4DNAA

Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
461
Chain Sequence
AFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQFAEHFEDAAGFGWTVGESRFDWAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELAGPNTVKLLASGKTVTAERIVIAVGGHPSPHDALPGHELCITSNEAFDLPALPESILIAGGGYIAVEFANIFHGLGVKTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQSVSADADGRRVATTMKHGEIVADQVMLALGRMPNTNGLGLEAAGVRTNELGAIIVDAFSRTSTPGIYALGDVTDRVQLTPVAIHEAMCFIETEYKNNPTSPDHDLIATAVFSQPEIGTVGITEEEAARKFQEIEVYRAEFRPMKATLSGRKEKTIMKLVVNAADRKVVGAHILGHDAGEMAQLLGISLRAGCTKDDFDRTMAVHPTAAEELVTMYQPSYRVRNGERVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable glutathione reductase
publication title CRYSTAL STRUCTURE OF putative glutathione reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 138
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4dnaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA02
4YTPA 2ZZBA 1EBDA 3EF6A 4EMJA 1CJ4A 1TRBA 3LZWA 5M0ZA 4H4VA 4RG3A 1E1MA 1REOA 2ACZA 4Y4NA 3H8IA 2JB2A 3GRSA 1L9EA 2FJEA 2VVLG 3UTGA 4B69A 2XVEA 2BABA 4ICYA 4BV6A 4FX9A 2BA9A 1IUWA 1KSUA 4I58A 1H83A 4H4SA 2ZZ0A 1L9CA 3H4KA 2AR8A 2YAUA 3CIRA 4OCGA 2V6OA 3R9UA 1XDIA 2YLZA 1ZOYA 3CN8A 4OPIA 4CY6A 3IF9A 1RP0A 4J31A 2BS4A 3PVCA 1ONFA 1GRGA 1CF3A 1S2YA 5TR3A 4A99A 1KDGA 3UKKA 3VQRA 3M12A 1L0VA 4H4UA 3AE1A 4B68A 1FEAA 1B5QA 4LU6A 4CCQA 2BYBA 2C73A 2YLTA 3K7TA 3URHA 3CGCA 2WOWA 2X99A 4EQXA 3E1TA 3NHOX 3OZ2A 4XXGA 4YKFA 2YG6A 4ZCCA 5KOWA 2JKCA 4RG4A 1NDAA 4ZN0A 3NTDA 5CQFA 3NNEA 3EAOA 2YM2A 4A5LA 4UDRA 1NHQA 2XLUA 1GREA 3AB1A 1PXBA 2ZZCA 1GV4A 3II4A 4FK1C 5GRTA 2GMHA 2VRMA 3GDPA 1FEBA 4JDRA 4A7AA 4X4JA 5EB4A 3OC4A 1GRAA 1NHRA 2C70A 1BGJA 3F8DA 5HY5A 4PABA 3CPJG 2GR2A 2WP9A 3RP6A 4A6NA 1DNCA 5KRQA 4J56A 5LV9A 3UKQA 2FJDA 3RNMA 4GR1A 2Y6QA 1MXTA 1KNPA 1GOSA 4IA5A 1IUUA 4D04A 1OJTA 2BS2A 2CDUA 2Y6RA 5GSNA 1W4XA 2APGA 2YWLA 4JQ9A 2C65A 2QA2A 1ZP0A 3QVPA 2XVJA 3D8XA 1H84A 1GXFA 2JB3A 4EMWA 2CULA 2BXRA 2YR6A 4J36A 1VQWA 5EOWA 1TDFA 3L8KA 2WHDA 3QVRA 4CRTA 4NTCA 3O0HA 4EIQA 3I3LA 3CGDA 4CNJA 3AE7A 2WS3A 2WU2A 1Y56A 4WX1A 1PJ5A 4Y4MA 3NN6X 2A8XA 3AE8A 4GF7A 2YR5A 4B67A 4AT0A 3LZXA 4AOXA 2XVFA 2GMJA 1KF6A 1YQ3A 1X31B 1H86A 2PHHA 4YXDA 1XHCA 4FK1A 3GRTA 2C75A 4XWRA 3CTYA 5L46A 2YLSA 5JCNA 2BK4A 1GETA 2QA1A 1N1PA 4B65A 1K0JA 2C64A 3UTHA 1VDCA 4A9WA 4Z2RA 2OALA 4BJZA 5BRTA 3NYCA 1GPEA 2YVGA 4DGKA 2EQ9A 1IJHA 1H6VA 3WE0A 1EL8A 2C3CA 2VVLA 1S3BA 4TLZA 3LJPA 3IHMA 1PBFA 2CVJA 3NKSA 1PN0A 4U2LA 2A89A 4M52A 2E4GA 1AOGA 1EL7A 1S3EA 1LVLA 3DGZA 4YTMA 5BULA 1GRBA 4C3XA 1OJCA 4E0VA 2B7SA 1CC2A 4J33A 2BK5A 4BURA 1N4WA 2VQ7A 3QFBA 3AD8B 4J34A 4N9XA 4H4WA 4P9SA 1EL5A 1GTEA 3ATQA 3H8LA 3ALMA 1IUVA 3GD4A 4H7UA 3KD9A 1PJ7A 1S2QA 1OJDA 3QSMA 1YY5A 4C3YA 4EQRA 3DK8A 4D03A 3LB8A 2GEWA 4TM1A 2IVDA 2R46A 1JU2A 1Q9IA 5HHFA 4CCRA 1RYIA 2IIDA 3ALJA 3DJJA 3VRBA 3V3OA 1B37A 3P9UA 4REKA 1IUSA 2Q0LA 4ZCDA 3ZYXA 2H88A 4OPLA 4OPGA 4YSHA 4H4XA 2WPCA 5KXJA 3UOYA 1PBEA 4ADWA 1VRQB 3HZLA 3QJ4A 4Z2UA 1V59A 4NEWA 4EQSA 1DOCA 4BK2A 1D4EA 1Q1WA 2GQFA 4ECHA 3F8RA 1NAAA 3NN0X 5KVIA 3DMEA 1ZMDA 3BNMA 4JNQA 4C74A 2R4JA 2YVFA 4H4RA 4Z26A 3SFDA 2BC0A 4O5QA 3UKLA 4X9MA 2VZ2A 3AE4A 2FJBA 5JCIA 2GRTA 2DKHA 1F8WA 5ER0A 3UP4A 1GTHA 3T37A 4Z43A 1NPXA 2V60A 4UDPA 2BXSA 4IVOB 4LA1A 2XFQA 2R9ZA 3NK2X 4TLXA 2E1MA 2YQUA 4EM3A 3K30A 4H4QA 2C66A 3AD7B 5FS7A 1H82A 3GYIA 2B76A 3QSSA 2YR4A 3AEGA 1GRHA 1JOAA 2W0HA 2NVKX 3GYJA 1GRTA 3UKPA 2O9ZA 1BF3A 4H4YA 2WDRA 3B6DA 4APNA 2XLSA 4AOSA 3VR9A 1VG0A 3C4AA 2RGOA 4GUVA 3ATRA 2XFNA 5J60A 3LADA 2GV8A 1E7PA 3NGCX 4OPTA 4TM3A 3VRDB 1DXLA 3GD3A 5HYMA 3AE3A 1D5TA 3UCLA 1D7LA 3VR8A 3NT6A 4U8KA 3BI4A 5FS6A 2GVCA 4U8LA 2YG3A 3V3NA 2H89A 5HXIA 2Q7VA 1JNRA 3DK9A 4EIPA 2R0CA 2Z5YA 1GT8A 2EQ6A 3CNPA 4OPCA 4A65A 4AP3A 2X3NA 3PS9A 3P4SA 5KOXA 4UP3A 2C7GA 3NYFA 2RGHA 1NENA 1K0IA 1OJ9A 3ABVA 1TYPA 2WQYA 2YG7A 1LQTA 1E6EA 2Q0KA 1RSGA 2YLRA 2VQBA 3C4NA 3P1WA 1PXCA 3IWAA 4U2TA 4U8IA 4IV9A 1BGNA 1PBDA 1PHHA 3ADAB 3UOXA 3GWFA 2AAQA 3BHKA 4H2PA 3DK4A 5JCLA 2BK3A 2XLRA 3AE9A 4YSXA 3QFAA 4K8DA 2XLTA 1JRZA 1CL0A 4EM4A 2VVMA 4Z25A 1P2HA 1TDOA 2XDOA 3M0OA 3BI5A 1LV0A 2YLXA 2YM1A 3UKHA 3GMCA 2BS3A 2ARDA 2B9XA 3AYJA 3P4PA 2YVJA 1Y56B 3ICSA 2R45A 2BCPA 3GDNA 2Z5XA 4I59A 2AQJA 1Q1RA 2JBVA 3CNTA 3CPIG 2V5ZA 3DJEA 4JY2A 4U8OA 2DKIA 3AEBA 4B66A 3CPHG 1JNZA 2XVHA 1DODA 1BKWA 2WDVA 2PYXA 3REDA 2RABA 3ZDNA 3CNDA 3NTAA 2OLNA 1JRXA 3VRAA 5FS8A 1CHUA 2UZZA 1DOEA 3EPTA 1ELIA 1OJAA 1NG3A 2X8HA 5CKUA 1DOBA 3Q9TA 3ICRA 2X8CA 1F8RA 3KU9A 1PS9A 3Q6JA 2C67A 3BNUA 4YKGA 1ZY8A 2HQMA 2B7RA 1VG9A 3SQPA 3AE6A 4NEVA 3BI2A 3UOVA 3AEFA 1O94A 2XFUA 4KX6A 2WOVA 1TDKA 4B64A 1BZLA 1SEZA 3AYIA 5U1OA 4J2WA 2BC1A 4DNAA 4J57A 4K7ZA 2IVEA 4K2XA 4OVIA 2OAMA 4Z24A 1CC4A 1ZOVA 3AWIA 3JSKA 1B4VA 3AXBA 1TDEA 1L9DA 2YG4A 2GH5A 3AYLA 3NIXA 1ZKQA 3KKJA 4H4ZA 2FBWA 1CJ3A 1FECA 2XVIA 3G5SA 3FIMB 3UKAA 4OPUA 3S5WA 4JN9A 1TDNA 1H81A 5BUKA 2XYOA 4CNKA 5U25A 1FL2A 2R0GA 2X50A 4TM0A 2GQWA 2B9YA 1LQUA 3PO7A 4H4TA 4YWOA 2EQ7A 3EANA 1TYTA 3QSEA 1E1KA 2WETA 3D1CA 1GNDA 3DGHA 2WPFA 3F8PA 4HB9A 5JCKA 3DJDA 3LXDA 1D4DA 1PJ6A 1COYA 2FJAA 4X9NA 4Z44A 1E1LA 3ITJA 1ZMCA 1KNRA 3NRNA 4CY8A 2GAHB 3FPZA 3KA7A 5U63A 5IPYA 1H7XA 1HYUA 1YQ4A 3ICTA 4IA6A 3SM8A 3KPFA 1ZDLA 2F5ZA 1XANA 3CGBA 4LIIA 5C3JA 4NTDA 4USRA 3RHAA 3SFEA 5EBKA 1N4VA 3CNSA 1DJQA 4GDPA 3FG2P 2VOUA 3IHGA 1GRFA 2C72A 4JNAA 2R4EA 5J7XA 3ISHA 4DSGA 2V3BA 4NTEA 2JAEA 1O95A 2A87A 4UDQA 3GWDA 3RP7A 3NG7X 5FMHA 3UP5A 2WESA 2Q6UA 3P4RA 2XFPA 4U8JA 4YSZA 1FOHA 3GMBA 1NHPA 3NLCA 4BK3A 2EQ8A 1MO9A 3AEDA 2NPXA 4GRTA 1M6IA 5FS9A 2XLPA 2WOIA 5EB5A 4TM4A 3I6DA 5C2TA 1GSNA 4CBQA 4KPRA 1XPQA 4USQA 4BK1A 2GR1A 3DA1A 4GDEA 1PDHA 2GF3A 4U8MA 2YLWA 1ZX9A 3DH9A 3AE2A 3G5RA 4K5SA 5JCMA 1FCDA 2C3DA 3AEEA 2GAGB 2R0PA 4AT2A 2JK6A 4A6NB 1GERA 1F3PA 2BACA 1NEKA 4BJYA 4DSHA 1Z6LA 3NK0X 1KSSA 3SGLA 1KFYA 5KVHA 4RSLA 4A79A 1CBOA 4B1BA 3COXA 2J3NA 1H7WA 2I0ZA 4K5RA 3UKFA 2BCGG 2WP5A 2GB0A 2OLOA 1B8SA 3GSIA 3IC9A 1LTXR 1JRYA 2YG5A 1UKVG 1YQZA 1NHSA 1GESA 1BWCA 4C77A 1E39A 3B3RA 3M13A 4FDCB 3AECA 4YSYA 2XFOA 2WBAA 1QLBA 4IVMB 5DBJA 1ZK7A 5KWFA 1E1NA 1DJNA 2B9WA 4OPDA 3DJGX 1P2EA 4H2RA 3G5QA 4NZHA 4O5UA 3LOVA 3NH3X 4C5OA 2VRLA 2C76A 2WPEA 1YKJA 2QCUA 1F8SA 4JY3A 3KLJA 3C96A 3UTEA 1O5WA 2JB1A 3AD9B 4H50A 2WDQA 3FMWA 1MOKA 4YTNA 1IUXA 2WU5A 3CNJA 3FBSA 1CJCA 1F6MA 5IQ1A 1QO8A 4H4PA 1IUTA 1CJ2A 4YT0A 2QAEA 2ZBWA 3NYEA 4Y4LA 3V76A 1Y0PA 4K22A 2GR0A 1CC6A 1QJDA 4EQWA 2XCGA 3UOZA 5M10A 4Z2TA 3AE5A 2V61A 3NK1X 4HA6A 4H2NA 4GCMA 1PBBA 4XWZA 1JEHA 4PAAA 4AP1A 1EL9A 4EMIA 1M64A 4WCTA 2WEUA 2GR3A 5IQ4A 3KVEA 1LPFA 1K0LA 2TMDA 2WP6A 4MJWA 4H2QA 4U8NA 3UTFA 1GEUA 2OA1A 2RGJA 4B63A 3K7QX 1K4QA 3CGEA 2X8GA 2E5VA 3ALLA 1NG4A 4U2SA 1PXAA 4U8PA 3RP8A 3S61A 3P4QA 2V3AA 1PBCA 1D7YA 1N4UA 3L1RA 3AEAA 3K7MX 5BVAA 2TPRA 1GALA 2CFYA 1D4CA 3BHFA 1LJ1A
