1H2IA

Human rad52 protein, n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
LCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Single-Strand Annealing Domain of Human Rad52 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA REPAIR PROTEIN RAD52 HOMOLOG
total genus 46
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2002-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1h2iA01
1KN0A 1H2IA 5JRBA
chains in the Genus database with same CATH superfamily
2QAEA 5FS6A 2XH0A 2OVLA 3THUA 3ZVHB 3QFBA 3SR6B 2RDXA 2XSXA 2HQMA 1JPDX 1D7YA 2BC0A 2PTYA 2QJNA 3FG2P 3LXDA 4GISA 4DN1A 1FECA 3HPFA 2OQYA 4E5TA 1XANA 2I5QA 4DXKA 2P88A 1PDYA 2E3TA 4J57A 2AL2A 2PTZA 4H4VA 1GRHA 2GQWA 3DGZA 2EQ6A 1RVKA 1TKKA 2QVHA 1BWCA 1WYGA 3D47A 3EEZA 3H4KA 4DWDA 3R25A 3STPA 3SN1A 2PP0A 2P8BA 1F3PA 2NVKX 3AN1A 3FVDA 3NRZB 3CGCA 3GD3A 4HPNA 3R11A 3DK9A 3TWBA 2WOWA 4YWOA 1MDLA 1ZKQA 2DW7A 3A7RA 1XHCA 4H4SA 4APNA 4EM4A 2GGGA 1GXFA 3SQSA 2PGEA 1FHVA 2GGEA 5FMHA 3EUB3 3TWAA 1SJDA 3UJRA 4H4QA 2GSHA 3FV9A 3H12A 1EBHA 5JCMA 3KLJA 1M6IA 3PK7A 2OX4A 4ROPA 3VFCA 5JCIA 4IP5A 2C3DA 3II4A 2WPCA 4HN8A 2AL1A 3GRTA 2TPRA 4MGGA 3IJLA 3V5CA 3MKCA 4M52A 3TTEA 1YEYA 2WP5A 3DIPA 1MDRA 3RNMA 4ZA0A 1X2GA 2OZTA 2OKTA 2W3SA 3TW9A 1DNCA 3Q45A 3DK4A 3QFAA 2AL2B 1ONEA 5G5HB 2O56A 2RABA 1NHQA 3DG6A 3UXKA 4GMEA 2ZC8A 4H4XA 2V3BA 3NVZB 1GESA 2ZZBA 5G5GB 1JDFA 3NFUA 2GGHA 3CGBA 4DX3A 2V3AA 1PDZA 3OZMA 4K1WA 1GEUA 1N5XA 3L5OA 1YQZA 4A35A 3L8KA 5EBKA 1WUEA 5FS7A 3TCSA 3OC4A 2V6OA 5ER0A 1KKRA 3R1ZA 1GRAA 5BOFA 1JPMA 4H4WA 3TJ4A 2GGIA 2C3CA 2X8GA 4TVWA 2XH4A 4H19A 3DESA 3HW2A 2PA6A 4Z1YA 3GRSA 4H4UA 3SN0A 4IZGA 2BCPA 4IL2A 1ZXIC 2OFJA 3N6HA 3P3BA 1H2IA 3ENLA 3R0KA 1N5WC 2WBAA 4M0XA 4A3RA 2E5AA 1EC9A 1XPYA 2XGZA 1V59A 2XH7A 2GDQA 3V5FA 5U25A 2PSNA 4ZCWA 3B9JB 3VA8A 3EAOA 3QKEA 3UGVA 1W6TA 3I4KA 3JZUA 4K2SA 5EU9A 1ZMCA 4HNLA 2YVFA 1EC8A 3ZLHA 1KD0A 3TJIA 4JDRA 1SB3B 2QGYA 3CYJA 2MUCA 1ZX9A 1MOKA 4IP4A 2BC1A 3VC6A 1BQGA 2POZA 2OQHA 4DHGA 1XS2A 5FJPA 2QJMA 4H1ZA 2EQ7A 2CHRA 1KN0A 4H2HA 