4KEMA

Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
390
structure length
390
Chain Sequence
MRIVEIREQTAGIKSDIANAFIDFSQMTCSVVAVVTDVVRDGKPVIGYGFNSNGRYAAGGLLRERFIPRLMSAAPDSLLDETGENLDPFRIWTRLMTNEKPGGHGERSVAVGTIDMAVWDAVAKIAGVPLYRLLADRFRGGVADDGVWVYAAGGYYYPGKDVKALQDEMRSYRDRGYRVVKMKIGGAPLAEDLRRIDAVLEVVGSGDNLCVDANGRFDIDTAIAYGEALKPYGLFWYEEAGDPLDYALQAELAKHYDRPMATGENLFSHQDARNLIRHGGMRPDRDWLQFDCALSYGLVEYLRTLDMLKENGWSSRRVVPHGGHQMSLNIAAGLHLGGNESYPDVFKPFCGFADGIAVEDGRVRLPDLPGVGFEAKSELFATMSGLLGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
rcsb
source organism Azospirillum sp. b510
total genus 140
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kemA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kemA01
4FI4A 3TCSA 3TJ4A 2OQYA 1W6TA 3H7VA 1EBGA 1JPDX 4HN8A 2GGJA 2XH4A 4HCDA 2OO6A 2PU0A 2QVHA 3MSYA 3I4KA 3N4FA 3DGBA 3H12A 3FCPA 4ZA0A 2PTZA 4GGBA 2QDDA 2PP1A 3IJQA 1L8PA 1KKOA 3CB3A 3EKGA 2ONEA 4K8GA 3UCDA 3I6EA 2DW6A 2P0IA 3SN4A 3T6CA 3SSZA 1TZZA 4ROPA 2PGWA 4EWJA 1JCTA 3I6TA 3VFCA 2OZ8A 1MUCA 2PP3A 4M0XA 4DHGA 3ES7A 3IJLA 2GSHA 2DW7A 1EBHA 4E8GA 4A35A 1MNSA 3QPEA 2OKTA 3GC2A 3R0UA 4YWSA 1EC7A 4HNLA 3V4BA 3Q45A 3CXOA 3VDGA 4K1WA 1FHUA 2OG9A 3TW9A 3CAWA 4H1ZA 3Q4DA 3DG7A 2HZGA 4HPNA 4IP4A 4M6UA 1JPMA 4DYEA 1MDRA 3TWBA 4JN8A 3RO6A 2AL2B 3BJSA 2XSXA 3TTEA 3JW7A 1NELA 3P3BA 4ENLA 2AL2A 3N6HA 3ZLGA 1IYXA 3TOYA 3MZNA 2OZTA 5FJRA 3STPA 3ENLA 1JDFA 1YEYA 3H8AA 3SQSA 7ENLA 1ONEA 4HCLA 2PPGA 3GY1A 4F4RA 3PFRA 3ZVHA 2MNRA 3UJRA 2RDXA 4J1OA 3TJIA 3PWIA 2FYMA 4GIRA 3T9PA 2OFJA 1E9IA 4J3ZA 3CT2A 1SJBA 3DFYA 4IT1A 2O56A 3FJ4A 3R10A 1EC9A 3D47A 4E4FA 1EC8A 3DEQA 3DFHA 4G8TA 2PS2A 4E4UA 3N4EA 4G7FA 3SBFA 2GGIA 3OTRA 2PU1A 1TKKA 3K1GA 4GMEA 1NU5A 2P8BA 3VCCA 4KEMA 3RR1A 5BOEA 2PMQA 2QDEA 3CK5A 4GISA 1SJAA 3UJFA 3UXLA 4Z1YA 2ZADA 1BKHA 3MKCA 4A6GA 5FJUA 2OVLA 4DX3A 1FHVA 3EEZA 4KWSA 1R0MA 4X2PA 3DG6A 4A3RA 1KKRA 2QQ6A 3B97A 4GFIA 3QTPA 1SJCA 4JN7A 2OLAA 3H70A 3QKEA 2HXTA 5ENLA 2HXUA 3VA8A 3RGTA 3BOXA 3R0KA 1WUFA 3V3WA 6ENLA 2QJNA 3U9IA 3UGVA 5BOFA 4MGGA 3P0WA 3VC5A 2P88A 3FVDA 3TQPA 4K2SA 3RCYA 3R11A 2GGGA 3VCNA 4KPLA 3S5SA 3S47A 2QJJA 3ZLFA 2P3ZA 3V5CA 3MUCA 1F9CA 2QGYA 3NZGA 4HCHA 2AL1A 2PODA 3TWAA 5J04A 3PK7A 3R1ZA 4DWDA 2OZ3A 3QLDA 2XH0A 2GL5A 5EU9A 2I5QA 4HYRA 2GGEA 2OQHA 4GYPA 4H19A 2PTYA 4E6MA 3SN0A 1PDZA 1DTNA 2NQLA 2XGZA 1RVKA 4IP5A 1ELSA 1XPYA 3MY9A 4IL0A 3UJEA 1MDLA 4H2HA 1P43A 3UCCA 1XS2A 2PP0A 2QJMA 2GDQA 5IDZA 3UXKA 4FP1A 1TE6A 2PSNA 4Z17A 3FV9A 4IZGA 2PTWA 2HNEA 4MKSA 3THUA 3UJ2A 3NFUA 2OPJA 1ECQA 4ZCWA 3OZMA 1MRAA 4GGHA 3BSMA 3RITA 3KUMA 3U4FA 3JVAA 1R6WA 2AKZA 1KCZA 3GD6A 3FXGA 4H83A 2XH7A 3NO1A 2OX4A 2ZC8A 2MUCA 3CYJA 4DXKA 3T4WA 3OZYA 5FJOA 3V5FA 3D46A 2P8CA 3DG3A 3HPFA 5FJTA 3VC6A 3N6JA 2AKMA 3UJSA 3PWGA 3DDMA 3ES8A 2FKPA 4GYPC 4IHCA 3JZUA 2XH2A 3MQTA 3OW1A 3SN1A 4E5TA 3ZVIA 3IK4A 3MWCA 3T8QA 3DERA 4IL2A 2PTXA 3P93A 2CHRA 3IJIA 3OP2A 2POZA 3SJNA 3R25A 2GGHA 3RRAA 3FYYA 1SJDA 2PA6A 2PGEA 1P48A 3OPSA 2PCEA 4JHMA 4KT2A 3GO2A 5FJPA 3QN3A 3NXLA 3ZLHA 4DN1A 3ZVHB 1BQGA 3DIPA 1WUEA 1PDYA 4MMWA 3DESA 4HNCA 1KD0A 1OEPA
chains in the Genus database with same CATH superfamily
4MB4A 3VD9A 4DUVA 1HNYA 4INFA 4EX4A 1EJVC 4N02A 4DAFA 4JX6A 1H63A 4PN2A 5AYZA 1TQXA 3EMCA 3SB0A 2QPXA 2OSYA 5CPMA 4U5KA 2FGZA 2VX4A 4ZMGA 2PP1A 4HJFA 4GZ7A 3G1AA 1W8GA 3BAXA 2E5CA 3CHCA 4PMXA 4WY0A 1W3JA 4MYXA 3SSZA 3LSCA 1D3HA 1YTDA 2AAMA 3QGAC 1TX2A 3NEVA 4DHGA 5LA1A 3PNUA 1H7PA 4RE0A 1EBHA 2YL5A 1UC5A 4HNOA 1OF8A 3E2QA 3R8GA 2W0UA 4GE8A 4B2DA 3TV8A 2Q3RA 4WLCA 1AD4A 1RVGA 3JRKA 3TQVA 1XW8A 3WDHA 3U57A 1YADA 4F9JA 4S3EA 4UTIA 2RAGA 4HPNA 4A21A 3GQYA 1CGWA 3E5BA 1LUCB 4J28A 4JTJA 2J9YA 1JZ4A 1OCJA 4JN8A 3QRHA 1LBLA 2XSXA 4CCCA 4IQLA 2JEPA 2VX7A 3OHMB 3ZS4A 3N25A 1Q2SA 2ZXDA 4PTNA 3OVRA 1NIUA 1E0XA 1LWHA 5D4YA 3H54A 3OIHA 1XR2A 2QCDA 2ICSA 1Q6EA 2XFFA 5DT7A 4GCAA 3VYLA 3IIXA 4ICMA 2OB3A 2PGRA 5LA0A 3RO8A 4CCDA 5ABEA 1W5QA 4EAYA 1OD0A 4XBSA 1I2QA 4ZO6A 1E5JA 4RNHA 1G9HA 1XHCA 2RDXA 4AYGA 3O0FA 1NFGA 3SGZA 1F3PA 3CZEA 3VNLA 2FYMA 2OFJA 4N9BA 2GJPA 2DORA 3PJWA 1WZAA 3B9DA 3QFBA 1X97A 5GJNA 1US0A 4L4LA 1V7YA 3DFTA 3DYMA 3GX9A 3PTKA 2P3EA 3DI1A 4HK5A 3K8LA 2GQ9A 3SRFA 3H2NA 3GDMA 2VJXA 2HE8A 3K1GA 3PVFA 4LW7A 1JPIA 1ECEA 5BRPA 3RR1A 1W5MA 3CK5A 3GU9A 4KFOA 4JGDA 3OYXA 3URAA 2YA1A 2Y61A 1FEAA 2E8ZA 5AHEA 1GRTA 1NJJA 4A6GA 2X30A 1C8YA 1OIMA 4IMDA 4AD2A 3SDOA 4ZZ9A 4H9XA 3N14A 1V6TA 2ZA2A 2OYLA 4F40A 5DANA 1E5NA 2WJDA 2UWFA 3CUGA 4H4XA 1KFWA 2VKZG 5ENLA 4C5YA 3TTOA 5TAOA 3VA8A 1E9ZB 3IJDA 1XLMA 4AY7A 3KTSA 2WMIB 3W1QA 4O16A 5AYXA 3NZ1A 1DVJA 4P8UA 4MGGA 3P0WA 4WZHA 1KM6A 2QCMA 4IICA 2X8RA 5DX7A 2J7DA 2ALDA 5D04C 1AW5A 2O92A 3WBEA 4UTFA 5D8WA 4MHBA 1IGSA 3V7PA 4RNFA 5BMWA 4D8LA 4M6QA 1RV8A 2TRSA 5BXRA 3W28A 1JCYA 1QRQA 1JDCA 1OC7A 3DYPA 5I2UA 2IKHA 1KRAC 1TQJA 1HTIA 3VIOA 2QUUA 1LT7A 1SPQA 2WMJA 2C19A 4LAZA 4GVIA 5D9NA 3ONCA 2VEPA 4MDPA 3EOSA 2VWTA 3SR7A 3AMZA 1I4NA 1C3FA 3BGGA 3HQOA 2I5GA 3E2RA 3GZ3A 3WD3A 3RLVA 4P7QA 5A6MA 2DUZA 4B3ZA 5H8UA 1B1YA 3DX5A 4R7JA 1JZ3A 5G1YA 1ODUA 3BH4A 3LCFA 