4HWKA 1GDHA 4DM7A 4P7BA 1M33A 5IBCA 3QXXA 2VIIA 3PR1A 4QIWE 2RJOA 4MW9A 4JJ7A 4X97A 3TBKA 1U1FA 2OOKA 5BVHB 3DLHA 4HWSA 2QOEA 4FS8A 3KEMA 1ZWLA 3ZQJA 3GB8B 3PC2A 3DE0X 4LRTB 5AM5A 4WN9B 4ZTZB 3IT2A 5BN4A 4O86A 2PJDA 4UDYX 2IIVA 3AEXA 3MJHA 3R3YA 4B4VA 4Q15A 1A04A 2QTVA 5LP1A 1FXWF 1X0VA 3RTEA 5KSPA 2NQ8A 3UWSA 2XA9A 2Y1OA 4U7DA 3P71T 3AINA 2ZJ2A 1H69A 4F2HA 3V1YA 4E13A 3DYIA 1YJXA 1OZ0A 1CQIB 3PFKA 5HJEA 3VISA 3B7GA 4NYEA 1TJ3A 2GN1A 4D9EA 3H11A 4DV4H 4MUNA 1EVQA 4Y1RB 1EKPA 3VV2A 2VLBA 4OP3A 1PRYA 1R16A 2AQ8A 1XJWA 1Z0JA 4EJSC 4BHTA 1Y7TA 3PXEA 4YFYA 4QM6A 2E5LB 2ZKLA 2AMYA 2O2GA 3ZDAA 2BFOA 3JAKB 3Q8LA 2BJWA 2XT9A 3P5BA 4XSVA 5SZKB 1F06A 3K1TA 4PIPA 4EY3A 1UP7A 3ZHVA 1CWUA 2VJMB 1ZITA 5SYAA 5HFJA 2CMGA 5CCEA 1MLDA 3OM0A 4C4AA 1O4VA 3C1OA 2M9MA 2VDNB 4PNPA 1C0KA 4D97A 4MSUA 4EW2A 5KYVA 3C1AA 4BFUA 4HQ6A 4AY4A 1K4KA 5HUHA 2GBGA 1J7KA 3T5PA 3C74A 2R4QA 2BEJA 2YVLA 4WEQA 1NNUA 1T0JB 3QIVA 2WIBA 4A8JA 4BY9E 4OOFA 3MS7A 3I6IA 1XK6A 1JU4A 2O3TA 4W7HA 1NQTA 1Z6TA 2WIFA 3WIOA 5KT3A 1NMXA 3AIMA 4MPTA 1JJFA 1SCUB 2FK7A 4Q3EA 3WP0A 5A4FS 2DIKA 4CQMD 3WGQA 3DO8A 2Q0SA 4M7EA 3TSYA 1KZYC 3RB3A 5GVSA 3VU8A 2ZJTA 3A37A 4E5YA 1Y3IA 4IXWA 3IGFA 4R9RA 4URZR 4RZRA 3HDGA 2I29A 2H3HA 1DCFA 3CWZA 1C8KA 3KV3O 1Q7TA 3FDZB 1TPYA 1CR2A 3WS7A 3GFOA 5K0TA 8GPBA 4OHCA 4DYHA 2ST1A 4FEEA 4IMRA 1MO6A 3GDHA 2PMCA 2HQBA 1Z0KA 2XDQB 2EJCA 2PLWA 1N7JA 2ZS8A 4F4YA 4KR0A 2CJFA 4O63O 3UMCA 2P2LA 5GONA 1DPGA 4DRXA 2H4JA 4TYNA 4NBSA 5C1OA 3IS3A 3T7RA 4C20A 4LF9H 2A59A 5K2OA 2D74A 2HMSA 1GNVA 4KEAA 3W4JA 3W8DA 1V4VA 3TZLA 2C28A 1P1CA 4C07A 2QUIA 1O94D 2GO1A 1IZ0A 3VR5D 4QKQA 5BOSA 2NNLD 3D6MA 4RB1A 4B17A 3WMRA 3BC1A 5CLFA 4O4HF 1WNTA 1IU9A 4KBFA 3WOHA 2C99A 2GZMA 5DWQA 1TC2A 4DC9A 5JCZA 4JI1H 1OUMA 2J5XA 3EGWA 2DLDA 3T7CA 4N76A 2GKGA 1P29A 2FXVA 2GRAA 2Y2UA 2GZDA 3VNBA 2JH8A 1UPUA 3HYNA 4DB4A 4F6RB 4G8CA 4AUEA 2IP4A 1JF8A 1YHNA 1HKUA 4HPWA 5DGDA 4HQKA 5F3WB 3CVVA 3HH8A 2FX5A 3LJKA 4ZQCB 3LQQA 4IIVA 3OFKA 3EGOA 4DDVA 3IFSA 5JLAA 1MQ9A 4NDNE 1PHRA 4S24A 5FB3A 2HPAA 4DHWA 3ILXA 1B4DA 2AGVA 2C7RA 1NLUA 3VKWA 4GVPA 4AZ3B 1QZTA 4F2DA 3OM8A 3ENKA 3M4XA 5AESA 2Q9AA 3RU9A 2FLLA 4DJ5X 3AONB 3SGLA 1P74A 4XJTA 1U2RA 3MGCA 4CC5A 2YY7A 3A1FA 1OLXB 1XQXA 4EJMA 2X8JB 4QSHA 2R3SA 4EHJA 5BQ3A 3G85A 1YE5A 2HLPA 2WZCA 4EKEA 1JEEA 3RU7A 3O91A 3UKDA 2COGA 3EA0A 1I2LA 1ISJA 3QU4A 1MA0A 4JJ8A 2JEZA 1FLAA 4BKQA 4GSKA 4O4IF 4F4DA 3LLCA 2R6R1 3RVPA 3X2FA 3E2MA 5L3SB 1C7ZA 3Q8KA 1W0JD 4N9WA 2E37A 4H4EA 5A0TA 2GNOA 3Q98A 4R69A 3K31A 3K94A 3X1MA 4DIFA 3GIDA 3U4IA 3WIDA 3TW7A 4ZV4A 5TT1A 1LZKA 3TBFA 4B3CA 2EL9A 2RHJA 1BYUA 4MV3A 1DWPA 4BQOA 1T3LA 2AF3C 2BL4A 2WYIA 3MUEA 3E3MA 1V51A 2V45A 2XUKA 1QQTA 4L07A 2JA5G 2GMWA 1BE8A 2IDJA 4GKKB 1SCQA 4AROA 2UZ0A 1LDGA 1XAIA 2IA6A 2WRZA 4YP7A 3T7AA 1G8HA 1A95A 2FWNA 5B6IA 1Y4SA 5G0TA 1K6IA 4YBRA 1D2NA 4UARA 5FXMA 1JEAA 3QW4B 4ND5A 1O57A 2HBYA 1D2MA 1QRTA 1WZCA 1VGQA 2HRRA 4LOKA 4K03A 4BO4A 2E21A 4Q00A 2W6QA 2NO7A 1YS7A 4UCXA 1UAGA 4AJJA 4DPKA 3LHFA 2NX2A 2QW8A 2ORED 