3VPCA

Argx from sulfolobus tokodaii complexed with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
molecule keywords Putative acetylornithine deacetylase
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpcA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpcA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpcA01
2Z04A 2QK4A 4WBNF 1KJ9A 2R84A 3AW8A 3KALA 1ULZA 3OUZA 3RFCA 5C1PA 3ETJA 1OBDA 3R5XA 4DIMA 3TW6A 5LOVF 4TUYF 1KBLA 4RZQA 1CE8A 4HNVA 1KEEA 2R87A 3LP8A 5BPFA 4HNTA 4FU0A 3UFXB 1SCUB 1A9XA 1C30A 5BMVF 4O2AF 4IIJF 4O4HF 5HV6A 2DLNA 2V58A 3KREA 1GLVA 5JQWA 2W6ZA 1Z2OX 3R5FA 1KUTA 2NPOA 1EUCB 2FPIB 4M99A 5FNVF 3K5HA 4EA8A 3WNZA 5LP6F 4O83A 2J9GA 5CAEB 3VMMA 3BG5A 1Z2NX 4M9CA 4C5AA 5KX5F 4FFPA 3TIGA 2GLTA 4WD3A 2R86A 2XD4A 3VOTA 2C00A 3MJFA 5HBRB 3OUUA 1EZ1A 4Y8VB 1CQIB 4MV6A 3KAKA 2VR1A 3G8CA 5CA1F 4I55F 2I80A 3TQTA 2R7LA 5C8YF 3U55A 2P0AA 3NUAA 3BSSA 4MV1A 4ZI7F 1VKZA 3WO0A 3ORRA 4TV9F 4XZ3B 1IOVA 1W93A 2DIKA 2GQSA 2W6MA 4MA5A 2YW2A 4EA9A 3JRWA 1CQJB 1DIKA 3GIDA 2NU6B 1GSAA 5JVDF 2FPGB 5J2UF 4IWYA 4O2BF 1B6SA 3V4ZA 3HBLA 1EHIA 4NYEA 3TINA 4YAJB 3V4SA 3JZIA 3BSWA 4O7YA 4O7NA 2V59A 3AX6A 5J2TF 4O84A 2R7MA 3JZFA 1I7NA 2YRWA 3E5NA 1KJQA 2PVPA 4IWXA 4EABA 2GPWA 2CNQA 4GGMX 2GQRA 4TV8F 1KJIA 2R6FA 1JDEA 4O86A 2FB9A 4YB8B 4O7ZA 4O4IF 4ZHQF 4M98A 2VPQA 2R82A 1I7LA 2YZGA 1Z2PX 5D8DA 1DV1A 2YZNA 3Q2OA 2Z02A 3HO8A 2CQYA 2W70A 2YS6A 5JVLA 5CA0F 3GLKA 5JH7F 2ZDQA 4FE2A 1M6VA 3U54A 4O7LA 2XCLA 3VPBA 3N8DA 1KC7A 4HQ6A 3K3PA 5DMXA 4MV4A 4L1KA 1A48A 5JQGF 3N6RA 4MV7A 1AUVA 2HJWA 5C1OA 2CNVA 2W6PA 4MV9A 1W96A 4FFNA 2CNUA 2W71A 4QSHA 4FGRA 2R7KA 3ORQA 2QF7A 5LA6F 4EA7A 1VBGA 3QFFA 4FFLA 1C3OA 4ZQIA 4O81A 5H80A 4MAMA 5K2MA 1PK8A 4YJ3F 4O4JF 2YZLA 2DZDA 4DLKA 5LXTF 5LYJF 2R7NA 4O7WA 3R9RA 3RV4A 2VHEA 3VA7A 2NU9B 2DWCA 3RV3A 1JDBB 4I50F 1GGOA 2VQDA 2WYOA 3DF7A 4IZOA 1EYZA 3K5IA 5CB4F 4C5BA 3BSYA 4M9UA 4YBZB 4C5CA 4FFRA 2FP4B 3SE7A 4HNUA 1KJJA 1DV2A 5I47A 2V5AA 4FFOA 1KJ8A 3Q1KA 2YL2A 2NU7B 1VBHA 3R23A 3VPDA 3KAJA 2GPSA 3TIIA 2ZDGA 3LWBA 4O7VA 2CZGA 4MV3A 1JKJB 4XYLB 1B6RA 3RUPA 3HB9A 5GONF 1AUXA 1EUDB 4ME6A 4YJ2F 2ZDHA 1PX2A 4J6EA 5KKNB 1BXRA 2R85A 4O4LF 4EG0A 4FFMA 2NU8B 2OLSA 2X0SA 2W6OA 4O7SA 4EGQA 3I12A 1T36A 1M0TA 2SCUB 2YWVA 4EGJA 2PBZA 1GSOA 5BPHA 3MWDA 4EAAA 2W6QA 2IP4A 2YS7A 4HR7A 2I8CA 3MWEA 2I87A 3R5HA 4O7RA 1WR2A 1BNCA 4O82A 4O7TA 4MA0A 1CS0A 3BFPA 5IYZF 3U9TA 1OBGA 2PN1A 4XX0B 1M0WA 3VPCA 4IHJF 3ETHA 4XYMB 1E4EB 1UC8A 4E4TA 5EZYF 4I4TF 2YZMA 3U9SA 2FPPB 1GSHA 2NUAB 4MV8A 3JRXA 1E4EA 1UC9A 2HGSA 2YRXA 2W6NA 2YYAA 3G8DA 4YAKB 1JLLB 3WO1A 1IOWA 4ZOLF
chains in the Genus database with same CATH superfamily
4CG1A 3JU3A 1IJFA 3TMAA 1Z3CA 1KTVA 3WXMA 2OD2A 3G8BA 4KXLA 2G70A 4Y9TA 2IH4A 3AW8A 2RI1A 2FOLA 1XNHA 3GLVA 3QU4A 4W63A 3C4QA 1C7EA 2Y1WA 3MTBA 4BLRA 1NLFA 1R10A 2VSQA 2MSCB 5DGAA 3M81A 2WU1A 4LHWA 2E49A 4L57A 3ZZ0A 1U3TA 2GYUA 4ALKA 1PWXA 3AHDA 3N7AA 1ZD1A 1DJPA 3V8RA 4GG1A 1T3GA 3JQ9C 1G8PA 2H6EA 5EPOA 5GP1A 3TQ1A 3ENNA 1HYHA 2HDHA 3AI3A 3DDCA 2JGDA 2XVYA 2H4YA 1GVNB 3NBZB 1RP7A 4O1HA 4W8OA 2DBQA 2QIOA 4Y2PA 3RVDA 3OE5A 3V4FA 4EZIA 3THYB 1XR3A 3UAOA 1OB5A 3EVBA 4HNQA 4XZ3A 2D0DA 1OV4A 4RF4A 5EUBA 3S2EA 4I0WB 4D57A 3W9SA 1YZLA 3QTBA 3T7KA 1U81A 4Q4HA 3UFXB 4UUMA 1F14A 4IIJA 4R6XA 4JT2A 3L0SA 2QT0A 3HKDB 3KJFA 2E1PA 3BXPA 2WP8J 4RFVA 3I04A 4ZPXA 4FB4A 3G1WA 4NG4A 1A76A 3FJ1A 1JFVA 2BWJA 2ZIGA 1DB3A 4E14A 5CPBA 3TY5A 2J9ZB 2BKEA 1ECLA 1QO7A 2IF2A 3ETGA 2O8EA 5I51A 1QIDA 1B04A 1GNQA 1SC1A 3CLKA 4HAVA 1XMQH 4ZOQI 2QRUA 1DCKA 1FP4B 3QPDA 4MRNA 4OGLA 1KUTA 3PK0A 2C4WA 3RLFA 1ATIA 4D0SA 5AW6A 4MW4A 1BJKA 3QK7A 4ZD6A 5TQVA 3KXKA 3O73A 3PE6A 4HY3A 4OBEA 3V2IA 4BN5A 1M2VB 2YBEA 3AEZA 5JCZA 2J3HA 4ZA2A 2GHIA 3VMMA 1YDHA 3AOEA 3VHRA 3UJ8A 5A5FA 1Z2NX 1WVMA 1DP4A 1XU9A 3OM0A 4O4IA 5AYVA 1GM5A 1XTTA 3TI9A 1MUUA 1QNLA 4UM7A 5F76A 4L85A 4E4YA 1RJDA 1XTZA 3U1TA 1P3DA 1N0HA 1QZTA 1PG2A 5ENZA 1HEIA 5KDOA 3IEPA 4URHA 5CP8A 1T26A 1DRUA 2DLDA 4H60A 4UHHA 5DN6A 1CG6A 3AR2A 4W5QA 3Q3JB 4YDRA 3WHLA 2VDMB 5JISA 4ZTBA 4YI5A 4XD7D 4MYTA 2HR1A 4PZ0A 4CQMD 2UVQA 2R97A 4DQNA 4EYEA 4GM0A 2NVUA 3FLEA 4X1KB 2R8YA 1MQ9A 5FTNA 3DMHA 4EY5A 3ML1A 4HAWA 1JIHA 3SQWA 2EEZA 2FSIA 2LZ0A 2A5DA 1QPGA 3D81A 4QT4A 1OCEA 3O4IA 1U7PA 5KBYA 2C58A 4WHXA 1H3FA 2BAGA 3ADDA 4NCIA 2PR7A 3ZY5A 2O8CB 1I4OA 1M1NA 2DFDA 1PHRA 2BKUA 3TM5A 2IIPA 3TWOA 5B1SA 3KKKA 2E55A 5HJ7A 1XP8A 1H9CA 2IDKA 3PHBE 1KHTA 4OLAA 4JXXA 5G2OA 2J87A 3U3XA 4MRRA 3T5HA 2ATXA 2QTVA 4P22A 4RLFA 4B73A 3PPYA 3TQOA 4ARZA 2P8JA 2ZWPA 3GLHA 4QGHA 4H0FA 4NMWA 5CNJA 4BO7A 4RVNA 2EKPA 2XYRA 3WC4A 2IIQA 4HNRA 1Z5ZA 4XZ3B 4UCUA 2VP5A 4WY5A 5J2TA 1VYHA 3G2IA 3MM4A 2PSEA 1HDXA 1QWSA 2O3UA 2JW5A 2QTMA 2R60A 1SIUA 2C9CA 4FX5A 4IQGA 2PA3A 2L17A 1Y3IA 3E9CA 1JKFA 2X7XA 3O9VA 1FDRA 4MVYA 1JEDA 5J9FA 1OQAA 1KAHA 3C3EA 4OXYA 1FP6A 2FRDC 4NNJA 3ZTYA 1M6WA 3OTOH 1N9KA 2DFLA 1BO6A 2ABJA 1OLUA 4GWGA 1VE7A 4TZTA 4B47A 2JLZA 5E6RA 1B23P 3T15A 1QH8B 2QTNA 5KMGB 3IIMA 5C35A 4LVNA 4M54A 4X8HA 4I3GA 