3MJFA

Phosphoribosylamine-glycine ligase from yersinia pestis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
429
structure length
429
Chain Sequence
AMNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylamine--glycine ligase
publication title X-ray crystal structure of phosphoribosylamine-glycine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
total genus 128
structure length 429
sequence length 429
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mjfA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mjfA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mjfA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 3mjfA04
2I80A 5J2TF 3BG5A 4RZQA 5LOVF 2DWCA 3GIDA 2PVPA 2FB9A 1CE8A 2CNVA 2YS7A 2R7KA 3R5HA 2DLNA 4FU0A 4O4IF 4MA5A 1A48A 1IOVA 3BSYA 3MWDA 2ZDHA 3OUUA 3G8DA 1KBLA 4O7ZA 5CB4F 3QFFA 2CNQA 1CQIB 5CA0F 4L1KA 3MWEA 2W71A 1DV2A 3AX6A 1E4EB 4FFPA 2NUAB 3KALA 4EG0A 4GGMX 4TUYF 1GSOA 1KJ8A 1IOWA 2GPWA 2DZDA 2Z04A 2W6MA 4MV8A 4O7WA 4NYEA 4M9CA 2VR1A 4MV1A 3R5XA 3ETHA 3WNZA 1C30A 4O84A 3Q2OA 3WO1A 5HBRB 1M0TA 3R23A 2R7NA 2VQDA 5JVLA 4FFOA 4ZI7F 4IHJF 5C8YF 5BPFA 3RFCA 2W6NA 3I12A 4HNUA 3TINA 2OLSA 4MV7A 4XYMB 2GQSA 4FGRA 3TW6A 1T36A 4J6EA 4FE2A 5BPHA 4M98A 5J2UF 4O7SA 3JZFA 2CQYA 3HB9A 5C1OA 4O7VA 4M99A 4O81A 3KAJA 4IIJF 2YZMA 1Z2NX 4TV8F 2HJWA 1EYZA 4ZHQF 2R85A 2YW2A 3JRXA 5BMVF 2V58A 1B6SA 4IZOA 5JQGF 5D8DA 4QSHA 4EA9A 3N6RA 2R7MA 4M9UA 5CAEB 2Z02A 4O7NA 2NU9B 4HR7A 2IP4A 3V4SA 1I7LA 3BFPA 3N8DA 3VOTA 1KUTA 3TQTA 3UFXB 3VPBA 1WR2A 4MAMA 1E4EA 3HO8A 3WO0A 2R87A 2NU8B 1PK8A 1VBHA 2R6FA 4WBNF 4HNTA 1VKZA 1GLVA 4WD3A 4YB8B 2NU7B 1B6RA 4DIMA 4IWYA 3VMMA 3DF7A 3U9SA 5FNVF 3LP8A 2GQRA 3LWBA 4EABA 4I55F 1BNCA 1CS0A 3K5IA 1M0WA 2XD4A 4YJ2F 1EHIA 4YJ3F 2XCLA 2R84A 4XYLB 1KEEA 4YAKB 3RUPA 1KJIA 5KKNB 5JH7F 2GPSA 4FFRA 5C1PA 5KX5F 4O4LF 2P0AA 4O7LA 4O4HF 4O82A 3JRWA 3KAKA 2W70A 2QF7A 4ZOLF 2R82A 3ORQA 3U9TA 2VPQA 4O7YA 4DLKA 4MV4A 3ORRA 4MA0A 5HV6A 2QK4A 5I47A 2SCUB 2YZLA 2R7LA 5H80A 2PN1A 1KJ9A 2GLTA 3OUZA 2V59A 4XX0B 1AUXA 5DMXA 4O2BF 3SE7A 3BSSA 1CQJB 1OBDA 3HBLA 4HNVA 1JDEA 1W93A 2W6QA 1Z2PX 2FPPB 2YRWA 1PX2A 2FPIB 2VHEA 1KC7A 3TIGA 1ULZA 1BXRA 4EA7A 2DIKA 2NPOA 3R5FA 1EUCB 2J9GA 1DIKA 4EGQA 4C5AA 3K3PA 2ZDGA 4O7TA 4IWXA 3ETJA 1GGOA 5CA1F 4EA8A 2I8CA 3JZIA 3VPCA 2YRXA 2ZDQA 2YZNA 4O86A 5LA6F 4I4TF 4O4JF 5LP6F 4FFNA 2YZGA 2WYOA 1EUDB 2NU6B 3VA7A 1GSAA 2I87A 5LYJF 1W96A 5IYZF 1SCUB 3RV4A 1A9XA 5JQWA 4TV9F 5JVDF 1VBGA 4C5BA 3V4ZA 1UC8A 2YS6A 4EGJA 3U54A 3U55A 4Y8VB 4YBZB 1GSHA 4C5CA 1I7NA 1Z2OX 1JDBB 5K2MA 5LXTF 3R9RA 2YYAA 3GLKA 4O2AF 3E5NA 3KREA 2YWVA 2X0SA 3TIIA 1M6VA 3Q1KA 4HQ6A 5GONF 2C00A 2R86A 3RV3A 2CNUA 4I50F 3K5HA 4MV3A 4EAAA 2CZGA 4E4TA 2YL2A 1JLLB 3NUAA 2FP4B 3MJFA 1KJJA 4O7RA 4XZ3B 4MV9A 2W6ZA 2W6PA 1UC9A 2W6OA 5EZYF 1AUVA 2V5AA 3VPDA 3AW8A 4MV6A 3G8CA 4ZQIA 1KJQA 1EZ1A 2FPGB 3BSWA 4O83A 1DV1A 2HGSA 1JKJB 4FFLA 4YAJB 1OBGA 2PBZA 1C3OA 4ME6A 4FFMA
chains in the Genus database with same CATH superfamily
3SOPA 4ZAXA 4B43A 3H4VA 2EJ0A 3I04A 2P9EA 5JAPA 3PR2B 1AUQA 3ORYA 1ZD3A 1J1ZA 4XUGB 4C6TB 4PQEA 1GT6A 2LW7A 3RVKA 3DZBA 3T1HH 4XGIA 4ZKDA 4KYUA 5ALYA 3HMQA 5CA0F 1IMOA 2Z1NA 1LLCA 2F62A 4HXYA 2P11A 2OBXA 3I58A 5BWUA 4LRWA 4QJBA 1K6XA 2XSZD 2V3WA 3ANTA 1II9A 2ZEJA 3BORA 2VDUE 1HQKA 1FRVA 4Z5XA 4DEXA 5J3JA 1T91A 2PBLA 1Q6ZA 3RIYA 1V45E 1P6XA 3UB4A 4Q05A 4FVTA 4Q47A 4JL8A 2HJ9A 3MBOA 2WV7A 2GK7A 2RH9B 3IEKA 2V7PA 1BXZA 1S0MA 4O4HA 4DM3A 4EHFA 5KFXA 1T1JA 3EPIA 4QJFA 3OTQA 1REQB 1U9IC 1KVQA 5BVGB 1N34H 4LOJA 4QPNA 5CW2A 3RB0A 4QHYA 1S2LA 4GP9A 4MVCA 2D1QA 1M2WA 4AW9A 4BKMA 4NNJA 2O2JA 3HN7A 3BSFA 5JD3A 2PLAA 2UZAA 1T25A 3UK0A 1JTVA 4ICIA 3B8HA 1SCKA 1YB4A 3B1XA 2VDVE 1IZ0A 3QFRA 2VYCA 3OIYA 1GADO 4XAQA 2J3IA 4IIJF 1Z0DA 2Q5CA 1HFEL 1CJCA 3C3PA 3PDIB 3ED5A 1B6SA 3IQHX 3VR1A 2GM5A 4OH7A 3SGLA 3N6RA 4KOAA 4BJHB 4DY4A 1K7CA 2W9CB 3BFPA 3X0DA 3HXQA 4WBXC 3FWZA 4FJ0A 3IURA 3VR3A 4Q9AA 2NZUG 2FJZA 5AXAA 4O3SA 5CNMA 2FN4A 2V6IA 3DAGA 2VHQA 3QKWA 3DHWC 2FEWB 1W48A 1CBUA 3PT9A 4E11A 5DN9A 4F4HA 1WL8A 5FHQA 1FSZA 4IXWA 2ZM6B 5JMOA 4GKAA 1FSSA 1E6KA 2QMOA 2DJIA 3K1YA 4DLRA 4CLRA 2ABJA 3HLKA 1Q7BA 5TARA 2LR0A 1FW6A 1S02A 4P9NA 3WKBA 1UJNA 2R6ZA 1E4YA 3G5LA 4O7YA 4DLKA 3WDLA 1GDDA 4CM6A 1GNVA 1VJ0A 5SICE 4O1MA 1G17A 1P0IA 5B1EA 2ZJ3A 5A0FA 5JAIA 4BVBA 5DX1A 1PYOA 2H4FA 4RKEA 3AP2A 4HP8A 3UT5B 1FFXA 3R8CA 4O33A 3TPZA 2CXHA 1DC8A 2ZSDA 4DKXA 1XRMA 4AIIA 4I99A 3RTGA 2FOXA 5EWFA 3I6YA 4KWCA 3DEZA 1NQTA 4TKVB 4A3GG 3DE7X 4KX3A 2C2RA 4O2LA 4EY5A 4RFLA 3SXJA 3IDZA 1N0WA 2G1UA 4V02A 1CZHA 2HV8A 1W1UA 4KGVA 2C9OA 5HDQA 2G28A 1PL8A 1IOZA 1KPIA 2BSQA 5AJWA 2WMNB 5GINE 1KETA 2V7WA 2CY0A 3V1KA 1D0IA 4UXHA 1QGYA 8ADHA 3L8ZA 1FDUA 4JNCA 4X20B 2BI8A 4RESA 1JALA 2ZJ4A 1QH0A 4ARSA 1O6CA 3U80A 4JKOA 3IUJA 2ZJ7A 4J29A 4QT0A 1XA4A 2X0SA 4LF5H 1HYBA 3T1OA 4LQ4A 1BDIA 4DM4A 1LRKA 2FK3A 3QV2A 2NSLA 5BSEA 4RA9B 3WYEA 4OMUA 3LH5A 4KDCA 2CDBA 4J3NA 3GGGA 3U6BA 1EB9A 1CVRA 3TGLA 3OY7A 3QIAA 4IIUA 3WL6A 2ZB8A 2B5OA 1UC9A 3L92A 4UTPA 2PMKA 2AOUA 1BO6A 4GLWA 