5K8LA 3QXGA 4NPCA 1S0UA 2NU8A 2CUKA 5HS6A 4DQUA 4B4KA 1N5IA 4JP2A 4TMVA 4Y2QA 2ECPA 4M8LA 3I52A 2JEGA 4ZHQB 5EPUA 5T8KA 3RJ5A 4AI6A 2GN4A 4XM2A 2ZSJA 3TQCA 3A9CA 4LFCH 2EX4A 2FSPA 4RH0A 4FP9A 1A1VA 4YCLA 3CX7A 1XD9A 3WK5A 2IH2A 3QY9A 4ZDWA 3B8HA 4D9NA 1MZVA 1QLWA 2YN2A 2VP9A 1PZXA 4M1EA 5AK6A 3FFBA 1W96A 3AUUA 4P92A 4WWHA 4RIEA 1V4BA 3VYTB 1UFQA 2X5JO 2BRUC 1KBOA 4GOJA 1R6TA 4G36A 3UYKA 1K5DA 4HJXA 1TT7A 1AJEA 2I91A 4BFZA 4UCOA 3UJ3X 5KTPA 2IIPA 4O4HA 4P7FA 4YQWA 3OE7A 4B81A 2Y77A 1WDWB 1UEXC 1ARZA 1KFKB 3HL0A 2XCIA 3HCFA 1EDEA 4HDKA 4B5LA 3T5DA 3KJEA 2V9WA 3TFWA 3UPUA 4C7JA 2I4OA 4UJ3A 3VBEA 4PGFA 5L3QB 1PNRA 3KHTA 3QFHA 4OQZA 1DC6A 2C0QA 3HPQA 1X70A 4DVJA 1HEUA 2PGAA 1UKEA 1LVGA 4Y6RA 2JA7G 1IOWA 2G0AA 1JHVA 2XUIA 4V02A 3BMOA 4IBOA 3P4UA 1VMKA 4NFLA 3AZQA 4YS6A 4CN8A 4R98A 3H86A 2H31A 3RWOA 3GLIB 4XQ9A 3WSTA 3TL6A 1LNQA 2J3HA 3AI1A 3IVAA 3WLJA 2IYVA 1FFGA 4CL0A 1QRUA 2P9QA 2YMMA 5M04A 3U3DA 3NV7A 2C2YA 1YVEI 1F2UB 3O95A 2BM8A 1PLLA 5DRTA 1QMGA 4TMXA 5IYZF 5B36A 4KDEA 1CS0A 3QEBZ 1AUXA 2ALJA 1YVUA 2XIJA 4YP6A 3MWGA 2ZYDA 4Y1FA 3M4JA 5FD8A 2JBHA 2PSJA 3OEHD 4O4IA 4O2AB 3RFCA 5CB4B 1Q15A 3EODA 1ZUD1 1JYFA 1RQXA 5LOVB 3JSLA 4QUDA 5J4LA 5K6RA 3FW1A 4M0EA 1YA6A 3HACA 2JLBA 1SZCA 5AVWA 1T5TA 3E9ZA 3VX4A 1E9SA 5LMCA 3I9JA 3JD1A 2WHPB 3DYBA 3VVBA 3NUQA 4ZVQA 1K8QA 2ON6A 3MT7A 1YDEA 1XTQA 4R7ZA 1AO0A 2W57A 2O7VA 3IMGA 2R47A 3QOYA 5IANA 4E6PA 3NHPA 3CE9A 3MFHA 4UE2A 3BQ9A 4LXHA 3PRHA 2Z8YA 5BQ5A 1U3UA 1E7SA 1NSFA 4RU1A 3PTAA 4IZIA 2EEPA 4O1MA 4WDRA 2W2PA 2SBTA 3LDAA 3VSAA 3HFRA 3NG1A 3GWZA 1YC2A 4C21A 4CCYB 2QLNA 3H1EA 2CXSA 1VPWA 4FB5A 1KIAA 5KTRA 4G2TA 1B3RA 4AQYB 4FU0A 5TEWA 1PGNA 1JHXA 4FS3A 1NVFA 2DTDA 1T6ZA 5JSUA 3BHNA 4ZIRA 4A5SA 3K5PA 3AWIA 3WIBA 1G21A 2XUDA 5LJIA 1IOLA 4XVCA 3WMEA 3NU1A 1T1IA 1Z63A 4I2NA 2F17A 4CL2A 2PZAA 1I2BA 3SS8A 5CM0A 4WZAE 5THQA 2EP7A 1AZTA 4A3GG 3SKVA 3IAUA 4O29A 3ECAA 3U6KA 4Q1EA 1FRNA 4Y0VA 4P8RA 2BEWA 4RD3A 4ZTUB 2GDZA 2C2OA 3D8RA 3UCEA 1FIUA 1LKZA 2FWBA 2F3PA 2WYHA 3M6IA 2C1XA 1ATZA 4JGBA 4TQ9A 2VJPA 3A0UA 5AVOA 3LCRA 3KJZA 4FONA 1X7YB 1BSVA 4TSKA 4GX5A 3BD6A 2EKLA 3BJEA 1DUIA 1PNQA 3CHYA 5BVHA 5CA1B 2FZ4A 3O7WA 4FQ5A 5EXTA 5KFXA 4KIFA 3DOEA 4IFIA 1DX4A 1P16A 3LNTA 4F3TA 4WN9A 1TO6A 3UQYS 5ESXA 3R5HA 3ZVRA 1U7WA 4PO1A 1FVOA 1KH3A 1J21A 3N6XA 3UUFA 3SVLA 1UKVY 1DKRA 2RHCA 3JYLA 4EY6A 4CNQA 5AUOB 3COJA 2E4ZA 2CF5A 2CDRA 1CQIA 3E5RA 4YXFA 1PX0A 5EJ9A 4UTZA 2O2JA 1SXPA 4MO9A 3HP4A 5EMJA 4RF4A 4ZRDA 4Y1RA 3W77A 5T4EA 1BDBA 2RE8A 1CIJA 5AVYA 5TJHA 4E2XA 1X9GA 3NC0C 4GLFA 2JBWA 4UM9D 3JAKA 2VI5A 2AMFA 3R3JA 1XDNA 4OYLA 4GYJA 1Y6GA 3K2BA 2VJMA 4BAZA 3RKSA 2QMOA 3WLOA 3PC6A 2WU0A 5CVCA 3BJMA 3HYTA 3UJPA 1DEHA 4MPDA 3KDPA 1BW9B 2W00A 3DBRA 4WUVA 4JI7B 3PUJA 4AFNA 1PO7A 3CNQS 3LWZA 1PT8A 4O83A 1A7KA 4PGHA 1YZHA 2C35B 4J76A 2OHXA 2FJZA 1C3OA 1FQWA 2COKA 1AB6A 2VATA 4E5NA 5BWCA 1P4GA 1TVEA 1TQDA 2JIDA 3BA9A 4LJLA 1OASA 1SCUA 3KT8A 4MQ5A 4TTVA 3RSHA 5CK4A 1B8PA 2PFSA 3G1UA 2FRDC 3NS7A 4OK6A 5HM6A 1PYOA 4DPMA 3FUUA 5CLQA 3VR5H 