4DNAA

Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
461
Chain Sequence
b'AFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQFAEHFEDAAGFGWTVGESRFDWAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELAGPNTVKLLASGKTVTAERIVIAVGGHPSPHDALPGHELCITSNEAFDLPALPESILIAGGGYIAVEFANIFHGLGVKTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQSVSADADGRRVATTMKHGEIVADQVMLALGRMPNTNGLGLEAAGVRTNELGAIIVDAFSRTSTPGIYALGDVTDRVQLTPVAIHEAMCFIETEYKNNPTSPDHDLIATAVFSQPEIGTVGITEEEAARKFQEIEVYRAEFRPMKATLSGRKEKTIMKLVVNAADRKVVGAHILGHDAGEMAQLLGISLRAGCTKDDFDRTMAVHPTAAEELVTMYQPSYRVRNGERVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glutathione reductase
publication title CRYSTAL STRUCTURE OF putative glutathione reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 138
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4dnaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA02
2O9ZA 4YKGA 3ALJA 2FJAA 3DJDA 1DJQA 4H4UA 3AYIA 2YLZA 1KSSA 4OPGA 2XFQA 3EANA 1D7YA 1PBEA 4USRA 3FG2P 1B4VA 2GR2A 1LQTA 2E5VA 4FDCB 4NEWA 3D8XA 5J7XA 5KOXA 2BXSA 2R0PA 4YSZA 4Z2RA 3GMBA 3SFDA 1XPQA 2XLPA 4RG4A 4Z43A 2WESA 4REKA 3CNSA 2IVDA 3CN8A 1E1LA 3BHKA 2DKIA 1BF3A 2C7GA 1GETA 3P4RA 1EBDA 2TPRA 3EAOA 1GREA 1VDCA 2EQ7A 2X50A 1NG3A 1YQ4A 3ICSA 5IPYA 2YQUA 1TYTA 3BNMA 4UDPA 3P1WA 4H4XA 3HZLA 2VVLA 2GRTA 2X8GA 1BGJA 2CDUA 3DK4A 4H7UA 3ATRA 4A7AA 4BK3A 2IIDA 2VZ2A 2Y6RA 1YQZA 3VRDB 3AYJA 4TLZA 3SQPA 2JAEA 1O5WA 3K7QX 3C4AA 4CNJA 2ZZBA 1E7PA 1S3EA 3FMWA 3QSSA 5BULA 2Z5XA 2EQ9A 2XDOA 4JQ9A 3RP6A 4X9MA 3UOYA 3KA7A 3IC9A 2Q0LA 2YG6A 4NTCA 5IQ4A 4H2RA 4H4RA 2PYXA 4UP3A 4U8JA 5JCNA 5ER0A 3ICTA 2XVHA 2JBVA 4C3YA 2VVLG 1IUWA 3DGHA 2YLXA 3VRBA 3T37A 1XANA 3GMCA 4BJZA 3AWIA 4O5UA 3F8RA 2GEWA 4LIIA 1K0IA 2WU5A 4PABA 4A65A 1GTHA 1UKVG 3CNJA 2XLUA 4D04A 4A79A 3NH3X 4AOSA 4WX1A 2BABA 3E1TA 2H89A 3AE7A 2QAEA 1P2HA 1CJ2A 2A8XA 2GR0A 1JRXA 2VVMA 3PVCA 4N9XA 4E0VA 5LV9A 2BA9A 1O95A 1Y56A 2JB1A 4JY2A 1K4QA 2W0HA 2OLOA 3LJPA 4GF7A 4J36A 1GRFA 2QCUA 3NYFA 1E6EA 4AT0A 5EBKA 2R0CA 2YVGA 2WPCA 1D4CA 3URHA 4U8NA 5FS9A 3C4NA 5U1OA 4OPUA 4B66A 3CTYA 3CPJG 2YG4A 3NN0X 2J3NA 1F8SA 2APGA 2YVJA 4U8KA 2QA1A 5HYMA 4EMIA 1DJNA 4TM0A 3KLJA 4ZCDA 2VRLA 2R4JA 3ADAB 3SFEA 5HY5A 1ZY8A 1CC4A 3FBSA 2C72A 2ARDA 3KU9A 3NHOX 3OZ2A 5C3JA 4OPIA 3D1CA 3NYEA 3FIMB 1S2QA 1H81A 1JNRA 1NHSA 3IHGA 5M0ZA 1MXTA 3ZDNA 4EQRA 1M64A 3LZWA 1PJ6A 4JNAA 2YAUA 3F8DA 4TLXA 2EQ8A 2WOWA 2JKCA 1N4VA 3NK2X 1H86A 1Q9IA 2YM1A 4X9NA 5EB4A 1H7WA 3KKJA 1K0JA 4KPRA 3VR9A 1TDFA 2YG7A 2C67A 4A99A 1CBOA 1FEBA 3GDPA 1NHRA 2XYOA 4U2TA 1RSGA 3H8IA 5HHFA 4H4YA 1GESA 4Z25A 1GRBA 1E1MA 3DJEA 2Q6UA 4YTMA 1Q1WA 2I0ZA 2YLRA 3NTDA 4YTPA 5EOWA 2R4EA 4YT0A 1NDAA 2YVFA 1EL7A 3AE8A 4KX6A 1PS9A 1VRQB 4EM3A 2BCGG 4LU6A 3COXA 4NTDA 2JB3A 3NT6A 4HB9A 2B7SA 3PO7A 4K5SA 4CBQA 4B69A 2XLTA 2B9XA 3AYLA 1GTEA 1E1NA 4IVOB 2V5ZA 3NG7X 3UKHA 2E4GA 3O0HA 4H4TA 2X3NA 3NTAA 4B63A 4AOXA 1SEZA 2XVEA 2GR1A 4FK1A 3I3LA 4OCGA 4K5RA 2RGHA 5DBJA 1PXCA 1CC2A 1YY5A 1Y56B 2GQWA 1JEHA 4M52A 1JU2A 3BI5A 1Y0PA 1B37A 3GDNA 2GAHB 2ZBWA 4Z24A 4AP3A 3DGZA 1ONFA 4ZN0A 2CFYA 1TDOA 2XVJA 3AD8B 3H4KA 2WHDA 3LOVA 1EL5A 2CULA 3K30A 3CGCA 4TM3A 3L1RA 3AEAA 2Z5YA 4AT2A 1D4EA 2GMJA 2XVFA 2V6OA 2BXRA 5CQFA 4JN9A 2C64A 1Z6LA 3BI4A 1OJDA 1PBCA 3PS9A 3ABVA 4FK1C 1IUVA 2GVCA 3BHFA 3UOVA 4CCQA 1D5TA 5U63A 4TM4A 1KSUA 1V59A 1TDEA 2V60A 3S5WA 3P4SA 1CJCA 4AP1A 2YR4A 2WP6A 4H4VA 3LXDA 2AAQA 5FS8A 5FMHA 1FOHA 4NZHA 1BGNA 4Y4LA 4U8IA 1E39A 1Q1RA 1PJ5A 1DOEA 2XFOA 1K0LA 4CRTA 3UP5A 2YLSA 1TRBA 1ZOYA 1ZX9A 4J57A 4H2NA 3ISHA 3KVEA 4YKFA 4XWRA 2AR8A 2OAMA 4GDEA 3UKKA 2XFPA 2YM2A 3AE1A 1PXAA 3GD3A 1FECA 1L9CA 1JRZA 2DKHA 4TM1A 1X31B 2R9ZA 1DOBA 2C70A 3DA1A 5BVAA 2R45A 5L46A 4EMJA 2A89A 1B8SA 3UTHA 1RYIA 5IQ1A 1O94A 2WETA 1GPEA 4JDRA 4P9SA 5EB5A 2OA1A 2WQYA 3ITJA 1GRGA 3CNDA 3DJGX 4K22A 2PHHA 2GAGB 1S2YA 4IA5A 2WDRA 4ICYA 3V3OA 4U8LA 1PBBA 4Z2TA 1KDGA 1S3BA 3UKLA 3Q9TA 4ZCCA 3FPZA 3CGEA 3IWAA 4FX9A 1GEUA 1GERA 1GXFA 4B68A 4CNKA 1B5QA 3RNMA 2WEUA 3QJ4A 3EPTA 2WPEA 4DNAA 1IUTA 3L8KA 2BK3A 3DK9A 4H4WA 1JRYA 2BK4A 3GD4A 1N4WA 2B7RA 3UKFA 1BWCA 4IV9A 3H8LA 3AE5A 3JSKA 3K7TA 3ALLA 3SGLA 2BK5A 1ZMCA 5J60A 4YTNA 3AXBA 3NK0X 4YSYA 4C77A 1H7XA 1IJHA 4DSHA 1NPXA 4K2XA 1VG0A 1TYPA 1FL2A 3GSIA 2GH5A 2WPFA 5BUKA 1IUSA 3AD7B 2V3AA 1CF3A 3AEFA 2WOIA 4A6NA 2C66A 4EM4A 2BS3A 3ATQA 5JCKA 3UOZA 4GR1A 2RABA 5GRTA 1PHHA 3ALMA 1OJAA 2A87A 2B76A 1YQ3A 2C73A 2WP9A 4J33A 5HXIA 1JOAA 2YWLA 2XLRA 1PN0A 2F5ZA 3AE3A 1M6IA 4UDQA 2WS3A 3ICRA 3EF6A 2VOUA 2OLNA 4I58A 4NTEA 3AE6A 4H50A 4K8DA 4DGKA 4A5LA 3UKPA 1DODA 1F8RA 3AB1A 1IUXA 3LZXA 1HYUA 4GCMA 3GWFA 2C3DA 1OJCA 4J31A 4OPLA 2BCPA 3AEDA 1PJ7A 4J56A 1YKJA 3AEBA 1CJ4A 3NKSA 3VQRA 1NEKA 1LJ1A 1N1PA 1LV0A 1LQUA 1IUUA 3CIRA 4C74A 3CGBA 1N4UA 2ZZCA 4BJYA 2WOVA 1GSNA 3CNPA 1MOKA 5CKUA 4D03A 1ZMDA 2NVKX 1LPFA 4CCRA 2JB2A 2BYBA 3ZYXA 1QO8A 4U8MA 2YLWA 3GRTA 2YLTA 3M13A 4JY3A 4BV6A 3G5QA 2RGOA 2XFNA 4MJWA 5KVIA 1VQWA 3UOXA 5BRTA 1XDIA 3M12A 4JNQA 1COYA 3G5SA 3QSMA 4EMWA 1D7LA 1EL8A 2HQMA 2H88A 2BS4A 4C3XA 5C2TA 4NEVA 3V76A 1KF6A 1F3PA 1ZKQA 5FS6A 1F6MA 3CPHG 5M10A 3NRNA 4K7ZA 2GB0A 4YSXA 3NN6X 1H82A 2CVJA 4U2SA 4I59A 3WE0A 1BZLA 2X8HA 2WBAA 4EQXA 4LA1A 2ACZA 3QVPA 3CNTA 5KOWA 1FCDA 3BI2A 1P2EA 1LTXR 1VG9A 2FBWA 1ZDLA 1GALA 4H2PA 3S61A 1NHPA 2C75A 2FJEA 3AECA 1CL0A 2R46A 2V3BA 5KVHA 1LVLA 3I6DA 4UDRA 1TDNA 3Q6JA 2EQ6A 3R9UA 1DXLA 2X99A 1GRAA 2AQJA 5KWFA 2Q0KA 4A6NB 1PXBA 3P4PA 4OPCA 2JK6A 3REDA 3RP7A 2X8CA 2C76A 3K7MX 5JCMA 2V61A 2WDQA 4APNA 4IVMB 1W4XA 3GRSA 2RGJA 1PDHA 3UTEA 1ZK7A 4BK1A 1FEAA 1EL9A 3NYCA 3NLCA 4Z44A 5JCIA 3LADA 5U25A 1KFYA 5TR3A 4A9WA 1MO9A 1CJ3A 1F8WA 4H4SA 1QLBA 2GQFA 4B67A 4BK2A 1H6VA 5KRQA 1L0VA 3AE4A 4Y4NA 2TMDA 4B65A 1ZOVA 1GV4A 2Q7VA 2B9YA 3UCLA 2VRMA 4ECHA 3RHAA 1NHQA 3P4QA 3B3RA 3BNUA 2XLSA 3AE2A 1QJDA 1PBDA 1DOCA 2C65A 4Y4MA 3VRAA 3G5RA 1REOA 2GF3A 3OC4A 2OALA 2XVIA 3AD9B 3AEEA 3QSEA 4RG3A 4H2QA 4B1BA 1NG4A 4DSGA 1TDKA 3NK1X 1BKWA 2YR6A 4XWZA 3DH9A 3KD9A 1JNZA 1KNPA 1CHUA 3UTGA 4WCTA 4EQSA 3UP4A 4YWOA 3NIXA 4BURA 1XHCA 2BS2A 4O5QA 1H84A 4USQA 3AEGA 4U8OA 1ELIA 3P9UA 1E1KA 2QA2A 4Z2UA 3V3NA 4X4JA 3DK8A 1H83A 1GOSA 1GT8A 1KNRA 1NAAA 4J2WA 4H4ZA 1RP0A 2Y6QA 1NENA 4CY8A 2XFUA 4ADWA 4CY6A 2GMHA 2GR3A 5GSNA 4XXGA 3GYJA 3DJJA 3II4A 2UZZA 2WU2A 3C96A 4IA6A 2XCGA 3CGDA 2YR5A 4YXDA 2R0GA 2YG3A 4C5OA 1CC6A 3GWDA 1AOGA 3M0OA 2BC0A 2BC1A 4H4PA 2B9WA 2IVEA 1L9EA 2VQBA 3B6DA 4B64A 2FJBA 2GV8A 3F8PA 3UKQA 5KXJA 2VQ7A 1GRHA 1OJTA 2ZZ0A 4H4QA 2C3CA 1ZP0A 1DNCA 4GRTA 4U2LA 4GDPA 5FS7A 4U8PA 1OJ9A 3QFBA 4GUVA 2YG5A 1GRTA 3QFAA 4OPDA 2E1MA 4OVIA 3SM8A 3UTFA 4EIPA 4YSHA 3IHMA 2WP5A 4Z26A 4PAAA 3NGCX 3QVRA 4J34A 4EQWA 5JCLA 3GYIA 2NPXA 3DMEA 3CPIG 3LB8A 3RP8A 1PBFA 3AE9A 4HA6A 4RSLA 1GNDA 3KPFA 3IF9A 1D4DA 3UKAA 4EIQA 2FJDA 3VR8A 4OPTA 1L9DA 2BACA 3NNEA 2WDVA
