4G8TA

Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target efi-502312, with sodium and sulfate bound, ordered loop
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
441
structure length
441
Chain Sequence
STPIITEMQVIPVAGHDSMLLNLSGAHSPYFTRNIVILKDNSGNTGVGEVPGGEKIRQTLEDAKPLVIGKTLGEYKNVMNTVRQTFNDHDAGGRGLQTFDLRTTIHVVTAIEAAMLDLLGQFLGVTVASLLGDGQQRDAVEMLGYLFFIGDRKKTTLAYQNQENDPCDWYRVRHEEAMTPESVVRLAEAAYEKYGFNDFKLKGGVLDGFEEAEAVTALAKRFPDARITLDPNGAWSLDEAVKIGKQLKGVLAYAEDPCGAEQGYSGREIMAEFRRATGLPTATNMIATDWRQMGHTISLQSVDIPLADPHFWTMQGSIRVAQMCHEWGLTWGSHSNNHFDISLAMFTHVAAAAPGDITAIDTHWIWQEGNQRLTKEPFQIKGGLVEVPKKPGLGVELDMDQVMKANELYKSMGLGARDDAMAMQFLIPGWKFDNKKPCLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucarate dehydratase
publication title Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target efi-502312, with sodium and sulfate bound, ordered loop
rcsb
source organism Actinobacillus succinogenes
molecule tags Lyase
total genus 150
structure length 441
sequence length 441
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4g8tA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4g8tA01
1FHVA 3OW1A 3SN0A 2GGGA 3ZVIA 2GL5A 3OZYA 3ZLHA 1XS2A 4E5TA 1JPDX 4HNLA 3V4BA 3GY1A 2PGEA 3PWGA 3DG3A 4E4FA 3FYYA 4GGBA 3B97A 3R0KA 2RDXA 3NFUA 3D47A 3UJRA 4GYPA 1SJBA 3T8QA 4J1OA 3CB3A 2PGWA 2PMQA 3SQSA 4HCHA 3JZUA 1EC9A 3ZVHB 2QJMA 3S5SA 5FJRA 3RGTA 1TZZA 3PFRA 2MNRA 4IT1A 3BOXA 4KEMA 3TCSA 2HXUA 2OX4A 3K1GA 3CT2A 2P3ZA 3VA8A 1F9CA 4K8GA 4E4UA 3R0UA 1TKKA 3SN1A 3DESA 1FHUA 2XH2A 3T9PA 4DYEA 3I6TA 1R6WA 3Q45A 4IL2A 3N4EA 5FJOA 3MKCA 4GFIA 2NQLA 1YEYA 3QKEA 4MMWA 3THUA 4K1WA 1KCZA 2AKZA 3D46A 3PWIA 3HPFA 1PDYA 4GGHA 2OO6A 3EKGA 5BOFA 3ZLFA 2GDQA 3P93A 3UJEA 1JPMA 1ECQA 2I5QA 2PTYA 3T6CA 2XH7A 2ZADA 1BKHA 1NU5A 1R0MA 3MQTA 2QGYA 3DERA 1EBGA 3TWAA 2QJNA 3DFHA 3MSYA 4KWSA 2PU1A 3IJIA 3UGVA 3CAWA 2ZC8A 3DIPA 1MNSA 2PP1A 3OP2A 3DDMA 4A3RA 4JHMA 3FVDA 2OVLA 3FJ4A 2QVHA 4F4RA 3OZMA 4DWDA 2O56A 3H7VA 4G8TA 1RVKA 4FP1A 4G7FA 1IYXA 2HNEA 3GC2A 4HCLA 3CK5A 3RCYA 2OZTA 2P8BA 2PU0A 3IK4A 3N4FA 3RRAA 3VDGA 3TWBA 2PTXA 3ZVHA 4M0XA 2HXTA 3ENLA 2QQ6A 2QDEA 1EC8A 2OQHA 1JCTA 3RITA 4GISA 1KD0A 2PP0A 2AL2A 2PPGA 3I6EA 4HPNA 3N6JA 3NO1A 2P8CA 3V5FA 3S47A 2FKPA 2OZ3A 4IP5A 5FJTA 1WUEA 2OKTA 2HZGA 4GMEA 4X2PA 3UXLA 2MUCA 4FI4A 3H8AA 3U9IA 4JN7A 2OFJA 5EU9A 2PODA 3ZLGA 3UJ2A 3DEQA 2ONEA 2QDDA 2GGJA 2XGZA 1P43A 2P88A 4ZCWA 4EWJA 4M6UA 4IZGA 3VCNA 4GIRA 3SN4A 1ONEA 3FCPA 1L8PA 2PSNA 3ES8A 4A6GA 1W6TA 2OG9A 3CYJA 3I4KA 3QLDA 3R25A 4HN8A 2PCEA 2PA6A 2OLAA 2PTWA 4MGGA 3R1ZA 3MZNA 3QPEA 4KT2A 1P48A 4H83A 3OPSA 4J3ZA 3OTRA 4DX3A 2PS2A 3V3WA 4IHCA 3GD6A 3VFCA 4HCDA 2QJJA 3ES7A 3EEZA 2PTZA 1ELSA 3UJFA 3FXGA 1MUCA 5IDZA 3STPA 3V5CA 1E9IA 1OEPA 3UCDA 2GGHA 1SJCA 4HNCA 1SJAA 3TQPA 4Z1YA 5FJUA 4H1ZA 3TOYA 4DN1A 4MKSA 3PK7A 3IJQA 4H19A 3DG6A 2DW7A 3TJ4A 1MDLA 1DTNA 2XH0A 4H2HA 3NZGA 4Z17A 2FYMA 4YWSA 1EBHA 4KPLA 2PP3A 3R10A 4ENLA 1PDZA 4JN8A 4K2SA 4IL0A 1TE6A 3DGBA 3JVAA 3KUMA 3VCCA 3FV9A 2CHRA 3H70A 3GO2A 2AKMA 4DHGA 1KKRA 4A35A 3SSZA 4E6MA 3BSMA 3UCCA 3R11A 3JW7A 3QTPA 4IP4A 3CXOA 3SJNA 3MWCA 1JDFA 1BQGA 3H12A 3Q4DA 5FJPA 3RO6A 3QN3A 2AL2B 3DG7A 1WUFA 3T4WA 3TW9A 3N6HA 3BJSA 6ENLA 7ENLA 1EC7A 5J04A 1NELA 3TTEA 4GYPC 4HYRA 5ENLA 2XH4A 2POZA 5BOEA 3NXLA 3VC5A 2OPJA 3RR1A 2GGEA 2OZ8A 4ZA0A 1MDRA 3MUCA 1MRAA 2DW6A 3UXKA 3P0WA 3IJLA 2P0IA 3UJSA 2XSXA 1KKOA 4E8GA 1SJDA 4ROPA 2AL1A 4DXKA 1XPYA 2GGIA 3SBFA 2OQYA 3MY9A 3TJIA 3VC6A 3P3BA 3U4FA 2GSHA 3DFYA
chains in the Genus database with same CATH superfamily
2PURA 4A3HA 4AFYA 5AYZA 5A6AA 1V3IA 4MJ2A 1PBGA 4JIQA 2ZRVA 3EX1A 3GW0A 3GXTA 2JGQA 5AHIA 3GWQA 4O19A 2PBOA 2DY3A 3VNKA 5FSDC 4ADUA 3PWGA 1EJWC 3CASA 1E6XM 3C5QA 4TU1A 2INEA 5I23A 3MANA 3R0KA 2VR2A 1XDJA 4DWSB 3I6RA 1BYCA 2C18A 1L6YA 2JGYA 1W54A 1Z6KA 2OLHA 1E9LA 1EUNA 2J66A 4OOUA 2PMQA 3FNDA 3NQAA 3ZYZA 4XTDA 4XZNX 4YNGA 1LVLA 5JCKA 1OVDA 4TR9A 3LGGA 1H7WA 1XH0A 5IOBA 5BXTA 3G77A 2B7OA 4UCFA 2B0MA 1E1CA 2R1PA 1FHUA 3N3TA 1ISYA 3RU6A 4DYEA 2FHFA 4H9UA 1LUCA 4LYRA 1XSJA 2C3DA 2DVTA 1VHNA 4UUIA 2YDAA 3THUA 1XBVA 4WQ6A 3W27A 2CZVA 1E3XA 2WSRA 2NQ5A 3TN4A 3WYZA 1FWNA 1W1B1 3CU2A 4HPJA 4Q8VA 1EYWA 1S7MA 4D6FA 2AGKA 4RXFA 3BL3A 5IFPA 3GK0A 3M43A 3DUGA 3C0LA 4L1XA 4LEFA 1TMQA 1JEHA 4TXEA 2CKRA 3VGDA 2C79A 2DH2A 3N2XA 2Z25A 2Q3RA 3UZJA 4A3YA 3F2CA 4KWUA 4FF5A 4LV4A 1JROA 4XO7A 3EWYA 3WLTA 5EL1A 2NVAA 4H6QA 2G37A 4WGXA 2PDCA 5BU9A 1F6YA 1W3KA 2A3HA 1XSIA 2O56A 5A6JA 4MNLA 3WQFA 5AFDA 5A94A 3VPLA 1MZHA 1JD7A 4RL3A 4JN6A 3TMLA 3OB8A 2ZDSA 1JPKA 3RCYA 2Y61A 1F05A 4QG8A 1TV3A 4YVXA 1UR1A 3W76A 3OGRA 2P10A 1GJPA 5K9XA 4B9ZA 1WE5A 4UQ9A 4NUWA 2JKPA 1TPDA 5DBUA 3RITA 5FF4A 1CEOA 2W3RA 1E56A 2C0HA 5K7JA 3WQWA 2IQ0A 1CXIA 4IQEA 1DJHA 3V5FA 4JS3A 4AF0A 1ZP3A 4B15A 1XYZA 4J7RA 4QEHA 2R1LA 2UWFA 1KFBA 3GX9A 4OVXA 3TW6A 2A7NA 1QTWA 2E8YA 4L9XA 3EDKA 4LXFA 3TYCA 4AYGA 3CGEA 4IPNB 5REQA 5D2YA 1JCJA 2AQWA 1UIOA 3ZFHA 2QDDA 2I56A 2BVWA 4XD3A 4AD3A 4E38A 1C92A 3E0VA 1R9XA 1KBJA 1VBJA 1KV5A 3U4AA 2BXVA 3KBMA 1C9WA 4H2CA 3LADA 3UW6A 1EL3A 3ES8A 2CKSA 3I4KA 3QLDA 1PS9A 2OYKA 