3VPCA

Argx from sulfolobus tokodaii complexed with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
molecule keywords Putative acetylornithine deacetylase
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpcA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpcA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpcA01
1W96A 4O83A 1JKJB 1B6SA 2SCUB 4FFMA 2R6FA 1I7NA 3WNZA 4Y8VB 2FP4B 3JZFA 2YYAA 1ULZA 3TINA 2CZGA 1GSHA 4HNTA 1KUTA 4L1KA 4I55F 4ZI7F 2VHEA 3V4SA 1B6RA 1OBGA 3MWDA 2R84A 2R82A 2I80A 2QK4A 3LWBA 5FNVF 3I12A 4HNUA 3SE7A 4MV9A 1KC7A 3R23A 4MV7A 4YB8B 2CNVA 2DIKA 4O7WA 3UFXB 4O7SA 4MV3A 4O4IF 4J6EA 4EG0A 3RUPA 5I47A 2PBZA 2YRWA 3U9TA 3V4ZA 2X0SA 4ZOLF 1SCUB 2CNQA 3U9SA 4I50F 4O2AF 5C1PA 5JQGF 2V5AA 4I4TF 3ETJA 4O7LA 2YZMA 2R7MA 1C3OA 4FFOA 5LP6F 1IOWA 4FFLA 2DLNA 2NU8B 3E5NA 1EZ1A 2NU9B 2HJWA 4O4JF 3HB9A 1EYZA 1AUVA 4O2BF 3BSSA 5CA0F 2PVPA 1CQJB 1UC8A 2J9GA 2XCLA 3WO1A 1JLLB 1W93A 1Z2OX 2FPPB 5J2TF 4MV4A 1Z2NX 2VR1A 2YW2A 2I8CA 1BNCA 2R7LA 2R87A 2W6NA 1IOVA 2PN1A 4O7TA 4QSHA 3HBLA 4WBNF 3KREA 3QFFA 1KEEA 1CS0A 5BPHA 1M0TA 4ZQIA 2GQRA 4MV6A 4O4LF 3JZIA 4MAMA 3N8DA 2YZLA 3BFPA 3K5HA 3R5XA 1PX2A 2VQDA 3GIDA 2NUAB 4E4TA 3DF7A 1PK8A 1VBHA 4FGRA 3Q1KA 1E4EB 5IYZF 5LA6F 3OUZA 5CA1F 4C5CA 5CB4F 1JDBB 4C5AA 1A48A 2W6MA 2R85A 3NUAA 2CQYA 5HBRB 2DZDA 2NU6B 3BSYA 4DIMA 5LYJF 2GQSA 1M0WA 4C5BA 1KJ8A 4M98A 2XD4A 2CNUA 4O84A 1EUDB 1GSOA 3G8DA 3R5HA 3U55A 4ZHQF 5LOVF 1E4EA 3KAKA 2ZDQA 1GSAA 2W71A 4HNVA 4O7NA 5K2MA 3Q2OA 4M9UA 2I87A 4EGQA 2R86A 4O82A 1T36A 2IP4A 3R5FA 2YS6A 3G8CA 2FPGB 4DLKA 5EZYF 4WD3A 4YJ2F 1GGOA 4EA7A 2P0AA 3K3PA 2ZDGA 1EHIA 2W6ZA 5J2UF 5LXTF 2NPOA 4FE2A 3BG5A 3TW6A 1Z2PX 1OBDA 2NU7B 4EA8A 3K5IA 1CQIB 4XX0B 3TIIA 2YS7A 3WO0A 3HO8A 1KBLA 1CE8A 5CAEB 2HGSA 2GPSA 4HR7A 1JDEA 4YAJB 3RFCA 2DWCA 4O86A 2ZDHA 3U54A 2YZGA 1I7LA 4NYEA 4M9CA 3VA7A 4XYMB 2YRXA 4FU0A 2YWVA 5KX5F 1UC9A 1DIKA 5H80A 3RV3A 1KJIA 4O7ZA 2W6PA 5BMVF 5JVDF 2V59A 4YJ3F 4YBZB 5HV6A 5D8DA 4EABA 3MWEA 1BXRA 4IWXA 5KKNB 1KJJA 1DV2A 3KALA 5JVLA 5C1OA 1KJQA 4O4HF 4O7RA 3OUUA 3AX6A 3AW8A 4ME6A 1AUXA 4EA9A 3MJFA 4EGJA 5JQWA 2Z04A 4IHJF 2OLSA 3JRWA 4TUYF 1DV1A 5C8YF 3RV4A 2VPQA 3KAJA 2YZNA 3ETHA 5GONF 5DMXA 2YL2A 4MV1A 5JH7F 3BSWA 2FB9A 4MA5A 2R7NA 3VPCA 2W6OA 1GLVA 4MV8A 3TQTA 1C30A 1A9XA 2C00A 4XYLB 1EUCB 4EAAA 4O7VA 4RZQA 1VKZA 4TV9F 1KJ9A 3N6RA 3VOTA 5BPFA 2GLTA 4O81A 4TV8F 1M6VA 3VPBA 1VBGA 3R9RA 3ORQA 4FFPA 2WYOA 2FPIB 4FFRA 3VPDA 2V58A 3GLKA 3JRXA 2R7KA 4IIJF 4FFNA 4YAKB 4MA0A 4IZOA 1WR2A 4O7YA 2Z02A 2W70A 2GPWA 3TIGA 4XZ3B 4IWYA 3ORRA 2QF7A 4HQ6A 3VMMA 3LP8A 4GGMX 4M99A 2W6QA
chains in the Genus database with same CATH superfamily
4F2GA 2HWYA 1I13A 4BP9A 2PXAA 2OE2A 5IH3A 1K7EB 3GLQA 4L16A 2Q1XA 4O2AB 5AW3A 1I2LA 2HDKA 1H2WA 1LPAB 2C9DA 1SVUA 3KAQA 2AQIA 3DDCA 3IQDB 2EVWX 4OP3A 2J3QA 1ZMBA 1Q3TA 2ZIVB 5FPOA 3NUQA 2ZQYA 4A82A 2PUTA 4O1HA 2RGYA 3OZFA 2XTZA 1FUEA 3QWFA 4TWZA 3AW9A 3P5BA 3F5FA 4W1QA 4K3UA 1PGNA 3ICQB 2CZGA 4JP5A 2HV9A 4WMLA 2DR3A 5LOVA 3OFSA 1FDOA 4P9NA 1ZJJA 2FSPA 4JI1B 4OY3A 3B7PA 3HM2A 3GJ8A 1BD3A 2H5EA 3HU2A 3IKJA 2X40A 3LX8A 1XVAA 1AE1A 3I76A 2D5BA 1S89A 3OQJA 3EZ7A 2NW6A 1LLDA 3TFQA 1VGQA 2K2QB 4INAA 1RFGE 2GBLC 3G6WA 1P80A 1N7GA 4O8CA 2GUGA 3PNKA 2H9IA 1AT1A 4LISA 1UBEA 5EJFA 4DCSA 2Z43A 3EGCA 3TNLA 3VSDA 3MAGA 1L6IA 2ID4A 2I2XB 3IV6A 3D5TA 4M38A 2V7BA 4MS4A 3E84A 4WY5A 1JL3A 5FADA 5K2OA 5KJ1A 3FI9A 1J8MF 5KKCA 4D0LB 2QUZA 4O2RA 3LWBA 2PLRA 1E9VA 2PL5A 5KFNA 2FP4A 4TMYA 5LL6P 1CDZA 1FS5A 1SKAA 4KWHA 2QOEA 3PW0A 3KU1A 3UPDA 3LBAA 1GUBA 4BWGA 3V7FA 6REQA 3KQPA 4HNUA 1LJUA 2GFHA 4RD4A 3HCCA 5HQ3A 3WC4A 5LBTA 1RWMA 4EJ6A 3ROKA 1VIYA 2P9HA 4N4AA 3MOSA 4BJ3A 2NZ8A 4UUOA 1E1QD 4GAEA 2VQ3A 3K9CA 3LY8A 2UDPA 6YASA 4BZWA 3DR3A 3SC3A 1TCBA 2SKEA 4ND1A 2CNVA 4TUYA 1S0UA 3ISVA 1LPSA 2PUWA 3M3HA 2RJNA 1D3AA 2OGUA 3JQBC 1N33H 3K73O 4H7HA 4PCVA 2G6TA 2V9ZA 3IP8A 4O7SA 4PYQA 1RI4A 4O4IF 1FRQA 3D4PA 1X92A 2V7VA 4RSGA 1IIRA 4UOQA 3T0FA 3VVBA 4AY5A 3RH0A 4M1TA 1EFVA 3OU6A 5CFPA 2YV5A 4M9ZA 5AJXA 3ZBPA 3RIGA 5CHEA 1JJVA 4GXQA 3AYHB 1V37A 4MO9A 2O57A 3P2OA 1Y3DE 4X0EA 1LDNA 2YV3A 4GR9A 3O4HA 4MW7A 1THTA 1UKYA 4J2HA 4ZAGA 3RVLA 5A02A 5AUOB 821PA 4LOLA 2BGLA 3JATA 2EJTA 2JVKA 2XQKA 3C6MA 3DQPA 3OETA 1ZC3A 2HF8A 4YHBA 4X61A 2V7QD 2VUGA 2W37A 3A6GA 2JZCA 4Z1MA 2EKZA 1EAYA 4O7LA 3JSXA 4GPIB 5TVGA 3WADA 3BOSA 3FPKA 3VM6A 3X1DA 3PHIA 3PDJA 1TMOA 2Q46A 5LP6F 2I3GA 4J7XA 2PG3A 2P3QA 2FPGA 1ULAA 4J9UE 1HSZA 2MWMA 3ZZMA 4LHSA 3DAHA 4L15A 4OX9B 4WFKA 3N9IA 4NBSA 2YVUA 5BNIA 4Z86A 1IHYA 2NV6A 1J1IA 2HTFA 1EYZA 4NYJR 3SZUA 3WV4A 1P17A 2AYYA 3LECA 2B8NA 4Z0PA 1Z4KA 4U7PB 2YN2A 3C5EA 2O8FB 5CA1B 5D00A 3QWBA 1ECGA 4XUGB 3PITA 3HGMA 1CJTC 2WUFA 4WOKA 1H3FA 1XLTC 3M34A 4DKXA 3H11A 4GRAA 2YQZA 3M5PA 4RLSA 4TV8A 5DCWA 3RYIB 3WFZA 3GTLA 4CMBA 4BVAA 4F4JA 1JDNA 3HDGA 4WKPA 3KDAA 5BNFA 5LU9A 3G82C 1ZCAA 4KO2S 1Z4QA 1JHQA 4PRLA 3HYTA 2WMOB 1E0KA 2J31A 4J9QA 1Z17A 3GN1A 2ZVPX 4G26A 3M2TA 4MCIA 4O2BA 3SXUA 1UBGA 4HV4A 2VR1A 3NG1A 4LH7A 1BDBA 