3VPCA

Argx from sulfolobus tokodaii complexed with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Putative acetylornithine deacetylase
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpcA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpcA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpcA01
2NU7B 1T36A 2FP4B 3R23A 4MV7A 3VPCA 3N6RA 1DV2A 3VPBA 4HQ6A 2W6ZA 3LP8A 2R85A 4O7VA 2DLNA 5IYZF 2YW2A 1OBGA 1CS0A 4FFPA 2OLSA 4TV8F 4XYLB 4YB8B 5JVLA 4GGMX 2QK4A 3HB9A 2CNVA 3RUPA 2I80A 3TIIA 1KJJA 3R5FA 1EHIA 4ZI7F 4O86A 3ORRA 2SCUB 4MV4A 4I55F 4MV8A 5D8DA 4HR7A 2DZDA 4YAJB 5CA0F 4O7ZA 3VOTA 2C00A 1KJQA 4O7SA 1IOWA 2VQDA 1Z2PX 4MV3A 4EAAA 4O83A 1EUCB 3AW8A 4MV6A 3TINA 4WBNF 1AUVA 3HBLA 2VR1A 2R7NA 4EG0A 2W71A 2NPOA 3NUAA 2HJWA 2YZNA 3V4SA 2YYAA 3U54A 5JVDF 3R5HA 1W96A 2YWVA 3BSYA 5J2TF 5C8YF 3G8CA 4O7LA 3N8DA 2R82A 1CE8A 1E4EB 4I4TF 2W70A 2ZDGA 4EGQA 4O84A 3U55A 3KREA 1JKJB 4HNTA 5HV6A 4MAMA 3MWEA 1KJ8A 3KAJA 1WR2A 3BG5A 4M99A 2CNUA 4FFOA 2PVPA 2VPQA 4O7TA 3K5IA 2NUAB 4DIMA 4FFLA 3K3PA 2W6PA 4QSHA 2GPWA 4O4IF 1EUDB 1M0TA 4M9UA 3VMMA 1KJ9A 4J6EA 5C1PA 3ETJA 4HNUA 1UC9A 2J9GA 1I7NA 2XCLA 4TV9F 5FNVF 4HNVA 5K2MA 3RV4A 4FFMA 3DF7A 3VPDA 1GSOA 1KC7A 2XD4A 2HGSA 1JLLB 3V4ZA 4E4TA 3ETHA 2FPPB 1VBHA 2QF7A 1M0WA 4O4HF 4YJ3F 5J2UF 3QFFA 1VKZA 2V59A 1DV1A 4EGJA 1M6VA 3RFCA 2R87A 3MWDA 3WO0A 5BPHA 2CQYA 4FFNA 1B6SA 2FPIB 4ME6A 1A48A 2CZGA 5I47A 4O2BF 3GIDA 4IHJF 2NU9B 4IZOA 4IWYA 3WO1A 3BFPA 2R86A 2DIKA 3AX6A 2P0AA 3Q2OA 2ZDQA 5LXTF 4L1KA 5JQWA 2NU8B 4O2AF 4IWXA 2GQSA 5KX5F 2W6OA 5CA1F 1Z2NX 2YZLA 3K5HA 5CAEB 4DLKA 3LWBA 1GGOA 5DMXA 5GONF 3GLKA 4FGRA 4IIJF 1B6RA 4O7YA 5C1OA 3ORQA 1JDBB 2PBZA 4NYEA 1KJIA 3BSSA 2GQRA 1E4EA 4YBZB 2PN1A 4XX0B 2Z02A 2IP4A 4Y8VB 2R7MA 4XYMB 2R6FA 2R84A 3OUZA 4FU0A 4MA0A 4FE2A 1CQIB 1Z2OX 4O7NA 5LP6F 3TW6A 2NU6B 2ZDHA 4M98A 3G8DA 3R9RA 2X0SA 4C5CA 1VBGA 1PX2A 1PK8A 3OUUA 2W6QA 2V5AA 3BSWA 1SCUB 3TIGA 1W93A 1AUXA 5LYJF 5H80A 5HBRB 4XZ3B 1KEEA 4O7RA 1KBLA 4MA5A 2CNQA 2VHEA 1JDEA 3E5NA 3SE7A 3JRXA 2GPSA 2DWCA 2YS7A 4EA7A 3Q1KA 3U9TA 2YZGA 4EA9A 5JH7F 2R7LA 1A9XA 3JRWA 4EA8A 3R5XA 4O82A 1DIKA 5BPFA 5LOVF 4FFRA 4ZQIA 3HO8A 1CQJB 4EABA 2GLTA 4C5BA 1ULZA 1OBDA 5CB4F 2Z04A 3U9SA 4O7WA 5KKNB 3WNZA 2YL2A 4ZHQF 3I12A 5JQGF 4YJ2F 4RZQA 2YZMA 3UFXB 2FPGB 3RV3A 1IOVA 2I8CA 5BMVF 1EYZA 1KUTA 2FB9A 3JZIA 4I50F 3TQTA 2V58A 1C30A 5LA6F 3KALA 1GSHA 2YRXA 4TUYF 4ZOLF 5EZYF 4WD3A 1BNCA 1GSAA 4M9CA 2I87A 4MV1A 1UC8A 4O4JF 1C3OA 3VA7A 2WYOA 4YAKB 1BXRA 4O4LF 1EZ1A 2YRWA 3JZFA 4MV9A 3MJFA 2YS6A 4C5AA 1GLVA 2W6NA 2W6MA 4O81A 2R7KA 3KAKA 1I7LA
chains in the Genus database with same CATH superfamily
1RJFA 3O84A 3AVUA 3K15A 4ESVA 4HYTA 4GM0A 2HK9A 1U3FA 3B1YA 1BE1A 3CLKA 3CLSD 4DV7H 1T91A 3AVWA 2Q3FA 4DBZA 2A0UA 4MW0A 4DC9A 1SG6A 1J1UA 4RY8A 1RPAA 4TV8F 1H5QA 1MEJA 5J43A 3FNIA 5B5SA 4AO8A 3HXMA 4OQNA 2YV5A 4QAJA 4RTOA 5I5TA 1UPCA 2B0JA 3AT1A 4UM8B 1G8SA 2VUMA 1ZLYA 2XEXA 1CY7A 2WTBA 5LBIA 4B9AA 3UIEA 2P6PA 3PWTA 4J9PA 2VHTA 1NY5A 5F33A 1X7WB 3DE5X 2E4AA 4D8XA 3D6FA 5JY6A 3S55A 2Q3BA 3CLTD 5KG3A 3DBIA 3QZ7A 2ZSFA 3STUA 2P11A 5JEEA 1QIFA 2XCTB 1W29A 1QYVA 2Q1YA 3N7AA 3IAUA 1T8UA 2FLLA 2BELA 3MCUA 4FGWA 1P4GA 2VPTA 3IKVA 1OF1A 1GPH1 1Z0FA 3R3ZA 2O8BB 1V6CA 2EAUA 2V9CA 4AWAA 3EC1A 1I01A 4M0KA 1MQ9A 2HF2A 2J0EA 1KS2A 5KKCA 4ZEWA 4JBHA 2NU7A 3KHGA 1COWD 3QXJA 3AVVA 1EFKA 2FJUA 2EU8A 3N2GA 1LX6A 1MLDA 3ZX4A 1N3IA 2PHZA 3AHHA 1KETA 4JI8H 3OZAA 3H5RA 2ZQYA 3ROFA 1LSOA 4CL3A 1Q3KA 1PTJA 3NAGA 3WO0A 1Z5PA 3OIVA 3ELYA 1EDZA 3DEYX 1CIPA 3JPYA 4E22A 4N5LA 1Z5OA 1FTQA 2X42A 4QOGA 4F1WA 2FXVA 1FXUA 1N34H 1JJ7A 1WXIA 1Y1KE 1X80B 5EE3A 3G9QA 1BDBA 1VLZA 2AW5A 3GOHA 3ORHA 2ZTMA 1QV9A 1ZIYA 4PLHA 2X5RA 1N92A 1WDTA 4DLVA 4C43A 3LYAA 4MH0R 4OLAA 4O7YA 1NN0A 1G1AA 4UUAA 3RRZA 4PZEA 3AUAA 4BLWA 5IFKA 1HZZA 3VNRA 2Z8XA 1OC2A 1XZDA 1NJ6A 1TO6A 4BMYA 2FY8A 3BE5A 4RWEA 4YAEA 3QE3A 4PZCA 4NU0A 2XE6A 2QUKA 1JR2A 1WUJS 2V74B 4XIFA 1XK5A 1KJYA 1QLWA 3VR4D 3GPLA 5MHTA 3GEDA 4DREA 3OM9A 2DHRA 1RLMA 4BE4A 3LXXA 4JI5H 2ZBEA 3MT7A 3BF8A 3RC3A 2AC2A 3IH5A 1DC4A 4DUZB 1I2DA 4P5EA 4HQKA 3C14C 4EA7A 1WV1A 1AGPA 1UWLA 2EJUA 2RF4A 5DQHA 2V9WA 1L5KA 2X6RA 2HIGA 3C5HA 3PEVA 3QWFA 4YRGA 1Z75A 1GNRA 1E79A 4RPJA 3BGIA 4OK3A 2YKGA 3OM0A 4WXMA 2AB0A 3D31A 4RB0A 1RFLA 4YLYA 3NHKA 4I2VA 2C42A 3RRYA 4RKWA 2R11A 4CF5A 3QU2A 3LDHA 5A02A 1RLOA 4BCBA 3NKVA 1GV0A 2NZ2A 1XL1A 2HIHA 3EWAA 1VJGA 2IYWA 2P9TA 1ZNYA 1YFKA 2I8AA 4ENPA 2R4TA 1S3GA 3M81A 4KQ6A 5LMNB 1R9MA 1D5CA 2MSWA 2R00A 3LUKA 4KN5A 3PQCA 4IXNA 4L9RA 5THXA 1DIGA 4QYXA 5TT0A 2ZIVB 2ZWAA 1BXRA 2HK6A 3KVYA 4LG1A 4YMIA 3WLOA 2H18A 3EH2A 3C3DA 2NU7B 4I4LA 1EFHA 2AFHE 4TMVA 3HJNA 3N0RA 2Y77A 4LE0A 3N2GB 1POWA 4GSLA 2JFUA 4F8EA 3Q87B 4R0MA 2UUAH 2IHTA 4EEZA 3WZMA 2JA1A 3U3MA 2I6QA 4U6SA 5GADl 2Q49A 4UE3S 3ZY4A 3I9OA 3NZEA 1TTPB 3O4IA 2WYWA 3PF9A 1XF1A 4KLCA 1Y6JA 4Z8XA 5FJIA 3RF6A 1P9OA 1RDFA 2ZUVA 5KAMA 4R7ZA 1QPZA 1SKQA 1RQRA 3ENZA 5AK6A 4Z1MA 3K1YA 4IV0A 2AEFA 5JS7A 2QVLA 4JB2A 4AKGA 5A2QW 4CM8A 3JY6A 