2YNMD 5D5PA 4PCAA 3FPEA 4KXVA 1CUCA 1ODCA 3D1JA 2ZIEA 4WEOA 4HDSB 3JQPA 3FCOA 3QEBZ 3D5QA 3QWUA 5EQFA 3PI7A 3WYAA 2BGWA 2WIKA 5C5DA 4UDYX 1PZGA 4UE2A 2WNHA 3H20A 1WTCA 3AUYA 1IDN1 3CIOA 1L7OA 1Q92A 1MQ8B 1CPYA 2CYCA 2DHDA 3PB3A 3Q5GA 3HOWG 1TIPA 4A8JC 5KFIA 1SZDA 3IDQA 2G5CA 3B1ZA 2MSNA 3IFSA 3KTAB 1I1QB 4M0CA 4XCXA 5F33A 2NPFA 1PF7E 3UICA 1QORA 3W05A 3QJ5A 4EJFA 4ZJYA 5A6VA 2VSFA 2XF8A 1E59A 3ZGOA 1FFDA 1ND6A 4RMHA 1CRPA 1GXSA 2JGIA 4NYEA 1BE6A 3A1EA 1L5WA 4A3IG 1KK3A 2VZ8A 4DNFA 5HKBA 1N6NA 2FN4A 3ICOA 3DEAA 4KQ6A 5JSKA 3RVQA 3MJRA 4JWTA 4DWOA 1W36C 2PUTA 4DFDA 1RTKA 2NXJA 4HBGA 1V4VA 2BMJA 4DR1H 1A2KC 1HDOA 4IS3A 4ZCIA 3ENWA 5I48A 1I3LA 3IP1A 1K89A 4FK8A 4RO0A 1SVSA 5I6DA 1ZNQO 3HU5A 4FONA 1E99A 4CMJA 4BQSA 4HSEA 4JQZA 1SXPA 1VPWA 4IIHA 1P7VA 4YR7A 2PZFA 3QXJA 1W47A 2I7DA 1Y42X 2W90A 4IEEA 5HQ3B 1KVRA 3QU2A 3TEFA 1QNFA 4Q4JA 5DN9A 2IFTA 1N2CB 4A03A 1TWGA 3UXHA 4BJHB 1EXNA 3C4JA 2F48A 5FWXA 1U2SA 1W1UA 4K1XA 3BRQA 4HDNB 1KJQA 1J21A 2XMQA 4YAIA 1XCPA 3ZLBA 2AOTA 3QZUA 5MN6A 3KNZA 4L9RA 3PGXA 5HGXA 5JO9A 3OU2A 2FWNA 3MJVA 4H6PA 1K5PA 4TV8F 1EWKA 2AR0A 3MS7A 3DPUA 3L46A 1ODIA 3FPCA 4IOLA 3IBFA 3SXUA 4RE5A 1TMGE 2HJHA 5F5NA 4Z0NA 3P94A 1K0UA 3MLEA 2P9CA 2WTBA 5LBTA 1T4DA 2X77A 1BZYA 2FB9A 2RHWA 5JH7A 4CNQA 2YFKA 1MH9A 4F2GA 1JXQA 2FJUA 4FOLA 4PF1A 4DA8A 1I1KA 5D8DA 2C1XA 2QUBA 3V2UA 1P73A 4IF4A 4NNOA 5FPQA 5B64A 3LLUA 5DT9A 1NV8A 1COWD 3BZUA 5T4BA 1OHHA 4CCSA 3H2GA 5KNDH 3LDFA 4LJAA 5K0NA 4W5HA 4MPJA 4KIWA 5ED0A 2X8JA 4BFTA 4UZEA 1KC3A 4RM3A 3MAGA 3I2KA 2WTAA 1AV6A 4EGAA 3O4FA 3U1BA 5LFAA 4HQ0A 1PDVA 1TECE 1Z06A 3CUEF 2PH7A 1DKNA 1OGJA 2KQUA 4N82A 4JXZA 1Z6AA 2IBTA 4YR3A 1DAGA 3Q7SA 4OHZA 1SKUA 2HHLA 2D62A 5HNEA 2Z83A 3DZ8A 5C34B 3TQFA 1G3IA 4PZ6A 1S4MA 1E3EA 2IHKA 2JAUA 3A2LA 3GBVA 3PNOA 1N25A 3BA1A 4OXXA 5EHNA 4RH1A 3ESAA 3ZEIA 1CNFA 3WHIA 4ZU1X 3ZUGA 3GUHA 3HDVA 2B78A 2XXBA 2DQSA 1TM1E 1ESNA 3WMRA 3MGGA 3PPIA 3N5CA 3VR4H 4E2WA 3FDXA 5IYBG 4CTNA 3DBLB 3VKHA 1OFTA 3TO5A 1A48A 3WLEA 2F8LA 5ALLA 3PUWA 1YQXA 2H52A 2PXXA 4QO8A 4F4IA 4MRMA 1VHJA 1FVFA 2HJWA 3A3YA 4IJ5A 4KAFA 1EVEA 1HR0H 4QXQA 5E9WA 5EVCA 1QKJA 2BW0A 3O21A 4EHNA 5JRDS 1HT1E 3R3XA 3T0IA 3TAHA 1II0A 1U9JA 2R48A 3A28A 3V1YA 5AICA 1H6CA 4DLXA 2EWMA 1XZAA 3DZJA 3A3PA 4RJ2A 5DLGA 4PG6A 3UOGA 3L8GA 5FTMA 1YHZA 4I4IA 4L0DA 3G0OA 4LZLA 5SYAA 1W6UA 3MGCA 4A6PA 4P3KA 5HW0A 4XCVA 4RCNA 5BOVA 4YMIA 1E5LA 2E5LB 5L9XA 3PVSA 1TE2A 2POQX 1YT5A 4LFAB 4MV5A 1QAQA 3TCXB 3TZEA 1ZFNA 1HC7A 2PWZA 4ZAXA 3U3RA 1ISIA 4NCXA 1M5RA 2CW5A 1E2DA 4X1OA 1PS9A 1SVOA 3KC2A 4QXOA 4KO2S 1RCFA 5GTDA 3T4XA 2P1RA 1MTOA 1K5HA 1SRRA 1UBFA 2IYRA 1W5FA 2R47A 3EFOA 2YZLA 1GPMA 1P75A 4ENPA 1LNZA 2YNMA 3N8NA 4B80A 1NI4A 3A9TA 3D1VA 3LOPA 4MITA 4XPZA 3B78A 3TZ6A 4OQLA 4B8ZA 2B8TA 3GBSA 2YDXA 1LC3A 1JXMA 4EFBA 4O7WA 1PQ4A 2FVXA 3ELWA 5DU2A 1JIUA 1J1IA 3AHJA 1QYDA 3KJNA 5FF9A 4F4XA 4EG1A 1ODJA 1XNGA 4XQ0A 1KI2A 5CDYA 2VHEA 1GADO 3SU8A 4X8MA 4DMKA 5BW5A 2NU9B 2Y3IA 4QPPA 4ZVUA 2E37A 1E79A 3INRA 3OIFA 3OKAA 3ZHYA 3Q3EA 2R79A 3GIWA 1RI1A 5I45A 5EHXA 1GO2A 5K2OA 1GGKA 2RGUA 1HT0A 5T5QA 1R9TA 4PLYA 5KU1A 5LWQA 1U0RA 1YL7A 1I5OA 1O97C 2HI0A 1GYQA 2AVNA 1SEPA 2VOBA 2QTTA 3BSFA 3EOAI 4HB4A 4PHHA 4ARBA 2QW8A 4DHEA 2QIPA 2QZJA 3OPQA 3WIBA 1XKLA 2BEKA 4DLZA 4QFBA 1M34E 1TJ4A 2OGUA 5EXSA 3DMGA 1Z35A 4MB6A 4FFDA 1B16A 4TXJA 5KG4A 2EHDA 2AI3A 4GPTA 5EIBD 3FDSA 1XROA 1GPYA 1VIDA 2OHXA 3G0GA 3GZJA 4M8IA 2IK8A 4TSKA 3TE6A 2O5EA 3KZOA 3O1HB 5FOTA 3CF6R 5B1EA 4LF8B 3QX7A 2VQSA 3ACBA 5CHYA 3EH2A 5FBLB 3TIXB 1XCMA 2H4ZA 3I01M 3V4PB 4A0SA 2C96A 4DQ0A 3VPDA 4B33A 2KHZA 2PUJA 4WXEA 5JV5A 2JH8A 4EKYA 1J90A 5B53A 2O7SA 1YAJA 3LM8A 3HXOA 1RHKA 2CCGA 3AI2A 1RHUA 3AK4A 3OICA 1DFHA 2FPRA 1R0CA 2WB1E 4JQYA 1G7TA 4AI6A 3GIMA 3IJRA 3MXOA 3V97A 2H48A 5ADHA 1MRZA 3D8SA 1XXHA 3LPDA 4W8HA 1DG1G 5FULA 5IP9G 1N3IA 3DT6A 4YPFA 3LHDA 3I4MG 1LI5A 3PITA 1B6RA 5KT6A 4ONEA 1YRYE 3IAEA 1DCMA 2B92A 4LVOA 5CVVA 1PNOA 4BNDB 4NU6A 4JXKA 2RAPA 4YASA 5BMOA 4EW1A 3LMLA 4B4VA 2QV0A 5KTOA 4I1UA 1SOAA 5LA6A 5B2EA 3F2VA 2OB1A 1X74A 4WOPA 1TCUA 3OOWA 2CLFB 3QELB 2GD1O 3FGZA 4HXYA 5EMKA 4QTUB 2ONCA 3DL4A 1GPLA 3QV1A 3PRYA 3U09A 2QRZA 3F5MA 2HHCA 1DJQA 1CEQA 4GEGA 1RAIA 3S81A 1F2TA 1PQYA 4F4JA 4TL9A 2EL9A 5CT4A 1TXGA 1P45A 3GGJA 4RYLA 4RJTA 1BD3A 1B0PA 3JVDA 5EMHA 5FI3A 3S1AA 1IJBA 1GXSB 2W2VA 3FBWA 4KLZA 3TBKA 4AVYA 1L9KA 1E89A 1CZUA 1ZK0A 4M46A 1IN6A 4JR1A 5JWOA 1NJ5A 1E2LA 3EHEA 4RUKA 1Z5VA 1S96A 1U8YA 2H85A 4P32A 5KSPA 1QMGA 3WLKX 4R54A 2WJZB 1LNSA 4KODA 3GUCA 1QDUA 4TVBA 3IL2A 1OTXA 4JKOA 3LV8A 3UYYA 1D8TA 5B2FA 1V16A 3I62A 3GZTB 2WT4A 4PINA 5AJZA 1IOZA 2C2HA 2H9YA 4FFWA 4PQEA 4YBZA 1X0VA 2I3AA 1LDEA 2NO6A 2P3SA 4AJPA 5T6MA 1ZD2P 4M9RA 1MX9A 2BF7A 1IULA 4MA0A 5G4LA 3VAZA 5HX7A 3PDIB 2I2CA 1UH5A 2WKRA 3ZDZB 3OCYA 5A2QA 4G8CA 5CK4A 1VPLA 2A4KA 5T41A 3AIIA 2R44A 2GEDA 2Q3LA 2ZJ6A 4DZTA 4GM1A 3KZCA 1ZQ1A 1EKPA 3DTNA 3PC3A 5BN1A 3CLSC 1FNMA 1P2GA 1T9DA 1GQSA 3LFUA 5ALSA 4DR5B 2O1WA 4P84A 4PYOA 2UYCA 4N9WA 1JEYB 3K0KA 1J8YF 4J2OA 5D3MB 3RAPR 