3RRAA

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
385
structure length
374
Chain Sequence
VKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPNPVWRHADGSVAEWAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative D-galactonate dehydratase
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
molecule tags Lyase
total genus 108
structure length 374
sequence length 385
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rraA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rraA01
2GSHA 4MKSA 2GGEA 4KEMA 4A3RA 3MZNA 2CHRA 3KUMA 2XH2A 2I5QA 3UJEA 3CXOA 3ZVIA 2PP3A 4GYPA 3SSZA 4HCHA 4GYPC 2PU0A 4G7FA 4H1ZA 4IL2A 2OVLA 2P8BA 3RCYA 4J1OA 2OX4A 3RITA 1WUFA 1EC9A 4E8GA 3K1GA 3ES7A 3QKEA 1SJCA 3Q4DA 2GGGA 3SBFA 4Z1YA 3EEZA 1WUEA 1KKOA 3MKCA 3ENLA 1EBGA 3MUCA 3PK7A 3V5FA 3ZLFA 1KD0A 3GY1A 3HPFA 3MSYA 2OZTA 4H2HA 3TW9A 2FYMA 3N4EA 1TE6A 3JZUA 4K1WA 2P0IA 1EBHA 3R11A 2XH4A 1RVKA 3GO2A 1DTNA 3SN4A 6ENLA 3T6CA 5FJTA 2PTZA 4FP1A 3NXLA 2QGYA 4ENLA 3GD6A 1KKRA 2PTWA 3FV9A 3QTPA 4IT1A 3IJLA 5BOFA 2QVHA 3CT2A 4GMEA 3RGTA 1F9CA 1ECQA 2OQYA 3UJRA 4DYEA 3D47A 3ZLGA 3VFCA 4EWJA 2ONEA 1NU5A 4HN8A 2XSXA 4HPNA 3TQPA 4DX3A 2AL2B 5FJPA 1XS2A 3OZMA 3DDMA 3N4FA 3IJIA 2POZA 4H83A 1L8PA 4IZGA 4G8TA 3IK4A 3OP2A 2RDXA 3S47A 1XPYA 2AL1A 2HXTA 3U4FA 2OZ8A 4IHCA 3OTRA 3FCPA 2GGJA 2XH7A 1ONEA 1KCZA 1OEPA 3N6HA 3T8QA 2QJNA 3RO6A 4DHGA 2DW6A 3SJNA 2PA6A 1ELSA 3TWAA 1R6WA 5J04A 3THUA 4FI4A 3IJQA 1W6TA 3OW1A 1E9IA 3DG7A 2PGWA 2OKTA 3QPEA 3BJSA 3DFYA 4KT2A 2MNRA 2OO6A 3R1ZA 5BOEA 3DESA 2PP0A 1P43A 3DIPA 4HYRA 1JPMA 5FJRA 2XGZA 1JCTA 2PSNA 3N6JA 3V4BA 1MRAA 3VC5A 3FVDA 4Z17A 4HCDA 3H7VA 1JPDX 3T4WA 2QQ6A 4E5TA 2PTXA 1SJAA 2MUCA 1YEYA 4GFIA 1SJBA 2NQLA 3MQTA 3JVAA 2P3ZA 5EU9A 2PGEA 3TWBA 3VC6A 3I4KA 2AL2A 4GGHA 4GISA 4DXKA 3GC2A 3R25A 2O56A 3MY9A 4ZA0A 5FJUA 3CB3A 3T9PA 2QJJA 2QDDA 2PS2A 1EC7A 1BKHA 4J3ZA 3PWGA 4DWDA 3S5SA 3VCCA 4M6UA 4X2PA 1IYXA 2P8CA 4H19A 2PTYA 2OFJA 3ES8A 5ENLA 3TOYA 1SJDA 4HCLA 3VDGA 3PFRA 3TCSA 1EC8A 1MUCA 3BOXA 3DG3A 2FKPA 1FHVA 3CAWA 3H12A 2GDQA 3VCNA 5IDZA 2AKMA 3BSMA 3CK5A 3V3WA 3QN3A 4HNCA 2OLAA 2HZGA 3EKGA 4DN1A 3I6EA 3P93A 3TTEA 2QJMA 3P0WA 4A35A 4JN8A 3ZVHB 2GGIA 3UCDA 2OPJA 3FYYA 1FHUA 5FJOA 3V5CA 3DEQA 3UXLA 3R10A 4JHMA 4ROPA 3Q45A 2ZADA 3RR1A 1JDFA 4GIRA 3NZGA 3JW7A 4KPLA 4HNLA 3R0KA 2GL5A 2OZ3A 3SQSA 3UJSA 3U9IA 3UXKA 4A6GA 2PPGA 3DERA 2HNEA 3OPSA 4K2SA 3UJ2A 3NO1A 4IP5A 3P3BA 7ENLA 3R0UA 4MGGA 4E6MA 3DGBA 3UCCA 4K8GA 2AKZA 1BQGA 3ZLHA 2HXUA 1NELA 1P48A 3CYJA 3SN0A 4IP4A 3DG6A 3MWCA 4JN7A 2PODA 2P88A 2OG9A 4M0XA 3I6TA 3H70A 1MDLA 3QLDA 3FJ4A 3UJFA 4GGBA 4MMWA 3SN1A 4E4FA 2ZC8A 2OQHA 4E4UA 2QDEA 1R0MA 4IL0A 3RRAA 1TKKA 3TJ4A 3VA8A 1PDYA 3B97A 4ZCWA 3TJIA 3ZVHA 3NFUA 2DW7A 1PDZA 1MDRA 3UGVA 4F4RA 3DFHA 3PWIA 4KWSA 2PCEA 3H8AA 2PMQA 2GGHA 2XH0A 4YWSA 3STPA 1MNSA 2PP1A 3OZYA 2PU1A 3FXGA 3D46A 1TZZA
chains in the Genus database with same CATH superfamily
2BSLA 2VD9A 2GSHA 1W3IA 2ZTKA 4JY8A 1N2VA 1GEQA 3QFWA 4R27A 1V6VA 4JTEA 1S5VA 7XIMA 3BOFA 1VR6A 3TN4A 3EX2A 5HQLA 3B9AA 2C0AA 1TWDA 1EA0A 1ZX9A 1HZYA 1SVDA 3SSZA 3FEQA 4GWEA 5E0FA 4MSSA 3URAA 1QNOA 1EYWA 4I6KA 7PTDA 3O1NA 3VNMA 2OJPA 2OVLA 2KAUC 1DPMA 2RDWA 4FLOA 4QDPA 4E8CA 1OYBA 3AICA 1A80A 3KE0A 4J2MA 2BVYA 1E3ZA 2F6UA 1AH0A 1OX5A 3EEZA 1O5XA 3BK0A 4H9MA 4YVVA 3OA5A 3USBA 3I4EA 1X7IA 5AN7A 1VGAA 3D3FA 4Y9NA 3OVPA 1WX0A 2Z25A 1IEXA 4IPLA 3EPNA 4H9TA 1LT7A 2Y8UA 3NDOA 3W6LA 1V7AA 2P0IA 3W87A 4H9VA 1GNXA 4AYSA 4YIWA 1ZTVA 2QCEA 4LSBA 4W7VA 5EBUA 4CNUA 1RALA 1H60A 5CGQA 2YIHA 3DFNA 4K8HA 3C61A 3T0CA 3I7SA 4ERIA 1M6IA 4XKYB 3C4UA 5ABTA 2NX1A 4CU6A 1U30A 1W9UA 2O4MA 2WSRA 3VFCA 3NJ3A 1W9BM 5BXTA 1FWTA 4D8ZA 4LAOA 2B4GA 2QMKA 3LHUA 5T26A 1XD1A 1XS2A 3OZMA 3WL1A 2Y7DA 1HVXA 1CI1A 4ZE4A 2FZMA 1L8PA 4IZGA 2ZRVA 3ZT5A 3CT7A 1ADSA 2EPLX 2NXHA 3BDKA 2PDUA 4HYVA 3R6IA 1JYNA 1I9CB 4C1NB 2DT0A 2YA1A 3GFYA 1F3TA 1T41A 1WQ5A 5H91A 4GK8A 3FVMA 3OYXA 1JZ8A 3AWNA 1MO9A 2GR3A 4WR3A 4GQBA 3VCRA 3E0WA 1X1NA 5I5RA 1OK6A 1O1ZA 3CGTA 4NEVA 5I77A 5D9OA 2BOGX 2E5BA 3W73A 1OIFA 3HQ1A 2CWXA 4AZGA 3WF1A 1V02E 1WZLA 3VUSA 3ITYA 2YCKX 3C2EA 2VC5A 3OW1A 1AD4A 3M5XA 4CN4A 3HPAA 1JPIA 1QPKA 3IAPA 3S6OA 2IPWA 3VDBA 1CXEA 2OXNA 2DSKA 2NV9A 5CBJA 3BVJA 3RPMA 3H2EA 2Y0FA 4UMBA 3WQOA 4KF1A 2NPXA 2P1FA 1QPNA 3RX4A 4AHOA 1SZFA 1QATA 2WQDA 4NX5A 4S3JA 1JPMA 1CPUA 5CG7A 2R14A 1HX0A 4O53A 1GYNA 3DXIA 4IF2A 4GBDA 2QQ6A 2CXEA 4AHPA 1A5CA 2ZX6A 4XBKA 3M43A 1W3HA 3LGGA 2OU4A 4DJED 2J8GA 3WUEA 1ME9A 3LHTA 2YLAA 3VIIA 3DGRA 5H8MA 3HOJA 5GRTA 4GGHA 3DJGX 3RLUA 1A0DA 2WXDM 1JGMA 2O56A 3BJTA 5TNVA 2WJEA 4JTSA 2QJJA 2V6AA 4H7VA 2QDDA 3ZS4A 2OEJA 4LAKA 1PSCA 2WJDA 4N9CA 3VCCA 3IJDA 1GQKA 3PANA 3KP1A 3G22A 3GG0A 2J7BA 4Q8TA 2WO5A 2UY2A 3VDGA 4L80A 2DU2A 4GI8A 4XZLX 2X0YA 3RUBL 4KGJA 3UGRA 4NNBA 3V0TA 2FKPA 5EMYA 4ICNA 2RGLA 3UFYA 5LIXX 3L8KA 4AH7A 1TVNA 1EJUC 4IUOA 1F6YA 3VDHA 4QE4A 1LORA 4GI4A 2C1IA 2CXGA 4C5YA 1DORA 4Z1DA 3AIRA 4Y9MA 1C8QA 2VEFA 4AY7A 4O11A 3H2CA 4AHQA 3AZTA 4QHRA 2EPNA 1GVYA 4TV6A 1TUFA 2GK1B 5M1TA 