2O23A 3JQCA 1ADJA 4RUAA 1Y1TA 4PIVA 1H94A 1M8FA 3ZY2A 3IDQA 1UBHS 4AJIA 2BQRA 2Q5LA 4HVAA 1YB2A 1J5EB 4YHHH 1W75A 3KKNA 3W06A 5L51A 5FRDA 1XP8A 1YS6A 4RQTA 1JZSA 3RAEC 5E8JA 5BUCA 3MWMA 2XDQA 3HT5A 1HDIA 4ZHQF 3KOUA 1VPDA 1B0PA 1PSDA 3EGDB 3MM4A 3S1LA 2DQYA 9LDBA 2XEXA 5H80A 3H5LA 4Q37A 1MZBA 4WVFA 4CBVA 2BM0A 1KEVA 3PBKA 3B1YA 1E2PA 4OLJA 1JE1A 5D00A 4YDHB 1SOVA 2YH2A 1ZQ1A 3WWEA 4BO8A 4FHEA 4R3NA 4J0JA 2NP6A 3F6SA 5KYUA 3ANLA 2BGRA 3AIIA 1IONA 1C81A 4R81A 4MQMA 4PTYA 1OZAA 4CMBA 3I61A 4HNAB 1SG0A 2ZM6B 2PSEA 2O2YA 2GCGA 2V3VA 5IASA 2NSYA 4DDMA 4AQ7A 4D92A 3GH3A 4PWZA 4XIYA 4KIGA 1FB5A 2DBZA 4DR2B 1Z6PA 4IFBA 1Y3BE 4EF4A 1CHNA 3O4VA 1ZHOA 421PA 3UHPA 2RMKA 3H9BA 3RJ0A 4Q05A 2B63A 3SEZA 2AE2A 1JSXA 5A9SB 3QKSB 1NVVQ 1WCYA 4AZ3A 1Z0UA 4ZRMA 4P4TA 5E2BA 4NQRA 3E84A 4F5YA 3KL2A 2PLFA 1HG0A 2LP4Y 1SVLA 2Y0BA 1NRIA 3ZX4A 2EL7A 3ITEA 1OLXA 1A9OA 1M2HA 2A3RA 4KJXA 1KK3A 1TCUA 1FOEB 2OXCA 5JHGB 3T5BA 4Q43A 4EJ2A 3BMXA 3HBLA 2PT5A 3HCEA 2BFCB 3KQQA 3TG8A 2JFYA 5AHWA 1N2CB 3OOSA 2DSTA 4YT8A 3DGEC 3NB0A 2HU5A 2XHZA 4LJ7A 2O06A 4O2AF 5IT9A 5CB4F 4DXHA 2V98A 3ZWNA 2OFWA 3I9FA 4XLLA 5LOVF 4RIGA 1RHRA 1JR2A 5L3SA 5IS2A 1TADA 3O8DA 3URMA 3TL3A 4HD8A 2JFFA 2K4MA 2QY9A 3HADA 4J9PA 2G1JA 3T52A 1KP2A 3MCZA 4A2AA 5J58A 3HP1A 2OV2A 2GS9A 1NNSA 3OTGA 1V0JA 2I1LA 4G24A 2HG8A 5EHGA 3KEOA 1AQJA 1WUHS 3C3CA 3PG5A 3IHTA 3O4GA 1E6LA 1GZ4A 1NN3A 3CVOA 4NBNA 3IODA 3I2YX 1JRLA 5CH5A 4EHHA 3QV2A 5IAOA 2IOFA 2GCEA 3LP8A 3MR5A 1CB7A 5E7IA 2FQYA 1E2NA 4U0KA 4IUCS 3GCXA 2V0CA 4KJZA 1M1YB 1XZKA 1UPXA 2OGWA 3CWQA 1K8YB 4DR3H 1NW8A 5T4FA 1ACJA 5CLGA 1OF1A 2B98A 4V0NA 3WYBA 3LUAA 2WU4A 1QOZA 3CIOA 5AQ1A 4CMIB 2QORA 1VPLA 2I8AA 1QYWA 2IGBA 5I7WA 1Y0BA 3T9BA 3KYHC 4ZPJA 2NV6A 1X1CA 2IZ1A 3I30X 1MB0A 2EFGA 3V4OA 4DMLA 5IT9W 2Z08A 2X2EA 1GTRA 5IEJA 2ZJZA 3GCGA 3L9XA 1QV6A 4IIDA 4F38A 1JWBB 2Q1SA 1FUEA 4ER3A 3SZOA 4D02A 3DT8A 3LT2A 3PE6A 3ZBTA 1CC1S 4WJZA 1UC9A 3DM5A 1TO2E 3T9FA 3GB9A 1XK7A 1YA8A 1NVVR 5FWDA 3P8ZA 4Z9YA 2JA1A 5DBGA 1JXQA 3L05A 2AHRA 2HV9A 3TE6A 1FX1A 2KYRA 1YRWA 4EJ0A 3FSGA 2D1QA 4ZVVA 2WG0A 1NX6A 3MGAA 3MGBA 3L8ZA 2V6IA 2J7PD 3Q7IA 4D9HA 3VR4A 2DSNA 3FGOA 4ZJZA 5CA1F 2XQVA 4UBKA 4X65H 2J0EA 1E2IA 3ZY6A 2F3RA 3N39C 2F7SA 5CDTA 5IEBA 5L3QA 1GKYA 1RXSA 2QM3A 4JJIA 4O84A 5KFMA 1YR2A 4BDTA 3GIJA 2Y1CA 3MBIA 3MFIA 3FKSA 3L0CA 1VS0A 3IUEA 3F6PA 4UPEA 3GLIE 1VKHA 3G8DA 4AYXA 3Q2IA 4ACBA 1YR8A 4F93B 3CRW1 3QU5A 2UYHA 3UFBA 2I99A 1KJWA 1JDJA 1RYEA 1SY7A 1QM5A 3TO5A 2R4TA 1A9PA 3WA7A 2ACEA 3JQ9C 1JFFB 2ZKIA 4DLYA 1ADCA 1OLSB 1Y33E 2R8IA 4NEQA 4G26A 4PG4A 4ZRNA 1F2UA 1MC5A 5JZMA 5DB4A 4QPCA 3GZTB 3IAM1 2RIPA 3I4NG 5FA6A 4DR5B 4HCJA 5ALMA 3S1SA 4MV6A 2RGAA 4X8LA 4YCSA 5A0VA 2VDQB 1RKQA 3QEKA 3FTNA 1N5KA 2IEGA 3ONNA 1NPDA 4JN6B 5L7TA 4J0IA 4B82A 2WFAA 2IRWA 3A1CA 3TE7A 3L82B 4O2AA 2H2HA 4KL8S 5CB4A 2JRCA 4P7JA 3M8KA 5ITZB 2WVJA 4COKA 3E7PA 3VTZA 4L0CA 4PSUA 5F2NA 2OBMA 1IZ7A 2JC3A 2C96A 2JFPA 1R64A 1JVSA 2P8JA 1ODJA 3TQHA 4WERA 1SAYA 3TFOA 2ZR7A 1Z0SA 1A8SA 2YQZA 3LT5A 4EHIA 