2DW7A

Crystal structure of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and meso-tartrate
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
388
structure length
388
Chain Sequence
SVRIVDVREITKPISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERHGVKANPRVFVYAAGGYYYPGKGLSMLRGEMRGYLDRGYNVVKMKIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIGFEGKSDLYKEMKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Enzymatic Activities in the Enolase Superfamily: d-Tartrate Dehydratase from Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Lyase
molecule keywords Bll6730 protein
total genus 135
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.2.1.81: D(-)-tartrate dehydratase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2dw7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2dw7A01
2PODA 3SBFA 2QJJA 4GYPC 5FJTA 1P48A 3DERA 4GMEA 2XGZA 3S5SA 4FI4A 4A35A 2XH2A 2QJNA 4GGBA 3MUCA 5FJUA 3QN3A 2GGIA 2AKZA 4H2HA 4YWSA 3OW1A 3TWAA 4IL2A 2NQLA 2QDEA 1W6TA 1DTNA 1TZZA 3ZVHA 4J1OA 3PK7A 1SJBA 3GY1A 3CK5A 3K1GA 4IP5A 2PS2A 4HNLA 3RCYA 2QVHA 3D47A 4E4UA 2PGEA 3PWIA 4H19A 1XS2A 3TCSA 1PDZA 1E9IA 3ES8A 3I4KA 4HNCA 3TJIA 4HCHA 2XH0A 1SJAA 3FCPA 5BOEA 3PFRA 2PPGA 3VCNA 2AKMA 2I5QA 3QKEA 5IDZA 2OX4A 1IYXA 4MMWA 2OZ8A 3UCCA 1EC8A 2QQ6A 4E5TA 2XH4A 2P8BA 4DYEA 4E4FA 4J3ZA 3UJFA 4EWJA 3VFCA 3SSZA 3R10A 3ZLHA 2MUCA 3ZVIA 4F4RA 4A3RA 3I6EA 4IZGA 3RR1A 3T4WA 3T8QA 2CHRA 3FYYA 3ES7A 3V5FA 3BJSA 2PTZA 3H7VA 3TQPA 3UXLA 3HPFA 4ZCWA 3DEQA 3TOYA 3RGTA 2GSHA 3CAWA 3GC2A 1FHVA 2OQYA 3NZGA 1BQGA 2AL2B 4MGGA 1ELSA 2OZ3A 4KWSA 3MY9A 3H12A 3CB3A 2ONEA 3N4FA 1SJCA 3P93A 3ZLFA 1MUCA 2HNEA 2XH7A 1KD0A 3I6TA 2OFJA 1BKHA 1P43A 4JHMA 5ENLA 2QGYA 4H83A 3NO1A 1TE6A 4K2SA 3CYJA 1JPMA 2PSNA 1TKKA 3MSYA 3IK4A 3R25A 2GDQA 3N6JA 5FJRA 1R0MA 4HN8A 4X2PA 4ZA0A 3CXOA 5FJOA 4IT1A 3H8AA 1SJDA 2GGEA 3RO6A 3OP2A 3STPA 2GL5A 3P3BA 3EKGA 3UGVA 1KCZA 3THUA 2P0IA 3CT2A 3NXLA 2OZTA 3V5CA 3IJIA 3B97A 3KUMA 2DW6A 2PP3A 2OVLA 1PDYA 3SN0A 2HXUA 2RDXA 1MNSA 3MKCA 3R0KA 3V3WA 4HCDA 4GIRA 2PCEA 3V4BA 4IL0A 1ONEA 2GGJA 2PGWA 2XSXA 3FXGA 1NU5A 1L8PA 3SN1A 3N6HA 4HPNA 4K8GA 3VA8A 1FHUA 2PTWA 3SN4A 2PTXA 1EC7A 3VC6A 3UJSA 5EU9A 3T6CA 4JN7A 4GISA 3R11A 2AL1A 3FJ4A 3MZNA 4MKSA 3UJ2A 2PMQA 3ENLA 6ENLA 3TJ4A 3SJNA 2P88A 3FV9A 4M0XA 2O56A 3DFHA 3NFUA 3SQSA 3OZYA 3VDGA 3UJRA 4M6UA 1F9CA 4KPLA 3R0UA 3BOXA 3OTRA 2POZA 4A6GA 4KT2A 3H70A 3DESA 1MDLA 2PP0A 3VC5A 4E6MA 1KKOA 3EEZA 3QLDA 3GD6A 3QTPA 2PTYA 4G7FA 3UXKA 1JDFA 3U4FA 1WUFA 3DDMA 1WUEA 1RVKA 3MWCA 2OQHA 4GYPA 4DWDA 1EC9A 3U9IA 1EBGA 2FYMA 2PU0A 4DHGA 2HZGA 4E8GA 2QDDA 3ZLGA 4Z17A 3N4EA 4G8TA 1XPYA 3T9PA 4ENLA 5FJPA 3TTEA 3Q4DA 2FKPA 3GO2A 3ZVHB 3DGBA 2GGGA 2AL2A 4HCLA 3DG3A 3TW9A 1KKRA 3IJLA 5BOFA 3JVAA 4IP4A 3S47A 3DG6A 3IJQA 4HYRA 3Q45A 3UJEA 1EBHA 3OPSA 2OO6A 2HXTA 1YEYA 2PP1A 1MRAA 5J04A 2QJMA 3DG7A 3VCCA 3OZMA 2GGHA 2ZADA 2PU1A 3RITA 4KEMA 4Z1YA 2MNRA 3BSMA 4K1WA 3QPEA 1JPDX 3D46A 2OLAA 1OEPA 2PA6A 3DIPA 3MQTA 3PWGA 1JCTA 3P0WA 4IHCA 1MDRA 2OPJA 3TWBA 2DW7A 2ZC8A 4DX3A 2OG9A 2P8CA 1R6WA 4DXKA 3JW7A 7ENLA 3FVDA 3RRAA 3JZUA 4FP1A 2P3ZA 3DFYA 4JN8A 4DN1A 4H1ZA 4GGHA 3R1ZA 4GFIA 4ROPA 2OKTA 1NELA 1ECQA 3UCDA
chains in the Genus database with same CATH superfamily
3TN6A 3N2MA 2H9AA 3C2RA 1Q6FA 4RLIA 2GUBA 1PB0A 3BLDA 3RDKA 1VS1A 1EWEA 1DP0A 4W8BA 4F2UA 3GIYA 4IGSA 4A35A 1OFPA 3STEA 1BVWA 1XG3A 2GGIA 2TRSA 4MYXA 4HB7A 4BI7A 2PWDA 3OLGA 4HOWA 4X0NA 5FSEC 1IGWA 4EPEC 3N3TA 1FDZA 4YWSA 4UOZA 4PMOA 1PAMA 4PN2A 1XLMA 1Z32X 1RM6B 1HJUA 4IFKA 1UB3A 3GXIA 4GYJA 5C55A 5K2ZA 2PDHA 4IUGA 4I8DA 3CK5A 5LIKX 1TUXA 1B3ZA 4IP5A 4AZBA 2DVUA 4DB7A 3FA5A 4PA8A 4LYRA 2QF8A 2QVHA 2V38A 3CZGA 1GVYA 4CQAA 3HW2A 2W66A 1DE5A 1RCQA 1WV2A 3UG5A 3R07C 4QJ3B 5I09A 3K8MA 4X3ZA 4EQSA 3PPCA 5AYIA 3FCPA 4S3GA 1XUZA 2PD5A 4WOZA 4M81A 1JROA 1EA9C 1EYEA 1EBDA 1YLVA 2I5QA 3NQAA 4G7EB 3QKEA 1XCFA 3KOZA 3N14A 1R2RA 4GA8A 4R7WA 1JPHA 3GR4A 5LNSA 4LB3A 3MJYA 2BY1A 3BAYA 1VF8A 1ZP3A 4OGZA 5CSRA 1V59A 3NSNA 3NL6A 2QW5A 1JD9A 2YGYA 4JAWA 1XLHA 1MOKA 1QBBA 5FJJA 3AXMA 4AC7C 4O1FA 1M5WA 4IZGA 3WQCA 2G4FA 2W54A 4JGDA 1EZ2A 2QMJA 2PBOA 2O4MA 1YE4A 3L12A 4AZIA 4TMBA 2RAGA 4DO5A 1AUSL 3W2UA 4F2TA 3WDQA 3P67A 3TQPA 1YBQA 5DMLA 1UZDA 4YN5A 2NX1A 4R33A 4QG8A 4BEUA 2JK6A 1UBPC 3D6NA 2GSHA 2WJEA 4QEHA 3EAUA 1H49A 2OQYA 3ZQ9A 1SZNA 4TXEA 3K8KA 4HPGA 3RLUA 5FL0A 3ITGA 1OK4A 4LYPA 3W1MA 3O6CA 4KWSA 3HG3A 1FWBC 1I0BA 5JH2A 4XD4A 1QHZA 1TJPA 4K37A 2DZTA 4WLCA 3AIBA 3CUGA 3QMSA 1V6YA 3AMLA 3W4RA 1JYVA 2NLYA 1JG9A 3STCA 1J2BA 4GVFA 3M0IA 5ENLA 3IGUA 2VJXA 4BY3A 1EQPA 4JDBA 1JCLA 1L8NA 2UBPC 3L0GA 5GJMA 3L21A 2RGMA 3UERA 1GVRA 1XIIA 4BV6A 4GY7A 3UA4A 1ZY8A 5FEZA 4PBFA 4S3CA 3VNZA 2GYIA 2E1DA 3W25A 2GL5A 4XBSA 5EMMA 1TV2A 4I5RA 5D38A 1XKYA 4Y9NA 5I3DA 1VBJA 3DJJA 2W27A 4Q7IA 1TFVA 3W7LA 1LT7A 3W26A 3ZMRA 3WDJA 4MY8A 1TSIA 3S9YA 2OVLA 3OBAA 3EPMA 2HXUA 5FEPA 2ISDA 2Z1BA 1FKWA 4N4PA 1W5PA 3T2OA 3N25A 2OLHA 1TWWA 4AD1A 2IXVA 2FFIA 2YPIA 1KTBA 3WLOA 1ONEA 1XKJA 4J2MA 4TQTA 5DFAA 3B8SA 4IGNA 1UKPA 3MA8A 3THCA 3RXZA 3QJAA 