1H2IA

Human rad52 protein, n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
b'LCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN RAD52 HOMOLOG
publication title Structure of the Single-Strand Annealing Domain of Human Rad52 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 46
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1h2iA01
1KN0A 5JRBA 1H2IA
chains in the Genus database with same CATH superfamily
2WOVA 2E5AA 4Z1YA 2HXTA 2XH0A 2CDUA 5FS6A 4EWJA 5GRTA 2RABA 1NELA 2EQ9A 2PP3A 1JROA 4GYPC 3CGCA 3I4KA 4H1ZA 1Q1WA 3EEZA 3R1ZA 3FV9A 1IYXA 1K4QA 4HNLA 2PP1A 4HCDA 4Z17A 3FCPA 2OZ3A 1SJAA 3VDGA 1X2GA 3SN0A 2PCEA 2W3SA 3TW9A 3BSMA 1ZXIC 3I6EA 1YQZA 3AM9A 1N5WC 1Q1RA 3MUCA 2GGIA 5FJUA 2GGGA 1N63C 3NXLA 2X8GA 1MRAA 3S5SA 1L8PA 1KN0A 4IP5A 3MSYA 1FHVA 3DESA 4IL0A 4EM3A 1EC8A 3DK9A 4H4YA 3UJEA 4FI4A 3O0HA 4NEWA 2POZA 3SN4A 2MUCA 3DH9A 2P0IA 3HRDC 3JW7A 2YVGA 5FJPA 4HPNA 3Q4DA 1GRHA 3CB3A 3CK5A 3ZLHA 3TTEA 1V59A 3RRAA 1NHPA 1TZZA 3MKCA 4EQSA 3SN1A 2PU0A 4J56A 3TQPA 3V3WA 3N6HA 4GGHA 5JCIA 2HNEA 1JEHA 4A3RA 4JN7A 4E4FA 4H4PA 1NHRA 3NO1A 3DGHA 4EMIA 2TPRA 1ZMDA 3H70A 2QJMA 2GSHA 3NVZB 3A7AA 1N62C 2OVLA 3ES8A 3R11A 4JQ9A 1VQZA 2OLAA 4H4WA 3UJRA 3QLDA 3L8KA 3OC4A 1KKOA 4H4VA 4M52A 2GDQA 3UXLA 3FVDA 5FS8A 3NVYB 3NVVB 2PSNA 4GYPA 2XSXA 5U1OA 1GERA 2AL1A 1MDLA 4YWSA 2WP6A 3II4A 3ZVHB 4JN8A 1OJTA 2OZ8A 3K1GA 3SJNA 1FFVC 1V97A 2GGEA 3V4BA 3R25A 3MWCA 2NVKX 5KVHA 4HYRA 3SR6B 3UCCA 1EBHA 5EU9A 1DNCA 1MUCA 3SQSA 2I5QA 2GR0A 4DX3A 2WOWA 3QFAA 4E5TA 1XDIA 4K1WA 1GRTA 3IK4A 1N5XA 3V5CA 1GV4A 2PTWA 3DDMA 4MGGA 4J1OA 2P88A 3DG7A 2YVFA 5IDZA 4YWOA 3ZVHA 5JRBA 1M6IA 3TCSA 4H2HA 2OG9A 4FP1A 1RVKA 1FEAA 4DN1A 3MY9A 2X8HA 2ZC8A 3CGBA 4H83A 2GQWA 1MNSA 4ZCWA 3U9IA 5G5GB 3R10A 4A35A 1P48A 3VFCA 3Q45A 2ZZCA 3THUA 1BZLA 3ETRB 3HPFA 4FDCB 4KWSA 3T8QA 4IZGA 2XH2A 3ZVIA 1JPDX 2PPGA 3DGBA 2PTXA 1GRGA 3ZLFA 2NQLA 3EKGA 3A7UA 1BKHA 3RNMA 3UGVA 1GXFA 3GD6A 1EC7A 1H6VA 1AOGA 3D46A 3CT2A 4FX9A 3NS1B 4X2PA 1SJBA 5JCLA 1ZMCA 1T3QC 1ONEA 4EMWA 1PDZA 