2C2WA 4Q7QA 3I39X 4V0QA 3WNBA 1KAQA 1UAYA 3X3HA 4P82A 3BFXA 1IHUA 3CA8A 5CEJA 5EZYF 1SUSA 5KTTA 2CLHB 3ACDA 3RRBA 4RLSA 1JPVA 4BGIA 5I4KA 4IKEA 2QUHA 1S2NA 2ICAA 2HSJA 4H77A 2C7QA 3BMQB 4OMDA 2OCAA 1LPAB 4FYPA 3DNFA 1V5GA 3PFCA 4C4RA 3U49A 1B33N 4EYIB 3KUDA 5EMJA 2WYWA 5LUBA 3UAZA 3OSUA 1UC9A 2RH4A 4BIMA 4WDRA 1Y8ZA 4DCGA 2HCBA 4R1PA 3RFTA 3GZNB 2AEMA 4O4LB 2BUAA 4NFHA 1KSHA 5EHIA 3L1HA 1P80A 3UKJA 1G63A 1WUIS 3OE1A 3AY0A 4Q00A 3FGNA 3PFWO 1C9YA 1GZ5A 2QVXX 4PO8A 3UBMA 2GN6A 1TJ3A 5JDIA 1EEHA 4RTKA 1GRVA 2P2CA 3P9IA 2CHFA 3R0ZA 1BS9A 3REOA 2XA1A 1YJ8A 2ZM5A 1U2GC 5DGBA 1ZD8A 4XKJA 3OSPA 5BXQC 3MMPA 4WOCA 3TUJC 4BBPA 1DBWA 1OKKD 1EFDN 3AVOA 3IAS6 2QMYA 3PBKA 1QDLB 4ECSA 1SXQA 5C7IO 4KGZA 2VTVA 2QRHA 3KYCA 3R40A 2X8LA 4S0ZA 4M6WB 2PSSA 3TNFA 2IBSA 3R3VA 4Q44A 3KE8A 1UBOS 3OAAA 5FUQA 3CO5A 5IH3A 4A0QA 2CJPA 4LC0A 5TXGA 1JAXA 4YCAA 5BWRA 2I3ZA 3ZXXA 1WQ4A 1DARA 2WA1A 4U2BA 3U13A 2BBWA 3K8ZA 3TMKA 3IVXA 4Z2AA 5FWYB 2G6BA 3PV0A 5BSFA 2JF0A 2ZCVA 3ZBUA 1HTWA 2ZWAA 3GJ4A 4FW8A 4PLTA 1D04A 2XTZA 4EPRA 1ETHA 4BPBA 4QBTA 5E9JA 2WI8A 3WYNA 3D7SA 4II7A 1IHXA 2A0FA 1O77A 1RHMA 2R6JA 3ZIUA 4DEYA 5LLTA 2E4AA 1DQPA 2AIRA 3BDIA 3P2OA 1NI4B 2YOGA 4IXNA 3L7BA 2GCEA 3IAAA 5KEIA 3OQVA 5GONA 2XADA 3N8GA 3OTWA 3E2MA 4PBRA 4XI9A 4DQLA 5IVPA 2HRDA 1J24A 2F7SA 2JLBA 3V8MA 4C4AA 1IY1A 1UPCA 1QIKA 3GJYA 2GPTA 5T3UA 4AZ3A 3U4DA 4O4HB 3WYGA 4HSGA 5KVQA 4C2UA 3IEIA 2WZQA 4FILA 4EKGA 4ETWA 2WV9A 3MTAA 1B1AA 1SXJA 4HDOB 1XEXB 4CYMA 3ZE7A 4CM5A 4J43A 4FB5A 2XNJA 2D13A 3EGIA 3TB4A 1VAJA 5LQJA 1JQ3A 4KGXA 4J3JA 2G04A 1P4HA 4QDZA 5TX7A 4H35A 3TOVA 2HU7A 3O93A 2DEUA 3F9RA 2JA7G 1W35A 4MGYR 2GN0A 1TKCA 5DHRA 3SHOA 2Y71A 4V0ME 4ALLA 3L07A 5TLSA 2NVYA 1WHSA 2Z43A 2ZJ2A 3CQ9A 4UM9D 1S0OA 3LQ2A 1U9ZA 2HBRA 1DJOA 4KUGA 4EHIA 5F2KA 3ZKWB 3U37A 2H7YA 2Q2NA 4KG7A 3TZHA 4I8IA 1WKVA 1XEFA 3GB9A 1YQEA 3GELA 4G1CA 3SICE 3VSAA 4BVEA 4AMGA 2GBPA 2ZSHA 4HNHA 3L4SO 4NDAA 4BFWA 1YFZA 4DIFA 4WBNB 4MMXB 4N01A 5ALXA 4C2BA 1PGOA 3E8SA 5EKXA 3KAKA 1S9HA 3L1JA 4HFNA 4XWWA 4UAVA 3NX4A 4WQMA 1P33A 2ORWA 3O3MB 3E5RA 3JZDA 4RTPA 5CA1F 5L3ZA 3ORHA 1Y33E 1X1SA 1SA0A 1KO7A 1LU9A 2Q1TA 2VBGA 3NWJA 4M8SA 4PPFA 1KO8A 5EJEA 1MD9A 2NSYA 3C6QA 1RP1A 3O26A 4N6OA 1E94E 1JA1A 1Z62A 1NPTO 3LIIA 2A9RA 3UMYA 1ZN2A 4PNEA 1N3BA 1PR4A 2WWXA 5BNIA 2BKVA 3FSEA 3ADCA 1N1GA 3GV8B 3EGEA 4PRYA 4BASA 2WQZA 2FTKE 3IQGX 3WO0A 1A96A 1BS1A 1T24A 2LXNA 5AOBA 5FOSA 4JEHA 2UXDB 3SG0A 2X3YA 4MR8B 4WY2A 1KMMA 1PJCA 5L3RA 1DWOA 3SOPA 2JJ1D 1D6MA 1X7DA 3FKSA 2ET6A 3WQBA 3V42A 1TVEA 2KW5A 1IOVA 2RC5A 2RH5A 3AFHA 5CURA 2CBGA 3GVIA 1QHFA 4JT8A 2NZ8A 3NHPA 3IVRA 5CH3A 4MA5A 3OU7A 3AQIA 1GG9A 4A2PA 1NJGA 4BFZA 1MPXA 4LF4H 2CWWA 3N86A 4TQ9A 3IS3A 3L7LA 3E4CA 4I4LA 3H7AA 5FNVB 2ZS7A 1ZAYA 1NUQA 4RU1A 3TGLA 2WSIA 2WUFA 5DQGA 2C5BA 4OV6B 4TTPA 5FIUA 1TVKA 3W9YA 4BX8A 4D8VA 4L72A 4W9NA 5JD4A 2RHOA 5EWGA 2BRUA 4JSTA 1U94A 2ZBPA 5KFDA 2AQKA 2Y99A 4PLVA 5HCNA 3W4JA 2P8SA 1K83A 1T8UA 2HSZA 4K86A 2H16A 3DZGA 3MUOA 5IHXA 2C9MA 2NYAA 4KREA 1UMDB 3HBLA 4I81A 2FKLA 4V3BA 3BDAA 1WCWA 1R5JA 4GOMD 1ZUIA 2BDTA 1DU4A 4H7DA 4HF7A 4BJ5A 3LDHA 3WJAA 3U7JA 5BW8A 2CVQA 5KYWA 2R8PA 4P7FA 4ETSA 1RWBA 3PE3A 5DNVA 4U0KA 3ZWCA 2ZSUA 1SCQA 1PAUA 2DPXA 4JJGA 3UWOA 4EEXA 4JXUA 5KFQA 1GV0A 3HCCA 5EP4A 4AS1A 3D0RA 3AVUA 3TLYA 2RHBA 3L6OO 1EX6A 1XTQA 1YGYA 2G8LA 3KAQA 3R44A 2CLOB 1XD2A 4IGFA 4FYYA 1TT5A 3BREA 3HDGA 3LUFA 3T1YH 1Y6ZA 3R6DA 5J5CA 1K3UB 1NBIA 3V6KA 1L5HA 1D3AA 5K0GA 4DLYA 4M1QA 4LF5H 3OHMA 2MT9A 3BJRA 1DMRA 1MDFA 3MFIA 3G3EA 2AC7A 1UAAA 3CONA 2CFTA 2JFYA 2Q3FA 3WAKA 4G0WA 5ALYA 3FMAA 2D1YA 1QZXA 1S02A 2FUEA 5EKDA 4NBVA 3HG7A 3Q8MA 1UP6A 2P68A 4RX1A 1ORTA 3UGJA 5E6SA 3G1UA 1KI8A 1SD1A 4O1IA 4CV2A 3AM4A 3F96A 2Q8NA 1P8LA 1K7EB 5SZKB 2W9AA 1JHZA 1PT5A 3USCS 2EKDA 1BDMA 1V3VA 2FPGA 3SQOA 3TY9A 2ZJ7A 3EBLA 3ZHSA 4ESEA 2Z2YA 3VPFA 3WLNA 5INTA 1JUDA 5GPBA 1E1DA 2A57A 1NLZA 4E6NA 1LQ2A 1Z56C 4D3DA 3BEOA 1TC2A 5EQJB 2NXNA 3N44B 5DG7A 2HPHA 3JQGB 3ROKA 3TSWA 3NTRA 4ECZA 3AU8A 4FM9A 2YHIA 1UMCB 2WMDA 3LXRA 3OFND 4YONB 3ASVA 4P35A 4BNIA 5AVUA 4R1SA 1LWNA 4UM9B 1A5BB 1WMFA 2IYUA 4MJLA 1ENZA 2JJ8A 2YZNA 2QAJA 2FZWA 5FR1A 5GVRA 3ZXSA 2BFWA 1UFQA 2P2LA 5ITWA 5LYJB 3ZY6A 3ADBA 5ALZA 2ZM6B 2XDYA 3O4GA 2QX9A 4LYHA 1A95A 1BFDA 2YJZA 4HPXB 4A26A 1CU1A 1R15A 4A4DA 1RR6A 4A8HA 1GO3E 1TMKA 3WL7A 1Z6XA 3CURA 1T8PA 1TEXA 3Q9SA 3HKZE 3CF2A 1CJVC 4PAWA 2CUZA 4MPTA 4U6NA 4NYJR 2HOQA 3R5SA 1JEQB 1D1TA 1KQPA 3D6HA 4MIYA 2Z5LA 3AUAA 4I1YA 3IPRA 4KITB 5IKPA 1W5EA 2PWAA 1O08A 4MPDA 1U8FO 2I8AA 4QXMA 2J9YB 2QS9A 4TLCA 5IDYA 3HL0A 2H2WA 3ECCA 3MINA 2AMYA 2EFEB 2WOJA 1JIVA 4MKRA 4CFZA 1IU9A 4IINA 2GF2A 5JDCA 1G2OA 4URZR 4D92A 4DPMA 1QG4A 1FNNA 2HIGA 3JSLA 1ADBA 1GTJ1 2YBDA 4X6LA 1W2WB 3TUZC 2HF7A 1QGAA 5UKDA 4AJHA 1XALA 3BIOA 3AHIA 4FBGA 3I1YA 4MB2A 1ISFA 4FYXA 1KR2A 3RYIA 4UXHA 2EZTA 2V98A 4ER6A 1N5DA 1CV2A 4D74A 4ETNA 1UM9A 4FGJA 1XZFA 4GR4A 4ZVNA 1NKSA 2VF8A 2ECPA 3VR6A 3H65A 1R50A 3KQOA 4BWFB 3JQBC 1ZEJA 3NUQA 5K0BA 3S29A 2R7KA 3KTOA 2Q3BA 3OPYI 3JAKB 4TV8B 