4KEMA

Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
390
structure length
390
Chain Sequence
MRIVEIREQTAGIKSDIANAFIDFSQMTCSVVAVVTDVVRDGKPVIGYGFNSNGRYAAGGLLRERFIPRLMSAAPDSLLDETGENLDPFRIWTRLMTNEKPGGHGERSVAVGTIDMAVWDAVAKIAGVPLYRLLADRFRGGVADDGVWVYAAGGYYYPGKDVKALQDEMRSYRDRGYRVVKMKIGGAPLAEDLRRIDAVLEVVGSGDNLCVDANGRFDIDTAIAYGEALKPYGLFWYEEAGDPLDYALQAELAKHYDRPMATGENLFSHQDARNLIRHGGMRPDRDWLQFDCALSYGLVEYLRTLDMLKENGWSSRRVVPHGGHQMSLNIAAGLHLGGNESYPDVFKPFCGFADGIAVEDGRVRLPDLPGVGFEAKSELFATMSGLLGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
rcsb
source organism Azospirillum sp. b510
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 140
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kemA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kemA01
3NO1A 2P3ZA 1EC9A 2PMQA 2PP3A 4ENLA 3BSMA 3R11A 3N4EA 4JN8A 2GGGA 3UCDA 3OP2A 2QDDA 4KPLA 3P0WA 3U9IA 4E6MA 4GYPA 3UJFA 4EWJA 4Z1YA 3CAWA 4H19A 5FJOA 3SQSA 3ZLFA 2XH7A 1MDRA 3H7VA 3D47A 3D46A 2HZGA 2OFJA 3UJEA 2PTWA 3TTEA 3ES8A 2GDQA 4Z17A 1PDYA 3VFCA 2GGEA 3P93A 3VCCA 3MSYA 4HNCA 4GISA 3RITA 1DTNA 3NZGA 4ROPA 1EBGA 3DGBA 3QPEA 3RGTA 3T8QA 4H83A 2PTZA 2QJJA 1XPYA 3BOXA 2PTYA 4K1WA 3VC6A 4HCDA 3MQTA 4MKSA 4IL0A 3CB3A 5IDZA 3SN1A 3R0KA 3H8AA 1EBHA 3FYYA 3KUMA 3UJSA 2AL2A 3DDMA 2OVLA 2ZC8A 2XGZA 1BKHA 1NELA 1BQGA 3K1GA 2PP1A 4DN1A 2XH4A 3R1ZA 2XH0A 2HXTA 3JZUA 3FJ4A 3OW1A 3PFRA 3GY1A 3V5CA 2P8BA 1JDFA 1P43A 3EEZA 1SJDA 4DWDA 4HPNA 1ONEA 4IZGA 2ONEA 3VA8A 3HPFA 3EKGA 4GGBA 1ECQA 4MMWA 2POZA 3TCSA 1FHVA 1MUCA 3OTRA 1YEYA 3UJRA 2QGYA 5J04A 3DESA 4HCLA 4JHMA 2PGWA 1KKOA 4H2HA 3UXLA 2OX4A 3DFYA 5BOEA 3PWGA 3DEQA 2QQ6A 2PS2A 3B97A 1NU5A 1ELSA 1XS2A 3V4BA 2O56A 3RCYA 2PCEA 2OZ8A 3SSZA 3I6EA 3RR1A 2HXUA 3UJ2A 2QJNA 2ZADA 4GMEA 4GIRA 2RDXA 4A6GA 2DW6A 2OQHA 2MNRA 3QN3A 1MNSA 3UGVA 2GL5A 3NXLA 3RO6A 5EU9A 4DYEA 3TJIA 2PU0A 3CK5A 3GD6A 1MRAA 3MZNA 4DX3A 4M6UA 3T6CA 3QTPA 1R0MA 2AL2B 2I5QA 3TJ4A 4A3RA 2PGEA 3DG3A 2P8CA 3V3WA 2QDEA 3DG6A 2OZTA 2P88A 3QLDA 2OQYA 1KD0A 4IL2A 6ENLA 3STPA 2OLAA 5FJPA 1R6WA 3BJSA 1IYXA 1TZZA 3H70A 1KCZA 3R0UA 5FJRA 1JCTA 3DG7A 4E5TA 4DXKA 3MWCA 2FYMA 2PODA 3N6JA 1SJAA 2GGJA 3ES7A 3IJIA 4IP4A 2AL1A 2FKPA 3RRAA 2OKTA 2QVHA 3Q45A 4DHGA 2AKZA 4JN7A 4KT2A 4KEMA 3N6HA 3OPSA 2OZ3A 4IP5A 2GGIA 2PP0A 4A35A 4ZCWA 2XSXA 3OZYA 3MUCA 3T9PA 4GGHA 4YWSA 1P48A 1EC7A 4HYRA 3CXOA 3SJNA 2DW7A 2QJMA 1SJBA 2PSNA 3I4KA 3SBFA 3VCNA 3MY9A 1WUFA 3ZVIA 2GGHA 3IJLA 3TQPA 4HNLA 3IJQA 3R25A 3GC2A 3VC5A 3CT2A 1L8PA 3SN4A 4IHCA 4HCHA 4FI4A 1JPDX 3V5FA 3ZLHA 3N4FA 3FVDA 3ZVHB 3DIPA 4J3ZA 2OO6A 1KKRA 2OG9A 3TWBA 7ENLA 3UXKA 2XH2A 4E8GA 4GFIA 3DFHA 1OEPA 3VDGA 1RVKA 3PK7A 5ENLA 3OZMA 3SN0A 2OPJA 5FJUA 1PDZA 4MGGA 3TWAA 3I6TA 1MDLA 3UCCA 3S47A 3H12A 3FV9A 4F4RA 1TKKA 3DERA 3JW7A 3U4FA 3Q4DA 4J1OA 1TE6A 1WUEA 3CYJA 4K2SA 3R10A 2PU1A 2HNEA 4H1ZA 3ZVHA 3TOYA 3THUA 4E4UA 3NFUA 3TW9A 4G7FA 2AKMA 2MUCA 3IK4A 4K8GA 3PWIA 4GYPC 5FJTA 2PPGA 2CHRA 1SJCA 4G8TA 4X2PA 1F9CA 4KWSA 3ENLA 4IT1A 3S5SA 4E4FA 1JPMA 1EC8A 2NQLA 3FXGA 5BOFA 1E9IA 4M0XA 3P3BA 2GSHA 3ZLGA 1FHUA 4HN8A 4ZA0A 2P0IA 2PA6A 3GO2A 2PTXA 3MKCA 3QKEA 1W6TA 3T4WA 4FP1A 3JVAA 3FCPA
chains in the Genus database with same CATH superfamily
1BEUA 1YDOA 1XM3A 4Z2LA 2Y8VA 5XIMA 2H6RA 3ZWSA 1F8WA 4F0RA 3HPSA 1FWSA 1AW5A 4TX8A 4PMZA 3DJJA 2DGAA 4PCSA 2EQ8A 3V35A 3GDLA 4ASTA 1FWDC 3WKZA 1UUQA 3AIBA 3BSMA 5CBJA 1PX3A 4LH8A 1E43A 2QDDA 3WFZA 4MWAA 2PDKA 1TYGA 1V0KA 1RCQA 6TAAA 2EPHA 3NOYA 3M6YA 1PTDA 4LU0A 3SR7A 3SQSA 5I3IA 2OLSA 1JCXA 2XPKA 5DMNA 3R0DA 5A6LA 2C3DA 4PN2A 1Q6OA 2RGMA 1A5MC 3GIYA 1V97A 1BVNP 3B8WA 3GFYA 4Z17A 2C1IA 2XVKA 2D73A 2XWDA 3AWOA 3SY5A 3CEUA 2VUYA 3CBWA 1DTNA 4LS1A 3A5FA 1YQ2A 3TTYA 4PH6A 3HV9A 2DSZA 1EKOA 1OM0A 3M0XA 2NLIA 1OFOA 2C0HA 3BXWA 5DMLA 1W3NA 3WNNA 3U5YA 3SN1A 2BV9A 2XU2A 4HTBA 3UJSA 4CD4A 2OVLA 1UIPA 4IFKA 4MM1A 3O2LA 1BKHA 4KIEA 1LOQA 5AC4A 1DHKA 4ZTYA 3GIQA 1OK4A 4GBUA 1LQAA 4CQ8A 1E6SM 1V02A 4Y9AA 5FEPA 4B92A 3HTWA 3VKAA 4H4SA 4R5EA 1B3WA 1SJDA 1OF6A 2VMFA 3IC9A 1SVDA 1MEIA 1JYWA 5HBFA 1PX8A 2QCCA 3CQKA 4NJJA 2HE8A 3AIVA 4KRZA 4J7RA 4RL3A 4ZQNA 1CXIA 3T55A 3UJRA 2TPSA 3FY1A 2PGWA 2A6LA 4IGNA 1Q6RA 2HJPA 5PTDA 5CZ0A 2F2HA 3WZ0E 1ELSA 1JOAA 4D9PA 4DJEA 1TRDA 4AVFA 1V3JA 4W8LA 5I24A 4O0QA 3CHVA 2VURA 1P6BA 1TCDA 3Q37A 2BVWA 4W93A 2GWNA 1J11A 1BTCA 4AX6A 3TYUA 1DQWA 3RXZA 4B3KA 1MZRA 4PL2A 3LGEA 1OGBA 1I2RA 3M0KA 3CTTA 4YL2A 3W85A 4KGJA 4L61A 3CLWA 2AL2B 2VC5A 3QGAC 3UWWA 4B2DA 2NV9A 2GQ9A 3V3WA 4S3EA 3OBEA 4RE2A 4GD0A 3FVMA 3BAXA 5LA1A 4AWTA 3BPWA 1YMYA 3GLCA 1LWIA 5CG7A 1UW9A 1PCWA 4TU1A 2OB3A 5LNUA 1M03A 3UETA 4BY3A 1SJAA 3CIWA 1UOZA 2E6AA 2GOUA 4AX7A 2OKTA 4D8AA 4GWEA 2PC4A 3UPMA 1ONXA 4JN7A 1W1YA 4XX6A 2XZ7A 2OZ3A 1KM5A 5U1OA 1NP2A 2EJAA 1FDYA 3L4WA 4LV9A 1EJVC 1QATA 2J9XA 4G9PA 5E0CA 3WLIA 1BYCA 4JBRA 5I00A 4V15A 1V51A 1PIIA 3VTRA 4EQRA 3CH0A 4B3LA 2FHFA 1QK0A 5A6MA 4UMBA 4IMAA 3POCA 4JD4A 1OSEA 3B8DA 2OSYA 1O12A 4AWSA 3VNZA 3WH8A 3HOJA 2CLPA 4FIRA 4DUOA 1TTQA 4FNUA 4A8NA 1HNYA 3RO8A 4A22A 2V5JA 4CQDA 4PUJA 1XH2A 4ZQRA 3TH6A 2EXOA 3NJ3A 3WLNA 4EQSA 