3E8XA 3OA0A 2OCKA 3DE0X 3GLHB 3C6QA 1GRCA 1IMJA 1DX4A 1DKNA 4TQSA 1EDZA 4G4SO 4K9DA 4UXIA 4Y6QA 5JVDA 2VDJA 2R7LA 3K2IA 3EXHB 4RD0A 1EIWA 3V32A 2RGAA 4BBSG 1RJ9A 1T5SA 4UU0A 5HF9A 4GS5A 1DEXA 1FLAA 4FYJA 1KDYA 2YINC 4QT4A 1HNWB 1OLUA 1WOMA 1YAHA 2C77A 1XT6A 3RRFA 4B82A 5MGNA 1CQWA 1FTSA 4XFKA 1XROA 4N40A 3RNLA 2AMFA 5A4MS 1SFOA 3E81A 3V00A 1DHRA 1PR9A 1M1XB 5DMHA 4ZK2A 2A84A 2WV7A 3FGPA 2BI7A 4LJRA 5E7JA 4IOMA 2HF9A 2V7WA 3OZRA 2MU1A 5KFPA 1KIMA 3UAWA 4B46A 5CCBA 2R1UA 2UUBH 4WLFA 2A1HA 1CS0A 2RHOA 1E1CA 5J4YA 2QRLA 4M7OA 3UKOA 4GMDA 3IO5A 1AHHA 4JBHA 5G2OA 1H5QA 2XRYA 3BIFA 1DKQA 1PS0A 3DD5A 3Q9LA 1CUJA 1YZKA 4LGCA 1D09A 1FYFA 2I4TA 4QTUB 3FSRA 1RWBA 2EL7A 4F4UA 3BE6A 1PKXA 2VJOA 3PA6A 2G4LA 1F3OA 1VPDA 5A3RA 3SBOA 1B1AA 2OUIA 1IQUA 2H7XA 2W00A 4FWBA 4IHKA 4WN9A 3W5OA 1XMIA 4PLFA 2WUGA 4Y1RA 1HYGA 1KFKB 3G6KA 1SCQA 3MWEB 4Q4DA 2JA7A 4CV2A 1KWGA 1PJ8A 2Q8NA 2QJRA 3KELA 1Y4SA 2DFNA 5E6UA 5BSMA 3RS7A 3ZZNA 3L0YA 1GPJA 3GQVA 3QM1A 3I52A 4FPXA 1IDN1 2WC1A 3SHFA 1U80A 4D2IA 2AXNA 1BQEA 2AE2A 1MJ5A 3Q1KA 3CQ9A 2CNDA 3DL0A 3WLJA 4AYXA 2ZWIA 3CKLA 4HHEA 1H6BA 1TWCA 4F56A 5K0BA 4BQFA 2H1WA 5KQGA 2WAMA 1KMNA 1Q0ZA 5IWAH 1KQNA 4Q8FA 4CIXA 4D98A 4NNOA 2XSZA 2B8WA 3I61A 2XVZA 1WNTA 4ETMA 1QK4A 2Z1MA 5JUMA 3B3FA 1DG1G 3T7TA 2O8EB 3I9MA 3IHWA 3NHYA 3K71B 1YIDA 3L7LA 4RK4A 4OHOA 2QGFA 4WNAB 3E3MA 1NGSA 3CPSA 3H2IA 1WDMA 3KXKA 2Q5EA 4X66H 1KJ8A 1TJ5A 1I6KA 3BILA 4JOQA 3EUWA 1YMQA 4OA8A 3VXKA 2ZFUA 3SM9A 3DZFA 4PFSA 3GV0A 5CXXA 4N9QA 3UG7A 3AVPA 3IPCA 1YOBA 2P9FA 4TQUS 3V7UA 5DLDA 1ML3A 1WCV1 3EEQA 1AKVA 3ND9A 2ZR0A 3KLBA 4PWZA 4D79A 3RODA 4BU1A 4BBJA 3NHFA 5HZGA 4RULA 1JEAA 3URMA 1AQLA 1PK7A 2Y6VA 4P2BA 5DN9A 1PR0A 4NENA 1L5GB 2WU1A 2QJWA 3U40A 2QTBA 3PWTA 4OHWA 4TRMA 2IUUA 1Q92A 4AJ4A 3DT6A 3GEHA 3PXXA 3Q7TA 4HWSA 3A28A 4TTTS 1KOGA 3NBQA 5THQA 2R60A 3K6SA 3BS4A 3QF4B 4BNFA 1CRPA 5JEEA 2VPYA 3UMBA 3ROQA 3KE9A 1GSAA 4MDEA 1GAXA 3ET5A 4PZ6A 1GPUA 5ALRA 3RQSA 3THYB 4YDHB 2XLCA 5TDHA 3DE7X 3QBVA 3G3EA 1YKSA 4W5WA 4O7NA 5K8CA 1A5TA 4LA4A 2CJYA 1FF9A 2PKCA 1MMFB 1I2MA 2OO5A 1EINA 4WRRA 1QAQA 3OCWA 4DREA 4L9SA 2EBHX 4CIVA 4RGBA 4S1VA 2GZAA 5BRJA 1K08A 2ZBPA 4O3OA 1WHSB 3WL6A 4C0BA 4ZT2A 1O9HA 2WVJA 1CUXA 1R16A 1GGOA 4P5EA 4CG3A 1PJZA 3F8WA 4DV7B 2IYEA 2Z56A 3HVRA 3X1ZA 2AG8A 4PSKA 2DUJA 4WESA 4ZO4A 3UKJA 3H97A 4DE5A 4DYHA 5GVSA 1Z0DA 1QCDA 1Q3HA 4BEBA 4FS2A 2CXHA 1JVSA 5KC9A 1N3YA 1Z88A 2GVZC 1HMYA 4KVZA 5G3YA 2G76A 1BE8A 4BQRA 2WSBA 2YIDA 4PAWA 1M2OA 4QYTA 4W5OA 3SDBA 2NVWA 1CU1A 1WEKA 2EFJA 2JFZA 1AF4A 4GICA 2WDTA 1XX6A 2X2PA 4R2WA 3W5BA 2O2YA 2O8BB 2ZSJA 3NAGA 1TLTA 1O0SA 2UKDA 1FYXA 5KMGB 1KDRA 5AH0A 3DE4X 5LZ2A 1LTHR 2OEPA 2EYUA 1N0VC 2C7GA 1UDXA 5CE8A 2D06A 3AY3A 1YI0A 3JQPA 4JEMA 2BONA 1LK7A 4G0UA 3TB4A 1VRVA 1NW4A 2VUTA 2WPNA 4N03A 4JC5A 4DWOA 4E94A 4MOWA 2AJDA 1SRQA 5EAIA 3HO1A 3OIWA 3L82B 4KE6A 4J0DA 3TUJC 2CVHA 1RAIA 1QO0D 4DA9A 2QTAA 1AQNA 3JWJA 4MTCA 2IEIA 3SR0A 2C9MA 1T2FA 1WUIS 2Y4OA 4F4FA 1YI1A 4OHBA 1H65A 3LD9A 3LH5A 1CDDA 4U63A 4Q21A 5TJHA 3WK5A 2PCLA 4ND3A 3OOSA 4E11A 5K8TA 2J33A 2PRKA 4LFCB 1YZNA 1NG1A 3WMWA 4UTOA 4XWKA 4PWYA 2ODWA 5K4HA 2C88A 1H69A 3EXFA 2AMLA 4PNZA 2ZRIA 2FWMX 3PGXA 1XMQH 1NX6A 5GOZA 4IQ0A 3K4PA 3GFOA 1GPYA 2F1RA 2QE7D 2QMYA 3W3AD 4E88A 5EN4A 2W6PA 1N7IA 2DUUA 1FFAA 5IXJA 2BSXA 1Y3FE 2EOAA 2WM9B 2FWAA 4KVFA 4HAZA 4ALMA 4OLHA 3UIEA 4D8TA 6LDHA 3E9EA 5D8DA 1KYXA 2AX3A 1HX7A 1KRXA 2C03A 3B6KA 2EWMA 3TH5A 5ANRB 4TYYA 1G7RA 2IDZA 1QRUA 4F1KA 4ZFNA 3ROFA 4UEJA 2V65A 4URFA 3ZWCA 2JLQA 4D9GA 4EW1A 2PKXA 2A0XA 1CUEA 3CN7A 2JI4A 1RYMA 4MPDA 4N6OA 4E5SA 3KETA 3DOCA 1JBQA 1T8YA 3UUEA 2B8JA 3D5EA 4ED3A 4TTQA 3EWNA 4C7OB 3OUUA 5JDIA 1K4YA 4FONA 2HLHA 2YIVX 4ZQFA 3K4QA 4A3BG 3VTAA 3AIOA 1QYRA 1ISSA 3EGDB 4XIIA 5HS6A 5C5CA 4TMFA 1OGIA 2VSOA 2ZOSA 3WYNA 3ZOKA 1KPGA 4M46A 4NESA 2Q2TA 1RYFA 2Q62A 4KNYA 5L9AA 4BMDA 3OTIA 2OLSA 3KYDB 2H9YA 1WKBA 2VH1A 2CMHA 3E6AA 3HU3A 3B3GA 4JR2A 5KFWA 4MGKR 3A3OA 3STYA 3W2FA 5HMLA 1NMQA 2TMYA 4RIGA 5AVSA 4EFBA 3DG9A 4R1LA 4U8GA 3H86A 1U7UA 3KOZA 4WVFA 1EGAA 1ZH6A 3PFFA 1XOIA 4FKMA 2H5LA 4LJ7A 3ZGLA 3CB2A 2W6OA 1CFZA 4PSVA 1N8TA 3AF0A 3DKKA 5B3JA 3FGOA 1QC5B 3H4TA 4IOKA 3WMEA 3HCFA 4PZCA 1GKLA 4I9NA 3ZXSA 4XYLB 3CRRA 2DY0A 5C34B 2V5UA 1P3DA 2I65A 2WE7A 1SBQA 1FW6A 1G9XA 2VRCD 3RC7A 4WACA 4WDQA 2XUGA 2SKDA 2HWWA 1RJPA 4MVJM 3SNHA 3HJCA 5HKKA 4CKZA 2OAP1 3F2IA 3FF4A 3K15A 3PVZA 5AK4A 3RLIA 2E55A 3RBDA 2F3SA 5CLLA 1PZFA 3PDIA 4P0QB 3GIKA 3K1AA 4JXJA 3WLRA 1I9GA 5CYPA 1V6SA 3OSZA 3IMFA 3T7CA 2QRMA 3RGZA 4TS9A 5BPFA 2AYZA 4JQSA 5FA6A 2UVWA 5H16A 3TEFA 2C92A 2VQFB 1ND5A 1E2UA 1KY5A 2P2YA 4R98A 3VO9A 3MEQA 4JJKA 4CLRB 9LDTA 3RGGA 5FL3A 4TGLA 4RK1A 5KG7A 2ZVQX 3GB9A 4EMUA 3KYIB 3KHRA 1ZNYA 1NHGA 2IZ6A 5EXSA 5B7GA 5HJ7A 5HTOA 3BICA 3NTXA 2R93A 1M2NA 2ZK7A 4OJNA 1VMKA 3QZUA 3A04A 5B3KA 3I09A 5CGZA 1IN1A 3LL7A 4FFBA 2FMXA 3DZCA 3GJSA 3LCRA 1LA2A 1TZKA 1PCXA 1QE0A 4GU5A 1IBMH 1AD2A 4UDOA 3VISA 2ZIEA 2ACEA 4J9PA 2RARA 4MJXA 5JE8A 3WYFA 4ALJA 1IULA 2O1SA 1PQPA 1MVNA 1TFUA 3MMXA 