4K1WA

Crystal structure of the a314p mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
412
structure length
395
Chain Sequence
b'SSGLVPRGSHMKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIKSLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGPTDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Crystal structure of the A314P mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Isomerase
total genus 144
structure length 395
sequence length 412
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2013-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k1wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k1wA01
3ENLA 2AL2B 2ZADA 2QDEA 1IYXA 3ES7A 2OG9A 2OQHA 3MKCA 4K2SA 3TJIA 4FI4A 3BJSA 3NXLA 2FKPA 3SN0A 4H83A 3FJ4A 4IL0A 2PU0A 3DGBA 3TJ4A 1WUFA 2AL2A 3IJLA 3T6CA 3CB3A 3I6TA 3Q4DA 3IJIA 3ES8A 4GGBA 2XH4A 2XH2A 2GGJA 3QN3A 2GSHA 4ENLA 1F9CA 3SN1A 4DHGA 2NQLA 4A35A 3GC2A 2XH7A 3I4KA 3DESA 3SSZA 2ZC8A 3VA8A 2QJJA 4DWDA 3VDGA 1MUCA 3RRAA 3S47A 1MDRA 4IHCA 1P48A 4J3ZA 3SBFA 1ELSA 3H12A 3THUA 4GGHA 1NELA 4H2HA 4DYEA 3RCYA 5J04A 2QGYA 3S5SA 3B97A 3TWBA 2QQ6A 1ONEA 3VC5A 3SN4A 2PGWA 2DW6A 1W6TA 3N4EA 4H19A 4IT1A 3CYJA 4HYRA 1FHUA 2HXUA 1P43A 3KUMA 1JPMA 3ZLFA 3VCNA 3N6HA 2PP1A 3UJFA 2I5QA 3H7VA 3P0WA 4GMEA 2PTYA 4IP4A 1JPDX 3MZNA 4KWSA 3Q45A 3ZLGA 4IL2A 3ZLHA 2XH0A 3CXOA 2PMQA 3VCCA 1SJAA 4X2PA 3DERA 3P93A 3H70A 3DEQA 4KEMA 3RGTA 4HNLA 4MMWA 3SQSA 3JVAA 3CK5A 4E5TA 2CHRA 3D47A 1ECQA 3D46A 3JW7A 2PS2A 1YEYA 4GISA 4GFIA 3UCDA 2XGZA 7ENLA 2OZ3A 4DXKA 2RDXA 1EBHA 1EBGA 1SJCA 1KD0A 3IJQA 2GGIA 2O56A 3VFCA 3UJEA 4MGGA 2MNRA 4JN7A 3HPFA 3TW9A 4Z17A 3TCSA 3NZGA 3FYYA 3SJNA 5FJOA 2OLAA 2PA6A 1JDFA 2QVHA 1FHVA 3FVDA 3QLDA 5EU9A 4J1OA 5FJUA 3DG6A 3VC6A 1EC7A 4E4UA 3QTPA 2PCEA 2PTXA 4K1WA 3U4FA 3OW1A 3V3WA 3TOYA 4E8GA 2GDQA 5IDZA 3GO2A 1R0MA 2HXTA 1R6WA 3V4BA 3TWAA 5BOFA 1KKRA 3QKEA 3ZVIA 3RO6A 3DFHA 3CAWA 4ROPA 4EWJA 2MUCA 2GGEA 2AL1A 3T9PA 1SJBA 4HPNA 4G7FA 2QJNA 1MDLA 2OZ8A 5ENLA 3PFRA 4IP5A 1OEPA 4E6MA 3UXKA 1NU5A 2POZA 3OPSA 2OKTA 3V5CA 3DG7A 4Z1YA 3UJ2A 4KT2A 5FJPA 1KKOA 2PODA 2GGHA 3PWGA 3RITA 2OFJA 4HCLA 2HNEA 2QDDA 4DX3A 4MKSA 1TKKA 1BQGA 3UCCA 5BOEA 3PK7A 3R11A 3UJRA 4M6UA 3MSYA 4JN8A 3GY1A 1TE6A 1E9IA 2OVLA 1KCZA 3H8AA 2GGGA 3STPA 3UJSA 1PDYA 2XSXA 2P8CA 3U9IA 3IK4A 3ZVHB 3R10A 5FJTA 2PPGA 3R0UA 3CT2A 2OZTA 2PGEA 1PDZA 2PTZA 4HNCA 1XPYA 1JCTA 4HCHA 3EEZA 3ZVHA 6ENLA 4A6GA 2P3ZA 4G8TA 4JHMA 4HCDA 1EC8A 3V5FA 3BSMA 3R25A 1BKHA 2P8BA 1MNSA 3GD6A 3TQPA 3EKGA 3UGVA 1XS2A 4DN1A 3MQTA 3T4WA 3NFUA 2ONEA 3OZMA 2AKMA 3OZYA 3FV9A 4E4FA 1EC9A 3BOXA 3DDMA 2OPJA 2HZGA 5FJRA 3PWIA 2P0IA 3R1ZA 4FP1A 3MUCA 4GYPA 4YWSA 1L8PA 4ZA0A 3DFYA 4IZGA 3N4FA 3MY9A 2AKZA 2OQYA 4F4RA 2GL5A 3T8QA 3P3BA 1MRAA 3I6EA 4GYPC 3MWCA 3NO1A 3RR1A 2OO6A 1SJDA 4ZCWA 2QJMA 1TZZA 2FYMA 1RVKA 3UXLA 3FXGA 2PTWA 3FCPA 1WUEA 2PP3A 3QPEA 4K8GA 3R0KA 1DTNA 3DIPA 3OP2A 4GIRA 3DG3A 3N6JA 2PP0A 3TTEA 3OTRA 4HN8A 2P88A 4KPLA 3K1GA 4M0XA 2PU1A 3JZUA 4A3RA 2OX4A 2PSNA 4H1ZA 2DW7A
chains in the Genus database with same CATH superfamily
2EXOA 2BTMA 2HQAA 2QDEA 2PDBA 1XICA 4GOAA 2IPJA 1YBQA 2XN0A 1YDYA 4HZ8A 3T6CA 1W5MA 4MNKA 3Q4DA 4PMYA 3S2CA 3M5VA 4YPJA 1OG6A 1UOKA 1R2SA 4TQTA 3HOJA 1YTEA 4F9DA 1BGGA 1F9CA 1SSDA 4ROQA 3DI1A 3ETRB 1DXIA 3W1RA 5D37A 1NARA 2UBPC 2E5AA 4TX9A 1MEIA 3NXFA 3VA8A 5I3DA 4Q8NA 1DJZA 2QJJA 3CZLA 3GNDA 4AZ6A 5AZ1A 1S46A 1X1ZA 5BRBA 1WBHA 1L6SA 3SBFA 3AISA 3P81A 2AAMA 4RK8A 2QULA 1HKJA 4KFPA 4CQDA 1GG0A 1JCMP 4WJXA 3RIKA 3SJ3A 3SIMA 1HQTA 2PGWA 4OBSA 2QLYA 3CIWA 2YW4A 1TX0A 4N6FA 5IBXA 1V6XA 4O11A 4UCGA 4IIFA 3N6HA 5TQLA 3TQKA 3H7VA 4H8VA 1E6NA 3FA4A 1VHNA 1QOXA 2ZRUA 3QR3A 3LXCA 4Q4KA 1KQZA 1LLOA 2C19A 4DEFA 4L56A 3U3HA 4DZAA 2NVDA 4RX0A 3TYEA 2W9MA 3T40A 4X2PA 1KGWA 1QMLA 1OADA 1A3WA 3H70A 3S4TA 3FEQA 1EOMA 3NQCA 4Q6JA 1O68A 2OEMA 3M0MA 2X99A 5BYWA 1EL3A 1IZJA 2YCIX 3WQFA 2EG8A 2F6KA 4XO7A 3POCA 4IPNB 4HA1A 4K38A 1EBGA 4FNPA 2EBNA 3TKFA 3NSMA 4CCEA 5JVLA 4W85A 4H04A 1VJSA 1OC7A 1GUVA 3TW6A 4TVUA 1TVLA 2FTWA 5DCBA 3IPWA 3A5VA 3SW6A 4WJ8A 1V6VA 2BHUA 3CB8A 2Z29A 2OLAA 2V2CA 1EUNA 3ZSTA 4JEJA 3C2RA 3PG9A 5HMDA 4XAPA 1LJYA 5BU6A 1OX5A 4IXHA 4C6BA 3WD4A 2XIMA 3OODA 4BQ4A 3C2FA 4JY9A 2OWXA 1CNVA 2Y6ZA 3LA4A 4Y7EA 3KXQA 1EJRC 4UTIA 2WQPA 1JD7A 4B4HA 3B0XA 6XIMA 4HK7A 5EYWA 3CZJA 1E1CB 2QPXA 4MOZA 4G7EB 1EUAA 3LGGA 1US3A 4WDXA 5IDZA 4DUXA 5I23A 3GO2A 4IPLA 4D9PA 3WUFA 3P7YA 3NRZB 3TWAA 1KKRA 5AC4A 1RCXB 4BI6A 2VGBA 3GRSA 3F7JA 4A3HA 2ZXDA 3AUOA 9XIAA 3HFTA 1LOSA 3WY1A 4XBSA 1FWFC 4HPNA 3TROA 1OVDA 3W00A 1OF6A 4WGHA 1K9TA 1MDLA 4NZ4A 1FVPA 4AZGA 2EQDA 1N8WA 3EWXA 2YBUA 5EMJA 2A6NA 4JN6A 3P6LA 3V5CA 2JF6A 4LSBA 1LVLA 1LRTA 2V5KA 4B90A 2OSXA 5A3HA 1OFEA 3KL3A 1PTDA 4EM4A 1P5BA 3UG8A 3NQVA 4A8LA 2WSKA 3WD1A 4RJEA 2JEQA 1QPRA 3MSYA 2YQUA 1TE6A 3H53A 4Y9PA 3G8RA 4A8NA 2AQOA 5FS8A 2XN2A 2DVUA 4N0RA 3LM3A 4U10A 1YDOA 2J3NA 3PUGA 2XSXA 1X39A 1TB3A 4ZQMA 1RLDA 3VIGA 2VKZG 3R10A 4FAMA 2OZTA 4HNCA 2A7PA 3T42A 3W85A 3LHTA 3VGBA 3FJNA 1AW2A 4BEUA 3NJ3A 4J3WA 1Q13A 3W86A 3IUHA 