5BPFA

Crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
291
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHESVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords D-alanine-D-alanine ligase
total genus 89
structure length 291
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bpfA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bpfA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bpfA01
3BG5A 2YS7A 1GSHA 2I8CA 2VQDA 1AUXA 1KBLA 2NU6B 4O7WA 4MA5A 4L1KA 1I7LA 2PBZA 3ETJA 4O83A 4I55F 4YJ2F 4WD3A 3NUAA 1GGOA 5CAEB 5EZYF 3ETHA 2C00A 4EGJA 4IIJF 2R7MA 2CZGA 4WBNF 1SCUB 1KEEA 1UC8A 3UFXB 3OUZA 2I80A 2V5AA 3QFFA 2YYAA 1W96A 2R87A 3N8DA 4HNTA 2QK4A 4NYEA 4EG0A 1GSOA 1OBGA 4O82A 2CQYA 1BXRA 2CNVA 1KJIA 3R5FA 1EZ1A 1JKJB 4E4TA 1KJ9A 1Z2PX 5DMXA 4EA7A 1CQJB 4EGQA 1EHIA 2W6ZA 4O81A 4O2AF 3SE7A 1DIKA 4O7YA 5CB4F 1CS0A 4FE2A 4FGRA 4Y8VB 4XX0B 4MV3A 4XZ3B 4DLKA 2YZMA 4O7RA 3K5IA 3R9RA 4O7VA 3G8CA 1VBHA 2IP4A 3V4ZA 5J2UF 4I4TF 2Z04A 3TINA 3KALA 2YZGA 2R7KA 1DV1A 2GPSA 4HR7A 1BNCA 2HGSA 2V59A 4ZQIA 2ZDQA 1OBDA 1GSAA 4XYLB 2OLSA 2XCLA 2R82A 2Z02A 2NU7B 2W71A 4FFMA 4QSHA 1M0WA 2QF7A 3JRXA 4MAMA 2R85A 5J2TF 3BSSA 4YAKB 1KJ8A 4O4JF 4O7SA 1A48A 3GLKA 2R7LA 3RFCA 3VOTA 2I87A 4ZI7F 3VPDA 3AW8A 1DV2A 1AUVA 4RZQA 1EYZA 2W6PA 1CE8A 3MJFA 2W6NA 4O7ZA 1KJJA 2PVPA 4FFOA 3ORQA 5LXTF 2YZLA 4O4LF 3AX6A 5GONF 4O86A 2ZDHA 5C1PA 5JVLA 3WO0A 1Z2NX 2YW2A 2VR1A 3TQTA 3KAKA 1T36A 4FFLA 2ZDGA 2HJWA 5JH7F 1E4EB 5HV6A 2WYOA 4MA0A 5LOVF 3U55A 3U54A 3VPCA 2NUAB 3U9TA 3TW6A 4EAAA 1KC7A 4MV7A 5JQGF 4HNUA 3G8DA 2W70A 5C8YF 1JDEA 2X0SA 3TIGA 1UC9A 4EA8A 5IYZF 3GIDA 2DZDA 3VPBA 1IOWA 3KAJA 3JRWA 5BPFA 2YRXA 3LP8A 1WR2A 3R5HA 4YJ3F 1IOVA 4YB8B 4TV8F 4C5AA 1W93A 4O2BF 2R7NA 4MV9A 4DIMA 3BFPA 4O84A 3RV3A 5K2MA 3V4SA 3WNZA 4J6EA 1M0TA 3DF7A 3VMMA 2NPOA 3HO8A 1Z2OX 3JZIA 2DLNA 3N6RA 5LA6F 3BSWA 3U9SA 5CA1F 1C30A 1PK8A 4HQ6A 4MV6A 4EA9A 2FP4B 4ZHQF 1EUCB 5BPHA 4FFNA 2YWVA 1A9XA 1PX2A 3E5NA 1B6SA 4IWXA 2W6OA 3K3PA 4O4IF 3KREA 1JDBB 3WO1A 2FPGB 3Q1KA 2NU8B 5KKNB 1I7NA 3JZFA 4IWYA 5LP6F 2R6FA 2GPWA 3Q2OA 2DWCA 5JQWA 4GGMX 4XYMB 3K5HA 2FB9A 4M9CA 4I50F 2PN1A 4O7TA 4FFPA 5HBRB 3MWDA 1VBGA 4YBZB 2W6QA 2R84A 3HB9A 5JVDF 2VHEA 3R23A 4O7LA 1EUDB 4MV1A 4TUYF 2NU9B 1CQIB 3OUUA 2V58A 2YRWA 1B6RA 5I47A 1E4EA 3LWBA 2FPIB 4HNVA 4MV8A 3TIIA 5LYJF 4ME6A 4O4HF 3VA7A 4EABA 5CA0F 2YL2A 1VKZA 1KUTA 2FPPB 4M98A 4FU0A 4O7NA 1JLLB 3R5XA 3ORRA 4ZOLF 3HBLA 3MWEA 4C5CA 4IZOA 2SCUB 4TV9F 1ULZA 5BMVF 4IHJF 1C3OA 2DIKA 2P0AA 2GQRA 4MV4A 2GQSA 1KJQA 4M9UA 2YS6A 2R86A 4C5BA 2VPQA 5D8DA 2GLTA 2XD4A 5KX5F 1M6VA 3BSYA 5H80A 4M99A 2YZNA 2J9GA 5FNVF 4YAJB 3I12A 2W6MA 5C1OA 2CNQA 3RV4A 2CNUA 3RUPA 1GLVA 4FFRA
chains in the Genus database with same CATH superfamily
2AXNA 1E6CA 3M5WA 3A9WA 1GSHA 2VJDA 3KB1A 3C48A 1WQ1R 3EODA 4RACA 4GUDA 3ZLBA 4LVCA 5KTSA 2XQFA 4O7WA 3M6UA 4B6OA 1A3CA 1QAMA 4XE5A 2PBZA 1LJ8A 3JQ7A 2I29A 3VAYA 3SSNA 2PMEA 1YJQA 2O5VA 1YL6A 3DDUA 4A2PA 3JWIA 2ZATA 4U2FA 1GVNB 1XD2B 3VKGA 1YRHA 3GAFA 1WXDA 1BMTA 3GV5B 2O7QA 3LY7A 5KVQA 5I7FA 5A9TA 3I23A 3DHVA 1K3TA 2B8NA 2OV6A 2GVZC 1WP4A 5DMHA 4F4FA 2O2IA 4ZYYA 2QR5A 1QTIA 4ZTBA 4TT3A 3LBHA 4N9WA 4TQGA 5CFQA 3P19A 3VKHA 5J43A 1IULA 2AE2A 5JAQA 4IHKA 4OQDA 2XYHA 5KSPA 2AGQA 3EXG2 3W3AD 1KEEA 1XU4A 2MYTA 1IONA 1II9A 1K68A 1UH5A 2NSHA 4I1VA 2IMWP 3M9LA 1GZ5A 1L7MA 3GFFA 5KQMA 2CLDX 2RK3A 2ZYGA 1GT6A 1P3DA 3AUKA 1XRNA 3L7YA 3VO9A 1KZGB 1LC3A 1D6JA 3VAAA 2OAP1 2YYAA 1KQPA 5JALA 4A91A 1NAIA 2ALZA 2O2YA 1QP8A 1TDJA 5M34A 5KYTA 3ZY6A 1I4DD 5JCJD 3PKIA 3QK7A 4DWOA 1SCAA 2DT8A 2WJ4A 3KZ1E 2DQKA 2NP6A 3WDKA 3J7TA 4NQRA 4A0SA 4EY5A 1KAGA 4BUJA 4YPOA 2BF7A 4MJ7A 1GR1A 2JFQA 3FLEA 2IYSA 3KP1A 4ZAXA 4FHDA 3E22B 1ADFA 2AG0A 4OV6B 5A3QA 2CE2X 1VIDA 1HFWA 3K2QA 1YE5A 2F43A 1FP7A 1YIAA 3GZNA 4HGNA 4NK5A 1AKRA 1OC2A 3OM1A 1JJFA 4U7TB 2BGIA 5ALMA 1F4VA 2G40A 2HOQA 3H84A 4YT2A 2MIIA 3ZZ1A 2OCIA 1FCJA 2VOJA 1J0AA 2VZ8A 4GOND 4UASA 4F8EA 1HLFA 4KXFB 5L4SA 2WT9A 8MHTA 3EQ6A 3WGTA 3T1HH 1KAEA 1V4NA 4BMOB 2R4TA 1C2TA 1KEPA 5AXAA 3BREA 5HTKA 1ENOA 3AZPA 3OMXA 2IZ0A 1KVSA 3IKLA 6GPBA 5J23A 1P2DA 1JHPA 1N8NA 1ZUD1 2H4YA 2YOFA 3OE1A 4KE8A 5BWBA 4GC6A 3DVLA 5MN4A 4P58A 4CPDA 1X1DA 5ERXA 2J31A 1RRFA 3ETCA 3PC6A 1XZIA 3LUFA 1MHTA 5DJ5A 1JZTA 2AFHB 1PK9A 1YCDA 4MR9B 4MQUA 4R8RA 1PJ3A 3KAQA 3U5ZB 2ZWAA 5EJIA 3UV6A 1UMDB 4C0QC 1I13A 1DKPA 4RHXA 4DNPA 4QJFA 1T6XA 3LG2A 4FFWA 4MIEA 2GERA 5DX8A 4B09A 5IM4A 1FBNA 2VHWA 3OBBA 1A8UA 5LJIA 3WE7A 2QYZA 2PXAA 2ZI5A 1O9GA 3BKXA 3HKDB 2DFTA 5BN4A 3K5PA 2IDKA 2FG6C 2CNWD 2IP4A 4RVCA 3R7NA 3QY9A 1PFUA 2Y1OA 4WSOA 5SZKB 3SJ7A 4F9EA 4U7GA 5KKAA 2C77A 4P33A 1ZH8A 1JMYA 1JNXX 4FHCA 5FPPA 2FYTA 2ZPUA 2ZSJA 4Y0VA 3FD8A 4FJ0A 3FNBA 3GIWA 2BBOA 4HL6A 4DM4A 2NZXA 1VJCA 3QV2A 3VZRA 2R7KA 1DC6A 1F2DA 3CNOA 2LDBA 1BMQA 3M6XA 2NVUB 3PGJA 1MX1A 1KBQA 4C7VA 2QTZA 2H9IA 2YFYA 4ARIA 2O8NA 1U1CA 4TYWA 5EIOA 1EBUA 4KX5A 5K20A 2NNWB 4M46A 4EB6B 4G4SO 1NG1A 2FSSA 1IBLH 2GYUA 2QTRA 2HEIA 1Z08A 2TMDA 3PPIA 5BW8A 1WL8A 2X1VA 2ZAGA 