3MJFA

Phosphoribosylamine-glycine ligase from yersinia pestis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
429
structure length
429
Chain Sequence
b'AMNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylamine--glycine ligase
publication title X-ray crystal structure of phosphoribosylamine-glycine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 128
structure length 429
sequence length 429
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mjfA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mjfA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjfA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 3mjfA04
4C5CA 4YJ3F 3TIGA 1JLLB 2W70A 1DV2A 4O7NA 5H80A 1AUXA 3KREA 4I50F 1B6RA 1M6VA 4O7TA 1KJQA 1E4EA 4MV8A 4EGJA 4O4IF 3OUUA 1DIKA 2Z04A 2NPOA 2R87A 1VBGA 3BG5A 2DZDA 3Q1KA 2YS6A 3QFFA 4WD3A 3AW8A 3K5HA 5BMVF 2SCUB 4O4HF 5LA6F 4MV3A 5JQGF 3ORQA 4M99A 3RFCA 4FFRA 4DLKA 1ULZA 1BXRA 4IHJF 2ZDQA 5HV6A 2ZDHA 2V58A 4RZQA 4EA9A 5CA1F 4FFLA 2YS7A 3ETHA 5LXTF 3VPBA 2GQSA 3TINA 3TIIA 2FPGB 4DIMA 4O2BF 4ZOLF 4TV9F 3R5FA 3I12A 3BSSA 3GIDA 1IOVA 1BNCA 5LP6F 2NUAB 2W6ZA 4ZI7F 2X0SA 2VR1A 3VMMA 1GSOA 2R6FA 4E4TA 4Y8VB 3WO0A 5EZYF 2HJWA 2NU9B 5JVDF 3R23A 1KBLA 1IOWA 2PBZA 3JZIA 2R7KA 4MV6A 1KUTA 4O81A 1GGOA 2IP4A 3JRWA 1M0TA 4FU0A 4C5AA 4MV4A 5CAEB 5C1OA 2J9GA 2GPSA 4ZQIA 2YZGA 3WO1A 2W6PA 2CNQA 4ME6A 3WNZA 3R5XA 1CS0A 2YZLA 3KAJA 4YAKB 2R82A 3U54A 1UC9A 2YZMA 4YB8B 2NU8B 3VA7A 2YYAA 5C1PA 2OLSA 1KEEA 2FP4B 4O7WA 1Z2PX 3HB9A 2FPIB 1E4EB 2GQRA 3KALA 1KJJA 3MWDA 4C5BA 4NYEA 2I8CA 3LWBA 1PX2A 5CB4F 4EG0A 1KJ9A 5KX5F 1I7LA 4O7ZA 4YBZB 5BPFA 3K5IA 3ORRA 4HR7A 2R84A 3JRXA 4O7YA 2ZDGA 5GONF 1KJ8A 1EHIA 2R7LA 1KC7A 5HBRB 3E5NA 2R7NA 3V4SA 2GLTA 4O82A 2XCLA 3N6RA 5JH7F 3HBLA 4IWXA 2R7MA 4FFMA 3RV3A 4IIJF 4MV1A 3BFPA 3VOTA 4XX0B 5JQWA 3G8CA 4O7LA 1JKJB 2QF7A 2W71A 3GLKA 2VPQA 2WYOA 4FFNA 2PVPA 1Z2NX 1EZ1A 2I87A 2CQYA 1C3OA 4O4LF 2R86A 3VPDA 2YW2A 2YRXA 4O7VA 1EUDB 2V59A 4O2AF 3ETJA 4I55F 1GSHA 1W96A 3SE7A 4FGRA 4WBNF 2VHEA 4MA5A 3DF7A 1M0WA 4M9UA 4L1KA 3MWEA 1VKZA 4O83A 4EABA 4O86A 5LYJF 4O4JF 4QSHA 1W93A 4TV8F 3OUZA 4IWYA 3RV4A 5C8YF 1CE8A 4M9CA 2NU6B 4HQ6A 2DWCA 1EYZA 3NUAA 2YWVA 3VPCA 4MAMA 3LP8A 2DIKA 5J2TF 1SCUB 4FFOA 1WR2A 4FE2A 3U55A 1A9XA 5KKNB 4EAAA 1DV1A 4XYMB 2W6MA 2C00A 2XD4A 1OBDA 2FB9A 5FNVF 3TQTA 1Z2OX 3HO8A 5LOVF 1C30A 2W6NA 3N8DA 2VQDA 4XZ3B 2YZNA 3U9TA 5DMXA 3MJFA 3JZFA 1CQJB 1GSAA 4O84A 3G8DA 3Q2OA 2PN1A 1PK8A 4O7SA 1AUVA 1VBHA 2I80A 4EA8A 2HGSA 1EUCB 2Z02A 4XYLB 3BSWA 4J6EA 3KAKA 4IZOA 4YJ2F 2V5AA 2CNUA 5K2MA 4HNVA 3R9RA 3TW6A 4TUYF 2CZGA 5I47A 2FPPB 2NU7B 3K3PA 3BSYA 4MV7A 2YRWA 3UFXB 3V4ZA 1KJIA 5BPHA 2YL2A 4EGQA 4ZHQF 4EA7A 5JVLA 5IYZF 1UC8A 2W6QA 4M98A 2CNVA 1GLVA 3U9SA 4GGMX 3R5HA 1CQIB 2GPWA 4FFPA 1JDBB 1OBGA 3RUPA 1I7NA 2W6OA 4I4TF 5J2UF 4MV9A 4HNTA 5CA0F 4MA0A 4YAJB 4O7RA 5D8DA 1B6SA 1A48A 2DLNA 3AX6A 1T36A 2P0AA 2R85A 1JDEA 2QK4A 4HNUA
chains in the Genus database with same CATH superfamily
2Q3DA 5E2IA 2C2XA 4R1QA 4UMDA 5LQMA 3IE0A 3D4LA 3GLIB 3E4DA 3LUKA 5J2UB 3GP3A 3FMFA 2WZQA 4OX9H 5AP9A 4GSLA 3T1OA 1QQTA 2A5LA 4AWAA 2BSAA 5AJZA 4L8VA 4XM2A 3ORQA 3G7NA 3CNBA 4FLFA 3TQFA 4LBVA 1RHKA 3DPUA 4IV8A 4EYOA 3LKZA 4RVDA 4PG4A 2C1XA 2V6MA 2FK1A 3U4QB 4LK2A 1U8TA 2M1ZA 1PJLA 2AOTA 1RAFA 1G0OA 3HYLA 2X0EA 2GYYA 2OVFA 3OQBA 1A4IA 3PPWA 4TL9A 4AECA 4RKEA 1SXJD 2HNBA 2C4TA 3TLCA 1G18A 1SXHA 4JUZA 3PA8A 2CFSA 4EM6A 3I2KA 4LOIA 3ETNA 3SNHA 421PA 5H7XA 1BDIA 3OEWA 2NUBA 2FWPA 4EKIA 1IQUA 1N6KA 4F4YA 4AFNA 2YBDA 2QV7A 2QYZA 4AJNA 4DR2B 4YIHA 4E08A 1PD0A 5J9FA 4I0WB 3SM3A 3KSZO 2CNQA 2KPOA 2UUCH 3HB5X 3K96A 4Y2YA 5IKMA 3K1YA 3ILVA 1B04A 4N1AA 2R6GA 2VA8A 2VTDA 4FMCB 4F1JA 3GMSA 1R66A 3REQB 3C3CA 2W2LA 4NNOA 4AYBA 2B2CA 5F5XA 4U3JB 4B35A 4YJKA 1WXHA 2IXFA 3TZHA 4MRPA 2SNIE 3Q7EA 1R4NB 4K28A 1TMYA 2QYHA 1EBUA 3HABA 3IALA 2OBLA 5CT6A 3RIHA 3TLGA 1YD7A 1DL5A 2PMEA 3NC4A 4YH1A 3DA8A 5DM0A 4AN1A 2OXTA 1KFEB 3PPXA 4JYZA 2EW1A 2J0SA 3A1EA 2OH2A 2NO4A 2PMZA 2X2PA 3TZ6A 4D3FA 4AKTA 1Y1RA 4X6LA 3ZE1B 2YW2A 3LQYA 2JFOA 3Q40A 1HDIA 3OJ0A 2C92A 3TQCA 1CQPA 3K6SA 3GT3A 4EABA 2E4UA 2X1VA 5IWAH 4U6SA 4TKVA 5ALKA 3GEDA 1IQ0A 5EQDA 2YVLA 3QKSB 4Y1RB 4UD2A 1HYEA 3GDEA 4UQPA 1DAHA 4DCPA 2MJLA 2VDQB 3U5TA 5KQSA 1EWYA 3OZEA 2ZE8A 1C7FA 1LW7A 1YK0A 3TRHA 4UBJA 3U1BA 3SYNA 2JAOA 3E7WA 1ISGA 1KR5A 2EJWA 1KIMA 2FKNA 2R6HA 3FWNA 4IXMA 1KOGA 3A9TA 1G7CA 2P4UA 5G0WA 1JEYA 4JOCA 2W6NA 1IIBA 5BN5B 4J9QA 5FTJA 4O84A 4GOKA 1AZLA 3KB8A 3CZ9A 3TQRA 3NLLA 5DN9A 3GLGE 3GJYA 2YQ4A 2AFIA 4OV6B 1LDMA 2IJGX 1I24A 5DGDA 4J0JA 5HUQA 3E15A 1M2HA 3VZCA 3GLHB 3R9RA 5BVHA 4OQMA 5GVRA 3CJQA 2F64A 3ZYCA 3DAFA 3CCCA 5EIFA 2EBUA 4A4DA 4KUEA 1A8QA 1F12A 4KRXA 7GPBA 5FQNA 1OX4A 2NV2B 3QE9Y 1NVGA 2QG4A 4DRXA 2IP1A 3OSNA 2X7HA 3COSA 3KDPA 4C3UA 5CDHA 2XC9A 2HEIA 1YS1X 4OFXA 1GDHA 4N5HX 3MOSA 2R85A 1XTQA 1UDCA 2QI9C 1ZBDA 2A9OA 3B7PA 2RHHA 2Y8EA 4ES6A 2VPSA 4YRRA 4F04A 2DPJA 3EXG1 2BGKA 4AJHA 2E5LH 1FUEA 1K5GA 3LYUA 1LSOA 4CYMA 1UPBA 3H3XA 3OMWA 5AK5A 3RCBA 3IIIA 1G9XA 4NOKA 