3MJFA

Phosphoribosylamine-glycine ligase from yersinia pestis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
429
structure length
429
Chain Sequence
AMNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylamine--glycine ligase
publication title X-ray crystal structure of phosphoribosylamine-glycine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 128
structure length 429
sequence length 429
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mjfA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mjfA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjfA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 3mjfA04
4O7YA 3K3PA 1CS0A 4M98A 2YS6A 3Q2OA 3R9RA 1GSHA 4MV7A 1KJIA 2R7NA 2YRXA 4EGJA 4TV9F 2QK4A 1W93A 3E5NA 2SCUB 2YWVA 4EG0A 4ZHQF 4IWXA 3UFXB 1CE8A 4EA9A 1I7NA 4HR7A 4GGMX 2YZMA 3HO8A 4DLKA 3VA7A 2XD4A 1WR2A 3OUUA 3RUPA 3VPCA 2PN1A 4YAJB 1PX2A 2W6QA 2VQDA 5CA0F 1C30A 4MV3A 4L1KA 4MV8A 2J9GA 4XYMB 1AUXA 4M9CA 3QFFA 4YJ3F 4WBNF 1JKJB 2DLNA 1GSOA 5H80A 2R82A 1E4EA 1ULZA 2VHEA 3MWEA 2GLTA 2YRWA 4DIMA 2XCLA 4ZI7F 4MV9A 3AX6A 1JDEA 3BSWA 2V5AA 2YZGA 5BMVF 4NYEA 3HB9A 3V4SA 1UC9A 4IIJF 4I55F 5LP6F 2R87A 4HNVA 4O2BF 2GQRA 3R5XA 4C5CA 4M9UA 3R5HA 5IYZF 1GGOA 1UC8A 2Z04A 4O4IF 4O4LF 5KKNB 4O7VA 3U9TA 3DF7A 1M0TA 4IZOA 4WD3A 4C5AA 2I8CA 3JZIA 4O86A 1A48A 3K5HA 2NU6B 4TV8F 4FFOA 2ZDHA 4MA0A 2P0AA 2PBZA 1W96A 2HJWA 2HGSA 2YS7A 3I12A 4O4HF 3WO0A 1M6VA 4FFMA 3U54A 4C5BA 5LYJF 3LP8A 2NU7B 2FPIB 2Z02A 2R7MA 1DV1A 2FB9A 5JQGF 2V58A 1EUCB 1OBDA 4FFLA 4J6EA 1GSAA 3TW6A 4YJ2F 2NPOA 5JVDF 5C1PA 4O7RA 2CNUA 4O7WA 1CQJB 4M99A 1KJJA 2YZNA 4ME6A 4EAAA 2YL2A 1EHIA 4I4TF 3Q1KA 2GQSA 3TIGA 3WO1A 1CQIB 5JVLA 1KJQA 2W6OA 5J2UF 3BSYA 1KC7A 2ZDGA 3OUZA 1EZ1A 2IP4A 1EYZA 2FPGB 2DZDA 2DIKA 1SCUB 2CZGA 1T36A 2NU9B 5HBRB 2WYOA 3R5FA 4EA8A 4ZQIA 1EUDB 1VKZA 5EZYF 3KALA 2YW2A 4XX0B 4HNUA 4MV4A 3ORQA 1IOVA 5FNVF 5HV6A 2GPSA 3RV3A 3MWDA 1KJ8A 1DIKA 4MA5A 4MAMA 2OLSA 3VOTA 1M0WA 5C1OA 2W6PA 3SE7A 4QSHA 4EA7A 4FU0A 4O7TA 1E4EB 4TUYF 1BNCA 1BXRA 2CNVA 1AUVA 5BPHA 4ZOLF 2R86A 3R23A 3GLKA 4MV6A 1KBLA 4FFPA 4O83A 2NUAB 5LA6F 4IWYA 5D8DA 4YBZB 4O4JF 3KAKA 5JH7F 4YB8B 3K5IA 3TQTA 5I47A 2DWCA 3BFPA 2CNQA 2W71A 4HQ6A 4FE2A 2I80A 4XYLB 1IOWA 1KUTA 2R85A 1VBHA 1Z2OX 5CAEB 1JLLB 2FPPB 3BSSA 3TIIA 4HNTA 3GIDA 4EGQA 2ZDQA 2PVPA 1Z2PX 1JDBB 3U55A 3BG5A 2W6ZA 5LOVF 3JRWA 4YAKB 2VR1A 3RFCA 3N6RA 3ETJA 2V59A 5C8YF 3MJFA 4IHJF 1B6SA 4E4TA 5CA1F 1DV2A 5GONF 1Z2NX 2YYAA 1KEEA 4FFNA 4O7NA 2FP4B 1PK8A 4I50F 3VPDA 3JZFA 5BPFA 2R84A 4EABA 5JQWA 5LXTF 2C00A 1OBGA 2VPQA 4FGRA 3V4ZA 4O81A 5CB4F 2X0SA 3ORRA 1GLVA 2W70A 4O7ZA 3RV4A 5DMXA 4O2AF 4XZ3B 3VPBA 1I7LA 1A9XA 3JRXA 1B6RA 3G8CA 2GPWA 2R6FA 3KAJA 2W6NA 3WNZA 2W6MA 2CQYA 4MV1A 3U9SA 4FFRA 1KJ9A 5KX5F 1VBGA 3NUAA 3HBLA 4Y8VB 2I87A 2R7LA 5K2MA 3ETHA 2NU8B 3G8DA 4O82A 3AW8A 4RZQA 3VMMA 3KREA 1C3OA 3LWBA 3N8DA 4O7LA 5J2TF 2R7KA 2YZLA 2QF7A 3TINA 4O84A 4O7SA
chains in the Genus database with same CATH superfamily
2R6GA 4NYMQ 4HEA1 4HMOA 3FUCA 4Y98A 4F2DA 5K4AA 4V0RA 1S02A 2G63A 5K3AA 3BD8A 4Y2JA 4FKZA 4A2WA 1J07A 2X9NA 4JU9A 3W5DA 4N0QA 1VI6A 1ZMOA 2XYHA 4D0NA 1CB7A 5JZVA 3DE4X 1YQXA 4BPBA 1WXWA 3R41A 4XJSA 1XU7A 4L9SA 4ZV7A 1O95A 4XD2A 1P0CA 3HCEA 2K87A 4B09A 5DV9A 3B5JA 4ENRA 3M5DA 2F43A 3DDSA 1NVUQ 1DAPA 2NN3C 4R1QA 1TM5E 4YCJA 3KUXA 2WSYB 3PITA 4C5CA 5M3BA 1G18A 1T3LA 1K97A 4B4KA 2BZSA 3X44A 3S8YA 1QIKA 2X1HA 3MMPA 2ASDA 3OY7A 4PZ8A 1OV4A 4DKJA 4WEQA 3CVUA 2ZDHA 2YHIB 3DPSA 2BEUA 4HDOB 5EUQB 2ZG6A 5K0EA 3CURA 3O6VA 2PKCA 3M1LA 4YUYA 2FH5B 1RJWA 1PLKA 1V5FA 1UOPA 5ALXA 1P7VA 1R50A 2CYCA 1AK1A 4E2XA 2GUWA 2W37A 3FKIG 4XD7D 3EDYA 1XZQA 4X1KB 2HLDD 1AQNA 2COIA 5CD9A 2DBVO 4FILA 4EAAA 1HDRA 1VFNA 2C5GA 3IB6A 1OU4A 2JGDB 3CVZA 5AUOB 1KJQA 1Z29A 2B78A 5AI5A 4M0FA 3QX7A 3ZW9A 3QU4A 3ZZMA 3QNWA 4KL8S 4ABYA 1UK8A 2VYVD 1OLSB 1TQ8A 1EESA 3F7OA 2V6MA 2COUA 1PK9A 2JANA 3UH1A 4ZMBA 4F4ZA 1R0WA 3IDSA 3FZNA 4JQYA 1RIIA 1Q20A 1QUFA 1YU9A 1W2HA 5B6IA 2F8TA 5DBGA 3R40A 1C0KA 4RDHA 1INLA 2AZ4A 2R1UA 1QRDA 1BXGB 2G1JA 2PMWB 4IKPA 4OREX 1GTRA 2YXBA 1KTVA 5D8DA 5JCZA 4YBZB 1OLOA 2VPXA 3OFVA 4GOOD 1K4YA 2HDOA 4LA4A 6LDHA 3D8NA 4EBCA 1VYTA 2BMEA 2WAQE 2PGNA 3NANA 3PIDA 2OG1A 1RK6A 2V8OA 1UMKA 1NVVR 3FI9A 4L2IB 1YB7A 1SQFA 4G4SP 3T4UA 4AI6A 1B0UA 3GPBA 1C7RA 4CV1A 2B36A 2F1OA 4Z0PA 4G1FA 2ZI5A 4ND2A 5CH5A 1GV1A 2VF5X 4HDNA 2QQ5A 5EWJB 5IYCG 3E22B 3KJNA 3SHFA 5HK8A 1JQBA 1O5IA 1UEXC 4DQVA 3BE6A 3JQRA 1N7HA 5ECWA 5AW2A 3I6MA 2ZBUA 2XZLA 1MAAA 3W5HA 2QTVA 3RS5A 5BT8A 3DH0A 1VXRA 5K3EA 4R81A 5HNKA 3C8MA 1KE2A 5AVUA 4CCSA 4IUYA 1FRQA 4YUXA 3F2VA 5AM5A 4JODA 1S5PA 2V6IA 2XNHA 2ZJBA 4ARSA 3ER9A 3MLBA 1QVAA 1T5LA 4I66A 3LGXA 2YN0A 3GLIB 2FW8A 3UG6A 5AI8A 1U7OA 4BP3A 3E9QA 1OKKA 4JYCA 4YYEA 5KYXA 5CITA 1O6FA 1E7MA 3QUQA 3C39A 1M2JA 4QBGB 1Q0PA 1F8YA 3LWBA 4RK4A 4I3FA 2IQ5A 4JNKA 3MTGA 3IP3A 3EGXA 4CR7A 3TQCA 2YR0A 1LNZA 4IDBA 3HXTA 2WJIA 4B6PA 1I4DD 1CW2B 5J47A 3WV5A 4CHGA 1GG9A 1CY6A 4F97A 3E5NA 2EF1A 2C5EA 2FEAA 3R6DA 4UREA 1GQFA 4D97A 1ECLA 3WDSA 3MBKA 4MIYA 