4XVEA 4HGXA 1XYAA 3QQWA 3TMLA 2W27A 3CTLA 2PDFA 5H8PA 2J62A 4R3UA 3VIJA 4HHHA 3P62A 2WC4A 3U2ZA 1XS2A 4BQ5A 3E2VA 4MWAD 1CXHA 3AIWA 3N15A 4WDUA 2A7RA 2WMJA 3QHMA 1F7BA 3NQMA 4DBSA 5HMSA 2J66A 3AHYA 2D0HA 3VMPA 4AZCB 4DO4A 1TA3B 5A6KA 5AY7A 4CN1A 4U4MA 2YA1A 3CO8A 3NDOA 1E6PA 5JCLA 2CLIA 1GJWA 1TFVA 2DSZA 4O12A 1EEPA 2AGTA 4X9SA 1OCNA 4F66A 5I2UA 2Z2AA 4HZMA 3K46A 3MWCA 3S5OA 3SAZA 2YR1A 3TONA 1TSIA 7REQA 5KMYA 1J5TA 5C55A 3HJEA 1FEAA 1RJPA 3A7AA 1EJVC 4MKVA 1B4KA 3QGKC 3WELA 1OB0A 3LB8A 3VE9A 1H1YA 1KA9F 4O10A 1YKWA 4D6CA 1C29A 4H9VA 1PZ0A 3K4WA 2BXZA 5F4WA 4R27A 4R7WA 4HB7A 1G9HA 4B2DD 4NF7A 2G3IA 3UXAA 3K1GA 4OTKA 4Q33A 3A24A 3WNMA 5JRBA 3M0ZA 3ITOA 1EJTC 4I7WA 4PC8A 2H9AB 4W9TA 1KB3A 2FVLA 2BV9A 3MZ2A 5C8BB 3IRSA 4FI4A 4Q6XA 3ICJA 4HNVA 2CC0A 4GUHA 3EKLA 3POHA 7TIMA 3AMGA 3G1AA 3IEBA 4YLWA 2VOTA 3BW2A 4OBRA 4B4FA 5EBKA 2A5HA 2DVTA 1A5NC 4LVDA 4DHGA 1U1JA 1IEIA 4IGHA 1EF2A 4XBKA 1L9WA 5LA0A 1KQYA 1XXXA 3WK2A 1K70A 1BFNA 1W9PA 3C3NA 5CQ1A 3DFPA 1G4PA 1MDRA 1WP6A 4QGCA 5A6LA 4JNZA 2JQXA 1DVJA 4C6NA 3W2NA 1QCWA 5CZSA 4AVNA 2V6OA 1EX5A 1G4SA 1SQ7A 3S5SA 3IUDA 5E70A 1B31A 1RD5A 4UQCA 3BUVA 3WLKX 2GVLA 4PODA 5DN1A 4WOQA 2EQ9A 1VBGA 1IXNA 3W84A 3UWQA 3CL7A 1ODZA 2CLFA 3VABA 4B5NA 1DIEA 4AVOA 1CTNA 3RF9A 3TAKA 3UJFA 2WPCA 3PNZA 2J7BA 5I00A 5IFPA 8TIMA 3N2BA 3LXDA 2BS9A 2OYLA 2C1GA 1H7WA 1W8GA 4Y9OA 4EWND 3PUOA 3JS3A 3Q45A 1M7PA 4ICMA 4Q4RA 3W29A 1W1IE 4DNAA 3S2JA 3MYPA 1MOKA 5LA1A 1GVEA 5DMMA 3IJ6A 3QQ1A 4GQRA 1JOAA 4WD0A 1LROA 1CIUA 3BW4A 4GISA 3DFNA 4OFCA 1PIIA 2WWCA 3II1A 4I3GA 3EUB3 1JL8A 1SJCA 1UPPA 1ZRQA 1M03A 4NNAA 3VFCA 2ZIDA 3O0FA 3UJEA 5FS9A 1H63A 4PTNA 4K8DA 1EEXA 3NQ2A 4M6VA 2C13A 3OEXA 3SCNA 3BZGA 5A2CA 2IQDA 1WDPA 4HNUA 3COTA 3ZZ1A 3CWOX 4INFA 5AFDA 2GH5A 2YYUA 4DJDA 4FNQA 1FWRA 4X2RA 2J8GA 1W0MA 3GE7A 1PPIA 2G95A 4H2CA 2Y8KA 4JHOA 4H7CA 2FQIA 4PMQA 3A4WA 3HG3A 1SYTA 4GRTA 2E4TA 3VU2A 2DSWA 4GH1A 4EACA 3V3WA 1K4QA 3OBKA 4J57A 1PBGA 4V1YA 1U1HA 3A9BA 3W7EA 1JYVA 1UWIA 3FFSA 3USZA 1LWJA 3L2LA 1DYSA 4NUWA 2PI6A 3BAJA 3CLMA 1J0KA 1R0MA 1V02A 1C7SA 1PX3A 3FIGA 1B2YA 3V18A 3NL3A 3MVIA 3KCOA 1N62C 2Z7GA 1B3ZA 3O06A 1ZNNA 3OLDA 1NM9A 2A79A 1ISXA 3PJUA 4NZ3A 5D2WA 1M68A 3MCNA 1JDDA 3PZIA 1TYPA 2QJNA 1XD0A 2E7FA 1SPQA 3OB8A 1HJVA 4W8BA 1FKXA 1BLIA 3PFRA 3L2MA 4UB9A 2XSAA 1X7IA 4L61A 1U30A 4TX8A 4KKXA 2NWSA 3GQYA 4Y8EA 2JIWA 3CQIA 4LQ1A 4W7VA 3PZ9A 5KEZA 3RPDA 1XGZA 1TZ7A 1XLHA 2CZVA 5FJPA 4LYKA 1V7YA 3UW6A 1H7PA 4HSNA 2QMKA 1BAGA 1DP0A 1GPWA 4LV4A 3THDA 4AEOA 3BH4A 3L5MA 1XSKA 4I7VA 1PL9A 4FIRA 1F3TA 5CSSA 3BLOA 4FK9A 2XN1A 3AMCA 1M53A 2IQTA 5EA9A 1XIFA 2FPVA 3BQ6A 2HBVA 2REQA 4TUFA 4AWSA 3TC3A 1I60A 4GKLA 4OQVA 1P0DA 2VCAA 1ZBCA 4IMEA 3H24A 1GEUA 1SB3B 1SZRA 3ZOAA 1I2NA 1SO3A 4ZVJA 4RR4A 1PS9A 1PKNA 3CT2A 3ARSA 3BSHA 4UUIA 4B5UA 1H2JA 1KM4A 3IVUA 4YL2A 2NT1A 4V2XA 4Q8TA 3N73A 3ABZA 4EP8C 3Q65A 3S83A 1XLIA 2FMOA 4E8CA 1J2BA 1ZBWA 3ATYA 3KS5A 1L6GA 3KWXA 3CAQA 4UQBA 3OU8A 4AF0A 2PC8A 4RXGA 1MNSA 3LSBA 2NX3A 3MU7A 2IMRA 3LHWA 3EKGA 4LS0A 3M0LA 2GUYA 3K30A 3T4WA 2AKMA 4PMZA 1KM6A 1F2JA 4W7UA 3QY6A 3STGA 5CSYA 1NHRA 3G8EA 4M7SA 2CETA 3ZMRA 5AHEA 4MFEA 3HGRA 3N12A 1KGXA 5CBJA 5BU9A 1DOSA 3D6NA 4GIYA 4K3ZA 3R6IA 4PUEA 3BLDA 3II4A 3WMBA 1W56A 3PUEA 4ZOBA 3MY9A 1JXKA 3QY7A 4IIEA 1VCGA 7REQB 3D9XA 2Q6ZA 4C7DA 1UP0A 3QY8A 3XINA 3T8QA 4IFRA 3FYOA 3BLEA 4KCVA 1MQPA 5K4XA 1EO5A 1HNYA 5U1OA 2HDJA 3L4WA 3AIUA 2QJMA 3GVVA 2ZZCA 3CM4A 4AD5A 1PKYA 1RVKA 5A1AA 1KNWA 3MP4A 4Y96A 3K8MA 4AWEA 4JFTA 4FR6A 1E3XA 4N9DA 3BGGA 4FLQA 3T0CA 1N55A 3CWNA 1D8CA 2XVKA 3NOEA 2PBOA 4LGXA 4GZIA 4M3PA 2IW0A 4AD4A 2WBKA 3GTNA 1R3WA 1XLMA 3WBXA 3G0UA 4IPPA 2WNZA 3R89A 3NVVB 3WUGA 3WLOA 1E5JA 3E12A 3PF3A 1LWIA 3KLKA 4UOJA 3BZJA 1X2HA 2RH9A 2P0OA 4MNMA 4H8UA 5JIWA 1BXNA 2EQ6A 3CZKA 3RX3A 3XIMA 7PTDA 3GXIA 4EAYA 4UXDA 4IL0A 3VIOA 1QT1A 3IJLA 4HZ7A 4PUUA 3CB3A 3KBVA 2OYKA 3K4AA 4TV5A 1HO4A 3C86A 3QN3A 1H5YA 4LUJA 1OD8A 1TMLA 2CKRA 2YOCA 4IQEA 1F4AA 3KDNA 4M56A 2FJKA 2XH7A 1UD8A 2A1YA 2D20A 3BTNA 4YU1A 3FVMA 4JFWA 1MUCA 3S47A 4LY4A 1IR1A 2FB2A 1B30A 2PURA 3WQOA 3KVLA 4LS1A 1P1MA 1TWDA 2XFFA 4J3XA 1AL7A 1XG4A 4JL1A 3VNIA 2ZZ6A 3W88A 1WXYA 4WIWA 3UZ5A 5DRIA 1YRRA 3CPGA 1BD0A 3WUEA 4H19A 4DM1A 1HVXA 2Z27A 4KIEA 5FAGA 1XCXA 4KCTA 1TR9A 4ES4A 1TQJA 2BOGX 1BYBA 5ER0A 2B0MA 5CAKA 4H8NA 1NTHA 2J6VA 1H5VA 4Z2JA 3NPWA 1Q6RA 3SFWA 3S42A 3PM6A 4AW7A 3B40A 1OWQA 4TTGA 2RGLA 2Y7DA 1WDRA 2PMQA 5LNRA 3B9JB 3GNNA 1EPXA 2JBMA 3KAOA 1NPXA 1S2AA 3I65A 1HKMA 3D3FA 4IMGA 5D8WA 4PCTA 3W22A 4I5UA 5G2IA 3V7PA 4WSJA 3V0TA 3VGFA 3GXFA 5CG7A 4RZ4A 3WBWA 4U5IA 1CXKA 1IT7A 3A21A 5TF0A 3SUSA 3DFTA 4Y2WA 5KTLA 3GUWA 2TSYA 3E2RA 4LYPA 3N19B 4DBEA 4DPPA 4GXWA 3RPTA 3A7RA 1RVGA 2A6LA 3M7WA 4UMAA 2WCSA 1ZKQA 4GRSA 4HPXA 5JIPA 2XWEA 1TX2A 4HT3A 4KETA 3W72A 1J12A 2CZFA 3UG4A 2VFGA 2QUVA 4NVTA 4H4PA 4ML9A 3RRXA 5FEWA 3VE7A 4KH2A 2FLIA 1VLWA 5FEPA 3F5KA 3SM0A 3QQ0A 3DG6A 4Q8QA 1I1XA 3DKJA 5FEXA 5K9XA 4BQ2A 2QCGA 4MZ1A 2NWRA 1XX1A 1VS1A 5A8PA 3ARYA 3AXHA 3LN3A 4B2DA 1ECEA 3O16A 4BR1A 3PSWA 3LCIA 1H7OA 3S5NA 3KBNA 3AXIA 