5BPFA

Crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
291
Chain Sequence
b'MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHESVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine-D-alanine ligase
molecule tags Ligase
source organism Yersinia pestis
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
total genus 89
structure length 291
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bpfA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bpfA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bpfA01
5C1PA 2GLTA 2XD4A 3VPBA 5BPFA 4YB8B 1UC8A 1I7LA 4XYLB 4WD3A 4O84A 4HNVA 1EZ1A 1BNCA 4EGQA 2YW2A 3VPCA 1W93A 3K3PA 3WO0A 4EA8A 3NUAA 3V4ZA 3LWBA 2QK4A 4IZOA 4O7NA 1EHIA 3BSSA 4E4TA 2R6FA 4DLKA 2NPOA 2I87A 2FB9A 3TW6A 1GSOA 2DIKA 3I12A 5LP6F 2I8CA 1KJJA 4C5BA 3VPDA 2GPWA 3JRWA 3KREA 2YS6A 3U54A 4HNTA 5CA1F 4FU0A 2PBZA 1VKZA 4IHJF 4EGJA 5CAEB 2V5AA 3MWDA 3GLKA 3VMMA 2FPPB 1CE8A 4O7ZA 4ZI7F 4FE2A 1IOWA 4O7TA 2C00A 3MWEA 2DLNA 3WO1A 1BXRA 4ZOLF 3AW8A 2FPGB 4TV9F 4IIJF 1VBGA 4O7RA 2W6MA 4YJ3F 3N6RA 3R5XA 1CQIB 5KX5F 1CQJB 1I7NA 3R23A 5HV6A 4M98A 3N8DA 4YAJB 5C1OA 5H80A 4O4IF 5JQGF 5J2UF 2YYAA 5JVLA 1WR2A 3BFPA 1GGOA 4O86A 4FFNA 4Y8VB 2V58A 1EUCB 4XX0B 2YRWA 2W6QA 3BG5A 2CNVA 1AUXA 5JVDF 2NU6B 3DF7A 3K5HA 4MA0A 3G8CA 2PN1A 2ZDGA 3Q2OA 3G8DA 1KJIA 3AX6A 3QFFA 1OBGA 1Z2PX 4HR7A 2HJWA 2PVPA 3OUZA 4MV3A 5CB4F 5GONF 1C30A 4I4TF 2NUAB 4M99A 2YRXA 1A9XA 3R5FA 5BMVF 2X0SA 4O7YA 1Z2NX 4HQ6A 4C5AA 2R84A 2W6PA 3RV4A 2SCUB 1AUVA 3U9SA 1CS0A 4NYEA 3ORQA 3RFCA 1KEEA 2W6NA 5JH7F 5KKNB 3ETJA 2VQDA 1DV1A 3TIGA 1Z2OX 4I55F 1A48A 2GQRA 3VOTA 2VPQA 4MV4A 5CA0F 4DIMA 2VR1A 2IP4A 3HB9A 4O4HF 1UC9A 2J9GA 4MV7A 4FFPA 1T36A 1KJ8A 5C8YF 4YBZB 2R85A 5IYZF 1B6SA 1KJ9A 2R7LA 3RUPA 4TV8F 3R9RA 1SCUB 3U55A 2YZGA 1JKJB 3KALA 1PK8A 2V59A 4MV8A 2Z02A 2R7MA 4M9CA 3TQTA 1E4EB 4MV6A 4MV9A 5LYJF 3MJFA 2HGSA 1W96A 1KUTA 2R7KA 4QSHA 4O4LF 1KJQA 5LXTF 4O2AF 4FFLA 1GSAA 2YL2A 1E4EA 2NU9B 4C5CA 1DV2A 2DZDA 3KAKA 3LP8A 4ZQIA 3VA7A 3JRXA 3OUUA 1EUDB 4IWXA 4O4JF 1ULZA 4O7VA 2FPIB 2CZGA 4O81A 2W6OA 2R82A 3Q1KA 3UFXB 2W6ZA 1M0WA 3ORRA 2DWCA 3SE7A 5FNVF 3HO8A 4YJ2F 3K5IA 5EZYF 1C3OA 5BPHA 4RZQA 4FFOA 4O82A 2NU8B 4YAKB 4O7LA 3JZFA 4MA5A 4O2BF 5J2TF 1DIKA 1M6VA 5D8DA 2R86A 3TINA 1JDBB 1KC7A 3KAJA 2P0AA 1GSHA 2QF7A 5I47A 1EYZA 3WNZA 3TIIA 3HBLA 4M9UA 4O7SA 2YZNA 3ETHA 4MV1A 4MAMA 5HBRB 5DMXA 2R7NA 4L1KA 1M0TA 2R87A 3BSYA 4XZ3B 3V4SA 5K2MA 2CQYA 2WYOA 1KBLA 3E5NA 2I80A 4TUYF 4ME6A 2OLSA 3GIDA 1GLVA 2ZDHA 1VBHA 1JLLB 2CNUA 2GQSA 2GPSA 3JZIA 2CNQA 2Z04A 4HNUA 4FFMA 4IWYA 1B6RA 2YWVA 2YZMA 3U9TA 5JQWA 2XCLA 4I50F 5LA6F 2YS7A 4FFRA 3RV3A 4WBNF 4ZHQF 3R5HA 4EA9A 4EABA 4EAAA 2VHEA 4O83A 4O7WA 2FP4B 4EG0A 4J6EA 1JDEA 1OBDA 2YZLA 4EA7A 1PX2A 2W71A 2W70A 3BSWA 4FGRA 1IOVA 4GGMX 4XYMB 5LOVF 2ZDQA 2NU7B
chains in the Genus database with same CATH superfamily
2C82A 1OFVA 1QF7A 2V54A 1PBNA 4D74A 1JBKA 4AY3A 2E48A 3BL8A 1UMDA 4BLSA 1VE1A 4RAZA 2GA8A 4HDKB 3I0NA 4OXYA 4YB8B 1PT8A 3AUAA 1VKJA 3JAKA 5ECWA 2VVTA 1PKXA 1ORIA 4O84A 1CC1S 3RS4A 4ECVA 4H35A 4RDHA 4I4TB 4MINA 1IXZA 1P74A 1OWPA 3G0GA 1JQAA 3ONVA 2A7XA 3TSWA 1IWOA 4LMBA 3W3AD 4LFCB 3GEHA 5JXHA 2VJMA 2D4HA 3E7FA 1RXSA 4KQ1A 5JCOC 2Q41A 1JAZA 3D2AA 4NQZA 3MWLA 4PGFA 3R9IA 3HDQA 1Q1GA 5JQGB 4AMYA 5DOVA 4MUNA 1N6KA 3AIOA 1UJCA 3C3BA 3K96A 4TWZA 3R1IA 4TSFA 2PRKA 2VJCA 3FTNA 3IDAA 4MWOA 5ALHA 3WJ2A 1B8VA 1AHPA 1OI3A 3AR4A 4UEJA 4OSOA 2Q0QA 1H2WA 4AQYB 2VDRB 1P19A 2FB9A 2UVDA 4N39A 1WS6A 3K8OE 1VKHA 3N2KA 1DGSA 5U9CA 4EEZA 3H5NA 5EPUA 2OFOA 4RB0A 3GLIA 3BF8A 3K9WA 1J7JA 4IGAA 4UVDA 5EPEA 1IYDA 2JGAA 3DUFA 4P93A 2XH8A 5TMBA 3NKLA 4IIUA 1G0NA 3JRWA 3BWCA 3IHWA 3O6VA 2HLNA 2Q9CA 4X64B 4BO1A 2IMWP 4NMHA 3UMCA 2X13A 2ORIA 1LI7A 2WD8A 3PNQA 1QQ7A 3INNA 2XQFA 4HH4A 3EZ9A 1JMKC 5A4AA 2ZREA 5CH8A 3TRIA 4JI4B 1WZCA 2FPPB 3LO5A 1G291 5DMHA 2EQAA 5L8VA 4PLPA 3PKIA 4GGPA 4HCJA 1GPLA 3CUKA 4KPUB 3TEKA 2BM9A 1JAIA 3VAAA 3FTDA 3MM4A 1DCKA 4F2WA 1MF7A 1ZGZA 5KTKA 5F64A 3B1ZA 3PDIA 2VCHA 2JHCA 4GYYA 2V7GA 4OA5A 3AESB 1XXHB 3K70D 1RRPA 1VFNA 3D4OA 3R6WA 2XF8A 4NICA 2P0YA 1GNPA 4TZKA 3FVQA 4UZFA 4WCDA 2LUOA 2ZB8A 1HGXA 4B3HA 4JYZA 2GJSA 1E66A 3JYQA 1JDVA 3F9RA 4MH0R 5T6MA 1ZIYA 1JEOA 4AF7A 3AKYA 3RU3A 2BGNA 3I5UA 4XGRA 5BWUA 1HMPA 3FJYA 3V1MA 4DB2A 4Q48A 1VG8A 3KR1A 3LC0A 3O82A 2A2ZA 4N40A 3ENQA 4EY6A 4NV0A 4XRRA 3B36A 2FQYA 1ZNXA 2HJGA 5FYDA 4AKEA 4Z49A 4A6EA 3PHGA 1EWYA 3DEIA 2JA6A 3FM9A 4DARA 4LMAA 3M6AA 2HJVA 1NMEA 2GB4A 4ZAVA 3TB4A 2JHPA 4B3XA 5D3MA 3H05A 3O0TA 1H2RS 1K7CA 2IDZA 4FYKA 4N3BA 2PMDA 4RB3C 2DPLA 2HDHA 5JDIA 1OWMA 1GIAA 3VOSA 3N6RA 1Z4LA 2CJFA 3COWA 4KQHA 5DULA 4FFBA 5HJ5A 1TYCA 2QP9X 5K01A 2ZSIA 3N2NA 4ALIA 5KX5F 1WHSB 2BFAA 2VTKA 3HLKA 3Q7SA 3VNVA 1Q95A 4HQFA 3R23A 4Y2PA 2A9PA 4E6EA 2GFHA 3WWZA 2YV1A 3IUQA 3U1VA 5LUBA 2DPIA 1TF5A 3PXAA 2VSOA 2H2DA 3C4QA 3WGMA 1B33N 3VSCA 5KO2A 3B6EA 4I4TA 4Y30A 5EUMA 1YKGA 4F3YA 4XDYA 1XCJA 1LWNA 3VJRA 1Y4SA 2DH5A 5COQA 4IJUA 1MKYA 4QKQA 2NQ2C 4O8CA 4OXRA 2CD9A 3P9YA 3W1GA 2I7VA 4M36A 