1DBTA 2WC4A 3BOLA 2NXIA 4H4TA 5FJOA 4AZIA 5FMHA 1PCKA 1VYRA 1TPUA 3VK5A 2BS9A 1HG3A 3BAWA 2PDHA 2BVTA 5TAOA 3TU9A 5AHNA 2YXGA 1EOKA 3WQ4A 3CUJA 1GGOA 2C15A 3MP3A 3VABA 1DQXA 2PDYA 1VEPA 3UG8A 1NFGA 3GD4A 1W9DM 2YL5A 2G4JA 2PZNA 3EEGA 3BV4A 1RQBA 2OOFA 2IPGA 1QMLA 3ALGA 3SI9A 4XAFA 1JOAA 4LC6A 3GW3A 1KFEA 4C6EA 4V2XA 3FHAA 2X8GA 3F4NA 1PEZA 3LQGA 4NP7A 4UC5A 4S2BA 1GT8A 3QLDA 5CZTA 1Q66A 3SN1A 3B0PA 1V6UA 4ACZB 1YE6A 1ZMDA 1QI5A 4GC4A 4ZQCA 3PUDA 3SCQA 2D3LA 1F3PA 3H4WA 2BY0A 1GEUA 3WEOA 3S1WA 4QG9A 2Y24A 2NQ5A 4Q7BA 3TMLA 2ZX9A 1MDRA 1A5LC 1S46A 4KWSA 4BZYA 1KLZA 3GAKA 2W55A 2V3DA 2VCBA 1N55A 2VRJA 3W1AA 4YVPA 2DH2A 1DE5A 2GGHA 3B9JB 3NZPA 2DZXA 1O12A 3KRBA 3W1PA 1WYIA 3GDRA 3O05A 4QS5A 4WY0B 4EK7A 3PB2A 4XIMA 2Q71A 3VNYA 4UTIA 5KITA 4QEHA 3KCLA 5CJ5A 1J6PA 3T81A 1L0PA 5IDIA 1JD9A 3MUXA 4NZFA 3OZYA 3IIPA 3GNNA 4JIHA 2XFYA 3E49A 3PHAA 3KRSA 4AW7A 2OZ0A 2XH2A 2ZA3A 3QGKC 3A9IA 3UWQA 4EE9A 3OQ8A 3MUZ1 3N14A 1VZWA 2PP3A 4MNJA 3HW2A 1XR2A 3GRTA 2Z27A 2ZIDA 1WNOA 1GZJA 4X0VA 2XFWA 2FHCA 1S7MA 4KEVA 4V33A 4QG8A 1MZHA 3R0DA 1NF7A 4IGHA 3W2JA 2CZFA 1FEAA 4E3VA 1UBPC 5I07A 3WK0A 1KBLA 3DN5A 3EPOA 1RHCA 4QRNA 3MHFA 3T44A 2JKAA 1QW9A 4EX4A 3E02A 3RIKA 3IANA 1GCYA 2A21A 1L6WA 3BG5A 2WBGA 3GVWA 3I7QA 1T3QC 3OBKA 1T96A 1JPHA 1LLOA 5D2YA 2QYGA 2RJGA 2WYSA 4GY1A 5D38A 4E2VA 2QPUA 3QHOA 1AQHA 3LCGA 5FJTA 3ABOA 1L6FA 4UOQA 1EZWA 4D1JA 3RYSA 3WK3A 2L5HA 3DYMA 4XUGA 3A7AA 3EOUA 4O17A 1RP8A 4FX6M 3AU6A 5AHFA 3W25A 5C9XA 2NSOA 1MFUA 2TAAA 4Q8PA 3TYBA 3KOWA 1A5AA 3VGHA 4DYEA 1B9ZA 3O8AA 4S1FA 1YDYA 2ONEA 1AA1B 2IXUA 2RDTA 2XSXA 2QCHA 3TQPA 3GTXA 4UNIA 5G4HC 3WDQA 1E1EA 1UA7A 1S2CA 3CQHA 3UY8A 3IJIA 1E1CA 1QXLA 2ZA2A 3TH6A 1R5YA 1NOFA 5I00A 3JS3A 1VHNA 3NS1B 4UXDA 3L66A 2R82A 4OIFA 1HJSA 3PN8A 1OD0A 3AMZA 3W7HA 3CUXA 3VILA 4HKPA 3MMWA 5AYXA 3OTRA 4O1EA 2E5DA 4GABA 3NSNA 4US5D 1J0ZA 4C6JA 2ESCA 3F03K 1HJQA 3LG3A 1DWAM 3AXIA 3N2CA 1WBHA 4YTRA 1GTHA 3M0IA 3Q94A 4UBPC 2Q09A 1E9IA 3WQ5A 5EMLA 4S38A 4IMAA 2IQDA 3A6OA 1U1JA 4Y9AA 1V0MA 3NL2A 3F1QA 5JBFA 5CSUA 2UY5A 2NVDA 3W7GA 5HMSA 3W1UA 5M03A 2HDJA 1JCLA 4P8VA 1V4YA 2WMJA 3BJFA 3MPGA 4MB4A 4TMBA 2XGZA 2ZXQA 1GJUA 4Z17A 2HVNA 4LV4A 4MB3A 2P76A 4JGDA 1UWTA 1UJPA 1EP3A 3GNPA 3II1A 1US3A 2HROA 3LV5A 1OM0A 3IIZA 1UWAA 4JL2A 1X1ZA 1REQA 4O4VA 4WDWA 2IKGA 2PGEA 3CXBA 3PAJA 3DK8A 1OCBA 2ZRXA 3AS3A 3SURA 2Y2WA 3T55A 3WY1A 1J0JA 1V3HA 2NX9A 3NVTA 5JCIA 1HXJA 5CC6A 3LTSA 3LGEA 3SCWA 1M53A 4MY1A 4O54A 1QNRA 3PWGA 4W8AA 4C6OA 1PKLA 4DWDA 3KZPA 3F5LA 3P8IA 1FRBA 2PDWA 2CNCA 5F2MA 3LD5A 3TOYA 2EJ1A 3IIXA 3KBWA 4W88A 1J01A 4J4KA 2DSZA 2F2HA 3HBLA 5AC4A 3TXVA 4F0RA 4A8LA 3CAWA 4IJCA 2GUBA 4W8LA 1SZNA 2D24A 1DHKA 2OCZA 1EF2A 3VCNA 1BWKA 3CO4A 4GVFA 1UC4A 2R91A 1F74A 4FPSA 5HMEA 3UA3A 3QZEA 3FSUA 1WZMA 4J3SA 1HL8A 2ZUNA 1QPQA 2IPJA 2QUTA 4HBKA 4US6A 4F0MA 4RK8A 1NFPA 4D72A 4LUJA 4MY9A 1SMDA 3WLJA 5EMUA 4J3TA 7REQB 1P6WA 3ABZA 1LWJA 3WQ8A 1E3XA 3WNMA 4HZ8A 1W1B1 1ADOA 3BAXA 2W66A 3RR1A 5A6BA 4BHYA 3NZGA 1W3KA 4ERAA 3LZ5A 1FEBA 3QFBA 1A5NC 5CPTA 3WQ6A 2YQUA 1ICPA 1XGZA 2TODA 3O7UA 3C6CA 4ZODA 3S2CA 1C8XA 3UWVA 3GYCA 2YDAA 3BG3A 3GXNA 5XIAA 1SFJA 2CLEA 1NQ6A 2DVTA 1VBJA 2E25A 2YVGA 1EGMA 2A7PA 2V5JA 3GXMA 2I16A 1FFUC 1O95A 3LN3A 4C6BA 5FI8A 4AXNA 4NZ5A 5A6MA 2WPEA 1OC6A 4F66A 1EQPA 4O0QA 1I2QA 3HG5A 2BX7A 4N9EA 4GINA 2HV5A 3USZA 4LVGA 1C29A 1F6PA 3B9NA 3H70A 1D3GA 3WK2A 5AYZA 1KFCA 4GGBA 4PMNA 3U2CA 3W7QA 4E4FA 1EH9A 4ML9A 1UOKA 2GJNA 1OFPA 3UPWA 1PIFA 4JY9A 4C1KA 1ZALA 3KDNA 2BY1A 3EB3A 2ZZCA 3CV6A 4ZCWA 8A3HA 1KM1A 1FWSA 1DEDA 5B80A 3UZJA 2HS6A 3H53A 1V02A 1MEWA 4FSAA 3FNDA 1RPKA 1GW9A 3PWIA 4KPRA 1VS1A 3GTNA 2AMGA 4P7OA 1ZAJA 2E7FA 4NZCA 3VZZA 2C14A 3OODA 1GK8A 2HQMA 3CL8A 3V5OA 3RPDA 1HJXA 3VIJA 1OQFA 3NSXA 1OGBA 5KETA 1RH9A 1PO9A 5A8QA 3WL0A 3B8SA 5C8BB 1P7TB 4LNCA 4R5EA 2PU1A 3QZ6A 1TZZA 5EL1A 3G18A 1XIHA 3UG3A 4KH2A 1L6SA 4UMAA 1JR1A 3WMBA 4H4QA 2FB2A 1NDVA 4AMCA 1BHGA 5F2LA 2VP8A 3SGUA 5CJMA 2OMAA 2VXNA 2OYMA 2J13A 2DSVA 4YS1A 4DNAA 3W1LA 1KBJA 1AQ0A 1TA3A 1YPIA 4OGZA 3GXTA 3ATYA 4G5DA 4J1OA 2PD5A 3W7PA 4PTVA 2BWGA 5CKSA 1E55A 3SCSA 3EDDA 1UWSA 1GZ1A 3NL6A 3LEPA 3ENLA 1CZ1A 4LYQA 3L67A 2CLKA 4H2HA 3B04A 2QR6A 1TE6A 5LNSA 4O52A 3K46A 1UWIA 2ZQ0A 4PCSA 1CXLA 8XIAA 5I02A 3MCOA 1U83A 4PCTA 3DI0A 4CQBA 2RUSA 2VFIA 2OX1A 2PTWA 4CQ8A 4GYKA 3TLQA 4MWAE 5BOFA 4XTDA 3QC3A 3PPGA 3MYPA 4B90A 2XVKA 3UJRA 3THAA 3S5YA 2HK1A 4D6JA 1RA0A 1JZ3A 1R38A 3FFSA 1E0WA 3AHXA 4ZVJA 3DDMA 3SJ3A 1EOMA 4DJFC 1JXJA 5K4XA 3R8GA 4BY3A 3TONA 1K8XA 5F1UA 1GOIA 3GLCA 2DY3A 4K7ZA 4WXYA 1NTHA 4Q4KA 3SQLA 1JPKA 1FWCC 1XH0A 4GXPA 4EPEC 1H09A 5CAKA 4N42A 2GGJA 2TPSA 2F61A 3A21A 2YR1A 4PL1A 1K7XA 1Q6RA 1VYSX 1IE7C 2IKIA 4J3WA 2NVKX 4GO8A 1GQIA 1IWAA 2CLFA 3KZSA 1GESA 4EQRA 3LNPA 3CH9A 4M56A 2HE8A 1EEXA 3FA3A 3CASA 2PDJA 4IIBA 4J27A 4ONVA 4L6HA 2H9AB 3UWWA 3AI0A 4YTUA 2D2JA 5E0CA 4JIEA 3N12A 3I68A 3ELFA 1DWIM 1ZL1A 3T2OA 3VGEA 4HMCA 3VUPA 2Y7FA 4AF0B 2ZRYA 3TYZA 1ZFJA 2C18A 4CCCA 3G3DA 5LGXA 4LY4A 3S83A 3HGJA 1BAGA 4JD4A 2FZBA 3NXFA 3HFTA 1I0BA 3WDRA 