4J4KA 1DL3A 2QS8A 2BXYA 4UTKA 1XBXA 4ZO8A 3V4BA 1OHLA 3CMJA 3AIEA 4YVPA 5BOFA 4IH3A 3BCDA 2P50A 4D72A 3W2JA 1Q4WA 1P6BA 1UA3A 5IFTA 4GH3A 3W23A 2PD9A 1FBAA 3FAXA 3MI2A 4MJMA 1W8SA 4LRTA 3VUSA 2W0HA 3QM3A 4B91A 2A85A 4Z1AA 2ZE3A 4DBWA 3QTGA 5TIMA 2WKGA 2YA0A 2VDGA 2FFIA 4A8IA 3FOKA 2OMAA 2WYSA 1E40A 2EKGA 1G69A 5U4NA 1GVYA 2NXIA 3C0LA 2Z1SA 2E5CA 5GJMA 1NH6A 4L4MA 5T8GA 3BLFA 1GRGA 1CENA 2O7QA 1TMHA 2E8ZA 3UWVA 4DI9A 4H4IA 2X30A 2REQB 3OHMB 4XV0A 2NXHA 3LI1A 2GLKA 1CPUA 3DFQA 2O55A 4B5TA 1WXJA 3A64A 5EBUA 4M81A 4GACA 2CLPA 3B9OA 3WJYA 1FH8A 4GK8A 1M6JA 1QW9A 4DWSD 5CBIA 1TUXA 2B31A 1VBHA 3THAA 1RHCA 3BAXA 5AKQA 2GQ8A 4NAEA 4EQRA 1FO4A 3FHQA 4C1NA 4KEVA 5JCKA 3GXNA 2R91A 5M1TA 4B5VA 4AF0B 2Y7EA 4ZBCA 2ZUUA 2P3ZA 4G8TA 1FHDA 3ARXA 4EE9A 2D3NA 1DJXA 4DO7A 1B90A 4GI4A 3V5FA 3W73A 1ZS2A 4BEQA 2WBGA 3ARRA 4IP7A 4OV9A 4PGLA 4DXXA 2IPWA 2ISFA 3FV9A 1LPFA 3IARA 4XD4A 3SFKA 2PE4A 4IGNA 3MT1A 1MEWA 3PTMA 2Z24A 3H4WA 3EDDA 4V15A 1US0A 3MUZ1 3FGCA 1AD4A 1BG9A 1P0EA 4UOQA 1DJWA 4J3UA 2GFTA 5GRTA 2WK2A 1REQB 4GE8A 5DELA 1QNVA 5JBFA 3W7RA 1ISVA 5D30A 3N4FA 2WNQA 4C6CA 1V4YA 3GTHA 3TJLA 4O1CA 4CQBA 4W89A 2F9RA 3RLHA 4G6CA 3KEHA 3QKZA 4WY0F 4JICA 3LHVA 3S2MA 2WMIA 2V82A 2ZCGA 3N2XA 3H2AA 4FX9A 3INPA 3W7HA 4CCZA 3GIPA 1P1XA 4H4SA 3T08A 3IVSA 1W9DM 2PTWA 3SQLA 1AL8A 1KBIA 2HMCA 1Q6LA 1CBGA 4LT9A 1RA5A 3UZJA 3NA8A 1UMYA 2GJNA 5HWNA 3BAWA 3AJXA 1XLFA 1M04A 2X05A 1OFBA 3M0KA 1YHTA 1G0CA 4GABA 1MUWA 4Q4QA 1QASA 1OGBA 5KITA 4JTLA 4JQ2A 5DXXA 1LQAA 2E68A 2J25A 3N11A 3EPOA 2O0TA 4D8LA 1UC5A 3SCSA 5I09A 3EXRA 2FHBA 2BP1A 3NL6A 1BTCA 2JGQA 4DVOA 4LB3A 3TJIA 2ZE0A 3BJSA 3A3HA 1KXVA 4ATDA 3W02A 3EPNA 3ITTA 4H83A 1WCGA 4IX2A 3M6YA 1SW0A 2B7NA 4YMZA 1LBFA 4UTJA 3MJYA 4GGBA 2GGJA 5G1MA 3LPOA 5FD0A 4AHQA 3W7LA 5JBEA 1MRQA 3I4KA 1EA9C 4ZO9A 4H4RA 1Z89A 3C8FA 1F6PA 2ZC8A 4HTBA 5AB3A 3QC3A 2FHFA 3C5QA 1ZBKA 1A50A 3EOUA 3FSUA 1DQWA 4NG3A 3H12A 5B7YA 2WWDA 2OSYA 1H41A 4DYEA 3S6DA 4L1WA 2Y5SA 1BWVA 5CH9A 4N9EA 4Q8PA 4JS3A 4NRSA 1QFEA 1OCQA 2G96A 3VIHA 2ZTKA 2DW6A 4YYFA 3AIVA 4FS9A 3AJ7A 2OWCA 2C18A 4PRRA 4S3JA 4HMEA 2PGRA 3QV7A 4F2TA 4DELA 2HXUA 4MLJA 2VEIA 3S1GA 1DJQA 3BICA 5D38A 2G3MA 1I2RA 3TN4A 3TP4A 2VX5A 1W1YA 3T2QA 1RXOB 1IXPA 5CPNA 3WKZA 2WMKA 4GQQA 1KBLA 1VPXA 4GZEA 3H54A 4MWAB 1UZ4A 2GDUA 3NQ6A 6A3HA 4IF2A 1X1OA 1JAKA 3DHPA 1QRQA 1SJAA 1X38A 2ZZ3A 3CC1A 3EXSA 3AALA 3SUUA 3WH5A 2J9ZA 2GVEA 3M0JA 3JVAA 3RU6A 5D03A 4PRTA 2X1UA 3D47A 5FCZA 3CJPA 1EYWA 3NAVA 4XKYA 3UXDA 2ZC1A 2VFIA 1WPCA 4GFIA 3ERPA 2UY5A 1FFUC 4ZTXA 1VPQA 4Y9MA 1TCDA 1GWJA 3VD5A 4MVAA 2OZ3A 3B9DA 3T2PA 3QZEA 4QEHA 3ANYA 2YB1A 5BOOA 4PYSA 1A3XA 3GTFA 1K8ZA 2E9LA 1TWZA 2GJXA 4ADWA 2DORA 3UR7A 1V6UA 1PZ3A 1C9WA 4ECLA 1WZLA 3GVQA 2CLHA 5HDRA 3M64A 4LAMA 2PA6A 3CUFA 3RAOA 4UTUA 5HA7A 2OEJA 3NQDA 2DIKA 4XAGA 1E6XM 3RXZA 4M6QA 3OYZA 2WW5A 5C9WA 1K6AA 1A80A 2NXGA 1DWHM 3QTPA 4AMCA 3PBYA 1WKYA 2W63A 1I75A 5HINA 3UETA 3UCQA 1KXHA 2OQLA 5XIMA 1GONA 4FMVA 1RALA 1DKWA 1GZ1A 4MADA 3BCFA 1EJWC 4FXSA 2V5LA 3IVTA 5AC5A 1KWGA 1R6WA 1JD9A 3DGZA 3ANUA 3CGCA 1V08A 2J7EA 3EKZA 4EWJA 3NEVA 5B7ZA 5BRPA 1XBZA 3PPFA 1R7AA 3H2NA 4G7FA 4CNSA 4GJJA 3TZNA 4EPBC 1NFPA 3PAJA 4O0KA 4MPQA 1W91A 3T05A 1N61C 1UWRA 3TU9A 4WQ6A 3S1WA 3L67A 4S38A 2CDUA 2RKXA 3R2GA 2POZA 1ODUA 4KQNA 1PWLA 2OKTA 4U33A 2Q71A 3BV4A 1SW7A 3OIXA 1QXLA 5C7HA 1KKOA 1H60A 1P6CA 3PWGA 3RITA 4HCLA 4JNYA 4EM3A 3MMTA 4EK7A 4QG9A 5I0DA 1C9DA 2WZTA 3LLDA 4NZ1A 2VM8A 1JI1A 2QMJA 4HPHA 2XDFA 5C9RA 4H9UA 4QE5A 2IKGA 2QAPA 2XVGA 4C1NB 3IRDA 3BG5A 3T0DA 2B7PA 4LW7A 1NFBA 3OBAA 3G22A 3F4NA 4KWVA 2J7HA 4ZQPA 1S39A 4AY7A 5EMLA 1BVNP 4ZGYA 4PMJA 3U5UA 3VZXA 1FDZA 2QNEA 4X22A 3T44A 4Z2IA 2PWVA 6ENLA 2CITA 4GINA 2V5BA 2PDPA 1TV8A 4QROA 4U3CA 2P8BA 1LYXA 3UGVA 4UFMA 2P1FA 5FACA 4JYDA 5C5YA 3FGCB 4WR3A 1XRSA 4E4FA 3CS2A 4H7ZA 2HISA 4LC8A 1W1TA 3NL2A 1W3JA 2P0IA 3N2MA 3C0JA 4HA4A 3CH0A 2BHYA 1V3IA 5HWMA 2F7FA 2JEPA 4KFOA 1ITQA 1E9YB 3H26A 4DNMA 5JMUA 1MSSA 1D7FA 1O5KA 4M82A 1Z42A 3C8NA 3DN5A 4QTGA 2D69A 3DI0A 3H4XA 1DNCA 1AJ0A 4TMCA 2WMIB 3CMGA 3T81A 1LBMA 1XGDA 3B0YA 3BCJA 4MJ4A 1TTIA 3QMTA 4Y8FA 2HE5A 1ZSXA 2ZA1A 4NEWA 1ME7A 2I14A 3I7QA 4ZQCA 3GFYA 4MB1A 1NWSA 1UMLA 4O52A 4GQBA 1MW3A 1TZZA 3PP7A 2Z26A 5C6MA 4IQLA 1VEOA 2QCLA 3KS6A 5FMHA 1NY1A 1ZDLA 1E6ZA 2Y70A 4HK5A 4GUGA 2VFHA 4F9JA 2VYOA 3W82A 4AXKA 3PJXA 3RR4A 4DNHA 1YXDA 4JTCA 4PMNA 1N8IA 2BG5A 3EOEA 4MNJA 1GVFA 3C2VA 3KX6A 3NVYB 4X0NA 1PCWA 3JZUA 3O6AA 1H09A 3EYPA 4TVDA 3WNLA 2PLMA 4H4ZA 1RQEA 1HGYA 3FKKA 1UKTA 1TUFA 1E5NA 3TV8A 3FLUA 3CO4A 1RR2A 3UY7A 1IYXA 2JKAA 5BWFA 3CV6A 3UFYA 5C9ZA 1FY6A 1ME9A 4JL2A 2PLKA 2V2DA 3TJ4A 4NZJA 3N9KA 1PUDA 3PBWA 3IJIA 3BL3A 1K8CA 1RP8A 2XH2A 1XFCA 4YTQA 2FPTA 2NQLA 1D3HA 3NSNA 3DESA 3AHTA 2WOWA 4QSHA 4O18A 2CBJA 4O4WA 2ZDSA 1E6QM 1BVWA 1UZ1A 2C1HA 2FTYA 1LBLA 4HZ6A 4QX4A 3VGHA 1WB0A 2FZ9A 4MG4A 5FL0A 3WQ5A 4ORMA 1STZA 2RDUA 1J0JA 5T91A 1UBSA 2H8ZA 3SEPA 4XZHA 4IIDA 1HL8A 2BDQA 4YTRA 3KLJA 2DUXA 3ZYZA 1HJUA 5U7SA 2E1WA 4GXPA 2ZRXA 2GVYA 4OOUA 1Q1WA 1XBVA 2V0TA 1R87A 4IOTA 4U31A 2ACSA 1ICPA 2KZHA 