chains in the Genus database with same CATH superfamily
2W54A 4YTPA 1EBDA 3S5SA 3T4WA 3V4BA 2JB2A 1L9EA 3QN3A 2XVEA 1X2HA 3K1GA 3VA8A 4I58A 4H4SA 5KNLA 4CY6A 4GGBA 4JN7A 4J3ZA 4MGGA 1GRGA 4A99A 3VQRA 3M12A 4H4UA 4B68A 1B5QA 2YLTA 4GYPC 3URHA 4IL2A 3E1TA 4YKFA 3SN0A 4RG4A 4ZN0A 3EAOA 4A5LA 3P3BA 2PGEA 3RRAA 1GV4A 5GRTA 4JDRA 5EB4A 3JVAA 2O56A 2GR2A 2WP9A 1TKKA 4J56A 4D04A 3NVVB 3DIPA 2BS2A 1W4XA 1ZP0A 1H84A 4EMWA 2CULA 2YR6A 4KEMA 1S7MA 2WHDA 3O0HA 1N5WC 2WU2A 3NN6X 1EC7A 4GF7A 3N4FA 4B67A 4AOXA 3LZXA 2XVFA 1KF6A 4XWRA 5L46A 2BK4A 1N1PA 4B65A 1K0JA 2C64A 3RR1A 3UTHA 4BJZA 3NYCA 1GPEA 1H6VA 1S3BA 4TLZA 3NKSA 1AOGA 1EL7A 1S3EA 3DGZA 3DEQA 2ONEA 4C3XA 1JROA 3HPFA 3FYYA 3R11A 5G5GB 1CC2A 3QFBA 3RGTA 4DHGA 3IJIA 3KD9A 1PJ7A 2XH0A 1H2IA 3ZVHB 4EQRA 2GEWA 3NS1B 1JU2A 2IIDA 2P0IA 4YSHA 3NVYB 4ADWA 3HW2A 2GQFA 3F8RA 3EEZA 4JNQA 3SFDA 4GFIA 1FFUC 2OX4A 1F8WA 1GTHA 1R6WA 2XH7A 4IVOB 2DW6A 5FJUA 3K30A 3GYIA 3H7VA 2YR4A 1JOAA 2OPJA 4APNA 3KPKA 2RGOA 4G74A 1NU5A 3NZGA 3NGCX 4TM3A 3VRDB 5HYMA 1D5TA 3NT6A 4DX3A 4U8KA 3BI4A 2YG3A 3IJQA 2Z5YA 1GT8A 2EQ6A 3CNPA 4A65A 5KOXA 2RGHA 3A7UA 1LQTA 1E6EA 3P1WA 1PXCA 3UOXA 1FIQB 3GWFA 3BHKA 4H2PA 3QPEA 1JRZA 4Z25A 1P2HA 1TDOA 2YLXA 2QJNA 1EC8A 2BCPA 2Z5XA 3CNTA 2XH4A 2DKIA 3CPHG 2OZ8A 3R10A 3RO6A 3NRZB 2RABA 1OEPA 5FS8A 2UZZA 1NG3A 2X8HA 3NFUA 3Q6JA 2C67A 2B7RA 1BKHA 3BI2A 3OZYA 2PPGA 4KX6A 3UJFA 1SEZA 4K2XA 5FJRA 3JSKA 1B4VA 3AYLA 2GH5A 3FIMB 4IP5A 3S5WA 3SBFA 2XYOA 3PO7A 2OQYA 4YWOA 1EBGA 1TYTA 3F8PA 3UGVA 3GC2A 1PJ6A 2FJAA 3ITJA 1ZMCA 2PU0A 1KNRA 2GAHB 5U63A 4IA6A 3KPFA 4LIIA 1XPYA 3RHAA 2E5AA 3UXLA 5EBKA 3CNSA 1DJQA 4NTEA 4UDQA 3RP7A 2WESA 2Q6UA 4YSZA 1FOHA 3GMBA 4GRTA 3MQTA 1ECQA 3NXLA 5C2TA 4CBQA 1WUEA 2QGYA 2C3DA 3DG3A 2JK6A 4A6NB 2PTYA 3B97A 1NEKA 4GAVA 2XH2A 1KFYA 4RSLA 3VCNA 5FJTA 1H7WA 2I0ZA 4K5RA 4NNJA 2OLOA 3GSIA 3IC9A 2YG5A 4C77A 3DFYA 4FDCB 4YSYA 2AL2B 4IVMB 3IK4A 5KWFA 1E1NA 4OPDA 3DJGX 3G5QA 4NZHA 4O5UA 3NH3X 1P48A 3C96A 4ZOHB 2JB1A 3FMWA 2QQ6A 3MY9A 1RVKA 1IUXA 2WU5A 5IQ1A 2XSXA 1CJ2A 3B9JB 3V76A 2ZBWA 3UJEA 1QJDA 1EC9A 3AE5A 2V61A 2POZA 4H2NA 3N4EA 1PBBA 1VQZA 4PAAA 4WCTA 2GR3A 4U8NA 4B63A 2E5VA 4E6MA 3NO1A 1FHVA 3AEAA 5BVAA 1GALA 3BHFA 4M6UA 3A7RA 2E3TA 3EF6A 1CJ4A 1TRBA 3CB3A 3LZWA 5M0ZA 1E1MA 4G73A 4ICYA 4FX9A 1IUWA 1KSUA 3CIRA 3H12A 2V6OA 2YLZA 4OPIA 1MDRA 3IF9A 3HYWA 1RP0A 4J31A 2BS4A 1ONFA 1KDGA 4EWJA 3AE1A 1FEAA 4CCQA 3FJ4A 2C73A 4EQXA 3CGCA 3S47A 1PDYA 3OZ2A 2YG6A 2JKCA 3T9PA 5CQFA 1JCTA 2OO6A 3NNEA 2YM2A 4UDRA 4H1ZA 3AB1A 1PXBA 4FK1C 3GDPA 3R07C 4G7FA 4X4JA 4G9KA 2C70A 5HY5A 3CPJG 5KRQA 3AN1A 3UKQA 4MMWA 2Y6QA 3UXKA 4E5TA 5GSNA 4JQ9A 1EBHA 2XVJA 3R0UA 1GXFA 2JB3A 4H2HA 4J36A 3L8KA 4EIQA 3I3LA 3CGDA 1PJ5A 3AE8A 2YR5A 1XHCA 3GRTA 2C75A 4Z17A 4DYEA 2YLSA 2QA1A 5J04A 2NQLA 4HNCA 4X2PA 1VDCA 4A9WA 4Z2RA 2OALA 2YVGA 3GYXA 1EL8A 1DTNA 2BRAA 4ZCWA 3IHMA 2CVJA 1PN0A 4U2LA 4E4FA 3HRDC 4YTMA 5BULA 3UCDA 2B7SA 4BURA 2VQ7A 4N9XA 4P9SA 1GTEA 3ALMA 4FI4A 1S2QA 2GGHA 4JHMA 2IVDA 2R46A 5HHFA 1RYIA 3V3OA 1FO4A 3P9UA 3L5OA 3ZYXA 2H88A 3UOYA 3HZLA 1V59A 1Q1WA 4ECHA 1W6TA 1ZMDA 2R4JA 3UKLA 4X9MA 2DKHA 3UP4A 1RM6B 4UDPA 3ES7A 2BXSA 3EKGA 4LA1A 4H19A 2XFQA 3OW1A 1N60C 3FXGA 4EM3A 3D47A 5FS7A 1H82A 3RITA 3QSSA 2NVKX 3GYJA 2O9ZA 1BF3A 2WDRA 3B6DA 4AOSA 1VG0A 3C4AA 3T2KA 3ATRA 3SYIA 5J60A 4GGHA 4TVWA 2GV8A 4OPTA 2DW7A 3GD3A 3VR8A 5FS6A 2GVCA 3T2YA 2H89A 5HXIA 4EIPA 3DK9A 4OPCA 2X3NA 2OVLA 3P4SA 1NENA 1K0IA 3TJ4A 4HN8A 2WQYA 5BOEA 2Q0KA 3C4NA 4U8IA 4IV9A 2PSNA 5JRBA 3ADAB 2PS2A 2BK3A 2XLRA 4YSXA 3IJLA 3M0OA 3BI5A 1LV0A 2YM1A 2BS3A 2ARDA 2B9XA 3ICSA 2CHRA 3GDNA 3VC5A 3CPIG 1Q1RA 4U8OA 1JNZA 2XVHA 1DODA 1BKWA 3REDA 3ZDNA 3TW9A 1JRXA 3VRAA 1CHUA 1DOEA 1OJAA 3SZCA 3Q9TA 1JPMA 3BNUA 1ZY8A 3AE6A 4KT2A 1KCZA 3ZLGA 3ZLFA 3UOVA 4IT1A 2WOVA 3ZVHA 4B64A 2OKTA 2GGGA 4DNAA 2IVEA 2OAMA 3THUA 1ZOVA 3AXBA 2YG4A 1ZKQA 5ENLA 2FBWA 2XVIA 3JW7A 3BJSA 1TDNA 5BUKA 5U25A 3TWBA 2X50A 2GQWA 1LQUA 3EANA 1E1KA 2WETA 5JCKA 3DJDA 3LXDA 1D4DA 3NRNA 4CY8A 3FPZA 3KA7A 3TJIA 3ICTA 1ZDLA 2F5ZA 3CGBA 5C3JA 4USRA 3FG2P 2OQHA 4JNAA 3DGBA 5J7XA 3ISHA 2V3BA 2JAEA 2A87A 3NG7X 3PWGA 4U8JA 4GMEA 2PODA 1NHPA 4J1OA 1M6IA 2OFJA 3SN1A 1VDVA 2GR1A 1PDHA 1ZX9A 3SJNA 3AE2A 4KPLA 3SZFA 2PA6A 4AT2A 1GERA 1F3PA 2BACA 4HYRA 4DSHA 1Z6LA 1KSSA 1KKOA 1P43A 1NHSA 1GESA 1E39A 3AECA 3GY1A 2WBAA 1QLBA 5DBJA 1ZK7A 1P2EA 3LOVA 4C5OA 2QCUA 3UTEA 1F8SA 3KLJA 4H50A 4HCHA 2W55A 3FBSA 2AL1A 1IUTA 3TOYA 2MUCA 1Y0PA 3SQSA 2GR0A 4DWDA 2GL5A 3PFRA 4GCMA 3CXOA 4XWZA 1EL9A 4EMIA 1K0LA 2WP6A 4MJWA 3DESA 3UTFA 3K7QX 2PTXA 4U2SA 4II3A 3S61A 3P4QA 2V3AA 3K7MX 1LJ1A 3ZVIA 2ZZBA 4EMJA 4H4VA 2ACZA 4Y4NA 3I6EA 4B69A 3GRSA 3UTGA 2BABA 1H83A 2ZZ0A 2AR8A 2YAUA 4G6GA 3R9UA 2PU1A 3CN8A 1TZZA 3QTPA 3PVCA 2HXTA 1S2YA 5KMRA 3UKKA 2BYBA 3N6HA 3K7TA 2WOWA 2X99A 3GO2A 3CT2A 4XXGA 1BQGA 3T31A 1MNSA 5KOWA 3NTDA 3BOXA 3R25A 1NHQA 1GREA 3II4A 2GMHA 2VRMA 1GRAA 1NHRA 1BGJA 3F8DA 4PABA 3PK7A 4A6NA 5LV9A 2FJDA 3P0WA 1MXTA 1KNPA 4IA5A 1IUUA 1OJTA 2I5QA 2APGA 2C65A 3QVPA 4GYPA 1VQWA 2AL2A 2GGIA 3QVRA 4CRTA 4NTCA 4CNJA 4F4RA 3AE7A 2WS3A 1Y56A 4YWSA 4Y4MA 4G8TA 2GMJA 1X31B 1H86A 2PHHA 4YXDA 2W3RA 3CTYA 3V5CA 4DGKA 2EQ9A 1ONEA 1IJHA 3WE0A 2C3CA 2VVLA 2A89A 1GRBA 1OJCA 2PP1A 4MKSA 4J33A 1N4WA 3AD8B 1SJAA 4M0XA 3ATQA 1IUVA 3GD4A 4JN8A 3AM9A 3QSMA 1YY5A 4D03A 1Q9IA 4CCRA 3ALJA 1B37A 4REKA 2XGZA 1IUSA 2Q0LA 4GAPA 4OPLA 4OPGA 4H4XA 5KXJA 1L8PA 3QJ4A 4Z2UA 4NEWA 1D4EA 5KVIA 3Q45A 4C74A 2YVFA 4H4RA 4Z26A 2ZADA 2VZ2A 2FJBA 5JCIA 5ER0A 1NPXA 2V60A 2P88A 2R9ZA 3NK2X 3FCPA 4H4QA 3AD7B 2AKZA 2B76A 3AEGA 2W0HA 3OP2A 1GRTA 1TE6A 4H4YA 5FJPA 3SY4A 3VR9A 3UCCA 1WUFA 2XFNA 3LADA 1D7LA 3CAWA 3V3NA 3T6CA 1JNRA 2R0CA 4AP3A 1X2GA 1OJ9A 1TYPA 1R0MA 2YLRA 1RSGA 2PTZA 2VQBA 3CMMA 4DN1A 1PHHA 2AAQA 4ZA0A 4NWZA 1MUCA 3DK4A 5JCLA 3AE9A 3QFAA 4K8DA 2QDEA 3MSYA 2XLTA 3T0KA 4EM4A 3V5FA 2VVMA 1JDFA 2PGWA 4K2SA 3AYJA 2YVJA 2R45A 2PMQA 2AQJA 2JBVA 3MUCA 3DJEA 4JY2A 2WDVA 1ZXIC 3V3WA 3CNDA 3EPTA 1ELIA 1DOBA 1F8RA 4ROPA 3T14A 1VG9A 3TQPA 1JRPA 3DERA 3AEFA 2HXUA 1TDKA 1ELSA 1BZLA 4HCDA 1WYGA 5U1OA 2BC1A 4OVIA 4Z24A 3AWIA 1TDEA 3VCCA 1L9DA 4H4ZA 1CJ3A 1XS2A 3G5SA 4HNLA 3UKAA 3TTEA 4OPUA 1FL2A 2R0GA 2B9YA 4H4TA 2EQ7A 3QSEA 4HB9A 3D1CA 1GNDA 2WPFA 3H70A 1SB3B 4X9NA 1H7XA 1HYUA 1XANA 4ENLA 4NTDA 5KMPA 4GDPA 2VOUA 4KWSA 1GRFA 2C72A 4DSGA 3P93A 3GWDA 3UP5A 2XFPA 2EQ8A 3AEDA 2NPXA 5EB5A 4TM4A 4H83A 1GSNA 1XPQA 4USQA 3RCYA 3DA1A 2OZTA 4DXKA 2GF3A 2ZC8A 3G5RA 5JCMA 4GIRA 3PG6A 2R0PA 2C4CA 4BJYA 3H8AA 3COXA 2WP5A 2GB0A 3UJSA 1JRYA 1UKVG 3SZWA 3M13A 2XFOA 3CK5A 2B9WA 4H2RA 1YKJA 4JY3A 6ENLA 1O5WA 2BRYA 