3RRAA

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
385
structure length
374
Chain Sequence
VKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPNPVWRHADGSVAEWAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative D-galactonate dehydratase
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
total genus 108
structure length 374
sequence length 385
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rraA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rraA01
2HXTA 3OW1A 3TOYA 2XGZA 3P0WA 2P3ZA 2PP0A 2OQYA 3OPSA 4HPNA 1JPMA 3ZVHA 3OTRA 3BSMA 1MUCA 4IP4A 1EBGA 4JHMA 3VC5A 4HYRA 2HNEA 3TWBA 3DERA 5FJRA 4E4UA 4H83A 3UXLA 4MGGA 3UJFA 3R0KA 2GGGA 4Z17A 5IDZA 3ES7A 1F9CA 3I6TA 2FYMA 3R1ZA 5FJPA 4H19A 1SJDA 4GMEA 3RITA 3THUA 1JCTA 1KD0A 3DDMA 2XH4A 2OZ8A 1KCZA 3ZLFA 3ZLHA 4FP1A 4E8GA 3TTEA 3MSYA 3NO1A 3SBFA 2QDDA 2CHRA 3STPA 3V5CA 4K2SA 1FHUA 2PSNA 3VCCA 3PWGA 4GYPA 3JZUA 3Q45A 4A3RA 4KWSA 3ZLGA 2HZGA 3ENLA 1EC7A 4DN1A 3V3WA 3DESA 3RRAA 2PCEA 1DTNA 2GGJA 1SJCA 1W6TA 3DG3A 4A6GA 3TJIA 4IL2A 1OEPA 4HNCA 3TJ4A 3I6EA 2PP3A 3UXKA 2PTYA 2GL5A 4G7FA 5ENLA 4HNLA 3HPFA 2AL2A 3FV9A 4HN8A 3T4WA 2PU0A 3QLDA 4HCLA 3CAWA 7ENLA 1P43A 3RCYA 3BJSA 4J3ZA 4K1WA 2PTXA 2PODA 2AL2B 3CXOA 1EC8A 3MQTA 2OKTA 3ZVHB 4A35A 4JN7A 3UCCA 3H7VA 3TCSA 4E5TA 4FI4A 2MUCA 5FJOA 2ZC8A 2OO6A 3DEQA 4GFIA 4G8TA 4ROPA 2I5QA 3SJNA 3GY1A 1SJAA 3SN4A 3DGBA 4DX3A 3FCPA 3N4EA 1NU5A 3H70A 4EWJA 3FYYA 1L8PA 3MWCA 3OZYA 4X2PA 3TWAA 3DG6A 4E6MA 2RDXA 3FXGA 4GGBA 3S5SA 2QJJA 3IK4A 1WUEA 3VC6A 1RVKA 3U9IA 2GGEA 3MY9A 1PDZA 2PA6A 3ZVIA 2PGEA 3GO2A 4H1ZA 4JN8A 3PWIA 4KEMA 3QPEA 3TW9A 3FVDA 4M0XA 2PGWA 3CB3A 4ZCWA 4KPLA 3OP2A 3SN0A 2GDQA 4YWSA 3JW7A 4Z1YA 2OPJA 3UJRA 1TKKA 3Q4DA 4ZA0A 3R0UA 2PTZA 4M6UA 3SSZA 4DHGA 2MNRA 2AL1A 2PPGA 3S47A 2QGYA 5FJUA 3V4BA 2DW7A 2QJMA 3RGTA 1BQGA 4F4RA 1IYXA 2P0IA 1NELA 2POZA 1YEYA 2AKZA 3NXLA 2HXUA 2GGHA 3V5FA 4E4FA 3N6JA 3N4FA 2AKMA 3P93A 3D47A 4DWDA 2P8BA 2OG9A 2PMQA 3BOXA 3JVAA 3U4FA 3R11A 3UJSA 2P8CA 4IHCA 4IP5A 4KT2A 5EU9A 1XS2A 3EEZA 1MDLA 3VA8A 2GGIA 3H8AA 4H2HA 3P3BA 1ECQA 1KKOA 3PFRA 2OX4A 3I4KA 3GD6A 3VCNA 3OZMA 3UJEA 4DYEA 2OQHA 2QJNA 1MRAA 3T9PA 3VDGA 3T8QA 2QQ6A 4GIRA 4J1OA 2PS2A 1R0MA 1MDRA 4ENLA 1BKHA 2OFJA 3ES8A 3DFYA 1WUFA 4HCHA 2QDEA 4GYPC 2O56A 1ELSA 3MKCA 3T6CA 4MKSA 3SQSA 4GISA 4HCDA 1EC9A 3CK5A 5BOFA 2XH7A 4IL0A 3KUMA 1R6WA 3DG7A 2GSHA 3IJLA 3K1GA 3CT2A 3RO6A 3PK7A 1JPDX 1E9IA 2ZADA 2PU1A 2OZTA 3MUCA 2PP1A 1MNSA 4MMWA 3IJIA 3RR1A 2XH0A 3UGVA 3GC2A 2ONEA 3SN1A 2PTWA 3DIPA 3MZNA 3R25A 3IJQA 1ONEA 2OZ3A 3QTPA 2NQLA 3DFHA 5BOEA 3R10A 3EKGA 2XH2A 3TQPA 3VFCA 1TZZA 3NZGA 3CYJA 1XPYA 1PDYA 4IZGA 2OLAA 3H12A 3FJ4A 1KKRA 2QVHA 3UCDA 1TE6A 2P88A 5FJTA 4GGHA 1JDFA 2DW6A 1P48A 3D46A 3N6HA 3UJ2A 2FKPA 2OVLA 3QKEA 4IT1A 1SJBA 4DXKA 5J04A 3QN3A 3B97A 1EBHA 1FHVA 6ENLA 4K8GA 3NFUA 2XSXA
chains in the Genus database with same CATH superfamily
3CO8A 4V1YA 1YPIA 1D7KA 5HR6A 4K7VA 4PBEA 2WVSA 1B4KA 1TO3A 4TTUA 3GXIA 1UD6A 2VR2A 1GXFA 4ICCX 4Z2LA 2PWFA 2EPKX 3BLKA 5H1WA 4QBXA 3T44A 3SGZA 2JE8A 3DERA 4YXGA 1WKEA 3T08A 2BGQA 2INFA 5C2XA 2RKXA 4UQAA 1HJQA 2UY3A 3KZPA 4AVFA 3O05A 1FH8A 4JIEA 3CAQA 4ZL1A 3HPZA 1WO2A 4QLKA 1O5QA 1F3XA 2NLYA 1J12A 3R1ZA 5JXQA 1O66A 3TW7A 1XR2A 5CBBA 3TJXA 4O19A 4GBUA 3TP4A 3PNZA 3DDMA 4UTFA 3MWAA 4OHQA 2QCMA 2R82A 3MUZ1 2GJLA 1W5MA 2J13A 1R46A 2UWFA 3V1HA 4EKJA 4ZQCA 3CIVA 4KCTA 3ITOA 2QMKA 1M68A 4C1KA 2YCKX 4MHBA 2ASHA 1L6GA 4IMFA 3RRXA 5HAOA 2VGGA 3BO9A 1IEWA 4G7EB 1XBVA 4GH3A 1FDZA 1GYMA 3WQDA 1T8QA 3AHYA 3GHSA 2VZTA 1EOMA 3PG6A 2GGJA 1UUMA 5I23A 2O4MA 4A6GA 1LBMA 1KBBA 4LUIA 2BODX 3GU1A 1UR2A 4AWTA 3VVGA 2VYOA 4X9YA 1S46A 4JL1A 2GJXB 4WLCA 3N9KA 1AMKA 3LXBA 3T1GA 1VBRA 2AQWA 4M5PA 4YS1A 3IIVA 3L0NA 4JQ1A 3O9NA 4NJIA 1UA7A 2AL2A 4HN8A 3KOZA 1L2UA 3RJYA 3I10A 1X6UA 4OTKA 1XSJA 5A6AA 2P53A 2E6FA 1UR3M 7ENLA 3A13A 2ZZ5A 3CUFA 2PI6A 3T0AA 1XG3A 5CSSA 2QJIA 3M64A 4HNTA 2WCGA 3NYDA 3QR1A 4AY1A 4BCEA 3V35A 3DEQA 2R1MA 1D8WA 1ZENA 2P3EA 3RN6A 2WJEA 2Z00A 2D2OA 1KO0A 4FX9A 5LA0A 1XX1A 2JIWA 2VRJA 2P10A 3NVYB 4LAUA 1DP0A 2F6XA 3KCLA 3W85A 4ZQRA 4CD6A 3MWCA 1TV8A 1US2A 3OZYA 4H00A 4HIBA 1NP0A 1Q5MA 4UUIA 1XYFA 3M4HA 1BQCA 4FAMA 5CGMA 5I09A 2QJJA 4NRRA 3W2UA 2BVWA 1OK4A 2HROA 1HKJA 4E2DA 1S2WA 4A8IA 3C5QA 3B05A 1NP2A 4Q8UA 3ZVIA 4ACZB 4WUIA 5G4EA 2IQ0A 1GRHA 1VCVA 1AQFA 3RM8A 3AHTA 3GD3A 4UQDA 3FVDA 1XRSA 1I6NA 3GRSA 3HGJA 5C54A 3M6DA 3T0BA 3TYAA 1ADSA 2NZLA 1KW1A 4C5ZA 4HNOA 3R0UA 2I17A 5HULA 1M5WA 3WEOA 3H2FA 1CGYA 1V79A 1SZNA 3S47A 3FKRA 5IBXA 4UQCA 7PTDA 1QW9A 3GVVA 4WRHA 3L4TA 4UTWA 3W81A 1E43A 1OJTA 1LROA 4HZ7A 2OO0A 1G4TA 2OG9A 3HV9A 5AC6A 1H09A 3W7DA 3W7KA 2RHGA 4G2DA 2UV8G 4ATWA 5I03A 4IHCA 5LHFA 1GOIA 1NF7A 4KW2A 3EKZA 2GR1A 3V5OA 1HKVA 1O95A 3G0XA 4H8HA 2XFFA 2OX4A 4FPSA 2YJQA 2CDUA 1EGMA 3B4UA 5CPLA 3TA6A 2A2IA 4MADA 2PDUA 1VQZA 4GJJA 1FWSA 3GM8A 1PCWA 1I75A 1R8LA 4WHBA 1R0MA 5CQ1A 3VZXA 1MW1A 3JUGA 1NQ6A 1QWKA 3H7UA 5CC7A 3BLLA 4PL1A 1JPIA 2SFPA 3WBYA 3E49A 3GW0A 3LHUA 3MKKA 2YW3A 4LYRA 3RM4A 