3VPCA

Argx from sulfolobus tokodaii complexed with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
b'MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetylornithine deacetylase
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
total genus 85
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpcA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpcA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpcA01
5JH7F 4C5BA 4ZHQF 5FNVF 2QF7A 2VQDA 4O4HF 2CNQA 1KUTA 1EYZA 1M0TA 2GPSA 3MWDA 5JVDF 2YZMA 2GLTA 4EA9A 3QFFA 2W70A 3V4ZA 2YZGA 3N8DA 1Z2PX 2YWVA 1E4EA 3GIDA 4O4LF 2YS6A 1AUVA 2I8CA 2YYAA 3ORRA 4MV1A 4MA5A 1PK8A 2CQYA 5CAEB 1KJJA 2GQSA 5IYZF 1DV2A 3U54A 3OUUA 3VMMA 3RFCA 2C00A 3UFXB 2R86A 2DIKA 3R9RA 4C5AA 3N6RA 4FGRA 1W96A 4RZQA 4O7ZA 1DV1A 5HBRB 4YAKB 5C1OA 5HV6A 2CZGA 3G8DA 3OUZA 3ORQA 3I12A 4GGMX 1UC8A 1IOVA 3G8CA 2VR1A 2R87A 4WBNF 1WR2A 2R7KA 4MA0A 2R7LA 4TV8F 4FFPA 2R85A 4O82A 4MV7A 1UC9A 3U9SA 4O84A 3ETHA 4ZQIA 1VBHA 4O4JF 1IOWA 2CNVA 1EZ1A 3JRXA 2X0SA 3R5FA 4FFOA 2PVPA 2NU8B 4O7VA 3DF7A 5LP6F 3HBLA 4FFMA 2Z04A 3R5HA 4HNUA 2CNUA 5GONF 1PX2A 4L1KA 2R6FA 3TINA 5LOVF 2V5AA 5BPFA 4O81A 4IWXA 2W6QA 2R84A 2YL2A 5K2MA 4O7RA 3BG5A 4YJ3F 1JDEA 4M98A 5D8DA 1EUDB 3Q2OA 3VPCA 3KREA 5J2UF 3VPDA 4IWYA 5CA0F 4YJ2F 4NYEA 3GLKA 1Z2OX 4EGJA 2YW2A 4ZOLF 2DWCA 2YZNA 2ZDHA 1OBDA 4DLKA 5C1PA 3WNZA 1AUXA 1KJQA 4ME6A 2FP4B 4O2BF 3JRWA 4MAMA 3KAKA 2R82A 2XD4A 1SCUB 1KJ9A 5LA6F 4TV9F 4MV9A 1JDBB 3BSWA 2R7NA 3RUPA 3AW8A 3HO8A 4FU0A 3BSYA 2WYOA 3VPBA 5BMVF 4O7YA 2W6OA 2XCLA 1GSOA 2J9GA 4EG0A 4ZI7F 2VHEA 4O7TA 1CE8A 4XX0B 5LXTF 1A9XA 1OBGA 4I50F 4EA7A 3WO1A 3TIGA 4EABA 4HQ6A 2W6NA 4O83A 3LWBA 4EA8A 2IP4A 2FB9A 2W71A 4O7WA 1KC7A 1C30A 4HNVA 3R23A 2OLSA 4M9CA 1A48A 1CS0A 2GPWA 1I7LA 5KKNB 3E5NA 1EHIA 4YAJB 1JKJB 2YS7A 5LYJF 4IHJF 2Z02A 4MV3A 4C5CA 1ULZA 2PN1A 3ETJA 3NUAA 4IZOA 5CA1F 5I47A 1M6VA 5JQWA 4J6EA 3AX6A 4MV6A 1EUCB 5H80A 1CQJB 4XYMB 3V4SA 1CQIB 3JZFA 4IIJF 4Y8VB 4EAAA 2V58A 4FFRA 3TQTA 4I55F 2QK4A 2W6PA 4YB8B 3K5IA 4XYLB 2R7MA 4EGQA 3K3PA 2NU6B 1W93A 4O2AF 1B6SA 5DMXA 1KBLA 3BFPA 2YRWA 1KJIA 3MWEA 3VOTA 5JQGF 2FPIB 4FE2A 4FFNA 4WD3A 2VPQA 3RV4A 3LP8A 2P0AA 5KX5F 3HB9A 4FFLA 4O7NA 3RV3A 1GLVA 1T36A 4HNTA 2YZLA 4O86A 2W6ZA 1I7NA 1B6RA 3KALA 2FPPB 1Z2NX 2GQRA 1VKZA 5C8YF 4XZ3B 2I87A 2NUAB 4MV4A 4MV8A 3WO0A 5EZYF 3SE7A 1GGOA 3R5XA 1GSHA 1VBGA 5J2TF 3K5HA 3U55A 4O7LA 5CB4F 4E4TA 2NPOA 2ZDGA 4O7SA 2V59A 2YRXA 3BSSA 2HGSA 2HJWA 4QSHA 2DZDA 4HR7A 2ZDQA 3VA7A 1KJ8A 2NU9B 3Q1KA 1BNCA 1GSAA 1JLLB 2SCUB 4I4TF 1KEEA 3TW6A 1M0WA 1E4EB 5BPHA 2FPGB 2W6MA 4O4IF 4M99A 4DIMA 2PBZA 1DIKA 2NU7B 5JVLA 3KAJA 4YBZB 1C3OA 4TUYF 1BXRA 3MJFA 3JZIA 2DLNA 3U9TA 4M9UA 3TIIA 2I80A
chains in the Genus database with same CATH superfamily
5JH7F 1T9BA 2QI9F 5AJVB 2QR5A 3OC6A 4R83A 1EYZA 1CZNA 3SDSA 4EYOA 5DM4A 4KO2S 4MQFA 2A4MA 3H17A 1OTHA 1SULA 5CIWA 3H1FA 1D7AA 3HWX1 3R0VA 4IJ6A 2P9BA 3H9UA 4Z0PA 3HCFA 2PGDA 4JYPA 2WWTA 3QX8A 4B0OA 4WKBA 3DF9A 3ZWNA 1FNNA 5BSWA 4HTFA 4DXAA 3QBDA 2P3SA 2JFZA 2ZSHA 4HLNA 1P7ZA 1PWHA 3MA0A 2QRLA 3SIXA 1TUEA 3GJ4A 5KT7A 3DCYA 3ZCUA 3K6JA 5U4QA 1JU3A 4R1OA 1L5NA 5CR5A 5HCIA 4DR3B 4BMPB 3EC1A 5KVCA 3NHFA 4OFWA 1NPDA 4ECSA 2EARA 1YOBA 1EDDA 2HDWA 3ANSA 1MO2A 1VRCA 2X9NA 3JQPA 2IK8A 4R7RA 2AZMA 2FR8C 1XCPA 4HCJA 4C4SA 1X70A 4QC2A 1PV2A 4QRHA 3ZGXA 3ABSB 3DE2X 4JLSA 4EGFA 3K6RA 1CFZA 2FZ4A 5KYUA 3T5MA 4PO8A 3IIMA 3CF4A 1TNDA 5BUCA 4OJYA 3AHIA 4QTZA 3TOXA 3ROGA 3UHJA 3VC3A 1FBNA 2AMJA 1N2JA 2ZSEA 1CDOA 2BFEB 2ILTA 2G77B 1KBZA 4DE5A 3JY6A 1W6UA 2JLCA 1LW7A 4QPPA 1ZK0A 5IJ9A 4KDFA 2YYZA 3BIFA 5ANRB 4O3NA 3PA6A 4Q00A 1XK6A 4Y1RA 5E4TA 4AMVA 1GRRA 2HK6A 5MHTA 4F5DA 1MX9A 4PCVA 3IHTA 1FSSA 5GIPE 3UPUA 1GQ2A 2ZLBA 1K98A 2QVGA 4XQ9A 3C3CA 2PNJA 3NTQA 1CETA 2EBUA 5T4HA 2BH2A 2FYTA 4HDMB 3K2BA 2R8YA 1K27A 4UBMA 5INTA 5CA1B 3QX3A 2VK1A 3PP8A 4EABA 1TB4A 3OKPA 1N1MA 4AKSA 3D4BA 4YJ2B 1G9SA 5THXA 4IEEA 2Y1FA 1K8XB 2GBLA 3KXYT 4MUEA 1CKOA 5GJCA 2OV4A 3AUTA 2XGJA 3CLTC 4P7KA 3SZMA 2YJTD 3O4VA 3UGQA 3VXKA 4ZDWA 3DCJA 4LVUA 1WLSA 3EIFA 4JYMA 2HPVA 5KNDD 3E05A 5I47A 2Q3DA 1ML3A 1UINA 1C9YA 3F1LA 4HD8A 2WPDD 3N0WA 3R6TA 4CTJA 5HIAA 3TMKA 3BMXA 2VHCA 3DPUA 3RARA 3LUPA 3FMGA 5FBKA 4EAAA 3GCZA 4WMLA 4XB2A 1XXHB 1AXEA 1JHOA 3L7LA 3UUGA 1T36B 2WVGA 4X61A 3HDTA 4RDHA 4G37A 2EJ3A 4ZT5A 2XD9A 3DP7A 1XDUA 1OYOA 5HZMA 1SPBS 2H48A 3WRXA 4O3RA 2HDNB 3D3WA 4ARAA 3MWJA 4QYMA 5H3HA 3BEOA 2H0QA 1WVGA 3NZEA 4UEKA 5JRJA 5D00A 5A62A 3E9CA 1LLUA 4YMTA 4E08A 3G1WA 2HSWA 2V1XA 4FYPA 1DZ3A 2FPKA 1L5GB 4URXR 2PIDA 4E1AA 2FR0A 1U7ZA 3NV9A 1SVKA 1WXWA 1BFUA 3NHWA 1L5RA 1Z2DA 2L2QA 2H8KA 4PHTA 3V6MA 4OJTA 5JPDA 2FPIA 1XPRA 4DCUA 4HFJA 5A9SB 4OD0A 3LVQE 3IRUA 1JNXX 2A5YB 5BQXA 3K70C 2V6GA 4XYBA 2H0RA 3F9RA 4TRJA 3B3GA 1A8QA 5DXJA 2JS7A 3NUZA 2AR0A 4Q3BA 5F2NA 2VBGA 4CDMA 1ACLA 3EPGA 1RHUA 3ZW8A 2F59A 4MUYA 3MWEB 3AEKA 1TPZA 1BYIA 2PZGA 3KD3A 2I62A 3DYVA 1KAQA 1L8OA 3H11B 3LPCA 3O4RA 4ZEVA 1W88B 1MF7A 4DDMA 3H99A 4RV9A 2XAAA 4KGZA 1Z6AA 3KOZA 4R68A 5IT4A 4JP5A 