3MJFA

Phosphoribosylamine-glycine ligase from yersinia pestis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
429
structure length
429
Chain Sequence
AMNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of phosphoribosylamine-glycine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords Phosphoribosylamine--glycine ligase
total genus 128
structure length 429
sequence length 429
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mjfA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mjfA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjfA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 3mjfA04
2GQSA 3AW8A 4WD3A 1E4EA 3I12A 2YZMA 2NUAB 2V5AA 2YWVA 2GPWA 2YS6A 4E4TA 4M9UA 2FPGB 1JDEA 5LP6F 1CQJB 1KUTA 3MWDA 1I7LA 4IWXA 3VPDA 3ORRA 2YZNA 4M99A 5H80A 2HGSA 3JRWA 3RFCA 4IWYA 2QF7A 1KJ9A 1A48A 3U54A 5JVDF 2FPIB 3TW6A 2YRWA 4QSHA 2W6OA 1Z2NX 3LP8A 3RUPA 4EG0A 4O4IF 4O83A 4L1KA 3HO8A 4O86A 3JRXA 4M98A 5LOVF 3QFFA 4M9CA 4NYEA 2NU7B 1CS0A 5GONF 1M0TA 1CQIB 2CNVA 5BPHA 4EABA 2Z04A 3ETHA 2CNQA 2R86A 4MA0A 3AX6A 1PX2A 2ZDHA 2FP4B 2YZGA 1C3OA 1KJJA 2XCLA 3VA7A 2YS7A 2PN1A 4DIMA 4O7SA 3R5XA 4MA5A 2PVPA 3GIDA 1PK8A 5CB4F 1C30A 4O7RA 1Z2OX 2R7LA 3BSYA 1W96A 3SE7A 1KJ8A 3V4ZA 2DIKA 3Q1KA 1IOVA 4MV1A 4O4LF 3BSSA 1IOWA 2CZGA 1M0WA 2SCUB 1EUCB 3BG5A 2W6NA 2NU8B 1VBGA 4ZQIA 1BNCA 2QK4A 1AUVA 4ZI7F 5JH7F 4XYMB 2R82A 4I4TF 5C1PA 2XD4A 4O2BF 4TV9F 4ZHQF 1E4EB 5CAEB 3JZIA 4Y8VB 1EHIA 3TQTA 3RV4A 1KC7A 1VKZA 4XX0B 3HBLA 3U55A 4YJ3F 1EZ1A 3N6RA 3NUAA 3BFPA 2NU9B 1UC9A 1JKJB 4O7ZA 4O81A 5IYZF 1CE8A 1JDBB 2YW2A 4YB8B 1GGOA 3VMMA 2V58A 1EYZA 3JZFA 2R7KA 2W6MA 2P0AA 1A9XA 1KEEA 4MV6A 4O7YA 4O84A 1DV1A 3TINA 2YZLA 2W6ZA 4XZ3B 4EGQA 5C1OA 1SCUB 4O2AF 3HB9A 5DMXA 4HR7A 4YBZB 1WR2A 1ULZA 1BXRA 2GPSA 5KKNB 4O4HF 1KJIA 4O7NA 2HJWA 2R6FA 2YYAA 4FFNA 2YL2A 4GGMX 3K5IA 4O4JF 1W93A 4ME6A 2NU6B 1M6VA 3LWBA 3U9TA 4YAKB 4HNVA 2PBZA 2DWCA 3RV3A 2VR1A 4O82A 3K5HA 3OUZA 5JQGF 2IP4A 2W6PA 2X0SA 4FU0A 3V4SA 4EA8A 5BMVF 4J6EA 1OBGA 3ETJA 4EA7A 1EUDB 4O7TA 4HQ6A 4FFLA 3R23A 1AUXA 4EA9A 2CQYA 4FFPA 2R87A 4FFMA 2I87A 4I50F 5LYJF 1B6RA 5LXTF 1GLVA 4HNUA 2R85A 2Z02A 2OLSA 2R84A 1KBLA 3VPBA 4IHJF 4WBNF 2ZDGA 5BPFA 1OBDA 4FFOA 1JLLB 4EAAA 2V59A 3G8DA 2YRXA 5I47A 2VHEA 4TUYF 1Z2PX 1KJQA 2W6QA 4ZOLF 2NPOA 4O7WA 1DV2A 3WO0A 5C8YF 3Q2OA 4C5CA 1GSAA 2WYOA 5JVLA 4C5BA 5HBRB 1B6SA 4MV8A 4XYLB 4MAMA 5J2TF 4RZQA 5K2MA 2DZDA 4O7LA 3OUUA 2GLTA 4HNTA 3BSWA 3WNZA 3VOTA 3R9RA 2ZDQA 5CA1F 4FFRA 1GSOA 2I8CA 4C5AA 2W70A 3E5NA 5HV6A 2FB9A 4YJ2F 4YAJB 3DF7A 5CA0F 4FE2A 4TV8F 4IZOA 3K3PA 1DIKA 3KREA 3R5HA 5J2UF 2DLNA 2I80A 3TIGA 4O7VA 4I55F 2R7NA 5D8DA 5JQWA 5LA6F 3TIIA 1VBHA 2C00A 3ORQA 4MV9A 3KAKA 5KX5F 2W71A 3R5FA 1UC8A 3MWEA 2J9GA 2VPQA 5FNVF 5EZYF 4IIJF 4MV4A 1I7NA 1T36A 3UFXB 4FGRA 3GLKA 3KALA 3WO1A 4EGJA 3G8CA 4MV3A 3U9SA 4MV7A 4DLKA 2CNUA 2GQRA 1GSHA 2R7MA 2VQDA 3VPCA 3MJFA 2FPPB 3N8DA 3KAJA
chains in the Genus database with same CATH superfamily
2JFBA 2WB1A 4Q9HA 4JJ8A 2Z8YA 2HBYA 3NHSA 3RLIA 4YXWA 3ND7A 1GUBA 1H2FA 3B6ZA 3MCUA 1JIKA 3MM4A 4ASUA 3GRPA 1NMEA 3Q7TA 4ONEA 3SLKA 3KTOA 4N12A 4EKYA 4WEQA 4Q1BA 4E1BA 1JKIA 3VO9A 5HZGA 4HDAA 4B3MB 2JA7A 3UT5B 1ONNA 1OA0A 1V37A 4HAUA 4BLTA 1K97A 1DTSA 4OFBA 5LL6b 1QTNA 1T4BA 2TRSB 3O38A 1PWYE 4MYUA 4Y6PA 2VYVA 5FI1B 3VO1A 4B35A 3SHVA 4YP7A 3L2PA 1I4OA 4DKJA 3IQDB 4YHHH 1YZ3A 2H2FA 2TMKA 2YYYA 4F97A 5K0ZA 1YFZA 4OUKX 1FF9A 1GCUA 1AZSC 4NPAA 4KJZA 5KWEA 5DLGA 3VPSA 3WWPA 1Y4DE 2CNKA 4DY6A 5JLAA 1M33A 3RIYA 1KMNA 1WQ3A 3GP3A 4H7JA 4OAOA 2BQUA 4ZCLA 3MCTA 5C32A 3RS8A 4N7BA 2P9FA 4H1HA 2KWIA 5AJUA 4AN4A 3GB9A 2W4MA 2KW5A 4DV7B 2HI0A 1J2EA 1I4EB 2EKPA 2J0EA 1U7WA 3A04A 5I7HA 1RIIA 3N5CA 1HZJA 4HRXA 3DE2X 2RGCA 2Z2KA 2VJLA 3PD0A 4RNDB 4F50A 3R3SA 3LP8A 1P3DA 3TQ1A 2XDQB 2YJ5A 3DEKA 4L02A 3WNDA 4BFVA 2PEYA 5ICCA 3I30X 4MHSA 5P21A 2O8FA 4PWZA 3BXGA 5KFFA 1BXKA 1X7ZB 3GHYA 2IUYA 1MJFA 2KPOA 4EG5A 4L16A 5BSTA 3LG2A 5EIHA 1SD1A 1K89A 1JTFA 4AJ2A 2AC7A 2O48X 1E79A 3H9JA 4J3JA 5TMPA 1AHIA 4M98A 1AC5A 1ABFA 1I3MA 1SCDA 1Y8RB 2UVWA 4M9CA 3HBFA 3RVLA 4EPTA 3E22A 4NYEA 3CRW1 1L4UA 3KEQA 1NX9A 3ELDA 3PUKA 3MTBA 1ZI9A 2ZR9A 3K1JA 2JVIA 3ZDFA 3FMPB 2BKLA 5CR5A 1LD3A 2UUCH 2C4MA 1LFDB 1NXVA 1VHJA 2OPBA 2PUJA 3KHTA 4R9UC 2G25A 4WBNA 1U2RA 1YDWA 3CLRC 3B5IA 2FE3A 3OHSX 2X3YA 5BXQC 3E82A 4DVJA 2OHFA 5B1DA 2ZDHA 2Q27A 2FP4B 1XHFA 3ZWMA 4D8UA 1FFXA 5CEFA 1WPRA 2WSSA 3LDAA 3QUSA 5JARA 3KEMA 1Q1BA 2QSUA 3NXKA 4X7RA 3V33A 2VJKA 2BFNA 1T8WA 3G6YA 4H7DA 5JWRA 3DXYA 3DGEC 2D5BA 4GVXA 2RD2A 5CB0A 3RB0A 1RM5A 1FUKA 3Q7PA 4LE0A 3IAFA 3G2MA 4RF5A 2FWPA 2GARA 2HTFA 4RM2A 4J1TA 1CQZA 1JX6A 1BX0A 3EDOA 4JEHA 4ZQBA 1HNWB 1FIUA 2HU2A 2VHUA 4AZ0A 2RHRA 4Z9XA 2XUPA 1EVKA 3KOYA 1U8TA 5AIBA 2P1RA 5BWOA 3OFVA 3DJYA 5G02A 2CLIB 1LH0A 3ESQA 3UEOA 2B1JA 4G2NA 4ECWA 1M83A 1N2BA 2ACEA 2YWRA 3IKTA 1E1QD 1K86A 3HKCB 3FY4A 2CEKA 4LYGA 1F0YA 1I6MA 1FRQA 1V45E 1I80A 1R5BA 2OCLA 2RGNA 2WF5A 3E1SA 3CEBA 3RRYA 3RAQA 4RXMA 2PT7A 4CMIB 2C3YA 2WC1A 5I5VA 3KL4A 3CCCA 1J25A 2Q8NA 3O21A 3MFYA 3SZOA 