4G8TA

Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target efi-502312, with sodium and sulfate bound, ordered loop
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
441
structure length
441
Chain Sequence
STPIITEMQVIPVAGHDSMLLNLSGAHSPYFTRNIVILKDNSGNTGVGEVPGGEKIRQTLEDAKPLVIGKTLGEYKNVMNTVRQTFNDHDAGGRGLQTFDLRTTIHVVTAIEAAMLDLLGQFLGVTVASLLGDGQQRDAVEMLGYLFFIGDRKKTTLAYQNQENDPCDWYRVRHEEAMTPESVVRLAEAAYEKYGFNDFKLKGGVLDGFEEAEAVTALAKRFPDARITLDPNGAWSLDEAVKIGKQLKGVLAYAEDPCGAEQGYSGREIMAEFRRATGLPTATNMIATDWRQMGHTISLQSVDIPLADPHFWTMQGSIRVAQMCHEWGLTWGSHSNNHFDISLAMFTHVAAAAPGDITAIDTHWIWQEGNQRLTKEPFQIKGGLVEVPKKPGLGVELDMDQVMKANELYKSMGLGARDDAMAMQFLIPGWKFDNKKPCLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucarate dehydratase
publication title Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target efi-502312, with sodium and sulfate bound, ordered loop
rcsb
source organism Actinobacillus succinogenes
molecule tags Lyase
total genus 150
structure length 441
sequence length 441
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4g8tA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4g8tA01
3TCSA 3CXOA 3SN4A 5FJOA 2FYMA 2PTXA 1EBGA 2PSNA 4H2HA 1WUEA 4ZA0A 4DXKA 1ELSA 1W6TA 3EEZA 3PWIA 3ZLHA 3U4FA 3SSZA 1SJDA 5FJUA 3JW7A 1PDZA 3JZUA 4MGGA 3ZLFA 3IJQA 2PA6A 3MZNA 4M6UA 4KPLA 1L8PA 2QDDA 3GY1A 2OQYA 3VFCA 6ENLA 2HXTA 4E6MA 3ENLA 2AKMA 4HCDA 2AL2A 4E4UA 4JHMA 3MUCA 2PODA 2OX4A 1R6WA 2GGEA 4FI4A 3FCPA 3RGTA 4G7FA 3ES7A 3CB3A 4YWSA 2AL1A 2RDXA 3NZGA 3ZVHA 2GGGA 4MKSA 5J04A 1FHUA 1P43A 3VCCA 4EWJA 3KUMA 5FJPA 3DG3A 4HYRA 2ZC8A 4K1WA 2QVHA 3DFYA 4IP5A 1JPDX 4DN1A 4H1ZA 4Z1YA 1P48A 2GGJA 1XPYA 3ZLGA 3V5FA 1KCZA 1ECQA 3R10A 4HPNA 2I5QA 4GFIA 2GSHA 1SJCA 3DEQA 4GISA 4HCLA 1RVKA 4DHGA 1MUCA 1KKRA 3VC5A 2OFJA 3BSMA 2MUCA 4DYEA 3B97A 3TQPA 1MDLA 3I4KA 3JVAA 3PFRA 3VC6A 2QJJA 2AKZA 3FYYA 1MDRA 3EKGA 4JN8A 3S5SA 2QJMA 2P8CA 3NXLA 3BOXA 2GDQA 2XGZA 4JN7A 1ONEA 3N6HA 3FVDA 2OZ3A 4HN8A 7ENLA 4IHCA 2P3ZA 4IL0A 3UXLA 1SJBA 2P8BA 1YEYA 1DTNA 2P88A 3H7VA 3V5CA 5BOEA 3Q4DA 3DGBA 1EC9A 2AL2B 2XH4A 3D46A 4HCHA 2DW6A 2PTWA 4Z17A 2HXUA 3R0KA 4MMWA 1TZZA 3H12A 2QDEA 3OW1A 3TOYA 3TTEA 3CT2A 3OP2A 3TJ4A 3I6EA 2OZ8A 4IP4A 2PGWA 4M0XA 4F4RA 3DDMA 3UJSA 3SBFA 2QJNA 3N4FA 4DWDA 3OTRA 3T8QA 5FJRA 3UJFA 3T6CA 3DERA 3H8AA 1XS2A 4GIRA 3DFHA 3GC2A 5FJTA 4ENLA 5ENLA 4E5TA 3OZYA 3R1ZA 4K8GA 2O56A 1TKKA 3UJRA 2POZA 3V4BA 3K1GA 3S47A 1PDYA 2OKTA 1EC8A 5BOFA 3DG7A 2GL5A 3CK5A 2P0IA 4E4FA 1MNSA 2PGEA 3PWGA 2PMQA 3GD6A 3GO2A 2OZTA 2PP3A 3H70A 3RCYA 3MKCA 4IZGA 2FKPA 3MWCA 3HPFA 3QPEA 1E9IA 2OLAA 2OO6A 3SN1A 3R0UA 1MRAA 3IJIA 1JDFA 3RR1A 1JCTA 3N6JA 3FV9A 2XH2A 3TJIA 3DESA 3CAWA 3ES8A 2HNEA 1BQGA 3N4EA 4DX3A 3MSYA 1EBHA 3IK4A 3R11A 3SQSA 3VDGA 1JPMA 3OPSA 4KEMA 2GGHA 3FJ4A 1SJAA 2HZGA 2OG9A 4A6GA 4J3ZA 2PS2A 3TWAA 1R0MA 3UJEA 2GGIA 3THUA 4FP1A 4H83A 4E8GA 3QKEA 4KWSA 3RO6A 4IL2A 3OZMA 3RITA 2ZADA 2NQLA 3QN3A 2XSXA 3ZVHB 2DW7A 3SJNA 2PCEA 4H19A 3QLDA 3UJ2A 3R25A 2PTYA 2CHRA 1EC7A 3PK7A 4GGHA 3UCDA 3UXKA 2OPJA 4J1OA 3ZVIA 3P0WA 3Q45A 3QTPA 2XH7A 4HNLA 3BJSA 3NFUA 2PPGA 3VCNA 2PP0A 4G8TA 3UCCA 3I6TA 4A3RA 3TWBA 3UGVA 3V3WA 2QQ6A 3NO1A 3D47A 3MY9A 3T4WA 2XH0A 1OEPA 2PU0A 4GYPC 5IDZA 3T9PA 1TE6A 4GGBA 4K2SA 4ZCWA 3P3BA 3P93A 4IT1A 1KD0A 3MQTA 3DG6A 3RRAA 1NU5A 2PP1A 2PU1A 1FHVA 1KKOA 2QGYA 2OQHA 3FXGA 1WUFA 1NELA 3IJLA 4ROPA 2PTZA 3TW9A 5EU9A 3SN0A 3CYJA 3U9IA 4GMEA 4KT2A 3DIPA 4GYPA 4HNCA 1F9CA 1IYXA 1BKHA 3VA8A 4A35A 2OVLA 4X2PA 2ONEA 3STPA 2MNRA
chains in the Genus database with same CATH superfamily
1SFJA 4UR9A 1JG9A 1EHNA 1UR3M 1AL8A 4IUGA 2WCAA 1NDAA 1XC4A 1MUWA 1VYSX 1IEVA 4JAWA 4TVUA 3PWIA 1QNQA 1B3ZA 1SJDA 2A6LA 3GVRA 1TCMA 2H6RA 1LTDA 3PF3A 2Q3RA 4PRTA 1AZ1A 1FCBA 2PA6A 1P1XA 2I7GA 3RO8A 4ORMA 3G1RA 2CBJA 3OVRA 3VPLA 5F4XA 4EK7A 1XI3A 2QEZA 4Z2KA 2HXTA 2HVMA 4FXFA 1N5WC 4X22A 3ENLA 3KS6A 1SR9A 3RX3A 1NDWA 3OA3A 1RD6A 5C9XA 1EWDA 3LLXA 3NZ1A 4H4XA 4IOTA 4I8YA 3WK2A 4QISA 3PZQA 4BQ5A 2JKPA 1PCKA 1E15A 2QGHA 1H6VA 2NWRA 3P61A 2F7FA 2VT0A 4MKSA 4YL2A 1CECA 3FAWA 3W82A 5I3GA 4W85A 1M6JA 1SGJA 4NAFA 3Q67A 2CZEA 5G1TA 3GNNA 1GZ1A 1OFOA 4GUGA 4PMZA 1IXNA 1JPDX 2QW5A 3FX4A 2WM0A 1D7YA 3BLDA 3N14A 3BZJA 4QG9A 1B54A 3KCLA 3CUHA 4GKTA 3SUWA 4S2BA 3ZLGA 1F2JA 4CNNA 2REQA 3N18A 1CNVA 2BGNE 3A7RA 1RQEA 3W2JA 2J3NA 4QJ4B 1E3ZA 2UZ9A 3VX1A 3O0FA 2QUUA 3DEQA 1EL3A 1X8FA 1CGXA 4LAOA 2ISSA 3WLQA 3C2YA 3WK1A 3E0VA 4AVNA 5HMFA 2H8XA 3RYSA 3ITXA 2ZUUA 1Z48A 1AOGA 3VKKA 1MDLA 5KZDA 4D8LA 3PFRA 3VC6A 1AODA 1MDRA 3ALFA 2O92A 3TYUA 4GC3A 3UZ5A 4WJ8A 4X0VA 3CHEA 3CGBA 4XZ9A 5I3KA 4H9UA 3CUIA 3ABRA 3AU6A 2Y70A 3UG4A 4C7FA 3TYDA 1LWIA 2PDFA 4QJ5B 5TNVA 3Q2DA 2OEKA 3TP4A 1J10A 1QTWA 4OOZA 1FWRA 1VEPA 3IS4A 4Q4PA 3G8EA 3MV01 2NVAA 3FLUA 1MZHA 3CUGA 3IIVA 3MBFA 1V0MA 4MFDA 1TPUA 3E0LA 1BRLB 4FB7A 3PSVA 1GYLA 3BCFA 2R6OA 4U33A 2DZPA 1U5VA 2X2YA 2OZ8A 1B0IA 1VP5A 4M0XA 3TN5A 2HEJA 3MZ2A 3PC0A 3E3HA 1QO2A 1JF5A 3SI9A 3ANYA 4PGLA 2PRHA 2UY2A 5CSUA 1SSGA 2GVJA 3D3AA 3LM7A 4J3VA 4DM1A 1TZ7A 4AF0A 2NQJA 3RILA 4ADTA 4XTIA 3CL7A 1L9WA 2XIBA 1B30A 1E0XA 4ICCX 4GNVA 1QPKA 5DBTA 