1H2IA

Human rad52 protein, n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
LCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR PROTEIN RAD52 HOMOLOG
publication title Structure of the Single-Strand Annealing Domain of Human Rad52 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 46
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1h2iA01
1H2IA 1KN0A 5JRBA
chains in the Genus database with same CATH superfamily
3ZLGA 2GGIA 1SJDA 2PP0A 2ZZCA 4K8GA 4H4XA 3UCCA 4EMJA 4IL2A 5FJOA 1FHVA 5EBKA 3RGTA 3B97A 2XH4A 2OQHA 2F5ZA 1M6IA 4IT1A 3ES7A 1N61C 1STZA 3QTPA 3UCDA 3CGEA 2BC1A 3D47A 1F3PA 3UJSA 1MOKA 2RDXA 4H4PA 4GR1A 2ZZ0A 2PTXA 3IJLA 1SB3B 3TQPA 2XH0A 2A8XA 1JPDX 4ROPA 2CHRA 1ZKQA 2WOVA 3ENLA 3UJ2A 2QAEA 3N4EA 5FS8A 2GSHA 2EQ7A 1FEBA 3FCPA 2GGEA 1N5XA 1ONFA 1FEAA 5FJPA 3DGHA 5G5HB 3FJ4A 2YAUA 5JCMA 3R0KA 1DXLA 2E5AA 4EQXA 4IP5A 4F4RA 4DHGA 3DK8A 2FKPA 3HRDC 3SR6B 3SSZA 4ENLA 3DG7A 2NVKX 2PGEA 3DGBA 1WUFA 2OKTA 1OJTA 2JK6A 2QQ6A 4M0XA 1KN0A 4H4QA 4H83A 2V3BA 3EAOA 4ZOHB 3TWAA 3S47A 3CXBA 2DW7A 2HZGA 3VDGA 4MGGA 2GR2A 3SQSA 2DW6A 4H4ZA 1SJBA 2W3RA 1MO9A 3H4KA 1N5WC 3UXKA 3HPFA 1GEUA 3PWGA 4FP1A 1E9IA 4EWJA 3IJIA 2TPRA 3CAWA 4HNLA 3R25A 1MDLA 4J56A 3URHA 2AL2B 3ZVHB 2QVHA 3QFBA 5IDZA 3RCYA 3OW1A 4IHCA 3VCNA 3L5OA 1OEPA 2AAQA 2C3CA 3NVVB 4K7ZA 3VC6A 3NO1A 3TW9A 4IZGA 3ZLHA 3IK4A 3CB3A 2HNEA 2PA6A 2PP3A 3CGCA 1YQZA 2RABA 1KCZA 1GRHA 3EEZA 3VCCA 4G7FA 1JRPA 3H12A 5KVIA 4J57A 3PK7A 1FHUA 4IP4A 2QJMA 2J3NA 2WPFA 1F8WA 2QDEA 3MUCA 3EANA 3RR1A 4IL0A 2X99A 3MQTA 3QKEA 2BCPA 1BQGA 2W54A 1LVLA 2X50A 4LA1A 1TYPA 3I6TA 2PP1A 1LPFA 1D7YA 3NVWB 4J1OA 5FS7A 4GYPA 1NELA 3DESA 1JDFA 2HXUA 4EMWA 3OC4A 3GY1A 1NHRA 2O56A 1ZY8A 2GGGA 1GRFA 2MNRA 4E6MA 2YVGA 5EU9A 1PDYA 2NPXA 3TCSA 1SJAA 3GD4A 2XSXA 3QFAA 3SBFA 3BSMA 4H1ZA 2GGHA 1ZMCA 3LB8A 3FVDA 2AKZA 4H4YA 4NEVA 3U4FA 3LXDA 2W55A 4H4WA 2XH7A 5JCLA 2PS2A 1BKHA 2W0HA 3T8QA 1N63C 4K8DA 4A6GA 1TZZA 1YEYA 4EQRA 3L8KA 3ETRB 2PU1A 3OPSA 1GRGA 1GESA 1ZMDA 4EM4A 3V3WA 1GRTA 5FJRA 1P43A 4KPLA 