3JZUA 4YTNA 2PP0A 1QO8A 4H4PA 1FHUA 1T3QC 2QAEA 3NYEA 3DDMA 4EQWA 3N6JA 4Z2TA 3T2ZA 3NK1X 4HA6A 4IHCA 5KMQA 4AP1A 1M64A 3KVEA 1LPFA 1K4QA 3CGEA 2QJJA 2X8GA 3ALLA 5G5HB 1NG4A 5EU9A 3RP8A 4TVYA 3BSMA 3Q4DA 3L1RA 1D7YA 2QJMA 2TPRA 2CFYA 4RG3A 1REOA 3H8IA 2FJEA 2VVLG 4BV6A 2BA9A 2FYMA 1L9CA 3H4KA 4OCGA 3NVZB 1N63C 1XDIA 2PTWA 1ZOYA 3VC6A 3D9XA 1CF3A 5TR3A 1L0VA 4LU6A 2W3SA 1NELA 3NHOX 4ZCCA 1NDAA 2PCEA 5BOFA 2XLUA 2ZZCA 2QDDA 5FJOA 1FEBA 4A7AA 3OC4A 3SR6B 4A6GA 3CYJA 3RP6A 1DNCA 3RNMA 4GR1A 1GOSA 2CDUA 2Y6RA 1N62C 2YWLA 2QA2A 3MKCA 3D8XA 2RDXA 2BXRA 5EOWA 1TDFA 4K1WA 1FFVC 4WX1A 5KMSA 2A8XA 3OZMA 2HZGA 4AT0A 3SXIA 1YQ3A 4FK1A 1E9IA 3TWAA 5JCNA 1GETA 3SN4A 5BRTA 3A7AA 3SX6A 4GISA 3LJPA 2HNEA 1PBFA 4M52A 2E4GA 1LVLA 3DG6A 4E0VA 2BK5A 4J34A 1MRAA 4H4WA 3T8QA 1EL5A 3H8LA 4H7UA 3VFCA 5IDZA 1OJDA 4C3YA 3DK8A 3LB8A 4TM1A 3VRBA 3DJJA 3FV9A 3AMZA 4ZCDA 2MNRA 2WPCA 3OPSA 1PBEA 1VRQB 3D46A 4EQSA 1DOCA 4BK2A 1NAAA 3NN0X 3DMEA 3BNMA 3R1ZA 2BC0A 4O5QA 1JPDX 3AE4A 2GRTA 3T37A 4Z1YA 4Z43A 2OG9A 1N5XA 2OLAA 3U4FA 4TLXA 2E1MA 2YQUA 2GGEA 2C66A 2PP3A 3U9IA 1GRHA 3I6TA 3NVWB 3UKPA 3QKEA 2P8BA 2XLSA 3OTRA 4GUVA 3CXBA 1E7PA 1DXLA 3SSZA 3AE3A 3UCLA 1MDLA 2FKPA 4U8LA 1STZA 3UJRA 2Q7VA 3PS9A 4UP3A 2C7GA 3NYFA 3ABVA 2YG7A 3MWCA 4U2TA 2OZ3A 3IWAA 1BGNA 1PBDA 3DFHA 3GD6A 1CL0A 2GGJA 4A35A 2XDOA 3UKHA 3GMCA 3P4PA 2GDQA 1Y56B 4I59A 2V5ZA 4B66A 3AEBA 3TCSA 4II2A 2PYXA 3NTAA 2OLNA 1KD0A 3HYXA 5CKUA 3ICRA 2X8CA 3KU9A 1PS9A 4YKGA 2HQMA 3ES8A 1SJDA 3SQPA 3KUMA 1YEYA 4NEVA 1KN0A 1O94A 2XFUA 3AYIA 4J2WA 4J57A 4K7ZA 1CC4A 3NIXA 3KKJA 1FECA 4JN9A 1H81A 4CNKA 4TM0A 4IZGA 3DGHA 2P8CA 4IL0A 1COYA 4Z44A 1IYXA 1E1LA 3R0KA 3FVDA 4K8GA 5IPYA 1YQ4A 1PDZA 3SM8A 3UJ2A 3ENLA 3QLDA 1F9CA 1N4VA 4E8GA 3SFEA 3IHGA 3MZNA 3DG7A 2R4EA 4E4UA 1O95A 5FMHA 3P4RA 3I4KA 3ETRB 3NLCA 4BK3A 1MO9A 5FS9A 2XLPA 2WOIA 1SJCA 3I6DA 4KPRA 4BK1A 4GDEA 4FP1A 2GSHA 4U8MA 2QVHA 2YLWA 3DH9A 3HYVA 4K5SA 1FCDA 3AEEA 2GAGB 4A3RA 3STPA 3NK0X 3SGLA 5KVHA 4A79A 1CBOA 1V97A 4B1BA 2J3NA 3UKFA 7ENLA 4G6HA 2BCGG 3EUB3 1B8SA 1KKRA 1LTXR 1YQZA 1BWCA 3B3RA 1DJNA 1N61C 2VRLA 2C76A 2WPEA 3ZLHA 3AD9B 2WDQA 1MOKA 3SZ0A 3CNJA 1CJCA 1F6MA 4HPNA 4YT0A 4Y4LA 4K22A 1CC6A 2XCGA 3UOZA 5M10A 1JEHA 4HCLA 2WEUA 1SJBA 5IQ4A 2TMDA 4H2QA 1GEUA 2OA1A 2RGJA 2P3ZA 4IP4A 3VDGA 1PXAA 3PWIA 4U8PA 1PBCA 1N4UA 1D4CA 2AKMA
chains in the Genus database with same CATH topology
4YTPA 2ZZBA 1EBDA 3EF6A 4EMJA 1CJ4A 1TRBA 3LZWA 5M0ZA 4H4VA 4RG3A 1E1MA 1REOA 2ACZA 4Y4NA 3H8IA 2JB2A 3GRSA 1L9EA 2FJEA 2VVLG 3UTGA 4G73A 2XVEA 2BABA 4ICYA 4BV6A 4FX9A 2BA9A 1IUWA 1KSUA 4I58A 1H83A 4H4SA 2ZZ0A 1L9CA 3H4KA 2AR8A 2YAUA 3CIRA 4G6GA 4OCGA 2V6OA 3R9UA 5KNLA 1XDIA 2YLZA 1ZOYA 3CN8A 4OPIA 4CY6A 3IF9A 3HYWA 1RP0A 4J31A 2BS4A 3PVCA 3D9XA 1ONFA 1GRGA 1CF3A 1S2YA 5TR3A 4A99A 1KDGA 5KMRA 3UKKA 3VQRA 3M12A 1L0VA 4H4UA 3AE1A 4B68A 1FEAA 1B5QA 4LU6A 4CCQA 2BYBA 2C73A 2YLTA 3K7TA 3URHA 3CGCA 2WOWA 2X99A 4EQXA 3E1TA 3NHOX 3OZ2A 4XXGA 4YKFA 2YG6A 4ZCCA 3T31A 5KOWA 2JKCA 4RG4A 1NDAA 4ZN0A 3NTDA 5CQFA 3NNEA 3EAOA 2YM2A 4A5LA 4UDRA 1NHQA 2XLUA 1GREA 3AB1A 1PXBA 2ZZCA 1GV4A 3II4A 4FK1C 5GRTA 2GMHA 2VRMA 3GDPA 1FEBA 4JDRA 4A7AA 4X4JA 5EB4A 3OC4A 1GRAA 1NHRA 4G9KA 2C70A 1BGJA 3F8DA 5HY5A 4PABA 3CPJG 2GR2A 2WP9A 3RP6A 4A6NA 1DNCA 5KRQA 4J56A 5LV9A 3UKQA 2FJDA 3RNMA 4GR1A 2Y6QA 1MXTA 1KNPA 1GOSA 4IA5A 1IUUA 4D04A 1OJTA 2BS2A 2CDUA 2Y6RA 5GSNA 1W4XA 2APGA 2YWLA 4JQ9A 2C65A 2QA2A 1ZP0A 3QVPA 2XVJA 3D8XA 1H84A 1GXFA 2JB3A 4EMWA 2CULA 2BXRA 2YR6A 4J36A 1VQWA 5EOWA 1TDFA 1S7MA 3L8KA 2WHDA 3QVRA 4CRTA 4NTCA 3O0HA 4EIQA 3I3LA 3CGDA 4CNJA 3AE7A 2WS3A 2WU2A 1Y56A 4WX1A 1PJ5A 4Y4MA 3NN6X 5KMSA 2A8XA 3AE8A 4GF7A 2YR5A 4B67A 4AT0A 3LZXA 4AOXA 2XVFA 3SXIA 2GMJA 1KF6A 1YQ3A 1X31B 1H86A 2PHHA 4YXDA 1XHCA 4FK1A 3GRTA 2C75A 4XWRA 3CTYA 5L46A 2YLSA 5JCNA 2BK4A 1GETA 2QA1A 1N1PA 4B65A 1K0JA 2C64A 3UTHA 1VDCA 4A9WA 4Z2RA 2OALA 4BJZA 5BRTA 3NYCA 1GPEA 2YVGA 4DGKA 2EQ9A 1IJHA 1H6VA 3SX6A 3GYXA 3WE0A 1EL8A 4B69A 2C3CA 2VVLA 2BRAA 1S3BA 4TLZA 3LJPA 3IHMA 1PBFA 2CVJA 3NKSA 1PN0A 4U2LA 2A89A 4M52A 2E4GA 1AOGA 1EL7A 1S3EA 1LVLA 3DGZA 4YTMA 5BULA 1GRBA 4C3XA 1OJCA 4E0VA 2B7SA 1CC2A 4J33A 2BK5A 4BURA 1N4WA 2VQ7A 3QFBA 3AD8B 4J34A 4N9XA 4H4WA 4P9SA 1EL5A 1GTEA 3ATQA 3H8LA 3ALMA 1IUVA 3GD4A 4H7UA 3KD9A 1PJ7A 1S2QA 1H2IA 1OJDA 3QSMA 1YY5A 4C3YA 4EQRA 3DK8A 4D03A 3LB8A 2GEWA 4TM1A 2IVDA 2R46A 1JU2A 1Q9IA 5HHFA 4CCRA 1RYIA 2IIDA 3ALJA 3DJJA 3VRBA 3V3OA 1B37A 3P9UA 4REKA 1IUSA 3L5OA 2Q0LA 4ZCDA 4GAPA 2H88A 4OPLA 3ZYXA 4OPGA 4YSHA 4H4XA 2WPCA 5KXJA 3UOYA 1PBEA 4ADWA 1VRQB 3HZLA 3QJ4A 4Z2UA 1V59A 4NEWA 4EQSA 1DOCA 4BK2A 1D4EA 1Q1WA 2GQFA 4ECHA 3F8RA 1NAAA 3NN0X 5KVIA 3DMEA 1ZMDA 3BNMA 4JNQA 4C74A 2R4JA 2YVFA 4H4RA 4Z26A 3SFDA 2BC0A 4O5QA 3UKLA 4X9MA 2VZ2A 3AE4A 2FJBA 5JCIA 2GRTA 2DKHA 1F8WA 5ER0A 3UP4A 1GTHA 3T37A 4Z43A 1NPXA 2V60A 4UDPA 2BXSA 4IVOB 4LA1A 2XFQA 2R9ZA 3NK2X 4TLXA 2E1MA 2YQUA 4EM3A 3K30A 4H4QA 2C66A 3AD7B 5FS7A 1H82A 3GYIA 2B76A 3QSSA 2YR4A 3AEGA 1GRHA 1JOAA 2W0HA 2NVKX 3GYJA 1GRTA 3UKPA 2O9ZA 1BF3A 4H4YA 2WDRA 3SY4A 3B6DA 4APNA 2XLSA 4AOSA 3VR9A 3KPKA 1VG0A 3C4AA 2RGOA 4GUVA 3T2KA 3ATRA 3SYIA 2XFNA 5J60A 3LADA 2GV8A 4G74A 1E7PA 3NGCX 4OPTA 4TM3A 3VRDB 1DXLA 3GD3A 5HYMA 3AE3A 1D5TA 3UCLA 1D7LA 3VR8A 3NT6A 4U8KA 3BI4A 5FS6A 2GVCA 4U8LA 2YG3A 3V3NA 3T2YA 2H89A 5HXIA 2Q7VA 1JNRA 3DK9A 4EIPA 2R0CA 2Z5YA 1GT8A 2EQ6A 3CNPA 4OPCA 4A65A 4AP3A 2X3NA 3PS9A 3P4SA 5KOXA 4UP3A 2C7GA 3NYFA 2RGHA 1NENA 1K0IA 1OJ9A 3ABVA 1TYPA 2WQYA 2YG7A 1LQTA 1E6EA 2Q0KA 1RSGA 2YLRA 2VQBA 3C4NA 3P1WA 1PXCA 3CMMA 3IWAA 4U2TA 4IV9A 1BGNA 1PBDA 1PHHA 4U8IA 5JRBA 3ADAB 3UOXA 3GWFA 2AAQA 3BHKA 4H2PA 4NWZA 3DK4A 5JCLA 2BK3A 2XLRA 3AE9A 4YSXA 3QFAA 4K8DA 2XLTA 1JRZA 1CL0A 3T0KA 4EM4A 2VVMA 4Z25A 1P2HA 1TDOA 2XDOA 3M0OA 3BI5A 1LV0A 2YLXA 2YM1A 3UKHA 3GMCA 2BS3A 2ARDA 2B9XA 3AYJA 3P4PA 2YVJA 1Y56B 3ICSA 2R45A 2BCPA 3GDNA 2Z5XA 4I59A 2AQJA 1Q1RA 2JBVA 3CNTA 3CPIG 2V5ZA 3DJEA 4JY2A 4U8OA 2DKIA 3AEBA 4B66A 3CPHG 4II2A 1JNZA 2XVHA 1DODA 1BKWA 2WDVA 2PYXA 3REDA 2RABA 3ZDNA 3CNDA 3NTAA 2OLNA 1JRXA 3VRAA 5FS8A 1CHUA 2UZZA 1DOEA 3EPTA 1ELIA 1OJAA 1NG3A 3HYXA 2X8HA 5CKUA 1DOBA 3Q9TA 3SZCA 3ICRA 2X8CA 1F8RA 3KU9A 1PS9A 3Q6JA 2C67A 3BNUA 3T14A 4YKGA 1ZY8A 2HQMA 2B7RA 1VG9A 3SQPA 3AE6A 4NEVA 3BI2A 3UOVA 3AEFA 1KN0A 1O94A 2XFUA 4KX6A 2WOVA 1TDKA 4B64A 1BZLA 1SEZA 3AYIA 5U1OA 4J2WA 2BC1A 4DNAA 4J57A 4K7ZA 2IVEA 4K2XA 4OVIA 2OAMA 4Z24A 1CC4A 1ZOVA 3AWIA 3JSKA 1B4VA 3AXBA 1TDEA 1L9DA 2YG4A 2GH5A 3AYLA 3NIXA 1ZKQA 3KKJA 4H4ZA 2FBWA 1CJ3A 1FECA 2XVIA 3G5SA 3FIMB 3UKAA 4OPUA 3S5WA 4JN9A 1TDNA 1H81A 5BUKA 2XYOA 4CNKA 5U25A 1FL2A 2R0GA 2X50A 4TM0A 2GQWA 2B9YA 1LQUA 3PO7A 4H4TA 4YWOA 2EQ7A 3EANA 1TYTA 3QSEA 1E1KA 2WETA 3D1CA 1GNDA 