3VPCA

Argx from sulfolobus tokodaii complexed with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
b'MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetylornithine deacetylase
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpcA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpcA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpcA01
1Z2NX 3U9SA 5JQGF 1UC8A 3N6RA 2XCLA 4O7SA 3TW6A 3MJFA 2I87A 4EA7A 3JRXA 1OBGA 1KJJA 5CA0F 3V4ZA 1C3OA 2GQSA 1CQJB 3WO1A 1IOVA 1CE8A 1KJIA 3VPCA 2NUAB 3UFXB 2R7NA 2YZNA 3VMMA 3KREA 2FPIB 3DF7A 2NPOA 3BSYA 2YZMA 1PX2A 2DZDA 4EGQA 2PN1A 2PVPA 3V4SA 1IOWA 5FNVF 5C1OA 3K5HA 2VPQA 3R5XA 1BXRA 4O84A 4O4HF 3HBLA 3WO0A 4NYEA 4HNTA 4XZ3B 5JH7F 1SCUB 4WBNF 1B6RA 4DLKA 5KX5F 1CQIB 5H80A 1B6SA 4C5BA 4EABA 3RV4A 5D8DA 4YAJB 3JZIA 4EG0A 4QSHA 2Z04A 2P0AA 1KEEA 2SCUB 4L1KA 1E4EB 4EA9A 2R82A 4O7WA 4DIMA 2YYAA 5JVDF 4EA8A 2GLTA 3MWDA 3BSSA 3ORRA 1JKJB 3LP8A 3R9RA 2GQRA 1KJ8A 3Q2OA 3R5FA 3VPDA 3JZFA 5CB4F 2W6NA 4IZOA 2XD4A 4FFRA 1M0WA 4ZQIA 3TIIA 4M99A 4M9CA 4TUYF 2R85A 4MAMA 2YRWA 2I8CA 1Z2PX 2VR1A 1AUVA 1E4EA 4C5AA 4O82A 3BG5A 4FFPA 4MV3A 2PBZA 5LYJF 4ZHQF 3RV3A 4I50F 5BPFA 4MV4A 2QK4A 3QFFA 2NU6B 4FFLA 2HJWA 1KUTA 4MV9A 3RFCA 5LXTF 2CZGA 5J2UF 3TINA 3I12A 1W93A 4C5CA 2CNUA 2R84A 1CS0A 1A9XA 3GLKA 3RUPA 5HV6A 2YS6A 3NUAA 2YW2A 3OUZA 2W6ZA 3R23A 2R86A 3K5IA 3BSWA 2GPSA 5JVLA 4O86A 2GPWA 1JDBB 1A48A 2YZLA 4ME6A 3G8CA 4FFNA 2C00A 2NU7B 4XX0B 2YWVA 1W96A 3N8DA 4XYMB 4HNVA 4O4JF 5LA6F 2YL2A 4O7LA 4YBZB 1I7LA 4MV7A 3ETJA 4O7YA 2HGSA 1VBHA 4M9UA 5BPHA 2DIKA 1M0TA 3TQTA 3U9TA 5EZYF 1VBGA 3WNZA 4MA5A 5C1PA 4MV6A 5DMXA 3Q1KA 3BFPA 4E4TA 4O7NA 3G8DA 4IIJF 1VKZA 2YS7A 1PK8A 4MV1A 5K2MA 3KALA 4IWXA 2ZDQA 1EYZA 3AX6A 1AUXA 4RZQA 3JRWA 1EUDB 1KBLA 3TIGA 2YZGA 2V58A 3GIDA 4I55F 4MA0A 2WYOA 4FFMA 5J2TF 4IWYA 4HQ6A 4J6EA 5C8YF 4O7TA 2R7LA 3HO8A 1EHIA 3LWBA 3AW8A 5CAEB 3R5HA 3KAKA 5IYZF 3ORQA 5I47A 3OUUA 2R6FA 1JLLB 2VQDA 1EUCB 2QF7A 2FPGB 2V5AA 1GSOA 2CQYA 1WR2A 4O2AF 4O83A 2FB9A 4YJ3F 1BNCA 2R7KA 4GGMX 4O2BF 1JDEA 5GONF 5HBRB 4EGJA 4XYLB 1GGOA 2VHEA 2DLNA 1ULZA 2CNVA 2OLSA 2W6QA 5JQWA 2CNQA 1EZ1A 2FPPB 2ZDHA 2FP4B 1KC7A 1DV2A 1T36A 5CA1F 3KAJA 5LOVF 4YB8B 1UC9A 1GSHA 4O4LF 5KKNB 1KJQA 4YAKB 3VA7A 4YJ2F 1KJ9A 2W71A 3MWEA 4Y8VB 4O81A 4O7VA 3U55A 1OBDA 2X0SA 2YRXA 2NU9B 4FFOA 2W70A 4I4TF 3E5NA 4HNUA 4M98A 1C30A 1Z2OX 2W6MA 1GSAA 4WD3A 4O7RA 1M6VA 4HR7A 4O7ZA 4FGRA 2W6OA 3HB9A 2ZDGA 2I80A 2J9GA 2W6PA 2R7MA 4TV8F 4EAAA 3SE7A 4FU0A 2Z02A 2V59A 1GLVA 4MV8A 4ZOLF 4O4IF 3ETHA 2DWCA 4FE2A 3VPBA 4ZI7F 2NU8B 5LP6F 1I7NA 1DV1A 1DIKA 5BMVF 2R87A 4IHJF 2IP4A 3U54A 4TV9F 3K3PA 3VOTA
chains in the Genus database with same CATH superfamily
3F96A 4HQOA 3ASVA 4L6AA 3DLTA 4ZRDA 4JI0H 2V97A 3N75A 3Q6MA 3UHJA 4E30A 4EY5A 4NV3A 3H40A 4MDYA 1U8AA 4EF4A 3SVTA 1G20E 2V3VA 4YAIA 1UZNA 4XJTA 4LXUA 1E6KA 3BKXA 5HQJA 5K3SA 3T3NA 2MU1A 1DPGA 4EHLA 1QIDA 1G9XA 5TQ0B 2O6HA 3C8UA 1SIUA 1LBHA 4YAWA 1SKBA 1FFDA 4XGQA 3O8LA 3FCCA 4KAJA 1SWVA 3P52A 1J8DA 3TDKA 3R3UA 1IOWA 2NV2B 2BSAA 4GPD1 4HB2A 2P77A 4JYMA 2HVSA 3IURA 1KJWA 1Q12A 2R5FA 1CEQA 5A9SA 1T8UA 4WXHA 4A3KG 2D1FA 3SG0A 3HXMA 1OI3A 3ADBA 4A16A 1E6WA 3U4QB 4W7SA 2J07A 2GN6A 1NUHA 4MRMB 4E7OA 4UZSA 3I8OA 2ILVA 1RAEA 2PX2A 1X0VA 3K20A 3KYIB 3HFJA 3LBIA 3ZXYA 1ZVJA 1D0SA 4H7JA 2PBFA 3KVVA 5I4IA 2HBZA 1U2DA 4GXTA 1CUDA 4HEA1 2QD3A 2WAMA 4Y9RA 4Q44A 2ZS8A 2H4XA 4MDHA 4A8JC 3AR6A 1FP4B 4L3OA 3TRIA 1BGVA 4WNYA 3THWB 3HGQA 2FK3A 16PKA 3VR6D 1K5HA 4ZPXA 5JAPA 4M3NA 4HI0E 1OLUA 2GOYA 2O2DA 2RGCA 4F12A 3NDIA 3GAZA 3VGJA 5IU6A 5C7LO 4RY0A 5ADUS 1JFLA 1B0ZA 3KKKA 1NOJA 4Q4LA 5F2EA 2WJHA 3PJRA 4ZODA 2Z2IA 4UUNA 4D9IA 1KI4A 4CC5A 3RUPA 1DJNA 2OAEA 4HXEB 1P9RA 4AMUA 4Z7NB 3OCYA 4C6TB 4Q4HB 4I1PA 5BV8A 4FEAA 4PM4A 1GKYA 3RWBA 4GGOA 1YI0A 2GARA 4AXXA 1SXPA 3F5FA 5JYDA 2C00A 5F7XA 1QGED 4M0CA 4NU5A 2CY0A 1GFWA 1MQAA 4O3OA 2DR2A 3RPEA 3IQEA 4XQ0A 3O2NA 3IVAA 1PHRA 4YRSA 3BEDA 4RV9A 3N40P 4C05A 3KTFA 3KR9A 1LDBA 2ASLA 2GM9A 1QIMA 2YIDA 3D5QA 2FTKE 1SCJA 2Z8ZA 1U3UA 1ZVMA 4MHTA 3TLYA 2VBGA 4BEBA 4MVJD 2VRCA 4MQBA 4UUBA 1QVAA 3PFGA 4OKIA 1MW9X 4O3MA 4IQGA 2VYNA 1SCKA 3G2IA 1BJKA 4MR7B 4JI2B 4P5EA 4RY9A 1I2LA 1F4LA 2BKXA 3CRMA 3GEBA 5EY5B 3CNNA 4PTLA 5C2JB 2O3QA 1KYVA 4JWKA 1H1DA 3WR5A 4L3WA 3K6SA 2GA8A 1YAJA 3KJZA 3DEYX 4WI1A 2CXQA 2F1KA 1M34A 5KVVA 3TTVA 4IIFA 3GJTA 1L8AA 2I6XA 1YGPA 1VSUA 3OTQA 3EHDA 4YO8A 1OHHA 1RYDA 1XNRH 3BWDD 2H63A 4EVSA 1PS0A 2VHEA 3TW8A 1EFPA 4J9PA 4R1QA 2O2ZA 2X4LA 1SBNE 1W0CA 1EIZA 4AQDA 3U5ZB 1SC6A 2PAAA 1X7ZA 2IQIA 4Q19A 2WV7A 4MVJG 2ZRMA 1KOJA 2FR1A 3SHQA 3VR3A 4TS4A 4NEGA 2JGNA 1Y8QA 4NBNA 3OUTA 4B81A 1W36B 3LZ6A 3T5PA 1E6MA 1G8FA 3E5NA 4IJQA 5DRTA 2DHQA 3FPKA 4BJ3A 4DV0H 4R2IA 2VO1A 2OXFA 1RK5A 3A7DA 4BQFA 3JR3A 4QTXA 1AKNA 5CBPB 3NV7A 5HIJA 3CVVA 4H59A 4O8ZA 2FMUA 2ATVA 3ZHQA 5A1TA 5ECDA 1X8XA 2H29A 4R9VA 4W5QA 2ZROA 3TD2A 3PXDA 2W2MA 4ZI3A 4KLZA 5KI6A 1UC8A 2WLSA 4E09A 2P1ZA 2Z6VA 1BXGA 1EFVB 1U0RA 2JJ1D 3QV2A 4A3BG 4QUHA 3W1BA 1VHWA 3W8RA 2V7PA 1IOVA 