3H84A 4BVLA 1TQ8A 5KFOA 3AI1A 5DGDA 1S2GA 4I1IA 1IQPA 1BEZA 4BVJA 1RP1A 1PFUA 1W96A 3QFCA 3LG2A 3G8CA 4IZIA 4ZEMA 3DL4A 3LQFA 5GMOA 1V8FA 3RB6A 1SCAA 4K6FA 3VHLB 3MHPA 2C9ZA 2AKAB 4A03A 4JV5B 2YXPX 4GRAA 1U3UA 3BXHA 1JWBB 3NOQA 2UYGA 2J41A 3TAXA 2CHGA 4AUEA 2GOYA 5KNDA 3I58A 2NAFA 3KZXA 1MJFA 3CZ9A 3GPDG 2FP4A 1DHRA 4N9WA 3SNKA 3T3DA 3G2KA 1YUMA 4LRSB 2OHFA 3RYIA 3H5LA 4MUKA 1IHUA 2AJ8A 3L2OB 3DQZA 4R8SA 2WC1A 1FK8A 3GUHA 3MOIA 5FKJA 3VTKA 4YR7A 4EGJA 2O50A 1WX1A 2C2KA 1VCIA 2M32A 1WF3A 3B1JA 1I3CA 2BFFA 5LBUA 2AQKA 1ZRMA 1SUPA 3G2NA 3QKUA 2VCHA 1XMVA 3ZJ4A 1UZNA 2A33A 3I23A 1PGJA 3F3KA 1UWCA 2Z2ZA 5JLJA 3SKYA 4E12A 3QK7A 1VCNA 2CYCA 2LZ0A 3NDJA 3V1LA 4DPKA 2W37A 3KT3A 4HVLA 2ZCUA 2YVQA 1XDWA 1RXYA 2GZ1A 4WY8A 1BXRB 3L7LA 2PUWA 3QIAA 2R47A 2C9OA 2ETVA 2J3MA 1BIFA 2VTEA 5EIXA 1DJLA 2YBEA 4KUHA 4DDVA 4S05A 3I52A 2EW2A 2JJ1A 2B25A 2QAIA 1I32A 4YK7A 1E1QA 3VYVA 1XNHA 4HAYA 1TC1A 2CMHA 4PINA 5EVJA 1IPHA 1OU4A 1UMBA 1YCGA 4G2TA 4W7IA 3WYAA 2FMHA 1ONPA 5B1HA 1YJAA 1Z0KA 4NATA 1N2SA 3C6BA 3CVOA 4JUBA 4RMGA 1MENA 1XDDA 4H1HA 3E5NA 3CKYA 4ASUA 2HC9A 3VAZA 4HH0A 4PGHA 1Y4ZA 3C41J 4AJEA 2WTUA 2HUNA 4IH9A 4R1LA 5CPBA 4L6AA 4BLRA 3OCWA 3P5SA 3K0EA 3PENA 3IQEA 1Z18A 3EY9A 4FOOA 2K2WA 5BY2A 2XGMA 4QT0A 4RYLA 5IBQA 2H65A 4CM8B 1PV4A 2WHEA 4C1BA 4F60A 3D43A 1YB5A 5KNCH 1OPXA 2BCEA 4HY3A 2E4WA 4QGHA 4M8KA 2GBLC 1P9NA 4GBED 2SICE 2VYNA 1DRVA 2ZK7A 3FMOB 3WKCA 1IJKA 3WMRA 1KYXA 2ZJ0A 3S1SA 3LPMA 1T5OA 5AQ1A 5BN4A 2CL0X 2EWWA 3VC1A 3AP2A 1O58A 3FDIA 4C2BA 2ENUA 2GUWA 3FDSA 3KYCA 2OPBA 2Z5VA 2QE6A 1J7KA 3OD5A 1I9GA 2A7QA 1OBFO 2VAPA 5K8IA 4TYMA 2O9JA 1FUUA 2JFWA 1EJ2A 4XX0A 4EG4A 4FNAA 4X1KA 2FP4B 4MV7A 3C3AA 1Q1GA 4HQ6A 1CZKA 2L42A 1ADCA 1HORA 5FHQA 3RYIB 1TAGA 3NBUA 1FRQA 4N6NA 3LUJA 4YJDA 3JR3A 2O23A 4FQ8A 1JJBA 1SCUA 3T5PA 4JQCA 2BFFB 2J09A 1AZWA 2LV8A 4MPDA 1NBWB 3BGWA 1WUIS 2A67A 2VJDA 5T64A 3VZRA 4J7UA 3LY5A 1W48A 3TL3A 1L6IA 3UMRA 4R5HA 4LVNA 4IS3A 2C4TA 3MGBA 1DUIA 2YCHA 5JE8A 3JXEA 1G6Q1 4JI0H 4HATA 2R5NA 2DMRA 1JAIA 3W9BA 1EVIA 1YASA 2B36A 3VPFA 3L4KA 4DB2A 1IEVA 3C3MA 4PZ9A 4RPGA 2YOHA 4IR1A 3OBIA 2ZDGA 3PFIA 3W6NA 1PV1A 2O5RA 4I6EA 3HCPA 2WUEA 3RADC 1LQ2A 2H5EA 4BO6A 3ZJYA 2P65A 5JANA 4XWYA 2PVPA 3S1LA 1RBZA 5AJXA 2REOA 3VVCA 5JAQA 1UMBB 1VTKA 3NIFB 1HFJA 3FPCA 3LQQA 4DCTA 4B44A 3O90A 3HKDA 1WDMA 2YN4A 4QM6A 5C37A 3VU1A 4CGYA 3EK2A 2NPFA 1GN9A 1O57A 4FKMA 2OHJA 2LCIA 4J7XA 2ZAOA 1SXJA 2O1XA 3DE2X 1SHJA 3S7TA 5KREA 1G291 1C1DA 1JX6A 3FXAA 2VJCA 3M6IA 4N47A 4OFBA 4HQ0A 2VZ9A 2EQAA 2ONKA 4KQ2A 3HKEA 3KXPA 4EPWA 1E4YA 5AH0A 1GYRA 4I66A 3GYGA 1KOJA 4TTQA 1IE3A 4R4JA 2FCAA 2FJ0A 2ZZMA 5KJ6A 3F8WA 3EXHC 1IYEA 3ZZ1A 1G2PA 2XGSA 4JI1B 5F9MA 1KRXA 2ZSJA 1KE1A 5KEIA 4QJ4A 1GL9B 3QLUA 3OZTA 2HBQA 2D4HA 2HEIA 1F4LA 1F0PA 2BHSA 3UEOA 2FW1A 4KXMA 4CW7A 5BN4B 4GGPA 2VWPA 5EJ7A 1LCIA 4K28A 4PC6A 2HA4A 3K70C 5AKKA 4F9GA 1MRZA 1RC1A 2OM2A 3T7CA 1EAYA 4Q19A 4XX0B 1YR2A 4X1KB 1NVMB 2VPXA 4ZEXA 2PH7A 3RSHA 3L0YA 1NKSA 2RGCA 2WB4A 1LSUA 2ZYVX 3K1TA 3RABA 5AM1A 1XTPA 2CFRA 4ZYLA 1WY5A 1M2KA 1RAAA 2VYVD 5BNFA 1SCUB 2DT5A 3E0XA 5H80A 1D6MA 1M2EA 1EZ4A 4BCDA 1FRFS 1VKNA 1U6KA 3QYAA 4K05A 3A6HA 5AJYA 3OQMA 4KDRA 2ZULA 2LIPA 1P45A 4NOLA 3NBAA 5HE9A 2FVYA 4MGHA 3IUEA 4XUGB 1EXMA 2XUGA 4OQZA 1LRJA 4F4JA 4IIHA 3L8CA 5JDCC 2NMVA 4MKHA 2C5GA 3R5KA 1PK7A 2HDHA 2ZRCA 4HS9A 5ESRA 3C6QA 3ZU3A 3K2IA 4BVFA 1CQZA 3T4PA 1PGQA 1GGVA 3LRXA 3DV2A 4WGFA 2R8KA 2CKDA 3CVUA 2YXNA 4DY4A 2H6EA 4GS5A 3NBYB 3AFNA 3M6UA 3RS8A 1D5WA 2Z83A 2I1LA 5FTWA 3NHUA 4CC6A 3HKDB 3J7AK 3IYLW 5GJBA 5I9IA 4Q1CA 4MQ5A 3SIXA 1SXJB 3DCNA 3T38A 1V39A 4MS1A 2IYZA 3TRKA 3J7TA 2DG2A 3PW4A 3G0HA 1C1DB 4I8DA 5I5YA 1QB8A 1A7JA 5CNJA 3UA3A 1FOEB 1RMQA 4BO0A 5LNK1 3W2IA 3HKEB 8ATCA 1VLHA 4TT8A 1YZYA 2JANA 1YVEI 3PNOA 3DEAA 2J07A 3THXA 4ILKA 4P81A 1S5PA 1YA4A 3FBWA 4TTJA 2UUCH 3WGLA 2PR7A 2GQ0A 3I4MG 5ARCA 1ISFA 3ZNQA 3ZDXB 4NENB 4Y6SA 3DD5A 4PWZA 2AJBA 5TJ9A 3CWZA 1I80A 2C4VA 1OA1A 1OI3A 1RZUA 3CH4B 5AW3A 2XSZD 1H4SA 2QRGA 1LPPA 1SVLA 1E5LA 2NPOA 1M1YE 1ISGA 1J2UA 4DV1H 3W6UA 4CQJA 4X6XA 1G21A 2IX9A 3QEAZ 2ASVA 3R24A 5G0VA 3N8DA 4YBRA 4H4EA 1KS9A 1L1FA 4NV3A 1PFQA 1JIQA 2QTWB 8MHTA 5LZ2A 2IOQA 1Z47A 5C8YA 3GVPA 4KQGA 4R8RA 4M6WA 2G0NA 4CTMA 4CLDA 5L7WA 3B60A 2DX7A 3AR5A 3GLGA 5I7EA 4TWJA 3N8IA 4HYKA 2XOEA 2OVFA 3GH1A 1Z6XA 1U65A 1NKVA 4J6EA 4OAOA 3RB0A 2FMIA 1U9IA 1K1QA 3BX1A 3GA5A 4X8MA 3FYDA 1Q44A 3AUYA 1ODJA 1TIPA 3F4BA 4COKA 5BWXA 2VXYA 3EXG2 4TPKA 4EHKA 1NM5C 2JKZA 3NGMA 5CUQA 5D2CA 2KSQA 1EVEA 1SWWA 1XIVA 3S2FA 2HWKA 2F3PA 1X7GA 2O2XA 3ZCPA 1U7WA 2F48A 2F3RA 3D0QA 1G19A 2J3JA 3WR5A 1M5RA 4GZ6A 2AQIA 5BPHA 3FKJA 4LHYA 3UV6A 2Y0PA 1WCWA 1DT3A 4UARA 4IHJF 3V7UA 2O2JA 2GEJA 4C4RA 2WWFA 1BKDR 3VZQA 5FYQA 3AEQA 1IH8A 2CLLB 5E2AA 4ID3A 4QULA 4B3FX 4DMKA 4BZZA 3V6JA 2ZTSA 2GMWA 1RRPA 2VA9A 1DAGA 2GM3A 1OIXA 5TMEA 1NX6A 3PPWA 3PQ7A 1W4BA 1ZYUA 1GGOA 1RAHA 2BY4A 3OX2A 3GFTA 2QTRA 3EEQA 2Y93A 1NVKA 2OHVA 2H51A 2WUWE 3BXFA 2GAOA 5FI1B 3H0GA 1VFNA 4R51A 1N32B 1Z17A 3X1KA 5BSMA 4HTFA 5EC8A 