4DNAA

Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
461
Chain Sequence
AFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQFAEHFEDAAGFGWTVGESRFDWAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELAGPNTVKLLASGKTVTAERIVIAVGGHPSPHDALPGHELCITSNEAFDLPALPESILIAGGGYIAVEFANIFHGLGVKTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQSVSADADGRRVATTMKHGEIVADQVMLALGRMPNTNGLGLEAAGVRTNELGAIIVDAFSRTSTPGIYALGDVTDRVQLTPVAIHEAMCFIETEYKNNPTSPDHDLIATAVFSQPEIGTVGITEEEAARKFQEIEVYRAEFRPMKATLSGRKEKTIMKLVVNAADRKVVGAHILGHDAGEMAQLLGISLRAGCTKDDFDRTMAVHPTAAEELVTMYQPSYRVRNGERVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glutathione reductase
publication title CRYSTAL STRUCTURE OF putative glutathione reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 138
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4dnaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA02
4U8MA 4APNA 4EQXA 1X31B 1E1NA 4H2QA 1JOAA 2TPRA 1OJDA 1L0VA 2C67A 1PXAA 4EM3A 2JK6A 2X8GA 2IVDA 4A6NA 4CCRA 3AD7B 4YSXA 2BS4A 2AR8A 4C3XA 2YVGA 1PBBA 3K30A 1RYIA 3NK1X 1K0JA 4K5RA 3UCLA 1D4CA 4B66A 2YM1A 2R0GA 2C75A 1CJCA 3SFEA 2C3CA 1H82A 3KKJA 5U1OA 1TDKA 2GV8A 4X9MA 1XDIA 4GDPA 4U2LA 4Y4LA 1REOA 3AE4A 4GRTA 1F8SA 5J7XA 1ZKQA 3UOVA 1GRGA 3AD8B 3LJPA 4WX1A 1PBFA 3QJ4A 3ADAB 3DGZA 3GMBA 1EBDA 1DODA 1CJ3A 3NK2X 4LIIA 1FEAA 4E0VA 1V59A 4K22A 3CN8A 4LA1A 1Y0PA 2GMJA 3F8DA 3ICRA 2WPEA 1NPXA 3II4A 2Y6QA 1AOGA 5BRTA 2R4EA 4TM3A 4D03A 4I58A 3CNSA 5M0ZA 3DH9A 2BCPA 3GYIA 4YKFA 4JN9A 2YR5A 3PO7A 3RP8A 4B65A 3KD9A 4YWOA 3AE8A 4DSHA 4A65A 3RNMA 1E1LA 2B9WA 3KU9A 3AE3A 2X99A 5EB5A 1IUVA 3D8XA 3V76A 3UP5A 4AT2A 1GXFA 1IUSA 1P2EA 2Q7VA 4HA6A 2E4GA 1GRAA 1TDOA 4UDQA 4J33A 1ZMCA 3UKFA 2X8HA 3M13A 4A7AA 1YQZA 4GR1A 4OCGA 4B1BA 3DA1A 4X4JA 2WPFA 4CNJA 3NRNA 5FS7A 2BS2A 3NT6A 4CY6A 2RGJA 3CGEA 1NENA 2QA2A 1GALA 1D4EA 3NIXA 5TR3A 3NK0X 2BACA 4U8JA 4H2PA 3CNDA 4A5LA 2YM2A 4J36A 3UOYA 1QLBA 4C77A 1LQUA 4K8DA 2B9YA 1GOSA 2WU5A 4FK1A 2WDRA 1CF3A 4K5SA 5C3JA 4WCTA 4PAAA 3AEGA 4U8PA 1YY5A 1ELIA 3DJDA 3ZDNA 2AAQA 3KVEA 3CNTA 1JNRA 1OJAA 2XYOA 5KOWA 3NKSA 4J31A 3AEAA 3M12A 2NPXA 2YG6A 4TM0A 4U8OA 1TDNA 2XFUA 2X50A 1BGNA 5KXJA 2Z5YA 3BNUA 3UOZA 4IVMB 1PN0A 3K7MX 4GF7A 4TM4A 1CJ4A 4XXGA 4Y4NA 4Y4MA 3NTAA 1FECA 3UOXA 2GR0A 4KPRA 2Q0KA 1L9CA 1KSUA 3O0HA 3QFAA 3LZXA 4CNKA 3BI2A 4ECHA 1D7LA 1GSNA 4Z43A 2B76A 1JRYA 3JSKA 4H4PA 1PJ5A 4JY3A 4LU6A 2NVKX 2H89A 1L9EA 4YSZA 1DNCA 1O95A 3AEDA 2Q6UA 2GR3A 2VQ7A 4REKA 3BHFA 4Z2TA 4EQSA 4J57A 4YTNA 2O9ZA 2VRMA 3RP7A 1K0LA 4AP3A 2C65A 4TM1A 2OLOA 2EQ9A 3V3NA 3NLCA 4B69A 3P4RA 1CC6A 3EF6A 1CJ2A 4EQRA 2YWLA 5C2TA 3D1CA 1E7PA 1B4VA 2XFOA 1H6VA 2WP9A 3KLJA 1BWCA 2HQMA 1JRXA 2OLNA 3C96A 2XVFA 1XPQA 1N1PA 2V3AA 2WEUA 4B64A 1YQ3A 4EQWA 4YSYA 4YTPA 3DJGX 2AQJA 3CPJG 1E39A 4ICYA 3IHGA 3SGLA 1XANA 1CL0A 2C70A 3ABVA 1KF6A 2B7RA 1D4DA 2CVJA 5HYMA 2FJBA 1H83A 1VG9A 3FPZA 4NZHA 2GB0A 3B3RA 1IUTA 2JB1A 4EM4A 5JCLA 1EL9A 1MXTA 3UKLA 4H2RA 3AEEA 1COYA 2FJEA 4ZCDA 2WDVA 1W4XA 2VQBA 1F3PA 5EB4A 3T37A 3UTGA 2BXSA 5M10A 1VG0A 3S5WA 1TRBA 3UTHA 1B5QA 2VOUA 1TYPA 4DNAA 4GCMA 4C3YA 4CCQA 1KSSA 2YG7A 4OPGA 1JEHA 5JCMA 1HYUA 2I0ZA 1EL8A 3AE5A 1D7YA 2DKHA 4BK2A 2RGOA 3ICTA 2GMHA 2B9XA 3L1RA 2GQWA 2VVLA 1KDGA 4IVOB 2V5ZA 2CFYA 3NYCA 1S2YA 3GD4A 1DJNA 3F8PA 3GWFA 1H7XA 1ZY8A 3GDPA 2VZ2A 1DOEA 1PBCA 1B37A 3HZLA 2JAEA 2XVJA 5CQFA 3VR9A 5LV9A 4H50A 1JU2A 1VDCA 2XLRA 2BXRA 1BF3A 2JBVA 5EBKA 2YLXA 3IF9A 3NGCX 4CRTA 1Q9IA 3UKPA 3C4AA 2XLSA 1GERA 1FEBA 1DOBA 1FL2A 3UKQA 2UZZA 3AB1A 3G5QA 3PS9A 5EOWA 3ALMA 5FS6A 1KNPA 3KPFA 4H2NA 2GR1A 1GREA 3G5RA 3URHA 1VQWA 3RHAA 3S61A 3LZWA 1GTEA 4EIQA 5IQ4A 5L46A 2X3NA 2QCUA 4TLZA 4EMWA 3NN0X 2R4JA 2YG5A 4A6NB 4ZCCA 3UTEA 1PXCA 1PJ7A 2VVMA 4H4WA 1F8WA 2RABA 3GD3A 3K7TA 5KWFA 2GAHB 2VVLG 3AE1A 3CPIG 5BUKA 3F8RA 4Z24A 1GPEA 1IUUA 2BC1A 4B63A 1GETA 3AE2A 2WQYA 3GYJA 3CNJA 3QSMA 4Z2RA 2E1MA 2EQ8A 4C74A 1Z6LA 4U8IA 3RP6A 3NNEA 2WETA 4RG4A 4JDRA 3IHMA 4K2XA 2BCGG 1JNZA 2JB2A 1ZX9A 1ZMDA 1IUXA 1O94A 1BGJA 2JB3A 1YKJA 4HB9A 2ZZ0A 3ISHA 4DSGA 5KVIA 5FMHA 5JCIA 4JY2A 4U8NA 1QJDA 5HY5A 4GUVA 1LQTA 4UP3A 2YR4A 2XLPA 2EQ7A 1N4UA 3DMEA 3AWIA 4JQ9A 2GR2A 2FJDA 2WS3A 3AE6A 3NYEA 2GQFA 2OAMA 2H88A 1GT8A 4H4QA 2GEWA 3ALJA 2C64A 1Q1RA 2DKIA 3SFDA 2GH5A 4H4VA 1E1KA 2BA9A 2CULA 3DK9A 4FX9A 1LJ1A 3LADA 1JRZA 2C3DA 2XCGA 4J2WA 3NHOX 2WU2A 2XFQA 2WOVA 4TLXA 2A8XA 2GF3A 3BI5A 3CGCA 3CGBA 3AEBA 4BURA 4USRA 4XWRA 2QAEA 2CDUA 2YVFA 3L8KA 4EMJA 2JKCA 4MJWA 4BJZA 2ACZA 1TDEA 1MOKA 1L9DA 2GVCA 2PHHA 4Z44A 1ZDLA 3VRBA 3ATQA 2XVEA 2OA1A 3CTYA 5KVHA 3QSEA 4Z25A 3AE9A 3AXBA 1CC4A 3G5SA 4RSLA 3BI4A 2A89A 2BYBA 3DK4A 3C4NA 4EIPA 2WP6A 4IV9A 4YTMA 3P4PA 5KRQA 3AEFA 3AE7A 3H8LA 1N4VA 1PS9A 4FDCB 2GRTA 2R45A 2YAUA 1M6IA 4J56A 1DJQA 1UKVG 2BK4A 5FS8A 1KNRA 2YLZA 1EL5A 3ITJA 3CNPA 1GRHA 4EMIA 4A9WA 2XLTA 3E1TA 2WHDA 3CIRA 5JCKA 2WP5A 1RSGA 2WDQA 4P9SA 4YT0A 2VRLA 2W0HA 2PYXA 4B68A 4H4XA 4BJYA 3GRTA 3V3OA 2C73A 4NTDA 2XLUA 1KFYA 2Z5XA 1GV4A 4GDEA 3FIMB 4A79A 4Z2UA 1TYTA 1Y56B 5BVAA 1NEKA 3DJEA 4CBQA 3M0OA 2V3BA 5ER0A 1H84A 3UP4A 1FOHA 2C72A 3WE0A 1K4QA 4OVIA 3VRDB 1YQ4A 2F5ZA 1PBDA 2ZZCA 3NTDA 1ONFA 4I59A 4X9NA 1E6EA 3IWAA 5IPYA 1OJTA 2YLRA 4BK3A 3NYFA 4O5QA 5DBJA 4N9XA 4ADWA 2R0PA 3VQRA 4H4SA 1GRTA 2QA1A 4U2TA 3I3LA 3QVPA 4D04A 1GEUA 1OJ9A 3GWDA 1NHRA 3COXA 3NG7X 3ALLA 2R46A 4NEWA 4JNAA 1S3BA 1EL7A 2WBAA 3Q9TA 1IJHA 1S2QA 3SM8A 4NTEA 4OPTA 3UKAA 4OPLA 2FJAA 4ZN0A 2YLWA 2FBWA 3ATRA 2V6OA 1PHHA 4YSHA 2ZZBA 1NHPA 3GMCA 4U8KA 1DXLA 3UKHA 1K0IA 4FK1C 1BZLA 1D5TA 5BULA 1F6MA 2YR6A 2X8CA 1GRBA 4OPUA 2XVIA 1QO8A 3DGHA 1M64A 3DJJA 4K7ZA 5GRTA 1OJCA 4H7UA 3EANA 3VR8A 5J60A 1CHUA 4DGKA 3EAOA 4OPDA 3FG2P 1H81A 2BK5A 4Z26A 4H4RA 1E1MA 4JNQA 4AOSA 2Q0LA 2C7GA 3BHKA 2GAGB 1H7WA 1H86A 2ARDA 2E5VA 4OPCA 4OPIA 3BNMA 4B67A 4NEVA 4H4YA 2R9ZA 3UTFA 2WPCA 1LVLA 4UDRA 3UKKA 1PBEA 3AYJA 2YQUA 3KA7A 1NAAA 1LTXR 1P2HA 2WESA 3QVRA 4IA6A 4CY8A 4H4UA 1LPFA 2A87A 3P9UA 1SEZA 1ZP0A 2B7SA 2YG3A 2XVHA 2WOIA 2YVJA 4PABA 4J34A 4O5UA 1NG3A 2BC0A 3H4KA 4AOXA 2WOWA 1ZOYA 1RP0A 3K7QX 1GESA 1VRQB 4BK1A 3B6DA 4YXDA 2YG4A 1Q1WA 3ZYXA 1N4WA 1NDAA 3AYIA 1BKWA 3DK8A 3Q6JA 3P4SA 2XFPA 2BABA 2BS3A 5HXIA 1NHSA 3H8IA 4AT0A 3GRSA 3LXDA 1PXBA 3LB8A 3GSIA 4RG3A 3CPHG 3I6DA 2C76A 4H4TA 2Y6RA 2ZBWA 1CBOA 4YKGA 1S3EA 3P4QA 1MO9A 1ZK7A 3IC9A 2TMDA 4M52A 2XDOA 1ZOVA 1IUWA 4H4ZA 3NH3X 3ICSA 1F8RA 3CGDA 4NTCA 5FS9A 3QFBA 3SQPA 4C5OA 3FBSA 4AP1A 2V61A 2IVEA 4IA5A 3PVCA 4U2SA 1Y56A 4U8LA 2YLTA 5U25A 1GRFA 5JCNA 2YLSA 5U63A 3OC4A 2APGA 4A99A 5GSNA 1TDFA 1FCDA 2IIDA 4XWZA 2J3NA 1O5WA 3AYLA 5KOXA 2BK3A 1GTHA 4BV6A 3P1WA 4KX6A 5CKUA 3OZ2A 5HHFA 4USQA 3REDA 4UDPA 1PJ6A 3EPTA 2XFNA 1LV0A 2V60A 3VRAA 3R9UA 1XHCA 3FMWA 1GNDA 3NN6X 1B8SA 1CC2A 3AD9B 1NHQA 1DOCA 2R0CA 3QSSA 2EQ6A 1NG4A 1PDHA 3AECA 2C66A 2RGHA 2OALA 3LOVA 5IQ1A 3GDNA