4LF6B 3MTEA 4Q24A 3T54A 3UYLA 4CIXA 3TOCA 1F51E 5TF4A 4Q0YA 1OU0A 4WADA 4XASA 3IC5A 2SBTA 1X86B 1QOPB 1L8AA 3A6FA 3L01A 5H02A 1Z5NA 2Z3VA 1U0JA 3F3MA 3K1TA 4KN9S 5DM1A 2PUFA 1RKVA 2AEJA 3SEQA 2BTQA 2D4AA 3PWSA 2IH5A 3VR6D 1XB2A 1SCJA 2WAAA 4P4GA 4U6QA 3L0IB 3WGZA 5LDHA 1KETA 1ZW6A 4F4ZA 3L05A 4H1VA 4MUBA 1ZCFA 1WPQA 2IGTA 1DKRA 3DOFA 3RRYA 3CVWA 3ITDA 1X1AA 2C5SA 5T8KC 5CX4A 3TSAA 5IJWA 3MMNA 1U8UA 2HUPA 1ZM7A 1HQCA 4LJ5A 1D9XA 4PZUA 2XCSB 4K6FA 1XAJA 1OX6A 2CLCX 1TTHA 3IP9A 4FOOA 5KYXB 3S2UA 2CXXA 4MLPA 2ZWIA 4E22A 4EL5A 4OX9Y 2WD7B 2WDZA 4LI3X 4U7FA 5LXTB 1FFXB 4YMUA 4EUFA 1J2EA 1H8ED 5K6AA 3FBTA 4CHGA 2Y9PB 2G28A 1DUSA 2BEWB 4HX9A 2H1IA 3N76A 1CQZA 1DKUA 1JDBB 3HEMA 1CVIA 4AURA 4LOHA 1P29A 1GGOA 3OWHA 4XIIA 1LI7A 3PQEA 4OSPA 4D0GA 2VQDA 1XE3A 3B5EA 4CLDA 2NUBA 2C0QA 1J5EB 2XCOA 2A9PA 5ALGA 1KMQA 1OZFA 4HP8A 4HTFA 2OBFA 2BSXA 1AGPA 1FFXA 3EDQA 1ORIA 1VBMA 3B36A 1PEYA 4YLYA 3F8WA 3H2IA 3D3JA 4RTJA 2GJKA 1X80B 1MC5A 1NXOA 2WJYA 4OGKA 4XDHA 5GY7A 3EPRA 3COZA 4Z0PA 4PN7A 5CB4B 5JNVA 5HF9A 2QJOA 4HNUA 1AKUA 2ZPAA 1MAAA 3PXEA 4OGGA 2HU5A 5SYNA 3RSHA 1ZM3A 4CR7A 3OUTA 1IWBB 2AUNA 3EY4A 4EO9A 1ZHOA 3G8YA 1SN7A 5I7AA 4RZ2A 2WG2A 3PG5A 5CVJA 2VUGA 4JVNA 4O2BA 1UWCA 3B38A 1Q12A 4HQKA 1E77A 2QYHA 4XJXA 3SQNA 4P3YA 3EK2A 5JZMA 2BMEA 4ZYZA 4RC9A 2GPSA 3GCDA 5J4KA 1CD5A 1QJ4A 1U1EA 1ZXXA 2FFQA 2ZS8A 3NYRA 1GD1O 4CG2A 2DB3A 3VFDA 1TQDA 5E3JA 2CZGA 1J22A 2HD4A 2GZ3A 2ZYDA 3AKEA 4UZFA 5IJ0B 3MNFA 2DLCX 5KG3A 3H17A 5JG7A 4YI3A 5IAOA 3GTMA 4YJ2A 1LF0A 4U7CA 2QD4A 2HBQA 3BMCA 3L0BA 4UEJA 1DS6A 4J9VA 2HF9A 2WVGA 1G6KA 1YZKA 4H3SA 4HEJA 2DTDA 4IJWA 4IOJA 1WJGA 4MI1A 1N34H 5TSDA 1IEQA 2DFTA 2RGNA 4RPCA 2EFYA 2HC9A 3PUIA 1EBFA 3LUJA 1PHPA 1OX4A 3TPZA 3V7FA 4JVOA 1ZN7A 1L4LA 3ZJ5A 1AURA 3I64A 4I14A 4ND4A 3FMPB 4FFMA 3OQPA 3ZGLA 3BCUA 3F3KA 3HJFA 1PW5A 3A06A 1KJYA 3T52A 2OHOA 1PR3A 3QLTA 1XDBA 3GMTA 4FFBB 5CLHA 1ZRMA 1X80A 3VKWA 2A3RA 2P1ZA 1K7YA 1GSIA 3LTEA 1VL1A 4OYYA 5JD5A 3IJEB 3UM9A 2W7TA 1VRWA 2VFAA 3A4YA 4RABA 1FYEA 2CL7X 5ARDA 3T5TA 3PTZA 1JFRA 1XP5A 1ZVJA 4CLHA 4YFVA 3RTAA 3OEEA 2MSEB 1SJ9A 1YNSA 1PRYA 4RHEA 4TM8A 4DUPA 3MJCA 2FVYA 3NH6A 1LLCA 3LTNC 4HR7A 3SAJA 4DDWA 3MCVA 2JIZD 4M7OA 1CE8B 3RC1A 3WKAA 1E8MA 3WS7A 1OOEA 2KB0A 5K0ZA 2B9EA 2BDUA 1RZUA 4I8DA 3VR5A 4K7JA 4P5PA 4IUBS 3CNLA 1ZR2A 4WX2B 3WK4A 2FZLA 2QMOA 2G67A 1A9PA 1CY8A 3W7AA 3LC1O 4O7TA 3ZOZA 3I2GA 5AW3A 1EJBA 1UMCA 2NXEA 3TOXA 4FR5A 4O0MA 1RM0A 4YREA 1SXHA 1KEUA 2QRVB 1CB7A 4NFSA 4XM2A 3BIWA 4K3UA 2E48A 1C9MA 3MMZA 1K4KA 1XCLA 4ZK6A 2Q3JA 1OH8A 1ISGA 4YP5A 3T1OA 4IXTA 4MROA 1DHRA 4JX8A 3EYAA 2FSFA 4WKPA 4O59O 3ZYZA 121PA 5AQ1A 3FG9A 3B2EA 1K8XB 1JR3E 5EZ6B 2GRUA 4LMBA 3ZDFA 3K31A 5M7EA 1O0CA 3VVLA 4BKUA 2J67A 2YZMA 2NT4A 4G4SP 1UF9A 1ZIYA 2GTPA 4UEKA 4KTVE 4MJ7A 3KHUA 2X0EA 2HWUA 4MV8A 4GSKA 4LF7H 1NFFA 3PP8A 3ZD9A 3SC2B 2PLAA 1JBKA 1FS5A 4YRBA 2AGOA 3G79A 4RB3C 1FZQA 3D0QA 3LGSA 4RKQA 1IN7A 1PJRA 4XGIA 5CLIA 3A58B 3QVMA 4B0OA 1RJFA 3VNSA 3JXEA 4YUWA 4JGBA 1NY6A 3BZWA 3OQHA 1R5BA 3QLJA 1WHTB 3ON5A 3A9UA 3Q15C 4RFSA 4RPGA 4JR0A 1K8RA 1EM8B 1P61B 3RYCA 3DPSA 4L4XA 1A77A 4FDLA 3O9MA 3JATA 2AFVA 3KPVA 4M1TA 2HQ1A 3ORFA 3Q9LA 4RVGA 3FIUA 2W98A 5A04A 3PJDA 3UG6A 3IGFA 3RKRA 1T10A 3F1KA 5CM9C 4BQEA 1DAKA 2MSWA 4IDDA 5GOTA 4P8RA 1IQUA 4HGRA 3DEHA 4JJEA 3JQFA 2OP1A 1ZEMA 4Y1GA 2C99A 1XAIA 3MUFA 4OXRA 1E6EA 3ZK8A 2FWBA 1HGXA 1SGWA 1Z0KA 4A2CA 3K9FC 4CEJA 1SVKA 3I9JA 5EEGA 1RQLA 3L1VA 5HILA 3RIZA 2B8NA 3JQ6A 4FXOA 2IIBA 3IEKA 4D3SA 1G8KA 1D2CA 1NQXA 3NIGB 1B8UA 5JNSA 1DBVO 2Q7OE 2YJ6A 3R9WA 3A1DA 4HNTA 1IEVA 4KXXA 5IU6A 2UZ3A 1A9XA 3PUYA 1SOWA 1VLZA 3EPIA 2QMUA 2ZRLA 3TBFA 1AMNA 3L7MA 1AHIA 1T9BA 4J76A 4CT5A 5DG8A 3N40P 1O96A 4NYIQ 4YMHA 2FG5A 4CF4A 4KLNA 4Q48A 1XJ5A 2OGZA 4IIJF 2W0SA 3L5OA 2WJGA 2HBZA 3AXTA 4HFJA 3D2AA 1VTKA 2JIBA 2ZRGA 4F56A 5FDFA 3ZDAA 4G1MB 3DTVA 1GNLA 1FFEA 4OO3A 2V58A 2JZNA 1G3UA 1KVSA 1U0NA 2ERYA 2VP4A 4H2DA 4JVLA 4KXWA 4LWQA 3WBFA 1E0DA 1FXSA 4U1RA 4QOEA 5LQSA 3WVNA 1V7ZA 1Q7GA 1V71A 3BXOA 1MX3A 3HH8A 1J06A 1B43A 1GNPA 2GVNA 4R1UA 4WZAB 4QREA 4DC0A 3VVBA 3KIPA 5JZOA 1YR1A 2N42A 3NTVA 3EZNA 4O83A 1RMQA 1S8AA 1TK3A 4KR6A 2CNWA 2P6PA 3ZW9A 4MR7A 2GTIA 1DPGA 4XTRA 3O38A 2QQEA 1QUFA 2BZ0A 1MO5A 3DXXA 4GZ3A 4RMIA 3VR1A 1QVRA 3RS0A 4QULA 1DAFA 1TO2E 3I0NA 3M9XA 4UU8A 3FHCB 5DCYA 3SFZA 3TXAA 1Q3TA 1DAEA 1YZYA 2G3YA 4Y67A 5A5VA 5ITSA 3WAGA 1HRDA 3DE3X 2PX8A 4WW0A 3UMCA 4R81A 1WCIA 5FWYA 3DM9B 1FFYA 2ZVJA 4RA6A 4UU1A 1IIBA 1Z4LA 5TPWB 1NRWA 3SC3A 5IZ4A 4II3A 2IGBA 4Q3EA 1E1CB 4EFMA 5ILOA 1BWSA 3LHIA 3KV3O 4OI4A 1GR0A 4JL8A 4IX9A 4ND6A 1VDMA 4ZU6X 4CEIB 3GJTA 4IYRA 2P5UA 3T3DA 1NLUA 5LVAA 4GEKA 4CMIB 3MBOA 4MVWA 1G3QA 1N9ZA 821PA 3KL2A 3N3BC 2AD5A 3DCNA 4JVMA 2B7CA 3G2OA 3RRNA 3NYWA 3GK3A 1AN9A 3MPUA 4DE5A 2JZOA 5I7VA 2P9EA 2IE0A 3AEKB 4X60A 1ISSA 2CLSA 3DLHA 4L76A 4EX6A 1YOVB 4ZGBA 1PZNA 3ZE0B 3I0ZA 1NPDA 1TCVA 3DXFA 1QF7A 2EP7A 3FDZB 3WMGA 3ZNOA 1E3JA 2PBFA 2XE7A 4AM8A 1LK5A 2VHQA 1YDGA 3I05A 3JALB 2JIMA 3TLGA 4Z7JA 4ZVOA 8ADHA 5BT8A 4GNKA 