5BPFA

Crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
291
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHESVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine-D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
total genus 89
structure length 291
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bpfA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bpfA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bpfA01
2QF7A 4O7SA 5EZYF 1KBLA 4EG0A 4FFMA 4ME6A 4HNUA 1ULZA 1EZ1A 2YZNA 5C8YF 4E4TA 2HJWA 4O81A 5BMVF 1JLLB 3BFPA 1M0WA 4MV7A 1Z2OX 1GSHA 4O4IF 2YZGA 2XCLA 3KALA 1Z2PX 5CB4F 4MV6A 1E4EB 2V58A 5IYZF 3N8DA 2VR1A 4L1KA 2VHEA 4MV8A 4TV8F 1SCUB 5GONF 4O4HF 1DV2A 3ORQA 3VOTA 4O7WA 4M9CA 2YW2A 1BXRA 1B6RA 5LP6F 1JDBB 2J9GA 2V59A 2V5AA 2WYOA 2NU9B 4FFNA 4C5CA 2CNUA 1W93A 2R6FA 4YJ3F 5I47A 3BG5A 2FPPB 3RFCA 1AUVA 4IIJF 2R82A 3SE7A 2PVPA 2FPIB 1CE8A 3BSYA 4O7VA 2Z02A 3GLKA 4FFOA 2R85A 4O86A 4FFRA 3G8CA 4HR7A 3BSSA 1EYZA 4RZQA 4O84A 3RUPA 4EGJA 5HV6A 3TIGA 4Y8VB 2X0SA 3VPDA 3UFXB 5CA0F 1KJ8A 5JVDF 1KEEA 2YS7A 3R5XA 2SCUB 1I7NA 1KJJA 3BSWA 2FP4B 4DLKA 4XYLB 4O7LA 4EGQA 1DV1A 1EUDB 3V4ZA 3JZFA 5LYJF 4YAKB 3QFFA 4EABA 2W71A 3VPCA 1M0TA 3WO1A 1EUCB 4MA5A 1IOVA 4MA0A 2P0AA 2I80A 3U54A 4M9UA 1IOWA 2C00A 4YB8B 1JKJB 2DWCA 4NYEA 1CQIB 1W96A 2YZMA 3TIIA 5DMXA 4I55F 3K5IA 4O7YA 1GSAA 1Z2NX 2GQSA 3OUZA 5H80A 3Q1KA 5KX5F 2R84A 3TINA 4IWXA 2YRXA 2HGSA 4ZOLF 2YS6A 3U55A 4C5AA 5LOVF 3U9TA 4FFLA 4XZ3B 4WD3A 1UC9A 3N6RA 3R23A 4I4TF 5FNVF 2GLTA 4O7ZA 2W6QA 1UC8A 2YRWA 3AW8A 4O4JF 3JRWA 1KC7A 1CQJB 3G8DA 1GGOA 2GPWA 1KJQA 2YZLA 4J6EA 4O7TA 2DZDA 2CZGA 1GLVA 3JRXA 2ZDHA 5LXTF 3VA7A 2W6PA 4C5BA 2NU7B 1A48A 4XX0B 4TUYF 2IP4A 3ETJA 3NUAA 3K5HA 1KJIA 1I7LA 2NU6B 4IWYA 4O2AF 3TW6A 1PX2A 3HO8A 3WNZA 1EHIA 5C1OA 2NU8B 5HBRB 1JDEA 4FE2A 2W6ZA 3MWDA 5J2TF 3AX6A 5JQWA 1C3OA 1VBHA 4IZOA 2R7LA 2CQYA 2DIKA 3LWBA 2GPSA 3JZIA 3VMMA 2I8CA 3I12A 1VKZA 1CS0A 2Z04A 3KAJA 2PN1A 4MV3A 5JQGF 2FPGB 4YAJB 4EAAA 5JVLA 2PBZA 4O2BF 2NPOA 1GSOA 5C1PA 5BPHA 3TQTA 1VBGA 3DF7A 2ZDQA 4O7NA 1T36A 4M99A 2I87A 3KREA 4I50F 4FGRA 5J2UF 2W6OA 5K2MA 4DIMA 4WBNF 4HQ6A 2R7MA 2CNVA 1BNCA 1WR2A 1M6VA 3U9SA 4EA9A 2OLSA 1KUTA 4FFPA 4TV9F 1AUXA 5JH7F 3HBLA 3LP8A 3R5FA 2W6MA 4XYMB 4EA7A 1A9XA 4ZHQF 4EA8A 1OBDA 2FB9A 4YBZB 1PK8A 5D8DA 5CA1F 3WO0A 4O83A 3K3PA 1OBGA 4O82A 5KKNB 3Q2OA 3OUUA 4O7RA 4IHJF 4GGMX 2NUAB 1C30A 2DLNA 3HB9A 3VPBA 3RV4A 2YL2A 2R7NA 4ZQIA 3KAKA 4M98A 2ZDGA 3ORRA 3RV3A 2YWVA 2R7KA 2W70A 4MV1A 5LA6F 4MV9A 3E5NA 4HNTA 2R86A 1KJ9A 4MV4A 3R9RA 2XD4A 3GIDA 4FU0A 2R87A 2YYAA 5BPFA 4ZI7F 4QSHA 1B6SA 2GQRA 2QK4A 4HNVA 4MAMA 3MJFA 2CNQA 3R5HA 2W6NA 5CAEB 2VQDA 3ETHA 1E4EA 3V4SA 2VPQA 1DIKA 4YJ2F 4O4LF 3MWEA
chains in the Genus database with same CATH superfamily
2V0GA 4ERNA 2R1VA 4DDWA 4ZDIA 1RABA 2VUSA 3DT8A 2ZJ7A 4X64B 3N7AA 4TT3D 1V4YA 3VNVA 2ZREA 3IGFA 3L1KA 4ZVTA 2OB1A 1EB8A 1DC8A 1IQ0A 4BVKA 3B3AA 5HIMA 8MHTA 1R0ZA 1KO1A 4BGVA 1RQRA 1O4WA 4BGIA 4FFVA 3T3PB 4H7JA 3T9CA 5K3AA 4C0SA 3U5ZB 4A3JG 1OYWA 4NS4A 2WI8A 3SVTA 2JLRA 1S2MA 3E18A 3II6X 4IIJF 4ZT4A 3GPBA 3B36A 4JI5B 4NJEB 3BKWA 4UKDA 1UBLS 1ZHHA 3U09A 1C9NA 3D7NA 2WA1A 1TEXA 4DLWA 4IGEA 3CRMA 4FFRA 3VJMA 4A6DA 4HB3A 1N5IA 5ECGC 5CLQA 1QOZA 4QWCA 4PBSA 2MHCA 2N47A 4DA4A 3H6KA 4JLUA 3N2KA 4ZP1A 3TXAA 1TW2A 1L5HB 3GHHA 3P5SA 3O9ZA 4KLCA 2O5VA 4LE0A 2GBIA 3V6JA 3GFQA 1QORA 3DEIA 3NONA 4F8YA 4XB1A 3MR2A 3NV9A 4DCTA 4KQIA 1ODFA 3O0TA 1TUIA 3TGWA 4PRLA 2OVFA 4AWBA 3R0ZA 5FF9A 1UBOS 3U3JA 5HW0A 3TQIA 3RBXA 1K5GA 2DP4E 1N6PA 4Q3BA 2IBTA 4C7XA 1JDZA 4U5XA 1XZKA 4BLOA 2O2HA 4W9NC 3SGLA 5AKYA 4WKOA 3UFBA 3ZDQA 4A5SA 3UYYA 1GDDA 2ANCA 4ONEA 2RGXA 4QT4A 3TRDA 4MRVA 3UB4A 5H59A 5IVKA 2WTXA 2I62A 2DQYA 4A4DA 2P68A 1YRYE 3W2HA 3MWGA 3ACDA 4MRPA 2BFOA 1C2TA 1WCWA 2LWIA 1U9IA 2F4VB 5CIWA 4O2RA 2B25A 2REBA 1CEXA 2E6UX 3K35A 3GO4A 4RPGA 1WXHA 5BOSA 4HTFA 3TSCA 3O47A 4GVLA 4PW0A 3TG8A 1SUEA 3NBZB 1PG0A 4H4DA 4XFJA 4OFXA 5F21A 2Q5CA 2JZNA 4ZCIA 3OX2A 3NRJA 3RAGA 3L6DA 2OOSA 2GN8A 4CMBA 1UNNC 3Q12A 1OQAA 3KOOA 2CLFB 3QEMB 3ZDYB 4TZTA 4M7RA 4UE6A 1QZXA 4BO0A 4DWOA 2CQYA 4UBMA 3UJDA 2DIKA 2NZVG 4HTFB 4JLWA 2OFFA 3HN6A 3OAAA 3SXJA 3IAHA 2VDUE 4WUTA 4C07A 3VOBA 4UNNA 4NC9A 1CUBA 3CWQA 1IN8A 2Q8QA 3SQWA 1TWCA 4JQCA 3RHFA 2Q3HA 4WBNF 5BWOA 4ZO8A 2WAQE 2AJDA 3DZCA 1RPZA 3AJRA 5EEHA 1T9BA 2XWJI 4B3GA 1OZAA 4LF9H 4MS1B 5ILGA 1CVIA 1XYGA 3ZE7A 3PHIA 3NAZA 4B80A 3Q6MA 3I6YA 1EWKA 4ICIA 1ANKA 4G9BA 1BA2A 1PT8A 4JODA 4CYMA 3K3PA 1RJEA 4BTEA 1EFHA 3PUWA 3K9LA 1LBIA 5C7LO 1SUPA 3PHLA 3FTEA 1XRPA 2W22A 1YB5A 3MAAC 3STTA 4OLFA 5BYKA 3C0FB 2R6AA 2OKGA 1YS7A 2H17A 1P44A 5EGSA 1YR8A 2IHYA 3AVYA 4RSHA 2WIJA 1KKLA 3BGWA 4GLOA 2X77A 3RRBA 3IPXA 5AESA 1QNFA 2JIDA 4MWEA 4AMVA 4AT1A 5HRUA 4ZVNA 2GPJA 1PGQA 2BMEA 2JLZA 1R6XA 1WXEA 1D09A 3W0LB 1AOXA 5ENDA 2AN9A 4LGYA 3WFJA 4I9FA 3HV2A 4JOQA 1PDWA 1XQXA 2QF7A 2JLAA 5DSXA 2NTEA 3R9IA 4CUZA 3OQOA 5KT5A 3LYHA 4KFUA 4PZ0A 2OAEA 1PZNA 1FQJA 1EKXA 3W9UA 1DQZA 2C61A 4GF5A 1L0BA 5F51A 3IEUA 3KAQA 