chains in the Genus database with same CATH superfamily
4APNA 4EQXA 4H2QA 4DXKA 1JOAA 2TPRA 2OZ8A 2X8GA 3TQPA 2AR8A 4C3XA 1RYIA 3NK1X 1K0JA 2C75A 3CT2A 3SFEA 2POZA 3IK4A 1ZKQA 1EBGA 3AD8B 3T14A 3MSYA 1DODA 1CJ3A 1FEAA 3DG7A 1V59A 4K22A 3ICRA 2Y6QA 1PDZA 3GYIA 4YKFA 4JN9A 2YR5A 4YWOA 2B9WA 2X99A 5EB5A 3V76A 4AT2A 2Q7VA 1GRAA 4J33A 3M13A 1MDRA 4GR1A 4X4JA 2QA2A 1GALA 5ENLA 3PFRA 5FJRA 2YM2A 3UOYA 1GOSA 1CF3A 5C3JA 4PAAA 3AEGA 1N61C 3DJDA 4H1ZA 3R07C 2AAQA 1JNRA 5KOWA 1BQGA 1P43A 3NKSA 2NPXA 4TM0A 2GGHA 4U8OA 4GYPA 2XFUA 2X50A 5KXJA 3K1GA 3BNUA 3DESA 1PN0A 4IVMB 3UOXA 2PCEA 4JN7A 4CNKA 2GL5A 4ECHA 1P48A 4IP4A 3JSKA 4H4PA 4JY3A 2QGYA 1L9EA 1DNCA 4YTNA 4J57A 2O9ZA 2P8CA 2EQ9A 5KMRA 3P4RA 1CC6A 3SSZA 3UJRA 1E7PA 1DTNA 3C96A 1XPQA 4B64A 1YQ3A 1E9IA 3DJGX 3AN1A 4ICYA 3IHGA 2C70A 3ABVA 2FJBA 4NZHA 3SZWA 1IUTA 4Z17A 1EL9A 3AEEA 2WDVA 1NELA 3S5WA 3JW7A 3UTHA 4GCMA 4CCQA 1KSSA 1HYUA 1EL8A 4G7FA 2GMHA 2B9XA 2GQWA 2VVLA 1EC7A 3HW2A 1KDGA 2V5ZA 3GD4A 1N63C 3SR6B 1PBCA 3VR9A 2O56A 4H50A 4KWSA 1VDCA 5LV9A 2JBVA 1BF3A 5EBKA 1KKRA 1FEBA 5EOWA 1GTEA 5IQ4A 5L46A 4EMWA 4ZCCA 2RABA 2GGJA 2OX4A 3GD3A 3UXKA 3K7TA 3U4FA 2VVLG 4Z24A 1GPEA 1FHUA 1IUUA 4B63A 3AE2A 3GYJA 4Z2RA 2E1MA 2EQ8A 3RGTA 1JRPA 3RP6A 3MKCA 3ZVHA 4JDRA 4K2XA 2BCGG 1JNZA 1ZMDA 3ZLHA 1IUXA 3VCCA 1YKJA 4DSGA 4U8NA 2E3TA 4GUVA 2BRAA 2EQ7A 3DMEA 3BSMA 2GR2A 2WS3A 1GT8A 4H4QA 2DKIA 3IJIA 2GH5A 1E1KA 2BA9A 2CULA 3LADA 4J2WA 5G5HB 3NHOX 1YEYA 4TLXA 3BI5A 3CGBA 4USRA 2JKCA 1TDEA 1MOKA 2GVCA 1ZDLA 3VRBA 3CTYA 3QSEA 1SJDA 4RSLA 3DK4A 4EIPA 1VDVA 1MDLA 1PS9A 4FDCB 2YAUA 4EWJA 2BK4A 1KNRA 2QDEA 2QJJA 1EL5A 3DEQA 1GRHA 2XLTA 2WHDA 3CIRA 2WP5A 1N5WC 1RSGA 2WDQA 4P9SA 4BJYA 1Y56B 3EEZA 5ER0A 1H84A 3UP4A 4OVIA 3VRDB 3GC2A 2ZZCA 3NTDA 3IWAA 2PTYA 2QJMA 1TE6A 5DBJA 1N60C 4H4SA 4U2TA 3GWDA 3ALLA 4JNAA 4A35A 4OPTA 3NVWB 4OPLA 3ZLFA 3T9PA 2P8BA 4M6UA 2ZZBA 1NHPA 4U8KA 1DXLA 3UKHA 1K0IA 2GGEA 3A7UA 2X8CA 3CXOA 3PWGA 5GRTA 4OPDA 3FG2P 1E1MA 2Q0LA 2C7GA 3Q45A 1H7WA 1FIQB 5FJOA 4TVYA 3VC5A 3BNMA 4UDRA 3UKKA 4GISA 1LTXR 1P2HA 4G74A 2WESA 2W55A 1SEZA 5EU9A 4O5UA 1NG3A 3HRDC 2WOWA 1GESA 3B6DA 3NS1B 3AYIA 1BKWA 3TTEA 2BABA 2BS3A 1NHSA 4RG3A 2ZBWA 1KKOA 3ZVHB 1IUWA 5FS9A 3QFBA 4E6MA 3SQPA 4U2SA 3PVCA 5U63A 3OC4A 2APGA 1TDFA 1FCDA 3AYLA 4BV6A 2XFNA 3VRAA 3NN6X 3FMWA 1BKHA 1NG4A 4II2A 3GDNA 1E1NA 2C67A 2JK6A 2IVDA 4A6NA 3K30A 4GGBA 3SXIA 4K5RA 1D4CA 2YM1A 1CJCA 4GAPA 2MUCA 1H82A 5U1OA 1TDKA 3SY4A 1NU5A 4Y4LA 1REOA 3AE4A 3UOVA 1GRGA 4F4RA 4WX1A 1PBFA 3QJ4A 3DGZA 4FP1A 3NK2X 4LIIA 4KT2A 2GMJA 3F8DA 3II4A 4HPNA 3JVAA 2ONEA 2E5AA 4I58A 5M0ZA 3DH9A 4GGHA 2BCPA 3RP8A 3KD9A 3AE8A 4A65A 1EBHA 3AE3A 3BJSA 1IUVA 4DN1A 3R1ZA 3CB3A 1P2EA 2E4GA 1TDOA 1ZMCA 4HNCA 4A7AA 3T2KA 4OCGA 4B1BA 5FJPA 3DA1A 4CNJA 3NRNA 4CY6A 2HXTA 1XS2A 2AKMA 3NRZB 1H2IA 3T8QA 3NK0X 2BACA 2OPJA 3CNDA 4FK1A 2PP1A 4K5SA 5J04A 1ELIA 2W3SA 5KMSA 3H8AA 3KVEA 1OJAA 2HXUA 3MY9A 3STPA 3AEAA 3GY1A 3DDMA 1BGNA 4IT1A 4Y4NA 2GR0A 2GSHA 2Q0KA 1GSNA 2B76A 3S5SA 2NVKX 2H89A 4YSZA 1O95A 4REKA 2Q6UA 4Z2TA 3BHFA 2FKPA 2VRMA 3RP7A 4TM1A 2OLOA 3NLCA 4B69A 3PWIA 2YWLA 3D1CA 3HPFA 2OZTA 1B4VA 3KLJA 2ZC8A 2PP3A 2V3AA 1CL0A 2CVJA 3I4KA 1H83A 5JCLA 1MXTA 3UKLA 1COYA 4ZCDA 5M10A 3T37A 3UTGA 2BXSA 1B5QA 2VOUA 2AKZA 1TYPA 4DNAA 4OPGA 4GAVA 2I0ZA 2QQ6A 2OLAA 4E8GA 2DKHA 2RGOA 3ICTA 3L1RA 3F8PA 2CHRA 3TJ4A 4FI4A 1DOEA 3HZLA 2JAEA 2BXRA 3C4AA 3UKQA 2UZZA 2PS2A 3RHAA 4EIQA 1RM6B 3NN0X 2YG5A 4A6NB 4G8TA 3UTEA 1JDFA 4H4WA 5KWFA 5BUKA 1GETA 2WQYA 3QSMA 4U8IA 3NNEA 3QKEA 4KPLA 5KMPA 1O94A 3DG6A 1FHVA 2JB3A 4MKSA 4E4FA 3ISHA 1IYXA 3I6EA 2YR4A 1N4UA 4ZCWA 3IJLA 2FJDA 4ZOHB 2OAMA 2C64A 1Q1RA 4H2HA 4FX9A 3FCPA 1LJ1A 1JRZA 1S7MA 3CGCA 3AEBA 2QAEA 2MNRA 2YVFA 4EMJA 4BJZA 2P3ZA 2PHHA 3S47A 3AXBA 2XH7A 3T4WA 2WP6A 4IV9A 3D9XA 3VCNA 3AE7A 3H8LA 1N4VA 4NNJA 1DJQA 1UKVG 5FS8A 6ENLA 3ITJA 4A9WA 3T6CA 1STZA 2PYXA 2XH0A 2C73A 2XLUA 2ZADA 3OP2A 2Z5XA 1GV4A 4A79A 3FIMB 3DJEA 4CBQA 2V3BA 2AL2A 2OQHA 1YQ4A 2F5ZA 1PBDA 4X9NA 1E6EA 4IL0A 2YLRA 4BK3A 3NYFA 3I3LA 3COXA 1XPYA 3TCSA 2R46A 3RO6A 4NEWA 1IJHA 4NTEA 4ZN0A 2YLWA 2FBWA 3ATRA 4FK1C 1BZLA 1D5TA 4OPUA 1QO8A 3DGHA 1KD0A 3NVZB 4A3RA 3VR8A 4DGKA 4H4RA 4JNQA 3FVDA 4AOSA 5JRBA 4K2SA 1H86A 4OPIA 4MMWA 2QDDA 3KA7A 3A7RA 1NAAA 2W54A 3SN0A 3QVRA 3T2YA 4CY8A 1LPFA 4GIRA 1ZP0A 3H70A 2WOIA 3CK5A 3ZLGA 4J34A 4YXDA 1Q1WA 1NDAA 3Q6JA 3P4SA 2AL1A 2OFJA 1FFUC 3GSIA 3LB8A 3CPHG 3IJQA 2C76A 2FYMA 4YKGA 4E4UA 3QPEA 1ZOVA 3NH3X 1SJAA 3ICSA 3SJNA 4YWSA 3RRAA 3FBSA 3QTPA 2PMQA 3T2ZA 2GGGA 5U25A 3P93A 2YLSA 5JCNA 1EC9A 2IIDA 5KOXA 3NVVB 4KX6A 5HHFA 3OZ2A 4USQA 3EPTA 1N62C 1LV0A 3R9UA 1XHCA 1MRAA 1B8SA 1NHQA 1KN0A 2R0CA 3RITA 2C66A 4IZGA 4Z2UA 4U8MA 1X31B 3DFYA 1PXAA 4EM3A 4CCRA 3AD7B 3GYXA 2BS4A 2YVGA 4ENLA 4B66A 2R0GA 3KKJA 2GV8A 4X9MA 1XDIA 5J7XA 1F8SA 2OZ3A 3GMBA 3OW1A 4E0VA 1RVKA 1Y0PA 3VFCA 4HNLA 2WPEA 1VQZA 1AOGA 5BRTA 2R4EA 3MQTA 3EUB3 3PO7A 4B65A 1KCZA 3KU9A 1E1LA 2AL2B 3UP5A 1GXFA 3AM9A 3VDGA 1FO4A 3EKGA 4UDQA 2X8HA 3A7AA 3ZVIA 4DWDA 3OTRA 3NT6A 3SBFA 3CGEA 2PSNA 3TJIA 5TR3A 4H2PA 4A5LA 2B9YA 2WU5A 3R11A 4MGGA 4U8PA 3UJFA 1TDNA 3UOZA 3K7MX 4GF7A 3CAWA 4TM4A 1CJ4A 4XXGA 4Y4MA 1FECA 3P3BA 1KSUA 1L9CA 3QFAA 3SN4A 3BI2A 1D7LA 1JRYA 1PJ5A 3AEDA 2VQ7A 4G6GA 4ZA0A 3UJEA 1OEPA 1CJ2A 3EF6A 4EQRA 5C2TA 2XFOA 1H6VA 2WP9A 2HQMA 2XVFA 4YTPA 2AQJA 3CPJG 1E39A 1XANA 1D4DA 3FPZA 1VG9A 2GB0A 2JB1A 1R6WA 1W4XA 3Q4DA 3SQSA 3QLDA 1SJBA 1D7YA 4BK2A 1JCTA 4IVOB 3NYCA 3GWFA 1H7XA 5CQFA 2XVJA 1JU2A 3NGCX 4XWZA 3RR1A 4CRTA 3OZMA 3OPSA 2XLSA 1GERA 1DOBA 1FL2A 3AB1A 4H2NA 1GREA 3G5RA 4HCLA 2PGWA 2QCUA 1X2GA 2R4JA 1W6TA 2XH2A 2VVMA 2GAHB 3DIPA 3CPIG 3F8RA 3CNJA 1ECQA 4C74A 2WETA 3IHMA 2XH4A 2JB2A 1ELSA 4JHMA 5KVIA 5FMHA 5JCIA 4JY2A 2XLPA 3AWIA 4JQ9A 1T3QC 3AE6A 2GQFA 2GEWA 3ES8A 3SFDA 4H4VA 3I6TA 3RCYA 2XCGA 2XFQA 2WOVA 2OG9A 2NQLA 3N6JA 4XWRA 2CDUA 2PTXA 3L8KA 4A6GA 4MJWA 3UCDA 3DGBA 3ATQA 2XVEA 2OA1A 3V4BA 4Z25A 3G5SA 3BI4A 4GMEA 4DYEA 2A89A 2BYBA 1SJCA 1N5XA 3C4NA 4YTMA 3P4PA 3AEFA 2GRTA 2R45A 4J56A 1M6IA 2YLZA 2RDXA 4EMIA 3BOXA 4HCDA 5JCKA 4YT0A 2VRLA 4B68A 3GRTA 3V3OA 4NTDA 1KFYA 1TYTA 1NEKA 3R0UA 1JPMA 1ONFA 4O5QA 4K1WA 4N9XA 4ADWA 2R0PA 2QA1A 4D04A 1GEUA 3NG7X 4H19A 5BOEA 1EL7A 2WBAA 3Q9TA 1S2QA 3SM8A 1WUEA 3D46A 3UKAA 4Z1YA 3GMCA 3HYVA 3QN3A 1JROA 1JPDX 4K7ZA 1OJCA 3NVYB 1WUFA 5J60A 3EAOA 2BK5A 3L5OA 2ARDA 3UTFA 2WPCA 1PBEA 3NXLA 3SZCA 3P9UA 2YG3A 2XVHA 4PABA 2BC0A 3B9JB 5FJUA 3CXBA 3UGVA 1VRQB 4BK1A 3ZYXA 3DK8A 5HXIA 3H8IA 4AT0A 3GRSA 3KUMA 3LXDA 1PXBA 3I6DA 5KMQA 3H7VA 2Y6RA 4HCHA 4X2PA 1S3EA 3P4QA 1ZK7A 3IC9A 2TMDA 4M52A 2XDOA 3R10A 3HYXA 3CGDA 