2UXCH 2BR0A 3KLMX 1NASA 5IAKA 1V26A 1PFGA 5JCZA 5DNDA 3QFTA 1YZ3A 2BIFA 2H06A 2PL3A 5L1LA 1CVLA 4NS4A 1G4HA 1KFJB 1XA3A 1RQXA 3UMFA 2I2XB 4ZVRA 2J33A 1QFYA 1E2NA 5FBKA 2BFNA 3AYXB 5C7OO 3NBZB 2CHGA 1Y6JA 4KIWA 4EEQA 1XZKA 2AWOA 3RC2A 2IYZA 5SZKB 3HLKA 3W6OA 2ZSAA 1FPQA 1Z22A 4MQEA 3P32A 4LIPD 5JJKA 4HSEA 3UB4A 3WADA 1I32A 3ZE9A 4MV5A 5IVDA 5HKLA 4E33A 1RP1A 3GI1A 1NVWQ 4Y8VB 4X93A 1JR3A 2JKYA 4ZARA 3E82A 2X0DA 4DJJA 1KEZA 4IKOA 1SXJE 5AD1A 3NEJA 1QF6A 2HL6A 3HCNA 2JARA 2PRSA 1LLUA 1P9WA 3FPJA 1X1EA 4F5EA 4DV5H 4WBXC 4BNDB 4CEHB 3RIEA 3BEDA 4DAAA 4DR5B 4QD3A 4BV3A 5M2QA 3W5BA 1E7SA 4BBSG 1IQPA 2AUMA 2D1RA 1P7YA 4NC9A 1FJGB 3DZIA 1BJKA 2RHTA 4QFMA 3ZY4A 5C8YA 1DXYA 2B2XA 3D2BA 2A1IA 1E99A 3EPJA 5HMMA 3V6LA 3SBDA 3DO6A 4RXMA 1UZNA 5K1ZA 3KRTA 1HZZA 3T5PA 1BWSA 1I2KA 3TF5A 2BQUA 1NXWA 1Z2AA 4WSOA 1KEWA 3NHZA 2R92A 5BQXA 4BFLA 4FFVA 1EFUA 1H0SA 2AVNA 3NVAA 4OHWA 4FNAA 4BJ6A 4DHWA 1P5HA 3OMXA 4H3KB 1CKNB 2P2NA 4MCIA 2F1KA 1O6CA 2B20A 3CW8X 3BHMA 3NG1A 2VJMA 2C8VA 3WL4A 2IYOA 5ICEA 3U3JA 3IR6A 3T3MB 1OX6A 1U28A 2J9ZB 3BTSA 3AR8A 5H3LA 3M3PA 1PS8A 3G0IA 1E3WB 2HAEA 4BO8A 3PW4A 2HHFA 2E55A 4JS0A 5BOSB 4DOMA 2FOXA 5F3WB 1GDDA 4KQ9A 1E9BA 2H2WA 2NXJA 3VJRA 3PKIA 4UTRA 4DJAA 1A9OA 1S0MA 1T6XA 4PM4A 2Q7OE 4PAOA 1XT6A 4HGNA 1BGWA 2XD4A 1DEOA 3IPCA 1KMHB 5CB8A 4XUEA 1FU4A 3VKGA 4CKWA 2L17A 4KACA 4IINA 3OC6A 5CPFA 2VRNA 3SYLA 1R0XA 4E2YA 3LCUA 1HA3A 2JK0A 5KG7A 3H3JA 3JATA 4LXTA 1ZGAA 1WW8A 1PU2A 4Z4FA 3N0TA 1XMIA 5CXXA 4R2HA 5JI2E 1MG0A 3NS7A 1OLUB 2ZIFA 2IHBA 1NT4A 5T4HA 3TM4A 2AOUA 1USVA 1P1IA 3AG5A 4D79A 3WK4A 3UWSA 3HCRA 2CHUA 3RSCA 1U5BB 1H9CA 1I6UA 1Q95A 3A31A 3CH6A 1MN6A 3GRVA 4UBLA 4P08A 4REOA 1YS6A 2GM3A 3L41A 1PFUA 5KQRA 1MQSA 1UDWA 4BC1A 1WQ4A 2VAWA 2KBFA 4MVJA 4A2PA 3EZ2A 3PI7A 1TLLA 1VB5A 4KBFA 4QGFA 2B92A 5KFNA 4BAZA 1H05A 4GXRA 4GVPA 5BN3A 5BWMA 3U7QB 3OT5A 3GUYA 1YA6A 4FUQA 1TPYA 4AI6A 4HTFA 4Z49A 3UAOA 1U98A 1XPOA 1E6WA 3E9ZA 2QSUA 3EOZA 3HI4A 4X8LA 5DYIA 1QIIA 5DNAA 5BXQC 4CC5A 4JYCA 5KC9A 2WU8A 4G89A 1AVTA 1XZAA 1U94A 2XDWA 3IAXA 1Z6QA 4W1RA 4JUFA 4P5EA 2RARA 5ELXA 1PR3A 3MS7A 3MWYW 3ADPA 2XUOA 5HE9A 1N2HA 4CPDA 4BNLA 3GLGA 1A8UA 1DIHA 5CX1A 2GASA 5IN4A 4FYHA 4WN9B 3KD2A 2YNMA 3R0IA 1UMDA 1JDZA 3QM1A 5JAUA 3LYLA 2FW6A 3OF5A 3H2HA 2H63A 3NOQA 2HD4A 1RXWA 4GL2A 2FGKA 3HV0A 5SZJA 3S3TA 3HY3A 4RSRA 4YRJA 3LT0A 5KFVA 3TW7A 1T2AA 2GTPA 3U1VA 5F5NA 1FDVA 3VMMA 16PKA 1I6LA 4I66A 1OWLA 2Q21A 4GM4A 3UNXA 5HEKA 3AR5A 1G21A 3GD7A 1FUYB 2NN3C 1G66A 1GTJ1 1KY3A 1KVUA 3FCAA 1L7OA 4S1NA 1LF5A 2BFEB 3EA4A 1CE8B 4BBZA 4KIUA 3ZGVA 4URUR 4C2TA 1UKAA 3MTEA 1XNQB 4OU5A 1E1CA 5I5TA 1EVJA 2J5QA 4ATNA 2XGMA 1KAEA 2VP0A 1X74A 5HJ2A 3GJTA 5KJCA 3F6YA 1QYVA 2CT8A 2F1OA 4EDFA 2JAXA 2JCGA 1RU3A 4QPCA 2R92G 1T8UA 3VRHA 1CJSA 3WLTA 1XYYA 3AHJA 4A16A 4O7ZA 3KWFA 4DCOA 4MB0A 5FO0A 5IVKA 1H3FA 2WJHA 2E2IA 3BOSA 2FPUA 4FYYA 1Y4UA 5J40A 5I8WA 4K5QA 4NCJA 4OP3A 1E7RA 1PVDA 4RQTA 5LUBA 5J47A 3PGLA 1S97A 2ZSIA 1YB5A 3MQFA 3OQHA 3MJHA 1DAMA 1KDOA 3MT7A 4HOYA 3RAFC 3VO9A 2LW7A 1CF4A 4EFKA 2JGNA 4BPRA 1ZVVA 2OXFA 1SXJA 1KK2A 4O2BB 4ZQEA 3WGVA 2QJOA 4RNCA 2BH9A 1PK9A 3GB8B 4FCTA 5B6JA 1EJ0A 3WIOA 4WNIA 3MWEA 2XMDA 7REQA 5JXGA 5DCUA 3CLVA 3JZ6A 1YO6A 5I3CA 2P7IA 2G36A 3D7RA 5DM4A 3PDIA 3ZI0A 5BVGB 3I2FA 4TTJA 4BV9A 4RVSA 4JJ7A 2X8JB 2A1HA 2W4QA 3D1JA 4QOIA 2DH5A 3SICE 4CV3A 1MAHA 2NO0A 1Q12A 5F3DA 2IEAA 4U7DA 1DJOA 3G5MA 3HCCA 5CA0A 1M2JA 2CNDA 1QORA 2YINC 1Z2DA 2IHKA 1CJMA 5EMLA 4NOJA 1RJRA 4PSAA 4FIDA 4KR2A 1L5YA 3BDIA 3CF6R 3DOJA 1RI2A 4ZQCB 4JYMA 3CRQA 2YHAA 1DG1G 5F3RA 1Q92A 4QXQA 1A27A 1WW3A 1PJRA 1EDOA 1TK2A 3CB4A 4QXRA 4YUYA 5K6TA 2HRBA 3BIWA 2Q5LA 5ALTA 1UZUA 4F2WA 5CB4B 4DLYA 1DX4A 3MYYA 2PSHA 3EVDA 1S8OA 4X1OA 3F96A 4MVJG 1EA7A 3CEHA 4IJVA 4L2IB 4KWEA 1BYUA 4ZVVA 3SF8B 3UYKA 2DB3A 1U3VA 3EC1A 4M98A 4K0RA 4JYPA 3KJXA 3O8CA 1E98A 1GT6A 2QVLA 3RS4A 2V7XA 4IRCA 1T5OA 2O19A 1T1RA 3VTAA 2YTZA 1UXOA 2FE3A 3MRSA 3JS5A 4HI0E 3NBFA 5CIWA 3LH5A 1RBQA 3JPYA 2GF0A 3R8XA 1M6HA 1JIVA 4GKBA 3WVNA 4G63A 1WNFA 1YF3A 2B78A 4MV8A 5DHUA 1ZL0A 1E96A 4JYAH 4UOQA 3L7DA 3N5KA 1YL6A 2CF6A 4KTVE 5IDYA 3HZRA 2Q5QA 3NHBA 4YCJA 3CN7A 4K86A 1GQOA 5LC1A 5KJ1A 2JDIA 5LD2C 3GTGA 5T14A 1GL7A 4RD2A 1REQA 3I9OA 1M34A 2Q2VA 3ACCA 1XZJA 4DSAA 1CTQA 3OFNA 2C84A 3UGKA 1ZEJA 1EZ4A 1VBNA 4JP3A 2ZGIA 2W90A 3VDQA 2YMPA 1G5HA 4APMA 3H4IA 1ZUHA 3LZDA 3BHNA 2O03A 4TLMB 4L3WA 3FLBA 1G8AA 4PNEA 4U0KA 4FBLA 5LP6F 1VG0B 2PWPA 4Q24A 4LK3A 3JU3A 1V37A 5AWFC 5THXA 4LECA 5I9NA 1YNOA 1JEQA 1G42A 1NWCA 5KNDH 3RG2A 4GLFA 1KYWA 4YV7A 1SO8A 3B60A 3L02A 1PJ3A 4F21A 3IRUA 1JDPA 4UM7A 4LX0A 4YQWA 3FMPB 3TEJA 4LGVA 5K8LA 4CQMD 3BAFA 2JHPA 1GAXA 2QXUA 2YV3A 4ZZ0A 1J09A 4BBRG 4H6VA 1YACA 2Q5FA 1IWPB 2VDLB 1C0PA 4MAFA 1AF7A 1NY5A 4JELA 4OPMA 3KQUA 3GUZA 1SC4A 3DYVA 2R6ZA 1WXDA 1II8B 2X2FA 3A6JA 5EHXA 2HCBA 4ENTA 3LWNA 4BFZA 2YJ3A 1L2TA 1NONA 1NP3A 2AR0A 3H9BA 5EJGA 1ISRA 1ZC3A 3EXIB 2XGOA 1CVIA 4FMDF 5ALDA 5ADHA 3RI3A 2VK4A 4N5IX 2WBLC 3AJ8A 3HCFA 3H1GA 2RH5A 2OCDA 1K8QA 3EVNA 2XX3A 5E4JA 4BL5A 2LD4A 4KNYA 4XX0B 2FX2A 4NZPA 3IUJA 