2IJGX 3T5HA 2IKSA 2WQZA 5F7XA 2WHPA 3JYHA 1P7ZA 5EFOA 1N5JA 5FO0A 1FE8A 2L82A 2J41A 3DLTA 3DNMA 1C80A 2EBHX 3DE4X 2HUPA 3DUFB 1TTQB 3HBJA 1G98A 2O8NA 5EIXA 1V9CA 4ZAGA 2CZCA 4HYQA 4IUBS 3JASB 3KSBC 3R74A 3ZEAA 1GPUA 1XLVA 2F43B 4JT2A 5F98A 2WMNB 1KOGA 1N36H 2K7ZA 5T3UA 1GPH1 3NGXA 2HGWA 3JVEA 1YOVA 4CCYA 5EPEA 4B34A 4Q9AA 1KE2A 1GUDA 4N39A 5HE8A 2KQUA 4J9KA 1FDOA 2FUEA 1U5CA 3HS3A 2FPKA 1VL5A 1YZYA 4INZA 4QEZA 4YB8B 2UAGA 4JI4H 1CUUA 4DLKA 3KG2A 4F04A 3KNZA 2WE8A 2R66A 5HUJA 1GPJA 2Q1WA 3KKLA 3K9FC 3DE2X 3RYCB 4M22A 1KVSA 3QYAA 5HV6A 3LP5A 3K8OE 2VHCA 1ZIXA 3JCZA 5ALRA 3DOIA 2IBSA 2XGQA 4GGOA 4Q01A 1SIOA 1N9GB 2C4VA 3I58A 3JQPA 3B3FA 1YB5A 4OATA 4KDFA 3NMUF 3U17A 3AF4A 2XUHA 2IEDA 3DV9A 2C83A 1TM1E 3OTIA 2W8BA 2VRWA 4DF3A 3HUEA 3R6TA 2PUGA 5CLHA 2UYQA 3G0OA 5CA1A 3SNOA 3TSZA 5C44G 1RLUA 4I2VA 3IEVA 4UULA 1NNLA 1U9IA 2PJRA 1QPGA 3ESAA 3HXKA 2PBRA 4M9UA 3IB3A 2UU9H 3C1TA 2BEKA 1WSCA 3FH0A 1QO9A 1JG1A 1NX9A 4KQ6A 3ZU2A 2GTPA 3R44A 1QUFA 3I2IA 2R1ZA 1YS9A 3C15C 1P62B 2QL6A 4RNDB 1RZ3A 5F51A 2NU6B 4JU8A 4F5ZA 1CQPA 1DJLA 3IHLA 3EF3A 2RGBA 2VQEH 4YMTA 1QHIA 1JHZA 4Y2YA 3A2KA 2WMYA 4ZGBA 2PNFA 2XHEA 3BAAA 4M0FA 2ZWIA 2YRXA 4IEFB 3BYZA 4U9UA 1BCRB 1SPBS 1N1GA 4KAFA 4MW7A 1SVUA 3DE6X 2AWNA 3UZUA 5IWCA 3UEOA 1CT9A 5AJUA 4E11A 4C01A 1L1RA 3ADPA 4D4IA 3V9AA 4H0CA 2GD0A 3LWNA 2BGWA 1Y4AE 4HLNA 3DKIA 3A9VA 3IILA 5JAMA 4F11A 3N2YA 4EI7A 4QFMA 1R0KA 1I3QA 5DISB 5PNTA 4HRAA 2ODNA 1PDVA 3K30A 3UMFA 3E7DA 4FZJA 4TVKA 2IHTA 3SXJA 4NWIA 2QRVB 2IXDA 4JLJA 1YACA 4E5SA 3IPAA 1CEEA 2AUTA 4KVAA 1OX4B 3HGMA 3RTCA 3KXKA 4X7MA 1AN7A 2ACKA 2BUAA 2WE6A 3ETGA 3GGGA 3T7DA 4IOLA 5E7QA 1UFKA 4A6DA 4AKSA 5HUQA 3T1TA 1MDBA 3GWGA 4RWZA 3FCAA 1NJ5A 1INLA 4IIHA 4MKIA 2II6A 4BV2A 4E22A 4L5BA 5ESDA 3OJEA 2RAFA 4R8UB 4R0VA 2ZBRA 1CFJA 2PM8A 3C0FB 2R9VA 1S8AA 1H65A 4BDSA 3QQMA 3HOWG 2FW8A 1XQ1A 5FO1A 1SA0B 3TTSA 1CUBA 3EGDA 1MV5A 3PW7A 2QHXA 3LUBA 4KGDA 5ALZA 2AC7A 1W8DA 2XF2A 5KYNA 121PA 4JGGA 3SNKA 2MINB 3B9RA 5LL6P 1OU4A 3TM5A 1L5YA 3QSYA 1JJVA 4C6SA 4L08A 2YXDA 3ABSB 4MS3A 2HMVA 3ZZUA 2RGVA 2VUMG 2NZWA 3VHXA 2XTMA 3K0SA 2G28A 1FFCA 3PC4A 3GD7A 5TGZA 1OZGA 4K0KH 2JLCA 5E4TA 3E9CA 3QUTA 1JXMA 7AT1A 2XMCA 3SJ7A 4C43A 3WDKA 3TKYA 4D5GA 5I5XA 2HVSA 4G5HA 4HNAA 1ZOIA 4A0QA 1J8FA 3CLTC 4YI5A 1YI0A 3WRWA 4ZWNA 3MRXA 2OHGA 3N28A 4BP3A 5IXJA 4TQSA 1GL3A 2RSLA 2V9CA 3HCCA 2A33A 1UBEA 1JKJB 5EP4A 5KFPA 1V45E 4BEVA 3RYHB 4ECZA 3W6UA 5D85A 1P2VA 1N6OA 4PYRA 1P45A 5IABA 3GQBB 5BNWA 4OFZA 3IAAA 4HADA 1PQWA 3HDQA 4O3MA 3QKSA 1IUPA 3NTVA 1NP6A 4MR7B 1OIXA 2H7VA 3TDKA 4FKZA 4LF4B 3RAGA 4LTNA 3V8RA 1AKYA 3LCJA 5J59A 1V7PC 4FZRA 4OCZA 2VT7A 3L7YA 1GNLA 1K1EA 5I9TA 5DHUA 1WDTA 3NYIA 4KFRA 2OHJA 2I8CA 4DV1B 4U5QA 4E4YA 1ZOLA 3TTWA 3X2EA 1CVLA 4Q3CA 3U48A 4W6QA 3RODA 2WM9B 3H84A 1QGUB 1N2CE 5CFLA 2J4CA 4BCBA 3VNAA 1KDZA 3L0DA 2I4TA 2VSOA 2R7ZG 5FX2A 3T1NA 4YH1A 2CVPA 4DSAA 3BEOA 4AY5A 4QBGB 2XJ4A 2GAIA 1I32A 3FNRA 2JLSA 4UHBA 3L4BA 3Q8RB 4PONA 3NHFA 2WHQA 5DH9A 1YKFA 1G8PA 1Q77A 2NU9A 1RM3A 4M83A 