4DJJA 4CM6A 3EGOA 2LDBA 2WICA 2Z0MA 4Q9KA 3R5TA 4GQBA 2WJZB 4RA6B 4UHJA 1JZQA 3PX2A 2GT1A 4FKZA 4YJHB 1B93A 2V6IA 3E81A 2PNJA 4HD8A 3VYVA 4KPYA 1UMCA 2VYCA 4W1SA 4ZT6A 4TKVA 5ICSA 5TLSA 4IXWA 4QHTA 3VBCA 4NC9A 2Z6VA 1V47A 2FE4A 5JPIA 1FPMA 1Z0SA 3IAXA 4GC7A 5AKLA 4UHBA 4O29A 2XUFA 5DNDA 2JHFA 4GX5A 3DB2A 3KPWA 1NXSA 1V2GA 4OFXA 2GERA 1C0IA 2QVYX 3A70A 4RV4A 5FTWA 3LXMA 3RVKA 2ZP1A 4LJ4A 4F6RA 5FX2A 2WJAA 5F35A 4MB0A 3VJRA 4KH1A 2REBA 3ZGZA 2NV0A 1JMYA 5CD9A 4J4TA 2WIAA 3SYMA 1EFDN 3DT6A 3ZTYA 4JC8A 5DM4A 2VSYA 5EJ2A 1EI9A 4UEKA 3MWFA 1DC7A 1J9ZA 3E84A 5JYEA 1HDCA 1PEYA 1H0RA 3E61A 3VTKA 5A4IS 1JBQA 3TG8A 3ELWA 4JI1B 2VQEH 3K1TA 3Q3GE 4FMCF 2YINC 4Y8VB 4EEQA 4FHDA 4GBGA 2CKMA 4IJQA 3WYEA 2PGOA 2CC2A 2ZT7A 3G82C 1C3OB 1D2CA 1YBVA 2WZDA 3GFRA 4E51A 1RJEA 5KWSA 2P6OA 3LO5A 1JDNA 3CE9A 3ET4A 5JDIA 1VBFA 3O1LA 3HT5A 2XOKA 4ZAGA 1AIPA 4J1QA 2QMEA 3ML1A 3NKVA 4LRUA 1AGNA 1RWVA 3IP9A 3JQ7A 4IAOA 2A1UB 3OIWA 3CVXA 1JPVA 2ODQA 4FN5A 1GN8A 4Q7MB 5IM4A 2B37A 2C20A 1FS6A 3AVXA 3LNCA 1HEIA 1SCAA 1JKMA 4NCBA 1GPH1 5CX4A 1M1YA 5JY1A 4FWIB 2C1ZA 1E2FA 1EG2A 1KEZA 1LQ2A 3ZN2A 3MJTA 4AKTA 4DRXA 2VTKA 1PZNA 1BZYA 3VR3A 4EHIA 3BMCB 3RO7A 1ZK4A 4B4WA 5LKRA 4O81A 2HA6A 2W6IA 3G5MA 4TMWA 4KRGA 4G84A 3RVMA 2ADMA 3V1KA 4B7CA 2P6UA 4CQMB 4YCAA 3PK0A 2WP0A 3ETNA 4G1FA 4DSAA 3W5UA 2A7XA 3WGQA 5LZ8A 4RCYA 1EZZA 1AV6A 3CF4A 3PF8A 2D2FA 3D6NB 1FU7A 1XALA 2Y0CA 4OA5A 4U9UA 1NULA 5EUCA 5TQJA 3ZCRA 4ECEA 1AF7A 1QDUA 1UBNA 3Q40A 3TRIA 4XVCA 3NBAA 4U2CA 3N86A 3M4ZA 2AUNA 4KN5A 1T8PA 4JSTA 3RC9A 2FLVA 4OHCA 1CRPA 4WKBA 1DT5A 3FMIA 4BO0A 1I5RA 1L5NA 5KVAA 2AJLI 4LYFA 4KLRA 2AS0A 2BGIA 3GJ8A 4WTOA 1ACLA 1X15A 1E6LA 1I4TD 5CYOA 2ORED 4AN1A 1PVVA 1G21A 3LU1A 4RPCA 1IJFA 5EZ5A 4YBZB 2YNMC 3AEUA 4ABYA 2GPSA 1J0DA 1F8UA 4EJSB 2O3QA 3DZFA 8GPBA 1BYIA 1CRZA 2BW0A 4RZUA 1TO6A 2X2FA 3CXUA 4A0GA 5FL3A 3GV8B 2D0OB 2RGWA 1DHTA 3KE9A 1D1SA 1EAMA 3I8SA 4FE7A 1O6BA 2EFGA 3MRTA 3ZE2B 1W36D 2M9MA 1DRWA 3QELA 4LBVA 4DRFA 4UHHA 4QM6A 1UAYA 1ZSYA 2G5TA 4XQCA 3UMJA 1Q1NA 1F12A 2BP7B 4V02A 1E9FA 4HJXA 4TL8A 3MR5A 1E63A 1TWCA 4TWZA 1LJLA 1P29A 4OK3A 4Q7QA 3DEIA 4MUIA 1PFKA 2FZVA 2NV6A 2DCMA 2IS6A 2O0JA 2XTJA 1VG0B 1LPPA 4NI5A 4QLOA 4NU8X 3TIXB 4QXOA 5T4HA 2CMGA 4MQLA 1KZHA 4PZ8A 1B0UA 3WWJA 1SG6A 3GDWA 3PUZA 3EXFB 2IIVA 4JT2A 3OA0A 5FWDA 4C6HA 2CJXA 1JEQA 2CXPA 3WGVA 5EIBC 5JYBA 2IHKA 1RWKA 3TI7A 4CMIA 4HEA1 3VO2A 1C8LA 4MUBA 2L0XA 2QEQA 1USVA 2YDXA 1H9CA 5EUMA 4RVNA 2G4CA 2BF4A 3I6BA 4HVTA 3QWAA 1T0IA 1RWPA 3UTCA 4F4YA 1FSFA 3LBAA 1K8RA 1P4HA 3RS0A 1XLTA 4IVPA 1ZGBA 5F9HA 4G5OA 1YBFA 4MUJA 3DE1X 1V4NA 4N7RA 2GMWA 4RHCA 4V0SA 1IN8A 1GPAA 4RYLA 2FFAA 5JCJA 3TBFA 4F9FA 2JEZA 1EHYA 5P8WA 3DC7A 3TOXA 4AECA 5BNIA 2XXAB 2JGNA 3GLGE 1YWGO 2M6RA 2QUIA 1ZU4A 1GFWA 1CC1S 1ST2A 1YS1X 3PXEA 4N3BA 2BQ3A 2GVDC 2NIPA 3RODA 4DPMA 3LCJA 2FF5A 2COKA 4PHFA 5E0OA 4MRMB 1I1LA 4GRIA 4I8DA 1WBDA 4GKKB 1TX4B 4MLDA 3Q3EA 1OLXA 3IQFA 4HQ0A 3LT0A 3EC7A 1SOMA 1Z3IX 4MUXA 2C2EA 5I8WA 3A28A 5IP7G 1KI6A 2QV7A 1NXTA 1M73E 2FLKA 2XWPA 1V16B 5L3SA 2YKGA 2ASJA 4OSOA 1TVKB 1KO7A 3GVPA 4RLQA 5CDFA 1OWMA 4K6OA 1JQLB 3W79A 4DPKA 5JATA 4J0CA 3WC4A 1M2HA 3I2GA 5LCXA 5LM3A 3KFXA 5KYWB 1W9MA 2L2QA 4QWDA 4EO7A 1N32H 3RVJA 5AW0A 4DJDC 2FK8A 2G9QA 2J0UA 2P35A 5C8YB 2CFIA 2EL7A 4HXFB 4XB1A 2GYWA 1JDVA 2HNBA 2JPDA 1Z25A 3OMXA 2OP1A 1Y5NA 10MHA 1VIYA 4JVSB 4JLUA 3CR8A 5L3QA 2V7PA 1YZGA 1HOTA 2QW0X 4H0NA 3RFXA 2WA1A 3CUYA 4F2WA 3T9AA 2Y9MB 3PW2A 3KG2A 4QULA 5ALNA 3BMNB 2MSCB 3TR6A 1NJFA 4UU7A 1YS2X 4M38A 2JFZA 2Y1WA 1WMSA 5F77A 3NRJA 2QRNA 3WMGA 3HC7A 2OAP1 5F3RA 2W5UA 2R8YA 3IQGX 4BNMA 4UXHA 1ES9A 4D4MA 4J9NA 1VRVA 5BWWA 1QWOA 4BV3A 4DEVA 3C3PA 3JWJA 2C96A 4BQEA 1QVVA 2IOHA 1SAYA 4DDMA 1UQRA 2YXPX 4P86A 3VOSA 3Q1LA 1GSAA 1K0UA 1NT2A 2W0SA 3A6EA 3CRQA 1JR3E 3G88A 4ZAYA 3STXA 1DIBA 3KTDA 4DHWA 5HZKA 2VHQA 3VNVA 3TEJA 3ASZA 5JPCA 1G21E 1W4AA 4LFAH 3DAGA 3HYNA 4JFAA 4B48A 4B3SB 4UCSA 1PZGA 4M0CA 1A9RA 4YHHB 3SWWA 2D74A 3M9MB 1CU1A 1Z0JA 4QUGA 3PG5A 3UMCA 1P9LA 5IAJA 2HNAA 3O90A 3C41J 1O5TA 2WMOB 3M4NA 3VPAA 5BWLA 1WCV1 3A1NA 5A9RA 4UVDA 4IIEA 3KETA 1K9SA 3VR6H 4BP9A 2WAMA 3ZZ1A 1QP4A 1JLMA 2OL4A 2PX5A 5E1OA 4W7IA 1RZRA 2GBGA 2IEBA 4C2MA 2YVQA 2IHZA 1WETA 1E3JA 4DB4A 5FPSA 1J56A 1L7XA 1V6CA 2ERYA 1VGRA 4CV1A 1OIVA 1R7RA 5CA1F 2QZ9A 3ED1A 1DINA 5EXSA 1EK2A 4KUHA 3W77A 3KYCB 2VTBB 3G7SA 3TZBA 5HW0A 1QRRA 1WKVA 4DR7H 1TU4A 2AFVA 1OH7A 3OU7A 1KPHA 5C5CA 4ER6A 2PQMA 1ZA1A 5F5NA 3WLQA 3RS7A 2AWNA 2C5EA 4QDTA 1G5HA 1SH7A 5DHAA 5E6RA 5GOTA 3VISA 4MIKA 3PR2B 3SVLA 1XCLA 3K3PA 1IFXA 4QLAA 4QU5A 4MYDA 3O95A 4AKEA 4PZAA 2E0IA 1R64A 4JLKA 4PO3X 3U3RA 3TCXB 2IKQA 3EMKA 3UMFA 5J2UF 2IU4A 1I2AA 3LDHA 1N9KA 2JLVA 2ZRNA 3KTAB 3N0TA 2CXNA 3UGKA 4IIDA 5KG5A 3FNFA 2WV9A 1HT0A 1I9GA 1L4KA 1XZQA 2GAJA 4OLBA 3AEQA 1JJAA 1CUFA 5CLHA 1TU3A 1ZJYA 2OORC 3DPIA 1EVJA 3EA0A 4MW6A 3QW4B 2C00A 1LBHA 4BMOB 3BCHA 2IL1A 4EB6A 1TNDA 4RLHA 1FUYB 4E7OA 2XYHA 5JZBA 2WSSD 4RTJA 3GG2A 5IEJA 3E1GA 5IT9A 5JS1A 1JHAA 4CIYA 1G98A 4CMDA 2O0MA 2BDTA 1KSJA 1OROA 3CJRA 5DI3A 2PHZA 4OG2A 4E11A 