chains in the Genus database with same CATH superfamily
3SR6B 4FI4A 1KSSA 3UJFA 2ZC8A 3EANA 1PBEA 4USRA 3FG2P 2GR2A 5J7XA 2BXSA 3TWAA 3A7AA 3DFYA 1ONEA 4YSZA 3R1ZA 4Z43A 2GGIA 2QDDA 1P48A 1EBDA 2TPRA 3P3BA 3ICSA 2EQ7A 2POZA 2VVLA 4H7UA 4A7AA 3DG6A 2Y6RA 1KD0A 3AYJA 1O5WA 4CNJA 3FMWA 1E7PA 1S3EA 3QSSA 3SXIA 2EQ9A 3RP6A 3IC9A 2OZ8A 3OTRA 4H4RA 2PYXA 5JCNA 3STPA 4ZA0A 3HYWA 3VRBA 3T37A 5KMPA 3VCNA 5EU9A 5KMRA 1GTHA 5BOFA 3E1TA 2H89A 2GR0A 3PVCA 2VVMA 1S7MA 1K4QA 3V4BA 4GMEA 1GRFA 1E6EA 5EBKA 2R0CA 5U1OA 4OPUA 1JPMA 3ZVHA 3NN0X 2APGA 2QA1A 4II3A 3KLJA 4Z17A 2VRLA 2XH2A 5HY5A 2ARDA 2PU1A 1H81A 3CAWA 2YAUA 3P0WA 3OP2A 3UCDA 3NK2X 2YM1A 3AM9A 1K0JA 2C67A 4A99A 2XYOA 1RSGA 4H4YA 4YTMA 2I0ZA 2YLRA 4YT0A 4KX6A 3AE8A 1H2IA 2BCGG 4LU6A 2W55A 2B7SA 1E9IA 4E8GA 5J04A 1EC9A 2XGZA 1MDLA 4IVOB 3UKHA 4AOXA 3KPKA 3D46A 4OCGA 3T2ZA 1PXCA 1Y56B 3BI5A 1Y0PA 1B37A 3D9XA 4DHGA 4ZN0A 3DGZA 4H1ZA 3H4KA 4ZCWA 3ZLHA 3AD8B 4NWZA 2CULA 3K30A 2GMJA 2HXUA 3K1GA 4JN9A 2C64A 1N5WC 3PS9A 2OZTA 4TM4A 1KSUA 4KT2A 3P4SA 4AP1A 2WP6A 4DX3A 1FHUA 4H4VA 5FS8A 1FOHA 4NZHA 4KEMA 4U8IA 4G73A 1DOEA 2XFOA 4CRTA 2YLSA 1JRPA 4YWSA 2W3SA 2AR8A 2YM2A 3FYYA 3GD3A 1FECA 1JRZA 1TKKA 1X31B 2R9ZA 3DA1A 3V3WA 1B8SA 2WETA 2OA1A 4IL2A 3VDGA 3FCPA 1S2YA 4Z2TA 1KDGA 1GERA 4DNAA 1IUTA 3UKFA 3GD4A 2B7RA 4IV9A 3H8LA 3AE5A 3JW7A 3AN1A 4IHCA 2BK5A 1ZMCA 4K2XA 1VG0A 3RR1A 1FL2A 5BUKA 3CXBA 1CF3A 5KNLA 2WOIA 3CYJA 4A6NA 4EM4A 1N60C 5JCKA 1PHHA 3ALMA 2B76A 4J33A 2XLRA 2NQLA 2PMQA 3SZFA 2P8CA 3I4KA 2OLNA 3AE6A 4A5LA 1DODA 3ZLFA 1OJCA 1YKJA 1CJ4A 3VQRA 1N1PA 1LQUA 4BJYA 1GSNA 1ZMDA 4CCRA 2JB2A 1QO8A 3FVDA 3IK4A 3V5CA 3GO2A 1VQWA 3M12A 3G5SA 4HCLA 1EL8A 1F3PA 5FS6A 3NRNA 4YSXA 1EBHA 3WE0A 1BZLA 3DG7A 3QKEA 3ENLA 3CNTA 5KOWA 1LTXR 1GALA 1NHPA 1FIQB 3Q6JA 1GRAA 3RRAA 3REDA 3P4PA 4OPCA 3R0KA 4II2A 5JCMA 4APNA 3CXOA 1DTNA 3JZUA 1ZK7A 1FEAA 3NLCA 4Z44A 5JCIA 3LADA 5U25A 4KWSA 1MO9A 1F8WA 1QLBA 1H6VA 3SN0A 1GV4A 3FV9A 2P8BA 2Q7VA 3RHAA 4GYPA 3BNUA 3SY4A 4Y4MA 3AE2A 3VRAA 3AEEA 3NVZB 4B1BA 3ZVIA 1NG4A 1TDKA 3NK1X 1BKWA 2YR6A 2AL1A 3S47A 3KD9A 1KNPA 1CHUA 4EQSA 3UP4A 2BS2A 1H84A 3R11A 1E1KA 2QA2A 5KMQA 4Z2UA 1H83A 3ES8A 2OPJA 3NS1B 1NENA 2XFUA 2GMHA 3C96A 4IA6A 3PK7A 1CC6A 4H4PA 2B9WA 5FJPA 2VQBA 4B64A 1BQGA 2ZZ0A 4G7FA 4U2LA 5FS7A 3MZNA 4U8PA 1OJ9A 3QFBA 4GUVA 2YG5A 3QFAA 2E1MA 4OVIA 3NGCX 3QVRA 2AL2A 4EQWA 3SBFA 3GYIA 3LB8A 3RP8A 3AE9A 3IF9A 3SN4A 1L9DA 2BACA 2ONEA 2O9ZA 4YKGA 1KKOA 3DJDA 3I6TA 4NEWA 5KOXA 2R0PA 1MRAA 1R6WA 4RG4A 2IVDA 1GETA 3EAOA 1GREA 2X50A 1YQ4A 5IPYA 1TYTA 3DIPA 3P1WA 4H4XA 2GRTA 1BGJA 2VZ2A 3OZYA 4TLZA 2XSXA 3C4AA 2XDOA 4JQ9A 4DWDA 4X9MA 3UOYA 3T31A 5IQ4A 3ICTA 2JBVA 3DGHA 3QLDA 4BJZA 4O5UA 4MMWA 2GEWA 1FHVA 1K0IA 4D04A 2XLUA 4A79A 3NH3X 2BABA 1P2HA 2A8XA 2BA9A 3DFHA 2JB1A 3PFRA 2W0HA 2OLOA 2P3ZA 2QCUA 3NYFA 2PGWA 4AT0A 2PA6A 2YVGA 4U8NA 5FS9A 4GGBA 3CPJG 5HYMA 3NFUA 4EMIA 3ES7A 1JPDX 4JN8A 3N4EA 3SFEA 2R4JA 2AKMA 3KU9A 4OPIA 3IHGA 1JNRA 1NHSA 3FJ4A 1MXTA 3U4FA 4EQRA 4JNAA 3F8DA 4TLXA 2EQ8A 3HRDC 5EB4A 1TDFA 1CBOA 3SJNA 2PSNA 2QVHA 3DJEA 3N4FA 1Q1WA 4YTPA 3T6CA 1VRQB 4NTDA 4HB9A 4K5SA 3RGTA 1GTEA 4TVYA 2V5ZA 3NG7X 3T8QA 2RDXA 1SEZA 4FK1A 3I3LA 4K5RA 2RGHA 1CC2A 4M52A 1JEHA 1JU2A 5FJOA 2PS2A 2GAHB 2ZBWA 1ONFA 2CFYA 1TDOA 3CGCA 3MWCA 2V6OA 3VFCA 3ZVHB 3SX6A 1N5XA 3BI4A 1IUVA 1TDEA 2V60A 3S5WA 1CJCA 1TE6A 3RO6A 4K8GA 4E6MA 3R0UA 3H8AA 1E39A 1PJ5A 2OKTA 3UP5A 3V5FA 3RCYA 4H2NA 4YKFA 3SZWA 1PXAA 1L9CA 2DKHA 3TJ4A 3B9JB 3NRZB 5L46A 3UTHA 3ETRB 3SQSA 1RYIA 5IQ1A 1O94A 3CB3A 1GPEA 2WQYA 3ITJA 4K22A 2GAGB 2WDRA 3UKLA 3Q9TA 3Q45A 4FX9A 1GEUA 3T2YA 4CNKA 1B5QA 2WEUA 3TCSA 1YEYA 3QJ4A 3EPTA 2WPEA 3L8KA 3DK9A 2BK4A 1N4WA 1BWCA 3JSKA 3ALLA 1KKRA 3NK0X 3QN3A 1IJHA 3R10A 3GSIA 1IUSA 2V3AA 2C66A 2BS3A 3GY1A 4GR1A 3MSYA 1X2GA 2C73A 1YQ3A 2WP9A 1JOAA 2GL5A 4KPLA 2WS3A 2VOUA 4I58A 1X2HA 4K8DA 3UKPA 3AB1A 3LZXA 4HYRA 1ZXIC 2C3DA 3VC5A 2BCPA 4J56A 3NKSA 1NEKA 1STZA 3CIRA 4C74A 1N4UA 3CNPA 1MOKA 1PDYA 4U8MA 3ZYXA 2YLWA 3GRTA 2YLTA 4JY3A 1JCTA 5KVIA 1SJDA 1XDIA 4JNQA 1COYA 3QSMA 1SJAA 2BS4A 5C2TA 1ZKQA 3CPHG 2GB0A 3NN6X 1NELA 1H82A 4I59A 3TOYA 1VG9A 4A6GA 3S61A 1CL0A 2R46A 4GAPA 3I6DA 2X99A 2W54A 4H19A 2DW7A 2Q0KA 4A3RA 4A6NB 1PXBA 3RP7A 2X8CA 2C76A 2PCEA 1PDHA 4BK1A 1EL9A 3NVYB 1KFYA 3H70A 2TMDA 4B65A 2VRMA 3OW1A 1NHQA 2XLSA 3G5RA 2XVIA 1REOA 3MQTA 1VQZA 4H2QA 1NU5A 5BOEA 3UTGA 4WCTA 4YWOA 4GIRA 4O5QA 3I6EA 1ELIA 4X4JA 3DK8A 4CY8A 4ZOHB 3DJJA 2XCGA 3CGDA 2YR5A 2R0GA 1AOGA 3M0OA 2BC1A 1L9EA 2P0IA 3B6DA 2FJBA 3UKQA 2VQ7A 1GRHA 1OJTA 3D47A 2C3CA 4GRTA 4GDPA 1GRTA 4EIPA 1ECQA 2FKPA 4DXKA 3DMEA 3CPIG 4RSLA 3QPEA 1PBFA 1GNDA 4NNJA 1D4DA 2QQ6A 4EIQA 4OPTA 3NNEA 3PG6A 3EUB3 3ALJA 4H2HA 1DJQA 2XH0A 2YLZA 4OPGA 3THUA 2E5VA 2E3TA 4FDCB 3GMBA 3SFDA 1XPQA 2WESA 4REKA 3CNSA 1EC7A 1E1LA 3BHKA 2DKIA 1BF3A 3P4RA 2PPGA 1VDCA 2YQUA 4DN1A 4UDPA 4E4FA 2X8GA 1F9CA 2CDUA 3ATRA 4BK3A 2IIDA 1YQZA 3VRDB 3SQPA 6ENLA 2JAEA 5BULA 2Z5XA 3R07C 3KA7A 2YG6A 2ZADA 4NTCA 1SB3B 4UP3A 4U8JA 5ER0A 4JHMA 4C3YA 1XANA 3HYVA 4MKSA 2XH4A 5G5HB 3F8RA 3PWGA 3N6HA 4LIIA 4PABA 4A65A 4G6GA 3QTPA 2PGEA 3AE7A 2QAEA 1CJ2A 2AL2B 1MDRA 5LV9A 4JY2A 2XH7A 5ENLA 3LJPA 4FP1A 4J36A 1D4CA 2WPCA 3CTYA 2YG4A 3DESA 4U8KA 4TM0A 1DJNA 4ZCDA 5IDZA 3ADAB 2FYMA 1ZY8A 1CC4A 3FBSA 2C72A 3NHOX 3UJRA 3OZ2A 3FIMB 1S2QA 5M0ZA 3T14A 2PP0A 3ZDNA 1M64A 1EC8A 4GISA 2PTZA 2OQHA 1Q9IA 3UCCA 1JROA 4DYEA 1FEBA 1NHRA 1RM6B 4U2TA 3H8IA 5HHFA 3NVVB 1GESA 4Z25A 1GRBA 1WYGA 5EOWA 2R4EA 1NDAA 3FXGA 3COXA 2JB3A 3NT6A 3PO7A 2XLTA 2B9XA 3AYLA 1OEPA 1E1NA 3O0HA 3NTAA 4GAVA 3JVAA 2GR1A 3GYXA 2QDEA 2GQWA 3TQPA 4HCDA 3GDNA 3NO1A 2WHDA 2PTYA 4TM3A 3KUMA 3AEAA 2Z5YA 4IZGA 4AT2A 1D4EA 2XVFA 2BXRA 5CQFA 1Z6LA 1PBCA 3ABVA 3BHFA 1D5TA 5U63A 2YR4A 3LXDA 2AAQA 5FMHA 3IJIA 4JN7A 1BGNA 3TWBA 1K0LA 3DGBA 3MY9A 1TRBA 1ZX9A 3ISHA 2OAMA 2XFPA 3AE1A 4TM1A 1DOBA 3DG3A 4A35A 2GSHA 4EMJA 2HNEA 1XPYA 3L5OA 4MGGA 4P9SA 2PODA 3CNDA 3V3OA 3DERA 1PBBA 1BKHA 2GGGA 4ZCCA 3CGEA 3EEZA 3RNMA 2BK3A 1JRYA 4H4WA 3K7TA 3SGLA 2GGJA 4YTNA 3AXBA 3SZ0A 4YSYA 5FJTA 2GH5A 2WPFA 2OQYA 3PWIA 3ATQA 2A87A 2PP1A 2F5ZA 1MNSA 5JRBA 4UDQA 4F4RA 3NZGA 4H50A 4DGKA 1F8RA 1IUXA 4GCMA 5FJRA 4J31A 3AEDA 1PJ7A 2OO6A 1LJ1A 1LV0A 3CGBA 2WOVA 3OPSA 4D03A 1LPFA 3M13A 3UJSA 3G5QA 2RGOA 3UOXA 3SSZA 1D7LA 2H88A 4C3XA 4NEVA 1KF6A 4X2PA 3GC2A 2WBAA 4EQXA 3QVPA 3N6JA 1FCDA 4E4UA 2C75A 2V3BA 5KVHA 2C4CA 1WUEA 1DXLA 3AMZA 2AQJA 2MUCA 2JK6A 2WDQA 2V61A 1W4XA 3GRSA 2RGJA 3H12A 3UTEA 3ZLGA 2GGEA 5TR3A 3MUCA 4A9WA 1CJ3A 4BK2A 7ENLA 3T2KA 4Y4NA 2B9YA 3UCLA 3B3RA 1DOCA 1L8PA 2OALA 4RG3A 2DW6A 3CMMA 3UJEA 2E5AA 4H83A 