4ZQIA 4D5GA 4AKSA 1KNXA 4JYZA 4EY7A 2ZSAA 4A5OA 2Y1CA 4C2MA 1UUFA 3SC2A 5JPCA 1SUWA 5JALA 1QFSA 3CH5A 3U7QB 4JBWA 5TEVA 2Y0BA 4IDFA 3UUWA 3MINA 1WA5A 2R7KA 4PWYA 1QV7A 1WCV1 2FR0A 3OSNA 3A2MA 4GLBA 1V8OA 4D6PA 4HFJA 4EH1A 2HLDD 3GFPA 4BTVA 3HSSA 4LCJA 4ZQGA 4CU5A 4HPJB 5A4FS 4MH0R 4EPYA 5BWOA 2BFNA 1JMVA 1ESZA 1NY5A 2Z5LA 2OILA 1W36B 3GVIA 4NZZA 2AV6A 2D06A 1TA4A 4GL2A 1GRNA 3PV0A 1TRKA 3OCWA 3PS9A 2GPTA 3O4HA 5D1HA 5JZOA 3WIVA 3JQRA 1SQ0A 1LBEA 1NI3A 1WD7A 2ZQYA 4NBSA 4X66H 5GY7A 3GJ4A 3Q2OA 4F50A 1U2SA 2IPMA 1TQ6A 1G42A 1CR2A 5K8LA 3SYNA 5BY2A 5DWDA 5B3KA 2A9RA 1PX0A 3B1YA 2O20A 3IO5A 3SC6A 3RFCA 1GV0A 3QOFA 3M33A 4RY9A 1GYFA 3HOXG 1W1IA 1QIGA 4R05A 1GA4A 3GP8A 1FJGH 4MIKA 3KUDA 5IAAA 2I54A 3GT3A 3SYKA 1E98A 3L82B 1UK6A 1XMXA 3TR6A 3BPSA 2OO3A 2QD4A 4DQXA 2VQFB 4PHGA 4ZV4A 4RV4A 4RLSA 1ORDA 1AGXA 1E2NA 2BE7A 1DRUA 2WUGA 2GZRA 4ZYUA 5E25A 2DY0A 2I1LA 4Q45A 1AKMA 4J0JA 5EMKA 1V1RB 1ZZGA 1IQPA 5EP2A 5TDHA 3A3KA 1QV6A 2JHCA 4ZCLA 5B7GA 1O96B 1OXVA 5DXJA 3VPFA 4L76A 1RKUA 1OTHA 3JAKA 4G6ZA 4QNRA 3UTCA 5B53A 3MWYW 4XWAA 5L3VA 2GK4A 1CS0B 1X14A 2QN8A 2W5UA 4HEQA 1RZ3A 2NSHA 2ZPUA 2AOXA 2GK3A 3EEIA 1W59A 2XJ9A 3KOWA 1RYDA 2RK4A 2HIHA 3RKUA 1FJ2A 2EGHA 2X23A 2J9FB 4C7VA 1SXJB 3TL6A 1QHFA 1SVNA 1TO1E 2H07A 1JHVA 2AFVA 1PTKA 4MVJD 1UQUA 2IPXA 1U5AA 1J22A 2V74B 1U7WA 1W93A 1ZOOA 4A8HA 3JQGA 4MLZA 4BNJA 3HJHA 2ASDA 2WAQA 5KCMA 3D81A 1NJFA 3Q9LA 1G21B 4GDFA 3KSMA 1OD6A 4XH9B 2DHRA 4D44A 1D8TA 2C5EA 3KEQA 3A70A 1OJ7A 1O58A 1UBHS 3NMUF 3H8VA 2NVXA 1C3VA 2YFKA 3DNMA 2W9AA 4PNPA 1PG5A 2GUGA 5L3QA 1GLNA 4D43A 3OLYA 2HMUA 1R10A 5K4HA 1DXHA 2CV1A 3HFRA 2FWMX 4S05A 3VBEA 4ZJPA 4PFJA 2J07A 1MDFA 1XTTA 2V65A 4ER0A 3QMVA 4I66A 2WPDA 2P2CA 3ONWA 4MUHA 3NHSA 1YQDA 3ELDA 2TS1A 3S2FA 3V1LA 3K5HA 3I39X 3D2LA 4QHSA 2W93A 1P91A 3N58A 1VIDA 1V3UA 4OBBA 2VZEA 1KS9A 1XCPA 4EQZA 1OVGA 1JHQA 2Q8NA 1LS1A 1G3IA 4X54A 4LYDA 1G2PA 2P2ZA 1HXHA 1S0UA 2FKAA 1F5NA 2YCLA 1S7CA 1ZGBA 1P5JA 2OGWA 4ENQA 1MV5A 4D2IA 3DBIA 4Z7JA 1ESNA 1LRLA 2BDUA 1BGWA 4S1WA 2IYWA 4N5HX 4C7MA 4A27A 3HJBA 2AUMA 4U1RA 4RVUA 5DHTA 1V3QE 3UJHA 2O3SA 1VBMA 4UPDA 2MR6A 2ORWA 5DNYB 1NF8A 2NSDA 3X1JA 5AD1A 4UD6A 2I4NA 4EBCA 5IDYA 1BE1A 2WFLB 5HMMA 5HKKD 4EG0A 1Z5OA 4QECA 3KXKA 4LBZA 3NI2A 1EESA 3QFSA 3CVYA 1E58A 4MV8A 1G2QA 2VJNA 3B20A 3SSNA 5EXEA 2D7DA 3SYRA 2OP1A 2AUTA 4JLSA 4Y0VA 5FJ8G 3R6LA 4FHCA 3RYIA 4X24A 5C8XA 3W2IA 3HACA 2ZG6A 4XJSA 1UCFA 2UVPB 2HZBA 1ZGGA 4TKUB 3AZQA 4F7DA 2C4UA 1KIFA 3IAEA 1WMAA 2YXPX 3C1UA 4RSMA 2BTEA 2VTBA 3SC4A 1DDOA 3KE8A 3L8EA 1AS3A 1NBWB 1V11B 4QPZA 2DLCX 1VL0A 1EYZA 2R8PA 2QW0X 1HGXA 5ALDA 4YJDA 3UV7A 3H2GA 4IQ8A 3PFKA 1ST3A 2QMHA 1XCOA 3WHKA 1BX0A 2EQBA 2OV6A 2REQB 1IPFA 4PLGA 3ZDXB 1YJAA 1V5GA 4CT0A 2IOHA 4FR0A 3FSGA 3RWBA 5CLIA 1O7JA 1GTL1 4LHEA 1DEKA 5H3CA 3D31A 2CFTA 4A3KG 1ZVVA 1RW4A 3Q11A 1ODKA 1J5EB 1NLUA 1ZSYA 1W88B 1KL7A 1XDBA 3IT3A 1EX7A 3R7SA 5I01A 2EXXA 1N25A 3TBKA 1PR4A 1U7ZA 1Y7TA 2Y1OA 2I6TA 2FR8A 4WESB 2AQ8A 5ENDA 3AY3A 2HY7A 5DHRA 1JFFA 3NT4A 5CJJA 3M2PA 1H4SA 4MP6A 1HTTA 3QU5A 4GI3A 5JEDA 3RIXA 4LI0A 4IG4A 1W36C 5AFSA 2CUZA 3L7JA 1TA8A 3T4EA 1E94E 1YK1A 1TM4E 1S3GA 1YMUA 2PS3A 3OPMA 4D45A 3OUZA 5JY6A 1T1IA 2W83A 4Q3NA 4NDAA 4OGLA 5JMPA 5LNK6 2AQHA 1E69A 1W8IA 1XK6A 1NTOA 2ZU0C 3ER8A 3TIGA 2B6HA 3HRIA 1L4KA 1ZI8A 5HA5A 2ZYAA 3U26A 4ER6A 1AUOA 4NZ9A 3M34A 3TY5A 5CM0A 1XWFA 2ZDGA 1SC6A 2COGA 2H1RA 2RKWA 4TXLA 5FLYA 4DLSA 2IHYA 3UMMA 3UCFA 5GV7A 1WDTA 4I1VA 2RI1A 1XA0A 2W2TA 1MO3A 2OGUA 3KHGA 1WOYA 1B93A 3NIGB 3S81A 3QXSA 3BUSA 2WG1A 5IVIA 1W5AA 4F4IA 2IEGA 4M1WA 1JEYA 3OCJA 3C85A 1YFJA 2DUMA 3GYBA 5IM4F 3DULA 1QRAA 4RPHA 3QSYA 4IIBA 3AERB 4ZDIA 4BP1A 2VDQB 3ZHCA 1X86B 2IS1A 3JTMA 4WZZA 1NUQA 3OOSA 2E85A 4ZAVA 3OFKA 4AN1A 5F1YA 3IL2A 5JFTA 1NBOA 1JFLA 2AJTA 2PMFA 1PYDA 1NW6A 4B1FA 4M0KA 3AI3A 2YWHA 2O57A 2CJWB 5AM2A 1K3TA 2MMCA 3AEQA 4CKEA 2ZPTX 1ISIA 4CM9A 4DF3A 1VJDA 1XJWA 4Q93A 4GI2A 3TRDA 2MCFA 3KV3O 1M66A 4ZYXA 2QT1A 1S68A 1SXJC 3VO2A 4HQNA 4ZVKA 1C0IA 2XYQA 4MYUA 5FB3A 3UA4A 3W6NA 3K0CA 2JLWA 2HZ7A 3RS5A 3UMJA 3LPNA 2B8TA 2WJAA 4J90A 5DASA 3U48A 3IILA 3SMVA 1CC1S 4D56A 2PNJA 1QYXA 4I4TB 2E3JA 4X6XA 3N87A 5BV7A 2ZCVA 3THWB 4HLCA 5EP3A 2C4KA 3K2BA 4PO1A 1QIEA 5IYZB 2XGQA 3WA6A 4O08A 3LQFA 3D2BA 3KV1A 3QITA 2X5JO 4H4DA 5ILQA 1D2GA 3ELUA 4D8WA 4YR3A 3D4OA 4AQYH 3WNZA 4NENA 3LCMA 1XN1A 4TM7A 2VHCA 4Z51A 2X9QA 3HCEA 1AKVA 4YO8A 3ZD9A 4C20A 4GNKA 1GR1A 4HDNB 4JOQA 1WCMG 4BKRA 5D1PA 4XRGA 3ICEA 1Q50A 1QYIA 4US1R 1CZNA 4JOSA 3T5BA 2LKDA 1T36A 2QMQA 4E21A 1L4LA 3E5HA 1J9GA 2PZMA 4QYSA 2BCEA 3B6KA 1S4QA 2Q4EA 5JZVA 4IF4A 1ZRSA 4Y2VA 5JAQA 5EUBA 4MW1A 2HF8A 1UBOS 3JZAA 4KUGA 1X7DA 1NXQA 4RLHA 1SVKA 4FHFA 1PS0A 3T35A 5AK3A 4ZMBA 4AD8A 1KO8A 2GOYA 2H85A 4ENVA 1RI1A 3OQPA 2J4CA 2PGIA 2YH2A 4HNRA 4DQUA 4AMBA 4Z3DA 4AT1A 1OWTA 4BX2A 2XZOA 1N7JA 1QVZA 2QYHA 4H3HB 3S2UA 1YRBA 4Z8XA 1VYVA 1YD7A 4WEQA 3B51X 3HVRA 4C0XA 1E89A 1JG1A 1BH2A 1PE0A 3CBQA 1F4LA 4HGNA 5BWBA 1B6RA 1WF3A 2JRLA 2DTXA 2JLVA 4LE1A 2X76A 4JR0A 1DQZA 3WAKA 2VP4A 2HYIC 5LKRA 3KPUA 3BK1A 4L5BA 2FMTA 