2C29D 4URVR 1NVEA 4P3YA 4YQFA 2C8VA 1SKYB 1S1CA 1CUSA 4RMNA 2ETXA 3ZI4A 1QWSA 5A1JA 4LFBH 4QQ8A 3TDNA 1WL8A 4JGIA 2CN1A 2F59A 1E2LA 4HAZA 1NGSA 2O48X 4TYWA 3TLYA 1VJGA 5HNKA 3U4QB 2ISQA 3U49A 3HO6A 4QYWA 3V48A 5LIRA 3EIEA 4NU0A 1N6LA 3EG5A 4O1IA 1M1YE 5BWBA 2DKNA 4PVCA 3N5KA 3CBQA 5HCIA 4ZT5A 2Q6IA 1M1YA 1CJCA 2Q99A 1FP4B 2CNDA 2NPOA 3K2EA 2X2PA 3SEAA 5BW4A 1KTAA 3RAQA 1N34H 3DVQX 4UBIA 5IJAA 1C3XA 4BNMA 3BXEA 4FC6A 4S12A 2VHJA 5JPDA 2QEQA 5EJ5A 4RZIA 4CMIA 3SBOA 1FUKA 4CR6A 1BN6A 4JT4A 1D2RA 2ZI9A 5IAKA 3V4FA 3U5TA 1WULS 5DHAA 4NHOA 1KJNA 2VUTA 2VQFH 4W5HA 8LDHA 3M4ZA 2RJNA 2YXPX 1EFRA 3HA7A 4NAUA 1Y42X 4CU5A 3TSWA 3CINA 2RARA 1HDOA 4U6PA 2GN8A 3RLIA 5A9TA 1G63A 1QCYA 1KZ1A 1RCTE 3SJCA 2PMFA 3G82C 1P0QA 4A8TA 2P1ZA 4FZVA 5FA8A 4W4TA 2Y4NA 1RQLA 3TOSA 2IOFK 2OK7A 3N0XA 3ZKWB 1LLDA 4MYTA 4MQEA 2I1VB 4P93A 2D2IA 2G4LA 4WOCA 4G5RA 5KFWA 1KO7A 5NLLA 2E6KA 4UOQA 2TYSB 4J0EA 2R6GA 5FEUA 1XXHA 5AK3A 4B4OA 2EW1A 3IDZA 2CUZA 5FV7A 1DS6A 4AULA 1ENPA 5JJBA 3I09A 5FOUA 3RRFA 2YS7A 1L5HB 3L6CA 1MUUA 1H5UA 2E18A 5TXGA 4LUCA 2Q5HA 4KSYA 2H65A 4UAGA 1NMYA 1L5FA 1G7RA 1G3IA 2GBLC 4WL0A 4CDRA 5DGAA 1OFIA 3DDZX 2PPLA 3V8VA 1RHMA 5BR8B 4NXNB 1EX1A 3U09A 1R4AA 1SB9A 2V7WA 4MVJI 4WSOA 3AUKA 4TVIA 4HWGA 4P08A 5SZHB 5EKTA 4D80A 1QVWA 2FR8C 3FR8A 1W35A 3C43A 4LFAB 3QWUA 1JFFA 4QIWA 1GP2A 1OLSA 4F1KA 3RTXA 4R2WA 2QRUA 1NWCA 1ZJYA 3DZKA 3UZBA 4FT4A 4INAA 4OV6B 3IOBA 1RPTA 2FWRA 3V8BA 1Q0PA 2R6CA 1JS1X 2Q45A 4PO8A 4CXMA 2WIAA 2NV2B 1DKOA 1KK0A 2H3EA 2J9XB 3OJOA 4US2R 4UVEA 1YZGA 1II0A 2I6FA 5CB8A 1XNHA 3LUKA 3ZXUB 5ITZA 4PS0A 4CKZA 4KR3A 4UHFA 3LX8A 4UEWA 3DO6A 4F21A 4JVOA 3S1AB 2WHRA 1ZZGA 4WNCA 3NVMB 1N3BA 3H2KA 4QM7A 2DFVA 4PYKA 3UXMA 3RFUA 1HL3A 2C3MA 2BM9A 3CVJA 1V37A 2CEAA 1FEZA 3ROEA 4ZVPA 1FNCA 5TGDA 5IYZB 1JEYB 3ND7A 3O31A 4N48A 3O1LA 4LBYA 2IPNA 1XAHA 1V1RB 3GRKA 3MYRA 5JDCA 3WGGA 2OXTA 1YMUA 2P77A 3LY7A 1EP9A 4L57A 5K3AA 2P9FA 4Y30A 2JIRA 1PTJC 3UMJA 3OO0A 1PJTA 2CXPA 2OHHA 3KIPA 1YU9A 2C07A 2F43A 2GGSA 3LW8A 4BB6A 3T6KA 4JVSB 3GAFA 4QXOA 1SC9A 3QU9A 1VBMA 4MVWA 4UTRA 1C7FA 2JVJA 2B99A 3IUYA 4FYIA 1QO7A 4J16A 1UXIA 4BO7A 3KYJB 1FW6A 1RC1A 3H17A 4ABYA 3RBAA 1Q5PA 2X8BA 3RTBA 2X7HA 3N87A 3FYCA 4KN5A 4XAQA 4YB8A 5EXDA 2XMPA 5KO2A 4L5JA 2VJKA 1Y37A 5I5GA 1XRQA 4NE7A 3AW9A 3RYCA 2GVNA 2B4AA 3MEQA 3FI0A 5TF4A 3EF0A 3E9QA 4HP8A 1XMIA 2FUG1 3CBGA 1N9GA 2A92A 4RZXA 2D7CA 2Z4SA 3ECCA 5ADWA 5DLYA 5FLKA 4FC7A 1ZH4A 3MGKA 4DSOA 4TTTS 1XDBA 2HMTA 1V43A 1AMOA 4GI5A 3O38A 5DG8A 4I4LA 3ZLUA 4RNCA 3BE5A 2CDAA 3D1VA 3OHAA 5DVZA 2YOGA 2GYYA 3AU9A 2RI1A 1BD3A 3IMFA 4J75A 1AK9A 4Q18A 3D0QA 2QZSA 4YREA 3IUNA 3VO8A 1BZYA 2GFHA 3PNQA 1TJ5A 3UJ7A 3ENVA 3KHHA 2AXPA 1MAUA 2XD4A 3JSNA 5C32A 3E9MA 4BO0A 4N54A 4CQLB 1CKOA 1JA9A 2ZIXB 1KK1A 5A3QA 2PMEA 2QUBA 4BMYA 2UDPA 4HUJA 1FDVA 4Y9SA 1W48A 2QXTA 3IDSA 4PYOA 4J9OA 3SC3A 1LUAA 4QFDA 5LYJB 3OZXA 2AOXA 2HTFA 1HFWA 3NIGB 3RTAA 3H2IA 1M2OB 3HJUA 1T4BA 1LXCA 4RUCA 4BLSA 3TVDA 3UAZA 1KVRA 4X91A 4IV0A 3Q1KA 2FUNB 2JF0A 4B3MH 2UYYA 4UEKA 2NW6A 