1XU9A 3G1TA 1AURA 1ZN2A 5KJEA 3ESBA 4RCYA 1U5BA 4M1KA 4DR3H 1C3XA 4AJPA 2C1XA 2IYRA 4OQDA 4LTNA 3OFNA 3KX2A 4B84A 1IMJA 2VPQA 2ZRPA 4RWEA 1NNI1 5JFOA 4FB5A 2FGJA 1ZCBA 3CUKA 3PENA 5KNCH 1WLYA 4BNDB 1T8WA 4Q0MA 2IYOA 3E9NA 1VCNA 5JCOC 5H80A 1JWLA 2PSDA 1SCDA 2O5CA 2G09A 2RH8A 4EG1A 3AVYA 4F8YA 1OXKB 1W581 4MVJF 1GNVA 2ZBPA 3UMSA 1E4EB 3ZE8A 4KR6A 1JTFA 1O58A 4UFZA 5KG0A 4MUGA 2XE7A 4KW7A 4CLRB 3HN6A 2ZIUB 1L7BA 2C8JA 1V7PC 1JQ5A 4AF7A 3C3MA 3E82A 2VP6A 4AS3A 3VYWA 1H8ED 1TYCA 4Q34A 3T5CA 3EGEA 3SHOA 3CZMA 1QG2A 1QQBA 2WTMA 3SEZA 2M2IA 4CTMA 2DR3A 5KFFA 4INJA 1GZHB 1S2GA 1M0SA 1AIPA 1FKAH 1JKJA 1VPDA 1YFZA 4HZUB 1GR0A 5MHTA 4DEYA 6LDHA 2OZEA 5TPZD 4GMFA 1XTUA 4MUJA 3W05A 4PRZA 4RQUA 4TSRA 1FBNA 5K3BA 3ZWXA 3G6XA 1PJLA 4I50B 3WRVA 1DWQA 4GPAA 2QG9A 2YZKA 3DP9A 4WH0A 1FVHA 3WLSA 4PFQA 9GPBA 2WAXA 5B58T 4FP9A 4EY3A 1UKYA 4FN4A 3PFIA 3KJHA 5J4HA 4R5HA 4F5ZA 3RJ0A 4UHDA 4DW8A 1CC1S 4U0JA 2J5QA 2ZIAA 1DP4A 2J45A 5LYJA 1EK5A 4NARA 2O8FA 4YBZB 4KVFA 3J81A 4JLUA 3DV9A 4WZBE 1Q3HA 3U9TA 2N3ZA 1XZNA 3AW9A 3TUJC 2JFXA 4EPVA 3KM0A 2BRUC 5B3KA 2ZYWX 3IJEB 3ZXUB 2CNLA 2QW0X 3TTYA 4BMXA 4RA6B 3VUFA 2C8LA 2PCLA 4OB6A 1N3IA 2FDXA 4MRRA 2YN0A 5DYWA 2WFZA 3JW8A 1RE1A 4C14A 3K53A 4RC9A 2ZCUA 4NMXB 3UXMA 4LTDA 3HA2A 3PFFA 4LUCA 4EMTA 2Q9BA 4DAOA 1ZSNA 2PWYA 3GIQA 5DXFA 3SX0A 2O8EB 1DHRA 1KE2A 5EKSA 1XGKA 2I6GA 3WLNA 3EIOA 1RM3A 4AKHA 3ZNPA 2ZWAA 3ELDA 1AT1A 1IVNA 2W48A 1RKBA 4QG7A 3TUZC 3F6CA 4ONEA 4U6QA 3M3PA 2X0NA 3QKUA 3JWHA 4RMGA 4DSOA 3S28A 5JNLA 4YJKA 2DEUA 2BZ0A 5JYCA 4DLNA 1VJ5A 2HWWA 2D2IA 3C0FB 2A86A 4XCXA 1UC9A 2DQZA 3WGVA 4LZOA 3DOCA 2HCJB 1ZOOA 5ALQA 2QPOA 4PSCA 2FPMA 2OHJA 4A0RA 1OILA 3PFKA 3GTJA 1XWWA 3K92A 2W8LA 1EKPA 1E9DA 5LMUB 3I64A 3C7KA 1GSAA 4QUBA 3D8BA 3UC5A 4FMCB 4GOMD 4BLQA 4QIWA 2RD2A 2XDQA 4MHOA 2E9SA 1JIHA 3VPBA 3OFSA 2W2QA 1NG9A 4XGKA 3RM3A 5JDCC 4EYGA 5JQGF 2ZJ6A 1QQ7A 3QKWA 1FLVA 1UPTA 5DP1A 5IARA 1JIKA 3ZBTA 3JRXA 4P0TA 3T3OA 4G56A 3GDHA 4JUCA 1YKSA 1QGAA 3FSEA 3TPZA 2VA2A 1IEQA 1XRJA 5LQKA 1WR8A 2IIVA 4CCYA 1QRAA 1CZOA 3BCHA 3LX4A 2ZUTA 4GZLA 1OKKD 4GOJA 5FLYA 3ENQA 3GY0A 2BUCA 3LGSA 4GFDA 5L45A 4MS3A 3V7FA 2JEOA 1ZPDA 2WSYB 5JSUA 3BFXA 1VI6A 5CDYA 3HBLA 3OKPA 4QOEA 3TQQA 5BOSB 1I9GA 4GNRA 3L02A 1K63A 3EWIA 4BNVA 1XO1A 3OO1A 5JAZA 1E58A 1AQUA 2GJ9A 1XEWY 1J6UA 2OENG 2QV0A 3RV4A 3AV0B 2WSLA 3H0EA 3FDIA 1HI9A 3DBLB 3MAGA 3CT6A 1PK9A 3A31A 3R5JA 3A3YA 4FGLA 1T26A 1Y6QA 3STXA 4V0OA 2UZIR 1N5LA 4FW8A 2XVYA 2WMOB 4ED0A 1GV1A 1MB4A 4C6SA 4OX9Y 4U00A 4KX5A 4Y2YA 2QVGA 4OK3A 1GO3E 3WISA 4OHUA 3TGWA 2JIMA 3ZNOA 3B70A 4MWCA 3TAUA 5NLLA 2AN5A 5F5LA 2Z8YA 1ORVA 3USES 5EJ6A 3P94A 4ED6A 3D6AA 2B25A 1AUQA 1YUMA 4TVBA 3WGUA 3GJSA 3IUBA 3KHSA 2V9PA 2KSWA 3GN1A 2ZYSA 2VSYA 3EK2A 3SF0A 4X63A 5FOVA 3ITEA 4F97A 1TCUA 2FNAA 2IS4A 3CUTA 3BHNA 4ME6A 2WT8A 1RQ7A 3F6PA 1IG0A 4EX6A 4LBVA 1KQNA 1Q7EA 5K0JA 2E4XA 1AZSC 2OQRA 2B4RO 2FE4A 3LY9A 1CJCA 2GAAA 4LOKA 4CKCB 2VYQA 5K0TA 2CEAA 2IU4A 1BGXT 1LQ2A 1TVMA 5ECGC 5LYYA 3I83A 2VUMG 2FUCA 4BB9A 3BHJA 3LC2O 3UC9A 3GUVA 2OCPA 4BNTA 3KEGA 4IL5A 4JLKA 3C6YA 4IWXA 1X3SA 2R1VB 3I58A 1LPPA 2CE2X 4MUNA 4FDTA 4BWFB 1EHCA 4S2UA 3TFWA 4RIFA 1E7YA 3OQIB 1RJQA 1E4GT 2EJBA 2Z1MA 4BDSA 5AOCA 1U3GA 4RAQA 4MA0A 1FBTA 4QVIA 4NHOA 1W4AA 1NZDA 2XB8A 5EJ2A 4IV0A 1A5ZA 4AMZA 4BU0A 4PN7A 3DAFA 4QLBA 1NJ8A 4PY2A 1SC9A 4E2ZA 1PS9A 4OXNA 1DC4A 4WLEA 4NFYA 5HK8A 3I01M 2AJDA 1T8SA 3PW5A 3MELA 3N2ZB 3K6JA 1W4RA 3SM9A 5HNKA 4IQFA 1QTNA 1SBIA 1GUFA 5L4SA 1DHTA 1K2VN 2W6ID 3SS7X 3QVOA 5EEGA 2CXTA 3DMYA 2Z3WA 1NUTA 4PBRA 3OPYI 4ERNA 4J4TA 4BRUA 1XTZA 1R8JA 1O7JA 1UJ5A 3VJKA 4I5EA 2D59A 3LQKA 1KIMA 1GNTA 1T43A 3Q6IA 3P9RA 5DQHA 2IMWP 4XR4A 2H85A 3FVWA 1DTSA 4RK5A 4CI0B 4CFZA 4HNUA 1P0PA 4CMEC 3GFRA 4CCSA 3LHFA 4XB1A 2C77A 4B6SA 3FKIA 1QG6A 4J1SA 5EWJB 1Y4DE 3OIVA 3K2QA 2XGSA 2IEZA 3JY6A 4JBGA 3G8YA 4XWWA 4ZAYA 4B6JA 3G0HA 5BNZA 4NU0A 4D4JA 3DLCA 4ZOLF 4RZHA 2J85A 5AW3A 4N03A 2EBFX 4BFLA 5CH3A 2KB0A 4F7WA 1RPZA 5KJ6A 2CK3D 3JQCA 3L6EA 4FCWA 1WL8A 4RZRA 4IUYA 4ETWA 3V4FA 1RC0A 2C7GA 3W8DA 2WK1A 4HDAA 2GNPA 4EPYA 1ST3A 1XOIA 5EWGA 1EVLA 3NNDA 2HADA 4I4NA 4AECA 5BWXA 3FZQA 1ADBA 2ZJ7A 2HDHA 1BS2A 3T7KA 3KTDA 2OGSA 1YDHA 1Z4JA 2OORA 3OP4A 1G3IA 2P5TB 5T6MA 3ZU3A 4QRHA 1QUEA 2F90A 4IKEA 3AL3A 4MTDA 4MLZA 2B63A 1CEEA 2H5LA 2GCGA 2YYZA 1JEAA 2X9LA 1NQAO 3DO6A 2J3MA 1KK1A 3FYCA 4PPQA 4J0QA 3R0JA 3REQB 3NTUA 1DDGA 3OZRA 1K83A 2IP1A 4RNDB 1L5OA 2WIDA 4UTZA 5FORA 4GLOA 1UFOA 3JASA 3NBMA 1XL0A 1Z8DA 1NP3A 4JSTA 4BUJA 3JATA 3RYCA 1ADYA 1Z0JA 3DKVA 2HCRA 4X3PA 4PC2A 3QUQA 3AF4A 5LQDA 2R6AA 4B3RH 3B13B 1G291 2BM0A 3PNQA 2ZKIA 1M7GA 3V1TC 1R16A 3UJ8A 1M6YA 2IUUA 2YQ5A 821PA 1PUIA 5THQA 1M2WA 3GG9A 1U1DA 1ID1A 1Z5OA 1AKVA 2BFFA 3COZA 2VDJA 4W99A 1P73A 4GKJH 3VC7A 2OG1A 4LJ8A 2JA7A 3IMFA 1AGNA 3NGXA 1PGQA 3K9HA 4MV7A 2P1RA 3SBDA 1OX5A 1I6LA 1X7YA 3EGCA 1U0OC 3TFOA 4RD0A 3WJAA 2COGA 3Q1KA 1Z4IA 4EBFA 2P9EA 4A2WA 4OBWA 2IUEA 2X0RA 1XWIA 3A6ZA 3EMVA 2ALZA 4RESA 4M0MA 2A0WA 1WQ3A 1SXJA 3LZCA 5KVSA 4IIJB 1QONA 3PP8A 3UJ7A 2X77A 