3QQWA 4FP1A 2PURA 2Y24A 3RILA 3SRHA 2PWGA 2OZ0A 4FF5A 4MKSA 4Z2HA 5FF2A 3VMPA 1YDVA 1R3RA 4JOMA 1C9WA 3C3NA 3RIKA 1OFDA 1JNDA 3GFYA 4GGHA 1UQZA 3PJTA 1VP5A 1PHWA 3WEOA 1VJZA 3DH7A 2Z1VA 1EX1A 4PUUA 3C0LA 4DWSD 1XX1A 2FH6A 2QULA 2ZC8A 5DELA 4ZL1A 2YL6A 1DXIA 3OZYA 1RA0A 3COTA 5CPTA 4FX8A 4JFVA 3VDBA 3T2QA 3E0LA 2E28A 4HA4A 1V08A 4B3KA 3DDMA 2WP6A 2WSKA 4Q6JA 4A8RA 1AQ0A 3ZVIA 1HJSA 3S5ZA 2NVAA 3LCGA 1DE5A 3E74A 4BWLC 2BY3A 4AHPA 2OTDA 5IFPA 3TSMA 1KCKA 4DAIA 3P5YA 4MIMA 3T0TA 4JCLA 4DUOA 1SJDA 2HK1A 2W92A 3TOPA 1FXPA 4DJEC 1LQ0A 5A6BA 5H2ZA 2BFGA 3WIJA 1TTPA 4DM1A 4O53A 4A3HA 5HPCA 4C7DA 2Z24A 1PXGA 1OEPA 1ESWA 4H9MA 2B7OA 1OT2A 3TJ4A 1LF1A 4BZYA 1D3CA 1EWEA 2UY4A 3ITXA 3B0UX 4TVUA 3GIQA 3M4HA 3VIFA 3CWHA 2R1NA 5A6TC 3BICA 1PKMA 1ZJHA 3LGGA 3H12A 1TJRA 2DIKA 1NQ6A 4WKHA 1H0IA 4W7VA 5DMNA 3PC0A 4NQ1A 4NT0A 1QUMA 4MB5A 4ZSTA 5HQEA 3G8EA 4NYYA 4EWJA 1UH2A 3IJ6A 3SRDA 4PCFA 4J7RA 2D2HA 2OZ8A 2PP3A 4JTIA 1XLCA 3UCQA 2W5FA 2EJAA 3RG6A 4JFSA 5HK4A 2A3LA 3CMGA 2OKTA 4G1KA 3NPVA 4C90A 3GG1A 4XVEA 2PWEA 1U1JA 3MCNA 1H51A 3EZ4A 4YU1A 4TQTA 3WH6A 4U3CA 4P8VA 3ANVA 1RJPA 1PPIA 1GOXA 1XLDA 3FJNA 3GTNA 3WDIA 1UJQA 5G2IA 3WK2A 4K37A 5J8LA 3CIWA 3PBVA 3T05A 1A49A 5EMYA 3W7NA 1ZQ5A 1NPXA 4H6KA 3DN5A 4WOQA 1W54A 1E1FA 2VR5A 4MLJA 4GNVA 2WVVB 3U2CA 2G3JA 2QAFA 1ONWA 3AZSA 4IQEA 2ISFA 3SURA 3UBPC 4DJDA 2AL2A 4HB7A 1OFEA 3NL5A 2JIWA 1GRFA 3MZNA 3UERA 4O8AA 8XIMA 2V5JA 1JQXA 5DQPA 3W83A 1JDFA 1XLKA 1VJSA 3QR1A 2BVYA 2VRJA 1EGZA 1UZHA 1K8CA 2C1GA 3P8JA 1KR1A 4X0NA 5KINA 1O1ZA 5CC5A 1EP1A 2C3CA 1K9FA 1YPXA 3KM8A 3UA4A 1FWCC 3MU7A 4Y9PA 4XISA 3W07A 4MNJA 3G3DA 9XIAA 3CO4A 2V82A 4QNWA 2J3NA 4HMDA 2G3NA 1MEWA 4GH3A 2PFHA 1G01A 5CSUA 2WZEA 1KA9F 3UJRA 4OHQA 3W7PA 3UF9A 3HURA 1VFFA 2BX7A 2OT0A 1HUVA 4PCPA 3OGRA 3TW6A 4NZ4A 1MO0A 1G7UA 1EC9A 2WMHA 3UXAA 4AD0A 2IS7A 2J24A 3WLKX 4PB4A 4O11A 1BYCA 1E4MM 3E0IA 1GOWA 3CZ8A 3V5OA 5CGMA 4HNTA 3PZTA 1EBDA 4WHBA 3QY8A 5DMLA 2GR3A 1GSNA 1M3UA 4W7WA 5HDRA 4G56A 2VUNA 4KEMA 3TLQA 1FHLA 2PDGA 2H8XA 3ARSA 4PODA 3CHVA 3QGKC 2O7SA 3UXIA 4MNMA 3W26A 1A5CA 1PZ0A 3PZ9A 1ZHAA 3TA9A 3NRZB 2E68A 4WDUA 4GIEA 4BEUA 4EQXA 4EPDC 2PDKA 3BUVA 3HTWA 3B9AA 3GBDA 1JYVA 4O1BA 3LBCA 3BW2A 3DJJA 1KKRA 3F03K 3PBUA 2ISSA 5CXPA 3NEHA 5IHSA 1C8XA 3GD3A 2I7GA 1V3HA 4M51A 2FGLA 4RKAA 2YAUA 2C8NA 2HXTA 2XZ9A 2ZZ6A 4UOJA 3TCEA 2MANA 3HN3A 4O12A 1TMHA 3NVYB 4H4RA 3GHUA 3P6LA 4NX0A 1OZQA 3P60A 1QNVA 3FJ6A 5AECA 2FVMA 2WLZA 1IT0A 1VBUA 2BLEA 4H3DA 4OBRA 2HK0A 4HSNA 3U9IA 3UGVA 4AH7A 3IJ9A 2WBGA 1S5MA 1JG9A 1ZNNA 1BVZA 5DN1A 3TQPA 3BLIA 3C0SA 1V6XA 3MHFA 3NQCA 3FKRA 1PUDA 4GJIA 1H6VA 3HFTA 2XSAA 1Z9AA 2PWFA 1FWTA 1EL3A 1WYIA 4X0VA 3EA2A 4YHGA 1KM1A 1UUQA 4Q4MA 4MAZA 3TWAA 2XM2A 4LV9A 3B8SA 3MP3A 3U5YA 1AQHA 4NRRA 1G0CA 4XZWA 5F2MA 4ASTA 1NHPA 2FZBA 1RBLA 3BSGA 1RVKA 2PZ0A 1HF6A 4IL0A 4E38A 2WNWA 4XBJA 5CPQA 1DJWA 1VFTA 3MCMA 2D22A 1WDPA 3BLPX 1ZZMA 1XS2A 2PP0A 4LUSB 3W6YA 4LUTA 2WC3A 1OGSA 1SO5A 5FEZA 4UFJA 5HWJA 3JUGA 3G6MA 3GVQA 2VFEA 1XD1A 4PL1A 2HNEA 4S23A 2OCZA 3B8VA 3SRKA 1AW2A 4HYWA 4LVAA 1MRAA 3XIMA 2XN2A 1B31A 4AQLA 3KUMA 4W8LA 4GUIA 5PTDA 3U4FA 4NP7A 2E6FA 4B90A 4H83A 3WD1A 2E09A 5G5HB 1DQUA 4PH6A 1FH8A 1XLJA 2WVUA 1TYPA 1O66A 1K7EA 3HPZA 2MUCA 3OA3A 1A50A 5LGZA 2QCHA 4X3ZA 4FR6A 3LI0A 5A69A 1JZ2A 4F2TA 1KCXA 4D2JA 1MVYA 2E4TA 5REQA 1R9YA 3TYCA 1OFQA 4QITA 3WJSA 4CQ8A 2UY3A 3GRTA 4KWOA 2FZMA 2FJKA 4PMZA 5CC3A 1TV8A 3NUKA 3TQKA 2PDLA 4UFIA 2EBNA 3MKVA 2EQ7A 4C6PA 2VO5A 3G3MA 1KTBA 2WPGA 2PTXA 4M82A 2CHRA 1XF0A 3R25A 4L4PA 2EPMX 1XRFA 4ML4A 1K3UA 2VZUA 4DBSA 2FQIA 1Q13A 2PCEA 4JHMA 3UGRA 1CB7B 4O1DA 3NXLA 3KBWA 1CGYA 1A4MA 1FP8A 3KCJA 1TVPA 1ZKQA 3MUY1 3WD4A 4QAWA 1GREA 3H23A 1PKLA 3H7VA 1NWTA 2A21A 5ECVA 2RDTA 2R94A 4KERA 2QVHA 3T4CA 1BSIA 1R3SA 5DXYA 3LPGA 4YIWA 3B0YA 1IZJA 4WOZA 4FPSA 3W1XA 3C52A 1BEUA 2ZRXA 1XWYA 4H7ZA 1CXIA 1UKQA 1SO6A 5HUPA 3FHAA 3IJQA 4S3CA 5HINA 2E5AA 5CEWA 3UR8A 3SECA 1A3XA 1E6QM 1J6OA 3EWDA 1AJ2A 3M6DA 2V69A 2AMXA 4GABA 3I6TA 3UWQA 1LRQA 2DW7A 4MFDA 3HJEA 2WZIA 2YDAA 4DNAA 4MNLA 3MKKA 4O1CA 3R0UA 1E6NA 1H5VA 5CJ5A 4UC5A 5A8GA 4W85A 3SCPA 2D20A 1HZYA 2NLYA 1XKJA 3GNRA 4WGHA 4IPPA 4A2SA 1AH4A 1I9CB 2DIEA 4H1ZA 2ZUUA 4JBRA 1VQTA 2HZGA 3E0VA 3MA8A 1WPCA 1P0KA 5I07A 1TRIA 4WDXA 3GYCA 3A4WA 2G3MA 3IUHA 4EQWA 5MKGB 2ZWZA 3KCOA 3W2LA 4US6A 3VDAA 1XP3A 2WZMA 4MJ2A 3DENA 4RZ5A 3JS3A 4PZVA 1EZ2A 2VX6A 2Z6IA 2H3DA 5LNSA 3KLLA 1TWZA 3SZ8A 2V3FA 1FCBA 2FPTA 4PMDA 4EAMA 3IIOA 2YYUA 5MHBA 3WNNA 1R38A 2UY2A 2CETA 2F5ZA 1XBVA 3TSDA 1KM0A 4NZJA 5DLCA 2AOSA 2DJXA 2YKKA 3BWWA 3BK0A 1BXCA 1VLWA 2VZVA 4CQBA 3WDJA 1UP2A 4U28A 1F76A 4AEEA 2MNRA 3CQIA 4IUGA 3VGHA 3QW3A 1XLLA 3T81A 4QG9A 2HE5A 2VFFA 4NNAA 3TAKA 1ZAJA 2YVGA 1VEPA 2WWCA 1RP8A 3PUDA 5H1WA 2O56A 4EF9A 1Q4WA 4K68A 4LS2A 4K7ZA 2GSJA 5D38A 1EQCA 3G6LA 4PSPA 3E96A 2KZHA 5JCIA 4F0KA 4X9SA 5LA2A 5AOUA 1XLFA 3LQLA 3PZUA 3DHPA 4QJ5B 3I3BA 3AMKA 3NNTA 1R3QA 4Q8WA 4FR1A 5IBXA 2PDHA 1GQJA 2E6DA 3MT1A 1RBAA 4P7NA 4EQSA 4C6FA 3IGHX 4FXJA 4IG2B 3UWVA 1VBJA 3F4CA 1R8LA 1WKFA 2VQTA 3RM4A 2QEZA 1MSSA 4NJIA 1S3TC 1P4CA 