3PSWA 2YA2A 2VX7A 1ESWA 1LBMA 5AC5A 3BWWA 3PANA 1I9CB 1FWJC 2XISA 5MF5A 2GVYA 2YYTA 3TWBA 3CT7A 2ISDA 2EPOA 2EG6A 1HKWA 3TSDA 3VIMA 4QITA 4AWEA 1H09A 3H2NA 5CC5A 1VHNA 4NJHA 3IV8A 2R9ZA 3OQ8A 4LV4A 3QY6A 1MZHA 3OOQA 1NEYA 4WCJA 2YCKX 3UCCA 2ZXQA 3E2QA 5FA5A 2FMOA 3LB8A 1J0ZA 1GOKA 1F6YA 2V3AA 4ZO6A 4TX9A 1UR1A 2REQB 3T07A 1WV2A 1VQZA 2PDIA 3MANA 4GKTA 1H1YA 4FOKA 4H4WA 1Z42A 1I0BA 4XZMX 1O7AA 5DRIA 3UG4A 4V28A 4UQBA 3N2MA 2PPGA 1Y5XA 2YCLA 2J79A 2WV8A 2XHYA 3T09A 4UTWA 4PUWA 1XCFA 5D30A 2VZOA 4E4FA 3URHA 5CSUA 3B3DA 2BGQA 2J8FA 1MRQA 2EGZA 1EJUC 4ZOEA 1OFQA 2GSJA 2BY1A 1JD7A 4UTTC 5CGMA 3C8FA 3WF0A 5LIYX 2ZDRA 4NYYA 2Y8UA 2ZVIA 1NARA 1PHQA 2HE5A 2VFHA 4JIHA 3RLHA 1FFVC 3TYCA 1Q7QA 4JTDA 3SGGA 2Y61A 3MBDA 1KR0A 1XLBA 2LLEA 4HK6A 2DQXA 2QUNA 1PUDA 2X7VA 3O0HA 2IS7A 5I3FA 3VIPA 1IEIA 3AHXA 3TYDA 5FI8A 5C55A 4XZHA 1JRPA 4ZENA 4U28A 5D2VA 4IMCA 3GVVA 4NI3A 1DTUA 4F0KA 3IACA 3P74A 1NHSA 4Q8PA 5C2XA 1OFRA 2A3EA 3HGRA 1CLVA 2WMHA 3VNJA 1QOQA 3G77A 3VNMA 2HZGA 2Y7DA 2WVVB 3SZ8A 3IV3A 1LUCA 3N3MA 2C19A 4MFDA 2ZUWA 3CS2A 3N73A 5F2MA 1XLEA 3RPMA 2XYLA 4N4PA 4N9CA 4EXAA 1OX5A 4ZSTA 3U5UA 1ZTVA 3TLQA 1JI2A 3MUIA 3URAA 1ADOA 4P8WA 4TQTA 3DFTA 3CQIA 3GVQA 2PAJA 4YTSA 4LCRA 1DJWA 4C1NA 1DJZA 1Q1WA 4HCDA 2PD9A 3C2YA 1SFJA 4QEEA 5A95A 1EDTA 3JR2A 3R0KA 3KDOA 5BNKA 4RR4A 2XGZA 2GJRA 1KLZA 5CJNA 2YLLA 2FZBA 4Z1DA 2ZZ0A 4H4YA 4JIQA 3SEPA 1PSCA 1RR2A 3WNOA 1Y65A 3C2FA 4BR1A 3LZ3A 1TPFA 3BAWA 1YDYA 1V7YA 4HPNA 2V38A 1ZY8A 3GFXA 3MVIA 3Q65A 2X1UA 4L7ZA 2VP8A 4NNAA 1E6XM 1UZ1A 3FYOA 2R9RA 3VIGA 1F76A 1DE5A 2C14A 2POZA 3TCSA 5BYWA 3W01A 4GIAA 4U3CA 1MUCA 3WBAA 3CM4A 4EE9A 4A3YA 4QEHA 3DESA 5LYRA 1XPGA 1ADDA 5DCEA 3HW2A 1W9PA 4F3HA 4Y2WA 3E0FA 1X38A 3V4BA 2O56A 2DT0A 1GVOA 1F4HA 1VYSX 2BHUA 1FBAA 2EAWA 3LCGA 3IIOA 1FWWA 1JZ2A 3TYZA 1VH7A 5CC6A 2ZUTA 3GTFA 4A6GA 2OQHA 1TVNA 2DSVA 4HOZA 2BZNA 4LANA 4C6EA 4NEVA 2PU0A 4FOUA 4DAFA 1ZCCA 1EH9A 2SFPA 4Z1AA 4DYJA 4GACA 3GR8A 2BY3A 3QTPA 4FXFA 2PGRA 1TWIA 1NWSA 2YLAA 2I5QA 1H7OA 2ACQA 5FF7A 4MDPA 4C6CA 2V2HA 2OZTA 4I7UA 3KTXA 4Y6GA 2WHJA 4MOZA 4JTGA 4HYWA 4IUGA 1N8IA 3QHNA 1LRTA 1FDJA 2JQXA 5DEZA 5FJRA 2NX9A 1UWSA 3I3DA 5JIWA 3N29A 5AHFA 3KVJA 3PZUA 1AJZA 5G5IA 2NWRA 2CZ5A 4REQB 1UR4A 4KT2A 1X1NA 2PRHA 4AMCA 4Q4QA 2EG7A 3OIXA 1XCXA 4ZO8A 4GVGA 2HK1A 1CX9A 3LD5A 3IK2A 1FA2A 2QR6A 4LUJA 2JBMA 4WUIA 1R5YA 2J7CA 1UA3A 1X2GA 1P48A 3UA4A 1ZS2A 3FX4A 3VFLA 3O3RA 5HATA 1XKYA 2QCEA 4J3VA 2GQ3A 3ZT7A 4GNKB 5J5DA 1PKNA 4GQ0A 3P5YA 1A5OC 2PSNA 3CZJA 3I10A 3VCNA 1T41A 4MJ4A 3DHPA 3GVWA 1AODA 2FVKA 2NUWA 2ZZBA 2CCRA 1LP6A 3W7OA 4MSSA 4X0NA 4X22A 3W4RA 5CAKA 1N60C 2X1TA 4GC4A 4O8AA 2E25A 4W7UA 2A3BA 1GKPA 2FDSA 1C8QA 3R7MA 3AYRA 3RJXA 3DENA 4UFHA 1J8VA 1W2PA 4ECLA 4KCWA 3PNZA 2J3NA 1GTEA 2OO6A 5CC3A 3C0JA 4S39A 5CGQA 1AD1A 1PZ3A 4MNKA 1UR9A 1S2AA 4EQXA 5F1UA 1EZ2A 3TEVA 2PBGA 3BANA 1DYSA 2Z25A 4DWSA 2OPJA 4IPLA 4AZCB 2WZTA 3DHUA 4MGGA 3A13A 2ALRA 2H8ZA 1KA9F 4ZOBA 4G7EB 3BAIA 3DFQA 3WEOA 1YNPA 2HSAA 4HT3A 1TIMA 2BXVA 1ZL1A 2IUZA 2HQMA 3ZT6A 2DUZA 4DB7A 1XIEA 3IVSA 1GW9A 3AXMA 4OV4A 2VGGA 1BWVA 3DK9A 3A9BA 3CXBA 4CD8A 3PULA 1NF7A 1OFBA 2MUCA 1FHLA 4RNHA 4YVPA 4H50A 2CLMA 4WXYA 2I57A 4R53A 1EWEA 3T8LA 4DM2A 5JIPA 4IT1A 1XKJA 1G94A 3S5SA 4EXBA 3GTIA 5BMWA 4BV6A 4DJDD 1XH0A 1FWAC 4FNPA 4EPEC 3CV6A 4C6JA 1GXFA 2AGTA 3II1A 1JUEA 3P3BA 5D9OA 1GQKA 2CBVA 2X8GA 1WYIA 2P3EA 4TXEA 3VNKA 3OA3A 1QHOA 4Q33A 2CZDA 3W28A 2Z27A 3VKDA 2BSLA 4DO7A 2GQ8A 3H26A 4G56A 2E3ZA 4H6KA 4NZ5A 4LVFA 3WLJA 1GVSA 2J24A 3L7RA 4ENLA 2YVFA 1PL9A 2FIQA 3LGGA 2IQ0A 4R7JA 3MV01 2NVDA 1WZKA 3C0LA 2VVNA 2QDGA 4JQAA 3R11A 1E1FA 3ECQA 4Q8MA 3UCDA 3P0WA 1TRIA 3TYAA 1TTPA 4L9ZA 1OG0A 3ETRB 2AMXA 1O95A 1R7AA 1GQNA 1YIXA 5IBXA 2E5AA 3W0KA 1SQ7A 3UPBA 2VXNA 1D3CA 3U48A 4RPPA 4QFUA 3PTKA 4ZXLA 4ZFCA 2CDUA 5G2HA 5CGTA 3W1LA 4L65A 3I7QA 3E5PA 3BJTA 1XIGA 3TSMA 2UBPC 1ZBVA 1HT6A 4PMXA 3MMDA 5K9DA 3DXIA 1M5WA 1JGIA 1T3QC 3THQA 1EA0A 3T2QA 1R46A 3PAOA 3HBLA 4RNFA 5T9BG 1JFXA 1ZJIA 4WKFA 1F3EA 1ZJBA 4WQ6A 1E15A 3THDA 1F3TA 1PE1A 1NDWA 3IJ9A 1RBOB 1NSJA 1UR0A 4IF2A 4JIIX 1DWGM 3P14A 5DBTA 4RZ5A 4XIAA 5D05A 5CKSA 2E7FA 4PL1A 5C6MA 3WK1A 4R9XA 4J3UA 3MKKA 3VPLA 3FG2P 5FIPA 3QVQA 5DXYA 3RFAA 2WCGA 3TE9A 2BS9A 4UBPC 1S2TA 4GBDA 1AA1B 3G1AA 3VUSA 5HQLA 1XIMA 3AXHA 3O63A 3WMLA 1J5TA 2BBFA 1M7JA 2MANA 3A21A 4AHQA 2J62A 1V5XA 2ON3A 3K8MA 3BG9A 2WPBA 3VA8A 3W2KA 3QSTA 5C9UA 5CSSA 2X8HA 1TV4A 1KFJA 4H8UA 2FPTA 5DQPA 1E55A 1C8YA 1E1CB 4JDBA 2CLIA 4PMQA 4L6OA 1Q5MA 5AHMA 2PS2A 4GRSA 1TX0A 6A3HA 3QXBA 3LQLA 4L6DA 3PN8A 3RNMA 1WNOA 5EFDA 4D6IA 4ILSA 1CW2A 3I6EA 1CDGA 4ACZB 4CD7A 2YCLB 3BE7A 1YRRA 1OVDA 1SZRA 3MV11 4UC5A 3QFAA 4ADUA 1WAWA 4L9YA 4QCFA 4DJFD 3CGTA 1FWIC 2VJXA 8CGTA 2HPMA 3FK4A 3WH7A 3MZNA 3UZZA 1EWDA 4AYSA 3KS5A 3GAKA 2OOFA 1M7PA 3U8GA 1BF2A 3LB0A 2P8CA 3KBNA 1JPKA 2Q8LA 3G6MA 2GUBA 2QCDA 3U4AA 1TV2A 4JNZA 3UFYA 3BZJA 2WOWA 1R6WA 2HRWA 5C9WA 2WNNA 4C6OA 3E3HA 5U4NA 4QSFA 1VCFA 1UH4A 3ES7A 5D2XA 4HHMA 2Z1KA 4NZCA 3ITXA 3AI0A 1A5BA 4PEEA 3WQGA 3RX2A 4Q3MA 4KKXA 4HOWA 5DO8A 1JZ5A 5M1TA 3R6IA 4L56A 1VBGA 1MFVA 