4KEMA

Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
390
structure length
390
Chain Sequence
MRIVEIREQTAGIKSDIANAFIDFSQMTCSVVAVVTDVVRDGKPVIGYGFNSNGRYAAGGLLRERFIPRLMSAAPDSLLDETGENLDPFRIWTRLMTNEKPGGHGERSVAVGTIDMAVWDAVAKIAGVPLYRLLADRFRGGVADDGVWVYAAGGYYYPGKDVKALQDEMRSYRDRGYRVVKMKIGGAPLAEDLRRIDAVLEVVGSGDNLCVDANGRFDIDTAIAYGEALKPYGLFWYEEAGDPLDYALQAELAKHYDRPMATGENLFSHQDARNLIRHGGMRPDRDWLQFDCALSYGLVEYLRTLDMLKENGWSSRRVVPHGGHQMSLNIAAGLHLGGNESYPDVFKPFCGFADGIAVEDGRVRLPDLPGVGFEAKSELFATMSGLLGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
rcsb
source organism Azospirillum sp. b510
molecule tags Lyase
total genus 140
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kemA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kemA01
4MMWA 3DESA 3QTPA 3V3WA 1FHUA 4HNLA 4JHMA 3ZLGA 3ZVHA 2PU0A 3RO6A 3GD6A 3B97A 2OFJA 1MUCA 3V5CA 4ZCWA 2OX4A 3I6EA 4Z1YA 3H8AA 3T6CA 2I5QA 2QDEA 4F4RA 2PODA 5BOFA 2XSXA 3ES8A 3Q4DA 2AKZA 1MNSA 2XGZA 3CK5A 3JZUA 1W6TA 2CHRA 4DXKA 3MUCA 1EBGA 4DYEA 3BOXA 3UJSA 3FXGA 3PFRA 1YEYA 3TTEA 2XH0A 1R0MA 2QVHA 2P8CA 1MDLA 3TOYA 3EEZA 1R6WA 3OZMA 2OG9A 4A35A 2PS2A 3TJIA 3D46A 2OQHA 4GYPA 3IJIA 3VCCA 3ES7A 3RR1A 3DFHA 4ROPA 3SJNA 3JW7A 3OP2A 4G7FA 4KT2A 3DERA 3R0KA 2PTYA 3T9PA 3DIPA 3ZVHB 1NU5A 4GYPC 3FVDA 3U9IA 4IP5A 2DW7A 3MQTA 1MRAA 3HPFA 1PDYA 3P0WA 2QGYA 3FYYA 3N4FA 3H70A 2XH4A 3R25A 3DDMA 1KCZA 3VA8A 3DEQA 1SJCA 3DG7A 1P48A 5FJUA 1JCTA 3I4KA 4DX3A 2PA6A 2POZA 3CT2A 2GL5A 1PDZA 3TWAA 4ZA0A 4EWJA 3ZVIA 2OZ3A 4FI4A 1ECQA 1OEPA 2OZ8A 2PTWA 1TKKA 2HXTA 3NZGA 3P3BA 1BQGA 4H1ZA 4GFIA 2PCEA 4IL0A 3UCCA 3VC6A 2NQLA 2ZADA 1E9IA 4YWSA 4HCDA 3BSMA 3H7VA 4K1WA 3GC2A 1KD0A 3PWIA 4JN8A 3R11A 7ENLA 2ONEA 3D47A 3FJ4A 2QJMA 3UXLA 3QN3A 3CXOA 1KKOA 4HNCA 3CB3A 1FHVA 5EU9A 4DWDA 4H2HA 3SSZA 3N6HA 1NELA 3THUA 3MZNA 2GGGA 2PP0A 4J1OA 3UJRA 4K8GA 2P88A 3QKEA 4M6UA 3VCNA 3NO1A 3BJSA 4KEMA 4K2SA 1WUEA 2OLAA 3EKGA 3R0UA 3QPEA 1BKHA 3S5SA 3CYJA 2OPJA 2GGJA 1L8PA 1SJAA 1ONEA 4E6MA 3UJ2A 4A6GA 3TJ4A 3STPA 2PTZA 2PTXA 4GGHA 4JN7A 3RITA 3UXKA 3JVAA 2XH7A 3OPSA 5FJPA 3NFUA 4IL2A 1TE6A 1EC7A 2OO6A 3I6TA 3T8QA 3K1GA 4GMEA 4E4UA 2PP1A 4H83A 3QLDA 4J3ZA 5J04A 1WUFA 3OZYA 2P3ZA 1JPDX 3N6JA 4Z17A 4G8TA 2O56A 3CAWA 3ZLHA 3PK7A 2AKMA 3GO2A 2HXUA 4GISA 2FYMA 1EBHA 3P93A 3TWBA 2RDXA 4HYRA 4IT1A 3SN0A 2AL2A 1DTNA 1P43A 2PGWA 3H12A 4IHCA 4X2PA 1KKRA 3FCPA 4A3RA 4HN8A 2GGIA 1EC8A 3MWCA 3S47A 3V4BA 3FV9A 2OZTA 4E5TA 5IDZA 5BOEA 2MUCA 4E4FA 1XPYA 2AL1A 1JDFA 4H19A 3GY1A 2OVLA 3VDGA 3N4EA 2HZGA 2OQYA 2PSNA 2P0IA 1JPMA 4GGBA 3TCSA 3V5FA 4ENLA 4MKSA 2PMQA 2QDDA 3OW1A 2P8BA 4M0XA 3ZLFA 2PP3A 3MY9A 3Q45A 3R1ZA 4HCHA 2QJJA 2MNRA 3IJQA 2FKPA 3RRAA 3TW9A 3DG6A 3RCYA 4FP1A 3UCDA 4KWSA 4MGGA 2DW6A 2GGEA 3SN4A 3SBFA 3IJLA 1TZZA 2QQ6A 3VFCA 2ZC8A 3R10A 2GSHA 3VC5A 3ENLA 3SN1A 2AL2B 2XH2A 3DGBA 3IK4A 1SJBA 3DFYA 4IZGA 3KUMA 5FJTA 3DG3A 2PU1A 3SQSA 3UJFA 3U4FA 3T4WA 3UJEA 2PGEA 6ENLA 3OTRA 2HNEA 4KPLA 4GIRA 3MKCA 1SJDA 4DHGA 4E8GA 3MSYA 1F9CA 3RGTA 1MDRA 4IP4A 2GGHA 2GDQA 4HCLA 2OKTA 1IYXA 3TQPA 3NXLA 3PWGA 5ENLA 4HPNA 1ELSA 5FJRA 1EC9A 5FJOA 2PPGA 1RVKA 1XS2A 4DN1A 2QJNA 3UGVA
chains in the Genus database with same CATH superfamily
3ZIZA 4FLSA 2DT2A 4BWLC 3V18A 4JIQA 4KWWA 1XR2A 4NRSA 3NQGA 2DQXA 5FF0A 3RAOA 4I7WA 3S46A 2WP5A 4ORIA 2V2CA 1XIHA 3QV6A 3SW6A 4O4VA 1N5XA 5CPQA 3GRSA 3SR6B 1KB3A 3MV11 4RE0A 1T7LA 4LYRA 2A3LA 5HXMA 4MKVA 1I1WA 1XCWA 3BV4A 2XDFA 4LUJA 4Q6JA 2EKGA 3QMRA 3AUOA 5G4HC 3VIJA 3C3NA 4NQ1A 5LYRA 1YMYA 3CO4A 1BYDA 1GVRA 3ONCA 3AHXA 5H1WA 2GDUA 5AC5A 5FL1A 3ZWTA 1P1MA 4XWUA 1JNDA 6ALDA 3IS4A 3O7UA 3SJNA 1CGYA 1XRTA 3FEQA 4X9YA 4JTLA 3VKKA 1WOBA 2Q01A 1M04A 5CSYA 4N42A 1B3VA 1XJBA 2PTDA 4HA0A 1CZ1A 3LGGA 4EWND 1IIGA 6XIAA 2VRJA 4B3KA 3WENA 4YIWA 1ME9A 4L64A 1HFBA 2CEQA 3II4A 3LXBA 2ATSA 4QE4A 3WUFA 1A0DA 5EB8A 4FLRA 1P48A 5FJUA 3ECQA 1X1NA 4NUWA 3WF2A 4EPEC 3KVMA 3TWAA 1V6WA 3L4TA 4ZFCA 3T05A 4KFPA 1KGUA 2ZZCA 3GS6A 4YN5A 1IXOA 1WDPA 3E1F1 4FDCB 1R2SA 1QATA 3HV8A 4H41A 2I9UA 4IL0A 4AZCB 2NVAA 1ZNNA 5HNTA 1RUSA 5HULA 1VFTA 1US0A 3PWIA 2CCRA 1ZP3A 3R11A 1VHNA 2OGYA 4OUEA 3IAPA 1VR6A 2XWEA 1Q6QA 1PX8A 2WW5A 4C6EA 4CCZA 1BYBA 4S3EA 3ITCA 1TPC1 3UG4A 3WK1A 2WZHA 1TWWA 5B80A 1P0EA 4HTYA 4QG9A 4TTUA 4J7RA 5BXPA 5A69A 4FXFA 3QMSA 1W37A 1K77A 2R1NA 2DEPA 4FXRA 1XHGA 3N6HA 3MZNA 1ISZA 4AY8A 4KEUA 3HMJG 2ZZ5A 1TYGA 3GB6A 3EOOA 1TYPA 1YHTA 3IEBA 4FK9A 3FY1A 3DKJA 3DK9A 5E5CA 1Q6DA 3N13A 3ZJ8A 2WNWA 1REQB 1QW9A 4KETA 4US5A 4R88A 4C1NA 1BTMA 3LLDA 1Z42A 2DPEA 4LUSB 3LPGA 4GO9A 4DJDA 3N12A 4IJBA 2HWGA 3C0LA 3TJ4A 1TV3A 3GR4A 4JN7A 3UXKA 3O0FA 1TSIA 3OPSA 4L4OA 5A6BA 3NVVB 1R7OA 2E0PA 3CL7A 4PCFA 3TA6A 4NAFB 3TTOA 5SWUA 4Z2KA 2ZKMX 1GHRA 1V6YA 3F5JA 3JS3A 1BLIA 2E40A 2VGFA 2P3ZA 4C6FA 4Z17A 1ADOA 4AQLA 3CAWA 3NEVA 4XQ6A 1AW1A 1MYRA 2CBUA 2XZ9A 4XD3A 4HP5A 3ABOA 4O1EA 3VE7A 3NO3A 5AZ1A 2GZXA 3I65A 2TODA 1Z3NA 3S4TA 2Y6ZA 4Y9MA 4ZXLA 4S1FA 2RAGA 3G1FA 2VEGA 2AL2A 3PTDA 4MZYA 3H12A 3ZSSA 1XYFA 1XSKA 2TPRA 3LHWA 1Z7AA 4J28A 3M0XA 1V7AA 3V4BA 5A6SA 4BV6A 2OYKA 1C91A 2OZTA 4X0VA 3WELA 4B5UA 1R38A 