3W1NA 4HMEA 1ISVA 3TNOA 2PE4A 2OZ0A 2ZA1A 1EJ7L 4BK9A 4H4YA 1FH8A 1E0WA 3MI2A 1S2VA 4HZ6A 2J78A 4PMNA 2QIWA 3W2NA 4EF8A 3RF9A 2PMQA 1A3HA 4YYCA 1BGAA 2PDKA 1KBLA 4FXJA 1O1ZA 1B4KA 3UXIA 2EKGA 4LVGA 3AYSA 1CGXA 4FSAA 3EWZA 4LV4A 4O53A 2DIKA 1HL9A 3L5AA 2QDGA 1QNOA 4ERAA 4M6UA 1ZAIA 4KPLA 5TD4A 1AZ1A 3VIKA 4RPQA 2WLYA 4IPLA 3H2EA 4LQ1A 2I5IA 2V81A 4US5A 2XM2A 4JTEA 3BAKA 2NXGA 1F7BA 1MDLA 2ZIDA 4K68A 3CB8A 1KKOA 2PDFA 3EEZA 4OBRA 2PTYA 2C19A 2NWRA 3CLWA 4XSLA 2VYOA 1EO5A 3ANYA 1GETA 2IPGA 4LUTA 5LGXA 1CLKA 1NQ6A 3ARVA 3O6DA 1A50A 1GEQA 4QHRA 4KERA 1VYRA 2E9LA 3VGGA 2OX1A 4UFJA 4TMCA 3P74A 1L6YA 1LRTA 3IIZA 4OV9A 3T9PA 4U5IA 4ZOHB 4R88A 1W9DM 3IGSA 1VLIA 2OKOA 4O10A 3SUSA 3LTYA 3DH7A 1WNOA 5BMWA 1HP5A 1KXVA 1UWSA 4IP4A 1JZ3A 4YCPA 1GQLA 2ZICA 2WKGA 1G01A 1D3CA 3FJLA 1E72M 1GPWA 2DZUA 4QLJA 4U31A 5H8PA 1J18A 3PBGA 3EXRA 3WBXA 1WX0A 2PP1A 2E77A 2I14A 1VEPA 4B3KA 5C9ZA 4E3TA 4YHEA 1S3HA 2VX7A 3RR4A 3CQHA 1E6QM 5TNVA 3WD1A 2XIOA 3FAWA 1O7AA 1TO3A 2XTKA 5CPQA 1XYMA 5HOSA 2MNRA 5C71A 1ZMCA 1JPDX 3D46A 1UWIA 3GNPA 3VE9A 3W70A 3SW6A 2UY5A 3K46A 1RA5A 4GQQA 1W91A 2XU2A 1UD6A 3TYCA 4MWAB 2OYLA 3TWBA 2WANA 3ETRB 1NDZA 3O6YX 1VB9A 3E0VA 2GR3A 1GQNA 5G4HC 3FVDA 1EL3A 5MKGB 4JS3A 3DOPA 1FP8A 1PXGA 3M6DA 1V7YA 5ECUA 4M82A 2JIWA 3L2IA 3UCDA 5C8BB 1A5AA 2VD9A 4GYPC 2FTWA 5AHIA 3KTXA 4WOQA 2X50A 3LPGA 2XGZA 3V35A 2F9RA 1M1BA 1OF6A 4ZSTA 2DP3A 5GRTA 3M0YA 2VR2A 2TSYA 2D20A 2YCIX 3QN3A 2VZOA 3T0DA 3B03A 4FDCB 2YCEA 1KFKA 2D3NA 2CBJA 4TVDA 3UEQA 4C6KA 1JZ4A 3M46A 3UVAA 5AC7A 3NVYB 4BR1A 3ZOAA 3A9IA 3M0VA 1RQHA 2X7WA 1DIKA 4CN1A 4ASTA 1P6CA 1F73A 1FCQA 3VDBA 3NO3A 3KVLA 1V3IA 5BXSA 4IIHA 3W85A 4DBWA 2WQDA 3TCSA 2CLHA 3W75A 3U2EA 2PWFA 3VOJA 5C2GA 1UZ4A 4LAUA 5DF0A 3WD3A 2BGNE 2OX4A 4MMWA 4NAFB 1X96A 2H8XA 5LZLA 3CH9A 4KEZA 1YX1A 4ICCX 1LORA 1A5UA 1DL3A 1QOPA 4ROQA 3CV2A 4MJ2A 2C13A 4UUIA 3C2VA 1K9TA 9XIMA 1XRTA 1KN0A 3OYZA 5CPNA 1E6SM 3MS8A 4S3FA 1ZB5A 4C6JA 1V6UA 2BX7A 3T4WA 1HF6A 1VD6A 3ARZA 3ARRA 1JR1A 3C52A 3O06A 4PUDA 5F7UA 1EGVA 3W7DA 3GU9A 2DJLA 4O0KA 3LCIA 1O6IA 2OTDA 3NZGA 3THDA 2CZEA 5L6UA 4LUSB 1WAWA 3SURA 5A94A 3S2CA 1N61C 1Z44A 3E3HA 4RXFA 4ECLA 2QJIA 1KFCA 1PBGA 2TPSA 1FWGC 2XUCA 1OSEA 3KLJA 3CUZA 1Z41A 1FFRA 1AQFA 4NXSA 4Z2KA 3PTQA 4PH6A 3T09A 3BURA 1LYXA 3QM3A 3CGEA 3WQEA 3AHXA 3II1A 3NGJA 3CYJA 1PWMA 3BWWA 2D2GA 3QTGA 4PC8A 2FB3A 2GDQA 2Q71A 3HQOA 3U7BA 1POJA 3V0TA 4X2RA 3O6AA 1R3WA 2HVNA 1ONRA 5DMYA 4IFKB 3AWOA 4MJZA 1I2QA 3ITXA 1JCYA 2ZUTA 1B4EA 4RZ6A 1CBGA 1NOUA 1SU5A 5BU6A 5BRQA 3A9BA 1HKKA 1QNVA 1NHSA 2RDTA 4GI8A 4JL1A 3NM3A 4PB4A 1DKWA 3CXBA 1I2NA 5ECVA 2VFIA 4NASA 3SI9A 2YL6A 4TUFA 2R82A 4HU4A 1VDVA 1R3TA 1BAGA 2ISVA 1OQFA 4URIA 4W86A 1JDEA 4CU6A 1AVAA 3REQA 4MNLA 3R0KA 2ZE0A 5HWNA 4DJDA 2PCEA 1GKRA 2EEXA 1LWHA 2ZZ3A 2HDJA 5TR3A 2FZ8A 2XSXA 3EXTA 4XIMA 4M19A 2HJPA 2KZHA 4WR3A 3RM9A 3WF4A 3HG2A 4UTFA 1EC7A 1E3ZA 1JF5A 5XIAA 3NQFA 4S3EA 4HKPA 4TX6A 3LNPA 3FJ4A 1U83A 4ZOBA 5T8GA 4ES4A 3VKJA 3SJNA 1TTIA 3CPGA 3KRBA 3RU6A 4LCRA 2CW6A 1IZJA 4E2VA 4GQ0A 1GG0A 3CEUA 3UJRA 5DELA 1F9CA 1GRGA 1H1ZA 2OWXA 2Q6ZA 2PDNA 1X7FA 3W1XA 4C91A 3HGSA 2GJLA 5CGTA 1ZX9A 3W23A 3H70A 3VM5A 1MMFA 1KBJA 1UKTA 4PSRA 1V0KA 3EKLA 3N29A 1AQ0A 3NTYA 4DO6A 4Z0SA 1TQXA 5CSYA 4ZMGA 1KRMA 4DYKA 1ZK7A 4AHQA 4AHPA 4U33A 3SO7A 3VIIA 2EKCA 2GSJA 4TTUA 5A2BA 4FIQA 4PL1A 4LVAA 2QT3A 2A6LA 5HATA 1LZOA 4RPPA 4H4PA 3DU0A 3THAA 4AZHA 2WM0A 1MQQA 4EWND 3GK0A 4YU1A 2J6VA 3GO2A 4A8NA 3W86A 5JBFA 2AL2A 2CLIA 3C4UA 4BQ2A 2D0GA 3GTNA 3CYVA 3WF1A 5DXXA 5DMMA 5HMFA 4XAGA 2WB5A 3IJQA 3FSUA 4B9YA 3RLGA 1WYGA 3DFNA 4XVEA 2VRKA 4D2JA 2NQ9A 2VGIA 2BP1A 3PJUA 3DN5A 4IP7A 4GI6A 3P60A 3SECA 2D1ZA 3AU6A 1UR1A 1GHRA 4QAWA 3LI1A 2YVGA 2VX6A 4QE5A 3K1DA 5CPSA 4LA1A 2F84A 3EOUA 3BC9A 2H3BA 2JGYA 1T6MA 5LIYX 1QATA 3O05A 2PDCA 3EA1A 2WWDA 3AXHA 4NX0A 1T96A 2CNCA 2IKHA 1TVLA 1N55A 4OBTA 1YQ2A 2E6FA 3HGRA 4FZIA 3DHDA 1AW1A 3CIVA 5AVNA 2W9MA 4O8RA 2ICSA 4JTQA 4FP1A 4LRTA 4XD3A 3B9JB 2HQMA 1UA7A 3OEXA 4MHBA 4LOCA 1EF2A 2OEKA 4GGHA 1W32A 2WPBA 2QJHA 3HG4A 2DZAA 3WKZA 1J01A 3QOKA 4IXHA 3VFLA 1UMLA 4AZ7A 4O15A 1OJXA 1SFSA 4R7JA 3LMZA 1CGWA 1V6VA 3ATYA 4UZUA 4QP0A 2AKZA 4RNIA 1TV4A 3W1UA 1VPYA 3MP5A 2XSBA 4K7YA 3TXZA 4ERGA 1TZZA 4UTUA 3MV11 3M4HA 1FIQB 4LT9A 9CGTA 1RQBA 1SJBA 1JXJA 2H90A 2CXGA 4C60A 2ZXAA 3S42A 3SQMA 1UWUA 1U5JA 3K30A 1ZBVA 3KVMA 1QI5A 1QNQA 4E4UA 4DJDC 1TX0A 4JNZA 4PR4A 3RUBL 4IXXA 1BWLA 1R9ZA 1M41A 1W1YA 3SCWA 4B5VA 2GDVA 1BQCA 4JEQA 1DJNA 2YR1A 3SRFA 3TX9A 1FP9A 4W7WA 1CGUA 4QM1A 1CIUA 2A85A 2VX4A 3WEOA 5AC5A 3WQOA 5D2YA 1VHCA 4H9VA 4FNPA 3IJ7A 4LS2A 3ZSTA 5E9AA 5I6SA 3WQVA 3KWSA 4AD2A 4N9EA 2HVOA 4LS1A 4D6GA 3S1GA 1PZ2A 2BBFA 1QRQA 1T7LA 2GWNA 1K4QA 3PBUA 2WP5A 3W7IA 4H4WA 4EPBC 3FYYA 4JEJA 4AD5A 2PTZA 4LJ3A 1IE7C 1SYTA 5LXXA 2GQ9A 3O0FA 4V2XA 2BVWA 1JD7A 3DEQA 1ADOA 1LOQA 2E5CA 1TWIA 2Z1KA 3BLLA 5LKYA 3BG3A 4NX5A 2V3FA 1DJYA 5GNYA 3AICA 4C6LA 1FWFC 5BOOA 2YFOA 2DORA 1EO7A 1Q8AA 1W9UA 2YQUA 3GW3A 1GRTA 3IAPA 1NM9A 5CGMA 1UKQA 2NLIA 4PUEA 2YL8A 4L5ZA 4DXVA 2ON3A 2W0UA 1E5JA 2VC5A 1O4UA 3ARSA 2DDXA 1SZGA 1TMQA 4WDWA 