5BWFA 2HVOA 3QMSA 2Z28A 2WPBA 2WWDA 4M6PA 1JRCA 2FTWA 3A4XA 1OABA 3KM8A 1EC8A 2WC3A 3VGBA 4N2YA 1B3VA 2IKJA 1VQTA 3WEMA 2ZZCA 2TAAA 3SGGA 1E51A 4JDYA 3TAKA 2PMQA 1XINA 3I65A 1DJZA 1EOKA 1K9EA 1TA3A 3HMCA 4LUJA 1TIMA 2OGJA 5DBUA 3CIVA 4IZGA 4TU1A 2E8ZA 1KFLA 4PCSA 1VLWA 3NQBA 5JBFA 4G7EB 2ZX7A 4QITA 2C14A 4GCXA 1G1YA 3LX9A 2OSYA 4DYJA 1LM1A 3HFTA 4WY0B 3OJGA 1GRFA 1X2GA 1E1CB 2OJPA 3WIJA 3EGJA 1F6YA 1E6RA 1LUCA 2XG9A 3CHVA 4JIHA 3CL8A 3Q65A 2VGIA 1R86A 2OG9A 3L4WA 3NM3A 1K03A 4Q4SA 4WJEA 1OJTA 1ZL1A 3EX6A 3SY1A 4M1BA 3CV1A 1DJIA 3L7RA 3QKEA 4H4RA 5I77A 3AXKA 3QGAC 1EPVA 4MDPA 2VFDA 4ZVJA 1KXTA 2PLKA 3GXTA 3T0BA 3IEBA 3HO8A 5M17A 4DXVA 2Z2BA 1ZU8A 3TTYA 4AAJA 2DT1A 5K9DA 2G3MA 4Q7IA 5EY5A 4B5WA 2ACSA 3C61A 4HMCA 5KVHA 3PPHA 4KCUA 5HQMA 4NX5A 3P0WA 4PFHA 4TO8A 4AY1A 4D6CA 5LA1A 4MTVA 3Q45A 3W25A 9XIMA 5CCZA 4ZXOA 2YBUA 1LLOA 3B3DA 1VD6A 4UFLA 2WKLA 3NO1A 2DVTA 5G1YA 1OB0A 3MWAA 1E1EA 3GFXA 1H7WA 3PZVA 3W83A 1E9YB 2DZWA 4AEFA 4AX6A 1DHPA 4JHZA 1KD0A 3UY8A 5TQLA 5CPOA 3PBUA 1VPXA 2OQHA 4ZB5A 7TIMA 1KGUA 2IUZA 5HK4A 1Q1RA 1X7FA 5RUBA 3PJWA 1H62A 1PCWA 1WAUA 4DO4A 1UCWA 3SCSA 2AGTA 4XKYA 7REQA 1BKHA 1TR9A 4V2XA 1ZJIA 1S46A 4X2PA 3G8RA 1SFLA 3STPA 2MNRA 2RH9A 3I6RA 4A8NA 4PUWA 3HA1A 1A0CA 4AXNA 4GE8A 2P10A 1F4HA 3C2VA 1UBSA 2F8QA 2VNCA 4OWGA 4IH3A 3B4YA 3KZSA 5BU9A 1Q6QA 1H0GA 3W7MA 1XYLA 3CV6A 1SO3A 4Z1CA 1PKNA 1V8EA 3MANA 1OCBA 2E25A 2PDQA 4O16A 4E0CA 3EA3A 4Q8NA 2VEPA 3WDIA 1W37A 1GKQA 3G22A 1KBKA 1TO3A 1UW9A 1H3GA 3VD7A 1A5NC 1FWCC 3WD2A 3F4WA 3H7UA 2GLKA 4ZR8A 1HL2A 3FCPA 4YHEA 4PUKA 5SWUA 1J0JA 3GD3A 4AH7A 3LHYA 1QPRA 4UB9A 4CCCA 2AL1A 4QAIA 1M1BA 3VGHA 4KWVA 4RK8A 4Z2GA 1XLCA 3WL1A 1FHUA 4XZBA 4A3QA 1DL3A 5HBFA 1M68A 3KCJA 4IP5A 1RXOB 4EQXA 2QLYA 5E6YA 4AZ7A 4DUWA 1QRQA 4FOKA 1P48A 3L67A 4IG2B 5HR7A 1DOSA 1UA7A 3CPRA 2Q8XA 4A4AA 1JZ6A 3HTWA 1PVNA 3PUOA 4XZIA 2G41A 2ZUMA 4LIIA 3LG3A 4JTLA 3WMCA 4J56A 4J3UA 4QTGA 1GJWA 3TONA 1CYGA 4AIUA 4FIRA 4ADWA 2CZDA 3TR9A 3N17A 1QASA 2HBVA 2VX7A 1JROA 3HOJA 2C19A 1KXHA 3ANUA 2J6XA 2VOTA 2WZHA 1OX4B 3EDFA 3TJXA 1K8XA 1V77A 4FR6A 5CSYA 2V3DA 2Y2WA 1BXCA 3L23A 1YNYA 3VIOA 2J6VA 2OZ0A 4JN7A 4OIFA 1M7JA 1QOXA 3WKZA 3WEOA 4D6EA 3IC9A 3UA4A 1JQVA 1E1FA 1KLYA 2XUCA 2XFYA 1PPIA 3NR0A 3M0HA 3I7QA 1C9DA 2CU0A 1YEYA 1DTNA 4RXGA 3SURA 3TZNA 4MNJA 3T81A 2B7NA 4F0MA 2GRTA 1KM1A 4ICNA 1TPB1 4IF2A 3U5YA 4H01A 5HPOA 1EF3A 1D9EA 3CMGA 4MMWA 3TDFA 1TZZA 3AMLA 1JQXA 3EMCA 1KB3A 4C1NA 4RZ5A 3LHWA 2Y8KA 1C7SA 1TV8A 1GHRA 1SMAA 4LA1A 3KL5A 4NASA 3P80A 2J27A 2WZIA 3NVDA 4MUZA 5CGMA 3VKAA 1UR0A 3WQDA 3W4RA 2NVDA 4C6FA 1OFDA 4DJED 1U1JA 4DYKA 7ODCA 1M9HA 3R0DA 3T55A 1FBAA 5AZ0A 3L5LA 4O1AA 1GQKA 1J2WA 3PJTA 3S47A 4XAFA 2V38A 1RP9A 4LEQA 3L5AA 4DNMA 3KBVA 1FUYA 3MUIA 4IX2A 3VD5A 5FAJA 3QSTA 4GI6A 4M3PA 1PZ0A 3Q6JA 3TAOA 3RX2A 1K9FA 1V4YA 2VTFA 5BROA 3O3RA 3GG7A 3CMJA 1E9IA 2YA0A 3SUTA 5AYZA 3AUOA 3MU7A 3FW6A 1CGYA 3MA8A 5DANA 3CAWA 2GQAA 4JKKA 4PMJA 5EMUA 5XIAA 3VVGA 1KTBA 2CLHA 3W73A 3IK4A 3GH4A 1LQAA 1HJUA 2GOKA 1V3KA 3FIGA 2QCNA 4JD4A 3QGKC 3BGGA 4O18A 1RD5A 2HZGA 4LU0A 1E6NA 2PDLA 2V82A 4QM1A 4KMQA 1XYZA 4GVIA 3UD6A 3QQWA 1CGTA 1BWLA 3LENA 2ZRYA 4C6QA 1L8NA 3II1A 3PHAA 1KXVA 3KVJA 1B4KA 1S5VA 3ARRA 1EP3A 1YTDA 2DZTA 5JVLA 2YGYA 3PTKA 3QN3A 4MYXA 3AJ7A 4PBGA 2B31A 5DY3A 1VHCA 4GYFA 4GJJA 3NQCA 2IPWA 1F05A 2DJXA 3MKVA 1MO0A 4ML4A 1PUDA 3AMKA 3R58A 3BV4A 4JFVA 3RFAA 3UBPC 3E0FA 3L2IA 4LVGA 2HROA 1Q13A 4DO5A 3L65A 2ZCGA 3R8HA 1O95A 4ACZB 2WVSA 3P84A 2JEPA 4O10A 4B3ZA 5LZLA 3E2SA 1PSCA 4LAKA 1PYFA 3HGRA 2NLIA 1U2YA 4G8TA 4E3VA 4DNHA 5FI8A 4N4QA 1HJWA 4UBPC 5KSWA 5CBIA 4GNKB 2B7OA 1VZWA 1SO5A 2EEXA 4I3GA 3LXBA 4W88A 4IPJA 5EL1A 3LS9A 1UB3A 1EJ7L 2PWUA 4QROA 4TOQA 4OKDA 2PP1A 4JICA 2QGYA 3V0SA 5D4YA 5AC5A 3O6DA 1H4PA 4YWIA 3WMBA 5GVJA 4DJDC 2JGYA 2B7PA 2C1IA 3WD3A 5AHEA 4HYVA 4F48A 3R7MA 4R9OA 3NA8A 3WJWA 4XD3A 4V1YA 3ATZA 3BMXA 3F4VA 3F5KA 2WQDA 4R33A 4ZQNA 2QV5A 3CV2A 4BK9A 3LN3A 4UFKA 3QSRA 3VA8A 4NXSA 3SCNA 1EX5A 1JDDA 4H2HA 4UQEA 4REQB 4CD5A 1TYTA 4HZ8A 5CGTA 1RJPA 3SSJA 5FJJA 3I10A 2KAUC 3K4WA 3LD5A 3XIMA 4XZLX 4ZODA 1MNZA 1Q6FA 2QJIA 2OXNA 3FAXA 5C9WA 4LTSA 5AC8A 2NXGA 4KEUA 3IUDA 2V5CA 4JTCA 3A47A 5LNSA 1HXJA 4U28A 1L2UA 3ARXA 4C90A 3E2QA 4O8AA 2FGLA 4Q22A 3VNYA 3URAA 3NTYA 5LHFA 5AYYA 4NQ1A 3PM6A 3DI0A 2WHJA 4LEFA 3NO3A 4J9JA 1GVRA 1GGOA 3FA3A 2GGEA 3CZJA 4K1GA 1HFBA 2O4QA 2BY2A 4UC5A 3UU0A 4D6JA 3O0HA 2NX1A 3CB3A 4DJDD 1TPH1 1D7KA 3ZT6A 3DJGX 1S3HA 3F5JA 3BXWA 3BAYA 1W2VA 1VFHA 5DRCA 1Z32X 1BF2A 4DBDA 4HYRA 2BHUA 1S39A 1FP8A 3HF3A 1I2OA 3E1F1 1BWKA 3OGSA 5HMDA 4H6EA 3L21A 2VURA 2VZTA 3QKZA 1TVLA 3PZNA 2HK0A 1LL6A 3MS8A 1OFBA 1NOFA 1W32A 2VEKA 2W91A 1TWDA 1JZ3A 3B40A 3M5VA 1XLJA 4PEKA 3A6OA 4FF7A 3W00A 3EXSA 2QF8A 1US0A 4MFEA 4DHGA 4FF5A 1MO9A 3VC5A 4PE8A 3I3BA 1QI2A 4DYEA 4O1CA 2NVKX 4EACA 4D6GA 4FNSA 2Z1WA 3OC4A 3W88A 3WNNA 3LRMA 5CBBA 4ZSUA 2VR5A 3IV8A 4O8RA 1J18A 5L9FA 2WVVA 1TR1A 2FVMA 5BRQA 3TC7A 1OFPA 3IIZA 2PF8A 3N6HA 4HN8A 4ZQMA 2P3ZA 1E9LA 2VDHA 2FHCA 2QAFA 2YZRA 2IPJA 5GPRA 4UTMA 5GNYA 3RLHA 4PL1A 3DZ1A 4PUEA 4DLFA 4AHQA 3FYOA 1BSLA 2AL2B 4HCHA 2A5HA 4HA3A 1R87A 1SZRA 