3DGHA 2WPFA 3F8PA 4HB9A 5JCKA 3DJDA 3LXDA 1D4DA 1PJ6A 1COYA 2FJAA 4X9NA 4Z44A 1E1LA 3ITJA 1ZMCA 1KNRA 3NRNA 4CY8A 2GAHB 3FPZA 3KA7A 5U63A 5IPYA 1H7XA 1HYUA 1YQ4A 3ICTA 4IA6A 3SM8A 3KPFA 1ZDLA 2F5ZA 1XANA 3CGBA 4LIIA 5C3JA 4NTDA 4USRA 3RHAA 5KMPA 3SFEA 5EBKA 1N4VA 3CNSA 1DJQA 4GDPA 3FG2P 2VOUA 3IHGA 1GRFA 2C72A 4JNAA 2R4EA 5J7XA 3ISHA 4DSGA 2V3BA 4NTEA 2JAEA 1O95A 2A87A 4UDQA 3GWDA 3RP7A 3NG7X 5FMHA 3UP5A 2WESA 2Q6UA 3P4RA 2XFPA 4U8JA 4YSZA 1FOHA 3GMBA 1NHPA 3NLCA 4BK3A 2EQ8A 1MO9A 3AEDA 2NPXA 4GRTA 1M6IA 5FS9A 2XLPA 2WOIA 5EB5A 4TM4A 3I6DA 5C2TA 1GSNA 4CBQA 4KPRA 1XPQA 4USQA 4BK1A 2GR1A 3DA1A 4GDEA 1PDHA 2GF3A 4U8MA 2YLWA 1ZX9A 3DH9A 3AE2A 3SZFA 3G5RA 3HYVA 4K5SA 5JCMA 1FCDA 2C3DA 3PG6A 3AEEA 2GAGB 2R0PA 2C4CA 4AT2A 2JK6A 4A6NB 1GERA 1F3PA 2BACA 1NEKA 4GAVA 4BJYA 4DSHA 1Z6LA 3NK0X 1KSSA 3SGLA 1KFYA 5KVHA 4RSLA 4A79A 1CBOA 4B1BA 3COXA 2J3NA 1H7WA 2I0ZA 4K5RA 3UKFA 4G6HA 4NNJA 2BCGG 2WP5A 2GB0A 2OLOA 1B8SA 3GSIA 3IC9A 1LTXR 1JRYA 2YG5A 1UKVG 1YQZA 1NHSA 3SZWA 1GESA 1BWCA 4C77A 1E39A 3B3RA 3M13A 4FDCB 3AECA 4YSYA 2XFOA 2WBAA 1QLBA 4IVMB 5DBJA 1ZK7A 5KWFA 1E1NA 1DJNA 2B9WA 4OPDA 3DJGX 1P2EA 4H2RA 3G5QA 4NZHA 4O5UA 3LOVA 3NH3X 4C5OA 2VRLA 2C76A 2WPEA 1YKJA 2QCUA 1F8SA 4JY3A 3KLJA 3C96A 3UTEA 1O5WA 2JB1A 3AD9B 4H50A 2WDQA 3FMWA 2BRYA 1MOKA 4YTNA 1IUXA 2WU5A 3SZ0A 3CNJA 3FBSA 1CJCA 1F6MA 5IQ1A 1QO8A 4H4PA 1IUTA 1CJ2A 4YT0A 2QAEA 2ZBWA 3NYEA 4Y4LA 3V76A 1Y0PA 4K22A 2GR0A 1CC6A 1QJDA 4EQWA 2XCGA 3UOZA 5M10A 4Z2TA 3AE5A 3T2ZA 2V61A 3NK1X 4HA6A 4H2NA 4GCMA 1PBBA 5KMQA 4XWZA 1JEHA 4PAAA 4AP1A 1EL9A 4EMIA 1M64A 4WCTA 2WEUA 2GR3A 5IQ4A 3KVEA 1LPFA 1K0LA 2TMDA 2WP6A 4MJWA 4H2QA 4U8NA 3UTFA 1GEUA 2OA1A 2RGJA 4B63A 3K7QX 1K4QA 3CGEA 2X8GA 2E5VA 3ALLA 1NG4A 4U2SA 1PXAA 4II3A 4U8PA 3RP8A 3S61A 3P4QA 2V3AA 1PBCA 1D7YA 1N4UA 3L1RA 3AEAA 3K7MX 5BVAA 2TPRA 1GALA 2CFYA 1D4CA 3BHFA 1LJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTP A;  2ZZB A;  1EBD A;  3EF6 A;  4EMJ A;  1CJ4 A;  1TRB A;  3LZW A;  5M0Z A;  4H4V A;  4RG3 A;  1E1M A;  1REO A;  2ACZ A;  4Y4N A;  3H8I A;  2JB2 A;  3GRS A;  1L9E A;  2FJE A;  2VVL G;  3UTG A;  4B69 A;  2XVE A;  2BAB A;  4ICY A;  4BV6 A;  4FX9 A;  2BA9 A;  1IUW A;  1KSU A;  4I58 A;  1H83 A;  4H4S A;  2ZZ0 A;  1L9C A;  3H4K A;  2AR8 A;  2YAU A;  3CIR A;  4OCG A;  2V6O A;  3R9U A;  1XDI A;  2YLZ A;  1ZOY A;  3CN8 A;  4OPI A;  4CY6 A;  3IF9 A;  1RP0 A;  4J31 A;  2BS4 A;  3PVC A;  1ONF A;  1GRG A;  1CF3 A;  1S2Y A;  5TR3 A;  4A99 A;  1KDG A;  3UKK A;  3VQR A;  3M12 A;  1L0V A;  4H4U A;  3AE1 A;  4B68 A;  1FEA A;  1B5Q A;  4LU6 A;  4CCQ A;  2BYB A;  2C73 A;  2YLT A;  3K7T A;  3URH A;  3CGC A;  2WOW A;  2X99 A;  4EQX A;  3E1T A;  3NHO X;  3OZ2 A;  4XXG A;  4YKF A;  2YG6 A;  4ZCC A;  5KOW A;  2JKC A;  4RG4 A;  1NDA A;  4ZN0 A;  3NTD A;  5CQF A;  3NNE A;  3EAO A;  2YM2 A;  4A5L A;  4UDR A;  1NHQ A;  2XLU A;  1GRE A;  3AB1 A;  1PXB A;  2ZZC A;  1GV4 A;  3II4 A;  4FK1 C;  5GRT A;  2GMH A;  2VRM A;  3GDP A;  1FEB A;  4JDR A;  4A7A A;  4X4J A;  5EB4 A;  3OC4 A;  1GRA A;  1NHR A;  2C70 A;  1BGJ A;  3F8D A;  5HY5 A;  4PAB A;  3CPJ G;  2GR2 A;  2WP9 A;  3RP6 A;  4A6N A;  1DNC A;  5KRQ A;  4J56 A;  5LV9 A;  3UKQ A;  2FJD A;  3RNM A;  4GR1 A;  2Y6Q A;  1MXT A;  1KNP A;  1GOS A;  4IA5 A;  1IUU A;  4D04 A;  1OJT A;  2BS2 A;  2CDU A;  2Y6R A;  5GSN A;  1W4X A;  2APG A;  2YWL A;  4JQ9 A;  2C65 A;  2QA2 A;  1ZP0 A;  3QVP A;  2XVJ A;  3D8X A;  1H84 A;  1GXF A;  2JB3 A;  4EMW A;  2CUL A;  2BXR A;  2YR6 A;  4J36 A;  1VQW A;  5EOW A;  1TDF A;  3L8K A;  2WHD A;  3QVR A;  4CRT A;  4NTC A;  3O0H A;  4EIQ A;  3I3L A;  3CGD A;  4CNJ A;  3AE7 A;  2WS3 A;  2WU2 A;  1Y56 A;  4WX1 A;  1PJ5 A;  4Y4M A;  3NN6 X;  2A8X A;  3AE8 A;  4GF7 A;  2YR5 A;  4B67 A;  4AT0 A;  3LZX A;  4AOX A;  2XVF A;  2GMJ A;  1KF6 A;  1YQ3 A;  1X31 B;  1H86 A;  2PHH A;  4YXD A;  1XHC A;  4FK1 A;  3GRT A;  2C75 A;  4XWR A;  3CTY A;  5L46 A;  2YLS A;  5JCN A;  2BK4 A;  1GET A;  2QA1 A;  1N1P A;  4B65 A;  1K0J A;  2C64 A;  3UTH A;  1VDC A;  4A9W A;  4Z2R A;  2OAL A;  4BJZ A;  5BRT A;  3NYC A;  1GPE A;  2YVG A;  4DGK A;  2EQ9 A;  1IJH A;  1H6V A;  3WE0 A;  1EL8 A;  2C3C A;  2VVL A;  1S3B A;  4TLZ A;  3LJP A;  3IHM A;  1PBF A;  2CVJ A;  3NKS A;  1PN0 A;  4U2L A;  2A89 A;  4M52 A;  2E4G A;  1AOG A;  1EL7 A;  1S3E A;  1LVL A;  3DGZ A;  4YTM A;  5BUL A;  1GRB A;  4C3X A;  1OJC A;  4E0V A;  2B7S A;  1CC2 A;  4J33 A;  2BK5 A;  4BUR A;  1N4W A;  2VQ7 A;  3QFB A;  3AD8 B;  4J34 A;  4N9X A;  4H4W A;  4P9S A;  1EL5 A;  1GTE A;  3ATQ A;  3H8L A;  3ALM A;  1IUV A;  3GD4 A;  4H7U A;  3KD9 A;  1PJ7 A;  1S2Q A;  1OJD A;  3QSM A;  1YY5 A;  4C3Y A;  4EQR A;  3DK8 A;  4D03 A;  3LB8 A;  2GEW A;  4TM1 A;  2IVD A;  2R46 A;  1JU2 A;  1Q9I A;  5HHF A;  4CCR A;  1RYI A;  2IID A;  3ALJ A;  3DJJ A;  3VRB A;  3V3O A;  1B37 A;  3P9U A;  4REK A;  1IUS A;  2Q0L A;  4ZCD A;  3ZYX A;  2H88 A;  4OPL A;  4OPG A;  4YSH A;  4H4X A;  2WPC A;  5KXJ A;  3UOY A;  1PBE A;  4ADW A;  1VRQ B;  3HZL A;  3QJ4 A;  4Z2U A;  1V59 A;  4NEW A;  4EQS A;  1DOC A;  4BK2 A;  1D4E A;  1Q1W A;  2GQF A;  4ECH A;  3F8R A;  1NAA A;  3NN0 X;  5KVI A;  3DME A;  1ZMD A;  3BNM A;  4JNQ A;  4C74 A;  2R4J A;  2YVF A;  4H4R A;  4Z26 A;  3SFD A;  2BC0 A;  4O5Q A;  3UKL A;  4X9M A;  2VZ2 A;  3AE4 A;  2FJB A;  5JCI A;  2GRT A;  2DKH A;  1F8W A;  5ER0 A;  3UP4 A;  1GTH A;  3T37 A;  4Z43 A;  1NPX A;  2V60 A;  4UDP A;  2BXS A;  4IVO B;  4LA1 A;  2XFQ A;  2R9Z A;  3NK2 X;  4TLX A;  2E1M A;  2YQU A;  4EM3 A;  3K30 A;  4H4Q A;  2C66 A;  3AD7 B;  5FS7 A;  1H82 A;  3GYI A;  2B76 A;  3QSS A;  2YR4 A;  3AEG A;  1GRH A;  1JOA A;  2W0H A;  2NVK X;  3GYJ A;  1GRT A;  3UKP A;  2O9Z A;  1BF3 A;  4H4Y A;  2WDR A;  3B6D A;  4APN A;  2XLS A;  4AOS A;  3VR9 A;  1VG0 A;  3C4A A;  2RGO A;  4GUV A;  3ATR A;  2XFN A;  5J60 A;  3LAD A;  2GV8 A;  1E7P A;  3NGC X;  4OPT A;  4TM3 A;  3VRD B;  1DXL A;  3GD3 A;  5HYM A;  3AE3 A;  1D5T A;  3UCL A;  1D7L A;  3VR8 A;  3NT6 A;  4U8K A;  3BI4 A;  5FS6 A;  2GVC A;  4U8L A;  2YG3 A;  3V3N A;  2H89 A;  5HXI A;  2Q7V A;  1JNR A;  3DK9 A;  4EIP A;  2R0C A;  2Z5Y A;  1GT8 A;  2EQ6 A;  3CNP A;  4OPC A;  4A65 A;  4AP3 A;  2X3N A;  3PS9 A;  3P4S A;  5KOX A;  4UP3 A;  2C7G A;  3NYF A;  2RGH A;  1NEN A;  1K0I A;  1OJ9 A;  3ABV A;  1TYP A;  2WQY A;  2YG7 A;  1LQT A;  1E6E A;  2Q0K A;  1RSG A;  2YLR A;  2VQB A;  3C4N A;  3P1W A;  1PXC A;  3IWA A;  4U2T A;  4U8I A;  4IV9 A;  1BGN A;  1PBD A;  1PHH A;  3ADA B;  3UOX A;  3GWF A;  2AAQ A;  3BHK A;  4H2P A;  3DK4 A;  5JCL A;  2BK3 A;  2XLR A;  3AE9 A;  4YSX A;  3QFA A;  4K8D A;  2XLT A;  1JRZ A;  1CL0 A;  4EM4 A;  2VVM A;  4Z25 A;  1P2H A;  1TDO A;  2XDO A;  