3ITOA 3ZT6A 1F3WA 1KW1A 1Q5MA 4JFTA 3R89A 3SGUA 2Z25A 2ISSA 1KBKA 1TWSA 2GQ8A 1ZLPA 4O0ZA 1QO5A 3RPTA 5DRIA 3IJ8A 3GH7A 2FZBA 4I8YA 3TROA 4AAJA 1A5KC 3U2ZA 2JGQA 3W24A 3LHYA 3CUIA 3QF0A 4Q8QA 1S1RA 4A8RA 1RJQA 4ZOEA 3QMTA 3WLKX 2ZRWA 3STPA 1YNYA 1KWKA 3QR0A 4Q4PA 1KQZA 3UGVA 4HK6A 1W1PA 4K1GA 1FWCC 3II4A 5FJIA 3SFKA 2ISWA 3BLOA 2IQTA 4JQ2A 4UCFA 3RM4A 4LSBA 4MPKA 4UMAA 3J7HA 4MB4A 5TQLA 4JL2A 4UQDA 3UCQA 3NXFA 4IQEA 2WVUA 3CT7A 5DCDA 3NZRA 2WPGA 2P3EA 4S39A 4C6PA 4AY1A 4J7RA 3JS3A 3ZYZA 3HN3A 3QBUA 2OO0A 1X38A 2XIBA 2E7FA 3TFCA 4R27A 1LOLA 2CLKA 2B81A 2SFPA 1GVFA 1TTPA 1YTEA 5B7YA 1ECEA 4RNHA 4US6A 3VC6A 3QPZA 3NL5A 3WX7A 1ZJBA 1ITCA 3UJ2A 1DEDA 1ICSA 3GDMA 2VWSA 3TJ4A 4TVYA 1A80A 4NNAA 5FL1A 2C18A 3C2OA 1Z7AA 4KQNA 2INEA 1GONA 3G1SA 2O56A 4DWSA 3NFUA 4RJEA 2XFRA 2X1UA 1HNYA 1DE6A 2FZNA 3VGDA 2DZBA 4GXWA 5U25A 4AX7A 3F5LA 2G37A 3WJXA 4A6GA 1ZAHA 3WQPA 1VHNA 5G4WA 3DCPA 2QCNA 1TPUA 4LTSA 4B2DA 4MZYA 2YCKX 3WMCA 3QLDA 3V18A 4YHGA 3W7PA 5AYBA 4JTIA 5FS7A 2HVMA 3DDMA 1WUEA 1EFZA 4HGXA 1DIOA 1SSGA 2O9OA 3MWCA 4UNKA 4Y9MA 1UPMB 4UMCA 4DWDA 1VYSX 4HJWA 4Y6GA 4NNCA 4AZCA 3EMQA 5KINA 3NDOA 3OZOA 1KBBA 1CB7B 4R53A 2J7EA 4JTHA 4H8VA 5E5CA 2B7NA 1TTJA 3WBEA 5H2ZA 5KETA 3QHOA 2A8XA 1G6CA 2FTPA 2GVEA 2PFHA 1SW0A 4JYEA 4H3DA 2AQOA 3Q45A 3ATZA 5DT5A 3AIQA 3OPSA 5C7VA 1CWYA 1M65A 1SFJA 1QI4A 1YMYA 1S5MA 3CQIA 1NOFA 3GSMA 3OBKA 2OOGA 4JTAA 2W79A 2FPTA 3QMRA 4GUFA 3PF3A 1PKMA 5FF7A 1FCUA 3W71A 1EX5A 3QPEA 3OHIA 5BRBA 5A3HA 4ZGYA 2PA6A 1K8CA 3AUJA 3MQTA 4A22A 1JCTA 1OD0A 4L61A 1RBOB 1E15A 2FVMA 4XZMX 3EA2A 2FQIA 1QASA 3W6MA 3FHAA 4AVOA 3M0XA 5G2IA 5EBUA 5EY5A 4N9CA 3TN3A 3APGA 2EQDA 4PRTA 3TC6A 1NH6A 3DC0A 4CEUC 3IAQA 1WOBA 4QSFA 2OKTA 3U48A 4IGHA 5C9UA 3W88A 1TPH1 4MWAA 2TYSA 4MFDA 5EMKA 1VCGA 1HO1A 1TG7A 4M5PA 1PHWA 1B9ZA 3Q37A 1BRLB 2REQA 3WF0A 4HPXA 4JCMA 1BLIA 1H2JA 3GFXA 1R5YA 4IMCA 4UTJA 3OQ8A 4WKFA 4DY1A 1V6WA 4KFOA 5D37A 3NOYA 3CAKA 1E1FA 3S6TA 1B2YA 1JZ7A 3G22A 4DLMA 3GQYA 2A21A 1W17A 2CKSA 5TAOA 2YL9A 1FO4A 3LCGA 6XIAA 2WPEA 2PGEA 1O1HA 4K39A 3LN3A 1M7JA 1E4NA 2JQXA 4H4TA 2PPGA 4ZB2A 5CLWA 4H4QA 1VBUA 3A4AA 2EQ8A 2X41A 3FHQA 2QCFA 2EG8A 1HFBA 1M3UA 3NQ6A 1IYXA 1LTDA 1KBIA 1EC8A 1G7UA 1KTNA 2J7GA 3T81A 3AMGA 3EDJA 2ACRA 4D6HA 2NT0A 5M2FX 1R8LA 1BTCA 3MHGA 4E4FA 1OHLA 5HNNA 1R30A 4A3RA 3BZGA 1JCJA 1VH7A 1UQZA 1KM4A 2IUZA 3T08A 1OK6A 3USBA 1P7TA 1IWAA 2WNZA 3U5UA 3ICJA 3O3RA 1D7FA 3T8QA 1Q66A 2YBTA 3CMGA 3G77A 4UMBA 3V5FA 3M7WA 3KTCA 4CU7A 2WVVA 3EANA 3TMLA 4LGXA 4P8UA 3CL8A 1GG1A 1AJ2A 3WJSA 5FMHA 3DAQA 1OT1A 5IXEA 2E6YA 1X7IA 3MHUA 1KM0A 4DJED 4GUIA 1AH0A 3I3EA 4DVOA 1KA9F 3AIEA 1OFRA 1EUNA 4PMVA 3CB3A 1RSCA 1QOQA 2VEKA 4MUZA 3KBVA 5D9PA 2Y0FA 2BVDA 3MANA 3PBVA 1Z89A 3QFWA 1YRRA 2FMOA 1SJCA 6ALDA 1KD0A 1XXXA 4QROA 1SGJA 2PLCA 4QBXA 2C3DA 3CZ8A 3ARTA 1VCFA 3T2QA 1UUOA 1Q4NX 3O7UA 2HNHA 1B9BA 2QUMA 4JTSA 3GX9A 3WH7A 3Q94A 4GZIA 4B3LA 1E4MM 5HR6A 2QYGA 2IS7A 4NJGA 1IIHA 4WSKA 2Q02A 2WOWA 1J5TA 1FQ0A 1ONXA 2VO5A 4IIBA 1V77A 1OFAA 4O1BA 3T40A 2Y63A 3VKCA 2RHGA 3P3BA 3I7SA 3RNMA 3D3AA 2XVGA 1AJZA 4GZJA 1XPGA 3WK2A 2FB2A 3VIPA 1AG1O 4XV0A 5I3FA 4B5TA 2A7RA 3C0SA 3CGDA 3PHAA 2PP3A 4WCJA 2ZWZA 1QBAA 4C1NA 3FAXA 4UFLA 1JQVA 3UY8A 3GC5A 3EB2A 1TUFA 1SO5A 1WDQA 3VUSA 5CG7A 3GXTA 4GBDA 1JYXA 1CGVA 1RP9A 3AOFA 4GPNA 2GR1A 3GG8A 1H1NA 1QAPA 5A69A 1XF0A 1V79A 1E73M 1VPXA 3LHWA 5HQEA 1YBQB 2AL1A 4W89A 3MZNA 2JEQA 3JZEA 3N13A 3RPMA 4K7VA 3VIHA 3VKKA 5I02A 1AMYA 5E9XA 1A5CA 4E3VA 1SSDA 4UTMA 1K70A 4KCVA 5HMSA 4XQ6A 2WOQA 1D8CA 2NQHA 3I3BA 4ADUA 4B90A 1VENA 2YFNA 3R0UA 4AH7A 1WYIA 4CQCA 2DSWA 3QVQA 2X16A 1QPNA 1R3YA 1NHPA 4UFHA 4I90A 3SR7A 3E5PA 4UBPC 3P82A 3CUFA 3OGSA 3H24A 2WMFA 2EPKX 2J74A 4ZSUA 1R85A 5KVHA 3E0IA 1SW3A 4WRHA 3ABZA 2EBNA 2V5BA 1JVNA 4PTVA 1C93A 3W7JA 3APYA 2OQHA 1NFBA 2W4XA 3EYPA 4L9XA 2ZZ0A 3BAXA 2PWUA 2J77A 1UOZA 3FKKA 1M53A 3ARPA 2ABBA 1QPOA 3VKBA 1CXHA 4LEQA 1ZJIA 1XGZA 3B4YA 2FKPA 5KMYA 5KZ6A 5FF4A 4R7OA 4GI4A 3G1YA 2OLSA 1AL8A 1EXBA 2JEPA 3SIZA 3CHFA 1F3PA 1I8JA 5CSUA 4JR5A 4K3ZA 7XIMA 2FHBA 1E0VA 1ENUA 4H4RA 2J6XA 2QCGA 3LCLA 4Q8MA 1F74A 5E09A 3ZXWA 3AMCA 3QZ6A 4PMQA 2BY0A 4X61A 1M03A 2W55A 5K9CA 4Q8WA 5FF2A 4F0RA 1YW1A 1XH0A 3SQPA 4Z2IA 5JBEA 3U5YA 2F2KA 2GWGA 5D9NA 5BWFA 4FLSA 4G1KA 1B3WA 3MUZ1 4GYKA 2IMRA 2OPJA 1H50A 4HZ7A 2ACSA 3MV01 1X1ZA 1W8GA 1Q2SA 4S2CA 4WX2A 4CUCA 4HOXA 1DPMA 1I2RA 5D8ZA 3JZUA 2AGKA 5AYXA 1PKYA 1WQ5A 1MNZA 4L80A 2HWGA 4H1ZA 3ARWA 3HU7A 4ROPA 1ECQA 2PODA 1XBVA 3QYSA 4DBSA 1RUSA 4XAZA 3EX6A 3N17A 4TIMA 3S5SA 2WMJA 1G4SA 1XCWA 3MUCA 2DH2A 2DY3A 4YNGA 4XO7A 4H9MA 4H6KA 4RW5A 4JXCA 1GVSA 1R3VA 1XFCA 1GPFA 3H22A 2NQLA 1GXFA 1DTNA 1UW9A 4GZ7A 3TXVA 4J1OA 3SY1A 4RX0A 2WBGA 3LZ3A 2TAAA 4H9YA 2PDXA 3L23A 1QHOA 3C3UA 3NOEA 3N19B 2VR5A 3VZZA 1IT7A 3E9AA 1DTUA 4AIEA 5EMJA 3SCPA 1E9IA 1W2VA 4QDMA 4GVHA 2PLKA 4MPQA 1YDYA 3EWYA 4FPSA 1KCKA 1J0ZA 4P7RA 4PUWA 1ICPA 3LLDA 4G7EA 3GDBA 3ELFA 3GUWA 2AKMA 2A3EA 4LBSA 5C2XA 5A8NA 2Y7DA 3WF2A 2CFYA 3M64A 1UOKA 4Z0JA 4XX6A 4ICMA 3H6OA 4HNTA 3ZZ1A 3GU2A 4WEVX 3CHEA 2FVLA 4AY8A 2J25A 2FJKA 3ZVIA 1R3SA 3MTWA 3F4WA 