1DX6A 1VHTA 1PR3A 4MW6A 4L7VA 3RHSA 2ZB4A 3T0FA 2NXJA 3K6JA 1LK0A 8ADHA 3PKIA 3ZHCA 1JAHA 1Z4LA 3LLCA 5I7SA 5FXMA 5KVSA 2FCAA 1ZY2A 1M10A 2VRWA 2I3BA 2XUHA 3KQNA 5E7QA 1IBLB 2DR3A 4QREA 1UM9A 1U2ZA 2HAEA 5C44G 4BWFB 4I1IA 2BM0A 1TK3A 4OX9B 1P9RA 1MRNA 4XVUA 5YASA 2GD1O 3T1TA 1ID8A 5JH7A 1H42A 2M05A 3ZVRA 3Q5DA 2CCJA 3J7TA 2HA7A 1XTRA 3UWMA 4CTNA 2R93G 4AKHA 3T7DA 2AFRA 1VPWA 2X22A 5KQPA 4EKNB 3IEIA 5JMOA 5J1TB 1UM9B 1MVOA 4X8MA 4D42A 2DEUA 2OBBA 4TVSA 4PIPA 1EDZA 1K83A 3ONWA 3KHGA 4JLMA 5IWCA 5JH7B 4BECA 1YGPA 5ITZA 1VP3A 3F5FA 2D5LA 1ECPA 1Z6XA 4XCXA 2WMOB 1B76A 3TUZC 4H2DA 1J0DA 4A2BA 3AI7A 3ZGOA 3LI2A 1ESDA 1IIBA 4BDTA 3QTTA 2XAUA 2YUIA 3A4LA 1X92A 1KK3A 3KVVA 4HBGA 3DL0A 3LO5A 1KSFX 1GUAA 2PGAA 2ZJZA 1XR3A 4BBPA 3NBYB 2O14A 1WBDA 2BHLA 5CHEA 2J3IA 3DZIA 3NW9A 4QIWE 5EXEA 4CTMA 2ZR8A 1RNLA 3F3SA 4GP9A 1D0SA 4TYWA 3VR2D 3KCQA 4N03A 1CC1S 5IVDA 2JCBA 2UUCH 2GXAA 1CUSA 2XMQA 4URFA 4XH9B 5G0WA 3LUCA 1MV8A 4RFVA 3PLRA 1LJ8A 3C6KA 4JSRA 1BHO1 4P82A 1R4MA 4N0PA 2ERCA 1D5WA 2A0XA 4ETSA 1O08A 3E1SA 2P65A 4DG8A 3TOXA 5IKEA 3VISA 1O8CA 2PRZA 2VPXA 1ZJYA 3WXMA 2ZSKA 4B87A 5BWRA 2J09A 3RKUA 4WKPA 2WM2A 1B8VA 1Y34E 2Z6AA 3UAWA 1CRQA 5JVLA 4TSKA 3R2JA 1KEEB 5DT9A 5KFEA 1TA8A 1VRVA 3IEPA 2PIDA 2WWHA 3BM5A 4IVPA 1R6DA 5J2UF 4FVTA 4N01A 3ND8A 1UBNA 4DR2B 2FPPA 5AK0A 4IQ4A 2QMQA 4TV9F 4CE5A 3VVCA 4N6OA 1V5IA 1Q50A 2CL5A 3WADA 2IZZA 2PLRA 2Y2VA 3EX7C 3FKIA 2QLJA 4PTZA 4PCAA 1YJXA 1QHNA 5CA0B 4H9GA 2PIAA 1BG6A 1C3JA 3HLKA 3UMCA 3CX6A 4EI2A 1QWOA 4COKA 5HCIA 3R7AA 3RK0A 2OGSA 5HK9A 2RIRA 1V7CA 5F2OA 4J7AA 3R0VA 1E1CA 1BVUA 2O6LA 1GZ4A 1MH9A 2F3SA 2CVQA 4RKRA 2PNJA 3RYCB 1BX1A 1P7VA 4M53A 3PCRB 4JI6B 4TLMB 2HUNA 2LNDA 4QDUA 2IFTA 2LR0A 4NXNH 5IT5A 1LRLA 1XZMA 1XC7A 1GXSA 5L3RA 1H2YA 3ZGVA 1YHYA 3CF2A 2B1GA 4URZR 4EF4A 5HR5A 1E1CB 4DN6A 3UUEA 3UHAA 1HQCA 1SCUA 4WK2B 2X8BA 1J2EA 1RRMA 3FYUA 5IDYA 1SVIA 1I6UA 1XTZA 3T7SA 4EO9A 3ROFA 4HDQB 1MVNA 5FR1A 4D3SA 1E5VA 1GZSA 1L5VA 1JPVA 4XW2A 1KDVA 1NA5A 1HQDA 2UVUA 1SCUB 1MA0A 3PB3A 2SECE 2XB9A 2ISSD 2FWNA 1HTWA 3PDUA 3Q72A 5JS7A 3AV3A 4FQ5A 2VDRB 3FYUB 2QZ9A 3SOZA 3HM2A 4R0NA 4PG5A 1XTUA 4LOLA 2WJWA 3C14C 2A1TS 3AL2A 5DCWA 3E7FA 3E4CA 3R7LA 1E9RA 4G67A 3H6HA 1AA9A 2R66A 3ROMA 4A0HA 1WF3A 2QMZA 1F8YA 5KHLB 3AERA 3PNYA 2YXPX 4MTDA 4OXRA 4PCVA 1Q1AA 4D5GA 5H8WA 4Y3UA 3AKYA 4IGAA 1E2HA 1L2TA 2ZM6H 2E1RA 4L72A 5ITWA 2N1MA 3RU7A 2CF5A 4LV6A 2Z2YA 1M0EA 3WGZA 3MFHA 2ZIFA 3MS7A 2QQEA 2VTVA 1UBKS 3NM5A 3AERB 3RVBA 5E38A 1MPTA 4CMCA 5C52B 4J2OA 1DMSA 2PLNA 4I81A 3DHNA 2ALZA 4LCBA 3AI3A 3WYCA 4YFVA 2VJBA 3GLIE 3RQIA 1KAHA 2ZT7A 3BA8A 2XMRA 3NTQA 1JPUA 4K28A 2FVYA 2DWPA 3C41J 3A9VA 3BH0A 5BR8H 1IQPA 3HY3A 4B6SA 3DV0A 3GVIA 1R6AA 1E2UA 5DWVA 1EBFA 2A4MA 1NSTA 5JUWA 2QJRA 2PMWB 2OILA 2XQJA 3PQ6A 4Q44A 4LF8H 1ICEA 4A3DG 3PTZA 1M7JA 5IM4A 1K6MA 4BTLA 1KXZA 4HADA 4GBGA 3JALA 2P5TB 1NUAA 5JBNA 3KPUA 2RGVA 4ZCMA 1NBMA 4CIDA 3DV0B 2B2NA 4OXYA 1J24A 1ZCFA 3TW8B 3DMFA 4FB5A 2RONA 2DUNA 2MDTA 1UBFA 2I76A 1U1FA 4DR7B 1R5JA 4R1PA 3IJEB 4LFCH 3AB7A 2OLKA 3JALB 2FHPA 3GR6A 4JP8A 4GYKA 4HWTA 2G71A 3NIDB 4EKIA 1TT7A 1VRCA 3HJFA 4DE5A 3BN3A 2VRCD 2HGWA 4IDOA 1FFAA 3QXCA 3DLAA 5JLJA 3B6EA 1BMTA 3TQTA 4M7OA 2FW6A 1U0LA 3AYHB 1SCAA 4CT0A 2RB5A 4XD2A 5FBWB 4RXTA 4PC3A 2ZSJA 4ZAGA 3GT7A 4PO1A 2JB9A 2D0DA 1WUHS 2OQIA 2BKUA 3OTIA 3HI6A 3FNIA 3UBTA 1G9TA 2R65A 2FE3A 2IDZA 3CU5A 4AUKA 3HL4A 3VR4A 2QX8A 1Q1ZA 3FSRA 3WV4A 4AN4A 2IVFA 4FE3A 2W9BA 2XUDA 2ZRCA 4MYUA 3K2QA 1UBTS 2TSYB 1E5QA 1M6WA 3IAS1 1SCQA 1O54A 3SZOA 1L5NA 3ZE2B 5I01A 1GGMA 2W2NA 1O94A 3MGKA 4BQRA 1CZRA 4KYTA 2W9BB 1KDYA 3X1KA 2OCAA 1QP4A 4ZJPA 1UIMA 3T0IA 2YMLA 3ZWKA 3H1TA 1X1RA 3NGXA 3EXEA 1VLZA 1L7VC 2F6RA 1CKNA 1N5KA 1OREA 4K6CA 2F9MA 4QU5A 4WK6A 3OECA 2HTFA 4BEVA 2XA9A 1EX9A 4N39A 1T3TA 1G41A 5ALZA 4FR0A 3WISA 1ZIYA 1CIVA 4M9XA 4M8NE 1IE3A 1RADA 4HH4A 1U2PA 1DBRA 2O2SA 5EXSA 2BEWA 4G37A 5K8UA 3P19A 4P5PA 2GERA 1CKNB 4HDKA 3EEOA 4H4CA 4HDMB 3OSZA 4KRFA 4IY1A 1L7PA 2YNMA 5C5EA 3T1NA 2MT9A 2HNKA 3U7QA 4GXTA 3D6HA 4J0EA 4MXDA 4HWOA 3MA0A 4GL2A 4Z2YA 3WGHA 2BEWB 4ZHQA 3U4QA 3LUJA 3OFJA 4O2BB 4HDKB 3SHFA 1ZRNA 1U8ZA 1YIAA 4YRGA 1ACLA 4N65A 5KJ1A 3DQQA 2PD3A 4QM6A 3U7QB 2PT6A 1UXKA 1V37A 1YACA 4KBYA 1FLNA 4MGHA 4C4RA 1IXKA 5DYNA 2D1RA 3DYIA 2WWWA 1SD1A 3HWWA 4MUAA 3IE1A 1FK8A 5EHZA 4ZHQB 5JJBA 3U4QB 4B6EA 3BJIC 2C00A 2X86A 3HKDA 2VHYA 3AG6A 2XJ4A 3E9YA 3AOGA 4TXMA 4YCCA 3HYNA 1S4MA 4TUYB 4AZVA 4GI5A 4LWOA 4LMRA 3JVIA 2B4QA 2WJ3A 3EGDA 4C87A 3V1NA 1I1QB 1J1ZA 4NNPA 3HKDB 1WDWB 1XDSA 4OUDB 4ALMA 1KC7A 2R11A 3DMGA 3CBQA 4LW8A 2P9TA 3C70A 3WBKA 4YRMA 1IPHA 1QYVA 1KYWA 4QC2A 4KPYA 1SEPA 3DLIA 3EGDB 2R751 1X15A 5F77A 1CKEA 5CEFA 1AHNA 2IITA 5C1IA 3WNZA 1ZL0A 2RGNC 2YHUA 5F7XA 4IV5A 2VLBA 2DT5A 3OMLA 2WJAA 2CJXA 1XD2A 5FWYA 2FEOA 1Z74A 3RS4A 2XADA 4QWEA 2FG5A 2CCKA 5ALWA 3IXQA 3RVRA 4GI1A 1W88B 2Q46A 1QP7A 3E48A 4MS4B 1VKJA 4JI7B 2FRDA 1TEZA 4GGPA 3DLPX 3VGPA 4FGRA 4PAOA 4TXHA 5FWYB 4Z7JA 1ECLA 1RWVA 2VCHA 4F60A 1AG9A 5JH7F 3R3XA 1GZ5A 1IHDA 1K6IA 1K4MA 5J5VA 2JVJA 