4K1WA

Crystal structure of the a314p mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
412
structure length
395
Chain Sequence
SSGLVPRGSHMKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIKSLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGPTDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Crystal structure of the A314P mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate
rcsb
source organism Novosphingobium aromaticivorans
total genus 144
structure length 395
sequence length 412
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2013-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k1wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k1wA01
3T4WA 3EKGA 1PDZA 3DG7A 3I6EA 1TKKA 3MUCA 3ZLGA 2GDQA 1WUEA 2ZADA 3NXLA 4IL2A 2DW7A 4HN8A 1KKOA 3CYJA 1TE6A 1R0MA 2PGWA 4HNCA 4KPLA 3OTRA 1MRAA 2PMQA 2PS2A 2QDEA 4A3RA 1FHUA 3IK4A 2FKPA 2QVHA 3MY9A 2OQYA 2OO6A 3PWGA 2PP0A 3VCNA 2OZTA 4J3ZA 3ENLA 2GGIA 3NO1A 3N6JA 3B97A 4EWJA 4DN1A 3QLDA 3TJIA 2HXTA 5FJPA 4IP5A 2PTYA 1W6TA 4M6UA 1XS2A 4ZA0A 3MKCA 2QDDA 1NELA 3UGVA 2P88A 2OG9A 1IYXA 3FCPA 3R11A 3UCDA 3DIPA 3IJQA 3TJ4A 4GGBA 3UJSA 3V3WA 3SN4A 2AL2A 3NFUA 3SBFA 4DXKA 4E6MA 4A6GA 2PCEA 3OZYA 3TQPA 3TOYA 3STPA 3S47A 2O56A 4DX3A 1ELSA 3OPSA 1PDYA 1SJCA 3ZVHA 3OP2A 3R1ZA 2I5QA 5FJUA 4FP1A 2PGEA 1E9IA 3HPFA 3KUMA 3NZGA 2XH4A 3H8AA 3S5SA 2PTWA 3N6HA 1KKRA 3DG6A 2MUCA 2P8BA 3H7VA 1P43A 2OPJA 3CAWA 4M0XA 3DG3A 4IHCA 3VDGA 5IDZA 2GGGA 4Z1YA 3FXGA 3I4KA 3UXKA 1BKHA 3H12A 3FYYA 3OZMA 2HXUA 2PTZA 2PU1A 3IJIA 1SJAA 3T6CA 2QJMA 1OEPA 3GY1A 2GL5A 2OVLA 3OW1A 3FVDA 2XH7A 3TW9A 3DDMA 3PK7A 3TWAA 4HPNA 2PU0A 3UXLA 4GYPA 3ZLHA 4E4UA 4IL0A 1BQGA 2XH0A 3RRAA 4G8TA 4H19A 4GFIA 4A35A 4JN7A 4MKSA 1F9CA 2QQ6A 4H83A 2DW6A 4FI4A 3R0UA 4KWSA 1WUFA 3JW7A 3ES8A 2P3ZA 1XPYA 1YEYA 3QPEA 3DGBA 4MMWA 1SJBA 3SSZA 2OLAA 2PPGA 4E4FA 3DEQA 4MGGA 2PODA 3BSMA 3PWIA 4F4RA 2GGJA 3N4EA 4H2HA 3SJNA 3RO6A 1MDLA 1JPMA 1TZZA 3GD6A 5EU9A 2XSXA 4JN8A 2AL2B 1JDFA 3TWBA 2MNRA 3UJRA 3Q45A 1EC9A 5ENLA 3TCSA 4HCLA 3VCCA 3VA8A 6ENLA 3UJ2A 5FJRA 3VFCA 2ZC8A 5FJOA 5BOEA 5BOFA 3DESA 1MUCA 3MWCA 2NQLA 3Q4DA 3JZUA 3V4BA 4J1OA 3ZVHB 4Z17A 3RITA 3DERA 2OZ8A 3V5CA 4E5TA 2PA6A 4IT1A 1L8PA 2GSHA 3FJ4A 3CT2A 5J04A 3CB3A 4HYRA 2P0IA 4ZCWA 2PP3A 3R10A 3CK5A 1R6WA 1MNSA 1EC7A 2GGHA 4ENLA 2HZGA 4KT2A 3QKEA 4K2SA 3IJLA 4GGHA 4IP4A 3H70A 4JHMA 3N4FA 2OFJA 3GC2A 3SQSA 1RVKA 3UJEA 3ZVIA 3RCYA 3CXOA 3VC6A 4DYEA 1EBHA 3UJFA 4H1ZA 4IZGA 3RGTA 3R25A 3BOXA 1JPDX 4HCDA 4E8GA 2ONEA 3D47A 2AKMA 3SN1A 1DTNA 3DFHA 2OZ3A 4K1WA 3P0WA 2QGYA 3BJSA 2QJJA 3UCCA 4HCHA 3MQTA 4G7FA 2RDXA 1EBGA 5FJTA 2OX4A 3U4FA 3K1GA 1EC8A 3V5FA 4GIRA 2QJNA 4ROPA 2PP1A 2PTXA 3PFRA 3SN0A 4X2PA 1NU5A 2XH2A 1KD0A 3ES7A 4KEMA 2PSNA 3QN3A 4GISA 4DWDA 3T9PA 2OQHA 2OKTA 2FYMA 1ONEA 3MZNA 2GGEA 7ENLA 3T8QA 3VC5A 2HNEA 2POZA 3THUA 3EEZA 3U9IA 2CHRA 3QTPA 4HNLA 3GO2A 1P48A 1MDRA 3JVAA 1FHVA 3ZLFA 3TTEA 4YWSA 2P8CA 3I6TA 3FV9A 3DFYA 3MSYA 4GYPC 3RR1A 4GMEA 1SJDA 1ECQA 3D46A 1KCZA 1JCTA 2AKZA 4K8GA 2AL1A 3R0KA 3P93A 4DHGA 2XGZA 3P3BA
chains in the Genus database with same CATH superfamily
4V15A 2H8ZA 4LRTA 3IUHA 4BI6A 3R5EA 3H4KA 4W9TA 3G18A 3QM3A 3MUCA 1XYCA 3GSMA 1AH3A 5I00A 3U5YA 3ZM8A 3BUVA 4UOJA 1AVAA 3ITVA 3GWQA 4AHQA 3CYJA 2C1HA 4P61A 2PDBA 3DHDA 4HNCA 9CGTA 1GOWA 3ERPA 3LBOA 2XDFA 1K8CA 4P2VA 3VD7A 4GZJA 1H7OA 3VDHA 3IK4A 1NWRA 4K8DA 3E12A 2EPNA 1M6JA 4N9CA 4MPKA 4UTTA 4IIBA 4Q33A 5LGZA 4C91A 4WRHA 1LRQA 3PWAA 3C3UA 3CZ8A 2GGIA 1MQQA 3B97A 3LXBA 3ABOA 3BQ6A 3G1AA 1FCQA 1NOWA 4ZENA 4PH6A 4WEVX 4I3GA 4J57A 5AC6A 2FGZA 1IZCA 5H91A 1JDEA 4JL1A 3UA4A 5IM51 4M52A 1W1VA 1JRBA 2PWGA 1OT2A 1EFZA 2WM1A 1JYWA 3SN4A 4QLLA 1E6ZA 3MZ2A 4GPNA 1EDGA 2XZ7A 3RM4A 1OX4B 5JCMA 2YLAA 3CQIA 5IFTA 1CXHA 1EWEA 5D2YA 1HKJA 3PZVA 4ES4A 1E9YB 3OLDA 4DNAA 1UWTA 4HB7A 3NDYA 3PNUA 3VD5A 2EHHA 2PD5A 5F4WA 3GFYA 1EX1A 2EQ8A 2BP1A 1A0EA 3VNZA 2I5QA 4RLIA 5FS7A 4GE8A 2WANA 5IRPA 2YCJA 1XM3A 4ZOEA 3TK7A 1KKRA 3PZIA 1RUSA 4JTKA 3VVGA 2C3ZA 3FHAA 2HTMA 3FS2A 3P62A 2WNWA 1VHNA 2I9EA 3XISA 4HVXA 4N6FA 1B3XA 4EPKA 3TYCA 2DFAA 2DT2A 4ICMA 2NXGA 2IPJA 3DZ1A 2Y0FA 1WYGA 1DXLA 1KBJA 3AZSA 3KZSA 4D6CA 4MY9A 4P7QA 1JUKA 1ZGDA 3APTA 5AY7A 3TUUA 4EX4A 1R3VA 4IJCA 3WJXA 2TRSA 3KVLA 3W27A 2P50A 3AROA 3Q37A 1YDYA 3FNDA 2X1IA 2HQMA 2X05A 2C7FA 4ZFCA 4C6FA 2DW6A 2A85A 3H22A 2BODX 2JIWA 3M0YA 3BARA 4GNKB 1F3WA 3JS3A 5E0FA 2ABBA 2HWGA 3TN4A 3PVFA 4MZ8A 4HHHA 3GM8A 3GU2A 4LAOA 1T8QA 3LPOA 4XZ9A 1E72M 3UFYA 1WOBA 3DGBA 4JZ5A 3GW0A 4REQB 3AIUA 3BLKA 4V28A 5HMSA 3TDFA 4PTWA 1FDYA 1DKWA 1YTKA 4EIVA 4QE5A 2DQXA 1JZ7A 5B80A 1QW9A 2DSWA 4HYVA 1PCKA 1SFLA 4IQJA 1KLZA 2ZUUA 3SY8A 2PD9A 3E2QA 4YNGA 1FDJA 3AN1A 4Y2WA 3VOCA 1IQ8A 2L5HA 3SGUA 4R88A 2W3ZA 3A12A 3EDEA 4E2OA 4AD1A 1MFUA 5EPDA 3VIJA 3SJ3A 5HPCA 2DZAA 1UJPA 6REQB 1ISXA 4UXDA 2YYTA 1ZK7A 1TWSA 4FOJA 3JZUA 1F3PA 4NT0A 3ALGA 1BKSA 3UVIA 1ZY9A 2IKIA 3E3HA 3WFAA 2YZRA 1L8PA 1Q65A 2ZTKA 3ARZA 5C2GA 2F6XA 2ZA2A 3BICA 1OK4A 3W2JA 3DGRA 3NEVA 4M80A 3F7JA 1RPXA 1TR1A 4UB9A 5FKYA 1W5MA 4XUYA 3VTRA 