3RRAA

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
385
structure length
374
Chain Sequence
b'VKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPNPVWRHADGSVAEWAEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative D-galactonate dehydratase
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
molecule tags Lyase
total genus 108
structure length 374
sequence length 385
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rraA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rraA01
1IYXA 1SJAA 2PTXA 3THUA 2DW7A 3T6CA 3GD6A 5EU9A 3UXKA 5FJPA 4J3ZA 1EBHA 1NELA 3FYYA 2QDDA 4MGGA 2ONEA 3MY9A 2FYMA 2ZADA 3MQTA 3OW1A 2QJJA 4YWSA 3V3WA 4A35A 1P43A 3ZVHA 3DG3A 2FKPA 3S5SA 4H1ZA 2XSXA 3FCPA 3IJLA 3OZMA 3Q45A 3FVDA 4GFIA 3RO6A 3FJ4A 4J1OA 4A3RA 2GGHA 3UGVA 3MZNA 3R11A 3R0UA 2GGEA 1NU5A 1XPYA 3GO2A 3RRAA 3EKGA 2PP3A 1R6WA 3S47A 3PWGA 3RR1A 3MSYA 3MUCA 1OEPA 2PMQA 3CAWA 3DGBA 1MNSA 2OLAA 3R25A 3CXOA 4HCLA 3IJIA 3SBFA 5IDZA 3SJNA 3ENLA 3NXLA 3ZVIA 2OZ8A 1R0MA 3VA8A 2PCEA 5J04A 3TJIA 3HPFA 4E4FA 4DN1A 1BQGA 3NO1A 1KKRA 2PP0A 3KUMA 2QQ6A 2OZTA 3K1GA 3QLDA 2P3ZA 1BKHA 2QVHA 3TW9A 6ENLA 3GY1A 2ZC8A 1E9IA 3SQSA 3RITA 4E6MA 4GYPC 3ZVHB 4IT1A 2QDEA 3SN4A 1WUEA 4E5TA 3Q4DA 2GGJA 1MDRA 4ROPA 2OFJA 3CT2A 3I6TA 3EEZA 4GYPA 1XS2A 1ONEA 3IK4A 3VFCA 4IZGA 1TKKA 1TE6A 3I4KA 4MMWA 5FJTA 3T8QA 3U4FA 3VC6A 3H7VA 1KD0A 3OTRA 3VCCA 2XH4A 3N4EA 3DDMA 3DG6A 4H2HA 2PGWA 3TWAA 4GMEA 2POZA 4EWJA 3OPSA 5BOEA 3CK5A 3H70A 3TCSA 3SN1A 3PWIA 3P3BA 5ENLA 3UJSA 4HCDA 1MDLA 3UJRA 2XH7A 3TTEA 4IP4A 4IL2A 3UJ2A 2MUCA 4HCHA 1F9CA 3H12A 4JN7A 4GGBA 1SJCA 3N6JA 3IJQA 4ENLA 2OVLA 2P0IA 2XH2A 2NQLA 3V5FA 4H19A 2AL2A 3OP2A 3N6HA 2PTWA 5FJUA 3TOYA 4GIRA 3UJEA 4HNLA 3DESA 3BJSA 4IL0A 3STPA 3RCYA 4E4UA 3UXLA 3P0WA 3ZLFA 4ZA0A 3QTPA 3PK7A 3U9IA 2PODA 3I6EA 3DFYA 3CYJA 3T9PA 4DYEA 2OQYA 3GC2A 4MKSA 3NFUA 2RDXA 1KKOA 3V4BA 3R10A 1JCTA 1RVKA 2PTYA 2HNEA 3PFRA 3FV9A 4Z17A 2AL1A 4JHMA 4IHCA 4E8GA 3VCNA 4JN8A 2PP1A 3V5CA 2QJNA 3SSZA 2XH0A 1EC8A 3TQPA 2GL5A 3H8AA 1ECQA 3P93A 3CB3A 3NZGA 2P88A 3UCCA 4DWDA 3ZLGA 2PS2A 3T4WA 3UCDA 2OQHA 3BOXA 2HXUA 3D46A 4X2PA 4F4RA 1KCZA 2OX4A 4DX3A 2GGGA 4Z1YA 4M6UA 4DXKA 1FHVA 2PPGA 1PDYA 2GDQA 1WUFA 1JPDX 2OPJA 3QN3A 3DIPA 4A6GA 4HN8A 3ZLHA 2MNRA 4FI4A 5BOFA 2OKTA 1TZZA 2AL2B 3OZYA 4HNCA 2O56A 2CHRA 2PTZA 3MKCA 4G7FA 2I5QA 4GISA 3ES7A 4KPLA 4KEMA 3ES8A 4FP1A 1EC9A 4IP5A 2OO6A 2OZ3A 3JZUA 4M0XA 5FJOA 1MUCA 3N4FA 4ZCWA 4G8TA 1PDZA 3VDGA 4HYRA 1JDFA 3DERA 1YEYA 3JVAA 2PGEA 4HPNA 2P8CA 4H83A 3B97A 3VC5A 2HZGA 2PU1A 2XGZA 3QKEA 2P8BA 1L8PA 1MRAA 4K2SA 4K8GA 3DFHA 3R1ZA 3DG7A 4KWSA 3R0KA 2AKMA 2PA6A 3JW7A 5FJRA 3SN0A 3DEQA 1EC7A 2GSHA 2GGIA 3D47A 4DHGA 1EBGA 4KT2A 4GGHA 3FXGA 1P48A 2HXTA 1DTNA 3TJ4A 1SJBA 3TWBA 3RGTA 1SJDA 2PU0A 1JPMA 4K1WA 3QPEA 1FHUA 2DW6A 2QJMA 7ENLA 3BSMA 3MWCA 3UJFA 2QGYA 1ELSA 1W6TA 2AKZA 2PSNA 2OG9A
chains in the Genus database with same CATH superfamily
3AJXA 1MVYA 2VDIA 2BP1A 4WOZA 3T6CA 2X8CA 1O66A 3BQ6A 4PUDA 1ITQA 3LYEA 4H3DA 2YVJA 2GQWA 1J0JA 2ZZCA 2XN0A 3PBMA 1B3VA 4BHYA 1EF2A 4H4IA 3KBJA 4DXVA 3EWXA 3WBYA 3WLLA 2E5AA 5EB8A 4WXZA 6TIMA 5T91A 4V27A 2AQOA 1TPVA 2VELA 2RH9A 1V5XA 1UKPA 3GDMA 3QFEA 4PR4A 5CJNA 2YPIA 5AHLA 1LBLA 2WVSA 3OZPA 1QNVA 5I00A 1US3A 2YX0A 5J5RA 4XZNX 4G1KA 1A0DA 4OOUA 3ZR4A 3ZJ6A 3BPWA 2HCVA 3AIQA 3SDOA 2R1KA 3SEPA 1W91A 1WDDA 4IPLA 4PMZA 2QR6A 1GXFA 3CUXA 4HA3A 3CEPA 1JQXA 3B8IA 3GIQA 3SADA 3W2NA 3SJNA 3UPWA 4N9BA 1Q6EA 3S6OA 3PVFA 1GETA 1TV3A 4QJ4B 4HU8A 4J56A 2CLLA 3NQBA 1JVNA 1BQGA 1RHCA 4MTVA 1YNPA 3A64A 1KKRA 2J7HA 2OZTA 1R9YA 4YLWA 1ZTVA 2QDHA 3GFXA 4CGTA 2JQXA 3CQIA 4HK6A 3THAA 3CGBA 1QI0A 4Q4RA 3RITA 4AHOA 3VOCA 2W6RA 4FNUA 3WLPA 4S3JA 4FNTA 3MHFA 2VX7A 4O1BA 1RJRA 3II1A 2WM1A 2PWEA 3M1ZA 3G22A 3QOMA 4IQLA 2L5HA 3H2OA 3IANA 2GDUA 1YX1A 3GRTA 1K6AA 4QBXA 4H04A 2Z2BA 4MZYA 3A3WA 2EPMX 1OHLA 4DY1A 2XSBA 2WHJA 1XYMA 3NM3A 1T8XA 4LBUA 1KTCA 2BXYA 5IBXC 3PANA 2ZRXA 3OTRA 2J74A 1Q6QA 4P61A 3WH6A 4H2HA 1B9BA 3VIHA 1DXIA 4P7LA 2ON3A 3WH8A 1UKSA 2PGWA 2V68A 4AF0B 3GRIA 3T2OA 5C7VA 3H7RA 3N18A 1XLAA 2A4AA 3UJSA 4GNVA 1D7FA 1AQ0A 2VD8A 4DBWA 5C71A 1YBQB 2W62A 2OOFA 3L21A 1ZDLA 3EXTA 4JN7A 2VRJA 7TIMA 3OG3A 5LGZA 1XIHA 3AMKA 1SR9A 1ZENA 3G5EA 5EMKA 1UYQA 4GKLA 3TDFA 4GZJA 3RM8A 5LNSA 1L6YA 3GTHA 2I16A 4RDWA 1WDQA 5HINA 1CGTA 4V1YA 3CH0A 5D33A 3BE7A 2CCRA 5JCIA 2EG8A 3G3DA 4UXDA 3TTQA 1GVEA 1R8LA 2WJEA 3DYMA 4AHPA 1FXPA 4GRTA 3EOOA 3UFYA 4H6QA 3VGGA 2NLIA 3FHAA 2J77A 5AYIA 3EDKA 2VCAA 1D9EA 4U33A 2Q71A 3BG9A 4Z17A 1XCFA 3IPWA 3QW3A 1V02E 1GEQA 3MDUA 1B4EA 1V6UA 1TV5A 1TMLA 1VJIA 1DL3A 4AEOA 3L67A 4ZE5A 3IJ6A 2VTFA 2QDGA 1MWOA 4G7EA 2CETA 4ACZA 3E0IA 3PC0A 1UROA 1V7YA 2WCSA 5D37A 3EDDA 3T4WA 5JCLA 3E0LA 1WDSA 2OQHA 3BOXA 4NAEB 1R7OA 2NQ5A 4WGHA 3GNRA 1NDAA 3CPRA 3AHYA 3GG0A 3SY5A 4LOCA 4UOZA 4DXKA 4WJXA 1FWBC 1GJUA 4NYYA 4ZXOA 1MEWA 4HN8A 4KQNA 3EB3A 4F9JA 3UPBA 2WMHA 4MB1A 1EJUC 1XQLA 3HQ1A 2QAEA 3IJDA 5CJ5A 3CC1A 4M6QA 2WPFA 2O92A 4CD5A 1VQTA 2ZRVA 3I7QA 3AMDA 3B9OA 1DVJA 3WQVA 1BXCA 