4MS1B 3I4LA 4BQSA 1RI4A 1PI3A 4BLSA 1GPLA 3JSLA 3NC0C 4X8OA 2FMUA 4QYMA 4ECWA 1MJGM 3PXBA 1UT6A 3WGNA 2H92A 1DKMA 5LYJF 2JB9A 4O7RA 4DYHA 1MJGA 3THXB 5CEJA 3U39A 2DUWA 1H0SA 2C20A 4TWBA 3KHHA 3BHIA 4N0EA 3R6TA 1XRPA 4KXNA 5JJKA 1SQSA 1P0MA 4AIRA 2BGGA 3R76A 3F90A 4BAUA 2HYIC 4G1FA 4O82A 1C9DB 2VP6A 3DLBA 5CVJA 2I3GA 3PD1A 3OURA 1G21B 4AY3A 3V8BA 4BUZA 3EH1A 2Z5GA 2ZRBA 2PRKA 1GYFA 1U0JA 3G2HA 3DAAA 1LK7A 4BECA 4QO7A 1KEPA 3NHZA 3OZGA 2JGFA 2BONA 3HOVG 3IXLA 5C8YB 4X00A 1CRZA 4M6WB 1A5SB 4H0NA 4B6PA 1GO3E 3TLZA 3GLGB 2CZCA 1Z38A 1WXFA 3AR2A 3GL9A 4F50A 5JS2A 1AA6A 1GZVA 3QTLA 3RU2A 2BMAA 4QICA 3LS2A 4RUKA 4ZYUA 3PC2A 3HN7A 2P5TB 2RG7A 3UKJA 5FHRA 1U3GA 4O7VA 3H5IA 3F7MA 1JP7A 4GAEA 4Y1FA 2WJVA 4RNDB 2D0IA 4PZ8A 2VG8A 3MA0A 1PWEA 4Z3OA 4GC7A 2OILA 1EFDN 5ADWA 3W0LB 3T7KA 3RGZA 1F38A 2QW0X 4B40A 1DP4A 1XZGA 3ZHVA 4KAJA 4GEGA 4A3BG 3LF1A 4E32A 1Y63A 3VKGA 1RMTA 1C9JA 2RJOA 3ZXUB 2ODAA 4D6XA 4LTDA 1NZDA 1U4OA 4JI2H 4KUEA 5AYVA 5FLXW 1ZR2A 5JIBA 4KNVA 2OCXA 1Y6QA 3AEQB 3H65A 2ZREA 5D1NA 3V55A 3S8YA 5C3MA 4V0NA 2EZ4A 1P77A 5FPKA 1VPDA 2VF4X 4JNCA 3FMPB 2LP4Y 2JI6A 4JHLA 2X23A 1P33A 1VMAA 5AJVB 5AVZA 5EHGA 3EPHA 3Q4GA 3TNJA 2QI9C 3TVTA 3LBNA 1KPIA 4TS9A 4ZVOA 1QYDA 2C4NA 3ROTA 1TTQB 2P1ZA 5DP2A 1YZ3A 4HTFB 1O5OA 2JAOA 5MDHA 3C97A 3N41B 1NUAA 4KAFA 3RASA 2V7QD 5D5QA 4BKUA 3HA7A 3BCHA 2V4QA 1E6LA 4FCVA 3ANXA 3P32A 1U2QA 5IXJA 2X9VA 2O6HA 3C5EA 3GZ4A 4OSPA 1I7PA 3H1BA 2G63A 4EKGA 2M2IA 4G9EA 1Z5GA 5TPZA 2OORC 4DRXA 4YONB 4KWTA 4DQLA 1IN6A 5BT9A 4B5KA 2CXPA 3LVQE 1NF2A 1X94A 4YACA 2VUSA 1J2RA 3V1NA 3DFFA 2R87A 5I6DA 1Y14B 4IX9A 2UVQA 4O2BF 2PJDA 3P52A 1C9YA 4PX3A 5M5BA 1F0NA 4HLCA 4MQLA 4ZHSA 4NPHA 1QOZA 3MT8A 5TQ0A 4NAUA 2FGJA 4D9GA 4NG4A 5DM70 1ILEA 3UMMA 3ZI7A 1U0HC 3DKVA 4GLBA 2ERCA 3SY8A 2RJNA 4K81B 4CMAA 1KXZA 1XD2A 5K8TA 3EEFA 1X9HA 3W04A 4FD3A 4GLFA 2ASJA 3D6UA 1WG8A 4PICA 1U28C 1Y4UA 3MUFA 2AXQA 2WTFA 4NG5A 3GJ3A 1X38A 3MUNA 1MG5A 2IHKA 1JHYA 1L4EA 2R84A 1SUSA 4TS4A 1FYEA 5FJJA 3ZI0A 1U0RA 4DV2B 2O14A 4IOMA 5C5IA 1G8PA 3KR9A 3GUVA 2ES4A 4IFTA 3ONDA 5K0JA 2GZRA 3ZV7A 1ZONA 4QLOA 1W2WB 5IHPA 1IRXA 2JIZD 2B3DA 3HRIA 2VDMB 2ASEA 4Z2YA 3OHSX 1UXOA 1UAAA 1HO3A 3T0GA 1ZGJA 2C5FA 3GP3A 5FPSA 2BSQA 1EJ0A 2IA6A 3L04A 4QFBA 2ANBA 4C7MA 1S2DA 3OQIA 2IYTA 3R3UA 4TKZA 2NU9A 3I12A 2DQYA 3NDRA 3QF7A 2WF5A 3HM2A 4UU0A 1DKUA 3VVLA 5GGXA 2ZXUA 3IQDB 4NICA 3T94A 3WGMA 4C0QC 3U37A 2IUTA 2QTTA 4WDRA 2G5CA 2X1MA 5DIFA 3RB3A 4ZN6A 4EKIA 3ZZNA 2OLJA 3U80A 2YRWA 4PAGA 5G53C 4HDRA 4PGAA 3VI4B 1TT5A 1SXPA 3WWJA 4DL2A 4TS3A 1WEHA 1KWGA 4E7PA 6NULA 3G88A 2HGWA 3UW1A 4W82A 4JBGA 2O1WA 4DRXB 4HQOA 1AM4D 3PYLA 1QIDA 1H69A 1R6BX 2FV8A 4DR6B 4QWMA 3PKJA 1DXYA 3MCVA 1QHYA 1DNPA 1JQ3A 2B8EA 1VPWA 1JQDA 1EB9A 2FWJA 3OE4A 4J2HA 2WR8A 3L5KA 4P3YA 1TYBE 1YQDA 2BHLA 1KYVA 2Q4BA 1IAQA 3L7YA 2RDIA 1YU6A 3COPA 1L2TA 4JUFA 5TQ0B 3GNLA 3GQVA 3W3AH 5JCPA 1HLFA 3IAXA 4MV6A 1UK7A 1DOAA 3FOBA 3LHIA 4MS4A 4WE3A 2HKIA 3GUUA 3L41A 4HYYA 3IAHA 4XSHA 3RBDA 1XD2B 1OIWA 1NXTA 2A5FA 5JD3A 3U7HB 5JNUA 1XTBA 2VH5R 4L95C 3DVQX 1GRRA 5EEGA 5L4LA 3JD1A 3FWHA 1S97A 5KVSA 4DL5A 1MC4A 1WSCA 4YQZA 4AYXA 2SNIE 1O03A 4FPXA 2UV8A 4DIMA 3IEUA 2IXEA 3ZWYA 3MK31 3U16A 3WNVA 4QQ8A 1OZ0A 1Y1VA 4BQIA 4W9NC 3VHRA 3H5NA 1KZ1A 1XGKA 3ZNOA 5CYFA 1I7NA 1Z56C 3S6JA 3WSWA 3W5SA 4UCXA 1TW2A 9ATCA 2VH2A 4WA7A 2BOVA 3SR4A 2QIPA 4DXAA 5DN6D 1KO1A 2IIBA 4HAVA 4NBRA 5CHEA 1CLEA 4P38A 1Z68A 5B3AA 3E9ZA 3BXXA 1XWIA 2O2HA 2CUTA 2ZWOA 4X7MA 2JGJA 2NXCA 3A6EA 3L4SO 4E14A 1F9AA 1B6SA 3K0CA 3EEBA 3OQIB 3WHIA 4GF5A 5BXYA 2CZGA 1BKSB 2NU9B 4TWRA 1CUSA 3VGJA 2BTEA 2VZLA 1Y9DA 5JV5A 5AVVA 1SOAA 1R4NA 4EHAA 1GFSA 1PDOA 4WEQA 3ABRB 4GOXA 5F3DA 3CVXA 3PW0A 4C0AC 4QIWE 1Q0LA 1ODTC 3CW2A 1HPLA 3V1YA 1SPBS 3V2UA 5KYXA 4PAQA 2GDZA 3OQ6A 4RY9A 1M6NA 2AK3A 3HDTA 2UZ0A 4QWDA 1TT5B 4ZC8A 4DABA 2FW7A 3EWSA 3QUSA 3ZU4A 3R41A 5DI3A 4UFPA 1T26A 1WS6A 1W30A 3BMQA 4MWEA 2EIXA 4WUVA 5GVSA 1WWKA 4Z9FA 2QENA 1F51E 1ZD4A 1OZAA 4O3FA 5TDHA 5KFZA 1H8HD 2QSYA 4KQ1A 4A8PA 2A4KA 1CDEA 3IJ5A 4DDKA 2B8TA 2CMGA 1NXQA 2IHVA 1E3JA 2I9KA 1W85A 2BBWA 4IXMA 1XZIA 4MUMA 4GGOA 4PZ0A 3W5IA 4D3DA 5I60A 2OHXA 3PEFA 2Q5OA 4U6NA 1Y9JA 2KBEA 5E6SA 4MS4B 1J5EB 1EWQA 2JA2A 3DOIA 3QKSA 2UVVA 4TN5A 4UKDA 3C8UA 4CT5A 1A9ZA 4Y9TA 4JQOA 1HWYA 3K0FA 3DL7A 3I1FA 2HV9A 2QX8A 4P36A 5BSKA 1OU0A 2DPIA 4I9GA 5J9FA 6ADHA 2ZR9A 2IQIA 2QU7A 3AJAA 3KDPA 4NXMH 3U3DA 5TIIA 5HSGA 1FSZA 1D0IA 3N05A 3MCWA 4Z1OA 3ZZUA 1LI7A 1QGUA 2NVWA 1W36C 3ZHTA 1KMHA 4CLEA 4Q1EA 2I1WA 4YAWA 5E2IA 1ZNXA 3UVEA 3EPJA 4Y3UA 1I9CA 4D4JA 1PNRA 2PUFA 2GF0A 1IYDA 2AQHA 4K3UA 1JZQA 3HO6A 1DV2A 3QG5A 3EOBI 1PG5A 4NYIQ 5DIZA 4QTUB 5C8DA 1TA9A 2I7XA 2ERYA 3NTUA 4KQKA 5GIPE 1HTBA 3TLAA 2DHQA 5K99A 1CKNA 1KTAA 1B1CA 3BDVA 1UBOS 1K7XB 4B2LA 4BO9A 1E9AA 4Y6RA 3HXLA 2I7TA 2VHCA 4FWBA 3WYBA 3QQPA 2DOKA 4WHMA 1UM9B 2FOLA 1GZHB 3GTQA 2O3QA 1BU5A 2REXB 1MB4A 4FBMA 2HZBA 1F2DA 4GMKA 5DTMA 3TUIC 4QEDA 4RM3A 2NUTA 2ZZNA 2JFVA 5KYXB 1L1EA 3I6BA 3KEGA 1EP9A 3I2FA 3T8YA 3IJEB 5BNTA 2CVQA 2QG4A 4BV8A 