4QUKA 5DT2A 3SPXA 3TEJA 4BO7A 3ZI0A 2WNHA 2GQ0A 3KUDA 5CDFA 3AKCA 8LDHA 3ZNNA 4ARCA 3V6KA 3VNNA 2QX4A 4S1OA 5FT9A 2QPOA 2WVAA 3ZU4A 1ZKMA 4AMVA 1MZBA 2H00A 4LDAA 3TIGA 2UVRA 1MV5A 1X8KA 1QG0A 3HCWA 2F17A 1X9NA 4MVJD 1VE9A 2JATA 2XNCA 4R9NA 1KAMA 1NULA 1YR9A 1W73A 1L1FA 3DMDA 2OBXA 1ZDMA 2OV6A 4EELA 1SG9A 1P6UA 4D02A 4B9EA 3PKZA 3MS2A 1XRMA 3T4PA 3UGQA 1IZZA 1CKNA 1J97A 1DIGA 1NFRA 3C0FB 1Q0SA 2P3LA 4I9UA 4YDRA 3PTZA 5HX7A 3AY0A 3AR6A 1X1EA 4IHJA 1YS1X 4M89A 2EWWA 4N8SA 5DYWA 3RM3A 3RHZA 1QH8A 5H70A 2E87A 2JCVA 5FLKA 1OFGA 2SCUB 1V8OA 3A6JA 5COQA 3FTFA 5CJJA 1Z4NA 2GBIA 4XM0A 2PUEA 2FZCA 3S29A 3TR6A 3VDMA 2PMWB 4WUTA 2OM2A 2YR0A 1QHFA 1RRPA 2JCBA 3LQKA 4N0QA 5HMMA 4BN0A 3WBJA 3ZLJA 5I5SA 2I55A 4DW8A 3JZFA 2L82A 3D0RA 4KH0A 1ZL0A 1AKUA 3V8QA 4E70A 1VPWA 2IEGA 3BHJA 3TINA 3OM0A 5AUPB 4OGLA 3DZGA 5AT1A 1X94A 4CM9A 1K75A 1L5FA 1O7JA 5BNWA 4IICA 5C7YA 4RACA 4ND8A 5FUBA 4D5GA 5U9CA 1W19A 2LCQA 1FVOA 5FULA 1N6PA 2AEJA 1Y6RA 3EC7A 4FD3A 2H29A 2FE4A 4PLCA 3ZH2A 4LBVA 4JBLA 5IRCD 4WEOA 1VG8A 1HNNA 4FYIA 3D4IA 1LBIA 3S7ZA 3HSYA 4ONEA 3AHIA 3QVMA 2BSAA 1ORRA 2CBGA 2RGGA 2W6JA 1T15A 3BYZA 4GRDA 4DLRA 1HDEA 1DJNA 1YR8A 3U19A 1C14A 4KYIB 1A50B 2QD2A 2QY9A 3IVGA 2CNBA 1PJBA 1E58A 4RJJA 5AVTA 1ZH4A 1XVTA 3HDJA 3OM1A 3RIHA 3VKVA 1JIJA 2EGUA 3DB2A 5F35A 2AGVA 3H13A 1Y7TA 2IUEA 3D7RA 3W9YA 4CM1A 5C44G 2OQIA 2X3YA 3ORHA 5L3VA 4ETWA 4Q3OA 3QFRA 1OZHA 3I6QA 1JFVA 3HFJA 2JJQA 3CXUA 3VR2A 5LDDC 5CM2Z 3QELA 3QWUA 1UJ4A 4KDRA 1KI6B 5JG7A 2ZR8A 2QRNA 3G7UA 2AG5A 3NRCA 1PGPA 2I34A 1O6BA 5C8YA 3TWOA 5I01A 2PRYA 3RARA 1OIVA 3H16A 4KU4A 2GPYA 1CY2A 5H3LA 2V0CA 4P36A 1RZRD 3I01M 1WX1A 3M4NA 4E2WA 2WYWA 3KZVA 4EG0A 1KQ3A 1XA0A 4MI6A 3V3TA 2H07A 3BIXA 1D6SA 3ZY2A 2Q5OA 3D6UA 1ZOOA 5E1DA 4CM4A 1UAGA 1SD2A 3DE5X 5I9SA 4PO8A 4E4YA 2YWEA 1ZUNB 2WJAA 3P2KA 4D96A 4ED6A 1PN3A 3BM5A 2VDQB 3M1IA 2CNQA 1XYYA 3I4NG 1R0ZA 4G0NA 5A71A 4ECXA 1U0LA 3OJWA 5FLEX 3RC2A 3A6PC 2OD7A 4D9IA 5A04A 4PGHA 4XFDA 4O2AF 3AC0A 2R8EA 3G59A 1GNRA 4C2AA 1JLRA 1M2VB 1EWRA 2AZ4A 3IAM1 2BT4A 3LCUA 4E4RA 1YACA 3B1JA 3P9YA 4O4JB 2JAHA 1OLUB 2XTNA 1MC8A 1RP7A 4KR2A 2BPOA 1NAHA 4X7BA 3LO8A 4O4IA 1Z5UA 5C32A 3QXCA 5I5TA 1JBEA 1N92A 3W6OA 2W9CA 4M6WB 3WMGA 4IYRA 4DLVA 2GD2A 3KT6A 3O4RA 2RBGA 4FI3C 1QPBA 3FW1A 4WADA 1LFDB 1U6JA 3W8RA 2HMWA 1EDOA 4IUDS 2ZYAA 3RB3A 3H2JA 3I5AA 3KPWA 4FS1A 1P1HA 3FMVA 1O0CA 3ZK9A 121PA 1VXOA 3MK31 5K0FA 2R93G 5FBQB 4RVOA 4W1PA 3ZD6A 1W52X 1ANKA 2FRVA 3PQ3A 4HMPA 2YXBA 4BLTA 3Q9UA 5FPRA 2QSJA 1MPXA 4J16C 1COWA 4I4NA 4UW9A 3Q3HA 4D26A 4DJTA 3K4HA 2BGKA 1WPGA 3HT5A 3BGWA 2C58A 4WERA 4ZT4A 4PFQA 3FKQA 3IP3A 2OHJA 3RIZA 1NFQA 5K1ZA 2QR3A 1ZBDA 1YQ9A 3B7WA 4HZIA 1EJ0A 4R31A 2BM9A 4A3MG 1G7CA 1WEHA 2J9FB 4H3VA 5FBZA 1ST2A 3NYIA 3TOZA 3VZPA 1MAUA 2L19A 5BSVA 2YCBA 4IKPA 4GE3A 2RSLA 5BN5B 3GG9A 4R0NA 4PYOA 3QLEA 2QUBA 3ZGZA 4N6NA 5IT5A 3Q5EA 2HSDA 3TRHA 2NPIA 5KBYA 4K9RA 4BWVA 3THSA 4BKQA 4UCFA 2FLVA 5BT8A 1QGUA 4IDDA 5AW2A 1ID8A 5DGBA 1NVGA 1YZQA 4D5EA 1M6WA 4RAZA 1LRJA 4GW3A 4MGHA 4WFQA 4F71A 3BCHA 5EQDA 3ZV5A 3TLGB 1GCAA 4RAYA 3IJEB 5KTKA 3KZ1E 3D1JA 3CVVA 1E9FA 1OC2A 5D87A 4ECYA 2NVOA 1UT8A 1MQSA 3MTEA 1T0PA 1O97D 3NHBA 1FSFA 4HQOA 4BMXA 1UDBA 3CG4A 1NUAA 3CJRA 1XZKA 4HAIA 3S2EA 3LUFA 3UHJA 4MVYA 3C8MA 2GQRA 1JHDA 4F85A 2Q3MA 4UEWA 1WMFA 3JQGB 4EHKA 4F3RA 1FVXA 2A3RA 1MT0A 3JARA 1XPJA 4TMWA 3EWAA 4G8CA 3T06B 2AS0A 2M32A 3K8ZA 3O84A 3Q3IA 3FDFA 5M7EA 5JYCA 3KKLA 1ADBA 1B7GO 4P5PA 4DR1H 5LJIA 2QTGA 3H5AA 3G6YA 3QF7A 3A0RB 1W9HA 5K8JB 3GDEA 2E1RA 3GJQA 3UT5A 3U80A 1ULUA 1HG0A 4UEKA 3WL3A 1NRIA 1GL3A 5AW8A 4NCNA 1NMSA 3JWHA 2VJYA 2PT7A 3QQPA 1IEQA 2FWRA 3AFHA 4Y9RA 5CU7A 4LC0A 2CNWD 4GUAA 4MVJP 2D0PB 2YWCA 3WBKA 1WP4A 1NSTA 3L7KA 3GU3A 1OFTA 1YJ5A 3E2PA 4RNMA 5AQEA 4BJHB 4EJMA 2OV8A 2P11A 4Q7LA 3GPLA 5J58A 3FMFA 3AIIA 5BQ5A 2ZIFA 3UA4A 1WJGA 5CVUA 3AR8A 4HG2A 1MA3A 4US0R 3UC9A 3L2OB 2NUTA 3IUSA 3G2KA 1R18A 2V1UA 3J80W 3CF0A 1EZZA 3JQCA 1KBQA 1EB8A 5EVCA 2X4IA 3RRMA 3LOPA 5B1SA 3RYHB 3IBCA 2DY1A 2BF4A 1XZQA 2YBEA 3ZE7A 4AJKA 4DCVA 2VXCA 2KI5A 3GB8B 5K6AA 1E6KA 1GSOA 2ZJYA 4OHPA 4X8OA 4X54A 5KREA 1Z06A 2QZPA 2GZRA 4TLMB 2I7DA 4RXTA 2ZYRA 4IIYA 1WXFA 2RCNA 3WGZA 4EHDA 1N2SA 2D4AA 3A14A 2XUJA 3FBGA 3VKWA 5LU8A 3H6HA 3RUDA 4BBPA 2FG7C 2ORVA 4QQ8A 5CVTA 3OX1A 1L1RA 2J4DA 1DE0A 1T9KA 2JIRA 2P5YA 4XM2A 2E6KA 5E3IA 3TL3A 2GCGA 1GG9A 1JXMA 1N2EA 3ILXA 4E33A 2XYQA 2YFKA 3KAKA 2QMZA 3J81k 1GRQA 1H5NA 2UVPA 2DC1A 3O8BA 4L8WB 2WG0A 2WTUA 3V2UA 3HVIA 1UJ5A 2Q3HA 2BKLA 3NOVA 1B8UA 4MUGA 1X7HA 4ZYZA 2WMYA 1R4ZA 5DOVA 5CFNA 1I2ZA 3STXA 3KSBC 4ENVA 3F6SA 1IQRA 2GM9A 1E3LA 2D5LA 3P4UA 1FTNA 2CKDA 5BMVB 1I7QB 4Q9NA 1VIDA 3G88A 2ZJTA 2JHCA 2QHXA 1F48A 4L3VA 4BVGA 1M2EA 2IC5A 1WQ3A 2GNPA 1Q22A 3OESA 3E1GA 1DNPA 3R7SA 4C4SA 2FE1A 3K2BA 2B4KA 1J42A 1Z47A 2R751 4FGWA 1H4QA 3AINA 4ARVA 3L92A 1NSFA 1VHTA 1Z4PX 4MZDA 4YJ2F 4QW9A 1QK5A 4IGKA 1CY6A 1X7YA 3QYFA 1LPPA 1J70A 2AVDA 5EMJA 4ZZ2A 6ADHA 3F6EX 5G4KA 4YMTA 3GNTA 1WR8A 3TSOA 2H31A 4N82A 3GDHA 3R3VA 5J2UF 4RTQA 1E6UA 4WECA 4YCAA 