4KEMA

Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
390
structure length
390
Chain Sequence
MRIVEIREQTAGIKSDIANAFIDFSQMTCSVVAVVTDVVRDGKPVIGYGFNSNGRYAAGGLLRERFIPRLMSAAPDSLLDETGENLDPFRIWTRLMTNEKPGGHGERSVAVGTIDMAVWDAVAKIAGVPLYRLLADRFRGGVADDGVWVYAAGGYYYPGKDVKALQDEMRSYRDRGYRVVKMKIGGAPLAEDLRRIDAVLEVVGSGDNLCVDANGRFDIDTAIAYGEALKPYGLFWYEEAGDPLDYALQAELAKHYDRPMATGENLFSHQDARNLIRHGGMRPDRDWLQFDCALSYGLVEYLRTLDMLKENGWSSRRVVPHGGHQMSLNIAAGLHLGGNESYPDVFKPFCGFADGIAVEDGRVRLPDLPGVGFEAKSELFATMSGLLGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
rcsb
source organism Azospirillum sp. b510
molecule tags Lyase
total genus 140
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kemA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kemA01
1KCZA 1JPMA 2AKZA 3R10A 3ES7A 3MKCA 3T6CA 2P8BA 4IP4A 3CT2A 2FKPA 4GISA 1JDFA 1IYXA 4K1WA 3ENLA 3PWGA 3HPFA 3QLDA 3R11A 3UJFA 3ZVHB 4GYPC 2OFJA 5EU9A 3SN4A 1NU5A 3DIPA 2PGWA 3RCYA 3TOYA 3OPSA 1RVKA 1TKKA 3SSZA 2DW7A 4JN7A 1L8PA 3I6TA 3Q45A 3RR1A 4A35A 4E6MA 1W6TA 1NELA 2GGJA 2OZ3A 2OQYA 3TJIA 2P3ZA 5FJPA 4FP1A 2OZTA 3GO2A 1DTNA 2OPJA 4H83A 3BJSA 4KPLA 3VC5A 3CB3A 3UJ2A 2RDXA 3DEQA 3OW1A 3TWAA 1EC7A 2XSXA 5FJOA 4DN1A 4HN8A 2QQ6A 3OZYA 3V5FA 1BQGA 3UCDA 4JN8A 3QN3A 3JW7A 3GY1A 1SJAA 2ZC8A 2OO6A 2PODA 2P88A 3I4KA 3QKEA 3T4WA 2PP1A 1JCTA 2OQHA 3U9IA 2PTWA 4J3ZA 3P0WA 3DG7A 3KUMA 4MGGA 3DFYA 4X2PA 4Z1YA 2GGGA 1EBHA 2ONEA 2OG9A 2O56A 4K2SA 3N6JA 1TE6A 3VFCA 3ZVHA 3MZNA 3OP2A 4HYRA 2AKMA 3THUA 4HCDA 4KWSA 4DX3A 1KD0A 3NO1A 3ES8A 3EKGA 2POZA 3RITA 3U4FA 4FI4A 4M0XA 3N6HA 4GMEA 4G8TA 5FJRA 3H7VA 2XH7A 2XH0A 3SJNA 3FJ4A 4IZGA 2OKTA 3P3BA 3FCPA 4KT2A 3TWBA 2I5QA 4HNCA 4MMWA 1MRAA 4Z17A 3R25A 3SN0A 2XH4A 2GGHA 3PFRA 1MDRA 3MSYA 3RGTA 3TQPA 4DXKA 2PA6A 3H70A 3TTEA 6ENLA 3UXKA 3FYYA 2GL5A 4H19A 3UXLA 2HNEA 2PTZA 1PDZA 2QJJA 3D46A 2QJMA 3H12A 1SJCA 1ELSA 5FJUA 3MY9A 1YEYA 3K1GA 1F9CA 5ENLA 3OTRA 3DG3A 1XPYA 2AL2A 1SJDA 2PP3A 3MWCA 2P8CA 4IP5A 2XGZA 3TJ4A 1R0MA 3FVDA 3FV9A 4GGHA 2ZADA 4HPNA 4GFIA 4GYPA 3VCNA 1MUCA 1TZZA 4ZCWA 2AL1A 3JZUA 3BSMA 1JPDX 4DYEA 3UJSA 1R6WA 3Q4DA 3P93A 4E5TA 4IT1A 2MNRA 1KKRA 2CHRA 2GGEA 2HXTA 3JVAA 3PK7A 3DDMA 3DERA 3SN1A 2AL2B 1P43A 3GC2A 3PWIA 4G7FA 1E9IA 3V4BA 4DHGA 2PMQA 4A3RA 2QJNA 3TCSA 2OX4A 1ECQA 2FYMA 2QVHA 1P48A 3DFHA 3ZLFA 3IJIA 1FHUA 2OZ8A 3RRAA 3CYJA 2GSHA 2GGIA 3SBFA 4IHCA 2PU1A 3D47A 3DG6A 4K8GA 3R1ZA 1XS2A 1KKOA 1EC9A 3CAWA 2NQLA 4F4RA 1SJBA 4JHMA 2PU0A 4E4FA 3ZVIA 1OEPA 3NXLA 4E8GA 3S47A 4IL2A 4HCHA 2MUCA 4KEMA 4ENLA 4EWJA 4IL0A 4H1ZA 2XH2A 5J04A 4H2HA 3ZLGA 1MDLA 3R0UA 2DW6A 3NZGA 1PDYA 2PS2A 4MKSA 3B97A 2PP0A 2PPGA 5IDZA 4HCLA 4ZA0A 2GDQA 3VDGA 3IJQA 3V5CA 4ROPA 3MUCA 2OVLA 4HNLA 7ENLA 4M6UA 2PGEA 3FXGA 4A6GA 3BOXA 2HXUA 1WUFA 3N4FA 2QDDA 3VA8A 3OZMA 3N4EA 1EC8A 2PTYA 3T9PA 5FJTA 2PTXA 3SQSA 3S5SA 3UJRA 4GIRA 1ONEA 2OLAA 5BOFA 5BOEA 3VC6A 3DGBA 3EEZA 3QTPA 3UCCA 4J1OA 2QDEA 4YWSA 3H8AA 3IJLA 2PCEA 3T8QA 4E4UA 1BKHA 3I6EA 3ZLHA 3RO6A 2P0IA 3VCCA 3IK4A 1EBGA 3V3WA 2HZGA 3QPEA 2PSNA 2QGYA 3GD6A 3R0KA 3DESA 3STPA 3UGVA 4DWDA 1MNSA 1FHVA 3UJEA 4GGBA 3TW9A 3CK5A 3MQTA 3NFUA 1WUEA 3CXOA
chains in the Genus database with same CATH superfamily
2VZUA 2Z1BA 4LEFA 2C0HA 5M2FX 1HN1A 1F3PA 5AHLA 5A3HA 1F07A 1YBQA 4IP4A 3TSMA 4D71A 1GZGA 4IPLA 3AUOA 3KLKA 1V08A 3FYOA 1W3IA 4PB5A 1NDWA 3HPFA 1KWGA 1E3XA 4XAFA 4IG2A 5JIPA 3QV9A 3NDOA 1UOZA 4N4QA 4AU0A 4J2MA 4C1NB 3KCLA 3WJYA 3RLVA 3QFEA 4LNCA 5DMYA 3LSBA 4JQ3A 1O12A 1JCNA 1RVKA 3EPMA 2QZRA 2C91A 1XM3A 1U5JA 1POKA 1WDSA 1YPFA 3EGJA 4XZIA 3K5XA 5CAHA 1WDWA 4PN2A 1MZRA 3L66A 1WAWA 2QEZA 1JL8A 4B90A 5CCZA 3FKKA 4DUVA 3RF9A 1PE1A 3DGHA 2EJAA 5C9UA 3O06A 1J8VA 4AZHA 4AIUA 1VR6A 4OE7A 3MCNA 4DELA 2A5HA 3HURA 1WXZA 1XDLA 2CESA 2E5BA 4GY7A 1XRSA 2G3IA 1Z69A 5BRPA 3U9IA 5D2VA 2WQPA 3H21A 3BV7A 3P74A 2XIJA 3DFYA 3G0SA 4Q8MA 3I65A 3B9DA 1HJWA 2CIPA 5DEZA 4K1GA 5A6JA 2ONEA 2OG9A 3KHJA 4AX7A 3W1XA 2POTA 2PAJA 3CAKA 2QS8A 3CXBA 4OBTA 4MVAA 1OB0A 2O0TA 2A2IA 2VVSA 3WN6A 3ARQA 1JD7A 1KM1A 2E8ZA 5KITA 3DAQA 4DX3A 3ZJ6A 4KFPA 3EKGA 3H23A 2CZFA 1GK8A 3C0JA 3GG8A 1OCNA 1KO0A 3WNOA 1NWRA 3SRFA 2NWSA 4JQ2A 4D6DA 3B8SA 3RJXA 2VFGA 2KX9A 4UFMA 1GEQA 1G5AA 1RV8A 1D7FA 2BGSA 3RU6A 5GVJA 1OHLA 1ZTVA 2ZZ2A 3ICJA 1NARA 1XDJA 1FWTA 1I8JA 3GU1A 4L9XA 4WSJA 6CGTA 4RE3A 1IQ8A 3KBNA 2A7NA 3PFRA 3W1TA 4HK5A 1CCWB 1Z8AA 4GXPA 5EL1A 4O1CA 1C8VA 4MPQA 2GK1B 5HPOA 5TNVA 2J27A 3W88A 4HU4A 4DXKA 3P60A 3MBFA 2E6YA 3KS5A 4UOJA 1XSJA 2DSVA 3QGAC 5HNUA 2EF9A 4EXBA 3QYSA 1DWIM 1DIDA 4O16A 4CUCA 4J57A 3LENA 3PM6A 3JZEA 4GC3A 1S46A 1QI3A 1SJCA 3QMSA 4PR4A 2OO0A 1PX3A 1JVNA 3LG3A 3WF3A 3VNZA 2F5ZA 4GUJA 4J3UA 4Y9PA 1R3SA 3DFQA 3DHUA 5HR6A 4DM2A 4FOKA 4JYEA 4GGHA 3MKKA 3LRMA 4EXQA 3W7PA 3NEHA 3RYSA 4BWLC 4HN4A 2PDBA 3UZYA 2WVTA 2DVTA 1FP9A 3CS2A 3TMLA 3RHGA 1G94A 3NZ1A 4PMNA 1FWIC 2RGMA 2Y62A 1HJQA 4GXWA 2HXTA 3ITXA 3HGOA 1ME9A 2EKGA 3CC1A 2P53A 3L4VA 2HVOA 1S5WA 2Z1KA 4AYGA 1ZBCA 1K8ZA 2A85A 3SCUA 1XDIA 1U1JA 1W54A 5K2ZA 1E9ZB 3G1XA 4NNAA 4DNAA 1HJSA 2VEPA 5FF0A 3C2FA 3IJ8A 4QQUA 4IJBA 4X0VA 1B3YA 3TH6A 2Y61A 