1V1RA 3CF4G 1NIJA 1Y9EA 4BY7G 4P7GA 5J2TF 1N57A 1TFRA 5CAEB 3A1VA 1X80B 1VDMA 4UAJA 3GMTA 4ADSG 5FLEX 3ITDA 4JLNA 4E14A 1VJTA 1G18A 4H0FA 3PUJA 2BEWB 2QF7A 1O0CA 3OHPA 3CGGA 1WXWA 3KJNA 3TCXB 4S04A 4F6CA 2RGVA 2CUZA 3ZD8A 2QMEA 3L84A 4X24A 1KAEA 4JC4A 3FCXA 3T54A 5J1TB 2UV8A 3F2IA 2CHUA 1P18A 2FP4B 4GMGA 4E15A 3GYBA 4U7DA 5BRNA 2HHAA 3UK0A 2X0FA 3S44A 3M70A 4LI3X 4JAVC 2OHIA 3RTAA 2GEVA 4ENSA 2G77B 3TG8A 3KPYA 2IC5A 1GTSA 3QQ5A 1TYBE 2OILA 4BFTA 1TFUA 3OX3A 1M6VA 2VHJA 2BGMA 3DKIA 1CY7A 3DMDA 5BWBA 3GLHE 2APJA 1GU7A 5REQA 4WRRA 4ED3A 3VSBA 5JLJA 4I3GA 4LRXA 4A1OA 3PHCA 4TTIA 1T6YA 2NU9A 3WAGA 1H8HD 2ALJA 4MW2A 2R8ZA 1DV1A 3VHXA 4N5HX 5BMVF 2GXSA 4ON9A 1ZZGA 4JGBA 4PS1A 4XI9A 2PKQO 4G67A 2ENWA 2Q3FA 1X1CA 3JAWA 1ISFA 4ZI7B 4XJSA 3J7AK 1PO7A 4LXTA 2GHIA 2W9BB 4YV7A 2CHVA 1RXVA 3QH4A 3DE3X 3IBYA 2YH2A 4WQMA 4UCVA 3K0HA 3NIFB 3PITA 5HX7A 1Y98A 4B31A 1O3YA 1E0KA 1UODA 2W00A 2UUAB 3MF4A 3RYHB 3N8IA 1DEKA 5B4UA 3BA8A 2Q8NA 2M1XA 3HDTA 1O4VA 4KXLA 4JUFA 4RL4A 3UJ6A 1ZU4A 4NOKA 4HLDA 2V0GA 4M9ZA 3B5JA 4EJ2A 1CK4A 1WY7A 1NN3A 3WMEA 1SVKA 1DQZA 3L6BA 1OBFO 4QWCA 4BYGA 1YJQA 3WO0A 3DLPX 3WFJA 4KO3S 4DLKA 4JQCA 2FW8A 4MVJI 4A1FA 1M9NA 4HMPA 1QQTA 4B4UA 4JEIA 1GAWA 3SR4A 1ULTA 4BMSA 4UDXX 1AKUA 3FNIA 3X3HA 2PMKA 5LDHA 2HJGA 3K1JA 3LXRA 1V9LA 2G28A 2R8GA 4DR5B 4BN4A 4C7JA 2ZB8A 3HHPA 5E9WA 1E2DA 4YMLA 4JI6B 2DUMA 1JWBB 3HN7A 4X62B 3VDRA 1ZN7A 1WZCA 1X1EA 2AVDA 1JMVA 1IN4A 1I7PA 3BXZA 4J9LA 4EW3A 5GVRA 3DE4X 2FLNA 1MB3A 4I4CA 3EVEA 2G4VA 2WA1A 5EIXA 2OOSA 4JP8A 2J5XA 4WT7A 1OD6A 3JD2A 3V6HA 1RRMA 1F48A 1A9XA 2R8HA 2C5FA 3BIWA 2V7TA 1IMOA 3H2HA 2V4MA 4G0QA 4MHSA 2IXGA 2XLBA 1ML4A 5KYUA 2FZVA 3IDQA 3U1VA 3HH8A 4U63A 3V7NA 4EBCA 1TA8A 2CCGA 3R4CA 2B9VA 2PJDA 1IBLB 1K7EB 2NZ2A 2A7QA 1E20A 2X4IA 3N28A 1MO2A 1DKUA 2VJAA 3CRRA 1O6FA 5TARA 3LYLA 2ONKA 5AXDA 2ECQA 4U2GA 3GJ5A 3PEWA 1QZUA 1QK4A 1A2OA 2B61A 4TM7A 5E2BA 3DTVD 3BE6A 3W2IA 2DFLA 5JSHA 4YUWA 3QELB 1KSHA 1A7AA 4HUTA 2QZ4A 1JQEA 4EEQA 2XVXA 1R5BA 1JVBA 1GGJA 4N5DA 1MT0A 2DGDA 2WPDD 4AF6A 4IDPA 2XSZA 1N9KA 3MRSA 3HXOA 4KGDA 5CUQA 5B55A 3BWBA 3CZQA 2HBYA 5BWUA 1G38A 2A0YA 1E32A 4Q3CA 1BFUA 1BQEA 2XXAB 1DTEA 3PDUA 3G7SA 1UPAA 3M83A 2G04A 5K3EA 3L8FA 3V3TA 4ND1A 2P3OA 1NA5A 4F6RB 2EWWA 1G6Q1 4ITRC 3QF4A 4ZCSA 3PPIA 5L3SB 3HCWA 3SNHA 4ZFNA 1DVRA 4UPDA 1RKUA 1T9AA 4NG4A 5F73A 4CC6A 2ZTMA 4JDPA 2IGTA 4N3CA 1HO3A 1A0OA 3C1UA 1C41A 4FSHA 3AUUA 4KYTA 4B7ZA 5FD6A 2YV1A 1UR5A 5AI9A 4BMNA 3RKRA 4ZAZA 2BUAA 4I4TF 3G9ZA 3GFPA 2UZ3A 5HKKD 1YCGA 3S68A 2HJVA 3ITKA 4CHTA 3J81k 4A0SA 3OF5A 1PJ4A 1P74A 1RIIA 3JWJA 3IOBA 1C3OB 4RPJA 3QEKA 3VVBA 3VAZA 3IAUA 3LFTA 2R6R1 2ZSJA 4WJZA 2GBLC 2JKZA 3L0ZA 1ZJ4A 4GZMA 1M3SA 3VOSA 2UU9B 4YFYA 3EAGA 5DAAA 3F46A 2UYOA 3R7BA 2AGVA 5CX4A 3F73A 4R2WA 4KQWA 2CSXA 3N58A 4YROA 3LD9A 2C3MA 4M1TA 1Q15A 1RXEA 4EG4A 2HLPA 2HCBA 1Y8CA 2OL4A 3U7EB 1M1YB 4DMCA 4MRSA 2J4DA 4AURA 1IZ8A 5HF9A 2DZDA 5C8VA 1KEEB 4Z7JA 2WTFA 4ZGBA 1H2ZA 1NVDA 1C0EA 4YRDA 3RS7A 1U94A 4Q1BA 2HA7A 1GPAA 1W36D 5DWQA 4UAGA 1MC5A 1PP4A 2VCEA 2EKDA 3COYA 1P4RA 1FTSA 2PIDA 4XQCA 4UAUA 2OA0A 3BHIA 1FUEA 121PA 4B2LA 4MLCA 1UZMA 4FT2A 2GEBA 3W1EA 1E2PA 1O95D 4R9UC 1AHPA 2YDXA 3VNBA 5KHLB 3B82A 2XTMA 1TM3E 1YL6A 1UMKA 4RETA 2W6NA 2QZ9A 3E9RA 1XEXA 3P2OA 3THXB 1E1CB 3WE7A 2ACWA 3C43A 3B1JA 2XQVA 2OD9A 3TIVA 4N3NA 1GL3A 2ZYRA 4DUYH 4K9DA 1H23A 5I9TA 3N07A 1GL7A 1OH5A 5AW0A 3I2KA 2ZSFA 5IWAH 4D1YA 4KQ9A 1BROA 3R44A 2OB1A 1CS0A 4X91A 3PYXA 4CTJA 1L7XA 4MQ6A 1KFBB 4CDNA 4JL5A 2WF6A 1S0UA 4PCAA 1L5ZA 3SCZA 3SXPA 3L7IA 4X65B 3GT4A 1J8MF 5H83A 1K66A 1EZZA 3INTA 5JBIA 4GR4A 1EJ2A 2Q6IA 4OQLA 4MGIR 3I28A 4BMOB 1VKNA 4BO3A 3TI7A 3GCGA 3SX4A 3ZU6A 3PTLA 2WWYA 1QE0A 3WLLA 3O38A 2WJIA 3P9ZA 5T8KA 1KF0A 4X1YA 2WT9A 2ZM5A 2AZMA 5CPBA 4HAXA 2JKVA 1BX0A 5L53A 5E38A 2P2NA 3L8EA 4MMZB 3D31A 3F9RA 4DUGD 2H16A 3TRFA 1FUUA 3S6JA 1V51A 1RHQA 3TW0A 1Q7GA 3KVNA 4ZRNA 2E4ZA 3EWAA 1G21B 3E7XA 3A6DA 4UZEA 3FUWA 3EGWA 3LPLA 1EUDB 3ULKA 3MILA 3DQPA 2RHHA 2IY8A 1OBVA 2QI9C 3FLAA 4UXHA 2GCOA 1UBCA 1MH9A 3SJZA 3UUFA 4KDRA 2OWOA 3HBNA 4DR1H 4O7TA 4ZOEA 5FUVA 4FBMA 1PQPA 1H1LA 1JECA 4DL9A 4IINA 4IBOA 4UFNA 4NP6A 3TG2A 1ACMA 3FGPA 3QPDA 4IUBS 1EHYA 2Q3LA 3ZY4A 2EWMA 3QXXA 1TA4A 2REOA 1NBAA 1I4LD 3PLAE 1JQ3A 5IH3A 4G1MB 1QKIA 3QVUA 2I7DA 4MUIA 1YUBA 3GYGA 3USZA 3PUVA 1N5DA 3EZ9A 3GDFA 4YRIA 2MSWA 1GGNA 2BM8A 1S03G 1KJ9A 2QRJA 3ONNA 2F67A 1DKLA 4R0VA 3K0FA 3KYCA 1I1LA 4RZUA 3QUTA 1J5XA 1WCIA 3Q12A 2VT7A 1PT6A 4ZVMA 4UU8A 3EPPA 4KDEA 1UEIA 1O1YA 1IN7A 2ZQ5A 1FMFA 1SHJA 4RULA 4HX5A 1L7DA 3U0BA 4B3SB 1AY0A 3HO6A 4YXWA 4LDAA 3HKBB 5DM1A 4O4LA 3ESRA 4RHUA 1OT3A 4W5TA 4MB6A 4YCMA 1KDOA 1FMLA 2EX1A 3SVLA 1WB9A 3E81A 5FLKA 1RPNA 4ZYVA 4A3FG 2JFPA 5ILOA 1PBTA 3Q8SB 5HF5A 3SLKA 2ZYDA 1QYWA 1PSWA 1HFEL 3O82A 2FRDC 3E2MA 1XR3A 4JJEA 3GFOA 3D81A 1I7DA 1EQUA 3GTOA 2PGXA 3B9QA 5ADVA 1MNQA 4FZ3A 1UMDA 4OATA 4DT1B 5DGDA 4KODA 1OR8A 2AC2A 3IT3A 4O84A 5DSTA 1VP9A 2PH7A 2OHVA 4IHQA 4F9TA 4V0NA 1QO0A 2FPRA 1SVOA 3GLTA 3OM0A 3QFTA 3IA7A 2HJHA 3SYNA 1WCMA 