1H2IA

Human rad52 protein, n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
LCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN RAD52 HOMOLOG
publication title Structure of the Single-Strand Annealing Domain of Human Rad52 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 46
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1h2iA01
1KN0A 1H2IA 5JRBA
chains in the Genus database with same CATH superfamily
2P0IA 3THUA 3SN4A 3R1ZA 4MGGA 3P93A 4ZCWA 3TTEA 3SQPA 3IK4A 2C3DA 4M52A 4MKSA 1P43A 3Q4DA 2HQMA 3O0HA 3FYYA 1OEPA 1RVKA 2PSNA 3QFBA 4GYPA 3DERA 3S5SA 3EANA 4EM4A 3CYJA 4FP1A 3DG7A 1FO4A 1H2IA 2OVLA 3OZMA 3T8QA 1N5WC 2PGWA 2RABA 3CAWA 4IL0A 2QQ6A 4K7ZA 1BWCA 2ZZBA 3TCSA 3IJLA 4EM3A 4J1OA 4Z1YA 1AOGA 2YAUA 3R0KA 2OPJA 4M6UA 2NVKX 1GSNA 3ZVHB 5FJOA 4G8TA 2HXTA 4ADWA 1EBDA 4FDCB 2W54A 4H4WA 4HPNA 2ZZ0A 3FXGA 3H8AA 1LVLA 2O56A 2P8BA 3S47A 1D7YA 3DG3A 4DX3A 2PU1A 1GRFA 1ZY8A 1JPMA 1OJTA 2ONEA 2PGEA 4IT1A 2GGEA 4H2HA 4GGHA 1MOKA 3RR1A 1MRAA 4H4VA 2XH7A 2OX4A 4YWOA 3ZLGA 1M6IA 2AL1A 3TOYA 2E3TA 1EC9A 2GSHA 3UJSA 4DHGA 3RGTA 4JQ9A 1W6TA 1FIQB 1T3QC 4H4PA 3CXOA 2HZGA 2P8CA 2WOVA 4EMIA 1LPFA 2PTZA 4A6GA 1KN0A 3OW1A 3A7UA 4HN8A 5EU9A 1GV4A 3UJEA 3DDMA 3UXKA 1RM6B 3SSZA 3H4KA 3QPEA 4TVWA 5TR3A 1N63C 2WP5A 5EBKA 1DNCA 3AMZA 2GR2A 1FHVA 3TWAA 3VCNA 3VCCA 2PMQA 5BOFA 3SJNA 1EBGA 3MSYA 3R10A 1XHCA 3EF6A 3PG6A 4M0XA 3ZVHA 1NPXA 1PDYA 3DG6A 3B9JB 4FX9A 3SBFA 1JDFA 3U9IA 3VA8A 4E4UA 3NRZB 3V4BA 1ZDLA 4KWSA 1IYXA 2WPEA 5FS9A 2OO6A 2C3CA 3I4KA 1ELSA 1KKOA 3DK8A 3TJIA 4G7FA 3PFRA 4H4QA 1KKRA 1R0MA 1R6WA 4JHMA 3I6TA 1GEUA 2WOWA 4LA1A 1BZLA 3QFAA 4EMJA 4EQXA 1SJCA 2AKZA 3N4FA 1VDVA 2PP1A 2GGHA 2FYMA 3UCCA 3FG2P 3R25A 1VQZA 4J56A 5U1OA 4EMWA 4IZGA 1FFUC 1ONFA 2GGIA 1V97A 3ES7A 3N6JA 4ZA0A 3GD3A 3NZGA 3UJRA 3MZNA 3RCYA 3ZLFA 1XDIA 2AAQA 3R0UA 3PWGA 3CGDA 3GY1A 4F4RA 2OZTA 4E6MA 3KLJA 2GH5A 5FS7A 2EQ7A 3UGVA 1YEYA 3NVWB 2JK6A 1DXLA 2XH2A 4GIRA 5JCMA 2MUCA 2WPCA 3HW2A 3U4FA 1E9IA 1XANA 3OZYA 2X8CA 2W3SA 1SJAA 2DW7A 2POZA 2FKPA 2XGZA 