3E74A 3C3UA 4HNUA 3E02A 4FLSA 4AISA 3WIJA 4E4PA 4J5NA 1PBGA 3LMZA 5BRQA 5DBUA 5LA1A 1V79A 3DBNA 4DO7A 1YW1A 2VMFA 5FS9A 3NS1B 1HT6A 3NQCA 1O66A 4O10A 3AOFA 4R34A 1RZMA 1GONA 2V3GA 4JHMA 4TQTA 1EGVA 3DHFA 3BG9A 3THDA 1DJNA 4IMGA 2CBJA 1ENUA 2ZZ0A 3WD1A 4RE4A 3KLLA 1JUEA 4DUOA 1YE6A 4B5UA 5DXXA 3PVFA 2NQHA 4H2HA 3LCHA 3T1GA 3VUPA 4MYXA 1Q5MA 3KDNA 4HOZA 2YL9A 4W4QA 4L1GA 5D4YA 3W1NA 4AZBA 3WLMA 3AYVA 2A6LA 2D20A 1UP0A 3GKFA 3M44A 3N34A 1FEAA 4ZA0A 3PPCA 4ML4A 1SB3B 1PCWA 1R38A 2X8HA 4M7SA 3CHDA 3SCTA 1G9HA 1LOQA 4RE2A 3CIVA 4D6CA 2XFYA 4LEQA 4AWSA 1UJQA 4Q4OA 2C3ZA 1UD5A 3GZAA 3AROA 2OEMA 4LBUA 1C7SA 3CZEA 3FA5A 3FA3A 5C6MA 4GNJA 3QTPA 3AJ7A 4MWAE 4W5ZA 4NJJA 4JY9A 4HOWA 2IKHA 4WKAA 2VEMA 3AALA 3F4NA 4GUFA 3GYCA 4ZFCA 2PSNA 3R0KA 3UGVA 2XFFA 4JTIA 1X8FA 4PA8A 1D8CA 5FI8A 1TTJA 5AOUA 5LZLA 3WJXA 4Q8VA 2IPJA 2YR1A 1GERA 1XLDA 2UY5A 1VKFA 1UASA 3T6CA 1E71M 2XIOA 3G2GA 2ABAA 2NV9A 3F4VA 2WCGA 1I60A 2FKPA 2V2DA 1OG0A 2DVUA 5FJIA 1GTEA 2ZDRA 1OFRA 3EBVA 4JIQA 1E9LA 1M6JA 2QR6A 4EVZA 3VIHA 3WLQA 3GD4A 3AHZA 1RD5A 2DT1A 4KCTA 2QDHA 2ZX7A 1QHPA 4DBEA 3BARA 4DAIA 2VWSA 1SFLA 3WUBA 1EL3A 3RU8X 3ITCA 3DJGX 3THCA 4Y7EA 1UUOA 1XWYA 3FJ6A 4CNTA 2J74A 4LUYA 5HXMA 1BZLA 3GDKA 3ZYZA 3WLPA 4ZTXA 1YKWA 1X2HA 1A5AA 2YKKA 4LUSA 2O4QA 1H63A 3HV8A 3BCDA 3QC3A 2VOTA 5KSWA 3QF0A 1NH6A 3II1A 1EC7A 2XSXA 1XLFA 3PR2A 4N6FA 4XTDA 2I7GA 2V8ZA 2IXVA 1HX0A 3UCDA 1J93A 3P61A 2FZMA 3AIRA 3NDYA 1X7FA 2P88A 3CV7A 2I16A 4RXGA 2UWFA 3UWZA 1U33A 1SSDA 1VENA 4IUOA 4FAMA 1XLGA 2J3NA 4GO8A 4CNSA 1I75A 4ZOEA 3RXZA 5F2IA 4KKXA 1OJXA 3WLRA 2C1GA 1XQLA 2YYTA 3DYMA 1O5RA 5GJNA 3M0HA 5EY5A 1F61A 3BLLA 1XLIA 4EP8C 1P6WA 3OLGA 5BWAA 4C6QA 2GJRA 3URBA 2GVJA 4G9PA 3UFYA 3FA4A 2DIKA 1J0IA 1KRAC 4YVXA 1UKPA 3U4FA 1O1HA 8XIMA 1G67A 1HJVA 4UZUA 3QV6A 1TPDA 4Q4MA 4KETA 6ALDA 2RDTA 4WSHA 3H4WA 4Z0JA 1PAMA 3VMPA 2YFNA 1VHCA 1P0NA 4RDVA 1TWDA 4LANA 4OECA 4QLJA 4H8VA 3P3BA 3EMQA 5CC3A 4L6HA 1EJRC 3WKZA 4EPKA 1YPIA 4AY7A 4QCEA 2QHAA 3APGA 3II4A 5TF0A 3S1VA 1H41A 2XH4A 1T3QC 2R24A 5HMDA 1UC4A 1XBXA 3DK4A 3SCNA 3W7CA 3TQPA 3ARTA 4CNNA 5E9XA 3Q94A 2YDRA 2RABA 3UWUA 4HZ7A 3CUHA 3FYYA 4HPGA 1TQJA 5A69A 5BMWA 2CC0A 5A8NA 4N9CA 1I2QA 1EOMA 1GVSA 1W9VA 3R6IA 1V7AA 4U3CA 2W66A 1TV7A 1TV5A 3BZJA 2INFA 4ZQNA 2PCQA 4JTUA 3GNXA 2NQ9A 5ENLA 1L2QA 3OTRA 1JI1A 4GBDA 2WJEA 5CLWA 3EDEA 4HA4A 2P76A 2QMJA 3FLUA 4ZQPA 2OSWA 1GW1A 1DQWA 1QNRA 2RJHA 1HGYA 4HYWA 2E6AA 4UCGA 2NX9A 4O8AA 3UESA 2VVNA 3CEUA 4QRNA 2VFIA 2QUMA 3WMBA 3PUDA 4HPHA 1AA1B 4YIWA 2VUNA 4RW3A 3NPXA 3PJWA 4DJDA 3DGZA 3W1RA 4TU1A 4V1YA 2DV0A 3VOCA 2V5DA 1B3OA 3AICA 5CBBA 5FAJA 1M1BA 2QIWA 5LKYA 1UA3A 4KRTA 5CSRA 2V2HA 3GC2A 4ADWA 1BEUA 1G4EA 1S1RA 4HD5A 2YFOA 3WNPA 1OIFA 1H49A 3ZWTA 4JTLA 1XLHA 4ZENA 2Z1WA 1ECQA 3H26A 5AZ0A 3S8HA 5K9CA 1AJ2A 3GXTA 4RNIA 3DFHA 4US5A 2OZ8A 1NTHA 3EWZA 1FWDC 3CHVA 1BAGA 1LCOA 4IHCA 3GR7A 4HVXA 1TPVA 4WIWA 3XISA 1PXGA 1XINA 2NSOA 3UCQA 1QTWA 2PDUA 4EE9A 1ECEA 4UOQA 1W5QA 4DF0A 4P7NA 3LCLA 1TYGA 5IBXC 1FFVC 3EANA 3A21A 1ZENA 2ZRZA 3VO0A 3S1WA 2J8GA 3HMCA 4O1AA 1N2VA 2DIEA 5H2ZA 4BA0A 4LH8A 5ER0A 1H50A 3ZVIA 4RLIA 4MUPA 3UVIA 2VL4A 1SZGA 2JGYA 4IL2A 3IAPA 3NOYA 4HCHA 1S5TA 2CW6A 3CZGA 4IGMA 3TR9A 3N11A 3ZLGA 1W5NA 2CHNA 2IPGA 3TCEA 3H54A 2OZ0A 4X9SA 4N4PA 5FACA 3NZGA 4CVUA 4UNLA 2BB0A 3VKDA 1BWLA 1EQCA 4XIAA 2Z28A 1J96A 1RQHA 1TPC1 2RJGA 4A2SA 3QHOA 4W8LA 2Y7GA 2X1IA 1OVDA 5D32A 2CLFA 4HNLA 1ZAJA 2JGQA 2VRKA 4PMXA 2W3RA 1NY1A 4NX0A 3ZWSA 3OZMA 3N4EA 3UPMA 1Z9AA 2EQDA 4Z0SA 1U2YA 3T9PA 5D2WA 3M07A 3CQ0A 3OODA 4KH2A 5JBEA 1NDZA 2W9MA 4DO4A 3A47A 4LC6A 5AYBA 5EMMA 2KZHA 1UD3A 4JFSA 4NG3A 1Q6DA 2FH6A 3SJ3A 5KEZA 1GZJA 3C0LA 2B7QA 4NZ4A 1U5VA 2GUYA 5DRIA 1S2CA 3L7RA 4B9YA 1QXLA 1MRQA 1TMQA 2WPBA 1ITQA 5G2IA 1NVMA 5HANA 6TIMA 1Z7AA 5F2LA 3LLXA 3KHDA 1WB0A 3UJEA 2XFRA 3G1YA 1PYMA 3QSTA 3NSXA 3KBWA 3R10A 2A0NA 1FWRA 4TUFA 2P8BA 3BOLA 4M6QA 1WKYA 3F1QA 4B5VA 1HVQA 4PTVA 4DI9A 3GIYA 3KOYA 4K1WA 5C55A 1YDNA 3WDPP 3G0XA 1B31A 3N2XA 1ZJIA 1W5OA 3FHAA 2BSLA 1PYFA 4DXVA 3U0HA 5HINA 4U3AA 1KM0A 2CZDA 4B15A 1XUZA 2G5WA 1XIGA 2WMJA 3ALGA 1OGBA 3WLTA 2FPVA 3WQ8A 4P7LA 1OCQA 2PURA 4QM1A 5AHIA 1GG0A 4BJHA 5G2WA 2OZ3A 1DJZA 1ZRQA 3SZ8A 1AG1O 3IUHA 4JIHA 1DTNA 1B4EA 1VZWA 3TNBA 1TV2A 4ZSUA 4BI6A 3LYEA 2WC4A 3E2VA 3LB8A 4IPPA 3S4TA 3EAUA 2V38A 4CLMA 4FO4A 4YTRA 3PAOA 3CHFA 5FL0A 3T0CA 1J0JA 2QQ6A 1V0LA 1YNYA 5SWUA 3NIYA 4PUJA 3DFNA 4UTWA 3A64A 3H7UA 3LLFA 1MOKA 4QJ1A 3VDBA 4DBSA 4P5UA 1FFRA 3OVQA 2O7SA 1OK4A 4DJEA 4QDMA 4KW2A 1QPQA 4CNOA 4AWUA 5D09A 2ZZ5A 1PX4A 2WBAA 3WL1A 4DIAA 1XI3A 4Z1BA 2HRWA 4DUWA 1QK0A 3TZFA 2F8QA 4C90A 5CBIA 4LA1A 5HNNA 3WG6A 3AXKA 1Q7ZA 3C5QA 1TO3A 3F5JA 4KESA 1ISVA 1DIKA 1B90A 1SZEA 3O0FA 1ISZA 2ZXDA 9RUBA 2VR4A 3RITA 2IKGA 1JCXA 1FWGC 4KBXA 4W85A 2X0SA 3W72A 1E1CB 2XJ7A 1B1YA 4RPPA 4DI8A 2J88A 4Q7NA 3HQNA 5L6UA 4H4PA 2J47A 4FALA 3KS6A 4JHZA 1XD1A 1Z32X 2WZTA 3VDHA 1OADA 2FZ9A 1E51A 4F8XA 2D23A 5I7GA 1R47A 3UETA 2Z25A 3I4EA 5E6ZA 3SN0A 1JCMP 4YCOA 4HQVA 3G24A 3WMLA 2YZ5A 2NV1A 3CZJA 1LP6A 1VEPA 3ZR6A 4HU0A 2QCMA 1DEDA 4JX6A 3RGTA 5LIXX 2HK0A 