1EB3A 4HHLA 2P10A 1O68A 1HW6A 1EO7A 3NZRA 1ZAIA 1NVMA 3LCLA 2OFJA 4FIQA 4D2JA 4FNPA 4D6JA 1XWYA 1C3FA 2C8NA 3OZPA 4YTRA 1KRBC 1TREA 3S46A 4J3UA 4HHMA 4Y7EA 4J2PA 4JTJA 3WMCA 3UJFA 3D6NA 3RX4A 5AFDA 2V68A 4LS1A 5LA0A 3AO0A 1Q6OA 1IXPA 4IXXA 1E1CB 4I9TA 4WXYA 1U33A 3EF6A 3S5OA 3O0KA 3AMGA 1YBQA 2Z1BA 3QSTA 1EYWA 5J8LA 1LLWA 1D3HA 1PKLA 2DSZA 5C2XA 2Y5SA 3BLPX 1BWKA 2QJJA 5HQEA 5GPRA 3PM6A 3VGHA 2D69A 3F4WA 1IIHA 2V6OA 5C9WA 4C90A 1DV7A 4E3VA 1DVJA 5T8GA 3K4AA 4RE3A 3OBAA 4KPRA 4IMDA 4O1CA 4GIRA 5A2AA 3SCNA 4ROPA 1MUMA 2HV5A 3I4EA 1F6KA 3TP4A 4GI6A 5I09A 3WJWA 3URQA 3S6TA 2BSLA 3VIOA 4PGLA 2XH2A 1LCOA 1YQZA 3U2ZA 7PTDA 4CU6A 3MB9A 1UR8A 2JKAA 4QGCA 1PCWA 3AHVA 4JNYA 1TPDA 1AQMA 1Z89A 4UR8A 4MIMA 4F0KA 3HV8A 2Z2UA 2OKTA 5FSEC 3FEQA 3LCFA 1N5WC 1BXNA 3MT1A 3GIPA 1DJWA 2XZ9A 3NUKA 3W37A 4HOWA 3WQOA 3KHDA 3QTPA 3WUBA 3Q2DA 2HSAA 4PBGA 3MP5A 4YU1A 4ZQRA 3MSDA 3IV3A 1SMAA 3MSYA 2WMKA 3B8WA 1H2IA 2CLKA 1K7XA 3S1GA 1WAUA 4BURA 2V2CA 4F2TA 4GVIA 2PWEA 1W5PA 4IXHA 1OIFA 3UPBA 5M03A 1KTCA 3CMJA 1RJPA 1RD6A 2H8XA 4IP7A 3I6EA 3PUOA 1Q4NX 2W61A 1GYLA 1W8SA 4CLMA 3D3AA 4H4SA 1REQA 1QNQA 5JUVA 1IT8A 1FCVA 4JIQA 4B4FA 2Y89A 3TR2A 3UY8A 1BVNP 1W37A 3TC6A 4FNUA 4KFOA 1B4KA 4GD0A 3BK0A 6TAAA 3TTSA 1DHKA 1MFVA 2OO6A 3PZMA 2QV5A 3NGJA 5L6UA 5XINA 1CYGA 1G6CA 2DZPA 1MEWA 1G69A 3QLDA 2HXTA 4JCMA 5A6SA 1KV8A 4Z2JA 1TTPA 1O5RA 1UKPA 3UCDA 1UKOA 1E4MM 4C5YA 4HIBA 4MHBA 1VFLA 5DBUA 2G8ZA 2CETA 4E8DA 4Q4MA 4Q32A 4ZOHB 1XYLA 2C1GA 3W25A 5CEWA 3WK2A 1GKPA 3UY7A 4EACA 5A8MA 2TSYA 1JNDA 3W1LA 1TPC1 1GZ1A 1X6UA 3P2VA 4O0QA 4NX5A 2O56A 2XSBA 1WXZA 3N12A 1TSIA 2G96A 2DUZA 3AJXA 1W1PA 1U83A 4JXCA 3KDOA 1QI2A 3M5ZA 5AVHA 2DEPA 2VGIA 3NZGA 3GUWA 3FW6A 4ZFMA 3N6HA 4HJWA 3F2CA 3QV8A 4HZ8A 3GDBA 3NVYB 2JQXA 2POTA 4P7LA 5I77A 3COTA 4I7UA 5E6YA 1DJGA 3KOZA 4HZ7A 3LCXA 4G6CA 4ADSA 3TYAA 2GPTA 2PDCA 1ZRQA 5FD0A 1XLLA 1TJPA 4PB5A 3G77A 2YDAA 2PU1A 3CMFA 1CBGA 3OW1A 4ACZB 3PK7A 5DBTA 6PTDA 4LVGA 1GW1A 1FWWA 2CLEA 2PU0A 2NXHA 4GYPA 4O15A 4DJFA 1FXQA 1XLMA 2OO0A 1DJYA 2X8RA 3RJYA 2YOCA 3OODA 1K03A 4R3UA 3S6OA 1XHGA 2C3CA 4O57A 1RR2A 4MYXA 4QITA 2ZUMA 3L2MA 1K4HA 5LA2A 2DSVA 3DENA 1VIZA 3IEBA 3V1HA 2VUYA 1R30A 1BWLA 1C8XA 5DT7A 5MF5A 4IIGA 2GWGA 2VCBA 2WZIA 2O7SA 4DWSD 4LC8A 3T09A 3KTXA 1C8YA 2V5DA 3VKDA 2BV9A 2CHNA 2A5HA 2VFDA 4N9EA 3RMJA 4A8NA 3WLPA 3KFTA 3SQLA 5JMUA 2WB5A 3WNOA 3QZEA 1BEUA 3KBSA 3W53A 5A8NA 1F3XA 3SJNA 5LNRA 4I7WA 3VM5A 3MMTA 1TV5A 4IPJA 2YYUA 4O54A 5G5IA 3EOLA 3FYOA 3UJRA 3STFA 5JIWA 2VZVA 3VM7A 1EC9A 2Q01A 1O1ZA 1GQIA 1DJXA 3WQEA 4RJEA 1BYCA 4XAZA 4K37A 1UA7A 3AYTA 3A7UA 4H7ZA 1US2A 1NDVA 1HJVA 4OVXA 4NSBA 2PDMA 2VZSA 3NYZA 4OWGA 3CLMA 4P7OA 1YYAA 3MWCA 4HD5A 3ZVHB 1X38A 1K1DA 3HM7A 2BMBA 1JQXA 4GY7A 4I5XA 2YXGA 2F5ZA 2GSHA 4FEZA 3W88A 4E3TA 3URAA 2DIEA 2VJXA 1X2GA 1GG0A 2NX3A 3THCA 1WB0A 3R10A 1ISWA 4OBRA 2WO5A 3ATZA 1D3GA 3GH4A 4LTSA 4GVGA 3STGA 2CFYA 2VEFA 1V4YA 3LA4A 2X0YA 4JOMA 2J66A 3THQA 3GC2A 4ZR8A 2QCDA 3VDBA 3UJEA 3ZVIA 1TTJA 1CZ1A 5BXPA 4I7VA 5G4HC 2NV1A 1ME9A 2VM8A 4H6EA 1GTEA 5JH1A 2I17A 2QJHA 4EE9A 2HPIA 2R14A 1TELA 3R4IA 1JRPA 4J27A 2X1RA 4AZ6A 3A3HA 4JKLA 9XIAA 4OE7A 2D23A 3CGEA 4B2DD 4H9VA 2WZTA 1M68A 3R13A 1EEPA 3AISA 1A3XA 2Y8UA 4IQLA 2GWNA 3IPWA 1ICQA 4DAIA 1N62C 4GINA 1BG9A 3WJZA 4POCA 1WPCA 4U3CA 4UTLA 4DVOA 2VEMA 1C8VA 3WDIA 5FEWA 3CUHA 5E6ZA 2WBKA 2G4JA 1EYEA 3WKZA 4XVEA 5HXMA 3WIJA 1R5YA 2DVTA 3UXAA 3GNDA 4LVAA 3RCNA 1OB0A 4HMCA 2VZOA 4PCSA 1F8WA 4QE4A 2R6OA 1J0YA 4RCXA 1D7FA 3F4VA 4XSLA 2HJPA 1KC7A 1NF7A 4CQCA 3AXIA 4DNMA 2OT0A 2VC9A 2Q8ZA 1AG1O 4MKVA 1HL8A 4EMWA 1A5SA 1H7XA 4UOQA 1W17A 2EJAA 4GKLA 2YDQA 1XV8A 2VNCA 1XUUA 4N7QA 1L8NA 1STZA 4IJBA 3LCHA 4Z42C 4NF7A 1JZ4A 2FQIA 3FX4A 4UTMA 1JZ2A 3A3WA 4YL2A 1QNSA 3VNKA 2YLLA 3R6IA 1OGSA 4GMEA 2GJRA 3BAXA 3UG3A 1LG2A 1QFEA 1Q6RA 4CVUA 2ZVRA 2Q02A 2O4MA 3PNZA 2AL1A 2J8TA 3DJGX 5C70A 3KDNA 2ZWZA 2BVTA 1OCNA 3IANA 3RU6A 2GQ8A 2BC1A 1MOKA 2WM0A 2HE5A 1W31A 3RLGA 4CCZA 1XH2A 1E5JA 4EANA 1WZMA 3TQ0A 1Q7QA 3B9NA 3B8DA 1Z48A 3OTRA 1UIPA 3IUIA 1EWDA 2YPIA 3AHYA 3TLQA 2J79A 5HMDA 3MY9A 5I3KA 3VIIA 3ARRA 4QM1A 4TTGA 5A8QA 3PF3A 4DJEC 4HTYA 4W89A 1VBJA 3NCOA 3R8RA 1GVRA 2ZX5A 1GVIA 1N5XA 2E5DA 1ZKQA 4BQ5A 2PLKA 2GSEA 1K70A 4S23A 1BVZA 3EKLA 3C8FA 3UESA 1T6MA 4H4ZA 1KCKA 3UXDA 4HU4A 5PTDA 2AL2A 4HQVA 3L4ZA 3M5XA 3VX1A 3IC9A 2BG5A 2WCAA 3WBXA 4AXNA 5HJLA 4AYSA 3B0VC 3KCOA 5C5YA 1FTXA 2ATSA 1X8FA 3M41A 1GW9A 3BQ5A 1RA0A 2PLCA 2HE8A 2ZC1A 3I7SA 4HU3A 1FQ0A 4ICCX 1PDYA 2PWUA 3CT7A 1V02A 4XK2A 1W2PA 3LY0A 4LALA 1TWIA 4PUJA 2NSXA 3LHYA 4PL2A 5FOOA 2XISA 4L7ZA 1POKA 1IIGA 2VO5A 5D9OA 3CUXA 3PZQA 4N42A 5JCKA 3PJXA 1MXDA 1QPQA 1OINA 4PR4A 2WVVB 4AF0B 4XD6A 5FI8A 4KCUA 3V7PA 5EFFA 3UG4A 3B8TA 2QUUA 2CESA 3GC5A 1U5VA 1EP2A 3B0YA 2FDMA 2DIJA 3IGUA 3ZMRA 2GJLA 1P1MA 4S2CA 4GXPA 2W0UA 1EUNA 1XCFA 2DZBA 3PG6A 2A0NA 3VFLA 3E2RA 1XG3A 4JQ2A 1CX9A 4O50A 4L1WA 3MJYA 1QAPA 1FWAC 4QSFA 3VUPA 3UXLA 2PDNA 1ZCCA 4L9YA 4BQ2A 1UH4A 4M7SA 4QQUA 5M2FX 1OFEA 1PIFA 3IJ8A 3HQ1A 1W0MA 2X41A 3ZSSA 4HZMA 3T1GA 4C6KA 1N8WA 4AZHA 1H7NA 1QO2A 3IAPA 