3VPCA

Argx from sulfolobus tokodaii complexed with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
molecule keywords Putative acetylornithine deacetylase
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpcA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpcA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpcA01
4ZI7F 4O2AF 5JH7F 3R5HA 4DLKA 2R7LA 2GPSA 4O7TA 3QFFA 4FU0A 3K3PA 2YWVA 4O7NA 2V59A 4YJ2F 3N8DA 2Z02A 1JKJB 3R9RA 1I7NA 3ORQA 1DV2A 3G8CA 1IOWA 5IYZF 4J6EA 3VA7A 5KX5F 1W93A 2GQSA 3U9TA 1VBGA 3R23A 2R7NA 4I55F 2WYOA 2PBZA 2R87A 3GLKA 1KJQA 1SCUB 3MWDA 1VKZA 5LP6F 2V5AA 2FP4B 4ZHQF 5FNVF 4M98A 3BSWA 4O81A 4MV3A 1UC9A 2XD4A 5J2UF 5CB4F 2DWCA 2W6MA 1E4EA 3K5IA 3KALA 1BXRA 2VPQA 2YRXA 2DZDA 4ZQIA 4IWXA 2I87A 3K5HA 4MV8A 4XYMB 2I80A 3RUPA 4DIMA 1KUTA 3OUZA 3TIGA 5HV6A 4O7SA 2VR1A 5LOVF 2VHEA 2R86A 4YBZB 2QK4A 1C30A 1DIKA 2PVPA 3BG5A 3LP8A 3N6RA 1GSOA 2ZDGA 3JRWA 5LXTF 4Y8VB 2R7KA 5JQWA 4MV9A 4EA8A 1KJ9A 4IZOA 4IWYA 4EA7A 3Q2OA 3JZFA 3Q1KA 4MA5A 2GQRA 1A48A 5BMVF 1CS0A 1B6RA 4EGJA 5HBRB 1GLVA 2W6PA 3NUAA 4O84A 4O4JF 1UC8A 2NUAB 2CQYA 1CQJB 1AUXA 5C1OA 1GSAA 4ZOLF 4E4TA 3VPDA 3VOTA 4O7WA 3KREA 5I47A 4HNTA 2YZGA 3AW8A 2R84A 3AX6A 4I4TF 3RV4A 4GGMX 1DV1A 1Z2OX 1GGOA 4I50F 5JQGF 4FFLA 4HR7A 4O4LF 2XCLA 2CNVA 4MAMA 4FFMA 1M0WA 1WR2A 1JDEA 3HBLA 4XZ3B 1EUCB 1JDBB 1KJIA 3UFXB 1W96A 2CNUA 1KEEA 4O7LA 4MV6A 4O82A 4TV8F 3U54A 2ZDQA 5JVDF 1Z2PX 4TV9F 3E5NA 5H80A 5KKNB 4EGQA 4XYLB 2W6ZA 2Z04A 2OLSA 2J9GA 3RFCA 2YL2A 3WO0A 2R82A 4XX0B 3BFPA 2NU9B 4C5CA 5JVLA 3SE7A 3WO1A 3MWEA 4HNVA 4MV4A 2GLTA 3VPBA 5CAEB 2NU8B 4MA0A 1KC7A 5J2TF 1M6VA 2YS6A 2ZDHA 3G8DA 1ULZA 4FGRA 5CA1F 1KJJA 2HJWA 4ME6A 2DLNA 3ETJA 4FFNA 2NU6B 4L1KA 3HB9A 1KBLA 1T36A 2GPWA 2YS7A 4EAAA 1GSHA 3KAKA 1IOVA 2YRWA 1VBHA 4RZQA 2R6FA 1OBGA 3V4SA 4O7YA 5BPFA 3GIDA 4YAKB 3BSSA 2YZMA 4O4IF 4HQ6A 1EZ1A 3LWBA 4NYEA 1PX2A 1JLLB 3HO8A 3VMMA 3OUUA 2X0SA 2QF7A 5CA0F 5LYJF 2CNQA 4O86A 1OBDA 2V58A 3JZIA 2YZNA 3V4ZA 2W70A 4O4HF 1BNCA 1EYZA 2NPOA 4O83A 3R5XA 4TUYF 1PK8A 4QSHA 1I7LA 4M9UA 1EHIA 2W6QA 3TQTA 3RV3A 4YAJB 4EABA 4FE2A 2YYAA 3U55A 1EUDB 4M99A 3BSYA 3ORRA 4O7ZA 4FFOA 2NU7B 2W6NA 4WD3A 4MV1A 2W6OA 3ETHA 3TINA 3DF7A 4YB8B 2FB9A 3TIIA 4O7RA 1C3OA 4O2BF 4C5BA 5C8YF 1CQIB 4C5AA 2FPGB 1A9XA 4YJ3F 3U9SA 5DMXA 3JRXA 2HGSA 2CZGA 4M9CA 3R5FA 1AUVA 2FPPB 4EG0A 2VQDA 2YZLA 1M0TA 3VPCA 2R85A 4EA9A 2YW2A 4MV7A 4FFRA 4IHJF 2R7MA 5EZYF 3TW6A 3I12A 2SCUB 1Z2NX 2C00A 2DIKA 5BPHA 5C1PA 3WNZA 5D8DA 3KAJA 2PN1A 1CE8A 5K2MA 2I8CA 4WBNF 1E4EB 2FPIB 1B6SA 2IP4A 3MJFA 5GONF 4O7VA 5LA6F 2W71A 4HNUA 1KJ8A 4FFPA 4IIJF 2P0AA
chains in the Genus database with same CATH superfamily
3AESB 2RGNA 3CZ5A 3FR7A 1XD8A 5HJ2A 4MW0A 2C5SA 3GGDA 3Q3EA 1C2YA 2I71A 2I99A 1H94A 1NBHA 3BKWA 3EPRA 1KI8A 1XVLA 1IEVA 1NN3A 1Q3KA 1RWQA 2MIIA 2PMBA 3RAQA 4J7UA 4JLDA 5A6SA 4ZXFA 1NVUQ 1ZHFA 4G0YA 2ZJYA 3VGPA 2PU5A 4A2WA 1L4YA 4RK7A 4YP3A 1DMSA 2XUGA 3JYLA 3UXMA 1M1XB 2QLBA 2X13A 4JR0A 4S0XA 2P40A 4PZZA 5JBIA 4EYIB 2PO5A 4K9LA 1ZUHA 5ULLA 1KK3A 4HLNA 1KYZA 1ZPDA 1DL5A 1DFGA 2QE7A 2BEWB 1UZLA 1L9KA 2IU3A 3KIPA 3OVMA 1YB2A 4TSFA 3ESCA 4PNHA 5CIWA 2GM4A 4OHYA 3NGMA 4N3BA 1JJBA 1XGKA 1Y1QA 3FTPA 5BV0A 4PLTA 3K1YA 3N05A 4XPIA 4LF9B 2EG9A 5D1HA 1SZPA 1UDCA 3Q0IA 4FYPA 4JI1B 3FKIA 5L1LA 1G7SA 5IT4A 3N2YA 2YINC 5ABPA 3T5HA 3VYVA 4B3BA 3NATA 3ZOKA 4W9NA 1Q0ZA 4D5EA 3GMSA 2HVSA 5JWRA 2GA9A 4L3OA 4BX3A 3NOOA 4O0LA 1QGUB 4L8WB 3HUTA 1SXJA 4TXJA 1JDVA 4WY8A 5HGXA 4CC5A 3MQ2A 5JHGB 1Z6GA 2AOXA 4EHAA 1IK4A 1I1LA 4J9OA 1Q0SA 4ECYA 4DV0H 1SVOA 3DJFA 3TIVA 1EWVA 5CVTA 2YY5A 3HJNA 4P98A 4BVEA 3C43A 3D8RA 5KFFA 1ODFA 1QJCA 2IXTA 2UZ0A 4JHXA 2Z83A 1ANKA 2Q1TA 1URPA 3O8BA 2NU6A 1NJ5A 1WDMA 4MIOA 1UJ6A 1YH3A 4MRMA 1SKYB 3D8TA 4FOOA 5EGNA 1PG5A 2OZLB 4AKEA 4AMVA 1TEHA 3O6VA 4KPYA 1JA0A 4N1AA 4AJPA 4GNKA 1PGJA 4U7WA 3QEMA 3VSEA 2C7VA 2ZCUA 1MB2A 4N49A 1IBKB 5A2QW 3KOOA 4OP3A 1MRSA 1GV1A 3DONA 4M21A 2G9NA 1XT6A 3B9RA 1FW8A 3WNCA 5KFVA 3I8OA 1Z0IA 2HGZA 3CN9A 1K63A 2IYWA 3DR3A 3W9UA 4DJDC 2NACA 1CNEA 2A4MA 5CB4F 1IUPA 2FUNB 4E13A 3DFZA 4I4NA 4FYIA 1K5DA 5TPZA 4CV3A 3AGPA 2VTBA 4CCAA 2B20A 4D0LB 5CIYA 1LPBB 1Z35A 2HO4A 4QA9A 2Q5IA 1XYGA 5CDFA 3PPWA 5TGDA 4YVFA 3BXXA 2ZZKA 2DR3A 2BL4A 4DKXA 4B84A 4XEHA 2UYYA 4LYYA 1Y9AA 3KVVA 3L8YA 5HKAA 3EFOB 1Z18A 2DWPA 3BIFA 2HLDD 1NVWQ 4A8JA 1I30A 5AP9A 4V3BA 2MTBA 3I6QA 2GRAA 2EGGA 2EYUA 1Y3IA 2X3UA 5HV6A 3THOA 4PZAA 3KU4A 5CAEA 5A9TA 5K0GA 3BJRA 2FE1A 3HM2A 3S40A 1PE0A 4B71A 1UXHA 1QGOA 4OUDB 5JASA 1KRWA 2WIKA 2CNNA 4MIKA 3RYTC 2WVAA 3PYLA 1MB9A 3UJ7A 4EEYA 2QK4A 2BW0A 1P2FA 2Q2WA 2PVPA 2PRYA 2VT2A 4GU5A 1SXGA 1Z63A 1PR0A 2REXB 1X8XA 2FZVA 4DR4B 1ELOA 1SKMA 1HDCA 4TVIA 1GQOA 4NH4A 3PU6A 2HWKA 1NE7A 4PW0A 1VQ1A 3N5CA 1BC5A 4ZDJA 4HT3B 1OFGA 1Y0BA 3COWA 3GC6A 2OEPA 1Y1SA 3DWIA 1VGVA 2I7TA 3MR6A 2RBEA 2ZBVA 4CCSA 2ZKLA 1XNHA 3IJRA 1LEHA 1C1YA 4KCGA 1NLYA 2IS4A 1CZRA 1QGUA 4EHNA 1IRXA 5AW9A 1N3IA 2H3HA 4UVEA 1DOAA 2PGIA 4O4JA 4JHLA 3VH4A 4CQNA 3UOGA 3Q1KA 1U0NA 1ZUWA 2A0UA 2FAXA 