4PVDA 4RTJA 4W99A 2JKZA 3T4XA 3F3MA 2F4VH 3LHKA 3QPVA 4ZI3A 1TF2A 1ZRMA 1KZHA 1T29A 1U9ZA 3MB5A 4Z0TA 3WGMA 2D1YA 3HI4A 3EUAA 3T0FA 1OB2A 4KW7A 5JMPA 2C1EA 3VAAA 2M6RA 5GGYA 3LRTA 4FDVA 3LBHA 5E7QA 5IYZF 1NC3A 4OYLA 4OOEA 4OFXA 4G8JA 5DT9A 1H5QA 4KO2S 4L50A 4ARIA 1SHLA 2G04A 4NZNA 4YRLA 1AKTA 1TUBA 5CIYA 3S5UA 1GM5A 3EVNA 1UAYA 3ECSA 5KC9A 1XRNA 1YCFA 1BWPA 3ZE6A 1CUWA 5EQTA 3SI7A 1GZSA 3HJAA 2HSJA 4PC7A 3AF5A 3CB4A 4KHZA 2WP0A 3AHFA 3WB0A 4JP8A 1VJGA 4B40A 4W8GA 1AMNA 2E1PA 1XNQH 1PW5A 4YREA 1HFWA 3FYUC 2JGKA 1L4GA 2JA1A 5KYUA 3C1AA 1KZ9A 4IIXA 5FPOA 3GMDA 3M0EA 2WIJA 5AKLA 2GKGA 4C7XA 4EFEA 4K6HA 2WAQA 3HR8A 3KHHA 1H2XA 2G09A 1E2HA 3UJDA 3P9CA 2Y0PA 1JYEA 1EZZA 5F3WB 2PMCA 2JFGA 1E7SA 2Y1WA 5LBTA 4H3SA 1J21A 4IRCA 3B53X 3ICPA 2ZQZA 3R3UA 4HFJA 3TW4A 1Z6TA 3B12A 3LKZA 1LW6E 5JPDA 2AQIA 2AF4C 5DYNA 5CVUA 2IT1A 4AMYA 1HDIA 2VWGA 2Z9DA 1Y8ZA 4TL6A 3TSAA 3ZK8A 4F2PA 1W35A 2GNPA 5CVVA 2H00A 2VZLA 1E2GA 3EPGA 2HI0A 4AL4A 3QF7A 2MHCA 4R3WA 2AUMA 2QZZA 2XUKA 2OCBA 2QPOA 5IASA 2QAGA 3N0XA 5TS3A 1SHTX 1OXMA 5EJ7A 2JGRA 1E6WA 2R8XA 4JGGA 3M81A 3RJTA 2YIDA 2Y92A 4CGZA 1P61B 1FDOA 2XECA 3KHSA 2F1RA 4I4IA 2N46A 4DV3H 1XZLA 3HUUA 3BE8A 3KKZA 2ARKA 3VBEA 2P6RA 4U7PB 2Q5LA 1ETHA 2LCFA 1OSNA 2EKLA 1FVFA 1XK7A 3V6KA 2CVQA 3GMIA 4NS4A 5CDGA 1R15A 3ZU5A 4I50F 1Q0UA 3FCYA 5JDCA 4ISCA 3KOUA 3AJEA 4TKVB 2PLFA 3JVUA 2BJVA 5ARBA 1PUJA 3CH4B 1Z5VA 3JD0A 5ICFA 2PZMA 3MGAA 3V6JA 5G4KA 2DBQA 4IZHA 5FJ8G 2CHFA 4IQ8A 3TMYA 3U16A 2QB5A 3JYPA 5DSZA 3V2IA 1XLWA 3OA2A 4IJMA 3HJTA 2H4JA 3UOWA 4KFCA 1DIRA 3PGMA 4PLFA 4YALA 3W1GA 4ADSG 3BORA 3LSYA 4CT4B 2AG5A 2V96A 1LZLA 4ZCLA 1JGTA 2X2EA 2WJYA 3L4SO 1UOEA 4O82A 2MINB 1C4WA 4P5PA 3TR0A 1I51A 3OWOA 2RBEA 4UCXA 1UDRA 3BMQA 1Y9ZA 5CT6A 5EPOA 3RBEA 1JVBA 4PLHA 4MRMB 2K7FA 3KJXA 2YWCA 3WS7A 1UC4B 2OHHA 1CPYA 1TQHA 4BC0A 3UB2A 3QVWA 4HVLA 1UC5B 2XKJE 1CQWA 3NHRA 1WR8A 4L8LA 1ZN7A 3SVLA 2OVBA 1KK2A 4L9WA 5GJVC 3C5CA 1IXKA 2P9HA 3QOWA 3I3OA 5KYGA 4MWBA 5TF4A 4OSOA 5FWXB 3ILVA 4RLHA 1TVEA 4J1TC 1PJCA 5FUVA 3RK0A 3K4HA 1C2YA 1LVUA 2OHXA 2V3WA 2YFQA 4L85A 3R24A 2ZJ8A 4M1EA 3REFA 2VJCA 1PWYE 4JSTA 1EDEA 5KQPA 5EN4A 1BVYF 3ULKA 4QGBA 1FX1A 1DOAA 2HV8A 1OMOA 2WU3A 2Y93A 3K70C 3MR2A 1G9SA 1BDIA 4HWTA 1E9SA 3W5CA 1TMKA 4EL0A 4G0NA 3GGDA 2VP2A 3T1HH 4FC7A 3JQ7A 3SFTA 2B8NA 3HU5A 3GBPA 1K4KA 4I08A 5JH7B 1OT3A 4MJLA 2OCIA 1VJCA 1Y1RA 4IVQA 4B3RB 4HUQB 3HSKA 3VU3A 1TJPB 1PJ2A 4NQZA 1RPTA 1S8FA 5AVVA 4F11A 4TV9A 1QK5A 4DAAA 3OI7A 4JYPA 4MQUA 2CD7A 1CDEA 4CQNA 1DOZA 1VE7A 3U31A 1CWUA 2VK1A 2CJWB 3AM4A 4PR0A 1YHZA 4XASA 3I5YA 3HOZG 1NF8A 1Z74A 3JATA 4W7IA 4H35A 3BGVA 2W9BB 4WFKA 1T4GA 3WO1A 1SVKA 5JJKA 4B3SB 3OLCX 2ACEA 2OORC 3U40A 2BAGA 1XQVA 1SCUB 2CY0A 1EZ4A 3H0CA 4M0UA 3BXZA 1EUDB 1L7VC 3FAZA 5HJ2A 4D81A 4CUKA 5IK2D 1TK2A 1F6WA 4G0OA 1RTTA 4AXBA 2VUGA 1T9GS 1V48A 5CM0A 2PGXA 1R4NB 2QJWA 3ZQ4A 2JFQA 4O4HA 3FTNA 2OMEA 3QKUA 2H0QA 1ACMA 2ZJ1A 1TOAA 4JYAH 1YFLA 1NG9A 4DR2B 3CLVA 2OM6A 2XVZA 3R3YA 1Q92A 1PR3A 5CM8B 1VE6A 1GO3E 3L46A 5JVDA 4Q4JB 3FIUA 3UHPA 2WW8A 1C81A 3B85A 4MW2A 2PZ8A 3DGEC 4KPYA 1UL1X 4G0ZA 5JAIA 2Q99A 2VUUA 1YVEI 2I6UA 4F6CA 2QUIA 5J2UA 1T13A 2OLKA 2QD4A 3GEPA 4TVSA 4AYXA 3AHHA 1H2RS 1BH2A 5BUSA 3RRXA 5LD2B 5KUTA 4A2CA 4RMHA 3DEZA 3PUKA 1TMYA 1ZRHA 2VPSA 1EUYA 1U0JA 4CF4A 5HNEA 3RGZA 5GONF 1QGDA 1N2GA 1XZ8A 4RD2A 3SOZA 3TEMA 3EODA 4PYQA 2VA3A 1S2DA 5JZ9A 4PXAA 5A5FA 2QTCA 2G1AA 3QLJA 3TUJC 2WKQA 2CNNA 4COOA 1CKEA 3MGBA 3D5QA 2QT0A 4W5NA 2YINC 1T9ZA 4DTIA 2XB8A 5EKUA 4KFUA 1S0OA 2QMEA 1J5PA 2AFHE 3S2IA 4LYAA 2IRWA 1RQXA 2FA9A 3FBGA 4E4RA 2IOQA 3ZZNA 1BCSB 5BUCA 3EAFA 4KRYA 3HT5A 2NU7A 3NWJA 2PGJA 1FPQA 3P2JA 4GVPA 1OA1A 5G0SA 4G26A 4GGOA 2X2FA 5HRCA 2ZLBA 3IULA 3N2YA 1ZOPA 2D5IA 4JBIA 1Z0IA 5BV7A 2QMYA 5CA1A 1R7RA 4CI9A 3AL3A 5DGXA 2ZSFA 1Q0LA 4TTQA 4DV5H 5KWEA 4MGHA 3ETEA 5BN4B 2Q0HA 2Q6KA 1ADJA 4TX1A 1A9ZA 4Z3KA 1UPXA 2R7NA 2ZROA 3AVTA 2NO4A 2I03A 3RARA 1K7EB 2LNDA 2Q5JA 4EGFA 4LXYA 2HREA 1NI4A 2CKMA 1S2GA 4Y1RA 1UINA 2IYAA 4BXOA 4LBYA 1JLMA 1US8B 5BR1A 4KQWA 4CEJA 3N8HA 3WXBA 2J4DA 2VYCA 4IMRA 5AHOA 4MV8A 2YXPX 2C5BA 1YGPA 4LZNA 3BWXA 4XRGA 3R5TA 2GAIA 5IJ0A 1X80A 4IP0A 3MD0A 2Y1GA 5ITZA 3RKSA 1RLOA 2DWPA 3IDOA 1RHJA 2ZYSA 4TWAA 1WULS 3K9QO 2W4MA 4X97A 5DRYA 2FK3A 4OPMA 1N5RA 1JPJA 1UC8A 2QXUA 3GJ8A 2DCUA 2NWQA 4C7MA 4RZSA 4X3OA 1FJ2A 2I8CA 2AGQA 2WIAA 2WHPA 1CUHA 4YRAA 3CVXA 2XB6A 3NEYA 1W49A 1AUOA 2ONZA 1RHQA 2OVFA 4K2HA 1B4DA 3WIUA 2EFDB 4URXR 4WOKA 3S8EA 3RO7A 4XTRA 5DRTA 1WMDA 1V8ZA 3EDRA 1QVVA 2P9TA 4LVCA 1GSAA 2FR8A 3N2IA 1XMOB 2MCFA 1J8DA 4H17A 1V6AA 2LV8A 1M2GA 5EWMB 3U4AA 1E3SA 2QV7A 3WMRA 3VHQA 2W22A 3L8HA 4RA6A 3M7IA 4V2IA 3Q0TA 3I52A 5C4MA 1V1RA 1BJKA 3OOWA 3V7UA 4AJHA 2BWJA 2BSAA 3KRTA 3E05A 1H4TA 5F1YA 4XX0B 4JROA 5EXTA 3VVCA 3WLIA 1VDZA 4HNAB 4ZCIA 3QVGA 5E4TA 1XZMA 4F96A 5E3IA 3IEVA 3U4QA 4UAJA 3BVPA 3S2ZA 4F71A 1F9AA 2RH9B 1P6QA 5F1KA 4HEQA 3CW2A 4K1LA 3GC6A 4YI3A 3W6NA 2OCDA 5FF9A 4B8ZA 5DISB 4M7EA 1DTSA 1N8SA 3ZJYA 1C1HA 3R6GA 3B38A 2HXGA 3Q40A 3RSCA 4DR3H 2P5SA 4DEVA 1PSZA 4ZOCA 2JH8A 2HZ7A 1XLUA 