5F1OA 4H59A 1H9CA 1EHIA 3REQA 3CUWA 1X13A 4DR5B 5IJAA 3RUPA 4BBZA 2XD9A 2HPAA 1BJRE 2GBFA 1TNDA 3K2EA 3BQ0A 2WPNA 2EG5A 4L15A 2P8JA 2E82A 3ODGA 4MW9A 2JD2A 3PNBA 4Y0NA 4ARBA 5C3EG 5P8WA 3ON5A 1XAHA 2YV3A 1XQWA 1K06A 3F9RA 2HSDA 5KNCA 3O3NB 3RAGA 1HDRA 1Z2PX 2G63A 1KPGA 2INGX 3TUJC 1T2NA 1MB9A 5AVQA 1NJ2A 4LNAA 1E20A 4PYLA 4Q9HA 2XLCA 4MWBA 5TQJA 4Y9DA 1JILA 4DL3A 5EEHA 4PTLA 2F59A 5G0SA 3RU9A 3DDNA 1T1RA 1GGEA 4OMFG 4K88A 5EE9A 3BWDD 5KTRA 4KXQA 1LTQA 1E0DA 3IO3A 1TO2E 4GKKH 3TOSA 4IMJB 2XNDA 4MW4A 1E6WA 4XLTA 1GG5A 2QZ4A 3KPVA 4GWGA 1WCXA 1C1DA 3HUEA 1Y1KE 3GLHE 4DCJA 2WVHA 3U44A 4M88A 3KREA 2PUBA 3D6HA 2XYPA 4KDRA 5CEJA 5A05A 4NU8X 4DA6A 3RV3A 3HCRA 3TYXA 1CRLA 3E61A 2BCGY 2CZGA 1J2UA 4Q9LA 3ESBA 5T3UA 1FJXA 1UFKA 3OCCA 4ZREA 5EKTA 4ID9A 2ACVA 1XFAA 1DMSA 3RSQA 3FF4A 2J3KA 1Z8FA 5HM8A 2DBQA 5C46F 1Q1ZA 1FUEA 5EVCA 4GQBA 3MJ4A 3RFUA 4N8SA 1C7JA 3TW8A 4Y6GB 2B3DA 3EXHB 2XRZA 5IKXA 4DV7H 5TNXA 3RR2A 2OESA 1V8DA 4OU4A 3NHWA 3QY9A 2GZAA 2LWIA 1H85A 4AXBA 4NOMA 3QELB 1T4CA 2PWPA 2XQFA 5ESRA 1MAAA 3OMXA 2AT1A 5L7YA 3TTWA 1IOVA 3C3JA 1SQGA 4KRXA 3PXGA 3B36A 3ZQ6A 3WK7A 1I5RA 1OWNA 2YIJA 3FN4A 3A7EA 1Q0TA 4DDTA 3GXOA 2EJUA 4WDQA 5BRNA 5KJFA 1BVRA 1E7QA 1EI9A 2HCRA 2I4OA 1HKHA 4KFUA 4QOEA 5JNSA 4LRTB 1IZ8A 5E4TA 5L6MB 1NAIA 1JR3D 2M98A 2IODA 1RK6A 2QLNA 5JH7B 1OHHA 3DP7A 4NE2A 1C30B 2WTNA 3B1VA 3LLMA 3CW8X 3ORHA 3LUGA 3KBOA 1ECCA 5F64A 2OCKA 1Y9ZA 2A57A 4LQCA 3QMPA 4A3JG 3F7OA 1X38A 1W5FA 3E27A 3D4LA 2Y4OA 4HGQA 1IONA 1Z26A 3IBGA 2AC2A 1GL7A 1PL6A 2Z8YM 3ESAA 1L6RA 1BKSB 4NECA 4M6WB 2IYEA 1NW3A 4OYHA 4O81A 4B80A 3KAJA 4I81A 4V0NA 1Q2UA 5AW8A 3LPCA 4EYHB 4NSNA 1UM9A 5EFOA 5M3BA 2B30A 4HUQB 5EUMA 3FVTA 5DG9A 1C9JA 3N3BC 2NU9B 1YRAA 2BUBA 2IL1A 1QX3A 2RDMA 1H05A 1EHYA 4HBGA 4Q3BA 3HU3A 1KY3A 4QWDA 3LGSA 4J2TA 5IEBA 3OSZA 2OECA 3EUFA 2R9VA 3GJSA 2HBZA 3JR3A 1GNQA 1G63A 4RC9A 4AJPA 4BU1A 2PANA 1E2QA 1ZPDA 4ITVA 3CT4A 3GLGB 1XDDA 2WSBA 4CCWA 4U5XA 1WW3A 3KJGA 2AFRA 5JH7F 2HK7A 2R8IA 2CNLA 4M9XA 1V8PA 2QSZA 1KKMA 5TGTA 1ZZEA 2W70A 3B1FA 3QLVA 5DLQC 4G4SP 4M1EA 3FLMA 2FWBA 5TF4A 3BHMA 2MU1A 5I7FA 1XXHB 3USCS 3BGVA 3TFOA 3AIIA 1FDTA 1MZBA 3P0EA 4RPJA 5KS8A 4PZ9A 4OG2A 2GESA 1SG0A 1N2CA 1MW8X 3UWSA 1T2UA 3BWVA 5HEKA 5T6BA 3L6BA 1KRXA 3FPSA 5E0KB 1PX2A 1N92A 5BSMA 1YGPA 1QH9A 2PT7A 3JWPA 5JSQA 4I6GA 1GJRA 5KZMB 2GLXA 1E9RA 4ABTA 4BRWA 3UOWA 2G70A 5E6SB 3DDUA 1Z0ZA 1YC5A 2FRDA 4MKGA 3A2LA 3NEJA 3SKVA 2EQAA 3VNQA 4GWLA 4DW8A 1R18A 1PUJA 3BXHA 1ZWKA 4G1MB 1LC0A 3SNOA 1T1GA 3PD7A 1YVRA 2AXQA 2H2HA 2FX5A 1YZTA 3NCTA 1G6Q1 1N36H 1IJEA 3EMVA 5TX7A 4C5CA 4LHYA 5BV2P 3TTXA 4M1YA 1IY1A 1T2VA 3HE3A 4FZVA 2B3TA 4REQA 2KYRA 2XQKA 3A0UA 4C4YA 3T94A 3CTMA 5DQIA 3JQDA 1TPZA 4TYMA 1MVOA 3TCKA 3FNRA 2WW8A 1EDBA 5I8ZA 3T0FA 4RQBA 3NIBA 3DD1A 2Z9DA 3G1WA 2CF6A 3GJRA 1KNQA 1SULA 1AXGA 4MVWA 4AI6A 1YA8A 4AYXA 2XOEA 2AWNA 2OGSA 3ZHZA 1R0SA 4GEGA 2HW8A 1XNRB 2GN6A 3H9JA 1LLDA 2ONZA 4E08A 4DR7H 1CT9A 1SIUA 4DCPA 2DPJA 1Z4MA 2P6NA 1SB9A 4WHMA 2ZBFA 1S2GA 3C74A 4Q5IA 4HZUB 2NADA 4YT4A 3V7YA 2F1JA 1TWAA 1AV7A 3VISA 4GR4A 4XE5A 3N42B 3D7NA 1O9GA 2GERA 1QLHA 5TPWB 2WILA 4D41A 3BAAA 5EJAA 4OSEA 3KYDB 5AOCA 5B58C 1JT2A 3MLEA 4NDNE 2RBGA 4TVOA 3D02A 1ITZA 1QK5A 3U81A 3ZCSA 1JHMA 3I1YA 2R751 4M8KA 4BECA 4NBWA 3LO5A 3N40P 1Y1VA 5FPPA 3AONB 4OTZA 3I2GA 3A9SA 1EFPB 3CUEF 5GGXA 1WY5A 5TQ0B 3ICCA 4DLNA 1NJ8A 1IYDA 1RQGA 4UM7A 4D9GA 3W9UA 5CIWA 1W6RA 3ZZ1A 4B2YA 2ALJA 1QH1A 2IW3A 3NB0A 5EKXA 3T34A 1VCIA 4IAJA 2D0OB 2EERA 1C8KA 3NU1A 2G08A 2JCBA 4R1SA 1UAAA 1Z12A 5K0BA 2EFYA 1CKOA 4K9SA 5B12A 1S2MA 4QFBA 3ZX4A 2W43A 3AHGA 3DAOA 4LXQA 3HXMA 5ALVA 3EXHC 3ZE7A 4DN6A 2JI4A 2HEIA 1YOBA 1NVKA 1Y1LA 2Y76A 2DFVA 2NU8B 7REQB 1L5WA 1HNZH 3BGWA 1VKZA 3DMDA 1GRCA 2ATLA 4R31A 4DEYA 3T9FA 4PAQA 2GQRA 3DPSA 3PQEA 4EABA 1KWKA 3DBLB 1UBKS 3MR2A 3JD4A 4WWHA 1XVIA 2E0IA 3BCRA 3LCJA 4LDNA 3CZ4A 3R0VA 4J9MA 4L28A 3T3OA 2O3RA 5FD5A 1WIWA 3L06A 3W06A 4JI4B 4IIGA 3IDAA 1FVHA 3MUOA 5HUJA 3ZDCA 3IHTA 2E4VA 3F8TA 4H1WA 2CDAA 1K4MA 3O1LA 1FX0A 2I76A 5A06A 3ZJUA 3B1ZA 1U0SY 3UHJA 2V59A 4PSUA 1KH1A 4DYVA 1MXHA 4RZIA 3N6VA 1SFRA 1JIQA 4D4IA 1RPNA 1MV8A 4KBGA 3STUA 1LJ8A 4MUIA 4RKRA 5HZGA 2N47A 5J2TA 4A0QA 4FQ8A 3NHJA 5EYPB 4U4AA 2A1HA 1GVNB 4JI7B 2OHOA 2YVLA 4BO1A 4I1YA 2CV0A 1OH6A 1YU9A 2AFIE 3IKTA 3SF8A 4HRXA 5AVOA 3C4JA 4FYKA 3RSSA 3GEMA 4YYEA 3QE0A 4Q7LA 3SIPA 1I24A 4QBGB 3GA7A 1Z47A 4Q3EA 4G97A 1JB9A 3L01A 5JS2A 2BKAA 5F9NA 4KPYA 1M2VB 3ZVLA 4EJ6A 3NIWA 1U2GC 1YIOA 1ZN7A 5JD6A 3MT7A 4Y98A 5HZHA 1E32A 3UCXA 1IFXA 5B4UA 4LFCH 3E84A 2HQRA 4ED6A 5JUWA 1WLSA 3VR5D 3IN5A 3NBUA 1ULUA 4Z4QA 4W63A 4DNPA 3U3ZA 4K5QA 2GZHA 3IODA 1Q0PA 4WQMA 1P19A 4I7EA 4IF6A 1Z0KA 4ZV9A 4IRXA 3MJCA 3PVSA 3E53A 1TYBE 2XIJA 4ETSA 2RDJA 1KF0A 4LE2A 4G5FA 3FMPB 1EFAA 2Z6VA 1Z08A 3PC3A 4QJ5A 4S12A 3R3YA 1H69A 4S1VA 3G0OA 4HDKA 4E5MA 2FE4A 2F7SA 2E48A 2AG6A 3QBVA 4OLHA 3BWYA 1ANKA 2V4RA 1CFZA 4CFZA 3KVNA 3LOPA 2RK6A 2JJMA 3JQ9A 2NYUA 1HY3A 2ZAOA 3OX1A 2QL5A 1XJ5A 3H4BA 4G24A 2NZXA 1W1WA 4OI4A 3HP4A 2I80A 2D1FA 2IY7A 2JFNA 1UQTA 1OBHA 2DCMA 2VNSA 2V03A 