1F6PA 3RR4A 1TPEA 2OO6A 4DJED 3JZUA 3E74A 3PPCA 3KP1A 4KH2A 4YCPA 1CXIA 4GCAA 2Z6IA 4LB4A 1Z44A 3AISA 3JVAA 3EX4A 2WMFA 4O54A 3G1AA 4PTXA 3BAIA 3ISIX 4DWSB 3I3BA 3BSHA 2IQ0A 3L0GA 3GIYA 5DO8A 3N2OA 3FJ6A 4NJIA 3GNNA 1JQVA 3U4AA 2ALDA 3WQ4A 4PUJA 3A5FA 1WXJA 4ZXLA 5FD0A 2WO5A 3HU7A 2BGSA 2AKMA 5D2TA 4CU7A 3PPHA 4HHMA 3GFZA 4FXSA 2D0GA 1ONFA 1XD0A 1IEWA 3RLUA 4R27A 2BODX 4C1KA 4RZ5A 4M29A 3UWVA 1G9HA 2EF9A 1XLEA 2YOCA 3AXMA 1RP9A 3RJYA 2GZXA 3WF1A 4QLKA 4LUIA 3TJ4A 1SJBA 4UFKA 2CKSA 4AZCB 1CGVA 2HSAA 1CZ1A 4GYKA 1XIFA 2PDYA 3GXTA 4K1WA 1FHUA 3OGRA 1OCBA 2Y5SA 1O94A 1FKWA 2ZUMA 3JU2A 2HS8A 2A0NA 4L56A 1BF6A 3A22A 1WXYA 4MADA 3EXRA 3D6NA 3DFPA 1MEIA 4RJEA 3SFWA 3C2EA 4RNFA 1KLZA 4FOKA 1RQBA 2NZLA 1YW1A 5BWAA 4J3ZA 4H9VA 3SI9A 1JGMA 1OABA 1ZL1A 5FS6A 4WK9A 3W7CA 2G3IA 5BRPA 3WLNA 1EJ7L 1CECA 1ZB5A 1GSNA 1QRQA 1XIBA 3WFAA 2V3FA 3TFXA 1I2RA 1W3LA 1TJ1A 3T0BA 1L9WA 2WP5A 3CAQA 4DPQA 4GFIA 3RO6A 2D3LA 3M0KA 4J1OA 5IOBA 1EP2A 1UD6A 4LY8A 4UTHA 3IAQA 4EM4A 2DUXA 2GGEA 1W3TA 3QY6A 1XIEA 4AC7C 4UTJA 5H6HA 1A53A 1MXDA 2FHFA 3AS3A 1UZHA 1R6WA 4PB3A 3WLSA 3D3AA 4A8IA 3FN9A 1SZGA 3GG8A 3LSCA 4UTMA 3GYCA 3NGFA 3M0MA 2DT1A 2WQDA 3WLOA 2ZXBA 4S3BA 2HBVA 5I78A 4BK9A 5AC6A 3U3HA 5CPOA 1VBHA 1EHAA 3HTWA 5CLTA 1AMYA 4E4FA 5IRPA 2Z2AA 2QUNA 4HOWA 5AYYA 2WHMA 4JDYA 1ZBKA 3KLKA 2J8GA 1VHNA 3NL2A 4D6HA 3WLJA 1A5LC 3GY1A 4XTDA 4G5DA 4O17A 3UXAA 3SQSA 4LWWA 1ZQ5A 4JTAA 3PG6A 1GORA 3MUXA 1HKJA 3KL3A 3G77A 1XH0A 4WSKA 4GRSA 1G01A 3A4JA 4NY2A 1YE6A 3BQ5A 1MDRA 3FKKA 1UBPC 3RFAA 1ITXA 5I3IA 1MOKA 2YA1A 3G1XA 4HNNA 1EX1A 4H9TA 4S39A 1RJPA 4V33A 3JZEA 4JFSA 3LY0A 3POCA 1M6IA 4K7YA 3DDMA 4GIAA 3HPAA 5IBXA 4JQ9A 1G94A 2R1NA 2Y88A 2V5KA 2C91A 3B0YA 3PB0A 3UR2A 3WDIA 1FCBA 2YGYA 3MWAA 5C9UA 1V3JA 2VFDA 4IWWA 1Z6KA 1W3IA 3P3BA 1H7RA 2VEFA 1NF0A 2QIIA 5LIUX 2ISVA 2V3BA 4GUFA 4D6IA 4W85A 2ICSA 2MUCA 2FHCA 4M1BA 1TWWA 1PZ2A 3W2LA 2OVLA 3GS6A 3THDA 1W56A 1A5UA 1HUVA 5KEZA 2V0TA 3IIZA 3V5FA 4WY0A 3H6OA 2ZC1A 1JUBA 4C6EA 4GCXA 1F4AA 1AL8A 4XBSA 3GBEA 1GZJA 5TD4A 2V3DA 3R0DA 3N9RA 4EXAA 3TQ0A 1JDAA 4HYWA 1EL3A 3RCYA 1HW6A 4Y7EA 5MKGB 4PBGA 5JMUA 3CQJA 2ZWZA 2VC7A 3CHDA 1JGIA 2WW5A 4PCNA 1IIGA 1OX4A 2NT1A 3NVWB 3S2JA 3SUWA 1XQKA 3M9YA 2J27A 4LEQA 3EWUA 4CQBA 5LNVA 2QCFA 3S0CA 4RZBA 3M0LA 2VGFA 3A21A 3VD3A 3STEA 1OD0A 2A3LA 2VEKA 4LRSA 7REQA 4XD5A 4NAFA 4L6OA 3LXAA 2ZZ6A 1DORA 3UWYA 1MUWA 3UWEA 2AL1A 1K4HA 3TMLA 3WBAA 1WV2A 3BLDA 1VPQA 1ISZA 1QPKA 3N9SA 3SCTA 3W6LA 3VKKA 4AZIA 2XTKA 1PWMA 3IEBA 2V5CA 2ESCA 1PCKA 3ITLA 1PBGA 1N62C 2OX4A 1RPKA 2VOMA 4S2CA 1RSCA 2XGBA 4M6UA 3ZOAA 3PULA 1CWYA 3H53A 4E3VA 3USBA 1JPDX 2OPJA 1BRLB 2OZ0A 3ZLHA 5FSEC 1TG7A 2BZNA 3BK0A 4J2MA 2AL2B 3L4TA 1KV8A 1QAPA 4RW3A 4ERAA 4UQDA 3H4KA 1CGXA 3VM5A 1EJRC 7TAAA 2HRWA 3WNPA 1XC4A 3QV7A 4UCGA 1LP6A 2X16A 4MWAD 4JQ3A 1K8CA 1DJNA 4FNRA 3SGGA 3LCIA 1XICA 3PTKA 2P1FA 4GO9A 3FLUA 2E9LA 1M7PA 5KINA 5CG7A 5I79A 4E2VA 1WKYA 4TTGA 1PS9A 6ALDA 4DJFD 2OO0A 4MAZA 4LT9A 4HA1A 3NR0A 2PE4A 5CZTA 3VC5A 2GR3A 2DEPA 1V0NA 3S8HA 3QKEA 3HRDC 4FLOA 1H2JA 1LWHA 4I5RA 2X2GA 3ARQA 3LPOA 3S6TA 4JGDA 1JXJA 3LLXA 1V0MA 3BGGA 3L23A 4MY9A 1AD1A 4CQ8A 2GRTA 2DQXA 3ARVA 1YXDA 4HA4A 5H8MA 1PEZA 3KL0A 3D47A 2QUTA 2ZUTA 1LBMA 3UY7A 3FGCB 3SCSA 3T44A 1M01A 2HXTA 4YCOA 5BW6A 1TE1A 3BCJA 2X1IA 4ICNA 2DVUA 2OEKA 4GHRA 2WNZA 4LUYA 2Y7DA 1ZJIA 3ABXA 1UPMB 3NSXA 2J7FA 1KM3A 5FCZA 4JEQA 2E4TA 1TR9A 3GVVA 2NSOA 4MLJA 1A5NC 2W4XA 4DUVA 4OFCA 1OFBA 4AY7A 1V6WA 3WNMA 2PTDA 1R3RA 3B8VA 2NUWA 1XKJA 5I7GA 4A2RA 1RV8A 1POJA 3DFNA 3LDVA 2QJJA 3E12A 4UR9A 1SSGA 4BFAA 3SJ3A 1HJQA 3W37A 1NP0A 5G1YA 2OYKA 3P82A 1NARA 1MXSA 1TJ2A 2O4QA 2XISA 2GUYA 3VUSA 3DGRA 1JF6A 3C2FA 2ISDA 4GZ7A 4WKFA 4XWUA 3R2GA 4TU1A 5I3FA 3L0KA 3L2IA 2P53A 1FWFC 2VC9A 2ISFA 4R34A 1FH9A 2YCLA 2X2YA 4BKNA 5DLCA 1QMLA 1FP9A 3E0WA 3RRXA 3WQWA 1ZK7A 4RDZA 3D0CA 4IGMA 1R38A 4O0ZA 3VD5A 2OLAA 3EEGA 2HK1A 2CXEA 3N3TA 4HSNA 2CERA 3CIWA 1EEPA 1OQFA 1TTPA 2BASA 2Z1VA 3G0XA 1ENUA 2VGIA 3GXIA 1PV8A 4REQA 3UWZA 4BF5A 3IACA 5A8NA 3FDGA 1J11A 2FTYA 1C8XA 4CQDA 2XJ7A 3VIJA 4M19A 2BC0A 1FFQA 4E6MA 2A7PA 4GYPC 3QPZA 2B81A 1TZ9A 2QDEA 3IV8A 1J79A 1WUEA 1M3UA 1JROA 3C2OA 5K4XA 4NI8A 3EEZA 1ONEA 3IK4A 3VFCA 3BH4A 1T8QA 2QS8A 1Q6CA 5JCNA 3NQCA 1W2PA 3QHOA 1TPWA 4XAZA 5JQ9A 3QBUA 4MNMA 2A6NA 2V30A 3VM7A 3TCSA 1B54A 3N11A 4LJ3A 3W73A 1Z41A 4Y9NA 2YYUA 1DJGA 2CLMA 1YKWA 1E6NA 4HTBA 3G6LA 4HMNA 1X8FA 3IGHX 1XSIA 1M65A 1PAMA 3S1WA 3AICA 3STGA 4US5D 1F61A 5G2HA 3W7HA 4FAMA 1D8WA 5LA2A 4JDRA 2VUYA 1EQCA 4H4WA 1Q6GA 3H2AA 4FO4A 2DIJA 1I2OA 3VDBA 3AIWA 4Q8WA 4J35A 1JJKA 3NPVA 3MI6A 4NVTA 4UTIA 5AHFA 4NJKA 5FL0A 1RLDA 4C6PA 1OFAA 1EPVA 1Q4NX 3IIOA 2WC3A 1H5VA 4WEVX 4J7RA 7PTDA 2HROA 1NJJA 3GU2A 1KFBA 5EL1A 1PTAA 2OB3A 1PX4A 3ONBA 5BNKA 1FVPA 4AMAA 1UH3A 4DWSC 4B91A 2VO5A 4DBDA 4ICMA 3GC5A 3UERA 4FALA 3B8UA 3VNIA 3VIFA 1DWIM 2FMNA 3LEPA 4EAYA 4BQ4A 5HWJA 1TJRA 3MBDA 3LBOA 5H8PA 1UW9A 4ZTXA 1EC8A 3TNOA 5CSUA 4NSBA 1WDWA 3EZ4A 3W7KA 1JR1A 3RHGA 4ZO8A 5HDRA 1NSJA 2PS2A 2J6VA 4Z1DA 3KW3A 4X2PA 4XSMA 4PH6A 3PBGA 3F5KA 