2BOFX 4UQEA 4F79A 4NNCA 3C3NA 3HZ3A 3BTNA 1C8YA 5EBAA 3CZJA 4LTSA 2Z2AA 3HFYA 2DZAA 5T9BG 4ZTYA 1K4HA 5DY3A 2G3JA 5FS6A 1NOFA 1XLLA 3GVRA 3EWUA 3THAA 4JTAA 3VD9A 2WM0A 1HO4A 1VEMA 4PUMA 3DH7A 3TOPA 5MF5A 3SY1A 4O16A 2RFGA 5GJMA 4B5UA 1QHZA 4Q6JA 4C90A 3NM1A 3R25A 2PDJA 1E6XM 2X16A 4Z2KA 1VIZA 3R58A 2NQHA 4I90A 3CWHA 3C0JA 3EMCA 3VGBA 4O13A 1MXSA 3NZGA 3QXBA 1UR8A 4QGCA 1SSDA 3AHXA 1TJRA 1ZCCA 1QOXA 1Q6OA 2D24A 2A3CA 4WGHA 4IMEA 4PN2A 1WAWA 5I24A 3UJ2A 1THFD 4I6VA 3UCQA 1IEXA 1JCNA 1A5MC 2EEXA 3EWXA 4GVGA 2VOMA 3GIQA 3QQ0A 2BGNE 1Q6CA 2RDUA 1OFDA 3IACA 3GVWA 1R3VA 4PMZA 4CNTA 1H51A 3QQWA 2OZ0A 4D6EA 1EX5A 1XSKA 3GNRA 1HW6A 5I07A 5DY2A 2HXTA 3FGCB 4G9PA 5D2YA 3VKDA 4FXSA 4WR3A 5HOSA 3O0FA 1G7VA 3UWUA 4HPNA 2Y8KA 3ARPA 2FPVA 4WSHA 2WBGA 1MQQA 1MNZA 4IH3A 1DV7A 1VBUA 2CIPA 2VT0A 5D09A 5FJRA 1VFHA 4JTHA 4XKYA 2DZVA 4D6IA 5C9RA 3GBDA 4O0KA 3DC0A 3ARUA 3ARYA 4Z42C 3TNBA 5IHRA 3QFEA 3DFQA 1U22A 1CBGA 4GMEA 4BWLA 2B7OA 1LF1A 3WNMA 4DIAA 4NY2A 4MYXA 3S1UA 4GXWA 4Y2WA 4ZSUA 3RDKA 1LLWA 1JEHA 3BG3A 4H8VA 4RZBA 2HISA 4GXMA 2A3BA 2RJGA 5FACA 5B80A 1WE5A 2HQMA 2UY4A 3Q45A 1R2SA 1B3XA 1QMLA 3NQ6A 2WZEA 4O52A 3P81A 5RUBA 1HUVA 1KN0A 4PB4A 3MS8A 5REQA 1OZMA 4M29A 4S3AA 5E70A 4JDBA 3UA3A 4FOJA 1DEDA 2YDSA 4AF0A 4EPKA 4MWAA 4AFYA 3T09A 4ZMGA 5T91A 4FIRA 4NXSA 5I3DA 3CHVA 3UWEA 1PHWA 3JS3A 3W23A 1F6YA 4DPQA 3PTMA 2V67A 2WCSA 3P5ZA 1DOSA 1ZBVA 2PODA 3QR0A 2ZZ6A 1QVBA 2QULA 2YXOA 5C0QA 2WSKA 4ML4A 5FA5A 5C71A 3H7VA 1BHGA 1AUSL 1XICA 2ALRA 3AWOA 2CZEA 5A2AA 4UQBA 2I5QA 1P7TB 1SR9A 4LH8A 4DJEC 1KM3A 1QI4A 1D7FA 4DX3A 3II1A 1DXLA 2X7VA 3FCPA 4H9XA 1XDMA 4E2VA 3A3HA 1IEQA 1NVMA 4L80A 2DSWA 3IRDA 2ZX9A 4FX7A 2BG5A 5BMWA 3PZUA 1HJUA 1STZA 5CG7A 4M51A 3SJ3A 2ESCA 4HK5A 5A94A 1EP1A 2EPMX 3OVRA 1TUFA 5F1VA 1YQZA 2E5AA 3WSUA 1GTHA 1VFOA 1YIXA 3TXVA 1XH1A 1NWSA 3AXMA 1JAEA 4ROQA 1IXQA 3L2IA 4C91A 4KGLA 2NW0A 1ZB5A 4HMEA 3V1PA 2OT1A 3BLDA 3N9SA 1LLZA 1V0MA 3G1YA 4ECLA 4JKKA 3OG3A 2OPJA 3UJRA 1W1VA 2PLMA 3SUTA 5A8MA 4Q7BA 1H7RA 3ZM8A 4JTSA 1RAKA 4UMAA 4HA4A 4Y9PA 4W85A 1Z42A 2D0HA 2QJMA 2BXVA 5FIPA 3TN4A 3CMJA 3KL0A 3NQ8A 1GRBA 3K13A 1TV4A 2V5JA 2VZVA 1SGJA 3N4FA 4JQ3A 3VKKA 1P1MA 3P93A 4H9YA 4JQ2A 3W26A 3DJJA 2CFYA 2W67A 3R11A 1QT1A 4KFPA 3IIOA 4IPNB 1NHPA 5CPTA 2EAWA 3VKAA 1B31A 4TVUA 1Q85A 3WLJA 4DZIA 5BWFA 1XLFA 4JYEA 4XD6A 4O14A 4Q4KA 3NVTA 4H6RA 3EXRA 3AIUA 1B9ZA 1QU4A 3GFXA 3BDKA 1ECQA 2W54A 1RCQA 4IG2A 1QBBA 3UXAA 5CH9A 2F8QA 2FTPA 5CXPA 3OIHA 3GIPA 2C1HA 2I56A 3IGXA 5AKQA 2C91A 4A3HA 1OYAA 3GTIA 3OA5A 3GD4A 4AZ6A 4R9OA 2QV4A 1PB0A 4FLRA 4W4QA 3W7NA 4APNA 3POHA 2XTKA 3CO4A 3SW6A 2D22A 1LQ0A 4WDXA 3NXFA 4QQUA 3W2MA 4N6EA 3RLVA 2X8RA 3I3EA 3MDUA 1F6KA 3LLDA 3SQSA 4NUWA 2XM1A 4D6GA 1DTUA 1EC9A 3GNXA 3Q37A 2WHKA 2J8FA 4XSLA 1OABA 2CYGA 2WM1A 3NQAA 4QHRA 3SY8A 4DUOA 3F4CA 4TMBA 3WEZA 2ICSA 4UNKA 1TTPA 1EA9C 6PTDA 2ZADA 2PU1A 3VO0A 2F2KA 1FUYA 3VYLA 4MLJA 1PX3A 1WB0A 2NVKX 1DE5A 4UFMA 3RR1A 4WY0F 1A4MA 3O6DA 1Z8AA 3BAYA 1GRFA 3WIJA 1BG4A 2W79A 2OSWA 5BOEA 1XXXA 1YNPA 4M6VA 2VP8A 2Z0IA 3ARZA 3ITXA 3NQEA 2XGBA 3ME3A 1TYGA 5A6KA 3H24A 3GVQA 4RDYA 3W1PA 3VCRA 4GGHA 3A9IA 1V6VA 4S3GA 1P48A 1U33A 2Y1HA 3N6HA 5GNYA 4E3TA 3M5XA 3IARA 4UR7A 2XYLA 2WOIA 4DZAA 4YYFA 2OVLA 3VPLA 4H9UA 5FL0A 3SCTA 2ISSA 1H5VA 3B9OA 4AVNA 3PZQA 1MXGA 1BYAA 2VFGA 4PC8A 3CH0A 2V38A 1IIHA 1XI3A 1UZ1A 3EZ4A 2GJRA 1HKWA 3KHJA 1GKPA 3GTHA 3LN3A 4MTVA 2OEKA 1JPMA 3G6MA 1W9UA 1EGZA 5G2HA 1W1A1 2XIIA 3RK8A 1U5VA 3S8HA 1WZMA 3GZAA 1H11A 2E9LA 1VGAA 4ZO9A 2WJZA 4DUXA 6TAAA 3UXLA 3B0YA 4LUTA 4PODA 1FFUC 4DF1A 1O5RA 2PD5A 3M0JA 3ES7A 3K1DA 2PLJA 2QYGA 1PKNA 1Q2SA 2NX1A 4O1BA 2ON3A 1JCTA 1ISVA 2ACUA 3NVDA 3W82A 3O1NA 4L1XA 5D9OA 2OOGA 3HGSA 1J18A 1IT8A 2Z1WA 5HNRA 4IXXA 2I1OA 1YE4A 3GYCA 1R3WA 1FIQB 1QBAA 3WQ5A 3A7RA 3MSYA 4NASA 4S23A 1OT2A 1QW8A 4QIUA 3TTSA 3WQ4A 2UY2A 3R6IA 2V0TA 3RO8A 3N2OA 2B7NA 2GPTA 2YBTA 3NQDA 4LF1A 5FSDC 4JEQA 2EPOA 2E1DA 3VCCA 2PDGA 3VUPA 1PV8A 2RABA 1FWRA 2DIKA 3WD4A 3G0SA 4B2DA 4PMXA 4JY8A 4AEFA 1TX2A 1UR9A 2VD9A 1H7XA 1XD0A 5MHBA 1P0KA 1J0HA 3RU6A 3W25A 4EMIA 1MWOA 2C79A 4MWAD 1MRQA 3CTTA 3VU2A 4GYFA 4J35A 4Y9OA 4D9PA 3IJDA 3O2LA 4JFUA 3SCNA 5C6MA 3LTYA 2BC0A 4GO9A 4DXXA 3UR8A 2B81A 2ZRZA 4AD0A 2PDPA 2QGHA 2C16A 4INFA 4LFYA 4XZ9A 2V5CA 3AMLA 3N3TA 5I3IA 1BWKA 3S9IA 1RK5A 1WAUA 1OCNA 4RE0A 5D37A 4HU8A 2WB5A 1T0OA 5A6MA 1DWJM 4DELA 1S5NA 4BFAA 3URNA 2BV9A 2D0FA 3Q67A 1E5JA 3DBNA 1OF8A 5EMMA 1N61C 4XTIA 1N55A 1GOKA 3D0CA 3SN4A 1XFCA 2A6NA 3AU2A 3M0HA 4OOUA 2V30A 4FNQA 1TJ2A 3G1HA 2E4TA 2QVNA 4UFJA 4XZMX 1MFUA 2YR1A 1R3SA 1C93A 5JH1A 1C9DA 1CX9A 1VF8A 4K6AA 3PZOA 4ZR8A 4PTMA 4Z2IA 4RW5A 4XAZA 2PDYA 3GC5A 3VNMA 2O9RA 4YTRA 3N19B 3VAVA 2YA2A 3NSNA 4AIOA 2QIIA 1WOBA 1VYRA 5K3VA 3NSXA 5HMFA 4C5YA 2NUXA 4J5NA 3K5XA 3QPEA 1UIPA 4O1AA 3OZPA 2VEMA 3OVPA 3M16A 3W7RA 4FNUA 1PIFA 3TYDA 1QNPA 3FAXA 1VH7A 2XUCA 3SSZA 2G96A 1H61A 1O12A 4P7LA 2HRWA 2DW7A 3PJXA 1OGGA 3QY8A 4N02A 5JCLA 3EXSA 3WBAA 4CQAA 3R43A 3QR3A 1OB0A 3OLIA 2ATMA 2G3MA 3TA9A 3H4GA 3GFYA 3C56A 2ZYFA 4AHPA 3LENA 1M6JA 