4L9SA 3DFZA 1A8HA 3R6GA 3SG0A 5CDTA 4GVPA 1LFDB 3NC4A 4IFIA 2VEOA 1I7PA 4HEA1 4LW8A 4PIPA 3HZZA 4L8FA 2VEDA 2Q4DA 3KZCA 4GOKA 1SO8A 1ZMXA 1PVDA 3QF4A 4RNCA 4B6QA 3FHLA 4WOCA 2F1JA 4CVNA 2VO1A 1P6UA 1S7GA 3R20A 1ZNXA 3OEEA 4LRUA 1TM1E 5E6UA 3ED5A 5FA6A 4BAGA 5HRAA 2QYOA 3TR5A 5A62A 5JWRA 5JQGA 1LKZA 4OHMA 5TDHA 4EY6A 4W63A 1PHPA 1Y7LA 2J3JA 2V54A 1D4ZA 1UBOS 4UU0A 5BSVA 5K3EA 3KDAA 1FUKA 2I2XB 1ZOLA 2KE5A 3CYFA 4OEHA 4RTQA 2RGGA 5KFJA 1G8JA 5HW0A 5ITVA 3NT2A 5HKBA 2O9JA 4LXGA 1TYDE 2H1WA 5HDBB 1OIXA 4EYEA 1VG9B 2ZUUA 5AJWA 1CERA 5H83A 4GZ3A 5KREA 4C0WA 2ZE7A 1NE2A 5TGDA 5LQNA 4L74A 5CJPA 2H4XA 4OHXA 3ILHA 3L9XA 3K16A 1YMVA 3NYRA 3NBQA 4ZEVA 1XQYA 2PDAA 3NATA 3UUEA 3K2EA 2NO7A 2X5XA 3VC1A 2B5OA 3SQDA 4J9MA 3PIIA 3FPHA 3IHKA 2DAAA 1GGHA 2O3UA 1V48A 1GQOA 3CEBA 4YVFA 3A7EA 2VDWB 3IHTA 2IBSA 5CGQB 3FVTA 5KFVA 2AVDA 1F48A 2BR4A 2PEYA 3NDRA 4AMYA 5EI5A 2GLUA 2IX9A 2LUOA 5JH7B 1QHXA 1X87A 3RKUA 2X0KA 3Q3JB 1G6Q1 1WXEA 1O89A 3GGSA 5BSUA 2QG6A 3UUGA 1RYNA 4CC6A 1B3RA 2JJQA 4HQRA 2I5PO 1QIIA 4O6VA 5I7HA 1E2BA 1PR0A 4E1AA 2XTNA 3K6SA 3PW0A 4ROTA 4MLCA 4PAQA 1FDVA 4QE3A 5FQOA 2PCJA 4MUEA 3F73A 4HMOA 4IR7A 3R7WB 8ABPA 4QXPA 4NDZA 4QVKA 3RHTA 5ALWA 2I6XA 2YOHA 1EIZA 1KK3A 2WA2A 3FDXA 4PZUA 5TPWB 3T94A 3V32A 3UJ9A 1GGEA 3UK6A 4KI0A 2LCQA 3G79A 3PHJA 1MO6A 4I36A 5AUPB 2W2QA 3NORA 2O2SA 1NV8A 1A96A 4LZWA 4FUTA 4XLTA 3SWWA 1ZYUA 1OXMA 2DBQA 3HSKA 1JTFA 1NVAA 3QKSB 4DV4B 1I3CA 3OO0A 1I3KA 4IZIA 2XVYA 3TIGA 1SG0A 1X7HA 4P5PA 1XNGA 1MFPA 1A4UA 2AQ8A 3RJ0A 3QENA 4MQMA 5DTQA 1KZYC 5T4EA 3L49A 5IKMA 2A1TS 4QDKA 4MEBA 5AVZA 1WB6A 4HH1A 3LP8A 4EFDA 3M33A 3DBLB 4AY4A 1KSFX 1CUVA 5IJZA 3D4IA 4KUHA 2I22A 1V5EA 4WCFB 1PHRA 4TV8F 1KFEB 1Q0LA 4X93A 5L3RA 3Q7TA 1AKVA 1EEXB 4RHCA 2IXDA 4BNMA 4ETIA 3ZWBA 4FB5A 4DNFA 4LFBB 1T9HA 2JC3A 3O93A 2BRUA 1CS4C 3H04A 2B78A 3NR2A 3VYWA 3GFBA 1XTPA 4RVOA 3B1WA 3RJ9A 4K46A 4RZHA 1V37A 5F3DA 4B6RA 4X5OA 4B6EA 4BFVA 3PEVA 5C80A 1E18A 1UEIA 4HLCA 1EA5A 2IEBA 2BMFA 5DCLA 3RV3A 4YN3A 1DC4A 3N6XA 3EY9A 3JV7A 4M9XA 2O7VA 4GLWA 5AJYA 3CNBA 3CRVA 2Q99A 3GXOA 5KG4A 5FHRA 1V1RB 1J8QA 2I6UA 1X6VA 5ANRB 1WZEA 3SQOA 3VYTB 4E30A 4LDNA 4MQEA 4B8ZA 4A26A 4HAIA 1QIDA 2H1HA 5I9IA 1ZIYA 1PJQA 3AU8A 4N48A 4RHTA 2JLWA 3G17A 2GYWA 1Y9AA 3BACA 3FOAA 1J8YF 1MCZA 2GD6A 2Q3BA 3X0DA 3CSWA 2J5RA 4A8JC 4MK4A 3EIXA 3FJOA 5A9RA 2XGMA 3AJAA 2OOKA 5BW5A 4ZALA 1U7PA 2HJ9A 1KSJA 1L8QA 3GQBA 2JFUA 1P2BA 4I8IA 3LQ4A 1WCYA 1OFUA 4Y2JA 3QHPA 3SYTA 3FTDA 3AC0A 3C8DA 3P4XA 3U7FB 2X23A 3DMNA 3QKRB 2ZGIA 4F97A 3G6VA 1C4OA 1V6SA 2PFSA 2YOGA 1W36D 3RT9A 3HGMA 3CLRD 3FLAA 4HQLA 4CMIA 1TQ2A 1SN7A 2I6SA 3GBPA 3R7AA 4FMCB 3A1VA 4K6HA 5IJ9B 4JC4A 4RULA 1ULAA 1YDEA 3TQCA 1Z39A 2DPJA 4FZVA 3H6GA 1CJCA 3O9ZA 1OX4B 1R0WA 2HDWA 3C98A 3CUKA 3NHKA 1YQUA 3C87A 1ZH4A 2GEUA 4WNCA 3VUFA 4NECA 3D4PA 3F9CA 4JLJA 4WK0B 2HY7A 1FNNA 1N75A 3DQQA 2P6NA 2XRYA 2A4MA 5IXJA 4RTPA 1GUBA 2BTQA 3SU8A 2FRXA 3LMKA 2CV2A 5H3LA 2JJ2D 3PGXA 1EFUA 1Z29A 2FUCA 1NMQA 3GLTA 3NJ4A 1ZKMA 4XJSA 5TQ2B 3HKBA 1HE1C 4NE9A 1WG8A 2Y0BA 4Y1RB 4D3SA 2G0NA 1PD0A 3DAGA 1IZ9A 4PLGA 4EATA 4C3OB 3V6HA 5LIPA 3C6MA 3U61B 1EDEA 1LK0A 1BX0A 3T1YB 4RK0A 1F12A 2VIIA 2W2MA 3MJ4A 3PYLA 5IASA 3AR5A 4NENA 1ZOIA 3JZDA 4N3GA 1R5BA 5EMJA 1IZYA 3R7SA 1AQ6A 5A0TA 2ZI4A 3REGA 4NJMA 5BWWA 4IWYA 1KORA 3AUAA 5M5BA 3MJVA 1S2MA 3N2IA 5CW1A 5CDSA 3PN1A 4IMRA 2ZSEA 2Q2NA 1C7ZA 2W2LA 4AYXA 1LTQA 1T2UA 1KI4A 3B3FA 5E6UB 2ZS8A 3QLVA 3BPSA 3L77A 1O95A 1U90A 1S0UA 2ZT7A 3A58B 3CONA 4PAWA 3WMRA 4DBZA 5JQGB 1L1RA 3R3JA 4EG6A 5LQMA 1ADJA 2VWQA 3OCVA 2EARA 4M7RA 3U48A 5K0ZA 3GCZA 3RUHA 3STHA 2YQ4A 1N0UA 3FYDA 3DTVA 2IYWA 4RIEA 2WFAA 3G2IA 3OIUA 1OQAA 3AYXB 4U8GA 4C1NA 2A5LA 3IUSA 4UCWA 1EMDA 1G7SA 2V8OA 5BO5A 2QXUA 2A1UA 2QNRA 5D3MB 1DCTA 3PNMA 3G2LA 1K7SN 3CW2A 1N34B 2RKOA 4XPIA 2ODAA 5ER9A 1DAIA 3HWWA 1M1YE 3IP9A 4EUKA 3N76A 1AMOA 2VYVA 1B8UA 3EHEA 4NE2A 3UB4A 1BVUA 3EW9A 2VJLA 2P7IA 3TLCA 2NYUA 1LQ2A 2XMQA 3AHHA 3GARA 3LA6A 3CLVA 2XB9A 2H2WA 2CYAA 1CQIB 1W0KD 4LSMA 3VJLA 4K6MA 4MRPA 3T7KA 3R3HA 2QYHA 3H8JA 3TQQA 3IULA 4EELA 1UBHS 3HCOA 5IHPA 2Z56A 2RSLA 4CMEA 2XNHA 1OU0A 3OTQA 3KJIA 1NVFA 3RKSA 2XHZA 2BFOA 1DIGA 1DTWA 1XZNA 1URPA 4F46A 1JLSA 5JFTA 2HMAA 3MMPA 4OAPA 3H1BA 2YRFA 5E2AA 2DCMA 5JSQA 1FW6A 3FJYA 4RA6A 4ZV9A 1F51E 4QUAA 5EHIA 4D25A 4MDYA 3T41A 1Y4AE 1D9ZA 3RWBA 4HTFA 1ML3A 1TX4B 3PUKA 3F3YA 3RJMA 1IG0A 3HDJA 2PO5A 2RC6A 5TS2A 1P2FA 3PXCX 4XASA 5E1MA 4ARZB 4O7NA 1IVNA 4EPTA 3L8HA 1FY2A 5KFIA 4GM0A 4NCXA 4AMZA 3T5JA 3V7YA 1SYXB 4HGRA 5LYYA 4BXXG 1OU4A 1P74A 2B0JA 2W48A 2X2FA 2OAEA 5LBIA 1IWBB 4YAOA 2ROQA 2WP8J 3MS7A 2PUWA 2BFFA 4ISCA 4J9UE 2C0PA 4HFJA 1AKWA 4QRIA 3W1GA 4R84A 4OB7A 1V16A 2JVJA 2X8WA 1JBQA 2OFOA 3NKFA 1DBWA 3OPYA 4GPIB 2YJZA 4ZVVA 4BRSA 1RZUA 1EWRA 1R0LA 3N58A 4D9MA 2JA6G 5CG1A 4OI4A 1DCKA 3GEBA 4A1OA 2FQXA 2FRDA 2X8LA 1OASA 4E3WA 5L4LA 2FE3A 1EM6A 3TH5A 2WBLC 3HDYA 1EWQA 4EG1A 3WWDA 2XOKD 4MUNA 5JTUA 5EUCA 3LUKA 1NOKA 4DW8A 2HJHA 3GIJA 3BXGA 3OQIB 1OI3A 2P79A 1E3EA 2FW8A 2FWJA 1JIJA 3RBEA 3H87A 5KAMA 3S2FA 