1E1KA 2PAAA 2R4TA 1G8KA 3KJEA 2CKDA 3Q87B 1LBEA 4J0KA 4NV3A 2O1XA 1AZWA 2EZ8A 5T64A 3UJDA 1J5EB 4XD2A 1SVIA 3UGTA 1SHLA 4RV5A 4MCHA 3PHHA 4A3SA 2CFCA 4BO7A 3ESXA 5KFYA 2FR0A 4IRUB 1XMVA 2OBMA 3O0TA 1OKKD 1RAHA 2QGZA 4WOPA 1SPBS 4K5QA 3V2GA 1NR7A 2I76A 4TYQA 1YJAA 1YJCA 2WWWA 1QG0A 1QO7A 4A15A 1DVRA 2I55A 4HDOB 1WPQA 1XRSB 1YMQA 2NO9A 3K2BA 2G9ZA 4QX6A 2Q8QA 3IEVA 2QPAA 5EXEA 4KLCA 4JLPA 1OLXB 2ZRBA 1ZW6A 2OWDA 2B4AA 1SUAA 4RAYA 4A1OA 4ZHSA 1N1DA 2QNRA 1UQTA 4I9UA 4A8PA 1MFZA 3FCCA 4BYGA 1ICIA 2PKXA 4BNGA 1RLUA 3HFGA 3GRAA 2PUFA 1R66A 3HBJA 1JL3A 2VP6A 5FI5A 1O89A 2GXQA 3DZKA 1H65A 3NTUA 3WLNA 4XIFA 3RGGA 2EARA 3F0TA 3OT5A 4KE8A 1H3FA 4QTUB 3ZV6A 1P5ZB 4INZA 3M5PA 3I64A 1I24A 5ADHA 1R4NB 4UBIA 3EC1A 4MQMA 1OXTA 2NO1A 4OBEA 5I3CA 1F6DA 1YV9A 1V3TA 1REQA 2UZ1B 4CDGA 3GLIA 3EULA 3ROQA 1E9RA 1TEHA 3MFIA 2AOUB 2RDMA 2Z9DA 2Y05A 4M1KA 5ERGB 2YC4C 4P7GA 3IUBA 5F2KA 2GQSA 2BFWA 1JAIA 3TH5A 4D0LB 2ALZA 4RDHA 4HH1A 1JPNA 3P9KA 4R2HA 5HM6A 4R7TA 3RRZA 2HD4A 3JCZA 1UDCA 5DN6D 3PVSA 3RBEA 5AESA 1XN1A 3SICE 4ZYVA 4NZMA 4JLMA 2GPWA 4GNRA 3BTVA 3MF4A 4QHYA 5D3QA 4ED1A 3RF7A 2HNKA 3ZNPA 2GXAA 5IJWA 2PUBA 1WDWB 1VB5A 3LX5A 1KUTA 3FZYA 3RT9A 5B4UA 3K70C 4BO8A 3HXLA 1IBKH 3ZXIA 2V3VA 2YOFA 5F1PA 2VQFB 3ZH9B 4NBWA 1RKVA 4JGGA 1GUZA 4OHYA 3QY9A 4K8RB 1YZQA 1CQWA 1VP9A 1X1DA 2R5NA 3C3JA 3CBGA 3PPYA 3PUWA 3DA8A 4ZVQA 3TX2A 1MXHA 3FI0A 1DAMA 1JHXA 3PUIA 1V8FA 3WHPA 5JNRA 4JU8A 4M9SA 4G81A 2FCAA 2P3OA 5SY6A 3PI6A 1XF9A 1V71A 2ZT8A 3PVXA 5C5DA 1JG1A 1AGPA 1GUYA 4OKSA 3S2FA 1O94C 3BZUA 2FXVA 1A0GA 4QWEA 1EVQA 4OI1A 1N0VC 3EEYA 3WIOA 1GZDA 1NVTA 2WLTA 4I1VA 4L28A 5ESDA 2GNOA 3AY6A 3GUVA 5AD1A 4DCTA 721PA 2I78A 3GXBA 2VHYA 5JZ9A 3N70A 2ZE6A 5KSZA 2XLBA 3C5VA 2V54A 3G0DA 4LF7H 1QYCA 2QN7A 3L5KA 4HXGA 1LZLA 3DHVA 3HYSA 2C7VA 3DKPA 4N01A 2X23A 5TQ0B 4H31A 2FEMA 5B6JA 3EOAI 4IG9A 3BWVA 5F5XA 4Z3OA 1QIEA 1DXOA 2XIQA 4GSKA 2JD2A 3COWA 2RH4A 1VMAA 2BKUA 4C0KA 2F1RA 1BD4A 4L07A 1PP4A 5CVCA 3SIXA 3JAKB 2FUNB 5A4AA 4V0MA 3ISJA 1X1EA 3WIEA 3WYBA 2LUOA 3THYA 2FUEA 3E35A 1ONBA 1UBTS 2HFKA 3VO8A 4JB0A 1EP2B 4KIUA 4TTVA 3KQPA 2B21A 1GA6A 3JSXA 4YRTA 5KC8A 3FRIA 3OI7A 3Q9SA 1AQLA 1JHUA 4X62H 1C4WA 2IVZA 3FCSB 4IJVA 4MS1B 3L8MA 4ZO7A 2HBZA 3PUJA 4JQCA 5EA2A 5ELMA 4QKQA 5KSWB 1XLUA 1IEQA 4OHFA 5DH9A 1T1IA 1I4DD 4WBSA 5BUSA 3AKYA 4JI0B 1K63A 4M1ZA 5FPRA 1EDOA 2CLMB 3C3WA 4XWAA 1RK5A 3ABRB 1XKXA 5EWGA 2QVLA 1CP2A 3MBOA 2IOQA 4NOLA 4XWYA 4L5AA 2J3HA 1Q0SA 4QQKA 5LC1A 4EB6B 2AG0A 4IW3B 4CLDA 2YS7A 5L4SA 3P2YA 1IZ7A 3T7JA 4LF8B 2Q9BA 1P1HA 5AHOA 5CA0A 5JNWA 4DIMA 2IX9A 4HYKA 3NTLA 1P2UA 4ARIA 3LQRA 3SOPA 4M8KA 2Y1LA 1PEAA 3D6MA 4NK5A 1I7SB 2JZCA 2XCPA 4KE7A 2HB6A 2XX3A 2OCIA 3CUTA 5JYCA 1QKIA 2NZ8A 3RG8A 5L7TA 3EG9B 5BW4A 1JFFA 1FJ2A 5LZ5A 4J94A 3U5TA 1VE9A 2NXJA 1PQ4A 4N9QA 1TKAA 3ZW7A 3AR6A 1CDDA 4Q15A 4MHOA 1OI7A 1SVLA 4TQUS 1LRKA 3E9ZA 3W9YA 4KVGA 4ETWA 4G5GA 1ZYUA 4OMUA 3KR2A 2R1VB 2VUTA 4ZFNA 2NTNA 4H7FA 5ALWA 1U3GA 4PLWA 3RVQA 2X8AA 5FOXA 1N3IA 1WLYA 3DCJA 2OYRA 1E18A 1NLFA 5FPOA 3GG9A 1IOWA 2B5VA 2JCBA 2ISCA 2IW3A 2Y1CA 2YQ5A 4RADA 5AK0A 4B2IA 1H4SA 5ITSA 2AD1A 2IEDA 2WNHA 3CLTD 4OSPA 3RR2A 3VNUA 2RHJA 3HA5A 1CJVC 3QF7A 1DE0A 5DW0A 3ZLTA 4R2XA 4WHMA 4EYKA 1V8OA 2ZI4A 2B8EA 3F98A 3H5WA 3JVEA 3TZLA 3N41B 4KU4A 3X44A 3DW3X 1A9QA 1L1EA 5HVNA 5L8VA 4Z53A 5I9TA 1H9BA 1I2KA 2R5WA 4U3JB 5JAOA 1LWNA 3KEGA 2G0AA 4MPRA 1E1YA 3MHPA 4QWWA 3FCXA 3KK0A 3VJKA 1Y7LA 3HYCA 5BN4A 3G2KA 2GJ8A 2XECA 5JS7A 2C7OA 4RK0A 2C84A 2HA3A 4RMIA 2Q6OA 4Y6GB 4JSRA 4Z3DA 5FAKA 4EKIA 1FBNA 2WWHA 1F48A 2CT8A 3MT9A 5HP4A 2DB3A 3LQQA 1KO8A 4AO6A 2IZ0A 3VYUB 2PKQO 4D79A 3IQHX 3T5GA 1PIWA 3DVQX 3Q88A 3WTCA 2XITA 3ROXA 4OQMA 3RTCA 3EWNA 4QATA 4DV3B 4QE3A 1GL6A 4V38A 4MINA 4IOJA 3K1AA 2R93A 4EBDA 2QTLA 2O8CA 2J9FB 4RVDA 1RYMA 4ND2A 1YONA 1DADA 5HCIA 4TRNA 1GNRA 4LFBH 1UIMA 3C7DB 4JEUA 1F17A 1W75A 3TLZA 4F3YA 5ALKA 1G6Q1 2Q4TA 5LMCA 1H8ED 5WRFA 1CJSA 4RPLA 2H5EA 2NU9B 1W85B 3ZCQA 3AG6A 1Z12A 2K87A 3QPAA 3KB8A 1L5VA 5F33A 2Q0SA 4IRMA 3E6AA 1KAGA 2XE7A 2VC2B 4R2WA 5LZ9A 4RKWA 4B3RB 2I65A 1Q0QA 2QRKA 3QU2A 3A6ZA 5FD8A 4X1YB 1Z7BA 4MH0R 4DC0A 1RIFA 2G67A 5D6OA 3PENA 2Q2OA 3BXEA 4MULA 4ETSA 2I7DA 2PTHA 2VCEA 5TGTA 2CFRA 2WI8A 3F3YA 5TQ0A 1GG5A 4HNRA 3VMMA 3WRYC 3T3EA 1FRVA 5JCOA 1E0KA 3RB3A 3D7SA 3KD2A 1IZ0A 1HNXH 4MYHA 3VNRA 4EKEA 3PRYA 1I32A 4IMRA 1I2DA 4L2IB 2G5CA 4LZWA 4AFNA 3KVRA 3STVA 5KYUB 5BQFA 4CEJB 4Y1EA 4N18A 1RYBA 3ZQJA 3I9FA 4LBZA 5HUJA 2QM8A 4X66B 4L6CA 4QA9A 1G16A 3U13A 2C22A 1F8GA 2XOKD 2HLDD 2PFGA 3K9GA 1TQHA 4ID3A 1CVIA 4WK4B 3DKVA 5L3VA 2ZIAA 1BQ4A 5FA8A 3S2SA 1WXQA 4B2PA 3C5WP 2VH2A 3KDSE 5HM8A 3P20A 3DAOA 3VR6D 2YJ4A 3AR2A 9LDBA 2X5XA 4CIAA 1UMDA 1UDWA 4TSFD 4GP7A 3JRNA 2Y0DA 4AC9A 5KOJB 3OEEA 1J20A 1RPAA 4DUZB 3JWEA 4K0RA 2ZXFA 1N6KA 4MS1A 1QHYA 1C7FA 1M9NA 1U3CA 1YRWA 1CDOA 2GVNA 2ODPA 2IODA 2EW8A 4N82A 2IJGX 3L82B 4UD6A 2Y92A 1Y1VA 2ZRLA 3CO5A 4KO4S 4LSZA 3MW8A 2ZOSA 1T6BY 3R3HA 4NLLA 4D8WA 3ER6A 4I2NA 4CTMA 4WUVA 4IJMA 1AE1A 4LZAA 1Z08A 3G5TA 1FC0A 4KEAA 2YW9A 3DE6X 1KK3A 4QICA 3PQFA 1A5SB 2GJAA 