2HMAA 1VI6A 2AGVA 1E4EA 4GX0A 1N2CA 3RHFA 1NW6A 4MUJA 1AVTA 3WA7A 2WF6A 4QEDA 3AKZA 2WM3A 2CEAA 2CQYA 2PZKA 3HB4X 4APMA 3AR5A 3S5UA 4B8YA 3MFIA 2WINI 3L9XA 2FLKA 4KXNA 3CT6A 1K4KA 1PO7A 3QPAA 2DBRA 4ARZA 3U56A 2W2QA 4C22A 3KYCA 1QFXA 2VPYA 3RTCA 1GRQA 4G5QA 1YMQA 4ADSG 4G5GA 3FUCA 3WRWA 4WXYB 1Y9AA 2BWJA 5E3IA 5P8WA 3FLMA 4GVLA 2ONZA 2V7GA 2XDYA 5JWOA 4YO7A 4JYZA 2JFGA 1D2EA 4EGCB 3L1HA 2AI1A 3SOPA 3UKOA 3CLTD 3ZDRA 4FS2A 2C3UA 1B2RA 2YJNA 3LMLA 3FVQA 4O33A 1KPGA 1X80A 2PL1A 4LZNA 4HLUA 3DEHA 1EP1B 4XJSA 2O8DB 2IUUA 4YV1A 4XVHA 1NT4A 3DW3X 4I46A 1GV0A 3ERCA 1IN1A 1B4DA 2YIVX 2WHXA 1ADBA 2VJMB 1MGOA 2E1PA 1FYXA 2JJ2D 4IWYA 1ZITA 3WR5A 1I1OA 2VWPA 3RIEA 1P1IA 2IXEA 3RU9A 1GNRA 4TZ0A 3SHVA 4D8TA 5ADUS 5KFJA 2WZDA 4FCWA 4MRSA 5EJFA 2RGYA 4A03A 4L6AA 3H5VA 5EKXA 5AO9A 1YRWA 4M87A 1AZTA 4F92B 2RBGA 3UAXA 4P7BA 3BRWD 2WF9A 1P3Y1 4D0LB 5P21A 2I22A 4TV9A 3TTVA 1WUHS 3RYTC 1OLXA 4RHEA 1UPBA 4BQNA 3MT8A 1K83A 4ECRA 2XKJE 3WFJA 4RVCA 2HWWA 4ILEA 1P1CA 4MB0A 2YY6A 4JEIA 3EEYA 4OLJA 2H4XA 1S9HA 2X86A 2XQKA 3T4UA 3SAJA 3LUDA 3ZGOA 3COVA 3W2EA 1LRJA 1YU9A 4UTXA 4JVNA 4DQUA 4ZI2A 3P7MA 5J63A 4UCOA 2RF4A 3QY0A 1R18A 1U7XA 2C1XA 5KFWA 4NEHB 3FOWA 2XQVA 3NTLA 2DSNA 3QVSA 3Q4GA 3ZCSA 4MVJF 3K70D 1M6NA 1ZO8A 3OSNA 2IE0A 1C7ZA 1PT6A 4C9BA 3UTDA 3AVUA 4DJDC 3K09A 1ZD2P 4DJ5X 4UCWA 4IXWA 3VISA 4OPMA 2RHCA 3ZE0B 4G4SP 1R8YA 2O19A 2YFYA 4P3KA 3TTXA 2TECE 2VHQA 3WY9A 2DWOA 4G36A 5CVCA 5IJ0A 2YZ2A 1SKBA 2BR3A 4DV3H 2PWAA 3OOYA 1RXUA 4JMPA 1GNQA 4I55F 4Q3CA 5EMNA 3AONB 3ZG6A 3JYHA 1E5QA 3ZDZB 2WW8A 4ZV7A 4MUKA 3PXEA 2FEWB 1M8FA 3KT6A 4K9QA 3GG2A 3GDEA 1M34B 4AN1A 5JADA 4EYIB 1CY1A 1Z3CA 2J45A 4GI1A 1A88A 3GUYA 3QMVA 1QG2A 2PE5A 5JXGA 3A25A 2YY5A 4XYMA 1XZQA 2A7QA 3IUJA 5FA5A 3W4KA 2NZUG 2O1XA 1JDSA 3ZDCA 3R6LA 5DYTA 2RB5A 4J8PA 4LHEA 1E79A 3E9MA 4B87A 1HE5A 1RS0A 4Q1CA 3PDHA 5EZYA 3GRFA 1CP2A 3DDSA 4EUHA 4EJ2A 2ZJYA 2VHZA 1VJCA 4MP8A 1FMLA 3AVOA 3S8EA 2ZI4A 4KQ9A 3BK1A 4Z1OA 5EIFA 1O1YA 2ZBEA 1NVVQ 1X1CA 3OZXA 1Z07A 1MW9X 4YR9A 1HT0A 3UB3A 3V32A 4C08A 5LNK6 1K5DA 1G6Q1 4DUGD 3AYZB 3AW9A 1G2QA 2ERXA 4H7DA 3FNHA 1VHQA 4Q82A 1J1ZA 1XEXB 1KR5A 1TI7A 1FXWA 1LFAA 5JUMA 1XKTA 3N8GA 2EW2A 3MMZA 1MRZA 3GFQA 1DQSA 3MWDA 2JEFA 1KOJA 2NU8A 2JLYA 1ND5A 3DDCA 4C3VA 4B1FA 4EFLA 1UXGA 4J90A 3AJ8A 4HQ0A 4QJBA 1IVYA 4FW9A 4UULA 4DV3B 2Y1OA 4TMKA 2WFLB 3WYGA 3JSAA 5C4XG 3GEPA 1VP3A 2I34A 2QL5A 4WESA 4EUEA 1FFDA 4K9DA 2NSDA 3OMLA 4KB5A 1WRBA 1CNFA 1LI5A 1OC2A 2ZJTA 3QSGA 1WWKA 3FCOA 1J56A 2ZZKA 3O91A 1M2HA 3QEOA 1SCQA 3OTWA 1K8RA 1FYVA 5DYGA 4Q24A 5MFPA 4IIFA 5EIEA 3FNQA 4J4TA 1OXXK 1FDTA 2AX4A 1ZUNA 1BDMA 5DM2A 3GAMA 2CV1A 2W0SA 3TG2A 1PSZA 1NULA 1EJ6A 4X7BA 3G3EA 2AC4A 3LFTA 4U63A 1L4HA 2JRCA 1YZHA 4RD1A 1E60A 4IJWA 3KREA 1YVEI 2IXAA 4K9KA 2JLZA 1TU4A 2CVFA 2HSJA 2FQ1A 3KL2A 3L79A 1UBCA 4UM7A 4GOOD 1NI5A 3MOGA 3CO5A 2YZKA 3ZDEA 1STOA 1U04A 2HF8A 3ZJYA 5A6SB 3FJ1A 3JD0A 4ZOQI 3EZ7A 3LX8A 5K4HA 3HH8A 3LC1O 3NASA 2YN0A 3Q0TA 3FDJA 4YCSA 5BUSA 1T2AA 3N3BC 2XUIA 4MR9A 2QD3A 4AUNA 1OFTA 2HIHA 1U3FA 2FAXA 3ZTTA 4E7OA 1KEPA 1JFFB 4UM9B 1IJKA 2VEOA 1VJGA 5IDWA 4X24A 1CXZA 1U1FA 3DTYA 5LR6A 5FOQA 1AKNA 1PYDA 1AK2A 1GGKA 2DU8A 1NZJA 3RTAA 1U7PA 3WG9A 2HJVA 4EZIA 4QZVA 1HX7A 3AKCA 1LI4A 2AXNA 1FJ2A 1RAAA 4H18A 3ZGZA 2D2VA 1XU7A 4HFNA 2VBFA 2YIMA 1C30A 2HBRA 3R7SA 2XLBA 1IM5A 2JGRA 2O1EA 3EUFA 1GO3E 4R71A 2YRFA 4BY9E 3TPFA 4KODA 4G1UC 1ZCZA 3C7DB 3ECSA 1DBWA 1U8ZA 3QTLA 4JI7H 3I04A 3N59A 1PGJA 3FTPA 2BFCA 1R2QA 4DL3A 4E6EA 1KDRA 4YP1A 3DBRA 1LDGA 3VVMA 4UAVA 1E4VA 3D8NA 3G82C 4CKZA 2ATIA 1XEWX 5KMGB 5KNBA 3EIQA 3BIXA 1OAOC 1V16A 5DGCA 4BMZA 3D3NA 4JOCA 5DMXA 4L50A 3A3OA 5E1BA 4B2IA 3I9MA 3CSUA 5KFEA 3PT5A 2PGIA 4WZBA 1VRVA 3F5SA 1N1GA 5DH9A 3R20A 1YBVA 4HRAA 4R8SA 2X8JB 1H2WA 2W6ZA 2NQ8A 4XPZA 3EIEA 4P5PA 1XRSB 3PGMA 5DHTA 1TL7C 4QPZA 3E0QA 2WF8A 2DBQA 1Z7WA 1J0DA 3ZZMA 2J3QA 4U02A 1ZNWA 3GJ8A 4QJ3A 3QYJA 5EMJA 4RPIA 1M5UA 1XQ1A 1M1YB 3JYLA 2EF0A 2IWRA 3DBHA 3GCXA 2BKEA 4Q1DA 5K0LA 4DZRA 2E5LH 1SU7A 3PQ7A 3FRHA 1J23A 3ZHOA 3ONVA 2PS0A 4JV5H 2ZU6A 3AUFA 2PX3A 4CF5A 1OTXA 1GRVA 4ENUA 5JVLA 4U2FA 3DXFA 1DEKA 4MWEA 1C4KA 3BWVA 1NXPA 5B36A 4DV4H 1SQ6A 5HXAA 2GERA 1S5PA 5AQEA 2DKNA 3TEFA 3LQSA 2H51A 3L4BA 4G9BA 2FEKA 4JI7B 4GDMA 1VI2A 4MR7B 2FPMA 4HFRA 2A5GA 2WVHA 2Y92A 5LUBA 2ZUCA 3SQNA 3OLCX 2OYRA 1NXTA 4F3CA 1K86A 1G16A 3A6FA 4I5IA 2PZLA 1CVLA 5FLYA 1EFAA 2OHVA 1NJ1A 3AVXA 4AZSA 1Z3IX 3LLCA 2P2NA 1SIOA 4KFRA 1RMYA 2WWYA 3GQBA 3W5IA 5F1OA 2OQRA 5EEGA 5T8KA 4G2NA 4JXZA 1DHRA 5FI1B 2XJ9A 2AL7A 1MOQA 5J5VA 4G41A 4NMHA 1I4DD 3WV4A 3SC4A 5L3QB 1FVIA 3IIIA 3JX9A 3FPBA 3KJFA 3RT9A 3C8DA 1Q57A 2PIAA 1ESZA 1J2EA 2G5PA 4BFTA 3LS2A 3E4DA 3X3HA 1T5OA 4LZJA 1Q3HA 1IB6A 3IP1A 4D5EA 5A02A 4U5QA 2GSDA 4H6VA 1U28C 4P31A 3LT5A 2V5AA 5CLFA 3CW9A 2HA6A 3GV0A 2LD4A 5KFKA 3TLGA 1NIJA 1QJCA 2SHKA 2VT3A 3V7UA 2E5LB 5MGBA 3NHRA 3D7RA 3FJOA 3Q8LA 1FNMA 4JV5B 4WK0B 2ASVA 5CIQA 3X2FA 1U8FO 1QKIA 4ATNA 3CKLA 4OK3A 1W36C 4GBED 2BZSA 2ODNA 3ILYA 3ZK9A 4RL6A 3GA7A 2COGA 1VJ0A 2WWWA 5FBHA 4MR8B 3CPJB 