1H2IA

Human rad52 protein, n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
LCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA REPAIR PROTEIN RAD52 HOMOLOG
publication title Structure of the Single-Strand Annealing Domain of Human Rad52 Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1h2iA01
5JRBA 1KN0A 1H2IA
chains in the Genus database with same CATH superfamily
1EBHA 3I6EA 3R11A 1GEUA 1VDVA 4JN8A 3DK4A 3TOYA 1XDIA 3H8AA 3LXDA 4HNLA 2AKZA 3MQTA 1FEAA 4IL0A 1ZY8A 1TYTA 2W54A 3AM9A 4H4XA 4X2PA 1ONFA 5JCNA 1F9CA 4GFIA 3S47A 3Q6JA 1GRTA 2OZTA 3HPFA 5JCLA 5FS9A 3DG6A 1T3QC 4EM3A 2ZC8A 3FVDA 3SQSA 1EBGA 1SJDA 1NHPA 1KCZA 2PU1A 2PU0A 2EQ7A 2X8HA 2WOVA 1DTNA 4M6UA 1MUCA 1FIQB 2OO6A 2WPCA 2NQLA 1ZMCA 3R0UA 3CB3A 2PCEA 4E8GA 3SN4A 4DXKA 1JRPA 3ZLHA 3QLDA 3P93A 3GRTA 3ZVHA 5U1OA 3NFUA 1P48A 2V3AA 3JVAA 1LVLA 1WUEA 3O0HA 5FJOA 3LB8A 1ZXIC 3DFHA 2GGJA 1GESA 2OPJA 2PS2A 4E4FA 3BOXA 3GC2A 4GISA 2XSXA 1ECQA 1KKRA 2POZA 2WBAA 3TTEA 2CHRA 1FHVA 3DG7A 4ZCWA 1JPMA 1N61C 5ENLA 1IYXA 1JCTA 2P88A 1BKHA 2ZADA 2QAEA 2XH0A 3H4KA 4H4TA 2QVHA 3CGDA 1STZA 4H4QA 1TZZA 2QJMA 4DN1A 4DNAA 2WP5A 4DX3A 3H70A 3MKCA 3TWAA 1NHRA 3RITA 1ZKQA 3QKEA 2OLAA 1GRBA 3DG3A 1GERA 1FECA 3ES8A 4FP1A 2PPGA 1WUFA 3NXLA 1KKOA 3GD3A 2GR3A 5JRBA 3ZLGA 3DJGX 3HRDC 3DH9A 1V97A 4EQXA 3R0KA 4BURA 1F3PA 3RCYA 2QDEA 2W3SA 2X8CA 2PGWA 2QQ6A 2WPFA 3CGCA 4HCHA 5G5GB 2OZ3A 2W0HA 4DYEA 2FYMA 2RABA 3Q45A 1Q1WA 3RRAA 4MKSA 4ZA0A 4J1OA 1XPYA 3B9JB 2CFYA 3PK7A 3A7RA 2OKTA 2ZZ0A 3IJIA 4E5TA 1TE6A 4IHCA 3MWCA 4TVWA 3SBFA 3UJFA 2PP1A 3I6TA 1SJAA 3EKGA 4H4UA 2BC0A 2GDQA 2YVGA 3OW1A 4EWJA 2GR1A 2GSHA 2OQHA 3OTRA 4IP4A 3EAOA 3BSMA 2WP6A 3UCDA 4K8DA 4H50A 3UJ2A 1H6VA 1BQGA 1FFUC 4H4SA 7ENLA 4Z1YA 4DWDA 3TJIA 1EC7A 2AAQA 4H83A 2YVJA 1R6WA 3DIPA 3T8QA 3JW7A 4K2SA 4ENLA 3IJQA 1GREA 3OP2A 4G7FA 4JN7A 3S5SA 4H4YA 5FJUA 3A7UA 4A3RA 3T6CA 2GL5A 5BOEA 5FS6A 3UJRA 4GGBA 4M0XA 4APNA 1NELA 4HCDA 1GETA 3DESA 5FJRA 3L5OA 6ENLA 2NPXA 1H2IA 2O56A 2PSNA 4KPRA 3UJSA 3OZYA 3VA8A 3PFRA 4JDRA 