3M0O A;  3BI5 A;  1LV0 A;  2YLX A;  2YM1 A;  3UKH A;  3GMC A;  2BS3 A;  2ARD A;  2B9X A;  3AYJ A;  3P4P A;  2YVJ A;  1Y56 B;  3ICS A;  2R45 A;  2BCP A;  3GDN A;  2Z5X A;  4I59 A;  2AQJ A;  1Q1R A;  2JBV A;  3CNT A;  3CPI G;  2V5Z A;  3DJE A;  4JY2 A;  4U8O A;  2DKI A;  3AEB A;  4B66 A;  3CPH G;  1JNZ A;  2XVH A;  1DOD A;  1BKW A;  2WDV A;  2PYX A;  3RED A;  2RAB A;  3ZDN A;  3CND A;  3NTA A;  2OLN A;  1JRX A;  3VRA A;  5FS8 A;  1CHU A;  2UZZ A;  1DOE A;  3EPT A;  1ELI A;  1OJA A;  1NG3 A;  2X8H A;  5CKU A;  1DOB A;  3Q9T A;  3ICR A;  2X8C A;  1F8R A;  3KU9 A;  1PS9 A;  3Q6J A;  2C67 A;  3BNU A;  4YKG A;  1ZY8 A;  2HQM A;  2B7R A;  1VG9 A;  3SQP A;  3AE6 A;  4NEV A;  3BI2 A;  3UOV A;  3AEF A;  1O94 A;  2XFU A;  4KX6 A;  2WOV A;  1TDK A;  4B64 A;  1BZL A;  1SEZ A;  3AYI A;  5U1O A;  4J2W A;  2BC1 A;  4DNA A;  4J57 A;  4K7Z A;  2IVE A;  4K2X A;  4OVI A;  2OAM A;  4Z24 A;  1CC4 A;  1ZOV A;  3AWI A;  3JSK A;  1B4V A;  3AXB A;  1TDE A;  1L9D A;  2YG4 A;  2GH5 A;  3AYL A;  3NIX A;  1ZKQ A;  3KKJ A;  4H4Z A;  2FBW A;  1CJ3 A;  1FEC A;  2XVI A;  3G5S A;  3FIM B;  3UKA A;  4OPU A;  3S5W A;  4JN9 A;  1TDN A;  1H81 A;  5BUK A;  2XYO A;  4CNK A;  5U25 A;  1FL2 A;  2R0G A;  2X50 A;  4TM0 A;  2GQW A;  2B9Y A;  1LQU A;  3PO7 A;  4H4T A;  4YWO A;  2EQ7 A;  3EAN A;  1TYT A;  3QSE A;  1E1K A;  2WET A;  3D1C A;  1GND A;  3DGH A;  2WPF A;  3F8P A;  4HB9 A;  5JCK A;  3DJD A;  3LXD A;  1D4D A;  1PJ6 A;  1COY A;  2FJA A;  4X9N A;  4Z44 A;  1E1L A;  3ITJ A;  1ZMC A;  1KNR A;  3NRN A;  4CY8 A;  2GAH B;  3FPZ A;  3KA7 A;  5U63 A;  5IPY A;  1H7X A;  1HYU A;  1YQ4 A;  3ICT A;  4IA6 A;  3SM8 A;  3KPF A;  1ZDL A;  2F5Z A;  1XAN A;  3CGB A;  4LII A;  5C3J A;  4NTD A;  4USR A;  3RHA A;  3SFE A;  5EBK A;  1N4V A;  3CNS A;  1DJQ A;  4GDP A;  3FG2 P;  2VOU A;  3IHG A;  1GRF A;  2C72 A;  4JNA A;  2R4E A;  5J7X A;  3ISH A;  4DSG A;  2V3B A;  4NTE A;  2JAE A;  1O95 A;  2A87 A;  4UDQ A;  3GWD A;  3RP7 A;  3NG7 X;  5FMH A;  3UP5 A;  2WES A;  2Q6U A;  3P4R A;  2XFP A;  4U8J A;  4YSZ A;  1FOH A;  3GMB A;  1NHP A;  3NLC A;  4BK3 A;  2EQ8 A;  1MO9 A;  3AED A;  2NPX A;  4GRT A;  1M6I A;  5FS9 A;  2XLP A;  2WOI A;  5EB5 A;  4TM4 A;  3I6D A;  5C2T A;  1GSN A;  4CBQ A;  4KPR A;  1XPQ A;  4USQ A;  4BK1 A;  2GR1 A;  3DA1 A;  4GDE A;  1PDH A;  2GF3 A;  4U8M A;  2YLW A;  1ZX9 A;  3DH9 A;  3AE2 A;  3G5R A;  4K5S A;  5JCM A;  1FCD A;  2C3D A;  3AEE A;  2GAG B;  2R0P A;  4AT2 A;  2JK6 A;  4A6N B;  1GER A;  1F3P A;  2BAC A;  1NEK A;  4BJY A;  4DSH A;  1Z6L A;  3NK0 X;  1KSS A;  3SGL A;  1KFY A;  5KVH A;  4RSL A;  4A79 A;  1CBO A;  4B1B A;  3COX A;  2J3N A;  1H7W A;  2I0Z A;  4K5R A;  3UKF A;  2BCG G;  2WP5 A;  2GB0 A;  2OLO A;  1B8S A;  3GSI A;  3IC9 A;  1LTX R;  1JRY A;  2YG5 A;  1UKV G;  1YQZ A;  1NHS A;  1GES A;  1BWC A;  4C77 A;  1E39 A;  3B3R A;  3M13 A;  4FDC B;  3AEC A;  4YSY A;  2XFO A;  2WBA A;  1QLB A;  4IVM B;  5DBJ A;  1ZK7 A;  5KWF A;  1E1N A;  1DJN A;  2B9W A;  4OPD A;  3DJG X;  1P2E A;  4H2R A;  3G5Q A;  4NZH A;  4O5U A;  3LOV A;  3NH3 X;  4C5O A;  2VRL A;  2C76 A;  2WPE A;  1YKJ A;  2QCU A;  1F8S A;  4JY3 A;  3KLJ A;  3C96 A;  3UTE A;  1O5W A;  2JB1 A;  3AD9 B;  4H50 A;  2WDQ A;  3FMW A;  1MOK A;  4YTN A;  1IUX A;  2WU5 A;  3CNJ A;  3FBS A;  1CJC A;  1F6M A;  5IQ1 A;  1QO8 A;  4H4P A;  1IUT A;  1CJ2 A;  4YT0 A;  2QAE A;  2ZBW A;  3NYE A;  4Y4L A;  3V76 A;  1Y0P A;  4K22 A;  2GR0 A;  1CC6 A;  1QJD A;  4EQW A;  2XCG A;  3UOZ A;  5M10 A;  4Z2T A;  3AE5 A;  2V61 A;  3NK1 X;  4HA6 A;  4H2N A;  4GCM A;  1PBB A;  4XWZ A;  1JEH A;  4PAA A;  4AP1 A;  1EL9 A;  4EMI A;  1M64 A;  4WCT A;  2WEU A;  2GR3 A;  5IQ4 A;  3KVE A;  1LPF A;  1K0L A;  2TMD A;  2WP6 A;  4MJW A;  4H2Q A;  4U8N A;  3UTF A;  1GEU A;  2OA1 A;  2RGJ A;  4B63 A;  3K7Q X;  1K4Q A;  3CGE A;  2X8G A;  2E5V A;  3ALL A;  1NG4 A;  4U2S A;  1PXA A;  4U8P A;  3RP8 A;  3S61 A;  3P4Q A;  2V3A A;  1PBC A;  1D7Y A;  1N4U A;  3L1R A;  3AEA A;  3K7M X;  5BVA A;  2TPR A;  1GAL A;  2CFY A;  1D4C A;  3BHF A;  1LJ1 A; 
#chains in the Genus database with same CATH topology
 2W54 A;  4YTP A;  1EBD A;  3S5S A;  3T4W A;  3V4B A;  2JB2 A;  1L9E A;  3QN3 A;  2XVE A;  1X2H A;  3K1G A;  3VA8 A;  4I58 A;  4H4S A;  5KNL A;  4CY6 A;  4GGB A;  4JN7 A;  4J3Z A;  4MGG A;  1GRG A;  4A99 A;  3VQR A;  3M12 A;  4H4U A;  4B68 A;  1B5Q A;  2YLT A;  4GYP C;  3URH A;  4IL2 A;  3E1T A;  4YKF A;  3SN0 A;  4RG4 A;  4ZN0 A;  3EAO A;  4A5L A;  3P3B A;  2PGE A;  3RRA A;  1GV4 A;  5GRT A;  4JDR A;  5EB4 A;  3JVA A;  2O56 A;  2GR2 A;  2WP9 A;  1TKK A;  4J56 A;  4D04 A;  3NVV B;  3DIP A;  2BS2 A;  1W4X A;  1ZP0 A;  1H84 A;  4EMW A;  2CUL A;  2YR6 A;  4KEM A;  1S7M A;  2WHD A;  3O0H A;  1N5W C;  2WU2 A;  3NN6 X;  1EC7 A;  4GF7 A;  3N4F A;  4B67 A;  4AOX A;  3LZX A;  2XVF A;  1KF6 A;  4XWR A;  5L46 A;  2BK4 A;  1N1P A;  4B65 A;  1K0J A;  2C64 A;  3RR1 A;  3UTH A;  4BJZ A;  3NYC A;  1GPE A;  1H6V A;  1S3B A;  4TLZ A;  3NKS A;  1AOG A;  1EL7 A;  1S3E A;  3DGZ A;  3DEQ A;  2ONE A;  4C3X A;  1JRO A;  3HPF A;  3FYY A;  3R11 A;  5G5G B;  1CC2 A;  3QFB A;  3RGT A;  4DHG A;  3IJI A;  3KD9 A;  1PJ7 A;  2XH0 A;  1H2I A;  3ZVH B;  4EQR A;  2GEW A;  3NS1 B;  1JU2 A;  2IID A;  2P0I A;  4YSH A;  3NVY B;  4ADW A;  3HW2 A;  2GQF A;  3F8R A;  3EEZ A;  4JNQ A;  3SFD A;  4GFI A;  1FFU C;  2OX4 A;  1F8W A;  1GTH A;  1R6W A;  2XH7 A;  4IVO B;  2DW6 A;  5FJU A;  3K30 A;  3GYI A;  3H7V A;  2YR4 A;  1JOA A;  2OPJ A;  4APN A;  3KPK A;  2RGO A;  4G74 A;  1NU5 A;  3NZG A;  3NGC X;  4TM3 A;  3VRD B;  5HYM A;  1D5T A;  3NT6 A;  4DX3 A;  4U8K A;  3BI4 A;  2YG3 A;  3IJQ A;  2Z5Y A;  1GT8 A;  2EQ6 A;  3CNP A;  4A65 A;  5KOX A;  2RGH A;  3A7U A;  1LQT A;  1E6E A;  3P1W A;  1PXC A;  3UOX A;  1FIQ B;  3GWF A;  3BHK A;  4H2P A;  3QPE A;  1JRZ A;  4Z25 A;  1P2H A;  1TDO A;  2YLX A;  2QJN A;  1EC8 A;  2BCP A;  2Z5X A;  3CNT A;  2XH4 A;  2DKI A;  3CPH G;  2OZ8 A;  3R10 A;  3RO6 A;  3NRZ B;  2RAB A;  1OEP A;  5FS8 A;  2UZZ A;  1NG3 A;  2X8H A;  3NFU A;  3Q6J A;  2C67 A;  2B7R A;  1BKH A;  3BI2 A;  3OZY A;  2PPG A;  4KX6 A;  3UJF A;  1SEZ A;  4K2X A;  5FJR A;  3JSK A;  1B4V A;  3AYL A;  2GH5 A;  3FIM B;  4IP5 A;  3S5W A;  3SBF A;  2XYO A;  3PO7 A;  2OQY A;  4YWO A;  1EBG A;  1TYT A;  3F8P A;  3UGV A;  3GC2 A;  1PJ6 A;  2FJA A;  3ITJ A;  1ZMC A;  2PU0 A;  1KNR A;  2GAH B;  5U63 A;  4IA6 A;  3KPF A;  4LII A;  1XPY A;  3RHA A;  2E5A A;  3UXL A;  5EBK A;  3CNS A;  1DJQ A;  4NTE A;  4UDQ A;  3RP7 A;  2WES A;  2Q6U A;  4YSZ A;  1FOH A;  3GMB A;  4GRT A;  3MQT A;  1ECQ A;  3NXL A;  5C2T A;  4CBQ A;  1WUE A;  2QGY A;  2C3D A;  3DG3 A;  2JK6 A;  4A6N B;  2PTY A;  3B97 A;  