3MJFA

Phosphoribosylamine-glycine ligase from yersinia pestis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
429
structure length
429
Chain Sequence
AMNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of phosphoribosylamine-glycine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords Phosphoribosylamine--glycine ligase
total genus 128
structure length 429
sequence length 429
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mjfA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mjfA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjfA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 3mjfA04
2R84A 3BFPA 4GGMX 2NU8B 4O7YA 1JKJB 3R5FA 3BSSA 5KKNB 1GSAA 5LOVF 5LYJF 2VR1A 2J9GA 2NUAB 5HV6A 2CNVA 3Q2OA 3K5IA 4FFNA 1ULZA 2YZNA 5FNVF 4FFPA 2V59A 3AX6A 5BMVF 1EUDB 2I8CA 5K2MA 4HNVA 2NU6B 2V58A 3ORRA 1JLLB 1E4EB 2ZDHA 3VOTA 2R6FA 3VPDA 5BPFA 4C5AA 4XZ3B 2YS6A 1M0WA 4O7ZA 4EGJA 4FGRA 4O4JF 1A48A 3BSWA 4TV8F 1WR2A 4MAMA 2Z02A 4XX0B 3G8DA 3N8DA 1AUVA 2XCLA 4ZHQF 4EG0A 2FPPB 5CA1F 3ORQA 1VKZA 4XYMB 4TV9F 4O7LA 3HB9A 4I55F 4IWXA 4IHJF 4QSHA 2CQYA 1GGOA 1KJ9A 4ZQIA 4MV3A 3UFXB 2ZDQA 1C30A 2R82A 2QF7A 2I80A 2GLTA 1M0TA 3K5HA 4MV4A 4O4LF 4IIJF 3R23A 1I7LA 2DZDA 4DIMA 1OBGA 3R9RA 3G8CA 1PK8A 4MV8A 5H80A 1M6VA 2W6OA 5DMXA 3KAKA 4ZI7F 2SCUB 4EABA 4L1KA 3LP8A 3U9SA 3TIGA 4M98A 2YL2A 2CNQA 3DF7A 2YZGA 4MV6A 2DLNA 4M9UA 4YJ2F 3RFCA 1KUTA 1KJ8A 5KX5F 4MA0A 4FE2A 2HGSA 2FP4B 1DIKA 4O84A 5C1PA 1SCUB 4DLKA 2NU7B 3KALA 5JH7F 3U54A 3TIIA 2YZMA 3KAJA 2DIKA 2VPQA 4EAAA 3VMMA 2YRXA 3RV3A 2PVPA 4HNUA 3GLKA 1GLVA 1BXRA 4YAKB 5JQGF 4O7SA 4WBNF 1B6SA 2YWVA 4MV9A 1KJIA 4YB8B 3MJFA 2W70A 3JZIA 2GQSA 4FU0A 4IZOA 1IOWA 4O7WA 3TW6A 3V4SA 3U55A 2C00A 1CQJB 5C1OA 1EYZA 5BPHA 2P0AA 3RV4A 2R7NA 1CE8A 3GIDA 3JZFA 1C3OA 2GPSA 4EA8A 3JRXA 2W71A 3TQTA 4O86A 3WO1A 3QFFA 1UC8A 4O82A 5JVLA 4I4TF 3VA7A 3TINA 3HO8A 1VBHA 1Z2NX 1KJQA 2NU9B 1Z2OX 4M99A 5EZYF 3KREA 4C5CA 3RUPA 4M9CA 2IP4A 4O7RA 4EA9A 2FB9A 3SE7A 3R5XA 2OLSA 3E5NA 3BSYA 2CZGA 2DWCA 4NYEA 2W6NA 4O7VA 4E4TA 2R85A 4O81A 2YS7A 1DV1A 3NUAA 3OUUA 2R7MA 4FFMA 1CS0A 1EZ1A 1AUXA 4YAJB 5CA0F 2FPGB 3LWBA 1IOVA 2GQRA 4XYLB 1E4EA 2FPIB 3U9TA 4C5BA 5GONF 2W6ZA 2V5AA 4FFOA 4O83A 4O4IF 1T36A 4HQ6A 5I47A 3WNZA 5LA6F 5LP6F 5D8DA 1KEEA 1W96A 2I87A 3K3PA 3MWDA 2GPWA 5HBRB 4EGQA 3WO0A 2R86A 1GSHA 1KJJA 2Z04A 1DV2A 1PX2A 3MWEA 5C8YF 5CAEB 4YBZB 2R7KA 1EHIA 4Y8VB 2R87A 3R5HA 4WD3A 2YW2A 2PN1A 1W93A 4FFLA 5JVDF 1EUCB 2W6PA 3HBLA 4O4HF 1JDBB 3VPBA 4J6EA 3V4ZA 2HJWA 4ZOLF 2W6MA 3VPCA 1BNCA 3AW8A 4O2BF 5JQWA 2PBZA 4ME6A 1B6RA 3JRWA 4RZQA 4MV1A 4O7NA 3BG5A 5LXTF 2XD4A 3Q1KA 2QK4A 2VQDA 4O7TA 2ZDGA 1I7NA 3N6RA 5CB4F 1KC7A 4I50F 4MV7A 4TUYF 5J2UF 1VBGA 3ETJA 2NPOA 2VHEA 3OUZA 4YJ3F 2YRWA 4FFRA 5J2TF 2W6QA 4MA5A 2WYOA 3I12A 1GSOA 4IWYA 1KBLA 2CNUA 1JDEA 1OBDA 4HNTA 1UC9A 2YZLA 1Z2PX 1CQIB 2YYAA 4EA7A 5IYZF 3ETHA 4O2AF 2R7LA 4HR7A 2X0SA 1A9XA
chains in the Genus database with same CATH superfamily
1Y8RA 5KCZA 2DU8A 1JE0A 3H8WA 4K0KH 3A3NA 1DBQA 1FP7A 2C4KA 2W00A 3T7CA 3L6BA 4YUZA 1B26A 2JIZA 4RNDB 4A2WA 1EGQA 1V8PA 1V8DA 2VG8A 2WOOA 1ONSA 2OVFA 5DSZA 1W4AA 2Z56A 3T54A 3LPDA 1E3WB 3KELA 4R7ZA 4LX0A 4S0XA 1S2NA 5LQMA 5KYWA 3B1FA 3BXXA 5FORA 1OY1A 2BI4A 2WFLA 3VR5A 2NGRA 4OM7A 2BCEA 5AJTA 4DMKA 1PDVA 3FSRA 2ARKA 4D6PA 2VP0A 4R2XA 5BSTA 3SX0A 3PR4A 1P9NA 2QBYB 2QSUA 3UJPA 2TECE 3CZCA 5HV6A 2DFTA 4W1PA 1N2JA 3FZQA 2H5IA 1KP3A 1L8XA 4YDHB 3B3AA 3QLVA 3BE5A 1XO1A 3KLNA 2DQ4A 3AVUA 2WM3A 2WSLA 4ED7A 3IJEB 3OKFA 4FFPA 1ZYUA 2V7UA 4TV8B 3QSGA 3PQ4A 5AVQA 2HD4A 3ANLA 3O8DA 4FNAA 1L6RA 1PTJC 1T0HB 1K5GA 3FVRA 2NSHA 5EJ6A 1DBSA 1FDTA 1Z2AA 4B76A 3GH3A 1OXUA 5JCXA 1EKPA 4QOHA 2RAPA 3Q5EA 5DCLA 2XUZA 5L1KA 1X7XB 5DI3B 5TMPA 4XCXA 3ZQKA 4DCUA 1Q3KA 2O8EB 1W25A 3V4VB 1P8JA 2NU6B 2NO6A 2QRUA 3G0CA 4BNTA 1L1RA 4TT3D 1LF0A 4RGBA 4EHIA 5KOHB 4RVUA 4S1WA 1LW7A 4C0KA 5IJ9A 3GTPA 3RUFA 2AC4A 4UHCA 1EFLA 2BGUA 2CJYA 5GQSA 5E4JA 1U11A 4BNNA 1ULBA 4J1QA 4PPGA 4WNAB 4GPTA 4CYMA 1E2BA 2RGBA 1NQWA 2YS6A 3TLGB 1VYVA 1CKMA 1HFWA 1P4SA 2ID9A 2WM9B 3RVPA 3VO9A 2YNMC 1J0XO 4HMOA 4UE2A 2QD2A 5JO0A 4DUGA 1SUCA 2QENA 3DSRA 5BSEA 3H5TA 4Q4HB 2ANCA 3ZCXA 1SR8A 3KFVA 1IY0A 2DUWA 2HA6A 2XMPA 3EVNA 4DLLA 2HHAA 5AQ1A 1Y8QB 1W5BA 5E7MA 3KKQA 1XQ1A 4UTZA 5I7HA 4Y3UA 5DH9A 2GR9A 5EFOA 4WHMA 2V74B 4ZCIA 2GCIA 2J0EA 1FNDA 1G63A 3KQOA 2YOFA 1NVKA 1YULA 4Q9AA 5DI9A 2VCYA 1V5GA 3EIXA 3PGXA 4PZLA 5HE9A 3DKKA 4A0FA 1UBKS 4EUHA 3DV9A 1Y9EA 1DC8A 1G291 5BSWA 1D2GA 1QX3A 4AL4A 1ZA1A 3FIJA 2KE5A 4DBLE 5E9JA 1NMXA 1P17A 1XA4A 5JLJA 2XOKA 1C8BA 3O9ZA 1MR3F 3F1KA 1Z34A 2HYIC 4GPAA 2CHQA 5BUQA 2YFKA 2LBPA 5E4YA 5FYQA 3E58A 4NXNB 3DPIA 3PHJA 3TZLA 1KJNA 3NBUA 4RPLA 1TB4A 3OO1A 3GZJA 2GLTA 4JZYA 1J22A 1SC4A 4RK6A 4ALKA 4DSZA 3USZA 3EPHA 3LL4A 2I6FA 3HVJA 1SUBA 3HOUG 3AVQA 2F3SA 5J23A 4U2DA 2XIQA 2XCIA 3LZDA 2NP7A 4EUFA 1SBQA 2QLMA 3HYNA 3KYCA 1XVUA 3KE8A 2OOKA 4HB4A 4V0NA 4YP1A 4YJ2B 2IUUA 1QBKC 1XJQA 3PC2A 4YV7A 2EZUA 4GVXA 1I4DD 2HUPA 1YVUA 2QL5A 1PSDA 2I2DA 1TKAA 2DQKA 2IDKA 3D3KA 3PFCA 