2J3NA 3VDGA 3D47A 1YQZA 3QTPA 4A6GA 3VC6A 3A7AA 1RM6B 2HXUA 3R07C 4GRTA 4IT1A 4YWSA 1SJCA 2X50A 3RGTA 2A8XA 4GYPC 3UGVA 3H7VA 1MNSA 3NVVB 3RO6A 2PP3A 3N6JA 1XANA 3TWBA 3II4A 4JHMA 3PWGA 4IP5A 3QN3A 2JK6A 3VCCA 2DW6A 3TCSA 3CGBA 3IK4A 3V5FA 3N6HA 4KPLA 1F8WA 4NEWA 3SN0A 1ZDLA 1GSNA 2F5ZA 3I4KA 3KUMA 3FXGA 4HNCA 4HN8A 2R9ZA 2PTWA 2OVLA 3CXOA 2OFJA 3STPA 3UCCA 4LA1A 3RR1A 4LIIA 2P0IA 1M6IA 3QFAA 2OX4A 5FS8A 3GD4A 3PG6A 4EQRA 4EQSA 4ADWA 1NPXA 3EEZA 4H4RA 1NHSA 2TPRA 1GRAA 1VQZA 3K1GA 3OPSA 2P3ZA 1MDRA 1JOAA 2EQ9A 2XH2A 2PTZA 5ER0A 3H12A 3OC4A 1NHQA 1N63C 1N5XA 3DDMA 2XGZA 2ONEA 2W55A 2GR0A 4EQWA 1EBDA 3R25A 2BCPA 3T4WA 3U9IA 4H4ZA 1MOKA 4YWOA 3R1ZA 3DGBA 4NEVA 1OJTA 1JDFA 1N62C 3CGEA 1E9IA 1W6TA 3NVYB 3BJSA 3AMZA 2E5AA 1NDAA 4FDCB 5EBKA 2GGEA 4KWSA 1N5WC 1X2GA 3MY9A 2HZGA 2AL2A 5TR3A 3MUCA 1XS2A 3VFCA 4G8TA 2C3DA 1ELSA 1DNCA 1FO4A 3NZGA 1JPDX 2X8GA 3V4BA 3D46A 5JCIA 2PMQA 1TYPA 2ZZCA 3UXKA 3ZVIA 1WYGA 3QPEA 3FYYA 3Q4DA 1ZMDA 2GR2A 4E6MA 3GRSA 3RNMA 4E4UA 3SN1A 2OZ8A 3L8KA 3THUA 1GXFA 4JQ9A 1AOGA 4H2HA 2C3CA 5KVIA 3DERA 2QJNA 4GMEA 4TVYA 2OQYA 1BZLA 1P43A 1OEPA 1ZX9A 3EANA 3U4FA 1Q1RA 2GGIA 3CT2A 4HYRA 3IC9A 5JCMA 1SB3B 4M52A 1PDYA 3P3BA 2I5QA 2ZZBA 4A35A 2CDUA 3KLJA 3NVWB 1XHCA 3UJEA 4EMJA 2HXTA 2V6OA 3SR6B 1MRAA 3SSZA 3IJLA 4GGHA 3DEQA 2FKPA 4H19A 3D9XA 2W3RA 2QDDA 1NU5A 3URHA 3DGZA 4J3ZA 1V59A 4MGGA 2PTYA 4EMWA 2X99A 4H4PA 3ES7A 1GRHA 4K8GA 3FJ4A 1DXLA 3FG2P 3CK5A 1FFVC 2AKMA 1FEBA 5BOFA 4J57A 3NS1B 2GGGA 4MMWA 1FHUA 4J56A 3SQPA 2BC1A 2YVFA 2EQ8A 1R0MA 4GYPA 1JROA 3DGHA 3EF6A 5FJTA 4GIRA 1MO9A 2V3BA 3DK9A 3CYJA 2PGEA 3GY1A 2WPEA 4FX9A 2E3TA 4GR1A 2AL2B 5KVHA 4BV6A 3P0WA 1ONEA 2WOWA 2HQMA 4H4VA 2PA6A 2P8CA 1EC9A 2OG9A 4HPNA 1L8PA 2HNEA 3HW2A 2PTXA 4F4RA 4DHGA 3SJNA 5FS7A 4K7ZA 5J04A 5GRTA 3PWIA 3VC5A 2NVKX 2PODA 5FJPA 4IL2A 1PDZA 3QFBA 3OZMA 3VCNA 2QJJA 5EU9A 3N4EA 2GH5A 4H4WA 2YQUA 2RDXA 5G5HB 3NVZB 1D7YA 4H1ZA 1MDLA 2DW7A 1X2HA 1S7MA 2XH4A 3DJJA 3JZUA 4IZGA 3GD6A 3V3WA 3FCPA 2GGHA 1K4QA 3R10A 3B97A 1RVKA 1N60C 3LADA 1YEYA 