4MIKA 3NBQA 1UMBB 2GVDC 3FUUA 2HJSA 3IQHX 1L9XA 2C9OA 1Z9BA 4DC1A 3LUFA 4RTKA 5LDHA 2OZLB 5D87A 5U4XA 4NS4A 2JI9A 4Q4AA 1PQYA 2YHSA 2XZOA 2AOTA 2O8FA 1Y80A 3WDLA 5IVPA 4ITUA 3GLHB 4DR1H 4QICA 2VWQA 4HDKB 1E2UA 3IUBA 3EDQA 2ILVA 3DQQA 4MW7A 4B4VA 2AFIE 1SJ9A 1XNHA 2IS6A 2DUWA 1OLOA 2OGTA 2EGGA 3S1LA 4DC0A 5B58T 1YDHA 3LBFA 1Q1GA 3UZOA 2QENA 4XFJA 1JEQB 2IDKA 2GBLC 4NY1A 2R6GA 4WV3A 2B5OA 2CDRA 1GN8A 1R9JA 3UMBA 4W7IA 4KGDA 3SHTA 4HVCA 1F3LA 3FLBA 1OFUX 1GFSA 4N5LA 2HYDA 3AHGA 1YJXA 4RS4A 3L06A 1M1NA 3Q98A 3WYCA 4LJRA 4Q4HA 3STXA 1PZMA 3SR4A 1R3UA 3CV3A 5FD5A 4H31A 4Q4JB 1CQJA 4FE2A 1S8AA 1N75A 4LE0A 3PUKA 3JQ9C 3B7WA 4OHWA 4I14A 3PXBA 1LDEA 1ZIXA 3UYYA 1KO5A 4QDJA 3WRXC 3HPRA 4NEGA 1QP7A 1ACMA 2XVZA 1XRPA 2YV3A 1KDYA 1SEVA 4RD3A 1SOMA 4RZHA 2QLLA 1R5BA 1KK1A 2WSSD 5BOVA 3NU1A 2VTVA 2GAOA 5E3HA 2EIHA 3AP1A 3QHAA 1IRIA 3B53X 3CUKA 4KTVE 2PS3A 4ACBA 1THGA 5JSHA 4DR1B 1IN8A 1CYEA 3A1EA 3D6FA 4UDOA 3AINA 5IKMA 3DHVA 3WMXA 2O0JA 2ZE7A 4CMCA 4NFHA 4RVHA 3AEUA 1NVWQ 2JDIA 2CNQA 2GPSA 3VH1A 4I9UA 2VPPA 3PPYA 2BBWA 3U4HA 1NKVA 3NWJA 1DGQA 1W36D 1BEEA 3TRHA 2E4AA 4OI2A 1ZGZA 1Q0QA 4DARA 5A4KA 1W5TA 3S7TA 2C88A 5KVSA 3I5XA 5A3JA 2WU1A 1NX6A 3OH8A 3U54A 5KC8A 1KHTA 4BNMA 3TXXA 2AC7A 2O9JA 1U0LA 3I45A 4H6PA 3AGQA 2PKYX 5LOVB 4FUTA 3ZNOA 3PN1A 3MERA 1KY4A 5FTJA 4C2TA 4FFPA 2F43B 3ZWQA 2GH1A 1B73A 4BJ6A 4HEA1 3HBNA 5DT2A 3V7FA 8OHMA 1G2PA 2YJ3A 3COWA 2DPGA 4DWWA 2R7ZG 1BCSA 1U0NA 1YZKA 4YWHA 1PF7E 5KFTA 4D99A 3QZ7A 2FFAA 3PEUA 1W4BA 3HDHA 5KJ6A 2V3CC 1DBQA 1J5XA 2NXEA 1NW3A 3CNNA 4QUHA 5A4DA 2Q9UA 3DZIA 3WKAA 2QM0A 2O48X 2HIXA 5CYOA 3U6BA 3NBKA 4OIFA 2Y6UA 3P9CA 2G82A 4YX9A 4EPWA 4JUDX 1KH2A 4HLUC 1MVLA 3CXRA 5AHWA 1YJBA 1E3WA 4JKOA 5HK8A 3FNGA 2BPOA 4O2BA 4X60A 4DCPA 4HAWA 3GXOA 1RFGE 2HCTA 3RJTA 4LX8A 2XB6A 5FV4A 2ZUDA 3LQRA 5CK5A 3JQ7B 4KO4S 4KPYA 3TW8B 3QJGA 3SHWA 4MEAA 3UYLA 2NM0A 3TOVA 4CGZA 1Q3KA 4B3DA 4D43A 1C2TA 1KWGA 1E66A 1J1IA 2MR6A 4KN5A 2LGJA 1T1GA 1WX1A 2IHBA 1I5EA 1ICIA 1GL7A 3OQJA 3PR3A 3LWDA 4F4XA 1NQAO 2BP7A 5DVZA 2D5AA 2AYZA 2OZVA 3UUEA 1UJ5A 3NJRA 1XU4A 1GADO 1OZAA 3OURA 3EQ6A 1V37A 1HT2E 2OTCA 2GRUA 1UBFA 4IRXA 4ND8B 2J9YB 1A8UA 3FZQA 5E8RA 3STVA 2YWRA 2JIRA 4TL8A 2JD1A 1CWUA 3WLKX 1HORA 1EFHA 4EQ6A 3P8ZA 4J75A 2FK7A 3IQZA 4CHIA 4YECA 2IS4A 2WLSA 1XE3A 3DOCA 3PDIB 5BSHA 1G291 4LYFA 4OAQA 3MSXA 3BA8A 4KQJA 4QT0A 1PGOA 3EASA 4M8LA 3AIMA 3CM0A 3IJPA 2WHYA 5CLIA 3H1GA 4CV0A 5GM2A 1U6KA 2NU6B 1EGQA 4HQFA 5G4LA 2QVXX 2XUGA 5I5SA 2A3NA 1P1HA 1E58A 2GHTA 3SZGA 1O9GA 3W3ZB 4K8OA 3IG0A 4G8DA 2MT9A 4G09A 5TQ0A 1TYBE 1ULBA 4ERNA 2BEVB 4QDUA 4UPDA 2C9ZA 1GA6A 4EL0A 3HEMA 2HRRA 4WBSA 4V3BA 5ARBA 2VZ0A 5CB4F 5IMSA 1QWSA 1PNOA 1K6EA 3SZLA 2PX0A 5BN4B 5EJ8A 1UEXC 2NSLA 4BO6A 3A6LA 4K1LA 3T7EA 5DFAA 1H3EA 1LPAB 4GMXA 2IU3A 5WRFA 1LJUA 3NC0B 4UAJA 3KD2A 2AJCA 4IIDA 5K0SA 1B04A 1CJUC 4CUZA 4ZC1A 2ADFA 3EVAA 5T14A 3LPLA 2B1RA 4DLNA 2M05A 5JAOA 5ED4A 4NZ9A 3KQLA 3GRCA 5EJ7A 3RAXA 2WJGA 2XNHA 3FAKA 1MG5A 3CX4A 1NNUA 4IAOA 2VHJA 4DQVA 1S8NA 3F5QA 5E7JA 3WBBA 4QPNA 3UIEA 5G3YA 4TWJA 3C2QA 3JQCA 2YN2A 1R9MA 2XE6A 5E7IA 4ZEXA 1TJYA 4H6WA 2R96A 4KK3A 3EOZA 3SYRA 4QUJA 3DFUA 3MQFA 1HE2A 1SKQA 4I2VA 4PC1A 1EDOA 2XH8A 3G8BA 4L28A 5HBRB 2ID4A 1MN6A 1CB7A 4AYWA 3NTRA 2XC9A 4WINA 5FBRB 4IRKA 1GU0A 4LZPA 4RK4A 4W1SA 3MINB 4PPYA 2WSYB 3C3PA 1P0MA 5IT5A 4A6PA 3W8EA 2L0XA 2HI0A 3FOFC 3JVEA 3FN4A 3UPDA 4LZWA 2WKSA 3LY9A 4UMVA 2IEIA 5FBQB 4FXPA 4W6QA 2CNNA 3FWYA 2PMZA 5KFIA 1MOSA 2F1HA 2QAJA 3PS9A 3ROXA 5KFQA 3BGVA 1ZH8A 2X1HA 2W43A 1TZKA 5L1KA 1L7QA 1IUPA 3GJZA 4D74A 3QWFA 3UWDA 1LPPA 3TPCA 2ZAIA 4BOYA 1PGPA 3GMIA 5JD4A 3MWGA 3E61A 1U7TA 2H17A 1KRWA 4YI3A 4W1QA 1Q0ZA 4FI3F 4C6RA 1XELA 3A2MA 3RHZA 4UUQA 1JVNA 2JBAB 4BQSA 2ZRFA 1SA0A 1Q14A 3ZV5A 3L1KA 4EFDA 1CUEA 4BMOB 4RTNA 2HF7A 2ABWA 4XTRA 1YCDA 3FFBA 4TMWA 2QKYA 3FR8A 4MDEA 2YDYA 5G1NA 5BN5B 2FLVA 2X3UA 3ZE6A 4CNQA 1VYUA 2QSJA 1L4LA 3P9NA 2XCLA 4BQPA 1DKQA 1P81A 4EG0A 3Q2IA 1NKTA 2I3GA 1IBRA 3WWCA 4KH0A 1JIUA 3WL3A 2IC5A 2RKWA 4F2PA 1NUPA 1IUKA 2WKWA 1GGJA 4LQLA 5FQOA 1ZM4A 3T9DA 4HZUB 4BKUA 2WSIA 5LUAA 3GRUA 3ROPA 4LCJA 1ZZGA 1AK1A 1VKJA 4JBLA 1A8HA 1AO0A 1R4AA 1ZVMA 3T7SA 4WGFA 1FP2A 1SKYB 1NMEA 4ZAXA 1HEIA 1RRMA 5HX7A 1KVRA 3TSWA 2Z8ZA 4L22A 4ESVA 1XVTA 2WOJA 1EIZA 2X5NA 1U0GA 2VA8A 3E2PA 1PEYA 1QIKA 1K63A 2FI1A 4B74A 4YAJA 5DBFA 4DABA 1Q1AA 3OU2A 2GCPA 4JI4B 3L0PA 4RUCA 4V2UA 1Y4UA 3ZX4A 4GZLA 2REQA 2MWMA 1QHHA 4IIBA 4CT0A 2IH5A 2HF2A 1RBQA 3DXZA 3T94A 3M6UA 3QRWA 1DTWA 4H7FA 5F51A 1QLHA 2GF0A 5ESXA 4COKA 5EYPB 2VJDA 4TWBA 4TKVA 3GN2A 4RABA 5CCXA 1W0CA 3ZV6A 1ODSA 5KOHB 4O3PA 3I9KA 4H7PA 5A3RA 1NOKA 4OLBA 1Z62A 1JDNA 4CM6A 3KHUA 1URPA 5A9TA 4NWIA 3VHXB 4R8MA 1PBNA 4O3FA 1ACJA 4D4MA 2W98A 4HH1A 4MKZA 1H2BA 2OO7A 3AQ4A 1DEAA 3GEMA 2EGUA 2RJ3A 1XKXA 3ET5A 2PSSA 3KQPA 4PBCA 2H1SA 1P0PA 3RVSA 5JI3E 4B3SH 1BW9A 1XTTA 3U0BA 1R16A 4ZIRB 5KT2A 2RE8A 2Q4OA 2EU8A 3IXLA 3AM4A 1BSVA 2YFKA 4MJ7A 4ALIA 4BGVA 1DMRA 1CCWA 1J21A 3OTOH 1YR8A 2XCQA 1C3EA 1I10A 2P77A 2OG2A 4O4LF 2W9XA 5EMKA 2V5VA 1CB0A 4ZRDA 