1NEK A;  4GAV A;  2XH2 A;  1KFY A;  4RSL A;  3VCN A;  5FJT A;  1H7W A;  2I0Z A;  4K5R A;  4NNJ A;  2OLO A;  3GSI A;  3IC9 A;  2YG5 A;  4C77 A;  3DFY A;  4FDC B;  4YSY A;  2AL2 B;  4IVM B;  3IK4 A;  5KWF A;  1E1N A;  4OPD A;  3DJG X;  3G5Q A;  4NZH A;  4O5U A;  3NH3 X;  1P48 A;  3C96 A;  4ZOH B;  2JB1 A;  3FMW A;  2QQ6 A;  3MY9 A;  1RVK A;  1IUX A;  2WU5 A;  5IQ1 A;  2XSX A;  1CJ2 A;  3B9J B;  3V76 A;  2ZBW A;  3UJE A;  1QJD A;  1EC9 A;  3AE5 A;  2V61 A;  2POZ A;  4H2N A;  3N4E A;  1PBB A;  1VQZ A;  4PAA A;  4WCT A;  2GR3 A;  4U8N A;  4B63 A;  2E5V A;  4E6M A;  3NO1 A;  1FHV A;  3AEA A;  5BVA A;  1GAL A;  3BHF A;  4M6U A;  3A7R A;  2E3T A;  3EF6 A;  1CJ4 A;  1TRB A;  3CB3 A;  3LZW A;  5M0Z A;  1E1M A;  4G73 A;  4ICY A;  4FX9 A;  1IUW A;  1KSU A;  3CIR A;  3H12 A;  2V6O A;  2YLZ A;  4OPI A;  1MDR A;  3IF9 A;  3HYW A;  1RP0 A;  4J31 A;  2BS4 A;  1ONF A;  1KDG A;  4EWJ A;  3AE1 A;  1FEA A;  4CCQ A;  3FJ4 A;  2C73 A;  4EQX A;  3CGC A;  3S47 A;  1PDY A;  3OZ2 A;  2YG6 A;  2JKC A;  3T9P A;  5CQF A;  1JCT A;  2OO6 A;  3NNE A;  2YM2 A;  4UDR A;  4H1Z A;  3AB1 A;  1PXB A;  4FK1 C;  3GDP A;  3R07 C;  4G7F A;  4X4J A;  4G9K A;  2C70 A;  5HY5 A;  3CPJ G;  5KRQ A;  3AN1 A;  3UKQ A;  4MMW A;  2Y6Q A;  3UXK A;  4E5T A;  5GSN A;  4JQ9 A;  1EBH A;  2XVJ A;  3R0U A;  1GXF A;  2JB3 A;  4H2H A;  4J36 A;  3L8K A;  4EIQ A;  3I3L A;  3CGD A;  1PJ5 A;  3AE8 A;  2YR5 A;  1XHC A;  3GRT A;  2C75 A;  4Z17 A;  4DYE A;  2YLS A;  2QA1 A;  5J04 A;  2NQL A;  4HNC A;  4X2P A;  1VDC A;  4A9W A;  4Z2R A;  2OAL A;  2YVG A;  3GYX A;  1EL8 A;  1DTN A;  2BRA A;  4ZCW A;  3IHM A;  2CVJ A;  1PN0 A;  4U2L A;  4E4F A;  3HRD C;  4YTM A;  5BUL A;  3UCD A;  2B7S A;  4BUR A;  2VQ7 A;  4N9X A;  4P9S A;  1GTE A;  3ALM A;  4FI4 A;  1S2Q A;  2GGH A;  4JHM A;  2IVD A;  2R46 A;  5HHF A;  1RYI A;  3V3O A;  1FO4 A;  3P9U A;  3L5O A;  3ZYX A;  2H88 A;  3UOY A;  3HZL A;  1V59 A;  1Q1W A;  4ECH A;  1W6T A;  1ZMD A;  2R4J A;  3UKL A;  4X9M A;  2DKH A;  3UP4 A;  1RM6 B;  4UDP A;  3ES7 A;  2BXS A;  3EKG A;  4LA1 A;  4H19 A;  2XFQ A;  3OW1 A;  1N60 C;  3FXG A;  4EM3 A;  3D47 A;  5FS7 A;  1H82 A;  3RIT A;  3QSS A;  2NVK X;  3GYJ A;  2O9Z A;  1BF3 A;  2WDR A;  3B6D A;  4AOS A;  1VG0 A;  3C4A A;  3T2K A;  3ATR A;  3SYI A;  5J60 A;  4GGH A;  4TVW A;  2GV8 A;  4OPT A;  2DW7 A;  3GD3 A;  3VR8 A;  5FS6 A;  2GVC A;  3T2Y A;  2H89 A;  5HXI A;  4EIP A;  3DK9 A;  4OPC A;  2X3N A;  2OVL A;  3P4S A;  1NEN A;  1K0I A;  3TJ4 A;  4HN8 A;  2WQY A;  5BOE A;  2Q0K A;  3C4N A;  4U8I A;  4IV9 A;  2PSN A;  5JRB A;  3ADA B;  2PS2 A;  2BK3 A;  2XLR A;  4YSX A;  3IJL A;  3M0O A;  3BI5 A;  1LV0 A;  2YM1 A;  2BS3 A;  2ARD A;  2B9X A;  3ICS A;  2CHR A;  3GDN A;  3VC5 A;  3CPI G;  1Q1R A;  4U8O A;  1JNZ A;  2XVH A;  1DOD A;  1BKW A;  3RED A;  3ZDN A;  3TW9 A;  1JRX A;  3VRA A;  1CHU A;  1DOE A;  1OJA A;  3SZC A;  3Q9T A;  1JPM A;  3BNU A;  1ZY8 A;  3AE6 A;  4KT2 A;  1KCZ A;  3ZLG A;  3ZLF A;  3UOV A;  4IT1 A;  2WOV A;  3ZVH A;  4B64 A;  2OKT A;  2GGG A;  4DNA A;  2IVE A;  2OAM A;  3THU A;  1ZOV A;  3AXB A;  2YG4 A;  1ZKQ A;  5ENL A;  2FBW A;  2XVI A;  3JW7 A;  3BJS A;  1TDN A;  5BUK A;  5U25 A;  3TWB A;  2X50 A;  2GQW A;  1LQU A;  3EAN A;  1E1K A;  2WET A;  5JCK A;  3DJD A;  3LXD A;  1D4D A;  3NRN A;  4CY8 A;  3FPZ A;  3KA7 A;  3TJI A;  3ICT A;  1ZDL A;  2F5Z A;  3CGB A;  5C3J A;  4USR A;  3FG2 P;  2OQH A;  4JNA A;  3DGB A;  5J7X A;  3ISH A;  2V3B A;  2JAE A;  2A87 A;  3NG7 X;  3PWG A;  4U8J A;  4GME A;  2POD A;  1NHP A;  4J1O A;  1M6I A;  2OFJ A;  3SN1 A;  1VDV A;  2GR1 A;  1PDH A;  1ZX9 A;  3SJN A;  3AE2 A;  4KPL A;  3SZF A;  2PA6 A;  4AT2 A;  1GER A;  1F3P A;  2BAC A;  4HYR A;  4DSH A;  1Z6L A;  1KSS A;  1KKO A;  1P43 A;  1NHS A;  1GES A;  1E39 A;  3AEC A;  3GY1 A;  2WBA A;  1QLB A;  5DBJ A;  1ZK7 A;  1P2E A;  3LOV A;  4C5O A;  2QCU A;  3UTE A;  1F8S A;  3KLJ A;  4H50 A;  4HCH A;  2W55 A;  3FBS A;  2AL1 A;  1IUT A;  3TOY A;  2MUC A;  1Y0P A;  3SQS A;  2GR0 A;  4DWD A;  2GL5 A;  3PFR A;  4GCM A;  3CXO A;  4XWZ A;  1EL9 A;  4EMI A;  1K0L A;  2WP6 A;  4MJW A;  3DES A;  3UTF A;  3K7Q X;  2PTX A;  4U2S A;  4II3 A;  3S61 A;  3P4Q A;  2V3A A;  3K7M X;  1LJ1 A;  3ZVI A;  2ZZB A;  4EMJ A;  4H4V A;  2ACZ A;  4Y4N A;  3I6E A;  4B69 A;  3GRS A;  3UTG A;  2BAB A;  1H83 A;  2ZZ0 A;  2AR8 A;  2YAU A;  4G6G A;  3R9U A;  2PU1 A;  3CN8 A;  1TZZ A;  3QTP A;  3PVC A;  2HXT A;  1S2Y A;  5KMR A;  3UKK A;  2BYB A;  3N6H A;  3K7T A;  2WOW A;  2X99 A;  3GO2 A;  3CT2 A;  4XXG A;  1BQG A;  3T31 A;  1MNS A;  5KOW A;  3NTD A;  3BOX A;  3R25 A;  1NHQ A;  1GRE A;  3II4 A;  2GMH A;  2VRM A;  1GRA A;  1NHR A;  1BGJ A;  3F8D A;  4PAB A;  3PK7 A;  4A6N A;  5LV9 A;  2FJD A;  3P0W A;  1MXT A;  1KNP A;  4IA5 A;  1IUU A;  1OJT A;  2I5Q A;  2APG A;  2C65 A;  3QVP A;  4GYP A;  1VQW A;  2AL2 A;  2GGI A;  3QVR A;  4CRT A;  4NTC A;  4CNJ A;  4F4R A;  3AE7 A;  2WS3 A;  1Y56 A;  4YWS A;  4Y4M A;  4G8T A;  2GMJ A;  1X31 B;  1H86 A;  2PHH A;  4YXD A;  2W3R A;  3CTY A;  3V5C A;  4DGK A;  2EQ9 A;  1ONE A;  1IJH A;  3WE0 A;  2C3C A;  2VVL A;  2A89 A;  1GRB A;  1OJC A;  2PP1 A;  4MKS A;  4J33 A;  1N4W A;  3AD8 B;  1SJA A;  4M0X A;  3ATQ A;  1IUV A;  3GD4 A;  4JN8 A;  3AM9 A;  3QSM A;  1YY5 A;  4D03 A;  1Q9I A;  4CCR A;  3ALJ A;  1B37 A;  4REK A;  2XGZ A;  1IUS A;  2Q0L A;  4GAP A;  4OPL A;  4OPG A;  4H4X A;  5KXJ A;  1L8P A;  3QJ4 A;  4Z2U A;  4NEW A;  1D4E A;  5KVI A;  3Q45 A;  4C74 A;  2YVF A;  4H4R A;  4Z26 A;  2ZAD A;  2VZ2 A;  2FJB A;  5JCI A;  5ER0 A;  1NPX A;  2V60 A;  2P88 A;  2R9Z A;  3NK2 X;  3FCP A;  4H4Q A;  3AD7 B;  2AKZ A;  2B76 A;  3AEG A;  2W0H A;  3OP2 A;  1GRT A;  1TE6 A;  4H4Y A;  5FJP A;  3SY4 A;  3VR9 A;  3UCC A;  1WUF A;  2XFN A;  3LAD A;  1D7L A;  3CAW A;  3V3N A;  3T6C A;  1JNR A;  2R0C A;  4AP3 A;  1X2G A;  1OJ9 A;  1TYP A;  1R0M A;  2YLR A;  1RSG A;  2PTZ A;  2VQB A;  3CMM A;  4DN1 A;  1PHH A;  2AAQ A;  4ZA0 A;  4NWZ A;  1MUC A;  3DK4 A;  5JCL A;  3AE9 A;  3QFA A;  4K8D A;  2QDE A;  3MSY A;  2XLT A;  3T0K A;  4EM4 A;  3V5F A;  2VVM A;  1JDF A;  2PGW A;  4K2S A;  3AYJ A;  2YVJ A;  2R45 A;  2PMQ A;  2AQJ A;  2JBV A;  3MUC A;  3DJE A;  4JY2 A;  2WDV A;  1ZXI C;  3V3W A;  3CND A;  3EPT A;  1ELI A;  1DOB A;  1F8R A;  4ROP A;  3T14 A;  1VG9 A;  3TQP A;  1JRP A;  3DER A;  3AEF A;  2HXU A;  1TDK A;  1ELS A;  1BZL A;  4HCD A;  1WYG A;  5U1O A;  2BC1 A;  4OVI A;  4Z24 A;  3AWI A;  1TDE A;  3VCC A;  1L9D A;  4H4Z A;  1CJ3 A;  1XS2 A;  3G5S A;  4HNL A;  3UKA A;  3TTE A;  4OPU A;  1FL2 A;  2R0G A;  2B9Y A;  4H4T A;  2EQ7 A;  3QSE A;  4HB9 A;  3D1C A;  1GND A;  2WPF A;  3H70 A;  1SB3 B;  4X9N A;  1H7X A;  1HYU A;  1XAN