3W5IA 3S2YA 2TS1A 5FPHA 3RKRA 4DUGA 4YDHB 3WAKA 3RIMA 3OICA 3K9WA 1NF9A 3R76A 1Z62A 4S12A 3S40A 2XTMA 3A7DA 2O8FA 4FDAA 1J09A 1VM6A 3KUXA 3ROGA 4Y8VA 2P4EA 1PFGA 5IKXA 3H2JA 1BYIA 1L5FA 5KG5A 3NWJA 2O2EA 1QHFA 3M70A 2AMJA 5AVYA 2QMYA 2VO1A 5GIPE 2OYRA 2IUTA 3DVLA 2B8EA 1M7HA 4GOJA 2W70A 2QUJA 2C7VA 4QXMA 1W73A 2FX5A 5EJ2A 2O8FB 3WGIA 2ZAIA 1AKEA 1G8JA 3ANTA 2GRJA 1J49A 1AV6A 4ND3A 3R5HA 1NG9A 1CERA 2EFYA 2IZOA 1IXYA 3RSQA 4QZVA 3PUHA 2BL4A 3FCYA 3MWEA 3GA0A 1ZXXA 1D7AA 5EIBC 1PFVA 4ZI5A 5E2AA 3W04A 4M1OA 2C7RA 3OZVA 4LQCA 4Y0VA 5A06A 3AUTA 2NNLD 4TL6A 2Q8PA 1LF0A 3LFTA 4XWTA 2Y0DA 3EXIA 1NX6A 2VP9A 3QJYA 5D3QA 3ZV6A 1U8AA 1ZNZA 3QXHA 1PG5A 3LECA 5KQRA 2FETA 1ZR2A 3IAUA 4Z4IA 4LZOA 4PS1A 5B2ZA 3O84A 4YO7A 1T26A 1NYLA 2QV7A 5K8IA 4CT4B 2HPZA 1GZDA 1XEWX 4ZJUA 4ZV9A 1XO1A 3EXIB 3I0NA 3N43B 1Y6QA 3EVNA 4WLFA 4OJYA 4F2PA 3DGFC 2HIXA 4HYKA 1N6NA 5FD6A 4YB8A 4ND8A 2II6A 1HFKA 3LWZA 1IJFA 1C30B 5CA0F 2BZGA 1TZJA 5K03A 3IIIA 1WF6A 4YP3A 1E3WA 5IJZA 1H6DA 1IEQA 4D6XA 3UO8B 4DJTA 4IIJA 4L07A 2GB4A 1YA6A 3VAZA 4XRRA 1BOOA 4FD2A 2PUEA 5JYEA 2EP7A 5D6OA 4MA5A 3Q0TA 4DA7A 4ED9A 5JY6A 4ENPA 5KFWA 3B1VA 3TNDA 3REOA 4YB8B 4QOJA 3A14A 4ND8B 4AO8A 3SXUB 4P2GA 2ASJA 5TPWB 1RI1A 4IFTA 2XA1A 4Q8FA 1E3WB 1ADJA 4Z0HO 1T3HA 2KX7A 3KPVA 3L0CA 4OIFA 2O3QA 1T9GS 3VZRA 5EKSA 3N75A 2PLAA 1WBJB 3A9UA 3LC0A 2WE7A 3ORSA 1I1MA 5F3WB 1ENPA 4PIMA 3C4QA 1W6UA 3DDWA 3NS7A 4RULA 1T0UA 2YJ5A 1WP9A 1GFIA 3SDZA 1F2UB 2OHFA 4E12A 3D0RA 2WYHA 2O3UA 3NBUA 2D2IA 4RF4A 1AUOA 1VCIA 4CF5A 2JVIA 3Q8QB 5DI9A 4DC1A 2FK2A 3QE9Y 3A6ZA 3B2EA 4D4IA 4FYIA 2WE8A 5FPQA 4RKWA 1RMTA 1BW9A 3SBDA 1QKJA 3QKRA 2W11A 4ZT3A 4V03A 5JRZA 3ZV3A 1GZVA 3NATA 1NI4A 3FY4A 4NV1A 4MKXA 5EERA 1MABA 4Z3OA 4NOMA 4WOKA 4KSYA 2W8ZA 5F7JA 3JQFC 2J0UA 3MJTA 4N76A 5F2EA 4HQFA 5IDXA 2GYYA 4BVLA 4GP7A 4C22A 3HXKA 4B82A 3TECE 1NURA 3CW2A 4AYTA 3L6CA 3UAYA 1OCEA 1XWFA 4QFCA 4KR6A 3ANLA 3FUWA 3DC2A 1SUCA 2I5PO 1NI4B 1Y63A 4R3UC 4CHIA 5BPHA 4R9NA 3CFYA 4BX2A 3T7EA 1KNQA 3OZXA 5FT9A 3NM4A 5TMBA 3WLOA 2PEZA 2J0UB 4EY4A 2O8CA 4OLAA 2ZI3A 3I2IA 4QXQA 1Q0RA 4M87A 3L1HA 2ZAYA 1JKFA 4PG8A 1C9MA 4U2BA 4EA7A 3GGJA 4ZGGA 5I51A 1CKOA 2P1DA 2WHQA 5DBEX 3WO0A 4F04A 2I3GA 3PUKA 1ESEA 1KY2A 1DTWA 3UFXA 4DPMA 2NT4A 1F0YA 5F12A 4MVCA 5NULA 3NC1C 2CNNA 5JO0A 4WLUA 1OWOA 4JSTA 1ZD8A 2UKDA 3QQMA 1AGNA 4MIYA 1E4GT 2CBXA 3PNMA 4QQ8A 3RRYA 3P45A 3GFFA 2R0QC 4ZCTA 2WT4A 2GEKA 4TGLA 1DTWB 4BJ6A 3HJRA 1YCDA 3T5KA 3IEXA 1XDZA 4ER7A 4YYZA 3D43A 1QF7A 4MUNA 2WB4A 1ISFA 5BR4A 5C2JB 4A91A 1FA9A 4K6GA 2GBLC 3CNLA 4HEHA 3N3BC 2FP3A 4NQZA 2XGSA 4YHHH 2YXNA 4P92A 4CIVA 2H16A 4Y2TA 2JFPA 1A5SB 1DKRA 4F3YA 1HZJA 1OKKD 4MR8B 3EVBA 4MMYB 4CV1A 3AEUB 2VATA 4WUVA 1Z2CA 2GEUA 3K09A 4HGRA 3KR1A 2YVQA 2WYOA 3OM9A 2PVCA 4LSGA 1X80A 5GADl 2E4UA 5AKZA 2GN4A 4RPKA 2ZAMA 3LZCA 1T1RA 2H0QA 2EJWA 1L5GB 2DPIA 2PGIA 5EI5A 1OH5A 1R7RA 3MCWA 2R82A 4XDZA 2B5OA 3TTSA 4RM2A 1YR2A 5HNEA 2HK8A 1DIAA 4ECEA 3EQ7A 5DTEA 2EL7A 4MNTA 5HFJA 4K0RA 2OCYC 4RF3A 1OR8A 4DUZH 3RUPA 4ZVQA 3ZCSA 1IZ7A 2HLPA 1X80B 1UK7A 4K7JA 4G0YA 1XRJA 1FFXA 1KJ8A 2JFUA 2XY4A 1YHNA 3DEAA 3BSWA 1R0CA 2E82A 1LX6A 3PDJA 5KYNA 3AR3A 3C0KA 3R44A 1TYBE 3W4IA 2XB8A 1YKGA 2PANA 4B71A 3VXKA 4FI3C 4YRQA 5JNLA 3HOXG 1N36H 3AF0A 4RK1A 2O0MA 5TY0A 2CXHA 2P3QA 5HCNA 4HVTA 2YVKA 4AS2A 1EGAA 4US0R 4WASA 3NJ8A 1FFXB 3MWYW 1T8SA 4E5KA 2B30A 4HPWA 4B45A 1FNDA 3ASUA 3I9FA 2VHZA 2AKAB 1RXEA 4HPJB 4UHEA 1TCAA 4WD3A 4Y2HA 1QZUA 4MWDA 3ZHOA 2QTLA 1Q1EA 2DKFA 2PSDA 3BFKA 3CUEF 1Z26A 3WGVA 1UK8A 5C31A 1E1LA 2KM1A 3H84A 5C8YA 1WXGA 2EFJA 2ZSBA 3W34A 4K2AA 3ESYA 4XVHA 2GOYA 3QHPA 2QSZA 4I5GA 1D4FA 5JSHA 3PPXA 1W36B 2R7AA 1WZ2A 5FLKA 3HR7A 2HLDD 4RCYA 1PDOA 2IYXA 3FSEA 4P5DA 5JNVA 1JKIA 1DC4A 5DG8A 3SKXA 1UFVA 4IYRA 1LPMA 3UV3A 5H5JA 2I6QA 5C8YB 1YAHA 2B1QA 3AESA 4TWIA 2VC2B 3QITA 4CQMD 5B1SA 4BCBA 4CKWA 4FBTA 2WUVA 1DWOA 2YV3A 3TZCA 1S3IA 3AQ4A 2FTKE 1MC4A 4GVXA 5H0IA 3BCHA 3GG2A 1K7YA 1FL9A 1KA9H 1ZU5A 1Z5UA 4MWSA 3ZUGA 1RBYA 3D8HA 4ZU6X 5D1NA 4O2BF 1FQWA 2QYTA 2GEBA 1K89A 4MQ5A 4LRUA 4BFZA 2ZDQA 3FMAA 2O3SA 1NI3A 4CG0A 4CCWA 1O9HA 3K2EA 3WWOA 4CKWB 3FA2A 3QVVA 2GO7A 4FT2A 4DM4A 5KTPA 1WCMG 3CF6R 2RHTA 2HRQA 3F78A 4ZHQF 2OFWA 3LUAA 2KBEA 2IHTA 4KO4S 2IRWA 3KEOA 2REXB 1KYXA 5JATA 3L1IA 3Q1LA 2R25B 4RAQA 5EZ6B 1I3QA 5JG7A 2NG1A 1OLXA 1K8YB 5KQLA 1M1UA 2OZPA 4KRYA 5KFVA 5J2UA 5I5WA 5AM3A 1XMIA 2HA6A 3KPYA 1NJGA 2XODA 2E2WA 1LS1A 4MUHA 5DM60 1XKLA 4LV8B 3WQSB 4CM4A 4X66H 2GHIA 1XJWA 4DR6H 4NG4A 1VE3A 2VI5A 4FFSA 3H5AA 4EITA 3EC2A 5I48A 3HA3A 3LHSA 1BEZA 4PX5A 2OENG 1NXPA 1CYDA 3WWJA 4M6WA 2WUWE 3EUFA 5GAJA 3WGTA 4PPGA 2COIA 2C20A 5HYVA 2NYVA 1QTRA 2D1QA 4CM4B 5UKDA 4EG0A 1RQGA 2R5NA 4UASA 5KVQA 1P5ZB 3ZHYA 4X44A 4Q8EA 1PHRA 2VYND 4QECA 3KYBA 4U2GA 2XOKD 3ICQB 5DI3B 5HMMA 3LC7O 1FNSA 4DCVA 1JIHA 3UUWA 4BDSA 1VYTA 3O8QA 2WWFA 4G9GA 4G8BA 4EJSA 3E0XA 2R6FA 4RK4A 4GKKH 3HYTA 4FW9A 1Q17A 3VM6A 1SB9A 2XE7A 1RRCA 3EHDA 3WLEA 2B8TA 4JT2A 2ZWPA 5CNKA 1N2GA 1HDYA 1QCDA 2XZPA 3ET5A 3O8QB 4N5MA 4EJSB 2V7QA 5DW0A 4DDHA 1S9FA 2IK8A 