1DX6A 2F3TA 5CP8A 4MW0A 2AFHA 3G2JA 1ZOSA 3JRWA 3LUHA 2H1LA 1RMQA 3HA7A 3TNFA 5HE9A 1NC1A 4ZVQA 4IDQA 4Z3DA 3FB1A 3LPCA 1P39A 4CZ2A 4PN7A 2PMZE 1VBKA 5FAKA 4R01A 3RVRA 3DYBA 4IJ5A 1GVNB 1BW9A 4PLZA 4D3DA 2H92A 1G8HA 5AKJA 1VRCA 3CZCA 2M6SA 4WBXC 5FB3A 3IQHX 1IQUA 4LMBA 4BMPB 3VNBA 1Y9AA 2XTZA 1N6KA 5D86A 1JFSA 3OEYA 2DFVA 3G9TA 1L8AA 2ZGVA 1XYVA 4KH0A 2Z95A 5FHQA 1HT1E 3PWSA 3CU5A 5BMOA 1QNFA 3ZHBA 3BMNA 1L3IA 3AVXA 1P17A 2R8GA 4B35A 3TCXB 4IM7A 5ESDA 4BQRA 2ZJ7A 4JR1A 4W9MC 3EEYA 1QKIA 2WWXA 3PHGA 1L5OA 1FSZA 3WLFA 4YECA 4QDOA 1QYXA 2V74B 3N0RA 1CR6A 3ASYA 5H1YA 1DT5A 3FLAA 1ISMA 1FNCA 2I7TA 3CZQA 1CZKA 1N5KA 1KVUA 2M6KA 1E62A 2J0UA 3LQSA 4QBTA 3EYAA 1KSGA 3RLIA 2P2DA 1LSJA 2EJBA 2P68A 4WACA 3RUFA 4NBNA 1RWNA 1N1MA 2BM8A 2YVQA 1H85A 8GPBA 3U17A 3NB0A 1TZBA 4F5DA 1IM5A 1YVDA 1I7SB 3L1IA 1HPLA 2IY8A 3WLRA 4PYLA 1I5EA 2EKPA 4GXRA 5JAHA 5JXIA 4LVUA 4D2IA 5EJ4A 3WLAA 4IDEA 5KFYA 2PZGA 2NVUA 1UBNA 2YQ5A 4TT8A 4B43A 4I8IA 4O2RA 2QNRA 3FJYA 5E4FA 2OR3A 3AJAA 4YWHA 1TC2A 2G4CA 4L4RA 1LLUA 4LFCB 5T4FA 2H4HA 2X58A 4NDNE 1XPJA 2B2CA 2JJ1A 3H04A 3PD1A 4A8PA 1NZJA 3M6AA 2QTRA 2H5LA 2X13A 4DBLE 1FMJA 2ORYA 2LDBA 1XTPA 4XXHA 4FEEA 1RZUA 1Q84A 4YIKA 3IDAA 2QQGA 4JMPA 2Y27A 4JYBA 1TX4B 2G7MC 1DBQA 1B41A 2C7GA 1ZVMA 4ZYZA 3BFKA 1VG0B 2A5GA 4QYIB 1ZC4A 3ASZA 2LZ0A 2UXBH 2AOWA 1TYDE 1YI0A 1PE0A 1ZVKA 3JASA 2GQSA 1GKYA 1THGA 2ANBA 4P32A 1NE7A 5CRIA 4LSAA 2P79A 2CLEB 4CLHA 8ATCA 2JFYA 2L18A 2FOXA 2XVXA 3WL3A 1O96B 2XIGA 2UUAH 1I6LA 1Z5UA 1EE1A 1C7IA 3OZVA 1JQLB 4AUKA 2HMYB 1WZCA 4G5GA 1OC2A 4O0MA 1LDGA 3VUFA 4JELA 4RMNA 2Y67A 2J6TA 1B00A 1FFCA 4NCHA 1Q7EA 4HEA6 3LLCA 5IAOA 1FQKA 1RYMA 1UEIA 5FWNA 2PMZA 2DH5A 3ICEA 2PZKA 4C6TB 5FTLA 3WGKA 3EA4A 3COPA 4ARVA 2ZS7A 2NUAB 1VA5A 1DADA 5DTIA 1TJ3A 3B6KA 4KPUB 2GPYA 1QRRA 2DP4E 2C7BA 5AW5A 2CKZB 2YY5A 3JQBC 2VC2B 3B36A 1VLJA 3FR7A 4Y6PA 4CCYB 1XEWX 5BVGB 5BYBA 1BHJA 3LOUA 4FNAA 4R8SA 4OH1A 3KKMA 1HTBA 3OZTA 4PZZA 1JR3D 2ZR0A 2FLKA 4H27A 3T5LA 1SG6A 5EWLA 4UPDA 3AXTA 4YYZA 1H2FA 4YR9A 4WN3A 3DAPA 3JU3A 2ATXA 3L6RA 1T2DA 2WMDA 2QX9A 5CW1A 4V1CB 1BKSB 4B85A 2VATA 2O8FB 2CV0A 3A9SA 3A4TA 3MEQA 4TRRA 1RI2A 3PSAA 5KFNA 1U2TA 4WE3A 5HZGA 1EX1A 2XKBA 4OHMA 4DR5B 1GCGA 2B4RO 2Q27A 2HK6A 2OTCA 3K35A 1COWD 2O19A 5JI3E 2BFCB 5DTJA 1WEHA 2Q4OA 1XQWA 2HCRA 2RBGA 4I19A 1M6YA 3UOAB 2WTAA 3I0NA 1G6HA 4AJEA 4DL7A 2JAHA 3LF2A 4E5PA 2OOKA 1KEUA 4GSLA 2QM8A 3QHQA 1E7YA 1EDOA 2IOHA 1CUDA 1XTTA 4BB9A 4S3MA 4FE7A 3KHUA 3KREA 1GPLA 1DRJA 2VG8A 1LLQA 2BR5A 3LW8A 2C2GA 5J59A 4O0LA 1AMUA 3MUNA 4JB0A 4OSPA 1PGOA 1A76A 2C29D 2D7CA 4W9RA 2WTXA 2IGTA 3WAGA 4GR9A 1QFXA 4QLAA 1OH8A 1TW2A 1ZAUA 1C8BA 2XT6A 5TC4A 4U02A 1ORDA 2GD1O 4FD3A 3VGJA 4N6GA 2ERXA 4QIHA 4TYPA 3OU7A 1P5HA 1N34H 4A5SA 5FO0A 3SJ7A 4E33A 3PUWA 1VJ5A 4M89A 3NRCA 1KY2A 3ELUA 1V7PC 4KMMA 3QFFA 2DR0A 2QS9A 4TYYA 1Y8QB 2A67A 1U8AA 3N59A 2XWSA 1T3TA 2J0EA 1L4EA 2JI4A 2C2MA 3E9CA 3VYWA 4A26A 2XUJA 2W2NA 4AG5A 4UUOA 1ULHA 3KLBA 1YNSA 4H15A 3OZWA 4YR2A 5JSQA 4CM4A 4UDXX 2WAOA 1EKVA 4TV8F 3IMGA 2GTHA 2OGZA 2FMKA 4BX0A 4FYWA 2GAJA 3IUPA 5ALNA 1N9ZA 3RAJA 2RE8A 2ODBA 4FFMA 2ONJA 2QRVB 3RIGA 1DV1A 2ID7A 1E9CA 4B3FX 2CBZA 4BCDA 1HT2E 1K6MA 5L3QA 4B3TB 4Z6KA 3G13A 2KS6A 4FJ0A 1H23A 3LY9A 1U8TA 2XPCA 3YASA 1XB2A 1YQ9A 3P32A 1K89A 4PZ9A 3GU3A 3TF5A 4DWJA 4J9UE 3ABOB 3IBGA 4RD3A 1T36A 1Z56C 3FHLA 4F60A 2WG0A 5BVHA 4S1PA 1XHLA 2GSDA 3QM1A 4I46A 3IE0A 5F5NA 4TZTA 1UMBA 3TPFA 2R1VB 5LM3A 4RHXA 5ALLA 3O8RA 2RGNC 3SF8A 4WUTA 1M0WA 4H2DA 3DMTC 2EDCA 2OB2A 3BK7A 3D5TA 5IFKA 5DBFA 4X8HA 3QPWA 1OY1A 1C4XA 4OX9B 3UC5A 2JCGA 3FSJX 1D0SA 4IR1A 3SYMA 1JBQA 3ADKA 2OY0A 2YOFA 4YASA 4IAJA 2JA7G 4PZEA 4BO7A 3I3SR 1TEVA 2WVJA 4YUZA 1CKOA 2W57A 1Y9EA 1UZAA 1CC1S 3DEIA 4MS3A 3N2LA 2UVQA 2NGRA 3HBJA 2ZAMA 5KBYA 3L2PA 2JEJA 2SHKA 4J9OA 1AE1A 4RK1A 2QVLA 2A88A 3OAAA 2A1TS 1P33A 1JJVA 2I3GA 3M70A 3SM3A 3LFTA 4LPSA 1BYUA 4LRWA 3OE5A 1D8AA 4PLVA 2WD7A 3D2BA 4XIFA 1Z4PX 1HMYA 1RVV1 1QF9A 1FJGH 1UPTA 3UAGA 5LZ5A 2HWKA 3HKCA 2W2XA 3UW3A 4XYMA 3LX4A 5IC5A 2K4MA 4HGZA 4KR3A 1KMNA 3WFJA 3ONWA 3DFFA 4D3SA 4ES6A 1JHMA 4G67A 3NBXX 5KOJA 2VQEH 1TPZA 2V03A 5T4BA 3TQRA 3PG5A 1X7ZB 1U1CA 3WSWA 4WESA 5CB0A 4QOEA 2ANCA 3DZFA 2HEIA 2CL6X 2YY6A 4WXEA 1M7BA 4NCNA 3EF3A 1KVQA 3CQ9A 2H07A 3FUXA 2B8JA 1I36A 2P9FA 2WUFA 2A7QA 4KNWA 1IQRA 2C96A 2DMRA 2HRDA 3AG5A 2FHSA 3O21A 3V5NA 1VQ1A 1BEZA 3GH3A 3CUKA 5K0CA 4C29A 1F8UA 4RQAA 2YNMC 1DP4A 2XSZA 4K8RB 4QICA 1J1UA 1RJPA 3GEEA 3L07A 5F2KA 5KU1A 2Z2ZA 3RAXA 3Q8WA 3BIOA 1WBBA 3MTJA 3PR5B 2ZYRA 1Q6YA 1N6HA 4TL7A 4LG1A 4EM6A 2YWVA 1O8BA 3NAQA 4OI1A 3OQVA 1PG2A 4J16C 2HF7A 3VX3A 4LN1A 1LX7A 2V6GA 4V2UA 2IYQA 5JCOA 3H1FA 2WD9A 4BQNA 1N6RA 2ATEA 4UTNA 1Y1VG 1JHRA 1HNXB 2QXTA 4Q66C 3VOBA 1K6XA 5FEUA 5HMLA 2NYAA 3O9ZA 5KJFA 1MCZA 1ZW6A 4NQRA 1CUEA 4GBGA 4BNWA 4BFYA 1V9SA 4RF5A 4GMGA 3T7DA 3FGOA 1TQ2A 3FLBA 4U9HS 3ZHQA 3W9SA 4FHDA 2SKDA 4GOLD 2QKYA 5KG7A 2YJ6A 2QD5A 1SUCA 3QELB 3FWKA 3FYDA 2IA5A 5ECYA 3U3DA 5F64A 4FVTA 1AGXA 1PBNA 5JI2E 4WEOA 3KC2A 3HXMA 5JAQA 3TNLA 3OG9A 2Z02A 1REQB 4DCGA 3FKSA 4QTYA 