2DW7A

Crystal structure of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and meso-tartrate
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
388
structure length
388
Chain Sequence
b'SVRIVDVREITKPISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERHGVKANPRVFVYAAGGYYYPGKGLSMLRGEMRGYLDRGYNVVKMKIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIGFEGKSDLYKEMKALAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bll6730 protein
publication title Evolution of Enzymatic Activities in the Enolase Superfamily: d-Tartrate Dehydratase from Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Lyase
total genus 135
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.2.1.81: D(-)-tartrate dehydratase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2dw7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2dw7A01
5FJTA 2ZC8A 2DW7A 3TJIA 1TE6A 3UGVA 2OVLA 3OZYA 3TOYA 2PTZA 4ENLA 1NU5A 1PDZA 3P3BA 3QTPA 1KKRA 3GC2A 2QGYA 5EU9A 4GGHA 3VFCA 3RO6A 2AL2B 3QPEA 1WUEA 4ROPA 1SJDA 4E4FA 2OO6A 3CAWA 4GYPA 4HNLA 3MWCA 4G7FA 2OX4A 2QDEA 3DG3A 3N6JA 1RVKA 3JW7A 2HXUA 3H70A 3MY9A 1F9CA 5FJUA 4IL0A 1TKKA 3TTEA 2DW6A 1JPMA 2HNEA 3ENLA 3DDMA 5FJOA 3FCPA 2GGHA 3ZLFA 3T8QA 3FV9A 4HYRA 3BJSA 3S47A 4K1WA 2PPGA 3MUCA 2FKPA 1MDLA 3FJ4A 3UCDA 3RR1A 1ECQA 1KCZA 3N4FA 4A3RA 2XH2A 3UCCA 2OZ3A 3STPA 2P8CA 2XGZA 1MNSA 2CHRA 4DWDA 3R25A 2GGGA 2RDXA 3VCNA 1BQGA 4E5TA 4DYEA 3U4FA 4ZA0A 4FI4A 2OZ8A 4H83A 4X2PA 3T9PA 3H12A 4KEMA 7ENLA 2PTWA 3QLDA 1SJCA 3KUMA 3PFRA 4KWSA 3RGTA 1MDRA 3NZGA 4YWSA 2AL2A 2QJNA 4KT2A 3HPFA 1EBHA 3D46A 3V5CA 3ES8A 4JN8A 3NO1A 2PP3A 3H8AA 5J04A 4E6MA 2P8BA 3RRAA 4GYPC 3T6CA 2AKMA 1ELSA 4IT1A 5ENLA 4J1OA 3PWGA 6ENLA 1MUCA 3SQSA 3CK5A 1R0MA 3CT2A 2O56A 2ONEA 3NFUA 4MGGA 2P0IA 3N4EA 2OKTA 2HZGA 3VCCA 1NELA 3OZMA 1ONEA 2P88A 2OZTA 3CXOA 2XH7A 3SN0A 3UJSA 3S5SA 3UJ2A 3H7VA 2GDQA 3JVAA 2OPJA 2XSXA 3DG7A 3EEZA 3R11A 4H19A 3GY1A 2PODA 3V4BA 4K8GA 3DFHA 3Q4DA 3DERA 2GSHA 1FHVA 3SN4A 3TQPA 2QDDA 2PTXA 3ES7A 3R1ZA 2PTYA 2XH4A 4K2SA 3UXKA 4DN1A 3SN1A 3V3WA 3NXLA 3R10A 1FHUA 1PDYA 5BOFA 4DXKA 1P43A 2QJMA 1EC7A 4DX3A 4E4UA 3PK7A 4HCDA 3DGBA 3P0WA 3V5FA 3MKCA 2PMQA 3RCYA 3RITA 4IP4A 3EKGA 3MZNA 3VC5A 4Z1YA 1W6TA 3THUA 3BSMA 1DTNA 2I5QA 3DESA 3QKEA 4MMWA 4IZGA 2OG9A 4HNCA 4M0XA 5FJRA 1KD0A 3ZVIA 3I6TA 1SJBA 3PWIA 3I6EA 3UJEA 4H1ZA 3IJLA 1IYXA 3TJ4A 1P48A 2NQLA 2PSNA 4ZCWA 2GGIA 3R0UA 3SJNA 3ZVHB 3FYYA 2PU1A 1L8PA 2ZADA 3IJQA 1EC8A 5BOEA 1JDFA 4A6GA 4DHGA 1MRAA 4J3ZA 3OTRA 3Q45A 2PGEA 4H2HA 3TWBA 3UJRA 4GFIA 3TCSA 3TWAA 1KKOA 1JCTA 2PGWA 4KPLA 3FXGA 2AKZA 1JPDX 2QQ6A 3VA8A 3D47A 4M6UA 3OPSA 3OP2A 4G8TA 1TZZA 3UXLA 2MNRA 2HXTA 1XS2A 3MQTA 1YEYA 3MSYA 2GGJA 3P93A 3R0KA 3DIPA 4HPNA 3IJIA 4GGBA 2AL1A 5FJPA 3DFYA 3N6HA 4EWJA 1OEPA 3DEQA 3I4KA 4HN8A 2PU0A 4F4RA 4GMEA 3ZLHA 2PS2A 3GD6A 3OW1A 5IDZA 3SSZA 3QN3A 4Z17A 1SJAA 4IL2A 2POZA 2XH0A 3K1GA 2QJJA 3U9IA 1E9IA 4FP1A 4MKSA 3CB3A 3FVDA 2QVHA 2GGEA 3BOXA 3VC6A 3SBFA 3ZLGA 2FYMA 3IK4A 2OQYA 3UJFA 2OLAA 2PP1A 1R6WA 4A35A 3VDGA 2PCEA 1EC9A 3TW9A 4E8GA 3DG6A 1XPYA 2OQHA 4IP5A 2GL5A 4HCHA 4JHMA 3B97A 2P3ZA 1BKHA 4JN7A 4GIRA 3T4WA 1WUFA 4HCLA 2OFJA 3JZUA 2MUCA 3GO2A 2PA6A 3CYJA 1EBGA 3ZVHA 2PP0A 4IHCA 4GISA
chains in the Genus database with same CATH superfamily
1M3UA 2FZ9A 4NYYA 4WK9A 4JFSA 4LNYA 4JIRA 3VUSA 3UF9A 1JAEA 1VF8A 5TBOA 2PEVA 6CGTA 1OGSA 5FAJA 1Z48A 1Z8AA 2FPVA 4Q8NA 3IACA 4XUYA 1C7TA 3G8RA 3GX9A 3SCTA 2A7NA 3L5AA 3LPOA 1E51A 1J0YA 5KVIA 1UH2A 2ZVIA 1J96A 2G8ZA 4YVXA 1WOBA 3N6JA 2L5HA 1R9YA 2OYMA 4PH6A 4XZLX 2DVTA 3KM8A 4TX6A 1IZJA 1H0IA 1FEBA 1UBPC 4GKLA 4I6VA 4LGXA 1GQJA 1B3VA 4C1LA 2WV8A 5FEXA 3RU8X 1MO9A 1RM6B 2ZUVA 1ZJHA 4X9SA 2YOCA 3GAYA 5TAOA 3PG8A 4DUXA 2Z26A 3PAJA 4ROQA 2PPGA 1KWKA 2E9BA 3NVVB 4PCSA 2IKIA 3QY6A 3BV7A 4U28A 1Z32X 4AIUA 3GTIA 1UUQA 2PCQA 3WJWA 3LK6A 1TWZA 2ZA1A 5D02A 2EG6A 4HTBA 2G3FA 4JTLA 4YN5A 3LHUA 3STPA 1JL8A 4ALDA 2VEMA 3B3DA 4RDWA 4C5ZA 1IXPA 4JTIA 4NZ5A 3ZMRA 3NG3A 1G4SA 2EQ8A 2E25A 4PUDA 4K7VA 5F1UA 3O16A 4MZ1A 1MI3A 4J3SA 4TVDA 1NWRA 3ZJKA 4BF9A 5C55A 2VD8A 3VCNA 3C4UA 2Y0FA 3EMQA 3CZEA 4YHEA 1H2IA 3T2QA 3G1SA 1A50A 3O0HA 1PYFA 4KEMA 4LS1A 3KUMA 4KWSA 4A8IA 5ABFB 5BRBA 1LBMA 4ML4A 3TC6A 1UR9A 3WNLA 3QV8A 1ZP3A 4GC4A 2C6QA 4I5XA 5J04A 4P8WA 2P8BA 4NF7A 3ABOA 3ID7A 4AWEA 4OV4A 1OVDA 2WXDM 4FMVA 1CLVA 4X0NA 2VFIA 3PB2A 3GR7A 3DFNA 4I9MA 5ER0A 1QJWA 1MUCA 4AZCB 1WDRA 1GVQA 4FF7A 5BXTA 5A8PA 1X6UA 3U3HA 2A6NA 1CT5A 3WLLA 4O12A 3WLQA 3E2QA 5DMYA 4XZIA 1ONEA 3OZOA 3B04A 4C1NB 1PSCA 3W87A 3CZGA 4CUCA 2Q6ZA 3KBWA 4FXSA 2O92A 2PODA 2V5BA 5D03A 4O16A 1GTHA 3NQBA 3QRHA 4N9BA 3RM9A 4KWVA 2J9XA 4B5UA 2D69A 2P10A 4MYXA 2PFHA 5GVJA 3AMZA 3V3WA 3W28A 3R10A 3EBVA 3H53A 1PL9A 4ZOAA 3INPA 1LOQA 4NYUA 1Q6QA 4NILA 3BWWA 2ABBA 1HVQA 3HRDC 5BXRA 2PRLA 3PJUA 3BAKA 2DP3A 1HUVA 1UPPA 2R9RA 1PBGA 3NJ3A 2CHNA 3WBWA 2QCDA 3SRFA 3WQ5A 3SCQA 2VMFA 4FA3A 4JCLA 5BWAA 4QDWA 3L2IA 1OCJA 3MZNA 5CC5A 3M6DA 3WY1A 2VM8A 1DTUA 4P7LA 4HMEA 2F6XA 2V69A 1PJ9A 4Y6GA 1EJUC 2FFCA 3QGVA 3VIIA 3VILA 5BXPA 4WKFA 3OU8A 5CSYA 3ONBA 1L2QA 5M3WA 