4BGUA 4I2VA 4IDGA 1PD0A 4O7LA 5FTMA 3OSNA 2ZUUA 1CY4A 2W71A 3OKFA 1MDBA 1PS0A 1RLIA 4ZI3A 2VQEB 3NKFA 1FUEA 1N7GA 4QW9A 4QU0A 1NRJB 5GVSA 4IJWA 2PFKA 2IUEA 3UHOA 1FCJA 1OOEA 2X23A 2YV1A 1JWBB 2YZMA 4PY2A 2DSNA 5JE8A 5D51S 2ETXA 5TNXA 2XE8A 4X61A 4MDEA 1D03A 1VLLA 2C9CA 1RJDA 4IQFA 1WCIB 2UUBH 4WQMA 3WQQA 3CINA 4X20A 4N40A 3VI4B 3IULA 1JQ5A 4DOMA 1K9VF 4EEZA 4A8PA 1O0BA 3DDOA 2YQ5A 1Y3HA 3WNVA 3NHKA 2V5UA 4MW1A 4S0XA 2R9VA 1FFBA 3WVNA 1P9WA 4RW0A 5IUJC 3I9V6 4BU0A 1GCIA 1HE1C 1SZPA 2Q2OA 3FPFA 2CB0A 4TRRA 4CLRB 3H4BA 4IMRA 3N2LA 5CLJA 3EOBI 2WQ6A 2BKXA 3VZSA 2JDID 1NNI1 1YBMA 1GILA 3UJ3X 1FW8A 1UZAA 1GR0A 4GEKA 1WOYA 3NOVA 5C5DA 1UOPA 4BY1G 4WLVA 2BGKA 4J4TA 3B8EA 1MNAA 1JTFA 2UZIR 2XUJA 1OXTA 3QF7A 1UBMS 1UZUA 3M89A 2NYRA 4Z1MA 4CC5A 1PCXA 1J8FA 3TZHA 4JIMA 1XLVA 4DMKA 1TECE 4D4KA 1C7JA 2J0QA 3KYIB 1WRVA 3U5TA 1VCMA 4ZREA 3HFSA 4GX2A 2RIPA 1QM5A 2OLSA 1YZYA 4F8EA 1UWVA 4B3RH 2BUCA 1LPSA 3H9JA 1ORVA 4NJEA 1AQUA 1V8BA 1ZMBA 1G7CA 2XIJA 4CM6A 4YV0A 4CL8A 3X2EA 1R6BX 1P1FA 5JAMA 4EL5A 3CSSA 1GD1O 4X60A 2VDMB 3OEHD 1L5HA 4G0XA 3ZGYA 4X00A 1YR1A 3UOGA 2PL1A 1GITA 5IWAH 4CKBA 2R7NA 2XTAA 5FBHA 3HU1A 4B8YA 4RVGA 2WNIA 1POXA 1ZUWA 3OTHA 1VE6A 2AC7A 1CUIA 1JF8A 5CURA 3OOSA 1O1YA 1JI0A 1UUFA 5D86A 1N48A 2IX3A 3RAFC 2EKZA 3EEIA 4HP8A 2DUMA 1ULHA 2UUPA 2VNIA 1XEFA 1Y3CE 4CKBB 3RFFA 4FFMA 3V32A 2FRVA 5EL0A 2PD4A 2I66A 5A3RA 5A9TA 3BXPA 1Y1RA 1WSAA 4JP1A 3CIOA 2WUDA 2YWCA 3HVIA 5TGZA 1XK5A 1NBME 1IG3A 3A8TA 2FAXA 1YL7A 3CUWA 4NAHA 2C0QA 2MSWA 2ZU0C 1SBHA 1ZIOA 4MCAA 4XEUA 3SF0A 4AJOA 3BG5A 4YR2A 3QEMA 1E2DA 1Y98A 3U48A 3H2YA 1R0KA 5C32A 2GKOA 1JDTA 3HM9A 1QPGA 1FYDA 1UMBA 3JRNA 4V3CA 2JIZA 4V0QA 5HOEA 4QA9A 4BO6A 5G3ZA 1DBPA 1UBEA 4OI4A 4YP9A 1K5HA 5FFNA 4YPOA 3CR7A 1OFTA 2EFGA 2WWYA 3GLTA 3L7DA 4D9EA 1ZOOA 1OW3B 5CYFA 3NHYA 4QWWA 4GX1A 4EFEA 1Z4QA 3CWZA 3EZXA 5KJCA 1B1CA 1UMBB 4DV0H 1ADCA 3C7KA 2FU5C 2SKDA 4DQVA 3ZG6A 5C8VA 4MS1A 1KZ4A 3S2GA 3CT6A 4Y98A 4R2MA 5JZOA 2GO1A 4TQRA 4BOYA 4DMHA 2BTQB 1EVIA 1Q3KA 2X9LA 4R40A 3ITEA 1VG8A 4ZMRA 4QQKA 2B5WA 1BH2A 1ZSNA 4URWR 4GL4A 3EBPA 4DL7A 4NMXB 2ZKLA 3WKDA 5DOZA 3WAJA 2BWJA 4QOFA 3KYHC 4JMPA 2B8NA 3L1JA 1ZGZA 4MARA 1QAQA 4CMEA 4ZQEA 5A4MS 1JTVA 1F0KA 2F2TA 4LNAA 3K9HA 4LX0A 3LG2A 2XA2A 3UJ7A 4KLZA 1DKUA 3H75A 4RDXA 1ZONA 1YDHA 2Y4RA 4L5AA 3TLJA 2G88A 3F49S 3JZMA 5EJFA 3RSSA 2VEOA 5E9JA 4HX2A 3MUOA 2JHFA 1KI3A 1V7QA 4KJXA 4U2FA 1FVFA 1QO9A 3O8CA 5K3CA 2QUHA 3RSFA 1M2WA 4AY5A 2V03A 2D59A 1OC4A 4X45A 4BPBA 2Z3ZA 2PJZA 3DAPA 3GV8B 4JB3A 2BMDA 4AKIA 2IYEA 3OOJA 4GI3A 3IOYA 4DIEA 3FF1A 1EE9A 2JK1A 5JD4A 1O77A 2J8ZA 5K0GA 4DLVA 3OZEA 5CYPA 3OP4A 1L5KA 1NN5A 4RYLA 4EY5A 4KACA 3PFWO 1J0XO 4GE0A 5EXXA 5BQPA 2CMKA 4JFAA 2VUUA 3QE0A 5DHUA 1QIFA 3Q3EA 3NVAA 1KVSA 4ZVPA 3NTVA 3LCCA 1I01A 1EUQA 2BQUA 4RY0A 3OJFA 3EH2A 3DBOB 1W5FA 3IUBA 4D3DA 1JU3A 4BTVA 1YIOA 4P3KA 4YDRA 3H6GA 5LQMA 1J25A 4ECUA 5KWEA 3ESXA 1HO3A 2HPVA 2BBSA 1U0SY 1HE4A 1MLDA 2ZIWB 1BD3A 3DGEC 1BH6A 4EF5A 2WNSA 3WSTA 1E0JA 3E1KA 5KSYA 3QVKA 3ENWA 2HHLA 3OIGA 3GIQA 2Q9UA 3TJRA 3SJCA 4RTJA 3HCBA 3X2SA 2YV5A 4J1TA 2B6HA 1U7WA 3ASZA 4KO2S 3PC7A 1JU4A 3SR0A 3R6WA 4RWZA 3WLMA 4MAMA 4LRXA 5LZ5A 3VR5D 3DTVB 4BMZA 1E9EA 1C0KA 3MMXA 2FSGA 3QU9A 1FVIA 2HVQA 3AKCA 1G63A 5FBKA 3A6JA 2M98A 10MHA 1CUCA 1G21B 3PF9A 2PGDA 4P5EA 3A3PA 2LGJA 3SJAA 3O38A 4LJ7A 4B2IA 5FA8A 1EK0A 1V3VA 5C8YF 1L7AA 3E9EA 5D00A 5KDDA 4RPHA 4GMGA 2W0SA 2ZYSA 1MX5A 1NXXA 1ZVJA 2H3EA 3N8DA 1VI2A 2CN1A 2Q3JA 2VZEA 1OH7A 2L0XA 3CSWA 1HDCA 3H9GA 4BAGA 3DTTA 3ANSA 3L4SO 1RMYA 3GGOA 3G2QA 5BYJA 5JUMA 2BCJQ 1AZWA 3UB3A 1TOAA 1JSXA 1LU9A 5CGQB 5H3HA 4PHGA 5E4FA 2V7VA 2IIPA 1RLUA 2NOAA 4DR1H 1GPAA 4BB6A 1ECCA 4Z0TA 5B2FA 4PYRA 4KHPH 1V7ZA 3QV2A 3UMYA 4LEIA 1NW8A 2ZQZA 4RUCA 4N0QA 5FX2A 1CIJA 3K70C 3IURA 5HV6A 5DQGA 1DAHA 3EA4A 1L2ZA 4C1BA 3S28A 1KEEA 3NTXA 2PXAA 2WFMA 5FUVA 4FEEA 2Z43A 5DZSA 4BX0A 4YEDA 1DUIA 1RVDA 2HRBA 4ZGWA 4RQAA 2NVYA 2C2YA 2HO4A 4C3UA 2ZJ6A 5LL6P 2QPTA 5G02A 1IOVA 4O1MA 5KFHA 1ZISA 3P2YA 3H99A 1SXGA 1CUGA 3U7RA 1TAQA 4I1PA 3CZCA 3RAEC 1RPJA 5CA0A 3MB8A 3PF8A 3ZXXA 4GDMA 2EW8A 2MJLA 1Y8RA 5K45A 3U9TA 3EF1A 2WJJA 4I5DA 4G3XA 4Q0MA 3BHIA 3AW9A 4Q43A 5EWLB 3K0CA 1YR7A 4W4TA 1T43A 5IW8A 4OHXA 5THXA 1SUBA 5K2OA 1YR9A 1W85B 3AUAA 3P9YA 3W1VA 3RYCA 4K9KA 1ZAKA 3M34A 1XRRA 2DOKA 4OA8A 3PR3A 1SULA 4BIMA 4ZYWA 3IO5A 4KNVA 5AW0A 1Y8RB 3W77A 1DT3A 4NH0A 1KTIA 4DCNA 3HTXA 2C95A 3MRTA 1W87A 5EA2A 8LDHA 3DCNA 2NU6B 1GYRA 1T3LA 5D01A 3UK6A 1VBMA 2FUNB 4IINA 2HDKA 2D06A 4MKHA 3B1ZA 2OCBA 2O48X 3FIJA 3QWHA 2AG0A 3GDFA 4MROA 3SIPA 1U3WA 3P9QA 4PZ8A 3TTWA 2BSQA 5DGXA 5CD1A 1G17A 3E8XA 2QVXX 1DUSA 2VKTA 4DR5H 1L8LA 1R0YA 4RIHA 4LF6H 1SXJB 2VWHA 1ZZEA 5IBQA 3B9QA 2NUTA 2I6TA 1OTXA 3HA5A 2XIQA 1WUYA 2IXAA 4UZSA 1QP0A 4UMDA 5CTAA 5AKIA 4EGCB 1COWA 2YIDA 1ABBA 3AP3A 3ENZA 4DCSA 1I0ZA 2J5BA 1RHRA 5CB6A 4KDCA 4FT4A 5D8DA 2V65A 3W8NA 1IBMB 4OQ4A 2Z08A 1PV2A 4ALNA 1RKXA 2NUTB 2ZKIA 1LKZA 3LY9A 2NUPB 2FEKA 4AZSA 1GQFA 4FS3A 3ZY6A 3L92A 3PNBA 3OCZA 2X4LA 5DHFA 2AWOA 4PQYA 4BBJA 4M9ZA 