5G0SA 3WHKA 2WZCA 1W94A 2IELA 3V8RA 3HMQA 3W8NA 3QF4A 3Q8PB 2DT8A 1CQIB 4FCTA 4IAOA 4BGIA 3KWFA 1Z15A 3IQEA 2RHHA 3M6LA 2KE5A 1KZ4A 4MULA 2BCJQ 4WLUA 2OA0A 4UDXX 2R00C 3T1OA 2ZJZA 3D0KA 5EL0A 1L5KA 1VSQA 3DBHA 1RWWA 2QTFA 1EWQA 3O31A 3ST7A 2FHSA 1VL8A 4X90A 3SG0A 1KAOA 4JC0A 4W1SA 4HR7A 1JDEA 2WG1A 4MPPA 3A11A 5FEMA 2OTCA 5J9FA 2IOFK 3PPVA 1NHWA 4ABTA 5GJVC 2QYOA 2EYQA 4NATA 3TLXA 1BGXT 5BSGA 4RNNA 4ROSA 1G20E 1ZQ9A 1QHHB 1PBNA 1RIFA 3EB9A 4MKHA 4DL9A 1HNXB 3FDSA 1D1TA 3BXXA 4TVOA 2FMKA 1RSZA 3SOPA 5U4XA 3DFMA 3V3KA 4EB8A 5K0ZA 3IUBA 1CP3A 5FHQA 1SZPA 2PL9A 2WJGA 1L4NA 1Y8QA 3G2QA 3KJXA 4PPQA 4XIGS 5F77A 2ZAIA 5H4GA 2WB1A 5ICCA 3QXXA 2ZS8A 2PZJA 2QNBA 5KX5F 1K4KA 3ETCA 1Z6PA 3AFIA 3HVHA 3OT1A 4WNCA 3RBXA 3ECAA 4C14A 1U8TA 3GROA 4RXUA 2ILTA 3FZGA 1U0JA 1NF3A 2GHIA 2V6FA 2CHUA 1HLPA 1YDMA 3DAOA 4LQCA 2QP3A 4I3GA 1LC0A 4Y8VA 2A59A 4OV6B 3HA7A 5JMOA 1TUGA 3FRJA 1GPWB 1YXMA 4KPUB 2E2HA 1NVXQ 5LYJA 3ZV3A 2PX0A 4B8ZA 3G2IA 1U2SA 2PH5A 5JCOA 1O03A 2VDNB 1P2TA 5F9MA 3V80A 2KSWA 2H2HA 3QUTA 4P32A 3GRCA 1N6OA 1XCGB 1MX3A 3ENVA 2B82A 3N0WA 4G1MB 4WT7A 3K0HA 5LPNA 3ZCQA 3WYAA 2VTBA 4CKBA 1WRBA 5AVJA 4B4WA 1QUFA 1DX9A 5EPOA 5K0SA 4GC9A 1LDEA 2C59A 3I9NA 4AVYA 4D9KA 1JB1A 4JGGA 3FR8A 4ZYXA 3PGLA 3U7JA 4DNOA 5IU6A 4UE3S 3PNLA 1RWOA 5E4JA 4BXOB 3AETB 1UZAA 2MSKA 3EXEB 4DMGA 2I6TA 2MCTA 3FMGA 4YCNA 1H8ED 5JCZA 1XVVA 3AOEA 3KS9A 4B34A 5LQAA 2GK3A 3GJYA 3FCUB 2E9SA 1BXGB 4LE2A 1P60A 1QTIA 2FRDC 2QMQA 3Q7EA 2VNKA 2AI3A 1DIRA 2HX1A 3UHPA 3E3LA 5FIUA 3C97A 4GPD1 1G5FA 5DO9A 4NYMQ 3OTQA 1NVKA 1JDZA 2IL1A 1S3GA 1EE1A 4I66A 3OJLA 4S1PA 3VX4A 1W87A 4YRLA 2OC4A 1AZWA 4DR5B 3ZJTA 1H05A 3DOEA 3ZDAA 3EK2A 3Q87B 4OGWA 4POAA 2I2DA 3W6PA 2YL2A 4FINA 1UF9A 2FLKA 1ML4A 4OSPA 4ZVQA 3V4OA 2C2ZA 4UPVA 3ONDA 5ALFA 1P2FA 3MCWA 2LE0A 1C0LA 1K2WA 2PBLA 2RONA 3I04A 3W2TA 4C7OA 1T3TA 2KW5A 4UNSA 2IXEA 1YIAA 1M7GA 3II6X 4ECZA 1KP2A 2WAXA 4TQ9A 4M2LA 3QENA 1URPA 2OKCA 1ECPA 3M7IA 1WQ4A 2PX8A 4UNIA 1ENYA 3EGDA 1QK3A 4KMRA 1GUZA 3QBJA 1J07A 1E4GT 5AW5A 1DBVO 4W7SA 1P1RA 2EKPA 2K5UA 1RQ7A 2DWPA 4BUJA 4TXJA 2BFAA 4F4XA 2WT4A 4ZI7B 5BUQA 3JATB 4E0BA 1M54A 2FFJA 1MB0A 1RD4A 5D1OB 2F8LA 2C3MA 2WAYA 1MOPA 2JA6G 4MW0A 3RFVA 2JFPA 4FYXA 3O74A 4JYPA 2NSDA 4KIFA 1W0CA 3IEXA 1VLVA 1Y7HA 1ZJYA 3AZQA 2XMDA 1PD1A 4M54A 3VPBA 1HPLA 5AUQA 4B2PA 1IBMB 1DIAA 2MSDB 1X7GA 5IWCA 1R0WA 5DNCA 1H6AA 1WSCA 4O4LB 2HHHB 2O1EA 3HCEA 3UWSA 1S4MA 3OLZA 1XMSA 4NV0A 4Q3DA 2JANA 1GEGA 1OU0A 4E12A 2JRCA 4HMQA 1NUSA 3WK8A 2CNKA 3T5LA 4KGDA 4F2HA 5LKAA 1NONA 4LXGA 3OICA 1BFKA 1OLSA 1LDBA 1GNLA 3GFGA 3QUBA 2NXNA 3T1VA 3TQQA 2RG7A 4MHTA 1U0TA 1P0FA 3M82A 1OWMA 3OQIA 1R9JA 5IKXA 1YBHA 1TF7A 1XQWA 3R5JA 4GX0A 2LKDA 2NUBA 2OBYA 4RH0A 2FQWA 3E5RA 2WVGA 3GLGB 3ZYCA 3K1AB 3F74A 2BGJA 5C5DA 4IDNA 4IRDA 1DKMA 1P7WA 4O2BB 3VSBA 4EHAA 1DTEA 2IPNA 3PDHA 2GN1A 1G8MA 3PNBA 5JVDB 3E23A 3BXOA 3GZJA 2O5EA 2PIDA 2QIOA 4MUMA 1KRHA 3SYMA 3T7DA 2I3ZA 1P29A 5KWVA 4OBEA 2J0UB 1YCGA 2O3TA 2J7PD 4LUCA 4YMHA 4ZI3A 4N7RA 5BSEA 4JFAA 4K0KB 4BNVA 2QZ4A 1ZY2A 3KLPX 1L8QA 1JMKC 4HX2A 3TNYA 1BDMA 3A1SA 2WU8A 2VDUE 3ZE0B 2OOKA 3AR4A 2IBSA 3EEYA 2VBCA 4NK4A 4X7RA 1G4HA 1X1SA 2FN8A 4G6ZA 1NRJB 1W5AA 3G5TA 4L6AA 5BWLA 1KL7A 1VPLA 1WU8A 2FPKA 1XDUA 2GCPA 1NR5A 2N1BA 2QA5A 3Q2IA 4YQYA 2YOHA 2R9VA 2O2HA 3FRHA 4W9NA 2OR3A 1I0ZA 1NN3A 4Q05A 1GSHA 4NZOA 1L4BA 2E2WA 3N75A 5GINE 5EJAA 2CW5A 5CFZA 3A9RA 4QNNA 1YRWA 1ISRA 1GZHB 2AR9A 2Y77A 5B3JC 3UATA 2WJWA 1MAHA 1CF9A 3H6GA 1KMCA 1EBUA 4JJ8A 4IX9A 1RRFA 1Q0QA 1N56A 2QQGA 2WE8A 1GFWA 3DB1A 3IPAA 4BUCA 3HCDA 3HWSA 2AG1A 3OIYA 4J0IA 3N76A 1X1QA 4I1OA 1RJWA 5F51A 3F9IA 3RTXA 1O0BA 4J0EA 5KNDH 2JIZD 4JN6B 2EFHB 5GJWC 4XH9B 2GXSA 5JSFA 1R9TA 1CY4A 4G86A 5I9BA 3SHTA 3HG7A 3TKAA 3HOWG 3CNHA 1RI5A 1FPMA 1YULA 3GFQA 3HBMA 1AGRA 3HVKA 4KRXA 4AF8A 3A2KA 1THZA 2VUUA 4D4KA 4NZZA 1CQJA 2TS1A 2W8BB 1ECJA 2H2WA 4EPVA 3IE1A 3UTCA 3EUEA 3TIFA 4RF4A 3PQDA 1II8A 4L0CA 2BZGA 2BQ3A 3M4ZA 4RKYA 3CO5A 5LVAA 4Q4JA 2Y1KA 1A5BB 1ZAUA 1G8FA 1QFZA 1USIA 1ZAKA 2FSUA 2EJCA 2VYNA 2Z3ZA 4C88A 3GLFB 2C4UA 1KI7A 3IOCA 1QONA 2PQ2A 3ISTA 4BGUA 4YMGA 2JD1A 3I0ZA 3AESB 3TPZA 5EI5A 3M9LA 5CMLA 3TLKA 2Y9PB 4F12A 1JWAB 3F6YA 3EQ6A 3I62A 3EXHA 3GEMA 3NW9A 1W2HA 3CNQS 3W2HA 3ANNA 1UXJA 2RF4A 4QUBA 4HGZA 4ZVTA 4NARA 4DMHA 3KXYT 5HCNA 4UE2A 5JNWA 1MAWA 3P0RA 1L5MA 4JYAB 2X5NA 3C3MA 1LNZA 5A7GA 5T14A 3HXQA 4WCFB 2ZRBA 2IH2A 3T7RA 4MCAA 4R2MA 2V7XA 2XCSB 4FIZA 4PBSA 2XRMA 4DAOA 2XAUA 3DDOA 2FR0A 5ALWA 1ODSA 4G4SP 1IZ0A 1Y4DE 1PFWA 1T4BA 4NCHA 2XXAA 3B52X 1Y3BE 1AGXA 2DUNA 1LGYA 2ODAA 1M74A 3CWQA 4L74A 1PT5A 2AJLI 2GF2A 4QDOA 4X1OA 4XUCA 4F0JA 1HNZB 5KTPA 3S2UA 1KY3A 2ABWA 3HK2A 4KMSA 1PR5A 1PFYA 4AYTA 3J7AK 4GZ5A 4HTAA 3WIUA 2F1JA 5K3CA 2H63A 1KE2A 1UBKS 1IOWA 2BFNA 4FKZA 3HKBB 1UP4A 4GX1A 4J0KA 4RZ2A 5DPMA 1OHHD 2NNLD 3SYNA 1EXVA 1WDWB 4ZODA 1XJ0A 3H2GA 1SKQA 2VXOA 3QEOA 3T3EA 5KG5A 4Z8YA 5IKEA 3VDRA 1VA4A 3O8NA 1F9AA 1YBMA 3WNDA 4C0KA 1SB9A 4O3QA 5IW8A 3BSSA 2V98A 2M6KA 2FA9A 3ID6C 4NAVA 5KHLB 4M9XA 3F7TA 3KC2A 3EIHA 