3VPCA

Argx from sulfolobus tokodaii complexed with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetylornithine deacetylase
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpcA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpcA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpcA01
3R5XA 3NUAA 4NYEA 3K5HA 2YZNA 4I55F 2ZDQA 4YAKB 1KJ9A 2W6OA 4J6EA 1UC9A 5K2MA 2ZDGA 5CA0F 3V4ZA 2R84A 4FFRA 3RUPA 2YWVA 3VPCA 4O7WA 3HBLA 1UC8A 4M98A 1GSOA 5CB4F 1GLVA 2CZGA 2C00A 1VBGA 4IWXA 1WR2A 3JRXA 2YW2A 5DMXA 3R9RA 4O7TA 4O7NA 3GLKA 4IZOA 3WNZA 1KUTA 4M9UA 5GONF 3VOTA 1KJQA 2CNVA 4MV7A 3N6RA 4O83A 2IP4A 4M9CA 2W71A 4WD3A 3TIIA 2V59A 1EHIA 5J2UF 4FFMA 2W70A 5LA6F 2FPPB 1C30A 2R7KA 5IYZF 3BSWA 2DWCA 4XX0B 1W96A 3R23A 4O84A 4HNVA 3BFPA 2FPGB 3K3PA 2W6QA 3VPDA 2VR1A 2I80A 3JZFA 3ORRA 5CA1F 3ETJA 1I7NA 4FGRA 3Q1KA 5C8YF 1VBHA 4MA0A 1M0WA 4XYLB 3Q2OA 4EABA 1M6VA 2I8CA 3LWBA 4YJ3F 5BPFA 3VPBA 2VHEA 1KJIA 4GGMX 4O7VA 2NU9B 4IWYA 2J9GA 1KJJA 4O7LA 2QK4A 3R5FA 1M0TA 2R7NA 3HO8A 4O7RA 1E4EB 2I87A 2NPOA 1BXRA 2FB9A 2V5AA 1GSHA 5FNVF 2OLSA 2NUAB 2YZGA 3TQTA 1IOVA 3KAJA 1EZ1A 1CS0A 4YJ2F 1KJ8A 2W6MA 2GQSA 4I4TF 1DV1A 1KC7A 3TINA 4FE2A 4O7YA 4IIJF 2VQDA 1B6SA 3TW6A 3ORQA 4M99A 1A48A 5CAEB 1AUXA 1T36A 1E4EA 3DF7A 2GQRA 3UFXB 3JZIA 4O2BF 3LP8A 2XCLA 1PX2A 1JDBB 3WO0A 1CQIB 2Z04A 4YBZB 3MWEA 2W6PA 4HQ6A 5KKNB 2FP4B 4FFLA 4ME6A 4L1KA 5J2TF 3SE7A 3TIGA 4XZ3B 4O4IF 4WBNF 3QFFA 4E4TA 3I12A 2YL2A 4MV8A 2R87A 1VKZA 4MV6A 4YAJB 2V58A 3U9TA 3RV4A 4O7ZA 2YYAA 4MV9A 2GPSA 4O4LF 2VPQA 4EA8A 3AW8A 3BSYA 4EA9A 2XD4A 2HJWA 2HGSA 1W93A 3MJFA 2PN1A 1C3OA 4Y8VB 3U55A 2R85A 5I47A 2QF7A 2CNUA 3V4SA 1DV2A 4TV9F 3HB9A 4TUYF 2PBZA 2PVPA 4O4JF 4EA7A 4ZI7F 1EYZA 2GPWA 1DIKA 4FFOA 5JQGF 4O7SA 4EGQA 2YS6A 4XYMB 3RV3A 3AX6A 1Z2OX 4O82A 4EAAA 4IHJF 5C1PA 2ZDHA 3U9SA 5H80A 2R86A 1CE8A 5BMVF 3KALA 3K5IA 4MV1A 3JRWA 4C5CA 4MV4A 4O81A 2R6FA 2SCUB 1JLLB 3G8CA 4I50F 2YZLA 1JKJB 5D8DA 5KX5F 5LXTF 5LP6F 4DIMA 4FU0A 1SCUB 3OUZA 1KEEA 4MAMA 5HBRB 1BNCA 1Z2NX 3VA7A 2NU6B 5EZYF 4C5AA 4O4HF 1Z2PX 1CQJB 3OUUA 4FFPA 3KAKA 1B6RA 5LYJF 3G8DA 4DLKA 1IOWA 4ZOLF 2NU7B 1AUVA 3VMMA 1I7LA 3U54A 1EUCB 5JVDF 4HNUA 4RZQA 2DIKA 2R7LA 4ZHQF 5LOVF 2GLTA 3N8DA 2WYOA 4O2AF 2W6ZA 2YRWA 5C1OA 5BPHA 1EUDB 2P0AA 5JVLA 1KBLA 5JH7F 4EG0A 4MV3A 1ULZA 4HR7A 2W6NA 2YS7A 1JDEA 2DZDA 3ETHA 3BSSA 3GIDA 1GGOA 4O86A 2CQYA 2YRXA 3E5NA 5JQWA 2R82A 2Z02A 1GSAA 1PK8A 5HV6A 4TV8F 4FFNA 2YZMA 2NU8B 4HNTA 4YB8B 4QSHA 1OBDA 3MWDA 2CNQA 3RFCA 3R5HA 1OBGA 2DLNA 4ZQIA 4MA5A 3BG5A 2X0SA 4EGJA 3KREA 4C5BA 2R7MA 2FPIB 3WO1A 1A9XA
chains in the Genus database with same CATH superfamily
3CVOA 3ZCTA 6YASA 1W85A 1KJ9A 4IUYA 4MW4A 4OU5A 4F93B 2FK7A 5K2MA 1RLIA 2BW0A 1UP4A 1Q12A 2YOGA 1ICEA 2IUFA 1ABBA 3WV4A 2CNLA 4JI4H 1PO7A 1CLUA 2Q5CA 3KQHA 4DSTA 1SUSA 2XOKA 4L0MA 3QKRB 2IC5A 2HNBA 2VPWA 5FPTA 5DW0A 3SKXA 3O3CA 1KMIY 2GPAA 1H5UA 2J48A 5E3JA 4TLLB 2X9VA 4KXMA 2HADA 3C1AA 4DV2B 1T3NA 1YMVA 3OLXA 3AP2A 2IF0A 4BWVA 1BGXT 3AVYA 3I39X 1Z4OA 4NQZA 1EUZA 1D0SA 1VI2A 4WFJA 2EP7A 5EHIA 2RGBA 2B4YA 3GRVA 4PRZA 2OGTA 2DLCX 2O8EB 3TIXB 3H4MA 4LQ4A 2E21A 5LQMA 1WWKA 3V8PA 2ZUTA 4LYJA 2Q6IA 1LFDB 2FSFA 4B45A 4XIGS 4JB0A 5B30A 4P4TA 5L3VA 1KEEB 4GLBA 3CX6A 1NZDA 1N2ZA 1M2VA 2DPLA 3AERB 1US8B 4MIEA 4K2AA 3KAJA 1TVKA 4ADSG 2OLEA 3INNA 1XA0A 1ZMOA 4OJYA 4JT2A 5AI5A 1E79A 1KVUA 3SQDA 3TL3A 2VCEA 4EB0A 5K4HA 1T4MA 4MSUA 4KPEC 1N2CB 3ABSB 2JJ1D 3L6RA 3P32A 5ENVA 1QIIA 3SS7X 2GZMA 4D81A 4UATA 4Q34A 4EG3A 3MR2A 2JI4A 1RKQA 4BNGA 1U8YA 4AG3A 2VTDA 3PD1A 3DMNA 4YAFA 3VQTA 2ZUDA 4ZAFA 1ND6A 4NNJA 3I5YA 2XOEA 3FLAA 2IHTA 4CG2A 1Q1ZA 2R65A 1E9AA 1WO8A 2WABA 4LAFA 1USGA 2WAAA 2XMCA 1VL1A 4XQEA 3KSUA 4G0WA 1GITA 3OX4A 4NBLA 1Y6FA 2FR0A 2GBCA 2JDIA 5J2TA 5IVPA 1LFAA 4OYLA 4YJGA 4FT4A 2OC9A 3U49A 1ZVQA 3KJQA 1IK4A 2GUWA 3CRZA 3NH9A 4U4AA 4RVOA 3UZBA 2AMLA 1CUEA 1XZBA 5EIBC 2FFBA 1FUKA 2GCIA 5FYDA 3U2QA 3BQ0A 3O95A 3QFSA 4EKYA 5FPOA 4IH4A 5AM2A 3U3JA 5D6OA 5ICFA 2UDPA 3BGOS 3EF3A 4GX1A 3HXMA 1FDVA 4UVIA 2FWJA 2A1TR 4K6NA 4CDNA 2XX3A 3U4GA 4P3PA 3NT2A 1NOJA 3EAFA 1GPNA 1HT2E 1CY0A 1JRLA 4WJZA 3SQMA 3DDWA 1FMTA 1GCUA 3DTYA 1Z35A 1YQEA 1ZJYA 2EIXA 1KK0A 4KQ9A 3OUZA 4IXWA 2ZIUB 3BL5A 5IC5A 1NVMB 3BE5A 1G5RA 4YYEA 3LHIA 3I2IA 3H4DA 1O5TA 1CZNA 4DA0A 3ZH2A 2H8GA 3BFVA 1XHEA 3RABA 1AUVA 3D2LA 4YNBA 1E8MA 1JSLA 5KWVA 2HU8A 1RYHA 5AVQA 1CQWA 2VSFA 1RVDA 1RJFA 1ORRA 1RQRA 3MHPA 1IUOA 2ZYIA 5AKGA 4EPTA 4S1WA 4KCGA 4QICA 3SBDA 4YPOA 3VU9A 1H69A 1JBQA 1VJDA 3VHXA 2D5LA 4X8HA 2XGGA 4N5DA 5HIJA 4A3GG 1W44A 4ZDWA 2I54A 3A05A 5THQA 3VBCA 3O9ZA 3BZBA 4LWQA 5IYDG 4JC5A 3FHJA 4UZFA 1YVUA 2R8EA 2PJUA 1SBIA 2RDMA 2GN9A 1U6JA 4GR5A 4FN4A 2W2XA 1EXMA 4LK2A 1Y80A 3K1TA 2D1SA 2ZE6A 1UEIA 1IG0A 4CE6A 4IKOA 3DPUA 3HM9A 2RGDA 5F35A 2G36A 4UNPA 1Z88A 4Y98A 4QLBA 4LFCH 1YVPA 4H35A 5HHTA 1LPBB 1E59A 3A70A 3IUMA 4Q6BA 2OBYA 3VPGA 3TDMA 3CJQA 4O1MA 3HDTA 3OJCA 2WKRA 2W83A 4LNUA 1JNYA 3WYEA 1IWBB 4JI8B 1G5TA 2PWYA 4MKXA 1NVAA 2CVOA 4DNFA 5CXQA 3KE8A 1L4LA 5CK4A 