3GX1A 4ZA2A 3QI7A 1OLUB 2DBRA 3ICVA 3FHLA 2GA8A 3NEPX 3QMWA 1JFVA 2C54A 4ZTBA 3V7UA 5KOIA 1EPUA 4WA8A 2JA5G 2QAGC 3AIIA 3KKPA 5BWWA 4HDCA 2W8LA 2GPYA 2ODPA 3IPRA 1DNPA 2GD2A 5CNMA 2WJ6A 1WR8A 3RYIB 2K2QB 1K92A 1E2PA 3VMFA 5FLMG 3EGIA 4A0FA 3SI7A 1SHKA 1XEXB 5EPOA 3GJ8A 4F3NA 5F5XA 4QDTA 5GJWC 2WR8A 3MFIA 2Y68A 3AYZB 2C4UA 4RHTA 3AR6A 2VDWB 4WZAE 3L4KA 4EPRA 1UEXC 3JXEA 5CW1A 3NYQA 4DANA 4H17A 4R1QA 5EJ5A 1W0KD 1DIHA 3IQZA 5JDIA 3RJ9A 2W9XA 1M6EX 3OU6A 3F8WA 4EGSA 1HNNA 2J5KA 3TW8A 2SCUA 4S05A 5ALSA 1OI7A 1OYVA 4B4VA 4NYMR 3VNSA 2EFCB 1NTOA 2YASA 3KTFA 5TXGA 4DA0A 1HE5A 1ZUD1 4BNWA 1Q0ZA 3UMMA 4ZCPA 1L5YA 1Y6RA 5EINA 1YXMA 4KDRA 1QIEA 1E2GA 3OAAD 4JL8A 1TKBA 1C4WA 2CMDA 2XUPA 2WKQA 4I9HA 5K0TA 2SCUB 3I5XA 4PGAA 3HYRA 4ER0A 1NG1A 1XGKA 3V4ZA 3RIGA 1XQ9A 4D9CA 3EZ7A 5DASA 4F7WA 5HOQA 2QZZA 4ETWA 4ZDWA 4ZO9A 3AL3A 4V0KA 1OD6A 1AVTA 4X3PA 2XYPA 3EQ8A 3ZW9A 4DG9A 1I3LA 1B42A 2IX9A 4BUCA 2TMKA 4JJ4A 4CG3A 1V9LA 2OCDA 1KTAA 4PGHA 4R0MA 1CQIB 2PKYX 4CGYA 3QM1A 1JHDA 4NPCA 4UPEA 3FMGA 1L7XA 3T1OA 3OC6A 3WL8A 3JSXA 1E4VA 1CT9A 3E58A 3L0PA 4CIWA 1CB7A 4ECWA 4RVOA 5H82A 4RV4A 4EJMA 1VLQA 4NBSA 3DHWC 5KC9A 1RVV1 2FMKA 3IQXA 3CNQS 4S0ZA 1NQTA 1NSYA 2PK3A 3V1TC 5IG2A 3BJMA 4KEAA 4ZXPA 4ZCRA 3GVCA 1PQYA 2Z6UA 2NXNA 3FWKA 3LK7A 1EHIA 5ELMA 4BFCA 2AHRA 2BHTA 3VJRA 3TPFA 5H16A 4MCJA 3HJHA 4LS3A 5D5QA 2P40A 4QPDA 4KQWA 3A7EA 4OTZA 1G38A 3OCUA 1VL8A 1DRVA 1PO7A 4HDOB 3H18A 1XNQH 2IIVA 4EMBA 1VZ3A 4TQUS 5EPEA 3LT2A 4M49A 4M0KA 4FLEA 1N9ZA 4F46A 2HREA 1DZ3A 4HDMA 2FOIA 5KWJA 1IM8A 1TMYA 2FLNA 2VKQA 4Z3DA 1KO8A 5SZIA 5LC1A 3KC2A 4TTPA 1KFBB 3DVAB 3F5MA 3GJZA 3LP8A 1MV5A 4ENVA 3N3AC 5AWFC 1W30A 5IAJA 1V6CA 4BQIA 3H9CA 1GPJA 2V3WA 4BNMA 2HF8A 1FFEA 1WH2A 4O2BA 1MG0A 3L0ZA 1OFUX 5KT7A 2FWMX 4K88A 4FGLA 1F60A 2X4GA 4FWBA 3I9V1 4MJ7A 4U6SA 2JGEA 2GK6A 4OBXA 4JBWA 2IMWP 1O5TA 4M98A 3CRRA 2WKRA 1VBNA 2NXEA 4TVBA 3ONNA 5DEIA 2XTJA 4DNQA 4M88A 2MSNA 2EKDA 5DX0A 3MJFA 2F00A 1CUVA 5CR9A 2AMLA 2UXCB 3HDYA 4BNYA 5KNDA 5BQ5A 4TUYA 1WAMA 1T5IA 3RB0A 5COBA 3IAAA 4FGJA 3CZ4A 4BMYA 4YMTA 4HNUA 3U3DA 3OEWA 5TF4A 1J2JA 4O59O 3D4NA 4OUDA 4F3TA 3V8EA 1JN0A 4ES6A 5IK2A 4GBMA 2O7RA 1DIOB 3VV3A 1JHXA 4RTNA 1T25A 1L4UA 1ZM7A 4D96A 5KG1A 1QH0A 4J2TA 3IA7A 4ECXA 4P0TA 3EVTA 1M5UA 1S7CA 2PL5A 4G2NA 4AZ3A 2FQWA 5KMGA 4HB2A 3D7KA 4D98A 3OE5A 2EZ8A 5LU9A 3J81k 2FQQA 4I19A 2PVPA 3I73A 5I9SA 4HH3C 2DWOA 2PSSA 1TAHA 4O25A 5A3SA 2ZXUA 5HS4A 3K0FB 3KHLA 1Y3AA 2C2EA 4AZ3B 5CVDA 4JNCA 2H54A 1W88A 5KMGB 4MS4A 1PLLA 2F1IA 2OO5C 4PLHA 4IIEA 4ER3A 1V43A 2JAOA 4AMGA 2Z0MA 3MPOA 4H3HB 4P7BA 4X6YA 2ZYWX 1YRLA 3PFHA 4ARUA 2XB4A 2YV4A 3KWMA 3MEQA 2FXVA 4NK4A 2HA3A 1N7JA 1V35A 2A6PA 3MHTA 3S24A 1T8RA 1TM2A 1ZMOA 4G0OA 2F43B 3KLNA 1DAOA 2PL9A 5FWXB 3DZDA 5I9LA 5KG0A 5DN9A 2P78A 5LIPA 4IV0A 1BGVA 5FBQB 1YV9A 3K5PA 1JAZA 1S97A 2QL6A 1OVMA 3ESAA 3W3AD 1GYFA 1EVQA 4HEQA 2C98A 4AB1A 5GPBA 3AW8A 2BKAA 4UHCA 1NXVA 3S3TA 1CJUC 4RD0A 1GDHA 3SHWA 2JFGA 3RVKA 2P9CA 2WF9A 2OK7A 1DJNA 3UMFA 4BRWA 5FTKA 3ADKA 2GD6A 5K05A 1X3SA 1CJVC 2P62A 4U7GA 1XRMA 1AIPA 1LQ2A 1B26A 4C7OA 1KARA 3THSA 1XFDA 4BKPA 4TYMA 1OFGA 2JHPA 4KH1A 4BPRA 3V2IA 3ZH9B 1A9TA 1OILA 1O5IA 3BGSA 1D3AA 4LCJA 1KPIA 1G6Q1 3LSYA 4NFLA 4JQOA 3JQAD 2ZBVA 1L4KA 4JV5H 1LJLA 2QM7A 4C7OB 4DRZA 3K96A 2QJTA 2D2EA 5E4TA 4RADA 2YKGA 4Z54A 3ZQKA 2QT9A 3LUHA 3ZV5A 4DR4B 2W4MA 3TIXB 5IBRA 3HXPA 2AZDA 1TKRA 3CLRC 5JSYA 2DCMA 4OB6A 1KJYA 2I2FA 2AC4A 4DJEC 3VNBA 2G09A 2C5EA 1EGHA 4ECQA 3TBKA 4N9QA 2J3MA 4L4YA 5IABA 3O1JC 1MQ9A 2H59A 4KXLA 2AR7A 1N8TA 3AY6A 4HWRA 1ZCAA 1DIBA 3GOQA 1YQ9A 4CDRA 1TTPB 2Y76A 1C30A 1Y14B 5D7BA 4IOLA 4NNOA 1SPBS 2AUTA 4JBHA 2FE1A 4MUKA 4JQYA 4B6PA 1A5TA 1UT6A 1S8AA 4G97A 3HOVG 4DQLA 1RU3A 3CTPA 3T7TA 4TMKA 3AVUA 2QG4A 1SXQA 2IHUA 3SXUA 2B6NA 5KINB 4KFTA 3GGPA 4N49A 5TPWA 1Y33E 3R5TA 1NFRA 2J85A 2IXTA 3SKVA 3P9SA 4MVJH 1V39A 3KHTA 2DFVA 1NKSA 3OZFA 1YAJA 1H9AA 4A0GA 5JO9A 3L4BA 2LIPA 1N7HA 1DX4A 1CQPA 4L85A 1F2UA 3ORYA 2HQBA 4OP3A 1RLOA 2XLCA 4X65H 4F1JA 3D6TB 5KJ6A 1KMIY 3WK6A 1GG5A 4WH0A 3BWCA 1II8A 4N47A 3PGMA 2J9GA 3TRFA 4NZ9A 2R8HA 1TEVA 3BDAA 1TVKA 1M6HA 1L7OA 3L43A 2YVUA 3P2OA 1HG0A 3LW8A 3KB1A 2R7ZA 3I2HA 4PQRA 1SXPA 4QBIA 4EG3A 4YAKA 2IHJA 4WFIA 4LSXA 1ORTA 3ZU4A 3GLKA 1J0CA 1HE3A 1II8B 2PKXA 2Q7DA 2EW1A 5EMHA 5M5BA 2Y05A 1KF0A 1TVKB 2NW6A 5B53A 2XGMA 5DQIA 5TQ2B 4KQJA 1VDMA 3S68A 3J7AC 1R9NA 3B6ZA 2RSLA 5LFAA 1S9HA 3PWTA 1UM8A 4YAKB 4BNVA 4FSXA 2ZI9A 3H3JA 4LA4A 2APJA 2XMDA 4PBTA 3LQRA 1JR3A 5B3JA 4V3BA 5CVUA 4EG1A 3HCNA 3KQTA 3KU4A 2GZRA 2C1ZA 3BHMA 2WHEA 2ZIGA 4GLJA 4MMZB 3VR4D 4J9NA 3P7MA 1A7AA 3Q40A 2ABJA 3ROPA 1J8MF 1RRGA 2AXPA 4GC9A 3EVAA 1QIDA 1FE8A 2DH6A 4G07A 4OF4A 1E6EA 4KO3S 3VTFA 4L16A 3LT4A 3UJ6A 3V80A 2D8AA 4UU8A 1GLVA 3A2KA 3HKZA 1J0EA 4X6LA 3G49A 2H8KA 2ZSDA 4ZYTA 5F23A 2F3RA 2GSDA 3IR5A 2QNIA 3D81A 1BCRA 1U5AA 3JWHA 1QHSA 4PC1A 3B70A 3L6OO 4OXNA 3K9BA 3BZUA 3G5MA 4V0LA 3QEJA 3FDIA 2GVNA 5KI6A 5FL7A 4B40A 2A7XA 5GY7A 1Z4MA 3GJ6A 4HFRA 1VBHA 4KYVA 4HQ0A 1W8DA 1VGVA 4TZ6A 2EQAA 1VMIA 2EEPA 3BF8A 4PLZA 