5B1IA 1B0AA 1A4UA 3OLQA 4XQ9A 2NACA 2PG3A 5DI3B 5CRIA 3WL5A 3I6ZA 5EIBD 5TX7A 4I4TA 1XMXA 4Z6KA 3BMQB 1LF0A 1X1CA 1G8FA 2JLYA 2Q6OA 4EP1A 3TW7A 3SI8A 3K3PA 5CX1A 4BMDA 1WUHS 4P0PB 4LECA 4HEA1 1VRCA 4DIEA 4TVKA 5BNWA 4Y0NA 2HIAA 3TS1A 3WL3A 1DBIA 4B7AA 2J48A 4EUSA 1W85B 3O7MA 4MLCA 3C3YA 2WNIA 4ENWA 3PDJA 4E5SA 4CI0B 4PX9A 4LZLA 5I7HA 4QHTA 1NN3A 3LUHA 2NVYA 5E6SB 1NQWA 3FUTA 3PXEA 4RTQA 3SE0A 4QBKA 4QL3A 3QKSB 3Q7IA 3TG8A 4UCOA 2VDLB 4ZOQI 4MINA 3K0FB 4ME6A 3GTKA 1RI2A 2HPZA 2QPLA 4GPIB 4UEJA 4RSHA 1CY2A 4YTEA 4IF6A 1NZJA 3PV0A 1NBOA 5T6MA 1KNXA 1P3DA 4HFRA 3OEED 2NO0A 1M7HA 3H13A 5DBGA 3PX2A 1X8XA 2GFHA 2R7ZG 4MUYA 4E1BA 4OHPA 3GLKA 3TLKA 3B1KA 3P2IA 1QGUB 3QHPA 1KMHB 1NE7A 3N7UA 1ZGGA 5B7QA 4ZOBA 2XA1A 1ZHSA 2PSSA 4X8HA 5HVNA 5P21A 1YACA 2AOWA 4WQMA 1M1NA 3KPWA 5KUTA 4I8XA 5A7GA 4RKYA 2OHOA 1R64A 2ZGVA 4TSRA 1KP3A 2WV7A 2WVGA 5HM8A 5HCIA 1CKNB 5EIHA 3T61A 4K9LA 4X63A 2I99A 3E3MA 3BTSA 1VL0A 1YB7A 3CUEF 2AJLI 4R2KA 3LC7O 1ZCBA 3QWAA 1EX6A 5FOTA 3MAAC 1KJWA 4FWTA 4GPBA 4IJUA 2WWXA 4Z2AA 5KU7A 5TGZA 4OMUA 3U48A 4CR8A 4BTEA 1AC5A 3AFMA 4J75A 2FYTA 2FPWA 1RVV1 2IE8A 4ZMSA 3WS7A 2NUTB 4EL5A 1F60A 5I3CA 1TZBA 2E85A 3DDNA 3N2IA 3TDKA 1ZG3A 3ET5A 1N6HA 4JUCA 4YRSA 4YUAA 2VWGA 3X2FA 2EYUA 5DGCA 1YJ5A 5ALPA 3DQPA 3N86A 5CX1B 1FU4A 1YJQA 2PX3A 1V7QA 2IHUA 4WASA 1OXSC 3O8CA 2VYCA 4F4YA 2FMTA 4F45A 2ZT6A 3M33A 2IYQA 4LZOA 2Q9AA 2FSGA 3EUWA 1VM6A 3FA2A 3RAPR 1HDYA 1XKTA 4BWFB 5J4KA 2FEKA 1CZUA 1FTWA 2Y1OA 1KZ7B 4F11A 2X9QA 1O77A 1CUVA 4E31A 5B3JC 1Y5MA 5SZJA 1N6IA 4R3NA 1FVOA 2XUHA 3ESRA 2JVJA 5HUJA 5H8WA 5ISMA 2EKBA 1XD9A 4KO1S 2MCFA 5TGTA 4MV8A 4S12A 4UNPA 3H83A 4B5LA 3PGJA 4L27A 1Q1AA 2VDWA 3BMOB 1HDEA 2DUMA 5BWRA 2PK3A 2B63A 2HX1A 1J2YA 1S8OA 4UXHA 4LHEA 4COOA 3EDCA 1SB8A 3AYZB 5IVKA 5FBVB 5L3QA 4AKEA 1OWOA 1MPXA 4IJ6A 3N8KA 1C29B 4A7PA 3UJDA 1FRVA 1YK0A 1G7RA 5EGSA 3EUEA 5JJIA 5KZMB 2H2FA 1IPEA 3DJFA 3DOFA 4LOHA 3DE4X 4JC8A 5AVKA 1V48A 1ZHOA 1PFYA 2DT8A 1E2UA 5KX5A 2JBWA 4PLYA 1M1NB 1GJRA 1S9DA 4UUQA 3KFVA 1UOOA 2JGRA 2R4UA 3L1IA 1L7PA 4GZLA 1E1KA 1VP9A 3EPRA 5KC8A 1Z26A 1Y7TA 3X1YA 2ZBDA 4I1VA 4J90A 2CV2A 5I4BA 4D3XA 3R6DA 3LM8A 3CVWA 3BM5A 4PSUA 2J9GA 3A25A 1ODLA 1UL1X 4H1WA 3AJ9A 3NUZA 2PKQP 2HAEA 2WU8A 2IXFA 4ID9A 4NBUA 3ZHBA 3A11A 4O3QA 3GJRA 4AMBA 4WZ6A 4EG3A 4WADA 1GEGA 2O48X 3QA3E 3IKLA 2P2YA 4MCJA 1J8QA 3K6KA 4TT3D 3GZJA 4ER3A 2MR6A 3RTEA 1Z34A 1K6XA 4RK4A 2D3TA 3QVKA 1C4XA 3ICCA 4TQGA 1EG2A 2PMCA 4D4IA 3I0NA 5IZCC 3WNCA 2ZRHA 2HN9A 1T2AA 3HXPA 2WP8J 5L1LA 1JLKA 4TWIA 5LL6b 1QONA 5HKLA 3T3HA 3LWBA 4BO8A 1CJSA 1EFLA 2W4QA 1PZXA 3BSFA 3T5DA 3C98A 3T5LA 1HYBA 1ZH8A 4KW7A 1RLJA 2ZRGA 1EXNA 2W6JD 3ZR4B 4TL6A 4LVCA 3OBBA 2WZCA 2QMHA 5T3YA 3VV3A 4QYTA 4BWGA 2F62A 3HJCA 1G5PA 1QHGA 4Z4CA 4MVXA 1DCFA 4UATA 4B0PA 4QREA 2IYLD 3A9SA 2F1OA 2OSVA 3RPEA 3C6YA 5HF8A 1MX3A 4MR7A 1VL6A 1B6TA 3ZHQA 2CCGA 4QQFA 4DMFA 4D9MA 2VDWB 4DHWA 5LN1A 4OAPA 3SJ7A 3SIWA 3PTLA 4HSEA 1Z4PX 2YV2A 1BSVA 1AUPA 2QNIA 4MLDA 4E46A 5L3QB 3A06A 1DXQA 4NCAA 3N2LA 3UANA 1KVSA 2RC6A 3F74A 2X86A 1PYOA 1C7FA 4HN4B 4ZCMA 1PFGA 1ZDMA 5LOVA 1G20A 2LPMA 3RYTC 3FYCA 5ARBA 2WZQA 1Q19A 5KX5B 3TSCA 4Y98A 1F8UA 2NSYA 3ND9A 1O97D 3BAAA 2VJYA 3L7IA 4ZEOA 4FGJA 1P1RA 1ZFNA 1WOMA 1N2GA 1SHLA 1PUIA 1GL6A 3AO0B 1C7RA 2GM4A 1ORTA 1VE3A 1MX1A 1OFVA 4Q4JA 4RY0A 5AO9A 2IYUA 1M3SA 4NU6A 2YJ5A 5FPRA 3A2NA 3CF6R 3GIWA 1VHQA 4RXUA 2Q28A 3AUSA 1GDDA 3QUAA 2DFDA 3F8NA 4PGFA 1ECFA 1R6UA 5KYNA 1RJGA 4UNNA 1U7UA 2QM3A 1Z2AA 2DHEA 2PH3A 1E1RD 1JAZA 4GLWA 2GSDA 4Q3DA 2HA7A 3VNAA 4EG6A 4LCJA 2P2SA 5C34B 4AKHA 4DG9A 4MJ7A 1SOMA 4M1QA 4ISCA 1M8PA 5TMPA 4OP2A 3TL6A 2GN4A 3TINA 2W00A 2AD5A 5G1PA 1E2HA 2GAAA 2HCTA 1Q0TA 1XU9A 2C78A 1N0VC 4FDAA 2KHZA 4XWAA 3GTGA 3OX1A 1Y81A 1I94B 3EODA 5L40A 4Q1VA 4PPNA 3Q15C 3WK4A 4G5HA 5DYWA 1KQNA 3CURA 2APJA 1K6IA 3TOVA 4W63A 3T9AA 4UHKA 3E2MA 2ZW9A 4LHZA 2OQRA 3A0UA 3FCSB 4G0NA 4FFLA 2AYYA 1G42A 4EYKA 3O1HB 1CR4A 5HKBA 3A70A 2N3ZA 4HSGA 5IKXA 1IXSB 2LVBA 5CIWA 4YRAA 1E9VA 5EJGA 1B8NA 3L7JA 3PPXA 4K3VA 4RIHA 3SP1A 4HZIA 4ZZ3A 4EQ5A 3EBLA 5COAA 4HD8A 2BISA 4DOMA 4XUEA 5FPHA 5IP7G 1A3CA 4KIJA 2QTAA 3DBVO 2YZ2A 4J4HA 3CE9A 1FCJA 3SVTA 2YIJA 4PHGA 4B6FA 1DV1A 1CJTC 1PEAA 4IVPA 3EZLA 2GPBA 2PJZA 1I2CA 2ZFUA 1SQ0A 5T67A 5LZ8A 5HK8A 1UBEA 3GJXB 5LOVB 5HZMA 1W73A 4EA6A 1G20B 3UWDA 2JLZA 2IGBA 4Y6OA 4S1NA 3DDUA 4NF2A 2CLMB 4L22A 2AEEA 4WOJA 4M38A 5FR2A 3EPPA 5ESWA 2YJGA 3REGA 2A7XA 3WRYA 5EWMA 2VHWA 1HDGO 4AU1A 2DBVO 1SELA 4BL5A 5J4VA 2XCAA 4BP1A 1PWXA 5LC1A 5FOVA 4MITA 2ZJBA 1H2ZA 4GXRA 2ET6A 1UZAA 3DTVA 1E1MA 2C4KA 5K6AA 1G5FA 1YMQA 3G6XA 4YMSA 5I7OA 5AVSA 3HI6A 3LX8A 4H3HB 3GW8A 3JV7A 4Q4JB 1UKEA 4R1TA 1F4VA 3DZKA 4F4UA 4A10A 1KO5A 3CSUA 2Q2OA 1ISMA 3PKZA 3VOSA 5K3OA 4WIAA 5BSUA 1NX9A 4CMKA 5DB4A 1RCFA 3R0JA 4DIBA 1XBTA 4CUZA 2ZJ1A 3ML1A 2VXCA 4D25A 1SKYB 3KPJA 2R1ZA 3RODA 3VYTB 3T7RA 4KIWA 2QBYA 3LKZA 3B48A 3I45A 1DC5A 1EUZA 3GLSA 2QLNA 4V2IA 1PNTA 4TM5A 3UQYS 2ID7A 4LHXA 2NSDA 3UWPA 1U02A 3QMMA 1MX5A 4O59O 5CFLA 1DWQA 1ZH2A 1QRSA 4QJFA 4NZOA 