1I2NA 3AJ7A 2X8HA 1EJXC 4TX8A 3VD3A 1KGWA 3QZ6A 3UCQA 1KFKA 4I8DA 3AUOA 1W2VA 3II1A 3U7BA 3VGEA 3U2ZA 5HMSA 4H50A 3W0KA 4L4PA 1B4KA 5CSSA 3L5OA 3S5YA 3ZJ6A 1TPDA 3VNYA 4LB4A 3ZT7A 2PWFA 2NV2A 1WP6A 4JTGA 4Y90A 1UKPA 1K7FA 3BAJA 4CU6A 1XHCA 2QUVA 2A5HA 1JD7A 1DWGM 2VFGA 4NZ3A 5FS6A 1TWSA 6REQB 2G3MA 1GOKA 4O10A 1CX9A 2CLKA 3N1AA 4KERA 5BRPA 5T9BG 3R0KA 5I09A 2AAAA 4EWJA 3H22A 3DEQA 2PU0A 2YLAA 5DELA 2E09A 2WZIA 2Z27A 4P7NA 1SM9A 1W3HA 2OX1A 4O53A 3CTLA 1FOBA 3IUIA 4Y9AA 2OTDA 3CB3A 3FVDA 4B90A 3VDHA 3VAVA 1V3HA 2R82A 3V36A 3VC6A 2WZMA 4B91A 3VDGA 3SSJA 5H8MA 4GHRA 1GW9A 5C9UA 2YL8A 4LF1A 5I2UA 1HKVA 2CBJA 2OQHA 3O7UA 2NXIA 4W93A 2YA0A 3MYPA 3HGJA 4WJEA 4EOUA 1F05A 3MCOA 3U2OA 3U48A 2D1ZA 1GRBA 3MO7A 1NHSA 3LY0A 1TA3B 1Y65A 3VX1A 4GISA 1J93A 1WXZA 3BQ6A 4PFMA 1D7YA 1TE6A 3CIXA 3BCDA 3M0JA 4LQ1A 4H6EA 2WMHA 4JGDA 3CQJA 3RDKA 3WK3A 2VZVA 5EU9A 4V33A 1QPKA 4MPQA 2DFAA 1TJRA 4JYDA 2AQOA 4IMAA 1FTXA 1N8FA 3QPEA 5E93A 3F4CA 1EUNA 3MUZ1 5HNNA 3NZ1A 3LCGA 1FCQA 3GM8A 4O8AA 2BXZA 1TO3A 3HPZA 4NX5A 2Q3OA 2W61A 4HJFA 3UG5A 3LGGA 2J7DA 3TTEA 2WMKA 3R7MA 1UD2A 2QUUA 5A6AA 3E49A 4LRSA 3WIJA 4D1JA 1XSIA 2CKSA 1CPUA 4HNOA 1XD0A 1UUOA 1KM0A 1TG7A 4A29A 4UTKA 1QI5A 1FXPA 1CGXA 4J40A 3CUXA 1YPXA 3VD7A 2WOIA 3LQGA 1WXYA 3WUGA 3IGUA 3UCCA 1EA9C 4PMZA 2Z0IA 1J4EA 2GUBA 3V1HA 1VPQA 2BHZA 3USBA 2CHRA 3PBWA 4GJJA 4IM4A 1C92A 2QCGA 3GXDA 1VRDA 3CAKA 3TXVA 4K36A 1MQPA 3LCFA 3OBEA 4PCPA 3CPRA 2HE5A 1FBAA 1O5RA 1C8XA 3TC3A 1PCKA 3QLDA 3A24A 5K3VA 1B3ZA 1FCVA 1VPYA 1G9HA 4BI6A 3QC0A 1TE1A 9RUBA 2DV0A 4LPCA 1S5NA 3JUGA 4S3FA 1V3JA 4LNCA 4B2DD 2Z1XA 4LY4A 1CGWA 1OD0A 3GNPA 1F8IA 4P7RA 4PMUA 5C9RA 3KL0A 4V28A 4AQLA 4ATDA 1G0CA 2ICSA 1ONRA 1ITQA 1TYPA 3UEQA 4LS0A 4TOQA 4H6QA 1A4LA 3UPBA 2F7FA 4QCFA 3EWWA 4CVWA 1GVIA 1T41A 5D9PA 1L2UA 3W25A 3N4EA 3DI1A 1E4NA 1CGYA 3APGA 3EXRA 2V2CA 3CXOA 1KBBA 2Q8LA 3BARA 3P0XA 1LP6A 5I78A 3UJ2A 3AZRA 4ZXOA 2OGYA 4HNUA 4BQ3A 4R7JA 4W8BA 5AKQA 5I3IA 3WUEA 4G9PA 1WOAA 2Z6JA 3G1FA 4N9CA 1TJ0A 1LLOA 4O50A 5BMWA 4ML9A 2VR5A 2ABAA 3TQPA 3PTDA 2EJ1A 2PTXA 3ES7A 4K2SA 3S2JA 3G0SA 1XV8A 3UZYA 4K8DA 3CHCA 4BK9A 3AIQA 1PHWA 3SDOA 3UESA 5DN1A 3RILA 4DO6A 3NQ2A 1UD5A 2BODX 2QPXA 3BZGA 5ABFA 3LZ3A 4GFSA 4E4UA 5JH2A 2GDVA 3UPMA 4LANA 3AU2A 3DGBA 3P0WA 3QVQA 4BQ4A 3EZ4A 1TZ7A 1HP4A 1VRXA 1S7MA 1KM1A 2NT1A 1FX6A 2J7HA 1PKLA 1BYBA 3TV8A 4QDMA 2C0HA 3GVQA 2D20A 1N8WA 4LUSA 2J6VA 1TYGA 4GWEA 3L0NA 1A0CA 2V5KA 2DUXA 5F2LA 4WY0A 2YL6A 4AZCA 4WD0A 2VX7A 1W8GA 2XPKA 4GVHA 1IT7A 5C2XA 2GGIA 3MDWA 1HNYA 5GJPA 1JDCA 1TRIA 4UTJA 2V5LA 3ARQA 1JEZA 4HNNA 3LRMA 3URNA 4MIMA 3CL6A 3ONCA 5E70A 4DNHA 1MXDA 1JZ3A 3OTRA 4C1NA 1K7EA 1ZGDA 1NFGA 3C0LA 4GQBA 3K5XA 3W7RA 4ECLA 4GUIA 3ORWA 1TVNA 2Y4SA 2IQTA 3CWOX 3N11A 3CZ8A 3OJGA 2XFFA 4DF2A 2G50A 5G2HA 4S2CA 3OP2A 4MZ8A 1QAPA 5F1VA 4TX9A 4J9JA 3CASA 1TZZA 4H8VA 3OVGA 1H09A 3TUUA 3KRBA 4Q8QA 1ISZA 1H1YA 1OFRA 1XCWA 3O6DA 4AWSA 4PUKA 2AL1A 4AEEA 2O4MA 1WE5A 3LBCA 4MNMA 1W56A 1P0BA 2E5DA 5D04C 4F4RA 1TPWA 1J6OA 3DHFA 4GBUA 1PO9A 3OW1A 3UR2A 4Z17A 3UYIA 3M0XA 4R3UA 3W7HA 2ZUTA 3FYPA 1Z6KA 3EOEA 1Q5MA 1T40A 3DK4A 2R1PA 3UJFA 2OYKA 2OLAA 2PP1A 4BCEA 4HHHA 4F0HA 3N3TA 4JICA 4ZFCA 4MWAB 4TV5A 2GR2A 1SQ7A 5CSRA 4EIVA 3R8RA 1V02A 4HA1A 1MQRA 1YNPA 2GL5A 1PWMA 4Q8VA 1OHLA 3B97A 3KE0A 2WMIA 4EP8C 1W9DM 1W3KA 1O7AA 2BY1A 3T4WA 4KWOA 3Q67A 2B0MA 3BJFA 2TRSA 3GO2A 3A23A 3FY1A 4GZEA 4AVOA 1BG4A 4IPIA 1ZRQA 3OQ8A 4W7VA 3T40A 3O63A 3GVWA 4JFWA 1MFUA 7REQB 1RCXB 1HFBA 3A3XA 3PP7A 4H7ZA 1O12A 3HURA 1XD1A 2FZDA 1VCVA 2QJGA 2P5NA 3PBVA 4E3VA 3FJLA 4A3UA 3BSHA 2YB1A 3QMRA 1NDWA 4W84A 1S2VA 2WOVA 2LLEA 3N17A 4AZ7A 4GYPA 1DHPA 3MWCA 5CH9A 3GXMA 3FGCB 2E5AA 2ZYFA 1XWYA 2BV9A 1AH3A 2Y7DA 3UW6A 1TPB1 1GVOA 4FOKA 3H2OA 2E28A 5I3GA 5IFPA 3HQ1A 3ATYA 1PS9A 4H4ZA 4V2XA 5FAGA 1YHTA 3OHIA 2VEPA 1FHDA 2VC9A 1RVGA 3LXAA 3BOLA 3S5OA 1AH0A 2OLSA 1TR9A 8RUCA 3ZLFA 3MC5A 3FV9A 5HATA 3P84A 3BJSA 3VDCA 2V38A 3FJ4A 3HV8A 1UWUA 1EEPA 4Z2HA 2G5WA 4Q6JA 3E0VA 3RNMA 4WJ8A 2OYLA 4DZAA 2I9UA 1BD0A 3OVRA 5FD0A 4DWSD 1SFSA 2NT0A 3WLPA 2Q71A 4XBJA 1IXQA 1Z9AA 1IR2A 1MFVA 4EE9A 1TA3A 2NVDA 1B3WA 1X38A 1G1YA 1DEDA 4GK8A 4DEFA 3NSMA 3NGJA 1W54A 3R25A 1B9ZA 2EKCA 2RDXA 2J9ZA 1RQEA 2XIBA 3W82A 1S2UA 3RNDA 3PJWA 1XICA 3EWZA 2WPBA 2Z1VA 1I75A 4ERIA 1K6WA 2D0HA 4O17A 2GVJA 1S1RA 3V0TA 3RGTA 3UY8A 3D3AA 1LJYA 1LUCB 1QT1A 1FDYA 2WB5A 4FF5A 3EDDA 1KWGA 3T1GA 4HPHA 2X99A 3D46A 5DCEA 3AIEA 1Q6RA 4LAZA 3DJJA 5FS8A 4V27A 3HM7A 2E1DA 1I2PA 3QV7A 1W5MA 2QS8A 3KP1A 4QIUA 1TPFA 4NZCA 5LA2A 3W22A 3BC9A 2XG9A 4LF2A 3QW3A 1I8JA 1BG9A 3UBPC 1TMHA 2Z2UA 2B81A 2QNEA 3VM5A 3NQFA 4GIEA 2WJFA 1OZMA 4AZ6A 4DJFD 3M9YA 4PTDA 3VNIA 4PTMA 4HT3A 4UCFA 5CZ0A 5HMEA 2QGHA 3AHYA 3LU2A 5A6LA 3S1XA 3EXSA 4HA0A 4ADTA 3MHUA 1FHLA 4XD5A 3WENA 1UKSA 1JFHA 1XLMA 2NXHA 3K2GA 4QTGA 5TF0A 1ISXA 1QWGA 4PTNA 1HO1A 3WF4A 3W01A 1E6RA 3QFWA 2E6AA 3H7RA 3CJPA 1XDJA 3OLDA 4X61A 4UTLA 3CV7A 3VVGA 1S5MA 4ZOBA 1JRBA 1LLWA 4O15A 1JXKA 1KGXA 2FDMA 1V03A 3H2EA 3REQB 2QDDA 3F2DA 1DIEA 2PTYA 2XH4A 4MNKA 4HBKA 3A6OA 1X8CA 1R9XA 3R13A 1E9ZB 3WD1A 3MSGA 1H7WA 3AHVA 