1XEWY 3CBQA 1IATA 2AEFA 4LY3A 4YQZA 1KEEB 2CDCA 3EGDA 4ENWA 1TIBA 2TMYA 4MDEA 2CNOA 1ODJA 3C74A 1D3AA 3MLEA 4HTFB 5H83A 5IK2A 2A9VA 3SHOA 2IYTA 2M6LA 5IJ0A 3HBNA 1M2EA 1ZIDA 3ESYA 4QIHA 1R7RA 3WLSA 4EZBA 4JIGA 2EARA 2J5RA 4FJ2A 3WLPA 1DX6A 1JJ7A 3CVWA 4R3UC 2FPIA 1SCAA 1UP7A 2NXEA 2PX0A 1PBNA 2GAOA 3DDWA 4W9NC 3RF2A 3P2MA 2SECE 3PQ4A 4ARAA 2OCBA 4EW2A 5AVVA 4UFZA 4N0DA 1JDSA 2OBNA 4OA5A 4EUKA 4F1KA 1XDUA 3HE3A 1NATA 5TJHA 3HLYA 1UPFA 1U1EA 1P39A 1FZTA 4EPVA 5C5EA 2G5PA 4EL5A 2QTRA 3ZY6A 4FYVA 3NVKI 3PPIA 5BOSA 1YL7A 2EDCA 4DCMA 2XXAB 4A2BA 2DH5A 3ANSA 3C3PA 4P4SA 2ZEJA 3GAMA 4H18A 1VA5A 1DBIA 2NV6A 2QRJA 4Y6RA 3UHJA 4BNKA 3O3NB 4E5SA 5JOQA 2VHVA 3OM1A 3RVPA 2EWVA 1CUXA 1GTJ1 4KFUA 1KFEB 1L8OA 4X7PA 3TX6A 5HOQA 5JZOA 2I2DA 4HX5A 2YQ5A 4ARZA 4IOJA 1PEAA 3IE1A 1UINA 4OQFA 3M5CA 3GCWA 5DW3A 2HLNA 3FFAA 3GTGA 4RB2C 2HCRA 3GL9A 3BWBA 3C1UA 4ZO4A 2CNVA 3PK0A 3CO0S 2CVPA 5DNDA 1A9SA 2Q3FA 3EVDA 2VK1A 3OPQA 2PPLA 2JAQA 2JRLA 2OO5C 2RGBA 3HJTA 2AR7A 3GEDA 4IHQA 4OGKA 5E9QA 1ZRMA 8AT1A 1I13A 5FV4A 4RTJA 3AVOA 5DHUA 3UGKA 3B2EA 3I0ZA 5JRJA 4U4AA 2ZUCA 4WLOA 1GPMA 2YQZA 4PX5A 2DPJA 1KZYC 3WS7A 2ERCA 1A77A 2VDWA 3HA5A 1SURA 5IWCA 1MVLA 2YUIA 3IE2A 3KQQA 4BQEA 4BGEA 2HJVA 3KLOA 1MX5A 3HJUA 3LQFA 4K8RB 3RK4A 3KJXA 4PZ6A 1M3SA 2JDID 4X7BA 4F04A 5C18A 4HH1A 4M7OA 2I91A 2O07A 2PQMA 1QU2A 3WWIA 3B52X 4N5DA 4JJZA 3Q5DA 2PNFA 4LK3A 2P35A 3UOWA 1KMQA 4IRXA 3BGDA 4BNDA 3JR3A 3L9XA 2HIVA 3CINA 5CDGA 3GJYA 3QNWA 3H0EA 3BQ2A 2H65A 3HVHA 4NCNA 3PRKE 4ARUA 1EE2A 4MB0A 3OI7A 5ALZA 1ARZA 1PJAA 4CM4A 5I3CA 3HJHA 4K9DA 1XB2A 3JQ7A 4RIGA 2WJVA 5HWSA 2XLCA 4QPPA 3EW9A 5DTRA 4EQ6B 1LNZA 3H9CA 4J29A 4OUDA 4LYHA 4WN9A 3T4EA 5FFMA 1JHVA 5KFOA 3ND6A 2XY4A 3RRNA 5IYBG 4V1CB 1NXWA 1XRNA 1ZMXA 3D3WA 3PDJA 1MFPA 4C3ZA 2LD4A 3S70A 4EEXA 8GPBA 1P3DA 1RWVA 5C8YA 4TWIA 1KY2A 5CFPA 2CXQA 2HA6A 3FVRA 5EZYA 1NSYA 1RBMA 3I8XA 4FDMA 4PM4A 2SNIE 5HIKA 1SXQA 4RUCA 4X84A 5EE0A 4NVRA 2BTQA 4XIIA 5TJ9A 2FRXA 2HSEA 2VPSA 3FYDA 3NT5A 3COZA 3EZ9A 5LYJA 3Q8WA 1U2DA 4RNOA 1VE7A 3F5MA 3WIDA 1N9GB 2Q4BA 2IS6A 1IOLA 2ZJOA 2XDWA 3A1UA 4CLDA 2NU9B 4MRVA 2PWAA 1P33A 4JDPA 1I2LA 4GSLA 4E2YA 2C7RA 1E3WB 1OHHA 3X1WA 2HPAA 3EAQA 3F9IA 3AF3A 4HNVA 2SKDA 1SQ6A 2BCJQ 3TLYA 3S29A 4EMTA 3K8YA 2OFPA 4MRPA 3NWBA 4TM7A 2C2OA 4NBWA 3TNDA 3EH1A 1DZIA 4A0SA 1YBFA 2YIMA 3LBIA 4L0MA 3NHYA 3ZXXA 1ULUA 2QNRA 3T8YA 1IZYA 3T0IA 1CE8B 1G2IA 4AF6A 4AMZA 3AONB 2Q0QA 3ITEA 5AKIA 1W5SA 3RJZA 4B73A 3GARA 4KHZA 3WLOA 4IDNA 1RMYA 3HJRA 3RSCA 3GT7A 1ULZA 4FGRA 2PQ6A 5JDCC 3FUVA 1CP3A 3OD1A 5FFNA 3RU9A 5JFGA 3THWB 1SCUA 2XTNA 3PNKA 1SXJB 5DGAA 4ME6A 2SHKA 4KXFB 3WK9A 1ZGAA 5L40A 5DNUA 2PUVA 5CEFA 3RDPA 1R27A 1RDFA 4NOKA 5EKSA 2YMQA 2QR3A 1ZHSA 1YKSA 1LVGA 4B4DA 1S10A 1AHNA 2DQ4A 3NV7A 3D3JA 3KUCA 2XSZD 5L45A 3KAKA 3GQBA 1DIHA 2VSFA 2P0EA 2XWPA 4KMRA 4UAUA 4XAQA 4YV0A 4UNPA 3ZHZA 4P2BA 1BXKA 2OZLA 2ZRDA 3EUFA 1TU3A 3ONEA 4BNVA 4EFKA 2EC5A 4TVSA 3E6AA 3VR2D 3Q5GA 1Y5NA 3KPJA 3T5DA 5E1MA 2BKEA 4Z3DA 4M46A 5A7HA 4ZKEA 4EQZA 4LHSA 1G5TA 3ONFA 3K71B 1QVAA 4L5IA 4KSCA 3N0WA 1QO9A 5KUTA 4OBWA 4PWYA 3LL7A 4QXAA 5KFDA 3G0BA 3PXDA 1ZL2A 4KXQA 4Q1FA 3TY9A 3R6LA 4RZ2A 3BSSA 1ZINA 4MR7B 2ST1A 5GIOE 1M2JA 4AKSA 3SS8A 2JEGA 4PG8A 2NXCA 3LYLA 1EE1A 3CF0A 1U80A 2ZB2A 2F64A 2DQSA 3B89A 3B7WA 1JQKA 3NJ8A 4II2A 3G88A 2P2GA 3KSUA 1LLFA 1KI9A 3NNDA 1Y3DE 1FOEB 5KFUA 3A10A 4GE3A 4NBKA 1YXMA 4DM7A 3ZK7A 4EY6A 1WETA 3CO5A 1N6LA 1Z4JA 3LP5A 3MINB 1K1SA 2NG1A 4LJ5A 4XX0A 2BTQB 4JB8A 2I76A 5I8PA 3LO8A 1QGZA 3D5EA 3DQZA 2BKXA 4G5OA 5EIBC 5K4AA 3UBMA 3T7CA 4LE2A 4GLXA 1SCNE 1L7DA 2WZQA 5DOZA 3S0JA 4R9RA 3ZEIA 1D8TA 1QVZA 1YR2A 2VTVA 2ZIXA 1V7QA 3FZEA 2IH5A 2YZNA 4WXEA 1HORA 3AV3A 4NG4A 2QN1A 1BDHA 5DT2A 2PT6A 5JV5A 4YDHB 4WN9B 4QW9A 1O9BA 1H2RS 3I58A 4RPCA 1TWGA 2X4DA 1XNGA 4GL2A 3T5JA 1HI9A 1Y42X 4IDEA 4BMOB 2VP9A 1I3CA 4EO9A 5A3JA 2UUBB 2Q3HA 2Z95A 1ZR4A 3CLRD 4NDNE 3WWZA 2J4DA 3GDOA 3LWNA 5JAMA 1MG5A 1WMFA 2WABA 1EHIA 4G5FA 3AJ9A 3SQWA 5ALTA 3O8NA 3W8NA 1H1TA 2W6QA 4OXRA 4CIVA 1M7BA 4O2BB 1KETA 4EABA 4AP6A 5BSGA 3PLAE 4FE2A 3F1KA 5AWFC 5FI5A 3R24A 3ZIDA 3JAWB 1SG0A 3PQ6A 4OHPA 5I5WA 1PFKA 1ZI9A 2WG1A 1JQDA 3AP2A 3EIUA 1YBVA 2BELA 2DPIA 2W6JA 2ZBEA 4JOSA 4MKFA 1JNYA 2CHFA 3D6TB 2BZSA 4OJYA 1F2DA 2QTTA 4GX1A 2AF3C 2QL5A 1RT9A 5HTOA 2DWUA 4TL6A 3EGWA 4GH5A 1JP7A 2IRWA 4D6PA 1EVJA 3HZZA 3EC1A 2C7PA 3A6ZA 2AS0A 4KH0A 4O1HA 3CNEA 3PL5A 3A7DA 5FFFA 1L5HB 4MZDA 4OCZA 4RJ2A 1ZSVA 2F3SA 1Z0AA 4R84A 2IC5A 5JNWA 3ZLUA 3D2AA 2XUZA 1Z74A 3GFFA 1NOJA 4X0EA 4P53A 2XYRA 3WGKA 3AIOA 1TOAA 3EZ7A 5F2NA 5IWAB 1ZAUA 4PSVA 1S2GA 2QE7D 3I1FA 4JR2A 2JA1A 2ZJ3A 3G5MA 5CIQA 3TDKA 5B58C 3CX7A 5BR7A 1YVPA 5B53A 2QLJA 1DJNA 3G1TA 1GV0A 4GYJA 1XMJA 1PTKA 4S3MA 4RLFA 4Y3UA 3V4PB 2Q1UA 1ZONA 2ZR0A 3W78A 2JNWA 1L7NA 2DPGA 4GNRA 3T5MA 4Q45A 4ZVMA 5JFTA 3RR5A 4YMTA 2KI5A 3R2JA 2ZOSA 1R0LA 2UUBH 1J21A 1GYRA 1W8IA 2QRVB 5WRFA 2DUJA 3I0NA 3OFJA 1CSEE 5BQXA 4K86A 4IF4A 2A2ZA 2R85A 3SC2B 3O5AA 4A9AA 4CM7A 1KYQA 1MC4A 4A8JC 3GELA 1O5OA 3H1TA 3PJDA 4V02A 5ITVA 