1TSIA 1ONWA 4DF0A 4TO8A 2ZFAA 5GJPA 2VYOA 3IVUA 1RQEA 2NXIA 2V82A 1W1PA 1RJQA 1WUFA 3L2MA 1XH1A 4NIRA 1AL7A 2I9UA 2WCGA 3LNMA 1MNZA 1HX0A 3BAXA 2VZSA 3H2MA 3OZYA 3SY1A 4EWND 2R1LA 4H01A 1AOGA 4GWEA 2BOGX 3K13A 5HAOA 1ME8A 4LPCA 2ZXQA 3PG8A 1VDVA 2V5LA 2PC8A 2DZVA 5LXEA 2V6AA 4WOQA 1X7IA 3NDYA 3VKDA 2Q3OA 3TYUA 3UESA 2FGBA 3KLJA 3YPIA 3HGOA 1OGBA 1TJPA 1BYCA 3VKAA 4G8TA 3OVRA 2FGZA 5AC5A 5KVIA 3VDGA 1HKIA 3PNUA 3H22A 4HPNA 4L1XA 2J88A 3SQLA 2FIQA 1KBJA 3E5BA 1SZNA 5XIMA 4EF9A 2HZGA 2WXDM 4NJGA 2QZRA 2G96A 1E51A 3V0TA 3W7OA 4UQ9A 4YTSA 1BSIA 2AAMA 2J4GA 2DZBA 1LL6A 5AKQA 1B57A 4NZCA 3WD0A 3TFCA 2ZZ0A 6REQB 1W8GA 1JDCA 1VPYA 2WZTA 3UD6A 4XBKA 1P4CA 1J96A 3HV8A 3RCMA 1DOSA 1QXLA 1TMQA 1AW2A 3H21A 4I6VA 2QJMA 7ENLA 3MDWA 4MOZA 4TTUA 4PN2A 4ML9A 2RDUA 2BY1A 2CHOA 2C1IA 3WFLA 3SO7A 4MKNA 5I77A 2ZUWA 3H55A 4H4PA 3UR8A 4L6HA 9XIMA 2OG9A 2ZRUA 1NHPA 4PTVA 2XIBA 4Q6XA 2GQ9A 1K8ZA 4LS0A 4K39A 5BRBA 1CXLA 2JK6A 1E0WA 2AQWA 4BF9A 3TV8A 3OVGA 1G4EA 1RUSA 1SM9A 4O53A 3MQTA 4PE8A 4DJDD 2DIEA 3AS1A 2FVKA 1OFPA 3S5SA 3E5PA 3GLCA 4R3UA 3CL6A 2YYTA 3QSRA 2PRLA 3ABOA 4UTLA 4GR1A 3WEOA 3ARTA 3AU2A 1NHRA 5D9OA 1EDTA 1RBOB 2NX1A 1RBAA 2PDNA 2HK0A 5IXEA 5CGTA 4BV6A 3RN6A 5AYZA 4XAPA 4CNSA 1BWKA 3BXWA 4W7UA 4KCUA 1I1XA 2E0PA 3H4GA 3GHUA 2VCCA 3MTWA 3MSRA 4YWIA 2VZTA 1NEYA 2FPTA 4C6JA 3MMDA 3E6EA 1IE7C 4JIEA 3S46A 1OCQA 3PWGA 4BZYA 3BUVA 4FXRA 4AF0A 1ICPA 3GAYA 3T42A 3CL8A 3CHEA 4ZOAA 3NUKA 4DNMA 4E38A 1VC4A 1H0GA 1XISA 3SR6B 3SBFA 1HP4A 1TWZA 3B05A 1IEQA 1YBQA 4S3KA 5DXYA 1ZKQA 3NS1B 2WZMA 3VDHA 2XFWA 4IFOA 1UD4A 2HVNA 4ZGYA 5HK4A 5D2VA 1HJXA 3RX3A 3HPFA 1BWCA 1WPCA 1GVOA 1DIOA 5F4SA 2GYIA 3SFKA 3KUMA 4FLQA 1DXLA 4JQ1A 5JH1A 1X96A 5EGRA 2YL5A 4W87A 4DO7A 3FKRA 4OV9A 2ZC8A 4K7ZA 2OSWA 3I65A 1X2HA 1WX0A 3A3XA 2ZZBA 4EVZA 4CCCA 1CLXA 4HYVA 1ME7A 1EA0A 3VZYA 5A1AA 1H60A 1HT6A 3JUGA 4ROPA 3EPOA 1WXZA 4NU7A 4GYPA 1EH9A 3NOEA 1RY0A 1E15A 4O50A 1HNYA 1SFSA 1BKSA 1E6XM 1SO5A 5T8GA 1JRBA 3TTSA 2OCZA 2BSLA 4KRTA 1N7KA 3QM3A 3G1DA 4H4ZA 3I7SA 4PCTA 4F0RA 3C6CA 2WKJA 4ATDA 1TTQA 1N63C 1NVMA 2C1GA 4YPJA 1VRDA 3DX5A 3EMZA 4B16A 4WQ6A 4FNSA 3M44A 4QIUA 2Y7EA 1MDLA 4NAEA 2XH7A 3P5YA 2D73A 3FDKA 3W1AA 4IL2A 3CWHA 1MXGA 1W1IE 3H12A 2PLKA 2ODOA 3N6JA 5DBTA 3VKBA 3BDKA 3WUEA 2YL8A 2XH2A 2NQLA 4KETA 1UH4A 1MW1A 1VFOA 1P0DA 4FDCB 3QFWA 4Q8UA 4CNTA 2WWDA 5LNRA 3MV11 4L6DA 5LZLA 2NVDA 4O1DA 2X99A 3PPFA 1J0HA 1P0EA 1Y8BA 1O5XA 2WOQA 3MMWA 2FTPA 3P0WA 4GACA 3XISA 3M5YA 2PCQA 3M16A 4QG8A 3SRHA 2AAQA 4AD1A 4AZGA 3RF9A 2G3MA 3KDOA 4Q8OA 4D1IA 4K1GA 1QW7A 1E71M 3JRKA 5ABGA 4C6CA 3MO4A 4FF7A 1C3FA 4RNJA 3V4BA 4W7VA 3NQDA 2PTYA 3KRSA 4DWSA 4EQSA 1MFUA 4K3ZA 4WXYA 3VCNA 3DGHA 1TPC1 3BJFA 4ZZ9A 3CUZA 1TRDA 2E6AA 1FWJC 1EGZA 1XM3A 4M6PA 4YVPA 2YVGA 3A13A 4FZIA 1D7YA 1NHSA 1FCUA 3GIPA 4F4RA 3ZMRA 4YL2A 4PMDA 5M3WA 4D6GA 1QOXA 3W27A 4Z1YA 4AEFA 1H09A 3N2TA 2HDJA 1JCYA 1XYBA 4AZCA 2ZE0A 3JS3A 3WQPA 1H4PA 2IQDA 4EP8C 1TVPA 3WDRA 3CHFA 1UKOA 3HPSA 4CNNA 2OKTA 4I7VA 1LLWA 2RJGA 2O56A 3NSMA 3VGDA 3WZ0E 1ZCOA 2Z6JA 3TXVA 4UB9A 4B3LA 4NQ1A 3G0SA 5I3HA 2Y70A 4GY0A 3CQKA 3IIXA 3W7QA 1WCGA 4GISA 1PIFA 3ES8A 2VEMA 3RM4A 4WDXA 2PDGA 1DWAM 1MZRA 3ABSA 5C9RA 1EC9A 2ASHA 2XN1A 2OLHA 2WC4A 4B5WA 5TAOA 4QITA 4L1WA 1X8CA 1E73M 3T2PA 3AMLA 3N4FA 1M7JA 3VNZA 3L0NA 4Q8QA 3DHFA 4UFIA 3KBSA 3DERA 2W27A 2PGEA 5TQLA 2IXVA 5I09A 1LWIA 4L9YA 2OKOA 1WAWA 3AXHA 4PULA 4DELA 4Q8TA 3BCDA 1R46A 4NP7A 2V67A 1UD3A 1VHCA 1U1JA 4EXBA 1JUKA 1K4QA 1XIDA 3DFHA 3TYBA 3BMXA 3LCHA 3R1ZA 1C9WA 1XLJA 3NQMA 1E6RA 3ZXWA 2QLYA 3N2XA 2BLEA 3UY8A 3GNXA 1L6GA 1VFLA 5FJRA 1K9TA 2CZFA 3O6AA 4HP5A 5I3JA 2GSHA 2HV5A 3NL5A 1SZRA 3Q6JA 2BC1A 1DQWA 3WK2A 1A5KC 4URIA 4NF7A 5TIMA 3G2GA 2GSEA 2XVGA 3HF3A 1RQHA 3DXIA 1F8IA 4CD7A 1SJDA 4E3TA 4HHHA 1JG9A 4AD4A 3MCOA 3TLQA 3QPEA 3W7IA 1JUEA 2QCLA 2PBOA 1B31A 1RAKA 2FMOA 3W71A 5G4WA 1XSKA 3LG3A 3MHGA 1W9PA 1E4MM 4IIDA 1MO0A 3GG1A 2P3EA 5K9XA 1Q6RA 1PWLA 3P8IA 3WL0A 4PTNA 4I8YA 2DJXA 1QATA 1H7WA 1SW0A 1KM1A 2TYSA 4D72A 4ZOBA 3R5EA 1YHTA 3U7BA 5CSYA 3GBDA 1EGMA 4B5NA 1P0KA 4FOUA 1F3PA 2XHYA 4DNHA 2AAAA 3MJYA 3WMSA 4LF2A 3CT7A 3IJ7A 1HKVA 1GHSA 2ATSA 1D8CA 2IPGA 4LS1A 2VM8A 4IGSA 2YR1A 2H90A 3URAA 3UG3A 3CZEA 5AC8A 3W7JA 3B9EA 1VAHA 1EQPA 3UGVA 4PMNA 4UTTC 2B31A 6CGTA 3W87A 1JXKA 3R0UA 2DH3A 3RYSA 1Y5VA 2BVWA 1LL4A 4GNJA 4OBRA 3W85A 2PLCA 4L4PA 3GR7A 3S2NA 1GV4A 3I3EA 3KBNA 2YA2A 2B7QA 2FVLA 4IXXA 1YADA 2GVJA 2NUXA 2CZDA 3C8NA 3GNPA 4FNPA 3QFBA 5H2ZA 3KP0A 4ERGA 3ZT5A 1RZMA 1EXPA 5DXXA 4CD6A 5IDZA 3EXSA 4B92A 3S1VA 2XVNA 2NWRA 4O8RA 3CMGA 3CUJA 1GQJA 4YTQA 3TJIA 1VFMA 3LGEA 2E3TA 2Z1XA 4H7CA 1S2TA 2PURA 1VCVA 4R33A 1V7AA 2CZEA 5FL1A 4FR6A 2ZYFA 2ZTKA 1OFQA 3CZLA 1BKHA 3A24A 3NL6A 3HFTA 2WZIA 2JIWA 3TYCA 3LCWA 4RNHA 3STFA 3H2CA 4DF1A 3RMJA 2INZA 4FNQA 4AYSA 5MKGA 2QMKA 3G1YA 2J7DA 1J0IA 2X0HA 3U2OA 1BSLA 3WELA 4S3CA 1XS2A 4HTYA 2WP6A 3GZ3A 2GK1B 1OG0A 3I4KA 5CGMA 1XD1A 3M64A 1A0CA 4M80A 3LHVA 2NUYA 3OBKA 4LS2A 1WAUA 1UR9A 3N4EA 4HPJA 5H91A 3OA3A 5FS8A 4K37A 4E4PA 1POKA 5I03A 1ZSXA 2E6FA 1UIOA 1N5WC 