1PSDA 1MJGM 2H1WA 2IEIA 3VKGA 1W73A 3DZIA 4PZ6A 1NIJA 4LC9A 5KYYA 2Q6IA 4TTIA 5BQ3A 3L82B 5LU8A 4ZZ1A 2C83A 2EBWA 1SXQA 3NBAA 2JVIA 4FGKA 4ZO9A 5DNVA 1B42A 2JS7A 5BMVB 3GOHA 1MHPA 3BL5A 2O1WA 3SHFA 3UAVA 4AY2A 1T4DA 2ZYRA 3R5KA 4G0VA 1NJGA 5HQJA 3RQSA 2ZBVA 3MAAC 1Z74A 4EFNA 1X80B 2VA8A 2VI5A 3IEKA 2NACA 1YBFA 2F4NA 4NDZA 4Q4DA 2RF4A 3PA8A 4KRXA 3A9TA 5A9SA 4KO8A 1A2BA 3N8IA 3HQ4O 2AYXA 3FSRA 3UGKA 5JY1A 2F8LA 3AX6A 5HCIA 4R1UA 5CU7A 3VUEA 4JXJA 4M0FA 1M6VB 3ZWNA 4BNTA 3AFHA 2ZUUA 4NESA 1Z2PX 2C7GA 3WQBA 1AKEA 3PDHA 3DWIA 1MV5A 2BFWA 2G04A 1CZKA 3E7PA 3EDQA 4UU7A 4NCKA 3ENVA 2HUNA 1QU2A 2WMYA 3PHHA 4PZYA 2R8HA 3U4QA 2B36A 3FR7A 1PVVA 2GETA 3K0AA 3F67A 3MRVA 3M7IA 3AJAA 5EHNA 2P62A 5JBQA 5K7SA 1H1TA 4KAFA 4R54A 2DY0A 3PKJA 2QNBA 1D1SA 2V5VA 3LK7A 5AVYA 1NUSA 2QX8A 3EHEA 4Y2RA 1ZRNA 1O58A 2Q4EA 3AVYA 1P2VA 3ABQB 4CUKA 4QYWA 1TQHA 1JZTA 3OJ0A 3GDEA 3R5FA 2VF5X 4B83A 3AUUA 4LE2A 3HR7A 1EXDA 4Z4EA 4FDMA 3W8EA 1ES9A 1AIPA 5E4JA 2A0YA 2OR3A 5C53B 3HKCA 3KTAA 1U3DA 2A1UB 1HDIA 2VHXA 3M3PA 1MP0A 2IHKA 1NTOA 3O26A 4NYEA 1U1GA 2ZIUB 3PJGA 4KAAA 4LYEA 1R9GA 3KG2A 3KPWA 3M3DA 1VRWA 2BKVA 4LJ9A 3R7WB 1CF4A 4LG1A 3ETJA 4YP6A 1MABB 4B4OA 9ABPA 3M6IA 4O63O 5JSZB 2AXEA 1LNZA 4JI5B 4GM1A 2PZBA 4JI3H 4HI0E 1BSVA 2OCDA 3F90A 2MOKA 3E1SA 3BOSA 3H9GA 1M66A 3CRVA 2J09A 1RAIA 1SXIA 1B6GA 1CY0A 1Z2AA 3AV0B 2W98A 4JI2B 4FX2A 1I50A 2OLKA 3P94A 3TZ6A 3RRYA 5A2GA 2VKQA 3OLXA 2AHRA 1RI2A 3TQSA 1KFCB 2GSWA 3CJRA 1BCRB 4JLMA 3ZX4A 5FUWA 4NU6A 1R37A 1J8VA 1QJ4A 3E3OA 3T1TA 3C8DA 4B76A 2JH8A 2WWWA 3DXYA 1CUAA 3FOAA 1KO8A 2AMVA 4G01B 5G1NA 7ADHA 2K7FA 2Y67A 1LQ2A 4JUDX 5ED4A 2PX8A 1BWQA 1IYEA 2WJPA 4GXRA 1OJLA 1YBAA 5EXSA 1UPBA 3SLGA 3WTCA 2AL7A 3OC0A 4M1KA 5JCJA 2QW1A 2P35A 1YIOA 1P1JA 2JI7A 3QHAA 5C5EA 1N5LA 4X7MA 1WSDA 3HA7A 3HABA 3L7IA 1S0MA 3I5YA 3UUEA 1R0XA 4A2BA 2ZTSA 2ZYVX 1G2QA 4CLDA 5C8ZA 1WAMA 3H86A 4ZC8A 4EENA 4E2YA 1ZQ9A 2OHJA 3ROXA 3G2NA 2B6HA 4QYIB 5KBYA 2SKDA 3KALA 1JWAB 2R5NA 4L3OA 1G20A 4PRLA 3ROPA 1XDZA 2B1IA 1DC7A 2HJHA 2GA9A 1NVDA 1QE5A 3HO6A 1NURA 4KMRA 2MR5A 2XMQA 2WPNA 1IEWA 1I4TD 1XEXA 1JE1A 2BR4A 5EEGA 4DDMA 4F4HA 1E0KA 2HL6A 4RLSA 3I92A 4G36A 4LBYA 4QGAA 5TS3A 1B43A 1HE4A 1UBUS 5JXWA 2GPJA 5DGIA 1K8XB 2R6GA 2GPNA 3QVOA 4RMJA 1JWLA 5D1HA 1Q0LA 4MK4A 4NMXB 2QS9A 3BE8A 3WY9A 2LNDA 3VV3A 1E1CA 3PXXA 1N0VC 4MUFA 4RH0A 1CG6A 1UOPA 1XFAA 3MBKA 1ZA2A 3D4IA 1A27A 2AMFA 5L3SB 4GDFA 2BHSA 1JVNA 4AZVA 3WGHA 5AT1A 1DARA 1JA9A 3KO8A 4Q9AA 4F1WA 4ZDIA 5JSKA 2IV2X 2QTCA 2PD6A 4CKWA 1DT5A 2AQ4A 1EZ4A 5HGJA 2GHRA 5ALKA 4KPYA 2AK2A 2V97A 4XQCA 1RLJA 5IJ0A 1N32B 2QI9F 3KKNA 4AZSA 4AX4A 3LA6A 3QU2A 1GAXA 1XLVA 3LX5A 4WKOA 4AJ9A 1Y4DE 2DJIA 1RPAA 3IBCA 3UJ9A 1TOAA 4S04A 3R8FA 2AOTA 1IONA 1J8QA 2RGXA 3LOQA 1R0BA 2JHFA 2P4SA 3LP8A 2AR7A 3CZQA 3GZNA 4ZQIA 3H8VA 3VA7A 5CA0B 3H0EA 3ZE2B 2EGUA 2NYAA 4NULA 4DSNA 2CL5A 3RJ5A 2CXSA 5DGTA 5CA1A 2C4KA 1NXTA 3RFVA 4FDTA 5JC8A 1JIHA 1WHTA 5A3JA 5JWRA 2Q3DA 4Y1FA 2J1LA 3SVZA 3U7FB 1NW4A 1R0SA 3OIYA 1Q74A 1TZMA 3OF5A 1JN0A 3U4GA 2CLFB 1LI4A 1RE1A 3QGMA 1KK2A 2JDID 4O7VA 4GD3Q 5C8XA 3NWBA 3FR8A 4J0JA 2QXUA 4WUTA 4ZAFA 2FG7C 4QDXA 5HUQA 2B7CA 4DUYB 4RHYA 1X1EA 4MQFA 2ZSBA 3Q1KA 5A4MS 4LRUA 1GU0A 2QG9A 4YRKA 4BP8A 3L0PA 1CF9A 1Y98A 4UOEA 2QN9A 3OPYA 3W2FA 5CURA 2FE3A 4DIUA 1SUCA 3LFHA 3SGLA 4YJ3B 5AW9A 5KNCD 2O1XA 5DNCA 1A97A 1O8CA 5KSYA 3OWXA 2OL4A 4A3GG 4XRGA 2IPMA 3K53A 4GX1A 2D0OB 4RY9A 1M5UA 5HEKA 3CH5A 3TD9A 4FYWA 5F1PA 3W0LB 3I2FA 4DA7A 2B9EA 2JZCA 3TMAA 2XIGA 3IMCA 5AUNB 3GGCA 5I5TA 2HRRA 2X58A 3JYHA 3R3YA 1TRKA 1QGOA 2PUWA 5BRNA 1KZ7B 3QVSA 1JAYA 1MEOA 4PFKA 3T5KA 1XAJA 1II0A 4UFPA 2J3HA 4V1CA 4FUQA 1C0IA 1Q11A 3DOHA 1H2AS 4BVGA 4CKEB 4RZHA 1EGAA 1U31A 4K0RA 4YQZA 1JQJC 2MSCB 1RCTE 2SICE 4IPTA 1AS0A 1VDZA 1BMFA 3AETA 3NC0B 1L5OA 3NRJA 1EFLA 3KE8A 2XZOA 1EK1A 2EP8A 4NNPA 2WP8J 1SUAA 4RELA 3PUXA 1CV2A 1Y8AA 4D0LB 3C43A 2OK8A 3KTOA 1G1MA 4JNCA 3OFND 1YUBA 2UVQA 4HDSA 2X0KA 1BVUA 3ESYA 5EUQB 3KQHA 3Q87B 4RF5A 1SCJA 3EXFB 3E53A 4BEBA 4HN2A 3X1WA 5KWIA 1KQFA 1NQAO 4M76B 5F2KA 4HDOB 5FOSA 4D3DA 2FYTA 3GV8B 1U90A 5EWLA 4PQRA 3BRQA 2XDQA 4AUEA 2IIVA 1JU3A 1M8GA 2LPMA 1UPFA 3HM2A 2Q0SA 1FS5A 1Z5GA 2BFBB 4MP8A 4TXNA 1NVVR 2GN0A 5C5CA 1NKTA 1TECE 1KRXA 1VOTA 1T9CA 4JVOA 1VCHA 4QDKA 3VR4H 4ZD6A 2VT3A 5K2OA 4ZYTA 5IW8A 2FK8A 1CWUA 2RKOA 3T38A 4WOPA 2IHJA 1FXSA 1LU9A 1YULA 1YZ3A 4QGSA 4KN6A 1P4RA 2CB9A 5KWJA 3SEAA 1YAHA 2VCYA 2VJKA 2O4CA 2YWXA 3QKTA 1GTJ1 4IQ4A 1SEIA 1D8TA 3BSYA 1GFZA 3KUCA 4RWZA 2BHTA 3TTTA 1V5WA 3DKKA 2X4LA 5ES3A 3K70B 1WHSA 1TK2A 2X0NA 2A0KA 5D84A 4YRFA 3ZYCA 4A2WA 3IP5A 2R8XA 2VXYA 1UWLA 3EGXA 3H42B 2HA3A 5H59A 4UMEA 1W76A 1G66A 4F3KA 4R84A 4I3FA 1U9CA 1E5QA 1L3IA 1E20A 4BLVA 3T1VA 1FE8A 3LIIA 5E95A 2WQ7A 1IG3A 2UZ1B 3ZS8A 3FKQA 2ZAGA 2W0MA 1ZBDA 4X92A 1F0PA 1ATIA 2OAP1 1EA5A 4GC6A 3JZIA 4FSXA 4MW0A 5GQSA 3MIZA 2J87A 3HADA 3BD8A 1EFDN 3L6OO 3ULKA 3VU8A 4KR7A 3UHOA 3A6DA 5K4HA 4D9MA 1I3NA 1NULA 1YQXA 3EUFA 4R1NA 1OWTA 4MVJG 2XGMA 3GLRA 1N0WA 4AXBA 1E1QD 1WNTA 4DC0A 1ZL0A 2QB5A 3EQ9A 2QAGB 3LLSA 1IJKA 