3MHTA 3TDKA 2Y76A 2RKBA 3G2OA 4Q9IA 4B43A 2XVMA 2AUNA 2CK3A 4JA2A 3VV3A 2AXQA 5TC4A 4K6FA 2BDEA 4JWTA 3G2LA 3REGA 1EM8B 3FTDA 3QOWA 1Z25A 2VC2B 2FJUA 4LVNA 3OJFA 4F5EA 1X8KA 3NS7A 2WJJA 1NI3A 1A8PA 3WLOA 5LKAA 5G0UA 3G59A 1XGKA 3G5LA 3I1JA 4HWOA 5JBQA 4J6FA 4WCDA 4O4JA 2FEPA 5EDWA 3L7BA 2HG8A 2R8IA 4XLLA 4RHTA 1NF8A 1OI3A 4M0JA 2WYUA 4D6PA 4PYOA 2ZE5A 2A92A 4Q18A 2WVJA 4OUKX 3BIJA 1FJGH 4RLQA 4IGEA 4YLYA 2J0VA 3SR0A 3GUZA 2I4IA 2V7XA 1CJKC 1EB8A 3IAS1 4UHKA 4NARA 2O0LA 3UV3A 3BFVA 3OA2A 3JAKB 2QUKA 1JG7A 3E7PA 4GMDA 3W9SA 3DBVO 3GLQA 2ECOA 3ZWVA 3I30X 1T29A 3RUHA 1HDCA 5GWXA 2H7XA 4D3XA 3U3XA 4PX9A 3HDQA 1IXRC 3RJ9A 2SICE 2C78A 3UFBA 3WGNA 4JI1H 4Y6PA 4UASA 2XMDA 3OAAA 4UNSA 1VRWA 5KNBD 2GI4A 3OTOB 1J8VA 1M5TA 3ZV3A 4MQBA 1JZTA 1L5ZA 1W5FA 4BVAA 4PRKA 4G0OA 1E4GT 4ZI7F 5AW8A 4MWZA 3KOWA 2I6XA 1NW8A 1YQDA 4A0SA 2H5LA 5BR4A 2VDNB 1OT3A 4YP9A 3A9CA 1B76A 1MEOA 5L4SA 4MWOA 5BURA 3C8ZA 4E2YA 1J0EA 3SQWA 4IDPA 1E1DA 4FX2A 4N9WA 2COUA 5EERA 1H4VB 3QOFA 2I3DA 3GJXB 1A7UA 5HBGA 3ZCRA 2F9MA 2WRZA 3MFQA 4TSRA 1O96A 1OPXA 3EPJA 4M89A 1B2LA 2B37A 4J0CA 5DV9A 221PA 3EGIA 7ADHA 4KVZA 2AZDA 3W79A 3H18A 5TDHA 4IO1A 1TT5B 4XOUA 3ZU6A 2OZPA 2X0NA 2ISSD 4ZWNA 1SVWA 1KFCB 1FJGB 2X3YA 4YB8B 2QE6A 1QGUA 1X86B 1O0SA 2J5BA 3SJZA 1ONBA 4GXQA 3UVEA 3QYPA 3OU7A 5FLKA 2PH5A 1JA9A 4XA8A 4KO1S 2B7CA 4G0NA 4OAPA 4RVUA 3KKPA 4G0VA 1I5OA 3PI7A 4PNZA 3DVSX 2WSSA 3RAGA 2QJWA 3U4GA 2FN7A 4MB2A 1E3IA 3RGXA 1J33A 1ZIYA 4JI1B 1GGOA 4KOEC 3COZA 3E84A 1NVMB 4DILA 5KAMA 1U28A 2GN0A 4DL9A 4XPIA 3O2JA 1M73E 3IP3A 2E5WA 1RABA 3NHLA 5C7LO 1FFXB 2XADA 4G1CA 4KVFA 5D1OA 4DN6A 2G67A 1JSCA 2BZGA 4IZHA 4QUIA 1ZM9A 2HHFA 5A9RA 1L5HA 5JNLA 4DJEC 3ST7A 1KFKB 1AURA 2I80A 1Z0IA 1QFJA 2YXEA 2DTDA 2NVYA 4J7XA 1XJWA 1KTAA 3DTNA 5DI3B 4CCYB 2ZSUA 1V5EA 4Z2YA 1FRQA 3P9XA 2KI5A 1I6WA 3MJHA 1F9EA 3WGTA 4XIIA 4AKIA 1RXVA 3BQ0A 2X7HA 2Q1TA 1ZMBA 4P5DA 4LJ9A 5HM6A 3UFXB 1ZU4A 5ALUA 3HN7A 4M55A 3L6DA 2EJ2A 3KU1A 2X6TA 4O7ZA 3CMCO 1XCLA 1KNXA 1JAIA 2YXPX 1TAEA 2X5OA 4K2HA 2OFPA 2R97A 4CC5A 3VFDA 4UDNA 2VSOA 1HDEA 2P9EA 3LCUA 3T9CA 1K6IA 1FMJA 2HXGA 3HVJA 4GI5A 5ALNA 4FMPA 4HYKA 5TSDA 1JPNA 3DONA 4PE5B 1ZW6A 4EW2A 2VS1A 1ODFA 2ECFA 4DA4A 3EHEA 3FOBA 6Q21A 2GEBA 1FZTA 1JWAB 3LA8A 1QZXA 4BU1A 1BCRB 1ORTA 3V8RA 1XZGA 4NU5A 3UY4A 4ETIA 4IAJA 3RF7A 5F9NA 3TLEA 1T10A 3KQQA 5HOQA 3EDMA 4H1HA 1Z2OX 4K87A 3WLFA 3FLAA 3UBTA 2PUGA 5C3UA 2JI7A 4DVJA 3TL6A 1WB5A 3JQ9A 2ZULA 1XALA 2AJ8A 3T3OA 1SUAA 2W2KA 1GNPA 3A1VA 3KYDA 5E3JA 1GO2A 4J1QA 1BWQA 4EBBA 4JMLA 2PBFA 4AZ3A 4BO7A 2D1YA 3RUPA 2JAPA 4V1CB 4ZAGA 1XWWA 4X84A 4C7KA 4F8EA 3LSYA 4RV4A 4DWOA 1VDZA 1LPBB 1IZYA 1EZZA 2ZJBA 1FDSA 1JLHA 2CNDA 6NULA 2QP3A 1LRKA 3CUVA 1C7EA 2WFMA 4L7VA 3U3ZA 3N2GA 1Z26A 1V3UA 4RQUA 2C5BA 4U6PA 2YZ7A 4NAVA 5KVAA 1T4CA 2FXIA 2QZSA 5T4BA 4YT5A 4MKIA 3H5TA 3AHCA 3U44B 1E3DA 4IJMA 1H1DA 4M8IA 4I9FA 3F7NA 2ST1A 2GLUA 1NFQA 3H5NA 2XGSA 3MRSA 3LHDA 1Z12A 3U7GA 1P33A 4LYJA 4HAIA 1U3CA 1C9EA 1KTVA 4OTZA 3WWOA 3TY8A 3Q7TA 5LB2A 1WSWA 3VKGA 3ROQA 3R6WA 3WL4A 3RVDA 1K3FA 4HBGA 1U1EA 2E4WA 5CXXA 4GBMA 2BHRA 1ISFA 2XCSB 1TIPA 2B4RO 3QELA 4MUXA 2BGNA 1TUGA 1V7PC 1E2NA 2WAXA 3OQPA 1GNLA 4AIIA 2GF2A 4ZDJA 1CUYA 3HJCA 3TOZA 1V95A 4QGSA 4NZZA 2DY1A 2H4ZA 4GIBA 4UDXX 2JDID 3DL2A 4LOAA 1ZQ7A 3H04A 5FORA 1ZUWA 2ZS9A 3VUFA 4G5RA 3FFTA 3QVGB 3TVDA 3UT5A 5FR2A 4BRSA 3WKEA 3H75A 4GWKA 1YHZA 5C8YA 3QLVC 5I5UA 5E25A 3I5YA 2LIVA 4OP2A 2VUIB 4QBTA 2VNHA 2OCPA 4ZK2A 4ZHQB 5DHQA 2JEGA 5HZKA 4I1SA 1GPNA 1RMTA 4K0KH 1KYYA 1T8UA 2XZLA 1NT2A 1NUUA 4OHOA 5JYDA 3NDPA 1DIAA 2XODA 2HK7A 1IQPA 2Y1WA 5CM2Z 3NM5A 3GP3A 4FMCF 3F1KA 3V7WA 2NTVA 1VPEA 4Q7JB 5EUCA 3TRFA 1ODCA 1W9MA 3TEKA 1HKHA 4QWDA 3GNQA 5FJIA 2H1IA 3VYVA 4IXDA 2CF5A 1TMGE 2HCBA 1J9GA 3L0DA 1I24A 2HO5A 4QQFA 2VH1A 4PFSA 4FOOA 5CBPB 4FDAA 5LZ9A 1D2HA 4BB6A 1IXZA 4QG7A 4NX2A 4YPOA 4MRAA 3ORRA 4MV1A 4PQEA 2HX1A 3LKBA 4TV8B 1UQUA 2R8RA 3O9ZA 1UM8A 3JD3A 1PFKA 4KYUA 3DCNA 4DL4A 2BGTA 4YCNA 1IU9A 1KWKA 3J80W 5EWJA 3BHJA 1KOFA 2W4QA 5K3AA 2C0QA 2J48A 3BMOA 5K2OA 4F4WA 4OHYA 1NYQA 1KR2A 3PNMA 2VUTA 3Q40A 1XT6A 1RDFA 3AJ9A 1BVUA 4BZWA 3NC4A 3NBUA 1GAXA 2AK2A 3OHSX 4EYEA 2DR3A 4AYBE 4C43A 1ZWLA 1WVMA 3F98A 2BTOA 4JB0A 4YROA 1KYQA 2J6CA 3KOMA 3PW4A 3TNFA 4DEYA 4FQ8A 3GTQA 3A1WA 1GGVA 2BFBB 1QIEA 1XTUA 2Z58A 4PG6A 2JGNA 5IYZB 3DMFA 5CW2A 4P81A 1A1VA 2QLFA 4OVKA 3I6QA 5DTJA 1XX6A 4BDSA 3PIDA 1HDOA 1BOFA 1MNQA 3PDJA 3ZS8A 4JS0A 2O6LA 3GELA 4K0KB 2D5IA 5KYWB 2YFHA 4U2DA 2QNIA 2DCUA 1GYRA 1RKBA 4FHZA 3O92A 421PA 4GG1A 2OAEA 3TJMA 3I92A 2RAVA 4NYMR 2EZUA 3GMTA 2YCLA 2BEWB 3KFLA 4LIPD 5KYYA 2CC2A 3EGDA 1P29A 3N2KB 2OCBA 4IUYA 1BHSA 3IESA 3HHEA 3VHQA 4XWGA 5DSTA 4XYEA 1PJZA 5BMVF 1RZUA 2EJUA 3JAWA 3VV2A 4KQ1A 4QOFA 3DWFA 1YC2A 4FKBA 1G21A 1MAAA 2O2ZA 1M2WA 4G4GA 5JC1A 2C29D 5EJ6A 1CF4A 2JIZD 4Z4EA 3AMVA 3SBDA 3VH4A 4UARA 1HG0A 3KVNA 4ZREA 1Q22A 4DJTA 1M2OA 4EA8A 4V2IA 1FYFA 4Q4DA 4MB6A 3PNOA 1QVVA 2VKQA 3K53A 4BNUA 3LQ2A 4MICA 4XM1A 5HFNA 4BNTA 4XX1A 2D7JA 1LK5A 4WH0A 1HL3A 3CNOA 2Q7DA 1UL1X 5ISMA 5I9NA 