4HIBA 3BGGA 3NL5A 3W2MA 3UBPC 2H3DA 4GI8A 1WDQA 3TQ0A 1W5QA 4Y90A 4GGHA 4JDRA 1S5MA 1B57A 4A8IA 4PE8A 4O10A 2QLYA 2TSYA 3GXIA 2B31A 1DV7A 3BLLA 4JFUA 2HMCA 4K3ZA 1H7RA 2X09A 3FIGA 4JL1A 4JTIA 1EQPA 4LBRA 4GYFA 4U31A 5LNVA 1Z7AA 4HK5A 5CQ1A 3WL0A 3W7PA 2FFIA 1R2RA 3N04A 1SSGA 2CLFA 2GUYA 1SSDA 2R82A 5AHNA 4LY4A 1B31A 2JFEX 4I8YA 2PDMA 2PDGA 4TVDA 3MDUA 2C71A 2V8ZA 2E67A 3GW0A 5A2CA 5KZMA 2YCJA 3O6DA 3LBCA 2D2OA 4O4WA 1GVFA 3GDBA 3RM4A 4D1IA 1GREA 4AW7A 5EMUA 1KFWA 3PPCA 1X6NA 3U7BA 3ABSA 4AAJA 1HW6A 4PSRA 3C2OA 4UXDA 5KINA 3VNLA 3OZMA 4ZL1A 4O1EA 2ABBA 3GDRA 3GQYA 8XIMA 3GXPA 1GG0A 3SI9A 3L4TA 3OHMB 4WOQA 1V0NA 3QHMA 4GK8A 4Z0SA 1KRMA 3NQDA 3H12A 3VD7A 5HWNA 4GY7A 1XIFA 4H04A 4U10A 1WB0A 1QI0A 1ZLPA 1BLIA 1OB0A 1HJWA 4H1ZA 2ZX6A 3LI1A 3L4XA 3ZVHA 1HJXA 3S46A 3LM3A 2J9YA 3RMEA 5I78A 4R3UA 2V67A 1RXOB 2YQUA 3A4XA 1JVNA 4XZNX 4RV8A 2BXZA 4WOZA 1PKYA 4B5WA 4G8TA 4AY7A 1F9CA 3WD2A 1OFDA 2W27A 3K13A 3TAOA 1B9ZA 2HS6A 3W7EA 4YMZA 3B04A 3CQ0A 3KBSA 4WJEA 1EJWC 1H2IA 4IX0A 2GK1B 2L5HA 2VZTA 1VIWA 3W23A 7A3HA 1ONWA 2QF7A 1W1A1 4S3AA 5BXRA 4GX9A 1AH0A 4NAFA 1LRQA 1L2QA 4EF8A 2PA6A 3GO2A 5GJNA 1WXYA 3QKEA 1QXLA 1Q3NA 4Y9OA 5EPDA 1K03A 4O14A 3BLFA 5KETA 3VZZA 1C8XA 3SUUA 3QF0A 4M7SA 5REQA 1F8IA 3AJ7A 1QW8A 1QHZA 2WVTA 1RPXA 3PPGA 4JN8A 3R07C 4IG2A 3EA3A 1PZ2A 4F0MA 3N34A 1KBKA 3M44A 3KOZA 2HBXA 2DIKA 2KX9A 3G1FA 3DFPA 4YNGA 1WDPA 2TODA 8RUCA 1F6KA 2YDAA 5I7GA 3GUWA 4H4XA 4LUTB 2BC0A 3I4EA 2W63A 3DX5A 2PRLA 3OVRA 3UD6A 2OZ0A 3LBMA 1LG1A 3CL6A 3S2MA 1M7OA 3UJEA 2ZRWA 4JTJA 4C60A 2PTWA 1U33A 4UTWC 3OG3A 1EJXC 3NG3A 3CHEA 4KWVA 3VGDA 2C6QA 2XG9A 3VFCA 1DPMA 4RX0A 4C5ZA 1VYPX 1MQRA 5A5WA 3LSCA 3ZMRA 1C9WA 1ZQ5A 2G3FA 2FTYA 1Q4NX 3ERPA 3NQ2A 3DYMA 3QPEA 2BNJA 4J40A 4KETA 1CCWB 4UTIA 2CESA 1AUSL 1BYBA 4XTDA 3WEMA 1XPYA 4DUVA 4C1LA 3O0FA 2E6FA 3HMCA 1VJSA 4GPNA 4CKQA 1FCQA 1A5CA 1QUMA 2B7PA 3KUMA 1UWRA 2B7OA 4QDPA 4EIVA 2O7QA 2F5ZA 4NRRA 5CJ5A 1IZCA 2PD5A 3GH7A 1EUNA 1REQA 4LBUA 3O16A 4GQRA 4AEEA 1CB2A 1B5TA 3OW1A 5TIMA 3RF9A 2PF8A 3FW6A 2FJKA 1S1RA 3DYPA 3GG0A 4KFPA 1XYMA 1IZJA 4RUBA 1ONEA 5EBAA 2QPXA 2P1FA 1S2VA 1AL7A 3MHFA 3L5MA 4GJ1A 5D38A 4EK7A 1XDIA 2GVJA 2Y7GA 1IGWA 4QLKA 1NY1A 1R9YA 3ARTA 4QS5A 2A7PA 3C6CA 1KTNA 2G4JA 1R87A 3AOFA 4CU6A 4IGSA 1N61C 1TMHA 4CQ9A 4P5UA 4JHMA 3TN6A 3LADA 3A6OA 1JI1A 4HNOA 2O92A 2YZRA 3S9YA 1JNEA 4XBKA 3GWQA 3B05A 3MKVA 1GYMA 1NVMA 3LSBA 2QUTA 3M64A 3TSBA 4B90A 2Y24A 4GZJA 1E1EA 1B90A 1DJXA 5A6TC 3L8KA 4LUSA 4I7VA 2D2GA 4ZB5A 3N13A 1ADSA 3C2RA 2YXXA 1D3GA 3LK6A 2FH8A 4XWUA 1H0GA 2ZXBA 4LVAA 2O9OA 1XLKA 3W82A 1W1B1 3GTNA 5B80A 4DBWA 4ONVA 2JIEA 3TMLA 1WKYA 3TDFA 4P8VA 2REQA 4D8LA 2CWXA 2BX7A 3EDDA 1MEHA 4L64A 1OGGA 3VDBA 4IIFA 2ZBTA 4O12A 1SO3A 4HPGA 1WDWA 2E9BA 2A4AA 4YU1A 1A3XA 4QE4A 2TMDA 3WNPA 1ZAJA 2ATSA 3KRSA 2C79A 3E96A 5EMYA 1VENA 4IOTA 5FAJA 3HQOA 3VI2A 4A05A 1J18A 1Z41A 3TLLA 3A7AA 4J9JA 1TFVA 1F8MA 1KBJA 4P61A 1W54A 1BFNA 2WAGA 3N1AA 3W27A 3M07A 1XV8A 4NZ3A 2TPRA 4LRTA 4W9TA 3NA8A 1H63A 2J88A 3A24A 5JBFA 3C3UA 4JIEA 1OJTA 4OKDA 1KO0A 4RNJA 3F7JA 4DRSA 1OY0A 1WBHA 3W6LA 1K6AA 5H2ZA 4AC7C 2WC4A 2VDGA 1SZGA 4IJBA 4S38A 2F2KA 3HIJA 5LHFA 4HJWA 4AXKA 1XLAA 4H9XA 4O11A 3BL3A 1ALDA 4PTMA 2XJ7A 3VDGA 1OYCA 4TV5A 2C1HA 2CBIA 2AMGA 2HWGA 1PZ0A 5JCIA 1TA3A 2FQIA 3KBVA 1A0DA 1UYQA 1E4MM 4K8HA 4F8XA 3GM8A 3MDWA 3A9IA 4M81A 4K7ZA 2BVDA 1TVLA 4XZ9A 1KXQA 3SAZA 3AYVA 1XYFA 3WSUA 2D2HA 1E1CA 5E0FA 2OTDA 2PU1A 5LSMA 2HNEA 5EA9A 5FS7A 4NHVA 3NO3A 1UC4A 2QKFA 4H4QA 4NUWA 4CQBA 3UR5A 3E12A 5HNUA 3NFUA 3GC4A 1VLIA 2WOIA 5FL1A 3EYPA 3P8IA 4K8GA 1FWTA 1YXYA 4ZB0A 3VD3A 1E9ZB 2VFDA 4CVUA 4AHOA 2GQWA 2CLKA 4H00A 3EOSA 3AZTA 5TQLA 2Z29A 1QR7A 4OT7A 5AC7A 1QDSA 4JQ3A 4JTCA 3N18A 4G7EA 3ABRA 3I65A 4KEZA 3GDMA 3NYDA 1FWEC 3CEPA 4AU0A 2J27A 4K8DA 3ABQA 1I0DA 3CZ8A 4NJGA 1VFHA 1AMKA 2D22A 1KM6A 3QGVA 2GSEA 1DJQA 2QV5A 4LAOA 1ZU8A 2WVUA 4K39A 1DXFA 3EPMA 4I7WA 3RUBL 3YPIA 1TPWA 3CUXA 1YPXA 3H53A 4H2CA 1Q6EA 4IFOA 3S6TA 5I3KA 4GVIA 3CU2A 4PUUA 1AJ0A 3QGKC 2PP3A 4QCEA 1L9WA 2PLKA 1N5XA 4INFA 3GHUA 3GHSA 1ZBCA 1EEPA 5KVHA 1TV8A 3AMDA 1OZQA 2GGGA 4MDOA 5CZJA 3WQ6A 2OLHA 1EIBA 3UJFA 4F40A 3LLDA 3O07A 1Y7VA 2HEJA 4YHGA 3LM7A 2IXUA 2FMNA 4N2YA 3SGUA 1F5ZA 3OLDA 3AWNA 3VYLA 3AIQA 3OG2A 3SIZA 4M82A 3P84A 3T1GA 1VC4A 2OWXA 3A47A 4WLCA 5GNYA 1E4LA 5AN7A 1KGUA 3NAVA 3LRLA 4GZEA 2VGFA 3NGJA 1CXFA 3UCQA 5DY3A 1IEXA 2IPJA 3QZ6A 4IGHA 1G0CA 3FKKA 4XUYA 4GISA 2CKRA 3R12A 4H9MA 3KWXA 3I68A 3SQLA 1W3IA 3PWAA 5M03A 3VIIA 2CWNA 2NSOA 4MY1A 3VC6A 4NU7A 4IL0A 3ONCA 3BLIA 3OGRA 3K4DA 2EEXA 4AMAA 1F05A 1SR9A 3VD9A 4Q8NA 5LNSA 2V3FA 1Q4WA 2EKCA 5G4EA 3RCNA 2W3RA 2PP1A 3GDTA 3KTCA 4YVVA 5M3WA 3NO5A 2PWVA 4ZB2A 1A5UA 5DCDA 1LF1A 3FA4A 3K30A 1TREA 2HXTA 3KCJA 3JZUA 3UZ5A 4FLRA 2NQ9A 4QBXA 1JDFA 3S8HA 5IBXC 4YLWA 5JVLA 4PTDA 2AAQA 1QW9A 3UYIA 3MMWA 3WK3A 1FP8A 5IHRA 3CMGA 5A6KA 3B8IA 1HZYA 4QNEA 3ABZA 1G01A 2O55A 4U2YA 4QG9A 4D6EA 1PO9A 1FWCC 1H1ZA 1UZDA 1IWAA 1GK8A 1W91A 4PEKA 5KVIA 3K8LA 1PAMA 2UY2A 3DFYA 4GXWA 5H8MA 4GLEA 2DV0A 2WLZA 2XM2A 1FEAA 1MO9A 3B9JB 1WDSA 2X2GA 1NU5A 3GXDA 3AZSA 