1B30A 2XGIA 3B04A 3BOXA 2YDRA 3BK0A 2P8CA 3WH6A 1GK8A 1AFSA 2VX5A 5EU9A 3VKBA 1MDLA 5LNUA 3OYZA 1F8WA 2V2DA 3F1QA 3UG8A 4AZCA 4QLJA 5EBUA 2A4AA 1DORA 1ESWA 5CJNA 1VYPX 4EACA 4DPPA 1TR1A 4OECA 3VDGA 3SI9A 2QQ6A 3IJ8A 2J47A 4WXYA 1MDRA 2A3HA 2HMCA 1GONA 4BEQA 1KWKA 2DFAA 3N1AA 1VFSA 4FNRA 2CWNA 4XBKA 3VOFA 2GUUA 1TV5A 4HSOA 5E6YA 3CK5A 3F03K 4DNHA 4GR1A 3LYEA 4L4PA 4PMJA 3QLLA 3TZFA 4UOJA 2ACQA 5G5HB 2PDXA 1J6PA 3NQVA 1K4GA 1FWWA 1V6TA 4PMVA 4IX0A 4A3QA 3M7WA 2OZTA 1F4HA 2PD9A 1W5PA 2E6DA 4PBGA 5A6TC 2GVLA 2VQUA 3KBWA 1V6YA 5DRIA 5TF0A 3LBOA 1M7OA 5AC5A 9RUBA 2W6RA 4HA0A 2ODOA 2G0WA 1EJVC 2OWXA 2G97A 1N5XA 3C3UA 1CT5A 3KDOA 3P6LA 1RR2A 5G5GB 4M56A 4FA3A 2Y70A 4KPRA 1QNVA 1TPC1 1TPB1 3LNMA 2CLMA 3BUVA 1YNYA 2VUNA 1CB2A 1JDFA 2WCAA 1K9EA 1IF2A 3GDRA 3NTYA 3BGGA 4YPJA 1M1BA 3M5ZA 4HSHA 1HO1A 1EJRC 4QLLA 4QISA 3DI0A 2QCGA 4M8UA 1CYGA 3QBUA 2VI0A 5AYBA 2CZVA 3BOLA 4R34A 5I0DA 2VHLA 3W88A 1ZJHA 3QN3A 2NWSA 3LY0A 3YPIA 5KVIA 3SY5A 3WLLA 2Y7GA 1GVSA 3VMPA 3TC6A 3B4YA 4L5ZA 3STEA 2P3ZA 2OQYA 2IQDA 3ZMRA 1LL4A 1V08A 3P8JA 4NEWA 2X0SA 3MT1A 1Q7QA 2TODA 1X7FA 3V75A 2J7BA 1GVFA 4W8AA 2A8XA 3O6YX 4KCWA 2FPTA 2H6RA 2JK6A 4JTEA 2PC4A 4AD2A 3SGGA 3EDDA 5AHIA 5EY5A 2G41A 1J9YA 4NNAA 3I6TA 5AHLA 1JPHA 5JIPA 1A5KC 1PX4A 3W7CA 4H19A 1GG0A 2ZZ1A 5E5CA 2ZUSA 1OZQA 3SFKA 2QAPA 1BXBA 3BVJA 2WSYA 3QV6A 1V0NA 1UKOA 1CW2A 4RNJA 3WQCA 4GRTA 4REQB 3CT7A 3SBFA 4LGXA 3M0ZA 4DLFA 4HA3A 1S2VA 3IGHX 4IICA 4UTJA 1ICQA 1AH4A 3LGEA 2ZZ2A 2E3TA 1ZAIA 5F4SA 1PTDA 2W66A 4R88A 5IHSA 5U1OA 4JYDA 4PYSA 1LPFA 3U7VA 2VELA 4KH2A 5LGZA 3CPUA 4GE8A 4RW3A 1EQCA 1FQ0A 1GSNA 4DYKA 3VMNA 1MZRA 3A7AA 4ZO7A 1K4QA 4A2RA 3S5NA 4HNUA 5ECUA 1K6WA 5TR3A 3MCMA 3NGFA 1LWJA 3DYPA 3R0DA 3IV8A 5HQLA 3TJ4A 3Q6JA 3Q2DA 1L6YA 4OV9A 3B0PA 2NVAA 1UQZA 1NWTA 3LDVA 3QPZA 2CLLA 1S1PA 1ZZMA 2Y5EA 1VCFA 4BQ2A 3W6LA 3HPFA 4FIQA 4L56A 3IJ7A 4K3ZA 2OQLA 2BSLA 3ISIX 1MW0A 3TMQA 3M43A 2W91A 2PU0A 3G1XA 1TCDA 3BV7A 2BC1A 2AL2B 4DJFC 4FNTA 3CXOA 2DEPA 1GEHA 4AZ7A 1X98A 3RIKA 3B06A 2VR4A 4DF0A 1E4IA 4D6CA 1DIKA 1TVLA 4L6OA 5I6SA 2DZPA 3IGSA 4O11A 4PCTA 3CQHA 1J0IA 4OWGA 4UNIA 3P60A 4GZ7A 3AIEA 1ADDA 4CU6A 5FJJA 2OYLA 4H4QA 1TPDA 4WKFA 1OINA 3KTSA 4MB4A 3CAVA 4QJ1A 1H7OA 3KL5A 4MY8A 4QAIA 3BG5A 3ANUA 4US5A 3FEQA 4B92A 2KAUC 4GNVA 5FKYA 2Y89A 1Y5VA 2H9AB 3MP5A 2XIMA 4PFHA 4P2VA 3WQGA 3NM3A 2V2CA 4PUUA 5HATA 3S5SA 4S2BA 1E1EA 5E6ZA 1RVKA 1P0NA 3CZKA 3EAOA 4J7RA 4JX4A 1CENA 1AQ0A 3F2CA 2D2HA 4PMOA 2J9YA 3GTNA 3PWIA 5D30A 1QI2A 1SYTA 4KEMA 2Z26A 2EQ9A 1H7WA 3M44A 1WYIA 1XIFA 3SZ8A 1CNVA 1EIXA 3SECA 3CH9A 4PH6A 2RDWA 2CLOA 4GUIA 4Y7EA 1A80A 3EWBX 3VD7A 1M03A 1NELA 3C0SA 1H6VA 4NZ4A 1YEYA 4YVVA 2HXUA 4YTQA 1YDVA 2PDHA 3W7HA 1IR1A 1IE7C 2C7FA 2JQXA 5FD0A 3D47A 4PTNA 3WLNA 3UVAA 1W37A 2YDQA 3QEZA 3W7OA 3O06A 4E2BA 2PEVA 1NSJA 4C7DA 4Y9MA 4GYKA 2INZA 4CCCA 3H23A 3CZGA 3LCGA 3VNZA 1OFAA 3S83A 1KKOA 2WMGA 3GXPA 3IUHA 5KZMA 1UD2A 4HNVA 2WC7A 3M9YA 1ML1A 3AFBA 4RZ4A 3U5UA 3VIOA 1WDSA 2NX3A 3N3MA 4U3CA 3SQLA 1LM1A 2YVGA 1UBPC 4JTDA 4JX5A 2PGFA 5EPDA 4GKTA 3DH9A 4B91A 3CUHA 4GCXA 4JNMA 4IMGA 1K02A 3CS2A 1RY0A 2OX1A 2I57A 5EYWA 3MV01 1H7NA 3PM6A 1N2VA 9CGTA 1E72M 1B3YA 3ITYA 1UW9A 2O9TA 3SUUA 1NHRA 4HGXA 4XISA 1DWAM 1BVWA 1O1ZA 2G3NA 1EWEA 3LG3A 4NVTA 1F3TA 1L6SA 4C65A 1E6SM 1VEOA 8XIAA 1W1B1 1BYBA 1XLHA 3PK7A 5CPQA 3AU6A 2AAAA 4Z08A 4MUPA 4F48A 4RX0A 1KRCC 1AVAA 4EPEC 1DIOA 4E3VA 4N9BA 4ILSA 4CU8A 3PZNA 5D4YA 4MMWA 1WZKA 2A0NA 3ZO9A 2C3DA 2OEMA 4R33A 4XIAA 4W5UA 3APTA 4NG3A 2J7GA 5C9UA 3CHDA 2VCBA 4G7EA 1GW9A 2H3BA 2PRMA 4DJEA 1OIMA 4KWVA 2JEQA 3E5BA 5D2VA 3IIZA 4Q8OA 2ISDA 3WENA 2UZ9A 1G69A 3TCEA 3C6CA 5LIWX 4LAMA 1HIZA 5G2IA 2VOTA 3WQ6A 3EPOA 4Q4RA 1VFUA 3MJMA 2B4GA 2FDSA 3VIHA 1UMLA 5AYXA 3AALA 1CZ1A 1OK6A 3BSGA 1SO3A 2GJXA 1N8WA 1YPFA 3A5VA 4JNYA 4HB7A 3GXMA 2BP1A 1UC5A 4XVDA 4PBFA 2ZXAA 1AQMA 2FGBA 4EM3A 1TV3A 1XLJA 3QHMA 3VDAA 2HVNA 2FH8A 1PTGA 1SO6A 1SR0A 1FKXA 2XGZA 1QK2A 3CZLA 3LA4A 2Y88A 3KXQA 2VRQA 1JDEA 4D8AA 4Z1CA 6XIMA 1XQKA 4QJ4B 3DAQA 3EMZA 2CLPA 3LUTA 4O4VA 4CN4A 4ZGYA 1WV2A 3F7JA 5DT7A 5TIMA 1KM0A 2VURA 1ZP4A 4F2UA 2GOKA 3LGGA 2OEJA 1J96A 2FZ9A 3LRLA 2WPGA 2DPEA 2PWDA 3OGSA 3E0IA 1G9HA 5F2IA 3WQOA 2DZXA 2ACRA 2IS7A 3NO5A 1I4NA 1E1FA 4DI8A 4ICNA 4HYWA 3IWPA 1N60C 3GUWA 1JI2A 1JCXA 3QW4B 3BC9A 5XINA 5CKSA 1KXVA 2NQJA 2EG6A 1FRBA 5FAGA 2YKKA 1AMYA 1KCZA 1A5BA 3HQNA 3BLIA 4ACZA 4EANA 4I5UA 3W02A 1A0DA 2QCCA 4OUIA 1XIIA 4QM1A 4RNIA 4B5TA 4AEOA 2FHFA 3M6YA 3V5CA 3NOYA 4KF1A 5B7ZA 4NRSA 2POTA 3S1GA 3RAOA 2REQB 2DIJA 4FLSA 4BK9A 4GXPA 1OG0A 4JAWA 4TX8A 4KWSA 3FW6A 2HZGA 4AXKA 2EF9A 1EC7A 1B5TA 2E77A 3E1F1 4DEFA 3N2CA 2GVYA 2Z2BA 4GD0A 5H6HA 5HDRA 1DTNA 4NX0A 3SCRA 3VM5A 1HX0A 2IKJA 1V3LA 1FWEC 3PZTA 4P5UA 3FXYA 4JIQA 5REQB 1MEHA 1FCBA 3TN3A 1DXFA 2IKGA 5AHEA 1P0EA 3ANYA 3W6YA 5C70A 2PTYA 1KGWA 3NVWB 5CGTA 3AC0A 1UOZA 2W27A 1LT7A 1RY8A 4MWAB 4U4MA 3UR2A 4ZEPA 1F5ZA 3EDFA 2E5DA 3DHDA 4PUKA 5HPOA 5CBJA 3FDKA 2OOFA 4WCJA 3LXDA 4KWOA 3TONA 3AJXA 3F5JA 4PUJA 2QT3A 2JEPA 4K1WA 3EA1A 1EJWC 3C2OA 3JU2A 1K8CA 4TX9A 