3CV2A 3AWNA 1TCDA 1PYMA 4Q7IA 4JS3A 1RD5A 1GT8A 2V9DA 3WQ5A 3MC5A 4KWSA 2F9RA 1CGUA 3N3MA 4D6CA 1C9DA 4FXRA 2V68A 4A3RA 1GRHA 4ONVA 1IZKA 3ERPA 3VU2A 3HGRA 3ZR5A 4F3HA 1PZ1A 1XIJA 2YLAA 3BAKA 1U5VA 1WDQA 3VOGA 1VYRA 1WP6A 2XN1A 4DM2A 1EOMA 3UPBA 1LM1A 1EPVA 1EEXA 2BXYA 4FXFA 3LGEA 1XLHA 1M03A 4XZMX 5H8MA 2CNCA 4NUWA 2P88A 3W25A 3PPGA 2PB1A 4Q4RA 4UOQA 1B3VA 2C71A 2X7VA 3AS1A 2XM1A 2DY3A 1V0MA 1ZENA 3HOJA 2NQHA 3RFAA 4XSLA 4W86A 4JTSA 3ZLFA 3FA3A 4YYFA 5M3WA 3H22A 3E0FA 2QV5A 4UOZA 3DC8A 3VOIA 3NZRA 5DEZA 2O9PA 1M9HA 1D8WA 3ITTA 2X1IA 1P7TA 1BYDA 2WJEA 5A8MA 3WLHA 4XSMA 3N18A 3D5HA 1SZRA 2GR1A 1YHTA 1CXEA 2GL5A 2ZX5A 1W9PA 4H4SA 3PULA 3GIPA 3I7QA 2CLLA 3GVWA 3VI2A 4D9PA 5M17A 4IIDA 1UA7A 2EO7A 3WMCA 1O5XA 3W9ZA 2E9MA 5BMXA 1RCQA 2F6XA 5AKQA 4YCPA 2CZFA 2QPSA 5T9CE 1SZFA 2VR2A 2Z2AA 3ANUA 1TPVA 3OIXA 3PBMA 1UWAA 1PE1A 3PUEA 1TV7A 3FFSA 2WMKA 1FQ0A 1SR0A 1S2CA 2FB2A 4LB3A 4PUDA 3WMSA 4I3GA 2PSNA 1VBGA 3FHQA 2GR2A 1KR0A 1K6AA 1FDYA 1EIBA 4PYSA 3UY8A 1K8ZA 2B7NA 3URBA 4N6EA 2PDPA 1UKTA 2G3FA 4JFWA 2WQDA 2IPGA 4Z42C 5AZ1A 3CC1A 2QKFA 4U2ZA 3EWXA 3WK0A 3ZWTA 3UZYA 4HPXA 1H50A 4KWUA 4D6DA 4B5UA 3LEPA 4J57A 4JDYA 3VMNA 4OVXA 4CU7A 5IXEA 3UW6A 4DO4A 1KQYA 1XLGA 1REQB 3N9RA 2ZZ0A 1OBAA 1DXLA 2CLHA 2W79A 3PG9A 1EP3A 1M7OA 1YDNA 1AD1A 2QHAA 1YNQA 4PRWA 4WQ6A 5AC4A 2PC4A 3MBDA 1ZY9A 3ZR6A 4K8HA 2QR6A 2BC1A 3OP2A 4H4UA 5C6MA 4J40A 1E0VA 1WDRA 2QCCA 4GI4A 1P48A 2INFA 1RY0A 2AAAA 1DL3A 2HRWA 2PEVA 4JQ1A 1JCJA 1A5BA 2G96A 4DN1A 3O8AA 4NU7A 1VFUA 3SQLA 3FKKA 4JKKA 3SGGA 2PRLA 3TN3A 4LCQA 1KD0A 1QBBA 3LDVA 4DZHA 2W0HA 3BOFA 1JRCA 1T8XA 1Q1RA 2AGTA 3UEQA 3IVTA 1CXKA 4DRSA 1SZGA 1ZGDA 4GRTA 1S46A 4Z2LA 9XIMA 4K6AA 4RJEA 1OFBA 1JPKA 1QI2A 4FLOA 1X8FA 1S39A 1QOXA 1VIWA 4NAEA 4NILA 3WMLA 4AZCB 3IAQA 4GKLA 1L8PA 4KEVA 1IT7A 2ZVIA 4WRHA 1VDVA 1J2WA 4FEZA 5BRBA 3ICJA 1LRNA 3HV8A 4LV4A 4OV4A 4Q8UA 3NVZB 1BVNP 3ZT7A 3ES7A 3AIEA 1MFVA 4REQB 3BV7A 2FPYA 4WVXA 5CGQA 1XYCA 1H09A 3ABZA 1WXJA 4UMAA 1JULA 1XC4A 1PKYA 4O57A 4FNSA 7REQA 2BC0A 4X9YA 1H4PA 3LENA 4M1BA 3B3DA 2BVDA 3GDLA 3EOEA 1B90A 5BXSA 3ARUA 1G4EA 1J5TA 4V15A 5ECUA 1SB3B 2WC7A 3Q4DA 2NV1A 4IX0A 2O9OA 5FSDC 3KVLA 1UOKA 3TN6A 3DZ1A 3TAOA 4WXZA 3RO6A 3LGDA 3TMLA 2BMBA 5TD4A 1OWQA 2H90A 2YBTA 3AZTA 3AXKA 1LUCA 2YXGA 4V27A 1I2OA 3E38A 4ADWA 4OIFA 4OZOA 4CQDA 3QZ6A 5U7SA 1F3XA 1LBMA 1K4QA 2CZVA 1GRBA 4JY9A 3LRLA 1FY6A 5CPSA 4FF7A 1QHOA 1O5QA 4MTVA 4DZ5A 1Q63A 1HP5A 1XYAA 2A1YA 5CGTA 4HNVA 4CEXC 1K4HA 4M6PA 5F2LA 1BHGA 1FWAC 2CKRA 4H7VA 3LBMA 4K8EA 3KOYA 4H6RA 5GNZA 4GQQA 2DZSA 3RLHA 3PZVA 4AC7C 1GVFA 2W3ZA 4F8XA 1GEQA 4R3UA 3W72A 5CSSA 3LM7A 4LVBA 2VC6A 4I5XA 2YLLA 2ZRZA 3VX0A 2OOGA 1UCWA 2NT1A 1D7YA 1C7TA 2XWDA 3GHTA 1DIEA 1YTKA 1EC8A 4H6EA 5CAHA 3E2VA 1GOOA 1QHPA 5I3HA 1IXQA 4W87A 3ARWA 3T7VA 4PCNA 3MI2A 2GVGA 4DJDC 1RUSA 1GJPA 4J35A 1TVLA 3OA5A 3EX1A 3S1XA 4NJHA 3H4GA 2WM0A 2WCSA 4U31A 2FVKA 3SEPA 3NL3A 3E6EA 1H7OA 2P5NA 2J66A 4HK6A 3V0TA 1AG1O 3PS7A 1CYGA 5F7UA 1C7SA 1KXVA 1OCNA 1W1YA 3LMZA 1GVOA 3UZWA 4RDYA 1F73A 4KFNA 3EDJA 1NDVA 5FJJA 4D71A 2DFAA 2I16A 4ZVJA 2VC7A 3B97A 1BD0A 2VCAA 1V3JA 2J78A 3GU2A 3W1MA 3GXDA 4JEQA 5JUVA 1HKKA 1DWJM 4OOZA 9RUBA 2XFWA 2WHLA 2XGIA 4LB4A 3PJXA 2QDHA 4GVHA 2ZBTA 4LBRA 2D0GA 4YL2A 1Z6KA 1QNSA 2W62A 1OFPA 2WMIA 3MHGA 3R11A 1M5WA 4JIHA 3CH9A 3L5MA 3K5XA 1RK5A 1F9CA 3ME3A 1KXHA 1QNRA 1Y65A 3O16A 1DIOA 1R7OA 1WAUA 3I65A 4GBUA 3W38A 1JDEA 5B7YA 1T41A 1DJNA 2OELA 2J7CA 1S1PA 2OZ3A 1MXGA 3P80A 4V1YA 2J8TA 2WYSA 3TLLA 1YPIA 1XIDA 3L2LA 5BW6A 3VD5A 4W88A 2VYOA 4D8ZA 1SFTA 3A4XA 2YCKX 2CLFA 3ZJ7A 3RX4A 8RUCA 4ZQMA 1JUEA 3LUTA 4PMYA 2FDMA 4HU0A 1U30A 1JAKA 5AHNA 1W1TA 5I7GA 2PTWA 1UR9A 1TB3A 1HKJA 3LBOA 1EYWA 4FX7A 4UMBA 3R89A 3T2PA 3GXPA 3MS8A 1PX8A 1KTCA 1VAHA 3TQ0A 4O18A 5A3HA 1O5KA 4PA8A 4TV6A 3R07C 5D2TA 3U5UA 3OG2A 3NXFA 1OJTA 2OLHA 4IMGA 3S3GA 2IW0A 3RF9A 3G0SA 4IGMA 1NF7A 1W9VA 4MSSA 3T4WA 4BCEA 4FXSA 2A4AA 3S1UA 4QE5A 1R3TA 1SFSA 4GJJA 4IGNA 2WP5A 5CH9A 1BRLA 3LU2A 4ATLA 3CWNA 4N42A 1S5TA 2QCDB 2XVNA 4K36A 3BQ5A 2WKLA 3ABOA 1ZCCA 2PDMA 3LHYA 5FOOA 4O15A 4AF0A 3UNDA 3GR4A 3P81A 4WKAA 3GXIA 3RJXA 3PPHA 1JXKA 2EQ6A 3ITCA 4POCA 1U1UA 2VC9A 2DGAA 1Z8AA 2UY5A 1UMYA 4GQGA 1WKEA 4R9OA 3VOHA 4V1XA 3NG3A 3UR7A 3MHUA 2A7PA 4PCTA 3UWZA 3WBWA 3ABXA 3BVJA 2GDVA 2ACRA 1L6GA 3S2LA 2DJLA 3SQMA 4AD4A 4AZIA 3KBMA 1XQLA 3BJFA 1L2QA 4WEVX 5BXPA 3K13A 1I60A 3DFQA 3OLGA 3VE9A 2DH3A 1DNCA 2F61A 3BMXA 3AMCA 3AM9A 5FI8A 1FWEC 2ZRYA 3BLFA 1J0JA 1CGVA 4LEQA 3UPMA 1JI2A 3UCDA 2BS9A 1MZHA 1VZWA 4LALA 4ROPA 3ZJKA 1JCTA 2RUSA 2DEPA 4KCVA 4NXSA 2VENA 3EX6A 4WDWA 1W56A 1I1XA 4A8LA 4JTDA 4PMQA 3K4AA 4LPCA 2J88A 5CG0A 4MG4A 4Z2JA 4WUIA 3FK4A 4W9TA 3SUUA 4UXDA 3S0CA 3GLCA 5KZ6A 3UZJA 3ZT5A 4JYFA 2YB4A 2CLKA 3E12A 3DBPA 3W22A 5C70A 5IM51 2ZUTA 1E6XM 3HFYA 4AD3A 3AIUA 1TE1A 3WJZA 3TWBA 2PI6A 1E70M 4JNYA 2V0TA 1R3YA 1W3NA 3NPUA 1DQWA 4XO7A 3NQBA 1E4NA 3NSXA 1LOQA 3LSBA 2WVVA 3CTTA 4F2UA 1V03A 2V81A 3C6CA 2ISVA 4E2VA 4DWSA 4XAFA 3DHFA 4H50A 2HDJA 1N5XA 4H2CA 4M1RA 3W37A 4LXFA 3DKLA 4J3WA 1V97A 4EE9A 2YFOA 3NWRA 1EQPA 5AC5A 2RJGA 4Q22A 