2GDVA 2QZRA 3H2FA 1QWGA 4WY0B 1H50A 3CUIA 1GRBA 3KW3A 2WWDA 2RJGA 4F9JA 1HJVA 2HXUA 2QJNA 2XN0A 3N3TA 2O7SA 4N4QA 2D1ZA 3H23A 3QN3A 1JQVA 4B5UA 2PDQA 4K6AA 4XAZA 1VHCA 4Y9MA 3SCTA 4DYEA 3O9NA 4NF7A 4F0SA 1XGDA 4O1CA 1KLYA 1L6YA 1MRAA 1NWTA 4QM1A 4Y8FA 2A5HA 1V6UA 1XHGA 3NDOA 2Z2AA 1W3HA 1DIDA 1TYTA 5BXSA 2BGNE 1TUFA 2AGKA 3P80A 1LLOA 5DMMA 4U4MA 2ZX8A 1NIUA 2QYGA 3QEZA 3W1PA 3INPA 3TYEA 1QNPA 4DBEA 1J93A 2E8ZA 4IISA 3IS4A 1UKTA 3QLDA 1V3HA 2D0HA 1QPKA 3STPA 4N7QA 3CUGA 5FJPA 1US2A 3AMCA 3MHGA 4K37A 4ZFMA 3QQWA 3ZFHA 3N17A 2Y85A 5DY2A 5I3JA 5MHBA 1D7FA 4D1JA 3PBWA 1GQIA 5KZ6A 4YWOA 3C0QA 3WQ8A 3S6DA 1Q8AA 1KFLA 4ORIA 1KM2A 1L8NA 3VCRA 1K70A 3ID7A 4BI7A 2F6KA 5K9CA 3A4WA 1VLWA 4PRWA 1SW3A 3UEQA 1ZBWA 5AZ1A 3QV8A 4LTSA 3P6LA 3DAQA 4TIMA 2ZRXA 3MZ2A 3GC5A 4PRTA 1UWAA 2CITA 2PEVA 4WF7A 5BRBA 4QE5A 2Z2BA 2ZTKA 1WZAA 3HFTA 3S5ZA 2EQ7A 1LM1A 3KBJA 4MKNA 3PZ9A 4O57A 1OZMA 4R34A 3M0LA 4FDCB 4H4TA 1AW2A 5D02A 5AB3A 4QP0A 4XVDA 4DF1A 1ICSA 3S42A 4MAVA 4J28A 1KCXA 1OQFA 3FVDA 4FNSA 2C91A 2OG9A 3WQ4A 3VXGA 5A1AA 4AD3A 2WANA 4PBFA 1H11A 3QV9A 4M6PA 1RVKA 1P6WA 3SB0A 2QUVA 5T9CE 1LPFA 1G5AA 4CLMA 4QTGA 4JKKA 1S5WA 2R91A 4EMWA 4TVYA 3ONBA 4FIQA 3TWAA 1YQZA 4KCVA 5A8GA 3B06A 1ODZA 3NL6A 4LVGA 2QCNA 2VT0A 1JYVA 3PVFA 1B2YA 1KRCC 3VVGA 4YHEA 4Z2HA 3TNOA 4I9TA 2PGFA 4JKLA 1QI2A 3THUA 3DUGA 4PR4A 2OT1A 5HNRA 3GAYA 4XO7A 4HTYA 4Q4KA 3IIZA 1XIJA 5AKQA 2V30A 1LLWA 3W7LA 2CHRA 3LTPA 4X2PA 3KP1A 1W8SA 1NFGA 3DBPA 1RP9A 5FEXA 3B4UA 2Y4SA 4C6DA 4G5DA 3AMKA 3CHFA 2E5CA 2E28A 3M0YA 2ISVA 3M7WA 1SUXA 3WQPA 2E1DA 5FF0A 1SGJA 2BP1A 3VNDA 3CZEA 3KVLA 3L4VA 2PDWA 3WH9A 4ZA0A 2VC9A 3C86A 2P0IA 2W66A 2ZKMX 1IT0A 1OD8A 1XW8A 2YL6A 3GH5A 3SUWA 2RHGA 1O68A 1JGMA 1VAHA 5CZKA 3BGJA 1YTEA 1RA5A 1AVAA 2DSUA 4RXFA 4LAMA 3S2LA 2FDMA 1KR1A 1BXCA 3URNA 1Z44A 4IMEA 1O66A 4YTTA 1ZP4A 6PTDA 1VBUA 1KW1A 1XDMA 5I23A 1GCYA 2WQPA 3KBMA 2DUAA 2WHKA 1XX1A 1JUBA 4QIUA 4GYPA 3WG6A 1ZXIC 3LXAA 3NPVA 3WDHA 3GD4A 4Z2GA 4ZO9A 5IXEA 4H19A 1CPUA 5F4XA 1I2OA 1ZBKA 2VZUA 3ZLFA 5HULA 2J8GA 3BV4A 3AAMA 4X9YA 4I6KA 2EQDA 3TKFA 3SRKA 3NRZB 5I3DA 2VR5A 4N9DA 3BG5A 1RPKA 3EX6A 1J0HA 1P7TB 1IF2A 2H90A 2Z2UA 2W6RA 3VOJA 4CD6A 2XFFA 3CIVA 3HM7A 4JY8A 3VCCA 1PV8A 2OYLA 1I1XA 2QF8A 2RGLA 1I2QA 1EXBA 3BDKA 4C7FA 4DNMA 2VX4A 3L65A 1EL3A 3L0NA 2R1NA 2A0NA 1DJIA 3GHTA 1X97A 3KVKA 3WDQA 3G1RA 2VRJA 2FHBA 2WHLA 4FNQA 2E5BA 2OXNA 2PDBA 3BMWA 4IFRA 5CPTA 5ECUA 2FHCA 3OLIA 4RDWA 3PBYA 3U6WA 5A8PA 1V6WA 1QO5A 2Q8ZA 4JNMA 3TQVA 3VABA 1GEUA 5CZTA 5XINA 2YGYA 3A22A 4Q4RA 3FJ4A 3SW6A 3NYZA 3IIPA 4OGZA 3BVJA 3EDEA 2B81A 1EEXA 5TNVA 1P43A 1VJZA 2PI6A 3F2CA 3EEZA 4K7VA 1HL8A 3BLOA 4XZBA 4M51A 1CBGA 4IZGA 3W07A 3SRFA 3EX3A 1EP3A 2NT1A 5FSEC 1MQPA 5IFPA 1OX4B 3WK2A 3QOMA 5ABGA 3G1VA 4RE3A 5KMYA 4CNUA 1V6YA 5C7VA 1HKMA 1AJ2A 1Q6FA 1W31A 2OEJA 2YL5A 2B0MA 4H01A 2Z1XA 1UD8A 2FLIA 1XIBA 2OX4A 4AIOA 5HMSA 1E4NA 2VEGA 2J7GA 5FACA 4JFWA 3CC1A 3O05A 5FKYA 3S1WA 3OBAA 3A3XA 1MW1A 1OG6A 2OZ8A 2ZRYA 1ML1A 1XDJA 1UKPA 4P7NA 1POJA 2VI0A 3QJAA 1A4MA 3BAKA 5AC8A 1JCMP 1UJQA 2E1WA 3KEHA 4KEUA 3O6YX 3KBWA 4RE4A 4BURA 1GJUA 2XGBA 1HP4A 1OC7A 4IMDA 1N2VA 3AHTA 4K38A 2VCCA 2D24A 3TJIA 4C91A 4NQ1A 3C2VA 1T7LA 3K46A 5JCKA 1ONFA 3KOFA 1UIOA 4BI5A 2FFCA 3G3DA 1GPWA 3N9SA 5BMXA 5A2AA 4MY9A 1Q2SA 3M0IA 1UBSA 1HKIA 3TFCA 3R58A 1B30A 1ZMCA 1GGOA 1US3A 1HGWA 5FF2A 2A21A 3KDNA 5EY5A 5BRPA 3KRUA 2YBUA 4LBSA 2OO0A 2FKPA 1F6PA 1L0PA 4W88A 3T08A 3W2NA 3UP8A 1VKFA 3WH6A 3OPSA 1VPXA 4OUEA 4W8AA 4M6QA 4IP5A 3ZR4A 1CGUA 4JS3A 1FH8A 4XZWA 1JROA 4NXSA 2C18A 4JFSA 4US5D 4GHRA 4ACYA 5I0DA 4ZR8A 1EC7A 3CUJA 1GVEA 4DJED 4GCXA 1NQKA 3H4XA 3CXOA 3HG4A 1D3HA 1JCLA 5LHEA 3NVDA 2NXIA 1ZJAA 3E02A 1PIFA 2ZRVA 2OKOA 5CLTA 3NQAA 4WDXA 4WGXA 5AVHA 5LIWX 3EGJA 3L12A 2QIIA 1Z3NA 1E72M 4HNLA 4XB3A 3IJQA 2ZE0A 1LOSA 2CLLA 2PC8A 4EOUA 3VO0A 5CXPA 1M68A 3L2LA 3VNYA 4JAWA 3NXFA 3I7SA 1R9ZA 4UQ9A 3T0TA 1JPDX 3HG2A 1CENA 1RP8A 3CUZA 6XIMA 3GH4A 2ACRA 2PWEA 2W5FA 2ZQ0A 2CPUA 3GD3A 1K02A 3PBGA 2Q3OA 1V02E 2CU0A 4FO4A 4KIRA 1OC6A 2W0HA 4ADTA 3P2VA 5EMJA 2A7RA 2E9LA 2GVEA 4GH1A 2YFNA 3MW7A 4RV3A 3VINA 3R89A 3BSGA 2Z0IA 2WKJA 1VFUA 1S46A 3F5LA 4UNLA 5C7HA 3JW7A 2QMJA 3Q4DA 3SQMA 3ZJKA 3NQEA 1TE6A 3OYZA 1WZMA 3QZEA 3WD0A 3WYZA 3S0CA 2Z1SA 1BRLA 1WZLA 3PFMA 1JCJA 4N6FA 1I2NA 3HQ1A 4O18A 2WCSA 1R3WA 4F66A 1RSCA 4R7OA 1UG6A 3GZ3A 4H7CA 4GUJA 2A3CA 1W1ZA 5EMMA 3GG8A 2PWUA 3ZT5A 4C6BA 1SJCA 4JQ2A 3V0UA 1JCYA 1PYFA 3PUEA 1GKQA 1HKKA 1XYCA 4HZMA 4UOQA 2Q8XA 5TAOA 4HBKA 4D6DA 2X0HA 3W02A 4IWWA 4H4VA 1RK6A 4M0XA 2R8WA 5A6BA 3PNUA 1NP0A 3DI1A 4AXNA 2X05A 1E0XA 3G5EA 1HO1A 1GOMA 4RK8A 3TROA 5F4WA 3NEVA 1TELA 1P6CA 4LIIA 2EF9A 3W53A 1DIEA 4GY0A 1GVIA 2YIHA 2Z6IA 4TOQA 2XFWA 4GABA 4LY8A 2VRKA 3WENA 1KXTA 1EC9A 3VX0A 2NV2A 3WLPA 1DL3A 1FWNA 1W9DM 2QJGA 1RUSA 4W7VA 3LRKA 3T7VA 3SCPA 4AZ5A 1XG3A 9XIAA 3KRZA 1OF8A 2QAEA 3PSVA 5HNTA 3U9IA 3G1XA 2HVOA 4LGXA 1ME7A 1IT7A 3J7HA 5BCAA 4I5UA 1EX5A 3CAWA 3A64A 1EB3A 3WQFA 4BI6A 1EF3A 2WXDM 4DI8A 3WMCA 3D47A 4TUFA 3S9ZA 2IPFA 1KFKA 4GINA 2GR0A 3AALA 3L66A 1FH7A 4P7LA 5A6AA 2I1OA 1KBIA 1FWRA 