4NTCA 4J1OA 4C5OA 2V61A 2PP0A 2OO6A 3N4EA 1Y56A 1R0MA 4U8LA 2YLTA 1PDYA 2HZGA 4H83A 4E5TA 2J3NA 1O5WA 2BK3A 3REDA 3NO1A 1GNDA 3AD9B 3QSSA 2EQ6A 3SX6A 1PDHA 3FXGA 3N6HA 2RGHA 1X2HA 3H12A 1OJDA 3ES7A 1L0VA 4YSXA 1PBBA 3UCLA 2C3CA 3SN1A 4GDPA 4U2LA 4GRTA 3LJPA 3TWBA 3ADAB 1EBDA 1MUCA 3CN8A 4LA1A 1NPXA 3FV9A 4TM3A 4D03A 3CNSA 4HN8A 4DSHA 4HYRA 3RNMA 3D8XA 4KEMA 1IUSA 4HA6A 3AMZA 3UKFA 1YQZA 3PK7A 1SB3B 2WPFA 5FS7A 2BS2A 3N4FA 2PTZA 2RGJA 4JN8A 1NENA 1D4EA 3NIXA 4U8JA 3NZGA 4J36A 1FFVC 1QLBA 4C77A 1LQUA 4K8DA 2P88A 2WDRA 4WCTA 1YY5A 3ZDNA 3UCCA 3CNTA 4K8GA 2XYOA 5G5GB 4J31A 3M12A 2YG6A 2Z5YA 2DW6A 3NTAA 2HNEA 4KPRA 2I5QA 3O0HA 3LZXA 3MZNA 4Z43A 4LU6A 1L8PA 2GR3A 4EQSA 4AP3A 1K0LA 2C65A 3V3NA 3NFUA 1TZZA 3U9IA 3TWAA 1BWCA 1JRXA 2OLNA 3UXLA 7ENLA 2OKTA 1N1PA 2WEUA 4EQWA 4YSYA 2QJNA 3CMMA 3SGLA 1KF6A 2B7RA 4G9KA 5HYMA 3B3RA 4DX3A 4EM4A 4H2RA 3KPKA 2FJEA 2VQBA 1F3PA 5EB4A 1VG0A 1TRBA 2P0IA 3VC6A 1EC8A 4C3YA 2YG7A 1JEHA 5JCMA 3PG6A 3AE5A 1WYGA 2CFYA 1S2YA 1DJNA 1ZY8A 3GDPA 2VZ2A 1B37A 2XLRA 3DFHA 2YLXA 3IF9A 1Q9IA 3UKPA 3G5QA 3PS9A 3ALMA 5FS6A 1MNSA 1KNPA 3KPFA 2GR1A 2GGIA 5KNLA 3URHA 1VQWA 3S61A 2GDQA 3LZWA 4J3ZA 2X3NA 4TLZA 5IDZA 3VA8A 1PXCA 3OZYA 1PJ7A 3MWCA 3ENLA 1F8WA 3FYYA 3AE1A 2BC1A 1Z6LA 4RG4A 4GYPC 1ZX9A 2PU1A 1BGJA 4HB9A 2ZZ0A 5HY5A 1QJDA 1LQTA 4UP3A 2PTWA 4G6HA 4IHCA 2PGEA 3NYEA 2H88A 3ALJA 3DK9A 2C3DA 2WU2A 2A8XA 2GF3A 4BURA 2XSXA 2ACZA 3UJSA 1L9DA 4Z44A 4II3A 5KVHA 3V3WA 3T0KA 3AE9A 1CC4A 5KRQA 4IL2A 1F9CA 3R25A 3D47A 2QVHA 3CNPA 3E1TA 2PU0A 4DHGA 2W0HA 4H4XA 4GDEA 5BVAA 3THUA 1V97A 3M0OA 3V5FA 1FOHA 2C72A 3WE0A 1K4QA 4I59A 5IPYA 1OJTA 5BOFA 3JZUA 3VQRA 1GRTA 3QVPA 4GFIA 1OJ9A 3GD6A 1NHRA 1S3BA 3V5CA 3B97A 2FJAA 2V6OA 1PHHA 4YSHA 2PODA 3SYIA 5BULA 1F6MA 2YR6A 1GRBA 2BRYA 2XVIA 3DERA 1M64A 3CYJA 3HYWA 3DJJA 4H7UA 3EANA 1CHUA 3P0WA 1H81A 4Z26A 4M0XA 2PPGA 3BHKA 2GAGB 2E5VA 4OPCA 4B67A 1ZXIC 4NEVA 4H4YA 2R9ZA 1LVLA 3AYJA 2YQUA 1TKKA 4IA6A 4H4UA 2A87A 3T31A 2B7SA 2OVLA 2YVJA 3GO2A 4AOXA 3H4KA 3K7QX 1ZOYA 1RP0A 2YG4A 2C4CA 1N4WA 2XGZA 4G73A 2W3RA 2XFPA 4IP5A 3SZ0A 4H4TA 4TVWA 1CBOA 2PA6A 3UJ2A 1MO9A 2DW7A 4H4ZA 1F8RA 4AP1A 2IVEA 4IA5A 5FJTA 3ETRB 1GRFA 4A99A 5GSNA 1GTHA 3P1WA 5CKUA 3TW9A 3SZFA 4UDPA 1PJ6A 3FJ4A 3MUCA 2V60A 4ROPA 3TOYA 1ONEA 1CC2A 1DOCA 3R0KA 3DG3A 3AECA 4NWZA 2OALA 3LOVA 5IQ1A 2OQYA
chains in the Genus database with same CATH topology
4U8MA 4APNA 4EQXA 1X31B 1E1NA 4H2QA 1JOAA 2TPRA 1OJDA 1L0VA 2C67A 1PXAA 4EM3A 2JK6A 2X8GA 2IVDA 4A6NA 4CCRA 3AD7B 3GYXA 4YSXA 2BS4A 2AR8A 4C3XA 2YVGA 1PBBA 3K30A 1RYIA 3SXIA 3NK1X 1K0JA 4K5RA 3UCLA 1D4CA 4B66A 2YM1A 2R0GA 2C75A 1CJCA 4GAPA 3SFEA 2C3CA 1H82A 3KKJA 5U1OA 1TDKA 2GV8A 4X9MA 3SY4A 1XDIA 4GDPA 4U2LA 4Y4LA 1REOA 3AE4A 4GRTA 1F8SA 5J7XA 1ZKQA 3UOVA 1GRGA 3AD8B 3T14A 3LJPA 4WX1A 1PBFA 3QJ4A 3ADAB 3DGZA 3GMBA 1EBDA 1DODA 1CJ3A 3NK2X 4LIIA 1FEAA 4E0VA 1V59A 4K22A 3CN8A 4LA1A 1Y0PA 2GMJA 3F8DA 3ICRA 2WPEA 1NPXA 3II4A 2Y6QA 1AOGA 5BRTA 2R4EA 4TM3A 4D03A 4OPGA 4I58A 3CNSA 5M0ZA 3DH9A 2BCPA 3GYIA 4YKFA 4JN9A 2YR5A 3PO7A 3RP8A 4B65A 3KD9A 4YWOA 3AE8A 4DSHA 4A65A 3RNMA 1E1LA 2B9WA 3KU9A 3AE3A 2X99A 5EB5A 1IUVA 3D8XA 3V76A 3UP5A 4AT2A 1GXFA 1IUSA 1P2EA 2Q7VA 4HA6A 2E4GA 1GRAA 1TDOA 4UDQA 4J33A 1ZMCA 3UKFA 2X8HA 3M13A 4A7AA 3T2KA 1YQZA 4GR1A 4OCGA 4B1BA 3DA1A 4X4JA 2WPFA 4CNJA 3NRNA 5FS7A 2BS2A 3NT6A 4CY6A 2RGJA 3CGEA 1H2IA 1NENA 2QA2A 1GALA 1D4EA 3NIXA 5TR3A 3NK0X 2BACA 4U8JA 4H2PA 3CNDA 4A5LA 2YM2A 4J36A 3UOYA 1QLBA 4C77A 1LQUA 4K8DA 2B9YA 1GOSA 2WU5A 4FK1A 2WDRA 1CF3A 4K5SA 5C3JA 4WCTA 4PAAA 3AEGA 4U8PA 1YY5A 1ELIA 3DJDA 3ZDNA 5KMSA 2AAQA 3KVEA 3CNTA 1JNRA 1OJAA 2XYOA 5KOWA 3NKSA 4J31A 3AEAA 3M12A 2NPXA 2YG6A 4TM0A 4U8OA 1TDNA 2XFUA 2X50A 1BGNA 5KXJA 2Z5YA 3BNUA 3UOZA 4IVMB 1PN0A 3K7MX 4GF7A 4TM4A 1CJ4A 4XXGA 4Y4NA 4Y4MA 3NTAA 1FECA 3UOXA 2GR0A 4KPRA 2Q0KA 1L9CA 1KSUA 3O0HA 3QFAA 3LZXA 4CNKA 3BI2A 4ECHA 1D7LA 1GSNA 4Z43A 2B76A 1JRYA 3JSKA 4H4PA 1PJ5A 4JY3A 4LU6A 2NVKX 2H89A 1L9EA 4YSZA 1DNCA 1O95A 3AEDA 2Q6UA 2GR3A 2VQ7A 4REKA 3BHFA 4Z2TA 4EQSA 4J57A 4G6GA 4YTNA 2O9ZA 2VRMA 3RP7A 1K0LA 4AP3A 2C65A 4TM1A 2OLOA 2EQ9A 3V3NA 3NLCA 5KMRA 4B69A 3P4RA 1CC6A 3EF6A 1CJ2A 4EQRA 2YWLA 5C2TA 3D1CA 1E7PA 1B4VA 2XFOA 1H6VA 2WP9A 3KLJA 1BWCA 2HQMA 1JRXA 2OLNA 3C96A 2XVFA 1XPQA 2V3AA 1N1PA 2WEUA 4B64A 1YQ3A 4EQWA 4YSYA 4YTPA 3DJGX 2AQJA 3CPJG 3CMMA 1E39A 4ICYA 3IHGA 3SGLA 1XANA 1CL0A 2C70A 3ABVA 1KF6A 2B7RA 1D4DA 2CVJA 4G9KA 5HYMA 2FJBA 1H83A 1VG9A 3FPZA 4NZHA 3SZWA 2GB0A 3B3RA 1IUTA 2JB1A 4EM4A 5JCLA 1EL9A 1MXTA 3UKLA 4H2RA 3AEEA 1COYA 2FJEA 3KPKA 2WDVA 4ZCDA 1W4XA 2VQBA 1F3PA 5EB4A 3T37A 3UTGA 2BXSA 5M10A 1VG0A 3S5WA 1TRBA 3UTHA 1B5QA 2VOUA 1TYPA 4DNAA 4GCMA 4C3YA 4CCQA 1KSSA 2YG7A 4GAVA 1JEHA 5JCMA 1HYUA 2I0ZA 1EL8A 3PG6A 3AE5A 1D7YA 2DKHA 4BK2A 2RGOA 3ICTA 2GMHA 2B9XA 3L1RA 2GQWA 2VVLA 1KDGA 4IVOB 2V5ZA 2CFYA 3NYCA 1S2YA 3GD4A 1DJNA 3F8PA 3GWFA 1H7XA 1ZY8A 3GDPA 2VZ2A 1DOEA 1PBCA 1B37A 3HZLA 2JAEA 2XVJA 5CQFA 3VR9A 5LV9A 4H50A 1JU2A 1VDCA 2XLRA 2BXRA 1BF3A 2JBVA 5EBKA 2YLXA 3IF9A 3NGCX 4CRTA 1Q9IA 3UKPA 3C4AA 2XLSA 1GERA 1FEBA 1DOBA 1FL2A 3UKQA 2UZZA 3AB1A 3G5QA 3PS9A 5EOWA 3ALMA 5FS6A 1KNPA 3KPFA 4H2NA 1GREA 2GR1A 3G5RA 5KNLA 3URHA 1VQWA 3RHAA 3S61A 3LZWA 1GTEA 4EIQA 5IQ4A 5L46A 2X3NA 2QCUA 4TLZA 4EMWA 3NN0X 2R4JA 2YG5A 4A6NB 4ZCCA 3UTEA 1PXCA 1PJ7A 2VVMA 4H4WA 1F8WA 2RABA 3GD3A 3K7TA 5KWFA 2GAHB 2VVLG 3AE1A 3CPIG 5BUKA 3F8RA 4Z24A 1GPEA 1IUUA 2BC1A 4B63A 1GETA 3AE2A 2WQYA 3GYJA 3CNJA 3QSMA 4Z2RA 2E1MA 2EQ8A 4C74A 1Z6LA 4U8IA 3RP6A 3NNEA 2WETA 4RG4A 4JDRA 3IHMA 5KMPA 4K2XA 2BCGG 1JNZA 2JB2A 1ZX9A 1ZMDA 1IUXA 1O94A 1BGJA 2JB3A 1YKJA 4HB9A 2ZZ0A 3ISHA 4DSGA 5KVIA 5FMHA 5JCIA 4JY2A 4U8NA 1QJDA 5HY5A 4GUVA 1LQTA 2BRAA 4UP3A 2YR4A 2XLPA 2EQ7A 1N4UA 4G6HA 3DMEA 3AWIA 4JQ9A 2GR2A 2FJDA 2WS3A 3AE6A 3NYEA 2GQFA 2OAMA 2H88A 1GT8A 4H4QA 2GEWA 3ALJA 2C64A 1Q1RA 2DKIA 3SFDA 2GH5A 4H4VA 1E1KA 2BA9A 2CULA 3DK9A 4FX9A 1LJ1A 3LADA 1JRZA 2C3DA 2XCGA 4J2WA 3NHOX 2WU2A 1S7MA 2WOVA 2XFQA 4TLXA 2A8XA 2GF3A 3BI5A 3CGCA 3CGBA 3AEBA 4BURA 4USRA 4XWRA 2QAEA 2CDUA 2YVFA 3L8KA 4EMJA 2JKCA 4MJWA 4BJZA 2ACZA 1TDEA 1MOKA 1L9DA 2GVCA 2PHHA 4Z44A 1ZDLA 3VRBA 4II3A 3ATQA 2XVEA 2OA1A 3CTYA 5KVHA 3T0KA 3QSEA 4Z25A 3AE9A 3AXBA 1CC4A 3G5SA 4RSLA 3BI4A 2A89A 2BYBA 3DK4A 3C4NA 4EIPA 2WP6A 4IV9A 4YTMA 3P4PA 3D9XA 5KRQA 3AEFA 3AE7A 3H8LA 1N4VA 4NNJA 1PS9A 4FDCB 2GRTA 2R45A 2YAUA 1M6IA 4J56A 1DJQA 1UKVG 2BK4A 5FS8A 1KNRA 2YLZA 1EL5A 3ITJA 3CNPA 1GRHA 4EMIA 4A9WA 2XLTA 3E1TA 2WHDA 3CIRA 5JCKA 2WP5A 1RSGA 2WDQA 4P9SA 4YT0A 2VRLA 2W0HA 2PYXA 4B68A 4H4XA 4BJYA 3GRTA 3V3OA 2C73A 4NTDA 2XLUA 1KFYA 2Z5XA 1GV4A 4GDEA 3FIMB 4A79A 4Z2UA 1TYTA 1Y56B 5BVAA 1NEKA 3DJEA 4CBQA 3M0OA 2V3BA 5ER0A 1H84A 3UP4A 