4APNA 4DLFA 1VFUA 5CPLA 1E5NA 5I3GA 2GUBA 1B90A 2PC4A 3W38A 2A7RA 4NEVA 4WSHA 4W86A 4CNPA 3E49A 3HJEA 4JKLA 5GVJA 4GIEA 3TTEA 1WBJA 1H51A 4H4XA 2EKCA 3ZJ7A 2IS7A 2FFCA 3W07A 4UUIA 4PCSA 1S2UA 1H5YA 1PYFA 1OT2A 1Q13A 3TLLA 3TSMA 3RXZA 3UYIA 5LIWX 5EMUA 1BRLA 3OBEA 1S39A 2BY3A 3GU1A 3CUFA 1G4SA 3FAWA 2BX7A 1T7LA 2AL2A 4RCXA 3BG5A 1GOXA 3LV5A 2INFA 1F74A 2Z1KA 3NQ6A 3CZGA 3DK8A 2EPKX 5FA5A 2WCAA 4ACYA 4FK9A 1JI1A 2XINA 4F2UA 3O8AA 5A2AA 3SUVA 2E6DA 4ACZB 4DQWA 2DQWA 2H9AA 1UR2A 5DMYA 3WUGA 4H8UA 5HMDA 2OQYA 2W5FA 3AU6A 4KPRA 3M0ZA 2PDCA 4P8VA 1N5XA 2PF0A 3QR3A 2EQDA 1EF3A 5GNYA 4N42A 2ABAA 2ZICA 4IHCA 4BS0A 4JN8A 5A8MA 2ZX8A 2AMGA 3SSZA 2ZUNA 2RHGA 2XH0A 1R3SA 2CDUA 1A47A 3W2KA 3H8AA 4MYXA 2X41A 2ZZ5A 1OYBA 2ZUSA 2DSKA 1G4PA 3ECQA 1IZJA 2DIKA 3UCDA 1SFJA 4UQBA 3W86A 3DH7A 4G6CA 3VMNA 4QG9A 1QT1A 2GGGA 3FGCA 3ZJ8A 3NQAA 2PRHA 3N15A 1U5JA 4KIEA 4HHLA 5DELA 2G3FA 2FHBA 4J3SA 4A6GA 1W9XA 3DCPA 3BLOA 3EAUA 1VEOA 1S46A 3NTYA 1GRBA 4ZSTA 1UR1A 2GOUA 3MUY1 4O11A 2PTZA 1CENA 1A5SA 3WBXA 2YCIX 3PZVA 3RNMA 4C6DA 2W61A 3W1UA 4IF2A 1JIBA 2GWGA 4QSHA 3HW2A 2UZ9A 2VX5A 4QG6A 1VR6A 1YRRA 4LNCA 5FJJA 1Y0EA 4UTWC 1LTDA 1MW3A 5CXPA 2PDQA 3ITTA 3ANVA 1BYBA 4PMRA 4B9YA 5CAHA 3HZ3A 4C6MA 2J7EA 2BVDA 4DO6A 1GZ1A 3VU2A 3B97A 4B3ZA 1GZGA 1SU5A 2CLHA 3HPXA 3DHDA 3GC4A 4LC8A 1SR0A 3Q94A 1UP2A 4YTRA 1REQA 1HO4A 4Z2IA 1B9ZA 2CEQA 3KFTA 5I0DA 1SFTA 2INEA 4S3AA 4YNGA 4NXKA 3DEQA 4QJ1A 2XSAA 3ARXA 1UZ1A 2Z29A 4DHGA 1H62A 3B0XA 4JKKA 1YNQA 4DZHA 2BTMA 3C8FA 4UFHA 4K8DA 3W26A 4JR5A 1M9HA 1V8EA 3AS0A 1QNPA 1SPQA 3OQ8A 4ZSUA 1PSCA 4MVAA 3IUDA 1GKQA 3EWCA 3E2VA 2DW6A 3HG3A 3SRKA 4I8DA 3KZPA 2XUCA 2Y7GA 3MKKA 4H9MA 2DZWA 4QNWA 4EACA 3P14A 3GXMA 4QTGA 4J3VA 1GOQA 4D6DA 3BSMA 4DZ5A 4EQXA 2C79A 3PUOA 4WR3A 2D0FA 1LL7A 4IIHA 4NZ1A 1W1VA 2G41A 3BLKA 4LAMA 1CXKA 3MMTA 1FWDC 2DT0A 4C6OA 4HNOA 3NO3A 3THUA 2DW7A 2QPSA 1LDCA 3C2RA 4ECLA 2BV9A 2UY2A 5A8OA 2GLKA 1QW8A 3CEUA 4Q8NA 2BHZA 2ALRA 5AYBA 3RU6A 4M82A 3EYPA 5DMLA 2FPVA 5FEXA 3DC8A 4QJ5B 4NZFA 5GQBA 2QIWA 1PKLA 3CB8A 5HMFA 4OBTA 3WF0A 3LHYA 1OT1A 3ABRA 2QV5A 4UMAA 4J3TA 3OZMA 1KR0A 3PSWA 3KEHA 4C6BA 2Y0FA 1Y65A 4N2YA 4R88A 1PZ1A 1HJUA 4UIOA 4HNVA 3MBFA 3AQUA 7CGTA 2VXNA 4PMQA 3THQA 5DBUA 3VE7A 5M2FX 1FDJA 5A6BA 3CASA 4LFYA 4PL2A 4UTTA 2F6KA 4ZEPA 2E8YA 3TZFA 2FFIA 1US0A 5DCEA 2YVFA 1OGGA 7A3HA 3CAWA 4H4TA 1UUMA 1V0KA 1DPMA 4HSOA 4W8LA 4N9CA 3MUAA 3M0YA 4H4YA 2EG7A 1UUQA 2DZAA 4HK7A 2R1MA 3LADA 3GB6A 2NXGA 4EQRA 3GXFA 3W76A 4B2DA 4O52A 1KM2A 4O12A 1XINA 1C8QA 3SECA 5E0CA 1DIEA 5KITA 1J5TA 1V97A 4JX5A 3E2QA 6ENLA 1OGSA 1E1CA 3T0TA 5EY5A 2A85A 1ZFJA 4LUTB 2QT3A 2W79A 2DUZA 1XXXA 4PA8A 4U5IA 4UQAA 1RCXB 4RDVA 1EXBA 4GBUA 3MP5A 4GI6A 1M7XA 4DAIA 4LIIA 3H23A 3I6TA 4TVDA 1F5ZA 1ZJAA 1A5OC 1HGWA 1S1RA 1WA3A 1LRTA 4O16A 3AI0A 3OGSA 2WWCA 1MO9A 3V7PA 3KLLA 2WJZA 3GE7A 2J24A 1KD0A 4KWUA 1W9VA 1J2BA 4Q8PA 1TZ7A 1VYSX 3FK4A 1P6CA 5GPRA 4CU6A 1WZAA 3O0FA 1XDLA 3VZXA 1G7VA 2WHLA 5JXQA 3CK5A 4KCVA 1BAGA 1ZBVA 2C1HA 4XSLA 3T4CA 4C7GA 1RP8A 2VCBA 3W01A 1BPLB 1W1TA 4KEZA 1BF2A 2O0TA 3C52A 4MJZA 4F9DA 4FLRA 1WKEA 3S3GA 1ZS2A 4FSAA 4ZQMA 3PBYA 3W82A 3BARA 4GGBA 4BQ5A 3R12A 3A7RA 3SCOA 3UNTA 3SCPA 3W7NA 3MP3A 2FB2A 3N19B 4PC8A 3LQLA 1ZZMA 3OP2A 4L64A 2PLJA 1KFCA 1J2WA 4ZBCA 4IP7A 1E72M 1V6XA 4NAFB 3M0HA 1UD5A 4JIIX 1UA3A 4HMEA 3MS8A 1EFZA 2CHNA 2Y4SA 3ZO9A 3DESA 3WBWA 3AYTA 3OBAA 5BYWA 5CEWA 3T2QA 5I07A 4XO6A 4IJCA 3CJPA 2GVYA 3T9PA 4JTTA 3KXQA 4X2RA 1PB0A 1KKOA 1XPGA 1T41A 3V0UA 1ZY9A 3LUTA 2DV0A 3WQFA 1NQ6A 2CZVA 1UWUA 1ICSA 1XHGA 1J9YA 2X42A 2GH5A 4IUOA 2RDTA 4YWOA 2J25A 4RV8A 2GQ3A 4L7ZA 1AH3A 1VB9A 3KE0A 3CB3A 1TJ0A 2B0MA 1AA1B 4UR8A 3GW0A 1GOIA 1DJWA 3CUIA 4B5SA 2Z4GA 3OA5A 3QN3A 1K02A 4X9YA 2GVGA 4GKTA 1TUFA 1M41A 2ZRWA 3AXXA 1GK8A 5EMYA 1UR8A 4RE4A 1W1ZA 3UG5A 1P7TB 2BDQA 3P62A 1E6SM 1M04A 3EX3A 1BWVA 4GUJA 3VXGA 3NPUA 3VIKA 2ZX6A 2HVOA 2UY3A 1R3VA 3M0IA 1XBZA 1ZXIC 4GABA 3AHVA 5FJIA 4TR9A 1EOMA 2JF6A 4TIMA 2YZRA 5FJOA 3G6MA 3MHUA 2D2JA 4LYQA 2QUUA 1ZHAA 3L4VA 3LENA 5BMXA 1OZQA 4FR1A 1NTHA 3LTPA 4UTWA 2REQB 3GKAA 3BL3A 3A3HA 2ZDRA 3KOZA 3TTYA 1Q7ZA 4PL1A 4B4FA 4F3HA 4JTLA 2Z1SA 3PF3A 5EFDA 2DJLA 3HQOA 4WKAA 3AROA 3L7RA 2XGZA 1J0KA 4J57A 1NWRA 4Q7NA 4BR1A 1V51A 1FHLA 4JTHA 1EWDA 1F8MA 3NQGA 3T81A 4ATWA 1JZ7A 1U5HA 4JNZA 2V3GA 2WNWA 1W31A 4EMJA 2G95A 4JD4A 2Z27A 2OXNA 1TQXA 3BLPX 4ICCX 3C0LA 3VGBA 5F1UA 1GYNA 3IWPA 4AX6A 3HIJA 1S2CA 3B40A 4RDYA 3VPLA 2YKKA 2E25A 4J40A 5AZ0A 4JFVA 1JCMP 3S83A 3WD1A 4X9SA 4JTQA 1OVDA 4O57A 2W92A 3NSNA 3HFYA 1H1NA 4Z42C 1XANA 1TREA 1AUSL 4H6EA 5HNUA 3TA9A 3EWZA 3W1PA 3WD4A 1KW1A 5FJPA 5AN7A 2A6LA 1QNSA 1NM9A 4GI9A 7XIMA 1IGWA 5LA0A 1OBAA 2YCLB 4J3UA 4IIBA 2YCEA 1J4EA 3OW1A 4B5TA 1Q2SA 5BXPA 5LIYX 1JEHA 1XRFA 3QY8A 3GQYA 2G4JA 3TR2A 2JALA 5HR6A 2Z25A 3DG3A 1QWGA 4GI4A 3N17A 1IEXA 4H1ZA 1YPFA 3FCPA 5REQB 3OVPA 1YMYA 1BVZA 3BURA 3QMTA 1HIZA 4R53A 2OR2A 3AIBA 3NVVB 2X05A 1W2VA 2BHYA 3ERPA 1RXOB 2D23A 4AY1A 2E9BA 2ZA3A 3MW7A 5DF0A 3KVJA 3LBMA 1NU5A 4AEEA 3QFAA 3KOYA 4MY8A 3HOJA 5D03A 5DCDA 4IPPA 4QDWA 1MRQA 