2J3NA 1NELA 3FYYA 3T8QA 3A7AA 7ENLA 1ZK7A 1N63C 1Q1RA 1WUFA 4GRTA 4GGBA 3UJEA 1MNSA 3MUCA 1LPFA 2PTWA 3URHA 4HYRA 2QDEA 4EMWA 4BURA 1BKHA 3NO1A 3UCCA 2CDUA 2X8CA 2GGJA 4JHMA 2WOIA 2GR0A 3H70A 1ZMDA 2DW6A 3HRDC 5ENLA 5J04A 1TZZA 1N61C 5JCNA 1LVLA 3RCYA 3NVVB 3CT2A 4G7FA 3DERA 3UJFA 3UCDA 5TR3A 2OO6A 3VC5A 2EQ8A 1EBDA 3SBFA 1FO4A 2WPEA 1SJBA 4F4RA 1ZY8A 1JRPA 2WP6A 1JROA 2EQ9A 3OZYA 4X2PA 1F8WA 4LA1A 4A6GA 3AM9A 4K8DA 1NU5A 5FS8A 5FJOA 1DXLA 3I6TA 4KWSA 1BZLA 5FJRA 1KKOA 3BSMA 2OZ3A 4G8TA 1FEAA 2OPJA 1P48A 5FS9A 1FEBA 1S7MA 3IJIA 4H50A 4H4RA 3CAWA 3D46A 3PG6A 3GD6A 4KT2A 2CFYA 3GD4A 1SJCA 2PU0A 3N4EA 4J1OA 2HZGA 4KPRA 2R9ZA 3A7UA 3R10A 2PS2A 5FJUA 3FJ4A 3ZLFA 4MKSA 1NPXA 4ENLA 3DJJA 2MNRA 3AMZA 1GRBA 4FP1A 1VQZA 4EQSA 3KUMA 2NPXA 2X8HA 3VDGA 3PFRA 2YVGA 1AOGA 2PCEA 1NDAA 3K1GA 1JOAA 3EF6A 1E9IA 1NHSA 3P0WA 5KVHA 2PU1A 3D9XA 3QPEA 1KCZA 2GR3A 1R6WA 3U9IA 3DG7A 3TOYA 3BOXA 3VCNA 4E4FA 2ONEA 1R0MA 3IC9A 4LIIA 2X50A 1JCTA 2YQUA 3TQPA 3I6EA 1VDVA 2PTXA 3CXBA 3T6CA 2NQLA 1GV4A 4IT1A 1IYXA 3DFHA 3CGDA 3V3WA 3FXGA 2F5ZA 2QJJA 1ONFA 3MWCA 2OZ8A 3NXLA 1NHRA 3NZGA 3GO2A 4M6UA 3IJQA 3N6JA 2W3RA 3OTRA 4K8GA 4EM3A 2AKMA 3T9PA 3Q6JA 2P0IA 1T3QC 3DFYA 3ES7A 4MMWA 3NVWB 2HXUA 4K7ZA 5GRTA 1Q1WA 4YWSA 4H83A 4EQWA 3EANA 1MRAA 1N60C 2WOVA 1EC7A 5U1OA 3B97A 4J3ZA 3DGBA 4HCHA 4IL0A 1DTNA 1TE6A 1TYTA 5JCKA 1TYPA 3MY9A 3LB8A 2AKZA 3QLDA 5KVIA 1NHPA 4HNCA 3ETRB 3GC2A 3N4FA 1FFUC 1GRFA 1P43A 6ENLA 3RGTA 2ZZ0A 1FFVC 3BJSA 4ZOHB 4HCLA 1STZA 3MZNA 4E4UA 3CXOA 3DG3A 4H4PA 2X99A 3DGHA 2FKPA 3S5SA 1H6VA 4FX9A 3FCPA 2W0HA 5JRBA 1ECQA 2PP3A 3T4WA 4NEVA 4GYPA 4JQ9A 2FYMA 3DJGX 3DK8A 2AAQA 3DEQA 3RRAA 2W54A 4HCDA 3CGEA 3RR1A 3EKGA 2QDDA 4GFIA 2GR1A 1GREA 1FHUA 3CB3A 4EQRA 3MQTA 4H4ZA 3O0HA 4Z17A 2ZADA 3SJNA 5IDZA 4EWJA 3R0UA 4GGHA 4JN8A 1OEPA 3OP2A 3SN4A 5JCLA 3RO6A 3U4FA 1GERA 1K4QA 2GRTA 1V97A 3NS1B 1GETA 4ADWA 4FDCB 4TVYA 2GH5A 5BOEA 1MUCA 2PMQA 1X2HA 2HXTA 1EBGA 3MSYA 3S47A 1RM6B 3QN3A 3DDMA 4J56A 3SQPA 4EQXA 1OJTA 1JEHA 4H4TA 3UJSA 1F9CA 3JVAA 2GR2A 3IK4A 4DNAA 4KEMA 