2VZSA 4CQCA 1CIUA 3SY8A 2VM8A 3OODA 5CKSA 1GW9A 2YL9A 3MHGA 3WF2A 1ZS2A 2EO7A 2XZ9A 1HKVA 4WQ6A 4AZCB 3UQNA 1CBGA 2Z27A 1ZK7A 3VMNA 3MI2A 4ZO6A 4TMBA 5CH9A 2XIQA 3EKLA 4WGHA 4CGTA 3OZPA 1EZWA 3I4EA 5JCLA 2P50A 1OYAA 3RAOA 4PYSA 2VC5A 4FLOA 1CCWB 5C9RA 1FY6A 2W5FA 3BVJA 4JN6A 3FK4A 1JPHA 2YBVA 1IWAA 3G1HA 4IMFA 3W2LA 2B0MA 1ZBVA 3EEGA 4IP7A 2O56A 4LBSA 4C6IA 2G50A 1UZ4A 1VFLA 4CU6A 3GX9A 3ARYA 3SEPA 3UYIA 4ECLA 4PR4A 5JRBA 4R85A 1OQFA 1OX6A 3WH8A 3C5QA 3OQEA 5EMJA 2W66A 5FS8A 1IIGA 1JZ8A 3V35A 4Q8WA 5LIXX 3GD6A 1E6QM 1ZCOA 3ZJ8A 4FHAA 3W02A 2HK1A 2JGQA 4PUMA 3AXXA 3SZ8A 3EDKA 3AMDA 5LNUA 3QPEA 1XF0A 5K9CA 1T96A 2RFGA 4Z0SA 2WJEA 3MHUA 1V97A 4H9ZA 3LK6A 3WQ8A 3L4YA 3L68A 4PCPA 4O0ZA 1Q6OA 3W7KA 3GDBA 2BS9A 2PC8A 3EZ4A 2ISWA 3SRKA 3ITTA 1UHVA 2A6NA 2FPTA 1POKA 3VDGA 4ZQCA 3GXPA 3TSMA 3WFAA 3NS1B 2DU2A 1E4MM 3BAJA 3EWBX 2X50A 1Q45A 5D03A 4HSNA 1IT0A 4GIAA 4M52A 2W79A 3QHNA 4LVFA 2Y5JA 4GZJA 1K4GA 1F3WA 3K4DA 1LL7A 3VMPA 4O1BA 3HMJG 3WH6A 4CCEA 1J0ZA 3G1DA 3BLLA 3RDKA 2NQLA 1FWEC 4WEVX 1X38A 2PDWA 2GUYA 1CLXA 4G6CA 1IXQA 3PTMA 5G5GB 4NJIA 2HCVA 4IMCA 4AD1A 1L0PA 1M7PA 3WQCA 4F0RA 3VD3A 3GVQA 2GWNA 4JTFA 3CHDA 3A64A 5D9OA 2PZ0A 6A3HA 2C6QA 1EHAA 1E4NA 1KV8A 4Q8MA 3O2LA 4NHVA 1W5QA 4JYEA 2I17A 1XV8A 3QTPA 5F2LA 4HNLA 4M19A 5AHFA 4BF7A 1QI4A 4CQ8A 4D6HA 2B4GA 3GG1A 4FOUA 3CL6A 2EQ6A 5AY7A 1R2SA 2WMIB 1A3HA 1PTGA 3HV9A 4H4IA 3PBMA 3V5OA 5FD0A 4JQAA 1J0IA 1K8ZA 4LBUA 3PTDA 4UR7A 4LB3A 2QUTA 4Q4QA 3P3BA 4DBUA 2D2OA 5A6BA 1NP0A 4UTWC 3CUJA 2VDGA 2GK1A 4LJ3A 1WXJA 4BZYA 4ZFCA 5DMYA 4R3UA 3DGZA 4MKNA 4W7WA 1HNYA 1VJIA 2PTZA 4K8HA 4NAEB 1CGUA 3SN0A 4AWUA 1MYRA 1KQYA 4B9ZA 3NEHA 4BY3A 1OYBA 4GYPA 3ARVA 4EXQA 5CZ0A 5A2AA 2ZXAA 3KVKA 3NDZA 3T08A 4LRSA 3S2CA 3L4VA 1PZ2A 2FTYA 1RY8A 4G7EA 4YCPA 2QF7A 3I7SA 8CGTA 3N19B 4IMGA 4HK7A 2CNCA 1V0NA 2BVDA 4AFYA 5JCIA 3IIXA 2NZLA 4PTXA 1E4IA 4RCXA 4MPKA 2BFGA 1ISZA 1E1CA 3LB8A 3NCOA 4UTTC 4HKPA 2DH2A 3DUGA 1STZA 1XDLA 4RDZA 3TYEA 2QDDA 5HJXA 3CGTA 4M7SA 3WLLA 1WBJA 1RBOB 3FSUA 4E6MA 1R9YA 4OT7A 4WXYA 1H2JA 3B8WA 4N7QA 5AB3A 1K8CA 2DY3A 3DECA 3WF4A 1AH0A 4KCWA 5H8PA 4ZMGA 2ZUTA 5HATA 4AVFA 4U5IA 2W63A 4CNPA 5FF0A 4FR1A 3B8IA 5U7SA 3N1AA 3AIUA 3LHTA 1W5MA 3QFEA 3E2RA 3IUHA 3M0XA 3AFBA 1DE5A 3WJZA 5JH1A 1YPIA 1LJYA 4NZ5A 2ALRA 1J93A 1FWDC 3AWNA 2OWXA 2YDAA 2GUBA 2EHHA 4S3EA 3MBDA 4BHYA 2VUYA 3H26A 3VUSA 3SAZA 1NWUA 1MRQA 1W1PA 4IQLA 1TYGA 1LWHA 1TJ2A 3U0HA 3WLMA 2NV9A 3BURA 3E74A 5U4NA 3CQIA 1D2KA 1FXPA 2G3JA 4CKQA 4PTNA 3CXBA 1DWFM 3JVAA 1LCOA 3P8IA 2CHOA 3IVTA 3W07A 3PZMA 2QJMA 4D8AA 1XLKA 3LHZA 3BOXA 3M6YA 4Q8OA 3BLOA 4D6IA 5MHBA 3OBAA 3E0IA 1YTKA 4KIRA 1E43A 7ENLA 3VOJA 4M82A 3APYA 1TZ9A 2ON3A 2POTA 1CXLA 3EYPA 4A3YA 1G4TA 1HO1A 4J3WA 2VFIA 2E3ZA 3M5YA 3H7VA 3Q4DA 1R3SA 3DFNA 2XH4A 2F5ZA 2IKGA 3K8LA 1KFKA 3OA5A 4WX2A 4EF9A 1GKRA 1TPDA 3TJLA 1EYEA 3SR7A 1VR6A 1XLDA 2Z2AA 3OP2A 4N9EA 5DT5A 1R2RA 1KFBA 3MYPA 4C5ZA 3W7CA 4ERGA 1EDGA 2PWVA 1DVJA 4ES4A 4QS5A 3G2GA 5BNKA 1IF2A 1YE6A 5LA2A 3LUTA 3Q37A 1E4LA 1A0EA 5CXPA 4JS3A 4GY7A 4Q8TA 5PTDA 1M53A 2Y4SA 4Z2IA 5I2UA 2Q09A 1TB3A 3NG3A 4AIOA 4PC8A 2YCKX 2QJHA 4QLJA 2HNHA 4E2OA 3AYRA 3QVQA 2QIWA 1FH7A 4AY8A 2GJLA 4HNOA 1QW7A 3VMOA 2YCJA 1KM2A 5E0CA 5HNUA 4WKFA 1PDYA 3RPDA 1UA3A 3WFZA 5BOFA 3GTIA 4QEEA 1CENA 3WF0A 6CGTA 2GL5A 4GOAA 1ZBKA 4YXGA 2BWGA 2X1RA 4FXJA 3PWGA 4FZIA 2WANA 4J5NA 1YNQA 3ZMRA 1LT8A 3MHFA 1QBAA 2ZZ4A 3MKCA 1X2HA 3QV6A 3MWCA 2NXIA 2GOUA 1AUSL 2VGGA 3L12A 3WLKX 4XD6A 2I14A 3FXYA 4IG2A 3QYQA 1JCTA 4C6JA 4FDCB 1JYVA 4QQUA 3MCOA 1ODZA 2GJPA 4GUIA 1KM4A 3OLDA 4HBKA 3BMWA 4ADSA 4AHPA 1XCWA 3PG8A 4KETA 3H6OA 2OWWA 1X97A 3IGXA 1UWUA 2P0OA 5I5RA 3N73A 4JIIX 2NUXA 3FA4A 1OCNA 4OE7A 5CJ5A 1OC6A 1LDCA 3L0NA 1OX4A 2PS2A 3W86A 1XCXA 5MF5A 4NILA 3VE9A 3NYZA 3E49A 3WQFA 1FCVA 4LVBA 3RITA 2AGKA 3KHDA 3PZ9A 3DU0A 1HIZA 3FJLA 4TTUA 2QCCA 5K7JA 1MI3A 3LSBA 2DIKA 4CD4A 4V28A 3M0LA 3HPXA 4LXFA 4EPDC 5T9CE 4Y9PA 3GE7A 4K68A 1J0KA 1EC7A 4UNIA 3VOIA 1HP4A 1F8IA 1Q6RA 4P7LA 2VQTA 1T3QC 1ONRA 5F7UA 1F6KA 3UPMA 3N3MA 3PBWA 2XWDA 3MV11 1RCXB 3EX1A 3BG5A 4CNSA 1E56A 3U2OA 1LOQA 3AS2A 3IAPA 2ZDSA 1GOQA 3W29A 4UQBA 1XIJA 2A3AA 3BARA 3MP5A 1XD1A 4A3RA 4GKLA 3D47A 3C8NA 2ZZ3A 5E9XA 2AQVA 1EDQA 5FS7A 4GXWA 1TMQA 1V03A 3NSMA 1BTCA 5I09A 3M7WA 5DF0A 3EDEA 1DPMA 2RDUA 2BP1A 3LBMA 1ZNNA 1ZAJA 1RK5A 4UR8A 3IACA 5CEWA 3C52A 5DEZA 1FHVA 2G3NA 3VAVA 1UWIA 3P74A 2R1PA 3FXGA 5KMYA 5AVHA 2R1NA 3SB0A 4Y6GA 5LIUX 2TPRA 3R2GA 1AQHA 4HNCA 1MQQA 1ONWA 4W89A 2PURA 5DFAA 4DI8A 4IMAA 2PTXA 4ML9A 5FMHA 4HB7A 1GVQA 3LV6A 1FXQA 4DXKA 1GT8A 2VENA 3EA1A 4NL1A 1F4AA 1EJXC 3C8FA 2F2HA 1DWIM 4UUIA 1R2TA 2VP8A 4PMNA 4TVCA 4MM1A 2G96A 1T8XA 1XRSA 1GERA 3SIMA 4N9DA 1FQ0A 1Q8JA 2WBGA 6ENLA 3C2EA 4DM2A 4L4OA 1BAGA 4HCDA 3TOPA 1E40A 2GSJA 1AMYA 4GQ0A 2OX4A 1VBRA 4LVDA 4N4PA 2C18A 1Z6KA 3LCGA 5E0KA 1NWSA 3H53A 4L56A 1GEUA 1J11A 5A5WA 4JNMA 3M07A 3W7NA 3GXIA 1PHWA 1B9ZA 3DYOA 1GETA 3DKJA 3W1XA 1FTXA 1EJWC 3W2NA 3H4GA 1A5AA 3S9ZA 4M7TA 1HKWA 4UQCA 1SYTA 3IJ8A 1IT8A 3WNOA 2YA2A 3WUEA 2WMGA 3AROA 3CGDA 1LRQA 1Q7MA 3H55A 1BHGA 4QSFA 5CLWA 4O14A 1H1ZA 1XLGA 1XPYA 2V30A 3VIMA 3CHFA 3LMZA 