3WN6A 3OEXA 1XLDA 1UASA 1LQ0A 2Y61A 1Q6LA 1VENA 3LPFA 4ATLA 2C13A 2E7FA 4JNMA 2WVVA 1J0YA 4JFTA 4WD0A 3W72A 1MFVA 4N4QA 1S5NA 2Y2WA 4Q4KA 1I1WA 1VBJA 3NXLA 4HGXA 1XJBA 4QXIA 3S1UA 5A6MA 1THFD 4OTKA 2DSVA 2CBVA 4D8ZA 4DM2A 3EWDA 3TIMA 2QQ6A 2QNEA 2E6YA 2XG9A 3WEZA 2P3ZA 1MI3A 1ONRA 4FMVA 4XZMX 5HUOA 1XI3A 2WSKA 3N6QA 4LAZA 2Q8LA 2BB0A 4Y90A 4ZOHB 3S5ZA 5CH9A 3GHTA 3CL7A 3HG4A 3QPYA 3ZVHB 3N9KA 1UJQA 2GGJA 2YDQA 4Q4OA 4LB3A 2FJKA 3H2EA 1BEUA 3WL1A 3O15A 1F07A 4EXQA 5CAKA 3ANYA 4D6EA 1SO3A 4EPEC 3WLQA 4JYEA 1I0DA 1HG3A 1XFBA 3QV6A 4JDBA 2D20A 1IIHA 5LGXA 2I5GA 3W4RA 3W7PA 1KBLA 4POCA 5CPNA 4J3XA 3H2NA 4R9XA 1VFTA 3W22A 1RA0A 4EPBC 3SUUA 1TO3A 3RNDA 2CBIA 4V2XA 3VOFA 5ENLA 2ZA1A 3BV7A 4YTUA 3ZR5A 4F0LA 3LN3A 3UJRA 3WMBA 1QVBA 1RY8A 5JU6A 3BMVA 4UNIA 1JI2A 3SGZA 1CI1A 3O1NA 4H8NA 2OSXA 3TX9A 4PCPA 3HV9A 1GPFA 3TYEA 1PTDA 1OWQA 4INFA 1LVLA 3UWQA 5FF3A 3RPMA 3EWWA 3AOFA 3N6HA 5BCAA 1O68A 2WYSA 3SCNA 1HL2A 4ZO6A 2GJNA 2C3ZA 1H50A 1WZLA 4BEQA 1RK6A 5LXXA 3MCMA 4HQVA 1YDNA 1E0TA 5CZKA 1ZUAX 4LANA 3APTA 1ME9A 3UXLA 3GR8A 3LMZA 4A3UA 3AWOA 3PK7A 1YIXA 3DHPA 3GH5A 4AIBA 4JCMA 3OYZA 3LX9A 1FEBA 3DFYA 3UR5A 2JGYA 5K2ZA 1C7TA 3Q37A 2G3JA 1EBDA 1FP8A 1S5MA 4C6KA 1VLWA 1UQYA 4UMBA 2GJXB 1ISYA 2QCCA 2E1DA 3VX1A 4DRSA 5IHRA 1T99A 2ADAA 1OFDA 2ZX7A 1SO6A 1K77A 2DZSA 3WG6A 1A5AA 1OC5A 3WF2A 1QCWA 1NWSA 3U5YA 2YXOA 4S3EA 4EAMA 4AXKA 4JQ4A 4O4VA 2V9DA 1R3QA 2Y1HA 4AHQA 3D46A 2XFYA 4FLSA 1WE5A 3SCWA 3UXIA 1XH2A 3G1SA 3AZSA 4DJEC 4LUSA 2W55A 1BGAA 4GIYA 1V6VA 2WSRA 2EBNA 4XQ6A 3QY7A 2XVPA 3DIPA 2GR1A 5FS9A 4HKPA 2CWNA 1DJQA 1XIIA 2UV8G 3O9NA 4FI4A 3APGA 3KWXA 4DAFA 1JNDA 1TZZA 3ME3A 3W00A 4IGHA 3U2ZA 4WZHA 3MKCA 4Q7BA 2OOGA 3CWNA 3K8MA 4QJ3B 3RX2A 2WSQA 1MQQA 3PJUA 1A50A 1S5WA 1N60C 1W1B1 3B9DA 3CXBA 2HPMA 5EMJA 3ETRB 3BG3A 1ZAJA 5HANA 3HM7A 1U5VA 3C0JA 1B30A 4CQCA 4IOTA 1D3CA 3SZ8A 1T6MA 2X8GA 3TYDA 3PZTA 4IPIA 1E9ZB 4M7TA 5JH2A 3A12A 1VEPA 4C6NA 3W28A 1XRSA 3F2BA 3GUWA 4QLJA 3DG7A 3KOWA 3LU2A 5HNNA 3CV1A 5T9BG 1K4GA 1P1XA 3VX0A 3VDAA 1Q6OA 3IK2A 4H7VA 4N02A 4JIPA 1L8NA 3WJSA 4G56A 3V18A 4AUBA 1CIUA 4Z1AA 1JFHA 5AVNA 3UQNA 4UNKA 2G5WA 3NYDA 3CYVA 4AZHA 1K7FA 3ARPA 2F8QA 1DBTA 3STCA 5KMYA 4AD5A 2ZZ2A 4ASTA 2R1PA 1KV5A 1TPFA 5KZMA 3Q65A 3VGFA 1KM5A 4ZQOA 4C7FA 2ZVRA 2D0HA 1H41A 4JL2A 2TAAA 3BW3A 3WQEA 1QHPA 4US6A 5JBFA 1W6TA 4M6VA 4PRTA 1DHPA 3W1XA 3AM9A 4GFSA 4WUIA 2V38A 1Q66A 1SJAA 1WOAA 2V69A 2PI6A 2VWTA 3VD7A 1OZMA 4YS1A 3VZZA 3B4UA 3AYRA 3FYYA 3PTQA 1C93A 4OGZA 3EMCA 3GH7A 3NYZA 5A2BA 2R14A 1CXEA 1Q6DA 5A6KA 3ARZA 5EPDA 5IM51 4AZBA 4Q4PA 4B3KA 2CLEA 2B7PA 2PWUA 4W9TA 3IJLA 5A6TC 4A2SA 1GEUA 5PTDA 4MPQA 3DECA 2Q02A 4A8LA 4HN4A 1ZP4A 3KHDA 3FJ4A 1ALDA 2GK1A 1A5CA 4FX6M 5HWNA 4U4MA 2IUZA 4ORIA 1CT5A 4HB7A 4Z0SA 4LBRA 3F7JA 1S7MA 2A3HA 1WZMA 3A4AA 1R3TA 5U7SA 2FZ9A 4P8XA 2GJRA 1EZWA 4A4AA 3AIVA 3ZQ9A 1GVFA 1KM6A 3TN4A 3RILA 2PMQA 2C6QA 1HKMA 2Z26A 3N2CA 4DUXA 1KRBC 3WX7A 2VT0A 4TVYA 3A7UA 3RLVA 3ENLA 2Y63A 3S1GA 1TWIA 2D2OA 3QXBA 3IGUA 3P6LA 4JBRA 4CD8A 2YDAA 1ITUA 4JEJA 3DC0A 5LHFA 1LROA 3KDNA 1M5WA 5DCBA 4XZWA 3SGUA 2R9RA 3SUTA 4MJMA 4Y9PA 1F3TA 4ZFCA 3B06A 4XX6A 3TSBA 3HO8A 3F4VA 4C60A 2HBXA 4W4QA 2E68A 5BOOA 3HBLA 3QRHA 4I7WA 1J01A 5G1TA 3VYLA 1DWGM 1EP1A 1MW0A 1OF6A 1G6CA 2XIOA 2XIQA 1B3OA 2KZHA 2OYMA 4LVDA 4TQTA 2QJIA 3GUGA 4QS5A 4JYDA 4B15A 3UPMA 2XFFA 4JOMA 1JD7A 5A95A 2Y8KA 1QW9A 1XC6A 1QPNA 2HEJA 1M7OA 2WHKA 4DBEA 1O95A 1ISXA 4KKXA 1Z7AA 1H61A 4OZOA 4Y6GA 4IJRA 1WZKA 2X8HA 1XYFA 4EPKA 3TWAA 1V08A 4QGCA 2DT3A 5ECUA 1KBBA 3M6YA 3EF6A 1UB3A 4JXCA 2SFPA 4J9JA 1UP0A 3WJYA 2VC6A 1FCVA 3QMRA 4R85A 1A3WA 1E6ZA 1FEAA 4CVWA 1JZ5A 1AJ0A 2FH6A 2GR0A 2GQAA 2WVTA 4GX9A 3WLHA 4HJWA 2WMJA 4Q3MA 2ZX5A 3T78A 4TV6A 4O1FA 3T0AA 1K9FA 1KXVA 2BVTA 4XD3A 1J0ZA 2E5CA 3VNMA 4NJJA 1Z3NA 5E6ZA 1X98A 5T9CE 4V1XA 2O7QA 3TZNA 1YQ2A 4YYCA 4ZTYA 4PUNA 3VKCA 2Y7FA 3ZLFA 3QTPA 4X60A 1JAEA 1VZWA 1E40A 1EP3A 2BY0A 1HQTA 4M51A 3EAOA 1GQIA 1M68A 4H6KA 2UY4A 3OG2A 3WNKA 2WMKA 4I9MA 3H26A 3AYSA 1RBLA 2HNEA 4Q8MA 4F0MA 2PD5A 3TNBA 2BNJA 5CC7A 1E1FA 2PLMA 4MSSA 1DNCA 3W7DA 4U3AA 3W24A 4HPGA 1OK4A 1X38A 3VNDA 2VEGA 2GL5A 1XYLA 5SWUA 3UEQA 4MM1A 2P88A 2X0SA 4RX0A 3LB0A 2HXUA 3P84A 3AXIA 1E56A 3NQFA 4H8HA 1S5VA 3PZ9A 3EBVA 4DX3A 4MWAC 4F2TA 1E5JA 3HGRA 1E3XA 3V1PA 2YBVA 2E09A 3S5YA 5D2XA 1KCLA 1JCLA 3AO0A 5AHIA 5DY2A 1R7AA 4H6RA 4U5KA 2CW6A 4DJEA 4MKVA 5G5IA 4JKMA 3TVAA 2V8ZA 4DJFC 1SZEA 1CXFA 5JBDA 4PB5A 3CUGA 4UTKA 2CHRA 2VR2A 4UTUA 2F84A 4YN5A 1YDYA 1NOWA 3TN3A 1XKYA 1XHCA 2CNCA 5GJNA 1QI3A 5HJXA 4C90A 3QW4B 2J9XA 2P10A 3SRDA 2ACUA 2VUNA 3W02A 1NDWA 1DV7A 4LAKA 1EX5A 3BGJA 2BCPA 1JDFA 3SURA 1XUUA 3WQOA 3QHNA 2QW5A 1SQ7A 1JZ8A 2I5IA 4DYKA 3FFSA 5BXSA 3W84A 2HS6A 3NEVA 3GDKA 5E1QA 4UTFA 4WDUA 1Q63A 1JPHA 5EBAA 3QTGA 3GHRA 3DYPA 1GRFA 2ZZ1A 2WKGA 5CJMA 5F1VA 1IXNA 1R2TA 3PG9A 3T05A 1DQUA 1CNVA 1VP5A 3LHZA 3DZ1A 3FS2A 2H8XA 4Y96A 2ACQA 2GDVA 3UA4A 3VI2A 2YDSA 3U2EA 1H0IA 3L5LA 2ATMA 4TOQA 3SCUA 3KVKA 4KFNA 3W29A 5K4ZA 3LQGA 5CLWA 3LCGA 1XG4A 4OOZA 3NJ3A 4HJFA 3ITOA 3M47A 1AH0A 