3P0WA 4H4TA 3ZLGA 3KLJA 5ENLA 5EBKA 2PP0A 1BWCA 2C3DA 1SJDA 3QN3A 4HN8A 4IT1A 3OTRA 4DNAA 5JCMA 2PGWA 2QJJA 2PODA 4KPLA 3RCYA 4K8DA 4MMWA 3JZUA 3N4EA 1XHCA 3U4FA 4HCLA 3V5FA 3D47A 3R0KA 2R9ZA 3QFBA 3FXGA 4A6GA 3TJ4A 1ZDLA 2HXUA 3UCDA 4ZA0A 2ONEA 3FG2P 1NDAA 3BOXA 1ELSA 3DK8A 3GD3A 1ONFA 2QDEA 4JHMA 3EAOA 2FKPA 2WPCA 4GFIA 4KPRA 5J04A 2OPJA 4IP4A 4F4RA 2BCPA 3DFHA 2XH7A 3MZNA 3GC2A 4ZOHB 2WP5A 2PTZA 2W55A 4LA1A 3RR1A 2HZGA 4ROPA 3UXKA 5U25A 3AMZA 3L5OA 2WBAA 3DGZA 3T6CA 3DG6A 3RGTA 2WPEA 1R6WA 1JOAA 2A8XA 5TR3A 4GISA 4ADWA 5ER0A 1JCTA 3QPEA 2P8BA 1P43A 3DG3A 4EMJA 1MDRA 1BQGA 4EM4A 2X50A 4H4QA 2CHRA 1F9CA 3JVAA 3NZGA 1FO4A 2OO6A 4GR1A 2X8CA 2ZZ0A 1GETA 2RDXA 3IJQA 3URHA 3CGEA 3GRTA 5FMHA 2V3AA 2XGZA 3ES7A 3OP2A 3H7VA 2AAQA 2AL2B 2QGYA 2JK6A 5JCKA 2V6OA 3GY1A 2PMQA 3DIPA 1GSNA 2PS2A 3DFYA 3AN1A 1LPFA 1X2HA 1LVLA 1ECQA 1NU5A 2OKTA 3H12A 4H19A 4JDRA 1KCZA 2J3NA 3TWAA 3NVWB 3VCCA 4KEMA 3H4KA 3S47A 3PFRA 2PTYA 2DW7A 1D7YA 3DEQA 1R0MA 3DJGX 3B97A 4DHGA 3CAWA 2W3RA 4IHCA 4E8GA 3LXDA 4E4UA 3RO6A 2C3CA 1EBGA 3LB8A 4J57A 2AL2A 3A7RA 1GRAA 2QDDA 3T9PA 1FECA 1F3PA 1PDYA 6ENLA 3EANA 2AKZA 1FEBA 1DXLA 2QQ6A 3ENLA 3SBFA 3N6JA 4IL2A 4KT2A 1GEUA 1GREA 1TYPA 1ZK7A 2GR3A 3OZMA 1EC9A 2GR1A 2GGJA 3D9XA 1XPYA 2FYMA 4H4UA 3N4FA 3P3BA 3VA8A 4MKSA 3STPA 2V3BA 2E3TA 2P8CA 4G8TA 1SJCA 2GR2A 4BURA 2NPXA 3NFUA 3NRZB 4HNCA 4APNA 1H2IA 3Q6JA 1GRBA 1WYGA 1JDFA 1NHQA 3B9JB 3CXOA 3UJ2A 5BOFA 4DYEA 2GH5A 4EQWA 1TYTA 2PU1A 2F5ZA 2O56A 3T4WA 1EBDA 3SQPA 1RM6B 4GRTA 3I6TA 4G7FA 1F8WA 4ENLA 1JRPA 1SB3B 2AKMA 1ZY8A 4EQXA 4H50A 3OZYA 1GRFA 4M0XA 4DWDA 4DXKA 3TWBA 2ZADA 4K7ZA 4TVYA 3GO2A 2EQ6A 4J3ZA 7ENLA 4M6UA 2QJNA 3PK7A 2QAEA 3QTPA 5FS9A 2PGEA 1WUEA 5BOEA 1XS2A 1YEYA 2EQ7A 4EQRA 4HCHA 2OX4A 5FJOA 3R07C 3GD4A 1MOKA 2WPFA 1FFUC 3MQTA 1FHUA 1GESA 3FJ4A 3LADA 5FS7A 2YQUA 2W0HA 3TOYA 2HQMA 3IJLA 1DTNA 2PA6A 1KD0A 5FJTA 3OW1A 4H4RA 3OPSA 2OZTA 1OEPA 2GRTA 4LIIA 2X99A 3GRSA 2WOIA 3CYJA 2OFJA 3TJIA 1FIQB 3P93A 3DERA 3BJSA 3QKEA 1ZX9A 2OQHA 3CGDA 3PWIA 3HW2A 1TKKA 5G5HB 1MO9A 