1YPXA 3VVGA 4AC7C 4O13A 3B0YA 3HG3A 3L5MA 4BFAA 3M0XA 2YZRA 1XQKA 1ME8A 2GUBA 5KMYA 2DJXA 4NVTA 4XD3A 1TVNA 4PBFA 5C7HA 9XIMA 3UQNA 2C7FA 1U5HA 3PZGA 1K1DA 4CCZA 5AHEA 5PTDA 3ID7A 2BC1A 1R2TA 4PUWA 5E9AA 2X40A 1TPUA 4POCA 3D3FA 2C13A 3DHPA 1TJPA 1IIHA 4S3DA 4LF1A 4S3KA 1UKOA 3WCZA 1SJDA 1B3WA 3VIOA 1DJYA 4UMCA 5DN1A 4WR3A 2DUZA 2WB5A 3A3XA 4KCVA 5DF0A 3M7SA 1FH8A 2C6QA 4Y9AA 2E1DA 3GXNA 2VKZG 4XQ6A 1HL2A 2PWEA 3G8EA 2AL1A 1F8MA 4XV0A 1AQFA 2E5CA 4HA0A 4C5ZA 3MO7A 2J9XA 1OFAA 4KFNA 2DH3A 3WQ6A 3TJLA 1VEOA 3A24A 2OKOA 3CASA 2QT3A 2G4FA 2JIWA 4X22A 3QW4B 1VBJA 2G4JA 1P43A 4RZ4A 3Q65A 3ARWA 3V4BA 5JBFA 4GJ1A 1QK2A 1VP5A 2X42A 1JAKA 1FFUC 1UR4A 4RCXA 4DPQA 4IGNA 1H7PA 3B04A 3BSHA 3MMWA 1W5MA 5D30A 1MEHA 3EX4A 2VFDA 4QQ3A 4IISA 3I3BA 5TAOA 2E6DA 1B2YA 1UWAA 3USBA 3FEMA 4GPNA 3TLQA 3E0FA 2C79A 4F0MA 4N2YA 1Y0EA 4RDZA 1FWAC 7REQA 1WOAA 3COTA 4IMCA 1UR8A 3VAVA 2YBVA 5FF4A 3NJ3A 4H4IA 4D8LA 1UBSA 1R3QA 1EC9A 4ML9A 4AXNA 1TIWA 3CV2A 1H7XA 2A8XA 3ZT6A 1KFBA 2OGYA 3L67A 1RPXA 3QR0A 3RNMA 2WPGA 3TYCA 4TX6A 3KL5A 3HN3A 2G3JA 4EM3A 1RH9A 4R88A 3FJNA 3SW6A 3GQYA 3S9IA 1JRPA 1Y8BA 1PWMA 4PMJA 2PS2A 7TIMA 4Q4PA 4XBKA 1E1FA 2PWDA 3AU2A 3LZ5A 2WO5A 4OJYA 1GYNA 2IS7A 2YW4A 2ISDA 3RPDA 3DFPA 5MKGB 1HL9A 3OGVA 2A21A 5AHFA 1T40A 2B7OA 4MAZA 4XG1A 1ME7A 2XVNA 3FXGA 3PBVA 2Z29A 1GVOA 2CCRA 2BV9A 4AIBA 4FXRA 3FG2P 3WEOA 4KRZA 2NLIA 1EJWC 3E0IA 1GZ1A 3MSRA 3VC6A 2HPMA 4C1KA 3AYRA 4O1FA 2GYIA 2GQWA 2DSUA 3O2LA 3CAQA 4JKMA 4IMFA 3TMQA 3QQ0A 1TREA 2VHLA 3ABXA 3V3WA 4NYUA 2Y7DA 3VMOA 1UIPA 2ZXAA 2G3NA 2NVCA 3S1GA 1EJXC 5E93A 4A29A 1XYCA 4LV4A 3EX3A 1FHVA 3UBPC 3UY8A 3W2NA 4UQ9A 3MQTA 2WHKA 1TCMA 4DZ5A 2VC9A 4WJXA 1JPMA 4MJ4A 1EXPA 3UXAA 3TDFA 3N04A 4FX8A 2OLHA 2HEJA 4NIRA 4B5XA 1I0BA 1CENA 2VWTA 3WJSA 1RK5A 3T05A 3RLUA 2X1TA 4FB7A 2WSQA 4ZO9A 3L5LA 3H4GA 4G2DA 1QWGA 3UNTA 4PRWA 3UJFA 2V3FA 3WMSA 1NWUA 4FR1A 1S2VA 1KM6A 2MANA 1WE5A 2PGWA 4KQNA 1TZ9A 3RCYA 3TW7A 4O28A 3B9OA 3VKCA 1N62C 3AMLA 2ZFAA 2OT1A 1SFJA 3EPOA 2B31A 3CLMA 4XZ9A 1EJVC 1MO9A 2DZVA 4XZWA 1X1ZA 4AUBA 4AQLA 2GGJA 2OQYA 3HTWA 3KVJA 2O9PA 3MUAA 2DSWA 1WXYA 2OZTA 4AX6A 4UMAA 3OBEA 3MC5A 1L6WA 5CPNA 3CB3A 3FS2A 2YJQA 1E1EA 4LIIA 1AOGA 4ES4A 4ZO8A 3M0LA 3ARVA 2VX5A 2PLCA 3WQGA 2F9RA 2Y8KA 1N60C 3CEPA 3GIPA 2YIHA 3O8AA 4M51A 3AUJA 1A4MA 4KWOA 1N8FA 4H7ZA 3QKEA 1HVXA 1W9XA 3T0BA 5AB3A 3T4WA 5I3HA 3SY1A 1L6FA 1PB0A 1QUMA 4H9XA 1EX5A 4C65A 4WJEA 4MDOA 3C4UA 1LL7A 3LXAA 3V75A 1HO4A 1X7IA 2EGZA 5AC8A 5D2XA 3KZSA 3QY7A 3AMZA 4YYFA 1EBHA 3M0IA 3KOFA 3R0DA 4I9AA 1P0EA 1AW2A 3L4YA 1UCWA 1F6YA 3VTRA 3LN3A 1GJUA 5A8PA 1HKWA 1LBFA 3KL0A 4LYRA 1JCYA 3TN4A 5EMLA 2A7RA 1E6NA 1BGGA 4ZE5A 2DVXA 2VGBA 2ZCGA 2R1LA 4JTDA 2YAUA 3ZXWA 1ZS2A 3OYZA 3TYZA 2VD9A 1XSKA 1DQXA 4O14A 4WY0A 5E09A 1C9WA 3OG3A 3AIVA 1X6UA 4OVXA 1XIDA 3N25A 1GT8A 3NYDA 4GY1A 3U2CA 5D9NA 2YDQA 2X99A 1LVLA 3TU9A 5I2UA 1CTNA 3QBUA 3ZS4A 1C92A 2P0OA 4JYFA 1VBRA 1DJGA 3W28A 4F9JA 2I5IA 1IEQA 1VYPX 3FX4A 4O19A 1IR2A 3FN9A 5EMJA 2J79A 3M6YA 4B9ZA 1SSGA 1ODZA 5H8PA 2QJJA 3H4XA 1DYSA 3L0GA 4LCRA 2GR3A 1CXFA 3GUGA 1YEYA 3K1GA 3N15A 4GD0A 2JKPA 1XD0A 4X61A 2CPUA 4TVYA 2BS9A 3TFCA 1OZMA 1CLKA 4HSNA 1TCDA 1V59A 2NUYA 2OEJA 1K02A 4GFIA 2ZQ0A 3H24A 3JRKA 1E1CA 4ZOAA 3GSMA 2OYMA 1S2WA 5IRPA 1XRTA 5AC4A 1F3WA 4QISA 4NYYA 3CL6A 4QJ5B 5B7ZA 2H8ZA 3MA8A 4W7UA 3SFWA 3UR8A 2ZXQA 3H2FA 2Q02A 2CHRA 3M4HA 3RIKA 1HUVA 4K37A 4QLKA 3MU7A 3TE9A 1BVWA 1EDTA 3DENA 3PWIA 4EPEC 4W84A 5G5IA 4GQRA 4NHVA 3P7YA 3GVWA 5G4WA 1FH9A 1Z44A 3K8LA 3RPMA 3BTNA 3U8GA 3NZRA 3WNLA 2E40A 2HVMA 1JQVA 2XN1A 4PUUA 1GRTA 1CGYA 3QR3A 2R1PA 3QPYA 1FHUA 2GSHA 1ZDLA 4O12A 4PMOA 2VEFA 3LCIA 4LS2A 4ZQCA 7TAAA 1TTIA 4UUIA 4ONVA 1JIBA 1V0MA 4PL1A 5EB8A 3W4RA 1LL6A 2C14A 1TZ7A 3QR1A 5FMHA 2ZE3A 4V27A 2XSBA 3BLOA 3W74A 2NUXA 3S6DA 3P8IA 2VC7A 3O0KA 1BXCA 2Y5EA 4CQ9A 4LTSA 1IHIA 2Q01A 5DANA 4ZTYA 1E4LA 1TTPA 3P6LA 2NXGA 2J7CA 4J7RA 1EZ2A 1L2UA 5AKQA 1KXHA 1HNYA 1T99A 4ZODA 3GTFA 4MKSA 1J5SA 1CT5A 5HQLA 1O1ZA 1TIMA 2PGFA 5K3VA 4RDYA 1RP8A 2R1MA 4LYKA 3OEXA 1XIJA 3V5CA 1NPXA 3QXBA 3UWYA 4PBEA 1QNOA 1R30A 1RPKA 1W9PA 2P10A 1BG9A 4JEJA 3N3MA 4OHQA 1SQ7A 4X63A 2YA1A 3UZ5A 2P50A 5TBOA 1VLIA 3VIPA 2H8XA 1VAHA 4W9TA 1RBOB 1T8XA 1ZK7A 3GFYA 4M5PA 2HROA 1PO9A 1WKDA 5B80A 1W1YA 2BOEX 1OC6A 1EWDA 1P0BA 1IGSA 3RO6A 1IEXA 4NL1A 3ARSA 2HZGA 1LWJA 1TV3A 2A79A 1BVZA 1HL8A 2EQ7A 2EO7A 4DWSD 4W89A 3BK0A 2FGLA 3SQMA 1GGOA 3EMZA 1JGIA 1XH2A 4AVOA 2HBXA 2B4GA 4L4LA 4JX4A 4UNKA 3NTYA 2C3CA 1SR9A 1EWEA 5A6LA 3U7VA 4NILA 1LRNA 1AZ2A 1AVAA 2VJXA 4OKDA 4UFKA 1BPLB 4AHOA 4LY8A 4DQWA 5MKGA 3S6TA 4MY1A 4MB3A 4ORIA 1PVNA 5JXQA 1TMHA 2Y88A 4GQGA 1DVJA 1TQXA 3LU2A 3SR7A 1H0IA 1ONRA 2DUAA 2OCZA 1S2AA 4M3PA 4BK9A 1VQZA 3HG4A 1XICA 3WLLA 4UFIA 6A3HA 1L0PA 3EMCA 2CEQA 4K36A 4B3LA 1H7WA 2FZ8A 1WOBA 3W7NA 1AD1A 1ZJHA 1TKKA 4H4VA 2CLEA 2W79A 4JEQA 3G3DA 2GH5A 4K7VA 3OZOA 1OYAA 2Y1HA 1VHNA 2UV8G 3SAZA 1LUCB 4GQBA 2ALRA 1JDEA 2FTWA 3M1ZA 3ITLA 2E7FA 2YCEA 1OCJA 2WWCA 1D7YA 4AC1X 2A3AA 2OT0A 3NSNA 3PPFA 4ERIA 4O54A 2BXZA 3O3RA 2VEKA 3E2QA 1SJAA 1EO7A 3U5UA 5AHMA 1SW7A 1YDOA 