1TVNA 2V68A 3SSJA 3OQ8A 4S1FA 4Y9AA 3URHA 3M0XA 4M1BA 4A29A 3KBWA 4OUIA 1WKDA 2V5JA 2EQ8A 3UA4A 1IWAA 5A6BA 1ZZMA 4CD7A 3PFMA 4O14A 1UW9A 4HD5A 4KWUA 3CMFA 4XKYB 1FFRA 4JTSA 2DT1A 5D2XA 1AQMA 4NJIA 3G6LA 5IOBA 3AZTA 4G1NA 2QCMA 5CSUA 4ZSUA 1DXLA 1Q6EA 4K7YA 2PS2A 3N13A 1JGIA 1UJPA 3W1PA 4UR8A 1UWTA 4JZ5A 3BWWA 2PUZA 4PUKA 2GJXB 1X97A 3IUIA 1Q85A 1R86A 4IM4A 1FOBA 4F0HA 2CZEA 4NJJA 4FF7A 2MNRA 4NX5A 1UKOA 3HPFA 2FFCA 2YL6A 2GPTA 4C91A 1B4EA 4AD2A 3NZGA 4LOCA 3P60A 1GRFA 1OFOA 1CXEA 4P61A 3GR8A 1KC7A 1D3CA 3O1NA 4DJED 4A3QA 1LRNA 4N7QA 1W17A 3KVMA 3M0VA 4J5NA 4UWMA 3RG6A 5KSWA 5EU9A 1J5SA 3SCPA 3C4UA 1XV8A 2ZUNA 4QCFA 1E1EA 5TD4A 3KCJA 3W1AA 1HJQA 2P3EA 1O1HA 4JPGA 3UPMA 1TELA 1WV2A 2F61A 3OLGA 1PVNA 3JUGA 4E38A 5I3GA 2VQUA 2ZX6A 3I68A 3W71A 1QPKA 2ZDRA 1N5XA 1MI3A 4G2DA 4YTUA 2A3LA 2NQHA 4UTWC 1JR1A 1NEYA 3NL5A 1KLYA 3LRKA 1HL2A 1QBBA 4IUOA 1ZAJA 1FFVC 5A2BA 1UJQA 4H00A 4FXFA 4ZEPA 3UY8A 1GRHA 3NZPA 4PA8A 3N2TA 1WYGA 4GR1A 3VXGA 2ZZ5A 1YNYA 3B3DA 1SJBA 2HCVA 1BEUA 4PL1A 4D1JA 2OEKA 1E0WA 3GHUA 1Q7ZA 4QRNA 5K9CA 4K37A 4LUSA 2D3LA 1R8LA 5G2HA 1DHKA 1GEQA 2C16A 3B9NA 3HJZA 1QNRA 2ACQA 4Z1YA 1BSLA 1SM9A 1XIEA 2PWHA 4LANA 1HVQA 4QAIA 4I8DA 1K9EA 5CC7A 3GFXA 3CGEA 3A3XA 3SB0A 4O4VA 2A3AA 1MW0A 1NSJA 3PK7A 2WMFA 3R11A 4Z2GA 4JGDA 4JQ4A 2WC7A 3JR2A 2A7NA 1XLDA 3L4VA 4DXVA 3TOPA 3U5YA 1HTIA 1W3KA 1BXCA 3TIMA 3T1GA 1JCXA 4AYSA 1L8NA 1H7XA 3R0UA 1JI2A 5H1WA 3WLPA 3GD4A 2CW6A 3LCFA 4MUZA 1NFGA 3UVIA 3UG5A 3WQ6A 2XIJA 3WYZA 1JCTA 1VYSX 3QV9A 1UUQA 1W1A1 1W5OA 1Y5VA 1XDJA 4Z0JA 1D8WA 1BXBA 2HROA 2GYIA 1R3TA 3EEGA 1LRQA 2VR2A 2X0HA 2XJ7A 4HJFA 3GD3A 5G4WA 4D71A 2QXWA 3WLRA 4CNOA 1H0IA 1O4UA 1DORA 1JIBA 5FF2A 5A95A 3K5XA 5AHFA 2EJ1A 4CN6A 1FEBA 2ZRZA 2TODA 3BAKA 4JTHA 5CCZA 4PUNA 4L4PA 1JQXA 1SFTA 4LRSA 4PEEA 3BMXA 1UP3A 1BG4A 1XYZA 3NEHA 4HVXA 2YDAA 4YWSA 5CZTA 1N60C 1R3RA 3UNTA 2XVPA 1BYAA 4JYFA 4IIBA 3O63A 2BASA 2PDGA 2GL5A 5HR7A 2BVYA 2Z1XA 2GR3A 1PZ2A 3GU2A 1VD6A 1K7EA 3ZXWA 3N3MA 4Q8VA 1JZ8A 4B5WA 3DK9A 5DBUA 3WX7A 2INEA 2WQDA 3CQ0A 3E3HA 4JDRA 1KV5A 2XGBA 4PL2A 3RFAA 3AWOA 2LLEA 2Y5JA 4I5RA 4WSHA 3I4EA 4DF0A 2EJAA 2J77A 3LQGA 2V69A 4FNUA 4EQWA 1JJKA 4QJ1A 1YTDA 1Q2RA 3K1DA 4V1XA 1SO6A 3NR0A 1UA7A 1SZFA 4L5ZA 2WANA 2HVNA 2ZXBA 3T4CA 2AAQA 3KRZA 2CKSA 2PEVA 1IGWA 3MYOA 1Z8AA 2VTFA 1XYCA 1EQCA 3EGJA 4AEFA 4H1ZA 2WZHA 4TTUA 1KFKA 4RE3A 2TPRA 4N2YA 3U0HA 4MWAC 5A2AA 3ITVA 1Q1RA 4KGJA 4YCOA 1F74A 1GSNA 1UZDA 3SN0A 4JR5A 4ONVA 2PU0A 1N7KA 4JTQA 3LTPA 4WDTA 2NSOA 3QF0A 3DYOA 1GPFA 3TN6A 1AD1A 1DXEA 1J0IA 4YVXA 4WCJA 3SN1A 3M47A 4LC6A 4F48A 4FR1A 3GXTA 3WQ8A 2ZUWA 4GUJA 1Y5WA 3LBCA 3SI9A 7ODCA 3T0BA 3CWHA 1A0EA 2Z0IA 4MJ2A 5AC8A 3ZJ6A 1Z7AA 1TJ2A 1XLKA 3NZ1A 2VNCA 2XINA 1QUMA 4O1EA 1OM0A 5EFFA 1B3WA 1UQYA 5DF0A 4FOUA 2VZTA 3VUPA 1GVRA 1HN1A 2DFAA 1E55A 3DYPA 3MBFA 4ZOAA 4DWSB 4ZL1A 2BVTA 3TWBA 2PF0A 2HSAA 3J7HA 3VGGA 4AIBA 2ICSA 1OT1A 4EPDC 3E74A 4AFYA 3E0WA 1LQ2A 1W6TA 3N4EA 1E73M 4UR9A 1EYEA 1GZJA 2BNJA 1X6NA 2BCPA 1VEMA 3SRDA 1TYTA 2BHZA 1XH1A 2ZVRA 3ONCA 4PTMA 1G6CA 3CQKA 3GDRA 1R47A 1VC4A 3T0AA 3VNJA 2J8TA 1GW9A 3LU2A 4PCFA 3F5JA 2PTYA 3UZXA 2I56A 2F6UA 4MY1A 2QUNA 1ZX9A 2AGKA 3WDRA 3OLIA 2XH0A 4NYUA 3WSUA 4B15A 2YCLA 1R2RA 4QIUA 1ITCA 5BROA 3AICA 3SUWA 3EB4A 4R85A 1DWFM 4RXFA 3KW3A 4AHOA 1DWJM 1UWQA 1YEYA 4AG0A 1XLLA 3SRHA 3W1UA 1I2OA 4S39A 3VKAA 1EBHA 5J5DA 1HKWA 2WHMA 2X1TA 3CUGA 3BGJA 4HHLA 4XWUA 2V3AA 4XZMX 4WZHA 3LBMA 1DE6A 1FP9A 2YXOA 2DH3A 4HK6A 4QJ4B 4DY1A 3BVJA 4A8RA 1W2PA 4AB4A 4R53A 5HPOA 3OA5A 4BF7A 3EDFA 2YCJA 1NHQA 5G5IA 3MO7A 4K1WA 1GKPA 1P6WA 3QOKA 4J27A 1C90A 5G5GB 3N14A 1B9ZA 2CEQA 4OWGA 1VZWA 3B04A 3C61A 3CV7A 4Z1DA 3C3UA 1QHPA 1CI1A 4Q32A 3LQLA 4TIMA 2VD8A 1XGEA 3TW7A 3TSBA 1MXGA 3VM5A 1NDYA 2CNCA 4LUSB 3ARPA 4ZENA 3FX4A 4XVDA 1PKLA 3W2LA 1XQLA 3VIPA 2I9UA 1U33A 3P8JA 2ZZ0A 3ITXA 2GJRA 4AZBA 3DH9A 2Y2WA 1EHNA 1TG7A 2G4FA 3GBDA 2VEGA 2V6AA 4NEVA 2RAGA 3KZSA 1FXQA 1UWUA 4JFSA 1AFSA 2E67A 5HUOA 4KT2A 2VGGA 3N04A 1D2KA 3MI6A 3PS7A 2QDDA 3L0KA 2BY3A 5CPOA 3EWBX 2CZ5A 2EEXA 1HKKA 3G77A 1JYXA 3ONBA 1TPDA 1PB0A 3STCA 2J79A 2WSYA 4AZIA 2GWNA 3RPMA 1WDSA 1YXCA 3H8AA 1U5JA 2VHLA 3PBUA 2Q8XA 1F4HA 2WVVA 3TH6A 1BF2A 5FJTA 1T41A 3P5ZA 2BGQA 4GLEA 3G2GA 4LUIA 3DH7A 3L68A 4KEUA 4GXMA 3WZ0E 2QUTA 4XZ9A 3V36A 2IKHA 1JRPA 3F2DA 3W7NA 3CGDA 3W6MA 2GK1B 5B80A 1UBPC 3OVPA 2DZWA 4IX0A 5E1QA 1ONFA 3RLVA 4UQ9A 3ELFA 4F0RA 4JTKA 1ZGDA 1ONXA 2QF7A 4GNJA 3MPGA 3BAIA 2E6YA 4APNA 3GTXA 1IHIA 4TO8A 3DBPA 3W27A 4ADUA 1ML1A 1ZY8A 1C3FA 1MWOA 1ISZA 2OT1A 3ZM8A 4M5PA 4IGSA 5LGXA 1GQLA 4F40A 2PWFA 1LLWA 4P7LA 2VR5A 3CUHA 4NX0A 1QPNA 1A5KC 4I5XA 4LIIA 1FCUA 3UWUA 4JX6A 3M0HA 4YCPA 2JE8A 1Y7VA 3RNDA 5FOOA 3VKDA 4EF9A 3SY1A 2PDXA 5HQEA 2A8XA 2HE8A 3FCPA 2WZMA 3LS9A 4UZSA 4QQ3A 3GG0A 3ARUA 4UFIA 1TWIA 1FWHC 1ZJAA 3MS8A 1RCQA 3WQEA 4DLFA 4CQCA 1V77A 3FEMA 3OJGA 3S46A 4ZQOA 4B9ZA 4O15A 3ZWSA 1U2YA 3MUAA 4LYRA 3WLJA 4C90A 3T2OA 3R5EA 1DHPA 2C0AA 3F03K 3WFZA 3W7QA 4OZOA 2Q3OA 4FNSA 1GORA 3UVAA 3VNLA 2YPIA 4O1BA 4ZB0A 3E0FA 4GO9A 1VQZA 3L4XA 1E72M 5D2VA 1BRLA 3TC6A 5D09A 