4Z17A 2P8BA 1SJBA 3UXLA 2GQWA 3NO1A 1LPFA 3ENLA 1KN0A 3V5CA 2QGYA 3CAWA 5U25A 1KD0A 3TJ4A 2MNRA 1ZK7A 3NRZB 4HCLA 3FV9A 2YAUA 3TQPA 3MZNA 4FI4A 3MSYA 3ZLFA 3ETRB 3EUB3 2XH7A 5IDZA 1GRGA 1GV4A 2AL1A 2PP0A 4EMIA 1JEHA 5FMHA 4K1WA 2MUCA 1BWCA 3DK8A 4KEMA 3T9PA 4ROPA 3GO2A 4EM4A 3AN1A 3DFYA 1TKKA 1EC8A 2EQ6A 5JCKA 4KT2A 3CXBA 4ZOHB 3ZVHB 2WOIA 1GRFA 3TW9A 3N4FA 2GRTA
chains in the Genus database with same CATH topology
1NHQA 4J57A 1GEUA 4J56A 3DK4A 2GR0A 2ZZ0A 4EQWA 1XDIA 3LXDA 1EBDA 2BC1A 2YVFA 3SQPA 2EQ8A 2BCPA 1FEAA 3DGHA 3EF6A 4H4ZA 1ZY8A 1TYTA 5JCNA 4H4UA 4H4XA 1ONFA 2BC0A 1MOKA 4YWOA 1MO9A 2V3BA 2YVGA 3DK9A 3Q6JA 1GRTA 2GR1A 1OJTA 4NEVA 2WPEA 3CGEA 5JCLA 5FS9A 4FX9A 4EM3A 3EAOA 4GR1A 5KVHA 4BV6A 2WOWA 2WP6A 2HQMA 4H4VA 1NHPA 4K8DA 4H50A 2X8HA 2EQ7A 1H6VA 2WOVA 4H4SA 1NDAA 4FDCB 2AAQA 2WPCA 5EBKA 2YVJA 1ZMCA 5FS7A 4K7ZA 1GREA 5GRTA 2NVKX 5TR3A 4H4YA 3QFBA 3GRTA 2C3DA 5U1OA 1DNCA 2V3AA 2GH5A 4H4WA 1LVLA 2YQUA 5FS6A 4APNA 1GETA 2X8GA 3L5OA 1D7YA 3O0HA 2NPXA 5JCIA 3LB8A 1H2IA 1TYPA 4KPRA 2ZZCA 3DJJA 1GESA 1S7MA 4JDRA 2J3NA 1YQZA 1ZMDA 2GR2A 4GRTA 2WBAA 2X50A 3GRSA 2A8XA 3RNMA 1K4QA 3L8KA 1AOGA 1GXFA 3LADA 4JQ9A 1XANA 2C3CA 5KVIA 3II4A 2GQWA 1LPFA 2QAEA 1BZLA 2JK6A 3H4KA 1ZX9A 4H4TA 3CGDA 3CGBA 3EANA 1KN0A 1Q1RA 4H4QA 4NEWA 4DNAA 1F8WA 2WP5A 5U25A 3IC9A 5JCMA 1NHRA 4M52A 1ZK7A 1ZDLA 1ZKQA 1GRBA 2ZZBA 1GERA 2CDUA 3KLJA 1GSNA 1FECA 2F5ZA 2YAUA 1XHCA 2R9ZA 4EMJA 2V6OA 3GD3A 2GR3A 5JRBA 4LA1A 3DJGX 1GRGA 1GV4A 3DH9A 4LIIA 4EMIA 4BURA 4EQXA 1F3PA 1M6IA 3QFAA 1JEHA 5FMHA 5FS8A 2X8CA 3GD4A 3D9XA 3PG6A 1BWCA 3DK8A 4EQRA 3URHA 4EQSA 3DGZA 4ADWA 2WPFA 3CGCA 4EM4A 1NPXA 1V59A 4H4RA 4EMWA 1NHSA 2TPRA 1GRAA 2W0HA 2X99A 2EQ6A 2RABA 4H4PA 5JCKA 1GRHA 1Q1WA 1DXLA 1JOAA 1GRFA 2WOIA 2EQ9A 3FG2P 5ER0A 1FEBA 3OC4A 2GRTA 2CFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRB A;  1KN0 A;  1H2I A; 
#chains in the Genus database with same CATH topology