5D32A 4MSSA 4Q4PA 3AQUA 4N7QA 2F38A 1TTIA 4YHGA 3UCCA 4LXFA 4LCQA 3Q65A 1MOKA 4OT7A 1E6RA 5CZJA 4PE8A 3W74A 4ZXOA 3KAOA 4XAGA 1CXLA 3LXCA 2OO6A 3F4VA 4M3PA 4V2XA 1BVZA 2YFNA 2YW4A 4C6MA 3KBNA 4US5D 1LT8A 1UH3A 4NAFA 1VPQA 4J40A 1EO5A 5AHNA 1JUEA 5JCMA 5A2CA 4GZEA 1R3RA 1Q6DA 2XWEA 2WZTA 2J27A 1S3HA 4DO5A 4EM4A 3QOKA 1G1YA 1ZTVA 3LBCA 3G18A 3EUB3 2PA6A 3CIWA 3PC0A 5DO8A 4GC4A 1HJVA 3O0HA 1GOMA 4DBEA 1TVNA 4YTUA 2GQ8A 3HGRA 5SWUA 2EXOA 2AMXA 3FFSA 1JF5A 2OJPA 2YQUA 2Q8XA 3GG1A 4KPLA 5C9ZA 4F66A 2C13A 1KXQA 4Z1YA 3WK2A 4GUFA 3OYXA 3ABRA 5CSUA 4NI8A 1E9ZB 1E0XA 5DT5A 1S7MA 6CGTA 1H1NA 2OMAA 3ZFHA 2V3EA 1RQEA 1WKFA 1V0KA 5L6UA 4RXGA 2P5NA 4DZ5A 1L2QA 3BOFA 1Q6EA 1PWLA 1W1IE 3PY2A 2YLLA 3MV11 3P0XA 5ECVA 5D2TA 3DHPA 1CI1A 1AL7A 4MOZA 2PDMA 2DP3A 3VDHA 5LA1A 1A0CA 3CEUA 3MP3A 3TTQA 1JCJA 3GXFA 3HIJA 4JIPA 2Q3RA 1YADA 2EJAA 3A24A 3B3DA 3VMOA 2Y5JA 2W62A 4AYSA 1JRCA 1AQHA 3A3WA 4JEJA 3UJEA 1BGAA 2XZ9A 4YCOA 4IG2B 5A69A 3H4KA 1ITUA 3QSTA 3VI2A 5K4ZA 4NAEA 1NY1A 5CJ5A 5A8PA 4UFIA 2DT0A 3S4TA 1XRVA 3QPYA 3HBLA 5FJIA 1BKHA 1UR1A 4EQXA 4GUGA 3N18A 1OX5A 4NI3A 2E40A 1P5BA 1HGYA 1E56A 3Q58A 1ELSA 2PWUA 1KRMA 4FR1A 1G94A 3DHFA 2I5IA 4O0ZA 4HMCA 4EMWA 2DJXA 3L0KA 1T5AA 2CERA 1E4MM 3HPAA 3P84A 3DG7A 4U2ZA 5GPRA 3OLEA 2VRKA 1H1YA 1SB3B 3M07A 5E09A 1UA3A 1IXOA 4C7GA 3NAVA 1OFEA 1VENA 1U83A 1R2TA 3VOIA 1BG9A 1RLCL 4LJ3A 4Q7IA 1QATA 2XH0A 1O5XA 4FX8A 3MHUA 3PB0A 3VGEA 5G1TA 5BXTA 4HZ6A 2IQTA 1XYCA 2EJ1A 1EF2A 4DJED 3A7UA 4PUDA 3ARVA 2FHBA 4X9SA 4PRTA 6ALDA 3OU8A 3KBVA 2XVNA 2A1YA 2VEGA 3FJNA 3UFYA 2WPBA 3NQGA 3KFTA 1QNOA 4IZGA 2Q8LA 1MW3A 2WZMA 2Z24A 3UQNA 1B0IA 1VRXA 1BFNA 3FY1A 1MW2A 1PWMA 2DW6A 3ZT7A 1DL3A 4BQ4A 1UOKA 1IEVA 2A79A 1CLKA 4OFCA 3WL1A 2QPXA 4Y9AA 3CEPA 5KZEA 3T4CA 4MDPA 1NAL1 4BQ3A 2CETA 2FGZA 1HKKA 2A5HA 1FHLA 4IMAA 2JGQA 3CQJA 3PPCA 1JUBA 3KTCA 1DHPA 1UKSA 1VZWA 4DZHA 1T8XA 5D8ZA 3OTRA 3BSMA 2FMOA 5HNTA 2VC6A 5FESA 1QPRA 4OJYA 3MHFA 3WZ0E 3HG4A 2D20A 1F2JA 1P7TA 2E8YA 4FF5A 2QW5A 1FFQA 3PPGA 3DX5A 3CAKA 4CVUA 4PCSA 3W7PA 2CITA 2XJ7A 5IOBA 5EMKA 3WLMA 4RPPA 1AJ2A 4FZIA 2NUWA 1NOWA 4LUTB 3W9ZA 3S5ZA 3WN6A 2WJFA 4MFDA 3RCMA 3EDEA 2CXEA 4NL1A 5FJPA 2QF8A 4PCNA 4EQRA 4EP8C 1T6MA 3VIPA 4HU4A 3C4UA 4NNBA 3E3HA 3TR2A 1VJSA 4POCA 1MUWA 1ZALA 4NZJA 3SM0A 2YPIA 5HJXA 1EXPA 3SQMA 5PTDA 2Z2UA 3R12A 1IZCA 4HBKA 3G1AA 2XVGA 1EP3A 4A3RA 1KFEA 2EQ6A 4DN1A 4LRSA 4Q4SA 1OIFA 3UG4A 3LS9A 2DZWA 2NWRA 1Q6RA 2OSXA 3VGGA 1AG1O 3BMWA 5U4NA 3S1XA 3I3BA 4JFVA 3GAYA 1T7LA 5AHMA 5HXMA 4PB3A 2PP3A 3UXKA 2QDGA 5M2FX 3ZT6A 4TTGA 3E38A 3WJSA 1XUZA 7REQA 4RJEA 1ONWA 2ANUA 1O94A 4WOZA 4URIA 3M41A 4ZSTA 2Y7FA 4KKXA 3T42A 1NFPA 4IX2A 3CJPA 3ZJ8A 4BZYA 4IFOA 4ZQMA 4A35A 1LUCA 1EA0A 1F8IA 1BKSA 2G8ZA 1EQPA 4LVDA 1V8EA 2NQ5A 5KZDA 4G8TA 1FH7A 3IJ6A 3K4DA 2WANA 3FYOA 3OJGA 5EGRA 5I00A 4GK8A 3GRTA 3W0KA 2C6QA 2ZX6A 1FFRA 4DVOA 3L5MA 3FLUA 1DXIA 3CV7A 1AH0A 1EYWA 3N4AA 4R7WA 4EMJA 1Y65A 1PZ1A 1ZY8A 3M1ZA 5TQLA 1FKWA 4AZBA 3EGJA 4C6JA 1TJPA 1AK5A 3ARSA 3SRHA 1XISA 2Y61A 1P6BA 3MY9A 2QDHA 4RUBA 1DNCA 1W3KA 1PDZA 1YTDA 5BWAA 1K3UA 3GBEA 2V68A 3EX2A 1JOAA 4JCLA 4F0MA 4XK2A 1QI0A 1WYGA 2OELA 2X30A 6REQB 4UR9A 2I16A 5BYWA 3TW9A 1XLKA 4M0XA 4ZCWA 1W54A 4C6KA 5LKYA 1JXKA 3IIPA 3QZEA 3TMLA 4I5RA 1V77A 4HK6A 3UVIA 3TFXA 1VCGA 4H4SA 4J3TA 2A7RA 1SW7A 2E25A 4OE7A 4JL2A 3SIZA 2P0IA 1XV8A 3W27A 3FVMA 3VNIA 4CKQA 4MKNA 4I5XA 3L2LA 1E0TA 3E0WA 3ECQA 3NEVA 1SFJA 2ZX7A 4GA8A 1JFHA 3MPGA 4GQRA 4LEQA 3HGOA 4IUGA 4DXVA 3H21A 4HQVA 3KWXA 2W0HA 1EUNA 4AVOA 2VX7A 5DMYA 4CNSA 1XH0A 4KT2A 1FY6A 2PF8A 3GNOA 5CLWA 1GJPA 1UWRA 3FDGA 1YTEA 2FFIA 4XTDA 1VDVA 1AH3A 4IPPA 3VCNA 1VEPA 1JDAA 4DYEA 3WUEA 4AZCB 2QXWA 3O0KA 2DVTA 4J2MA 5F4WA 5U25A 3CC1A 2QCEA 4K38A 4J3SA 4KEZA 4EX4A 3WCZA 3V7PA 1RSCA 3W1NA 2RJHA 4ZOCA 4RK8A 3DYMA 3R8RA 2DJLA 2CKRA 1QI3A 1S2AA 1UR0A 4O8AA 1RV8A 3BW4A 3STGA 3ABXA 2WLYA 4Q7NA 1F3WA 3I7RA 4ICMA 4XZNX 2ZICA 1XWYA 4WF7A 3EPNA 1ZNNA 3BXWA 2BOGX 2WMIB 2ZCGA 3LB8A 3CHFA 1SFSA 4DJFA 1RD6A 1E0UA 3HQ1A 4S38A 4XAYA 2X05A 4HMDA 3NVVB 3G24A 1MNSA 3CQKA 5LNWA 3S6OA 3IJIA 4EXQA 4GIEA 4GQGA 4LSBA 3UESA 3QQ1A 3EAUA 3V18A 5FF4A 3TQKA 7TIMA 2OYMA 2X0YA 2YLAA 2EO7A 3IS4A 4B4HA 4UCGA 4CVWA 4FXJA 2XH2A 2YFOA 4WDUA 1UJPA 1KWGA 2F84A 1XLBA 3BCJA 3A23A 1C91A 2E3ZA 2GWNA 4RV8A 1VFFA 1W3NA 4B3LA 4O1DA 3UETA 7XIMA 3EKLA 5A6LA 3RPMA 2J7HA 1BAGA 3G1FA 3GHTA 5ABFB 3QKEA 3ZIZA 3ATZA 3WMLA 3GU9A 2DV0A 1QPNA 1H5YA 1Q2RA 1GOXA 2V69A 3MDWA 2Z28A 1FCVA 4AMAA 3VIFA 1UMYA 1C8XA 2GJNA 5FEXA 4O10A 1GYNA 3E0LA 3QV7A 4GOAA 3A64A 1KXHA 3G1SA 3AIWA 2GOUA 1J4EA 1EBDA 1JZ8A 3H4XA 3L21A 1U5JA 3LPFA 5HWJA 3W38A 1DQUA 4HJWA 3G2GA 5DBUA 4JHMA 4MJZA 2WP6A 3AO0A 3FJLA 2J4GA 2J6VA 1I2NA 1I8JA 1LL6A 3HPXA 4AX6A 3IAPA 3TROA 2C8NA 5IDIA 2OR2A 3HV8A 4Q8QA 5EMUA 5AC4A 4HVXA 1RUSA 3H2OA 1F9CA 3BCFA 1VBGA 1BZLA 2XVPA 4YHEA 2WBKA 1X96A 1NDYA 4HZMA 5FS7A 1MFVA 3AMGA 1C9WA 1PJ9A 1BWCA 2VVNA 4P8VA 3IV3A 2W92A 4AD4A 2ZUWA 2J77A 2Z25A 1MO9A 1QPKA 4G56A 4JYFA 4J3XA 4GZJA 3MA8A 2BXYA 4DJDC 4GX9A 4JX6A 1LWIA 4MAVA 3UWZA 1N82A 2ZZBA 3KOYA 