1AJZA 1WDRA 1RP9A 1BF6A 4AZCB 3EMZA 4U4MA 1X7FA 5HJLA 4LTSA 5BCAA 4CD5A 3OTRA 4ZR8A 1OJTA 1MFVA 2YCLA 1I45A 3N9RA 4H00A 4I7WA 5JVLA 4K7YA 1CIUA 3FA4A 2JEPA 3UWYA 3MP3A 3BMXA 1S46A 3IIVA 3WNNA 6ALDA 3VI2A 1RA5A 2XYLA 1JYWA 2YXXA 5DELA 3MCNA 3M0XA 1O1ZA 4GIYA 4MFEA 5FKYA 3W84A 1R7OA 1EXPA 1IEVA 2X50A 2ZUWA 3VD7A 1YXCA 2OODA 1GV4A 1H1YA 3IJQA 4D8LA 1JAEA 3KCLA 4GC4A 1XF0A 1Q7ZA 1MDLA 1XKYA 1SZNA 4ZO6A 4ACZA 4Z17A 4QRNA 1JDCA 2W92A 3FGCA 5A6BD 1V8EA 4NASA 4DF0A 2D2GA 2XPKA 1W56A 5XIMA 4I8DA 3UT0A 2OO0A 3UA3A 1US3A 2ISDA 1IR1A 4J3WA 3VNLA 2WMHA 2C0AA 2C16A 2WKJA 3PTQA 3WCZA 4KS0A 4DO7A 1E4NA 3I65A 3IRDA 1QO2A 4N7QA 2ZRYA 1XLBA 3IV8A 3FAWA 3QTPA 4WGHA 3CNYA 1ZNNA 1JZ4A 2CXEA 1EWDA 3GSMA 4WOZA 1VLWA 1XLEA 3PZTA 4US6A 3DG7A 2W9MA 2R14A 2EGZA 3HN3A 4GRTA 4JIIX 2W63A 3CM4A 3MC5A 4IMAA 3EWBX 2X7VA 4ICCX 5FD0A 1QI2A 2BFGA 2VX6A 5J04A 1GEQA 1NELA 2R1NA 4DZIA 1HKKA 1TUXA 2BVDA 3T2QA 1UH4A 1CI1A 1XWYA 2XH4A 4LC8A 4X22A 2WCAA 2G41A 5HK4A 4CCEA 3RR1A 2CBIA 3FDGA 2VL4A 4C1LA 1O95A 3VMOA 1ZBWA 2J88A 1GRHA 1KBBA 4F9DA 4WY0A 4ATLA 3S4TA 2XWDA 5EBUA 5CPTA 1XP3A 3KVMA 1SZRA 2XSXA 4WDXA 3GD4A 3HV9A 2PDUA 5LNRA 5DT7A 3RPTA 2VDHA 1CWYA 1YDOA 1XHCA 2R1MA 1HVXA 3PJUA 1NVMA 1A0CA 4XD4A 3T05A 4YYCA 2IPWA 1A80A 3VKCA 3N25A 3NZPA 2UY4A 3NSXA 1XS2A 1JPDX 3AIEA 3GY1A 2BWGA 3KHDA 2XFFA 1HKWA 4QG6A 3H21A 2V81A 1G01A 3AIVA 3BG3A 1SFSA 3GNXA 2R82A 3CXBA 3BJFA 5XINA 3SGGA 3F2DA 4EP8C 5BWFA 3A13A 5EMYA 3PJTA 5FEPA 2WPFA 2E8ZA 1OX5A 2QVNA 1V03A 2ZYFA 3CAQA 3B03A 3UETA 4INFA 1LBMA 1OFPA 1TZZA 3PFRA 4LC6A 4U3AA 4C90A 4U5IA 3U5YA 4P7QA 3C56A 3UR8A 1B30A 3M07A 4E4UA 3VK5A 2WZTA 3LHVA 4QLKA 2EAWA 1LLZA 3VGEA 3UA4A 3BAJA 1WXJA 3WF0A 2GYIA 3UG8A 2ZFAA 1NDAA 2IPFA 2JQXA 3MKCA 3PZOA 5H2ZA 3ZT6A 3ARTA 3F4VA 4K1WA 2CITA 3W7DA 4LBSA 4N9BA 3EKZA 4GGHA 1PDYA 4N6EA 3HZ3A 3Q2DA 1X8CA 1QI5A 1JZ2A 4I9JA 1TZ7A 4GO9A 1NIUA 1G4EA 1GJWA 4NXKA 2A3CA 2OEMA 1JCNA 2PTYA 3SCTA 1VPYA 1ZJAA 5C9XA 2XINA 3EA1A 2EQ7A 5DBTA 4PMQA 4RE4A 3GVVA 4AY8A 4C65A 1R3TA 1A5KC 4D1JA 2ZUVA 3TE9A 4HA4A 1XIDA 2Y8VA 5EBAA 3W7JA 3NPVA 3WDJA 2PP1A 1S2AA 2NUYA 5E93A 2AAAA 6A3HA 3SRFA 1XSKA 1E43A 4DZHA 1X98A 1IYXA 5IHRA 4B3LA 2DQXA 3EWUA 4B5NA 3TWBA 1CW2A 2BY0A 5T9BG 9CGTA 2V5DA 1CENA 3Q67A 3FIGA 3SCOA 1DIDA 2R9ZA 3DYPA 1LF1A 3CQKA 1UWTA 1UR2A 3EZ4A 3AI0A 4CD8A 3P8IA 3W1MA 3B8IA 3KOYA 4XZ9A 3KBJA 3O07A 3G8RA 5I7GA 1QOXA 3UCQA 3PG9A 2ISVA 3N6JA 3U3HA 4H4ZA 5T91A 5BMWA 4AWUA 4PUEA 4KGLA 1V3LA 1JRCA 3DGRA 3UXLA 2VFIA 4H9XA 4OECA 4X9YA 4QS6A 3NQEA 1JPHA 1NY1A 3EX4A 5JUVA 5C2CA 2V30A 1SSDA 3U7VA 4QCEA 2QV4A 2WCSA 4QBXA 3H8AA 2PDBA 5AC6A 4J3XA 2QCGA 2WM1A 1ADDA 1WPCA 2NVKX 2F38A 2YCKX 3UZXA 1GHSA 2DFAA 3S9ZA 1G94A 4C6QA 3ARPA 5CC6A 3BLIA 3WQ4A 2PGRA 4UQDA 1A5BA 4REQA 3W1RA 2JBMA 4Y9OA 2YBVA 4AEFA 4UOZA 3UG4A 1BF2A 3R25A 1BXCA 3W3OA 4PUUA 4GBDA 1OQFA 1S38A 3V18A 2C15A 4KCWA 1OHLA 3VOIA 3WEZA 3B40A 4HIBA 1O5RA 1M9HA 4Z2JA 1CPUA 3RCNA 3A7AA 5KITA 4H4SA 3GVGA 4GHRA 1W5NA 4LUSB 4ONVA 1PCKA 1VKFA 4MVAA 3AAMA 1XIGA 2CERA 3W85A 1PHWA 2BXYA 4GNJA 3VIOA 3DGHA 1YDVA 4PMNA 1AOGA 5C2XA 1JYXA 4MOZA 3EXRA 4KEUA 2VJXA 5G5IA 4H19A 1RY0A 4YCOA 2QAFA 3L68A 4XWUA 1JZ3A 4WD0A 2XSAA 3NM3A 4JKLA 4S3JA 4OV9A 4M80A 1QW7A 1IGWA 3CPGA 1PSCA 4YWSA 4HOWA 2QCLA 4V15A 3M0ZA 3OQ8A 3HPXA 1BZLA 3RILA 3DGBA 3IIOA 1UKSA 3AM9A 2I57A 4DBSA 1D7YA 5A6MA 1FDYA 1OB0A 4HT3A 4HZ7A 4IQDA 2ZX9A 3UGRA 4U3CA 4Y6GA 1QWKA 3B05A 4I7VA 5LNUA 3BCJA 4AC7C 2Z6JA 3IC9A 1MOKA 2GR3A 3B4UA 5DF0A 3OO2A 3AMKA 1EDGA 1OCNA 3L0NA 1UQYA 3EDFA 1NQ6A 3M0IA 3FOKA 4YS1A 3RAOA 1GHRA 3ZJ7A 1ZB5A 4KW2A 2WZHA 7PTDA 4DO6A 1ESWA 4P7NA 5A6BA 3AYSA 4KQNA 1W91A 5ENLA 2OCZA 3S6TA 4DBUA 4W84A 3O1NA 3FJLA 5C0QA 4XTIA 6REQB 4Q7BA 1EP1A 3WF4A 3PBMA 4F0MA 1S1RA 1PX3A 4TV5A 1F4AA 3MMWA 5JMUA 1FUYA 2CNCA 4LV9A 1PKMA 4Q33A 1VF8A 1QATA 1A47A 2EPOA 3A5VA 1F7BA 5K4ZA 1ALDA 1K1DA 4DI9A 3MP5A 4PL1A 2VR4A 3LNMA 3NXFA 1VIWA 1EX1A 3DFYA 1ZPTA 1TPEA 1RLCL 3XIMA 1XQKA 2FDMA 2G0WA 3E2RA 3IAQA 5EMJA 1TUFA 3CO4A 2ZVIA 3QFWA 2DIEA 4HNUA 1DKWA 2CESA 3VFLA 4PMDA 1K02A 1UBSA 2OZ0A 5H6HA 5A2BA 1BG9A 2PGEA 1O5KA 1JZ8A 1Q63A 1FCVA 4HYVA 3EWCA 1L6GA 4E4FA 2NUXA 4PYSA 4MWAB 4J56A 3MJMA 1NFBA 2FVLA 1OG0A 4U33A 2QPXA 1EBDA 5MF5A 2BBFA 2FPYA 3WH5A 2PDQA 3FY1A 1XRSA 3T78A 1CB2A 2G5WA 2PGWA 5I3IA 1GVSA 1LL4A 5G4WA 4WOQA 7A3HA 1XISA 4JQAA 4LS1A 1B3XA 2PDKA 3WDPP 3I68A 3FG2P 4CU8A 3S1GA 1J9YA 3K1GA 3PJXA 6CGTA 4OBSA 3HQNA 3MCOA 2NX9A 3RMEA 4O8AA 2QMKA 5IXEA 1PEZA 4ZOCA 3T55A 4UC5A 4DJFC 3EPNA 1IR2A 4G7EA 3SN1A 1TV4A 3O16A 1XX1A 4FLQA 3Q45A 1WA3A 2XFRA 3EAOA 2DORA 4NJJA 2E0PA 5D33A 1E0WA 3E96A 4QNWA 3GYEA 1HKJA 2C6QA 1XH1A 1QAPA 1WZKA 1W3TA 3LGDA 5KVIA 4MYAA 4BS0A 1V02E 1JGMA 2D3LA 3BO9A 5DXXA 2PWHA 1TPWA 3POHA 2P76A 1B3VA 3VO0A 1OWQA 2W79A 4Z0JA 3WH9A 1CGTA 5D9NA 4XKYB 2RJHA 1YNYA 5FEZA 4CN4A 4BQ3A 4CN6A 3GUWA 3ARWA 2GK1A 2XISA 3NZ1A 1JULA 4EQXA 2QT3A 3NQ8A 5KINA 3CEUA 4JQ9A 4QQUA 1RSCA 5A6KA 1OYAA 4YMZA 1D7KA 1XYLA 1WAUA 3ABZA 3ZQ9A 3JZEA 4E2BA 3MHUA 2CHNA 1ZY9A 4GPNA 5T8GA 4LCSA 1TWSA 2Y2WA 3MW7A 5CBBA 3QZ6A 3UR5A 4D6CA 3IAPA 2XN0A 3JS3A 4HCLA 1YNPA 1UP3A 2QIIA 4O15A 1WBJA 3O3RA 2E68A 4O50A 2VTFA 3GDKA 