4FDCB 3VFCA 3NXLA 2NQLA 4H4SA 3SN0A 1KKRA 2GDQA 4EQSA 3V5FA 4H2HA 3IC9A 3Q4DA 2W3SA 3SQPA 1XDIA 2OO6A 2GL5A 2PSNA 1JEHA 3RNMA 2CDUA 3UXLA 1FECA 1IYXA 2GGJA 3VC5A 2X8GA 1F9CA 1NHSA 3I4KA 3U9IA 2OZ8A 3BOXA 2AKMA 4JN8A 3R11A 1JPMA 5FS6A 1WYGA 4E5TA 1GXFA 2YVJA 4HCHA 2QGYA 4ZCWA 4DNAA 3NS1B 2P88A 4GRTA 1JCTA 3DGZA 4GGBA 1WUEA 2YVFA 3QN3A 4ZA0A 1NHQA 5ER0A 2OX4A 5U25A 3DIPA 1NDAA 3R0UA 3GD6A 4TVWA 4BURA 1W6TA 2PTWA 1FFVC 2E3TA 2X8CA 3DK9A 4GISA 4A35A 1XS2A 3RO6A 3TOYA 3V4BA 3P93A 3A7RA 3R07C 3CGDA 4HCLA 4KT2A 3D9XA 3S5SA 3TTEA 4E4FA 3II4A 2AL2A 3GC2A 3ZVHA 2HQMA 3DFYA 3DJJA 3EKGA 1NHPA 4Z17A 1ZDLA 2YQUA 3K1GA 1ELSA 3OTRA 4H19A 3CYJA 3A7AA 1GSNA 5GRTA 1MUCA 4LIIA 2PTYA 3DG3A 2PMQA 1TYTA 3JZUA 3KUMA 4FI4A 1ZX9A 4H4VA 1S7MA 3CK5A 3RRAA 1XHCA 1KKOA 2PPGA 3T6CA 2WBAA 1JROA 4EMIA 3Q6JA 2OFJA 5TR3A 3T9PA 2OLAA 2GH5A 3AM9A 3N4FA 2GR0A 3IJQA 2PODA 1RM6B 3CT2A 2PU0A 3T4WA 5BOEA 3EF6A 1X2HA 3TWBA 1KD0A 6ENLA 2ZZBA 2PGWA 4KEMA 4NEWA 2WP5A 4DYEA 3FXGA 1ZXIC 1FO4A 4TVYA 3ZLFA 1EC7A 2ZADA 4KPRA 5U1OA 2GR3A 3R10A 2FYMA 4M52A 1VQZA 3UJFA 1BZLA 1N62C 3O0HA 1JOAA 2POZA 1NPXA 1H2IA 5FJUA 3STPA 1MDRA 2P3ZA 3NVZB 3PG6A 3UJEA 1Q1RA 4EM3A 3Q45A 2OG9A 4APNA 4H50A 4K2SA 5FMHA 4HN8A 1R0MA 3DDMA 1TE6A 2HXTA 4K1WA 1DNCA 5JCIA 3QPEA 3LADA 3AMZA 3KLJA 1GERA 1GRBA 2WP6A 1R6WA 1FIQB 4M6UA 3DG6A 3MKCA 5FS9A 1ECQA 1GV4A 3H7VA 4DXKA 3DEQA 3MZNA 3V5CA 3SN4A 2R9ZA 4YWOA 3FYYA 2OVLA 3PWIA 4H4UA 1ONEA 2OPJA 4EQWA 3MWCA 4DWDA 2EQ8A 4MMWA 3AN1A 3ZVIA 3PFRA 3HW2A 2WPEA 4GGHA 4FX9A 3N6HA 3NVYB 3OZYA 1L8PA 1EBHA 2ONEA 3JW7A 2C3DA 3TJ4A 5J04A 1T3QC 2BC0A 3GO2A 7ENLA 1TKKA 3CXOA 3N6JA 4JQ9A 1Q1WA 2OZ3A 2P0IA 2P8CA 3FG2P 3D46A 5JCKA 3I6EA 2I5QA 3NFUA 2GR1A 2WOIA 2V3AA 1RVKA 4J3ZA 2QJJA 1GETA 4HYRA 5G5GB 2GRTA 1XPYA 3MSYA 3NZGA 3R1ZA 4X2PA 4MKSA 5BOFA 3B9JB 5FJTA 1VDVA 3DH9A 3P3BA 4DX3A 4GMEA 2GQWA 5KVHA 3SN1A 4E8GA 1P48A 1PDZA 3UJRA 4Z1YA 5JCNA 3UGVA 1H6VA 3OP2A 3P0WA 3DJGX 2OZTA 3VA8A 3EUB3 5ENLA 3DERA 3SJNA 4GYPC 4GIRA 4H4TA 1GREA 3RITA 1BWCA 3CGBA 4HNCA 3DFHA 3TJIA 5JRBA 1X2GA 