1NVXQ 1GGVA 2RB5A 2PT5A 1A48A 3MRVA 1PV4A 2AEFA 4LXTA 1MJGM 2VDWB 1Y7PA 4K8OA 4X7RA 5DM4A 4BWYA 1UKCA 2D3TA 3MOIA 1VP9A 3CS3A 5EWMB 5BWRA 5M2QA 3NPAA 1AMUA 2B8JA 3RLFA 2WVGA 1E5LA 3TE6A 1ZVMA 2Z4RA 4U7GA 1FLDA 8LDHA 2IOFK 3N75A 3LXMA 1T9DA 2P65A 4WZAE 3MYRA 1HL3A 2RG7A 3VZDA 3OE4A 4IQGA 4TL8A 4UE6A 1T6NA 1OI2A 3UJ8A 2UVQA 4ECYA 3NRJA 4CI0B 4XTCS 4Y6RA 3WSTA 2HU2A 4QDXA 3LUPA 4IRDA 1WZCA 3KT0A 4DJTA 4F3NA 5H0IA 2NVUB 1QONA 3TSAA 4W1PA 3RVPA 2XEDA 1VI5A 1XEXA 1IM5A 1P4JA 1KVTA 2PKQO 2RHOA 2F17A 3EQ6A 4IRCA 1JBKA 2C8JA 3LY7A 2ASVA 2VZ9A 2C8VA 1JU9A 4AM8A 3IVXA 3T7SA 1I3LA 1K5HA 1GVHA 1K3UB 2UVWA 1QGAA 5DLYA 2VT2A 1EP9A 1ZR2A 4NU0A 2ZR7A 3RRFA 2YX1A 5LQKA 4C2BA 4UNIA 4CGYA 4IFEA 4Q7EA 2H54A 1GV1A 1RM3A 3Q8LA 5AJXA 4KNWA 1XTKA 2ZRKA 4IRMA 3UGJA 3B60A 1XBTA 1VSQA 4PZCA 3U4MA 3MGBA 3ZXUB 4MI9A 2AXPA 4RK7A 2REBA 1YQWA 1E3DA 3BM5A 2BFPA 4PLHA 2OZEA 1KERA 1LCIA 5KWEA 1MNQA 3IUPA 5IXSA 2IX3A 2ANCA 1XAIA 2JZOA 3ASUA 2VA3A 4DDWA 1DHRA 4K9DA 2N9UA 5LL6P 2M6KA 4OLBA 1S9HA 1A9ZA 4MW0A 1LVHA 1M33A 3X2SA 2OFWA 3GJQA 5AR1A 3LQSA 2SCUA 1X87A 2ZS7A 2UUBH 2G9VA 5FOXA 4V0MA 3CEPB 3W4IA 4J76A 3REFA 4QYWA 2OWOA 3PQ5A 5FNZA 3H9BA 3CZAA 2EQ5A 3AGQA 3F9IA 1U4SA 1INLA 3M4IA 4E3ZA 2PCLA 1R0RE 1O94C 5FCDA 3MTEA 3T0IA 1P6QA 5LOVA 3GJ8A 3ZBQA 4PRYA 3BGDA 4I2NA 3DT9A 2X0JA 2EJWA 3MJHA 2H63A 4QASA 2RF4A 2IWRA 2P6MA 2ISQA 3TLJA 4ZRDA 1GITA 1GKYA 3B3JA 1VKRA 2ZI6A 3VR4D 3Q8PB 1P3DA 2GUWA 5HRAA 1H1DA 2OFFA 5CEEA 1MABA 1Z0IA 4A3FG 4JELA 3R24A 3DZHA 4G0XA 4TSRA 3WGUA 1EEXB 3AJ8A 3VC2A 5FPQA 3OECA 3WWJA 3ONEA 1AE1A 2ENUA 2XUFA 1L6IA 1SUIA 3OTWA 4YAFA 1D3AA 1JDBB 3GFBA 1I13A 4Y9TA 5CK4A 3O4GA 3NW9A 3BWMA 3QY0A 1O03A 1UP7A 4URZR 3KWLA 4CU2A 2D54A 3BMNB 1U2ZA 2DWOA 3F6BX 3NP9A 2HJRA 5MN5A 3ZNNA 1RJ9A 4RK6A 3FPGA 3G8BA 5CG2A 4DARA 3OQOA 1R15A 4JBHA 1I51A 5DG8A 3X1DA 1Y8RB 3BWEA 5JDCA 1DFGA 3ZQ4A 2C2EA 2IHBA 4IY1A 4NG4A 1YOVA 1DHTA 2J30A 4UHBA 4RX1A 2IBMA 1TA0A 3H4TA 3R3UA 3N6XA 3EFOA 3K09C 3RIGA 3UBTA 1ZXLA 5D7NA 3ZU5A 3ML1A 5F33A 4HTAA 3M82A 2ZRGA 3RUIA 2D62A 4HVLA 2XITA 1IIRA 5DRYA 4ZIRA 4MGKR 3AI1A 3QE4A 3LQYA 5E6RA 4H7HA 3D3JA 3LKBA 5K8TA 4I1RA 5LFAA 2L69A 3SWWA 1Z62A 1NAHA 2CUKA 3OHPA 4HDAA 4RGVA 3A6FA 3LDUA 2OBYA 4AUMA 1L5FA 1OXBB 4NNPA 3A10A 2AN5A 4W9RA 5BN3B 2R65A 4H7JA 2EHJA 2NTYC 1AGRA 4FZ5A 1U2PA 5KC9A 3ZDFA 4H1TA 2P9TA 5HP4A 2K2WA 3SVZA 2ONCA 2VF5X 3FPAA 1SVUA 3AUYA 3SJ7A 1V1MB 3FYUB 2VP9A 2VQDA 5AKIA 4CI9A 4I8IA 2ZB2A 1G4AE 2SICE 4O63O 2RHBA 1Q17A 3GWZA 3ND9A 3FUXA 3KJIA 3ETCA 3URMA 2VJDA 4QOHA 3OIUA 4FE2A 1UBRS 3PDJA 2ZXFA 1QC5B 4ZAZA 5J9FA 1VGRA 1RAGA 3DEIA 3R6DA 1UJ4A 4Q4HB 3GNQA 4RKFA 5C1DA 4B82A 3UH0A 1GXSA 2Q1SA 4KQFA 3N43B 1OF1A 1DEHA 1RYHA 4C0JA 2PK3A 4QSHA 1XKXA 3LLSA 3HA7A 3SICE 3UW1A 1GUFA 4DQVA 2EG9A 2FN9A 3VPBA 4MAMA 1E8NA 4GYYA 2GZSA 3CR7A 2JAXA 3DQPA 2ODNA 4U2EA 4CIXA 2WHPA 3CLHA 3HDYA 3R7DA 2X3UA 5IKOA 3MW8A 4JB2A 5BXQC 5UKDA 5ILGA 4X94A 4DMFA 2H1WA 2B2CA 1X1QA 4NCIA 3EOZA 5GZ3A 4XIFA 1KOJA 4PZ8A 5JWRA 4X44A 4D4HA 1J1UA 5ICEA 3HSYA 3QUAA 5G4LA 4FDAA 2FWAA 2EGUA 5KHAA 3CUTA 3OM8A 1ZITA 4DV1H 2B9EA 5LZ5A 5JFOA 1RZRA 4RF3A 3PSAA 3VYTB 4G41A 5K0ZA 1NPYA 3T3NA 1ZISA 2J3DA 3GVCA 3HC7A 3VSEA 3RAFC 2E2IA 3T38A 4NV0A 3L8CA 4FGLA 3I1FA 3L02A 1RYNA 2GPBA 1OU4A 3QEMB 3T7AA 4KQ9A 4OJKA 3GQCA 1D03A 1U2QA 1XNJA 1G5QA 3K3PA 2JH3A 2PUHA 1N5OX 4MJLA 1YZNA 5E6UA 3VHRA 3T52A 2CXPA 3VGPA 2W2OA 3VPCA 4JUCA 1KQFA 4BDSA 2F3RA 1Z37A 1R8JA 3ZV5A 3FOFC 1TK2A 2VWGA 1UWKA 4W5WA 4LH7A 2XX3A 1QVVA 4JJZA 5LYJF 3B85A 3PQ4A 3HKZA 1Q7GA 1U9YA 4M8LA 3SR3A 4PZYA 3UZUA 3ENQA 2WA2A 4YLYA 4JVOA 5K2MA 1W87A 3SHTA 1J70A 1V4YA 4F3TA 3STWA 3CEJA 3V8QA 2RARA 2EFDB 2WNSA 3WKDA 4ZZ0A 5KMGA 3WK5A 2XXAA 1AB6A 4N8EA 3WNBA 3GJ6A 3KVRA 4MCIA 2VK2A 3K92A 1IBKB 3ZD6A 1U0RA 4K9OA 3Q0TA 1XTSA 4OVKA 4R9SA 4C22A 3KKMA 4BRSA 1PGPA 1Z6TA 2W6JD 1KYYA 3MXTA 2C28A 4KQHA 4KC0A 3GO4A 1ZH2A 4FE4A 2RGUA 4O29A 2BGUA 3X44A 4JI3H 5HCNA 2QQFA 3H42B 1AC5A 3AETA 2B1RA 1I30A 1DV1A 2EBUA 3MFYA 2YNMD 3MWGA 3LC1O 3VHLB 5H59A 1CQZA 3PFFA 4ALNA 2OQIA 1HE3A 3L5OA 5JQGB 2GWHA 3ZCPA 2ZIGA 4EUFA 4Z99A 1PLLA 2AG5A 1PZEA 3A1FA 5C7OO 3IEXA 2B7LA 3JVUA 4PG8A 2V5VA 2CW7A 5IFLA 5LA6A 3OPYB 2OOSA 3QLUA 4DV0B 2YINC 2BEWB 2DY1A 3LUHA 1A7KA 5LB4A 1Z0AA 1E1MA 2I0FA 4HX9A 1RLUA 4AIRA 1MF7A 3AH8A 4FNOA 2HMTA 4R9UC 1AQYA 4TN1A 3HYRA 5EL0A 1S8AA 5GOZA 3GH3A 4YJ3B 3P2EA 1Y4AE 2PGJA 4DV4H 4HKTA 4I9HA 5CT4A 3NUZA 2IUEA 3LE8A 3QEKA 1XQYA 1F0NA 1I36A 4G1BA 2QDKA 3OWHA 4DG5A 4ZOLB 1JNYA 1JDBC 2VSQA 5DISC 3RKRA 4IR9A 2BN4A 1I7QB 3O3OB 2HMSA 1A4IA 4JI5B 4PDBA 3NEAA 4JWTA 5EJ8A 1NL3A 1O6ZA 1K1SA 3D4NA 2ZYUX 1JIIA 3WRWA 3DZCA 2W22A 5JFGA 4FNAA 3WFZA 3T5CA 4AY3A 3FWPA 3B7GA 5L95A 4Y9RA 2JAOA 2AD1A 4HH1A 2H6EA 1LPSA 3H04A 3KSAC 5JQGF 1VPEA 2I03A 1PNVA 1WBDA 3AUJB 4BS9A 4ED7A 1P5FA 4F6RA 3LG2A 4WTOA 4YIHA 2FHSA 2B7BA 2R7ZA 3OOHA 5E2BA 3IX7A 3RSZA 4MWCA 2I6GA 4MUFA 5AKJA 3WWZA 2Y0CA 5CCBA 2CUTA 5F3DA 2FPXA 1E2DA 1Q14A 2BBTA 3I2HA 1KMMA 2FUG6 2HDHA 1IEVA 3L0SA 4O2AA 5KYWA 1SO8A 1M1YE 4YJ3F 3P2YA 3CFYA 1N9GA 3COPA 2AYYA 1TVEA 3V4RA 1UK7A 4NICA 5EIBC 4ZOLF 