4XWZA 1JNZA 3SYIA 5FJUA 1N63C 4BURA 1XHCA 4USQA 4U8OA 4GYPC 3P9UA 1V97A 2GGHA 1KNRA 1GT8A 4H4ZA 1RP0A 2Y6QA 2OFJA 1SJBA 4CY6A 1VDVA 1FO4A 4XXGA 3GYJA 3A7UA 3HW2A 2BC0A 2PP3A 2GV8A 3F8PA 5KXJA 4G74A 2OZ3A 2PTWA 1DNCA 4OPDA 3SM8A 3UTFA 4YSHA 3VA8A 3IHMA 2NPXA 4M6UA 3KPFA 1IYXA 2FJAA 4H4UA 3AYIA 2XFQA 3UJ2A 1SJCA 1D7YA 1MUCA 4ENLA 1B4VA 3H7VA 1LQTA 1R0MA 3D8XA 2PTXA 4Z2RA 3SN1A 2XLPA 3CN8A 1T3QC 2C7GA 4J3ZA 1NG3A 4TVWA 4EWJA 3BNMA 4GFIA 3HZLA 3DK4A 3TTEA 1W6TA 3K7QX 2ZZBA 2Q0LA 3UXLA 4H2RA 1FFUC 2XVHA 3DEQA 2VVLG 1IUWA 2YLXA 1TZZA 3GMCA 3AWIA 2WU5A 1UKVG 3CNJA 4AOSA 4WX1A 2QGYA 1JRXA 4E0VA 4N9XA 3SZCA 1O95A 1Y56A 2QJNA 2BRYA 4GF7A 3URHA 3C4NA 4B66A 3S5SA 2J3NA 1F8SA 3GD6A 2YVJA 3NVWB 5KMSA 5C3JA 5G5GB 3D1CA 3NYEA 2MNRA 3LZWA 1PJ6A 2WOWA 2JKCA 1N4VA 1H86A 2BRAA 4X9NA 3VCCA 1H7WA 3KKJA 3VR9A 4KPRA 2YG7A 3GDPA 2I5QA 1E1MA 2OX4A 2Q6UA 2CHRA 3NTDA 2YVFA 1EL7A 1PS9A 4EM3A 3B97A 4B69A 3VC6A 1P43A 3TJIA 4B63A 2E4GA 4H4TA 2X3NA 2XVEA 3CT2A 4M0XA 5DBJA 1YY5A 4Z24A 4AP3A 2OVLA 2XVJA 3LOVA 1EL5A 3L1RA 4K1WA 1OJDA 2HXTA 4FK1C 2GVCA 3UOVA 4CCQA 1V59A 1XS2A 4Z1YA 4Y4LA 4HCHA 4K2SA 1Q1RA 3BSMA 1ZOYA 4J57A 3KVEA 4XWRA 3UKKA 4GDEA 4G9KA 3HYXA 2C70A 3TW9A 3MKCA 5BVAA 2R45A 2A89A 3NXLA 3OZMA 4JDRA 5EB5A 1GRGA 4IP4A 3DJGX 2PHHA 4IA5A 4ICYA 4U8LA 3CK5A 1S3BA 1KN0A 3FPZA 3IWAA 1N61C 4B68A 1GXFA 2QJJA 4IT1A 4CBQA 3Q4DA 1FFVC 3T0KA 5J60A 2QJMA 4C77A 1H7XA 4DSHA 4IP5A 1NPXA 3P93A 1TYPA 4J1OA 3AD7B 4ROPA 3AEFA 3UOZA 3BOXA 2RABA 5GRTA 1KCZA 1OJAA 5HXIA 2YWLA 1PN0A 3AE3A 1PDZA 1M6IA 3ICRA 3EF6A 4NTEA 1RVKA 1ELSA 1HYUA 3GWFA 4OPLA 3AEBA 3BJSA 3T9PA 3U9IA 1IUUA 2ZZCA 5CKUA 2NVKX 2O56A 2BYBA 4BV6A 2XFNA 4MJWA 5BRTA 4EMWA 1WUFA 2HQMA 3V76A 1F6MA 5M10A 4K7ZA 2W3RA 2CVJA 4U2SA 4G6HA 2X8HA 1N62C 4LA1A 2ACZA 4GGHA 3BI2A 1P2EA 2FBWA 2PU0A 1ZDLA 2AKZA 4H2PA 3A7RA 2FJEA 3AECA 1LVLA 4UDRA 3UGVA 1TDNA 2EQ6A 3R9UA 5KWFA 3IJQA 3K7MX 4IVMB 4IL0A 2GDQA 3NYCA 2GQFA 4H4SA 4B67A 5KRQA 3UXKA 1L0VA 3AE4A 2OG9A 1ZOVA 4ECHA 3P4QA 3HPFA 1QJDA 1PBDA 3DDMA 2C65A 3QSEA 2GF3A 3OC4A 3AD9B 2OLAA 3RITA 4DSGA 1EBGA 3IJLA 2P88A 3R25A 3DH9A 3NIXA 4E5TA 3AEGA 3V3NA 1GOSA 1NAAA 4HNCA 4J2WA 3EKGA 4ADWA 2GR3A 5GSNA 3II4A 2UZZA 2WU2A 4HPNA 4YXDA 2YG3A 4C5OA 3GWDA 2IVEA 4HNLA 4HN8A 4H4QA 1ZP0A 3T4WA 2WP5A 4Z26A 4PAAA 2HZGA 4G8TA 4J34A 5JCLA 1JDFA 4HA6A 3UKAA 2FJDA 3VR8A 2WDVA
chains in the Genus database with same CATH topology
2O9ZA 4YKGA 3ALJA 2FJAA 3DJDA 1DJQA 4H4UA 3AYIA 2YLZA 1KSSA 4OPGA 2XFQA 3EANA 1D7YA 1PBEA 4USRA 3FG2P 1B4VA 2GR2A 1LQTA 2E5VA 4FDCB 4NEWA 3D8XA 5J7XA 5KOXA 2BXSA 2R0PA 4YSZA 4Z2RA 3GMBA 3SFDA 1XPQA 2XLPA 4RG4A 4Z43A 2WESA 4REKA 3CNSA 2IVDA 3CN8A 1E1LA 3BHKA 2DKIA 1BF3A 2C7GA 1GETA 3P4RA 1EBDA 2TPRA 3EAOA 1GREA 1VDCA 2EQ7A 2X50A 1NG3A 1YQ4A 3ICSA 5IPYA 2YQUA 1TYTA 3BNMA 4UDPA 3P1WA 4H4XA 3HZLA 2VVLA 2GRTA 2X8GA 1BGJA 2CDUA 3DK4A 4H7UA 3ATRA 4A7AA 4BK3A 2IIDA 2VZ2A 2Y6RA 1YQZA 3VRDB 3AYJA 4TLZA 3SQPA 2JAEA 1O5WA 3K7QX 3C4AA 4CNJA 2ZZBA 1E7PA 1S3EA 3FMWA 3QSSA 5BULA 2Z5XA 2EQ9A 2XDOA 3SXIA 4JQ9A 3RP6A 4X9MA 3UOYA 3KA7A 3IC9A 2Q0LA 2YG6A 3T31A 4NTCA 5IQ4A 4H2RA 4H4RA 2PYXA 4UP3A 4U8JA 5JCNA 5ER0A 3ICTA 2XVHA 2JBVA 4C3YA 2VVLG 1IUWA 3DGHA 2YLXA 3HYWA 3T37A 1XANA 3VRBA 3HYVA 3GMCA 4BJZA 5KMPA 3AWIA 4O5UA 3F8RA 2GEWA 5KMRA 4LIIA 1K0IA 2WU5A 4PABA 4A65A 1GTHA 1UKVG 3CNJA 2XLUA 4D04A 4A79A 4G6GA 3NH3X 4AOSA 4WX1A 2BABA 3E1TA 2H89A 3AE7A 2QAEA 1P2HA 1CJ2A 2A8XA 2GR0A 1JRXA 2VVMA 3PVCA 4N9XA 4E0VA 5LV9A 1S7MA 3SZCA 2BA9A 1O95A 1Y56A 2JB1A 4JY2A 1K4QA 2W0HA 2OLOA 2BRYA 3LJPA 4GF7A 4J36A 1GRFA 2QCUA 3NYFA 1E6EA 4AT0A 5EBKA 2R0CA 2YVGA 2WPCA 1D4CA 3URHA 4U8NA 5FS9A 3C4NA 5U1OA 4OPUA 4B66A 3CTYA 3CPJG 2YG4A 3NN0X 2J3NA 1F8SA 2APGA 2YVJA 4U8KA 2QA1A 5HYMA 4EMIA 1DJNA 4II3A 4TM0A 3KLJA 4ZCDA 2VRLA 2R4JA 3ADAB 3SFEA 5HY5A 1ZY8A 1CC4A 3FBSA 2C72A 2ARDA 3KU9A 3NHOX 3OZ2A 5KMSA 5C3JA 4OPIA 3D1CA 3NYEA 3FIMB 1S2QA 1H81A 1JNRA 1NHSA 3IHGA 5M0ZA 3T14A 1MXTA 3ZDNA 4EQRA 1M64A 3LZWA 1PJ6A 4JNAA 2YAUA 3F8DA 4TLXA 2EQ8A 2WOWA 2JKCA 1N4VA 3NK2X 1H86A 1Q9IA 2YM1A 2BRAA 4X9NA 5EB4A 1H7WA 3KKJA 1K0JA 4KPRA 3VR9A 1TDFA 2YG7A 2C67A 4A99A 1CBOA 1FEBA 3GDPA 1NHRA 2XYOA 4U2TA 1RSGA 3H8IA 5HHFA 4H4YA 1GESA 4Z25A 1GRBA 1E1MA 3DJEA 2Q6UA 4YTMA 1Q1WA 2I0ZA 2YLRA 3NTDA 4YTPA 5EOWA 2R4EA 4YT0A 1NDAA 2YVFA 1EL7A 3AE8A 4KX6A 1PS9A 1VRQB 4EM3A 1H2IA 2BCGG 4LU6A 3COXA 4NTDA 2JB3A 3NT6A 4HB9A 2B7SA 3PO7A 4K5SA 4CBQA 4B69A 2XLTA 2B9XA 3AYLA 1GTEA 1E1NA 4IVOB 2V5ZA 3NG7X 3UKHA 2E4GA 3O0HA 4H4TA 2X3NA 3NTAA 4B63A 4AOXA 4GAVA 1SEZA 2XVEA 2GR1A 4FK1A 3GYXA 3I3LA 3KPKA 3T2ZA 4OCGA 4K5RA 2RGHA 5DBJA 1PXCA 1CC2A 1YY5A 1Y56B 2GQWA 1JEHA 4M52A 1JU2A 3BI5A 1Y0PA 1B37A 3GDNA 3D9XA 2GAHB 2ZBWA 4Z24A 4AP3A 3DGZA 1ONFA 4ZN0A 2CFYA 1TDOA 2XVJA 3AD8B 3H4KA 4NWZA 2WHDA 3LOVA 1EL5A 2CULA 3K30A 3CGCA 4TM3A 3L1RA 3AEAA 2Z5YA 4AT2A 1D4EA 2GMJA 2XVFA 2V6OA 2BXRA 5CQFA 4JN9A 2C64A 1Z6LA 3SX6A 3BI4A 1OJDA 1PBCA 3PS9A 3ABVA 4FK1C 1IUVA 2GVCA 3BHFA 3UOVA 4CCQA 1D5TA 5U63A 4TM4A 1KSUA 1V59A 1TDEA 2V60A 3S5WA 3P4SA 1CJCA 4AP1A 2YR4A 2WP6A 4H4VA 3LXDA 2AAQA 5FS8A 5FMHA 1FOHA 4NZHA 1BGNA 4Y4LA 4U8IA 1E39A 1Q1RA 1PJ5A 1DOEA 4G73A 2XFOA 1K0LA 4CRTA 3UP5A 2YLSA 1TRBA 1ZOYA 1ZX9A 4J57A 4H2NA 3ISHA 3KVEA 4YKFA 4XWRA 2AR8A 2OAMA 4GDEA 3SZWA 2XFPA 3UKKA 2YM2A 3AE1A 1PXAA 4G9KA 3GD3A 1FECA 1L9CA 1JRZA 2DKHA 3HYXA 4TM1A 1X31B 2R9ZA 1DOBA 2C70A 3DA1A 5BVAA 2R45A 5L46A 4EMJA 2A89A 1B8SA 3UTHA 1RYIA 5IQ1A 1O94A 2WETA 1GPEA 4JDRA 3L5OA 4P9SA 5EB5A 2OA1A 2WQYA 3ITJA 1GRGA 3CNDA 3DJGX 4K22A 2PHHA 2GAGB 1S2YA 4IA5A 2WDRA 4ICYA 3V3OA 4U8LA 1PBBA 4Z2TA 1KDGA 1S3BA 3UKLA 1KN0A 3Q9TA 4ZCCA 3FPZA 3CGEA 3IWAA 4FX9A 1GEUA 1GERA 1GXFA 3T2YA 4B68A 4CNKA 1B5QA 3RNMA 2WEUA 3QJ4A 3EPTA 2WPEA 4DNAA 1IUTA 3L8KA 2BK3A 3DK9A 4H4WA 1JRYA 2BK4A 3GD4A 1N4WA 2B7RA 3UKFA 1BWCA 4IV9A 3H8LA 3AE5A 3JSKA 3K7TA 3ALLA 3SGLA 3T0KA 2BK5A 1ZMCA 5J60A 4YTNA 3AXBA 3NK0X 3SZ0A 4C77A 4YSYA 1H7XA 1IJHA 4DSHA 1NPXA 4K2XA 1VG0A 1TYPA 1FL2A 3GSIA 2GH5A 2WPFA 5BUKA 1IUSA 3AD7B 2V3AA 1CF3A 3AEFA 5KNLA 2WOIA 4A6NA 2C66A 4EM4A 2BS3A 3ATQA 5JCKA 3UOZA 4GR1A 2RABA 5GRTA 1PHHA 3ALMA 1OJAA 2A87A 2B76A 1YQ3A 2C73A 2WP9A 4J33A 5HXIA 1JOAA 2YWLA 2XLRA 1PN0A 2F5ZA 3AE3A 5JRBA 3SZFA 1M6IA 4UDQA 2WS3A 3ICRA 3EF6A 2VOUA 2OLNA 4I58A 4NTEA 3AE6A 4H50A 4K8DA 4DGKA 4A5LA 3UKPA 1DODA 1F8RA 3AB1A 1IUXA 3LZXA 1HYUA 4GCMA 3GWFA 2C3DA 1OJCA 4J31A 4OPLA 2BCPA 3AEDA 1PJ7A 4J56A 1YKJA 3AEBA 1CJ4A 3NKSA 3VQRA 1NEKA 1LJ1A 1N1PA 1LV0A 1LQUA 1IUUA 3CIRA 4C74A 3CGBA 1N4UA 2ZZCA 4BJYA 2WOVA 1GSNA 3CNPA 1MOKA 5CKUA 4D03A 1ZMDA 2NVKX 1LPFA 4CCRA 2JB2A 2BYBA 3ZYXA 1QO8A 4U8MA 2YLWA 3GRTA 2YLTA 3M13A 4JY3A 4BV6A 3G5QA 2RGOA 2XFNA 4MJWA 5KVIA 1VQWA 3UOXA 5BRTA 1XDIA 3M12A 4JNQA 1COYA 3G5SA 3QSMA 4EMWA 1D7LA 