3DEQA 2PTWA 2F5ZA 4Z17A 4IP4A 2OQHA 5FJTA 1TYTA 1Q1RA 4FI4A 3NVVB 2HXUA 2OLAA 5FJUA 1WYGA 1SJBA 3R11A 4IP5A 5JRBA 1ZK7A 3SN0A 2WOIA 3Q45A 4TVYA 4KPLA 1FFVC 5G5GB 3CB3A 5FS8A 2WBAA 1GETA 2BC1A 2QVHA 3DJGX 3PWIA 3GRSA 3A7AA 1NHSA 5J04A 3DH9A 4NEWA 4ZOHB 3UJFA 5IDZA 3K1GA 3MWCA 2OQYA 2PU0A 3JVAA 2W0HA 1N5XA 1X2HA 3N6HA 4IL2A 2PTYA 1BQGA 1WUEA 4H19A 3ENLA 4KEMA 3T4WA 1GRHA 4LIIA 1F9CA 3PK7A 2OG9A 2AKMA 1GRAA 4MMWA 4EQWA 4J57A 3VC6A 3DFHA 2OZ8A 4NEVA 4DNAA 1EC8A 1GRGA 3EKGA 1ZX9A 3D46A 5JCIA 1ZMCA 3RITA 3T9PA 2TPRA 4GGBA 3ETRB 4H4ZA 4H50A 1PDZA 1L8PA 3CXBA 2YVFA 4K8DA 3TWBA 4A3RA 3QN3A 1NHPA 2XH0A 1NU5A 3AN1A 2BCPA 3OP2A 1F3PA 3CK5A 1NHQA 3T6CA 2DW6A 3VFCA 5JCLA 1S7MA 4JN8A 1NELA 1TZZA 1N60C 7ENLA 2NQLA 5FJPA 3L5OA 3DESA 3CT2A 4E8GA 2CFYA 1TYPA 3LADA 4KPRA 4GFIA 1K4QA 2X8HA 2YVGA 4H83A 2YVJA 3H12A 4HCHA 5FS6A 3A7RA 3UJ2A 3BOXA 3JZUA 1ZXIC 1EC7A 5GRTA 2GRTA 4A35A 3TQPA 1GESA 2J3NA 1JPDX 3DJJA 2P3ZA 2GGJA 3ZVIA 5JCNA 3GC2A 4H4UA 1BKHA 2GR1A 2XSXA 1MNSA 1FEAA 2ZADA 3OC4A 3EAOA 1STZA 2GR0A 3OTRA 2EQ9A 2PPGA 3DIPA 4HCLA 3MY9A 2QJNA 3NFUA 1MDLA 3IC9A 4K2SA 2GDQA 3CGEA 3DGHA 3H70A 3DK9A 3GD6A 3V3WA 4X2PA 4HCDA 3V5CA 3Q6JA 1MUCA 3V5FA 1Q1WA 5KVIA 3D47A 2YQUA 2WPFA 3ZLHA 1DTNA 4EQRA 3VDGA 3DFYA 3NXLA 1GXFA 2EQ6A 1V59A 1KD0A 3L8KA 3MQTA 3IJIA 4KT2A 4DN1A 5BOEA 3B97A 5FMHA 3HRDC 4GMEA 4BV6A 4DYEA 1TKKA 2X50A 3IJQA 3RO6A 1JROA 1XS2A 3MKCA 2GGGA 2PP3A 3SN1A 4H4RA 4APNA 3DGBA 1FEBA 4YWSA 4DWDA 4E5TA 3MUCA 2A8XA 1P48A 1MO9A 4BURA 4E4FA 2QDDA 2PTXA 2PP0A 4GYPC 4H4SA 2OFJA 2WP6A 2OZ3A 5ER0A 3OPSA 3TJ4A 1ECQA 3GD4A 2HNEA 3BJSA 4H4XA 1TE6A 3I6EA 2PA6A 2X99A 2EQ8A 1SB3B 5U25A 3CGBA 3II4A 2QDEA 1FECA 3UCDA 3KUMA 2AL2A 3JW7A 3FV9A 3QKEA 2CDUA 4GRTA 4J3ZA 4K8GA 2GL5A 1F8WA 1H6VA 3P0WA 1MDRA 4ENLA 2OKTA 2QJMA 3CGCA 4HYRA 1GERA 2P88A 2GQWA 3P3BA 2I5QA 5FJRA 3D9XA 5JCKA 4HNLA 1NDAA 3FVDA 1N61C 1XPYA 3STPA 1GRBA 2QJJA 1WUFA 4ROPA 3DGZA 1ZKQA 4H1ZA 2QGYA 5KVHA 2RDXA 3AM9A 2W55A 2E5AA 3GO2A 2CHRA 3GRTA 4EWJA 2PS2A 2ZC8A 4GR1A 3LXDA 2W3RA 1NHRA 2QAEA 2V6OA 3NVYB 