2C2OA 2B0CA 5B7GA 4ZCQA 1ZEJA 2WAQE 3K05A 3GH1A 1W19A 1A4RA 1IATA 1U98A 3ESQA 4QNRA 5B6JA 4K9MA 1LVHA 2BD0A 1TVKB 5EJEA 3QV1A 1XV5A 3CE6A 3AI1A 3I0MA 1B6SA 1C1HA 1W4LA 4FLEA 1KNQA 1JHPA 1NR1A 3GHHA 4C07A 3ZY6A 2O8EA 2DBYA 2H5JA 3BJIC 2Z2IA 4JV0A 1FQOA 5CBKA 4KSCA 2MSWA 1YOVB 2D0PB 2YZLA 4JR1A 3NX4A 5M5BA 4WFQA 1MQ9A 3E6AA 3M5PA 3C3KA 4C3UA 3GZNA 2GCOA 5ARCA 4BV2A 5IDVA 2H00A 1X9HA 5BV2P 2NZ8A 2AG6A 3VTKA 2FX3A 4C0HA 5AVTA 3ADKA 3IE1A 3LSTA 3R0ZA 1X7YB 1PZFA 1TLTA 3RFXA 5BSFA 1EVQA 2XRFA 4A16A 5EXTA 1OXUA 2PY6A 2ZBRA 3G9QA 2YYYA 2OHJA 4RX1A 1N33H 5KOJA 5CYPA 3WK4A 4O08A 1LX6A 4RDIA 4MVJE 3PW0A 3ICVA 1NNEA 5I7FA 1MNAA 3NQ41 2F1OA 4CL3A 3EIOA 4HN4B 4QYXA 3QVTA 1DC6A 3LW8A 4PY2A 2AFRA 1ZMRA 3MBKA 5L7WA 3Q2KA 1JSLA 5DZSA 3WLSA 1POXA 4FJ2A 2CBXA 3PWSA 5I60A 3VSEA 4EPYA 3T3EA 1Y98A 4MKFA 2A1TR 3ORSA 3LFUA 4RTSA 5HIMA 2A5JA 2QQEA 3WQSB 1TA0A 3INGA 5C3MA 3RRYA 5ENVA 4NNJA 2H4WA 3M0EA 3TIVA 3GRAA 1UNNC 4JI0H 1U0FA 4V0SA 3MLAA 2DIKA 4DAEA 2IVFA 2P5UA 3RUDA 4BASA 1PNVA 5B37A 2P2YA 1W4AA 3QK7A 3PJDA 3H3XA 4GVXA 1JQJC 1JA1A 1JNYA 4X90A 2IBSA 3A4IA 2CB9A 4QBKA 5KOYA 4WY8A 1UC8A 3WI7A 1KYXA 4M38A 3ZW9A 2CLKB 4OM7A 1H3NA 3KRTA 1YE8A 1ZH2A 1JHXA 1N1EA 1CKMA 3UENA 4CFZA 1C3LA 2M9MA 3WIDA 1L5QA 2XQFA 4ER6A 2CFSA 3TCKA 1Z06A 4P9NA 1PNRA 2RH4A 3L0YA 3IXMA 5LA6B 3Q3IA 4E51A 4UC0A 4J91A 4HEA6 4U5XA 4MVWA 3K9GA 3RGGA 4UTRA 3T7CA 1N33B 4XGKA 2ZT8A 4RK6A 1WNTA 3KFXA 1MAHA 1MQSA 3K9FC 2VFAA 2OR3A 1CUZA 3B2NA 4F96A 2BE9A 4X65H 4YY3H 1V26A 2F1IA 2FWRA 4M7RA 4IG9A 4IO0A 1MORA 3A1DA 3UA3A 2DHCA 4YQYA 3PGXA 5BQ5A 1NYLA 4LN1A 3I6MA 1SQ5A 4G01B 4NK4A 2FUCA 2I3ZA 3WHLA 3ZYZA 4JT8A 4W1RA 5IT9W 3KEGA 1RC1A 1ZSVA 2GTIA 3W7AA 3AIOA 1USGA 2EBHX 4JI0B 2N3ZA 4MLZA 2Q8QA 3PENA 1Z28A 1NWCA 4Q8FA 4UXHA 1SVLA 1GWNA 1TIKA 2CJWB 3D3JA 2P5TB 3KB2A 3EB9A 3ILXA 2YS7A 2RH8A 4CTKA 3K30A 4RVDA 1N1DA 1TCVA 1RYSA 4BP1A 5DRTA 1YFKA 1QNFA 3A1CA 3KVOA 3KKLA 4PYIA 4D3YA 4EJ0A 1DWOA 1BROA 1KI6B 2R8PA 2I4OA 4BDTA 2DQKA 2OHOA 4DYHA 4JLJA 1NXQA 3HM9A 3GEIA 1E2DA 1WPXA 1DVRA 3AF1A 1KIMA 4TXLA 1XL0A 2DBVO 1X2EA 3KYBA 4DLUA 2RGVA 2PX4A 3NHUA 3SX0A 5HTOA 5MN4A 1JFSA 4P34A 4GFDA 1P16A 2P2SA 3KOXA 2OMEA 4MROA 2LZ0A 1CUJA 3HOXG 1DJMA 5KFCA 2MR5A 4OQEA 1UEIA 1Y7TA 2OHIA 2ZRCA 4CKWA 3OPYB 2AH5A 1Y3FE 4G4IA 4IHJB 2XMCA 4OLHA 1OJLA 3UJ9A 4NYJR 1QDLB 3VOBA 4X65B 4YY3B 4MNTA 4G86A 4XZ3B 1Y1WA 1CP3A 3RK1A 1CJTC 2JGMA 2CK3D 4CI9A 1ZPDA 4BZPA 3H2ZA 2GXQA 3H9QA 1GCIA 2XDQA 3LX5A 1XNJA 4CIVA 4L9WA 3IDFA 3GVHA 1KARA 2V4RA 3TE7A 4PRLA 1BFDA 2H4HA 2PEZA 2XR1A 2HA0A 4P35A 2XNKA 4P7GA 2EKBA 4L5IA 1Z4OA 4ML3A 2OMKA 3I42A 1GU1A 1ZSNA 1F14A 2ONYA 3M70A 1ES9A 3L8HA 3W5BA 2MTBA 1DAAA 3AWIA 2J3IA 1MW8X 5FTKA 3RBAA 3KP1A 4ID9A 2D1RA 1SUBA 3I2JA 4GPD1 4TYYA 3S2GA 3THYB 5A0VA 2IV3A 4FWTA 1CHNA 3T3PB 4I4NA 4G4SO 4OYYA 1RXCA 3ZX5A 4UJ3A 3Q8SB 3W0LB 1WUYA 1TYDE 1L8LA 3IULA 5REQA 4DCCA 2VG8A 4DV4B 3CGGA 2RAFA 5CP8A 1SD1A 3EEFA 4PRZA 2UXDH 3JXEA 5FFNA 1OQAA 3RAFC 5ADWA 3GD5A 2R8BA 2GJ4A 2I2AA 3T9FA 3AQIA 3LQ1A 3ONDA 4N4AA 4DDKA 4CR8A 2HZ7A 3OAAD 3NFYA 2H1HA 1MT3A 3GT4A 4MQEB 1V35A 3JV7A 4E5PA 3R8XA 3T1QA 1IQUA 1I14A 3O2NA 4YH1A 1O8CA 4X0EA 4M1KA 2I8LA 1T5HX 1BIFA 3VH3A 2RG1A 1UT5A 5HOEA 4N49A 2VDKB 4G3XA 1FFYA 1JQLB 1LDBA 4ZCSA 3L0SA 4GBGA 5M2QA 2HA7A 4Y6LA 5HFJA 5LKRA 4QRIA 4YFVA 1JG6A 2IUSA 1TWGA 2O2JA 1R0RE 3EQ8A 3W3AH 4B79A 3R3WA 4HS4A 1IC6A 4GPZA 4F4YA 4C4TA 1UWKA 3EFOA 1R4ZA 2BDTA 3UPTA 5ELXA 1UFKA 3AUAA 1KYWA 1SZDA 3AHDA 2BGWA 1DMSA 3EH1A 1RJEA 4CQNA 3WBKA 4EHHA 1ZA1A 4BKOA 5KTRA 2KE5A 1IULA 4LFAH 4JLBA 4JKYA 3L77A 1G5IA 3G13A 5FEUA 1RRPA 2VZ8A 3UOGA 3G02A 4N5NA 5L3ZA 3D2BA 3WTBA 2P27A 2H2FA 3TX6A 1NXWA 2PX8A 4BVLA 4AY6A 4YJGB 1RHKA 3C7AA 2VSYA 1PJLA 5IJWA 1U7OA 3O7WA 3SJBA 5LYJB 3D0QA 2YJGA 5JNVA 2GM3A 4H7EA 2FSGA 3V34A 4JAVC 3EIXA 1U6JA 4NENA 1QOQB 3PXDA 4D9KA 4F06A 1J4AA 5JZSA 1PQPA 4S1NA 3QEAZ 4LZZA 2A1UA 4TMVA 1IY2A 1JG4A 2R4UA 3H8WA 2QR2A 4MTLA 5ULLA 3HCAA 1YJ8A 2JW5A 2XUFA 4IF4A 2QNRA 1NN5A 3R4CA 4CLXA 2WIKA 3CF2A 4KIFA 3LJKA 4NG4A 4N18A 2D00A 1GNSA 3FZEA 1G7TA 1UC4B 3Q88A 3KR9A 1RK6A 4RNCA 3Q7RA 2DWQA 3MWFA 2V58A 3I2IA 5KS8A 1H5NA 3GX1A 1N2OA 4WL0A 3I6ZA 4QECA 1GPAA 4YMVA 3KETA 3E1KA 3EGXB 2P9QA 3I64A 1Q91A 2W8KA 4C1BA 5HCUA 5AVZA 2JIMA 3EIUA 5KG4A 4MYHA 4AUMA 1OH8A 4F12A 2X2PA 4P0QB 2QRGA 3EMDA 4GX5A 2C07A 1CUFA 1LY1A 2CMDA 4F3TA 1J97A 1D5WA 4HWSA 2P7HA 4RGQA 2QMUA 3OHBA 2KQUA 2QZ4A 1TVMA 3VZRA 3RCBA 2KM1A 3BK2A 2PMKA 1DEXA 4LFAB 1Z2NX 2JPDA 4QFBA 4C4OA 4PS0A 3PNBA 1W1IA 4HRYA 4NCJA 4ND7A 3H4BA 3ZXSA 3N86A 3SC3A 4G5OA 1U81A 1AE1A 2NU9B 1Z18A 4RKRA 1KRHA 1WZEA 3DMHA 2VQFH 1BRTA 1Q0HA 3ESRA 1NQXA 3MJEA 3HOVG 3IP7A 1Z68A 2Y4RA 4Y2GA 3TAXA 4TUYF 3VDQA 1TD9A 2QN1A 3WYBA 1ISSA 3PD0A 3HY3A 3WGIA 1QZZA 3ZY2A 4KUEA 2XMQA 2PMCA 3TK1A 1ZAKA 1N4AA 3PNSA 2GD2A 4E1BA 5DCYA 1P75A 3QZUA 2ZJ3A 2GM5A 4Y9RA 8GPBA 4R01A 4PC3A 1GUYA 1ODJA 3E3AA 4Y7DA 2NXWA 5KHLB 4YP7A 4UTPA 4BO4A 4RIFA 2NO7A 1AKMA 3F3KA 2JLSA 1PUJA 5H59A 3GIKA 3BQ9A 2I9PA 4IUDS 3K8QA 5KTMA 1JFLA 1H93A 2QHXA 1GNTA 4HDSA 2VDWB 3JYPA 3FVTA 4LI0A 2VZEA 