4MQFB 4Z9FA 3EVBA 5GZ1A 2HRZA 2AEJA 1AGRA 1MIOB 3ODGA 1BMDA 1KVTA 5EXDA 3QMMA 4BCBA 2ZUWA 3NBKA 3HK2A 3QFCA 4G07A 3CVYA 3FUUA 3RJTA 3T5BA 1J5EB 2N1BA 3FXAA 1CY1A 4I1YA 4KO4S 2R93G 5T57A 4LSMA 1ONNA 1NA5A 3JX9A 3W34A 1E6CA 1L7RA 1TE2A 3EDYA 2XE8A 4XB1A 1NXSA 4WBNF 1XZCA 5BVGA 4RTNA 5K3SA 5K3CA 2IP4A 5IVPA 2O50A 3RYCA 2RF4A 2OV2A 2F1HA 2RK4A 4DJFC 3R3WA 5AKKA 1AMNA 3WKBA 4TX1A 2ZIGA 2POQX 3DQQA 2FSSA 3PQ2A 2EZ4A 3QVOA 3ECCA 3RFXA 2CBGA 1L3CA 3LT4A 1ND6A 4DAEA 5IAOA 2JLZA 4OHWA 1Q1ZA 1N5DA 2WU3A 1GAQA 1QP0A 2EJ2A 4ED6A 2V98A 2VKQA 4Q3DA 4ZI7F 1T29A 3ZDBA 1PUIA 3H97A 4ZRMA 3NJ4A 1U2ZA 2IYEA 3HMQA 3N86A 5KWVA 5MN4A 3V7UA 4UDYX 2GF9A 3AVWA 3JWJA 5FIUA 3KK0A 2XMQA 3O84A 3IUMA 3REOA 4C2AA 4BIIA 3AFNA 3DXFA 2NAPA 5TQVA 3ZD9A 4QVIA 3SZUA 4LJSA 1R0ZA 4OXNA 3IAAA 2CHQA 1A8HA 3X0DA 1VKRA 3GYBA 4O33A 4UEWA 3TO5A 1E3QA 2XGPA 1V0JA 4HNHA 3UJ6A 3PC8C 3DLTA 3NHRA 3SXUA 4RA9A 4Q1BA 3E9YA 2P9BA 1N6RA 3GLTA 5CX1A 1YZQA 5DM2A 3CKLA 4UKDA 1XJCA 2VAPA 1VSBA 3QKSA 3VMFA 3PTAA 3LFHA 3SSMA 5BW4A 4X00A 4D3DA 3T5AA 3LC2O 4DLUA 3ECSA 3OSUA 1LPSA 1YV9A 1IL0A 2Y0SA 4C4TA 4KMOA 2IOYA 5IXYA 4LSXA 2XT6A 5DN6A 5IFLA 1T10A 3AI1A 3B38A 1LSJA 4JEMA 5D5PA 2P7HA 3VNUA 3RAPR 1IOWA 4B35A 3QLJA 4Q7JB 1U4SA 4J4BA 3WV4A 3ZJ4A 1JIUA 2J6BA 3P20A 4YYEA 3LGXA 1IB0A 3D54D 3KQLA 3VO2A 4DARA 3GAFA 3CRW1 3WGMA 4D0NA 3L5KA 3LUHA 5KHOC 2I62A 4M9XA 2NZWA 1Z4KA 2OM6A 2ZVDA 5JSQA 4NICA 4KQ6A 4LCJA 4UBOA 3FWHA 4BO1A 2VFAA 3QVKA 3S8YA 2BQUA 2QVBA 1KJQA 5KFCA 2DPHA 2IW1A 2IVFA 3IJEB 2R8OA 4O2RA 2OO5A 4Y7CA 4DRXB 2WOOA 4FE3A 4O5AA 5T14A 2V5AA 3RC3A 2RDJA 1RYEA 3FTCA 4IQGA 4PTLA 2HLDA 3RASA 3FSGD 3OIWA 1NUHA 3ABSB 1AB5A 3G59A 2EYQA 3MC1A 3AM3A 4KVZA 3HXKA 4IHKA 3EXEA 4AY3A 3LX8A 5JZVA 4J0EA 2WTUA 3GZNA 2FLVA 3ZCRA 2QTZA 2FUCA 5JC8A 2V6BA 4LRUA 1QE3A 4OFXA 4WDQA 5FLEX 5KTNA 2FI1A 3A6JA 3QYJA 3FPHA 3BL5A 3LJKA 1V8FA 1L5QA 5EDWA 2AT1A 1BRTA 4IWXA 2OA0A 5FOVA 4AMBA 1XL1A 3HCPA 1NI4A 1L4NA 1MEOA 2JLQA 3FNQA 2C94A 2BLNA 5FI1B 1K8QA 3LU1A 4H1VA 4E1VA 2IV3A 4I4TA 1VCIA 1HXHA 3PUVA 2HC9A 3H9EO 2Z3ZA 3O7WA 3DZCA 2FUEA 4XYBA 4EKDA 4BXOA 5ARDA 4C7OA 3LBFA 1J39A 2GK3A 1V37A 3R4CA 1NJ6A 2F6RA 1YS9A 4QEZA 4N5HX 3SDSA 2HIHA 1Y6FA 3BF7A 2ZSKA 3GQBB 4GMGA 4MYDA 4RX1A 2W7TA 3L8EA 4IG4A 1U0LA 3I34X 4A3CG 4LDRA 3ZIAA 1E32A 1SUWA 1J5EH 1BRMA 3S8MA 1J2TA 3EASA 3PYXA 1QRSA 1L5RA 3AUAA 3AKCA 3DMDA 4JXJA 5ALDA 2AR0A 1F9EA 4IIXA 3RGWS 4U2DA 3GR6A 2DFVA 4IVPA 2XXAA 2JAHA 1EFPA 2PRIA 2Y66A 2QROA 3A2LA 3G9QA 5C80A 1RJRA 2PT5A 3QOFA 1HFWA 2UYQA 1R4AA 2O7SA 3OWHA 2FA9A 3PRHA 2FLKA 2J5QA 3P2JA 3E8XA 4O4IB 4RCZA 4Y1EA 2ZB7A 1LW6E 3UUEA 4KGVA 5CYGA 2R48A 1CUWA 2H1LA 3G82C 3WTBA 3GVPA 5FD5A 2IMWP 3DT8A 5G3ZA 2CZQA 4ACAA 5IRCD 4P9NA 4B3HA 2XYQA 4K9OA 2P91A 1CETA 4WNAA 3WFJA 5F7ZA 1H0KA 2VHXA 3ND8A 4RVOA 1A8UA 4E5VA 3MUNA 2HV9A 1A8QA 5AKHA 2EQBA 4O25A 3W6NA 4KC0A 3EIHA 4N5LA 1U2PA 1OE0A 4EFNA 4YV1A 2JD2A 5B1HA 2FJZA 1H2YA 3G2OA 2OFFA 5TV2A 2CUTA 4CEJB 2XCSB 3WDSA 4Q0MA 3D1JA 3U17A 1EUYA 4BO6A 3GIWA 3P45A 2JW5A 1DWQA 1SZDA 1XZLA 1JN0A 3N8IA 4H9GA 1OXSC 2I2XB 4HP8A 4R01A 4C7VA 4RS3A 1H2XA 2EFDB 3FPBA 5HHTA 3IVMA 3TY8A 4H0FA 5KVAA 1NU6A 3GVHA 3ZUPA 4DS3A 2ASDA 1R4NA 1WPXA 1MF7A 2NWQA 4RFSA 1P2VA 4B3CA 5AVWA 2CF6A 2R79A 3TI9A 2J85A 3CKYA 1T0BA 3VU0A 2F3QA 2B3DA 5CBKA 2YYSA 3K2IA 4DXDA 3PFCA 2DPMA 1IXZA 4X61A 2BUCA 1P1CA 2H7YA 2O4UX 2OECA 5TMPA 3WLMA 4UXIA 3NTXA 3DTNA 4D98A 4CIAA 3HBFA 3TPFA 3OSNA 2XOKD 4B1FA 2PKCA 5AQ1A 2YJNA 3C3BA 4Y6SA 3SX2A 1MZPA 1ECCA 1C1DB 1KI6A 1ZXLA 3AX6A 1U98A 3U0GA 1YDWA 3LYUA 4PXAA 5EMMA 1TCVA 5F64A 1B8PA 7ABPA 2XHEA 4DV4B 3LK6A 4EGFA 4AZTA 3OX3A 5I7WA 2QRGA 4LXUA 3E4CA 1I4DD 1SHUX 1A7JA 2CDAA 2WA2A 2X14A 2YMPA 1YWGO 3TBHA 3U48A 1EFDN 3ZKWA 3EDRA 4CKEA 3E53A 4JVOA 1E4YA 3VGJA 5IZ4A 3KQVA 3SPXA 4MQ5A 1RYHA 2PSSA 1IFXA 3TZHA 2F3UA 3X1YA 4I99A 5AI8A 1G8GA 2RAVA 1B41A 3KZ1E 4YAWA 3RTDA 4KO2S 3HKDA 1QXSA 4NE2A 4WOBA 5AJWA 5FYDA 4E22A 1POXA 5A5DA 5H8WA 4GSYA 4H59A 2OLJA 4V0QA 4OY3A 1I4OA 1J97A 2BI8A 2V6MA 3KWJA 1ZN8A 4DV1B 4U3JB 1TADA 1KJIA 2Q1XA 5DP1A 3WKEA 1L1EA 2C7QA 4OSPA 4BPBA 2MOKA 1K08A 3FTFA 2AGQA 4QU5A 1RI5A 3SJUA 3BB3A 1DFIA 3KLBA 4FEAA 5DQHA 1W96A 2P6RA 1W46A 5LQAA 2OYRA 3C6KA 5IP7G 1W5EA 2H0AA 1TAHA 2NVUB 4HLQB 4NY1A 4L07A 1QHEA 3SEFA 1P4JA 5T64A 1GTVA 3L93A 3ZGVA 1E3IA 2H2FA 1GGKA 4F6RA 5DHPA 2RH5A 4Z51A 3DVAB 1HL7A 3QU2A 4B3XA 1JEAA 1RRPA 3C15C 4QDXA 4RK4A 4KTTE 2FK8A 2M1ZA 5IJ9A 1SXJE 3AP3A 5KAPA 3J80W 1F8FA 2Z4RA 4HWRA 4RZ3A 1GDDA 1UKBA 5A0FA 4GUDA 3VPSA 1IPHA 1TWAA 1EFPB 1T9GS 5FD6A 1TMOA 5LUBA 1FY2A 3LHFA 3KCNA 4PF1A 1H2AS 3O9MA 4ED8A 3GJ7A 4RKRA 5ED0A 1R18A 2VH1A 4DBVO 4FFBB 3QFHA 1LRKA 1YQUA 1JMYA 2OUIA 2RIRA 1JBEA 2D0OB 3A3OA 4LF4B 3T9CA 3WO0A 2W9CA 3EPPA 1KR2A 4BASA 1SA0B 1KIAA 2FPWA 4FGUA 4FE7A 1IUNA 4FNAA 2FQQA 4FYYA 2JCXA 4G1VA 1QFJA 2R82A 4GC7A 2GKOA 4WFKA 4KOAA 3OQ1A 4E1BA 3HZHA 2QD3A 2CVHA 1U6JA 3GJZA 2CE7A 4C20A 3RUCA 3M1AA 1ESDA 2VN8A 1XK6A 5KEIA 1KZGB 3QW2A 5DLPA 1GCOA 2WBLC 4GYWA 1JHPA 3O4IA 3ZWQA 1H42A 4MVJF 1L5OA 3MUOA 2VUMA 4ZU6X 1I3KA 4MW1A 1V51A 