3K8ZA 3F73A 4CG3A 2C4HA 3W8EA 4QGGA 2YVLA 5AKGA 3P97A 2WUDA 1HQKA 4O3FA 3DR5A 5DGDA 4AX4A 3KQOA 1QCZA 2BM9A 5CX1B 4AS1A 3ROPA 4YASA 5I48A 1KS2A 2P4UA 1UBOS 2QMZA 2QXTA 2Z8ZA 3I5XA 4HAYA 2BKVA 4O82A 1HUQA 3MJ4A 2J9YB 1H5UA 5BWMA 4CT5A 1Y1RA 3L49A 4J7XA 1P2TA 3RPEA 3A4NA 4Y7CA 3RIXA 3G79A 3RVBA 2YXBA 1ZD2P 4CODB 3W90A 1P6UA 2VBFA 2QGFA 2YV2A 1RJQA 3EYYA 3JQFC 3P8ZA 2CB9A 5JXIA 2ZJFA 3G0OA 4TLMB 4KITB 4LF6H 4EHLA 5LD2C 3CSWA 4BMSA 5BMVF 3U49A 2R6R1 4REQA 4YRKA 1QQAA 5D5HA 5IRCD 1RMYA 1UK6A 2J8ZA 2NUAA 2H5LA 3BSFA 4X44A 1UK9A 5CT8A 5BSEA 1D4ZA 4QJIA 4AKHA 3R23A 3QOYA 1RLIA 5YASA 1IN6A 1P1KA 2AVNA 1JHOA 2FEWB 2YFHA 4MXDA 3U1VA 3NHBA 5JRZA 5E3HA 1CLEA 3OEYA 2I87A 1IUNA 3FUUA 3BQ9A 3KM0A 1OD6A 2C9MA 5TGDA 3IA2A 3SK0A 1T1GA 3HOZG 3O1HB 4JIGA 4UQPA 4WLOA 3M3HA 4FIZA 1Z36A 1PG2A 2Q7DA 3QVTA 3R3ZA 1W46A 4RMNA 5HCNA 3RSFA 2DP4E 3RYIB 3UJ7A 5KTYA 4DCNA 4V2UA 2E1RA 2J6UA 2ZRDA 4AM8A 4H6XA 4HRAA 5EYPA 1SHZA 3H11A 1GYPA 3GZNA 3QMMA 2DHDA 4WBNF 2YVAA 4OREX 4QL3A 4ECAA 3DOCA 4J9MA 3PE6A 1T9DA 2DG2A 3G6KA 3IA7A 1PS9A 4WFKA 5IC5A 5BSUA 1R12A 2R97A 4AQDA 2OKCA 4D3SA 1T9GS 3A6FA 2VO1A 1V7PC 4AO8A 3VR2A 4EY7A 1JZTA 2HDNB 2XJ4A 3A0RB 2XBLA 5A0FA 4EATA 1VKRA 1P0PA 1H2RS 2UUOA 3N0RA 4PZEA 4GT1A 4D45A 1Y1QA 4WZBA 2FPWA 1MKYA 5L7YA 1H2HA 3DLAA 4JZKA 4NHEA 4R3NA 2OC9A 1N2XA 1U28A 1MF7A 3HV0A 4YLGA 4LZPA 3V80A 4W63A 4BKQA 1RQRA 1Z37A 3DXXA 5JC8A 3CC8A 5E7IA 1JDPA 3P32A 4MIEA 2OLKA 2EQBA 3HDVA 2AN5A 5JMOA 4R3WA 1N77A 2CYCA 5DM0A 1Z0ZA 2WMNB 5A62A 2MOKA 3EEFA 1OLUA 4KCGA 1H0KA 4IDNA 1CR6A 4GH5A 4MS4B 5HKLA 1IATA 1YOBA 2BYTA 2YWGA 5DASA 1NSTA 2JG3A 2CUZA 3JALB 3P94A 4WLUA 2YWXA 1H2ZA 4AD8A 3T5KA 1CB7A 5KFDA 4G5XA 1G1AA 2AK3A 4I36A 1OI4A 3BA6A 5DYIA 3RYFB 3U4QA 3O31A 1FFGA 2EEZA 3EH2A 4CCYA 4LOHA 2ZS7A 3GJ4A 4R8MA 4TWJA 3RSOA 4Z4IA 3V97A 5EG5A 5D84A 4AK9A 5JR3A 2OB2A 5ILOA 1N0WA 2R1UA 4G4SP 4MAMA 4J03A 4B85A 4UHKA 4EPWA 4S1TA 4O7LA 3FOBA 5DT9A 4MX8A 4L8FA 4MICA 2HM7A 2Q5FA 4IIVA 5EOVA 5TPWA 1YVRA 2YV3A 1DPFA 1SWWA 2HA2A 1QPGA 1LF5A 2IOFA 2NZYA 3EARA 3NYIA 4JOSA 3GVCA 1VS0A 1T94A 1KY4A 1UPCA 3DYBA 4N0QA 4CL0A 1L5HB 5GVSA 2IPOA 5EQJB 3IUJA 4IGFA 5TXGA 3QV2A 5KYTA 4EITA 3H2IA 3JY6A 4JXXA 2HVQA 2ZQYA 2PANA 3ETGA 4C4ZA 3HCFA 1X7XB 3C5HA 3B13B 5KFSA 3FR8A 3O6VA 2OHHA 1Q1GA 1XQWA 4M7PA 1WCMA 1G8JA 3WK4A 1IUKA 3PEYA 1DWOA 4GR5A 5FOTA 4I99A 2JAWA 2RFLA 3LC1O 3JATB 1J24A 5ESRA 2ENUA 1CEYA 4CHIA 3FWKA 3PHIA 3C3XA 2E7ZA 4QPZA 3AFHA 3HJGA 1B4DA 1P7PA 1SC9A 2O2CA 4PCVA 2VUUA 3RU7A 4PFQA 3HXMA 4U7HA 3D7KA 2AQIA 3F7OA 1N2SA 4I1RA 4X45A 4ZVTA 2GHIA 2QTFA 1EG7A 2J32A 1US8B 3ZLVA 4UEWA 3FYSA 1I01A 2DC1A 2P1DA 4N7MA 5AI8A 1XTSA 4C7BA 4U1RA 4OY3A 5A06A 1Y82A 5CLJA 5L1KA 4ZEXA 3AERB 4RK7A 1MX9A 5D1PA 1ZRNA 1VBHA 4HQRA 1WMEA 2A6PA 2PKQP 3BWCA 5EJ5A 5CDHA 1GSIA 3I1FA 1E8MA 3IERA 2BFBB 4GVPA 4LKOA 3U39A 4BQOA 4L4RA 2KYRA 5DTQA 1U7HA 3PQ6A 5IKPA 1C41A 3A2MA 3MTEA 4QUHA 3LVFO 4MLZA 2VDLB 1WABA 1LPOA 1LDGA 3BHIA 3TY8A 1BRTA 1U3FA 2VSOA 3NXSA 3PITA 3QI7A 1MB4A 4EEXA 1HE5A 4ECSA 4E70A 4ZCMA 2WAOA 2DSTA 1MMFB 1WUIS 4MV4A 1E2GA 3BTOA 2E4AA 4FNMA 2PWZA 5A4KA 3N43B 1PWEA 4KE9A 1A0IA 1VGQA 3EZXA 5EP4A 1LLFA 4RANA 1UXGA 4Q24A 4MMYB 3W2TA 2CFMA 1ZZGA 1DIHA 4M7EA 2P7HA 4JYBA 1E6KA 2XDQA 3BAAA 3MRXA 3LOQA 4BEJA 5JI2E 2COGA 2D3WA 1RHRA 3HLYA 3O94A 3PPVA 5JJBA 3T5PA 1MD9A 1WD7A 4OB8A 3RSQA 2B3TA 1PGOA 2OCXA 1NOKA 3KALA 3OEWA 1BEUB 3DVAA 1Z88A 1U8CB 4Q1EA 2VHXA 1JF8A 3CX4A 4BHTA 1EFRA 2IYFA 1GFSA 1ESZA 5FUWA 1M8PA 3CEJA 2DGDA 1AM4D 4PYLA 2BFFA 1EP3B 2BFCB 5AKHA 3VDMA 1ZK3A 2QLFA 2HU7A 4LHSA 2Z08A 5EJGA 3BC1A 3IMFA 1J2TA 1GP2A 3NBZC 3HI4A 2G83A 3ITNA 4Q6WA 1UAGA 4IIBA 1ISSA 2I29A 2CXUA 2F4VH 1R18A 2JGLA 4EW6A 3LBHA 2HHFA 1U2GA 3Q8LA 1TAQA 2WSYB 4DVGA 5LIPA 1XQXA 3AUAA 1TW2A 4ZYLA 2ZUEA 2A57A 4FB4A 3AF4A 1DEKA 4HNAB 1I3KA 2QVCA 1VG9B 3OZ7A 3K4PA 2D1QA 2QUZA 4W7SA 1TL7C 2V7GA 2PSFA 2UZ4A 4S2EA 3WB2A 2AC4A 4MVJM 1XXHB 3I62A 2FJ0A 4PDBA 2HRBA 4LY6A 3I12A 1N2HA 2Y1OA 2AYZA 2Q3BA 3L7IA 3CEHA 3OEED 3DFKA 4J2OA 1G2QA 3MTQA 4FHCA 4QARA 3VSCA 1UFOA 1OV4A 3BB3A 2VT2A 2UV8A 1G20B 3VR6A 3VZDA 4R0VA 4F12A 1THZA 3EXEB 1DAOA 2P9YA 2J5BA 3K20A 1V3UA 4IIGA 4CGYA 2FPGB 4HDRB 3HO6A 2GI4A 3PQ4A 4TMZA 2D2XA 3I34X 3QPCA 4TXMA 2GB4A 4OLHA 2Q3MA 4BNFA 1XQYA 1NJ2A 4ZYYA 4CXMA 2ZTUA 2UVVA 3P9PA 4KFSA 1IM2A 3BAFA 3V5NA 5T5QA 4D42A 3HCNA 4JVNA 1WU7A 3FNQA 4JUCA 4BNTA 5KHOC 4XTRA 1K6EA 2HCRA 2GGSA 2W00A 3KXKA 2Q4DA 4GFDA 3PDHA 4F4IA 5JJIA 2JEIA 1MXFA 4DV7H 5U9CA 3QXJA 5B7NA 1Z75A 5I9LA 1BGXT 4OSEA 5K8CA 4B3RH 5C7LO 1W59A 2YUIA 3DMHA 4V24A 4EG6A 4EZIA 1JRLA 5H4HA 4ZV9A 5FPKA 3TW6A 1C50A 3EXG2 4HYEA 4MIOA 3IO5A 2HLHA 1NU8A 4EY5A 5KTNA 1GTVA 3RUPA 5CITA 2JLRA 1GARA 2BELA 3KQYA 3RW9A 1R8JA 3UFBA 4B0OA 1HFJA 3M2PA 1EBFA 4DZZA 1KTVA 1AK1A 5KVVA 3KPVA 3GFPA 1SXJB 4OPMA 4XPZA 2JFHA 2XXJA 4O86A 4Z9YA 5T6BA 4YLYA 3LF1A 2E89A 4U3JA 4DEXA 3UMYA 1XRJA 2ZJBA 4AY4A 5LYJB 2IYWA 2YY7A 2NU7B 3N05A 1J42A 3E05A 5FLYA 2G08A 5KFEA 5GONF 3UJ9A 4C0XA 1JR3A 1HZZC 3LA8A 4G0NA 3G9XA 2I99A 2YIJA 2NG1A 5T8KC 4Q82A 1ST3A 4IOKA 2IBTA 4QSMA 1T3GA 1Q2XA 2ERCA 5DZSA 