1FOHA 2C72A 3WE0A 1K4QA 4OVIA 3VRDB 1YQ4A 2F5ZA 1PBDA 2ZZCA 3NTDA 1ONFA 4I59A 4X9NA 1E6EA 3IWAA 5IPYA 1OJTA 2YLRA 4BK3A 3NYFA 4O5QA 5DBJA 4N9XA 4ADWA 2R0PA 3VQRA 4H4SA 1GRTA 2QA1A 4U2TA 3I3LA 3QVPA 4D04A 1GEUA 1OJ9A 3GWDA 1NHRA 3COXA 3NG7X 3ALLA 2R46A 4NEWA 4JNAA 1S3BA 1EL7A 2WBAA 3Q9TA 1IJHA 1S2QA 3SM8A 4NTEA 4OPTA 3UKAA 4OPLA 2FJAA 4ZN0A 2YLWA 2FBWA 3ATRA 2V6OA 1PHHA 4YSHA 2ZZBA 1NHPA 3GMCA 4U8KA 1DXLA 3SYIA 3UKHA 1K0IA 4FK1C 1BZLA 1D5TA 3HYVA 5BULA 1F6MA 2YR6A 2X8CA 1GRBA 2BRYA 4OPUA 2XVIA 1QO8A 3DGHA 1M64A 3HYWA 3DJJA 4K7ZA 5GRTA 1OJCA 4H7UA 3EANA 3VR8A 5J60A 1CHUA 4DGKA 3EAOA 4OPDA 3FG2P 1H81A 2BK5A 4Z26A 4H4RA 1E1MA 4JNQA 4AOSA 2Q0LA 3L5OA 5JRBA 2C7GA 2GAGB 3BHKA 1H7WA 1H86A 2ARDA 2E5VA 4OPCA 4OPIA 3BNMA 4B67A 4NEVA 4H4YA 2R9ZA 3UTFA 2WPCA 1LVLA 4UDRA 3UKKA 1PBEA 3AYJA 2YQUA 3KA7A 1NAAA 1LTXR 1P2HA 4G74A 2WESA 3QVRA 3T2YA 4IA6A 4CY8A 3SZCA 4H4UA 1LPFA 2A87A 3P9UA 1SEZA 3T31A 1ZP0A 2B7SA 2YG3A 2XVHA 2WOIA 2YVJA 4PABA 4J34A 4O5UA 1NG3A 2BC0A 3H4KA 4AOXA 2WOWA 1ZOYA 1RP0A 3K7QX 1GESA 1VRQB 4BK1A 3B6DA 4YXDA 2YG4A 1Q1WA 3ZYXA 2C4CA 1N4WA 1NDAA 3AYIA 1BKWA 3DK8A 3Q6JA 4G73A 3P4SA 2XFPA 2BABA 2BS3A 5HXIA 1NHSA 3H8IA 4AT0A 3SZ0A 3GRSA 3LXDA 1PXBA 3LB8A 3GSIA 4RG3A 3CPHG 3I6DA 5KMQA 2C76A 4H4TA 2Y6RA 2ZBWA 1CBOA 4YKGA 1S3EA 3P4QA 1MO9A 1ZK7A 3IC9A 2TMDA 4M52A 2XDOA 1ZOVA 1IUWA 4H4ZA 3NH3X 3ICSA 1F8RA 3HYXA 3CGDA 4NTCA 5FS9A 3QFBA 3SQPA 4C5OA 3FBSA 4AP1A 2V61A 2IVEA 4IA5A 3PVCA 4U2SA 1Y56A 3T2ZA 4U8LA 2YLTA 5U25A 1GRFA 5JCNA 2YLSA 5U63A 3OC4A 2APGA 4A99A 5GSNA 1TDFA 1FCDA 2IIDA 4XWZA 2J3NA 1O5WA 3AYLA 5KOXA 2BK3A 1GTHA 4BV6A 3P1WA 4KX6A 5CKUA 3OZ2A 5HHFA 4USQA 3REDA 3SZFA 4UDPA 1PJ6A 3EPTA 2XFNA 1LV0A 2V60A 3VRAA 3R9UA 1XHCA 3FMWA 1GNDA 3NN6X 1B8SA 1CC2A 3AD9B 1NHQA 1KN0A 1DOCA 2R0CA 3QSSA 2EQ6A 1NG4A 3SX6A 1PDHA 3AECA 2C66A 4NWZA 2RGHA 4II2A 2OALA 3LOVA 5IQ1A 3GDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U8M A;  4APN A;  4EQX A;  1X31 B;  1E1N A;  4H2Q A;  1JOA A;  2TPR A;  1OJD A;  1L0V A;  2C67 A;  1PXA A;  4EM3 A;  2JK6 A;  2X8G A;  2IVD A;  4A6N A;  4CCR A;  3AD7 B;  4YSX A;  2BS4 A;  2AR8 A;  4C3X A;  2YVG A;  1PBB A;  3K30 A;  1RYI A;  3NK1 X;  1K0J A;  4K5R A;  3UCL A;  1D4C A;  4B66 A;  2YM1 A;  2R0G A;  2C75 A;  1CJC A;  3SFE A;  2C3C A;  1H82 A;  3KKJ A;  5U1O A;  1TDK A;  2GV8 A;  4X9M A;  1XDI A;  4GDP A;  4U2L A;  4Y4L A;  1REO A;  3AE4 A;  4GRT A;  1F8S A;  5J7X A;  1ZKQ A;  3UOV A;  1GRG A;  3AD8 B;  3LJP A;  4WX1 A;  1PBF A;  3QJ4 A;  3ADA B;  3DGZ A;  3GMB A;  1EBD A;  1DOD A;  1CJ3 A;  3NK2 X;  4LII A;  1FEA A;  4E0V A;  1V59 A;  4K22 A;  3CN8 A;  4LA1 A;  1Y0P A;  2GMJ A;  3F8D A;  3ICR A;  2WPE A;  1NPX A;  3II4 A;  2Y6Q A;  1AOG A;  5BRT A;  2R4E A;  4TM3 A;  4D03 A;  4I58 A;  3CNS A;  5M0Z A;  3DH9 A;  2BCP A;  3GYI A;  4YKF A;  4JN9 A;  2YR5 A;  3PO7 A;  3RP8 A;  4B65 A;  3KD9 A;  4YWO A;  3AE8 A;  4DSH A;  4A65 A;  3RNM A;  1E1L A;  2B9W A;  3KU9 A;  3AE3 A;  2X99 A;  5EB5 A;  1IUV A;  3D8X A;  3V76 A;  3UP5 A;  4AT2 A;  1GXF A;  1IUS A;  1P2E A;  2Q7V A;  4HA6 A;  2E4G A;  1GRA A;  1TDO A;  4UDQ A;  4J33 A;  1ZMC A;  3UKF A;  2X8H A;  3M13 A;  4A7A A;  1YQZ A;  4GR1 A;  4OCG A;  4B1B A;  3DA1 A;  4X4J A;  2WPF A;  4CNJ A;  3NRN A;  5FS7 A;  2BS2 A;  3NT6 A;  4CY6 A;  2RGJ A;  3CGE A;  1NEN A;  2QA2 A;  1GAL A;  1D4E A;  3NIX A;  5TR3 A;  3NK0 X;  2BAC A;  4U8J A;  4H2P A;  3CND A;  4A5L A;  2YM2 A;  4J36 A;  3UOY A;  1QLB A;  4C77 A;  1LQU A;  4K8D A;  2B9Y A;  1GOS A;  2WU5 A;  4FK1 A;  2WDR A;  1CF3 A;  4K5S A;  5C3J A;  4WCT A;  4PAA A;  3AEG A;  4U8P A;  1YY5 A;  1ELI A;  3DJD A;  3ZDN A;  2AAQ A;  3KVE A;  3CNT A;  1JNR A;  1OJA A;  2XYO A;  5KOW A;  3NKS A;  4J31 A;  3AEA A;  3M12 A;  2NPX A;  2YG6 A;  4TM0 A;  4U8O A;  1TDN A;  2XFU A;  2X50 A;  1BGN A;  5KXJ A;  2Z5Y A;  3BNU A;  3UOZ A;  4IVM B;  1PN0 A;  3K7M X;  4GF7 A;  4TM4 A;  1CJ4 A;  4XXG A;  4Y4N A;  4Y4M A;  3NTA A;  1FEC A;  3UOX A;  2GR0 A;  4KPR A;  2Q0K A;  1L9C A;  1KSU A;  3O0H A;  3QFA A;  3LZX A;  4CNK A;  3BI2 A;  4ECH A;  1D7L A;  1GSN A;  4Z43 A;  2B76 A;  1JRY A;  3JSK A;  4H4P A;  1PJ5 A;  4JY3 A;  4LU6 A;  2NVK X;  2H89 A;  1L9E A;  4YSZ A;  1DNC A;  1O95 A;  3AED A;  2Q6U A;  2GR3 A;  2VQ7 A;  4REK A;  3BHF A;  4Z2T A;  4EQS A;  4J57 A;  4YTN A;  2O9Z A;  2VRM A;  3RP7 A;  1K0L A;  4AP3 A;  2C65 A;  4TM1 A;  2OLO A;  2EQ9 A;  3V3N A;  3NLC A;  4B69 A;  3P4R A;  1CC6 A;  3EF6 A;  1CJ2 A;  4EQR A;  2YWL A;  5C2T A;  3D1C A;  1E7P A;  1B4V A;  2XFO A;  1H6V A;  2WP9 A;  3KLJ A;  1BWC A;  2HQM A;  1JRX A;  2OLN A;  3C96 A;  2XVF A;  1XPQ A;  1N1P A;  2V3A A;  2WEU A;  4B64 A;  1YQ3 A;  4EQW A;  4YSY A;  4YTP A;  3DJG X;  2AQJ A;  3CPJ G;  1E39 A;  4ICY A;  3IHG A;  3SGL A;  1XAN A;  1CL0 A;  2C70 A;  3ABV A;  1KF6 A;  2B7R A;  1D4D A;  2CVJ A;  5HYM A;  2FJB A;  1H83 A;  1VG9 A;  3FPZ A;  4NZH A;  2GB0 A;  3B3R A;  1IUT A;  2JB1 A;  4EM4 A;  5JCL A;  1EL9 A;  1MXT A;  3UKL A;  4H2R A;  3AEE A;  1COY A;  2FJE A;  4ZCD A;  2WDV A;  1W4X A;  2VQB A;  1F3P A;  5EB4 A;  3T37 A;  3UTG A;  2BXS A;  5M10 A;  1VG0 A;  3S5W A;  1TRB A;  3UTH A;  1B5Q A;  2VOU A;  1TYP A;  4DNA A;  4GCM A;  4C3Y A;  4CCQ A;  1KSS A;  2YG7 A;  4OPG A;  1JEH A;  5JCM A;  1HYU A;  2I0Z A;  1EL8 A;  3AE5 A;  1D7Y A;  2DKH A;  4BK2 A;  2RGO A;  3ICT A;  2GMH A;  2B9X A;  3L1R A;  2GQW A;  2VVL A;  1KDG A;  4IVO B;  2V5Z A;  2CFY A;  3NYC A;  1S2Y A;  3GD4 A;  1DJN A;  3F8P A;  3GWF A;  1H7X A;  1ZY8 A;  3GDP A;  2VZ2 A;  1DOE A;  1PBC A;  1B37 A;  3HZL A;  2JAE A;  2XVJ A;  5CQF A;  3VR9 A;  5LV9 A;  4H50 A;  1JU2 A;  1VDC A;  2XLR A;  2BXR A;  1BF3 A;  2JBV A;  5EBK A;  2YLX A;  3IF9 A;  3NGC X;  4CRT A;  1Q9I A;  3UKP A;  3C4A A;  2XLS A;  1GER A;  1FEB A;  1DOB A;  1FL2 A;  3UKQ A;  2UZZ A;  3AB1 A;  3G5Q A;  3PS9 A;  5EOW A;  3ALM A;  5FS6 A;  1KNP A;  3KPF A;  4H2N A;  2GR1 A;  1GRE A;  3G5R A;  3URH A;  1VQW A;  3RHA A;  3S61 A;  3LZW A;  1GTE A;  4EIQ A;  5IQ4 A;  5L46 A;  2X3N A;  2QCU A;  4TLZ A;  4EMW A;  3NN0 X;  2R4J A;  2YG5 A;  4A6N B;  4ZCC A;  3UTE A;  1PXC A;  1PJ7 A;  2VVM A;  4H4W A;  1F8W A;  2RAB A;  3GD3 A;  3K7T A;  5KWF A;  2GAH B;  2VVL G;  3AE1 A;  3CPI G;  5BUK A;  3F8R A;  4Z24 A;  1GPE A;  1IUU A;  2BC1 A;  4B63 A;  1GET A;  3AE2 A;  2WQY A;  3GYJ A;  3CNJ A;  3QSM A;  4Z2R A;  2E1M A;  2EQ8 A;  4C74 A;  1Z6L A;  4U8I A;  3RP6 A;  3NNE A;  2WET A;  4RG4 A;  4JDR A;  3IHM A;  4K2X A;  2BCG G;  1JNZ A;  2JB2 A;  1ZX9 A;  1ZMD A;  1IUX A;  1O94 A;  1BGJ A;  2JB3 A;  1YKJ A;  4HB9 A;  2ZZ0 A;  3ISH A;  4DSG A;  5KVI A;  5FMH A;  5JCI A;  4JY2 A;  4U8N A;  1QJD A;  5HY5 A;  4GUV A;  1LQT