 1EBH A;  3I6E A;  3R11 A;  1GEU A;  1VDV A;  4JN8 A;  3DK4 A;  3TOY A;  1XDI A;  3H8A A;  3LXD A;  4HNL A;  2AKZ A;  3MQT A;  1FEA A;  4IL0 A;  1ZY8 A;  1TYT A;  2W54 A;  3AM9 A;  4H4X A;  4X2P A;  1ONF A;  5JCN A;  1F9C A;  4GFI A;  3S47 A;  3Q6J A;  1GRT A;  2OZT A;  3HPF A;  5JCL A;  5FS9 A;  3DG6 A;  1T3Q C;  4EM3 A;  2ZC8 A;  3FVD A;  3SQS A;  1EBG A;  1SJD A;  1NHP A;  1KCZ A;  2PU1 A;  2PU0 A;  2EQ7 A;  2X8H A;  2WOV A;  1DTN A;  4M6U A;  1MUC A;  1FIQ B;  2OO6 A;  2WPC A;  2NQL A;  1ZMC A;  3R0U A;  3CB3 A;  2PCE A;  4E8G A;  3SN4 A;  4DXK A;  1JRP A;  3ZLH A;  3QLD A;  3P93 A;  3GRT A;  3ZVH A;  5U1O A;  3NFU A;  1P48 A;  2V3A A;  3JVA A;  1LVL A;  1WUE A;  3O0H A;  5FJO A;  3LB8 A;  1ZXI C;  3DFH A;  2GGJ A;  1GES A;  2OPJ A;  2PS2 A;  4E4F A;  3BOX A;  3GC2 A;  4GIS A;  2XSX A;  1ECQ A;  1KKR A;  2POZ A;  2WBA A;  3TTE A;  2CHR A;  1FHV A;  3DG7 A;  4ZCW A;  1JPM A;  1N61 C;  5ENL A;  1IYX A;  1JCT A;  2P88 A;  1BKH A;  2ZAD A;  2QAE A;  2XH0 A;  3H4K A;  4H4T A;  2QVH A;  3CGD A;  1STZ A;  4H4Q A;  1TZZ A;  2QJM A;  4DN1 A;  4DNA A;  2WP5 A;  4DX3 A;  3H70 A;  3MKC A;  3TWA A;  1NHR A;  3RIT A;  1ZKQ A;  3QKE A;  2OLA A;  1GRB A;  3DG3 A;  1GER A;  1FEC A;  3ES8 A;  4FP1 A;  2PPG A;  1WUF A;  3NXL A;  1KKO A;  3GD3 A;  2GR3 A;  5JRB A;  3ZLG A;  3DJG X;  3HRD C;  3DH9 A;  1V97 A;  4EQX A;  3R0K A;  4BUR A;  1F3P A;  3RCY A;  2QDE A;  2W3S A;  2X8C A;  2PGW A;  2QQ6 A;  2WPF A;  3CGC A;  4HCH A;  5G5G B;  2OZ3 A;  2W0H A;  4DYE A;  2FYM A;  2RAB A;  3Q45 A;  1Q1W A;  3RRA A;  4MKS A;  4ZA0 A;  4J1O A;  1XPY A;  3B9J B;  2CFY A;  3PK7 A;  3A7R A;  2OKT A;  2ZZ0 A;  3IJI A;  4E5T A;  1TE6 A;  4IHC A;  3MWC A;  4TVW A;  3SBF A;  3UJF A;  2PP1 A;  3I6T A;  1SJA A;  3EKG A;  4H4U A;  2BC0 A;  2GDQ A;  2YVG A;  3OW1 A;  4EWJ A;  2GR1 A;  2GSH A;  2OQH A;  3OTR A;  4IP4 A;  3EAO A;  3BSM A;  2WP6 A;  3UCD A;  4K8D A;  4H50 A;  3UJ2 A;  1H6V A;  1BQG A;  1FFU C;  4H4S A;  7ENL A;  4Z1Y A;  4DWD A;  3TJI A;  1EC7 A;  2AAQ A;  4H83 A;  2YVJ A;  1R6W A;  3DIP A;  3T8Q A;  3JW7 A;  4K2S A;  4ENL A;  3IJQ A;  1GRE