1QNQA 1B3OA 4N9CA 4XD6A 2DQXA 1XUZA 4GQGA 2D2HA 5DQPA 2XH4A 3M5YA 5LNWA 4G56A 1PIGA 1PTAA 3KP0A 3AXXA 5BNKA 5CBBA 4JTAA 2Q01A 2PDHA 6TAAA 1VFHA 3EWUA 5E6ZA 1W3IA 3R43A 5FEZA 2V5CA 2HS8A 1S3TC 2QJGA 3VOHA 2JF7A 3A13A 2NUXA 1OCBA 3MA8A 2E6DA 3NQGA 3TTYA 4PZVA 3NUKA 1YNQA 1YXYA 1KFJA 2FGLA 4P7QA 1E70M 5LNVA 2WSQA 4FLSA 1JUKA 1GJPA 3S3GA 5HK4A 1XKJA 2PDQA 3RX2A 1VRDA 4C60A 1THFD 1G7VA 1KR1A 1KRAC 1V93A 1QHOA 4HYVA 3NIYA 4TV6A 1W54A 3KVKA 2CERA 2DP3A 4DIAA 4PUWA 3URQA 5MHBA 1VAHA 2VXNA 2RDTA 1LM1A 4GVFA 4O1AA 4DM2A 1P43A 2RABA 3EX6A 4TVYA 1KXQA 2GR0A 1OABA 5DY2A 3N34A 2I5QA 3TJXA 2J47A 2R1LA 4K68A 1Q6QA 2QAFA 3QFBA 1V02E 2YCLB 5AC7A 3E9AA 4AIEA 1UQZA 3ZLGA 3P61A 1D7KA 3VCCA 4AAJA 2I5GA 1KCLA 2CESA 2NSXA 2ODOA 4ML4A 1OFQA 1LL7A 4PRWA 3I3BA 4QNWA 4E5TA 1W3TA 3RDKA 1HP5A 4TVWA 1RBLA 1WNOA 1EP2A 5BXTA 1T6MA 3FA3A 2PC4A 5I3KA 5D2TA 4UR7A 1IV8A 4L1XA 1OIMA 3TR9A 2J9YA 2BGSA 4IPJA 1S1PA 5CLWA 2CLLA 1KD0A 4DBDA 3RU8X 2GGIA 2W62A 1S2WA 3NOYA 5CPMA 4R88A 2H8XA 2BC0A 3WK3A 2VURA 3OG2A 4JN7A 1IT0A 4JQ9A 2GQ3A 3HMJG 4O19A 1BGAA 1H1NA 5I07A 3TDFA 4AWTA 6REQA 2I9EA 4A22A 2Z7KA 3VGEA 4HQVA 3TUUA 4ZE5A 1NOFA 4XX6A 2NVKX 5AYZA 3WCZA 1QOQA 4HOWA 3ZSSA 2PBGA 3DYMA 4GNKB 1M6IA 3FDGA 3A4XA 3BJTA 4Y90A 2R9ZA 2VT0A 2V8ZA 3HW2A 1S7MA 3S9ZA 1DBTA 1YADA 1XLBA 1FUYA 4NYYA 2WMGA 3UR8A 2HXTA 4KCUA 5A5WA 3TA9A 1L6WA 4DQWA 1JCLA 1DEDA 1R3SA 4PTVA 4TX6A 3WH7A 3BSGA 1TPC1 3HPSA 4UNLA 1T99A 1KRBC 5HXMA 3L5LA 1XYFA 1S38A 4HMNA 4NHVA 3A7UA 4GD0A 3N9SA 4DI8A 1OFRA 2QDGA 2E28A 5ENLA 5HQMA 1XANA 1UWAA 3DJJA 3M6DA 3U4AA 3VKBA 1DJNA 4X60A 1OZMA 1UOZA 3PZQA 4HSHA 1EGMA 2XIIA 4ZOHB 1WKEA 2ATSA 2QJHA 1VFSA 1CWYA 3D3AA 3IACA 3LOTA 2VCCA 1VBUA 2BY0A 2RUSA 2ZZ4A 5A6MA 2DZBA 1W5NA 2J7GA 5M2FX 5AVNA 1TV4A 3URAA 2DT3A 3GXMA 2WVVB 2PF8A 1OZQA 5EBAA 1OK6A 1J01A 4UCFA 2XZ9A 1EFZA 2HS6A 4DUWA 1WO2A 1W32A 3PC0A 1SZEA 1DQXA 1IZCA 3V0SA 3HU7A 4H6RA 1XG3A 2PPGA 4RKAA 2X50A 3REQA 2PGEA 2H9AA 3N17A 3HQPA 2GDVA 4XQ6A 1W3LA 4ZO7A 3HIJA 4E3TA 1EHAA 2QCNA 3SDOA 1KBJA 3MSGA 4HCDA 4LAUA 2GQWA 4AH7A 5FKYA 5CC5A 1CGWA 5CGQA 2VR4A 5GPRA 3FA5A 4NJGA 5E0FA 3NZQA 3HTWA 8XIAA 2UZ9A 4E8DA 3GWQA 4IMDA 1J6OA 1Q6FA 3FJLA 4OJYA 3VIFA 1FX6A 3L8KA 2CPUA 4CLMA 1VFOA 1TIMA 2E6FA 3NTYA 3MUCA 3AM9A 4HP5A 1A4MA 2CBVA 1Q6CA 3TEVA 1FH7A 4Z2HA 5E09A 4R9XA 3U2OA 1UH4A 1XI3A 4PUMA 3F4VA 1O1ZA 5E93A 3UWEA 4KBXA 1ZCOA 1PKMA 3E02A 4HA0A 3WNKA 4S2CA 3KBMA 1IEWA 4H8HA 3GNOA 3NPVA 3PBMA 4J2MA 4QE4A 4S3KA 1JYNA 1ZAHA 3WLSA 2IPFA 3NDYA 2Z6IA 5I3JA 2YL8A 1JPIA 3IAPA 2FYMA 3DKLA 3SGZA 3VCRA 4DWSC 1VPYA 2XFWA 3LHYA 3PSVA 2GOUA 4NAFB 4GIRA 1HFBA 4M29A 3OO2A 3C0QA 1V79A 3DG3A 2VZOA 4MYXA 1J79A 4O50A 5C9UA 4XD5A 1EXBA 5AC6A 3KTSA 4QLKA 1KO0A 3APGA 2XPKA 3NYDA 3SCVA 5AHNA 4HMCA 4YN5A 3EWDA 5DCEA 3RM4A 1D7YA 3HA1A 2ZRVA 3ECQA 1IR2A 1AH0A 2DW7A 3TXVA 1BRLB 3CYVA 4KW2A 2ATMA 2R94A 4NXKA 5T26A 1V8EA 4OHQA 1GW1A 2FKPA 5EPDA 4PMVA 4MLRA 3W25A 2AMXA 3P84A 1W37A 2AQVA 1TPFA 3I3EA 1CGYA 4JCMA 4QR6A 4LS2A 3ZR4A 5EFDA 2VD9A 3W6LA 2R1PA 1UD5A 1BKSA 2WPGA 2CHNA 3A5FA 3LI0A 4ACYA 3FJ6A 1V3HA 2XZ7A 4ZQRA 4QNEA 3CUXA 1EF3A 3L2IA 4DWDA 3DHDA 4JTTA 2CBIA 4J3ZA 1TWSA 2OOGA 4I7UA 4ICCX 2ALDA 2JALA 4C6DA 5C2CA 5AOUA 3S1VA 3GDKA 3URNA 3H2FA 2MANA 1MW2A 4R33A 3WF2A 2QQ6A 3P74A 4Z0SA 3ZO9A 1S5TA 3W7GA 2ASHA 4CQ9A 3WH6A 3HG5A 3B0PA 2TPSA 1KM1A 3WEZA 1OFPA 3KTXA 1J6PA 4IT1A 3WEMA 4A2RA 2BVWA 4IXXA 3SUTA 1CGTA 5A6TC 1ZJHA 1GOKA 4DPQA 4XK2A 3AZRA 8A3HA 3JRKA 2R9RA 2Y88A 1EBDA 9RUBA 4B9YA 1JXJA 1H61A 4F8XA 3TN5A 1PTGA 2DZXA 3CHDA 2Y63A 3R8HA 1QWKA 4W4QA 3OOQA 2HK1A 3S9YA 3PZOA 3P93A 3QHOA 4W84A 5M03A 4PULA 3LHUA 1GVQA 3SQSA 4YYCA 4O13A 3WLHA 2FZ8A 4GYKA 4C6IA 2WPFA 1JZ3A 1T40A 4JTFA 4WXYA 2ACUA 3JW7A 4H6EA 3EOOA 1WAUA 1WDWA 1RY0A 2G0WA 3ABXA 2D2JA 4JQ3A 3IJ9A 1OK4A 4AZ7A 1VRXA 3HURA 1POJA 4L4LA 4O1DA 4DYKA 2TAAA 3TQVA 4QS6A 1FDJA 6REQB 2PZ0A 3V75A 4RNIA 4NXSA 3AROA 4Q7IA 4Z17A 3SO7A 3E38A 2E6AA 3FYYA 2W5FA 3IGHX 3NZRA 3PTDA 2E9BA 3HGOA 3QVQA 4JTRA 3FVDA 4MNLA 4ATWA 1I4NA 1VLIA 5LHFA 4J1OA 3BOFA 1GHSA 2D22A 4NQ1A 2ZX7A 1EC7A 2X40A 3NCOA 3T09A 3SADA 2WHJA 4FALA 1GQJA 1JDCA 4GCXA 2PTXA 3N25A 4LBUA 2KAUC 3NSXA 3WG6A 1XIHA 2Z2BA 3H6OA 3VM7A 1ITXA 4R9OA 1LDCA 3BDKA 3WLMA 2J75A 1A0CA 3MBDA 3SGUA 2DZTA 1HKIA 4M8UA 3VX0A 4ZXLA 4ICNA 4P7NA 4LTSA 2FVKA 4C1KA 4R7OA 4LJ3A 3QKEA 3H21A 3GDTA 4BV6A 4LAOA 5TNVA 4XUGA 1H50A 1R46A 3M0YA 2INFA 2EKCA 4ZE4A 1O7AA 1TPEA 2D1ZA 3HMCA 2WB5A 3CGTA 3PY2A 5HBFA 1Z32X 3LPGA 2EO7A 2X16A 4EXAA 3KRBA 3W7IA 4IP5A 4C6JA 3WK1A 4PR4A 1NU5A 3AMLA 3GG1A 3U7BA 3IIXA 4C1LA 1E9ZB 1JVNA 1ZHAA 4UFLA 3ZT7A 1RM6B 2VGFA 4I6VA 5ABGA 3BMVA 3HQ1A 3Q58A 3MCMA 3DOPA 4DX3A 5JH1A 4AMAA 3LB0A 4MKSA 1QK0A 1OF8A 1H7RA 1CGUA 1GOIA 4ZB5A 5G2WA 3AMZA 3M44A 3NM1A 2VZVA 2DVXA 2EPKX 5LHEA 4UTLA 2X8RA 3VNMA 1ADOA 4QLJA 3PVFA 4RDVA 4D1IA 3CQHA 3REQB 2NQJA 1R9ZA 2DSVA 1C92A 3OVRA 3U9IA 1ONWA 2W3ZA 3V1HA 2WCGA 1OX6A 4FNRA 5CAHA 2W91A 2YDQA 1TO3A 1PDZA 3LADA 3E1F1 1RD6A 4HCHA 2WPEA 1FHLA 4AD1A 3QOMA 5D2YA 1Q7MA 4JHMA 1XISA 1K4GA 3EX2A 3UZWA 1GOMA 4F2BA 4WKHA 3E2SA 4BF5A 1RJQA 4Q7NA 3GD6A 