3SZRA 2X9VA 2W0SA 3FDZB 1QFJA 2XT6A 4B34A 1LFDB 3VYTB 5AIAA 2OLJA 1WSCA 2QX4A 2VDMB 4ZT3A 1AQLA 1DRKA 4C4PA 1C50A 4DR6H 4OYYA 2UVUA 1NI4A 2OO5A 1VCHA 1QVRA 3IULA 2J3KA 5BNWA 4Q6BA 3RV3A 2E6KA 4I50F 3HSKA 2GERA 2HWXA 1U31A 1QZ3A 4IO1A 4UEWA 3INNA 3OIGA 4RHTA 4RM2A 2B35A 3VI3B 2G4LA 2HPZA 5LZ5A 4HQKA 3GLVA 5TPWB 1CF9A 5GAJA 4LF9B 2A5LA 4PX5A 4TUYA 4US2R 1CXZA 3MMXA 5KFQA 3GLGA 4OYHA 5LA6F 2P9QA 3S1SA 3TSAA 1D09A 2ZLBA 5ALPA 3UA3A 1JHYA 2P9GA 4V1CA 1E9BA 3GBVA 3T9CA 5AI5A 3KTAB 3AETA 1SVNA 3GQBA 1QF6A 3SD7A 5BN5B 1P31A 1ZN9A 5EERA 3MRTA 2XYHA 1OXMA 1SWWA 3QJ5A 1SBZA 3GEEA 1XCBA 4IR9A 1QS0B 2NNLD 1M8FA 4HAOA 2REXB 4N6GA 2KWIA 3A1UA 2OKCA 1T10A 4FLFA 3RTBA 4G65A 4ZARA 1RHUA 5DN6A 3KKNA 4IIEA 4F04A 1EQ2A 1TUGA 4AW9A 1YB6A 1WETA 1AV6A 4QBIA 1JE1A 4Q1CA 5HGJA 1NNEA 2DABA 2QENA 1ZQ7A 4R8LA 1CJVC 1EJBA 4BBJA 5I9BA 1E1QD 1E3IA 1EAMA 4HV4A 2CXNA 3AERA 4KMSA 4L8GA 1OIXA 1PYOA 2RCNA 1F7VA 5CCXA 3V4PB 2FEMA 4Z4GA 2PLFA 2M6SA 1C1DB 2WP0A 3ZK8A 3TYXA 4LQCA 3C85A 1RI5A 1WNFA 2HQBA 1AS0A 1QR2A 4DNFA 5EUQB 1KO1A 4L75A 1EGVB 1HV8A 3TCKA 4BQQA 1YRYE 1S0MA 4QUKA 2I7TA 4FMCF 1W29A 1NMYA 5IXYA 2H8KA 2XQGA 2IEBA 3E18A 2FU5C 1XQ9A 1QR6A 4R8UB 3U9LA 4XDYA 4G4JA 4F84A 5HIMA 1L4FA 3NETA 2O3UA 3IHKA 1NRJB 3MGAA 1Z63A 1EESA 5DLEA 4RF3A 2VQ3A 5L1KA 2AOTB 2FE3A 1T2FA 2Y66A 3EDRA 4YCJA 1WXXA 1SIOA 4J3JA 3ZD6A 1LB1B 3GIPA 2ODBA 5AVWA 3H5AA 2G9NA 1JSXA 3OOJA 2IEGA 4O4IB 3NBZC 3PNSA 2GPNA 4BYMA 1SG0A 4GZ6A 3GVXA 4O1IA 2RHBA 3CPHA 1GWNA 5DPMA 2O23A 2UVQA 3OM8A 4BKRA 4JJ6A 2ASVA 1LX6A 1BA2A 5BWMA 1YD7A 2WFLA 2QKYA 3ZXSA 2PFGA 2J31A 4DMMA 5KS8A 2YHIA 2F64A 3C1AA 1VLLA 3CRNA 1QKKA 2EW1A 4YT4A 4UM9B 3GRPA 2A92A 2HREA 3GU3A 5JBQA 2DYKA 3EXIA 2R8JA 4PDBA 1OU0A 4O4HB 5FFMA 3FOBA 2J4FA 3VI4B 3LXXA 2OBNA 2ZE7A 5KO2A 2ICAA 4JKYA 1OXBB 1NM5C 5AI0A 4NMWA 3E6AA 5BUZA 1K2WA 1T3HA 4FZVA 1CRPA 3ENWA 3KXPA 4RLQA 3LM8A 3LWZA 3WGYA 1UOPA 3G2QA 2F59A 1F8YA 1U9JA 2SCUA 2VH1A 3LQRA 2RBGA 4PQRA 3PL5A 3KJEA 4M0EA 4Z86A 5EPUA 4LFBH 3SZMA 2NP6A 3DLBA 2GN4A 4H3VA 1TM2A 5ALTA 3R3ZA 3PHBE 4BTLA 1PJ2A 3UTCA 1IN5A 5DNUA 5HUHA 3RJ9A 1ZIXA 4M46A 5TR9A 2PZAA 4FHCA 5LP1A 2O0JA 3FUVA 4PWQA 5CBKA 2G7MC 4D81A 3OG9A 3O8BA 2WILA 1NP7A 3F8WA 3DTYA 4N54A 4LJRA 2JFOA 3HKDB 1TU4A 4RV4A 3W6UA 2PMCA 2ZTLA 1NBMA 4ZYYA 3L8CA 1E0JA 3W6ZA 4U8HA 1CNFA 4Y2JA 5EIAA 1JAYA 1GCAA 4AUKA 1I0ZA 1E96A 3IUYA 3QRWA 2X5OA 3FY4A 4D45A 4RXMA 1S2OA 3HSYA 2I62A 2QUJA 1QFXA 2W11A 3H5OA 1JDPA 4RMNA 4MMXB 5J3JA 3BFPA 3GIWA 3L1HA 2JIZA 4AT1A 5THKA 5AVJA 3JWPA 4FJ2A 1QOQB 3U48A 1VL2A 3OVMA 3QXHA 1QPGA 3QLJA 4UE3S 3QGMA 2DLDA 2J1LA 5E4YA 3KQWA 5INTA 1L4MA 4JUIA 4YT8A 3L6OO 4HATA 3L4BA 3I9NA 4PQFA 3ZHZA 2NZXA 4AXBA 4XWGA 1DQNA 1H6AA 1ZM4A 3C8HA 2OHXA 5IYBG 3R5HA 1DC8A 3M33A 4UHBA 2J9FB 2HQRA 2KX7A 5FX2A 5FJJA 2QZPA 2XUPA 2OT3B 1SBCA 3FUTA 2JIRA 3HCEA 1J20A 1X70A 3PNVA 4PHTA 2EW2A 5T57A 2UVWA 2H1VA 3H13A 1H6BA 2H52A 3K2BA 2QL6A 3DDHA 3PHLA 1RKVA 3WIUA 1GIAA 2XXBA 3KOOA 4OHPA 5CPFA 5JQWA 2A4MA 3FWNA 4MUHA 1ONNA 5A3VA 4V24A 1JFFB 2C0QA 3WLKX 2ZJ1A 5AH0A 4ZAXA 4G89A 2I1WA 3OAAD 5A6VA 2IDMA 1ZCJA 3FDFA 1DBSA 5D01A 4H7EA 1KJQA 2EP8A 2W71A 3O3MB 4QDJA 4ZI5A 3FKSD 4HNRA 1UINA 2B8WA 4CKZA 1H2HA 2W2TA 3MJEA 1TTQB 4B3DA 3LQ4A 4G81A 4D98A 3ICPA 3KQOA 4KQ1A 3DO5A 1DBQA 4ENUA 3VZBA 3PKZA 5HS4A 4GC7A 1WPXA 3AHFA 3CWZA 1XZBA 2PMDA 3NUQA 1P6QA 3JAKB 3PX7A 4Q16A 2Y76A 4RYDA 1R5NA 1CZNA 4H27A 4RHYA 4EPRA 1K7CA 1MTOA 4FYVA 1ZGBA 4QUJA 1B7GO 3L2PA 1S10A 4BWYA 2VP9A 1IN1A 2BFNA 2OZLA 2MWMA 4X8OA 3X1DA 4UTPA 4NXMB 3QBTA 1XTSA 3QVXA 3OZXA 4L5CA 1CY6A 5AKGA 3GRVA 5FQOA 4E6EA 4C88A 1Z8HA 5LP6A 3LY8A 4L9WA 5E9JA 2AN3A 3URKA 1L2ZA 2VJBA 4FYPA 1DJPA 3HABA 3V4OA 1R66A 3NALA 3BMNB 3ODGA 2PL9A 5D3KA 1JDNA 5F4BA 4AUEA 1P1CA 4XZ3B 1XRSB 4F46A 5CFLA 4BX8A 3R77A 2ZRQA 4D3FA 3EWNA 1CQIB 4RD6A 2QL9A 3GLFB 1RAAA 4HAVA 2OCYC 3E7PA 3WGLA 4LVOA 4EG0A 4MZXA 2WHPB 5GIPE 1SD1A 4XKJA 3OE5A 3IEPA 1M33A 5HUJA 2FJ0A 4E21A 2J08A 1VHLA 4IJKA 3Q2OA 3C6ZA 3HKCA 1E5DA 3D8SA 5A4KA 4TN5A 2R8RA 2Q1YA 1ZGGA 2GO1A 4AKEA 2AFIA 1RJWA 1AKRA 1WDWB 5AOBA 1E2GA 2PX6A 4HZGA 2CUTA 4YDSA 3ZX4A 1CUEA 4PVDA 3RWOA 1ZLYA 1TVKA 1PEKE 5CM0A 4C5CA 1BEUB 3DZCA 5IM5A 4OA5A 1W49A 5LUBA 1TAUA 1V1MB 5FO1A 2QS9A 1Q50A 3ANXA 1NURA 3A6KA 4NE7A 4UEQA 3PZPA 3U3MA 1XZCA 4BVFA 4A2PA 3RG2A 3KZCA 3RSOA 2Y05A 5KFUA 4RD4A 4E2YA 1TTPB 3GN2A 4XYMB 3IUNA 5KPJA 1AGRA 2ZREA 2EC5A 4JI3B 1ZAKA 3ABRB 5G02A 2QTGA 4R98A 3A6HA 1G7CA 2Q5CA 2EKQA 3K6KA 5T4BA 1E3QA 3MT9A 4DLUA 3ROMA 1VBGA 1BE6A 3QHQA 2JVKA 1XAHA 2UVVA 1VA4A 1E5XA 4P22A 2XR1A 1NRXA 2O2HA 2PAFA 5LZ4A 4IIJF 2DG2A 4MQFB 3LQ1A 3HR4A 1D2CA 3ZCQA 3E9YA 4WKOA 1HE1C 4H7DA 1Z12A 1ZIOA 2HA5A 1KYWA 4AG3A 4Z53A 1NC3A 4HZIA 1JT2A 1K06A 3VUEA 1JU4A 1MAVA 1U02A 3I6QA 4Y0NA 1U1CA 3VR4A 1GFIA 2IDKA 2IT1A 5LU8A 4KN5A 3T3MB 4YTEA 5GINE 3OEED 4MIKA 1XYYA 5DQGA 4L76A 3Q9LA 4K0KB 2J9ZB 1U0FA 2RAFA 2RAVA 3SYKA 2KPOA 4CR8A 4ZTBA 2RB5A 1W85A 3FYUA 3JWEA 1P5HA 3MBOA 1L4KA 2OCDA 3FLEA 1EUCB 2Q45A 2PKEA 1DAOA 3K1AA 4H1WA 3HC7A 4YDQA 1LPMA 4OGWA 4Q9NA 5DVZA 1CS4C 2P68A 4KHPB 