3RR1A 4JKKA 3N18A 3O1NA 1LLZA 1Z8AA 2ZZBA 1GOQA 2CHRA 3RHGA 3A3WA 3HQNA 4QE4A 4PMYA 1BSLA 1CTNA 2JKAA 3EWDA 3WN6A 3QOMA 4ZO7A 2XVNA 5I3KA 3S1UA 4D72A 2YB4A 3PJTA 1K4HA 3R2GA 4I7WA 2CHNA 4O1DA 5CZTA 2Z2UA 1UJPA 2O55A 2OZ3A 4MNJA 1F6KA 3AJXA 4DF1A 4NG3A 2V30A 4XUGA 1UPPA 3MUIA 3DKJA 1S5TA 3D9XA 2W6RA 3W7OA 3A13A 2NV1A 1R7OA 3I10A 3PNUA 3LSCA 4QS5A 1L6FA 5IRPA 3CNYA 1Z42A 2FVKA 3WLQA 3PAOA 1HW6A 1PIIA 1AQHA 3FX4A 1KCXA 4IMFA 3T0AA 1UIOA 3F2BA 4O12A 3VIJA 3TQ0A 4YTSA 4DUOA 2PDMA 3B40A 1R0MA 2DH3A 2I7GA 1UR3M 1KV8A 4AWUA 2CESA 2NSXA 1UD5A 5FJOA 5C2CA 4IT1A 3VIGA 3ALFA 1SJDA 1PZ3A 1TRDA 4W8AA 3WLSA 4PTNA 3UFYA 3JRKA 2YBUA 4EXQA 2H3DA 3B05A 1N62C 1O94A 3TKFA 2DUXA 4PCPA 4ACZA 4UCGA 1V97A 1C7SA 2C1HA 2OZTA 2ZUVA 3DYOA 4NRRA 4XG1A 1QK0A 4YVVA 4MJ4A 3LBCA 1A0CA 4PYSA 4YMZA 3CZJA 4C6QA 5DX7A 3G6LA 4YLWA 4AD3A 1B57A 1ZSXA 3NQMA 3RJYA 3VGFA 3V4BA 4IL0A 5A1AA 1LG2A 2Z29A 3NRZB 3TEVA 3BG9A 2J47A 3GNXA 1Y7VA 3EOOA 1E6ZA 3CUXA 3N6HA 2Z6IA 4HPNA 4HZ8A 3NL3A 3BOLA 1LF1A 4A21A 4FNUA 4PMZA 2ZQ0A 4TU1A 1VPQA 6ENLA 2DT3A 1Z3NA 4GJ1A 1VBHA 3UGRA 3OU8A 3ORWA 2YXXA 3QHNA 3BLKA 1E1CB 4YCOA 1CECA 5HBFA 3WEZA 1W54A 1GW9A 4CNSA 2R24A 4Z2LA 3DBPA 1JRPA 4J3VA 4GFSA 2R9ZA 5I23A 3EDKA 1JULA 1A0DA 5FEWA 2VCBA 3CL7A 3VC5A 3V7PA 4D1IA 2V5JA 1RLDA 4BWLC 3PG8A 3E2VA 4HPHA 3WLMA 4QJ4B 2W63A 5CJ5A 1ADSA 5A8QA 3NM1A 2AAQA 4FX7A 3ABXA 3N3MA 4GJJA 3S6OA 4JDYA 4LB4A 3UZWA 1Q6CA 4DHGA 2QCEA 1DQWA 3UWQA 1RAKA 1EPVA 3C6CA 3WD0A 1PX4A 1CX9A 1KM5A 3LHVA 2Z1SA 3UR8A 4G8TA 1RVGA 4L4LA 3TTEA 1BXCA 3CHDA 1K02A 1RK5A 3RM8A 1OC5A 3IIPA 1KM3A 2XGBA 3FVMA 1GVIA 3MUXA 4ZB5A 3F1QA 3RRXA 4AZCB 4YTTA 3IJLA 4S3AA 1VEOA 1GQJA 3JVAA 3STFA 1NAL1 2F8QA 2BHZA 1NF7A 3W82A 2OCZA 1XLDA 3M0HA 3UZXA 1MEIA 1Q65A 1MRAA 3HO8A 1TYTA 2BASA 2W3RA 2WZIA 4D6DA 2ALRA 3GNNA 4U2YA 5TIMA 4XSMA 1PYMA 3QGVA 3VD4A 3ZJ8A 5AHEA 4GX9A 3QLLA 1O68A 2HS6A 1K7FA 3V5OA 1QVBA 1BSIA 3V75A 5D2XA 1MYRA 2QUNA 3GTXA 3I4EA 3HQPA 8TIMA 4O11A 5E0FA 3WUFA 4IHCA 1ICQA 5JMUA 4C6OA 3FN9A 3QQ0A 3F03K 4DX3A 5HMEA 4OVXA 4ORIA 4JKMA 3WMLA 1T3QC 3QPYA 4Y9OA 1Q8JA 2W3ZA 2Y62A 2ZX9A 1NEYA 2CLOA 3OA5A 4B5NA 4F79A 2ZXDA 3VNIA 3EOLA 1E1EA 1CT5A 1VEMA 2O9PA 1K6AA 3CIWA 3F5KA 1QT1A 5CEWA 2E6AA 4FNRA 1W9VA 2PWVA 2JK2A 2E3ZA 2QR6A 4LAZA 2A0NA 3WLPA 1C8XA 1IV8A 1GHSA 1NFGA 2ISFA 3SRHA 5BWAA 1UZ1A 3GR7A 3KBJA 4FB7A 3BG5A 1E70M 2Y85A 4IL2A 1V5XA 4C7DA 4GG9A 1W6TA 5FSDC 4NU7A 4WHBA 2BSLA 1HL8A 3NGFA 3WNOA 1TX2A 3N9RA 2VCCA 3HOJA 3C56A 1GZGA 4M29A 5EB8A 4K7ZA 1JCXA 1VR6A 2PWHA 3BUVA 2YSWA 2EQ9A 4QG9A 1XLCA 4EMWA 3BW4A 4H19A 1FECA 1XS2A 1VCVA 5BROA 5I2UA 1TR1A 4BQ3A 3I4KA 3G0UA 3TJIA 1F76A 1E6NA 1F4AA 2CFFA 2XG9A 2WOVA 3UWZA 1LL7A 3IRDA 1BYBA 3CHVA 3QZEA 3VD5A 2VZTA 2ZE3A 1CB2A 3GBDA 4PB5A 4PUMA 5D05A 4Z1CA 2VDHA 1QFEA 2QJGA 1EUAA 2P8BA 2OR2A 4HK5A 1K8YA 3VX0A 1G4PA 3V0UA 4GY0A 3DKLA 1ONWA 4ATDA 1HG3A 1UD3A 3Q65A 4UQAA 4GH1A 3GD4A 2TPRA 3ZLHA 1E5NA 1BXNA 4KGJA 4X22A 3I6EA 5JIWA 4NP7A 4DBUA 4F3HA 2CCRA 2ZRUA 3WDHA 1BF2A 2XIIA 2C0AA 2ZVRA 3G3DA 3H7VA 2GOKA 3LBOA 4DAFA 3FJNA 3IUHA 4Q8UA 3UZ5A 3TYBA 2H8ZA 2FFCA 1X8CA 4LVFA 4OECA 2VVNA 3LTPA 3MSGA 2F5ZA 4FOJA 3VNDA 5CAKA 4FR6A 3LDVA 5CC5A 4MIMA 1V0NA 3LS9A 5F1UA 4Z2JA 4N0RA 4JIHA 1H7RA 3PP7A 2FDMA 4ICNA 1E51A 1N8FA 2G3MA 3RNDA 2R9RA 4JTFA 4S3JA 5M5DA 2J27A 5AB3A 3BARA 4OWGA 1B90A 2NX9A 3PUGA 5FEXA 2QZRA 1K8XA 1Y0EA 4MWAE 3ABRA 1W3LA 4NEWA 4J3UA 2Y4SA 3LERA 3MKVA 4PMUA 3AHZA 2BCPA 1G5AA 5J8LA 5IHRA 2WPCA 4RDZA 2CYGA 5EBKA 3BH4A 1V08A 3TW7A 1D2KA 2EPNA 4TO8A 1VRDA 4DI9A 2ZX6A 3GVQA 5EPDA 2BB0A 2Z0IA 2R1MA 4E38A 3NVWB 1HGYA 1F6YA 1UD2A 1DWIM 1KXTA 4AZ6A 3T42A 3FYOA 2V8ZA 1IWPA 2IKIA 4IG2B 2J9XA 3LM3A 3FFSA 3W2KA 3OODA 3CT2A 3SCQA 3WQ6A 4O0QA 3LYEA 1UR9A 2FZDA 3WLLA 3K13A 3ID7A 2QGHA 4ATWA 1I0DA 1U33A 2RDXA 4M6QA 3L67A 3HGOA 2B4GA 4GIRA 4KRZA 1MFVA 3SCNA 4Y96A 4XIAA 2DVXA 1W1IE 1IZKA 5T26A 4REQA 3BLPX 1JUBA 1TR9A 1XIBA 3AI0A 4N6EA 4QNWA 3WDIA 5G1TA 3RO8A 1XGDA 4ERIA 1RH9A 1B1YA 2PTXA 1KWGA 1LQAA 1QI0A 3PZ9A 4MWAC 1FH7A 1O95A 5EU9A 3ZJ7A 1I1XA 4GYFA 4XTDA 3B0PA 2V3EA 3ENLA 3CZKA 4O1EA 1VQZA 2YB1A 2C91A 4DJFC 2PDQA 3QYQA 1LUCA 1R86A 4O19A 3WNPA 2DQXA 4M0XA 4YVPA 3DFHA 1EEPA 3SQSA 2CITA 3M6YA 5LNWA 1WKYA 2OOFA 1VFLA 4M8UA 5D02A 4PCSA 4XZ9A 5BXTA 4J28A 2ZZ6A 3IVTA 3QV8A 4LUSA 3QV6A 4DI8A 1E40A 5JBDA 3S9ZA 2GRTA 1H41A 5PTDA 3VMPA 1VGAA 5EMYA 2PWEA 4JKLA 3W7KA 1FX6A 3IWPA 4Q4KA 3DUGA 4MF4A 3PBMA 1XCXA 2O9TA 4YYFA 3VI2A 1X39A 3NQDA 5HUPA 2KX9A 1AFSA 3GDTA 1C7TA 4ATLA 5H8UA 3U9IA 1EBGA 1U22A 3SCTA 3QY7A 4MJMA 4CQ8A 3ZLGA 4Z17A 3H54A 3LLXA 1F2JA 2J9ZA 4ENLA 3SCOA 1GUVA 4ILSA 1XDIA 3G8RA 1Z48A 2GQ3A 3K8LA 4GK8A 1KKRA 3RLVA 3VOFA 1A5MC 1WZMA 3MMDA 3KLKA 2ZZ7A 1LT8A 4HYRA 2HCVA 3R8RA 4BEQA 3MI3A 3N73A 3UJEA 1QCWA 1YEYA 1FWHC 2NX3A 1PSCA 4EK7A 5AZ1A 1EJSC 3VOCA 4KCUA 4C7GA 3W1LA 5AYZA 1U2YA 3AMKA 1CXFA 4AF0A 4HJFA 5C7HA 4XTIA 4CKQA 2PC8A 1W8SA 1L9WA 3EDDA 1BG4A 3E2SA 5JQ9A 1NDWA 3H26A 3FK4A 2OLAA 4BF5A 2GR0A 2CETA 3W7CA 4C6FA 1AQMA 3USZA 3QC3A 5HWJA 4IIDA 4TX8A 2GOUA 4O16A 5F2GA 4LPCA 1W3JA 5DRCA 2V3AA 4AXNA 1QW8A 3IACA 5BXPA 1FXPA 3EX1A 3K4DA 1ZDLA 1UIPA 