4AXXA 1ISHA 4BCCA 5B1EA 1QK4A 2JKYA 1NMSA 1DTSA 4DHEA 2GWRA 5ICFA 2RGUA 4C22A 5DI9A 4BWVA 3H9BA 3EXHA 4FGUA 4I4CA 1H4VB 1UPXA 2CXSA 1MT3A 1W52X 7AT1A 2YJ6A 5K0FA 2ZB3A 1WKVA 2PSHA 3I61A 16PKA 4ZCRA 3EA4A 5ALQA 4MTEA 3KOYA 3BMXA 1WMFA 1SUCA 3LDGA 4FM9A 2Y6UA 3F97A 1ZZGA 1XLTA 1T36A 3C74A 3VPBA 2OM6A 5SY9A 2GT1A 3NMUF 4D45A 3PFHA 3H3VH 3IPYA 4MPPA 4B46A 1B2RA 4H7PA 1OASA 4N48A 4CQMD 2V4MA 3ST7A 4AF7A 1ZK2A 3SM9A 1IBMB 1DAIA 4GMDA 3O94A 4DADA 3UV7A 3HU1A 1Z15A 1SXIA 4GMXA 3N39C 1L4BA 4EHBA 5CA0F 4RYDA 3D2LA 1G41A 3RS4A 2I3AA 5J3JA 4X20A 8AT1A 1CEYA 3BDIA 5EWMB 2J7PA 3NWBA 4XIGS 2BQ3A 4B3BA 3ZCUA 3ZZTA 2VUGA 3AGQA 4EPTA 2W11A 4TTTS 1VIMA 1BXGA 4RZIA 2QJFA 5TT1A 3UQZA 1MGPA 1JDPA 3KZVA 5HF5A 3MXTA 2Q46A 3LDUA 3SS9X 3U55A 2C3YA 4OP3A 2ONYA 1YHNA 4N5DA 1OD6A 3KYCB 1KJ8A 1EDBA 4PR3A 4QSMA 3FCYA 4D0RA 1JXOA 1W1WA 6GPBA 2HGXA 3OIGA 3OA2A 3UENA 1RWMA 1Q3HA 1V96A 2C8KA 4KXLA 2A78A 2EOAA 4RK1A 1SC4A 3P27A 5HG0A 1GVNB 3H5OA 1WW2A 5EP3A 3T5CA 2QBYB 1EZZA 3IHKA 1Q7BA 1UXJA 3WGZA 4DUZH 1IWPB 1NOJA 3C5VA 4B3IA 4B8YA 2IHJA 2VDVE 2A0YA 3U0VA 1SVNA 1GU0A 2BKAA 4AKTA 2I6GA 4FYVA 1CXZA 3FM9A 1WB4A 1Q2UA 1YI8A 4DEXA 1OX6A 1XAJA 2WSYB 3LO5A 5KOYA 3OECA 1B3BA 3OVMA 1VE6A 1FQJA 4TL7A 2ZT7A 3TEMA 4X94A 4RCYA 4D9JA 4RHEA 5BYBA 3U56A 5ALJA 5F3RA 2QLBA 1Z3IX 2XBLA 3ITDA 4M0FA 2QMZA 3IEMA 2FZLA 3GY0A 4M46A 1U2DC 1J25A 3OPMA 5DTJA 4RHXA 3RSOA 5G3YA 5FT9A 4V38A 4DCVA 5DNAA 2GAJA 4IH1A 5JS6A 3H6HA 2ENWA 4E5PA 4AF8A 1T36B 4YRIA 9ABPA 3TM5A 1I51A 4AM8A 1YE5A 4QLAA 1QCCA 1BRMA 4AJPA 3A2LA 2DWQA 4XSVA 3FYSA 3FH0A 1VSUA 1DRJA 4UFNA 1AHIA 2OYSA 4U4AA 1UBTS 3E9DA 3SZRA 4TXNA 4F2WA 3KZOA 3KKEA 3DCYA 3LO8A 4B7CA 1X1SA 3AEZA 1JEAA 1C4WA 2B2NA 2EEZA 3BACA 3WLQA 1QTIA 5H3HA 4X20B 5HZGA 5TJHA 4ALNA 1YDWA 2X2EA 5H7XA 3IB6A 4PBRA 2FFJA 1VA4A 5FPTA 4AYWA 5L95A 4HAXA 1WE2A 2AZDA 1BXGB 3M4JA 3OJFA 4ECAA 2HBZA 2Z04A 3PWSA 3L1KA 4CMFA 1VAJA 3TW0A 2F3QA 4RUCA 4TMTA 3DTNA 2FZ5A 2HNKA 2FPOA 1A98A 4NJMA 1C30A 1URPA 2XH8A 4PZDA 3WOHA 5GTDA 2IXGA 2PAAA 3OE5A 5FLYA 2NZXA 4CTOA 3IR5A 2QT1A 1RKXA 2OBFA 2YQ5A 2P4UA 2WUDA 4R68A 3LJKA 4JV5H 1R0XA 3NCTA 1XZPA 1XROA 1YBHA 4X93A 1RBQA 3B6MA 3G8BA 1YKSA 1WBJB 2DJIA 2VJLA 4YJKA 1TW3A 4K9RA 3LL4A 2OGSA 4N39A 3PIIA 1DIOB 2I6UA 3ZW7A 4C2MA 1JWLA 4CU5A 4ZJYA 1P18A 3L8YA 3Q8LA 3HACA 2G9RA 1RYDA 2RHLA 2YXEA 2OOKA 2GF9A 3TXXA 2GB4A 2XTJA 5HBRA 5K20A 2R9VA 2DFTA 3QH4A 2F7SA 1OLUA 1WUKS 2ALJA 4BQQA 4XB1A 1FQWA 4L9WA 4BYMA 4D92A 5EOVA 1S0UA 3DOEA 3RGGA 4U7TB 4FVTA 5AKHA 2E18A 1VMIA 4BRZA 1SD1A 3GT0A 1W5BA 1P31A 3LT2A 3RIGA 2R0QC 1KERA 2KSWA 3BILA 4C7KA 3BQ9A 4YRNA 2JH8A 2PKQO 4GC6A 1YAJA 3U7QA 1SRQA 2PD6A 1KSJA 2HVRA 4GP9A 1TEXA 3G1TA 6REQA 4YR3A 2W70A 2E55A 2ZWPA 4BNLA 1ZESA 3S5UA 3P9SA 1DAOA 1M6EX 3PR2B 5KTKA 3KAJA 4MYCA 3TZQA 3RC9A 2GCGA 4YV1A 1LBTA 1B14A 1H2BA 4MTLA 3NNSA 4BVEA 1B16A 2C2BA 2P6OA 2FZGA 4PX5A 3DZCA 3HPRA 4EM6A 3KXYT 5A5DA 1R8YA 3FG9A 1QF9A 2BEUA 1BXZA 1XCPA 5TS2A 3PCTA 3GJTA 4CRWB 1BS2A 4KNWA 1SKBA 1NP7A 2I7VA 3RCBA 4BDSA 4UVHA 4QVIA 1ZA1A 5EMMA 2ZKLA 2HT1A 4HP8A 4B8ZA 3V8RA 5KFPA 1XC7A 4OF4A 3CX7A 3LIIA 3Q88A 4NBTA 3VJLA 4OGGA 4BP8A 3E0QA 3L8EA 3MRXA 2I66A 3FMVA 2Q1SA 1X0XA 4E4RA 3TR0A 3WBBA 3COWA 2YYSA 3GIDA 1XCJA 3DHVA 1IXZA 5EHNA 4RVCA 2WG1A 2IL1A 1RXCA 4QQRA 4NJMB 3PRHA 1C30B 4L1KA 3OJEA 4N40A 4IIBA 1NXVA 4YREA 3LYLA 2HRCA 5T7BA 3COSA 4XQEA 2J3KA 4GM1A 3DAPA 2GCOA 4Y2RA 2IUYA 4F3YA 4O0MA 4P83A 3W8RA 2QORA 2G08A 4QNRA 1AXGA 1RBYA 4BGEA 1W581 2GCEA 2UAGA 3FKSD 2Z3VA 5TB5A 4IAJA 2WAAA 4KR7A 2JHAA 3PCRB 3E7FA 4AMUA 5K0SA 2WJYA 1RYHA 1RPZA 3OAAD 4TMXA 1CRWG 1KAHA 3STWA 4EI2A 4ZYYA 4FOPA 1IZZA 3R9RA 2YNMA 4RTKA 4BNHA 1FIUA 1JR3A 5T4HA 4FEYA 1VJ5A 5KJ1A 4JYAH 5HBRB 4LRXA 1KEEA 3BEDA 3MJVA 2B69A 4DUGA 1ZISA 1OLUB 1NFRA 5JO0A 1CV2A 2YWXA 1QPBA 1VPLA 4KITB 1LUAA 2A8YA 4O3PA 1WOYA 1XDSA 2DQKA 3HDHA 3OESA 2FZEA 1VYTA 3WKEA 3HCEA 4EK9A 2GRUA 4NLGA 1RU3A 5CVDA 3PLRA 4XQ0A 3U7QB 1HT3A 4OQMA 3BTVA 2ZWMA 3TLBA 3QE9Y 4P08A 2ZZKA 2PBLA 2VJQA 2VQSA 2V96A 2E4ZA 4D26A 2B1IA 4LSXA 3ROZA 1QYRA 4FSHA 4WPGA 4D9FA 2NVUA 3O3OB 3QXXA 4EITA 1GP2A 1NQOA 1JRLA 3CIOA 1ECJA 2KW5A 1P4RA 4W1QA 1C9NA 3V7NA 2BEUB 3EXEA 2D0DA 5M29A 3IIEA 4E08A 3T1TA 1U1DA 5CTAA 4DCMA 2IEZA 3L8DA 1DL5A 5JZSA 4RF5A 3GV5B 2XT0A 3PC8C 3DMYA 2IYNA 5KQRA 3K2EA 8OHMA 1R7RA 3VBEA 4NCIA 5E0KB 2A5DA 4L73A 2ZT5A 1YIOA 1HI9A 5CFPA 2C92A 1F06A 3P0FA 5K0BA 3O9MA 3O4FA 4MWZA 5KWVA 2PUBA 3W4KA 4HR7A 2IUUA 3E4CA 3L6BA 1MV8A 2JGEA 4I4IA 4DL3A 1I36A 4IZ6A 2GX6A 2NT3A 1TF7A 5E7MA 4JI1H 3OU6A 2AI3A 1BFKA 4KN8A 3TMYA 5JBNA 1CPYA 3UBTA 3PB3A 3MMZA 4F2HA 4MR9A 2HT6A 3MTJA 4B09A 4B7UA 4CV0A 3GNQA 3IEKA 1EP2B 3FFWA 2BZGA 3C5WP 4MUEA 4EX7A 3GD7A 3CZCA 4O2RA 2JGNA 3SIPA 4FFOA 2QZJA 1XXHE 4UCVA 1NBAA 2ZROA 4UNIA 2AK2A 4BNNA 1ZD5A 2GK3A 1RRFA 2Q4TA 2VJAA 5DBHX 4RSGA 4C3OB 1JF8A 5IVPA 2K5UA 3KYHC 1KEEB 3K4QA 4KXUA 4N41A 5EP4A 1V25A 3D8TA 1XTVA 4WESA 1CUZA 1P75A 4MHTA 2NQ8A 3VPDA 3THSA 2J0QA 2EJCA 4GMHA 4CC5A 4LZWA 4EY3A 3CNEA 2Y68A 3COVA 3UMGA 1GKLA 2BFNA 5G3ZA 2ZI4A 3IVCA 4IUYA 1ZSNA 