4X1YB 1SHTX 1RC0A 2A2ZA 3PENA 3A6HA 3U7GA 1JDVA 4Q18A 4PF1A 3UIEA 1IXYA 1QR6A 3ZI4A 5JISA 3DL4A 1OCEA 2I1QA 4R1NA 2VQFB 4OB7A 2IOFA 3THWA 1W5BA 4V1CB 4PVCA 1SBQA 3OFJA 4AMBA 2GFHA 3G49A 5BYJA 3SU8A 1HV8A 5DOVA 4I8DA 4Q43A 4NJOA 4JVSB 3I45A 3EEQA 3QXJA 5C37A 1L4HA 5P21A 4EG8A 1T3ZA 3M2TA 1PTJC 5TSDA 1T6YA 5FTNA 4RE6A 4EFBA 4Q8FA 4CCYA 4EG4A 4ZCIA 5DX1A 4L6AA 3CPHA 4JX9A 2HJRA 3WIBA 1CF9A 3OKAA 4B6EA 1NVAA 2H59A 4Y2PA 1EBBA 4YJHB 1ZDMA 3ABQB 4W82A 4ZTBA 3QRWA 4N4AA 1J0EA 2QT9A 1XNRB 1YV9A 1G16A 1O5IA 1PCXA 1AKWA 3JSNA 2QW8A 4CQLB 1CUFA 4F3YA 3S8EA 1B8VA 2NTEA 6REQB 9GPBA 1GRQA 3HT5A 1TVKB 1WCWA 3GFFA 3TKLA 4DMLA 2DUUA 1Q7TA 1RHRA 4PBCA 3O7WA 4LJLA 4PYMA 1ZI8A 1II0A 4BX0A 2C8KA 4LXIA 4RBNA 1GOTA 4NYJR 1IZZA 2ZUTA 3THYA 1JVSA 4NJMB 2PZJA 1XI2A 3LQ2A 1DMSA 3TTVA 1Y80A 3U9SA 2WQ6A 3RC1A 4RTNA 1Z7YA 1ZD8A 1PR2A 1ZH6A 2EERA 5JNSA 1OU0A 3MB8A 4L9WA 1JX4A 2ZR7A 3NAMA 4DNXA 1EHYA 3H4DA 1A9TA 1KBQA 1M8FA 3UUWA 3PUKA 3C5EA 3WNVA 4UFNA 5EHNA 3LLVA 1HG1A 4BMCA 4ENRA 5LQCA 4GO1A 2NV6A 1FQKA 2ZLBA 2UVPB 1JEEA 3DDHA 1JL3A 4WFIA 4KSYA 1UJ2A 2CSUA 4WQMA 1MEEA 3SZGA 1V11A 3IPAA 3D0QA 3NUQA 1K97A 1W73A 4QLAA 3I2GA 4JJ8A 4ACAA 3SQDA 1KWGA 2OKGA 1NPYA 1PR4A 1DTEA 4KMRA 2ZDQA 1QYWA 5AK3A 1WR8A 3K1JA 4NQZA 3TRKA 1QZTA 3IVCA 4HAOA 4QDTA 2AB0A 3VI4B 1JYEA 1NJ8A 4ITUA 3IV6A 2X2OA 2AZTA 2FZEA 4M7OA 2HK9A 3AWIA 1XMSA 5G4KB 2PLRA 3Q6NA 1YJ8A 1L5GB 3MOIA 5GZ6A 3W8RA 3TUJC 5FWYA 3DNMA 3RSLA 3CVUA 1BKYA 2G1UA 1KAHA 4J75A 4O3NA 4DJFC 4IIJA 1YJQA 4AY5A 3V8VA 2VNAA 1Q57A 2UYHA 3IP3A 1IOWA 4ARZB 4XIIA 3AHDA 4J1QA 5LP1A 4YRCA 1R0WA 1V9CA 2A9VA 3IDSA 2FZGA 3PJDA 5IYZB 4KC0A 2NO7A 4BU1A 1K86A 3ZJ5A 4D96A 1RK5A 3PC2A 3SVZA 1QIMA 3IT1A 1MOSA 2P3QA 5I4BA 3KUXA 3GK3A 3TMYA 2QVYX 4Q3CA 1JECA 2XTAA 3HXPA 3VO1A 4KQMA 1A0OA 4I6EA 3KB2A 2VNKA 1Q7RA 3WYBA 5IHPA 3PNBA 4Q7QA 2R1VB 2RHDA 2M6RA 2PUGA 4J91A 5I5UA 4HPJB 2XXJA 2ILVA 3MGBA 2OV3A 2ID9A 4E7PA 1PL8A 4GEGA 4W5NA 2WIBA 2WTXA 4C87A 4AS1A 3UB3A 2XMCA 4KQGA 4JI0B 3V55A 1WO8A 3T06B 4GGOA 1U11A 2NXEA 4JV5B 2XTNA 3PW2A 3TDKA 5DBEX 1BSVA 3H16A 1ORRA 4ZYZA 2Y9PB 1ECGA 2MOKA 4UU8A 3VJMA 1E7YA 2JL1A 4DIKA 1JHYA 4E5PA 4NOLA 1LV7A 1CZUA 5G0UA 1GEEA 1DQZA 4MW9A 4TVOA 3OZCA 3ZLTA 1X8JA 4HDRA 4EJSB 2QL6A 5BNTA 2FDCA 3ACBA 3V9AA 5A5FA 1ZUWA 5T5QA 2ZR0A 2DBQA 1USGA 4I5IA 2YVQA 3QVXA 3X1YA 2V45A 3EAGA 1S0UA 2RJ3A 5IDQA 2CLSA 2OBBA 4XR4A 5ITWA 5F9FA 5C4GB 4ZCMA 1Y3AA 4CM3A 1V25A 2N3ZA 3H6GA 1NV8A 4EJFA 2FRVA 4HP8A 3WL3A 4D0LB 2FN4A 3VPCA 1VZ3A 1MC5A 3R7SA 4II7A 5IABA 2PFGA 4QJIA 2YIJA 3NETA 2W2LD 3MWGA 1Z5UA 3OOWA 3HY4A 4KOAA 1FP4A 3MXTA 1NXVA 1T5DX 4XSVA 2DH6A 3WNQA 2SCUA 2XDQA 5IUNC 4DV0H 4RMNA 3QYAA 2B82A 5AOBA 4XM0A 1OA1A 1GSAA 4QSMA 1C81A 4QM6A 5IF3A 1E1DA 2VKQA 1OAKA 3A1CA 5BW8A 2V5AA 3NXKA 2A5GA 3DTTA 1J25A 4NYIR 5L8VA 2A7QA 1CZOA 1Z37A 1N2OA 3HBJA 4J43A 1FS5A 4X6YA 1TVEA 1FUIA 2C88A 4DLXA 1QOPB 4CRWB 4H59A 4BKUA 4KQ6A 1KMCA 5JIBA 1J0DA 1QE5A 2GARA 4FI3C 2PQMA 3E27A 4GUDA 1M6YA 1Q84A 2HIVA 5D8DA 2GXUA 1WULS 4YNBA 4OQQA 5DBIA 1ONSA 1WMFA 4KR3A 1CNMA 2VK1A 2Y9MB 3Q3CA 5GJBA 1M6VA 5EQTA 5H3HA 4M86A 3ZQJA 2Y4NA 2FEOA 2I0FA 2XZLA 1T9AA 2JLXA 2DPGA 2HSJA 3L0BA 2OQVA 4PHGA 3U02A 2EFHB 1KDVA 1JW9B 1Z5PA 1WB5A 3SFVA 1XOIA 4ESEA 4YK7A 1UZMA 1MABB 1Z0KA 3BXHA 2EQBA 1F8FA 1WZEA 1ISPA 5JJLA 3FDXA 2F43A 3CONA 2UYYA 2CLKB 2BZGA 1U8UA 3AM3A 1JKJA 4EI2A 3ROMA 3BSFA 1Z6PA 5GM1A 3FNRA 1TA8A 3ASZA 4GQBA 2XA2A 3BERA 1LC0A 1EWRA 4A0GA 4AXBA 5CNIA 3SSNA 3NYQA 1COWA 4B3SH 2ZAIA 3EHDA 4AMUA 2VR1A 5B3JC 2PA3A 2NUTB 3GTMA 4YQYA 4JI1H 2DR0A 2OV2A 1F20A 1X8KA 1E9DA 5B6PA 3GPCA 1C0EA 2VFAA 1ZONA 4KO4S 3OF2A 2WFAA 3B9QA 4C5AA 1O08A 1C9EA 4GZLA 1KY4A 1I8TA 1N1MA 4QWCA 1EDBA 4ZGWA 1N5RA 2DMRA 3D8TA 3TFWA 4MTEA 1U3UA 5IH3A 4EK9A 1A2OA 1NVTA 4WTOA 4L78A 5KNBD 3UTDA 1X9HA 1SK8A 3WWEA 5AXBA 1ICIA 1ZH8A 5CDTA 3HVRA 1RAIA 3WLSA 4YCMA 4EPWA 4G07A 3ZW7A 1Q3TA 3D3KA 5EJ4A 4Q16A 1KC7A 5HBRB 3EQZA 1ZW1A 2IF2A 1FUKA 2CW7A 4ARUA 1NC1A 2WG2A 1VLVA 2V6BA 1W47A 3ETLA 1W7AA 1YC5A 3IV7A 3S1AB 1TFUA 3H1TA 4OCZA 3T3OA 1X14A 3MJ4A 1DDIA 4RFVA 1KHHA 4JIMA 2RAUA 3QF7A 5E7QA 5KYGA 4XUGB 5EMMA 3DKPA 3I01M 1JR3D 3CURA 2VDVE 4G5QA 3QVLA 4EF5A 4IUYA 2CE7A 2IXTA 4X65H 5ABPA 1WXXA 5H68A 1XDUA 5AHXA 3STYA 2EFEB 1FNMA 2D4HA 2QDKA 1GGFA 2XQVA 5K0EA 3ZHUA 5HF6A 2EJ3A 1X2BA 4J2TA 1BN7A 2WKSA 5LL6b 2ALJA 5IU6A 5B3KA 1QWSA 1CY0A 4OBWA 1RXUA 1BOFA 3HJFA 3HKEA 1YFJA 1C0KA 4OXQA 5FI5A 1UBGA 3BB3A 5AXDA 4Q9LA 4DADA 3OTHA 2OILA 3WB9A 1Z9BA 4MLZA 3CJRA 1I3LA 2R6JA 1XNRH 1T6ZA 2VJKA 4NG4A 5TF0A 4G26A 5KSWB 1E3SA 4WE3A 3P0RA 4AYBE 2D5BA 3RBAA 2AOTB 4R1SA 1J56A 2Z83A 1RAAA 2UXDB 1PP4A 1QSGA 1NQOA 3ANYB 3DULA 5C18A 1N6OA 3F3KA 1Y4SA 5IYDG 2EIYA 2WNIA 3GWZA 5BO5A 3MCWA 1T24A 4B0OA 2B1QA 3AK4A 2QVBA 3T9EA 4ALIA 1V6SA 2LDXA 4PSCA 4C4PA 3W2EA 3HPRA 3JVEA 1A8PA 3CB2A 5B7PA 3DXFA 3RUPA 1GTVA 2PMZE 4CMDA 3O38A 2H52A 5IBPA 5FD5A 3WAKA 1MX5A 2PX8A 4JI5B 4C3ZA 3BILA 3E18A 1P3JA 5MDHA 2XJ9A 3OZSA 4O4LB 2OO3A 4QUBA 4ZI7A 1SVOA 4LHZA 3W6NA 4PBTA 5K3OA 2MSCB 3B78A 1G7TA 5L1JA 1PG5A 1I2MA 4P6VF 3QJGA 1GYPA 2NUPA 4WK2B 2IXBA 1X7YA 