4HK6A 1CX9A 1IZJA 4TMCA 2Y8KA 5D02A 1DIKA 4C6PA 1PKNA 1XHGA 3NVVB 4QAWA 1E9ZB 3ZSSA 2DUXA 4HJWA 3E0LA 1XLEA 4EMJA 1CGTA 3OLEA 4WKFA 3KL5A 1Q1WA 4IH3A 1W8SA 2ZE3A 3ZWSA 4ZENA 3RJYA 2C19A 4PB3A 2C7FA 4M6PA 3ZOAA 2VEPA 5DEZA 3W75A 4J35A 1IGWA 4M6UA 3R89A 5A6SA 3EWYA 3I3EA 1XCFA 4H19A 2PTYA 1QHPA 4ADWA 5ENLA 2FHBA 1Z7AA 4LY8A 3U7VA 1V93A 2PCQA 4Q8UA 5KVHA 2W6RA 2EQ7A 3QMTA 3MA8A 4KBXA 1PL9A 4IP7A 3A64A 2V5LA 4LCSA 3GHSA 1Q1RA 3H12A 3UP8A 1JZ7A 1XIJA 4IQJA 1R3QA 3LBOA 2BOFX 4HNUA 3MKKA 2GJRA 3BSMA 3GIYA 2R1NA 1OGSA 4PR4A 3RF9A 4B9YA 4H4YA 1DKWA 2V8ZA 2FH6A 2HZGA 2VM8A 3E0IA 4OU1A 1FKXA 1QBAA 3QV6A 2PBOA 3EXRA 1XLBA 3SAZA 3O16A 5IXEA 2ACUA 3W83A 1FHUA 1M3UA 5FA5A 3U2ZA 3O15A 1KFBA 2FPVA 1S2AA 5DRCA 3ITOA 4B16A 4KRZA 4OQVA 1EKOA 2PDCA 4NQ1A 2WANA 4KPLA 1BPLB 4JYEA 1EJTC 5AKQA 4O8AA 1X2GA 3AJ7A 4BWLA 1PWMA 5B7YA 2VCCA 1KBIA 1OBAA 3UJSA 4PODA 1TR9A 2F6KA 2YBVA 5HPCA 2ZZ3A 1FDZA 1A3WA 4UQDA 4O19A 3VGDA 4LYKA 3EWXA 3HJZA 4JTHA 2E6DA 1TMLA 3B0UX 2YJQA 4U2YA 4R9OA 1UR0A 3W2NA 4MGGA 2A2IA 2J4GA 4FNRA 4LRSA 1MQRA 3AFBA 1UW9A 2WM1A 1B2YA 3APTA 5DF0A 2CZDA 1GVQA 3CUIA 4KWWA 1TCMA 1EZ2A 1RV8A 3UZZA 1OK4A 1JCJA 1KW1A 1WP6A 2X09A 3R8HA 2PI6A 3W3OA 4CU7A 1UR2A 3I6RA 1G0CA 4D71A 2J8TA 3G0UA 1ISWA 2OLHA 1WAUA 2A3EA 5CXPA 3SUUA 2V2DA 5D2WA 3UWZA 2JFEX 3BCJA 4DO7A 1D3CA 4M1BA 3S8HA 3QC0A 3TJIA 5HBFA 2WOWA 2PWHA 1H49A 5A5WA 2D3NA 3DFHA 4L4OA 3DUGA 2V5DA 3ZZ1A 3NQMA 3I10A 4GIYA 4Q33A 5H8PA 3LMZA 2B81A 2YB1A 2BODX 4LANA 1NWSA 1K77A 2WOIA 4KRUA 4QM1A 1EIXA 2PP1A 5I2UA 1CLXA 1CNVA 4O0ZA 2E6FA 3KOYA 3OB8A 5I0DA 1WXZA 3S46A 4RDVA 3BLLA 3KUMA 4B92A 1OX4B 4RX0A 1A53A 1GVIA 5F4SA 1O66A 3W7JA 1C9WA 4AD3A 2DFAA 2ISDA 4CKQA 4FLSA 2INEA 2JKPA 1VRDA 3WJYA 2VDGA 1E9YB 4H1ZA 1QASA 4IL2A 5G5HB 2PC8A 3MV01 4H4IA 3WQFA 2P8BA 5C71A 1FECA 3DFQA 3RITA 4Y8FA 2PWGA 3VD3A 1F7BA 3CZ8A 2UZ9A 1SW7A 3ES7A 1SJCA 1ZCOA 2Y8VA 2I9UA 1A5BA 2WPGA 4HOWA 1UD4A 4FALA 3EMZA 2Y5SA 4RPPA 2ZUVA 2XG9A 1EF3A 2A3CA 3VOIA 4V1XA 4H8HA 5BXPA 3WBYA 1IXNA 3TTQA 4QLKA 4RNIA 2QVNA 3S5ZA 1EDQA 3LSCA 4HSHA 1TREA 3GO2A 1M41A 4H7ZA 6ENLA 1YBQB 3IPWA 3T6CA 1TZ9A 2QF8A 3P60A 2YL8A 3BAKA 3CWNA 2Y61A 2DEPA 1XG4A 3GD6A 4QSFA 1E0VA 4WOZA 1GQLA 3C2OA 1MUWA 4JBRA 1DXEA 3MW7A 1F9CA 5JUVA 4NAFB 2TRSA 3D47A 3KBMA 3TYCA 3NL5A 4A2RA 5CG0A 2ISFA 1EX5A 4AC1X 4C6IA 2W27A 1XX1A 4AG0A 5JMUA 4TQTA 1EWEA 3AXHA 4HPNA 1VFUA 4FNPA 1XIEA 5FEWA 1PZ3A 3KVMA 4QE1A 1K7EA 3QY6A 2POZA 2Y63A 3W28A 2BY2A 3AROA 4GQRA 4HGXA 1KFWA 4TTUA 1G4PA 3ONBA 1BVZA 1F4HA 3DAQA 3CGCA 3WYZA 1Z42A 3F2DA 1EP1A 1JYXA 3O0FA 4J9JA 4NJHA 1KCZA 5AC6A 1O4UA 2OGJA 1VC4A 5FF2A 1E6XM 5I79A 4X63A 5ABHA 1IWPA 3MP4A 4MWAD 1ITUA 4CLMA 1J4EA 1W6TA 3RM9A 2YYUA 3W24A 5AC7A 2XIMA 2DIEA 1MQQA 1LTDA 4OUEA 3ZJ8A 3P82A 5MHBA 2GQ8A 2VQUA 4ZEPA 4R88A 2H90A 2X1UA 4H4XA 4M1RA 2B7NA 4GXMA 3ZM8A 4J5NA 1H4PA 4P7QA 3E0FA 5G1YA 4AAJA 4G7EB 4HYRA 5FJRA 4H00A 4UOJA 2P53A 3B0YA 1MRAA 1ADDA 1FWFC 3BAJA 4PMVA 3LU2A 3U5UA 2HBXA 2VTFA 1ZY9A 3MSGA 3WLQA 2DSUA 3LMYA 1GOWA 1ECEA 2XVNA 2FGZA 1A3XA 3AALA 1MSSA 4YTTA 1R2RA 2P3ZA 5GJPA 2O9PA 4LS1A 2XIOA 3F4WA 3TFXA 1YADA 3PJXA 2Z2AA 2DH3A 4PMOA 3S5NA 1F4AA 5ABFA 4FOUA 4ZA0A 1AL8A 3BZGA 2E5CA 2CBJA 2NSXA 3E12A 2EPMX 2VEIA 4JTCA 4A4AA 3GNOA 1EGVA 2ZVRA 3DK4A 2OLSA 1DJHA 2FZ8A 3V0SA 1TV4A 3TN6A 1ME7A 2VX4A 1EC8A 4MF4A 1ME8A 3DG3A 1FWIC 1TV7A 1QPRA 2YCIX 1LROA 2W0HA 1ONWA 4ZFCA 4B5UA 1NH6A 1SSGA 4JQ9A 3PBGA 3T0BA 2Y85A 2PDLA 5FL1A 1B31A 1NHPA 5BYWA 1LUCA 3ZQ9A 2ZUTA 1QHOA 2WVVA 4DLMA 3ZR5A 3GC4A 4KESA 4B5NA 4JNZA 3G1XA 1U5JA 4KQNA 3V7PA 4LPCA 3WUBA 3IUHA 1DXIA 1RJQA 1NM9A 1UR9A 3FAXA 4CEUC 2FB3A 3IJ8A 1ZJIA 1KM5A 4ZSUA 3EYPA 4A21A 2VL4A 1GRAA 3BLDA 2GL5A 1PAMA 3N25A 4PUNA 3PTQA 1TJRA 4MWAA 3RXZA 4CNNA 4A6GA 4C5ZA 1UH4A 3DFSA 3W22A 1IZKA 2VFGA 3WG6A 1HGYA 2YZRA 3QV8A 1AW2A 4KCUA 2FPTA 1LT8A 4S3EA 4LALA 5HAOA 1Q63A 1QWKA 2DPEA 5BRBA 3PZUA 1WKYA 3KBJA 4Y7EA 3W2KA 3QBUA 1R9ZA 4BURA 3H24A 4KWUA 1GKQA 3OBEA 3P8JA 4FAMA 1CLKA 1MOKA 2J7GA 3CV2A 5IHRA 3GVVA 1X96A 4HU4A 2E5AA 1IF2A 1MDLA 2Q8XA 3FJ4A 3B9EA 2HVOA 3W0KA 4AD1A 4UTHA 1FCBA 4QDMA 1W1YA 1QOQA 1TV5A 1J93A 2QUUA 4Q8WA 3WFAA 3N04A 3UXAA 4NXKA 1OG0A 1LL6A 3NPUA 1R3WA 1GORA 4JDYA 3T05A 3U6WA 1FBAA 3EOLA 1Q2SA 2QCDA 4WHBA 1CDGA 1IIGA 1RCOB 3SY5A 5LIYX 3VIPA 4AEEA 2GPTA 4PBFA 2GVEA 2VRKA 1E4NA 1TPH1 3WBEA 1DXFA 3T1GA 4BA0A 1EHAA 5DELA 3TN5A 5BWFA 3LPFA 1LBFA 4JZ5A 2AOSA 2V67A 4JICA 2DZVA 3CZKA 3ARUA 2J88A 3H54A 3LK6A 4K6AA 4JIPA 4Z1AA 2CU0A 1XYFA 3MZNA 3GRSA 4L1GA 3G77A 2X1TA 4APNA 1W17A 2GWGA 1E40A 1BWVA 1WDSA 4CD7A 2J3NA 3UNDA 4JFVA 2Q3OA 3VPLA 1FVPA 4U31A 1H5VA 4YHGA 3RMEA 3W1RA 3CIVA 1OABA 1SO6A 3LS9A 3VOFA 2O9OA 2CLIA 1BG4A 2EPKX 4O18A 4LH8A 1Q7QA 1S2TA 1WUFA 3K1GA 1IEIA 1XRSA 4CD4A 3BL3A 4CD5A 3GE7A 1YHTA 2DUAA 4V27A 3B8UA 3L4TA 5FOOA 1DIDA 3MKCA 4GLEA 4JTUA 1NIUA 8TIMA 3M5ZA 4LOCA 4C91A 3Q65A 3URBA 3THCA 3M0MA 3ZSTA 5K3VA 4NILA 4LX4A 4LB3A 4Y9OA 5LXEA 3GX9A 4EMWA 3JZUA 4JX5A 2X8CA 3NYDA 1JJKA 5K4ZA 1YNPA 4J3XA 1KM4A 5D2VA 5KINA 2PF0A 5I23A 1XG3A 3AMDA 1UWQA 2XIBA 1H2JA 3TTSA 3N9RA 4UR9A 5GPRA 1P6BA 