1EP2A 4JFSA 1I2PA 3IIZA 2MUCA 1A0CA 1JDFA 2OVLA 1W3HA 1HGYA 4HHHA 4B9ZA 1UC4A 5JBEA 2CLEA 4CD7A 1JYNA 3KZPA 1ME7A 4UFIA 3RF9A 2C0AA 2CDUA 5LGZA 1F61A 4CU7A 3AWNA 5HNUA 3ITLA 4ZOBA 2HK0A 1WO2A 4ZOCA 1GRBA 4POCA 2PZNA 4AZIA 1VEOA 3HZ3A 1F05A 1RAKA 3GIQA 4Q4PA 2ISSA 3S1UA 4XSMA 2Q6ZA 1UUQA 2VQUA 2JFEX 1FH9A 3LGEA 4BQ4A 2Z1KA 4C7FA 2QW5A 3PPCA 3SAZA 3GH5A 4NF7A 2DFAA 4NSBA 1FP8A 2HQAA 4G5DA 4U33A 1KTNA 3U2OA 3V1HA 4K37A 4U5IA 2PRLA 4MY8A 3RIKA 4DY1A 4HPJA 1EF3A 1O6IA 4DM2A 3SSJA 3VMOA 2XZ7A 3AMGA 2ZA1A 4IQLA 3IK2A 4S3FA 3EUB3 4ZEPA 2DZTA 4J4KA 4JN6A 3AS2A 1FVPA 2ZTKA 4FOKA 1AQMA 3TXZA 2QCFA 4B3ZA 2WSRA 3QJAA 3TQPA 1XP3A 4JKLA 2PLMA 1C9WA 1C8QA 5D2WA 2WOQA 2OZ0A 5FEWA 3NAVA 3IJ6A 2FVKA 4K1GA 4IGSA 5FEXA 3VGFA 4IFKB 3WLRA 4M51A 4IQDA 3ZT6A 4WKFA 4HNVA 2G4JA 4NHVA 2OWCA 3PBGA 3CIWA 3QGVA 2FTWA 4GR1A 4DXXA 2VOMA 1QBAA 3QXBA 4W8AA 5FMHA 4JFVA 3PM6A 2PDWA 1V0MA 2WSQA 4RZ6A 4O28A 4CEXC 1OYAA 1BSLA 5LIYX 1XYLA 3W2MA 4BA0A 3ELFA 3AZTA 1RPKA 3LXCA 3NA8A 1QO5A 4P7LA 3SADA 3URNA 3W81A 4JD4A 5CPSA 4I90A 5A5WA 1V6UA 9XIAA 2RHGA 2CW6A 4NJJA 3SQLA 3N2TA 2WCAA 1OINA 1W5PA 1NVMA 5IHSA 2BVDA 4PFHA 4O10A 5DLCA 3W76A 1ISWA 4I5RA 1D2KA 1VH7A 1UP3A 1TJPA 1PPIA 3ITYA 4WRHA 3G1YA 5GQBA 4MJ2A 3A23A 1H6VA 4D6CA 3FSTA 4F0HA 1HL2A 3CWHA 4W86A 3CASA 1PKYA 2Y62A 2ZRWA 3GDMA 3M44A 4LCSA 3LBOA 1JF5A 2DU2A 1ZK7A 1GKQA 1G5AA 3R0KA 1VD6A 2PZ0A 1VCFA 3U9IA 4NJKA 1XLBA 4GQ0A 5FOOA 1FIQB 1P0DA 3LSBA 1VKFA 2E9LA 2D2HA 1OX4B 1RJQA 1R8LA 3EKLA 3RDKA 1Y7VA 4LEFA 3R5EA 4DVOA 2VC7A 1S1PA 1KA9F 2WZIA 4PTVA 1C29A 3ZYZA 5M03A 1EWEA 5AC4A 4BQ3A 3FNDA 1W1YA 4PH6A 1AD4A 5CC5A 4XKMA 4H1ZA 3CHFA 5G5IA 3VC6A 1J5TA 5KSWA 4E0CA 4NAEB 1ZHAA 2EPKX 2XYLA 4KRUA 3N2MA 4ICMA 3H2EA 4S3BA 3P5YA 4PCNA 1OG6A 3WLHA 3TYAA 4CNOA 2WCGA 3C2RA 3PAJA 4Z1AA 2ONEA 1DIEA 4RL3A 1NHRA 3LD5A 1MRQA 1OFBA 1XCFA 3ITVA 3MUAA 4HPHA 1DWHM 1JCYA 4S39A 1IEQA 1ZCOA 4PYSA 3M64A 1H5YA 5D38A 1XFBA 1EO7A 1FWDC 4J1OA 4R7OA 2PBOA 4UTWA 5LIKX 3OGSA 1LL7A 1IEWA 5I78A 2WBGA 1XIDA 3UNDA 3FG2P 1KQYA 3LCHA 3WF0A 2NSXA 2PDPA 4C6CA 5A6JA 1P6WA 2VCBA 2X41A 4BF9A 1B90A 1SFLA 1W1PA 5G1YA 3MMDA 4WDWA 3C2VA 3VNIA 2W6RA 3HW2A 4H4VA 1QPRA 2ZVRA 3FGCA 4TVYA 1FRBA 1WE5A 1OF8A 4QLKA 3AALA 1H7XA 3S9ZA 5DEZA 5JIPA 4H4IA 1TFVA 1TIMA 3VZZA 3A64A 1XHCA 5G1TA 3O05A 2Z26A 5K3VA 3KLJA 3T8QA 5JBFA 1ZJAA 4FALA 1UD8A 3URHA 2PP1A 4GE8A 1P1XA 2OOFA 4AVFA 5CJNA 2XISA 5E0KA 3VINA 1Q65A 1O7AA 2GK1B 3OZYA 2QPSA 4QIUA 4ZBCA 5C55A 5TNVA 3ZLHA 2A3HA 4Q22A 1W3JA 2DSKA 3GO2A 4DYKA 4EM3A 2VGBA 1ZMDA 1B30A 2RDXA 3B8DA 5U25A 3WBYA 3EWDA 4PMYA 3UW6A 3VIHA 4U31A 4Z42C 4IHCA 5AHIA 2YX0A 2J8GA 4HZ7A 1E0WA 3W7RA 4AH7A 5BWFA 4X9SA 4C90A 2G0WA 1FBAA 3GM8A 2C16A 4M29A 1W1VA 1M5WA 1ZENA 3W83A 1RZMA 1SFTA 3IACA 2ZRYA 4LWWA 1Q8JA 2VTFA 1ZBWA 3MUIA 4FIQA 4QGCA 2GWGA 2FHFA 4C65A 4WDUA 4H4XA 2GH5A 4IFRA 3LI0A 3EX6A 4CCDA 3WDIA 3IAQA 3APTA 4LBSA 1DOSA 5GJMA 3ZLFA 1EYEA 1W32A 1WAUA 5I77A 2YB1A 3TJXA 3WL1A 1RM6B 4H4UA 3MC5A 1KM2A 5D2YA 3U7VA 2XIMA 1IEIA 1UHVA 4RCXA 5H8UA 2FIQA 2ZUVA 4ML4A 1OCQA 3MSDA 1TZZA 1H2JA 3ALGA 3AN1A 4A8LA 1XKJA 3P61A 1MQPA 4UIOA 2WNNA 4IZGA 5FJTA 4AVNA 1N7KA 4BHYA 2QEZA 2DJLA 3WUEA 3XINA 1KXHA 3EWWA 3SUTA 4LAMA 3OA3A 5LHEA 5GNZA 4GHRA 3TSBA 3DI0A 1LG1A 1W0MA 4MZ8A 3KRBA 3WQ8A 4XISA 3DECA 1E40A 1H62A 4RK8A 3ANYA 1I60A 3H2CA 1RHCA 5E0CA 4W9TA 4UTHA 4KFOA 3TZNA 3MMUA 4U2ZA 4O53A 1X6LA 2YDQA 3A4WA 1W31A 4QJ3B 3JUGA 1EQCA 3SO7A 4C6JA 2VM8A 5HNRA 3SIMA 2C79A 4NJHA 2Y8VA 1YTKA 3PNUA 2W3SA 4GIEA 8RUCA 1AJ0A 2UBPC 3DESA 3DFOA 5BXTA 3NCOA 4HGXA 4LB3A 5ABHA 2E6FA 3H53A 4ZE4A 3CPRA 5I09A 4MB4A 1KBIA 1E0TA 1T40A 4IIDA 5GPRA 3I6EA 2YCIX 2XPKA 4LCRA 1BZLA 1PIIA 3BK0A 2GJXA 4YTQA 4K38A 2XN1A 1BWLA 1XKYA 9CGTA 5CGMA 3HRDC 3QW3A 3VKCA 2V6OA 4J27A 3ZO9A 1MXGA 2J3NA 5C54A 3JZUA 1WKYA 4UFHA 3HPZA 3EXRA 1UWQA 4DXKA 4BY3A 1YXCA 3WDJA 3WQ4A 1YEYA 1AODA 3TE9A 1L0PA 2V2DA 1WYIA 2VGGA 3GW0A 1EDGA 1UR3M 4UBPC 4B4HA 1E71M 3HG3A 1MDLA 2YXOA 1R6WA 2ZYFA 3BOFA 4PZVA 1O94A 3TJIA 1SZEA 4US6A 3WEZA 2IPGA 3G1HA 4EXQA 3C0JA 4N6EA 5I24A 4PRRA 5DFAA 4A3HA 3GYEA 3L0NA 4HU4A 4XZIA 3L66A 3DXIA 5D9MA 2WOWA 4UNKA 3HBLA 2WVSA 3H2AA 1N2VA 3VIOA 4NKCA 3DIPA 4DUXA 2ZA2A 3CAVA 2JEPA 5JXQA 1JCJA 3EPOA 3K5XA 4W7UA 4H4SA 3P0WA 4AD4A 2HQMA 1G4PA 3UT0A 3ANUA 3NYDA 4XB3A 2Z28A 4AIBA 4AD2A 3NEHA 7A3HA 4JTAA 3VA8A 1W3IA 3O9NA 3W75A 3N4AA 1K1DA 1RY0A 3J7HA 3N25A 5JCKA 3W7KA 4D6JA 4EWJA 3QPZA 1V3HA 4K7VA 1M7PA 2XIQA 4H7VA 4HYVA 4ATWA 1J0KA 1KTCA 3NS1B 4MJ4A 2VENA 4D8AA 4M6VA 1BD0A 2F2HA 3KCLA 4BKNA 1Q6OA 3VGEA 4GZIA 4TV5A 3S1VA 4JX4A 3LY0A 3Q37A 1J79A 3BSMA 4W4QA 1EF2A 1GOXA 2PDYA 7XIMA 2PC4A 5DMYA 3RNDA 4DJED 4EACA 3AIQA 2ZUWA 2REQA 4Q4KA 3FA3A 3W85A 4DZAA 2E68A 3DOPA 2ZUTA 5BOOA 2XHYA 1JD9A 1UKOA 1VBHA 4LS1A 3MUXA 5EMYA 3IJ8A 3OLIA 2FGZA 3LLFA 4EP8C 2GQ3A 1R3YA 3LNPA 2PWUA 5D05A 5BU6A 1OYCA 3WNOA 1YDYA 7TIMA 4WHBA 1NDWA 2YA1A 4J56A 3KLKA 2O0TA 3WH5A 1SYTA 3VKDA 3TVAA 4BQ5A 5KVHA 1KM0A 1XUZA 4D72A 2EPOA 2QCEA 2A6NA 1J96A 4WF7A 1S2CA 1XLIA 4UNLA 1BWVA 1W9VA 4JTHA 1AQHA 1TV7A 3A47A 1WZAA 5HJYA 1S2WA 2Q8XA 1VFLA 2EG7A 3IJ9A 2VZOA 2OQLA 2QDGA 