3VJLA 3PHCA 1DO2A 2WE8A 4TGLA 2ZBDA 4A8TA 1H2ZA 2C2GA 3N07A 4JVLA 2YNMA 4YAKB 4OXXA 1C1DA 2OAQ1 5AKLA 1X8XA 2G71A 3PRYA 4DM4A 4WA7A 5KG2A 4W5NA 1KY3A 4DCNA 3OD5A 2FWIA 1B8OA 3F7TA 1G42A 4RFVA 1SBIA 1L4GA 3E22A 1RQXA 2ETXA 4EW3A 1A95A 3RK0A 1YZTA 1S2GA 1COWA 5KIAA 2LW7A 5BNZA 1JJ7A 1S96A 3FFAA 3B1ZA 2JFUA 2P1ZA 2EZ8A 4YASA 2CHGA 2IBKA 2YWEA 4J0IA 1Q12A 3DMGA 4FGJA 3L84A 4REMA 5CVJA 3FNEA 2NACA 1JHDA 2HADA 4C2UA 1Z47A 4JLUA 2IYZA 2JJQA 4KVAA 4ALLA 4ZO4A 4LF4H 1BXGB 4XAQA 1FYWA 3AO0B 2X40A 3HYTA 4H3KB 4ETMA 1DLJA 2QTVB 2BMEA 3NIFB 5C2JB 2LXNA 3OOEA 5JAMA 3CVXA 2NO5A 4LFCH 3MWYW 4CKCA 5EZ5A 2VDLB 3IP9A 2HHHH 3IAS6 4RCYA 1QGED 5IM4A 4Z2AA 3NDIA 4BWSC 3O03A 4Q6WA 3QLVA 4HRVA 4PS1A 3BJMA 2JIZA 4LRTB 3FVRA 3TLJA 2E0IA 2ZWAA 3PT9A 4NZMA 1CT9A 1UDBA 1E9BA 3S44A 4NVRA 2A33A 2X14A 5DBOA 5AW4A 3KJGA 4B40A 2W48A 4ZQEA 3F96A 4FOLA 1CR4A 5EFZA 3A3PA 4FDUA 1YR2A 1G3UA 2GJ9A 3UNXA 5HPYB 1JYSA 2REXB 4C06A 3ZE2B 4IKEA 3OCWA 3T7RA 2QTTA 4FEYA 1QF9A 1V11B 3ITDA 1KDPA 1QONA 4B4UA 3LF1A 1DSSG 4RJIA 1TKAA 4HGYA 4ED9A 4QNMA 4CMJA 1F6DA 5CA1F 4O2AB 2H18A 4DMLA 2PD4A 2ETVA 1MA0A 3C24A 3UGJA 4X3PA 3VRHA 1ZRMA 3CF4G 4KBYA 2ORYA 4D46A 3HJHA 1NNI1 1BKDR 2DAAA 4DA9A 2Q5QA 3L0BA 1W34A 4GE0A 4AXXA 3SC2A 4HNHA 5JRDS 2BEUB 3DMTA 5B5SA 3S24A 1EFKA 4QODA 1IOLA 2WZBA 1Z2EA 2G1KA 1M6WA 1I4TD 5JQGA 2ZZNA 3RR2A 2HO4A 3IKTA 4LYDA 3DE6X 4QELA 2I4NA 4WSOA 4LF4B 1WW8A 2Y1LA 5E95A 1WV1A 5JATA 1UKBA 4MKXA 2H06A 3LK7A 2I7DA 4BX9A 1CKNB 4I99A 4LMRA 4HUJA 3VDXA 4C29A 3DBOB 2Q5IA 5A4JA 1AF4A 1EM6A 3J7TA 2FFQA 1NHWA 5GTDA 4FFDA 1VBGA 4Q45A 2H5EA 1U3GA 3GB8B 3O74A 3HUTA 1LBQA 4RZRA 2IUEA 5EHXA 2X0FA 1QIGA 1PG2A 2X5KO 3RFTA 4BV3A 3FR7A 1NN3A 3LRPA 1CRQA 2PBZA 4WOPA 3OSZA 4CIXA 1YWGO 1S0OA 3SZRA 1X14A 1J8YF 3HI4A 4MKRA 3PYMA 1GZ4A 2DJIA 1IMJA 1P0CA 2NZYA 4LYGA 3FZNA 4A92A 2PKCA 5FNVA 4TVBA 2DJ5A 1CUVA 4B3GA 1O3YA 4F1JA 4KCGA 3ZY5A 1VC2A 3F6BX 3RRXA 1IXYA 1ZIDA 4RENA 2WG1A 4OMUA 2Y2UA 4BPRA 2YWVA 1AX9A 5ALIA 4BX3A 1P1BA 1BO6A 4R3NA 1U3VA 1CJMA 1PK8A 2DQZA 3CNLA 1CUWA 1HNXH 5LYYA 4WNAB 4P3PA 2WJ3A 1DTSA 3OCUA 2ANCA 3FBWA 1P8LA 4X7RA 5CT5A 4YAWA 2ICAA 3PEVA 4X71A 4B48A 2NUBA 2EGHA 2RJOA 3SSOA 1U4SA 3DC7A 1FSFA 3OSUA 4ZEMA 4GSKA 3S4YA 4L5JA 4RA6A 4WBNA 3EY4A 4JEUA 5IVHA 1NFRA 3RU2A 2GKOA 4YYEA 3OPMA 4CIAA 1R6BX 4X1OA 3SF0A 3G6XA 6LDHA 3SE0A 3D3QA 3PGKA 1G7CA 1ZBQA 1M75A 3NEPX 1WHSB 2YV4A 1WCYA 2C42A 4A3KG 2VBCA 5FHQA 1OH6A 8ATCA 2J6BA 3I34X 4QX6A 5KTSA 1IN7A 4O8CA 2AA3A 1A9TA 1J9ZA 2ZQZA 4ZZ0A 2OG1A 3ED5A 2ZETA 2AX3A 3SP1A 2NX2A 5KCZA 3I2KA 1WZNA 4J0JA 1ZGHA 3VX3A 5CFNA 4UUPA 3BZWA 4IOKA 1C5KA 3VSBA 4EMBA 3NTOA 1MVOA 3HGTA 4NFSA 1GRNA 1IJBA 1FVOA 3ESCA 5IKXA 3HRHA 1VM6A 3SEAA 2XOXA 3BKWA 3LY5A 2JEIA 5THQA 3SVTA 3JTEA 2FOLA 4DUYH 3HB0A 3JWEA 2I66A 3MHPA 1N6IA 2W2XA 4EG3A 1SWWA 1JVBA 3HY6A 2AQIA 4I1OA 2W6OA 3OZRA 5CXUA 2WYIA 4ZVKA 4HDQB 5IXJA 3SQDA 4C21A 3PE3A 2ZIZA 3T1OA 1GAJA 4J16A 4DUZH 4L4YA 2OHHA 1HNXB 4TM7A 4UEJA 3BVPA 4RH3A 1LI7A 1OYWA 3KTMA 2VPXA 2IYPA 3D8SA 1FLNA 2J85A 2H0AA 3DEAA 5LZ7A 4OGGA 3IFSA 2PMBA 1JYFA 4YO8A 4CE6A 5GADl 3KHGA 3TBFA 4OBEA 5JY6A 5JAZA 3CUYA 4P86A 4F3KA 4ECQA 3VGJA 2A7XA 1RIIA 2GZ3A 1G1MA 1L5FA 3TGLA 4XIYA 5TIIA 4DA8A 4EYSA 3CLKA 3NBMA 2FY8A 3GVPA 2WU8A 2WUGA 1EK6A 2YVUA 4W5RA 4P7JA 4J0DA 4GQBA 4EF5A 1E1LA 3U0VA 4JV2A 1DKNA 3ZHUA 4GAEA 2V4UA 3BQMB 2BUBA 3SIPA 2WYVA 4F2DA 1H9BA 1RQPA 3PRJA 1A9XB 2ZYRA 4XDGA 5LQKA 4H1TA 3LVFO 1HZZA 5DCWA 4BNYA 3H13A 2W9BB 3JVVA 4AMUA 3A9SA 3O47A 1WL8A 1XYYA 2PPVA 2MMCA 3GRKA 2A9FA 3N1UA 5E1OA 1KK3A 3B1VA 4ZAYA 4AECA 5FWXB 1R6DA 1XTBA 1UJMA 2NVWA 3K9CA 1OTYA 3PTAA 3NIDB 4PZ9A 5TQ2B 1TU0A 3TJZA 5L8VA 4W99A 1OAKA 3BB4A 3MW8A 1LVGA 3PC8C 3RHSA 3R5XA 5T64A 4PLYA 3IN5A 5U1PA 2ZWOA 1I33A 3K2IA 4L02A 3UICA 1FCJA 4BNXA 4M7OA 2CXTA 4EFEA 3BUSA 4JYBA 3EXFA 4B2LA 1U8XX 2QX4A 4GT1A 3WLEA 2QJOA 2FPSA 4X1IA 4DUZB 1XNQH 1M0WA 4H15A 3ZKWB 4I3FA 4D9GA 2JEJA 3CLHA 4IGIA 2PT9A 3A6HA 5AKYA 5T7BA 4WDRA 3RVKA 1I01A 2NTYC 4B75A 1UQRA 3DLTA 3GF4A 3W1EA 4AIRA 3AY7A 3B82A 1ZOPA 3K6SB 1MRNA 1S01A 4WKPA 3ZCVA 3MJCA 3OTHA 4BRZA 4BX0A 3PGA1 3ZQ6A 4B3SB 1K8ZB 4OMCA 8ABPA 1VFPA 1T6ZA 4L0DA 4X7PA 4R3WA 1HE3A 2Y1XA 2IL1A 5HUHA 1II8B 1GDTA 1VMEA 1WU8A 1F2UA 2VVTA 3EZYA 3BA9A 1EG2A 4JCCA 2BMAA 5NLLA 1XDDA 3SG0A 3HWRA 3R0JA 5H68A 2JG3A 1M2VA 3ED1A 2QEQA 2A9QA 4RACA 1KDZA 4AJ4A 2PQ0A 1QR2A 5DTRA 5LD2B 3IAHA 4KR7A 1MB9A 3UMYA 3G2QA 4ZT4A 3JZDA 5B6IA 3N2YA 1AZWA 1ZBDA 2GN6A 2ACEA 4QJFA 2R6FA 1OT5A 2AMVA 2PLWA 4FILA 3P0IA 4WZZA 2A0KA 5J2UF 4WN3A 2WJWA 1PNTA 4UUGA 2XRMA 1FTQA 5K8TA 3GLGB 2VAWA 1XNQB 4M9SA 1N5MA 2ID8A 3M9NB 4PPQA 5J43A 4AN4A 4XE5A 1SQ0A 1L1FA 1PAUA 2WWXA 4FE4A 4OQ4A 3NPMA 4QFMA 3FZGA 2MYNA 3M6WA 4S1OA 3GK3A 2HGZA 3N44B 3ELUA 5FTWA 1CERA 5JG7A 5TMBA 2W9AA 1DNPA 1GJRA 5E2AA 2H7CA 4J94A 2HJHA 4E5KA 5EWGA 3RBDA 2X8LA 4JBXA 2WA2A 2GPJA 3TZCA 2YU9A 3STTA 2A8YA 4P58A 4A3IG 2I99A 4DSZA 3IMGA 2JBWA 2H54A 5CT8A 3DLAA 4NJEB 2FUG1 4EEQA 4C4AA 3DDOA 5AW6A 1TF2A 1V6AA 5AHXA 1Z4KA 2WAQA 1G3IA 2V3VA 3LC2O 3TQRA 1NRWA 4DQLA 2NO4A 2VF5X 3LFHA 3I01M 