3OZMA 2PTZA 1SJCA 3DK4A 3BJSA 2WPCA 4DN1A 3JVAA 3H70A 1GRAA 1FFUC 4YWSA 3QLDA 1EBGA 2XH2A 2V6OA 1EBDA 1V59A 4H4RA 1NU5A 1EC9A 4HPNA 4A3RA 2XGZA 2P8BA 4KWSA 3GRSA 2WOWA 2EQ9A 1XANA 2PCEA 2ZC8A 3H8AA 4E4UA 2QDDA 1V97A 2MUCA 1N60C 4G8TA 2X8HA 3ES8A 3FV9A 1EC8A 4JN7A 3THUA 3A7UA 4ADWA 3MY9A 1ZK7A 1K4QA 3NRZB 2AL1A 2EQ6A 1DTNA 1AOGA 4JHMA 4GFIA 4JDRA 3GD3A 4BV6A 2OQYA 1MRAA 4HCDA 3GRTA 1MNSA 2QJNA 2CFYA
chains in the Genus database with same CATH topology
4EQWA 3CGCA 1YQZA 1NHQA 2RABA 1GRHA 2EQ8A 5ER0A 5U25A 5KVIA 4J57A 1NDAA 2WPEA 2ZZCA 4BURA 4FX9A 2X8CA 3DK9A 2J3NA 4H4XA 2WPFA 1F8WA 4EMJA 3EANA 2C3DA 5EBKA 2BC0A 3CGDA 2X99A 3D9XA 4JQ9A 1Q1WA 2BCPA 3FG2P 3II4A 5JCKA 1LVLA 2HQMA 2X50A 4LA1A 1TYPA 2GR1A 2F5ZA 1M6IA 3DJJA 2WOIA 1NHPA 1LPFA 2V3AA 1D7YA 5FS7A 1ZDLA 2YQUA 3CGEA 2BC1A 1GETA 1F3PA 1GSNA 5GRTA 4EMWA 2GRTA 3OC4A 4LIIA 1MOKA 1NHRA 4H4PA 4GR1A 2ZZ0A 1ZY8A 1TYTA 1GRFA 3DH9A 1ZX9A 2A8XA 2GQWA 4H4VA 5KVHA 1S7MA 2YVGA 1ZKQA 5JCNA 1XHCA 2WOVA 2NPXA 1H6VA 2QAEA 3GD4A 3QFAA 2WBAA 4EMIA 3DJGX 5FS8A 3Q6JA 2EQ7A 5TR3A 1ZMCA 1FEBA 3LB8A 2GH5A 4NEVA 4H4YA 2GR0A 3LXDA 1ONFA 1FEAA 3DGHA 4H4WA 3EF6A 2YAUA 5JCLA 4H4TA 1GREA 2W0HA 5JCMA 1BWCA 3CGBA 1DXLA 4K8DA 2ZZBA 4EQXA 4NEWA 5JRBA 2WP5A 3DK8A 4EQRA 3L8KA 3DK4A 1GRGA 2WPCA 2NVKX 4KPRA 5U1OA 1GESA 1ZMDA 1OJTA 2JK6A 4EM4A 1GRTA 1GRAA 1KN0A 2GR3A 4M52A 4FDCB 1BZLA 4H4QA 3O0HA 2V3BA 3EAOA 2V6OA 1EBDA 4H4SA 1V59A 4H4RA 1JOAA 1NPXA 1H2IA 4EQSA 2GR2A 3PG6A 3IC9A 4H4ZA 1Q1RA 4EM3A 3GRSA 3SQPA 2WOWA 2EQ9A 1XANA 1MO9A 3H4KA 4APNA 1XDIA 4H50A 1GEUA 1JEHA 3RNMA 5FMHA 2CDUA 2X8HA 2TPRA 1FECA 1DNCA 5JCIA 2X8GA 1NHSA 4ADWA 1ZK7A 3LADA 3KLJA 4J56A 1K4QA 3URHA 1GERA 3QFBA 1GRBA 2WP6A 2EQ6A 1AOGA 3L5OA 5FS9A 5FS6A 4JDRA 2AAQA 1GV4A 2C3CA 1GXFA 2YVJA 3GD3A 4K7ZA 4BV6A 4DNAA 3GRTA 2R9ZA 4GRTA 4YWOA 3DGZA 2YVFA 4H4UA 2CFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2I A;  1KN0 A;  5JRB A; 
#chains in the Genus database with same CATH topology