3RBDA 1R4MB 1WKVA 1R15A 1FXWA 3ZHBA 5F23A 3PO3G 1FZQA 4NJOA 1Q0RA 3LOQA 2QAJA 2IYOA 4FM9A 2VSYA 2X4DA 2KM1A 3A6EA 2W6JD 3Q8XB 2QRVA 3VR2A 2FJPA 4LQDA 4KX3A 4KHPH 3N6VA 4X8HA 4Z8XA 4MTDA 3U81A 3B89A 4JI5H 3QQPA 4U2BA 4N40A 2YMPA 1N2OA 2NXCA 4DRYA 4WGFA 1HFJA 1SURA 3I62A 4DDWA 1UFVA 2ZR9A 5DP2A 1NLYA 4NBUA 1YE8A 3MMZA 2OFOA 3K8QA 1HSZA 2PG3A 1QGAA 3FWHA 4PSVA 3V7UA 1NLZA 1P75A 5H4HA 1PGJA 2EIXA 2P90A 2NZ2A 3PV0A 4TKUB 2WTXA 4IUYA 1RIFA 5KTKA 4XVUA 4R8UA 1HGXA 5HQ3B 5KMGB 1ULBA 3BXXA 4BNNA 5EFZA 2HNAA 1GO3E 2B5OA 2VPPA 3T34A 3WFIA 4MMXB 1G8SA 1YQGA 4L1KA 1E63A 2VSFA 1SA0A 3C4QA 2JGKA 1QGDA 3ENZA 1NLFA 2J6TA 2W5UA 5EPOA 2I6GA 3W9UA 1F2DA 5JJKA 3G79A 2XBLA 5YASA 1DJOA 2CXRA 3GYBA 3DC7A 2C4TA 2R62A 4L85A 4NPAA 4X20B 2JZCA 4EPRA 2C3YA 3DQQA 4RW0A 4EA9A 3OMXA 2MINA 2V3WA 1SHTX 4CU2A 3CVXA 1NMSA 1NVWQ 1KMNA 4CWAA 2PZLA 1JDNA 5KVSA 5EJAA 1T24A 1GQYA 2PN1A 1KVQA 3IEKA 4Y9UA 2HK9A 2M6RA 3HCBA 1XHLA 5CLJA 1K5PA 3AVTA 3ADCA 4AO6A 2AFHE 1QHEA 4UE3S 3HOZG 2CW5A 3HGTA 4ZZ0A 1DAMA 3TXXA 2QRKA 1PJ2A 3C1UA 2WM2A 3BTOA 4AZ0B 2MWMA 3RS3A 2R97A 1GN9A 1U63A 1ZD3A 3ZCSA 4XX0B 2ZTSA 4XA8A 5HIJA 3EC2A 1JKJA 1UPTA 5I8PA 5LZ4A 3RYHA 2ATIA 3FPGA 4PCVA 2WPNA 2C7PA 2LXNA 3LTNC 5HF6A 4EEYA 1Z07A 5BV1A 4BPBA 3EZ9A 3GQBA 2ZIVB 3OLWA 3AF5A 1XDDA 4GVLA 1RW4A 1IEVA 2QIOA 4UQOA 4JITA 3K5HA 4Z9FA 4MR7A 1XA3A 1O97D 4X1IB 4FCWA 3DEZA 5KC9A 2XUZA 2ENWA 1OYVA 3ICCA 1JFVA 1C4OA 1AMNA 1XCOA 5J5CA 2R8JA 4JK3A 3GCDA 1P0FA 3C8UA 3H2YA 1TYZA 3PTLA 3RFXA 1VJRA 4UTOA 2XAUA 4OMUA 1NZDA 3O83A 1N33H 4NXMB 3CUKA 4RK4A 3WNCA 3ETNA 3GLTA 1QGUA 2O5EA 1H2XA 2ZDGA 1NDHA 3WLRA 2IDMA 3ITNA 4N0MA 3MS2A 3H20A 3IBGA 5ALLA 2QRMA 5K0BA 4B2IA 2WD7A 1YUNA 3MQFA 1AKNA 2P30A 5E38A 3E3LA 5EJ7A 2JJ8A 1VE1A 2C5SA 3FTEA 3M3HA 5ALQA 1Z06A 2E4WA 1Y14B 1DXQA 1WSWA 4R8RA 5ES3A 3QI7A 1N5MA 4IILA 5SZIA 4U7FA 4ECRA 1SKYE 1NBHA 4I6JA 4TVSA 5HOEA 1S9FA 2ZCUA 2AG6A 2VWHA 2CLDX 2JHAA 3PF9A 3JR7A 1CHDA 3Q87B 4RACA 1XKLA 2V4ZA 2OCKA 5DM60 3CUTA 1Y1VG 3MRTA 3TJMA 4N0EA 2WZQA 1KQOA 4IJUA 3KOXA 3IKVA 1N2GA 4G1MB 1KY2A 2VQ6A 1SIWA 3CTPA 2YRWA 1N1MA 3FRHA 3L8GA 3L6OO 5KNLA 2WC1A 1CRZA 2Z9CA 1ZGGA 4CF3A 3ZDCA 2MSLA 4D9MA 4I7HA 1I2KA 2I71A 3FJYA 2XCTB 3ZWYA 1EWYA 3HBNA 4QL3A 2HSDA 1XTRA 5CIWA 4A3KG 1QHHB 2G9QA 3BQ1A 4JV0A 3D3WA 2P9YA 1WRBA 2ZE7A 3OIDA 4HH4A 1QHXA 2XB8A 3GLUA 2WAQE 5TARA 5C1IA 3ZIAA 3R9WA 1K7SN 1MR3F 1QTIA 2D5CA 2ZCVA 2WAQA 4UFNA 1A2OA 4WTOA 1W5SA 2FFQA 3TEJA 3DXYA 2AR9A 5IU6A 3BOSA 4B6FA 2XBMA 1XPJA 2ILTA 3NCHA 5IVDA 1I2CA 3PF8A 5EY5B 5JRJA 1HLPA 4XI9A 1DVRA 3P9KA 1GZ5A 1Z4NA 1ZUWA 1DBQA 4A3LG 4M1TA 3T3NA 2FU5C 2YZKA 3CLRD 1DC7A 3A14A 2XGGA 1ITZA 4NNJA 4DV0B 3AEUB 2RHLA 5F2EA 4LX8A 1FDTA 4KE9A 3HM2A 4JLPA 5GTDA 5IKXA 3BFPA 2IXFA 2WJZB 1EGMB 2QJWA 1CUCA 2XNSA 3SY8A 1AKTA 5K0CA 3BQ0A 1RKBA 5EWMB 4YUAA 2CK3A 4EG5A 3T12A 3I9V1 5DU2A 2JA8G 4UNSA 3F46A 3CMMA 4OXYA 3VM6A 2WYWA 4HQOA 2V5UA 2EZ8A 1L5HA 5ALXA 4TM7A 1Q1ZA 4IQ4A 4HQRA 3UOAB 3X0DA 4WZAA 2ECKA 2OWDA 1OXKB 2IITA 3P45A 1ZJJA 3RFFA 3JPWA 1FYXA 3VVMA 4ALKA 2W6MA 