4NASA 1K9DA 2BBFA 2BFGA 2EXOA 5BU9A 4FHAA 1G69A 2BG5A 4PMOA 3CGEA 5LNWA 1ZMDA 2X30A 2FZ8A 4ADSA 2NWSA 1X2GA 4MNLA 1DJIA 3WDPP 1Y7VA 5CBBA 4JIRA 4LF1A 4S3DA 1WDPA 5MF5A 2PWGA 4G9PA 4JN6A 4CQAA 2DU2A 3L12A 3GDRA 3GTFA 1PE1A 3O2LA 3QMSA 4JTUA 4RPQA 4M3PA 4CLMA 4M81A 2CLKA 1JOAA 5A8QA 4F8XA 3PJTA 4WIWA 2ZRZA 1GEHA 2QCMA 3EDFA 2QDDA 4JTIA 4LUTA 3URBA 1VIWA 2QGHA 3MY9A 3A4XA 4AZ5A 1EIXA 4LGXA 4YWSA 4WGXA 4A35A 4AG0A 5ABTA 2LLEA 3NIYA 2EPHA 1JZ4A 3EDJA 3LRLA 5ABEA 4JX6A 1JCNA 3DJJA 4LRTA 4R5EA 4F0KA 4P5UA 2OQLA 4YTTA 3MZ2A 3QQ1A 4GQQA 2BXVA 3AS2A 1UWTA 3FYOA 4X63A 4JS3A 1J12A 2A8XA 4LALA 4PBEA 1TTJA 4KWOA 2PDKA 4EF8A 4I3GA 3WIJA 1TIWA 3RLGA 4LYRA 3O6YX 1DWHM 4KIRA 1BHGA 1ZGDA 4B5VA 1FFUC 1Q1RA 1KM4A 3MSYA 5D32A 3V75A 1Q4WA 4KCWA 3C4UA 3G1FA 1O5KA 1VD6A 4ROQA 4F79A 3CXOA 4QNEA 1MQPA 2F9RA 3ITYA 1ZX9A 1J93A 2ZZ7A 3ZVIA 2A3EA 3IVSA 1HTIA 4OVXA 5GJMA 4WJ8A 1I75A 3BGAA 5KZDA 4OUIA 4B4HA 3W1LA 1NIUA 1OC6A 4N4PA 2XPKA 4CN6A 2ABBA 2HVMA 4PEKA 5JIPA 3LV6A 4F40A 1A49A 3E0FA 4I9AA 3OHMB 4H2CA 4IX0A 1VS1A 4C6IA 3FA5A 3E1F1 4HBKA 3FSTA 1VJZA 5EMLA 2ACSA 3HG5A 3C61A 3TONA 3NRZB 1NHQA 2D2GA 4UZUA 1F2JA 5D30A 1B2YA 2OWWA 3M46A 4HU3A 1LZOA 3K5XA 9CGTA 4ZO7A 2RJHA 3CT2A 4P8WA 1A80A 1JFXA 3LA4A 3LGDA 1TKKA 2P5NA 4E2OA 4H7ZA 3GDTA 2XWEA 5FJTA 2J78A 1FQ0A 3UNDA 4GY1A 2UWFA 4L9XA 4YJ5A 4XD4A 1E9LA 2EGZA 5BU6A 2ZTJA 2VNCA 5CPSA 3RUBL 1JRCA 2DFAA 1AZ2A 2PDXA 1OFRA 1QWKA 1KRMA 4C6QA 3W3OA 4IFKB 3ONCA 3OPSA 4QS6A 3E2RA 3PWIA 1WP6A 1X6NA 4R7OA 1XBXA 4PZVA 1UHVA 1LUCB 2CPUA 3VMPA 1UJPA 3NOYA 4HCHA 2PZ0A 5AYXA 4WVXA 2E1WA 3IJQA 3KCLA 3L5OA 2H9AB 1BVNP 1FWNA 3NEHA 3W2MA 3BAYA 1RM6B 3TAOA 5E9XA 1P7TA 2WQPA 1XRTA 1GJWA 3C86A 3E9AA 3OGVA 4IUGA 4DEFA 2C14A 1PIIA 5CBIA 3G18A 3HGSA 3CPUA 2WLZA 2VURA 3DFTA 4UQCA 2WB5A 1I2QA 3CTLA 5GRTA 3PAJA 3GW3A 4EQWA 3GVGA 4N6FA 3SIMA 4AU0A 3RM9A 1Q6FA 2NQZA 3I6EA 1IWBA 3VVGA 3EOEA 3GTXA 2ZA2A 2R24A 2CLIA 3PM6A 2RDXA 1NOUA 2REQA 5FF0A 4EKJA 2RABA 3QC3A 2YZ5A 4H4UA 3W1MA 5D9MA 5CZSA 4E8GA 1UKQA 3KBVA 1V4YA 2D1ZA 2ZDSA 3UZXA 3N34A 4AD2A 3AUOA 3N14A 1R86A 3IGSA 3LK6A 2WLYA 3OIXA 3O0HA 2CIPA 3T8LA 3UCCA 1J8VA 4IICA 1AW1A 1BG4A 3SCQA 5CCZA 3CTTA 4W5UA 2V3EA 1H1ZA 3UGRA 3ATYA 4KEUA 1HP5A 2Y85A 3IRDA 3N04A 1JDDA 2VEIA 4NX0A 1CGWA 4EMIA 2C71A 1PDYA 1R30A 1VFHA 4IMFA 4MWAA 1K3UA 1RPXA 2HMCA 3ZWSA 4KESA 4YMZA 5BOFA 5BXTA 4MUPA 2J8TA 4H9ZA 4ZMGA 1QOQA 3QZAA 4KEVA 3B03A 3ARWA 4DJFA 4C1LA 4IG2A 1REQB 4X0VA 2OZ3A 1ISVA 5KZEA 2EAWA 1MW2A 1XLKA 1FX6A 3P2VA 3VABA 3VDCA 4HYRA 4ONVA 1NFPA 2CLPA 5CBJA 1AMKA 4GJJA 4Y8FA 3R8GA 2J75A 5REQA 1VLIA 3FAXA 3BOFA 1ZPTA 1RCOB 1L8PA 3BANA 1U83A 2CITA 1S2WA 3S5NA 1ICQA 2VQTA 1GRHA 1N2VA 1CEOA 3POHA 1B4KA 4DM1A 1GVYA 1W5OA 2VQUA 3BZJA 3H7UA 3UVAA 3UZYA 2C3DA 4S3FA 4ZR8A 3PTDA 3QV9A 4KT2A 1Z89A 1JDEA 1U2YA 3WUFA 3LTSA 2IPWA 2G37A 4H4RA 3B9AA 3GRSA 5C55A 4LVFA 5AB3A 1EO7A 4DJDC 4XKMA 5B80A 4Y9AA 3A9BA 2RGMA 1WYGA 1XGEA 2V81A 1XW8A 2QGYA 4E8DA 4H00A 3LTYA 1U22A 4OBSA 4XZBA 3W7LA 1PZ3A 1NAL1 2EEXA 3DU0A 1ZBWA 3PB2A 1TVLA 2VDGA 1IXQA 1KA9F 1WB0A 5GNXA 1M53A 5EKYA 1TX0A 3UXKA 4WF7A 4CEUC 2RFGA 4O14A 1YTEA 1U33A 1GW9A 3NZPA 3URNA 3WDHA 1EGVA 3PJXA 3WLRA 1P43A 4U3CA 3KRBA 3ZVHA 2FKPA 3W83A 3C0QA 2BY2A 1I8JA 3CM4A 4MB3A 1XGDA 3BW4A 2QULA 4M5PA 4YU1A 4Y2WA 1IF2A 2WMGA 3C0SA 3PBWA 1EUAA 3R11A 5B7YA 3KS6A 1UR0A 2R82A 4B9ZA 3T1GA 3CIVA 2DGAA 3RRAA 2HJPA 3L4XA 3NPXA 1CLVA 1KFJA 3P74A 3WK0A 1DTUA 2J9YA 3NQVA 1GPWA 4O1AA 5CPTA 3TR9A 2WBAA 3NO5A 4RKAA 4D1JA 3ZR6A 1GTHA 1MNSA 2BOFX 3NPWA 4Q4MA 4A3YA 4RK8A 4S38A 4YHGA 2XZ7A 1E1CB 2PWDA 3PUEA 4N0RA 1ML1A 3O6CA 1KQYA 4XZ9A 2GR2A 2EQ7A 2VL4A 3R8RA 2KX9A 3O0KA 4QROA 2XIJA 3QYSA 1E3ZA 4WDTA 4IQJA 2OLSA 1HJVA 3N2MA 2P0OA 4MHBA 3PSVA 3ORWA 1O5RA 3DH9A 4K38A 3AZTA 1DE6A 3NVTA 3K46A 2X0YA 2BMBA 3V36A 3M43A 4IT1A 3B4YA 1TYTA 1EDGA 1S38A 4A8NA 4NZ5A 4OT7A 4EOUA 4FB7A 3CO8A 1TFVA 4FPSA 3AAMA 3QR1A 3WDQA 1K7XA 2E9MA 1EZ2A 1L2QA 5ABHA 1FTXA 3T8QA 3WMLA 3U4FA 3H7VA 3TW6A 3N3MA 3NDZA 3P0XA 3LXDA 4N7QA 3ZS4A 3VCCA 1VEMA 5KZ6A 2GJXA 2WPCA 3IUIA 4XZLX 4US5A 1OX6A 1RH9A 2ZUUA 3PZMA 4GMEA 4FIRA 1FUYA 1R85A 1EJTC 3W9ZA 1EKOA 1LRQA 4JPGA 5DQPA 1TB3A 1UPPA 3CV6A 3VTRA 4V15A 3VOGA 4Z2JA 1PZ0A 2PDJA 4EM3A 3RIKA 3PAOA 1X1ZA 4S3GA 4Q4QA 3NA8A 2VGBA 3UW6A 1DE5A 1VIZA 3B9JB 2HQAA 2FZDA 1H1YA 4PODA 2P0IA 3N73A 2WOVA 3IVTA 1FWHC 1O5QA 2EPLX 2C18A 2J13A 4O4WA 5A6AA 3T7VA 4RZ4A 4IMGA 3GTIA 4PSRA 2G50A 1QUMA 1LM1A 3VINA 5M03A 2DZUA 4GIRA 3UJEA 1YPIA 2XVKA 2X1RA 3H54A 4D6JA 3R6IA 1TVNA 1FWEC 2GSJA 2XM2A 3U7VA 1ODUA 1XLLA 1DP0A 9XIAA 3LCFA 3V16A 3EWBX 2Z28A 2F61A 5DMMA 2YL9A 3FEMA 1EB3A 5JCMA 4PTWA 3GC2A 2AMXA 2D69A 3UBPC 1Q2RA 3VD9A 1X7FA 2ZZ4A 3C3NA 4AIOA 2F6UA 1I0BA 3Q58A 2VI0A 4RV3A 1KNWA 2VWSA 4DUWA 2Z2UA 1HF6A 3NG3A 3MJMA 1VBRA 3UZWA 2QJNA 2G8ZA 4EE9A 4Q8VA 5AECA 3VGHA 3T0CA 1ECQA 3N1AA 1RA5A 1XP3A 1Q8AA 2VD9A 1JYWA 5C8BB 5E0FA 8RUCA 3DK4A 3UWUA 2F6XA 4AAJA 5LKYA 2BOEX 5A8GA 3VNYA 1VKFA 2DT2A 2Y8VA 2GDQA 4IXHA 4RNIA 4L80A 3AIRA 1C91A 3OLEA 4KWVA 3QSTA 3DKJA 2MNRA 3LCXA 3K2GA 1OJXA 3MUZ1 1Q8JA 3HPZA 4PTDA 5JVLA 