4E6MA 1FIQB 3ZVIA 2GL5A 3JW7A 1N62C 3CK5A 3R07C 2P3ZA 4EMJA 3PWGA 4GYPC 4NEWA 1GRGA 2PGWA 3RITA 3UXLA 2W55A 2PPGA 1MO9A 1GRTA 1GSNA 4EMIA 3PWIA 4DYEA 2PP1A 2WPFA 1SJAA 3Q4DA 3LADA 3ZLGA 2PODA 3ZVHA 4GR1A 2JK6A 4KPLA 3H8AA 3SSZA 1XDIA 2A8XA 2OG9A 3OPSA 4H4YA 2QQ6A 3V4BA 3DH9A 2XH2A 3H7VA 1ELSA 3UJ2A 4GIRA 3P93A 3VCCA 2HNEA 1L8PA 3NVYB 2YAUA 2OLAA 2YVJA 4IHCA 3GY1A 2P8CA 1ZDLA 3OW1A 2ZZCA 4JN7A 5FJTA 3ES8A 4FI4A 3QTPA 4E8GA 4BV6A
chains in the Genus database with same CATH topology
2QAEA 5FS6A 1GESA 1NHPA 2ZZBA 5KVIA 2WP6A 2EQ9A 3QFBA 1GRFA 1F8WA 4LA1A 2HQMA 3CGBA 4K8DA 2ZZ0A 5FS8A 2V3AA 1DXLA 1BZLA 1D7YA 2BC0A 3FG2P 3LXDA 1FECA 4H4PA 1GEUA 2X99A 1FEAA 3DGHA 3L5OA 5FS9A 1YQZA 1XANA 1H6VA 4FX9A 3L8KA 5EBKA 2W0HA 5JRBA 4J57A 5FS7A 3OC4A 2V6OA 5ER0A 1FEBA 4NEVA 1S7MA 4H4VA 4JQ9A 3DK8A 3DJGX 4H50A 1GRAA 2AAQA 1GRHA 2GQWA 3DGZA 4H4RA 4H4WA 2EQ6A 3PG6A 3CGEA 2C3CA 2X8GA 2CFYA 1BWCA 2GR1A 1GREA 3GD4A 3H4KA 4EQRA 3GRSA 4H4UA 4H4ZA 4KPRA 3O0HA 2R9ZA 2BCPA 1F3PA 2NVKX 1H2IA 1NPXA 2WBAA 3DJJA 5JCLA 1GRBA 3CGCA 1GERA 1K4QA 2GRTA 3GD3A 1V59A 4EQSA 1GETA 3DK9A 5U25A 4ADWA 2WOWA 4FDCB 4YWOA 2NPXA 2GH5A 2X8HA 1ZKQA 3EAOA 4APNA 1XHCA 4H4SA 4EM4A 1GXFA 1ZMCA 2YVGA 1NDAA 2YVFA 1JOAA 3EF6A 1AOGA 1NHSA 3SQPA 4J56A 4JDRA 4EQXA 5FMHA 1OJTA 1JEHA 4H4TA 1ZX9A 1MOKA 5KVHA 3D9XA 2GR2A 2BC1A 2GR3A 4H4QA 4DNAA 3IC9A 4LIIA 2EQ7A 2X50A 1KN0A 2YQUA 5JCMA 2J3NA 3KLJA 1M6IA 4EMJA 1GV4A 4NEWA 1GRGA 3CGDA 2F5ZA 5JCIA 1ONFA 1ZK7A 1MO9A 2C3DA 1NHRA 1Q1RA 1GRTA 1GSNA 2WPCA 3II4A 4GRTA 4EMIA 3GRTA 2TPRA 2WPFA 1LPFA 3URHA 3LADA 4EM3A 4EMWA 4GR1A 2JK6A 4BURA 4M52A 3Q6JA 1XDIA 2A8XA 2WP5A 3RNMA 2CDUA 2X8CA 4H4YA 3DH9A 4K7ZA 5GRTA 1DNCA 1Q1WA 2WOIA 2GR0A 1ZMDA 4EQWA 3EANA 5U1OA 3DK4A 2WOVA 3QFAA 2YAUA 5JCNA 2RABA 2YVJA 1LVLA 1NHQA 1ZDLA 2ZZCA 1TYTA 5TR3A 5JCKA 4H4XA 1TYPA 2V3BA 2EQ8A 1EBDA 3LB8A 4BV6A 2WPEA 1ZY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN0 A;  1H2I A;  5JRB A; 
#chains in the Genus database with same CATH topology