3K8KA 4JTSA 2JEQA 3S2NA 5GNZA 1GW1A 4LCRA 1RY0A 1KM0A 1RBLA 5DMLA 4AWEA 4GISA 3LTYA 1RVGA 3NGFA 2J9ZA 3TYCA 5A2BA 5MKGA 4X0NA 4BURA 3TYAA 2OFJA 1M41A 2CERA 1ZGDA 3T2QA 4QE4A 3B97A 3OQ8A 3AQUA 4C6BA 3I4KA 3DKLA 3BMVA 2FZ9A 3VDCA 2CBIA 3GZ3A 3S5SA 4IPPA 3HM7A 1P6BA 5M2FX 2DSUA 1VEMA 1XHCA 2WHLA 2ZRZA 3U48A 1PWMA 1ZSXA 2Y7GA 1EYWA 4UWMA 4AZIA 4ZTXA 1JUEA 2OCZA 1MEIA 1VJZA 1OSEA 2WOIA 1B5TA 4WHBA 3BE7A 4JQ4A 2IS7A 4FO4A 5LSMA 4JKMA 4Q4RA 1BYDA 3QOKA 3WBWA 3UFYA 4CU8A 5BOEA 3NIYA 4XD4A 2JK2A 4DIAA 3OIXA 1BGAA 2GDUA 1ZRQA 2GH5A 4FOJA 1WAWA 4HK6A 1DWHM 3W84A 3TH6A 5GNXA 1I6NA 2WC7A 4HNUA 4HPXA 3TJ4A 2OEMA 1ZJAA 4OOUA 4H4PA 1E6ZA 1MVYA 4EMWA 1KA9F 1UWSA 3VIIA 1S2UA 3UJSA 5JIWA 3QV9A 5G5IA 3P60A 5LIKX 3M9YA 3AXHA 1EWEA 1AFSA 1WBHA 1DP0A 2DIJA 5I24A 2OODA 2CEQA 2DSVA 1TTQA 1C90A 3H8AA 3N11A 1XS2A 4GWEA 2INFA 4N9BA 4JHOA 3G6LA 2QMKA 1IGWA 1QI3A 2XTKA 3DFHA 1UPPA 4PB5A 2Y8UA 2O7SA 3OLGA 1EGVA 1V6UA 3EOSA 4G5DA 1QW8A 4R27A 4KGJA 4ATLA 3AHYA 3MI6A 3CK5A 3KLKA 2X8RA 3VO0A 1EJVC 1O5QA 3KOWA 1RZMA 3EMQA 2YVFA 2V2HA 1GHSA 2NQ9A 4EANA 2PP3A 1YYAA 1VCFA 1G6CA 4MYAA 5ABEA 1XM3A 3LA4A 2R94A 1MW2A 1VEOA 2YFOA 1JIBA 4AYSA 3W7LA 2IMRA 4N6FA 3FEQA 4LYKA 3SCUA 2QCHA 3QOMA 1JNEA 1PL9A 4FSAA 1UD2A 3KTXA 4L61A 3NJ3A 2BC0A 3H4WA 3PB2A 3AMGA 1V0LA 2E67A 4LB4A 4H2CA 3CLWA 1UD8A 2YZ5A 3G24A 3WH5A 2VEFA 5A8MA 4Z0JA 2YFNA 4CQAA 5F1UA 1GORA 4A6GA 3UF9A 2RABA 2UY5A 3KWXA 3NO5A 4BI6A 2OELA 3VUPA 4OZOA 1A5LC 5E5CA 4QE5A 5A6BD 4J7RA 4GUJA 4UFJA 4FP1A 2GJXB 2O9OA 4GABA 3Q58A 1V02A 1I8JA 1WNOA 1NDZA 2GR2A 3RF9A 3H4KA 2XSXA 4IXXA 3QFWA 3N9RA 3ZVHB 5KITA 1K3UA 1JD7A 4NNBA 4FK9A 4AF0B 2JALA 4D6FA 5D9MA 3W75A 1VYRA 4Q6XA 3C2RA 3A5VA 2YCLA 5JQ9A 4KWOA 1XISA 3W27A 1LROA 3WN6A 4ZTYA 3PK7A 3E0WA 3QEZA 3SGUA 4L80A 5CZJA 3WBAA 3ZVIA 3QHOA 3BOLA 4MZ1A 3AIVA 4JDRA 5KZEA 1IGSA 5F2IA 1Y65A 5FCZA 3BJSA 1SB3B 3ARTA 4GUHA 3WBXA 2JFEX 1OM0A 4XQ6A 5GJPA 3LHUA 3TK7A 3UCCA 3GFZA 3LZ3A 4JNYA 2V3GA 4AEEA 1O66A 5C9ZA 3MY9A 1S2WA 4AISA 4H9TA 3TFXA 2Y24A 1Y5XA 3S2MA 5AYXA 5LXXA 1EH9A 4W93A 2GSEA 2W3ZA 3M0IA 1ZY9A 2EKGA 3GYCA 2W4XA 4MF4A 4AC1X 1EGMA 4E2DA 3AUJA 4IGNA 3W76A 3HG2A 4WRHA 1VRDA 3W7DA 1GREA 1JI2A 1LORA 1PTAA 5EB8A 3OBKA 3DFOA 1I45A 3LXCA 4JTAA 2X1TA 1UJQA 1X8CA 2WJFA 1BEUA 3PFMA 4RX0A 3CT7A 3TCSA 1FA2A 3PULA 4H41A 3T44A 4UOQA 1UKOA 1FRBA 4IISA 2V67A 1FWJC 1PIFA 4OBSA 4RW5A 4DBSA 3GVWA 2V68A 1TPC1 1KWKA 3WBYA 3JRKA 3CASA 2W3RA 3SSZA 2NWSA 4A21A 1OGGA 1UUMA 1D3GA 1P4CA 3JZUA 3K4AA 3SY5A 1PKMA 3KLLA 4C5YA 4AMCA 3FYPA 3P6LA 5I07A 4CU7A 4W86A 3W38A 1R7OA 3EXTA 1YX1A 2AKMA 3IAQA 2VELA 4US6A 4F40A 3ZYZA 3MUXA 3LOTA 1EGZA 2E6YA 1L2QA 4WVXA 2IQTA 1Q63A 3MSGA 4H4ZA 4XZWA 4A2SA 1MSSA 4GRTA 4NEWA 3M64A 3VOFA 2HE5A 5HJYA 1Q7QA 4PUDA 2WMFA 3H7RA 2ZUWA 4H8VA 4RE2A 4MB5A 2QVHA 3P7YA 4X60A 3LDVA 1EO5A 4YN5A 1J0HA 4BI7A 1Q65A 5EBUA 3M7SA 2XSBA 3M0YA 4K8DA 1KCZA 2VQUA 5I3IA 3ZJKA 1ML1A 4RXFA 4HU3A 1XBVA 1H1NA 2G4FA 4A3UA 2CETA 1V6XA 2J62A 4L65A 4LAZA 2PWHA 4UCGA 4JIPA 4XKYB 3ZZ1A 7REQB 2QPXA 1R3YA 1AA1B 2V3EA 3POCA 3BSMA 4PUNA 2PLMA 1VQZA 2NXHA 2WMIA 3ARSA 3V75A 1OYCA 3MDUA 3WD0A 2X2GA 2HWGA 2ZZ2A 2J24A 1W9PA 3HURA 1QHOA 1ICQA 2XGZA 3GWQA 4JOMA 3B0UX 1GPWA 1N61C 4FA3A 4DZAA 4NAEA 2DQWA 1UYQA 2JE8A 3UXLA 4EE9A 2GQ8A 2FDSA 4C6KA 2YIHA 4UMAA 1RA0A 1UOKA 3GDMA 2PDHA 2NSOA 3TA9A 3V5CA 1EC9A 2R91A 4DUVA 2C13A 4LS2A 4C6EA 3W7RA 1UKPA 3D0CA 3O16A 4JTTA 1JCMP 2Z2UA 3EDJA 1TJ1A 3B9NA 3ITCA 5G4HC 2PGWA 1FEAA 1BF6A 3NPVA 5IHSA 1CEOA 5C2CA 3TEVA 4L6OA 4YNGA 2A3BA 4CN6A 3GVVA 2WLYA 2CESA 1XJBA 4KRZA 1AG1O 3HJEA 4B90A 3E12A 1AQ0A 1LG1A 1PXGA 2E68A 4ZE5A 3BLIA 2Y1HA 5ENLA 2TYSA 4YLWA 5E6ZA 3K1GA 1R38A 1QVBA 4IXHA 2BY1A 3BICA 3OYXA 2W55A 5HQLA 2Z0IA 3ARQA 3GHTA 4GVGA 4G1NA 1O5XA 3WBEA 4F2BA 4AZ6A 5AN7A 3IWPA 4NJJA 1NHSA 1XGDA 1O6IA 2XGIA 3CM4A 1EPXA 3QGVA 2Z4GA 3UGRA 4Q6JA 1XC6A 1TWWA 3W0KA 4AY7A 4O50A 5CAKA 2WPCA 3TJIA 4MG4A 3ES8A 5C2GA 3IVUA 2W0UA 3DX5A 3M0JA 2WMJA 3W24A 1KO0A 1ALDA 4R7WA 5HULA 4I9AA 3SQSA 1JEZA 1OG0A 3AISA 1JPMA 5CLTA 2VGBA 2OLSA 4O0QA 4LT9A 1XFCA 3T8LA 2I56A 1DXEA 2G8ZA 1PX4A 1GQJA 4JQ3A 4C6DA 1O1ZA 4J3ZA 3NPXA 4NXKA 3EOUA 4CQDA 4K6AA 2E9BA 2Y61A 1P7TB 4HOWA 3EPNA 1YPFA 4DXXA 4Y9AA 4C1NB 4H83A 4HD5A 1OFEA 1KCKA 4AHOA 2BCPA 1ZX9A 4FLRA 1V51A 4IL2A 2BBFA 3DOPA 3AOFA 4DO7A 1JYWA 1P5BA 2AAMA 2FZDA 2QMJA 2FVLA 1GUVA 2DUAA 4GACA 1PE1A 1H11A 1XLAA 1SO4A 2F61A 3N15A 1CT5A 3WLOA 4O1DA 5EGRA 1WDDA 3HB9A 4PCNA 5HNNA 2VRJA 3W6YA 1WZKA 3UWUA 4J2PA 4OHQA 3W7PA 3SCPA 2V3FA 2PB1A 5D33A 3UP8A 3IRDA 2VXNA 4GCAA 2ZWZA 2PGRA 2EAWA 3TMQA 2WPEA 3IV3A 1W1B1 1W1IE 1E0WA 1GESA 4GI9A 4L7ZA 2FPVA 2PWEA 3W1RA 3G1FA 4ZO9A 3B04A 3B8TA 3B0VC 1OADA 4Q8VA 4PTMA 2O7QA 3OLEA 2CHNA 1AJ2A 2WHMA 1DWAM 3WJSA 5AVNA 3QR1A 3N9SA 4DF0A 1HF6A 1TMHA 4NZFA 2QVNA 3B9OA 2ACUA 5I3HA 3FDKA 3IGHX 3P67A 3ZWTA 1YDNA 2VD8A 3AHXA 3HBLA 1GK8A 1YPXA 5FAGA 3AIWA 1WUFA 4KEVA 5EKYA 2ZQ0A 2X30A 3U9IA 3W1NA 4LSBA 1Q6LA 1ICSA 1DIEA 1C8VA 3AJXA 3GDKA 4JBRA 1OY0A 1ZAIA 3LCXA 3VYLA 4RDWA 1XWYA 2E9LA 1JZ7A 3LXAA 4GX9A 1S5WA 1N5XA 1X1NA 1JPIA 3CXOA 2G97A 4ZZ9A 1BG4A 1P0NA 4CNTA 2QT3A 6TIMA 2X40A 3SW6A 3THDA 4KFPA 1FCQA 1W31A 1UP3A 