4KQ2A 2VJMB 3AEQA 2W6OA 4EY5A 2V9CA 1SMKA 1IJFA 4JVMA 5ESDA 1B3BA 1HDEA 2D7JA 2HMAA 3AR6A 1SCJA 3GA5A 4FFBA 4FYXA 3BF8A 4US0R 5ALKA 1Z8NA 3AL0C 4JXUA 1ZQ7A 3GLIA 3WWOA 4ZI7F 5C8YB 3NEYA 3QUAA 1HI9A 2ZUEA 1N0VC 2GXQA 5TS3A 4TS4A 4HATA 2K5UA 3LPNA 3MSCA 4BKUA 3O8QB 3V3KA 1GFWA 1SC6A 2GRJA 2HV9A 1SHLA 3KIPA 3OY2A 2GFIA 2A9QA 4PZYA 5CR9A 2AJCA 6ABPA 2XVYA 1NUPA 3RODA 4OL0A 3V2IA 3P9CA 2YL2A 4R1SA 1RXEA 2JLWA 2YZGA 4AY5A 3HVIA 3TZQA 3HKZE 1YL5A 1PLJA 3MLAA 4F4HA 5KVVA 1N6LA 1OI7A 1X7WB 3B13B 1K83A 4UNQA 4WVLA 1P1FA 5FWXA 1XEAA 2JFVA 2XE4A 2YBDA 4IR1A 3E03A 3M7IA 2E21A 3JAWB 4N47A 1Q7EA 5IK2D 5MN5A 3OQ6A 1KZHA 1FA9A 3PT5A 5SV2A 3WLLA 1I1MA 3TBKA 4GPBA 4GL2A 1CJTC 1RVV1 4FE2A 1ICEA 3GDEA 1LNZA 3DEHA 5FRDA 4BVBA 2GN1A 2QNRA 1ZHOA 1KIFA 2XCTB 4BYMA 3HRKA 3PSHA 3WHLA 1UDWA 2CVZA 2P4EA 4AZ0A 4O84A 2H59A 1SCUB 1AX9A 1MG0A 3R44A 4URXR 4MPTA 3MWMA 1XZMA 3BZWA 1X92A 4MGIR 1FCJA 2BHSA 1T9DA 4Q4AA 5DISB 4BJ3A 4BC0A 1IUNA 3TIIA 1SXGA 1DJOA 1E62A 2PWBA 2PZAA 4QKQA 4MQFA 4B79A 5KYKA 2Q6IA 1E2IA 2F4VH 2V8OA 4PN3A 2E5LH 4UFZA 1JKFA 3AUJB 4LOHA 4PM4A 2ACKA 1L7BA 4GLWA 1T2AA 1JEDA 2AEMA 2FE1A 1WXGA 2XY4A 4HQKA 2WSSD 4RV9A 2TSYB 3UJ9A 4ZK6A 4CODB 5KTSA 2WV9A 5I8PA 1SHTX 4WUTA 3VU3A 2G7MC 1E2DA 2VUIB 3SN6A 5B53A 7GPBA 3UA3A 4KQ6A 4QQRA 4YRIA 5J4LA 3CSDA 3FHLA 4IRKA 3PF9A 4D0NA 1EWRA 3H2KA 2DUJA 5H82A 3AL2A 2V6BA 2NUTA 2JA2A 2R1VB 1V25A 3COVA 4GVPA 9LDTA 1RAAA 2GN4A 2CMDA 2IGTA 1ORWA 4TMVA 2LCQA 3WWCA 4WESA 1BVRA 1W4LA 4PAOA 4DUYH 3CKKA 4NE7A 5JZVA 4ENWA 3T7AA 5JXGA 3CF0A 2WTNA 2EOAA 5L7TA 2E55A 3AZPA 4QRHA 1ZCFA 4W7IA 2BH9A 1WOMA 4LSGA 2IEDA 4ZDJA 3AONB 4U8GA 4FXOA 3VDQA 4P7KA 1Y9ZA 4L85A 2PO5A 4K87A 1V43A 3ENZA 1FFGA 3DE7X 3MAJA 2FMTA 2JLBA 4P82A 2DTEA 1WLYA 2FWJA 1XMOB 2BF7A 2GPSA 3H6GA 1REQA 5YASA 3CR3C 2IZ1A 1N2OA 2P9JA 2QQ5A 3LUPA 4RF4A 4BN5A 1NVWQ 2HGZA 1AUOA 2EC5A 2Q5JA 3RIZA 1QUFA 3M4IA 3KXPA 5F52A 1H42A 1YVEI 4AUEA 5AIBA 3UYYA 4NBVA 1OI2A 5TXGA 3A2MA 2B98A 5JVLA 1USUA 2EW2A 3P4UA 3TE6A 4CKBB 4OGLA 4LECA 2GN8A 2A4MA 2HDOA 1F2TB 2IY8A 4PONA 4ABYA 5GY7A 3TXAA 4IOMA 1JRLA 4J2OA 3VSDA 2J7KA 3B12A 3ADOA 3KKLA 1Z2NX 2BFNA 2RC5A 1M76A 4PQEA 3WGNA 2PD3A 1T2UA 1L5RA 1G18A 1CS4C 2WG2A 2Q5FA 3WA6A 1YQTA 3G2KA 4HDSA 4M9XA 3BXFA 1MGPA 3IP7A 5AESA 2C29D 1EFRD 4RV4A 4JJKA 1IEXA 4HB2A 1DQYA 1R9NA 1XLWA 2R4UA 1KH1A 2XE8A 3AZOA 1KJWA 3MJEA 4QVGA 5EEGA 4ZDWA 2HJSA 4KO3S 3SXUA 1E6WA 1V3TA 4FS1A 5DNVA 5BYJA 3E7XA 1QCYA 5KYUA 1O9GA 4EBBA 3PZPA 2WU8A 3TZ6A 3LF1A 3W5JA 4MVJI 1ONBA 2EV9A 5BN1A 3B7WA 3STWA 5A6SA 1SCBA 1YCHA 1GGMA 4GQBA 4W8HA 1ADGA 1UBRS 3UKJA 1WHTB 2PMEA 3WYGA 4HXFB 1H66A 2OGUA 3K92A 5CURA 1PD0A 2J6UA 3C6ZA 2FPPA 2I55A 4PLFA 4UAJA 4DL6A 1E7WA 4RXMA 4BBSG 3EXEB 1LY1A 3M6WA 4MXDA 1RYZA 5CLGA 1KOLA 3FOEC 1NSYA 2CXNA 2ID4A 1ODSA 1Y34E 1ILEA 4CLDA 3NBZB 5BN5B 2IYPA 3H1AA 2XAUA 2YQZA 4KN6A 3TLEA 4YFVA 1LJLA 1HDCA 2DX7A 3QU5A 5EEHA 2P7IA 4Z0TA 4DR5B 4RE5A 3TCNA 3GDFA 3BJYA 1I1NA 2IXEA 4E32A 4G1EB 1Q0HA 4NU5A 4ICIA 1H4TA 3HYRA 1UM9B 4EMBA 1E3EA 3I23A 1WEKA 5HRCA 3U7QB 4KPUA 4BO3A 1ZEJA 1TJ5A 5KSPA 2XNCA 3ULKA 2HWYA 2QAJA 4OATA 4W5OA 3VZPA 2XNJA 3U56A 1CRLA 4QU0A 1D07A 5IF9A 4ND1A 5JASA 1U1CA 2E0IA 3Q9LA 4Y2XA 1QCCA 3QPAA 13PKA 3GTQA 1SQ6A 2FSIA 2H31A 2I65A 3ABQB 2CMGA 3AR3A 1XCGB 1G20A 2R6R1 3JQ8B 5TQ0B 3UA4A 5J9FA 4E94A 1XJ5A 4R84A 1QHSA 5I47A 1L5OA 2Q62A 5BSMA 3MCZA 4RPCA 1G7SA 1K8RA 2JPDA 2NZXA 3LHIA 4OKSA 4CEHA 1NBAA 5MN4A 1ZOIA 4WXEA 1HQCA 8ATCA 2WQ7A 5D5QA 5E25A 1EKVA 4GSYA 5KFCA 2BGLA 3SQLA 1Q74A 3I6QA 1DLIA 4V0LA 1Z62A 4RNMA 4A2BA 4E6EA 2A14A 3HNPA 2HJHA 3TTWA 1G0NA 3L06A 3QZ7A 3SNKA 1UPUA 2IODA 2WM8A 3PXDA 3OMLA 4HN2A 4MR8B 1W85B 1PSWA 4CLHA 3TEJA 4RLHA 4OMUA 4EJ2A 1QR2A 3C3AA 5EKDA 2D5CA 3MILA 1FB5A 1GSHA 1T8RA 4K88A 1B2RA 4OGWA 2C2EA 2VK8A 4Z49A 1CUDA 5KQGA 3MUOA 3QHPA 2R8PA 4XWOA 3CX8A 1DV2A 4AF8A 3HG7A 1KEKA 1O94D 2GBCA 3LGAA 4EGFA 5L95A 3JAMA 2A0FA 4FDVA 1OHHA 2FKNA 3D43A 5FJ8G 3C3BA 4JBHA 5LLSA 3WL5A 1JNXX 2HSEA 5DX8A 1OX4A 1H5NA 2Q50A 2E5LB 3JYNA 3IOBA 1XAJA 4UPDA 3R3JA 4DOMA 1Z5ZA 2FEXA 4Y8VB 2HF9A 2Q6LA 5IYCG 5EP3A 4ZVQA 5JLAA 1AXGA 2W43A 5BQPA 1Q19A 4FOTA 4WLEA 4F4WA 3NLLA 1U81A 4JBLA 1NR7A 4KSBA 5DM60 4XQ0A 3S5UA 1Z2CA 1AGRA 1QXSA 2BMDA 3IPXA 2QVZX 3LBNA 1YMUA 3FJOA 4YX9A 3HKBA 4O4HF 2ZR0A 4P7JA 1UJ2A 4J6EA 1XZ8A 1PAUA 1LSSA 3SM9A 3JYLA 5C8VA 5K0EA 5A0FA 1IONA 3GFOA 3PNYA 3H86A 5JSQA 1NATA 5ITZB 5JZMA 4PYQA 2JFQA 3VO8A 4EG5A 3NNNA 2YR0A 5CVDA 1X1QA 3RB3A 2GM5A 2IYOA 2Z6VA 3DE6X 4RZQA 1H2AS 1IHYA 1JNYA 5DJ5A 1O87A 1KMQA 1DL5A 1RWOA 1OLUB 2E37A 2NPIA 4P84A 4PGGA 3K8ZA 5KNBH 3IIEA 4MRRA 4E2FA 2GBPA 1UDBA 3FCUB 1QRUA 2VP6A 4UPVA 3I5UA 3ZDEA 4QOFA 1KVQA 3WAJA 1TWHA 4CM4B 2JJ8A 1YU6A 4IHJB 3MMXA 1DT3A 1I7NA 4Z8XA 1PNOA 2Q4BA 3QNMA 3JXEA 3SFVA 3BMQA 4BNWA 4BQQA 2WQ6A 1AKYA 1GGKA 5TQ2B 2D7DA 2DQSA 5MHTA 1RHMA 2HGWA 5CM8B 3PC8A 4XWKA 5F9FA 2QX9A 2PZMA 1HR0B 3Q8SB 2W2KA 3NHZA 1U7PA 5DBFA 5D86A 3U9LA 4NMWA 3T1OA 1L4KA 2GCOB 1I1LA 4KXLA 4R0VA 4US1R 2QMZA 5AM5A 5HKAA 5K1ZA 4ECUA 4QODA 3ZJTA 2HHFB 1DMSA 3T5AA 4H1TA 4IIVA 1IZ7A 5A5VA 2DQZA 5E6RB 4OHVA 4RK7A 