A;  4ENL A;  4NTD A;  5KMP A;  4GDP A;  2VOU A;  4KWS A;  1GRF A;  2C72 A;  4DSG A;  3P93 A;  3GWD A;  3UP5 A;  2XFP A;  2EQ8 A;  3AED A;  2NPX A;  5EB5 A;  4TM4 A;  4H83 A;  1GSN A;  1XPQ A;  4USQ A;  3RCY A;  3DA1 A;  2OZT A;  4DXK A;  2GF3 A;  2ZC8 A;  3G5R A;  5JCM A;  4GIR A;  3PG6 A;  2R0P A;  2C4C A;  4BJY A;  3H8A A;  3COX A;  2WP5 A;  2GB0 A;  3UJS A;  1JRY A;  1UKV G;  3SZW A;  3M13 A;  2XFO A;  3CK5 A;  2B9W A;  4H2R A;  1YKJ A;  4JY3 A;  6ENL A;  1O5W A;  2BRY A;  3JZU A;  4YTN A;  2PP0 A;  1QO8 A;  4H4P A;  1FHU A;  1T3Q C;  2QAE A;  3NYE A;  3DDM A;  4EQW A;  3N6J A;  4Z2T A;  3T2Z A;  3NK1 X;  4HA6 A;  4IHC A;  5KMQ A;  4AP1 A;  1M64 A;  3KVE A;  1LPF A;  1K4Q A;  3CGE A;  2QJJ A;  2X8G A;  3ALL A;  5G5H B;  1NG4 A;  5EU9 A;  3RP8 A;  4TVY A;  3BSM A;  3Q4D A;  3L1R A;  1D7Y A;  2QJM A;  2TPR A;  2CFY A;  4RG3 A;  1REO A;  3H8I A;  2FJE A;  2VVL G;  4BV6 A;  2BA9 A;  2FYM A;  1L9C A;  3H4K A;  4OCG A;  3NVZ B;  1N63 C;  1XDI A;  2PTW A;  1ZOY A;  3VC6 A;  3D9X A;  1CF3 A;  5TR3 A;  1L0V A;  4LU6 A;  2W3S A;  1NEL A;  3NHO X;  4ZCC A;  1NDA A;  2PCE A;  5BOF A;  2XLU A;  2ZZC A;  2QDD A;  5FJO A;  1FEB A;  4A7A A;  3OC4 A;  3SR6 B;  4A6G A;  3CYJ A;  3RP6 A;  1DNC A;  3RNM A;  4GR1 A;  1GOS A;  2CDU A;  2Y6R A;  1N62 C;  2YWL A;  2QA2 A;  3MKC A;  3D8X A;  2RDX A;  2BXR A;  5EOW A;  1TDF A;  4K1W A;  1FFV C;  4WX1 A;  5KMS A;  2A8X A;  3OZM A;  2HZG A;  4AT0 A;  3SXI A;  1YQ3 A;  4FK1 A;  1E9I A;  3TWA A;  5JCN A;  1GET A;  3SN4 A;  5BRT A;  3A7A A;  3SX6 A;  4GIS A;  3LJP A;  2HNE A;  1PBF A;  4M52 A;  2E4G A;  1LVL A;  3DG6 A;  4E0V A;  2BK5 A;  4J34 A;  1MRA A;  4H4W A;  3T8Q A;  1EL5 A;  3H8L A;  4H7U A;  3VFC A;  5IDZ A;  1OJD A;  4C3Y A;  3DK8 A;  3LB8 A;  4TM1 A;  3VRB A;  3DJJ A;  3FV9 A;  3AMZ A;  4ZCD A;  2MNR A;  2WPC A;  3OPS A;  1PBE A;  1VRQ B;  3D46 A;  4EQS A;  1DOC A;  4BK2 A;  1NAA A;  3NN0 X;  3DME A;  3BNM A;  3R1Z A;  2BC0 A;  4O5Q A;  1JPD X;  3AE4 A;  2GRT A;  3T37 A;  4Z1Y A;  4Z43 A;  2OG9 A;  1N5X A;  2OLA A;  3U4F A;  4TLX A;  2E1M A;  2YQU A;  2GGE A;  2C66 A;  2PP3 A;  3U9I A;  1GRH A;  3I6T A;  3NVW B;  3UKP A;  3QKE A;  2P8B A;  2XLS A;  3OTR A;  4GUV A;  3CXB A;  1E7P A;  1DXL A;  3SSZ A;  3AE3 A;  3UCL A;  1MDL A;  2FKP A;  4U8L A;  1STZ A;  3UJR A;  2Q7V A;  3PS9 A;  4UP3 A;  2C7G A;  3NYF A;  3ABV A;  2YG7 A;  3MWC A;  4U2T A;  2OZ3 A;  3IWA A;  1BGN A;  1PBD A;  3DFH A;  3GD6 A;  1CL0 A;  2GGJ A;  4A35 A;  2XDO A;  3UKH A;  3GMC A;  3P4P A;  2GDQ A;  1Y56 B;  4I59 A;  2V5Z A;  4B66 A;  3AEB A;  3TCS A;  4II2 A;  2PYX A;  3NTA A;  2OLN A;  1KD0 A;  3HYX A;  5CKU A;  3ICR A;  2X8C A;  3KU9 A;  1PS9 A;  4YKG A;  2HQM A;  3ES8 A;  1SJD A;  3SQP A;  3KUM A;  1YEY A;  4NEV A;  1KN0 A;  1O94 A;  2XFU A;  3AYI A;  4J2W A;  4J57 A;  4K7Z A;  1CC4 A;  3NIX A;  3KKJ A;  1FEC A;  4JN9 A;  1H81 A;  4CNK A;  4TM0 A;  4IZG A;  3DGH A;  2P8C A;  4IL0 A;  1COY A;  4Z44 A;  1IYX A;  1E1L A;  3R0K A;  3FVD A;  4K8G A;  5IPY A;  1YQ4 A;  1PDZ A;  3SM8 A;  3UJ2 A;  3ENL A;  3QLD A;  1F9C A;  1N4V A;  4E8G A;  3SFE A;  3IHG A;  3MZN A;  3DG7 A;  2R4E A;  4E4U A;  1O95 A;  5FMH A;  3P4R A;  3I4K A;  3ETR B;  3NLC A;  4BK3 A;  1MO9 A;  5FS9 A;  2XLP A;  2WOI A;  1SJC A;  3I6D A;  4KPR A;  4BK1 A;  4GDE A;  4FP1 A;  2GSH A;  4U8M A;  2QVH A;  2YLW A;  3DH9 A;  3HYV A;  4K5S A;  1FCD A;  3AEE A;  2GAG B;  4A3R A;  3STP A;  3NK0 X;  3SGL A;  5KVH A;  4A79 A;  1CBO A;  1V97 A;  4B1B A;  2J3N A;  3UKF A;  7ENL A;  4G6H A;  2BCG G;  3EUB 3;  1B8S A;  1KKR A;  1LTX R;  1YQZ A;  1BWC A;  3B3R A;  1DJN A;  1N61 C;  2VRL A;  2C76 A;  2WPE A;  3ZLH A;  3AD9 B;  2WDQ A;  1MOK A;  3SZ0 A;  3CNJ A;  1CJC A;  1F6M A;  4HPN A;  4YT0 A;  4Y4L A;  4K22 A;  1CC6 A;  2XCG A;  3UOZ A;  5M10 A;  1JEH A;  4HCL A;  2WEU A;  1SJB A;  5IQ4 A;  2TMD A;  4H2Q A;  1GEU A;  2OA1 A;  2RGJ A;  2P3Z A;  4IP4 A;  3VDG A;  1PXA A;  3PWI A;  4U8P A;  1PBC A;  1N4U A;  1D4C A;  2AKM A; 
#chains in the Genus database with same CATH homology
 4YTP A;  2ZZB A;  1EBD A;  3EF6 A;  4EMJ A;  1CJ4 A;  1TRB A;  3LZW A;  5M0Z A;  4H4V A;  4RG3 A;  1E1M A;  1REO A;  2ACZ A;  4Y4N A;  3H8I A;  2JB2 A;  3GRS A;  1L9E A;  2FJE A;  2VVL G;  3UTG A;  4G73 A;  2XVE A;  2BAB A;  4ICY A;  4BV6 A;  4FX9 A;  2BA9 A;  1IUW A;  1KSU A;  4I58 A;  1H83 A;  4H4S A;  2ZZ0 A;  1L9C A;  3H4K A;  2AR8 A;  2YAU A;  3CIR A;  4G6G A;  4OCG A;  2V6O A;  3R9U A;  5KNL A;  1XDI A;  2YLZ A;  1ZOY A;  3CN8 A;  4OPI A;  4CY6 A;  3IF9 A;  3HYW A;  1RP0 A;  4J31 A;  2BS4 A;  3PVC A;  3D9X A;  1ONF A;  1GRG A;  1CF3 A;  1S2Y A;  5TR3 A;  4A99 A;  1KDG A;  5KMR A;  3UKK A;  3VQR A;  3M12 A;  1L0V A;  4H4U A;  3AE1 A;  4B68 A;  1FEA A;  1B5Q A;  4LU6 A;  4CCQ A;  2BYB A;  2C73 A;  2YLT A;  3K7T A;  3URH A;  3CGC A;  2WOW A;  2X99 A;  4EQX A;  3E1T A;  3NHO X;  3OZ2 A;  4XXG A;  4YKF A;  2YG6 A;  4ZCC A;  3T31 A;  5KOW A;  2JKC A;  4RG4 A;  1NDA A;  4ZN0 A;  3NTD A;  5CQF A;  3NNE A;  3EAO A;  2YM2 A;  4A5L A;  4UDR A;  1NHQ A;  2XLU A;  1GRE A;  3AB1 A;  1PXB A;  2ZZC A;  1GV4 A;  3II4 A;  4FK1 C;  5GRT A;  2GMH A;  2VRM A;  3GDP A;  1FEB A;  4JDR A;  4A7A A;  4X4J A;  5EB4 A;  3OC4 A;  1GRA A;  1NHR A;  4G9K A;  2C70 A;  1BGJ A;  3F8D A;  5HY5 A;  4PAB A;  3CPJ G;  2GR2 A;  2WP9 A;  3RP6 A;  4A6N A;  1DNC A;  5KRQ A;  4J56 A;  5LV9 A;  3UKQ A;  2FJD A;  3RNM A;  4GR1 A;  2Y6Q A;  1MXT A;  1KNP A;  1GOS A;  4IA5 A;  1IUU A;  4D04 A;  1OJT A;  2BS2 A;  2CDU A;  2Y6R A;  5GSN A;  1W4X A;  2APG A;  2YWL A;  4JQ9 A;  2C65 A;  2QA2 A;  1ZP0 A;  3QVP A;  2XVJ A;  3D8X A;  1H84 A;  1GXF A;  2JB3 A;  4EMW A;  2CUL A;  2BXR A;  2YR6 A;  4J36 A;  1VQW A;  5EOW A;  1TDF A;  1S7M A;  3L8K A;  2WHD A;  3QVR A;  4CRT A;  4NTC A;  3O0H A;  4EIQ A;  3I3L A;  3CGD A;  4CNJ A;  3AE7 A;  2WS3 A;  2WU2 A;  1Y56 A;  4WX1 A;  1PJ5 A;  4Y4M A;  3NN6 X;  5KMS A;  2A8X A;  3AE8 A;  4GF7 A;  2YR5 A;  4B67 A;  4AT0 A;  3LZX A;  4AOX A;  2XVF A;  3SXI A;  2GMJ A;  1KF6 A;  1YQ3 A;  1X31 B;  1H86 A;  2PHH A;  4YXD A;  1XHC A;  4FK1 A;  3GRT A;  2C75 A;  4XWR A;  3CTY A;  5L46 A;  2YLS A;  5JCN A;  2BK4 A;  1GET A;  2QA1 A;  1N1P A;  4B65 A;  1K0J A;  2C64 A;  3UTH A;  1VDC A;  4A9W A;  4Z2R A;  2OAL A;  4BJZ A;  5BRT A;  3NYC A;  1GPE A;  2YVG A;  4DGK A;  2EQ9 A;  1IJH A;  1H6V A;  3SX6 A;  3GYX A;  3WE0 A;  1EL8 A;  4B69 A;  2C3C A;  2VVL A;  2BRA A;  1S3B A;  4TLZ A;  3LJP A;  3IHM A;  1PBF A;  2CVJ A;  3NKS A;  1PN0 A;  4U2L A;  2A89 A;  4M52 A;  2E4G A;  1AOG A;  1EL7 A;  1S3E A;  1LVL A;  3DGZ A;  4YTM A;  5BUL A;  1GRB A;  4C3X A;  1OJC A;  4E0V A;  2B7S A;  1CC2 