4AZ7A 2CZEA 3G18A 5CSYA 4X60A 2QQ6A 2PI6A 4RZ6A 2IKGA 5FI8A 3HFYA 1H63A 1I2PA 1EC8A 1SW3A 4KCUA 1YQZA 3EA3A 4LX4A 5HPCA 4NT0A 1IGSA 3OGSA 1KFLA 4ECLA 1H7OA 3KRBA 4DPQA 1TJ0A 4AZIA 4DJDC 4LCRA 4LSBA 3ABQA 3W73A 3EB4A 4Q8UA 1X2GA 3W7CA 1WYIA 2QS8A 1GOQA 1OD0A 4A29A 1NARA 2ABAA 3KZPA 1A5OC 2VX4A 3GR8A 1GNXA 4ICMA 1NPXA 3E2SA 1UIPA 2NWRA 1UOZA 1W9PA 4YTUA 1S2WA 2V5JA 3SO7A 4IG2B 4C6MA 4KGJA 6TIMA 3F03K 2VC7A 2WAGA 3HW2A 1M01A 3L9CA 2VCAA 2C7FA 2X30A 3GU1A 3LCFA 4GXWA 3MS8A 3TYEA 3QMRA 2PF0A 3RX4A 1RHCA 3DKJA 1EDTA 1XYCA 3A9IA 3C3NA 1N2VA 2NV9A 4H7ZA 1BWCA 1Q1WA 3E0FA 2OWCA 4GX8A 2D3NA 2D22A 1FA2A 2OMAA 3REQA 4C60A 2ATSA 1MW3A 1LOSA 4J2PA 3U0HA 1RJPA 3RPDA 2WMIB 1Z44A 8CGTA 2F6XA 4LUTA 1YLVA 2CYGA 2WPEA 3V5CA 3UP8A 5T9CE 3SAZA 4Z1CA 2Q8XA 1GOIA 4CQDA 1AFSA 3DZ1A 5FL1A 2VQTA 4TVCA 3P84A 1K8ZA 1H7XA 3NJ3A 4MUZA 1QPKA 3G5EA 5FJUA 4C6DA 1IZJA 2O55A 5AHLA 5E09A 4UZUA 5A6TC 1T99A 1SZEA 3AMZA 4TV6A 3TYUA 5AYYA 4NY2A 3KWSA 3HRDC 1F8MA 1H0IA 2EPKX 3MU7A 1D2KA 2D0FA 4GUGA 4YHGA 4PMOA 3MKKA 1FHLA 3OA3A 4S38A 2BC1A 4I5RA 2H9AB 2V38A 3AWNA 4X2RA 4A35A 2CZDA 1HJUA 4PUJA 3BSMA 1Y7VA 3EOOA 1V3JA 1C7TA 1NDVA 4NAEB 1TCDA 1P1XA 3W74A 3R11A 3BZJA 3PG8A 5DFAA 3I3DA 1TB3A 3LOTA 5HMSA 2ZZ5A 5FJPA 3LLXA 1OC7A 2VGGA 3B04A 3I7SA 3TTOA 2JKAA 3KEHA 1DQWA 3K8KA 3LHZA 3MT1A 3T4WA 1R3QA 3A4WA 1J01A 5D04C 4L61A 4BEUA 4XZMX 1OGBA 1TYTA 3W1PA 4AY7A 1XHGA 3QFAA 3AALA 2CZ5A 1EA9C 2PWGA 3ITXA 4ZSUA 3FJNA 1CLVA 3LV6A 5AB3A 3F5LA 4H04A 4W89A 1EO7A 1NHQA 4JL2A 1GVQA 3LXBA 3QTGA 2YZRA 1UZHA 1VIZA 1U5VA 1KKOA 2TMDA 3C52A 4X61A 3G1XA 1B31A 2DJXA 3T0AA 3IEBA 3POCA 4LCQA 1G4SA 1KM4A 4J3TA 1X38A 2WOIA 1XLCA 3MY9A 1YE6A 4IMGA 1J10A 3VIMA 1EKOA 1FHVA 3NVTA 2A7RA 3EAUA 1UP0A 4YL2A 3NOEA 1VJZA 3AIUA 1VQZA 3ZLHA 2FHBA 3ZT5A 5A8OA 2YB4A 3QQ0A 2D73A 3C2RA 4FZIA 3GBEA 1J0IA 3W7HA 4EAYA 3ZZ1A 3DG3A 4NRSA 1YTKA 3GU2A 2GUBA 3KBWA 3D47A 3VIIA 1JQXA 3B8SA 1GKQA 4PL2A 3R94A 1TELA 3WQDA 2CPUA 4XG1A 1MVYA 3CB3A 5BXSA 1VFUA 3ITTA 3MUIA 4JX6A 1J0ZA 2X42A 1JFXA 4F9JA 3GHSA 5DMMA 2PLMA 2YL8A 1JJKA 3SJ3A 4GINA 4JNZA 3CLMA 4D1IA 4QM1A 2XFYA 3DFNA 2OX4A 2P3ZA 2G96A 3M47A 1OG6A 2AOSA 3W28A 4QISA 3R0UA 3HTWA 1CX9A 1LROA 3SIZA 4O4VA 2PUZA 2PRHA 2Z7KA 1O68A 4FNSA 3UY8A 4LUYA 2DUAA 2ZUNA 4JFUA 3K2GA 1JAKA 2G3JA 3TLQA 4UXDA 2EQ6A 1E4LA 4IPIA 2OYLA 5CSSA 1F74A 4Z2LA 1CGWA 4Y9NA 2YIHA 2E09A 1K4GA 5B80A 3WF2A 1OIMA 3DH7A 5FCZA 1NWRA 3ZJKA 3LYEA 3AMDA 3TTYA 1HKMA 5SWUA 1CNVA 2I5QA 4ZE4A 3WH6A 4XV0A 2F5ZA 1YXDA 2ZADA 4DUOA 3OBEA 4RLIA 3AHXA 4C6EA 1QVBA 3UYCA 1CBGA 5D8ZA 2Z26A 5FA5A 5D2TA 4LVDA 1UR4A 1BFNA 3DXIA 3IK2A 3DFHA 4UMBA 3ORWA 2AAMA 4JOMA 1RH9A 2CWXA 2E5BA 4OJYA 3RF9A 1PUDA 3ITLA 1LWIA 3PR2A 2XIBA 4KFPA 5MKGB 3EX6A 1G4PA 1I8JA 2IS7A 4H4WA 1F4HA 2Y5JA 1LOLA 3V16A 3B0UX 2OYMA 1UCWA 3CL8A 3ALFA 4W93A 4FA3A 3M0LA 1A3HA 3KRUA 4Z2HA 1RVKA 2Q8ZA 1ZUAX 1W1VA 3H53A 4ZQNA 2P0OA 2YX0A 5A6LA 4G7FA 4NX0A 4A05A 4DIAA 5JU6A 3GTFA 2ZRWA 4RW5A 4ZQCA 4NJGA 3PANA 3VZYA 3FEQA 1I0DA 4JPGA 3RG6A 2RDTA 8A3HA 3EX3A 2VFGA 3WEOA 3BVJA 3VOCA 1F3WA 1AUSL 4QJ5B 1K9EA 5CGMA 3WNPA 2AL2A 1RY8A 4ORIA 4Q8PA 1P6BA 3LQLA 2FMOA 1F3EA 1K6AA 2PDMA 3G0SA 3ANVA 4KMQA 3OG2A 2IKJA 4NI8A 2R1KA 4GVFA 4NXSA 2JF6A 3B4YA 5MHBA 3L4TA 1RCOB 4IIBA 5C54A 3HPSA 2ONEA 4GZEA 3FLUA 3P5ZA 3UWUA 2XIJA 3DHDA 3EMQA 2J24A 1KQZA 4C7FA 4X63A 4FNQA 5BMXA 3NM1A 3QSRA 3KW3A 3IVUA 2EQ9A 1KFWA 7REQA 4A6GA 2IMRA 2WP5A 2X05A 3W2UA 3HO8A 3V1HA 1S2CA 5CC7A 3NYDA 2XVPA 3VD5A 3WDIA 4X3ZA 1MEIA 4Q4OA 1BGAA 4UTTA 4JIEA 3RUBL 2OLAA 1SW7A 3ABXA 5AHNA 1GONA 5AKQA 3GIQA 3S46A 1E51A 5AYIA 4OT7A 1DQXA 2JIWA 4WKFA 1NFPA 4B92A 1GPWA 4JCLA 1VFLA 2CFYA 1T3QC 2XVLA 5CCZA 1QCWA 3PPHA 4C1NA 3SECA 4HGXA 4IIEA 1E5JA 3VZXA 1AQ0A 2XGIA 3TYZA 4MY1A 2I7GA 4MNMA 2PEVA 3BCFA 3RM4A 2NX1A 3H7UA 4AMAA 3LBOA 3CUJA 2Y0FA 3FYOA 3QHOA 4WVXA 2J75A 5D30A 1D8WA 2GOUA 4JTAA 4W5UA 3S2CA 4W7VA 5TQLA 1FWCC 4S3AA 4QSFA 2PTDA 2V5LA 1UWQA 4K36A 1JXKA 3R10A 5HUOA 3TONA 2FJUB 5CEWA 1K9DA 3STCA 1N62C 5HJYA 2JALA 4J3VA 4PTWA 3N18A 2VNCA 5CZTA 2VGFA 4KEVA 1GQJA 4KF1A 4J3UA 2PGFA 2EPLX 1E6RA 4E6MA 1L2UA 1OGSA 3PWAA 1QNOA 2EHHA 2EG7A 1FCUA 2X7WA 1F3PA 1LWJA 2W0UA 3DOPA 1JZ7A 3WUBA 3BURA 3DFPA 3QEZA 1ZQ5A 4JTIA 3WD2A 4R33A 5G1YA 1DWAM 2XVGA 1H50A 2GSEA 1Z41A 1CTNA 1QXLA 2GJXB 4CCZA 4OZOA 1N5XA 5ABGA 3LLFA 1KB3A 1T6MA 2WKLA 4XD6A 2Z2AA 4J28A 3STEA 3UNTA 3G0XA 3KBVA 1RPKA 3RNDA 2EF9A 1Q7QA 4WDUA 4JTKA 3ZJ8A 1B4KA 3L0GA 5HPOA 1LUCB 5JBEA 1GVOA 1PKLA 2G3IA 3LEPA 3N9SA 4C6KA 2YZ5A 4ZL1A 4YCPA 3IJDA 3PF3A 1O5QA 3BG9A 4PMXA 2DW6A 1DEDA 4H9ZA 4PBFA 5D05A 3DHPA 2J7FA 1OT1A 1YYAA 1QW8A 3VE7A 3IGUA 3WUEA 2YGYA 4BFAA 3LB0A 1W8SA 2KX9A 3DKLA 3LS9A 4GI6A 4B5WA 1KWGA 4OTKA 2Q02A 4S1FA 2ZICA 4GK8A 1V6YA 1ODZA 4JTHA 4DVOA 3NTYA 3G1AA 4A22A 3GVRA 3IIZA 2W3ZA 5I3FA 1HL8A 1D3HA 2VWSA 1U1UA 2GQ8A 5A2CA 3EBVA 3OGVA 4A4AA 3FSTA 1R3VA 4HNLA 4QTGA 3VIKA 1O94A 2A6NA 4H4IA 4M1RA 3WQCA 3L4ZA 4CGTA 3K30A 4AX7A 1XD0A 3PC0A 5GRTA 4Q32A 4NG3A 3FVMA 2LLEA 4JFWA 3WK1A 5FAGA 5L6UA 2YJQA 4E4PA 1RV8A 1N7KA 2WP6A 3VCRA 3I3EA 1I2NA 3ETRB 1HJVA 2ASHA 4BV6A 2E3ZA 3B0XA 4RZ4A 3Q6JA 5A2AA 4F0HA 2ZX7A 4BF7A 3MBFA 2Z7GA 1UASA 2X0SA 