3R6WA 3PFFA 3HA3A 4JGIA 3PT9A 3TQIA 3LOQA 2C9MA 5K0TA 2XDYA 1M7JA 2O8DB 3GUZA 1K7SN 4HS9A 3ZVKA 1NM5A 4O2LA 3ICQB 4PAMA 2GFHA 3ZWBA 2YC2C 3DKKA 2QU8A 4GP7A 2HJ9A 4I55A 4ZVOA 1YDWA 2VH2A 1ZONA 3V2GA 4BV3A 5A7HA 3H18A 1YIDA 2IS4A 4DN6A 1C3LA 1SBZA 2WJVA 2HGXA 4KPGA 4N82A 5TDHA 3KELA 4JI3H 3RYTC 3TEJA 2VRNA 4UDOA 3IA2A 2XQGA 2J6HA 2P41A 1FQJA 4U5XA 4W7SA 2J3KA 1P9LA 5CNIA 2P62A 3GN2A 2VJMB 1ZAKA 1ZO8A 4R98A 4BYMA 2HHJA 4B7ZA 1W0KA 1UKEA 1N2ZA 3F90A 3LUFA 1IY2A 2IEGA 4J9NA 5I6DA 4KR6A 3QKRA 3GG2A 2CLIB 2ZRKA 4M9ZA 5KNCH 1G2IA 3RRBA 2PT7A 5KNBA 1IBKH 3TIIA 1CY0A 3CUVA 3LLUA 1H69A 3R3VA 1XZAA 1I3LA 3RJ0A 3A2MA 4B34A 3S99A 3BEDA 5C4IA 2FZVA 2HCJB 3WHKA 2O52A 1FFHA 4QQRA 1M6VB 1OILA 3I6BA 1RBMA 3HLYA 5KNBH 4YQWA 3CEBA 2BFDB 5FPYA 3ZXUB 4A2BA 4P5DA 2C88A 4QO7A 4OBEA 4F8JA 3HL0A 3WHIA 4DZTA 2N1BA 4JJGA 4NXNB 3OLXA 1H05A 4Q39A 4K28A 1TJ4A 5HM8A 1WOMA 5AESA 3EW9A 3VPDA 3R9KA 3RUEA 4A3EG 4P3YA 1RHKA 2ZIXA 5C1DA 2ZXEA 1MUUA 4IZ6A 4AN4A 3BHIA 4K6NA 3SZMA 4LRTB 4MW9A 1ZJ4A 3KYHC 2ZB3A 1U0BB 1NJ2A 2IJGX 4O4LB 2IH4A 2E18A 3HWRA 4ZXFA 4G85A 5A5VA 4M83A 1JMKC 1MAHA 4M76B 2R1ZA 3WKCA 4XEHA 2FUCA 1R0RE 4D0SA 3DZBA 4C76A 3OESA 1SCQA 2VCHA 2UU9B 3C0FB 1PBTA 2OSBA 1DG9A 3GGSA 2P4HX 1FP6A 3SIRA 3EQZA 2C5FA 3ROFA 4L8YA 1W0JD 2IEYA 3L1HA 1NDUA 3DHWC 4A27A 4P7JA 2OLJA 3TTTA 4NU0A 4GX5A 2W8KA 1LU9A 1FFGA 1LPSA 4E12A 4BRUA 4XSVA 3A3NA 3AHDA 4H08A 1NLUA 4Q6WA 4D43A 2G4LA 4O84A 4O7SA 2H7YA 2FPGA 1IK6A 1FUKA 1M66A 2PH5A 2VH5R 1L8LA 3NJ4A 2HU5A 3C3BA 3PGJA 2FMHA 3OTOH 3IIKA 3AI3A 4Y2XA 1BGWA 1XDZA 1GQ2A 2UZ3A 1S89A 4P6VF 4EW6A 5REQA 4OYRA 4ED8A 2Y1EA 5K3CA 3B9QA 3CNQS 3QE9Y 1IBCA 4QHSA 3ZGOA 4YR3A 1JJIA 1KL7A 1XV5A 5IW8A 2EFYA 4CT5A 3WOVA 3O1LA 3FMFA 1SGWA 1SBIA 4J0CA 5BWWA 4FIDA 1SXJA 4EA6A 2VAPA 4LF5B 3T35A 4W5QA 4BFSA 1KFJB 5J1TB 3WLMA 2CFMA 1KPGA 1ZG3A 3U37A 3OOEA 3KOZA 1X13A 3ZY4A 5CLLA 3ESZA 5CG2A 4OHWA 5KTMA 3M6MD 3E23A 1NY6A 1GUBA 2POQX 2FFBA 1P0QA 4QGHA 3M5CA 2WP8J 2CNDA 3OCXA 2AMFA 2W4IA 4DPMA 5FL3A 4B6GA 2HRZA 4MUAA 4O7RA 3NBMA 5KT6A 3EVEA 1JIHA 1TCAA 4RIHA 3GLHE 5C8YB 1DFHA 1H2ZA 4UE2A 4IHAA 1E1CB 2WG1A 3RTBA 3GT3A 2XDAA 2E4VA 2YN2A 2P11A 4B4VA 2OD2A 1QIHA 2W2OA 1SXIA 1T2NA 2RAUA 2IU6A 3TGPA 1T43A 1Z7BA 2HHHH 1T9AA 4QATA 3WGOA 2X4LA 1OLXB 1CUBA 1E2FA 1N8KA 5EIBD 4WXYB 4HDSB 3AY0A 3VZRA 2B25A 4WA7A 4N9QA 1CNFA 2C83A 1VBMA 2UDPA 3NHSA 2W2TA 5JRJA 4F3NA 3VJKA 1RNLA 4PRZA 2EFGA 4ZYXA 5DW0A 5FUQA 4Q4CA 3HSSA 3ND5A 4EB6B 5JZOA 3A6ZA 3DP9A 1SKAA 1VKHA 1NPYA 1I0LA 4AJ2A 1ZGCA 1CB0A 2JGAA 1G2OA 4F7WA 5L3SB 1QOPB 4JL8A 4M1KA 4B3MB 1T3HA 1TYAE 2YX1A 4PLCA 3ETNA 2R85A 3ICOA 2V9PA 2BP7A 1JLLB 3W79A 5SICE 5D1NA 1SRQA 2JFPA 2GCGA 1ECGA 5IN5A 5KI6A 4H1VA 2W6ZA 1E96A 1JDBC 3PK0A 4G84A 4ZYWA 4FN4A 3NKLA 4RZRA 3LPLA 3OHMA 1ZESA 2GHIA 4Z4EA 4W6ZA 2E89A 1BC5A 2Z9CA 4DLPA 7GPBA 3EOAI 3P2KA 3U4IA 3BCRA 1UOQA 4BLRA 1GTL1 1YBFA 5FOXA 5COBA 4XWYA 2C42A 2ZBGA 4MUKA 3WIDA 2C2DA 5DHFA 2Z6AA 4K6FA 1CZHA 4KQXA 1PZEA 5A0FA 1JILA 4RV5A 1JHYA 5DHPA 2A92A 3IXLA 1UMDB 2FJ0A 1K6JA 4QYTA 4OHOA 2ZKIA 2AOTB 2IK8A 1HG1A 4DEYA 4DNPA 2SKCA 4C2UA 4B7XA 3IAFA 1DTWA 2AQ4A 2PX8A 2Q3BA 4MO2A 4R8UA 3ANXA 1TUGA 1M6HA 1TCVA 521PA 4HEHA 1PJ8A 3H4MA 3O1JC 4ZCMA 5LSAA 3WLJA 3B13B 1LBQA 3VXKA 5KFRA 1UJNA 4X6YA 4AY3A 4IG4A 2JFHA 1QTRA 4MEBA 3H16A 2D2FA 1FDIA 4EQ5A 4FS2A 5FP0A 2DUJA 2DF8A 1DC8A 4AB1A 2IH2A 1XDDA 4GBED 4E08A 2IHVA 4IWXA 4ZHQF 4TKMA 3DVLA 5DI3B 4HR7A 4K6CA 4DMFA 3NKVA 1WR2A 3UQYS 2VSQA 2OGUA 2OB1A 3ADCA 4RLFA 4QKQA 2AI3A 1I4OA 2OEPA 3DVAB 2OYCA 1KO7A 3HFSA 4FFVA 2UVWA 3HP1A 2XY4A 3INNA 4EKNB 1G5RA 4ZVNA 4EUKA 4IQ0A 2ZREA 4ZZ3A 4KDFA 3KXDA 1Z4NA 3GLHA 1UZLA 5JCJD 4A3FG 3VNSA 4LMAA 1L7MA 5TS2A 3R4CA 2A5LA 1HQDA 1B74A 4MGYR 5C4GB 3DF7A 4K03A 3EBLA 3KIPA 4BNKA 3EGIA 4C7KA 4GC6A 2AI1A 3K5HA 1JDZA 3RVKA 1BN7A 3DDUA 4YC7A 1PFQA 3RAEC 3H5OA 3K0AA 1WW3A 4P54A 1P2FA 1THZA 1M8JA 4FE3A 1YJXA 4MRPA 3IOMA 5K3BA 2IKQA 3T3PB 1J8MF 1WSWA 2VXYA 1QX4A 2VDLB 4Z1MD 3L06A 3TM5A 3TW6A 4BQIA 3GIWA 3IKLA 4CKCA 3ETGA 1CQJB 4M99A 1QZTA 5HK9A 4OQLA 2YCBA 4IO1A 3GIMA 1NP3A 1E64A 2DU8A 2Q2NA 3G8BA 4RM3A 5BSGA 4YT5A 4I7HA 1ZOLA 2ZM6B 1GPBA 3RVOA 4ZC8A 1JU9A 3OKPA 2XCQA 1GDHA 3WSTA 5DH9A 4BU1A 3HFJA 5T41A 2HUNA 3DP7A 3G0CA 4DDHA 4YDRA 4DQKA 5IVPA 2F8MA 3N2ZB 2VNIA 2P9GA 3BMCA 2PD3A 5KNDA 4NZOA 1Y4UA 1CF4A 3VNUA 1MX9A 5TSDA 2J9XB 2ZBRA 4B1FA 5JAMA 1OXKB 4GNKA 1A3GA 3C1TA 2NT3A 4OJNA 1G7SA 2YU9A 5KNDH 3EIXA 1PNOA 4A1OA 3F4KA 2QD3A 1GNTA 2CNQA 3AR7A 2XGOA 5GJCA 5I3ZA 3TEKA 2HFJA 2HQRA 3C8DA 2QN6A 4G2NA 4M1WA 3KQUA 1NIJA 4D9BA 4U4AA 1DO0A 4QWDA 5D5QA 4Z54A 2ZWVA 1WP9A 4RV4A 3WDMA 5AKGA 4A3MG 3NTRA 4X66B 4GPTA 1IB0A 5I5TA 5B7GA 5I01A 4RVGA 1AUPA 2I2XB 2XGSA 4D1YA 3QY0A 2AJTA 3LY7A 3S70A 3FB4A 1J23A 4LQDA 4M1ZA 1TO6A 4IIYA 1PK8A 3KOWA 1RCTE 2OSVA 1ZEJA 1E2LA 2HIXA 1Z8FA 5BPFA 4RY0A 3GLSA 2HA4A 3PA8A 5D5HA 3O91A 3EIEA 3I4NG 3ERCA 3WWPA 1DLIA 5F4ZA 4WFJA 3MJDA 3G82C 4RZ3A 1KI2A 1B8UA 5I5EA 4H0FA 1TGYA 2J6IA 1KY5A 2YXDA 1IBMH 2VYND 3MSXA 4HRVA 1F0NA 3UA3A 3HEMA 1QDUA 4JJEA 1N9GA 3EEOA 4ENVA 3G8YA 1Q17A 4F4WA 2UVPB 4OU5A 1WB4A 3DB1A 3PDJA 