1ZX9A 2QCLA 3T2OA 1JF6A 3UR5A 4U10A 1KCXA 3ABZA 4QHRA 1KV5A 3TYCA 2NLIA 3M7WA 3URAA 3LCHA 4H04A 3GG1A 5BMXA 3W2LA 2HE8A 3HGSA 1Y5XA 1VB9A 2DVXA 1JCNA 3SY1A 4ZQPA 2DSUA 2GVGA 1JUEA 3CMGA 4UUIA 1EOMA 5E0KA 1LRQA 3U8GA 2ZTJA 1DL3A 4Z2JA 3THUA 4UQEA 4G1KA 4MY9A 1JRPA 1ZNNA 5JCLA 3N2TA 5F4XA 2Q3RA 1POJA 4XSLA 3VIJA 3WYZA 3JZEA 4LU0A 3TYEA 4I6KA 1SJBA 4HNTA 4MJMA 4L65A 1RK5A 3ALGA 3GH7A 3RRXA 3N2BA 2XWEA 3AU6A 1ZAJA 5LXXA 4RZBA 4AEFA 4DZHA 2JK6A 4M81A 4FIQA 2PBOA 1Y5WA 1M7PA 2FGLA 3M0HA 1KTCA 5DX7A 1EJ7L 4IGSA 3WSUA 2E1WA 4YHGA 3R6IA 1BVNP 1UBSA 5ECVA 4XV0A 2WSPA 2V6OA 2R8WA 4GFIA 1W2PA 3UXDA 5F7UA 3MVIA 3KTXA 1VR6A 2QQ6A 2AOSA 4PC8A 1C9WA 5JVLA 5IM51 2ZA2A 4FLOA 3QGAC 1C93A 5BU6A 1ZBWA 4Z0JA 6PTDA 1Q4WA 4DM2A 2WQDA 3FS2A 1SZGA 4GKTA 4TVUA 5B7YA 5LA0A 5LZLA 3PG9A 1B3YA 1GOIA 2QAFA 4S3AA 1F2JA 1RHCA 3QFBA 3DFOA 3GD6A 2ZDSA 4IUGA 4CCEA 2CBVA 4WJXA 2VWTA 3EDJA 3NA8A 2XFRA 1XG4A 3WQFA 1ML1A 3GXNA 4ZQNA 1H49A 1HT6A 3GBDA 3MKKA 4QEHA 4WDTA 1E9IA 2W63A 5BZAA 1H61A 1LRTA 4MG4A 2CNCA 4RUBA 1T7LA 2Y62A 3ZLGA 1E6ZA 3HV9A 3FYOA 4JTHA 4AZGA 4Z2IA 3LDVA 5REQA 3CV6A 1JYWA 2WO5A 1X98A 4FOUA 3H21A 1HL9A 3WLOA 3E0FA 3VYLA 3TW9A 3CGEA 2XYLA 1HKJA 1VCGA 3VIGA 2DPEA 3P61A 2C1GA 1H4PA 4D8AA 1VBGA 4MVAA 3GU1A 3KBSA 1JZ4A 1F74A 2B7OA 2Z4GA 1FXQA 4WQ6A 2HVNA 5IXEA 3AS1A 4HK6A 5EMKA 4IHCA 3SGGA 1A5CA 5FJTA 4EVZA 5J8LA 4JFTA 4Q4OA 3RPDA 4NEVA 1LCOA 1P5BA 3P3BA 4O28A 4IFOA 3S2CA 3QV9A 5T26A 3V18A 1I4NA 1ZJAA 1UWAA 3EMZA 3W4RA 4AIOA 3LX9A 2AL2B 1XL9A 1CB7B 2EPMX 4H4PA 1UR1A 2I5IA 3CO8A 1WAUA 2XVNA 1XGZA 1L6SA 3WLRA 3W1PA 3B8DA 1REQB 2CLLA 2GQWA 4L9XA 3QZEA 1R8LA 1B0IA 4UQ9A 3CGCA 3AZTA 5F2MA 3BGGA 1JCXA 2GQ3A 2A3BA 4UTTA 3ZO9A 4LV4A 1QW9A 5B80A 4O1DA 2FJKA 1KXTA 3VD9A 1K8XA 4IMFA 1O5QA 1WPCA 3QF0A 1VYRA 1W1PA 3HB9A 3CUFA 4QG8A 1O6IA 4D6GA 2XU2A 5KSWA 5TQLA 4JY8A 4DJDA 2W62A 4LVFA 3IV3A 5CC7A 4MWAA 2WC4A 5I3KA 1AD4A 4U4MA 3P14A 3GSMA 1GHSA 2XH2A 2Y24A 2RUSA 5FESA 4RKAA 3A7RA 1VD6A 1F3PA 3VOGA 3M41A 1PX4A 2W6RA 1PIIA 1QHOA 4NNCA 3S42A 3L9CA 3SGZA 3VK5A 1V97A 4DB7A 2Y5EA 4EANA 1IEXA 3E2VA 3R0DA 2VC5A 3L7RA 3T44A 2YW4A 1RV8A 2FZMA 1R3YA 4XK2A 3FLUA 1YTEA 3CHEA 3KRUA 4FIRA 1W3LA 1STZA 2PDLA 5HR6A 1J0HA 3EPOA 2C16A 3GKAA 4J3XA 2QJNA 3B9NA 4OIFA 4TV6A 2YL5A 2J77A 4MB1A 4GOAA 2V5CA 4JN8A 4UFMA 2Z1WA 3CLMA 1W3NA 2PD5A 4E6MA 5A8QA 3FGCA 1E4MM 4GI9A 3T6CA 4HNVA 1XLJA 5G2IA 1W9PA 4PSPA 3C2VA 4Z2LA 1FUYA 1WBHA 2VO5A 4XD6A 4I90A 5JH1A 4YWOA 3KX6A 1HX0A 3LHTA 4CCDA 1HW6A 4CD8A 1FWCC 3TA9A 1AZ1A 2WQPA 3AIUA 5A6BA 3VUPA 1TV4A 3DHDA 3U4AA 2CFYA 4GVIA 2V81A 2R91A 3UG8A 1ITUA 2P88A 3VKCA 3VPLA 1S2AA 3GG8A 3H7VA 5ABGA 4J57A 3O1NA 5AZ1A 1R3VA 4ZTXA 3O0FA 3STFA 4K7ZA 1JZ5A 3GHRA 2NVKX 1HJSA 3G1YA 3U6WA 2QUMA 1Y8BA 5K9DA 1FCUA 3CH0A 3EF6A 3OLEA 3MMDA 4PR4A 1ADOA 2DJLA 3VIOA 2ISFA 5A1AA 4GCAA 1ITXA 1Q65A 3HFTA 4DBEA 4C6JA 3GE7A 5LYRA 2NPXA 1H5VA 5HJXA 4DN1A 2XVPA 2WVUA 5I07A 3C56A 4AD2A 1MYRA 4MUPA 4NAEB 1L6GA 4LWWA 2QDHA 3W7MA 2IPGA 1J18A 3VKBA 3E0IA 1LUCA 3SGUA 3W26A 3A7UA 5JUVA 5CKSA 1FWEC 1UD8A 2CLEA 3D5HA 5KETA 1TPEA 3QBUA 3ZT6A 4HK5A 3SW6A 4QX4A 3VFLA 4DY1A 5ECUA 4HZ6A 1OFEA 3S1UA 4IGHA 2ZRYA 4HZ8A 3ISIX 3N2CA 1TTJA 3FHQA 1JDAA 2WZHA 3TYZA 4LBRA 5HNRA 4LVAA 4RCXA 1RA5A 1FWDC 3CWNA 1XGEA 2Y2WA 3W2KA 1AQHA 1H0GA 1R9ZA 4QJ1A 4O4WA 4LRTA 1TUXA 4J3VA 1W9XA 3R0UA 3B0PA 4JR5A 4A3HA 1XIIA 4C6MA 4N2YA 4UTTC 2XVLA 3ATZA 2PU1A 1FH8A 3LM7A 4JYFA 3IJQA 4DPQA 4V1YA 1EC8A 3PTKA 3VXGA 2C3CA 4NVTA 3GDKA 2QLYA 3TWBA 4H7VA 3WH6A 1YX1A 1VEPA 3OB8A 1V6UA 1I1XA 3L4VA 4Q4RA 2W79A 3IEBA 3TYBA 4RZ6A 3R58A 3REQA 4HSNA 1CXEA 4P8UA 4UFJA 4MWAC 4EPEC 2BGSA 4GH3A 3EUB3 1F6KA 2JKAA 4WRHA 3VKKA 3N9RA 3PC0A 3WD4A 5D2YA 1RQHA 4BEQA 3GRIA 1AH4A 3L5MA 3WG6A 1EFZA 4MZYA 4W4QA 3DU0A 1PCWA 4GMEA 3SSZA 3ARRA 3MANA 3JR2A 3WBAA 2VZSA 2CLIA 5DF0A 4L9YA 4HPGA 3N14A 2IKGA 2XSAA 1CBGA 4NAFB 2Z1KA 3VZXA 3SBFA 3H4XA 3Q94A 1SB3B 4G6CA 1F3XA 2VI0A 1R6WA 1Z7AA 3FN9A 5A6SA 4M82A 5D2TA 2I56A 4US6A 1TRDA 2PCEA 1EX1A 4FNTA 1N60C 3VD5A 1PKNA 3C2YA 4TMBA 2CITA 1NWSA 2QT3A 4XVEA 3W07A 1BKHA 4JN7A 4FAMA 4ZQMA 5DANA 1K1DA 1B90A 4CQDA 5MHBA 3VGDA 4E2DA 1FWGC 3IAQA 4PRWA 3CIVA 1P0DA 3WH5A 3I10A 4NZJA 1ZZMA 2OU4A 5IDIA 3UGVA 3UVIA 2PGRA 4CN1A 1H11A 1L6FA 4ZENA 3CHVA 3QTPA 4B15A 2WNQA 4AYGA 1OC5A 1QOPA 1WAWA 2XWDA 2VZOA 1CEOA 3LHYA 3QOKA 1S3TC 4D71A 1B1YA 1WKFA 1KM5A 5K2ZA 4K37A 3T2PA 4HNLA 2E5CA 2OX4A 4MJ2A 2ANUA 1RVKA 1K4HA 1YQZA 4OOUA 3FFSA 2ZX8A 1E9YB 4IH3A 2XFWA 1DWFM 3T8LA 1FKWA 2VKZG 2YDAA 3W7IA 3PZGA 1LWJA 3GNXA 5FJOA 3B9JB 4S2BA 4GRSA 2HROA 4ZB0A 3NQVA 1OF8A 3C8FA 3WBYA 4IX2A 3GQYA 5AECA 1VBHA 4J2PA 4AZBA 1YDVA 2CWXA 2GVYA 2X16A 4L1GA 3G5EA 1SZEA 4KRUA 3WDJA 4XTDA 1SO6A 1UMLA 5HNTA 1KGUA 5AYXA 4FSAA 3GVRA 1OFDA 3II4A 1QNSA 2OT1A 3RR4A 2EPKX 3F7JA 2CBUA 1Q6OA 3SEPA 3QY7A 4NZ4A 2I14A 1JFXA 1UZHA 4HU0A 4L4LA 4ERGA 1VP5A 5L6UA 4INFA 3PR2A 4XD4A 5I24A 2WVVB 4XKYB 3OGSA 2I7GA 3R4IA 5FF3A 4M7TA 4DWDA 2C7FA 1XLEA 3RLVA 3GNRA 2PDBA 4GNVA 4S3CA 4QNEA 3GHTA 1W9VA 1V3MA 4ICCX 2RGLA 2AL2A 1TR1A 4MF4A 4DWSB 3T05A 3QR0A 4C7GA 1TV3A 2F2HA 3V0SA 1XC6A 4WUIA 1E5NA 2R1LA 1REQA 1RQBA 