3QMTA 2R6OA 3H2MA 3W7LA 3WLHA 3QXBA 4JGDA 4AHOA 3L2LA 3UWQA 1M1BA 4AF0B 2DV0A 1VFMA 4P7LA 2G4FA 3QY6A 2PRLA 3FW6A 3I3BA 4Q22A 4RDZA 1I6NA 1V51A 4ZXLA 3BC9A 4FMVA 3M64A 3VX0A 3PZIA 1DTUA 3KHJA 3LUTA 5REQB 3PZGA 1V0KA 3VDBA 2ZUSA 5JCMA 3C61A 3SI9A 2BCPA 2V2DA 2OGJA 3ARSA 1JPMA 2VFEA 5GJNA 5AYBA 2V63A 3AMGA 3QHMA 1PX8A 5I78A 4LWWA 9XIAA 3WD4A 3WQVA 5HA7A 3QOMA 2QJNA 2D20A 3OLDA 3TK7A 1ME8A 3CS2A 5LA1A 1TPH1 3SY8A 1FO4A 1UHVA 1XI3A 4I3GA 4PFHA 2RJGA 1AJ2A 4Z0SA 1J11A 1JXJA 4JHMA 5FF0A 1U5HA 2WMJA 3TNOA 3S3GA 3BE7A 2YCLB 5FJIA 3URHA 4MJ4A 2B7PA 2Y6ZA 5PTDA 1TWDA 1OC6A 4JKMA 4KCVA 1GYLA 3WFAA 3T44A 2DZAA 1I2OA 5KVHA 1Y5WA 4UFJA 4O10A 1JUKA 4K68A 3KL5A 1HNYA 4FXRA 3N6QA 5I3GA 4GE8A 5DT5A 5F2LA 1R3WA 1VBGA 3N73A 3ABOA 2CLMA 1FCBA 1JUEA 1TR9A 4PUDA 4YU1A 4GISA 3AUOA 3D3AA 1HUVA 2VMFA 1LDCA 3INPA 2PPGA 3VAVA 4LRTA 1A53A 3ARRA 3MVTA 2DUXA 3W2LA 2VCBA 1FBAA 3S9IA 1YTEA 1F2JA 3NZRA 2BXZA 3WD0A 4NHVA 1OYBA 3U2EA 3GXPA 2REQA 1KCLA 3O05A 2D1ZA 3ITVA 4GZIA 2YDRA 2WOWA 4AIEA 3PSVA 1EPVA 4XBSA 2B31A 1TO3A 3SN4A 3NPXA 4EQSA 1L8PA 1F6PA 2PSNA 4S3KA 3PZ9A 3HIJA 3G0UA 5KEZA 3CYJA 3TJXA 3W7QA 1ONFA 2CLOA 4XQ6A 4KESA 3W23A 4JNMA 1DYSA 4Y90A 4S23A 1DORA 3Q58A 4Y2WA 3GR4A 3CQJA 4GWEA 3R7MA 4C91A 1KC7A 1P48A 1VFOA 4HYWA 1S5WA 2YDQA 3IS4A 4OFCA 5TBOA 1E6PA 3GD6A 3G1HA 1UR3M 3RLGA 3UBPC 4Y9MA 1OBAA 3TV8A 2OU4A 2VC5A 4WY0B 4MZ8A 2IW0A 1TVPA 5LIKX 3M7SA 3ITOA 3DU0A 5C71A 5AY7A 4OHQA 3NURA 4GVIA 5GQBA 3NZGA 1ZJHA 4JTLA 3GNPA 1XLJA 2J7DA 1JDAA 2PP3A 2R91A 4AWEA 5CPSA 5I6SA 1IZCA 1XYAA 3FV9A 2UY5A 2ACUA 1ZSXA 1HTIA 3QVQA 4GABA 4RDVA 1KXTA 1U22A 4Z1BA 1TG7A 2ON3A 2O4MA 4XUYA 4IIDA 3RIKA 1A4MA 1VS1A 1AL8A 3M46A 4CNNA 1IXPA 1J93A 5K9CA 4BI7A 1BVZA 2H90A 4UR9A 4XK2A 1PX4A 5A95A 3TQVA 4AHQA 1V6VA 3E9AA 2Y63A 1YRRA 3S2MA 3URNA 4WEVX 5KTLA 2A85A 3UF9A 3G2GA 1CZ1A 2XG9A 1OK6A 3ABSA 3VKKA 3TKFA 4S3BA 5D8WA 1S2VA 3AS0A 2E67A 2YCIX 3KTCA 2YVJA 3N6HA 3RHGA 1FWDC 3R13A 5EMUA 1ENUA 3KM8A 2NXGA 3AZRA 1J5SA 4AQLA 3L2IA 3P67A 1TIMA 1QI4A 4RNHA 1M6IA 3RU8X 5AHEA 1P4CA 1DXLA 3HGSA 3NSNA 4GACA 1C3FA 1V6XA 2Q8LA 5DN1A 3AN1A 4GYKA 3W71A 4U10A 4DXVA 3V35A 1PB0A 4U31A 3R89A 4RCXA 1Z42A 3IANA 1QBAA 1V59A 4XSMA 3ONCA 2PLKA 4UB9A 2VUYA 5CPOA 2CETA 2INZA 4OKDA 5I3DA 1KWKA 3ZIZA 5TR3A 3ARZA 3OZOA 3SBFA 5FJJA 4DJED 4BF5A 4WRHA 4DEFA 1QNPA 3U4FA 3WLRA 2Z24A 3N19B 3OW1A 1AQMA 1IWPA 3FSUA 1XGZA 2UY2A 3GIPA 2WC3A 2BC0A 1KFKA 1W5OA 3FHQA 3W1QA 3WLMA 4LVAA 5HULA 2BGQA 1KRMA 3V4BA 5HNUA 1F73A 1V79A 1ADOA 1FHDA 4BQ4A 3ZWSA 4ZOEA 4RE2A 3GVQA 3B97A 2E5AA 3LNPA 1WP6A 2ZCGA 1CCWB 4DRSA 3EPOA 4Z2IA 3SQSA 1QUMA 1W9BM 3C86A 4GUHA 1RK5A 2QDHA 2WLYA 2QJMA 4A2RA 1VYPX 1QO5A 1ICSA 4QXIA 2PWEA 2J8GA 3BWWA 3U8GA 3RPMA 5KSWA 1WKFA 4QX4A 4RNIA 2A7PA 1X96A 4P7RA 3WMBA 2H8ZA 4GC3A 4P8VA 1THFD 4D6JA 1V6WA 5HOSA 4NZJA 1R6WA 2XIQA 3L5MA 4GRSA 1X6LA 2B7QA 3AXKA 3V75A 1T8QA 2C3CA 2PDFA 2NQLA 4DJFD 4V33A 2EXOA 2AKZA 2VO5A 3B8VA 2C14A 3DYMA 4KFNA 2PBGA 1PWLA 1Q6FA 3TP4A 2GDQA 3OLEA 5H91A 5LIWX 1E40A 4LY8A 3M0VA 5D9MA 2TAAA 3AS3A 1REQA 3RCMA 4HVXA 2V3EA 2Y24A 4CU6A 4REQB 2B7NA 2E25A 3EKLA 3NL5A 1N8WA 2E5CA 3WFLA 1M68A 1BRLA 4OE7A 1FWTA 1SSGA 2G4JA 3TA6A 3G8EA 5D03A 4B3ZA 2DDXA 3SUVA 3VOFA 2CLEA 4H7CA 3B06A 3IUDA 5TNVA 1R30A 5JBDA 2PAJA 3QZAA 1K9FA 3AHZA 3TC7A 3GW3A 3G1VA 4BHYA 2V82A 2OSYA 2VVSA 3VKAA 4EACA 3M5ZA 1HT6A 3T07A 3CK5A 2P8BA 3BDKA 3N4FA 5H8PA 2A1YA 3SCSA 1YPXA 1IV8A 2IXVA 4FDCB 1BYBA 4R85A 5LYRA 1UUQA 4XZBA 4ZB0A 3D0CA 3BMVA 4R5EA 1YDNA 1YKWA 4LS2A 1FQ0A 3GHTA 3OLIA 3CQIA 3ZS4A 3P74A 4L80A 2VENA 1MZRA 1IT7A 4NYYA 1WUEA 2YR1A 3W86A 2DZPA 3AXHA 3LRKA 2PDWA 4UNLA 4H01A 1SUXA 1FVPA 1F3XA 5I3JA 4NIRA 3AHTA 5I5RA 4DNAA 5EU9A 3R2GA 1RCXB 4IIGA 2OT1A 4N42A 1OSEA 1H11A 3QGAC 1WDWA 1NF7A 2PD5A 3M9YA 1DJXA 2UV8G 4EWND 3QH2A 3UVAA 1ZK7A 3PUEA 2DZWA 1Y5VA 3PJWA 1B3YA 3GNRA 4KETA 4GKTA 1YQ2A 1T96A 2J7HA 4MG4A 1HF6A 1XBZA 1CB7B 4FSAA 1J6OA 1YTDA 2ADAA 3GAYA 4HMCA 2ZZCA 1V7AA 1GOKA 3MUXA 4MAZA 4IP7A 3TTSA 3CUIA 1TX2A 3CIVA 4HN8A 1W37A 3FYPA 5HR6A 1FCQA 2OEJA 3BXWA 1TV8A 1OJXA 4H83A 2XM2A 3VIGA 2BHZA 3V3WA 1S39A 2RDWA 4R34A 3LB8A 3W7MA 4UTLA 4LY4A 1O60A 1ELSA 3EGJA 4PCPA 4CD6A 2VOMA 4HPGA 1MUCA 4MFDA 2ICSA 4E3VA 1TWZA 3WN6A 1H6VA 1VBHA 2NT0A 3PBGA 2X0YA 4WKHA 4HNCA 3ME3A 3TQPA 3WNKA 2GVJA 2AGTA 2CLHA 3CT7A 3THQA 3WLOA 1DTNA 4CN1A 2QZRA 1ZALA 2GJNA 1PPIA 1PV8A 3GXDA 1XRFA 4MDPA 3QC0A 1LWHA 1ZBKA 3KL3A 1PDZA 2VC9A 2WHMA 4K2SA 4UFIA 1ZGDA 1PKNA 3PUOA 5M17A 4O16A 2CHRA 3N2CA 2XIOA 5I3KA 3KTXA 3LGEA 3MB9A 1S1PA 3GTHA 1H51A 2MANA 3W0KA 3HF3A 2Y7EA 2DH3A 4MYXA 1F8IA 3VOGA 4F2UA 1DP0A 2Q6ZA 1SO5A 3KX6A 3O6DA 1IEQA 3P2VA 4MJZA 4QS5A 3KBSA 1MSSA 5LNWA 1O1HA 4NZ5A 4LB4A 3T40A 2X8HA 5ECVA 2QXWA 3H7RA 1ONRA 2R94A 5FSEC 2DSKA 1YDYA 1C9DA 4YJ5A 2QJIA 4Y9PA 4KRUA 1X1ZA 1IEXA 4K38A 3RJYA 1ITUA 4IICA 4GQ0A 4BCEA 2E9MA 3ZXWA 3C0JA 3L4VA 3PBYA 3BARA 5EFDA 3W7RA 4G7EB 3IARA 3I10A 4RPQA 5DCDA 3LX9A 2EQ8A 1TJRA 3LTSA 3NDYA 1N8FA 1XDLA 1Q13A 3BK0A 1C8VA 3FA5A 2Z1KA 3SCWA 1H5VA 3PNZA 3BAIA 3M44A 1R9YA 4A8IA 2X99A 2WANA 3C0QA 4RV3A 4RZ5A 3MHFA 2FZDA 4FF7A 3TSDA 3NPWA 3KP0A 4O53A 3CHVA 2OQYA 3E38A 4JTJA 4WIWA 4XAZA 1H62A 