 3ZLG A;  2GGI A;  1SJD A;  2PP0 A;  2ZZC A;  4K8G A;  4H4X A;  3UCC A;  4EMJ A;  4IL2 A;  5FJO A;  1FHV A;  5EBK A;  3RGT A;  3B97 A;  2XH4 A;  2OQH A;  2F5Z A;  1M6I A;  4IT1 A;  3ES7 A;  1N61 C;  1STZ A;  3QTP A;  3UCD A;  3CGE A;  2BC1 A;  3D47 A;  1F3P A;  3UJS A;  1MOK A;  2RDX A;  4H4P A;  4GR1 A;  2ZZ0 A;  2PTX A;  3IJL A;  1SB3 B;  3TQP A;  2XH0 A;  2A8X A;  1JPD X;  4ROP A;  2CHR A;  1ZKQ A;  2WOV A;  3ENL A;  3UJ2 A;  2QAE A;  3N4E A;  5FS8 A;  2GSH A;  2EQ7 A;  1FEB A;  3FCP A;  2GGE A;  1N5X A;  1ONF A;  1FEA A;  5FJP A;  3DGH A;  5G5H B;  3FJ4 A;  2YAU A;  5JCM A;  3R0K A;  1DXL A;  2E5A A;  4EQX A;  4IP5 A;  4F4R A;  4DHG A;  3DK8 A;  2FKP A;  3HRD C;  3SR6 B;  3SSZ A;  4ENL A;  3DG7 A;  2NVK X;  2PGE A;  3DGB A;  1WUF A;  2OKT A;  1OJT A;  2JK6 A;  2QQ6 A;  4M0X A;  1KN0 A;  4H4Q A;  4H83 A;  2V3B A;  3EAO A;  4ZOH B;  3TWA A;  3S47 A;  3CXB A;  2DW7 A;  2HZG A;  3VDG A;  4MGG A;  2GR2 A;  3SQS A;  2DW6 A;  4H4Z A;  1SJB A;  2W3R A;  1MO9 A;  3H4K A;  1N5W C;  3UXK A;  3HPF A;  1GEU A;  3PWG A;  4FP1 A;  1E9I A;  4EWJ A;  3IJI A;  2TPR A;  3CAW A;  4HNL A;  3R25 A;  1MDL A;  4J56 A;  3URH A;  2AL2 B;  3ZVH B;  2QVH A;  3QFB A;  5IDZ A;  3RCY A;  3OW1 A;  4IHC A;  3VCN A;  3L5O A;  1OEP A;  2AAQ A;  2C3C A;  3NVV B;  4K7Z A;  3VC6 A;  3NO1 A;  3TW9 A;  4IZG A;  3ZLH A;  3IK4 A;  3CB3 A;  2HNE A;  2PA6 A;  2PP3 A;  3CGC A;  1YQZ A;  2RAB A;  1KCZ A;  1GRH A;  3EEZ A;  3VCC A;  4G7F A;  1JRP A;  3H12 A;  5KVI A;  4J57 A;  3PK7 A;  1FHU A;  4IP4 A;  2QJM A;  2J3N A;  2WPF A;  1F8W A;  2QDE A;  3MUC A;  3EAN A;  3RR1 A;  4IL0 A;  2X99 A;  3MQT A;  3QKE A;  2BCP A;  1BQG A;  2W54 A;  1LVL A;  2X50 A;  4LA1 A;  1TYP A;  3I6T A;  2PP1 A;  1LPF A;  1D7Y A;  3NVW B;  4J1O A;  5FS7 A;  4GYP A;  1NEL A;  3DES A;  1JDF A;  2HXU A;  4EMW A;  3OC4 A;  3GY1 A;  1NHR A;  2O56 A;  1ZY8 A;  2GGG A;  1GRF A;  2MNR A;  4E6M A;  2YVG A;  5EU9 A;  1PDY A;  2NPX A;  3TCS A;  1SJA A;  3GD4 A;  2XSX A;  3QFA A;  3SBF A;  3BSM A;  4H1Z A;  2GGH A;  1ZMC A;  3LB8 A;  3FVD A;  2AKZ A;  4H4Y A;  4NEV A;  