2WO5A 4O17A 2E09A 1IR1A 2QT3A 9CGTA 3TX9A 1DOSA 1JFHA 3QR0A 3S1GA 3QZAA 4GIYA 4MB5A 3SCSA 5E9XA 4Q4PA 3QTGA 4B5VA 4DO6A 3RGTA 4H83A 3JU2A 1GOWA 3BICA 1CGXA 4LFYA 2YX0A 5TR3A 2EKGA 4ZOHB 1YX1A 2ZC1A 1UOKA 4I90A 4PUNA 2GK1A 2FGLA 4AY1A 1AMYA 4MKVA 5HUPA 3W38A 3ABOA 4MPQA 3FYYA 1J0IA 2AL2A 2ZC8A 5KSWA 4BQ4A 3BCDA 4W8BA 2YPIA 2QVNA 3ITLA 3NGFA 3NWRA 4D71A 1RJRA 2C8NA 1CYGA 3FDKA 2IKGA 1P4CA 4MZYA 4FPSA 3M41A 5A8OA 3L5AA 4HKPA 1TV7A 3E9AA 4JNYA 4Q7BA 4QR6A 2QCFA 3SCUA 2BTMA 1LRNA 3PJXA 1OCNA 4EF9A 1RY8A 4LXFA 1O4UA 4ZQCA 5D8WA 1W5MA 3GKAA 3HPFA 5FCZA 3UNDA 4MG4A 1M6IA 3QMSA 2PDHA 4UR7A 1UKOA 3AQUA 5J8LA 4IPPA 3KOYA 1OK6A 4BJHA 5DXXA 1E3XA 5A3HA 4IFKB 4PMDA 4PRRA 4RDYA 5I06A 4AIEA 4IPNB 4LUTA 2NPXA 4JY9A 3GS6A 3VZYA 4FAMA 3DH9A 5D9MA 4PUKA 1RD5A 1SYTA 5C2GA 1V79A 1EYWA 2WJFA 3ZR6A 2A3HA 2C3CA 3KHDA 2VEKA 2VQTA 3WELA 1B3VA 4P2VA 1C93A 1XBXA 2Y8KA 4TX6A 3M0HA 2NW0A 1E9YB 1RV8A 4OJYA 5KZDA 2XUCA 2IPGA 3WLLA 4M8UA 5EU9A 5CPNA 3WFAA 4B16A 3TAKA 3QFBA 5I09A 4NY2A 2WM1A 4H9TA 4QS6A 4QDMA 1E40A 4ML4A 1V3MA 3T0AA 3BK0A 3LBOA 4PB5A 4Q4OA 2DZXA 1X96A 1J12A 2DQWA 2OQYA 1ZDLA 4KWUA 1AQMA 2VOTA 1E71M 1TPDA 6ENLA 5KTLA 1YPIA 2XM1A 4NIRA 3BJSA 1REQB 3H70A 1KCZA 3PY2A 4UFKA 2DT3A 4TO8A 5MKGA 1TWSA 3WNLA 3N6JA 1H7WA 1SU5A 3ARPA 3IJIA 3MYOA 4EAYA 3RU8X 2BOFX 4H4ZA 1D7YA 1OCQA 2EPKX 2VEIA 4DJFA 3S2JA 4DUXA 3UZWA 1OIMA 2OCZA 4DYKA 2PDYA 4FX6M 5AHEA 3ITOA 3DFSA 2A3AA 4ZCWA 3O15A 2DVUA 2HTMA 4D6JA 1U1HA 5HINA 1P7TA 2Y5EA 3RDKA 2V3DA 4FLOA 4YIWA 3NEHA 4C6QA 4BA0A 4DZAA 3UYCA 2XFRA 3A7RA 2WCAA 4GOAA 3WJSA 1FDZA 4XAFA 1PTGA 1TX2A 2HDJA 2YDSA 3VM7A 3SBFA 1J01A 3UWUA 1WUFA 1W9BM 2NT0A 1HXJA 2YB4A 1JIBA 5C5YA 3E49A 2DORA 4WRHA 2X7WA 4Q7IA 4ZVJA 3H2OA 3W24A 3VC5A 5HR7A 4I9JA 2A6NA 3SN4A 3DC8A 1M04A 4FXRA 4YCPA 4FI4A 1SZEA 1KN0A 1KTBA 1J9YA 2IKIA 4Q8VA 3DIPA 3QC3A 2ICSA 3MP4A 3P8JA 4XZLX 3RILA 4LS0A 4PYSA 1E5JA 1DBTA 4AUBA 4AD1A 1OGSA 2FZ8A 1IHIA 3B9AA 4QNWA 1IXOA 4J57A 1DQUA 1XRSA 4RW5A 5GJMA 3MSDA 2X0SA 3EWZA 3PK7A 3QY7A 2H9AB 4MHBA 5A94A 4GVFA 2OEKA 1AH3A 1YKWA 1ITXA 4OIFA 3FAXA 4H7VA 3AISA 4U2ZA 4YS1A 4O1AA 3T42A 3S47A 2Q6ZA 2UY5A 2WZMA 2YZ5A 4ZOAA 1XISA 5DN1A 1BAGA 1J6PA 1ISYA 4ZTXA 1DJGA 3WJXA 4JR5A 4QISA 1N7KA 5F4SA 4H6QA 4XBSA 3VIOA 5TF0A 1NOWA 1UPMB 1B4KA 2QPUA 4W5UA 3WDPP 3GRSA 2QGHA 3IIXA 4MY8A 3LGDA 3OB8A 3PZNA 5CLWA 2JEPA 1QNSA 1S2UA 3R2GA 4AZCA 4OE7A 3ENLA 4B5XA 2ZZ3A 3HRDC 1NAL1 1NHPA 3SY8A 4DLMA 3NSNA 3XIMA 3G1YA 1WE5A 3WH5A 4LC6A 1TMQA 1VD6A 1MVYA 4B5SA 1SMAA 1WO2A 4H3DA 1Q6DA 3VGBA 1K4HA 4JTUA 1KWGA 3P0XA 5ABEA 2WM0A 4JKMA 3MKCA 1XSIA 1A0CA 4V33A 3TUUA 1TR1A 3NO1A 2JE8A 1EOMA 4PTWA 1V0MA 1FY6A 3VDHA 4NNBA 3W7IA 1TB3A 1G6CA 3L2MA 1GRGA 1OCBA 3NZ1A 1FCVA 1HJQA 1C92A 3COTA 4BQ3A 5AYXA 2VWTA 1TCMA 4PMYA 1ZY9A 2DZUA 4RLIA 3VGHA 3E74A 5E09A 3T2OA 1WYGA 1R2SA 4YJ5A 3WF4A 2XVGA 4BEUA 1UR8A 5HANA 2XVLA 3G1HA 4PB4A 2VWSA 2G3IA 2PDUA 2ASHA 4IQLA 4DBSA 4MZ1A 4S2CA 4PB3A 4Y96A 2UV8G 3WBYA 4J3WA 2YKKA 3RITA 2ZZ1A 1A80A 4ROPA 3GTHA 3KLKA 3HA1A 3RRXA 4DM1A 3BURA 3PJTA 4OU1A 3TR2A 1VEOA 1AQ0A 3U0HA 4FOJA 1OFEA 4GYKA 7TAAA 4DO4A 1SMDA 3B9NA 3CB3A 4QLLA 4MNMA 1QPRA 1ZAHA 3U2ZA 3IAQA 4PODA 1W0MA 4DF2A 4PZVA 4HNTA 1H7PA 4HZ7A 1JCNA 8XIAA 1W37A 1VYRA 3BAJA 4DN1A 1XLMA 3EXSA 3R1ZA 1BTMA 2YBVA 4O15A 3PFRA 1T40A 5JMUA 4WD0A 4Z1BA 5AOUA 4C1NB 3OLGA 4REQA 4LUYA 2ONEA 1WKFA 5ABFB 1W3KA 3W7DA 1DWHM 3MCOA 2TYSA 4U5IA 1ECQA 4IXHA 3TTOA 2OGJA 2W54A 1GEQA 4TVUA 2OMAA 3OTRA 1TSIA 4J4KA 1E5NA 1V3IA 3NIYA 2FB3A 3UXLA 5H8UA 2V3BA 4NG3A 2R6OA 3E2VA 4UIOA 2QQ6A 2XVPA 3SQPA 1U5HA 3TOPA 1ITQA 4RZ6A 4PFHA 2UZ9A 4JQ4A 1LUCB 4QG8A 3UR8A 4ZEPA 1PKMA 1YPFA 3MHUA 3EEGA 1XLGA 2I14A 3CH9A 3WF3A 4HMDA 3N11A 1PCKA 1JAKA 4LNYA 4F0LA 4Z2JA 4A3UA 3O8AA 2YA1A 2GL5A 4JICA 5LZLA 2E0PA 3BJFA 2CKSA 3NR0A 1GESA 5JCMA 2BFGA 3FGCB 3CK5A 1RBLA 4JQ9A 3D5HA 1B1YA 1OWQA 5FJJA 6REQA 3CHCA 3QQ1A 3TR9A 2OODA 1R3RA 1K7EA 3OZOA 2PGEA 3EMQA 1FXPA 1FUYA 3DG6A 1WQ5A 1NWUA 3GXMA 1V0LA 4ADSA 4PMOA 4AF0B 2VYOA 1N62C 1MW2A 4BZYA 1BG4A 2Z1WA 4IGMA 3CB8A 5BU6A 4AVNA 5FF3A 3TC3A 4IP4A 2G4FA 4LYQA 1VCGA 3OGVA 4IQJA 2VCBA 3U2CA 3BLDA 1FFQA 3ZIZA 2QAPA 5FEZA 2YW4A 2F6UA 2WK2A 2QEZA 1F74A 3ARWA 1RH9A 3MT1A 3VGGA 1IZKA 2E6DA 4L4PA 3EWWA 3OZYA 4J2PA 2Z4GA 2YFOA 4C7GA 3UVIA 4GQQA 1DE6A 5E6ZA 3F2BA 3M5YA 2PUZA 2DIEA 1JL8A 2ALDA 4CNSA 3S6OA 1K7FA 3L2IA 1FP9A 3WLSA 4ZZ9A 1SJBA 3GG1A 3V0SA 1LVLA 1NDZA 3KWSA 3DFOA 4N9BA 2GUUA 4ICCX 5F2GA 3CL8A 1K9TA 3EOLA 3VE7A 1A3HA 1C90A 2YW3A 4PSPA 3NDZA 4JEJA 2FJUB 3S5YA 2YA0A 1P1MA 4IHCA 3TXVA 2TRSA 3CQJA 3UT0A 2J78A 2FGBA 4OQVA 4M80A 3ZLHA 3W6YA 1E51A 3ZSSA 4WSJA 5XIAA 3DHFA 2VNCA 3GU9A 1O1ZA 1WPCA 2WMFA 4GC3A 1TV3A 2ZIDA 1UZ4A 1OEPA 4EMIA 1UR3M 2YDQA 1MUMA 5LIXX 1SW7A 4GIEA 4YCOA 1UMLA 3B40A 5BWAA 1KM1A 2AQVA 2C3ZA 3TP4A 3SN0A 4HOXA 3OVQA 1B3YA 4JTAA 1XFBA 1VRXA 5J5RA 4ZQOA 3LYEA 4M1RA 1X7FA 1BVWA 1NHRA 3QV7A 5E6YA 1EGMA 4F4RA 4UB9A 5T91A 1Q8JA 3LA4A 4KGLA 3D3AA 3TJXA 2YL9A 1A5NC 3TN5A 5G4WA 1IWPA 3MTWA 5EMLA 1JDAA 1YXDA 2Y6ZA 4N42A 2BC1A 3LX9A 3NQ8A 4WEVX 4PMRA 3LHWA 4IIBA 1QRQA 2WBKA 4I8DA 1CECA 2DVTA 1B0IA 4OOUA 2GJNA 