A;  4UP3 A;  2YR4 A;  2XLP A;  2EQ7 A;  1N4U A;  3DME A;  3AWI A;  4JQ9 A;  2GR2 A;  2FJD A;  2WS3 A;  3AE6 A;  3NYE A;  2GQF A;  2OAM A;  2H88 A;  1GT8 A;  4H4Q A;  2GEW A;  3ALJ A;  2C64 A;  1Q1R A;  2DKI A;  3SFD A;  2GH5 A;  4H4V A;  1E1K A;  2BA9 A;  2CUL A;  3DK9 A;  4FX9 A;  1LJ1 A;  3LAD A;  1JRZ A;  2C3D A;  2XCG A;  4J2W A;  3NHO X;  2WU2 A;  2XFQ A;  2WOV A;  4TLX A;  2A8X A;  2GF3 A;  3BI5 A;  3CGC A;  3CGB A;  3AEB A;  4BUR A;  4USR A;  4XWR A;  2QAE A;  2CDU A;  2YVF A;  3L8K A;  4EMJ A;  2JKC A;  4MJW A;  4BJZ A;  2ACZ A;  1TDE A;  1MOK A;  1L9D A;  2GVC A;  2PHH A;  4Z44 A;  1ZDL A;  3VRB A;  3ATQ A;  2XVE A;  2OA1 A;  3CTY A;  5KVH A;  3QSE A;  4Z25 A;  3AE9 A;  3AXB A;  1CC4 A;  3G5S A;  4RSL A;  3BI4 A;  2A89 A;  2BYB A;  3DK4 A;  3C4N A;  4EIP A;  2WP6 A;  4IV9 A;  4YTM A;  3P4P A;  5KRQ A;  3AEF A;  3AE7 A;  3H8L A;  1N4V A;  1PS9 A;  4FDC B;  2GRT A;  2R45 A;  2YAU A;  1M6I A;  4J56 A;  1DJQ A;  1UKV G;  2BK4 A;  5FS8 A;  1KNR A;  2YLZ A;  1EL5 A;  3ITJ A;  3CNP A;  1GRH A;  4EMI A;  4A9W A;  2XLT A;  3E1T A;  2WHD A;  3CIR A;  5JCK A;  2WP5 A;  1RSG A;  2WDQ A;  4P9S A;  4YT0 A;  2VRL A;  2W0H A;  2PYX A;  4B68 A;  4H4X A;  4BJY A;  3GRT A;  3V3O A;  2C73 A;  4NTD A;  2XLU A;  1KFY A;  2Z5X A;  1GV4 A;  4GDE A;  3FIM B;  4A79 A;  4Z2U A;  1TYT A;  1Y56 B;  5BVA A;  1NEK A;  3DJE A;  4CBQ A;  3M0O A;  2V3B A;  5ER0 A;  1H84 A;  3UP4 A;  1FOH A;  2C72 A;  3WE0 A;  1K4Q A;  4OVI A;  3VRD B;  1YQ4 A;  2F5Z A;  1PBD A;  2ZZC A;  3NTD A;  1ONF A;  4I59 A;  4X9N A;  1E6E A;  3IWA A;  5IPY A;  1OJT A;  2YLR A;  4BK3 A;  3NYF A;  4O5Q A;  5DBJ A;  4N9X A;  4ADW A;  2R0P A;  3VQR A;  4H4S A;  1GRT A;  2QA1 A;  4U2T A;  3I3L A;  3QVP A;  4D04 A;  1GEU A;  1OJ9 A;  3GWD A;  1NHR A;  3COX A;  3NG7 X;  3ALL A;  2R46 A;  4NEW A;  4JNA A;  1S3B A;  1EL7 A;  2WBA A;  3Q9T A;  1IJH A;  1S2Q A;  3SM8 A;  4NTE A;  4OPT A;  3UKA A;  4OPL A;  2FJA A;  4ZN0 A;  2YLW A;  2FBW A;  3ATR A;  2V6O A;  1PHH A;  4YSH A;  2ZZB A;  1NHP A;  3GMC A;  4U8K A;  1DXL A;  3UKH A;  1K0I A;  4FK1 C;  1BZL A;  1D5T A;  5BUL A;  1F6M A;  2YR6 A;  2X8C A;  1GRB A;  4OPU A;  2XVI A;  1QO8 A;  3DGH A;  1M64 A;  3DJJ A;  4K7Z A;  5GRT A;  1OJC A;  4H7U A;  3EAN A;  3VR8 A;  5J60 A;  1CHU A;  4DGK A;  3EAO A;  4OPD A;  3FG2 P;  1H81 A;  2BK5 A;  4Z26 A;  4H4R A;  1E1M A;  4JNQ A;  4AOS A;  2Q0L A;  2C7G A;  3BHK A;  2GAG B;  1H7W A;  1H86 A;  2ARD A;  2E5V A;  4OPC A;  4OPI A;  3BNM A;  4B67 A;  4NEV A;  4H4Y A;  2R9Z A;  3UTF A;  2WPC A;  1LVL A;  4UDR A;  3UKK A;  1PBE A;  3AYJ A;  2YQU A;  3KA7 A;  1NAA A;  1LTX R;  1P2H A;  2WES A;  3QVR A;  4IA6 A;  4CY8 A;  4H4U A;  1LPF A;  2A87 A;  3P9U A;  1SEZ A;  1ZP0 A;  2B7S A;  2YG3 A;  2XVH A;  2WOI A;  2YVJ A;  4PAB A;  4J34 A;  4O5U A;  1NG3 A;  2BC0 A;  3H4K A;  4AOX A;  2WOW A;  1ZOY A;  1RP0 A;  3K7Q X;  1GES A;  1VRQ B;  4BK1 A;  3B6D A;  4YXD A;  2YG4 A;  1Q1W A;  3ZYX A;  1N4W A;  1NDA A;  3AYI A;  1BKW A;  3DK8 A;  3Q6J A;  3P4S A;  2XFP A;  2BAB A;  2BS3 A;  5HXI A;  1NHS A;  3H8I A;  4AT0 A;  3GRS A;  3LXD A;  1PXB A;  3LB8 A;  3GSI A;  4RG3 A;  3CPH G;  3I6D A;  2C76 A;  4H4T A;  2Y6R A;  2ZBW A;  1CBO A;  4YKG A;  1S3E A;  3P4Q A;  1MO9 A;  1ZK7 A;  3IC9 A;  2TMD A;  4M52 A;  2XDO A;  1ZOV A;  1IUW A;  4H4Z A;  3NH3 X;  3ICS A;  1F8R A;  3CGD A;  4NTC A;  5FS9 A;  3QFB A;  3SQP A;  4C5O A;  3FBS A;  4AP1 A;  2V61 A;  2IVE A;  4IA5 A;  3PVC A;  4U2S A;  1Y56 A;  4U8L A;  2YLT A;  5U25 A;  1GRF A;  5JCN A;  2YLS A;  5U63 A;  3OC4 A;  2APG A;  4A99 A;  5GSN A;  1TDF A;  1FCD A;  2IID A;  4XWZ A;  2J3N A;  1O5W A;  3AYL A;  5KOX A;  2BK3 A;  1GTH A;  4BV6 A;  3P1W A;  4KX6 A;  5CKU A;  3OZ2 A;  5HHF A;  4USQ A;  3RED A;  4UDP A;  1PJ6 A;  3EPT A;  2XFN A;  1LV0 A;  2V60 A;  3VRA A;  3R9U A;  1XHC A;  3FMW A;  1GND A;  3NN6 X;  1B8S A;  1CC2 A;  3AD9 B;  1NHQ A;  1DOC A;  2R0C A;  3QSS A;  2EQ6 A;  1NG4 A;  1PDH A;  3AEC A;  2C66 A;  2RGH A;  2OAL A;  3LOV A;  5IQ1 A;  3GDN A; 
#chains in the Genus database with same CATH topology
 4APN A;  4EQX A;  4H2Q A;  4DXK A;  1JOA A;  2TPR A;  2OZ8 A;  2X8G A;  3TQP A;  2AR8 A;  4C3X A;  1RYI A;  3NK1 X;  1K0J A;  2C75 A;  3CT2 A;  3SFE A;  2POZ A;  3IK4 A;  1ZKQ A;  1EBG A;  3AD8 B;  3T14 A;  3MSY A;  1DOD A;  1CJ3 A;  1FEA A;  3DG7 A;  1V59 A;  4K22 A;  3ICR A;  2Y6Q A;  1PDZ A;  3GYI A;  4YKF A;  4JN9 A;  2YR5 A;  4YWO A;  2B9W A;  2X99 A;  5EB5 A;  3V76 A;  4AT2 A;  2Q7V A;  1GRA A;  4J33 A;  3M13 A;  1MDR A;  4GR1 A;  4X4J A;  2QA2 A;  1GAL A;  5ENL A;  3PFR A;  5FJR A;  2YM2 A;  3UOY A;  1GOS A;  1CF3 A;  5C3J A;  4PAA A;  3AEG A;  1N61 C;  3DJD A;  4H1Z A;  3R07 C;  2AAQ A;  1JNR A;  5KOW A;  1BQG A;  1P43 A;  3NKS A;  2NPX A;  4TM0 A;  2GGH A;  4U8O A;  4GYP A;  2XFU A;  2X50 A;  5KXJ A;  3K1G A;  3BNU A;  3DES A;  1PN0 A;  4IVM B;  3UOX A;  2PCE A;  4JN7 A;  4CNK A;  2GL5 A;  4ECH A;  1P48 A;  4IP4 A;  3JSK A;  4H4P A;  4JY3 A;  2QGY A;  1L9E A;  1DNC A;  4YTN A;  4J57 A;  2O9Z A;  2P8C A;  2EQ9 A;  5KMR A;  3P4R A;  1CC6 A;  3SSZ A;  3UJR A;  1E7P A;  1DTN A;  3C96 A;  1XPQ A;  4B64 A;  1YQ3 A;  1E9I A;  3DJG X;  3AN1 A;  4ICY A;  3IHG A;  2C70 A;  3ABV A;  2FJB A;  4NZH A;  3SZW A;  1IUT A;  4Z17 A;  1EL9 A;  3AEE A;  2WDV A;  1NEL A;  3S5W A;  3JW7 A;  3UTH A;  4GCM A;  4CCQ A;  1KSS A;  1HYU A;  1EL8 A;  4G7F A;  2GMH A;  2B9X A;  2GQW A;  2VVL A;  1EC7 A;  3HW2 A;  1KDG A;  2V5Z A;  3GD4 A;  1N63 C;  3SR6 B;  1PBC A;  3VR9 A;  2O56 A;  4H50 A;  4KWS A;  1VDC A;  5LV9 A;  2JBV A;  1BF3 A;  5EBK A;  1KKR A;  1FEB A;  5EOW A;  1GTE A;  5IQ4 A;  5L46 A;  4EMW A;  4ZCC A;  2RAB A;  2GGJ A;  2OX4 A;  3GD3 A;  3UXK A;  3K7T A;  3U4F A;  2VVL G;  4Z24 A;  1GPE A;  1FHU A;  1IUU A;  4B63 A;  3AE2 A;  3GYJ A;  4Z2R A;  2E1M A;  2EQ8 A;  3RGT A;  1JRP A;  3RP6 A;  3MKC A;  3ZVH A;  4JDR A;  4K2X A;  2BCG G;  1JNZ A;  1ZMD A;  3ZLH A;  1IUX A;  3VCC A;  1YKJ A;  4DSG A;  4U8N A;  2E3T A;  4GUV A;  2BRA A;  2EQ7 A;  3DME A;  3BSM A;  2GR2 A;  2WS3 A;  1GT8 A;  4H4Q A;  2DKI A;  3IJI A;  2GH5 A;  1E1K A;  2BA9 A;  2CUL A;  3LAD A;  4J2W A;  5G5H B;  3NHO X;  1YEY A;  4TLX A;  3BI5 A;  3CGB A;  4USR A;  2JKC A;  1TDE A;  1MOK A;  2GVC A;  1ZDL A;  3VRB A;  3CTY A;  3QSE A;  1SJD A;  4RSL A;  3DK4 A;  4EIP A;  1VDV A;  1MDL A;  1PS9 A;  4FDC B;  2YAU A;  4EWJ A;  2BK4 A;  1KNR A;  2QDE A;  2QJJ A;  1EL5 A;  3DEQ A;  1GRH A;  2XLT A;  2WHD A;  3CIR A;  2WP5 A;  1N5W C;  1RSG A;  2WDQ A;  4P9S A;  4BJY A;  1Y56 B;  3EEZ A;  5ER0 A;  1H84 A;  3UP4 A;  4OVI A;  3VRD B;  3GC2 A;  2ZZC A;  3NTD A;  3IWA A;  2PTY A;  2QJM