4ZEPA 3BDKA 2QULA 3TSBA 1ICPA 3BC9A 4HMDA 2VX7A 4WJEA 4IG2A 1W91A 3DAQA 1QHOA 3I65A 5C7VA 1IXNA 4LUTB 1UD2A 2PPGA 5FF7A 1XRTA 1OABA 2WC4A 4YS1A 2Z24A 4EOUA 4TX9A 3RO6A 4S3GA 1FKWA 4YCOA 1Z42A 2WQDA 1JCMP 3TE9A 1T3QC 3AUJA 3RU8X 1X6NA 5D2XA 3EYPA 4AMAA 1ITXA 1ODZA 1ZJHA 4LB3A 4AEOA 2GSJA 3VCCA 3VA8A 3BL3A 1UP3A 3LZ3A 1V6TA 2ZZ5A 3THAA 5BXRA 1HIZA 1KCLA 2FPVA 4GWEA 1PV8A 1SR0A 2NQLA 4ATWA 1CLKA 3WY1A 1VRDA 3C2VA 5AKQA 3CLWA 1GOMA 1PS9A 1VJIA 4Y90A 1P4CA 1IGSA 3NQCA 3IV8A 4B5TA 3UR8A 3EPNA 3CT2A 5J04A 1RLCL 2I14A 1NFBA 1DWGM 3EB4A 1ZCOA 3BJTA 2JGQA 4GCXA 3VXGA 4IIDA 2HZGA 1GT8A 5EA9A 1LLOA 1KXHA 3QKEA 2NVDA 1TJ2A 3ZYZA 3LRMA 2E1DA 3G0SA 3EA2A 5TAOA 3MWAA 2PB1A 3UYIA 1WA3A 4A05A 3NZQA 3CO4A 2G3NA 3C86A 4EAMA 4KBXA 3VIPA 3L2IA 3AFBA 4NNCA 1I2OA 1K77A 3RM9A 3LV5A 3D47A 3HZ3A 3IRSA 1FP8A 3SEPA 1TRIA 1U1HA 3B4UA 1JYVA 2QGYA 2BY1A 3STEA 2WP6A 2CWXA 3EWDA 4C6JA 3WCZA 2FHFA 5BU6A 4HA3A 3PUDA 1D8CA 3RR4A 3H7RA 1PX3A 5FF0A 3VMOA 3QFEA 4LOCA 3WLIA 2CHOA 3NJ3A 1H5VA 3HPXA 3M0JA 4PRTA 4D6IA 3N73A 3TNOA 3PFRA 1GGOA 2YAUA 4NG3A 1ZLPA 3WLRA 5HR6A 4DI8A 4HZ6A 5LHEA 3NZ1A 4BEUA 4I5UA 4RPQA 1UROA 5TNVA 3MHUA 1S7MA 1CENA 5CPTA 3C8NA 4WDUA 1PIIA 1F7BA 1Q6EA 1XBYA 2EKGA 1GVQA 3QN3A 1THFD 1E9ZB 2QVNA 2Y5EA 1O66A 3E2VA 5HQMA 1ICSA 2VUNA 3MA8A 3R0DA 4IGSA 5C9XA 4HU8A 2OR2A 3BTNA 2GH5A 5AZ0A 3MV11 5IFPA 4TO8A 3W7DA 1V8EA 2FGBA 3GO2A 4LYKA 4QG9A 1V7YA 3MHGA 4H9MA 3W2UA 1G9HA 2E6DA 1KW1A 2F38A 2C16A 5E1QA 1R2SA 1UWQA 1VIWA 1Q6CA 3DFYA 4PULA 2WOWA 3CUFA 3EX1A 3LCWA 4MNLA 3IGSA 4JIIX 2BC0A 4AIOA 3P8JA 4ONVA 3R43A 2J9XA 3E9AA 2QZRA 1M65A 4DHGA 1I1WA 1PHQA 3BAWA 2NSOA 2NV9A 1B9ZA 3RLHA 1QOPA 3UGRA 1TIMA 1H7PA 4GIEA 4L64A 3URHA 1E3ZA 1X1NA 4GQQA 1XG4A 4Q4OA 2O7QA 3LTYA 4M3PA 4DF1A 2X0SA 2TPRA 1KFKA 3KP1A 5KITA 2J7HA 3C61A 2DZSA 6TIMA 1LPFA 1R0MA 1SGJA 1XANA 4WSKA 2OSWA 1BYDA 1OG6A 5G1YA 1Q6QA 3EB3A 3TZFA 3BAKA 3P67A 2CBUA 1BRLA 3W1TA 1VKFA 1W9PA 5HPOA 3WEOA 3II4A 1H2JA 1M01A 4KGJA 4GC3A 1V6UA 3QW3A 1ZBKA 2I57A 4CEUC 5H8MA 3VU2A 1XQLA 3MJMA 3TTYA 1UUQA 3T4CA 3M64A 5ER0A 3MKCA 3MI6A 1I60A 4A8LA 1Q45A 3FCPA 4AB4A 5I79A 3RCMA 1DJHA 1WKYA 3N2BA 4KWVA 1KR0A 3O06A 3SBFA 5HQLA 2ZDSA 4B15A 5FA5A 3TQPA 4AH7A 3S1WA 2E9MA 1GRFA 1TO3A 5HK4A 3OZOA 3VOJA 4WOQA 3PPHA 2R9RA 1W3NA 1E0WA 2HS6A 4OGZA 1XCWA 4GYFA 2GK1B 1ELSA 3L5MA 4CGTA 7REQB 1GWJA 3GH5A 4US6A 3EWUA 1SR9A 4QNWA 3LB0A 2VC5A 1E70M 3G6MA 3T55A 2B81A 1ZAHA 4Y96A 2VQUA 1FUYA 1Q1WA 4J7RA 2BOFX 3LXCA 3GD3A 4M0XA 3B0PA 4LCRA 3H4XA 3SGZA 3L5AA 4J3XA 2TYSA 1BKHA 3OZMA 1ZENA 3ANYA 2HXUA 2XVKA 1XYMA 4NZ3A 1OD8A 3EUB3 4BZYA 4UTIA 2X2GA 2HK1A 1E4NA 1GVOA 3H2NA 3L67A 4U4MA 2D3NA 1R87A 3DFOA 3CMGA 4I6VA 1QNVA 1XRFA 2GVEA 2CWNA 3GDMA 1XFBA 3EZ4A 5U1OA 4ZVJA 1FWFC 1YE4A 1JOAA 3W6YA 3BZJA 3RNMA 2X8GA 4MWAD 2EPLX 3GUGA 5FL0A 3G1FA 3LHTA 1P1XA 4PODA 3TAKA 1HJWA 4H9YA 2PC8A 5GJPA 1FWTA 3L66A 2EXOA 1NP2A 4WF7A 2QS8A 3H2FA 3PAOA 1S38A 2OLAA 1QDSA 2A3HA 2WLZA 3TC7A 3UR5A 3BSMA 4HA0A 1UWAA 4AD2A 3AS3A 2J7EA 3N4EA 5FF3A 2V3EA 3ARVA 3UPWA 2ZRXA 1UUOA 3UZ5A 1OVDA 1YXYA 2RJHA 4MB4A 1ZFJA 1GREA 1SW0A 1RV8A 3FOKA 3PHAA 1NWSA 4DJEA 5TQLA 2CZEA 5ENLA 1OX4A 5FACA 1Q7MA 4QROA 2XGBA 2FDSA 1A80A 3TX9A 1KBBA 5D02A 3BCFA 3CBWA 3LCGA 3UJ2A 3TW7A 4LAUA 3B9OA 2VZUA 2OYKA 1QMLA 1MUCA 5EBUA 1FBAA 4A2RA 3TYEA 2ZICA 5GJMA 3WJSA 2O55A 2PWFA 1EF3A 4O53A 3E02A 4D1JA 1RJQA 4MNJA 3HN3A 4LYPA 4NJJA 2PA6A 3TSDA 4AZCB 3L5LA 1K9FA 2DSKA 2P3EA 1TQXA 3GDLA 5GVJA 3II1A 1HL2A 2C0HA 4TIMA 4D8ZA 4R9XA 5D32A 1RCOB 3W1NA 3WK3A 2QGHA 1MEIA 3DYMA 2F2HA 1V5XA 3VKJA 1H7WA 1W32A 4MY1A 2GGHA 3KRUA 3W3OA 3W23A 4DF2A 3FSUA 3H70A 4QAIA 3S2NA 1AK5A 1J0KA 1A4LA 2V0TA 3EB2A 3LMZA 2UY4A 4A3YA 1O5QA 2IKGA 2W79A 4GZEA 1EH9A 2XVGA 4US5A 3N13A 5AHNA 4WKHA 5HMFA 1W54A 3AXHA 4YWOA 3VOFA 2V3DA 2AKMA 3NGFA 4JAWA 1DTNA 2E09A 3H24A 3TVAA 3WQ6A 3SSJA 4W5ZA 1M03A 4L9XA 1YE6A 4JHOA 3FIGA 1GESA 2VR5A 3LHUA 4Y9AA 1CXKA 3PPGA 4MLRA 4NNAA 5ABHA 3N15A 2XM2A 2C13A 3EX2A 4C6PA 1A3WA 1SPQA 5K9CA 1GKQA 2VFHA 3OLIA 4CQAA 1NU5A 4AWTA 3U2EA 4OECA 1DE5A 2V5CA 1VEOA 1VENA 1JGMA 2VDIA 2W63A 3LTPA 5LIYX 5G4EA 5KINA 3B8SA 2PDUA 3PC0A 3ZWSA 3SCSA 2R1PA 2PSNA 3O0FA 1IZJA 1LL6A 3G0UA 4IPLA 1Q66A 4OHQA 1WOAA 3TONA 3P7YA 4I8DA 4YVXA 1TYPA 4O8AA 3WNKA 3WH7A 2I7GA 1AD1A 5CSYA 1GPFA 4NAEA 1JIBA 1OFRA 4I9MA 2PWHA 4NILA 4OFCA 1KM3A 1LZOA 2DPEA 5JBEA 4CD7A 1U1JA 2HNEA 2D22A 4S3BA 2HK0A 1AJZA 4LPCA 3ANVA 3GTIA 3JVAA 4JTAA 2ZZ1A 1QTWA 5JCIA 1FHVA 4PYSA 3DFTA 3FLUA 2VHLA 4UTWC 3AWNA 3CQJA 5AYXA 4AYGA 3U48A 4DAFA 3EX4A 3OVRA 2J27A 1W3TA 4QBXA 3GTHA 1SUXA 1XLGA 4LY4A 1W1YA 2QHAA 5FS9A 1PTDA 4PMXA 1QBAA 4R7JA 4Z08A 2FMOA 3W82A 1M1BA 3N1AA 3H4WA 2YVGA 3H2AA 2ZE0A 1VBGA 2EPOA 1S5WA 3ZLGA 4FO4A 4EKJA 3GTXA 2ZZ6A 4RW5A 1GUVA 4NJKA 4NAFB 4D8AA 1J10A 1E1CA 2WPGA 1R46A 1GVFA 5D9MA 1NJJA 2ACSA 2FFIA 1OZQA 2CBJA 4Z0JA 4AZGA 2WQPA 2I5GA 3PWGA 1TTQA 4BI5A 3EX6A 3CPRA 2OZTA 4H4RA 3L21A 2XN0A 4QQ3A 3IUDA 5LKYA 1GEUA 4FX7A 4JQ9A 1JROA 4MWAE 2OX1A 2PBOA 2D1ZA 5G1TA 1XS2A 4UUIA 4BKNA 2ZBTA 3SCWA 1QW8A 1ZBCA 5DMLA 2RDWA 4LBUA 1EJSC 1SO5A 4PUWA 4RNIA 2HROA 2VGFA 4C6EA 