4JL2A 3XISA 3A3WA 4AG0A 2XIMA 3U3HA 1OHLA 1QBAA 3SCNA 3V75A 3UVAA 3GNXA 4RKAA 1CGWA 4CGTA 3CAVA 2DJXA 4JPGA 5G2WA 2OYKA 4XAGA 1XBZA 1XLFA 5C9RA 1EJTC 2H8XA 5G5HB 3HG5A 1GNXA 1V3KA 2W3SA 2DZSA 4S3BA 2YYUA 4AISA 3UG3A 4N6EA 5LA2A 4K68A 1F4AA 1VR6A 2ZA3A 1QMLA 3UZYA 1YXCA 2X40A 2PDNA 1O5KA 3CO8A 3KL0A 4Z1YA 3SCRA 1ISVA 4BCEA 4RDZA 2D3NA 2XH7A 1M3UA 3MI6A 2CETA 5LGXA 4JYFA 1MUWA 1DWJM 3TU9A 2ZICA 1E0TA 3E2RA 1O6IA 4XV0A 2HBVA 1TZ9A 2GGEA 3LTSA 3CGDA 3RM9A 6TIMA 3HURA 2QULA 3DGBA 5JBEA 3N25A 4FXSA 2GYIA 2WYSA 5ER0A 1JUKA 3DGZA 3MSGA 3VMOA 1FXQA 2VR4A 3WCZA 4YYCA 5C9ZA 2GH5A 4NX5A 4MADA 3EB4A 1UUMA 5IDZA 3TC7A 1P1XA 5FD0A 1YDNA 3APTA 3IVUA 1HVXA 3L0GA 3QQ0A 1QO2A 2V68A 2VEPA 3B8SA 3TW6A 4IIEA 1BHGA 3GU2A 1QNQA 5A8QA 1AZ1A 3M9YA 1KBBA 4MNJA 3HO8A 4JFVA 2NQJA 1VB9A 1PHWA 3WDIA 2CYGA 2J6VA 4UTLA 3T4CA 4DWDA 3PP7A 4BF5A 3QR3A 2Q02A 4Z42C 4GGBA 3N15A 4WGHA 4AH7A 5I3GA 1G4TA 3C56A 4GRTA 1H61A 3KX6A 1F3PA 1XSKA 2G3JA 1BRLB 4X61A 1JZ8A 3OVPA 2PWFA 3S1XA 3WJZA 3ZQ9A 2DT2A 5SWUA 1TJRA 2G5WA 1IXNA 1XS2A 2JK6A 1IQ8A 1FX6A 3CAKA 3RCYA 4ORMA 4EPKA 3U2OA 1B3ZA 3PPFA 3W6MA 3JRKA 2Y1HA 1R8LA 4LNCA 1K77A 2V2DA 1PIGA 3HZ3A 1XLLA 1LTDA 5M2FX 3OEXA 1Q6CA 3W86A 2GPTA 4NASA 3TK7A 2WVSA 5LNRA 5CSRA 4UTHA 3T2PA 1XLDA 1KM0A 1NM9A 1QTWA 3DK4A 2Y5SA 1FWFC 2IW0A 3G22A 5FL0A 4B5TA 5FS8A 2QDEA 4AHPA 3O7UA 4O16A 5L6UA 4F2TA 1LBFA 2RDUA 2VM8A 2O9TA 3VKBA 3ABXA 1CXEA 2YVJA 4MWAC 3WQCA 1JCTA 7TIMA 1OBAA 1Z89A 2ZZ5A 1XLHA 4LEFA 2B7QA 4CU8A 4JYDA 1S5VA 4MLRA 1UKQA 5B7ZA 4G6CA 4CN6A 4UFJA 4Y9NA 3I6RA 5BXTA 3LCHA 4IUOA 3VD5A 5IFTA 2Z7GA 3A12A 3AXKA 1MNZA 4MZ8A 5AYYA 2W92A 3ITTA 5JRBA 1OABA 2OWWA 1DWAM 4BKNA 2GJXB 1EGVA 3MYPA 4IPJA 1Q66A 4V2XA 4R7WA 1UH3A 3ATYA 4L4MA 4LUIA 4WDTA 1RY0A 1CGTA 4PMNA 4J2MA 3LPPA 4BQ5A 2X30A 3M0VA 4EACA 3R8RA 5HXMA 1GEHA 1X8FA 1YW1A 2DW7A 5EBKA 1K8YA 2VEFA 4E8DA 1BG9A 1BF6A 2ZYFA 3JS3A 3W1XA 2GGHA 3EWBX 4ACZA 4E2OA 1B4EA 4M19A 5BZAA 3GNDA 3GC2A 2QHAA 3PZMA 3TIMA 5DBUA 4S3KA 1XANA 1E0UA 1H62A 3ALFA 4JTLA 2DDXA 2DEPA 2Y88A 4GUIA 1VPYA 1R3SA 5I07A 3VU2A 1HG3A 1SO5A 1X6UA 1MYRA 3RAOA 1M65A 5EL1A 4Q8WA 1W9VA 4M24A 4WVXA 3WN6A 3A7UA 1IWBA 3KTSA 3UR2A 3ZXWA 2JIWA 1WOBA 4UZUA 3MJMA 3ZYZA 1K8CA 2V5LA 1W3TA 1RQEA 4JN6A 1ECEA 2G37A 4XISA 3OYXA 5FJUA 5JUVA 1RM6B 2NVKX 3LQGA 2FZDA 4HA4A 3SUSA 4EX4A 2J6XA 4MNLA 4AFYA 3FHAA 3WLRA 2WC7A 3DERA 3WBEA 5HJYA 2F38A 1E70M 3L23A 1F3WA 1JF5A 1YTDA 3UXDA 3DCPA 3S4TA 3S5NA 3THAA 4E4UA 1JZ6A 1G7VA 4E2BA 3POHA 3M7SA 3PB0A 4XUGA 3UA3A 3CJPA 4Q4SA 4AB4A 3E0VA 3AJXA 3H4WA 4B9YA 3PZVA 3MUAA 2AKMA 4G7FA 4ATDA 4DAIA 5JXQA 3PUOA 5I77A 3W73A 3PWIA 2ANUA 1CZ1A 3WQWA 1PKLA 4DJDC 1KFCA 3LCFA 3OVGA 4CCCA 1C7SA 2F61A 1N55A 4R85A 2J75A 1GVYA 4O1BA 2R24A 3GYEA 1Q1RA 1R3YA 1PVNA 1YBQA 1FTXA 3GBDA 4DWSC 3I3BA 4RDVA 2P50A 2GJXA 1V77A 4C6KA 4ES4A 1S3TC 5K4ZA 4BWLA 2GQAA 1B54A 1NH6A 3ZS4A 3IRDA 4OV9A 1OD0A 3FA5A 5DT5A 2DZTA 2XFYA 4HQVA 3SCWA 3SFKA 3MMTA 4KW2A 3TJLA 1TUXA 1VS1A 1P0NA 3WNMA 1US0A 1CWYA 2CIPA 2WJDA 1QJWA 3P67A 1PYMA 3NZPA 2DSWA 4WJXA 5CG0A 2XIBA 3OP2A 1XG4A 4WHBA 2WP5A 1J2WA 3WJWA 1GZ1A 2NQHA 1EP2A 3GW3A 3CTLA 4X2RA 1A5SA 4PCNA 1RQBA 1OT2A 5HMFA 3PZGA 3W74A 5HA7A 1ME8A 3H4GA 4GO8A 4HHHA 5HPCA 4UTUA 3ANYA 2ZDSA 2FZNA 1HL9A 3W72A 1XUZA 2Z1VA 2UY4A 3R79A 1C3FA 1XYBA 2OX1A 4TMBA 4TVWA 4XKYB 2GDQA 3P62A 1EDQA 3EXRA 5AYBA 2WOVA 3T0BA 4FHAA 4HNCA 1T8XA 1GRAA 1JDDA 2VFIA 3F5JA 3LENA 2WHMA 3B0YA 3OO2A 5E1QA 2BXYA 4FA3A 1XL9A 3MI2A 3NSMA 4CNNA 1VZWA 1CTNA 4WIWA 1XGZA 3HG3A 2GJPA 4JTEA 4F2UA 3F5KA 4TMCA 1JNDA 1FCUA 4AIBA 4L6HA 3AICA 3NPXA 4LSBA 4R33A 4RCXA 1IE7C 1OADA 3UXIA 4GFSA 1GJPA 3T0CA 3APGA 3M0ZA 2XH0A 3PJUA 1K9FA 1UWIA 4ZE5A 3P81A 1AQHA 3W22A 2HV5A 3S9IA 2YJQA 2GOKA 3W7CA 1Q6QA 3ICJA 1ICQA 1LLZA 5CSYA 3FYPA 1PBGA 2GZXA 2F84A 2Y89A 3E0WA 3N12A 1O5XA 1Q85A 4BF7A 3RR4A 1A0EA 3OGSA 3AMLA 2PZ0A 3UESA 1S3HA 2AAAA 5F7UA 1QHPA 4HP5A 1BWCA 1FHVA 1BPLB 4PBEA 2ZFAA 3CPGA 1THFD 4XSMA 1GOOA 5HDRA 3B9DA 3BUVA 2CEQA 4XG1A 2D2JA 3LDVA 3VKKA 4KFOA 1KCKA 1H7NA 2VVSA 3O6AA 4JIRA 1R3TA 5KITA 3LHZA 1VBHA 4L9XA 4X63A 3AIWA 3GXNA 3HB9A 4DEFA 3ZO9A 4WDWA 2PCEA 4FXJA 1LL6A 1EJ7L 1EIXA 2NVAA 3EZ4A 4Q8UA 4S3GA 5A69A 4LJ3A 5CBIA 2V82A 1FKWA 4O0KA 4DZHA 4X0VA 1MNSA 4MWAE 3NXLA 4X9SA 2ZWYA 1TJ1A 2D0GA 4C90A 3EB2A 1FWHC 3TMQA 2WSYA 3EXTA 2Q01A 3R8GA 3KL3A 5BROA 1E9LA 3QC0A 4JTFA 3VIJA 3G0UA 1W8GA 3LMYA 7REQB 1FRBA 1BKSA 4OHQA 2ZZ6A 4YXGA 3PF3A 1KD0A 2G8ZA 1EUAA 1IYXA 3M16A 3N2CA 1OIFA 3DG7A 3TYBA 4NI8A 3EANA 2AL1A 1W1IE 1A4LA 3SRDA 4ZODA 4HU4A 3Q45A 2DZPA 3W26A 3NM1A 2C0AA 3N6HA 4BEQA 4OBRA 3DI0A 1BSLA 3K4WA 2CZEA 5LKYA 1KXVA 3WO8A 5GQBA 2GGIA 4ZSUA 2PP0A 1ZMDA 2FVLA 1JAEA 1GJWA 4S3CA 2ZTJA 2JALA 5I3HA 3NQMA 2YBTA 3AHZA 1VQTA 4YWSA 1H60A 4U33A 3NVTA 5E70A 4C6IA 4Z1CA 4FLQA 3CHDA 4AF0A 2D69A 1X8CA 4U5KA 4LAZA 3O0KA 1D8CA 4RZBA 3SJNA 1H7XA 2C1GA 5AYZA 2F9RA 2NVCA 3D0CA 3AIRA 1UD6A 4ICNA 1PWMA 4FK9A 3I4KA 5C71A 3L68A 2GVGA 1S2CA 2CNCA 4QHRA 4FB7A 5CPSA 3DKLA 3G6LA 1K4QA 4HNUA 2FVMA 3RPDA 1WOAA 1FOBA 2Y0FA 3MO4A 1L8PA 2ABAA 4I5RA 1E56A 4GJIA 3P7YA 3UU0A 4W84A 6CGTA 4J3ZA 4A29A 3LNPA 4Y7EA 1JZ4A 