4IV8A 4MR8A 2JGLA 3AEUA 3COVA 1PWZA 1L7EA 2A5LA 1BCRB 2EBUA 2P9FA 3AVQA 3CN7A 1TRHA 4B47A 3RVDA 5JLAA 3AUSA 3B1XA 3QLUC 1K63A 1ZN2A 3T3OA 4N0DA 3OMXA 5DBHX 1JAXA 2ATIA 2I9PA 1TWHA 4CF4A 5B1EA 1QBGA 5BT8A 3T15A 3C3AA 2W6MA 2JLWA 4Q3AA 5IAGA 4KE9A 2RH8A 4W5RA 3WLAA 2ZAOA 2ZM5A 1YBHA 1KXJA 3G9ZA 1TX4B 2NV0A 2ZRGA 5TGTA 5KFLA 1Y1VG 2X9VA 4Q3EA 5FPSA 2VA9A 3A6EA 1RCTE 1U2DA 3PJDA 2JIBA 3WBBA 1Z3CA 3AJDA 2ZDGA 1AQLA 5K6TA 4L5JA 5I7VA 1FP7A 4G8CA 2C31A 5KFTA 4AQ7A 1KVTA 4TKMA 2R87A 3REQA 2BP7B 1VA5A 2GFHA 2NQTA 4TVKA 4TROA 4H4EA 4RCNA 3WHKA 1SVUA 5IU6A 1JEEA 2OA0A 5ALEA 4S1PA 2YFKA 2R2AA 1U6KA 1I7DA 1HBJA 2WJIA 1YBVA 1VMEA 2HO5A 4D4JA 1NAHA 3SM9A 3ZU2A 4INJA 4QUIA 1NVWQ 3ZTYA 3REQB 4TQAA 2HDHA 4JBIA 1NC1A 5JAQA 1TVMA 1JI3A 2FK8A 5DTIA 3CVUA 1IXZA 1Z2PX 1XALA 1H2HA 4BYMA 3ICOA 3CRQA 4OEHA 4LZJA 3H1EA 2NADA 3WDSA 4KIUA 3A3YA 4F85A 4JK3A 2ZB7A 3QFRA 3DP9A 1C3EA 3TF5A 1EEXB 1I10A 1AS0A 2ZGIA 3K0BA 4C3ZA 1TFUA 5C8XA 2I29A 3L7YA 1Z8NA 3NIFB 5IDWA 1L4EA 1NDUA 2P6NA 4YAIA 1XLTC 1KDRA 4XIYA 5BSMA 1TJYA 4UHKA 3OCVA 5LJIA 3NOQA 2VCEA 3ZDAA 3OCCA 1SM4A 1DB3A 2I2XB 5J9FA 4NBNA 3DNFA 5E6RB 5SZKB 2R97A 4RMGA 1YU9A 2J32A 2C7PA 1DV1A 3MOSA 3QFFA 5BW6B 1M76A 1ZUNA 4FILA 4MUFA 5CTJA 5BSWA 1WA5A 1SA0B 2HQ1A 1XDBA 4XGIA 1BN7A 3KSMA 5CBPA 1SRRA 4P33A 1YZQA 2BGRA 5JY1A 4DV5H 4U7DA 1T9HA 3ZVKA 2XI4A 3K30A 3KEMA 1Q74A 1KYQA 3G2HA 4TTQA 1SZCA 1GAEO 1ZUNB 5T57A 1JS1X 3U56A 5K01A 3QUSA 5JNTA 4BLSA 4F1KA 1YFZA 5LUBA 5KYWB 2W4IA 3RFVA 3RVNA 2DKNA 5CBPB 4HGPA 1C29B 3KR9A 3RODA 5EHQA 1ZG3A 3FNHA 4TQ9A 3MJCA 1VFNA 4RTSA 4YQEA 2Y2UA 1FX1A 3SZ3A 1N56A 3JASB 1X1CA 3IRVA 1MTOA 4CUJA 3W2GA 4DLPA 2VPZA 1A0GA 1BCSB 2V5VA 2I8LA 4TUYF 4YJ2B 4C30A 5MN6A 1OROA 5IS2A 1ZFNA 1Y3IA 1DU4A 2I4RA 2PMBA 1RLTA 3TIVA 1ACJA 1YC5A 1DEAA 4PLFA 3ANNA 3WFIA 5IH3A 4IZOA 4C03A 2GGSA 4JCCA 4OBWA 1H2EA 2QR3A 1VLMA 3Q9UA 4O8ZA 5DI3A 5JWOA 3I5YA 3M6VA 2VYVD 4HK4A 4UCVA 1HI9A 3AFOA 2N42A 3GNLA 5IN5A 2QL7A 5EG5A 4XQ9A 6LDHA 4IMIB 2QENA 3DZGA 1WB9A 2AB0A 3CZQA 1O3YA 1FJHA 1QUEA 2AX4A 4FFBA 2PMFA 3BT7A 5I5YA 4HUQA 5DGAA 3SC2B 2WYVA 1GVNB 3U7FB 4BMVA 2O6HA 1GU1A 3JWIA 1P74A 3Q11A 4Q05A 4IS2A 4M1SA 1W9MA 4NSNA 2ES4A 5KVAA 4OREX 1SH7A 3ER9A 4QTUB 4MUXA 4FFBB 3D2LA 2VUHB 3D4BA 3CHYA 4B3MH 1E5TA 4HUQB 1X8LA 2BZ1A 3L7OA 4JMLA 5E1MA 3QX7A 1ORRA 3KJEA 3QPDA 3GFTA 3N7TA 2HD4A 3LWNA 1FRZA 1N32B 3VSAA 1FLVA 1TZCA 2C2WA 4Q7QA 5CFLA 4MV4A 2SNIE 4FDTA 4WXYB 2XNHA 1C9JA 3WRXA 1XTTA 2E5FA 2J4FA 3KZ1E 2N9UA 4GS5A 3QV1A 1E4FT 3T38A 1CUUA 1AHPA 2ZUEA 5M2QA 1WCIA 1KFEB 1ATIA 1FTNA 1QNLA 1E62A 1XN1A 8ATCA 4X54A 1KYVA 2EQ5A 3KJZA 1FBTA 1ZSVA 4EVSA 3E9ZA 4K0KB 1IWOA 2YWJA 2BM9A 4IJVA 3RC8A 1VKOA 2BMVA 1DC7A 3Q3JB 3ORHA 1E6LA 3PICA 1EG2A 4LF4H 1EFPA 1PYOA 5AI9A 3T9EA 3JQPA 1QAOA 1T2NA 5ISMA 4GWLA 3HSSA 4FX2A 4CLRA 2FR8A 1TF7A 2XIGA 5B3AA 3TW0A 3PVCA 1XMQH 3NHWA 3VDRA 1B8UA 3A0RB 6AT1A 2PT9A 1XTIA 4ALIA 4E22A 1VB5A 1U2SA 1MAUA 4E32A 3BFJA 1EFPB 4Y2QA 4RD6A 1KI7A 5CT8A 3QEBZ 4M37A 1XZBA 5JNUA 3QVUA 2IXEA 4EK9A 4ED0A 1Z4OA 1SC6A 4KMSA 1R18A 4MJ3A 3KSRA 5BSGA 1UWCA 3BMQB 2J48A 4FGWA 4X71A 1L7QA 3VO9A 5A4DA 5HZGA 2ZETA 3C98A 5B1IA 1OB5A 1JTEA 4FN5A 6REQA 2B4RO 1TVEA 3D3JA 1BQ4A 4TLEA 4IGIA 3LKDA 4Q1DA 5F9MA 4PBCA 1SUFA 3IPLA 1RJWA 3DL7A 2GPTA 3LWDA 4KQ9A 4RSGA 4JBNA 1KAMA 4U0JA 4JXJA 6REQB 3VPAA 2H9IA 4YP5A 2NZJA 3DE2X 1S2DA 3EVZA 5LL6b 1XNRH 3W6ZA 4B0PA 4L95C 1XZPA 3PUZA 2CE2X 1DHRA 3JQCA 2EW2A 5GOZA 2FE4A 5LBUA 1A8PA 2OBXA 4B8ZA 4KVGA 5ALVA 3DFZA 4RHFA 3M5CA 3LOUA 1TLLA 4RORA 3IAXA 4E08A 3M6UA 3AKEA 4QQNA 4CQNA 2IWRA 4FHGA 3AXSA 5C46F 1DE0A 5ALJA 2PZKA 2AWNA 4PZPA 5L1JA 4NJOA 4AJJA 2E2HA 2ZRLA 4GPZA 2QRLA 5A5EA 4DNPA 3R41A 1LCIA 2K5UA 3GIIA 5JZVA 4GHWA 2JCXA 1QVZA 4U8HA 3RYFB 4R81A 2WJVA 2RD2A 4MV5A 5IEBA 4LBVA 3QVXA 3I52A 1ZM4A 4UNPA 3L8HA 4DL6A 2F3PA 3QNWA 2Z9CA 4IQ0A 1JDBC 2GJ8A 2Y4NA 5EJ7A 2H1SA 3PYXA 4NBKA 1ZVQA 1F4PA 3OE7A 1C0LA 1XQ1A 2HWUA 3B20A 4QTYA 1DKPA 1U3VA 4V02A 4ZYXA 2R8JA 1Z5GA 1K3TA 4J29A 1GAQA 2LBPA 2NX2A 1JU9A 3NR2A 5CGZA 1KKMA 3EXHC 2GJAA 4LXHA 2FDXA 3E7PA 5TX7A 1MCZA 2COEA 3OD1A 1ODJA 2GILA 3HR4A 1COZA 1MB3A 1ZIXA 2I4TA 1ISSA 3TEFA 3J81A 4FQ8A 3RBVA 5LQJA 5G1PA 2AG1A 1THMA 2ZJ1A 3IUEA 3CPEA 2ZYTX 4GR4A 2BJVA 3ONEA 1F2VA 1Q92A 4AY3A 4PM4A 3HNOA 3N07A 3G0CA 1X2BA 2Y92A 2ENUA 3X43A 5BXQC 2DUJA 1N4DA 3RVJA 3LA6A 4JEHA 3U4GA 4IEEA 3SS7X 3PFBA 1P5RA 4AIIA 3JD0A 2BTQA 3UHPA 5COAA 4QHYA 1O0SA 3E84A 4BC1A 3KKEA 4KTVE 1GN9A 2VQDA 2OM6A 4RIFA 2X0IA 3V2UA 4RC9A 2JIMA 2OVBA 1LK5A 1Y4ZA 5HS6A 4JVNA 5EE5B 1CNEA 4X7MA 4YACA 3IFSA 2JA6G 5K3BA 3BKXA 4CJXA 3TMYA 4H6WA 2WJGA 1QRDA 3EQZA 4RIGA 5EQJB 4J0KA 1YB2A 5L4LA 2FF7A 3HPQA 4LYYA 1ZOLA 2ZXEA 3GDEA 2WJZB 1DV2A 2FZVA 5JYCA 1BXRA 4L57A 3HZOA 1SQFA 4JLPA 5CMLA 3FPBA 4XI9A 1ZKMA 3LF1A 4YV1A 3UYKA 3D02A 2YWBA 4WCFC 3ESZA 1V7PC 4K9NA 1UZLA 4UBNA 1BXRB 1PIWA 1QQAA 3BD8A 3PBKA 1FDTA 3QQ5A 4B6OA 2PPLA 5E25A 4YUYA 1N3IA 2C4TA 3W8FA 2Y8EA 3U4IA 1YJAA 4B75A 1WY5A 4QM7A 2QW8A 4EM6A 4KOAA 1WMDA 3PP8A 1BDJA 1DDGA 1JJFA 4H7KA 1VJ5A 2XITA 1P0PA 2WF7A 4BKOA 2WSBA 3LE8A 