2QF7A 3II1A 3QQ0A 4ACZA 1WXYA 3N19B 3NQEA 2W61A 2G50A 1X1OA 1UR4A 4IJBA 4J3UA 4PRRA 1QMLA 2GDUA 4U2YA 4AG0A 2W54A 3WUBA 3GTFA 3MTWA 4A2RA 2CFFA 1GWJA 2FZ8A 1KGUA 4MAVA 3KOXA 4IH3A 3KX6A 3PUOA 1VPXA 3O0KA 1W3HA 5EPDA 1LORA 1GRGA 4OBTA 1UYQA 1H3GA 2V5LA 4LA1A 1UD5A 3GIYA 3W7DA 3CUIA 3M9YA 1V02E 4B4FA 2XDFA 4J56A 3Q94A 1NVMA 3W7MA 2G0WA 3IJ7A 1S7MA 1XHGA 3DFNA 1XCFA 1E4IA 3RNDA 1UH4A 5BOEA 3KVMA 3KLJA 2PMQA 4V2XA 1UWRA 5HBFA 7CGTA 5CC6A 2WZHA 3ECQA 1QWGA 3UJFA 1T6MA 2Z6JA 4JQ3A 3HPAA 1VEOA 1F8MA 1O4UA 2B31A 1KGXA 3KOZA 3O6AA 4DX3A 3LCWA 1QNOA 2NV2A 4X2PA 4B9ZA 3M5XA 2B81A 3IIZA 3PTMA 1Q6DA 3L0KA 3AI0A 3V0UA 1PSCA 1VCVA 3OG3A 3DYOA 1J18A 1CZ1A 3NTYA 4AYSA 2C0AA 1TPH1 2HJPA 2I9UA 2XSBA 1WUFA 4GY7A 4QLJA 1UZ4A 3FYPA 1QHZA 1JYNA 5BOFA 4YHEA 2HVMA 3N34A 1C91A 2VGIA 1QPKA 2PDNA 3NURA 4R34A 1RZMA 4V28A 2D3NA 3EA1A 4MJZA 4WDTA 3CUXA 4IOTA 4WSKA 3VNKA 1ZJIA 2CYGA 4HN4A 1S2WA 1FO4A 4MKVA 4UTWC 4DPQA 3W7GA 4MY8A 3CZKA 5HJYA 4DJED 2R24A 2Q8LA 1P5BA 1IEIA 5ABHA 3PK7A 4DWDA 1SSDA 2FTYA 1G67A 1FDZA 1GPFA 3SCWA 1PIGA 1IR1A 1EO7A 5D05A 1LQAA 4PEKA 4E6MA 3TX9A 1OCQA 1SFJA 4B5NA 4Z0SA 4S3BA 1K77A 1OB0A 2J7HA 3QC3A 4Q8PA 5L9FA 4IMFA 5D2WA 1BWCA 3M47A 2DQXA 2QCNA 1L9WA 1F6KA 4Z2IA 1JF5A 2JE8A 1GZ1A 3N4AA 3TU9A 1VCFA 2PRMA 3M1ZA 2GJXB 1NARA 1UIOA 2E8YA 5AHFA 3IIPA 4I8DA 1FFQA 4LUSA 4APNA 2BTMA 4AZHA 4GZEA 2XIQA 5FJIA 3N9KA 1TREA 1CWYA 1VH7A 4TX8A 3NVVB 5JRBA 4ES4A 4EKJA 5FKYA 4KGLA 2WHKA 4S1FA 2YBVA 3W2NA 2OLSA 1P1XA 2Z28A 5G2WA 2PTDA 1J5SA 1VHCA 4CEUC 1YXCA 3GR7A 4PMNA 3UZZA 3VILA 3N29A 4HMCA 1BAGA 1LLZA 2XVGA 4HK7A 1E43A 3MSRA 5CBIA 1XFBA 4PUJA 4R85A 1MXSA 4L5ZA 3AIRA 1WBHA 2VCBA 4W5ZA 1KBLA 3CGEA 2V3GA 1MMFA 4R33A 2NVCA 3TC7A 4C60A 4AIUA 1TPC1 1X1NA 3DJGX 3QHOA 5FJPA 5HULA 3EWYA 3L68A 4KFPA 3EUB3 5I5RA 2X50A 1VFLA 4BFAA 3M0VA 3DGRA 3KS5A 4WJ8A 1WUEA 2Y2WA 4AZGA 4M5PA 3FN9A 4RPPA 3WLRA 3LOTA 1AL7A 1R7AA 3S9YA 4CVWA 3SQPA 1ZAIA 2OO6A 3EB2A 3GVVA 4IP7A 4C6QA 2X16A 3WF2A 1TUXA 3WF1A 3NYDA 4CGTA 2R1MA 3VIJA 1J0HA 4BQ5A 3R4IA 2XHYA 1JRPA 3BAWA 2DP3A 4ML9A 4KMQA 1KKOA 2A3CA 5FD0A 4ZXOA 4O0QA 1M53A 2DW6A 2DVXA 3SN4A 4ZR8A 3LRMA 2XUCA 3VFCA 4QDWA 2VC5A 4M6VA 4IM4A 1XG4A 3NCOA 3TVAA 1ONFA 1OX5A 1UR2A 2W6RA 3GTXA 1DKWA 4LT9A 4GO8A 2FB3A 1ZLPA 3MVIA 3W0KA 5G4WA 3VDGA 2GYIA 1P6WA 4QS6A 1LG1A 2XVLA 2Z7GA 3ZR4A 1R85A 2C14A 3BLKA 4UTJA 4CLMA 1B3YA 1IIGA 1LT8A 2BBFA 3A13A 1EGVA 2GQAA 3BOLA 3QHMA 2X41A 2YSWA 2IKJA 1MDRA 2JK2A 1GKRA 2GQ8A 5LIWX 4MM1A 3Q58A 2I5IA 3PFMA 1DYSA 4EWND 2YJQA 2CC0A 1R3WA 3JW7A 5C0QA 3QEZA 1V5XA 2QT3A 2QW5A 1H5YA 3EXSA 3AHZA 3N9SA 1B9BA 5LIUX 2PDJA 4HA1A 4Y90A 3H6OA 1PZ3A 5MKGA 3E1F1 1WA3A 4KWVA 5FIPA 1EKOA 1VRXA 1QT1A 2J9XA 2VEKA 4C7FA 5EMUA 1ZMDA 3AROA 1J8VA 4DEFA 2FVLA 1YQZA 3QJAA 3E3HA 3M7WA 3SM0A 4S3DA 1U1HA 3IV3A 4ZB2A 3AFBA 1RPKA 1RALA 2WPCA 2RGMA 1YRRA 1VR6A 1IR2A 2VR4A 3WD0A 4PFHA 2Q01A 1XLEA 4L80A 1F8WA 1QK0A 4TR9A 1FFVC 1GRAA 3FA5A 3AO0A 2X0SA 3MANA 3PTQA 4RR4A 4J1OA 1XJBA 2C7FA 1J0IA 4AD1A 3O63A 1PB0A 3LPPA 2X05A 4PEEA 5HNUA 3ITYA 5BZAA 3WNKA 2WBAA 3DBNA 3FJ4A 4A3UA 3WH9A 1V6UA 4D6EA 4UWMA 2RFGA 3R10A 1OGGA 4E4FA 3K4WA 3UZ5A 4C6IA 3DHDA 3RM8A 1TTQA 4PC8A 2DT1A 4LUTB 1FOBA 2NW0A 1GQLA 3QZAA 4GH1A 2YVJA 2VUYA 5LKYA 3EBVA 1J4EA 3POHA 2GQWA 3H2AA 3C8NA 5EMKA 3S2NA 3GRSA 1FWGC 1E3ZA 2JQXA 2A7NA 3MI6A 1O95A 4ROQA 1G4PA 5CZ0A 5XIMA 7TAAA 1BSLA 3ZZ1A 3BARA 3RX3A 5FACA 1E1CA 1XIHA 3TC6A 3DHUA 3NOYA 3P84A 2IPWA 2ZADA 3FX4A 2C0HA 1NY1A 3AUOA 3W7QA 4S39A 4O0ZA 4M81A 3WQOA 1E0WA 5DXXA 4RV8A 4YYCA 1H1ZA 2DSVA 3OVGA 3NJ3A 1OX4A 5REQB 1VB9A 3QTPA 4XQ6A 3OB8A 2V3AA 4WCJA 2OLAA 4FALA 1W31A 4YTQA 1B2YA 1NTHA 3VKCA 3M16A 3W87A 5AHLA 5DRIA 1TELA 3ISIX 3L5LA 3O6CA 2ZCGA 3V3WA 1RCXB 6ENLA 3ARRA 1NDZA 4LANA 2G8ZA 3AYTA 2DSKA 3TN5A 2C3DA 4L61A 4LYQA 2DZPA 5K9XA 4XTIA 1VC4A 3AZRA 3VCNA 3FDKA 4FLRA 3LLDA 1GJUA 3S5SA 1ZMCA 3EPMA 1BWKA 1GJWA 4C91A 3SJ3A 4UQEA 2QGYA 3H2OA 2YW4A 2AL1A 2D23A 5CSRA 2DZVA 2IXVA 3U2OA 3F5KA 1SMAA 3BCDA 4HU4A 2HTMA 1PO9A 1JGMA 3H53A 1IEWA 3IJ8A 4YTRA 2Y4SA 4UCGA 2DT0A 3GKFA 1U5JA 3W6LA 1MFUA 3CL8A 4AX6A 2OOFA 2BVTA 2OGYA 4HYRA 3YPIA 3J7HA 3CPRA 3RCNA 2J7GA 4H19A 3STFA 4M8UA 2E6AA 4QDMA 5BWAA 5K7JA 1W9XA 3SY8A 2DT2A 1IV8A 3LXAA 3QF0A 1TA3A 1GESA 1UD6A 3NO5A 1H60A 4Z17A 3FAWA 2QJIA 5HMFA 3A47A 4RDVA 4LC8A 1NFBA 1BG9A 3TXZA 2D2JA 3TYZA 2VP8A 1KBIA 5LHFA 4MWAD 2BV9A 1JZ7A 2J27A 3C3UA 3SCQA 3ZO9A 1VFSA 4A22A 2E7FA 3BJTA 4LAKA 4Y2WA 4KEZA 3VAVA 4CCZA 3VOCA 4Z1BA 2Z1XA 2EPOA 1YIXA 2VRQA 3CL7A 4UTHA 4XV0A 3VC6A 2AKMA 3AYRA 4HP5A 3TE9A 1EX5A 3LHZA 1XYLA 2F2HA 1XH2A 1UR3M 4DPPA 3VK5A 4BV6A 1TCMA 3VIMA 1REQA 5DCBA 3EAUA 2NQ9A 1CNVA 4IL2A 1I0BA 2DUAA 1KLYA 2NT0A 2O55A 3CHDA 2PDWA 1ISVA 3RRAA 3FYYA 4M29A 4LRTA 1QDSA 3UG3A 3VD4A 4FX9A 2IUZA 1QNPA 2Y5JA 3AMLA 5FA5A 2HBVA 1TWSA 3QZEA 4JZ5A 1W5PA 2TMDA 1H7WA 3Q2DA 4OTKA 1R9ZA 4H7CA 4MMWA 1XYBA 3DESA 2HPMA 2ZFAA 1ZAHA 3BDKA 3CL6A 5TR3A 4LF1A 4OQVA 2C3ZA 1J6PA 1SW7A 5JBEA 3TYDA 1JCMP 2RABA 3NQFA 1ISYA 3URQA 4MUPA 2VHLA 3THCA 4RUBA 2W3RA 2YXXA 3N4FA 1Q66A 3T0AA 4GINA 3WH8A 4NJJA 1HL9A 3N11A 5EKYA 5JCKA 2EPNA 3SCVA 3K2GA 