5C71A 1LQ0A 3WLNA 1KCLA 3VOIA 5LGZA 1WYGA 1Z3NA 4EK7A 5DMNA 1VPQA 5G4HC 2PTWA 3T8LA 2ZA3A 3M9YA 3TXVA 3SUVA 3NUKA 1B3XA 4RZ5A 1LF1A 2C18A 2QPUA 3NL5A 3DI0A 4UR8A 1EJSC 4AB4A 3NPUA 1MMFA 4H7CA 5EYWA 1DV7A 1CBGA 2PRHA 2CERA 4HYRA 2RHGA 2JKAA 3THUA 4XB3A 1Z6KA 3MSGA 4V15A 2WBGA 1EP2A 4GIYA 4FI4A 4LB4A 3UPBA 1ZP3A 2EG7A 3D9XA 3E2SA 2DJLA 3RM8A 3V7PA 3HMJG 1ZU8A 1NP0A 3CMGA 2I56A 1U22A 5LA2A 4Q4RA 3SJNA 3SM0A 1F3XA 3VZZA 8XIAA 3GRTA 2EPKX 4PUKA 4JS3A 4Z08A 5EGRA 4UTJA 1MRAA 3PULA 4HHMA 3R25A 2WHLA 3BW3A 1XC6A 1EFZA 4HB7A 5M5DA 4IIFA 3GR4A 4UXDA 1WAUA 3EA3A 2PTZA 3RN6A 3TTQA 4DBDA 1R5YA 3B4UA 4XZBA 1QDSA 1TPWA 5J8LA 2Y8UA 2W54A 4PCPA 4UTMA 3IWPA 1IR1A 1NHSA 1BXNA 4ZB0A 3FIGA 4F3HA 3CHCA 1R3YA 3PZOA 3UVAA 1NP2A 3UG8A 1XYLA 5FEXA 3RR4A 4UTTA 4PUMA 5JIWA 3BSGA 1Q3NA 1Q6EA 3VD7A 4OV4A 4ATWA 3GE7A 3BSMA 1VFTA 2PD9A 2ZZCA 1R6WA 4CQ8A 4H6QA 4L56A 2WJFA 1YYAA 1KQZA 1KM2A 1KNWA 1W56A 4N9EA 3DDMA 3B8UA 1GOXA 4MDPA 1KXTA 2ANUA 2IQDA 1ALDA 4H4SA 1RSCA 2BVYA 4Y8EA 3CWHA 3ABRA 4ZFMA 2FIQA 3F03K 3UZJA 3GS6A 2HS6A 1TUFA 1GQIA 1MYRA 1KR0A 5AYXA 1TYPA 3TCSA 2X2YA 1VIZA 3RRXA 2FB2A 1P48A 2ISWA 4DJFC 4NZ3A 1G6CA 1TUXA 1T6MA 4PUEA 4XD4A 3FGCA 3WLSA 5EFFA 4BEQA 3MP4A 1H1NA 2GUUA 3FKRA 4J4KA 1A5SA 4J2PA 4ZSTA 3DG6A 3LERA 2V81A 3IJ6A 1XYBA 4FA3A 1VH7A 5BXRA 3WELA 4C6FA 4GZ7A 1BGAA 3DYOA 1G7VA 4WQ6A 5HQEA 3TA9A 3B9JB 4WF7A 1CGXA 3BV4A 1FFQA 5AECA 3O15A 2PRLA 1J2WA 1C8QA 1V3MA 3W2MA 2DZSA 3G1VA 4RL3A 2VGFA 1K9FA 2WC7A 3KX6A 2C1HA 2MUCA 2WHJA 6XIMA 3EOUA 3IUIA 4U5KA 1EO5A 2PF0A 2PDNA 3STGA 4DPPA 1AH0A 4ZQMA 4AD2A 4WHBA 2J8TA 1PS9A 1D2KA 4DAFA 1FOBA 4YVVA 3IEBA 4PE8A 2PF8A 3LI1A 3NDZA 3A9BA 4DYJA 1ZPTA 1AZ1A 2E0PA 2TODA 3UWQA 3VDGA 1E5JA 5LA0A 4AVNA 4LUTB 4ROPA 1FDYA 4A4AA 4LPCA 2PDQA 2QW5A 4XVDA 2W91A 1WA3A 1PKMA 4GRSA 1Q4NX 4M19A 3R12A 1HKKA 4GKLA 5FEWA 3IGUA 4KMQA 2EKCA 2V63A 4O50A 3UCCA 4Z2IA 4ALDA 4F2BA 2PCEA 3SCVA 5D9MA 4Q4QA 5CPTA 2WVVB 3LK6A 3EX2A 1OGGA 1GPFA 2W0UA 1I1XA 1VQTA 1IXOA 3N9SA 4GKTA 4JTSA 3OHMB 1UKQA 4TTGA 3ORWA 4PYSA 1JCJA 1TJ1A 2E9MA 2ATSA 4S3BA 5E0FA 1KLYA 1I9CB 4BY3A 1AH4A 3CK5A 4YTUA 3LCXA 4IUGA 4C1LA 2ZUUA 2ZUSA 1RALA 4H9TA 1Y5XA 2W3SA 3TUUA 5FKYA 1W91A 1XIIA 4PBGA 5XIMA 4HYVA 3TQ0A 1OD0A 2VFFA 2EQ6A 4GFSA 2IPFA 1KBBA 4P8WA 4FX7A 3NAVA 3O07A 1XGEA 2WKJA 1ZMDA 1NU5A 1K8CA 5CG7A 1R87A 1QNSA 4KFOA 3P5YA 3RLGA 1KRBC 1XIFA 1HG3A 3LPPA 3Q2DA 3VINA 1L8PA 3VUSA 4NAFA 2GSEA 4ZEPA 4Q33A 3NQDA 3JUGA 3H4KA 1NELA 1R3WA 2P3ZA 3IARA 3T08A 1XLEA 1G4PA 3AIWA 4HZ6A 3B0XA 2EXOA 3TN6A 4RZ6A 2OPJA 1BYCA 1GW9A 4P7RA 3DEQA 3LGEA 3RX3A 4F2UA 3AHXA 1GORA 5GPRA 2VRJA 3DOPA 3RILA 1GOQA 5F7UA 2DDXA 1BQGA 3HJEA 3KTXA 4GE8A 4G1NA 2FVKA 5HJLA 4K38A 2OEKA 4IX0A 1N5WC 3VZXA 2ZC8A 3KWSA 3INPA 3KVMA 3IS4A 4RNFA 3P8JA 3M5YA 2WJDA 1UD8A 4O17A 3EA1A 4PCNA 2QAEA 4QFUA 3A22A 4HSOA 1LQAA 2E3ZA 3ZO9A 2J7DA 3C3NA 3URQA 3TEVA 4MGGA 2DORA 1DIEA 3N6QA 4O11A 4FNQA 1WZLA 1FX6A 1UWQA 4PEKA 1OJTA 2O56A 4DUXA 3FEQA 1KFWA 1V3LA 3W7EA 3CQJA 5EA9A 4HHLA 4KWVA 3OGRA 1ZY9A 3B8VA 1O68A 4KWSA 3NO1A 3EPNA 3OBKA 2YSWA 5BROA 1EJTC 4REQB 4W7VA 2C15A 1STZA 1KR1A 3KFTA 3WH6A 4S3GA 1H60A 3QW3A 1VCGA 3A9IA 4OOUA 4EKJA 2QUNA 2W6RA 3WH8A 4C6MA 4GRTA 2XGBA 4Q4SA 2YDAA 3ELFA 3PTDA 3VE7A 2FMOA 2BODX 1LUCA 3MBDA 1TV4A 2QYGA 2XH0A 3HGJA 1H2IA 5I24A 1PPIA 3CTTA 1JRCA 4NJIA 1UR2A 4JIIX 1ZAIA 1QW9A 2NQZA 4Z17A 3CUXA 3BC9A 3FHQA 3GG0A 3MSYA 3S2LA 4FMVA 1XANA 1CIUA 3RUBL 3DFSA 5CZKA 2DT0A 2WXDM 1GKRA 1H5VA 4LQ1A 4I90A 3EF6A 2CXEA 2WSKA 4U31A 1QNPA 1UR1A 3NQMA 2OSYA 3PTMA 4XIMA 5JCKA 4N6EA 1BLIA 3LSCA 5U7SA 2VXNA 3TN5A 3MUY1 3MY9A 5JCNA 4X2RA 2CDUA 4X60A 2ZRWA 3LHWA 4O0QA 2D73A 1GYLA 2P8CA 4IP5A 3SRDA 1QCWA 5CPSA 2JK6A 3C2OA 3FV9A 4NUWA 4WLCA 4K8DA 1NDVA 4EOUA 3UA4A 1W3KA 1KGXA 2HVNA 3QOKA 1UZHA 2VC6A 3M0VA 3R5EA 4WGXA 2GR2A 2PDXA 2IQ0A 5CZJA 5E0CA 4JPGA 3OLDA 5EBAA 3GD3A 1XP3A 3FXYA 1BYDA 2ZZBA 2B0MA 3WQVA 2JALA 1VYSX 4Z2JA 4HPJA 5I03A 1Z89A 3W23A 2RUSA 1E6QM 4PMDA 2YLAA 2WNNA 1M7XA 4K8HA 2Z4GA 1OQFA 1XSIA 2BXYA 5F2GA 1M04A 2XISA 4QIUA 1OD8A 1RVGA 1JYWA 1FDZA 1B0IA 3BG3A 1NFBA 1AUSL 2WMHA 1Q13A 2G50A 1RLCL 3O6YX 1S2TA 3CWOX 1TX2A 2C19A 1C93A 4K8GA 3FVMA 3EDDA 2V82A 2BDQA 2QCLA 4UWMA 3EDKA 3ALFA 3P67A 4F0KA 1QBBA 3F4DA 1I4NA 3SEPA 1ZY8A 2GLKA 5BZAA 3POHA 5ABFA 2OJPA 3TYDA 1AL7A 3IJDA 1F4HA 1KGWA 3UYCA 4AG0A 3TLLA 1P6BA 3EB4A 4HP5A 3R0UA 4QTGA 4TOQA 4QS6A 3UP8A 1T96A 4Q32A 5KZMA 3PSVA 1ZL1A 1JGMA 4Q8OA 3WMCA 1TR1A 2J77A 4C6OA 4OV9A 1R2SA 1Q45A 3WH9A 4R7JA 1QASA 4UR9A 4AD4A 2VD8A 4WJ8A 2AMGA 4L4PA 2I9UA 3EOOA 4PZVA 2PTYA 1OX4B 2Z7KA 4GH1A 5GNZA 1NOUA 1MFUA 5H8MA 2JFEX 1DXLA 4URIA 2XINA 3UNDA 5JMUA 1JDCA 2EG6A 4JKLA 4A2RA 1RLDA 3LV6A 1E56A 2Q6ZA 1KRMA 1OM0A 3T42A 2FDSA 4I3GA 4IOTA 3I10A 3CZKA 3MMDA 1JUKA 1MNZA 1S2UA 3QOMA 1R2RA 4WXZA 3WEZA 1FTXA 2QUVA 3IK2A 4HU3A 4TXEA 5FL1A 4IFKB 1NQ6A 1DOSA 5G1MA 5CJ5A 1X98A 1GQNA 1MNSA 4HBKA 4C6DA 3I7SA 4JTGA 1DPMA 2J9YA 4MZYA 4PRRA 1KQYA 4U4MA 4PGLA 4GI6A 3BMVA 1W9BM 3CLWA 4LOCA 2F2HA 3ES7A 4M6PA 3AQUA 1P4CA 1UMLA 2V0TA 1GQJA 2FPYA 4MF4A 3AS0A 4BWLA 3BLDA 2IPWA 4KWUA 4UTWC 4MNJA 3FJLA 1FXQA 3M7WA 3Q37A 