2H7CA 1A88A 9ABPA 1O96B 3R3VA 5IT0A 2ZB7A 1ZQ1A 4PGMA 1RZUA 4F9TA 1WD7A 4OIMA 2WUFA 2ASJA 2AR7A 5C35A 5JFTA 5KVQA 4QWDA 4DLKA 1DKNA 3DBRA 2BMJA 3ZK8A 4PZ0A 4BLUA 4GIBA 4TM8A 3KR1A 3PB3A 1WMAA 1RPZA 5CURA 2CXPA 2PZLA 5E0OA 3DVQX 4P0PB 3C8UA 1E5DA 2B8JA 2EF0A 2BY4A 4M21A 3KYBA 3WKDA 1E2DA 3M49A 1VGRA 4P4UA 1W4LA 4HWTA 5EJAA 3DKIA 1FSPA 1NU8A 4CDMA 1EGVB 1FRZA 1F51E 4E6PA 1Y6ZA 4BLRA 4TVKA 1HRKA 4MVJD 1V16B 3SG0A 2R8BA 4L4UA 4CKZA 5HJEA 3GZNA 2QTHA 3QLVC 1CRPA 4TKVB 3GNQA 4EW3A 3R0QA 1Y1PA 1W0KA 2JI6A 1R5NA 3WNZA 1WEKA 3OQ6A 2OQIA 4I4IA 1PJ4A 2ZTSA 3DLBA 1TCAA 1IQRA 1GKIA 4OF4A 3D7KA 5CVTA 3R4VA 2VT6A 1QHFA 1WZ2A 3LI2A 3TSYA 3PFCA 4K9RA 2G67A 2HWKA 2PV0A 1ZA1A 1HNXH 2ODBA 1V8ZA 4OMUA 2WAXA 1EK5A 5A0TA 2YNMD 3U0BA 3RBDA 4YCSA 4XRRA 2W22A 2R8ZA 3WXBA 3EOAI 4MVCA 2AFIB 4GVXA 1Z8NA 1P61B 1QDEA 4L9RA 3U6KA 3ZDYB 2QTZA 1TWHA 2EATA 1JU4A 2CSXA 2BLNA 1T2UA 5HMLA 1U0BB 5JUWA 3QOYA 3NDRA 4F50A 1SMKA 5CYGA 4XCXA 4YAGA 4OGKA 3BJIC 3FZEA 5AVKA 4LUCA 3QU5A 3NTLA 4DANA 5KFYA 5TT0A 2BFFB 4IICA 4LRSB 2WPDD 1K6EA 5HK8A 3RLFA 1JHAA 2OZEA 2JA1A 3BN3A 3F9RA 3V2HA 2YWDA 3VSAA 2OYRA 4PWZA 3E8XA 2AI3A 5TGDA 2B0JA 4TTAA 2R44A 3K0BA 3DZBA 3PDHA 5JEDA 4UC0A 3ETDA 1YH3A 3GBPA 5C1DA 1JR3E 1LJUA 1EAMA 2YC2C 1G0NA 4BQQA 2AE1A 2N75A 4KGDA 4Y6LA 4JI4B 1QQBA 3GH3A 1L5LA 4BLPA 1KJNA 1HDEA 3GQVA 1VMIA 4WA8A 1E5LA 3P97A 3AI2A 3G2NA 3LYHA 3PC6A 1YL7A 3AIOA 2QZZA 1T5BA 3F73A 1WPXA 1AS3A 4OHYA 4N6GA 3KKEA 3SJZA 5K20A 2VRCA 1Y6FA 3NHPA 2J3QA 3TQOA 3DE4X 3N41B 2CVZA 4NK4A 4HZGA 2LPMA 1N5JA 2V98A 2PT5A 3ZZTA 1SUWA 4UNIA 3COZA 2HSWA 2YYYA 4IYJA 3GJ7A 4FHFA 4FR0A 3T5KA 1UK8A 3TW8B 5GIPE 1R15A 2I4MA 4O0LA 3ZBUA 3IBCA 5HS6A 3ZK7A 4YJ2F 3GCXA 5JALA 1NNUA 4ZO4A 2JS7A 4MQEB 1LBQA 2HU7A 2YJNA 1GYFA 5IT4A 1A5BB 2HKIA 3VSDA 1W4AA 3GVIA 2NYRA 5FEUA 2X9VA 3DT6A 3UN1A 3H65A 4XYEA 4QHTA 4C22A 8AT1A 4WERA 1T8RA 2RJNA 2DHQA 2ZATA 3MXOA 4A2AA 2VDRB 1WPGA 5AVRA 3WMEA 4PICA 2Z2JA 4RIEA 4C4YA 2FPWA 5CR9A 3OIFA 3OIGA 4RTPA 2WHYA 4WKGA 4YJ3F 3D2AA 4DQNA 3SGLA 1AH2A 3KREA 4DUZB 2FMFA 1UOPA 3OUUA 4PPFA 4HQFA 3P2JA 4WCFC 2WHPB 4M9QA 5C7IO 1NLZA 4BNNA 3HJTA 4LC1A 1ODFA 4MWTA 1IHPA 4GICA 4A3JG 1WNTA 2V9PA 1EXDA 4D74A 2I91A 3ASYA 1XKTA 1ODLA 5KFFA 1VE1A 3PUXA 4EA9A 3N2EA 4QOJA 2D7DA 3P20A 1KSFX 1JQKA 2AUTA 1R74A 4QXMA 2QM7A 4ZOLF 3WYDA 4F84A 4BY7G 2WSYB 2ZJTA 1PS0A 2UXBH 1QHXA 1EUYA 4NZNA 1CJUC 3ZJUA 1KS2A 3OTGA 1P1BA 4MUMA 4HB2A 4JNCA 1A69A 4KREA 2GNAA 4WBSA 1VJDA 3QOWA 4YAFA 4XOUA 1IWBB 5EZYF 4HFNA 3TVYA 4N0PA 2FWJA 2YCLA 1ZN8A 1HEYA 3AM1A 4DLLA 3ORHA 1ZN9A 3HADA 3FFXA 3SX4A 1UJNA 3PFBA 5A5EA 1NJ1A 2FSVC 4PLVA 2P2LA 3FPGA 4UUNA 2W83A 4MVJE 1QRTA 2ZBEA 4W5HA 1FYWA 2TECE 3WDMA 4LSWA 1VA5A 2RH8A 5CFRA 4KVFA 1XZFA 4Q6WA 1JKXA 3MWDA 1QC5A 2EZ8A 4D26A 2Y2UA 2JDID 1IYEA 1ZIYA 4BRWA 1P2VA 3LF2A 1PJZA 4YYEA 1XNGA 2O7VA 1F2UA 1DEKA 1LJ8A 2FDXA 3S28A 1NW3A 3DJFA 3FFTA 4XZ3A 2DLCX 3BWVA 1FTNA 4KQHA 3AXTA 3OFND 3HBNA 3D8BA 4R1PA 3AJAA 1P1HA 4S2EA 4GC9A 3WB1A 1X8XA 5AIBA 4DLAA 2JF0A 2NLOA 2WLTA 2H1LA 4MVYA 4RADA 1H93A 4RLHA 3UFXA 4A3FG 3OEYA 2WVAA 1VGQA 1U1IA 1BRMA 4JBIA 1GGJA 2EL9A 4RPLA 2X5RA 1ISIA 2Y1WA 1RCTE 1L1RA 2QZ4A 2SECE 3PXEA 1DCTA 3VHQA 4L5JA 2DHEA 3CEJA 1U2QA 2HWWA 1N32B 5K3WA 1FQOA 4CC6A 3PCRB 2RGWA 4TV8F 5DN6A 4Q1FA 4LMAA 3AUAA 1G21E 4DYDA 5ENZA 3H4TA 1BS2A 4JFRA 1Y9JA 3IR7A 1Y3CE 1T8SA 3OMLA 3A9WA 2GN0A 1C3EA 3EULA 3GT7A 2J5BA 4FOSA 4BFUA 3CX6A 2ASDA 1CX9B 4EB0A 3COPA 4Y6GB 5ALVA 4B40A 4M1ZA 5JSZA 3QE4A 1P6QA 3MINB 2JFQA 4IOLA 5KSZA 3IB3A 5KNBA 5KUTA 4E12A 3GLGB 2M98A 4B31A 1YXMA 1ZI6A 2W98A 1XRRA 3ZZMA 1A2KC 2VYQA 2BQ3A 1KA9H 4X3CA 4GZ5A 4C21A 4A6DA 4L4XA 5KTPA 4MMXB 3LT2A 1A8HA 3RRBA 1QNFA 4GKAA 4WNAB 5E7MA 5KFQA 4IH4A 1PLLA 4ZYYA 4L85A 2ZAMA 4GBGA 5CFMA 4BWVA 2C9YA 4BMXA 4J6FA 2CNVA 1GLVA 3KO8A 4PCLA 1A4UA 3HV2A 2BGRA 2OEPA 3EF1A 2FU5C 5EQJB 2FPMA 4XFJA 8MHTA 3WK9A 4KO8A 3LO8A 2ZGVA 1DC8A 4DZRA 3R5JA 3K8QA 3T41A 4AVYA 4V2UA 1ODKA 1VXOA 5E3JA 1Z5ZA 2AG1A 4HADA 3M9XA 2CD7A 2AN5A 4AUEA 4UBIA 4I1IA 4J3NA 1YMUA 2ZBVA 2YASA 4BKPA 9LDBA 3QI2A 4DIUA 3E9QA 1IONA 5LKRA 3ODPA 4C3OB 2VNSA 1K7XB 1QLWA 1I2BA 3AF2A 4XIJA 1TU4A 1LFAA 1U2EA 3Q8MA 3MIZA 2Y99A 3V2UA 2PO7A 4AKEA 2J30A 3NEPX 1YIDA 1N2SA 1GGHA 2IOQA 3O2NA 5L95A 4DFDA 4NCAA 4RKYA 1P73A 2VF5X 4PYIA 5DCLA 1M1UA 1VG8A 4TV9F 2D2IA 1A7AA 2JJYA 1Z4QA 4O08A 1TAGA 5E6UA 1T9DA 1T0BA 3MBOA 3DH0A 1T91A 1WMEA 2AF3C 3L49A 1SXJB 2VCYA 6NULA 1AGNA 3IIEA 1YE8A 4NY1A 2WIAA 1IM8A 1ESZA 4CT5A 2JHCA 3P9KA 3ENVA 3HZOA 6Q21A 2PKXA 3IJEB 4UCRA 4UOEA 1DNPA 4QPJC 4LF6H 5B4VA 1AO3A 2ZWPA 3Q5DA 2H57A 1FFHA 3WL6A 2LCFA 1GZVA 1SR8A 4GQIA 1USKA 4JT9A 1ZM2A 2GEKA 2BDUA 3CC8A 4B3RB 3BH6A 4RVOA 1RJQA 4BZQA 1LX6A 5DM1A 3CLKA 3DDZX 1ORTA 1FVFA 3O1IC 5FUVA 2GD2A 3DVLA 3C3EA 4KR6A 3FUXA 4CMAA 4K40A 1J7JA 4A5SA 2QP9X 4RCZA 3LBNA 5KOYA 5EJMA 1S89A 3LY7A 5DM60 1OZFA 3L2OB 4FHDA 1HL3A 2GLTA 5FAKA 5BV7A 3N8KA 1OIWA 2QD5A 5JH7F 2CKZB 3C6ZA 2ZVPX 1JZSA 3F8WA 3EMKA 1M6EX 4FSXA 5DT2A 1E4YA 3D43A 3RF7A 1QHHA 4AY4A 1M34E 1V0JA 3BE8A 2YXNA 3WWHA 3FLMA 5FV7A 2FFRA 3SS7X 2AC4A 2Q4OA 1P19A 3WISA 2EJVA 