1W6TA 4E6MA 1N60C 5KVIA 3IC9A 3IJIA 5JCNA 2YVJA 3VC6A 1NHSA 2YAUA 3PG6A 2DW6A 3CXBA 4GGBA 1S7MA 3R0UA 3RITA 3UJSA 1STZA 3EF6A 2P3ZA 4H4XA 4K2SA 4H4SA 2ZZBA 4GMEA 1TE6A 2OQYA 3EUB3 1JPMA 4H4ZA 4GIRA 2CFYA 2GGHA 3H8AA 1E9IA 1VDVA 2EQ8A 2MNRA 4TVWA 1WUFA 3PWGA 4BV6A 2XH4A 1XANA 4NEVA 1KKRA 5FJRA 3VCNA 3SSZA 3VC5A 4K8GA 1N61C 3DK4A 3FYYA 2GL5A 2BC1A 3UJFA 2BC0A 3DJJA 1ZKQA 1NPXA 3KUMA 2QVHA 2W54A
chains in the Genus database with same CATH topology
2A8XA 2WOVA 5TR3A 1EBDA 1GV4A 5ER0A 3SQPA 2CDUA 5FS6A 4ADWA 4GRTA 5GRTA 2RABA 2EQ9A 4EMJA 1F8WA 4EQXA 2YVFA 1ZY8A 4H50A 1GRFA 4EM4A 4YWOA 5JRBA 2X50A 1M6IA 3CGCA 4K7ZA 4H4QA 2EQ6A 1Q1WA 1FEAA 2X8HA 3CGBA 2GQWA 1K4QA 4GR1A 2QAEA 2X8CA 2ZZ0A 5FS9A 1GETA 3URHA 3CGEA 3GRTA 2EQ7A 2ZZCA 5FMHA 1BZLA 2V3AA 4FDCB 4EQRA 2AAQA 2JK6A 1YQZA 5JCKA 2V6OA 1Q1RA 2WPEA 1GRGA 1MOKA 3GD4A 1GSNA 2WPFA 3LADA 1GESA 2X8GA 1LPFA 5FS7A 1LVLA 2YQUA 2W0HA 2HQMA 3RNMA 1KN0A 4JDRA 2J3NA 4H4RA 4LIIA 2GRTA 1GXFA 2X99A 3H4KA 3GRSA 2WOIA 4EM3A 3DK9A 1D7YA 4H4YA 1H6VA 3DJGX 3O0HA 4FX9A 4NEWA 1AOGA 3DH9A 3LXDA 1ZX9A 2YVGA 2C3CA 5JCLA 1ZMCA 3CGDA 1GRHA 3LB8A 4EMWA 4J57A 1MO9A 1V59A 4H4TA 1NHPA 5KVIA 1GRAA 3KLJA 4EQSA 5EBKA 4J56A 1FECA 1F3PA 1BWCA 2C3DA 3EANA 3IC9A 1FEBA 5JCIA 4DNAA 1JEHA 5JCNA 2YVJA 5JCMA 1DXLA 4K8DA 4H4PA 1NHRA 4EMIA 3DGHA 1NHSA 2TPRA 2YAUA 3PG6A 1XHCA 1S7MA 1ZMDA 1GEUA 1GREA 1TYPA 1ZK7A 3EF6A 2GR3A 4H4XA 4H4SA 4JQ9A 2GR1A 2R9ZA 2ZZBA 3D9XA 3QFBA 4H4WA 4H4UA 3L8KA 3OC4A 4H4VA 1ZDLA 4M52A 4H4ZA 5FS8A 2V3BA 2CFYA 3FG2P 1NDAA 5U1OA 2EQ8A 2GR2A 1GERA 2NPXA 4BURA 3DK8A 2WP6A 3GD3A 3II4A 1ONFA 4APNA 4BV6A 3EAOA 1H2IA 1OJTA 3Q6JA 1XANA 2WPCA 4KPRA 4NEVA 2BCPA 1GRBA 1NHQA 2WP5A 2NVKX 3DK4A 4LA1A 5KVHA 2BC1A 1DNCA 5U25A 2GH5A 3L5OA 4EQWA 2BC0A 2WBAA 3DGZA 2GR0A 3DJJA 1ZKQA 1TYTA 2WOWA 3QFAA 1NPXA 1XDIA 2F5ZA 1GRTA 1JOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN0 A;  5JRB A;  1H2I A; 
#chains in the Genus database with same CATH topology