3QQ0A 4CNOA 2E0PA 2GQ3A 1MZRA 4EWJA 1P7TA 5I6SA 3SEPA 2EQ9A 2VMFA 1JL8A 4PFHA 1YTDA 3GQYA 2WP5A 3GXFA 2ACRA 1R9YA 4AIBA 3C2FA 4WK9A 4C6QA 1RD6A 3WD0A 5DXYA 1NY1A 1YNQA 1ZBWA 1XPYA 3PG6A 2Z4GA 2Q6ZA 1RBAA 3A4JA 2DJXA 3WIJA 4LUTA 3W1QA 4Q32A 1XRVA 4XD5A 4C6KA 1D2KA 3L0KA 2J9XA 4GY0A 4JNYA 3WEMA 4BJHA 5J04A 3AMGA 4D2JA 2JGQA 5RUBA 3TQVA 2AAAA 3ARRA 1VQZA 4HSOA 3DFYA 2HS8A 4GUFA 4OBRA 2I5IA 1XBZA 2YXXA 3N6QA 2FVLA 1QBBA 3LB0A 1U1UA 3BARA 5JU6A 1X1OA 5H1WA 2PSNA 3NQVA 1CXIA 1VRXA 2VO5A 3MB9A 1JPDX 2XVLA 3BUVA 3EWBX 3S42A 4WZHA 2PTXA 4DJDA 3DBPA 1AL7A 1F5ZA 3G1DA 3QTGA 1G5AA 3QHNA 2BGNE 2NQLA 4IICA 2V38A 4BI5A 2NUXA 5EU9A 3WD3A 3UU0A 3UZXA 4UFHA 1KR0A 2D20A 4DXKA 1YLVA 5FL0A 3NO3A 1NVMA 3MU7A 3OVGA 5A6KA 2VUNA 3KRUA 4KFOA 2NWSA 3OG2A 2WC3A 5FJUA 3VKDA 1I75A 4DQWA 1BKHA 1NHQA 1R46A 3WLTA 2UY3A 3QQWA 2OFJA 1SB3B 2YA2A 3CIWA 3N17A 1W0MA 4R3UA 1XDLA 1VFFA 4HCLA 4XZBA 2BG5A 4FLQA 3RR4A 3AZSA 2Q3RA 1W5MA 3NM3A 5AECA 1UPMB 2AKMA 1JRBA 1HKJA 3S3GA 1QCWA 4AWEA 1LP6A 3SFWA 3T4CA 1YXCA 2AGTA 2VGIA 3URHA 4A2SA 4HHMA 3GD3A 1H5YA 1N7KA 1RVGA 4LCRA 4PMRA 2ZDSA 1H61A 1EJVC 5FSEC 2WMIA 4LNYA 2E6YA 3GBDA 4C6DA 4O1FA 2IKHA 6TIMA 4F3HA 1NF0A 3S5OA 2Z0IA 5JCMA 1NWRA 5TBOA 2BTMA 1UBSA 3ID7A 5BNKA 4U28A 4FHAA 3QJAA 5A8OA 1EXBA 2GSJA 3QMRA 3C8NA 2XTKA 4HU8A 4K8EA 4RLIA 2DZPA 2FFCA 1PYFA 2V5CA 1BGAA 1ENUA 1FOBA 2E9BA 2C1HA 1MMFA 2Y1HA 4NT0A 2D73A 5AHIA 5D9PA 3SCTA 1PX8A 2OO0A 1TRDA 2JE8A 4MJ4A 3FEMA 3KWSA 1TR1A 2J8FA 3U2OA 2V30A 1R87A 3GZ3A 3T78A 4HQVA 1UIPA 2NQ9A 2ZX8A 1HO1A 2ISWA 3CUZA 5D4YA 5A2CA 4L9XA 2HXUA 1P48A 2YPIA 3BCDA 4IFRA 4XD4A 1XLHA 3P84A 1A5MC 3FLUA 1VCGA 2DORA 4B3ZA 2PGRA 1FFQA 1QI4A 1BKSA 3ARYA 3K8LA 1M7OA 1TFVA 4UTTA 5HOSA 4MB1A 4IL0A 2CLHA 3SW6A 5C7VA 3QW4B 1KXQA 4UTWA 5U1OA 1PDYA 3CH0A 3WLRA 2G37A 4ICCX 1GOKA 4YCPA 1Z41A 4IG2B 3DHUA 3PZMA 4ZOHB 4Y96A 4F4RA 4IIHA 4B3KA 3EXSA 4PMUA 3RDKA 1KFJA 1PTGA 3H22A 2PMQA 1JUEA 1W5PA 4TXEA 1FP9A 3GU9A 3NURA 4GYJA 2VEGA 5FF4A 2CFFA 3GR4A 2ZX5A 4I8YA 1C9DA 3CQ0A 5TIMA 1R8LA 4FXFA 4AD5A 3DFOA 4X2RA 3N19B 5D09A 2NLYA 4A8RA 2FTPA 5ECUA 1SMAA 4UWMA 2ISSA 4CNSA 4RDWA 3MTWA 4JN6A 4TX9A 1CGYA 3CXOA 2WNWA 4PTXA 1E6SM 3P2VA 4B5VA 3GB6A 1XLDA 3TCEA 3GUWA 4H4RA 3AS2A 3CQIA 1HNYA 3MANA 3GVGA 4PFMA 4MNMA 5LNUA 3IGXA 1E51A 1H62A 3RX3A 4ZB0A 3K1DA 1TTPA 3VDAA 3KBNA 5TQLA 5M2FX 4NRRA 4G9PA 4HTYA 4ORMA 4ZFMA 4EAMA 3SBFA 2VOMA 3H55A 1ESWA 3R13A 4EVZA 4FB7A 5LNRA 3GG7A 1VBHA 2C8NA 1O1HA 1A5SA 1QU4A 3K4DA 4HA0A 4S3BA 1CECA 1KRCC 2C91A 1ZDLA 1VHCA 3G6MA 3DENA 3B4YA 4FMVA 2PTZA 4AX7A 1EO7A 4JTDA 3QHMA 4UTTC 3G8RA 4Z2IA 3STCA 1HT6A 4HB7A 4K36A 1VCVA 1EO5A 2PUZA 4XK2A 4D6HA 1CGVA 1MW1A 4URIA 4I5RA 5TF0A 4G6CA 1L8NA 3L5MA 3LADA 5T9BG 1A50A 3WELA 4ERGA 1Z89A 3IS4A 4Z1BA 1N82A 4H83A 2HMCA 3BW3A 3N73A 4JXCA 4XZMX 1XGDA 4Y6GA 1ISZA 4H8VA 3NG3A 1C91A 1B0IA 4S3DA 4IQLA 3U4FA 5LXXA 3HURA 3AMLA 5FF7A 4JTRA 3BMXA 3EPMA 4HT3A 1OEPA 4HMDA 4QSHA 1NFBA 2WVTA 4JYDA 4V1YA 2DW6A 4DHGA 1CW2A 2WVUA 2PDBA 1MW0A 4Q4PA 4YPJA 1FUYA 4C1LA 4JNMA 1Z6KA 4DB7A 1DIEA 3IJQA 4OOUA 3NVZB 3UETA 3WLNA 2F38A 1E5JA 2PDKA 1LL4A 2JQXA 3FOKA 4JQ2A 3TYEA 5FJIA 2HQAA 1XYCA 1V7YA 3WNNA 1H6VA 4FNTA 2FMOA 1S2VA 4YNGA 4P8UA 2J75A 1DE6A 5MF5A 3CJPA 4TR9A 5C9WA 4H9ZA 3ITTA 3TC7A 1UZ4A 2J77A 1K9TA 4U3AA 4UTLA 4K3ZA 2NX3A 2IQ0A 5CPSA 3SUTA 3W1NA 1M65A 2VKZG 2QXWA 1MEHA 4MUPA 3K8KA 4WDTA 5A8NA 4WX2A 5BOOA 4BR1A 2PF8A 1JCMP 5C54A 1MXDA 1FCUA 1TIWA 2CCRA 4GISA 1XICA 1PX3A 2G41A 2XM2A 1BYDA 3GVRA 2DSWA 1K8CA 3MY9A 3QXBA 3SCRA 1E0TA 5FAJA 2PWVA 1RLCL 2OT0A 4ZO6A 2DVXA 2XN1A 3CBWA 3CWHA 1QUMA 2ZFAA 1O5KA 5DLCA 6XIAA 1VLWA 2CFYA 1YNYA 4HOXA 1Y7VA 2RAGA 3DI1A 1DVJA 1BRLA 3AXKA 1TYGA 2YW4A 1BWCA 1KXHA 3L4ZA 5BXRA 4C6LA 2DDXA 3B0VC 4EP8C 1V3JA 5IDZA 2BXYA 1JAEA 2V3EA 4PUKA 3N2OA 3C52A 1LPFA 1K6WA 2YCJA 2ZKMX 1XANA 1QNPA 4GZ7A 4M6QA 2GYIA 1J8VA 3WDHA 1QO5A 1V79A 2H8XA 3OBAA 1XUUA 4IGMA 1KV5A 4LYPA 4CQCA 3LGDA 4G7EA 2A3HA 6CGTA 2I9EA 3UXLA 1GWJA 3AYRA 5A95A 4ROPA 3CB8A 5E6YA 5BROA 2YL6A 5C2CA 1N5WC 3ZJ6A 5I3JA 4I7WA 4RE0A 2QCGA 1E1CB 2D1ZA 4F9JA 1OFEA 3IVSA 4W5ZA 1BD0A 1QNVA 1GXFA 1UKTA 4DI8A 1Q5MA 2J6XA 3SUSA 3WN6A 2GR0A 4HK5A 2H3BA 1R7AA 1M5WA 3B06A 5JVLA 2ZXDA 3E96A 2WCAA 4NJKA 4HYWA 4IP5A 4GZIA 3M46A 3ZT6A 1RUSA 5HWJA 3KVJA 1OSEA 2EO7A 4MY8A 2OODA 4LRTA 4MJMA 3ANUA 5REQA 3AJXA 3TR9A 1JZ2A 5EPDA 3BLFA 4Q8VA 3TIMA 4HNNA 1W9XA 2WZTA 4GZJA 1EUNA 1R0MA 1IEVA 1T40A 4RL3A 1YTEA 3W7KA 1VPXA 3O0HA 3I65A 3OIHA 2W5FA 1QOPA 1S5WA 4TO8A 1REQB 1EJWC 1VFHA 2FH8A 1JEHA 1K70A 4Z2LA 4GO9A 4JQAA 2X7WA 1UD8A 3G1VA 3FA4A 2GUYA 2PDIA 1UD3A 2VJXA 1US2A 3E6EA 1XBYA 1GG0A 3TJLA 3SQPA 3GXIA 2YKKA 4FX7A 4IQEA 3P0XA 3BC9A 1EHNA 4B15A 1V3IA 3H4GA 1BYBA 3SY8A 5FKYA 3P5ZA 3KOFA 1ML1A 1THFD 3F4VA 3ZVIA 5CLWA 2R9ZA 2UBPC 4DAIA 4CN1A 1XL9A 5JCLA 2J79A 5EY5A 4ADUA 3G1YA 2E68A 3BTNA 1J5SA 2NUYA 4DWSD 3KTSA 3PC0A 1D3HA 1TSIA 4OWGA 5AZ0A 1X6LA 3N1AA 3UYCA 4S2CA 3NQDA 3HN3A 4JYFA 1EDTA 2FDMA 3Q4DA 5H8UA 1KA9F 3WLSA 3SB0A 4TUFA 3VX0A 1WCGA 3MUCA 1D7FA 3KTCA 3VNDA 1KD0A 4FLRA 4A3HA 5CSRA 2Z1KA 4NASA 3MCMA 3EMQA 