1C3OA 2O07A 4WWHA 4EFDA 1U4SA 4Y9UA 3H0EA 5CT9A 4EGCB 4M60A 1MA0A 2CZCA 3RKRA 4WQMA 4AZ3A 1IXKA 5AI5A 4HDSA 5KAMA 4ECYA 4KAJA 4NXMB 3AESB 1E7MA 1GGKA 4UBOA 1V51A 4R6XA 2JAPA 5ALUA 2BQRA 1L3CA 2Q41A 4CC6A 2WF6A 4LJAA 4RS4A 3ZGNA 3ZV3A 3ZDXB 1KYWA 3E2PA 2HRDA 4MIYA 2DBRA 2I33A 3LUKA 2ZUWA 5REQA 1CUAA 2V7BA 2XGGA 3IKMB 2BVNA 2WIGA 5EHZA 2MWMA 2Z4SA 1L7QA 3PW5A 3E8MA 4QASA 1HT1E 4YCSA 3I5AA 5IN5A 4BE4A 2Q0HA 1XYYA 1XAGA 1C30A 3P2OA 2LD4A 2QRZA 3EZLA 1V9PA 3WKCA 1GCIA 1XMIA 4ZPXA 5K3DA 5EWMB 4PCLA 4H0CA 4CM7A 4WKOA 2YXEA 3UKDA 5K01A 1BS1A 3CTPA 4R8RA 4RD2A 4RTPA 3E9RA 4MUGA 1X7YB 3IKVA 1M5UA 3LDFA 3BXHA 1JB9A 1E9EA 3EOZA 4PQEA 3VTZA 4E30A 3AYZB 1QIKA 3FH0A 5I4KA 3NIFB 5E25A 4ZO4A 3DJFA 1YUMA 2WJHA 4ASUD 1TQDA 4CDMA 3DMRA 1TYZA 1MVNA 1M3SA 1LV8A 3HFRA 5FPQA 2ZREA 4XVHA 5CM0A 1Y1SA 3MB8A 1UKYA 2NSJA 3AU8A 1NL3A 2GF0A 1IL0A 4XM1A 5J1SB 4I9GA 1MR3F 2OUKA 1SK8A 1OFIA 1FTSA 5MGBA 1MQ8B 3L7NA 3DZBA 5TQ2B 2IK8A 4HPJB 1WMAA 4IOLA 4LEIA 4DL4A 2I34A 2H59A 4X92A 1DFHA 3B3QA 5ECDA 3KS9A 1D6JA 4NWIA 2YH2A 1HTTA 3KXIA 3KBBA 3SBOA 1SRQA 3EAFA 4DV4B 4L8WB 3V2HA 4YGYA 4GPEA 3QOWA 4XXHA 1XZKA 5DHFA 3L40A 3L0PA 2FMXA 5CYGA 2XE4A 3GEDA 3P0RA 2GZ3A 1JAXA 4X1KB 4KR7A 4GL4A 4RENA 1IU9A 4WLFA 1CE8B 2NUPB 1HQYE 2G07A 4G36A 4CZ2A 1QHHA 5HJEA 1EHIA 2Y99A 3LF2A 4IUDS 3ES9A 4ZYUA 3DBVO 3BH0A 5HNEA 1Y8AA 1RM4A 3RU3A 1BMTA 5ECYA 2Q29A 4Q9AA 4LJSA 1KXJA 1VI2A 1Z9BA 4CMCA 2WQ7A 1LS1A 5BSVA 4J0GA 4JJ7A 1SR8A 2PSEA 2WYHA 3N6XA 3FX2A 5DEIA 2IWRA 4PF1A 3FKIA 1AG9A 3GLTA 1DJOA 2O4UX 2DKFA 4GKVA 2QVGA 1C4OA 2XH8A 2FWIA 4Z0NA 2C2HA 2PA3A 2R6JA 3VVLA 1E98A 3IQXA 3H3XA 4A0QA 1UC9A 2IYSA 1C1XB 3AEKB 3SZRA 1WLSA 1U0LA 3BIXA 4JCOA 3MUOA 3T3HA 1RYNA 2BFDA 1T2DA 1Q44A 1QYDA 4Y2XA 3TZQA 3FCEA 2ZBRA 2DPIA 4KK3A 1C1DB 1E7SA 2J6BA 3GLIE 1FPQA 1LZKA 5F98A 3FG9A 3Q3VA 2P9BA 2IUUA 4BATA 2B4YA 3F90A 2AZXA 2JEJA 1IQRA 4NF2A 5EWJA 2PS0A 3JQDA 4EA6A 2F3SA 3QYJA 2XY4A 4CNQA 1V43A 3CGWA 2OAGA 4ALMA 3LT4A 3Q8RB 3DAAA 4G09A 2JLZA 3LY8A 4LYAA 1FLVA 1S8NA 4K9PA 2PUEA 1QRSA 3AM4A 3BJRA 1NE2A 1SQGA 1VKJA 3RAPR 1WUJS 2NU6A 5IAOA 1KEPA 5A5FA 3L01A 4LMRA 1N0HA 3W4KA 3WYNA 1Z4MA 1QJ4A 3L1KA 4UCUA 1A8HA 3BZWA 4A6XA 1ZM4A 4WCFC 5C4GB 1ZN9A 5E7JA 5DHRA 3TCKA 3ZE9A 4O2AF 3WGUA 2O2YA 2CNNA 2WP8J 2I9PA 1M2OA 1BMDA 3WSTA 5IJ9A 2OZVA 2E4UA 3E2MA 3RBVA 2OZLB 3OSZA 4EUNA 3IG0A 5CXQA 4LVUA 3WBJA 1FP2A 1JT2A 4QPJC 4D6XA 3OSNA 1QVAA 4CQLA 5KO2A 3B2NA 2ZEJA 2JASA 4PZYA 4RTSA 1KJIA 3ADOA 4TTSA 1QHGA 3PQ2A 3HB5X 3SZGA 5F5LA 2BL4A 3AI7A 2PXCA 4JJEA 3TGWA 4AJEA 3UJNA 2VSNA 5KNDD 1N3BA 1FE8A 1NVUQ 4HLUA 2WT9A 1B41A 1CUUA 1L7VC 4MWCA 4CKBB 2C4WA 2B94A 2DBZA 3K5IA 2IU6A 3N2KA 1UR5A 1ZIOA 3AR5A 3FYCA 4KVAA 2DU8A 1RLMA 1NN0A 4RSMA 1VFNA 1ZVJA 4X00A 1K1EA 4F4WA 1DB3A 2GWRA 3K1AB 3ZNNA 2Q4EA 3P0JA 1UBLS 3VGJA 1PT6A 4TL7A 3GIKA 2ZXEA 3BDVA 3FWNA 3JQ6A 1BXZA 2ZTSA 4PLGA 3BOSA 1NOJA 3BUSA 5MFPA 1TLTA 4MO9A 4GG1A 1K3UB 2FG7C 3U4IA 4MZXA 2C9BA 5EGSA 2QTAA 3ADPA 4HWTA 2EF1A 1AKQA 3ZDYB 3IALA 2PLAA 2C98A 4HN4B 1OLOA 1QIHA 5IT5A 1GKYA 1XPRA 2CJYA 1GRNA 3HLKA 2MINA 4J9KA 1R6BX 3A9WA 3HKDA 4Q4CA 4DCPA 3MIIA 1T6ZA 1T9BA 3ZJYA 4Z4QA 4YX9A 5C1BA 1ULHA 2O2DA 4YMSA 4AJLA 3REOA 5JYDA 4B75A 2XYPA 3VR2D 3KZOA 3GN1A 4LHWA 5CT5A 4IM7A 2D5AA 2NYUA 2X1HA 3TQSA 3WMEA 1IYDA 1RXUA 1SZDA 5JSZB 1NBMA 1PS8A 3KR9A 3G1WA 4NBUA 3WWDA 1TZ2A 3KQQA 1UMKA 4ISBA 3HVUA 4Y6SA 5BR8B 3DF9A 1W48A 4FS8A 5HZHA 4G0UA 1WW3A 1BW9A 2Y67A 4O2BB 3B78A 4ZT4A 1WU8A 3PHGA 3JQ9A 1L5RA 1NQ5A 3L7MA 4LJ5A 2QD4A 1MO5A 4JOCA 1Q3TA 1O6FA 3WHIA 1DDIA 3NO4A 3AEUB 5KJ6A 5CNJA 5I5EA 2IP1A 3H86A 2IDJA 2I2XB 4DJEC 2YWCA 3H3JA 2ATLA 5DCWA 3GLGB 2P6RA 4HH0A 2O8CB 1EFVA 4IDBA 4L7QA 2PKEA 3W34A 2V9PA 3IVRA 2ZK7A 4LZOA 3FWPA 5COBA 3QKRA 2D62A 4I4TA 3S3TA 1RJ9B 5IKEA 2ASEA 5KAPA 2O8VA 3B51X 3N8NA 1XELA 4DDHA 3QVVA 3K6SB 4EAAA 1GUFA 2O2EA 2OBBA 3DWFA 4UC0A 4BQPA 4RSGA 1SKUA 3GA5A 1T1SA 4QRIA 4EYSA 1H2BA 1W5EA 4QQRA 4QBGB 4EHKA 2D4HA 3JQAA 4WGFA 2NP6A 3EDQA 4XCQA 1RZ3A 3PGXA 5BNZA 2VHEA 2VP2A 1QVZA 5FNVA 3BXPA 4L4ZA 3ZWBA 4ADSG 5DOZA 3ER8A 3UWSA 3GUUA 4WJZA 4ED7A 2O3UA 2R8XA 2BDUA 3G0BA 4MR8A 4DMRA 2RAPA 1TM4E 1IUOA 4LPKA 4Q6BA 1SQ0A 2OBNA 5G3ZA 4ZVOA 4LFBB 2C2XA 3F6RA 1X2BA 1ZJJA 2AZTA 5G0UA 1OLSA 2WJPA 1FVOA 1NNI1 3V8RA 3E1KA 3AFGA 4ZZIA 3A7EA 2GSDA 3OM8A 2QROA 3GVHA 5FKJA 1HYHA 2NXWA 1V41E 3N2YA 4QOGA 1JPUA 4E6PA 4DCSA 2VDNB 3C8UA 3R4VA 4RF4A 4X61A 4QYTA 4AUEA 1YTLA 3QY0A 3EPLA 5CYFA 1E3MA 4AUKA 3VDQA 2P4QA 3FPSA 5C1DA 4KP7A 4ND1A 3SF0A 2BI8A 2DETA 4JI8B 1O0BA 2QX6A 3V4OA 3HCRA 3II6X 3RADC 4H18A 1V35A 4KSBA 2BH9A 4DMKA 3N0XA 2OBFA 1KDOA 4EZEA 1KI6B 1WIWA 3OJCA 5CE8A 2VH5R 3HH8A 1AN7A 3W6UA 5DBEX 2XBUA 4L8VA 1HYEA 3C5CA 2AIRA 5FWYA 4ZOQI 5TS2A 3KHGA 4CQLB 3C8HA 4LQLA 1F5NA 3F97A 2QAGC 1WNTA 1N5RA 2PZGA 2RGUA 3R77A 4KACA 4YJKA 4Q4JA 3T15A 4EUFA 2D54A 2AE2A 1DIRA 4RY9A 1ISIA 2OPHA 1L5GB 3RB4A 3K0CC 2ARKA 3WJAA 1L4EA 4UW9A 5TIIA 3H83A 1H6DA 4WERA 1OZAA 4QTTB 1RLJA 3WB1A 3O1IC 1ISJA 1BGVA 2H4WA 4G86A 4JCCA 3E15A 3R5HA 5FT9A 3OQBA 1CZKA 1GZHB 1OAAA 2OGWA 4RFSA 3W8RA 3LHFA 2LVBA 4ZK6A 5EJEA 3B7WA 5K0TA 