4F12A 2WF6A 4URXR 1W5EA 4TTQA 2IEZA 3B3AA 3O0DA 3HXTA 2Q62A 1DIHA 1X1DA 2WTBA 3ORRA 1R10A 1MABA 4ZDKA 4L7QA 4O7VA 3GJXC 4YXWA 5FBKA 10MHA 3AJ8A 3A2NA 3KT8A 1NMSA 1UDWA 5JYCA 3FMGA 5AHOA 1HT0A 1BQ4A 1NZFA 2XNHA 1WDKA 1NV8A 2EZUA 1SBQA 4QTTB 4HN2A 3WJ1A 3P4YA 1YQWA 1QNLA 2H9IA 4H27A 3FPCA 3EB9A 3IHKA 2DQZA 2UVUA 4ICIA 3QWHA 1KGSA 2HK8A 1A72A 4O2AB 4E09A 4DV0H 2GJ9A 3GN1A 5MF6A 4KOAA 3A26A 4BZZA 2D7JA 4ZO4A 1NI4A 2VJYA 1CQIB 4QTYA 3H65A 3HKBB 5EZ6B 3VI4B 3JALA 3TJZA 3N2KA 2NTEA 1D6SA 4PIVA 2JFBA 3GDFA 5BWUA 3OY7A 3KOWA 2VTBB 4CLEA 3DOHA 3TEFA 1VPLA 2JAWA 3UWSA 5DYGA 3NBZB 4IYRA 2DC1A 3KKEA 3FMAA 1HNXH 3D6MA 3ETEA 4LTDA 3HKEA 1Q1QA 2HZBA 1P2DA 3N74A 1TWFA 4FKBA 2ALJA 3LC7O 1JEYA 4EIWA 4OMUA 4OXRA 1FDIA 3E35A 4H1TA 3V4SA 4Y6GB 4Q0YA 1JIQA 4QELA 3W3AA 2P62A 5BORA 4EPVA 2JIZA 4O4HB 3QBEA 4H08A 2HT1A 4UUGA 1V47A 1JSXA 4KAFA 2NVYA 1A1VA 4C04A 1H9AA 1E3WB 2IZ5A 1RQLA 2EU8A 1P3Y1 4ETMA 4NS4A 4AJEA 5EIFA 3C6YA 4RMHA 3EMBA 3C1TA 3LK7A 1IOLA 3RB0A 2IPAB 3WGLA 3E5MA 3WGOA 1QO0D 4DXHA 1A8IA 2GNPA 3FOBA 5HG0A 4QDUA 1W29A 4BLQA 2CNNA 1GG2A 1J39A 3HBMA 2YY5A 3DP9A 1J06A 1HZZC 4IQGA 1U2GA 4ZXFA 3RVJA 2WU3A 3WG9A 4AUMA 3SNOA 1XRQA 3C6XA 1F60A 1SU4A 4XVUA 4NZOA 1J0BA 1RJ9B 3I9MA 3IPYA 2X0JA 4U2BA 4FYHA 2QT0A 1Z22A 3FYSA 3GGCA 1SO8A 2C03A 2QN7A 2NZJA 3NU1A 5J5VA 3NHPA 1P3DA 1PNRA 3TWOA 2ODTX 2W90A 5I4BA 2XTZA 4GYWA 2B30A 4HMPA 3F8NA 3ABRB 3ROPA 5F52A 2QE6A 2WICA 1UFQA 2H3EA 2FP4A 3A9WA 2V5VA 5LBTA 2W48A 5J63A 4KPUA 2D5IA 3LWZA 1M2OA 2YASA 4OU4A 1T25A 4Q19A 1B3BA 1RI2A 1X7YB 2WHPA 1PGJA 1WTCA 1N0WA 3NHWA 2I71A 1U2GC 1SULA 3PJEA 3L7KA 1UC9A 4IH1A 1E0JA 4NLLA 3VSEA 4ZVMA 3HVJA 5IT4A 1GM5A 1A9YA 2Z3VA 3VRHA 4FI3F 3M4YA 1SWVA 5HNKA 4B4KA 2BUAA 1H2EA 3MUFA 3FCOA 1LC3A 1ISJA 1ECFA 2WJ3A 2FQQA 4MV7A 3F9CA 1CVRA 3FWZA 4DMRA 2IP4A 4OHUA 4TYNA 4LHEA 2C84A 3VZDA 4AP6A 3SJAA 4QM7A 3IX7A 3L5OA 3C3XA 1DIGA 4AMGA 4Z7OB 1YONA 3VNAA 1E4YA 1TJNA 2YIMA 3BB1A 3KQWA 2R7ZA 3EXFB 2WZDA 2VPIA 3M6AA 2J07A 1DKLA 5KS8A 2I67A 1WSWA 3KTAA 2JKYA 2H9YA 3AZPA 4G6ZA 3NVMB 5DHUA 2LDXA 3Q2OA 1DVRA 3GZ4A 1IK6A 3UAGA 2J1LA 4AF6A 2I8CA 5KYUA 3FOCA 3BHMA 4DV3B 3LHDA 3FTQA 3R5FA 4DR3B 1GGMA 3BTOA 1JAYA 2EW8A 3H11A 3L4SO 1DC5A 2EKPA 1RPNA 1ZMXA 2J7PD 3O8CA 1E9VA 1UZMA 3F4LA 3GV0A 2PVSA 2YKGA 1N0IA 4RAOA 2DVMA 5IZCA 4J9PA 1SC9A 4ZPJA 2UYYA 4J8PA 4U3JB 2H2WA 3N2YA 2AIRA 3SI7A 3D8NA 3BA8A 1UINA 2QDKA 4REOA 1PWYE 1Q19A 2DTXA 2FPUA 5EMHA 5DHSA 2Y77A 1DAFA 2YRFA 5B6IA 3EWNA 1WCIB 5IT5A 2ZIZA 1MD9A 3BRWD 1RBZA 2O8DB 4TKVB 2NTNA 2Z8ZA 4Z9YA 5B5SA 3VZCA 3OQMA 2G6BA 3U44A 4DCCA 1NM5A 3TRDA 4FMDF 3GV8B 3IERA 5EZ5A 4P9NA 4I55B 5C46F 2PLWA 1KOLA 4NPAA 1OIVA 3FMIA 1JAHA 4TV9F 1CQZA 4BWSC 2UVRA 5FDFA 4UHFA 5ALYA 1NR7A 5KOIA 2X40A 4MLZA 1MB3A 4J03A 2JH3A 2NADA 2PKQO 5HNEA 2LIVA 2I9PA 3U3XA 2K2WA 4UZSA 4XGIA 1T3LA 5DRYA 2BHRA 3I45A 3Q12A 1JEQB 1FUUA 2HREA 2J4DA 4Q5IA 2JFWA 3PPIA 3HLKA 3UG6A 4PLYA 5EKTA 4GS5A 4LRUA 1KZ6A 3W8FA 2IH2A 3CPSA 2FK8A 2VT7A 1DJPA 1OWNA 3JYOA 3ZYZA 2C5LA 1BKDR 3GTQA 1CUCA 3ZWMA 1NM5C 4GUAA 1HTBA 1Z75A 5CXUA 1XBTA 3G13A 2V4ZA 2FF5A 2Q1TA 4DLKA 3ST7A 2WDPA 4E7OA 3THWB 2EFGA 2FLNA 2P4UA 1ZSNA 3T1HH 4AUEA 2BFAA 2AOTA 1BXRB 4KUGA 3SIPA 1FSGA 3W5JA 4R2JA 3SX4A 4R69A 1ET0A 1ZO8A 1ZM2A 4CI0B 1VS0A 5KT4A 2H2FA 2VWQA 3ZWKA 3TK1A 1JQDA 4WXHA 3ZDAA 2COKA 4E88A 4JI6B 3QEKA 2HWKA 4X64B 2ZYDA 2WFLA 3DFKA 3H2JA 5JMTA 3LQKA 1DT5A 2ZR8A 3EG9A 4YR9A 1L9XA 4TMTA 2NO5A 1T5OA 3T7KA 4IAJA 5ES3A 2ROQA 2RGNA 4M7EA 3R5HA 4MI9A 1M3SA 3WB0A 3PXXA 5ED4A 1RM0A 2R5FA 1UDAA 4JXUA 3H4BA 5FPPA 2I2WA 4UHHA 1RWOA 4B3BA 3KHHA 4RZIA 1M54A 4ENUA 1SRQA 4E6NA 2ZCUA 1JTEA 3AF3A 1XTZA 4YV2A 3JAKA 4QBKA 1G98A 2AN9A 4FX5A 4PYLA 1GGVA 1XPUA 1NAIA 2CXHA 2FXVA 1V5GA 1SR8A 1ZNZA 2QV0A 1TK3A 3RLIA 4MDEA 1USUA 4N7JA 1HYGA 4ZO9A 5AVRA 1CERA 2APJA 4OV6B 4IR1A 5IJWA 1ADYA 5G4KB 4BKQA 2E48A 1AXRA 1K98A 5JXGA 1YHNA 1D2CA 5AW3A 2JLSA 3MUOA 3JZAA 3WBBA 4ECTA 4FBTA 2AEFA 2VRBA 5ALIA 2ODQA 4EKDA 3NTOA 3KSAC 4LGMA 2I4IA 5B1SA 1WLYA 1W76A 4FDLA 5B1IA 3L8ZA 2C0PA 4PSAA 1XZCA 4G01B 4HF7A 4K05A 4P83A 4H7EA 5IHPA 3BMXA 3UJ8A 5TEVA 1G21A 2PSHA 1E1LA 3WBFA 1FP1D 1Z2DA 2D2VA 2OY0A 1RHQA 2DBVO 3PQDA 1EUCA 4X7BA 2ZYGA 3VR0A 4HI0E 3PW7A 4L4SA 3GEGA 5AUNB 1ZIDA 3D1VA 4ER6A 3Q6MA 4BEJA 3C3CA 1UXJA 3QELA 1Z37A 4HGZA 3WNVA 3LV8A 2A4KA 3E3LA 3OT1A 4Z4HA 4IIJF 3N8HA 3K9FC 4OATA 1MQSA 4B8YA 3PQ5A 1SQFA 1CB0A 5CMLA 1R16A 1OHHD 3N8GA 4ZN6A 2AFIB 2WMNB 3R24A 1EU1A 5HZMA 1UMCA 5EKSA 3D0RA 4MDFA 2DPGA 4KQ6A 1X80B 4BNVA 4XYGA 2NMVA 4D80A 3A1UA 3G6KA 2ONCA 2IYUA 1Z83A 4Z5XA 3HR4A 2EATA 2DYKA 1M7GA 1UMKA 2LP4Y 3A6HA 2FZWA 4RLQA 5AMXA 2VTKA 1YI8A 5B2FA 4MR9B 2WVAA 4HBGA 2K7ZA 2FPOA 1UH5A 3PRKE 3LBIA 3OE4A 1YRBA 4BX0A 2RAPA 3BQ2A 1RHUA 2G1JA 1R6BX 4FHFA 3IOCA 3CUKA 4RCNA 1YD7A 2DR3A 1NXSA 5G0VA 3IC5A 4V0OA 3KB1A 5DP1A 3IIMA 3OQIA 1I7SB 2H5JA 2H11A 3RREA 5F12A 3ICWA 4LKOA 1ODIA 3T5PA 4PLTA 1I7DA 1MGPA 1ITZA 3P0FA 3L0PA 3T1YH 2BZ0A 4CN9A 1G55A 5KWSA 1KZ9A 1UF9A 2R86A 4A3EG 5BMVF 4LZAA 2FEAA 1TZCA 4W63A 5LZ5A 4WA8A 4BIMA 3ASVA 3ZQ6A 4KVZA 