2QTBA 4B44A 1A9PA 1ATZA 4BJHB 2RDMA 4BNUA 3PJRA 4EGAA 2I6SA 4ED8A 3QWUA 2WT9A 2PUFA 1Z8DA 3AUXA 5LD2B 5IVHA 5DSTA 3F90A 1OX6A 4PDBA 2E4ZA 3CJRA 5TIIA 1OBOA 5ALHA 2GKSA 4PYLA 4P53A 5AXCA 2I2BA 3T1HB 4UZEA 1DPFA 3C85A 2P2DA 2NZ8A 3KVOA 1FDUA 3CISA 3PR1A 2WWGA 2RBKA 1ZNWA 3UPTA 2O7SA 2PWPA 2A7QA 3WMRA 1Z06A 2Q1UA 4UEWA 3OZWA 1NNUA 4Z2AA 1X9IA 3TNLA 1BKDR 1YQDA 1DBSA 2M6KA 4JA0A 3DTVA 4EG4A 3KL4A 3P0FA 3EYWA 4XUEA 4JEIA 4ZTZB 2PAFA 1G21A 5TRTA 4JELA 5AYVA 2GJ4A 4ED7A 4PZLA 3GY0A 3HXTA 3L9XA 2A3NA 1T8TA 2YDXA 2E5LH 5IFKA 2H08A 3L7IA 1DG9A 3D8RA 1DXYA 4TWBA 4N7BA 5DTQA 2PN1A 5CXQA 3NC0B 1MC5A 2YICA 5AMXA 5IDVA 2C35B 4PZAA 2R00C 5BT9A 2Z2JA 3CLTD 3NZEA 1N5MA 3SX0A 1F12A 1PNRA 1R0RE 4H18A 2H1IA 4FLFA 3KP1A 3FYSA 3DWGA 4P9NA 4XD7A 4B0OA 4BZQA 1BNCA 1XNJA 5KAPA 3UXEA 2OHGA 1H8EA 4PF1A 3CNHA 1U0NA 3CLUD 3C5VA 4YRJA 3SJBA 4R1NA 1HX7A 1DQPA 2PZEA 5EIAA 3QXXA 3PC8C 4HAZA 2VPWA 1KDPA 3AFMA 3DPSA 2HMTA 5A9SA 3MOGA 4QWMA 4UHHA 4G84A 1XHFA 5JECA 4ECYA 1I9GA 2ZRBA 1X7ZA 4FC7A 1W4ZA 2VWGA 1QFMA 4CBVA 4JUFA 2XUZA 2JEIA 4XOUA 3ICEA 3DZKA 3CGGA 3BULA 4G6ZA 4O5AA 1YDWA 5A9SB 1PJBA 2JKZA 1V48A 2VUMG 3FFTA 1ODCA 4QFDA 4JI1H 3RHZA 4ZZ1A 2ASVA 3FDFA 5FJ8G 3V4SA 3DG9A 3EAGA 5ANRB 4YJ2F 1X7ZB 4F72A 1G8KA 1PT5A 1QBKC 1NV9A 2L69A 5EWLA 3SBOA 2JW5A 2YXBA 4GQBA 3PQ8A 2Z9DA 1QQTA 4ND7A 2W0MA 4RV5A 4BP3A 1W85A 5COQA 3WS7A 2GPBA 4LF7H 3PXUA 4GO1A 1F6DA 1QCYA 1KR5A 3F47A 1ULBA 1IK4A 2VHEA 2HMUA 1KK2A 3VOTA 2RI0A 3DTFA 3ZQ4A 1Q0TA 4CN8A 2C9MA 2OCIA 2PO7A 4F5EA 1PFYA 1EXWA 2NU6A 4X63A 4EWLA 4HATA 1HYBA 5DLQC 1XYVA 3N39C 1TXGA 2AA3A 4K9LA 3QPUA 4F6RB 1YE3A 4I50A 4D5EA 2RH5A 5CLLA 2IZ5A 4GQAA 1ECJA 3OJOA 3FOZA 1E1RD 3M4YA 1AF4A 2QT0A 1U4SA 1E6WA 2J7KA 3HRHA 1KEUA 4R1OA 5MHTA 5JBIA 4FJ1A 1KS9A 4BRUA 3EUEA 1QQ6A 3RJZA 1U81A 4DL3A 1K7FB 4P54A 5AM1A 1CHDA 4UUPA 3TZBA 1D0IA 3IAFA 4I50B 2BTEA 1NFFA 3G2KA 1E8DA 1SXJA 4JI4B 1E4YA 4R2WA 2F17A 5AVQA 2FSPA 4IIGA 1MZVA 1UKYA 1M2JA 1T6BY 3IV9A 2HQRA 2C2BA 2CC2A 5GINE 2QSYA 2CB9A 2OWEA 4GBJA 3O4IA 5A7FA 1BQEA 4EB3A 3K4HA 2GJ9A 2DLDA 1L8OA 1N4AA 1UR5A 1KQOA 1XZAA 5IP5A 1PJRA 2JLSA 2R47A 4RESA 5JWHA 2NUPA 1MOSA 1IL0A 1DAFA 3VOAA 4FBUA 4IR9A 3HXOA 4D0RA 1SBIA 4JVOA 4D9KA 4JOSA 2VJMA 1RBMA 4EYKA 2Z4SA 4RS3A 2EIYA 2WU4A 5B4TA 2ZPAA 3VJKA 4CFYA 1OLUA 1PWHA 3ODPA 1FDVA 4ITUA 5E6SB 3FMIA 3J81W 1EFTA 3LW7A 4XR9A 4ALJA 1KJIA 1QUFA 3PQEA 5BVGB 3G3EA 3GFGA 3R9KA 3NTRA 4TTRA 4B3TB 2R79A 3W5VA 1X19A 1NBWB 3TD6A 2O23A 3LDGA 2RBEA 1BWPA 4FHCA 2VJMB 1N34B 7REQB 3A32A 2O5RA 3ZJTA 3PR4A 2I99A 2ZROA 3DBLB 1ZUIA 3RYIA 3L01A 1KC3A 3WZMA 1XEXA 1Y7TA 1C7FA 4MQUA 3A3NA 1TJ4A 4GPIB 3NH9A 1R12A 3VMMA 4B35A 2VDWA 4MUIA 3OSUA 1JG4A 3O26A 3RUFA 1YJCA 4R8RA 1V45E 2HHJA 2W4QA 3SGIA 3H5LA 3TFWA 5KYYA 1HNZH 2RC5A 5LQSA 5JJCA 4FHEA 2QTVB 2CNVA 2AOXA 3L77A 3DQPA 1IZZA 2EX4A 3U17A 4KVFA 2Q3EA 3IH5A 3WQBA 2ZWMA 3L0DA 4A2WA 2JIZD 4E2ZA 3IOMA 1QCZA 2FB9A 3TS1A 5MGNA 1I6WA 1Z6GA 1T6NA 4BS9A 2ZANA 4NVRA 5KYYB 2ZJOA 5E3JA 4YMWA 4YJDA 3A9RA 3FBTA 1USGA 1CR1A 5DYWA 1ST3A 4JI0H 1QOQB 2DTEA 5KVCA 3KWLA 3IOEA 2OOKA 5LMNB 2R3SA 3L0IB 1RSZA 2QOEA 1YUMA 1FY2A 2D1SA 2EC5A 2X4DA 2BH2A 2ZBUA 4YDQA 3LKZA 1P4RA 3U7IA 2WYWA 3PX3A 1CQIA 4IDEA 2XRYA 1FDSA 5FUBA 5ER6A 3EWSA 5G1OA 4C7VA 2QRPA 4M9RA 2GCIA 4RKEA 5EJ4A 5JNRA 2FPWA 4KWIA 3SICE 3IDAA 4C43A 1M5TA 4IKEA 3O8DA 2PR7A 3TAHA 1Y82A 2PX8A 3C3PA 3OETA 3AFIA 3PT9A 3HKZE 2CXRA 1ABEA 1EFRA 3OF2A 4W8HA 3OPQA 1Z2OX 3JQ9A 2AG6A 2HDOA 3LP5A 4MV6A 3RREA 4LMYA 3RFXA 2PZ8A 5CJPA 4PYMA 1WHSA 1WQ3A 3WYDA 4JU8A 1E3LA 4EQZA 5BSFA 5EDWA 3I09A 3MD9A 1UH5A 2LCIA 3ITDA 3CLSD 1F8GA 1QO0A 1Y4DE 3BXEA 2G3YA 4XTCS 4PZDA 3UNXA 3RH0A 2YIJA 3GUUA 4OJTA 1WHSB 4K8OA 1T0HB 1YZGA 4H1WA 3EEFA 1X7HA 4MQLA 3L1UA 2HF2A 1D07A 2WKPA 1XMOB 1NMEA 2BI8A 4MDYA 1PR9A 4YHBA 5K5EA 3LUGA 3THOA 3E61A 1Q0UA 2RBGA 1NUHA 4XYLB 2G9UA 2CSUA 1ZXBA 3V9PA 2DPGA 4H6XA 1WCYA 1QLWA 1JB9A 1Q2UA 3DSRA 3K8QA 3CXRA 4HLUA 2I6FA 3DVAA 2E4WA 1NY5A 3Q8RB 2V4UA 1ZRSA 2Z1DA 3MINB 4BNFA 5DGIA 5HFNA 3TY9A 2KBFA 2ECFA 1MZPA 2AOUB 1NMXA 2PV0A 2ABWA 3NUGA 2VP2A 3JWPA 1P5JA 3EARA 1ZW6A 4AF8A 3P0JA 1FSGA 5ERGB 2H18A 2F90A 3MTQA 1RQLA 3GRPA 1KVRA 4CMFA 5ALDA 4Q12A 2EFEB 1VBFA 4D3YA 4O7ZA 4G24A 3QP9A 3ZDBA 3ETEA 4IR1A 1HF3A 3HA2A 2WK1A 1QPBA 4TXNA 5G0UA 3DZBA 4D82A 4ECTA 3UMRA 4J6EA 2H7VA 4RHXA 3EIQA 1WHTB 3IP5A 5DGTA 1A48A 5FUQA 1NQWA 1SU7A 2BRUC 4NH4A 4EVIA 2JA8G 1PR5A 1TTTA 4QASA 4QEZA 3NFRA 4IO1A 3HO8A 3BVPA 1U7OA 1L4YA 1NT2A 1P29A 5BMVB 1U90A 1QTQA 4J9KA 2WZCA 3WGKA 5I8PA 3LUFA 4UAGA 3PUXA 1NWCA 1GNRA 3QWFA 5F4BA 4RNMA 1ZA2A 3FFAA 1H66A 4IRUB 2Z2KA 5IVPA 3PZBA 5FPPA 2QRUA 4I1SA 3I39X 3T5LA 5CLGA 3DF9A 3R8CA 1KGDA 1ST2A 1Z35A 3T35A 4O3QA 1QTIA 5JFGA 2HSWA 4QAJA 1KIAA 2H1HA 3ND9A 1KYYA 4MIEA 3AHDA 2AKEA 3DB1A 2XMCA 1XSEA 4DV3H 4OM8A 5HIJA 4HJRA 1P9OA 3K0FA 2ZG6A 2C3PA 2CKDA 4TVOA 3Q2OA 1H1LA 4IRMA 4MKGA 2AEJA 3R6GA 2VTDA 1WSCA 2KMLA 2ZFUA 1L7NA 2VP0A 4NYJQ 1Z0ZA 3DFFA 5KT6A 2VNSA 4AZ0A 4C0KA 4U2KA 5JSUA 1NVDA 5FPOA 5KG6A 2FLVA 3MK31 2E7ZA 3ORRA 2OLEA 2I55A 4Z49A 1H1LB 3WIEA 1KEVA 4AD8A 