4OHOA 4B09A 3ZD7A 3LQKA 4IXDA 4MA0A 5JSFA 2CFSA 2SECE 3FYUC 3TNDA 4Y67A 1Y3AA 3BDAA 3F4BA 3H9GA 1E1RD 1SC1A 4XX1A 1POWA 4ND2A 1QPGA 1Q95A 2QM3A 1E2MA 2BWJA 3WXBA 3SZUA 2ADOA 3DOFA 5GADl 3KJQA 3G1TA 3V4LA 1C1XB 1JHUA 1DEAA 3K7EA 4LF7H 4H6VA 1RXSA 3IJPA 2XMRA 2DSNA 3T6KA 2YRXA 1LC3A 1NT4A 3I92A 3QHAA 1J2RA 3I4CA 2BGTA 5HKBA 1QYVA 5BR8H 3S5JA 2CCKA 3PFHA 2HHHB 2PWYA 3RF6A 4Z9YA 5GM2A 1M1UA 1KKUA 4KQ1A 2ZJ8A 1S5PA 1GN8A 1RMYA 1E9DA 2G1JA 1Y1PA 2V7VA 3FNQA 3VDXA 4MCJA 4LF6B 5EZQA 1L5ZA 4UULA 4IDBA 3KFLA 3EDQA 2R93G 1RWKA 4CQJA 4L8WB 4F96A 1QS0B 3MR6A 4IX1A 4IHJA 4DFDA 2CVFA 3IP9A 4Q3LA 3CX8A 1EWRA 2IZ7A 4RWEA 3MJFA 1GUZA 2ZSEA 4BV2A 1C9NA 3C5VA 3TLYA 2HPZA 3STTA 3OF5A 1NYRA 4M0MA 1PEDA 1ZAKA 2L2QA 1HOXA 2FZVA 2YY6A 3G8CA 2HCTA 1FP2A 3RM3A 2C9MA 4AZ3B 1DKNA 3CF4G 1G7SA 4X6UA 4LYYA 2PGLA 2BZGA 3ZJ4A 1OX6A 4YBRA 3FUTA 4Z0NA 3G8AA 1L1QA 1WW8A 4R8UA 1B1CA 2IYAA 3PUKA 1JWBB 4FNGA 3E81A 2YJGA 3PQ3A 2JA8G 1OFVA 2ZAYA 1NRWA 4LRQA 5IHPA 2OT3B 3EF1A 1GCUA 4U0KA 5A9RA 1HNXB 4JFRA 3E3MA 5K3CA 4R3NA 3LVBA 2WZQA 3BFXA 4YT5A 1HZJA 4JYAH 5T5QA 1VHWA 4RW0A 3GMSA 4V0KA 2PD6A 1UKEA 4S1NA 2COIA 5FA5A 3FVVA 4LC0A 1QVRA 5CXSA 1DDIA 5KBYA 4AAYA 2OCIA 3M1YA 2CNDA 3MC1A 3NNSA 1KO7A 2G67A 5CYGA 1J5PA 3WJ2A 3GNSA 2FUNB 1RKBA 3BCUA 5FUMA 4G4JA 2OCDA 2B8EA 2YN4A 3LW8A 3JWJA 4V03A 1KR5A 2Q5FA 2GHTA 4KRGA 1Z7BA 5B30A 5BSHA 1NUHA 4MVJA 2C2MA 1CUJA 4F2WA 5U9CA 1ENOA 3L7YA 3PWTA 4Q4DA 4IJ6A 1ID1A 3D4BA 4U9HS 5JSHA 4D9BA 2A4KA 3OKAA 4Q4JB 1Z9BA 1AH2A 4JC5A 3H3FA 2W2LD 5ES3A 2ESRA 4ZVVA 3T4PA 3C24A 3JSNA 5HPYB 4IDQA 1WRVA 3LIPA 1ZNZA 3JQFC 2RGVA 1JSLA 4TWJA 5KWIA 2IPAB 1BHSA 2Z08A 1AURA 1E1DA 1JEQA 2VJBA 1SK8A 3WYFA 4IDAA 1DBWA 1II0A 5ESDA 1NF3A 4UMVA 1M8JA 1S3SA 2GD0A 3MJEA 3LYAA 1KEVA 1BG6A 1MXFA 4CMEC 1TQDA 1XZMA 3H2IA 4M89A 4XSHA 2HU5A 5L53A 1QM5A 4Y2GA 2B99A 4F5ZA 5B36A 1U28A 1YA4A 2O3JA 5DTRA 1EGHA 4KIFA 4CE5A 3ZU2A 3AG5A 4ZQHA 1H8HD 2CMGA 3L7AA 3SX4A 1F6DA 1KEUA 4ZU3A 3T9BA 2WZBA 5PGMA 4W5JA 2YQZA 3M6VA 3E9ZA 3B48A 3JRWA 2Q2QA 4OGFA 2R82A 2YICA 1FDVA 3BN3A 4D6YA 5ALNA 1FNNA 3DFFA 5KQPA 1ECPA 3ILYA 1E3SA 5FPKA 5MF6A 4KMMA 4EB6A 3DUWA 5CXXA 2Q4BA 4D8VA 3WL7A 1T35A 3LSTA 4B3JA 2O4CA 1C9DB 2HOQA 4XJTA 3IP8A 4XLLA 3Q5GA 3JQ7B 1GAWA 3U5ZB 2DPIA 2VCEA 5B2EA 1TIPA 2H7XA 3TTVA 2IKQA 3NHMA 2VPZA 4HYTA 3BA8A 1EFRD 3V55A 1L4EA 3IERA 1U80A 3IDFA 4GE0A 3WJAA 1P29A 3R44A 4JCCA 3R7BA 4FBTA 3I9LA 3TQSA 3BS4A 1QAOA 2V96A 3WGLA 4WKBA 2CXSA 2HNKA 2QD1A 1D2NA 4D81A 3VU3A 5JZBA 2RHMA 5MGNA 2JIZD 5DI3A 1LX7A 3FLAA 2OBFA 3KSRA 1B3RA 3ISVA 4OH1A 4PZ0A 4EW1A 3K6SA 1DDGA 3GIIA 2G5PA 3PO3G 4HEHA 4OXNA 3GZNB 3FTCA 2JL1A 3TB4A 4F4YA 4JJ4A 5ALXA 4WZ6A 1A96A 1QO9A 3KEFA 5GGYA 4PIVA 3LS2A 1XTIA 1CRQA 2I2BA 3H6KA 3LU1A 5HOEA 3A1WA 5K09A 4Y2YA 5F73A 3GRUA 5ALLA 5A5DA 5LIRA 3ABQB 4GOKA 4QATA 1ZD1A 3U7GA 2P4SA 3F8SA 4HVTA 5BMVB 1SHUX 4LWOA 3JQAA 3W5JA 1I2LA 1X39A 1LBTA 1IK6A 2IYNA 1AKUA 2IY9A 3V97A 3DWGA 3KTFA 2RFLA 2CMHA 1AD2A 1NN1A 1RRKA 2CF5A 2Q2OA 3CF6R 5HNEA 1NI5A 3V9AA 2CN1A 2VSFA 4G0PA 2Z1MA 1RMQA 3WRYA 1CETA 3TMKA 3BCHA 4FGKA 4C4PA 5DTIA 5TJHA 4LKOA 4DZZA 2FK1A 2HX1A 3F6EX 4GC7A 1L7VC 1OFUX 5FLXA 4BVFA 4LSMA 2HDOA 1WHTA 3UHAA 5HMLA 3L0BA 4Q03A 3BE4A 4F12A 2CT8A 2Q7OE 1JPVA 2E2WA 4ZEMA 2IQIA 2O0LA 1CTQA 3DXYA 2MYPA 3ILVA 3VNVA 2IIVA 3IP3A 4QOIA 5EJ9A 4G07A 4KLRA 4YUAA 1I50A 3HKBB 1ZJZA 1JG6A 4QD3A 3UFBA 5KNCH 5AKGA 3ZQKA 2BEUB 1NBIA 1P4HA 9LDTA 3MOGA 1THTA 1E61A 4OK5A 2NAFA 4IRUB 1FYXA 3Q4GA 1PLKA 4H7DA 4ETIA 5JWHA 1F7VA 5I9LA 5BMVF 3DHNA 1TT5B 1P1FA 4BV9A 2VUIB 5HG0A 1H9BA 2JGDB 2FUEA 4J9KA 5JS6A 4GOLD 4Z3OA 2H31A 1N2EA 3OJCA 4CG0A 1ZWLA 2R68A 1P60A 3DCYA 3CLRC 2MMGA 3I9KA 2ODTX 3WSWA 1BFDA 3WMWA 3M3PA 3VDMA 1ZONA 3OTHA 3UMBA 3MD0A 4KAXA 2NUTA 3PRHA 4MW7A 1MPXA 4ZXFA 2QM0A 1NI4A 4MQ4A 4H1HA 3FLBA 1M8GA 2DHDA 5BP7A 4GC6A 4TM8A 3GBPA 3VO9A 2HWXA 4UDNA 5CG1A 2HF2A 5AVSA 2VJMB 2VQEB 2ZI4A 3BCSA 3BKXA 3EEBA 3ZWKA 3S55A 4URYR 1OAKA 3EC7A 4CKYA 4E33A 5HGXA 2PSHA 3IPCA 3VAYA 1WV1A 3TDKA 1J42A 5IN5A 2Q4DA 4DWJA 1MOPA 5KEIA 3KK0A 4PONA 3UQYS 3MZ0A 1WUIS 2B5WA 1IXYA 2WLSA 1P7ZA 3G02A 1KE1A 4CLOB 3PPXA 4YRDA 1NUUA 4A6XA 2VUSA 1DRWA 1ZM2A 3QGMA 2VRNA 3F6PA 1PJCA 4Q37A 3T5KA 4ONEA 4B84A 3GJ0A 2YN2A 1LX6A 4J16A 3L8FA 1EB8A 3WLHA 3N76A 1DJPA 1ZXXA 5IXYA 3NUQA 5FPRA 2RHHA 1N2XA 1XE3A 1ZVQA 5JW6A 1PJ2A 1LTHR 4YPOA 3RIZA 2IYFA 1J8MF 3EXEB 3DBRA 2V6FA 2QNIA 1ML4A 5F1KA 5FR1A 1JQDA 2CD9A 1GNTA 5M34A 1IRXA 2CJXA 1HH4A 2VBIA 1PJTA 1WEKA 1RPZA 4AQ7A 3DDSA 3IUBA 2R3SA 2E87A 4PU0A 4M38A 1LSUA 1USWA 3KQKA 4FBUA 3UHFA 3ROQA 3X1ZA 1CJKC 1MTZA 3L1HA 3HU1A 5D2CA 1C9YA 4WCFB 1QZUA 2YIDA 5BSGA 1ABBA 1BCSB 3H9UA 5TRTA 3CPHA 4C0HA 3ZI4A 4G4SO 3U3JA 1SUFA 4A8JA 1TOAA 4P7FA 2CCJA 1I1NA 2ZWAA 3SQOA 3GFGA 3KX2A 3LOUA 4B44A 2UYCA 1OASA 2GJ9A 4P8RA 1RWNA 1QX4A 1A7JA 1VE5A 4MLCA 3KQNA 3WLIA 4KAFA 4U02A 3CVWA 5EVJA 2FVXA 2QX8A 2J9RA 4OUKX 5REQB 2UZ1B 2YZ2A 3EJ6A 1TEXA 3JASA 2OWDA 1N6IA 1U0EA 5IF9A 2DZDA 3GJ3A 4I55B 4Q18A 3JZMA 5EWLB 2A5YB 1P73A 4CR7A 4HWRA 3OZCA 2IITA 2NGRA 1G9XA 3C3CA 4V2IA 5AJUA 4JYCA 2I22A 2KS6A 5DMHA 1ENZA 3VNNA 5LSAA 