4JLWA 4J4TA 1XX6A 4UW9A 1U1FA 3SZ3A 1Z25A 2DIKA 2FOXA 1EQ2A 2PFSA 4O3FA 4DLBA 1CR4A 1PVDA 1C9KA 3AHCA 5BR8B 3LQQA 4DDUA 3LLVA 4D3XA 1Q83A 3C0KA 1K8QA 1Q44A 3RR2A 2NW6A 2D5IA 5KT5A 1X39A 2CMKA 2ZE8A 3CX3A 3PWKA 3DD5A 4GPAA 3KTDA 5P21A 3RYHA 5JD6A 1CZHA 2VK2A 3H2HA 2J7PD 1Y14B 4RM2A 1AKTA 4NPHA 2Q6LA 3FNHA 3O8BA 4BVFA 4RZRA 3N43B 2ZJYA 3HKEA 1UXIA 2F67A 2WIBA 3TYXA 4HK4A 1GGEA 1WQ1R 3FAZA 1L4NA 2VPSA 2XWJI 1SUCA 2JARA 1ETUA 2GFQA 1UBMS 3T9FA 5CM8B 1UBHS 4HAUA 1X1EA 2QN9A 3A4VA 1ZK1A 5EPUA 5IWAB 4HPJB 1QHIA 2ST1A 1VIMA 3OZBA 3UTCA 4AB1A 4BB6A 1MN6A 2RGCA 4L5CA 1TAUA 4X62H 2FUNB 4UTOA 3B3GA 5A4FS 1EVIA 2FG7C 1REQA 3DL2A 4OJKA 4DL4A 1QP7A 5E4FA 2ODNA 2JI6A 3GJSA 2AK3A 5JZVA 2YJ3A 1XTBA 4HNGA 2HMSA 3DZHA 3ZS9A 3FPKA 1OKKA 1UDXA 3I5YA 3PEWA 1FUIA 1VGQA 3OOJA 3Q3CA 4D6XA 1T94A 3SI8A 3DTFA 2A5LA 4Q7LA 5IRCD 1L1EA 1U0OC 5DTRA 1C14A 2PV0A 1HL3A 1CSEE 2PK3A 3K6RA 5DGTA 1UQRA 3SYTA 3V3TA 4KQEA 4PEVA 3WSTA 3U31A 1M2JA 1M66A 1D0VA 2XNHA 3HEAA 2Y93A 1H42A 2EDAA 1DQZA 1W44A 3H7IA 4DWWA 4LBZA 3I28A 4ZI7B 1GY8A 2HLHA 5E38A 2X7JA 4ZCQA 2GPWA 4TPKA 2XEXA 4N49A 1DX4A 2GK7A 2E82A 3U5TA 2CJXA 3SLRA 5HTKA 4CHTA 2PMZA 1TT7A 4M0KA 3NBKA 4NCHA 2GRJA 1DFIA 5I5XA 1O4VA 1I01A 1Z08A 5ALVA 5CVTA 3HJGA 3IUMA 2NGRA 3OJ0A 1ZBDA 1Y3AA 2PKCA 1W7AA 2CZQA 2GJ4A 3D4LA 4O7ZA 1JS1X 3E0QA 3EWIA 4WSOA 4WN9B 3UWMA 4GMFA 3RBVA 4AUNA 3EEYA 4RV4A 2ABWA 3M4YA 4LI0A 2OPBA 3A70A 3EIFA 5HNKA 3BOSA 3WNCA 2N1BA 4J0FA 4RJLA 2J9FA 3ENZA 2CEAA 4O3QA 5FPTA 3T5CA 3X2FA 2QDXA 3HJHA 4I50A 4UBMA 3NEAA 5BY2A 3IUJA 3PR3A 1XZKA 4AJKA 4X91A 4IMRA 4BNFA 3EEOA 3GP8A 1T2FA 3QIVA 1R16A 3E82A 2X2EA 4GUAA 5G0WA 4B3FX 5F3WB 2EEPA 2FW1A 1UL1X 4RUAA 2G0AA 4LKOA 4DCNA 5IMSA 1XU4A 5B3KA 1T1EA 3K0AA 4KO8A 5AI9A 1JFFA 3PKZA 4FNAA 4G0NA 5HOQA 3AUXA 5AJHA 3PZPA 2F3QA 1FS4A 1KEKA 5DK6A 2A6PA 3PR2B 3VH1A 4FJ2A 4O2AA 2GZRA 3ROTA 1IBCA 2ECKA 2CD9A 4BQIA 1E61A 2WWGA 4H31A 3A2NA 1YV9A 4Z3OA 2FV8A 4DJ5X 1A3CA 3N07A 1SB9A 4UCTA 2H2FA 3PDWA 5EXXA 4WBNA 1J99A 1Z4MA 2AYZA 2CHQA 5JOQA 2ZT6A 4XGNA 1KVTA 1M73E 2IDZA 5EMMA 1T3LA 2GKSA 1X9IA 4GSLA 3PRKE 4PHTA 1LSSA 3KD2A 4L6CA 7ABPA 2JDID 2CXNA 2QQ5A 3B12A 2QAGC 3D59A 4L7QA 4HQ6A 1BGXT 4MQUA 3QA3E 1PJLA 3EZ9A 4JC4A 1W0KD 1A0IA 1OXVA 5E1OA 1BU8A 5KG0A 2P9BA 5KFXA 1JX6A 2XDQA 4DV4H 3AJRA 3CH7A 3GWGA 2HMTA 4Y0NA 5FFNA 5FR2A 3DFFA 5TPZA 3SIRA 4KWCA 1SU7A 2AJCA 3DB2A 3A2MA 421PA 1KYTA 1BXKA 3PVZA 1PD0A 5DMHA 1DC8A 2M1ZA 2FZKA 1XN4A 3OKFA 5I5TA 2VQEH 4HDSA 4Z4QA 1DAPA 3R3ZA 4F04A 3OOSA 4NLGA 3KHLA 1NN5A 2EFHB 2DCMA 2VQ3A 3JAMA 3IKMB 4JC5A 3NAQA 4U7DA 2F3UA 4AXBA 1AGXA 2O0JA 3E3LA 1H5QA 2VPYA 4EMTA 1W36B 3RE1A 3AFMA 4FN4A 2I67A 1N2ZA 3EIHA 1L7MA 4INOA 4D46A 2XT9A 1K4MA 1P0PA 3MBIA 5DX8A 4M53A 4NENA 2UXDH 5ILQA 1JFFB 2WFLB 2PX4A 2Q5CA 3QQMA 5FOXA 5IF3A 3RHTA 3O0TA 6Q21A 1LLQA 1MO4A 1RD4A 1CY2A 1LX6A 4IJVA 4L27A 3U3ZA 5ISMA 4LHZA 4V0RA 3JQRA 2QTRA 2AE1A 5I8WA 4FWTA 1MGOA 5DLFA 1P3Y1 2RGXA 4DSOA 1R0ZA 1NOKA 4X9XA 3NKVA 4A3EG 4BEVA 1CUAA 2VDWA 3DKPA 1WCYA 4DMRA 2YICA 3GUUA 4YRPA 1VFNA 1C7RA 1YRLA 2ZYHA 4PY2A 2ENUA 3BJZA 4ZT2A 2ODBA 1ZOIA 3WRXA 4CM8B 1YS7A 2Q3HA 2VS1A 2D0OB 4FJ0A 4ZOLA 1N2CA 5JMTA 1LPPA 4WESB 2GM3A 4I50F 2AQHA 5HVNA 3P1JA 4Q9AA 2ZAYA 2W4IA 2WJVA 2RJNA 3ZIAA 5AUOB 5MFPA 2X76A 4FCVA 3V2GA 4X00A 1IAQA 3AF2A 1DX9A 3ACCA 3RCBA 5KHOC 1XLWA 3NTOA 4E46A 2QSZA 2VHTA 1JHAA 2F9FA 1GR1A 1INLA 3IN5A 1CCWA 2IQ5A 2AW5A 2YJGA 1QE3A 1HEUA 3MWYW 4LQ4A 5TE9A 1EXMA 4Q8FA 2B4QA 1AGRA 1IPHA 1U4OA 3RS4A 3TPFA 2PUEA 1J0EA 1PT7A 4NJEB 1UDCA 2JASA 3VXKA 3OMLA 4F6RA 2DHEA 3BBLA 3TZCA 4UHKA 1G18A 1IBLH 1V4YA 2BH9A 2O1SA 2VPTA 4QYIB 3DL0A 4UVHA 4F1WA 4X7RA 2X0FA 4I3HA 5C4IA 1WMEA 1YRAA 1HO3A 3O95A 4Z7QB 3SLGA 4JQCA 1GUFA 3PR5B 2HJSA 1R4MB 1IY9A 1AS2A 1P8AA 5F9NA 2QRLA 4KV9A 4H18A 1KIMA 4RA6B 3DZKA 3VVCA 4B0PA 1B8OA 2E4YA 2LCFA 3H1AA 5G0SA 3TSYA 3RYFA 3T1YB 4JI8B 5FPOA 1GNSA 3ZX4A 1ORWA 4OI2A 4CN8A 5EXTA 1NIPA 4FDVA 3AMVA 2QA5A 4UPDA 4D82A 3ANTA 1AJEA 1E3WB 4LF5B 1DRVA 1N8TA 4LBWA 3LLMA 1ZSVA 1O5OA 2C2YA 4OXIA 3KVNA 4B3SB 3H2YA 1QHGA 3GHYA 2IP2A 3INGA 3CZQA 4PS0A 3G5TA 5EIOA 4NYMQ 3SX4A 2XKKA 3MC1A 5CXSA 1ODFA 1DOAA 1LA2A 1T5DX 1WSDA 2CYAA 2OD9A 3KXDA 3QU7A 4GKAA 1RI2A 4NFYA 4ARSA 4OLJA 4NEGA 1YONA 3BD6A 5I5SA 3D8TA 4TTRA 5TJHA 4UASA 1XHEA 1YCDA 2J3DA 4YRKA 1EP9A 2HPZA 2DABA 1VGVA 2G1AA 2IA5A 1I1HA 2YXLA 3GNQA 4KQXA 4M1SA 4NP6A 3PHJA 5FUVA 1UMBA 5EA2A 1U2QA 2D7DA 2O3JA 4W6QA 2NZYA 4KN6A 4FYVA 2QL6A 3H9QA 2HIVA 3TS1A 2O54A 1EE2A 1M7GA 3QZ7A 1OWOA 3QQPA 2WRZA 1ADCA 4YP9A 4ZHQA 3CVUA 5CYPA 3KLBA 1PJ3A 2VT2A 3KRTA 3OU6A 5H3LA 4CXMA 2W6QA 2P4EA 4G4IA 4LA4A 5JZBA 3ADOA 3CVXA 1P3JA 2H4XA 2PT5A 3AVWA 1T2CA 1J5PA 1VL6A 4NBRA 3FPSA 2WTXA 4NBKA 1P17A 1RT9A 2PV7A 3LWDA 5DNEA 5A5DA 3MRTA 4IILA 4UDNA 1YUBA 4EF5A 1J1UA 2OO3A 1HYGA 4OP1A 5E7JA 2QBYA 1SQ0A 5JYEA 4CQNA 3WGOA 3L06A 1OA1A 3RWMB 4JB0A 3LKDA 4KQMA 1KWGA 2TMGA 2X9GA 4A8PA 1C3VA 1KR5A 2ZKLA 4WEQA 2QY9A 1WUJS 1N6IA 2ZRCA 5CX1B 4FOSA 3EUAA 5AM5A 1I2ZA 1RJPA 3SFTA 3H4BA 2RHDA 4L3WA 4JFAA 2RHHA 4ZOCA 2EVWX 4LY6A 4MEJA 1IBKB 4I4NA 