 2WOV A;  2E5A A;  4Z1Y A;  2HXT A;  2XH0 A;  2CDU A;  5FS6 A;  4EWJ A;  5GRT A;  2RAB A;  1NEL A;  2EQ9 A;  2PP3 A;  1JRO A;  4GYP C;  3CGC A;  3I4K A;  4H1Z A;  1Q1W A;  3EEZ A;  3R1Z A;  3FV9 A;  1IYX A;  1K4Q A;  4HNL A;  2PP1 A;  4HCD A;  4Z17 A;  3FCP A;  2OZ3 A;  1SJA A;  3VDG A;  1X2G A;  3SN0 A;  2PCE A;  2W3S A;  3TW9 A;  3BSM A;  1ZXI C;  3I6E A;  1YQZ A;  3AM9 A;  1N5W C;  1Q1R A;  3MUC A;  2GGI A;  5FJU A;  2GGG A;  1N63 C;  3NXL A;  2X8G A;  1MRA A;  3S5S A;  1L8P A;  1KN0 A;  4IP5 A;  3MSY A;  1FHV A;  3DES A;  4IL0 A;  4EM3 A;  1EC8 A;  3DK9 A;  4H4Y A;  3UJE A;  4FI4 A;  3O0H A;  4NEW A;  2POZ A;  3SN4 A;  2MUC A;  3DH9 A;  2P0I A;  3HRD C;  3JW7 A;  2YVG A;  5FJP A;  4HPN A;  3Q4D A;  1GRH A;  3CB3 A;  3CK5 A;  3ZLH A;  3TTE A;  1V59 A;  3RRA A;  1NHP A;  1TZZ A;  3MKC A;  4EQS A;  3SN1 A;  2PU0 A;  4J56 A;  3TQP A;  3V3W A;  3N6H A;  4GGH A;  5JCI A;  2HNE A;  1JEH A;  4A3R A;  4JN7 A;  4E4F A;  4H4P A;  1NHR A;  3NO1 A;  3DGH A;  4EMI A;  2TPR A;  1ZMD A;  3H70 A;  2QJM A;  2GSH A;  3NVZ B;  3A7A A;  1N62 C;  2OVL A;  3ES8 A;  3R11 A;  4JQ9 A;  1VQZ A;  2OLA A;  4H4W A;  3UJR A;  3QLD A;  3L8K A;  3OC4 A;  1KKO A;  4H4V A;  4M52 A;  2GDQ A;  3UXL A;  3FVD A;  5FS8 A;  3NVY B;  3NVV B;  2PSN A;  4GYP A;  2XSX A;  5U1O A;  1GER A;  2AL1 A;  1MDL A;  4YWS A;  2WP6 A;  3II4 A;  3ZVH B;  4JN8 A;  1OJT A;  2OZ8 A;  3K1G A;  3SJN A;  1FFV C;  1V97 A;  2GGE A;  3V4B A;  3R25 A;  3MWC A;  2NVK X;  5KVH A;  4HYR A;  3SR6 B;  3UCC A;  1EBH A;  5EU9 A;  1DNC A;  1MUC A;  3SQS A;  2I5Q A;  2GR0 A;  4DX3 A;  2WOW A;  3QFA A;  4E5T A;  1XDI A;  4K1W A;  1GRT A;  3IK4 A;  1N5X A;  3V5C A;  1GV4 A;  2PTW A;  3DDM A;  4MGG A;  4J1O A;  2P88 A;  3DG7 A;  2YVF A;  5IDZ A;  4YWO A;  3ZVH A;  5JRB A;  1M6I A;  3TCS A;  4H2H A;  2OG9 A;  4FP1 A;  1RVK A;  1FEA A;  4DN1 A;  3MY9 A;  2X8H A;  2ZC8 A;  3CGB A;  4H83 A;  2GQW A;  1MNS A;  4ZCW A;  3U9I A;  5G5G B;  3R10 A;  4A35 A;  1P48 A;  3VFC A;  3Q45 A;  2ZZC A;  3THU A;  1BZL A;  3ETR B;  3HPF A;  4FDC B;  4KWS A;  3T8Q A;  4IZG A;  2XH2 A;  