A;  3OP2 A;  4G7F A;  4JN7 A;  3S5S A;  4H4Y A;  5FJU A;  3A7U A;  4A3R A;  3T6C A;  2GL5 A;  5BOE A;  5FS6 A;  3UJR A;  4GGB A;  4M0X A;  4APN A;  1NEL A;  4HCD A;  1GET A;  3DES A;  5FJR A;  3L5O A;  6ENL A;  2NPX A;  1H2I A;  2O56 A;  2PSN A;  4KPR A;  3UJS A;  3OZY A;  3VA8 A;  3PFR A;  4JDR A;  2J3N A;  3VDG A;  3D47 A;  1YQZ A;  3QTP A;  4A6G A;  3VC6 A;  3A7A A;  1RM6 B;  2HXU A;  3R07 C;  4GRT A;  4IT1 A;  4YWS A;  1SJC A;  2X50 A;  3RGT A;  2A8X A;  4GYP C;  3UGV A;  3H7V A;  1MNS A;  3NVV B;  3RO6 A;  2PP3 A;  3N6J A;  1XAN A;  3TWB A;  3II4 A;  4JHM A;  3PWG A;  4IP5 A;  3QN3 A;  2JK6 A;  3VCC A;  2DW6 A;  3TCS A;  3CGB A;  3IK4 A;  3V5F A;  3N6H A;  4KPL A;  1F8W A;  4NEW A;  3SN0 A;  1ZDL A;  1GSN A;  2F5Z A;  3I4K A;  3KUM A;  3FXG A;  4HNC A;  4HN8 A;  2R9Z A;  2PTW A;  2OVL A;  3CXO A;  2OFJ A;  3STP A;  3UCC A;  4LA1 A;  3RR1 A;  4LII A;  2P0I A;  1M6I A;  3QFA A;  2OX4 A;  5FS8 A;  3GD4 A;  3PG6 A;  4EQR A;  4EQS A;  4ADW A;  1NPX A;  3EEZ A;  4H4R A;  1NHS A;  2TPR A;  1GRA A;  1VQZ A;  3K1G A;  3OPS A;  2P3Z A;  1MDR A;  1JOA A;  2EQ9 A;  2XH2 A;  2PTZ A;  5ER0 A;  3H12 A;  3OC4 A;  1NHQ A;  1N63 C;  1N5X A;  3DDM A;  2XGZ A;  2ONE A;  2W55 A;  2GR0 A;  4EQW A;  1EBD A;  3R25 A;  2BCP A;  3T4W A;  3U9I A;  4H4Z A;  1MOK A;  4YWO A;  3R1Z A;  3DGB A;  4NEV A;  1OJT A;  1JDF A;  1N62 C;  3CGE A;  1E9I A;  1W6T A;  3NVY B;  3BJS A;  3AMZ A;  2E5A A;  1NDA A;  4FDC B;  5EBK A;  2GGE A;  4KWS A;  1N5W C;  1X2G A;  3MY9 A;  2HZG A;  2AL2 A;  5TR3 A;  3MUC A;  1XS2 A;  3VFC A;  4G8T A;  2C3D A;  1ELS A;  1DNC A;  1FO4 A;  3NZG A;  1JPD X;  2X8G A;  3V4B A;  3D46 A;  5JCI A;  2PMQ A;  1TYP A;  2ZZC A;  3UXK A;  3ZVI A;  1WYG A;  3QPE A;  3FYY A;  3Q4D A;  1ZMD A;  2GR2 A;  4E6M A;  3GRS A;  3RNM A;  4E4U A;  3SN1 A;  2OZ8 A;  3L8K A;  3THU A;  1GXF A;  4JQ9 A;  1AOG A;  4H2H A;  2C3C A;  5KVI A;  3DER A;  2QJN A;  4GME A;  4TVY A;  2OQY A;  1BZL A;  1P43 A;  1OEP A;  1ZX9 A;  3EAN A;  3U4F A;  1Q1R A;  2GGI