7ENLA 2ZUVA 4Z0JA 2HVNA 3G1DA 2A8XA 1I45A 2DU2A 4E4PA 1ZUAX 2E6YA 3DFHA 3HJZA 4TVCA 1XDLA 3EWYA 5ENLA 3F2DA 1H6VA 2X8RA 2X1SA 1HVQA 2IQDA 4C1KA 4JCMA 2HISA 5BU9A 3I6TA 2ZZ7A 4FF5A 3IPWA 1MDLA 3URQA 3I7RA 3EDFA 3EAOA 4YTUA 1SM9A 4H9ZA 5HOSA 1K9DA 1TKKA 4UCFA 3ITYA 4MB4A 1W1PA 2WVVA 1R3VA 1LYXA 3GVGA 2ISWA 2WBAA 1SO6A 4DJEC 3L4ZA 4QG6A 1BWLA 1FKXA 2BB0A 2J9ZA 1G9HA 1UQYA 4X3ZA 3LCLA 4OECA 3VGEA 1EXPA 4F9DA 2POTA 1MI3A 3OZPA 2WWCA 1CT5A 1TJ0A 1KRBC 3PBVA 4AZGA 3SRHA 3IVTA 3W88A 3DHDA 4EANA 5FESA 2GR1A 1ISWA 1SZFA 4DWSD 2JEQA 2WJEA 4PCPA 1S5NA 1XBYA 3FFSA 4AQLA 2NQLA 4C7DA 2PWHA 4WKAA 1EO7A 5G1MA 1HIZA 3EMCA 2XZ9A 3W1TA 1TV5A 4OVXA 2Q09A 3GTXA 3NURA 3ARSA 5HMEA 1PZ1A 3PM6A 1JEZA 3O06A 1O5RA 2PTXA 2XSAA 2VQUA 3CAQA 4FP1A 3B8TA 2VKZG 1S38A 1BWKA 1BYAA 5CPOA 2WNZA 1SZNA 3RK8A 2VC7A 2YOCA 4J56A 2F7FA 3UW6A 3BMXA 1XLCA 3CNYA 3ARQA 4HSOA 3PG9A 2E77A 4D6GA 3W3OA 4XD4A 4EWJA 3IANA 4LF1A 3NQFA 1Q65A 1TVPA 3UG5A 2HK0A 1GRTA 1XXXA 1JYNA 1RLCL 3Q67A 4QROA 5GJPA 1L6WA 1UD4A 3M0JA 3EAUA 3WQ5A 5AHLA 1UHVA 1VIZA 3K4AA 2NQ5A 1HUVA 2A1YA 1UUOA 2A85A 4XZIA 1V6VA 1AQFA 3LHTA 4O4VA 2ZXDA 1BXBA 1UKSA 3W7HA 1XIHA 4PC8A 4QRNA 1DNCA 2BWGA 1BVZA 2X2YA 4C6PA 1TO3A 1O1HA 4LYRA 3QFWA 3T8QA 3E38A 4QJ3B 1HKJA 2QCGA 3LCIA 3G3MA 3ARVA 3K5XA 4G1KA 4IMFA 3MQTA 4MKSA 4O54A 1WP6A 2AAMA 1F61A 3W1RA 3DDMA 1A53A 4FX8A 4NNCA 4XD6A 1GORA 2XGIA 3NQ7A 4EAMA 3QPZA 4ERGA 1GERA 4H8NA 4XD3A 1T0OA 2PDJA 2FH6A 5E0KA 2WZIA 3WQDA 1JULA 1XLIA 3R4IA 1KB3A 2QS8A 3VK5A 3N4AA 1TJ2A 3URBA 3B0UX 3RMJA 3STEA 5A6JA 3GY1A 5C2CA 4MUPA 4RW3A 3NQGA 5GRTA 1ZAIA 3CZLA 1CEOA 5EGRA 1UR2A 2W4XA 3IJ7A 4JCLA 3T81A 4AZIA 1EJSC 1ISXA 3EKGA 3GG7A 4MWAD 3UF9A 2Y7FA 4LYKA 2DH2A 3B0PA 1J6OA 2EPNA 2V5DA 5M17A 3AXXA 1VP5A 3GVRA 3EPNA 2J7EA 3BQ5A 3V1PA 5DRCA 3W2UA 1GG1A 3FKRA 2OU4A 2NSXA 3NL2A 1VFTA 4US5A 2QMKA 2BGSA 2XIQA 4LB3A 1KV8A 4CCDA 4ZE4A 4UUIA 3PTDA 4XBJA 1KWKA 4X60A 3QHOA 4ATLA 4QXIA 3SSZA 4J5NA 1UWQA 2G0WA 3CWOX 5EYWA 3UJ2A 1VJIA 1FH9A 2ZADA 5FJIA 1TA3B 3TV8A 3LMZA 3PZOA 4APNA 2WKLA 1QOXA 2INFA 4LOCA 3PZTA 3MI3A 1WKDA 1GETA 3LERA 1UP2A 3AHYA 1GPFA 2RFGA 3W81A 1O5QA 4W89A 1C7TA 1A5LC 4KWOA 3TJ4A 3M5ZA 7PTDA 4XD5A 1GQLA 4ATWA 4HGXA 4TR9A 4O50A 2KAUC 4KBXA 5FF4A 1EPVA 4JTQA 1G7UA 1MOKA 1G4PA 1OYBA 3ARZA 2G3MA 1R85A 3ARYA 2GGJA 4UFLA 3W2LA 2ZRUA 1IEQA 3NL3A 2JKEA 3LI0A 4EM4A 1L2UA 4DXVA 1Y0EA 1PX4A 5AVNA 3KCLA 4NILA 1HQTA 3P60A 3N2OA 2V5BA 1ZP3A 4MF4A 3UWEA 1RK5A 2PLCA 3GNOA 3TTSA 4IX2A 2WNWA 1DIKA 2HNHA 3G18A 3PUDA 3BCFA 3GSMA 4IIGA 4M5PA 3UGRA 3VOGA 1X1ZA 1DVJA 2NWSA 3H22A 3UXAA 1YE4A 3MPGA 1FHDA 1AG1O 1A47A 3CUFA 2X50A 3R43A 3GRTA 3CGEA 4PCFA 1U30A 3IJLA 3R94A 4KF1A 1GZJA 4UMCA 1H0IA 3TQPA 4YTRA 4CEXC 3GRIA 1Z48A 1RVGA 2CLHA 5U25A 4DNHA 3N19B 1PJ9A 4Q32A 4GQGA 4GG9A 3IUHA 1AD4A 4NX0A 3S1VA 2BMBA 3WY1A 4V27A 2E68A 4AEFA 4AD5A 3IGHX 3F4WA 1XYLA 1I2PA 4HU3A 4AZ6A 3SURA 5C0QA 2EHHA 3UXKA 1GQJA 4CVWA 1JF6A 3QW4B 1Y5WA 1D2KA 3RX3A 4E8GA 2YXGA 4E0CA 5E9AA 3THCA 2UWFA 3VMPA 1GWJA 4RPQA 4O19A 2A3LA 1I1WA 4JTTA 4ZXOA 4D6CA 2XTKA 4KRUA 1M53A 3FS2A 3FNDA 1XRVA 5EB8A 4QLJA 3ME3A 2D3LA 3QY8A 2INEA 4LWWA 1M6JA 3H2MA 4FS9A 3CO4A 3W83A 1U1JA 4L80A 1UD3A 2UY3A 1R2TA 5H1WA 2ZX5A 5LNWA 3SO7A 3TN3A 1OT1A 3TW9A 1TWZA 1XI3A 3VGFA 1E6PA 4Q4MA 3HPAA 2IPWA 1RZMA 2BHYA 2ZA1A 3PG8A 3NSXA 2J77A 4KPRA 3W25A 1JPMA 1EC8A 3BC9A 2J7HA 2WLYA 4PA8A 3VKCA 2OELA 3WLQA 1V3LA 3L67A 4QGCA 5I79A 3IJDA 1W3LA 4DBUA 1S7MA 1AL8A 4EMJA 1XQKA 2R94A 1Z8AA 4H4IA 2CFFA 3T40A 1M1BA 3CYVA 3PC0A 4IXXA 1JXKA 2YXOA 5A2BA 2V6AA 5AY7A 4WJ8A 3T78A 1Z69A 2QCHA 3OBKA 2P3ZA 1YYAA 3B8VA 2PMQA 3GDKA 2V2CA 4JXCA 3E0LA 3LZ5A 3M6DA 3K8KA 3LXCA 7XIMA 4DO5A 4HNVA 1HX0A 3LEPA 1JDEA 2OYMA 4NZ4A 3T44A 2D0FA 3AUJA 3KZPA 2P10A 2X8CA 3WDRA 2VOMA 2FGZA 1GTHA 5JU6A 2WBGA 1GT8A 3KE0A 3L5OA 1NDVA 3NQBA 4C5YA 1AOGA 3IEBA 5HMDA 3MU7A 2WSKA 3PUGA 1VFOA 3ZJ8A 1QT1A 1D7KA 1DIOA 2YL8A 3Q94A 1KV5A 2OFJA 1I4NA 3EWXA 3S2NA 3N14A 5IOBA 1UWUA 3RLVA 4L4OA 5D32A 4Z08A 2DP3A 1Z9AA 3VZXA 2EPMX 3EWUA 1KM4A 2V3EA 1W9UA 1U2YA 4URIA 1XBVA 3QSRA 3IAPA 4NAEA 1TTIA 2BCPA 3AMZA 2BVYA 1Q7ZA 1I60A 1X7IA 4K1WA 3W75A 4XTIA 3W7MA 5LIUX 2O4MA 4XK2A 1G4EA 3UG8A 3SIMA 3R8HA 2IMRA 4UQCA 3UWZA 1EYEA 1Q45A 4K7YA 1W5NA 1S39A 4LEQA 2XWEA 4FF7A 3V1HA 1T6MA 1TMLA 1XGEA 4MJ2A 4H4RA 1JZ7A 1ENUA 3K1GA 2QCDB 3LOTA 4KH2A 1RBAA 1HKVA 4AZHA 5F2IA 5RUBA 2NZLA 3SADA 3MUY1 4GQBA 3KAOA 1CLKA 2QAFA 4LCSA 3UWQA 4BFAA 1ZFJA 2Z1BA 3FDGA 5GNZA 5FEWA 2P8BA 3QOKA 5A8NA 4DJDA 1SB3B 4JZ5A 2B7NA 2WSQA 1YTKA 3MVTA 3TZFA 1W5PA 3P5ZA 1VGAA 1LROA 3D6NA 4Q8TA 1DJNA 2V5CA 3SECA 3Q58A 4HMEA 1RCXB 2WMGA 3N9RA 4IMGA 1SFTA 2OJPA 4YVXA 2OOGA 1R7OA 3KFTA 1V93A 3MCNA 1XQLA 3B97A 3WJYA 1IIHA 1J5SA 3GFZA 3G8RA 2XSBA 4UQEA 4UZSA 2B4GA 1NJJA 4GE8A 1GRHA 1W2VA 3WLHA 4QJ4B 4BK9A 3REQA 4LRSA 1R47A 4UOZA 1TPVA 3WBXA 3WD1A 2V6OA 3G24A 4GIRA 4ZOCA 5D04C 2PWDA 2QNEA 4IPIA 4ALDA 2EQ9A 5HR6A 4N9EA 1PWLA 3LHYA 1FEBA 4LQ1A 4IQDA 1VF8A 3MJYA 3GHRA 1YNYA 3ARXA 4DQWA 5HUOA 1BYDA 3PG6A 2ZOXA 3QYSA 1HJSA 2CFYA 3DG3A 1LBLA 1JG9A 1TPC1 4HK7A 3HJEA 1P0DA 2J7FA 5EMKA 3AO0A 3FEMA 3WQEA 4FX9A 1NDAA 