4H6RA 3FJ6A 1T99A 4I5XA 3LXBA 2YZ5A 3GRTA 4L64A 1YQZA 1JEZA 5AHMA 1TPEA 3ZFHA 4GX8A 3CGCA 1XDLA 4NZFA 4Q4OA 2WSRA 4BHYA 4XZLX 2XIQA 2OJPA 3OC4A 4MB3A 4D8ZA 4S38A 1CYGA 5FJUA 2V5CA 2QCHA 3ZR4A 4FX8A 1PTAA 1XRSA 4S2BA 2VP8A 3LGDA 2Z1WA 2QV5A 1FCBA 3V36A 4FLRA 3OBEA 1XBZA 4J35A 4AVNA 4FMVA 4OOUA 1Q6OA 2P1FA 2X1SA 3GVRA 1BEUA 3CV6A 1ZBCA 3UF9A 3MHFA 1TA3B 3PWIA 2PEVA 4JNYA 3AC0A 1JZ6A 4LNYA 3FGCA 4LIIA 3URBA 4CNTA 2I57A 5ABHA 2EHHA 3VINA 1EPXA 3SGGA 1UWAA 3ARUA 5BOEA 1FWWA 2NT1A 2FHCA 2BHYA 5CZKA 3AXIA 4MZ8A 3EMZA 5A6BD 2Z6JA 3P61A 3PC0A 2FGZA 2X2GA 4CQ9A 4ZB0A 1TPDA 1E0XA 5C5YA 3AMZA 4J3ZA 1V0MA 1HJWA 1IGSA 5DY2A 2MUCA 3E02A 2E9BA 3T07A 1N8WA 3W7QA 1GYLA 3BLIA 1GTHA 4CN6A 3GIPA 5CH9A 5KSWA 1K9EA 3VUPA 1YDOA 1TPB1 3A12A 2C79A 4MNKA 2BZNA 3MP3A 2BVTA 3SRDA 4IPIA 4WJXA 2FMNA 3ZIZA 1VQTA 2VEPA 4W88A 4A3HA 2J3NA 4JY9A 2HPMA 4HBKA 3OHMB 2DEPA 1MW2A 1UR8A 2VMFA 1ZBKA 4GIAA 3S8HA 7ODCA 3EB4A 3LGEA 1E6RA 3C2FA 5U1OA 1AODA 1KCLA 2OT0A 1V7AA 1R9YA 4NL1A 3TIMA 1BKHA 4LUIA 2BY3A 4HPJA 2BGQA 1QW7A 4O28A 4DNAA 3L4YA 1W3IA 4XZHA 1I75A 3GHSA 3VM7A 4UQ9A 4TVCA 2V3BA 4HHLA 4NJHA 1XHGA 1THFD 1E43A 4HSNA 3DC8A 2XWEA 3H8AA 2WCAA 3WNLA 2BOGX 4FOKA 3WLHA 3TN5A 1KCZA 2C6QA 2OB3A 3THUA 2WCGA 2XGIA 3TYAA 1XX1A 3DENA 2E0PA 1I60A 3AS2A 4KGLA 4XBKA 2ZBTA 3MBDA 4JPGA 1MXDA 4PZVA 1UQYA 3OIHA 3HPAA 3AN1A 5G5GB 3VXGA 1JYWA 2DSUA 1OX4A 3T44A 3N9SA 1PPIA 5A8GA 4NNBA 1G7VA 5FOOA 4E8CA 3I7QA 3CJPA 1LDCA 3LHTA 1NU5A 1B3XA 2XSAA 5G2WA 4OUIA 2ODOA 5FI8A 2I56A 2ZKMX 5CGQA 5KEZA 1X97A 1W0MA 3R58A 3NA8A 4I6VA 3NVTA 2YCLB 4LW7A 1LRNA 3TSMA 4H4UA 2WC4A 4QEEA 4V15A 5CKSA 3VX1A 1HVXA 4MDOA 1STZA 3MYPA 2CLMA 4D6JA 4D8LA 3H2CA 1GRAA 1EHAA 3W0KA 1PJ9A 1GRBA 2E3TA 5E6ZA 1JGIA 4Z1DA 4C6CA 3SM0A 3RFAA 3QGAC 2WKJA 1TV7A 2PCQA 1NARA 4CD4A 4HMCA 4EXBA 1ZALA 2AQWA 5A2CA 5K4XA 3MVIA 3OTRA 1NFPA 1SFTA 1K03A 2Y2WA 4R34A 3RG6A 1VBRA 5D9OA 3V16A 3A7UA 4PCTA 3ZJ6A 4W84A 3GD6A 2JF7A 4N2YA 5BYWA 1RVKA 3W38A 1VC4A 2D0HA 3M5VA 1H7OA 4DO7A 3UWVA 3W76A 2EF9A 1S5WA 3XINA 5D2VA 1FWEC 5IDIA 2J7CA 3DYPA 1P6BA 2HMCA 4MOZA 2V6AA 4GUJA 3EX4A 1H51A 2B7PA 3Q4DA 4RCXA 5LIXX 2PRMA 2WAGA 3CAVA 3ZVHB 5E0CA 3M0LA 4CNNA 2D22A 1KO0A 2XPKA 3GRIA 2OELA 1I6NA 2QLYA 3Q67A 1E9YB 3G24A 2Q01A 1YIXA 1Y5VA 3P0XA 4H4IA 5EFFA 3SUWA 1P4CA 2OSYA 3WY1A 3T1GA 2BXYA 3NVDA 3CUJA 1WZAA 4LYQA 2QMKA 1N5XA 3SZ8A 5I3GA 1DHPA 1KRCC 2WC7A 3ITLA 3AS1A 2YDSA 4O8AA 3BSMA 4ZXOA 4JY8A 1NWTA 4P5UA 3L68A 2PDJA 4Z2HA 1BG9A 1R3QA 2V5LA 4Y8EA 4PUNA 3LCWA 1W31A 2V67A 1GKQA 1JAKA 3A4JA 4MG4A 1R6WA 1KR0A 4PUJA 2OYKA 3HTWA 3M5ZA 2F38A 4KETA 3QV9A 2WVVB 3O07A 4I7VA 3IGHX 4XZIA 3DGRA 2EQ7A 3PBYA 1XW8A 4CD7A 2Y88A 4C6MA 4K6AA 3N12A 3WD2A 1UUQA 4FI4A 5CPLA 3IJDA 3AZTA 1ZKQA 5JCKA 2C7FA 1KGUA 1ZS2A 4H4XA 3WZ0E 3KX6A 3OLEA 5C6MA 1BYAA 1OX4B 1SZFA 2HV5A 1P1MA 4RKAA 4GH3A 4J9JA 3ZWSA 4C6DA 3M0ZA 1MXSA 1MRQA 4NILA 3G5EA 3S1XA 3WUEA 3AO0A 1TYGA 1BFNA 4OIFA 1MO9A 4BZYA 1VFTA 4F0MA 4O14A 1V3HA 1ZXIC 4PULA 4F0HA 1DHKA 4JICA 3E74A 1E0UA 1OVDA 4JNMA 2VC6A 1PO9A 5FAJA 1BTMA 1Y8BA 2GPTA 4PRWA 2G95A 1V03A 5IDZA 1Q6RA 2OZ8A 3UCCA 4C6IA 1MSSA 1AOGA 4A29A 3BZJA 4OV4A 5A8PA 1MW3A 3AJ7A 3KOWA 4HU3A 4G9PA 4GXPA 4NHVA 3WJYA 3W74A 5H91A 3WG6A 2PDWA 2GUYA 2F6UA 1E6XM 1EOKA 3CTTA 3WJZA 1IF2A 4LWWA 1J6PA 4AFYA 4MSSA 5KZMA 4UFKA 3VYLA 3W28A 4WUIA 1REQA 2EG6A 2R91A 1C3FA 3KP0A 1QJWA 2Y61A 1XINA 3LCHA 3MMWA 4OE7A 5E0KA 3TFXA 3L5LA 4DWSB 2YDRA 3DGZA 1DXEA 2J7BA 3CWNA 2AL2B 3N2XA 4CEXC 5EMUA 1ME7A 4HYVA 5E70A 1V02A 1Q1WA 3WQ4A 2EXOA 3EWCA 1FOBA 5ER0A 4F0SA 2ZRYA 2YIHA 2XH7A 3QY8A 5EMLA 4YWOA 3VNJA 3W84A 2X7VA 3MW7A 4XKYA 4H83A 5E6YA 1XDJA 5FACA 1U30A 3W7GA 8XIMA 2WYSA 4JIPA 3ALGA 3R25A 1GESA 2YDQA 4AYGA 4H6EA 2YA2A 3SY8A 3VNKA 3AALA 4P7NA 1SFLA 1ZRQA 1XLLA 2HISA 5HAOA 1IEIA 3ABOA 2QNEA 2EJ1A 3F5JA 2WMIA 1RR2A 3GDLA 3LY0A 5U7SA 1RZMA 1RP8A 1XH2A 3N2CA 3NXLA 3POCA 1XC4A 4KF1A 1UJQA 2CLLA 3KUMA 4H01A 1RBAA 1RK6A 1LBMA 2WZTA 4GKLA 1RD5A 2WSKA 1VJZA 3LB0A 4JN6A 1MNSA 3VNYA 3LSBA 4LNCA 4AWEA 1GZJA 1IQ8A 3TR2A 5A8MA 5I00A 1GWJA 2WNNA 4GINA 1TJ1A 3AISA 4S3BA 1V3KA 1LCOA 2J8TA 1CLVA 2EO7A 4K8GA 3A7RA 2PTWA 3B04A 2BC1A 3E12A 3PTMA 4LCSA 5M03A 3HIJA 4HIBA 3VGBA 1YTKA 5HQLA 4AYSA 2JKEA 3SUVA 2J7HA 1K1DA 5A6SA 4PUUA 2JKPA 4D6EA 3PFMA 4QGCA 1TELA 4BURA 3HFTA 2X8GA 2UV8G 5LA0A 2QS8A 3TTQA 1KGXA 4UTIA 4AIOA 1HGWA 3UG3A 1XLKA 3BOXA 3TW6A 4RNFA 1W37A 5EKYA 3BSGA 5H8MA 2CZ5A 3H4KA 3H55A 1TCMA 3FDGA 1HN1A 4ZODA 1DV7A 4IFRA 2QUTA 1F3TA 2FIQA 4RZ4A 2QAPA 2VGGA 2ZUMA 5XINA 4ZOCA 3PZQA 1M7PA 1Y65A 3PZNA 1XYLA 3WLIA 3ZO9A 2FYMA 2NWSA 1TQJA 4KW2A 4DYJA 4W7VA 1HKWA 2QPXA 1VFHA 4H4VA 1EQCA 3GR8A 3NWRA 1DYSA 1JRCA 1WBJA 1GV4A 2Y8VA 4NJKA 5DCBA 4P7QA 3NPWA 3OB8A 3DG3A 4EMJA 3NUKA 3VK5A 3OG2A 3F4NA 4HP5A 3RX3A 3RMEA 1GQKA 3E96A 1N2VA 4EIVA 1A5BA 3NQ8A 5HUOA 1US0A 4R9OA 3BLFA 4WJ8A 3WQ8A 1A47A 2C8NA 4R85A 1OFBA 3R43A 1W1VA 1LVLA 3G8EA 5BCAA 2QJMA 3SRKA 1R2SA 3OZMA 3BXWA 4DRSA 2OMAA 2YJQA 2UY2A 3HZ3A 4O1AA 1NOWA 1KQYA 3O9NA 4RW3A 4Q8NA 1XJBA 2FPVA 5ABFA 4H4SA 2VUNA 4C6EA 5E93A 2BG5A 2PDLA 4XO6A 3TYEA 2ZVIA 2DT1A 1MVYA 3BK0A 3TA9A 4MB5A 3W1QA 