1E66A 1X74A 4GRAA 1O8CA 3LVBA 3K9WA 1KMHB 2NO7A 4DCSA 3GQBA 1ECGA 1ZMTA 4BVBA 4LVOA 3KR2A 3NOVA 5DG8A 4I1YA 2H4HA 3I9JA 3K6JA 2P2NA 5JCXA 1WB9A 5DHPA 2VAMA 4C88A 3OP1A 3R7WB 4MW6A 3SE0A 4PZLA 1SVSA 2N9UA 3DOFA 1S2MA 2GN8A 3FN4A 3O83A 7MHTA 3VC3A 3UJPA 1TWHA 3QYJA 5AXDA 3CKKA 1TF5A 1VBFA 3QUBA 1HEUA 3C74A 3TLYA 4INZA 4XEUA 4N0QA 2P2SA 5AJVB 3G0BA 4JVOA 1V9SA 3ECSA 2GK3A 1PT7A 3A1VA 5CRIA 1D4FA 3G59A 3RU3A 1KMCA 4J1TA 1XVIA 1HYHA 4DSZA 1S68A 4TQGA 4ZVRA 4MVXA 2O8VA 4A6PA 1IDN1 3DZGA 3LBYA 4M46A 4ETWA 1RBYA 4Y8VA 5CFLA 2ZRJA 3DDNA 1L5QA 4C6TB 3E7DA 5TS3A 4Q1DA 1ZHFA 4NZNA 3FJOA 1AO0A 4OLJA 4YJKA 4M76B 5KYKA 4EPWA 5BWVA 4RS4A 4TLCA 4U39A 1PR6A 2O9JA 2GXUA 4W6QA 3ZWOA 1P2SA 4J1TC 2WR8A 4H60A 3G85A 1PJLA 1ACLA 1IM8A 4Z9AA 1QP4A 3MGKA 4C4AA 5JTUA 3HJHA 4TYYA 2IUUA 1ZN7A 4O0MA 4ESEA 5FA5A 4KO2S 2HWUA 5FLXA 3S8YA 5M04A 2WYUA 1NVBA 4YR0A 5K0FA 3JYPA 3LK6A 3N2IA 3F8WA 3SJBA 3X1YA 3HGQA 4PLFA 1QO9A 1ZNYA 4NU6A 4CTMA 5ALUA 4AYTA 3N6VA 1LPOA 1O95D 1WUTA 4E13A 3T5KA 3MSCA 4ETNA 2V8BA 2WHRA 5TSDA 5L3ZA 2OUKA 1PL6A 2C97A 1R9GA 2FSVC 4ALKA 4KPYA 2OP0A 1GUZA 3C6KA 4Z0TA 4Q1BA 1T8TA 1K4KA 3BACA 1GNSA 2L69A 1S3FA 2VSYA 5D51S 3FRJA 2FLPA 1QG4A 1P9OA 3IIJA 3WLSA 2Q7XA 1YIAA 2XNKA 3DC7A 4KGDA 3RRBA 1Z9BA 3H0GA 3ZHQA 3MB5A 2OHIA 3ZQ4A 3VKHA 4ZC1A 3T5AA 1TTQB 4I9UA 1Q2XA 1T24A 1UKAA 1BMTA 4OMDA 1XNQB 1LPMA 1TLLA 4Q3LA 4HGRA 1SHJA 1LSOA 2V0CA 4ND4A 2XH8A 3E2IA 2DKOA 3I4CA 3I53A 4R16A 3WXMA 4B3SH 1NVKA 4ALLA 2JFNA 4ZTUB 3VAYA 1O77A 2FWMX 4Q43A 3D0QA 2QRVB 2HVQA 3SSMA 2H3HA 4YDHB 4F9GA 4L0DA 1PS9A 4RTKA 2V58A 1A1SA 1Z0SA 4P32A 3TW8A 1JHAA 5CFPA 2V9WA 3GT3A 2ZM6B 4X1OA 1P9WA 1MIOB 5EL0A 1Z6QA 1II9A 3RTDA 3GYGA 1CNFA 1NQOA 3ORFA 4D9BA 2QVYX 3HUTA 5THKA 1YJAA 3HTXA 2GPWA 4FP9A 3OWHA 4X8OA 1BHJA 3LW7A 3PYLA 1X7DA 3RC7A 3CG0A 2AI3A 4PZZA 3NBYB 3D8UA 1AK1A 5EXSA 2RH8A 4F06A 4C7OA 4X3OA 2O7NA 1HG0A 2PR7A 3ZLUA 4NONA 3VNSA 3RHZA 2I6XA 1XE3A 1XZIA 3PUWA 1YE5A 5ENZA 1FZQA 1THTA 1ZAUA 1Z29A 2WK1A 3SYKA 2GM3A 2X3FA 1QAQA 4KOEC 4ARAA 3OUUA 1K66A 3LUFA 3CKYA 4KWHA 2KB0A 3ILSA 4MJXA 4AKGA 3PUKA 1RWMA 1SOWA 4JODA 1ISIA 1OI2A 4XLZA 3GBSA 3MOGA 1K6EA 3AUYA 1V7ZA 2COUA 3H9CA 4WDRA 3S2UA 4B3IA 1SCNE 5HJ7A 1M2KA 5F1YA 4KG7A 1KY2A 3HUEA 3GZJA 4LPSA 1FX0A 2WB1E 2L17A 1L4BA 2GYVA 1GYRA 1UAGA 1SYXB 3RS2A 5JANA 1YK1A 2WJJA 1LRKA 3ONEA 4BUCA 4D3FA 1A82A 6ABPA 3TOSA 4W8HA 4U8HA 1KYVA 3QLVA 2Q0HA 4TXNA 5K3CA 2JCVA 2VHWA 3PFNA 2QTBA 1RC8A 3SR3A 2I1VB 3L7YA 4KUEA 3L8YA 2JEOA 2VWGA 2KPOA 5CA0F 5L1LA 2V7EA 3S8MA 3VSDA 3ZVMA 2CSUA 1Y63A 4F4FA 2MSCB 2II6A 3WWJA 1O6BA 5LJIA 4QX6A 2JI6A 4G0MA 4G97A 1AUOA 4Q66C 4O2LA 1B04A 2X19A 3WKDA 2QT1A 1MA3A 2YC4C 1IXYA 5B12A 4LDNA 3F67A 4A0HA 3HQ4O 4MTCA 2OBBA 2BFEA 3TOZA 4ROSA 4CLRB 2JFHA 1NLFA 2Z9CA 1F2UB 2ZS8A 1U3GA 1IHXA 5KYNA 2R8GA 4WKBA 2XT9A 2OK8A 2WTEA 2HVSA 2MU1A 3KQVA 3T5TA 2SCUA 1J5PA 2X13A 4R2MA 3P2JA 4O1HA 5KYVA 2W6IA 3L9WA 2DUNA 1G2QA 3M5WA 1B14A 4F5DA 5FOTA 1Q44A 4YR7A 3KVRA 2ORVA 1A71A 3BORA 1AKUA 1E2QA 3QLVC 2ODBA 3PL1A 1Y1PA 3H04A 4LFAH 1M2GA 2IU3A 3RK4A 2XMRA 4L85A 3NJ4A 2R6HA 1J8DA 3KZKA 4CKEA 2YXDA 2OAP1 3MMZA 4URUR 1UKZA 1FQJA 3KELA 3D64A 4KFTA 3OPVA 3PWSA 2OMEA 1NG1A 1K2VN 1U0JA 3LC0A 3V2IA 4BKMA 3MZ0A 2C54A 2KWIA 4D0GA 1BXZA 4YECA 1KAOA 2PD6A 3UGTA 3ACDA 3LYAA 3E58A 3L5KA 3FAZA 4KPFC 4RJKA 2B99A 4O25A 1TRHA 3RUEA 4H7DA 3Q2IA 4RF2A 4ZQHA 4BLRA 4TMZA 4J7XA 3EGIA 1M7JA 2V0GA 1E9DA 1RE0A 2HF8A 2XXBA 1UBKS 3SF0A 2F3PA 4HDSA 1VG9B 4IGKA 1WQ4A 4OYRA 1N5RA 1IHOA 1KAGA 3DUFA 2FLLA 1YZGA 1SQGA 3KXDA 3QPDA 3KOYA 3G6WA 4O4LF 3HDGA 1FP6A 3RSFA 3LWDA 5HYVA 4Q4JB 1OQAA 2BTQB 2X0NA 1HX7A 3D6TB 2J5QA 2P3SA 4LJAA 3RAPR 1HRDA 4QOHA 2PS9A 4KLNA 5LMUB 1YQTA 4FNGA 3ESAA 3QHPA 1XNRB 4X84A 2JEYA 1JH8A 3NXSA 1NVFA 2WIJA 4KHPH 5D1OB 4YCLA 1XAGA 3MC1A 3LX4A 5F76A 5DG7A 4ESHA 3PB3A 4Q7EA 4CKXA 1DAKA 5KREA 4CT4B 4CIAA 3FYUB 3TO5A 2AU0A 2Q2WA 3EXHA 4C05A 1Y1TA 1KY5A 2BI8A 3TLAA 4D8XA 2QRJA 2XAAA 4G84A 1E6UA 3ZCXA 1QQAA 2BC9A 4LYFA 4HD8A 3V1UA 3VYSB 1POWA 3S27A 3RC2A 1HSZA 1O95C 4CV2A 1C4KA 1E2NA 1ZIXA 4LJRA 4PTLA 4MYTA 4LHWA 4BNLA 4GQIA 1RYFA 1QAMA 5T4EA 1HFKA 5ECYA 1ENYA 3OQ1A 3HEBA 5A4IS 1LNQA 4N8SA 4I1UA 2O03A 3EZXA 2OUIA 5A62A 1A9XB 3QNMA 4ZU3A 1UC4B 2Q5JA 3L1VA 3EY9A 4QPCA 1SUEA 4GKAA 3H8SA 5EUCA 3KETA 3EXHC 3WGQA 1I33A 2EIHA 3DVLA 2CJFA 3CSSA 2M2IA 3AESB 4CBVA 1BD3A 4FSDA 3CVWA 1FC0A 1TA8A 4TUYA 3L43A 2CFMA 2D0OB 1S4QA 1V1JA 5BNTA 2QB5A 3OF3A 5IDVA 4D6XA 3GJ5A 2CDBA 1LBIA 5LLDA 3MRSA 4TZKA 4EARA 1B0UA 2AE1A 3OPYB 1AN0A 1ZD5A 2R3SA 4M98A 5D87A 5DJ5A 5AVOA 1XZGA 3ZIUA 1VFNA 1VLLA 4N0MA 1M75A 1TD1A 3ND5A 4KR0A 4WT7A 4S2UA 3VU3A 3REQB 5EP1A 5ALJA 4DE5A 4M8IA 4HXFB 1K3TA 1WXIA 2Q6VA 2B4TO 2OYRA 4MARA 3U4QB 1SOAA 1WF6A 4TZ6A 1IB6A 4CTJA 2Y0SA 2IDMA 3L40A 3WNBA 3AHDA 3ZD8A 1DQSA 3HJRA 2NZ2A 2Y71A 1AA9A 3I2GA 2P8SA 1TU3A 2P6PA 3UMFA 3DGEC 3IO5A 4RTQA 2R66A 3OZCA 2ILTA 4QUJA 4F46A 1PL0A 3U4CA 3NAQA 5KFQA 3Q0EA 1Y3BE 4G63A 5K0LA 4XXHA 4IHJB 4PG6A 4AN0A 4J9MA 1I4EB 1XMSA 2P9HA 3OMXA 1M10A 3GDHA 4UBMA 1JYEA 2H52A 2D1YA 5AHXA 2QBYB 1LQ2A 2L2QA 2P65A 3B9QA 1VOTA 3WWOA 3I5MA 1LJUA 1Z4NA 2ZIEA 5C4XG 4EDFA 1NFQA 5E7QA 4FZ5A 3CNQS 4JXKA 4KRXA 3PNBA 3M83A 4B6FA 2O8BB 4KXYA 2E5FA 4I8DA 3VYRB 3HC7A 2FK3A 2FJPA 3RAFC 3H1AA 1J0XO 3UOWA 2CLKB 5LKAA 4IINA 5HTKA 2C7PA 2VZ8A 4ZDJA 4CU2A 5JNVA 2HCRA 3KV3O 2RBGA 3R4VA 1PWZA 1W0JD 5HW0A 5FB3A 1P8AA 3BD8A 3W7VA 4CM9D 3T35A 1QYXA 1O96B 3TMYA 1G7TA 3G0GA 2QP9X 2C98A 2V7UA 2RE8A 5H9WA 4LZLA 1DIAA 5JAUA 1ZBDA 3ZWBA 2BSAA 2UU9B 3KKNA 2AFIE 1LTQA 1RWVA 3K9BA 4BO3A 2UKDA 3SLRA 2HMYB 2IHJA 4PX3A 4HDMA 1IY9A 3GCXA 4K6HA 3JTEA 1X70A 1KNXA 3LZCA 2FDCA 3HU2A 1OFTA 2R87A 5DTEA 1R4MB 5D3QA 2RF4A 4YV0A 1DAHA 3E48A 1PJSA 3VR5H 3MA0A 4FYMA 4XW2A 5CVCA 5H0IA 3OC6A 4Q21A 3ICVA 4PM4A 3UYKA 3MIZA 5I01A 4BYGA 3KHRA 3FVVA 1H2XA 4LRXA 3CJTA 4UUOA 5HOEA 4MVJD 4F6RB 4N3GA 1KZ1A 3KTFA 3LDHA 1RQNA 3AVOA 1ZCAA 5TIIA 1K1SA 2Z4SA 2FI1A 2A9RA 4BNYA 3Q8PB 5LB4A 3AIMA 4EUHA 3OO1A 1ZICA 2PXCA 1Y7HA 3U0GA 4PAMA 1DJMA 1U9ZA 2X6QA 2G06A 2AGOA 1GIAA 1E7WA 1V5EA 2HMWA 2R25B 3MTGA 2AOVA 5IT0A 2YZLA 2N46A 2GPJA 4K9LA 3AO0B 2WDZA 2Q46A 2D1QA 1VGRA 4H15A 3OQVA 3HO6A 3TLGB 3JQGB 1N5DA 3RNOA 3HSKA 2IHUA 4RZSA 4RFLA 2FMXA 4V0RA 3UB2A 5A2QA 4EJSB 4JLKA 2Z4RA 4NCIA 3HJBA 2ZIFA 1DEAA 5AM0A 2J41A 3USZA 3T3IA 1E3IA 5LOVF 1I36A 5AW4A 2B94A 2GASA 3L04A 4YRTA 4BNUA 2YWFA 5CT9A 5IXYA 4IXMA 2PPLA 2VZEA 2HN9A 1IJFA 5CM8B 3ZXUB 1P2UA 5KFBA 4R1UA 2R96A 1R6TA 4PGMA 2FZLA 3P2KA 3QUQA 3DCIA 3ZE9A 1O1YA 3EWSA 3RFCA 3G8YA 4WY2A 3RC8A 5FEMA 2XD9A 2SHKA 1SMKA 3EEBA 3TXXA 3IUJA 3RGGA 4MRAA 4HDRA 4B2LA 1VPDA 4I2NA 2NZXA 1W59A 3VPAA 5AICA 4NYJR 1PK9A 4GP9A 4QBIA 5DQHA 4Q9KA 4EUNA 1QH1A 4DJAA 1S2OA 3I5XA 2IYPA 2VXYA 2GESA 3R7BA 1JBEA 4LXHA 4MO2A 2G88A 4J7UA 1FP4B 4BAUA 2G1KA 1VJGA 2CK3A 1ZUIA 3CCFA 3SR4A 1BXKA 1EFCA 2WYVA 4YRBA 5D5HA 4YAIA 1WD7A 3BX1A 1N36B 1Y8QB 1T5TA 4DV6B 3EZGA 5IHXA 1XMJA 4P7BA 1CUDA 4Z86A 1TZJA 1PQYA 4F6LA 4J7CA 1L0BA 4Q03A 4N6OA 1M1YE 4I7HA 4R98A 3UK6A 4US1R 4QU0A 3B9RA 1I32A 4L7VA 1S3SA 3EIQA 3K72B 4A6DA 1RWWA 2EAUA 2E1RA 1EB8A 1CULC 3GX1A 3OT4A 3FPHA 4B9EA 3L1HA 2CN1A 4E3ZA 2O5CA 5J1SB 1K8ZB 1B0PA 1RAFA 1RRPA 2O0MA 2G0TA 1H6AA 4FGKA 3V1TC 3RADC 1FDUA 1F3OA 5T3UA 2P5UA 3E15A 2YJTD 3ONDA 4DJJA 1LJ8A 4PVDA 3T9DA 1ZKDA 2XSZD 2NN3C 3B7PA 1T5IA 3OE7D 3AHJA 5IU6A 3VU1A 3FG9A 5H16A 4KLZA 3RUIA 1X7XA 2G76A 1QIJA 3KZVA 4B32A 1PFGA 2PRYA 2UVPB 3H6GA 5DH9A 4EKEA 3JXEA 1HF3A 3Q3CA 3ZGOA 3U3OA 5JAQA 1DKNA 1F12A 2XGSA 4TQSA 1H1DA 1LTKA 2C2HA 2OLKA 2ONJA 4E5YA 2W57A 1W2WB 1SFRA 4G25A 4YMIA 3ZJ5A 2F4VB 3NWBA 1H2AS 3UMSA 1JX4A 4B35A 3IQHX 4TVSA 1JJ7A 1I1HA 1V9PA 1OSNA 3SNKA 1F7UA 4JENA 2I2BA 1KKUA 3U16A 4H6PA 2PA0A 3GLIE 3SXUA 5KSPA 2DAPA 4F3KA 2GN1A 4RA6B 1LBTA 1DCFA 5KT7A 3DJFA 2Q2OA 5BSGA 1DAOA 1JR3A 1OMOA 3STTA 4GPAA 3BK1A 2D5CA 9ABPA 4QARA 1EX7A 3THYB 2R47A 4I1SA 4LJ6A 3GV5B 3OOHA 3LX6A 1QVZA 1L1FA 1QHYA 1UT6A 4FN5A 1EP1B 2R0QC 2P67A 2CF5A 2YX1A 1KQ3A 2R7ZG 1ARZA 2DWPA 5BNIA 3DOCA 1TM3E 3QLEA 3T3PB 1OX6A 2J6HA 4E6EA 4Q48A 1ETHA 1VHDA 3LUDA 3VVBA 2GM5A 4HFJA 3QIVA 7ADHA 5AKZA 1YDEA 1H3FA 1K3UB 4F50A 5F7OA 3IUSA 4JJIA 3O92A 3MGAA 5JVDF 3E8MA 3TOVA 4MX8A 4WBNA 5KTPA 2W98A 2WMDA 2MOKA 4BO0A 2YRWA 1MC4A 4BBSG 4YH1A 2P0AA 2NV6A 2R92A 3VKWA 5E25A 3QWFA 1UMDB 1AQ6A 1C1XA 2POQX 1WY7A 2Q7OE 1X42A 2YWXA 2XRMA 2Q4OA 1CJMA 5AW7A 1G60A 2EFYA 1CJVC 3L84A 3QI7A 3KJFA 3DFZA 1P2FA 2YHIA 3D6NB 3I5UA 1M67A 3PPXA 3RS3A 1WHTB 2XT0A 4JJ6A 1KI8A 2Q5EA 3OLCX 4P1ZA 4M2LA 4YUVA 3A06A 1OREA 1XWIA 3AKYA 3TTTA 4RHXA 1Y1QA 4LY3A 3ZJYA 3RFTA 821PA 1GU1A 1OGYA 1E1NA 1ZOSA 4GI2A 5TGDA 4HZUA 5FI3A 4BUJA 3SMVA 2IXFA 1Y9JA 4PZAA 5KNDD 4JA2A 1T3TA 2FN9A 1Y9DA 4CLOA 3GPCA 1TVEA 2ZPUA 5TC4A 1KTVA 1L7EA 2J6CA 2Z3ZA 4E21A 4K9PA 1XZPA 3ANMA 4RE5A 3KLPX 4HNAA 1R0LA 4MQ6A 1XZNA 2OD9A 2VJAA 3TNLA 4ODIA 3S2EA 3SJ7A 3SKYA 4E0BA 4RHEA 3A9SA 4QDZA 2QRLA 1Y1SA 1LSUA 3TLZA 3LUHA 3ZIDA 3ZTYA 4EABA 1HZZA 2B82A 1RACA 2HU2A 3ZYCA 1XTIA 4BWFB 1U63A 2G83A 2ZAIA 1LY1A 3CZQA 1IQ0A 1K9SA 2JIDA 4U7PB 2MMCA 3KAQA 3UN1A 3GEBA 5BO5A 2JJ1A 2RGRA 3O8BA 2PYDA 1L5YA 5TPWA 5ESDA 5IBPA 3ENWA 3BB3A 5KFGA 2WD7A 3BMQB 2D2IA 2LGJA 3I9NA 1Z4JA 4CL2A 3Q3VA 2ERCA 3ZCPA 1YS4A 4LOHA 2HIMA 2HHCA 1EXWA 2QTFA 4BDTA 4I6GA 3KLNA 2WQ7A 2YW9A 2POCA 1C0KA 3K73O 3F47A 4HTFA 3PS9A 2A92A 5FAXA 2G7MC 3GAMA 3V8VA 5J9FA 4DV7B 1L5OA 5K3BA 3UBMA 4HAXA 3DLHA 3M3PA 5B4UA 3P0IA 3F96A 4FR2A 4TM5A 4BMYA 1T0IA 2F8LA 3PFKA 3IUEA 4ERNA 2NTJA 2J9ZB 2P0EA 2I3BA 1R0SA 1F5SA 2A0UA 2NXNA 3E9DA 4HLUC 1VMDA 1E8NA 3QVUA 2PZFA 3NALA 3DNMA 5JC8A 2F00A 2C2KA 5ALLA 4QRIA 4HH0A 5CX1B 1BFUA 1AC5A 4QT4A 1D1SA 3BH0A 3PFCA 2PWZA 2GF9A 2CKZB 3O4HA 4I8XA 1S8AA 2L42A 3MF4A 4MQUA 2I2XB 4XYMB 1ES9A 3G9ZA 4DLRA 2VK2A 3WRYC 2HXSA 2Y1FA 4B6GA 2D13A 3D7SA 3ZV3A 1RXUA 2XKKA 3LRPA 2NACA 3DXFA 1I94H 2HXYA 3R0ZA 2CVPA 4IAOA 3C1UA 4JGBA 3K4QA 4XQGA 5L6LB 2E4XA 1JT9A 1HK7A 3T7EA 3PF9A 1C9DB 2X2PA 2C3MA 4NMLA 4I1PA 2C5AA 3OZUA 4C4PA 4R2LA 1PFQA 1JXLA 4FD3A 3VOBA 4ZV4A 3QEOA 1GPDG 1L5HA 4TT8A 2C31A 3I34X 3I6BA 5C32A 3IAXA 3UFBA 5HM6A 1FFSA 2YTZA 4CQMB 3FPEA 5CVTA 4ZHQF 1M73E 2ZRDA 