1EL8A 2HQMA 2H88A 2BS4A 4C3XA 5C2TA 4NEVA 3V76A 1KF6A 1F3PA 1ZKQA 5FS6A 1F6MA 3CPHG 5M10A 3NRNA 4K7ZA 2GB0A 4YSXA 3NN6X 1H82A 2CVJA 4U2SA 4I59A 4G6HA 1BZLA 3WE0A 2X8HA 2WBAA 4EQXA 4LA1A 2ACZA 3QVPA 3CNTA 5KOWA 1FCDA 3BI2A 1P2EA 1LTXR 1VG9A 2FBWA 1ZDLA 1GALA 4H2PA 3S61A 1NHPA 2C75A 2FJEA 3AECA 1CL0A 2V3BA 2R46A 5KVHA 4GAPA 1LVLA 2C4CA 3I6DA 4UDRA 1TDNA 3Q6JA 2EQ6A 3R9UA 1DXLA 2X99A 1GRAA 2AQJA 5KWFA 2Q0KA 4A6NB 1PXBA 3P4PA 4OPCA 2JK6A 3REDA 3RP7A 2X8CA 2C76A 3K7MX 4II2A 5JCMA 2V61A 2WDQA 4APNA 4IVMB 1W4XA 3GRSA 2RGJA 1PDHA 3UTEA 1ZK7A 4BK1A 1FEAA 1EL9A 3NYCA 3NLCA 4Z44A 5JCIA 3LADA 5U25A 1KFYA 5TR3A 4A9WA 1MO9A 1CJ3A 1F8WA 4H4SA 1QLBA 2GQFA 4B67A 4BK2A 1H6VA 5KRQA 3T2KA 1L0VA 3AE4A 4Y4NA 2TMDA 4B65A 1ZOVA 1GV4A 2Q7VA 2B9YA 3UCLA 2VRMA 4ECHA 3RHAA 1NHQA 3P4QA 3B3RA 3BNUA 3SY4A 2XLSA 3AE2A 1QJDA 1PBDA 1DOCA 2C65A 4Y4MA 3VRAA 3G5RA 1REOA 2GF3A 3OC4A 2OALA 2XVIA 3AD9B 3AEEA 3QSEA 3CMMA 4RG3A 4H2QA 4B1BA 1NG4A 4DSGA 1TDKA 3NK1X 1BKWA 2YR6A 4XWZA 3DH9A 3KD9A 1JNZA 1KNPA 1CHUA 3UTGA 4WCTA 4EQSA 3SYIA 3UP4A 4YWOA 3NIXA 4BURA 1XHCA 2BS2A 4O5QA 1H84A 4USQA 3AEGA 4U8OA 1ELIA 3P9UA 1E1KA 2QA2A 5KMQA 3V3NA 4Z2UA 4X4JA 3DK8A 1H83A 1GOSA 1GT8A 1KNRA 1NAAA 4J2WA 4H4ZA 1RP0A 2Y6QA 1NENA 4CY8A 2XFUA 4ADWA 4CY6A 2GMHA 2GR3A 5GSNA 4XXGA 3GYJA 3DJJA 3II4A 2UZZA 2WU2A 3C96A 4IA6A 2XCGA 3CGDA 2YR5A 4YXDA 2R0GA 2YG3A 4C5OA 1CC6A 3GWDA 1AOGA 3M0OA 2BC0A 2BC1A 4H4PA 2B9WA 2IVEA 1L9EA 2VQBA 3B6DA 4B64A 2FJBA 2GV8A 3F8PA 3UKQA 5KXJA 2VQ7A 1GRHA 1OJTA 4G74A 2ZZ0A 4H4QA 2C3CA 1ZP0A 1DNCA 4GRTA 4U2LA 4GDPA 5FS7A 4U8PA 1OJ9A 3QFBA 4GUVA 2YG5A 1GRTA 3QFAA 4OPDA 2E1MA 4OVIA 3SM8A 3UTFA 4EIPA 4YSHA 3IHMA 2WP5A 4Z26A 4PAAA 3NGCX 3QVRA 4J34A 4EQWA 5JCLA 3GYIA 2NPXA 3DMEA 3CPIG 3LB8A 3RP8A 1PBFA 3AE9A 4HA6A 4RSLA 1GNDA 3KPFA 4NNJA 3IF9A 1D4DA 3UKAA 4EIQA 2FJDA 3VR8A 4OPTA 1L9DA 2BACA 3NNEA 2WDVA 3PG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9Z A;  4YKG A;  3ALJ A;  2FJA A;  3DJD A;  1DJQ A;  4H4U A;  3AYI A;  2YLZ A;  1KSS A;  4OPG A;  2XFQ A;  3EAN A;  1D7Y A;  1PBE A;  4USR A;  3FG2 P;  1B4V A;  2GR2 A;  1LQT A;  2E5V A;  4FDC B;  4NEW A;  3D8X A;  5J7X A;  5KOX A;  2BXS A;  2R0P A;  4YSZ A;  4Z2R A;  3GMB A;  3SFD A;  1XPQ A;  2XLP A;  4RG4 A;  4Z43 A;  2WES A;  4REK A;  3CNS A;  2IVD A;  3CN8 A;  1E1L A;  3BHK A;  2DKI A;  1BF3 A;  2C7G A;  1GET A;  3P4R A;  1EBD A;  2TPR A;  3EAO A;  1GRE A;  1VDC A;  2EQ7 A;  2X50 A;  1NG3 A;  1YQ4 A;  3ICS A;  5IPY A;  2YQU A;  1TYT A;  3BNM A;  4UDP A;  3P1W A;  4H4X A;  3HZL A;  2VVL A;  2GRT A;  2X8G A;  1BGJ A;  2CDU A;  3DK4 A;  4H7U A;  3ATR A;  4A7A A;  4BK3 A;  2IID A;  2VZ2 A;  2Y6R A;  1YQZ A;  3VRD B;  3AYJ A;  4TLZ A;  3SQP A;  2JAE A;  1O5W A;  3K7Q X;  3C4A A;  4CNJ A;  2ZZB A;  1E7P A;  1S3E A;  3FMW A;  3QSS A;  5BUL A;  2Z5X A;  2EQ9 A;  2XDO A;  4JQ9 A;  3RP6 A;  4X9M A;  3UOY A;  3KA7 A;  3IC9 A;  2Q0L A;  2YG6 A;  4NTC A;  5IQ4 A;  4H2R A;  4H4R A;  2PYX A;  4UP3 A;  4U8J A;  5JCN A;  5ER0 A;  3ICT A;  2XVH A;  2JBV A;  4C3Y A;  2VVL G;  1IUW A;  3DGH A;  2YLX A;  3VRB A;  3T37 A;  1XAN A;  3GMC A;  4BJZ A;  3AWI A;  4O5U A;  3F8R A;  2GEW A;  4LII A;  1K0I A;  2WU5 A;  4PAB A;  4A65 A;  1GTH A;  1UKV G;  3CNJ A;  2XLU A;  4D04 A;  4A79 A;  3NH3 X;  4AOS A;  4WX1 A;  2BAB A;  3E1T A;  2H89 A;  3AE7 A;  2QAE A;  1P2H A;  1CJ2 A;  2A8X A;  2GR0 A;  1JRX A;  2VVM A;  3PVC A;  4N9X A;  4E0V A;  5LV9 A;  2BA9 A;  1O95 A;  1Y56 A;  2JB1 A;  4JY2 A;  1K4Q A;  2W0H A;  2OLO A;  3LJP A;  4GF7 A;  4J36 A;  1GRF A;  2QCU A;  3NYF A;  1E6E A;  4AT0 A;  5EBK A;  2R0C A;  2YVG A;  2WPC A;  1D4C A;  3URH A;  4U8N A;  5FS9 A;  3C4N A;  5U1O A;  4OPU A;  4B66 A;  3CTY A;  3CPJ G;  2YG4 A;  3NN0 X;  2J3N A;  1F8S A;  2APG A;  2YVJ A;  4U8K A;  2QA1 A;  5HYM A;  4EMI A;  1DJN A;  4TM0 A;  3KLJ A;  4ZCD A;  2VRL A;  2R4J A;  3ADA B;  3SFE A;  5HY5 A;  1ZY8 A;  1CC4 A;  3FBS A;  2C72 A;  2ARD A;  3KU9 A;  3NHO X;  3OZ2 A;  5C3J A;  4OPI A;  3D1C A;  3NYE A;  3FIM B;  1S2Q A;  1H81 A;  1JNR A;  1NHS A;  3IHG A;  5M0Z A;  1MXT A;  3ZDN A;  4EQR A;  1M64 A;  3LZW A;  1PJ6 A;  4JNA A;  2YAU A;  3F8D A;  4TLX A;  2EQ8 A;  2WOW A;  2JKC A;  1N4V A;  3NK2 X;  1H86 A;  1Q9I A;  2YM1 A;  4X9N A;  5EB4 A;  1H7W A;  3KKJ A;  1K0J A;  4KPR A;  3VR9 A;  1TDF A;  2YG7 A;  2C67 A;  4A99 A;  1CBO A;  1FEB A;  3GDP A;  1NHR A;  2XYO A;  4U2T A;  1RSG A;  3H8I A;  5HHF A;  4H4Y A;  1GES A;  4Z25 A;  1GRB A;  1E1M A;  3DJE A;  2Q6U A;  4YTM A;  1Q1W A;  2I0Z A;  2YLR A;  3NTD A;  4YTP A;  5EOW A;  2R4E A;  4YT0 A;  1NDA A;  2YVF A;  1EL7 A;  3AE8 A;  4KX6 A;  1PS9 A;  1VRQ B;  4EM3 A;  2BCG G;  4LU6 A;  3COX A;  4NTD A;  2JB3 A;  3NT6 A;  4HB9 A;  2B7S A;  3PO7 A;  4K5S A;  4CBQ A;  4B69 A;  2XLT A;  2B9X A;  3AYL A;  1GTE A;  1E1N A;  4IVO B;  2V5Z A;  3NG7 X;  3UKH A;  2E4G A;  3O0H A;  4H4T A;  2X3N A;  3NTA A;  4B63 A;  4AOX A;  1SEZ A;  2XVE A;  2GR1 A;  4FK1 A;  3I3L A;  4OCG A;  4K5R A;  2RGH A;  5DBJ A;  1PXC A;  1CC2 A;  1YY5 A;  1Y56 B;  2GQW A;  1JEH A;  4M52 A;  1JU2 A;  3BI5 A;  1Y0P A;  1B37 A;  3GDN A;  2GAH B;  2ZBW A;  4Z24 A;  4AP3 A;  3DGZ A;  1ONF A;  4ZN0 A;  2CFY A;  1TDO A;  2XVJ A;  3AD8 B;  3H4K A;  2WHD A;  3LOV A;  1EL5 A;  2CUL A;  3K30 A;  3CGC A;  4TM3 A;  3L1R A;  3AEA A;  2Z5Y A;  4AT2 A;  1D4E A;  2GMJ A;  2XVF A;  2V6O A;  2BXR A;  5CQF A;  4JN9 A;  2C64 A;  1Z6L A;  3BI4 A;  1OJD A;  1PBC A;  3PS9 A;  3ABV A;  4FK1 C;  1IUV A;  2GVC A;  3BHF A;  3UOV A;  4CCQ A;  1D5T A;  5U63 A;  4TM4 A;  1KSU A;  1V59 A;  1TDE A;  2V60 A;  3S5W A;  3P4S A;  1CJC A;  4AP1 A;  2YR4 A;  2WP6 A;  4H4V A;  3LXD A;  2AAQ A;  5FS8 A;  5FMH A;  1FOH A;  4NZH A;  1BGN A;  4Y4L A;  4U8I A;  1E39 A;  1Q1R A;  1PJ5 A;  1DOE A;  2XFO A;  1K0L A;  4CRT A;  3UP5 A;  2YLS A;  1TRB A;  1ZOY A;  1ZX9 A;  4J57 A;  4H2N A;  3ISH A;  3KVE A;  4YKF A;  4XWR A;  2AR8 A;  2OAM A;  4GDE A;  3UKK A;  2XFP A;  2YM2 A;  3AE1 A;  1PXA A;  3GD3 A;  1FEC A;  1L9C A;  1JRZ A;  2DKH A;  4TM1 A;  1X31 B;  2R9Z A;  1DOB A;  2C70 A;  3DA1 A;  5BVA A;  2R45 A;  5L46 A;  4EMJ A;  2A89 A;  1B8S A;  3UTH A;  1RYI A;  5IQ1 A;  1O94 A;  2WET A;  1GPE A;  4JDR A;  4P9S A;  5EB5 A;  2OA1 A;  2WQY A;  3ITJ A;  1GRG A;  3CND A;  3DJG X;  4K22 A;  2PHH A;  2GAG B;  1S2Y A;  4IA5 A;  2WDR A;  4ICY A;  3V3O A;  4U8L A;  1PBB A;  4Z2T A;  1KDG A;  1S3B A;  3UKL A;  3Q9T A;  4ZCC A;  3FPZ A;  3CGE A;  3IWA A;  4FX9 A;  1GEU A;  1GER A;  1GXF A;  4B68 A;  4CNK A;  1B5Q A;  3RNM A;  2WEU A;  3QJ4 A;  3EPT A;  2WPE A;  4DNA A;  1IUT A;  3L8K A;  2BK3 A;  3DK9 A;  4H4W A;  1JRY A;  2BK4 A;  3GD4 A;  1N4W A;  2B7R A;  3UKF A;  1BWC