3U4F A;  3LXD A;  2W55 A;  4H4W A;  2XH7 A;  5JCL A;  2PS2 A;  1BKH A;  2W0H A;  3T8Q A;  1N63 C;  4K8D A;  4A6G A;  1TZZ A;  1YEY A;  4EQR A;  3L8K A;  3ETR B;  2PU1 A;  3OPS A;  1GRG A;  1GES A;  1ZMD A;  4EM4 A;  3V3W A;  1GRT A;  5FJR A;  1P43 A;  4KPL A;  4FDC B;  3VFC A;  3NXL A;  2NQL A;  4H4S A;  3SN0 A;  1KKR A;  2GDQ A;  4EQS A;  3V5F A;  4H2H A;  3IC9 A;  3Q4D A;  2W3S A;  3SQP A;  1XDI A;  2OO6 A;  2GL5 A;  2PSN A;  1JEH A;  3RNM A;  2CDU A;  3UXL A;  1FEC A;  1IYX A;  2GGJ A;  3VC5 A;  2X8G A;  1F9C A;  1NHS A;  3I4K A;  3U9I A;  2OZ8 A;  3BOX A;  2AKM A;  4JN8 A;  3R11 A;  1JPM A;  5FS6 A;  1WYG A;  4E5T A;  1GXF A;  2YVJ A;  4HCH A;  2QGY A;  4ZCW A;  4DNA A;  3NS1 B;  2P88 A;  4GRT A;  1JCT A;  3DGZ A;  4GGB A;  1WUE A;  2YVF A;  3QN3 A;  4ZA0 A;  1NHQ A;  5ER0 A;  2OX4 A;  5U25 A;  3DIP A;  1NDA A;  3R0U A;  3GD6 A;  4TVW A;  4BUR A;  1W6T A;  2PTW A;  1FFV C;  2E3T A;  2X8C A;  3DK9 A;  4GIS A;  4A35 A;  1XS2 A;  3RO6 A;  3TOY A;  3V4B A;  3P93 A;  3A7R A;  3R07 C;  3CGD A;  4HCL A;  4KT2 A;  3D9X A;  3S5S A;  3TTE A;  4E4F A;  3II4 A;  2AL2 A;  3GC2 A;  3ZVH A;  2HQM A;  3DFY A;  3DJJ A;  3EKG A;  1NHP A;  4Z17 A;  1ZDL A;  2YQU A;  3K1G A;  1ELS A;  3OTR A;  4H19 A;  3CYJ A;  3A7A A;  1GSN A;  5GRT A;  1MUC A;  4LII A;  2PTY A;  3DG3 A;  2PMQ A;  1TYT A;  3JZU A;  3KUM A;  4FI4 A;  1ZX9 A;  4H4V A;  1S7M A;  3CK5 A;  3RRA A;  1XHC A;  1KKO A;  2PPG A;  3T6C A;  2WBA A;  1JRO A;  4EMI A;  3Q6J A;  2OFJ A;  5TR3 A;  3T9P A;  2OLA A;  2GH5 A;  3AM9 A;  3N4F A;  2GR0 A;  3IJQ A;  2POD A;  1RM6 B;  3CT2 A;  2PU0 A;  3T4W A;  5BOE A;  3EF6 A;  1X2H A;  3TWB A;  1KD0 A;  6ENL A;  2ZZB A;  2PGW A;  4KEM A;  4NEW A;  2WP5 A;  4DYE A;  3FXG A;  1ZXI C;  1FO4 A;  4TVY A;  3ZLF A;  1EC7 A;  2ZAD A;  4KPR A;  5U1O A;  2GR3 A;  3R10 A;  2FYM A;  4M52 A;  1VQZ A;  3UJF A;  1BZL A;  1N62 C;  3O0H A;  1JOA A;  2POZ A;  1NPX A;  1H2I A;  5FJU A;  3STP A;  1MDR A;  2P3Z A;  3NVZ B;  3PG6 A;  3UJE A;  1Q1R A;  4EM3 A;  3Q45 A;  