2WMGA 4FALA 6XIAA 1HX0A 2PGFA 3G3MA 2YKKA 3M43A 1SZGA 1JCYA 3R94A 6CGTA 3VZZA 4HGXA 1TYTA 9XIMA 1VBRA 2IW0A 4NZ1A 5IXEA 3CQHA 2GYIA 3TN3A 4EF9A 4DF0A 2OMAA 2BHZA 4G7EA 4Q6XA 3AZRA 2VEIA 2CC0A 3CZJA 3USZA 1XDMA 2OWXA 3HPFA 1VS1A 3UWEA 2F9RA 3MC5A 3S42A 1EXPA 3SUTA 4QEEA 1JXKA 4QJ4B 1K3UA 4RE0A 4GO8A 1U22A 4J2MA 1MEHA 1Z7AA 1HTIA 1BGGA 3DBPA 4RPPA 2WVUA 4LUSA 4X63A 4BWLC 1VLIA 4B3KA 3RK8A 1H6VA 2A3CA 3NQ2A 3TW9A 4GUFA 4UR9A 3GH7A 1GOKA 2QDGA 1ME8A 4DJDD 2WMJA 2F6KA 2V3AA 3KAOA 1F5ZA 3OU8A 3KEHA 5L9FA 4BCEA 1D8WA 4YJ5A 3L7RA 4H19A 4JTQA 3RPMA 3O7UA 3VGDA 1JD7A 2B7PA 3PB2A 3WQCA 1DIOA 4LY8A 5HJYA 2VOMA 1BWCA 1ONXA 4MY8A 1QASA 1EBDA 3WF2A 3K8KA 4H4UA 4Z2LA 5DRCA 4DPQA 1VZWA 3OEXA 3P6LA 2A7RA 2XSAA 2Q8LA 3C0LA 3PWIA 2GGJA 3WDRA 1QI5A 3GFZA 4B5VA 4O13A 1TB3A 5DRIA 4R7OA 3KE0A 4KWUA 3DCPA 5EU9A 3U4AA 2V82A 1JDFA 1G1YA 3NQBA 3F4CA 3STCA 2GR1A 3LENA 1RAKA 3VOIA 3A4XA 2XU2A 4W5UA 1GJPA 3S5ZA 3WF1A 4XKYA 3TJXA 2WNQA 3VIFA 3NR0A 1RALA 1HKMA 1R47A 4QJ5B 1P0DA 1J0ZA 3VIHA 1NQ6A 4GCAA 2O9OA 1FH7A 4PMJA 3POHA 1KB3A 4A3UA 2Z7KA 3RILA 2ACUA 1XLBA 2FTWA 3DERA 3DI1A 4ZQCA 2WSRA 1B3WA 1TPWA 4FS9A 4IT1A 4IIHA 1YNPA 2XUCA 1RBOB 4IX2A 5DO8A 3QY6A 1CGYA 2GQ3A 1A5AA 1KFEA 2VENA 1XIEA 3BCDA 7CGTA 1BF2A 1X8CA 1R6WA 4MADA 4ZQMA 2EEXA 4HNVA 3PFMA 2VELA 1CLXA 1HGWA 1GQLA 3CTTA 4H8HA 3HB9A 5CBBA 1B1YA 1QK2A 2BLEA 3WQ8A 2I5IA 3BZGA 3SRKA 4TX6A 2C6QA 4JY8A 5FJIA 3R89A 4IZGA 3EMQA 3RGTA 4GX8A 3VGEA 3W72A 5M3WA 5FF2A 3VYLA 1UG6A 3RO8A 1X96A 3VIMA 1B9BA 2VX5A 5CJNA 6XIMA 4RK8A 1JNEA 4IQDA 3T7VA 1JF5A 1JL8A 3D3FA 2CLLA 1FWJC 3N4AA 2DJXA 3V0SA 4XIAA 2O9TA 1HXJA 3MBDA 4L1XA 1MW1A 1GZJA 4FZIA 5A3HA 2FMNA 3ZSTA 3GU9A 3K1GA 3QXBA 1H1ZA 1S2WA 2BVYA 1S39A 2WVSA 2QF7A 3QMRA 4FX6M 2X40A 1S3TC 2C3DA 1Z44A 2ACQA 3SFWA 4OQVA 2Z1WA 1PPIA 4BF7A 4MJMA 4PTNA 3VD3A 1KD0A 1X97A 2GUBA 3WLKX 3LUTA 1RA5A 4M81A 2QCCA 4EQSA 4H7VA 5E93A 2GVYA 3T9PA 3GW3A 1GRBA 3HV9A 3A22A 3S1XA 4H4TA 4WY0A 2FYMA 4WKFA 1ZJIA 2DZWA 3Q58A 3GXNA 1RPKA 5D9PA 3TA6A 1JZ5A 2YW4A 3U9IA 5CJ5A 3URNA 4JFWA 1S5TA 1UB3A 4ZOAA 1TRDA 3HFYA 2OXNA 4F79A 1TPVA 5EBKA 4OOZA 8CGTA 3TTEA 3FAXA 3V18A 2YB1A 3N6QA 4OV4A 2QMJA 3RR1A 1K4QA 5CPOA 4BK9A 1SJDA 2P0OA 4R34A 2W3RA 2GQ9A 5IBXC 3GDKA 1DTUA 2OLSA 2V69A 2OGYA 4M1BA 3GBEA 1P0KA 2FPYA 2BY0A 3QGVA 4UNKA 1H51A 1KM0A 4MAVA 3V75A 3RX2A 2FTPA 3DHUA 2XGZA 4FXJA 1WZAA 2QCDB 3BW2A 4C6OA 1TJRA 1V51A 1XPGA 4UFMA 1F4AA 1YW1A 3E0WA 4QFUA 2J6XA 2VURA 3KBVA 2DW7A 1V3LA 2Z6IA 4KWWA 1KGUA 4A22A 2PMQA 1XBVA 1C93A 2ASHA 3O6DA 4K36A 2GUUA 3F4NA 3LM7A 2X09A 3SRHA 1SM9A 4GABA 4W7UA 2WLYA 4IPPA 3VIKA 3CO8A 5BOOA 3QHOA 3WL0A 2J62A 5A6BD 1Q2SA 5FJPA 2Q3RA 2PTYA 3WH9A 2YBVA 1I6NA 3LQGA 1GOOA 1SO3A 1XIFA 4H4IA 2WW5A 2FB3A 3NSXA 4H41A 4K68A 4XUGA 5AHLA 3DFPA 4IWWA 4X3ZA 5HMEA 1ZXIC 1N8IA 3B9DA 5C9ZA 1H0GA 1V7AA 3NQAA 2BY2A 4FLRA 3WL1A 1FEBA 3XIMA 1ZALA 3VDAA 3TOYA 1JDDA 1E71M 4L6HA 1XP3A 2X7VA 3MCMA 1OCQA 1SJCA 1I2QA 2EPKX 3A47A 3PJTA 4TVCA 5CXPA 3L65A 3SCUA 5BWFA 5CC5A 3H23A 1PIGA 3S5SA 3CAKA 5A2BA 1ZPTA 3NVWB 2EQ9A 3N29A 4TUFA 2ZOXA 1I8JA 1K7EA 3W7EA 2BWGA 2PURA 2OSXA 2E8YA 2WHMA 1EOMA 1VH7A 1MYRA 4FR6A 2NVCA 3SQPA 1OC7A 5AC4A 1KQZA 5CCZA 4Q22A 4HPXA 2PTZA 2QYGA 3WBEA 2QJMA 1Y8BA 1AL7A 1A53A 2OVLA 3WNNA 2FZDA 4PB4A 2YVFA 5CZJA 1Y5WA 1UKTA 1OFPA 4UTWA 4N02A 4NL1A 3C0SA 3EPOA 4LC6A 1PWMA 2V63A 2QUVA 4UNLA 1XCXA 2BXZA 3CHVA 1SVDA 3PSVA 1PYFA 3B40A 4WUIA 5BROA 3ZJ8A 1Z3NA 3ID7A 3CGTA 1NWTA 3DKLA 5FIPA 3ZJ7A 1KGXA 4KWSA 1IWPA 1YQ2A 2I16A 3GFXA 4YHGA 1X98A 2CITA 3EXRA 3W01A 4ZBCA 5CG0A 3LMYA 4AVFA 1OFAA 4NX0A 4O1AA 3WQDA 1CEOA 3KOYA 2VD9A 4M6QA 3NQVA 4F4RA 3EAOA 4K7YA 4LUJA 1MDLA 3NOEA 4BY3A 4AEEA 3GD6A 2DZUA 4FB7A 2AL2B 5TD4A 3P0XA 4P8XA 2MNRA 1OY0A 2TMDA 3LSBA 3PZGA 1K8XA 2BDQA 2WMHA 3H4GA 2D2JA 1QI4A 3PAJA 4I9AA 4RZ4A 3EDKA 1ZMCA 4IUOA 1KM5A 2KX9A 1KM6A 5BOFA 3P81A 4W7WA 5A6TC 1PUDA 4CEXC 1Q6LA 3ZWTA 3OHIA 3QPZA 1MQRA 2VTFA 3ALFA 1JGIA 1Q6DA 1RQBA 2QF8A 4L6OA 1FFUC 3O6CA 4H9ZA 1XISA 3BOLA 5A6BA 1U1UA 4PL1A 1S5NA 2JF7A 3KRZA 4BF9A 2DT3A 2ADAA 3OBKA 4LS2A 2G95A 2X1SA 3CASA 3JRKA 1NY1A 4HNNA 1LLZA 3SQSA 2J13A 1RVKA 2OOGA 4APNA 5CPSA 1DEDA 2HVOA 2ZCGA 4ZE4A 2PC4A 4DYEA 1FO4A 4JYEA 3WBAA 4ZSUA 3O6YX 3CUZA 3L23A 3R25A 4QTGA 1KRMA 5DMYA 2VYOA 2J6VA 1PWLA 1R2TA 2ZRZA 4O14A 3DFHA 5AECA 1C9DA 1UMYA 2O4QA 3NAVA 5CPNA 1PXGA 4JFUA 4GNJA 2HQAA 1Z8AA 5HOSA 5AVNA 1EOKA 4L1GA 2UY3A 5U4NA 3FDGA 4Q6JA 3RN6A 5FJTA 4PMVA 4BWLA 3PBWA 2VDGA 1PHWA 4UMBA 4C1KA 1R7AA 2X1TA 4IG2B 3W2KA 1D7KA 1H1YA 5A94A 2PTXA 1SSDA 1OGBA 5F4SA 1T5AA 3L12A 3SIMA 3NSMA 4CN1A 4UWMA 1CI1A 3PZ9A 1EDQA 1I2PA 2NUXA 4NZCA 1US0A 1UKSA 4EQXA 1TV4A 1JAEA 3UF9A 2UWFA 2XFFA 1UW9A 4WDXA 1XD0A 3BGAA 3GQYA 3T07A 2QUNA 1EJXC 1ONFA 1VFSA 2YW3A 4K39A 3MZNA 1FH9A 4GKTA 3DXIA 1GJWA 4KERA 1XQKA 2D0GA 3GXPA 1CPUA 2GR0A 4RUBA 3AWOA 3ITTA 4QDWA 5C9RA 1Z9AA 3TOPA 3LRKA 5EY5A 4Z1CA 5TBOA 4XX6A 2HDJA 2Y85A 3UW6A 1QNPA 1QPNA 5CPMA 4PTMA 3RYSA 4ZOBA 3WF4A 2QR6A 1AH0A 8XIMA 2ZDRA 3KTSA 1AMYA 4RZ5A 1PZ2A 5K9DA 2PDQA 4A8IA 3P3BA 4F8XA 1PDZA 1MW0A 1NPXA 4FX8A 4ZO8A 2Q8XA 4Y9PA 3G8EA 1JI2A 1HF6A 