3QPWA 4BO9A 2LV8A 2GMWA 3H42B 4NLLA 4C04A 2F43A 2XKBA 1KO5A 1N1MA 4E4YA 3RGGA 5FWXA 5H3LA 1JQKA 3IAM6 3ZDDA 3ELYA 4AZ0B 2EJUA 2OSVA 3N2NA 3BRQA 5BV2P 3ENQA 3N0WA 4UTXA 1VG0B 5KFAA 3A6GA 2VJNA 5LZ7A 4IDQA 4J6FA 3P9RA 4IH4A 4RJ2A 1J90A 4Z6KA 1G8HA 2C5FA 2I1QA 4HEA6 1V3UA 3QX8A 2B0JA 3R3WA 3JU3A 5LLSA 3OQNA 2V6MA 2V5AA 4YUZA 4EO7A 2RGYA 4Z4FA 1FS5A 1W93A 4WNCA 2F1OA 2Q5IA 2OV2A 1ZESA 2ZPUA 3DMRA 4MSUA 4WFJA 4Y1FA 1KOLA 3ZDXB 1Y9JA 2NP6A 5IM5A 5EUQB 1K4YA 3ZHUA 2PLFA 4HDRB 3DEHA 5BW4A 221PA 2TECE 3VHLB 3I4CA 1BRMA 4CN9A 3JPYA 1J1IA 4DSTA 3H9BA 2FLKA 3OT4A 4QG3A 4LWQA 3NASA 2A0YA 4YRSA 3PR2B 3ZDEA 3GYBA 2X0EA 3VPSA 3ZJUA 1R2QA 5HZMA 4HRYA 4IDCA 1M0TA 5IKOA 3KQUA 4Q47A 3WGYA 3SLGA 5ALFA 5LBIA 1DC3A 3MBIA 3LPDA 3I9OA 4GAEA 2J6HA 3X44A 3S2EA 1SHJA 4ESHA 5BUQA 3TIIA 1U3TA 4BLUA 4F93B 1SC4A 4UCOA 1TMKA 1P61B 4OIMA 2Q0SA 1G55A 5IJAA 5KFKA 2CT8A 2JEJA 2HIGA 4CKYA 2CYBA 1H0RA 1MVLA 4XKJA 1UC8A 2FGKA 4O6VA 3H5WA 5KQMA 2HJHA 3RB6A 1ESNA 1E99A 3PNKA 3ADCA 1LDMA 2HY7A 2VZ8A 2RG1A 3CNBA 3PE3A 1HRDA 2WM9B 3RSZA 4RA9A 3IHTA 2LDBA 4LFAH 3IOCA 3D3WB 1BQ3A 3QUTA 2FKNA 5J40A 2QVYX 4AKSA 1IYZA 4BFYA 4ARIA 3IP6A 1F7UA 1S0MA 5GIOE 4EI8A 2IH5A 1JHMA 4UDXX 3W7AA 2R7LA 1RAAA 1MQAA 3GJRA 3U6KA 2OV3A 4X0EA 5IARA 3KQKA 2OXIA 4RA9B 1P6QA 2VDLB 4D1YA 4X92A 3G9QA 4YH1A 4C7BA 4RHUA 3H7IA 4PSCA 1HPLA 1QG0A 2Y1CA 3DVSX 4AX4A 1QK4A 1ML3A 2AMFA 1VBGA 4R05A 3OLXA 3IA2A 3CNEA 4I50F 1JG6A 5D84A 2QUAA 2VNAA 4JJIA 1AXRA 5FA6A 3GJ7A 1BRTA 2DY1A 1RYRA 4UDNA 3VKVA 3EPPA 3RC2A 3QVOA 4XYMB 1L5SA 3TTVA 2VRNA 4OHOA 3D7RA 2EJTA 1IHYA 1NYTA 1ELOA 3OFSA 1GQOA 3FSJX 3DULA 1AHHA 3T9AA 1OBVA 1J8QA 1AKQA 1NBMD 5TQ2A 1I3OA 3A6LA 3CPHA 3I3OA 1I9CA 3E22B 3PGJA 3TX2A 1Z33A 2R44A 3ISTA 3QH4A 4CE6A 4QUEA 2Q0XA 4D9IA 2BR3A 5C7OO 2PMEA 4DKXA 2V74B 4GYWA 4RTOA 3USES 2RDJA 1K4KA 3ABSB 1DRJA 1NXOA 2IE8A 4LF9B 1A7JA 1N6IA 5BPFA 4B4DA 1RKUA 3BMCB 4NCHA 1AKWA 4B1FA 3F1KA 4LPSA 2X58A 1P0CA 1DX9A 4KN5A 5IXSA 3SC6A 4OB7A 4YONB 3ZE9A 4Q7LA 4MQEA 1K86A 1US8A 1AO3A 5AW8A 5FEMA 2KI5A 1E6UA 3TAUA 4O4JB 1BXGA 2JGIA 4DUYH 5JMTA 4JEMA 4R8MA 5CPBA 3OJ0A 4KK4A 4RMHA 4J9PA 1Z9BA 1IEXA 2ZBRA 3TOSA 4EEYA 1CJSA 3ZWBA 5DYYA 2DHEA 1X7DA 3RUIA 4C89A 3TQCA 5B6PA 4YRTA 3RBAA 2L42A 2JLQA 4H0NA 4UHBA 2JFHA 4DV4H 1F9EA 3QSYA 3DTNA 4ND4A 3HFGA 1IPEA 4MQEB 1US8B 4OQMA 1VCOA 2ZJBA 1BXGB 1V96A 4UVEA 1UXJA 1RWKA 3W5AA 5L95A 2ISCA 3CQ9A 4OOFA 5JDCA 4YCSA 2FW8A 3AC0A 1FLAA 1E2FA 4E07A 1UDRA 1U2GC 2DKOA 1VPLA 1C4KA 2J3DA 5BP7A 4H16A 1CU1A 3BAZA 1E1YA 2VUIB 4Y2PA 5DTMA 5DBOA 3N6VA 1O94D 3KXYT 2VBFA 5TVKA 1I0LA 5CEJA 4WMLA 5KNLA 4KXNA 3ILXA 4WOCA 4EUNA 3EF3A 1I0IA 3M9MB 3L46A 3ZY5A 3HUTA 4U9UA 2D8MA 5A71A 1I3CA 1FDOA 1JVSA 1XZIA 1N0IA 3SEQA 5IEJA 1BN6A 1FYFA 2BF4A 1ODLA 4EKGA 5DGBA 4PHFA 1F51E 4TKVA 2EG9A 3ZVNA 1P1HA 1R88A 4Q9HA 2R6R1 2P75A 2A1HA 4G5FA 1XF1A 1GSAA 4NZOA 1X3LA 2QGZA 4JKIA 1X7GA 1HZZA 4R8KA 5K3SA 3OCYA 3EUAA 3V4VB 2YNMD 4FINA 2GEDA 5I9MA 1JQJC 3DE5X 2WKWA 1BS2A 2FQXA 4CFZA 4QGFA 4TKVB 2HYDA 3HSYA 1HETA 1CFJA 3SZLA 3O9VA 1ZX1A 4ZZIA 3LXUX 3T06B 4EYHB 2EWVA 1M54A 1BKSB 3CONA 3FPCA 3LC1O 2XCIA 3H2BA 4OATA 4UNIA 1XCPA 1ZGCA 3KVNA 3OZRA 2G67A 1IU9A 2BP7A 4AF6A 2FYTA 2ZB3A 2C2MA 2PSFA 1QIKA 3QUQA 5KNDD 3NPMA 2GAOA 1W5BA 1H6BA 5JASA 2RFLA 3M3PA 1GHTA 4RFLA 3RS5A 1CF9A 4XWWA 5FOTA 3MIIA 3B52X 1QRAA 2NAPA 4A3BG 2AD5A 2X3UA 5ADWA 2GQ0A 2FK3A 2PWAA 3G0BA 1QV7A 1OBCA 4NJMA 4YT5A 4I46A 4HX5A 3MGGA 2JFFA 2RJOA 1XNGA 2PWYA 4U7CA 3LQ4A 2QNRA 2GZDA 3LNTA 4F5YA 2UUCB 1EWYA 1FFCA 3HEMA 2ZJTA 1XMJA 2VYFA 3OIUA 3KXLA 1FFDA 2Q21A 2ZE8A 3OF3A 4EZBA 3VFDA 4NJMB 1L4GA 2FN7A 2DULA 4MMXB 2NAFA 2BGTA 3PE6A 4Q7EA 4CF3A 4WBSA 3A1WA 5FI0B 2I2AA 5FD5A 2YJ4A 5AK3A 1Q0LA 3PGA1 4GQIA 1TCBA 4II2A 3GD5A 1B8NA 4RZ2A 5E6RA 3T3EA 5REQB 2EX1A 1KJNA 4PAWA 1J9ZA 4IQ8A 5ALXA 2ZIXA 1HXHA 3WGOA 1XAGA 4EYSA 5KZMB 2XCPA 3RAPR 2CLOB 3V3KA 1SVSA 2A9RA 3B89A 1SA0A 4JU9A 3ZCXA 1NZDA 3BIWA 3PPIA 2XD4A 3GIDA 4AY6A 1PV1A 3GEGA 5D5HA 3VHXB 1ONBA 4J7CA 3IP1A 1PNOA 5EESA 2FWBA 1U8XX 1WTCA 4DBLC 5LXTA 3L8EA 2ZIXB 3M1YA 1SVOA 5HE8A 1O95A 4WY5A 3G5AA 1AQIA 4UVIA 3ONFA 3AVXA 4UM7A 3TO5A 5KYWA 4JZYA 5I5TA 2OC4A 1F3OA 1DO8A 4QLOA 5FFMA 4DUGD 3WGJA 5BMVF 3LHKA 3HCPA 4XSVA 2IYVA 5FPKA 1HFJA 1JSRA 3JASA 5LXTB 2C4MA 3TZ6A 3B2QA 5PNTA 1G21E 3VU1A 2JGNA 1BCSA 2HN9A 1EP9A 4YJ2A 3EG9B 4NXNB 2RGBA 4IVRA 1PZXA 3JAMA 3KKKA 5P21A 5CCBA 1PZMA 1H2AS 1QR2A 1N1DA 3PNLA 4IKOA 4Y0AA 2SKEA 1IG0A 3L2PA 1ZHFA 3A3OA 3G88A 5CM9C 5LQAA 2HC9A 5IMBA 1N1EA 3IRUA 5ALKA 3BS4A 3N8NA 1ZOSA 4L6IA 5FAXA 5AK4A 3U9LA 1M1XB 2WZDA 1JHZA 4LYHA 3SSMA 5AUOB 3QBEA 5FADA 4DL5A 1SCIA 2CLEB 4G0VA 2JGRA 5J43A 4RNCA 1UDWA 3L4EA 3ZHZA 3G8YA 3JZDA 3S2UA 1USUA 4N5NA 1EUYA 5H68A 2VHQA 2NQ2C 3ZBQA 1T4CB 1TYCA 2FFBA 4UM9B 1W4AA 1F5SA 2P0AA 1Z0KA 3GZNB 4IIHA 5JC8A 2P9JA 3RG8A 3SC2A 4D9FA 2B3TA 4J0QA 1GNVA 1OFUA 1I32A 4ND1A 4WK4B 3F7MA 1OJ7A 3E15A 1R37A 3VPGA 2K6GA 1QHGA 4EJ2A 3ROTA 5B7NA 1RAHA 2A4KA 3O21A 3WHPA 1NSFA 3NEYA 4RBNA 2ZM6B 1GNPA 4UQOA 5EGNA 2PRYA 5LKRA 2OAGA 2XJ9A 1IC6A 4JDPA 4XSGA 4CDGA 3PR5B 2IKSA 3HCCA