 2QAE A;  5FS6 A;  2XH0 A;  2OVL A;  3THU A;  3ZVH B;  3QFB A;  3SR6 B;  2RDX A;  2XSX A;  2HQM A;  1JPD X;  1D7Y A;  2BC0 A;  2PTY A;  2QJN A;  3FG2 P;  3LXD A;  4GIS A;  4DN1 A;  1FEC A;  3HPF A;  2OQY A;  4E5T A;  1XAN A;  2I5Q A;  4DXK A;  2P88 A;  1PDY A;  2E3T A;  4J57 A;  2AL2 A;  2PTZ A;  4H4V A;  1GRH A;  2GQW A;  3DGZ A;  2EQ6 A;  1RVK A;  1TKK A;  2QVH A;  1BWC A;  1WYG A;  3D47 A;  3EEZ A;  3H4K A;  4DWD A;  3R25 A;  3STP A;  3SN1 A;  2PP0 A;  2P8B A;  1F3P A;  2NVK X;  3AN1 A;  3FVD A;  3NRZ B;  3CGC A;  3GD3 A;  4HPN A;  3R11 A;  3DK9 A;  3TWB A;  2WOW A;  4YWO A;  1MDL A;  1ZKQ A;  2DW7 A;  3A7R A;  1XHC A;  4H4S A;  4APN A;  4EM4 A;  2GGG A;  1GXF A;  3SQS A;  2PGE A;  1FHV A;  2GGE A;  5FMH A;  3EUB 3;  3TWA A;  1SJD A;  3UJR A;  4H4Q A;  2GSH A;  3FV9 A;  3H12 A;  1EBH A;  5JCM A;  3KLJ A;  1M6I A;  3PK7 A;  2OX4 A;  4ROP A;  3VFC A;  5JCI A;  4IP5 A;  2C3D A;  3II4 A;  2WPC A;  4HN8 A;  2AL1 A;  3GRT A;  2TPR A;  4MGG A;  3IJL A;  3V5C A;  3MKC A;  4M52 A;  3TTE A;  1YEY A;  2WP5 A;  3DIP A;  1MDR A;  3RNM A;  4ZA0 A;  1X2G A;  2OZT A;  2OKT A;  2W3S A;  3TW9 A;  1DNC A;  3Q45 A;  3DK4 A;  3QFA A;  2AL2 B;  1ONE A;  5G5H B;  2O56 A;  2RAB A;  1NHQ A;  3DG6 A;  3UXK A;  4GME A;  2ZC8 A;  4H4X A;  2V3B A;  3NVZ B;  1GES A;  2ZZB A;  5G5G B;  1JDF A;  3NFU A;  2GGH A;  3CGB A;  4DX3 A;  2V3A A;  1PDZ A;  3OZM A;  4K1W A;  1GEU A;  1N5X A;  3L5O A;  1YQZ A;  4A35 A;  3L8K A;  5EBK A;  1WUE A;  5FS7 A;  3TCS A;  3OC4 A;  2V6O A;  5ER0 A;  1KKR A;  3R1Z A;  1GRA A;  5BOF A;  1JPM A;  4H4W A;  3TJ4 A;  2GGI A;  2C3C A;  2X8G A;  4TVW A;  2XH4 A;  4H19 A;  3DES A;  3HW2 A;  2PA6 A;  4Z1Y A;  3GRS A;  4H4U A;  3SN0 A;  4IZG A;  2BCP A;  4IL2 A;  1ZXI C;  2OFJ A;  3N6H A;  3P3B A;  1H2I A;  3ENL A;  3R0K A;  1N5W C;  2WBA A;  4M0X A;  4A3R A;  2E5A A;  1EC9 A;  1XPY A;  2XGZ A;  1V59 A;  2XH7 A;  2GDQ A;  3V5F A;  5U25 A;  2PSN A;  4ZCW A;  3B9J B;  3VA8 A;  3EAO A;  3QKE A;  3UGV A;  1W6T A;  3I4K A;  3JZU A;  4K2S A;  5EU9 A;  1ZMC A;  4HNL A;  2YVF A;  1EC8 A;  