4N3AA 4FUQA 3RS8A 2QLLA 2I1QA 4DB2A 2H7XA 1L7EA 4U39A 4E5NA 2J9FA 1V2GA 5TIIA 1EVJA 4AJJA 1RZRA 4JL6A 5IH3A 4ND5A 3CX8A 4BU0A 1D1TA 1MV8A 2HVQA 3K0FA 4H1HA 1VHQA 3IPYA 3CZ5A 1QHHB 4FFBA 2KB0A 3IPXA 5ARCA 3FCSB 2REQB 4EY5A 4AP9A 3MN1A 3EUFA 1QE0A 4IQGA 5F73A 1WMSA 2R47A 4HDCA 3LWDA 4MV7A 4CDGA 2FLPA 3P9PA 2KE5A 4FZVA 2ODEA 3H97A 3KT8A 4NFLA 1DGSA 5JSFA 4FFWA 2V7BA 1QJCA 4YIHA 1XYYA 4Y9DA 5F21A 2GJ4A 3RTCA 4JJKA 4TN5A 4CXMA 4KYUA 4B6RA 1GSOA 3DAAA 2R82A 1GZ4A 1YZFA 4L5CA 1P8LA 2ZCUA 5TQ2A 1U0LA 4DMRA 4TUYB 2ZUSA 3T9BA 1O9HA 1S2OA 1L5WA 3AVWA 5F98A 3TY9A 1OROA 2PCJA 1EA5A 1R66A 4E0BA 4WRRA 4UHBA 4MR7A 3M4ZA 4N8EA 3EW7A 3Q6IA 1VHWA 5KREA 3UAOA 4H1UA 4GP9A 3K1ZA 2HJWA 1C1XB 5BSRA 1AG9A 4WLEA 1UAGA 4ZVUA 3U5ZB 3OT1B 1SUIA 4B6FA 1UM9A 3UPDA 3ZW7A 4BP1A 4WK0B 2HA6A 3R8FA 4JJIA 1ORVA 4GC7A 2V55B 2NVWA 4C14A 4Z4CA 5ICEA 5LIRA 2H4XA 4DL6A 1DT3A 2BM9A 4BO3A 3C7TA 3NCTA 4RAOA 4P36A 1HRDA 4NX2A 3FUWA 3AJ8A 1KY4A 4JI7H 3R7NA 3NAMA 2ZVPX 3A10A 4I9HA 3THRA 2YW2A 1KJWA 2NSHA 3NTLA 3GZ4A 2H1WA 2QYZA 3FPSA 4DRZA 1ONPA 1I13A 5E6UB 1M2VB 2A3NA 2J5RA 1T5BA 4Q16A 4UPEA 5A71A 2W6PA 2EARA 2G9NA 1VMDA 2XB2A 3JRNA 5L6MB 3GVIA 2VCYA 1ZKDA 4FE4A 3ZQ6A 4G56A 2II6A 2HAEA 1JU4A 1ZHHA 3E6AA 4TYNA 2VTBA 3GLKA 3QVUA 3KE8A 3AG6A 3E9EA 4B71A 4IWYA 4DMLA 1QYRA 3T61A 3V7WA 3IBSA 4NY1A 2BCJQ 2BGJA 2UYQA 2X86A 3ZJTA 3QNMA 4HBGA 3CH7A 3DQPA 2FWAA 1SZDA 1J00A 3G0GA 5KYWA 3P2OA 1HWYA 4AMUA 1E9DA 4U6QA 5JRDS 2QSZA 3AVUA 4AJLA 3SZRA 1IG0A 4MULA 5KPJA 2QENA 3HOVG 3SDBA 5AVTA 3W4KA 5BQFA 3PRKE 3ECAA 1G7TA 1ZM4A 3MT9A 4Y2SA 2ZYIA 3IEUA 4MPDA 3QU2A 1TT5B 3TBKA 3UMBA 3OT5A 4KRGA 1FNBA 1Z38A 1G21E 3IP6A 1QPGA 3N86A 4DC1A 1J2RA 4J76A 5AKIA 1YD7A 5DIZA 4MVJM 2J5QA 2YJGA 4ZRMA 3HY6A 5B2ZA 5FOVA 3T7JA 2O54A 3UMFA 5IC4A 3FFBA 4F8EA 2PAFA 1W36B 2YFKA 3UANA 4OOFA 3PQ6A 4IR7A 2H48A 1E7RA 4HAUA 2FLLA 1Y6QA 4R51A 1BTOA 3BILA 4HFNA 4UNPA 3NBQA 5AK5A 1NVVQ 4YJHB 4TKZA 3MUEA 1XEXB 1M7HA 4BWYA 3U9SA 3RPEA 1KJ9A 2X40A 2VT3A 4DA7A 2V8BA 4EEKA 4APMA 2NACA 1F38A 3G2OA 3CEAA 3JWIA 2E48A 4NR0A 3PX3A 2WLSA 2Y3IA 1Q19A 1R9TA 5BQXA 2WF7A 5I9SA 4E5UA 4IV5A 3P19A 1XNJA 1L3CA 4TLDA 2B9EA 4A3DG 4F8YA 3FVWA 2VPTA 2VJOA 1L5RA 1XVVA 4HTFA 4KLNA 4NPAA 2W42A 4LSGA 5HFAA 1KC1A 5KYYA 3FOFC 1Z25A 4BRSA 1PGPA 2CXNA 1NNUA 4EJSB 4K87A 5B4UA 3ZWQA 1LNSA 1KF0A 4QRDA 2EFHB 4LVOA 1AGYA 4QJIA 5JECA 2IZ7A 3ZDZB 1LGYA 4Q21A 4EEQA 2RGXA 1SC6A 3SIWA 4KR7A 1E4VA 4U7WA 4GHWA 1KZ1A 4JBLA 1AK2A 2MR5A 4GSYA 1GKKA 1UJ5A 1C0LA 1XJCA 1Y48E 1G8YA 3EBPA 2PR2A 2EHDA 1XD8A 4HWOA 5T7BA 3A6LA 5GQSA 4O2BF 1WCV1 2Z3WA 4LNAA 5KTOA 3AR3A 1JSCA 3ROMA 1IHYA 5KKNB 1WDKA 1PFKA 1L8OA 4EPRA 4F50A 2FK8A 1H2YA 1MIOB 2XOEA 2DC1A 4GR4A 4M54A 3K71B 2X1LA 4JBXA 3GHHA 3IQFA 3RU3A 4URVR 2FPIB 3Q98A 2I4MA 4IXMA 1W0CA 4IXDA 1DJQA 4NBKA 2HIVA 3C0KA 2J8ZA 2PV7A 2AC7A 3BIFA 3IV9A 3ZWDA 2UUCH 3W2EA 1G5HA 1G20B 3LGAA 4MDFA 4PC1A 1WZNA 4X71A 5B7PA 3DR3A 3F9CA 4ZI7A 1AGRA 2CUKA 4XM0A 2W6OA 1TF7A 4BFXA 2R8RA 1Y1SA 4R5HA 5HBRB 4NH0A 2EL7A 3BKXA 3A2KA 3EDOA 2FW0A 3O8CA 1E18A 2ZI3A 4O3MA 2QRQA 4HVCA 1Q7BA 3HZHA 1QQAA 4G5HA 3TAXA 1GYPA 1MH9A 3A6FA 3ZNNA 5ULLA 2B2XA 3UV3A 1RQGA 3CR8A 2K2WA 1OFUA 1GRRA 3M3PA 2PUBA 2O3QA 3ZIUA 4LDQA 3EJ6A 1JIJA 1G21A 3P97A 1P81A 2OXEA 1CHNA 5KX5B 4GGPA 4FCWA 2NU8A 1RYFA 4PFJA 5J5AA 1MB4A 3FROA 5AXDA 3WQQA 2O8BA 4P81A 4YJKA 1KRWA 1RQPA 4M60A 3HJBA 2BH2A 1U1IA 3U3KA 4EJFA 5LBUA 2M98A 2WJ6A 2I2DA 1X9NA 2FRVA 2A9KA 5CYFA 3ZE9A 3OBBA 2BMVA 3SDSA 3QEJA 1X38A 3GWZA 4CM3A 1Z37A 5NULA 2J5XA 1O77A 3FVTA 1UBTS 4DG9A 2CFCA 1KHHA 3FE2A 2FYTA 1W6RA 1YC5A 3L8DA 1MT0A 5EEHA 4QUAA 1PL0A 1RQ7A 2CFOA 4PWYA 2E2IA 3ZWXA 1JH8A 3KWLA 3OE1A 3Q9NA 1UKCA 1W5SA 1ECPA 1YUBA 4YRQA 5LB2A 5JYEA 3IYLW 2EJ3A 3KQMA 1W75A 1CSEE 3PPIA 5BWLA 5F77A 1PUIA 4ETNA 4DLYA 2KWIA 1YVRA 4ZK6A 2L82A 1QORA 3NBZB 2R84A 3QZUA 1MPTA 4BNHA 2OA0A 4L57A 3TO5A 1ICIA 4M0JA 3EXHB 3F3KA 3EAQA 1Z2EA 1NFFA 1JI0A 2HJSA 2W70A 5EGNA 1DAOA 2DWOA 4RXTA 4Q3BA 4ZYVA 5K0GA 2AXPA 4BJHB 2LW7A 4IS3A 1QWSA 1JHUA 2I6SA 2VUMA 1MJFA 4ZAYA 1MAVA 2A5JA 1V95A 3BABA 3E53A 3GN1A 4A82A 1WSDA 4ECQA 4BO2A 4HZGA 3QTLA 4DG5A 1DBWA 5K2MA 2POCA 3L9XA 1GYFA 1J42A 4WY5A 3IAXA 3ZHCA 5M29A 4X1YB 1J7KA 4M1SA 1R88A 3T54A 4MQ4A 5IAJA 2B98A 4EX6A 3N6VA 3ESXA 3R0XA 1UF9A 1CR0A 2C54A 1T35A 1NHGA 1CYEA 4ATNA 5I5WA 3D3NA 3PUVA 3X0DA 2HFKA 1TC1A 3G6KA 3CWZA 5JZBA 1VCOA 3AEUB 2H52A 1FMLA 4GMHA 3R9RA 4UCUA 1PJLA 3HUTA 3L40A 3G7SA 2SBTA 2GCOB 3QRWA 3DBLA 4AJNA 3FR8A 5A3JA 1VSUA 3NBKA 4YAJB 1L4NA 2FW6A 2ZSEA 3MMNA 5FOSA 2Z43A 5EQJB 1KT8A 3OO0A 1X14A 2IBTA 1S0UA 3QTBA 4L27A 3RB6A 1OXBB 5BN3B 4MCAA 1S7GA 3P9KA 5L7YA 5L40A 3I4MG 3IODA 2IDKA 4HNVA 1IJKA 3IRVA 1WY5A 1ONOA 1QB8A 2BFMA 1G1MA 4KSYA 2X5RA 3FCCA 4QFDA 1IAQA 4X60A 2BGIA 3OM0A 3JZIA 2F3SA 3O4JA 4LCEA 1U2GC 2HUPA 1BWRA 3AHJA 5C34B 1X7YB 1VJ0A 2C4WA 1A9PA 2R4TA 5FLEX 4A3GG 3I05A 2IYLD 2PYZA 4F6RB 2YC4C 3H8SA 3GJXC 2XOKD 2ECPA 5DYTA 3ZVLA 3AVQA 4GM4A 4BKQA 3W1VA 1EAYA 2ZSKA 3C45A 4AJOA 1TA8A 3X1YA 3N5CA 3GCZA 5D87A 4AX8A 3VNQA 1EE2A 2HLPA 3KCNA 2YV2A 5SY6A 1TAQA 1RCUA 1XU4A 3OJ0A 3WFIA 1FP4A 