2R1VA 1A5TA 4QPCA 3Q7PA 3TQQA 3I9FA 5EIEA 1X9NA 1SBHA 2L19A 2PAFA 2QGZA 4RE6A 5ITSA 1SHKA 5DASA 4C0BA 3R7WA 3RAFC 4UFZA 3B6JA 3P19A 1E99A 4HPXB 5JSHA 3QY0A 2XTMA 3JRNA 2FSVA 1VECA 1UM8A 2OQVA 3U4MA 3AIIA 4AJ9A 5A3VA 2NVUB 5KT5A 1MEEA 2V3CC 3HGTA 5EWJA 1UEIA 5IM4A 3IMEA 3AVOA 4PQRA 2GD2A 4IW3B 3FCEA 1YQTA 1FFXA 1A7AA 3PC4A 5C1OA 1Z0SA 3EXEB 3LT5A 4RQBA 5AW6A 2RB5A 3LWNA 3STHA 5FUQA 3GJ0A 3W9YA 3TLEA 1KPHA 2YYZA 4JVOA 5J4YA 4EPVA 3D64A 2FWAA 4YIHA 3SHOA 3JD3A 4FWIB 2XDYA 1FFAA 1AGRA 3PXXA 4Y1RA 2J5KA 1P5HA 4BB6A 2QPOA 1KFCB 1NW5A 3Q5DA 3S0JA 2PUJA 4W9NA 2R5FA 3KHTA 1HYGA 3RS3A 3OIWA 2XV1A 4IRUB 3JRXA 3TLMA 2VDPB 3LPLA 4F0JA 4ESOA 4Q4CA 3U9LA 5JH7F 4WA8A 4B3MH 3TAUA 4UNRA 1ZXBA 5ALRA 4UXJA 3QU7A 2FK3A 4J1TC 3GC6A 4XQCA 3K3VA 5JAMA 1RQLA 3UAZA 4ZFNA 1YNSA 1Y1TA 2B1JA 1U6JA 4MR9B 3QLVC 2XWBF 3ZJTA 4JL8A 3QSYA 4CLOA 2MYPA 2HXYA 1QAOA 4M54A 4UU7A 5AW2A 3TY8A 2B5OA 1JHVA 1OLSA 1E2KA 2PX8A 5AM2A 3NBFA 3L0IB 3SZGA 4I50A 3WB9A 4G41A 4X41A 1YDMA 2EBWA 4ZVUA 3P9YA 4ZCTA 1LSJA 4TTAA 3T35A 2JDID 5FAXA 2DPGA 5DTRA 4EY5A 3OTWA 3E8MA 4LV8B 2G3YA 1U0BB 2RMKA 1Z6GA 3FJ1A 1K9VF 1USVA 3AHDA 4WESB 1O5IA 1G4UR 1NFFA 4IIXA 4DV0B 1E69A 1CUEA 2I3ZA 3AOGA 5J1TB 2FMFA 3E27A 3QXGA 3QE0A 3VKWA 5ALNA 1NF3A 4N03A 4CWAA 5BP7A 4RU1A 2R1VB 1GA4A 4GR9A 3Q8MA 2IYPA 3AUTA 5K05A 1T0HB 1V95A 4BPRA 4C4XA 1E3MA 3R7WB 2H2WA 4XB2A 4O3SA 2C00A 4O7SA 4DAOA 5KNCD 4OJQA 3A1NA 1PKXA 3BXOA 1D0SA 3UTDA 3E9RA 4E94A 4A8TA 3I73A 3INYA 2WFZA 1AKVA 1JEYA 3H20A 3VVBA 3WDLA 5ERXA 4J4BA 3IRVA 1UMKA 2YZNA 4YLEA 1FFXB 3Q98A 4CMBA 2WYHA 3ZGXA 3UK7A 4XDYA 4ITUA 5IT5A 1QKIA 1VMKA 2R92G 3TRIA 2C31A 3WLMA 4K9QA 4LPSA 2OCYC 4RAQA 2HRBA 2PGAA 3A3NA 5WRFA 2AR0A 1OI2A 4O7TA 1NRWA 3K94A 4HDRB 2ZVPX 1Q17A 2GLXA 1X7DA 4RVOA 3T3IA 2A9VA 4Y1RB 3G23A 2UZIR 4LRQA 1ZIOA 4NFLA 2EBHX 1IBKB 2WM3A 3G02A 5HHTA 5KBYA 1Z0JA 4H4CA 2OV3A 5DK6A 1TMYA 4Q9DA 2UUOA 5BW8A 1MVLA 3ANYB 5BWMA 1D1SA 4KR0A 2QJOA 4L3WA 5KQSA 2VHUA 1YDHA 1VKZA 3KSMA 5DM1A 4FLEA 3MWDA 5EINA 5B58T 4AICA 4YPFA 1XRNA 1XQ9A 1VHTA 4B6SA 4NAVA 5I5GA 4IZOA 2Z2IA 5LQAA 4QODA 3EVEA 1O6ZA 2XZPA 1XDNA 1G3IA 1C3VA 1GD1O 2NXEA 3PJDA 5CVTA 5JQWA 2V7PA 4DR5B 4JBXA 1OLSB 2OECA 4LDZA 3TKAA 5IKPA 1S2OA 4JEUA 4I50B 2Q6LA 2OUKA 4E3ZA 1P2GA 4BFLA 1C80A 3KT0A 1OBOA 1QLHA 2WAQE 4DYDA 1N1GA 5BOSA 4DCNA 4AIIA 3CS3A 3GT3A 1UFVA 4DA0A 2PQ2A 2ACWA 1G0OA 3ZVNA 3T0FA 4TMFA 1IZ7A 1BVUA 1Y8AA 2BBOA 4HFJA 3PEYA 4QASA 4FE2A 4B3HA 4EFDA 2WKSA 4A2QA 4JFRA 2D1RA 3PNKA 4IV8A 4KSBA 4Z4HA 1KFBB 2V5AA 3GV8B 3GT4A 2VRBA 2Q21A 1AKWA 5KFEA 3NFRA 2R1TA 1MU0A 4RULA 1JU3A 3KCNA 3AK4A 5ICGA 1GN8A 1H9AA 3AR9A 3UUEA 3A4MA 5E9AA 2JA6A 2ZAMA 1RNLA 2CLCX 3WRXA 4PYOA 5KB3A 2X8JA 4GI7A 2AJTA 4L57A 2GD0A 4WKPA 1X7YA 4ABYA 3SG0A 2R8GA 2AG0A 1R4NB 4W1PA 3V4RA 3UB4A 1DMSA 4QRHA 2ETXA 3CJQA 4Q0MA 3QPCA 1TC2A 4Q03A 3OCUA 4ZCLA 3ZY3A 4IXWA 2PS1A 1H6CA 2FR0A 3JWHA 1BWQA 1XD8A 2A9PA 1R0KA 4WK2B 3JAKA 1QH0A 2C5EA 3GJYA 4IIYA 3CX8A 1RSZA 2QGNA 1IJEA 3B1FA 3G59A 2BWJA 3B6IA 5AR1A 1JH8A 3FIJA 3GGCA 2WJPA 4DQVA 2JFXA 3PNPA 3LC0A 2ADMA 4EHDA 3HCDA 1P7WA 4FCTA 1LPMA 1SD2A 1TTTA 4CU2A 2X58A 3IUSA 4BHTA 2IYAA 2WYUA 1I10A 4B79A 1HQKA 1ZM7A 2CUNA 4A3KG 2JIOA 5FL7A 4IBOA 3P96A 3KTAA 4N49A 3UPTA 1EBBA 4X3PA 2YY7A 1E64A 3L0OA 3H7IA 4O4IA 2H08A 4IEIA 5HKKA 3UJNA 3ZWDA 4WJZA 4BMVA 1WD5A 3WTBA 3RVBA 1X8LA 2VOJA 3MWDB 4GVXA 2PRSA 4FN5A 4CIYA 1WRBA 2C7VA 2XQFA 2TS1A 3QZ8A 2FDCA 4X45A 1OGJA 2I65A 1R50A 1XEFA 4AS3A 1P0QA 1YA8A 3MQ2A 4H7KA 4GE0A 1QC5A 5CNKA 2KPOA 4JN6B 5IMBA 1TA8A 4QOHA 3RSLA 2QLFA 1A9PA 4EYEA 1RWVA 4NJOA 1VB5A 5AVYA 3IV6A 4HAZA 3W5CA 3O2SB 3PN1A 1MB3A 2YWVA 4UVGA 3H2SA 1ZOPA 2PX4A 5BOSB 5DW3A 4Z9BA 1KAOA 1E0AA 4MB6A 2O1EA 1OYVA 2F4VH 2PXHA 4MUIA 3RIHA 1FLAA 3KB8A 4H60A 3FOAA 4MAFA 1MBZA 2GUGA 5GPBA 2FKNA 2EVWX 1L5WA 4MJ3A 2QYZA 1ZR4A 3D4NA 5JTUA 4KLRA 4OQPA 3E70C 2ZRPA 4Q37A 4B71A 1DEOA 3OLVA 3HHPA 4ETSA 1O4VA 2R1TB 2HJHA 5AW8A 4R41A 3RKSA 2ID4A 2QNBA 5HQJA 4FDMA 4AURA 3FUXA 1X7YB 1V1RA 4TLCA 2IOFA 1W0CA 1OBCA 2HRQA 1UKBA 4QGFA 1Z45A 5B7PA 4AZWA 1RRCA 1KH2A 1RM5A 5LZ4A 4QVKA 3N70A 2CSUA 5F12A 4DARA 3JAKB 2J3LA 1I5RA 2R4QA 2BCJQ 2AOTA 2G71A 4QTZA 1YKFA 1E62A 1RK6A 2VAWA 4RUAA 4YP5A 4B85A 2IODA 1VYUA 2PGNA 2PEZA 2G76A 4I4TB 2X40A 2OO7A 1LTHR 3ANSA 1RLIA 5EPUA 3KTAB 4MKGA 3UC9A 3RVOA 1I0LA 2YWRA 4MJLA 9LDTA 4LQDA 4O4IB 3SCZA 3ZOKA 3N44B 3VJMA 3I9NA 3PU6A 2ZM6B 3BFVA 2A9RA 4PEVA 3THWA 3N0TA 1CUCA 1A8PA 1HKUA 1I1MA 2R66A 1GKUB 2VHEA 4ALJA 3SE7A 2D1QA 1TAHA 2QEQA 2DJ5A 3HWSA 4EYQA 4O5AA 1JG4A 1N0UA 4EIWA 3OO0A 5AVRA 3KQKA 5LJLA 4DVJA 3DMHA 3ETNA 2QPAA 4CMIA 4NU8X 2FUG6 5BPFA 2CKZB 5JD5A 3PNSA 3V97A 4BNWA 3QWBA 4UTNA 1CERA 4CM7A 3A6DA 4N9QA 4BGUA 3U0GA 5DISC 2DSNA 4UDYX 5IZ4A 1QGDA 5JFTA 1QH9A 1BYIA 2ZS9A 2YICA 2V58A 3T4XA 3UJHA 1PFVA 3ANNA 3FNGA 3E58A 4ZYWA 4CCSA 2ODQA 3NT2A 4C6TA 4II7A 3K1ZA 2QY6A 3WQRA 2SKDA 5EZYA 4J9LA 4OHOA 1IBRA 2YMQA 4X84A 3MJRA 4UPDA 4RHFA 5F7OA 5BWNA 13PKA 1QIGA 1FYFA 5BVHA 1HRKA 3HB1A 4OXIA 2BFOA 2GN6A 4WXRA 3PP8A 1BQ3A 3HVHA 4EB8A 4H6XA 4S1WA 4TYPA 1WO8A 