1Z69A 2GSJA 4YIWA 3B8TA 1SMAA 4DZIA 4JQ1A 3UGRA 3GXDA 3P67A 4LBSA 4QDWA 1O60A 1V3MA 3A9IA 3FG2P 4X3ZA 4JKKA 3C2EA 3UG3A 1NDZA 3R1ZA 4Q22A 1R9YA 1YQ2A 3AZSA 2EAWA 1RQBA 4ZA0A 2E40A 4RE2A 4O1FA 3AHVA 2AKZA 1AMYA 1RP9A 3IV8A 1AOGA 2YL9A 4DZ5A 2WM1A 3UA3A 3L4UA 1IZKA 2BY1A 3P3BA 3QJAA 1UUOA 3N2CA 1VFLA 4QAWA 4RZBA 4NILA 3NVWB 3H2OA 4DAIA 1GHRA 1WOAA 5DT7A 5DEZA 4J3TA 2R82A 1EPVA 1GTHA 3PZGA 4P8UA 3O6YX 2EPOA 1VBRA 2NX9A 4K1GA 1ADSA 3OGRA 1IGSA 5I7GA 3MP5A 4BI7A 3HB9A 3ABQA 2YGYA 3N6JA 4ZOEA 1EX1A 4ZXOA 1ZMDA 5F4SA 3B9AA 4KPLA 5CKSA 2ZWZA 2BOFX 3O7UA 1JFXA 1HXJA 4NI3A 1NDAA 1KW1A 4M0XA 4FLRA 5DLCA 2DZVA 1HO1A 4MPKA 3B06A 4JTGA 4XB3A 3AWNA 2FDSA 1TR1A 4H4TA 1MXDA 4L9XA 1XW8A 4M52A 5FS7A 3F4DA 1YPIA 3GG7A 1T0OA 1GNXA 4GY7A 1A47A 1X6LA 2QGHA 3W2MA 4PMDA 4O8RA 3H22A 1CW2A 1I1WA 1OFDA 4AUBA 4LUYA 3OGVA 3F1QA 1QU4A 1NVMA 5IHSA 1GESA 3GBEA 3H23A 3ES8A 3C2YA 4HN4A 1UR3M 4CEXC 3SR6B 5ABEA 2OGJA 3WUBA 3ITLA 5HJYA 1E6SM 3HRDC 3WFAA 5AZ0A 3IAQA 5CC6A 1W1PA 5LIXX 2F6XA 4KMQA 1RLCL 3APTA 5LNSA 3QHNA 3GLCA 5I24A 3P80A 4EXBA 1WZKA 3HZ3A 3MVTA 1O5XA 1PCKA 4NP7A 1JQVA 2BX7A 2I1OA 3PB0A 3UESA 3CPRA 4H4WA 4LVGA 5LZLA 3B97A 1HUVA 2PLJA 3CZGA 1GV4A 1M7XA 4S3BA 1AG1O 4QSFA 3QEZA 1KFWA 4JD4A 4IJCA 1KWKA 3VNZA 3FSTA 3WF3A 4CD4A 4Z2KA 4PTDA 3LK6A 5HNNA 3KUMA 4WVXA 2EHHA 4EANA 1V97A 1AW5A 4ILSA 1GXFA 4C6LA 3WF0A 1VQTA 2AQWA 1H7NA 1IIHA 4N42A 1H11A 3CXOA 3ITCA 4HNTA 3DERA 1KM2A 1TQXA 1QNSA 3VYLA 2WOQA 2ZTJA 3SIZA 5HJLA 3CHFA 3S1XA 4H4QA 1Z9AA 4D6DA 2G50A 3L21A 2CHRA 2V38A 1ECQA 1KTCA 3VDCA 1UYQA 2ESCA 4JIRA 5M5DA 3FDKA 2WOIA 8CGTA 4UTTC 4GHRA 5U25A 2J4GA 2PWUA 4MGGA 2OZ0A 2XHYA 4GC4A 1JPKA 2HWGA 1SFJA 1OC6A 3BO9A 4JCLA 2ZOXA 1NIUA 3THQA 4NZCA 3N4AA 3CXBA 3ZT6A 4HSOA 1ZPTA 3QLDA 3LTSA 5DBTA 1E71M 4UTWA 5JH2A 4LF2A 4RCXA 5CPQA 2XISA 1Q6OA 1GCYA 3G24A 1CX9A 3U4FA 4M6PA 1WDQA 1H51A 2X42A 3OVQA 3T07A 3GNPA 1OT2A 1RUSA 3ZR5A 1WKFA 3NQFA 3L4YA 1FP8A 2YVFA 2ABBA 4GUFA 1XWYA 1JNEA 1QI0A 1V0KA 1UZHA 4A3YA 3RO6A 2CWNA 1KXTA 3HV8A 3W1NA 5DMNA 2GGEA 4JDYA 4YXGA 4AD3A 3PR2A 1V0MA 2YX0A 1OD0A 3WN6A 3UYIA 2ALRA 3LCGA 2OSWA 3EX4A 2NQ9A 1REQA 4FXRA 5JCNA 4Z1BA 1OEPA 4I9TA 3GC5A 3B8DA 3F5LA 4WRHA 3HPXA 1UR9A 3G1YA 3PHAA 3JZEA 2NV9A 5F7UA 4V28A 2GGHA 3IIZA 2QW5A 1L6YA 3LGEA 4EOUA 3GRTA 1S5WA 3L5AA 3QZ6A 3VDHA 3TLLA 1I45A 1KTNA 3IIVA 1Z41A 2H3BA 3IJ8A 4DJEC 3K2GA 2EPMX 4IJBA 4D2JA 1JULA 1CDGA 1F3PA 4MTVA 4G1KA 1MZHA 4FX7A 3SCWA 4PEKA 5LIKX 5K2ZA 2GQAA 1PIFA 4E4PA 1BF6A 1W3HA 2QIIA 2WMHA 2F5ZA 3STPA 4NU7A 1JEHA 3UJSA 1PDYA 3ME3A 4OIFA 1FWBC 2YXXA 5XIAA 2XUCA 3DZ1A 4J3VA 2YDSA 3EMCA 3E0IA 3W9ZA 3WD3A 2X8HA 4MDOA 3PBVA 1JNDA 3EEZA 3B03A 3IV3A 3BC9A 6CGTA 3SCRA 2EQ7A 3TAOA 4J40A 1VIZA 2Q8ZA 2V81A 2FH8A 1J0HA 1IEVA 3PZTA 4BJHA 3LD5A 4LBRA 1DJYA 3CBWA 1GREA 3WQCA 2J88A 6PTDA 1L2UA 4EPKA 1J11A 1P7TA 2DPEA 4FA3A 2VC7A 4R34A 4ASTA 1NHPA 4FP1A 1ZY9A 1M41A 4PUJA 3OYXA 1H49A 3LLXA 5D9NA 3GRIA 4K36A 1MYRA 2PRLA 3KBJA 1GEHA 3LTYA 4LF1A 3WNNA 5AECA 3W53A 2J8FA 1DV7A 1T7LA 1T8QA 5MKGA 1U22A 1K8YA 1IEQA 2VVSA 3R0DA 1VBJA 4M1RA 1SJDA 3UR5A 4W5UA 1O66A 2W67A 2QAEA 3AU2A 3M16A 1K02A 1LL6A 4J28A 4KS0A 3W7MA 2DDXA 3DHUA 3FXGA 4PN2A 1F8WA 2DY3A 1PSCA 2ZA3A 3DENA 1FECA 1VFFA 3LCHA 3QPEA 3UU0A 1ZXIC 3OBEA 1Q45A 3OTRA 4E0CA 2E77A 4MWAA 4JDBA 3R79A 1Z44A 4WUIA 1AK5A 4TVCA 3PANA 1CZ1A 1XH0A 2DUZA 4S23A 4LVBA 3IK2A 2QKFA 1G4EA 1B3VA 2ZX8A 1X98A 4OU1A 3FHAA 1HW6A 1K77A 5FS6A 1P4CA 3CHCA 3GH5A 3TYBA 3MKCA 4L1GA 3O0KA 1DQUA 2ZRYA 3BURA 3QW3A 3N29A 1SR0A 1CT5A 2HNHA 4OBTA 1LQ0A 3NO3A 3VOIA 1JDEA 1U83A 4LYQA 3HM7A 4JIEA 4YTTA 4H9MA 1DJIA 1PJ9A 3H55A 4KERA 1VDVA 2NUYA 4PMOA 4OKDA 1NHSA 3TSMA 1DJGA 2Q09A 1OG0A 1E4NA 2PAJA 3TN3A 4QLLA 4PCSA 4US6A 4DYJA 3GS6A 1OBAA 3IIOA 3CZEA 4H2HA 1E4IA 5H8UA 2YW3A 3RCYA 5H2ZA 3G1XA 1V3LA 1UH2A 2FGZA 4X63A 1M7JA 3KZPA 3NM3A 2ZZBA 3L12A 3WF4A 1F6YA 2E8YA 2VUNA 1AUSL 2J7DA 5FESA 2R8WA 1MNZA 1AODA 2CU0A 3CYJA 4HYRA 1FHUA 1NF7A 5AVHA 1YX1A 3AYRA 3ZLFA 4LCRA 4FDCB 2EF9A 4RPPA 4GKTA 1XIJA 1K4HA 4GX8A 4AC1X 3SRFA 3P0WA 1PHWA 3N18A 1IXOA 2Y7GA 1M65A 4HJWA 3MZNA 3HBLA 2A2IA 4Z08A 4AIOA 5DO8A 3GR7A 4UBPC 5DMYA 3EWWA 4O16A 1IQ8A 4XTDA 4JFUA 5HWJA 3CASA 4QE1A 3TVAA 4HNLA 7XIMA 4BURA 3KFTA 3U7VA 2QYGA 3C56A 3YPIA 1R38A 1KFEA 1I8JA 1UIPA 3O0HA 4ZO6A 5I03A 3UCDA 2XIBA 1XUUA 3WDHA 2W79A 3TFXA 1ZQ5A 2C3ZA 3MDWA 4XUYA 3F2CA 1VB9A 1UD4A 1RK5A 3PN8A 2XIQA 1XQKA 5TBOA 3S6OA 3PULA 1JDFA 2I5IA 4EX4A 5A6AA 4CU7A 4EMIA 5IXEA 2IUZA 1B1YA 6TIMA 1UR1A 1ZB5A 3VC6A 1C8YA 2F38A 1V0LA 1GJUA 1UKSA 3UR2A 2J7FA 3AXKA 1GZGA 3LXAA 1EDGA 3AQUA 4JTDA 4DJFC 3DXIA 3OW1A 4BI5A 1SW3A 5G1TA 2WNWA 4M19A 3CL8A 3NWRA 1E0UA 4GYJA 3GH4A 1E15A 1U5VA 1S2TA 3NGJA 2DZAA 2D0GA 1TPH1 3DX5A 4JAWA 2YFOA 5FF0A 4QDMA 4YHEA 3ZVIA 1Q6GA 2WVTA 2UV8G 3AIQA 1WOBA 2AL1A 2PDYA 3TMQA 3EMQA 3HN3A 4EF8A 3M43A 4UTFA 2A3EA 3APYA 4NI8A 5HJXA 4M80A 3V0UA 3VK5A 3PTQA 4GBDA 2OO0A 2P53A 1E3ZA 4JYEA 4JHZA 2Y5EA 3QSTA 1X7FA 4I6KA 4WY0A 3GVRA 4QITA 2Q3RA 1FWGC 4PBEA 2VX7A 1HT6A 4XSMA 1H4PA 5LSMA 4WKAA 1T3QC 3TK7A 3VIKA 2WOVA 1SUXA 2CCRA 2QCDB 5HQLA 2Z25A 3KCLA 2E0PA 