2P9BA 4MW2A 4ON9A 3CLSC 5FWNA 3FYCA 1UDRA 3KS9A 2ZPTX 2I03A 3ANMA 3QPCA 4LQLA 4ILEA 1JHQA 2E7ZA 2XCLA 3LUHA 3PC4A 4QGGA 1L4HA 4FLFA 2NAPA 4Q21A 2Y27A 3GRCA 3S1AA 3PDCA 4ARUA 3LL4A 1NM5A 1I6UA 7ABPA 1OH5A 2CNWD 5JHHB 5JCJD 1C7IA 1NSYA 1TF7A 4RS4A 3NHUA 5BORA 2XCQA 2V0NA 3GH3A 3M2TA 4Q1EA 4Q03A 2FZ4A 2HDNB 1U7WA 3EZLA 3GHHA 5LZ9A 2XBUA 3E7XA 3QVKA 1HQKA 3BREA 4I4CA 1BE0A 1HI9A 3INRA 2JAOA 3SLRA 4AJKA 1ZINA 4WJKB 5I60A 1AO3A 3L5KA 2YHIB 4BPBA 1PS8A 1UWKA 3UICA 4D9HA 3EZ2A 3ND8A 4J03A 5CDTA 3GJ7A 2QROA 3QBEA 1EVYA 2HWYA 3CRRA 3AU8A 5HJEA 1XT6A 1K83A 1GYQA 2GAOA 3QVMA 2QLNA 4I08A 5B30A 3JPYA 4EMSA 1IXYA 3C6KA 3T5HA 2WG1A 4GZMA 2OBXA 3GAZA 1PG2A 3NQ41 2J7PD 4QVKA 4EUEA 1E69A 1DMSA 3U5TA 1NBIA 2GN8A 5CDHA 1Z6ZA 4OXXA 1IM5A 3PGMA 4OD0A 3K09C 4CLRB 3L8CA 3ZV7A 4E15A 1TU3A 3VO2A 5CFPA 2XNDD 4BRSA 1OU4A 3AOEC 4QO8A 2DULA 3OZCA 4TUYB 5G0TA 4V38A 5C1PA 2V9PA 4FK8A 2AC7A 2QX9A 3G0CA 1JXMA 3DZGA 1HG0A 1O95C 1BGWA 3GBSA 3I3OA 1E2DA 5BPFA 3EIUA 4ICIA 4KBFA 2HIAA 2LE0A 3BJZA 3K6RA 3RHFA 2PYDA 4PZ8A 3HKEB 1M6NA 1BS9A 2PAFA 1F1JA 2EIXA 3I2GA 4F96A 2GN1A 5L1IA 4LSGA 3S5JA 1QH1B 4YMUA 3I09A 4BMSA 4DV1H 1I1OA 1V6CA 1FFCA 4JV0A 2PBRA 5ICFA 1T8TA 3CVOA 1Z3IX 5M2QA 4MDEA 5AOCA 4JU8A 2JG3A 2WM8A 3HCBA 5EWJA 3PFIA 2FPUA 4C7OB 4XEUA 3TRFA 2JEYA 3MBIA 3G02A 1ZS9A 3HU3A 4PZPA 3PQCA 1IN4A 4GBJA 2AGPA 3UA4A 1OWOA 1ZU5A 3P52A 4IS3A 4BMCA 4OX9Y 1CIJA 3JVIA 3B3GA 3H75A 4F4XA 4QPDA 2P41A 1AHIA 4DQKA 2HR1A 4KFCA 2A9FA 3G6XA 1EHCA 2BR5A 4A3EG 3ZBPA 2O57A 2JI8A 3E0XA 2VEDA 4LGVA 1SIBE 3HXLA 1YE3A 5ITZB 1M73E 1UBOS 3VTZA 4WY8A 1NAHA 1RWMA 4RNNA 4HWTA 3RSZA 1YMVA 5ALZA 3NH9A 4MUAA 4R3WA 1VSBA 1XMIA 1UAYA 4MDHA 3DOJA 3CKMA 5HP4A 5IYBG 4ZOAA 1V2HE 2FPGA 1OT5A 4YRIA 3QBDA 4KR6A 1J2UA 4JT4A 1OIVA 4B2IA 3QZ8A 1KE1A 1HE2A 2P7HA 5K0ZA 2H3EA 2OZEA 1XTVA 2XYVA 2N46A 1MNQA 1LDYA 1YOBA 2JIZA 1W9HA 2WWXA 4CM1A 4UULA 5FIUA 4UBJA 2F7SA 1L5RA 1RWWA 4D0GA 3WTBA 3RAGA 4CMKA 2IYEA 2UYGA 2RHCA 1OLSA 3WB1A 3HG7A 4IGEA 4MQBA 1A98A 1JTEA 2IH5A 3OOWA 2FU5C 3QY0A 1YB6A 4QIWE 3JQFC 2BSAA 1E3JA 2ASVA 2IFTA 2P1ZA 2RCYA 3K35A 3OFSA 4QTXA 1YASA 2YHIA 3RLFA 3KYHC 1KU6A 5HCUA 1YKFA 4E5NA 2Y0SA 1QFJA 1T1JA 1T2CA 3E5RA 1VL5A 4UASA 2N0SA 4QA9A 1OXTA 4HADA 3ME5A 3QIAA 1XI2A 4EYHB 1JEAA 3FAZA 4OLFA 1NAIA 2Y1LA 3PX2A 4I3GA 2ZK7A 4JOQA 2EDCA 2I4OA 1N7HA 2P90A 4Q05A 2UVRA 4NF2A 5I9MA 5I7SA 3TTWA 5IBQA 4B71A 5ICMA 2WWIA 4R8MA 5JYEA 4FMDF 3WNQA 1R1DA 2PS9A 1KVQA 2VNHA 3THRA 4NOMA 4CV0A 4DREA 3WZ2A 1OTYA 4EDHA 1I5RA 2POCA 1NYRA 3CHYA 4ZHSA 2K7ZA 4D0RA 4XX0A 5IAJA 1EDZA 3HBFA 4EELA 3T54A 5ALYA 1XZHA 4EPWA 4U8HA 3ORFA 4BGVA 4ETNA 1EQAA 2R62A 1N5DA 2WBLC 1NOKA 2WMOB 2X9LA 2J9FA 1RK5A 4EGFA 2BFCB 2G9ZA 4ZOCA 2FA9A 3VU1A 2WHRA 5DGHA 5L1JA 3BB1A 3M6VA 3V2HA 3KQVA 4OF4A 4EPTA 3RVPA 4EJSC 4D8XA 5LQCA 1RRVA 5KU1A 1ZNZA 1W35A 1M7GA 2ECQA 4RZ3A 3VBEA 3WC4A 5JTTA 3NBYC 1NVKA 3A2LA 2HO5A 2ZRDA 1AQIA 3LA8A 4E5DA 2ZI6A 2R3SA 1JEQB 1AQYA 1VJ5A 2HPZA 3K94A 4G65A 3LPAA 2C8VA 4CWAA 1CJCA 4X54A 3R7BA 1PT9A 2P9EA 4P0QB 4WHMA 2ZAMA 3BG5A 3DO5A 3LW7A 5IDVA 1JHDA 2E2HA 4M0KA 1VG0B 2HKIA 2QI9C 5JVDF 5HRUA 2HREA 4JZKA 3AGPA 1W75A 3OTIA 4G23A 1Y7LA 4F91B 1IHYA 2F43B 3KUUA 1DAKA 1O3YA 4LEIA 4DLUA 1CUCA 5DVZA 2R6DA 1DUVG 1T4GA 2HM7A 5KUTA 4U7GA 2WSIA 4FVTA 4RTMA 4P5DA 1VIMA 4GMGA 1NW9B 3UUGA 4M86A 1PZFA 1E3WB 8AT1A 2C2ZA 1KSFX 4ZRNA 1BC5A 3CTPA 1U5BB 2QT1A 2N1BA 5DTEA 4YP9A 2GJ8A 3MF4A 1ESZA 4E5MA 1RPJA 5LJLA 4JXXA 1UAGA 5A4KA 2X5RA 2VHUA 1R12A 4DQNA 1II8A 4J94A 3DFMA 1Q7RA 3T52A 2JIRA 4XYMA 2Y1EA 3I04A 2X9GA 5ALXA 5GONF 2XOEA 4CN8A 1Q2UA 3NHMA 2RI0A 2ZITA 3D3KA 4M99A 1RQPA 3A1CA 3EXFA 3FPBA 5KFGA 1TW2A 1KMHA 1SKUA 2YJ6A 4IJVA 4YJ2B 2GD6A 5DZSA 4AMVA 4MS1A 1PR1A 4YLEA 5AMXA 2RE8A 1K5GA 3SXJA 4UCOA 2RAFA 3E7DA 4L15A 3QE0A 3TRKA 1MAAA 2I6UA 3MMZA 3EPPA 2PLRA 1NU6A 4B31A 3K7EA 3PC3A 2G5TA 3HRIA 2CJPA 2VN8A 5I4KA 1IUKA 2RHBA 3TVYA 3GTKA 1I7QB 2W6PA 4ZKEA 2P6OA 4YV2A 4EFMA 3QBVA 3MILA 1EIWA 2FK1A 5JXGA 1M1YA 3PQEA 1LJUA 2NO5A 1BAPA 2BHNA 3I9JA 1IAQA 3BDIA 3ZWOA 4N9QA 4ZHQA 5JR3A 1GUAA 2WFAA 3B6JA 3G9XA 1N7JA 3EEIA 3JQQA 4XWWA 4A10A 3FJOA 3MTBA 1VLHA 2BLLA 2E3JA 1VL0A 5C3UA 1A8HA 1KH3A 3HB5X 3KTFA 4RJ2A 4CCAA 1TUBA 1ORDA 3DE0X 3EA0A 1BTOA 1FSZA 1XD2B 4NJMB 5CM0A 5LYYA 1XQXA 2ZJ0A 5CYPA 1KMQA 4PTLA 3ZDEA 4F0JA 1HWYA 3SSMA 1X7ZA 2J3QA 1L7VC 1I2LA 1XZIA 1CT9A 4RHXA 4R40A 4XDGA 5CJ2A 3EISA 4HV4A 2XD9A 3CF4G 1I4LD 4D43A 4GICA 1M33A 4C03A 1ZGBA 2IA5A 5A4DA 1F51E 1LRJA 2O0MA 3JAMA 3AO0B 1DAFA 3ASUA 3KZ1E 3RSOA 4L28A 2DTEA 1NATA 1QYIA 1UR5A 4TL6A 2R7ZA 3GWZA 3RGZA 3TTUA 2ZWPA 3RYFB 3HZHA 1L4GA 4NBSA 4D4GA 4OB7A 3OCWA 2HSEA 4KIWA 1E2UA 1M2EA 3LBIA 3VAYA 4DM7A 1RXWA 3TNFA 3ZI0A 4PX3A 4TRJA 1HEIA 4IZIA 1T3TA 5UKDA 5C32A 1QHXA 1RADA 4HWSA 3CZAA 2IIPA 1NVEA 2JFWA 4EYOA 1DBQA 4PAQA 3D4BA 1XCMA 4TWRA 3F6YA 3O1LA 3DNMA 2P5YA 1RQGA 2P3SA 5BN4B 3RTAA 4D0SA 4PCLA 4PLFA 3RF2A 2IX9A 4Z4QA 5FNVB 3A05A 4F85A 1K1QA 3G13A 1A3GA 2YJ5A 4C3VA 3ISVA 4HZGA 1TADA 1W5EA 2QE7A 2X23A 3O4FA 3E3AA 3UJHA 4Q3NA 3VXKA 4QWAA 4RKYA 2IYRA 5DE3A 1WF3A 3UH0A 4CKWB 1W96A 2XUOA 1XGKA 