2ZXDA 4MKNA 3H8AA 4JTAA 3M46A 4KWUA 4RE2A 2Q8XA 2FH8A 4GX8A 1VCFA 2PDNA 3ZYZA 4D6DA 3TIMA 3LBOA 1IR1A 1ISYA 3SQSA 4GC3A 5BOOA 3AWOA 1QI0A 4K1GA 3K4DA 1UJPA 4F2TA 4YMZA 2PZNA 4ZTYA 4JIQA 4JFVA 3CXBA 3B40A 3E74A 4IWWA 4BR1A 3IIVA 5EFDA 4LTSA 4MGGA 2HTMA 4IPLA 5FEZA 4B5SA 3VCCA 3RX2A 3THCA 4GUFA 4WY0F 1KCKA 3LLDA 2XH7A 1B30A 1GQKA 1ZBKA 2BBFA 3HG4A 4GPNA 2X7VA 5XIMA 1GQLA 3W7DA 5KINA 1UC5A 2C15A 4Q6XA 1GTEA 2V9DA 3V4BA 3IAPA 2P0OA 4Q22A 1AL8A 3P67A 4YTQA 2VOMA 1N61C 1GVYA 5BCAA 3P74A 4LSBA 3LLFA 4LUIA 2GSHA 1GOXA 2VGGA 1ONWA 1OC6A 1AQFA 1US0A 1TJ1A 4Q4QA 3S83A 4XZ9A 3CWHA 4OKDA 5KZDA 1FVPA 5EB8A 3CGBA 4EQXA 4NU7A 2QF8A 3CM4A 4BV6A 3QM3A 3L8KA 1N63C 3DGHA 3EAOA 1PX8A 2QDGA 2ZE0A 1GERA 4US5A 4UTIA 1YTKA 2ACQA 3GKFA 2P53A 1V0KA 2WOWA 3CQ0A 3UZJA 1W6TA 5CPNA 3RUBL 4RV3A 3LB0A 2XN0A 4IZGA 1D3HA 3H4WA 2DZPA 3S6DA 2YQUA 3NURA 4EQSA 3RX4A 3SM0A 2OEKA 5T9CE 4B3KA 2V3GA 2WNZA 2PLCA 1E6QM 1E6NA 3WF2A 3PN8A 3QPYA 1V4YA 2XSBA 4A2SA 4Y2WA 2H9AA 2NQZA 4PUUA 2WBAA 3ZVHB 5EFFA 1DWHM 2G4FA 1HIZA 1E1CB 3D6NA 1L8PA 1ZCCA 2Y85A 4PBEA 4YS1A 1BF6A 1MWOA 1Q6GA 3H2AA 3NZRA 1IXOA 1CTNA 4H2HA 1K6AA 3QHMA 3CQHA 3FW6A 3EB4A 1ZU8A 4PMQA 1RALA 4NEWA 1RXOB 3CLWA 3W1NA 1EXBA 4HZMA 3U7VA 2REQB 4M6UA 3HPSA 2UWFA 1OF6A 2WANA 3KDNA 1RBOB 4XZWA 5I3FA 1H1NA 2C3DA 3N3MA 3G1HA 4PE8A 3IJ7A 1ICQA 3A47A 4KKXA 3JRKA 4QEEA 3VINA 3DC0A 4L80A 3BSGA 2FH6A 1RPKA 5JBEA 3T08A 1KFEA 3MTWA 3LNPA 2E9MA 2Q8ZA 5AVNA 3W9ZA 3VNZA 5D37A 1OX5A 4Q4SA 3G1AA 4PB5A 4IQLA 1YRRA 4JQ3A 3A9IA 2V2DA 2VGIA 1P0NA 4NI8A 3LENA 4C1KA 4Z1AA 3W74A 1UOZA 1FWFC 4OZOA 3KTCA 1TWIA 3QSTA 1H7XA 4LXFA 4ACYA 3M0MA 3R94A 1LPFA 3W7QA 5EMJA 1VJSA 2C79A 2ZRWA 3S8HA 1EYWA 1XPGA 4ZE5A 2C91A 1TCDA 3D0CA 4GUGA 3NRZB 4TVCA 4HGXA 3IUDA 1BZLA 3R5EA 2BCPA 1GORA 3TDFA 2W66A 4EM4A 1AVAA 1THFD 2QIWA 2V67A 3P5YA 4CNSA 1ICSA 1KM2A 1UKOA 2H8XA 3S9ZA 2DT1A 3S3GA 5LHFA 3W02A 3VOIA 4HK7A 2NQ5A 4C91A 2HK0A 1V7AA 2JALA 1YDOA 2QHAA 2VFEA 3MW7A 2YZRA 4FOJA 3WDQA 4L6HA 2OO6A 1GZGA 4ICNA 2FTPA 5G5GB 1WQ5A 1O60A 3AC0A 3BAIA 1A80A 2PLMA 3PS7A 1GV4A 2YBUA 1QPRA 3BGAA 2ATMA 5LIXX 1TKKA 2YVGA 2ISDA 3VNDA 2ALDA 3AALA 1JPMA 1V02E 2QJIA 1K03A 3LXCA 3ETRB 2BASA 2ASHA 3BMXA 5CPMA 4Q33A 1HJVA 1XLHA 4D2JA 4UNIA 4NAFA 2VDGA 2PDKA 4IFKA 4JIEA 3EOLA 1KBLA 2VDHA 1XGDA 3UCDA 1ECQA 1UC4A 3PNZA 1HKWA 3AUJA 3PAOA 4IQJA 1MXGA 4PCFA 1UZ4A 5BNKA 4TR9A 1UB3A 3NDOA 2P8CA 2WBGA 4Y8EA 3B8WA 1JGMA 2J9YA 4QLKA 2O7QA 2DJXA 3NZPA 3FEQA 4Q8OA 1R47A 4PL2A 4DUWA 1TX0A 3RXZA 3QXBA 1ALDA 1GCYA 1FFUC 1H5YA 2E6YA 1EHAA 3MDUA 4J35A 1QWKA 1UHVA 3O9NA 3FAWA 1DQWA 2OMAA 2WCGA 1XIMA 3M0ZA 4YWSA 1HKMA 4BHYA 5J5RA 1DIDA 3DC8A 3PM6A 1ISWA 1VBRA 2D0FA 3TCEA 1OQFA 2VTFA 3OIXA 4MB4A 5IRPA 3B8IA 3RJYA 2JKEA 3TAKA 4HOWA 2VC6A 1TB3A 2VNCA 3TLQA 1JR1A 1GJWA 5D8WA 2JF7A 4A22A 4O0QA 2VGBA 5TR3A 1DIOA 1SO3A 3SUTA 2GLKA 2G97A 2BY2A 1R0MA 2XISA 1LG2A 2DZVA 5JXQA 1XIBA 2QVNA 2HS6A 3AO0A 3PULA 8A3HA 3WF3A 3L4WA 1JD9A 2ZWZA 4PMDA 2F2KA 2OO0A 1FEAA 4YNGA 3L2LA 4UNKA 2PDYA 3T81A 4ZSUA 4RV8A 1HVXA 3NQEA 2VHLA 5HNUA 3Q65A 4C6OA 1ODUA 2G3NA 2XSXA 4AZ5A 3A4AA 4JTSA 4IG2B 2CZDA 2QIIA 3Q37A 5E0CA 1NAL1 1YW1A 4K8GA 1WX0A 4NSBA 4LV9A 4KGLA 2ODOA 5H8UA 1FQ0A 3WJSA 2BG5A 3UXKA 3AFBA 2X1UA 4GA8A 2B7PA 3TN4A 5G1TA 2D24A 2PDIA 4ZQCA 5BOFA 5D30A 1CXFA 5AYZA 1M01A 4AU0A 2QJMA 2JF6A 3WBEA 3AMGA 3IANA 1F5ZA 2E4TA 3W7GA 3EB2A 4HCDA 4O0ZA 3RPMA 3PBYA 4ATWA 3N9KA 2YW3A 2ZUSA 4UTWA 3RITA 3TQ0A 3WD0A 4CKQA 3HMCA 3PZUA 4C60A 2CZEA 4C7DA 3TSMA 4Z1BA 1FH9A 3QQ1A 3E9AA 3TW7A 1EA0A 2BVYA 3HMJG 1OWQA 3F5LA 1V0MA 1EDQA 5BROA 4I3GA 3NOEA 5AC6A 4H1ZA 3B0UX 1GNXA 4K8HA 1XLLA 1P48A 1QPNA 1LYXA 2ZXQA 2RKXA 1UH4A 3VMOA 2XZ9A 1BXNA 3GXIA 3AZSA 3EX2A 3UWUA 5T8GA 5HXMA 2DDXA 2E40A 3LI0A 3G1VA 4UQBA 2CZFA 1BFNA 3WMCA 5E9AA 1KLYA 3S6TA 2QR6A 3UA3A 4S3BA 3BOFA 2W0HA 1MW0A 2WNWA 1Z3NA 2TSYA 4X3ZA 4Q32A 3APTA 3MT1A 3PPFA 3GDMA 5K4XA 5A8GA 1QO5A 4DLMA 4QXIA 3QEZA 5A8OA 3NQ7A 2OSWA 2MNRA 1K4GA 3MQTA 5HPOA 1ZBVA 3IJIA 2JFEX 4AUBA 2EGZA 3BPWA 4UCGA 1TVLA 3I4KA 4NNBA 2GVLA 4DO5A 3CO4A 4JHZA 1E15A 3NR0A 1UG6A 4JKLA 1MVYA 4Q7IA 3MO4A 5DQPA 3WLJA 1RJQA 3P6LA 3LERA 4F2BA 3TA6A 2QJJA 2AMXA 1HXJA 2PGFA 1U33A 3AMLA 1MW2A 3F5JA 4YTTA 1DNCA 3TFXA 1TQJA 1XIHA 4UMBA 2WKGA 3GRSA 1XQKA 2FB2A 4LB3A 1KBJA 1E1EA 3IIXA 3UZWA 3RMEA 3UWEA 4HP5A 5BYWA 3S9YA 1XPYA 2AMGA 3OGVA 4IIGA 5M1TA 4FR6A 2KX9A 2NW0A 2INEA 1UR8A 4GIRA 3LXBA 1SFLA 3GYCA 3F4WA 4PTWA 2Z24A 5JIWA 3ZVHA 2YX0A 3GIQA 3VE9A 3TNBA 4JXCA 1I0DA 1GVSA 3TW6A 1OGGA 4YLWA 5M17A 2CESA 1HGYA 4GI4A 1CXKA 7CGTA 3WQWA 2ZQ0A 3TOYA 3TE9A 3EPNA 4GZIA 2QCDB 3CUGA 4UFIA 3BLKA 2E67A 2RAGA 1LORA 1JPHA 4OV9A 2J75A 4YIWA 1H50A 3IPWA 4MJZA 1XUUA 2XIQA 4GCXA 4G1NA 1WKEA 2QDEA 1EJSC 4N02A 4D8LA 3LRKA 5HMFA 3H70A 3M7SA 1E1FA 3HQOA 1NJJA 4U3CA 5FJUA 5CQ1A 3EX6A 3OC4A 1PWLA 1ZBCA 4AAJA 4ZQRA 5SWUA 4W9TA 4JPGA 4BJHA 1UQYA 5C2GA 4O18A 1FIQB 5HK4A 2TYSA 3VIFA 1DWJM 1AUSL 3BLOA 3DH7A 3P80A 3S47A 1YIXA 2VC7A 4NXSA 3TR2A 3SUUA 3BGJA 4PODA 5XINA 1WXJA 1XRSA 4H2CA 4UTUA 1MRQA 4DWSC 1Q8AA 2H90A 3L21A 1OFBA 2GYIA 3A3WA 4PUNA 2VEGA 2WWCA 3NEVA 1FWSA 4H9XA 4F9DA 1CXLA 2JK2A 