1DQWA 3MI3A 1TZ7A 2FHCA 3EA3A 3NG3A 1TFVA 5EL1A 5A2BA 3GH5A 4L7ZA 3A12A 4D71A 1E70M 2P50A 3GQYA 1PYMA 4LQ1A 3DN5A 1FCUA 3TSBA 4LS1A 3G0UA 3NURA 5HANA 4UR8A 3LZ5A 4DNMA 5CPMA 4LWWA 1OADA 2NT0A 2X8CA 1W91A 4Y90A 3MCOA 5EB8A 1NWRA 4KRTA 1GRAA 4HNLA 1C8QA 2GK1B 4IPIA 1A3XA 3WG6A 2ZXBA 3WEMA 3IEBA 1WQ5A 5DANA 1H60A 1UKTA 4OZOA 3WX7A 4B5NA 2PTXA 3SAZA 1EC8A 4V15A 2YX0A 2Y63A 3PG8A 3VGDA 3VUSA 3TCSA 4FOUA 5EFDA 4IXHA 1WDRA 4F2TA 3W2NA 2ATSA 1BF6A 4XG1A 2NQZA 3WDPP 4P8WA 1QOQA 3NZPA 2Z7GA 3QJAA 4LNCA 5FF7A 3P67A 4LVAA 3PZVA 3QMSA 4C7FA 4O54A 4RE3A 4LV4A 5BXRA 1RHCA 1FDYA 3N11A 3I3DA 1RK6A 4JQ9A 2V3GA 1XFBA 1H2JA 1R30A 4PCPA 3M0VA 3ELFA 3VC6A 2R9ZA 6XIAA 4S3BA 4W84A 1SZFA 5BU9A 1OGSA 2VCCA 3L67A 4IGHA 3KBMA 1J11A 2QS8A 3OLDA 1ZAHA 1JZ7A 1PZ2A 1C7TA 3T40A 2VL4A 4UNLA 4XO6A 3R79A 1ZUAX 8CGTA 2IKIA 4LANA 3W7MA 3COTA 1NPXA 2V6OA 2XSBA 3FOKA 2O55A 4XSMA 1VR6A 5JBDA 1RH9A 3H6OA 3W28A 1JDDA 2AL1A 3NYZA 2BHYA 3QV8A 3BMXA 3WNNA 4HHMA 3RGTA 3F2DA 3GVGA 2WZHA 5XIAA 1N8IA 2WOQA 1XINA 5DXYA 2WV8A 4IPJA 2ABAA 4JY9A 1AZ1A 1XLMA 4UBPC 3OEXA 2E28A 3UR7A 1V93A 1U1HA 1C8VA 3SUSA 3W6MA 2X1RA 5D9PA 4CU7A 4DY1A 3LCFA 1UASA 1GKRA 3H2EA 5JCNA 4ONVA 4NEVA 4L6DA 3UWYA 1VBHA 3U2CA 2CNCA 2IXVA 1BPLB 5BXPA 1LORA 4TVDA 1JG9A 4AY7A 1BTCA 3PJWA 2AQOA 1XLGA 1A5UA 1D2KA 2YL6A 1F74A 1M65A 3GHUA 4PCFA 1H63A 2XISA 3CNYA 5DN1A 1OCBA 5CCZA 4GQQA 3NCOA 3BL3A 3H2NA 1U1JA 4QDWA 2A85A 1WKDA 1UB3A 5DMLA 1F61A 2CXGA 3ES8A 1ZS2A 3OO2A 1WUFA 3QC0A 4P8UA 5HQEA 1IWAA 1QJWA 1KNWA 2D3LA 3T7VA 4L9XA 4MKSA 2CZ5A 2HBXA 3U5YA 1PS9A 4DAIA 3NSMA 2F6KA 3UWVA 1IWPA 4Q4MA 2DY3A 2ACSA 1OVDA 4IL0A 2QJHA 3RUBL 5F4XA 1ZMCA 3MVTA 1U2YA 2GSHA 4UTTC 4J2PA 4DNAA 3SRFA 1R3YA 3H55A 2PFHA 1EJXC 1OQFA 3UXDA 4DJFD 1ITQA 3W7QA 2YZ5A 2WAGA 2EBNA 3AXXA 3GWQA 3FJ6A 3GDBA 4REQA 1CLVA 4ZQPA 3ERPA 3N12A 3LCHA 1K8YA 4IIHA 1JNEA 3CWNA 4H4VA 1M6IA 3H53A 1GVIA 2V3AA 2E7FA 1W3LA 5CC5A 1GJUA 1JULA 1B54A 4K39A 4MNKA 1O5KA 1W9PA 1TZZA 1W5OA 1YLVA 3E12A 1PDYA 1DWIM 1CXKA 4KRUA 2CBIA 5I77A 1ENUA 1I0DA 3NZ1A 3NR0A 3SB0A 1F7BA 1TX0A 2ZZ3A 3L8KA 2J9ZA 1S2TA 4XZLX 2YCJA 1SFTA 1JAKA 4RDZA 4AIUA 2W63A 2IPWA 3TLLA 4IT1A 5EMLA 1PO9A 4MB1A 1TUXA 4EQWA 3QFAA 2D1ZA 3BQ5A 4DO6A 2WKGA 1V3JA 1HN1A 2X99A 3RR4A 4HT3A 3DK4A 1A50A 1A0EA 3K4AA 3OW1A 2RUSA 3FEMA 4XV0A 5DMMA 3GXTA 5JQ9A 3TXZA 2QKFA 4L9ZA 4X61A 3PNUA 2PDFA 1N8FA 1H0IA 2G4FA 4FXFA 5EKYA 1CLXA 2W3ZA 3OA3A 3KZSA 2VFHA 5LZLA 2X0HA 4E4UA 1XGDA 1BD0A 4K8HA 5AZ1A 4RL3A 3WUBA 4H9VA 1JZ6A 1Q1WA 5EBKA 4O1FA 1FWHC 3VD5A 1RPXA 1WXZA 2H9AA 4S2CA 4B5XA 2GGGA 4HD5A 3WNLA 4BI6A 1FP9A 2C3ZA 2JGYA 4IMDA 4H6EA 3PFMA 1LLOA 3ZR6A 2HBVA 1IXPA 1KM2A 3KOWA 2C15A 4H3DA 1KD0A 1E73M 1GQNA 2GSJA 4F0HA 1QOPA 3SUWA 3ZLFA 2X09A 3CV1A 4FP1A 1EPXA 3TW6A 1QTWA 1VC4A 2WVUA 5BNKA 4LCSA 4BR1A 1WOAA 4B5VA 3BURA 3O15A 3AXKA 2CHRA 3STPA 5BRBA 1D7YA 4UOZA 3GR7A 1ZU8A 3W53A 2XFRA 3U48A 3G1VA 4FNSA 2QCFA 1ZBKA 1YW1A 1TWIA 4HU3A 3RRAA 1MI3A 2VZUA 3UF9A 2PCEA 1VB9A 1JYWA 1A49A 2EG7A 1S2UA 3EB4A 1H50A 2Z1VA 1DJGA 1SJCA 1SPQA 4EXBA 4AUBA 4NZ5A 3BGAA 3CMFA 3W76A 3MVIA 2F9RA 4CN1A 3MU7A 1XJBA 1J5TA 5EMJA 2YCLB 1GTEA 3G3DA 4O12A 1KCLA 1XHCA 3UY7A 3GLCA 2F61A 2QCNA 5D02A 4LVBA 3U3HA 2TPRA 4O1CA 3SADA 1SZRA 4Y8FA 1XQLA 3QLDA 3NQ7A 4QG9A 4GY0A 1Q45A 3AS3A 3WNOA 1UZ4A 4HCLA 4JTQA 3AMZA 1Q6GA 1TPEA 3WDRA 3WLHA 1X8CA 3KHDA 3LTPA 4YWOA 3VGHA 4HHHA 3O07A 3VFLA 4MKVA 1V02A 4E5TA 1TV7A 1OFRA 3B9AA 2VTFA 3QMTA 4MJMA 3WQEA 1OY0A 3JR2A 4JXCA 2ZC8A 5FEPA 3B8UA 2XWDA 2CLKA 1EB3A 1H4PA 7TAAA 3PBGA 1FWCC 3TYUA 1FWTA 4AYGA 2VEIA 2Z6JA 4GINA 1OM0A 3LI1A 1V51A 1KCKA 2OGJA 4UTWC 1B2YA 5JUVA 3HA1A 4NAFB 5EA9A 4X2PA 3TWAA 3PB2A 4NJJA 5K2ZA 3CGTA 2J62A 1TREA 1A5CA 4IQEA 1IIGA 3RLUA 3THDA 3W1MA 2WPCA 5GNZA 3E02A 3RU8X 4WX2A 4CEUC 1WDQA 3DKJA 2DT1A 4H1ZA 1M3UA 2OODA 1HJWA 1XYBA 1ME8A 2O9OA 3GXNA 3K30A 3CV6A 4LV9A 5DEZA 3SN0A 4KBXA 3E2QA 3S0CA 1WBHA 3VE7A 3U8GA 5D38A 4XD5A 4QXIA 1JIBA 3PTQA 1TWSA 1C29A 2W61A 1IHIA 4F4RA 1V4YA 2X1IA 4UFLA 3BJFA 3ALFA 3AROA 4B4FA 1KQYA 4E4FA 1VBJA 3LGDA 4OVXA 4FR6A 3GNDA 4YNGA 3O7UA 2PRHA 3TN6A 3T2OA 3AUJA 1IGSA 2PC8A 3UPWA 4YCPA 2EKGA 4Q8TA 2P8BA 1A5AA 2XFYA 1B3ZA 3WLSA 3GTXA 1DIDA 3FS2A 1Y5WA 1PKYA 2FQIA 2ZXQA 3WDJA 3B9EA 4ORIA 3AI0A 5DXXA 3PTDA 2PDNA 3A21A 1X7IA 1B57A 2HWGA 4ERGA 1HKIA 4NZ3A 3MUAA 4XZBA 3MMUA 2X2YA 1W1ZA 1XKJA 1K8ZA 2YDAA 4IIFA 5FL1A 3OQ8A 4UFKA 1L9WA 4NAEB 3VIIA 2BWGA 3NS1B 4FEZA 1TTJA 3M5YA 4IP7A 3AIRA 1LRNA 4ZB5A 2BDQA 1SU5A 3MANA 2V8ZA 5KITA 3A4JA 1TPH1 3QOMA 2DVUA 3EOSA 2ZC1A 2X1TA 4WIWA 4GVFA 3RM9A 4FLQA 2C1IA 7CGTA 4CD7A 3MUIA 3CT2A 3W3OA 1H2IA 1SVDA 1M7PA 4LAKA 3WK0A 1Q6LA 1KBIA 3WK3A 4CUCA 4ALDA 5H8MA 2O7QA 1G0CA 4JFSA 1AJ0A 3S2JA 2Y8VA 4P7QA 3SRKA 3CGEA 2BHZA 1TA3A 5C9WA 2C14A 3UGVA 4A29A 1I45A 4A3YA 5CAHA 4XZIA 3TKFA 3B0XA 2D73A 4JFWA 2PZ0A 2REQA 2DUXA 2YA0A 1F3EA 1R7AA 2PWEA 2OZ3A 3AMDA 4B9ZA 1GEQA 3VFCA 4FSAA 2IKHA 1TPVA 1UROA 4HHPA 4AHQA 4IGNA 2WNWA 3TK7A 2WQPA 3GG0A 4OKDA 2IW0A 3L4ZA 1EHAA 1IT0A 3OHIA 5AB3A 3WY1A 4S39A 5F2MA 3LHWA 2CKSA 3L4WA 3DFTA 2GUBA 1WP6A 2PBOA 1LYXA 4D2JA 