3V4RA 3U4MA 1FEZA 3JX9A 1C3OB 1OGIA 4BWFB 1ECPA 1UZAA 4LGMA 3ZE1B 2CUZA 5LXTF 2GLXA 4M7RA 2YN4A 4QLOA 4UMVA 4DE5A 2IHNA 1VMEA 3X1ZA 3Q12A 1OFUX 1H05A 1WCXA 3R41A 4W8OA 3VR6D 1SKAA 4BB5A 1N9GB 4DYHA 1YKSA 1D4AA 3I9OA 1NY5A 3T95A 1P9RA 1QKKA 1UP6A 5J4HA 1T4CA 3AYHB 1I32A 3K31A 4ZU6X 1E3LA 5AQ1A 4E13A 2D1YA 3JQFA 3O47A 1T94A 4WBNB 3CA8A 5FPTA 2QP4A 4PLVA 3HFRA 2OG1A 1QV9A 2DBZA 2Q5OA 5AM1A 5BWXA 2IY8A 3V7WA 4DUGD 4TKVA 5KEIA 1K3FA 3UBMA 1ZJ6A 3JWEA 2IKQA 3ON5A 3FGOA 2P2ZA 2WUEA 2X5XA 1NUUA 2IJGX 4M3NA 4MUXA 3SM9A 2Y66A 2ZJZA 4ZVTA 4KQXA 2C61A 3TY9A 5I5WA 1IH8A 2UUPA 4GP9A 4IUDS 3GO4A 1FDRA 5FBVB 3L02A 3OQIA 4BQSA 2DHDA 2WDTA 1P6UA 2P69A 1WXWA 3FCUB 5I5GA 2CZGA 2G7MC 5L7YA 1U2DC 4K1XA 1YCDA 2QKYA 4C01A 3ICEA 1RYEA 3CO5A 3PP8A 4GE0A 3V8PA 1COWD 4OHBA 2BI4A 3OIFA 5E7MA 4YR9A 2FWJA 5GPBA 1KY4A 2LWIA 1L8AA 4L0DA 5JAPA 2Q5CA 4PGHA 5JMTA 4LGCA 2XNJA 4L4SA 4K0KB 5DK4A 4QOEA 3AVUA 2G5CA 4GWLA 1J70A 1UKZA 2IPNA 2J3IA 5K3BA 2P2CA 5BWWA 2V3VA 3IO5A 3K5IA 4BECA 1XYVA 4GPBA 2QR2A 1FSPA 3GRPA 1W7AA 1T2EA 4QNNA 1BFDA 1SU7A 2F59A 4FFOA 4X91A 4Q7QA 1II8B 4R0VA 2CXTA 2H17A 2Y4RA 4HNSA 3QJ5A 5DHQA 3A1EA 2WYUA 2Q3JA 3Q9LA 3QA3E 3IKMB 3LE8A 4KNWA 3BIOA 3PPWA 4ARZB 4CNQA 5F5XA 3FHLA 1JR2A 4LRXA 3UK6A 1O03A 3NTXA 4OAQA 4Q7EA 4X6UA 5K0JA 4CDGA 1BJRE 1XU7A 1T5SA 2OQRA 1KRHA 1X7WA 4I7HA 1IPFA 1CR0A 1RVV1 3SR3A 3DFIA 3OQNA 1T43A 1DQSA 5B1DA 1S2NA 1NGSA 1Q84A 1CKNB 2N1MA 3C3JA 3H5TA 3KT0A 1EGVB 1H6CA 2HF7A 3OQBA 4I46A 5JLJA 2UZ1A 4NBWA 4MW1A 1A9TA 1VL6A 1IZ8A 2A57A 4QRDA 4UAVA 2W42A 3BAFA 2DT5A 2R86A 1MR3F 1U7XA 4AM8A 2IYTA 3EVCA 4O33A 2LKCA 2MSNA 4WZAA 4BZQA 3F3MA 3JALB 5H16A 3C39A 1HSOA 3D8TA 3VR3D 4TZ0A 1JNXX 3A9CA 3OEHD 4P08A 3TLXA 3D1JA 2ILVA 4ED6A 1GPDG 1YAJA 2R60A 5C5IA 4QUKA 3DJYA 4MULA 3UZOA 5HBRA 2B0CA 3W04A 4J9OA 3QOYA 5TEVA 3D8RA 1IJFA 3GT4A 4ZCIA 1VPWA 1SOMA 1I01A 1OZAA 2JAUA 2Q9BA 3L04A 3SICE 2HQBA 1WPXA 4C0KA 1Y1SA 3N7TA 1IATA 2PXXA 4O1IA 4UEWA 3CEJA 3KZKA 3K0BA 4ABYA 1SH7A 4WEOA 1WMAA 2HV9A 4PLYA 2KMLA 5EHZA 1CXZA 1ST3A 2M6KA 3EIEA 3GARA 4JV5B 1JG6A 5H8WA 2O5EA 1UFOA 5HMMA 1IY1A 4HHEA 4QPNA 3ADCA 1JLKA 2O07A 1XZFA 1DAAA 3OX4A 1VE6A 2XUKA 4RZSA 4N5LA 4HQOA 2R4TA 4JUCA 4X5OA 4L74A 2WU3A 1RTTA 3AZQA 5HQ3B 3BC1A 4YH1A 2BM8A 1C2TA 3QXHA 3D1LA 4HDKA 3W4IA 3AWIA 2OLSA 4IDGA 5EJ6A 3FYTA 1WG8A 1A04A 1NSTA 2AVDA 2CNUA 2V7TA 4N18A 3TTXA 5FPQA 4CI0B 3ZDDA 1GDHA 2VK4A 1I9GA 4XE5A 5B7QA 1HE3A 5HX7A 4O3PA 1ANKA 2FPPA 3CPEA 4CIYA 4ED3A 3COPA 2FSHA 2O2ZA 2X1HA 5EJ9A 1G7RA 3OFVA 4OHZA 2Y0PA 4B3DA 2BBTA 1DHRA 2XMDA 3M9MB 3EDMA 3WLEA 3I1FA 3M5PA 4MQ6A 2FUG1 2W7PA 2QUJA 1PEKE 2PM8A 1IQRA 2VWQA 1E7SA 1I3OA 2V7QD 4YP1A 3SIXA 2WWHA 4L8VA 1R5OA 1EFTA 4GKJH 1EPUA 2JEFA 3PCTA 4BMDA 5LA6F 3E5HA 3RTCA 4OL0A 1NZFA 4LHWA 3EULA 2CZCA 2AG5A 1THZA 5EY5B 7REQB 1SXPA 4DV0H 5KTRA 1X87A 2A5DA 1Z6YA 4I5GA 2PWBA 4EFDA 2R4QA 1DHTA 1M76A 1PQ4A 3KRTA 1M0EA 1VCOA 5A02A 4QYTA 1DRKA 3ZXSA 3IMKA 4JT2A 1H66A 1K97A 3EZGA 3O1JC 1KK0A 1UC5B 5FUMA 2C2DA 3LRPA 4F8EA 2CBGA 4N5NA 2FF7A 3WBBA 2G77B 1IHUA 2I33A 1C8KA 3BSFA 2PNJA 2Q99A 4EG0A 2XAAA 3TLKA 4IDCA 4RVCA 5D00A 2JGIA 2X8JA 4D41A 5F3WB 4D8UA 4KRFA 4HDAA 2O8FB 4C4SA 2YHSA 1NFQA 1Z75A 3L8MA 2JNWA 3WK8A 1Q7CA 4NCJA 1H23A 4CM4A 1HH4A 5IAGA 4I19A 2RHGB 3RDPA 5E3IA 3DBLA 5AW7A 3TRHA 1J0CA 3R3XA 1UFKA 4EA6A 4GS5A 2F3TA 4DLBA 2FQ1A 2FN3A 5HKOA 3TGPA 1ZR2A 2FSFA 3G88A 1E0JA 4ETIA 1PS9A 4DIFA 1PK9A 2XJ4A 4PHFA 2REQB 2BEWB 4BFXA 2BOVA 2PXHA 5E9AA 1P2BA 1LZLA 3ZGXA 1T2FA 2ZDQA 5TLSA 5DB4A 1T0IA 4ZVVA 2HK9A 2Y1OA 3EZYA 2C98A 1A4IA 1V7PC 1G6HA 3BGOS 2L42A 1CNEA 3WYDA 1G8GA 1L5WA 1Y9EA 2EJUA 2CCGA 2HHCA 3MLBA 2KW5A 1U5CA 4TVBA 2YWDA 1YBVA 3CX6A 3EARA 5D3ZA 5DEIA 5J4VA 1MB4A 2RH4A 3OKAA 1WMDA 4YRTA 3RT7A 2VYNA 1KDYA 5LVAA 5EJ7A 2PSEA 2FPXA 2NZWA 3IV7A 1XHLA 4JHXA 1RHRA 3SLKA 4UJ5A 4E22A 4O59O 1EFRA 2GHTA 3HYNA 4G37A 3HJTA 5EMJA 4M4SA 4OXKA 5AUQA 3U49A 1OH6A 3AUFA 3JQBC 1EVKA 4CLRA 3IFSA 4HLUA 5LDGA 1ZVVA 1KNXA 3LF2A 1O9GA 2CHGA 4OI1A 3DVQX 2G9NA 3FDFA 1E5XA 1E3SA 4TTRA 3LWBA 2JGJA 3TVDA 2GFIA 1VBNA 1DVRA 3UBTA 3KOMA 3RC9A 4E4TA 4N3AA 1Z36A 1C3EA 2P2SA 4B6GA 3WDKA 1EJ0A 1JT9A 5ABPA 2V4ZA 4X20B 4DV5H 5CX1B 1ZMTA 1YZVA 4ZU3A 4AS3A 1OFUA 2EX0A 2Z30A 2IY9A 4GKAA 4XVUA 1YQQA 1MQSA 3OT1B 3H3FA 1QIFA 3REFA 1VIVA 2QBYB 4IHAA 1PWZA 1V4NA 2FZWA 3NALA 3ZK7A 1C7EA 1MB3A 1YDGA 2I55A 5F73A 4PC7A 3TO5A 2ZCJA 3U09A 4L07A 3HDYA 1HQDA 3MWDB 2COIA 1ZY2A 2M2IA 2TMYA 3VRHA 5IZ4A 2JLSA 3JD4A 2YS6A 2HNBA 5FWAA 3AEYA 4N8EA 3M6FA 1GDDA 1QRDA 1Z7GA 1Z5ZA 3T0GA 5KFRA 2CVPA 1HYBA 1K75A 1WHTB 1EX7A 1OILA 2CXUA 5DLFA 2EJVA 2NQ8A 2PVSA 3O3NB 1TMKA 4KQIA 4O5AA 1NTRA 3IULA 1VE3A 5HMLA 1U7HA 1UEIA 3FZEA 5SYMA 3DE5X 5TDHA 4B8WA 2COEA 2IL1A 3BTSA 4IDFA 3S2IA 4DPLA 3PFNA 4FE7A 1CE8A 4OI4A 1BXZA 2AF3C 4K05A 4EGAA 3E1GA 1IB0A 2D2FA 4YO8A 5BUQA 1KI2A 2XT6A 3LCMA 2I2XB 5P8WA 4DL4A 1S7CA 3GGJA 3WICA 4DCPA 4ATNA 4U5QA 3MQ4A 3A8TA 3NIBA 2RMKA 3EOAI 2NT4A 2PSDA 2O50A 4KGVA 5FQOA 5JAUA 2C00A 3HUFA 5K99A 4WOKA 1L1RA 3AHCA 3MWEA 3CS3A 3NHKA 4FJ1A 4I5IA 4LDAA 2O6LA 1HE8B 1I80A 4OFBA 1GNQA 4WIAA 