3SB0A 1SW0A 1EYEA 1UKTA 2W66A 4IGHA 4IX2A 2OELA 2GK1B 1RJRA 3W72A 4XISA 1N63C 4O57A 1WXZA 1A5AA 3B9DA 3L8KA 4E0CA 3CV1A 1UROA 3BOLA 5HJXA 4EPEC 4K37A 2GJRA 1AODA 3IJ9A 1GKRA 4X9SA 3L5LA 3G1FA 1H7RA 3HJZA 2GH5A 3GHUA 3WLJA 4W5ZA 3RN6A 5E70A 1PZ3A 3QOKA 4HCHA 4WKAA 1JCLA 4MIMA 4DZ5A 2ESCA 3MMTA 2R24A 3MUY1 1AVAA 1ONXA 3GG1A 5HWMA 2X1RA 4QHRA 4NZFA 2HXUA 4S2BA 1EA0A 4DJEA 3EOUA 1PO9A 5A69A 2X8RA 3GDRA 8TIMA 2L5HA 3W7KA 4AZCA 3QJAA 2HEJA 2FIQA 2NLYA 2WHJA 1SMAA 3GQYA 1XV8A 5FJOA 3STFA 4A3UA 4Q3MA 1H60A 1GVRA 2G8ZA 5A8NA 3CB8A 1ZBCA 4PTMA 3LY0A 4CVUA 3KOWA 3E12A 1QOQA 4O1BA 3W1TA 3TSBA 1ZAJA 2VEKA 4F0RA 2WZMA 3ZLFA 4R9OA 4PMRA 1VFSA 4ZO8A 1LBFA 3WLLA 2FZBA 4GH1A 1ZRQA 1DJIA 1NU5A 4IH3A 1KM3A 5CH9A 3QBUA 2BB0A 2ZXQA 3WH8A 3MSYA 3TC3A 1UJPA 3VDCA 2D69A 1NFGA 3MV11 4HK7A 3QMSA 3ZM8A 1TRDA 2FTYA 5GNXA 4HQVA 3TCEA 2YA2A 3GC5A 2QVHA 3REQB 4F4RA 2BVYA 3BLPX 3C8FA 4HMNA 5FESA 3GE7A 2BOGX 2SFPA 4G8TA 1W5MA 4L1WA 1TTQA 4LUTB 4OIFA 3DH9A 5DANA 4AEOA 2D0GA 1XICA 1UJQA 3GC2A 4DJFA 3E1F1 4LYQA 4FOUA 3U2ZA 2PTXA 5JH1A 1PKYA 1E4MM 3NL2A 3UXIA 2TPRA 4NX5A 3DBNA 1LL6A 2UY3A 2GLKA 4C6JA 3AS1A 4UFMA 4PTNA 1KGWA 2WMGA 4DM2A 4QNEA 3S47A 4HU4A 4L4PA 2OKTA 1NM9A 3WMCA 4R7WA 2MUCA 1PTAA 2OB3A 2ZX6A 3GHRA 4LVFA 2OXNA 1XLIA 4GI4A 4ZQOA 1DWIM 3VNIA 1X7IA 3G6MA 1W1TA 4JN7A 1HO1A 2X8GA 2AMXA 1QFEA 4K7VA 3TIMA 3KOXA 1NQKA 1MYRA 1A5SA 2YSWA 3VCNA 1ZAHA 5HR7A 5FS6A 5LGZA 1E9YB 4ILSA 4UR8A 1O66A 1Y65A 3BV7A 3EPMA 3A5FA 4I7UA 5E6YA 1P6WA 3QW3A 1F3TA 2BY3A 3TLLA 2GQAA 4WR3A 1J2WA 4M6VA 3UEQA 4HA1A 4AD0A 5AYXA 1MQRA 4D72A 3OIXA 2W0HA 1XG3A 4LEQA 5EPDA 3F2BA 4GR1A 3TN5A 1EGMA 4DX3A 1XLDA 3L5OA 1F61A 1NWSA 2Y5SA 4KKXA 4MB5A 3W87A 3G3DA 3ES7A 2WJDA 3WLSA 4AD2A 4I8YA 1DWGM 4LAOA 1MNZA 2J9XA 4GO8A 3K1DA 1BTMA 3PAJA 4NP7A 1HXJA 4MLRA 3WNMA 5HMEA 2QUTA 4QSHA 4JD4A 3SR7A 2YBTA 3AWOA 2X1SA 4JICA 4Q4KA 3IPWA 4HKPA 1Q7MA 3C6CA 1JVNA 2OSWA 4CD4A 1U1HA 2QAEA 4F79A 5E9AA 5IRPA 2DVUA 1M53A 3KCOA 4Z08A 1H2IA 3WUGA 2P50A 3TOPA 2DT3A 3K46A 1TV2A 1A5LC 2WQDA 3N17A 1NP2A 1TA3A 2DZXA 1UD4A 1UKQA 3LPPA 4JIRA 2WPBA 4B2DD 2WMFA 1GXFA 5ER0A 5I0DA 3CXOA 1CT5A 1BWKA 1TMHA 2DT1A 4UTWC 2RABA 2YKKA 3MYOA 3A9BA 3O0KA 3U2OA 2Y5EA 3V36A 3H54A 1Q66A 2E28A 4CKQA 3WLIA 1I60A 6ENLA 5DQPA 5A8MA 4D8ZA 1JF5A 3CTLA 5CPQA 3KLKA 4H9TA 1YW1A 2EKGA 3NNTA 1WNOA 1U83A 4IX0A 3HBLA 1KLZA 1TV7A 4ERAA 3NXLA 4TX6A 1A5MC 2DZVA 1RBOB 2XUCA 3APTA 3CUHA 4UQAA 4EF8A 1BSIA 2D2OA 4GVGA 3KCJA 4H6KA 1GVYA 1HGWA 2OZ8A 3B9JB 1PTDA 4Q6JA 3FFSA 3MUCA 2YVFA 3N2BA 4F0KA 2O4QA 3M1ZA 5BXPA 4E8GA 1TTJA 2QKFA 2Z0IA 3NUKA 2WOVA 2V6AA 2YDSA 2G3FA 5GJPA 4NJHA 4PA8A 4ZQPA 3VVGA 4D2JA 3QQ1A 2BDQA 4WJEA 3A4JA 4UQEA 2HBVA 3BW2A 2JK2A 1XCFA 3GBDA 1V0MA 3MWAA 4L4MA 4V1YA 2TSYA 4O11A 3DCPA 2QF7A 8XIAA 2QMJA 5LZLA 3FEMA 1ONWA 2CBVA 7CGTA 4AWSA 4D6IA 4PCSA 2HVNA 5HNRA 4DLFA 4I9MA 1K77A 4ATWA 3E2QA 2ZZ2A 1KR1A 4EM3A 3OBKA 1VQTA 2YBUA 1JDEA 4AX6A 5FMHA 2A3AA 1F76A 1N55A 2X1TA 1RD5A 3DN5A 3JZUA 4TOQA 3CZEA 5FJRA 3KZSA 1I9CB 3MCMA 1JRBA 4R7JA 4HOXA 1JEZA 5E0KA 3CT2A 3GKFA 2CW6A 1B4EA 2QV5A 3QPYA 4K8GA 1AD4A 4GI9A 4O4WA 3PN8A 1UD5A 1M5WA 1GOMA 1KM0A 1D3GA 1H61A 2WWDA 4ZO7A 4FX7A 1Y0EA 2ZRXA 5D9OA 2DGAA 4MMWA 1KCZA 4MM1A 4LUSA 3PWIA 2NQ9A 2PFHA 3LZ3A 3EKGA 1ZMCA 3NRZB 3P80A 2V69A 3ICJA 1LLWA 3DBPA 4PEEA 4ZODA 1LT7A 2ZBTA 4ZXOA 2OSXA 4GUIA 3QYSA 3CV7A 1FWAC 1BKHA 4FNRA 4YHEA 2CFFA 2IKHA 4JEQA 3DHUA 4OOZA 1X1OA 4LA1A 1K8XA 1KM1A 4GG9A 1KM5A 5DRIA 1FECA 3IJIA 1DJWA 3UGVA 1UMYA 3LENA 3LERA 2FFIA 3EWZA 5FL0A 4A3RA 5AN7A 1NHPA 3IGSA 3QW4B 3T0BA 2OKOA 3M0HA 4HA0A 2ZZ1A 5CBIA 4M82A 4JEJA 2ZVRA 4FP1A 4GQQA 4GD0A 4M6PA 3DI0A 1Q6LA 3IJ6A 2HQMA 3LHTA 1Q6RA 2FZNA 3MBDA 1S2TA 2IUZA 4DF2A 1VC4A 3HG4A 1W9UA 3G1RA 2HXTA 4JNYA 2ZUUA 2VFFA 5LGXA 3N3MA 3HJEA 5CJMA 2WBGA 1OZMA 1W32A 1A4LA 4UNIA 3JRKA 3DI1A 3W22A 1VH7A 4N9EA 2I9UA 2AAQA 4B5XA 4UBPC 1RP8A 1JL8A 3AJ7A 4HD5A 4Q4MA 1VP5A 3CV2A 1SO6A 3SRKA 2WK2A 3MYPA 4WXYA 1QNSA 2RAGA 4ZSTA 1WX0A 2WQPA 5HANA 1V77A 1EP3A 2OWXA 3K4DA 1EGVA 4DUXA 4I9TA 3BLDA 3UY7A 1SMDA 2J79A 4D6DA 3VM7A 3QR0A 1HJQA 3GYCA 1UW9A 1IIHA 1EP2A 2VZTA 4KFOA 2BG5A 4WJXA 5LHFA 3VGGA 1W6TA 5HQEA 5GPRA 1X6UA 4CLMA 5D2WA 1WV2A 4O0KA 1QPNA 3RNMA 3BUVA 3PVFA 4EMIA 2J3NA 1TV5A 3TW7A 5D38A 4XBKA 5KZ6A 1KTBA 1MWOA 1WDDA 3KRSA 2OR2A 3MZNA 4Q7NA 3JR2A 3H23A 4UNKA 3GFZA 3U2CA 4DZAA 1Q1RA 4LJ3A 1XFCA 3AJXA 3WKZA 4TUFA 3CO8A 4HCDA 2QJJA 4IJRA 1MXGA 1VEPA 4PTVA 4ADSA 4B5SA 2Y62A 1AK5A 3UCDA 1LOQA 4HOZA 4L6HA 2GGHA 4IMEA 3QV9A 1UMLA 1W5QA 4Z2GA 4U28A 4LAMA 5HNNA 1HP5A 2DW7A 1OM0A 3TJ4A 4IJCA 4YVPA 3CAVA 3TDFA 1V6UA 3P81A 4BWLC 3TMQA 4E8CA 1MXSA 4IMFA 4IFKB 5I24A 3R07C 4UMAA 4A8LA 3LCXA 4HSOA 3PTDA 1R2RA 4B5VA 2GQWA 1E1FA 4S3CA 3LRMA 4XZWA 4ACYA 4HPHA 4G6CA 4JDRA 3NR0A 1HJXA 1PYFA 1JF6A 3HV8A 5EYWA 4HSHA 3PZMA 3SSZA 5BZAA 3W6LA 1FWGC 3B9EA 5C70A 3GC4A 1E55A 1TYPA 1R3RA 4HN4A 2BP1A 3PAOA 1MEWA 3EB2A 1FWJC 3WF1A 2X1UA 3GD3A 1I1WA 4S3EA 4O14A 4QFUA 3Q4DA 4Q4SA 5I79A 3UQNA 1IWBA 3AZSA 2Z6IA 4JY8A 1XUZA 1PAMA 3KTSA 3CLWA 4IXXA 3EDEA 1XC6A 4NZ4A 1FKWA 4KCTA 4PUWA 1K7EA 2ZXAA 1K9TA 5CJNA 1EJUC 4XKYA 1V93A 4DBDA 1TMLA 1NSJA 4KERA 5KZEA 4MWAE 3S5ZA 3SCPA 