3TS1A 1QNLA 2CVHA 4GYJA 4N6OA 4KO8A 4E14A 1UKYA 1PTJA 4PQRA 5MDHA 3JSNA 1CEQA 2X2OA 4KQWA 3AZQA 2XCRB 2YBEA 4K26A 4YQEA 1FA9A 4TKUB 4A9AA 1U0JA 1PIWA 4IIGA 2C9DA 3JQGA 2WNSA 3Q85A 1DEHA 4JN6B 3GPLA 1JR2A 3A4TA 5LBUA 1CUBA 5EWFA 1FMFA 1YR6A 2QPLA 4XWOA 3HCWA 5IUNC 3QVXA 3Q5GA 4ZCRA 4XB1A 4MCIA 2DTXA 3SKYA 5JROA 4NSNA 4NP6A 1T2DA 3KEMA 1GGMA 1ISJA 1XZDA 1C80A 2RCYA 4M6WB 3FRIA 3OFJA 2GUGA 1VLVA 4UJ5A 4BCDA 5H7XA 4JY7A 5SZKB 3KZ1E 3LM8A 2PZFA 3F3MA 1DC8A 5AFSA 5JT1A 2EIYA 4PSDA 1CY8A 2VDVE 4O7LA 1VSTA 4KE7A 1ZK2A 3G0CA 2ORVA 3MMNA 2JA5A 3E9QA 4A82A 1OW3B 1YDEA 2DUJA 1UWVA 4ED3A 2VWGA 2JKZA 3ROKA 5EWLB 1W1UA 3RS2A 2NQ2C 1JV2B 3BKXA 4QQNA 4X6UA 1L3IA 4O63O 3ZNNA 3N8HA 4LNUB 2QPTA 3U7RA 1AF7A 4CQMD 3DEZA 1A4IA 1EWRA 3V6KA 4M0PA 3ND7A 4KXLA 1WCIB 3FZYA 3EUEA 3AU9A 2VHUA 5JIBA 3G6YA 4ZFNA 2BIFA 2P9GA 1UDXA 4R2MA 3KSAC 2C8VA 3ZDBA 5FI5A 2E1RA 3VR5H 4HEJA 1TKBA 4NECA 4J7CA 1B3BA 1WZCA 3FUWA 3CJRA 2VQ3A 3WBFA 3DW1X 1ZC4A 4AY4A 2D5CA 1P31A 3ML1A 3EVFA 5A5EA 3FOZA 3EGCA 3K0AA 1IBLH 1OREA 1VG1A 2H2DA 1CUXA 4KWTA 5HA5A 2HHLA 4R1NA 2CUKA 5EKDA 1XLVA 1J2TA 1KMNA 3RAPR 1JJFA 1CPYA 1XD2A 2W7OA 4MO9A 1T3GA 1Q7BA 3ONEA 1UIRA 2CYAA 4HXGA 5C51B 4C4ZA 1SN7A 1S8OA 4PZYA 4R9NA 4PU0A 3BHIA 3DCIA 3JRXA 4MGEA 2YNMC 3NEJA 2IE8A 3T3NA 1QAMA 2J4DA 4MQLA 1EK0A 2TSYB 2EVWX 3MELA 5GONA 3BGDA 1FFBA 3OCVA 3VNRA 4X62H 4WXPA 1UZNA 3PI6A 4YJ3A 3C3MA 2WD8A 5F98A 3GC6A 1K4MA 4L8FA 4BNDB 5JY1A 2R60A 5D86A 2AUTA 3U7HB 5TGDA 1E6LA 4ZOLA 3CEBA 5FRDA 3B3FA 3S70A 1SK9A 3ESDA 1IHDA 1LLCA 5ILGA 1LWNA 3WNZA 3K5WA 4GKBA 3ECAA 2FP4B 2YHAA 3UT0A 3AIKA 5SYNA 3A2KA 3Q15C 5KG0A 4EI7A 2QD5A 3QZ8A 3CVJA 2JCGA 1U0RA 4A3BG 4J9VA 1EK2A 4J0KA 1Y3CE 3GV7B 4FUQA 4DLTA 1XD9A 1C9DB 1W8IA 4KQHA 3I9JA 4GBJA 2IXDA 2QT1A 1K88A 1TPYA 4AG5A 2IHJA 3KHHA 1FJHA 3BWDD 3ISVA 2VPZA 3GTGA 1XZBA 1Y5MA 1IBLB 4EDFA 1ZNQO 4BN5A 1L4YA 4IW3B 3LZ6A 5D3MA 4IIJB 3R23A 1ZKMA 1C7QA 3HS3A 3DPIA 2ORWA 4L9SA 1I7LA 1DRUA 2P2CA 2NGRA 1I2DA 3G0IA 4WHXA 4RDXA 5DNYB 4MUNA 1U80A 1NASA 2HWYA 4CQLA 2IVZA 2Z43A 2B3TA 1C1YA 1AA9A 1QO9A 4X97A 5H02A 4A8JB 5KYXA 1MFPA 3LHIA 2OV1A 3HFSA 2P5YA 2XBUA 1T94A 1L7RA 4NBUA 5M7EA 5J9FA 4UCSA 2D0OB 4X62B 1QCCA 1WKBA 4PC2A 1VA4A 1S4MA 4NRDA 5JDCC 5D5PA 3R3ZA 1F2TA 1N7HA 2BR5A 3TN7A 2N1BA 1E9VA 5TVGA 4KPUA 4FZRA 3UWPA 3FPSA 4N9QA 4B4OA 3VR6A 2REOA 2A84A 1YFLA 1MT0A 4OX9H 5KX5F 2WIAA 1I36A 5K0NA 1DZIA 2QYTA 1DCMA 5EKUA 1XJ5A 3DMTC 3H2IA 1T91A 4I4TB 1I2KA 4UCTA 3OOSA 2CXSA 1M6VB 1WXEA 4BUCA 4DMCA 3I9V1 5JISA 5J2TA 1FQKA 1RI2A 1JJBA 3L7JA 4OKNA 4CEHB 1NSYA 5FUYA 3P0HA 4O7SA 2WTBA 3F7MA 2NMVA 2YNMD 2JLAA 2FR1A 1JLLB 1MPTA 3DDZX 2IW3A 4YT8A 4UQOA 2NZVG 1GPMA 3IOEA 3VR4A 4G0YA 4PGGA 3QE0A 4DIMA 3QEBZ 3P9SA 1FTSA 5F33A 1Y5IA 5JAUA 3D43A 4JZKA 4GF5A 3ZI0A 2ZR7A 3KELA 3CKMA 1D2MA 1KXJA 4D3ZA 1TCUA 2PFKA 4JHXA 2VP2A 3IR6A 4FNAA 4OXRA 2HEIA 4YUVA 1COWD 1MAVA 1CG6A 4QYIA 4KLAA 1G2IA 4TYMA 2ROQA 1JEYA 4CCSA 5EJ4A 2HMYB 5IK2D 3B36A 3HKBA 2WK1A 3ICQB 1NIPA 5K6AA 2DRIA 4CNBA 5IH7A 2ZUSA 3THWA 4A26A 2AWNA 1HSOA 4Z0HO 1G98A 1V4VA 3WMWA 1WMEA 4II3A 1FU7A 3QTTA 3ON5A 3ANMA 2IZZA 1DBSA 2HEGA 4PG7A 4RUKA 4QDKA 3ZGNA 2J33A 3MJ4A 1ULAA 3E5MA 2K7ZA 5DW3A 3Q6NA 3B9PA 3DE1X 4CLHA 4KBGA 3N0RA 1P5ZB 3AEZA 3EAGA 1DIRA 3S81A 3JASB 2RHRA 2AFIA 5AKKA 3RLIA 4DGSA 2VJQA 2P9ZA 3OOWA 1WDMA 4FR5A 4N5MA 1ID8A 4OX9B 4NC9A 4UUMA 3ETHA 1E1KA 3CBGA 3TFOA 2CNVA 1AN7A 1U4NA 3SS8A 5SYMA 2P9CA 3KS9A 1WMDA 3CZQA 2J9XB 4IRUB 5LP6A 3DE7X 4L6CA 2H3EA 3CISA 2DWPA 4HAZA 2FZ5A 1L1QA 4EF6A 4PZPA 5LOVF 4Y2UA 5GY7A 4UTZA 4Y9TA 3CUUA 2QBYA 2GEVA 4HVAA 4WLNA 2OCAA 4F9FA 3K6KA 4BFUA 1FP7A 3FLEA 4E46A 4YRSA 2YWDA 4Q34A 1U2PA 1CZKA 3ADOA 2Q6KA 4MO2A 5FWNA 3LCJA 3P71T 1GEGA 1H1LA 4ED0A 3AYXB 2DXIA 1FSZA 1FDUA 5GZ1A 3W9UA 4ZYVA 3DBIA 4KAFA 1N6RA 2H2GA 1QH1A 1PJ3A 3ZWOA 5JBIA 1ZMOA 2ZI7A 5HK9A 4MI9A 1NR7A 1LC0A 5GZ3A 4PYQA 1PV4A 1GSOA 5COQA 1HE1C 1OFIA 4TM8A 4KIJA 1ADCA 5BWNA 3KO8A 4KV7A 2JI6A 2AEFA 1O5IA 1I7PA 4Z86A 2R1VB 3TD2A 1GGNA 3X43A 2YJ4A 5LMZA 4PWQA 1L4EA 1CY4A 3KJEA 1YZVA 1MTZA 5JTTA 1AGPA 1MRSA 4DNXA 1P4RA 4J16C 1YS1X 3RC3A 3U7JA 4D79A 1N5KA 4F04A 4EA6A 5LB4A 2JCVA 3A26A 5ALDA 1JWBB 3RYHA 1XOIA 3NHZA 3M5WA 1WZ2A 3TR6A 1CQIB 5I9IA 5DHPA 4G5FA 1ZW1A 4CN9A 3C41J 1P6XA 3WLRA 4QRDA 5JU6A 1YBAA 3EWAA 2QN9A 4OLFA 4HWGA 3GB9A 3NB0A 4BEVA 3O9VA 3BQNB 3D5QA 1T1EA 2J0EA 1Q92A 5IUJC 1NMZA 2DR2A 3AI3A 4JENA 2CFTA 1WBDA 1HZZC 3REFA 3OEHD 3UBMA 3TO5A 2VJYA 1H6BA 3H3VH 5EGSA 5K03A 4LMYA 3MTBA 1J06A 1SK8A 2I7VA 5IS2A 2O06A 1T0JB 5CHYA 4D97A 1CY0A 5BVGB 4J2TA 5FFFA 5KVQA 3L8CA 2BFDA 2HRZA 1WDTA 3V4FA 3JALB 1BNCA 4J2HA 2ZIWB 3TW6A 4DTCA 3ZJVA 4LQCA 2NUTB 2GK7A 2P68A 1KEWA 3KAJA 1T8WA 4D7AA 3C3WA 1CVIA 2G4CA 4J9KA 2B82A 5KKCA 5CGQB 3EYAA 3CNHA 5SZIA 1I9CA 1ZNXA 4I1VA 5KNCA 2B1IA 2G80A 3ZBUA 1UXKA 2GZMA 5JVDF 2JIPA 2GLTA 4K86A 3DM5A 3EA0A 4EY4A 4ZEOA 2WUDA 3SPXA 4IDBA 2OV3A 6YASA 4BY1G 2FK2A 3UJ7A 3GILA 1K68A 1DADA 1A82A 2P6RA 1U65A 2M32A 4V0RA 3RF2A 2YUTA 1X1EA 4BC1A 5KFGA 1PJTA 2WYWA 1LQ2A 2G1AA 1MABA 1EHYA 1V4BA 3DC2A 4MW6A 1WXGA 1NMYA 2WM9B 