5HNTA 4W85A 1CB7B 2JK6A 1G7VA 3EX4A 2W0UA 3MS8A 4BQ5A 4B4FA 1OVDA 3FJNA 3AS1A 4DZIA 1VKFA 3WLLA 3TTOA 4E4PA 2WCGA 2ZWZA 1W3JA 4RE4A 2VWSA 4AC7C 4B2DA 3L2LA 5ECVA 5FEXA 3ZLGA 3I3DA 1NU5A 1HIZA 3KHJA 4PBEA 5A6TC 4DX3A 2FFIA 2X8HA 3A4WA 4GKLA 2X05A 4BEQA 4QLLA 1F8IA 4IIFA 3RU8X 1H7PA 5E93A 4LTSA 2G0WA 2DZBA 4AZ6A 4NF7A 4WJXA 3IK4A 4K37A 2P3EA 1OADA 1W5OA 4N4QA 4R85A 3F5KA 3M16A 3VOHA 4WIWA 3AIWA 4IHCA 4AY8A 2V5BA 4UTMA 1W1ZA 3ABRA 4DUXA 3SR6B 4QJ3B 5K7JA 1AQMA 1A5OC 3MUY1 3W2UA 4B5XA 2PA6A 2POTA 4B91A 3LB8A 1S2UA 3TMQA 2XSBA 4XZIA 4Y8EA 2BP1A 1U22A 2VZVA 3EWCA 2WSKA 2Z2BA 4AIEA 3U8GA 4IMDA 4OUIA 4H2CA 5JIPA 4WJ8A 1FWGC 2OO6A 4AZ7A 4F79A 2ZC1A 1FWWA 5C2GA 1TPEA 2VR2A 3STGA 1S1RA 3N6JA 3FVDA 1LQ0A 2Z29A 4EPKA 5CLTA 4AWSA 1E0XA 3FJLA 5EMJA 4IUGA 4LUSA 3ZIZA 3FYOA 2QMJA 4HA3A 3WFLA 1H51A 1UIOA 3HG2A 3MDWA 4K38A 3B3DA 4EWND 1GPFA 2GQAA 3PTDA 1TA3B 1MRQA 2HRWA 1IR1A 1T6MA 4UOZA 4JTFA 4YU1A 1KM3A 2P5NA 1XYZA 3LDVA 2NVCA 3UA4A 4KMQA 1OFRA 2DJLA 1O6IA 3R12A 3S2MA 3F2CA 1OT2A 1ZPTA 1W5NA 1F3EA 2WW5A 3VNKA 3HMCA 4AD4A 2I57A 5C55A 3UNTA 4L64A 4H4SA 1N8IA 1F3XA 2HPMA 1MUCA 1YQZA 4GUGA 3B05A 4R9XA 2INZA 5DX7A 3QPYA 1VFTA 3B8WA 2EHHA 4DRSA 1UOZA 3GBEA 4KEZA 3QF0A 1V51A 4PA8A 4JEJA 4GFSA 3EWWA 1EBDA 2VX5A 2WLZA 1HP4A 1H7OA 3QY7A 1H7RA 1O7AA 4GZEA 3PAOA 3AS0A 3N2BA 3B03A 3UCDA 1M9HA 4POCA 4DNHA 1LBLA 1Q45A 3PTKA 4QCFA 2YDQA 5HMDA 2DP3A 3SGGA 4S39A 1F73A 4JFTA 2VVSA 5G1MA 4IMFA 3WD4A 1UQYA 5EGRA 3TQKA 1F2JA 4I7UA 3CAQA 3F2BA 4GC3A 3KBSA 3VD5A 1HKMA 4H3DA 4MZ8A 1IT8A 3KTXA 2XVPA 2F7FA 2BMBA 1Q3NA 3EWUA 3LNMA 5F1VA 4KFNA 1UZDA 4K8DA 3SR7A 2PRLA 3AXMA 2EG7A 3C0LA 1W8GA 1OB0A 1TRIA 3NO1A 1FH7A 3TAOA 5HNRA 1MXSA 3M0HA 4O13A 5A8PA 5GNZA 2ZXAA 1AODA 3R58A 1YXYA 2TSYA 1V5XA 2WJZA 5HNUA 4GIEA 1ISXA 5CH9A 4S23A 1T7LA 3D3AA 1QK2A 3O9NA 4NI3A 4TVUA 1YDNA 1QFEA 1BYAA 2QDEA 3MYOA 4V15A 3VTRA 4ML4A 4BKNA 3BQ6A 1D8CA 3FHQA 3GYEA 3TZFA 4J3UA 3W4RA 1RR2A 2WPCA 4Q4MA 2ACQA 1CB2A 1EJ7L 3EA1A 3L7RA 3WQVA 2PCEA 4C6NA 3GKFA 1KRBC 4QEEA 4L1WA 1U2YA 1D7YA 3DC8A 1VBUA 3G1AA 2NUWA 3W7RA 1VJIA 3DYOA 3BANA 3GRIA 1WOBA 4AEOA 2DV0A 1TPVA 1NOWA 2QDHA 5FEPA 3PPHA 1V6YA 2ASHA 3L4VA 3CGEA 4AMAA 4DEFA 4DYJA 4GE8A 5A94A 2XJ7A 4XD3A 4HN4A 2AQOA 4IPNB 2VGBA 3MO4A 3CPGA 3NRZB 1JAKA 3FGCA 5A8GA 3L5LA 4NZ4A 3VE9A 3QSRA 3MI2A 1ZXIC 3TNBA 4HA1A 3NGJA 3I3BA 1HN1A 1TMQA 5FESA 3N4AA 1EP2A 2E4TA 1ZKQA 4O1AA 1K4QA 4WSHA 3LI1A 4Q6XA 1AJ2A 1UUQA 1WUEA 2DQWA 1VD6A 1RCXB 4ZBCA 1LLZA 3GNRA 3MSYA 3K5XA 3QFAA 2EGZA 1UP0A 1V3KA 2J25A 1H63A 2QJHA 4AX6A 3KVKA 4IG2A 3GIQA 3B9OA 1BSLA 2OSXA 4ES4A 1ITQA 3GU1A 1IXPA 2AGKA 2VZTA 5I3FA 3N15A 3LENA 4E8DA 1WDDA 1WZKA 2ZZ5A 5HANA 2YVFA 1UZHA 3B8VA 5JRBA 4I9MA 1K9DA 1HO4A 5BXSA 3WH6A 1N8WA 1FCVA 3FG2P 3E2VA 2E9MA 3TW7A 2GFTA 4WY0F 2PDMA 3AM9A 3N29A 2VZSA 1CTNA 4BF7A 3NA8A 1YYAA 3T07A 1TB3A 1IXQA 3GH4A 3N2TA 4LVBA 3CHFA 2V3GA 1QO2A 5CGTA 2X8RA 3S47A 3GNXA 3TZNA 3OO2A 1NDWA 3ARQA 2PGFA 4H4UA 1XQKA 4PRWA 2FGLA 1U5VA 5EYWA 3PR2A 2G3FA 2OELA 1W1PA 3KBVA 1GHSA 2ACSA 4F9DA 2J66A 3CMFA 4P8WA 3PUOA 1X98A 4JKKA 2VHLA 4CUCA 4PC8A 7ODCA 4HA4A 2D0FA 3IV3A 3VI2A 2W79A 3W7IA 1ELSA 4S3FA 2QV4A 3RHGA 4EMIA 1UD6A 5CSYA 1J6OA 3BLOA 2WPBA 4RKAA 4GHRA 3B4UA 1HJUA 1B54A 4LWWA 3AOFA 4N4PA 1GTEA 3U57A 1GERA 3DIPA 3ARVA 3VIMA 5IFTA 1C8YA 1WKFA 3C56A 2PLKA 4JTKA 1OINA 2ALRA 3W71A 1XI3A 1FQ0A 2WJFA 1UKOA 1JF6A 4DF2A 5C6MA 1YXDA 4OJYA 1M03A 4P7RA 3BLIA 3UT0A 2WHJA 1XSKA 3VIKA 3NVWB 2W54A 3TWBA 2A1YA 3IIVA 3PZVA 3LZ3A 2OB3A 1ISYA 4EACA 1KCXA 5IM51 3LLDA 2DIJA 1XP3A 1GVSA 5J5DA 1TPDA 4A3UA 2B31A 4F0SA 1F05A 3GK0A 2QAPA 4Q8MA 3V36A 4DJEA 3K4AA 3GDMA 2E8YA 3NPWA 2XWEA 3H23A 4PSPA 4DVOA 2OEKA 4KCVA 1AVAA 1N63C 1MVYA 1DP0A 4EM4A 3HGSA 4GRTA 2E28A 1RCQA 4DBWA 3O0KA 2V3BA 3MMDA 5XINA 5ABEA 1BVWA 3TVAA 4Q3MA 1JF5A 3FS2A 3QGVA 2NQHA 2ZRZA 5DCBA 3CV1A 3TE9A 2PE4A 3HQOA 3EZ4A 1X39A 3M64A 4LBRA 3SZ8A 3VM7A 3FYYA 4KCTA 2YCLA 2ZZ4A 1OWQA 4B3LA 3WLOA 4XAPA 3WJWA 4GIRA 3VMNA 3LY0A 3P62A 4LBUA 3BLEA 5G2HA 2E3ZA 4FEZA 3VNJA 4Q6JA 1VCFA 2PDGA 4LBSA 3QYSA 5CSSA 5JIWA 1KBBA 3S9IA 4MAVA 3GS6A 3N9SA 5BZAA 3SSJA 1Z32X 2A6NA 2R1LA 3AISA 1UR3M 4WUIA 3VX1A 3W7CA 3P3BA 4DXVA 3ATZA 1CXKA 2WZMA 2EKGA 1I1WA 3IEBA 1W56A 4K8GA 1TWWA 4NJGA 3CYJA 4F2TA 2X0SA 3VKKA 2J9YA 2D22A 4JN7A 5JXQA 2BGSA 2HNHA 4WVXA 4M0XA 3LCXA 1EPXA 2G96A 3I6TA 1E0UA 4QDWA 4UFKA 2J7CA 1KFKA 1GRHA 1PTAA 1R85A 1TTQA 1BTMA 2X0HA 1UC5A 4J57A 3K2GA 4RPQA 2J9ZA 3QM3A 3TLLA 3L23A 4CQ9A 2Z1SA 3NUKA 3Q2DA 4LF1A 1Y5WA 4RZ6A 4X9YA 4UTJA 1A5UA 3WLHA 2O0TA 4XO7A 5J8LA 4JDRA 1FWBC 1NJJA 4WQ6A 4TU1A 5ABFB 2C16A 2FTWA 4DLFA 3K30A 2HK0A 5KVIA 5KTLA 3TC6A 1XM3A 1DIOA 1DTUA 3AMCA 1KGWA 1IT7A 1VPYA 3UW6A 4MJ2A 2VC9A 3LA4A 3IRDA 3CMJA 1KRAC 3HZ3A 4P7LA 2YW3A 5BMWA 4ZE5A 4GNKB 3WSUA 4GYPA 4GQ0A 3LHZA 1OCNA 3V1PA 2A0NA 2JIEA 3HF3A 3VD4A 1GSNA 3HIJA 4EXQA 3A7UA 3ITLA 3AYVA 3OC4A 4X3ZA 4L6OA 3ZR6A 2X2GA 3V16A 2WKLA 1LUCB 2ZDRA 2WVVB 3N2MA 3IC9A 3C86A 4H01A 3WQGA 2CLPA 1C92A 4NL1A 4MADA 4TV5A 1NARA 2R1PA 3FA5A 5FF3A 5KSWA 1MEIA 2W9MA 1LG1A 1KKOA 3IGHX 4OKDA 3LPPA 3P81A 4AVFA 