2RE8A 3IB3A 1B74A 3MWEA 2CMHA 2MR6A 2B63G 3EFBA 3OBBA 3OF3A 2B9VA 3LT5A 1IY8A 4RAYA 1VI6A 1N5LA 1Y8QA 3I04A 4PG5A 5MFPA 3K0SA 3HO1A 1JILA 4DLSA 1XN1A 3IQIX 1L1QA 2WVHA 4KKVA 4TMWA 3F90A 1TKCA 2NU8B 1OZ0A 1XTPA 2ZSHA 4FNOA 2FU5C 3O8DA 2RGVA 3H7IA 4TS3A 4QBGB 1XA0A 3L5OA 1LJ8A 4MYHA 4EKEA 3QJGA 3JQPA 1JEQA 4ER3A 1G41A 1HV8A 3G8DA 5KTOA 2GMWA 4EO7A 2JFWA 2TRSB 5E4FA 1QRDA 3R7BA 4BLPA 3RAGA 1NUTA 1HA3A 1CUFA 3IQXA 4CMGA 2ET6A 4Y9TA 3WYCA 3F47A 3L7BA 2JZOA 4JZYA 3KQMA 3TPZA 4IPTA 3C4VA 1C7EA 4PVDA 3ZWKA 3DL0A 3OWOA 1G59A 2Y92A 4KXUA 5A4MS 4N01A 3IEMA 1U63A 1HPLA 1N0HA 2ZWPA 2GPWA 3NKLA 3UT6A 1DHTA 4JL8A 1IUOA 4Z4EA 3VO1A 5BNFA 4BNGA 2QRMA 1IQRA 2W2MA 1JPNA 2WKSA 5FUBA 5HIMA 1Q84A 1QRUA 1OFHA 3M4XA 3N3AC 4YXWD 2YRWA 1XDWA 2VK8A 3HYTA 4RZQA 4IJ6A 4NYJQ 1G7RA 2DUWA 3EXFA 3K2EA 4B6QA 5JD6A 2R8HA 3OESA 4HWGA 5AHOA 4P7GA 2FHPA 1V1MB 1R0KA 2HSGA 5IUNC 2E21A 2R751 1A69A 2BZ1A 4QOEA 4BEBA 5EY5B 3F7MA 1AB6A 1SEVA 5KFGA 3EFOA 3UGTA 4D4HA 5SY6A 1N0WA 3IMEA 4ALJA 1E8NA 5E4YA 3ZBTA 3DDOA 3FNIA 4JKYA 3ZX4A 4KJZA 1R6UA 4OM7A 5KNCA 5FUYA 4LZNA 3MYYA 3TQRA 1DXHA 2HQRA 3Q72A 2FSGA 4AN0A 2GXAA 3CX8A 2O6HA 3KQPA 1WMAA 1ZIOA 3DD1A 3T5KA 1MPXA 1C2TA 5F9NA 1T2VA 2VCEA 1WLYA 1XPJA 2VHJA 2W2KB 1F51E 1YRYE 3BIOA 4CL2A 4HPJB 1JQ5A 2QI9F 2RGEA 3C5WP 2J3JA 3EK2A 1QP4A 1U99A 1SC9A 5TMDA 2CXOA 4Q4HB 4W5JA 3OUUA 2GJ8A 4IFIA 4TMFA 2O7NA 3EXHB 1XZQA 2EFCB 5AW6A 2E2IA 1NWCA 2P6OA 3W8FA 4OX9Y 2PTGA 5CXQA 5AVTA 4WX2B 1K97A 1W5FA 1O94C 1E2NA 2HA7A 1ECLA 2O0KA 2ZAIA 3K0AB 3LVQE 4QREA 1FYEA 1W73A 4EMBA 1BE6A 2HY7A 3DAGA 3R7AA 1P2SA 1N25A 4EGAA 4TZTA 1G66A 3ASVA 4E2ZA 1X9NA 3ADCA 4IRCA 2IW3A 4IKPA 3JCZA 1WH2A 2XGMA 3HOZG 2J5KA 1W48A 1I6KA 3B1JA 5ESRA 2GESA 2G06A 4ARCA 1EGAA 3PNLA 3A6LA 5CG2A 1NP3A 5KWEA 1TVKB 1S7GA 1EE9A 2X0NA 2Z3VA 5BWWA 3AG6A 3N07A 1NQWA 2OLKA 2FN7A 3EUAA 3KKKA 4MO9A 1FJ2A 5CVJA 3L6CA 4CKXA 3HOWG 1CUAA 2XCQA 3DZKA 3USES 3R0JA 4ZXPA 4X7RA 3RKUA 3TQCA 4DAAA 4N8SA 2CSXA 1G3RA 3SSAA 2XKKA 2B0CA 3DPSA 1Y1PA 3H8WA 5BRJA 4JI8B 2XQFA 5I7VA 1JPJA 1IY1A 1D2EA 4DL4A 2OWDA 2Q29A 2WM9B 3PDWA 4FWBA 5T8KA 2YXDA 3I01M 3BMXA 2FPUA 1NXTA 2DBYA 4UMFA 5HNKA 1TZCA 3H9GA 4PVCA 1U6IA 2C4TA 4MQFA 1GPJA 2PANA 3DTVA 4BFUA 1T0PA 3GXBA 2VYND 4PZ7A 3AETA 3DZ8A 1OB2A 2BSAA 2XAUA 4YB8B 4IEIA 4E11A 1Y7HA 3G6YA 2AG5A 2GZ3A 3FG9A 3O3OB 3QFSA 1WW2A 4Y2JA 1ESEA 4CYMA 3K6KA 5JC1A 2C03A 1CUYA 3PC7A 3Q85A 2BFBA 2FFQA 2W9AA 3I5UA 3MMPA 2WY2D 5CYPA 3RD5A 1VIDA 2WHPA 3ZBUA 4E03A 4ABTA 4F93B 2QTHA 3M5DA 2NO9A 2NTYC 4YJ3F 4LTDA 3BXOA 4LV8B 2CLFB 1XN4A 2PMKA 3E2MA 3PUZA 2WTEA 1F20A 1TKRA 2Q45A 3RS0A 3GP8A 2OYCA 4AJHA 1V4YA 3DE1X 3L7DA 1C9EA 6REQB 4RCYA 4WXYB 3KAPA 4OO3A 2B5OA 2AEMA 2OHJA 2GO1A 3G2QA 2QENA 3K8ZA 4G0MA 5FTNA 3AFIA 3B3FA 4AYWA 3CLUD 4ZJZA 3BWEA 1G0NA 1IN7A 3BA1A 1PT5A 1SVLA 4LK2A 3AJEA 4PGHA 3W2TA 5BY2A 3U44B 1I1KA 1PKXA 5CA1B 5H7XA 3M4NA 4XYEA 2AFIE 1NF3A 5LZ9A 3B3JA 2NW6A 4HX9A 3RWMB 3C6ZA 2E89A 2ID7A 3UQYS 1A98A 3AZPA 3L7NA 2C2ZA 3AU9A 3C8DA 1TM4E 1U90A 5AK0A 4RAQA 2HW8A 1Q7RA 5EZYF 2IQ5A 3BHNA 4LH6A 3TW6A 2NYUA 1W6UA 5EJIA 3M1YA 3UAXA 4EJ0A 1UOPA 3I12A 4IL5A 4M1TA 4MUAA 1YAJA 1KYXA 2JIQA 4JJKA 1OGJA 4U39A 5DTEA 4AB1A 3CKMA 2QPLA 3K0BA 3NAGA 2W7OA 4MCHA 1Q22A 4Q3CA 5COBA 5JPCA 3A36A 1WHTB 1GGEA 1LLUA 2PN1A 3SMQA 3ZE0B 5BW5A 1KZ1A 2B82A 1W47A 2Q3BA 3IHWA 3KDPA 4OL0A 5ALMA 4UQLA 4IAJA 2ZAYA 5DLDA 3CF2A 1L5MA 2YOHA 1YK1A 3H5VA 4XASA 3BHIA 4AP5A 1NONA 1PQWA 2HQOA 2JATA 3OE7D 2BGRA 3UJNA 3AUTA 4CF4A 1YIDA 4W7HA 3IQHX 1EQAA 4PV7A 4CMFA 3UWPA 3H3JA 5I7HA 5IVHA 1GCIA 4JI7H 4ND2A 4Q03A 5KG6A 1LVHA 4UU0A 5KU1A 1FUEA 1PFWA 1UPXA 4Q3EA 1NW3A 4ZODA 5GVRA 2D74A 1B0ZA 4PX2A 1KSGA 2YV4A 4Q9NA 5ELMA 3KV1A 2HA2A 3T7JA 5JSFA 3E1SA 4HDNB 1V39A 2JAWA 4OTZA 1WRVA 4MYTA 1GARA 5EPUA 3DAFA 4YJDA 1UQTA 4P7FA 5C37A 6PFKA 5GJWC 5MFZA 3R77A 1QF7A 1JU9A 2IYLD 1MO4A 4BY1G 2WWYA 3DUFB 4KFTA 5NULA 1XQ9A 1VL2A 3G13A 1CEXA 1JHYA 2AQHA 2C3UA 1H1LA 3OMLA 5F78A 4EVSA 2GSWA 4D9JA 3P32A 4LECA 1MG0A 1KNQA 4J2OA 5SZIA 1N1EA 1TUGA 4FU0A 2A5JA 2YIDA 4URFA 1ZH4A 3K3PA 4JJEA 5EMHA 4ZALA 2QRQA 3F49S 3V4VB 1WCV1 4J43A 2VAVA 4OBBA 2ON6A 4JI4B 2F8SA 3HI6A 1HFKA 1C1XA 5AVUA 5B1SA 1ZU4A 3WHPA 3NALA 3HKBA 3TH5A 3CZMA 2P9TA 5B3LA 5AVSA 2XMSA 3GI1A 2C9CA 4JUFA 4YCAA 1RYDA 3SI7A 1L8AA 2GNPA 1SHLA 1U81A 2OGWA 3NEAA 4I9FA 4NYMR 3TQIA 3UMJA 1N77A 4Z4GA 1GG5A 2ZB3A 2IBKA 2X5XA 5JNRA 2Q5JA 4M0LA 3ZE7A 2ZWVA 1MFZA 3ZJVA 4CFZA 5LPNA 2QQ5A 5G0UA 2AN9A 1SN7A 2OR3A 1V35A 4L2IB 5C8ZA 4ZVNA 3R23A 4CFSA 2D2FA 4GGPA 3HDTA 1UXIA 4D4LA 2PVSA 4Z2YA 4EMSA 1AURA 4R6XA 4QGAA 2XRMA 3WP1B 5K3OA 4CMJA 4POAA 1F0PA 2D7JA 3KT8A 1PYGA 1S2MA 2IEDA 1B0PA 3TFOA 4LJKA 4B83A 3L84A 2XIGA 1YA4A 1ZD5A 4WHMA 1FDSA 2VJLA 2PX4A 2H7VA 2QJWA 3DDSA 1TFRA 3ETLA 4OX9B 3HOYG 3PXGA 3DDZX 4WZBA 5REQB 2ODWA 1RYRA 2RHCA 2WLSA 3HG7A 1SIWA 1IHYA 5EZ5A 4ZHQB 2FPLA 4KN5A 3SF0A 3HY3A 3KUUA 4DV2B 5LQDA 2N47A 4C9BA 4DR1H 3D5TA 5L1IA 1HE3A 1W581 2IXEA 2XE4A 3HNOA 1VRCA 2QTVA 5BVHB 4YCNA 1QCYA 1YT5A 2UYGA 4TWRA 4Y9SA 5K8IA 1N5MA 5KOIA 3OUZA 1CJUC 1S3FA 3K0HA 