3WENA 2OG9A 3MJMA 1EH9A 1J0JA 4IM4A 4EMIA 4D9PA 4QDWA 1E3XA 3QQ1A 1E1CA 2VOMA 3E2RA 4JN8A 1RPKA 4LANA 4GFIA 1OYBA 3HJZA 2R8WA 1GYNA 1GOWA 4M3PA 3FIGA 3B8UA 5FAGA 3DERA 4S3KA 3UYCA 4GGBA 1NP2A 3AWNA 4KMQA 3S2MA 4F8XA 3ITTA 1P0DA 3M5XA 4O54A 2XJ7A 2PI6A 1L6WA 2VCAA 2BY2A 3QXBA 3VD9A 3GXFA 1CZ1A 1YNPA 4XK2A 1KFWA 2ZWYA 4PFHA 5JUVA 1JYNA 4TVWA 3K1GA 1GEUA 3NPUA 2WCSA 4IG2A 1JZ5A 5CPTA 2Q8ZA 3FGCB 3NS1B 4XD6A 3W29A 1J4EA 3W2LA 4YTRA 3A6OA 2VFGA 1HT6A 1JJKA 4CN4A 1QMLA 1FH9A 4BKNA 5HWMA 4G5DA 3L0KA 3O0HA 1H61A 3IGXA 2UY4A 4XZNX 3RCMA 3UY7A 2BGSA 3POHA 3CHCA 3ZR6A 2DFAA 5BXRA 3E0WA 5F4SA 4AX6A 4E5TA 3PPHA 1W1TA 4CNUA 4PEEA 2YL5A 3R10A 3ARQA 3SJ3A 3SAZA 4M80A 1QWGA 4GC4A 3RJXA 4JOMA 1H3GA 1GKPA 1CPUA 3RLHA 5HR7A 3B8DA 3HMJG 3TJLA 3CWOX 3GFYA 4DIAA 2GVJA 3N2OA 3RX4A 4CD5A 4ZCWA 4PSPA 1PKNA 2O0TA 4HHHA 2ZC1A 4H9XA 3BDKA 4A2RA 3PPGA 3QW3A 4C1NB 1UR4A 4HD5A 2X09A 1A0EA 2ONEA 4OTKA 4A4AA 2GVLA 6XIMA 4I9MA 3UQNA 5REQA 5T91A 4HA3A 2XIMA 4CNPA 1JUKA 3LRMA 2D3LA 4R5EA 1AJ0A 2E4TA 1TE6A 3W7EA 3S0CA 3R13A 1DJHA 5I77A 1JPMA 1O5RA 5DBUA 4DM2A 4H7ZA 3GB6A 1D8WA 3GXPA 4GO8A 2D23A 5G2HA 4HMDA 3LXDA 1LM1A 2XFWA 1V8EA 1P1XA 1ZENA 3UVIA 1QNPA 1AD1A 1ZPTA 1SMDA 1F61A 5F2MA 4Q8OA 1I2PA 3IPWA 2W92A 3VDHA 1IT8A 2QXWA 3MVTA 4KCWA 3LV5A 3WBAA 3CPUA 1QI2A 3CC1A 5J5DA 1QTWA 4ADWA 2YW3A 2Q09A 2F6XA 4JQ1A 3WCZA 4HT3A 1JZ2A 3NYDA 1FY6A 2BFGA 1IZCA 2P0IA 2PDYA 1H60A 3IJIA 4FLQA 4GI9A 1JDCA 3D3FA 1TPFA 2ESCA 2VEMA 4KWWA 1B3YA 1OB0A 5F4XA 1XYCA 4HOZA 2X40A 1EGMA 2OYMA 2CXEA 4IQLA 2W67A 1YTDA 2DSKA 2V5DA 3G18A 1H7NA 1G67A 2NQ5A 2PGWA 4NYUA 5C70A 3W3OA 4IF2A 4PUKA 3I6RA 3DHPA 2BHUA 1HX0A 1RXOB 4J40A 3M0JA 3WH6A 3VZXA 4P2VA 2J24A 4GOAA 4N9BA 3FDKA 4NRSA 1H2IA 2G0WA 5DO8A 4F0KA 1V51A 4MKSA 3W37A 1GREA 1ZNNA 1JI2A 3L7RA 5DQPA 3Q2DA 4JYFA 1T40A 2CBIA 4OFCA 3OA3A 5AHNA 5JXQA 2YLLA 2XISA 1OADA 4POCA 1E6PA 1VAHA 3QFEA 2GLKA 3WQGA 3VO0A 3M47A 3HGJA 4OOZA 2C1IA 2NUXA 4A3YA 1UP3A 2RDWA 3NR0A 5A6JA 3RCNA 4W93A 4KRUA 4FXRA 7A3HA 3SCVA 4CVUA 3U4FA 4C5ZA 3UT0A 3A4XA 1GEHA 2P76A 1XV8A 3ARXA 4ONVA 1LLWA 4ZR8A 2WWCA 2C71A 3VOGA 1FEBA 3CGBA 1J0IA 1X6NA 2A3LA 1K9DA 4ACYA 3BQ5A 4WSJA 3VGHA 2WV8A 1RALA 2CLFA 4RE2A 1XC6A 3WD4A 3E6EA 1HUVA 2NV9A 1S2WA 2GJXB 4M51A 3R8GA 2YX0A 5A5WA 2HEJA 1BHGA 3EMCA 5CG0A 2ZXBA 3BLEA 4ML4A 1EBHA 2INZA 5A95A 3PM6A 2OO6A 3CUHA 1CW2A 3AZRA 3APTA 1GCYA 2HTMA 4NI3A 2ZX7A 4H8HA 1GYMA 3LPOA 3OGVA 2WNWA 4IIFA 4AZ5A 1TIMA 2GGHA 5HQMA 1EOMA 4IX0A 4L4MA 4ZE4A 3SQLA 3F2CA 3QR1A 4P7LA 3LQLA 5FKYA 3RITA 2Y89A 1Q2RA 3W1AA 2O4QA 4XZBA 3MPGA 1F8IA 3F7JA 3GM8A 1JOAA 2J79A 2OXNA 3L8KA 4V33A 2WKLA 1DWGM 3TAKA 1FFVC 3N9KA 3BO9A 3C8NA 3NZQA 4KPRA 3HV9A 1F8WA 3AHYA 5HJXA 2PRLA 4DWSC 3H4XA 4LAKA 3PTKA 4D6FA 2E40A 2PAJA 3GNDA 5IM51 2Z7KA 3KS5A 4GC3A 1WOAA 3KM8A 3LHZA 1LP6A 2I9UA 3WLRA 3T78A 1VFMA 1XBXA 2PDIA 4MFEA 1PHQA 3CAQA 3LB8A 1A4LA 2V0TA 1KRBC 2GJNA 3M0KA 3WFAA 1UH4A 1GJWA 4QE1A 2PDPA 1X1NA 3S9IA 3CEPA 2DIJA 5A6AA 4O1CA 5CJNA 3K4AA 4Z08A 4C6BA 1HKVA 3V1HA 4QSHA 4Q33A 5D32A 1XSIA 2NQJA 3HBLA 1IEQA 5AZ0A 4IJCA 2PF8A 4O57A 3UG4A 2E67A 4XD5A 4GZEA 3MC5A 3GH5A 3AROA 3HPZA 3B8TA 3FEMA 1OG6A 4DPPA 3D47A 3L65A 4EF9A 4GBUA 4Q8TA 4KEUA 3LD5A 2VXNA 3U57A 1PDZA 1FA2A 1K6WA 4IWWA 1MW0A 1H0GA 3S5ZA 2XH0A 2AMXA 3PZUA 2VUYA 1NTHA 5D2TA 4OUEA 3GHTA 3MWAA 4YPJA 2FPYA 2HBXA 3OIXA 4X63A 3VKDA 1ME9A 2QQ6A 3WELA 4DBEA 3GG7A 2GUUA 2VEGA 1F05A 3UJFA 3LK6A 3N1AA 4HU8A 3BJTA 2J8FA 3KFTA 4XBJA 3TTYA 2ZDRA 3GG0A 3OVPA 2VGBA 4FX6M 5D4YA 4Q22A 1Q6EA 1KM2A 2ZFAA 2NW0A 1J11A 1TMLA 1C9WA 3LG3A 3FA3A 4NIRA 1XRVA 5JIPA 3UNDA 3HPFA 1OGGA 4M6VA 2QAEA 1C8YA 3IEBA 1O12A 3P7YA 3RGTA 5K4ZA 1BXBA 3GC2A 1GNXA 4Q7NA 3C8FA 1XIGA 3GYEA 1EIBA 1C92A 2OGJA 1NSJA 5FS6A 4M52A 5A8OA 2GH5A 1D9EA 4O52A 1MI3A 5IBXA 4IISA 1X8FA 3M1ZA 1QOXA 1PS9A 3AHTA 2IPWA 4INFA 2G97A 4K38A 4UQCA 3QRHA 5XIMA 5G1MA 1AW5A 2OODA 2HNEA 4GHRA 2QF7A 4FK9A 1UWQA 3RAOA 3KHDA 1JEHA 1BWCA 2QCDA 3A24A 3O63A 1FBAA 1PWLA 5BNKA 1O5XA 3EWBX 3T0TA 2TODA 1HIZA 1FHLA 1OIMA 4NYYA 1M04A 4FX9A 4KKXA 2XFYA 2YAUA 4YTQA 4B2DD 4NUWA 2XVLA 5C9WA 3T0CA 3W53A 4O4WA 3W27A 4DPQA 4NAFA 2GGEA 5HNTA 4U10A 4HU0A 4AC1X 2PDGA 4ZEPA 1H62A 4F40A 3KZSA 4D6CA 3ZM8A 4DUWA 1M6IA 1FUYA 3V5CA 3B97A 3FYPA 2YW4A 4LCQA 1ZCOA 1TVPA 1J93A 3M07A 4UNIA 4W85A 2OWWA 3ZSSA 3UXAA 2G3JA 3KZPA 4L6HA 4NAEA 2ATMA 1RY0A 2HBVA 3AS3A 4E8DA 4NZCA 4LC8A 3LXAA 1FWJC 3G6MA 1DIEA 1ISZA 1OCNA 3BCFA 3UESA 2YXOA 4B16A 1L8PA 5BW6A 2A4AA 1KR1A 1DJWA 1TTQA 1Q7ZA 3HQ1A 1V02E 4LF2A 2QPSA 1EZWA 2BV9A 4GISA 4UZSA 3KS6A 4HSOA 1IR1A 4PODA 2VFHA 4B4FA 4PTDA 2ZUWA 4JTLA 4EM3A 2PWGA 5EL1A 1PYFA 4AIUA 2IKGA 3UNTA 4AW7A 1NDYA 3BL3A 1L2UA 2C3CA 1S5NA 1W9PA 3URAA 3UYIA 1L0PA 1WKDA 4QFUA 3FKRA 4MAVA 3WDRA 1YDNA 3KBNA 3WBYA 3KCJA 1A5SA 2FJUB 2WVTA 3PZIA 4FF7A 4IGMA 2VC9A 1QO2A 1JDFA 4FR1A 5IBXC 1WUFA 4DNMA 1EJTC 1EIXA 2A3HA 2E5DA 3IJ6A 6REQA 1PL9A 3LENA 5CJMA 2JALA 3GLCA 3WNKA 1EC9A 2PUZA 4PFMA 2NZLA 5I0DA 1NQKA 3VVGA 1FTXA 3P5YA 1ZY9A 5F1VA 1GVEA 2RFGA 5JVLA 3A4WA 3BGJA 3PUEA 1XPYA 2AAAA 3LEPA 2ZZ2A 3GBEA 2W61A 1CLXA 1TPWA 4JTUA 1WDRA 4NT0A 4EP8C 1JDAA 3UWYA 1ZBWA 