1WW2A 3AUTA 4UTOA 4BNIA 4CLOA 1G6OA 3P52A 2OCXA 4ZQIA 1Z35A 4N8SA 3ORQA 3KPWA 3BCUA 2PUTA 2YFHA 3VSEA 3F0TA 5JYDA 1GGFA 1HNNA 1RYBA 5B1SA 4F3YA 3VDXA 1S1MA 4R41A 4QSHA 4LOHA 3BH7A 3DW1X 4AC9A 1GT91 2UXCB 2L0XA 2QTNA 4MS1B 3IUBA 2AXQA 2O8EB 1ILWA 1I32A 4JC4A 4QYMA 4BTVA 2R65A 2IDMA 5SZHB 4QULA 5FQOA 5DJ5A 1XU9A 1AV7A 3WP1B 1GPWB 1ZK1A 4I4TA 5A9RA 1YV9A 4F9EA 5JSZA 3KZCA 1QDEA 1FTGA 3GIDA 3BWEA 4J0IA 2FG5A 4MHOA 3CZAA 5IM4A 4C78A 1PWEA 2RGDA 2V0NA 1I4TD 4AO6A 1E0KA 5JBIA 3NONA 3FUVA 7MHTA 2H8GA 4DBZA 2QIPA 1DKOA 4BNUA 4G5YA 4FJ2A 3CFYA 1OGIA 5JNLA 1XL1A 3JAKB 1I4WA 1KIAA 3DMPA 4LF8B 1D4FA 9MHTA 2AE1A 3HPRA 4I5DA 4CMKA 5AK0A 1EPUA 4AKTA 4L8VA 5HJ7A 4KXWA 3PXEA 1I80A 2ZWOA 1X9HA 3TSZA 1J06A 1B14A 1CUUA 3HN6A 3VPGA 3SOPA 1PUXA 1SOAA 1ILEA 4AJKA 4A5OA 1L9XA 1PEYA 2PY6A 3H2KA 1KR5A 1D1QA 3UJAA 3S4YA 4ESHA 1OFVA 5IEJA 3AEZA 3QFSA 3QG1A 5JC1A 2VNJA 3QUTA 1ZZEA 3WV4A 1NOKA 2BI8A 1VL1A 1USUA 3AKEA 1MORA 4CIXA 3GJZA 2AD5A 2R8HA 5E0OA 4C20A 3RIYA 4E07A 3PUZA 5BNZA 4DA9A 5KOHA 1ZIPA 3LP5A 2PS0A 4MUIA 4UXIA 2QMOA 4Y9RA 4B80A 4A3IG 1YA4A 3K3PA 2QR5A 1Z5ZA 3GFQA 2EL9A 3DOOA 3TQOA 3FWZA 5JXJA 2VPYA 5IKXA 1XNGA 3SI8A 3HO8A 1S96A 4HDRA 3MINA 2X4DA 3BJIC 4NOLA 1NSTA 3RUPA 3ZK7A 2GEBA 3IERA 1IUPA 3RWBA 4B76A 1ZY2A 2NVOA 2J33A 4KHPH 5FBKA 1I0IA 1XTRA 3RYCA 5HRAA 1HNWB 5FUBA 4DRXA 4K3UA 4YHHB 4UCWA 2RGEA 4US1R 4BKMA 4RFVA 3LAWA 5DM2A 2ON6A 2CNWD 4R2JA 3ROGA 4RHFA 2MDTA 1Y3HA 1LC0A 2ZQYA 5D3QA 4ZO9A 3UGJA 2IEZA 1UJBA 1C5KA 2IQIA 1LRJA 1O8CA 1PIWA 3BFVA 2ZE7A 5HOQA 1YJ5A 3HKBA 4MQFA 1J9ZA 4MB2A 1ABBA 1MEEA 3W4IA 1WB5A 1NRIA 1CJCA 3DW3X 4EL5A 4Q3KA 2C5HA 3BGOS 2JFOA 1QZUA 3Q10A 4KQ1A 2JFXA 3VMFA 5HCIA 2CZCA 1BHO1 3DQQA 1X1EA 4KWTA 4OJQA 1HRKA 4MCIA 4RO0A 3Q7IA 5EXEA 4HNSA 4PCVA 2D6FA 4GI1A 3QWUA 2J7PD 1U2SA 3O2JA 5C8XA 5ALZA 4FONA 3BSYA 5CX1B 2YOGA 3IXMA 1L6IA 3O93A 4YHBA 1TUEA 4KR9A 4UW9A 1O03A 2CDNA 3EK2A 4Q34A 1Z13A 1GCUA 4ZIRB 2FSFA 2IYOA 1W76A 3F6CA 3IBFA 1OJ7A 4UEWA 3Q2IA 4L72A 3P0FA 1ID8A 5FOUA 1IZYA 4QAQA 4HAYA 3K16A 4UM7A 4G63A 2PZJA 4D9NA 4EYSA 5IDXA 5K8TA 3ES9A 4Y6GB 4WWHA 2V5VA 1ZU5A 1JQKA 4TTAA 3BZWA 4F0JA 1IU9A 3E8XA 4JC0A 1N2SA 2G6BA 4ND4A 1Z2OX 5F7OA 4LOKA 2IOFK 3KR9A 4QTTB 4LJ6A 3RF7A 2OC4A 2BJHA 3AY3A 4XYEA 1YFJA 4LYJA 5JHHB 2PNFA 2Z30A 3L7JA 1X86B 1M8FA 1ESMA 1WNFA 3RUCA 4RAZA 4EG4A 1SC3A 4CR8A 3TSCA 4EG8A 1S01A 4UQOA 3NGMA 2FZ4A 1NOIA 5D01A 2GF0A 4ZO4A 5A2GA 5L1KA 3H0EA 2QTBA 3OIDA 2R7ZG 4D9FA 5FBZA 4A03A 4R4JA 3H0GA 2WV7A 4M1QA 1FCJA 3L7NA 4AY6A 4KVAA 5DG9A 5KFCA 1SCBA 1TMGE 1OZFA 3DDZX 1VJTA 4ECEA 2W6ID 3ZUGA 4ZJUA 4PZAA 4IJKA 2RKBA 3DEHA 1GYQA 3TCNA 4MVWA 4X3CA 2PPLA 4NV1A 3E4DA 3RYHB 3W8FA 5EC8A 3DZIA 4EMBA 3FDIA 4OO3A 3QPCA 1EQ2A 4NZZA 4HVTA 4Q03A 2X3FA 1PJ3A 4HQNA 3NUAA 1DO8A 4YPVA 4ENTA 4UQLA 1KDPA 1RQLA 3FI0A 3OPMA 3WNDA 4WJKB 5CR5A 1LB1B 4RTOA 1T0BA 1S2NA 5IKPA 4ZXPA 4CF5A 2DM6A 3NEJA 4D96A 4CM9A 1DIAA 2VKTA 1CJVC 1XEAA 1UBUS 4EPYA 2X2PA 1RQ2A 3BMOA 2IXEA 4OD0A 2CFIA 4PHCA 4RB1A 5AOVA 4HCJA 4Q1BA 4EG6A 2YJ4A 1PQWA 4EQ6B 5HF8A 5A05A 1W4CA 3JATB 4M9XA 1SXJE 3I4FA 3OQIB 3N7AA 4E1VA 4Q4HA 4RGVA 2W2MA 3HDYA 2HADA 1MA0A 4DV2H 2J4FA 2NP6A 4IMIB 5DWDA 1RI4A 4DSZA 1ZM3A 2QMUA 3S2UA 2ICAA 4X64B 5F9FA 1A9YA 4PYIA 3DWFA 3BYZA 1EI9A 2D54A 1K7XB 3LKDA 1B0AA 3GIJA 1GPKA 5DNWA 4QNRA 4QW8A 4XYLA 1HLDA 3BRQA 5KNCA 3HOUG 4YJFA 3W5JA 4G24A 4BNDB 4DKXA 4ZAGA 2YKGA 2V0CA 3PEWA 4YAWA 4IJUA 2D0IA 3D43A 3M6UA 1T2CA 5EJGA 5C5EA 3I2GA 2WAAA 3W5SA 1BE1A 1P8JA 4N65A 3W7VA 1XTSA 4IIUA 4ZAFA 3KT0A 3H2JA 5JQGF 3KTMA 2HBZA 1X42A 4EYQA 3N87A 3L93A 2F59A 1DU4A 1ZM2A 1NBMD 3FNGA 2TYSB 4KKXB 2VRCA 4RHTA 3SNKA 3OZ7A 3VX4A 4JLPA 3GLFE 5E3JA 3WNBA 2OBFA 1I2AA 5BSVA 5LP6A 2I66A 1SU6A 1H8EA 1FKAH 4N0DA 5DHSA 4JT8A 5B2FA 1X1RA 1JR4A 1Y6FA 1B42A 3FRHA 4IX9A 2V6FA 1I2KA 1X7HA 2MR6A 3D3QA 3UK6A 2QSUA 2ZKLA 4QYWA 5MFPA 4ZARA 2XXJA 4OUDB 1CFJA 4ZEXA 5KHAA 4GH5A 3DCJA 3AU8A 4MKRA 3DZDA 3ZY6A 1CQPA 2QL6A 1UKVY 3CZ9A 1AN9A 1Q1NA 2H9IA 4PBSA 3S7TA 3RS9A 4G1UC 4UTXA 2R44A 1O94D 1V43A 1UH5A 4DB4A 1AC5A 3K8ZA 1Y7IA 3WR5A 1E59A 3IXQA 4LFAH 2FRXA 4KACA 2C2RA 3D1VA 3F6YA 3UCFA 1Z4LA 1OX4B 4ZU6X 1QRSA 1SR8A 1DEXA 1VBFA 3SU8A 1Z6XA 3L4BA 3UKJA 1JU3A 1J0EA 4U6PA 3TXAA 2W9CB 3P0IA 1L7XA 4ONEA 4EECA 3VO9A 3TL6A 1TM3E 5H9VA 5FUWA 3VU9A 3NHWA 2J7KA 4RTNA 3FDJA 3ZD9A 3VR2D 3H19A 1MH1A 4BNMA 4YMGA 5B37A 1P5ZB 4Q45A 4L7VA 3FMPB 3HGTA 3BD6A 5CEJA 3SS8A 1GFIA 1KVTA 4EKDA 3JS5A 1XK6A 3BFJA 2R93A 5HMMA 5AT1A 4BZQA 5KT7A 5JEEA 1AQUA 1WDMA 1F2DA 1EK2A 2V97A 2P5YA 2ZTUA 5AM1A 1JG2A 1RHUA 4HB4A 4OQEA 1L5ZA 5AVRA 3D4BA 1U3UA 5F35A 4Y6LA 4KLZA 5K7SA 1TA4A 4LZZA 2GNAA 3UWMA 3ZIAD 3ZWWA 1F12A 4WLUA 1GCOA 4L08A 1Q6ZA 5K6RA 3WB9A 1LH0A 1Z8HA 2GASA 5IPFA 1U2QA 1RXEA 2TMKA 3RHTA 1DOHA 4WCVA 3QA3E 4MI1A 2ISCA 2NTNA 2P4QA 1WUIS 1RI3A 4WPGA 2XD4A 1JEEA 3BJRA 1XCMA 2WU1A 1C30A 3WDLA 3T1VA 3D0KA 4WZBB 4G37A 3GDOA 2BT4A 3GNLA 4UHKA 1QP8A 4ARCA 1GZ5A 1RSZA 4MPTA 2NNLD 2QZ9A 2P0YA 5U1PA 3GLFA 3T99A 4QT0A 3JQAA 4WHXA 2P77A 5LDGA 4Z3OA 3TLEA 4BFTA 4HGOA 4M0CA 2HSWA 3OCWA 2UAGA 2PH3A 4BOYA 3ENQA 4UTZA 1V11B 3VDQA 4PLWA 