4BV6A 1Z9AA 3PBWA 4YLWA 1AW2A 2C1GA 3KRSA 4H4XA 3AHZA 1ICPA 2XSXA 2HNHA 3QC3A 3RNDA 4JDRA 2PP0A 4IPLA 4RE4A 1I2PA 2W3RA 3CGBA 2ZDSA 2OYKA 1Z6KA 1DJXA 5IM51 4DAFA 2OWWA 4IJCA 4HTYA 4WQ6A 3W1XA 3WH8A 3PBVA 3V0UA 3N17A 4IUOA 1REQA 3LMZA 3MI6A 4H01A 2ZX5A 3P82A 3UJFA 2BY1A 4ZB2A 5IDZA 9XIMA 2NXHA 4IIDA 1TQXA 1ZLPA 3RITA 3THUA 4HPXA 1FOBA 1MO0A 2XH4A 2H8XA 2AAQA 4FOKA 2NVCA 3CUGA 3LHTA 1W56A 5D05A 2DSUA 3R8HA 4BY3A 3EYPA 4M81A 1T99A 1IZKA 3KTXA 1XLIA 2DQWA 3H7RA 1HL2A 2PDKA 4GO8A 2CLIA 1SQ7A 3GHRA 1HQTA 3S46A 4K2SA 3PPFA 1X97A 4M24A 3N14A 1HTIA 2JFEX 4TV6A 1GW1A 4P7RA 4TIMA 1V7YA 4JD4A 5E1QA 4NYYA 2O9PA 2XFWA 1UIOA 3GXDA 1BWVA 4DBDA 5H8UA 3BH4A 4AU0A 3W87A 1V5XA 2VMFA 3VE9A 4EF8A 1UWQA 1WZAA 1A5LC 1W6TA 2BXZA 4KEVA 4LB3A 4L1WA 4WEVX 3TJIA 3T8LA 2WK2A 4PTDA 3ZXWA 1CB7B 1K03A 3INPA 3KEHA 1FO4A 3SRDA 5KSWA 2GL5A 3AN1A 4IFRA 3TE9A 1DWHM 1BF2A 3LSBA 2YBUA 4PULA 5M5DA 2QUVA 4AG0A 4F40A 3BGJA 2CBVA 5A8QA 2ZUTA 3FV9A 2XIOA 1HNYA 7REQB 1N5WC 3S9YA 2J7FA 5I3KA 4LPCA 3S42A 4QFUA 1NM9A 5A6BA 2V5DA 2OKTA 5TAOA 1LJYA 1B4EA 3QMRA 4W8LA 5GQBA 2HSAA 2QNEA 3LPPA 1LUCB 5JCIA 2WWDA 3RCNA 1WKYA 3DZ1A 1FWNA 3R13A 3GRIA 3SJNA 1XCXA 4M82A 5DELA 1US3A 1Y8BA 2WMFA 4ZE4A 4K8DA 1TZ9A 1EJTC 1XIEA 4UZSA 4AZGA 3WYZA 2HVMA 2TAAA 1GHSA 3ETRB 3FYYA 1QCWA 4D6FA 3EWZA 1OC7A 4O8RA 2FVLA 4AWEA 4H4WA 2GGEA 2EQ8A 3REQB 4FLOA 2PF0A 3DU0A 3G5EA 2WNZA 3FYPA 4LYPA 4X22A 2FJUB 4KFNA 1LP6A 2R1LA 3LB0A 3QVQA 1IXNA 4PUWA 2V2HA 2H90A 2XSAA 4D6DA 1YBQA 2V5BA 3L5OA 3G77A 3LADA 1O6IA 4BQ5A 3H4WA 3ICJA 3AYRA 4I9JA 1E0VA 4UFHA 3V4BA 3CXBA 1DJIA 1XHGA 3TYBA 2HK1A 1VP5A 4B9YA 4C6CA 1O4UA 3BLEA 1DKWA 3B8WA 4QG6A 3AWNA 1AW5A 4A2SA 3CASA 3FA3A 1RQBA 4DWDA 4FB7A 2A3AA 2Z1BA 5I2UA 1E1CB 1FVPA 4XUGA 2OB3A 4YYCA 4X0VA 3U4AA 3S6DA 3W7LA 2EPHA 1CDGA 4QEEA 3W07A 1SZGA 5F1UA 1XS2A 3ITTA 4DJDA 3VA8A 2V3DA 5CGQA 3N9RA 4GCAA 4NU7A 4GKLA 1X39A 4GH1A 3LHZA 4H2HA 3OBEA 3IRSA 4JTKA 3WDHA 3QSRA 2ZKMX 3PFRA 4HKPA 3WO8A 1SW3A 3S6TA 1L6FA 2NSOA 1R9XA 4XKMA 1TIMA 2YAUA 4DBUA 2EHHA 3AISA 2OQHA 4W8BA 2XN2A 1J93A 3T8QA 1RBAA 2C3CA 3UY8A 1OYCA 4H7CA 5A8NA 3FNDA 2HPIA 4KGJA 3P80A 2E6YA 1L8NA 4RXFA 5K4XA 1IQ8A 3LNPA 1Q8JA 3CM4A 3WFAA 1KLYA 1AOGA 4PFMA 1XYMA 5TBOA 4S3KA 2BB0A 1WXJA 1M53A 1E40A 5KEZA 3LHYA 1SO4A 5HUOA 4RZ5A 2ZXDA 5E9AA 1B3OA 3DFPA 2XH7A 1FXQA 1KCXA 3H2CA 3UZWA 4TUFA 4O18A 4ZVJA 5M3WA 1ZX9A 3KVLA 4GI8A 3I4EA 4YVXA 4R53A 1NTHA 2Q8ZA 4KCUA 1W1TA 1E9IA 2ZUNA 4Z2GA 3ZOAA 3PHAA 2J9XA 1CXEA 1Y5XA 2R1KA 3MYPA 3VZYA 3CLMA 4ZFCA 2GFTA 4S3JA 1L6WA 1N63C 2QUTA 1HKMA 3DIPA 1H62A 3DK8A 3WLRA 3VNKA 3C2EA 3W1RA 4AXNA 3MP4A 3R10A 1CGVA 4MNLA 4UOQA 4C6DA 1LG1A 5E9XA 3AXIA 2ZZ4A 4R5EA 5EMYA 1FWBC 1XUUA 1FWGC 2GSEA 1W5NA 5FF0A 3P74A 1ZCOA 4GI4A 3LLFA 1J0JA 2YSWA 3BG9A 3OZOA 3G8EA 1RBOB 3B8DA 1D3CA 2EKCA 3SGUA 3UZYA 5EFFA 2XU2A 1R86A 2CPUA 5JRBA 4UXDA 4B3KA 4JHZA 5LIXX 5FOOA 4KEUA 3AMCA 2A3EA 3WQFA 1DPMA 1RQHA 1W8GA 1EXBA 3OLGA 4WSKA 5D9MA 1UQYA 2R6OA 5G4HC 4UTKA 1YXYA 3UNDA 3TOYA 3NWRA 2PUZA 1Y0EA 2ZA2A 1QDSA 1K7XA 3QW3A 1ZRQA 4ZOEA 3VOGA 1U30A 4MLRA 3NPWA 1KTBA 4L6HA 5FF3A 1KRBC 3L65A 4DB7A 5G2WA 5LXXA 1PL9A 2A7NA 4AD5A 2GQ3A 2HNEA 3W01A 4UTLA 1ZBWA 2J6XA 3PF3A 1PXGA 4KRZA 3EX3A 5JU6A 5DRCA 4D1IA 4NX5A 3H26A 4B3ZA 2BASA 2CLEA 3SCOA 3UD6A 4Z17A 5LNSA 1FWDC 4WDTA 5I79A 3LCIA 2W9MA 5CZ0A 2OLHA 3EEGA 4YTSA 1VLWA 3KW3A 2V82A 2O4QA 3KRUA 4L65A 2Q01A 2HS8A 1JZ3A 3BLFA 4RDVA 1OSEA 4IGSA 4UMBA 4DUVA 4QQ3A 3IC9A 3P62A 2Y6ZA 4NJHA 3RPDA 2A21A 3TTEA 1A5OC 2E0PA 3NO1A 1FDJA 6REQA 1FWFC 2YOCA 5AN7A 1G6CA 1KM1A 5CPNA 4Z1DA 5JH2A 1DJQA 4M6QA 3BV4A 3EA2A 1B3WA 2Q3OA 3APYA 4LUSB 2DZBA 4YN5A 2BOEX 3V3WA 1V02E 5E93A 4UTHA 3BW3A 3MMDA 5HINA 1VPYA 4GQBA 4MY1A 4J56A 1ZK7A 5LIKX 2VNCA 1PSCA 4R7JA 4HNCA 1XSIA 3S1VA 1H41A 4TX6A 2VFDA 1W31A 2VKZG 1Q6FA 2ABBA 2GVEA 4G7FA 5ENLA 1XDJA 4DWSC 1DWGM 3WF3A 1RCXB 1R87A 5CG0A 1OWQA 1TRDA 4X63A 1GREA 3UYCA 3RCYA 3W2LA 3BAIA 4LU0A 5A6BD 5T9CE 2BZNA 3MQTA 4R27A 2VFIA 4PSRA 3ZVHB 4MYAA 4KIRA 1V6UA 3BMVA 2BX7A 2QCHA 4FDCB 2VZSA 5KTLA 5C2GA 3F4NA 2WMJA 3LPGA 1HVXA 4TVWA 1PBGA 3OOQA 3BARA 1PCKA 4HU0A 1XYLA 1Q63A 3KBSA 3WLTA 5DX7A 1FX6A 2G50A 2VC5A 3UWWA 4IQDA 3K4WA 5HA7A 2YB4A 4JTCA 5CSRA 4LYKA 1ZP3A 2PZNA 1KRAC 5TD4A 4EWJA 4WZHA 1CEOA 3HOJA 1J2WA 1OT1A 1YPXA 4GGBA 2JIEA 5FSEC 3G3MA 4I9TA 1YXCA 2WMIA 3Q94A 1WUEA 3A22A 3U9IA 4AHOA 1Q65A 4NKCA 3E6EA 4US6A 2PGRA 4D72A 1QFEA 2DZSA 2ZE3A 5KINA 4V1XA 2F6UA 4S3DA 4TVCA 4ZENA 5J5RA 2YVFA 2PDWA 3LCLA 5FAJA 1I9CB 3W1AA 4E4PA 1AD4A 4ZA0A 1XIGA 4M6UA 2QGYA 4ADTA 1TG7A 2F7FA 3FAWA 1BQGA 1WNOA 1Z89A 4LYQA 1E9LA 4NXKA 1IYXA 2POZA 3ZJ6A 2VO5A 4QROA 3AS1A 1QHPA 3PULA 4LEFA 4LY8A 1POKA 5ABFA 1QXLA 3NPVA 2ALDA 4YVPA 3JVAA 4MZ8A 1UHVA 1JCMP 4DJDD 4AD1A 1AODA 4IP5A 4PTXA 2IPGA 1XG4A 1W2PA 2GGIA 2V5LA 3GX9A 1P6CA 1A5SA 4K1GA 5BRPA 1GKQA 3BANA 1QRQA 3HQPA 5G4WA 2VC7A 3OG2A 3MKVA 1J0YA 1NJJA 4GFSA 1H0GA 3RXZA 4H4IA 1TJ0A 4CNOA 4WGXA 5M1TA 3NEHA 1K7EA 4BEUA 4JPGA 4LC8A 3UG5A 4GY1A 1LOSA 2WW5A 2X40A 4JDYA 3WF4A 2X8HA 2O56A 4JCMA 3PAOA 4HPJA 2DZUA 1J5SA 3CLWA 4N42A 3EWDA 7A3HA 