2OG9 A;  4APN A;  4H50 A;  4K2S A;  5FMH A;  4HN8 A;  1R0M A;  3DDM A;  1TE6 A;  2HXT A;  4K1W A;  1DNC A;  5JCI A;  3QPE A;  3LAD A;  3AMZ A;  3KLJ A;  1GER A;  1GRB A;  2WP6 A;  1R6W A;  1FIQ B;  4M6U A;  3DG6 A;  3MKC A;  5FS9 A;  1ECQ A;  1GV4 A;  3H7V A;  4DXK A;  3DEQ A;  3MZN A;  3V5C A;  3SN4 A;  2R9Z A;  4YWO A;  3FYY A;  2OVL A;  3PWI A;  4H4U A;  1ONE A;  2OPJ A;  4EQW A;  3MWC A;  4DWD A;  2EQ8 A;  4MMW A;  3AN1 A;  3ZVI A;  3PFR A;  3HW2 A;  2WPE A;  4GGH A;  4FX9 A;  3N6H A;  3NVY B;  3OZY A;  1L8P A;  1EBH A;  2ONE A;  3JW7 A;  2C3D A;  3TJ4 A;  5J04 A;  1T3Q C;  2BC0 A;  3GO2 A;  7ENL A;  1TKK A;  3CXO A;  3N6J A;  4JQ9 A;  1Q1W A;  2OZ3 A;  2P0I A;  2P8C A;  3FG2 P;  3D46 A;  5JCK A;  3I6E A;  2I5Q A;  3NFU A;  2GR1 A;  2WOI A;  2V3A A;  1RVK A;  4J3Z A;  2QJJ A;  1GET A;  4HYR A;  5G5G B;  2GRT A;  1XPY A;  3MSY A;  3NZG A;  3R1Z A;  4X2P A;  4MKS A;  5BOF A;  3B9J B;  5FJT A;  1VDV A;  3DH9 A;  3P3B A;  4DX3 A;  4GME A;  2GQW A;  5KVH A;  3SN1 A;  4E8G A;  1P48 A;  1PDZ A;  3UJR A;  4Z1Y A;  5JCN A;  3UGV A;  1H6V A;  3OP2 A;  3P0W A;  3DJG X;  2OZT A;  3VA8 A;  3EUB 3;  5ENL A;  3DER A;  3SJN A;  4GYP C;  4GIR A;  4H4T A;  1GRE A;  3RIT A;  1BWC A;  3CGB A;  4HNC A;  3DFH A;  3TJI A;  5JRB A;  1X2G A;  3OZM A;  2PTZ A;  1SJC A;  3DK4 A;  3BJS A;  2WPC A;  4DN1 A;  3JVA A;  3H70 A;  1GRA A;  1FFU C;  4YWS A;  3QLD A;  1EBG A;  2XH2 A;  2V6O A;  1EBD A;  1V59 A;  4H4R A;  1NU5 A;  1EC9 A;  4HPN A;  4A3R A;  2XGZ A;  2P8B A;  4KWS A;  3GRS A;  2WOW A;  2EQ9 A;  1XAN A;  2PCE A;  2ZC8 A;  3H8A A;  4E4U A;  2QDD A;  1V97 A;  2MUC A;  1N60 C;  4G8T A;  2X8H A;  3ES8 A;  3FV9 A;  1EC8 A;  4JN7 A;  3THU A;  3A7U A;  4ADW A;  3MY9 A;  1ZK7 A;  1K4Q A;  3NRZ B;  2AL1 A;  2EQ6 A;  1DTN A;  1AOG A;  4JHM A;  4GFI A;  4JDR A;  3GD3 A;  4BV6 A;  2OQY A;  1MRA A;  4HCD A;  3GRT A;  1MNS A;  2QJN A;  2CFY A; 
#chains in the Genus database with same CATH homology