1NPTO 2AH5A 4IF6A 4TWAA 4H35A 5HX7A 2AD5A 4Q9DA 2WUWE 2VK1A 3R0XA 3TQCA 4KI0A 1ZMXA 5FOUA 3JSNA 4IIYA 4YC7A 3JQEA 4ARCA 2QRUA 1N36B 3W5SA 3PIDA 4BXXG 5DQIA 1VC2A 3ZE8A 1X7WA 4LFCH 2C7QA 1LI4A 1JLLA 1R4MB 1BDMA 4REQB 1D3AA 2OHJA 3WWIA 1FFBA 3IEKA 2W8BB 1TB4A 2F6RA 1LGYA 4HZGA 4UDXX 5GZ6A 1M5RA 1ZUIA 2BR5A 4IX1A 3K71B 1RQPA 2GETA 2JRCA 1ECCA 2ROQA 1CP3A 2DPJA 2W93A 5EZYF 2ZIEA 1J8QA 4OI4A 4WK0B 1IBKB 1DGQA 1MZPA 1KIFA 3BAZA 2IQIA 3CZ4A 3C1AA 4K1LA 4RU1A 4HWPA 5E95A 4F4UA 1EWKA 1Y5RA 2AJBA 2FZCA 4KXNA 1L8AA 2CXSA 4PEVA 1NW6A 4ZV7A 4PN3A 3U4QB 2P9CA 3AIOA 4CQMD 1Z16A 1DIOB 2WYUA 4KZPA 3KV3O 3FPHA 3T38A 2ZIVB 4ZT2A 5KZMB 2IBKA 1M7BA 3FI9A 3X1DA 4QWMA 3SIPA 1NXXA 2OP0A 2E1PA 2FX5A 1QS0B 5DV9A 2PU5A 1M34B 3TFOA 2I3BA 2C92A 2BWJA 5FL7D 2CLLB 4MQFB 2WU8A 5B3KA 1Y3HA 3TKYA 4UAUA 4IH4A 4ND3A 4AJPA 4CCWA 4FZ5A 1T24A 3F46A 5BWXA 5HK9A 3OTIA 3WBKA 5I6DA 5JS2A 3BL6A 4ESHA 5L95A 4WXMA 1GQFA 3FWHA 2FA9A 3BXFA 4J0FA 1PJRA 1J39A 4PQRA 1FNCA 4NL4H 2YMQA 5DFAA 3RS3A 4CLRA 4RVUA 3WL8A 2FU5C 5C7IO 3AF0A 3PNBA 3AJ9A 2NACA 3OHMA 4AMUA 5BSWA 4MMZB 5FEUA 5KU7A 1YB2A 1ACMA 3KLBA 3KQSA 3X1KA 2FOIA 1COWD 1XRRA 4FGWA 4UD2A 3UM9A 1FVFA 3ABIA 1RRGA 4D9BA 1JEQB 2ZSKA 2OV3A 3A3NA 3A7DA 1XEFA 3GWZA 2GDJA 1FRZA 1G59A 1CRLA 2AXPA 4MR9B 1ZOOA 4JHXA 4X65H 4MW4A 1P4GA 2V5AA 1DC8A 2W98A 3EVAA 4DQLA 1LDYA 7MDHA 1CNMA 2HXGA 3AEQB 4BLSA 1QTQA 4DR4H 2YVKA 5HKAA 4I0WB 5DIFA 3LK6A 1PW5A 1CQJB 1EVEA 4FM9A 1D2MA 1N6HA 1E4GT 4U00A 2L18A 3EIEA 2AK2A 3KKLA 3QEKA 4K46A 4OXNA 2I3AA 4C08A 1ZAYA 1QANA 4L5BA 1V26A 2H4JA 5BWBA 3QOXA 5EIBD 1JALA 2O20A 2O57A 4GYYA 1T2EA 2FW9A 4U6PA 2VDKB 1KY3A 3DM5A 4ZI7B 3CTMA 3W5IA 1AH2A 4E2ZA 1IN1A 3S55A 4CT0A 3IT2A 5BT9A 3Q6IA 2IYRA 2JANA 3C24A 3A8TA 3VPHA 2HGSA 3ILYA 4U9IS 3BWXA 4KV7A 2H7VA 3NB0A 3SQXA 2QY6A 1L5ZA 2ACVA 3VNQA 4I1YA 3OMWA 5CNKA 5BR8H 2AE1A 2ZUTA 2AEMA 1GYRA 4RIGA 1COZA 3N44B 3W5JA 3F9RA 4CM8B 4IGEA 3D8UA 1YI0A 1G8SA 5DBGA 4QSHA 4UTZA 3KYDA 1PJBA 5KYWA 2ZRPA 4JSYA 1YIDA 5IVDA 4MB6A 4PVCA 1DQPA 3GEHA 3T3NA 1T91A 5FHQA 3G6WA 1ZH6A 1Q50A 3WGKA 1IHDA 1PG0A 4NQRA 3IIMA 4UEOA 5M3BA 2M6KA 5CW1A 4CLHA 1XF1A 4Y6LA 2G9VA 1MGPA 2NSDA 2HJRA 3NVDA 5G0TA 5AFSA 4H7IA 2C4NA 1CQIB 1PV2A 3ORFA 1TEXA 5DXJA 3UAWA 4FGLA 3VC1A 5LSAA 3PO3G 1D07A 2X0FA 2P4EA 3H1EA 2FRDA 1DC5A 4XIIA 4D9MA 1X86B 4M83A 1K0FA 5AI0A 1KYTA 4TRJA 4BUJA 4G1CA 1U2ZA 4RFSB 2NTVA 3N2GA 1SA0B 4FYJA 1BQ3A 1YVEI 4A3FG 4F4HA 1EFKA 2WTFA 1S9HA 3NT5A 3HQ4O 3SGIA 2RGVA 1OWNA 2FUCA 1HXHA 4JQSA 2B1RA 3MCVA 3PPIA 4CKWB 2WG0A 3ILXA 1X7WB 4DRXB 4AI6A 3AJDA 3GPDG 4BGDA 3QWUA 1IDOA 1IWPB 1J33A 3IRUA 3P2MA 5LJLA 3OZXA 4GKAA 1GL3A 3ZZMA 4E33A 1BEZA 1E2DA 3DBLB 3EUEA 4L9WA 2Y1FA 4N65A 2NVYA 4BWVA 4C0JA 1OVGA 4G67A 4O3PA 4LXUA 2C2ZA 5ED0A 3OTHA 3HDYA 3Q2KA 3OFND 3HOWG 2FPGA 4NDZA 3WICA 5DGXA 1SZJG 5BOSB 3I5MA 3AEKA 4QZVA 2I03A 4XB6B 4YEDA 5C51B 1PTJA 8ADHA 3OZWA 3DHWC 2H1RA 2HSWA 1CNFA 2VDVE 3L0CA 4Q4DA 1K7XB 1YK0A 3DPUA 4EG1A 3FDIA 4YO7A 4OQDA 1KY5A 1JQBA 3DO5A 4LF4B 3QMVA 3JARB 2XMRA 4LXIA 2W2LA 4MQFA 2XQIA 4REMA 4Y2YA 5IT9W 1GADO 1S1MA 4YQWA 2G88A 2HHAA 3IXLA 1E9AA 3K0EA 3K9LA 2JA5G 4H7EA 5LLTA 3KHSA 2OQRA 3BSSA 1E1QA 1RI2A 3BHNA 4OEHA 5CVJA 3UQZA 3VU3A 1P5JA 3CG0A 4YRCA 5HZMA 4JDUA 3QEBZ 1M34E 1RXIA 3SSMA 3TL2A 3E7XA 1CR1A 5JHGB 5F7XA 1M2FA 2GEJA 2OOSA 4FB5A 1MIOA 3HKZE 4MKIA 4QXQA 3MD9A 3R44A 3OTOB 4FCCA 5K0JA 1IAQA 1TWGA 4V2IA 3D81A 3G2NA 3MC1A 2FPKA 2HHCA 1XXHA 2ODBA 3D6HA 3ADDA 1H85A 2XF2A 2HV8A 3AH8A 2H8GA 4X66H 2IZ6A 1VIMA 5G4KB 4LBWA 3I4LA 2C94A 4Y2SA 4YUVA 4B3XA 4AXBA 4BVHA 1O95D 1M2WA 1KKMA 1ZISA 3D54D 2ZBFA 1A2KC 1X1BA 1SBYA 3DM9B 3LWZA 4TWIA 4DN6A 4DDVA 3MLAA 2VEDA 4PZ0A 3PW4A 1NKVA 2UU9H 3NUQA 5GV7A 3X43A 2PSJA 4M3NA 5CA1A 1E96A 2NXCA 4N49A 1CLUA 3FA2A 3HABA 3DMTC 3X1WA 4D8YA 2PIAA 3BORA 2IHBA 3VV2A 4C0QC 2B35A 2CEAA 4DG5A 3E8SA 1L8OA 1BCRB 1M7HA 1UF9A 3LQ1A 4Z3KA 2XCQA 3KHKA 4GU5A 2ET6A 3FTPA 3TE6A 5F21A 4DLZA 1FFHA 1OOEA 4UPEA 5KG3A 2UU9B 1BJTA 2DQKA 1NVAA 1I13A 3AESA 3T7AA 1J07A 2GAIA 1TF5A 4CIVA 1V6AA 1T4MA 2VP0A 4JMLA 1N57A 1O96A 2BRUC 2XVXA 3HJBA 4TV9B 3TSCA 3T9EA 5AH0A 7MHTA 3NBZB 3RVSA 2IF2A 4BV2A 1GL9B 2YWHA 3M5DA 4CEHB 4C30A 1ESMA 1XNHA 4E31A 3R74A 2IYVA 3BRCA 4AJNA 1QX4A 2H51A 3A9TA 2X8WA 2IIPA 3QNWA 3DOIA 1PJAA 3LDGA 3GEMA 4HDQB 5CFRA 5JMPA 1UJNA 5KINB 2P2ZA 2P9EA 4CKCB 1HDRA 1PDWA 3S27A 2V58A 3EFHA 2P65A 1Z29A 4PLCA 1Q6YA 4RCZA 1E2EA 3RSGA 5AVRA 3NDRA 4TVOA 3CUVA 5THKA 1OWOA 4ZJPA 3KQHA 2JBHA 1G18A 1MEJA 4KPUA 1L7DA 2EFDB 4INOA 1G19A 1BVRA 1IJKA 1GPYA 3FTNA 3DVSX 1HEYA 1C9DB 1DXYA 1OYOA 2BN4A 2CVPA 2FN3A 1KO1A 1M0EA 1FLNA 3P9XA 2VXCA 1NVBA 2EU8A 4YQEA 5J3JA 3M6AA 1SYXB 3LC2O 3N0VA 1QF6A 3E9NA 3KAPA 1TZMA 5IF3A 2JJ2D 3EMDA 4AP9A 4EVSA 1QV9A 2PH1A 4Q4HB 3LRXA 1JQKA 4NEQA 3MQFA 2NVWA 3ZKAA 2ZB8A 4QDKA 1YA8A 1VE3A 4ID9A 7YASA 1PE0A 1W30A 2JIRA 3V3TA 1LK5A 2B4RO 2OVFA 2XT0A 3OQVA 4X5OA 3RUCA 2JIBA 4DDKA 3UB4A 1UT5A 2CCJA 2R25B 4QIWE 2XCIA 4PW0A 4C05A 3WLHA 4EARA 2ATCA 4EWLA 1AGXA 2CNWA 2BBTA 1UFQA 1DRUA 1JXMA 1QK4A 2FDXA 2K2QB 2MSKA 2ILVA 2VBIA 2HQ1A 3DQPA 4YROA 3BWDD 4UUBA 4H7HA 