5C1OA 2IZOA 4Y2HA 4HK4A 4M0UA 2WTUA 2R6JA 2ARKA 1MJ5A 4HY3A 2QM0A 2ZG6A 1F0YA 3DOOA 1QQ7A 5FT9A 5G3ZA 2JA6A 4IEEA 3JPYA 2IY8A 4CMKA 4HNTA 3MWDA 2AVDA 1PJ3A 1WEHA 2FFHA 1P2BA 1YO6A 4HNGA 1GGKA 3LC2O 3NPMA 1RAEA 3RIMA 1Z7EA 1L5VA 4AL4A 2BQRA 2RONA 4NYEA 3ZCUA 3K5HA 4P5EA 2EFHB 4TL6A 3TVYA 3IP8A 5IJ0A 5KU1A 3KPWA 2A9VA 2CLEB 1U3TA 4LPKA 1HLFA 4X54A 1K7EB 5CM0A 4KWEA 5FOSA 3UXHA 4PHCA 5AIBA 1Q57A 4BNZA 4DARA 2PAFA 5I4CA 3PIIA 4BNKA 4ECSA 5JY1A 1VE9A 1COZA 4HH3C 4QOEA 4UCQA 4FFMA 2ZTHA 4RAQA 1JBKA 4XGNA 2IS1A 3BUSA 1PJCA 4IJWA 2BH2A 4XX1A 1J8QA 1IVSA 4GR4A 3C3MA 3ZBPA 3V4FA 2W2MA 4JUZA 5LL6b 2NU6A 2IMWP 4B8ZA 3FCEA 4GP6A 3E03A 1J25A 1Q7CA 4W5RA 4RMNA 1J1ZA 3OJOA 4S0XA 1QG6A 5KYWB 3RAEC 2Q4RA 4CXMA 5H68A 1GL9B 2QU7A 3F7MA 4AUKA 3JYHA 1FRQA 1CKEA 4K81B 2RAVA 3IBSA 4MUMA 3WE7A 1CSEE 4XQ9A 4YJ2F 5FI5A 2GAIA 4Q4HA 1R4AA 3AF0A 5H83A 5HSGA 5JATA 5JROA 3H8JA 3DAHA 5FPHA 3GHYA 2VQEH 2E6KA 1GTVA 3UMCA 1E77A 5COAA 4KQHA 3UIEA 1GV1A 2ZWOA 2KMLA 4CVNA 1DLJA 2WB2A 4OQMA 4JH0A 2X1MA 3HEMA 2XQIA 4DVJA 1TO1E 2IUTA 3LD9A 5JUMA 3LT5A 1L7NA 3IP6A 1GNPA 4LJ9A 4V24A 2B1GA 4IIFA 3TQ1A 4TV8B 4A2QA 1JS1X 2FWPA 3KSBC 4BVFA 1T9AA 2QX8A 4G1FA 2F8SA 1H4SA 1XD2A 5JT1A 3ZC3A 2QY9A 4IZIA 4EGCB 2X8AA 4TKUA 3VZPA 3PDCA 5HK8A 1B42A 5F2EA 4Y6QA 3FX2A 5JSYA 3LAWA 1XVVA 3CLKA 3RIXA 1P45A 2VUTA 1K1QA 2GBPA 4DL3A 4C29A 1YKSA 5LZ9A 2PRJA 1V3QE 4DQNA 3UM9A 2DBYA 2WRZA 2I1QA 2JH8A 1SXQA 3CPJB 2JFUA 4NPCA 6NULA 3LGAA 5KNBH 1QQ5A 5IKEA 5GONB 4H6WA 1OILA 1NVWQ 2ECQA 4O0LA 2NUBA 1QO0A 1S0NA 4RHTA 4IIUA 2NVBA 2QRMA 1N2SA 1WG8A 4N8DA 4DL4A 4I3FA 3IO3A 1LEHA 4JSRA 3ZQKA 3VHLB 5CVJA 1D0VA 3BIFA 3KXLA 5DYYA 3AZQA 2YFQA 1Z8DA 5EMMA 2Q1SA 4ILEA 2FCRA 2LV8A 8MHTA 2CZCA 1BKSB 3QYAA 3RU7A 2BEUA 4CEHA 2VDLB 4IDFA 4NCHA 4MWTA 3STWA 4MEAA 5KTRA 5C80A 3KJZA 1OI7A 1DHTA 3NATA 3WI7A 2TMKA 1GPJA 2R5NA 4N0DA 4BMSA 5KNCD 5TVKA 5I60A 2X5RA 1TQ6A 4MEJA 2B4QA 3H0GG 2ID7A 2YZMA 5F1KA 3OURA 4R2IA 4MGEA 2GD0A 4IP0A 3KYBA 2XXAB 1PR0A 1MO6A 2Y0BA 1ZNWA 1DEHA 3RYIA 1RRKA 3UGKA 1V45E 4U8GA 2OCBA 4DL5A 1INLA 3M6VA 4CKBA 2W6OA 4DR7B 4TKZA 1V3UA 4E14A 4EO9A 3LZ6A 5D5QA 3I62A 1K6IA 1PT8A 3NDPA 4PRKA 4KXUA 5ITZB 4PW0A 3AB7A 3JRXA 1GGJA 1ZCFA 5EIHA 4D44A 1U3DA 2F9LA 2FMTA 2VH2A 2IOQA 1TYCA 2HMAA 1HV8A 3F49S 3ZHOA 4TWRA 1E7RA 5GJWC 5EJ7A 1NDUA 4L4RA 1PVDA 2VJPA 2P91A 2PT6A 1KNQA 3EAQA 3VR1A 2IKSA 4WY8A 3G1WA 1SCIA 1UDXA 2IV2X 4B33A 2EZ4A 3TGWA 1P1FA 1RFGE 3QFCA 1OH6A 5KSYA 3B13B 3UJNA 4HVTA 2AE2A 1MOPA 5CT6A 4JR2A 4ZV7A 1IBKH 3UJ9A 3EFEA 3GLSA 1CE8B 1TM4E 5C8YF 1HE1C 4ZHSA 3J81k 1ONNA 2OHOA 1Z4PX 1LWNA 1SXJB 2J7PA 4J3JA 2CFTA 4CL3A 4US0R 3SNHA 3QMVA 4EUSA 3MJ4A 2HBRA 2HNAA 1GO3E 5JPDA 3UJAA 5EFOA 3LZDA 5ICGA 4TYQA 3RVLA 5I8PA 4CF4A 2JVIA 1A9SA 2W8BA 3PNPA 4EFEA 5CU7A 4DZZA 1P4JA 4I3HA 2BFDA 2Q2NA 5CIWA 3SDBA 1ZU4A 2ZIXB 4L0CA 3RSSA 2HPHA 2HPAA 3I28A 5JAMA 3BRWA 4B7XA 2H1OA 3MWEA 3ZE0B 4JBIA 4QTZA 4NOJA 4E2FA 5GGXA 1Y1LA 3K1JA 5JCZA 3CXUA 2N1MA 4FFLA 4KYUA 4WI1A 1P7WA 1CBUA 4NYJQ 2A4MA 2UZIR 5KMGA 3MFQA 1G3QA 5K3FA 3BF8A 2C2MA 3QF7A 4JT8A 3LXUX 1TJ3A 1ZWLA 3QEBZ 3OPXA 3FH0A 1PJZA 2Z08A 1PIWA 5E6SA 4DUZH 5H3LA 4J9KA 1HGXA 2CCKA 5TGZA 1ZVKA 2VRCD 3K0AB 1MHPA 2X4GA 2J32A 4P58A 3P9CA 4WZAE 1VXRA 2AN1A 3C8DA 2XTAA 1DXYA 4YP9A 1MQAA 2WNIA 1JE0A 2WT9A 3GAFA 2FUG1 4RVCA 4H1WA 3WP1B 4B2IA 4JZYA 3ESRA 5AXAA 2RJNA 5FUMA 1WZ2A 3E9ZA 5KX5F 2IEIA 4HVLA 1I3OA 3D2BA 2XNSA 3L49A 5K1ZA 2MT9A 4R9VA 3C3AA 1I6LA 3V2HA 3ZX4A 2R5WA 4FC7A 3L1IA 3IRVA 5LN1A 1QFMA 3IBTA 3U1TA 3GCGA 5H59A 5E38A 3DNFA 2QTRA 2FSVA 3TFWA 5KWIA 3G8DA 1EZZA 3IAUA 4JB8A 4DR5H 3H2IA 3B1YA 4DB2A 1RI4A 1MX1A 5IWAH 2IPXA 1HYBA 4MVWA 1M1YB 3EY4A 2YMPA 5GOZA 4NTZA 4HVAA 4NXNH 3BQNB 2BEWA 3PD0A 2CNOA 2H1LA 4XVHA 3R6GA 3M49A 3HRKA 1M33A 3RKSA 5HPYB 4HYTA 4TYPA 2A2ZA 1KS2A 2EW1A 1XJCA 3CWQA 4OHZA 3PBKA 4BHTA 3K30A 4TN1A 3A6EA 2HGXA 2HTFA 2REBA 1PEYA 1KYYA 1KJWA 1PRYA 5K3DA 5K05A 1QWOA 3EGDA 4TTRA 2AN4A 4KQXA 4JBWA 5B2ZA 4ARUA 5K8CA 3FPSA 2XC9A 1HDOA 5I7VA 1UC8A 1FEZA 1WR2A 4OGWA 3D6AA 4M88A 3C6BA 4LHVA 3VOTA 2DUUA 3JV7A 1XDDA 1XALA 1RKXA 4ARZB 1JDBC 3CNHA 1GG5A 3LFTA 1ZBQA 4UBOA 2ODNA 3ENQA 3IT2A 3FHCB 3HM2A 4B7ZA 3ML1A 4AMVA 4LF9B 1NPYA 4QDTA 1R0ZA 1DL5A 1RK6A 3GLIB 1J0DA 2AJLI 4QBFA 2Q9CA 4TKMA 4Y0NA 4PSUA 5KYYB 3O31A 1TT5B 4RD2A 1VMIA 4B3XA 1QYDA 3P4XA 2ZTVA 4UEOA 2VF2A 5J4KA 4IJ6A 4BASA 1VRWA 1KVSA 1ZGGA 2OV1A 3Q8QB 1CVLA 3ASUA 1RK5A 4ER7A 2ZSEA 3LQ2A 5FKJA 4UOEA 2CV2A 2OBXA 3MD9A 4ZANA 5AJXA 1X8KA 1OHHA 2XEXA 2AX4A 4XIJA 3PIDA 4LVUA 4C20A 1DARA 3GMSA 1CUZA 1PG0A 3W5SA 5DYTA 4C4XA 1YDGA 2WSSD 3GJZA 5A3VA 1EGVB 4EQZA 1YFKA 3NHRA 1R0RE 4HWRA 1DO8A 5JYBA 1EVIA 5CLIA 2RH4A 4I2VA 5BYAA 3MWMA 1W52X 2HEIA 4EEYA 1U0TA 2XE6A 2CXTA 3VJLA 4RENA 2ZK7A 2GETA 3F98A 3AJEA 5EXPA 2COIA 3GPIA 2WT8A 2Z6QA 4XEHA 5E1OA 3UUWA 4WL0A 5IMBA 3D9QX 1AHNA 4FYPA 4INAA 1YC5A 4B83A 1TGYA 4N65A 4GOLD 3O94A 2GARA 1SU6A 1ESMA 1IRXA 3KJXA 1HE5A 3H5TA 3UAZA 4GPZA 1USVA 1RIIA 1Z2EA 3ESQA 3ROGA 5COQA 1JL3A 2EL9A 2QUKA 4F97A 3HYNA 1VIAA 3MILA 5CB0A 4DT1A 3WK8A 1VMKA 