3U56A 5CFRA 1Q0RA 3JVVA 4YMLA 4IR7A 1FY2A 3FFAA 1J2EA 4HJXA 3CF4A 1I6MA 1PFGA 1QQTA 2FLNA 1IN7A 1CLUA 2I4LA 3BE5A 3OWXA 4IIBA 4XSHA 3WYBA 4DMFA 2RHMA 4RIHA 1HY3A 1XNGA 2UYYA 3DKPA 3V42A 1MVOA 1KYWA 1Q17A 5AM5A 5DT9A 3T1HB 3LC7O 1VBMA 3AGPA 1HF3A 1TFRA 1XPRA 1XFDA 1ENOA 4I6GA 4BVKA 1LSOA 1CIJA 2NVBA 3WJ7A 2IA5A 1GVHA 1YUBA 3F3YA 4U9HS 1VDZA 3RJ9A 2DQ4A 1NVTA 5HRAA 1TYCA 4ZJUA 4R3NA 3CKYA 3GO4A 1X3LA 4I1SA 5F1PA 1W30A 4I8IA 5G40A 3NKLA 1S0OA 2AL7A 2ECQA 2TSYB 5KOIA 2XUAA 3AG5A 4O2AA 5CD9A 2IZZA 4YASA 2PWAA 4NENB 4CMJA 3LUCA 4IDPA 1I14A 1LTQA 1QRAA 4B76A 1NUQA 1W8IA 3P4XA 1QF9A 4I1UA 3UUGA 1YNSA 4P81A 2XNKA 4UBNA 5FO0A 4HAUA 4QBHA 3R76A 1LC3A 1WTAA 1CD5A 2QUJA 1MD9A 1PNOA 2XHZA 4D6XA 4QTXA 4FBGA 5AW7A 3WJ2A 1FTYA 1JYSA 1U8ZA 2P2LA 2MMCA 2RBEA 3DXYA 4WL0A 5A0TA 1U2ZA 3QVGA 1Q0UA 1E96A 4QBIA 4NZMA 3LP5A 4I1RA 3HJFA 3OC0A 4CCWA 1J7JA 4EVIA 5L1JA 4GO1A 3I5YA 5F98A 3PEEA 2QNIA 4BQPA 7ADHA 3GGJA 4FS3A 5GM1A 2DR2A 3IMCA 1GU0A 1T1JA 2FETA 3WLTA 1EDBA 2PV0A 1HH4A 1HORA 3BWMA 3CLTD 2EX4A 4FGRA 4KSBA 4Q24A 4MQ5A 1E4EB 2QLMA 3V9PA 1TD1A 4MRAA 4R1SA 4TV8B 4U6SA 3FZYA 4PTLA 4LF8B 1KDVA 3MWJA 1JG7A 5D1HA 5ARCA 2B9EA 3DHEA 3I8XA 1X86B 3IE2A 2XHEA 4LDNA 1NNSA 4DPMA 1P45A 1RAFA 2WZQA 2Z4TA 5JRJA 1F17A 4LBYA 3HB4X 4MROA 5T8KA 1UJBA 1BVUA 1SCNE 3HLTA 1DGSA 2OAGA 2PE5A 3QJYA 3BSYA 5EE9A 1RXCA 3MGAA 5FWYB 1VB5A 4ZVMA 2C5BA 3V4RA 1RWXA 4LF4H 1I33A 1Y1KE 1X9GA 2ZYUX 3PQCA 3PXEA 3H5RA 3RUFA 1EX7A 2Q1YA 3UICA 1DAFA 2UUBB 2FKLA 4ED0A 1F0PA 1L4GA 2IXDA 4X60A 3PE4A 2HYDA 3ZTTA 1QDEA 4M1YA 3L7AA 2PYZA 3UZOA 1KYZA 1KQGA 1XZFA 1M6HA 3AEUA 3PQ8A 5I45A 3P71T 1GG5A 3KOMA 4ND5A 1PTKA 5EERA 2D1TA 5EJ7A 4LOHA 4V24A 5ERYA 3QU7A 5FBHA 4QBTA 2QUHA 3R09A 2VIIA 5A6SB 3UJHA 4DQVA 5EXEA 2WG2A 3IAS1 5JAOA 2PSJA 3K8QA 1G3QA 4ZAWA 1IN4A 4CF5A 2GAOA 1IN5A 2JRLA 2VN8A 5DHAA 4YR7A 3P9IA 5HFJA 4HYKA 4AMZA 3PD7A 2O3JA 4NTZA 2DTDA 1F2UB 4B3DA 1SU8A 2JGKA 2GZHA 1QP0A 4C7KA 3BZUA 5E6SA 1BGVA 2NV2B 1XAGA 3DW1X 2NUTB 2FK3A 4PS1A 2R86A 3H7AA 1IBKB 1KKUA 3R9XB 1OYOA 1O6CA 5DXFA 4M1QA 4S2EA 3MNFA 4A2AA 1HDYA 1Z6AA 3R3JA 4KC0A 3UK2A 1FMTA 3VTFA 1HRDA 1TYDE 5AKXA 1KKMA 2YN4A 4RNOA 3R5KA 4RY2A 3USCS 5KQLA 2E3JA 3CCBA 1PT6A 1A4XA 4YRSA 1Q44A 4EYHB 2QTHA 4QRIA 4O3NA 1KBOA 1NDHA 2IPXA 3F4BA 5KWJA 1T3HA 1E3QA 1JQLB 3O03A 3P0EA 4RPIA 4DDHA 1DCMA 2FMAA 3QHQA 1XTBA 3PVXA 2F3PA 2QT1A 2X14A 3SXJA 2OXRA 1HM5A 2QMEA 4J3FA 4CQNA 4IVRA 5ALGA 2VT2A 4YRMA 3SVZA 4UMEA 1OXMA 3L9XA 2HSZA 3DMGA 1JAIA 4OQNA 1YA4A 4CC6A 2QGNA 2PGXA 3N40P 3W4JA 5I9IA 3AJRA 2Z6VA 2I3BA 3PIDA 3VDNB 2XXJA 3U62A 4GSLA 1N32B 2YNMD 2Q4DA 3A2NA 4G0XA 4BLUA 2RI6A 1QGED 4EB3A 2PUDA 4K28A 1Q84A 2H7VA 3BA1A 3QFHA 5IP5A 1UJNA 3GLIB 3U54A 2DVMA 1GKIA 2JD2A 3HUEA 1EKFA 1TQDA 3NWOA 5J5AA 4KR6A 2BELA 5LR6A 1QO7A 5FFFA 2IYFA 4FHFA 4GI1A 4RMIA 2C0QA 4JUBA 3WWDA 5EKSA 1A2QA 3KFLA 5JRZA 4I2NA 2XE6A 4NH4A 4YCCA 3CRZA 5JXIA 4DRZA 5A9SB 2JGEA 2X8WA 2ZJ2A 2O1WA 4L5BA 4D9FA 5BV1A 4RESA 1E2GA 2PSHA 1KSFX 2X9NA 1U2GC 4K9LA 4M7RA 3KSMA 3UH0A 1XTIA 4Y9DA 1UC9A 1KI4A 3EY9A 1R0BA 1TK2A 1E2IA 3H1PA 3A9TA 3NHUA 4Q02A 3SBDA 4YYZA 5AIBA 6NULA 2OWDA 2C4HA 3QYAA 4M7PA 2W11A 4JB2A 3D0OA 5EXDA 2WWTA 2ZU0C 2AX4A 1A88A 2IZ0A 2X6TA 4L50A 4XGIA 1P5RA 3LF1A 4C7JA 4EY8A 5T7BA 2FOIA 1U2QA 1Z33A 4QYIA 1G66A 1MOQA 3AKDA 2EHJA 3L3BA 3GLUA 3F5SA 4XLLA 3BQMB 1Z62A 1IHPA 2I1VB 3DUWA 5DCYA 4KXVA 3M9MB 4ZGBA 1E1LA 3AFNA 2VNAA 1U1CA 1IK4A 5CH8A 2XT9A 3ZHBA 1CJSA 2XYGA 3ESQA 3NVKI 3CH7A 5KZMB 4FR0A 3BQ2A 2NGRA 5BQOA 4IL5A 1OLXA 4N7MA 3PPYA 3EGVA 4M76B 2R6ZA 1CNFA 2EJUA 1DXYA 4JT8A 2PX6A 1EK6A 3KXLA 2UXCB 1KJQA 4RVHA 2FJ0A 3I1YA 2FPWA 3F96A 4JP8A 2Y1XA 4G5XA 3JXEA 2QXUA 3DNPA 2R96A 4ME6A 3AK4A 3PO2G 3D2AA 1PRYA 4KDCA 4EA9A 3WWEA 1XK6A 1NW6A 2Y4NA 1XMJA 1MA0A 3GWGA 1T9CA 3M9WA 4UUAA 2P2ZA 3R7BA 5DQIA 1JHZA 1ORTA 3NT2A 3Q7QA 1XWWA 3F6RA 2PK3A 4EY4A 3BF8A 3QV2A 4I3FA 4MHSA 1IXZA 2XWJI 4EG7A 5LNK6 3FE2A 3RVOA 3OEHD 1DMRA 3MFHA 1Y63A 3JZMA 1HTWA 2LIPA 2QDXA 3NLLA 4NZNA 1EWVA 4AKTA 1UM9A 3VHXB 5BR4A 4NK5A 3UUWA 1JQEA 1KH1A 1EQ2A 3ET4A 2H08A 1XEFA 3MVEA 4K9SA 3WGGA 4DGQA 1WW2A 3GTPA 1C2TA 1ZK1A 1JHYA 2ZYHA 3P0IA 3WP1B 3DWGA 1C8LA 2HBQA 3B51X 4JEUA 3SVLA 1XA3A 2QTNA 3C14C 3ITNA 3K16A 4ID9A 4KQKA 4NBLA 4TKZA 1Z0ZA 5CRIA 4CM4B 1PQ4A 4JVOA 5JSZA 3MWFA 5T41A 3W0LB 2YXLA 4YX9A 2IJGX 3IBSA 2FVXA 3GI1A 2VAPA 3K09A 4CR6A 2Y0PA 3QEAZ 4TN5A 1M72A 3LYHA 1K86A 1GNTA 2XQIA 2F4VH 3N8KA 2AFHA 4M8KA 3HN7A 5GZ3A 1XZDA 1Z0UA 2VQ6A 3LY9A 3VPAA 6PFKA 3L2PA 2SCUA 3PRKE 2GM4A 4UEQA 3ELBA 1ADCA 3GC6A 5DBEX 5C8DA 3QW2A 4GL2A 3FDXA 3G7SA 4NP6A 1NFFA 1GL7A 1SC6A 2P6RA 1Z7EA 2N9UA 2BJVA 3L1IA 4REOA 5AJYA 3OKPA 3RUCA 1KZ6A 2D6FA 3R44A 1E89A 4DQ0A 1T9DA 3IIJA 2E82A 3EXHC 4LHZA 4GOND 5CJ2A 5DTIA 5KYUA 3RWBA 4AG3A 1YQQA 1V4VA 5FOXA 2R79A 5LQRA 5SY9A 4GBED 2LD4A 1K6MA 2AI1A 4K9PA 5JFTA 1A7JA 4KACA 1HLGA 1JHXA 4PQYA 2PUCA 2DKFA 2P7IA 2YY7A 3TEMA 2GHRA 5DGIA 1TQ2A 4J9SA 4HGNA 3WJ1A 1GZDA 1P7YA 3ZV6A 4E2FA 3DOIA 3ZDEA 1XV5A 4WK4B 5AVXA 4FFNA 3GILA 1JJIA 3B6ZA 1Y3AA 2BM0A 2DPHA 5DEOA 5KJEA 2VP3A 3RSLA 