4W7WA 2FDSA 3I7SA 1US2A 4NJHA 4APNA 4B3LA 4KCVA 3TX9A 3C2RA 4TIMA 3VDBA 1WZKA 3SY8A 1XYBA 4IJBA 4IIDA 2ALRA 3TYDA 1IHIA 2RH9A 3E2SA 4RW3A 5LNSA 3LTSA 2IUZA 1QDSA 3U4FA 1JI1A 4ZA0A 3ELFA 4FI4A 2ZZ6A 1SUXA 4LUTB 3CEUA 5M2FX 3PJTA 4RZ4A 4ZODA 7ENLA 1QW7A 3GH5A 5CGMA 2ZRVA 4BA0A 5CSUA 4MM1A 4S39A 5DXXA 1MEWA 4LCQA 1V7YA 1EBHA 1JDEA 2OXNA 4PA8A 4NRSA 1LL4A 4CD6A 5FI8A 4A4AA 1F6PA 1TV2A 1R2TA 3GS6A 5FIPA 3B8UA 2BGNE 1YE4A 1OJXA 2BHUA 3NL6A 2Q01A 2NWSA 4UQDA 3AJXA 2P1FA 6ENLA 5FCZA 3W1RA 4WOQA 5JIPA 1H62A 1NP0A 6TAAA 3AS3A 3BW3A 2O56A 4LVGA 3IRSA 1KC7A 3NFUA 4WSHA 3FSUA 2ZX7A 4P8XA 5FJJA 2ZRXA 3IV8A 2ZKMX 4JQ9A 1A53A 2E8YA 1KBIA 1J0ZA 4LYKA 2EJAA 1WDSA 1PZ2A 4HHMA 4FLRA 4B4FA 3AYRA 1T8XA 2ZUWA 2OPJA 4FLQA 3L66A 4W8LA 3GY1A 1I60A 4PMYA 4DJDD 2WSYA 4MWAD 4QE5A 1OK6A 1FECA 4UOZA 1DJXA 2BP1A 3C3UA 4RNJA 2YR1A 1N5WC 2ZZ0A 3SN1A 5A5WA 4DELA 1PDYA 1ZALA 4GYKA 4AD5A 3KAOA 1B54A 4MFDA 4DXKA 5AC4A 1XANA 1BWKA 1GRHA 3GVVA 2PF0A 3HTWA 1A5AA 3ZSSA 2J3NA 4JYEA 1J0IA 2WLYA 3AROA 2Y5SA 2H8ZA 3WLMA 2DZAA 3XIMA 3KRZA 5FKYA 4M56A 2PMQA 3EOUA 4CNOA 4NI3A 4IQDA 3QYQA 4QG6A 4IQEA 1J5TA 4Z1YA 2NSOA 1NQKA 1VBJA 3KDOA 1DTNA 1B9BA 5EGRA 3F2BA 1GJPA 1JULA 1VGAA 4MMWA 5LNRA 4EF8A 3L0KA 4M0XA 2HDJA 3EWYA 3S2LA 9XIAA 3UETA 1JOAA 1W17A 1I2RA 4DJEA 1EIXA 1IYXA 4OBSA 2NUWA 1S1PA 2X2GA 4HPXA 5CBIA 1CXIA 3WEOA 1F3WA 5IFTA 4LCRA 3SJNA 2Z00A 1Z41A 2HBVA 3FYYA 3DFSA 3USZA 3W76A 4AX6A 4XSMA 3MI6A 3LPFA 4F8XA 3G0XA 4L6OA 5A6BD 4Z1DA 1VBUA 3V5OA 1C7SA 5DT7A 4IG2A 2HPIA 4DF1A 5FSEC 5DMMA 4QLLA 2ZXAA 3ARZA 4LX4A 1FWBC 2VX6A 2WAGA 4S3GA 3S1VA 2DZXA 4RL3A 4TXEA 3OVQA 3DI0A 3UWQA 3NDZA 2EQDA 4FPSA 1W1B1 4AWTA 1KM4A 5C2CA 2XGIA 3ITGA 3G24A 2YBTA 3ALFA 2J8TA 2G0WA 3T0BA 1JZ6A 3EPMA 5GRTA 1BYAA 2EQ6A 5AHMA 2DT2A 1SFJA 1EH9A 4JS3A 5AYIA 2ZC1A 3ARYA 1OK4A 3TTQA 1XYLA 2HNHA 2DVUA 4FLSA 1J79A 3AYSA 1CENA 1H41A 1VFSA 1KFWA 2GUYA 2WC3A 3TLLA 2VCBA 1G67A 1OT1A 3KCOA 1R38A 3MWAA 2DU2A 4LS2A 4KESA 1X39A 1BYCA 5EBKA 2IQDA 4JL1A 4EXAA 4DXXA 2J4GA 1ME7A 3BVJA 2C0AA 1Q6DA 3KS5A 3GG0A 1N55A 1UA7A 3NM3A 4EAMA 4R7OA 3NM1A 3K30A 4C6QA 1LL7A 3BG9A 1H6VA 2BXYA 1UQZA 1S38A 2QPUA 1LG1A 1L9WA 2GJNA 5HJYA 2ACSA 3W73A 2CERA 3PZQA 2PTDA 1VFOA 4OJYA 3CMFA 5CEWA 2JBMA 3EA1A 1GW1A 1IIHA 2X42A 2R1NA 5FEPA 1W91A 2Y88A 1XBXA 7XIMA 3M5YA 2I1OA 1OYAA 2E6DA 1RD5A 4PGLA 1AL7A 1XXXA 3WFAA 4BURA 1KLZA 3DAQA 3DOPA 4C65A 2Q09A 5KTLA 4MAZA 3ITTA 2YFNA 3NQCA 1EX5A 3RM8A 4LUSB 1J8VA 1GKRA 1M41A 2NUXA 2V6AA 3NQDA 2VJXA 3QHOA 4YYFA 1MW3A 1SJDA 2QUNA 5CPTA 3W00A 3CAWA 4EKJA 4JX6A 4WY0B 4PMRA 1C8QA 2GPTA 4O8RA 2PDGA 3JW7A 1XI3A 2Y5JA 4Q3MA 3EA3A 2CHOA 4Y8FA 4M24A 4AZIA 4E8CA 2AQVA 4K8EA 3GTFA 3A5VA 1RD6A 1QHPA 3PZIA 1D3CA 4PCTA 1NF7A 1X1ZA 3QPZA 1GRFA 5JQ9A 3W7KA 3STCA 3GAKA 4UTMA 1U5VA 3HBLA 5FS9A 5HQLA 3T8QA 1IQ8A 1QFEA 2OODA 1BKSA 3AYTA 2Y8UA 4OU1A 1LBFA 2XM2A 3KWXA 2FKPA 1MDLA 1BSIA 1IEWA 3U2CA 2G95A 1P4CA 2DUAA 1OJTA 1JNDA 5C9ZA 4A3RA 2WMGA 2V8ZA 4XAZA 5C0QA 5AC8A 3UR7A 2PD9A 1VQZA 4CEXC 2PURA 1LQ0A 4LIIA 1XSJA 4TQTA 3MPGA 3W7JA 1R3WA 4AY7A 1YLVA 4ZFMA 4HN4A 3AYVA 4RPQA 2X1SA 2WM1A 3BMWA 3O0KA 1YNQA 3OEXA 1J01A 1PIGA 3ZM8A 3ZWSA 4Z1CA 2GK1B 1LL6A 1ZAIA 2PDPA 4DJEC 3T9PA 4AZHA 2WSRA 1F3TA 3PFRA 1OYCA 3WFZA 2WCAA 2A2IA 4BS0A 4XX6A 2WSQA 4KPRA 2VCAA 2GJXB 7PTDA 4U2YA 2DSWA 3V5CA 1DJQA 5IOBA 1BVWA 1KQYA 5E1QA 3H7UA 5BW6A 4OECA 1P1XA 3E0LA 1KFJA 3E96A 2WMIB 2AKMA 3L4XA 4QP0A 5I3JA 2CXGA 1TX2A 1MO0A 3SECA 5A2CA 1FA2A 3EX3A 3ZZ1A 2XN2A 3TKFA 2OT0A 2YYUA 1WDDA 4O11A 4NXKA 1R3RA 5EMLA 1ICPA 3MHGA 4AVFA 2QEZA 4O57A 3S4TA 2V5JA 3UA4A 3ABXA 4QITA 4CD7A 2FPYA 1DXIA 3KBNA 3GFXA 3CUZA 4QROA 1GPWA 3JVAA 1ZK7A 1M03A 3LS9A 2YPIA 4GYJA 5AY7A 3W2UA 3H2MA 3SRHA 5FF0A 4AISA 4BF5A 1QASA 3CGTA 4LFYA 4W86A 3IIPA 5EMMA 5E6ZA 2ZX9A 3LD5A 3PSWA 1QNPA 3TONA 4NX0A 2VUNA 3APYA 3VD4A 3K4WA 3KVMA 3C52A 3W7CA 1JZ7A 1Q66A 4AF0B 1FHUA 4AWUA 2PAJA 4LUTA 1K8CA 1ZENA 3M0KA 2YB4A 4M52A 3QQ0A 3NO3A 1ONFA 3NIYA 3GDLA 2X0YA 3ITXA 2OWCA 3QLLA 1BWLA 2CLMA 4AYSA 4IGMA 2YDQA 4HMCA 4Y9PA 1GQIA 3IC9A 1E5JA 3V5FA 5KEZA 4LYQA 2PRMA 4IIEA 1QI3A 2RDWA 1RSCA 4NZ1A 4IP4A 2OEJA 5A8MA 3PZMA 4EXQA 4L6DA 3AXIA 2QCNA 1UW9A 1TWWA 3MYOA 3EDFA 1H3GA 5G4HC 1WCGA 2OG9A 2FLIA 5FJRA 3CU2A 2PDHA 3ZVIA 1EUAA 2V0TA 2Y6ZA 2ZZ3A 3T09A 1FFQA 2Q02A 4I9AA 1PVNA 2ZZ5A 2X1RA 4JQAA 2GVEA 3LQLA 3K4AA 1V51A 2FMNA 2D2GA 2A3LA 2NWRA 4H8NA 3P81A 4J7RA 3VIHA 1WBJA 5BOEA 1H1ZA 1V6XA 3I3DA 1T8QA 1L0PA 1IWPA 3B9EA 3F4NA 1U2YA 5D9NA 2BOGX 3WDRA 3HW2A 4DZ5A 2V3FA 3NSXA 4JQ1A 2ISSA 1PE1A 2J66A 4QRNA 5JRBA 4G2DA 3EDKA 2ZCGA 4C6IA 5BU9A 1OSEA 1H7PA 2I9EA 3GZAA 1XLIA 3CUJA 2UY4A 5AHLA 2OWXA 3L68A 3N6HA 1MSSA 3NVZB 4FX9A 2GQAA 4EXBA 1K77A 2UV8G 3CUIA 3S1GA 4QSFA 4ADUA 1V6WA 2C71A 3QW4B 4A2RA 2POZA 2C3ZA 2XDFA 3VIMA 1UIPA 4O1EA 1ZPTA 1V6TA 1ZDLA 1CGVA 1E40A 1FDZA 2OQLA 4B5VA 3WQDA 3L12A 1MEIA 4DPPA 2J62A 3M1ZA 1VYSX 5I6SA 4LEQA 4JCMA 4GD0A 3PTMA 1Q7QA 1B3XA 4I7UA 4US5D 2JE8A 3SUVA 4F0MA 2NX1A 5I03A 2EF9A 3K1DA 1GREA 4HCHA 1JI2A 1JXJA 3EOOA 1LWHA 1C8YA 5KZ6A 4KEVA 3NS1B 3SFWA 4L61A 2G3IA 1GYMA 2PA6A 3CYJA 1GT8A 4F2UA 2F84A 1OINA 3U57A 3NPVA 1DPMA 