2W22A 4TKLA 5BW6B 1KU0A 2WWRA 3DFFA 2GK6A 4BFLA 1J70A 1F6WA 3QUSA 2VPQA 1E62A 3P2EA 4XYEA 5HJ7A 3VBCA 1ZWKA 3I28A 2QRHA 1NOJA 1DOHA 1F0KA 2BHRA 2A86A 5H02A 1D6NA 4EENA 1N5LA 2RHWA 1ZGHA 1EK1A 1DJPA 1G17A 2JGAA 2FGKA 4IEFB 4OOFA 1T5OA 3BD9A 3IUQA 4I6EA 4P4TA 3DHEA 1E7QA 3BA9A 2X1MA 2WD9A 3UKDA 3HVKA 2J9GA 1DWQA 1JIKA 1QG0A 3PDCA 4DR4B 4FP9A 2R60A 5REQA 4BY1G 4JI0H 2C31A 3K0BA 1AKUA 3V3KA 1MV5A 4DLXA 1NSYA 1MA3A 1NR1A 1OFGA 2GKSA 2IYZA 3ANNA 3M0EA 4FDVA 3KJEA 5C35A 2H52A 4DA4A 1I50A 3RTAA 2FMIA 2YVAA 2HBRA 4CC5A 4GO1A 2PMCA 3RG8A 4ZWNA 4QFBA 2AYYA 4BGUA 1MF7A 5HQ3A 1T43A 1SZCA 2EZ4A 2A0KA 4BEBA 5LQRA 4FZ3A 5K3FB 4BGVA 1KZHA 4CHTA 2DUJA 1MVLA 4OKNA 3WJ7A 4QU8A 3UFBA 1Z7YA 1GTRA 4Q9JA 1POWA 1USWA 5I5TA 2CFCA 3HKCB 4JL8A 4N5IX 3AHIA 2QRNA 2QB5A 3M5DA 5EYPA 3RS9A 3WQRA 4Q1CA 1RJFA 2DPXA 3CUVA 4IF6A 4G0YA 4JZYA 3PTAA 3D5QA 3AP1A 1VKNA 2ZI6A 3HUUA 3D43A 3NI2A 4RY0A 1F1BA 1B4DA 1LV8A 3HQ4O 2J4DA 2PWZA 1R15A 1PLLA 3ZH2A 3OG9A 5SYNA 3ZCVA 1IXSB 2GF2A 2W2TA 3PVXA 4IIJF 3GRAA 3H9QA 3JXEA 1JYSA 4Q93A 1E9AA 4TRJA 4DCVA 1ARZA 1CRLA 4RVNA 4CN8A 1HT1E 1HYGA 4F5DA 1UWKA 2W6JD 1KMHB 3CF4A 4PBTA 2P9YA 3ETGA 1JTEA 1Q2XA 3F3SA 2Y3IA 3QPUA 4JAVC 5T57A 3D6TB 4EK9A 1OXKB 3WHIA 1K4KA 2HSWA 2ICAA 3JS5A 1VZ3A 3B7PA 4Y67A 1S2OA 2BEKA 3CF6R 4DUZH 4RPCA 3N44B 1K6EA 4V3CA 4RU1A 2VYFA 1AKMA 3MOGA 4NYEA 2AMYA 1V1MA 2GM5A 2OM2A 3CX8A 4JI0B 1GSOA 3ZDCA 2JNWA 3VVLA 4K9SA 1XCMA 2JIOA 3EVZA 3OFVA 3P2IA 4MGHA 5HBRA 3ZKAA 5AVYA 2O0MA 3EMKA 2DLCX 1TT5B 4LOIA 1MAWA 2O3SA 3TXYA 2WFLA 3PNSA 1OKKA 1ZK0A 3K9HA 4CG0A 1BS2A 1FP2A 2X5OA 3HV2A 3VC3A 2HMSA 3BWYA 5HM6A 3ZWCA 3KYIB 4BNDA 4R2IA 3LC7O 4XPZA 2ISQA 1NNSA 5ALUA 2WJGA 3RSSA 1I10A 2ZJYA 2KYRA 3BMXA 4Q01A 4QJIA 2ZULA 3ZU3A 5KQGA 2RAPA 1EEHA 3OF3A 1GZVA 4RMHA 4Q1FA 1ZD3A 5C8YB 4M1SA 3BCSA 4A7PA 3WIBA 5EPOA 4PZ0A 4ASUA 2X2OA 1IK6A 1UIMA 2GB4A 2OGSA 1DTEA 1W1WA 3MA0A 4NK4A 2ASVA 3ROPA 2VRCD 3B6ZA 3MFHA 1FYXA 2BBTA 4JB0A 5C7IO 2QSJA 2Q7XA 4FKMA 4O0LA 1CS0A 4HNAA 3JD1A 2LIVA 4DSNA 1B8VA 5C44G 5TXGA 3TX2A 5D3QA 3AEXA 1MABB 2A33A 4C7XA 3W3ZB 1P75A 2RMKA 3KB6A 3U4QB 1JUDA 3EXAA 3L40A 1ORHA 5K0NA 1E1RD 5THXA 5K6RA 2CUKA 1F20A 3VDQA 1X14A 2E85A 2UZ3A 4B33A 1TA8A 3WQSB 1DDOA 2R0QC 1KL7A 1MIHA 1HBJA 5DQHA 2E2HA 2YV4A 1VBHA 5F2KA 5LVAA 2P0YA 2GBFA 4P4SA 3TDKA 3IR7A 1O6FA 2Z8ZA 4KR0A 1N0HA 3KSRA 2C9ZA 1XT6A 4ND6A 4H4EA 4R9VA 1LLCA 5EIWA 5KSOA 1XLVA 3DKVA 3LDGA 1T3LA 3P5SA 4YRSA 1FSFA 1YMQA 2C1ZA 1C0LA 3QVGB 1PNVA 3KKKA 3RARA 1WCMG 3UY4A 2Q0SA 3LT0A 4Q9NA 3W5DA 4G26A 4BNIA 2WWIA 2YCHA 1SCKA 2IL1A 1UK9A 2EGHA 2IU3A 2M9MA 2O2GA 3I53A 4E4YA 3GMSA 1PW7A 1VECA 3H16A 3THXB 3CQ9A 2WPDA 4EQ6B 3AQIA 2L0XA 4LXQA 5CH8A 2PXHA 3WWPA 5IAEA 4BNJA 4DHEA 1RQPA 1Z26A 3BXEA 3T3PB 3HR4A 4RPJA 4DT1A 4N82A 1P7YA 3E9DA 2BV3A 3VPAA 1AJEA 1YDMA 3A14A 4KIFA 4HDKA 4HQNA 4FBGA 4KC0A 3EUAA 4JKYA 2AD5A 2DHRA 3NRCA 4U5QA 3JQBC 4KL8S 3DE6X 2R6CA 5F1YA 3LDAA 3D3WA 3LDUA 4EW3A 4HGZA 1P0CA 3PXEA 3OFNA 1MO4A 4D8UA 4JROA 4EO4A 4YAKB 3DC2A 1OWNA 1N3YA 2B61A 3VRHA 1KYZA 5CNIA 2WHPA 2O1EA 4N01A 4OMUA 4DN6A 4F1KA 1FRZA 2A4KA 2OVBA 4NH0A 1HQYE 4MQ4A 2XIJA 9LDTA 2QAGB 1UWVA 4RPLA 3T95A 1NYLA 3PA8A 1DAPA 1DRUA 1LI5A 1CQZA 1Q44A 4LHWA 5K8CA 3QSYA 2CKZB 4JUZA 1HQKA 3RAXA 5DRTA 3FHCB 3RVNA 4BFCA 1ML4A 4UEJA 4C2BA 1QFSA 4FYKA 3HKEA 1T0IA 2CLCX 3IEPA 4UJ5A 5LXTF 2PS1A 1MTOA 2QJTA 4WEQA 3OZCA 4YP0A 4BO0A 1QQTA 5K09A 1JHQA 4WFIA 2ZDHA 4L75A 3CZCA 2CMFA 3BD6A 5REQB 1VMKA 3ZW8A 2BEUA 5J2UB 2ACEA 3TKYA 4P7KA 2Q5CA 4LZJA 5HEKA 4DG8A 4ERNA 1KR2A 1MVNA 5AW8A 5KQPA 4JI2H 2F3TA 3N2ZB 1IDN1 4G67A 1BA3A 2H16A 4EY7A 1G60A 3PTZA 4IQ8A 2GJ8A 2OH2A 2HWUA 3UTDA 4HKTA 3ZIUA 1O9HA 2QVLA 5AMXA 3QWFA 4PYIA 1Z8HA 2DPIA 1SXJC 2JZCA 5BQXA 4I1YA 1ZZGA 2QQ5A 1QTQA 3VNRA 5FI3A 2JHPA 1USGA 4EF5A 3NHUA 3WJAA 1T5DX 1ZGGA 2QAIA 2FPIA 3KNZA 3KSBC 4G9EA 2DUWA 2YZKA 4L6AA 5JD6A 2WU8A 3BYZA 2PQ2A 3U54A 3GJTA 3MB5A 4UEWA 4GG1A 1RLTA 4PNEA 4RAYA 4YR2A 1GILA 1NJ1A 1L5ZA 4TN5A 1TU4A 3SC2A 5HM8A 3ZCSA 1JR3A 2Z2ZA 4K88A 4YH1A 1JLLA 1A98A 4MV7A 2GZSA 4FI3C 4LHEA 3UMJA 4E2ZA 5AM3A 1T1IA 1N32B 4M1OA 1NUHA 1WUYA 1NC3A 2OCKA 5GY7A 1SG9A 4OHBA 2OXIA 2IYRA 3ZS9A 3HVRA 4DEVA 1V6AA 1QH0A 2CD7A 4UMVA 1D0SA 4XQCA 4AKEA 3NGMA 2H1IA 2QJRA 1NVMB 1JQLB 5G41A 3HLKA 4BWGA 4LF8B 4AC9A 1K66A 2JAQA 1YB2A 3H9BA 4DLYA 2R2AA 4EJMA 2H18A 1W5AA 4KWTA 3GZJA 1D2MA 3VPBA 2FHPA 5ESXA 2H08A 3KAJA 1IYZA 1IUPA 1MC1A 5B55A 2I1QA 5IYCG 2IIPA 1G21A 1S8FA 3PT5A 1ONOA 5KFWA 2RH8A 3H6HA 1LPNA 1V2HE 5B2FA 3PC8C 1GCOA 3T7EA 3EXIB 3UGKA 5HF6A 3ZU2A 1ZJJA 3C3XA 1TF2A 3GU3A 5FPOA 2A7XA 4WDRA 4XB1A 2AWNA 1LPOA 2ZVQX 4JBGA 2FMXA 4NL4H 3TLYA 3VHLB 3EA0A 3KOMA 3VNBA 4DIUA 2VNJA 4V1CI 1TKRA 2VCYA 2BPOA 2N46A 3RIMA 2DKFA 4RZ3A 3ITEA 2WLTA 2WSMA 3FDZB 1Z6ZA 2V4MA 4WOPA 3UC5A 2NUBA 3U3XA 4E15A 3UJ8A 3D0KA 2AZMA 4DIMA 1CJMA 2NO0A 4YLGA 4ARAA 3BB4A 3QU5A 3F4BA 3GPLA 1I32A 3LUGA 3BFPA 3FKJA 4ZYVA 2DY0A 2G17A 3V4SA 5JXJA 1BN6A 1FMTA 3G5MA 1M2HA 2VS1A 4HF7A 3NYIA 4LZAA 1JQBA 1ZESA 1FS4A 2ZRNA 4F5EA 2CFTA 1OXUA 3H05A 3K4PA 5I3CA 1HNWB 3D0RA 3G89A 2HA4A 