3PZNA 4DLMA 2VZUA 1AD4A 1JL8A 3KVLA 2QUMA 3MO7A 3TUUA 4G7FA 1W5QA 4GPNA 4HA0A 3WLIA 4GNKB 4FP1A 2PWVA 4QAWA 3RK8A 1Z8AA 1NY1A 2W63A 3U48A 2PFHA 4IP5A 4C7DA 3TC7A 4HIBA 1S3HA 1TA3A 2ZQ0A 4ZCWA 1GG1A 3PBUA 2HNHA 3TQKA 1GVSA 1KXHA 4BURA 2V5JA 3E0VA 3CAKA 4EPDC 1XYZA 2YAUA 1ADDA 1OJTA 2X1TA 4X22A 3PHAA 1Q45A 4HPXA 3U5UA 4BF7A 4K8GA 4JICA 4AVOA 3AFBA 3CPGA 4KWSA 1QR7A 3R0KA 1LF1A 4GD0A 1L6FA 4MNJA 2PA6A 1UR4A 3ELFA 4JFUA 2X09A 2WK2A 3C5QA 3E2SA 2DY3A 1PVNA 2GQ8A 1SO4A 2HE5A 2EO7A 4QDPA 3QLLA 4AISA 1LCOA 3R43A 4JQ2A 4NZ4A 4XG1A 4CCZA 3RAOA 5BZAA 1H3GA 3M5VA 5HMSA 3FG2P 3WQGA 3ZYZA 1FDZA 6A3HA 2D22A 5G2IA 4DJDA 4RZ6A 3ZSSA 1D2KA 1VGAA 3TK7A 1GQLA 4XIAA 1W5MA 4A8RA 4AWUA 2V2DA 2JKAA 4MFDA 2ZRYA 3L4UA 2PDFA 5M5DA 1XBYA 1NELA 4L61A 4DO4A 4NILA 1DQXA 4GVHA 1NQKA 2ONEA 4NUWA 1LLZA 3BICA 3PJWA 4AWSA 4IGNA 3WD2A 3SM0A 1UZDA 4UNLA 5F7UA 1G1YA 4HOZA 2CFFA 1V79A 3LGGA 1Q65A 1QNQA 2OU4A 1XLHA 4FIQA 3U2CA 2WVVB 1HJWA 4C1NB 9RUBA 4RW5A 1LT7A 1CB7B 1W9UA 2PDPA 1P1MA 4KS0A 4O10A 4XZHA 3BZGA 1A4MA 4WDWA 3W81A 4OUEA 3PS7A 4PFHA 2VVNA 2IPFA 1VCGA 3OO2A 3S47A 3MA8A 3KBWA 3AHTA 1FWSA 3VOIA 3DGBA 2I17A 3HN3A 4O0KA 3O16A 3PTMA 4LY4A 5ABFB 2OWCA 2VX4A 4J2PA 3OLGA 3R89A 4WKHA 1U1HA 1PYMA 4UCFA 1Y5WA 1GG0A 3ABZA 2EPOA 3MCNA 3LRKA 1ZMCA 5KETA 2Q01A 1L6SA 3R8HA 1IGSA 3AMZA 1XGZA 3P61A 4BA0A 1O7AA 2CZ5A 3FW6A 2C0AA 3OQEA 4B90A 4HZMA 5HUPA 8XIMA 2XIMA 2AOSA 4FF5A 4R9OA 3W7GA 5EBKA 1R9ZA 5F2IA 1DWFM 3A5VA 1IEVA 4M1RA 3W1QA 3THCA 3W88A 1GWJA 4O0QA 1VBUA 5D38A 1OCJA 2OFJA 3L4ZA 1G4TA 2ZIDA 3TROA 5I06A 1C9DA 1PO9A 1TPB1 8A3HA 5CGQA 4HOXA 5HMEA 5K7JA 1DXFA 2DZTA 4HT3A 3G1RA 1UR3M 3DI0A 2YXXA 1BZLA 3RO8A 4U31A 3L4YA 2X7WA 3SCRA 4GUGA 3P81A 1XRVA 4RE0A 5D09A 3SN1A 1XYAA 1ECEA 4JTEA 2CXGA 4GZEA 3PBVA 4GA8A 4XKYB 3UETA 3CGDA 1C8YA 1SUXA 4F66A 2X40A 1UD2A 4UC5A 3VNJA 4J3WA 3IGXA 2CU0A 4AW7A 2Y5EA 4CKQA 2ANUA 4XO7A 2TRSA 1OB0A 2AGKA 4IFRA 2CFYA 4U2ZA 4CQ9A 2QUVA 1PX3A 2EJAA 3N2BA 3SQPA 1N55A 3M4HA 1L2UA 2PTWA 5FJUA 4LU0A 1KXTA 5D4YA 1IZKA 4OV4A 3WUBA 3GX9A 1FWGC 3Q2DA 3AHZA 4YHEA 2RGLA 5LIKX 1KRCC 4RR4A 2P50A 1OG6A 5LSMA 2FZNA 3IAPA 4G1NA 2VOTA 4P7OA 2OEMA 4CNUA 3L8KA 4CUCA 3VILA 5AC7A 4JTGA 3AUJA 2ZVIA 3CYJA 1B5TA 2A3CA 1XBVA 4MKSA 3OJGA 3GU9A 2CWXA 4JTSA 5HA7A 2WOWA 5BROA 3QHMA 1RVKA 3DKLA 5C70A 4OIFA 4PTMA 3L4WA 2OJPA 1QU4A 1S2AA 4LUSB 4Z1BA 3TYAA 1CYGA 3FV9A 2HPIA 5C2XA 5XINA 4QE1A 3O05A 1X1OA 3O63A 3PZGA 1XCXA 3FEQA 3CHVA 4X61A 4F48A 1TPDA 1GJPA 2YBTA 1LQ2A 3OHIA 4ZQPA 1T3QC 1V77A 4I90A 3W70A 1BQCA 4LH8A 2X1UA 4GK8A 3RLHA 4K6AA 1FOBA 3F5LA 3BLIA 3A47A 1EEXA 4QDMA 2PPGA 1XLIA 3F2DA 3EPMA 5U25A 3R7MA 4ORMA 1CBGA 5EYWA 3LBCA 4AX7A 4GJIA 2YIHA 3GVQA 4Z2LA 5A6SA 2J8FA 2JFEX 1AW5A 5HNTA 1E4LA 3M6DA 1TRIA 2QCDA 3ES7A 4AZ7A 4EIVA 3ZWTA 4OU1A 1GRGA 4UWMA 3PN8A 3WFZA 4M0XA 8XIAA 1UWSA 3VNKA 3NZRA 2H3DA 1KTNA 3BAKA 4W84A 1UCWA 4Q7IA 1RALA 1RD5A 3GH4A 1YEYA 3BV4A 3TYZA 5A6LA 2VFEA 1TCMA 4ES4A 4O19A 2P8CA 4MJ2A 4OJYA 3S2MA 4DZAA 4H9XA 4JTRA 2XM1A 4J5NA 5ECVA 4K2SA 2ZZ3A 1V3HA 1NDZA 4TX8A 3M5XA 5D2WA 5M1TA 1O4UA 1JULA 1WYIA 1O12A 3SN0A 3CNYA 3H4XA 4XV0A 4DPPA 3CQ0A 2PZNA 5KVHA 5C2CA 4NJHA 2PDWA 3NVZB 3DYOA 3IJ9A 5EBUA 4UQEA 3L5MA 3OODA 4LV4A 4JTCA 1SMAA 1DTNA 1LQAA 4NKCA 1XIGA 4ZVJA 3CQHA 2NT0A 1TV8A 1JPMA 4OWGA 5E9AA 1XLCA 2X7VA 1HO1A 1MUMA 4HVXA 1XG3A 1LOQA 2J7CA 3HMCA 4XTIA 4ZQCA 1E4IA 1ELSA 1LOSA 3TW7A 1HKKA 2CC0A 5D02A 4Q22A 3G1HA 2IKGA 2PSNA 4QP0A 4E2DA 1UBSA 2GJLA 2Q8ZA 3IS4A 1TX2A 1BWLA 3EANA 4I6KA 4QLLA 2IMRA 1OK6A 3A7AA 4TMCA 3PPGA 3USZA 3KOXA 1FWWA 4C6FA 3V3WA 4W7WA 5EFFA 1TPH1 2EG6A 1RK5A 1JNEA 2FVMA 2TPRA 4AWTA 4J28A 5A6JA 4IH3A 1V6YA 2W3SA 3Q45A 3FVDA 5A8PA 3VKJA 3B04A 3ZZ1A 1K8YA 4OQVA 5EA9A 3MPGA 1E0UA 3B0PA 2V5DA 3WF4A 1OX5A 3FX4A 4MDOA 3UYCA 3GO2A 4MB5A 3ZFHA 3BLLA 5CC3A 1XDIA 3W25A 5JCKA 3ARRA 4PMVA 4IFKA 1HL9A 4LCQA 2RDWA 4ZODA 1GONA 3GXDA 3MUIA 1TPUA 1N8IA 2DORA 4DI9A 1FBAA 1X97A 4HCLA 1F3XA 3I6RA 1L0PA 2IKHA 3VA8A 2WSPA 1XLBA 4E8CA 1LUCA 2E8ZA 4C65A 3HURA 3F03K 2BWGA 2OX1A 5I23A 5F2MA 4UFJA 3GR4A 1DKWA 3GG7A 4LEFA 3TW9A 1NDYA 3MVTA 4RPPA 4HPHA 4TVCA 4UMCA 5I24A 1CX9A 2WKLA 2QKFA 1MEHA 3NVDA 3RU8X 1KN0A 5DT7A 1JYNA 1GESA 2HTMA 1EO5A 1GW1A 4XB3A 4JQAA 4PUWA 4W5ZA 5C7HA 1GGOA 4BI5A 4F0SA 1UUOA 3Q4DA 5C9XA 1QBAA 2YFNA 1SSDA 1E6PA 4XVEA 3T08A 2PDMA 4HSHA 4JY8A 3PR2A 1R47A 4ILSA 1EIBA 4I7UA 1F4HA 4Q33A 1PJ9A 4Y9MA 1KO0A 2O4MA 2WAGA 3UU0A 4QAIA 1V3KA 5LA1A 4AXNA 3FVMA 2EQ9A 3LZ5A 1BLIA 3MMUA 4M24A 3VIIA 1MQRA 3WNLA 4AMCA 2QJGA 2R8WA 3N13A 3L68A 4KFPA 2WJFA 1UG6A 2DH2A 2EKGA 3F2CA 3GXNA 1W3JA 4P8UA 1QFEA 2DSUA 5CSRA 3BOLA 1W0MA 1JD9A 1XCWA 3GK0A 2PGRA 1D7KA 4XISA 2I1OA 4TX9A 3JR2A 5FI8A 1SJCA 3SR7A 4ENLA 3GNOA 3OC4A 2PDLA 3BTNA 3M41A 2R9ZA 5E5CA 2GVLA 4GQGA 4H19A 1B0IA 3ZT6A 5I6SA 1ZCCA 1O60A 1KQZA 4HK5A 1QI2A 2OT1A 5G1MA 4RE2A 4E0CA 2PDBA 2DZXA 3BJSA 1XIJA 3NZ1A 4AFYA 3GSMA 1OIFA 5D2YA 4HHPA 3II4A 3WDJA 5CG0A 1C8VA 5D04C 3ARSA 3TA6A 4BWLC 4GXPA 3NQEA 4DYEA 3BSGA 1H7OA 3ZM8A 1FFVC 1H2IA 1W5PA 2HWGA 1JPIA 1ISWA 1J10A 1YTKA 3GXPA 3TU9A 1PKMA 1DIKA 2PUZA 3O3RA 