1ECEA 1A3HA 3MI6A 4N2YA 4OT7A 3MBFA 2WMKA 3URQA 4A6GA 1QPKA 3LPFA 4N9EA 3JVAA 4ZOEA 4XD5A 1UCWA 3CH9A 5DN1A 3VXGA 2V0TA 2FHBA 3UU0A 4N0RA 3QGKC 4PB4A 2C1IA 2QMJA 3FVMA 4GQBA 3GDRA 3NQDA 3OO2A 3W01A 3S0CA 3W1UA 1NTHA 4DXVA 2UY3A 3QYQA 3OBAA 3NZRA 1J0IA 2A2IA 4GRTA 4LS2A 3RLGA 1ZRQA 4HPGA 4ACZA 3DGZA 2FYMA 1VFUA 1TCDA 5DBTA 3NUKA 4HYRA 3AYSA 3W6MA 5I06A 3SCTA 3VX0A 8A3HA 4IUGA 4F0RA 1P6CA 3UD6A 1DQWA 1XDLA 1XLKA 3KOWA 4C1NB 3L5LA 3UNTA 4E5TA 3RM9A 1XBXA 2A7PA 1S5NA 1GOKA 3N15A 2V5BA 4B5NA 3GY1A 3F2BA 1TQJA 1XM3A 3MW7A 3G6MA 1JPMA 1Y8BA 1BAGA 3PVFA 3W22A 3IANA 3R8HA 5K9CA 1NH6A 3PHAA 4LY4A 1W8SA 4OZOA 2GWNA 1Q13A 1SFJA 3R1ZA 3W28A 4QG6A 1LBLA 2ZUNA 2ZX5A 3M5YA 1PHQA 3UYCA 2Y88A 4ZQPA 2ISWA 3B0PA 1OG0A 2QAPA 5A6TC 1IEXA 3TJLA 1UD2A 4DJFA 3TUUA 2GGEA 3U3HA 2IKIA 4DZHA 1V6TA 4WR3A 1RPXA 4AVOA 1DXLA 3WLNA 3WJZA 2AL2B 5LIXX 3GTHA 3P67A 4G7EA 1EJ7L 4GZJA 3HQPA 3PUEA 4JHZA 1GJUA 5FF2A 2YW4A 1A80A 5U7SA 3GW3A 4DF2A 3W6LA 3LZ5A 4R27A 3QF0A 1FEAA 4LS0A 4GIRA 3TOPA 3VNMA 1M53A 1P5BA 2BGSA 1QMLA 3NZ1A 1HKJA 2E5CA 3W2JA 2GSJA 4ZOHB 4EXBA 3XISA 2FZMA 3E0VA 1W1IE 5J8LA 3E49A 1JCLA 2NWRA 2IPWA 4Q8PA 3KW3A 1TJ2A 2R24A 4YCPA 3UZXA 2RGLA 5BRPA 2GRTA 2GPTA 4OQVA 3WJXA 3VKJA 4HMEA 2BY2A 5EY5A 3L5AA 1VBUA 2A4AA 3VDHA 1LT7A 4GC3A 5F2LA 3LCGA 1VP5A 3NTYA 1NARA 3GHRA 3SCWA 3LI1A 4ZOAA 1MUCA 2FTPA 2EAWA 3W7MA 3M0MA 3E2VA 5A8GA 5JBDA 4JX6A 2QZRA 1RK5A 1NP0A 3NURA 3Q4DA 3LQGA 5G1MA 1F2JA 3PS7A 4EXAA 2XUCA 1A5MC 3WG6A 1TCMA 3KVKA 1H3GA 3T40A 1F6PA 4UTFA 1CB7B 2YLAA 3NDOA 1OM0A 3H6OA 3EAOA 4PUWA 3SY1A 4Q4SA 4L1XA 1TPVA 2HS8A 1OABA 1DKWA 4C1LA 3GVQA 4FS9A 1HJXA 4NX0A 3HV9A 3UXIA 3O15A 3ZMRA 1XF0A 4HSNA 4OVXA 3LG3A 1CGTA 3USZA 3DJJA 3JU2A 3L4YA 1MXDA 4YL2A 3AS0A 4FR6A 2BOGX 3QSRA 1HP5A 2FDSA 1UD3A 4S3GA 1I1XA 2E6AA 3GG0A 4GYPC 4PCTA 1KFCA 1M68A 2YZ5A 1FKXA 2YAUA 5EBKA 3MQTA 3U5YA 2YL8A 1BF2A 2QGYA 2YCJA 4QDWA 2X1RA 3H70A 2XH4A 3IRDA 2HV5A 1BF6A 1AJ2A 3IGUA 1VYSX 4I7VA 2Q02A 2AMXA 1TVNA 1Z6KA 4DX3A 1X6UA 3M5XA 4ZA0A 4AWSA 3W7GA 3WBWA 5AB3A 4MWAA 2C91A 1LF1A 1S7MA 4QAWA 3HGJA 3AXHA 5E9XA 1FO4A 2FZ8A 2EJ1A 2HXTA 4OGZA 4UUIA 3P3BA 4GIYA 4O0ZA 2EPMX 2V3EA 1K9FA 3GSMA 3LNMA 2DV0A 2KZHA 3HGSA 3AXIA 3CMFA 3W7CA 1IF2A 1JNEA 5LSMA 4RUBA 3H2FA 3PUDA 4KCWA 2DIEA 5FACA 3S9IA 2W0HA 2CHOA 2GUYA 4JTCA 1ZKQA 1JEHA 4D8ZA 1VZWA 1BVWA 3NQMA 3VIGA 3P8IA 1V03A 4YWOA 3F1QA 1VLWA 3IGSA 5GJNA 3SI9A 2R9RA 2Z0IA 5IHRA 2HVNA 2B7NA 1D8WA 2E9MA 3DAQA 1YW1A 4EF8A 1V3JA 2NT0A 2YGYA 2D2OA 4CNTA 3SY8A 2J8FA 2X0YA 4YNGA 5I02A 2PP0A 5EGRA 4RW5A 4DWSD 1K4QA 1QPOA 1X38A 5LNVA 1PZ3A 2ZVIA 4M6UA 1XD1A 3M16A 5LIWX 4IQEA 2DUZA 3VAVA 4Y8FA 2A5HA 5LXEA 1W5NA 3MCMA 3M5ZA 4ZQMA 2GLKA 4AMAA 1XYAA 3RK8A 1V3LA 2VEPA 3BXWA 1B3ZA 2YJQA 3M07A 3TYEA 4TMCA 3N9RA 4JCMA 3UJ2A 3W02A 2EGZA 1X97A 1R3QA 1OT1A 1QOXA 4JCLA 3E0LA 4WIWA 2CBVA 4PMVA 3RX3A 1I45A 4ZTXA 3G1DA 4UR7A 1O5XA 1IIHA 3UWEA 1GERA 5HOSA 3A4AA 3W27A 4JFTA 1W2VA 2X99A 5HR6A 3WK0A 1F6KA 3QLDA 4X61A 2CHNA 1JXKA 2WKJA 4IX2A 4MJZA 3WH7A 3UEQA 3KWXA 4M24A 4DJEC 1JZ8A 1KLZA 1GESA 4QBXA 4LY8A 1US2A 2QIWA 1ZU8A 3DI1A 3EWCA 4U5KA 2CPUA 1ZAJA 4CLMA 2XINA 4IG2A 1PO9A 2H6RA 2X7WA 4XX6A 3U5UA 4Y6GA 4M1RA 5C5YA 4V15A 3R94A 3PG6A 3GFZA 3SN0A 1LWIA 4KS0A 2XM2A 1V97A 5FCZA 2ZXDA 2YLLA 3NPXA 1Z89A 5A3HA 5HINA 3KBNA 3TONA 3KBSA 4JS3A 4S3DA 3FGCB 1EJRC 1SO3A 5IDZA 1EGZA 1AA1B 1A5KC 2WSYA 1ZY9A 3RO8A 3B05A 2PDNA 2OTDA 4TQTA 1XYCA 4ADTA 1E1FA 3W84A 4R34A 3V0SA 3VK5A 4IPLA 4HD5A 5U1OA 4O0KA 4XUYA 2BDQA 3GU1A 4GI6A 4C91A 5A1AA 3UA3A 1EIBA 3O6CA 2PP3A 2HPIA 1DIOA 2W27A 3OVPA 2V3BA 3FX4A 1J6OA 3W1NA 4QS5A 3RCYA 3UPBA 2V5JA 3H26A 3LMYA 5CBJA 3BMVA 3IJLA 1NFGA 4YVVA 3UPWA 2GSHA 1Q4NX 1NEYA 4Q8OA 4Q8QA 4IH3A 2VT0A 4NI8A 3V75A 1W9UA 2A85A 4EAYA 2YBVA 3D3FA 4GWEA 1H7WA 2PB1A 4HHLA 4IGNA 2Z4GA 4Y8EA 4ZQRA 1GW1A 1X98A 3UR8A 1OFAA 1R2RA 2Y5SA 2ISFA 1V93A 3PNZA 3PG8A 4HKPA 1RBLA 4UR9A 4CD6A 1V7YA 2ZZ6A 5CXPA 1MWOA 3KFTA 1L6YA 1THFD 1K6AA 1G94A 4LX4A 4O50A 1UQYA 3MSYA 3GXDA 3G8EA 3OA5A 1O5KA 1CEOA 1XIEA 3OGVA 3C8NA 2I7GA 3VZXA 3WF1A 1I2NA 4PODA 1UBPC 4GY1A 1YXDA 3FDGA 1BQCA 1AK5A 3GNDA 4UB9A 2GR2A 2WHMA 4KIRA 2VDHA 3N14A 3WCZA 1L2UA 4DN1A 2FLIA 2VUNA 3FJ6A 2BX7A 1HKMA 4WKAA 4H4WA 2PDBA 2WC7A 2BHUA 3DKLA 3GNOA 2VGIA 3B8IA 3GD6A 1TTPA 3EX1A 2OFJA 2A8XA 2OX4A 1MW2A 1HG3A 5FF7A 1CCWB 2NUYA 1VIZA 5IFTA 5REQA 2WWCA 1LDCA 4B15A 3GXIA 1KM4A 2DH2A 3N2OA 3MU7A 4G9PA 2AKZA 2INFA 2XGZA 3N9SA 3MUCA 4UMCA 3RG6A 3G3DA 4C7GA 2QDHA 4GY7A 4I5XA 5AHNA 2EQ7A 1KBJA 8XIMA 3M7WA 4CQCA 5JRBA 4EVZA 5KZMA 4ML9A 4S2BA 1OFDA 5A2BA 3UZ5A 4UXDA 4FLOA 1ZBCA 2OQHA 1RR2A 4F0KA 1XSJA 3QFWA 4FNPA 2PDUA 4FOJA 3GAYA 5DMLA 4GUFA 1JYWA 5FS7A 3WD3A 1QHOA 4AIOA 1RBOB 3T0BA 4IMCA 3PANA 2BC1A 4B4FA 3URAA 3ZR4A 4ZQNA 1VENA 2WAGA 4HSOA 5KITA 4G56A 3GTIA 1MRAA 1MW1A 4MOZA 3WDQA 1EHAA 1CB2A 1JDEA 1Y5XA 4V28A 1QI2A 5FJJA 4NT0A 1LOQA 2GJXB 1YQZA 2HS6A 3S5NA 3WDHA 1ZSXA 1OWQA 1AH4A 4HJFA 1CXEA 3LPPA 2GL5A 2FMNA 5E70A 3AHYA 1OC6A 3CUHA 3DYMA 2YDRA 1Q6EA 3S2NA 3YPIA 5CSRA 4TX6A 3C6CA 4GYKA 3N29A 2G3MA 3FAXA 1AH3A 1XW8A 2PCEA 2NQLA 3W1PA 4YWSA 4MLJA 3PUOA 3GZAA 