2PWDA 3OG2A 5JIPA 3WBYA 4R53A 4FOUA 5I6SA 4L61A 4XQ6A 2PDHA 4JFSA 1Y7VA 4YTSA 4O17A 1LG1A 3FVMA 1LWJA 3W2MA 1TUXA 3QVQA 4YXGA 4AD0A 2ABAA 2WNNA 4KEVA 1GPWA 4WK9A 3S0CA 3LPFA 4LVDA 4PMZA 2NWRA 2BCPA 2PF0A 4WR3A 3FA3A 3W29A 4XZMX 1RM6B 4UQEA 5BCAA 2INFA 2OYMA 4QIUA 4UTKA 5C54A 4HK5A 2CDUA 3GTNA 3B04A 4B90A 4PMUA 3DK8A 4DEFA 4M82A 3MANA 1RSCA 1JZ8A 3HTWA 1B3YA 2J75A 4GBUA 2PDYA 3SCVA 1NELA 4AAJA 1ISZA 1J5SA 4F9DA 4F2BA 3VI2A 1EIXA 3VD9A 1GVYA 4G56A 1BSIA 2Y7GA 3N3MA 1F8MA 4B3LA 1ADOA 2XIIA 5JVLA 6A3HA 1O7AA 3KLKA 3EWCA 3C5QA 4O16A 2YXOA 4DLFA 5D2TA 1YX1A 1W3JA 2BY3A 2ZUNA 3CGBA 3TH6A 1WAWA 1JYXA 3AIBA 3OGSA 4XZLX 1Q4WA 3CPUA 3P80A 2TODA 4GRSA 5LIUX 3S8HA 5H2ZA 3GNXA 1SQ7A 2Y24A 4OBSA 5C0QA 3MSRA 5GNXA 1VDVA 4HK6A 2OOFA 3DG6A 4JL2A 2RABA 1XLHA 3C0QA 3HMJG 3P61A 4JIRA 1CNVA 3OO2A 4Q8QA 2CCRA 2WXDM 3NVDA 2I1OA 3EGJA 5KVIA 4JD4A 5JU6A 3H2MA 2C14A 2V30A 1KRAC 3WQPA 3V36A 3FXGA 2ZUSA 4LH8A 3APGA 3Q94A 1OF6A 4CD4A 1J2WA 3T6CA 3R07C 2GL5A 2Z7GA 2B7OA 2ZZ7A 3CPGA 3IIPA 3ORWA 3PN8A 4WD0A 1KLYA 3QKZA 4XO6A 1GG1A 5HWNA 4U33A 3VKBA 3HQPA 4GI8A 5KZEA 1RBLA 3PJUA 4DPPA 3IRDA 3PZUA 4U28A 2XH0A 2JGYA 5IBXA 1MO0A 5CC6A 3WEZA 1NDZA 3L0NA 4A35A 4DUWA 1HFBA 3QR3A 1BRLB 3TA9A 4TVDA 4BR1A 3KCLA 3L9CA 1O5KA 2PDWA 4FI4A 3A9BA 3FA5A 3M0XA 2ZWYA 4RE2A 5DCEA 3T78A 2ZXAA 3VINA 1IEIA 3RG6A 5JQ9A 4Y6GA 4Y9OA 3ITCA 2YA0A 3HG4A 1GNXA 3WMLA 4E4FA 3N17A 3C4UA 4BF5A 5I3HA 1QU4A 2YBTA 1BLIA 3WNMA 3T0CA 4RL3A 5HWMA 1OF8A 2WHKA 1NOUA 5DF0A 1A49A 4CQBA 3LN3A 4KFPA 3SECA 3TWBA 4N4QA 2OLHA 3HG3A 2V2DA 2OKOA 3KRBA 1LUCA 4HMEA 3WYZA 1KCXA 3Q45A 1LL7A 1K4GA 3TTQA 3G0XA 5I0DA 1PX4A 2CXGA 3LV6A 1W9UA 1V59A 2VXNA 3W24A 1LM1A 1MO9A 5FJRA 3VNMA 3K4DA 2AMGA 1GRAA 2CYGA 1V3JA 3TYDA 5RUBA 4O8RA 1R3YA 3S83A 2FPTA 1TMQA 3SIZA 3LI1A 3V5CA 1GCYA 2WP5A 4ADWA 1QOXA 2G4FA 4PCFA 3CB3A 4OIFA 4OUEA 3NEHA 2QPSA 4IPIA 1VBHA 3ARSA 1VCVA 4QISA 4XD5A 4WDWA 2D2HA 4KT2A 5KVHA 2QCHA 1TX2A 1XBZA 5CSSA 4Q4RA 2J7BA 3QY7A 3VC6A 5MHBA 3T2QA 1UMLA 5A1AA 3DX5A 5BMWA 1LTDA 3A24A 4JICA 1OIMA 2GOUA 1XH0A 4K1GA 3M16A 4UR7A 3PTMA 3CIXA 1KRCC 1SZRA 5T9CE 2R1NA 2Y2WA 2XIBA 4K38A 1LRNA 2FLIA 2FB2A 3KOXA 2ZUTA 1UR4A 2HVMA 2PDKA 2ZTJA 1S2TA 1JAKA 4B5WA 5AYZA 1VF8A 3H7UA 4LF2A 5LNWA 3W7PA 2SFPA 3N9SA 1CT5A 1CTNA 1ENUA 2ACRA 1DWFM 2XN1A 2WPEA 4AG0A 4URIA 2X8HA 3V35A 2YIHA 3KVMA 4UTJA 1R9ZA 1EPVA 4ORIA 4FF5A 2OU4A 1HT6A 4KEMA 3REQA 2VFEA 3LERA 1E0TA 2GOKA 4DZAA 3OHMB 2CZVA 2LLEA 1FOBA 1UWUA 2WNZA 4F66A 1XLDA 3QSRA 3EWBX 1GRGA 4H9UA 5AN7A 2W62A 2YSWA 3F4DA 3LK6A 1N8FA 5EGRA 4X2RA 5B7YA 4TXEA 3KWXA 4QAWA 4JFTA 3R58A 1L6WA 1XRVA 3PR2A 3U57A 1NFPA 1W5QA 2FZ8A 4LEFA 2WJEA 3W7QA 1QI0A 4NJIA 1TPB1 4UQCA 4ROQA 1XFCA 1N55A 4CVWA 2G3IA 1UPMB 2P8CA 1OX6A 4MDOA 3GVRA 4AZCA 3GRTA 3G3DA 3U7VA 1N2VA 2DT1A 1OYCA 2G5WA 3G1HA 4ZODA 2YL8A 5BRPA 2J4GA 1JPHA 1UR0A 3R0KA 3BLEA 1YPXA 4Q4PA 3RNDA 4A3HA 3NQ6A 4NUWA 1BWVA 3TXVA 3UZXA 2DIKA 4JPGA 2D3LA 2E5AA 2GDQA 4QX4A 2NUYA 4HA4A 2JBMA 2NW0A 2XIOA 2A8XA 1HL9A 3SW6A 2VX4A 4P8VA 4HMNA 3IVTA 1MRAA 4MOZA 2PS2A 2R8WA 1QT1A 2OTDA 3L0KA 4UOZA 5TR3A 1MQPA 1E0XA 3AHZA 3BSHA 4ZXLA 3TCEA 2BOGX 1IEQA 2ODOA 1ZTVA 3E96A 1LROA 3NIYA 2OZ0A 3NO1A 2QCEA 3N6JA 3NOYA 1JCXA 3QYQA 4CNOA 1UWSA 1N63C 1BG4A 1VCGA 4HPJA 1VEMA 2XWEA 4L4PA 3LCIA 4PRRA 2BTMA 5HJXA 3A5FA 3SAZA 1AFSA 3GX9A 1A5CA 1W6TA 3T08A 3WLMA 4M6UA 2J7GA 5EL1A 4MG4A 2OG9A 3SO7A 2E0PA 3W9ZA 1H1NA 3V3WA 1D2KA 4ICNA 4DWSC 3AMCA 1XLAA 3CNYA 2GDVA 4F2UA 3OA3A 4A4AA 1QJWA 3N2MA 3JU2A 2C71A 4MB3A 5C7HA 3BV4A 4NAEB 4MDPA 1W3KA 1TZ7A 3ZZ1A 2JK2A 2ZUWA 3UZWA 4AZ5A 5KZ6A 2WHJA 1VR6A 3C52A 3URBA 4M6VA 3GD4A 1EEXA 5XIMA 4K7ZA 2QUMA 4NI3A 3H8AA 1B5TA 1V0MA 3CUJA 2X50A 5AZ1A 4A21A 1NM9A 2V6AA 4YYFA 3FFSA 4GXMA 4NQ1A 5E9XA 3VO0A 1X1ZA 4UTUA 1UP2A 3SY1A 1KM4A 1TX0A 3OBEA 1B54A 3IJIA 3W7CA 2BVDA 2BZNA 2RJGA 1S5VA 3KX6A 1IWAA 1H09A 3PG8A 4PUNA 3VZYA 3QV6A 2OWWA 3ZLHA 4M1RA 1V77A 4MM1A 3FJLA 1C29A 3I3DA 4W87A 1A5NC 2XVPA 3CV7A 3CYVA 4NAFA 8TIMA 1EA0A 3LHWA 2JALA 4G8TA 4AHPA 3PZOA 5K9XA 3T2PA 3LLFA 1RXOB 2YJQA 2PZ0A 4U3AA 4LFYA 3R0UA 1QHZA 4MB5A 4HTBA 5E09A 3OOQA 2G41A 4H6KA 3AS1A 3TKFA 2G0WA 1F6PA 3LBCA 3SSZA 3M6YA 1B3VA 3W7JA 4WSHA 1WDRA 4AD5A 4G5DA 3BVJA 4Q8TA 4DYKA 4MTVA 3M0HA 4U5KA 1XIJA 3KOFA 3WUFA 3DH7A 3W1MA 2E77A 5DN1A 3EBVA 2W3SA 4CU7A 4LGXA 2VD8A 1AODA 3WFZA 3W2NA 4IFOA 3TCSA 2YL9A 6ENLA 3VFCA 2W91A 2AAQA 4G7EB 4ZB5A 1F6YA 2VGGA 3DESA 4O10A 3W73A 1HNYA 1EA9C 3G1SA 2OEMA 1PSCA 3M44A 4WCJA 5HINA 4XZWA 1AZ1A 4GIYA 3SFKA 2ZXDA 3WQWA 3W1RA 4ZCWA 2PP3A 2B0MA 3SY5A 3S5NA 4EPEC 2G50A 2VT0A 2ZZCA 4X0VA 3R2GA 1XJBA 2VCAA 4XB3A 1OFQA 4B5NA 4ZO9A 5I5RA 2FJUB 3BJFA 5M1TA 1PE1A 4Q8PA 2B31A 1UP0A 3L4WA 4UTHA 4LUSB 2P53A 4RKAA 3E0FA 4KRTA 1TV7A 2BFGA 4AMCA 5DANA 4QLJA 3MI3A 4HCDA 1RK6A 1LWIA 4CQ9A 3VE9A 1V6XA 3TQKA 1K02A 4ZB0A 1YTDA 1XYFA 1PVNA 5K3VA 3UG8A 2QIIA 3BJSA 2Y4SA 4TR9A 3UCCA 3HMCA 1UR2A 2Z28A 1L6YA 2A7PA 3IGXA 1EBGA 4LANA 4CU8A 1DWHM 2YQUA 1BPLB 1WXJA 5IDIA 2QAFA 3IJ7A 2YCLA 2TPSA 1ZP4A 4W8AA 4LEQA 1KWKA 4AWUA 2NQZA 1DBTA 3MMWA 4X9SA 4Q8NA 1HO1A 3SCPA 3TYZA 2YVJA 1PEZA 5HWJA 3IACA 