A;  3CT2 A;  4HYR A;  3IC9 A;  5JCM A;  1SB3 B;  4M52 A;  1PDY A;  3P3B A;  2I5Q A;  2ZZB A;  4A35 A;  2CDU A;  3KLJ A;  3NVW B;  1XHC A;  3UJE A;  4EMJ A;  2HXT A;  2V6O A;  3SR6 B;  1MRA A;  3SSZ A;  3IJL A;  4GGH A;  3DEQ A;  2FKP A;  4H19 A;  3D9X A;  2W3R A;  2QDD A;  1NU5 A;  3URH A;  3DGZ A;  4J3Z A;  1V59 A;  4MGG A;  2PTY A;  4EMW A;  2X99 A;  4H4P A;  3ES7 A;  1GRH A;  4K8G A;  3FJ4 A;  1DXL A;  3FG2 P;  3CK5 A;  1FFV C;  2AKM A;  1FEB A;  5BOF A;  4J57 A;  3NS1 B;  2GGG A;  4MMW A;  1FHU A;  4J56 A;  3SQP A;  2BC1 A;  2YVF A;  2EQ8 A;  1R0M A;  4GYP A;  1JRO A;  3DGH A;  3EF6 A;  5FJT A;  4GIR A;  1MO9 A;  2V3B A;  3DK9 A;  3CYJ A;  2PGE A;  3GY1 A;  2WPE A;  4FX9 A;  2E3T A;  4GR1 A;  2AL2 B;  5KVH A;  4BV6 A;  3P0W A;  1ONE A;  2WOW A;  2HQM A;  4H4V A;  2PA6 A;  2P8C A;  1EC9 A;  2OG9 A;  4HPN A;  1L8P A;  2HNE A;  3HW2 A;  2PTX A;  4F4R A;  4DHG A;  3SJN A;  5FS7 A;  4K7Z A;  5J04 A;  5GRT A;  3PWI A;  3VC5 A;  2NVK X;  2POD A;  5FJP A;  4IL2 A;  1PDZ A;  3QFB A;  3OZM A;  3VCN A;  2QJJ A;  5EU9 A;  3N4E A;  2GH5 A;  4H4W A;  2YQU A;  2RDX A;  5G5H B;  3NVZ B;  1D7Y A;  4H1Z A;  1MDL A;  2DW7 A;  1X2H A;  1S7M A;  2XH4 A;  3DJJ A;  3JZU A;  4IZG A;  3GD6 A;  3V3W A;  3FCP A;  2GGH A;  1K4Q A;  3R10 A;  3B97 A;  1RVK A;  1N60 C;  3LAD A;  1YEY A;  4Z17 A;  2P8B A;  1SJB A;  3UXL A;  2GQW A;  3NO1 A;  1LPF A;  3ENL A;  1KN0 A;  3V5C A;  2QGY A;  3CAW A;  5U25 A;  1KD0 A;  3TJ4 A;  2MNR A;  1ZK7 A;  3NRZ B;  4HCL A;  3FV9 A;  2YAU A;  3TQP A;  3MZN A;  4FI4 A;  3MSY A;  3ZLF A;  3ETR B;  3EUB 3;  2XH7 A;  5IDZ A;  1GRG A;  1GV4 A;  2AL1 A;  2PP0 A;  4EMI A;  1JEH A;  5FMH A;  4K1W A;  2MUC A;  1BWC A;  3DK8 A;  4KEM A;  3T9P A;  4ROP A;  3GO2 A;  4EM4 A;  3AN1 A;  3DFY A;  1TKK A;  1EC8 A;  2EQ6 A;  5JCK A;  4KT2 A;  3CXB A;  4ZOH B;  3ZVH B;  2WOI A;  1GRF A;  3TW9 A;  3N4F A;  2GRT A; 
#chains in the Genus database with same CATH homology