4KCWA 1GVOA 3UXIA 2DZSA 1DQWA 2J7EA 3F4CA 2ODOA 3EDKA 3HPFA 4HIBA 2DIKA 2ZXBA 1OJTA 1LJYA 4AWUA 1RVKA 1P0NA 1WDRA 1XIFA 3SN4A 2V0TA 1BVNP 1GUVA 3QR1A 1K7FA 2G3JA 4I9JA 3UWUA 1PIGA 1E43A 3BPWA 1G01A 2WNQA 1KKRA 3TXZA 4MWAB 3QTPA 3W00A 4IT1A 3MT1A 4PCPA 1J0IA 2QVHA 3PF3A 5A6JA 1NDZA 4UNKA 1K4HA 2WZEA 4Q8OA 1CEOA 2BC0A 1QHZA 5DQPA 3L0GA 3OQEA 1C3FA 2A3LA 3OGVA 1DJIA 3WUFA 2AL2B 5C2XA 3V0UA 4NSBA 2DT2A 2TYSA 3CEUA 2GRTA 1QI0A 3RNMA 3AN1A 5AVNA 5TD4A 1JRCA 4UCGA 3CUFA 3TW6A 1SFSA 4DZ5A 3WNKA 3CQJA 1F07A 1O60A 2F2KA 3G1SA 3KAOA 9RUBA 2ZUWA 1DWGM 4HK7A 4JX4A 5T8GA 1GVRA 4PMYA 4MG4A 4MKNA 3BW4A 3TSBA 2RH9A 2X99A 1F3WA 2QCDB 4QITA 2BGQA 1XISA 4JTTA 4FI4A 1KWGA 4G2DA 4AB4A 1DWJM 5B7ZA 1HQTA 3W01A 1JQVA 3YPIA 3OIXA 4AISA 1GVEA 3L65A 4Z2GA 3TNOA 4PUWA 3AYSA 3LBMA 3LYEA 4US5A 3E0VA 1S1PA 3GW0A 3DH7A 1UYQA 3M5VA 4MYXA 4TIMA 1V03A 2VR4A 4HCDA 3A13A 3BV7A 2VQTA 3T2QA 1G6CA 3MDUA 4ATLA 1XH2A 4RJEA 1M04A 3NL3A 1BWLA 3CPRA 4DO5A 4Q8NA 3HQNA 4H4ZA 4PUMA 2Q8LA 3NZ1A 2PDNA 1OD8A 5D2XA 2XPKA 1Q6GA 2QPXA 4H7CA 2Z2UA 1FWRA 3SDOA 4OTKA 4TVYA 4QQ3A 2Z24A 1XHCA 1EC7A 3W29A 3VE7A 1D8WA 2VI0A 4J3ZA 5I3IA 1VB9A 4Y90A 1OFBA 1TELA 1KWKA 2D23A 3KW3A 1KN0A 3QW3A 4QAIA 4LGXA 2YCEA 5E1QA 1VIZA 1G69A 3HO8A 3QOKA 3M1ZA 4I3GA 3ZT7A 2W3RA 4PL2A 1GVFA 1FHVA 1Z8AA 3HRDC 1JFXA 4AY1A 1G9HA 4JTLA 2XYLA 3HU7A 1OYAA 1XF0A 3FSTA 3PPCA 3R79A 2HTMA 4H8NA 4CCZA 1MFVA 3QY8A 3QN3A 4B5TA 3RFAA 1K6AA 3TSMA 1VF8A 1B1YA 1V0KA 2YVJA 3TTEA 5ER0A 1TVLA 3FJ6A 3ZVHB 4IIEA 4I8DA 4HZMA 3ARWA 1SU5A 4H9YA 2BVDA 5HR7A 3W82A 3ABSA 2Z1XA 1SZEA 4JHMA 1AZ1A 3HG4A 1B3WA 2Z6IA 3H2MA 3JZEA 2GR1A 1OHLA 4QJ4B 2EKCA 5E70A 1CXHA 1FXQA 2EAWA 5HQEA 1ZJAA 2V5KA 4XAGA 1CGUA 3TK7A 2DZTA 4L9ZA 4Q4QA 3AHZA 2CBUA 4PBGA 1VBGA 4LUTB 3POCA 1Q7MA 2W62A 3P5YA 3UXKA 3QH2A 3LM7A 4IJBA 2V81A 2INFA 1GYLA 4MFDA 5FSDC 3CM4A 4GQGA 1JZ5A 1UA3A 3ERPA 4D1IA 4PEKA 3OA3A 4Z08A 3R0UA 1YPFA 3INPA 4HMNA 1R3SA 4JTGA 1N60C 3E1F1 1KM2A 4Q7NA 2ZZ0A 4JQ1A 3LCIA 3W7DA 5BWAA 5IFPA 3CZLA 3WDPP 3CO8A 1H0GA 5LGZA 1NWTA 3ZXWA 4XSMA 3WQDA 2ABAA 2V82A 4RE3A 1OGGA 3WQCA 1ZAHA 4O16A 3NCOA 2GVJA 7CGTA 4FDCB 4O14A 4U3CA 1ZP4A 3VNZA 3L9CA 3GHTA 2J24A 4AD2A 4E2BA 3C0QA 2R6OA 4DPPA 3B97A 4WRHA 3LUTA 3PFMA 2QUMA 3CYVA 3IUDA 1R2SA 2NT0A 2D2OA 4JR5A 3WENA 1V3LA 3NFUA 1ZSXA 6XIMA 1TV2A 2FVMA 1VIWA 3QOMA 5G5GB 4FNQA 1E6RA 3KP0A 1GOQA 4M19A 3BO9A 4FIRA 2ZWYA 4NZJA 3W23A 3UEQA 4EPBC 4AD0A 3STPA 1PE1A 3GXDA 4BEUA 4JIRA 4XTIA 2VZOA 4CVUA 1GG1A 3REQA 1LRTA 3WX7A 4DY1A 3C5QA 3VD7A 5C0QA 4GJJA 3RM8A 3PNUA 1K9EA 4KEUA 4HPXA 5CPOA 3TKFA 3WUGA 1M7XA 1QRQA 5TR3A 1IZCA 2ZBTA 1XIDA 4G56A 4PMXA 2CHRA 2E6AA 2ZOXA 1PVNA 4MJZA 3UJEA 3EDFA 1UP2A 1V08A 3WEZA 2YSWA 1VP5A 4I7VA 1EB3A 3WF0A 4FR1A 1JGIA 1RAKA 1OZMA 4DZAA 1DXLA 2GVYA 5LIWX 4G7FA 1J79A 3CEPA 4CNTA 3NQ8A 2ATMA 1XYMA 4NG3A 3W38A 3CZJA 1EC9A 2WMIB 1CIUA 3QKEA 2A8XA 3FIGA 1YE4A 4KIRA 1J5TA 1KNWA 4BS0A 1XIGA 3UVIA 2CBVA 3TEVA 5DFAA 5I03A 3AWOA 3PK7A 3PP7A 3TX9A 1FKWA 4M82A 1DWHM 3QPZA 1IEWA 2GQ9A 4A3YA 4P61A 2QF7A 3G3MA 2A79A 5F4XA 2CKRA 4HHLA 1DJQA 3WD2A 1TX0A 4FP1A 3NXLA 2GQWA 2ZX7A 4O57A 3DYPA 1X8FA 2FZNA 3BGJA 2UV8G 3BG9A 4GA8A 3NQCA 4LIIA 1ECQA 5CPNA 4FF7A 2FZ9A 3L4XA 1O5RA 5LZLA 1P5BA 2Y7EA 4L7ZA 3SIMA 1ZZMA 1H2IA 1W9PA 3MUAA 5A6LA 4LC8A 2UWFA 1S2WA 2REQA 4W7WA 2WPFA 5DMLA 3VKAA 4HPHA 1I4NA 3O6CA 5CZJA 5EBAA 4UB9A 3COTA 1WDPA 1FXPA 3OP2A 3CAVA 4CCDA 2RDXA 3MHGA 2HXTA 3H4KA 4C6FA 2NT1A 4AWTA 1IQ8A 3W07A 3PWAA 2YFOA 2E9LA 3M44A 3ITXA 2QCCA 1OF8A 3VVGA 4I6VA 3EOSA 4UFJA 2EQ8A 3CLMA 1UWUA 3E38A 4PB5A 2X41A 3NEHA 2C71A 2ZZ2A 3PJWA 3V1HA 4MHBA 1VH7A 4EQXA 5A1AA 4E38A 1QI3A 3Q58A 2CKSA 3EXTA 3PBYA 4N9BA 3SIZA 1XDMA 2YLLA 4QGCA 5A69A 2JGYA 1U5HA 4HNVA 4B9ZA 3O06A 5BOEA 1RPXA 5KZDA 1GRBA 3IAQA 4U4MA 1FFVC 5CGMA 3QFEA 4FXJA 2O9TA 4YTSA 1DJXA 1XLGA 3SRDA 3WH7A 4RUBA 1OCQA 3STFA 2X7VA 4E5TA 1E6NA 5CZ0A 4LB4A 3FKKA 6REQA 2J47A 3U4AA 1UJQA 1XIBA 5LSMA 3LSBA 1IIHA 2KZHA 2P0OA 4MNKA 1J2WA 1LRQA 4H6KA 4JTQA 5H2ZA 3BXWA 2Z1WA 3GH7A 5FS9A 1IXOA 4MYAA 2J7DA 3MI3A 3CB3A 3RMJA 3FAWA 1C7SA 4H9XA 2G97A 4MPKA 3W84A 1LZOA 1UKQA 4H4PA 1IYXA 4DO6A 5D9NA 1SO4A 5D37A 2J74A 3ES8A 3SO7A 5DANA 3KCOA 2GVLA 1VEOA 1D7KA 4HNTA 4LT9A 4UUIA 2RHGA 1H1YA 3R07C 4GD0A 1XD0A 2D2GA 4G1NA 3RJXA 3NGFA 4HP5A 3GM8A 1P1XA 1OF6A 3TA6A 3NPXA 3N13A 3TROA 1Z69A 1JUKA 1GJWA 3VFLA 2CHNA 1BG9A 3HJEA 1GEHA 3NZRA 1QR7A 3N9KA 3IGSA 3OZPA 3CS2A 4W89A 1ZRQA 3EKGA 1PIIA 3U48A 2GJPA 3W74A 3AYTA 3CIXA 1IT0A 3ZJ7A 2QDGA 5K9XA 2QJMA 1SM9A 3M0YA 3W1XA 1UUMA 1Y5VA 4JDBA 3TP4A 3LV6A 3T40A 4QIUA 4EKJA 1B3VA 4D6GA 3BQ5A 2V3AA 2A6LA 1Q13A 1HKWA 4OBTA 4L4LA 2O7SA 4A3QA 4H41A 1LOSA 2G8ZA 3EWDA 5HA7A 3FY1A 1VFOA 4UQAA 2CW6A 1GHRA 3WCZA 4A29A 1UWRA 3TYUA 1W1TA 1WV2A 3A3XA 2SFPA 2VFFA 1VAHA 3WO8A 4BWLC 3L0NA 1ZJHA 2VGFA 2X16A 3EF6A 3GFZA 1LL7A 3W88A 4B5SA 2H6RA 2WKJA 4WJEA 4LUIA 3A4XA 1A47A 1N5XA 2I1OA 3A3HA 4MZ1A 3DGBA 1Q2RA 3LHWA 4WOQA 4LEQA 1AW5A 3UCCA 4DUOA 1BQGA 3ZLHA 4IGNA 3RLHA 4LU0A 3TA9A 3ANYA 1ZUAX 3DGHA 2CBIA 2Q02A 4IP4A 2V63A 3WLIA 1EGZA 2IUZA 1TIMA 4FR6A 4JKLA 4AIUA 