3ZLH A;  1KD0 A;  3TJI A;  4JDR A;  1SB3 B;  2QGY A;  3CYJ A;  2MUC A;  1ZX9 A;  1MOK A;  4IP4 A;  2BC1 A;  3VC6 A;  1BQG A;  2POZ A;  2OQH A;  4DHG A;  1XS2 A;  5FJP A;  2QJM A;  4H1Z A;  2EQ7 A;  2CHR A;  1KN0 A;  4H2H A;  2J3N A;  1NEL A;  3FYY A;  3T8Q A;  3A7A A;  7ENL A;  1ZK7 A;  1N63 C;  1Q1R A;  1WUF A;  4GRT A;  4GGB A;  3UJE A;  1MNS A;  3MUC A;  1LPF A;  2PTW A;  3URH A;  4HYR A;  2QDE A;  4EMW A;  4BUR A;  1BKH A;  3NO1 A;  3UCC A;  2CDU A;  2X8C A;  2GGJ A;  4JHM A;  2WOI A;  2GR0 A;  3H70 A;  1ZMD A;  2DW6 A;  3HRD C;  5ENL A;  5J04 A;  1TZZ A;  1N61 C;  5JCN A;  1LVL A;  3RCY A;  3NVV B;  3CT2 A;  4G7F A;  3DER A;  3UJF A;  3UCD A;  5TR3 A;  2OO6 A;  3VC5 A;  2EQ8 A;  1EBD A;  3SBF A;  1FO4 A;  2WPE A;  1SJB A;  4F4R A;  1ZY8 A;  1JRP A;  2WP6 A;  1JRO A;  2EQ9 A;  3OZY A;  4X2P A;  1F8W A;  4LA1 A;  4A6G A;  3AM9 A;  4K8D A;  1NU5 A;  5FS8 A;  5FJO A;  1DXL A;  3I6T A;  4KWS A;  1BZL A;  5FJR A;  1KKO A;  3BSM A;  2OZ3 A;  4G8T A;  1FEA A;  2OPJ A;  1P48 A;  5FS9 A;  1FEB A;  1S7M A;  3IJI A;  4H50 A;  4H4R A;  3CAW A;  3D46 A;  3PG6 A;  3GD6 A;  4KT2 A;  2CFY A;  3GD4 A;  1SJC A;  2PU0 A;  3N4E A;  4J1O A;  2HZG A;  4KPR A;  2R9Z A;  3A7U A;  3R10 A;  2PS2 A;  5FJU A;  3FJ4 A;  3ZLF A;  4MKS A;  1NPX A;  4ENL A;  3DJJ A;  2MNR A;  3AMZ A;  1GRB A;  4FP1 A;  1VQZ A;  4EQS A;  3KUM A;  2NPX A;  2X8H A;  3VDG A;  3PFR A;  2YVG A;  1AOG A;  2PCE A;  1NDA A;  3K1G A;  1JOA A;  3EF6 A;  1E9I A;  1NHS A;  3P0W A;  5KVH A;  2PU1 A;  3D9X A;  3QPE A;  1KCZ A;  2GR3 A;  1R6W A;  3U9I A;  3DG7 A;  3TOY A;  3BOX A;  3VCN A;  4E4F A;  2ONE A;  1R0M A;  3IC9 A;  4LII A;  2X50 A;  1JCT A;  2YQU A;  3TQP A;  3I6E A;  1VDV A;  2PTX A;  3CXB A;  3T6C A;  2NQL A;  1GV4 A;  4IT1 A;  1IYX A;  3DFH A;  3CGD A;  3V3W A;  3FXG A;  2F5Z A;  2QJJ A;  1ONF A;  3MWC A;  2OZ8 A;  3NXL A;  1NHR A;  3NZG A;  3GO2 A;  4M6U A;  3IJQ A;  3N6J A;  2W3R A;  3OTR A;  4K8G A;  4EM3 A;  2AKM A;  3T9P A;  3Q6J A;  2P0I A;  1T3Q C;  3DFY A;  3ES7 A;  4MMW