3OZ7A 1PT6A 3A32A 3SJ7A 4BBJA 4F71A 3OEHA 3H20A 1NPDA 1HT2E 1A7JA 1JR3D 3E70C 3OOSA 2A58A 4A2QA 3R0QA 4LXUA 1GPKA 4F9EA 2OD9A 1A5AB 2D62A 4QDUA 1PQWA 1XRRA 3N8GA 1ZH4A 1E1YA 1RYMA 1ZM9A 4FFWA 4P3PA 4QQ8A 5CTAA 4WESA 1QR2A 1AKUA 4QTYA 3DM5A 3OX3A 5K3CA 3ZLUA 5GMOA 3BTUA 2F8TA 2NUPA 1Q14A 3VZCA 1E6CA 1R16A 1XP8A 2B30A 2H2WA 3OJCA 1XEAA 4JLUA 1IJBA 1RLUA 1LX7A 5DU2A 1G20E 2O52A 4RL4A 3T4XA 2KM1A 1KBOA 2PGAA 3WLTA 4NCHA 2XWPA 4MW6A 1X1DA 1HT0A 1O2DA 1CQIB 1ARZA 3QFCA 3DE2X 3GFQA 5FL7A 1CQJB 4ACBA 1UXOA 4RPCA 1DKRA 1O96B 1DUSA 1E1RD 1FX0A 2VQSA 2ZRMA 3O8DA 2O2HA 4BMPB 4JKIA 1WMSA 3MPUA 3PL5A 1KDOA 4L4ZA 4ZYVA 5LZ2A 4DKXA 2J6CA 2YXBA 1Z4QA 2X7HA 3MGGA 3KFXA 3KM0A 3MWJA 3QMMA 1BVHA 1Z88A 1TLFA 1VG9B 2AD5A 2KS6A 2IW3A 2Q27A 4GWKA 5J2UF 4WKCA 2MR6A 2R11A 3GCXA 1FFSA 1MVOA 1XBTA 4WZBB 4LJSA 4YP0A 5KJFA 4RD4A 1Z9BA 3EXHB 3BFPA 3QM1A 4L9SA 1YVUA 3DB2A 4O86A 3PQ4A 5EERA 3RTEA 1SQ0A 2QR5A 3GRVA 4JMPA 1XLWA 3ETLA 1TQDA 3L2OB 1VBMA 3R0ZA 3UWDA 1FIUA 4XX0B 4TQ9A 1S1CA 2BFBA 3NYQA 2W6QA 4J0HA 2J0SA 2P3QA 3BQ1A 1H69A 4H6XA 2JGKA 2ZQZA 4H4EA 1Z0JA 4L73A 4DQVA 1AGXA 1HFKA 2FEKA 2B94A 4KPGA 3UZBA 2IHUA 3DB1A 5LLSA 3AY0A 2ZDGA 3VH1A 4UBLA 4MMZB 2I3DA 5EXXA 1Z22A 4B34A 4LOHA 2I78A 1SKYB 4CF3A 1RRMA 1FTSA 4G1UC 1DZ3A 2X0DA 3SM3A 3H5VA 2V45A 4MYCA 4ERXA 1OBGA 1QP8A 3A14A 1OZFA 1SD2A 4INOA 1XA4A 3LUBA 3MTAA 1NJFA 1Y3IA 1IM8A 1YVDA 1ZUHA 2ZIAA 4WDRA 5DWDA 1LDNA 4GZ3A 5CT4A 3RUDA 2YV4A 3QEBZ 4KU4A 4IZHA 3EVBA 1V3QE 3MWYW 4L76A 4LQCA 5WRFA 2CHFA 5LOVA 1FF9A 1LLQA 3KOZA 1GZ3A 1I33A 1DBVO 4QASA 3B9RA 5TQ2B 3BYZA 1PEYA 1NNSA 2R44A 2P0EA 4MW4A 4QG7A 2FJZA 1GRNA 1UL1X 3ETGA 4YRBA 1G21B 1JQLB 4HGRA 2BCJQ 3HN6A 3Q7EA 4KO1S 1OGJA 5C31A 1NMZA 3SR4A 1SG0A 3DEZA 5CRIA 3PVXA 4DYVA 4IDOA 1G38A 2WFLB 1YRWA 1EESA 1QLHA 2RGWA 4LVOA 4DLYA 4WCVA 2BPOA 1E8MA 4C7KA 1VGVA 3RV4A 1XA0A 4YJFA 6GPBA 1KP9A 2XQKA 4ZC1A 2WINI 4F84A 4IIDA 5BQOA 3WQQA 5FORA 5EIXA 3QWIA 5JRZA 2IP2A 5JH7F 3ZEIA 1NFRA 3IAM6 2WLSA 1ZD4A 4MR9B 3VQTA 4DPMA 2B8JA 5LD2B 3QU9A 1HFJA 3S7TA 1W88A 1GR0A 2VPZA 4BP3A 1I6WA 2YIVX 4C7BA 3FFTA 3FSGD 3QVGA 5H81A 1HNWH 3I52A 3B5JA 4L3VA 5IT4A 3KZVA 1U2QA 4MCAA 3UN1A 2C94A 4BV2A 4DGQA 3IE0A 4LWPA 6LDHA 3U44A 5LZ5A 3UJ7A 2JCYA 2DR2A 4RIFA 4TKUA 5A04A 4ZDJA 1SWWA 2J3EA 5C46F 5ER9A 2WAXA 4BUJA 2QZPA 3BRWD 2NZXA 5JS2A 1NXPA 4KIUA 1T0PA 5FBLB 4EY7A 2FPKA 2I2BA 1G6Q1 4YAGA 5C7LO 4H31A 4UAGA 3TXXA 3OMXA 1HEUA 3FNIA 1X14A 4FHGA 4J7CA 5GVRA 1JJIA 4HP8A 1NF8A 2F67A 3DQZA 5K6TA 4DAAA 3JD3A 3FLAA 3IAFA 3JSXA 5JZVA 3ZNQA 4RQUA 1L1EA 1YCHA 2BFFA 2H65A 2HCTA 4XTCS 1IBMH 3NBFA 2M6LA 5IM4F 3OM9A 1Z38A 3SDSA 5JNTA 3RSLA 2IP1A 1L2TA 1UJMA 5I4BA 1SPXA 5IYZF 2PPLA 3LKVA 3BF7A 3LVRE 2AFIE 2YMPA 5B7NA 1QX4A 1U2RA 4JI2H 2A78A 3HXKA 4X97A 5KDOA 2UU9H 2E0IA 2YFQA 5KNBD 3SQXA 4WERA 3CVUA 1YO6A 2V59A 4QREA 3CINA 4DWVA 2HSDA 1SUDA 2JKVA 5DQHA 2HAEA 3ONFA 1SFOA 3R4CA 3NWJA 4ND2A 4L16A 3SE0A 1CY8A 3OM8A 3H5AA 2H06A 3Q9UA 1IEQA 1CZRA 1E4EB 1BDJA 2BL4A 2H9AA 5AO9A 3STXA 4QXRA 4X7BA 2Y05A 2BY4A 1YC5A 1OPXA 3DYIA 4KQ2A 3ZTYA 4U7FA 2X6RA 1PUXA 4AK9A 4KOEC 3ANXA 3HL4A 4JZYA 3HVJA 5BOSA 5KT5A 3DYVA 3HZOA 3QYJA 1YJCA 1LD3A 1GQQA 2IQIA 2VDWA 4IIXA 4MKZA 4BL5A 3L05A 2PX0A 2GCGA 1CJBA 4ENSA 1JSCA 1PYOA 3EC1A 1Y1VG 2AIRA 4O3NA 4TS1A 3C5EA 2I3GA 1X9NA 4O4LF 1TUGA 2ASJA 2QVZX 2VJNA 5ALOA 5T41A 3DDHA 4XGQA 2VC2B 2NU8A 1R64A 5AW4A 3BA1A 4KXQA 2ONJA 4F7DA 2PKXA 2CEAA 5EL0A 1H2XA 2ZSFA 4F4IA 2VDOB 2YCBA 3ESAA 1ZGJA 3OVMA 3RYTC 4DQXA 2HWWA 3X2FA 1BXRB 3MGBA 4EYQA 1T9GR 4XJXA 1CUXA 2P27A 4K9SA 4BS9A 3AVQA 4ED8A 3WDMA 5DXJA 1ID8A 1PZXA 3SVLA 3GIPA 2W58A 4ZJPA 3CNBA 1FUEA 4DV1B 4ZJZA 3OQJA 2BBWA 4J0MA 4CTJA 4ZGBA 5F7OA 1YJBA 2NSLA 2JZNA 4OSPA 4U39A 4DT1A 1T8PA 3FW1A 3JSLA 2V7PA 2C96A 3W5HA 4JQCA 4F5WA 3RVJA 3T12A 3U3JA 4HNAA 2ZGVA 1TLTA 1KJWA 1KPGA 3PENA 3E9QA 5ARCA 5DM2A 1LW7A 2G72A 4I0WB 1LW6E 5KFEA 1N32H 3DM9B 4PO1A 1QNLA 5KZMB 3HI6A 2G9QA 1INLA 2QL9A 1IY9A 3KTAB 1WWKA 3DMYA 3UAYA 5KOHB 2H1OA 2PWYA 3Q5EA 3RVBA 3W9BA 5JNUA 3ZHOA 2C95A 2GS9A 1GGFA 4CL2A 5IJ9B 4E12A 2I2AA 3GZJA 3DOFA 4IS2A 3C0KA 2RBKA 5B2ZA 5HZKA 2HIXA 1KFEB 3T3MB 3DMRA 5BUSA 3A1FA 2JFQA 1ADYA 4INAA 5EVJA 1Z16A 5EZYF 3RRZA 4NZYA 1CVRA 3HCEA 5D5PA 1YK1A 4P53A 1ZVMA 5FOQA 4PR3A 3PUYA 2WB1A 1MX3A 4Y0VA 4FE4A 4V0MA 5IC5A 1KS2A 4EKEA 3W3AH 3VPHA 1WVMA 4UUNA 4KFSA 1Z4KA 1YZLA 1GPH1 3PIRA 4FEGA 1ZG3A 1Z25A 1WY5A 1QKIA 3HEMA 4RDCA 1AH2A 1J00A 1W0JA 1A9OA 4OH7A 5JIBA 1HRKA 5T8KC 4XWYA 4G2NA 4L5JA 5CNMA 3KJFA 5A9SB 4LF7B 2A5GA 1HG1A 2Z8YM 4L0CA 5CX4A 4MHOA 4A3IG 3UPTA 1I51A 1Z47A 4HX9A 2QMOA 4KWCA 5D8DA 2VHTA 3H2SA 2RCNA 3NLLA 3P96A 2P9JA 3ISTA 5EWLB 2HSJA 3QUCA 1QYWA 1FK8A 1T6XA 1ZC4A 4OHOA 5AESA 1GRCA 1HDXA 3KOUA 1A95A 3BJIC 6NULA 3QVXA 3JVDA 5ELLA 4GVXA 3D0RA 3KB2A 1J2RA 3FLBA 2GUGA 3E61A 3DD5A 2FFRA 3WFZA 2G1PA 2QF7A 1XKTA 3LF1A 4M38A 5BMVA 2GKOA 4BY7G 3BJEA 3WSVA 2QJTA 1DLIA 3O4IA 4Z1MD 3SQNA 5B4UA 4MKIA 1UQTA 2FEXA 1OH7A 1CZNA 1ZAYA 1RJGA 4BN4A 5G40A 1FUYB 1JW9B 5I4IA 1VE5A 2FV8A 5DLQC 1X7HA 4RENA 3AUTA 1EK5A 3H5OA 2R66A 1EE1A 3C45A 4MAMA 1KR5A 4K1LA 