3IBSA 2HO4A 4OGWA 4BASA 5LQJA 1B42A 2PM8A 3SXUB 2O3JA 2BUAA 1UDXA 2AV6A 2WHEA 3QNUA 4O2AF 3LL4A 4TL7A 2E4WA 2RC6A 5DNWA 3CLRC 1EJBA 1U2DC 4LTDA 1QU3A 3VAAA 3PD0A 4BC0A 1JWBB 2HZBA 2H8GA 1OVMA 2XZTA 3LQSA 4UCXA 2R6CA 4BLOA 4BPBA 1NXSA 5I8PA 5CDGA 1FMJA 1V8DA 4I9FA 5I45A 3RK1A 2FN8A 1QO9A 3C43A 3UJCA 1BXZA 2XSZA 1SVIA 1AZWA 2Q0QA 2V0CA 2R00A 2QTMA 3ANXA 3D4PA 1YQ9A 1ZCBA 1WW2A 1H2HA 4YECA 3GFSA 4RIGA 4HO1X 1EWTA 2OLEA 1EQUA 2Q1YA 2PKWA 2PH3A 5BMOA 1BXGB 1QP8A 3EF0A 3L7YA 4WASA 3M0EA 2XQFA 1KQOA 3DCYA 3ECAA 3KHUA 1M2VA 4YBRA 3VM6A 5TV2A 4FEGA 3KX2A 2FSGA 1JSRA 3OX1A 5CDFA 2VA9A 3PTZA 1IXRC 4RY2A 1R6BX 4HAZA 5JCXA 3QVGA 4Q3OA 2WPDA 2YWJA 2FN9A 4J0EA 2CB9A 4DR2H 1W25A 4ED7A 2DGDA 1C9YA 2ZRFA 3TNYA 2HG8A 1E64A 3TTWA 3TIGA 3H0GA 5JWRA 5SV2A 4EJMA 2Y1LA 3VXKA 1RKVA 5JMOA 3BA8A 2JFFA 2N0SA 1UT5A 2ZB4A 1ODCA 5K5EA 2WF8A 1VJ5A 4C07A 5D01A 5A04A 2P4SA 1D2GA 1L1EA 4FS8A 1AGYA 4HRVA 2YWGA 2RDMA 3R6DA 3PR3A 4GOMD 4OLJA 5KHLB 4WHMA 1Q6YA 1FYVA 1F8UA 4BTLA 4A0FA 3IEXA 3ZJYA 1PWEA 3LRXA 3BHIA 5CK5A 3AB7A 2WJZB 2V65A 1FBTA 2N42A 5FADA 3DHVA 4JVOA 2XEXA 4ZYUA 3BWXA 2L42A 5DTEA 1TECE 2I4LA 1N0WA 2G80A 2ZRMA 5FOSA 4CM7A 5IANA 3UUGA 1EFVA 1EP3B 3ZEAA 3ZY3A 3K6KA 4N7MA 1OF1A 5B30A 1WVIA 2IWRA 4E11A 1NXTA 1Y33E 2DU8A 2W4MA 4MYTA 2XUHA 3GX1A 1VL5A 4KMMA 4O6VA 1TMOA 2H29A 5IFLA 1G8FA 2V55B 1Z4MA 3E2IA 5BN4A 1PVOA 4CLDA 3A4VA 2G5CA 4E7OA 2R6DA 3R40A 1I2AA 3PS9A 1UJ4A 5JVDB 2O3TA 2EFYA 3T5AA 4CGYA 1R0YA 2P6RA 3ILSA 3B5JA 3ETEA 4C03A 2QX7A 3I6QA 4PLFA 3RYFB 4UNPA 4NFYA 4ECTA 3LWBA 1GITA 5CCDA 4LZZA 3HFRA 1JJIA 2EG5A 4N12A 4LWPA 4IQ8A 2ZDGA 3SC2B 1AMOA 4LRTB 4U2KA 3DAOA 1E58A 3JWGA 4RCVA 2PUAA 3SI7A 3PRHA 1ZISA 4V0OA 3LVRE 3QBTA 3G2JA 3QG5A 1NR5A 1OFGA 3LPNA 4GECA 5B2FA 2CLMB 1AQJA 5HKOA 5F23A 3HH8A 1NIPA 2CLIB 5DX8A 3BGDA 5JG7A 1HTBA 2BFPA 1COWD 3TLMA 1UANA 1GV0A 2CCGA 4BGVA 2R96A 2R86A 5EZ6B 1IN7A 5IZCA 3RSHA 3ETJA 4J0CA 1JAHA 1GSHA 3IO5A 2QG6A 3B70A 3EXFA 1RTKA 1KYIA 4DR1B 1QFSA 2ETVA 2O9JA 1U7WA 2ZE7A 3KJIA 2DFVA 4QAJA 3ZNPA 2P1RA 5F9NA 1ZRSA 5AW0A 2H1OA 4LY6A 1AK2A 4WY5A 1V11B 2JJ1A 1Z68A 1TOAA 4A36A 2FR8A 4R1MA 4EBFA 2QL5A 4BO5A 2R2GA 2E49A 1NVVQ 3JARB 2R8GA 4JWTA 4DBZA 4HRAA 2YZNA 1Z07A 4I50A 4ZVUA 4RV4A 4X6UA 4FYIA 1MVOA 4B3HA 1FFDA 3QLEA 1E2PA 2PBLA 1DDOA 4ARBA 1XQWA 4IDNA 4U2DA 2J59A 3BC1A 3RGZA 2AMFA 4JL6A 3PHLA 4HNVA 1GHTA 2PL1A 2BI7A 1J39A 4MGKR 1XC7A 4L4SA 2PSEA 3H0GG 4JUCA 3V46A 1KRWA 3COJA 3B82A 1I6KA 3LZ6A 1JDBB 5DM70 1SKMA 3OQ1A 4I4TF 4QUHA 5LQKA 3BWMA 4Q4HB 1L4NA 3A2KA 2IBKA 2JKZA 4QWWA 1KEUA 4WLUA 5JCOC 3HGMA 1SPBS 1ZN7A 2WJGA 5A9TA 2W37A 3TBHA 3AIKA 1ID8A 4R05A 3M5DA 1OI7A 3QY0A 4DR5H 2NVXA 1HOTA 1BCRB 4W9MC 5A71A 4RH3A 5F5LA 4PO1A 5B36A 1L5FA 1L5HB 1FJGH 3QF4B 5EHZA 1NSTA 2I1LA 3WJ7A 1OBFO 3QEMA 3HPQA 4LAFA 3A70A 3M6IA 1X1TA 2C0QA 2A86A 1RAEA 5AHOA 3ZZUA 1P1CA 5HKAA 4IQGA 5JNLA 5K8CA 5IAEA 1EFPA 2VP2A 4QDZA 1TTHA 2ZYWX 5KX5A 4LOAA 3LGSA 1FXWA 3LSTA 3GZJA 1U7PA 5D1OA 4KLCA 1SY7A 1ICEA 4OP1A 1DG3A 3H4BA 2IS6A 4MR8A 2EOAA 1X7WA 3WJAA 1KH3A 2CE2X 3RVDA 3TLBA 3AEKA 1J0XO 4CODB 5DBFA 2MHCA 2IUYA 2R47A 4EZIA 2GMWA 3C3JA 2V03A 4OKIA 3DC2A 4R9UC 3LM8A 1OGJA 1QM5A 1WSWA 2B7CA 1ZY2A 4AYTA 1ZGZA 3G0CA 1B15A 1W87A 3KHGA 2RGBA 2XMPA 3QU7A 3MYRA 2AW5A 3GR6A 4TXMA 1UIMA 5FH9A 1GILA 2BTQB 2A0KA 3PT5A 2Q27A 1WQ3A 4M0UA 4IJUA 1ODSA 3N8IA 4U8HA 4IFEA 1UEJA 1R4AA 4N0QA 5KBYA 4QGHA 4XYLA 3CWQA 3DGEC 3S2GA 2UZ1B 1DJLA 4BNHA 4AIRA 3LLMA 5DG7A 1JR2A 1JAZA 4N9QA 2EVWX 4W99A 3ORFA 1VJTA 1WCV1 5F2NA 3W77A 4EO9A 2C4NA 3EBOA 2JAUA 1Y9DA 2CNBA 2LE0A 1C9DB 2D62A 5EOVA 3IG0A 1TIPA 5K09A 1W0KD 2PAAA 3PUJA 2BR4A 1RLUA 5ICCA 1EXNA 4U39A 3SIXA 1QO0A 5AM1A 3QXCA 4JLPA 1G3IA 5I5YA 4Z1OA 3MQ2A 2VLIA 3SFTA 5FUXA 2YWVA 1VG1A 1CY1A 3HKDB 4Z4QA 4PLTA 2WTFA 1M2EA 5ALGA 3TN7A 1G2WA 5FFNA 4WA7A 1U0RA 1F2TA 1QH1B 2WZDA 1J33A 1Q1QA 4UPDA 3HA7A 3N1UA 4P3KA 4X5OA 1ZR2A 4Y30A 3AOEA 5KSOA 1AHNA 4XH9B 4YBZA 2F67A 1OZ0A 3PZBA 3A6GA 3ZNQA 3N76A 2CVQA 1N8SA 3GWGA 4OJKA 1XVIA 3DQPA 4CW7A 1ESDA 4O3QA 1N9GB 1CRLA 5LDHA 1U1DA 4F6CA 3OICA 1N3BA 4I9UA 4RSGA 3GQBA 2H4WA 3CSSA 5C4MA 5BWWA 1XF1A 1U5AA 1KPIA 4MRMB 4R81A 3RF2A 1SCAA 1L3CA 3TX6A 3ZGLA 4EYHB 3QENA 1IN5A 1W30A 4HAYA 1THZA 2OD2A 4URXR 2R97A 2IZ7A 3RT7A 3ICWA 3KOOA 4UTZA 5BSEA 521PA 2XCTB 4X8MA 4ZJZA 3KYDB 4BGIA 3RIMA 3GFVA 3PIRA 4F9FA 1IPEA 1TK3A 1JRLA 2HBZA 1F48A 3Q9SA 1RHJA 3N39C 3SYMA 1YE5A 3UATA 4DSNA 2VUUA 3I83A 4BQRA 3A1DA 3Q3VA 4WXRA 2JFPA 4HWKA 3U7HB 3VR4D 4Z8YA 3KZ1E 3HU3A 3UMRA 4RA9A 1XNQH 2K7ZA 1URPA 1WDTA 1I3MA 1W8DA 3EIOA 2VRCD 1Z16A 4N6OA 3LS2A 3L7KA 4Q7EA 1TDJA 4X62B 4YJ3A 4H7PA 1ZMBA 1ONOA 2G5TA 2WFLA 3RHTA 3X1WA 4IH9A 3VZQA 4KE7A 4UPEA 2JFVA 5LDDC 1VHTA 3A1FA 3HUTA 5K0NA 3L6EA 2AJCA 3H75A 3M3HA 1BS1A 5G1NA 3DT9A 1SN7A 1E9FA 5DWVA 2IYNA 3UENA 1TMKA 3HM9A 4GRAA 2TSYB 4N0DA 3D3EA 2EW2A 1E9SA 3VH3A 4LF9B 4UAGA 2Z2YA 1TVCA 1MAAA 4J9LA 2QN6A 2AF4C 5DK4A 1V2HE 4V1CI 3D6FA 2QTVA 1YHYA 1NJSA 3U7JA 4IMJB 4YA6A 1M7GA 3CU5A 4NENB 3W5SA 3PK0A 2R7AA 3D3JA 1GQQA 1SXPA 4N65A 4D56A 2J09A 3WY9A 1QXSA 1V9SA 4B7XA 4Z53A 4ESHA 4BCDA 2EP5A 4F06A 4FHEA 