3QLDA 1JCTA 4DXKA 3HPFA 2R9ZA 1N62C 3DK4A 1JEHA 1GREA 3FJ4A 1X2GA 3LB8A 4HNCA 6ENLA 3RNMA 3H7VA 1JOAA 2XH4A 4GISA 1JRPA 1ZMDA 3ES8A 3TW9A 3VC5A 2ZZCA 3EUB3 1SJDA 2X8GA 3NO1A 3R07C 3BSMA 3NVZB 4H4TA 5G5HB 3N4EA 3URHA 4EQSA 1KCZA 2BC0A 4JDRA 4IHCA 2PCEA 2AL2B 3SR6B 4K1WA 1GRTA 3QTPA 2V3BA 3EEZA 4H4YA 5ENLA 2NPXA 3NS1B 3RRAA 2PODA 3FCPA 2GR3A 1FHUA 3SQSA 1EBHA 3UXLA 4JN7A 1YQZA 2V3AA 1ONEA 2MNRA
chains in the Genus database with same CATH topology
4EQWA 4J57A 1ZDLA 4H4SA 4NEVA 2WPEA 5FS9A 2C3CA 2WP6A 5ER0A 4DNAA 3SQPA 3DK8A 2C3DA 1GRGA 4M52A 3GD4A 1ZX9A 5JCIA 4H4QA 1ZMCA 4H4XA 2HQMA 3O0HA 2TPRA 4H50A 4H4ZA 2X99A 1GEUA 3QFBA 2YVFA 2WOWA 4LA1A 2EQ8A 4K8DA 5U25A 3EANA 1BZLA 3CGBA 3II4A 3QFAA 1NHPA 4EMJA 4EM4A 4EQXA 1FECA 1MO9A 2BCPA 3FG2P 1H2IA 4GRTA 2CDUA 1F3PA 2RABA 1F8WA 1H6VA 1NHQA 4J56A 5U1OA 4EMWA 5JCLA 1S7MA 1ONFA 3L5OA 4K7ZA 1BWCA 2ZZBA 3CGCA 1GERA 4EM3A 2GQWA 3GD3A 1AOGA 2YAUA 2CFYA 1TYPA 3LADA 2NVKX 1GSNA 4KPRA 1XDIA 2AAQA 3D9XA 5JCKA 1K4QA 1NDAA 2X8HA 2YVGA 4ADWA 3CGDA 1EBDA 4FDCB 1GRBA 4H4WA 2ZZ0A 1ZKQA 3DGZA 1LVLA 2YVJA 3KLJA 2GH5A 5FS6A 1D7YA 5FS7A 2EQ7A 5KVHA 5GRTA 1GRFA 2GRTA 1ZY8A 1DXLA 1GESA 1OJTA 2J3NA 2JK6A 3DJJA 2WPCA 5JCMA 1XANA 3GRTA 1MOKA 5JCNA 1FEBA 2X8CA 4H4VA 4GR1A 4H4UA 2GR1A 2F5ZA 4YWOA 3LXDA 1FEAA 3OC4A 3EAOA 1NHRA 1M6IA 2GR0A 2EQ9A 2QAEA 2V6OA 1TYTA 4JQ9A 1Q1RA 2R9ZA 4H4PA 3DK4A 1JEHA 3IC9A 2WOVA 5JRBA 1GREA 1ZK7A 3CGEA 3DGHA 3DK9A 4EMIA 1LPFA 2WOIA 1KN0A 3LB8A 3RNMA 3Q6JA 1JOAA 5FS8A 1Q1WA 2WBAA 5KVIA 1GETA 1ZMDA 2BC1A 2YQUA 3DJGX 1GV4A 3GRSA 2ZZCA 2WPFA 1NHSA 2X8GA 3DH9A 4NEWA 4EQRA 4H4TA 4EQSA 3H4KA 3URHA 1GXFA 4BURA 2EQ6A 1V59A 3L8KA 5TR3A 2BC0A 2WP5A 4JDRA 2W0HA 5EBKA 1GRTA 5FMHA 1DNCA 2V3BA 2GR2A 4H4YA 2NPXA 4BV6A 2X50A 2GR3A 1XHCA 3EF6A 3PG6A 1GRHA 1NPXA 4LIIA 1YQZA 4H4RA 4APNA 2V3AA 1GRAA 4FX9A 2A8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN0 A;  1H2I A;  5JRB A; 
#chains in the Genus database with same CATH topology