3BMOB 3ESCA 1S68A 1OC2A 4GXTA 1X7HA 3PYXA 5JS8A 5KTOA 1I33A 4QATA 4JI6H 3F6SA 2PV0A 1JLSA 1KQNA 2HPVA 2R8EA 3IDFA 4MW6A 5IK2A 4P5PA 1YIAA 3MPOA 3RBAA 1A5ZA 4DZRA 3H5VA 3G2NA 1OIWA 1QF9A 2J4DA 3R3XA 2ZTLA 2FAXA 4G9GA 3MWFA 1RYRA 1HNWH 1IWOA 3AFNA 5BV0A 5BYAA 1Z13A 1ZXXA 2B3DA 1JEYA 1TQHA 2IV3A 3N76A 1BOFA 2ENUA 3L7BA 2YV1A 3HU2A 4AKEA 4D8TA 2A1UB 1T8UA 2PH1A 4EEKA 5KMGB 3FMVA 2WQZA 3UGKA 2GEDA 1ZI6A 4BP1A 3ZH9B 5CVEA 1N9GA 2MOKA 4QOGA 1MAWA 1Z4OA 2OECA 4M1KA 4Q34A 3V8QA 4B4OA 1H6DA 3HDQA 3LT4A 1WQ1R 5TRTA 3BIOA 3NUGA 4BO5A 2QLJA 4PSAA 1T2FA 4DR6H 1XTTA 1JKJB 1B8OA 2OV8A 3LA6A 1BN7A 1GZSA 2L18A 3EH1A 4Z9BA 1GUFA 5L3QB 2F43B 4PCAA 1L7VC 4TGLA 4HWPA 1HO3A 3IVAA 1I51A 2EW1A 1P4JA 3QLJA 2QG4A 1YZKA 4YK7A 2FCAA 1DARA 3V4FA 2GVNA 1K6EA 3CNLA 1B7GO 1RQNA 3SQNA 4R5MA 3BHMA 3QEOA 2XQIA 1NI4A 5AO9A 4CEJB 4NESA 4DB2A 1L4YA 2ATIA 4DEVA 5DM1A 2CNVA 2O1EA 3K1JA 1YVDA 1CR0A 3ABIA 1OBFO 4HQ0A 4XR4A 4AJJA 3DXXA 721PA 1W36B 1KMHA 3G5LA 4W82A 4XH9B 2J6HA 2NVOA 5FKJA 2YZNA 5EYPA 1CLEA 3RDPA 2BSAA 1FDWA 4CLOB 2Y2UA 4BNDB 3RJ0A 2NT3A 4DNPA 3A6FA 4RKEA 3JQRA 3C6KA 4EZIA 1PW5A 5IKMA 3W1VA 3RJ9A 3TIXB 1JPJA 3QXJA 4C03A 4C9BA 1H1TA 4AF7A 4L02A 4II3A 4BATA 3OFJA 4ZMRA 2X5XA 5BOSA 4GR4A 3G6VA 1FMJA 2UVPA 1I94H 2ASJA 2HJ9A 2WP0A 1OV4A 2V9WA 3QWHA 2CFCA 4AUMA 5E6UA 1GJRA 1T6ZA 1RM5A 1KMMA 2HWWA 2QE6A 4CCYA 4F97A 1XZHA 2SNIE 4XFKA 4J07A 4JC5A 2VQFB 1NJSA 1E4EB 1Z35A 1CKEA 1ZGJA 2Q5LA 4HSEA 4YMWA 4KPYA 4IDDA 3DE1X 1DBWA 4UCQA 2C82A 5CDFA 3EGDA 4EBFA 5CDFE 1GUZA 1OC4A 4XWWA 8ABPA 1KK1A 2EJ2A 3M4XA 1MNAA 5AK0A 2O6LA 1NF8A 3OESA 2CBZA 3O90A 4A6PA 4F85A 5AVUA 3LLCA 1LK7A 3IIMA 4N3GA 4A1OA 1P19A 1H5UA 4TLEA 3BSWA 2AOTA 2Q5CA 2DE0X 4QREA 1UKAA 4PINA 3A2LA 3NBZC 1EKFA 2QTVB 1G19A 2XTNA 3EEBA 5F3DA 5FADA 1BJKA 4LOAA 4G5YA 4Q3NA 3RVJA 1X74A 2VEOA 1DBRA 1Y5LA 4EG0A 3ND9A 1SM4A 4FGLA 4INPA 4KW7A 4WOCA 5A9SA 5DQHA 2FN7A 5E0OA 4TXHA 4U7CA 3VI3B 4EMTA 1OZGA 1VIYA 3GGGA 3R4CA 1VI5A 1JIKA 5CFPA 1KZ1A 5FA6A 3HB9A 4IWXA 1EFVA 1Z0KA 3EDMA 1FSFA 1PYGA 2Y1KA 3N28A 3QF4A 4MCIA 1X3LA 1ZGHA 4MRMB 4UHDA 2NX2A 2X22A 2QOEA 1U2QA 2PL3A 4E5UA 1ZW1A 4G23A 4KRFA 2XXJA 1TECE 4S05A 1Y4ZA 3ACCA 1VG8A 3L3BA 2J3QA 3RC9A 5KYTA 5AKLA 2ZDQA 1C30A 4ZXFA 1RWXA 2IELA 4Y6OA 3FZGA 3D4NA 3DCJA 2FQWA 2Y4RA 4JIGA 1N36H 1T0IA 3S7ZA 4QVKA 2HSJA 4BDSA 2PNFA 2PQMA 2VYFA 3S2ZA 4F3NA 1WBBA 1EUZA 5C9ZA 2BC9A 2X0KA 3N8IA 3GJ3A 4DLSA 1EZZA 2WG1A 3U4QA 1JS1X 3E48A 1OA0A 3IESA 5G3YA 1YK0A 1HLGA 3R9RA 3OJLA 2Q4DA 3ESDA 3OWOA 3RG2A 3VYUB 1T15A 3KJIA 4F5YA 5EC8A 5L4SA 5CA0A 1D2HA 1K92A 3MWDB 5CDGA 3RSLA 2EX0A 1M6VA 3EF0A 2PQ6A 2W4QA 4RVNA 4DR7B 1HY3A 1THTA 4PNEA 2LRHA 3RYIB 4LMPA 1EP2B 4N0QA 2IL1A 4DYDA 4S1OA 3TMKA 3MINA 3J7AK 3EF3A 1Y8CA 5FJIA 4B09A 3D2AA 3E6AA 1W85A 1XQVA 1MW9X 2HHCA 1XTKA 1YOVA 1PR0A 4IJ6A 1UIMA 4OGGA 2FJPA 3GEMA 5G40A 5FPRA 4ZU1X 5MN6A 4QBKA 2ZP1A 2OILA 1G9SA 1BG6A 1FF9A 5H3HA 1Y7PA 1I3LA 1SVOA 2DHCA 4N7BA 3FPSA 5AOBA 3W77A 5CRIA 1J5EB 1CD5A 4RGQA 4XD2A 3VOAA 4AO8A 2PUTA 3AB8A 3ZC3A 3X1MA 3H3JA 3S99A 2NVXA 1UUFA 5JSZB 1MZPA 4BP8A 3IIKA 1NRWA 3SIRA 4WCFA 5IFLA 3JAKA 4HGYA 5L8VA 1LDMA 5BWMA 3RT9A 3UOGA 4AY4A 3EXHC 4Y2JA 3F47A 4LF5H 2AGVA 3MMSA 4TMXA 1P2SA 1OA1A 4XGRA 3I28A 5I5SA 5FF9A 2GEKA 2ZRIA 4Y2YA 1ZP6A 3WHPA 3PL5A 3KK0A 3H5RA 4B44A 3L6UA 2BHTA 3U81A 4QGSA 2C8VA 4D4GA 3SR0A 2JRCA 3UH0A 4RV5A 3AKZA 3OTOH 2J3JA 1TO1E 4EOGA 3STUA 3B52X 3AY6A 1ONNA 4A3BG 1R9JA 3ZWMA 7REQA 4CM7A 1U5AA 3WOVA 2BM0A 4URUR 4LV6A 3W5DA 1R15A 1WUKS 3AQ4A 4ZVSA 1Z63A 5CCXA 4IIXA 5EFZA 4BE9A 2I4MA 5JZ9A 1VHDA 2RAUA 1XQ9A 2QX7A 1Z8DA 2OYCA 1HOTA 4C21A 2N3ZA 2Q46A 3JZMA 5ALZA 3V00A 4XDHA 2J07A 3AEUA 3FKQA 3O47A 4KR3A 4HQRA 1I2KA 1CCWA 3D6FA 4RXTA 5DPMA 1R0BA 2W93A 4ZDKA 3EPJA 3BH0A 1JX6A 3V6KA 3KZXA 2ZB8A 3T5DA 2O8FA 4UD6A 3OCVA 3VDXA 1PQWA 4K40A 4P4GA 2YXPX 2ZT5A 3V8BA 4LVCA 4DJTA 3L7CA 3NTVA 1RE1A 4XJSA 4DA8A 2GYVA 3EZ9A 3GAMA 1VLMA 2QW8A 1D03A 3HDTA 4A7PA 2FG5A 1TKRA 1JHAA 3JAKB 1JQ3A 3ACBA 4G8CA 2W2NA 4LCBA 5BV2P 3FPCA 3VGJA 3SIPA 1VPWA 4YMVA 1U2TA 3N43B 1GPKA 5CT5A 3ZGLA 5KT4A 3WJAA 2ECQA 2P6NA 5A4IS 4C6TA 1GM5A 3OIDA 1PR2A 4JGGA 1R0WA 2QYOA 1E4OA 2DVMA 4Q45A 1KIAA 2A5GA 3RIGA 1YA6A 1WKBA 4XDYA 2X1LA 2P0YA 2R7NA 2J33A 1WDLA 1ENOA 2H8KA 3WRYA 1H4VB 4ZYTA 4J9NA 3EG5A 3AESB 4D4HA 3O94A 2Z4TA 5HF8A 4JLJA 2JGNA 4JLMA 2RB4A 5DT9A 2PGLA 3E1SA 2ROQA 3GU3A 3ZXSA 4EA8A 1RAHA 1E3IA 2HQOA 5A7GA 2R7ZG 3IP8A 5ALEA 3IE0A 3MCUA 2X40A 3ZZMA 1BKDR 1G59A 3WO1A 2QRPA 3DVSX 1GSIA 4ZARA 3WV4A 1TYCA 4A16A 4A2AA 3H20A 1K3FA 3QXSA 1VE1A 1SHJA 3FDXA 2IWRA 2E4VA 1QZUA 4PAQA 3KSDO 1N2IA 4ROSA 4RVDA 5HK8A 3VR5H 3GIQA 1PU2A 3CZPA 3MCVA 5CA0B 5FBVB 1RIFA 2EJ3A 5J4KA 2P30A 4BV9A 2PPLA 3L7MA 3ZHOA 1GNTA 3WL6A 1YMQA 2VZLA 1QYIA 2ZT6A 3KZCA 3RVNA 4E2XA 2QAIA 5IULC 3AM1A 1DC6A 4O08A 2O8CA 2CNLA 4KIGA 4LEIA 4OXQA 4OX9Y 2VRCA 3AYXB 1JLRA 4TXLA 1NBMD 2YJZA 3AUYA 4G4GA 4DMUB 4F4CA 5HTOA 4YP5A 1QPBA 1Q77A 4N65A 3BL6A 2GJAA 3EEYA 4I6GA 4PLZA 5BO5A 3ZLUA 3BB4A 4KITB 5L51A 3VBCA 3GUCA 4TKLA 5EVJA 3UAVA 3UMGA 4E11A 2NYVA 1IZ0A 4U2BA 3DZDA 4M3NA 3TGLA 5J4YA 5PGMA 1KR2A 