3PX7A 1WBJB 2W9BA 1DOZA 1FX0A 3NRBA 1DQYA 5KT3A 1JT9A 2ASVA 5KFHA 4IHJF 4ZQFA 4B3JA 1ULUA 4B45A 2PH3A 2B36A 2OQRA 3UWDA 3ZQJA 1OZGA 1PGJA 2JA8G 2WTMA 1THGA 4ZXPA 1QCDA 4F8EA 1P9RA 3CYFA 2VWGA 3QFHA 5HTOA 3IT0A 2BBOA 2JRCA 3S40A 2CEKA 3ZDCA 3CSWA 1ZOSA 1J8QA 2GBCA 4P80A 3Q7RA 4Q93A 2K87A 1TUGA 3SM9A 3WL8A 4AG5A 1JHPA 1TIBA 1IHOA 2JJQA 1L4BA 2DWQA 3HU1A 5FUXA 4AS3A 4DNOA 5BUQA 4F21A 3I61A 1YR7A 3KTFA 2ZXFA 4C7XA 5LQDA 4R2WA 3TFOA 1KZ7B 2ZSFA 1JFLA 4KDFA 1GFSA 1R12A 4LQCA 1K1EA 4KIGA 2XZDA 4MTLA 5KIAA 4GL2A 2AG0A 2OY0A 4X8OA 4B6JA 4XRGA 3H83A 5LQUA 3QBDA 4RGBA 3TJZA 3A6LA 4UBOA 1TW2A 3TEKA 4BMVA 5HXAA 2GEFA 2WWYA 5F4BA 5AVWA 5L53A 1CFJA 1NY5A 5ALRA 4I08A 3RC9A 1IOWA 1GEEA 1Z38A 4GL4A 5EZSA 1OXSC 4ZV7A 1OLSB 3KJXA 4Y2GA 1S0NA 1XNQH 2ZTUA 2ZI5A 5ADUS 2FZEA 1EFPA 3S5UA 2PLNA 3ZE1B 4D81A 1EAYA 3BXHA 2H0RA 4Q7JB 3EBPA 3R5JA 3U3JA 3ZW7A 1JKIA 4XD7A 2LE0A 1MXHA 3AR6A 4GBJA 3SP1A 4JMLA 1AN0A 3FFXA 3JX9A 4IHKA 1E9CA 1SUAA 2SKEA 2Z95A 2VZEA 1Z5GA 4NESA 3RFCA 1PGQA 5FL3A 3UXEA 1RPZA 3WMEA 1B15A 4ED1A 1MJGA 3GJ3A 3LPCA 1M1YE 2FE3A 1Y3BE 2PKQO 2V97A 2WHRA 2WJPA 5KFZA 2AW3A 3QBJA 4TMTA 4D43A 5IUJC 5KPJA 4BLVA 1E4YA 4QATA 2UDPA 3V34A 2YHAA 3F4LA 4WACA 3P0EA 1R66A 3TAUA 4F3NA 5A9RA 4N3GA 3WL3A 2QLFA 4OOFA 3IT1A 4LE2A 5HJ5A 1FFAA 3OWXA 1JDPA 2OORC 2R87A 1J5EH 1GCOA 4MW6A 5DTQA 4TYWA 2H57A 3HA3A 4POAA 3AY6A 3OEHD 2IUYA 4ATNA 4JJFA 4FI3F 4IYJA 3ZVRA 1I3CA 1PFQA 3U6KA 3EODA 2H2HA 2ADFA 2H51A 1WAMA 1W4CA 4Q21A 2V9PA 4A9AA 3RU2A 2PX2A 1WOMA 2WU0A 2PUCA 2JFFA 4JI3H 5HQJA 2XVAA 2ZT7A 4DCCA 3ADKA 1FLAA 3N59A 4RS3A 5KYTA 4D3ZA 4HMQA 3FI9A 1RBMA 4RNMA 1PFVA 1LSUA 3PQ3A 2WKQA 4IR7A 4X8LA 1Z2OX 2BMWA 4PSAA 3EYWA 3FOWA 2NPOA 4HVLA 1WL8A 3IT3A 4ZOEA 4IXWA 2HDNB 2V4RA 3MW8A 3T34A 1SURA 5MGBA 2GVDC 5MHTA 2XMDA 4DAEA 3TH5A 1MABB 1T4CB 3KELA 1W30A 1HZJA 5TPZD 3OETA 3WB0A 3ZV7A 1Z4IA 4CT0A 1N2EA 4E09A 1E92A 1GUDA 4L16A 2R1TB 3TVTA 1B73A 2WUGA 3QEOA 3OCCA 2HEIA 4GC7A 1ZZEA 4J2TA 5BWXA 1ENYA 2PGXA 3M6VA 3Q5EA 4PO9A 4CR8A 1UOQA 721PA 4HX2A 2JDIA 1H94A 2VHWA 1CWUA 3KBOA 3OKCA 3PQFA 2B63G 3CPSA 3JZ6A 4FFPA 3KZMA 3LSYA 4O0LA 1NBME 4ZEOA 1IONA 4O5AA 3AFIA 4ON9A 4RPIA 4EA6A 3K09C 2VQFB 3GRRA 2EU8A 1PX0A 2IPXA 2ODWA 1EGAA 3TGPA 2Y2VA 1XFDA 1HMYA 1EZ1A 2YMQA 4ZCSA 4BO5A 4ENWA 5HRUA 4Y8VB 3JAKA 4Q9DA 1PLJA 5CE8A 5EE5B 4MA4A 3PVXA 5SZJA 2PSDA 1Z4NA 3J7TA 3RWBA 3THWA 1RXYA 4FC7A 4HYKA 4O08A 3KPWA 4OAQA 3TEMA 4BNDA 1VA4A 1BEEA 1Q91A 3GFFA 1CT9A 4PFQA 2ECFA 3LBFA 1BG6A 4NX2A 3CMCO 3PNBA 1QVWA 1SU6A 1Z22A 3HYSA 1YR9A 3PJEA 1O9BA 4EO7A 4R2LA 3G6WA 2BFFB 1GUZA 4S1OA 4BAZA 3KYDB 4HN2A 2W43A 1L7EA 3BA6A 4PR0A 5C8YF 3PC7A 1JWAB 1YQTA 3JASA 3I8SA 1YVEI 3C8UA 3PNLA 3H11A 1G98A 1H2FA 4RF5A 3VYWA 1G5TA 3F6YA 4R9SA 3DH0A 1ZX1A 1Q77A 3UXYA 1ZGHA 1WD5A 1SVMA 2WYHA 6PFKA 4R8RA 2GEBA 4K5QA 3GIQA 1UIMA 2OVFA 1EP3B 5DGXA 4LYJA 4L6IA 4LVUA 4URYR 4EVSA 4CIBA 1UBJS 2ERCA 3ESBA 5F9HA 1GKYA 5AD1A 4EFDA 1HK7A 5EIFA 1BFUA 3GBPA 1QX3A 1DTWB 5CFMA 4EGFA 3GW8A 1ENOA 4IV8A 5L8VA 1P7WA 5KFVA 4MHSA 4QPZA 4QFMA 5T7BA 1AQLA 1I0IA 4JJ8A 4EW2A 3MUEA 1M75A 3QVTA 3SSOA 2ZFUA 3SGIA 4BFCA 2UVPB 1N0IA 1Y8AA 3WWDA 3QNMA 1VCHA 3WNQA 4D6PA 3K9NA 3MWEB 4HUJA 2I4TA 4Y2VA 2NYRA 5B1HA 4C4PA 1RLJA 4EA9A 9LDTA 1QX4A 2PIDA 2R1UA 3AT1A 3R9XA 1DWUA 2ILVA 3S3TA 3STTA 3BB3A 4ZRDA 4CUKA 4JJ7A 4V1CB 2WDPA 2ATLA 3LT5A 3NKLA 1JHVA 4I36A 4QC2A 2GUGA 2VDKB 4P86A 4F2HA 3KV1A 1JAZA 2CB9A 1UADA 1OFIA 5L4LA 2NTVA 4UVEA 3CJRA 3PIDA 5G4KB 3X0DA 1TD9A 1MP0A 2F1RA 2O6LA 3A1FA 3LX6A 4IMJB 4ZC8A 2CVPA 3TRHA 2DY1A 4YUAA 3BL6A 5AM2A 1XXHB 4PYNA 4DR6B 1KJWA 2C4MA 5CNMA 3U2QA 2FK1A 5CVEA 2VXYA 2H1CA 2P6UA 1H6AA 3AV0B 4Q9HA 2CV1A 1PDOA 3HGQA 3JZIA 3BSWA 4Y98A 4INPA 4ZV9A 1YQ9A 2NN3C 4NMHA 1FUEA 3CLSD 1E9FA 1IBLB 3LZDA 4JUFA 4Y6PA 1ZY2A 2G7MC 2XAUA 3W6UA 4HWRA 1H2YA 3SKXA 2D1TA 3O84A 4YV1A 1KMHA 2LWIA 4HKTA 2V7VA 1Y6RA 3FMVA 3QELA 1T2UA 1ZYUA 4WL0A 1I7NA 2YMLA 2FWPA 2FR8C 2PKWA 4PLHA 1L3IA 4FYHA 5IASA 5JAIA 4QXAA 4CMBA 3FF1A 2YRFA 1SC4A 1K75A 3VZDA 3FFBA 3TBHA 2WIFA 3WGTA 4CIDA 5D6NA 2QTCA 2RGEA 1D7AA 1RTTA 4MWGA 4KPGA 2BR5A 3H86A 4OKIA 2Q7XA 2X0JA 3A14A 3DCYA 2HF8A 4A2WA 1P0IA 3I09A 3ABRB 1A27A 3C1UA 3DAYA 4ZODA 3Q0EA 2GX6A 5NLLA 5CCEA 3QWAA 2EHJA 2VT7A 3FNBA 4Q4JB 4D9GA 4Z49A 3N2NA 1XJ0A 4TX1A 1JJAA 1HFEL 1N36H 2OCLA 4MQBA 3L2OB 2W6ID 4Z54A 2QYOA 4WLEA 5JFTA 1XBTA 3K3VA 2ZS9A 1ZD5A 4AWAA 1A9OA 1BMFD 1SM4A 2J3LA 2P78A 1AKQA 1JYFA 1D0IA 4M98A 1VP9A 4RIEA 5JD3A 3W5JA 5B6JA 2PGDA 4W99A 4YJHB 4E2FA 1N5LA 1E7RA 4D7AA 1PDWA 3LFTA 3AEXA 3D8HA 4OYRA 4U00A 2VHVA 1AXGA 3S99A 1F8YA 1VXRA 4GE3A 4EJ6A 1X8JA 3EGXA 2G5GX 3NHZA 1ZNXA 4INAA 4UJ3A 4WY8A 5F73A 2K5UA 4BMPB 5KWEA 3AXSA 3FNRA 3T5BA 2GF0A 3HXQA 2ES4A 3I04M 5HPYB 5JMWA 1M3SA 3EULA 2XGMA 1GHTA 1I14A 2QGNA 2JGDB 4MHTA 2CVZA 4CMKA 2YS6A 3B2QA 5CT5A 5ALWA 3NETA 5JVLA 4DJJA 2GZSA 2QTAA 1Z4OA 3N3AC 4CMHA 3Q4GA 3ZHOA 1FNDA 2VP3A 3LS2A 2GZHA 4RA9A 3UHFA 3QYJA 1C7ZA 1JPNA 1KPGA 2RGGA 1N3YA 5FB3A 3W6PA 4DTIA 3MRXA 4BQRA 1E2IA 3UWSA 5JTUA 4P36A 3VOBA 3EASA 3GD7A 4M83A 3AIKA 3K6JA 6AT1A 