4TVOA 1OFVA 5TNXA 4HH4A 5LQUA 4HX2A 3MERA 4WNIA 4DYHA 3JD0A 4KACA 1TIPA 2PX6A 4TX1A 3DBLA 4QG3A 3HVKA 2X5NA 4EG7A 5KOHB 1DG1G 2VDWB 4NJMA 3IMCA 3QKTA 4KMOA 6PFKA 2FPLA 3I6MA 1Y42X 2EDAA 3RSZA 4YJFB 5IVIA 4DMFA 5LP6A 2NAPA 3R5JA 1JVBA 5BUQA 4K6MA 1M6VB 3PEYA 1Z5PA 4UULA 4ZQCB 5KG5A 3FLBA 4Z0PA 4ML3A 1ZL0A 4YMSA 3RARA 3OCZA 1ZM7A 3TSWA 1BW9B 5JSZA 2NYRA 4GYYA 4COKA 3PC2A 1Y6RA 1FFXB 5DGIA 1UNNC 1FLVA 3VKFA 3FCYA 1OBOA 2RGCA 2AB0A 1DJLA 2QVCA 1L7AA 1FJXA 3GJ0A 2IYFA 4Y0VA 3K8ZA 3P0JA 2NU8B 3GPBA 4ED9A 5IJAA 2ZPAA 1V9LA 4W7IA 3U4AA 5LP6C 2ZGIA 2EFCB 5C3UA 2GZ3A 4IKEA 1EAMA 2R44A 3GGSA 3MOIA 4DL6A 3R5XA 3QPBA 4NMXB 1ZEMA 4BJ1A 1SG6A 1FX1A 4YAKB 1CR2A 4CTNA 3STVA 5KTTA 4MJ3A 1WXFA 1FLDA 2Y4RA 3GH3A 4Q93A 2XCTB 5CJPA 3U09A 2ZTMA 4GSYA 4HN4B 3MQ2A 3WGVA 2P2CA 1P6XA 3UK7A 3PQ3A 3WK7A 4V3BA 3AEXA 3OSPA 1SK8A 2AYYA 3EARA 4IBOA 4M9XA 3N2GB 4DCTA 1BVUA 3UMJA 1FQOA 3MRTA 3ND9A 1ZA1A 3HP1A 3TPFA 3RD5A 2AI2A 4HCJA 7REQA 2C99A 5JQGB 3VR2D 1O95A 1WPGA 4DM3A 3VR6D 4GWKA 1E2LA 1FUIA 1JFVA 4X91A 2NTVA 3AR8A 4LZJA 2YYZA 5H70A 5TMBA 1K27A 3KCNA 1EEHA 2OBLA 2HQRA 3KEGA 3WBKA 4CM8A 3VPXA 4OXYA 2PZMA 3CWCA 1CRWG 1TKCA 2VHVA 1JPNA 3BGWA 2WYHA 1EWQA 1F4VA 3TLXA 5ANRB 4Q4DA 2WV9A 1VBMA 2AMFA 3U7HB 2PMDA 2ZB2A 1MAVA 2Z5VA 5ALEA 4C14A 2JANA 2BR5A 4D02A 1U5BB 4UCWA 4GWLA 3N28A 5EVJA 1GDDA 4MW7A 3EPRA 4IXTA 3FUTA 1P81A 1GZHB 2E5LB 3C8MA 1GARA 1LRJA 3GCWA 3E3NA 4ZEMA 4P84A 1ZOIA 2XJ4A 3BA1A 3NTLA 3QFRA 3ZHZA 1GTZA 2XF2A 5JH7B 1ISMA 3KHTA 4DR1H 5KC8A 2NW6A 1OZ0A 5B7QA 4LC1A 3QWBA 3HFSA 2BUCA 1E6MA 3BWVA 2C0QA 4L6AA 4HEA1 5HQ3B 4KIUA 5HOQA 4UEKA 3OZDA 3COVA 4GI7A 3IAAA 1P6QA 1UAYA 1NXTA 1DUVG 3W77A 5SYNA 4KKVA 5HILA 1P4SA 1J5EB 4EWLA 4XB2A 1DXOA 1HUQA 4HUQA 3AW8A 1U4NA 3BTVA 1MFPA 2ZAYA 4S1TA 4NYMR 2V1XA 1H1TA 1II8B 4QXQA 2DABA 3RASA 1E96A 3D4IA 4WOCA 1FSSA 4G5RA 2ONKA 4HATA 1ABEA 1V8DA 2NSLA 4CRWB 2ZRMA 2J30A 1XZQA 3FGZA 3VYVA 3ZZTA 1SC6A 3LF2A 5DLDA 4KQCA 3HK2A 4ZI7F 1EYZA 2ZRQA 4RTJA 1XA4A 1MDFA 3R6TA 1HC7A 5JMPA 4UHJA 1C9KA 4RVDA 3T4EA 1Z2OX 2VH1A 4HRAA 4BRSA 4OSEA 4W7SA 3CF6R 5FLXW 1JFFA 1P33A 3DBRA 3H2YA 1EK1A 4ZOLB 4CM4A 1TU4A 1SZDA 4C2UA 3V7YA 4PZYA 4YQWA 1GZSA 3SVZA 1YIOA 3FYHA 3M9MB 3K31A 3H9JA 1ZINA 3GCDA 4TTPA 3RUHA 2X7HA 5DNWA 2ZI3A 3KAPA 1PZHA 4F9EA 1RXWA 3EXEB 4MYRA 3W1EA 3K15A 1AHPA 4J0EA 4C7MA 4DC0A 3RS0A 4QUBA 2OGWA 1EP3B 1A3CA 1I10A 4JT4A 3R6DA 4QGFA 5DXAA 4ZYXA 5BSKA 5A6SA 3NTXA 1A88A 4QA9A 4MZXA 3OA2A 3H8VA 2PBFA 4L28A 2NOAA 1P0QA 2GKOA 1EPUA 4PYNA 1DQNA 1K89A 2PQ2A 4ZGGA 2Q49A 2J09A 3JSNA 1U2EA 1D04A 3PP8A 5K3AA 4NV0A 2Q2TA 3UJ7A 4XVCA 4RMJA 1EI9A 2PM8A 1GRQA 4Y67A 3IS3A 5GZ6A 1PLLA 3KREA 2DHDA 2DTEA 2OXEA 3NRJA 2FE3A 4E1VA 1KI2A 2QGZA 4OKSA 1Q1AA 4BPBA 4EY3A 4JLMA 4TRNA 2NO6A 4BV2A 2FLKA 2QN8A 3E4DA 4W8GA 3LJKA 1A3GA 4WK6A 4FFRA 1ATIA 1QQTA 1GSOA 4JI4B 2E0IA 2H65A 4CDMA 3RB4A 4O7NA 2P77A 4D9KA 4EHHA 1OLUB 2CE7A 2WAXA 5CLHA 4Q4AA 3JWIA 1QIGA 1KFCB 3A4MA 3WWIA 1VIMA 4J90A 3WISA 4IHQA 1WKVA 5CTJA 1UODA 2CLOB 2G71A 4UCOA 3I4LA 4EJMA 4TZ0A 2CUTA 4DILA 1AB5A 2C22A 3BJRA 2Z56A 3DBHB 3NM5A 5AW6A 1SXIA 4Y2PA 4G24A 3BFPA 4IL5A 1W73A 4AYBE 4HHEA 3KQPA 3I3SR 3T1VA 4HPJB 4P82A 4II2A 2JA2A 2YJNA 4OUDA 1GL6A 5SZIA 3A4YA 3FJ1A 2WJVA 1M6HA 1A2QA 3KZOA 5EFZA 2OB1A 5TQ2B 1SGWA 4PZ9A 4CLHA 2HV9A 1GG8A 3UOAB 1ZUHA 3W1BA 4FFBA 2PY6A 4LJKA 4CCYB 5FNVF 1DG3A 1SXJE 4FM9A 2VAVA 2XUZA 2HSGA 4J0FA 1WSCA 5KTOA 1U7OA 1B73A 4K1LA 5AM3A 1VHWA 1B26A 4OLAA 4EQ6B 4M49A 2W6MA 5BN3B 4TMYA 5CNIA 1OOEA 5LNK1 3TINA 5K6TA 4PX5A 4OFXA 4UC0A 5FQOA 1QR6A 5ARBA 3BGVA 2P30A 3Q72A 1L2ZA 4NZZA 4YB8A 2R92G 5CPBA 2DQYA 1DDOA 3W5UA 2EEPA 2AOUA 4RW0A 1DKPA 1N75A 4WOBA 4UCRA 2GOYA 4J4HA 4EJ0A 4AJJA 5ALNA 3SEQA 4K6GA 5BWOA 3TKLA 2DOKA 2H5IA 3E5RA 5GJVC 4V1CA 1NMEA 1UBEA 3RHFA 5JHHB 3AJ9A 3VISA 2VBGA 4IJUA 2P9FA 5HF6A 5KVVA 1QFZA 1ZI6A 4MV8A 5DFAA 5C52B 2ZS7A 1HFEL 2ZTSA 5JMWA 1V8FA 2ZJ3A 5I9TA 1JQ3A 3TL6A 1XG5A 3V46A 3DLAA 4DHWA 2P3OA 4IV0A 2QZJA 4TLMB 1WXEA 2IWHA 5CA1A 1EA7A 3C5VA 4KFRA 3W1GA 3A0RB 3QF4A 4RTSA 4MPJA 1MOZA 3HY6A 1I1NA 1G1AA 4LRQA 2HLDD 3DZIA 1AKWA 1L4HA 1TAQA 2CLMB 3WNQA 2XNJA 1KOFA 2GTIA 5E6UA 1YFLA 4Q39A 1C2TA 3L46A 3WP0A 2D2FA 2NVUB 1D9XA 3CRQA 5C1DA 4I4LA 3G68A 3TZLA 1FMLA 3BE8A 4DADA 3TECE 3ZJUA 1NF8A 3NBYC 4JP2A 2MIIA 2IWRA 1QG0A 4YHBA 3QYFA 2IZ7A 3UT0A 1PTKA 4QTXA 3L7LA 4I50F 1E63A 1BVHA 4NJEA 1OX5A 4A1OA 4BLOA 2FGJA 1IFXA 4OAQA 3UG7A 3LP6A 2RGGA 1QZTA 5HBRB 4AO6A 4KWIA 4RZUA 1TU0A 3ESBA 3MN1A 3ULKA 1P72A 1MO2A 3HYTA 4JV1A 4RKRA 1NRWA 3GNSA 3PHLA 4XGKA 2C35B 1PYGA 4N12A 1DZIA 1PQWA 3W6ZA 4CIXA 3EULA 1ZR2A 4DSOA 2OQ2A 5HE8A 3U31A 2NUPB 1Z26A 5FD8A 1S9DA 3S55A 1EJ2A 3SS9X 2PFGA 3O3NB 1TX4B 1XEXB 3EDQA 3IDOA 4QECA 1C7RA 1DRUA 2DZDA 3WLEA 3WZMA 5KFUA 4GLLA 2YRXA 3KWFA 5HK9A 4IPTA 3WIOA 2JLVA 1AQLA 2JEJA 2E4UA 2ZREA 4ZIRB 5DGTA 4MI6A 2QMZA 1L7MA 1ZNQO 2PDAA 1N6RA 4MVYA 2R11A 1XZJA 2CNQA 1PHRA 4PNEA 1JPJA 3PWTA 5L7WA 3N40P 4BV8A 2B8WA 2IOFA 4Y2RA 1Z45A 3ZW9A 3B3QA 4TSRA 2VLBA 1IUNA 1JMYA 3QITA 1UPAA 2GKSA 5HUJA 3H6KA 1MORA 2QTVA 1UZUA 4RQAA 