 4EQW A;  3CGC A;  1YQZ A;  1NHQ A;  2RAB A;  1GRH A;  2EQ8 A;  5ER0 A;  5U25 A;  5KVI A;  4J57 A;  1NDA A;  2WPE A;  2ZZC A;  4BUR A;  4FX9 A;  2X8C A;  3DK9 A;  2J3N A;  4H4X A;  2WPF A;  1F8W A;  4EMJ A;  3EAN A;  2C3D A;  5EBK A;  2BC0 A;  3CGD A;  2X99 A;  3D9X A;  4JQ9 A;  1Q1W A;  2BCP A;  3FG2 P;  3II4 A;  5JCK A;  1LVL A;  2HQM A;  2X50 A;  4LA1 A;  1TYP A;  2GR1 A;  2F5Z A;  1M6I A;  3DJJ A;  2WOI A;  1NHP A;  1LPF A;  2V3A A;  1D7Y A;  5FS7 A;  1ZDL A;  2YQU A;  3CGE A;  2BC1 A;  1GET A;  1F3P A;  1GSN A;  5GRT A;  4EMW A;  2GRT A;  3OC4 A;  4LII A;  1MOK A;  1NHR A;  4H4P A;  4GR1 A;  2ZZ0 A;  1ZY8 A;  1TYT A;  1GRF A;  3DH9 A;  1ZX9 A;  2A8X A;  2GQW A;  4H4V A;  5KVH A;  1S7M A;  2YVG A;  1ZKQ A;  5JCN A;  1XHC A;  2WOV A;  2NPX A;  1H6V A;  2QAE A;  3GD4 A;  3QFA A;  2WBA A;  4EMI A;  3DJG X;  5FS8 A;  3Q6J A;  2EQ7 A;  5TR3 A;  1ZMC A;  1FEB A;  3LB8 A;  2GH5 A;  4NEV A;  4H4Y A;  2GR0 A;  3LXD A;  1ONF A;  1FEA A;  3DGH A;  4H4W A;  3EF6 A;  2YAU A;  5JCL A;  4H4T A;  1GRE A;  2W0H A;  5JCM A;  1BWC A;  3CGB A;  1DXL A;  4K8D A;  2ZZB A;  4EQX A;  4NEW A;  5JRB A;  2WP5 A;  3DK8 A;  4EQR A;  3L8K A;  3DK4 A;  1GRG A;  2WPC A;  2NVK X;  4KPR A;  5U1O A;  1GES A;  1ZMD A;  1OJT A;  2JK6 A;  4EM4 A;  1GRT A;  1GRA A;  1KN0 A;  2GR3 A;  4M52 A;  4FDC B;  1BZL A;  4H4Q A;  3O0H A;  2V3B A;  3EAO A;  2V6O A;  1EBD A;  4H4S A;  1V59 A;  4H4R A;  1JOA A;  1NPX A;  1H2I A;  4EQS A;  2GR2 A;  3PG6 A;  3IC9 A;  4H4Z A;  1Q1R A;  4EM3 A;  3GRS A;  3SQP A;  2WOW A;  2EQ9 A;  1XAN A;  1MO9 A;  3H4K A;  4APN A;  1XDI A;  4H50 A;  1GEU A;  1JEH A;  3RNM A;  5FMH A;  2CDU A;  2X8H A;  2TPR A;  1FEC A;  1DNC A;  5JCI A;  2X8G A;  1NHS A;  4ADW A;  1ZK7 A;  3LAD A;  3KLJ A;  4J56 A;  1K4Q A;  3URH A;  1GER A;  3QFB A;  1GRB A;  2WP6 A;  2EQ6 A;  1AOG A;  3L5O A;  5FS9 A;  5FS6 A;  4JDR A;  2AAQ A;  1GV4 A;  2C3C A;  1GXF A;  2YVJ A;  3GD3 A;  4K7Z A;  4BV6 A;  4DNA A;  3GRT A;  2R9Z A;  4GRT A;  4YWO A;  3DGZ A;  2YVF A;  4H4U A;  2CFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...