3REFA 3SP1A 1NFRA 1ICEA 1L4YA 2BJVA 2HJWA 2NSYA 3G8BA 3K32A 3SQWA 3ASYA 3IVGA 1CRQA 4CUZA 2ZTLA 4DREA 2R66A 3LP5A 1C30B 2NO6A 1E60A 1MO2A 5JSYA 3T06B 2OXEA 1QIJA 2PX0A 2XD9A 2WIFA 3M9WA 1BG6A 2AQ8A 2G80A 2Q0XA 4RX1A 1N4AA 4BLWA 4DC1A 5CFPA 1W93A 4IHAA 3QLJA 4QUDA 4EI7A 3K9FC 2PL3A 3JYQA 1RJFA 2ON6A 2KX7A 4TMTA 4LK2A 1VPLA 5JWHA 1DCMA 3CNQS 1UC5B 4QW9A 1IY2A 5CAEA 2W2OA 3X1JA 4UEQA 3BK1A 4YLEA 1O94A 4ZGWA 3ZY2A 3FUVA 3U02A 4YT8A 3PUYA 3RYFA 3S29A 3ZHYA 2JKVA 4JI2B 5A7HA 5AW5A 2G1KA 2ZRKA 1SVSA 3KUXA 3CNBA 2QRGA 1ZVQA 4FHZA 4GWGA 4B47A 3UBMA 5JPDA 1AB6A 3RC7A 3LY7A 4EYOA 3HJFA 4OJYA 3GLQA 4C3VA 2VJMB 2JBAB 2O0LA 4GMFA 4NNOA 3T12A 3A1UA 5JIBA 4RJLA 3NAZA 5BYJA 2CL5A 7AT1A 5LMUB 3ZKWB 1PGPA 3EGXA 5DBIA 3NHAA 3DULA 3PNLA 3EW9A 1T3NA 2RCNA 1GYFA 4IMIB 3ACDA 4N8DA 4YRZA 1N5IA 2Q46A 2UZIR 5HWSA 1XZPA 1EAYA 3CWQA 2HK6A 4E4YA 1AGRA 1V1MB 4B44A 2Q21A 4XUDA 4HUJA 3TK1A 1Z4OA 2X22A 1RCTE 3ICWA 1BKSB 3EBOA 3K15A 1G7CA 1Z07A 3WLFA 3JATA 4NQZA 2FZLA 4RY0A 1K8XB 3GGPA 5IULC 5LYJF 4K2AA 4Q3EA 3CUWA 4O0LA 4F6LA 5AXAA 1YS7A 4F85A 3T8YA 2WHRA 3BD6A 3F7MA 1MHTA 1Q3KA 5J58A 3FZQA 1XRLA 2PS9A 4ZMRA 5KNBD 1IMJA 1NFQA 4BKOA 2B20A 1JDJA 2WVHA 3NR2A 4HAOA 5EKUA 4RUCA 1C9NA 4CM9D 4A8TA 4JB8A 3K5PA 2R68A 2MR6A 1CD5A 4D9IA 3NU1A 3FSJX 3D0RA 5DP1A 3LYLA 4M0PA 5AOVA 4A3KG 2FSGA 2J3EA 2ETVA 2OMEA 3C1UA 1GNPA 1WB5A 4G9EA 1PFUA 1ZXXA 3E3AA 3TTVA 1SEIA 2QTNA 3FKJA 5ISMA 2FSVA 1YIOA 1U0TA 2JLQA 3CG4A 3NFRA 1E1LA 5JCJD 5A6VA 1DBQA 2VWGA 3DCNA 1T5HX 4Q05A 3W1BA 2HA4A 2P1ZA 4KWTA 5I47A 1VE7A 3DOOA 4TKMA 1PUXA 4N0DA 4H6VA 2QQ0A 4RPJA 1QH1A 1GAWA 4QXPA 2VPPA 4P4LA 2GILA 4MVJG 3W8NA 4GQIA 3RRNA 5FR2A 3O4IA 2FG6C 3PCTA 3HBMA 3LGXA 3WO0A 3QXGA 2DPMA 2WTEA 1F38A 3LRTA 4KYVA 3ZWOA 5J4KA 1SB8A 1PQWA 1UK8A 3DDUA 2YNMD 3LLMA 2ECOA 1SU7A 4FOPA 2JGEA 2XA1A 4ZI7A 3HACA 5MF6A 3AR7A 2AI1A 2FZ4A 2QLNA 2HGXA 1TT7A 4JJGA 3WWEA 1M8KA 3HGTA 4ZHQA 5A3QA 4GLFA 1TZCA 1VSBA 4GP9A 1UAAA 1VIVA 1B23P 3PHLA 4MWOA 3GRRA 1VSQA 1SOAA 1TJNA 2X13A 3C8ZA 2OECA 3EPGA 1R9MA 1S2NA 4P3KA 4BO3A 3O9ZA 4MS3A 2QTTA 3HKDB 1TAUA 1RHMA 2GCPA 3TVDA 1HETA 3WK7A 1ADFA 4RIHA 3D7LA 2C35B 4WW0A 3T9BA 4HNTA 3SHQA 1SQ6A 2YJZA 3BSWA 4BPBA 4O3MA 5KFVA 1U1EA 2RCYA 3U9LA 1FLAA 4L0DA 4DV1H 1MC5A 4YAWA 3UZOA 4Q4HA 3UKOA 3KWFA 2CK3A 3V34A 2JI7A 3FNBA 4FFRA 1EJ2A 4HLUC 4RAOA 1HMYA 1GSOA 1YDEA 1Z26A 2XVMA 5CVDA 3TUIC 2CMHA 2ZXUA 5FF9A 2W70A 1C0EA 1TA4A 4IDEA 3BXXA 3E5NA 4MGIR 3STTA 2CFTA 1XVIA 4W6QA 4C78A 2ALJA 4IXMA 4DM7A 5IF9A 4L08A 4OHRA 3KXYT 1XGKA 1A3GA 1VJGA 2FB9A 2BD0A 3N58A 4TLAA 1QM5A 3N07A 1E2MA 3DF7A 1WUKS 2HXYA 4LJKA 4MKGA 4Z0HO 1V7QA 1NVGA 3MUFA 5CJJA 2NTYC 1KEUA 4PZZA 3RUHA 4HZUB 3VR5H 3U6KA 1QRTA 4F5DA 1S2GA 4BGIA 2EV9A 4NNPA 4L8GA 3VU9B 5DSXA 2F48A 4QBFA 1A9PA 2OQVA 2BM8A 3KELA 1CUGA 1ZM9A 4IIUA 5K9ZA 4IVNA 3F6PA 3EPHA 4ZWNA 4EGSA 4OO3A 4UNNA 3WY9A 1JHYA 2AW3A 4L3OA 2W4QA 3ESZA 1C7QA 3SMVA 3ZLJA 4C2BA 3OT1B 1VE6A 1AXEA 2PLRA 4Z5XA 2C2YA 4B5KA 3SQMA 3PS9A 4YPFA 5H68A 4DCUA 1UMBB 3OKPA 3HUFA 1CT9A 3RC8A 2W6ID 1M1YE 1UT6A 4AG6A 1F5SA 4ESOA 1Z6GA 1W0KD 4N47A 3LGAA 4QVIA 1KGSA 4L3WA 1P2SA 4XX1A 4AKIA 2QD5A 3DMGA 1EHCA 2H6EA 3W3AD 2RC6A 1MH1A 2CZQA 4WN9B 3TIFA 2A84A 1K7CA 1J70A 2BHSA 2G1JA 2GN4A 4H77A 1K68A 2WILA 2J6TA 5KSYA 5A04A 1ZX1A 4IMPA 4R16A 5ALGA 1KZ4A 5K3CA 2BJHA 1P9OA 1T8YA 2V1XA 2W43A 4FYKA 4XJVA 1SK9A 5EVJA 4ER0A 4KPEC 1P6XA 3W5DA 5AM1A 5EP3A 5K3FB 3TD2A 2QOEA 2P0EA 3C6QA 2HLPA 2YWDA 3KPYA 3IELA 2QORA 5JAPA 1SCJA 4Q34A 5K3WA 1NZFA 3NWEA 4NPCA 3GFTA 3NAQA 1Q57A 4FEEA 3PFCA 1IIBA 2I6TA 3U9SA 5E8RA 5G1PA 1WCXA 4BN4A 3NBQA 4MV7A 4PC6A 4M9XA 2RBKA 4DR2H 1QCDA 1TQ4A 2ZJ2A 1Y9DA 4WT7A 2XT9A 4CKYA 4CVNA 2LV8A 2QLMA 4J0MA 1GQRA 3IILA 4F8JA 4AXXA 2IH4A 3TOVA 1KP2A 1E1MA 3CRVA 3ZHUA 1K1QA 1EEXB 4A4DA 1RBMA 1X80A 2FEOA 2CXRA 2JFYA 3LC7O 4PBTA 1Q19A 3S40A 4TTRA 5A02A 3F5DA 1HM5A 1E8DA 5CEJA 3RFTA 3EGEA 4I3FA 2ZBGA 4LV6A 4PQFA 3SKXA 2ABWA 1L4LA 3MGGA 2QN6A 1P19A 4XGIA 1NA5A 2BRUA 4I4LA 3CX7A 1XK6A 2YHSA 4CEIA 1DO0A 2C9YA 2YWEA 4WD3A 3AOGA 3TSOA 2HLNA 3K0FA 3I8XA 1NUHA 4ZN6A 5GWXA 2GEUA 4P0QB 4B3TH 3L4KA 4FHFA 3V00A 2P8JA 3E9YA 3PNKA 4ZGBA 1NQTA 3DZHA 3VR4D 2X6QA 2E5FA 2HMAA 1VRCA 1I1OA 1KS9A 3HP1A 4E4TA 4RH3A 4CTJA 2HMUA 1CSEE 2JA6G 1M8FA 2YQZA 1VPDA 2CLDX 4WDRA 2H00A 4TLCA 3CFYA 3ANLA 2IA6A 1TFUA 1IK6A 2R2AA 2X0EA 4QVKA 2D2IA 2J3IA 3MMZA 3VHQA 3ZE0B 1NBHA 1N2IA 1L7OA 3YASA 4I1SA 3WNCA 3B12A 2QZZA 5BW5A 3JZMA 1EDBA 2V6FA 5F4ZA 2V0CA 1PVDA 2GPNA 4ZEOA 2ZR7A 1TPYA 3FUXA 3SAJA 4BQIA 4EX6A 4G0VA 1YJXA 2H1SA 3UG7A 1B6GA 1QRAA 2C2GA 1MX3A 1NDQA 3CVWA 4MHTA 3M6WA 1LFAA 2W48A 3FMVA 4ZQCB 3L8DA 1EB9A 4II7A 2D0IA 3J81W 1JJBA 3F5SA 4RNMA 2VFAA 3EWIA 1VTKA 4Z7QB 1A48A 2HSDA 4IS3A 5EMKA 4EUEA 2PWPA 5KWIA 3HOVG 4QYWA 2VRBA 1DAEA 2YRWA 1C0PA 3DQZA 2KBFA 2X0NA 3NPMA 3EFOB 5IASA 2BE9A 4Q9JA 2WHPB 1KWKA 1DQRA 2GXUA 2LP4Y 5IUKC 4HWOA 2F00A 3K8OE 3EFBA 3HM2A 3IOBA 4OQ4A 3TLXA 1WCIA 3C4VA 4GICA 1TF7A 1SJ9A 2FJUA 2VI5A 3C7CB 4UREA 1CUSA 2HTEA 4ZREA 2AI2A 1I2BA 1GILA 5D5QA 2JI6A 1W0CA 1HL3A 3GGGA 4PQGA 1XDSA 2CKZB 2HH9A 4GD3Q 4U7WA 2ZZKA 1XN4A 