4M7SA 3PZVA 3UXAA 1N82A 1QJWA 2V0TA 1SYTA 4O28A 3I7RA 3KP1A 3VE9A 4HHPA 2WO5A 1KRAC 5U7SA 4AEEA 1C91A 1R86A 1ZU8A 1OF6A 3BANA 3UJSA 3WY1A 3BPWA 3PULA 4RE3A 4IUGA 5A8GA 1GQLA 5ABFB 5E6ZA 4B2DA 3AHYA 4PR4A 3LXDA 1M7OA 1OX4B 3MHGA 2VRKA 4O1AA 1XM3A 3A12A 4N6FA 1W31A 4H41A 3LI0A 4FX8A 3MZ2A 4MZ1A 1HZYA 2QCDA 1VAHA 3W82A 3UJEA 2PDXA 1B5TA 1OFQA 1KN0A 4NNAA 4LIIA 3I7QA 3WNLA 1A3WA 2BY2A 1SO4A 1TFVA 2NSOA 1RXOB 4TVUA 3TH6A 4NI3A 1GTEA 2Z1SA 5AOUA 5JRBA 1Q6CA 3VDHA 3C2YA 3NYZA 4OU1A 3SDOA 2VUNA 3HGJA 4MKVA 2IPGA 2OX1A 2NZLA 3EUB3 4I90A 2ATMA 1W3IA 4FALA 1GQKA 5HAOA 3AICA 3N9KA 1VPXA 2PWFA 3AYTA 3CHEA 1EJVC 1OINA 3H2EA 5BNKA 3CL6A 4I6KA 2ZIDA 3HU7A 2ZXDA 1S5VA 2I5GA 3H2OA 4ZOHB 3AIRA 1E0UA 5DY2A 3PZNA 4MLJA 4IT1A 3BOXA 2CBUA 3THCA 4DWSC 2E1DA 3NWRA 2F8QA 2QLYA 2HPMA 3GXIA 2C8NA 1G1YA 3VX1A 1V3MA 1ITCA 4ZTXA 3PBUA 3PHAA 5K9DA 4IL2A 1VLIA 4GLEA 1HKIA 5D37A 1D8CA 2ZOXA 1J0JA 4GFIA 4LNYA 4IOTA 2REQB 2FQIA 3QKEA 2OOGA 2WWCA 1V97A 3YPIA 2WMIA 1JUBA 2VEPA 4O1CA 1JI1A 4Z1DA 4QR6A 2POTA 1TJPA 1UD8A 3EOLA 1GKPA 3GG0A 1L6FA 4NZ3A 4C5YA 4GH3A 4FXSA 2V3AA 2XH7A 2HE8A 1XJBA 4M5PA 1R0MA 1QNVA 3MUAA 1SR9A 2EQDA 1NP0A 1XLFA 1AMKA 1OABA 1TQXA 4EOUA 4UWMA 3ITCA 1Q65A 4LW7A 2E9LA 2NQHA 3L4WA 4MY8A 1ICQA 4GFSA 1J0KA 3LM7A 1DE5A 2PDGA 2H9AA 5CKSA 3CH0A 4UTFA 3A4AA 4G5DA 3PPFA 3RRAA 4M8UA 2ZRUA 2FVMA 3MDWA 1YADA 3RYSA 4M0XA 1P7TA 4H4TA 1J18A 3H2CA 3R5EA 4PRTA 1NOFA 2QDEA 4K8HA 3PG6A 1KD0A 1JZ6A 2DUZA 1XYMA 2RGLA 1LPFA 4GXMA 4BEQA 3E2VA 4I6VA 4K3ZA 4AXNA 1E71M 4X0VA 2QPSA 5BYWA 4AWTA 2FKPA 4IP5A 4QE1A 5FJTA 2HWGA 3W88A 4X2PA 1D9EA 1TJ2A 2A21A 2YL6A 3QKZA 4O54A 4MDOA 4TX8A 4LRSA 3E5BA 3G1YA 1ICPA 1M03A 3IJ8A 3SZ8A 1AD1A 3C2VA 1OF8A 3WBYA 2PODA 3IUHA 1SR0A 4ZEPA 2ZZ0A 3EEGA 1AJ0A 3DECA 4WCJA 2IXUA 1DOSA 4M6UA 3UWZA 3CZGA 5EGRA 1K4HA 5TD4A 3U48A 3UYIA 4W86A 1KCXA 1X1NA 2VEIA 2JFEX 1J0HA 3WELA 3NGFA 3W7OA 5B7YA 3LRLA 2EPNA 3U57A 3M4HA 2HS6A 4D9PA 2VDIA 4L4OA 4XIMA 2A5HA 4XVEA 1FIQB 3ERPA 3ITYA 3F7JA 4IPPA 4CNUA 4KT2A 3B8UA 1E6ZA 3ZR6A 2HCVA 4C6OA 3M0JA 1E6NA 5AVHA 1H5YA 3RFAA 4K8EA 2BOFX 5KETA 4MJMA 1BAGA 4MF4A 3FJ6A 1A5NC 3DK9A 2RDUA 1W1YA 1XUUA 3GRSA 1E4IA 4UTKA 1JIBA 5AECA 4FS9A 2JKEA 1R3YA 3O6YX 5CG0A 4WJ8A 1P0KA 3S2NA 1SJAA 4MB3A 4Z1YA 5LHEA 3GXFA 1XR2A 2FZMA 1F5ZA 3KL0A 4GQBA 4MKSA 1BYAA 3HPAA 2YYTA 1A0DA 1H2JA 3W7PA 2A3BA 2QUMA 2XN1A 4W9TA 1GZGA 3SQLA 2O9OA 1FH7A 4W87A 1GZJA 1QRQA 2ZC1A 4K39A 3EXTA 2ALDA 3VNZA 4F3HA 3T4CA 3W02A 4V28A 1OT2A 1B90A 2AQOA 5BRQA 3WQ8A 1HN1A 3WH7A 4EK7A 3P14A 2FB2A 2VVNA 3ANYA 2XWEA 4U2ZA 1RQEA 2TODA 3AMLA 2QNEA 5A3HA 2ZDRA 1HL2A 1H7NA 1G69A 4HSNA 3JW7A 4F66A 4KRTA 1NAL1 4IP4A 5CAKA 2YFNA 4NAFA 3CUGA 1TIWA 2FFCA 3GZAA 2I14A 3CJPA 3GLCA 2W54A 2BGNE 2O7QA 3WBAA 4KBXA 5DCBA 3GRIA 1UOKA 2YA1A 5JXQA 2OLSA 4GYPC 1T0OA 1B54A 2GDUA 5FS8A 4J3SA 1NDZA 1EF2A 5MKGA 2OPJA 3FN9A 3FXYA 3URAA 4IGSA 4ZA0A 2I17A 2A3LA 4ZQMA 3SGUA 1G5AA 3UWVA 1YBQA 1QDSA 4GBUA 1XGDA 3VKJA 4ROQA 1VDVA 5CJ5A 4H7VA 3K4WA 1DL3A 2KAUC 2WVSA 2F9RA 4UTUA 4WDWA 5G1MA 1WYGA 1REQB 1G7VA 4ROPA 3WG6A 5G2HA 1HJSA 3KE0A 4JQ3A 4QIUA 1M3UA 3MA8A 3P0XA 2W61A 1ZDLA 2ISSA 1GRFA 1JPIA 4MB4A 5E5CA 1D7FA 4LAUA 2OT0A 3KFTA 4RNJA 2CLFA 1FFUC 2W4XA 3CZLA 1JFHA 1K70A 4W8AA 2GWNA 2X41A 2WC7A 4UFHA 1ME9A 3UJRA 3MVIA 3QGKC 4PEKA 4XAPA 4H8HA 4LAKA 2EKCA 3URBA 3A22A 1EC9A 1ZMDA 2ZA2A 2QUVA 5AC7A 3PUDA 4NKCA 3H2FA 4WK9A 1B3ZA 5HINA 5CAHA 4M3PA 2WW5A 3FKRA 4Y96A 4M52A 3BAYA 3O15A 3RJXA 2YQUA 5AC5A 3W6MA 3SUSA 4GCAA 2YB1A 3OVPA 1K4QA 3NVVB 1XLLA 2F84A 2A2IA 1E0VA 2QJGA 1LYXA 1T8XA 4JL1A 1YEYA 4MZYA 2O9RA 1S3TC 4EQRA 3KOZA 4D6HA 2ZZBA 2DZSA 4FX6M 5AVNA 3S6OA 4DBWA 2VD8A 1XLHA 1R5YA 1EH9A 2GJLA 2HSAA 2XJ7A 2VZVA 2DSWA 3UVIA 5C2GA 1XDIA 2GR0A 3LPFA 4MTVA 4Q8QA 2NV2A 1ZL1A 3DERA 3TWAA 5TF0A 3M0YA 1M7JA 3A3WA 2X2GA 3ZSSA 1Z69A 1UWUA 3QHNA 3DIPA 4GIAA 3GAKA 4HTBA 3VABA 4ADWA 3LSBA 2J62A 4AAJA 2NPXA 4JIPA 3RX3A 2A6LA 1XL9A 5AHFA 4JDYA 5ABHA 3COTA 3M5XA 5FACA 1CGYA 5L9FA 3DC0A 3WLNA 1XYFA 2ZE3A 3IVTA 3VXGA 4U5KA 4YIWA 2CLKA 4DYJA 4QE5A 5C9UA 2PU0A 3LCIA 4DUVA 4LB3A 4EMJA 1KV8A 3N34A 3ZVHA 5T26A 1R38A 4PC8A 3BTNA 3CHDA 3QRHA 3BOFA 5H1WA 4ZZ9A 1Q5MA 4DY1A 4XVDA 2NQZA 5I77A 2XSBA 4DF1A 5J5DA 1BTCA 4ZO9A 4PUMA 3CAKA 4GJ1A 2P8CA 5IBXA 4UQCA 4CEUC 2GJXA 2QUNA 2YXOA 2F61A 2OZ3A 4FR6A 4QAIA 1POKA 2WNNA 4MY9A 1UWRA 2XIMA 3R8GA 2XM1A 3WENA 1JDDA 4O18A 3DFOA 1E6QM 1CGUA 4Q4RA 3HPZA 5G2WA 1HFBA 5K4XA 5IDIA 4PSPA 4NILA 2R8WA 4AD1A 3BLLA 3U9IA 3VIPA 3SADA 5U4NA 3UJ2A 1STZA 1XCXA 5G4HC 4A8RA 2P88A 4MB1A 4ZCWA 4GZJA 4LT9A 1UPPA 1VFTA 5XIAA 2ZZ3A 3SCVA 2FH6A 3UU0A 3BCDA 3UXDA 5JCIA 3L0KA 1GTHA 3MSRA 4DXXA 3LA4A 5D2XA 5F4XA 4AZGA 3D9XA 3HMCA 3T0DA 3OYXA 4AW7A 3AXMA 4WLCA 3IRSA 4D6EA 3GG7A 2TRSA 4NVTA 3VZZA 4N02A 2FMNA 3L12A 1EEPA 2D2HA 3QZEA 1MMFA 1H0GA 3O6AA 3T1GA 1WKDA 2WVVB 1S5MA 4BK9A 4CUCA 1QHPA 1XPGA 5FEXA 2E77A 3L23A 3KLLA 5EKYA 2P1FA 5DEZA 2ZZ6A 3UZYA 1ML1A 3CQ0A 3CUFA 3DG6A 1WDPA 1TSIA 2BMBA 3MP4A 4QGCA 2YL9A 5CGQA 1PVNA 1ECEA 1VD6A 3L67A 1EBHA 4JTGA 2ZTKA 4FNPA 4MADA 4J27A 3W2NA 3FA3A 1AZ1A 5FS9A 3ALGA 3MDUA 3GB6A 3L7RA 4GQGA 3NPUA 3VCCA 5KZDA 3OLGA 3H70A 3AU2A 1OC5A 4EAMA 3K4AA 