1P6WA 1JNDA 4D8LA 1DJNA 2CESA 2C19A 1NARA 3TTYA 1RA5A 3KUMA 3MZ2A 2DZTA 1CIUA 1NH6A 3IVUA 3WBXA 4G6CA 4J4KA 1GZ1A 4TV5A 3UZZA 2IMRA 3WDQA 1JPDX 1X6LA 1QR7A 1FA2A 4F8XA 1P0BA 4MWAE 3N6QA 3P5YA 5CZTA 4R9XA 3SEPA 3HN3A 4O28A 3GG7A 3L4VA 4CCZA 1RCOB 2XG9A 4NQ1A 3NDZA 1ODUA 4OBTA 2NQLA 3DFHA 3EF6A 4AX7A 2F2HA 2WNNA 2WXDM 4GG9A 3MO7A 3EKGA 3G22A 4EAYA 1XC6A 3TNOA 1JCLA 1XBYA 2QIWA 1TWWA 3QY6A 2E9BA 3W22A 1DJHA 3VNYA 1CXIA 3UCDA 5LSMA 3UXIA 3SCUA 1SFLA 1N7KA 3D46A 5A6JA 3LRKA 4GBDA 4F3HA 2OGYA 2GVGA 3DKLA 4C6OA 5ABHA 3VOHA 1GORA 1P1XA 4PMQA 2Y5SA 5CJMA 5J04A 5C7HA 2GK1A 2CW6A 3B97A 2GQAA 2HEJA 4AC7C 3LCXA 3NFUA 1E3XA 1MZHA 3NOEA 3TEVA 2ZUUA 4ASTA 4LF2A 4N2YA 3KBJA 4JBRA 1I1XA 4K36A 5BROA 7ODCA 4WJXA 3E96A 4GI6A 3LEPA 3WJXA 1G67A 2WKLA 3CQIA 1DWFM 3TFCA 3I6RA 1VYSX 3W83A 4MM1A 4MIMA 2QZRA 2Y7DA 4DO4A 4HYRA 4GRSA 1RP8A 1DVJA 2VX4A 1DXEA 4ADWA 3RNMA 5U7SA 1S5TA 3W2JA 4KFOA 3MHGA 4QDPA 2A7PA 3EDJA 5E0FA 1KBLA 1D3HA 4B15A 3HG5A 1B1YA 2JF7A 1EDTA 3R0KA 4QNEA 2J66A 5D33A 2DH3A 3ZSTA 1W3JA 5HNNA 3DCPA 2ZBTA 3QYSA 1EOKA 4NP7A 2VDGA 1KFWA 3W37A 1YHTA 3DFNA 4LY4A 1TCMA 1X1NA 4GHRA 3OGRA 1E4NA 3BAWA 5JMUA 1K77A 2FIQA 3L4XA 1F4AA 2QLYA 1UH2A 4YTTA 4O50A 1BRLB 1VRDA 3TYEA 1ZFJA 3WK1A 2YCIX 1XYZA 3MCNA 3WF2A 4RE2A 2ZDRA 1Q8AA 1EUAA 3AICA 3TUUA 1JI1A 1W9XA 1VPXA 4WSJA 3RG6A 2WLZA 4XAPA 2JKAA 1PAMA 3NRZB 1T41A 1VS1A 3URQA 2GR3A 3ABSA 2QAEA 1W1YA 3GH4A 2FLIA 4C6PA 1CTNA 4J28A 2IPJA 1QNRA 3T55A 4ZOHB 2ZRYA 1K8XA 5LNRA 5CZKA 2J74A 3B8SA 2VFEA 1EH9A 2VENA 3GAKA 1RP9A 2NXGA 1EF3A 4W88A 3WQPA 2FH6A 1VJIA 1ZHAA 4AISA 3LZ3A 3AXHA 3IUIA 3NL3A 5J8LA 3ZSSA 5XIMA 1S38A 1YDOA 3T4WA 2X50A 3F5KA 3JZEA 4J3ZA 2QV5A 3PANA 3I65A 3FG2P 3A4WA 4M1RA 4DO7A 1HP5A 3MSDA 5K9XA 4H41A 1XKYA 2QJGA 1PZ3A 2X42A 4FI4A 4JTFA 4W9TA 2XM2A 1P0DA 2VZOA 1GVQA 3AZTA 3N34A 4XAFA 4GFIA 3OVGA 4S1FA 2NX9A 4JHOA 1ZSXA 3UG3A 4X2RA 3T0DA 3KE0A 4YMZA 1VFMA 3IK2A 3KS6A 1GOQA 1C3FA 3TYZA 4EF9A 1ZPTA 4GIYA 5DF0A 1XLCA 3OBKA 4H9MA 1HVQA 4AMCA 5JIWA 3D3AA 3NVZB 1ITXA 4DUWA 3IK4A 1G4SA 2DU2A 3EX1A 4HOZA 2XIQA 3XIMA 1FEAA 1PIIA 1M41A 3TH6A 4H4PA 3OVQA 1F07A 3CUZA 1R38A 3U57A 2PGEA 4QS6A 2TSYA 3H2MA 1J01A 3HM7A 3CB3A 3RX2A 3WH5A 1R5YA 1QPQA 4LNYA 5BCAA 2DSKA 5AVNA 5IFPA 3EB2A 3Q4DA 1JQVA 2DVXA 3DC8A 3T2QA 2XPKA 3NUKA 1OF6A 2I9UA 2NLIA 4CNNA 1V0LA 3UBPC 1TTQA 4BF9A 2R9RA 1W3HA 1TELA 3W4RA 3HG3A 5C7VA 2GGHA 2RGMA 5LIYX 1SW0A 3QGKC 5AFDA 1FFVC 3UU0A 2WPEA 3L12A 2EG8A 4DI9A 1H7PA 1UBSA 4H6QA 4GJ1A 3WLPA 3U4FA 1XIMA 4QTGA 1O60A 5HR7A 1H1ZA 2G95A 1PKLA 4QG8A 3RYSA 3TAOA 1KFKA 1UP2A 3A4AA 2B7PA 4QRNA 1LOQA 3CPGA 4FNPA 2WPFA 4BF7A 2OLSA 4RDWA 2H8ZA 4JTLA 3P3BA 3PWAA 4LIIA 1LRQA 2XVKA 2DDXA 3PP7A 1EWDA 2DSZA 2VEKA 2QJNA 4E8DA 3HMJG 2DUZA 4J3UA 3POCA 3DBPA 4MVAA 2J3NA 2PWVA 4A8LA 1UD8A 3K8LA 1GETA 1PTAA 1EZWA 4OOZA 4PMUA 4R7OA 2W5FA 1MYRA 4LB4A 4GYPC 1EJSC 5CPSA 5C5YA 1KBJA 2G3IA 2VCAA 3U2OA 4H8NA 4HCDA 1UD5A 2OKOA 4NT0A 3K2GA 1J0KA 4H4TA 1EJUC 3THCA 2ZRXA 3NDYA 3ZR5A 4BF5A 2ZTJA 3VXGA 2CZFA 1NEYA 1EDGA 3IJLA 4TU1A 2ZIDA 1Q66A 2ZVIA 4RPQA 1UC4A 2WYSA 1OC5A 4NILA 1VLIA 1RZMA 3DFOA 4W5ZA 4CD8A 1Q4NX 3OC4A 1I2RA 3U2ZA 3MW7A 3BZGA 5DLCA 8TIMA 1UUQA 4J9JA 1QASA 3QFBA 5AY7A 4HPHA 1YXDA 4PGLA 3RLHA 3IJQA 3FIGA 2R94A 2HQAA 1TA3B 5LXEA 1ONEA 4U2YA 2CHNA 1CXHA 2GLKA 3NA8A 1GOOA 4JQ4A 4Q32A 1NDAA 2V6AA 3VGFA 4JICA 3EPMA 1TE6A 3PBYA 1MUMA 5FJTA 2Y62A 3L4YA 4XQ6A 3MMTA 3ONBA 4FX6M 4ERIA 5LA2A 4GX8A 4XX6A 2CC0A 2YCLA 2E5CA 4GVHA 4Y9NA 2G4JA 2ZRVA 1ITCA 4FALA 1KV5A 1FWJC 5A8GA 4QSFA 2WQDA 3ARRA 1JL8A 3C2FA 4IJBA 5KMYA 1JZ2A 3O63A 4GI9A 3ZJKA 1C90A 3I68A 4LS2A 1G7UA 3TN5A 4NJGA 5JVLA 1GWJA 2H3DA 1XYAA 3WLKX 1GEUA 2RAGA 4H50A 4M80A 1TRIA 3ITCA 3S5YA 3NQMA 4C1NA 1EBGA 1V3HA 1JUKA 3EB3A 4N9EA 1FHDA 3CHCA 1RLDA 3KLLA 3LRMA 1E6QM 3W73A 3VKCA 1GQJA 3TWBA 3D3FA 1XRTA 2FZBA 4IFKA 3TX9A 4V28A 4JQAA 4QCEA 1PIGA 1V7AA 1REQB 3A6OA 3HTWA 3UR5A 1TE1A 3FHQA 1KGXA 5C8BB 3VZZA 2W4XA 4KESA 4WY0B 4B5SA 5HJLA 4M52A 4GPNA 4JNZA 3L68A 3NL6A 4I6KA 4E8GA 5FCZA 1E9YB 3CWOX 2QF7A 3HO8A 4MFEA 1XCWA 1R2RA 2YA1A 1KBKA 2AOSA 5DCDA 1Q1RA 2RH9A 5DFAA 5LNVA 2ZFAA 4A22A 3TR9A 1GVYA 3ZLGA 1JR1A 3ENLA 4GJIA 4WDWA 4QNWA 2W55A 1HL8A 3N15A 5HUPA 4GYJA 3KRZA 1J6OA 5I02A 2R1NA 1DJWA 4JTRA 4XBSA 1ICSA 1OEPA 1VJZA 1KV8A 3E0VA 3LXAA 2PLCA 4K7ZA 1TJ1A 1V97A 3VD3A 3ARXA 4WXZA 3URHA 1K1DA 2O7SA 1K9DA 4NYUA 2QAFA 4RCXA 3R07C 5AYIA 1NDZA 1EL3A 4Z0JA 1GNXA 4UCFA 2HTMA 4XZWA 2R8WA 3BJSA 2LLEA 5AZ0A 1XH2A 3B9DA 4LVGA 1TMHA 2PLKA 4EE9A 3LD5A 1W2VA 1AA1B 1E4LA 2FB3A 3ATYA 2HVOA 5AC7A 5D03A 3M0YA 2ZOXA 1Z3NA 3XISA 1A4LA 1RXOB 3PUDA 3ZS4A 3QV9A 4Z1AA 5DMNA 4ZB0A 4C6LA 4UZUA 3T78A 2YBVA 2ISFA 4Y96A 3AZRA 2O92A 4PRWA 2WVVA 2WOWA 1KFLA 5HPCA 2BBFA 4LT9A 1BYCA 3ZWSA 1KLZA 1E6NA 3CL7A 4MZYA 4HPGA 2FVMA 3FXGA 5D8WA 4ADUA 5H2ZA 1TB3A 1I60A 4MZ1A 4KETA 3F2BA 3N2BA 4DM1A 3FHAA 4C6IA 1EP2A 5E0CA 1EX1A 2JALA 2TRSA 1KM4A 1BTMA 2XN1A 1WA3A 4G1NA 1RALA 1TSIA 3R7MA 1V3MA 4F0KA 4RV3A 3GO2A 3C0LA 4ORMA 1X6NA 2DT2A 4HYVA 2BLEA 3VOCA 2GR0A 4QAWA 4HHLA 4J3WA 4H4UA 1RA0A 4YWIA 1VIWA 3JW7A 3R4IA 