2V8BA 1PGOA 1K8XB 1NVGA 4J0KA 3B8EA 2HMTA 5DBOA 4E09A 5KSZA 4JOCA 4X8LA 3EUFA 1CVRA 1PZNA 3R0XA 3RNOA 4CL2A 4UOZA 1IG3A 4PTYA 1H9CA 2XADA 4QIHA 5KX5A 5LA6F 4MVJP 1A76A 3QWIA 1FMLA 2EZ9A 1T2EA 3R7BA 3BIFA 4BX3A 2QAGC 4MITA 3ZE8A 3B9QA 1Z6QA 4NESA 1STOA 4AY3A 1DUSA 5ADUS 2AMFA 5KT6A 1XCJA 2J0UA 3OP4A 5AK6A 3CE9A 3UWMA 5KYWB 1UQTA 3GP8A 1V35A 3IAUA 5JBQA 2ZSFA 4KQXA 1JHOA 3OLWA 1JEJA 3BXHA 3JVVA 4ZRDA 4N5HX 2GK4A 2ZAMA 4M8KA 3V4OA 2FE4A 1Y5NA 4X8MA 5IS2A 4Q4HB 3PSHA 4XGIA 1WU7A 2CJXA 2FA9A 1X1TA 4RC9A 4NFYA 1B6SA 1PJSA 3SZUA 1V45E 2FFJA 2RAFA 4KMRA 4PC2A 1YDHA 4WY5A 5LZ9A 5HFAA 5KG6A 4GGOA 3L4EA 1QDUA 2GDZA 2G9VA 4LV6A 1CFZA 4JR1A 4OLHA 2I8AA 4P6VF 3Q98A 3HU2A 4IHJA 1BCSB 2OGZA 1LWOA 1VJ0A 1D5CA 4FHFA 3PQFA 4RSGA 3UT5B 2GXUA 4LBVA 3Q8WA 4HDMB 1DBSA 5AI6A 2BMDA 4BDSA 2PS9A 4E51A 4OFXA 4ZCRA 4UKDA 1AUPA 2IHBA 4CR6A 2JH9A 4ZEOA 5JXGA 3GPCA 2FSGA 3I9V1 2R25B 1JG1A 1FP6A 2I3DA 4UUMA 2A5FA 3RU2A 4JQSA 2MSWA 3CUYA 1M2OA 1A5AB 1VJ5A 4MWGA 2HVSA 4YJ2A 5AK5A 4EPYA 4D9HA 2GPWA 4YP3A 3G7SA 4C0HA 1IH8A 3ES9A 2ETXA 3Q3GE 2JASA 2FPRA 3C1AA 5HIAA 2G9UA 5IXYA 4WZAA 2OZEA 3I37X 2PPVA 4CMAA 2VDMB 5TRTA 5KNCD 2Z3VA 1QX4A 3TKLA 2XB6A 3RYTC 3ELWA 1PGPA 3KT6A 4YPFA 1ODIA 1AQYA 2C54A 1KEUA 1RFGE 3FNRA 1E59A 2VUUA 3OT1A 3PC4A 4FFDA 4OJTA 3WLSA 3JYNA 2VJOA 2FRVA 3UKJA 2JGJA 4GZLA 4R8KA 5DO9A 4QVIA 3FOFC 3OSZA 1CZNA 1WUTA 5BWCA 1N2GA 1L7NA 4EH1A 1Y6RA 1Y1SA 2OCYC 4MYUA 5GZ1A 4KPFC 1W30A 2JBAB 4KO3S 2CJYA 3R23A 3QHQA 4IDEA 3PXDA 4M49A 2F90A 3F67A 2IOQA 2H2IA 5EXTA 2UZ1A 1EVYA 2JLQA 5A6SB 2PZLA 5DK4A 1WDWB 4JGIA 1IAQA 3MTAA 4TUYF 5DGBA 3GAAA 1KAOA 1ULSA 2OHIA 3DBRB 4MMYB 5EXPA 5KWJA 4ND2A 1FP1D 2NZWA 2JGMA 2FOXA 2LTAA 2ONCA 4I9GA 4UHEA 1Y6GA 1TW2A 3K9GA 3D0QA 3IYLW 4MP8A 5JDCC 4Q43A 1Y8ZA 3H17A 1H2WA 4J9NA 2AGVA 3FN4A 1C4KA 2PS0A 1SQSA 3ESZA 3UAWA 4M60A 4RTRA 2O6HA 2YJGA 4M9QA 4DM3A 1DKMA 2CLIB 1R4ZA 1GXSA 3L6UA 3PRHA 2DPMA 4GQIA 4R41A 4ZV7A 4Z54A 3SDBA 4IKOA 3WQHA 2FUG6 1EBFA 1WCWA 4PN7A 3STVA 4UCVA 2HO5A 4Y2PA 5JNWA 4HFRA 3A6DA 4LF8H 1VP3A 1ZHFA 4K6FA 1TEXA 2ES4A 5CHYA 1H23A 2VDJA 2WA1A 5GP1A 1GPLA 4BQPA 3EGOA 1U9ZA 4LDZA 2B20A 4FCWA 2YJ4A 1NGSA 1JLLB 4G56A 2BFCB 1AV7A 3BTUA 3CJTA 3C6BA 1SU4A 4FZ5A 4H1UA 3RTCA 4BVGA 4I3FA 4LE0A 4REQB 2D3WA 5L3SB 3BMQA 4NR0A 1FJXA 1ZPDA 1NN1A 1X7ZB 4MUHA 1LF0A 3KSUA 5HA5A 4NAUA 5AKHA 4HX9A 4RETA 4BV3A 4C2UA 1WCV1 3H5IA 4NMWA 5K05A 4AZ3B 4PSDA 3HBLA 1WRVA 1LDNA 3TE7A 2ZYTX 3WGOA 3VGPA 2CFSA 1VG0B 1JIQA 3DGFC 2SCUB 2NUTA 4ZYZA 1R4NB 3TL2A 2RG1A 2HJVA 1IRIA 3NBUA 1ULZA 2AD1A 3TRKA 4DL7A 3E61A 1NMEA 2N0SA 4I8DA 3ZLTA 2AOUA 2KWIA 3EA5A 1FFEA 4P0PB 4FGJA 1JGTA 1NN0A 3TOCA 4KODA 1WHSB 2YWCA 5F9HA 1Y1RA 4JI2B 5JSKA 5EZQA 4CFSA 4CEIA 3QX8A 1DO2A 1OZGA 4G1EB 2GQ0A 1NRIA 4A4DA 3AF6A 1KEKA 3RASA 2J6HA 4IWNA 4RW0A 2YIMA 1DELA 1GY8A 4NXNH 3BH6A 4E2WA 1OLXB 3GGCA 2ZUFA 1M1UA 3H42B 4RUKA 1E7RA 3L07A 2BM0A 1SIBE 2OOSA 5CNKA 2REQA 1P5JA 4FYPA 5HQJA 3RS0A 1SRQA 1B6TA 1M66A 4QXOA 3RRMA 1ZR4A 1Q7GA 3LECA 2ESRA 2P1ZA 4KH0A 4LOHA 1DIBA 4AYBA 1QG6A 2BSAA 4OQLA 4WI1A 4ZDIA 3BIOA 2GAAA 1HWYA 2COKA 3QU2A 3LVBA 2JEFA 4TLBA 4XX0A 1IY9A 3ZV5A 4RD0A 4OQZA 4D3FA 2PUFA 3IRUA 1NFFA 3CZRA 3UT6A 4FN5A 4W5NA 1JDPA 1GLVA 5F76A 3VNVA 4UNIA 3H9JA 4JOBA 3VYVA 4RKWA 2PRZA 3TPCA 4PU0A 2C5BA 2IIBA 2I3GA 4RMIA 5HMLA 2V7WA 1YU6A 3C3WA 1FVIA 3WBBA 4J3JA 3UNXA 4X66H 2R66A 4V0ME 4L1KA 5HKOA 1I7LA 3EPGA 4JKOA 4MR7A 1L7VC 1AQIA 1K5DA 1QHIA 1V7PC 4XKJA 3PXAA 4INOA 2QZZA 2PPLA 5G0SA 2GN0A 4L6IA 4PTZA 3FIJA 1V4YA 1T2CA 5CAEB 1Y5MA 3CF2A 2F1IA 2J08A 4HXYA 4OVKA 4PX5A 4QUHA 1E2FA 4UAVA 3QOFA 1CVIA 3OLYA 4X3OA 5L40A 5LQKA 1V8PA 3BUSA 1V1JA 2ZTLA 3DM9B 4BQOA 2B8TA 1VB5A 3EZFA 5DPMA 3IPCA 3A6EA 4KQ9A 1UZMA 3MT7A 4PLZA 2WAQE 3DE7X 3S28A 1N7JA 3OLXA 4X8HA 3VNAA 3UXEA 1G5TA 4MKIA 3G82C 2EKQA 1RC0A 3I92A 2VAWA 3VNQA 2YV1A 3PWZA 3PPXA 3O4HA 2ZREA 3PR1A 3S0JA 4BS9A 4HBGA 5CLFA 1PU2A 2W00A 3PW7A 4OSEA 3TZCA 4QZVA 3OFSA 4N65A 4NG4A 2PQ0A 2X2EA 3DLAA 4KAFA 1TGVA 1IZ7A 1EXDA 2G1KA 2WE7A 4G1FA 3H5LA 3WYCA 3M6VA 3IP3A 1TQDA 3MIIA 1UDCA 2DWQA 2PX3A 1RRVA 3PKJA 4CTKA 1SD5A 1FVXA 3F3MA 3F96A 2CC2A 1Q7BA 2C57A 1F2UA 2O06A 3EUWA 3C7CB 2CUZA 3DLPX 4IS3A 4R2MA 4DLBA 4WZAB 4CEHB 4DCCA 2FVYA 1GZ4A 2JGDB 5FTJA 2XYPA 4BY9E 5AI9A 1H22A 2X13A 1IHYA 3TNDA 4EKDA 4W5OA 1V3UA 2R65A 2RCNA 1TVKB 5I5SA 1T91A 3MWDB 3PFWO 4IIUA 3A36A 2Q4TA 4XOIA 4E22A 3HOVG 3JZMA 1ZK3A 5DCWA 4W5HA 1EXVA 1EDDA 2ZVJA 3DLCA 3OZDA 2Z98A 5F52A 3I2JA 5D1HA 2CBGA 1UUFA 2ZXUA 1DE0A 1CHDA 3IDSA 4BVHA 1EHIA 2V74B 2MSLA 2B1QA 3OT5A 4AN4A 3CW9A 3WGZA 4BX2A 4U2GA 4NJEA 4CMIB 4Z5XA 3VSBA 4EUNA 2CW8A 3OJFA 4Y2YA 1HL7A 1XRSB 2A1IA 4NP6A 1Z47A 1SC6A 1UPCA 4Q66C 5A3RA 3B3AA 4A8TA 1V1RA 1Z82A 3T7DA 5B7GA 5JCPA 2R92A 5FWYB 4PVDA 1GPJA 5FL7D 1RYEA 1UKEA 3RB0A 2DJIA 2AXPA 4UAUA 3QVUA 2FR8C 4PANA 1P39A 1RAHA 5BSMA 1I7SB 2XXAA 4Q03A 2E7ZA 4X54A 3BJYA 1GIAA 3C0KA 1U8EA 3P71T 2O59A 2HU5A 1M0SA 2WD7B 3JWGA 1NONA 1P1IA 2YHUA 3OECA 3QBVA 4EWLA 5B3JC 3R0QA 1NXWA 1BDMA 1KJYA 5A4FS 1SR8A 2Q6LA 2Z04A 1S0OA 1COZA 4PAOA 2RHRA 1RBQA 4MWSA 4U9HS 