3ZBTA 2DFLA 3ZLTA 4WN3A 3WC4A 2CEKA 4EHLA 2D59A 2EOAA 3R3XA 4PXYA 1SVMA 2GVNA 3ZVRA 2UXDH 3E23A 4X65H 2GPAA 3ZGXA 1R9JA 4LWPA 2FW9A 2FQYA 5I5XA 1JQJC 3BJIC 4FXOA 3RPEA 3SJAA 4ZYWA 2W42A 1GDHA 1JKMA 4PLZA 3T1TA 2TMGA 1P61B 1JXLA 1UPBA 2LCIA 1QOQB 3RVMA 3W3AD 1UODA 4ZDJA 2NUBA 4N6NA 3KWFA 4G25A 1SURA 2AF3C 2BLLA 3ZW9A 1ZCZA 2QTBA 2H7CA 4RTPA 2GD1O 1W9MA 2I66A 2W98A 1RK5A 3QNWA 4OOFA 4G5HA 4ESOA 4YHHB 5K01A 4ZANA 3ZKWB 1M0EA 1KJZA 1ZH8A 1E2BA 1MUUA 4LJSA 1UKZA 3PU6A 2AC4A 1LPNA 4TZ6A 4I55F 3CNOA 3DEKA 4U3JB 4AKGA 2OFXA 4OP1A 2XD4A 2E89A 2JFHA 1Y5MA 1EBUA 1FXWA 1ZL2A 2DUJA 2O2XA 1XLUA 3WIUA 4KYVA 3SP1A 4R7ZA 3H4DA 1LKZA 2UV8A 4D4LA 3SQWA 2C82A 3GZTB 4L6CA 2X77A 5SYAA 5DGHA 3GTPA 4EUEA 4U7DA 1UPFA 4A93G 4LGVA 2O50A 3MHPA 1IDOA 5LM3A 2XDAA 3EIHA 4UJ3A 4KV7A 3PW5A 1TC1A 2HJVA 1LEHA 3S28A 4DCCA 2UUPA 4LXGA 2VG8A 4XPZA 1DOHA 3DMHA 5HS4A 2AQIA 3HUFA 3OOEA 1MP0A 1UL1X 1RMTA 2M1ZA 4EHNA 1IEXA 2OWEA 3VSDA 1H0RA 2W8KA 1JMKC 4NF2A 1LNSA 3OOJA 1ODCA 2WJ3A 5F5LA 3GEPA 2WE6A 4ZVPA 1SCUB 3M4XA 2XCOA 3EQ7A 3QKRA 1QTIA 1JR3A 4FLEA 3CLUC 1GARA 5BYBA 4LQLA 1P2BA 4DLPA 3DQZA 3WLRA 1Q0LA 2PD4A 4EHHA 4ARAA 4DR4H 4I4CA 2GHQA 4GW3A 5CYPA 4YJGB 3QKIA 1T5BA 4O8ZA 1P80A 3UENA 3T61A 1A3GA 4ENPA 3FRHA 2R92A 3TD6A 2K5UA 4K05A 3SHWA 3FM9A 1QVAA 3A4NA 2ZSKA 1B15A 2HU8A 4ZYVA 3BMCA 5SZKB 1D4FA 1OIWA 2IH2A 1KAMA 2UUCH 1SCAA 3GZ4A 3OLZA 5K0EA 4FFLA 3C7CB 5TLSA 4J0FA 1IN8A 4FIDA 2DQYA 4JI8H 3HVKA 1VPTA 1R9TA 3W4JA 5G0VA 3QLJA 3CGGA 4KQEA 3BFKA 3VNSA 3RSOA 3HA2A 2WTXA 1HF3A 4H27A 1LI4A 1P33A 1E63A 4YMUA 2UAGA 4DIDA 4GKJB 1LD3A 4OX9Y 5ELMA 1R0WA 4LSZA 1DAMA 2A78A 4MUYA 1BQEA 5CD1A 4H31A 2MOKA 3AX6A 2JA5G 3KQWA 4TSKA 4EJSA 3I30X 4B71A 4XPIB 2GPWA 4Q02A 4KJZA 1YZKA 4GI5A 2X6TA 5BWXA 3PUHA 5IAKA 4IDPA 3PYLA 2WDPA 1YZFA 5FPSA 3BJYA 1AZSC 1AKEA 3IHLA 2C20A 2VATA 1K68A 3FMGA 1XVAA 4QUGA 4CIDA 1ES9A 1U7PA 3U3KA 4E1VA 4DR3H 2CLKB 2DULA 4WOKA 1WJGA 2Z57A 3IQIX 3ILHA 1B33N 4D0GA 5LZ8A 1SU6A 1TI7A 3ZVMA 4IRKA 1EFDN 3GLVA 3OWOA 3T7EA 1DBIA 4XQ9A 2AEEA 2BGJA 2X4LA 4V1CA 1DP4A 2VDRB 2BD0A 3NTXA 1N33B 2IUFA 5LNK1 2FPSA 4DZRA 1KS2A 3NP7A 4YT8A 4ND8B 4LV6A 4RM3A 3OQ1A 1VPLA 4X8MA 4ZCTA 2XMBA 3V5NA 4LZPA 4CKCA 1MG0A 4FYJA 5I5WA 3O8RA 1P2DA 1PKEA 3RVDA 1KSFX 5TQ2B 4WCFC 1SVLA 3L41A 2Q9BA 1Z4NA 2BMEA 2ZGVA 1RACA 2HCFA 4TL7A 5ICSA 3HV2A 1U7OA 3E3LA 4KR0A 4QYMA 2HREA 4B87A 4R2XA 3SXPA 5AUNB 4GLFA 3L8GA 1JFSA 1AU9A 3T3IA 3HG7A 2CGEA 1KDVA 1LNQA 1Q0ZA 1V4VA 3MGGA 1VB5A 1L4GA 2QLLA 4N49A 1CF4A 1PJ3A 3U1BA 1TCCA 1ZESA 2XQJA 4QA9A 4X3PA 4R9VA 2BKVA 4PZEA 4B3MB 1E2KA 1Z5PA 4L8LA 4DL7A 1KY4A 5T8KC 4LJ9A 3BX1A 1W52X 5H4GA 2EEZA 3K9WA 1AOXA 2A1UA 4RZSA 5KTKA 2I1WA 1I4WA 4KPUB 4FE3A 1ILWA 3CB4A 1O97C 2XUDA 3FI9A 4K9QA 4D92A 2UDPA 1QHNA 3GUCA 2C2HA 5LU8A 2O2DA 2GRAA 2A0FA 5IP7G 3AQIA 4RS3A 1EVYA 4UHHA 4RDCA 3FSRA 3DYVA 4LOLA 3J7AC 2BM0A 5C35A 5A9TA 2JVIA 4IXNA 2PUDA 4AULA 2BLNA 3OTGA 3EZYA 2UZ3A 4R9RA 4UTNA 2YZNA 4NBNA 1Z8HA 1DJMA 5LP6F 4QFDA 3HLYA 2ETVA 3CSDA 2WUEA 3SIRA 3V6HA 1Q74A 2MYNA 1X42A 4W5OA 1VJTA 4GX0A 1U9JA 2DUWA 4O3FA 1G98A 1EP3B 3HUTA 1GFIA 4RGQA 3Q1LA 3CG0A 4YDSA 3NHZA 5GZ6A 4YCJA 1M73E 2FFJA 5KCZA 1N1DA 2BRUA 2GBLC 4MEJA 1JHRA 4BGIA 3IUNA 1QHSA 1SWVA 2GJSA 1X6VA 5ICCA 4EAAA 3WLPA 1NN0A 1QHHB 2ATVA 5KVVA 2QTAA 3GW8A 4G2TA 1E3JA 1M6HA 1C3EA 4C6RA 3NHBA 3I1JA 3PKZA 3Q87B 3NUAA 4TMVA 4IYJA 1SIBE 1Y1QA 2DMRA 3FWHA 2BGIA 3HKDB 1GNPA 3C6BA 4CMIB 4CMJA 3RIHA 4RNCA 2YJ3A 4R54A 2D2XA 4BHTA 2X5XA 4M0LA 5FWXA 5BT9A 4HMQA 2PVPA 2ID8A 4B6GA 4I9FA 2N1BA 3K6KA 1PT6A 4GBJA 2WVJA 4NMMA 2DLNA 3HN2A 1Z34A 4RS4A 3MWDA 3PP8A 2YJ5A 2CVHA 1YE5A 1DINA 2J7PD 4NCAA 2VAVA 3EVCA 2DUNA 4PIMA 4PPFA 3P9CA 2ZGIA 4N7JA 4WGGA 3FDXA 2YBDA 2COKA 3DOIA 2DEUA 5A0TA 4B7XA 1BD4A 5SY6A 3W9SA 3T3EA 2EC5A 4O1HA 3BJEA 4EY6A 4CMFA 5F9HA 4B7AA 4F56A 4TXNA 2TMYA 5EXTA 5CFMA 1C7EA 2YOGA 2B7CA 3I9JA 3ZG6A 2PMBA 3N8KA 3DJYA 3W1EA 1N3LA 5KSWB 2A30A 4R2HA 3BQ2A 4ZYTA 4DCGA 3ANSA 1PT9A 4LOHA 4EKIA 4PC2A 5SZJA 5C9ZA 3NOQA 1Y0BA 2J6HA 4F0JA 3L43A 4A8PA 4RAOA 3KPJA 5KYXB 2Z2IA 4O7SA 2JA6G 4MB6A 1DOZA 1D4AA 3KQTA 5L7WA 1SRRA 2YC4C 4GICA 4JBNA 4N3GA 3H1FA 3L6RA 3N59A 4XGRA 3DBHB 3L7LA 1YFZA 9ATCA 4LFAH 5FTLA 3QIVA 2R85A 2C7PA 1YBAA 3V7WA 5AKYA 1I5EA 2WJWA 2OY0A 2RGAA 1D2RA 5ICGA 2FQQA 3G2PA 1SCNE 3EGEA 2QTWB 4BE4A 1TJ4A 4ENRA 2X8WA 3INTA 3D43A 4MS1B 3KTAB 3VR5A 1KQOA 1V2GA 4MUJA 2WLTA 3DFZA 1X7XB 1YR3A 4C4TA 2ZUBA 1VP3A 4FS3A 1HTWA 5HWSA 1CLEA 4A6EA 5JRDS 5DISB 1UXJA 3BH0A 3EGOA 3LY5A 3PNOA 5C1PA 2A35A 1P0FA 4F8EA 2M05A 4EMTA 3O73A 1R3DA 1RFLA 4IOLA 3L9XA 1CJTC 3IV7A 4J1TC 1V5EA 3OP4A 1J0XO 3ITDA 3ZI0A 2SHKA 1DT3A 4WLNA 2BFDB 2PN1A 2VOBA 3TSCA 3ESDA 2HBQA 2BH9A 2VOEA 2QRNA 3VPGA 2QRKA 3OPYI 4D3SA 2PKEA 4XQGA 1QV9A 1LDMA 5CMLA 3EPKA 5F3WB 5L40A 1PFGA 4UNRA 3NYIA 2JIQA 3PX2A 2VHEA 4CKBB 3AY0A 1TMKA 1P0PA 2RDIA 1BFUA 1V16A 4D3ZA 4K2AA 1P45A 4ZO7A 2ZVJA 1MZVA 1J9EA 2VWHA 4KQGA 3J81W 3UQZA 5JJLA 1LWNA 2NW6A 4WINA 2QVYX 1W85A 2XUHA 3OHBA 3KHHA 1RHQA 4IICA 3ONDA 1GIAA 3FPEA 3MNFA 1GPAA 5KAMA 5DHFA 2ZP1A 5CTJA 3X1YA 1H1LA 4FONA 1WXHA 2J4FA 3R9XB 1W96A 3HI4A 