1P4AA 1ADGA 1GGFA 4FGJA 2NYAA 4WCFA 3OD5A 5BUCA 3PJGA 4JMLA 2E48A 1GUYA 2VG8A 1G3IA 1F7UA 1L0BA 4QJ4A 2VP0A 3TD2A 4B2PA 4BZPA 3RJ9A 5FUMA 3L92A 3IIMA 3H4TA 1WV1A 1O3YA 3SICE 5G0TA 1IEXA 3HBJA 1R4NB 3STHA 4YBZB 1RLJA 2XNCA 3EG5A 1RWWA 4B2YA 3FYUB 2CKDA 2I8LA 1T36B 2PJUA 3EZXA 1DIKA 2BY4A 4LEIA 4QO8A 2JEIA 1UPCA 4AX4A 1JJIA 1EA5A 4OHUA 4YHHH 3NONA 4NONA 4HZUB 3VC7A 4D43A 4WA7A 1RJ9A 3TBKA 3U0VA 4D81A 3AL0C 3LNTA 2NPIA 1FNSA 3NPMA 2EOAA 2OD7A 4WACA 2HJHA 3BL8A 2HJ9A 4LPKA 4M7WA 3JRWA 4IOKA 4FYJA 3P9CA 1HDRA 1FF9A 3QH4A 1MZBA 2ZQ5A 4G5QA 3D6FA 4RV4A 3WBJA 4BAZA 1H2HA 2FP4A 3T9BA 2AX4A 2C8LA 4MTCA 4IFTA 4Q05A 4MUNA 4U7PB 4KOEC 2CK3D 5KFRA 2NZ8A 1GN8A 2YNMD 3C5EA 4LF5B 4RVUA 2JJMA 3G0IA 5E6SA 3WFIA 2NVWA 2UU9H 1YRHA 2J32A 4HSGA 3VPGA 1MOQA 4L4XA 2VA8A 5AW3A 1A48A 3NHMA 2OCXA 1JVNA 1OREA 1ZM9A 5CDSA 5JEEA 5KQLA 1F7VA 1XI2A 4IXNA 3QY0A 2FPOA 2BM1A 1FFGA 1RXEA 3EFHA 2QXTA 1E3MA 3SYKA 1HL3A 1HO3A 5T6MA 4G67A 4CMIA 5EE9A 1RWXA 3VU8A 1N6HA 1G8JA 4QUDA 3OQ6A 4PC6A 5KFXA 2G0TA 2HYDA 5G1OA 1I2MA 3ED1A 2XCPA 2PZFA 5DLYA 3FR8A 2PRSA 1DRUA 1HDOA 1XUOA 2I6QA 3ZZMA 1T2EA 1NBEA 5JYBA 4R1UA 3HLKA 4O29A 2G5TA 4OLAA 2XE7A 3AV0B 3HGTA 5LR6A 2CJFA 4IJKA 3TS1A 4CGYA 3Q88A 3E3OA 1GG2A 4HNTA 2V9CA 3TM5A 3EBOA 4GC9A 3TR6A 2PSDA 4TS1A 3DEFA 4XYMA 1P7YA 5ALOA 3CY6A 1Y5RA 4QGGA 4AO7A 3NM6B 2CL6X 2PKRA 5K8CA 4R05A 121PA 1HOXA 2UVRA 2EXXA 2XV1A 1GZ4A 3FNGA 4MI1A 3O2JA 4RSGA 4KYVA 1UBRS 1Y8AA 1W52X 1KK0A 2G40A 4I7HA 2OMKA 4LS3A 2DEUA 2QN9A 4QXRA 3L6DA 2UUCB 2Q5OA 3X1XA 3VR5A 4PFQA 1ISIA 3MRXA 4HQ0A 3KQHA 1AK2A 2B6HA 5DYWA 1G4UR 2JGJA 2JJYA 2R00A 4FKBA 4MAMA 4C30A 1VL6A 4M8SA 4EP1A 1E1CB 3BWXA 4K3VA 5F3DA 2EZ9A 2C31A 3WMRA 4X66H 4QLOA 4R41A 1ZNYA 4P4TA 3B20A 2A58A 1UXJA 4UCSA 2ACVA 3KB8A 3A1DA 3ORSA 1E63A 4FEYA 4HO1X 4BKPA 2C84A 2NT3A 3MJRA 4Q02A 4XYGA 2OB2A 3WB1A 2X1LA 4RNCA 4FT2A 2RGDA 1QH0A 4QULA 1FDVA 2FF7A 2YWXA 3QOYA 4J94A 2HLHA 3SR3A 4QYIB 4BVGA 4XYLA 4S35A 4IR9A 3EF0A 5UKDA 5IUKC 4J76A 4N65A 4D4JA 4R69A 5SYMA 1P9RA 1L5FA 4UXHA 2GBPA 1J2YA 3F6SA 4YMWA 5F1OA 3LKVA 2EW8A 4KUEA 4O7LA 3B1VA 4ML3A 3ZHRA 4NEQA 1IXRC 1YHNA 1KAOA 3T1YH 1XTKA 3DAPA 3FBGA 1DQPA 3PHHA 4QHYA 3BL6A 2WVJA 3HKDB 3U54A 2QPAA 3WLRA 3RFUA 2HZBA 3U39A 2BEUA 3K73O 1V6CA 4GOND 2N9UA 1RHRA 4CMKA 5L8VA 2BFDA 3RARA 3E5NA 4QT0A 4XGRA 3NU1A 2W9XA 4FI3C 4NU8X 3I92A 4JQZA 4NBTA 4GRIA 1O87A 3AXSA 2QUHA 5LMNB 1JZQA 1YZFA 4KV9A 2XYGA 1OH7A 4RZSA 4MSUA 2IYSA 2Z8XA 2WSMA 4CXMA 4P4LA 1WXFA 2CFRA 3MGGA 3R09A 3T1NA 4A82A 4F1JA 1GFZA 3VZQA 4YHHB 1UBHS 1X74A 3EYAA 5J43A 1T5DX 3ID6C 1XPUA 3NGLA 1N7HA 4Q4JA 3VHRA 3FA2A 3EXG1 4XLZA 1IK6A 3MMNA 5LVAA 4M8IA 3OIDA 3ZDFA 5J2TB 1M72A 4XJSA 4LH7A 5IABA 1FL9A 4AKTA 4JI6H 3RVQA 4HWKA 3ULKA 3FBWA 3DLHA 1XQYA 4BFYA 3HN7A 4D4MA 2R7ZA 1YRAA 1DVRA 1NVAA 1OZGA 3DDNA 4M76B 4MVWA 2W9BA 3V8PA 3PEWA 1QWSA 4TS9A 4AZWA 5ITZA 2RHHA 2ZUTA 4DA9A 2X5OA 1UQUA 1A5TA 3G0DA 3L8FA 1C8LA 3LPDA 3VC1A 3COJA 1YZNA 4EB6B 2RSLA 1RABA 3C6BA 2JIMA 2UVDA 2WTBA 1IYEA 1FBNA 1XXHE 1HZZA 4FZVA 4G2NA 4JYPA 4LRXA 2DWQA 2NQ2C 4MA4A 1JX4A 1P0IA 2PT9A 4RK6A 1SUSA 4AWXA 3G2MA 3PJFA 5L3QB 1P0QA 3FHLA 2V1UA 2VJMB 4ZTZB 5C2JB 4MVJE 5ALIA 3FRHA 2VI5A 4FGSA 5CB4B 4ZO8A 2Y0CA 5C5IA 4MS1A 3OWXA 4ARVA 3PI6A 1WM1A 1U28C 1NI3A 4IXWA 5AHWA 1MAUA 1ZA1A 3RH0A 3ROEA 3EPLA 3AJ8A 1U7UA 1RFLA 2H11A 3T34A 3K20A 5EJ6A 4I1UA 3NMUF 4QVKA 1EBFA 3ETJA 2B8JA 2VL7A 1PL0A 1YS2X 5DH9A 3RVNA 1E6EA 3LHDA 2ZRBA 4R8UA 3TRJA 3AQ4A 5A2GA 1XXHA 3QG1A 5C7IO 5GVSA 4MKZA 3PDIB 4IXDA 1NRJB 3EWIA 2O2CA 2ORED 4K9KA 3ZCPA 3OZGA 5EJ9A 9LDTA 1IBSA 2Q3JA 3JAWA 3AUYA 1TFUA 4N0EA 2PR2A 5BORA 4U7TB 1Y3BE 3RSZA 3FFWA 4N5MA 4WPGA 4ZVOA 2QZ9A 2Q9AA 2VF2A 3G49A 3T1QA 1VL8A 3FTEA 1UFKA 5FBZA 4V3CA 4L9RA 1U1DA 3MXOA 3OC0A 3L0PA 3EFEA 4YALA 2INGX 3A1SA 2Y0BA 2IDJA 3T38A 1I32A 3OQJA 1A1SA 2H5EA 5JG7A 5KFHA 2EW2A 2X40A 3LLVA 3ESRA 3R4VA 4V0ME 4FCWA 5IMBA 4B2IA 4Z4IA 4PIPA 4ZOLB 1YB1A 2FZWA 2ECQA 3P71T 4YECA 3KE8A 5HM6A 4GGOA 4F85A 2CJWA 4S1PA 3LZDA 4X1KB 3GRVA 5HMMA 4LXTA 3TQOA 5KOJB 2C4HA 2NZVG 4KZKA 1ATZA 1X13A 4H0CA 4LE0A 3QVSA 4P3XA 4M89A 2JVIA 4ZC1A 5BURA 1KQFA 1V8OA 2B30A 1CUHA 2OC9A 1WABA 4KQKA 5G4LA 1MAWA 3RBAA 4BC0A 3DKKA 1Q0RA 1P8JA 1W0KD 2V7GA 2DKOA 4ZU3A 7GPBA 3SWWA 3LQKA 2EG5A 1XQ6A 5A1JA 4B45A 1GQYA 4LDNA 1MH9A 3AF5A 1NWHA 4LOJA 4PCUA 4TOIA 4G9GA 3FPGA 2LNDA 4UHFA 1W4LA 3ZVLA 2ZRMA 3UPDA 3HI4A 3GBSA 4GM4A 2W70A 2Q1WA 3FYUC 4NCXA 1UMDA 4P34A 2X2PA 5FHRA 1DTSA 2GCOA 2R1ZA 4K9MA 1MW8X 2YQ4A 2QRPA 4JKIA 3QELB 4Z0NA 3WWYA 1GUZA 4DA0A 3EIXA 4UAJA 4CLHA 5KYXA 1FFAA 5C4MA 1WUJS 1KRXA 1YHYA 3V6MA 3GLGE 2JJ8A 3ER9A 4KQMA 2YN4A 1VRVA 3AKEA 4M9UA 1ADJA 2FEKA 3D4IA 3EVFA 3FDIA 3PQ8A 5B37A 5TXGA 2IA6A 1H2ZA 3ZXUB 4EHJA 2F3PA 3BMCA 3TQTA 3PC8A 4Q1AA 1QFXA 2FEPA 2ZRCA 4QOSA 3ZLVA 3D4NA 4DSAA 2VQEB 1F48A 2WU0A 2D59A 5FL7A 1UZUA 1YGPA 1M1YB 4GC5A 4MH0R 4OI4A 3HM9A 4EBFA 2JEFA 4O7ZA 2IUTA 4XQ9A 2EQ5A 2RDMA 5SZHB 3KQKA 4ZREA 2GPAA 4W6ZA 2GAIA 3AEZA 2VJAA 4GBJA 5FR2A 2JIOA 4CQMD 4PYMA 2BR3A 2IELA 3OTHA 5DWQA 3EMDA 2X9GA 3F5SA 2QT1A 1HG1A 4KQWA 