A;  1TE6 A;  5DBJ A;  1N60 C;  4H4S A;  4U2T A;  3GWD A;  3ALL A;  4JNA A;  4A35 A;  4OPT A;  3NVW B;  4OPL A;  3ZLF A;  3T9P A;  2P8B A;  4M6U A;  2ZZB A;  1NHP A;  4U8K A;  1DXL A;  3UKH A;  1K0I A;  2GGE A;  3A7U A;  2X8C A;  3CXO A;  3PWG A;  5GRT A;  4OPD A;  3FG2 P;  1E1M A;  2Q0L A;  2C7G A;  3Q45 A;  1H7W A;  1FIQ B;  5FJO A;  4TVY A;  3VC5 A;  3BNM A;  4UDR A;  3UKK A;  4GIS A;  1LTX R;  1P2H A;  4G74 A;  2WES A;  2W55 A;  1SEZ A;  5EU9 A;  4O5U A;  1NG3 A;  3HRD C;  2WOW A;  1GES A;  3B6D A;  3NS1 B;  3AYI A;  1BKW A;  3TTE A;  2BAB A;  2BS3 A;  1NHS A;  4RG3 A;  2ZBW A;  1KKO A;  3ZVH B;  1IUW A;  5FS9 A;  3QFB A;  4E6M A;  3SQP A;  4U2S A;  3PVC A;  5U63 A;  3OC4 A;  2APG A;  1TDF A;  1FCD A;  3AYL A;  4BV6 A;  2XFN A;  3VRA A;  3NN6 X;  3FMW A;  1BKH A;  1NG4 A;  4II2 A;  3GDN A;  1E1N A;  2C67 A;  2JK6 A;  2IVD A;  4A6N A;  3K30 A;  4GGB A;  3SXI A;  4K5R A;  1D4C A;  2YM1 A;  1CJC A;  4GAP A;  2MUC A;  1H82 A;  5U1O A;  1TDK A;  3SY4 A;  1NU5 A;  4Y4L A;  1REO A;  3AE4 A;  3UOV A;  1GRG A;  4F4R A;  4WX1 A;  1PBF A;  3QJ4 A;  3DGZ A;  4FP1 A;  3NK2 X;  4LII A;  4KT2 A;  2GMJ A;  3F8D A;  3II4 A;  4HPN A;  3JVA A;  2ONE A;  2E5A A;  4I58 A;  5M0Z A;  3DH9 A;  4GGH A;  2BCP A;  3RP8 A;  3KD9 A;  3AE8 A;  4A65 A;  1EBH A;  3AE3 A;  3BJS A;  1IUV A;  4DN1 A;  3R1Z A;  3CB3 A;  1P2E A;  2E4G A;  1TDO A;  1ZMC A;  4HNC A;  4A7A A;  3T2K A;  4OCG A;  4B1B A;  5FJP A;  3DA1 A;  4CNJ A;  3NRN A;  4CY6 A;  2HXT A;  1XS2 A;  2AKM A;  3NRZ B;  1H2I A;  3T8Q A;  3NK0 X;  2BAC A;  2OPJ A;  3CND A;  4FK1 A;  2PP1 A;  4K5S A;  5J04 A;  1ELI A;  2W3S A;  5KMS A;  3H8A A;  3KVE A;  1OJA A;  2HXU A;  3MY9 A;  3STP A;  3AEA A;  3GY1 A;  3DDM A;  1BGN A;  4IT1 A;  4Y4N A;  2GR0 A;  2GSH A;  2Q0K A;  1GSN A;  2B76 A;  3S5S A;  2NVK X;  2H89 A;  4YSZ A;  1O95 A;  4REK A;  2Q6U A;  4Z2T A;  3BHF A;  2FKP A;  2VRM A;  3RP7 A;  4TM1 A;  2OLO A;  3NLC A;  4B69 A;  3PWI A;  2YWL A;  3D1C A;  3HPF A;  2OZT A;  1B4V A;  3KLJ A;  2ZC8 A;  2PP3 A;  2V3A A;  1CL0 A;  2CVJ A;  3I4K A;  1H83 A;  5JCL A;  1MXT A;  3UKL A;  1COY A;  4ZCD A;  5M10 A;  3T37 A;  3UTG A;  2BXS A;  1B5Q A;  2VOU A;  2AKZ A;  1TYP A;  4DNA A;  4OPG A;  4GAV A;  2I0Z A;  2QQ6 A;  2OLA A;  4E8G A;  2DKH A;  2RGO A;  3ICT A;  3L1R A;  3F8P A;  2CHR A;  3TJ4 A;  4FI4 A;  1DOE A;  3HZL A;  2JAE A;  2BXR A;  3C4A A;  3UKQ A;  2UZZ A;  2PS2 A;  3RHA A;  4EIQ A;  1RM6 B;  3NN0 X;  2YG5 A;  4A6N B;  4G8T A;  3UTE A;  1JDF A;  4H4W A;  5KWF A;  5BUK A;  1GET A;  2WQY A;  3QSM A;  4U8I A;  3NNE A;  3QKE A;  4KPL A;  5KMP A;  1O94 A;  3DG6 A;  1FHV A;  2JB3 A;  4MKS A;  4E4F A;  3ISH A;  1IYX A;  3I6E A;  2YR4 A;  1N4U A;  4ZCW A;  3IJL A;  2FJD A;  4ZOH B;  2OAM A;  2C64 A;  1Q1R A;  4H2H A;  4FX9 A;  3FCP A;  1LJ1 A;  1JRZ A;  1S7M A;  3CGC A;  3AEB A;  2QAE A;  2MNR A;  2YVF A;  4EMJ A;  4BJZ A;  2P3Z A;  2PHH A;  3S47 A;  3AXB A;  2XH7 A;  3T4W A;  2WP6 A;  4IV9 A;  3D9X A;  3VCN A;  3AE7 A;  3H8L A;  1N4V A;  4NNJ A;  1DJQ A;  1UKV G;  5FS8 A;  6ENL A;  3ITJ A;  4A9W A;  3T6C A;  1STZ A;  2PYX A;  2XH0 A;  2C73 A;  2XLU A;  2ZAD A;  3OP2 A;  2Z5X A;  1GV4 A;  4A79 A;  3FIM B;  3DJE A;  4CBQ A;  2V3B A;  2AL2 A;  2OQH A;  1YQ4 A;  2F5Z A;  1PBD A;  4X9N A;  1E6E A;  4IL0 A;  2YLR A;  4BK3 A;  3NYF A;  3I3L A;  3COX A;  1XPY A;  3TCS A;  2R46 A;  3RO6 A;  4NEW A;  1IJH A;  4NTE A;  4ZN0 A;  2YLW A;  2FBW A;  3ATR A;  4FK1 C;  1BZL A;  1D5T A;  4OPU A;  1QO8 A;  3DGH A;  1KD0 A;  3NVZ B;  4A3R A;  3VR8 A;  4DGK A;  4H4R A;  4JNQ A;  3FVD A;  4AOS A;  5JRB A;  4K2S A;  1H86 A;  4OPI A;  4MMW A;  2QDD A;  3KA7 A;  3A7R A;  1NAA A;  2W54 A;  3SN0 A;  3QVR A;  3T2Y A;  4CY8 A;  1LPF A;  4GIR A;  1ZP0 A;  3H70 A;  2WOI A;  3CK5 A;  3ZLG A;  4J34 A;  4YXD A;  1Q1W A;  1NDA A;  3Q6J A;  3P4S A;  2AL1 A;  2OFJ A;  1FFU C;  3GSI A;  3LB8 A;  3CPH G;  3IJQ A;  2C76 A;  2FYM A;  4YKG A;  4E4U A;  3QPE A;  1ZOV A;  3NH3 X;  1SJA A;  3ICS A;  3SJN A;  4YWS A;  3RRA A;  3FBS A;  3QTP A;  2PMQ A;  3T2Z A;  2GGG A;  5U25 A;  3P93 A;  2YLS A;  5JCN A;  1EC9 A;  2IID A;  5KOX A;  3NVV B;  4KX6 A;  5HHF A;  3OZ2 A;  4USQ A;  3EPT A;  1N62 C;  1LV0 A;  3R9U A;  1XHC A;  1MRA A;  1B8S A;  1NHQ A;  1KN0 A;  2R0C A;  3RIT A;  2C66 A;  4IZG A;  4Z2U A;  4U8M A;  1X31 B;  3DFY A;  1PXA A;  4EM3 A;  4CCR A;  3AD7 B;  3GYX A;  2BS4 A;  2YVG A;  4ENL A;  4B66 A;  2R0G A;  3KKJ A;  2GV8 A;  4X9M A;  1XDI A;  5J7X A;  1F8S A;  2OZ3 A;  3GMB A;  3OW1 A;  4E0V A;  1RVK A;  1Y0P A;  3VFC A;  4HNL A;  2WPE A;  1VQZ A;  1AOG A;  5BRT A;  2R4E A;  3MQT A;  3EUB 3;  3PO7 A;  4B65 A;  1KCZ A;  3KU9 A;  1E1L A;  2AL2 B;  3UP5 A;  1GXF A;  3AM9 A;  3VDG A;  1FO4 A;  3EKG A;  4UDQ A;  2X8H A;  3A7A A;  3ZVI A;  4DWD A;  3OTR A;  3NT6 A;  3SBF A;  3CGE A;  2PSN A;  3TJI A;  5TR3 A;  4H2P A;  4A5L A;  2B9Y A;  2WU5 A;  3R11 A;  4MGG A;  4U8P A;  3UJF A;  1TDN A;  3UOZ A;  3K7M X;  4GF7 A;  3CAW A;  4TM4 A;  1CJ4 A;  4XXG A;  4Y4M A;  1FEC A;  3P3B A;  1KSU A;  1L9C A;  3QFA A;  3SN4 A;  3BI2 A;  1D7L A;  1JRY A;  1PJ5 A;  3AED A;  2VQ7 A;  4G6G A;  4ZA0 A;  3UJE A;  1OEP A;  1CJ2 A;  3EF6 A;  4EQR A;  5C2T A;  2XFO A;  1H6V A;  2WP9 A;  2HQM A;  2XVF A;  4YTP A;  2AQJ A;  3CPJ G;  1E39 A;  1XAN A;  1D4D A;  3FPZ A;  1VG9 A;  2GB0 A;  2JB1 A;  1R6W A;  1W4X A;  3Q4D A;  3SQS A;  3QLD A;  1SJB A;  1D7Y A;  4BK2 A;  1JCT A;  4IVO B;  3NYC A;  3GWF A;  1H7X A;  5CQF A;  2XVJ A;  1JU2 A;  3NGC X;  4XWZ A;  3RR1 A;  4CRT A;  3OZM A;  3OPS A;  2XLS A;  1GER A;  1DOB A;  1FL2 A;  3AB1 A;  4H2N A;  1GRE A;  3G5R A;  4HCL A;  2PGW A;  2QCU A;  1X2G A;  2R4J A;  1W6T A;  2XH2 A;  2VVM A;  2GAH B;  3DIP A;  3CPI G;  3F8R A;  3CNJ A;  1ECQ A;  4C74 A;  2WET A;  3IHM A;  2XH4 A;  2JB2 A;  1ELS A;  4JHM A;  5KVI A;  5FMH A;  5JCI A;  4JY2 A;  2XLP A;  3AWI A;  4JQ9 A;  1T3Q C;  3AE6 A;  2GQF A;  2GEW A;  3ES8 A;  3SFD A;  4H4V A;  3I6T A;  3RCY A;  2XCG A;  2XFQ A;  2WOV A;  2OG9 A;  2NQL A;  3N6J A;  4XWR A;  2CDU A;  2PTX A;  3L8K A;  4A6G A;  4MJW A;  3UCD A;  3DGB A;  3ATQ A;  2XVE A;  2OA1 A;  3V4B A;  4Z25 A;  3G5S A;  3BI4 A;  4GME A;  4DYE A;  2A89 A;  2BYB A;  1SJC A;  1N5X A;  3C4N A;  4YTM A;  3P4P A;  3AEF A;  2GRT A;  2R45 A;  4J56 A;  1M6I A;  2YLZ A;  2RDX A;  4EMI A;  3BOX A;  4HCD A;  5JCK A;  4YT0 A;  2VRL A;  4B68 A;  3GRT A;  3V3O A;  4NTD A;  1KFY A;  1TYT A;  1NEK A;  3R0U A;  1JPM A;  1ONF A;  4O5Q A;  4K1W A;  4N9X A;  4ADW A;  2R0P A;  2QA1 A;  4D04 A;  1GEU A;  3NG7 X;  4H19 A;  5BOE A;  1EL7 A;  2WBA A;  3Q9T A;  1S2Q A;  3SM8 A;  1WUE A;  3D46 A;  3UKA A;  4Z1Y A;  3GMC