A;  4IV9 A;  3H8L A;  3AE5 A;  3JSK A;  3K7T A;  3ALL A;  3SGL A;  2BK5 A;  1ZMC A;  5J60 A;  4YTN A;  3AXB A;  3NK0 X;  4YSY A;  4C77 A;  1H7X A;  1IJH A;  4DSH A;  1NPX A;  4K2X A;  1VG0 A;  1TYP A;  1FL2 A;  3GSI A;  2GH5 A;  2WPF A;  5BUK A;  1IUS A;  3AD7 B;  2V3A A;  1CF3 A;  3AEF A;  2WOI A;  4A6N A;  2C66 A;  4EM4 A;  2BS3 A;  3ATQ A;  5JCK A;  3UOZ A;  4GR1 A;  2RAB A;  5GRT A;  1PHH A;  3ALM A;  1OJA A;  2A87 A;  2B76 A;  1YQ3 A;  2C73 A;  2WP9 A;  4J33 A;  5HXI A;  1JOA A;  2YWL A;  2XLR A;  1PN0 A;  2F5Z A;  3AE3 A;  1M6I A;  4UDQ A;  2WS3 A;  3ICR A;  3EF6 A;  2VOU A;  2OLN A;  4I58 A;  4NTE A;  3AE6 A;  4H50 A;  4K8D A;  4DGK A;  4A5L A;  3UKP A;  1DOD A;  1F8R A;  3AB1 A;  1IUX A;  3LZX A;  1HYU A;  4GCM A;  3GWF A;  2C3D A;  1OJC A;  4J31 A;  4OPL A;  2BCP A;  3AED A;  1PJ7 A;  4J56 A;  1YKJ A;  3AEB A;  1CJ4 A;  3NKS A;  3VQR A;  1NEK A;  1LJ1 A;  1N1P A;  1LV0 A;  1LQU A;  1IUU A;  3CIR A;  4C74 A;  3CGB A;  1N4U A;  2ZZC A;  4BJY A;  2WOV A;  1GSN A;  3CNP A;  1MOK A;  5CKU A;  4D03 A;  1ZMD A;  2NVK X;  1LPF A;  4CCR A;  2JB2 A;  2BYB A;  3ZYX A;  1QO8 A;  4U8M A;  2YLW A;  3GRT A;  2YLT A;  3M13 A;  4JY3 A;  4BV6 A;  3G5Q A;  2RGO A;  2XFN A;  4MJW A;  5KVI A;  1VQW A;  3UOX A;  5BRT A;  1XDI A;  3M12 A;  4JNQ A;  1COY A;  3G5S A;  3QSM A;  4EMW A;  1D7L A;  1EL8 A;  2HQM A;  2H88 A;  2BS4 A;  4C3X A;  5C2T A;  4NEV A;  3V76 A;  1KF6 A;  1F3P A;  1ZKQ A;  5FS6 A;  1F6M A;  3CPH G;  5M10 A;  3NRN A;  4K7Z A;  2GB0 A;  4YSX A;  3NN6 X;  1H82 A;  2CVJ A;  4U2S A;  4I59 A;  3WE0 A;  1BZL A;  2X8H A;  2WBA A;  4EQX A;  4LA1 A;  2ACZ A;  3QVP A;  3CNT A;  5KOW A;  1FCD A;  3BI2 A;  1P2E A;  1LTX R;  1VG9 A;  2FBW A;  1ZDL A;  1GAL A;  4H2P A;  3S61 A;  1NHP A;  2C75 A;  2FJE A;  3AEC A;  1CL0 A;  2R46 A;  2V3B A;  5KVH A;  1LVL A;  3I6D A;  4UDR A;  1TDN A;  3Q6J A;  2EQ6 A;  3R9U A;  1DXL A;  2X99 A;  1GRA A;  2AQJ A;  5KWF A;  2Q0K A;  4A6N B;  1PXB A;  3P4P A;  4OPC A;  2JK6 A;  3RED A;  3RP7 A;  2X8C A;  2C76 A;  3K7M X;  5JCM A;  2V61 A;  2WDQ A;  4APN A;  4IVM B;  1W4X A;  3GRS A;  2RGJ A;  1PDH A;  3UTE A;  1ZK7 A;  4BK1 A;  1FEA A;  1EL9 A;  3NYC A;  3NLC A;  4Z44 A;  5JCI A;  3LAD A;  5U25 A;  1KFY A;  5TR3 A;  4A9W A;  1MO9 A;  1CJ3 A;  1F8W A;  4H4S A;  1QLB A;  2GQF A;  4B67 A;  4BK2 A;  1H6V A;  5KRQ A;  1L0V A;  3AE4 A;  4Y4N A;  2TMD A;  4B65 A;  1ZOV A;  1GV4 A;  2Q7V A;  2B9Y A;  3UCL A;  2VRM A;  4ECH A;  3RHA A;  1NHQ A;  3P4Q A;  3B3R A;  3BNU A;  2XLS A;  3AE2 A;  1QJD A;  1PBD A;  1DOC A;  2C65 A;  4Y4M A;  3VRA A;  3G5R A;  1REO A;  2GF3 A;  3OC4 A;  2OAL A;  2XVI A;  3AD9 B;  3AEE A;  3QSE A;  4RG3 A;  4H2Q A;  4B1B A;  1NG4 A;  4DSG A;  1TDK A;  3NK1 X;  1BKW A;  2YR6 A;  4XWZ A;  3DH9 A;  3KD9 A;  1JNZ A;  1KNP A;  1CHU A;  3UTG A;  4WCT A;  4EQS A;  3UP4 A;  4YWO A;  3NIX A;  4BUR A;  1XHC A;  2BS2 A;  4O5Q A;  1H84 A;  4USQ A;  3AEG A;  4U8O A;  1ELI A;  3P9U A;  1E1K A;  2QA2 A;  4Z2U A;  3V3N A;  4X4J A;  3DK8 A;  1H83 A;  1GOS A;  1GT8 A;  1KNR A;  1NAA A;  4J2W A;  4H4Z A;  1RP0 A;  2Y6Q A;  1NEN A;  4CY8 A;  2XFU A;  4ADW A;  4CY6 A;  2GMH A;  2GR3 A;  5GSN A;  4XXG A;  3GYJ A;  3DJJ A;  3II4 A;  2UZZ A;  2WU2 A;  3C96 A;  4IA6 A;  2XCG A;  3CGD A;  2YR5 A;  4YXD A;  2R0G A;  2YG3 A;  4C5O A;  1CC6 A;  3GWD A;  1AOG A;  3M0O A;  2BC0 A;  2BC1 A;  4H4P A;  2B9W A;  2IVE A;  1L9E A;  2VQB A;  3B6D A;  4B64 A;  2FJB A;  2GV8 A;  3F8P A;  3UKQ A;  5KXJ A;  2VQ7 A;  1GRH A;  1OJT A;  2ZZ0 A;  4H4Q A;  2C3C A;  1ZP0 A;  1DNC A;  4GRT A;  4U2L A;  4GDP A;  5FS7 A;  4U8P A;  1OJ9 A;  3QFB A;  4GUV A;  2YG5 A;  1GRT A;  3QFA A;  4OPD A;  2E1M A;  4OVI A;  3SM8 A;  3UTF A;  4EIP A;  4YSH A;  3IHM A;  2WP5 A;  4Z26 A;  4PAA A;  3NGC X;  3QVR A;  4J34 A;  4EQW A;  5JCL A;  3GYI A;  2NPX A;  3DME A;  3CPI G;  3LB8 A;  3RP8 A;  1PBF A;  3AE9 A;  4HA6 A;  4RSL A;  1GND A;  3KPF A;  3IF9 A;  1D4D A;  3UKA A;  4EIQ A;  2FJD A;  3VR8 A;  4OPT A;  1L9D A;  2BAC A;  3NNE A;  2WDV A; 
#chains in the Genus database with same CATH topology
 3SR6 B;  4FI4 A;  1KSS A;  3UJF A;  2ZC8 A;  3EAN A;  1PBE A;  4USR A;  3FG2 P;  2GR2 A;  5J7X A;  2BXS A;  3TWA A;  3A7A A;  3DFY A;  1ONE A;  4YSZ A;  3R1Z A;  4Z43 A;  2GGI A;  2QDD A;  1P48 A;  1EBD A;  2TPR A;  3P3B A;  3ICS A;  2EQ7 A;  2POZ A;  2VVL A;  4H7U A;  4A7A A;  3DG6 A;  2Y6R A;  1KD0 A;  3AYJ A;  1O5W A;  4CNJ A;  3FMW A;  1E7P A;  1S3E A;  3QSS A;  3SXI A;  2EQ9 A;  3RP6 A;  3IC9 A;  2OZ8 A;  3OTR A;  4H4R A;  2PYX A;  5JCN A;  3STP A;  4ZA0 A;  3HYW A;  3VRB A;  3T37 A;  5KMP A;  3VCN A;  5EU9 A;  5KMR A;  1GTH A;  5BOF A;  3E1T A;  2H89 A;  2GR0 A;  3PVC A;  2VVM A;  1S7M A;  1K4Q A;  3V4B A;  4GME A;  1GRF A;  1E6E A;  5EBK A;  2R0C A;  5U1O A;  4OPU A;  1JPM A;  3ZVH A;  3NN0 X;  2APG A;  2QA1 A;  4II3 A;  3KLJ A;  4Z17 A;  2VRL A;  2XH2 A;  5HY5 A;  2ARD A;  2PU1 A;  1H81 A;  3CAW A;  2YAU A;  3P0W A;  3OP2 A;  3UCD A;  3NK2 X;  2YM1 A;  3AM9 A;  1K0J A;  2C67 A;  4A99 A;  2XYO A;  1RSG A;  4H4Y A;  4YTM A;  2I0Z A;  2YLR A;  4YT0 A;  4KX6 A;  3AE8 A;  1H2I A;  2BCG G;  4LU6 A;  2W55 A;  2B7S A;  1E9I A;  4E8G A;  5J04 A;  1EC9 A;  2XGZ A;  1MDL A;  4IVO B;  3UKH A;  4AOX A;  3KPK A;  3D46 A;  4OCG A;  3T2Z A;  1PXC A;  1Y56 B;  3BI5 A;  1Y0P A;  1B37 A;  3D9X A;  4DHG A;  4ZN0 A;  3DGZ A;  4H1Z A;  3H4K A;  4ZCW A;  3ZLH A;  3AD8 B;  4NWZ A;  2CUL A;  3K30 A;  2GMJ A;  2HXU A;  3K1G A;  4JN9 A;  2C64 A;  1N5W C;  3PS9 A;  2OZT A;  4TM4 A;  1KSU A;  4KT2 A;  3P4S A;  4AP1 A;  2WP6 A;  4DX3 A;  1FHU A;  4H4V A;  5FS8 A;  1FOH A;  4NZH A;  4KEM A;  4U8I A;  4G73 A;  1DOE A;  2XFO A;  4CRT A;  2YLS A;  1JRP A;  4YWS A;  2W3S A;  2AR8 A;  2YM2 A;  3FYY A;  3GD3 A;  1FEC A;  1JRZ A;  1TKK A;  1X31 B;  2R9Z A;  3DA1 A;  3V3W A;  1B8S A;  2WET A;  2OA1 A;  4IL2 A;  3VDG A;  3FCP A;  1S2Y A;  4Z2T A;  1KDG A;  1GER A;  4DNA A;  1IUT A;  3UKF A;  3GD4 A;  2B7R A;  4IV9 A;  3H8L A;  3AE5 A;  3JW7 A;  3AN1 A;  4IHC A;  2BK5 A;  1ZMC A;  4K2X A;  1VG0 A;  3RR1 A;  1FL2 A;  5BUK A;  3CXB A;  1CF3 A;  5KNL A;  2WOI A;  3CYJ A;  4A6N A;  4EM4 A;  1N60 C;  5JCK A;  1PHH A;  3ALM A;  2B76 A;  4J33 A;  2XLR A;  2NQL A;  2PMQ A;  3SZF A;  2P8C A;  3I4K A;  2OLN A;  3AE6 A;  4A5L A;  1DOD A;  3ZLF A;  1OJC A;  1YKJ A;  1CJ4 A;  3VQR A;  1N1P A;  1LQU A;  4BJY A;  1GSN A;  1ZMD A;  4CCR A;  2JB2 A;  1QO8 A;  3FVD A;  3IK4 A;  3V5C A;  3GO2 A;  1VQW A;  3M12 A;  3G5S A;  4HCL A;  1EL8 A;  1F3P A;  5FS6 A;  3NRN A;  4YSX A;  1EBH A;  3WE0 A;  1BZL A;  3DG7 A;  3QKE A;  3ENL A;  3CNT A;  5KOW A;  1LTX R;  1GAL A;  1NHP A;  1FIQ B;  3Q6J A;  1GRA A;  3RRA A;  3RED A;  3P4P A;  4OPC A;  3R0K A;  4II2 A;  5JCM A;  4APN A;  3CXO A;  1DTN A;  3JZU A;  1ZK7 A;  1FEA A;  3NLC A;  4Z44 A;  5JCI A;  3LAD A;  5U25 A;  4KWS A;  1MO9 A;  1F8W A;  1QLB A;  1H6V A;  3SN0 A;  1GV4 A;  3FV9 A;  2P8B A;  2Q7V A;  3RHA A;  4GYP A;  3BNU A;  3SY4 A;  4Y4M A;  3AE2 A;  3VRA A;  3AEE A;  3NVZ B;  4B1B A;  3ZVI A;  1NG4 A;  1TDK A;  3NK1 X;  1BKW A;  2YR6 A;  2AL1 A;  3S47 A;  3KD9 A;  1KNP A;  1CHU A;  4EQS A;  3UP4 A;  2BS2 A;  1H84 A;  3R11 A;  1E1K A;  2QA2 A;  5KMQ A;  4Z2U A;  1H83 A;  3ES8 A;  2OPJ A;  3NS1 B;  1NEN A;  2XFU A;  2GMH A;  3C96 A;  4IA6 A;  3PK7 A;  1CC6 A;  4H4P A;  2B9W A;  5FJP A;  2VQB A;  4B64 A;  1BQG A;  2ZZ0 A;  4G7F A;  4U2L A;  5FS7 A;  3MZN A;  4U8P A;  1OJ9 A;  3QFB A;  4GUV A;  2YG5 A;  3QFA A;  2E1M A;  4OVI A;  3NGC X;  3QVR A;  2AL2 A;  4EQW A;  3SBF A;  3GYI A;  3LB8 A;  3RP8 A;  3AE9 A;  3IF9 A;  3SN4 A;  1L9D A;  2BAC A;  2ONE A;  2O9Z A;  4YKG A;  1KKO A;  3DJD A;  3I6T A;  4NEW A;  5KOX A;  2R0P A;  1MRA A;  1R6W A;  4RG4 A;  2IVD A;  1GET A;  3EAO A;  1GRE A;  2X50 A;  1YQ4 A;  5IPY A;  1TYT A;  3DIP A;  3P1W A;  4H4X A;  2GRT A;  1BGJ A;  2VZ2 A;  3OZY A;  4TLZ A;  2XSX A;  3C4A A;  2XDO A;  4JQ9 A;  4DWD A;  4X9M A;  3UOY A;  3T31 A;  5IQ4 A;  3ICT A;  2JBV A;  3DGH A;  3QLD A;  4BJZ A;  4O5U A;  4MMW A;  2GEW A;  1FHV A;  1K0I A;  4D04 A;  2XLU A;  4A79 A;  3NH3 X;  2BAB A;  1P2H A;  2A8X A;  2BA9 A;  3DFH A;  2JB1 A;  3PFR A;  2W0H A;  2OLO A;  2P3Z A;  2QCU A;  3NYF A;  2PGW A;  4AT0 A;  2PA6 A;  2YVG A;  4U8N A;  5FS9 A;  4GGB A;  3CPJ G;  5HYM A;  3NFU A;  4EMI A;  3ES7 A;  1JPD X;  4JN8 A;  3N4E A;  3SFE A;  2R4J A;  2AKM A;  3KU9 A;  4OPI A;  3IHG A;  1JNR A;  1NHS A;  3FJ4 A;  1MXT A;  3U4F A;  4EQR A;  4JNA A;  3F8D A;  4TLX A;  2EQ8 A;  3HRD C;  5EB4 A;  1TDF A;  1CBO A;  3SJN A;  2PSN A;  2QVH A;  3DJE A;  3N4F A;  1Q1W A;  4YTP A;  3T6C A;  1VRQ B;  4NTD A;  4HB9 A;  4K5S A;  3RGT A;  1GTE A;  4TVY A;  2V5Z A;  3NG7 X;  3T8Q A;  2RDX A;  1SEZ A;  4FK1 A;  3I3L A;  4K5R A;  2RGH A;  1CC2 A;  4M52 A;  1JEH A;  1JU2 A;  5FJO A;  2PS2 A;  2GAH B;  2ZBW A;  1ONF A;  2CFY A;  1TDO A;  3CGC A;  3MWC A;  2V6O A;  3VFC A;  3ZVH B;  3SX6 A;  1N5X A;  3BI4 A;  1IUV A;  1TDE A;  2V60 A;  3S5W A;  1CJC A;  1TE6 A;  3RO6 A;  4K8G A;  4E6M A;  3R0U A;  3H8A A;  1E39 A;  1PJ5 A;  2OKT A;  3UP5 A;  3V5F A;  3RCY A;  4H2N A;  4YKF A;  3SZW A;  1PXA A;  1L9C A;  2DKH A;  3TJ4 A;  3B9J B;  3NRZ B;  5L46 A;  3UTH A;  3ETR B;  3SQS A;  1RYI A;  5IQ1 A;  1O94 A;  3CB3 A;  1GPE A;  2WQY A;  3ITJ A;  4K22 A;  2GAG B;  2WDR A;  3UKL A;  3Q9T A;  3Q45 A;  4FX9 A;  1GEU A;  3T2Y A;  4CNK A;  1B5Q A;  2WEU A;  3TCS A;  1YEY A;  3QJ4 A;  3EPT A;  2WPE A;  3L8K A;  3DK9 A;  2BK4 A;  1N4W A;  1BWC A;  3JSK A;  3ALL A;  1KKR A;  3NK0 X;  3QN3 A;  1IJH A;  3R10 A;  3GSI A;  1IUS A;  2V3A A;  2C66 A;  2BS3 A;  3GY1 A;  4GR1 A;  3MSY A;  1X2G A;  2C73 A;  1YQ3 A;  2WP9 A;  1JOA A;  2GL5 A;  4KPL A;  2WS3 A;  2VOU A;  4I58 A;  1X2H A;  4K8D A;  3UKP A;  3AB1 A;  3LZX A;  4HYR A;  1ZXI C;  2C3D A;  3VC5 A;  2BCP A;  4J56 A;  3NKS A;  1NEK A;  1STZ A;  3CIR A;  4C74 A;  1N4U A;  3CNP A;  1MOK A;  1PDY A;  4U8M A;  3ZYX A;  2YLW A;  3GRT A;  2YLT A;  4JY3 A;  1JCT A;  5KVI A;  1SJD A;  1XDI A;  4JNQ A;  1COY A;  3QSM A;  1SJA A;  2BS4 A;  5C2T A;  1ZKQ A;  3CPH G;  2GB0 A;  3NN6 X;  1NEL A;  1H82 A;  4I59 A;  3TOY A;  1VG9 A;  4A6G A;  3S61 A;  1CL0 A;  2R46 A;  4GAP A;  3I6D A;  2X99 A;  2W54 A;  4H19 A;  2DW7 A;  2Q0K A;  4A3R A;  4A6N B;  1PXB A;  3RP7 A;  2X8C A;  2C76 A;  2PCE A;  1PDH A;  4BK1 A;  1EL9 A;  3NVY B;  1KFY A;  3H70 A;  2TMD A;  4B65 A;  2VRM A;  3OW1 A;  1NHQ A;  2XLS A;  3G5R A;  2XVI A;  1REO A;  3MQT A;  1VQZ A;  4H2Q A;  1NU5 A;  5BOE A;  3UTG A;  4WCT A;  4YWO A;  4GIR A;  4O5Q A;  3I6E A;  1ELI A;  4X4J A;  3DK8 A;  4CY8 A;  4ZOH B;  3DJJ A;  2XCG A;  3CGD A;  2YR5 A;  2R0G A;  1AOG A;  3M0O A;  2BC1 A;  1L9E A;  2P0I A;  3B6D A;  2FJB A;  3UKQ A;  2VQ7 A;  1GRH A;  1OJT A;  3D47 A;  2C3C A;  4GRT A;  4GDP A;  1GRT A;  4EIP A;  1ECQ A;  2FKP A;  4DXK A;  3DME A;  3CPI G;  4RSL A;  3QPE A;  1PBF A;  1GND A;  4NNJ A;  1D4D A;  2QQ6 A;  4EIQ A;  4OPT A;  3NNE A;  3PG6 A;  3EUB 3;  3ALJ A;  4H2H A;  1DJQ A;  2XH0 A;  2YLZ A;  4OPG A;  3THU A;  2E5V A;  2E3T A;  4FDC B;  3GMB A;  3SFD A;  1XPQ A;  2WES A;  4REK A;  3CNS A;  1EC7 A;  1E1L A;  3BHK A;  2DKI A;  1BF3 A;  3P4R A;  2PPG A;  1VDC A;  2YQU A;  4DN1 A;  4UDP A;  4E4F A;  2X8G A;  1F9C A;  2CDU A;  3ATR A;  4BK3 A;  2IID A;  1YQZ A;  3VRD B;  3SQP A;  6ENL A;  2JAE A;  5BUL A;  2Z5X A;  3R07 C;  3KA7 A;  2YG6 A;  2ZAD A;  4NTC A;  1SB3 B;  4UP3 A;  4U8J A;  5ER0 A;  4JHM A;  4C3Y A;  1XAN A;  3HYV A;  4MKS A;  2XH4 A;  5G5H B;  3F8R A;  3PWG A;  3N6H A;  4LII A;  4PAB A;  4A65 A;  4G6G A;  3QTP A;  2PGE A;  3AE7 A;  2QAE A;  1CJ2 A;  2AL2 B;  1MDR A;  5LV9 A;  4JY2 A;  2XH7 A;  5ENL A;  3LJP A;  4FP1 A;  4J36 A;  1D4C A;  2WPC A;  3CTY A;  2YG4 A;  3DES A;  4U8K A;  4TM0 A;  1DJN A;  4ZCD A;  5IDZ A;  3ADA B;  2FYM A;  1ZY8 A;  1CC4 A;  3FBS A;  2C72 A;  3NHO X;  3UJR A;  3OZ2 A;  3FIM B;  1S2Q A;  5M0Z A;  3T14 A;  2PP0 A;  3ZDN A;  1M64 A;  1EC8 A;  4GIS A;  2PTZ A;  2OQH A;  1Q9I A;  3UCC A;  1JRO A;  4DYE A;  1FEB A;  1NHR A;  1RM6 B;  4U2T A;  3H8I A;  5HHF A;  3NVV B;  1GES A;  4Z25 A;  1GRB A;  1WYG A;  5EOW A;  2R4E A;  1NDA A;  3FXG A;  3COX A;  2JB3 A;  3NT6 A;  3PO7 A;  2XLT A;  2B9X A;  3AYL A;  1OEP A;  1E1N A;  3O0H A;  3NTA A;  4GAV A;  3JVA A;  2GR1 A;  3GYX A;  2QDE A;  2GQW A;  3TQP A;  4HCD A;  3GDN A;  3NO1 A;  2WHD A;  2PTY A;  4TM3 A;  3KUM A;  3AEA A;  2Z5Y A;  4IZG A;  4AT2 A;  1D4E A;  2XVF A;  2BXR A;  5CQF A;  1Z6L A;  1PBC A;  3ABV A;  3BHF A;  1D5T A;  5U63 A;  2YR4 A;  3LXD A;  2AAQ A;  5FMH A;  3IJI A;  4JN7 A;  1BGN A;  3TWB A;  1K0L A;  3DGB A;  3MY9 A;  1TRB A;  1ZX9 A;  3ISH A;  2OAM A;  2XFP A;  3AE1 A;  4TM1 A;  1DOB A;  3DG3 A;  4A35 A;  2GSH A;  4EMJ A;  2HNE A;  1XPY A;  3L5O A;  4MGG A;  4P9S A;  2POD A;  3CND A;  3V3O A;  3DER A;  1PBB A;  1BKH A;  2GGG A;  4ZCC A;  3CGE A;  3EEZ A;  3RNM A;  2BK3 A;  1JRY A;  4H4W A;  3K7T A;  3SGL A;  2GGJ A;  4YTN A;  3AXB A;  3SZ0 A;  4YSY A;  5FJT A;  2GH5 A;  2WPF A;  2OQY A;  3PWI A;  3ATQ A;  2A87 A;  2PP1 A;  2F5Z A;  1MNS A;  5JRB A;  4UDQ A;  4F4R A;  3NZG A;  4H50 A;  4DGK A;  1F8R A;  1IUX A;  4GCM A;  5FJR A;  4J31 A;  3AED A;  1PJ7 A;  2OO6 A;  1LJ1 A;  1LV0 A;  3CGB A;  2WOV A;  3OPS A;  4D03 A;  1LPF A;  3M13 A;  3UJS A;  3G5Q A;  2RGO A;  3UOX