1TVKA 3OOSA 3DKIA 3PUYA 5AHRA 2PEYA 5G0VA 3PGA1 1SEIA 2KJQA 5EE5B 3WDLA 4YMUA 4KIGA 4LMBA 1JAZA 1YJCA 2PKXA 1M73E 4DA8A 2Y8EA 4FI3F 1PTJA 1QANA 1ACMA 4U5XA 2XUOA 4BEVA 5ITZB 3LZCA 4A2AA 3FRJA 3H2HA 2WFZA 3EA0A 4YDSA 5EJEA 4XWWA 3K5WA 2H5JA 3SXUB 4O2BF 4X94A 1KEZA 3AU8A 5CB8A 1FFDA 3C48A 1CQIB 2H51A 1K9SA 3QX9A 4PICA 1B76A 3PFKA 5EKUA 3MG9A 3O4VA 2BPOA 4MPDA 3OZBA 1NUSA 2V7EA 3O92A 1JJAA 4NBNA 3I6YA 5H81A 1A8IA 4FMDB 5E9WA 2VQ3A 3EXG2 2ZJ4A 1FMJA 2JA6G 3GLSA 3N2KA 5JARA 3UMYA 3EBPA 3H3VH 2VJPA 1M2OB 4Y9DA 4AJEA 4L51A 4ZQCB 1ZJYA 2P2DA 2OXIA 1OFVA 5JR3A 4KRFA 3DHVA 2FWMX 3IV7A 2HD4A 3CCBA 3BVPA 2XZOA 3K6SA 5ITWA 1A9PA 4DVJA 1M0TA 1HFEL 3O21A 1U02A 5JISA 4A10A 3E84A 3OLZA 4IS3A 3TLKA 4Q37A 1P2UA 4B7CA 4DMRA 5KVCA 2ZP1A 2YHIB 2WDTA 1TQDA 3LHKA 4ZQGA 1E92A 1XKTA 1W1IA 3DGFC 4HAYA 3CA8A 1Z38A 1QCDA 2F62A 3I9OA 2C7BA 2WP8J 1RCFA 4OGLA 3FSRA 1Y5LA 2C5HA 4NENA 2VH5R 2ZI5A 4NEHB 1A5ZA 4J3FA 4P84A 4YRFA 4WNIA 4ALMA 4B3DA 4F3CA 3HR8A 4DB2A 2I9KA 4WKNA 1GRQA 1Z2NX 3KKMA 2ETXA 1GCAA 3OJOA 1HOTA 5BYAA 1Q50A 1XKXA 2DR0A 3LUBA 3LX5A 3ORHA 4UPDA 1GXSB 4KB5A 4DZZA 1PZFA 2VQSA 2Y4NA 3GA0A 4B46A 4NJMA 3GJSA 2WUGA 1WXWA 2FWJA 3B6MA 2A1HA 5IT9A 1X9HA 1KO4A 1TAQA 3ABIA 4LGMA 4L4SA 4Y98A 3QXJA 3C70A 5D3QA 2PFKA 1GQ2A 4C21A 1D09A 1E20A 4MJ3A 8OHMA 3VZSA 3CX4A 4KJXA 3MWGA 2FWIA 5LU9A 3QNMA 1KNXA 2PIDA 3IEIA 1E66A 5CM9C 5BWCA 1JTEA 3V8MA 1LJUA 2K7ZA 2W2NA 5DK6A 2X58A 2YC4C 1H1LB 1I3NA 2QRUA 3AY3A 1NPDA 4Z9YA 1JFSA 3MAJA 4J0IA 3A11A 3MRVA 4NWIA 5L3RA 2NU8A 5J4KA 5K3EA 1SVSA 1NZJA 2FPPA 1QV7A 3EUWA 1II8B 4JKOA 1SELA 5EWLB 3TD9A 1E64A 1IQPA 3BH7A 3TQFA 4Z7NB 3BJIC 2Q6LA 3CRVA 1HR0H 1MCZA 2JB9A 3KX2A 3PNBA 4U9UA 3QZUA 5DX1A 3TAXA 2CWDA 1ODCA 4C7KA 2VWHA 4DHWA 1O5IA 1EGQA 2GVDC 2EFHB 5T4BA 3M1LA 5BYBA 5DLGA 4G65A 4L0DA 1CEYA 1GKIA 1AF7A 5KQRA 4PGGA 2GBCA 4QO7A 2E4YA 2XGOA 1S7CA 4WBXC 4UASA 4HADA 4KE8A 3GTJA 1PS9A 4QPJC 4ZCTA 5FWXB 4ZDWA 1UXOA 2QRHA 4FS8A 4IFEA 2PGLA 4EUEA 1OXMA 4WY5A 1U7ZA 5AT1A 3C3MA 3N41B 2BP7B 4JD5A 3T4XA 3MFIA 1FP2A 2EFGA 1UWCA 2WUEA 3TL3A 3LPCA 1ZCFA 1LZLA 4FQ7A 4Y2GA 1UXGA 2EEZA 1JKJB 4RIHA 2YUTA 4U63A 4BJ5A 1PAUA 1KXZA 3ILVA 4BO0A 2QJOA 2AA3A 2QYTA 2JFVA 3O8QB 3SN6A 3SOZA 1P2GA 4HS4A 1E77A 3FFTA 4U2GA 4MULA 3EWSA 1CS4C 2WTXA 2HK9A 4WZAA 4QLAA 1ADFA 1EU1A 1VSTA 4LWPA 4RUAA 1UJMA 2CHGA 2FPMA 2I9PA 2XEDA 1RYMA 4IIUA 4RPGA 5FPTA 5KVSA 3LPLA 2I3BA 2FR1A 5C3UA 3UA3A 4MS3A 4NCKA 3K0EA 2R7NA 1P7ZA 1LY1A 2JHCA 1UJ4A 5BN1A 2E5WA 4W5HA 3ZHUA 4GLWA 3AF4A 1ZMBA 2X4IA 2ZR7A 3KEMA 4LNUB 5DGHA 1PL7A 4QYWA 1E1RD 2MSDB 2NO0A 3LUGA 4ECVA 2VYVA 1AKMA 4DE5A 2CXXA 3USZA 3MSCA 5LMCA 3LHSA 1U1GA 1RKQA 2EP8A 2Y0EA 1KU0A 1HFJA 1CERA 3M6MD 5EWMB 4CF6A 5KFZA 3EX7C 2XKJE 2R97A 1UC9A 5LLSA 4YROA 4FKMA 1U3UA 2ZJBA 3W7BA 3EVTA 3IKMB 1UBCA 3WJ1A 1ADYA 3DWGA 4R2JA 4ZANA 5AKLA 4RF5A 3KTAB 4IICA 5TS2A 4YBZA 2R5WA 4OYRA 2VPQA 4UHCA 1A7AA 2ZSDA 2B34A 5HJEA 4M0PA 1Z62A 4DKJA 1AV6A 5MGBA 4NAHA 5ESWA 4ZN6A 2UXBB 4D02A 2EHJA 4N9QA 1ZC4A 2IPMA 1JFLA 1KUTA 1X39A 4ERNA 4DV7H 4B47A 4DG9A 3I52A 2BLLA 1FFBA 1UF9A 3OKCA 4X1IA 3Q8PB 2CB0A 1XVAA 3U1TA 3QWFA 3PPVA 1J0BA 1HH4A 1SQ5A 1WQ1R 2DHRA 4HY3A 4H1UA 1JR3A 3DOJA 2R7AA 4LQCA 4M0KA 3Q7SA 4GLBA 5K6RA 3WLQA 1NIJA 4FM9A 1DG1G 3KEGA 3QXCA 4ZO6A 2FE4A 2P9YA 1IRIA 3LDHA 4BDTA 4KREA 1YNSA 3DE6X 4JASB 4QDOA 4WL0A 4BVAA 2AOUA 3WIOA 3T3MB 1YB7A 5L3SB 2Z58A 5HRCA 1AXGA 4U8GA 1WUIS 3FYCA 4XKJA 3A4TA 3QWHA 1UUFA 1ZQ9A 5B7QA 4EBCA 2NUTB 1DBSA 4W5NA 4OGWA 2VHTA 2GZSA 2UVPB 1YDGA 2YFQA 3JQ8B 3USCS 3KCQA 2V6IA 3L2OB 4F71A 2V3WA 1M6YA 3F9RA 1XQ1A 3IUYA 1N75A 5SZKB 1RU3A 2QS9A 2VKTA 2E5LH 4C1NA 1J1ZA 3TEMA 1FP6A 2QYZA 1T5OA 2WYVA 2PX6A 1QK4A 3JQQA 4WZAE 2RHGB 3WQBA 2GQRA 3LPNA 4GR9A 1S97A 1IEWA 2E82A 2VXCA 2ZJ0A 5HBRB 1TT7A 3SCZA 4HB4A 2DF8A 3QXHA 1KI7A 4KIUA 4QM7A 4WBSA 1GM5A 1YQ9A 4KMMA 1HF3A 2VUHB 1EI9A 4N41A 2CGEA 4QJFA 2JCYA 4Q3LA 3EPIA 1ZSYA 1U0TA 5AVRA 1V2GA 4XJXA 5FBRB 3OT4A 1DSSG 2QNBA 1GEEA 5SYNA 4GIBA 3V8RA 1TQHA 5BP7A 2EFEB 4YJFB 3PGXA 4PS0A 5ECYA 5KCZA 3PV0A 4P0TA 3THXB 1M1ZA 2G7MC 2Q6KA 1SMKA 5A04A 2BFFA 4S12A 5F5LA 3ZCVA 3P0EA 2BGJA 2ZJTA 1CG6A 3CVJA 4NK4A 2K5UA 4JXZA 1RD4A 5BR8B 4NL4H 2ZE8A 3KXLA 4RV5A 4FD3A 3SXPA 5TPWB 2RHWA 1V71A 2DLDA 4D42A 3LW7A 3S44A 4OH1A 2V3CC 1QIGA 3B6JA 5DWVA 4RU9A 5HS6A 5ICSA 4TKUB 2Y0DA 1J8DA 1P5RA 3HLTA 4UZEA 3TVYA 1UPTA 4A0HA 3TG8A 5EJ7A 4I6EA 1KORA 3CLUC 4J03A 5GONA 1HT3A 3AEYA 3C2QA 3GFOA 1X7XA 2AG1A 1RM0A 2V7TA 5K3FB 5DU2A 3GFGA 4YX9A 1LV8A 1TZ2A 2QD4A 4NQRA 3D3WB 4Q0YA 3WADA 4LF5H 5L4LA 2X9VA 4DSZA 1I3MA 3JD1A 2XWQA 2PGJA 3FMOB 4ZOEA 2F4VB 1NQTA 2X23A 4BO3A 5LQRA 3EBLA 3RVDA 2G6BA 1DBVO 3DZFA 1X1EA 1N78A 4F4DA 3IDAA 1T5BA 2PZGA 3AEUA 1XBTA 2A88A 3N40P 2EKLA 3MMSA 3NHZA 3AILA 4JUDX 5D00A 4GX5A 4L4YA 2X8JA 3H3FA 4A5OA 3CVVA 3K3VA 2CB9A 5D3ZA 3C7KA 4JB2A 3HBLA 2EJVA 1TNDA 2V7XA 3A4VA 2IA5A 3E1GA 5JATA 4XZ3B 4I6JA 4MVJM 1JDBB 2CLMB 2PXAA 2WYIA 1QO0A 2FHSA 1DCMA 2FEWB 3UXHA 2D1TA 2GFHA 3ZWOA 1ZGZA 1Q83A 2I33A 1YR7A 3GJ4A 2IF0A 3UFXB 3IHTA 4JGBA 1P16A 5AVOA 2AOTB 1IOZA 1KO5A 