A;  4J33 A;  2BK5 A;  4BUR A;  1N4W A;  2VQ7 A;  3QFB A;  3AD8 B;  4J34 A;  4N9X A;  4H4W A;  4P9S A;  1EL5 A;  1GTE A;  3ATQ A;  3H8L A;  3ALM A;  1IUV A;  3GD4 A;  4H7U A;  3KD9 A;  1PJ7 A;  1S2Q A;  1H2I A;  1OJD A;  3QSM A;  1YY5 A;  4C3Y A;  4EQR A;  3DK8 A;  4D03 A;  3LB8 A;  2GEW A;  4TM1 A;  2IVD A;  2R46 A;  1JU2 A;  1Q9I A;  5HHF A;  4CCR A;  1RYI A;  2IID A;  3ALJ A;  3DJJ A;  3VRB A;  3V3O A;  1B37 A;  3P9U A;  4REK A;  1IUS A;  3L5O A;  2Q0L A;  4ZCD A;  4GAP A;  2H88 A;  4OPL A;  3ZYX A;  4OPG A;  4YSH A;  4H4X A;  2WPC A;  5KXJ A;  3UOY A;  1PBE A;  4ADW A;  1VRQ B;  3HZL A;  3QJ4 A;  4Z2U A;  1V59 A;  4NEW A;  4EQS A;  1DOC A;  4BK2 A;  1D4E A;  1Q1W A;  2GQF A;  4ECH A;  3F8R A;  1NAA A;  3NN0 X;  5KVI A;  3DME A;  1ZMD A;  3BNM A;  4JNQ A;  4C74 A;  2R4J A;  2YVF A;  4H4R A;  4Z26 A;  3SFD A;  2BC0 A;  4O5Q A;  3UKL A;  4X9M A;  2VZ2 A;  3AE4 A;  2FJB A;  5JCI A;  2GRT A;  2DKH A;  1F8W A;  5ER0 A;  3UP4 A;  1GTH A;  3T37 A;  4Z43 A;  1NPX A;  2V60 A;  4UDP A;  2BXS A;  4IVO B;  4LA1 A;  2XFQ A;  2R9Z A;  3NK2 X;  4TLX A;  2E1M A;  2YQU A;  4EM3 A;  3K30 A;  4H4Q A;  2C66 A;  3AD7 B;  5FS7 A;  1H82 A;  3GYI A;  2B76 A;  3QSS A;  2YR4 A;  3AEG A;  1GRH A;  1JOA A;  2W0H A;  2NVK X;  3GYJ A;  1GRT A;  3UKP A;  2O9Z A;  1BF3 A;  4H4Y A;  2WDR A;  3SY4 A;  3B6D A;  4APN A;  2XLS A;  4AOS A;  3VR9 A;  3KPK A;  1VG0 A;  3C4A A;  2RGO A;  4GUV A;  3T2K A;  3ATR A;  3SYI A;  2XFN A;  5J60 A;  3LAD A;  2GV8 A;  4G74 A;  1E7P A;  3NGC X;  4OPT A;  4TM3 A;  3VRD B;  1DXL A;  3GD3 A;  5HYM A;  3AE3 A;  1D5T A;  3UCL A;  1D7L A;  3VR8 A;  3NT6 A;  4U8K A;  3BI4 A;  5FS6 A;  2GVC A;  4U8L A;  2YG3 A;  3V3N A;  3T2Y A;  2H89 A;  5HXI A;  2Q7V A;  1JNR A;  3DK9 A;  4EIP A;  2R0C A;  2Z5Y A;  1GT8 A;  2EQ6 A;  3CNP A;  4OPC A;  4A65 A;  4AP3 A;  2X3N A;  3PS9 A;  3P4S A;  5KOX A;  4UP3 A;  2C7G A;  3NYF A;  2RGH A;  1NEN A;  1K0I A;  1OJ9 A;  3ABV A;  1TYP A;  2WQY A;  2YG7 A;  1LQT A;  1E6E A;  2Q0K A;  1RSG A;  2YLR A;  2VQB A;  3C4N A;  3P1W A;  1PXC A;  3CMM A;  3IWA A;  4U2T A;  4IV9 A;  1BGN A;  1PBD A;  1PHH A;  4U8I A;  5JRB A;  3ADA B;  3UOX A;  3GWF A;  2AAQ A;  3BHK A;  4H2P A;  4NWZ A;  3DK4 A;  5JCL A;  2BK3 A;  2XLR A;  3AE9 A;  4YSX A;  3QFA A;  4K8D A;  2XLT A;  1JRZ A;  1CL0 A;  3T0K A;  4EM4 A;  2VVM A;  4Z25 A;  1P2H A;  1TDO A;  2XDO A;  3M0O A;  3BI5 A;  1LV0 A;  2YLX A;  2YM1 A;  3UKH A;  3GMC A;  2BS3 A;  2ARD A;  2B9X A;  3AYJ A;  3P4P A;  2YVJ A;  1Y56 B;  3ICS A;  2R45 A;  2BCP A;  3GDN A;  2Z5X A;  4I59 A;  2AQJ A;  1Q1R A;  2JBV A;  3CNT A;  3CPI G;  2V5Z A;  3DJE A;  4JY2 A;  4U8O A;  2DKI A;  3AEB A;  4B66 A;  3CPH G;  4II2 A;  1JNZ A;  2XVH A;  1DOD A;  1BKW A;  2WDV A;  2PYX A;  3RED A;  2RAB A;  3ZDN A;  3CND A;  3NTA A;  2OLN A;  1JRX A;  3VRA A;  5FS8 A;  1CHU A;  2UZZ A;  1DOE A;  3EPT A;  1ELI A;  1OJA A;  1NG3 A;  3HYX A;  2X8H A;  5CKU A;  1DOB A;  3Q9T A;  3SZC A;  3ICR A;  2X8C A;  1F8R A;  3KU9 A;  1PS9 A;  3Q6J A;  2C67 A;  3BNU A;  3T14 A;  4YKG A;  1ZY8 A;  2HQM A;  2B7R A;  1VG9 A;  3SQP A;  3AE6 A;  4NEV A;  3BI2 A;  3UOV A;  3AEF A;  1KN0 A;  1O94 A;  2XFU A;  4KX6 A;  2WOV A;  1TDK A;  4B64 A;  1BZL A;  1SEZ A;  3AYI A;  5U1O A;  4J2W A;  2BC1 A;  4DNA A;  4J57 A;  4K7Z A;  2IVE A;  4K2X A;  4OVI A;  2OAM A;  4Z24 A;  1CC4 A;  1ZOV A;  3AWI A;  3JSK A;  1B4V A;  3AXB A;  1TDE A;  1L9D A;  2YG4 A;  2GH5 A;  3AYL A;  3NIX A;  1ZKQ A;  3KKJ A;  4H4Z A;  2FBW A;  1CJ3 A;  1FEC A;  2XVI A;  3G5S A;  3FIM B;  3UKA A;  4OPU A;  3S5W A;  4JN9 A;  1TDN A;  1H81 A;  5BUK A;  2XYO A;  4CNK A;  5U25 A;  1FL2 A;  2R0G A;  2X50 A;  4TM0 A;  2GQW A;  2B9Y A;  1LQU A;  3PO7 A;  4H4T A;  4YWO A;  2EQ7 A;  3EAN A;  1TYT A;  3QSE A;  1E1K A;  2WET A;  3D1C A;  1GND A;  3DGH A;  2WPF A;  3F8P A;  4HB9 A;  5JCK A;  3DJD A;  3LXD A;  1D4D A;  1PJ6 A;  1COY A;  2FJA A;  4X9N A;  4Z44 A;  1E1L A;  3ITJ A;  1ZMC A;  1KNR A;  3NRN A;  4CY8 A;  2GAH B;  3FPZ A;  3KA7 A;  5U63 A;  5IPY A;  1H7X A;  1HYU A;  1YQ4 A;  3ICT A;  4IA6 A;  3SM8 A;  3KPF A;  1ZDL A;  2F5Z A;  1XAN A;  3CGB A;  4LII A;  5C3J A;  4NTD A;  4USR A;  3RHA A;  5KMP A;  3SFE A;  5EBK A;  1N4V A;  3CNS A;  1DJQ A;  4GDP A;  3FG2 P;  2VOU A;  3IHG A;  1GRF A;  2C72 A;  4JNA A;  2R4E A;  5J7X A;  3ISH A;  4DSG A;  2V3B A;  4NTE A;  2JAE A;  1O95 A;  2A87 A;  4UDQ A;  3GWD A;  3RP7 A;  3NG7 X;  5FMH A;  3UP5 A;  2WES A;  2Q6U A;  3P4R A;  2XFP A;  4U8J A;  4YSZ A;  1FOH A;  3GMB A;  1NHP A;  3NLC A;  4BK3 A;  2EQ8 A;  1MO9 A;  3AED A;  2NPX A;  4GRT A;  1M6I A;  5FS9 A;  2XLP A;  2WOI A;  5EB5 A;  4TM4 A;  3I6D A;  5C2T A;  1GSN A;  4CBQ A;  4KPR A;  1XPQ A;  4USQ A;  4BK1 A;  2GR1 A;  3DA1 A;  4GDE A;  1PDH A;  2GF3 A;  4U8M A;  2YLW A;  1ZX9 A;  3DH9 A;  3AE2 A;  3SZF A;  3G5R A;  3HYV A;  4K5S A;  5JCM A;  1FCD A;  2C3D A;  3PG6 A;  3AEE A;  2GAG B;  2R0P A;  2C4C A;  4AT2 A;  2JK6 A;  4A6N B;  1GER A;  1F3P A;  2BAC A;  1NEK A;  4GAV A;  4BJY A;  4DSH A;  1Z6L A;  3NK0 X;  1KSS A;  3SGL A;  1KFY A;  5KVH A;  4RSL A;  4A79 A;  1CBO A;  4B1B A;  3COX A;  2J3N A;  1H7W A;  2I0Z A;  4K5R A;  3UKF A;  4G6H A;  4NNJ A;  2BCG G;  2WP5 A;  2GB0 A;  2OLO A;  1B8S A;  3GSI A;  3IC9 A;  1LTX R;  1JRY A;  2YG5 A;  1UKV G;  1YQZ A;  1NHS A;  3SZW A;  1GES A;  1BWC A;  4C77 A;  1E39 A;  3B3R A;  3M13 A;  4FDC B;  3AEC A;  4YSY A;  2XFO A;  2WBA A;  1QLB A;  4IVM B;  5DBJ A;  1ZK7 A;  5KWF A;  1E1N A;  1DJN A;  2B9W A;  4OPD A;  3DJG X;  1P2E A;  4H2R A;  3G5Q A;  4NZH A;  4O5U A;  3LOV A;  3NH3 X;  4C5O A;  2VRL A;  2C76 A;  2WPE A;  1YKJ A;  2QCU A;  1F8S A;  4JY3 A;  3KLJ A;  3C96 A;  3UTE A;  1O5W A;  2JB1 A;  3AD9 B;  4H50 A;  2WDQ A;  3FMW A;  2BRY A;  1MOK A;  4YTN A;  1IUX A;  2WU5 A;  3SZ0 A;  3CNJ A;  3FBS A;  1CJC A;  1F6M A;  5IQ1 A;  1QO8 A;  4H4P A;  1IUT A;  1CJ2 A;  4YT0 A;  2QAE A;  2ZBW A;  3NYE A;  4Y4L A;  3V76 A;  1Y0P A;  4K22 A;  2GR0 A;  1CC6 A;  1QJD A;  4EQW A;  2XCG A;  3UOZ A;  5M10 A;  4Z2T A;  3AE5 A;  3T2Z A;  2V61 A;  3NK1 X;  4HA6 A;  4H2N A;  4GCM A;  1PBB A;  5KMQ A;  4XWZ A;  1JEH A;  4PAA A;  4AP1 A;  1EL9 A;  4EMI A;  1M64 A;  4WCT A;  2WEU A;  2GR3 A;  5IQ4 A;  3KVE A;  1LPF A;  1K0L A;  2TMD A;  2WP6 A;  4MJW A;  4H2Q A;  4U8N A;  3UTF A;  1GEU A;  2OA1 A;  2RGJ A;  4B63 A;  3K7Q X;  1K4Q A;  3CGE A;  2X8G A;  2E5V A;  3ALL A;  1NG4 A;  4U2S A;  1PXA A;  4II3 A;  4U8P A;  3RP8 A;  3S61 A;  3P4Q A;  2V3A A;  1PBC A;  1D7Y A;  1N4U A;  3L1R A;  3AEA A;  3K7M X;  5BVA A;  2TPR A;  1GAL A;  2CFY A;  1D4C A;  3BHF A;  1LJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...