3EDRA 4Y2QA 3MRSA 5I9SA 2PU5A 4PCUA 3B53X 5ALOA 2J48A 2X9NA 4B6GA 3HA2A 4G01B 4R3WA 4AG5A 3C45A 1SUAA 2Y67A 1VSVA 2F2TA 4UUAA 1NG9A 4IIYA 2HGSA 2P4SA 3HADA 5HMMA 1THTA 3HJCA 1DGQA 2COIA 4Z86A 1OBDA 3QNMA 4XUCA 3TM5A 2O1SA 3OFND 4BVEA 4HNGA 3AETA 1UJMA 4YRMA 2IX3A 1TWHA 3KTOA 1SVMA 4RCNA 3DTFA 3RR2A 4IQGA 3BD8A 2BR5A 4CKXA 1E89A 2EKLA 3RIZA 3RBAA 3HOXG 1M72A 1SBYA 1SHZA 4RVFA 3ZI7A 1DP4A 1M0WA 5LMNH 2SBTA 4C78A 1QC5B 3EY4A 3I5AA 3W9BA 1KNQA 4X24A 4HFNA 2MYPA 1R6BX 4DYDA 5EGSA 4MAMA 4P3YA 2XF8A 4TKUA 2XXBA 5IYZA 1ZMTA 2AHRA 2VQ6A 1LSJA 1B15A 5BQ3A 2ORWA 2P3QA 4YDQA 2CVOA 2HRCA 5JO9A 2D6FA 2H11A 3BAFA 3V6JA 1L8LA 3L8CA 3KXYT 4L7VA 4F6CA 1E9SA 3VPDA 1W76A 2NV6A 1L5HA 3VHQA 1E9FA 1HMYA 2VF7A 1CE8A 3GFGA 4BUCA 2YWGA 4MUYA 2VK4A 3FE2A 4NPHA 4A3DG 2PANA 1BKDR 2CW5A 2IA5A 3L4KA 2Z2XA 1K7EB 2WWFA 3N70A 3N59A 3NIFB 4ZQCB 3N3AC 3QFTA 4BBPA 4LHZA 2OHGA 4J2OA 1A2QA 3B1ZA 4XVHA 3AVYA 4F8JA 1OR8A 1U0FA 4MOWA 3F47A 5LYJA 3LLVA 3OA2A 2CLFB 3AX6A 2R4UA 4O86A 2RHHA 2X8JB 3MUFA 1F8XA 3GGDA 4OHUA 1KP3A 4RMJA 4LFCH 2C61A 5E1OA 2Z6UA 2IXEA 3QLTA 1C30B 3GIMA 3P9QA 3KJXA 1OAKA 4DV1H 1JFFA 2MHCA 2V0NA 4JVOA 3BQ0A 4KX3A 1V5FA 3OWHA 4NNPA 2QE7D 4CM1A 1UWCA 4XXHA 1EQAA 4UUBA 4KVAA 4WLOA 4YCCA 1KBZA 5L1KA 4M6WB 3DEYX 3T5AA 3O2SB 2PMKA 1WXXA 3ONNA 5DM1A 2BSXA 3V8RA 2KSWA 1CQIA 5JDIC 2XIGA 4UDOA 2OZPA 5DW0A 5JH7F 1UFOA 5DM70 1U4NA 3EPPA 3R2JA 4KJXA 2SKDA 4V24A 5AD1A 3HTXA 4FE7A 5LOVF 4L85A 1N2XA 4OUDA 2CL0X 4YJHB 4R7GA 2A3NA 1KYTA 3HY3A 2IYLD 5CG2A 2QGNA 3CLSD 3FBTA 4WCDA 3QKWA 2P4UA 3L7MA 1WPGA 2PX6A 5BOSA 1GN9A 4EZBA 2Y2VA 4A0RA 3H8WA 4LNUA 4Y2GA 3FCOA 3QKIA 1YNOA 1GG2A 4XD2A 5FO0A 4GBGA 5JYEA 5ES3A 4DMCA 1XJCA 3Q7QA 3QA9A 5AUQA 1JBKA 4PYOA 3W5OA 4B73A 2OYCA 2FUNB 4ECZA 1DXOA 3EG5A 3N2GA 4ZXPA 4XYBA 3UWPA 3V9PA 3X2SA 2JLXA 1F17A 1SCUA 3D1JA 3HC7A 1NYQA 4MRMA 1CBUA 3A0RB 3G0DA 4MAFA 3TKAA 1Z0UA 3QBDA 3A8TA 4H15A 1C1XA 4AX4A 3DLBA 3UMFA 3BA8A 2BFWA 2BF4A 5DNCA 1IOWA 2XCSB 5BPFA 1QAOA 4HQ0A 5DISC 3Q0TA 1VYHA 4IINA 5KG7A 1SKAA 3VBEA 3B82A 1XDDA 3PEEA 4DXAA 5CUQA 3N8KA 1YQQA 4HB0A 1UBFA 1X39A 1JL3A 1Y6QA 3GJ4A 3EB9A 1GHTA 1I6KA 1FNBA 3V1YA 3CVWA 3PNOA 4FWBA 4IDFA 4IJQA 2QYSA 5KTTA 1XZQA 2JEYA 3GPBA 1W93A 1V16B 2FEKA 3WWYA 4A9AA 3HYSA 1VXOA 1Z0JA 2J9XB 3Q15C 1AKQA 1PYGA 4MQ6A 3K8YA 4OQNA 1XTKA 4CM3A 1U7HA 1UPTA 3Q8PB 2K5UA 1NX9A 2L2QA 1SOVA 1J21A 3SJAA 2ZYUX 4DMKA 1TTTA 1N6PA 2MJLA 1VLLA 1BXRB 2VPIA 1YR9A 1LSSA 1IDOA 3E3NA 4LXUA 4LV5B 3SOPA 5CITA 1O96A 3B48A 4OLBA 4FMCF 1NATA 5IU6A 1SVUA 1EFTA 3MNFA 1TKAA 4AKGA 4BHTA 4F3RA 3EOBI 5A5FA 1Z36A 5ITZA 2I7VA 4OX9H 2BELA 2C98A 2I65A 1SEIA 2I9PA 3ZY4A 3C5HA 4FYVA 2GVDC 3DMTA 5JV5A 2UUBB 4NLLA 5JEEA 5LDHA 4RK6A 2GZMA 1ZAYA 3UAXA 3C6ZA 4JIGA 1Q7EA 1QTNA 4NJEB 4RQAA 3RAJA 2E5LH 3WMEA 4C4OA 4CKWA 1A7UA 2WJVA 2KX7A 5DNYB 3RW9A 1E6MA 1XWIA 4UFNA 3JQFA 1ULUA 4W5QA 1NP3A 4Q4JB 1R50A 5CA1F 5FV7A 4C7OA 2BGKA 1KHTA 1P9RA 1SRRA 4F45A 2NTYC 5KT7A 4UU8A 4GX2A 1P4RA 3NHMA 3Q9SA 4Q7LA 3T1HB 3ZG6A 1L9KA 2GNOA 4IRKA 1ZGZA 4DC1A 1QYVA 3THWA 1GPNA 3FTEA 3CKKA 3GGJA 1HRKA 2IPNA 3PQ4A 1C8LA 2NSLA 3MWKA 3WLLA 5A71A 1UXHA 2ZS9A 3WGVA 4X60A 1R4MA 4PZCA 2AJTA 2I91A 3RSGA 1I1KA 4KTTE 4PFQA 3W7VA 4JI7H 3LBNA 3LNCA 3REQB 3M4IA 4QYXA 1NM5A 4KRXA 3MFQA 5DP1A 3OQPA 5H3CA 4KDRA 3O47A 5ALHA 5BVHA 4JBXA 4IWXA 2IELA 2YN0A 3EGDB 1I80A 4XM2A 2XGJA 1XKLA 5BR7A 3RUCA 3UMRA 5IP9G 2FPSA 1ZWLA 3K3PA 2F3UA 2WOOA 1RXWA 3VR4H 1K5GA 4EJSA 5HKAA 3ASZA 3U56A 2CVFA 3U37A 4Y6PA 1GKLA 1KQNA 1T2VA 3VPSA 4WHMA 3AVUA 4WN3A 1I5EA 5K8VA 1P7CA 4ZOCA 3H18A 4OHYA 1NNUA 2FEMA 1EFPB 4DIEA 5I7VA 1EXMA 2HMYB 1SFRA 3IJRA 2VA8A 3W1EA 3WFZA 1ZS9A 2ENWA 1EI9A 2IQ5A 5TMEA 5BP7A 10MHA 1Z6YA 4TZ0A 3TMAA 1KMHA 2YJ6A 4ZICA 3I2YX 1IJEA 3K1JA 1E5TA 3CTPA 3M9WA 1AZWA 3LGAA 2X2PA 4C01A 4IDPA 3AKYA 3AFNA 2IS6A 1FS5A 3GPDG 1WETA 3AL3A 1M33A 4WXEA 3WYGA 5AK0A 4ZIRA 5HBRB 1NW3A 1S9DA 3AY6A 4HQOA 1YK1A 3E1GA 1YRWA 2R6R1 4J3FA 1M8GA 2A94A 3PR3A 2FN8A 1H1LA 4X64H 1X92A 1CY4A 2P2DA 2VHVA 3DOUA 3HB9A 3MGAA 2Q2TA 2PA3A 3Q9UA 4V2UA 2CUNA 5EEGA 3SX4A 4D02A 4WA7A 4TLDA 1MOPA 3S29A 1ZRSA 3L1VA 2NM0A 3VV2A 5CA1B 3A26A 4P81A 4MGEA 3K73O 3EC7A 4RORA 2BISA 3ECSA 1JU9A 2B3TA 3JASA 1RM4A 2H48A 2JCGA 3C8ZA 1R2QA 4HTAA 4DV4H 1TEHA 4BJ1A 4DHWA 5EE3A 4DGQA 2POQX 5JS7A 1O95C 3QBTA 3WK5A 1UKCA 3QLJA 3ZWXA 2GXQA 3QIVA 4DLRA 3F74A 1DO8A 4UTOA 2AK3A 5HJEA 1RKBA 1II0A 1OWMA 1TM3E 1XLTC 4ZAYA 3RGGA 4AUMA 2VJMA 1WZIA 2SKEA 3NALA 4FIZA 1GFZA 1RJ9B 4EYSA 3AWDA 2VA9A 5LL6P 3SFTA 3RVSA 4M1TA 4MV8A 4GIBA 4BFTA 1WCIA 1XC7A 1AQUA 1JU3A 2HF9A 4YDSA 3KQWA 2WKQA 2YY6A 3WL3A 3RYCB 1VKZA 1HL3A 3G7NA 2BD0A 2HMWA 3M6AA 3EUEA 3NOOA 1MJ5A 4DWWA 3ENKA 7MDHA 1JDBC 2V65A 1KP2A 1TOAA 4QJ5A 3LD9A 3EISA 1V71A 4AF7A 2ECFA 4E1VA 1WCXA 4AJ9A 4E5NA 1T9DA 4U7CA 1SBNE 2IF2A 3ZGOA 2CT8A 3KB2A 2B3DA 4Y2XA 5K3AA 4GICA 2B2CA 2EFYA 4KRFA 3U4AA 2AZXA 2GN6A 5K6AA 4IZOA 1NN3A 1MOSA 2GDJA 2Q41A 1CKOA 5CXSA 4LF4B 3QQPA 5JASA 5DXJA 4NOKA 2Q3JA 3UAOA 3DWEX 4BASA 1H5UA 4RHUA 5BMVF 2QAGA 2A5DA 1QH1A 3SVZA 4GBED 2BFNA 3OIGA 2BFDA 1HEUA 3IQEA 2FW7A 