4PGGA 4UPVA 4R8LA 1VSVA 1LC3A 4K05A 3MR3A 4UAVA 5HWSA 1E92A 5AM3A 1GHTA 3STXA 2CLMB 2E5FA 2QLFA 2ROQA 4KRXA 4D6YA 4CL0A 3G1UA 3RVPA 3ESCA 3OE7A 1CUAA 1P6XA 2ASLA 3H6HA 3QJYA 2ZSDA 1PWHA 5GY7A 1PS9A 1P19A 1SK9A 3T8YA 3HDHA 3KB6A 5BN5B 4HS4A 1Z4OA 4Z99A 3U49A 1E99A 3DZKA 1KAOA 2Q0XA 3OF5A 3NW9A 3Q6NA 1W36D 1PZGA 3QLUA 2O5VA 2XJ4A 2EQAA 1E3WB 4KQHA 5K0LA 4O29A 4FQ7A 3BJMA 3PC3A 2Z2YA 2R0QC 3LRPA 3ZWYA 3EEFA 4R2HA 3W1EA 3Q7QA 1LSUA 2ZSBA 5E1MA 2F3QA 3UTDA 5IT9W 3OKCA 1YI1A 4GS5A 2C04A 1OE0A 3MYRA 3B51X 1GAJA 5U4XA 1S8AA 3C4QA 3QVVA 6REQB 4KDCA 3N07A 3ADBA 1DBVO 2KYRA 1W47A 4ZC1A 4B45A 5IDYA 2EX4A 4DV4B 1KI8A 4JXJA 3MJEA 2D5CA 1JIIA 3AP3A 1DEHA 2UXDH 4FFPA 1I1NA 16PKA 1UBFA 5JJ5A 3GI1A 3RGGA 2O23A 2ODWA 3VQTA 2EW2A 2IPNA 1D2GA 1COZA 1FXWF 3CC8A 2HPVA 4D45A 2LR0A 1N5IA 1H5NA 4RUAA 2BRUC 1CEXA 2WFMA 3EXEB 1LZKA 1OXUA 5GAJA 1I2LA 4IBOA 5JD3A 1U9CA 2BDUA 1M7GA 5LDDC 3BB3A 3BXPA 3CNEA 3FMAA 3NM4A 4E32A 5JMTA 1DG3A 3D7RA 4NJMA 1PCXA 1K63A 5ALSA 1SEIA 1SHKA 1LBTA 4YJ3B 2HLHA 4RH0A 5E6RB 1G41A 2B0CA 4IX1A 4IOMA 1BAPA 3OU6A 2P6NA 8ADHA 3EMDA 3ZIDA 3EZNA 4WN9B 1QFYA 4IIJB 4K6KA 2UZIR 5JYBA 1ES9A 1DKNA 3KYDA 4MB0A 4X00A 3CKMA 1JA9A 5DOZA 2Q9BA 3QOFA 1UIMA 4RVFA 2BGUA 3GRPA 2GK7A 1BVRA 5LDHA 3RIZA 1V6CA 5EQFA 2JDIA 1NW9B 3WISA 4NZPA 3LUAA 5A62A 2AX4A 3PQFA 1XVTA 4PX9A 5LKRA 1VL8A 1UDXA 4JWKA 1ZBQA 3U56A 1OI4A 1Z8DA 3AOGA 2DQSA 4EPWA 3VOSA 2RKOA 3LNCA 4DNXA 3J80A 4JJAA 1W5EA 3NHZA 3VR6A 4O7LA 4JI2B 3E3LA 3ZVNA 2WWVD 4I6JA 2ZQ5A 2Q3HA 2QZSA 4M9SA 3MAJA 1RJFA 4WNIA 5BR8H 4R2WA 2VJDA 4U0KA 2HF2A 5E7JA 3MQFA 3HJUA 3H83A 2J6BA 2HSZA 3VR6H 2P9EA 5CB4A 3P71T 3C48A 4LWQA 1FRNA 4P7GA 4DOMA 5BN1A 4Z51A 2FMAA 3DE2X 1LDBA 1DX4A 2E4UA 3VH2A 3WK8A 3UBTA 3RSZA 5H80A 1ML4A 4PW0A 1B8VA 1JT2A 3UNXA 4FCCA 5BWVA 3F9RA 4XKJA 5K01A 2ZRQA 3CBQA 4LUCA 4QM6A 2DE0X 5KZMB 3ED1A 4IZOA 4PNPA 4C4SA 2QBYA 2GZSA 4MGZR 4UDNA 2Z56A 2WWHA 1W96A 1HKUA 3BSFA 3VR0A 1EDDA 3SYRA 3GA7A 4TVBA 1W1IA 1L7PA 4XPIA 1M2OA 2JBHA 3EYWA 1FQWA 1DO2A 1ISRA 2GRJA 4MLPA 4DY6A 1UXGA 4KQJA 4Y9UA 3VYVA 3AI2A 2BTEA 2OFPA 1WH2A 2O7NA 4U3JB 2BV3A 4XGQA 3D4OA 4E6NA 5DX0A 4V1CI 1EX7A 2VDRB 4WBNA 4NNPA 1UDAA 1MGPA 3LOPA 5BSWA 5LQCA 1T25A 1T10A 2YZKA 3I32A 1HETA 3H2YA 3ANMA 1V16B 1KQNA 3QKSB 4EWLA 5BY2A 2I7CA 1K06A 3FTPA 2JJ2D 2A5FA 3OX2A 2FRDC 1XI2A 4DUYH 4UUBA 4WL0A 4C4PA 3OQBA 2VZ0A 2XWBF 2GNOA 3T1QA 3VISA 4L76A 4RIEA 2F00A 4EFLA 4HWRA 3I64A 4PFSA 4DIEA 1ZCAA 1V7ZA 5L51A 1YZGA 4IRDA 1PZHA 3DMRA 2B1RA 1BXRA 1YZLA 1TTTA 4MGIR 1BRMA 1ZI9A 4UBOA 1U0HC 6ADHA 5DN6A 2CUNA 3VAZA 4V39A 3STHA 5JH7F 2Z2XA 5FPTA 3K7EA 2WUGA 1OJLA 3ZHXA 1WCWA 3VKFA 1L1QA 2NYVA 3BIXA 1P5RA 4RA9B 1K1SA 2WSSA 1U4NA 2X0RA 3C3AA 1XPOA 2BGNA 4GPEA 4HDAA 3C2QA 3MSCA 4M0LA 3L49A 3G0IA 4ED7A 2YZ7A 2OECA 1A0GA 3K20A 3GIQA 1RWWA 2VKQA 2JLVA 5KWIA 1VG9B 5DQGA 5IABA 3GHYA 4BZXA 4FMBB 3ZE7A 3IT1A 1V0JA 1O58A 4DV1B 3FTFA 1HDCA 3MJFA 5ADWA 2O1SA 3EGCA 3S2FA 3UWDA 2BY4A 1QGYA 1E1KA 3AP2A 4ON9A 3UC9A 4KPEC 3JYQA 1G63A 1JDPA 2Z3VA 3STWA 3OC0A 4YCAA 5AJVB 1NTOA 2Q5EA 4CKYA 4G89A 3NGXA 4UULA 1M5RA 3HV0A 1W52X 1XCJA 2XTMA 4YO7A 1SPBS 1HBJA 1SU4A 3UO8B 3TFQA 3GZNB 1OYYA 4LZOA 3UOGA 2C4UA 1GRQA 4WY2A 4U2FA 3N05A 2NZVG 3KOXA 4NVRA 4IPTA 3PC8A 1N2IA 3M4IA 1NMZA 4ZJYA 3UMGA 4RHCA 3PKJA 4FMDB 1MAWA 5D3KA 1IY9A 3GCGA 4UUMA 3NDIA 1TL7C 1GQRA 3DJYA 1DAAA 4EVQA 4R2XA 4A0RA 4YJ2B 5I9MA 3TX6A 3IQGX 1G3RA 4FYXA 2HA2A 2JEIA 4D57A 3KDPA 4RY8A 2C7VA 3NNDA 2E6UX 5HQ3A 3FOEC 1I94B 4RESA 5K3FB 4RD1A 1NN1A 3VU1A 3I0ZA 1BH6A 1Z17A 1P5FA 3SYTA 4CMBA 1I7NA 3E3NA 3K6SB 4YTEA 4O2AA 2EIYA 1DIOB 3LX5A 5L7WA 3OCJA 5JUWA 2RJNA 3D8UA 3WMGA 4B0OA 3ZY3A 1MO4A 1E4EA 2SECE 4KXNA 5G3YA 4UNNA 4J9KA 1KH1A 3W2GA 5LB4A 3R7AA 4IJ6A 4URZR 1QRUA 4RTMA 1F2TA 4FTWA 2GEFA 3CR7A 5IKEA 4RL6A 1TIBA 1UWCA 1JDJA 1JAHA 4YDHB 5KG2A 3U4HA 1YJQA 4RSGA 4PPNA 3UKDA 3F7MA 4FEYA 4Q4AB 3LQFA 2Z3ZA 1R2QA 3GQBB 2Q9CA 1GL3A 1SCJA 3QX8A 4MA0A 3GPIA 1R18A 5JPCA 3DA8A 4INAA 4NIMA 4RBNA 1SD2A 2CBXA 2HMTA 1RJQA 3CX7A 4MHSA 1TCCA 4OA8A 1D2MA 2AU0A 3VKUA 4W82A 4BNVA 2GXAA 4YRBA 4DLAA 1Y4AE 3KQWA 3FH0A 2O20A 2WSLA 4PZDA 3JALA 3MR6A 4EFDA 4GYYA 4PO8A 1CRLA 4PGMA 1O6ZA 4HWPA 2B1GA 2FFAA 1R0SA 3IVAA 1LVGA 2AMJA 2NUBA 4HYEA 1SQ6A 4ID9A 1Q50A 2O0JA 4HDMB 4JI1B 1UP4A 4WDQA 2NAPA 3QH4A 2V98A 4O8CA 3DBHB 1WQ1R 1YE5A 3FMGA 2P3QA 4R6XA 2RHHA 4JAVC 3LO5A 4RSHA 4Y2YA 2WHEA 3VTZA 1SWVA 2P90A 4EG7A 2O59A 4TLBA 5C1OA 4AN0A 3NGDA 4WCFC 4PQRA 2L17A 1CP3A 1PGJA 4DVGA 4EI2A 1JR6A 4QVGA 1XWFA 2XGPA 2P78A 2PKRA 4P0TA 4ZQBA 1V4YA 3DPIA 2EJWA 3BFPA 3L79A 2W71A 1J24A 4FMCB 5I5UA 3T41A 4GAEA 3GX1A 5CFPA 2G9RA 3I42A 2V6BA 1CUCA 3IP9A 3U7GA 2PJZA 4POAA 2VHQA 1SNYA 2BFNA 5EESA 4M8IA 2X8BA 1I1OA 1WUYA 2V4MA 4QL3A 2FW9A 3KUCA 3EXG1 5M34A 2VHWA 3WYGA 3EGDA 2Q5QA 1T0PA 3E3OA 5E2AA 5H70A 1TIPA 1QCYA 2ZT7A 4PYRA 1OFUX 3F96A 1SUWA 2PS3A 3JSAA 4DCMA 3HZOA 1OBOA 2DKFA 1Z5NA 3DV0B 4LDAA 3B9PA 1NGSA 2W90A 4BFUA 4RH3A 3PJDA 3IHKA 5DHQA 2X0EA 3KYCA 4CKEA 2QAIA 3PYLA 3MM4A 3RAGA 5FOWA 3OEHA 2PWAA 4PU0A 3I01A 4NXMH 2YWHA 2DOKA 1GPAA 3A3OA 2Q3FA 3EJWA 1K92A 2X41A 4XX1A 4R83A 