3BFXA 4U0KA 5DVZA 5LD2B 4BDTA 2TECE 4XOIA 1RIIA 2Q5LA 2G77B 4OXKA 1SWWA 3RB0A 3RFTA 4ZI7A 1G6HA 1OY1A 2GESA 5JD3A 2CHQA 1NJ1A 1LLQA 1XQYA 2X19A 4MI9A 3U4GA 4FGSA 2HXSA 3DWFA 4NCXA 4PYMA 4BB6A 3HXLA 2GZSA 3C5HA 4NR0A 3DZBA 1GV1A 2OCBA 4RZ3A 3D59A 3QKSB 5AYVA 4P3YA 1JG6A 2HA4A 2R25B 4PSAA 4RETA 2ZBFA 1JHAA 1QV9A 2D8MA 4KXFB 3ESBA 3SEZA 2ZT8A 1M2WA 2HLDA 3L0DA 4H0FA 4TTSA 3ANYB 5DW3A 4ZALA 2QTLA 4B7XA 5KB3A 4XD7D 5DHSA 4V1CA 3LP8A 1P2GA 2V4UA 2X58A 1G8HA 3NHZA 4PYIA 5F2NA 3WAGA 4U4AA 1FYEA 1KFEB 4KE7A 1G8KA 4JB0A 3RROA 2FXIA 3VOSA 5K01A 4RIFA 4YRPA 2X2OA 4BZZA 4WCDA 4EDFA 4Z1OA 1XPUA 4EHHA 3N3AC 2JKVA 2WTEA 2XGOA 2CXPA 2HQ1A 1N32H 1PZHA 2DGDA 4FFMA 3QV1A 4ES6A 1II8B 2JAWA 1YZYA 3DWEX 4PSUA 1Q21A 1ZUNA 3FM9A 5FH9A 2C4NA 2RIRA 3HKCB 3JD4A 3ZWDA 2VP9A 1RW4A 2YYAA 4B3TH 2BEKA 3GV7B 3JQGA 4GOLD 4XFJA 3T5BA 1SVWA 4YAKA 1W46A 4R1NA 1DAGA 1TAUA 1YB5A 2XNDD 4WKOA 5IT9W 4L6IA 2G17A 3L6UA 3SS7X 4LYGA 1TL7C 4HDMA 4P38A 5FNZA 1D4FA 3FNEA 5DBFA 5EEHA 3ZU2A 5J43A 3CEJA 5SY4A 4B44A 1RHRA 5SYNA 2PWYA 4BY7G 4MJ3A 3N6VA 3FMPB 1W5TA 4L73A 2FZKA 4M7WA 1IPFA 2H1SA 3FNFA 3PUIA 1SKYB 1XNRB 4XVHA 2JDIA 4RY8A 1O96B 3HKEB 4M88A 1AO0A 1T10A 2XYPA 5FOQA 4MUIA 4DM3A 3FG9A 3EPJA 1B42A 4P3NA 2IQ5A 2M1XA 1XP5A 3BXHA 2VRCA 4BRWA 2IYQA 1P1IA 1PNTA 2C98A 3I53A 2IYLD 5KFAA 2GJ4A 4HP8A 2VTVA 4OAOA 3TF5A 1IHUA 4Y9TA 5FJJA 4BBAA 1KEZA 1XTJA 2HJHA 2ISSD 1A8PA 4DABA 2BFMA 5AM1A 3S28A 5HRCA 1KS2A 2P62A 3RC9A 1RC1A 2AHRA 1NMZA 2VTDA 4C4TA 3I12A 1TMKA 4MV9A 5JBNA 2PT5A 1DFGA 2HHAA 2V97A 2R8GA 3FN4A 2A5FA 2XVMA 5AHRA 3D4BA 4YUXA 4BAUA 5JDIC 1JHRA 1JRLA 1UKZA 4HFRA 1E60A 3JR3A 4CLEA 3WDKA 2NT3A 5K8VA 1D4ZA 2WM8A 2XR1A 4F4IA 4DG9A 3T61A 2O6LA 1FMJA 3OFJA 1Z4MA 2FSIA 5HVNA 3G0OA 5L1IA 4ITVA 1T4GA 1RPNA 3GLSA 2RGXA 4YFYA 3GTOA 4TMTA 4ZP1A 1LH0A 4Y3UA 4YN3A 2WB2A 4URWR 4TKVB 2BKUA 3AFGA 3UMVA 4ZTUB 4LJYA 1XMVA 4G1CA 4HDSA 2EJVA 2V6MA 4FUQA 1C30B 3CUKA 3FPGA 4R8RA 1UDCA 3TZ6A 2NZXA 4QJ5A 2J32A 5H3HA 5HCIA 3QUSA 1M8KA 1MFZA 1GGKA 3THWA 4U5QA 2RHTA 4XQCA 3VU9A 5CT9A 4EJFA 3WLMA 3ZZUA 2I0FA 2B6HA 3L1UA 4NNPA 2RHLA 3AM4A 2JCGA 4W7HA 4DIDA 5JSUA 2NUPA 2ROQA 2XT6A 5ALSA 3NOOA 1N25A 2MYNA 2QW0X 4QX6A 2I9PA 1E9AA 4D43A 3PXBA 2DULA 3TJRA 5JI3E 1XR3A 2OENG 1CVLA 1VECA 2C8JA 3CRMA 3EDQA 1PFUA 4KCGA 4B6FA 3QXGA 4Q4JB 3DO8A 1Y6GA 2B3DA 3E9QA 3INTA 3CJTA 2PSSA 3DT8A 4MTEA 3DE1X 4TMKA 4TPKA 2R7MA 4WZBB 5FCDA 2OHHA 4DJEC 3IC5A 3U09A 1UBJS 3VUFA 3PCRB 4IFEA 2VP5A 3QXHA 1F4VA 1I1QB 4NFLA 4YVFA 3V34A 2B3TA 2R8IA 2HREA 3PUXA 4UU1A 4FEGA 1T29A 1EAMA 4GP9A 4U2KA 3DEFA 1E1RD 3ZXXA 3EXG1 721PA 1TVKB 1T35A 2LNDA 2GT1A 3OKFA 1RI3A 2VI5A 3QI2A 3R5SA 4R1OA 4YP6A 2WQ6A 5T4EA 3SR4A 3PEYA 3ICOA 3IDOA 1MJHA 1JR3A 5CA0F 1D07A 1G6Q1 1YB4A 2FUNB 2NO5A 4XIFA 3UBMA 3HNRA 5HUJA 5KYWB 1I10A 3T54A 2WUDA 4LW8A 2A9PA 3ZS9A 4ZAXA 1XF1A 4RL4A 3WYEA 3MHTA 2H0RA 1XBTA 3AMVA 5JH7B 4W9NC 2GCOA 4EG3A 3U9LA 3UJNA 1WLYA 3FUUA 4HWRA 1KIFA 5FTWA 3KZKA 3OOYA 4D8WA 1A1VA 5EE1A 1M8GA 3FMIA 1Q2XA 2I7XA 1BS1A 1NSYA 1U7PA 4CFYA 3R7AA 3QXJA 4E14A 1GXSB 2A1IA 3JPWA 3OZDA 3VJKA 2DKOA 5FQNA 1WMDA 2ZYSA 2Q45A 5AI9A 2VWGA 2ZRHA 3DVQX 3W6UA 4K6MA 4G3IA 5IF3A 1JIHA 1G1MA 4GZ3A 1PHRA 4MA4A 5ILGA 5BSTA 3ZGXA 5CT4A 3VZSA 1SXJA 3AP3A 1LI7A 3AH8A 1P7CA 3Q6IA 3QU2A 1L5SA 1T0UA 4PYJA 1C1HA 4N3BA 3LULA 3IBGA 3GQBB 2XAAA 4Y2XA 4RTOA 1QHYA 2FEPA 3FFXA 3REQB 1N77A 3PLAE 3OD5A 3WKEA 1NDQA 1GIAA 3JQEA 4RSHA 3PUZA 4WFIA 5FYQA 3NCHA 2BHTA 3HBLA 4X1IA 3WRWA 3LUHA 2H3EA 5FBRB 3A3PA 1MORA 3ZQ6A 1GO2A 3TOVA 2A0WA 2Z6UA 1YVUA 4CNQA 2IPMA 3K96A 3ERCA 4WE3A 4HQNA 3SC4A 5BPHA 2QYHA 1WKVA 2WF7A 3KPJA 2FOXA 3MSXA 1FDSA 1ODKA 3P2YA 1RQXA 3TQHA 3WYCA 4AJLA 1X15A 3SZRA 3FCXA 4CUKA 1K1QA 3O3OB 3WLPA 5IDXA 5EE3A 3WOVA 5KNDA 1L7AA 3ZW9A 5EIBD 1OH8A 3C5CA 4JVSB 4KKXB 2BMDA 3JQFC 2Z5GA 3NPMA 4DIKA 1DGQA 5CIWA 4P58A 2YZLA 3F9CA 5EKXA 4LECA 4URVR 3REGA 1IY8A 5DHTA 1FUKA 4LVCA 4ZKDA 4I1PA 3AZPA 3VTKA 3PJDA 3CR7A 2GAAA 1JE1A 2FK1A 2Z8YA 4KAJA 1UEJA 1ZU4A 1A8UA 4KLCA 5C1IA 2UZAA 1KAEA 1YC5A 3IQHX 3ZQ4A 2OGTA 4D6YA 4J1TC 3JX9A 2Z8YM 3VZBA 3PGKA 2LUOA 3VMFA 4E4TA 1B0AA 4ZVVA 4CPDA 1KRWA 5FLMG 1XGKA 3ZEIA 5BURA 1E79D 2DPYA 3VNUA 2KLHA 2SBTA 4ICIA 4JT2A 1DWOA 1ULHA 3FOCA 5KFKA 1PTJC 2IOFA 1PYGA 4GOOD 4KQEA 3E4DA 3C1OA 3AYXB 2JGLA 2M2IA 3O5AA 2E21A 4MK4A 2J6CA 3HWRA 4G36A 4ZQBA 3EZXA 2W2PA 3NJ8A 4N47A 3WHLA 2Y92A 3O83A 4M1ZA 1NLUA 2A8YA 1Y0BA 3O6VA 3SU8A 1HFWA 1PV1A 3TR0A 4AZWA 4RDHA 2JCXA 1PFVA 2X1MA 3CVXA 3NHLA 3QP9A 3M4XA 1SXHA 5IWAB 2QDKA 4MINA 4RZUA 1AO3A 3SWWA 4MWBA 3KTDA 2YW9A 1UK9A 4E3WA 2DB3A 1G18A 1WXIA 5FL7D 3WQRA 3T5KA 3IJRA 1F2VA 4CLOB 2F43A 3VAZA 3VI4B 5SV2A 1U0FA 4CQMD 3G0GA 2G0TA 3PFCA 3T3IA 1T2NA 3MM4A 1E4EA 3AR5A 4J91A 4AECA 5I5GA 4OO3A 1SQ6A 4JX9A 4RJLA 1YVEI 3ITDA 1ZU5A 5CM8B 4A3DG 2H48A 3MOIA 4JXKA 2M9MA 3P97A 4QO7A 5EWJB 1GWNA 1S7GA 3MJHA 1Q57A 3SEFA 1BVYF 1U5BA 3QY9A 4OKNA 4QODA 3TB6A 3WL5A 1B74A 5HEKA 1GUDA 3L5OA 5LMUH 2Y2VA 3TCKA 3ZHCA 2H51A 3EVDA 2XZDA 2ZIWB 4DTIA 3BREA 4UVHA 1ZNWA 2BFDB 3NZEA 4IRUB 3OE7A 4YP1A 3UOAB 5TARA 4XGKA 