1XTZA 1B1AA 3QNMA 3QQMA 1E1LA 2JEGA 4NFSA 2XGGA 5J5CA 4F85A 1UC8A 1I1MA 1P44A 2ERCA 4HH3C 5D51S 3D0KA 2JI6A 3WGGA 3A8TA 4B4DA 3S7ZA 2X58A 1JKXA 2H48A 2M9MA 3HDJA 4KIUA 3D6MA 2ZJFA 1BJTA 2V4UA 4ZEXA 4P4UA 3ADKA 1PQ4A 4LUCA 1ZHFA 3NM5A 3V6KA 4B7UA 1NVFA 3ZCXA 4Q1CA 5LLTA 1L7BA 3FB1A 2PUCA 3BMQB 3U4QB 3QVJA 1YB5A 1MO4A 4QAQA 5B3AA 1MGPA 3B5IA 4IOKA 3CEBA 1XNQB 3GLIA 4A4DA 3PUJA 5DDIP 1KJQA 4IO1A 3CX3A 3GPLA 5EHGA 1USIA 1QE3A 5EKSA 1WKCA 4KQKA 1F12A 2IHUA 3VH2A 4JSRA 3V8VA 3G2HA 4G5RA 2VHXA 2W2KB 4L0QA 2W48A 3VOBA 3DOHA 1T1SA 3AU9A 2J3QA 3FFXA 2H92A 3BACA 2IIBA 2YJ6A 4A2PA 4W9NC 2GO7A 4XW2A 2VHWA 4BX9A 1A69A 2NUAB 4CKZA 2HPHA 3IVRA 3D3KA 3D7KA 2AZXA 3KDSE 5LYJB 1N2OA 1UKYA 3UKDA 3EGDA 3S27A 2VK1A 4FILA 5K3DA 1NXSA 1OZ0A 2OC4A 4NYEA 4AG5A 1ZICA 4RDIA 4J6FA 4P98A 1P7CA 1S8OA 3MJVA 4OL0A 4C0KA 3PVXA 4BQNA 3D1VA 2Q46A 4J9PA 2JI7A 5HF8A 3BBLA 5E3JA 4EFDA 5DGXA 2FZ5A 5JAOA 4WE3A 2GN1A 3TIVA 1SCBA 3FB4A 4OYRA 1DAIA 4O2BB 3DOCA 2BBWA 4N65A 5GZ1A 3KB6A 1DBPA 4NULA 1T9ZA 2ZUDA 1GPWB 3MWLA 2Q0XA 1DEOA 5KJ1A 1M83A 3E3OA 4RADA 5CXUA 1UMCA 4N3AA 4EY3A 2ODEA 3TQIA 4B3TH 4L5IA 1JJAA 4R6XA 1XB2A 3SSOA 3N8DA 1QHYA 2QQ0A 1YBFA 3DLHA 3G5TA 2WIDA 1CRZA 1NF2A 4ESVA 1AZTA 4KYTA 2B4YA 2XSZA 3NDPA 3AEYA 5AUQA 1H5QA 3TZLA 2WIAA 5BN4A 3W5UA 2NU7A 3PDWA 2IDJA 1R0CA 4CHGA 3GIPA 2D00A 2C96A 1JSCA 1MA0A 1VGQA 4EYGA 2Q5QA 2ZJTA 1UQRA 4HH4A 5BQ3A 3BEDA 4JYPA 4TMTA 1OIVA 4KWTA 2O0JA 4UNSA 4IMPA 1ZGJA 1LS6A 3IR7A 1WCWA 4P38A 1TEHA 1YDHA 2VBGA 3CH6A 3N41B 4B34A 4JIMA 4GBGA 5G0UA 2FX2A 1P2VA 1BXGB 3PQ6A 1JZTA 4XD2A 2JLUA 4RV9A 4WPGA 1LK5A 1W94A 1RLTA 1PVVA 5CT6A 4B79A 4DDKA 2HA6A 1NGSA 1GAQA 3WR5A 4C0BA 4XX0A 3EPRA 1UK8A 5ISMA 2ZYHA 4KFRA 4O2BF 4BN5A 4Z9AA 3DGEC 3ME5A 4BE9A 4BMYA 1UWVA 5DBEX 1A5BB 1ISFA 4LJ4A 1CUCA 4WXRA 4FT2A 3LBFA 2O8FB 5AVVA 4OEHA 4RZRA 3AUAA 3IH5A 2FFQA 1XALA 1EQAA 2ZQZA 2VHVA 2BMAA 3RUEA 2XMPA 1S0NA 5CLJA 1PWHA 3G9ZA 1TU0A 3NFYA 4QXPA 3B3FA 2NSYA 4L4SA 1BVHA 4NMWA 3ZNPA 3SZMA 2EWVA 4TRRA 2TMKA 4WNIA 1P2GA 5EXPA 2ZULA 1I1OA 1R8YA 2HSGA 1QYCA 4OUDB 1Q44A 3VDQA 3EARA 1J49A 5H3LA 1I7NA 4Q0MA 1D2HA 1KAOA 1RHMA 2C7VA 3SSMA 5K4AA 1Z5ZA 5FWYA 3QM1A 1Z56C 4Z9FA 4ZQCB 2M32A 1XHEA 4QUIA 4TYYA 2BISA 5IAGA 4IJVA 2WIJA 2X7XA 4DAAA 3PW0A 1AXEA 4QW9A 1K88A 3NH6A 2R1VA 2WJPA 3HDGA 1H6DA 2Z83A 1O6FA 3LQQA 1KJJA 3EDOA 1MOZA 4P3XA 3VR0A 3AF4A 4OHBA 3OTOH 1E3LA 3EWAA 3F3KA 1VGVA 1Z7YA 3WMEA 4ZI2A 2GLUA 1WE2A 4EJMA 4PAGA 4YAJA 1NVMB 4XKJA 1Z75A 4MJ7A 3RK0A 5DP2A 5FUYA 2AX3A 1GU1A 4NIMA 3ZZUA 4KAJA 2IZ6A 5A9SB 4ARUA 2XB2A 3LT0A 3AP3A 2BIFA 1ORIA 1MHPA 1AGPA 4IDDA 2RIPA 2ILVA 4IS3A 1X7ZB 3T4UA 5AI8A 5KDOA 3W6PA 3GX1A 4G8BA 1JJIA 1L2TA 5BWWA 1B2LA 3RSFA 1LFDB 5C18A 1O2DA 1EJBA 2JLYA 1FFDA 4H7IA 5JI2E 4MJ3A 1E1QD 5BO5A 3KM0A 1YKFA 4MDEA 4NQRA 2AJLI 1MORA 4X64B 1NXVA 4R2JA 3LCUA 4N0MA 1Z6AA 2B1IA 4N40A 2C61A 1HNWH 5L1JA 1AJEA 4FGSA 2HHLA 4OBEA 5J59A 3MTGA 1IN5A 4LHWA 4ALKA 3X2FA 3R9IA 4ECZA 1PDVA 1IXZA 2JIRA 1SN7A 1NKVA 4OI0A 4FT4A 1ZNXA 4QUBA 3VMFA 4YR9A 4NBUA 2FXIA 1X1DA 3LX6A 4HNUA 3E22B 2ARKA 3I61A 3R5SA 2VA9A 2C95A 4W82A 5H4HA 1P0CA 1XTQA 2WF7A 3QVSA 2PNFA 4CIWA 1ZK4A 3PIDA 2Z95A 3EDMA 1CKNA 2V6JA 4GECA 5F35A 2HJWA 1L4MA 1E1YA 4LJLA 4RB3C 3KZXA 5H5JA 4FGUA 3CRQA 4PPNA 4D9CA 1GCAA 1OB5A 2WE8A 4QARA 1FCJA 1SVSA 2HLDA 2IPLA 3WWIA 3RANA 4LSXA 2C4NA 2OCGA 4RDHA 5ARBA 1QDUA 3MS7A 3G89A 1JA1A 2BKLA 4AMVA 1SMKA 3KOZA 3M81A 3I8OA 4GG1A 2FQWA 1ZIOA 2F3PA 3HPQA 4DDVA 5BYAA 2EP7A 4G3IA 4MRSA 5KYGA 1YTLA 2ZI3A 1ZCBA 5JYCA 2BSAA 3RRNA 1VLZA 2HIXA 2UU9H 1Y6JA 5IUNC 1JEJA 5FI0B 1V6CA 4EFNA 2XWSA 1JEOA 3ZK8A 2W6JA 4HWTA 2QD5A 1GPNA 5CIYA 3AIMA 2PUAA 4J0IA 3PNVA 4Z53A 1TIKA 1XU4A 1XWWA 3LPAA 2XODA 3RHZA 2YNMA 1PR0A 1Z5GA 5D85A 4BAUA 2QAGB 3WV4A 5H1YA 4Q7MB 3VTZA 1ZBDA 1QO0D 4X41A 5ALHA 1X1CA 4NMLA 1ADFA 3ELBA 5AI6A 3W1VA 1I7PA 1DWPA 2P9GA 1U65A 5F4BA 1FDRA 2XUJA 4Q1DA 3TJRA 2F6RA 1TGYA 1A9QA 1YBHA 1LBQA 3VYWA 2J6SA 1VHLA 4DV5B 3ZNQA 3AIOA 3DUFB 3T12A 3A26A 1XTBA 2VDMB 2VJQA 4KEAA 4KQ2A 4O3NA 5KG4A 2ADFA 2FSUA 4LYHA 4JNKA 4KK3A 3KNZA 3T5MA 1AXRA 4BVEA 2DH6A 3AV3A 4NBKA 5TMBA 3EQ8A 4DMUB 3PEWA 2IVZA 4RM2A 5HKLA 4KUEA 4J9QA 4TSFD 3TAXA 2RI0A 2FOLA 2VK8A 1SRQA 4HS9A 2JH9A 4LYGA 1B16A 4Z2YA 5L7TA 5EIEA 1ZU5A 5AI5A 4L4UA 5IYDG 1NNLA 4EYSA 5DM1A 2Y6VA 4E2WA 1BRTA 1X1RA 3G6XA 4MVJH 4ZT3A 3H5NA 2NVBA 4UZSA 3HCAA 2WSLA 4HYKA 4HQKA 5JR3A 3OQNA 1ICEA 5JXHA 1EMDA 3RU2A 1AY0A 3VSCA 1QP4A 2DAPA 5KREA 4PCVA 2CXUA 4F4CA 1XZJA 4RENA 5IZ4A 2X7HA 2Q1UA 3DZ8A 1YNOA 1ZA1A 4MHOA 5IT5A 4CLXA 3Q10A 4DNOA 2XE8A 5EE1A 5BVHA 1NZJA 1T13A 1SD2A 2DFTA 5BSRA 3L6CA 1YJBA 4P80A 2IHNA 1F8YA 1ML3A 2UXCB 1BVYF 3A25A 4QU0A 1EZ4A 2HJSA 3OPVA 4KLCA 2VSNA 1Z07A 4CGZA 1NPDA 2PQ6A 3GTKA 3K94A 2ODBA 1OWOA 3I6ZA 2DKFA 4M7WA 3AR5A 3MWEA 1DKLA 2YJ4A 3CNBA 5CITA 1VDMA 1T2AA 2JGMA 1V9SA 3QPDA 2LGJA 2ODPA 2CLMB 5DXFA 3GV8B 3F5DA 3DO8A 3OM0A 1PZFA 5JAHA 3V8MA 5KFVA 3PA8A 1XROA 3R74A 1T8YA 1B3BA 2OLKA 4CM8A 5CVTA 4OGWA 2PT9A 3VUFA 3A2KA 2JFWA 2YJZA 3PW4A 5HBRA 4LY0A 3R0IA 2ECPA 3ECCA 5A7GA 1H2XA 121PA 1L7MA 1LW6E 3RTBA 3N2KB 2R8YA 3M5PA 