 1NHQ A;  4J57 A;  1GEU A;  4J56 A;  3DK4 A;  2GR0 A;  2ZZ0 A;  4EQW A;  1XDI A;  3LXD A;  1EBD A;  2BC1 A;  2YVF A;  3SQP A;  2EQ8 A;  2BCP A;  1FEA A;  3DGH A;  3EF6 A;  4H4Z A;  1ZY8 A;  1TYT A;  5JCN A;  4H4U A;  4H4X A;  1ONF A;  2BC0 A;  1MOK A;  4YWO A;  1MO9 A;  2V3B A;  2YVG A;  3DK9 A;  3Q6J A;  1GRT A;  2GR1 A;  1OJT A;  4NEV A;  2WPE A;  3CGE A;  5JCL A;  5FS9 A;  4FX9 A;  4EM3 A;  3EAO A;  4GR1 A;  5KVH A;  4BV6 A;  2WOW A;  2WP6 A;  2HQM A;  4H4V A;  1NHP A;  4K8D A;  4H50 A;  2X8H A;  2EQ7 A;  1H6V A;  2WOV A;  4H4S A;  1NDA A;  4FDC B;  2AAQ A;  2WPC A;  5EBK A;  2YVJ A;  1ZMC A;  5FS7 A;  4K7Z A;  1GRE A;  5GRT A;  2NVK X;  5TR3 A;  4H4Y A;  3QFB A;  3GRT A;  2C3D A;  5U1O A;  1DNC A;  2V3A A;  2GH5 A;  4H4W A;  1LVL A;  2YQU A;  5FS6 A;  4APN A;  1GET A;  2X8G A;  3L5O A;  1D7Y A;  3O0H A;  2NPX A;  5JCI A;  3LB8 A;  1H2I A;  1TYP A;  4KPR A;  2ZZC A;  3DJJ A;  1GES A;  1S7M A;  4JDR A;  2J3N A;  1YQZ A;  1ZMD A;  2GR2 A;  4GRT A;  2WBA A;  2X50 A;  3GRS A;  2A8X A;  3RNM A;  1K4Q A;  3L8K A;  1AOG A;  1GXF A;  3LAD A;  4JQ9 A;  1XAN A;  2C3C A;  5KVI A;  3II4 A;  2GQW A;  1LPF A;  2QAE A;  1BZL A;  2JK6 A;  3H4K A;  1ZX9 A;  4H4T A;  3CGD A;  3CGB A;  3EAN A;  1KN0 A;  1Q1R A;  4H4Q A;  4NEW A;  4DNA A;  1F8W A;  2WP5 A;  5U25 A;  3IC9 A;  5JCM A;  1NHR A;  4M52 A;  1ZK7 A;  1ZDL A;  1ZKQ A;  1GRB A;  2ZZB A;  1GER A;  2CDU A;  3KLJ A;  1GSN A;  1FEC A;  2F5Z A;  2YAU A;  1XHC A;  2R9Z A;  4EMJ A;  2V6O A;  3GD3 A;  2GR3 A;  5JRB A;  4LA1 A;  3DJG X;  1GRG A;  1GV4 A;  3DH9 A;  4LII A;  4EMI A;  4BUR A;  4EQX A;  1F3P A;  1M6I A;  3QFA A;  1JEH A;  5FMH A;  5FS8 A;  2X8C A;  3GD4 A;  3D9X A;  3PG6 A;  1BWC A;  3DK8 A;  4EQR A;  3URH A;  4EQS A;  3DGZ A;  4ADW A;  2WPF A;  3CGC A;  4EM4 A;  1NPX A;  1V59 A;  4H4R A;  4EMW A;  1NHS A;  2TPR A;  1GRA A;  2W0H A;  2X99 A;  2EQ6 A;  2RAB A;  4H4P A;  5JCK A;  1GRH A;  1Q1W A;  1DXL A;  1JOA A;  1GRF A;  2WOI A;  2EQ9 A;  3FG2 P;  5ER0 A;  1FEB A;  3OC4 A;  2GRT A;  2CFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...