4M7TA 4TV5A 5BRQA 3QLLA 3GSMA 4X2RA 2PDBA 3M0JA 3CB8A 3VTRA 3GXMA 3AISA 4GACA 4CCEA 2IKIA 5AFDA 1M04A 3LLFA 4AZCA 2C1IA 3GH5A 1J9YA 4C6CA 2F2KA 3M41A 2ZZ4A 4QP0A 4KWWA 1L8NA 3B4UA 2V2CA 4DZIA 4X61A 3WD2A 3GC2A 2FGBA 1WKYA 3SFKA 1DWFM 1ALDA 1WBJA 2R1KA 5LYRA 3GNNA 4UZUA 3LHUA 4CKQA 3MMWA 3TNOA 2Y7GA 1XRTA 1K7FA 1FWIC 3H21A 1XLIA 2Z26A 3WBXA 2BWGA 1WAWA 3WLSA 4MWAB 3IAPA 2CBJA 2W91A 1Q4NX 2ABAA 1Z89A 3TTEA 2BGQA 2PD5A 3DI0A 5CPNA 2ABBA 3VDCA 4C6EA 5A6AA 3MMUA 4H41A 4ZODA 2AQWA 2XYLA 3PZMA 1UKSA 2X0YA 1VEMA 3STPA 2D73A 1AODA 1HJXA 4EOUA 3MO4A 3AXMA 3S83A 4EIVA 3GVRA 2R8WA 2I17A 1PWMA 1P7TB 4GXWA 3GDRA 1ZB5A 1Q6LA 2F38A 1FWHC 5I6SA 2CU0A 1CTNA 3KWXA 2TODA 3AXIA 4CVUA 3LHTA 1V6WA 3CJPA 3BANA 5MF5A 2A3BA 4JX4A 2BCPA 1JEZA 3FJLA 3STGA 3R13A 3RK8A 3GHSA 1KFBA 4B5WA 4B92A 3ITLA 2ZUVA 5ABFA 4G8TA 1LG2A 1O12A 3RUBL 4E4UA 3UZXA 4JTTA 2D2GA 4I6KA 3MMTA 4HOXA 3A9IA 1BVWA 3TK7A 1Z69A 3BAJA 2PWVA 1I8JA 3PBWA 1NDAA 1XIMA 4XAYA 3L4YA 3WJXA 1OIFA 2EJ1A 1OF6A 1BKHA 3UVAA 2W27A 1GG0A 4C6NA 4O1FA 3IANA 4RZ4A 4ORMA 1TVNA 1V0KA 4NI3A 2CBVA 2Y7FA 1JCXA 5A6SA 5A2CA 2QQ6A 3M44A 1SJCA 3HV9A 4JTCA 2IPFA 3MWAA 1J79A 1GCYA 3WZ0E 1VPYA 2DIJA 2VGFA 1GVYA 5KZMA 1H7NA 3NQMA 4Q6XA 5HWMA 1ZK7A 5D2YA 3F7JA 4XAGA 1GOKA 2ZICA 1XI3A 2A85A 2IPJA 4W8BA 4MJMA 3W27A 1ISWA 3EDEA 1QCWA 3WDRA 3LADA 1GHRA 5SWUA 5AVNA 2WNZA 2F8QA 2BB0A 6CGTA 3NZGA 1DJGA 4GC3A 4JTAA 4H8UA 4RV3A 3G22A 4L9XA 4O8RA 3BW3A 3ZWSA 5C55A 5JCNA 4XZNX 4QLLA 4HTYA 1TRDA 3O9NA 1KM2A 1KWKA 4JN6A 1KTNA 1GPWA 4UBPC 3FYOA 2PTYA 2FDSA 3SN0A 4NAEB 3KBVA 3V1PA 4WJXA 2GQ3A 4LNYA 2XGZA 2GK1B 3A6OA 1F74A 3PB0A 4IP5A 5CZTA 5F2GA 3MY9A 3SIZA 1A5KC 4W4QA 1XSIA 2WKJA 3TNBA 5EMLA 2ATSA 1N82A 5KITA 2YCIX 4WR3A 4O14A 4RW3A 4ZTXA 3GTIA 4BHYA 3BMVA 3P0XA 2O7QA 3PY2A 3LMYA 3THUA 3WK3A 1W3KA 1XL9A 2DZWA 4GYFA 7REQB 3TJXA 3VE7A 4W7UA 2P0OA 4QEEA 2JKAA 4KQNA 1W8SA 3N2TA 4QG8A 3W7LA 1KCZA 1R87A 3W81A 3WQGA 1GV4A 3KRUA 1E4LA 4Q7NA 1Z7AA 3QQ1A 1EA0A 3CYJA 5JU6A 1DJXA 4IGHA 1QXLA 1BTMA 4JIPA 4O50A 1ITQA 3GKAA 1PX3A 1I2PA 4WSHA 1Q85A 4HU8A 3VIKA 3SN1A 1W3LA 4Q4SA 1UR0A 1A47A 2ZZ5A 1W9DM 5KVHA 1N62C 1TJ1A 3BLLA 4ZE4A 4DLMA 4MY1A 4JKMA 2EAWA 1UC4A 5DBTA 2PGEA 2Q09A 2PUZA 3TC3A 3OPSA 4EPKA 3W75A 3PBYA 1D9EA 3BZJA 1IHIA 3UXDA 2QYGA 2Z1WA 1F2JA 1DORA 4JQ9A 1S38A 4WD0A 1NH6A 1T7LA 1HJVA 4FI4A 1RR2A 4M52A 3D6NA 1CT5A 3LTSA 4HN8A 1G94A 4YWOA 5GRTA 3GFXA 1SW3A 3AAMA 4AMAA 5T26A 2YIHA 2J77A 4A29A 1PCWA 3R8RA 4CNNA 3R94A 2Q71A 2QDDA 4MZ8A 2OX1A 5HPOA 1UBSA 3GG8A 3ANYA 1QOPA 3KAOA 3WENA 3CS2A 3EKGA 1GONA 2CLMA 3I6EA 1GZGA 3QSRA 2BGSA 2Y5SA 4Q4OA 4ALDA 3SY5A 4KRUA 4M0XA 2WMFA 3WSUA 3H2CA 3UWYA 1LLWA 4NASA 3RLGA 4H4YA 3CQ0A 4EMJA 4GUHA 1DXEA 1XC6A 4BI7A 3CU2A 3REQA 3I6RA 3L4VA 5A6JA 1FHUA 5D9MA 3GE7A 1FCQA 1B5TA 1GVIA 2AGKA 3BC9A 3B06A 3M6YA 2WW5A 3EPOA 2FHFA 3K1DA 4AAJA 2E3TA 4IFRA 5KTLA 2XVPA 3WL0A 4TTGA 1IXPA 2CCRA 4LAUA 3HU7A 1DWHM 3DAQA 1ML1A 1BFNA 4GIAA 5JVLA 1XCXA 2FFIA 3UWWA 1ITCA 3DECA 3TOYA 5LNRA 3KL3A 2J74A 2G41A 4O19A 1JF6A 3P5ZA 3UR5A 4ZOCA 2WC4A 5AY7A 4OECA 1U22A 3SR6B 1VFOA 1H1YA 4LGXA 3H8AA 4LAOA 3QFEA 5JCMA 4YVPA 1R2RA 3SQSA 1MW1A 1Q45A 1US2A 3VD7A 7ENLA 3WLOA 4FNPA 4IUOA 5LZLA 3LD5A 3GY1A 1X98A 4TXEA 4P7OA 4BK9A 3PZNA 2ZTKA 3B9EA 2Z1BA 1PV8A 2RGLA 4JDBA 1OFRA 3RMJA 1UB3A 1FFRA 2ZUMA 3S5YA 2ZE0A 3EEGA 4HHLA 1XGDA 3WQCA 4GO9A 2G37A 4GY0A 3HMJG 3AIBA 3U2EA 4H9UA 4EXAA 4FSAA 3F2BA 2WSPA 2FTWA 1JR1A 2ZXQA 2HSAA 5AYIA 3T44A 3WUFA 3SUWA 3WQPA 3FAXA 3CUJA 1SW0A 3W7IA 4WKFA 3PAOA 1OK4A 1Q7ZA 4D6HA 3H4WA 2ZZBA 3ZJ6A 1SJAA 3ATZA 3ATYA 4ATDA 2R9ZA 5TF0A 1XIFA 4C1NB 4D1JA 3WK1A 3WG6A 3LM3A 1LLOA 4HHMA 2OVLA 3SCRA 4EPBC 3EEZA 3MJMA 4ZEPA 5FMHA 3P8IA 1GOIA 5EB8A 2W9MA 4MZYA 4DNHA 3B05A 1FH9A 3LXBA 4RDWA 4DYJA 5T8GA 1LPFA 3NSMA 4PUKA 1BRLB 4IX2A 5CBJA 1IWAA 3RGTA 1EPXA 5LNVA 1DWGM 4YPJA 2GOKA 4UNIA 1TPB1 1E1EA 1ISXA 4AF0B 3L4ZA 4C6OA 3SCNA 1J01A 3NQ7A 1M6JA 2V5DA 4NZFA 4CUCA 2G4JA 4Q4QA 5BYWA 4NSBA 3A24A 1N61C 1EJTC 3QM3A 4L1WA 1BF2A 3ITGA 4WJEA 1XIGA 3TFCA 1XDLA 1IF2A 4NIRA 4XKYB 4HCHA 4GLEA 3KRSA 2GOUA 2OGJA 3N04A 4DLFA 3TDFA 3D9XA 1UD4A 1XDIA 1LP6A 1FWFC 1ZP4A 1Q3NA 2I5QA 4V33A 1OJXA 4FDCB 1TJPA 3QYQA 4NEVA 5D02A 3NDYA 3QPYA 2VMFA 2A5HA 1OZMA 2JFEX 1GQNA 2ZKMX 1K4GA 4F0RA 2PLJA 1WO2A 4LY8A 3G0XA 3TA6A 3CGTA 3WQ4A 3RPMA 1UKOA 2CKSA 1FTXA 1TE6A 2IQTA 2CBIA 1IEVA 3CIVA 5J5DA 1XRVA 1YTEA 2QXWA 3GFZA 2ZX8A 1EO5A 3LB0A 4AHQA 4RE3A 2A3EA 2PDCA 2GJXA 3UG4A 2J8GA 4ZO7A 3OBEA 3OZOA 3IGSA 3JVAA 1R6WA 2AKZA 2WJFA 4Z1CA 3OOQA 2YX0A 3AHYA 3UG8A 3ARTA 1Q6GA 5A94A 3QGVA 1OSEA 3VOFA 1N2VA 4J3TA 1ME8A 1GTEA 4FZIA 3QH2A 1L2UA 3HPFA 1FHDA 3S1GA 5KSWA 5JBFA 2HPIA 3QFAA 1LTDA 2RH9A 3W7OA 4PTMA 4IIBA 3CM4A 2YXOA 1DOSA 3R58A 1B0IA 1I45A 4DWSB 1OG6A 3IJIA 3CO8A 2QJHA 1HX0A 2POZA 2ZC1A 3ALGA 2PDYA 1ITXA 1TPEA 4MJ4A 1X1ZA 2A3AA 5DY3A 5F4XA 4ADTA 3W00A 2XFYA 4ACZB 3SAZA 3CEPA 4HA0A 5LNWA 5G4EA 1TPUA 1C29A 5FL1A 5JH2A 2ZUWA 4JTEA 1UZ1A 1EDTA 4RLIA 3PJUA 4PULA 5I24A 1W6TA 4ZOBA 1JPDX 3FA4A 5I02A 3BMWA 3WQDA 2NV9A 1F6YA 1JOAA 4CNTA 4I7VA 2W63A 3L21A 1JDDA 1FWRA 4H9YA 4YVXA 5FS7A 1S1RA 4BWLA 