4FSDA 3MWYW 4J6FA 1SU8A 1Z16A 3N5KA 1ZLXA 2GEFA 1MVLA 3C8ZA 1P3Y1 2ONJA 3OSPA 3H2IA 1N6KA 2OBYA 3QLVC 1ZH6A 5FA5A 3F7TA 5JTUA 3BACA 1NHWA 4J0CA 1KI6A 4TWBA 5IYZA 1ANKA 3H8VA 3VC3A 5M5BA 2JD0A 5KAPA 3NC1C 3C5WP 4UD2A 3KQQA 5EINA 2HDNB 1I3MA 2ZITA 3LOQA 4QFDA 4EO7A 1IYEA 1EGQA 3OZSA 4FFDA 4BBZA 1U2SA 4RXUA 2J7PA 1RWKA 2CJPA 4J16C 2DWCA 1YR9A 4ZI7F 4NXNB 2GZHA 2SKDA 4Z0NA 4ZYXA 4C87A 3UKOA 2E5FA 2YCBA 3RUCA 2QXYA 3CKYA 2VJMB 1TAHA 2JIBA 3NM6B 3WO1A 3FTNA 1I6UA 2FLWA 5AJHA 2XCRB 1ISPA 2MCTA 1VIVA 2R1TB 1QYXA 1TAGA 2WDPA 5CLGA 1MPXA 1YZYA 3ST7A 4IRDA 4JYCA 3AUYA 2I65A 2LP4Y 5K3FA 4BP9A 2YHUA 3DPUA 3WGJA 1ZK4A 2Z3VA 4AM8A 5FXMA 3KLPX 4KO1S 3QKIA 5IC5A 3GH1A 2HF2A 2A84A 4DLLA 4K6GA 3PE4A 4RACA 3MMZA 1V6SA 4V2UA 4Z4HA 3JZIA 5JZ9A 2PGOA 1U9YA 4R3UC 4ZIRB 3NIWA 5C31A 3PXBA 5E8RA 3CNEA 4KE9A 3W7AA 1IUKA 2R7AA 4PLCA 4BVLA 3W9UA 1ZK1A 3GTQA 3V4LA 2JGDA 2NG1A 2P6MA 2OAP1 4DXDA 2DTDA 4IRUB 5E3HA 3WKEA 3M1YA 2ECFA 4PHFA 3RFUA 4G01B 2CC2A 5K3DA 3O9VA 3M9NB 3H17A 4XA8A 1JR3A 2OWEA 2BP7A 4CM9A 2PUWA 2VNAA 4XWOA 2GMWA 2HOQA 3KLMX 1NVXQ 2O20A 3CLSD 3JVIA 3LFUA 4RIGA 4D9CA 4ZEVA 1N6NA 2FWMX 4MVJH 1Q1ZA 3RK0A 3I0NA 4K9NA 3C4VA 4ZK2A 2PGDA 3FDSA 2GZAA 2IOFA 3I6ZA 3FZNA 4OSEA 4U2KA 4IEEA 2PX0A 1T3GA 1XLVA 1JQKA 4D3SA 2HGSA 1X1RA 4II3A 3O91A 3U44B 1A95A 2ODNA 4RH0A 4Y98A 4HXFB 1S2LA 2XBLA 2Q4EA 3BT7A 1C1HA 2HT6A 4WA8A 2C88A 4NYJQ 2HI0A 5D3QA 1U7HA 1HM5A 3OCJA 2PV7A 5EEHA 1IM8A 4DCJA 4COKA 1EVEA 4MVJE 2FSSA 5IUJC 1TJYA 1L7RA 4ACBA 2G06A 1W6RA 3TB4A 3QHPA 4UUOA 3WGMA 1Z8FA 1YA6A 1OSNA 4P8RA 3FNHA 2ODTX 2GAFA 2NPFA 1JGTA 2QU7A 2M05A 1GAQA 3VZCA 4OI0A 3PR2B 4YMUA 4PIPA 2REQB 1ONSA 1W73A 2OYRA 3JRNA 2GH1A 4F3KA 1S3IA 1ZH4A 2PWAA 2MHCA 1I2DA 1Q1QA 3CIFA 4LDRA 2PXXA 4EGJA 4HJXA 2OXIA 1E0AA 5FUXA 4KQCA 3HGMA 1CLEA 2QTHA 4MVJM 4HRXA 3OY7A 3D6UA 5CFZA 2CYCA 1QORA 4U2BA 3ZNQA 2CDCA 2XCPA 1QANA 3R2JA 4DSTA 1TC1A 2BKEA 5HSGA 2QR2A 2Z98A 1JEOA 1X14A 3MWEA 3HJUA 1O2DA 4M1QA 3PEUA 2PLNA 3B85A 2Y0BA 1C3VA 2GPBA 3OKCA 1TYEB 1TC2A 5LVAA 4QJFA 3E9CA 5D86A 4YJ3A 2WWVD 1M1ZA 4F93B 3E23A 1XXHA 2FZGA 2OXCA 3ESZA 4WFQA 2SICE 3SE7A 1Y1WG 3TSZA 1D4AA 1ZY2A 3U4MA 5KFHA 4I5GA 2H54A 4MVCA 4YRBA 1LZKA 4WACA 3KT6A 1Y1VA 2BF4A 2L0XA 1AX9A 4YPVA 3CR3C 1QRRA 1JXLA 5D51S 2VAXA 1M74A 4Q8FA 5C5EA 4F5WA 5KFZA 2JAPA 1PNVA 4KR7A 1GL9B 3IMGA 3IE0A 1RYFA 4Y1GA 1O5TA 1W5EA 3E1GA 4JH0A 4CWAA 5HUQA 5E8JA 3IS3A 3FHCB 5JMTA 3R9WA 3DBOB 5JO0A 2V4ZA 1FRNA 5CHYA 5AKHA 3QPVA 1F4PA 2GJKA 1QAMA 1G3RA 4DDUA 4J7XA 3AUTA 4PR3A 3NHWA 1WXGA 4INPA 3NX4A 3Q7QA 1LSJA 5K7SA 3OE7D 4OXQA 1DQYA 2IU0A 1SK8A 1UDAA 2ZJAA 3LL7A 3GNQA 1US8A 5AXAA 3VNAA 1YS9A 3BX1A 4PG6A 5FUYA 4W1QA 2RHCA 3H4DA 5CMLA 1D4OA 2YTZA 1KQFA 3NB0A 4TLMB 2HLNA 3RSFA 4WXPA 4OYLA 2VRBA 1T0IA 3OHSX 2IU6A 2I99A 2VK1A 5HK9A 1E9EA 1KYTA 4L3VA 1IK6A 4I1IA 5KYWA 1MXHA 3D6JA 3LBHA 3RH0A 5ITVA 2F6RA 4UBLA 3GPDG 4E31A 1GUAA 5ITSA 4MV3A 3GJZA 4AQYB 4ZANA 2PY6A 4YQFA 1BXRB 3A1CA 4EUKA 3JQ6A 4DQ0A 1C2YA 3Q98A 3FOFC 3KJGA 3ZXXA 4YV2A 5IFKA 1T0PA 3ETNA 3PUIA 3S40A 3ZV4A 5E6UB 2FSVC 1K6JA 4KU4A 2V6BA 4K6NA 1IWBB 1QF7A 3A9SA 1BGWA 1ORTA 4I1OA 1T91A 3QIAA 4WCFB 1KBZA 2GSDA 2XJ4A 4X6UA 1DOZA 3ABOB 3C70A 3VTKA 1KI7A 1MU0A 3BB4A 5ALVA 5NULA 3I2FA 5K0BA 4N4AA 2FUEA 4HY3A 3SE0A 5MGBA 2QTRA 1R0KA 1UBJS 4OQNA 1ZMXA 5K8LA 1E61A 5KNDD 5JXIA 2WFAA 5JRZA 3F78A 3WNZA 2X86A 4ND8B 3PEYA 2CLFB 2QD2A 1ECGA 4PYNA 2X7JA 5P8WA 3I76A 4PANA 5GP1A 3WI7A 2VZ9A 1RYBA 1V9SA 3S24A 5HDQA 1JE0A 3Q1LA 5CVJA 2H2IA 5DI3A 1BMTA 3RAEC 5H70A 2B2NA 4HF7A 3BSFA 4C2BA 2FZCA 2GJ8A 5JXWA 1X7WA 5A2GA 4F91B 2G4CA 5K6RA 1IZ7A 1GG8A 3PKIA 1BC5A 1NVKA 4BWSC 3R7FA 4DA4A 3WBBA 5EMKA 4YJ2A 3BMQA 1F9AA 1S3FA 5AKJA 4Q7LA 3RNOA 4NFSA 3NR2A 4YRZA 3SGIA 3ZHSA 4DA7A 1I2KA 3U80A 1P4HA 2MSKA 3L5OA 2C97A 1PRYA 4MR8B 4KLNA 2YYYA 1GXSA 1R9JA 2EWVA 2AQ4A 1QH9A 3IP9A 5L3VA 1EZ1A 4LJYA 3VSCA 3L0PA 2P9CA 4EATA 1CUHA 3R8CA 2XE6A 5FB3A 3DV2A 1ZUHA 2ZUEA 3SJ7A 3GUHA 4ZQGA 5C8YA 4J3NA 3F0TA 5BORA 3UK6A 1G6HA 3W5IA 2WU8A 1JW9B 4IFEA 1NJ2A 1XRMA 4QE3A 1ZS9A 4DMLA 3PGKA 3OQOA 2A6PA 3MB5A 1E5LA 3MRXA 4GOKA 4D96A 4O7RA 3DAHA 3AHDA 1D9ZA 4DCGA 1GN9A 5CXQA 2M6RA 4UE6A 4EB3A 1PQUA 1J99A 2RKOA 4EUSA 5KQLA 5DP2A 3FR8A 5TJ9A 1XNGA 3JARB 3ZKWB 3CEJA 3ILYA 2L2QA 4DV4H 1N7IA 5AR1A 1WXHA 3IAM6 4M21A 4B2YA 3A4TA 4EEKA 3AUFA 1KERA 1L5YA 2FK1A 1N32B 3HJRA 4JQSA 1V6CA 1RABA 2SKCA 3HUTA 5SY4A 3BREA 1M66A 1E7MA 3W6NA 4JLBA 1WVGA 1YVPA 4B3CA 1A9OA 4HN2A 3DMPA 2JIDA 3MLAA 5CNMA 4TTQA 2ACEA 3FNBA 3HPQA 1QZZA 3LPCA 2ZAMA 4B44A 3P2KA 3H9QA 1JR2A 3O74A 2I3AA 2E18A 1YBMA 3O8OB 3LLUA 1LQTA 3ASYA 4CQJA 1P6UA 1KC3A 1DAPA 4NY1A 1A9TA 3EDYA 1RXWA 3G3EA 1FFAA 4RVCA 3P0RA 4P7KA 1XD8A 4RTSA 5EIWA 3EFEA 4RKWA 3NPAA 4JR1A 4S05A 2P0AA 4AICA 2IE0A 2ASDA 1PR3A 1JU9A 2R82A 1OZFA 3VZQA 1PL8A 3H4TA 5BW6B 4TS9A 1I2AA 2A3NA 1OH7A 3SS8A 5H9WA 1PWXA 1BMFA 3HVUA 1E2QA 2QSYA 2NQ8A 1SHKA 5JD3A 4COOA 3LW7A 3RC3A 3PPXA 4J0KA 3UN1A 4KGXA 1J2TA 3IIJA 1GPYA 5G40A 1MIOB 5KDDA 2CLMB 2Q2QA 3AI2A 1E64A 2WKPA 5B30A 4N1AA 4K2AA 3JQAB 1HPLA 3G0GA 2HUPA 2IBTA 1TCBA 