4GHRA 3GVVA 5CBJA 2V5BA 3OQEA 3W0KA 4UFJA 4MNKA 4XAFA 4AWSA 3SCTA 1J2BA 1IF2A 4C5ZA 5LNUA 3NL2A 1XL9A 3WLSA 2HBXA 5FF4A 1AQ0A 4DWDA 3HGJA 2AGKA 4XKYB 2F61A 1OADA 3GYEA 1CXFA 3D0CA 3EMZA 2Z29A 4OT7A 4PMNA 3V5OA 3HGOA 5EYWA 1A47A 1NH6A 3W81A 4C7DA 2POZA 1XLEA 3A4WA 4O4WA 3CGDA 3LXAA 4BQ4A 2CBIA 2C1IA 4AU0A 1ZSXA 5FESA 3PBMA 3FV9A 2ZRUA 3IK2A 1FRBA 3QFAA 1TWZA 2VWTA 1Q5MA 4K8GA 4B91A 3NVTA 3JUGA 3TMQA 4CD5A 3P93A 3VGFA 5CPLA 1EJVC 5J5RA 1VLWA 3YPIA 4LRSA 3HPAA 1UZHA 2NV2A 4E0CA 1K6WA 2QXWA 1DQXA 4N9DA 1TE6A 3SR6B 3LGEA 4KETA 5A95A 1V03A 1YRRA 1QPOA 1GORA 4H2CA 4GK8A 3EANA 4LIIA 3RMEA 4TVUA 4GACA 2R24A 3QH2A 1E6PA 1NFGA 2PCQA 2PP0A 2X16A 1IHIA 1WDDA 3ZQ9A 1G7VA 2A3EA 2QMKA 4JTFA 1XW8A 4EWJA 1JVNA 4N2YA 3W7HA 3B0UX 1UUMA 4KS0A 5ABGA 1ECEA 4Z1BA 1U5JA 5EMLA 4ZA0A 4AWEA 5EMUA 1RP9A 2VX6A 3GK0A 1QCWA 1EO5A 4LS0A 3TJ4A 4GY1A 5CSUA 3BAYA 9RUBA 3NRZB 2J88A 4E6MA 5KSWA 3O16A 2XIJA 2CBVA 5ECUA 2QKFA 4J40A 3STPA 1UOZA 2D73A 2WZEA 3ARUA 4M7TA 3FEMA 3GG8A 4WY0B 3CQKA 4Z2GA 1T96A 3GAYA 4DB7A 4JQ3A 4V33A 3OQ8A 3AYRA 4ERIA 3AALA 3R1ZA 3B9AA 5IHSA 2PGEA 1MZRA 2PTWA 1WBHA 5HUPA 1HJUA 1JEZA 3UNDA 3EDDA 1G7UA 3KOWA 4AQLA 1SO4A 4O28A 3EEGA 1JI1A 3M4HA 3O8AA 2HNHA 3CZGA 2H3DA 1PBGA 5AYIA 4MF4A 3MVTA 2Z2AA 1V0LA 1MRQA 1OC5A 5A8GA 2WSPA 1GYMA 1XIMA 1TMLA 4J3WA 2V5KA 3EWYA 3LDVA 4LNCA 1TJ1A 1FHLA 4XBKA 3I3BA 1QR7A 3NQDA 4W8LA 1H49A 3IVUA 1VPQA 4W86A 5FCZA 2E1WA 1UASA 3O15A 2REQA 1LP6A 4P8WA 3TZNA 3BV7A 3EOEA 1DJNA 1OG0A 4O0KA 3H54A 4AFYA 2RKXA 5ECVA 4JBRA 4XV0A 5JBFA 3LSCA 4CKQA 1BTMA 4PMOA 1W9XA 2Z4GA 4FNRA 3FJ6A 3H6OA 3P14A 2WK2A 3GRIA 2G3MA 2HS8A 1FXPA 2AQOA 1GHRA 3DUGA 4IMAA 2NWSA 4JY9A 3W85A 3WDQA 4DQWA 4AIBA 3FG2P 1B31A 1ITQA 4LSBA 1BVWA 1QPKA 1WKDA 3ECQA 5TIMA 1YDOA 1OD0A 4F0LA 2QDHA 1X7IA 1XYAA 4LU0A 4KH2A 1W1IE 1GV4A 3TC3A 1M7PA 2Z1VA 3KVKA 3H53A 5HR7A 2QV4A 3UA3A 2NLYA 2Z00A 5JCNA 1GVSA 2XHYA 3ITOA 3C6CA 1TPEA 3HW2A 4S38A 2VC7A 1CWYA 1J5TA 4QP0A 4MZ1A 1JPKA 2C15A 3L4VA 5CQ1A 3RITA 3AZTA 1ML1A 2OZ8A 4FNQA 4A3QA 1XGZA 1GZGA 5EB8A 4DWSA 1J79A 1HZYA 5LNVA 3B06A 1Q7ZA 4KQNA 5A8OA 3GXTA 5F2GA 2QJIA 3WQ5A 5I3FA 4RNHA 4JDYA 3GAKA 4CN4A 2EKCA 3HU7A 5A6JA 4PMQA 3AHTA 4C60A 1FWBC 3CEPA 3N4FA 4AVOA 5CSRA 1UR9A 3AMZA 1PKMA 3UD6A 3H55A 5DXXA 1V79A 1XRSA 2ZVIA 4D6GA 3N04A 3G1DA 2YBUA 1XICA 2A3BA 1CXLA 4R7WA 1VFFA 4D6EA 2W4XA 3AIEA 1CGTA 1MXSA 3PTDA 1NEYA 5DCBA 1XBXA 1QNOA 4TVWA 4L6DA 1ME7A 1IT0A 4RV8A 3P0WA 5G2WA 3W76A 3ZS4A 3PUGA 1XLIA 2VKZG 1ZUAX 4FAMA 1XUZA 1LF1A 1C7TA 4GUIA 4EPDC 4HBKA 3O63A 1XLCA 3NDZA 4XAYA 1Q6FA 2GQAA 2ZZBA 3QYSA 1EPXA 3BLFA 3ARXA 3W71A 3NL3A 5FEPA 4X61A 4DYJA 1TFVA 3KS6A 4LAKA 4MKNA 2A3AA 4QSHA 5KZMA 4WIWA 4I8YA 4O1DA 3EXTA 1AA1B 3ES7A 2GVJA 1A5BA 1GYNA 4PEEA 4HKPA 4HOZA 4LYRA 3BXWA 4PZVA 4TTUA 5GNYA 1Q2RA 3UWYA 4S3DA 1AL8A 1VPYA 2PLJA 1A5OC 4YN5A 3NDOA 1R7OA 5D37A 5HNRA 4IX0A 2WJFA 1VFOA 2OWCA 4B2DA 2EO7A 3ZT7A 1P48A 4JQ4A 5DCDA 5F2LA 3PJWA 1W5OA 4FHAA 1L6FA 2ZYFA 3HIJA 1WZKA 3NPWA 1J01A 3W07A 1JCTA 1GJUA 1JG9A 2I9UA 1ZBWA 2YX0A 1X7FA 3A9IA 3LEPA 3SQMA 2F6UA 4WJXA 4ZTYA 2IKHA 3CJPA 1BFNA 3ZIZA 1OYBA 3QFWA 3LD5A 2A6NA 3EKGA 2WC7A 3CZLA 3LNPA 4CQDA 2XWDA 4EMIA 1G94A 1WBJA 3KCJA 4AISA 2YB4A 4DI9A 1Q13A 3TR9A 1FFVC 2VR2A 4IFKA 3QHNA 1DJIA 4G9PA 4EQRA 5G5GB 4ZQPA 2DUAA 1WCGA 1HJQA 2WZHA 4A3RA 3MUIA 3UZZA 4B16A 3ABRA 5E5CA 2WKGA 4HNOA 4GQBA 2Y63A 4JS3A 3S9ZA 3ZOAA 1AH4A 4L80A 1CGXA 1V3KA 4DM2A 2ZE3A 1OHLA 3EOSA 3U3HA 3TJIA 4Y9MA 4WX2A 1Q8AA 1XYZA 2WC3A 3B8UA 1W5NA 3ETRB 1E55A 3KP0A 3OIXA 5A6KA 4WVXA 1FIQB 2VDHA 4KIEA 3PBYA 3F5KA 2IQTA 3ISIX 1S46A 1TCDA 3ARPA 4MWAC 3Q67A 3I7RA 4S3AA 4AD3A 2HPMA 1V0KA 2JKEA 1A5KC 2C79A 3WFLA 3PPFA 4NYUA 3OG3A 1K9EA 3GRSA 2NXIA 4QHRA 3TQVA 5K4ZA 4UFLA 3E0LA 2P76A 4Q4KA 3T0TA 3PTQA 3FK4A 1ALDA 5FEZA 2Y8VA 5GJNA 2PLMA 4EXQA 2AGTA 1ZB5A 3EA1A 2DU2A 1ZMDA 2GQWA 3W84A 3OPSA 4H4VA 3C3NA 3P84A 4HPHA 1A0DA 2A6LA 2O9RA 4NU7A 5C71A 4CUCA 5LXXA 2XFRA 3KUMA 3F5LA 4DUXA 3GKFA 4C6IA 2J7DA 3ABXA 1MSSA 4JIEA 4F0MA 2OPJA 3DFSA 3H21A 3IJDA 4C6NA 4D6DA 1YLVA 1M5WA 3VDGA 4NKCA 3W7RA 1J96A 1JUBA 5D05A 1G4EA 4WGXA 1DJZA 5M5DA 3ICJA 1RCXB 1GSNA 2VR4A 1GOXA 4XTIA 2GUYA 2VGBA 2VEPA 1Y0EA 2P1FA 3TWAA 1FWCC 3AIVA 3BURA 3FXYA 4IMGA 2F2KA 2A1YA 1I4NA 3B9EA 4NYYA 5FJJA 1W3LA 1E6RA 1LORA 4JN7A 4QS6A 3GBDA 4MKSA 2WZMA 7XIMA 3K13A 3MKVA 3WLJA 4WLCA 4GI9A 1BTCA 3CUIA 1HUVA 3TFXA 2Z1SA 5KEZA 2J24A 3RIKA 1LDCA 3VNJA 1T7LA 5EMJA 4MMWA 2GJXA 3HQOA 2XN2A 2VEGA 1EHAA 2HBVA 4QEHA 2DP3A 2PODA 1UD3A 2PE4A 2DVUA 3FJNA 4QG8A 5I24A 1XR2A 2IPWA 2ZA3A 4M56A 4JTUA 2ANUA 5XIAA 2IQDA 4H4YA 3ARWA 3WNPA 1VGAA 1W56A 3EDJA 3O1NA 1E6QM 2OJPA 3UG5A 3MO7A 2Y8KA 3BGJA 4GQGA 1I1XA 1W3IA 5CZTA 1A50A 4L9ZA 3NQ8A 4ML9A 4R85A 3O05A 5GQBA 4TOQA 5CZ0A 4OJYA 4GLEA 4H00A 2X42A 4JEQA 2W66A 3DHPA 4R9OA 5AC8A 3AXXA 2A7NA 2ZC8A 1V3MA 1JZ3A 4C7GA 5HDRA 3EWXA 1GQJA 2W67A 3FYPA 4AX7A 1GXFA 4GRTA 2NQ9A 4B92A 1ISVA 4B5UA 3RLVA 1E5NA 4O1BA 3OA5A 3VX0A 2Y70A 4GVHA 1EGMA 1X2HA 4OZOA 3NM1A 4KCVA 4GUGA 2QEZA 3XINA 3M9YA 4MFDA 3BAIA 1E9LA 4FLQA 2E6FA 5LA1A 4C65A 2ZXBA 1G01A 2VL4A 3T40A 1JCJA 3KHJA 4IGHA 