3ZVI A;  1JPD X;  2PPG A;  3DGB A;  2PTX A;  1GRG A;  3ZLF A;  2NQL A;  3EKG A;  3A7U A;  1BKH A;  3RNM A;  3UGV A;  1GXF A;  3GD6 A;  1EC7 A;  1H6V A;  1AOG A;  3D46 A;  3CT2 A;  4FX9 A;  3NS1 B;  4X2P A;  1SJB A;  5JCL A;  1ZMC A;  1T3Q C;  1ONE A;  4EMW A;  1PDZ A;  3P0W A;  4H4T A;  3ZLG A;  3KLJ A;  5ENL A;  5EBK A;  2PP0 A;  1BWC A;  2C3D A;  1SJD A;  3QN3 A;  4HN8 A;  4IT1 A;  3OTR A;  4DNA A;  5JCM A;  2PGW A;  2QJJ A;  2POD A;  4KPL A;  3RCY A;  4K8D A;  4MMW A;  3JZU A;  3N4E A;  1XHC A;  3U4F A;  4HCL A;  3V5F A;  3D47 A;  3R0K A;  2R9Z A;  3QFB A;  3FXG A;  4A6G A;  3TJ4 A;  1ZDL A;  2HXU A;  3UCD A;  4ZA0 A;  2ONE A;  3FG2 P;  1NDA A;  3BOX A;  1ELS A;  3DK8 A;  3GD3 A;  1ONF A;  2QDE A;  4JHM A;  3EAO A;  2FKP A;  2WPC A;  4GFI A;  4KPR A;  5J04 A;  2OPJ A;  4IP4 A;  4F4R A;  2BCP A;  3DFH A;  2XH7 A;  3MZN A;  3GC2 A;  4ZOH B;  2WP5 A;  2PTZ A;  2W55 A;  4LA1 A;  3RR1 A;  2HZG A;  4ROP A;  3UXK A;  5U25 A;  3AMZ A;  3L5O A;  2WBA A;  3DGZ A;  3T6C A;  3DG6 A;  3RGT A;  2WPE A;  1R6W A;  1JOA A;  2A8X A;  5TR3 A;  4GIS A;  4ADW A;  5ER0 A;  1JCT A;  3QPE A;  2P8B A;  1P43 A;  3DG3 A;  4EMJ A;  1MDR A;  1BQG A;  4EM4 A;  2X50 A;  4H4Q A;  2CHR A;  1F9C A;  3JVA A;  3NZG A;  1FO4 A;  2OO6 A;  4GR1 A;  2X8C A;  2ZZ0 A;  1GET A;  2RDX A;  3IJQ A;  3URH A;  3CGE A;  3GRT A;  5FMH A;  2V3A A;  2XGZ A;  3ES7 A;  3OP2 A;  3H7V A;  2AAQ A;  2AL2 B;  2QGY A;  2JK6 A;  5JCK A;  2V6O A;  3GY1 A;  2PMQ A;  3DIP A;  1GSN A;  2PS2 A;  3DFY A;  3AN1 A;  1LPF A;  1X2H A;  1LVL A;  1ECQ A;  1NU5 A;  2OKT A;  3H12 A;  4H19 A;  4JDR A;  1KCZ A;  2J3N A;  3TWA A;  3NVW B;  3VCC A;  4KEM A;  3H4K A;  3S47 A;  3PFR A;  2PTY A;  2DW7 A;  1D7Y A;  3DEQ A;  1R0M A;  3DJG X;  3B97 A;  4DHG A;  3CAW A;  2W3R A;  4IHC A;  4E8G A;  3LXD A;  4E4U A;  3RO6 A;  2C3C A;  1EBG A;  3LB8 A;  4J57 A;  2AL2 A;  3A7R A;  1GRA A;  2QDD A;  3T9P A;  1FEC A;  1F3P A;  1PDY A;  6ENL A;  3EAN A;  2AKZ A;  1FEB A;  1DXL A;  2QQ6 A;  3ENL A;  3SBF A;  3N6J A;  