A;  3NVW B;  2HXU A;  4K7Z A;  5GRT A;  1Q1W A;  4YWS A;  4H83 A;  4EQW A;  3EAN A;  1MRA A;  1N60 C;  2WOV A;  1EC7 A;  5U1O A;  3B97 A;  4J3Z A;  3DGB A;  4HCH A;  4IL0 A;  1DTN A;  1TE6 A;  1TYT A;  5JCK A;  1TYP A;  3MY9 A;  3LB8 A;  2AKZ A;  3QLD A;  5KVI A;  1NHP A;  4HNC A;  3ETR B;  3GC2 A;  3N4F A;  1FFU C;  1GRF A;  1P43 A;  6ENL A;  3RGT A;  2ZZ0 A;  1FFV C;  3BJS A;  4ZOH B;  4HCL A;  1STZ A;  3MZN A;  4E4U A;  3CXO A;  3DG3 A;  4H4P A;  2X99 A;  3DGH A;  2FKP A;  3S5S A;  1H6V A;  4FX9 A;  3FCP A;  2W0H A;  5JRB A;  1ECQ A;  2PP3 A;  3T4W A;  4NEV A;  4GYP A;  4JQ9 A;  2FYM A;  3DJG X;  3DK8 A;  2AAQ A;  3DEQ A;  3RRA A;  2W54 A;  4HCD A;  3CGE A;  3RR1 A;  3EKG A;  2QDD A;  4GFI A;  2GR1 A;  1GRE A;  1FHU A;  3CB3 A;  4EQR A;  3MQT A;  4H4Z A;  3O0H A;  4Z17 A;  2ZAD A;  3SJN A;  5IDZ A;  4EWJ A;  3R0U A;  4GGH A;  4JN8 A;  1OEP A;  3OP2 A;  3SN4 A;  5JCL A;  3RO6 A;  3U4F A;  1GER A;  1K4Q A;  2GRT A;  1V97 A;  3NS1 B;  1GET A;  4ADW A;  4FDC B;  4TVY A;  2GH5 A;  5BOE A;  1MUC A;  2PMQ A;  1X2H A;  2HXT A;  1EBG A;  3MSY A;  3S47 A;  1RM6 B;  3QN3 A;  3DDM A;  4J56 A;  3SQP A;  4EQX A;  1OJT A;  1JEH A;  4H4T A;  3UJS A;  1F9C A;  3JVA A;  2GR2 A;  3IK4 A;  4DNA A;  4KEM A;  4E6M A;  1FIQ B;  3ZVI A;  2GL5 A;  3JW7 A;  1N62 C;  3CK5 A;  3R07 C;  2P3Z A;  4EMJ A;  3PWG A;  4GYP C;  4NEW A;  1GRG A;  2PGW A;  3RIT A;  3UXL A;  2W55 A;  2PPG A;  1MO9 A;  1GRT A;  1GSN A;  4EMI A;  3PWI A;  4DYE A;  2PP1 A;  2WPF A;  1SJA A;  3Q4D A;  3LAD A;  3ZLG A;  2POD A;  3ZVH A;  4GR1 A;  2JK6 A;  4KPL A;  3H8A A;  3SSZ A;  1XDI A;  2A8X A;  2OG9 A;  3OPS A;  4H4Y A;  2QQ6 A;  3V4B A;  3DH9 A;  2XH2 A;  3H7V A;  1ELS A;  3UJ2 A;  4GIR A;  3P93 A;  3VCC A;  2HNE A;  1L8P A;  3NVY B;  2YAU A;  2OLA A;  2YVJ A;  4IHC A;  3GY1 A;  2P8C A;  1ZDL A;  3OW1 A;  2ZZC A;  4JN7 A;  5FJT A;  3ES8 A;  4FI4 A;  3QTP A;  4E8G A;  4BV6 A; 
#chains in the Genus database with same CATH homology