1P1BA 4QGAA 1YL6A 1KMCA 3MUNA 3VYWA 2JIOA 2RK4A 3N8IA 1TECE 4B4DA 5LYJF 2RH8A 4PG7A 2MIIA 1AN9A 3WQRA 5CYOA 4D79A 1QF6A 1LI4A 2GT1A 4W1QA 4JBYA 3KE8A 1IFXA 5A7HA 2R44A 4HMQA 2WJVA 1KEKA 1G55A 3KXIA 1B1CA 4OX9B 3DJFA 3OBIA 1Z7YA 3TSOA 1R0SA 2C7QA 2IC5A 2P9EA 3QE9Y 2XW6A 2Y27A 3NRBA 5KYWB 1GO2A 3H2HA 3WGUA 5KG0A 1Z0IA 4IJQA 1U0BB 4IDDA 1RTTA 1FSGA 4MROA 3OT1B 1YL5A 2HHFB 1C8BA 2K2WA 3QZUA 5A1TA 1H9CA 3FD8A 4BCCA 4YT4A 4EUEA 3DZDA 2DHQA 3S1AA 4ZCTA 1A5AB 1U04A 4EL0A 3VDQA 2AMJA 2FPLA 3PI7A 1ZVJA 2XKJE 4RKEA 1S9HA 1TMYA 3EAQA 4H16A 5CPFA 4GSYA 1QHSA 3OZTA 2LBPA 3TOZA 1QVZA 5IYZA 2VHEA 2XCPA 3ADDA 4BU1A 1V1RA 2WT4A 3BWXA 2H1LA 1LV7A 3KALA 3LBIA 1EFKA 1FSSA 3I6BA 4GPZA 4RPGA 2IYTA 3U40A 3UKJA 2O4UX 2ZSBA 1XNRB 1PZMA 1Y1WA 1LK5A 5KZMB 4Q03A 5CB6A 6Q21A 2WVAA 3GDFA 1I8TA 4RTKA 4KKXB 2HSEA 1QP7A 4WY5A 3H0GA 2VHYA 5FBKA 2B0JA 1P0IA 2MR6A 3GLSA 3ZLTA 3I92A 1GG5A 2BN4A 2FSVA 3CF6R 1U7PA 1I4EB 1SN7A 1YB1A 4JI6H 4P4GA 2R60A 3QVWA 3BH7A 3PVXA 1K8ZB 4ESEA 2B82A 5F1PA 3PC3A 3PZBA 4E5KA 1DHTA 2EERA 3IEMA 2HWXA 5KSWB 3UV7A 4IJ5A 1YOBA 1KJ9A 4OHPA 2WJIA 1W581 2A5FA 3UHJA 4LMYA 5JVLA 4OQPA 3KK0A 3K4QA 2EKQA 3A1NA 4BP8A 3FDZA 5F9FA 3W7BA 1XPOA 3O47A 1EM6A 4IRXA 5TV2A 4X6XA 4N3BA 1EK5A 3ODGA 4K9MA 4JLUA 3K9WA 1JVBA 3CGWA 3RC8A 2H5IA 4HLUC 4R9VA 5C4MA 1TI7A 4DDUA 1RYRA 4B32A 3A9SA 5DK4A 1C5KA 4JUAA 3ZU3A 2O8VA 1SO8A 1GZDA 2J6UA 4ZU3A 4HXYA 4BZPA 2WAYA 2YX1A 1AN0A 2LNDA 2C3PA 4JWKA 3RK1A 2P5YA 1YS4A 3TZQA 2R92G 3PZRA 4L5CA 2ONKA 4O2RA 4H6VA 4B44A 5EJIA 2OHVA 5HGJA 3RRBA 1XKTA 4XIGS 3E81A 4NMLA 3PNSA 1OFVA 3UHOA 3U7FB 2EKBA 3B53X 2ZIXA 2CVHA 2FX3A 3U4AA 4GMFA 1ORTA 5B4TA 4F4ZA 4YV0A 1QFMA 2HD4A 2QG6A 1MJNA 2WP8J 1EI9A 2WJAA 1CP3A 1O75A 3O8BA 3HRKA 1MX5A 1YKSA 4XEHA 5A5GA 5F4BA 4UAJA 4X9XA 3GCWA 5LYJA 1CJBA 1F8FA 3KB1A 1J7JA 2WYUA 4F6RA 1SIBE 4GT1A 1M2OA 4GMKA 3HNRA 4LJ5A 1B6RA 3PL5A 2NZUG 4BFLA 3QX8A 3TR5A 1VSQA 3OM1A 2AZDA 5IDXA 3PNYA 5K3WA 3TF5A 5ITWA 3BQMB 1LDBA 5C7OO 5TPWB 5DOVA 4HMOA 2DWCA 5DYTA 1YZFA 2IXAA 1VE9A 4LYDA 3E61A 1MIOB 1DAHA 1ZFNA 4IS2A 1XMQH 3KV1A 1Z5OA 4MI3A 3P0HA 3AB8A 4YC7A 1A8QA 2E4YA 2DUNA 4D44A 4EKIA 4ARCA 2UZIR 4NEHB 5C18A 5E1BA 4YASA 2X8JA 4IWNA 1FFAA 2BJHA 1D0IA 4FE2A 5KWJA 3ISJA 4KQ1A 1XRRA 5LA6B 2YHUA 2VPSA 4LQLA 2JIBA 3T7SA 3ZW8A 4M76B 3M6FA 4NU5A 3WLTA 3B2EA 3ZTTA 5BWXA 4C4RA 1G4UR 3NVDA 5G41A 2GPYA 3S5UA 5BSUA 3HB7A 1V11B 4S3MA 4C3ZA 4ZOCA 3VZBA 2PMKA 5KAPA 1MKYA 2DRIA 4G23A 2EWVA 4TKUA 2XZOA 3K0KA 3WDMA 1VG1A 1CE8B 2XNDA 4JCCA 1V8PA 5HQ3A 4DA4A 4NIMA 3H3VH 1KERA 4CKXA 1P2TA 2XNCA 2Y1EA 5L9XA 5KMGA 1DBVO 2EAUA 4G9BA 2C5GA 4C1NA 3RC3A 2W90A 3ONFA 2ZYIA 1PHPA 4LIPD 3EBOA 2BTQB 3WIEA 1OV6A 2R1UA 1YVPA 1X87A 3JQ8B 3ELUA 1SC4A 1E5DA 3ZWCA 4S1WA 3CM0A 4FVTA 1GARA 3VFDA 2H07A 3A1SA 3IHWA 3NPMA 2DZDA 3RUHA 3O9ZA 3EJ6A 4I5DA 1Y5NA 2CKDA 4X20A 2Q0QA 5CURA 4ECXA 3ZHQA 3ZV6A 2V3CC 5AK5A 3IQIX 2VBGA 3ABRB 4A3JG 1I1MA 2OCLA 1KI3A 4E31A 2ZBFA 3DZIA 1AGPA 2A1UB 3JARB 2VOBA 3NUGA 5DHTA 5HFNA 2EDAA 5BUZA 3UT5B 3UK6A 1NW6A 3VAYA 5HJ2A 5K8VA 5FEMA 