 2P0I A;  3THU A;  3SN4 A;  3R1Z A;  4MGG A;  3P93 A;  4ZCW A;  3TTE A;  3SQP A;  3IK4 A;  2C3D A;  4M52 A;  4MKS A;  1P43 A;  3Q4D A;  2HQM A;  3O0H A;  3FYY A;  1OEP A;  1RVK A;  2PSN A;  3QFB A;  4GYP A;  3DER A;  3S5S A;  3EAN A;  4EM4 A;  3CYJ A;  4FP1 A;  3DG7 A;  1FO4 A;  1H2I A;  2OVL A;  3OZM A;  3T8Q A;  1N5W C;  2PGW A;  2RAB A;  3CAW A;  4IL0 A;  2QQ6 A;  4K7Z A;  1BWC A;  2ZZB A;  3TCS A;  3IJL A;  4EM3 A;  4J1O A;  4Z1Y A;  1AOG A;  2YAU A;  3R0K A;  2OPJ A;  4M6U A;  2NVK X;  1GSN A;  3ZVH B;  5FJO A;  4G8T A;  2HXT A;  4ADW A;  1EBD A;  4FDC B;  2W54 A;  4H4W A;  4HPN A;  2ZZ0 A;  3FXG A;  3H8A A;  1LVL A;  2O56 A;  2P8B A;  3S47 A;  1D7Y A;  3DG3 A;  4DX3 A;  2PU1 A;  1GRF A;  1ZY8 A;  1JPM A;  1OJT A;  2ONE A;  2PGE A;  4IT1 A;  2GGE A;  4H2H A;  4GGH A;  1MOK A;  3RR1 A;  1MRA A;  4H4V A;  2XH7 A;  2OX4 A;  4YWO A;  3ZLG A;  1M6I A;  2AL1 A;  3TOY A;  2E3T A;  1EC9 A;  2GSH A;  3UJS A;  4DHG A;  3RGT A;  4JQ9 A;  1W6T A;  1FIQ B;  1T3Q C;  4H4P A;  3CXO A;  2HZG A;  2P8C A;  2WOV A;  4EMI A;  1LPF A;  2PTZ A;  4A6G A;  1KN0 A;  3OW1 A;  3A7U A;  4HN8 A;  5EU9 A;  1GV4 A;  3UJE A;  3DDM A;  3UXK A;  1RM6 B;  3SSZ A;  3H4K A;  3QPE A;  4TVW A;  5TR3 A;  1N63 C;  2WP5 A;  5EBK A;  1DNC A;  3AMZ A;  2GR2 A;  1FHV A;  3TWA A;  3VCN A;  3VCC A;  2PMQ A;  5BOF A;  3SJN A;  1EBG A;  3MSY A;  3R10 A;  1XHC A;  3EF6 A;  3PG6 A;  4M0X A;  3ZVH A;  1NPX A;  1PDY A;  3DG6 A;  3B9J B;  4FX9 A;  3SBF A;  1JDF A;  3U9I A;  3VA8 A;  4E4U A;  3NRZ B;  3V4B A;  1ZDL A;  4KWS A;  1IYX A;  2WPE A;  5FS9 A;  2OO6 A;  2C3C A;  3I4K A;  1ELS A;  1KKO A;  3DK8 A;  3TJI A;  4G7F A;  3PFR A;  4H4Q A;  1KKR A;  1R0M A;  1R6W A;  4JHM A;  3I6T A;  1GEU A;  2WOW A;  4LA1 A;  1BZL A;  3QFA A;  4EMJ A;  4EQX A;  1SJC A;  2AKZ A;  3N4F A;  1VDV A;  2PP1 A;  2GGH A;  2FYM A;  3UCC A;  3FG2 P;  3R25 A;  1VQZ A;  4J56 A;  5U1O A;  4EMW A;  4IZG A;  1FFU C;  1ONF A;  2GGI A;  1V97 A;  3ES7 A;  3N6J A;  4ZA0 A;  3GD3 A;  3NZG A;  3UJR A;  3MZN A;  3RCY A;  3ZLF A;  1XDI A;  2AAQ A;  3R0U A;  3PWG A;  3CGD A;  3GY1 