3TW4A 1RC0A 4UE3S 1M6VA 3V8EA 1MNAA 4PG5A 3GB8B 3VU0A 3EG9B 3R7WB 4L4SA 1PW7A 3F74A 5L3QB 3HFJA 1T0BA 1U0GA 5EIXA 4O7LA 3BCHA 2JGJA 2JHAA 4DYDA 2UUBB 3PSHA 4HUQB 1DI0A 4D9NA 2WF5A 4G81A 2GFHA 2OWDA 3WFZA 2JJ2A 1NF2A 1BE1A 5DK4A 4PFSA 3ISTA 4OHPA 1XKXA 4XQEA 4GXTA 3HVUA 4GPD1 1M2HA 2PFGA 4RZSA 1BQ3A 1JPUA 3PKJA 2P3LA 2RGYA 3PQ8A 4Y0VA 4QG7A 1XMOB 4N3CA 1TKAA 3D8BA 3LNTA 4OH1A 5EJAA 5GJVC 5GOZA 2NXWA 2NACA 4I6JA 3RVJA 4DRFA 1UBSB 4QQFA 4UNQA 1LY1A 1GT91 5GM2A 1H69A 5TS2A 3VBEA 4MW7A 1MG5A 2IW3A 4CTJA 4TS3A 2A1TR 4DLNA 4OAOA 2ZRJA 2IWHA 2R8BA 2A9OA 3R8CA 3RS5A 3WLIA 3A3OA 3BMOA 4X71A 2PGLA 1VBGA 1TTTA 3O8CA 4AY4A 2LBPA 1LRJA 2WJAA 4IIDA 2EJ3A 3I9LA 5E7IA 1GZHB 5KCMA 2P91A 3BGSA 3QFFA 3DBHA 3GQCA 5EE3A 1E32A 3GJ7A 3LY5A 4LGCA 1YQDA 5A4AA 4XVUA 2FEPA 4LHSA 4O4JB 2P9HA 4RORA 1KI7A 2I1LA 4WI1A 3ESZA 5C44G 3H5NA 3BVPA 3DDNA 1CHNA 2UXCB 2DFNA 4Q4HB 3ZHVA 3LU1A 4JI7B 4NONA 1HNXH 3MGBA 4O63O 3W77A 4ND8A 2JCSA 4KPUA 4TROA 1QHNA 5D87A 5HIJA 3A4LA 4UTRA 1V41E 2MU1A 4FKBA 3ANNA 3PXCX 1RJGA 4XYLA 5FPHA 2COEA 4Z51A 2A0WA 4Z9XA 4C6TB 4TL7A 3I1IA 2NTJA 2FRDA 3M2PA 4N3NA 4DCTA 1SKYB 1EJ6A 5ALIA 4Z4EA 4US2R 4CG3A 4HB3A 3THWB 3AB3A 1RCUA 4CKEA 1HZZA 1V4NA 1WUYA 4BQNA 1J9GA 1VKNA 2Y4OA 3GQVA 3OG9A 3RHFA 4MR8A 5CB0A 3OMXA 1V16B 4P98A 3PLAE 4E33A 3PZRA 2N75A 3CY6A 2YDYA 4C4OA 1QHXA 4PTZA 1EK0A 1A82A 1FP4A 2CDRA 4XGRA 1GEGA 3OO1A 2H59A 1PZMA 2QTBA 2QP9X 2UZ0A 4WWHA 3FHTA 3CRVA 3CXRA 1TYBE 3D02A 4CM1A 4OJTA 1UKVY 3DS8A 4MWEA 4R9RA 1OH5A 3B89A 3B1FA 3PUXA 4J1SA 2K6GA 3QPVA 4DWJA 1YKFA 1RHRA 3QSYA 2P69A 3E1KA 2DUNA 3LQ4A 1KYIA 4MYRA 3LPLA 4QPDA 4X64H 1GUAA 2FW7A 5J63A 4D9BA 2XQJA 3F6PA 1Q16A 2B63A 1K3TA 1Y4DE 1O94D 1YC5A 3Q7PA 3U56A 4BHTA 4E08A 5C81A 2QX7A 4RQTA 1JBEA 3GOQA 4C1NA 4COOA 1ONNA 1TGYA 4TTTS 5K4HA 3O7WA 1WSCA 1EJ2A 1YBAA 4BNTA 1DTWA 3R6WA 4TV9A 4FGZA 3TLXA 4LTMA 1HORA 1NVEA 3TIVA 2ZR0A 5AHOA 1P74A 3B7GA 4UJ5A 1TZMA 1U2DA 4QWEA 1E9VA 2VN8A 3E3OA 5G0VA 4Z2YA 5I9BA 2XC9A 3FSGA 5E1BA 3G9UA 4PONA 5CIQA 1V1RB 5KTNA 1LS1A 1UK9A 1XOIA 1NNI1 1YS1X 1BCSA 1XHLA 2B4AA 5T57A 1YZFA 4Z8XA 3JD4A 4YJ2F 2ZI6A 1CUGA 3O90A 4CFYA 3BQ9A 4IL5A 1CJSA 3N7UA 1QYCA 1FJXA 3HFRA 1PQWA 2D59A 3JVVA 1ZETA 3QEMA 3JQDA 4R4JA 3U3DA 3GMDA 1I3MA 3BCRA 2XUJA 4JP5A 4BNHA 6ABPA 1P1HA 2QE7A 4W9RA 3GU3A 1DT5A 2W6OA 2I6GA 3J80W 3JQ7B 4OHWA 3V48A 3N53A 3N70A 1QGOA 2BGKA 4WLVA 1O2DA 3THXA 5AOVA 1XAGA 1AY0A 1JAIA 2DPMA 3BERA 1SVWA 4RSGA 2CVOA 4I4TA 3OZXA 1QTNA 3DMTA 4JJAA 4BMOB 4MI6A 3EC1A 5LD2B 3EF1A 5EKUA 5I5EA 1QYRA 3TOSA 4TTQA 4S04A 1ISJA 1KTAA 4EGJA 1T2NA 1FUUA 2BFPA 3IPCA 3MWDA 1V26A 1VP3A 1YQWA 2AT1A 5IXSA 2Q9BA 4EL0A 1O9HA 3QF4B 3QU5A 4FFSA 2V6GA 4E2YA 5ARBA 1NYLA 3G2NA 2BHSA 1R0SA 3BGDA 3IMFA 4MVJA 3GRVA 3FVRA 4HGQA 1ZONA 1J56A 4MDFA 2EBWA 2GOYA 1N2GA 3FETA 5CFRA 2VF4X 5LR6A 1Y9JA 1U8AA 3W90A 1HKUA 3SEAA 4EBDA 1PL8A 2VXBA 5JAUA 5JPCA 3GLGA 5EUCA 3HJRA 5FWXB 3E1SA 1NBMD 2QY6A 3AEUA 4MQEA 5AM1A 3NNDA 2N46A 2XECA 5L3SB 4MWSA 3VOAA 2HY7A 1G8MA 5CJJA 2PQ2A 2XMCA 4JDUA 4CN9A 2YUTA 3VI3B 3LVQE 3OJCA 4M1YA 4N7RA 3DQPA 5H68A 5KINB 4CIVA 4DM4A 1L4HA 3KSBC 3X43A 1DKQA 4KQCA 5HF8A 4ZI2A 4OHCA 4F96A 1M0WA 1DC4A 3H1PA 3ROFA 4KX5A 4XVCA 2FFAA 1Y82A 5I01A 1Y4ZA 4MUKA 3FDJA 4HS9A 1D5WA 1VJ5A 3C39A 4PSKA 5FO0A 3ZOKA 1QTQA 2HKIA 4PWZA 1C1DA 1XI2A 2B1GA 3NATA 4TM7A 2HQRA 1XRJA 1FL9A 4AMZA 4WZZA 3GPIA 2R8KA 3NONA 5JQGA 3F7MA 5F1YA 5FJJA 2JFHA 2R1VB 4DR6H 2GGSA 2AJBA 5U4QA 2RARA 3D6UA 1M6VB 4IH1A 4I9UA 3NOXA 4C06A 1MAWA 4RXTA 1TUBB 2J7KA 1H2EA 2AI1A 5ESWA 5GWXA 5A71A 3GHHA 4RV5A 4GRAA 3DAFA 1ESZA 1O8CA 1I7SB 3WYBA 1UXKA 2FFBA 4LZWA 3UV7A 4BL5A 5C8ZA 5GADl 2OLKA 3NO4A 4M8LA 4W8GA 3DOJA 5DHAA 4LV8B 1XEXA 4ZJZA 2NMVA 1PJ4A 5A4KA 2P3OA 3VR0A 5EJ4A 2QSUA 2WIAA 3HI6A 4H3VA 4IQFA 4MVJH 3W6OA 4C76A 5JCOC 2WQ7A 2DJIA 2Q9UA 3QEKA 3E15A 1RYNA 5H3CA 4J4HA 3CUUA 4TS9A 3GRFA 1FTWA 4M3NA 2DMRA 2OXCA 4D8WA 3FVQA 1E0SA 1N5KA 4W4TA 4O3SA 5BQOA 5ENDA 1TA9A 2JKYA 2QORA 3E3AA 1OVMA 3EDCA 2Y1DA 2ZBEA 1GGMA 1XFAA 5KFLA 2IU3A 2UAGA 2ZJ8A 3L40A 4L8WB 2O6HA 1XQWA 3EG9A 3R7WA 2UU9H 3UFXA 5K05A 1Z16A 5L3QA 5LYJA 4ZYWA 1XEAA 3QE0A 3OA0A 1R0LA 1S2DA 1KZ6A 1X9GA 2PZBA 4I1RA 3UFBA 1A0GA 1ZNYA 5TVGA 3V32A 1P8JA 1GQRA 3VBCA 2BM1A 1FLDA 1IBRA 4MUXA 2I33A 4BVGA 4V2UA 2ZRQA 1FXUA 2D1FA 4DANA 4FU0A 4X1IA 2D06A 2WLTA 2Z8YM 5D00A 4GH5A 4X63A 4PBTA 5SICE 2MINB 4C6HA 4TLBA 1RPAA 4ZO4A 4XFDA 2B1QA 4QOIA 4BLUA 4D4HA 4DXHA 3DM5A 3FTPA 3K0SA 4O4HF 4GI7A 5K99A 1OYOA 3GIKA 3C3BA 3QHQA 4XM1A 3O82A 5JCJD 1CJKC 3RHSA 3HO1A 1POXA 1UBKS 2O8EB 4G4SO 2DLNA 3K0EA 4R01A 4Y9DA 1QFZA 1ZG3A 4HH3C 1XZHA 2V7QA 4DSAA 3E81A 1XXHE 1A4UA 3IUYA 2BSAA 3R5FA 1ONPA 4BJ1A 2BCGY 2OEPA 1NUAA 1BH6A 2B34A 3A32A 3T3OA 1K2VN 1TC1A 4JQSA 2N0SA 2ONJA 1EDZA 1G2IA 4XDZA 1B00A 4FOTA 5ESDA 5JVDB 4DARA 1G2WA 3BF8A 4EB3A 2VHUA 3HV2A 1D2MA 2R0QC 2VPWA 2RH8A 4MB0A 4R3WA 5F9FA 4HXFB 1VCIA 1RM4A 3I01A 5AXCA 3G0DA 4V0NA 3PRHA 3MT8A 5A1JA 4C5AA 1CJBA 3E61A 4M4SA 3V7WA 3VJLA 3TW8A 3OTHA 1SOMA 4NU5A 2PHZA 1UEJA 4G3IA 3I83A 4PGFA 3OT4A 2R86A 4RANA 4CKWA 2Q4RA 