3REFA 4HDRA 4EA9A 2RGGA 3TD6A 221PA 1N7JA 1X1SA 2VHCA 2ZULA 1C8VB 1WTAA 2HU7A 4N49A 1A71A 1OZHA 2ZYGA 5FUYA 2E4ZA 2VJNA 5D3QA 3RBZA 4EHLA 2NN3C 4EHJA 1RR6A 2RC6A 3C3KA 1D6NA 1Z73A 1CEQA 2C2GA 2R92G 4MKGA 4E4TA 2HEIA 4N01A 1W8DA 3AUKA 5TT0A 1Y33E 4HRAA 2AI3A 5CDUA 1R6AA 4C7JA 3WLKX 2V4UA 2Q8NA 1CZNA 3OUUA 4U9HS 4LRWA 3AWIA 1FQKA 4OJQA 4P35A 2XTMA 4PIPA 4N3BA 1TA0A 3UB4A 2HI0A 1UBOS 2PLRA 2YWGA 3IUNA 3QG1A 1Q21A 4LOIA 4NJMB 1EFHA 3FWNA 3JATB 2Y1DA 3GL9A 4H60A 4X6UA 4BBZA 4ZYYA 3OOJA 3VISA 2IS6A 1AHHA 1NVVR 1Z15A 2NXNA 3L9XA 4GRDA 4BNHA 1QPGA 1MFZA 1Q7CA 2HIHA 2ORWA 5KNCD 4PLWA 2ZITA 1KDRA 5DCYA 4US2R 3RBEA 3GMDA 1M5RA 1X38A 3AO0B 2GERA 2JDIA 1YDHA 5LOVB 1L7PA 1AKEA 1XDZA 4R2JA 3V1NA 1U2RA 2GLXA 3C3YA 1NI3A 2XZTA 4NKRA 4V0RA 5KJEA 4GPZA 3V1MA 3U9TA 4EL5A 1G7CA 3JSXA 2G76A 3K72B 1GZ3A 1VP9A 2HQSA 3KLBA 4FMBB 2VDWB 4HHEA 2PQ2A 3UMSA 4DL3A 2DCMA 2OHOA 5EJMA 3VHXB 2P1ZA 2WC1A 5DGDA 1D6MA 2X23A 1RPJA 2G1UA 2V5AA 4YMGA 2AS0A 3TW4A 1NU8A 1FTYA 1U98A 2H2GA 5I51A 4QDJA 1T6XA 5KQLA 4EDHA 3MB5A 1TJYA 2X15A 5KFYA 2OC4A 1F0YA 1DBPA 1SVMA 3F2VA 3AF0A 5CNKA 2FPIA 2X0RA 3ZK8A 4ZT4A 4Z1MD 5U4XA 1WLSA 1N78A 1BA3A 3MOGA 3TN7A 2CNBA 4B34A 2CKZB 5DQIA 3QKSA 1PDWA 1S4QA 4RY9A 4Y98A 1ZH2A 2PM8A 1ZM4A 3CLHA 1XBTA 1NBIA 3J80W 4HYYA 4AWXA 3QVUA 2CHVA 2C5LA 2PPVA 3KHUA 1H2ZA 4XIJA 3ZJYA 2F3UA 4M7OA 1YCGA 3UJBA 4YQFA 4NBUA 1WX1A 5ARCA 1HT1E 4MYHA 3OECA 3OA2A 2XZOA 2FGJA 4B9AA 3HBNA 2W37A 3QBDA 1I6LA 1IB6A 4CFYA 3TNYA 1B14A 4W9NC 3MFYA 5CIYA 5KDLA 4Y1EA 4DMMA 1PX2A 5A9RA 5TQ0A 3UT5B 4NX2A 1JKIA 2PFKA 3F6CA 3MYYA 3WV5A 1Q16A 4YI5A 3UPUA 3UNXA 3C1TA 1DEOA 3MRSA 5KFPA 3GV7B 3L1UA 4FBMA 4RMHA 2E85A 3TOZA 1SURA 1RXYA 3V32A 3B3FA 5J2UB 3MS4A 2I91A 1MV8A 3T6KA 4K9RA 2YOHA 4NZNA 3LXXA 1VKJA 1WB5A 1T35A 1ZSNA 2UZ4A 1ZD9A 4AJ1A 5L3VA 1JYFA 2ZXUA 4JI5H 3BICA 4LZPA 3D5EA 4HN4B 3FDZA 1ZMXA 4XE5A 4K6OA 1DIAA 2AJ8A 3EISA 4W9RA 3GLFE 2ZXFA 2O7QA 2QMEA 1T5OA 3A26A 3IIIA 5I9IA 2BGKA 1HE4A 2J5BA 4JL8A 4ZZ2A 5JUMA 3W1GA 3WWPA 5K0JA 2O8FB 3ZHBA 2H52A 4OHRA 4YJ3A 4BVAA 2DBZA 3LQ4A 3V1YA 1T1SA 3SBXA 3G2IA 1P6QA 3A14A 1C1DA 2WKPA 1H23A 2QAGC 3AI3A 1DXQA 2R3SA 3OQIA 2QK4A 2BUCA 2V3VA 4I14A 3VUFA 1XNQB 4O7TA 4TVBA 1EFAA 2RGWA 3KYCB 3RFXA 1AB5A 2IYFA 3C5HA 3F4LA 4QG7A 1U3FA 5DGTA 5G0UA 1SC1A 2DR3A 4LRQA 1TYAE 1CUXA 5KFVA 3F90A 5AMXA 2JHPA 5JC1A 2REOA 1GLNA 1IDOA 1GPNA 2VRBA 1Z22A 3O9MA 2E82A 4K86A 4LC0A 2H4WA 4M53A 5DLQC 4B6RA 3CZ4A 3EXFA 4RM3A 3AVVA 4IV8A 4OQPA 2I2WA 2VJKA 2CYBA 5SZJA 3RS3A 1GHTA 2CN1A 1CJUC 1KNQA 4A6XA 1VBGA 3PK0A 3LC2O 1CJCA 2JJ1D 3OC6A 5T4BA 2WUFA 3D4IA 4X63A 3CTMA 4MQ5A 2I6UA 3RYCB 3TB4A 4JI8H 1G6HA 1NT2A 2PS9A 4MVJM 5JJCA 3LOPA 5G0WA 5K0NA 4HTFA 5AHXA 3HB5X 3LKVA 1DEHA 2V7GA 1KF0A 4X97A 4IJWA 1HDIA 1KKUA 3K9HA 1CJSA 4UDNA 4RKWA 3DHEA 3I5AA 1VZ3A 1W4RA 1CHDA 1JIUA 1GL3A 2AEFA 4GH5A 4M7PA 5TPZD 2JGIA 3WY9A 1QTQA 2XB6A 3G5UA 4LHYA 1OH7A 1NLUA 2C8LA 3ECAA 1QLJA 3M0EA 1KL7A 3TZEA 4DEYA 4BGDA 4MB6A 4O2AF 4P58A 3TTXA 5LZ9A 1K7CA 3EF1A 5H9WA 1X8XA 1ADJA 3LS2A 3DBHB 2IEZA 2FVXA 2PUHA 4XEHA 1XXLA 1CQPA 1F60A 1IB0A 1RRPA 3M4ZA 4L27A 1R9GA 4U2KA 2R84A 4WAUA 3ZE9A 1YB4A 1V37A 4MW5A 4GI7A 3O4FA 4ETSA 4QPPA 5FNVA 4JEIA 1SKMA 5EZYA 3RHFA 2ZE7A 2J6CA 1OLXB 1X9GA 5AW0A 2QVCA 2X19A 3ENQA 6REQB 4Q7KA 1VMDA 3LPMA 1NXTA 4UATA 4AYTA 3AVTA 2C9BA 3UGTA 1QTNA 2WT9A 4XCVA 5BWRA 4CJXA 2R97A 1VXRA 4KNYA 1M6EX 1RQGA 2ASEA 2G88A 3FD8A 5GTDA 4BQPA 4YJFB 3C87A 4BBPA 5E4TA 1RAEA 4JZKA 4RPJA 1JTFA 3GRUA 1MQ8B 1PEKE 4M2LA 1G7RA 5E1DA 5FI3A 1C1HA 5L3RA 5TT1A 5LP6A 2C35B 4XPIA 4G0NA 1E2QA 5LYYA 3TQOA 3ZHVA 5BURA 2F9FA 4BLRA 3KU4A 2X6TA 3Q2OA 3M9OB 3LTEA 5D2CA 4OEHA 1LLDA 5I5XA 4B6JA 2WU4A 2FCRA 2C61A 4IJVA 1XK6A 1QMPA 3BVPA 4ID9A 3WDKA 4KLCA 2ZBRA 3HN6A 2B78A 2BCGY 4LDNA 4CCYB 2UXCB 2BR4A 1FMLA 1SCNE 4QXRA 1QIDA 2FW7A 2XKBA 4WCVA 2X6RA 3CT6A 3IXQA 1Z74A 2ACVA 4HAYA 1BCSB 4A3LG 4MVJG 5BMVF 1X1EA 2Q1SA 4U4AA 3UV6A 4HGRA 2JJQA 2QTVA 4L0QA 2Z0MA 3CISA 3Q85A 2RK6A 3N9IA 2Y67A 5C7OO 2CVPA 3B9BA 3D7KA 3ZHQA 4B5KA 3CZMA 2R8JA 1W75A 3HL0A 3B38A 1TVEA 2LIVA 4HVCA 4AY6A 3E4DA 4RC9A 5SICE 4YMTA 1U6KA 3QVLA 3RGXA 1EK5A 2BN4A 5BPFA 3B89A 3V5NA 2MCTA 5D6OA 4BFCA 4KV9A 1A5SB 1RRFA 4FS8A 1T2EA 4H27A 3NYQA 4LBYA 1DG9A 2EZ9A 2GUWA 4WNCA 1YA4A 2JEYA 2CXSA 1TK3A 2OHVA 2VA8A 4FGRA 1CT9A 1K66A 3LQYA 3QKWA 4QPZA 1WKVA 3OZAA 3RRFA 4F6CA 2FQQA 5I5EA 4C07A 5IT5A 1G66A 2O0JA 5BVGB 2I62A 3BORA 1G5TA 1Q0LA 1P1CA 4YA6A 1DMRA 2XCLA 1KYWA 2ET6A 2DFLA 3IEUA 1PDOA 3FB4A 1T4GA 3F8TA 4EAQA 3WHIA 2BH2A 2Y1EA 4AAYA 4FLMA 3KTAB 5CXXA 1HG0A 4O6VA 3IAS6 3ABSB 1QGOA 4YQWA 1JLLA 2CK3A 2BEUB 3IOMA 4M21A 1VKZA 4YJ2A 1W2WB 5HIMA 3H18A 2XA1A 3ZV6A 4DSNA 2JLRA 4KXUA 4D26A 3BS4A 1A88A 1ACMA 4YUVA 4BO4A 1FUIA 4UBNA 4GD3Q 5BR8H 3KKZA 4ZT5A 3CEBA 1R8YA 3HH8A 5F7JA 2F1OA 2OBNA 4F5DA 2CV2A 2DT8A 1QBGA 2A57A 1RWMA 3R9KA 4WVFA 1EWVA 3IBCA 3CVVA 2YIDA 4BO0A 1FXSA 2I2FA 5CDSA 3VI4B 2FG7C 5DEIA 4JBXA 2Z9CA 3WWHA 2DT5A 1WW8A 3PQ2A 2FTKE 2VSQA 3IPAA 4AD8A 4D46A 1KYTA 3JQ7B 3C3MA 3UXMA 1AN7A 3T52A 1QHIA 5DQGA 1M0TA 3R7FA 1JFFA 1W0JD 3NP9A 1XTIA 2BTOA 3KAQA 3DMTC 