1CXIA 1PTGA 1UC4A 3BG3A 3NZPA 1J11A 4LT9A 1CXEA 2E3ZA 2JIEA 4GH3A 1YTEA 5AC5A 4NJGA 3RCYA 1UZ4A 3A4JA 2J7CA 3NQGA 1XSJA 3AU2A 5C8BB 1EX5A 4H7CA 3B05A 5U25A 1GKRA 1ZP3A 3UEQA 4JTEA 3LXDA 5CZSA 2ZZ2A 1NDYA 3TYUA 1BQCA 2OZ3A 3GVGA 3AICA 1B30A 4YVPA 3ARQA 4PN2A 2OX4A 4NXKA 1GHSA 1DWIM 3MYPA 4XG1A 4H8NA 3NQMA 2ZFAA 1VQTA 3MUAA 2J9ZA 1K8ZA 5ABFA 3C2EA 5JCLA 1ZQ5A 5G4WA 4AY8A 2EQDA 3T8LA 4PB3A 4XAGA 1OFDA 4ALDA 2ZRVA 3FDKA 4LBSA 1MUWA 1AW1A 1M04A 1F3TA 1Z6KA 3KL3A 4H3DA 1EJTC 1KFLA 4XWUA 5MKGA 5EMYA 4ADUA 5T26A 1LUCB 2R1MA 4JTSA 2Z6JA 3N25A 2OQHA 2IXUA 1O6IA 3R8GA 1H4PA 5ABEA 5KZDA 3QBUA 4E8CA 3AIQA 3WENA 1NP0A 5I3GA 3THUA 3EDFA 2Z27A 5D9NA 4M19A 4DZHA 4AY1A 3NO5A 1YHTA 1DXFA 1WDSA 1SZNA 2DZTA 5CAKA 2CLIA 4GZ7A 2XM1A 5FS6A 1TPH1 1V08A 2OCZA 3ONBA 1ZX9A 3UPMA 4LQ1A 5C9UA 3N2OA 3D46A 2OODA 2D0HA 3N19B 3CS2A 4H8UA 1XKJA 3MPGA 2ISVA 1KNWA 4LYQA 5D2VA 1DXIA 4LVFA 4F0SA 3KBMA 3QGKC 4H9TA 2MANA 3ITGA 1JCNA 4JIHA 4JQ1A 4E38A 1LQAA 2X7WA 3TMLA 3QC3A 1UD8A 1TV3A 3IARA 3K8LA 3IJ9A 2CU0A 3UU0A 2E5CA 3GU1A 3A5VA 1M9HA 1FHDA 2ISWA 4BHYA 4M5PA 3L4UA 3GTFA 4OBTA 5DQPA 1EGVA 1IEXA 3AMKA 4CQ8A 3DKJA 2AQVA 4AHOA 3BLLA 3N14A 3KRSA 1XXXA 4O4VA 4ORMA 1EQPA 1HKWA 5CLWA 2CW6A 4GNVA 4J3ZA 3GZAA 5H8UA 4NZJA 1SZFA 4WKAA 4DN1A 4WHBA 4I90A 1LOQA 2WHLA 1BXCA 4DJDC 1B3OA 4RW3A 2QW5A 1CCWB 2AOSA 3GR7A 3UGVA 2RDUA 2ALRA 4RR4A 4RV3A 4YTTA 1KN0A 3L8KA 2BXYA 1EP3A 1OGGA 3UJSA 1OYAA 2Y61A 1XIDA 3REQB 2J78A 1GEQA 2PRLA 3W7OA 2PI6A 2Y88A 3N3TA 4QR6A 1Z41A 1TIWA 1TZ9A 4DJFD 2YA1A 4S1FA 1L9WA 4X60A 5KTLA 1FCUA 3WG6A 4JGDA 5H8PA 1GONA 4DZ5A 3PBVA 2PGRA 1PYMA 5BXTA 4A29A 4NVTA 1E1EA 1JYNA 5D38A 3OP2A 3OB8A 1H7RA 2WSYA 5BMXA 3GIQA 5G1MA 3QGAC 4WZHA 4N9BA 2EPHA 4R5EA 2PFHA 1AQHA 4OOUA 1B0IA 2MUCA 4UFHA 3H7VA 1YADA 2IUZA 4AIUA 4PE8A 5FSDC 3CM4A 2DGAA 3WQFA 4PA8A 4C1NA 4XBJA 1RK5A 4YTUA 2ZKMX 1LOSA 3OGRA 1NTHA 4O18A 3I4KA 2Y5JA 2R94A 4MYAA 4F0RA 1H11A 4HHPA 3RHGA 1N60C 2YXXA 1RD5A 2WPBA 3VOGA 1BHGA 4H4WA 2NT1A 3A4AA 4QJ1A 4LXFA 5REQA 4EM3A 3BAJA 3M7SA 3GG0A 4UCFA 3BMXA 3RJXA 3BW4A 4YIWA 3WELA 1JQVA 3OVGA 2OYLA 3I10A 3RRAA 1PJ9A 3GXIA 2RUSA 4XZIA 3U6WA 2PBGA 4GUHA 3D5HA 1C9WA 1JXJA 2QQ6A 1KQYA 4RDWA 1W1A1 1QXLA 3UYCA 4N6EA 3ELFA 4GJJA 4ZSTA 4BS0A 4K6AA 3QR0A 1E6NA 1UOKA 3TAOA 1HVXA 1SJBA 3CC1A 3HGRA 3S2JA 3C0JA 1VYRA 3DEQA 3KLLA 4ADTA 1J6OA 2QCLA 1P0BA 1XLJA 5LYRA 1BXBA 4H2HA 4CNUA 2PTDA 1W9BM 4EK7A 1V3HA 3GNPA 2GLKA 1I9CB 1KO0A 4IGMA 4HK7A 1F76A 3S9YA 1DPMA 4RZ6A 4UC5A 2XGIA 4KESA 1M3UA 4NJHA 3TLLA 3W26A 3MDWA 4H4QA 1VEPA 1B2YA 3W00A 3WDJA 1H0IA 4H01A 1Z69A 3EWWA 4D9PA 4DELA 5LXEA 4JTCA 3Q4DA 1VAHA 4EMJA 3B8VA 4MWAA 1VFHA 1BYBA 3M0KA 3VE7A 1I2RA 4Q8OA 4W84A 4M29A 3LRLA 3FJ4A 5FAGA 3ABSA 4ZQNA 4HNTA 3NTYA 4LF1A 2IKJA 1SW3A 1SSGA 2FIQA 3KTCA 3NXFA 2EPMX 1MNSA 3FAWA 4Y8EA 1VFUA 4V2XA 4PCPA 3V1PA 4JHMA 1KBLA 1P0NA 3FA4A 5JBDA 4HNUA 3MSGA 3VNDA 2ZX9A 5T91A 3O3RA 4AEFA 3GIYA 4O19A 3HRDC 3WH8A 2QAPA 5CGMA 1GTHA 1UWRA 2AQWA 5HBFA 2YCIX 2ONEA 3DGZA 1F61A 3PG9A 2W92A 3MW7A 4TX8A 4ECLA 4ZB2A 2X1UA 2HEJA 4IMCA 2YR1A 3QRHA 4HA1A 4C6BA 4BI7A 4ATDA 3IGHX 3DN5A 1VFMA 3BG5A 3FGCA 3L5OA 1NARA 3CV2A 4J3SA 1GVEA 4GJIA 1P6CA 4KCWA 4DBDA 3LGGA 1H62A 1ODUA 5DT5A 3MKKA 1XF0A 4NHVA 4FLOA 3WDPP 1P6BA 3W6MA 4LW7A 2Z1KA 3LX9A 3CHFA 4IJRA 3VMNA 1W9DM 3GXDA 2UY2A 1MXGA 5LNSA 1OC6A 1CW2A 1E1FA 5C2CA 1F3EA 4LJ3A 3JZEA 4GISA 3TYBA 3WQGA 5A6LA 3M5VA 2W9MA 2ZZ3A 4MSSA 3F2DA 1X1OA 1UWIA 3GDRA 4Q7BA 3LPGA 3G1VA 4QLKA 4K8EA 4S3KA 3AUOA 1ZAJA 1SW7A 3AJ7A 4YWIA 4JR5A 2EF9A 1XINA 3M47A 3OYZA 3IS4A 5CKSA 3LG3A 1XIGA 2WOQA 4PUUA 3N9RA 4FNTA 1TYGA 2E6YA 4WJ8A 1UH2A 1DOSA 2FZBA 3QPYA 3T4WA 2ZA1A 1DWAM 3MMDA 5A2CA 4NRRA 3P8IA 3ZT5A 4HT3A 2A4AA 3A64A 3OVQA 3A3XA 3QTGA 2E68A 1X39A 3WF0A 3SUWA 3QR1A 1GOIA 1RQEA 1JCLA 1K8YA 4NASA 1CGUA 2E40A 1VPXA 4A8RA 3F1QA 3DOPA 4PMRA 4XD4A 4WSJA 2IPGA 4CD8A 1KXTA 2OELA 4C6DA 2FH6A 3IIOA 3LOTA 3AMLA 4C1LA 2J9YA 3WEMA 3ENLA 2R1KA 3SI9A 1RY0A 3TU9A 2E4TA 2FGLA 3BANA 2Y6ZA 2CZFA 3UWZA 4DBWA 4IP5A 2V3GA 3HQNA 3W7IA 3C56A 3G1RA 1TVPA 2YCLB 3MU7A 4KW2A 3RF9A 4KIRA 1OJTA 5I2UA 4GYJA 1NIUA 1IXOA 1UBPC 3O0HA 2J8GA 1ITUA 1TQJA 2D2OA 4GI4A 3IIZA 1OBAA 1E4LA 2O0TA 5G2IA 4GGBA 2DH3A 4H9XA 2Q09A 3UR7A 3SURA 4F48A 1HVQA 4DIAA 2DZVA 4IIEA 2J47A 4PTDA 4BV6A 1Q6GA 3L4XA 4QJ3B 1A3HA 5A8PA 4L4LA 5AHFA 1DE6A 1KV5A 4XZBA 2IS7A 4DX3A 5HATA 2W54A 3MV01 2IMRA 1EQCA 2Y7DA 4UQBA 1WZLA 5FJUA 4PMYA 1E9IA 3TEVA 2Y1HA 1UR1A 4KMQA 5F2IA 3J7HA 3KZPA 1ZY8A 1AD4A 3PPCA 2C0AA 3CV6A 4LB4A 2I56A 3KXQA 1NHQA 2PDGA 1EDTA 3H12A 4PCNA 1S2AA 3QLLA 4PRWA 3KL5A 1ZU8A 3BO9A 4AZIA 1CDGA 1LYXA 4Z0SA 5I3IA 3AM9A 2BHYA 1PAMA 3SUSA 3HBLA 2QNEA 5EBAA 2Y7FA 1EJ7L 1DIDA 3BLIA 4E4UA 3DK4A 4IL0A 3ZR5A 4XISA 5M17A 1SMDA 3E5PA 3HURA 1PZ3A 1D7YA 3LU2A 1H41A 5AOUA 5JH2A 1E40A 2DUXA 4PMDA 3KW3A 1O94A 2E67A 2CZ5A 3ARYA 4AZ7A 4QCEA 2VRKA 2RAGA 2JF6A 4IF2A 3QPEA 1QI3A 3H2CA 3LPPA 3GS6A 4PUEA 4H4PA 3T05A 2VOTA 4Z1AA 3EXSA 2QPUA 2WAGA 3H2EA 4MGGA 5D04C 3QZAA 2WJZA 2XFYA 5D2WA 3UERA 5I03A 1EKOA 4NEWA 3FKRA 3HPSA 1TZZA 2YFOA 1H3GA 2DV0A 2XSXA 4JN8A 3AXKA 1UA3A 4ZL1A 2WVTA 