5JU6A 1UJCA 3NT4A 4FGUA 1KYXA 4GDFA 4K6OA 3S24A 2IXAA 1FQWA 2DY0A 4R9UC 4FFVA 3W5SA 3GLIE 3KSUA 4DCUA 1L8QA 3M5DA 2JEIA 3ZHUA 1Q5PA 3K05A 3H4IA 4TSFD 3TLBA 3ZHBA 5CA1B 4M1ZA 3J7AK 1CUJA 2NM0A 2H54A 3KT6A 5ELXA 3NC4A 1BS2A 2JL1A 3DHVA 4JC0A 2Y0CA 2NZXA 3NG1A 4N6GA 3JWEA 1U7XA 4QTYA 4F91B 2Z9DA 1Z5WA 4D5GA 3G2HA 3QE2A 2BLLA 3VYSB 1Z8FA 4M38A 5J5VA 3CVVA 3O9ZA 4EI7A 3HM9A 2YVLA 2PD4A 4JL5A 1GKLA 2N9UA 3PDHA 1K8ZB 3DWFA 1VB3A 3Q87B 4L5JA 4RKFA 1K6EA 3A6HA 3ESDA 3IXLA 1MC8A 2EZUA 3L7JA 1AKYA 2WAMA 1VG1A 1V7CA 5EE1A 3VO9A 5JEEA 2X9QA 4WLUA 1I1OA 2C3PA 3OC0A 4NHEA 2RHLA 1RMTA 3HU2A 5BQ3A 4XYBA 3SSAA 1FK8A 1K7FB 2OOKA 3OT1A 5L40A 2RDJA 4D2IA 1FFHA 4WK6A 1ZGAA 5LC1A 1BIFA 3NHAA 4PZLA 4Q3AA 4JJ4A 1XZMA 4BKQA 1WM1A 3L9XA 1NSTA 4KMMA 4XWYA 4LXQA 5IK2A 5EJ8A 5JJIA 3G6KA 1NC3A 2C5HA 1I4TD 4U63A 5EYPB 3VDXA 2IEYA 4YAFA 1YJ5A 2C9OA 5EOYA 3AI1A 3AU9A 1X0XA 3MOIA 2QJRA 3MAAC 1E1LA 4Q4LA 1ZSNA 4HD8A 2P9GA 3V8VA 3D54D 3O4VA 2IV3A 2FMXA 3NCHA 4BUCA 3C4VA 4Q34A 3P9ZA 1RJRA 3M4ZA 3H5TA 2I3DA 4KNWA 4AMYA 3C43A 3B53X 2PVSA 1BHJA 4IQ8A 4F3TA 4FINA 3T1VA 1GSAA 2VSNA 4UCRA 4DR5H 3OPYB 3H5WA 4L5AA 4XM0A 3MK31 1GZ3A 1I33A 2Y1EA 5BRAA 3UCEA 4G8BA 4F2WA 5JT1A 4GKKH 2X9VA 3RTCA 4HO1X 1Z8DA 3GRUA 2NUPA 2P9JA 1G7CA 3LPAA 2PMEA 2Y67A 4IIXA 4ZDKA 4PVDA 4YY3H 1FYDA 2YHIB 2W2NA 4F3CA 4S1PA 5KFKA 3OQ6A 1O03A 4COKA 7REQA 4DIBA 4P33A 4TLLB 4Y1RB 5YASA 1M1NB 3QXXA 2BGTA 4YCCA 5FV4A 2B21A 3UMVA 2C4KA 3P20A 4AP9A 1O3YA 3NYQA 3P9CA 5EIBC 5D5QA 5SY9A 4ZK2A 5DYWA 3EGWA 2BFEA 5D3QA 3H6KA 2IEZA 4KVFA 4NK5A 1IH8A 2J6BA 1Y8QA 2NO9A 2BQUA 3UHAA 3FYUC 5K0JA 2H1OA 1NUSA 2B6HA 1MENA 3AHGA 5A1TA 2R7MA 3PNSA 4JI6B 4PZYA 1O97D 5AVJA 1SCKA 3KVYA 3IKLA 3Q40A 5FBWB 1BVYF 3LUCA 1T6NA 2YWGA 2J85A 2VP0A 3ZJVA 4JCCA 1WU7A 3AL0C 3R6GA 1MPTA 4RTLA 2XCTB 3THYA 4GZLA 1K1QA 1T3HA 2ZYAA 4OGFA 4RK6A 2INGX 3U7RA 4EFNA 4HT3B 4PAOA 3H9EO 3ZDDA 4UULA 4Q05A 1BQEA 4TT8A 2DH6A 1NURA 5EIHA 2DBVO 2IZ5A 3AF6A 4ZI5A 3LUGA 3OZEA 5TIIA 4MNTA 3ICVA 4B1FA 4F6LA 3CKKA 2HK9A 2XR1A 2V7EA 5IYZA 3SBDA 5CDGA 1SBNE 3P4XA 1P1IA 1IY0A 5C5IA 1SG0A 3TDNA 1RYFA 3DHWC 4OG2A 3Q8KA 1J0AA 3D2LA 3F5QA 2BTOA 2V7WA 3GGCA 4NZ9A 4ZCTA 2FWAA 1EGQA 2C28A 5HJ2A 4JUZA 1I7LA 3M6IA 4XB1A 3P2EA 3QF4A 2RKBA 1QGZA 3O8QB 4FTWA 1J0XO 1Z2PX 3LGAA 4Q3OA 4U9IS 2IUUA 3RFUA 4LC9A 3SF8B 4EPTA 4CLOA 5SYMA 1XDUA 2XCUA 1KQGA 1RKBA 3HB4X 3ROXA 2ZJ3A 3LQKA 3R7FA 1Q0QA 3F7NA 3TD9A 4AN4A 4KXYA 1C4OA 4G5HA 5KWIA 3D7KA 5LZ9A 4CCYA 4KWIA 5IBRA 2AN1A 3AFNA 1CK4A 2IZ7A 4LF9H 2I78A 1XNJA 4QVKA 4V0MA 3NGLA 2WK1A 1K66A 1SUPA 1CUUA 1UIRA 1ZUWA 1QCYA 3FPHA 2YXEA 1UKAA 3LL7A 4GKBA 4FBMA 4IIFA 2EL7A 1L8LA 3E5MA 4IZIA 1H8EA 2J9RA 3BB1A 2OE2A 3DAAA 3HKCB 4I9NA 2X13A 4U7TB 4U6SA 4BQPA 4MINA 3ICPA 2XUKA 4QGSA 4CM9A 5CLGA 1CQWA 1KDPA 1ZN8A 3HCNA 2AFHB 3IE2A 5D1HA 4AN0A 3TNDA 2A67A 2JZCA 4BU0A 5GGYA 2YWJA 1KZ9A 1GRRA 2L42A 5E2AA 5U9CA 2CF5A 2PGAA 1SKAA 2UV8A 3WIUA 5K51A 5C37A 3GILA 2HT1A 1H0RA 1JSXA 1ZAKA 4OD0A 1APBA 1WS6A 4RETA 3UC5A 1V96A 2RBGA 5DO9A 521PA 5JNLA 4Q02A 5CGQB 3I3OA 5A9TA 1T34A 3R7LA 3RSLA 1YUMA 3TDMA 4YLGA 3TCKA 3DBVO 3D6TB 3KFVA 2ZJ4A 4L1KA 3EBOA 4QUDA 2I54A 2ZU0C 1Y9EA 1NVMB 4MV7A 1YA4A 1RRFA 2ZUBA 2FN3A 3LC7O 3M1YA 4JC8A 2FFRA 4L28A 4MARA 1X7YB 2F2TA 1A9SA 1IQRA 4AJOA 4EB6B 3LY9A 4IRMA 2W11A 1NQ5A 5CDHA 3ZIDA 3ZGNA 3K92A 4BV3A 3EPKA 2ZJ0A 3UK7A 2R62A 4E6PA 3I4NG 3ZVLA 2ZUWA 2LPMA 3CEBA 3L2PA 1XQ9A 2BP7B 4RTSA 1BDJA 2ZZMA 4IRKA 4G2TA 4ZTZB 4ILKA 2H7VA 4JI1H 2ARKA 1FDSA 4RTOA 4CCAA 4AMVA 2B7LA 5CNKA 4W5OA 4ITVA 1P39A 1A4XA 2CL0X 5DXAA 5JHHB 3L0DA 3WSVA 4KLRA 5DHTA 4BTEA 2NP7A 3CZRA 2OD7A 5CRIA 2BFFA 1CRWG 4RW0A 4B46A 1NGSA 1V39A 1IZ7A 3WNDA 4IDCA 5DTMA 4BNLA 4F46A 2WAQE 3L84A 2OBBA 5BWTA 4OHRA 1U90A 1MNQA 3RNOA 5ADVA 2CFCA 2C77A 2ZE6A 4S24A 1TF2A 5CTJA 5K3FB 2XWPA 2BGMA 3BK7A 4PX5A 3BMCB 4BLOA 3PU6A 3K96A 2QX8A 2HVSA 4NTZA 2UXBB 1U8XX 4PBSA 2GCOB 3LYHA 4ZOBA 1HKHA 3AONB 4L9WA 4A0GA 2C9ZA 3BIFA 3O47A 1IHDA 1KE2A 3RV3A 2J6UA 2H1FA 2PT7A 1Q0UA 3CZ4A 3KJEA 2NO1A 3W2GA 5JNTA 4RCZA 2NAPA 3FDZA 4C2MA 3EVZA 1F20A 1GA1A 4WLNA 3ZU2A 1DPFA 1E5XA 3N0RA 2QZ9A 4DIDA 4B7ZA 2VA3A 3HWX1 2XPCA 5LQMA 5JR3A 2V1UA 1TQHA 3QPUA 2J4DA 4QUJA 3BSYA 5B12A 1ACLA 2EJ0A 1O75A 1DTEA 2YQ5A 3DKVA 3HBMA 4OJQA 4ED2A 4Q7MB 5LMZA 2L2QA 3LQFA 1UPBA 2NTNA 4QU5A 5HRAA 4P7BA 4WJLA 4QTZA 4YAEA 4BV8A 2AGPA 2QRVA 2B98A 3L4BC 3EWAA 4CM4A 4F4CA 2ZYGA 4XB6B 5I5GA 3HY3A 2ATCA 2CFMA 2J0EA 1JQJC 4GZ6A 4PCLA 1E69A 1FTGA 2OLJA 3REFA 3WIVA 4KWEA 4LXYA 4I19A 4AJ4A 1NAIA 1KJ8A 4D44A 1H0SA 3E2PA 5LB4A 2PJDA 3MCTA 1F5NA 1M2EA 3DE2X 3F4KA 3JQAB 2Q6KA 3QLUA 2IYYA 2FLKA 2WVAA 4O02B 4QOSA 5BOSB 4OVKA 3PXDA 3UCXA 2FQQA 3MMSA 2DPJA 1EVYA 4QA9A 2ZUEA 2QJTA 2XYHA 4JYBA 5IANA 4J9PA 1GVHA 5JEDA 1P1JA 5CHEA 1MOZA 4LNUB 1RWMA 2OLEA 4NOJA 1XRNA 4IHJB 1K9SA 5FPKA 2WJ4A 4O7VA 2C88A 2D54A 4NK4A 1WSAA 4FYJA 1R6AA 4K28A 2XE8A 5EZYB 4HWOA 3E84A 1XQ6A 2H8KA 1KYYA 2KBEA 1TU0A 3IAM1 3HI4A 1JLRA 1M8KA 2I2WA 5DNAA 1CJMA 5LSAA 3T99A 1L4EA 1T9CA 4Q1EA 4YAWA 3P9XA 3A7DA 3H3JA 4XOIA 6REQB 4CFSA 2H92A 1SCAA 2R4UA