4IL2 A;  4KT2 A;  1GEU A;  1GRE A;  1TYP A;  1ZK7 A;  2GR3 A;  3OZM A;  1EC9 A;  2GR1 A;  2GGJ A;  3D9X A;  1XPY A;  2FYM A;  4H4U A;  3N4F A;  3P3B A;  3VA8 A;  4MKS A;  3STP A;  2V3B A;  2E3T A;  2P8C A;  4G8T A;  1SJC A;  2GR2 A;  4BUR A;  2NPX A;  3NFU A;  3NRZ B;  4HNC A;  4APN A;  1H2I A;  3Q6J A;  1GRB A;  1WYG A;  1JDF A;  1NHQ A;  3B9J B;  3CXO A;  3UJ2 A;  5BOF A;  4DYE A;  2GH5 A;  4EQW A;  1TYT A;  2PU1 A;  2F5Z A;  2O56 A;  3T4W A;  1EBD A;  3SQP A;  1RM6 B;  4GRT A;  3I6T A;  4G7F A;  1F8W A;  4ENL A;  1JRP A;  1SB3 B;  2AKM A;  1ZY8 A;  4EQX A;  4H50 A;  3OZY A;  1GRF A;  4M0X A;  4DWD A;  4DXK A;  3TWB A;  2ZAD A;  4K7Z A;  4TVY A;  3GO2 A;  2EQ6 A;  4J3Z A;  7ENL A;  4M6U A;  2QJN A;  3PK7 A;  2QAE A;  3QTP A;  5FS9 A;  2PGE A;  1WUE A;  5BOE A;  1XS2 A;  1YEY A;  2EQ7 A;  4EQR A;  4HCH A;  2OX4 A;  5FJO A;  3R07 C;  3GD4 A;  1MOK A;  2WPF A;  1FFU C;  3MQT A;  1FHU A;  1GES A;  3FJ4 A;  3LAD A;  5FS7 A;  2YQU A;  2W0H A;  3TOY A;  2HQM A;  3IJL A;  1DTN A;  2PA6 A;  1KD0 A;  5FJT A;  3OW1 A;  4H4R A;  3OPS A;  2OZT A;  1OEP A;  2GRT A;  4LII A;  2X99 A;  3GRS A;  2WOI A;  3CYJ A;  2OFJ A;  3TJI A;  1FIQ B;  3P93 A;  3DER A;  3BJS A;  3QKE A;  1ZX9 A;  2OQH A;  3CGD A;  3PWI A;  3HW2 A;  1TKK A;  5G5H B;  1MO9 A;  1W6T A;  4E6M A;  1N60 C;  5KVI A;  3IC9 A;  3IJI A;  5JCN A;  2YVJ A;  3VC6 A;  1NHS A;  2YAU A;  3PG6 A;  2DW6 A;  3CXB A;  4GGB A;  1S7M A;  3R0U A;  3RIT A;  3UJS A;  1STZ A;  3EF6 A;  2P3Z A;  4H4X A;  4K2S A;  4H4S A;  2ZZB A;  4GME A;  1TE6 A;  2OQY A;  3EUB 3;  1JPM A;  4H4Z A;  4GIR A;  2CFY A;  2GGH A;  3H8A A;  1E9I A;  1VDV A;  2EQ8 A;  2MNR A;  4TVW A;  1WUF A;  3PWG A;  4BV6 A;  2XH4 A;  1XAN A;  4NEV A;  1KKR A;  5FJR A;  3VCN A;  3SSZ A;  3VC5 A;  4K8G A;  1N61 C;  3DK4 A;  3FYY A;  2GL5 A;  2BC1 A;  3UJF A;  2BC0 A;  3DJJ A;  1ZKQ A;  1NPX A;  3KUM A;  2QVH A;  2W54 A; 
#chains in the Genus database with same CATH homology