4RXMA 2JFUA 2WWTA 3K0HA 5CGQB 2JHGA 4QJIA 5SICE 3ZV5A 3DDNA 1H4TA 1YE8A 2WAQA 3T1HB 1GUDA 1QOZA 2C07A 2RBEA 1W19A 2YXNA 3CIFA 3INTA 3K0KA 1RBZA 1E3DA 1T9HA 3KJGA 4I7EA 2HGZA 1EI9A 1SQSA 3BH6A 5HKBA 2P3OA 2VBIA 2KBEA 3VVBA 4H3HB 2IDMA 4CKYA 3EZNA 4RPGA 3LUKA 4ZI7B 3PEFA 2GESA 1XZLA 4U2KA 1SCDA 5GWXA 3RLIA 4OAPA 3SBEA 4D8YA 3ZH2A 1ETHA 3RSHA 5B12A 2A30A 5DNYB 4G6ZA 4LHSA 4OP3A 2F3RA 1XB2A 1MFPA 4QJBA 1GU1A 4GC7A 4XYBA 1QP0A 1N75A 3KWMA 4MYSA 4OQ4A 3ED1A 5EINA 5C5JA 1JAHA 3H2GA 3O74A 5G4LA 3ABRB 4DBLE 1QIJA 2G82A 4CIWA 4HNAB 2HHJA 4WKNA 3D7LA 4NLGA 1VMKA 1K1SA 1ZSNA 4PQFA 4ZGGA 3ICVA 5G4KB 1L7DA 3SHOA 2YR0A 1EA7A 2OG2A 1LC0A 2PH5A 2Z04A 2J6BA 3D3NA 3L0OA 5DISC 3H9JA 3PQ2A 4OFXA 3RO7A 1JZSA 4QTZA 4KAXA 5AHOA 5BYKA 2NTJA 2YX1A 4L78A 3KAPA 5ITSA 4JP1A 3WAKA 2B63G 2FMIA 4RQBA 2AG6A 2YWVA 1Q21A 5FPYA 1NP3A 4QEDA 4C2MA 1RKUA 4NZNA 5KYUA 3SC4A 2P68A 3DDWA 3TLZA 4C87A 1H2HA 1UDAA 4KN8A 4X1IA 3B1VA 2Y6UA 5LZ8A 3QX9A 3LAWA 5E4TA 4DYDA 2Q29A 3CTMA 5EMHA 3RFFA 2YS7A 3QF4B 1CCWA 4FQ7A 2W4IA 5EP1A 1IDN1 4ROSA 1Z26A 4D3SA 4OHXA 5KNCA 3L0ZA 5DX1A 2IU0A 3WIEA 1L8LA 4F6RB 2J45A 3OCZA 2W6IA 5CLIA 2V7BA 4CMEC 3B2EA 5A05A 3TE7A 2C2YA 2UUCB 4IH4A 5EWEA 3AUKA 4DT1B 4PYJA 4YI5A 1YZQA 2Q3CA 2UVUA 3V5NA 3FBGA 1ZK2A 1TWAA 4O83A 4L8GA 3SYRA 4E88A 3OX1A 2FP4B 4YONB 4EFLA 1W46A 3RB0A 3D5QA 2HO4A 4LHYA 2B1GA 4B6QA 4XOUA 4NDNE 5CYOA 4W7IA 2XUFA 5J2TB 1QF6A 3WP1B 1SXHA 4GIBA 4GXTA 4P98A 3GJ6A 1IWPB 2QYZA 5F35A 3GLFB 2IYYA 1EEXB 3OHSX 1OYWA 2POQX 2C0CA 4KSCA 1N6HA 3DKVA 4GGMX 5E1BA 5AXCA 4R16A 2W6JA 3G89A 1KC1A 1KBZA 2E89A 2OP1A 4LS3A 3F49S 4QUAA 1P0PA 2D7JA 4WCFC 2PMWB 4Y1RB 3KZCA 1BDBA 1TD9A 3GK3A 3JQEA 1PWXA 4H9GA 1H5QA 1N2GA 1R9MA 5DI3A 3MTJA 3F6PA 1I7LA 3M49A 5EXPA 2VDVE 2C2EA 2DQYA 3ABOB 3NBQA 4TX1A 1ZAKA 3OHPA 4Q3EA 3JQAD 2GTHA 2NYUA 1M7HA 2VQEB 1EP1B 2IYUA 5EIHA 4BP1A 3QPBA 5B6IA 3OM0A 5HCNA 3WYNA 2PRZA 3CUVA 2CKMA 2GDZA 2DPGA 2W9AA 3AQIA 3ASVA 4M9RA 4FNAA 4RUAA 1Z4NA 4YRZA 5BO5A 3V00A 4B6PA 4M6WB 4XQEA 5FUBA 1UT6A 4YAOA 4WOBA 2W2LD 1DIRA 3ROMA 5F76A 4DLKA 1VPLA 2E6UX 4FHDA 2D1FA 2O2IA 3FLEA 2UZ4A 1TQ6A 4G5HA 4V0SA 4X9XA 3HFGA 1YVPA 2GCIA 2EHJA 3H7IA 1G3MA 4Q00A 5CVTA 3VUFA 3COSA 2X8JB 4A0QA 3PJRA 1R5JA 3EGDA 3BWVA 4BZZA 1LVGA 1TIPA 2IPXA 4IOJA 4N5IX 1NL3A 4OQNA 1D6SA 4G41A 5L53A 3ZXXA 4JJ8A 2Q2UA 1JKJA 5KTNA 3REQA 4LRQA 3OEEA 4LY3A 1XMQH 3EXG1 3U54A 2G17A 4LWOA 1DIAA 1D0VA 5ALNA 5HDBB 1F0KA 2PJRA 4CKEA 2Y4OA 3D64A 3W5VA 2LIPA 3GW8A 4RA6B 1F8UA 3DEKA 3BD6A 1SVMA 3HSSA 4FSHA 4JB2A 4B48A 4W82A 5E3HA 2B3DA 3IVAA 3ZE9A 4C3OB 4RVOA 5GGYA 2PJDA 4UDYX 4UFZA 3GQCA 1R9TA 4I14A 4LE1A 5TMDA 2OYCA 2ZJTA 4LJRA 4B7UA 1ESDA 4O0MA 1ICIA 2Q4BA 2WAYA 1TVCA 1R0ZA 1BFKA 1GV0A 1ZM3A 2OORA 1PE0A 3CR3C 3EW9A 4HAIA 4IQ0A 4WKGA 3K9BA 3SS9X 4DDWA 3U16A 1PVDA 2QG6A 3KZXA 4KUEA 5FBHA 3ONEA 2PS3A 1U7DA 2E2WA 5DJ5A 1IK6A 1UDXA 2XMBA 1UUFA 1MC4A 3FI9A 3R09A 3M6UA 4KUHA 3C14C 1TYEB 2A67A 3NATA 3BS4A 1JEDA 1ZI9A 2TMGA 1D7AA 2C2XA 3WQRA 1L4FA 3CRW1 5IYDG 1YOVB 1FYEA 1GL6A 4C0XA 1JX4A 1MIOB 2R97A 2YN2A 4CXMA 4CC6A 3I04M 4M88A 1ZL2A 2IU4A 2VWPA 4LYFA 5KYGA 2AQ8A 2GYYA 2PUVA 1B04A 4GBMA 4LW8A 5THQA 2JEJA 2HBQA 2UUBH 2B8EA 3WLFA 5HKKA 2FE4A 4UUGA 1R15A 3K4HA 2Z3ZA 4O2BA 4UCUA 5H70A 2VS1A 3RVKA 4EQZA 4ZXFA 3WB2A 3QH4A 2H4ZA 3R74A 2FPIA 1ZNQO 1GR1A 4JBLA 2EF0A 5DIFA 3PD7A 2WKQA 2FJUA 3NWPA 4Y6RA 1D09A 3S55A 1XCLA 4C0JA 5FXMA 4E03A 2AOTB 1QHYA 3DS8A 1U2EA 2FW6A 3T7IA 2P3LA 4OGFA 4EKGA 2ONCA 2VF7A 1G3QA 5LMNB 4Q3KA 4B87A 3W9YA 4FXOA 4LJYA 2Q28A 4O4IF 2WU0A 5KCMA 3ZEAA 4BO0A 2FR0A 3EZ6A 1BE1A 2AJTA 1KA9H 3B8HA 3VNUA 2X3FA 3GJRA 2R1TA 4M0CA 1NRJB 3P2MA 4PY2A 4HEHA 2H4WA 4R7ZA 5B4TA 1DXYA 2OZKA 1GG5A 2QSYA 1Z08A 2CNLA 3G9UA 1V37A 2APJA 3F9IA 3L43A 4QYSA 3PXBA 4Q9HA 2ZT5A 4Y2HA 1RD4A 4JN6B 4ZEWA 4TYQA 1EUCB 3ETEA 5EZ5A 4BQFA 5BOSB 5CB0A 3PHLA 3I01A 4XH9B 4Q66C 4CFZA 5TJ9A 4LBVA 1H5UA 2X0RA 1TFUA 2VG8A 5CIWA 3L0YA 4DY6A 2VT2A 3K5HA 5D3QA 1X74A 3PNOA 4GW3A 3S8MA 4L5AA 4ZV7A 2ZYSA 1GKKA 3WISA 4B84A 2PFKA 3RRNA 4UZSA 4KO2S 5KSZA 4YJ3A 2GARA 3V2IA 4AJNA 4ZTZB 1SKYE 1VBKA 1WKCA 3MT8A 1AZSC 3ILXA 5JAZA 3MCUA 1WDMA 3ZDAA 4TVOA 2BV3A 5TXGA 1Y7IA 4BKPA 1K88A 4EHFA 5BQPA 4WMLA 3SU8A 2XB4A 1E3MA 2ZW9A 3WGJA 3O2JA 5LMCA 1RYNA 3JQPA 4MV3A 5TE9A 1XQ1A 1ULAA 3K2QA 4RNCA 3FUVA 4P31A 1D6NA 2A8YA 4O4LA 1KVRA 1LS6A 4Q3BA 4F6LA 3PUVA 1SKMA 2OO3A 4KSBA 2BQRA 3S68A 1IOLA 2XB9A 4EPRA 4W5TA 4Q0MA 4OBEA 4EFKA 1ZNWA 3COVA 2GXAA 1JZQA 1VI2A 2Z56A 3DCJA 4IMIB 4C06A 5E7JA 4DEYA 4LJ7A 1X8XA 2DQSA 4EBBA 2PT9A 4CL0A 4CGYA 4MTCA 1FJXA 2C2WA 3AYXB 1P0IA 1X8KA 4CCSA 1UM9B 4O4HB 5CA0A 5HIAA 5TB5A 3MWEB 2Q7DA 1U0NA 2OHFA 4EEQA 1FTGA 5E6UA 4ZEMA 3R2JA 3DEAA 4BLPA 5CB4A 3W5AA 1TC2A 4FR0A 2OV8A 5GJCA 1KEEA 4MP3A 3R3ZA 1S9FA 4TYMA 1CK4A 3LHKA 1U2SA 1YJXA 4B3JA 2CNBA 3NTQA 3LBAA 4YT4A 1TJYA 1LBEA 2DWOA 3KYDB 1PJLA 5TGDA 4DG9A 3T3NA 1Z4OA 3VOTA 2EJ3A 1NG1A 4AO8A 1MC8A 1DO8A 2PKQP 5B58C 4RF4A 5IVDA 1SMKA 4BXOB 5EJIA 4LISA 2IOYA 5DCWA 4EKIA 3KYIB 4BMXA 3M5DA 4UD2A 4MV4A 1I7DA 1YTLA 2EFDB 5CITA 2YTZA 5E9JA 4A23A 1ONBA 4ER0A 1SN7A 4N3GA 