5E09A 3C2RA 3KTXA 2OEJA 4JQAA 1PZ2A 3CWOX 4A3YA 3ITOA 2YBUA 1JXJA 3WNPA 1K8YA 1ZX9A 2GJLA 4K8GA 4DJEA 4OUEA 4BI5A 4YCOA 2P0IA 4ZBCA 2BG5A 3VABA 1EGMA 2QAPA 2HNHA 2QV4A 2BDQA 2XJ7A 3M0IA 5CPLA 2C16A 4JXCA 4QNEA 5LIKX 3K4DA 3VGFA 1EEPA 2EKCA 4RDZA 4HD5A 2WHMA 4AB4A 1GTHA 2OODA 1MNSA 3HJZA 4L6DA 4DXVA 3VUSA 1ADSA 1Q6FA 2INZA 1VD6A 2VVNA 1AFSA 4QR6A 2WNQA 5HATA 2B0MA 4KGJA 3SIMA 3HBLA 3UYCA 3EWZA 1ZJAA 4L9YA 1CI1A 2E67A 1H62A 4LH8A 3NYZA 1PIIA 3BG5A 1OC6A 2O4QA 1GQKA 3UR2A 4H8HA 1P1MA 4QG6A 2YCEA 2VZSA 2ACSA 3P3BA 4J2MA 5F2IA 2CPUA 1KFJA 2Y62A 3WFZA 3L7RA 3O7UA 3ZLGA 2BHZA 4XUGA 1MW2A 3A12A 4UNLA 4CNOA 4H4ZA 3NQVA 2CDUA 1JL8A 3QY6A 4EM4A 4NF7A 4B3LA 4R7WA 3WO8A 1K6WA 4ZB0A 4MLRA 3WNMA 1K03A 1UHVA 1YE6A 3GG0A 3W7EA 4ZOEA 2V30A 3BO9A 1A5AA 1YXDA 2L5HA 1KXQA 1XFCA 3R43A 4NZ5A 3QXBA 2NXGA 1M68A 3G5EA 1CX9A 4F4RA 1UPMB 1MUWA 3QV7A 1VS1A 1N8FA 3VINA 2BP1A 2VGBA 3TJIA 2GJNA 3PWIA 2G3IA 4UTTC 3BCJA 1E9IA 1XYZA 4IT1A 1HKWA 2FPVA 1T0OA 5C7HA 4AWUA 5AHIA 1OY0A 4FOUA 1W9UA 4AU0A 3GAKA 4XZIA 2D0HA 5H6HA 3NQ8A 2EG7A 2P1FA 3DH9A 2PS2A 2POTA 1MRQA 2ZZ3A 4UFHA 3OTRA 3NDOA 4JIEA 2ZIDA 4Y6GA 5A5WA 1FWSA 3B03A 2QDEA 1ZDLA 2WNNA 2VL4A 3RRXA 2XIIA 4JDRA 2BSLA 3DK9A 3CUZA 4OV9A 2XN0A 3EWUA 3L0NA 4Q4KA 1XLBA 4H9ZA 4KETA 1XPGA 3W7KA 2O9TA 4GQBA 4WY0F 1T5AA 4LVFA 3WJWA 4ILSA 3VOJA 3PUGA 1DHPA 4IMEA 2ZA1A 3S2CA 3PB2A 4QBXA 1GKQA 2X42A 2G95A 3SW6A 1B3OA 2KAUC 2FMNA 2DZUA 1S5NA 4URIA 1ZRQA 5D09A 4Q8TA 3MP4A 1JPHA 1R9XA 1KM3A 1HJUA 4P5UA 4CD7A 2E40A 4QJ1A 5C54A 4C6KA 2Q6ZA 1PTDA 2VELA 3CAVA 4UTKA 5I3GA 1RPXA 5L6UA 2XGBA 1T8QA 3MUCA 3FEQA 4HSOA 5H8PA 2W4XA 5E93A 4PTXA 2DVTA 4YXGA 2HROA 5AN7A 1XBZA 4IQJA 1ICPA 3APGA 5HWNA 3A7AA 2PWUA 1AQMA 3E5PA 5FS9A 2PZNA 1EH9A 4HYVA 4E3VA 2WKGA 3WYZA 4UR8A 3G18A 2G4FA 4I9AA 2NQLA 3D3AA 4UB9A 5T91A 4UTMA 2ZTJA 1OFAA 3OODA 4C7GA 4GXPA 2C6QA 5I78A 3BAYA 3KWSA 3B04A 3TROA 2WVSA 3UXKA 1TR1A 1QI4A 1TX0A 1EA9C 4KCWA 4LYKA 3U7BA 1SQ7A 3QY7A 2OSWA 2VI0A 4AWEA 4PTDA 1GEHA 1NHSA 5FEPA 3IWPA 2NXHA 3DGZA 3KTCA 3L0GA 2EPHA 3WF3A 3EDKA 5RUBA 2BOEX 3C0JA 3LNMA 3A3WA 4QE4A 4YTTA 1YKWA 4OT7A 5D2VA 5KMYA 3UPWA 2V3DA 1HKIA 1G7VA 5HA7A 1BXNA 2PF0A 2PDXA 3LRKA 1HN1A 4R9XA 2YZRA 2GRTA 1IEXA 4OUIA 4IISA 3GR8A 1X6NA 2X1TA 4U3AA 3V5FA 4P7LA 3UWUA 2YB1A 2NQJA 1QW7A 3GXTA 2R91A 4K38A 1DPMA 3I68A 3CV7A 4C6JA 4FIRA 4IHCA 1W5NA 2P76A 2YL9A 2Z1KA 4QE1A 3W1AA 2PLMA 1GVRA 4E5TA 3QV9A 3CMFA 2J6XA 4AHOA 3MWCA 3V1HA 3T8QA 2GUYA 3LXCA 4RL3A 3VM7A 2E5BA 1PVNA 3PG6A 2J9ZA 4MNKA 3GS6A 1NSJA 4RXGA 3SJNA 2X1SA 3UNTA 4W5UA 2NUYA 1VPQA 4IFKA 5FEXA 2W67A 2Y63A 4O4VA 3RLUA 1YBQB 3HA1A 1JAEA 3TTYA 2VX5A 1KWGA 3W88A 3UETA 4FLQA 3W84A 3TKFA 3LCLA 1GZJA 3KP0A 3EGJA 3WLPA 1UD8A 4ERAA 5LSMA 2ZRUA 3XINA 4XO6A 1A0CA 2I9EA 2Q8XA 3NVWB 3ARVA 1BGGA 3O3RA 3A9BA 3LPFA 3QOMA 3T2OA 4HNUA 3UFYA 1XYMA 4JTQA 3NZPA 2RDWA 3BW4A 3FCPA 4Q4PA 1IEQA 3W4RA 2CBUA 4TMCA 1C93A 2WJZA 1EWDA 4AD5A 4A4AA 2WV8A 2CWNA 4UCFA 2NUWA 5EL1A 2ONEA 1QNQA 1QATA 3T6CA 3S4TA 3GHRA 3RXZA 2ZDRA 1MUCA 3C4UA 1VENA 3V75A 1E1CB 3N1AA 1WZLA 4K8DA 5KETA 1NOWA 4MUZA 1EXBA 3XISA 3B8DA 1DIKA 4Z08A 4HPJA 4HNLA 1EIXA 1GUVA 3W1UA 4LBSA 3QV6A 3CXOA 3F2CA 4L6OA 1N7KA 1US3A 4K1WA 4BR1A 3ABSA 1SFLA 2VWSA 3HG4A 1TWWA 1EYEA 4K7VA 3VKAA 1NWRA 1OX4B 1EJWC 3DG7A 4KF1A 1TZ7A 4IIEA 1WDSA 4PTWA 3NGJA 2DZTA 4YVVA 1A3WA 1A80A 3H2MA 5C9RA 4JHZA 1DP0A 3TJLA 1KFLA 4MWAA 4TTUA 1J0KA 3IGUA 2CIPA 3TUUA 4ENLA 4BQ2A 3CYVA 4IQDA 1YLVA 5G5IA 3W02A 1F61A 3MUAA 4CNUA 4PE8A 1CW2A 1ZBVA 1X6UA 2WAGA 1QR7A 4FK9A 4O1EA 1NWSA 3OBAA 1FCVA 2ESCA 4M56A 3CHFA 4IFOA 4Q8VA 3NA8A 3TIMA 1DEDA 5AYBA 4UTLA 1KBBA 1SVDA 1C92A 1CGXA 1MYRA 4EPEC 4C65A 3OU8A 1PCKA 4JKLA 1Y5WA 5G2HA 2Z2BA 1QI3A 1Q7MA 4AUBA 2YDSA 4NEWA 3KVKA 1RJRA 3EWCA 3I3DA 3U0HA 4QS5A 2EKGA 4IJCA 1F05A 2A8XA 5GNYA 4D6JA 2Z1SA 3D47A 3GBEA 4ZOAA 2YPIA 4LUYA 3HRDC 3DEQA 1STZA 2H9AB 3DFHA 3II4A 3KBSA 3L9CA 1ZTVA 2Y88A 3OJGA 4B16A 1TA3B 5CZJA 2E1DA 4BEQA 5EFDA 4QXIA 3B9OA 4N4QA 4QDPA 1IT8A 1KW1A 2PU1A 5A8PA 1TKKA 5FF4A 3IVUA 3MJYA 2QUMA 1RXOB 1TWIA 1AVAA 3D3FA 2FZ9A 3B0VC 3PSVA 2WM1A 2Z27A 4U10A 2WZTA 3M0LA 1PX4A 3G1FA 5DCDA 4GG9A 2D2OA 3W2MA 4IMAA 1PJ9A 4DO6A 4S3GA 5A95A 1N55A 4BURA 4NX5A 3M07A 2GR0A 2XINA 4L56A 3WLJA 1XKYA 4IMCA 1Q1WA 2XU2A 2PDQA 3R8HA 5B80A 3OGVA 3QOKA 1HKMA 4AX7A 4I7UA 4ZTYA 3K46A 4GY1A 1V93A 3KEHA 2DSWA 3QVQA 3BURA 1O7AA 5CBBA 1X39A 1L0PA 2C15A 4O13A 1O5RA 1O68A 1UR8A 4GXMA 3CXBA 1TSIA 2NSOA 1AZ2A 3NQGA 4FO4A 1TJ2A 3T1GA 4L1GA 4JIRA 2Y70A 4HBKA 3I7SA 3GW0A 4CD6A 2VOMA 1J0ZA 4N4PA 2QMKA 3ETRB 4S3KA 2XVKA 4N7QA 4DJFD 4NL1A 3V5CA 4B5TA 4S2BA 3W1RA 5HNNA 4A8NA 4G5DA 5CQ1A 2OJPA 3W73A 3MSGA 3K30A 1SM9A 4AZ5A 2C13A 1SZNA 4EK7A 1H7XA 3QLDA 2X1UA 3NL2A 1KNWA 1EB3A 1F3TA 5TQLA 4FNUA 1NOUA 2E25A 1CXFA 3W23A 1Z32X 3LA4A 2TPRA 3B9NA 2DU2A 2BOGX 3LG3A 2J6VA 2ZRWA 3KL0A 3LK6A 3UJEA 2WLYA 1P43A 4WGXA 3GXNA 4HNNA 2CWXA 5EYWA 4US5A 5IDZA 1LRTA 2GK1A 4U5IA 5C7VA 1OGBA 1NHRA 2UBPC 1IWBA 2D1ZA 1VYPX 3H7UA 4PMUA 1WZKA 2PLCA 3NFUA 1XH1A 4E8DA 1XBYA 5M2FX 4GD0A 3T0CA 1JGIA 1QWKA 4JTUA 4HMNA 1MQQA 3PZIA 4LY4A 5C9XA 3A4AA 3EA3A 4PMOA 