A;  3SSZ A;  1D7L A;  2H88 A;  4C3X A;  4NEV A;  1KF6 A;  4X2P A;  3GC2 A;  2WBA A;  4EQX A;  3QVP A;  3N6J A;  1FCD A;  4E4U A;  2C75 A;  2V3B A;  5KVH A;  2C4C A;  1WUE A;  1DXL A;  3AMZ A;  2AQJ A;  2MUC A;  2JK6 A;  2WDQ A;  2V61 A;  1W4X A;  3GRS A;  2RGJ A;  3H12 A;  3UTE A;  3ZLG A;  2GGE A;  5TR3 A;  3MUC A;  4A9W A;  1CJ3 A;  4BK2 A;  7ENL A;  3T2K A;  4Y4N A;  2B9Y A;  3UCL A;  3B3R A;  1DOC A;  1L8P A;  2OAL A;  4RG3 A;  2DW6 A;  3CMM A;  3UJE A;  2E5A A;  4H83 A;  4XWZ A;  1JNZ A;  3SYI A;  5FJU A;  1N63 C;  4BUR A;  1XHC A;  4USQ A;  4U8O A;  4GYP C;  3P9U A;  1V97 A;  2GGH A;  1KNR A;  1GT8 A;  4H4Z A;  1RP0 A;  2Y6Q A;  2OFJ A;  1SJB A;  4CY6 A;  1VDV A;  1FO4 A;  4XXG A;  3GYJ A;  3A7U A;  3HW2 A;  2BC0 A;  2PP3 A;  2GV8 A;  3F8P A;  5KXJ A;  4G74 A;  2OZ3 A;  2PTW A;  1DNC A;  4OPD A;  3SM8 A;  3UTF A;  4YSH A;  3VA8 A;  3IHM A;  2NPX A;  4M6U A;  3KPF A;  1IYX A;  2FJA A;  4H4U A;  3AYI A;  2XFQ A;  3UJ2 A;  1SJC A;  1D7Y A;  1MUC A;  4ENL A;  1B4V A;  3H7V A;  1LQT A;  1R0M A;  3D8X A;  2PTX A;  4Z2R A;  3SN1 A;  2XLP A;  3CN8 A;  1T3Q C;  2C7G A;  4J3Z A;  1NG3 A;  4TVW A;  4EWJ A;  3BNM A;  4GFI A;  3HZL A;  3DK4 A;  3TTE A;  1W6T A;  3K7Q X;  2ZZB A;  2Q0L A;  3UXL A;  4H2R A;  1FFU C;  2XVH A;  3DEQ A;  2VVL G;  1IUW A;  2YLX A;  1TZZ A;  3GMC A;  3AWI A;  2WU5 A;  1UKV G;  3CNJ A;  4AOS A;  4WX1 A;  2QGY A;  1JRX A;  4E0V A;  4N9X A;  3SZC A;  1O95 A;  1Y56 A;  2QJN A;  2BRY A;  4GF7 A;  3URH A;  3C4N A;  4B66 A;  3S5S A;  2J3N A;  1F8S A;  3GD6 A;  2YVJ A;  3NVW B;  5KMS A;  5C3J A;  5G5G B;  3D1C A;  3NYE A;  2MNR A;  3LZW A;  1PJ6 A;  2WOW A;  2JKC A;  1N4V A;  1H86 A;  2BRA A;  4X9N A;  3VCC A;  1H7W A;  3KKJ A;  3VR9 A;  4KPR A;  2YG7 A;  3GDP A;  2I5Q A;  1E1M A;  2OX4 A;  2Q6U A;  2CHR A;  3NTD A;  2YVF A;  1EL7 A;  1PS9 A;  4EM3 A;  3B97 A;  4B69 A;  3VC6 A;  1P43 A;  3TJI A;  4B63 A;  2E4G A;  4H4T A;  2X3N A;  2XVE A;  3CT2 A;  4M0X A;  5DBJ A;  1YY5 A;  4Z24 A;  4AP3 A;  2OVL A;  2XVJ A;  3LOV A;  1EL5 A;  3L1R A;  4K1W A;  1OJD A;  2HXT A;  4FK1 C;  2GVC A;  3UOV A;  4CCQ A;  1V59 A;  1XS2 A;  4Z1Y A;  4Y4L A;  4HCH A;  4K2S A;  1Q1R A;  3BSM A;  1ZOY A;  4J57 A;  3KVE A;  4XWR A;  3UKK A;  4GDE A;  4G9K A;  3HYX A;  2C70 A;  3TW9 A;  3MKC A;  5BVA A;  2R45 A;  2A89 A;  3NXL A;  3OZM A;  4JDR A;  5EB5 A;  1GRG A;  4IP4 A;  3DJG X;  2PHH A;  4IA5 A;  4ICY A;  4U8L A;  3CK5 A;  1S3B A;  1KN0 A;  3FPZ A;  3IWA A;  1N61 C;  4B68 A;  1GXF A;  2QJJ A;  4IT1 A;  4CBQ A;  3Q4D A;  1FFV C;  3T0K A;  5J60 A;  2QJM A;  4C77 A;  1H7X A;  4DSH A;  4IP5 A;  1NPX A;  3P93 A;  1TYP A;  4J1O A;  3AD7 B;  4ROP A;  3AEF A;  3UOZ A;  3BOX A;  2RAB A;  5GRT A;  1KCZ A;  1OJA A;  5HXI A;  2YWL A;  1PN0 A;  3AE3 A;  1PDZ A;  1M6I A;  3ICR A;  3EF6 A;  4NTE A;  1RVK A;  1ELS A;  1HYU A;  3GWF A;  4OPL A;  3AEB A;  3BJS A;  3T9P A;  3U9I A;  1IUU A;  2ZZC A;  5CKU A;  2NVK X;  2O56 A;  2BYB A;  4BV6 A;  2XFN A;  4MJW A;  5BRT A;  4EMW A;  1WUF A;  2HQM A;  3V76 A;  1F6M A;  5M10 A;  4K7Z A;  2W3R A;  2CVJ A;  4U2S A;  4G6H A;  2X8H A;  1N62 C;  4LA1 A;  2ACZ A;  4GGH A;  3BI2 A;  1P2E A;  2FBW A;  2PU0 A;  1ZDL A;  2AKZ A;  4H2P A;  3A7R A;  2FJE A;  3AEC A;  1LVL A;  4UDR A;  3UGV A;  1TDN A;  2EQ6 A;  3R9U A;  5KWF A;  3IJQ A;  3K7M X;  4IVM B;  4IL0 A;  2GDQ A;  3NYC A;  2GQF A;  4H4S A;  4B67 A;  5KRQ A;  3UXK A;  1L0V A;  3AE4 A;  2OG9 A;  1ZOV A;  4ECH A;  3P4Q A;  3HPF A;  1QJD A;  1PBD A;  3DDM A;  2C65 A;  3QSE A;  2GF3 A;  3OC4 A;  3AD9 B;  2OLA A;  3RIT A;  4DSG A;  1EBG A;  3IJL A;  2P88 A;  3R25 A;  3DH9 A;  3NIX A;  4E5T A;  3AEG A;  3V3N A;  1GOS A;  1NAA A;  4HNC A;  4J2W A;  3EKG A;  4ADW A;  2GR3 A;  5GSN A;  3II4 A;  2UZZ A;  2WU2 A;  4HPN A;  4YXD A;  2YG3 A;  4C5O A;  3GWD A;  2IVE A;  4HNL A;  4HN8 A;  4H4Q A;  1ZP0 A;  3T4W A;  2WP5 A;  4Z26 A;  4PAA A;  2HZG A;  4G8T A;  4J34 A;  5JCL A;  1JDF A;  4HA6 A;  3UKA A;  2FJD A;  3VR8 A;  2WDV A; 
#chains in the Genus database with same CATH homology
 2O9Z A;  4YKG A;  3ALJ A;  2FJA A;  3DJD A;  1DJQ A;  4H4U A;  3AYI A;  2YLZ A;  1KSS A;  4OPG A;  2XFQ A;  3EAN A;  1D7Y A;  1PBE A;  4USR A;  3FG2 P;  1B4V A;  2GR2 A;  1LQT A;  2E5V A;  4FDC B;  4NEW A;  3D8X A;  5J7X A;  5KOX A;  2BXS A;  2R0P A;  4YSZ A;  4Z2R A;  3GMB A;  3SFD A;  1XPQ A;  2XLP A;  4RG4 A;  4Z43 A;  2WES A;  4REK A;  3CNS A;  2IVD A;  3CN8 A;  1E1L A;  3BHK A;  2DKI A;  1BF3 A;  2C7G A;  1GET A;  3P4R A;  1EBD A;  2TPR A;  3EAO A;  1GRE A;  1VDC A;  2EQ7 A;  2X50 A;  1NG3 A;  1YQ4 A;  3ICS A;  5IPY A;  2YQU A;  1TYT A;  3BNM A;  4UDP A;  3P1W A;  4H4X A;  3HZL A;  2VVL A;  2GRT A;  2X8G A;  1BGJ A;  2CDU A;  3DK4 A;  4H7U A;  3ATR A;  4A7A A;  4BK3 A;  2IID A;  2VZ2 A;  2Y6R A;  1YQZ A;  3VRD B;  3AYJ A;  4TLZ A;  3SQP A;  2JAE A;  1O5W A;  3K7Q X;  3C4A A;  4CNJ A;  2ZZB A;  1E7P A;  1S3E A;  3FMW A;  3QSS A;  5BUL A;  2Z5X A;  2EQ9 A;  2XDO A;  3SXI A;  4JQ9 A;  3RP6 A;  4X9M A;  3UOY A;  3KA7 A;  3IC9 A;  2Q0L A;  2YG6 A;  3T31 A;  4NTC A;  5IQ4 A;  4H2R A;  4H4R A;  2PYX A;  4UP3 A;  4U8J A;  5JCN A;  5ER0 A;  3ICT A;  2XVH A;  2JBV A;  4C3Y A;  2VVL G;  1IUW A;  3DGH A;  2YLX A;  3HYW A;  3T37 A;  1XAN A;  3VRB A;  3HYV A;  3GMC A;  4BJZ A;  5KMP A;  3AWI A;  4O5U A;  3F8R A;  2GEW A;  5KMR A;  4LII A;  1K0I A;  2WU5 A;  4PAB A;  4A65 A;  1GTH A;  1UKV G;  3CNJ A;  2XLU A;  4D04 A;  4A79 A;  4G6G A;  3NH3 X;  4AOS A;  4WX1 A;  2BAB A;  3E1T A;  2H89 A;  3AE7 A;  2QAE A;  1P2H A;  1CJ2 A;  2A8X A;  2GR0 A;  1JRX A;  2VVM A;  3PVC A;  4N9X A;  4E0V A;  5LV9 A;  1S7M A;  3SZC A;  2BA9 A;  1O95 A;  1Y56 A;  2JB1 A;  4JY2 A;  1K4Q A;  2W0H A;  2OLO A;  2BRY A;  3LJP A;  4GF7 A;  4J36 A;  1GRF A;  2QCU A;  3NYF A;  1E6E A;  4AT0 A;  5EBK A;  2R0C A;  2YVG A;  2WPC A;  1D4C A;  3URH A;  4U8N A;  5FS9 A;  3C4N A;  5U1O A;  4OPU A;  4B66 A;  3CTY A;  3CPJ G;  2YG4 A;  3NN0 X;  2J3N A;  1F8S A;  2APG A;  2YVJ A;  4U8K A;  2QA1 A;  5HYM A;  4EMI A;  1DJN A;  4II3 A;  4TM0 A;  3KLJ A;  4ZCD A;  2VRL A;  2R4J A;  3ADA B;  3SFE A;  5HY5 A;  1ZY8 A;  1CC4 A;  3FBS A;  2C72 A;  2ARD A;  3KU9 A;  3NHO X;  3OZ2 A;  5KMS A;  5C3J A;  4OPI A;  3D1C A;  3NYE A;  3FIM B;  1S2Q A;  1H81 A;  1JNR A;  1NHS A;  3IHG A;  5M0Z A;  3T14 A;  1MXT A;  3ZDN A;  4EQR A;  1M64 A;  3LZW A;  1PJ6 A;  4JNA A;  2YAU A;  3F8D A;  4TLX A;  2EQ8 A;  2WOW A;  2JKC A;  1N4V A;  3NK2 X;  1H86 A;  1Q9I A;  2YM1 A;  2BRA A;  4X9N A;  5EB4 A;  1H7W A;  3KKJ A;  1K0J A;  4KPR A;  3VR9 A;  1TDF A;  2YG7 A;  2C67 A;  4A99 A;  1CBO A;  1FEB A;  3GDP A;  1NHR A;  2XYO A;  4U2T A;  1RSG