3TQCA 3GHHA 4M0FA 1Q91A 2R7ZA 4O82A 4LXQA 5ITVA 4R83A 3ANMA 1FJXA 1AKMA 2IHZA 3VGPA 1I1LA 2IYNA 4HN9A 4KLZA 4P83A 3ZIUA 5C18A 2ZETA 3EJ6A 1JHVA 5KWIA 4B3GA 1M1UA 2I3AA 3QQ5A 1DMSA 3MHPA 4WFJA 4W63A 2W58A 4E31A 2C2EA 4NJOA 4DSUA 1KU0A 2BMAA 5TQ2A 4AZVA 3KHSA 2BTEA 4EA7A 3U26A 1CZNA 3HU5A 2GM3A 1O2DA 1SXJD 3ANLA 4OFBA 3F46A 3LDHA 2ZW9A 2RGRA 3UMFA 5I51A 1D04A 3EEOA 3G2HA 1GQSA 1RCUA 4RMJA 4J3NA 3TTVA 4U02A 5AKKA 1GPLA 1AQIA 1UXGA 3FETA 4CMFA 4N0MA 2E18A 1XLUA 3ITKA 4A2PA 2DTEA 3LWZA 3MTJA 3V8NA 1ZGBA 2CLEB 4ESEA 4RV4A 2COJA 3LPAA 5AJVB 4BXOA 5I4CA 4E30A 1YWGO 1HEYA 4L28A 3R0IA 4OAQA 3OCCA 5BXYA 4KL8S 1R0XA 1K8ZB 1KWKA 3F9RA 2QPLA 3MFQA 3N28A 3U44A 3QOYA 2QTRA 3RSOA 4OGKA 3RGXA 5IBRA 1FBTA 3EZ6A 2JS7A 3MAAC 4XWOA 4EYQA 5AI5A 1CUWA 3CH4B 5BYKA 3IPYA 3VI3B 3MJEA 5JTUA 3GIPA 4HVTA 2WWGA 2I9KA 1BXRB 2H4HA 4C01A 1SC3A 1FMCA 2UVPB 4HDNB 2YXDA 1TU0A 3ABOB 3DBVO 4D9HA 2IUSA 4HCJA 1MDBA 2BBOA 3QUCA 3MCTA 1BHO1 1EX6A 3F71A 4QOJA 3ELWA 4IMRA 3SSMA 3TY5A 1R6VA 3PWKA 3SLKA 2WU0A 2OAQ1 4Z9YA 2UZ0A 3DVLA 1RTKA 1UPFA 4EFDA 1ZFNA 1WZIA 3SYRA 5DZSA 3EYWA 1NG9A 3T3OA 1OROA 1MABA 2IZ1A 3V8MA 1L0BA 2JFGA 1L4YA 4YJFB 4X1KB 1XNJA 4ZEOA 3USES 3VPHA 2JBHA 3AI2A 4EO4A 2JJ2D 1PGJA 3RV3A 1KERA 2RJ3A 4GP7A 3P4YA 4DCPA 2VH2A 4D4IA 2CV1A 3LK7A 5ALTA 4XGNA 3FCYA 1IWBB 5H5JA 2NIPA 5FUQA 5G4KB 5HNKA 1X7ZA 3B9QA 3CXRA 4KODA 1BW9A 2V4RA 1OMOA 3WHIA 3HN2A 3H4IA 3A37A 4BWFB 2VDKB 1OZAA 1ZK4A 1WXWA 1U02A 2WFLB 1NVWQ 2YJZA 4QHYA 4LY3A 3CF4G 5TV2A 1FFXB 4DA7A 1Z6QA 5B1DA 3UHAA 5JJIA 5EYPA 3CINA 3ZDBA 2EQAA 1NP7A 4LQ4A 5H0IA 1BEEA 4LDJA 4A2WA 3N7UA 3RF7A 3GP5A 4KXUA 1RNLA 4ND7A 5HF6A 3TFOA 3AX6A 1ZRSA 1GT91 3NT4A 2PLFA 4IH9A 3TLZA 3H05A 5LMNB 4TSRA 3FSGA 2DERA 5AOBA 4EFEA 1RLIA 2HDWA 3RC3A 2UVUA 1DJPA 2Q6LA 4ZMBA 5EIFA 1U28A 3KJFA 2VYCA 3JQ9C 4W9RA 2F4VB 2Q4BA 1N2GA 4IHJF 4FYKA 1E2NA 2CDBA 4IIHA 1P1CA 4A0FA 3JRWA 3LVQE 1J8YF 4AY2A 4MAFA 4E5KA 5EDWA 2AN5A 2V6IA 3QSYA 4JDPA 5DLGA 4NOJA 2IX9A 4LHEA 2DBRA 3RWOA 4I4TA 2CHEA 3DFZA 2CMKA 4HGOA 1YJQA 5DMXA 1OFUA 2XNSA 1NXXA 2F7SA 2BKXA 3E27A 4LMRA 4WTOA 4E22A 1ZI9A 4N1AA 4NFSA 5FD8A 5JYDA 4X45A 4L51A 4L0DA 4FWTA 4IGEA 4LFAH 2G40A 1JVNA 4Z6KA 1WXEA 3DTFA 1QVVA 3TQTA 2JEOA 3EYAA 4EVRA 2H2FA 5A2QW 4LFCH 1C1XA 3NI2A 4LCBA 3U17A 4B7AA 4EUSA 4GF5A 4H1VA 2MIIA 3LC2O 4KO4S 1I2BA 2V9PA 1N2CB 1CUBA 3DD1A 4O8ZA 2G9QA 3RYCA 3I23A 1BOOA 4G85A 5KDDA 1TPYA 1VKZA 2P8SA 1JJ7A 5CK4A 1HE1C 4IGFA 4W5HA 1V39A 5D01A 4L0QA 4OREX 1YE5A 4RD2A 4OQQA 1J2RA 1FVHA 3AUSA 3UPUA 1AS2A 4N54A 2ONJA 4OA5A 3T9EA 4C1NA 1ZN7A 1FZQA 1SVMA 3DHNA 4KB5A 4JXUA 5DG8A 1EDDA 2VEDA 3IRUA 3MA0A 4YCDA 4OYYA 4DRXB 2PUHA 1UAAA 4JI5B 2V54A 3O8QA 4O08A 2CHGA 1Z6XA 2ZRFA 4ZO7A 5EXPA 4P84A 2DSTA 4MNTA 2PD6A 1CUCA 2CJXA 5EZYB 2PZMA 3KSRA 1FFCA 3JAKB 5EC8A 1Z35A 3RAQA 4D74A 5F7ZA 1F5SA 4B47A 1V8FA 4J9OA 1LUAA 2C7VA 3AILA 2BEUB 1XA4A 1XRQA 2DFKB 2I99A 3MTQA 3S1SA 4QVIA 1QQAA 4AJ9A 1PW7A 1E7QA 4JYZA 4PHHA 2D7DA 4UTVA 3T5TA 4IKEA 1YDHA 4B40A 4FFRA 4ZANA 3SYLA 3I6MA 3DXZA 1KMMA 2Q0SA 3O7MA 5D7NA 1E6MA 2B78A 3ZXIA 1JXOA 3AUUA 4G25A 3BE8A 1OILA 4D82A 3CLUD 1QZXA 3ZE8A 2X9QA 2J6SA 1E2LA 1ZO8A 2PS3A 4II2A 4NDNE 4DUZH 4BYGA 4EARA 1E62A 4TMZA 5EVJA 4B2IA 2LR0A 4PZUA 2LP4Y 1V48A 2JZOA 4Q9LA 4XDYA 3WLIA 2XMPA 2UV8A 3ZY5A 3MMNA 4MQEB 5AI6A 1XEXA 1XZAA 3AUTA 3PF8A 1RXIA 1C3EA 2EFDB 4M86A 2G5CA 3Q5DA 4A3EG 2WHEA 2E4WA 5L7TA 2LXNA 5IKPA 2UXBB 1CJKC 1VA5A 2BE9A 3RYTC 1WSAA 3QE4A 1R6BX 4RAOA 3VPGA 3ICVA 2HUPA 3VO2A 4DCNA 3SNKA 1G20A 1OWNA 1DLJA 1OUMA 4NXNH 1X42A 1AKNA 2C20A 1U1EA 2ZI3A 2GMWA 1PFKA 1W96A 3FFBA 3UXYA 3ZEAA 4JQZA 2WUVA 3TNFA 2F4NA 1FEZA 2YHIA 3G23A 4RQTA 1EFRD 4YK7A 2IP2A 3LIIA 4JB8A 3KWLA 3IUMA 5CXUA 1RJQA 4QQFA 1WMEA 1UMDB 1UQRA 2YOFA 3EE6A 4NRDA 4X8LA 3U7EB 3WB0A 2P9EA 4KWTA 4UTPA 1C4OA 4ZDIA 1I7NA 4Y8VB 1QGDA 1W4AA 4CMAA 4LH6A 1S0NA 2WP8J 4DBZA 3F3KA 4K6GA 2CCJA 3O91A 3UA3A 3GHYA 3WLSA 5CYGA 2BKAA 5A5VA 2X0RA 4L76A 2CXSA 2PLAA 2RHGB 4U1RA 5TB5A 4PYKA 2XPCA 2H1RA 1F0NA 1NV8A 1PT9A 3WLFA 2X7HA 2F9LA 2XQGA 2ZBGA 5YASA 3AL0C 4MQFB 1KUTA 5EUQB 3E35A 4JU9A 5IJZA 5GJBA 2DRIA 1RP1A 1S8AA 3WLAA 5K7SA 1PL6A 1PHPA 1D0SA 1YCDA 2HF2A 3DPSA 3M1LA 4NOKA 3H2ZA 3HHEA 2PSDA 2W4MA 4HNSA 5GJCA 5ICFA 4JHXA 3GBPA 3H99A 2BVNA 3C5WP 3HOYG 2D8AA 1KI1A 5ICMA 4LSMA 4JFRA 1RYZA 4EQ5A 4Y2QA 4C4RA 3K9HA 3H87A 1A0GA 1YZLA 4BASA 4IV8A 1QMGA 4JMPA 3SI7A 5IABA 2FE3A 4JV5H 2ZXEA 2CE2X 3ODPA 3QH4A 3NC4A 3KVOA 4UBOA 4V0QA 4AM8A 1OD6A 4DUGA 1IONA 3VJLA 1G0NA 1U04A 5GTDA 4L07A 1EKXA 1S03G 5B53A 1NBOA 3DV0A 2FUG6 3H75A 3LHIA 3V1MA 1GNSA 4A10A 1W5FA 4AN0A 4BNYA 1T9HA 4QKQA 3NBZB 4N3GA 4WBNB 4ZOLA 3UZBA 3RCBA 5LQUA 3HLKA 4GLBA 2YWHA 2MR5A 3FCCA 2XJ4A 2QTTA 1ODIA 4QJBA 4D97A 1UZUA 1XLVA 4L9RA 5EQFA 3UK6A 3DMNA 1WY7A 3MF4A 3PR2B 2O8DB 5CA0B 1QVWA 3K1ZA 1T8WA 3M5WA 4GOXA 3GT7A 3HS3A 2W9CB 4M6WA 2IYXA 1TM2A 2A86A 1CXZA 1A04A 3GEPA 5ITZA 4P3XA 3RR2A 4OB7A 4F8EA 5JBQA 3TLJA 4F97A 4UCUA 1K8QA 1CRZA 3B70A 1T0BA 3WGTA 1TT5A 5D6OA 2RKOA 4ZT7A 5JZOA 5LM3A 4DCCA 2HB6A 2H4WA 5C35A 5JXWA 4C3OB 4PG8A 3P45A 