4RORA 2G9VA 2R6DA 4LXIA 2BI8A 3K0HA 1ZQ9A 1JAYA 2ZBUA 3K1ZA 3T34A 2PHZA 2D7CA 3USCS 5TGZA 5KC9A 1JZSA 4G8CA 1RWBA 3S1AA 2C77A 4NCNA 4EFMA 3M33A 1DG9A 4PC6A 3EZNA 1QVRA 1BH2A 1OBHA 1V48A 2FW0A 3I9LA 3T38A 3TD6A 2H8GA 3MM4A 1G63A 1RJ9A 1R5NA 1A98A 1H2AS 2J5KA 3DBLA 1YBFA 1G0OA 4DSOA 2ODQA 5EIXA 2XT0A 1Z4IA 2RDMA 2PA0A 2QJTA 4PSKA 3CHYA 4DFDA 2NVBA 1JQ5A 5LDDC 2M6SA 1YC5A 2VP9A 2ZJZA 1FFGA 3UJNA 5CYFA 2P5SA 5LLTA 5IAJA 2Z6UA 5IDYA 2QRQA 1Z75A 2CMKA 2FVYA 2RHOA 4RXUA 2Q9CA 3PC8A 4RAQA 3PF9A 3JZ6A 2NSJA 2AG5A 2J9GA 4HH3C 1R6UA 3RUEA 4NNPA 2NWQA 3OG9A 3B6ZA 1V5FA 2H4FA 3NT2A 5A0FA 7YASA 2XA1A 3EXHB 1M8KA 4EPVA 2R8HA 4KXYA 3N76A 1C1XB 3VVCA 2C3MA 5BUQA 4PCUA 1WP4A 1KC3A 4XUEA 4OREX 3VHLB 4B3BA 5A3QA 5DDIP 2HCJB 2OO3A 1W2WB 1E9CA 2FZCA 5ILQA 4UTVA 1U2DC 3MK31 4XASA 3CKKA 1XLUA 2BV3A 4JK3A 4PC7A 1G8MA 4F9EA 3CVVA 4U7HA 1NOIA 1BE0A 4UPVA 4OKIA 3IBTA 3AVVA 1ZAUA 1PKXA 2YWXA 3P2MA 3EUAA 3A14A 3TQCA 4GOKA 1YV9A 5BYKA 1PTJC 1ZM7A 3AUKA 4RW0A 5FT9A 5E9WA 4JBNA 2GFQA 1I5RA 5T3YA 4ZQFA 4FFNA 2HSGA 1AGXA 4ZCIA 3FCAA 4HDRA 1Y9EA 3FMOB 3R5KA 2J4FA 4MTCA 4JT4A 2ONJA 2WIGA 1GD1O 3RYFA 4MJLA 2QTGA 4MMXB 4X8LA 2DUNA 2JATA 2DEUA 2R68A 4YP5A 4XJXA 1PS8A 2OCGA 1L7NA 3B6MA 3SLGA 4ZVNA 2E2HA 4CDRA 1BYUA 3ILVA 4AJJA 4QVIA 3S2FA 4C7XA 4CQMA 2Y99A 3M9WA 3A0UA 1Z6YA 5A06A 4IDHA 3Q1KA 4NL4H 3FCCA 4XLZA 3NVAA 1RYYA 2EWMA 2JNWA 3T0GA 5AW0A 2CNWD 1J90A 2RIRA 4E1VA 2X2EA 1AUPA 1M0SA 3EARA 3O5AA 2PKRA 3VOSA 3AJDA 3IP8A 5TLSA 3DO6A 4Y1FA 3O82A 1ZINA 1RAGA 2G0TA 2ET6A 3IAUA 4D6YA 1T9HA 2P35A 4FYVA 1CZHA 4MS1A 4OHUA 3U17A 3N8DA 3GCDA 1DFGA 2K2QB 2HK9A 1C9MA 3BQ1A 4F5ZA 5KG3A 1W4CA 2FSIA 1R9GA 4FFBB 4YGXB 1DKOA 3JZAA 2YOFA 4RFLA 2VNJA 1QQAA 2DLDA 5I5EA 1DC7A 2FH5B 3U4IA 5BQPA 4XCVA 3HKDA 3EVCA 4AFNA 2XGQA 3QQPA 5KFLA 4O0LA 4EZBA 1V3VA 3NH9A 4MCHA 1NXVA 4G89A 2YH2A 2BEKA 3TE6A 2D5BA 4OSEA 5IDQA 3DKRA 4MWCA 5TGTA 2JLRA 5EOYA 3ICPA 2UXDB 3TRIA 3GVCA 4ZODA 3DP9A 3CZ5A 5HQ3B 2Q4TA 1IG0A 1A50B 4E33A 1OX4A 2VJBA 1UOQA 4REOA 2X9VA 3W5DA 1U2EA 1S97A 1P9RA 4X00A 1JQKA 1DJOA 1MDFA 2OGUA 3ZWXA 3JQ8B 5HQJA 1TTQB 2AQ4A 1MZBA 5CD1A 4D9MA 2FSFA 5CA0F 1I6KA 4RU9A 3HVIA 3NXSA 2B2CA 2OA0A 1HZJA 1B1CA 2HWXA 3CWCA 2PBRA 1HWYA 2VEDA 2I33A 2J3KA 3S40A 1Y8QA 2FPLA 1C3JA 1Q6YA 1RQRA 4C6TB 1UMDA 2BMDA 4QDTA 1ISHA 1HR0H 4BWYA 2VF8A 3LVBA 4BTVA 3IVXA 1VSVA 5F2KA 1BZYA 2V7PA 5FFMA 1M66A 3RVMA 3NKLA 4LGCA 3R8CA 1YVPA 5FV7A 3CU5A 1J8MF 2HVRA 3Q7QA 3KEOA 2VA9A 1QHIA 4AG6A 5DLEA 1KVSA 5AT1A 1LTKA 2WQ7A 1V39A 5L3RA 1GXSA 1BDIA 4H7HA 4HWTA 3VVBA 4FT2A 1JTVA 5HP4A 1P9WA 3NHBA 2UVWA 2QYZA 5IARA 1JB9A 1A76A 4INPA 4PQGA 4L4SA 4JCOA 4WNCA 3O2SB 4PG5A 5KKNB 1GAEO 1JXAA 3W6ZA 4KBFA 3QPUA 3L8ZA 1RXEA 5EWEA 2MSEB 4D02A 2O2GA 3NC1C 3RVLA 3U3KA 5CUQA 3Q0IA 2XV1A 2DMRA 1S3GA 1WSDA 2PV0A 3O0TA 4XCQA 4IVQA 4JC4A 3C43A 1EE1A 1KEVA 2WAMA 4JJEA 1XVUA 3KKKA 3H4IA 4YV7A 3KV3O 4MPDA 3G1UA 2B83A 1EB9A 4YRAA 1F17A 5DG9A 1NNLA 5AVUA 5AICA 3N8KA 2VT7A 4LDPA 2IUFA 4U4AA 3G2NA 3H42B 3V48A 1LPNA 2UU9H 5B1DA 4BE4A 4L3OA 4UTNA 2PQ2A 2D8AA 1YQXA 1DJNA 3IDOA 1HR0B 2XUHA 3IB6A 3KAPA 1ESCA 3K0EA 4DWVA 4ZPJA 4DCJA 2QIOA 3MJRA 5DP2A 2QPOA 5JPIA 3H97A 3CVWA 5FA8A 5BWUA 2FETA 4R1MA 1HO3A 4RIEA 4P38A 4JXKA 1VIVA 2GN8A 5IFLA 5ADHA 1EDZA 1CZRA 2Q1YA 1M0EA 4KACA 2OH2A 1EFPA 3GA5A 3LGXA 3T1NA 1NL3A 2OFWA 4L2IA 2GNOA 1XVVA 4ENRA 1P39A 5L7YA 5IK2A 3I2GA 4I1RA 1UBMS 1X1RA 3U6KA 4EGSA 3KKEA 5DO9A 1FLVA 1AKTA 2ZR8A 1OOEA 3FSEA 4WK2B 1DCFA 2QTBA 3Q3EA 4BFVA 1JH8A 1YZUA 2WB2A 4D26A 2P9JA 3AWDA 4EMSA 4PINA 2PJZA 2VQFB 1K7CA 3O0DA 2VAMA 2GX6A 2DLCX 2FJZA 1GG5A 2OKGA 1FX0B 5H9VA 2AQ8A 1BXZA 1V1RB 2AOUA 3VX4A 3DUWA 1GPUA 1FMTA 1WMFA 5ECDA 5A3VA 3L5KA 3VJMA 5K8IA 3ELBA 4FS8A 4C5AA 5K6AC 2BQRA 3BE8A 3NCTA 1GG8A 1YJAA 4FKMA 5F2EA 3LL4A 1BXRB 1YQQA 5IG2A 3P0EA 1L5OA 1FRVA 5K45A 1BVHA 3KQYA 5DLQC 3PHBE 4I6EA 2WEKA 1H42A 2JJYA 3ONFA 1E2FA 3O7MA 4Q93A 1GLGA 1GAQA 1QFZA 4C14A 2X0IA 3PXAA 1WXIA 4JFRA 2RFLA 4B2PA 5I7HA 1X6VA 1IWPB 2IIBA 2PS9A 3N6XA 4A0FA 2VZ9A 3PX3A 1SXJB 3CONA 2E4ZA 2J46A 5JDCA 2P4QA 3RANA 4YJ2F 3ADCA 5LP6C 2FUKA 4EGJA 2ZWPA 3EZFA 2AKYA 2VK2A 4G24A 3CVZA 4I08A 5C1PA 3OFKA 4YDHB 7MHTA 2YOHA 4S0XA 3G0OA 4HN9A 1T1SA 2V55B 1RMQA 1VYTA 3FMPB 4CMBA 1X42A 4DQXA 5KG6A 1WA5A 2V0GA 2JGAA 3G8AA 5ENZA 1EX7A 3ZD9A 4PAMA 4QEZA 1AZLA 3GDGA 1ZXBA 3H2GA 2EJ0A 4DRXA 1ENZA 4RA9B 3DHNA 2LV8A 3DV0B 3H1TA 3IKVA 1Z6PA 1T8TA 3WLMA 2PAFA 1JXOA 5EIBC 5ERYA 2L19A 4LFCB 3EQ7A 5F1PA 3KJNA 3VR6D 3SFTA 1A3CA 2HHHB 3IELA 2GEUA 4C4PA 1W9HA 5FI3A 2OWEA 2TYSB 1VTKA 2JA5G 3D3KA 4DXDA 2VYCA 4MX8A 1Q1BA 4KO3S 3QEMB 4G5SA 2E55A 3TFWA 4JI8H 3H4TA 3B20A 4IG4A 1HV8A 4GO1A 3RBXA 1J0BA 1MV5A 1XWIA 4KR0A 3QHPA 4ZMBA 3U5ZB 6REQA 2FUG6 1YA8A 1Z56C 5DEIA 4ZQHA 5BRAA 5AM4A 1W8DA 4XGNA 5DNAA 1YVUA 4BXOA 3DFZA 3GG9A 1YA6A 3VR4D 1TW3A 4LRUA 4J76A 3ENQA 2W7PA 1LS1A 3JQEA 4BNZA 3JSXA 3AYHB 1KYIA 4CMHA 3RUIA 2XQGA 3OEHA 1HFJA 4LE2A 2IYYA 2AN5A 3AHHA 2GNPA 2RI0A 1KMHA 2SKDA 1CRWG 3F6EX 3L6OO 5DQIA 3P9KA 2BISA 2AN1A 4NTZA 3SF8B 3FW1A 3DZKA 3GGOA 5K8JB 3O1LA 3DOIA 4AZWA 1AA6A 2EJWA 4TT8A