1LP6A 2ZWZA 2F2HA 2PC4A 2W62A 4JTUA 2E6AA 1W1ZA 4PULA 1SZGA 4WY0F 4J40A 3VKDA 1UBPC 3PS7A 3QF0A 4IFRA 1E6SM 2QULA 1AW1A 4Y8FA 4BJHA 4QG9A 1JDFA 5EB8A 1JQVA 2DT2A 1EJSC 3O8AA 3W7EA 4O0ZA 4P8UA 2OEKA 5G1TA 3RO6A 3BAXA 4AIUA 2J8FA 5FS7A 1ZBVA 1TZ9A 3NQ6A 4IUOA 3PY2A 2C71A 1MEHA 1B9BA 1IEIA 3ZR4A 4G1KA 1SGJA 3UWWA 4FIRA 7ENLA 2HDJA 4QLJA 5HATA 1GPFA 1TPVA 4FLSA 2Q3OA 2Z1XA 3WQPA 4O12A 2P53A 3PB2A 1SZFA 1OD8A 6XIMA 2XVKA 3T7VA 3T42A 2Y7FA 3MPGA 3L4UA 1UR8A 1ZFJA 2I5IA 3UXKA 2ZUMA 1LQ2A 2HRWA 3BLEA 2Y70A 4GOAA 1XLKA 1GOWA 3GNOA 4AIBA 4CNSA 5A6SA 1AH3A 1G6CA 3A21A 3T2OA 1ZKQA 1XPYA 3OHIA 2C13A 5F1VA 3LHWA 3UFYA 1PJ9A 2ODOA 4XIAA 5C7VA 3ZMRA 3TC6A 1EHAA 5A5WA 2G50A 3L4XA 4BI5A 5EMMA 4RJEA 1JCXA 1G67A 3ZVIA 2HNHA 4E5TA 4R53A 1XLGA 3BW4A 3PPGA 4UFLA 4PRWA 3VIHA 2E9BA 1UZ4A 4HZMA 4HPXA 5C8BB 1JZ5A 4ASTA 5BRBA 2W91A 2WSPA 4UTJA 3AIBA 1GW1A 4YWIA 1A5CA 3MJYA 5CZKA 3W7GA 4QJ4B 1DIEA 1FP9A 1KGXA 2GQ3A 2ZX5A 4JFVA 1BLIA 2MNRA 3GIYA 4S3GA 3MI3A 5HMDA 2HBXA 4MWAC 5LNVA 2TPSA 1HGYA 3LXCA 1T5AA 3NO3A 5IHSA 1LORA 3F5JA 2DPEA 4I5XA 3UWEA 4PGLA 5E9XA 1FOBA 3PUGA 2D23A 1LQ0A 1XG4A 4H8UA 1HKVA 1DIOA 1RLDA 4AD5A 2WSQA 4TTGA 2V2CA 3AROA 4K1GA 2I16A 3SUUA 1QPOA 3Q65A 3G22A 4HNOA 3PZUA 5AZ1A 2G97A 1IT0A 2QF8A 1RJQA 3CWOX 1ZZMA 1V7YA 2PLCA 2EPHA 2Z1WA 4NEVA 2RFGA 3T6CA 1TREA 5K3VA 4CQAA 3W1AA 1YHTA 3TQ0A 5FF7A 4QDMA 2VWTA 4DO4A 1C7SA 1EBGA 1DBTA 3CGCA 1PXGA 2XGBA 1J96A 2FPTA 5AC8A 1F07A 1MNSA 4TQTA 3M6YA 3QY7A 4LYKA 1Z7AA 3P7YA 5EY5A 3S2LA 3FJ4A 3L66A 4JX4A 4KWOA 1N8IA 1UB3A 4URIA 3GS6A 4DWDA 3KDOA 4YTQA 1XIJA 3E3HA 1US0A 5CC3A 1YXYA 2E40A 1RZMA 4NSBA 3WBWA 4J9JA 3AQUA 4NZ1A 2O9TA 4O52A 1EOMA 3IK4A 1DJQA 4APNA 1WBHA 1WKYA 2GPTA 2PRMA 3FDKA 3S6DA 5HUPA 3LBMA 1GVFA 4JYFA 2KZHA 2VEFA 3C0SA 4EF9A 3OVRA 4B90A 3BMWA 4Z2KA 1X8FA 3WJSA 1FEAA 4X0NA 1KTCA 3I6EA 3O0FA 3TX9A 3S2JA 3UZ5A 2JK6A 2ZZ4A 1DNCA 9RUBA 1JGIA 3NO1A 4RNFA 3II4A 2PDPA 4O13A 1R87A 1HVQA 5G2IA 1GWJA 2NSXA 1OFEA 2FZ8A 3CWNA 2Y89A 1K6WA 3LM3A 3IJ7A 4JZ5A 3NCOA 4GJJA 4DBEA 3LU2A 2V3BA 1AMYA 1CECA 3M5VA 3N12A 1EOKA 4E2DA 3UG5A 5D4YA 1TA3B 4PMZA 1SM9A 4OQVA 1KQYA 2XZ7A 1D3CA 3IIXA 1B3OA 1RALA 1QBBA 2VYOA 3L2MA 2Z27A 3AXXA 3VU2A 4RV8A 3EYPA 3RX2A 4HK5A 4BQ5A 4ES4A 1Q6DA 4E3TA 1U5JA 3O2LA 1E1CB 1K8YA 2GQ9A 3R4IA 2C1IA 4J35A 4H6RA 1OCBA 3A4XA 3T0TA 3USZA 5EMLA 4OUEA 3HM7A 3AISA 4C6FA 4EXBA 3M16A 1I2RA 3H6OA 3CZ8A 2FLIA 4IHCA 4EXAA 2DT0A 3UR7A 1VB9A 4PMJA 1UD6A 2PTZA 4RXGA 3UJFA 1PWMA 3PNUA 1W17A 1P0NA 3N1AA 4EPDC 3HMJG 1WDSA 3TOYA 1H4PA 4E2VA 4EX4A 1I4NA 3N29A 3AU6A 3TA9A 2EJAA 3CC1A 3CHFA 1M41A 2NUWA 3N04A 2QGHA 3R43A 5JH2A 2HPIA 2QYGA 3AOFA 3SRHA 4JN8A 1GG0A 2H6RA 1ME7A 3EWXA 2WBKA 1TE6A 3TYDA 3WBXA 3CH9A 3PBWA 3TYBA 2DSUA 4R7OA 1QT1A 1AH0A 3W26A 1SFTA 2PC8A 2X1IA 4PE8A 2C1GA 5DX7A 3R58A 1ISXA 3R0DA 4O1EA 5I3HA 2VI0A 5LKYA 1MQPA 3RM9A 1HW6A 3LG3A 1UQZA 3ARVA 3AYVA 2ZX8A 2ZUTA 4WHBA 3SJNA 3MWCA 3V0TA 1GVEA 3QPZA 1XW8A 1G0CA 3I4EA 1DVJA 3MSDA 2YYUA 2J8TA 3UERA 5FEWA 4RE0A 3H26A 4XUGA 4W8BA 2ALRA 5G5HB 3O6CA 3OVGA 2BY1A 2QUUA 4L9YA 1QR7A 2YCJA 4MNJA 3NQCA 3P82A 1GREA 1FY6A 1Q3NA 2VGBA 4YXGA 1TPB1 2YLLA 2J27A 3W6YA 3R8RA 3TQKA 5BOEA 3GRTA 4HU8A 3V0SA 4M29A 4HNVA 1ITQA 1L9WA 2E7FA 3VNYA 5KZMA 3SCRA 1MRAA 3MTWA 4M51A 3L65A 3IJLA 2VCCA 3B0PA 2VX5A 1FWIC 2CC0A 4EPBC 3WZ0E 3TYAA 2AL1A 3KRZA 1S5NA 3F1QA 1DHPA 1NWTA 1C90A 5D02A 2GSHA 4IM4A 4D8AA 2WNQA 1QI3A 2ZXBA 2DIKA 2HK1A 2QDGA 3KS5A 3BV4A 2P3EA 3LCGA 2E4TA 1J79A 4Q7IA 1H41A 1LL7A 4UTWA 3TSMA 4GQRA 1ZJIA 3F4CA 3W75A 5BROA 3GTNA 2DZBA 3TNBA 1DHKA 8XIMA 1K7XA 1V0NA 3OOQA 1Z48A 2E1WA 2WPGA 3SQPA 4UIOA 3VINA 3GU9A 4R3UA 1L6SA 4FIQA 1XGEA 4J2MA 2RDXA 1EJTC 5K2ZA 2Z28A 4ALDA 3MUZ1 1KW1A 2I9EA 1UR0A 3DK8A 4FK9A 3FAXA 4ACZB 3FGCB 5GJMA 1YX1A 1YE4A 1O12A 5EA9A 1XLMA 3WK3A 7TIMA 3RGTA 3TEVA 2PZ0A 3W1XA 4QEEA 3SEPA 4HHHA 3G1SA 2O0TA 2OGYA 1J8VA 1VJIA 5CLTA 3W70A 5HXMA 1CXEA 1YIXA 1U33A 3DESA 3N13A 4DUWA 1DQUA 2BS9A 2YLAA 4C6LA 4C6PA 3IIPA 4HHMA 3PTKA 3GNNA 3GH7A 4DWSD 1I1XA 4DNHA 2RKXA 1EIBA 3H2NA 4A8NA 5I00A 1RBLA 5CXPA 4BI6A 1SU5A 1UA3A 1O5XA 3AS2A 3HPFA 2RHGA 4FO4A 1ADSA 4LPCA 5KMYA 4NJIA 3PFMA 1OFOA 5F2GA 3VD3A 5BOOA 4MPKA 4DJEC 1XIHA 1M04A 3A6OA 3LI1A 3B8TA 4YPJA 4IGMA 4FAMA 5U1OA 1BXBA 1WZMA 3NQMA 1GESA 3S83A 1Q8AA 3A3HA 3H4KA 1MW2A 1JYNA 2CDUA 1L2QA 3LHUA 3CAWA 2VELA 3CV6A 2GVLA 1FWRA 6TAAA 4H9VA 5I03A 3OP2A 1W5PA 3LPOA 4PTXA 5BWAA 4O17A 5ABTA 4LNCA 1VYSX 4JQ4A 3HG5A 4GY7A 1SPQA 1EJ7L 4IJBA 3B3DA 1R47A 3H7VA 3ZT7A 3O06A 3RMJA 3K8LA 1W9DM 3APYA 3AIWA 3TFXA 2V3FA 2HNEA 1GEHA 1HX0A 4NYUA 1C8XA 2CXGA 1KXQA 1IEWA 2WPCA 1F6KA 2OQHA 1JCTA 3WJZA 4FR1A 2NXIA 3OU8A 3ID7A 2WXDM 4JX5A 3A23A 4HPNA 1W1A1 1EZ2A 3UNDA 5DMLA 4ERGA 5DY3A 3WQGA 2EBNA 1QPRA 4ML4A 4QDPA 4OV4A 4GMEA 3S1WA 4YN5A 1V5XA 3WIJA 1FKXA 3CWHA 2CEQA 1A0EA 1VEOA 3DX5A 1Q6EA 1M6JA 4OBTA 1B0IA 1J5TA 1SFJA 3S5OA 3BLKA 4DAFA 3MO4A 2OFJA 3E49A 2V9DA 2FB3A 2X8CA 3WQ5A 1RUSA 5HDRA 3SCNA 2XGZA 5CZ0A 1KR0A 1BHGA 2ZKMX 2GZXA 4Y7EA 3WX7A 5DMYA 2HVOA 4PCTA 3NQFA 1KTNA 4AIOA 4H4VA 5A8PA 2OG9A 3C2EA 5C9ZA 3ELFA 4FNUA 1KFJA 1UWSA 2Q09A 2WMKA 3NEHA 4KIEA 4HU3A 4CQBA 1RQBA 1BGGA 2PCEA 1HG3A 2J4GA 