 2QAE A;  5FS6 A;  1GES A;  1NHP A;  2ZZB A;  5KVI A;  2WP6 A;  2EQ9 A;  3QFB A;  1GRF A;  1F8W A;  4LA1 A;  2HQM A;  3CGB A;  4K8D A;  2ZZ0 A;  5FS8 A;  2V3A A;  1DXL A;  1BZL A;  1D7Y A;  2BC0 A;  3FG2 P;  3LXD A;  1FEC A;  4H4P A;  1GEU A;  2X99 A;  1FEA A;  3DGH A;  3L5O A;  5FS9 A;  1YQZ A;  1XAN A;  1H6V A;  4FX9 A;  3L8K A;  5EBK A;  2W0H A;  5JRB A;  4J57 A;  5FS7 A;  3OC4 A;  2V6O A;  5ER0 A;  1FEB A;  4NEV A;  1S7M A;  4H4V A;  4JQ9 A;  3DK8 A;  3DJG X;  4H50 A;  1GRA A;  2AAQ A;  1GRH A;  2GQW A;  3DGZ A;  4H4R A;  4H4W A;  2EQ6 A;  3PG6 A;  3CGE A;  2C3C A;  2X8G A;  2CFY A;  1BWC A;  2GR1 A;  1GRE A;  3GD4 A;  3H4K A;  4EQR A;  3GRS A;  4H4U A;  4H4Z A;  4KPR A;  3O0H A;  2R9Z A;  2BCP A;  1F3P A;  2NVK X;  1H2I A;  1NPX A;  2WBA A;  3DJJ A;  5JCL A;  1GRB A;  3CGC A;  1GER A;  1K4Q A;  2GRT A;  3GD3 A;  1V59 A;  4EQS A;  1GET A;  3DK9 A;  5U25 A;  4ADW A;  2WOW A;  4FDC B;  4YWO A;  2NPX A;  2GH5 A;  2X8H A;  1ZKQ A;  3EAO A;  4APN A;  1XHC A;  4H4S A;  4EM4 A;  1GXF A;  1ZMC A;  2YVG A;  1NDA A;  2YVF A;  1JOA A;  3EF6 A;  1AOG A;  1NHS A;  3SQP A;  4J56 A;  4JDR A;  4EQX A;  5FMH A;  1OJT A;  1JEH A;  4H4T A;  1ZX9 A;  1MOK A;  5KVH A;  3D9X A;  2GR2 A;  2BC1 A;  2GR3 A;  4H4Q A;  4DNA A;  3IC9 A;  4LII A;  2EQ7 A;  2X50 A;  1KN0 A;  2YQU A;  5JCM A;  2J3N A;  3KLJ A;  1M6I A;  4EMJ A;  1GV4 A;  4NEW A;  1GRG A;  3CGD A;  2F5Z A;  5JCI A;  1ONF A;  1ZK7 A;  1MO9 A;  2C3D A;  1NHR A;  1Q1R A;  1GRT A;  1GSN A;  2WPC A;  3II4 A;  4GRT A;  4EMI A;  3GRT A;  2TPR A;  2WPF A;  1LPF A;  3URH A;  3LAD A;  4EM3 A;  4EMW A;  4GR1 A;  2JK6 A;  4BUR A;  4M52 A;  3Q6J A;  1XDI A;  2A8X A;  2WP5 A;  3RNM A;  2CDU A;  2X8C A;  4H4Y A;  3DH9 A;  4K7Z A;  5GRT A;  1DNC A;  1Q1W A;  2WOI A;  2GR0 A;  1ZMD A;  4EQW A;  3EAN A;  5U1O A;  3DK4 A;  2WOV A;  3QFA A;  2YAU A;  5JCN A;  2RAB A;  2YVJ A;  1LVL A;  1NHQ A;  1ZDL A;  2ZZC A;  1TYT A;  5TR3 A;  5JCK A;  4H4X A;  1TYP A;  2V3B A;  2EQ8 A;  1EBD A;  3LB8 A;  4BV6 A;  2WPE A;  1ZY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...