2VH2A 1KA9H 2EG9A 2W7TA 5EYPB 2QPOA 4U5XA 2AGPA 3BZWA 4GI3A 2JA2A 3FMFA 4PYMA 2DTEA 4DBLC 1J8DA 4A0RA 3JZAA 3PIDA 4Q12A 4ZHQA 4AZ0A 1L4NA 3BT7A 1CW2B 1XAJA 3V6KA 5LBUA 2H5LA 3DQPA 5DO9A 2DEUA 3HABA 1H93A 3JR3A 5I7VA 3MUOA 3USES 3ZY3A 2PZMA 2OORA 3V1LA 4B3JA 2HIMA 3WQHA 1YCHA 2X19A 3B52X 1RYYA 3GNTA 3OWHA 3MWDB 1P2BA 2NO0A 3G2HA 4OHFA 4BGIA 3QKUA 4FBTA 1EXVA 1G59A 5BVGB 5DAAA 3Q3HA 3DT6A 2QP9X 1PSWA 4CYMA 3NBFA 2AZXA 5IH3A 4X1IA 3PZPA 4HXFB 3X1KA 4N9QA 2B4YA 3SZUA 1UODA 4HOYA 2WU3A 4UU1A 4L5IA 3CUEF 4JBNA 3LC0A 1N2JA 3D4LA 3GA0A 2DQKA 4GWKA 1ZJWA 4DR7H 1QYXA 4GP6A 4DQDA 1ATIA 3PJEA 2J30A 2YW2A 3KJHA 3H8JA 4R8MA 2VSXA 3D4OA 1UDRA 1VLVA 5KFFA 3ZW7A 2BGMA 5H59A 3WL7A 4CV1A 1R6DA 1E3LA 3NOQA 2VUGA 4J3JA 3UUGA 2BGNA 2RGNA 4DADA 1QWOA 1G19A 5I4BA 1G18A 3EZ2A 4HB0A 2ZEJA 3CSDA 3DBVO 3GLIA 4Q3LA 2M6LA 2NUTB 2BKAA 3H99A 3PWKA 1M76A 4EG0A 4A15A 4ECQA 1KS2A 3G02A 3S5JA 3S2EA 3R24A 1HMPA 1DINA 2WUDA 2AK3A 1KGDA 5DXAA 4MYUA 1TEHA 2QZZA 5K4GA 3LKZA 2D3TA 1ZUHA 2JDIA 4QRHA 5CE8A 1BN7A 1JB9A 1SMKA 1SXJC 3QGMA 2JVKA 1SQ6A 3OE7D 5EWJB 2Z3VA 1TAQA 4XWWA 2OHFA 1KGSA 3MWEB 2W8KA 5BQXA 5AKJA 1BS2A 4BZWA 3B5EA 3RGZA 2GQRA 2DYKA 1C9EA 1BS1A 5LOVA 3GUHA 4FSHA 4KODA 3RVSA 1QHHA 5IMBA 1E4VA 2QGZA 1TTHA 2PJZA 3O26A 2ZJ4A 2X1MA 5GV8A 3D7LA 3LG2A 5A5FA 5CU7A 1OXVA 4RDCA 3RWMB 1BRTA 1MIHA 4HFMA 4ZYXA 5JANA 2XXJA 4FHDA 5LZ7A 2BGKA 4UTNA 1NG1A 4IPTA 3KQLA 5ICEA 3H40A 3ZHTA 4QPDA 1OOEA 4CCAA 1UPCA 10MHA 2IV3A 2XVAA 1KOLA 4KXQA 4JEMA 2P78A 1A50B 4GKJB 4OHUA 5KSYA 1SNYA 1DJPA 1B0AA 2OVBA 1PK9A 1IUOA 1Y5LA 4Q3KA 3I76A 2GLXA 2F1IA 2VYCA 3DW1X 1G8MA 2D1RA 3E3NA 2QL7A 3AEUA 3OOYA 2DC1A 4BMNA 3KKOA 1Q7GA 2YIMA 3NNDA 2NO5A 4CM1A 3VDXA 2IXTA 1E1YA 4R7RA 1HNWH 3KPUA 1M10A 2XZLA 5DFAA 2YFQA 5KQPA 4E12A 1MC4A 4WKNA 2HVRA 3S81A 1T8UA 1O1YA 2QG4A 4DILA 1YKGA 3NP7A 1OWOA 3WBFA 1FA9A 1G5QA 3D43A 4A6XA 5EWMA 1QB7A 5SICE 5DHPA 4G8JA 3JQBA 2QYOA 3PXBA 1USVA 4QHSA 2C77A 1Z56C 2ZRCA 3WRXC 1XQWA 2HWYA 3WGYA 1UK7A 4DCUA 1LZLA 3PJFA 3H97A 4IOKA 4YCJA 4IMJB 2BW0A 5CVEA 2RHGB 2TMGA 3IT3A 2IE0A 1P19A 2J6CA 2IY9A 2BDTA 1KYYA 3VJRA 2SKDA 1BQEA 2QR5A 4I9FA 1O9HA 4MULA 1RVDA 3UBMA 2ZE6A 2HIXA 4HNRA 5EXEA 3KAKA 3FKJA 5CYFA 3BH6A 1PT6A 4JZKA 4B3GA 3TRJA 3EK2A 3RSQA 1X7YA 3DLBA 3VYUB 4INOA 1HNXH 4UXIA 1EP3B 1YZLA 1UAAA 4DG9A 3FUXA 3S2SA 1T0BA 4UHCA 5D1HA 2X0KA 4BECA 1VXOA 1HLFA 2O3QA 4PO3X 1AUPA 1G3MA 1NVAA 4XASA 3UOGA 2C5LA 4JI8H 5KYWA 4DMHA 3T4PA 1WV0A 1WF3A 4S1VA 4BMPB 1V41E 2IS1A 1SQ0A 4EFMA 1AZSC 1L4HA 2ZTHA 2X8AA 4PYNA 5CA0B 4C4PA 5GMOA 4EG6A 5LA6F 3OPXA 3OQNA 1LNZA 3W5AA 3MN1A 3ROFA 3C3JA 2FEWB 4MDEA 4LZJA 1CEYA 3U80A 4B3RB 2XZDA 1EA5A 3A6HA 2X86A 4KP7A 1MG0A 4V3CA 4U7TB 4DC0A 1ZCJA 2JCVA 1P80A 4UFPA 5TQ2B 4ALMA 3E8XA 4ZICA 1Y3HA 4RNNA 3KQKA 2OC9A 3NYWA 1W1IA 2FQ1A 3LIPA 2J6IA 5T4HA 1RAGA 3UJAA 1R00A 3UAXA 1BW9A 3WRYA 4EGSA 5FNVB 2RHWA 2O6LA 3TTVA 2PIDA 2ASJA 1AZLA 5F77A 1V71A 3H7AA 3VZPA 3FYHA 3KKQA 3AUXA 3VH4A 1GNQA 1E5QA 3OIVA 2CHGA 4E51A 4ENPA 4BUZA 4R2KA 3IN5A 2IYXA 1GGEA 3ACCA 3A3KA 3EZYA 1BIFA