 2A8X A;  2WOV A;  5TR3 A;  1EBD A;  1GV4 A;  5ER0 A;  3SQP A;  2CDU A;  5FS6 A;  4ADW A;  4GRT A;  5GRT A;  2RAB A;  2EQ9 A;  4EMJ A;  1F8W A;  4EQX A;  2YVF A;  1ZY8 A;  4H50 A;  1GRF A;  4EM4 A;  4YWO A;  5JRB A;  2X50 A;  1M6I A;  3CGC A;  4K7Z A;  4H4Q A;  2EQ6 A;  1Q1W A;  1FEA A;  2X8H A;  3CGB A;  2GQW A;  1K4Q A;  4GR1 A;  2QAE A;  2X8C A;  2ZZ0 A;  5FS9 A;  1GET A;  3URH A;  3CGE A;  3GRT A;  2EQ7 A;  2ZZC A;  5FMH A;  1BZL A;  2V3A A;  4FDC B;  4EQR A;  2AAQ A;  2JK6 A;  1YQZ A;  5JCK A;  2V6O A;  1Q1R A;  2WPE A;  1GRG A;  1MOK A;  3GD4 A;  1GSN A;  2WPF A;  3LAD A;  1GES A;  2X8G A;  1LPF A;  5FS7 A;  1LVL A;  2YQU A;  2W0H A;  2HQM A;  3RNM A;  1KN0 A;  4JDR A;  2J3N A;  4H4R A;  4LII A;  2GRT A;  1GXF A;  2X99 A;  3H4K A;  3GRS A;  2WOI A;  4EM3 A;  3DK9 A;  1D7Y A;  4H4Y A;  1H6V A;  3DJG X;  3O0H A;  4FX9 A;  4NEW A;  1AOG A;  3DH9 A;  3LXD A;  1ZX9 A;  2YVG A;  2C3C A;  5JCL A;  1ZMC A;  3CGD A;  1GRH A;  3LB8 A;  4EMW A;  4J57 A;  1MO9 A;  1V59 A;  4H4T A;  1NHP A;  5KVI A;  1GRA A;  3KLJ A;  4EQS A;  5EBK A;  4J56 A;  1FEC A;  1F3P A;  1BWC A;  2C3D A;  3EAN A;  3IC9 A;  1FEB A;  5JCI A;  4DNA A;  1JEH A;  5JCN A;  2YVJ A;  5JCM A;  1DXL A;  4K8D A;  4H4P A;  1NHR A;  4EMI A;  3DGH A;  1NHS A;  2TPR A;  2YAU A;  3PG6 A;  1XHC A;  1S7M A;  1ZMD A;  1GEU A;  1GRE A;  1TYP A;  1ZK7 A;  3EF6 A;  2GR3 A;  4H4X A;  4H4S A;  4JQ9 A;  2GR1 A;  2R9Z A;  2ZZB A;  3D9X A;  3QFB A;  4H4W A;  4H4U A;  3L8K A;  3OC4 A;  4H4V A;  1ZDL A;  4M52 A;  4H4Z A;  5FS8 A;  2V3B A;  2CFY A;  3FG2 P;  1NDA A;  5U1O A;  2EQ8 A;  2GR2 A;  1GER A;  2NPX A;  4BUR A;  3DK8 A;  2WP6 A;  3GD3 A;  3II4 A;  1ONF A;  4APN A;  4BV6 A;  3EAO A;  1H2I A;  1OJT A;  3Q6J A;  1XAN A;  2WPC A;  4KPR A;  4NEV A;  2BCP A;  1GRB A;  1NHQ A;  2WP5 A;  2NVK X;  3DK4 A;  4LA1 A;  5KVH A;  2BC1 A;  1DNC A;  5U25 A;  2GH5 A;  3L5O A;  4EQW A;  2BC0 A;  2WBA A;  3DGZ A;  2GR0 A;  3DJJ A;  1ZKQ A;  1TYT A;  2WOW A;  3QFA A;  1NPX A;  1XDI A;  2F5Z A;  1GRT A;  1JOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...