4IIHA 2ZBTA 3VGBA 1B0IA 2VDIA 5BROA 3ZXWA 1DP0A 4PA8A 3PBWA 3LDVA 1O1HA 1VFFA 5T8GA 5CAHA 1QT1A 1KLYA 4AWEA 2YPIA 3WK3A 1QO2A 4DYJA 3RPDA 4AD0A 3UXLA 3QN3A 1JUEA 3QFAA 4RXGA 3UF9A 1MUWA 3WD4A 2W3RA 3S5YA 4KPRA 1XLGA 3G1XA 2J78A 1GSNA 1SO5A 5HQMA 1UZ4A 2HMCA 4DF0A 3ABSA 3V16A 3L68A 4PUNA 1S2VA 2JIWA 3CH0A 1FXPA 4K8GA 4Y9PA 4AZHA 1N8IA 3KBJA 3QKEA 3NQFA 4AHOA 4HZ6A 1F76A 1RCOB 3M0LA 4R7JA 5D02A 3OU8A 3P62A 3KDNA 3DBNA 1B9BA 1CBGA 1SR0A 2H90A 3ARRA 3IIVA 4KEMA 3VFLA 3EYPA 1MQRA 5KZDA 5LA1A 1QNPA 2WVUA 3VX1A 1LLOA 3MB9A 5LNUA 2PLKA 5I3IA 4FOUA 3PY2A 3IJ7A 2F6KA 3W72A 3K8KA 4GBUA 1B5TA 1K4GA 1DJGA 2REQB 5FF4A 3HA1A 3I6TA 1XXXA 3MI3A 2OSXA 3IVTA 4F0MA 2C3DA 4D6DA 1U1HA 1KXTA 1W91A 4I6KA 5K4XA 3KS5A 3UETA 4A2RA 4H01A 2I17A 1GW9A 2VZSA 1Y65A 3GTFA 1EJUC 3QBUA 4D9PA 1TX0A 8XIAA 2SFPA 3USBA 3TEVA 3L7RA 4H4PA 1HUVA 2A21A 5H6HA 3N1AA 2OLSA 1DJYA 1B3XA 2V5LA 1DIDA 2FFCA 4DWSC 4H9VA 2OT0A 1IR1A 3WLOA 2ZFAA 4CQ9A 1S39A 1GKRA 4UMAA 2DVUA 4GD0A 1O5QA 2WC3A 3IVSA 5BOEA 1EXPA 1DWAM 3B0XA 1LLZA 1ZZMA 4GIAA 1K8ZA 1KR1A 5KZEA 4O4WA 4ZR8A 1VFHA 1J0YA 3CUFA 4WX2A 3GVGA 1FQ0A 3CZGA 2QDDA 2OO0A 1ZAIA 1GCYA 1E3XA 4CNSA 3WL0A 2R1KA 3WLPA 3GDLA 3INPA 3MUY1 2IQTA 2BVYA 4MTVA 1UJQA 1FDZA 1PIGA 3GR8A 3OC4A 1T8QA 1X7FA 2NSOA 2YA2A 3QKZA 4QQUA 3TYBA 1O1ZA 1O68A 3BLOA 5A2CA 3TQKA 1K02A 2JIEA 5TQLA 4MDPA 4IM4A 3RCNA 4UOZA 1JPHA 5PTDA 1G9HA 1UKQA 3FS2A 3B8SA 3FA5A 1KCKA 3NQBA 2C7FA 4DF1A 4L1WA 2PDGA 4EPDC 3BSGA 2B0MA 3NYZA 1AH0A 1E9LA 1GVOA 2FQIA 4RE2A 1LL6A 2H9AB 2Y7DA 2JKAA 4GNKB 4IIFA 1GZ1A 4KRZA 4ADUA 5FAJA 3FIGA 4XIAA 1G67A 2HJPA 2QF7A 3T09A 4HCLA 2OKTA 2Y7GA 1EGMA 3W4RA 1TTIA 1V08A 4GJJA 3GXPA 3PWGA 2EQ8A 4CNPA 4U28A 1LRNA 4XAZA 5FJOA 5AVHA 1JDCA 2WMHA 3CIXA 4C60A 3VZYA 3ZT7A 1TZ7A 2O4MA 4PMQA 1NJJA 3KTXA 1LQ0A 1ONRA 2XWDA 2ZX8A 4HSHA 3WLKX 3IPWA 5DT5A 1FY6A 1Q5MA 1ISYA 1K70A 3TK7A 4C6MA 3L8KA 3ZLGA 3VABA 3WQCA 2J62A 5AHFA 4G7EB 3FEMA 5JU6A 2WHJA 3MT1A 3LTPA 2IQ0A 1OVDA 4H00A 2UY5A 1YADA 3R12A 3UCQA 1BVNP 1R3RA 3AYTA 1EX5A 4GPNA 1V4YA 4FPSA 4FNQA 3TU9A 4QDPA 4CU8A 5C9WA 2X1SA 2PD9A 1O60A 3BH4A 1R47A 3ZJ7A 3EXSA 1OB0A 3VCRA 4FXSA 3CZKA 3GG1A 2Q8LA 4Q33A 3DGHA 4Z2GA 1BKSA 3ALFA 1FHDA 1QR7A 2QF8A 3EZ4A 1JZ6A 3LS9A 2ZUUA 1LLWA 4PSRA 5CC7A 2ABAA 3HMCA 3BCJA 3PJTA 1H0IA 3RR1A 3JW7A 1V5XA 7TAAA 3GHUA 3WX7A 4G7FA 3WH8A 4M7SA 1DJIA 4AEFA 2CWXA 1L6FA 1JAEA 2PTYA 3NGFA 1FOBA 3AFBA 2IPJA 1CXFA 1DXIA 5GNYA 3G6LA 3DHDA 3PB2A 2EPNA 1PUDA 1IXNA 3CZJA 4HU3A 3PZOA 1UA3A 1JRBA 3WEMA 1NQ6A 3B9AA 4ES4A 1P0BA 1JCTA 3I4KA 3FJLA 3EOSA 3VDAA 2V5DA 3URBA 1NOWA 3TROA 2P53A 3CGTA 4NZFA 1EL3A 3E0WA 4J3UA 3AQUA 4B90A 3WLLA 4Z2HA 3ME3A 2WNZA 4DEFA 5AFDA 2BNJA 3I3DA 3KM8A 4MNMA 4UTLA 3OYZA 3L2LA 4GK8A 2QHAA 2JKEA 1QRQA 4PGLA 1QVBA 4F8XA 2WV8A 1WZKA 1VPQA 4DNMA 5I3DA 3UG5A 1Z8AA 3N3MA 1OZQA 2PDIA 3MS8A 2V30A 1GQJA 4B3LA 3GNPA 4Y2WA 5C6MA 3UZYA 1VLIA 4HNUA 1U5VA 3TAOA 4HNCA 3STCA 3BUVA 1DWJM 3GX9A 1ICQA 3MZ2A 5K2ZA 5FL0A 4RZ5A 3ZS4A 1DBTA 3B8VA 5KMYA 2C71A 3TAKA 2GR0A 3TC3A 3HIJA 2OEMA 3R79A 3EKGA 1D3HA 5D2XA 3S5SA 1QWGA 3HPAA 5HMSA 4X63A 4O13A 1ONEA 1XRVA 1ZAHA 4V1YA 2VYOA 1M65A 3S3GA 3VNZA 5IBXC 3STPA 3WQPA 3T55A 3B8TA 5AYIA 3TH6A 4QE1A 4ILSA 3W9ZA 3K1GA 1GRGA 4E4UA 2PDHA 5AKQA 1YE4A 1JCNA 1FHLA 1HJUA 2QYGA 2ZICA 3GVWA 4PMJA 3TYDA 2VOTA 1ENUA 4DUWA 2QGHA 1DQUA 4UQ9A 1NFBA 3A7RA 3AO0A 3B0UX 3PSWA 3BL3A 1GKPA 4GC4A 5GRTA 5A95A 3NVDA 2EQ9A 3TWBA 3STFA 1FFVC 1HL8A 5C0QA 1FWRA 3PSVA 4YHEA 2DJXA 3R58A 5D2TA 1BPLB 3SGZA 1TQXA 5LA2A 4X2PA 3STGA 5F7UA 4H9XA 4HYWA 5BRQA 2Z25A 4A3RA 5U4NA 2W92A 4C6PA 3OB8A 4AFYA 4XTIA 3A9IA 1CLKA 1VEMA 3TV8A 3QQ0A 4EX4A 1S2UA 1SR9A 3QC3A 4D6EA 4DI9A 4DAFA 5DY2A 4CN6A 4Q4QA 3G77A 3F5LA 5DXYA 1UWSA 1A5AA 3Q94A 3CGCA 5HATA 3LRMA 2XJ7A 4OV9A 1GVYA 5I6SA 2BBFA 5CG7A 3S42A 4O1BA 1LM1A 4QP0A 3PBMA 3P82A 3K4WA 3U2EA 1I9CB 2Q09A 1GEHA 1UR9A 3LHTA 3B9OA 1EDTA 2ZX7A 1LROA 3C0SA 2ZOXA 3NSMA 4MGGA 1EEPA 4ADWA 3TA9A 3HM7A 4IG2B 1JRCA 5HMFA 2G37A 3VM7A 3EX3A 4MPKA 3W23A 3VFCA 3RM4A 1O95A 1DHKA 2EO7A 1S1RA 4RV3A 1NP2A 3WZ0E 3MUZ1 3VPLA 2V82A 4NU7A 3KUMA 1SGJA 1E51A 1GYLA 4C6LA 4S2CA 3T4WA 1G7VA 3LV5A 4MB3A 2PGEA 1UB3A 2WXDM 2JGYA 2WCSA 3B04A 4H7CA 1WXYA 3LPOA 3P8JA 3GXTA 1IT0A 1FCQA 2HNEA 3V0TA 2HVOA 1OFRA 2QUVA 5C9ZA 2J24A 3WN6A 3DK8A 4TTGA 2QUUA 1NM9A 3RUBL 1A3XA 3LADA 1TR1A 1XGEA 3PTMA 2EBNA 3H54A 4P7OA 1F3TA 4K7YA 3L9CA 3DFTA 5EFDA 4J2PA 1DJWA 1GQNA 1C93A 5FJRA 3OEXA 2JF7A 4XBJA 1RQEA 1AQFA 2BXYA 2QCDA 3CL6A 4ALDA 4EPKA 5EBUA 4M6PA 3V3WA 3ZVHA 5G4EA 2RH9A 5ER0A 4JNMA 3CHEA 3WIJA 1XLMA 3EDDA 3MWAA 1IZKA 3C3UA 3H8AA 2X16A 3GC4A 2OSYA 1HQTA 3WH9A 5D2VA 3DN5A 4XKYA 1QK0A 2VC5A 1SZNA 3CK5A 4R5EA 2DT1A 1VFMA 3PZVA 1AMKA 1V0LA 3BW4A 4GXMA 3SUWA 4AUBA 5A8QA 4J5NA 3FXGA 1AW2A 3W7HA 4JYDA 1VBJA 3WY1A 1XIGA 4HB7A 3E5BA 3CT7A 2KX9A 4L9XA 4WOZA 4QXIA 4RJEA 3T1GA 3N18A 5DELA 1DVJA 2VDGA 2FH6A 3BJTA 3ES7A 4JTTA 1CGXA 1QOPA 4LAKA 4OHQA 3DFHA 2XG9A 1WXJA 1XYMA 3TTSA 1T3QC 2WOVA 2Z2UA 4GNJA 2DVXA 3V1PA 2QVNA 3N2XA 1DNCA 4IJRA 4HBKA 4QG8A 1FWTA 2XN2A 5I23A 1CX9A 2E7FA 1MMFA 3NM1A 1EA0A 1YE6A 3WMBA 2QMKA 1R3VA 1GTHA 1G0CA 