2GVLA 2FMOA 2XH7A 3ELFA 4KEUA 1MEHA 1XINA 5CZKA 1GVQA 4MY9A 1U2YA 4TX9A 2GSEA 5LXXA 2W55A 2O0TA 4W93A 5FJTA 3GC4A 2VGGA 4R53A 1QAPA 4LS0A 3WQ6A 3UJSA 3USBA 7PTDA 3M0HA 2TSYA 4LWWA 4AVOA 3NS1B 3IK4A 3PAJA 2Z29A 2HMCA 2FIQA 1KBJA 5U25A 2QUNA 3T0BA 1LROA 4DNMA 1UWIA 1GGOA 1BZLA 1DIDA 3LHWA 1NF0A 1X2HA 2BGNE 4WIWA 2ZOXA 3GO2A 1ONRA 1RHCA 5G1MA 3EPNA 1RLDA 1UKPA 4L64A 1C8QA 5CG7A 1VF8A 4GJ1A 3N2MA 1ADOA 2O4MA 3G24A 4FIQA 4S2CA 1YMYA 1EFZA 2QMJA 3L12A 4DF1A 1QI0A 1SO3A 4CD5A 4FOJA 3O06A 2J4GA 4QISA 5U4NA 2PU0A 1BKSA 6XIMA 3NPXA 1HT6A 3LXDA 1UUOA 2WPBA 2ISDA 2O9RA 5ABFB 5LXEA 1XXXA 4GGBA 2VEFA 3OYZA 1YNYA 4YLWA 4HOZA 2EEXA 5BCAA 1UIPA 3OVQA 5C9WA 3CZJA 1FA2A 5C5YA 4PMRA 4QIUA 3B8IA 1FVPA 2REQB 2F6KA 2VEGA 3INPA 1OX6A 5C2CA 2VFGA 1WV2A 3R5EA 4XD4A 3HGOA 4QFUA 2DZXA 3CGBA 4QAIA 1UD3A 1UWSA 2ZX9A 4MVAA 3GU1A 3ZFHA 1TV2A 3AOFA 2XIOA 1DTUA 3WDPP 5E5CA 1TYTA 1B54A 1LQ2A 1Z44A 2W66A 4XX6A 1S3HA 4PCSA 3G1YA 4GUJA 2OG9A 4G7EB 4UR9A 1AL8A 1MXDA 2EG8A 4H8VA 3TW9A 4HPHA 4O54A 5E6YA 1YW1A 2CLIA 4M6UA 3GNPA 3LTYA 4DYEA 2Z2UA 4H8NA 5HANA 4A8IA 5EFFA 3AYSA 1TPDA 3BJSA 3MO7A 4OE7A 3RMEA 5XIAA 3IARA 4AEOA 1VQZA 3NPWA 2OR2A 1UOZA 3N2OA 4AY8A 3IUDA 1XICA 2HWGA 3N6HA 1EP2A 2PDIA 2RKXA 1F5ZA 1RQEA 4EANA 4H9VA 5FJRA 2BY2A 1S5VA 5ABGA 2NX1A 2E1WA 1XV8A 4S3JA 5FL0A 3AS3A 1ICSA 2HEJA 1UWQA 5E6ZA 3CUFA 1QVBA 1TJ0A 3VGDA 1HO1A 2OEKA 2V63A 3GUGA 3L2MA 4UQ9A 3LQGA 4KCTA 4LU0A 4GNKB 4IIGA 2GUUA 2PWDA 3V16A 1K9EA 3WKZA 3HIJA 5E1QA 3WQWA 4DBEA 4PB3A 4GVFA 3RCMA 3RAOA 3CT2A 3MV01 2J25A 1V4YA 3V18A 5CCZA 1K7XA 1KO0A 4I8YA 1X6LA 3CHEA 3WL1A 2FHBA 3GH4A 1KCLA 4PBFA 3OBKA 4LCRA 3W82A 1TZ9A 1SR9A 3SBFA 4QQUA 2J75A 5U1OA 3UY7A 3T55A 3SUTA 3EX4A 1TG7A 2I14A 3AIQA 3BGJA 4CQCA 3EANA 3WMBA 1CBGA 1OC5A 5DFAA 2YA0A 5I23A 3ZSTA 1LCOA 3L2IA 3NVDA 4L65A 3B8WA 3L66A 3DFOA 1VRDA 5A8NA 3GZAA 1G69A 4XD6A 5DT5A 2X0HA 4BF5A 1EJSC 1UA3A 3V0SA 1R0MA 5A6LA 1CLXA 4X22A 4C1NA 1DXFA 4RNJA 3ZSSA 1JFXA 4GFIA 1WDDA 1V02A 4JN7A 3N12A 3CAKA 3ZM8A 3A64A 1GHSA 2HXUA 3RYSA 1IXNA 1MEIA 1OD8A 3HO8A 3QMSA 1OG0A 5K2ZA 1I2RA 2QJNA 1LYXA 3I4EA 1CLKA 2EPKX 4C6BA 3PR2A 2CESA 3WQVA 3U48A 3VZXA 3MSDA 3ABQA 3H4KA 1H11A 1W1B1 3FSTA 2V38A 4K2SA 1KV5A 3URHA 3DUGA 3PWAA 3SCTA 2GGGA 3VKJA 1DJIA 1RK6A 5BU9A 4B91A 2X8CA 4ZSUA 3EB4A 2ZWYA 4NXKA 3LTPA 3CEUA 2PODA 1FWDC 3PF3A 1FDJA 4J3VA 1NOFA 2Y5EA 4QJ3B 2PAJA 1N8WA 5D2XA 3GWQA 2XH0A 4XKYA 3VO0A 1ZY8A 3H26A 4X63A 5TNVA 3BE7A 2Z25A 1UWTA 1R47A 4GYPA 5GNXA 2AAQA 4O52A 1WKDA 3VIGA 2CFYA 2Q02A 1F3EA 3GVGA 3VGBA 4MPKA 3EDDA 5F1UA 2ZXBA 1JROA 1XISA 5FF3A 3HPSA 1F4HA 5GJPA 3BLEA 3UVIA 1V0LA 2ANUA 3MV11 3VCRA 5G4HC 1RLCL 1PTAA 5BNKA 2OWWA 1GQIA 1NWUA 1GVSA 2CEQA 2SFPA 1TO3A 4O10A 7ODCA 2YGYA 3GG7A 3REQB 1TPFA 1PS9A 1LL7A 3BSMA 4LSBA 3M5VA 5HR7A 2ZZ1A 3R7MA 1XUZA 5DMMA 3A7RA 5EY5A 5HXMA 3M43A 4ZENA 1NP2A 3VGEA 3NO1A 3FSUA 2VDIA 4EP8C 5DBUA 4LBUA 3PHAA 3A7UA 3D46A 3KS6A 4JL1A 4JTHA 5K3VA 2FKPA 2HV5A 1Q6QA 1D7KA 2B7PA 4BKNA 2F84A 3CV1A 1E72M 3VNZA 1A5UA 4DZAA 1VIZA 2J47A 1UPPA 1KRCC 2GGHA 3WLIA 1VHNA 1OT1A 3A5FA 1EUAA 1RD6A 3R12A 1Z3NA 4XB3A 3WLTA 4KT2A 2XIMA 2VDHA 3FOKA 1DQXA 4TVDA 2GWNA 1GEUA 4C6DA 4HOWA 2Q8ZA 3HG5A 5EMMA 4YWIA 3PTDA 5C71A 3SSJA 3NR0A 1FKWA 4LJ3A 1PDYA 2Y7DA 3CLWA 4M7SA 5I0DA 1WZMA 4UQDA 3OLDA 4GYJA 3VGGA 2D3LA 5TIMA 5M5DA 3AYVA 4RCXA 4XIMA 1V3IA 1CXLA 4FNTA 1L6FA 5T9BG 4S38A 1VFHA 3EB3A 3S1WA 1R30A 3WDQA 3IGXA 3EWWA 4B9YA 4GR1A 3GM8A 1QBAA 2QPUA 4MFEA 4XVDA 1W37A 1W2VA 3S6DA 1LJYA 4YN5A 4XZ9A 1EHAA 2WANA 4J9JA 2Y8VA 1RCOB 4Y9AA 3ZMRA 4E2BA 5HUOA 4TX6A 3VXGA 5I3FA 1YDOA 4AZBA 3NQ6A 1XSKA 4E0CA 1NAL1 3SO7A 3BQ6A 3MYOA 4GCXA 4Y7EA 1A0DA 1QPRA 3FG2P 3CH0A 1IIHA 1M41A 1E15A 2OEMA 2FTPA 3O15A 1FXQA 1BLIA 1GOQA 1KN0A 1SGJA 1ZUAX 5HMSA 5FCZA 1YPFA 1A3HA 3H55A 1KFCA 4FLSA 4XTDA 2V5KA 3W24A 3RNMA 4I9MA 2Y8KA 2NSXA 3WLNA 4MYAA 2RJHA 2ZQ0A 5BROA 2CZDA 4H4TA 1JUBA 4KPRA 3S9ZA 2JKPA 1H49A 4H6QA 1JNEA 3GC5A 1XIEA 3QKZA 3ENLA 4LF2A 4YS1A 1RY8A 1PYFA 1Y5VA 3MDUA 1FECA 1P0EA 3MW7A 1CCWB 4Z2GA 3MZ2A 3TZNA 5IBXC 1BG4A 2GWGA 3TZFA 1ZP3A 4OOUA 3UP8A 3PM6A 3RM9A 1P0BA 1CEOA 3OZPA 2V5CA 1AA1B 3CQKA 4LNCA 4FA3A 4QM1A 1W3TA 4MDOA 3NGFA 3GNDA 1POKA 1KM4A 3CGCA 1FCUA 1FUYA 3LZ5A 2YA2A 4LAMA 2X7WA 3BXWA 4ICCX 2PLKA 3KFTA 4DI9A 3ARYA 2QIWA 1W2PA 4CNSA 3W1NA 3WY1A 4AIBA 4GUFA 2HS8A 3MVTA 4DF0A 5AHMA 1J12A 3BPWA 1E40A 2J62A 1OYBA 3WBAA 1AMKA 3UA3A 3KBNA 4LUJA 4U33A 3VKDA 5HNRA 4ADUA 4GUGA 1V3MA 1AW1A 2V6AA 3N4EA 5CJNA 4FX6M 4TUFA 4MWAC 3OGSA 3AALA 1KRMA 1R86A 3RPDA 1X7IA 4W8AA 4ZGYA 5HAOA 1AQFA 3UXLA 1T96A 2V5BA 1F07A 2E0PA 5I03A 4QSHA 3H2FA 5FJUA 3N2XA 3U2ZA 1O1HA 2NXIA 3LHVA 1E9YB 1Q65A 2IKGA 3WQEA 2QAEA 3S42A 1MW3A 3M46A 4GX9A 2J79A 4K1GA 4LRSA 1B3XA 4ORIA 1XBXA 2WQPA 1KLZA 3ARXA 2DZAA 3QKEA 4I5RA 1DWIM 3NM1A 3NQDA 1EDQA 2WSRA 3LB8A 1L6WA 4Z2KA 3R2GA 2EXOA 1FFUC 1HFBA 2XG9A 4RK8A 1RQBA 4E3TA 1G5AA 1TIMA 2OQLA 4JNMA 1BGAA 4AIEA 2OT1A 2X1RA 3BG9A 3VFLA 1O6IA 3T08A 4N0RA 2VD9A 2XFRA 3HW2A 4XZHA 3VZYA 3ALFA 4QGCA 5D32A 3LLXA 5K9CA 4E8CA 5J04A 1CLVA 1E9LA 3TP4A 3F5JA 3GXFA 4HJWA 3CLMA 1KV8A 3JZEA 4KRZA 2DPEA 4HKPA 2WOIA 