5I7GA 3KBJA 4KRUA 3G5EA 4GJ1A 3RIKA 3T09A 3LXDA 4Y96A 1NHPA 3W01A 3GSMA 4I9JA 2VZUA 4MB4A 1TWZA 3C2OA 1G5AA 4MKVA 4DPQA 3KDOA 4JFUA 4NF7A 1S2AA 5A6TC 1TQXA 4YTTA 4PN2A 3CLMA 1W1TA 4LS1A 2OQLA 4DUOA 4JHMA 3PR2A 1ONFA 4IFOA 3G6MA 4F2TA 1X6UA 2J7DA 2HBXA 4TVYA 3PWAA 4FI4A 4YTQA 4G7FA 1WKFA 2PWDA 3RRXA 1PZ3A 5KZ6A 5LHEA 1HGYA 2X8CA 1GZJA 3MVIA 5CC6A 1AQMA 1GVEA 3CGCA 4OQVA 2VD9A 3TMLA 1EEXA 2YB1A 4DNAA 4PULA 3MUZ1 4ZGYA 3DC8A 4B5UA 2YKKA 3USZA 5D02A 3FY1A 5JUVA 2YLLA 3URQA 2OLHA 1GVYA 1CGWA 3BV7A 4E8CA 4A8RA 2V6AA 4JNZA 3EWUA 4S3CA 4ATDA 1O12A 4M29A 1MXSA 1R9XA 4B92A 3LTSA 3B8UA 4IWWA 2HJPA 2O55A 1LG2A 2FB3A 2XVLA 4W5ZA 4HCLA 1XSKA 3W70A 2EG8A 4CNUA 3GHUA 1V3HA 1BYCA 2PLCA 3WH9A 3TQ0A 3KEHA 1A3XA 3TQKA 1TV3A 1N82A 3UXIA 3ZR4A 3A4WA 5CBJA 2J7FA 4H4YA 1JRBA 2ACQA 3ID7A 4H9XA 2ABBA 3BW4A 2PWFA 3VNKA 2P8CA 2PEVA 4JYFA 4V27A 4OJYA 4IPNB 1W3IA 1S1RA 1PKLA 4K8EA 1ONEA 1HO4A 2ZIDA 4EAMA 3V16A 5FKYA 3N12A 4UTIA 1V3JA 1QDSA 2IKHA 1Y5WA 2VR4A 4R34A 3TQVA 2P8BA 3LSCA 4L9ZA 3OB8A 1AVAA 4PRRA 3D6NA 1TJPA 3WY1A 3GXFA 1K4QA 1QFEA 2XVNA 1KGWA 3NGJA 4TQTA 1H50A 3WNPA 3KE0A 2MANA 3H12A 3W2UA 1IXOA 1LLZA 3NOYA 1SQ7A 3OW1A 1B2YA 1CXEA 2ZRWA 3IRSA 4FMVA 4B3LA 4JTJA 3DDMA 3TV8A 2YB4A 1W5OA 4JTDA 1QPQA 4GY0A 4JEQA 1C92A 2HDJA 4WXZA 1VGAA 1R3QA 3B9DA 1KR1A 4JZ5A 3GTNA 3UWVA 3UZZA 3WQ6A 3S5NA 2ZUVA 4HQVA 4EP8C 4NNAA 3D3FA 1V3MA 4GBDA 3UCQA 5G5HB 4ENLA 3R1ZA 2FH6A 3ABZA 1Y5VA 1TKKA 5HDRA 1OG6A 3W7IA 2R8WA 5C0QA 3CS2A 1K9TA 3WDQA 4H8HA 1SO6A 3CB8A 3WLJA 3UERA 1W3TA 5AHNA 2YL6A 4KRTA 3CNYA 3ZO9A 3QC0A 1NWRA 4GG9A 4UZSA 1JZ5A 4XAZA 4RE3A 2NX3A 1TUXA 1LLWA 3DBPA 1J79A 1EXPA 3O05A 2RDWA 3LTPA 2UV8G 3PVFA 3PG6A 4L1WA 2J13A 4UCFA 1MRAA 2WVVB 3RR1A 4UMCA 1DWJM 3UWEA 2TPSA 5EMMA 3WEZA 1FWWA 4B5TA 2WSPA 3AXMA 1DHKA 1DNCA 3K46A 1FWIC 1AZ2A 4IUOA 2CDUA 4DX3A 3ZR6A 4EKJA 4QNEA 5M03A 1HT6A 2DIEA 2PC4A 4H8UA 3NNTA 1QXLA 3FJ4A 3QH2A 4L4PA 4E3TA 1KRCC 1F73A 5K3VA 3WH7A 4GHRA 4HA1A 2YW4A 4YJ5A 4MAZA 5DXYA 4DZIA 2Q8ZA 3NQ6A 4YVVA 1JYXA 3NM1A 4QCFA 4HZ6A 1GOOA 3UJEA 2ZZ0A 1BLIA 1W3NA 1UKTA 2PF0A 2Z1VA 4O4WA 4PODA 5IHRA 4XKMA 3B9AA 4AD4A 1ZDLA 1WKYA 1OIFA 1UWAA 3EPOA 4C6OA 3VDHA 5C8BB 3HIJA 4IGMA 1XIFA 4GXPA 4RZBA 1BTMA 3UG8A 1K9DA 1TV7A 2YVGA 2A7PA 4Z2LA 3IUIA 4KERA 2O0TA 5F1VA 1C9WA 1Q1WA 3SQMA 2XVKA 2CLIA 1QK2A 1VIZA 4LY8A 3VM5A 1YDOA 4IJRA 2IQDA 3LCLA 1T7LA 2XH7A 4AD5A 3C56A 3UWQA 5LKYA 1YXYA 2YXGA 1WPCA 4IQEA 1RPXA 4GO8A 3SGZA 5FOOA 2ZE3A 3GIPA 1CLVA 1YIXA 2D20A 4WD0A 3ETRB 3UGVA 3R43A 1XKYA 2H3BA 1EIBA 4KQNA 3MP3A 1V5XA 2QCDB 4Q3MA 4XZMX 3E5PA 3NXFA 7CGTA 5U25A 4B5SA 3NYDA 1KWGA 2WKJA 2W27A 5I3DA 2Q3OA 3DFTA 4F3HA 4AG0A 3UR7A 2E5CA 2DGAA 3G18A 5T26A 3TLQA 1W54A 2VFFA 1XGEA 1G94A 4KS0A 4WK9A 4WGXA 1QI5A 5JMUA 2X16A 3PNZA 4JCLA 1MW0A 2PI6A 4LAUA 3VXGA 3W1PA 2R14A 3HGSA 4IIBA 4ILSA 4ZE4A 3TIMA 4X2RA 4ZOBA 2D3LA 3FOKA 2VHLA 2F9RA 2HS8A 1XLHA 3CO4A 2BC1A 4KKXA 1EBGA 4QJ1A 3SADA 2BVWA 2WO5A 1MW3A 2WZTA 1Z7AA 2QKFA 1ELSA 4DJDA 5AC4A 1V0KA 4N9CA 1VENA 4GXMA 4WSKA 1ITXA 2DZAA 2FGBA 3R4IA 3GTFA 3TLLA 1O4UA 3AHVA 1DXFA 2Z7KA 1EQCA 3U5UA 5H91A 3T7VA 2A8XA 2A2IA 5E70A 2QV4A 1XW8A 3PBYA 2D1ZA 3MZNA 5HXMA 4ZO8A 3KHJA 3A23A 1ZP4A 3AI0A 2XWEA 1TV5A 2C15A 1GZGA 3WQOA 3FHQA 1JEHA 3C0LA 1AH4A 3RLUA 2Y62A 2VVNA 1HW6A 5REQA 5HNTA 3AZTA 1UR4A 4IQDA 2LLEA 2GJXA 3FN9A 4HU0A 3B0YA 4B16A 3GH5A 1NQKA 2D2HA 2X8HA 4CCDA 3W6MA 1BYBA 4EWND 3BL3A 4UMBA 3ZVHA 4H7CA 3XINA 3VM7A 2AMXA 3ALGA 5FJPA 4QQ3A 4P8UA 4GYJA 4H1ZA 2GK1B 2Q8LA 3GVGA 4XIMA 4NRSA 1G4PA 5A6MA 3Q94A 2C71A 4C65A 4MJ2A 1ZY8A 3ZS4A 3ABXA 1PV8A 1A5SA 5A1AA 1JF6A 4MB3A 3SUUA 1EO7A 1KKRA 1XG4A 3EUB3 4LC8A 2OTDA 5I78A 3VNIA 2PFHA 2V63A 1W9XA 1VC4A 3BAWA 3SQPA 3EWCA 4K36A 4X9YA 5GJNA 1WDWA 3G3MA 2D73A 3TSBA 3OVGA 1A49A 4I5RA 3AIQA 1V6WA 1XUUA 4OBRA 2WOQA 1NVMA 3FDGA 4ZOEA 3CEPA 1IZCA 4XISA 1AH3A 3TZFA 1I60A 2W92A 3QJAA 1I1XA 1MFUA 4H4VA 5E9AA 1RUSA 1QT1A 3DH7A 2X05A 2QAPA 3ZSSA 4D1IA 4FX6M 1JUKA 2CBUA 4AUBA 2E3TA 3R94A 3S1WA 2C3ZA 3U7VA 3B0PA 3BSGA 3WLPA 4ZB0A 3SBFA 1KFJA 3P8JA 2A4AA 1LBMA 3VKJA 1LBFA 1LBLA 1S2TA 1JUBA 1U1HA 4DBEA 1GOWA 5EPDA 1CX9A 1NF0A 2ZX8A 4S3DA 3APGA 3WQPA 4GNJA 1G4EA 1C93A 1OGSA 1W1YA 3L4UA 3B4UA 4PCFA 4TUFA 3GKAA 5I03A 5C5YA 3GM8A 4QGCA 2EBNA 1VFMA 4A29A 1W8SA 2E6FA 1QHZA 2WM1A 4R7JA 2BDQA 3E9AA 2ESCA 4Q33A 4NZ3A 3CZGA 1QWGA 4ZOAA 1YTEA 3GO2A 4I7VA 4IIGA 4ZB2A 2J7HA 5AYIA 4C1LA 3SCWA 1DIOA 1VCVA 1A3WA 3IPWA 1CW2A 2WBAA 4L9YA 1KR0A 1XIDA 5FS9A 2CLLA 2XPKA 3QW3A 4QXIA 2GVEA 4XO7A 3MMTA 3THCA 3R0UA 1RM6B 3NVTA 3TNBA 1DJHA 1A80A 2QS8A 4G9PA 3DESA 3QMTA 4LUSB 3RU6A 6REQA 1AW2A 3TW6A 4JY8A 4B5NA 3WLRA 4E38A 2V5LA 3KOFA 3UT0A 3TE9A 1JCYA 4BEUA 3N34A 4G1KA 4KEMA 4PMYA 1Z42A 2ASHA 2WCGA 2CPUA 4WZHA 1XQKA 1XIHA 2GVLA 3HG4A 2YSWA 1J5TA 1JXKA 1V7YA 4H7VA 5CGQA 1RAKA 3RM4A 1FX6A 5JIPA 1KC7A 2ODOA 2I9EA 1LZOA 3PBGA 1JGIA 2Y63A 5HQEA 1WDQA 2ALDA 1WOBA 5M1TA 5CZTA 4B5XA 4JR5A 3COTA 1E0UA 4QG8A 4BCEA 3T42A 2ZADA 3KP0A 5LIYX 2NPXA 4PSRA 3THAA 3L4ZA 5LYRA 4IPLA 3G77A 4XVEA 5G2HA 2PCEA 2XVPA 1XH2A 1C8QA 2PRMA 4A8IA 4IIFA 3P2VA 3GNOA 4W9TA 3TA6A 5B7ZA 3BGAA 5BXTA 2IPGA 3LB0A 3W37A 1JCLA 9CGTA 4KBXA 3KW3A 4ZOCA 4IIEA 