1NSJA 4R27A 3BOFA 3MP3A 3PSWA 3LZ5A 3UWVA 3RM8A 1R3RA 4GBDA 4D8LA 1AUSL 2WBGA 3WH6A 1JJKA 1R9YA 3ATYA 4YMZA 1L6GA 4DJDA 1C90A 1KM1A 2WMIA 1BF6A 1P7TA 3RPTA 5CLTA 4PTXA 1E6SM 3R79A 4UTFA 3QFBA 4N0RA 1Z32X 3V4BA 4GQ0A 3QHMA 2CKSA 4UNIA 3A7AA 5EMKA 3SB0A 3AAMA 4X22A 4NI8A 1AMKA 1G5AA 3G22A 3M07A 4L5ZA 4C6QA 2BHUA 1M7XA 4IQEA 3KBJA 1A5UA 4ZGYA 2F84A 2X8CA 1SO6A 4DBUA 1IZKA 2G37A 2HRWA 2NPXA 3QOMA 2PWVA 1EGZA 4GGHA 2PRHA 3GYCA 2B4GA 3N11A 4JQAA 3NA8A 3CXOA 4IPNB 4UQAA 3THDA 2GVGA 1EBHA 3VABA 4G1NA 3WLTA 3CB8A 2REQB 4IICA 1LRTA 1XDIA 4TMBA 4NZ4A 3EOUA 3M7WA 2NQJA 4K1WA 4JX5A 3VIGA 3GHTA 4XSMA 1DJQA 3BLDA 3MMUA 4PUKA 4Q8MA 1V02E 2J25A 4S3CA 3B03A 4DNHA 2VFGA 2RFGA 3ZXWA 5IHRA 1EC8A 4GYKA 3LS9A 4AIEA 3HFTA 2PP1A 3F03K 1T41A 4BQ3A 3I3EA 1JRCA 2CIPA 4HPGA 1CGWA 5JXQA 2XINA 2EG6A 3GXFA 4GUJA 4ERAA 3U0HA 4C6LA 3A6OA 4CN6A 2WPCA 4XO7A 1C91A 4NNBA 4EXBA 5CH9A 1QWGA 1U30A 2BXVA 2OEJA 4CD6A 4E2DA 4S39A 3NSNA 3BGGA 4XTDA 3SCOA 3OLEA 4D1IA 3WMBA 3E49A 1UHVA 2Z2BA 2ZZ4A 3C2RA 3OLGA 1YXDA 1HP5A 1R85A 4GO9A 2PEVA 3RAOA 1KXQA 2EAWA 3QJAA 1MW3A 3ABZA 7ENLA 3VC5A 1I2NA 1HN1A 5G2HA 2H9AA 4G2DA 4IOTA 3TJLA 1WXYA 1MDRA 3S6DA 3ZLFA 1KXVA 2WV8A 2VRJA 3AOFA 3SADA 2X30A 4IM4A 3WD4A 4DWSB 3PULA 2F7FA 2WWDA 1Q85A 2UY5A 4NY2A 1BD0A 1Y65A 1WKFA 4OKDA 4NXSA 5A5WA 3N2TA 4FLSA 3VNYA 2V3BA 1NHPA 3POCA 1JUEA 3L68A 2YCKX 3I7QA 3W1PA 3E38A 4J3TA 1FCBA 5ABTA 4HN8A 4B5XA 4EXAA 3BH4A 1NHSA 5DEZA 3O6AA 4CNNA 3NQEA 2GZXA 2PGWA 2FHBA 1ONWA 2UV8G 1YPFA 1YXCA 1KA9F 2GR3A 5FMHA 1R8LA 1C7SA 1HJXA 4H6RA 4KFNA 3W7NA 2V5JA 4XD3A 4GA8A 1EL3A 3M0MA 5BZAA 1FVPA 1B57A 2QPXA 1KTNA 4PFHA 4V1YA 3W7GA 4E2VA 5CG7A 1U2YA 2WKLA 1XIHA 1XKYA 4I9JA 5SWUA 2BNJA 2WYSA 1VB9A 3LI0A 1N82A 3GZ3A 3ZO9A 2QDDA 1IE7C 2P88A 2XG9A 3CHCA 3OGVA 3AIRA 1TA3A 1IV8A 3CH9A 1I0BA 1FDZA 2BS9A 4EQWA 3WQVA 3UT0A 1RJRA 2PCEA 3ITYA 1QO5A 1FWDC 4O12A 4IISA 1QNRA 4OTKA 3S47A 3Q65A 4JFVA 3HF3A 4FNSA 1UD6A 2DZXA 2VVSA 1V97A 3LYEA 4PSRA 1Q8JA 3W22A 2HCVA 3QC0A 3S1UA 2NX1A 1E0VA 2FZ9A 3E6EA 3EOOA 1FP9A 3K2GA 1XD1A 4QG6A 1VRXA 4TQTA 4X0NA 5KMYA 3BSGA 4GY0A 1P43A 1JFXA 1J18A 5KETA 3FKKA 1F8IA 3SCQA 4CNTA 4IHCA 3W1UA 4LCQA 1VHCA 2VQTA 3UXKA 4PTVA 1UKQA 4EM4A 4J3VA 4YYCA 8RUCA 1DYSA 3WUGA 5BYWA 3GY1A 3LHVA 2TAAA 2V8ZA 2WBAA 1I0DA 4DJED 1NF0A 3DDMA 4QE1A 3AMDA 1V0NA 4HPNA 4UCGA 1M6IA 3ME3A 3V16A 1V6VA 1J9YA 4IFKB 4PC8A 4Q4QA 3UBPC 3MUXA 4GFIA 5DX7A 1XIBA 1F9CA 4LCSA 2Z1XA 1ZJAA 1G4SA 3TSMA 1PO9A 2QLYA 4TV6A 2QT3A 4EPBC 3ONCA 7TIMA 1YNYA 3P5YA 3ES8A 2WOVA 5FEXA 1H61A 1AOGA 3SRDA 3W02A 4QDMA 3TTOA 5E70A 3CHDA 3SCRA 3PS7A 4ZO7A 4Z1DA 3EPMA 1KGWA 3UP8A 3S5YA 3AYSA 4US5D 2BX7A 3OC4A 1SYTA 1UBSA 4N4PA 2HISA 4QS5A 1R3WA 3CXBA 1TTIA 3QQ0A 4WXZA 3K8MA 3U8GA 4GH1A 5D09A 3WX7A 3DYPA 1TCMA 1KTBA 4HN4A 3Q6JA 3RDKA 3B9JB 4AZBA 1SB3B 4Z17A 5D8WA 4LAZA 3PZTA 3A21A 4JYFA 1UH3A 4E5TA 4L65A 5AYYA 1V93A 1FH8A 3GHRA 3BE7A 4DZIA 4IFRA 2P0IA 4UZUA 1W8GA 1E3XA 4WGHA 3CAVA 3CK5A 1A0CA 1PKNA 4DM1A 1LL4A 1NQKA 3WNLA 1EP1A 3GG7A 4K2SA 2C91A 4IP4A 1YNQA 4JHZA 4B3ZA 3W70A 3K5XA 1QPRA 2V3FA 4RZBA 3SUUA 5F7UA 2HMCA 4U5IA 5DY2A 1S1RA 5DELA 2ATMA 4W4QA 4H1ZA 1OFBA 4FXRA 4TMCA 4FF7A 2NQHA 3ABQA 3MO4A 3W83A 4CCEA 1DP0A 2PDPA 3SN1A 1KBIA 1D3CA 2CPUA 5LIKX 3F5JA 4Q4SA 3PP7A 4HCHA 3CGCA 4XZNX 2IQ0A 2FHCA 4DO5A 4RDZA 2NVKX 4HOXA 1JF6A 4AC7C 5HUOA 1WV2A 1VBUA 1WO2A 2UBPC 1JDCA 3B0XA 4Y9NA 1I75A 4S2BA 2ZRYA 4GJ1A 2GJXB 2PAJA 3UXIA 1ITCA 2OB3A 1QW7A 1OT1A 2CNCA 5D33A 4M24A 4JDBA 4I6KA 1Q3NA 1S2CA 4LX4A 3RRXA 1A4MA 1T8XA 4RNFA 2QCGA 4ZQOA 3VGBA 4NEVA 1J0IA 1FWRA 2DH2A 1NDAA 3UCQA 4D72A 3VKAA 1IR1A 2VWSA 1FWIC 2Q71A 4UFIA 2ZX6A 1K9DA 2E9BA 3LLDA 3LTSA 1UD5A 2E9LA 1W1B1 4W88A 1M53A 4HNLA 3DU0A 1WQ5A 4MJ4A 4P5UA 3FSTA 3ZFHA 1CECA 1JPIA 3S2CA 3GR8A 4J28A 4UBPC 2Z26A 1XC6A 4LWWA 1K9TA 3DHFA 3R12A 4UQ9A 2FVMA 3NURA 2AKZA 3KBWA 2X0HA 3KS5A 1O4UA 1NHRA 4JX4A 2A3LA 4JTIA 3W87A 3GHSA 1ZHAA 5BU9A 3DI0A 3LBMA 3ITXA 3GLCA 1TVNA 1TKKA 3AIWA 3MBFA 5B7ZA 4R33A 4IL2A 3O2LA 3UNTA 1FWHC 3DJJA 1RHCA 2P5NA 3CTLA 3ZJ6A 3MUZ1 4H4XA 4KPLA 1CGVA 5J5DA 2FKPA 2QVHA 5BWAA 1IGWA 5H1WA 4DUVA 3CUGA 3NNTA 4FSAA 1RVGA 5HULA 1JR1A 5DMNA 2XIMA 3CIVA 3FHQA 5I3DA 1TG7A 4REQA 5T9BG 1V3IA 2YZ5A 4L4OA 4C6MA 5ABFB 2FJKA 4JX6A 3F2BA 2GVLA 5EFDA 4LBRA 3IIXA 4XZHA 3LQLA 3S2MA 3IJQA 2J8FA 1GEHA 3G8RA 4EVZA 3WLNA 4DXKA 1B4EA 3CWOX 1T40A 5MKGB 4QXIA 4XVDA 4NP7A 3MHFA 3ZR4A 4FA3A 1VQZA 4WOZA 1UIOA 4MFEA 4CNSA 3NS1B 3NVVB 2AAAA 1CB7B 6REQA 5F2MA 4Q7NA 5LZLA 4RE4A 4M8UA 1S2UA 1UR3M 3B8IA 2V2HA 4L4MA 2AMXA 5A6AA 7ODCA 3VPLA 2GRTA 2XH4A 2JE8A 1VP5A 2P8BA 3OYXA 4J4KA 2Z25A 3CL8A 3UVAA 1O95A 4AUBA 5IDZA 2GGGA 4Z1YA 5FL1A 1GOQA 2CFFA 5K4XA 3W7KA 1YDVA 4KRZA 3VNIA 1QATA 4BEQA 1SJAA 1OEPA 3WD3A 4E4PA 3PB0A 1H63A 1ISYA 4PFMA 4GXWA 3FVDA 4YPJA 3NPXA 1TWDA 2V67A 4UZSA 1RY8A 1PZ1A 2KAUC 3K4WA 1VC4A 1H5YA 7TAAA 4CCDA 2X2YA 1YBQB 5LGXA 3TV8A 2ICSA 3NG3A 5LIWX 3TW6A 2NT0A 2PDLA 4MAZA 5CGQA 4OUIA 2O9PA 2DVXA 4KEUA 4GZIA 1POJA 3EKZA 1H60A 2PUZA 2OEKA 3MVIA 1QOQA 4MJ2A 3DGHA 1TJ0A 3N2XA 1FWGC 3PUEA 5D4YA 4RXGA 3LM3A 2FH8A 4HP5A 3MP4A 5I02A 2QCNA 1TWWA