1YS1X 4MUGA 2GM9A 3EDOA 4ECUA 1IHUA 1UM9A 2Q8PA 1Y63A 2CF5A 3QUCA 3M4IA 3W5OA 3RU7A 1R66A 4A3LG 1K68A 2EJ3A 2E4VA 3IDFA 4LJAA 5ALRA 3UC5A 4PEVA 1CP2A 2J0SA 1RIIA 5FOUA 3HTXA 2BGIA 2P41A 3IIEA 2AE2A 4LF7B 3Q11A 3X1JA 4L22A 1PR3A 5GADl 2J9FB 4M22A 3E5MA 1A9TA 1OZAA 5M34A 3DLPX 1TMKA 4FP9A 1NJGA 4HYEA 4F9FA 4EGQA 1EGMB 3I9LA 3KL4A 5HBRA 1CKMA 4RD1A 5K0SA 4UCTA 1MBZA 2C0QA 3N0TA 2VEOA 3MTAA 3RFCA 2L69A 4DPMA 2OHHA 1RYYA 1VJ0A 1DMRA 3QPUA 1XQXA 3LGAA 1CVRA 3DTYA 4FMDF 1QIJA 5LKRA 3S6JA 3AR8A 4MGIR 3ECAA 1AH2A 3FKJA 2BMJA 4BTEA 1FNCA 4P3NA 3HB4X 4BMVA 4MEAA 2H7XA 3OEHA 4NCIA 3REGA 2H1CA 4UQPA 4YT5A 1LQTA 5AW4A 3QWAA 5DBOA 3DE0X 1MLDA 3GT3A 2G77B 1FLDA 3F5FA 3NAMA 3N2IA 1AN7A 1MU0A 2GEVA 3KB6A 1K5GA 4KQ9A 4Q7KA 2Q3DA 4TXNA 3ZXIA 2AQIA 2WJPA 4RXMA 3K6SB 3B5IA 2A30A 3H1BA 4B4UA 2NT4A 4TMVA 4UHEA 3MVEA 2QTVB 4U5QA 2DVMA 3WBFA 1QE5A 1DT3A 2ZYVX 3K2BA 4YC7A 1GTSA 1BVHA 5JXJA 4F4YA 1A9RA 1QGDA 4G3XA 4NBRA 3A31A 4HDRA 2V9WA 1FE8A 2J3MA 4HNQA 4OFZA 3V1TC 4F56A 3U7QB 1Z5OA 3GAZA 4KLZA 4FE4A 3OJLA 4JU8A 2F1IA 5EOVA 3TKYA 4FR5A 3LCVB 3A3YA 4NYMQ 2XZPA 721PA 1PT8A 4B3FX 1WB4A 3P9KA 4NJMB 1ONBA 3LP6A 1XAGA 4D26A 3GGCA 2ATEA 3TXAA 1S5PA 1ZOPA 5J4LA 1NW9B 4MRNA 4D1YA 4LC9A 2PS9A 1MEEA 2ECPA 3QEKA 5FRDA 4LF7H 4G0WA 3I4LA 4JA2A 4F6LA 1WXGA 3K94A 4ZOCA 2NV2B 5H3CA 1M6VB 4R16A 2J30A 1KWGA 1YL6A 4PLZA 3RBXA 3DDHA 3BGWA 3FBTA 4PFKA 3WQQA 3HYCA 1VJDA 1ZMRA 1IN5A 3BK1A 2Q1YA 3HCCA 4XCXA 3X2EA 3S2ZA 1WBDA 4M1EA 3TRHA 3G2HA 4WKPA 1L7BA 3FCSB 3U37A 4B2LA 3P2YA 3HFRA 2P5UA 5DX0A 2D54A 3ZNNA 2FZEA 5KINB 4AG5A 2IXAA 1BQ4A 2GDZA 2QJRA 4S2EA 5LU8A 1O03A 2FEOA 1XF1A 1ZD8A 4JJ6A 5EP2A 5FXMA 2CNDA 3MWMA 2PNJA 5E7QA 1FK8A 5D7NA 2WUWE 1ML4A 2B98A 2CFTA 2GJ4A 2IOQA 2MR5A 2NNLD 1QSGA 1JR2A 1KPIA 3KTDA 4X44A 5DAAA 3BERA 2BH2A 1WKBA 1V8ZA 2E2WA 1GU1A 2FJUA 2YHAA 1ZKMA 4HXEB 3N2GA 4ND4A 4OHKA 4R2LA 1MJNA 3HV0A 4MPJA 4RPJA 4IIGA 3A25A 3U0BA 2IZOA 4A0FA 2XVMA 1VIVA 1WCXA 2WQZA 4K8OA 2J3LA 3UK2A 1G4AE 3K5PA 1ZW6A 3ND7A 3KQWA 1QTQA 4O4IF 1TTQB 2IHKA 2AZMA 3C6XA 1K7YA 5DO9A 1FXSA 5AJHA 3BM5A 1QPZA 5JD5A 3NCTA 1NKSA 5THQA 1AGNA 2PK3A 4LSZA 3A26A 3SHVA 3B85A 3MBKA 3CH6A 1DKLA 1EK5A 1WDTA 1JLSA 1VMDA 4GZ3A 4NJOA 1W29A 221PA 3P2OA 4CQMB 5EIAA 3VMMA 2ZTMA 1YA8A 2VNSA 3B1WA 4QGBA 5LYJF 5GOTA 3OJEA 3RVLA 4AECA 2VTDA 4JYBA 2WTMA 4QJIA 3W2EA 3RS7A 3JQCA 5KJ6A 1A9XB 1CJTC 4B0OA 1OVGA 1PLJA 1G21A 3ITKA 3Q5EA 2EP5A 5KG2A 5T3YA 5JJKA 3T3PB 2ZVQX 2C83A 1ZN7A 3U3DA 2EIYA 5CFNA 1Q1BA 4A1OA 2GN0A 3H05A 4RH1A 4K6NA 4MGHA 1DEXA 1K7SN 4UE6A 4D82A 4G23A 1T9HA 2X2OA 3DYBA 4M0JA 1SUEA 3QV1A 5JLAA 1FVHA 1UCFA 1UFVA 4IZIA 4EG8A 1J2UA 1X7WB 4K0KH 1RRVA 2VJOA 4O63O 2FV8A 3OTIA 4PR0A 4HH0A 3F6PA 4Q3NA 3ZW9A 2WD8A 4NTZA 2FXVA 1J22A 2FGJA 1NOKA 5KFWA 1MOPA 1V45E 4HEA6 3BSYA 4LHEA 2HLPA 1M6EX 3PF8A 4FDUA 2PAAA 5IH7A 4G26A 2Q1SA 3ZWVA 3QKTA 2UVUA 1MZVA 1R37A 2B5WA 4HNRA 4LTNA 4YAJA 1T3GA 3V4FA 3AB8A 3THYB 1C8VB 1O97C 3KOUA 3RT7A 1IQ0A 2BM0A 4LI0A 3RRYA 1KEKA 1Q1NA 3B70A 5A3QA 2ECKA 4FFWA 4ENPA 1VB3A 2XNJA 1UK7A 2ZIZA 1DEKA 2FRDA 2LV8A 3E3AA 4X3PA 4CLOB 4LX0A 4DT1B 5HP4A 5DXJA 5DRTA 1V4NA 3E3MA 2AI1A 4FXOA 1TK9A 4RIEA 4Q1VA 1UWVA 3AUXA 3PL1A 4X8HA 5T41A 3X1KA 3ZV5A 5KREA 4W5RA 4PZLA 4YAOA 5TB5A 3IPAA 5HIIA 4CG3A 3F1LA 1HDEA 5K4GA 1N4DA 5L3QA 4AY6A 4TQRA 4F4ZA 1A9XA 1DKNA 2H06A 4GVPA 1R5JA 3ZC3A 2JL1A 2WKQA 4HX2A 3DBHB 2EX0A 4GLJA 1EXVA 2BBTA 4I1VA 5B3JA 1DEHA 2BKLA 3VTZA 2PH1A 2ESRA 2R8PA 2VPXA 3GPCA 1Z3CA 2X8LA 1D1PA 1KIMA 1VP9A 4TRJA 3UMFA 3ZKWB 1QH9A 1P0CA 4Z3KA 1NFFA 3VR4D 4OHOA 4G6ZA 1WUHS 5J1SB 1RPNA 1D4OA 3HCAA 3L0OA 3AHDA 2Y3IA 2DHQA 2PH3A 4PZ0A 1H9BA 4UEKA 1IZZA 4WFIA 3VYWA 3WK4A 2O52A 4ZIRB 1FDOA 3MELA 3PE6A 1JDZA 3G2PA 5BO5A 1P45A 3NBFA 4RGBA 4EIWA 1BOFA 4PZ8A 5C1DA 3DFMA 1BAPA 4JNKA 3RBEA 3K96A 3RGGA 1EFKA 4J0GA 1PNRA 2YV3A 4XM0A 2XYPA 1JE1A 4BVJA 2ZJ8A 4EG1A 5LDDC 3IV9A 1FC0A 1W2GA 4REQA 3IP9A 5FYQA 4L50A 5CB0A 2L18A 5LFAA 2EV9A 3WNZA 5D8DA 3QZ8A 3F8NA 1F14A 2AGVA 1Y5IA 4PZ9A 4OOFA 2PUDA 2YMMA 3A2KA 1N4AA 1VHWA 3DEJA 1EQUA 3LUFA 3M4ZA 2J7KA 3GFBA 2B83A 5DBGA 3TQ1A 3INGA 3TG2A 4LCEA 4EDHA 4LJRA 2FSVA 2IOFK 5BSTA 2PSJA 1E4OA 3T4UA 4QFMA 1GL6A 3G0HA 2ZR9A 1T9KA 2VXOA 4FHCA 3H5OA 1YQTA 1TUBA 3ICOA 4LAFA 3AL3A 1VL0A 4EAQA 4RHCA 4D0SA 4X6UA 4LRYA 4D0GA 4HEHA 2R1TA 4OKSA 2UVWA 1GUDA 3M82A 1PLKA 1EBBA 3B6KA 4D74A 1E9AA 1SHKA 3V33A 3P0JA 4FOSA 1Z6YA 1OFTA 1E3SA 5AM2A 2FZGA 3H18A 3MJDA 4FHZA 3ZJUA 2O1EA 1PYDA 1X86B 2IGTA 3GK3A 3R0QA 4BKRA 4UU7A 4QOHA 2CBXA 2RGYA 2F43B 3C8MA 1JJVA 1RQNA 2R1VA 3E03A 1CDOA 2OUKA 4OF4A 2XUDA 3K4QA 4WLNA 4BAUA 1HM5A 2DT5A 3G9UA 5E25A 5J23A 4JV1A 1VPVA 1XTJA 1X19A 2IHVA 2WFAA 1ACJA 1VE9A 3I9V6 2ZCJA 3FLBA 5JQGA 1T4CB 2O2SA 3W5JA 4FZRA 1K1EA 2AEEA 5DV9A 2DBRA 4N3CA 3SHWA 3LFUA 4QDUA 4BC1A 1DT5A 4DLRA 1YCDA 2YWVA 4NZNA 2WINI 4ER6A 4ZHSA 3N28A 3DH0A 3VH2A 1E18A 1VL5A 2FN9A 4NZZA 2ODPA 2DR2A 5C34B 3BQMB 4QYXA 4RH3A 1BGWA 3HU1A 1NL3A 3A1NA 1JIHA 1I7NA 1T2CA 4R7ZA 1B6TA 5FOTA 1FMTA 2Z2XA 4HUQB 2FMFA 3K72B 4LFAH 3F8TA 1RQLA 5KS2A 1R3UA 2HQ1A 2QJTA 5IYZF 