3PG8A 1RSCA 4U4MA 4QTGA 1XGEA 4JL2A 3TTQA 1XPYA 2WSQA 1IZCA 4B5VA 1NP0A 3NO3A 3O6DA 3K8KA 2XISA 2GDQA 2EGZA 1DWAM 1UG6A 2QNEA 4RZ6A 4UTWA 4LUIA 4UUIA 3TXVA 2QDGA 4LYPA 3WH5A 3WLQA 5EA9A 3EMZA 2GH5A 4F79A 3VKKA 1QFEA 3UJ2A 4N9CA 3MBFA 6REQA 3HQ1A 4G9PA 1NDWA 1N63C 4GIYA 1E51A 5C2XA 4HZ6A 4XAZA 1TV4A 2BODX 3GD6A 1B57A 3FXGA 5C9UA 3IIVA 2VFHA 4H4PA 3WN6A 4UMCA 2BNJA 1XDMA 3NQAA 2WB5A 3GUWA 1GW1A 1R5YA 2VOTA 3DG3A 1JI1A 4TIMA 1FH7A 2FLIA 4M24A 3PWGA 3S46A 1KBKA 3MUIA 4BI6A 1HL8A 3OW1A 3ZOAA 2A6NA 1EOKA 1Q6CA 5I77A 4H00A 4RE4A 3N13A 2DT3A 4JY8A 4B5SA 5IOBA 1N5WC 4JCMA 3B0XA 4O4WA 4Q7BA 2CLEA 3DFPA 5I06A 5CKSA 3O6YX 3CGDA 3AHVA 2PA6A 2PBOA 3EYPA 2ZZCA 3E0WA 2NVKX 3UG5A 1W1A1 4M80A 4NHVA 2ZVRA 2YCLA 4TO8A 1Y8BA 1BF6A 2QUVA 4NAFA 3DXIA 3MPGA 3DK4A 1TMLA 3GK0A 3OEXA 1YBQA 2QJGA 5DMYA 3W53A 1H61A 1EBGA 3NSNA 1PAMA 3WCZA 2GGJA 4W84A 4HCDA 2WXDM 1RJQA 3VZZA 4EACA 1FEBA 3IC9A 4HU3A 4ZA0A 1JDAA 3AMDA 4ICNA 1JZ6A 3DK8A 3O2LA 4XG1A 3AS2A 3VIHA 1CIUA 1PWLA 1F7BA 1CENA 2VTFA 3RU8X 2GJRA 4GOAA 4NYUA 2X8GA 4D8AA 5C8BB 1FBAA 2YFNA 4XAPA 1P0NA 1JFHA 2JGYA 8CGTA 4A35A 1XRSA 4IPIA 3TYUA 1BWVA 5JIWA 2PGFA 1M7XA 1TYGA 1D7FA 3LYEA 4OBSA 3M0KA 3EDFA 4ZQPA 3LPOA 1KM5A 5AZ0A 2Q3OA 4JFTA 1M1BA 3KHJA 4H4VA 4BQ3A 4DI8A 3AQUA 5AC6A 3NAVA 3I7RA 3SY1A 3LNPA 2EQDA 3TTSA 1BYAA 4LTSA 3F1QA 4HA3A 1ONXA 4QX4A 4ZFMA 3VDHA 5IHRA 1Q8AA 1NELA 4AIOA 3W7RA 1AK5A 1K1DA 3S2MA 1X2GA 3THQA 3POCA 1G1YA 2P53A 1ME9A 2CXGA 1ZBWA 4IIHA 2IQDA 2ZA3A 2OZTA 4F2BA 2HQAA 3OC4A 1D2KA 2A7RA 3G77A 3F2DA 2EG6A 2WOVA 1HJQA 1YEYA 1Q8JA 1HVXA 5F4SA 4E4PA 3NIYA 4CU6A 1F8IA 2P50A 4CN6A 5GQBA 4JYEA 1KXTA 4ZQNA 1OVDA 3RJYA 3W01A 3M64A 4GNJA 3A4JA 1W1VA 4AY1A 2VXNA 3ZVHA 4MZ1A 1QO5A 2PBGA 2UV8G 1JCNA 4AW7A 1B3ZA 1UJPA 3GW3A 3CIXA 4QRNA 2ACUA 1SJBA 3DFYA 3N73A 1OM0A 1S5WA 4L6HA 1EHNA 3T40A 4AVFA 3ARQA 2BXVA 1S2UA 1EJUC 1P0DA 1J0YA 3TEVA 3H4XA 1UZDA 1K9TA 4HHPA 4O1AA 3WH7A 1ZU8A 4PL2A 4DBDA 4MWAE 5DCEA 4HPGA 1E6ZA 2GGIA 1A53A 4GBDA 1FWWA 5M03A 2H9AA 2WCGA 2YQUA 4LFYA 4JR5A 4NNCA 2YR1A 2QLYA 3E2SA 3NQ2A 1UP0A 1KFKA 1P6BA 1E6SM 3C86A 1FWBC 1HG3A 4LS1A 5E0CA 2QS8A 4IJRA 3EX2A 3G2GA 1ZFJA 3HB9A 2V67A 3O0HA 1IQ8A 4CN1A 3R0DA 1XM3A 1OCBA 3EKZA 5GJMA 2C1HA 2RDUA 3SUVA 1JRBA 2WBKA 4KS0A 4MF4A 4HZMA 3HG3A 1PHQA 4KBXA 2VT0A 2X09A 1FX6A 5JXQA 3DG6A 1WOBA 1LVLA 4PTVA 4RPQA 4DBWA 4Q8OA 4PUEA 1I1WA 1DJHA 2YCJA 1CDGA 1QPOA 3K8MA 5D33A 4PUNA 3OQ8A 1B30A 5D9PA 4LVDA 3KOFA 3TR9A 2OKOA 3BOXA 2JGQA 1W5OA 4HTBA 5CZSA 4EVZA 3FGCB 2YOCA 2B4GA 3EOOA 5FAGA 4I90A 4K7YA 1G4SA 8XIAA 4IFKB 3G1SA 4Y96A 3ONBA 1UMLA 3C2VA 1FIQB 4KPLA 4J3SA 4HIBA 3F4NA 2XTKA 4FB7A 2JF7A 3WEMA 3W6MA 4ZO9A 1E56A 4ZO8A 3QC0A 4MADA 1OFOA 5EBUA 3R1ZA 2NX3A 3THDA 1LDCA 1I0DA 4HQVA 5G1TA 4BJHA 4DF2A 2VM8A 3DU0A 1YE4A 1H7RA 3QTGA 1IGWA 4AEFA 5IFTA 2Y8UA 3U7VA 4LX4A 3QBUA 4N2YA 4B2DD 2IMRA 1DTNA 4UQCA 1U5HA 4J3XA 1ELSA 2V8ZA 1SSGA 5F1VA 3ZYZA 3UCCA 3W7JA 2QJMA 6TAAA 1LOLA 3BTNA 3EXTA 1ODZA 3AXHA 4L4MA 5K9DA 3IS4A 4WF7A 4P8WA 3T09A 5K4ZA 5JCLA 2Y89A 3W85A 1V0NA 3EF6A 2OPJA 3VIIA 1AZ1A 1RA5A 1AJZA 2BHUA 2QVNA 5I00A 3GD4A 3VUPA 3W74A 5TBOA 2NWRA 1W1ZA 4L7ZA 2EQ9A 2V6OA 2LLEA 5LHEA 3G1DA 2ACQA 4JTKA 3PZOA 1HP4A 2XPKA 3N3TA 3LY0A 2ZX6A 4ZE5A 5DY2A 3Q65A 4UFLA 1CXHA 4DXKA 5KEZA 4TMBA 2VDGA 4BQ4A 1LL4A 1S2AA 5FJOA 1WE5A 4PMVA 4PGLA 1XYFA 2P8CA 3F4DA 4XIAA 2QGHA 3N6QA 1EF2A 4MOZA 3DCPA 2R82A 4AISA 4GYPC 5FS8A 2JKEA 2GPTA 4NJGA 3C2YA 4AZ6A 1HGYA 1X38A 1JUKA 1XH0A 1VBRA 1CECA 2HVNA 5FF7A 3IRDA 1MZRA 3P93A 8TIMA 4HSHA 1UASA 2VURA 2C18A 3PZQA 2NLIA 1YNPA 3S5NA 2PCQA 1ZPTA 3GDBA 4NY2A 3UT0A 3L4UA 1JEHA 3MI3A 3KHDA 3UESA 1R46A 3DIPA 4NG3A 4PB5A 3W7HA 3NL6A 4P2VA 1V59A 3KDNA 1LWJA 4US5D 3S5OA 4JIQA 5BU6A 3G8RA 2F7FA 1DBTA 4H4QA 1WNOA 3N17A 2ZZ7A 4UTUA 3WUEA 9CGTA 1V6YA 3QMTA 5FESA 4DVOA 1VJIA 4EF8A 3PBGA 4NI8A 5AC7A 1V3KA 5LGXA 2PTZA 4WY0B 1XIIA 2QCFA 2PF8A 4DBUA 1E3XA 4DJFA 4G6CA 4AXKA 2PD9A 3CB3A 4CU8A 4M3PA 1PKNA 4D6FA 4E2OA 1LWIA 2FZDA 2PGWA 1E6PA 3RU6A 4DO5A 2JBMA 2J13A 4CN4A 3IJLA 2E5DA 2GSHA 3CUHA 1Z42A 2REQA 1PL9A 3BAIA 3L23A 5XINA 1PBGA 3HQPA 3A22A 1W91A 2F6UA 4XZBA 5D30A 5HMDA 4DWSC 1GYLA 2R9RA 1BWLA 5E9AA 1V7AA 2QZRA 3AU2A 4L4OA 4DYKA 1KB3A 1YQ2A 2VFDA 1YYAA 4F0SA 3CAWA 1H1NA 2A79A 3KZPA 3B9JB 1KFEA 2CZ5A 2GVJA 3M5YA 4IP4A 1C90A 1JPMA 2YW3A 2CXEA 4G7EA 5HQMA 1DHKA 3CASA 2IXUA 3AU6A 3D0CA 3EOLA 2WOWA 4AWSA 2DDXA 5D8ZA 3AC0A 1IYXA 1TV3A 3CQHA 3S6OA 3GRIA 3KVJA 2ASHA 1LBFA 2ODOA 2I1OA 1B3WA 4GZJA 4L9ZA 1V51A 3L4XA 2Y1HA 3R79A 4PMJA 1RH9A 4ATWA 3KRBA 4FAMA 1E71M 4LVGA 3HZ3A 2AQVA 4TVWA 4HCLA 2PPGA 1HQTA 4GHRA 2PDUA 3QYSA 1POJA 2HCVA 3OVPA 3MCOA 4S3AA 2Y6ZA 4YTUA 3WX7A 2JK6A 1N8IA 3TFXA 4XD3A 3W1LA 1GERA 1D8CA 4YNGA 2VQUA 4J3ZA 4NVTA 5EMJA 3M0YA 1HXJA 4MB1A 5A8QA 4PUMA 1AOGA 3WUGA 3TYAA 4UR7A 4R7OA 1XDJA 2ZZ2A 2CW6A 3SUSA 1MOKA 1WYGA 3M5ZA 2V2HA 3W2UA 3EWBX 3ZIZA 2JIEA 4CD4A 2VNCA 5BOOA 4Q8NA 2YVFA 2GLKA 4O0KA 1EUNA 4OGZA 1BPLB 3CPUA 4DQWA 4GMEA 1NU5A 2P8BA 4IGSA 3ZT6A 4IPJA 2X8HA 4D6GA 3DOPA 3QMRA 4LIIA 2A6LA 3F4WA 4DY1A 4GISA 4N9EA 1S2TA 1TPWA 5A1AA 3C5QA 1Y5XA 3TYEA 4JFUA 3GB6A 2FZNA