1UXKA 1QYXA 4GLXA 3LI2A 3TTSA 4JK3A 4ZCIA 2V1UA 1G2IA 4D92A 4PICA 2BFBB 3M34A 1QZXA 4MZXA 5GPBA 4B48A 4DBVO 2Y1GA 4KOEC 5BWRA 4FD2A 4RFVA 1P9WA 1SCBA 5EP2A 2WWVD 3FIUA 3B2EA 2HU7A 2YMLA 1JHXA 4KXWA 1BW9B 4Z0HO 3RU7A 2Z5LA 4X20B 3CNNA 4FZRA 1IRXA 1IPFA 5ENVA 1JEDA 1SOAA 3FCCA 4YRTA 3VX3A 2I4RA 1O3YA 1BHO1 2E55A 2H3HA 1K0UA 2FK3A 3SNOA 3DLTA 4OGWA 1UDWA 4W99A 4YAKA 3LXUX 4S2EA 4RU9A 1YZFA 4LCEA 1PO7A 3DP9A 4OBBA 1ECJA 4WA8A 2Z4TA 5GTDA 1UKVY 4XWWA 1EK6A 4PRKA 4DA7A 4U7DA 1PTJC 2XI4A 4MI6A 1H4VB 2E6UX 3CPEA 3W5UA 4J75A 3E2IA 5HOQA 2HYIC 3FVRA 5DRYA 4C14A 4AJ4A 3DFKA 3GLUA 4H3KB 1OZHA 4R6XA 4RL6A 3RFXA 1YZ3A 2CJFA 5JEDA 2QTGA 1DX6A 3S24A 1R0YA 4LMAA 5A6VA 1RAIA 2BEWB 2MSCB 1BDBA 1UBTS 3ZJUA 2V6MA 1AUXA 3WMWA 3PP8A 4J1SA 2FSVA 4KOAA 2LKCA 5SICE 4CM4B 5BRAA 1NW8A 2R8BA 4IEIA 2B9VA 3MFIA 3WLTA 3G6XA 3TY9A 1O94C 2X9GA 4RSRA 3RVQA 4O83A 3WKDA 2XJ4A 2JFFA 3HCEA 2PZ8A 3TZEA 4QOEA 1ORVA 4NSNA 3F6RA 1EFVB 2EHDA 2FN3A 1RLUA 2I1VB 3T9AA 4JV5H 3D5TA 1KIAA 3C85A 4KXMA 1KI6A 2VL7A 3DZGA 5KI6A 3TSOA 1JFLA 3UB3A 3Q11A 4Z9FA 2Q8PA 4GSLA 2R2GA 1T8UA 3HCBA 3PE4A 2O52A 4LYEA 5LQUA 3DVAB 3UWSA 3TECE 1B2LA 1SBIA 3BJEA 3TFOA 3ESXA 1OXTA 2XUGA 1QYRA 1AA9A 3O3OB 2QTVB 3K09C 2F59A 2X0NA 2XNSA 3FMGA 3NBMA 3OX1A 1FVHA 1YCHA 2ZJTA 3G7UA 5C7LO 3OE7A 4HATA 4WERA 1V9CA 2JJMA 2G0TA 4K6GA 4RB0A 2VI5A 4FONA 3VH1A 4BMZA 2B7BA 3ZHVA 4RWEA 5HPYB 4NKRA 4TT3D 4DAEA 2GZ2A 1EFPA 4J90A 1E2HA 2C5SA 3O0TA 3BIWA 4Y2UA 1W96A 1E2EA 5DE3A 5GQSA 5TEWA 5I4KA 2QK4A 4BNDB 5JPCA 1GL9B 2HSGA 5M29A 2MYNA 1Z33A 2H3EA 1TVMA 3WL4A 7MHTA 4JT4A 5DHPA 2ECKA 1RXCA 2OV8A 1U7UA 3NBZC 2B7CA 5EINA 1KDPA 1TQ8A 1U0BB 1RT9A 3MUNA 3QUQA 4CKEB 1T1JA 3ZV4A 2MDTA 3VDRA 2BBSA 2HSDA 4Y6SA 4RPGA 1OWTA 4S0ZA 3V6LA 5KG5A 2X3FA 5EJEA 2AUMA 3IB6A 3VV3A 4NAVA 3RB6A 2BIFA 2FLLA 1JEQA 4UNQA 4F04A 2B2XA 1QP4A 3A1UA 4O3OA 3CMMA 1DBVO 2X77A 4JJ7A 4A6XA 4B3XA 4ACBA 2R8GA 1KJ9A 1KWGA 1NOIA 4QSMA 2ZAIA 3A4YA 5DG8A 2HHJA 2VUTA 1UP6A 1RJPA 1QV9A 2QUZA 3MGGA 4IIHA 5EIXA 3AM1A 5JT1A 3SKVA 1YI8A 3H5WA 3QF7A 4R31A 3QVVA 4BMYA 1L1FA 4BKQA 3OQNA 1JZSA 2J0UB 1OY1A 3TI7A 1NM5C 4KVFA 3EAGA 3U62A 3GUHA 4XWGA 1QE5A 2Q46A 3W06A 2C3MA 3JQRA 1CLUA 4NOLA 5AOBA 4DPMA 3R6WA 3GJXC 3FCYA 1I7QB 4DA8A 4DWVA 2WF5A 1VGQA 5EIBC 1OW3B 1QYDA 1XFDA 3O38A 2O20A 3Q41A 1HDZA 1RYBA 3DEFA 3UKOA 3VAZA 4AG6A 4WZBB 4I66A 4EHFA 2PL5A 4A16A 4URVR 2PKEA 4W5WA 2VTBA 1CEXA 1TJ3A 4HS4A 3R9RA 4LEIA 1LZKA 5JTTA 1DFHA 3G8CA 3CWZA 3IQWA 5F9LA 3M83A 1ZR2A 2DOKA 2DWPA 3SN6A 3NDPA 2QUJA 4UM8B 4EHHA 4HDMA 4O2LA 4Q19A 3LJKA 5DHRA 2P9JA 4BIMA 5IT9A 3W8EA 2R7AA 4DVGA 4PQEA 3OMLA 1KFCB 1Q91A 4MYDA 1G2OA 1MHPA 2QUHA 5CM2Z 1R6TA 1QP7A 1Z4IA 3KWLA 2EL9A 2C9DA 2A1HA 1WJGA 1RC1A 2WQZA 3HCWA 1YZYA 3QX9A 2BHTA 5KNBA 2GPSA 4RD4A 3DA8A 4DR2H 2I4MA 1IZZA 5GADl 2FF7A 4YMGA 5KTOA 2CMKA 4ETSA 2JANA 1IXKA 4ZQIA 1R37A 2RC5A 3H0KA 3R77A 4L4SA 1SH7A 2NAFA 1Y1WA 2O07A 5FOQA 3X1XA 4XWYA 1RRGA 2I33A 5F73A 4F6RA 2P90A 1OOEA 1T8SA 1U80A 3RVDA 4QT0A 4CIDA 2YXEA 4TSFA 4H7DA 5G4KA 2GHTA 4GPAA 2JD1A 4RFSB 4LMPA 3CUWA 4I14A 4JB3A 1KKMA 1KVRA 1M2VB 3AFIA 4HH4A 5IEBA 4JJAA 1Z83A 2UAGA 4QSHA 3P9YA 1RHUA 2VZLA 2YZ2A 1XTZA 5CP8A 2QF7A 2Q6TA 4ND7A 5HDQA 5HRCA 1GPDG 2GZRA 4KCGA 1LS6A 2B63A 2NV2B 2QRKA 1XV5A 2A3RA 2JRLA 2IYTA 5ICMA 5AUNB 3F7MA 5ERGB 4YJ2B 1FIUA 3DLIA 2X4GA 1MO5A 1RSZA 2Q62A 4GM1A 3U0GA 1H2AS 4FDMA 1NW5A 2ZCUA 3GBVA 5ULLA 1OPXA 1BMDA 3H20A 2IYYA 4JI6H 2XCAA 1DT5A 1G8AA 1H2BA 2AT1A 2H1FA 3PQ3A 4UBKA 4GF5A 4R2LA 3B2QA 3ZZNA 2FHSA 2QPTA 2B69A 1D6SA 1PSWA 2LPMA 2ETVA 3E70C 4DC9A 4DRFA 4FBUA 1RPAA 2VTVA 2J4FA 3BRWA 4X1KA 4YR7A 3W5HA 5EKTA 4FWTA 5K0EA 3ORQA 2G4LA 2C2DA 4KRGA 4WKCA 3EAFA 4G8DA 4F4YA 2D5AA 5GONF 1CY7A 3A1DA 1XCLA 2VNKA 3NHBA 1VZ2A 1XSEA 5DWQA 1S0NA 1JAXA 1PYDA 2CBZA 1C81A 1Q20A 4QECA 4YAWA 3TY5A 1F2TB 5K3SA 5AIBA 5JS8A 1US8B 1DO0A 4EVRA 4B0PA 4Y2TA 1X7YA 3RYFA 4RABA 3AVXA 1B0AA 1G8SA 5A6SA 1UCFA 1FUYB 2VF2A 5AJVB 4Q05A 3EX7C 5EGNA 2AN5A 3QLUC 4F3CA 1N7IA 2QX4A 2BEVA 5JSHA 3FTNA 4Q7JB 3R5SA 2F4VB 1FDIA 4P9NA 4QU9A 4DCTA 4INPA 3DCYA 4CF6A 4DL3A 1IBRA 2WOJA 3WWEA 1KY4A 1G8YA 3GHYA 1X77A 4L2IA 5BYAA 4MS1B 4G5SA 4ZAWA 2VNIA 1XEWY 5AJTA 1H05A 4M1KA 2GNAA 2PUVA 5F35A 3VPCA 3S99A 1IPEA 4C7JA 1VKOA 3BT7A 1SZPA 3IUJA 1CR0A 2FKNA 3GRPA 4TYPA 4Q9LA 5A04A 2F9MA 3MYRA 3O1IC 1WMFA 3BRSA 1J6UA 4DEXA 1O8BA 4QUJA 1M73E 3PYXA 1Q84A 3KHRA 3CX4A 3D1LA 4I9FA 2LD4A 2P6RA 3QX3A 5KTPA 4PCVA 4PRZA 1VL5A 1JX6A 1KKUA 2YCLA 3ELUA 3MJTA 4D4MA 1JILA 2ZLBA 3JD3A 5FAKA 4ZVMA 1Z0AA 1EGVB 2PR2A 3F98A 1U6IA 3QVKA 4J94A 2GA9A 3U31A 2CMHA 2PQMA 3VSAA 4EITA 5KZMB 4RTMA 4EA6A 4RZRA 3V55A 3UJHA 5HGXA 5I5XA 1RMTA 5BRNA 3SCZA 1ZITA 1T24A 2GJKA 1KU6A 1BXGA 1CZLA 1NQAO 4JT9A 2XBUA 2CV1A 5KYWA 4MWZA 2VVTA 2YFQA 1BH6A 1YQWA 3E22A 4OHFA 4WXHA 3HU5A 3G0GA 3FYHA 3V4PB 1XZAA 1UOQA 1UADA 1GTMA 1PZXA 4L4XA 4TVSA 3V1TC 2O8CB 2VDVE 3L8DA 4URWR 1VLMA 1VP9A 3TRFA 3LIPA 3PVCA 4W82A 3FYTA 4URXR 2AXQA 2LIPA 5T14A 3RHFA 3IBYA 4KPEC 3FKSA 4RADA 4W1QA 4GDMA 3AZOA 5TMDA 4LWQA 5DBEX 1ISIA 5K0CA 2W7PA 2YWBA 1FDOA 3DOOA 4QEZA 