A;  4F4R A;  2OZT A;  4E6M A;  3KLJ A;  2GH5 A;  5FS7 A;  2EQ7 A;  3UGV A;  1YEY A;  3NVW B;  2JK6 A;  1DXL A;  2XH2 A;  4GIR A;  5JCM A;  2MUC A;  2WPC A;  3HW2 A;  3U4F A;  1E9I A;  1XAN A;  3OZY A;  2X8C A;  2W3S A;  1SJA A;  2DW7 A;  2POZ A;  2FKP A;  2XGZ A;  3DEQ A;  2PTW A;  2F5Z A;  4Z17 A;  4IP4 A;  2OQH A;  5FJT A;  1TYT A;  1Q1R A;  4FI4 A;  3NVV B;  2HXU A;  2OLA A;  5FJU A;  1WYG A;  1SJB A;  3R11 A;  4IP5 A;  5JRB A;  1ZK7 A;  3SN0 A;  2WOI A;  3Q45 A;  4TVY A;  4KPL A;  1FFV C;  5G5G B;  3CB3 A;  5FS8 A;  2WBA A;  1GET A;  2BC1 A;  2QVH A;  3DJG X;  3PWI A;  3GRS A;  3A7A A;  1NHS A;  5J04 A;  3DH9 A;  4NEW A;  4ZOH B;  3UJF A;  5IDZ A;  3K1G A;  3MWC A;  2OQY A;  2PU0 A;  3JVA A;  2W0H A;  1N5X A;  1X2H A;  3N6H A;  4IL2 A;  2PTY A;  1BQG A;  1WUE A;  4H19 A;  3ENL A;  4KEM A;  3T4W A;  1GRH A;  4LII A;  1F9C A;  3PK7 A;  2OG9 A;  2AKM A;  1GRA A;  4MMW A;  4EQW A;  4J57 A;  3VC6 A;  3DFH A;  2OZ8 A;  4NEV A;  4DNA A;  1EC8 A;  1GRG A;  3EKG A;  1ZX9 A;  3D46 A;  5JCI A;  1ZMC A;  3RIT A;  3T9P A;  2TPR A;  4GGB A;  3ETR B;  4H4Z A;  4H50 A;  1PDZ A;  1L8P A;  3CXB A;  2YVF A;  4K8D A;  3TWB A;  4A3R A;  3QN3 A;  1NHP A;  2XH0 A;  1NU5 A;  3AN1 A;  2BCP A;  3OP2 A;  1F3P A;  3CK5 A;  1NHQ A;  3T6C A;  2DW6 A;  3VFC A;  5JCL A;  1S7M A;  4JN8 A;  1NEL A;  1TZZ A;  1N60 C;  7ENL A;  2NQL A;  5FJP A;  3L5O A;  3DES A;  3CT2 A;  4E8G A;  2CFY A;  1TYP A;  3LAD A;  4KPR A;  4GFI A;  1K4Q A;  2X8H A;  2YVG A;  4H83 A;  2YVJ A;  3H12 A;  4HCH A;  5FS6 A;  3A7R A;  3UJ2 A;  3BOX A;  3JZU A;  1ZXI C;  1EC7 A;  5GRT A;  2GRT A;  4A35 A;  3TQP A;  1GES A;  2J3N A;  1JPD X;  3DJJ A;  2P3Z A;  2GGJ A;  3ZVI A;  5JCN A;  3GC2 A;  4H4U A;  1BKH A;  2GR1 A;  2XSX A;  1MNS A;  1FEA A;  2ZAD A;  3OC4 A;  3EAO A;  1STZ A;  2GR0 A;  3OTR A;  2EQ9 A;  2PPG A;  3DIP A;  4HCL A;  3MY9 A;  2QJN A;  3NFU A;  1MDL A;  3IC9 A;  4K2S A;  2GDQ A;  3CGE A;  3DGH A;  3H70 A;  3DK9 A;  3GD6 A;  3V3W A;  4X2P A;  4HCD A;  3V5C A;  3Q6J A;  