1Q16A 4JI8B 3BKWA 4JVSB 4BGUA 2O0HA 3FHLA 4FKMA 4QT4A 2ROQA 1X8KA 2XMCA 3RS4A 1J23A 3KJIA 4EG5A 2YZLA 4L22A 8LDHA 3PRHA 2OGUA 4Q4CA 4UM9D 1QOZA 4FYYA 5K3WA 4J90A 1DEXA 1L4YA 3M1IA 1G5QA 4FNOA 2JLAA 3BPSA 2GEDA 3BB3A 4QXMA 4GSLA 2QU8A 4EY6A 1GT91 3RSHA 1H0HA 5I5EA 2WD8A 4GXQA 1H2RS 1KEKA 3JD1A 1JIVA 1BQ4A 4DIEA 3UT6A 2QR3A 4LHXA 5E1OA 2SNIE 1E7QA 4ZDJA 4ZCTA 4EF6A 3WWJA 3CPSA 1UPXA 2FQWA 1YIAA 1EXVA 4OM7A 3PR3A 4JT8A 4LYHA 4BNGA 3QZ8A 2HHLA 4GLLA 3G2MA 3K96A 1YHNA 1NC1A 4EH1A 1KO5A 2DQSA 5E6RA 3EPLA 1EJ6A 1UQRA 4FJ0A 1R4NA 2O5RA 4HQRA 4Q1VA 1JIJA 4NNPA 2ZVQX 5CX1A 1QZTA 2WTBA 4KN9S 3CCCA 2JEIA 4KQJA 5BN3A 5AW7A 4A3GG 2XUKA 2I4LA 4W63A 2D0DA 4PTYA 2R7ZA 3BQ0A 1RHKA 4D6PA 1HTWA 2CWWA 2FVYA 2O50A 2ZPAA 1N6LA 2PYZA 4YV1A 5A5FA 1K5GA 2CNVA 5LLSA 3KB1A 4L02A 3EZGA 1T25A 3BD6A 1KC7A 3T0IA 5IMSA 2B3TA 1AZWA 3ZZ1A 1MQ8B 1M2JA 4Q7MB 1R0WA 3H8JA 1I30A 2P3LA 1ZD3A 2RIRA 4YAKB 3OESA 4EB8A 2RH5A 2X5XA 4DIFA 3R9KA 4OI2A 2WZDA 4XH9B 1D4FA 3WK7A 3WLHA 1U1IA 2PZ8A 4P92A 2Y68A 1T8RA 3JTEA 4IY1A 3RVQA 4J7UA 5C3MA 7REQA 3CCBA 3AHGA 5JRJA 1N36B 4RKRA 1O8BA 4TS3A 3G8AA 1UFQA 4BTEA 4AYTA 4O4IF 2GRAA 3A4IA 2ZUCA 4S0ZA 4ECEA 5ITZA 1FYDA 4L50A 1OAOA 3RUFA 2I9PA 3EGXB 3Q8PB 1TRKA 4QQRA 5MN5A 4KZKA 4DLPA 3GLUA 1E0DA 1ST2A 3HWWA 5AKIA 1GZ3A 1NRWA 2O7RA 3VHLB 4J9QA 1G8MA 1CE8A 4JV5H 1BQ3A 5BW5A 1RKXA 3FKQA 3A37A 3NIBA 4OK6A 1K1QA 4NMMA 2AZXA 5KQMA 1Q74A 4DIUA 1CG6A 2JGEA 1TPZA 1ZUNA 2D5LA 4DNOA 4CM8B 1Z0IA 4FYMA 3U3JA 3GWZA 4ZT7A 3CH6A 2YR0A 3K5HA 5TQ2A 1T9KA 3S99A 1V45E 1SA0A 4C7OA 3BJEA 4ASUD 3FCSB 2C59A 2GLUA 4TTSA 3ANMA 4ARIA 4O4HF 4R3NA 2OTCA 2JA6G 3THSA 2COEA 2X9QA 3PXUA 3GMSA 4XLLA 1DAEA 5K0ZA 3IAM1 1NW8A 1YB2A 3TJMA 4B76A 5JH7B 3V2UA 2HNBA 4HMQA 1LDYA 4EJSB 5BN4B 2C78A 3ZU4A 2EX4A 3SOPA 3LP8A 1KNXA 1E59A 4P2GA 3CZ4A 3Q3VA 2ZJOA 4LJSA 3WMFA 3DMGA 4DLSA 4AZ0B 5J40A 3E03A 2XD4A 2BMFA 4N18A 5JNWA 4U6PA 4F7DA 4KI7A 1JG1A 1EVJA 1SHZA 2ZJZA 3KQSA 4IGIA 4OPMA 3UMBA 5CCBA 1I3QA 4MPTA 3KXDA 1B33N 2Q3MA 4F3RA 4TL7A 3FWZA 4JYAB 5H81A 2GNOA 4DAAA 2H7VA 2GPJA 3CLTD 2H8GA 1HGXA 4QAQA 3VPXA 3EEFA 2YW2A 2QRUA 3S2UA 1KP9A 3SQNA 3I2IA 3ZR4B 1JDBB 1TX4B 3PC2A 2W6JA 4FGWA 4HVCA 4EUNA 1JI0A 2M6KA 5EJFA 1JYFA 1V5WA 3NRBA 1PZEA 1TD9A 4CM4B 3STTA 4LF5H 2DP4E 4PBTA 4LGCA 3AB7A 3KR0A 4I1YA 4GP9A 1E3SA 4KO2S 4Q48A 2Y1DA 2AU0A 5ANRB 5C37A 2JH9A 2GF0A 3L1IA 1SZJG 3GG2A 4IDEA 3ESXA 2XRZA 1GM5A 2XGMA 3FG9A 1EYZA 1K6IA 3LT4A 3Q4GA 1JA1A 5A6SA 1HG1A 3E8SA 2PMEA 5BVGA 5FUQA 2C9MA 2B1JA 1UKEA 3G9QA 1LBIA 5KFWA 4ZEMA 3O2JA 1Y82A 3NRCA 1ITZA 5BNIA 1UPFA 4LK2A 1Z7WA 1X39A 1ZOLA 4DL2A 1K27A 3GW8A 4HB4A 5EPEA 4MGHA 3UAGA 3W3AD 5GJCA 3VR2A 1KS2A 3RVSA 2HR1A 2GB4A 2YN2A 4JXUA 4EAQA 4BCDA 3FRIA 1SXQA 2AFRA 3FF4A 4NH0A 2R7KA 4P7JA 3CWCA 1EFHA 2X3YA 2PRSA 2A9OA 4KXNA 5DCYA 4QTYA 1HL7A 2ZI4A 1OXTA 8ABPA 5I7SA 1Q3TA 5A06A 3T94A 3W78A 4TRJA 1YRWA 2JBWA 2BR4A 3P20A 4H4EA 4JNKA 1DEAA 1MGOA 2NT4A 1XE3A 5G0UA 3KAPA 3T5JA 4LFAH 5KTMA 4HX2A 2HTEA 1H4VB 3CVXA 1NQWA 1VG0B 2AMYA 3T5DA 1EFRD 5DCLA 5FEUA 3W5UA 1WBBA 3EAQA 3CZPA 1KK2A 3UZUA 3DEIA 3RJMA 1S97A 3WL5A 4EVQA 3KXYT 4RQAA 3B3FA 4HDKB 2O2GA 4MPRA 3KSZO 1MABA 3B9RA 3WGGA 6ADHA 1WPGA 1YFLA 1Y1SA 4AJ4A 4DL6A 4QGGA 1PFQA 1YACA 3JQRA 1O9BA 2JZOA 1A5AB 4Q82A 1XVUA 3KTMA 4IOMA 3ZWVA 3THRA 1D7OA 1O87A 2I87A 1GGFA 5KPDA 4OUDA 1KYYA 2J3QA 3ZHYA 1OBOA 4DR7B 4NZPA 5JXHA 1CUJA 3UTDA 2JKYA 5JNRA 1D07A 3B5EA 4CEJB 3Q11A 4PZZA 2IYVA 3PW2A 3H2KA 4TYNA 4TVOA 1DRWA 1NKSA 2D2EA 2DFPA 1ZOSA 4PAWA 1Z0SA 1AMNA 1CUUA 1GPLA 1NI5A 3SC3A 4LFCB 2PVPA 2DPJA 3OWOA 4NZYA 4K1LA 2LV8A 3I5YA 4DGSA 4URXR 1GNLA 5EIOA 3OJCA 1U0GA 4MYRA 4JR2A 4M1SA 1QHIA 1SCUB 3MCUA 4XYEA 3UKJA 2JL1A 4MS4A 2FN9A 1I4WA 2Y77A 5D1HA 4RMHA 2R8KA 5KHAA 1NULA 4WBNB 3LX8A 1RK6A 4LOJA 2RJOA 1OLSB 1E2EA 4C89A 4JT4A 1Y8RB 1RNLA 2VT3A 3ER6A 4GECA 5K3CA 1F8GA 1IEWA 4FM9A 3PDIB 3MR5A 3GJRA 2WZQA 3MMNA 2II6A 5CIWA 3OZTA 5KCZA 1XQ1A 4BP8A 7AT1A 4F2HA 4AZ3B 1NXXA 3PA8A 4ZVTA 4X7MA 4X3CA 3CPEA 1OTXA 3MYRA 1XCPA 4MGEA 4G3XA 1YA8A 4NATA 1V3UA 4OB7A 3C3WA 2P67A 1L4GA 5B1EA 5EZQA 3GPCA 4FFBA 2HJWA 5C7IO 3RHFA 1K6XA 4ZVUA 1K8ZB 2ZIVB 2OAQ1 1E1LA 3LIPA 3OCCA 4RCZA 1GPH1 4ZHQB 1SUIA 5ALRA 1DIBA 2ZIZA 4N5LA 2C82A 3BAFA 1UM8A 3WTCA 4WNAB 2I3DA 5EWLB 2WR8A 2XVMA 4ECXA 3ND6A 1F7UA 3O84A 4C4RA 1J9GA 2J41A 4QPCA 3H8SA 3IMKA 1QVZA 2QTCA 4PW0A 2GPWA 1EG2A 1KI3A 1UKAA 2FHSA 3OU6A 3BGDA 1TK3A 2ZXUA 2QLJA 3C3EA 4UU0A 1AMOA 1XNJA 1OLXA 2PEZA 1RAGA 1JBEA 4KUHA 2P2LA 3QXGA 3Q7EA 1X2BA 1KH1A 1Y1TA 3HZZA 5K9ZA 3GK3A 1X15A 3OPVA 1H9BA 2E4VA 3PUXA 3OTHA 4AMGA 4EG8A 4TZ6A 4XFJA 3IFSA 4KFUA 3QHAA 3QUSA 4L2IB 4LWOA 4X71A 2C5GA 1EGHA 3TNDA 1ZJ6A 3C14C 5K0EA 1NWCA 2VCHA 5AK0A 2X41A 3IKLA 3WL7A 3TGPA 3VQTA 1ZIYA 5A9TA 2W2KA 3A0UA 2Y8EA 2QMUA 4C0KA 2FWBA 1S1MA 2JATA 2JLCA 3QUBA 3CX3A 4ER6A 1L9XA 3FVVA 1HTBA 2ZWPA 4OMFG 4CMBA 3O1JC 2YXDA 5JHHB 2BHSA 5C44G 1RHMA 1U7UA 3JQ7B 5T4FA 3KAKA 2A9VA 3L4KA 4AX4A 4JLSA 3OUUA 1ESDA 2XKAA 4D9EA 3H9EO 5J5VA 1R8SA 4F2PA 1NXTA 4BFUA 1YOVA 4G0WA 3BH0A 1YJAA 4ZYLA 1XFDA 3D2LA 3EF3A 1FVXA 3KEMA 