2OMAA 3UY7A 2I9UA 4FNQA 2PP0A 4WKAA 1J12A 2PRLA 3I6TA 5JCMA 3QBUA 2QQ6A 3W26A 2Y0FA 4W87A 3H2AA 1GRBA 4PZVA 3PZUA 4UOJA 5D2XA 1OVDA 1XPGA 3GRSA 1R7AA 5CJMA 2O9TA 1NU5A 4HP5A 1JPKA 4UXDA 3WX7A 4QFUA 3UXDA 1EF2A 4W5UA 1GG1A 1HG3A 3N25A 5AFDA 4D2JA 3MYOA 1NELA 1DQUA 3TW9A 4W84A 1EOMA 3W2KA 3STCA 3KX6A 3N2MA 1K6AA 2PDMA 3QRHA 3M5XA 2WOVA 3UESA 1N8FA 1DIDA 1XLBA 4O12A 1NEYA 1BWVA 4H9VA 2GQ9A 1G69A 1MEWA 3REQB 3MPGA 1QWKA 4EOUA 5FA5A 3UETA 4UTWA 4DZ5A 4WOQA 2EGZA 1EA9C 5H8UA 3ZOAA 3ICJA 2YW3A 2V5JA 1XSJA 1LPFA 1W6TA 4CD7A 3ONBA 1GG0A 2BNJA 3WDPP 5G4EA 1EP2A 3S4TA 4I90A 2Y6ZA 2EPKX 3EB2A 3R07C 2E7FA 2OYMA 5CAHA 4AZBA 2NV2A 4U2ZA 5DRIA 6PTDA 5BOOA 2FZ8A 1TTIA 3URHA 1P7TA 5KETA 1N8WA 4C6CA 1FHLA 1XICA 4AEOA 2R1LA 3RNMA 4UTTA 3PAOA 4GRSA 1KBJA 5HMEA 4TX6A 3IARA 5ABHA 4CQ9A 1PAMA 4BV6A 1F3TA 1Q6GA 1NFBA 3VI2A 3BQ5A 5DELA 2I57A 4GH3A 4KW2A 4XZNX 4RNJA 2INZA 3BLEA 4IX0A 4TV6A 2YDQA 2PUZA 2E28A 1VHNA 2I5QA 4QG6A 4LV4A 3B8VA 3SCRA 2YAUA 2Z1BA 4WDTA 3KRUA 4R5EA 1RVKA 3HJZA 1VJSA 1H49A 4NEVA 5BRBA 1EUNA 2A3LA 4AD2A 4AD0A 3LBCA 2VKZG 2D2JA 3QC3A 3PZGA 3LY0A 1TJRA 2J75A 1PJ9A 1J6PA 2AKZA 3VABA 3EKGA 2JK6A 3VIFA 3ZR5A 2XN1A 1XDIA 4CUCA 3BH4A 3PY2A 1T40A 2BSLA 3KBNA 5HUPA 1H1YA 3KXQA 3ZIZA 3FVDA 4NI8A 3S6OA 3HV8A 1GONA 3GAYA 3TTQA 2HV5A 1QMLA 5H6HA 1YXDA 3UWWA 1HKMA 4MIMA 2EG6A 3GQYA 4BQ3A 4YTRA 1FOBA 5G1MA 3CUFA 4Y2WA 2PTWA 3S1UA 1OGBA 1N8IA 2JBMA 1IEXA 3WK3A 3TOYA 4PSPA 3CT2A 3DI1A 5H1WA 1IEWA 3F2BA 1EXBA 1FWAC 2PD5A 1FFVC 1XIEA 4R88A 2HISA 3O07A 4JFWA 5A8NA 1RBAA 3W71A 3VFLA 1A53A 4KESA 4NIRA 1UPMB 2D0FA 4JX5A 1SU5A 1HKIA 1HJVA 4Z2JA 4LF2A 4E2VA 5D2VA 1KRBC 2ZDRA 1UR2A 5A6AA 3ITOA 3GB6A 3KP1A 4GK8A 1ITCA 2GYIA 4HN4A 2GPTA 4JIQA 3PTQA 3VNMA 1W2PA 3T78A 1X98A 3A9IA 5HA7A 5MKGB 4AZ5A 3V7PA 1W1VA 4GY1A 2VEMA 1H7RA 2VWSA 2JQXA 3PPFA 3RK8A 4JPGA 1E6PA 5BU6A 2PGEA 2WXDM 2X41A 4NZ1A 3R8GA 3WQWA 4QS6A 5CPTA 3W2MA 1HGWA 3AYVA 2WNWA 3GDLA 4TV5A 5TF0A 1Q85A 4GR1A 3BK0A 2OLAA 3BCJA 1DXIA 1Q3NA 4Q8UA 4M1RA 1YXCA 2XH2A 3LLDA 4YPJA 4YYCA 1Q5MA 4QHRA 1FH8A 1M01A 4HYWA 2ZZBA 5HWNA 2W61A 4XZHA 1X1OA 3ZXWA 2FIQA 1RJRA 1FFUC 1EBHA 5AZ1A 4K7ZA 3HW2A 3VK5A 1JXJA 2VMFA 4D1JA 1JDCA 3OPSA 2Z1KA 4QRNA 3VOGA 3MMDA 1Q66A 1NJJA 2CKRA 1XD0A 1JDAA 3DK8A 3RX4A 2P3EA 4RV3A 1RP8A 2GGIA 1XRVA 4BKNA 4JTGA 2WVTA 4W4QA 2VEIA 2G95A 3INPA 2NT0A 3VX0A 1OT1A 5A6JA 2BGSA 1F5ZA 4LH8A 1KRAC 4EF8A 4MLRA 3F4DA 3AHZA 4MZYA 2WJDA 4ZQPA 1QR7A 4RNFA 1QO5A 4C60A 1OC7A 1VBUA 4W7UA 4WUIA 1B3OA 1N7KA 1QNOA 2ZKMX 3CEUA 1V7AA 3U2CA 3LI0A 1S5TA 1ZCCA 3ABOA 3RU8X 4PMXA 3SFKA 4YMZA 3DYMA 3IIOA 3NFUA 4B9YA 2PPGA 3W85A 3VIHA 3LCHA 3CPGA 3QZ6A 1EX1A 1MUMA 2BX7A 1OEPA 3ARWA 2W0HA 2FPYA 1U5HA 3W6LA 2DZXA 4IJBA 2R9RA 2TODA 3GH7A 3U3HA 2UWFA 4IT1A 1LL4A 1RALA 1GTHA 1W8GA 3CJPA 1KKOA 2C3DA 2G0WA 1REQA 1XIGA 4JQ9A 3UW6A 3WQVA 3QY6A 3M0KA 1WB0A 4ZL1A 3WSUA 2Y88A 2XIIA 4OGZA 4LC6A 1Z3NA 2CLEA 2BXVA 1XDMA 3PZTA 4A35A 3KVLA 4LAMA 1SW7A 2B81A 4UTUA 5FJOA 5A6LA 3T0TA 4US5D 4UQDA 1XUZA 4UZUA 4YTSA 3EDDA 2VCCA 3R89A 2HVNA 3EF6A 3UR2A 3EWYA 3A4AA 4E2BA 3W7EA 2X99A 4LV9A 2NW0A 2BMBA 4ICMA 5HNRA 3A13A 3HN3A 1QOQA 5CC7A 1I0BA 1ADSA 2YCLB 4M6UA 1NWTA 1H2IA 3RCNA 1P1MA 4XSMA 2RJHA 2OQYA 3NL2A 1O5RA 4F0LA 4EXBA 1DYSA 4Z2HA 3JS3A 1ZALA 3BWWA 1BXNA 1I1WA 3MUCA 1BXBA 3U2ZA 2PODA 3GR7A 2QUMA 3M6DA 4EMJA 5EFDA 1R3RA 4HU8A 4HMDA 1FDZA 5F4SA 2H3DA 1W3LA 3RGTA 1Z89A 1LF1A 3GS6A 1IT7A 3W53A 1TFVA 3FGCA 2QDGA 5C55A 4A8LA 5J04A 4XIAA 4DJFC 4EWJA 1EJUC 1QAPA 3PSWA 3DG3A 2E6AA 3DGHA 2ZZ5A 2QPUA 2C91A 1KFEA 3PPCA 2B7QA 2I5IA 5HOSA 1U33A 1FO4A 3WNKA 5A6KA 2CBVA 2PAJA 3R10A 3GIQA 4LOCA 2ACRA 3B05A 3CZ8A 1SJCA 5EBKA 5JH2A 4Q7NA 1HJQA 4HMNA 1RQBA 4O19A 4R7OA 2F38A 3WLIA 1DV7A 3PANA 1WZLA 4EPBC 2QCDA 1XRFA 4P7QA 5BMXA 2D23A 2X7WA 4AU0A 2QJJA 5JBDA 4AX7A 4GQQA 1W3KA 2OSXA 2YJQA 4FPSA 1X7IA 3RCMA 2XM2A 4JTQA 1K8YA 4J3TA 2WYSA 4JFTA 3ATYA 3AAMA 4L1GA 3GTXA 3B9JB 1B4EA 2E6DA 4AW7A 2C7FA 3EKZA 4UTKA 4Z1AA 3TX9A 1CTNA 4EPEC 4RPQA 5CSRA 4DJFD 3VGFA 3H2MA 4EAYA 4HOXA 2PBGA 3PP7A 3PN8A 3AMCA 5GRTA 3RM8A 1KLZA 1LQ2A 3ABQA 1VLIA 3DGBA 3WUFA 3ARUA 4MHBA 2DW6A 2J9YA 2QCEA 3GUGA 3NSNA 3ZWSA 4RDYA 3C3NA 1ENUA 3V18A 2HXUA 3WQEA 1JZ2A 4RZ6A 1UMLA 3BSHA 1EJTC 2QDEA 3NL6A 1PO9A 1IWPA 3LPFA 2G5WA 1MXDA 2BY0A 4AZHA 1VYPX 5AHMA 2ICSA 4AWTA 2YA1A 5G2WA 1L6SA 1PKYA 4FNRA 4MNLA 2IXVA 3I7RA 4PMUA 3F5LA 3KRSA 1EFZA 2ANUA 3SQLA 2FZNA 1FKXA 1TRDA 3GR4A 4RR4A 2TSYA 3UJFA 3DERA 3W22A 3P62A 1B3XA 4H8NA 1XBXA 4DEFA 3TROA 3V1PA 3W7HA 1V3IA 2KZHA 3WJYA 4NU7A 4F0SA 3KLJA 5IM51 1IV8A 1VBJA 3MTWA 1BFNA 2H8ZA 3V4BA 3UA3A 3CQHA 1C8XA 3M4HA 1BGGA 1QOPA 1HQTA 3NL3A 1QNRA 1DJGA 4NUWA 1XYBA 4RNHA 4LALA 4DAIA 1NPXA 2ZRVA 1IWBA 1OF6A 3M0ZA 3NEVA 2OZTA 1V79A 3H70A 4H4SA 5HWMA 3URNA 2GR0A 3S8HA 3TR2A 3A24A 1F07A 2QXWA 2DORA 2WLZA 5KZMA 1K77A 2PDXA 3SRFA 2ZICA 4HSOA 3S1XA 3AXIA 3U4AA 2ZA3A 5BXPA 3QY7A 3WYZA 2GR3A 2QCLA 4A2RA 4ADUA 3O6YX 2BTMA 1LQ0A 3I68A 1E72M 3AO0A 1BYAA 1OWQA 1F76A 3DHDA 2QCFA 4L4LA 3CWNA 3WK0A 4BI5A 3EWXA 1WYGA 1TQJA 5FF3A 2Y8VA 3I3DA 4WJXA 3W87A 3H2NA 5IBXC 5A8GA 5BXSA 1E0TA 1ESWA 1SFTA 1UROA 2CHRA 2BXYA 4J3SA 3H2FA 3HG3A 5E0FA 2XN2A 1X6LA 