2PDJA 4AX7A 4NNBA 4OECA 3NQAA 4B3LA 3UCCA 3PUDA 1UROA 1J0YA 1J0ZA 4DO6A 4J56A 3LBOA 4X61A 2BB0A 3VDBA 2QUMA 1KCZA 1UR2A 3ZIZA 3E0VA 2Y1HA 4B92A 4F0KA 4MB4A 3WMSA 4J3SA 1EP3A 3ARVA 2P8CA 3IK4A 2ON3A 1ISYA 2NX1A 4YS1A 4CVUA 2JKPA 1F5ZA 1JCNA 3MUY1 4RDWA 5JU6A 3PZNA 4HTYA 5A6SA 4A6GA 3W70A 1OSEA 4Q8UA 2PZNA 5FAJA 1QWGA 3R25A 4WOZA 2TYSA 3UP8A 5G1YA 3TQPA 1AA1B 4WJEA 1P7TB 1CGVA 2DIEA 4DN1A 2G37A 2F2KA 3U6WA 4BF9A 4CQAA 2HZGA 3TX9A 3CUZA 3QZAA 1SVDA 4WKFA 2YAUA 2E1DA 3SY5A 1FWAC 5MKGB 4JKMA 1L8PA 1P0BA 1WDDA 2WLYA 1CB2A 3GVWA 3DK4A 2IQ0A 3WK0A 2W66A 2O9PA 1WE5A 3MUXA 3ALFA 2OU4A 4FSAA 3VI2A 1XPGA 2IKIA 4N4PA 1YDVA 1GK8A 1MUMA 4C6OA 4K8HA 2QDHA 1KM5A 3QMSA 1G4TA 3WDQA 2D0FA 2FGBA 4Y9NA 3QYQA 4PFHA 4JTIA 5FSDC 3ZJ7A 3ARQA 1DTUA 1FWNA 4HNNA 3W7PA 2CFYA 2QEZA 4D6IA 4Q4MA 3TTEA 4LB4A 3HO8A 4LALA 5TAOA 3WJZA 2FPYA 3NG3A 1MEHA 5EMYA 3RO8A 1FWCC 4IUGA 4AEEA 2X09A 4QM1A 1AW1A 3O05A 4A3RA 2VRQA 4LPCA 3P0XA 1CXIA 3MW7A 5HAOA 2ZADA 2OT0A 3KOZA 1QPOA 2FZBA 1JAEA 4HMDA 1W1B1 4K2SA 3LLFA 3AC0A 3N2OA 2YLLA 4H4VA 1FWJC 1A5CA 1MFVA 5F2LA 1V6TA 4L4OA 1Z6KA 1VR6A 5A6JA 1Q63A 2VWSA 1PV8A 3CIXA 4ENLA 3RYSA 3LG3A 4RUBA 3GTIA 3GC2A 1Y65A 3N6QA 5MF5A 5HR6A 1MFUA 4H9TA 5REQA 1GQIA 3STEA 3NVZB 3TZFA 1RSCA 4JFVA 4C6KA 3VOJA 3K8KA 3S2NA 4ADTA 1RBAA 2QPSA 3B4YA 2QV5A 3NVDA 3BW3A 1I9CB 3MC5A 1QNPA 3KL0A 2BFGA 4AY1A 2JKEA 3VPLA 2VX4A 4LX4A 4B3KA 2D24A 4LXFA 1U5HA 5E9XA 4NKCA 2VEFA 4LCQA 3TFCA 2YXGA 4GG9A 1XBYA 4MB3A 3W1XA 4WLCA 2PDCA 1A5AA 1YIXA 3VZYA 4L6DA 1LWHA 2J27A 3R8RA 1K9FA 1Q5MA 3AN1A 4GMEA 3TLQA 1JPDX 1MQRA 4URIA 5DX7A 2ISVA 2WLZA 3O6DA 1EO7A 1ZK7A 2WXDM 3DEQA 1BZLA 4U2YA 4JOMA 2H6RA 1V6YA 3LM7A 3WJSA 4MMWA 5I3IA 2WZEA 4EMWA 1EKOA 3GHTA 5J5RA 3R7MA 1J2WA 4MAVA 4YTSA 3CV2A 2Q8LA 4E2DA 4I8YA 5HNUA 1W31A 4ZMGA 3ZS4A 1Q4NX 1F3EA 2VMFA 1J18A 2XGZA 1EJUC 1YBQB 4GX9A 3UPWA 2NUWA 3D5HA 2HPIA 4IWWA 1EQPA 3WDJA 2SFPA 1NQKA 3A6OA 5G4EA 2EGZA 4AVFA 2Z6JA 3KP1A 3WF1A 3ABOA 4ALDA 4FO4A 4UIOA 3DFSA 1R3QA 4AQLA 1OINA 1DWIM 3MUIA 2QIWA 3CHEA 2Z4GA 2PD5A 1XRTA 1M01A 4C7FA 5ABTA 2IKJA 1KFCA 1TIWA 4EPEC 1ZALA 1JUBA 3MV11 2V3DA 2NV2A 4MB5A 4ZZ9A 1TJ1A 1BVZA 3T7VA 3DK8A 2G5WA 4QG6A 1N63C 4UC5A 1XC6A 2EG6A 3TCEA 4JIPA 4GYFA 3AYSA 1NP2A 1HJWA 4EKJA 5H8MA 1F07A 4NSBA 3FXYA 1MZRA 3NNTA 4ATLA 2RFGA 1TPVA 3ITGA 1IF2A 4ROPA 2MUCA 3EB2A 4QJ5B 3KBSA 2DZSA 4K7ZA 3M1ZA 3CU2A 2VWTA 4WY0B 2WHKA 3HPZA 1LZOA 1YLVA 3ARZA 4NJKA 1A49A 1KCXA 3ARTA 5BRQA 4KPRA 3QGAC 2OODA 4XZNX 3W7KA 2F84A 1GT8A 5DMLA 5BW6A 1FWWA 2ZA2A 3IC9A 2VFFA 3KL5A 1Q8JA 5LA2A 5F4XA 5A8MA 5E6YA 1GRBA 3I10A 4GBUA 4XAFA 4RDZA 1SFSA 3MWAA 1A0DA 4MDPA 4CD6A 2Z28A 4M6UA 5JBDA 3KVJA 1B3XA 1LOQA 1I2PA 4JIQA 4FB7A 3AYVA 4L9YA 4L6HA 4WHBA 2H3DA 2BVDA 2CFFA 4NT0A 1NOWA 5K7JA 1QHZA 1QW7A 3BANA 1NJJA 2E09A 1EZ2A 1TZ9A 1BTMA 1M3UA 5EY5A 4S3EA 3EANA 4AYGA 5IHRA 3MCOA 5AYYA 4U3AA 5D33A 3GHRA 2NT0A 3BG3A 4P7OA 3L23A 1E4LA 4G5DA 2V3EA 1ZFJA 2PDKA 5D05A 3ALGA 4QS5A 5CZKA 4XD3A 1VGAA 3OZYA 2Z1WA 3EDJA 3C2OA 2GSEA 3NQEA 1RBOB 1KM3A 3PWIA 4JXCA 3AU6A 3M5ZA 1LL4A 2RJHA 4GQ0A 3TNBA 3AO0A 3M4HA 3A4JA 4KF1A 1GOOA 3DC0A 1OX4A 4KEZA 1ZBVA 4H4XA 3Q37A 1H2IA 2G4JA 1XIMA 3GM8A 1J93A 3W81A 5DY3A 4NASA 3W7DA 4DWSA 2CIPA 4H50A 3WBAA 3WBYA 1Y5XA 4E2OA 2DJXA 4GYPC 5DCDA 4GUIA 3NGFA 2X8CA 4ZCWA 3THCA 1H6VA 4KRUA 1W5QA 2O4QA 4GZ7A 3QGVA 2TMDA 3FNDA 3OP2A 1BPLB 1HIZA 4XBJA 1F3XA 3BJFA 4X9YA 4YJ5A 4I90A 2X7VA 4KRZA 5EGRA 1UC4A 3DJGX 4L80A 3W75A 5I78A 3BAYA 4BWLA 2QR6A 3VNYA 4I9AA 1TV5A 4XIMA 3AYTA 2PSNA 2ANUA 5EMMA 1FCVA 1GOQA 2UY2A 3UYCA 3HGSA 1KFBA 2Z2UA 2OG9A 4OE7A 4JTEA 4QJ3B 4XTIA 2YDRA 1R9XA 4NJHA 3DGBA 1E0XA 1WUFA 5EKYA 3NYZA 1W1VA 2YSWA 3WEOA 3N3TA 1CECA 2AMGA 1ZLPA 5K9DA 2WC3A 5REQB 3QRHA 4UFKA 2WKLA 3OQEA 4A35A 4A05A 4D6GA 1JZ2A 4UNIA 5M17A 2FB3A 6XIAA 3RRAA 1TJPA 3IWPA 1BYDA 3SY8A 4JEQA 2XVNA 4IHCA 3EWCA 4LU0A 1G94A 1ELSA 3THUA 4GGHA 2Q02A 2W3SA 4J2PA 2D23A 4RL3A 4CVWA 4QDPA 1RJRA 2POTA 1TTQA 4ZR8A 1BWKA 4W7WA 3SECA 2X2YA 1B3YA 1RV8A 1ONEA 5ABFA 4C65A 1W9VA 5FF4A 1OJTA 4GA8A 1WQ5A 1Y8BA 1S2CA 3SQMA 1EXPA 4E2BA 1T5AA 1VFMA 1GRAA 1XLGA 5CZ0A 3HPAA 5HNRA 2OELA 2D2OA 1JDAA 3TXZA 3G6MA 1UD3A 4GIAA 1V03A 5EL1A 5FA5A 1LT7A 3KM8A 4ZODA 4XZWA 2R1KA 3KTCA 1AH4A 4BY3A 1HJXA 2Z1KA 3LRLA 4MY9A 2VP8A 3M7SA 2BLEA 3QFAA 1A5LC 3MJMA 4KEMA 3PPHA 3AS3A 2IXVA 1VEPA 3EAOA 3H2CA 2FMNA 4Q3MA 3RJXA 2R6OA 2UWFA 3WO8A 4C6MA 1K9DA 2DZPA 7ENLA 3C6CA 1E0TA 1V59A 3ZJKA 5DT5A 4IPIA 4D6FA 4JKLA 3SCTA 1UKPA 3M41A 7TAAA 1V3JA 2Z00A 2ABAA 3HQNA 3DU0A 1Z3NA 1ZAIA 3MHGA 4PMXA 4GY1A 3TW9A 3BLIA 4CD8A 1RPXA 4LAKA 3MV01 2TRSA 1NDVA 1NP0A 1POKA 3HGJA 3PPCA 5FJOA 1W9UA 3WIJA 1E9LA 3UNDA 1ESWA 1VJZA 1YYAA 2BZNA 3M9YA 2PWGA 1KRCC 1HGWA 3UERA 3HQOA 1ZL1A 4REQA 3VIMA 4V27A 3T8LA 1QW8A 4FF5A 4HBKA 3TYCA 3LY0A 5A69A 1BSIA 2GK1A 4E8GA 5LGZA 3NS1B 2GDQA 3RNMA 1RQHA 1TJRA 5KZDA 2WP6A 1R5YA 3N9RA 5JQ9A 1LORA 3FN9A 3KOFA 3DFOA 5D9OA 1W9XA 2G97A 1PAMA 1MO0A 3E49A 4U2ZA 3NURA 2VEPA 3GDMA 4F2UA 3AFBA 4GO8A 4KFNA 2G3NA 2V9DA 3M07A 3PZUA 1DIKA 3NPXA 1H0GA 2HTMA 1GETA 2HVMA 4FEZA 3EMZA 4PTWA 4RW3A 4E6MA 4QISA 4RZ6A 