4ATLA 3MP3A 2B7PA 4WY0F 1HGWA 1BSIA 1I2QA 4NZCA 5REQB 1XH2A 3QZEA 1PHWA 1XIMA 3AMDA 4MAZA 4GINA 3HTWA 3BZGA 3WJYA 5C9XA 4QR6A 4PMXA 2J66A 1RP9A 4V2XA 1EBDA 1UD5A 3EA1A 4NL1A 1MEWA 2JF6A 1YQ2A 3GNXA 4QM1A 3ABQA 2OZ8A 4Q8UA 1PTGA 1SW3A 3C4UA 1LP6A 1Q3NA 1ML1A 4LYPA 4US5D 2Y89A 1TMQA 4UTUA 3N11A 3BO9A 4FXJA 1GOQA 3VIKA 4DJDD 3WLJA 1CIUA 4AD1A 3GC2A 3WQEA 4LB4A 1LZOA 1VRXA 4CQBA 4J2MA 2VX4A 3ICJA 5A6BD 3CHCA 3ERPA 4JIRA 1JGIA 5K7JA 1DWGM 1GEUA 1QW7A 5AYXA 4O11A 1PVNA 3QQ1A 2D23A 2QPUA 4WCJA 4DBUA 1BRLB 4ACYA 2YL9A 1UZ1A 5EU9A 3DH7A 3AU6A 3NWRA 1Q6LA 2GVYA 4QSFA 2GGGA 2W0UA 2INZA 2PLJA 3GDKA 2HISA 2VD9A 3CLWA 3RFAA 4GNVA 1UD4A 1V8EA 2VR2A 3E3HA 5FF3A 3WO8A 2XFYA 3MHGA 3RYSA 1RA0A 3CB8A 4EQWA 4A29A 1A5UA 1V02E 3W88A 3U2ZA 1DE6A 1D3GA 2DT0A 4YVXA 2PAJA 5JCMA 1CXLA 2EKCA 1ADSA 4NZ1A 4PMRA 1N5WC 4AEOA 3T4CA 3CHVA 3QW4B 3ZWSA 3ZJKA 2DQWA 1E72M 4H4QA 5DCEA 3R43A 2PTXA 1JPIA 4GGHA 3RPTA 2PRMA 5HBFA 5FJIA 2VFDA 2E8YA 1FWCC 4K7ZA 4CD5A 1EZWA 1LG2A 1UG6A 4NNAA 1YNPA 3UFYA 3O2LA 3G22A 4H83A 1P4CA 3TQ0A 3TC6A 5AC6A 3GQYA 1SSGA 3ZZ1A 4LALA 3NQVA 2ADAA 3G24A 6PTDA 3UWQA 5F1UA 3PK7A 1WDQA 1FTXA 2BZNA 4CN4A 2I56A 3P93A 4XTDA 1TRDA 1JZ7A 1VFOA 4IIEA 4CD4A 4LV9A 3A3HA 3FCPA 2VELA 1FFQA 4AHQA 3GKAA 3DK4A 4B91A 5DY3A 3HOJA 4IPIA 4YVPA 4MDOA 5H8MA 1AZ2A 1UMLA 4HA3A 3CQ0A 1XH1A 4H19A 4OOUA 2CIPA 2F7FA 4BCEA 4LA1A 4ROQA 3W82A 4L6HA 1PKLA 4HOWA 1XLJA 3CZEA 2PMQA 2CLMA 3AS3A 4QX4A 4ZQCA 1YNYA 3S6TA 3FDKA 4K39A 1HNYA 5CBIA 3OG2A 5JUVA 1KWKA 3RXZA 1WAWA 4HNTA 4C6DA 3W7NA 2GSEA 1SMDA 3C61A 3RR4A 2V68A 2W4XA 2X8HA 2Y5JA 1OK4A 4REQA 4GCXA 4PMUA 1VJSA 4NZ4A 1W3KA 1YBQA 1SJBA 1O4UA 3PJWA 2JKPA 4UNIA 2RUSA 4NI3A 1FCUA 3II1A 3P60A 1E4LA 2TPSA 3S2JA 3O6YX 4YU1A 1SZGA 1XBVA 4GKLA 1XDMA 3TFCA 3PPGA 1J2BA 1KXVA 2DZAA 1VBGA 4QQ3A 4RW3A 1I2OA 2Q71A 1ITCA 2XGBA 1JUKA 5TR3A 2V63A 4H50A 2F5ZA 5RUBA 2DSWA 2W67A 3QV8A 4D6IA 4UTTA 4A8RA 4LAUA 3BLPX 3OZOA 4WLCA 1XLHA 3PJUA 2W61A 1HKVA 4ZL1A 4TXEA 4P8UA 1FDYA 3H7RA 4JL1A 1D7FA 5MKGA 4C5ZA 9XIMA 4XAGA 4ZSUA 4LIIA 2GJRA 1A5CA 2WLZA 4QSHA 1NDAA 2FHCA 1DJHA 1SFSA 2QCCA 1JXJA 2C18A 3AIUA 2G3NA 4AEEA 2GVGA 2WMJA 3AXXA 2OXNA 3VGHA 3LTYA 1B57A 3IV8A 4OUIA 2CERA 2ZDSA 1MEHA 2NVKX 2FGBA 1RH9A 2AQOA 4Z08A 1JZ4A 4YTTA 1XGZA 3LU2A 2AAQA 1EJVC 1E73M 2QS8A 3D3AA 4IICA 1WZMA 4O14A 3TLQA 2C14A 4RLIA 5HK4A 3WJWA 2XM1A 1E0VA 3F2CA 2FFIA 1EJWC 4FZIA 5D03A 2W54A 2UWFA 1RD5A 2XSAA 4KRTA 3SRDA 4E3TA 1TR9A 1TV2A 4UTJA 3SUSA 4GVFA 3ITXA 3KTCA 2OSWA 4J3TA 3B9EA 3OBKA 5E6ZA 2BHZA 5LKYA 3VM5A 1QUMA 6XIMA 2F2KA 1Q45A 5A6AA 2GOUA 4DZIA 4G1KA 2DW7A 2V67A 4L9YA 5A8NA 4INFA 1EJTC 5F2IA 1ZPTA 1H1NA 3L67A 2RDUA 4GACA 1R3WA 2VCAA 1MW3A 5LZLA 2DY3A 3MO4A 3CUZA 3G18A 5XINA 1ZY8A 3W26A 4O12A 4MG4A 5FI8A 4MIMA 2ZXAA 1KFEA 3IIXA 2YXGA 3CEPA 3UWYA 3GBEA 2VMFA 3NR0A 2O92A 4QEEA 4O52A 3H4KA 2IMRA 5BCAA 4GZ7A 3W2KA 2CXGA 1Q7QA 3CO8A 4PMNA 4M56A 1IZJA 3W2NA 5LXXA 1ALDA 4IP7A 7REQB 4K36A 3T44A 4DLMA 4HOZA 1QNQA 3S8HA 3KL3A 4PSPA 1WP6A 2BHYA 5B7ZA 2NVCA 3BQ6A 4FAMA 3LM7A 4XVEA 1E43A 5TD4A 3NQAA 3E2QA 3T2OA 2J6XA 5FKYA 4WD0A 1QI0A 3OVRA 4TVCA 4QJ5B 1UKPA 3TZFA 3UZWA 1JAKA 1S38A 3AZRA 2XU2A 1FHVA 3AYRA 1NF0A 3VTRA 4KH2A 2VJXA 1G6CA 4H2CA 2CNCA 2FMOA 2EJAA 2ZCGA 2VR5A 3L23A 2I9EA 2ZE3A 5CKSA 1NY1A 1A4MA 4FB7A 1FKWA 4O15A 4HHPA 5D30A 2AGKA 3TYZA 2XN0A 1E55A 1GQIA 4Y96A 1V0KA 5E1QA 2C19A 2W62A 1YTEA 4I3GA 1ZBKA 3VO0A 3QGAC 3EF6A 3CAQA 3CYJA 6REQB 3KP0A 1AVAA 3DJGX 1JCXA 3W1AA 2OMAA 3M0KA 2DGAA 3BWWA 2WB5A 4E6MA 3LCIA 9RUBA 1U5HA 3NJ3A 2JALA 1HL9A 3LEPA 2BFGA 4O1DA 3PB0A 1EC7A 2P5NA 3NM3A 5DANA 2ON3A 3DX5A 2BTMA 3GLCA 3PZIA 3RLUA 4DJDC 4M82A 3QHNA 3VOJA 1NDZA 3WNKA 4KW2A 4XZHA 4LYKA 4AF0A 2VUYA 4LVAA 5JH2A 2OT1A 3C5QA 2Y0FA 5HWNA 1LVLA 3SCNA 1XYZA 5A8PA 2GQ9A 4I9JA 1G4TA 1T6MA 1HJQA 3ARXA 3M0JA 3OIHA 3QHMA 1OCJA 1H1ZA 4WDXA 5HQEA 1OY0A 3E0IA 3VNLA 3D6NA 2DSVA 1TJRA 4EMIA 1DTNA 1AUSL 4XZLX 4QEHA 5DCBA 4NZ3A 1J93A 2AAAA 5A8MA 4JQ9A 4WUIA 2DSUA 4GUIA 4XZ9A 1UC5A 3G1RA 4AD5A 3EDFA 3BAIA 3H4XA 4UTMA 2GYIA 2CKRA 3S6OA 1W9BM 2PSNA 2WZTA 3TNBA 4NY2A 1XX1A 4AG0A 4EM4A 1M9HA 2CZDA 3EDJA 1K9EA 3AU2A 2VC9A 4S38A 1JFHA 5CPMA 3UGRA 3ZFHA 4B5SA 4F48A 2DZPA 3IRSA 3ARQA 5I3KA 5IBXA 4LNYA 3BE7A 3NSXA 3OLEA 1A49A 3ARUA 1S5TA 2QUNA 3DZ1A 3W86A 1TO3A 4W89A 1EP3A 1XD0A 1DWFM 1U1JA 4O0QA 3BURA 1M6IA 4Z0SA 4BEUA 2E28A 3LCLA 1X96A 2PU1A 3O8AA 3K30A 3KWSA 2RJHA 4AXNA 1R9YA 1W17A 3SCVA 2PWEA 2Z29A 2FDMA 1R3TA 3S83A 1IWBA 1JDDA 3SCRA 3SUVA 3RM8A 2YXXA 1E6XM 1SJDA 1Q2SA 4MM1A 4N4PA 4AW7A 1JYVA 4NJIA 3GBDA 5KINA 2QLYA 4MZ1A 4PFMA 1VCVA 2BS9A 3HG5A 3BAYA 3GC5A 3WLQA 4QNWA 1XRSA 3KL5A 1F3PA 4JEJA 1IYXA 2QV5A 4PUKA 1H7OA 3A21A 4KCTA 4F2TA 3CQKA 5M3WA 3A4JA 4DO7A 1VFSA 5ENLA 1NDVA 3ETRB 3QY7A 1GG1A 2NQJA 2CZVA 3MCNA 4UQCA 2NV1A 2YL5A 4JQ4A 4H6RA 4PCSA 1GVIA 5DO8A 5F1VA 4JHMA 5H91A 1Q6RA 5AN7A 5FD0A 2WK2A 2ZZ2A 5AY7A 3CPUA 3W29A 4U4MA 4ZCWA 3E9AA 4GI9A 5C9RA 2H3BA 3BG3A 5K9XA 1WKFA 1NWTA 1P0NA 2QDEA 4TX9A 2W5FA 1PZ0A 5KTLA 4AX7A 2FVMA 2Z6JA 4ZE5A 1HF6A 3ZR5A 1JULA 3ARWA 1ISXA 1HXJA 4B16A 1VEPA 1TVLA 1QI3A 2Z7GA 4GY0A 3UJSA 1KCXA 2JK2A 1M7JA 