5I3ZA 4L9RA 4R1PA 4MR9B 2O0LA 4JI2H 4WESB 1TO1E 3GELA 3DKPA 1EGMB 3Q5GA 3SOZA 1B76A 4K9KA 3ANNA 2ET6A 3PF9A 4GPZA 4BX3A 1RHJA 4CTOA 5JFTA 4UOZA 5DHPA 1OBDA 1ZC3A 2HYIC 3FB4A 3HT5A 1DKMA 1L3CA 4UW9A 1K88A 1KIFA 4U1RA 5F7ZA 1XMOB 4R9SA 1KRHA 2H1WA 3TQHA 2IJGX 5DNVA 5CNKA 2E48A 2C3UA 1PFWA 2JASA 3HXKA 2AD5A 2B82A 2LVBA 4RA9A 4LOLA 4FE2A 4IMIB 2R4TA 3H0GA 1HFKA 2DECA 1UBHS 2A5GA 1SOUA 2O03A 4MWSA 4HL6A 3NCTA 3FLMA 3GLIA 1P9WA 1UZLA 4LCJA 1ORRA 1H3FA 4QU0A 5BV1A 3VJMA 1TM7E 1W2WB 2ZIXB 5KFIA 5ALIA 1EXWA 3JYQA 5K51A 1M67A 1YIOA 1E9FA 1PL7A 3JR7A 4QBHA 3HL4A 1QPZA 3ZBPA 2BR0A 3OD5A 4V0LA 5I8PA 3QQPA 3N0VA 2FUKA 3RW9A 4BO9A 3IBFA 3OJEA 3ZG6A 1N75A 4FFSA 3CR7A 3IJPA 1SKAA 2FOLA 1Z36A 2FPLA 1FFXA 2B5OA 3AHCA 1TB4A 1ZZEA 2FCAA 5KG1A 1T4CB 1ZAUA 1IY0A 1LWNA 1QJ4A 5A0FA 5G1PA 3AVVA 5FWYB 2GEUA 3WWIA 3BMXA 1UBFA 3A9UA 4PZ7A 4DJFC 4E07A 5E7MA 2C04A 1DEOA 2Q50A 2ZKLA 1CSEE 2V74B 3HY4A 3VNRA 4QYMA 1COWD 4H1UA 2HA6A 5JG7A 1TT7A 2I7CA 4UNRA 5IKOA 3GZNA 4PQEA 4HKTA 1GLNA 3EASA 2DTEA 5M29A 3DZIA 1L7MA 2JAUA 4KJZA 4MAMA 4UUQA 1HETA 5IAJA 4KWCA 1SMKA 4DZTA 1V3TA 4L9SA 4K9QA 1W19A 3K8ZA 3GMIA 1ZWLA 3ZNNA 1Y3AA 4NVRA 4TKZA 2R6CA 4ITUA 2NX2A 2IRWA 3N2KB 4K88A 3LG2A 5AI8A 3KEFA 5I7RA 5EDWA 4FUQA 3I5XA 3BBLA 3K0AB 2QVXX 5ES3A 2J8ZA 2E5LH 3B52X 4DV6B 3WAJA 1JB9A 2PSFA 4YRCA 3HDGA 4JMLA 1HEYA 4ECWA 1RLMA 2VTDA 3OTWA 5ED0A 3KP1A 1Z6AA 3LS2A 4KH1A 1NXPA 1GNPA 4I9NA 2NV0A 2CJYA 4I14A 3UJPA 4TXNA 3OZUA 4PZ0A 1UP4A 1V2GA 4IFBA 1H4QA 1AN9A 3ICQB 3EGOA 5T14A 3OLYA 5C5JA 4TT8A 3VU1A 1PYDA 3FVTA 5KBYA 3BA1A 4LRQA 4BXOB 3B1FA 1XIVA 4L6IA 3RS8A 2W2PA 4BZWA 1SJ9A 5FBHA 3ZU2A 1KFJB 4I4LA 1GZUA 2J3EA 4NZZA 2BGJA 5C5CA 5DK6A 1K8RA 5K20A 2WYIA 2HMSA 4BLRA 1USGA 4MCJA 4LDQA 3OSNA 3L9WA 2W8BB 2H1SA 4FT4A 1W36C 3PVCA 1P61B 2RGGA 4LRUA 2Y1KA 3BTOA 1L7NA 5DNAA 1OXSC 2IX9A 4UBMA 3GQCA 5ELMA 4EKEA 1JKIA 4WZAB 2FPGB 2I5PO 1O95C 3ROPA 1BNCA 2V7QD 1OVMA 3N2GB 1SUWA 2IS6A 2GN9A 5T5QA 3MPUA 3E1KA 3HCDA 5FV4A 1G3MA 1ZI8A 4G36A 1UMCB 4JB3A 3FPFA 3QVGB 5EVCA 2VJLA 3EFBA 3C3JA 1H66A 4YB8B 3OM1A 2IY7A 2AMFA 2PMZA 4G6ZA 3DZFA 3ONVA 5DO9A 2EZ8A 2ZUDA 4WY8A 4YCBA 5LDDC 3DE1X 3WGIA 3CC8A 3TZCA 2HIAA 1R00A 4HAWA 3FXAA 4D41A 2ZANA 1JF8A 5L9XA 3AR3A 2A78A 3QYAA 1F2UA 4LIPD 2Z02A 1DGQA 2RGWA 1SBTA 1E69A 1FVFA 1N6RA 5JASA 3BFJA 4NOMA 1VCOA 2F17A 1IBSA 5IM4F 3VOTA 2FAXA 4FFWA 1PFYA 1KSGA 2I22A 4U2DA 5KWSA 1TEZA 3PI6A 5LMUH 3GX1A 4YH1A 4UBIA 1FOEB 4OMDA 2Q2OA 1DUSA 1FQOA 1LRJA 1UXGA 4W8GA 2RH9B 4PYIA 1M7HA 2FZWA 3HB0A 4J1TC 5K4AA 3MOSA 3N8NA 1XRRA 3RBEA 4RHCA 2IUTA 5TGDA 4DLWA 2PPLA 3M2PA 2B8JA 2VXBA 4HWTA 3DXZA 5IASA 1U5CA 1G5HA 1ADJA 1G7SA 1JEYA 2WM3A 4ZJUA 3FHOA 3PX2A 3Q88A 4MYHA 3LRXA 4D0LB 2AOUB 3FX2A 4NCAA 2FSGA 1YJ5A 4FQ5A 1XVIA 4EA9A 3L01A 5GQSA 3Q3JB 3BC1A 3RBVA 3RJ5A 4DV5B 3I6YA 5FL7D 3Q7RA 2X7XA 3MT8A 3ZWOA 4FDVA 3GFTA 1XD2A 4WW0A 1WDLA 4X44A 1DQPA 4KPFC 3GVHA 4DE5A 2E6UX 4WMLA 1BVUA 3DMTC 5BV7A 1AMUA 3MTBA 1TUBA 2OV3A 1ABFA 2GILA 3NORA 4UCRA 4IFTA 3GR6A 2F8TA 2A9PA 2BGTA 3IOCA 4GEKA 3HYCA 5AXBA 2I0FA 1IXSB 1PR6A 4EO9A 2Z4SA 4KRFA 3TOCA 4O59O 3PJEA 1Z29A 4ND5A 3G17A 3R3WA 4JBXA 5B64A 3ZY2A 4QOSA 4YCCA 3RVJA 5DI9A 2HY7A 4ALKA 4UQLA 1XKXA 2F1JA 3HHEA 5FWAA 4KFCA 5AVTA 1U90A 2QPTA 1UJ2A 2K7FA 5F3RA 3TOZA 1ODTC 4EKYA 2GVZC 4LY0A 1VMKA 4XIJA 4XCQA 5L7WA 2OHHA 4L78A 4MQLA 3X2EA 2WDTA 4DN6A 4J0EA 1LK7A 3RI3A 1YQDA 3SJCA 3WRWA 2PJRA 1N2EA 3HFGA 2XUGA 1EQAA 1SOVA 5KT7A 1HYHA 3PEEA 5FUWA 4XTCS 4JU9A 4R69A 3WL6A 4PGAA 1HOXA 5C1BA 4X97A 2NU7A 3OZIA 4XX0A 3SBEA 2UVPB 2NUPB 1JAIA 3JALA 4ZJYA 2XODA 3ROXA 2TRSB 1JHQA 1IBRA 2FLLA 2QXTA 3B20A 1KY4A 2JI7A 1T94A 2QUBA 3LPNA 3BB1A 5T4EA 1EUZA 4BFSA 1UDBA 1NY5A 3TTUA 3AVTA 3JQAD 1SB8A 4QXOA 3ZTYA 3S7ZA 1U8XX 4IIDA 1UUFA 3V7UA 2DERA 4XW2A 5I60A 1P0FA 4G86A 3PZRA 3IQWA 3G23A 2CQYA 4Z0PA 4MJ3A 3AV3A 1TK9A 1VP3A 2J30A 2HVQA 5K2OA 4ZPJA 1E5VA 3VR6H 2AE1A 4KFRA 1YZLA 4I3HA 2GEKA 1H2EA 1ECJA 3WXMA 4ZOQI 3SLGA 2B2XA 4HX9A 4PXSA 3AU8A 5CR5A 2C2GA 3TN7A 4BWGA 4RAZA 4GRAA 5ELLA 2OB2A 1U7XA 2O59A 2IZ5A 1DLIA 3ROFA 3L4EA 1VPLA 3HV2A 1USKA 4YRMA 3R8XA 2H2GA 5EE3A 4DBVO 2W7TA 3ZHOA 5KFAA 4PNHA 2G8LA 1THGA 1JFVA 1UADA 3L3BA 1ZIDA 2XAAA 3NV9A 4E5SA 3D2AA 5DSZA 1FFBA 5CFPA 4BKMA 4MVYA 3M2TA 2WFMA 4OX9H 2JI8A 1X74A 3IC5A 3DVSX 1GTG1 5K5EA 1JJAA 1S9FA 1O0BA 1YR8A 2BFCA 3IVGA 4JKOA 2IHZA 5AKYA 4X1IA 4REQB 2X8AA 2VNKA 1JL3A 1BWPA 3C0KA 4E5MA 3O1IC 3TW7A 3FMGA 1XPRA 3EMKA 1P39A 4G3IA 2QPAA 1XQ6A 1U7WA 1PBNA 3DF7A 2ZRDA 1CX9B 2AX4A 5EJEA 3ZHXA 5HPYB 3SR0A 1WD5A 2PX5A 3RC9A 4MK4A 1F38A 4KB5A 1Q2XA 4G9BA 4AY4A 4GOXA 3ZH2A 3S70A 3HOYG 1Z37A 3IDOA 1TQ4A 3D43A 4KTVE 3GP8A 5JCZA 1OPXA 3AHHA 4EPXA 1N8NA 1Q1GA 2H59A 3NP7A 1KO8A 4K1XA 3EIXA 4HDNA 4AJIA 3W9BA 1OZ0A 1FMCA 3U7JA 3JQQA 2E4WA 5JMWA 5G2OA 5D7BA 1X0XA 4EUFA 4INZA 1E3DA 1EB9A 5AI4A 4F2GA 3WJ1A 2HU7A 1ABBA 2QVBA 3VC1A 1C9MA 5ICSA 2QN9A 2X4DA 1BE0A 2V4RA 4KK4A 3PTZA 4EHFA 2FPWA 4EENA 4YALA 4Q3DA 1QDLB 1TKAA 2XGQA 3FCOA 3R5TA 2XUDA 4XSVA 3TTSA 5JRDS 2C0CA 1PT8A 1BU8A 3I12A 5JY1A 5KG5A 1O08A 1KI9A 1TWHA 4KRGA 