2ZCVA 3BL5A 1SUAA 2MHCA 4E31A 1ID8A 2UVVA 1R8XA 3A6DA 4JMLA 3H0GG 1DIRA 2Q28A 4REOA 2WT8A 2Q1XA 2OY0A 3GV8B 1I6WA 3ZDAA 3V4OA 5C8XA 5JZOA 1RDFA 1UXKA 1W36C 4R1PA 3SHVA 1FRNA 1Y4DE 3ICPA 3UAWA 4DL2A 1YE3A 2GAFA 4JLBA 1M66A 3GEPA 1ODCA 4AB1A 2R79A 4O4HA 3ICQB 1V7QA 2HVRA 1TC1A 2BFAA 3FN4A 2NYAA 2JFZA 4L9SA 4M22A 4UVEA 4UUQA 4ND2A 4CE6A 4X62B 4V1CA 5TQ2A 4E5NA 3E84A 4OU5A 2PSJA 3N8KA 4KOEC 4RTQA 5JJ5A 3GUYA 3OQHA 5CDHA 3DMPA 2Z1NA 1ECGA 4TTAA 2C22A 4YAWA 3NYRA 4J7AA 3L8FA 2JARA 1M2NA 1X8KA 2SBTA 2VYVD 4EABA 1QHEA 2A7XA 4RJ2A 4TYYA 1Z4JA 2CMHA 1T10A 3TVDA 1EDOA 2Q8QA 3TIGA 1WMFA 3CZRA 1LQTA 3D6HA 3DLTA 3GT7A 5E6RA 5ER6A 3T7JA 1WHSB 4UTNA 3HCCA 2YWXA 4FBGA 1NXVA 3OC0A 4ZAVA 4RULA 2HDHA 2YFQA 3MWJA 1W1WA 1ORHA 3GZNA 2OHIA 4K3VA 3RSOA 2YJNA 1W7AA 3F8WA 5AKZA 3L7JA 4TWAA 2FQYA 3IIJA 2ZIEA 1GTSA 1KTVA 2C5HA 3AUAA 3RF7A 3O3NB 4D4MA 5H9VA 4ZOAA 2X0FA 1KUTA 1V3VA 1ZCBA 3H42B 4IH4A 5ES3A 5HHTA 4QNNA 4JB0A 4XX0A 3VTKA 1NNEA 1ZC4A 3T3HA 2IYQA 1L9KA 2JA6A 3EVCA 4LYJA 4NVRA 1HEIA 2A9RA 3AIIA 4L4ZA 4LC9A 4WY2A 3VU0A 1BIFA 3JALA 3SDSA 2HGSA 1IBKH 2BY4A 4HNHA 4TTJA 5D00A 4JBGA 5JSYA 3V46A 4ASUD 4MR9B 1P9OA 2W8KA 3FWPA 3OAAD 4DDTA 3ZIDA 2NSYA 4Z4CA 4QWBA 3UATA 2G71A 2BE7A 3BD9A 1PS8A 4MP8A 3SEFA 1LC3A 3B5EA 2IZ6A 5IDXA 5DWDA 3MC1A 3MMPA 4JJ4A 3FDSA 4CEIB 3NWEA 4I36A 4PG8A 1S7GA 5JAHA 2ZRPA 1QE0A 3N05A 1KOGA 2Q3HA 1U1IA 3I04M 3NH6A 4I8DA 2J6SA 1N3IA 4D5EA 1JR3E 1XALA 1A7UA 2OD2A 2YRXA 1BCRB 2J32A 4G4SO 4LNUB 3UUWA 1TMGE 5A1JA 4RPKA 1U1EA 2WY2D 1FTWA 1YE8A 1GLVA 5ALJA 1EESA 2UZAA 2PR7A 5B1YA 2IX3A 1A97A 1N2BA 2O54A 3U6KA 4RH3A 2XWJI 1TQ6A 3AVOA 4K6HA 4CHIA 4G89A 4Z9FA 1BA2A 1LZKA 1PWEA 3IAFA 4L5AA 4Y8VA 4TS9A 3RS9A 4OHBA 2JLXA 4DIDA 3FAKA 3B2NA 4MV9A 4G9EA 3GDHA 3HDHA 3HSSA 3BK7A 3LKDA 4IDFA 5DNYB 3JYQA 1V1JA 1H1LB 1NUQA 2Q3BA 3L2OB 4GOOD 2ZLBA 1LPBB 2MR6A 1KFKB 3KKOA 2DQYA 3NOOA 3L4EA 3OZIA 2FPKA 1Z82A 1COZA 1G8YA 1RWKA 2GOYA 4BUCA 4O3OA 4N1AA 2XMDA 3TX2A 3UJCA 4BQOA 1CRPA 2VLIA 3H0KA 3RC1A 3U39A 3LFHA 2J0VA 5AW5A 1SB8A 3G5AA 2B3TA 3SFZA 3P2IA 5JIBA 4U2GA 2F4VB 4J0FA 3ILVA 3HYTA 3DAGA 1DIGA 5HS6A 3W6PA 3RNLA 4JI7B 3K9GA 2AI2A 2MSKA 1O1YA 2ZW9A 4QBHA 5A5DA 2PH7A 4CN8A 3L7IA 4I19A 5IBQA 2TYSB 3ILSA 2REQA 4TVOA 5DLDA 2ZT7A 4J0KA 1F1BA 3AF3A 5DWQA 2X7XA 5A3VA 4QO8A 3C97A 2GASA 4KAJA 4J9SA 2C3OA 2GJ4A 5F1PA 5TMEA 4DV6H 1E9AA 4MQEA 1UFOA 3LD9A 2I7XA 1YQXA 1N2HA 1T5HX 2NO0A 2OHJA 2VWGA 3JQFC 4L5YA 1U8XX 4QDUA 4R2HA 3EIFA 4XD7D 2FMUA 3TQHA 4WQMA 4JEUA 1XROA 4UHKA 5EIBD 1J8MF 4B4UA 4EUSA 1OB2A 3TLAA 4RB2C 1I2CA 1C1DB 1TAGA 1XEWX 1DX4A 2J3DA 3GQBB 5ECWA 1FSGA 2W4IA 4FNGA 1JHMA 4MWOA 3OSNA 2ZUFA 4HBGA 3H9JA 5FA8A 3YASA 4BQNA 4Z4EA 3O0TA 4MKHA 1DGSA 4MKXA 4YAOA 1K5HA 4L7VA 2E5FA 4HMQA 5HQJA 1JPNA 4JWTA 5TPZA 2WJPA 1J6UA 2IOHA 5SY4A 4M99A 2JFFA 2RDMA 4JYPA 4M83A 2DHDA 2VPZA 8OHMA 5LSAA 1OH8A 1OTXA 2J3HA 4EO4A 1YA8A 1GAJA 5I7RA 4M9CA 4BV2A 5T6MA 3LSYA 3PFGA 1L4GA 4KQJA 4R2IA 4UOQA 5JDIA 2G0TA 5DT2A 1UXJA 1O89A 2QAGB 1DJLA 3TTYA 4YUXA 1HFKA 1VCOA 4KN8A 2IU0A 4NU0A 1UM9A 3VZQA 3NBAA 2A1TR 3T94A 3GV5B 3GYGA 3ZTYA 4G86A 1RZRD 2YJTD 3U7IA 3NHAA 3TEFA 4G8JA 5AT1A 1W48A 3TECE 2Q6TA 3Q3IA 3D3QA 1P72A 1ZIPA 2FX3A 1YBHA 2HLPA 5C5JA 5IC5A 3T9FA 1CS0B 1H0KA 3X1ZA 3KYDB 1OWOA 5LLTA 1NUTA 3PD1A 5BORA 2FG6C 1ODKA 3QHAA 3KPWA 1GKKA 1F2UA 1UPFA 4KQEA 3PLAE 2G08A 3SC2A 4AZVA 5CNMA 4P0QB 2NYRA 3EWNA 4KHPB 4E2WA 1NYLA 1NF3A 2VAPA 1PJSA 3LVQE 3OFND 4IOKA 3PDIA 3UY4A 5IN4A 2X9NA 4F5WA 1ZCZA 4DV4H 4H15A 1VYHA 2CHFA 3P71T 5BV7A 3ZTTA 1N8SA 4F1JA 2PT5A 1EUYA 3LBAA 1DG1G 3T99A 3H2YA 3AETA 5DGXA 1JG1A 1RJQA 1JI3A 1KI9A 2VF2A 1BVUA 4LCJA 5L1IA 2LGJA 3WK7A 1ST2A 2G28A 1IOVA 2A9OA 2ZCJA 2HUNA 2DKFA 4Q37A 3JWEA 1J07A 1DRKA 2XXBA 4ZI7A 1A3GA 1NC3A 1XNRH 3G89A 4LS3A 1B8UA 4P4TA 1Q0ZA 5JRJA 4UASA 1T5IA 1DJQA 4MKZA 2VNJA 1NSFA 4J91A 3M6LA 1J9ZA 3EN0A 3A58B 4J9KA 1RJEA 1CBUA 2FFQA 4BFLA 4TV8A 1JUDA 1GD1O 5D8DA 4FOOA 1ZNQO 4RW0A 2WUDA 3KXIA 3L18A 3I4MG 4O2BB 1T8SA 4AUKA 2OZPA 3URKA 1RI2A 2V6IA 4X1YA 2NO7A 1UOQA 4I4NA 2EFYA 3LQQA 2JJ2D 4P4SA 3WB1A 3G6WA 3ELDA 3LP6A 1XC7A 3PHIA 5LMCA 3KNZA 3BL8A 5CBKA 3JQ9A 5FV4A 4J8PA 2FK8A 1E0JA 4MVJE 2WSBA 2YIMA 2VWHA 2BZ0A 1TTPB 1GEGA 1JVNA 3NW9A 5IBPA 4KL8S 1SOMA 2BFDA 5B6PA 5DTEA 5EP2A 3VDRA 1ODFA 5K3OA 2C4HA 3D8BA 5K6RA 3EJ6A 2IPMA 2HMUA 3N42B 1T94A 3STTA 1XF9A 5JDIC 1JZSA 4B3XA 4FXPA 3EX7C 5EQDA 3I1FA 1VC2A 2BBTA 1EEHA 1IJKA 3C1UA 1TW2A 5BUZA 1MA3A 4D9CA 1P91A 4WT7A 1MEJA 2JIDA 1ZGZA 2H1CA 3VNSA 3QIVA 1NF9A 5AHKA 1EX1A 1GR1A 1FTGA 4OHZA 3E15A 2I4TA 2BKLA 1WP9A 3H2BA 2X9QA 1OKKA 4ZPJA 3IQHX 3PIIA 1YS9A 5JG7A 2DEUA 4GX5A 3A9SA 3QV2A 2JCBA 3CEHA 2FUG1 3EGXA 3ICVA 3WK5A 1AK2A 3HYCA 2VTBA 2O7SA 4BEVA 1WSBA 3R24A 2GK7A 3GJ4A 2GBGA 5G4KA 1JH9A 3ISTA 4RVGA 1BMDA 5F9NA 1SQFA 3DT9A 4BMYA 3U0GA 2WAXA 4RHCA 2PBZA 1VSBA 3IQXA 2HA7A 4J2TA 4I2NA 1W73A 4X7RA 4Q4AB 3OP4A 3UN1A 3EZGA 3SZGA 3KD2A 5BR7A 1OTHA 3A7DA 3UZBA 1NUAA 2YYSA 3AR2A 3V6LA 3VO1A 1EP3B 2WIDA 3L6RA 3WGKA 4R1UA 4D8VA 1NZFA 1MIOA 3HBAA 4Q3EA 5EXSA 4HP8A 3M83A 5LYJA 3GILA 3S28A 3WFZA 4UOEA 5FWYA 3M6AA 2P2LA 3DHVA 