A;  3HYV A;  3QN3 A;  1JRO A;  1JPD X;  4K7Z A;  1OJC A;  3NVY B;  1WUF A;  5J60 A;  3EAO A;  2BK5 A;  3L5O A;  2ARD A;  3UTF A;  2WPC A;  1PBE A;  3NXL A;  3SZC A;  3P9U A;  2YG3 A;  2XVH A;  4PAB A;  2BC0 A;  3B9J B;  5FJU A;  3CXB A;  3UGV A;  1VRQ B;  4BK1 A;  3ZYX A;  3DK8 A;  5HXI A;  3H8I A;  4AT0 A;  3GRS A;  3KUM A;  3LXD A;  1PXB A;  3I6D A;  5KMQ A;  3H7V A;  2Y6R A;  4HCH A;  4X2P A;  1S3E A;  3P4Q A;  1ZK7 A;  3IC9 A;  2TMD A;  4M52 A;  2XDO A;  3R10 A;  3HYX A;  3CGD A;  4NTC A;  4J1O A;  4C5O A;  2V61 A;  2PP0 A;  2OO6 A;  3N4E A;  1Y56 A;  1R0M A;  4U8L A;  2YLT A;  1PDY A;  2HZG A;  4H83 A;  4E5T A;  2J3N A;  1O5W A;  2BK3 A;  3RED A;  3NO1 A;  1GND A;  3AD9 B;  3QSS A;  2EQ6 A;  3SX6 A;  1PDH A;  3FXG A;  3N6H A;  2RGH A;  1X2H A;  3H12 A;  1OJD A;  3ES7 A;  1L0V A;  4YSX A;  1PBB A;  3UCL A;  2C3C A;  3SN1 A;  4GDP A;  4U2L A;  4GRT A;  3LJP A;  3TWB A;  3ADA B;  1EBD A;  1MUC A;  3CN8 A;  4LA1 A;  1NPX A;  3FV9 A;  4TM3 A;  4D03 A;  3CNS A;  4HN8 A;  4DSH A;  4HYR A;  3RNM A;  3D8X A;  4KEM A;  1IUS A;  4HA6 A;  3AMZ A;  3UKF A;  1YQZ A;  3PK7 A;  1SB3 B;  2WPF A;  5FS7 A;  2BS2 A;  3N4F A;  2PTZ A;  2RGJ A;  4JN8 A;  1NEN A;  1D4E A;  3NIX A;  4U8J A;  3NZG A;  4J36 A;  1FFV C;  1QLB A;  4C77 A;  1LQU A;  4K8D A;  2P88 A;  2WDR A;  4WCT A;  1YY5 A;  3ZDN A;  3UCC A;  3CNT A;  4K8G A;  2XYO A;  5G5G B;  4J31 A;  3M12 A;  2YG6 A;  2Z5Y A;  2DW6 A;  3NTA A;  2HNE A;  4KPR A;  2I5Q A;  3O0H A;  3LZX A;  3MZN A;  4Z43 A;  4LU6 A;  1L8P A;  2GR3 A;  4EQS A;  4AP3 A;  1K0L A;  2C65 A;  3V3N A;  3NFU A;  1TZZ A;  3U9I A;  3TWA A;  1BWC A;  1JRX A;  2OLN A;  3UXL A;  7ENL A;  2OKT A;  1N1P A;  2WEU A;  4EQW A;  4YSY A;  2QJN A;  3CMM A;  3SGL A;  1KF6 A;  2B7R A;  4G9K A;  5HYM A;  3B3R A;  4DX3 A;  4EM4 A;  4H2R A;  3KPK A;  2FJE A;  2VQB A;  1F3P A;  5EB4 A;  1VG0 A;  1TRB A;  2P0I A;  3VC6 A;  1EC8 A;  4C3Y A;  2YG7 A;  1JEH A;  5JCM A;  3PG6 A;  3AE5 A;  1WYG A;  2CFY A;  1S2Y A;  1DJN A;  1ZY8 A;  3GDP A;  2VZ2 A;  1B37 A;  2XLR A;  3DFH A;  2YLX A;  3IF9 A;  1Q9I A;  3UKP A;  3G5Q A;  3PS9 A;  3ALM A;  5FS6 A;  1MNS A;  1KNP A;  3KPF A;  2GR1 A;  2GGI A;  5KNL A;  3URH A;  1VQW A;  3S61 A;  2GDQ A;  3LZW A;  4J3Z A;  2X3N A;  4TLZ A;  5IDZ A;  3VA8 A;  1PXC A;  3OZY A;  1PJ7 A;  3MWC A;  3ENL A;  1F8W A;  3FYY A;  3AE1 A;  2BC1 A;  1Z6L A;  4RG4 A;  4GYP C;  1ZX9 A;  2PU1 A;  1BGJ A;  4HB9 A;  2ZZ0 A;  5HY5 A;  1QJD A;  1LQT A;  4UP3 A;  2PTW A;  4G6H A;  4IHC A;  2PGE A;  3NYE A;  2H88 A;  3ALJ A;  3DK9 A;  2C3D A;  2WU2 A;  2A8X A;  2GF3 A;  4BUR A;  2XSX A;  2ACZ A;  3UJS A;  1L9D A;  4Z44 A;  4II3 A;  5KVH A;  3V3W A;  3T0K A;  3AE9 A;  1CC4 A;  5KRQ A;  4IL2 A;  1F9C A;  3R25 A;  3D47 A;  2QVH A;  3CNP A;  3E1T A;  2PU0 A;  4DHG A;  2W0H A;  4H4X A;  4GDE A;  5BVA A;  3THU A;  1V97 A;  3M0O A;  3V5F A;  1FOH A;  2C72 A;  3WE0 A;  1K4Q A;  4I59 A;  5IPY A;  1OJT A;  5BOF A;  3JZU A;  3VQR A;  1GRT A;  3QVP A;  4GFI A;  1OJ9 A;  3GD6 A;  1NHR A;  1S3B A;  3V5C A;  3B97 A;  2FJA A;  2V6O A;  1PHH A;  4YSH A;  2POD A;  3SYI A;  5BUL A;  1F6M A;  2YR6 A;  1GRB A;  2BRY A;  2XVI A;  3DER A;  1M64 A;  3CYJ A;  3HYW A;  3DJJ A;  4H7U A;  3EAN A;  1CHU A;  3P0W A;  1H81 A;  4Z26 A;  4M0X A;  2PPG A;  3BHK A;  2GAG B;  2E5V A;  4OPC A;  4B67 A;  1ZXI C;  4NEV A;  4H4Y A;  2R9Z A;  1LVL A;  3AYJ A;  2YQU A;  1TKK A;  4IA6 A;  4H4U A;  2A87 A;  3T31 A;  2B7S A;  2OVL A;  2YVJ A;  3GO2 A;  4AOX A;  3H4K A;  3K7Q X;  1ZOY A;  1RP0 A;  2YG4 A;  2C4C A;  1N4W A;  2XGZ A;  4G73 A;  2W3R A;  2XFP A;  4IP5 A;  3SZ0 A;  4H4T A;  4TVW A;  1CBO A;  2PA6 A;  3UJ2 A;  1MO9 A;  2DW7 A;  4H4Z A;  1F8R A;  4AP1 A;  2IVE A;  4IA5 A;  5FJT A;  3ETR B;  1GRF A;  4A99 A;  5GSN A;  1GTH A;  3P1W A;  5CKU A;  3TW9 A;  3SZF A;  4UDP A;  1PJ6 A;  3FJ4 A;  3MUC A;  2V60 A;  4ROP A;  3TOY A;  1ONE A;  1CC2 A;  1DOC A;  3R0K A;  3DG3 A;  3AEC A;  4NWZ A;  2OAL A;  3LOV A;  5IQ1 A;  2OQY A; 
#chains in the Genus database with same CATH homology
 4U8M A;  4APN A;  4EQX A;  1X31 B;  1E1N A;  4H2Q A;  1JOA A;  2TPR A;  1OJD A;  1L0V A;  2C67 A;  1PXA A;  4EM3 A;  2JK6 A;  2X8G A;  2IVD A;  4A6N A;  4CCR A;  3AD7 B;  3GYX A;  4YSX A;  2BS4 A;  2AR8 A;  4C3X A;  2YVG A;  1PBB A;  3K30 A;  1RYI A;  3SXI A;  3NK1 X;  1K0J A;  4K5R A;  3UCL A;  1D4C A;  4B66 A;  2YM1 A;  2R0G A;  2C75 A;  1CJC A;  4GAP A;  3SFE A;  2C3C A;  1H82 A;  3KKJ A;  5U1O A;  1TDK A;  2GV8 A;  4X9M A;  3SY4 A;  1XDI A;  4GDP A;  4U2L A;  4Y4L A;  1REO A;  3AE4 A;  4GRT A;  1F8S A;  5J7X A;  1ZKQ A;  3UOV A;  1GRG A;  3AD8 B;  3T14 A;  3LJP A;  4WX1 A;  1PBF A;  3QJ4 A;  3ADA B;  3DGZ A;  3GMB A;  1EBD A;  1DOD A;  1CJ3 A;  3NK2 X;  4LII A;  1FEA A;  4E0V A;  1V59 A;  4K22 A;  3CN8 A;  4LA1 A;  1Y0P A;  2GMJ A;  3F8D A;  3ICR A;  2WPE A;  1NPX A;  3II4 A;  2Y6Q A;  1AOG A;  5BRT A;  2R4E A;  4TM3 A;  4D03 A;  4OPG A;  4I58 A;  3CNS A;  5M0Z A;  3DH9 A;  2BCP A;  3GYI A;  4YKF A;  4JN9 A;  2YR5 A;  3PO7 A;  3RP8 A;  4B65 A;  3KD9 A;  4YWO A;  3AE8 A;  4DSH A;  4A65 A;  3RNM A;  1E1L A;  2B9W A;  3KU9 A;  3AE3 A;  2X99 A;  5EB5 A;  1IUV A;  3D8X A;  3V76 A;  3UP5 A;  4AT2 A;  1GXF A;  1IUS A;  1P2E A;  2Q7V A;  4HA6 A;  2E4G A;  1GRA A;  1TDO A;  4UDQ A;  4J33 A;  1ZMC A;  3UKF A;  2X8H A;  3M13 A;  4A7A A;  3T2K A;  1YQZ A;  4GR1 A;  4OCG A;  4B1B A;  3DA1 A;  4X4J A;  2WPF A;  4CNJ A;  3NRN A;  5FS7 A;  2BS2 A;  3NT6 A;  4CY6 A;  2RGJ A;  3CGE A;  1H2I A;  1NEN A;  2QA2 A;  1GAL A;  1D4E A;  3NIX A;  5TR3 A;  3NK0 X;  2BAC A;  4U8J A;  4H2P A;  3CND A;  4A5L A;  2YM2 A;  4J36 A;  3UOY A;  1QLB A;  4C77 A;  1LQU A;  4K8D A;  2B9Y A;  1GOS A;  2WU5 A;  4FK1 A;  2WDR A;  1CF3 A;  4K5S A;  5C3J A;  4WCT A;  4PAA A;  3AEG A;  4U8P A;  1YY5 A;  1ELI A;  3DJD A;  3ZDN A;  5KMS A;  2AAQ A;  3KVE A;  3CNT A;  1JNR A;  1OJA A;  2XYO A;  5KOW A;  3NKS A;  4J31 A;  3AEA A;  3M12 A;  2NPX A;  2YG6 A;  4TM0 A;  4U8O A;  1TDN A;  2XFU A;  2X50 A;  1BGN A;  5KXJ A;  2Z5Y A;  3BNU A;  3UOZ A;  4IVM B;  1PN0 A;  3K7M X;  4GF7 A;  4TM4 A;  1CJ4 A;  4XXG A;  4Y4N A;  4Y4M A;  3NTA A;  1FEC A;  3UOX A;  2GR0 A;  4KPR A;  2Q0K A;  1L9C A;  1KSU A;  3O0H A;  3QFA A;  3LZX A;  4CNK A;  3BI2 A;  4ECH A;  1D7L A;  1GSN A;  4Z43 A;  2B76 A;  1JRY A;  3JSK A;  4H4P A;  1PJ5 A;  4JY3 A;  4LU6 A;  2NVK X;  2H89 A;  1L9E A;  4YSZ A;  1DNC A;  1O95 A;  3AED A;  2Q6U A;  2GR3 A;  2VQ7 A;  4REK A;  3BHF A;  4Z2T A;  4EQS A;  4J57 A;  4G6G A;  4YTN A;  2O9Z A;  2VRM A;  3RP7 A;  1K0L A;  4AP3 A;  2C65 A;  4TM1 A;  2OLO A;  2EQ9 A;  3V3N A;  3NLC A;  5KMR A;  4B69 A;  3P4R