3N3TA 5MHBA 2ACQA 4Q8NA 2XSBA 4H04A 4Y90A 1G4SA 1H60A 3P81A 1UIPA 3MYOA 1R0MA 2QV4A 2B4GA 2RDTA 5CLWA 1ZP4A 4FLQA 3G3MA 1UBSA 4PUEA 1P7TA 2V5CA 4GX8A 1QPNA 1RA5A 1JG9A 2Z6IA 3B4YA 4JHOA 2Q3OA 1KFBA 1VPYA 3C2OA 3AISA 4QJ1A 2PWHA 3KHDA 1HIZA 3CQJA 3UXAA 3AYVA 4I8DA 3DERA 4ZSTA 1UWUA 2QCDB 2PE4A 3S2CA 1I8JA 3ZVHB 1NU5A 3HQOA 2OJPA 1XCXA 1E15A 5CG0A 3LLXA 2ZRXA 3WK2A 4Q8WA 7ODCA 2O9TA 1IR2A 4V1XA 3TW7A 2CYGA 3B9JB 2D2GA 2QPXA 1IQ8A 1GYNA 4PTMA 1UOKA 1FX6A 3M5VA 1KWGA 1OGGA 3DG7A 4XKYB 3QYSA 2WLYA 3DYPA 4AIEA 4GJIA 2OEJA 1E5JA 3EWYA 1ADDA 1KQZA 2NV9A 1RBAA 4FX6M 4Z2IA 1IT7A 4LBRA 3T7VA 2OB3A 2IUZA 5BMWA 4Q8MA 3GUWA 1TPH1 1ECQA 4LNCA 2CESA 2G3FA 5D33A 1O12A 3CZLA 2X8GA 3SZ8A 1GQLA 1B2YA 2ZADA 1KFWA 1W9XA 3TR9A 1ZTVA 1G1YA 1LTDA 5EMJA 3VMNA 3U57A 3T2QA 4LANA 1XISA 4JN8A 1K6WA 1QNSA 3TR2A 5EPDA 4Q8TA 4MUZA 3KOZA 4JTIA 3TSDA 5CZKA 4LVFA 4QTGA 4S23A 3AMLA 1H7PA 3BLDA 3R0DA 3I3EA 2BY1A 3W0KA 4P2VA 3VGDA 2OR2A 3ZQ9A 3LXDA 3PZTA 1K3UA 2VCCA 3DGRA 4H6EA 2NWSA 3THUA 1R85A 2DUAA 5GJPA 3W1TA 2DDXA 4KWVA 4A8IA 4FHAA 2XVNA 3NPUA 4X60A 3I7RA 4A8NA 3BSHA 1GHSA 4DB7A 3F4NA 4Y9NA 1YPIA 3TMLA 4K8HA 2WPEA 3W1RA 3BCFA 1E6SM 2X8RA 3UXDA 1XL9A 5TBOA 4H8NA 4UTWC 1H41A 1LORA 3SRKA 1RCXB 3M46A 1GGOA 2EG6A 4RZBA 1CLVA 3M0YA 1KBBA 3N2CA 2PFHA 4B2DA 3PWAA 1BG9A 4DNHA 2VFIA 2YIHA 3MANA 4RV8A 4D8LA 1LBMA 3RNMA 5LA0A 2GQAA 4L6DA 3UZZA 3NXFA 1UKSA 1RJRA 4UOJA 1MNZA 4O18A 5CZJA 5FAGA 2WQDA 3F4DA 2WSPA 2P10A 1LQ2A 3P2VA 4GYJA 2BOEX 4QRNA 1GEQA 2B7OA 4IMEA 3WMCA 4HPXA 3U2CA 1E4MM 5HR7A 4PTWA 2ATMA 3LHVA 1MUMA 2YCEA 4HMNA 4L56A 3KP1A 2BLEA 3TMQA 5BRBA 5I03A 5FS9A 1YPXA 3THCA 5D9OA 1JD7A 4UFKA 3O0KA 4WY0A 2CZEA 3QTGA 3N04A 3NVZB 4WJEA 4ZMGA 4RX0A 4IQJA 3WKZA 4M8UA 4UTKA 3FV9A 2IKJA 1KBKA 4U3AA 4AZGA 4QROA 5TAOA 2YDAA 1XPYA 3DENA 1VDVA 1UH4A 1UPPA 1ZL1A 2Y2WA 3N4EA 2BVTA 4J3WA 4E8DA 4N6FA 2NQHA 5K9DA 2Z00A 1L9WA 1ZX9A 4OKDA 3Q6JA 3UWWA 3KAOA 1B54A 5AC8A 6A3HA 1QHPA 3TW9A 2WNQA 3U8GA 3UA4A 4Z1CA 2CLKA 2E77A 1OF6A 3QH2A 3VOGA 2DZUA 3KRZA 3GG8A 1XDIA 4JKKA 4FNUA 1W5QA 3RHGA 1TPB1 2C6QA 2I1OA 3ENLA 2WM1A 3NNTA 2INEA 4NZ5A 2CLIA 1UKTA 1OX5A 1TWZA 3RCMA 1XI3A 3S1WA 5H2ZA 3R7MA 4E2OA 5I00A 3D5HA 6ENLA 1MSSA 4LT9A 3OTRA 1VJZA 5GNXA 1GRHA 1Q6CA 3W2LA 2I5IA 3KBMA 4JYFA 2PI6A 3KHJA 1LJYA 3O07A 3P74A 3H2MA 3BDKA 4E4PA 4YWIA 1OX6A 5T91A 3R89A 5BZAA 4BWLA 5DX7A 3UWVA 2WP6A 1A4LA 3AMCA 2ABBA 3MDUA 5A94A 2YCKX 3LK6A 2CLLA 1EC9A 4JKMA 5CPNA 4JQ3A 3TQVA 1N8FA 1GRFA 4B5VA 2X1TA 3O3RA 2CFYA 4IF2A 3LM3A 4REQB 4DQWA 3A6OA 3F4CA 5AYZA 4HNLA 1YBQB 2NXIA 3RN6A 4JXCA 1M01A 2Z1WA 4LSBA 1PAMA 4E2DA 1SO6A 1W9PA 2CLOA 5C2CA 1PIFA 3CWOX 3NZPA 2NX9A 4JTRA 2A3AA 3TFXA 1KM1A 1PZ2A 1PWLA 3GIYA 2OOGA 2TRSA 2PODA 3MMTA 2E5AA 2WQPA 4D6FA 3A12A 2Y85A 4BS0A 5D9PA 1WCGA 3B3DA 2IQDA 4L4PA 1EH9A 4MWAD 2WPBA 3UP8A 4TIMA 3MPGA 2EHHA 4EQSA 1XPGA 1LT8A 4NYUA 1E3ZA 1F6YA 4JIEA 3W2UA 4RZ4A 3QRHA 2Y61A 2DZBA 4LTSA 1S3TC 1TWSA 5MKGB 1VS1A 3BMWA 4P7RA 3TW6A 4LVBA 4HOXA 5HUPA 3WH6A 2PDLA 2DT3A 3PF3A 4UQEA 5JCLA 2JQXA 2XVGA 4ZB5A 4H9UA 3RLVA 1J01A 4DLFA 1K8CA 4PUUA 2A0NA 3EWUA 4OTKA 1ZFJA 3B8UA 4O8RA 1CYGA 4AXKA 1HX0A 4CD8A 1TZ9A 1X2HA 1AOGA 4JTSA 1GWJA 1PDYA 1SZFA 1UQZA 2OEKA 3BANA 2HDJA 3AHVA 2E1DA 4R9OA 4MNLA 4JTEA 3U4AA 1DJNA 3DDMA 5CGQA 4YCOA 1L6GA 3DEQA 5CLTA 3MSRA 2I16A 4KGJA 4ICNA 3MVTA 4EE9A 3PZGA 4LRTA 3M6YA 1G4EA 3K2GA 1C9DA 1QU4A 2YR1A 3SM0A 1M6JA 1AQ0A 4FR1A 2G41A 2V2HA 3SECA 3LRLA 5E6YA 1LRQA 1FWSA 1R87A 1SW7A 3UCCA 4IMGA 4HNOA 3EAUA 4H9TA 1OCBA 4L65A 2VWSA 4C5YA 3WUGA 1EJXC 3H7VA 3GDTA 3FHAA 1PZ1A 1Y0EA 3W07A 4AISA 3H7UA 1EIXA 1UIOA 4W5UA 5D04C 4TVWA 1JROA 2Q3RA 4IMDA 2YKKA 1JVNA 1H1YA 1JGMA 3BLLA 3CXOA 1UA7A 5F4XA 4D71A 4PE8A 1PCKA 2H9AA 1VYRA 3LCWA 5EMKA 1JZ5A 1MO9A 2V5KA 3Q2DA 4AC1X 2AMGA 4WEVX 3BARA 1TVPA 1QOQA 3AC0A 4GVIA 1PX4A 3VCNA 3HQNA 4I9AA 3CGBA 1ZJBA 3V35A 1DJZA 5A2AA 2XIIA 5BXRA 3NVYB 2EQDA 4LBUA 3KRUA 3NSNA 4EF9A 4MYXA 1RP8A 2A1YA 4Q6XA 2WO5A 2GJNA 2YVGA 3T0CA 5HJLA 2GGJA 1SJAA 1FWHC 2VFHA 3G0XA 4U10A 5I3JA 4UFMA 5J5DA 2I14A 4JAWA 5BYWA 1UZDA 1C7SA 2WANA 4MAVA 3WNMA 2A79A 5HMDA 1I0DA 4HNNA 3VYLA 2ZRZA 4DO5A 3OYXA 2POTA 1WUFA 1STZA 1FFUC 4L7ZA 5D8ZA 2J9YA 2HCVA 2G4FA 1OJTA 4YJ5A 2TSYA 5IRPA 1XYBA 4NIRA 3ZR6A 4ZQOA 1J10A 4C6IA 4PCPA 2ACRA 4GFSA 2OYLA 3H4GA 4NYYA 1M1BA 2Y7FA 3A9BA 4EPBC 1EBHA 5I5RA 4XO7A 5HPOA 3DFNA 1VAHA 1FWWA 2ZZ4A 1A53A 3BG5A 2LLEA 5LNRA 4S3KA 1YXYA 1TX2A 4PTNA 2WHLA 4A3UA 3L2IA 4C6QA 1SPQA 2HRWA 4XD6A 5ABEA 3FYOA 1DQXA 4MNJA 1U33A 1UR8A 1LOLA 1PCWA 1GQKA 3H21A 1D8CA 4IIGA 4K8EA 2VQTA 1K9DA 2HZGA 1UWTA 2O4QA 3PBVA 4EIVA 1SSDA 4IMFA 2YFOA 4GUHA 1M7XA 2Z1VA 1NDYA 1GYMA 3OGRA 2QCHA 3AXKA 4L9ZA 3CV6A 3Q45A 1J0ZA 3FOKA 4XG1A 2DZWA 2MNRA 3A7UA 4A3QA 4AF0B 2Z1BA 3H24A 6CGTA 4NEWA 4PN2A 1ESWA 1KC7A 4JZ5A 4YHGA 3BICA 2CFFA 3LN3A 4ADSA 1WB0A 1XH0A 4NXKA 2D0GA 1XINA 1CXHA 1S2TA 5FS6A 3SCPA 3M0HA 5I2UA 3SN1A 4URIA 2BOFX 5LHFA 4IWWA 1YDVA 4W84A 1OIMA 3XIMA 2B81A 4DJFC 2ZWZA 3W7DA 4V27A 5HA7A 1ICPA 4CU6A 4GYFA 2C13A 3RX4A 2BSLA 4JDBA 4DM1A 4K68A 3VILA 4BI5A 4JTGA 4JQAA 1KW1A 1JIBA 3APGA 1FECA 3HGOA 4ERIA 4RPPA 