3IVXA 5GPBA 4B4VA 2IKQA 2JLQA 4LJYA 3ETEA 4HNRA 1QAMA 1W52X 4LJKA 4EMSA 4OLFA 1T1GA 4DGQA 1HZJA 1DX6A 2PR2A 1PJ3A 1VKNA 5THXA 2HVSA 1VCIA 5EE0A 4HUJA 4GI3A 4I55B 1T25A 1GQ2A 3D7NA 1Z36A 1U0NA 1L8OA 1MCZA 1SK8A 1TK9A 1CVIA 1VG0B 1JTVA 2RJOA 5GZ6A 3ZWVA 4NFSA 5JV5A 4IGAA 1VPDA 1JALA 2I1QA 1ORRA 4ESHA 3M33A 3O82A 1WZUA 3DBHA 2P69A 1WVMA 2B7LA 3KSUA 3F8NA 2DPLA 3GUUA 2XW6A 3TW8B 4ZI5A 5JU6A 5JDCC 4KXQA 4F9EA 2AXPA 4GO1A 4GC7A 3F7MA 1D09A 3T9EA 3T3OA 4MHTA 1O75A 5KOJB 4R2MA 1WV0A 4CMFA 4Z4HA 2FMFA 1KBLA 1O08A 3GRRA 1JV2B 1NV9A 1TZCA 2EKPA 3UF0A 4LBZA 3RVDA 2EJCA 2YZLA 3HKDA 4MQ4A 3E4CA 4P3PA 3I1IA 2YV2A 4M8SA 3C7CB 5D6NA 3ETHA 1L2TA 1LKZA 4DWOA 4QJBA 1C2TA 3FBWA 3CF4A 1J2JA 1QYCA 3HABA 5I7FA 2Y4NA 3IHTA 1DAGA 3NHLA 4L5JA 1TCUA 5IWAH 5JSHA 1MC8A 4DYHA 3T9CA 5T57A 4I7EA 1NZJA 2DF8A 4BRUA 4U3JB 4K6NA 1AGPA 3A05A 4KN5A 1N2SA 2JJMA 4X7PA 5CFRA 1XT6A 1UKVY 4ZD6A 5IX8A 4Q7LA 4BO1A 3ONFA 4DUYB 2HR1A 5ESRA 4BCBA 4UFPA 3FBGA 1U7XA 4HDNA 3HBFA 1AKUA 3O4IA 2P7HA 3EWAA 2GF0A 3WAKA 3FSGD 4LDRA 2QY9A 1ZEMA 3OPVA 3VU1A 4BX8A 4CR6A 2EKLA 1IN5A 2IA6A 2BFEA 2R6JA 3OQIB 4HMPA 2GH1A 4XIGS 5D1NA 4Q8EA 5FHRA 4CMGA 3EAQA 5AUQA 5H3CA 2CLCX 4ARCA 4U6NA 3PDWA 3EMBA 2D06A 3NKVA 3UT0A 4EUKA 2BVNA 2B83A 2DY1A 2PCJA 3L7DA 3MBKA 3GHHA 4JI3H 1ST3A 1XVAA 1U0FA 1YR6A 2FLWA 2YZ7A 3BE8A 2XJ4A 4JP5A 1USVA 4MW1A 4QUAA 4XARA 4XLLA 1NXOA 3FFTA 3H11A 3JR7A 3L8HA 2CNOA 3FDZB 3V7FA 1SG0A 5HKKA 1SBIA 1BW9A 3VGPA 4NFHA 1OMOA 1KT8A 1CUGA 1AHNA 1G3QA 2EBUA 2YHSA 4R9VA 4YBZA 2DETA 1V4NA 2WUWE 4Z3OA 2CMFA 3EIWA 1YAHA 4XGQA 5AKEA 5HIAA 3RB0A 2F4NA 1A9QA 3LCRA 3BMCA 5KOYA 1PVOA 4YR9A 1WZEA 1OWTA 3ZHRA 5KFDA 4JA0A 5K9ZA 3EGOA 2FZLA 3LHFA 1KI4A 3AHJA 4DCJA 1UZUA 3KO8A 5H16A 1JIHA 4P3NA 4PFKA 1RNLA 3E23A 1V0JA 5JRDS 2C2MA 2BHLA 1JA9A 1E20A 2WMDA 4KQKA 4IUYA 2C83A 2RGEA 5BNWA 3K70B 3VNBA 2BBWA 4F0JA 4CKBA 5IVHA 3VPDA 1ZUNB 2DM6A 2AZDA 4DDVA 1X7DA 1TT5B 4DZTA 2IYVA 1K7SN 4EJSB 2VC2B 4Q4CA 2XRFA 3OJFA 4MI6A 2O8DA 1DFGA 1B8VA 1W34A 2P2CA 2QN3A 3KHSA 2QQEA 3VV3A 2BI8A 2A78A 2X0IA 3U44A 3ILYA 3VPSA 3D31A 3WP1B 2PJUA 1ZH4A 2XYVA 2Z02A 3L4KA 1K4MA 3HQ4O 1MIOB 2OEPA 5FWYB 3K4PA 2G1KA 3RAQA 4N48A 2HHLA 3NBKA 1MH1A 5IMSA 2HIMA 3HWWA 4ER6A 4RHFA 1GCUA 3G1UA 2P3QA 3ZDZB 4BOYA 2JANA 3QI2A 5CW1A 5H3LA 3G85A 2ZQYA 1HDRA 1U90A 1SOWA 2GD0A 1MEOA 1QIHA 1XK5A 2GMWA 2XTZA 4WDRA 2QZZA 5FPSA 2D2EA 4YGXB 1QJ4A 3C0FB 2ST1A 1HF3A 1Z33A 4KH1A 1OXTA 1RKVA 3GR6A 4XRGA 4XSGA 3VHXA 3B5JA 1LRLA 1DCFA 4JT9A 1GV1A 1OD6A 1IHUA 2BGJA 4YONB 2CBGA 4DWVA 3DMRA 4EEYA 2Y0SA 3DOFA 5CYOA 1Y3FE 4LXIA 3J81k 3B3JA 3EVAA 2IMWP 4I7HA 4CQNA 4EL0A 1H2BA 1W36D 3C3PA 4HQOA 4ZQIA 3HSYA 4GHWA 4ARUA 2KPOA 3PNLA 1AXRA 2JCXA 4PR3A 4TYQA 4BB0A 2EXXA 2ORYA 4M36A 5FWAA 4NBRA 1LX7A 3H6KA 5AI6A 5J1SB 2BGIA 5KYWB 1K6JA 3IUJA 1NJ5A 3DAYA 2HQRA 4C0WA 2VTDA 3GK3A 4YQZA 1FJXA 4KPGA 2F9LA 2G1PA 4IVRA 4ZVMA 4B46A 1T4MA 1I32A 1Y82A 1YUNA 4JT4A 4HGNA 4ZC1A 1VA5A 4OV6B 1L0BA 2UYOA 1VGQA 1FUKA 2HSDA 4FR2A 4FCVA 4EHNA 1JU9A 4BQRA 1WF3A 1PRYA 4QYIA 1HMYA 4KV7A 3M1LA 5C0OE 5TPWA 3NDBB 2CC2A 1JAHA 2BKUA 2X5JO 3I3SR 3O74A 5I9MA 5JSUA 5LU9A 1AO3A 1SU8A 1MX1A 4PC6A 3A9UA 1V8ZA 3I5XA 1UDRA 4IDPA 2IU6A 4N0PA 3TNLA 1VL5A 2EKQA 3LHKA 4WI1A 4HJXA 4RD0A 3WIUA 3ESQA 4L51A 3PHCA 4P4SB 4MB2A 4DC0A 3UPDA 1GKUB 2BGWA 4QXAA 5DGAA 2B8EA 2COJA 2Y1OA 4JQSA 5EMKA 2GD6A 2ZIUB 3WJ2A 4P86A 4CGZA 1TA8A 3H1PA 4BBRG 1VSVA 3C8MA 1MZBA 1L2ZA 1OYYA 1M2FA 1WQ4A 2CKMA 3LK6A 2GZAA 1AVTA 3KYJB 3NBXX 2FF7A 4MMZB 4X65B 3NDPA 2DHRA 1X0VA 3PVZA 5DOVA 3ELBA 2WE6A 4FDLA 1IHPA 1SBNE 4JU8A 1OFTA 4V38A 1XZKA 3Q8PB 4HNGA 4L16A 5FWXB 2Y76A 2RARA 4TZKA 4FMCF 3REQB 3BXGA 4KACA 4AKIA 1SXQA 1ZM3A 4YV0A 3TKAA 4KP7A 5L53A 4AJ4A 4LF4H 3KVNA 3EMVA 4GW3A 5BWNA 1DINA 5L1LA 3GLTA 4BX9A 3EZYA 2IYWA 4ZAZA 2ZJYA 3KOMA 3MM4A 3TRJA 1X1RA 1G3UA 3UBMA 4RQAA 3G82C 3TK1A 3RSCA 3BE4A 3FWZA 3H9EO 5KX5F 2VEDA 1GAWA 4X64B 3K0SA 1GRCA 1YB2A 2HWXA 5EIEA 4KGZA 2OM6A 4CF3A 2XIJA 4Y2UA 3SLGA 4H1UA 1EK6A 3B70A 3NGLA 4BWSC 1KBQA 4UM9D 2J7PA 1ZRNA 5HUQA 3OG9A 3EYAA 1ABFA 3E0XA 5CEFA 3T3IA 3LYAA 3PX7A 5BWUA 1TJ4A 4X3CA 4YV2A 2JFHA 4WLOA 3FA2A 1HG1A 1AQJA 5GGXA 2EHJA 1PTKA 2O50A 4P32A 3U54A 5E8JA 3RC3A 4AQYH 2I6SA 3ROQA 3CW2A 1E6LA 4M55A 1NW7A 3KYHC 5AJZA 1S02A 2Y68A 3GTKA 1E2EA 1CZRA 1O97C 2HSWA 5FLXA 3RT1A 3W5VA 3HPQA 5EJ9A 3NONA 4LF6H 1Q1EA 2IVFA 1A5TA 3G7SA 4LXQA 5KQSA 4U02A 2JFXA 4ZGBA 4CL2A 1JJ7A 2C95A 2PA0A 3C7DB 3H4IA 1I30A 2OHFA 4KIJA 4O7SA 3TTUA 3NFRA 3SF8A 3UAYA 3TYXA 1Y3IA 1XRLA 1F2VA 4R2KA 1L5MA 2H2AA 2AEJA 5DNWA 2GA8A 3WLQA 3ELYA 1GTRA 2IHBA 4MR7A 1XGKA 3OEEA 3V1TC 1UEXC 2BHNA 3SYTA 6NULA 1UQRA 3WZLA 1A5AB 3DDSA 3OM0A 3NRCA 3F9RA 4GKBA 5AM2A 5LU8A 1QH8B 1XKQA 2FPMA 1NXXA 3BDIA 1E9BA 1O96A 3NEJA 5LBUA 2IBKA 4HH1A 1OYOA 1UBJS 4OFBA 4INAA 3GQBA 4CCWA 5KG2A 3AZQA 1VJ1A 1VBMA 3IDZA 3JQBC 3IALA 1QH0A 1KQFA 5JWRA 4I50A 5NULA 5K8LA 1SXJC 4DA9A 3U19A 2FUEA 4IQ4A 2GB4A 5AVKA 4C06A 5ICFA 3E3MA 4UMFA 2QHXA 3CLRC 2R6ZA 3N7AA 5ALPA 1JYEA 1SU6A 4NK4A 3VSAA 4JA2A 1PFVA 2QR3A 4M1WA 3K30A 3JASA 3DONA 4GP9A 4CT0A 5CFMA 4S2UA 4OYRA 3AP3A 3FNIA 