2C28A 5EWFA 1FNBA 2SCUA 3KVVA 1TNDA 2GZAA 1FNCA 4Q1DA 4YAIA 1WUYA 3PWSA 2J9GA 3H1FA 4Q4AA 1T4CB 1I2KA 2CVQA 1N1GA 3QXGA 3U19A 3SQDA 2Q5HA 3AJEA 2C3OA 1N6PA 2PZAA 1UJ4A 2VSQA 4JI5H 3LDAA 1UBEA 2D06A 2HHAA 4MWZA 4ND5A 1V0JA 1USGA 4NC9A 5ICEA 3AILA 4PDBA 3EGXB 3HCNA 4XLZA 1RVDA 1T0UA 5TVGA 3UW1A 1E0AA 621PA 1RAFA 3N2IA 1RHUA 1U3CA 2WZQA 4IDHA 4L6AA 2WIAA 5HIJA 3ZUPA 2PGJA 3B5IA 4X62H 2B61A 4DJAA 1TMGE 2XUQA 1LPPA 4F2GA 4W5RA 2QTWB 1RCUA 2LP4Y 3U0GA 1JS1X 1AS3A 1J0EA 3IV6A 2KYRA 4QVGA 5B1HA 4IOMA 4K86A 1TUEA 4HMQA 4Z0NA 1F2TA 1L5FA 2J5BA 3CX8A 5K4AA 4DV3B 4UM9B 1IZYA 4M37A 2XXAB 4KP7A 3VPGA 4FYXA 4KW7A 1B15A 4N9WA 2C22A 4Z7OB 1PNRA 2KB0A 2PMEA 3MEQA 4ZANA 2P9CA 5FI0B 5KSOA 2A7QA 1NC1A 1SKQA 2RAVA 3F2IA 3QXSA 4JQYA 2A9QA 3UENA 1QVZA 4MUMA 4AQDA 4DA6A 2D00A 4HYTA 2WUVA 3EG9B 1BJTA 2RGVA 3KBOA 5CXXA 4YXWD 5HILA 4P81A 3L8GA 4Q24A 2C4VA 3WK6A 3LDUA 4UCVA 3C7KA 4NARA 4ALKA 5IFLA 1GSAA 1G98A 5C44G 1S1MA 3GDWA 3RRBA 3FI0A 1HNZB 1E2EA 3KHSA 1J90A 3FMAA 1SR8A 1UIRA 5KTTA 3ES9A 3R5JA 3UCXA 3AUYA 3V2GA 1KFKB 3KXYT 1YDMA 4TRNA 4MHSA 2D7DA 3LLMA 2G28A 1K1EA 4D3XA 3SYKA 3OQOA 1B14A 5AVKA 3ILSA 3QYFA 5M29A 1GT91 3ITEA 3D1VA 1TQ8A 4IHQA 3NTOA 1SHZA 2VCEA 3MB5A 3IKLA 4YR2A 3SFVA 2FLPA 1C1DB 1U8AA 3W3AA 2PKCA 5KYVA 4BBPA 5CCDA 4RZ2A 4H16A 5KVQA 1Z5OA 4GDMA 1VS0A 1N1MA 1RRFA 2H29A 4II7A 3S2FA 2C5FA 4KPEC 3BEDA 1CTQA 3E2MA 2PH7A 1YD7A 5JS1A 2YCHA 4DV4H 2Z0MA 3D8UA 2OVBA 3IQGX 1QYVA 2ZRJA 3D2BA 2FSIA 3JR7A 1SOVA 3HC7A 1Q0PA 3A4NA 3AKCA 3DC2A 2BFEB 3F7NA 3HU1A 3MTGA 1RABA 2WIFA 1EUDA 3AERA 2J9YB 1OR8A 3EPGA 2WB1E 1ECFA 1XZQA 2QTAA 3Q8RB 3DMTC 4BATA 3IRVA 4E3WA 4ISCA 3EMKA 2JEIA 1M0SA 1ZJ4A 3DTYA 4FT2A 4Z51A 3PO2G 1AS2A 4MI9A 3WLKX 1UBRS 1MU0A 1QM5A 4IV5A 5LQDA 5CK5A 5EKXA 1KJZA 3HUDA 2H07A 2OK7A 3JQ9A 1JKMA 1V9SA 1ZISA 1ZCFA 3ORYA 5HPYB 2XCUA 5AWFC 1Z6AA 1L4BA 1TO2E 2Q3EA 2QVBA 4EECA 5I6DA 1E79A 2H2AA 3NC4A 1DX9A 1SRRA 2WJJA 2PU5A 4O4IA 4RMHA 4JX9A 4P4LA 1B93A 3VJKA 3X1YA 1AB5A 5AVUA 1N2HA 4JGBA 5GAJA 1DEAA 1UODA 2JVJA 3F6RA 3Q6NA 4Q82A 4XX1A 1HE1C 3ELBA 4C6HA 2ODQA 4RSMA 2YJGA 4BFLA 4Q34A 2F3QA 4P5EA 3AGQA 3O3MB 5JLAA 3UB3A 1E3IA 4CQMA 3GROA 4OHWA 3BORA 3VC3A 3OCCA 2YIDA 4ED9A 3DLAA 5E2AA 3LT2A 4UW9A 1H93A 4GLOA 3GZNB 3V1NA 1MAWA 3CNOA 4QHTA 1BEEA 4PG8A 4URVR 3CBQA 4DSAA 3OIDA 4MGHA 4MVCA 3ZD9A 1R18A 4RGQA 5LP6B 2E5FA 4X00A 5BSGA 4OL9A 3G2PA 1D8AA 3WLHA 2AMYA 1YHYA 5KNBA 3FWHA 4S1OA 3TAXA 1NXOA 2G4LA 2IH2A 3WGZA 3TS1A 3FFXA 4EG5A 3HVRA 1NNLA 5H9VA 2HPVA 2B92A 2D1SA 5I7HA 2VDWB 3FPJA 1A76A 4IVPA 1KC7A 3EGEA 1M2VA 4JI6H 1W0KD 3WNVA 1C30B 3O21A 4DCOA 1GSHA 2JATA 3R3JA 1G17A 4HDNA 3SZUA 4ITRC 1ISSA 4BQEA 3CVXA 3P20A 1N5KA 2IS2A 4M54A 1YJ5A 3PJEA 4ZALA 2TMKA 1J09A 2NN3C 2WMNB 3LPCA 3WGGA 3UG6A 2ACVA 2XCSB 1CRPA 4KR9A 4G1VA 4BEVA 4M9UA 4QWCA 1LNQA 4HVAA 4ZZIA 1S9HA 3AJDA 4XWAA 3IQZA 3ZK8A 3ECCA 3BULA 3GGSA 5CEFA 3Q0EA 2YVAA 4Y6GB 2WC1A 4HWKA 2C5BA 4D4KA 1ZH8A 2EYUA 1JF8A 3GCZA 1I3MA 4HATA 5KFTA 1A9SA 3C5VA 3EDCA 5IXSA 3HHEA 3TY8A 2BEJA 3NHSA 5HBGA 3RIGA 2F1JA 4F04A 4TYYA 1OAAA 1D4OA 4KIGA 5A4FS 3BXPA 3EAFA 4G5FA 1ENYA 1M0TA 2AW5A 6AT1A 4NEHB 1P7YA 1PU2A 2BEWA 2LCIA 1Q2XA 3WIUA 4CF4A 3ICOA 1X86B 4WZAE 5DN6D 1J23A 1JE0A 4BPRA 4RK4A 1J22A 1V26A 3C3DA 3KU1A 2C5HA 2NO7A 1F9AA 3O0DA 2VHVA 1JYFA 4DZRA 3IPXA 4XFKA 4PIVA 4W9NA 1RWQA 3Q7PA 2CMDA 1N2CE 1PGOA 1A0IA 3HACA 4K8OA 2JCXA 2QRHA 2J6HA 2FXIA 1DFIA 2I4MA 4YT8A 1OH8A 2WYHA 1JEJA 3BX1A 4HEA1 3FKSD 4NKRA 1I36A 2QQGA 3KELA 4WVFA 3NDJA 1V8DA 3IQIX 4YUZA 2VIIA 3H6GA 1G8JA 4F4CA 4WFKA 2FLWA 1Z5WA 4DNFA 5CP8A 2H92A 2PZJA 2YZMA 1P75A 5IN5A 1YNOA 1BX1A 4URUR 4OUDB 4YALA 1N36B 4XDHA 1OXKB 5I5YA 4MLPA 2J46A 2EEZA 2B1QA 2FP3A 5EIFA 1G3UA 1RZRA 3B51X 2C7OA 2W2MA 4A0HA 3ST7A 3HDVA 1P2TA 3EPHA 1QQTA 3AOEA 3CVZA 3S3TA 6REQB 1YACA 1JFFA 3LDFA 1QFZA 1IIBA 2OBNA 2EP7A 3T35A 1EZZA 4UCXA 4ZO8A 3M2PA 5EIAA 2VYVD 3UHJA 4MW7A 2HVSA 1C9DB 2IDJA 1PL7A 3FOEC 3H11B 2C5GA 3T4PA 3UTCA 1GAEO 3ZHRA 3EIOA 1QB8A 1QH8A 3FB1A 3P2EA 4OU4A 3QJGA 2YNMD 1W8DA 2H51A 1N2ZA 3FCCA 4ESHA 2BIFA 3CCBA 1VQ1A 2RD2A 2P1RA 1EDEA 1O6CA 4KQJA 2JLXA 8MHTA 3AT1A 1VE7A 1JDEA 3TEJA 2JGDB 1XC7A 1KKLA 2AOUB 3S28A 1T91A 2VJYA 2R5FA 5LQSA 1P9OA 3KHRA 1IPHA 1ATZA 1YA4A 2VP0A 4HVLA 3FMOB 1M8KA 1V6SA 1YQEA 3T7RA 3V55A 3V80A 1W34A 4MGEA 4DDVA 3P71T 4TWBA 1WJGA 3T0IA 3JWJA 5C1DA 4YPVA 5IJXA 2PEZA 4H17A 4XIIA 2QVXX 2CJYA 4HQKA 3ILVA 2OHGA 4JH0A 2RGRA 1WE2A 1Y82A 3RGGA 3GRUA 3OCUA 2HK6A 3UJAA 3N43B 1Z8HA 1P4AA 4H4DA 3NV9A 4XYMB 4C0QC 2PU7A 1NUAA 3S24A 1SXJE 3IEMA 1FNNA 3M1LA 4NH0A 2CW8A 3EXEB 4NK4A 5M5BA 3IIJA 3CUTA 3Q8WA 1AZWA 4U6SA 4FWIB 2CNOA 4HQ0A 2GN4A 2XD4A 2F1HA 3B6KA 1P33A 2P75A 2O3UA 1N56A 4I36A 1Q6ZA 3L01A 3TX2A 1J99A 2ECKA 2ZIVB 3PJDA 4LI3X 3E81A 3DMDA 3QKUA 4ILKA 5CM2Z 4RSGA 2C7RA 1EUYA 3L1VA 2C78A 3BUSA 4NBUA 1CW2B 4Q9KA 3R8XA 1WW2A 1ACMA 2DFVA 2GEBA 5CNJA 3SX4A 5F2NA 5G0UA 3AHHA 5HFAA 3FNEA 5CBKA 1QVWA 1ORHA 2VRWA 2O1EA 3N74A 3S2GA 3O5AA 4M8NE 1TEVA 4PG5A 3A6ZA 2QZJA 2O3RA 3G2QA 3IEPA 3QLTA 3IJ5A 1XNJA 4MGIR 2Y0EA 1SCNE 5DYWA 1I8TA 4QYIA 4G85A 4E32A 1JHOA 3N05A 