3GJRA 1Y89A 4YAKA 3GFSA 3K9QO 4Y98A 4DMGA 4OH1A 3VYWA 2ETXA 3PYXA 5B53A 1YC2A 3R7NA 4D6YA 3NNSA 1EVZA 3EXHA 4KIFA 3UWPA 1ZCFA 5JFTA 1EFCA 3I6YA 1K8YB 2LE0A 4IDFA 5BPHA 3ESAA 4I5FA 1CR2A 4X1KA 3G6VA 5I9MA 4B0PA 5HYVA 2FWAA 1SXHA 3U4MA 2AGVA 1F4LA 2HY7A 3MOIA 4HQNA 4MA0A 2WG1A 3F49S 3HRKA 5H3HA 3MWKA 1Q6ZA 3NCHA 4B83A 5BWCA 2JLXA 3BWYA 421PA 3RI3A 3GLVA 4MLPA 4FSDA 3RCBA 3VZCA 4E4RA 1RJGA 2X5KO 2ZE8A 3UB3A 1VPWA 2DABA 2PV7A 4RH0A 2ZJAA 2J6HA 3MEQA 4J0DA 4WY5A 3V7WA 2IDMA 2IP2A 4MW7A 4ECVA 2XB6A 3NTXA 3RASA 3GH3A 4WFIA 4ZYTA 3RD5A 1RAGA 1FUUA 4KLNA 1MVOA 4XGKA 3UT6A 4ATNA 5CMLA 5FJIA 4A8JA 4DLWA 1JEYA 2PN1A 3DR3A 3GCDA 3MIZA 3LOPA 4BKPA 4EBFA 3G8AA 1FFDA 1Q17A 2WWTA 1J8DA 3OQHA 5AKIA 2OCDA 4F3KA 1W4ZA 1LBIA 1XZCA 3B1ZA 5EIAA 4BZQA 2FSVC 2I6FA 4MGZR 4EI8A 3R2JA 3P9YA 2G9RA 5FLKA 3D8HA 5CFZA 1Y4AE 3L06A 4RK4A 3HYRA 1D2NA 1Y3CE 3HB7A 2AUMA 3QFHA 2JLYA 2FXIA 1PZEA 3E9CA 1BKYA 1VA5A 1L5HA 3DS8A 3GT4A 3RSZA 4B8ZA 5ALFA 1T5LA 3N2IA 4FGKA 1W96A 3RWOA 4F2DA 3BA1A 1QKJA 1XWIA 4BC0A 3R9XA 3A14A 4ZPJA 1J21A 1M6HA 2EKQA 1DG1G 1WL8A 3NEYA 3HFJA 3V4ZA 4KKVA 3ZY3A 3ZXSA 3D1LA 2V9WA 2ZSIA 2WE6A 1B00A 5M5BA 1U9JA 1XFAA 5DTMA 4E2FA 4WY2A 5L4NA 1TEVA 1DOZA 1JVBA 3X1XA 1OI2A 3QX7A 2CLHB 3R3WA 5A5GA 4BNIA 3M9LA 2FK7A 1SZCA 4BZPA 1VG8A 1R27A 3PKJA 5AHKA 3K73O 2X8LA 1QCYA 4B4OA 4HVLA 1A7JA 3TQQA 2DHCA 4DNPA 2O7QA 2BFMA 3CLTC 1BXRB 1RWQA 3D3NA 3D8RA 3QYAA 4WHXA 4G5SA 4KUGA 4LTNA 4KBYA 3TSWA 1YC5A 2A9VA 4R0NA 2DVMA 4DL9A 1PJQA 1N6LA 3KQLA 2QK4A 3RTXA 5FPTA 1AUVA 2JZNA 2UYHA 3H2KA 4K6HA 4PXYA 3U7EB 2H8KA 4XYMB 3GMDA 5CH8A 4UNSA 3GLIB 1C80A 1YKSA 2EIXA 4G07A 4E5NA 1G8AA 1UXOA 3VQTA 2GR9A 2AC2A 2V98A 4K9DA 1VSVA 3IB3A 5BV0A 2HWXA 3GTQA 4A93G 1JR4A 3O8NA 3RBAA 2VAMA 5CK4A 3TB4A 2BFBA 3S8YA 1NQXA 2QL9A 2HEIA 5FBRB 1J00A 1KO5A 4U7GA 3SYKA 1KVUA 4EECA 1UODA 4ND6A 1EDDA 4DABA 3QIVA 5FLMG 3GIWA 3VZQA 4MDHA 1L1FA 1CUZA 2AQHA 2A9PA 2NZUG 3DFFA 2B6HA 2QUKA 1NMYA 3GT3A 2Q6TA 5K0FA 3RV4A 2Z8YM 3DTNA 4PBSA 2XKJE 3CWZA 3K6KA 5CBKA 1ZQ7A 4Y9RA 2GK3A 3TW7A 1DQSA 1R88A 1K5DA 3PZBA 1RRVA 3CJTA 4MI6A 4YJ3F 5AHWA 4F4CA 2JEOA 2O1SA 5G41A 1QH1B 4OHZA 2Q3JA 2YXNA 2ZYHA 1KAEA 3EQ6A 3M81A 2UZAA 3V8VA 5KX5A 2I9KA 1G2OA 1Y42X 5A2GA 2RB4A 1G4UR 2NGRA 3AHCA 4U9HS 2POQX 3AUXA 5DBHX 2GTIA 3RH0A 5HJ7A 5IEBA 1W4RA 3DAFA 2LKDA 1PFQA 4XSVA 2QKYA 5EZYB 3IHWA 3GAZA 4LX0A 3K30A 3UCEA 2BFFB 1KU6A 4X64B 5ALQA 4NAHA 1G0OA 4UBJA 2C07A 3R6LA 1KORA 4FMPA 4HX2A 5BNFA 3KQUA 1IPFA 1S9FA 3OQ6A 4K9NA 4CT4B 1A4UA 2JA6A 4GMGA 3WS7A 4NCNA 2QR3A 3H20A 3KWJA 4DBLC 1KBZA 1VPVA 3W4IA 3AR8A 2H65A 3SBDA 3VFDA 1ECBA 1XNRH 4LYHA 1QH8B 1P17A 2O6LA 1Q7EA 3AYXB 3VRHA 5KKCA 3B1XA 4EM6A 3DEHA 5ENVA 1AZTA 4PAGA 4GZ3A 4YA6A 3DBHB 2GFHA 1TK9A 5F78A 3VR5A 4CIBA 5I7WA 3QSYA 4WXYB 2HJVA 4YYZA 3DHEA 4O84A 2Z3WA 3KLOA 1TZJA 1ZK0A 4P36A 1UADA 4R68A 3CLUD 5CLLA 2XGJA 3UJHA 3P27A 5TARA 1V8DA 3BCSA 3ANNA 3LLUA 4J7UA 4H3VA 5JNUA 2BP7A 4JJ6A 2A9JA 3GELA 3E3LA 2IYOA 3GQVA 4KL8S 4UZEA 5JDIC 3DOEA 2XKBA 1GEEA 1Y3AA 2BFOA 4XLTA 2O7SA 3ABSB 3P71T 2IU3A 2EEPA 3OPNA 4S1NA 4C7VA 3GTMA 2RI6A 2XTMA 3FIJA 2A14A 2E55A 4HP8A 4P9NA 3W04A 2MMGA 4HDRA 1Z2DA 2ZB4A 1R0BA 1J9GA 3GPBA 3HZOA 1KMQA 4M6WB 3UT5A 2BZ1A 2IZ7A 1A1SA 3O4HA 1TQ8A 1HO3A 5DLPA 4B3JA 2ZSHA 1FU8A 1PZMA 5I51A 3HVJA 3PR1A 3QBEA 1TO2E 1SUPA 5I9BA 2DFVA 3VVMA 4YUXA 5DE3A 4DARA 4LJYA 3FVWA 5LWHA 4ECUA 4XDGA 4L74A 3TXXA 3QHAA 1E3WB 3C39A 4IV8A 4F9TA 1AHHA 5HTKA 3I0MA 4FGUA 1N36H 4GGMX 4Z8XA 5HFNA 3CXRA 1PEKE 2IHVA 3DD1A 3EDYA 4CI9A 1T4CA 4DZTA 5I7SA 4XA8A 3K70B 4URXR 2A0WA 5FTMA 4YYEA 3R3UA 3R5KA 1FP1D 4FBTA 5EWLB 3G0HA 3NOVA 4Z2YA 1EA5A 6REQA 1UKEA 5AM5A 2UYCA 2I1WA 4LCJA 1XL1A 4F06A 1PG5A 2X76A 2OXCA 1Y14B 2OSBA 1CVLA 2JARA 1U9IA 1X2EA 4MCAA 5BQPA 5L6MB 1TOAA 2XV1A 4MWZA 2JA8G 2W8LA 3R9XB 2H2IA 2C78A 2UYYA 3H5VA 4GSLA 1JMKC 4K9OA 5FB3A 5TPWB 1Y63A 5EKSA 2J30A 5EJ7A 3ZE7A 2V7QA 4QUAA 1CK4A 1N8NA 1XNRB 4PS1A 1FP7A 2JJMA 1EFLA 3GROA 3F9CA 4IDQA 2H1FA 1K7EB 4TYPA 1H1LB 4BTLA 2XCRB 3KYHC 1PEDA 4NU6A 2VJYA 4TSKA 4F4FA 2MIIA 4BZWA 5AI9A 2WE7A 4NH0A 5I45A 3EN0A 1LKZA 2BCEA 1EDEA 5D86A 4JDPA 1WKCA 1YDHA 4KN9S 5K3FA 4BDSA 1PJ2A 4K6NA 3LQYA 3TQRA 4FDUA 5EGNA 4D0NA 2RHCA 4EUKA 1O6GA 4AY6A 1EUDB 4O7TA 4ZVKA 4JLSA 3SU8A 4CFSA 2B83A 2VJPA 1OXBB 2FP3A 1IH8A 2YHAA 1Y1VG 4FFMA 5EJ4A 5K6AC 4KDEA 3QKTA 1RI4A 2QLJA 1FEZA 1SXJD 3OIUA 4JKOA 2D7JA 4ND8A 4N5HX 3INTA 5AP9A 1GLVA 4PTYA 3GZTB 4ZJYA 1RM0A 2RBGA 5I7AA 1KY2A 1VHDA 2XNCA 3D5QA 2ONJA 2OV2A 4R54A 2H2GA 3RTEA 3BIWA 3SQDA 3CURA 5IT0A 3SYNA 1HT3A 1PCXA 1JWBB 1UBUS 3WBFA 1NW7A 2POCA 5DCLA 3WGLA 4BJ5A 4HX5A 3RUFA 4ZZ3A 2J9FA 5ECWA 4LECA 1U3VA 1D1QA 1QV7A 3GGSA 3MT0A 1MJNA 1I1HA 2EW2A 1AU9A 5DULA 4UTNA 3I9LA 5HNKA 1IHUA 3HMKA 1SXQA 5AO9A 1E94E 1Q0PA 1RRPA 4RNNA 3NDBB 4OGFA 4DR4B 4LY3A 2B1GA 2EZ9A 3G8DA 3FRJA 1E2IA 1R4MA 1O5IA 4JBLA 1K75A 4NBLA 1YNSA 2BUAA 3HKBA 2W9CB 3MTGA 3MHTA 1A04A 2FSFA 4JL6A 4QVGA 3OPYA 3BZBA 5DM2A 4A2BA 2XA2A 1W5FA 3TDNA 1HI9A 2I3GA 2PWAA 2XNDA 1M2VB 4YS6A 5KQSA 1BA3A 3DE4X 3FCYA 3U17A 1JDBC 2V55B 3A4MA 1SVMA 3HJNA 1UWLA 2H5IA 5EWEA 3MJSA