3LRKA 5TIMA 1FRBA 2VEIA 3WDHA 3VU2A 4LAKA 5HUOA 4S3AA 4GJJA 1F76A 3E6EA 2YVFA 4GBUA 3LTSA 3BCFA 3EWCA 3IUDA 3LOTA 4DLFA 4M56A 1DORA 4JL2A 1LLOA 3HG2A 4DO6A 4FR6A 3W01A 2HPIA 1FO4A 3NQ6A 3ECQA 3TJIA 2NX1A 1XPGA 1MXGA 2V5KA 1XIBA 5CAKA 1QW7A 2WVVA 3BLEA 4EM4A 4JTJA 2OU4A 3UJ2A 1WBHA 2EJ1A 1IWPA 1XHGA 3W7IA 5T26A 4ERAA 4AIEA 3FDKA 1KFEA 4U2YA 3EWWA 3WL0A 4JN8A 2DY3A 3TAOA 2V3EA 5CBJA 3R79A 3S9ZA 1I1WA 2ZVIA 3I4KA 4E2VA 1JFHA 4ZB5A 2ZUWA 1OG6A 1V0KA 3KLJA 1GOKA 2BHYA 2XVLA 3CGCA 1OF6A 1XF0A 3KUMA 1MVYA 2H3BA 1FWJC 2V69A 4DF2A 2X2GA 3S1XA 1A0EA 1CPUA 5AYYA 1UR9A 1SZFA 1WCGA 3ITGA 4Y9NA 1MUWA 2XDFA 5HNRA 3E2RA 5JVLA 4AZ7A 3GDMA 1WZAA 1CGTA 4ATDA 2FFCA 2XN2A 4L1XA 3SURA 1GJPA 1BWCA 4HGXA 3W7OA 4QX4A 3ATZA 4J28A 3LCFA 3L4ZA 2J7FA 5FSEC 1VBUA 2WQDA 3H22A 4JTQA 3W1QA 2C1IA 3GR8A 4KGLA 4MWAC 3L2LA 4ZOBA 4GR1A 4EMJA 1AQHA 4R5EA 4PMVA 1SZRA 2OKTA 3QGVA 4BZYA 1H62A 4I5XA 1WBJA 1EHNA 3TWBA 3AIEA 8TIMA 2IXUA 5IDIA 3WLHA 1VEMA 1S7MA 1A5KC 1YTDA 4GI9A 4LGXA 2GGHA 2I57A 3HO8A 1W1A1 4LVGA 5C9WA 4ZOHB 2YBUA 1SO6A 4FK9A 3N2TA 3LRLA 4XUGA 2J78A 2VZOA 1WDRA 2ISFA 2Q09A 3G22A 3U6WA 3AO0A 5F1UA 1BF6A 4H4TA 1X6NA 5LNRA 2YCLB 3NQBA 1TVPA 4HZMA 1O94A 4DNMA 1CLVA 2DT3A 5K9DA 1DWGM 2D2GA 1KV5A 3T81A 4L6OA 3PZVA 2A3BA 4PEEA 1EB3A 4S3JA 1LBLA 1W2PA 1K70A 5HWNA 4REQA 3NQEA 5FD0A 3OB8A 4R7OA 3T0TA 4ZQOA 2QCHA 4B5WA 4QG8A 2QVNA 4WDXA 1UD4A 4W86A 1P0KA 5CPLA 4ZCWA 4OBSA 2DGAA 3M0MA 1JPDX 3NQVA 5CKSA 2SFPA 1VF8A 4H4YA 1RBAA 3HQOA 5A2AA 1KXQA 3WK3A 4H2CA 1BD0A 2QCNA 1R3TA 2QLYA 4H9YA 3TROA 1XLKA 3ITYA 3W24A 1PUDA 3RLHA 2UBPC 3LNPA 1G4TA 1VRDA 1UD2A 2YLLA 1W3HA 2VRQA 1V4YA 1L6GA 3HRDC 3DUGA 4XAYA 4GOAA 2FYMA 4CVWA 5CJMA 3DH9A 1AH3A 1VS1A 2J9ZA 1RY0A 2O9OA 4TV6A 3QY8A 1D3CA 2ZRVA 2GQAA 2E3TA 3SB0A 2AGTA 2OYKA 3KRBA 4IFOA 4CN1A 4GABA 1H09A 3F7JA 4DEFA 1CX9A 2DZBA 3M0YA 5A8MA 3R8RA 3T78A 2D2HA 3TC7A 3T40A 2NQLA 4O4WA 2PU0A 1IZJA 3DYPA 5IOBA 3MV11 2DT2A 4JX5A 3NGJA 4F0RA 3RJYA 5U1OA 1GSNA 2FMNA 1F4AA 3SR6B 2ZWYA 1Z48A 4RK8A 1W17A 1KN0A 2X8GA 3UG3A 5FOOA 1PV8A 4DVOA 4H1ZA 3U57A 3H2OA 4A22A 1Q85A 1LRQA 1P7TB 3B97A 3EXRA 4C6PA 2X7VA 2I9EA 1F8IA 3GNOA 5MF5A 4QLLA 1EOKA 4IJRA 3IJQA 2EAWA 4B4FA 4DBUA 3IACA 7ENLA 3R7MA 3SADA 3MVTA 3QTGA 4Q7IA 3G1FA 3RNDA 3VA8A 4DNHA 4D6GA 1L9WA 2GQ3A 3LI0A 1K3UA 3VIKA 1JR1A 4F48A 2EQ8A 3U5YA 4R27A 3LM3A 1ONEA 1XCWA 3WBWA 3WQCA 1JXJA 4FOJA 1N5XA 1FWHC 4BCEA 4E2DA 1WDQA 2Y7EA 4YHGA 1K8XA 2NSXA 2ZTKA 1JFXA 3H8AA 3HPSA 3NSMA 1XH1A 3WBEA 1UQYA 4LAOA 4DWSA 3LCWA 1H0GA 3NEVA 3WNMA 3QPEA 1TV8A 1XH0A 3LXCA 3HPXA 3A7AA 2A7PA 4H4XA 1EIBA 1RA5A 1JRBA 5A1AA 1SR0A 2IKJA 1B3ZA 2EPLX 5LIYX 2NT1A 3MANA 5EKYA 1BF2A 2AKZA 3FK4A 4FF5A 5LNWA 4BQ2A 3C0QA 1R3VA 3ENLA 4L9YA 1S38A 3EZ4A 2GZXA 1Y5WA 3CUJA 3B8IA 1R7OA 1ZJAA 3LHYA 3R11A 3WQ5A 3CNYA 4M29A 1V93A 3GRIA 3O9NA 4HA1A 3S42A 4QP0A 1DWFM 2R1NA 4FOUA 2X0HA 1DJHA 3EOLA 1PX8A 3VKBA 2E77A 1OX4A 5B7YA 3PTQA 2XIMA 1Q7QA 3K46A 3SSZA 2WAGA 1W3LA 1XISA 3G0UA 2PWHA 3Q45A 3L9CA 4LSBA 3THAA 3NRZB 1GVYA 4O18A 1ONWA 1R7AA 2ZZ1A 3TV8A 3ITOA 3W07A 1S5VA 3IIPA 4NEWA 4OTKA 4MJ2A 3FOKA 4CD5A 2J7HA 5BCAA 4DJFD 3GTHA 1TFVA 1P1MA 3IVUA 3SRKA 4IFKA 3CAVA 1CB7B 5IBXA 4OZOA 2QDGA 2Y7FA 4UFLA 4O1EA 3BZGA 3CBWA 3PFMA 2D22A 3FYPA 4JQ4A 3LXBA 2DH2A 3PBWA 1X38A 1KV8A 3BANA 4NT0A 3CH9A 3P0WA 2GJNA 1X39A 1TA3B 3W70A 2ZKMX 4BR1A 3SSJA 4Z1YA 1XFCA 1MW1A 3ARUA 2DP3A 4TIMA 4FNSA 2D0FA 4EANA 1V6UA 3EWDA 1H11A 5D33A 1VFFA 1WPCA 3AS2A 4PCSA 3JR2A 3ARZA 1Q6FA 5DBTA 2OWWA 1UH4A 4ZB2A 3PB0A 3RK8A 1XYFA 1MFVA 5AZ1A 5D8ZA 3TSDA 1E0XA 1LT8A 4Q6JA 4Q22A 4JIRA 4XBSA 2ZRYA 4JZ5A 1LBMA 2ABBA 1TJ2A 1JZ8A 1XBYA 1CXLA 2WMIB 1E72M 3T55A 3MT1A 3VCRA 4F79A 1LLWA 3U7BA 4GVFA 3NL6A 1OFOA 4DB7A 2JEPA 5HNTA 2WKLA 3B9AA 2WMFA 2PUZA 2BWGA 1JNDA 1POJA 3O0HA 1EJ7L 1GUVA 2ZX8A 3K4WA 4LAMA 4O15A 3E1F1 2W4XA 4NZJA 2BVWA 3WDRA 3WO8A 2O9TA 4U2ZA 2HNEA 4ADUA 1BYAA 4ROQA 4QHRA 3O16A 1RXOB 3D46A 3VKKA 4GVHA 4ADTA 2VNCA 4LYQA 5JQ9A 5AHNA 2XYLA 2CETA 1LOLA 4CQAA 3KAOA 4JDRA 3MWCA 3NYZA 4CEUC 3WQ4A 2XGZA 5D03A 3GNRA 1M7PA 5A6MA 2QULA 4H8NA 1LWHA 4MZ1A 1JPHA 1A5MC 1CGVA 1EXBA 5AY7A 4P8UA 3HZ3A 1F2JA 3UWVA 2BGNE 4QJ3B 1YQ2A 3SCSA 3GH4A 3NCOA 3UJSA 3SO7A 3F2BA 4MADA 1K4GA 1M01A 4WKHA 1M41A 3IV8A 3D6NA 3GDTA 2XIIA 1E40A 3JVAA 3EX6A 3HIJA 3PK7A 1NOWA 2V5JA 5G2HA 1ITCA 2AL2B 5J5DA 3QM3A 3GG7A 3VNJA 2J8FA 2VDIA 2GWNA 3F2CA 1GKQA 5A5WA 1A80A 3UPWA 1ONXA 3G8RA 2ZZ4A 4GVIA 4A3RA 3DN5A 1XC4A 1VYRA 1XLCA 2YGYA 3AMDA 3PP7A 4QBXA 3SBFA 1RJPA 4ASTA 3NL2A 2YCLA 1DJXA 1EYWA 1C91A 1TMLA 1J01A 5HJXA 1QRQA 4LRTA 1GVIA 1UZDA 3W37A 1QI5A 2G97A 5CPMA 3HFYA 2D2OA 3R1ZA 4GI8A 4LJ3A 4GX8A 2QF7A 4GUGA 4Q7BA 3VOHA 5KINA 4RDWA 4E4FA 2HNHA 2AAAA 3L23A 4E8GA 5C5YA 1GRBA 3LV5A 3S47A 1G4SA 4N42A 4KEMA 2QV5A 3QC0A 1K9EA 3LBOA 3MPGA 5J04A 1JDDA 4UCFA 2FZNA 3DZ1A 1UH2A 4GK8A 1UC5A 1PZ2A 1R9XA 5FAGA 1CXEA 1IE7C 2OELA 1GOWA 1N55A 1FECA 2NVDA 2REQB 1UW9A 2I17A 3HB9A 4HMEA 1TG7A 1EGMA 4LU0A 1UQZA 5KETA 4LUJA 1WKFA 2H6RA 2FGZA 1EH9A 5RUBA 5F4XA 3ARPA 1XV8A 3IVSA 5LHEA 1RCXB 2PTXA 3PZQA 1IV8A 3UJRA 3MW7A 4BQ4A 1GKPA 3UXDA 2Y6ZA 3BO9A 5E70A 1K8YA 2G95A 