3VOFA 5F1UA 1R30A 3IIPA 1DIOA 1QPQA 1F61A 1WX0A 2E25A 4CCCA 2GVGA 3T78A 3B8VA 3PAOA 4BKNA 2ZZ2A 5C0QA 8RUCA 4HHPA 2PFHA 5C9XA 1WZAA 2P76A 3AIBA 2JIEA 2VEKA 2FTPA 1TYGA 1GERA 4B5SA 1X2GA 1EH9A 3P8IA 1XDIA 1H1ZA 3QC0A 3U57A 2VEMA 4AU0A 1XSIA 2ZYFA 1XR2A 4MJZA 3L4TA 1PHQA 1I0BA 1K8XA 4TOQA 2EG7A 4Z2LA 3MKKA 3EWZA 4MY8A 3ZVHA 4XAZA 5CPTA 4MZYA 5M3WA 3RLUA 3W1QA 2B81A 1GVIA 1XKYA 5EB8A 3RM9A 1FWEC 4U28A 1UP2A 4GWEA 3DAQA 3QPYA 1IIGA 4L6OA 1BWLA 5HANA 4JBRA 3RK8A 3QV8A 3AS0A 3TNOA 5BXSA 1FXPA 1AJZA 3OIHA 3GDLA 3MQTA 1XINA 2YVGA 1CEOA 2EPNA 3MI3A 4UQEA 4OV4A 3UPBA 1EZWA 3GZ3A 4UFJA 4IIHA 3DDMA 1EB3A 1LT8A 1YPFA 2PDWA 5E0CA 3IJ7A 4H3DA 4JX4A 3GXPA 1OX4B 4FX6M 3TE9A 2BBFA 3PBGA 1I2QA 3L0GA 3ITYA 4NZ5A 1SR9A 3EA2A 3DFYA 3KOYA 2FH6A 5I3FA 3E2QA 3S8HA 1GKQA 9CGTA 2E9MA 2NW0A 5HNTA 3R13A 2FVMA 3EX1A 3P82A 3QFWA 4HHMA 3BV7A 3RR1A 2OO6A 3ZWTA 4LA1A 4N4QA 4DJFD 1CCWB 2DSKA 4WDWA 3W3OA 3KLLA 4P8XA 3CUIA 1H62A 3LGDA 3W07A 1VH7A 4GJ1A 2CBUA 3AS1A 2EPLX 4ZOCA 4K8GA 2ZBTA 3TYUA 1F05A 1FWDC 4K7VA 2CLKA 1EWEA 1V6WA 1O6IA 3NO5A 5GNZA 3MO4A 3PZMA 5CJMA 3TYAA 3V16A 4C6FA 4PTXA 1B57A 4JIHA 3KRUA 4YWIA 1CB7B 3W26A 1J4EA 1FA2A 1Z48A 2HJPA 3W2KA 5C2GA 1TTJA 2PDMA 5CGMA 4DBUA 1A5UA 1TJ0A 4XZLX 1TPWA 3B0UX 1PYMA 1XDLA 4DO5A 4MYAA 5L9FA 3UT0A 1C8QA 3GSMA 5SWUA 2OQHA 3RCNA 5A8OA 2G3FA 3LMZA 3NXLA 4GCAA 2GR2A 3ABRA 1MVYA 2AL2A 2QPUA 2WPBA 2PLCA 3G0SA 5LIYX 4S3CA 2C79A 3WENA 2V67A 2YA2A 5D02A 1HKVA 4IG2A 5KVHA 5A6BD 4LAZA 5CG0A 5LIUX 4R7JA 1A5OC 2ZZ7A 3ZFHA 4O53A 1CLXA 1A4LA 3CNYA 1PE1A 4CNNA 3G5EA 4HU3A 4LNYA 2ZWYA 3L9CA 1EGZA 3BE7A 3U2CA 1QR7A 4ZB2A 5DFAA 5GJNA 5ABFB 3LENA 5K3VA 3GIYA 4CNPA 1BWCA 1SGJA 3KDOA 4IIGA 5J04A 4EQXA 4LEQA 3R58A 2QGYA 4X0VA 2WVUA 3LYEA 5FI8A 2VUYA 3VC5A 4EVZA 4IMAA 4W8AA 4FOJA 3O8AA 2ZX5A 3SR7A 2I57A 4AD0A 2GUUA 4N9BA 2OCZA 4LVFA 4D6HA 2IPGA 1Q6DA 2C15A 3VD3A 4PMUA 2Y24A 4KWSA 1YE4A 4AIUA 1SO4A 5IBXC 3ZLHA 2ZX9A 5C2XA 1SMDA 4RPQA 5K4ZA 4UTTA 1C8VA 4GJIA 4N6EA 1J96A 3GAKA 3D46A 2DV0A 1QDSA 3E96A 3WQVA 1XIIA 2XIOA 4QP0A 4XISA 4BK9A 4DXKA 3GW0A 4O0ZA 4GFSA 4FPSA 5CXPA 3R94A 2AAAA 2YZRA 1JG9A 3ZJ8A 4CGTA 4LWWA 1QI3A 5A8NA 2VCBA 2G8ZA 4WGXA 1TTPA 1WZMA 3EAUA 4REQB 3B0VC 1LG2A 1F8IA 1OIFA 1ZP4A 5DRCA 2Y7FA 2HBXA 3CAKA 1UASA 4A3UA 1X8CA 2CLOA 3C52A 3WNOA 2DH2A 1SSGA 2QCFA 2VFDA 2W4XA 1AJ2A 2BY2A 5ECUA 3TOYA 3GKAA 5KINA 3EDKA 4CEUC 3DCPA 2AOSA 3BG9A 3DHFA 4IFOA 3N1AA 2XU2A 2E3ZA 3B4UA 4DRSA 1KLZA 4QG8A 5FL1A 4GI8A 1GRTA 3PZVA 2NLYA 2WJEA 3KE0A 1TPB1 5CSRA 3S5YA 3SQPA 2WJZA 1XFBA 3VX1A 3HFYA 5I02A 3LXBA 1ICQA 2ZUSA 3PG8A 4IGMA 1D3GA 4MM1A 1EIXA 3JU2A 3EA3A 1JEZA 4AC7C 3AAMA 2C71A 5KZ6A 4DJEA 2ISWA 6ALDA 1QVBA 3DG7A 2YIHA 3CIVA 2Z1BA 1XF0A 2JK6A 4DF1A 3WH9A 4DUOA 3LERA 4IICA 1IE7C 1FH9A 1K1DA 4LFYA 2HPMA 2A3CA 5I77A 4JTJA 4TXEA 5BOEA 4NRRA 1UR8A 3FYPA 4QEEA 3G0XA 2GJLA 4JN8A 1S2VA 4NAFA 1E9IA 1XP3A 2DT2A 4WK9A 4BZYA 1EP1A 3UBPC 5JUVA 3G1DA 2GGGA 4OOZA 1OC5A 2XFRA 1HL9A 3UEQA 3ZVHB 4BFAA 3FW6A 1GTEA 4MSSA 2OKOA 3TYZA 1XDMA 1MW1A 4LCSA 3TQ0A 3EF6A 2A3HA 5G4HC 1N2VA 4L64A 1J8VA 3R07C 3NQ7A 3QSRA 2HQMA 2C1IA 1EC8A 1W5PA 3S5ZA 4EAMA 1LG1A 1R3YA 2J24A 2UY3A 3E0LA 1YW1A 1VIWA 1EJXC 5AYBA 2INZA 5I06A 3W7JA 1OYCA 1QBAA 4H4UA 1NDWA 3VD7A 1N8FA 4DB7A 2C3CA 3OZMA 5I79A 1RAKA 1XLAA 3BARA 2C91A 3QW4B 1K7XA 1EC9A 1JGMA 1SZGA 3HG4A 2OJPA 3MMWA 1VCVA 4GVGA 4UTHA 3U2EA 2DJLA 2CYGA 3V5OA 3IS4A 1HZYA 5GNXA 4OVXA 1ENUA 5HPCA 1T8XA 2WJFA 1JRCA 2UY4A 1VCFA 4JQAA 1JZ6A 2GRTA 1WA3A 3TTQA 2X0YA 3BGAA 4UQDA 4F4RA 4FX8A 2NQ5A 3O3RA 3ZQ9A 3SUVA 5BWAA 1GQNA 4W93A 3VOGA 1BQCA 5E0KA 3DGHA 2V63A 1FCBA 4ZTYA 3O2LA 1K3UA 1OYBA 4S3AA 4J35A 4EXQA 2WZIA 1AZ1A 3Q2DA 3UXLA 5CJNA 2DSUA 4AZ5A 1XYBA 4KESA 2PP3A 5HMFA 2A21A 3SCUA 1DTNA 1R85A 4FLOA 2RHGA 2JFEX 3W7CA 1XHGA 1UB3A 3EOSA 3PTKA 3GKFA 1F3WA 3ANVA 3W0KA 2J6XA 3HF3A 4CU6A 4NAEB 4XZIA 2VRJA 3V35A 1W2VA 2OX4A 5ECVA 1E4MM 1C93A 3VZZA 3CAVA 3K8LA 3OVGA 4GPNA 3L5OA 4Z42C 2AL2B 4LEFA 5E9AA 4RV3A 1XCWA 3STFA 4AX6A 4POCA 2D2GA 2WCAA 3H2MA 4KWOA 1F73A 2GJPA 3AMDA 5FF3A 2W3RA 3FJ4A 3FKRA 3MSDA 4IG2B 1QAPA 1EOKA 3VMNA 1XM3A 4CCDA 1ZTVA 5CC3A 3M46A 5D9MA 4F0LA 1P0KA 1SZNA 4US5D 3GDBA 4HYWA 3DUGA 4TMBA 3EX3A 3CHVA 3LZ3A 3KOWA 2CLMA 2WVSA 1PO9A 2DGAA 1RZMA 3VNKA 3SSZA 1JF6A 1HJSA 3WL0A 1V3KA 1P48A 3MSRA 4GI6A 1CLVA 3RILA 1F8MA 3H7UA 1NELA 2PRHA 4OGZA 1IT8A 3WQ4A 7CGTA 3PPGA 1GYLA 2X0SA 3I6RA 4O54A 3A23A 3WLLA 3V1PA 3VAVA 4G9PA 3GU1A 5KZEA 3W83A 3R12A 1LF1A 3VMOA 4PBGA 3VOCA 1GOXA 2CHOA 1OYAA 1UR0A 4P5UA 1HF6A 3S2LA 5C70A 1JPMA 4V33A 1TV3A 2V2HA 1R3VA 1G67A 4UNKA 5CZJA 1JCJA 4IP4A 1V7AA 1V0NA 3RM8A 5CPSA 1VFUA 1XYMA 1VHCA 1TV7A 2RJGA 1OCJA 2YCEA 4S3FA 4FOKA 4RW5A 3P5YA 4S3GA 3KRSA 1XLCA 5IM51 3GNXA 1H3GA 5D4YA 3VD9A 3MHUA 4F79A 4PH6A 3RGTA 3TC7A 1XYLA 5KVIA 3CK5A 3FK4A 2WAGA 4BS0A 1Q8AA 1D9EA 2OTDA 4R5EA 5BXPA 2VDIA 1ZCCA 4WEVX 5XINA 4CNTA 3W4RA 4NNCA 2RDXA 2OB3A 2FZDA 2GOKA 2QCEA 3LCWA 3LMYA 4EIVA 2GR1A 4JTUA 1TV2A 2I7GA 2VDHA 5D04C 1XIBA 4J9JA 8XIMA 1XC4A 1JPHA 4NL1A 2O9RA 4BCEA 4PCNA 4H9YA 4DJFA 2IXUA 4UMCA 3VTRA 3H4GA 2QVHA 3BMWA 1XD1A 4P2VA 1FHVA