4KXUA 4LMYA 1P2FA 2E4WA 4Y6QA 1E59A 2GJ4A 2IOHA 3AW9A 3P9ZA 1X0VA 3SXUB 1BKDR 1KR2A 3VYWA 1BQ3A 4JUAA 4BVKA 4ZK6A 1HE5A 4XPIA 4XI9A 2VJQA 3FKIA 1EDDA 3P9PA 2OM6A 4JT9A 4YJGA 4IFBA 4E3ZA 4XD2A 1WZNA 3M1YA 2I8CA 3HT5A 1RHJA 2ZZKA 3AHFA 1K4YA 5CLFA 1KJJA 1EGQA 3BL6A 4ZCPA 2P40A 3EDOA 2HNKA 1KU0A 2VUHB 3GRZA 2GPWA 4N01A 4OG2A 1TXGA 2A1TR 3UM9A 4I50B 4N7JA 5IULC 3ZWDA 3AONB 4R2JA 3HM9A 1Z0FA 3RJMA 4DV7H 3GWGA 1TJ5A 4OB6A 1MD9A 1LFAA 2IYFA 2JEGA 3TL6A 4BTLA 2YV3A 4KGDA 1VHWA 4XPZA 3GLVA 5GJVC 1I0LA 3CYFA 5BWMA 5ITVA 1CEEA 2AN3A 3ANYB 2DYKA 1SBNE 3K3VA 2CL0X 3DBHB 2PRYA 3E5MA 1ECGA 4HDMB 3BZWA 1UK7A 4MIYA 4UUBA 3U13A 2AOWA 3T9BA 1PJTA 1TA9A 2M98A 2WM9B 3WJ1A 5A06A 1KP3A 1OLUA 2OZVA 4ZOLA 5IUJC 1R0LA 3QF7A 2OB1A 2J41A 1TYBE 4RMIA 2VJPA 2QYSA 8OHMA 1DBRA 4IBOA 4DAOA 3HB0A 3N1UA 4YI3A 1KO1A 1KY5A 5H3HA 1ZH0A 1RPZA 1X7XA 1BVYF 1P1IA 3VDXA 4TTJA 1M8FA 3M1IA 4GFDA 1PR2A 1W1IA 1II9A 2YRFA 4Y9UA 4AZ0B 1T0BA 2WHPA 4EWLA 4Z54A 4KITB 1GPWB 5CVDA 2H4YA 2JL1A 4CODB 3AFNA 2OYRA 2XUIA 2GJ9A 2Z2XA 4ACAA 3I6MA 3UH1A 3A7DA 2ZLBA 1I30A 2O2CA 2AKYA 2ZE5A 4ZMSA 1QAOA 4EL5A 2VL7A 1K06A 4DA0A 2HI0A 4DUYH 4DVJA 2W6MA 1FVFA 1YJAA 3GGDA 1Y6GA 4PZ7A 1JEQA 4YRAA 2IEDA 1NWHA 3O31A 1NRWA 2FOIA 1RWPA 4A5OA 3WGUA 4BX2A 4Q44A 1X9GA 3R5XA 4ZV4A 3AFOA 3EF1A 1WNFA 1M67A 4EBEA 1YL7A 1RC0A 2IZ1A 3JQGB 1V48A 4TKZA 5G0WA 3ZU4A 4Q16A 4OLBA 3I37X 1JLRA 3TRDA 1E58A 1KEWA 3GLSA 2XWQA 4D8VA 1J24A 1P1BA 3BA9A 1FLDA 2H4XA 3MAGA 1CU1A 3G0DA 2I65A 5JQGF 1UF9A 4QGHA 3ZCXA 1JBEA 4KBYA 4L4UA 4C76A 2JIQA 1QMGA 4AP5A 3IAM1 2VPYA 4D6XA 4X3PA 4ZARA 3UMVA 1OTHA 4OHYA 4DCMA 4R71A 1E2JA 2ODAA 3FRHA 1IQ0A 3H3VH 2GZ1A 3PL1A 5JJIA 5C8DA 3ZS9A 2AQHA 4CNBA 5IF9A 1YHZA 2ZTHA 3EHDA 1MJGA 3PXEA 3JYLA 4CR6A 3GQBB 2AJCA 1E2PA 1T8RA 4L85A 3AF2A 1Z29A 2JFZA 3CXRA 1RYFA 1WDLA 2GK6A 3AM5A 2PX3A 4HQRA 4W5HA 2PN1A 1QIGA 3DBIA 1O75A 1XCOA 2WJ3A 3DPUA 4ISBA 2FF5A 2WPDD 3NFRA 4IUBS 5DEOA 4EARA 1OB2A 1FQWA 2E9SA 1TTTA 1X1AA 2IUEA 5DM0A 2X7XA 4KNVA 3MHPA 4OKIA 1ZX1A 2KX7A 2Q4RA 3V8VA 1RJEA 2Y2UA 2C20A 3DAPA 4M0PA 4PZDA 4B33A 4D9IA 5AYVA 4LFBH 3G8BA 4WLFA 3OX2A 3AU9A 2H00A 3OUTA 3OZVA 1UMBA 1KNQA 2VYVA 5DTRA 5E2BA 4AT1A 1COZA 1NC3A 1VHQA 4JJAA 5BV0A 2OZLB 1M34E 5AVZA 5K0CA 4A0FA 2C9MA 1TTHA 3S8YA 1CB7A 1R6VA 1YCGA 3CX4A 2JK1A 2XUZA 2CLDX 1H2FA 1M6EX 3IDZA 4R2LA 1DTWB 2IYWA 3EVGA 4C4XA 4ZFNA 2IYNA 5AW3A 1HV8A 1X7DA 2VZ8A 1ZKMA 2AT1A 3D4NA 4IIHA 4MUYA 5JPIA 1F06A 1QHGA 3JZ6A 1SQGA 4D4IA 1QPGA 3MOIA 3OU6A 4E5PA 4NX2A 2Q2WA 5FJJA 4TZ6A 4NPHA 1U4NA 3NBMA 2DKNA 1MVLA 5IP7G 2VUMA 2YUTA 1JBQA 1KQPA 1GL3A 3HCAA 3Q41A 4KYTA 3R0IA 2Y9MB 4P7KA 5AM2A 1MJHA 3UWSA 1FZTA 5B3LA 3FNBA 1F3LA 3F71A 4RPLA 3WWOA 2D5IA 3MR5A 1JQBA 4I55F 2XTZA 4UPVA 3VR2A 1Z39A 3BE4A 1VIYA 4A91A 1ZUIA 2FUCA 4ZCMA 4JLNA 4CG2A 3MQFA 2VPQA 4GX2A 3T3DA 3L8FA 1IM2A 3NHFA 1XZGA 1NYTA 4UVIA 4EGSA 2Q1TA 3BMCB 1AV7A 2P5SA 4RU1A 1CY2A 5AM4A 2UV8A 2I4IA 4HLNA 4LHEA 1XDUA 1NA5A 2OQ2A 1KEPA 4MVJD 1L4MA 2AD1A 1V9CA 4LZPA 4TSFD 3UAOA 5KT4A 1OZHA 1W36D 3DTVB 3QTTA 1GAWA 1UQRA 3ODGA 1YR6A 1R9JA 1EAMA 3KQSA 4RMGA 4GLJA 3UMRA 4H1HA 1R0CA 3WL5A 1DWOA 1QNFA 3BRSA 4MV7A 3C5CA 3P0JA 4A93G 4BQIA 3KSZO 2NNLD 1NXXA 3LRTA 3QMWA 2JEOA 4PZZA 3CF0A 4P8RA 2BYTA 3IH5A 2ZXFA 3V1YA 2PS0A 2R85A 5DYNA 3L7BA 3DNPA 3JQ9C 4PYMA 5DIZA 5AVWA 2O8DB 1KPHA 5FOVA 3OZXA 2CN1A 5BY2A 2A86A 5EKDA 1U5BA 1XTKA 5BV1A 5EHQA 1RPNA 2HQOA 3QLUA 4BU1A 3D7KA 1W4RA 3RIYA 4KTTE 3KR2A 7MDHA 4X1OA 1TGVA 3U4DA 1QQAA 2BSXA 3GJ4A 1PJCA 3L0SA 4BFWA 2H1SA 2WD7A 3BD7A 4I6EA 2AW3A 2O4UX 2Q50A 4A3CG 1JXQA 1PR5A 2X40A 1KYYA 3LX4A 3QE2A 1UZNA 4LC0A 4N6OA 5D3KA 5JRDS 2HK8A 2V7WA 1WX1A 4KJXA 2Z3WA 2VHWA 3KXDA 3T5BA 2XBMA 2FSUA 5KFBA 2AX4A 1BVRA 2WSSD 2FPRA 2FY8A 3QW4B 4ONEA 4TT3D 5T3UA 5CFRA 4AMZA 3GP3A 5E8JA 5HM6A 1Y3AA 3QLVA 1H2ZA 2CLOB 3A37A 4K28A 3JALA 3ODPA 1QGDA 1ZD3A 3P8ZA 3NTVA 4ZQHA 3WYCA 4CQLB 4E46A 2PKYX 5HKLA 3A70A 4YRPA 1X1RA 4OU5A 4RD6A 2NUTA 5B55A 4D46A 1QPZA 5FBKA 5PNTA 1JRLA 2HT6A 4CM9A 1XU4A 2YL2A 1QBKC 2VOEA 5L1KA 3AK4A 3IC5A 4B79A 5KTMA 3K9NA 4J76A 1T1EA 5IP5A 3TCNA 3VYTB 3TFQA 3H97A 1B2LA 3D3WB 2V6GA 3F9CA 4AS2A 5K1ZA 3K5WA 2JA7A 3RKSA 1X3SA 4R5MA 1T29A 4RNDB 4D8TA 1MHTA 5H1YA 4TROA 2XPCA 5KCZA 4GPEA 4Y1EA 3UK7A 3Q88A 2XQJA 4LSXA 1ZJYA 5KQSA 1PTKA 2G09A 3BCRA 4Y6LA 1X7XB 4PZLA 4OKSA 4UHCA 1WCMG 3Q3HA 3BCHA 3CEBA 1CZLA 1DEXA 3U80A 5IJWA 2JLBA 4UTVA 2PL5A 3AOGA 5FFFA 4BNXA 2VJDA 2QYTA 5TGTA 3QVGB 3VISA 4ED7A 1ISRA 1VJTA 4U2BA 3HRKA 1T8WA 5CBPA 2FR8A 2AFIB 4CQJA 1VIDA 2C04A 3FDJA 2Q6KA 2W6ZA 2R93G 1V4VA 4MEJA 5KMGA 1RZRD 3RWOA 4YCNA 1O77A 5M34A 2QLTA 3IBYA 3LHSA 1P62B 2R0QC 4YAKA 2QRVB 5HF9A 1WCMA 3TW0A 4DUZH 2HMVA 4K88A 4V2UA 1KYWA 4AWBA 5FNVF 4QW9A 2C3MA 4LOAA 1UPCA 3FKSA 4X8LA 4P6VF 1FVOA 1EP3B 2GQ0A 1YIDA 4CMIB 3W79A 4AD8A 4ZO4A 1DJPA 1WB4A 2PUTA 3JVUA 3CJQA 4NI5A 1PFKA 1MT0A 1YR2A 4WK6A 1A7AA 4CU5A 4WN9B 1K7YA 1SQ6A 4HB2A 3PGA1 4B35A 5C8VA 1JWBB 2ZRGA 3GC6A 5HR5A 4LTMA 1I0IA 5KG0A 3D6TB 3W78A 5MF6A 1IQPA 2Q3FA 2QLJA 3DVSX 4LNUB 4GMKA 4E51A 3F5DA 5J2TF 4L2IA 2IXGA 3I28A 3VYVA 3F6BX 5DYIA 5DSZA