2PFSA 4GMDA 4GMXA 4MUJA 3KQKA 3Q7SA 3T5PA 5IT9W 2YQ4A 2X0EA 3WNQA 3PR2B 3B53X 1V47A 1Y9JA 4GWKA 4TQAA 4KO2S 3D0KA 3BFVA 5C4XG 5ETJA 1EMDA 3ZWDA 5A6VA 1ZHHA 2MT9A 1CE8B 1LSOA 4LXGA 3A37A 3EXG1 1AGXA 5ARBA 4I4TF 3V6JA 3GLSA 4B35A 2CCGA 5ILGA 1LB1B 1N1DA 1NVEA 1R1DA 2JDID 3VKFA 2VDJA 4HVAA 4RFSB 1SXPA 1BEEA 5LYJB 1DRVA 3TZHA 3NEAA 2ZBQA 1SU4A 5DGCA 2E2IA 4J90A 3PO2G 3D6JA 3CZ9A 1KVUA 3QJ5A 1CRQA 3SK0A 3MLEA 3KX2A 5K6AA 2QTFA 3KPYA 1GFIA 2XVXA 2ID7A 1ANKA 3Q7RA 5TMBA 4HGQA 2AUNA 4XM0A 5GZ3A 1VBNA 5JADA 5KSYA 1WWKA 2J48A 1P29A 4KI7A 2IP4A 4QPDA 4O7RA 4QLBA 1H0SA 3FTQA 2GBLA 3WBKA 1CUHA 4P31A 2O5EA 1MXHA 1YTLA 2OLSA 1UBTS 4GKVA 1E3LA 4NBTA 4RJLA 4GVLA 2FUKA 2FWMX 3C45A 1A2BA 2FFHA 5CH8A 1I4EB 1UKBA 2WB2A 2EZ4A 3ELUA 2UXDH 2C03A 1G2OA 4JC4A 4KWEA 2J9RA 5E9WA 1ITZA 3ANMA 4NPCA 3G6YA 5IH7A 1RHQA 2X42A 1E3QA 3AH8A 3FGNA 1E59A 4F60A 1YFJA 2C8KA 4FIZA 4IO0A 2P79A 3IV6A 1BCRA 2EQ5A 1WSCA 1OLXA 2IEIA 3P0JA 2ATLA 2F3PA 2BZSA 3NHBA 4LTMA 1SU7A 1Z5UA 3LU1A 4U2EA 3WGQA 3OZXA 5IVDA 5B3LA 5LZ2A 3TAUA 3OX2A 1S2LA 2B4QA 2VDQB 3GIKA 1NKTA 1U3WA 3JALB 4AJLA 2AOVA 3OCJA 4Y1FA 3EVBA 1EPUA 3TEKA 3L0ZA 4RZUA 4G0VA 1E4FT 1FVXA 5KKCA 1U3VA 1QZXA 2H17A 4MYCA 4EYGA 2GPBA 5EZ6B 1P0QA 4G25A 1I6UA 1XXHB 5LMUB 4RA6B 2GZDA 4D9JA 2GQRA 2UZ0A 4FWIB 2ES4A 4C08A 4MDYA 1CY4A 4C14A 3COJA 1NDQA 1G20B 4Q0YA 2J6IA 3JQ8A 2Z8YA 4NU6A 3R3VA 3GZNB 5AHOA 5FPPA 3HLKA 5K51A 4DQ0A 5IXYA 2OFFA 5TSDA 4ENQA 2P68A 4MRMA 3SJAA 2ZB7A 4AUNA 4DCSA 1XELA 1EFPA 3H87A 1IBMH 2MSNA 4XCQA 3T1YB 2ZUWA 4LV5B 1UBHS 4GOMD 1GRQA 1H69A 2YMMA 5F9MA 5IP5A 5ALUA 4AS1A 1IPHA 4MAFA 4ATNA 5EE5B 3PL1A 5FHQA 1W96A 1DXYA 3CUTA 1T34A 3A4MA 4WFJA 5AHWA 5JWHA 3HCOA 4GMKA 3LDFA 4UMEA 5C4IA 2P5SA 3UGJA 3QKIA 1OT3A 4RD1A 4IILA 2ZPTX 2WWWA 4ND8A 5HCNA 3CEMA 3G0GA 3UK7A 4Y7DA 3W1BA 3U4CA 5BVHA 2G4CA 4Q4DA 1IUOA 1PLKA 3I6YA 4M1QA 3C7TA 4MO9A 4G5RA 3SU8A 3L5OA 4ECXA 4QGHA 3IA7A 2DPIA 2GTHA 1XAIA 2WKWA 3CONA 2NMVA 3ZDFA 4OUDA 1CP3A 3DOIA 4PC3A 2RHRA 2RCYA 1HNNA 2JJ1A 3F73A 1E63A 4PO1A 5J2TB 3FYUC 3PW0A 2QP3A 5J63A 1APBA 4H3HB 2QWXA 2WE8A 4JBIA 2QYTA 1F2UB 3Q72A 1YRYE 4NEQA 5K3BA 4EWLA 5BSVA 3PXUA 2I33A 3O5AA 5HRAA 4NONA 1K88A 4U1RA 4JJEA 4DBVO 1GAEO 2GCNA 2HBRA 3HA5A 5BOSB 1TUEA 4GQIA 1F1JA 4O3NA 1CUBA 2PEYA 3CF2A 3C5WP 3MOSA 2BEJA 3OTIA 4OXKA 4Z4QA 1CY8A 2A67A 2H8GA 1OE0A 2AJLI 5K3FA 2JGJA 2V7EA 3DQQA 1JQDA 2AI1A 2WWTA 4G24A 4QICA 3UMRA 5MFPA 1T2VA 5DF1A 3EZ6A 3I72A 2RIPA 1TUGA 3RB4A 2HA5A 1JZQA 5CT4A 4YCMA 1WZNA 2LNDA 3QENA 2C2RA 4KLRA 3V8NA 1YR1A 4H4DA 3OWHA 4TM7A 1EWTA 1AKQA 3REQA 3NDIA 2A2ZA 1IRIA 4UTVA 1B6RA 5KQPA 1H0RA 2VUMG 1F2TA 1G8FA 2E1RA 2I7TA 3RUIA 4O7NA 1HNXB 2EX4A 1XZFA 3ETNA 3GUHA 3KQWA 3UOWA 1BKSB 1FDRA 4DV5H 2WKRA 2GBLC 2X0JA 2OZLB 2VQDA 4F2DA 5A9TA 1Y6QA 1A95A 4HY3A 5SYMA 1R4MA 4R8VA 2H1RA 4LNAA 5DZSA 1FYWA 2EDAA 2XYPA 2ZT8A 4M8KA 4N8EA 3GJXC 4BEJA 1NVGA 5JVDB 2XX3A 4ENVA 1GQOA 2A5LA 3M4NA 4KIFA 1U5CA 2GILA 4KYUA 4F84A 5CHYA 3IDSA 4JLDA 2SECE 1RJ9A 1SQ0A 1AZTA 4NYJQ 5ADWA 2MSCB 4KVGA 3S2UA 3VV2A 2YCBA 2VHEA 1PZGA 1NN5A 5LL6b 3ZCRA 1JXLA 1VGRA 5DTQA 2IOFK 3IOYA 2P91A 3E5MA 2OFOA 4FZJA 4Z7JA 3HLYA 1JH8A 2IU4A 5ALRA 4AS2A 3ICEA 4MUEA 4GRIA 5AW1A 1GSOA 4EENA 4IWYA 2C84A 5C1BA 2DMRA 3KUKA 5AM0A 2YC2C 1JDEA 2VA9A 4LQCA 2DPJA 1XNQH 2PUJA 2XNSA 1ZHQA 4IF6A 5H68A 3UAOA 4CKWA 2UU9H 5JCPA 1PT6A 5A4KA 1CQIB 1J8YF 4IDHA 4M0PA 5TIIA 5ES4B 2ZRNA 1XN4A 2IEAA 1X1AA 3SHQA 1QANA 2Q8PA 2UVDA 4YAFA 2ZYVX 3DDWA 5COQA 1DTWA 2OO3A 1AA6A 4MGKR 5EGSA 2Q3DA 4FEGA 1U9JA 4UE3S 1PWYE 4HLQB 4AN4A 2C5GA 4O4LB 5ERGB 4G1BA 4ZAFA 1FX0B 3GBSA 2J7PD 1QIMA 2X86A 2JVJA 4KXVA 1VHLA 4MI1A 5A7HA 5IEJA 4WZBA 1JECA 2JVIA 1JWAB 1Y9AA 2N75A 2PSEA 1M0EA 5AJWA 1FNBA 3KPVA 4ZEXA 3DE0X 3BFPA 1XWIA 3FVTA 3ROPA 3TJZA 3WMFA 1KDTA 3HYSA 3TH5A 4TT8A 5H0IA 5CA1A 3ZNOA 4MS4B 4O7YA 5JFTA 2FMAA 1E6KA 4UUAA 4N4AA 2PD4A 5B7NA 1QC5B 1Y7TA 2WJGA 5LUBA 1JAIA 1QH1A 3BSSA 3LUCA 4GT1A 1XTVA 4ZALA 3GJ8A 2IPAB 3D54D 5AXBA 5IKOA 3IQGX 5DWVA 2FDXA 1UJ5A 3TRIA 2ZWMA 2JGLA 2ZBUA 2G9VA 3KEFA 1US8A 3OJEA 4XFJA 5HF6A 4ZV7A 3V48A 3EA0A 4MYSA 4QECA 1IK6A 4DR5H 5P21A 5IKPA 2KWIA 1D2RA 2CJWB 2ERXA 3PU6A 4MRAA 1O03A 1O6ZA 1FPMA 1BFDA 1TVMA 1V3QE 2WOJA 3ESBA 3GP3A 2QW0X 3BHNA 3L9WA 1NYQA 4I8IA 3T61A 5IANA 3AY0A 3TZBA 4IFBA 1KYQA 3Q15C 5A4DA 4CTJA 1PBTA 1MJHA 4PZPA 3LGXA 3W5OA 4KDRA 3QLTA 4XPIB 1E1NA 3HWX1 4GYYA 5JWOA 2BM9A 3BPSA 1EB8A 3KSRA 4NV3A 2Q5HA 1V7ZA 2OAGA 3SBDA 1XLTC 1EUDB 1QNLA 5AXCA 1XZDA 3FNHA 3KB6A 1K8YB 1PJTA 4MQ6A 3U3MA 4JB2A 4HNVA 2KBFA 3HM9A 3L49A 2FWRA 4ZN6A 3HJCA 5TR9A 4II7A 2KQUA 1KNXA 1T0JB 2ZDHA 3KRTA 4RJIA 5C8YA 4F11A 5LZ5A 5KIAA 1Y6RA 1UAYA 2FI1A 2QD3A 3LP5A 1G21B 1U9YA 3ZI7A 1XG5A 2IT1A 3N0VA 4GE0A 3L07A 2QTWB 5DGHA 1KEUA 1NVMB 5DCUA 1P33A 2CL7X 3DV0B 1ZUNA 1J99A 4WK4B 4ASUA 5FTJA 2HMWA 3BCSA 3AR4A 1SZCA 5EWJA 1MVNA 4AJOA 1FS6A 3CH5A 5C5CA 4TV8F 2VK4A 1U7ZA 1P3Y1 3P26A 3H3VH 3MTIA 1OXSC 3JPYA 4FINA 1LS1A 3KZOA 1ADYA 3CRQA 3NM4A 2R6AA 3N5CA 4I46A 3IKMB 3GELA 5HOEA 5J5VA 4U6PA 4WKOA 4BLQA 4ABTA 4ZHQF 3NDJA 1EQAA 4CVNA 3DJYA 2W2LD 4GC5A 2F1RA 1XKTA 1DE0A 5ADHA 