3V1MA 5C1OA 4ZKEA 3DFUA 3ZHRA 5EGNA 3IVAA 2N9UA 1B8NA 3ZGOA 4BQOA 4NF2A 2YH2A 3OFVA 2H9IA 2QZPA 3OCYA 4PNZA 1SQSA 1SOVA 4O5AA 2VPIA 4CQMB 3H8JA 2HHCA 4PW0A 2C28A 2R62A 2JHGA 3REFA 3HKZE 3HU5A 3C4VA 1RZ3A 5CFZA 3KE8A 3FCOA 4OLBA 5IF9A 2Y0BA 2CUNA 2GBGA 3R74A 3TJMA 4B5KA 2YXBA 1ENPA 1SKBA 5DKFA 4ZHSA 1KI1A 1CC1S 3UJ7A 1P44A 2PSJA 2NPIA 4HXFB 2GK3A 5E9AA 1E5XA 2GZDA 1FC0A 2H9YA 4KU4A 1AS2A 2H11A 2BFOA 4Y0NA 1ZK3A 4TWRA 1JAIA 2Q2QA 2P9YA 1JH8A 1LWNA 4J8PA 1YR9A 3SZUA 2XB2A 5J4KA 2I2DA 1RKXA 2QM8A 3AUFA 2VJOA 4YN3A 3NVMB 4JLDA 4PX3A 4KMSA 4XDYA 1HMYA 1E1RA 1PF7E 3RTCA 4MW1A 1B73A 1R9NA 3N0RA 2EKBA 2WT8A 4HRYA 5KWSA 2VSFA 3BD7A 4QASA 1QP4A 2BHNA 1VKZA 1T4GA 4DLWA 1JU3A 1ULSA 1YWGO 1QYRA 2VF2A 4R16A 5CBKA 3DP7A 4ZI7B 3FCYA 3WTBA 1XN4A 5JO0A 2GM5A 3OO0A 4LH7A 2C2OA 1UDBA 3Q5EA 2Q5CA 2Q5OA 3V8RA 1BKDR 1CUJA 4XYGA 3PWSA 3BF8A 3THXA 4C0SA 1TM3E 1V2GA 3L7LA 5E4TA 4ZCPA 4JKIA 4MWCA 2PKEA 4P5PA 5DPMA 2VN8A 1LDNA 5DGIA 1NVFA 3KHKA 1TF5A 1UZLA 1DJMA 4AF8A 1VSVA 4NECA 2GD6A 3RRJA 2VYCA 4RU9A 4NIMA 2E0IA 3ZTYA 2AN1A 1DPGA 2BHTA 4UXHA 3BXFA 1APBA 4Q12A 1B16A 3Q1LA 2XIQA 1EFAA 5AKGA 3VVBA 5AM0A 3JAWB 2AK2A 3H5VA 3C1AA 1QKJA 5IKPA 1W1UA 5MN5A 1NC3A 3T1HB 2NUAA 3I05A 3NC0B 1G8YA 4PRYA 1QS0A 2NO6A 2QTAA 2GGSA 5H3CA 2G72A 2CL6X 1J70A 3JQ7A 1Z0DA 5DN6D 5CX4A 1QH0A 3PNMA 1YI0A 3AVYA 4WN3A 1B43A 3W8FA 4D9MA 2QK4A 4IRMA 1DP4A 1NW8A 3MUNA 3IEKA 4AMZA 2GERA 1KOJA 3NCTA 3BDAA 3VX4A 4QFCA 3A3PA 1PZFA 3TY9A 5LFAA 3T52A 1XZDA 4S1WA 3N8NA 1TA0A 2NSJA 3CSDA 4B81A 1Z4OA 3AEQB 3OCJA 4ECZA 1ANKA 1G2OA 2BLLA 2RGYA 3KL2A 3RUCA 3BXOA 5JXHA 1XRLA 4MJ7A 2JZCA 4WZBA 1IEVA 4NDAA 3INNA 3U39A 1KGDA 4NJEB 5KYUA 4B7ZA 4ECRA 3HCAA 3Q85A 4D7AA 3TOZA 1XX6A 1ONNA 1NFQA 2GYVA 1AA6A 2D5AA 3FFAA 3QELB 1XWFA 2NTVA 1A9QA 1QV6A 1SU6A 1E1NA 2E89A 4DCSA 1KAOA 4KBGA 1O95C 3WTCA 2QA5A 2IBTA 4B4VA 2HQBA 3IH5A 1UXHA 4C7MA 3BFKA 1E2LA 1E4GT 1L4EA 1JHDA 2VQFH 4DL7A 2JCVA 1JKFA 1ZEMA 4RWZA 1FX0A 4YVFA 5HNEA 3SYTA 1WP9A 2ZKIA 2QPOA 1JNYA 2QAGB 5KG3A 1RQ2A 3BE4A 3KG2A 4HAWA 4QPPA 2FPSA 1FFEA 3V7YA 2Y71A 3PFKA 5AW9A 4MV6A 4J0HA 1WG8A 2QLNA 3LPCA 4OUKX 2B99A 2O7NA 3A32A 3RTDA 3IOEA 3EARA 3JQ9A 3EXHB 3M70A 3VDXA 3RHFA 1K75A 3STWA 1V5IA 1JQBA 3U54A 4PNPA 3MCVA 1NM5A 3VA7A 3QW2A 1LRLA 2A8YA 2VBGA 2RAFA 3VH2A 3LRTA 5DHFA 1U9IA 4F71A 4EGCB 1AKQA 2WHXA 2GAIA 5LMZA 2P40A 3UAXA 3DAYA 1FYDA 2FCRA 5BPFA 4HBGA 5KT6A 5ECYA 1YVPA 4PPQA 1XTIA 2IZ0A 1GPYA 4QUIA 4HEQA 1SOWA 2W00A 2GPTA 2OXCA 3IQGX 2X6TA 3NXSA 2EGUA 4OU4A 3DDCA 3MLBA 4AT1A 5JSQA 1Y7HA 4ZVQA 2QPLA 4WK6A 1V4VA 1WDMA 4BKQA 3FYCA 2ZS7A 5EXTA 3E7FA 1EBFA 2IUEA 4E22A 1VMAA 2C42A 4FGUA 1ZCZA 5KG6A 3GTOA 1CJCA 2XGSA 1DBSA 3A6KA 3IMEA 5AJHA 1G9SA 5BRNA 3OH8A 1FTYA 2YHUA 1RZRA 5KREA 2ALZA 4JXJA 2NT4A 3OT1A 1UK6A 4V0SA 2WJWA 2DF8A 1OXBB 3BRWA 2HW8A 1QUEA 3RV4A 4MZXA 4YRQA 4O2AA 4DDWA 1JVNA 4EZBA 5L45A 2OUKA 5ALXA 4NFHA 1TWGA 2DIKA 5A4MS 3RFXA 3HKZA 3M8KA 2R60A 3W5VA 2JPDA 4RB0A 4PX9A 4V0RA 4IAJA 2WIFA 4Q8EA 3C6QA 3KP1A 2D1YA 1XE3A 3TL6A 1E18A 1MD9A 1ZD5A 1BGVA 4YP5A 3QITA 4OHFA 3CEMA 5D7BA 1M10A 1SKQA 2VLBA 4O8CA 2I3DA 1S10A 2C5FA 3EB9A 3TNJA 1UJCA 1T15A 3TLGB 3GU3A 3DEYX 1V7QA 4NMWA 3RSGA 4KV7A 1N1GA 3TLJA 3RRYA 1GUAA 2F9MA 1PFVA 4PO3X 1LKZA 4F5YA 3C3KA 3F6RA 5IJWA 5FTKA 4Q02A 1A0GA 3E48A 4MYCA 1MB3A 1NRJB 4AYXA 2FWNA 4NS1A 3KPUA 4FJ0A 1MVNA 2E4XA 3GOHA 3VSEA 5K3FA 4C0XA 3OKCA 2J6CA 3HFJA 1MO2A 2NU9A 4FFPA 2H54A 1U80A 4IGIA 2D54A 3K6SB 1BFKA 1CFZA 4DR3B 4JB8A 1RZVA 3KR2A 1NURA 3C6KA 3CH5A 3P0FA 1ESEA 1IXKA 2OBFA 2D2EA 1R10A 1GPJA 1KFKB 4S12A 1ZK4A 2BFBA 3OETA 2XSZD 5ALRA 3ONDA 1NA5A 3L1HA 3JTMA 3WK5A 3V4OA 1MFZA 2IEGA 3DDNA 1VYHA 2XUGA 3N42B 1XTRA 5E2AA 1J1UA 1OSNA 1F2UB 1TYAE 2C3YA 2J0QA 4KFRA 2XQIA 4YI5A 2QN1A 2YOHA 3L0SA 3AR9A 3LUCA 4DLSA 1JEYB 2IITA 4WZ6A 2COGA 1OAOA 2FMUA 2Z4SA 4IXTA 5KOHA 4EMSA 5A5GA 1QF7A 3ZUPA 4JI0H 1IEWA 2G08A 5IX8A 4HYTA 4XQ0A 2JFGA 4JV5H 3G7SA 4JITA 2PH5A 2I2CA 1Y9ZA 1IOZA 5AW5A 2WKQA 3GPBA 2B7BA 4FDAA 3WRYC 4KXYA 1K3UB 5BVHB 4RV9A 4V3CA 2VHYA 4FR5A 5DHAA 3U0VA 3U7EB 1ODTC 3WQSB 2XT0A 4P22A 1SCJA 3WLQA 2F55A 3L6DA 3W1GA 1AK1A 4BE4A 3PXGA 1ORHA 5CG2A 2C3OA 2WW8A 5JRJA 4CR8A 2ZS9A 1OX4B 4DRXB 4JV2A 1E5VA 5I9MA 5A4JA 3M4ZA 4D4GA 1BEUB 2JD0A 2H3HA 1NBAA 4KB5A 4LY9A 4X61A 5BURA 3KAJA 4OB8A 4D9BA 4BWYA 4L76A 3P2EA 1FSZA 2FMIA 2ZCJA 2XT9A 2EZ4A 1PX0A 2GZAA 4GWGA 3VR4A 4V0KA 3WL8A 2NW6A 1KJ9A 2OHIA 2PS9A 1RJDA 5FNZA 2RH4A 3JWJA 5KT7A 4MAAA 1KBZA 4XB2A 4F4CA 2IHTA 3CG0A 1E2HA 4BJ3A 3UWDA 4I5FA 5FPPA 5AVJA 4CFSA 3DZHA 3CIOA 3EX7C 3QQ5A 4XA8A 3KT6A 1RC8A 3WGGA 3CRRA 2JCBA 4LOLA 3G59A 3PFIA 1CUDA 3JSXA 4ZAGA 4HDNA 3WGKA 3JALA 5JY6A 2HSZA 4MB6A 4AZWA 1YVUA 3L0CA 2FPPA 4ZVPA 3SDZA 5BWBA 4US0R 2WVGA 4KR0A 4DMKA 1IYDA 4NBKA 4D98A 4RQBA 2OV1A 4DHEA 4TS4A 2OCBA 3W1VA 5JYCA 2CHEA 2ZRJA 3V34A 4RTOA 1ZLYA 3MLAA 3O84A 4PG6A 4PXSA 3JASA 1OC4A 4AQDA 4REQA 3EZXA 3WRXA 2L82A 4PGGA 4NPCA 3SHTA 3PG5A 4H1WA 4A1OA 4MB2A 5C9ZA 3UC9A 1B8OA 3IOBA 3RSZA 4TVSA 1CUSA 3H0CA 3IFSA 4FPXA 3I34X 4B8ZA 2NZWA 2HRCA 3M1IA 3WDSA 2WJ3A 3FRIA 4XWKA 4DC9A 1YR8A 3WLHA 3P9IA 1H85A 