2XDWA 4NZYA 5I5EA 3ZI7A 2X0SA 1ZN8A 3CX4A 3MG9A 5BWOA 2AC2A 1W5BA 1SCUB 1WXQA 2H4YA 1HK7A 5E0KB 4BVJA 3F7MA 2Z95A 4DBLE 2A6PA 4PS0A 1BJRE 4AUEA 1GA4A 1I94B 2AKYA 3QKUA 1VYVA 3T5HA 2ZTSA 3KUXA 1N1GA 3GQBA 2ZYDA 2KPOA 1VL5A 5CM0A 2VWQA 3GNQA 4MGYR 5JS6A 2YZMA 3IKMB 2Q1UA 4ZREA 3M3DA 4DR4H 8ABPA 4EG1A 3LI2A 3BMNA 3RQIA 3VSAA 1GGJA 3FTPA 3MMSA 4GHWA 4JU8A 1JHPA 4RLFA 5JJ5A 2FDCA 4PAOA 4YP5A 5KAPA 3QI7A 2OVBA 3MWDB 4EIWA 1XVLA 1XTUA 1K83A 2QJOA 3H8JA 4RPGA 2XE7A 5AW6A 4N5LA 4XW2A 4X64B 4H08A 2QL6A 1PWXA 1TJ3A 4Y6LA 2VDPB 3GXBA 1US8B 3L8YA 3LDUA 2X42A 3DZJA 1EVKA 3BWEA 4ZTZB 4IF6A 5KU7A 1TO1E 4MI1A 2QRZA 1T2VA 1Q0PA 3QLTA 1GCIA 2OCXA 1UC8A 4IPTA 2NUPB 1KZGB 2IU0A 5HOQA 4S04A 1Y6JA 1WXGA 5IN4A 2JA1A 2YJTD 3I64A 16PKA 1NBWB 1OI4A 1RYNA 4TM5A 2EFYA 2QM3A 3BKWA 4EI2A 2UVQA 1ZC4A 1ARZA 5DWDA 3KB2A 4EUKA 4EW3A 1MT3A 4X9XA 2ANBA 4LF5H 1B6TA 2QRPA 3BACA 2YWBA 3PEVA 5CB0A 3CE6A 3H9JA 2ZRKA 3G7NA 4UVGA 1P1FA 3ZD7A 1WY5A 1XIVA 3AWDA 1NRXA 1JPJA 5IEBA 1NM5C 2IIPA 2J0UA 3IUPA 3LA6A 4KMOA 1O08A 2V3CC 3ZBQA 4QULA 3D54D 1RJGA 3SNOA 5BR1A 1J8DA 2BKVA 4DR3H 2Q99A 3CC8A 4DV2B 3ISJA 3MTAA 2O14A 5TS2A 2QX6A 1FFSA 1O4VA 3IOBA 3RFXA 2FNAA 3ZK8A 4ENPA 1E3DA 2J8ZA 2MTBA 2QT0A 3WWJA 1FFBA 1NWCA 1TYEB 3HL0A 1CR6A 4RZXA 4KEAA 4F2PA 3HCAA 4E1BA 2FW6A 1W36B 1SUWA 3SDZA 4F38A 1MQ8B 2AFIA 3A1UA 5C46F 3BJYA 1F5NA 1XPOA 3OZEA 4UQPA 1ILWA 2ZITA 1A7AA 2C8KA 4HAOA 4YJ2B 1YKGA 2PGAA 3JZIA 2FPPA 5GIPE 1E20A 3N8DA 3ASZA 5GPBA 4RTNA 3RC8A 3I3OA 2IWHA 1RZVA 2CFCA 4FDMA 2XVXA 4GWKA 2CVPA 4HGPA 3THYA 3ENNA 5ADHA 5IAOA 4EUNA 3U1TA 3KEOA 4BO1A 7YASA 2JLCA 2X77A 1UBFA 1WLSA 4KQJA 2OGSA 1XKXA 2QRVA 1ZD5A 4G4GA 5IP9G 3AB8A 3BN3A 3SQLA 2HBRA 4QBGB 4CV1A 4QTYA 3K9BA 4QO8A 4W8GA 3MR2A 1PWYE 2D13A 4ND2A 1F6DA 1VBHA 2RBKA 3VVLA 3C43A 4DZRA 5A5GA 5JPCA 1FIUA 1DFHA 1IE3A 1VJRA 3DTVB 4AY4A 1SC1A 3H5VA 4PCAA 5LA6F 3OUZA 2D00A 1QUEA 4M8LA 2QW1A 2GASA 3U6KA 3FVWA 1N4AA 1G64A 1GDTA 4LHWA 3E0XA 5M2QA 4C5AA 2AIRA 3OQPA 4WI1A 2R6CA 3GJXC 3MUNA 4KHZA 2W6MA 2OCDA 3CBQA 3DGFC 2CKMA 3V55A 4Q45A 4DVJA 3HB1A 4W5TA 2QZSA 1JEQB 4DM4A 2WT8A 1PUXA 3MTGA 3GRKA 1Q7RA 1R6UA 3U0GA 5LYJF 1IM5A 3NIBA 4ZOQI 4DJDC 1NLYA 4AQDA 2Q0QA 1NA5A 4R9VA 5HKOA 4M1EA 4WIAA 5LUAA 4B1FA 2C9YA 3ND8A 3WYDA 2H65A 2CNUA 3KOOA 2PRIA 1DJMA 5I4KA 2ZKLA 2P5TB 2I2AA 2KYRA 3TTWA 2D2VA 2JGFA 2PRJA 5E38A 5JMWA 2Y1DA 2HLPA 2J3IA 4Q7JB 4OUKX 4PYRA 2IU6A 4X6LA 2OCLA 5ABPA 4DY6A 1Z4LA 2F3TA 1G8AA 4LZZA 2X0EA 3VPXA 3MR5A 1KEWA 1AHNA 3ZPXA 2Z2ZA 3QKRA 2C57A 1VMDA 4JOBA 4ED1A 2JCSA 2ONYA 3I73A 4LNAA 4AF7A 3T5AA 2GSDA 4Q0MA 1PNVA 4ENSA 3AF6A 1BA3A 2JEZA 1XHEA 4BO2A 4JI3H 3GCXA 4NKRA 4LGYA 3FKSA 1HDRA 4DR7H 1NURA 1VJ0A 4IW3B 1HFKA 4Y6RA 2HNKA 1HQYE 2QENA 3AG6A 5TE9A 5TQ0B 4DC9A 1DQYA 2RH9B 3TMKA 4CV0A 1XMOH 1UOQA 1VCOA 2Q4TA 2Q6VA 2GEUA 3P9PA 2JKYA 3QW4B 4M0CA 2IZ7A 3DMFA 3KU4A 4IH4A 4MTLA 3Q2OA 4PWQA 4PPGA 5LB2A 1E1KA 2Q49A 3WQSB 4AJEA 1OI3A 4JI2B 2ADMA 1NW8A 3IHKA 4PVDA 2JGMA 3C1AA 3E61A 4F4ZA 2Y27A 1IWOA 2WJ3A 4EHBA 3ZOZA 4EFLA 4WASA 4HNGA 2CLSA 4Y1EA 1QH0A 5KJFA 4I5DA 3RHFA 4I0WB 2CKZB 4WBXC 3BE4A 1Y9AA 3KVNA 5JPIA 1JYFA 4WD3A 3HKBA 1C8VB 1QORA 1HTTA 2NNWB 2WF9A 3CH5A 3IQGX 1IXRC 3LRXA 3MT7A 5FPSA 1COZA 4L22A 3RU9A 4HQLA 5FV4A 5B58C 1QP7A 4IFIA 5CGQB 1V11A 4XM1A 4JENA 1G2OA 1EHIA 1M5UA 3PYXA 5KX5A 1FU7A 4NCAA 1EUDA 2BRUC 4XWAA 5ALUA 4M49A 1RCFA 3O1HB 4M1MA 3RVSA 2GS9A 1F2TB 4QVKA 4BU0A 1A9OA 2R44A 4DSAA 2F6RA 4CN9A 5THKA 1KI3A 4DV0B 2A1UA 4TKUB 5G1PA 5HIJA 3PB3A 2FXVA 3E7FA 4EPRA 2ZB2A 4YT5A 5JDCA 4GKKH 3V2GA 1U8XX 3WGLA 4A3KG 2H1CA 2W8LA 3ZHOA 1XFAA 4E6PA 2HGSA 4NL4H 1O6ZA 2UXCH 1H5UA 3OQ6A 2AZDA 5E7IA 3SJZA 4CG2A 2EAUA 3E2MA 3NUGA 4HFJA 1L5LA 3SKYA 4D9MA 4MKFA 1QYIA 3H9QA 4O86A 3HJUA 1HLDA 3L1KA 4URUR 1XQVA 4M1WA 1N2BA 1GYPA 2I2WA 2WTAA 1LFAA 4ZAVA 2TYSB 4OJTA 3AERA 3KPUA 3LGAA 3MJCA 3K6RA 4H77A 3T1TA 5AW1A 1L7QA 2IUYA 3COZA 3H0GG 4IDQA 2FQ1A 2KQUA 4PCUA 3VKGA 3UF0A 2NZYA 4O33A 4PLZA 4Q48A 2YVAA 5L1LA 1LD3A 1IBKH 5LXTB 2O03A 4UUGA 1R6XA 4N8EA 3ZWQA 1D2GA 1MV8A 4ADSG 3QE0A 2NXEA 3BFJA 3P94A 3ZJ5A 1ZVJA 3JY6A 3ZE1B 1Y14B 4W5RA 3I4CA 1YQTA 2C99A 2VA9A 5KFBA 3G89A 3FYDA 4FCVA 4YUAA 3KL4A 5TT1A 2ZE8A 4HYQA 1S02A 4A6DA 1R37A 1J22A 1PSDA 1WNFA 1P4GA 2BBTA 3P27A 1ZMOA 5LA6B 4YNBA 3STWA 4DZZA 1R9GA 2HZ7A 2W83A 2LWIA 2WYVA 3CZQA 2H1HA 4GBMA 5TPWA 3WIBA 3TOXA 5KG3A 1LW7A 1VIAA 2FCAA 2V59A 3Q0TA 1BRMA 3R5TA 4YBZB 4RUKA 3ZWKA 2WHPA 3QVGB 1PZEA 4CRWB 2MMGA 3EOZA 4F5DA 5HIKA 1KARA 1EK1A 2WU4A 5LBIA 1OH5A 1U4NA 3TE7A 2YDYA 4EBFA 3P0JA 1BXRA 1MG5A 1ZH2A 2ZIUB 1HLFA 1WV1A 3O94A 1SN7A 3IX7A 4PONA 4TTJA 5JVLA 4CMKA 5HA5A 4EX6A 2EEPA 1JDJA 1FSSA 4AG6A 4AKGA 1L7NA 2JDID 4PM4A 3ROMA 4O7RA 5CCEA 1Q1GA 1VDMA 3EIEA 1M5TA 1CNMA 2PS1A 4V0LA 2JBAA 4U3JA 2EKLA 3VV2A 3TS1A 1KS9A 1AUXA 4NS1A 1E1QA 2WTXA 3TL6A 1JHOA 2W0SA 3HPRA 4CT5A 2ASEA 2XUKA 4PHTA 3LBIA 3T5CA 3FWPA 2R6DA 4FMPA 1ZMXA 5DJ5A 3VC3A 4EYGA 4HC4A 1WAMA 2HK9A 1YR1A 1IJEA 4FB5A 1E69A 4W9MC 2HK8A 2DM6A 1XRNA 2O2XA 3DA8A 4MKGA 1SHLA 4GKJH 1HOXA 4H4EA 3R3HA 3ZX4A 5AESA 1OIWA 5AM2A 5I4IA