2ZIEA 2DGDA 3TW7A 2WU1A 4GO1A 1DBWA 1Y82A 5KX5F 5GGXA 2BIFA 3P9YA 3VYRB 3AW9A 4TV8A 3PUWA 4L8FA 1XAIA 2MSCB 3KWFA 2BHRA 1XR3A 1XRMA 4OQEA 4C08A 4N47A 1LPMA 2J3KA 1WPQA 3IERA 3IVGA 4DY4A 3GLKA 1ZU5A 4DTCA 5CLFA 5E7MA 1ORWA 2CNLA 2PUCA 4CMIB 1T8PA 3KJZA 3RSGA 3O1IC 5LP6F 5FO0A 5TR9A 3RF7A 5FOSA 2WSYB 1WHSB 1TCCA 1XTRA 3QXGA 1JECA 4C0JA 3F3YA 4PONA 3ST7A 4CLEA 1R6DA 1XJWA 4O81A 1UMDB 2JI4A 2XB4A 1SQ0A 3H19A 1UT6A 3P8ZA 1FA9A 1USIA 2WNHA 1JWAB 4IEEA 3AR6A 1FSSA 2R7ZG 3PHJA 5T67A 1GTZA 2Z8ZA 2W6MA 3L1UA 4BTLA 4LFBB 4C0HA 4I1IA 4FWIB 1U7HA 4MMYB 4LSAA 1GGJA 1EK2A 4JQSA 3QTLA 4LXGA 1SXPA 4C2MA 4CG1A 4YCDA 1EFRD 3DSRA 4S0ZA 5DTJA 5ERYA 1NW4A 2I87A 5ESDA 5J3JA 4KR6A 4XGNA 3ORYA 1NHWA 3NNSA 1P9OA 1CNMA 3ESBA 3AVQA 1L7VC 2ZSAA 4YJHB 5FF9A 3D3KA 3MD9A 3SJ7A 4L5YA 1HDYA 2IEGA 4Q19A 4AY2A 2QJFA 1F38A 4G1MB 2PCJA 4IRKA 1TYZA 3HB1A 4IR7A 2L19A 1G42A 1WVMA 2Q3CA 1W88B 4HEQA 1A71A 3NXSA 3W2GA 1BG6A 1M34A 3T5GA 3UYKA 1J0DA 5G4KA 5DMHA 3T12A 2HHJA 4RTOA 2B69A 3AR5A 3PXXA 1T13A 1T2AA 1CLEA 1J5XA 1VXRA 1U8XX 3CVOA 3LP8A 4MB2A 3RVSA 3RRXA 1O97D 2ID9A 5E1BA 3GRUA 3NFYA 4PFSA 1P9NA 4MKGA 4HDAA 1YR1A 3AL2A 4Q3AA 1WP9A 3ESDA 3ANNA 1M5TA 4JVNA 3V2UA 2GYUA 4ZI2A 2R7KA 1DAAA 2UXCH 2WIBA 4R1LA 2JPDA 4LC0A 4QBTA 3NT2A 4TN5A 2FVYA 1LF0A 1QYWA 2NO6A 5LZ5A 1AGXA 4YJKA 1XV5A 2SICE 1V1RB 2IKQA 1Z08A 4JQOA 2RIPA 1RRFA 1SYXB 1IIBA 1L7QA 3N1UA 1CEQA 2XOEA 1P1RA 4JWTA 3UQ8A 4INOA 3O8LA 4M2LA 4AYXA 1I94B 4DYVA 2IEYA 1RYZA 4ZAXA 4UD6A 3FNBA 3HPQA 3U4MA 3UWKA 1DRJA 2BBWA 4UM9D 2IH2A 2D8AA 1IWOA 4Y7DA 3ZI4A 1GLVA 2GQ0A 3AIKA 5LLTA 1V8PA 2HSZA 4BMZA 2X19A 2BI4A 2FLNA 1E2PA 1J06A 4U2EA 2KX7A 4JXUA 4WIAA 1UC8A 3PXUA 1NDUA 2DJIA 1GUBA 2E85A 4H77A 5C8DA 4QOIA 2BDTA 1I14A 3KKEA 3PE4A 4JI2H 3HU2A 3WZMA 3LBNA 3CSUA 2YWFA 1ZLXA 3EAGA 5C1OA 1C7JA 1U8FO 2O2DA 3AY6A 2A3NA 1KK1A 3AEKB 4WXMA 2Z6VA 2FMHA 1YAHA 3TLGA 5BMOA 4NCAA 1GEGA 3PIRA 1W36D 1AU9A 2P67A 1DC6A 3A2MA 1V3TA 2DQKA 4UOEA 3R8FA 1YDMA 2AFRA 4ZZ2A 4KWHA 1M6HA 5IW8A 5L3ZA 3J81k 1MC5A 2VCYA 4ZQEA 3AEQA 1J8YF 3FTNA 3OBIA 2HFJA 2OGUA 3WYDA 4QTTB 2E18A 3KWMA 4JSYA 1EXDA 4KNVA 5AVXA 4RV9A 3COPA 3ROGA 3RVOA 3CMMA 3WLJA 2ODTX 3FPSA 5EPEA 3K70B 2PO7A 3UXYA 1UC5B 3FUXA 2XWBF 2WSSA 1XTIA 1GGOA 4Z8XA 4A8JB 5AIAA 1XP8A 3C3EA 3GUYA 4Z5XA 5A4DA 2VZ0A 5EL0A 1KP2A 2OK7A 2QLLA 4P08A 5L4NA 4YJ3B 1Q7CA 2P2SA 1F6DA 3IR5A 1IZ8A 3ZZTA 2EWWA 1FSZA 1NQVA 2PLNA 3OKAA 4E7OA 1NG1A 1KU6A 5FI3A 5BN5A 2FK7A 1IWBB 2OY0A 1T25A 3QU9A 1E4FT 2Q0XA 4TN1A 4OHZA 5A4FS 4FUQA 4G0UA 5DHFA 3ZHCA 5HJ7A 1N2CA 5D1OA 1T34A 2IU4A 5F7JA 4RF4A 5FTLA 1UDAA 1QG2A 3I4CA 5G02A 1G2WA 2OC4A 1SOMA 5IAGA 3AK4A 3OECA 4YR3A 1A2BA 2HA5A 4GG1A 5LBUA 3OO0A 4ZYXA 3L8ZA 3PT5A 1I51A 5BSWA 2IXFA 2JIPA 2WUDA 1FX1A 3H1FA 4X85A 4DT1A 4ESOA 4QXPA 3FGNA 5DZSA 1OFIA 3IXQA 5AW2A 5EJ8A 1ZICA 4TV8F 2C4VA 3I9FA 2V7BA 4MKXA 1PSWA 1IPEA 1SR8A 2JIDA 2OGTA 3CPSA 2VQ6A 5DGCA 4M7RA 3UYLA 1DEOA 2WAXA 3CEJA 4M9RA 4CKBA 2VUUA 3PUJA 4RTQA 1ZUD1 4YR2A 2BCGY 3GVXA 1KS9A 4JLJA 3D8NA 2XRFA 4HOYA 1AG9A 2IDKA 4CJXA 4K6KA 4RU1A 3I2KA 1KVSA 3CXRA 1V43A 4JJFA 3ZWMA 1J00A 4GI3A 3N3BC 5B2ZA 4B3TH 4O2BA 3TYXA 2WM3A 2Z8YA 2ZM6B 2B7LA 1AUQA 2IOHA 3NPAA 2QR5A 2NO5A 3FMGA 2F55A 3H5LA 4Q1DA 3V1MA 1ZRSA 1Z8FA 3OLXA 5KYGA 5DTMA 4PHTA 4N5NA 5FWYA 3ONWA 4JROA 2R6ZA 4ZV7A 3CS3A 1TZJA 4Y8VA 2CVOA 5EIOA 3UH0A 4ZI7A 2A6PA 1MHTA 3U6BA 1HNZB 2IYAA 5AHKA 1QUEA 3U56A 2ASVA 1I6WA 2IGBA 4AKGA 2AK2A 3OPYI 4C5CA 2HH9A 1Q6ZA 1Q0QA 4GPZA 1SC4A 2YHSA 3RK0A 2QPTA 5KZMB 1YFJA 1Y8RA 3GV8B 2RC5A 3BZBA 3LQQA 1X1SA 2WUVA 2ZTLA 3RADC 4IEFB 4R40A 5DT9A 4U9IS 1TGYA 4FPXA 3V1NA 4ENTA 5L6MB 2FDXA 2GXSA 1KMHA 2H08A 2HMVA 3KTMA 4TKMA 2GLTA 3VPBA 4UCXA 3HP1A 4E5MA 2CXRA 4F3TA 2C3OA 1B2RA 2R66A 1I5EA 3W6OA 3ZDCA 4E12A 3EGVA 2FX3A 5I5GA 3KYBA 2IBMA 2P5YA 1ZD3A 3UWOA 4F45A 2V4UA 1Z29A 3AUUA 4X62B 2P3OA 3DQPA 1NBMD 3G5UA 1PEKE 4B6JA 1HRKA 2D5BA 1X7GA 4G5XA 1I2AA 4ILEA 1R00A 3GT0A 4MI6A 4ER7A 3QG5A 5B7GA 4HH4A 5JMOA 1U5CA 2BEKA 2VA3A 4HI0E 3IEVA 1YCGA 4WK6A 1CDDA 1QONA 2IY7A 2BFMA 3GT4A 4YUVA 2BHSA 3ET4A 2HMTA 2WT9A 1K7EB 2PM8A 1VPWA 1AD2A 1SVKA 3QLUA 6AT1A 1O6BA 1W76A 1B2LA 3O8RA 2PL5A 3WK5A 4EAAA 1SCJA 3HHEA 1OBCA 4PYJA 1JAXA 1SUFA 3OHAA 1WY5A 4EI9A 2ZJ7A 1J8VA 3CF4A 4URUR 5CPFA 2GEBA 3W3ZB 4BQFA 3VNSA 4RNMA 3AERA 4OQXA 1C3XA 1CB0A 1N2BA 3HB7A 3UAYA 1YA6A 3DT9A 2L0XA 3ENZA 2WM8A 3IBGA 4WDRA 1P75A 4WUVA 3HDVA 5TC4A 2EL7A 4GAEA 2VBGA 1OBGA 4HDQB 3UF0A 1FRVA 4DYHA 1KMIY 1YR6A 1QIDA 1KAMA 2DY1A 2R9VA 3L40A 1B00A 1PWHA 4U0JA 5IH3A 2XDYA 1AQIA 3G2IA 4C87A 2A5DA 2CJYA 2RJOA 1BROA 3SZLA 3E3NA 4ND8A 3TOVA 3WP0A 4O1IA 5D2CA 3WRXA 1P80A 4QU0A 2OK8A 3K92A 2V7QA 1PW7A 5K8VA 4H3VA 2QTFA 5C1IA 4IIYA 3RRZA 4K5QA 1D04A 1AQ6A 1PDOA 1PN3A 4TSFD 2CMFA 2G0NA 3OQVA 1EZ1A 4OGFA 2GTHA 1TM5E 1R9MA 1W75A 2I2WA 2PQ0A 2YVKA 1PZXA 3HCNA 4GXTA 4O3PA 1PFVA 3WGIA 5JNVA 1DU4A 4BV9A 1M76A 3DB2A 1OC2A 1YQWA 3QRWA 4NYEA 2NM0A 4O6VA 4Q7LA 2YW9A 4NK5A 4QELA 4UEJA 3JVVA 3VSDA 1JLLB 4NMHA 3SDBA 1W85A 4HRXA 1B93A 4XIYA 2CSUA 3GJ0A 5JWHA 1U1IA 3RWOA 1K89A 2HBZA 2F8MA 4O86A