3ZT5A 4L4MA 1VKFA 4UTUA 4AZIA 1YBQB 5A95A 2PPGA 4D8ZA 1R3QA 2P76A 4GY7A 5MKGA 3GYEA 4LS0A 1CGWA 1G5AA 4ZQOA 2V3FA 1XLEA 5BXSA 4I8DA 4CCDA 3WBEA 4LC6A 3V5FA 2BY0A 3M0KA 4LX4A 4UB9A 4I9AA 1XIHA 2GZXA 3TVAA 5HMDA 1DBTA 4O4WA 2FDMA 2GR2A 4N4PA 1YQ2A 3D6NA 4R3UA 3V16A 3OODA 1Z7AA 3AHVA 2YVJA 4HNNA 3EBVA 4IWWA 2FZMA 1DHKA 4Z1BA 2DORA 2IPFA 4M6PA 1M7XA 3THQA 2WNQA 3OZMA 3W2KA 4LRTA 1XM3A 1V6WA 2WSRA 4TXEA 4NJKA 3CIXA 4L64A 4J1OA 4J27A 3C0QA 2X8GA 5CC3A 3UA4A 5FF2A 2A6LA 2HE8A 3SR7A 4M7TA 3QY7A 3L0GA 3P61A 5IFTA 2G5WA 5HMSA 3V0SA 4FK9A 3TSDA 1SSGA 3N04A 1JGMA 3UPBA 3NO3A 4PEEA 3GDMA 4L9YA 2XIBA 4DWSA 2FZDA 1ZL1A 1OX4A 3OBAA 1KB3A 1ECEA 1PPIA 1HJXA 4TMCA 2VEFA 1X8FA 8RUCA 1W9DM 5JBEA 1UR4A 3LHVA 5BU6A 1EGVA 2JBMA 4H9ZA 1YDYA 4IM4A 3GC2A 2BFGA 1UZDA 3SCVA 3WUGA 1O68A 3MC5A 3SIMA 2NV2A 4Q4OA 4S3FA 1BGGA 1QHOA 3BAKA 2HDJA 1UWUA 1JYXA 2TPSA 3KX6A 5G5IA 3LV6A 4XWUA 3LBMA 3UEQA 1WBJA 1W1PA 4UTIA 5F7UA 5TNVA 3PJUA 3TQPA 1LCOA 4JIRA 1XW8A 2J88A 2D3NA 1I1WA 2TMDA 3CL8A 2FVKA 3AIVA 2GRTA 2ISWA 2BMBA 3MTWA 3DHUA 3GNPA 4IOTA 2FKPA 2OSYA 3A4XA 4IQLA 3OGVA 4ZTXA 4JKLA 2UBPC 4H4RA 4EPDC 3RLGA 2E8ZA 3GK0A 2P0OA 3APGA 1M04A 1S1RA 4HOXA 3WD0A 1XANA 1EBHA 2J7EA 4LUJA 3WF0A 1KFCA 1KC7A 1QNSA 3AIBA 5AC8A 2WWCA 2ZQ0A 1SM9A 3DUGA 4MNJA 1JYNA 1OG6A 1EEPA 1MUCA 5A5WA 3CQ0A 4M19A 3KLKA 5GJPA 2ZX8A 4KCVA 5IRPA 1M01A 4OV4A 4JZ5A 1D3GA 2I14A 1XIDA 3RMJA 2FFCA 4QE5A 3IPWA 3PZIA 1XDLA 1X1ZA 4H83A 3U7BA 1C92A 4JTIA 4W7VA 2FPYA 1WCGA 3SSJA 3EXTA 2VQTA 3AJ7A 3AS2A 5I5RA 1MQPA 3TQVA 3SCQA 4F2BA 4QDMA 3QTGA 1GVEA 3AS0A 4JTTA 3LCWA 3LMYA 1D8CA 4CN6A 1ME9A 4PL2A 4TR9A 1BWLA 3T05A 2CBUA 3REQA 4H04A 2PE4A 2P1FA 4U28A 1VHCA 5BW6A 3PJTA 3B03A 1HGWA 2JF6A 3XINA 3W29A 3B40A 5K9CA 3DJGX 3GTFA 2QCDB 3L7RA 3S5OA 4XVEA 3KLJA 4E2OA 4X0NA 3M47A 4XD3A 3IAQA 1W17A 3GG8A 4CEXC 2PSNA 2ZA1A 3M46A 3WNPA 3PN8A 3B9NA 4AAJA 4QJ3B 3MSGA 2E68A 3EWYA 3DESA 3NPUA 4BKNA 3W1UA 4UMCA 3NGJA 2ADAA 4H2CA 3SQPA 2MANA 1E0WA 2HE5A 1XBZA 3HQOA 4ZXLA 1QAPA 3DG3A 3CBWA 3PZ9A 1ONFA 4NIRA 1E1CA 1CGUA 3I6EA 4R85A 1BXCA 1US0A 3QRHA 2X2GA 2C71A 3TDFA 3VX1A 1U5HA 4EQSA 2HCVA 3L66A 4YJ5A 3SURA 1UJQA 4LBUA 2WSPA 3O6CA 2EGZA 3KWSA 3CHEA 3W1TA 4ZO8A 3HF3A 4DBWA 1L0PA 3VINA 1CCWB 5LYRA 4BI7A 4CQCA 3ABQA 1VQTA 2ZZ7A 3SCWA 5A8OA 3OB8A 3B9JB 1Q7MA 4GNKB 4MPKA 1QI5A 1G4PA 4ZO6A 2YZRA 5C2CA 2D2GA 2FZ8A 2MUCA 1XGZA 1S2CA 3AOFA 3BPWA 3NIYA 3TC3A 1HJSA 3RHGA 2FB2A 5JBFA 5A1AA 3EOLA 3RX3A 4O53A 1A3HA 4C6FA 3AM9A 1RBLA 4CD5A 4Q8VA 3DYOA 4M7SA 1XLDA 1UWAA 3NNTA 2Z27A 2HPMA 1JCYA 5DCEA 2BVYA 1JPKA 3L9CA 4LALA 1V59A 2XINA 3MYOA 4HSNA 4OU1A 1E3ZA 5HQMA 2OT0A 2FZNA 1JEZA 2GWGA 1V6XA 1VFTA 2W3SA 2IUZA 1OCJA 1ZGDA 1FECA 2Y85A 1Q3NA 4JN8A 2Y4SA 2DIEA 4ADSA 1J8VA 4RZ6A 4DRSA 4H6KA 2PGWA 4BJHA 4B2DD 2X1UA 1D9EA 5J5DA 3BWWA 4G1KA 1MQRA 1AD1A 1J10A 3EOUA 4WK9A 3NL2A 4HZ8A 3V36A 2G3FA 2FTWA 4FXRA 2I7GA 4PR4A 1VAHA 3IJ9A 2WHLA 2VX6A 1V3KA 2OTDA 4GUHA 5AECA 3M0XA 1BYDA 1YTKA 1OD0A 4DM2A 5GRTA 1SUXA 2AKMA 4W89A 4YU1A 3CZEA 3MSRA 3QHNA 4JTUA 5CLTA 3TU9A 3GU2A 3GS6A 5I3JA 4KIEA 1HF6A 5I3HA 3RILA 4MPQA 2AQVA 4U3AA 3UJSA 3S3GA 3LERA 3EEZA 3E2RA 3GKAA 1HG3A 1NF0A 2R91A 4XZHA 6A3HA 1P4CA 3PBUA 4Y8EA 3USZA 1QK0A 4LW7A 5T8GA 2HK0A 4C60A 2CLFA 4XD4A 4F0RA 3I7QA 3QF0A 1YE6A 3GW3A 3I4KA 3VX0A 1DJZA 3M5VA 4CNPA 3BCDA 3HRDC 1R47A 1MRAA 3KRBA 3T9PA 5FI8A 1XLAA 3T0TA 5BMXA 4HK7A 2VEPA 1GUVA 1E55A 5E0KA 3WD2A 1PKMA 2PS2A 5FMHA 1JFXA 5GVJA 1TVPA 1DJYA 1K70A 4ENLA 1FXPA 1JXJA 1TR9A 1XIBA 4HOWA 4I9MA 4WD0A 5LHEA 4D1JA 4BI5A 1F6PA 3II4A 1NIUA 4I7UA 1TMLA 2VWTA 3H22A 4GISA 3GDKA 5AVHA 3ZQ9A 3K8MA 4DWSD 3KDNA 1TPFA 1YKWA 3TSMA 2YXXA 2BHUA 2QCLA 3B8TA 1W9BM 2QUUA 5M17A 1J2BA 5LGXA 1YNQA 3WL0A 3TAKA 5I06A 1JD7A 1UCWA 3ZJ7A 3HG2A 4QE4A 1RVGA 4WJEA 2YYUA 2XHYA 1E6ZA 2KZHA 6TIMA 1KTCA 2YL5A 5D2WA 2JKEA 1H3GA 3T0CA 1GOWA 3U6WA 1K7FA 3G6LA 3NPXA 3S2MA 1UD3A 3MI2A 3CYVA 4LUSA 1SMAA 3CGCA 4H7VA 3M7SA 2E1WA 1JYVA 1WDWA 3C8NA 5GJNA 3QZAA 2QHAA 4CCEA 2QR6A 4QJ5B 1TWDA 1LQ2A 2P88A 2GDUA 1C7SA 5F2LA 2IXUA 3PZGA 5ABGA 4OUEA 4DBSA 4JTGA 1OGBA 1X2HA 2Z29A 3PSWA 2QUMA 2CBJA 1SJBA 1UWSA 1XBXA 1UWIA 2ZRWA 3FSUA 1AW1A 4K8GA 3MO4A 4MB3A 4F9DA 1NOUA 1R3TA 4O0QA 3HPSA 3A9BA 3ZVHA 1Z32X 3GC4A 5D9NA 2NT1A 1XRFA 3KOXA 1XP3A 3VC5A 5F2GA 2V9DA 3ABZA 1OBAA 4JR5A 1KFBA 1EZ2A 4S3CA 4PTWA 2EPLX 4XBJA 2E9MA 1EEXA 1F8MA 3GR4A 4MGGA 4PMDA 4H8UA 4PRRA 4A4AA 2YGYA 3LM3A 2BVTA 2CU0A 1DYSA 3RPTA 3W72A 1FP8A 1V3IA 3PZMA 3FA4A 3UZJA 3FKKA 2XVLA 3PG9A 2OZ8A 2TYSA 1ISZA 5CAKA 3ZLHA 3NQCA 1EDQA 3BLOA 3GSMA 2A3LA 4QS5A 9XIAA 2QDDA 3KL3A 1XF0A 2ZUVA 3NQBA 4H7ZA 3WFLA 2EPNA 1WDPA 1F05A 3O6AA 3SUVA 1VHNA 4GYPA 3WQVA 4UC5A 5K7JA 4GVIA 2J7DA 4MUZA 3WQWA 4J57A 2PURA 1OX6A 3SFWA 1W9VA 3NZRA 4UIOA 2PDCA 2CZDA 3LU2A 3WBWA 5FS8A 1ISWA 4IL2A 4JGDA 2VR5A 4GIAA 3LSCA 4RR4A 3CB8A 1JJKA 3LV5A 3UZ5A 4BA0A 3BW2A 3OIXA 4Z2HA 3U2EA 4PMNA 4HN4A 4LCRA 4C6BA 3QHOA 4NHVA 1OJXA 2Q09A 4AIEA 1TIWA 1K9FA 1ZMDA 4EPBC 5JCKA 2VC9A 4E38A 1ISYA 5A6SA 1ZXIC 1KGUA 2C0HA 3ZWTA 4MY9A 3QKZA 1ALDA 4Q4QA 1EKOA 2I9EA 3FX4A 2DUAA 3RJXA 2YCEA