3EEZA 1LG1A 2PC4A 4WDTA 2Z1XA 4E4UA 1BKHA 1UWRA 3I6EA 4W8BA 1AFSA 3HQPA 1AL8A 3TAKA 4F0LA 3UZZA 2QGYA 4DXXA 4XTIA 3AXHA 4C1NA 1S3TC 3A5FA 3S5YA 5DCBA 4XZHA 3TW9A 3IRDA 4AZIA 3MI6A 4NZ1A 4WY0F 4ZVJA 3B8TA 3AU6A 2HDJA 1Q1RA 4AZCB 3LPFA 2W92A 3TYEA 1P7TA 1XXXA 2E5DA 1NIUA 2WK2A 1EHAA 3VE9A 1Q6LA 2CZVA 4E2BA 3QLDA 1XX1A 1HO1A 4RNHA 3PZMA 3EEGA 3KL3A 4PTNA 4IIDA 1ZUAX 4UTFA 2VOMA 3QVQA 3B0VC 2UY4A 3H2AA 2WOWA 1DE5A 2D2JA 4C6BA 3E0LA 1NOFA 3PAJA 4R7WA 4RZBA 4AYSA 2WSRA 1T7LA 3LXDA 1J0ZA 4ICNA 3PZIA 3KEHA 3TSBA 3VPLA 1Q6CA 2IMRA 3MTWA 4TX9A 4IIBA 2ACRA 5J5RA 3WK1A 3EA2A 7A3HA 1QPKA 4GZIA 1JYXA 2VCAA 4PUNA 3E49A 3BURA 4FP1A 2FDMA 1UBPC 1YMYA 2AGKA 3ARRA 3GH7A 3GO2A 5HWJA 1QVBA 1WYIA 3VC5A 2QGHA 4N9BA 5I3DA 3SGUA 2ZA1A 3HV9A 2FHCA 4YCPA 1V0NA 1DXFA 3C86A 2AQVA 4GO9A 3OZYA 4ZO6A 3D0CA 3B9NA 1VFSA 5FSDC 4JFUA 4JTEA 5K4ZA 4ZZ9A 4EIVA 3GW3A 3TXZA 2J7GA 2R6OA 3WNKA 3MMTA 3MCOA 1C8XA 4Y90A 4QEHA 1HW6A 3AIUA 1V3HA 2HQAA 3NPVA 4ADSA 4RXFA 1XLLA 1XKYA 2VUYA 1TTQA 3NZQA 4M6VA 4X2PA 3CGDA 4F66A 4K2SA 3N6JA 4MZ8A 5H6HA 1KFJA 4IIGA 5FS8A 3A4AA 3DCPA 2V3AA 3UR7A 3E0VA 4JNZA 1ICQA 2VZTA 3LPGA 2VO5A 1W31A 3N6HA 2Z26A 2GK1A 3BG5A 3H7RA 1ZGDA 5HR7A 3HJZA 1QMLA 2FLIA 4JL1A 3BCJA 3GTNA 2WJZA 4APNA 3H2NA 4H9ZA 2X1RA 1OY0A 1H7NA 3QQ1A 3FCPA 3KP1A 3WD2A 4JCLA 4QSFA 1F8WA 3ZFHA 3DGRA 5BRBA 1AJ0A 3SCWA 4Y9MA 3WLKX 1ZQ5A 1MWOA 5FF7A 1G1YA 4NF7A 2GVEA 2QV4A 2QAPA 4H01A 4N9DA 3PUEA 2OGJA 4TO8A 2RH9A 3NO5A 4Z1AA 3WX7A 3RX4A 1V6YA 5JUVA 4MIMA 4MYAA 1TA3A 1XBVA 1H4PA 1P5BA 4A8IA 4C91A 3PG6A 1SGJA 3T44A 2E6FA 4CD8A 3BAIA 1Q6OA 3EYPA 1Y7VA 1V3JA 1PEZA 2WC3A 4MFDA 3XINA 3GHTA 3AFBA 1XPYA 3PJTA 2D69A 5REQB 4ORMA 4J9JA 4E38A 3L0KA 1RHCA 1QWKA 1SO4A 3HGSA 3MWAA 1R0MA 4NXSA 3TQKA 4D72A 4CGTA 2BCPA 4Q8NA 1HJXA 3JZUA 2WBKA 1RY8A 3DXIA 5IFPA 5IHSA 3LS9A 4HA3A 2ACUA 4CQBA 3LY0A 3W53A 4IT1A 1O5QA 2MNRA 4MOZA 3BQ6A 2WMIA 2ISVA 3KP0A 2DU2A 3HF3A 2PC8A 1W3JA 4YWOA 1PCKA 3NM1A 2G0WA 4D2JA 2DSZA 3AIBA 2QKFA 4EMWA 1O95A 1IWAA 3WY1A 2PDKA 4DHGA 3AJXA 3GK0A 2R94A 4ERGA 3ERPA 1DIOA 4EAMA 1AMKA 2PMQA 5LXEA 1M03A 3NNTA 1V03A 2BHUA 3GWQA 4C5YA 2QVHA 3G1AA 2VR2A 2ISSA 1Q6QA 4B5NA 7CGTA 4CQDA 2GVYA 2PGRA 2VM8A 3EUB3 1QJWA 2PB1A 1MEWA 3LNMA 4RJEA 3STEA 1G7UA 2I14A 3SRHA 1TPB1 4A05A 2WMGA 2R1KA 5FEZA 1C8YA 1XS2A 2BC0A 3PUOA 1MEIA 1U83A 1ZXIC 1B5TA 1ZB5A 3SFKA 3GUWA 4Z1CA 3W1LA 1SJBA 4L7ZA 2B7PA 1OEPA 3VNKA 1AW5A 1TRIA 1UH3A 2B81A 3SUWA 4MUZA 3GXFA 4H6EA 3GAKA 2L5HA 3GLCA 1R9ZA 4JIEA 3N4AA 1G0CA 1UWTA 4GCXA 1BKSA 4NU7A 2XH2A 1LTDA 3PBGA 2E4TA 2CITA 4UQCA 1XGZA 1KGUA 1UZ1A 1TPFA 2ZBTA 3CUZA 3SCQA 3UG4A 4IIEA 3PZTA 1BWVA 4S1FA 3DECA 2X0YA 4XD6A 3L8KA 5F4SA 2GDQA 2FFIA 3WF2A 2WM0A 4TVCA 3IVTA 3NVWB 4MWAD 2PWUA 5CC7A 4IIHA 4XZMX 3CL8A 4A6GA 6XIAA 1N61C 2Y70A 3BOXA 2FH8A 3W26A 1QHZA 2YCKX 3C52A 3VIMA 2DZXA 4QCFA 3BPWA 3W84A 3NQ7A 3PBMA 2TAAA 1EDQA 1MQPA 2DSKA 3VXGA 1UG6A 2WPFA 3EXTA 3T8QA 1UWIA 4PMZA 3S2CA 1F73A 5CLTA 5D2YA 4QR6A 4DY1A 1BHGA 4GH3A 2PFHA 3STPA 4W93A 2CKRA 4Z42C 4UQAA 3BQ5A 2BLEA 3LD5A 1CXIA 4MPKA 3MYOA 5E6YA 5XINA 4NAEB 2X09A 3CXOA 4JDYA 2ODOA 3CMFA 2C8NA 4AD3A 4LCQA 2BNJA 2ZTJA 3LEPA 1E55A 3N2BA 1ADOA 1ZBWA 4GINA 5EMUA 2GDUA 2ICSA 4HHPA 4XWUA 3SN4A 3KM8A 4H9MA 4CU8A 3W3OA 1H51A 4DF1A 3W71A 1X96A 1FY6A 3LBCA 3TOYA 5HWMA 3EAOA 5DY2A 1V5XA 1XCXA 3VGEA 3TC3A 1FWSA 1VD6A 4X9YA 4AD5A 2QCDB 4AZ6A 1R86A 4EXAA 4E6MA 5DX7A 2PE4A 3LB0A 3HM7A 2GWGA 5DELA 2JF7A 1UWUA 3BXWA 3O7UA 4JTKA 1SUXA 1U30A 3N1AA 4UR7A 1HKIA 4YMZA 3HG5A 4HN8A 4NX5A 5DCEA 3RM4A 3GFXA 3JW7A 3SCPA 5HAOA 3CPGA 4O1BA 5C2CA 3MV01 2XGIA 3JS3A 4P8XA 3T2QA 4I6VA 3R4IA 2F7FA 2WKGA 1XYZA 2OQHA 2WV8A 4GXMA 3URHA 3NA8A 3W7QA 4R9OA 1S5NA 4AZCA 1QW8A 1YRRA 4JD4A 1PHQA 4NY2A 5HMFA 2XIBA 4I7WA 3WEMA 4LUSB 5HULA 3PNUA 1CLXA 4J3WA 2QNEA 2VQUA 4IPIA 2OOFA 3G5EA 4LYPA 4BF5A 5T9CE 2R8WA 1W9UA 1E4NA 4V2XA 3RMEA 3ABQA 3OO2A 1JOAA 2POZA 5GQBA 1NAL1 5I23A 3W7GA 5BU6A 1NHPA 5I6SA 1RAKA 5FJRA 3NQFA 3VILA 1HP5A 3DU0A 4YU1A 1VB9A 2GFTA 2NXIA 3H2EA 2PWVA 1JD9A 1PZ1A 2YA0A 1JZ6A 4KPRA 2VX7A 3C8FA 4AXKA 4XZLX 1V6TA 1XRFA 4IGSA 3M5XA 2EG8A 4YNGA 1YXCA 2A4AA 1TPH1 4ZXOA 4DBWA 3E3HA 4PL2A 3A6OA 4V33A 2IKIA 2J24A 4AEFA 3MUXA 1FHDA 1SMDA 1HIZA 4FNUA 3M47A 3ZT7A 4UB9A 5IXEA 3AYSA 1FWWA 4MSSA 1EIXA 1L6SA 3W02A 1AK5A 3GB6A 2Q8XA 2WZEA 4XSMA 2PDLA 3UD6A 2CLKA 3SY8A 2Q3RA 1T41A 1NWTA 2BOFX 3CB8A 3CZLA 1F3EA 2QAFA 4LW7A 4UTHA 1W1B1 5A6TC 1VCVA 4V28A 4U5IA 2Z27A 3BVJA 4ECLA 3KWXA 4I9TA 4MNLA 4DZAA 3PF3A 1XLAA 4BF9A 1KM5A 1FIQB 1IT8A 3DI1A 3VCNA 1VC4A 1MUCA 3PG9A 3IGSA 5CSSA 4FLRA 8CGTA 1ZCCA 2ZUVA 3RCMA 3T0AA 3Q4DA 3P93A 1UHVA 3TJXA 1S1PA 1LLZA 3L4TA 1HQTA 4Z2LA 3SN1A 3DJJA 2KAUC 4EMIA 3FFSA 2NVAA 3OQEA 4E8DA 5I02A 3NVZB 2OODA 1UJPA 4IMEA 3WQWA 2ZWZA 2Z6JA 3ZM8A 3QV8A 3B40A 3R89A 3KBMA 3UWEA 3P0XA 4L80A 3C8NA 1J12A 4C7GA 1BFNA 2CFYA 3HW2A 1LZOA 4O53A 2H90A 2V30A 4UBPC 1TWIA 3WQEA 4WCJA 1M7JA 5A2CA 3SQLA 4RV3A 4GQ0A 2YDSA 3M43A 3LTPA 5REQA 4A3UA 1PWLA 4LNYA 1A0DA 3AWOA 3SGGA 2OSXA 2E67A 1M3UA 3LX9A 3M5ZA 1VJZA 1KTBA 4AF0B 4IM4A 1ADSA 1O60A 4B92A 3NQ2A 4GNKB 1EEXA 3VNDA 3PPGA 1EGZA 3GBEA 