5IDWA 2O0KA 4ZPXA 4YGXB 4EARA 5HX7A 2VFAA 2IH5A 1HQCA 2Q6IA 1B76A 4FYHA 2WI8A 2NVXA 3EFOB 3NETA 1UM9A 1ZGCA 2Q1SA 4WEOA 3ZK9A 4BMCA 3H3XA 1BMFD 3HO1A 3VMMA 3FGNA 3FMIA 5HNKA 3BF8A 3EIWA 1BOOA 3IRVA 3RIYA 1WXFA 3VNUA 1CWUA 1Y5LA 1AMNA 3PB3A 5GINE 2O8EB 4EJ6A 1OUMA 1L4BA 1Q3KA 1UKYA 4RH0A 3DLHA 4W8OA 1UAAA 5DYTA 5TPZD 4YT8A 2WSBA 2H8GA 3VKUA 1DJQA 5FULA 1P4SA 2JK1A 4R5MA 4BCBA 4BWSC 5DZSA 4EKNB 5KG1A 4GP6A 1EE2A 4DREA 5EWFA 4NU8X 1OGIA 3A4MA 3KK0A 4B47A 5AI8A 3NUZA 1TI7A 3DXZA 3IMGA 1QRRA 3GRVA 3E58A 3SF0A 2Y66A 4LG1A 2GBIA 1D7OA 1RRPA 2G36A 4ZQGA 3PQ2A 4KE6A 5EMNA 5FF9A 5ED4A 3Q88A 1VLZA 2Z08A 5INTA 2Q3LA 1YK0A 4PPGA 2JHCA 4NDNE 3V5NA 4EB6A 5M04A 5AW3A 4ZQBA 4BNKA 3SJBA 2G5PA 3C74A 3DNPA 3P0IA 4TV8A 2EP7A 1DBIA 3IILA 4YS6A 5FFMA 3TTXA 2AI3A 1I2ZA 2AIRA 4LSZA 3ZE2B 2G80A 4B8YA 3TY8A 3OZSA 4L15A 2P2SA 3KLOA 4FEAA 4DA9A 5IANA 3QF4B 4M21A 1JI3A 2CLEB 5LLSA 4D8WA 3VTFA 1LY1A 1Q7TA 4ZK6A 1F2UB 3RLIA 1GAWA 3KREA 4C29A 5A9SB 2WABA 3AG6A 3O8QA 4J43A 4D82A 1QKKA 2DC1A 1JECA 1NY5A 3II6X 3UQYS 4TMTA 3QM1A 3VMFA 5EJ8A 3S8YA 3L02A 3NIGB 4MLZA 4P3NA 1PSZA 4U7FA 4HEA6 3DB1A 1RJQA 4BXOB 2OO5A 1R3UA 3FLBA 4ALKA 4N6NA 4XTCS 4JEMA 4LZPA 2WIFA 3DUFA 4ICIA 1X1EA 2HH9A 2PGOA 4E7PA 5K45A 2FPXA 1IHXA 1NKSA 4B3SB 1AF4A 1YTLA 1VC2A 4UM9B 4QXAA 1QU2A 4WDQA 3NTOA 4Z99A 3UOWA 1JJBA 3ASVA 1ZGAA 4R2JA 5F77A 4UXJA 5HUHA 4PV7A 5LZ2A 4DV0B 2W4IA 4O7TA 1RIFA 3MQFA 5EZYB 3T1OA 1MKYA 2PY6A 4LRTB 3KLNA 4XDGA 1V11B 1SGWA 2X3YA 3EYWA 3SSMA 4LF6H 3PPYA 5EIBD 1DC7A 2I03A 2Z9BA 4MDFA 3ONDA 2DWOA 4DV7H 3H3VH 4JBYA 1NR7A 5IJ0B 3GJYA 2X1HA 2W2OA 4O7LA 5CB4A 2F9FA 4DIBA 1A7JA 4CMDA 1Y34E 1HYBA 4UCTA 1X7WB 2NPIA 3C15C 3FSGA 4W5JA 4YMTA 2QBYB 1H1TA 1I6UA 1ID1A 4TQAA 4EUHA 3OSUA 4KWEA 4GMHA 4UQOA 1DINA 4B4UA 1ZUHA 2PL1A 3SQXA 1ILWA 1CY2A 3HXMA 3TR6A 1W0JA 3SKYA 3TNYA 2X86A 3COZA 1LRJA 3IPRA 4LYAA 1D1TA 3GYGA 1R6AA 1J7JA 1IN5A 1C3LA 2IHUA 3NBXX 4BU1A 1XHFA 4ED3A 1NUTA 1M6EX 3HKCA 4QOSA 1FJ2A 2QR2A 3AUFA 3QG5A 4N6OA 4P3KA 3HR8A 4PAGA 4QRHA 1RI1A 4WFJA 3AFHA 3KEQA 1T6YA 4PGMA 1N9GB 1JVSA 4AN0A 5I3ZA 5IT9W 3GMDA 3SFZA 4D42A 4ZOLA 1CD5A 4HMPA 5TF0A 2MSKA 4AY5A 3B85A 4KN9S 2I71A 3H2ZA 2YL2A 2QNIA 1ZX1A 2W8BA 4NOJA 2R1TB 4OJNA 3AM5A 1CCWA 1W85B 3TRDA 4DKJA 2O2CA 5H1YA 3WIVA 1GQSA 3T54A 3OZRA 3A3YA 4KP7A 4TWZA 3ZVMA 2ZVDA 1NXVA 4KXLA 1JNYA 5BUQA 4DSTA 1U0HC 1TMKA 4U6QA 4PHHA 1G3MA 4FGSA 2WJ3A 4FQ5A 4BVLA 3R5XA 2VWHA 5E1DA 1P5RA 2VK2A 1YRBA 4YROA 5I01A 2Y0EA 3GRCA 2QN3A 3M9MB 4RF2A 3MOIA 3PE3A 4O2BA 5FCDA 1QHHA 2D62A 1V1MB 2V4UA 1G8HA 3VJKA 3WB1A 3WV5A 4ND5A 2XZDA 5ECYA 3UT5A 1NF9A 5F5XA 1P19A 2IZ1A 1DOAA 2V6FA 3UCFA 3OM8A 4G8BA 4IAOA 1GRCA 2ODBA 2WDPA 3G0HA 1SIOA 3W5AA 1KAHA 3WR5A 5BWOA 3HSSA 1E1DA 1PX0A 3ESBA 1VE1A 1OHHA 2ERCA 6ABPA 1MNQA 3R6TA 2Z8XA 5C31A 3PVSA 1B41A 3U3OA 5JIBA 4CEJB 1N2CE 4D9KA 4Y0AA 4KREA 1ISGA 1B16A 4BE7B 4UD6A 1K7CA 5I4BA 5IH7A 4ZO7A 5KJEA 4N8DA 2RGDA 4C08A 1JG3A 4C5BA 5J3JA 1VOTA 3AKEA 2FMUA 2QX8A 1K92A 3E9CA 5JECA 1WOMA 1BDIA 2EJ2A 2IC5A 3G2OA 1M83A 1KNXA 5BSGA 4Z2AA 2CNKA 4X44A 1V8ZA 2I9KA 1HX7A 4PLFA 4L8WB 3OHSX 2DH5A 3KOYA 4BZWA 2V9WA 1FRQA 3PW2A 2H59A 3B60A 3KYHC 1MA0A 4N40A 3BGOS 4DR1B 3WICA 4Z1OA 3EGXA 3SS8A 4QUBA 2Z83A 1Y63A 3SZRA 4MQEB 1TADA 2ZSDA 1LBSA 2RDIA 2HV9A 1ZVQA 1YR8A 2G4VA 1XI2A 2FJZA 1DLJA 1JXAA 4LIPD 1QH9A 2GD1O 5AXDA 5BQPA 3TLMA 2V3CC 2Y0SE 3ZOZA 4LPSA 2OHVA 4ZREA 3DE1X 3BWXA 1H6CA 4GMDA 1QH8B 5J4YA 4HOYA 1E8DA 2WM8A 1I2BA 4LNUB 1RYMA 2PT7A 2X8JA 1GZHB 2QGZA 4LQCA 4DYVA 2YIVX 3ER6A 2QW8A 4MQFB 5GGXA 2XTJA 5KC9A 2NU6B 1Q92A 2EP8A 1QNFA 3DCNA 4ZC8A 4ZKEA 1J0EA 4P7FA 4Q3BA 1WPXA 2H2FA 5EIEA 4CGZA 1E92A 3AILA 1JWAB 1XZGA 4E0BA 1U0JA 4CI9A 4D9FA 4TQ9A 4OGKA 1JEOA 5C8DA 2HCBA 3I64A 2NG1A 1T26A 3KZXA 1E58A 1QFMA 3EIFA 4KU4A 4S1OA 2V9CA 4IGKA 3LK7A 1XTVA 2EDAA 3KZVA 3GQBB 3A1NA 5FBRB 2NSDA 2AOXA 1LDBA 5HFJA 2OYRA 1N6KA 4BO1A 3NTQA 1WTCA 2ZPAA 3WDSA 5FD5A 3TL6A 3X1YA 4A0FA 1OH6A 2BTQB 4KO1S 5FPQA 5E8JA 2HHFA 4EUFA 5LL6b 3LW8A 3CVJA 4ZRNA 5EMMA 1TUBB 1IMJA 3DH0A 1T4BA 4PRLA 4URUR 1G5PA 1K27A 1M1NB 3UHFA 3ZQ4A 4C2AA 3HB5X 5DN6D 2R6GA 1PS9A 3PU6A 4JI3B 5FEUA 1CJVC 3GLFB 4X6XA 5DOZA 4J9SA 2XBLA 4ZA2A 2FLVA 5C5DA 3EYYA 2NTJA 5CCXA 1JF8A 1T4DA 4J3NA 5JJ5A 1SC4A 3RRZA 3ZJ5A 1L5KA 3IP6A 3GVIA 3QBJA 3RSCA 1LEHA 2CXOA 3IODA 4BZXA 3I9MA 3PJFA 3U49A 1VE9A 3INTA 2EWWA 1GTL1 5KWIA 4MV0A 2HZBA 2XNDD 2W2LD 1A88A 2A92A 3C70A 1EXNA 2RHJA 3KOOA 4IXMA 5DWDA 4S05A 2P9GA 2QOEA 2R6ZA 2XT6A 1IZ8A 3UMBA 3VVCA 4CT0A 2V97A 3T5CA 1BD4A 3L4BA 3C4VA 2J6UA 4WACA 4YDHB 4RTNA 3BGSA 3S8EA 3PJRA 4CQMD 1ZD5A 4U0JA 3GRKA 2DTDA 2Q1YA 5FOTA 2WJZB 3D64A 3TXXA 4UARA 2REQB 4B3RB 4FR2A 2EJ3A 1QM5A 2FWNA 3CCFA 1HA3A 3RT7A 4HPXB 3S2IA 4ACAA 4BO5A 1DTWB 2Y68A 2YH2A 3O91A 2EBWA 2ZSKA 4HNRA 4RDHA 1DIKA 1A9ZA 1P1CA 3UANA 3HY4A 3OICA 5K8JB 5CB4F 2X41A 5TMPA 3WZ2A 1LTKA 3CR3C 5AVKA 1DSSG 2VP4A 4RDCA 5CT4A 5FUMA 3MCVA 2Y1KA 4F93B 3BX1A 3UMMA 1ZHSA 4NG5A 1GA6A 4TROA 4DJJA 4GOLD 3JARB 1PD1A 1DU4A 2CGEA 2G88A 4HYEA 1DG3A 5CT9A 2ZK7A 3ZWAA 4AT1A 3L4JA 2GO1A 2DFVA 3ZQJA 4DXHA 4LDAA 