1MUC A;  3V5F A;  1Q1W A;  5KVI A;  3D47 A;  2YQU A;  2WPF A;  3ZLH A;  1DTN A;  4EQR A;  3VDG A;  3DFY A;  3NXL A;  1GXF A;  2EQ6 A;  1V59 A;  1KD0 A;  3L8K A;  3MQT A;  3IJI A;  4KT2 A;  4DN1 A;  5BOE A;  3B97 A;  5FMH A;  3HRD C;  4GME A;  4BV6 A;  4DYE A;  1TKK A;  2X50 A;  3IJQ A;  3RO6 A;  1JRO A;  1XS2 A;  3MKC A;  2GGG A;  2PP3 A;  3SN1 A;  4H4R A;  4APN A;  3DGB A;  1FEB A;  4YWS A;  4DWD A;  4E5T A;  3MUC A;  2A8X A;  1P48 A;  1MO9 A;  4BUR A;  4E4F A;  2QDD A;  2PTX A;  2PP0 A;  4GYP C;  4H4S A;  2OFJ A;  2WP6 A;  2OZ3 A;  5ER0 A;  3OPS A;  3TJ4 A;  1ECQ A;  3GD4 A;  2HNE A;  3BJS A;  4H4X A;  1TE6 A;  3I6E A;  2PA6 A;  2X99 A;  2EQ8 A;  1SB3 B;  5U25 A;  3CGB A;  3II4 A;  2QDE A;  1FEC A;  3UCD A;  3KUM A;  2AL2 A;  3JW7 A;  3FV9 A;  3QKE A;  2CDU A;  4GRT A;  4J3Z A;  4K8G A;  2GL5 A;  1F8W A;  1H6V A;  3P0W A;  1MDR A;  4ENL A;  2OKT A;  2QJM A;  3CGC A;  4HYR A;  1GER A;  2P88 A;  2GQW A;  3P3B A;  2I5Q A;  5FJR A;  3D9X A;  5JCK A;  4HNL A;  1NDA A;  3FVD A;  1N61 C;  1XPY A;  3STP A;  1GRB A;  2QJJ A;  1WUF A;  4ROP A;  3DGZ A;  1ZKQ A;  4H1Z A;  2QGY A;  5KVH A;  2RDX A;  3AM9 A;  2W55 A;  2E5A A;  3GO2 A;  2CHR A;  3GRT A;  4EWJ A;  2PS2 A;  2ZC8 A;  4GR1 A;  3LXD A;  2W3R A;  1NHR A;  2QAE A;  2V6O A;  3NVY B;  3QLD A;  1JCT A;  4DXK A;  3HPF A;  2R9Z A;  1N62 C;  3DK4 A;  1JEH A;  1GRE A;  3FJ4 A;  1X2G A;  3LB8 A;  4HNC A;  6ENL A;  3RNM A;  3H7V A;  1JOA A;  2XH4 A;  4GIS A;  1JRP A;  1ZMD A;  3ES8 A;  3TW9 A;  3VC5 A;  2ZZC A;  3EUB 3;  1SJD A;  2X8G A;  3NO1 A;  3R07 C;  3BSM A;  3NVZ B;  4H4T A;  5G5H B;  3N4E A;  3URH A;  4EQS A;  1KCZ A;  2BC0 A;  4JDR A;  4IHC A;  2PCE A;  2AL2 B;  3SR6 B;  4K1W A;  1GRT A;  3QTP A;  2V3B A;  3EEZ A;  4H4Y A;  5ENL A;  2NPX A;  3NS1 B;  3RRA A;  2POD A;  3FCP A;  2GR3 A;  1FHU A;  3SQS A;  1EBH A;  3UXL A;  4JN7 A;  1YQZ A;  2V3A A;  1ONE A;  2MNR A; 
#chains in the Genus database with same CATH homology