1QPNA 4U28A 2O9RA 2P3EA 3NVTA 4CCEA 4KCUA 3VM5A 4NEVA 2DW6A 1QI0A 3S6OA 3SUTA 5I3FA 3MUIA 2OYLA 4C6KA 5CJNA 3WNNA 5IDZA 4OGZA 3B0PA 1DXEA 2NT0A 4WGHA 2WNZA 4EQRA 2CYGA 2OVLA 3C56A 1D3HA 3GH5A 5C2GA 2Z0IA 3PTKA 1WUFA 2QDDA 2VFHA 4DRSA 2INZA 3UF9A 5JCMA 3VIFA 1DWHM 3SQPA 2J7BA 3WFZA 3FAWA 4A3QA 1DXIA 3HA1A 1R8LA 4AEOA 2G37A 3CUGA 4RUBA 1B57A 4EPDC 4AY1A 3T2PA 3DGBA 1V8EA 4W88A 3NM3A 1E4IA 4J1OA 4JHOA 2QJGA 2OB3A 4UTLA 2WP5A 4CD4A 4PODA 3WYZA 3ZLHA 1FKWA 2V5LA 3VCCA 3AI0A 3N19B 1L6YA 2V6OA 3QFBA 2ACSA 2FQIA 2NW0A 3G18A 4A3HA 2GQ9A 1JUBA 2F61A 1OCBA 3N2OA 3W81A 1YTKA 3SCRA 4DZIA 5I3GA 3U2ZA 3NXFA 3L4WA 1F05A 3PZNA 4YS1A 1KFLA 4KEVA 4J3TA 1XR2A 5CC6A 4IMAA 5FF3A 1GRFA 4AHPA 3APTA 3SIZA 2J62A 3BAWA 2RAGA 3LA4A 4K39A 4AVFA 1FUYA 1E6PA 1VFLA 2E68A 1W8GA 4GA8A 2OFJA 4GYPC 4RV8A 5EU9A 2CWXA 3MUZ1 3A4XA 1E15A 5CZ0A 1D8WA 1V02E 1DL3A 3GXMA 1PIIA 3VYLA 1PZ3A 4ZXLA 1TWSA 3L4UA 4WD0A 3KOXA 5GJMA 2FVLA 1DQUA 1E0WA 3PJUA 1V6VA 5FJPA 4HOXA 2VCBA 2ZX5A 4Z1DA 4C6LA 1WX0A 4Q8TA 4DJFA 1TJ0A 1V6WA 3BJSA 2R9RA 3IV3A 3RO8A 4EX4A 2C3DA 2JF6A 1V6XA 3GXDA 1GQKA 4Y6GA 5K4XA 1ZP4A 2Z2AA 4HKPA 4C7FA 4DN1A 2XG9A 3PB2A 4UMBA 1ISWA 4IQLA 4PSPA 3V5FA 3BDKA 1KM3A 1GHRA 3PNZA 3C6CA 2Z1VA 3W83A 3PUGA 5KVHA 3SUUA 3PC0A 4JIPA 3ZZ1A 1LL4A 4D6HA 2VENA 3APYA 4NAEA 1EP1A 4AH7A 2PP1A 1JCTA 2BHZA 3P62A 1D3GA 3NQAA 2QCGA 1XHCA 4US6A 5JH1A 3W7RA 3TIMA 3CGEA 3E96A 2BASA 1XIHA 4B16A 3GAYA 3GNPA 2ZX6A 1UR3M 1K9TA 4AHQA 4OUEA 1J79A 3PZUA 3BAKA 3BH4A 2OLSA 3BOFA 1VGAA 3GVVA 3QLLA 5JCIA 3DK9A 4HCDA 3R43A 1E0TA 1TE1A 3F4CA 4QJ4B 1GQLA 3DH7A 1N63C 3UEQA 3KRUA 4EPBC 4C6IA 4WVXA 5C0QA 4GC4A 3QSRA 2CFFA 5CH9A 5TR3A 4Z2HA 4GZJA 3H7VA 2QCDA 2XH7A 3PPHA 1OK6A 3AWNA 4NASA 4IWWA 5AVNA 1QPOA 1HP4A 1YDYA 3CUIA 4RX0A 2CLOA 4OU1A 3JU2A 4QROA 1E0VA 3BLPX 3XIMA 4HNCA 3WJWA 1W37A 4L9ZA 2WZMA 3OZPA 1W1IE 2J75A 2V3BA 3WQDA 1KB3A 1NFGA 5T91A 2X1UA 5A8OA 1Q4WA 3HPZA 4KF1A 7XIMA 2FGBA 3H70A 2JQXA 2W3ZA 2Z00A 3OQ8A 1M53A 3R8GA 3UXLA 2QMKA 5M3WA 4JQAA 5LNSA 2A1YA 2E1WA 3LQGA 3HPAA 3ZSTA 2XU2A 4AY8A 1FWFC 3WLJA 2VDHA 4L4MA 1F5ZA 1SW0A 1EJUC 2QUUA 4YTQA 1PTDA 1OFDA 1UMYA 3W38A 1FDJA 3ZMRA 4PSRA 1Q8AA 3VOJA 4RPQA 2VX4A 1OYBA 2VEGA 2X16A 1DJIA 3UT0A 3P80A 3CJPA 4A8NA 5LXXA 4HU8A 2ZXBA 1CYGA 4Q6XA 4R3UA 4ILSA 1K03A 2GGEA 1SW3A 3AMKA 1IZKA 3W7DA 4MJZA 4CU6A 3W25A 4K3ZA 4MWAB 3V1PA 4M7TA 3BICA 1E43A 1WP6A 1ZSXA 1JG9A 3QHNA 1OF8A 2VFEA 5BXTA 2ZDSA 4L61A 2CLLA 5C8BB 1TR9A 4W8AA 4O1DA 3RDKA 2QJNA 4E8CA 4DLMA 1JQXA 1QO2A 4A8RA 4HMDA 2ZZ7A 3STFA 1PIFA 4UNIA 4IXHA 4JKKA 3IIVA 4MKVA 3W22A 3MHUA 3IIOA 3TVAA 1SYTA 3LGGA 1KKOA 4H04A 4NNCA 5U4NA 3CAWA 3BL3A 5BOOA 4D1JA 5GNXA 3VGGA 4ATLA 2UZ9A 3NXLA 2OQLA 1NHQA 4PB3A 1VRXA 4RW5A 2G8ZA 4DWSC 5EFDA 2XFWA 1OZQA 2HWGA 3TOPA 3TKFA 7REQB 4S39A 5C9RA 3TTSA 1XIMA 5DLCA 3LADA 1E9YB 4K7ZA 2RDWA 3KZPA 2O7QA 2OXNA 2QJIA 3QKZA 3WZ0E 1EDGA 2V3DA 3S9YA 4JCMA 4KGJA 4XD5A 4JNMA 3GNNA 3WF1A 3AM9A 4EQWA 2OTDA 1RCOB 2NQ5A 3CH0A 3GXPA 5IFTA 3ZIZA 3PG8A 1EUNA 1A0CA 1JAEA 2O92A 2E09A 5BOEA 1E4MM 3W1MA 2XHYA 2ASHA 2HS8A 2QDEA 2TPSA 3KRSA 5A2BA 3H55A 1GG1A 1I2OA 3EKLA 1WV2A 3MKVA 5CGQA 2YCIX 4TMCA 2IQTA 4WX2A 3IIZA 1H1ZA 1REQB 1GOIA 4AF0A 1DWAM 4PUDA 2VP8A 3PHAA 4I8YA 1K7EA 4D6JA 3EB3A 1R3RA 1M5WA 3MKCA 2WWDA 1GHSA 3G6MA 1JJKA 3VGBA 2EPOA 3GFZA 2Y24A 4GISA 2XZ7A 1RP9A 3A3HA 1J18A 1E73M 4UTUA 1ZKQA 2ZIDA 1KXVA 4MB5A 5C9ZA 1S5MA 1W0MA 1XW8A 3P81A 3TYUA 1B9BA 3PY2A 1FQ0A 1H7RA 3VIIA 3LBMA 3W76A 1P0DA 3NOEA 3KBVA 3EDFA 3HFTA 3NG3A 1H61A 1OT2A 2D1ZA 1T5AA 2RFGA 4O0KA 4KS0A 2WLYA 4GUHA 3AS1A 2PLJA 1J0YA 1FWNA 2Z1SA 2WSYA 5H8UA 3QFAA 2Y5SA 4OBRA 3A7UA 3UGRA 3EB2A 3T07A 3QV7A 4NZ5A 3OC4A 4FDCB 1Q1WA 1BRLB 1UUQA 5D04C 1IXNA 4H83A 3OIXA 2RDXA 5TD4A 5I3IA 3TWAA 2Q8LA 2YB1A 5JU6A 2G41A 4NI3A 3MJYA 4PC8A 4EQSA 1F6PA 2BOGX 1B54A 4MG4A 5LNUA 4H41A 2CKSA 1CZ1A 3N29A 3N17A 1DNCA 3AISA 3RAOA 3ANUA 1GCYA 1ZALA 3GYEA 5E1QA 5HOSA 3EWBX 2Y0FA 1JXKA 3E38A 3H6OA 5AC6A 1JZ5A 3KXQA 5T9BG 4D6IA 4OT7A 3W2UA 1GJWA 5BU9A 1LG2A 4MM1A 4ZE4A 3TNOA 2ADAA 2O55A 1J11A 1Q6RA 3NZPA 3IC9A 4Y2WA 1NHRA 3WBYA 2AQWA 3HQ1A 1YE4A 1T8QA 4B2DD 4FLOA 4XSLA 4CKQA 2NXHA 4S3CA 3G1SA 4Q8QA 3EOEA 3CHEA 3TC6A 2F84A 1YXDA 3CV1A 3RX2A 3DBPA 4C6EA 3S2JA 1OIMA 1TYTA 1KC7A 1CWYA 3LMYA 3O6CA 1W3NA 2G3MA 4HK7A 1DKWA 2R14A 1XCFA 1LWIA 4GX9A 2ZUTA 3MDUA 1ZZMA 3N14A 4NXKA 3RG6A 1H5YA 4GY0A 1GNXA 1MDRA 1DTUA 5G4EA 1KFKA 1YTEA 3OVGA 1GXFA 5EPDA 2HTMA 4JTHA 2O4MA 2Y63A 2OR2A 4YN5A 3TTEA 2PDIA 1AW1A 4GYFA 4U33A 3OIHA 4IH3A 3LHTA 4Z2GA 2WP6A 2GRTA 2GL5A 4LS0A 5FESA 2ZA2A 2E25A 4J3VA 4CCDA 3OVRA 3M0ZA 4WY0B 1EA0A 4D8ZA 4XX6A 4JICA 1EPXA 5HQMA 2ZUNA 2YL5A 3F4WA 3WK2A 2PP3A 3L0NA 1GVFA 4LRSA 2GOKA 4HJWA 4BQ3A 2NVKX 1M7OA 1GYMA 4R85A 2ZADA 3BWWA 5CC5A 3WENA 3M5VA 5DFAA 1UKSA 2CLHA 2WCSA 1SMAA 4MFEA 3AHTA 4I7UA 1HKVA 3W9ZA 4CCCA 2J13A 3ARXA 2YL6A 2NLYA 3QFWA 5MHBA 1KKRA 3BUVA 4PTMA 3UERA 4WRHA 3T2OA 2VURA 4LBRA 3MHFA 1N82A 5LIKX 3DERA 4KCWA 4YHEA 1M6IA 3MI2A 3AN1A 4IPNB 4D8AA 1BTMA 1TRDA 5I06A 2X05A 3ZJ7A 1VFUA 3SY5A 3V35A 4H00A 2XVKA 3OGSA 4U10A 1HXJA 3GIQA 2HISA 5CPQA 3W73A 1KBIA 4LVFA 3ZJKA 