3KR0A 1FYVA 2WTAA 2GHQA 2Z0MA 3HYRA 2I7DA 5HIAA 2OCGA 3F3YA 2QKYA 4DLNA 1DTEA 4LFCB 2DFDA 3AHCA 5DHRA 4OQNA 6CHYA 4O3RA 4LRSB 4FYJA 1DRKA 1KUTA 1Y7TA 2GX6A 2ZJ2A 1PNOA 1EE1A 5FJ8G 2M32A 4FMCF 5IDQA 2ISCA 3DH0A 4HQNA 2W9CB 4E5NA 3BMOA 3DA8A 3HPQA 1PJ4A 1TECE 3Q3JB 3BE4A 3C1OA 2ZZMA 5DB4A 1LLFA 4UBIA 1H66A 3K9HA 3A37A 4WY5A 4F9FA 2ID4A 1C0LA 1CEYA 3PX3A 3VPFA 2PHZA 4TGLA 1ZAKA 1FTWA 2P5YA 4PLVA 1NJ2A 1G2WA 2HF2A 2HMSA 2IHBA 1ZESA 4HNSA 3FIJA 1G19A 1VDZA 4WZAB 2RHCA 3C4QA 1R12A 3DF9A 2VO1A 3T7CA 5G1OA 1K63A 4ZKEA 5FFNA 1KJ8A 3B5JA 2PZBA 3HOWG 5FHQA 3O7WA 4Z4GA 1W0JA 4MPTA 4CM9A 5JAHA 3RYHA 4IDPA 4IVPA 3ER6A 2ASEA 2FH5B 3G2JA 1LBSA 4RF4A 5TDHA 5KT6A 4P0TA 3T1QA 4YS6A 4J4BA 1RQPA 2BF7A 1X7HA 4EI7A 3RVRA 2JA6G 3ENVA 1FP2A 2Q9AA 3W05A 4E32A 3G9UA 4AX8A 4WCFA 3PNQA 5K8LA 1I1OA 1MKYA 2EJTA 2RKWA 4CDRA 4DV1B 1EFLA 1N8SA 3T5JA 4ZVOA 4E2XA 2X0IA 4NH0A 2X8JB 4IR7A 2OVFA 3ZHBA 4C4YA 4MVJA 4GMGA 3MINA 3WIVA 1Y8AA 1OLXB 4UUNA 4OQQA 4CUJA 4CETA 1L2TA 3WTCA 1QCDA 1AGXA 4DA7A 1N32H 4M7WA 3UUEA 2PTGA 1HT3A 1IIRA 4J91A 1GDTA 1TRKA 5U9CA 2GWRA 2BFOA 5CDFA 3PE4A 1L7VC 3V8BA 3LT0A 5K8TA 5BR4A 2FW1A 3FFBA 1TUEA 3D1LA 4GQBA 3NC1C 3TRJA 1DQYA 1EFVA 1C9NA 4WCFC 3WLIA 2KLBA 3VMFA 4MQFB 1O94D 4LBWA 2X2FA 3K32A 4ED6A 3QU2A 2Z6VA 1ZJ4A 2XYVA 2QL6A 2VUUA 2C2XA 2COJA 4R8VA 4RD6A 2R6ZA 3WYGA 1LCIA 3SEAA 4OOEA 4WPGA 4KREA 3WWCA 5MGBA 4J9NA 4C0QC 3ND8A 3OOSA 3ZV4A 3GEMA 2G5PA 3QEAZ 2EBWA 1JJVA 2GS9A 3ZZUA 4JVNA 3EIFA 4I3GA 5EHNA 4LV6A 3DHNA 3SSAA 3EPIA 1KPIA 2O2DA 2UZ3A 4IV8A 1TL7C 4KKXB 1QV7A 2RMKA 1EUDB 2YICA 1WH2A 3T7JA 2HLDA 4Z7JA 4ED0A 2VHYA 2GPTA 2VBIA 5I5XA 3GIDA 4Q3KA 3U81A 1G8PA 1SIUA 1XCPA 3UW1A 4DAOA 1KXJA 1WXHA 4B17A 1DAAA 1CUJA 1FS4A 1Y3AA 2G9UA 5DN6D 4OVKA 3WYAA 3UAXA 2F62A 1RBMA 1E2KA 1H05A 2JLRA 4LE2A 3T61A 1KI1A 2Y1CA 4HLUA 1N9KA 4F86A 4UU7A 3WYNA 1KVQA 3ABOB 2XYHA 3UAYA 5BQ3A 4B7AA 5TRTA 3HJAA 4RESA 5DM1A 3K0FB 3IUQA 1NIJA 4HOYA 1ZK0A 2VATA 1P18A 4PYOA 3TR5A 1EM8A 4M0FA 1TJYA 2I1LA 3FHTA 3K1AB 1ZMBA 2EBHX 1VIVA 3WRYA 3L7MA 1KAEA 2ZUVA 1IEVA 2F67A 3RF2A 1CUGA 1NBHA 4FB4A 2LKCA 3H84A 2VJQA 1Z7WA 3I9KA 1WETA 4BMPB 1Q3TA 4FDVA 4BC0A 1KI7A 2EFEB 4MP3A 2P9JA 2YWCA 2ZR7A 4FDAA 1D09A 1DJNA 4RK6A 1JECA 3EVGA 1BE1A 4YRAA 2I62A 1P6UA 2JGAA 1JZTA 4R9RA 3OIVA 2P9GA 3LUCA 5BYKA 2Y4NA 3V3TA 2NU7A 1KWGA 5A2QW 3CBGA 3BMCB 2VVTA 5EZSA 1B1CA 2Q6KA 4BEVA 1CJBA 5KYGA 3GAAA 2JEZA 2XSZA 4KV7A 4TZTA 3OE7A 5JW6A 3O4VA 1YZQA 2QVXX 5KJ1A 3GVPA 6ADHA 1Y7PA 3JQPA 4BLVA 4JBHA 4N03A 4O2BB 4BKPA 1LX6A 1GFSA 3IMKA 2QM8A 5KBYA 3NR2A 2XQFA 3RAGA 4MYUA 1Y98A 5A5FA 4O7YA 2GZHA 4MDHA 1V26A 1KC1A 2Q8QA 4U2GA 4ZDIA 1XCBA 2CBXA 3H0KA 4HQOA 3UJDA 2PUHA 2IBSA 2XA2A 4M99A 1GNQA 1H2RS 4YDRA 1GZ4A 3S81A 2XLBA 4AJ9A 3GRAA 4L9SA 1JVSA 3LNCA 5LIPA 5ARDA 1XA3A 2H0QA 1JKFA 2QVGA 3WYFA 4B7CA 2H7YA 4AJPA 5EHGA 4YASA 5H4GA 3LUAA 5FOVA 2PQ0A 5GOTA 1A5ZA 3FMFA 1ONSA 1N8KA 1T9BA 3SHVA 4D3XA 1T5LA 3PFWO 1DQPA 3QKRA 5C4IA 4E7PA 3HEAA 4D3ZA 3H40A 1VLZA 5ALMA 1OB5A 1S2NA 1D2RA 3VYWA 2IEDA 1TMKA 1QM5A 4BNFA 4B46A 3G9QA 3FR8A 4A5SA 4TTTS 4GBED 2IYSA 4ZAYA 3LGSA 5SICE 4L4ZA 4GH5A 5CB4B 5H02A 1QYWA 4F4ZA 3ZLTA 3E23A 4J9VA 1FXWA 2JKZA 4NENB 3EVNA 4IXNA 3DPSA 2DULA 4G4GA 5T7BA 2O8EA 5HFNA 3JQDA 2ZJTA 4PPFA 1FFYA 3JARA 2PFKA 4UDOA 1GKYA 1DU4A 3FOAA 1ZZEA 1PJ2A 4PC3A 3LYUA 2QPAA 4DCNA 2MYPA 2CJXA 1IJBA 1U3FA 4OJMX 1HQYE 1KEEA 2RK6A 2QT9A 4HEHA 4Q4CA 2XDYA 3AERA 1UPUA 2O8CB 1US8A 3K1YA 4OJKA 3FOFC 4RVGA 1M34E 3M9LA 3IAFA 1Z07A 5I8ZA 4WUTA 1BOOA 4N7MA 1H3NA 2HF9A 4EJSC 3EK2A 4AKEA 2CD9A 1EGHA 1N2CA 5IWCA 3E3MA 2LD4A 2V6BA 4ZXPA 3T1HB 2OZPA 4JUIA 2YWJA 4A3BG 1U1GA 2LIPA 1FP7A 4JAVC 4I0WB 1FUEA 3LPAA 1RKUA 3N44B 1A04A 4RNCA 1WMDA 2IYRA 5NULA 4MHSA 2QMQA 1SKAA 4L3VA 1ZMRA 4XD2A 5JSFA 3H87A 1Z4MA 2OM6A 4P3NA 1OUMA 3I8XA 1R5NA 1P3JA 1XD9A 9LDTA 5HV6A 5I7WA 2RI0A 2XI4A 4Y2YA 2I4LA 3JR3A 3CX4A 4L57A 1M83A 3HCDA 2R8JA 3V7UA 4JLAA 4GKVA 1Y6QA 2EV9A 4X60A 2LBPA 5U1PA 1HA3A 5KNDA 3DLBA 5A05A 1GDHA 1LXCA 1W4BA 3HOUG 3S44A 3G79A 3CR7A 1BMFD 4PXSA 1OY1A 4JP3A 4KO3S 3V8QA 3D8RA 4P7GA 4NYMQ 4I19A 4KE8A 2OCLA 2AEMA 1C4OA 4QT0A 3DYIA 2CF6A 5FTKA 4IZOA 2OKCA 1KL7A 3B3JA 3IQIX 4OFWA 421PA 3V8RA 4UEQA 1UJMA 2QM7A 3PITA 1GGNA 5IUNC 4E94A 1JKIA 1LI4A 3ICCA 4Y1FA 1MGOA 1RRGA 2Q99A 1UXHA 1CUXA 3IOEA 1SBNE 3KQYA 1D7OA 3QJYA 1J1IA 1FCJA 2FQXA 1KVRA 3G6VA 1ISRA 2P4HX 4G86A 1S2DA 3SZOA 2E2HA 4PICA 3MWLA 3WQSB 1K4MA 1FPQA 4QDKA 1T9DA 3BIWA 1XMQH 2FQ1A 4HKTA 4D56A 2A9JA 5DSXA 1T5SA 3AETB 3ODGA 2UYGA 2V9CA 1VSBA 4OLBA 2VOEA 4NMMA 3RNLA 1MEEA 1CD5A 2ENUA 2BGWA 3ANNA 2W2PA 3CNNA 2GI4A 2KBEA 2PIAA 3WZ2A 1AUQA 2EP8A 4RPIA 1U7XA 3HSYA 1JF8A 3RVDA 3GQCA 4HFRA 4CQMD 3M6XA 4R05A 1RYRA 3LLCA 4ZEVA 5EIOA 1CZOA 1V43A 1E3JA 3FF4A 1UT8A 721PA 1TCBA 1YVRA 4RGYA 2NT4A 1YQQA 2BJVA 3B1VA 2PH1A 3TOXA 2JEGA 4D0RA 1TA4A 4UM9B 5EUMA 1Q74A 4PCVA 3C24A 5ETJA 3H2GA 1NNSA 4PQEA 3NHBA 2AF3C 2PV7A 4G5HA 1VAJA 4O5OA 3WLRA 1J8MF 2QGFA 4K9KA 4GI3A 3CPHA 3QA3E 1T4GA 4CQJA 4MIYA 4ONEA 3JWHA 3ZDXB 3H8WA 2J5KA 3GJTA 3ZHTA 4RIIA 4CM5A 2ZSBA 1AZSC 