4D2JA 1NFBA 3VFLA 1IXPA 5I5RA 2PP1A 2BXZA 3V5CA 4H4SA 2NX9A 3TQPA 1X6LA 4AB4A 1NF7A 1E0XA 4LAUA 1PTGA 2NVCA 4DWDA 2A2IA 3WSUA 4GG9A 4XK2A 5KTLA 1VJSA 1TV4A 5C6MA 3XINA 1YE4A 2X1SA 4JTKA 2O9OA 4K68A 1F7BA 2IKJA 4DB7A 1FWIC 1P0NA 3P8JA 3M7WA 4IIFA 3IIVA 4PUUA 1SW7A 3WEMA 4CCDA 4ZOCA 2JF7A 1GVQA 4AIEA 3ITVA 5AZ1A 1O1HA 2V63A 3L66A 3EA1A 3P80A 1B3ZA 4TX6A 1F73A 4Z08A 4JCLA 5AHNA 1OD8A 3KTSA 1EHNA 1YDVA 4NRSA 3M07A 1J5SA 5AY7A 5G4HC 3S42A 3CV2A 1ZJHA 4JIQA 4R7WA 1MUCA 4Q6JA 4UOQA 2J9ZA 4Z2HA 1TV2A 4K36A 5D9PA 2UY5A 4GYJA 1B3YA 3GWQA 2Y89A 4L9ZA 3VIPA 2B7OA 4KF1A 5FIPA 4ZL1A 5K9CA 3EPNA 3DBPA 2PU1A 5HBFA 4DYJA 3UP8A 2HE8A 2J47A 4BJHA 1A4LA 2OODA 1Z32X 2WMIB 1OC7A 3QGKC 3VIGA 3PNZA 4NNBA 3FSUA 3SCVA 5AHEA 3C3UA 2BHUA 5HPCA 1QDSA 3MYPA 3WO8A 4FEZA 4CU8A 2Z24A 2DSWA 4IMCA 1MZHA 2J3NA 1EBGA 3RX4A 2Z0IA 3CS2A 1HZYA 5IFTA 2JIEA 2J7BA 4HMDA 2WPGA 4OE7A 4HMCA 4LQ1A 3RGTA 1V02A 3EOUA 3GDLA 1YQZA 4TV5A 3P60A 2FLIA 2FH8A 3T40A 2FDMA 2G4FA 4QSFA 2TODA 4JTDA 5HXMA 1O1ZA 1ZU8A 1T40A 4JTFA 3TJXA 2AKZA 5F4WA 2FJUB 4M8UA 3ZT7A 3CAVA 3VGEA 3K8KA 1CTNA 3P67A 3OU8A 3WF3A 4V28A 1PX8A 3KL5A 3OLDA 2Y6ZA 1U1UA 5G4EA 1SMDA 2FYMA 2JGQA 1AQMA 3OLIA 1I4NA 4A3QA 1QPQA 2C3CA 1OIMA 3H2FA 2C15A 4GOAA 4ZB2A 3R79A 1EJSC 1GOKA 3WMCA 3NWRA 4A3RA 3MV01 1RCQA 1S1PA 4WSJA 2I56A 4JFWA 1OSEA 1BTCA 5MHBA 4D6FA 4LC6A 2ZOXA 3QV8A 3UZZA 1YNYA 4WY0F 4LCSA 1FY6A 3OYXA 3S1XA 1VQZA 3MUCA 3O06A 1HJSA 5E0KA 3G3MA 2H6RA 4QX4A 2WBKA 1ESWA 4GO8A 2QCNA 3ANUA 4FX9A 3E02A 2CBJA 2PB1A 5A69A 3NQ7A 4WRHA 3IJIA 1QNOA 4QQUA 2A1YA 1ZY8A 1HXJA 1R0MA 3BLEA 5B7ZA 6XIAA 4AWEA 3M5ZA 4XUGA 2I7GA 5J04A 4PMUA 4IMAA 1UWAA 4QHRA 5AC4A 5JIWA 1IT8A 3S9ZA 3KM8A 4LV9A 4H4QA 3WLTA 3TP4A 3EMQA 3KBMA 3F1QA 4IJBA 2XGIA 1D3HA 3G8EA 4G2DA 1PKYA 4H8VA 1KFEA 5E70A 4KRZA 4ALDA 1VYRA 4AVNA 1GVIA 1PUDA 4FX7A 3FOKA 1DJZA 3D3FA 3PZUA 3IJ8A 3H24A 2GPTA 5DT5A 1IR1A 3BJTA 3LXBA 1F6YA 1V6TA 3WQ8A 1MMFA 2FZBA 3R94A 3AC0A 1TE6A 2Q3RA 3VC6A 4LSBA 3QZ6A 3URHA 2XVLA 2IKIA 4F0HA 1UOKA 2EQ6A 4HU0A 2POZA 5BOEA 3H70A 1ZAIA 2WZEA 3V35A 1R87A 1EWEA 7ODCA 1AFSA 3NXFA 5HPOA 3IC9A 4LAOA 3VO0A 4QRNA 3EX2A 3ID7A 1QJWA 2JKEA 4HNUA 1I45A 2OTDA 4IP4A 3UR7A 4MB4A 3ZSTA 2DUAA 1FKXA 3GTNA 4BQ2A 1K03A 3UJ2A 4RUBA 2F2KA 1HKWA 3T09A 4AD0A 4WLCA 3CO4A 3EB2A 4GC3A 4NZ3A 3LD5A 4M52A 3F4CA 3T07A 1P5BA 1RVGA 1QI5A 1Z42A 1XIMA 3WH9A 2YBUA 1Q7MA 4RE3A 3A6OA 4E2BA 2PDHA 2PDIA 1PCWA 2NW0A 4IISA 3L9CA 3BCFA 2E77A 3VD4A 5AHMA 2IW0A 4MIMA 2WANA 3FHQA 4NL1A 2E28A 3VK5A 1XLMA 2FDSA 3E3HA 2QCHA 3REQB 5D05A 1WKDA 4PRRA 4MPKA 3TOPA 4BWLA 3NQ8A 3QGAC 1AH4A 2F2HA 2NX3A 3QGVA 1GERA 1FFRA 3OIHA 4FA3A 5HQMA 4K8HA 4TXEA 3VOJA 3F4WA 2Y8UA 2WJDA 4MWAB 1QO5A 3N4AA 3WJZA 1UIPA 4N9DA 3EOLA 1W32A 3NZGA 4GVGA 2R6OA 4CN1A 4OKDA 3J7HA 1IWAA 1M03A 1AJ2A 4DWSD 6TAAA 3C2YA 1VF8A 2NQ9A 1YYAA 3D9XA 1W17A 3QH2A 1N8WA 4ERIA 4IG2B 3S9YA 2YB1A 3DUGA 1K1DA 1NWUA 1ZJBA 3QJAA 1KXQA 1UWRA 1I2NA 2QHAA 1UZ4A 5DRCA 2XDFA 1TWDA 3A4WA 4KMQA 1OADA 3GFYA 2GVEA 2I57A 2W3ZA 1J6OA 1FH7A 1XSJA 2PD9A 4JIHA 4GXWA 3ALFA 1EA9C 3KTCA 4PUKA 1AK5A 4FS9A 1EUNA 1RLCL 4KGLA 3VIMA 1QOPA 2OWXA 1FHDA 1V93A 4MNKA 1XLFA 2CKRA 1A0EA 3DGZA 1H6VA 4NT0A 1E4NA 3MI3A 2JBMA 4I9JA 1AODA 1FA2A 2C16A 5F2LA 1E1EA 4L1GA 3W7RA 4KWWA 1XDMA 3AMGA 3QOKA 2OSYA 5DMNA 5BRQA 3O07A 3U6WA 2Y62A 2PRMA 2ISSA 2P8BA 4C1NA 4GH1A 2GJPA 1SVDA 1LG1A 1KLYA 5FEWA 2VHLA 5CC6A 2CYGA 1XFCA 1Y5XA 4DIAA 1XUZA 2GOKA 1PPIA 3V0SA 2D24A 1NH6A 2KAUC 2XIIA 1W8SA 5G2WA 1P6WA 5HULA 1V3IA 2VRQA 3OZOA 5FF4A 3WK1A 1CCWB 4QISA 5DX7A 4UFLA 1H49A 5H8UA 3XIMA 2QAFA 5FEPA 5C5YA 1FWAC 4M7SA 3SSJA 2VVSA 2Z7KA 2ZXAA 2PU0A 3QZEA 1NDVA 3CBWA 3NZQA 3KRUA 5ABFA 1W9BM 3EB4A 2FQIA 2ZCGA 4LVGA 1JYXA 3ARYA 4ADWA 4W8AA 2CBUA 4BY3A 1VBGA 2A5HA 1XYCA 5FOOA 2C19A 1GUVA 3EGJA 4Q4SA 8CGTA 3QR0A 3UA3A 1IYXA 1KWKA 2PTXA 4LXFA 3ARUA 4XVDA 3QF0A 3GD6A 4GE8A 2PAJA 1EBHA 2BVYA 1OYCA 2YLLA 1D3GA 1LYXA 4XZIA 1GVRA 3ZIZA 4AIUA 1QHOA 2A7NA 1NFGA 2YJQA 2YQUA 4YYFA 1R9XA 1TIMA 1F76A 3PFMA 4KFOA 5CZ0A 1C90A 3B9NA 2X8RA 1H7XA 4Z1CA 2FB3A 4PBFA 1VFSA 4DXXA 4ZQNA 1FO4A 2VMFA 3KVMA 1TQJA 3AZRA 4MYAA 5M17A 3KAOA 3VE9A 2GUUA 3ATZA 1V3LA 3B0VC 3UXDA 2PP3A 3ITXA 2NV2A 4GVFA 3NL3A 3FXYA 3R13A 2YFOA 1Q7QA 3KS5A 4QQ3A 1FECA 3P5ZA 2EQ8A 4GUHA 3AWNA 1CGYA 3GHSA 3M0XA 3B8DA 4DI8A 3B8TA 4YVXA 3DOPA 1M1BA 3WK3A 3TXZA 2J6XA 1LOLA 4XD6A 4A3HA 2R94A 2QF7A 1F3EA 3W74A 4IQDA 2G0WA 3DHUA 5C0QA 1H63A 4XKYA 2PCEA 3QYQA 1QO2A 2DDXA 1LG2A 3WJXA 1WBHA 2PP0A 1QPOA 3RPDA 3BMWA 2YCJA 3HMJG 1AZ1A 3K1GA 2F5ZA 3W1NA 3LNPA 1OY0A 2RAGA 4F2BA 1UMYA 1AQHA 4FX8A 3VMOA 5FS7A 3TAKA 4D8AA 5CPQA 3GD4A 1OYAA 3UCQA 5F4XA 1KTBA 4BEUA 2Q8XA 5FKYA 1DYSA 3FYPA 3LSBA 1DHKA 4H9UA 4A21A 2TMDA 3I7RA 2WSYA 3MKVA 2PBGA 2W0HA 4P7NA 5G5HB 1IZCA 4CNOA 3F4NA 3FNDA 1Q3NA 3VCRA 4QEHA 4XIMA 3R4IA 1R2RA 4W93A 4DBUA 1GKPA 1QHZA 1JEZA 3NVYB 3P7YA 1I2PA 3ITGA 3W1TA 3WLMA 1EDQA 3CZJA 3AIUA 3HGJA 4JNYA 2G3NA 2DSZA 1GREA 3KZSA 1E70M 4MWAE 2NPXA 3BO9A 5DFAA 5FACA 3UF9A 4EWJA 2E67A 4TVWA 1M6JA 1EYEA 3EA2A 3N29A 3K30A 5A2CA 2NQJA 2VFIA 3RDKA 1E0VA 1CPUA 3GDBA 1A3XA