3LPGA 3N2TA 4F0SA 3S5NA 3CMFA 3U7BA 1B57A 4WX2A 2VEMA 2HV5A 1UYQA 4PH6A 4YTTA 4GUJA 3Q94A 1ZCCA 3TVAA 2Z29A 2QEZA 4B91A 3VFCA 4GYFA 2DSZA 4LAZA 1FXQA 2NV1A 2F2KA 1GYNA 3FXGA 5IDZA 1ZCOA 1RA0A 2WHKA 2V5KA 2PDJA 3JU2A 5CG7A 2PCQA 4N4PA 4B9YA 4XKMA 3RLVA 1Z3NA 2E6DA 1VZWA 3E5PA 1FWBC 4QROA 4V1XA 2D0HA 2IQDA 3UPWA 4KPLA 1IQ8A 1XCWA 4TX9A 2QCDB 3F4DA 4L6OA 2J6VA 3B8WA 2IPJA 4HB7A 2VR5A 4ERIA 1M7XA 3KUMA 4JQ1A 3K8MA 3RLHA 4FLOA 2H8XA 2QCEA 2EO7A 3E0WA 4O0QA 2GRTA 5TAOA 1MQQA 3ZO9A 4L6DA 3W38A 1IHIA 2E5DA 2QHAA 4JIHA 1C93A 3T8LA 4HU0A 1WO2A 2CLIA 3GH5A 1E1EA 1SFLA 3O63A 4WZHA 3KVLA 1TE1A 4P2VA 1FWHC 4TVWA 4AISA 2VGIA 4L4LA 3RLUA 1LRTA 3SRDA 3OODA 1US2A 2VD9A 5LXEA 3H55A 4EANA 3ECQA 3GFYA 2WVUA 2R9RA 3PPCA 3W01A 1GSNA 3IUIA 4TVYA 2VOTA 3TUUA 3BJSA 1Q4NX 5J8LA 3CPUA 4D71A 4WSJA 5CZJA 1JNDA 1BQCA 2W3SA 2DEPA 2CU0A 3H4XA 3NIYA 1U1JA 4HYRA 1W9XA 1W2PA 4WSKA 5M03A 1CGXA 3VC5A 3GM8A 4CD7A 1R8LA 3G24A 1ZS2A 4RUBA 5M1TA 4BWLA 2INFA 1OGGA 5F4SA 5E0FA 3VNMA 3CYVA 3WSUA 3NL3A 3AO0A 2YPIA 3S1XA 2YCEA 1YMYA 4QITA 3TXZA 1TPC1 4CQ9A 5CC5A 1BVWA 1NOUA 5FF2A 1XDMA 5I07A 1SO3A 5CSUA 4IF2A 1JRPA 1LQAA 4P8XA 1CDGA 1XH2A 1MUWA 5CBJA 3LV5A 2F6KA 2YW4A 5CGTA 1FEBA 2GGGA 3GG8A 2QCMA 1MUMA 3CUXA 5LNSA 1P1MA 3S42A 4HZ8A 4B16A 2OJPA 4DNMA 4FX9A 4GNVA 4DO5A 1C8YA 1W3HA 3EDJA 2QR6A 4XO6A 6XIAA 2Z1BA 1MI3A 3A7RA 1L8NA 2VT0A 1DWJM 3ARQA 4F40A 2OQLA 1SJBA 2J78A 3C2FA 3T8QA 1GERA 1QASA 3SR6B 4HMEA 3F4WA 2FTWA 1P7TB 5GVJA 3S5SA 1LCOA 1J4EA 3V0UA 3DFTA 4R9XA 3WNOA 4KEMA 3S0CA 4GI8A 1LM1A 3KDNA 1B9ZA 1J0YA 3ZJ6A 4ZFMA 3B0VC 4FXJA 4DJDD 1E70M 7TAAA 3R79A 4M1BA 1GOXA 2DIJA 3I6TA 3OHMB 3PTMA 3VKBA 2A4AA 2BNJA 5U25A 3GDMA 3W1LA 2PWVA 5GNYA 1GQIA 2EEXA 3MI6A 2VFHA 3VIFA 3VGBA 5DXYA 4PTDA 3UD6A 4POCA 1UC5A 3P93A 4HJWA 3UZZA 4IMDA 4GA8A 1BWVA 5I2UA 1O4UA 2PZNA 1QHOA 1Y5XA 3CZKA 4L1GA 1IWAA 1P0BA 4IPLA 3HQ1A 1XD1A 3HQPA 1G9HA 1IXQA 5HWJA 3SM0A 1UKPA 2O9PA 4A21A 2PF8A 2EPMX 3KBNA 1EO5A 3AFBA 4RDWA 1GK8A 3CGDA 2ZZ7A 1E0XA 3OZMA 4LALA 5ABEA 1AW2A 1Q2SA 1EZWA 2XN2A 2ZE0A 1QMLA 1Z9AA 2Y85A 1UH3A 4DPPA 2BLEA 1XBXA 3URQA 4DWSA 3S5YA 1TVLA 1KA9F 1DWFM 3PBVA 1XFBA 3QR3A 3XISA 4PMVA 3LCHA 2BZNA 3IWPA 6PTDA 1TPUA 2Z4GA 3DYOA 2HROA 2OTDA 2VXNA 1FX6A 4LANA 3EWWA 3WL0A 2VZUA 4JFSA 5DLCA 3K13A 2ABBA 3SGZA 1J2BA 4BZYA 1HJWA 1TTPA 4Y9AA 3M5YA 3BLFA 5LSMA 2VEGA 3M6DA 2CCRA 4B3KA 4C6BA 3WQEA 1U2YA 1EX5A 2QPUA 4IIHA 4OGZA 3W7NA 1KXVA 5G5GB 1FH8A 1EB3A 4C6IA 2W6RA 4CNTA 3EMCA 1I2QA 4FI4A 2J7GA 4PBEA 1H1ZA 4HTYA 4FOKA 2GGJA 1QWGA 2VZSA 1UR9A 1UUMA 3OEXA 2JEQA 1JOAA 4IZGA 1QOPA 3ZSTA 3Q37A 4ADTA 3H22A 8RUCA 4NAFB 4ZENA 3A7UA 2NW0A 2YAUA 1B2YA 3R8HA 1Z32X 1RAKA 1EF3A 3FK4A 4YVVA 3DGZA 2TYSA 1WZLA 3HURA 4S3DA 1EDQA 4UFKA 3VM5A 1LZOA 4KIRA 3W29A 2A3EA 2Z1VA 4MGGA 3NQ2A 3QPEA 1PIGA 4TTUA 3A24A 2VRJA 5EBKA 3BSGA 3CBWA 3MMUA 5HBFA 4LU0A 3VTRA 1W3NA 2PD9A 4N9DA 4CNPA 3FS2A 3EEZA 4JTDA 4LYPA 3SSJA 4ZTYA 2XIIA 4IQJA 3STPA 4RPPA 3WDRA 3D6NA 1OEPA 1YBQB 4H8VA 1SQ7A 1GORA 1SJCA 5D09A 5FOOA 1RCQA 1L6WA 4DN1A 4H1ZA 3W2KA 5IM51 1Q2RA 1JCYA 3TFCA 3EANA 3PK7A 1AA1B 1O7AA 5FAJA 1LLOA 3VMNA 1GZ1A 2CWNA 2E6FA 1H7PA 1GVIA 1XIFA 2DP3A 1ZP4A 4TO8A 4P61A 3VDAA 4JDBA 2VQUA 1X6NA 3LK6A 5EMKA 5IFTA 2O92A 5J5RA 4IL0A 1R85A 4Q6XA 4J4KA 1XLAA 1FFVC 4NU7A 4H4PA 1DXFA 3M0KA 3AYRA 3O7UA 2NQJA 4MSSA 2AQVA 1V08A 3A3XA 1KKRA 1Y8BA 2QJHA 2Y1HA 3W25A 4L9ZA 3HGOA 4Q8NA 3UPMA 3WK2A 3BZGA 3GR7A 3LD5A 4JHZA 2I1OA 4JR5A 1JG9A 3PSWA 3H12A 2X2YA 4TIMA 3DFSA 1GT8A 4M6QA 4H9YA 3WLKX 3H2AA 1XRVA 1IE7C 3E0LA 4MHBA 1TWIA 5F1UA 1X2HA 2HVMA 4IQLA 4CQ8A 2IKIA 1WKEA 3BGJA 4Q8OA 2G95A 1EEXA 3QY8A 3E6EA 1FP8A 3GXMA 3OJGA 3UR2A 1KBKA 2POZA 3W53A 2F6UA 4ZBCA 1EQCA 4JXCA 1OY0A 1R2TA 3UG3A 4MAVA 5F2IA 1GOOA 3OVQA 2WLZA 2DSVA 2OWWA 1FDJA 3TXVA 1XXXA 3WMLA 5LIXX 1ZTVA 4OWGA 5DO8A 4CU7A 4LF1A 4XAFA 3V5OA 4HJFA 3HFTA 3LMZA 3RO8A 4I5UA 3USBA 4IMCA 3P3BA 3MV01 2WSKA 4KEZA 3ZR5A 1BEUA 4IIFA 4DB7A 3SN0A 4AHPA 5I09A 1GCYA 3BAKA 3NVDA 4QQ3A 3B0YA 2UZ9A 2H3BA 1ZX9A 1EXBA 2WV8A 1PHQA 3HG3A 4FXFA 3W2MA 3WQOA 5LIYX 2J77A 1HP4A 2Q71A 3UPBA 3NAVA 4I9AA 2AMGA 4RZBA 3FYYA 3OG3A 3N2OA 1H1NA 4DELA 4GYPA 4H4XA 3ONBA 1UD2A 4J1OA 3ANUA 5A8QA 4BURA 2ACSA 4PODA 4D6GA 3ZVHB 4H6EA 2VHLA 3NZQA 4JTRA 1XIIA 2RGMA 1GRAA 2ANUA 3W83A 3SW6A 1B1YA 1M7PA 3OQEA 3VA8A 4EE9A 5D2VA 4LVBA 1TKKA 1VBRA 2F7FA 4PN2A 3RM8A 2DJLA 3T9PA 2RUSA 1IXNA 4JFTA 1PIIA 4JKKA 1PCWA 1Z8AA 4RX0A 3NSMA 4MWAD 4O1FA 3N4EA 4F8XA 3GVWA 1I75A 3B9NA 1W9VA 3WO8A 2DU2A 4AB4A 4YTRA 3TTQA 1BVNP 4AMCA 1FFRA 2JF7A 2OO6A 3BG5A 4UTIA 2VP8A 4H4QA 3PP7A 2Y7GA 2NXHA 1EUAA 3AMCA 3R12A 1VRXA 5ECUA 1XIBA 2VX7A 2PDYA 3QV7A 2J6XA 1IF2A 3OZPA 3NEVA 4JYDA 1XIEA 2QCNA 3T08A 4CQCA 1T7LA 4AZ6A 4L64A 4IFKA 1RR2A 4BF9A 1GRTA 1CXHA 1ISWA 2BTMA 3DDMA 3FVDA 3P62A 1TYGA 1T41A 1OYCA 2XU2A 4DJDA 4MKNA 1DPMA 4N9CA 3A64A 3AXIA 3LLDA 3WJXA 5E0CA 3KOFA 1UKOA 3MKVA 4U2YA 3VOHA 2Y8KA 2V6OA 2P5NA 1DXEA 3BSHA 5FF3A 4GX9A 3W4RA 3CHCA 3G1DA 1ODUA 4ZB5A 1CGVA 1LTDA 4LS0A 3ENLA 1GQNA 2PDHA 3LXAA 1S2UA 4UQBA 1MW0A 4L7ZA 1EGZA 1H3GA 1K3UA 4JTFA 1JNEA 4GY1A 3ABRA 4IXHA 2YOCA 5DMNA 4KWWA 2X0HA 1DJNA 1S3HA 1XC4A 4L56A 4US5D 3N4AA 1KCKA