5AW9A 3OJXA 3V6JA 4TWJA 1VBKA 3I04M 3BDIA 1RZRD 1LW7A 2DUJA 4DDTA 4NF2A 2UXDH 3BRQA 4E6PA 1AS2A 5HQTA 4U39A 2CUKA 2ZXEA 3OA0A 5KIAA 3LKVA 3WGZA 5B7PA 4B83A 3R0IA 2W83A 5ALGA 4M6WA 3OJFA 2H00A 4JJAA 2FN7A 3K9FC 3LQ2A 3RBAA 4PV7A 4DLBA 2X8JB 2CVHA 4FGKA 4RGQA 3WRYC 1JHZA 5AM5A 2B5VA 4OMCA 4JI5H 4DRXA 3EAFA 4BAGA 4E4TA 3IALA 4O7NA 5GVSA 4KDCA 1D1TA 1JVSA 1LF0A 3K0CC 3IXMA 2D2XA 1B1AA 4LGMA 4U9UA 4FYXA 4Q4AB 1Z0ZA 3S2IA 2HJRA 3UAWA 2A1TS 3DBRA 4EELA 4YRPA 4RLHA 4KYUA 5LZ2A 3QLTA 2XMRA 2QUKA 2MINB 2YOFA 3DWFA 1E3WA 2O6LA 4IWYA 3PCTA 3LLMA 4RAOA 1UFRA 1H3NA 5EP3A 2BR5A 4C0BA 4EFLA 2C03A 3IQFA 3T99A 1LBEA 1V5IA 5JJCA 2WSMA 1QVVA 3S1AB 2YHSA 3SVZA 4PYKA 2NO0A 3EVNA 2LIVA 4ZVNA 3DB1A 3A3NA 5LDGA 1O94D 1SZPA 2C7PA 1YRQA 4O2AB 1L2TA 3BQ2A 4LF7B 3ZH9B 4E5DA 3R7DA 3RKUA 1ZJJA 2WUGA 1FXWA 2Y4NA 2O2EA 4J0JA 3VA7A 4QYTA 4LJ5A 4Y8VB 2XNDA 3R3VA 2HK8A 3AKEA 4LY6A 1OREA 2HK7A 3HJAA 2E87A 3ZK9A 4A3DG 2QUZA 1C0KA 3NMUF 1F0KA 1GL6A 3FTQA 3HZOA 2GZ1A 2GUGA 3FSJX 2DFDA 3WGKA 1F2TA 4KNWA 2DJIA 4V03A 3CWQA 4RB1A 2XUHA 1AF7A 3RRXA 2Y6VA 4D5EA 2XB2A 2NYUA 3KETA 4R9NA 2VUUA 1T3NA 3OH8A 3VPHA 1H2FA 3KHTA 2IV3A 3U9SA 1GGVA 3NHBA 1CBUA 3AOEC 1TT5B 3AR5A 1OBGA 2PWPA 5D84A 2AQHA 1JHVA 1NVAA 5C4MA 3IUPA 4JJ7A 4GC6A 1KJIA 3IAHA 2QYTA 3CKMA 4F9GA 1HRDA 2RG1A 2AEFA 3P9YA 5AHOA 3G6YA 4YRTA 4H4DA 1ZD5A 2LIPA 3BOSA 2YJTD 3R3XA 4EG7A 1FSZA 1YDGA 4J0MA 2F55A 4CNQA 4DG5A 2VBIA 3HKEB 4Q02A 3ZDAA 1ZMRA 4MNTA 5JDIA 2WUWE 2PO7A 4P36A 3LY5A 1O6BA 5JH7F 1DE0A 5CLQA 3N74A 3SN6A 2HM7A 4WXEA 2BKAA 5BQOA 3RIZA 2FR8C 2UUAH 4QLAA 1UXKA 5FULA 4ECRA 3IILA 4P86A 1LBQA 1X7HA 3QG5A 3V1LA 3DB2A 2C0PA 1KWGA 1TIKA 3NCHA 1NHGA 4DM3A 3AY0A 4F0JA 3LH5A 4EJ0A 3ZQJA 1N2SA 3EZYA 4I6GA 1U0BB 2UUBB 2V6FA 1OFTA 3PU6A 1HDYA 2OK7A 2E2HA 1N8TA 2HPAA 2AQKA 2PHZA 3TE6A 4GRDA 4MWDA 2XB4A 2ZRNA 3KKLA 3WLTA 2RDJA 1FFWA 3EDCA 2FW6A 2C28A 4BRSA 1O6GA 1YB5A 5AT1A 1J8QA 3PDCA 3PNPA 3O93A 4NLGA 5BSFA 4E6NA 3TQCA 1JLKA 3GF4A 4DR5H 5C18A 4URHA 3HJCA 4JI6H 3MWFA 4JBHA 4E2XA 4X62H 2WU3A 2XMGA 1FS4A 3UY4A 4N01A 3LQFA 2JANA 4P82A 5DOZA 4DJ5X 1F8UA 2Q46A 1T1GA 4H9GA 4ARZA 2C54A 2HIXA 2QMZA 1TZJA 2F00A 4MYDA 3WYAA 1TZ2A 4CMDA 3UAXA 4Z1MD 4IJUA 4CLOB 4E08A 1QQ6A 3FUUA 4Q4JB 1U1GA 3WHKA 1I51A 2X5NA 1CUWA 2HAEA 3AFMA 2E49A 1CJKC 3TAXA 3IAFA 4LHVA 4HQLA 4MV0A 2OCBA 1FSGA 5A62A 2RKBA 2F4VH 2YVKA 2HN9A 2IXTA 4ENRA 1RKQA 2QP4A 4OD0A 3WV5A 1IBLH 5B3AA 3GUZA 3UG6A 3ONDA 5E9QA 1KBLA 3T5HA 5CYFA 3TQRA 1TQ8A 4OLFA 1BN7A 2PGNA 4KQ2A 4LZLA 2JGIA 4HGOA 3HN2A 4M1MA 4E4YA 4G0YA 4CYMA 3EEOA 1OC4A 3KT3A 2NUTB 3KLBA 4NBLA 4ZEXA 4MWGA 4WN9A 1R18A 1K4YA 1HK7A 1C7FA 5BMOA 5B1SA 4KP7A 1ETHA 3D8NA 2Y4RA 4N40A 2UZAA 2R25B 1YR6A 3AO0B 3MIZA 3C7AA 2G1PA 5TF0A 3SBXA 5KFMA 2KI5A 3LCMA 5HMMA 3C1OA 3L8ZA 4ID9A 3GAAA 1ZJYA 4J9RA 3HOVG 2FG6C 1BN6A 3CX6A 1I6WA 5AUPB 5F2NA 2YJ6A 1ISMA 4D42A 6REQA 3W8NA 4U7TB 1IFXA 3KZ1E 4AJKA 4JYPA 3SFZA 3I3OA 3K7EA 3TQ1A 4F4CA 3TWOA 4E0BA 2K87A 3CLHA 2V6JA 4ZVSA 3SICE 2RJ3A 4OHYA 1YJBA 3DMFA 3VDQA 3PUYA 3I9JA 3V2GA 1W4BA 1ZGJA 4XWYA 2CV1A 3OC6A 1VOTA 4H6WA 5IJWA 1GUYA 3EUFA 3D3QA 3WK6A 4TROA 1CQPA 3SXUA 1JZQA 3DV0A 5HXAA 4O3SA 5KX5A 4C7MA 1G66A 1R0CA 2GQSA 4OF4A 1M1NA 2QT1A 2R1ZA 2IOHA 3U31A 3Q2KA 3DO8A 2EF1A 4CT5A 3QLUC 5JVDA 1NYTA 3G6VA 3N6VA 4QHTA 2AFHA 4DUZB 3BSYA 1F51E 3CFYA 3ZCRA 4FBTA 2XB6A 3FMOB 3ORHA 2PN1A 4R05A 1YIDA 5C8DA 1XK6A 2UU9H 3NNSA 1KARA 4WPGA 3KXIA 3PQFA 5HF8A 5F1OA 5BWCA 4WBNF 2B1IA 3LW8A 4MKZA 4NYIQ 4EKIA 1WCWA 1C1XA 2YU9A 4HWKA 3B1WA 3FNQA 1C4OA 4BNLA 1YBAA 4MS1A 4MQEA 1GTVA 1Z6QA 5I5XA 4FCCA 4IEFB 4QOGA 4PS0A 5ALOA 4RFSB 4HGNA 3MTAA 3F7MA 3RC2A 4HH3C 3ZLVA 1F3LA 5KZMB 1U0TA 2COKA 5L3QA 1DB3A 1U4OA 3MFHA 4PZ8A 3R5FA 3VPDA 5AJTA 4HWOA 1QG0A 3MWJA 4TXJA 1ZRNA 3E35A 3VR5D 4CPDA 3H19A 2Y27A 4PYMA 1TA9A 1L1FA 5BRJA 1GQYA 4Q15A 2W5UA 2HRBA 5JD5A 4ZHQF 3NWPA 1XVLA 4JSYA 1C7JA 2Y0SA 3ANSA 4PPFA 4OSOA 4WLFA 1NW6A 1N6PA 4JQYA 1OAAA 2QTBA 3GXBA 4ARBA 1ZVVA 1KO4A 4QDKA 1M1YE 3U5TA 5EFZA 4O0MA 3B60A 3IBSA 4MEBA 1W34A 4G5QA 4TTTS 3QPBA 4IJ6A 4NX2A 1WRBA 4B8WA 1NDUA 3BQ1A 3UMRA 2AG5A 5LLDA 3PWZA 4BATA 5CITA 4CMIA 3GAFA 3GPIA 2G07A 2Y1CA 4AP9A 2ZT6A 3KYJB 2RONA 4UTVA 4MYCA 4BNXA 5CCEA 2IX3A 3DFKA 4LK3A 1L5NA 3C98A 3HBFA 3DKRA 3B36A 2FHPA 4ILKA 2C83A 2O8CB 5KYXA 2J6SA 3K4QA 2JAHA 1PJRA 4X65H 4QWWA 3ZKAA 4NYMQ 2YY7A 4EJMA 4HHEA 1QGOA 1MP0A 5KQRA 3KYHC 4D4MA 3KBBA 1XYVA 1PWEA 5AK5A 4OREX 4B3TB 1E4OA 3QU4A 3UPTA 3KU1A 2HHHB 2WYOA 3ESCA 3UH0A 1P2VA 3X1ZA 3MBKA 2QNRA 2PZMA 3TTXA 4KXWA 2AUMA 2PKYX 1LH0A 1V7CA 3IRVA 5B1DA 1DJOA 3HYNA 5T41A 5H4GA 3TTWA 3KSRA 4AFNA 4I19A 3G5TA 1PNRA 1LRKA 2ZSUA 3CSSA 5DNEA 1UOOA 1V6AA 2DQYA 1JEQA 3JQ8B 4GKAA 5FAKA 4X90A 4E46A 1L8LA 4NK4A 2VAVA 4TQGA 5FOWA 1XN1A 4UCFA 4Q9KA 4KRYA 4L8FA 1JLLA 1KMMA 1YO6A 1X2EA 3A0RB 2IBMA 3LBNA 2RJNA 3CLSC 2DQKA 5EIBD 1KIAA 5TMBA 1CDOA 2ZRCA 4OBEA 2JHAA 1ISGA 3C2QA 2QRVA 1EXDA 1EINA 3MR3A 3D64A 1CP3A 3DTTA 5DBEX 4Q00A 3TQOA 4OVKA 5IWCA 1PQYA 4CE6A 1VSTA 1W48A 1Z6XA 4YCAA 1NV8A 5JSZB 2QQ5A 4B6FA 5CDHA 1PZXA 4F1WA 3ZEAA 5AVKA 5FL3A