3C0SA 4PCNA 3H2FA 3O2LA 3UG4A 3ORWA 2E09A 5DT7A 1CT5A 3NOYA 2Z00A 4M7SA 3W7EA 2OQHA 4E4UA 1VJSA 1JCYA 7TIMA 4XB3A 3N34A 4Y2WA 3O6DA 5K9DA 3GTFA 4UFMA 1BTCA 1V6XA 4ZGYA 3UBPC 4YCOA 3GDKA 3VA8A 1ONRA 4PUUA 2NLIA 4UQCA 1OY0A 3LRMA 2X1SA 4GRSA 1BYCA 1JROA 4FNSA 1VENA 3XINA 1PHQA 4PTNA 1UH3A 4ZSTA 5K9CA 4ZOAA 4YWIA 3SY1A 1GRFA 1L6GA 2VEMA 3LXCA 3B8TA 5DXXA 1HUVA 3WMCA 3S2JA 2E1WA 1TMHA 1POKA 3NOEA 5F2GA 2CDUA 1I2RA 3SCOA 2R1KA 2BNJA 1W9VA 1GETA 1KQYA 2GH5A 1J0YA 2E8ZA 4IPIA 1NQKA 4ZOEA 4NNAA 1H7WA 1T99A 3HPSA 1BRLB 1E15A 3P7YA 3SRKA 1I1XA 3WQWA 2PB1A 3T8LA 4C60A 3RO8A 1V77A 1EJRC 3TQ0A 2R8WA 4QBXA 2QS8A 1NDYA 3HV9A 2IW0A 5CPLA 4IFKA 5FIPA 3ITCA 1RM6B 1KXTA 1SSDA 4JTIA 2DVUA 4D6CA 3WJZA 3WZ0E 2F5ZA 1JCXA 3A4AA 3VMPA 3IRSA 4PRRA 4XBSA 3NTYA 1ZENA 1LG2A 2CIPA 3KCJA 3UERA 3B0XA 3P80A 4FOJA 1TJ2A 4F2BA 4LW7A 4D6FA 4LAUA 1XPGA 1CLVA 2P10A 3DK9A 3H2AA 2IKJA 3VOGA 2XDFA 4IJRA 2NWRA 3W1MA 4KRTA 3AO0A 1H0IA 1KQZA 1ONFA 3LXAA 1KTCA 3UR5A 2WZHA 3WBXA 3ZO9A 1WO2A 2GUUA 1QT1A 2FPYA 2J62A 4B5WA 1QVBA 1OC7A 3TC3A 2CPUA 1Q4NX 3LLFA 3LPGA 4JX6A 4BF5A 1TG7A 3DU0A 2XZ7A 1C8VA 1BZLA 3EGJA 4MLRA 2DGAA 1FY6A 4LV9A 2JF6A 3S0CA 2R9RA 1IHIA 3UG5A 2D0GA 4JFWA 1J2BA 2CHOA 3CUHA 4B4HA 5REQB 5HXMA 2A85A 3MO7A 2WCSA 1A49A 1V6WA 1ZBVA 3THDA 1OCJA 1XLCA 4G8TA 5CPMA 5D9MA 3S9ZA 3PZOA 4XWUA 3LOTA 4EAYA 2AAQA 1B4KA 5EFFA 3UQNA 1JUBA 5BMXA 3PVFA 1BLIA 1UD5A 3G0XA 3FCPA 3CWOX 3MKVA 4DM2A 1KRMA 5HINA 3W6YA 3VZYA 3CV7A 5HUPA 3UR2A 1QJWA 3KEHA 1R6WA 1EXPA 3SUWA 3W26A 3W7MA 1KGUA 1WXJA 5M17A 2BXVA 2BXZA 1LDCA 2DT1A 9XIMA 1DQUA 3BSHA 3L4WA 1YMYA 5IBXA 5LHFA 2VURA 2QUVA 2XINA 4ZMGA 4H6RA 1XXXA 4LAZA 3XISA 1J0KA 2PP0A 4PH6A 1HVQA 4D8AA 1ODZA 4O28A 5LA2A 2OGYA 1W2VA 2PDFA 2YX0A 4P7NA 1LM1A 1JCTA 4WD0A 3V4BA 4FA3A 1Q6OA 1XINA 4PYSA 4UZSA 2PFHA 1ALDA 1SO3A 3L5OA 2ZA1A 4X60A 4F8XA 1SJAA 4MKVA 4R34A 1NOUA 1NPXA 2XHYA 1OIMA 3RK8A 3WKZA 1YEYA 1E56A 4AZHA 4H4WA 2J7HA 2WC7A 3T7VA 1JCNA 4NAEA 3VC6A 4J56A 4I9AA 4U5KA 5L9FA 5AFDA 3I4KA 2AL2A 3HFYA 3W2MA 5KZMA 1S38A 4XO6A 1G4SA 3HV8A 3AC0A 3OHIA 4ZQOA 4C7DA 2FJUB 3SECA 5DMYA 4L56A 4ZQMA 4JTAA 1K1DA 4FZIA 3LCFA 3BH4A 2FDSA 3FXYA 3N18A 4NHVA 4NRSA 1SJDA 4PTWA 1BFNA 2JKEA 5G4EA 4QXIA 1VFLA 3PFRA 2FHFA 3RLVA 2B0MA 1B30A 3IARA 3RN6A 3H2OA 4ZZ9A 3HPZA 1QNQA 5FS8A 3STEA 2X1IA 1JD7A 2PLJA 3PNZA 5A6BD 2IXVA 4NI8A 3CK5A 3LI0A 4MFEA 4HZ7A 2JIWA 2OLAA 3BGAA 4W7UA 2FLIA 4DN1A 2VDIA 3CZEA 2AQWA 3I6EA 2XIIA 4W9TA 2P50A 2PWUA 1Z3NA 2GGIA 2PRHA 5CC7A 4AUBA 1LQ2A 2VELA 1L9WA 1BF6A 3C0JA 4GXWA 1TWIA 3G1FA 1N61C 1S5MA 3MJMA 1TPWA 1IV8A 3T08A 2V69A 3KM8A 4TX6A 4IM4A 2QJGA 1KBKA 1ODUA 3WH9A 4QISA 3VXGA 5GNYA 5IBXC 1FA2A 4O12A 4S3AA 4BQ3A 2ADAA 2WBKA 3BW2A 1ZAIA 2QT3A 7TAAA 2NZLA 1TTJA 3N2XA 3SRFA 2WZIA 4L65A 3T42A 4GIAA 4ADSA 4MWAC 3QVQA 3A3WA 1RQHA 2GOUA 3AIQA 3W76A 5FCZA 2Z1BA 1O5QA 3UZWA 2JEPA 3H6OA 2DZAA 2BDQA 4X22A 1ZGDA 1A3HA 3M7SA 1UHVA 2TPRA 4QNWA 2W91A 4IMGA 3GG1A 1TWZA 4D9PA 1EDGA 4ATWA 1UMYA 1Y65A 2OG9A 4PRTA 1TPFA 1HKIA 1ZHAA 2GVGA 4DJFD 2J7FA 3G8EA 1A0CA 1XV8A 4K39A 4GR1A 1SO5A 1V97A 1A4MA 3TR2A 1LWIA 1HJWA 3NM1A 1GQNA 1JDDA 1XIIA 4KS0A 4Z0SA 3AQUA 4GH3A 2WP6A 2Y6ZA 4KETA 4LUSB 4EM3A 1X7FA 3ZVHA 4INFA 2YL9A 4EQSA 4DWSB 2I56A 3UGVA 2KX9A 3MWAA 2PDQA 2RKXA 2CEQA 2C6QA 4QR6A 3B9DA 2X42A 1RBLA 3QR3A 4DYKA 1WAWA 2FGBA 1D9EA 3FDGA 4LXFA 3SADA 4GVIA 4O10A 1WXYA 4EXAA 2ZZBA 3CPUA 3AUOA 4QE5A 3SUVA 1QK0A 1I6NA 2W3SA 1GOXA 3NVDA 3WJSA 3D46A 3EAUA 3ECQA 3R4IA 4AZCA 5U7SA 4ZQPA 1V59A 5JBEA 1CGWA 1XRTA 3NDZA 4M5PA 4GNJA 4PMQA 2QHAA 3FX4A 4HU0A 5CZSA 2I5QA 2VCAA 4Q4RA 2BHZA 2G95A 1CCWB 2YFNA 5HJXA 5AB3A 1I2OA 3G1RA 1PCWA 4D8LA 5JCKA 3EX1A 2WK2A 1E4LA 5G2IA 2PD9A 2VX7A 4LVDA 2QCLA 1KTBA 1SFLA 1YW1A 3DKLA 1OZQA 5GJNA 4CD6A 3G1HA 2GGGA 3PG9A 4N02A 1UMLA 3LERA 3W53A 1MI3A 1E1FA 4PULA 3ZLFA 3APYA 1HKVA 1M68A 4HJFA 4ZXOA 1WZAA 4YLWA 1FWDC 1OJXA 3K4WA 2EQ6A 3GIPA 4TVWA 3WNLA 2XISA 1Q4WA 3CQKA 3DHFA 3LRLA 3M4HA 4RNJA 1OT1A 2X30A 1EWDA 4GVGA 4L1XA 5HK4A 4UQ9A 4O0KA 3WF4A 3OLDA 1RD5A 4LQ1A 4GMEA 3W85A 5EB8A 8CGTA 1OYCA 4DUVA 2NVAA 2A7NA 1NAL1 3WH8A 5FEZA 4HN8A 1XYAA 1XGEA 4DJFA 1G4TA 4AVOA 5KMYA 3A7RA 1BXCA 1G1YA 1EL3A 1F8MA 3SCVA 4E0CA 3AHTA 3MJYA 5BRQA 3F4DA 2AL1A 4OFCA 2WHLA 4NVTA 1Y5XA 3NO5A 1ZMCA 3AIUA 4FX8A 2XH7A 2J6VA 1PPIA 2NV2A 2ZCGA 4PUJA 4PE8A 4DBUA 4ASTA 2VWTA 1JZ6A 3G6LA 3O07A 4UQEA 3AIVA 3RO6A 5AHLA 1MO0A 4N6EA 4NX0A 1GKRA 4XVEA 2Z7KA 2YDRA 1FWEC 2X2YA 1FCQA 1AG1O 1AMYA 2OWXA 4J28A 1UASA 4MUZA 3AIEA 2PGWA 1F8WA 4REQA 1MW3A 3BJSA 1BGGA 3AAMA 1H1NA 3P14A 2EEXA 2ZZ6A 4MDPA 4W5UA 2GZXA 3ARPA 1XWYA 4NYUA 9CGTA 3M0ZA 3QSTA 3VC5A 2PURA 5KZ6A 4LCQA 1NEYA 4IX2A 2GLKA 4UTFA 4KFPA 3FGCB 5K2ZA 4LYRA 3DECA 4GFIA 3S6DA 1XLJA 4DJDC 2ZTJA 3VKCA 3RLGA 1XDIA 4TTGA 1XCXA 1HFBA 1SR0A 3E5PA 1J0HA 1FP8A 1C93A 5G1TA 2QGHA 1E72M 1VJZA 2OOGA 3C3UA 1V6TA 4OE7A 4QFUA 2V2CA 3FDKA 4W4QA 1LOLA 2I14A 4N2YA 2GDUA 1AFSA 2QPSA 2WLYA 4O1CA 6PTDA 1KB3A 2OKOA 2VC7A 5IHSA 1NDAA 1CGXA 1ZP3A 3WQPA 4OZOA 3W6MA 1DHPA 1KXVA 3UPMA 2Y89A 3BOXA 4QTGA 1ZY8A 3H7RA 1SR9A 3P74A 4RV3A 4R7WA 4JPGA 