2TMDA 1R86A 3DC8A 3U7BA 1VF8A 1PSCA 4ZTYA 2YW3A 3TKFA 1JQXA 4X3ZA 3Q65A 2QJIA 3WNPA 4E2VA 4L1GA 2QXWA 4MHBA 3N2BA 4LAZA 4JQ1A 1HTIA 1XGDA 1C8XA 1Q1WA 4HPNA 1ELSA 2AAMA 3WBEA 1T99A 4F0LA 1CGVA 5CPOA 5D32A 1J5SA 1UW9A 2NLIA 2X42A 1FP9A 1HVXA 2PWFA 1U1UA 5IFPA 2A3BA 5HAOA 1FHUA 2QJHA 2OCZA 3B0YA 3EGJA 2X0HA 3WSUA 3O1NA 3P80A 4GVGA 2A6LA 3OIXA 4W8BA 4P61A 3AI0A 1X1ZA 1W1TA 2VFFA 4OWGA 2XVPA 4C6KA 4F4RA 3WFZA 4BZYA 4KIEA 3L4VA 1Z41A 3KE0A 1MFVA 1GVQA 1XFCA 2Z24A 2VFGA 3I7QA 2E67A 2QCNA 4KCUA 3BOXA 3PFRA 1CWYA 4GLEA 3A5VA 3VKBA 3ZSTA 2OELA 2X09A 1JJKA 3NL2A 4L5ZA 3SY5A 1LWHA 1ZS2A 2D24A 3B40A 4DZ5A 3OZMA 4JIHA 5ECVA 3LOTA 5C8BB 1ODZA 2EPLX 4A35A 1R5YA 3WD1A 1M3UA 1CW2A 4JY9A 2C15A 3IJIA 3VCCA 5M2FX 1RALA 2D0FA 1OD8A 3UR7A 2V81A 1N60C 1T41A 4KT2A 4MB5A 1OYBA 2DIKA 1W1B1 1ZBVA 3FXYA 1BVZA 4JTDA 4LPCA 4DBEA 2V69A 2OGJA 3NQ2A 2BCPA 4HK6A 3DBPA 1PX3A 4BEQA 1G01A 2A7NA 4EK7A 4A3YA 2DH3A 3PN8A 7CGTA 1R30A 1YKWA 3R25A 4AC7C 2ACUA 4O16A 1TWDA 1CGUA 4Z0JA 4YYFA 2PA6A 3REQB 4GQGA 3ONBA 3POCA 2J77A 5XIMA 3UQNA 1VJIA 1FWJC 2R1MA 2CLPA 1X39A 1YLVA 2Z1XA 4JY8A 2Y1HA 3QFEA 1QI4A 2D20A 4Y9AA 4PUMA 1OADA 8TIMA 1X8CA 1P7TB 1BTCA 2W9MA 1BXCA 4NX5A 4BQ2A 1WYGA 2C8NA 2NUXA 4MWAC 4LVDA 3M1ZA 1C92A 5DRCA 4E2BA 5ABTA 4UFLA 3HO8A 4W88A 4QISA 5F4SA 2HTMA 4WOQA 1WV2A 3KEHA 3TSMA 3LGDA 4V33A 3GH4A 1H09A 3F4WA 3H2NA 1UUOA 2D2JA 1D3CA 1IWAA 3L21A 1JUBA 4J40A 4WJ8A 3BLKA 1EWDA 1J4EA 2WYSA 4MPQA 2VX6A 3R8RA 4LUIA 3CQIA 2ZZ7A 3VGGA 5F2GA 1QNOA 4F40A 4UFJA 4W5ZA 2FJKA 4XZBA 2E3TA 2AOSA 3ARYA 4AIUA 3NQ6A 4B5TA 5CPTA 1KO0A 2X8CA 4FO4A 1F74A 1I75A 4OBSA 4D1IA 1MEIA 3BW3A 4QE5A 1UMYA 1W1A1 4K2SA 4QFUA 2PDJA 3EA2A 3K8LA 2JEQA 3R0UA 4R9XA 4B5XA 2F9RA 2I57A 1GTEA 1S5VA 2OPJA 4YLWA 2AQVA 2W91A 2FH8A 4YTSA 3LUTA 5AVNA 1TWIA 1POJA 2PWGA 1FUYA 3PPFA 4RNIA 1TE6A 2OO6A 1RLCL 3MTWA 4ZO8A 2WM0A 1FCBA 3TTQA 5HJXA 4GQRA 1XQKA 3QMTA 3PZMA 3W7JA 3SRHA 5I79A 3L12A 2L5HA 2G95A 1HJWA 3EA3A 4Q4OA 1A47A 5F4WA 3WFLA 1EUNA 4UOQA 2CITA 4LJ3A 2VD8A 1NWSA 4IOTA 2XFFA 1UJPA 3MA8A 2PURA 5A6KA 1H49A 4HN4A 3TNOA 4CQAA 2J27A 3VKAA 3EDKA 3HGRA 3ARZA 5C7HA 4RR4A 2DP3A 2AKMA 3T2PA 3DFQA 4BF7A 2R14A 4TVDA 1XLCA 1BGAA 5CSUA 1O66A 2VEIA 1W3NA 4A22A 1KKRA 5JIWA 3BG9A 4UR8A 1H4PA 4IUOA 3MWCA 3C2EA 3IUIA 3WUBA 3PBUA 1K9TA 2P76A 1WKEA 3W73A 2YA0A 3FKRA 1JEZA 4E4FA 1KM5A 4BFAA 3SIZA 3QZ6A 3AXMA 2YDSA 1QXLA 1XG3A 2R1LA 3UZJA 1MVYA 3PBYA 2J74A 3V5FA 4ENLA 1AZ1A 3CBWA 3GFXA 4S3CA 1UZHA 2HE8A 3G0SA 1BFNA 4Q4MA 3D9XA 3WBAA 5EMUA 1FFRA 4XSLA 3IGHX 5HUOA 3RJYA 4RDZA 1KFJA 3T07A 4L61A 2H8XA 3QOMA 4XAPA 1AMYA 4C6BA 4PBGA 4ZODA 3T0DA 2DW6A 3SBFA 3AM9A 2C1GA 1L6SA 4ZO7A 3ARTA 2V38A 3FLUA 5M17A 2VVNA 4QLJA 2D69A 3LHUA 2BODX 4WY0B 2BMBA 2PRHA 3SQSA 3MMWA 4OECA 1D7KA 3P6LA 3KOYA 1GOWA 3CL8A 1E0UA 4A2SA 1Q63A 1E9YB 2A3CA 2KAUC 1BRLA 2XFWA 3EOEA 1B3WA 2ODOA 1K7XA 1BXBA 4FNSA 4L80A 1XIJA 3W7OA 4IMAA 2G50A 3AUJA 3LB0A 2WPGA 1XBYA 1UOZA 4P8XA 1ZB5A 3S5OA 3GHTA 1B9ZA 3FSUA 2QAEA 2PD5A 4MUPA 1GZJA 2FPVA 2ALRA 2BC0A 1X1OA 2QJNA 4P8WA 3UR5A 3NPVA 3E2SA 2YOCA 4MMWA 2WC4A 4F9DA 5T9BG 3TYUA 3CQHA 4JTUA 3OOQA 3GXFA 4JNZA 3B97A 3TXVA 3D0CA 4IXXA 3CUIA 5G2WA 1O5RA 3VIIA 5AHMA 3RMJA 2WVVA 3TTYA 3ID7A 4K3ZA 4HIBA 3EMCA 5I3HA 2WKLA 4Q7IA 2PDCA 3F5KA 4N4QA 2NVDA 2BB0A 2CHRA 4ICCX 5HNNA 4LFYA 1XLAA 2FJUB 1TB3A 1YPFA 4LQ1A 3SURA 3FW6A 1ODUA 2CKSA 2P8CA 4JTJA 1J9YA 3TOYA 4I9TA 5CC3A 3ATZA 1IGWA 3GK0A 3DC0A 4CCEA 3WBXA 1VBRA 2PS2A 4O17A 3I68A 3WD0A 4HHMA 1B31A 5H8PA 1PB0A 3AOFA 1WDDA 2PGRA 4P7NA 5CJMA 4KF1A 5CZ0A 3WMSA 1DJQA 2E8ZA 3FFSA 4J3XA 4OFCA 4H6KA 4CNNA 4HMDA 4EOUA 3QV9A 3WQWA 2OWXA 4GXPA 3I10A 2P3EA 3NO5A 1V79A 3A4XA 4MF4A 1S46A 5C7VA 1F7BA 2J7GA 3LHYA 4RNHA 3EPMA 3G0UA 5CAKA 4A05A 4JICA 4L4MA 4JYEA 1XLLA 1U22A 2PDXA 2D3NA 1KCZA 3OQ8A 2NUWA 4WXZA 4XZNX 1J0JA 4QCEA 4TR9A 3GE7A 5D9NA 2POZA 5DBUA 1PDZA 4GRSA 2OZ3A 4P7QA 3GRIA 2F84A 1XIFA 4AU0A 2HVMA 3N17A 3NRZB 2PTWA 4J3VA 2VRQA 2VNCA 2YVFA 1BQGA 2EXOA 2Y7EA 1CENA 1Z32X 3QQWA 2DZVA 4ONVA 1J18A 4D2JA 4DUVA 3NQCA 1XC6A 1KGXA 2IKHA 3BOLA 4HCDA 4K1WA 3H4WA 2QUMA 1J0HA 1KD0A 1SO4A 1LYXA 2C0HA 1QHZA 3TN4A 2Y4SA 4L6OA 2WWDA 1EQPA 5DMNA 3EEGA 1DIKA 2Y63A 1CGWA 3EPNA 2B7QA 3SUUA 2QKFA 4LC6A 5A6MA 3CB3A 5HWJA 1H63A 1HT6A 1FEBA 4DWDA 1EEXA 1NELA 1X6NA 3QM3A 5DF0A 3VD4A 3GIPA 4GJ1A 1MQQA 4EKJA 3M47A 1TV5A 4GUJA 4O8AA 4JR5A 1GOOA 4JIPA 4M80A 2W66A 2PF8A 3W7IA 4LW7A 2X05A 1I4NA 3TDFA 1WUEA 4ZFMA 5C2GA 2HBVA 1EUAA 4DAIA 3G1VA 4O1CA 1LCOA 4D1JA 2Z2AA 3QVQA 2VVSA 4MFDA 1JL8A 3QZAA 4N7QA 5C2XA 1K7FA 1W54A 1QW8A 4GUGA 1UUMA 4KWOA 4LUYA 1GORA 2PTZA 5G2HA 4TOQA 4PEKA 4XZWA 3RITA 2X7VA 2WBAA 3VOCA 5DMMA 3TN5A 3VOFA 5AC7A 2PDQA 4GA8A 1JF6A 4DO4A 1KRAC 1ZJIA 3OVQA 5G5HB 2XGIA 1V3IA 1TRIA 4OIFA 3L4ZA 3R07C 2NQ9A 1TREA 5JCNA 2HBXA 2AGTA 2FB2A 1DYSA 4C6OA 3CTLA 3P7YA 3CMGA 2WMGA 1JPDX 1F3XA 5EL1A 1S3HA 1EA9C 3EWBX 3Q58A 4JPGA 3MI2A 3DYOA 4KESA 1TJ1A 3KTSA 3H55A 4GH3A 1PE1A 4M1BA 4CVUA 4KKXA 2VHLA 3T81A 4GISA 3GWQA 1H7RA 3S6DA 3AJXA 3MKVA 2WJZA 4MY1A 2WOIA 4IT1A 2F6UA 1X8FA 1PV8A 3E6EA 4PTDA 5FA5A 3LBCA 1GVSA 4JDRA 3EKZA 4NEVA 3CHDA 3OHMB 4EMWA 