2E9MA 3LPGA 1E6QM 3NPUA 2VRQA 1OFAA 4B4FA 4DWSB 2O0TA 3AROA 3WUBA 4NAEB 3LY0A 2FYMA 4UTMA 4KCTA 3LN3A 5G5GB 1NQ6A 3PTQA 4EM3A 1X6LA 2ZRZA 3N2TA 4CCEA 5TD4A 3WUGA 2WPFA 3S3GA 4XIMA 3W7NA 2D20A 3F1QA 4KEMA 1V08A 3PPHA 3QR1A 5AZ0A 2NV1A 2DZVA 4HD5A 3W71A 4I9AA 1XH1A 3ZSTA 2D23A 3MP5A 2R1KA 5D37A 4ROQA 2EJ1A 2XSXA 1NOUA 1VBJA 3GB6A 3WLMA 2J74A 3IGSA 2JF7A 4GI6A 2CW6A 1B9BA 1ZRQA 4WZHA 1VEMA 4AVOA 2VL4A 3QLLA 1K9EA 2QUUA 3IJ6A 3UZXA 1CLXA 4WY0A 3VM5A 5HWJA 3WFLA 5C70A 4RE0A 2AOSA 1TE1A 2EPLX 3BGAA 2I9EA 1JZ3A 3AMGA 4NKCA 2VGBA 4JHOA 1TR9A 3ZJ6A 3EOEA 4ZBCA 3P61A 2ZZCA 1Z32X 4PCTA 3N2BA 3V5FA 4MPKA 3LS9A 4B2DD 2CXGA 2ZVRA 1XRTA 4R88A 3CQHA 4QAWA 5JH1A 3K1DA 1EBDA 1XICA 4NSBA 4EXQA 3CGBA 3NCOA 4UR9A 3L9CA 3GE7A 4HPXA 2E3TA 4HJFA 4UNKA 3O6CA 5D03A 4DI9A 1V6TA 5HAOA 5AHIA 1ZGDA 2JGYA 2O4QA 4GYJA 1XSJA 2DFAA 3NPWA 3WEZA 2CHOA 4C6FA 2C15A 1WUEA 3DKJA 1UZHA 1J0JA 2NLYA 3L4YA 3BMVA 4R9OA 2Y70A 4Q8OA 3DYOA 3AN1A 4O0ZA 3O1NA 5HPOA 2GJLA 3IK4A 4AD2A 3G0SA 4HA3A 1V6XA 2J66A 4FNRA 4DNAA 3SJ3A 3SFWA 1NFBA 3APYA 4V1XA 2QUMA 4HHPA 1GYNA 5BOFA 1E0WA 3FJLA 1ZALA 4WR3A 3AS0A 3ITGA 3BO9A 4M6VA 2J13A 2QPSA 2GSHA 1OX4A 1BD0A 2I9UA 3C4UA 2PURA 3KOXA 3MUXA 3PB2A 1XINA 4I3GA 1GHSA 2G3NA 4E2DA 3CL7A 1MFUA 3A23A 7REQA 3UWVA 3BG3A 5I6SA 5IM51 5I03A 1C91A 3FCPA 3WQVA 3F4CA 2J7BA 1XC6A 5A8MA 3RNDA 1XHCA 3TNBA 1HF6A 2PDPA 3EMZA 1WAUA 2BY0A 1A5AA 1RD6A 2A2IA 3PR2A 3OC4A 1G67A 1WKEA 2QV4A 4HPJA 3NVWB 2ZZ4A 3STGA 4WX2A 4B3ZA 5BOOA 3AIUA 4KPLA 1UH2A 5G2IA 3VOHA 1OC5A 2ZZ2A 5T8GA 3W1QA 3RJYA 1TWDA 2PCQA 4XVEA 5FJOA 1VBRA 3KZSA 1EJRC 3D3FA 3UPWA 2PZNA 3H7VA 5DF0A 4XKMA 3UY8A 2BVTA 4KCUA 3G2GA 3MWAA 4S1FA 2CHNA 5D33A 1QFEA 1QNRA 4IM4A 1EO5A 4HN4A 5K4XA 3UWYA 5DANA 1X98A 1PDYA 1KTCA 1TPUA 1WDDA 5BRQA 3DFNA 3LLXA 4AYGA 3LCWA 2INZA 1EPXA 1VDVA 3A5VA 2VFEA 2NQZA 5EKYA 2QJJA 2V69A 2QW5A 1LDCA 1UP0A 2IXVA 4HB7A 3HF3A 5CZSA 4IP7A 2G96A 3KOWA 2WZHA 4MJZA 4P8UA 5D2WA 1TPEA 1DJHA 1NELA 3MUZ1 4Y8EA 3AIEA 1TYPA 2X1IA 3F4VA 1R30A 4UNIA 1NPXA 1RHCA 2FZMA 1KQZA 3LTYA 4IIDA 1HP5A 4K36A 1RLDA 1N63C 3LHVA 1JXJA 4M52A 5E93A 4DF0A 5CBBA 4CNOA 3GBEA 4ZMGA 1RA0A 2AQWA 4CD5A 1XCWA 2Z26A 4OUIA 2Y62A 3QW3A 3TN4A 3AC0A 4K8EA 1TIWA 3S1UA 4MMWA 2PF0A 1R38A 1NDYA 1QW7A 3E1F1 1FWBC 3AYSA 1POKA 2QGYA 3LXBA 3MB9A 1NHQA 4UR8A 3KL5A 4H2HA 1TZ7A 4NT0A 1I6NA 2ODOA 3BH4A 3QYQA 3CLMA 5JH2A 2W0UA 1O60A 3KM8A 3DC0A 4CN4A 1ZHAA 1E6NA 4POCA 2OQLA 5ABFA 4GMEA 4AD4A 4CN1A 5C54A 2OSXA 5D4YA 3UGVA 3RO6A 3ZR5A 4KFNA 4O1FA 5LGZA 3QRHA 4H6RA 2FTPA 1GOIA 4W87A 3WD3A 3GD6A 1FIQB 2Z24A 3EKLA 1CGYA 3CUHA 1S1PA 3CZKA 3ARUA 1UC5A 2QJHA 2Y63A 3ITVA 3W9ZA 2PDFA 2CC0A 3KLLA 1U22A 3C3NA 1N8FA 4IQEA 4O13A 3DOPA 3UY7A 2CERA 2Z6JA 2GVLA 2P88A 2YCEA 1DXEA 3SSJA 3NOEA 4IL2A 4EPBC 3FJNA 4OBTA 1H1NA 1XYAA 3QM3A 1Y5VA 1NFPA 2NUYA 1P0EA 4MYXA 3VAVA 4PUDA 1KBLA 3IWPA 4PULA 5D9PA 1GZGA 3S83A 3W29A 3RRAA 1NTHA 3NTYA 1CXHA 4LF2A 2IKJA 1G69A 3V36A 4AD0A 3BLKA 4KS0A 2W91A 2I17A 1YADA 4UMAA 4ZQPA 1UWTA 5M5DA 3BLEA 3EWCA 3RM8A 1CXKA 2WMJA 4LX4A 4E3VA 2XINA 1QU4A 5FAGA 3WQOA 3TCEA 1HO4A 4OTKA 3L21A 3T9PA 3F03K 1Q6LA 1LQ0A 1H49A 1H4PA 5K7JA 5LXXA 4MAZA 2QCLA 1MWOA 2V81A 1X2HA 1BZLA 2YCIX 3N6QA 2DT1A 4W85A 1XD1A 1TTJA 2PDXA 1UD5A 1IEVA 5HQEA 3R25A 4ZGYA 4A2SA 4NVTA 4B15A 1CGVA 3CT2A 3HGSA 3TZNA 2OEMA 3PJWA 4F0HA 5F1VA 4NEWA 3ZVHB 1KXHA 4DZ5A 1JPIA 3SUVA 3STFA 4GFIA 3GIPA 4XKYA 1M7XA 4PMVA 5CPMA 1C29A 3M43A 3NUKA 4C6LA 4N02A 1NOFA 2QDHA 3BZGA 1IGSA 2DZBA 2J8TA 1PDZA 4FNTA 1W32A 3GYCA 1ZZMA 2WOQA 4CQAA 4MYAA 4Q7NA 3V18A 1J79A 4EQWA 2FZ9A 4I6VA 1KQYA 4LYPA 2NX1A 2Y5JA 3H2CA 4QE1A 1AK5A 4K2SA 3R10A 1KM3A 1PB0A 4ML9A 1H2JA 3KHJA 2GR2A 4HMNA 5LXEA 2OR2A 3AS3A 4HNNA 3QFEA 3JUGA 5FJTA 2BOGX 2DZWA 1K1DA 2ISFA 4JX4A 3H24A 4RNIA 4PTVA 4LVBA 5K3VA 4LALA 3ALGA 1PXGA 1LORA 1LG2A 3W7KA 1XD0A 2RAGA 2XIIA 1E9IA 3FGCA 1E6RA 4JYEA 1E0VA 1VFLA 4A4AA 1FECA 1K7XA 3ANUA 2VZVA 1FHUA 1GVRA 1KGWA 5D2TA 1L6SA 3CASA 1F3XA 2HPIA 1TQXA 1TJPA 2E5DA 2RDWA 5CEWA 2GDUA 1Q2RA 1ZENA 1FO4A 5G1YA 3TONA 2NUXA 4MIMA 4N0RA 1QPNA 3GK0A 2WMIA 4B91A 4XO6A 3GNPA 3HMJG 4E2VA 4YPJA 1BXNA 3H6OA 1ZPTA 2DPEA 3RCMA 5ABHA 5U7SA 3FLUA 3CV1A 1QI3A 3RLUA 4W5ZA 4QQUA 5CPQA 4DVOA 3DN5A 4UTKA 4D2JA 3IGXA 4XSLA 4D6HA 2FPYA 3HPXA 4WK9A 3MP3A 1FWGC 4JQ1A 1B3XA 4LVDA 3PZIA 3ORWA 3EX4A 3SGZA 2RUSA 7ODCA 1RJQA 1YE6A 3LCXA 4QDWA 3TTEA 4H6EA 3LV6A 4RZ4A 3ZZ1A 1KRAC 3UERA 3P93A 3MSYA 4GR1A 2RDTA 3PBMA 4ERIA 3NZGA 4WXZA 4OFCA 2NXGA 1MXDA 1EBGA 1MW0A 2E4TA 1DWFM 1XR2A 1W3JA 2H3BA 4HSHA 3R5EA 4DZIA 1W17A 2A79A 4IIHA 3BOXA 2PTYA 3BQ6A 4PMUA 2F6XA 4BWLC 3W00A 4KQNA 1DXLA 6REQB 3EDKA 5JBDA 1CXLA 1LCOA 3GX9A 1A5KC 1EBHA 2IQTA 1SR0A 3C61A 4S3JA 2ISSA 4TTUA 4NL1A 2YVGA 2ZUUA 3L0KA 4HSNA 4WDUA 3DECA 1BQGA 3RLGA 3U57A 3AM9A 3WLTA 1LT8A 3KRBA 1WXJA 1TQJA 2XH4A 1U1UA 2J7DA 2W79A 2PLMA 3U7VA 2PDCA 1KFEA 5KZEA 2ADAA 1RALA 3V5CA 1IR2A 5JCLA 3SDOA 1N8WA 4KERA 3M47A 4CCZA 2W62A 5B7YA 4Q6JA 4U3AA 2PBOA 4D8ZA 1UA7A 3OQEA 1FFUC 4EP8C 2X0YA 4W4QA 4IG2B 4LAKA 3SCOA 1HJUA 4M29A 1S2WA 4PTNA 1J10A 1EHAA 4JFTA 3W76A 1FFRA 1K6WA 4LW7A 2ZE3A 1ICPA 4UWMA 4OBSA 1C9DA