1GESA 1BRLB 3DKJA 1UPMB 1T5AA 1BXCA 4DI9A 3DKLA 4OWGA 5AC5A 3G2GA 4WDXA 1LT7A 4P7QA 2VP8A 3ANUA 3M44A 3MHFA 6A3HA 3VMPA 4H4IA 2B4GA 4URIA 3SR7A 4MY8A 4OBRA 3RU6A 1RCQA 3ITVA 1JJKA 1KR0A 1VC4A 2D2HA 4BF7A 4XAGA 3SCRA 3WJYA 3NNTA 1EWEA 4A3YA 3W1MA 1U22A 4N4PA 3R79A 4LVDA 5TNVA 4UR9A 2YXOA 3BG3A 1NFBA 3P5ZA 5I02A 5FACA 5CBJA 1F6YA 5AYYA 1P7TB 3DFTA 1VFMA 3KOZA 1HJQA 4S3KA 1V3KA 3FCPA 4HA4A 4DF0A 5HBFA 3BLLA 4JIIX 2JGYA 1XLAA 1Q4NX 3L0GA 3SAZA 2I57A 2FZ8A 4P5UA 2ZZ7A 2Y7GA 3N12A 4DBDA 1NDYA 3LG3A 5DMLA 3H26A 5DFAA 1Q1WA 6ALDA 1GKQA 3Q6JA 4IMCA 1VS1A 2RGMA 2INZA 1ZTVA 5CG0A 3ZOAA 4NUWA 1E70M 1VYPX 2OSYA 3UPWA 3VO0A 5EBAA 3AIBA 3MZ2A 3M6YA 4LCSA 2PC4A 3OG2A 1AJ2A 4E5TA 1CLKA 3OQEA 4JQ2A 4U3AA 2ZZ4A 3AN1A 1M7OA 4RX0A 1QBAA 3T0CA 3KHJA 4QE1A 3NXFA 4PSRA 3RPTA 3W7OA 2ESCA 4OHQA 3VKAA 1TV5A 2O9TA 1WYGA 2DSVA 5DRIA 1AW1A 1A5OC 4HHLA 5CZKA 3DK8A 5REQB 2E6FA 2PDXA 3N34A 1IEVA 4AB4A 4I9JA 3VGFA 3FXYA 3UWVA 3QGKC 2DY3A 4WR3A 3IS4A 3BLIA 4IUOA 3AHXA 3I7QA 3M5XA 2EAWA 5ENLA 4O19A 2GJLA 1EBDA 2NQHA 1TTQA 4FX8A 4PYSA 3TYAA 3BAWA 2AQWA 1C9DA 4CQ9A 1QNVA 3V75A 3BCFA 2EHHA 1XH1A 3AIVA 1O5KA 2ONEA 4C5YA 1J6PA 4JNMA 3NYDA 4H4YA 1EO5A 3MA8A 3TNOA 4ORIA 5HQMA 1UZDA 1ZHAA 4U31A 2CU0A 4L5ZA 1ZL1A 1W5OA 1W8SA 1V0LA 2OZTA 1H7OA 1V0NA 1QRQA 3HPAA 5HUPA 1M68A 2PWUA 1OZQA 1VFUA 2BC0A 5JCMA 3ARPA 3KBVA 2BXVA 2Y8KA 1YBQB 3S0CA 4GI6A 3B03A 3WQEA 3VX0A 3WQ6A 4FNRA 1ADSA 2DH2A 4WDUA 3R1ZA 1G4PA 3FOKA 1W9BM 4RXGA 2TPRA 2WMJA 1E9LA 1PX3A 3NXLA 3Q58A 2XJ7A 2GK1A 4XAYA 1EF2A 1WDPA 3M0LA 1R30A 2F5ZA 2D2JA 2EQ7A 2GUUA 2GJXA 1LQ2A 3QSRA 1DQXA 3O05A 1GSNA 1I2QA 3ARSA 4AH7A 2XIJA 3EXTA 1TIWA 3HA1A 2WPEA 2YL9A 1BLIA 4W89A 2O9OA 7ODCA 4IF2A 4W8AA 3VTRA 4XZMX 4XISA 4GZ7A 3DFPA 1US3A 3W2MA 3PBMA 2B7QA 2HCVA 3KXQA 1KNWA 3K13A 1W1A1 1QCWA 3EANA 3IJLA 4JFUA 1SFTA 3VNLA 1G5AA 3T55A 5LHEA 5C70A 4ATLA 2HVMA 1KRBC 3KRSA 1XYMA 1TELA 4ZEPA 2PDUA 1QR7A 4M29A 2NSXA 5AZ0A 1UD4A 5EMYA 4JTCA 4ES4A 1U1JA 3NTYA 4QQ3A 2WVTA 4GACA 3A4WA 3VA8A 4ZE4A 1CB2A 4GIYA 2V5DA 1X2HA 1V79A 1TREA 1EP2A 3FVMA 4CU7A 4AF0A 3IGSA 4OT7A 5C8BB 1XINA 3OOQA 2ZDRA 5FJPA 3LXDA 3ZJ8A 2W5FA 1D8CA 4D6JA 3SQPA 1E72M 3MUIA 4I9TA 1GWJA 1T99A 3DZ1A 2X8CA 4C6BA 3I68A 2OGJA 1S5WA 4IMEA 4UC5A 3L65A 3ICJA 2A79A 2XH0A 2EXOA 3BLPX 2DZTA 1E0UA 3ITLA 3ARUA 3CTTA 4DZIA 3K8LA 3O6YX 1LZOA 4UTHA 5I79A 1LLZA 3BOXA 1KA9F 1FO4A 1NARA 4XKMA 1ME9A 5HMDA 2OQYA 3LCIA 3GU2A 4A35A 4JTKA 3SCSA 2HBXA 5A6TC 1GGOA 1VFFA 4UOQA 3NQAA 1RCOB 3N15A 1BQCA 4JDBA 3GNOA 1PTAA 3B9AA 2IPWA 4JTUA 1EYEA 2P3ZA 4QE4A 2O0TA 4QQUA 2ZXBA 2Z2AA 1UJQA 2YLLA 5G1MA 1I2OA 3ARTA 2X8RA 3QY8A 4BEUA 3GTNA 4PB4A 4GZJA 1PDZA 3AXKA 1FRBA 2QGYA 1TQXA 2DSKA 4AY1A 4DBUA 1RLDA 2JGQA 1F61A 4H9UA 3RO6A 5HAOA 1I9CB 4CQAA 5H2ZA 5AYBA 3R8GA 4CN6A 2CLHA 1XDMA 1T3QC 3A21A 5C71A 3A12A 3PF3A 4XVDA 1KRCC 2PE4A 2GFTA 4GR1A 2VWSA 3PNUA 2X40A 1QOXA 2BOEX 5A94A 4CNTA 1XKYA 4PB3A 2Z28A 1VAHA 2PF8A 2R9ZA 1TMLA 3ENLA 2HMCA 3LPPA 3NZQA 4NQ1A 2EPNA 1CIUA 2PB1A 1EQCA 3TJXA 3C2OA 1HG3A 3L23A 4PUJA 4AHQA 3H4GA 4WEVX 3MUCA 2YFOA 2C8NA 1Y7VA 1IT8A 5I5RA 3W6LA 1EJVC 4O1FA 3B0XA 2RDTA 3FKKA 4F0RA 4N9EA 1XR2A 1Z69A 2XM1A 4PCNA 4HU4A 1A3HA 4XIMA 2H6RA 4QISA 1HL8A 4QS6A 3WDHA 1UWQA 1D8WA 1UMYA 2IXUA 5D4YA 2ZUMA 2ATSA 2PC8A 1F73A 1KRAC 1Q63A 2QXWA 2XGBA 4H4QA 1ZY9A 3HQPA 1BRLA 1Q13A 1F4AA 5H6HA 1GONA 3NL2A 4OOZA 2NLYA 1HN1A 2G96A 5AHFA 4X2PA 3WNKA 1QNQA 3PBUA 3H12A 1JIBA 4L1WA 2XVKA 4MFEA 2G41A 3C0SA 4N6FA 1N5XA 4EPKA 4FNSA 2DSZA 3WKZA 2WKLA 3VKDA 2P50A 1AQMA 4XBKA 3NO1A 4C6PA 4QSHA 3KLKA 5BWFA 3O8AA 4GJIA 1LOSA 5FL0A 1KV8A 2FZNA 3BTNA 1MW1A 2EPHA 4GYPC 1OM0A 3P2VA 1TTPA 2D23A 5D2VA 1X97A 1C8VA 2QMKA 1EXPA 2C19A 2DZWA 3W1XA 2BVWA 3WEZA 2YCLB 3QR3A 1P7TA 3LGEA 4CD4A 3KFTA 3H24A 1GYLA 1DHKA 3KOFA 3EEGA 3PUGA 3AHZA 5G5IA 4MNJA 3RLUA 3HQNA 1W37A 1FWHC 4V15A 1O1HA 3ZJ7A 1LWIA 4M5PA 3OLIA 3VKJA 4NJJA 1RPXA 4GI8A 1Q6FA 1Q85A 1Q8JA 2UY2A 1ZMDA 4IPNB 4H19A 4K6AA 3URBA 2UY5A 2QW5A 2OCZA 1HJUA 4M6PA 4PUEA 3DERA 1UIOA 3LRLA 1GUVA 3GW3A 5CZJA 1TWDA 1M6IA 3WD3A 3XINA 4BI7A 1U30A 5F2GA 1C91A 2YCJA 2F9RA 2VVSA 1A0EA 2OLHA 3GWQA 1GETA 5D9OA 1JYXA 3KCJA 5G1YA 2PDFA 4Q8PA 2UY3A 4RK8A 4DX3A 2WJDA 1E0VA 2D3LA 3ITCA 4MTVA 1EGZA 1SYTA 4M80A 3WH8A 4KCWA 2E8ZA 1OC7A 3SCVA 4DLFA 2EQ9A 2FB3A 1SZRA 4F0KA 4QCEA 3TXZA 1K9DA 3ZR6A 1NTHA 5FF2A 3CZLA 5LSMA 1J2BA 5FEWA 2QAPA 4Z42C 2V3BA 2ON3A 2BZNA 1V6VA 5FS7A 2ZZ1A 3L2MA 5HUOA 5A2BA 1V93A 1IE7C 3SCUA 4JIHA 3V1PA 5CLTA 4R27A 5IHRA 3WUFA 7A3HA 4NL1A 2PSNA 1PKMA 1XLCA 1KR1A 2IW0A 3I65A 4OUEA 3NWRA 1W5PA 4AG0A 2D3NA 4WIWA 4OFCA 4M6VA 1LQAA 4WKHA 1R3SA 4EPDC 1R2SA 4XTIA 4ACZA 4ZMGA 3U5YA 4ZOCA 4U5IA 3O2LA 4GVFA 4J3ZA 3OLGA 1I0BA 1F8WA 3RX3A 2R94A 2Y7FA 3HF3A 1EEXA 1T0OA 3SIZA 1YBQA 3A4JA 2AKZA 2VEFA 2FGBA 4W88A 5FL1A 4UNLA 4YTSA 4LW7A 5HA7A 3PZVA 2Y61A 4IPJA 5KZMA 1EPXA 4LYRA 2BB0A 2YIHA 4MKVA 3BL3A 1UOKA 4F9JA 3P93A 2CXEA 2J47A 4GY0A 1AMYA 3DFYA 1OEPA 2QMJA 4GNKB 1JCLA 2I17A 2WJEA 5EBUA 4ZQOA 1A5SA 3DYOA 5LIYX 3W1UA 3G18A 1SGJA 2J27A 3QN3A 4JDYA 4RR4A 3FDGA 4ZO6A 3K1GA 1LRNA 4HA3A 1F7BA 1D7KA 3N4AA 3HGOA 3N29A 3TROA 2DIEA 1QNOA 