A;  1CC6 A;  3EF6 A;  1CJ2 A;  4EQR A;  2YWL A;  5C2T A;  3D1C A;  1E7P A;  1B4V A;  2XFO A;  1H6V A;  2WP9 A;  3KLJ A;  1BWC A;  2HQM A;  1JRX A;  2OLN A;  3C96 A;  2XVF A;  1XPQ A;  2V3A A;  1N1P A;  2WEU A;  4B64 A;  1YQ3 A;  4EQW A;  4YSY A;  4YTP A;  3DJG X;  2AQJ A;  3CPJ G;  3CMM A;  1E39 A;  4ICY A;  3IHG A;  3SGL A;  1XAN A;  1CL0 A;  2C70 A;  3ABV A;  1KF6 A;  2B7R A;  1D4D A;  2CVJ A;  4G9K A;  5HYM A;  2FJB A;  1H83 A;  1VG9 A;  3FPZ A;  4NZH A;  3SZW A;  2GB0 A;  3B3R A;  1IUT A;  2JB1 A;  4EM4 A;  5JCL A;  1EL9 A;  1MXT A;  3UKL A;  4H2R A;  3AEE A;  1COY A;  2FJE A;  3KPK A;  2WDV A;  4ZCD A;  1W4X A;  2VQB A;  1F3P A;  5EB4 A;  3T37 A;  3UTG A;  2BXS A;  5M10 A;  1VG0 A;  3S5W A;  1TRB A;  3UTH A;  1B5Q A;  2VOU A;  1TYP A;  4DNA A;  4GCM A;  4C3Y A;  4CCQ A;  1KSS A;  2YG7 A;  4GAV A;  1JEH A;  5JCM A;  1HYU A;  2I0Z A;  1EL8 A;  3PG6 A;  3AE5 A;  1D7Y A;  2DKH A;  4BK2 A;  2RGO A;  3ICT A;  2GMH A;  2B9X A;  3L1R A;  2GQW A;  2VVL A;  1KDG A;  4IVO B;  2V5Z A;  2CFY A;  3NYC A;  1S2Y A;  3GD4 A;  1DJN A;  3F8P A;  3GWF A;  1H7X A;  1ZY8 A;  3GDP A;  2VZ2 A;  1DOE A;  1PBC A;  1B37 A;  3HZL A;  2JAE A;  2XVJ A;  5CQF A;  3VR9 A;  5LV9 A;  4H50 A;  1JU2 A;  1VDC A;  2XLR A;  2BXR A;  1BF3 A;  2JBV A;  5EBK A;  2YLX A;  3IF9 A;  3NGC X;  4CRT A;  1Q9I A;  3UKP A;  3C4A A;  2XLS A;  1GER A;  1FEB A;  1DOB A;  1FL2 A;  3UKQ A;  2UZZ A;  3AB1 A;  3G5Q A;  3PS9 A;  5EOW A;  3ALM A;  5FS6 A;  1KNP A;  3KPF A;  4H2N A;  1GRE A;  2GR1 A;  3G5R A;  5KNL A;  3URH A;  1VQW A;  3RHA A;  3S61 A;  3LZW A;  1GTE A;  4EIQ A;  5IQ4 A;  5L46 A;  2X3N A;  2QCU A;  4TLZ A;  4EMW A;  3NN0 X;  2R4J A;  2YG5 A;  4A6N B;  4ZCC A;  3UTE A;  1PXC A;  1PJ7 A;  2VVM A;  4H4W A;  1F8W A;  2RAB A;  3GD3 A;  3K7T A;  5KWF A;  2GAH B;  2VVL G;  3AE1 A;  3CPI G;  5BUK A;  3F8R A;  4Z24 A;  1GPE A;  1IUU A;  2BC1 A;  4B63 A;  1GET A;  3AE2 A;  2WQY A;  3GYJ A;  3CNJ A;  3QSM A;  4Z2R A;  2E1M A;  2EQ8 A;  4C74 A;  1Z6L A;  4U8I A;  3RP6 A;  3NNE A;  2WET A;  4RG4 A;  4JDR A;  3IHM A;  5KMP A;  4K2X A;  2BCG G;  1JNZ A;  2JB2 A;  1ZX9 A;  1ZMD A;  1IUX A;  1O94 A;  1BGJ A;  2JB3 A;  1YKJ A;  4HB9 A;  2ZZ0 A;  3ISH A;  4DSG A;  5KVI A;  5FMH A;  5JCI A;  4JY2 A;  4U8N A;  1QJD A;  5HY5 A;  4GUV A;  1LQT A;  2BRA A;  4UP3 A;  2YR4 A;  2XLP A;  2EQ7 A;  1N4U A;  4G6H A;  3DME A;  3AWI A;  4JQ9 A;  2GR2 A;  2FJD A;  2WS3 A;  3AE6 A;  3NYE A;  2GQF A;  2OAM A;  2H88 A;  1GT8 A;  4H4Q A;  2GEW A;  3ALJ A;  2C64 A;  1Q1R A;  2DKI A;  3SFD A;  2GH5 A;  4H4V A;  1E1K A;  2BA9 A;  2CUL A;  3DK9 A;  4FX9 A;  1LJ1 A;  3LAD A;  1JRZ A;  2C3D A;  2XCG A;  4J2W A;  3NHO X;  2WU2 A;  1S7M A;  2WOV A;  2XFQ A;  4TLX A;  2A8X A;  2GF3 A;  3BI5 A;  3CGC A;  3CGB A;  3AEB A;  4BUR A;  4USR A;  4XWR A;  2QAE A;  2CDU A;  2YVF A;  3L8K A;  4EMJ A;  2JKC A;  4MJW A;  4BJZ A;  2ACZ A;  1TDE A;  1MOK A;  1L9D A;  2GVC A;  2PHH A;  4Z44 A;  1ZDL A;  3VRB A;  4II3 A;  3ATQ A;  2XVE A;  2OA1 A;  3CTY A;  5KVH A;  3T0K A;  3QSE A;  4Z25 A;  3AE9 A;  3AXB A;  1CC4 A;  3G5S A;  4RSL A;  3BI4 A;  2A89 A;  2BYB A;  3DK4 A;  3C4N A;  4EIP A;  2WP6 A;  4IV9 A;  4YTM A;  3P4P A;  3D9X A;  5KRQ A;  3AEF A;  3AE7 A;  3H8L A;  1N4V A;  4NNJ A;  1PS9 A;  4FDC B;  2GRT A;  2R45 A;  2YAU A;  1M6I A;  4J56 A;  1DJQ A;  1UKV G;  2BK4 A;  5FS8 A;  1KNR A;  2YLZ A;  1EL5 A;  3ITJ A;  3CNP A;  1GRH A;  4EMI A;  4A9W A;  2XLT A;  3E1T A;  2WHD A;  3CIR A;  5JCK A;  2WP5 A;  1RSG A;  2WDQ A;  4P9S A;  4YT0 A;  2VRL A;  2W0H A;  2PYX A;  4B68 A;  4H4X A;  4BJY A;  3GRT A;  3V3O A;  2C73 A;  4NTD A;  2XLU A;  1KFY A;  2Z5X A;  1GV4 A;  4GDE A;  3FIM B;  4A79 A;  4Z2U A;  1TYT A;  1Y56 B;  5BVA A;  1NEK A;  3DJE A;  4CBQ A;  3M0O A;  2V3B A;  5ER0 A;  1H84 A;  3UP4 A;  1FOH A;  2C72 A;  3WE0 A;  1K4Q A;  4OVI A;  3VRD B;  1YQ4 A;  2F5Z A;  1PBD A;  2ZZC A;  3NTD A;  1ONF A;  4I59 A;  4X9N A;  1E6E A;  3IWA A;  5IPY A;  1OJT A;  2YLR A;  4BK3 A;  3NYF A;  4O5Q A;  5DBJ A;  4N9X A;  4ADW A;  2R0P A;  3VQR A;  4H4S A;  1GRT A;  2QA1 A;  4U2T A;  3I3L A;  3QVP A;  4D04 A;  1GEU A;  1OJ9 A;  3GWD A;  1NHR A;  3COX A;  3NG7 X;  3ALL A;  2R46 A;  4NEW A;  4JNA A;  1S3B A;  1EL7 A;  2WBA A;  3Q9T A;  1IJH A;  1S2Q A;  3SM8 A;  4NTE A;  4OPT A;  3UKA A;  4OPL A;  2FJA A;  4ZN0 A;  2YLW A;  2FBW A;  3ATR A;  2V6O A;  1PHH A;  4YSH A;  2ZZB A;  1NHP A;  3GMC A;  4U8K A;  1DXL A;  3SYI A;  3UKH A;  1K0I A;  4FK1 C;  1BZL A;  1D5T A;  3HYV A;  5BUL A;  1F6M A;  2YR6 A;  2X8C A;  1GRB A;  2BRY A;  4OPU A;  2XVI A;  1QO8 A;  3DGH A;  1M64 A;  3HYW A;  3DJJ A;  4K7Z A;  5GRT A;  1OJC A;  4H7U A;  3EAN A;  3VR8 A;  5J60 A;  1CHU A;  4DGK A;  3EAO A;  4OPD A;  3FG2 P;  1H81 A;  2BK5 A;  4Z26 A;  4H4R A;  1E1M A;  4JNQ A;  4AOS A;  2Q0L A;  3L5O A;  5JRB A;  2C7G A;  2GAG B;  3BHK A;  1H7W A;  1H86 A;  2ARD A;  2E5V A;  4OPC A;  4OPI A;  3BNM A;  4B67 A;  4NEV A;  4H4Y A;  2R9Z A;  3UTF A;  2WPC A;  1LVL A;  4UDR A;  3UKK A;  1PBE A;  3AYJ A;  2YQU A;  3KA7 A;  1NAA A;  1LTX R;  1P2H A;  4G74 A;  2WES A;  3QVR A;  3T2Y A;  4IA6 A;  4CY8 A;  3SZC A;  4H4U A;  1LPF A;  2A87 A;  3P9U A;  1SEZ A;  3T31 A;  1ZP0 A;  2B7S A;  2YG3 A;  2XVH A;  2WOI A;  2YVJ A;  4PAB A;  4J34 A;  4O5U A;  1NG3 A;  2BC0 A;  3H4K A;  4AOX A;  2WOW A;  1ZOY A;  1RP0 A;  3K7Q X;  1GES A;  1VRQ B;  4BK1 A;  3B6D A;  4YXD A;  2YG4 A;  1Q1W A;  3ZYX A;  2C4C A;  1N4W A;  1NDA A;  3AYI A;  1BKW A;  3DK8 A;  3Q6J A;  4G73 A;  3P4S A;  2XFP A;  2BAB A;  2BS3 A;  5HXI A;  1NHS A;  3H8I A;  4AT0 A;  3SZ0 A;  3GRS A;  3LXD A;  1PXB A;  3LB8 A;  3GSI A;  4RG3 A;  3CPH G;  3I6D A;  5KMQ A;  2C76 A;  4H4T A;  2Y6R A;  2ZBW A;  1CBO A;  4YKG A;  1S3E A;  3P4Q A;  1MO9 A;  1ZK7 A;  3IC9 A;  2TMD A;  4M52 A;  2XDO A;  1ZOV A;  1IUW A;  4H4Z A;  3NH3 X;  3ICS A;  1F8R A;  3HYX A;  3CGD A;  4NTC A;  5FS9 A;  3QFB A;  3SQP A;  4C5O A;  3FBS A;  4AP1 A;  2V61 A;  2IVE A;  4IA5 A;  3PVC A;  4U2S A;  1Y56 A;  3T2Z A;  4U8L A;  2YLT A;  5U25 A;  1GRF A;  5JCN A;  2YLS A;  5U63 A;  3OC4 A;  2APG A;  4A99 A;  5GSN A;  1TDF A;  1FCD A;  2IID A;  4XWZ A;  2J3N A;  1O5W A;  3AYL A;  5KOX A;  2BK3 A;  1GTH A;  4BV6 A;  3P1W A;  4KX6 A;  5CKU A;  3OZ2 A;  5HHF A;  4USQ A;  3RED A;  3SZF A;  4UDP A;  1PJ6 A;  3EPT A;  2XFN A;  1LV0 A;  2V60 A;  3VRA A;  3R9U A;  1XHC A;  3FMW A;  1GND A;  3NN6 X;  1B8S A;  1CC2 A;  3AD9 B;  1NHQ A;  1KN0 A;  1DOC A;  2R0C A;  3QSS A;  2EQ6 A;  1NG4 A;  3SX6 A;  1PDH A;  3AEC A;  2C66 A;  4NWZ A;  2RGH A;  4II2 A;  2OAL A;  3LOV A;  5IQ1 A;  3GDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...