3SGIA 5ABPA 3HJTA 4NU0A 1K8QA 1ZW6A 3PICA 1D1SA 1GRVA 3CQZA 2I0FA 4R81A 3W6OA 2OXCA 2ZTVA 5CX4A 4XOUA 1VJDA 1XJWA 1H6AA 1NTOA 2Q8QA 1KVUA 4WXPA 4GEGA 4DMUB 3GLGA 1V9LA 1LV7A 2EZTA 3ZJVA 4DV6H 3PXXA 3VOAA 2BQ3A 1GPWB 3C5EA 1EQUA 3VZSA 1GTJ1 1RAFA 3RSZA 2IH2A 1W34A 1DAAA 4ZVOA 2DQSA 1F3OA 3UH1A 5EN4A 3RWMB 1T5SA 2FWIA 4N03A 1CB0A 4GOOD 5AM5A 1SNYA 4C21A 1DWUA 1ORTA 3R3YA 4QDUA 2DWUA 2QZ4A 3ZJ4A 4X7PA 3IVXA 4UCFA 4Y6RA 1L7OA 5HF9A 1FFAA 1NBHA 4ZVTA 4UM9D 2ZUTA 1HT2E 4KN8A 4BPRA 3I9V6 2GM3A 1JI0A 3L7CA 3TLJA 1O9BA 4DR1H 2AA3A 2E21A 1T9ZA 3AOEC 5JS2A 4L8YA 4HAUA 3CBQA 1NAHA 2LRHA 1IWPB 4GI2A 3E8MA 1U99A 4MIKA 3H5OA 1M8FA 3AZQA 3LWZA 4DARA 5IAOA 5EL0A 2WB1E 1H1LB 2OPHA 3JRXA 2RGCA 3TEKA 4DY4A 5H82A 3QJ5A 1C1DB 1Y9JA 2VDNB 2XQJA 3K35A 4PX2A 3HBFA 2C7OA 3Q8QB 1L5QA 2VOEA 1EP3B 1L5LA 1SUBA 2WUWE 1U8XX 3QYFA 1RKVA 3FOZA 4PW0A 3FUWA 2JKZA 2R7LA 1I3NA 1QIFA 3VOTA 1Y3DE 1Y33E 1FMFA 3IQDB 1DQZA 1ZA1A 1MQAA 1SBHA 1K89A 2P5YA 2G77B 2C5LA 2J5KA 3AHDA 2W6PA 4MDEA 2XA1A 1T9KA 2JKYA 2PX2A 3WGJA 3FB4A 3ZWKA 4O7ZA 3NXKA 2IUSA 2PIDA 2WWGA 5JI3E 3QU7A 1DJNA 2B5WA 1WD7A 4BFYA 3TQHA 4RMGA 1UAGA 3SM3A 3LIIA 3B70A 3C0FB 4Q3NA 1I4OA 1NTRA 2PD3A 3HBMA 4I9UA 4DM7A 4V0QA 2W2VA 5KFZA 3GR6A 1KIMA 1FDWA 1TAQA 5B64A 2B98A 4KLCA 3ZU6A 1JKIA 4K28A 2B37A 4V1CB 5C1PA 1H9AA 3STWA 3FCXA 5EQJB 3VR3D 3KHSA 1MQ8B 1UFRA 4LWPA 4PFSA 2I7TA 3U13A 3C7TA 4XLLA 4MVWA 1U81A 4ITUA 2YW2A 1WABA 3NTUA 3OZFA 4TMZA 3NH9A 1TEVA 2VR1A 4OXKA 1NLZA 3V42A 2WU1A 3Q8KA 3P0FA 3TQTA 3IPXA 1F0NA 2RBKA 2QMUA 2IXFA 3PI6A 4IXTA 4Q6BA 4EHNA 3JASB 4FFLA 3O73A 5KYVA 3JAMA 2EBFX 2VHJA 5FD8A 4ZO4A 1VHDA 1E4EB 3OLQA 4LV8B 1UDBA 1DAHA 3HMQA 3WNQA 3ZHRA 4C0JA 3OC0A 4PQFA 4E6PA 5A2QW 4HT3B 5EHNA 1A50B 3BE8A 4K9PA 1Q74A 2D8AA 2W0SA 2OFWA 1VYVA 4MCAA 1W8DA 1BXKA 3WHKA 1QOQB 2AN9A 1H66A 3TW6A 2Y71A 1Y8RA 4RLHA 4ZU1X 1AQNA 4MJLA 5EUBA 4LGYA 1WB4A 3TJZA 4H1TA 4HYKA 2VUHB 1AIPA 4KSCA 1QYWA 1J0DA 1QMPA 1RP1A 3DZBA 4INAA 1ZHOA 1RPNA 2VKQA 1U8UA 2WJYA 1CP3A 5KQSA 1QO7A 2H2HA 2PGNA 3EGIA 5G02A 1GA1A 2ASJA 4PZLA 1LC0A 4K0KB 5DLQC 5K6AC 3EBPA 1CKNA 4NV0A 3LT5A 4O25A 2B6HA 1PK7A 3MGBA 3ZHUA 3DYBA 5TSDA 3F7NA 1O5TA 2AG8A 4GZ5A 1N33B 1MJFA 3BAZA 5AK3A 2PU7A 1ZM2A 2H92A 1NX6A 3A9VA 4ALLA 1XTJA 5FOXA 3Q5DA 1IEQA 3R5HA 3PNQA 3HDGA 1S9HA 2PV7A 2AJDA 2D06A 5DSZA 1GJRA 3RK1A 3GELA 4MRRA 4R54A 1SG6A 4HDRA 1ACJA 4LDJA 1XZLA 4QYTA 3F4KA 4OYLA 2Z2IA 3PTLA 4IJ6A 3A9SA 1Y5IA 3TO5A 1GOTA 2F64A 1H2YA 3SBXA 1EP9A 5LP6B 3Q87B 4F1WA 4Q7QA 4MV9A 2AQ4A 3AEUB 3BD7A 1CJUC 1TWCA 2BJVA 3ENQA 1RQLA 4TUYA 3FKIA 1IEVA 1L7DA 4O63O 1GG8A 5LU9A 2CXXA 4YP9A 3V9AA 2V98A 3IIKA 1HFKA 3ZDRA 1CXZA 3K32A 3OY2A 5K99A 3WRWA 4N54A 1RI5A 1E98A 1P7WA 3EPRA 2NV0A 1UKBA 4I08A 1ACMA 3T4UA 4Q9AA 1KY3A 2XCIA 5B37A 2QMHA 4HNHA 4NFSA 5CEFA 5JSYA 3Q4GA 4D0LB 5KUTA 1Z6XA 1UKAA 5ALLA 4UBNA 1PTKA 2YWDA 1RKUA 4OLJA 4YAEA 4CR7A 4CXMA 3NDIA 4XWTA 4W8HA 1BQEA 1U2DC 2HDNB 1G63A 3S2GA 4JODA 2DMRA 1J8DA 1V5IA 2FUKA 2OSVA 2PLFA 3GLRA 2CXRA 3L4SO 3CIOA 3PGA1 5LQDA 4TTRA 4MQLA 1CK4A 1WXQA 2CNLA 4TXJA 2IHVA 2I1WA 2BN4A 1XQ6A 3QXSA 1GZ3A 2A59A 4CMKA 1E4VA 1YIOA 1PQYA 4Q1EA 3IQHX 3USES 3WHLA 2C3YA 3JY6A 4P53A 2QN1A 2EX4A 1H0RA 1LSOA 2CF6A 3B9BA 3G49A 3GW8A 3N7AA 4LS3A 4R8VA 1OZFA 4P4SB 4DAOA 1JAZA 1EBBA 2H4FA 4OO3A 4QICA 5G1NA 4PC1A 2Z4SA 4JLWA 3ZC3A 4JJEA 2M1ZA 2CNDA 2J33A 2XNCA 1HNXB 3EW7A 3MD0A 3T3GA 4C2MA 1NBME 1QK3A 3MWEB 1FXWA 1QPZA 3AV3A 3LRTA 4J0EA 4MXDA 3AERB 3BZBA 2J46A 4DV3B 5A4KA 2VXYA 5BRJA 3Q2KA 1D4FA 3X1JA 2HGWA 4IRCA 4FBMA 2AKAB 2J09A 3ZCQA 2FPGB 4JXZA 1JDUA 3ZIAD 4LF5B 2AOUB 1UBCA 3I1FA 2HTEA 2ZI9A 1J8MF 3LHKA 3PHGA 5KFRA 1C1XB 2F43B 1WDTA 2HFKA 4YRKA 1G291 1H6DA 2B1RA 1ZIDA 3CO0S 3CV3A 4LHSA 4XIJA 5ISMA 5SY6A 4HDKB 4KLRA 3TCNA 4JD5A 4P84A 1W29A 2YQZA 5CCEA 1Y9EA 4U3JB 5AVUA 2QTLA 4B2YA 1X15A 1RCTE 1WS6A 4GGMX 1CUXA 1G5IA 1GUZA 2OCLA 2D00A 4R2XA 1QPGA 5FOUA 4BB6A 1T4MA 2P6UA 5DGIA 4DEYA 5MGBA 1S3FA 1T3GA 1SCDA 3IAS1 3TI9A 2VJQA 4AQ7A 6ADHA 1H5QA 4XB2A 3ZNQA 1SELA 2J3IA 3Q6IA 3GFRA 3GZNB 3FCAA 5L95A 4TYMA 4TWIA 2XMPA 5CBPA 1HLPA 4F86A 5JW6A 3EXFB 4A10A 1OMOA 2VAPA 3IIMA 3K31A 4M37A 4RM3A 2AR9A 2RBEA 3W5SA 3WYDA 4HX2A 4CNQA 1UNNC 5YASA 4KHZA 4MMXB 3NEPX 1VKHA 3G1WA 3I2KA 2R00C 3NM4A 4HAOA 5E2IA 5FBWB 1P0FA 4JI1H 4JBNA 1L7EA 2JIRA 4PPYA 1CUSA 3HFGA 1R18A 4IJWA 4JOSA 1HTTA 2FJPA 5IP5A 4ZANA 3WY9A 4K9NA 2QL5A 1KRWA 1G8MA 2BM8A 4GH5A 2UYCA 3AU9A 4LTNA 1SHKA 4K87A 4YT5A 4PWQA 2ZOSA 4BC1A 2C4WA 3GZTB 1U5BA 4HRVA 3STUA 1RLJA 2GJ9A 1L5GB 4B4VA 2P7HA 5LUAA 2QTNA 3G0CA 4TYNA 2UUCB 1IOLA 4GC7A 3ZDBA 1CQPA 2H0AA 2H07A 2QE6A 3N6VA 4X1IA 2PMDA 1WW2A 4MW5A 4DL4A 1T3NA 3K7EA 1XU9A 4KAXA 5AKJA 3KQHA 1GKUB 1U7XA 2AZTA 4JUIA 3T52A 3G1TA 4KLAA 4TM7A 5ELMA 5CA0F 1VLVA 4TKVA 1XALA 2ZUBA 1QHFA 2ZJFA 3BF7A 2HM7A 2ZIGA 4ZCSA 3HT5A 2Q5IA 1FQWA 4H08A 4PLWA 3O2QB 5HS6A 1QLJA 1CDZA 4URFA 3OCUA 1WMEA 3UN1A 2PMWB 3IBSA 2NPFA 2YC2C 2FCRA 4JJIA 5AP9A 3RIEA 3SD7A 3GB8B 1C9NA 2QIOA 2PYZA 1CV2A 1RCFA 4X85A 2YX1A 4WFQA 3UJ6A 1AGYA 3PLRA 2UVDA 2VJBA 4YUZA 1RKQA 1FU4A 1CJBA 1VPDA 3E84A