4C7JA 1GXSB 2WFLA 1QIIA 1ARZA 1W94A 3IMEA 2ILVA 4D9MA 3HHPA 1Y7PA 4LZWA 3ZWOA 3ZQKA 2XUHA 3IIEA 3PNSA 2CQYA 2EGUA 3LYHA 3G2MA 2QHXA 3I58A 1G8PA 1DCKA 4R0VA 3SQWA 4Q9AA 2XGQA 3RJ9A 3TLZA 1N7IA 1I24A 1SAYA 1XHEA 4XRRA 3TEFA 1NTRA 3REQA 3NHMA 3QQPA 5THQA 3MNFA 1RW4A 5BYAA 4MI3A 2QJTA 2IODA 1QYCA 3CRNA 2I99A 3EDQA 2WJGA 2QJRA 1OZGA 2I2WA 4EY8A 2A4KA 2BYTA 1QH0A 2FCAA 4TMZA 1H3NA 4YY3H 2YJ3A 3A05A 3EUEA 2BDTA 1RQRA 3OZCA 5B64A 1J0BA 2L2QA 4G0YA 4GMFA 1UAAA 4LJKA 1JWLA 4DV6H 3F6PA 1N4AA 4D4GA 5LCXA 2J3LA 4DR4B 4QREA 5EMHA 3ZCVA 2IV3A 5CLIA 1OREA 2GK3A 5AYVA 3T3NA 1SULA 2R92A 2ZRPA 4ZMRA 5IZCC 3BL5A 3MELA 4LHZA 3NTOA 4KGZA 3BDIA 2Q7DA 2C03A 4H7KA 4PHGA 5DM70 3UAYA 4BAGA 1OZ0A 4C22A 2GA9A 1NQTA 1DX9A 1X0XA 5JS8A 2I6TA 3L8ZA 2C7RA 1PU2A 4XIYA 3TLBA 4YAEA 1NP7A 2QXYA 1UOOA 4L78A 1WMBA 2YWEA 1R3UA 1FVHA 3FRJA 4RKYA 2F1IA 3OX3A 4JV2A 4HLUC 3P20A 4XPZA 2EP8A 2F1HA 5FL7A 5AVXA 1OTHA 5CDTA 3C3DA 2VP4A 2WLTA 1C7JA 1TD1A 1T5HX 3DBOB 1MFPA 3QVSA 4OQQA 4X20A 4Z49A 2EZUA 1GR0A 2CXSA 1Y9DA 1M34B 4AY2A 1G55A 1MABA 3CH6A 2R00A 1H0HA 4CM8A 1V3UA 4RWZA 4BZZA 2HCFA 2IPAB 3ZN2A 4OJKA 1A72A 4GKBA 2HPHA 2O5RA 5ADUS 4LE0A 2FPOA 4IGAA 2G08A 3C8HA 4J2OA 4MP8A 3HO6A 4GKAA 1WOYA 3DKVA 3MS4A 4JUAA 3H42B 3LFHA 4JUDX 5DASA 4E03A 3IGFA 2HHCA 4A0QA 2Y9PB 1U5AA 1B04A 2Q5FA 4NENA 1FNMA 2JJ8A 4U5QA 3K0EA 4BLQA 2XI4A 3N41B 1VMKA 3RH0A 2JIZA 3QJGA 1AN0A 3A2LA 4IOKA 2FDCA 5I45A 4BV8A 1LPPA 1C3VA 3WGQA 3FPHA 2F43B 3EN0A 1KMIY 1V9LA 3UUWA 4TTSA 4RVOA 1C9NA 2LGJA 1SBHA 4ND6A 1RI5A 2N1MA 2YWBA 5PGMA 1TW3A 3WL5A 3RVNA 5ALMA 1YRWA 5C3MA 4TTIA 3U0BA 2H8KA 2VDMB 4JBWA 2WSMA 4L5JA 4MW1A 4LXXA 1DPFA 1F7VA 4EGAA 3KWFA 4JYMA 3JAWA 1CVLA 3EX7C 1O97C 5ALEA 3GEDA 1GYRA 2BEUB 1NI5A 2WB4A 1DRVA 1KIFA 2F8SA 4V0LA 3NZEA 2V4QA 4P84A 3TTVA 1WMEA 5B6PA 4UTVA 2Q0QA 1HR0H 2JA5A 2V3VA 4NZ9A 4CKXA 3HMKA 5I9BA 1WXFA 2HW8A 4DLNA 4UE6A 4GI2A 2ZUBA 4GWGA 3N76A 1IZZA 4KWEA 5HIKA 3WYAA 3HNRA 1DUIA 3VO8A 5BV1A 2WAMA 4EHFA 1JSXA 3CKKA 2OK7A 1P1FA 3AY6A 1XJQA 4JFRA 4WOCA 5ITSA 3OO1A 1U7UA 2SNIE 2BUCA 3ZGNA 3K9GA 2VPQA 4YRKA 1GPYA 3IVXA 3GP3A 5LIPA 5KJ1A 1IVYA 1ORRA 1EJ0A 4DXDA 2X14A 3CRZA 3KK0A 4TKUA 1N6IA 4OHCA 1F5SA 2XZOA 4QRHA 3IOCA 1DHRA 4CMEA 4RIFA 5EHGA 1DDOA 2ZBFA 3RK4A 3DMNA 5ALPA 1VPDA 4DT1A 1X8LA 4XR4A 3IESA 3NORA 5D1PA 3M6WA 4B6OA 2BQRA 1VKOA 2AJ8A 2P0EA 2YUTA 4N48A 3BXOA 2R8YA 4E09A 1Q83A 3FWHA 4OMDA 6GPBA 3PA6A 2DUMA 2DFLA 3OLZA 2A9QA 3HB5X 4CFZA 4RZQA 5AXAA 1BZYA 3LNTA 3GPCA 2QVXX 5AK4A 1HLFA 5T4EA 3MD9A 1LSOA 4O7YA 1Z39A 4ECUA 3I9LA 1QG4A 1RKUA 2FPLA 2E87A 3DEAA 3LD9A 3TUIC 1MB0A 2H59A 1WCYA 3EARA 3WIVA 2ZZMA 4FOPA 3STVA 2J08A 1YSCA 1VECA 2FMXA 1QAOA 4RK7A 1ODLA 3QYPA 4HDNB 1G2WA 1A9RA 1U0RA 2NSYA 2PKXA 2CGEA 3KEGA 1DARA 4W1RA 4ALJA 3OEED 2QQEA 3SX4A 3MWKA 2PSHA 2ZIZA 5G1OA 4ALKA 2JAWA 1VP9A 1VZ2A 4G07A 5TNXA 1UBOS 1RMYA 2XYRA 5HHTA 1T0IA 4JP2A 2C7PA 3C5WP 3AI1A 3C8UA 4TXLA 3WGJA 2AFRA 1UK7A 1VGRA 2QTVB 2ZUDA 4BO5A 2XCIA 1U02A 1ZPDA 4YB8A 3AR4A 4AIRA 2R2GA 5TY0A 4HYKA 3HKZE 3K5PA 2Z1DA 1XCLA 2FPPA 1A5SB 3HU1A 3C3MA 3CJQA 1JRLA 3K2QA 3IEMA 3M2PA 3ITNA 2IXAA 4LNHA 3U4CA 3KP1A 4GLLA 2ZE5A 3ELYA 4CC6A 1G8GA 4ZRNA 1JHVA 4BGUA 4IEEA 3CSWA 3LUKA 5KYXB 2BP7B 1E2QA 2NV0A 3E7XA 3LYLA 1OOEA 1TK9A 1J1IA 5EL0A 1JMYA 3NTXA 3JXEA 4E6EA 1NN0A 5LUAA 3PW0A 1KQOA 4LZPA 2AGPA 1CFZA 3SSMA 4KO1S 4V38A 3LW7A 2RONA 3EGXB 3AVYA 2EBUA 1UFVA 3P2IA 4OBWA 1RWPA 2HU2A 3AHEA 2WIFA 2F4VB 4MLCA 4YRIA 3PUIA 2AVNA 3PJRA 4B3CA 3U3OA 3VVBA 1ADBA 3C41J 3FF4A 1QFZA 5FAXA 3KLOA 1QVRA 3PLNA 3TFOA 5JROA 1T5TA 2FEMA 2R6JA 3QYAA 3BA6A 2HKIA 3QV1A 5CYGA 4UZFA 5J4VA 1LBSA 2ZI7A 1TAHA 5LYJA 3HADA 4QE3A 4HTAA 4HN4B 5JS6A 3CVJA 1GA1A 3L7YA 5FTNA 1TWCA 3T5AA 2B94A 3L3BA 1XDWA 4MAFA 3ESDA 1IBRA 4QGAA 4X61A 3AR9A 1VLMA 2FUG1 4FE2A 1FXSA 1TUBB 3UYKA 5IP5A 3PU6A 3L7CA 1IN7A 1XNQB 1TLLA 5ADVA 2AWNA 3IDFA 1ND5A 3E48A 2L69A 4OHKA 2AK3A 2PNJA 1G3MA 1AZSC 4CT0A 4F56A 3MVEA 2LTAA 1UQRA 3FFTA 2JRLA 4I6GA 3E70C 3EY9A 1U28C 3X2EA 4I2NA 2GXQA 1FYFA 5EUBA 5FNVA 4DMGA 4K9RA 2WTNA 2P2NA 1W4BA 1HE4A 2FWPA 5P21A 4KG7A 4MYTA 2UZ1A 4C4AA 3SHOA 4Q47A 3PFWO 5KYUB 4N3BA 4B46A 4LV5B 4R8RA 4LQCA 1A88A 4X6UA 5K5EA 4IKOA 2I7DA 5DGCA 2QUJA 4C05A 2BOVA 1VFPA 3G23A 5FADA 3KOMA 3ZLBA 3PHHA 1NA5A 4BO1A 2VDOB 4GYWA 1UFOA 3INYA 4A6DA 2XA1A 2HQBA 2OP1A 4P0PB 2VHZA 4LZJA 2R6FA 2FEKA 5DNEA 2UZ0A 4AO8A 4CV0A 3PQCA 2NG1A 3FHJA 2Q4BA 5KFHA 1J20A 5AJUA 1G66A 5A9SA 4HX2A 3G2PA 1WQ3A 2DPIA 3OP4A 3GDEA 4X3PA 1HE2A 4K40A 2MWMA 4BP9A 4OAOA 2EX1A 1LLDA 1SXGA 3WLSA 2BL4A 2ECQA 3C3KA 3NP9A 5MN4A 3L5KA 1FP7A 3EQ2A 4IHJA 5FX2A 1Q7TA 1NN5A 3V1TC 3HKZA 4NE7A 3T38A 3DLIA 2UVUA 4W8HA 2WA1A 1N36H 4TMVA 1XA4A 2QAGB 3L4EA 4DV3B 4DCUA 3HYTA 5E8RA 4KODA 1NXTA 2BFFA 5KFQA 1EWVA 1YTUA 1M1XB 1KRXA 3E9DA 1HOTA 1D2RA 3ONNA 4YRFA 5B1IA 5C44G 1D2NA 4HL6A 3LM8A 1OW3B 2R79A 4Q1FA 2Z6UA 2HIMA 1JHAA 3QI7A 3WFZA 1XVAA 4BFVA 3VJRA 3NCHA 1J9EA 3M9XA 2VLIA 4WKBA 1DINA 2F8LA 2ESRA 4KN6A 2X5OA 3RROA 2VRWA 2DETA 3IPAA 2UYCA 4Q24A 3AV3A 3I23A 1E79A 5FJIA 2UZAA 3KEFA 3P9IA 2HA0A 4DGSA 2BLNA 1R6AA 5CFRA 1SD5A 2PD4A 4YRCA <