5C9UA 4ZTXA 5GVJA 3IUIA 3NQGA 2XN2A 1IGSA 1Q6EA 1R3RA 4BF9A 2RJHA 5EA9A 4WXZA 3M07A 2D0HA 4NZ3A 4S3KA 2ZUUA 4XV0A 4YWOA 2Y4SA 3AZRA 2CERA 3P93A 1FHLA 2RGMA 3P0WA 4JS3A 4DO4A 3G2GA 2QCMA 3POHA 5IRPA 3S6TA 4ZL1A 2XIJA 1AJZA 5MKGB 1EX1A 5EKYA 4PCFA 5AYBA 4OBSA 4FK9A 4JQ3A 1JDFA 2W67A 5L6UA 4HU3A 3U5YA 2WMHA 3E3HA 1U1HA 2JALA 3GUGA 2CYGA 3NAVA 4NYYA 3TDFA 4GUIA 2EBNA 3L5AA 3QKZA 3IK2A 4Q7IA 1WKEA 3RRXA 1YRRA 4C90A 3E5BA 3D5HA 1DJGA 4MDOA 3MUIA 1XC6A 3UR7A 3LBCA 2BC1A 4XKYA 3SRHA 3UJ2A 5JBDA 4XKMA 4A8NA 4UTUA 1PHWA 2AKZA 2EF9A 1J12A 3T2PA 1AJ0A 4YJ5A 3HMJG 3M0XA 1Z48A 3OLIA 3KX6A 1YIXA 3MWCA 1RY0A 1HL2A 2AQVA 2ZICA 1RY8A 3M0LA 2PDXA 4GUHA 5KEZA 3KLJA 5A2BA 4Z1CA 3GHRA 3RAOA 4C1NA 1FWHC 1SW0A 4TVCA 2XGIA 3PZIA 1MXGA 3RRAA 1XYBA 3AUJA 1VQTA 3LM3A 1XDJA 4TX8A 4WCJA 1VEMA 4XVDA 4UTWC 4GCXA 5KZEA 4WGHA 3WBWA 3SCPA 3MVIA 3DHDA 3EX6A 2WHMA 2BASA 3H8AA 1AMKA 1XH1A 1M7PA 3QV9A 4ZO8A 3LX9A 4YWSA 3R8RA 4XZ9A 5GNXA 5AHEA 1FTXA 3IJ6A 3MC5A 1ICQA 1MNSA 4QROA 5A8MA 1J11A 2DUZA 4UTKA 3LHVA 3PPFA 2VEKA 2QUNA 1B5TA 5I3KA 4PMZA 1DJWA 3PZQA 4A3RA 3KVLA 1CYGA 2HPIA 1LOQA 3EOEA 5I78A 4JCMA 1K02A 1X38A 5DCDA 2RABA 4L61A 3NQEA 1BF2A 3DFPA 1T8QA 2GOKA 2PTDA 5U4NA 2NXGA 2QJIA 2PU0A 2XM1A 1X8CA 1Q6FA 3M0JA 7A3HA 1Y0EA 1GRTA 1XSIA 2CWNA 4JOMA 4EOUA 4E8GA 4KWOA 1EUAA 2GJLA 2WSYA 4C6CA 3W27A 2YCLB 1FDYA 2QCFA 3WF2A 1WKDA 4CNPA 1OFOA 4QX4A 1E9LA 3V5FA 3ZWTA 3VINA 3GY1A 1UQZA 3UY7A 3HGOA 4WKAA 2QULA 3PZNA 2I17A 4M80A 3PSVA 3PUGA 2H3DA 4GG9A 1M01A 4C7GA 1WE5A 3GH5A 3MMTA 1MW2A 4IQDA 4ZXLA 2VX6A 3KL0A 1FO4A 3H4XA 4M7TA 3NPVA 3N3MA 4ENLA 1PZ2A 3FV9A 1NP2A 3H21A 3U0HA 3GKAA 4K7YA 4OOZA 3VOJA 1CBGA 4PTMA 1E70M 3CT2A 1H3GA 3GDLA 2VOTA 4JFUA 3WNPA 2GK1A 1LYXA 2X40A 1RJRA 4F48A 3W02A 5F7UA 2AAMA 1XRFA 3GG8A 4LA1A 4L5ZA 2CESA 2VFDA 1RLDA 5FJPA 5BU6A 1AOGA 4YVXA 3N4FA 1LCOA 2PBGA 1JDAA 1AK5A 1W1VA 3URNA 1J96A 3OZOA 4GJ1A 1XYLA 2FTYA 2GJXB 4CU8A 1XSJA 4MVAA 1M6JA 4Z2JA 3FW6A 1DNCA 4BQ2A 1X2HA 1WB0A 2ALDA 1ONEA 3TFCA 5BRPA 4UR8A 1GRGA 1UKPA 3OLGA 2ICSA 1N62C 3EKZA 1HKKA 1KM6A 4IFOA 3CUGA 3EKLA 4ROQA 1IEQA 5C9ZA 3VO0A 2ISVA 2Z1VA 1FH9A 2V3FA 3OGRA 2HJPA 1Q6DA 2AMXA 3DG7A 1SUXA 1L6YA 4RDYA 4ACYA 5G4WA 1I60A 2X1RA 5M3WA 4KT2A 3VGFA 1Q7ZA 2VNCA 2YBUA 5C9RA 4H6QA 4M51A 3MI6A 4NY2A 3WLKX 4ACZA 3JRKA 4JIIX 2Z28A 1XJBA 3GU2A 1B3XA 2G3IA 2VZUA 3W7LA 4E2DA 4U2ZA 1TWSA 4GI9A 2R1MA 2V6OA 3SM0A 4GVHA 4MLJA 1JZ4A 3F7JA 2YXOA 3VIGA 1F61A 1KR1A 1SJBA 3MQTA 1A5KC 4CGTA 3A9BA 2F9RA 1FWJC 4X9SA 4M29A 4AEFA 1W32A 1XW8A 3GC2A 1YDVA 5ABGA 3R25A 4W93A 3B8DA 1XFCA 1XLLA 3DX5A 2ZRUA 2A5HA 4W8BA 2PS2A 4WY0A 1XIMA 2VVNA 3UF9A 1V3MA 3IVUA 3D9XA 3VZXA 4UNLA 1QDSA 4ATDA 5JH2A 3N3TA 1DJZA 1JULA 2ATSA 5HJLA 5U25A 1MUMA 2C0HA 4XBJA 5D8ZA 3PULA 2PWEA 5DN1A 3JR2A 3PJTA 5DBUA 5AZ1A 4JIQA 2O7QA 3ISIX 1XBVA 5E09A 4IX0A 1JFHA 3CAKA 1MNZA 3S1XA 2Z26A 3K13A 1HF6A 3CU2A 1S39A 3KXQA 2QLYA 2BHUA 2GSEA 3V35A 1A0EA 1K3UA 3LRKA 5LA1A 2E77A 3GWQA 1ZCCA 4LEFA 2NV1A 3OYZA 3V5CA 5E0KA 2XN0A 1UD2A 1SZRA 1Q6LA 3QMSA 4O4WA 3AHVA 4MM1A 4BQ4A 2ZADA 1S5TA 1T5AA 2UY4A 1PB0A 3NQ7A 4JHOA 2C1GA 2WMGA 4OV9A 1HGWA 3R2GA 3DC0A 2G5WA 1WOAA 3KOXA 2QIWA 3T0TA 4NU7A 4DNMA 3WDIA 4PGLA 4GX9A 1BXBA 3RCNA 2W3ZA 3GVQA 3BURA 5XIMA 1KM0A 5GQBA 1BSIA 4HZ6A 3DGZA 3OPSA 1JNDA 5T91A 2C3DA 1DOSA 4S3GA 1EIBA 5CQ1A 3HGRA 2XSAA 3E2QA 3PY2A 2A4AA 3ZMRA 3IVTA 4CD8A 4W84A 4RNFA 1NELA 5DMMA 3PZTA 3QEZA 1PV8A 4DELA 2BZNA 1XKYA 5HPOA 2PODA 4O8RA 1W54A 1SPQA 3SCNA 4PMJA 1K4GA 2OYLA 2TMDA 1BQCA 4M3PA 4QJ5B 3NNTA 3LTYA 5AVHA 4HHPA 4O50A 1US0A 3IGUA 1LWHA 3OEXA 1GW1A 3BCFA 4D6DA 9XIAA 1ZBKA 2NQZA 2WHKA 1FFRA 3GDTA 1SGJA 1PDZA 1HTIA 4I90A 3GHUA 1DJNA 3MBDA 4PZVA 1H41A 3PM6A 2O4QA 2JEQA 2HISA 3WBAA 1B9BA 1AQFA 4F2UA 2XGBA 2PWDA 4CVWA 3U7BA 3IV8A 2ZRWA 3KLKA 4YYCA 4XSLA 1LVLA 2PWFA 3APGA 3ONCA 4W86A 2PEVA 1L2UA 1NSJA 3GR8A 5HMFA 4RW5A 4UQBA 1XBXA 2GGEA 2C3CA 1NP0A 5M5DA 2ZVIA 4ZO9A 1GQJA 1I45A 3RG6A 4ZO7A 2A3AA 1JI2A 4LAMA 1Z9AA 3IIOA 1VDVA 3MBFA 3W37A 1PTDA 4CEXC 4N0RA 3AU2A 1TPB1 4PB4A 4PN2A 2QW5A 1W2PA 2HBVA 4M6VA 5FF0A 4KIEA 1AH4A 1JG9A 4DF0A 1B90A 3L4UA 4J40A 3A5VA 2CLLA 3HG3A 3LCLA 4UR7A 4DAFA 4NJIA 1ZLPA 3O6AA 2FQIA 2YOCA 3A47A 5HATA 1SW3A 1P0KA 4AU0A 3NR0A 1EBGA 5C70A 4PEEA 1P0DA 4LVFA 2WSQA 1MQPA 4TVDA 3IJ9A 2YGYA 1YKWA 2CZ5A 3TW9A 2FYMA 4K68A 4K1WA 1IWBA 2QNEA 3S1UA 1DTNA 4JAWA 4DWSA 1GKPA 3EMCA 1T8XA 2OWWA 4F40A 2CITA 2FIQA 2WMFA 3W2LA 5SWUA 2GWNA 4RDZA 3W86A 2QGYA 1SYTA 5J5RA 5HDRA 1RK5A 2R94A 4BFAA 1XFBA 5DT5A 3GR7A 3UESA 2J27A 2QIIA 5HWNA 4P8XA 2WV8A 2IPFA 1M1BA 3VNIA 1HW6A 4WKHA 2QV5A 2OSYA 2ON3A 3LHYA 5BU9A 7REQA 3DZ1A 4A05A 4WDUA 1E4MM 4TOQA 4KERA 2BV9A 3T0AA 1VPQA 2F84A 1JNEA 3BAYA 4N7QA 4M81A 5D03A 4IXXA 2OQLA 2XU2A 2E67A 3M0KA 1IR2A 2EG6A 3LQLA 4FNUA 1ZB5A 3TOPA 3S4TA 5JCNA 3M47A 4CCEA 1FH8A 5PTDA 1PWLA 5LKYA 1Q8AA 5AHMA 3GZAA 1QPOA 3N6HA 1OX6A 5DCEA 1WDQA 2ZZ1A 4LUYA 3SJNA 2WB5A 2FVKA 2I7GA 1UB3A 5DO8A 5G2WA 2WQPA 1GZGA 3HPXA 4DJDD 1TQJA 1G4EA 3H7UA 3M0VA 3R94A 4BK9A 3QPEA 3R43A 3W81A 3R1ZA 3REQB 3DESA 4LJ3A 2D69A 3CHVA 4XAZA 3LLXA 3A24A 2WOVA