 4EQW A;  4J57 A;  1ZDL A;  4H4S A;  4NEV A;  2WPE A;  5FS9 A;  2C3C A;  2WP6 A;  5ER0 A;  4DNA A;  3SQP A;  3DK8 A;  2C3D A;  1GRG A;  4M52 A;  3GD4 A;  1ZX9 A;  5JCI A;  4H4Q A;  1ZMC A;  4H4X A;  2HQM A;  3O0H A;  2TPR A;  4H50 A;  4H4Z A;  2X99 A;  1GEU A;  3QFB A;  2YVF A;  2WOW A;  4LA1 A;  2EQ8 A;  4K8D A;  5U25 A;  3EAN A;  1BZL A;  3CGB A;  3II4 A;  3QFA A;  1NHP A;  4EMJ A;  4EM4 A;  4EQX A;  1FEC A;  1MO9 A;  2BCP A;  3FG2 P;  1H2I A;  4GRT A;  2CDU A;  1F3P A;  2RAB A;  1F8W A;  1H6V A;  1NHQ A;  4J56 A;  5U1O A;  4EMW A;  5JCL A;  1S7M A;  1ONF A;  3L5O A;  4K7Z A;  1BWC A;  2ZZB A;  3CGC A;  1GER A;  4EM3 A;  2GQW A;  3GD3 A;  1AOG A;  2YAU A;  2CFY A;  1TYP A;  3LAD A;  2NVK X;  1GSN A;  4KPR A;  1XDI A;  2AAQ A;  3D9X A;  5JCK A;  1K4Q A;  1NDA A;  2X8H A;  2YVG A;  4ADW A;  3CGD A;  1EBD A;  4FDC B;  1GRB A;  4H4W A;  2ZZ0 A;  1ZKQ A;  3DGZ A;  1LVL A;  2YVJ A;  3KLJ A;  2GH5 A;  5FS6 A;  1D7Y A;  5FS7 A;  2EQ7 A;  5KVH A;  5GRT A;  1GRF A;  2GRT A;  1ZY8 A;  1DXL A;  1GES A;  1OJT A;  2J3N A;  2JK6 A;  3DJJ A;  2WPC A;  5JCM A;  1XAN A;  3GRT A;  1MOK A;  5JCN A;  1FEB A;  2X8C A;  4H4V A;  4GR1 A;  4H4U A;  2GR1 A;  2F5Z A;  4YWO A;  3LXD A;  1FEA A;  3OC4 A;  3EAO A;  1NHR A;  1M6I A;  2GR0 A;  2EQ9 A;  2QAE A;  2V6O A;  1TYT A;  4JQ9 A;  1Q1R A;  2R9Z A;  4H4P A;  3DK4 A;  1JEH A;  3IC9 A;  2WOV A;  5JRB A;  1GRE A;  1ZK7 A;  3CGE A;  3DGH A;  3DK9 A;  4EMI A;  1LPF A;  2WOI A;  1KN0 A;  3LB8 A;  3RNM A;  3Q6J A;  1JOA A;  5FS8 A;  1Q1W A;  2WBA A;  5KVI A;  1GET A;  1ZMD A;  2BC1 A;  2YQU A;  3DJG X;  1GV4 A;  3GRS A;  2ZZC A;  2WPF A;  1NHS A;  2X8G A;  3DH9 A;  4NEW A;  4EQR A;  4H4T A;  4EQS A;  3H4K A;  3URH A;  1GXF A;  4BUR A;  2EQ6 A;  1V59 A;  3L8K A;  5TR3 A;  2BC0 A;  2WP5 A;  4JDR A;  2W0H A;  5EBK A;  1GRT A;  5FMH A;  1DNC A;  2V3B A;  2GR2 A;  4H4Y A;  2NPX A;  4BV6 A;  2X50 A;  2GR3 A;  1XHC A;  3EF6 A;  3PG6 A;  1GRH A;  1NPX A;  4LII A;  1YQZ A;  4H4R A;  4APN A;  2V3A A;  1GRA A;  4FX9 A;  2A8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...