5D3QA 3KPJA 5C8YB 1LU9A 3DVAA 3TJRA 5FL7A 1T1SA 1QTIA 4AG5A 2VDOB 4IILA 5T3YA 2X2EA 3LG2A 1DPFA 2Q6VA 1CUBA 2DE0X 4H7IA 1T9GR 2GPAA 4LBYA 4M88A 3JAKA 3C45A 1ADJA 3R7BA 4BQPA 3BIJA 1ZXBA 4LCEA 2DTEA 1LI4A 1NOIA 3Q3EA 2BSQA 3TUZC 1QE0A 3OZUA 3LUFA 1W0CA 3H2GA 2VJMB 2GO1A 3AEUA 3RVPA 4Q1CA 4MO9A 3HYRA 7ABPA 3CT6A 1QK5A 3TO5A 2R6AA 5IAGA 3CLHA 1GNSA 5KOJA 2OGSA 1QYXA 3CMMA 3IL2A 3B52X 4QOHA 3C5VA 4I4LA 2YUIA 1JEDA 5DNVA 3UJHA 3RIXA 4FDUA 4MYSA 2O3RA 5LP6A 4C5CA 2HHFB 1WDKA 2WLSA 3OE5A 2JIZA 1IUPA 5KCMA 2OR3A 4I4TA 4DLUA 2JJ1D 4KKVA 1E4EA 3UZUA 3VQTA 4FGSA 2OUIA 2VUIB 1FW6A 3F4LA 3DTYA 2RGCA 3AILA 2IXEA 4CDRA 1NW7A 1FFXA 1JIQA 2KM1A 1NN1A 3EEYA 3BZUA 4CKWB 1YRAA 2AWNA 3TZLA 1VHWA 1WZUA 3DYBA 3WICA 3IN5A 1VB3A 2VHCA 2ZDHA 3GIJA 3TZBA 3JATB 3QLUC 4EWLA 1X9GA 4K2AA 1LTHR 3PWKA 4LYJA 1NKVA 5DULA 5KFTA 4DSTA 2AOUB 4GOND 2NVYA 3B12A 1VRVA 3CLSD 4R2KA 1IN4A 4NE2A 2R751 3L2PA 5D84A 1SVLA 2XLCA 3UKDA 2FRDA 2Y1GA 1VHJA 2OGTA 3ED5A 2A0XA 4RPHA 3CVZA 2R8RA 4F4IA 2REXB 1NOKA 2BL4A 2PZFA 1W5SA 1IMOA 4JC4A 2P9HA 1LPBB 2MT9A 3C85A 1Q3HA 4Q21A 1W94A 3F74A 2P1DA 5ARBA 3WLFA 5CDFE 5EWMA 1J06A 4IG9A 3GRYA 1B74A 1EDEA 2QR3A 3NJ8A 1YR6A 2O6HA 3B6JA 4PYRA 3FPEA 5BN3B 3H2KA 5DB4A 2J3KA 4LMPA 3BEOA 2YIMA 4HTFB 3C1OA 1DBQA 3V42A 3PVZA 4FD2A 3DTFA 4PRLA 4BKRA 121PA 2H17A 2GZ3A 2XA1A 2GBLC 1G55A 3ZE7A 4EBBA 2PJRA 4MARA 3SIRA 3AC0A 3T3HA 2G9UA 4AX8A 3QVMA 5ESDA 4KYVA 4Z4EA 1PFKA 5CX1B 1SWWA 3MCUA 3UA4A 2UXDH 5IFKA 3L4SO 4FJ1A 1W52X 2HBRA 1UMDB 2R7ZG 2GPBA 3AJRA 2EHDA 1T43A 2TMYA 4M76B 1TWAA 3X3HA 5C5CA 1I4EB 5B2EA 4QWEA 3RB0A 4F8JA 5SY9A 3AQIA 3TAXA 5JDIC 1E4VA 3DTGA 4IV5A 1N1EA 4YRTA 4X1KA 3MB5A 5FV4A 3PVCA 1ZHHA 3SBXA 3V6KA 3RE1A 2ONZA 4B3GA 3CX3A 3BJZA 1QKKA 5FTWA 2QVXX 4L4YA 4LHWA 4QHSA 1LBEA 4G5XA 3L92A 3B1JA 4UCUA 1G21B 1TAUA 4JI5H 3H4VA 4HAIA 3AUUA 2C2RA 5FUYA 3BMOA 1NHGA 2WWIA 5HDBB 3I3SR 1E1CB 1K66A 4CM4A 1FVHA 1NBOA 3LP8A 2ZQYA 4ZQGA 1I80A 1R8JA 2CXSA 1DO8A 1FFBA 1G7RA 2B1RA 3IOCA 3AVPA 3ZHSA 2W6MA 1BFUA 4NAVA 5JD3A 2QM0A 4RVHA 4AUKA 1KYQA 1O6FA 2VZ0A 4UUAA 4FFBA 2CXQA 2R68A 3JWIA 3HZZA 2BEJA 1U9YA 4KQFA 13PKA 3P0JA 5JCPA 1T1EA 4KQEA 3CZCA 3U0GA 3IB6A 1FLDA 2G0AA 4X85A 4RF3A 2DUNA 3K53A 1OIVA 2FSFA 3MSCA 4MUEA 5CHYA 1WMSA 1ZUD1 3TTUA 2IU4A 3PQDA 4MUBA 3ZCRA 2DBVO 1I3KA 1YFLA 1DMRA 1VHDA 3NPMA 4MGZR 1S5PA 5TE9A 3L8EA 3LUDA 4UNNA 1GPH1 2W6OA 2VCEA 2MSNA 1QO0D 4JJ6A 3WYEA 3PC3A 1YCGA 3MWEB 7REQB 4PPGA 3A7EA 4OQ4A 4NE7A 2FLWA 4IRKA 3PDIB 1KDZA 1WY5A 1ODIA 4JQZA 5J63A 4CR7A 5T8KA 2V74B 3DSRA 4O7NA 4LJ7A 3PUHA 5LCXA 5IW8A 3WZMA 4X71A 5L6LB 1ISJA 3KQVA 2G1JA 3KLBA 3TD2A 1RCUA 5CA0B 4MQ6A 5FYQA 3KOXA 4J9RA 1OV4A 2HBQA 4WEOA 1MO6A 4YROA 5DNCA 3A27A 1P1JA 1NJ6A 3RFCA 2IX3A 1F5NA 1O0CA 4KYTA 1UBEA 3GT0A 4J9UE 4NU0A 1RYFA 2H2GA 2TMGA 3JQAA 4AQ7A 2VHQA 4HGPA 1E6LA 2I3AA 1UFVA 3GUVA 3PP8A 3BZBA 4Y1GA 5KTMA 3GRAA 4NTZA 2AXEA 2W8BA 5FP0A 4DLRA 4Y7CA 1QCCA 1HL7A 1JBQA 4I3FA 5BYKA 4F56A 3PQ6A 4Z2YA 2HA7A 1ECCA 4RLSA 4IUCS 1NJGA 3L6OO 1V3QE 1OW3B 4UW9A 3UWPA 2UAGA 4OX9Y 1KYXA 2VEDA 3QUAA 1EJ6A 1RJEA 3NGLA 3UF0A 2YZGA 2NT3A 5KFJA 3HFGA 2ZUCA 1F06A 4GGPA 4JI4H 2MYPA 4IIGA 5BV1A 1D8AA 1K8ZB 1RK6A 1K6MA 2TMDA 2V0NA 3EVBA 5DI3A 2QVGA 3EW9A 1BEZA 1PE0A 1YAJA 1YRYE 1KS9A 1BG6A 2JH3A 4X3OA 2C58A 3WWIA 2YXEA 4RTSA 1AA9A 5L40A 3EASA 2PUJA 2AG5A 5I7VA 3RYCA 4FKZA 1R16A 2UKDA 4AJ1A 1HK7A 4B79A 4WX2B 4BEJA 4NFLA 4XB1A 3PC8C 4MCAA 4QULA 4LHXA 1U1EA 1YJAA 2PYIA 2J0UA 3ZGZA 1REQB 2C82A 1M34B 2OWOA 3SC4A 3H6KA 1CUIA 1P0FA 5I5SA 2PXCA 4JASB 3CR7A 4X60A 5ITZA 3WWJA 1R8SA 1SPXA 4IAOA 3TECE 5I3ZA 1MENA 4WVFA 2WM8A 3M6AA 2ZSEA 5CW1A 1PJQA 3W5CA 3IT0A 1RMTA 4WCDA 4NR0A 3TS1A 2WPNA 2OZLA 3ESBA 1JEQB 3LIPA 4JQCA 5CE8A 1DS6A 1Q0QA 3QG1A 1DLIA 4TMTA 3UKOA 1KYVA 1I7PA 4HY3A 4ZVSA 3SHQA 1SEVA 4EY4A 1NUSA 1WX1A 4WXMA 2JA5G 4DUZH 2Q0SA 1ZD4A 4TS1A 3P9PA 2VH2A 3SBEA 3GFRA 1FYEA 1Q2XA 3Q4GA 2CXOA 2WUEA 3PNKA 2XQJA 1HURA 4ZQFA 5CMLA 1ZGBA 2RHLA 1E9EA 3OJXA 4MUAA 3HR8A 4MX8A 4LJAA 4QARA 1XYGA 3A3OA 3RH0A 4OD0A 4MQUA 1F2DA 4NBTA 3Q2OA 3RJ0A 1P91A 1CR2A 4K26A 1FP6A 4MUKA 2H4YA 5FEMA 2XGPA 4TKZA 3ZJTA 2XWSA 1UADA 3VUFA 1D4FA 1KZ7B 3VTKA 1L7BA 2QZJA 4WGGA 1R50A 3LT5A 1XHFA 1UWKA 4D9FA 2VPYA 1K08A 1T5HX 3WGLA 4KN8A 2ZBFA 3PE6A 1E1RD 3TZKA 4HXEB 5A0VA 4DIOA 3THWB 4BX3A 3O8LA 3T5LA 4DV4B 3S2FA 4LYAA 4R0NA 1IPFA 5DH9A 2DJIA 3AEXA 1RR6A 5K0FA 5JI3E 5KWVA 3AEKB 3R1IA 1JDEA 2Q5IA 4JLMA 1AN7A 4TX1A 1U9JA 2X22A 6LDHA 2Z6UA 2RGNA 3G2LA 4Q5IA 4CCYB 3DMGA 3O82A 3QKTA 1B6RA 2Y1XA 3IQDB 4LV5B 3T35A 5KNCH 1CUEA 4MI6A 1B1AA 5HIJA 4QYMA 3FETA 2RG1A 3CUWA 3QOFA 5B1DA 4D4MA 1YZTA 4EBCA 1X0VA 1ARZA 2DEUA 3NGXA 2I4OA 4H1UA 1XRPA 3QHQA 2NAFA 5EC8A 3UQYS 4HUJA 1G8GA 3AEZA 4KQWA 2LNDA 5IXJA 1QV9A 3UMYA 1X3LA 3OU7A 4Z1MA 4R2JA 3KFXA 3HL4A 3O9ZA 3H6HA 1UP4A 4OHKA 4DUGA 4WY2A 3THYB 2XUFA 2CXHA 4GPIB 3CRZA 2I6GA 4INPA 3T3EA 4RK7A 4BO7A 4NV0A 2C4HA 4HWGA 1MLDA 5GY7A 2FX3A 2YQ5A 3KKPA 1ZW6A 2W9BA 2P9JA 3V1NA 4UJ3A 2IH4A 3FCXA 2BN4A 4YQEA 4EUHA 1H2AS 3IOYA 4E31A 1D4AA 1N32H 3HA3A 3FHLA 2FEPA 3L1UA 2BMEA 3PC4A 3SD7A 2Z5VA 4HVAA 4ND8A 2XGGA 1FY2A 