1GP2A 4GC6A 3GZTB 4IG9A 5FOWA 3WRXC 3U5ZB 3WYFA 3JQAD 4WKPA 5C44G 2C2ZA 3ZV7A 3GTGA 3I83A 1F51E 3MIIA 4D9MA 1WQ3A 3TLZA 4EIWA 4UC0A 1D1SA 3FR8A 1OIVA 3W5HA 3QMVA 3OICA 4HTAA 2AH5A 4B43A 1ISIA 1ZD5A 2FGKA 3IUEA 4FDUA 4EHHA 4LHZA 3B36A 1Z18A 3CT4A 3DOJA 4OP2A 1N3BA 4CMEA 3QTLA 4I1SA 4UEKA 5EE3A 1AZLA 1N5MA 1TZ2A 3K2BA 1PGPA 3OZ7A 2WHRA 4CMIA 3T7TA 2VPXA 1U9ZA 1Z4MA 4JEHA 4IL5A 4QAQA 3FF1A 4PRLA 4NENB 2XKKA 3ML1A 5AW4A 1M7HA 1VJRA 1WJGA 2F62A 2IXFA 3R3ZA 2NVYA 4WECA 3ED1A 4YMIA 2J3IA 2FRDA 4L0CA 1I13A 1PUJA 2HMTA 2IQIA 2W0SA 2J08A 2EJWA 1Q95A 3TDKA 2ZRBA 3H6HA 3P5BA 2FSGA 4LHWA 5EWMB 2NUPA 2M6SA 4UCWA 3LLMA 4C0HA 2BFEB 3T1HB 4Y2TA 5FOXA 3GLFB 3DZJA 5KFLA 3G8CA 4BNKA 3FVQA 4PWYA 5IZCA 1GT6A 3FOAA 4NS4A 1HYBA 1M67A 2XF2A 2P6RA 5EWJB 4IY1A 4A23A 2RI1A 1UKEA 1XFAA 5FOTA 2I22A 3D8UA 2GEBA 1UJ4A 1IMJA 3FPKA 4KE7A 2QV7A 4M0KA 4O1HA 4UEWA 5AKXA 5DIFA 1OLSA 4AP6A 4TMFA 5BVHB 2V03A 1XZEA 1HDYA 4CPDA 2H06A 4HAUA 2OORC 3CRW1 4TTIA 5DSTA 3WLMA 1YQQA 3MS2A 5AJUA 2CXRA 3AKYA 4HCJA 4EEZA 2Y0BA 3LZCA 3K8QA 3NBYB 3LLSA 3BQ9A 1D9XA 1YJAA 4HSGA 1QYXA 3EVZA 1EFCA 1U8AA 2JS7A 4LKOA 4O29A 5AI8A 2JFNA 1OI3A 3IAS1 5BQ3A 4OSEA 5CBPA 2O8BA 4NMHA 2QMQA 3FMIA 5EUBA 3ND6A 1BU5A 1KFBB 3K6RA 4JUIA 2Z4RA 3TLMA 3W9SA 4B3SH 2DUNA 5DYTA 1M6HA 1GZVA 1SZDA 3R0IA 2YXLA 5F7ZA 1RXVA 1SEPA 4RH1A 1MC1A 2ZU6A 2YFYA 3GBPA 4OJNA 3U4HA 2BZ1A 3S0JA 3T95A 3SQOA 1Y6ZA 1EJ0A 3THSA 3OM1A 4A5SA 1HE5A 1P45A 2H1SA 1N5JA 3EDQA 2XUFA 3K1AA 3KOOA 3LOQA 3PA6A 1MFPA 3C48A 4IVNA 4ETIA 5JS7A 5KDDA 2C2DA 1P3JA 1ONOA 3PDHA 1MIHA 1NFRA 3EY9A 4UTXA 1KYZA 2B5VA 5MGNA 1P4RA 3A25A 1YJ5A 3NBFA 5EJ7A 3U6BA 4TPKA 2ADMA 3G9TA 2PX6A 2JA6G 1XYGA 3EPKA 3IBTA 4A15A 4G26A 1C8LA 2F17A 2GPJA 1KPHA 3ZK7A 5C1PA 4ZCPA 3HOZG 1V9LA 4C0LA 1TPZA 3RR2A 1FPQA 1K9SA 1T2CA 1UXHA 3I64A 4I6EA 5KKAA 3KALA 1DOAA 4RNNA 2AEEA 4J4BA 4M0DA 5DM70 2G3YA 2AFRA 2I9KA 1J56A 2DCUA 4Q3OA 2ISQA 2DIKA 4R98A 3RGGA 4CRWB 3INYA 2PFGA 1ZIDA 3IDOA 4M7RA 1GDHA 2HWUA 4LBVA 1YHYA 3AB7A 4WZBB 3JQ6A 3TSCA 1TJPB 3DQZA 2OC9A 2OXRA 3ITNA 2QN1A 4M1YA 4WKNA 4V0ME 3VC7A 1X7GA 1SAYA 3BWYA 4I9UA 5IYBG 5JQGF 4O3SA 1XMPA 5IS2A 1AO0A 1YS1X 4PYRA 5A4FS 4LJSA 1NFFA 4CV2A 3DDCA 1QOPB 5ALLA 1JMKC 1SGWA 1YZ3A 1BGXT 3HKBB 2J5XA 1P73A 4K0RA 1CETA 3EG9A 3MD0A 4PZ9A 3V42A 4F3TA 1U2ZA 2PZFA 2B2NA 4LE0A 3CNNA 3GIPA 5CXUA 2AV6A 2OYSA 3AG6A 3K9WA 3UKDA 3A4VA 1OSNA 4OI2A 5JSKA 4OBEA 3NC0C 4CQJA 1OXMA 3K09C 3OOYA 2ANBA 3Q3HA 4FMDF 2C2HA 2JH9A 4H7JA 1NP6A 4Z86A 5D3KA 4INZA 4JI3B 3QEJA 5AXDA 3NVDA 1XZIA 5LP1A 3ROXA 5JBIA 1ZAYA 3Q4GA 4IIJB 4QL3A 4TS1A 1CEYA 4JLOA 5TF0A 3KSZO 5DXAA 2B9VA 2OQ2A 3FJ1A 3O4HA 4P3KA 3WLOA 2WEKA 2OXTA 4MWDA 4AMVA 1GZ7A 3HC7A 2GDZA 5L1JA 2VHTA 1IU9A 2PXAA 1JJIA 1NQOA 3OIGA 5FUXA 1CDOA 3VR6A 2BMEA 3K35A 2G83A 3VNNA 4MV5A 2CCJA 4LIPD 3UMMA 3L4BA 4O2BA 3JS5A 4FT4A 4JNCA 2JLYA 2BYTA 1MO4A 4DR1B 2CFTA 3ZZUA 3VYTB 1XXHE 2WZQA 3A1DA 4R69A 3NRJA 4UCXA 2FKAA 4X92A 5EAIA 2QRJA 2AJDA 1UC8A 1C1XA 1E2KA 2COGA 3AI7A 4GFDA 4M38A 4EY3A 5B12A 3DFKA 2PGAA 2CXUA 3I6MA 4Q43A 1KE2A 4R8SA 2AFHA 1I6MA 3HCWA 1LVHA 1QNFA 4JJ7A 5EJEA 1KI3A 1RZRA 4JLAA 3WLNA 1S0UA 5ENDA 1GGHA 1KI2A 2POCA 2AK3A 1FFHA 2NO5A 4J03A 2G72A 3JD2A 3OBIA 1KO1A 4IDBA 2XHEA 4QNMA 4X1IA 5EMHA 1Z2OX 3RS0A 1K4KA 2Z2YA 3HKCA 4B7CA 2GA9A 3O92A 4ZOBA 3T1NA 3GVHA 5EZYF 1SUWA 2VJPA 2W2QA 1QYVA 3DZIA 3PLRA 4MGZR 3RGZA 1R0YA 1UAGA 3ZGOA 1DLJA 3AEYA 3IBFA 4RTMA 4ER5A 2QUHA 3VPHA 4CF7A 3BEOA 1CJKC 4HH3C 4MJXA 4RQUA 1V16A 4JQCA 2VYNA 2O23A 2BR5A 3E82A 3IODA 5AUNB 1OQAA 1Y0BA 1P4AA 4NCNA 3BSYA 3X1WA 1BYIA 1FLNA 2QRMA 2HHJA 2BE9A 4PBRA 2VXOA 5IT0A 5IT9A 2FPXA 2XE7A 1UBMS 3EFEA 5BWCA 2WTUA 2UZIR 1YF3A 2OG2A 1SWWA 4NYJR 4ZFNA 1Y4SA 3DFMA 3K1TA 4DMFA 3DWIA 2QSYA 2V5UA 2VAMA 1WM1A 5K4AA 1KBOA 3ITKA 4M49A 2P9CA 1CWUA 3FHOA 1PSZA 1CJBA 3PPIA 4TROA 2ZIZA 3SOPA 2NV0A 5JJLA 4WZBE 1QOZA 2R2GA 3MJSA 2O5VA 1W581 4G4SP 4OAPA 4PFQA 3WQBA 2XR1A 3VYRB 4G3IA 4LWPA 4PS0A 5BP7A 1SVSA 4U0JA 3L79A 4PYOA 1CR1A 2J1LA 3GARA 1CS0A 1MP0A 2C9CA 5BSHA 3GVIA 3JYHA 5I45A 5FUMA 3OPNA 4ZDIA 5AIAA 4QJ5A 3WAGA 3U0VA 1SHKA 5TF4A 2YY6A 3M6XA 3KQYA 4CM8A 2H1IA 2OV2A 2E2WA 1ZWLA 3HBMA 3C39A 1PNVA 3LHSA 3OEHD 3RAPR 2PL1A 3FYSA 1KP2A 2HOQA 3PVCA 1GPWB 3ISJA 5DK6A 4E1BA 2YFHA 1GCIA 1QVAA 1DQRA 5JALA 4KXMA 5JXHA 3JR3A 2H1FA 1B0AA 1X3SA 1F3OA 5JH7B 1CEEA 2IP1A 4IQGA 3T9BA 3BQ1A 3F4KA 2FFBA 3RS8A 1YC2A 1HTTA 4HDKA 2G1JA 5ALVA 2UUCB 1IEQA 1BXGB 2F6RA 2G77B 4JBYA 3IILA 4B83A 1PV1A 1I3KA 4N76A 5FLXW 3ZWCA 2VHVA 5D1HA 1QGYA 1VGVA 2WTBA 2FX2A 4RDHA 4HQ6A 1EKXA 1LGYA 3DB2A 5JSZA 4D79A 3EVGA 3ZY2A 3CUSA 1D5WA 1NW8A 4I2VA 5FR1A 4KMOA 5DX1A 3ZJ4A 2W42A 3GXOA 2JZOA 1W88A 2CLSA 2IIVA 2QRVB 1KEEA 3H5WA 4OQLA 2HPZA 3ZYZA 5IP9G 5AKKA 1HYHA 4RB3C 2W2KB 3GW8A 5JS2A 4C0BA 2HQ1A 4CNBA 3K3PA 5B58C 1WXXA 5DOZA 3J80A 3B1XA 4MWZA 2FPGA 3Q10A 1PFYA 5AW6A 1MAUA 3N0RA 4KUGA 3QZ8A 2P9FA 3WKAA 2Y1XA 4HI0E 3GNQA 3NB0A 3AEKA 4QUGA 2VJYA 2ODQA 3NCTA 4RKYA 2R93G 1MEEA 3JD1A 3MEQA 2JW5A 2B1RA 3GJXB 1RI1A 4WK6A 2XNDA 4IDQA 3UCXA 2AWOA 3EZFA 2YYYA 4FEEA 4QXPA 1AJEA 1G3RA 4DR2H 1Z0FA 2FEWB 2YYZA