4QDKA 1X70A 3KU1A 4DFDA 3ADPA 1V1RB 4NQRA 1I3MA 3IQIX 4DC0A 1UK6A 3ILYA 1JJIA 1HSOA 1GKKA 3SSNA 3E9CA 3ZDRA 1S2LA 4LJSA 3R3YA 4OU4A 3CZAA 3GV0A 1RPTA 1Z7GA 3VR5A 3S2ZA 3T99A 4GQIA 3F5SA 3CCBA 2AOTB 4BNDA 1GO2A 2Y1XA 4QUBA 2X15A 1GLGA 4KX5A 1GUBA 3NP7A 1T1RA 4A3CG 2ZUWA 1A5ZA 3GRVA 1UXGA 3PVZA 2G7MC 3CM0A 4A3EG 2YWGA 4K9NA 1FS6A 2EX1A 1QIMA 1D2NA 3KT6A 3AEKA 2YDYA 3ONVA 2WM9B 5DNEA 3CRMA 4RBNA 1N2EA 4LBVA 4JYBA 3D3EA 3DS8A 1L5VA 2R8RA 1IK4A 3EGEA 2H2HA 1EKXA 4OYLA 4B34A 5C8XA 3CZ5A 1EE2A 2XXAA 2FMXA 2VQEB 3Q9NA 4MGZR 3THWB 2QP9X 5C1PA 3TDNA 5H9VA 2Q41A 4PRZA 4EO7A 4ETWA 3D3NA 4B3SB 1RKUA 1JIHA 4M7EA 4B6JA 4JLAA 4R0NA 5FR1A 2OYRA 1SXHA 4CMIB 5CLGA 2ASDA 3DZBA 4MCAA 1G20E 1IOLA 4YT8A 1P91A 1YC5A 1RACA 2OYCA 2GXUA 1KI4A 2WKPA 5BOVA 1J5EH 3SDSA 1J6UA 4EUHA 2IQ5A 4KH0A 2DKFA 3UJ6A 3F46A 3PZPA 2YHAA 1C7IA 5DJ5A 4XTCS 1INLA 2AR7A 3Q8SB 4UUGA 2AOXA 2C4WA 1YOBA 4UDNA 4IDHA 3RD5A 3PQDA 1LDYA 4DLKA 3ICOA 3VU8A 4KBYA 4FQ7A 3QY9A 5EZYB 3IDOA 3N76A 1I50A 3G82C 3QTTA 5CA1A 3TUJC 1NLMA 3DOHA 3PHBE 2A58A 2H16A 4JYMA 1P7PA 2XTZA 4Y2TA 4DLSA 2VJKA 2XWSA 4TWAA 5BVHB 1Z82A 2GASA 2QN8A 1AF4A 2QRJA 4IOLA 4FU0A 4ZWNA 2COKA 4LX8A 4RQUA 1IIBA 1ZIXA 3UAXA 5JSFA 2O06A 3NATA 5F1OA 2AMVA 2BC9A 3L0ZA 4IZHA 3ILHA 1SKYE 3PHJA 2HD4A 2IEBA 3ZHSA 3I30X 5LB4A 1EK5A 3B1XA 5K0EA 2J3QA 1SBCA 3MGKA 3IRUA 1ML3A 3BKXA 1RLUA 4ZV9A 3HCRA 4YEDA 1DEAA 3T5MA 5B55A 3WWEA 3HRKA 5DGBA 2XB9A 4UZEA 1YQXA 4LH6A 1JQBA 3HV2A 5M7EA 2DH5A 4L16A 1UQUA 1J8DA 5LZ9A 3K1AA 1EM8A 5BYKA 3SHFA 4XWGA 2HDWA 4X65B 3RFTA 5ADVA 4BNDB 3B8EA 3HN2A 1D8AA 3EWNA 4LMRA 4CYMA 4WL0A 1PQYA 4BO7A 1ZSYA 2ZBQA 4EFBA 3UK2A 3JQFC 2ECKA 3KQTA 5BMVF 4DGQA 3BJRA 1XTUA 3MS7A 4ABTA 3E3LA 3GIKA 1OR8A 5AUQA 1WETA 1KJZA 5BNIA 1U80A 2ZR0A 3HDJA 4XJTA 3UK0A 3I37X 1GNLA 2B78A 3O03A 2R48A 1B0PA 4KN9S 2XXAB 4LY0A 4ZA2A 1C3OA 4AWXA 2GBLA 3QLTA 1A7UA 3AFOA 3E8SA 2F6RA 3LT1A 2QTLA 4QWAA 1PJAA 2OOSA 5HP4A 5AJUA 1XZFA 5GV8A 4TTPA 3S40A 1AXRA 2Q5FA 4UFOA 3SXPA 3A1UA 4HNSA 1Q12A 4MR7B 4F3TA 3H1AA 2AI2A 3ESQA 2G9QA 3BAFA 4ODIA 3K0AA 5JJ5A 4JSTA 2XR1A 2B8JA 1NVVR 2GN9A 3V6KA 4K8OA 3WLAA 2J6UA 3TIFA 2OY0A 1M34A 1NNI1 1XP5A 5BR1A 1ISIA 4S1OA 4LMBA 3O4JA 1JYSA 1RHRA 2VRNA 2RGNC 4M36A 3S81A 3ESZA 1KXJA 2WVAA 2J5XA 5L7TA 4PLTA 4JC4A 5BWUA 5E38A 1LDNA 1ZVKA 3EARA 4MRRA 3FCAA 2IUEA 2WPDD 2YTZA 1EUQA 1O9HA 2HA5A 3IP1A 1ULTA 4CHTA 1RRMA 5KJEA 1CUFA 5G1OA 1RAIA 4G0YA 5DM4A 1N2CA 3ROEA 1TVMA 2W7PA 2QS9A 1O5TA 4YXWA 4PO3X 3WQSB 2EJTA 3SEAA 2HWUA 3NH9A 1YC2A 4OQYA 2K87A 1EVZA 3M8KA 3FZEA 1D7AA 3RU3A 1G4AE 5HM6A 1FFWA 1W8IA 1XZJA 2ACVA 2W2KA 1HNWB 2TMYA 1XKXA 5FULA 1G55A 5JYEA 1ZM2A 5F52A 3BJEA 1FUEA 1M8KA 2MSDB 2JFZA 3IIMA 5ALLA 2JIQA 1EVJA 5CB8A 3OZIA 2G28A 4C6RA 1GARA 1X92A 2X2FA 4RFLA 1CVIA 2GTPA 5AI5A 4RADA 2PZKA 3AUKA 3W3AD 4R83A 1G6HA 4RZ3A 5I7AA 3DDSA 1EM8B 3RJ5A 4XYLA 3WYNA 2XMZA 5MFZA 1UDXA 1N3YA 4YJ3A 1PR0A 4EDFA 2AUMA 1S3FA 4ZK6A 5DG7A 2BM9A 4GRIA 3K9WA 2IWRA 2ATIA 3ITKA 3SFZA 3FOZA 5F98A 3K9HA 5NULA 4BVBA 4G63A 2HEGA 2BMWA 3L4BC 4JSRA 4BFUA 3OT1A 1OSNA 4KBFA 2R25B 4F6RA 2PY6A 3RDPA 3PIDA 1UOQA 3TRDA 3BRWD 5EJ5A 1OYWA 1BD3A 3UCEA 1P44A 2HSEA 1C3OB 3OH8A 5BN3A 1W7AA 4M1OA 3EIWA 4WN9A 3O4VA 3WTCA 4KWIA 2ZI5A 4HRAA 3OUZA 3W8EA 1BMTA 1SXJE 2UVPA 2VTVA 5DBOA 4R1NA 4LTMA 1ZL2A 1MZBA 1KO8A 4NS1A 5KFBA 3K0AB 2PANA 3IXMA 4BNYA 1H2YA 3FPJA 5G0TA 5IASA 2YZ7A 1TUGA 1UBFA 3BH6A 2OGWA 1M34B 2QLTA 4NZPA 3BD9A 3T9DA 1ZCJA 1KDYA 3VH2A 2YJ3A 5DHPA 4KWEA 3CW8X 2O0HA 1U94A 3RVDA 2E48A 1S4MA 4MW7A 1NBHA 1BDIA 4V3BA 3HCCA 4JL5A 3KXKA 1XXLA 3SHQA 2JFYA 4FR5A 2C9YA 4D80A 2YHUA 2Z08A 1UOEA 3ONWA 1H2FA 3EGVA 4JLUA 2FTKE 3U3OA 4OPMA 4D6PA 4ZARA 5JNSA 1Q0PA 2OD7A 1V5FA 3RIZA 2OCPA 2O2DA 3OFND 1RZRD 2VRWA 1N2CB 4GXNA 1UMCA 3KLNA 4RSRA 2CHUA 4HX9A 1PS9A 4MV0A 4FXOA 4GD3Q 1FVFA 2VRCD 1R5NA 2A1UA 3RROA 4YQWA 1P0CA 3UA4A 1G59A 3DUFA 3DTVB 4DV4B 3F8TA 5JDCA 1ETHA 5JO9A 4XVRA 5A3RA 4YR9A 1RKQA 4P3KA 4ETIA 4REMA 5FV4A 1O6GA 3PRYA 3PF8A 1NW8A 3BORA 1XTJA 4LE2A 2X4GA 2YS6A 2NYRA 2VT2A 3T7DA 4FJ2A 1SOWA 4BTVA 3PDCA 3QNMA 3R1IA 3DZHA 1GTMA 3N2ZB 2QG6A 5EWFA 1WW8A 5KAPA 4ZCQA 1DPGA 3I8SA 4XYLB 1H42A 4YAFA 1TZCA 4U2BA 2B2XA 3CN7A 1DJOA 1T6NA 3GLHA 4YJ3B 3TD2A 3HMKA 2EFGA 5ES4B 1DELA 4TTVA 1R74A 1MTOA 1NVVQ 4EYSA 1PWYE 1T0UA 5AQEA 4RCNA 3FDFA 3GTLA 2BGWA 2O07A 1N2HA 3HBAA 3PZRA 4OKIA 3OT1B 4WBNF 4XVQA 3TZKA 3BMCA 3LU1A 3S68A 4F6RB 1F8YA 4NR0A 4M9SA 1LFDB 3NUAA 4J16C 2I91A 5K4GA 2VVTA 3EXHB 1F1BA 2IBTA 4WN9B 1G7CA 2OGUA 1Z8NA 5JI3E 5CAEA 2IEGA 3ELWA 5LMNH 1VJ0A 2WE6A 4ZVSA 1ZD8A 2UVPB 2Z1DA 3I8XA 2XUKA 3AQIA 1YQUA 2DQSA 2QRHA 1G6KA 1HLDA 4XA8A 2J87A 3FHLA 3K70B 2GEVA 5BYAA 4OI0A 3K9BA 1CUYA 3O3CA 4TSFA 1XNGA 1ZN2A 3E9MA 5EIAA 1HMYA 3CLRC 5DGHA 5A3JA 1AY0A 4ZVMA 2H1IA 1HQDA 5EE5B 1C4OA 1NGSA 3DLPX 4EHJA 3DOOA 4UCSA 4HNRA 3R7BA 4H7EA 3PVXA 4MWSA 4X44A 4AN1A 3T7EA 1NM5A 2WBLC 4DPLA 1BX1A 3IILA 4MP6A 4QNNA 1Y82A 2R97A 4L8VA 1A2QA 1G21E 2AN5A 4WCFC 1OHHD 1KMQA 1YQEA 3GDEA 1KYQA 3CKLA 1UMCB 1I6MA 1GPWB 5IAKA 4CL0A 5MGBA 1OKKA 2A1UB 3GMIA 3NPAA 4BC1A 