5KVIA 5IXEA 1EPVA 4JNYA 1DXEA 1UWAA 2VL4A 2BXVA 2FPTA 2VI0A 4ZB2A 4WK9A 1RV8A 3VDGA 4MFEA 1P6BA 2NLYA 3W38A 4MY9A 4LEQA 1L6WA 5F2MA 4MKSA 3IIOA 2J13A 3QHOA 3O0HA 1TPEA 1SZRA 2Q8ZA 1CDGA 5HMEA 2QJJA 1QNVA 1JFXA 3IJQA 3RRAA 3O16A 2CLFA 3CGDA 3OHIA 2Y8UA 1QDSA 1V02A 1WQ5A 1OC5A 4I6VA 3STEA 7REQA 4ZZ9A 2PEVA 3UVAA 1EHNA 5MF5A 3L5OA 4EQXA 3U0HA 3IK4A 3DFYA 4XK2A 1W8GA 1XIBA 2R91A 3UYIA 4JEQA 1Q6GA 1TA3A 3A13A 2ZZ0A 1ZDLA 1KN0A 3HF3A 4CKQA 1MW0A 1UASA 1ME8A 3PZUA 4LF1A 2V3AA 1N63C 3WQFA 1ZQ5A 1W3TA 2RABA 3UG3A 3MSGA 4PL1A 3PZ9A 1PXGA 3WDPP 5D09A 1GK8A 2PGFA 3CZ8A 1DTUA 5ABGA 4PRTA 3HB9A 3VD7A 2EEXA 3AS1A 2CWNA 2J7BA 5I07A 2E5BA 1UD6A 5HQLA 5A6LA 2VC6A 3RLHA 3I4EA 5BU9A 1OHLA 3MV01 3AICA 2PPGA 4ZGYA 4GABA 1KFKA 2BV9A 4ZXOA 3OVGA 4G6CA 3LB8A 3NOEA 1NAL1 2YBUA 3EXTA 2D0HA 4Z2LA 3CTTA 3CM4A 3L0GA 6REQA 4FNRA 3W1QA 2VKZG 1B4KA 2ZUSA 1DXFA 4XIMA 3B4UA 5CH9A 4B5WA 2VURA 4FEZA 3W37A 2Y70A 2PU0A 2X2YA 3EMZA 4GH1A 3OBEA 3CEUA 2Z27A 1AL8A 1NF7A 2ZZ3A 1SVDA 5EBAA 4IPJA 1OGBA 3M6DA 4AZ7A 1QTWA 1JCMP 3TX9A 5BOFA 2ZIDA 4N9DA 1IV8A 3VIMA 4K8DA 1DEDA 2J79A 4DPQA 5D37A 2DSZA 3W1XA 4LRSA 5G5GB 3KOFA 2Y8KA 4G1NA 2BG5A 2J9ZA 4GI8A 3G8RA 1PBGA 4D6GA 5GVJA 3QPYA 4GVHA 4DBDA 2J25A 1ONFA 3WNLA 5CZTA 2JGQA 2WJDA 4S3JA 4GYPA 4WXYA 2ZQ0A 1BYAA 4NNBA 1F4AA 1PJ9A 4NG3A 4AHPA 2ZXQA 3E0FA 3M41A 4ROPA 1YX1A 3MO7A 1Z9AA 2A3EA 3G1SA 1VGAA 1PS9A 3AMKA 1XWYA 4XV0A 4WSHA 3TP4A 1K8XA 1GONA 5AYYA 3GD4A 4GO8A 3UVIA 1Q66A 1WKDA 3HPFA 4GG9A 3BAJA 3MDWA 1GJPA 2ZZBA 2BGQA 4LUTA 3PFMA 1Q1RA 1V3KA 1SJCA 2NQ5A 2JBMA 3R4IA 1H50A 4RXFA 3CT2A 3ZVIA 5K4ZA 1Z44A 1TMHA 2A7RA 3C2FA 4WDTA 1IE7C 1OGSA 3CUGA 4NNCA 3LV6A 1IT8A 4NXSA 2OU4A 2ZZ1A 3ISIX 4RNFA 4DBWA 2PCQA 4H8VA 3V36A 5JCIA 3CWNA 3OG3A 3NDYA 1UWRA 1RLDA 2X0SA 3C52A 1V0NA 3JRKA 4JTKA 1DORA 4XVDA 1H5VA 4DNAA 3FJ4A 3CLMA 3GKFA 5EMMA 5AOUA 1F4HA 4PB3A 1OSEA 2TYSA 4KEZA 3VVGA 3SSZA 4R3UA 1SU5A 2QJGA 1B3OA 3HG2A 1FWFC 4KERA 3ORWA 3GHSA 1MOKA 4HT3A 1PKNA 2ZE0A 3UERA 4P5UA 4MADA 4UTIA 4O1AA 1GPWA 1WDWA 5L6UA 1VPXA 3B06A 3QPEA 1BKHA 3FK4A 4GXWA 2X1UA 1E6RA 4HZ8A 3EMQA 1EO5A 1RXOB 3FYPA 5I7GA 1BEUA 1WBJA 1IXPA 1MXSA 3F03K 3K8MA 4HK5A 2C1HA 3NG3A 4HZMA 4LC8A 4DJEA 3W6YA 4JTQA 2XH7A 3F4VA 4QNEA 3PULA 1WZLA 3T08A 3QFBA 3BVJA 1HO4A 4PBEA 1FA2A 2R6OA 1CXKA 1EGVA 1ISVA 4PBFA 1GETA 2UY2A 3M4HA 4J3ZA 3LSCA 3T42A 2AQWA 5AZ0A 5FESA 4UQBA 1F07A 3B9DA 4JIIX 3K1DA 3R13A 3VNYA 3PR2A 1KV8A 1DV7A 4LAOA 4ZO6A 2TAAA 1RY8A 1Q7ZA 2VX7A 2BY0A 4PEEA 2NPXA 4XAYA 4U2YA 4HQVA 5LNSA 3RX2A 2X1IA 2GVLA 1YTDA 3RMEA 1GOMA 2J7DA 3LCFA 1W1ZA 2P0OA 1S2AA 4PMOA 4UC5A 1Z69A 1NPXA 3V0UA 4H8UA 2AL1A 4KBXA 2PLCA 2XIJA 4B9YA 4FX9A 2BXZA 4H9ZA 1UPMB 4AB4A 2P0IA 3FJNA 4Z1BA 2Z2BA 3CAKA 4O1FA 1E56A 4RPQA 1AG1O 4LU0A 3W7EA 3L5MA 2E1WA 2YBTA 2NZLA 4N02A 4YYCA 4ORMA 3LHZA 3HN3A 4H4TA 1OFPA 3N19B 1EZ2A 1EB3A 1R3SA 3W00A 3P84A 3KVLA 4DI8A 1GOIA 3UCDA 1HJSA 3JR2A 3SN4A 4BK9A 1BGGA 3V5OA 4ZB0A 3EB3A 1QPQA 4AWTA 3KVJA 2BVWA 3BJFA 1D9EA 2WVTA 4XBSA 2XFRA 2ZC8A 3VC5A 4F66A 2GQWA 3NVWB 2HROA 3IIPA 1I6NA 3WEOA 1JI1A 1K8YA 3FHQA 1JPKA 3EX4A 1FH8A 3OJGA 1KFLA 3UJEA 2G96A 2DUXA 2QNEA 4NASA 1GG0A 1HN1A 3IC9A 3L4UA 2PUZA 1UROA 5ABFA 4I9MA 2GR3A 1KRMA 5FS8A 4KQNA 5EMLA 4KPLA 2CZ5A 4LXFA 4JFUA 3MKCA 1DWIM 1E4NA 1HVQA 3KCOA 5C9UA 3IWPA 3VD9A 4IP4A 4M5PA 1VB9A 3BLEA 3VE9A 4WGHA 2J88A 4Q32A 3QV7A 4HA4A 3NXLA 3SQPA 3CU2A 5CSSA 3K4AA 3U6WA 5AHEA 1U30A 3C2YA 3W70A 1IWPA 4GI4A 3DU0A 5C70A 1ZCCA 4QITA 3G2GA 3SEPA 1ITUA 3A5FA 1J6PA 3PP7A 1AL7A 3B03A 1C8YA 4IX0A 3CC1A 4YMZA 3WQDA 2ZUMA 3CXBA 1LWJA 5FEZA 3WQGA 3MHUA 1BXNA 4HJWA 3GUGA 4C7DA 3KS6A 1WPCA 2CXEA 4BI7A 1T5AA 3V5CA 4Z1YA 2GUUA 2GDVA 2YFNA 4J9JA 1M41A 3LENA 1U83A 2O7SA 3ES8A 1GREA 2D22A 5CC6A 2J7EA 3HG4A 3K46A 3EWZA 4MYAA 4H4YA 1W6TA 1SM9A 2V6AA 2E25A 4M3PA 1R2TA 4PUJA 2WJFA 1W5OA 4H9MA 1XUUA 2YZRA 2XH0A 3IGXA 1PTAA 1NIUA 5T26A 3SB0A 1H2IA 2QVHA 2EPHA 3R6IA 4JL2A 1SMAA 5IOBA 3WYZA 1KXQA 3S2LA 3VUSA 1H61A 4YS1A 4PRWA 1YYAA 1RJPA 1EYWA 1R9XA 3D46A 4CGTA 1WA3A 2F6XA 3S1GA 3ABXA 4LGXA 3OP2A 4UZSA 3BPWA 4LV4A 3EANA 3A3XA 1YRRA 4IFOA 5BWAA 1R46A 3EOUA 3ARPA 4RNJA 3ABRA 4RE4A 1LRTA 4AY1A 1VQTA 1A5BA 3W1LA 2DZXA 4KEVA 1PYFA 2ASHA 2ACSA 2CLHA 4O19A 3HFTA 4RDVA 4DRSA 3M9YA 2HE5A 2WVVB 5CQ1A 1BYCA 3LZ3A 2F8QA 3QSTA 1HKKA 2ZTJA 1EPXA 4DO6A 3PZNA 3UWZA 2G3IA 5D4YA 3CYVA 3UBPC 3A22A 3CUXA 1LQAA 3VMPA 1VYPX 4CQ8A 2RKXA 2OYMA 1Q4WA 2QAFA 5CGTA 1K7EA 3O6AA 3OLGA 1TELA 4EAMA 5JQ9A 4GFIA 3SCOA 2BY3A 4RDYA 4F0SA 1NWUA 1AW5A 1F8IA 1EOMA 2FZNA 3GNNA 3E74A 1GZGA 2OODA 3LMZA 1E4IA 3B9NA 5HPCA 4H8HA 2YCLA 3THAA 3M43A 3WLTA 3F7JA 2NQZA 3IV3A 2QJMA 1DJXA 2NW0A 1G69A 4CCCA 1QCWA 5T9CE 1DE5A 1OT2A 3PAOA 5M5DA 3NPWA 3P14A 2VWTA 1KKOA 4APNA 2ZX9A 4H2HA 3HJZA 1NFPA 4BJHA 1ONWA 1ZMCA 5E09A 3R2GA 4JQ2A 5CPLA 2I5GA 3CUJA 2P88A 1TYTA 3M0VA 3OODA 3VNKA 3BLFA 4EMJA 2VZUA 4QHRA 5EA9A 2E09A 3VU2A 1F8WA 3MJYA 3TYCA 3MVIA 3BJSA 3T78A 1XQLA 2QCLA 3BQ5A 1HZYA 2F38A 3BAKA 2PDMA 3LXAA 3SCUA 3GR7A 5TF0A 4CVWA 2E4TA 5D8WA 5CBBA 4J3SA 4F9JA 1E6NA 1A50A 2ZX6A 1RSCA 3UESA 3K13A 4LCQA 5E9AA 4EQRA 4NILA 3HURA 2WPFA 2YSWA 4RKAA