1TTPA 3NSXA 2ZUSA 4J1OA 1ZHAA 1YKWA 4WSHA 3A5FA 5D2TA 2WSRA 3O1NA 4C6NA 4IICA 4O54A 1UZDA 3VCNA 3DN5A 3HPSA 4QAWA 3VTRA 2JIEA 1S2VA 3N2BA 3C2FA 1UJPA 1GQNA 4XAYA 1Z44A 1I2QA 4O53A 3MKKA 3M41A 3STFA 4EVZA 3T9PA 5M3WA 1TCDA 4I6VA 3DK4A 5JCKA 4FALA 3BANA 3QZEA 5LGXA 3P93A 1M7OA 1XYCA 2QHAA 3GXMA 4QSHA 4A22A 3N6QA 5EFFA 2WHKA 1J2BA 3W72A 3ZSTA 1HJSA 3E96A 3IJLA 4ROPA 3BOFA 7XIMA 3HRDC 1EUAA 3KL0A 4KT2A 1QNVA 4MB1A 5DO8A 4EIVA 2EPNA 4M51A 1F9CA 2AQWA 5I3JA 1GKPA 1TPWA 1W9BM 2QCMA 3JUGA 4JL2A 5HJLA 2A85A 3SN4A 3GC5A 2CC0A 4BR1A 2O4MA 2ZE0A 3FSTA 2E09A 2V5BA 1E71M 4YYFA 3LGDA 3VU2A 1KCXA 1TWSA 4LUSA 1TG7A 1BKSA 1JRPA 1XDJA 5FJUA 2A3EA 5DX7A 4A3HA 2RKXA 1S5NA 5D37A 3EMZA 2WPGA 3W28A 3SDOA 2J88A 1VB9A 3H2EA 2CKSA 3FFSA 2YXXA 3EAOA 3DHPA 2PDJA 3TU9A 3CTTA 1OT2A 4LNCA 5E1QA 3BLKA 1U30A 3LBOA 4W8LA 2VRKA 1PBGA 3EXRA 1HVQA 1ZB5A 2A79A 3HQ1A 2FJUB 2CLFA 4O13A 1FDYA 4LNYA 5F4WA 5ER0A 1P0EA 3VKDA 2GR1A 4ONVA 2UBPC 5B7YA 2WQPA 2EQ9A 3BAKA 3I3EA 5FS6A 4HHPA 3RG6A 1ZBCA 2DVUA 5CJNA 3KUMA 1ZBWA 3R79A 1GQIA 1VH7A 4N42A 3O63A 3IIPA 3D5HA 3YPIA 3WDJA 1QPOA 2J77A 4EXAA 1JCJA 4C1KA 3KBWA 1M6IA 1C7TA 2E9MA 1SFSA 2FGZA 2GGJA 3PPGA 3M43A 3V1HA 3VIJA 4XWUA 3LCWA 4H6QA 4XSLA 4DWSC 4HNVA 1TRIA 4HZ7A 4DLMA 1Q4NX 3MVTA 2GQ3A 5FF7A 1R47A 2BVYA 4MY1A 2EQ7A 1JD9A 1SMDA 4XBJA 4XBKA 3RN6A 1C29A 1O7AA 3UWZA 5D05A 4GZEA 2FDMA 4N02A 4MPQA 4URIA 3LHVA 1GXFA 1B57A 3ZQ9A 4AXKA 3CC1A 3W7OA 2X42A 2RDTA 5EMKA 5FACA 1KXQA 1V6YA 5D30A 3UZJA 4UNLA 1XCFA 3STGA 4EX4A 2BVTA 3HGOA 3QXBA 1HP5A 3WNMA 1QHPA 3LRLA 3BW2A 1VFFA 4IHCA 2FMNA 1J01A 1YQ2A 1YBQB 1ECEA 1GJUA 4NJGA 4DO6A 1BVWA 3O6CA 3GU9A 5F2GA 1TELA 3BLPX 3REQA 1FWFC 5EMYA 2YQUA 4HU4A 1W5PA 4PMVA 2FMOA 2EPLX 1LWJA 2EG7A 1L6WA 4Q7BA 3L5OA 3R0KA 4D8ZA 3O0KA 1NDVA 1UG6A 2OX1A 4C6LA 4DWSD 3N4AA 1S3TC 1OHLA 2Y89A 4KH2A 2IW0A 3RLVA 1BZLA 4IP4A 5GQBA 1DJNA 2XSAA 1LOSA 3STEA 2D0HA 2PDNA 3QTGA 3VDAA 3RNDA 2HRWA 1X1ZA 2BY3A 3CUZA 3ITLA 3MUAA 3OZOA 2W9MA 2CLOA 2ZVIA 3M16A 4O4VA 3R6IA 2QR6A 3OLIA 4H6RA 4PB4A 1IXPA 3RHGA 2E77A 4KEZA 2CWXA 3W7JA 5J5RA 2A21A 2V3BA 2QULA 1CDGA 1GOIA 3OGVA 4B2DD 1QU4A 3UJRA 3SCVA 2BOGX 2F2KA 1W1ZA 3WUGA 2DT0A 2ZFAA 3CZLA 1AK5A 3LMYA 2OKOA 4GA8A 3WELA 5E93A 4S38A 4E4FA 4P7RA 1MNSA 3CAQA 2JF6A 2PDIA 2ZUNA 3AWOA 2J78A 1NHRA 1H0IA 1KQZA 5C54A 4QE1A 3DCPA 4MNMA 2VVSA 1DQXA 2VJXA 4E8DA 3VINA 2OO6A 3MW7A 1KM6A 4DJEC 1UQYA 2QDHA 1GOMA 3IJ9A 4QDPA 1FWSA 5CPNA 1AQFA 1JFHA 1A4LA 2OYLA 1LVLA 2NVCA 3T05A 4RLIA 4F79A 1RJQA 4PTVA 2J7CA 3T0AA 3A3WA 2PE4A 4TXEA 2BHZA 4MWAE 3WF3A 3M5ZA 4MAVA 4X9SA 1DXLA 3OBEA 2TRSA 2Z6JA 5AHIA 4Y9NA 1W9DM 1H41A 2TMDA 3U6WA 1P6WA 3GXDA 1OBAA 3DYPA 3POHA 3THUA 3GBEA 1S5MA 3NZPA 4NYYA 3UZYA 3NQVA 5CG0A 2DUXA 5LIWX 4TR9A 1XLMA 3UZWA 4GIYA 4V1XA 4HGXA 2PDKA 3LPGA 4HZMA 6XIMA 1WKDA 3ECQA 2DW7A 3M47A 4GC4A 1V6VA 2XISA 4JQ1A 1I4NA 3L9CA 2NV1A 4EQRA 3QLDA 3QR0A 3VGEA 2IQ0A 2RAGA 2OR2A 2OSWA 2HSAA 4GGHA 2WSQA 5I3FA 4NVTA 3TFCA 2XZ7A 4V33A 3KOZA 2WNQA 4HNTA 1C3FA 1JULA 1AJ0A 4C7GA 1QUMA 5IFPA 8XIMA 1AD1A 4KCVA 1SW3A 1VPQA 4CQBA 4GO9A 3T1GA 1CXKA 4LW7A 3A7UA 1IIHA 2VOMA 3ELFA 4I6KA 1GWJA 2VR2A 4YCOA 3ISIX 1NARA 5KEZA 4M24A 3TN6A 3PUDA 5IDZA 3GNDA 3VNDA 3TKFA 1MQRA 2V9DA 3BG3A 1PIGA 1XYAA 4ZCWA 1RA5A 4D9PA 1D8CA 4K7YA 5HWJA 2OWCA 3KRBA 4IGSA 1RSCA 3DG6A 1V3LA 1WXZA 3MSDA 1O60A 3S83A 2QNEA 4FLSA 1RLDA 2I5GA 5EU9A 1I2RA 4NX0A 1VFOA 5JXQA 1CI1A 1EBDA 4W8BA 5C71A 1ISYA 2Z1SA 3UR8A 1I0DA 3G1AA 3S5ZA 3QHMA 4YU1A 4GBUA 2ONEA 1NSJA 1UBPC 1A0DA 3UXAA 4PB3A 4LFYA 1RPKA 2D3NA 2FYMA 2PSNA 5T9BG 5BZAA 1A47A 2G37A 1A5OC 3NPWA 1TX0A 2PDBA 4LCQA 4WIWA 5D32A 2HS6A 3O9NA 3CBWA 3FA5A 5FEPA 5DN1A 1VPYA 1HX0A 1O68A 3JW7A 2V8ZA 1P6CA 2ZXDA 3LV5A 1UWQA 1KV5A 5G4WA 1NHQA 1VAHA 1D7FA 4WCJA 4KFNA 1JVNA 1ME7A 3GUWA 1PZ1A 3T2PA 1WDRA 2DZBA 4U3AA 3CZKA 3VFCA 4P7NA 5CZSA 3WLSA 2E40A 4E4UA 1T6MA 1H5VA 1FP9A 2CITA 4XVDA 1ZJBA 2E5BA 3C86A 4O57A 4XK2A 3KTSA 1BPLB 2ABAA 3GNRA 2XYLA 4YWSA 4ROQA 4AZGA 3DK9A 3HG5A 3P5YA 4ATWA 2GGGA 2XIMA 3OHIA 3MC5A 3F4NA 1UMYA 3P5ZA 4ASTA 1W3HA 3GDRA 1SZEA 2FZBA 2VCBA 3H54A 4Q4KA 5FF4A 3ZFHA 4JTHA 2V0TA 4DN1A 5IXEA 3UPWA 4DF2A 4B15A 4Z1YA 1Z9AA 1QNSA 1KNWA 5IDIA 1XH1A 2QZRA 3KL3A 4HTBA 4UTHA 3AS1A 3PUEA 4OBTA 1GNXA 1W91A 1DWGM 4DAFA 4XAGA 1J4EA 1MOKA 2I1OA 4QLLA 2CZFA 2D24A 3URBA 1RLCL 3MCMA 3SFWA 3OGRA 3NDOA 3P81A 4EPKA 2VC6A 2WSKA 2V6OA 1RHCA 3BCDA 4MWAA 7PTDA 3NQ7A 2NUYA 1OD0A 4OUEA 3WQGA 1GPFA 3IJ6A 4GYKA 4AMAA 4QLKA 2RUSA 1M03A 2F6UA 3P14A 3ABSA 5L6UA 4NRRA 4AC7C 2Y7FA 1U83A 5A3HA 2SFPA 2GWGA 3H24A 4N0RA 4KWUA 3TYZA 1THFD 1UUOA 4QR6A 3BW3A 3NURA 1KGXA 1MW1A 4FEZA 3A9BA 1UD5A 1XR2A 3AS0A 3DFPA 1H63A 3O6AA 4TVDA 1LRTA 2ZWYA 2DPEA 3D46A 5REQB 1RR2A 5EA9A 3CYVA 2X1IA 4MY8A 3W74A 1ICPA 5A2CA 2ZZ7A 1P0BA 4YS1A 3WUBA 1KRMA 4LYPA 4D6DA 1ODUA 2PD9A 3A22A 1WDSA 4ERAA 2ZA1A 4G56A 5BMWA 2E0PA 1W9UA 1XLLA 2XDFA 3MJMA 3RMJA 2QJNA 5ECVA 3N4FA 3OTRA 1ZAHA 2YYTA 5FL1A 3BTNA 3T8QA 4IFKB 3GU2A 3WLHA 1VBGA 2A7RA 2VZOA 4Z08A 5FJRA 3NQMA 3KZPA 1UIOA 1AD4A 1E0VA 4LPCA 2ZRUA 4OV9A 4JY9A 2GJRA 4R9XA 2AOSA 3OZYA 8TIMA 4K8GA 1GTEA 3CAVA 2WOWA 4NYUA 4RDVA 1R9ZA 4B3KA 2OKTA 1CB7B 1L6YA 1OZMA 5A94A 