3DUFB 3EE6A 4EGAA 3NU1A 2HHJA 4EZEA 2HO5A 3GLGE 1QNLA 3HDYA 4FIZA 3FB4A 2P7IA 4D8VA 4N0QA 3ME5A 3FB1A 1P0PA 2AVDA 4NYEA 2IHBA 1CC1S 2WQZA 3WQBA 1NQXA 1KZ4A 1GL7A 4WCVA 1TYAE 1VLMA 2C28A 4W8HA 1CUIA 1R8JA 1NR5A 2YWJA 1JUDA 4A2PA 3WSVA 1ADBA 2M05A 2V7VA 1NNSA 1K8RA 4HMQA 5G0WA 2HRZA 4XRGA 2L0XA 3TPCA 1JEDA 4GLXA 3Q0EA 2FRXA 4LJ8A 3HWX1 4KAXA 3GLHB 1WMBA 2QJTA 4XLZA 4S2EA 3M0EA 1E0DA 3KSAC 2FWBA 4NYJR 4PXYA 3QJGA 1UDRA 4Q9JA 3O82A 2PT9A 4OHWA 1EPUA 4PSVA 3IBYA 3JQAD 3L8HA 3BMCB 1JPUA 1G64A 3PUYA 2PYZA 4EABA 5I9MA 1M8JA 5ED4A 4XVCA 3JYPA 2C0QA 3PX3A 3HDVA 4URYR 4PAWA 4MGIR 5AESA 2ZWIA 1WAMA 3G7SA 1ZKDA 1S96A 1U2GC 2ACKA 4QDOA 5CE8A 2H7YA 3SC4A 2DXIA 1I94H 3ETGA 2RGBA 1N1DA 1T1SA 2BGTA 2PL3A 1QMGA 2DHCA 3UYLA 3LVFO 3U2QA 2HLNA 4B76A 2O19A 4KO3S 3LFHA 1QZXA 1K98A 5T3UA 2HM7A 2A86A 5LQSA 1YZVA 1L5MA 3W5HA 4TLBA 5GIOE 2PZAA 3A28A 5BRJA 1QUFA 4AKIA 2PX0A 3F6RA 3T1HB 3IAM6 2PSDA 4OB6A 1ZUIA 1EDEA 2XGOA 4C7VA 3C8ZA 4ATNA 3OG9A 2I2CA 3OEWA 4ZYVA 3FNEA 1EK6A 2FDRA 2ORWA 4WH0A 4DLRA 2G07A 1R66A 4BV2A 1Z22A 1BOFA 2ZBGA 1YVPA 1YR1A 4DAAA 2WHRA 2YU9A 5IPFA 4ENQA 3ZYCA 2BYTA 1D9ZA 4RK7A 3BH0A 4LNUA 2ZRIA 4BBRG 2V9ZA 3CONA 1SZJG 4OUKX 3OWXA 3GILA 3JSAA 3FZYA 4EAAA 4EF5A 3BZUA 4DJAA 1NBMD 1A8QA 1QTRA 3LP5A 4LISA 3RTCA 1DGSA 3V34A 1J24A 3P9ZA 4JLOA 3LLMA 3B3AA 3LPNA 4ZTBA 4C04A 4U7GA 3P4XA 1KPGA 2RJ3A 4P53A 4IJ5A 3A4TA 2Q6IA 5L9AA 1WMAA 2XECA 2Y1LA 3C6ZA 3G49A 3ZE8A 2QN6A 1JR3E 5K51A 1OY1A 4M88A 3SYNA 4A6EA 2OO5C 3JQDA 4FNMA 4RD4A 3GJ8A 5KNDH 2ZBVA 3GD5A 4ZZ2A 1TK9A 4XYMA 1J97A 4UOZA 4UHBA 1DC7A 1TYDE 4XD7A 1ZXXA 4LKOA 3B13B 1X8KA 1HM5A 4GZMA 1NBIA 2X0EA 3TNYA 3CX4A 2WK1A 4M76B 2AN4A 3CVVA 4MHSA 2WP0A 3GTJA 4X60A 3D7MA 3IDZA 1WD7A 1MTZA 4EBFA 3NC0B 3GHYA 4KXWA 2J0UA 2VO1A 4GHWA 3VYWA 3MLAA 3PC8A 2XPCA 2NTYC 5HFNA 2ZM5A 1TM7E 3CEPB 2GO7A 3HB7A 3NHFA 4J4TA 4NP6A 3ODPA 1KARA 2QMOA 4G81A 4OBXA 4MGYR 3TPZA 3BQ0A 1V3VA 1JAHA 4PSDA 3W5VA 5A4AA 1UK9A 3V2GA 2OORA 1KH3A 1AU9A 2YWHA 3FVVA 3CC8A 1YBFA 2J5QA 5KVCA 1ZICA 4WFJA 6REQB 1PL0A 2WB1A 2AIRA 3GP5A 3IP7A 3F3SA 2BFPA 2H63A 2NO6A 1Z5WA 4JI6B 3KD2A 3ETCA 4GYWA 4K40A 4F4DA 2UYYA 5KSZA 2YV4A 2Y1DA 1JDBB 5JC8A 3U7JA 1NYQA 2B92A 2XLCA 2H7VA 4FE3A 2IYFA 4A4DA 1E4EA 4C01A 2Z8ZA 3CZRA 1SFRA 2P75A 3GJ5A 2B5WA 2IP4A 3HCAA 4FB4A 1FY2A 3B9RA 1N78A 3LDAA 3NYIA 3MGCA 1U28A 4O29A 2EF1A 3SHTA 2C29D 1SWVA 2X8BA 3M3DA 2VIIA 1AKEA 4AQDA 1Z4IA 1QZUA 4LNUB 2JZOA 4RKQA 4MA5A 2R65A 4LHVA 1IBMH 1T4DA 2Q7OE 3ZYZA 3GFVA 3DOCA 4XDZA 1EFPA 5F5XA 821PA 4QGBA 2JA5G 1YZHA 4MPRA 1VRVA 3F2IA 1PJ8A 4NYJQ 2I54A 1P1CA 2GEDA 4EG1A 4P7KA 4NFYA 4UJ5A 2ZIUB 3GRZA 5AVQA 4DQNA 1C0LA 2GCOB 4QBHA 4FYHA 1RZ3A 5C5JA 3M9OB 1PU2A 3B20A 1R18A 1ZC3A 4CJXA 3ECSA 3S8MA 1AQUA 1DADA 5LA6F 3R4VA 2C2GA 4P4SA 2F17A 1FNBA 3U4IA 3O21A 1XKQA 4WN3A 1QE3A 3FWYA 4ALKA 5K6RA 5JJCA 1Q3TA 5I9SA 2NO5A 1VBMA 4QPNA 1PJ3A 3OMXA 4PF1A 4DLPA 3UOWA 2OBYA 4CM9D 1O95D 4M86A 1D6JA 4O2LA 2J0UB 4L08A 3TYXA 1P5RA 3A1TA 5CB0A 1EI9A 2XUZA 4FGSA 4BVGA 5B2ZA 3L92A 3L49A 2V54A 2QNRA 3VZSA 3TIIA 2QA5A 1NV8A 4EECA 2FN9A 2QPTA 3IR6A 3NEPX 1DQPA 1DINA 4E5VA 2HIXA 1D09A 4Q02A 2V7TA 4PW0A 3FBGA 4DXHA 2H31A 3NG1A 1Z8FA 3OFSA 2ZYUX 3G9XA 3CO0S 4IVNA 1Y5RA 3GZNA 4LIPD 4D0LB 4LZAA 2DQ4A 5PGMA 2GBFA 2Y4RA 1KI9A 2QG9A 2W22A 4GPD1 1Z4KA 4Y18A 3R9WA 1W46A 3N8HA 3HCFA 4JXZA 4DSOA 1E4EB 5IAOA 1T0JB 4ZVKA 2MOKA 4RV9A 1J0CA 1CR0A 4D57A 4M99A 4UNSA 4WI1A 4PYQA 2B21A 4M0MA 1VJRA 2PJRA 5D6NA 2ABWA 1ZH4A 3F5DA 4KAAA 1ABBA 1U11A 5L45A 4F86A 2FP3A 3AF4A 4OSEA 3V1TC 5AD1A 1PJ2A 2XDWA 4EHLA 4QVGA 3IPLA 2F1RA 1V71A 2IP2A 1UKZA 1K0UA 4JKYA 2BKVA 1EFPB 4NRDA 4XM2A 1M76A 1DO0A 3RJMA 4KRXA 3MILA 3IX7A 1I0ZA 3L07A 4UPEA 1Y89A 4IFEA 3R75A 1FLNA 5A5GA 4R81A 5AJTA 1LWOA 2GHTA 1SFOA 4JEMA 2OHHA 4YP7A 2PVSA 5GAJA 1NATA 3FR8A 1E9EA 3M6WA 4MMYB 4UASA 2JLCA 4LRYA 4ZCPA 3BL8A 4JZYA 4PLWA 3FPFA 4WXHA 1N5RA 2IVFA 3SBOA 3H8VA 4ZGBA 1ACLA 4A3LG 5A7FA 5CG2A 1TYCA 4B48A 5AK0A 3LWDA 3IPXA 3IQXA 4N6OA 1JH9A 3ZX5A 5ALWA 3AY7A 4D98A 4F4XA 4JCOA 3SJZA 1Q0QA 3CLUC 1NVEA 2GLUA 4A3GG 3KD3A 5K3CA 5FUBA 2PN1A 3T7IA 4EF4A 2PUVA 4GBGA 3P8ZA 1SB9A 2BLLA 5SY6A 4XM0A 4E6PA 3A4NA 3A3KA 3E7DA 1CY1A 2FG6C 1K75A 1ULBA 5BWTA 4Q9IA 3TSYA 1F14A 4CG2A 5JD6A 4L74A 1W1UA 5TARA 3HBFA 5HGJA 1XE3A 2QTCA 2V3WA 3O74A 1GL3A 2KYRA 3A14A 1JDEA 3ESYA 3G0CA 4F2GA 3MF4A 1OLXA 1LLQA 5BQFA 4IKOA 4F9EA 2RHMA 1SIOA 1CYEA 3CPHA 3CSDA 2C2RA 1JTEA 4RJLA 5DX1A 3FVRA 4QUAA 1XVAA 2WDZA 1EXWA 3GZNB 1XPJA 2PL9A 1PJZA 1SOUA 4BZQA 3GPBA 3AKEA 1AHPA 2FSPA 3DE7X 2XQKA 3TY5A 3OTQA 3WISA 4JKOA 4MWBA 3G0GA 4J6FA 5EWJB 1P5FA 3GIIA 4JMPA 1PCXA 1D1PA 4L0MA 4LJYA 4AMVA 4CLHA 4RKFA 4RVFA 4O8ZA 3EVBA 3OTIA 4KG7A 1PYDA 1AKMA 1RRGA 4G5RA 1UC8A 4YX9A 2IC5A 3PK0A 3UMSA 3KR0A 3B2EA 3WMGA 4KV7A 4KFRA 2X22A 3NHLA 1N32H 3WSTA 4EY6A 4RD3A 3C1UA 1VI5A 4UULA 2H8GA 4KHPB 4YR2A 121PA 2I4NA 2HLHA 3LBYA 4D43A 1G9TA 5AICA 2HV8A 5L7YA 3EVNA 3BTOA 4MB0A 3R5JA 2OXTA 3NETA 3L06A 1E4VA 1QLJA 3NDIA 3IDFA 4MQEA 4NWIA 3BA8A 1S8NA 5IAJA 1E77A 3KELA 1OX4A 5FX2A 1SIWA 4DXDA 2ZYAA 4YCCA