2GGGA 3DI0A 5DBTA 3K2GA 3KP1A 3CLMA 3BVJA 2WLZA 4ZE5A 4AZGA 1QR7A 3EA3A 4C5YA 3N2TA 2E28A 4H8NA 5GJNA 3B9AA 1C8VA 1X2GA 2BWGA 3FW6A 1HJXA 3LCFA 1JDDA 2E9MA 2ZOXA 3NQVA 3A5VA 2PBGA 4Z42C 2E25A 3P6LA 4AF0B 2QHAA 4JQ4A 4G56A 1CXLA 5HK4A 1DJIA 3O15A 3OGRA 3G1VA 2RDUA 3C5QA 2WJZA 3VTRA 3QHMA 4KEMA 1XH1A 1WXYA 3OLIA 2ZXQA 1LPFA 1Z6KA 3KVJA 1A5LC 3MMUA 3DGHA 2Y8UA 2NSOA 1OCQA 2BLEA 1LOSA 2DT2A 5AHLA 4D8AA 4QXIA 1F4HA 2DW7A 4OT7A 1M9HA 3JW7A 1FVPA 4HK7A 3DI1A 4WY0B 4IX2A 4XUYA 3WSUA 4AEOA 1Q7MA 3PG6A 4JTTA 2GQWA 1TIWA 3NVVB 5G5IA 4H04A 4L4PA 3WMSA 5DT7A 3UETA 3HRDC 4F0LA 4F66A 5EYWA 3WNNA 2DSVA 1BRLA 2XH2A 3VNLA 2HE5A 4ADTA 2EQ6A 4G2DA 3LGGA 1YYAA 3YPIA 2A7NA 2PRHA 3DK4A 3EUB3 3D0CA 1KFEA 3CQ0A 4D71A 3TSDA 4RR4A 1QWKA 1JFXA 5LYRA 4CQDA 1CXIA 3S1VA 1LQ2A 3I3DA 3TU9A 1S3TC 5LIWX 2X8CA 1OCBA 3W2MA 4P8XA 1KLZA 4ZQCA 4IIGA 4U3CA 2YXGA 3T8LA 4WXZA 4RE0A 2HQAA 4QTGA 4QLLA 4UR7A 1XQKA 4LAOA 1TREA 3E5BA 1JNEA 1UKOA 4HNCA 3W6LA 4HCHA 4KS0A 3UR7A 2CZFA 3M43A 1N8IA 2E1WA 4XB3A 5CZSA 1N5WC 5DN1A 4EE9A 1OFDA 4DJEA 4FNQA 1KM1A 4Y9AA 2HROA 2QV4A 4Q7BA 2X05A 1W1B1 1B54A 3IARA 2YOCA 4CD6A 3TLQA 4AEFA 2VI0A 1P0KA 2X99A 2VHLA 3I65A 1BD0A 3IIOA 3VFCA 1XDMA 4JTRA 2WPFA 3AAMA 1XIDA 1NDAA 2R14A 1JCNA 3URHA 4O50A 4NI8A 1UMYA 5GJPA 2UZ9A 3TONA 4X0VA 5LNUA 2ZTJA 3ES7A 4PRRA 4LC6A 8A3HA 2F2HA 3R79A 1P6WA 2WZEA 2VWTA 2W91A 1ODZA 4BI6A 5KVIA 1H5YA 1IEVA 4EANA 3OVGA 3QFBA 3KL3A 6CGTA 3W9ZA 4LEFA 3HG5A 2R1NA 3N11A 3TYDA 3L2LA 3UPMA 1ELSA 3P80A 2A1YA 5A6KA 5I78A 1OF8A 3KAOA 3PG9A 2WJDA 4W5ZA 4V28A 3VKAA 4KH2A 1FDYA 1MUCA 1RJRA 2CEQA 4NJIA 1V93A 5LA2A 2VZSA 3H7UA 3W7HA 4PMJA 2ALDA 4LFYA 3B9EA 4S1FA 3QH2A 1P43A 4O18A 3AXKA 4TV6A 1I4NA 1N7KA 2PZ0A 1GOMA 2WSYA 2A79A 1TKKA 3AYRA 3UZZA 3DYMA 1ODUA 4L7ZA 4JYDA 5HNUA 5FJRA 3ZWTA 1J79A 4X2PA 4ZA0A 1GERA 4MLJA 3WF3A 4QX4A 2G96A 2XFFA 2DV0A 1BKSA 2OQLA 3UPBA 5A6BA 1PE1A 4L9ZA 4QIUA 3IIXA 3VCRA 4ZQRA 4GUGA 1POKA 4W8LA 4UWMA 4DJFD 1ZL1A 5A6TC 4V1XA 3W72A 4DZAA 3EOSA 1ONFA 3IVUA 2DJXA 4FXSA 1K9FA 2OT1A 5M17A 2V2CA 2I9EA 4B5UA 3ANUA 3F4VA 1WP6A 2TMDA 1Y5WA 1R87A 3FEQA 1M6JA 2CC0A 5T9BG 3N04A 3W7RA 2G3FA 3FA4A 2REQB 2A2IA 2V69A 4PMDA 4GD0A 2EAWA 4D1JA 3WK0A 5C0QA 2J75A 2B7QA 2GGJA 4DLFA 6TAAA 1Q6LA 4IPPA 4DXXA 1QUMA 3CBWA 3C0LA 1MEHA 4PMXA 1MZRA 4LXFA 2D24A 4GNVA 3TE9A 4EXAA 2AAMA 1HP4A 2BC0A 1YXDA 4JN7A 1U1HA 3BV4A 4NZ3A 3IK2A 1CCWB 3LOTA 4LH8A 5C9RA 2YVFA 3TZNA 2C14A 2P5NA 4FIRA 5TF0A 3VIFA 3A64A 3O2LA 1B3OA 3R8HA 1UWRA 3MP4A 1I1WA 2O7QA 2Y6ZA 5DMNA 3TA6A 1H4PA 4UTHA 4AUBA 1IEXA 3BICA 3B0YA 3LZ5A 2WC3A 1QPQA 1BYCA 4REQB 3AXXA 1CENA 1ADDA 4E2DA 1MQPA 3G1AA 4H9UA 5JU6A 4LUTB 4JFVA 4L1GA 5DLCA 2BMBA 3UXDA 3OJGA 1GJPA 1JFHA 1B3VA 1UP2A 2G3IA 4PE8A 4K36A 3S46A 4XAPA 1BWKA 1ZCCA 1QXLA 4QRNA 3GDKA 3P84A 4XISA 5LSMA 3NAVA 3N4EA 3UU0A 2Y5EA 4G6CA 4A8LA 1US2A 2VZUA 3G1XA 2WHMA 5CCZA 4LY8A 3DGBA 3KDOA 2FTYA 4EKJA 2WZMA 3UR5A 3CZEA 4ZQPA 1J10A 2A3BA 3TW9A 4DJDD 3W81A 3B8VA 5BOFA 4WDXA 2Q8XA 4QNEA 4ML9A 3RX2A 3MO7A 1VFFA 2FZ9A 4GQBA 5I24A 5CLTA 2OEJA 5IFPA 4JTKA 3HJEA 2DT0A 3RK8A 3DG7A 4EQWA 2F7FA 2W5FA 3AZSA 1WO2A 3VABA 1HJSA 1GSNA 2WJFA 1W5OA 4Y90A 5CC7A 2WVSA 3G0SA 2YVJA 1QU4A 4NZ5A 2XZ7A 5EA9A 4LVBA 3DHUA 4OU1A 3PWGA 1UG6A 1XANA 4EPDC 4QR6A 2ZC8A 2Z00A 4JIEA 2EPLX 3KBWA 3UWEA 3RRAA 4PBEA 4IPNB 4WKAA 4J5NA 3N2BA 2YDAA 3NYZA 2NXHA 3C0JA 2J88A 3MBFA 3BJFA 1HVQA 2CBUA 5FF0A 2FDSA 4DJEC 4JIQA 4H4ZA 3V0SA 1RCXB 2QJJA 5CC3A 4A3QA 3U7VA 2E09A 3GH4A 4GMEA 4Z1AA 2J62A 1G1YA 1SO4A 4GIYA 4ALDA 3IUDA 4YWIA 4AVFA 4GCXA 3TH6A 3EGJA 5K9XA 2BS9A 4FXFA 1HQTA 3E49A 3VDCA 4ZVJA 3KRUA 4H2HA 4BQ4A 3SUTA 1LUCB 5LIUX 4RZBA 1ZGDA 3ZVHA 1OINA 1DJGA 2XN2A 3NZ1A 2DQWA 1F6PA 2IW0A 2IPFA 4NF7A 2J13A 2J9YA 1IWBA 2XVKA 3BAIA 4HNLA 4TX9A 3RCYA 3FS2A 4CQBA 4C6NA 3UZJA 4DJFA 3IJ9A 1P5BA 3VPLA 1ZHAA 1EP1A 2VZVA 3WH8A 3NURA 3IRSA 3BMXA 1QNSA 2DUAA 1J5SA 1R2TA 1SJAA 1EB3A 3WK1A 5I5RA 1Z69A 3WLJA 1WKEA 2EG7A 3EWXA 4CVWA 4JTJA 3TYZA 3VD3A 1W56A 4M7SA 3OZPA 4KIRA 4E0CA 4HHMA 2VL4A 3I7RA 5K9DA 5KTLA 2YA1A 2CIPA 3W1RA 1VFOA 1OM0A 3PZVA 5LXEA 5RUBA 1XIEA 2PB1A 1DNCA 4O13A 1P0BA 1TWDA 6PTDA 1XIHA 4N9DA 3IVSA 3BJSA 4JIIX 4XZWA 3CQJA 4H9TA 4NKCA 1TJRA 1UR0A 2QUUA 3W1TA 3MMTA 4US5D 2J7DA 1DXFA 4AY7A 1DXLA 4GKTA 4EQRA 4WD0A 3CAWA 4Y8FA 5F2IA 2VFFA 1UD4A 4GCAA 2WOIA 3FOKA 1P0NA 3MKKA 3PBWA 4MGGA 4UFMA 2HK1A 2XZ9A 2Y24A 2Y7EA 1W9BM 2ZRVA 3EB3A 3L9CA 3N4FA 4S3DA 5HMDA 5AC8A 5MHBA 3T05A 1KRAC 4FOUA 3GAKA 2O7SA 2WMKA 2DUZA 2X1RA 5JCLA 1OG0A 2QCLA 4M24A 1XUUA 1WZKA 3L2MA 3PB2A 1W1ZA 1Q1RA 3CTLA 8XIAA 5IHSA 3HB9A 4DQWA 3UD6A 2ZX8A 1Q45A 1OIFA 3TQVA 1J96A 3OP2A 1FHDA 3B06A 2ADAA 2R1KA 3WFZA 3EKGA 1B30A 4WIWA 1WKFA 3BPWA 4DNHA 1R9XA 1EA0A 4QQUA 4RE4A 3GWQA 2PC4A 3ABSA 1U5HA 1T41A 2FGLA 2W0HA 1SPQA 3OVQA 3EDEA 3PANA 2FGBA 1GW1A 4XWUA 3IC9A 2GQAA 4LS0A 4HA0A 3GG1A 3S83A 1ALDA 3KL5A 1HTIA 1QK2A 3AS0A 1W5QA 4HCDA 4AHOA 4QCFA 3TUUA 4WGXA 2WK2A 3P81A 1GK8A 4PMRA 2YA0A 1JXKA 3FXGA 3BMVA 1XYZA 3NDZA 4YVXA 1UWTA 4I9TA 4XAYA 3KLLA 1FWDC 2BXVA 3LM7A 3LV6A 4Q4SA 1ITUA 4F48A 1O5QA 3U6WA 5CAHA 3UJSA 4KBXA 2D69A 2Z26A 4NZ1A 2E5BA 4WKHA 1XBYA 