2Q28A 4EI9A 1JG6A 4KN5A 2ZCJA 4X24A 5BV7A 4UU8A 3EA4A 2YBEA 1YTLA 4RPHA 2FWAA 4HDKB 5TMDA 2YJ3A 4EECA 2I7CA 1MR3F 1UZAA 2PJRA 4O3NA 2YUIA 4P08A 1A2KC 1Y8RB 1XR3A 3SF8B 3D0KA 1JI3A 4BE4A 3IEKA 3MJDA 1KQGA 4UOQA 1AN9A 3T1YB 4M7RA 5JWOA 1AZWA 4RV5A 4MV1A 4MA4A 3PG5A 3AXSA 3PTLA 3WL7A 3RH0A 2KS6A 3MQFA 5LXTF 2J0EA 2J7KA 3GA5A 1W8IA 5B58C 3A7EA 3F2VA 4FFWA 2ZBUA 2D7CA 1CKOA 2JJ8A 1O58A 1NSFA 3I58A 2P1DA 1L4YA 2H1VA 2DT8A 4FFPA 1GUBA 3AV3A 4L9WA 2YNMD 3T4PA 5MFPA 5IJZA 4XH9B 4FYVA 2RGVA 1TGVA 1HDIA 3GIPA 2COGA 5KKAA 5TQ0B 5C7OO 2L19A 4Y2TA 3I76A 5TX7A 2VKQA 3DCJA 3WLHA 3K2BA 4ZO6A 2BKXA 2Q5QA 4O2AA 2FTKE 3QIAA 5JCJD 4DLAA 3OC0A 4MB2A 4M9ZA 2CQYA 2FEOA 5AI8A 4RQTA 2G1PA 2KM1A 5A5VA 2IHZA 3HKBA 3OBBA 1VCNA 2QQ0A 4HP8A 3EBOA 5CYOA 2OK7A 1PQUA 3B1WA 3FKSD 2PGAA 2QTWB 4MKRA 3MFIA 2VTBA 3T1TA 3FA2A 2B63A 4R2XA 3AINA 2I6TA 5IARA 3ROXA 2OORA 1CFZA 2COEA 3NJ8A 1ZVMA 4JNCA 4LY9A 3DLIA 4P98A 3EFOB 1FS6A 2OWOA 1QPZA 2WD9A 1B7GO 2YOHA 1JTVA 1SVKA 3KKPA 1BQ3A 1TIBA 4QQKA 1SEPA 5ERXA 3WKBA 1LLDA 3COYA 2QHXA 2HJVA 5C2JB 4RZ2A 4Z8XA 3OCYA 3TSYA 2UZ1B 1HSOA 4NYIR 4FOPA 2X86A 4C3VA 4DA9A 3KPJA 1W46A 1JR2A 1BN7A 1LQTA 4LWPA 3RU9A 1JDPA 3UWPA 3CSDA 4A5OA 1E3WA 1XF9A 3CIFA 4Q8FA 2RHDA 5AKXA 4ZOCA 4EBDA 2V7QD 2IDKA 1G6KA 5FUXA 2BEKA 1D6JA 3KSRA 3NBZC 3O84A 1KEPA 1UJ5A 2B3DA 1SOUA 2OORC 3BXOA 1BRTA 2UUCB 2H85A 3RDPA 2FP3A 5EAIA 4BMXA 3C98A 3QZ8A 4FLEA 2W4IA 4FR5A 1FNDA 3PL5A 1E6EA 3PNYA 4HVCA 3N87A 1ZHQA 3O90A 1K1EA 4MZDA 2PGLA 4X85A 1RJ9A 1YB2A 2IDJA 2XUPA 4LHZA 1DSSG 2VQSA 4ZT7A 4PC7A 1DINA 2OLSA 3SP1A 1IYEA 1CF4A 3B52X 3A1CA 3RCBA 3MCVA 3QVGB 1C0EA 3PQ6A 1QB8A 2C59A 2OEPA 4ARBA 1ZQ9A 1TF2A 4EF5A 2PS3A 1U81A 1VL5A 3QVJA 3D81A 3TPZA 3CA8A 3V32A 4H3KB 1P1JA 5F4BA 4NCNA 1J8VA 2HRZA 4Q6WA 3GRFA 4H18A 4RVUA 1HDRA 2WAQE 3LCCA 1X7YA 1JEJA 2WWTA 2R48A 5AKYA 1Z2CA 4WADA 3R7DA 4CKYA 4YI3A 5KKNB 3G1UA 3ZV6A 4O4IF 1I8TA 1QQBA 4B3SB 3GG9A 5FR1A 4JYZA 4LKRA 4BN0A 4RNNA 1PW7A 3T34A 3ZD6A 2H16A 1FRVA 2YXLA 2GPSA 1Q7EA 4Y0AA 1CUSA 1FA9A 3BPSA 4DWWA 1CDZA 5EE1A 2PN1A 5DAAA 1Y3IA 3HDQA 2ES4A 3DWFA 1Q20A 1TVMA 2XODA 2FOLA 1WZNA 4LJLA 3GGOA 1M6WA 3DXZA 3WLKX 3B12A 4YO8A 4DV5H 3EXFA 3B7GA 1DBQA 1KIFA 4Z4CA 3DL0A 4ZJZA 3F4BA 4ZARA 3FUXA 5KFHA 2QJWA 1FTNA 4X65B 3FYDA 2OXTA 2FRVA 4YAOA 5CR5A 1JV2B 1G9TA 3ET5A 4EI8A 2AOXA 4NE2A 1CG6A 1SUFA 4ZICA 4KAAA 4KIFA 4QW8A 3QVKA 1ZHHA 4CI9A 1X1SA 3GFTA 4BNDB 3M6LA 2EQAA 3EQ8A 2ECFA 1E5LA 3TY9A 4HZIA 1Z5VA 4WASA 1Z0UA 2RK4A 4TRMA 1GPAA 2O19A 3OCWA 2PE5A 2IXTA 3I0MA 4D4KA 3GDOA 4ZAXA 3F8SA 2XVXA 3A9TA 3O4FA 5KNCA 4HWKA 4U3JA 1I1LA 2JLQA 1ULZA 1XCJA 4J9OA 1NYTA 3NANA 3BSSA 5KJFA 1R9JA 5HBGA 3CUSA 4FHGA 3OECA 4JBLA 4MJ7A 1E32A 2XUIA 4LDQA 1NUPA 4IMRA 1G291 3OICA 4WN3A 1WCIA 4F5WA 4Y6SA 1YOVB 4CMFA 3EBPA 3K2IA 3ER9A 5T14A 4B3RH 4WV3A 4XFKA 2O8DA 4TKVA 3QEJA 4TYMA 5B7NA 1ANKA 3QZ7A 4OXQA 4U0KA 2O0JA 1WW8A 1CY8A 3ZDQA 3SZGA 1FFWA 2C29D 2ADOA 4I55A 5HCNA 4BB6A 5HIKA 5HUQA 5K51A 1T2CA 2YNMA 4OY3A 1J24A 1Y8ZA 1GAWA 2FJUA 5KPDA 3DAAA 4RJ2A 4D25A 1S0MA 2W0MA 1YXMA 4GMHA 5CW1A 4YMVA 4FYKA 4R81A 1CHNA 1SAYA 5I9IA 1XZEA 4G0OA 1MTZA 4K40A 4IQFA 1LPSA 2OD2A 4O83A 1AURA 3USCS 2HWYA 4EB3A 4IDNA 1LQUA 1XYVA 4LF7B 1R6UA 1JEQA 4UU1A 3VTFA 4TM7A 4N6NA 2WUGA 3IJPA 3JVUA 4FYXA 3LL4A 3V42A 1QRUA 3TMAA 2O8FB 2ZBRA 3TAHA 2CW7A 3OZAA 5CEJA 4DLUA 4I46A 1X92A 3L1JA 1IY1A 3BAFA 1XTKA 4IFTA 5KHOC 1IBSA 1H2HA 2FUNB 2XA9A 4ETSA 5F9LA 1ZGAA 1I2ZA 1X14A 3LQFA 1L7XA 4YJ3F 3PW4A 3H97A 4QUEA 3ZJVA 1J56A 3THWA 4BJ5A 3PTAA 3AEQB 2YNMC 2A1TS 1DIRA 6LDHA 2NPOA 3V80A 1BXRA 2CHQA 3ZWDA 3WOHA 3TZBA 4FEYA 1U2RA 4CCSA 1GVHA 1KO7A 3AUKA 5KQGA 2B4RO 2IYEA 3TQHA 3EE6A 4FYYA 1GHTA 2NNLD 3ICEA 1LDMA 1VL6A 4RACA 3OTIA 2OYCA 1QB7A 2ZEJA 5T6MA 3FTCA 4MQEB 3KQSA 3ZDCA 4F5EA 3CRNA 1PFVA 3BJMA 1WUIS 1PNQA 1QE0A 4HQRA 3A9CA 1YAJA 2F8MA 1DP4A 4CG3A 4EJ2A 4K86A 3WRVA 2QLJA 1XHLA 1PLKA 3FYTA 2V7QA 1PX2A 2RIRA 4YVFA 3LOQA 3LPDA 3U4IA 3EUFA 5H7XA 4IIHA 1BG6A 3MT9A 4G67A 2ERXA 2G17A 3VO1A 1BH2A 4KQWA 1N1EA 5A06A 2CWWA 3W5OA 1D7AA 3DTVB 4BZQA 1G38A 5J1TB 4B6RA 2VRCA 4F4CA 4UE6A 2G09A 3ZDRA 4NICA 5G4KA 3COPA 1NNLA 3NIBA 2XY4A 4GMFA 4L5YA 3TAUA 4XDYA 2BMFA 2FLVA 4KWCA 4JI1H 4PG4A 2E55A 1V16B 3EDRA 1CUYA 5LZ2A 3WDSA 4CCAA 1P5HA 4AY5A 1F48A 4FW8A 3TCKA 3STHA 3D6FA 3I2JA 3BF7A 3C87A 4ZVKA 4E2ZA 5FO0A 2PWAA 1YZHA 2JAXA 1P2GA 4NL4H 2R6FA 5B2EA 1JLLB 3PZRA 3Q3EA 1MDBA 1N6NA 1B8UA 2I3ZA 4E3WA 3CUUA 1AK2A 3SQOA 3KUUA 2N1BA 4RD4A 2OWDA 4UNQA 4E22A 2PEYA 5AI4A 1W581 4YV1A 3R3VA 5ICSA 5EP4A 1ZL2A 3QENA 1P17A 3T0FA 4EMTA 2HI0A 2VP2A 2Z43A 5C44G 2QSUA 4OHCA 3C7CB 4ZCPA 3L3BA 1NUTA 4ISCA 2I4RA 2YWGA 4EATA 3G2PA 1ZK1A 2A5LA 1LNZA 1C9JA 2FMUA 1ZHSA 3TDNA 2UXBB 3B1KA 1YACA 2AW3A 2PWPA 3D6HA 1T0PA 1X80A 2EDCA 4GBMA 2NUTB 3M4ZA 3UATA 2XCRB 1UIRA 5FPSA 5BV1A 2HXGA 1SPBS 1ZD3A 1A5AB 3AR3A 3SX2A 4PBSA 3ZY2A 3O9MA 5UKDA 4YDQA 4QUHA 4J49A 4RK7A 4S0ZA 4XM1A 4UBNA 4MR9A 3NUAA 1X1EA 1UWLA 3MYRA 4JYPA 2I7VA 4I6EA 4WKNA 1KQNA 1NJ5A 3U7IA 5G0UA 2YJ4A 2QZPA 3D3EA 2GMWA 4AKSA 1OYWA 4BEBA 2A7QA 3QKWA 2XADA