2J78A 4B5TA 4FR1A 2GGEA 1W31A 3NVYB 3IK4A 3VI2A 4HYWA 2WWDA 2ZWYA 2FTWA 4GRTA 4KBXA 2YVFA 3URQA 4DI8A 4AMCA 4MB3A 1GRGA 1IZCA 3DG6A 4A05A 1XYAA 1JEHA 1BGAA 4G7EA 4JHMA 4HPJA 4JNYA 4KRZA 4J56A 1DORA 2WSKA 5GQBA 1A5KC 2FHBA 2IQ0A 1ODZA 2VXNA 1BVZA 3BLEA 3M64A 4L4MA 2J7EA 3AIWA 3ABSA 3AWNA 1KXHA 4B5NA 1RBAA 4V1XA 4PTXA 4DJED 1Q6EA 3WO8A 4KRTA 4JX5A 1A49A 2OVLA 5KITA 3LB8A 3WLSA 1GXFA 1SMAA 3WH9A 5HINA 3LTPA 2GWNA 4LY8A 2WYSA 1J9YA 1KFLA 1DJZA 4DXVA 5J5DA 4ZB2A 4P61A 1DOSA 2QF7A 2ZX5A 4DYKA 3WMLA 3WNNA 3W7EA 4XO6A 3DG3A 1E71M 2ZBTA 5D38A 3NL3A 5DY3A 3S9IA 1MEHA 4BY3A 2TAAA 3RO8A 1NQ6A 3T42A 1SMDA 2W92A 2H9AB 2V68A 2D0GA 4H4UA 4BWLA 2DH3A 3UERA 2ZICA 1F9CA 3IIZA 2HK1A 4QGCA 5DRCA 4W85A 3H6OA 3ABRA 4QFUA 4S1FA 3DDMA 4QJ5B 1DYSA 5MKGB 2ZE3A 4KIEA 1VLWA 5CPLA 3KVKA 1UWTA 1CWYA 3UY7A 2POTA 3WQ4A 3L4UA 4H4XA 5HANA 3W6MA 4HYRA 1GVFA 3YPIA 1E43A 3OG3A 3GXFA 2CZVA 2OJPA 2WHMA 1J11A 4Z0SA 2DQXA 2J88A 3KOXA 3N4FA 4WXYA 1OT2A 3HIJA 3NVTA 1XFCA 3ANVA 1QI4A 1Q7MA 4IGNA 3VNJA 5HULA 3VE7A 3S5ZA 3DK9A 2NVCA 3WBXA 1YPFA 1SW0A 1PPIA 2BVDA 2VVNA 1W5NA 3W70A 1OBAA 3LV5A 3LPGA 1K9TA 3PPHA 3QC3A 1HKKA 3W85A 4PMOA 4H6RA 3DHPA 3UP8A 3ZR5A 3QJAA 4L4OA 5CJNA 3C0JA 2E77A 1IGWA 3E38A 1EWDA 3EWDA 4CD5A 5A6JA 1FKXA 1MDRA 2HJPA 3QR1A 1M1BA 3B8VA 4IP7A 4RE4A 1SR9A 3L67A 1QATA 4LVBA 3UNTA 3ES8A 3WF1A 4C7FA 2BDQA 5LIKX 4GG9A 1ZJIA 1V3LA 3CZJA 1QHZA 3WDIA 3AXXA 5FOOA 2O9RA 4JBRA 3WQOA 3SRKA 1E3XA 3E1F1 3QOMA 4S3DA 4UQCA 4Q8WA 3BAYA 4H4SA 4D72A 3EX4A 3BO9A 3FEMA 3FG2P 1DJWA 3CT2A 4I7WA 3THAA 2XZ7A 1P0EA 3WL0A 1OX4B 2DIJA 1XP3A 2D73A 4E4PA 2P0IA 1XLKA 1F8MA 2YA1A 4QNWA 4E2OA 4EMJA 3LLXA 3TN3A 1BAGA 3W29A 3HZ3A 4NJGA 4EX4A 1XYCA 3UXAA 1XCFA 4DJDC 3EEZA 1WKYA 1XIEA 1G4TA 4FZIA 2D2OA 2BFGA 3Q4DA 5CXPA 5I06A 2J24A 1XYFA 2BOFX 1RLCL 3SN4A 4FDCB 1RR2A 3ITOA 3W71A 3ZIZA 1X7IA 5FF7A 3O15A 1WV2A 1GK8A 3ARVA 2A3HA 4Q4MA 1JCYA 3LGDA 2HPMA 1TUFA 4B5WA 4LAUA 4ONVA 3HFYA 4IFKB 3BDKA 4KEZA 3AMKA 3OBKA 1XH2A 3VOHA 1KFCA 3MUAA 3PB0A 3UFYA 3VCRA 3UR8A 2XIOA 3PFMA 2FJUB 3BSMA 4QLJA 1W3JA 1E3ZA 3VMNA 6TIMA 3KTSA 3OBAA 5JBFA 1NHQA 1ZS2A 3O07A 1BYDA 1UR3M 2F61A 2YCLA 3MUXA 4JTTA 2IXVA 3DHUA 3FA4A 1OYBA 1W1YA 4UR8A 2NQLA 3C5QA 5F4WA 3WLHA 3A13A 1GG1A 3BURA 4MNLA 4E0CA 3RMJA 3PUDA 4BWLC 1G6CA 1S39A 1BSLA 3CQKA 2G37A 1CGUA 4M3PA 2WP6A 3WCZA 5C5YA 1O95A 3M07A 3VNKA 4QJ3B 1F4HA 4ZR8A 2JEQA 1YPIA 2X2YA 4UBPC 1QK2A 3SZ8A 1X1OA 3KVLA 2DZBA 3DX5A 2XN1A 2E3ZA 2QCHA 2WPFA 3COTA 1XCXA 2ACUA 3A3HA 3NQGA 3WH7A 4GE8A 1JPDX 1DBTA 2HQMA 4UZSA 3PUEA 2GOKA 5U25A 1B31A 1PZ0A 5DEZA 3CHFA 1DJNA 3SY5A 3GH4A 2O4QA 2CLOA 1A5UA 4HIBA 1P6WA 2HXTA 1VENA 1XS2A 5DCDA 2DORA 5CZTA 2F6UA 1N82A 4JKMA 1NWUA 2R14A 1X96A 3RK8A 5AB3A 1LVLA 3K46A 4B5XA 5IBXA 5DO8A 3CEPA 3B4YA 4D8ZA 4QAIA 3WLIA 1DJHA 2WHLA 1T96A 3AMDA 1EL3A 3CC1A 2VX4A 3VM7A 2E68A 3AOFA 1Z42A 1XHGA 1I6NA 2OOFA 3S2NA 1A5NC 4DIAA 3J7HA 1OFPA 2JQXA 4RLIA 2W3ZA 3HN3A 4KWWA 2V3EA 2V2HA 4RNIA 3CV1A 4X9YA 3NAVA 4PRRA 1IT0A 3T07A 3GHSA 3EDEA 3TU9A 4N7QA 4KMQA 4F0SA 2CCRA 1VFHA 2H3BA 4XIAA 4ZBCA 4F48A 1GZJA 3GC5A 5A3HA 4C90A 3GNDA 2WPGA 1Q2RA 1UKTA 1ZLPA 2ACRA 3N04A 4D6FA 3DFQA 3TTOA 4AEOA 5AOUA 3SCOA 1M65A 4AXNA 1UP3A 4KIRA 4REQB 2B7NA 4YVVA 3TJIA 3GD4A 5JCIA 1ADDA 2VFHA 3CPGA 3GIPA 4O13A 3WDPP 5I3DA 1H63A 1KKRA 1XYZA 1ONXA 1U5JA 4GO8A 4JEJA 4NIRA 2BVTA 1E55A 4XZHA 3W2NA 1S2TA 3GFYA 1XBVA 4YVPA 5TIMA 1X6LA 4LA1A 1PEZA 4W7UA 1Q6LA 1E0XA 1UKQA 4X63A 5D9MA 3C2FA 1YNYA 1OY0A 4RNFA 2GJPA 3OVPA 4YWIA 2PWHA 4S23A 2I16A 3W1AA 3MCMA 1U1UA 4WF7A 4P8VA 1WKDA 1A5BA 2QCEA 4MLRA 1G69A 1OADA 4ZOEA 5K7JA 1XM3A 1P6BA 1ISVA 1QK0A 2DW6A 1XQLA 5KZEA 2WLZA 4F40A 5A8NA 3JS3A 4ZO8A 5C9WA 4YTRA 5DBTA 4Z08A 1Q2SA 4H4WA 1MUWA 1TTIA 4JY9A 1FWTA 3AMCA 1OABA 3MP5A 4GXWA 4PZVA 2NV9A 4JD4A 2J7CA 2YA2A 1KXVA 4DUOA 3GXPA 3EWCA 3H23A 1YQ2A 3MSRA 3RFAA 2NZLA 1XRVA 2CFFA 2W27A 1MNZA 3DGRA 3SFKA 4AD4A 4BI5A 2E9LA 4DNMA 3NSNA 4MDOA 2VT0A 4C6FA 1XKJA 1MNSA 3LHZA 2HISA 3LSCA 1VKFA 5L9FA 4OTKA 3BZJA 3RLHA 2GGGA 4IX0A 1JZ2A 1XW8A 3KS6A 2GR3A 1XLBA 1E4IA 2VYOA 4KEUA 4IIFA 3VDAA 3WK0A 5DT5A 1RP8A 4AIBA 2A21A 4RW5A 3WK1A 1M53A 1FH7A 5CGQA 2BC1A 4YL2A 1XLFA 3PZOA 4IIHA 4M19A 2Y70A 2ZX6A 4DYJA 1JZ8A 1IWAA 1E73M 2VGFA 1BEUA 5RUBA 2FGZA 3N13A 2XIMA 3U2EA 1EDTA 1RA0A 1UD3A 1K3UA 2ZVRA 4XAFA 1D3GA 1BXBA 4UOJA 1UROA 2GWGA 3F2CA 4N6EA 5LIUX 4OVXA 3BAXA 4AD3A 4EQRA 1TSIA 4TUFA 6REQA 4PUMA 2C18A 3MUY1 3MCNA 3AS2A 3MBFA 4AMAA 4LEFA 1Y0EA 5I77A 5MKGA 3NEHA 2JEPA 4UFHA 2WP5A 1M04A 2NQ9A 3U5UA 2OKTA 2Y7EA 2GJRA 1K9EA 4IJCA 1A47A 4H8HA 1FFVC 2OOGA 1A3WA 5IBXC 5LGZA 1NELA 3LMZA 3CBWA 1JCJA 4MY1A 1E4LA 2X50A 2QJHA 1FWWA 1P1MA 2PDJA 3I4EA 4NHVA 3CQIA 2GDQA 1XLGA 3GDTA 4I8YA 1XSKA 3TYUA 4NKCA 1XIFA 4EACA 1TV7A 1EZWA 3WZ0E 2WCSA 4YCOA 4LAMA 3LNMA 1G4EA 4GO9A 4C6LA 2WVSA 3KHDA 1EOKA 5D05A 3EGJA 3LZ5A 3N6QA 1FHVA 4EWND 1JUBA 5KVHA 2QUTA 4CQBA 4EMIA 4B92A 3LCWA 4M51A 4Q8UA 1JF5A 1MZHA 1Z44A 5G4EA 1M5WA 3WJXA 4UXDA 5CPQA 3MB9A 2WNNA 5K9XA 2ZZCA 3OIHA 1P0KA 4HSOA 3TAOA 1NHPA 3BXWA 3MKCA 5M5DA 1C3FA 4L1XA 1OD8A 3TN6A 3E02A 1IV8A 1V6YA 4I5RA 1ZP4A 4DVOA 5AHNA 3FA5A 1X8FA 3LOTA 