1RHCA 1EJUC 2HK0A 4UR8A 3NNTA 1LBFA 1TA3A 3OOQA 3PB0A 2WMGA 3KOYA 3LRKA 2DZSA 2G50A 1JQXA 3N15A 3CMJA 2P10A 1WZLA 1OYAA 4GVIA 4LALA 4P7OA 3EZ4A 3ITYA 3TYUA 1XL9A 3I68A 2ZYFA 5HINA 2VDGA 5K7JA 2RJGA 1RBLA 3M44A 2B7OA 1ZU8A 1WCGA 5C9XA 2GVYA 3W73A 1KV5A 2PURA 3KOFA 4H00A 5J5RA 5HULA 1E71M 3PTDA 1O60A 4RUBA 4KRTA 2BDQA 5MF5A 2GJRA 2XM1A 4NZ4A 4ZTXA 2I17A 3WL0A 1WBHA 4WDUA 4J57A 4DZIA 2DGAA 1EYWA 4QISA 2OU4A 4UC5A 3EX2A 2HZGA 3SB0A 1SB3B 3TJXA 2J66A 3GE7A 3S5NA 3LUTA 1BPLB 1PKLA 3HM7A 4MY1A 3UWWA 3KL0A 2X0HA 1W5NA 4APNA 3B9OA 4U28A 3B9DA 4DWSD 4TV5A 5CPMA 1OT2A 2D2OA 3WLNA 3R7MA 1ZJAA 1S39A 1DJXA 1FCVA 2PD9A 1P7TB 3LU2A 2VEFA 4AG0A 3PSWA 1ESWA 3W6YA 1BVNP 3HF3A 4O4VA 1HL2A 3FXYA 1YPXA 1X6UA 3URQA 3A23A 3OVRA 5K3VA 3AYTA 3R6IA 4J3SA 2WM1A 2VC7A 2ZADA 3CASA 5CBJA 3W01A 3E1F1 2XVPA 3NQ2A 4CCZA 1O66A 4AWTA 1OFOA 3CL6A 4MKNA 4EOUA 4CCCA 3QSTA 2OSWA 2IXUA 3BCDA 1U5VA 1DWAM 1HJQA 1TMHA 4DUXA 2XYLA 2Q3RA 2QCMA 5FS8A 2HPIA 3GXNA 1XLIA 3MCOA 2WP6A 1FWAC 1RJPA 1XSKA 4HNNA 2P8CA 4WF7A 2O92A 4DXKA 3BCJA 3G2GA 5A2AA 3NQ7A 4MY9A 1ITXA 2P3ZA 3MUAA 1JCMP 3PAJA 4N4QA 3JUGA 1G69A 6TIMA 3KEHA 4PL2A 3P5ZA 4WSHA 3H21A 3SBFA 8CGTA 3LMYA 3PUDA 1UBSA 7REQA 4EX4A 9XIAA 3B0VC 3ERPA 3A3HA 1WB0A 1IXPA 3A5FA 2DIEA 1WA3A 2QJNA 2V68A 2Z7GA 4J3TA 1OGBA 5D8WA 2YCJA 3LHUA 3EEGA 2BXZA 3KRSA 3WIJA 3SSJA 1KNWA 4KIEA 4OBSA 2I5GA 3TWAA 2Z27A 4A2SA 4EACA 1ISWA 1K7EA 2G4JA 4CCEA 1EJWC 1HKMA 1K3UA 4QJ5B 3GY1A 5AOUA 4BF9A 3UA3A 4ZQOA 1NDVA 2PS2A 1HJVA 3R0DA 5D09A 2ZA3A 1HZYA 4PCNA 3NQEA 4M1BA 4ZTYA 2G41A 3PY2A 1J0YA 1KM6A 1W9XA 1KGWA 4PCFA 2IKJA 3TR9A 4GE8A 4EAYA 1GRFA 1PCKA 3ONBA 1JZ8A 1SR9A 3TK7A 2VGFA 4PTMA 1LROA 5I03A 3VOHA 5AC4A 1YXYA 4L56A 3HFYA 2B0MA 4H50A 3GIQA 3SIMA 2WW5A 1V6XA 1T8QA 1UCWA 4DBDA 1OABA 1LWIA 2DZPA 3OO2A 4LBRA 4DYEA 2FLIA 4KESA 3GVGA 4ACZB 3ME3A 4ZL1A 3GHRA 2WO5A 1A5OC 3DFQA 1MUWA 5BRPA 3S1WA 2XN1A 3CO4A 2V5KA 2Z2AA 2Y70A 3QV7A 5B7ZA 1V3MA 4IMAA 4TR9A 3WMBA 1KFLA 4XVDA 2YLAA 1MW1A 1UR2A 2B31A 3MCNA 3TOYA 1VP5A 2ZUUA 7TIMA 4YIWA 1FHVA 1XYBA 1UC4A 1VBGA 4HZMA 4HMNA 2ZZ5A 3ZT5A 5KZEA 2VURA 4GWEA 4E4PA 3TLLA 1UKSA 3MY9A 4A8IA 1A4MA 3AUOA 1G94A 5ABFB 1YADA 1T5AA 3EBVA 4P61A 3NEHA 4WY0A 1XYFA 3W00A 2QGYA 2VVSA 1G4TA 4BWLA 3LTSA 3MT1A 2VNCA 3LX9A 4HA1A 3UW6A 4Q32A 2Z1VA 3H2OA 3W83A 3W87A 4FLOA 2X8RA 3E2QA 5CQ1A 1X98A 1X6LA 4HNOA 3GHUA 5HPOA 3MB9A 4FA3A 4JD4A 1NHQA 3IANA 1LLOA 3WQWA 4UQBA 3KRZA 4ZOAA 4GY1A 1VYPX 3L4UA 3PWAA 1VRXA 3M41A 2ZUSA 3AMDA 1UD8A 5CSSA 3F2DA 4MUPA 1BF6A 4GACA 1LQ0A 2KAUC 2Z2BA 4IQJA 4L6DA 3BSHA 4OQVA 3S5OA 3LNMA 2GJPA 3GC4A 2DW6A 4Z2GA 1TB3A 5LNVA 1VFSA 1PDYA 4MNMA 3U4AA 1IXNA 3UG8A 3PSVA 2D0FA 2D2JA 1L6GA 2ASHA 3WDPP 4HNVA 1QI3A 1XR2A 4BI5A 2V6OA 3ITVA 3WUGA 1OYCA 2A5HA 2QVNA 3NO5A 2PLJA 4MTVA 2PZNA 3AHVA 4GIEA 1MXGA 1D3GA 2DZWA 4ZZ9A 4AIBA 3WFLA 3TAOA 3R11A 3GKFA 1S2UA 4DZHA 3UPWA 3UP8A 4KWUA 3U0HA 4GRTA 1SM9A 4IOTA 2AGTA 1FEAA 2ABAA 1X2HA 3KCLA 3OZYA 3GW0A 1WAUA 1PVNA 3GVWA 1PIFA 1UYQA 3U2OA 2E8ZA 2JF6A 3SCUA 4HVXA 3G3MA 3K4WA 1GOXA 1VIZA 1KXQA 3A21A 1SVDA 2RABA 4MADA 3WJWA 4N42A 1LL4A 4AEEA 2QAFA 3BANA 2ZX5A 3QTPA 1AH4A 3G1DA 2VR4A 3IUIA 1G9HA 1RY8A 3PJXA 4ZQMA 1WDDA 3MYOA 4NXKA 1YXCA 2CHOA 4Q4MA 2Z28A 3L66A 2V2DA 3IV3A 5DY3A 5A6LA 3R94A 2CWXA 2WHKA 1JL8A 2C16A 2PU0A 3H53A 4G1NA 4FNSA 1GTEA 3AU2A 1TJ2A 4E8GA 4HHPA 3QZAA 4IIEA 2E5AA 2HE8A 1RQEA 2ZTKA 5FJPA 5AN7A 1S5VA 3COTA 4I7UA 1J0HA 1H5VA 1XQLA 5CZ0A 1YE6A 4GXMA 1RPXA 5CBIA 2G3NA 2Y7GA 3AIVA 3WO8A 3EAOA 4DM1A 1DWFM 3F4CA 3GNOA 1UH2A 3SDOA 4W9TA 1DQUA 3NPVA 4W7UA 5ABEA 3FLUA 1IR2A 2BOEX 4M7TA 3TV8A 2VQTA 3JR2A 4GLEA 4EVZA 1TE1A 3A47A 2ZRZA 4FHAA 3MO4A 1PX8A 1EKOA 2Q8LA 1JF6A 3WQDA 4XKYB 3VNMA 1OC6A 1MUMA 2ZZCA 2BOFX 2V82A 3TSBA 1UZHA 5D30A 1NY1A 4I9AA 2PU1A 4BA0A 3S2LA 3DECA 2V2HA 4QDPA 4QAIA 1OEPA 1ZZMA 2GK1A 1E9LA 4CCDA 1BYDA 5HA7A 1OWQA 2YYUA 1W1A1 3P0WA 1MDRA 1OC7A 1SW7A 4P8VA 2ACQA 2GZXA 4FO4A 3A7AA 1FWNA 1HKJA 3P8IA 3VILA 5AFDA 2QEZA 3KHJA 3H2NA 7ENLA 3CWHA 4HTYA 2QCCA 3IIVA 3IS4A 4KEVA 4H2CA 1L2QA 1I9CB 3XIMA 4GVGA 3H4WA 7CGTA 4DELA 1V3LA 1M68A 3LLFA 5I07A 1E9ZB 1KC7A 5HDRA 4B5WA 5FJTA 2DPEA 3T55A 4C1LA 3DK8A 4LY4A 3GFZA 3RILA 2X42A 4MDPA 3N6QA 3HA1A 4NVTA 2LLEA 3VZYA 1XLFA 3GAYA 2Y5JA 1JI1A 2A3AA 3THQA 4IQDA 3OW1A 3NQGA 3SEPA 1EGZA 4RNJA 3VIOA 3MDWA 1M7OA 1H7XA 3PK7A 3W02A 1XLGA 3S5YA 1TVNA 3L5OA 3P14A 1J6OA 3INPA 7PTDA 4KWOA 4L1WA 1AD4A 1XRFA 1U1JA 1BZLA 1OFQA 3WH5A 3G1RA 4RV8A 3NCOA 2X2YA 4RE3A 3NL2A 4AQLA 2OGYA 2VTFA 5HNRA 1EF3A 1PCWA 3SCSA 3JU2A 1D7KA 3B0XA 3CGTA 4UTWC 2XHYA 4UXDA 5L9FA 3GVVA 1NP0A 3GUGA 1H1YA 3IV8A 1GOIA 4EPKA 1WDSA 4UNLA 1L6SA 3EXSA 3SSZA 3GZAA 4AISA 4F4RA 5FA5A 1DQXA 1ISXA 1JNDA 5FIPA 4BCEA 4JDRA 2CPUA 1GOKA 1Q63A 5AKQA 3UXLA 4WY0F 3SGZA 5D04C 5F2LA 3EX3A 2YCLA 3B9NA 4V1YA 1S1PA 4CU8A 3NPXA 4IH3A 4TTGA 4IFOA 3DFOA 1EJRC 3RMJA 3U2CA 1RCOB 1OBAA 2ANUA 1SQ7A 1Q85A 1BQGA 3LI0A 3AYVA 3NSMA 3TDFA 3R5EA 3BGAA 3CPRA 3H12A 1GOOA 1T8XA 5KZDA 1K7XA 4MZ1A 5GNXA 4JX5A 1C9DA 4AWSA 5ABTA 3P93A 3ZLFA 1XSJA 3EKZA 3I6TA 4S23A 4ZENA 1QHPA 2AQVA 3FY1A 4JBRA 5D03A 5I3IA 4U2ZA 2VFDA 2Y7FA 3NO1A 2INFA