5LQUA 1UC9A 4Q48A 4LSMA 2V6IA 1H4VB 3FBTA 1ORIA 4AUMA 5JNWA 1DRUA 1YQQA 4XIYA 4ZRNA 3BD6A 1YHZA 4YBZB 4H0CA 3OTQA 2WB1E 2GA8A 4MP3A 1I3NA 3ORRA 4JSTA 3ZH2A 3MBIA 4BO2A 1TT7A 4E07A 3VTFA 3K4QA 5AJTA 2IIQA 2DAPA 2R66A 3DV0A 4O82A 3SNOA 4Z0TA 3O4GA 2J48A 2DSNA 3LHIA 5E6RA 3VU1A 1W4BA 3GQBB 1OLOA 3ELYA 4UU1A 1AN9A 4LN1A 1Q19A 1KQNA 1SG0A 4KLZA 4ECXA 3ANTA 2YHIA 1FL9A 3NBYC 3A6DA 4C88A 2OHFA 5SICE 3CTMA 3RC9A 3OG9A 2HQOA 1DFHA 3EXG2 4JP8A 5FWYB 3CUVA 1QDLB 4UHHA 2N46A 5F35A 2VIIA 1CQIA 5F73A 3W8EA 4IIJB 1ECPA 1V3VA 1KDYA 4FSDA 4CUKA 3I73A 4ON9A 1ZKDA 5LQSA 2V7GA 2CXNA 1NLMA 1NFFA 3GNSA 5MFPA 4D6YA 3WJ1A 3IT2A 3OWXA 2BW0A 3ZW8A 2PUWA 3I5MA 4BVHA 4K46A 5A3QA 4G09A 1VC2A 2VSYA 3W1WA 2RDJA 3K20A 1G6HA 1T6BY 3OHAA 1SB8A 1Y1LA 4JKOA 1QONA 2ERXA 4YRIA 2D8AA 2SICE 2QTLA 4G01B 4GP7A 5AW1A 2JNWA 4L28A 3DE2X 2BKXA 4U6NA 2C0CA 4KKXB 2V6JA 3S2YA 3FZGA 3WYGA 1DV1A 2HNAA 3TEFA 3PSHA 1UBCA 3JWPA 4I9HA 2R11A 3NASA 4HTAA 5K6AA 2MIIA 4O29A 2Z6QA 4CG0A 3KYHC 3A3KA 1XQVA 3G2KA 3ISVA 4N3BA 1A0IA 3NCHA 4P7KA 4FWBA 3G5UA 3GCGA 4P3PA 2H16A 3ZCPA 3T7CA 4MPPA 2OM6A 4GLBA 4IVPA 4CIBA 1WVMA 2OM2A 3AI3A 4YCLA 4B3CA 4U1RA 1Z26A 3RVLA 1SEPA 1U0TA 3BBPA 4IL5A 1GPMA 4JYBA 4US2R 4XEUA 3ZV6A 1ZR4A 4C6RA 2OVBA 4MUFA 5JPCA 2W0MA 2BISA 4MKGA 1XU7A 3I9NA 4HDRB 1RZRD 1X70A 2EX4A 4IWNA 4JAVC 5I51A 3FUVA 4KK3A 4MV9A 1FVXA 2OSBA 1QHYA 3A58B 3BRWD 3GDOA 2P9ZA 1U90A 2OFOA 2I22A 1EIZA 3K92A 5BSWA 2FV8A 1LBIA 2QORA 3K32A 1C7RA 4UHKA 3KHTA 4W1PA 1CJVC 4B3RH 4OQZA 1AUXA 1PRYA 1OD6A 5AJUA 1INLA 4EGJA 1HH4A 4E6NA 4BQSA 4EH1A 1TK9A 1J24A 2GCPA 1Y9AA 3HJAA 2AZMA 1FP4B 3O8OA 2ZJFA 2ZJ6A 3KE9A 3TB4A 4RMHA 2SCUB 3RBXA 5C46F 1YZNA 2ZCUA 1IL0A 2XDQB 1QZXA 3BWBA 2PRZA 1MAUA 2CLLB 1EQ2A 1ZGCA 3BJYA 3G6XA 4B3TB 3ZH9B 1X92A 4PZ7A 2LXNA 4F72A 1A77A 4DYVA 1H5UA 4R2LA 4FGJA 3CF0A 2HI0A 2ZJAA 3TH5A 1ESCA 2C9DA 3VUEA 3KQSA 3GIDA 3GA5A 2FLLA 1W36D 5C8DA 4OBXA 3RUDA 3D7NA 1MW8X 5EVCA 4EI8A 1E0JA 3WA6A 1WA5A 4BBAA 1OFUA 3QQPA 2YJ4A 4DVJA 1L9XA 2YFHA 4TWBA 1WMDA 2IV3A 1MC4A 3L8ZA 1YI8A 4FZRA 1CYDA 4NHOA 1YIAA 3FTEA 4ZOCA 1IUOA 3RWOA 4Z7QB 3A10A 3TXYA 1CCWA 9MHTA 3PI6A 2YWXA 1M6VB 3JYHA 1VHQA 3CY6A 1WDLA 3U3MA 4HH1A 1MZVA 3NH6A 4FK8A 2H1VA 1FJXA 4OLFA 4HPXB 4MDFA 3L9WA 1LVUA 1M6WA 1W2HA 2EIHA 1HYBA 3EQ6A 3MTJA 2BCJQ 3PE3A 3Q6IA 2HIGA 3KZNA 3SC3A 4PZAA 1RAGA 4WZBE 1ZAUA 3RVNA 1WV1A 4P3XA 1N2GA 4UFZA 2QT0A 3QVTA 5A06A 2FZWA 1Y4ZA 2F43B 3QWAA 5A9SA 2PWAA 1GPDG 4LCBA 1JKJB 4NEGA 4ETSA 4ND6A 1AKMA 3UT5A 3K9WA 1BKSB 4PQGA 4F3NA 2B37A 2C2YA 3MD9A 5F4BA 4URVR 4PQFA 4M9ZA 1HR0B 1T9BA 4O7VA 4YJ2A 1MIHA 2OWDA 1SCNE 5IAOA 2IYYA 3BE5A 3SKVA 3LGXA 1K68A 4RE5A 5JJCA 4RTLA 4TKUA 4B9AA 4I1UA 1F3OA 1NNEA 4CFZA 1K9VF 2V7TA 1WXWA 5DLDA 2V6GA 3RU7A 1U6KA 2WSSA 1Q0TA 1VGVA 3FF4A 2WB1A 4AC9A 3N2GA 5HCIA 4CIXA 2OQ2A 4C43A 1G4AE 2WICA 4KP7A 3O75A 4YCAA 1KQGA 5KYUB 2FUCA 1P2SA 3OHSX 2Y2VA 2HQSA 3GEPA 4RM3A 1JZTA 2PX6A 3L4KA 4V2IA 1GCAA 3VR6D 2OK8A 1WAMA 5EAIA 2OCGA 2GILA 5TVGA 4ZFNA 2RK6A 1FP2A 1U0EA 1U02A 4OFWA 3KXLA 1W6UA 1K7YA 2H2IA 1NZFA 4PZYA 3F3SA 4M8IA 4X7BA 4NCKA 1EGQA 1Z3IX 1DSSG 2PANA 2VP9A 2BTOA 4DBLE 5JW6A 5IDVA 2O52A 2UZ3A 4JB0A 4Y2TA 4ZOLA 2MYUA 5JZBA 1V96A 2OPHA 3M6WA 4D97A 5LVAA 2YZ2A 1QU2A 2JGRA 4L51A 3T7JA 1PW5A 2AOVA 2IYTA 2PUEA 1X7DA 4DLNA 2R8HA 1TM2A 3KQNA 2BI8A 1CY4A 3DFZA 5DP1A 2ZR8A 5EZYA 4CTJA 3HKEB 1EXWA 1VYVA 1KJQA 3LCRA 2IC5A 4BYMA 1KMIY 3HBMA 4L4ZA 3C24A 4ISBA 4H0NA 3EEOA 5CNKA 3RTXA 1SVUA 3U4CA 1J99A 4Z7OB 5DGCA 5FL7D 1YVDA 5M3BA 4BVJA 3IIMA 1YC2A 5LMNB 2H2DA 4W4TA 5JZOA 4IDPA 1XCMA 4I6JA 2BE7A 4PYOA 3C8DA 1EFKA 3KYJB 1Q7CA 2Y1KA 2HK7A 3ENQA 3SJAA 3MGCA 3WMXA 3O3OB 3N58A 4H7JA 2Z95A 4BXOA 4AO7A 4DVGA 4H18A 2QLJA 4A3IG 4FW9A 2J31A 5JAMA 2VT7A 3T8YA 5H82A 1E0SA 2XQGA 3RHSA 1CUUA 2BFAA 3G6KA 4D44A 3L93A 5BWRA 2IHUA 2P78A 1KO7A 5MHTA 2TMKA 4ECSA 1YQTA 3JR7A 4J7UA 1G60A 2O7RA 5M7EA 4WDRA 4BYGA 1VKHA 2XUAA 1C1YA 3NNSA 5CU7A 4DR1H 4UOZA 2WI8A 4NV3A 4ZEXA 2Z57A 5EIBC 2AMVA 4E6EA 2JIZD 3KQLA 3NHFA 4QGGA 1FMCA 5KDLA 3SM9A 1XTVA 2HHJA 2HIMA 1S2OA 1YE3A 3A6EA 2P4HX 1XK5A 2ISQA 1AGPA 3CQ9A 2NUPB 3DDUA 1NMQA 3KHHA 2ODAA 1X7YB 4OTZA 2R8OA 4II3A 4TV8A 4IDFA 1P31A 1OXVA 3DD1A 4OM8A 2W6JA 3ZCUA 2QLTA 1Z4NA 4YIKA 3OOEA 2ZVQX 5EA2A 3B1ZA 1I2CA 3DBRB 5C5EA 3WXMA 1R9MA 4OH1A 1HNWB 4IUBS 3H04A 4D9GA 3O4HA 3ONVA 3ZTWA 5KFKA 4CKEA 1YI1A 1ZMTA 4EB6A 1AT1A 2I7TA 1R7RA 3IX7A 4BN5A 3HJNA 1GG5A 2ZRAA 3U3XA 4Q66C 1S02A 4HL6A 3D1LA 3EBLA 2RB4A 1SBNE 4FYPA 2PLFA 4CM8A 3E9EA 4A73A 4EI9A 2B69A 2JHAA 4BRSA 2E2HA 1XGKA 3K9CA 5DNUA 2OFPA 1L7EA 3RTEA 3VU3A 4I55F 2Q41A 4BVEA 2OAEA 4RK5A 4XLZA 1CEXA 3A4NA 3AERA 1DOHA 3F4KA 4MUJA 3GZNB 2YXLA 3EG5A 4J4HA 4XEHA 3UICA 1EZZA 4QQKA 1Y8ZA 1YUMA 1J1ZA 2DFPA 2FR1A 1YIOA 5LU8A 3ZV7A 4RXTA 4KAJA 3OOSA 3DMFA 1DAGA 4JB3A 5E8JA 4G5SA 1NI4A 1W4CA 3STHA 4RGBA 2WYUA 1FJ2A 4PWQA 2PQ0A 1XWIA 3G13A 4QHYA 3AL0C 4RQUA 2EC5A 1N7IA 3EYAA 4LGCA 3TTXA 2R65A 5LPNA 4L8LA 3LNTA 1SB9A 3LUGA 3H5LA 1FQJA 4UHBA 4TLAA 1E5QA 4N5NA 3PHJA 3BGIA 3RAEC 2HH9A 3EZGA 1TAQA 2Z0MA 3KWJA 5F77A 2BD0A 1TAHA 3CX7A 3CKYA 1PT7A 2NTYC 5I7SA</