3DC0A 3N29A 4AWSA 1SSDA 4LX4A 5ABFB 1N2VA 3ZT5A 3RCYA 3RJYA 3AMZA 3A3HA 2QJGA 4XV0A 1MWOA 2VYOA 1UP0A 1QW9A 3P0XA 1CLKA 2EQDA 3CUXA 5CZKA 2Z24A 2WV8A 5D04C 3FV9A 4LGXA 2BGQA 1M04A 1OX5A 3W9ZA 2Q6ZA 2E1WA 3N4EA 1GYNA 2NQZA 1Q2RA 4NSBA 1TTJA 1VKFA 5I23A 3TUUA 2XJ7A 2VO5A 3LNMA 1VS1A 5C7VA 3GBDA 1G01A 5AHLA 3HQPA 5BXRA 1XBZA 1X6NA 3OHMB 1B3WA 3V0TA 2QUNA 2VFHA 3QYSA 3OG2A 1K4HA 4NI3A 3TWAA 1EZ2A 3EB3A 2ZTJA 1OJXA 3ZJ6A 1IR2A 2OOFA 3UNTA 3CU2A 2J7GA 2ZX5A 4LRTA 3CHCA 4TX9A 3KRZA 3OVPA 5HANA 4HVXA 2V5KA 5FIPA 2PZNA 1UP2A 3GD4A 2C8NA 3XISA 1VRXA 4UIOA 1SZFA 1BSIA 2J79A 1WQ5A 4ALDA 3UVIA 9RUBA 1ZFJA 1K6WA 3F03K 3UVAA 4DY1A 2E8YA 3EB4A 3E2VA 1RCOB 3UXKA 2AMGA 4FNTA 5XINA 3PZIA 1MQPA 3AICA 3W1TA 4H4TA 3EX4A 1R3TA 1XIBA 4ORIA 4LQ1A 2WW5A 2A7NA 3PNUA 5CG7A 3G1YA 3QPYA 4AVOA 1E9ZB 2QPSA 1W5NA 4NKCA 2UY3A 4FIQA 3BZGA 2FQIA 4UFHA 3EPMA 3H22A 1D8WA 4M6VA 4DRSA 1AL7A 2ISVA 1SR0A 3GAKA 1E5JA 4B5VA 4EQSA 1WDPA 4MJ4A 3N2CA 4L6DA 2JKAA 1K1DA 1FDJA 2OEJA 2NQ5A 4K3ZA 3BJTA 4L9XA 6REQB 2XM1A 3FKKA 3L66A 1GRTA 2ISDA 3RXZA 4P5UA 4X63A 2ZZ1A 1XXXA 3W23A 2IKIA 1IR1A 5I06A 3N2OA 1HZYA 1OFAA 1UR8A 3T0CA 1UZHA 2CZ5A 4F0HA 2WMKA 3B8SA 2CFFA 3AU2A 2DJLA 2DSZA 4AIEA 5D2WA 3H23A 1N63C 5J8LA 4WDXA 4JQ2A 3OIHA 5D8ZA 3V36A 3FS2A 5DXXA 3WLTA 1FHDA 4UFIA 1TYPA 2ZBTA 3EEZA 1HL8A 3E5BA 3PZOA 1H51A 3U4FA 2F6KA 1PDZA 1R30A 1M5WA 2CLMA 4DB7A 1IHIA 5BW6A 1KN0A 1ISWA 4MGGA 3W7QA 3VIPA 3W1LA 3PS7A 1ZJHA 5I00A 4CVUA 1F8WA 3GDTA 1NM9A 4TX8A 4GI8A 2BLEA 1O1HA 3K30A 1DEDA 3LEPA 1CXFA 4HA4A 2X8GA 4GH1A 5C2XA 3IANA 4HTYA 3G3DA 4GI4A 4Y90A 1R6WA 1YADA 3B8DA 3GRIA 1EA0A 5AC7A 4H9MA 4PMDA 1BRLA 1UIPA 3BC9A 5HR6A 1BQCA 3WQ5A 4P8XA 1DJWA 4DPPA 1P43A 9XIAA 3A7AA 3LCIA 2W62A 4OU1A 1R46A 5D8WA 2KX9A 3GXNA 4QX4A 2ZC8A 2X09A 4I5UA 3WG6A 2Z1XA 1Y7VA 4LUTB 3T0DA 1XX1A 2WP6A 2GZXA 4M5PA 1J96A 3FNDA 1PX8A 2DZVA 1E73M 3R12A 1W1A1 1DJYA 3V5FA 4O0KA 4L4MA 1LP6A 1T99A 3M1ZA 3BAIA 3RJXA 3WDRA 2Z25A 4F66A 3NL5A 1M65A 3M0MA 4HJWA 1OD8A 1AW1A 2OT0A 2V2CA 4PUJA 3CZEA 4GZ7A 5FSEC 3M46A 1L6FA 3S3GA 3W7GA 1BVNP 2WKGA 1TJ0A 4J27A 1VDVA 3GG0A 3L2LA 3RR4A 4TTGA 4P7OA 3SM0A 1H5YA 3FYYA 3TXZA 2CFYA 4S3KA 3NQAA 2H9AB 2INEA 1SZGA 5DCDA 4U31A 1NQ6A 5C7HA 1K7FA 1UKQA 3O7UA 1EJRC 4EQWA 2OZ3A 4IL0A 5C9UA 4IFRA 1ZKQA 3K8MA 2CWNA 2X0HA 4ZEPA 4WY0A 3WCZA 1H7PA 2WNZA 3KAOA 2YCEA 1TE1A 4NG3A 3CPUA 5HPCA 4RE0A 1UUQA 3UNDA 4B4FA 3W3OA 1YQZA 1RK6A 4D72A 2DZSA 2J47A 4LCSA 3SR6B 4B91A 2Z29A 3WLNA 1KFCA 2Y5SA 3TTEA 2V2DA 2XFFA 2YBTA 1DIKA 1OFRA 2VX5A 2RGMA 5B80A 2CLKA 1SVDA 5KVIA 4DWDA 4JX6A 4NY2A 1S7MA 5A69A 3WJXA 4WLCA 3LPOA 1WOAA 4H3DA 2VFEA 1XQLA 4GIEA 3ANVA 4KPRA 3K13A 3LCFA 4NP7A 3J7HA 3H21A 2QAEA 5DT7A 1FFQA 5TBOA 1A5KC 3AYTA 4E4PA 4O17A 1TMLA 2POZA 3THQA 5M5DA 4XAPA 3GR8A 2IPFA 4LS0A 4L1XA 2PLJA 3E6EA 1D3HA 4I7UA 1PYMA 3BGJA 2P0IA 3ITYA 1S38A 1PWLA 1A4MA 4HHHA 2C1GA 4JKLA 2DVXA 1F8MA 4QCEA 1PS9A 4JXCA 1M7XA 3VKCA 3S46A 2WWCA 4QJ3B 2FKPA 2DZUA 4MJZA 4NT0A 2J9XA 3IJIA 3HQOA 1JDFA 3GYEA 4BA0A 1WO2A 1YE4A 3NVWB 3GNPA 4INFA 4RL3A 2PGFA 4A05A 4HIBA 1Q4WA 2G3IA 1TVNA 3OEXA 4MVAA 1R5YA 4C6PA 2HE8A 3S6DA 4WY0F 3MSYA 1QATA 3MB9A 5TR3A 2ATSA 4YWOA 4LYRA 3NZRA 2CYGA 1W17A 1FCUA 5EMLA 2RJGA 1GCYA 1F3EA 3F2DA 4WKHA 1BVZA 4P61A 4U5KA 2WZEA 3C0QA 3HFYA 3LQLA 3MSRA 3EA2A 3USBA 1DORA 4JTUA 2D69A 1B31A 5LNWA 1AJZA 1WKEA 1ZPTA 3EOOA 5AC6A 3TC6A 1DQWA 5I79A 2X1UA 1E6SM 2PDGA 1WXYA 1V59A 3DAQA 2D0GA 2OT1A 3WQ4A 4WDUA 1YBQA 3HZ3A 4EM3A 2DEPA 1T8QA 2BG5A 5BCAA 4PFMA 3WENA 4O1EA 4IM4A 4MNKA 2J74A 3NVZB 3R25A 2PTYA 2ZZ6A 3NUKA 2VC9A 4AQLA 4BQ4A 2RGLA 3RLGA 4UTLA 2CZVA 3PG9A 4J28A 4OTKA 5A8OA 2DH3A 1Q6EA 2BXZA 1HTIA 1DTUA 4ACYA 3CQJA 3R13A 4R53A 4Y7EA 1UWTA 3S5OA 3KBMA 1QJWA 1UOZA 3EOEA 4OFCA 3V3WA 1US2A 4NZJA 4EMIA 1H61A 4U10A 3L4TA 1JDEA 3BJFA 4IPIA 1PEZA 4O11A 4MWAC 1ZMDA 5A8PA 1HJXA 4DWSB 2CXEA 3QMRA 1VF8A 3RRAA 4UFMA 4RKAA 1KM3A 1T0OA 1B3YA 2NUWA 1NP2A 2A1YA 3R8RA 1OIMA 1SPQA 2DV0A 1KFWA 1XIIA 1TREA 2VFGA 4NJHA 1UASA 3ZT7A 1OK4A 1FWNA 4XD5A 3FHAA 3NQ8A 2HMCA 1TSIA 7A3HA 2YDRA 2FHFA 4AYGA 1XLIA 1GEQA 1WUEA 1UC4A 3MO4A 3EWWA 4J2MA 3VZZA 2FJKA 4V15A 1YRRA 3TW7A 5JCNA 3DJJA 5CPMA 2ZA2A 2PCQA 3VIKA 3B0XA 3C4UA 3T4CA 1FECA 2DP3A 4ZBCA 2CLPA 3U7BA 4H50A 1GQLA 2DFAA 4Y9MA 2VGFA 2EPMX 2YL5A 1ZTVA 3VCRA 4I7WA 2VX6A 1L8PA 3S1GA 1UQZA 3GY1A 5E09A 1PIIA 3N2XA 3UEQA 2BB0A 4IMEA 3QR3A 4DUXA 2WPFA 3SECA 2J8GA 4MWAD 8RUCA 4TVWA 1E3XA 3S5YA 3CMFA 1O94A 3APTA 4AB4A 4GJIA 2W3SA 2YR1A 3WDHA 1QBBA 3ZJ7A 1OINA 1OCJA 5EYWA 4FXSA 1HN1A 3K5XA 4CLMA 2W54A 4FS9A 2RDXA 1FH9A 2R82A 3AIEA 3VCCA 2CCRA 3L5MA 1RQHA 3CTLA 3AN1A 1EKOA 4HHMA 2J7BA 3DGRA 2VC7A 3DFYA 3AS3A 2DQXA 4PBFA 1NTHA 4GX8A 1R3WA 2A3HA 4O52A 1FWGC 1C8YA 4NZ4A 1JNDA 1REQB 3BLFA 2DDXA 4RV8A 4HPNA 1UKSA 4HOZA 3RM9A 4LVAA 2D2GA 3OU8A 1SZNA 3VOHA 1MZRA 2HQAA 1MUCA 4D71A 1JL8A 1GOKA 4GQGA 2FHBA 4UTJA 2MUCA 4K39A 2Q02A 3TQPA 5DLCA 3DHUA 3QY8A 3MT1A 3GLCA 2WK2A 3GW0A 2VCAA 3EX3A 4JN8A 4LUYA 4Q4OA 3SUSA 3VD9A 1G0CA 1MEHA 1TVPA 4RZ4A 3AHTA 4MSSA 4W7VA 1VIWA 3PBVA 4L64A 1HKJA 4H4WA 5FSDC 2WCSA 5IFTA 3CIXA 1WV2A 2JIWA 1R8LA 1ZP3A 2BODX 2P88A 4XTDA 3ITVA 3KWSA 1WA3A 8A3HA 3VIGA 1P0DA