1QTWA 2OEMA 2CBIA 2TMDA 3VC5A 2YJQA 3H2FA 3LADA 3BK0A 3DN5A 5JMUA 3QKEA 4KGJA 4ZSTA 3SIMA 1KD0A 1AFSA 3HJEA 3B05A 3OZPA 1NDVA 3HOJA 3LYEA 4KW2A 4KS0A 3GTHA 1OX4A 3R43A 1YTDA 1DE5A 3W37A 1DKWA 2YSWA 4WSJA 4ZZ9A 3GDBA 1ZY8A 5A95A 4X60A 2QCCA 2F8QA 4WVXA 2ISVA 2ZADA 2FZBA 2PWGA 3QV6A 1JDFA 4JAWA 3TQVA 3CPUA 4WX2A 2WOQA 3VZZA 1FWIC 4DRSA 2BTMA 3MSDA 1DV7A 2W0UA 3ZR4A 4MDPA 3FXGA 4ADSA 3CS2A 5PTDA 1U1HA 3C61A 3ZFHA 4PFHA 4C6EA 1L8NA 1AQ0A 1M7JA 2HEJA 4LC8A 2HS8A 4G8TA 1VQTA 3EA2A 4PEEA 3LTYA 4FALA 3GBEA 3TJLA 1G7VA 2BY3A 1UP0A 2X1TA 4XWUA 3S46A 1ZXIC 2VR2A 4Y7EA 3WNOA 3QQWA 3TQKA 1L6WA 3S6OA 4MAVA 1R2RA 4Q7BA 4W5ZA 2HWGA 1Q1RA 3BH4A 4F79A 1K9FA 3SO7A 4JTQA 2PS2A 1VDVA 4GVGA 1SZNA 1EJWC 1OCQA 5AN7A 3GC4A 1JQXA 4A3QA 2PLJA 4A8RA 4FP1A 3SCPA 4MKSA 1FWJC 1JG9A 2A7PA 3NYZA 4PBFA 4DNAA 4S38A 3QMSA 1FP8A 3THQA 5HPCA 1JROA 3HPXA 4AVNA 3WUBA 2ZIDA 2IPFA 1NIUA 1BF2A 1Z89A 2V63A 1H7NA 3NL5A 2CZ5A 2QV4A 4GXPA 5D8ZA 4MPKA 4M1BA 1TMQA 3FJ6A 3N73A 4KCTA 3GU9A 4RDYA 3DYPA 4K7YA 1JRCA 1S2CA 5LNUA 3PPCA 5HQEA 1TPC1 3TC7A 1PAMA 9CGTA 1QBBA 4C6CA 1R3TA 3K8MA 3W1TA 4ENLA 3W75A 3M47A 1O94A 1KTBA 3N2XA 4GGHA 3W72A 5I00A 5A6MA 4AFYA 5GPRA 3UWWA 3LCXA 2R1MA 4TU1A 3PG6A 3ECQA 1CI1A 1VHNA 3DBPA 1YDYA 1K8YA 2DT3A 4JHOA 1OFAA 1ZFJA 4L9ZA 3VABA 3M0IA 4H9MA 1W3IA 4NNAA 3RJXA 1S2WA 5FF4A 3IWPA 1WZAA 2PWEA 3HG2A 4E8DA 3M5ZA 5E9XA 1PUDA 2QZRA 4NJIA 3AAMA 3MMWA 4LBUA 1N62C 2HNEA 4G56A 1W3TA 4K68A 5HOSA 2GQ8A 2PRHA 1EQPA 4HTYA 2FMOA 5I7GA 1CECA 4Q4KA 3FAXA 2JKPA 4WGXA 3T7VA 4PRTA 4ILSA 4KCUA 4IJRA 4PMJA 3MU7A 4I5UA 4EMWA 3CIWA 1S5TA 1KCZA 4TVYA 3C6CA 1J0KA 3WQ8A 4BKNA 4J3WA 4FXFA 2BS9A 2FHFA 3TOPA 2OZ3A 2J25A 1WYIA 1NOWA 4B3ZA 1UCWA 5HWJA 1X7FA 1AJZA 1UWIA 1KM3A 3POCA 1EF3A 1SU5A 2RFGA 4HSHA 2FTYA 3W86A 3KEHA 4REQA 3IVUA 3NGFA 1JUKA 3FIGA 3LUTA 1YXCA 2VRJA 1TJ2A 3D9XA 4CNUA 2RHGA 4PTVA 2YYTA 2PDCA 1XG3A 4IMDA 4MLJA 1SJCA 4N42A 3T78A 5CJ5A 4IIBA 3IARA 3K8KA 2A3CA 2A0NA 5CCZA 2HVOA 2PBGA 1UP2A 4LC6A 1YDNA 5M03A 4HVXA 2XVGA 5TD4A 3DJGX 1Q45A 3WQPA 4GABA 2FPTA 3QKZA 4IT1A 2C1IA 2B31A 3BJTA 1X1NA 3PWGA 2VEKA 3MP3A 2RJGA 1LDCA 3NQ8A 4U5KA 4IPPA 4KQNA 4M6QA 3URHA 4J3UA 2ZUNA 4IMGA 5EL1A 1PV8A 2EG7A 3BG5A 1ECEA 4CQ8A 3ZT5A 2HZGA 1OCBA 1UD6A 2X05A 1W1TA 2WHKA 1XC4A 2VQTA 1HGWA 3OZMA 1S5VA 1D9EA 3GR4A 3WLNA 3WEMA 1EIBA 5LNWA 4IXHA 3NVDA 3F03K 1H2JA 2G3JA 2VEIA 2PWDA 3CYVA 4HB7A 4QG9A 4GJ1A 4AHOA 3M4HA 3PANA 2EO7A 4OQVA 2WHJA 3TTYA 4UQAA 1GVRA 4NY2A 3SUSA 5LKYA 5U7SA 4AD1A 1V77A 2V30A 1BTMA 3W88A 3EKZA 1V59A 2YZ5A 1X6NA 2AGTA 3E0WA 4O0KA 2WM0A 3QTGA 3TMLA 1CDGA 1UR4A 1EC7A 4RE3A 4RZ5A 4GY7A 4IISA 4R34A 7REQA 3GIYA 1D7FA 2FVLA 2IKJA 3PSVA 1KTNA 3GFZA 4HQVA 3AICA 3BMVA 5CAHA 3DESA 3IVSA 4CNPA 1AJ0A 1YMYA 1AZ2A 3PPGA 3RLGA 4FB7A 1MMFA 2VZTA 1TPUA 3S1WA 4LUJA 3LA4A 1XISA 3AHTA 3UWYA 2CLPA 3JU2A 1WNOA 4FHAA 2A6LA 1PTDA 3ME3A 3MMTA 3S2MA 3IVTA 4WZHA 3OYZA 1XLDA 2CLFA 4WGHA 1EP3A 3A64A 2DUZA 4CCCA 1U5HA 4Z2GA 4LOCA 2ADAA 3W7NA 3N25A 4KFPA 1XF0A 4POCA 1GG0A 2FIQA 3I3EA 2V3AA 1K02A 3ABQA 2PGEA 3N2OA 4GQQA 4HMNA 3B8SA 2E5BA 4U33A 2J6XA 3CV2A 5BXSA 4DAIA 1Q7ZA 3TWAA 1I45A 1KKOA 3SUWA 1AG1O 1DJIA 2Y89A 3BLDA 3E12A 4RE0A 1RUSA 2WKJA 3M43A 2W3SA 5FMHA 1DJGA 3D47A 2G4JA 1JYVA 3OPSA 4TO8A 3CGDA 5B7ZA 1GPFA 1XDLA 2AAMA 4PL1A 2W55A 4H4RA 3IJ6A 1B2YA 1UWRA 2BWGA 3GTXA 1V3IA 1VIWA 1K70A 1LOLA 1N7KA 4GIAA 1FP9A 2NX3A 1OFQA 3RM4A 3WX7A 1BGGA 4WKAA 2ZTKA 3CMJA 1YXYA 3BQ5A 1SO5A 5HJLA 2OSXA 3P60A 1PB0A 4UTWC 5A2AA 4GNJA 3AIRA 4Q4PA 4WHBA 3G1RA 1QXLA 2A3EA 4KH2A 2VZUA 1RJRA 4EAYA 2YXXA 3F4VA 4PN2A 4KETA 4JTFA 1QVBA 5MF5A 4E8GA 3KZPA 1QU4A 1NEYA 2HRWA 3O6CA 1JNEA 4IOTA 2PDQA 3WMSA 2WW5A 3O3RA 1CCWB 2GR1A 4A21A 1OG0A 4HU3A 5CAKA 3BW4A 1GRAA 1O66A 1GOQA 1F76A 3KLLA 1NP2A 1O1ZA 1S46A 1JVNA 1ZCOA 2WC7A 2DW7A 3W7LA 1AW2A 3ZSTA 1IEIA 4M8UA 1NF0A 3SRDA 1TYTA 4JL2A 1GJUA 4GQ0A 5DBUA 5DY2A 5F2IA 4EM3A 1DVJA 2W91A 1LROA 3EWUA 4AC7C 4ROPA 2VFDA 2VOTA 2WZEA 4MWAE 4G7FA 2EPOA 4JIPA 5DCBA 1J12A 2HXUA 3MY9A 3LI1A 4M1RA 4LAKA 4MUZA 5HDRA 2X0SA 3IJ8A 4D1IA 1Y5VA 2J7BA 2AGKA 1E6PA 1UASA 3PZ9A 1K4QA 8XIMA 3A4XA 4A8NA 5JBDA 2MANA 2W54A 4ERAA 1R7OA 4XQ6A 1RBLA 4DBSA 2XUCA 3AXHA 5CGTA 4IXXA 1NFPA 4JQ4A 4UTFA 1TPVA 4YPJA 4U2ZA 4YXGA 3TSDA 3G0UA 8TIMA 1W1IE 4YJ5A 4KF1A 5E0FA 3BICA 1ZQ5A 2O55A 3FK4A 1AOGA 2CW6A 2VDIA 1VJZA 1TV8A 1DJYA 3G6LA 4DQWA 8XIAA 4GUJA 3NO5A 4EF9A 2I5GA 2VQUA 2XTKA 5AFDA 4ZVJA 3ERPA 4H01A 1G94A 1VPXA 4Q7NA 3UZ5A 2YCIX 4QR6A 3UGRA 2OZ8A 3WQVA 4XD3A 4CGTA 1BTCA 1RZMA 3WN6A 5XIAA 3NZGA 3W1QA 2CEQA 3HO8A 5EA9A 4H7CA 4XG1A 3VOCA 1NSJA 4HZ7A 5ABEA 3L5LA 4JNZA 3A22A 4OE7A 3IUHA 3C86A 1MUMA 4I7VA 1BWVA 2J13A 3ANYA 4FNPA 5JCKA 3RG6A 4YYCA 2GRTA 4KFNA 4B9ZA 3C0QA 3GYEA 1UUMA 2BX7A 3TVAA 3M0VA 3CK5A 3M5VA 1KBKA 4UMAA 5CC3A 3SCNA 4G5DA 4CNNA 5CZSA 3UVAA 5CLWA 3EAUA 3F5KA 4XZNX 1JAKA 3WJZA 3KVJA 4ZB5A 4EQWA 1TJPA 4S3JA 2KAUC 3MI2A 4Y96A 3UJSA 3S5SA 5G2WA 4HOZA 1VEMA 2E7FA 2NV1A 3Q2DA 4YU1A 3MMUA 1VH7A 3R12A 3MKVA 1GEHA 4YTUA 1CLXA 1AA1B 4RDVA 1GZ1A 4LT9A 2BNJA 3GR8A 3FX4A 2WBKA 1JQVA 1DIKA 5CPOA 1QOQA 1R3QA 3PBGA 2IPJA 1P43A 3BUVA 3O06A 4JTEA 3B9OA