3ZLFA 2VGIA 1BTCA 1V02A 3GXIA 1L8NA 2Y4SA 3IIXA 2HSAA 1SFSA 2CBIA 3TTOA 3GVQA 5FJJA 1GVQA 2NX3A 3D47A 3BAYA 1VCFA 1Q7MA 3R8HA 4GHRA 3GG1A 3ANVA 1CXKA 4A3YA 3WDQA 3L4XA 5LIUX 1ZBVA 3IPWA 4NI8A 1Q63A 2PDFA 1TSIA 2FPTA 1EX1A 3QZAA 2YQUA 5CQ1A 1YDVA 4YWIA 2GVLA 1XG4A 3VGDA 2AAQA 1PKLA 3CGBA 4H50A 4PFHA 2DQWA 4BHYA 1KBJA 2WNWA 2PZ0A 4BKNA 1RBLA 1XJBA 3WH7A 3DC8A 1LYXA 2Q3OA 3BW2A 2VELA 3DKLA 4MNMA 3TFXA 4MWAA 3AMGA 4HCLA 3CO4A 1NDAA 3LM7A 3QY6A 3IANA 3CTLA 1ZBKA 4PMUA 3MUCA 3GVGA 3TX9A 1A5CA 1ZJBA 1SVDA 4I5UA 4WDWA 3PN8A 3QMTA 4IQDA 4FX9A 4PH6A 1NJJA 5C70A 2NV2A 4Y96A 4H6KA 1B9ZA 1NEYA 2AOSA 2GOUA 4GIRA 3V1HA 5CZTA 4JTFA 2V2CA 3OA3A 1OYCA 1YLVA 1CB2A 2HMCA 4H4QA 4J40A 3A5VA 1RM6B 3IJLA 4F9DA 1WNOA 2PBGA 3ZSSA 3NR0A 3AMCA 1LQ2A 3G6LA 5D8WA 4CD7A 3IGHX 1N8WA 1ONFA 1TB3A 3BJFA 4WSKA 1PKYA 2F2KA 4EWND 1YQZA 3UZXA 1Z42A 3ME3A 1DHKA 3WDIA 2NQJA 4D1IA 1EZWA 5FIPA 4NNBA 5FS7A 3TTYA 5C2XA 2Y89A 1KCZA 3G1DA 3GRSA 1KCXA 4LFYA 4Y8FA 2VT0A 3OG2A 3CL7A 5JCLA 1JDFA 3CYVA 1RR2A 5CXPA 2XN0A 2EBNA 3D3AA 3NQGA 5CEWA 4Y9OA 4LALA 2TRSA 3EKZA 1A53A 4C7DA 2FVMA 1D7KA 3VZYA 2QXWA 5A6BA 2XM1A 3A4JA 2V6AA 4H9VA 4LAZA 1NWSA 4HJFA 4GCAA 3W2KA 1W8SA 4DJDC 3M6DA 5E0KA 1US2A 4JN7A 1RK6A 3WUGA 4LB3A 3AC0A 1KBLA 4K8EA 2ZOXA 3O6AA 1E6ZA 5DRCA 3AHYA 2XTKA 1EEPA 1ZX9A 2WCAA 2CLPA 7ODCA 4DYKA 4CNPA 2YBTA 1A5NC 3N3TA 3ZOAA 1REQA 1US3A 4PMYA 3L65A 1UKTA 1IXQA 2DIJA 1RUSA 1UYQA 2WPCA 3ZR5A 2OWXA 3VKAA 2D3NA 1R9YA 4XKYB 3A23A 4XAZA 1HZYA 5I77A 3LHVA 3DG7A 1GOMA 1R85A 4AMAA 1A50A 3O63A 3GM8A 2X50A 4KWWA 1JEZA 3TYBA 4F0SA 1GOOA 1M65A 4LX4A 1A47A 3W2JA 5HMSA 3V36A 1CDGA 4PCTA 3MZNA 3OP2A 1UR0A 3QGKC 2X8CA 1M68A 4MY9A 4ZOCA 5FS6A 4JXCA 1GRAA 3GBDA 4M0XA 3A12A 1UPPA 3N9RA 3M64A 2PD5A 3C2YA 1JYVA 3K8MA 2DPEA 3O05A 1WDDA 5M1TA 3M0KA 1XYMA 5E5CA 5G1TA 2X1SA 4QE5A 1Q66A 1J6OA 4B4HA 1BRLA 1XUUA 4QAWA 2FJUB 3N12A 5ECUA 1JF6A 4YYCA 4YJ5A 4GG9A 4KT2A 3S3GA 2JIEA 2PDJA 4QAIA 1ITUA 3EXSA 2GPTA 3GW0A 4MMWA 4LVDA 1OWQA 5C54A 4G6CA 5BMXA 1BSIA 3VOGA 5BWFA 3S5ZA 4QSHA 3EWXA 1C90A 5AYIA 4E3TA 2PDGA 3D5HA 4K7YA 4JYDA 3QZ6A 4UIOA 1FCVA 3OHIA 4GQQA 4HNOA 1K6WA 3VNMA 3M0JA 3J7HA 3CUFA 3W7KA 3TQVA 2BY1A 1GTHA 2WVSA 2QJMA 1N7KA 3H12A 1HJUA 4H8UA 1JI2A 4PULA 4UTKA 4OOZA 3P2VA 1LROA 4CD6A 1W3TA 2PEVA 3V5OA 4GZEA 4FNPA 4GWEA 4LVAA 3W1UA 4L4OA 3CWNA 5A94A 2W5FA 4AFYA 5CPOA 4NZFA 2D0GA 4M1BA 1E6SM 3ONCA 3WBAA 2Y2WA 2QPXA 5A8QA 3AIQA 2EPMX 4DYEA 3ABZA 1BSLA 3SUSA 4BS0A 1IGWA 3V16A 3K1DA 2PDWA 1FA2A 3UWWA 1AODA 2HK1A 3UW6A 3LGDA 2V67A 1MW0A 3E5PA 4GYJA 5KZDA 2RDUA 1FP8A 3HBLA 5DXYA 3P84A 1O6IA 5D9PA 3YPIA 1BQCA 3T09A 4AWEA 3NQ8A 4D6EA 1F3TA 2ZICA 3NGFA 1T0OA 1TJRA 2Y85A 1MXSA 1Q8JA 1XG3A 2CNCA 3PJXA 3VDCA 2V5CA 4PMRA 1PL9A 1A3WA 2QF8A 2BG5A 4M80A 3M46A 1RJRA 2XIQA 5F4WA 3CQIA 2W55A 2ZVRA 4WK9A 3M16A 3RRAA 5I5RA 3S0CA 2CBVA 2WVUA 2ALDA 4F0HA 3KDOA 2QCCA 4TVWA 4UTIA 1DWJM 5D38A 1SU5A 1MI3A 1P1XA 3ANYA 4KERA 4I5RA 3R94A 3KBSA 2VCCA 3VNIA 3L2MA 2F38A 1NDYA 1RJQA 1Y65A 4HNVA 1AMYA 4HHHA 4QDWA 1GWJA 4ZL1A 2FHBA 1XFBA 1GETA 3QYQA 2DEPA 3VNLA 1QI4A 4LUTA 4DJEC 2ZZ3A 3STCA 2Z2UA 3BLIA 1FCUA 1J4EA 1NFPA 2WPEA 1H2JA 4MNKA 2J25A 1J2BA 4TVUA 4ENLA 4L65A 4EWJA 3S46A 1CXHA 3FGCB 2WNQA 3LZ3A 5HMEA 2WYSA 3W6YA 2CU0A 3GHRA 2PRMA 1U1HA 3UXIA 2PP0A 3ETRB 2GSJA 3MCMA 4IXXA 3KVKA 4HIBA 5LNVA 1K4HA 4A21A 4ZMGA 4BI5A 4N0RA 4AWTA 1WXJA 3W86A 1FWEC 5IM51 4M6UA 3C61A 3SECA 3WFAA 2PDYA 4G1KA 2J4GA 4NJKA 1UUMA 1SO3A 1DJQA 4HMNA 5ECVA 4ICMA 3U2OA 3W7HA 1HGWA 2TYSA 4NSBA 3PSWA 1PJ9A 5BOFA 4XAGA 4Q8WA 3NVDA 4FLQA 1QBAA 5HPCA 4UQEA 1PIGA 1VBHA 1YHTA 1FBAA 2D0HA 3I6RA 4HNNA 4E0CA 2P0IA 5FA5A 4IP7A 1C29A 1DP0A 3VX1A 1PZ0A 3S2MA 2BFGA 2GJXB 3CZ8A 2BP1A 1EKOA 4HTYA 5CSUA 1ZNNA 4DWDA 1A5LC 1KRCC 4JQ1A 4O8RA 3GU9A 1QFEA 3KCJA 1K9DA 1TWWA 1GEHA 4GGBA 4S23A 1KFCA 3NFUA 1THFD 1SM9A 1QOXA 4GYKA 3DKJA 1RD6A 3K4DA 4ZQRA 3ZQ9A 3WLOA 5A6SA 3SDOA 3I68A 1A3HA 1J10A 4BI7A 3GX9A 5G5HB 1NM9A 4O4VA 3TW6A 1VJIA 1OFBA 5DQPA 3ZVHB 1GVRA 3MB9A 3BGGA 2X41A 1W32A 1OX6A 4FNTA 3SGZA 3N2MA 5I3JA 3B0UX 2Y5JA 4ACZB 3WD4A 2YVGA 4JNYA 5JRBA 3K30A 4G7EB 5LIWX 2WSPA 3RR1A 1LJYA 1OFEA 2YXXA 1WDPA 4ICCX 1U1UA 4WZHA 1XLBA 1BWKA 3MP3A 1FHLA 3R07C 3B9EA 1XLMA 2J6XA 2WZIA 4KPLA 3UG5A 3IJ9A 4YPJA 3NPWA 3VK5A 4JGDA 5FJOA 1F6KA 3LUTA 5TQLA 1RCQA 1UZ4A 3B06A 2CHOA 2H9AB 4CN6A 1SZNA 4S3EA 4NAFB 3I3DA 5DT7A 2WOQA 3N18A 2UY3A 2B7NA 4P8VA 2AMXA 1BG4A 3W87A 4UZSA 1S39A 2PDPA 4INFA 3GDBA 2FTPA 1OX5A 4I7VA 3N73A 1WZKA 3BLKA 1FVPA 6PTDA 5DO8A 1F7BA 4FNRA 3WFLA 1IZCA 3MJMA 2H3DA 2AKMA 4AZGA 1KD0A 3KBJA 5LYRA 1UD6A 1IIGA 1KM4A 2ACQA 1IF2A 3AS3A 3UR5A 3VI2A 4MLRA 2EPHA 2WMKA 2XVPA 5AFDA 4XO6A 4B91A 2AAMA 1KWKA 5BW6A 1MW3A 1HKJA 2IUZA 2E8YA 1DHPA 2BY0A 3RMJA 1WO2A 2I5QA 2Q8ZA 3O6DA 4KIEA 5I09A 4JQ9A 1FWCC 3VD4A 4FZIA 3OYXA 3E0WA 1PTAA 1EQPA 5C9XA 2XWDA 1MUMA 4XKYA 2XUCA 3DHDA 5XIAA 4H4WA 2PLKA 2PA6A 6ENLA 4QG6A 3WBXA 3VFLA 3M41A 1ISXA 5BYWA 4MLJA 2WOVA 4HMCA 4I9JA 1Q2SA 3WJZA 4KRUA 3KTCA 3MDWA 3W2LA 4JY8A 3GHSA 4NRRA 1B30A 1UA7A 3F5LA 2YX0A 5CG0A 1M9HA 1X1NA 3S1UA 2C0AA 5T8GA 3CT7A 1XBZA 3FVDA 4HSHA 2VDGA 4G5DA 1Q65A