A;  3H8I A;  5HHF A;  4H4Y A;  1GES A;  4Z25 A;  1GRB A;  1E1M A;  3DJE A;  2Q6U A;  4YTM A;  1Q1W A;  2I0Z A;  2YLR A;  3NTD A;  4YTP A;  5EOW A;  2R4E A;  4YT0 A;  1NDA A;  2YVF A;  1EL7 A;  3AE8 A;  4KX6 A;  1PS9 A;  1VRQ B;  4EM3 A;  1H2I A;  2BCG G;  4LU6 A;  3COX A;  4NTD A;  2JB3 A;  3NT6 A;  4HB9 A;  2B7S A;  3PO7 A;  4K5S A;  4CBQ A;  4B69 A;  2XLT A;  2B9X A;  3AYL A;  1GTE A;  1E1N A;  4IVO B;  2V5Z A;  3NG7 X;  3UKH A;  2E4G A;  3O0H A;  4H4T A;  2X3N A;  3NTA A;  4B63 A;  4AOX A;  4GAV A;  1SEZ A;  2XVE A;  2GR1 A;  4FK1 A;  3GYX A;  3I3L A;  3KPK A;  3T2Z A;  4OCG A;  4K5R A;  2RGH A;  5DBJ A;  1PXC A;  1CC2 A;  1YY5 A;  1Y56 B;  2GQW A;  1JEH A;  4M52 A;  1JU2 A;  3BI5 A;  1Y0P A;  1B37 A;  3GDN A;  3D9X A;  2GAH B;  2ZBW A;  4Z24 A;  4AP3 A;  3DGZ A;  1ONF A;  4ZN0 A;  2CFY A;  1TDO A;  2XVJ A;  3AD8 B;  3H4K A;  4NWZ A;  2WHD A;  3LOV A;  1EL5 A;  2CUL A;  3K30 A;  3CGC A;  4TM3 A;  3L1R A;  3AEA A;  2Z5Y A;  4AT2 A;  1D4E A;  2GMJ A;  2XVF A;  2V6O A;  2BXR A;  5CQF A;  4JN9 A;  2C64 A;  1Z6L A;  3SX6 A;  3BI4 A;  1OJD A;  1PBC A;  3PS9 A;  3ABV A;  4FK1 C;  1IUV A;  2GVC A;  3BHF A;  3UOV A;  4CCQ A;  1D5T A;  5U63 A;  4TM4 A;  1KSU A;  1V59 A;  1TDE A;  2V60 A;  3S5W A;  3P4S A;  1CJC A;  4AP1 A;  2YR4 A;  2WP6 A;  4H4V A;  3LXD A;  2AAQ A;  5FS8 A;  5FMH A;  1FOH A;  4NZH A;  1BGN A;  4Y4L A;  4U8I A;  1E39 A;  1Q1R A;  1PJ5 A;  1DOE A;  4G73 A;  2XFO A;  1K0L A;  4CRT A;  3UP5 A;  2YLS A;  1TRB A;  1ZOY A;  1ZX9 A;  4J57 A;  4H2N A;  3ISH A;  3KVE A;  4YKF A;  4XWR A;  2AR8 A;  2OAM A;  4GDE A;  3SZW A;  2XFP A;  3UKK A;  2YM2 A;  3AE1 A;  1PXA A;  4G9K A;  3GD3 A;  1FEC A;  1L9C A;  1JRZ A;  2DKH A;  3HYX A;  4TM1 A;  1X31 B;  2R9Z A;  1DOB A;  2C70 A;  3DA1 A;  5BVA A;  2R45 A;  5L46 A;  4EMJ A;  2A89 A;  1B8S A;  3UTH A;  1RYI A;  5IQ1 A;  1O94 A;  2WET A;  1GPE A;  4JDR A;  3L5O A;  4P9S A;  5EB5 A;  2OA1 A;  2WQY A;  3ITJ A;  1GRG A;  3CND A;  3DJG X;  4K22 A;  2PHH A;  2GAG B;  1S2Y A;  4IA5 A;  2WDR A;  4ICY A;  3V3O A;  4U8L A;  1PBB A;  4Z2T A;  1KDG A;  1S3B A;  3UKL A;  1KN0 A;  3Q9T A;  4ZCC A;  3FPZ A;  3CGE A;  3IWA A;  4FX9 A;  1GEU A;  1GER A;  1GXF A;  3T2Y A;  4B68 A;  4CNK A;  1B5Q A;  3RNM A;  2WEU A;  3QJ4 A;  3EPT A;  2WPE A;  4DNA A;  1IUT A;  3L8K A;  2BK3 A;  3DK9 A;  4H4W A;  1JRY A;  2BK4 A;  3GD4 A;  1N4W A;  2B7R A;  3UKF A;  1BWC A;  4IV9 A;  3H8L A;  3AE5 A;  3JSK A;  3K7T A;  3ALL A;  3SGL A;  3T0K A;  2BK5 A;  1ZMC A;  5J60 A;  4YTN A;  3AXB A;  3NK0 X;  3SZ0 A;  4C77 A;  4YSY A;  1H7X A;  1IJH A;  4DSH A;  1NPX A;  4K2X A;  1VG0 A;  1TYP A;  1FL2 A;  3GSI A;  2GH5 A;  2WPF A;  5BUK A;  1IUS A;  3AD7 B;  2V3A A;  1CF3 A;  3AEF A;  5KNL A;  2WOI A;  4A6N A;  2C66 A;  4EM4 A;  2BS3 A;  3ATQ A;  5JCK A;  3UOZ A;  4GR1 A;  2RAB A;  5GRT A;  1PHH A;  3ALM A;  1OJA A;  2A87 A;  2B76 A;  1YQ3 A;  2C73 A;  2WP9 A;  4J33 A;  5HXI A;  1JOA A;  2YWL A;  2XLR A;  1PN0 A;  2F5Z A;  3AE3 A;  5JRB A;  3SZF A;  1M6I A;  4UDQ A;  2WS3 A;  3ICR A;  3EF6 A;  2VOU A;  2OLN A;  4I58 A;  4NTE A;  3AE6 A;  4H50 A;  4K8D A;  4DGK A;  4A5L A;  3UKP A;  1DOD A;  1F8R A;  3AB1 A;  1IUX A;  3LZX A;  1HYU A;  4GCM A;  3GWF A;  2C3D A;  1OJC A;  4J31 A;  4OPL A;  2BCP A;  3AED A;  1PJ7 A;  4J56 A;  1YKJ A;  3AEB A;  1CJ4 A;  3NKS A;  3VQR A;  1NEK A;  1LJ1 A;  1N1P A;  1LV0 A;  1LQU A;  1IUU A;  3CIR A;  4C74 A;  3CGB A;  1N4U A;  2ZZC A;  4BJY A;  2WOV A;  1GSN A;  3CNP A;  1MOK A;  5CKU A;  4D03 A;  1ZMD A;  2NVK X;  1LPF A;  4CCR A;  2JB2 A;  2BYB A;  3ZYX A;  1QO8 A;  4U8M A;  2YLW A;  3GRT A;  2YLT A;  3M13 A;  4JY3 A;  4BV6 A;  3G5Q A;  2RGO A;  2XFN A;  4MJW A;  5KVI A;  1VQW A;  3UOX A;  5BRT A;  1XDI A;  3M12 A;  4JNQ A;  1COY A;  3G5S A;  3QSM A;  4EMW A;  1D7L A;  1EL8 A;  2HQM A;  2H88 A;  2BS4 A;  4C3X A;  5C2T A;  4NEV A;  3V76 A;  1KF6 A;  1F3P A;  1ZKQ A;  5FS6 A;  1F6M A;  3CPH G;  5M10 A;  3NRN A;  4K7Z A;  2GB0 A;  4YSX A;  3NN6 X;  1H82 A;  2CVJ A;  4U2S A;  4I59 A;  4G6H A;  1BZL A;  3WE0 A;  2X8H A;  2WBA A;  4EQX A;  4LA1 A;  2ACZ A;  3QVP A;  3CNT A;  5KOW A;  1FCD A;  3BI2 A;  1P2E A;  1LTX R;  1VG9 A;  2FBW A;  1ZDL A;  1GAL A;  4H2P A;  3S61 A;  1NHP A;  2C75 A;  2FJE A;  3AEC A;  1CL0 A;  2V3B A;  2R46 A;  5KVH A;  4GAP A;  1LVL A;  2C4C A;  3I6D A;  4UDR A;  1TDN A;  3Q6J A;  2EQ6 A;  3R9U A;  1DXL A;  2X99 A;  1GRA A;  2AQJ A;  5KWF A;  2Q0K A;  4A6N B;  1PXB A;  3P4P A;  4OPC A;  2JK6 A;  3RED A;  3RP7 A;  2X8C A;  2C76 A;  3K7M X;  4II2 A;  5JCM A;  2V61 A;  2WDQ A;  4APN A;  4IVM B;  1W4X A;  3GRS A;  2RGJ A;  1PDH A;  3UTE A;  1ZK7 A;  4BK1 A;  1FEA A;  1EL9 A;  3NYC A;  3NLC A;  4Z44 A;  5JCI A;  3LAD A;  5U25 A;  1KFY A;  5TR3 A;  4A9W A;  1MO9 A;  1CJ3 A;  1F8W A;  4H4S A;  1QLB A;  2GQF A;  4B67 A;  4BK2 A;  1H6V A;  5KRQ A;  3T2K A;  1L0V A;  3AE4 A;  4Y4N A;  2TMD A;  4B65 A;  1ZOV A;  1GV4 A;  2Q7V A;  2B9Y A;  3UCL A;  2VRM A;  4ECH A;  3RHA A;  1NHQ A;  3P4Q A;  3B3R A;  3BNU A;  3SY4 A;  2XLS A;  3AE2 A;  1QJD A;  1PBD A;  1DOC A;  2C65 A;  4Y4M A;  3VRA A;  3G5R A;  1REO A;  2GF3 A;  3OC4 A;  2OAL A;  2XVI A;  3AD9 B;  3AEE A;  3QSE A;  3CMM A;  4RG3 A;  4H2Q A;  4B1B A;  1NG4 A;  4DSG A;  1TDK A;  3NK1 X;  1BKW A;  2YR6 A;  4XWZ A;  3DH9 A;  3KD9 A;  1JNZ A;  1KNP A;  1CHU A;  3UTG A;  4WCT A;  4EQS A;  3SYI A;  3UP4 A;  4YWO A;  3NIX A;  4BUR A;  1XHC A;  2BS2 A;  4O5Q A;  1H84 A;  4USQ A;  3AEG A;  4U8O A;  1ELI A;  3P9U A;  1E1K A;  2QA2 A;  5KMQ A;  3V3N A;  4Z2U A;  4X4J A;  3DK8 A;  1H83 A;  1GOS A;  1GT8 A;  1KNR A;  1NAA A;  4J2W A;  4H4Z A;  1RP0 A;  2Y6Q A;  1NEN A;  4CY8 A;  2XFU A;  4ADW A;  4CY6 A;  2GMH A;  2GR3 A;  5GSN A;  4XXG A;  3GYJ A;  3DJJ A;  3II4 A;  2UZZ A;  2WU2 A;  3C96 A;  4IA6 A;  2XCG A;  3CGD A;  2YR5 A;  4YXD A;  2R0G A;  2YG3 A;  4C5O A;  1CC6 A;  3GWD A;  1AOG A;  3M0O A;  2BC0 A;  2BC1 A;  4H4P A;  2B9W A;  2IVE A;  1L9E A;  2VQB A;  3B6D A;  4B64 A;  2FJB A;  2GV8 A;  3F8P A;  3UKQ A;  5KXJ A;  2VQ7 A;  1GRH A;  1OJT A;  4G74 A;  2ZZ0 A;  4H4Q A;  2C3C A;  1ZP0 A;  1DNC A;  4GRT A;  4U2L A;  4GDP A;  5FS7 A;  4U8P A;  1OJ9 A;  3QFB A;  4GUV A;  2YG5 A;  1GRT A;  3QFA A;  4OPD A;  2E1M A;  4OVI A;  3SM8 A;  3UTF A;  4EIP A;  4YSH A;  3IHM A;  2WP5 A;  4Z26 A;  4PAA A;  3NGC X;  3QVR A;  4J34 A;  4EQW A;  5JCL A;  3GYI A;  2NPX A;  3DME A;  3CPI G;  3LB8 A;  3RP8 A;  1PBF A;  3AE9 A;  4HA6 A;  4RSL A;  1GND A;  3KPF A;  4NNJ A;  3IF9 A;  1D4D A;  3UKA A;  4EIQ A;  2FJD A;  3VR8 A;  4OPT A;  1L9D A;  2BAC A;  3NNE A;  2WDV A;  3PG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...