3OURA 4B8WA 5C8YF 2AFHB 1YK0A 1E1RA 1Y6QA 3PA6A 3GFTA 1CSEE 3KXIA 2JFFA 4DNFA 4JJ8A 2P4UA 4M98A 3NATA 4OLJA 4FS2A 3HB9A 5DSZA 3FHJA 1M1NA 5HQ3A 1C0PA 3HDTA 4EG1A 4LMAA 4XTRA 3PZRA 4JC8A 2WD8A 1F2UA 1XU9A 2O54A 1OXTA 3F74A 3TKAA 3KJZA 1GGNA 3RYHA 1M10A 2HRCA 5JIBA 4BVHA 1UJBA 3O92A 1QP8A 2OPBA 1RLJA 4JLBA 2HSWA 5HKKA 2Q5JA 3ESCA 2H1CA 3GDEA 2YOFA 1MTOA 1JIXA 3IMFA 2RC6A 3TM5A 1PI3A 2JPDA 3O47A 1FRQA 4YB8B 2E5LH 3T5TA 1HG1A 1M74A 4TUYA 4JVMA 1D1TA 4NZOA 1T43A 3QKTA 3TLAA 4CC5A 2O8NA 2FVYA 4CM3A 1D1PA 1Q22A 3IESA 2BYTA 1E3QA 4ZI5A 2ZCJA 4N5LA 3ZW8A 4GKBA 5FP0A 2WC1A 1W29A 4L85A 1IL0A 1SEVA 5B3JA 3DBOB 3PWSA 3KYBA 2J6IA 4D9NA 3EIXA 2HQOA 3FPCA 2I33A 1GT91 1A0GA 3LC7O 5BNIA 3KR2A 2ZVPX 2W2MA 4XFJA 4HGYA 3KT3A 3PXEA 2FEAA 4G0MA 3FGZA 2HHFA 4MPPA 3C2QA 2CVPA 4GYKA 1DO8A 1Q7RA 4QC2A 4LRSB 2ZLBA 5ETJA 3GARA 2BY4A 5IT9A 4ZPJA 4AKHA 2JFPA 3UK7A 1UBTS 5KQRA 4G1VA 3PJRA 1MNAA 1Y9JA 1DZIA 1ZD4A 4UTRA 1EFVB 2XF8A 3A04A 4QOGA 5E4JA 2QE7D 1JI0A 3AJDA 4NJEA 1TECE 5JI3E 4O3RA 4A3BG 1KVUA 3INYA 5I7WA 1VCHA 1YB7A 2Y6UA 1V0JA 1VPDA 2C00A 4BFLA 4GVPA 2A0UA 3AWIA 2AYXA 5E9JA 3ZE9A 1D2CA 1XDWA 3PC8A 3RYCA 3TVTA 4NY1A 3PX7A 1SIOA 1YDWA 3PJGA 1EUYA 3MR3A 2VPXA 4JGIA 4ZGBA 3T5AA 4PANA 2I5PO 1PTJC 3HJCA 3GG2A 3NV7A 5D3MA 1XZ8A 1XAGA 5D1OA 3RC1A 2R60A 1NULA 4A2QA 2JHAA 4LHXA 1ZR4A 4MVJP 4ED0A 4MPDA 5KFKA 2QAGC 3E0XA 4R8SA 3V8RA 1M75A 3R5HA 1Z16A 3I0MA 1T0IA 1XNGA 4LECA 1YO6A 3EGWA 2ATIA 4DCOA 1OFIA 2C3UA 3CRMA 2FH5B 3GUHA 3U13A 4GR5A 4J7AA 3FTNA 8OHMA 3GJYA 5ALTA 2G0NA 2E6UX 2A9OA 3KL2A 4Z9BA 1WLYA 4Z4HA 2XBLA 2XVYA 2I78A 4YJ2A 5I9MA 4J1QA 3F6CA 5KOIA 4AY4A 1F0YA 1TD1A 3GHYA 2WM3A 5HE8A 4QRIA 5AQEA 1LF5A 3UAVA 1T6BY 3EY9A 1I3MA 2HF7A 1NMSA 2CHGA 4J43A 3AJ9A 3VYVA 3H0CA 3K9QO 5FFNA 3K5PA 4IZHA 4FGRA 5T67A 1C4XA 4AJEA 3JAMW 2DT5A 3OFJA 4ZZIA 4ZT4A 2H0RA 1QK3A 2F1HA 3DCIA 2BQUA 1JPUA 3KXYT 4MYDA 3WS7A 2QG4A 4DMMA 4E0BA 3E2PA 3R3SA 2VPYA 1GZUA 3ZZNA 1GILA 5I7OA 3HR8A 9GPBA 5KOHA 1A1SA 3C39A 5I3CA 1J23A 1M72A 5CBKA 1GYPA 4URXR 3VU9B 4A3DG 1NP6A 1DOAA 3NS7A 2RMKA 4A7PA 5IABA 4HNTA 3BXOA 3T1HB 1FL9A 3NEPX 1DBQA 3UUEA 1JDZA 3BF7A 2C58A 4EP1A 5IJXA 5DYYA 2ZRMA 2A88A 3FKJA 3AINA 2J6UA 2ZIUB 2RGWA 2RHDA 4DT1B 1V37A 1KJIA 5CX1B 1G3RA 5K0FA 2O5VA 1W35A 1ONNA 2XW6A 1G20B 4UCXA 1K75A 3AI7A 4J94A 1GQOA 1ESMA 5IRCD 1N34B 4GPZA 4OIFA 1O95C 4Z1MD 2A94A 4A73A 5KTPA 1D6SA 4EY8A 4RMNA 2I1QA 3BXZA 2O8EA 4PSDA 4UM9D 1X1EA 2JASA 3V6MA 1MJ5A 3GC6A 1HEUA 3PFWO 4MR9B 2C57A 2RGNA 5GQSA 1OC4A 3NM6B 5THKA 4TM5A 2JKVA 5IJZA 3MTAA 1LDBA 5HFNA 1M76A 4IKOA 2CLHB 4YWHA 1RCUA 2LTAA 3LKVA 1EK1A 5JS7A 4KPGA 2BUAA 3DLPX 5EQDA 4MXDA 4GOOD 3U4AA 1FQOA 4MR7A 3MMNA 3P97A 3CN9A 4B4KA 2ZJOA 4DUGD 5EIXA 3OQIB 2G7MC 4IW3B 4ALIA 1GQ2A 2Q0QA 3I9NA 4NTZA 4LJ7A 1B8VA 3IEVA 2WTEA 2BSXA 4NCXA 4PG4A 2NZWA 1WCMA 3FMFA 3BGOS 4NAUA 4AB1A 2ACWA 1QOZA 3VNBA 4LF9B 2IOFA 1EVEA 4AMUA 1XLTC 1P5RA 4GXTA 3TLGA 3SX2A 3DL0A 3T06B 2Z5FA 2JAWA 3ZH2A 4MQFB 4EYEA 3DTVD 4ZI7A 1GTSA 1WXIA 2V7UA 2LPMA 2WR8A 3LHFA 4B83A 3H2YA 1FY2A 4GRAA 4KTTE 1XDGA 4C29A 4YACA 3SX0A 1MJHA 5J4KA 1IY9A 4AVYA 1OXXK 1U31A 1IJBA 4IUCS 3TSOA 4L5JA 1EZ1A 3QVKA 4JEUA 1PGQA 1E66A 4X1KB 4TS3A 4K9PA 1Z6ZA 4TV8A 1U8TA 3WADA 1G59A 1Y7HA 1X7YA 3TDNA 3VH4A 3AEKA 3KXLA 5D87A 5IP5A 2FB9A 5JG7A 1QNLA 5KFRA 3I76A 1U3CA 3GLFE 3OIWA 1QGUB 3WWCA 2QORA 3EG5A 3RCBA 3G59A 2R00A 2PSEA 3AGPA 1TW3A 2QTRA 1I2ZA 2GEVA 4J0HA 4Q8EA 5AK5A 5EIFA 1NM5A 4EVIA 2XZDA 2ILTA 4JLOA 1KGDA 1U8YA 2QSUA 2VP6A 3RI3A 5HIAA 4YUYA 4PCLA 3PNPA 3D6FA 1QRDA 3U31A 3FAZA 1W4LA 3HO6A 4LJ8A 5CFNA 3FG9A 3W78A 1JEDA 2FUG1 3HVUA 2PFGA 4WZBE 3PEVA 1FLAA 3IMGA 2X9VA 4N7BA 2HCBA 1SUCA 2UYQA 4LF5B 3WLQA 2E55A 4GM0A 4NEHB 3IOMA 4UCOA 2JFZA 3BTOA 4BLOA 2A6PA 1T5LA 3S2IA 2FZGA 5FA6A 5E2IA 5KYKA 3N9IA 2DE0X 2F64A 4DZTA 2O7RA 2OLSA 1Z29A 2OVFA 4X00A 1AQ6A 4OHXA 2YV1A 1T3SA 5EQTA 1UMBA 1X9NA 1CQPA 4M3NA 4GYJA 4ND1A 3H1AA 4BJ3A 2BFEA 5F1PA 5I8PA 1X3SA 5JJIA 5IJ9A 1B23P 3U19A 1HLPA 3CH4B 1HFKA 4C4SA 3O0DA 4IINA 5KTSA 3PEUA 3F1LA 4FFVA 3DMTA 1QGOA 3FYTA 1SUBA 3EIEA 2CSXA 2BHRA 1BW9A 1OT3A 1JMYA 5EWEA 4R68A 4EJ2A 1PSWA 2RBEA 1XZKA 5LXTB 2PZAA 3PXDA 1R00A 1VA4A 1PEYA 1LXCA 1N8TA 2EKLA 3H5TA 4I14A 3K1AA 1KEEA 1MAVA 5F9LA 2GB4A 3TNJA 3QK7A 4RIGA 2P77A 1SBZA 5A3QA 5K8JB 5KVAA 4X66B 1XFDA 1KK1A 1RWPA 4LRUA 2C83A 1UKVY 3DR5A 2Y1LA 4FFBB 3MAGA 2LUOA 1KMHB 4NZYA 2ZYSA 5CCDA 3C8DA 1MMFB 3IELA 4R2IA 1OI3A 3V33A 4DL6A 4LAFA 4HNVA 5GAJA 1OH8A 2IXTA 1FJGB 4RXTA 4XDHA 2AOTB 2C35B 1U7DA 1Y1WA 4IAOA 4YDRA 2XGMA 2M6RA 3F71A 3M9MB 2YV2A 2PV0A 5EJ5A 4FYVA 5J5AA 1TCUA 4J0GA 3ENZA 3G0IA 2CL7X 5E1MA 4EA8A 2A5DA 1FBNA 4E4YA 1DAHA 3RT1A 3WL3A 3FDZA 3BICA 4E6NA 1OI7A 3LV8A 3QKSB 1HDXA 2YDXA 1XJ0A 5FA8A 3TOVA 4JENA 4ENUA 1NWHA 4QAJA 3RTXA 3PI7A 1TFUA 3CWCA 3GLHA 4ZFNA 4IVNA 4AK9A 4B9EA 2O2ZA 5T14A 1L4BA 2PRJA 2OEPA 5JVDF 3HU5A 5BQFA 3DM5A 2PV7A 3KR9A 3AR3A 1J24A 5LXTF 4YFYA 1YUNA 2C4HA 3F97A 3D8SA 1WVMA 5HZKA 1W4ZA 1SBHA 2FW8A 2NNWB 3NGLA 2AK3A 2ZUWA 4B48A 4EBFA 3GU3A 4CKWA 3ZE1B 2OLJA 2OD9A 2Q3EA 1SPBS 4YMLA 1Y4ZA 3DM9B 4XZ3B 1GG2A 3TI7A 1CCWA 3BD9A