4DNAA

Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
461
Chain Sequence
AFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQFAEHFEDAAGFGWTVGESRFDWAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELAGPNTVKLLASGKTVTAERIVIAVGGHPSPHDALPGHELCITSNEAFDLPALPESILIAGGGYIAVEFANIFHGLGVKTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQSVSADADGRRVATTMKHGEIVADQVMLALGRMPNTNGLGLEAAGVRTNELGAIIVDAFSRTSTPGIYALGDVTDRVQLTPVAIHEAMCFIETEYKNNPTSPDHDLIATAVFSQPEIGTVGITEEEAARKFQEIEVYRAEFRPMKATLSGRKEKTIMKLVVNAADRKVVGAHILGHDAGEMAQLLGISLRAGCTKDDFDRTMAVHPTAAEELVTMYQPSYRVRNGERVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative glutathione reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Probable glutathione reductase
total genus 138
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4dnaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA02
4AP3A 3Q9TA 2GAGB 3KLJA 3IC9A 3FG2P 3DGZA 5CQFA 2JK6A 4JY2A 2C67A 4C74A 4GUVA 1VDCA 1ZOYA 4AOSA 4EM3A 2C3DA 2J3NA 4I59A 5IQ1A 3UTHA 3G5SA 2Y6QA 1FEBA 1PXAA 2TMDA 3DJEA 3P4RA 4EMJA 3UKPA 3CGCA 2WESA 1DJQA 4XWRA 1XDIA 4YSZA 4H4ZA 2XVIA 1IUVA 2AR8A 2GQWA 4N9XA 1YQ3A 1GETA 2XFPA 2YVJA 1IUUA 2VVLG 1ONFA 3LZWA 4J57A 4OPGA 2B9YA 2WP6A 3IHMA 1D4EA 3JSKA 4CCRA 1BGJA 2Z5YA 1VG0A 3SFDA 2BK3A 2BXSA 2OALA 2R9ZA 1PXCA 3ITJA 1TDNA 4NTCA 4U8PA 3UOZA 1PBDA 1XANA 1ZY8A 4H4QA 2C7GA 4IA6A 5KOWA 2WEUA 4GDEA 1L9DA 2BS2A 4OPCA 1ZMDA 3NK1X 4YTMA 4D04A 2GH5A 3P9UA 2WOVA 3UKFA 4B1BA 5FS7A 4EQXA 2RGJA 2YG6A 1DOBA 2V61A 2A8XA 1GOSA 1QLBA 3UKKA 2QCUA 3K7MX 1KNPA 4Z44A 1GPEA 3GDNA 3UKQA 4Z2TA 4LU6A 3GD3A 4Z43A 3AD8B 4Z2UA 2WPCA 3EF6A 3GD4A 3AE4A 2APGA 4OPLA 4Z25A 2XLUA 5KVHA 3B6DA 2EQ6A 1JNRA 4HA6A 3AE5A 4YT0A 1ZOVA 3QSEA 2NVKX 4U8LA 2BYBA 2BS4A 4U2TA 3VRBA 5BULA 1NAAA 2UZZA 3DK8A 3BI4A 1FECA 2XLRA 2XLSA 4GR1A 2CVJA 3CIRA 2X8GA 3QFBA 2EQ7A 1K0IA 2I0ZA 1PBBA 3GWFA 3GWDA 4AT2A 5KRQA 1GSNA 1F8RA 1O95A 1S3EA 2GEWA 3UKLA 4YWOA 2C70A 3WE0A 2YR5A 1PJ5A 3AEEA 2JBVA 4GRTA 2B76A 1XHCA 2H89A 3UP4A 2ZZBA 3AE3A 4Z26A 3LOVA 4YXDA 3AECA 3L1RA 5BUKA 2WPFA 1OJTA 4CY6A 2DKIA 3LADA 1GALA 1VG9A 2GR2A 1KFYA 3S61A 2OAMA 3LJPA 1MXTA 1PDHA 3KVEA 2GR0A 2V60A 2PYXA 2B9XA 4REKA 1CC6A 3NTAA 3LXDA 3CN8A 2YR6A 4DGKA 2W0HA 1GT8A 1H86A 2H88A 3P4SA 3UKAA 2GV8A 4OPDA 4TM3A 1EBDA 2YLTA 3BI5A 4U8OA 3AYIA 3NT6A 2TPRA 4K7ZA 4Y4NA 5JCKA 4I58A 5EBKA 1FOHA 1S2YA 4B64A 2R0GA 1BKWA 4RG4A 4C3YA 1KSSA 3P1WA 1H84A 1TDKA 5FS8A 2VQBA 2XFOA 4X9NA 3ZYXA 2RGOA 2VVLA 5L46A 1D4DA 3VRAA 4YTNA 3PVCA 1IUWA 3AEAA 2YVGA 1KDGA 3AXBA 4CNKA 2XYOA 2XLPA 1NEKA 5CKUA 2JB3A 5TR3A 2ZZ0A 1RSGA 3GMBA 2ACZA 3KU9A 4H4VA 5FMHA 4U2SA 3H8IA 2BCPA 5FS6A 2BS3A 2HQMA 4AOXA 1B37A 3UOXA 2WS3A 2YQUA 2VOUA 2YR4A 2WP5A 5GRTA 4YSYA 4FK1A 2VVMA 2XFNA 4A99A 4EQRA 1NPXA 1COYA 2WDQA 1GRHA 2JKCA 3QVPA 4H4YA 1PBEA 2VZ2A 3G5QA 1E39A 3FIMB 2WQYA 1GRAA 4DSHA 1NHPA 3S5WA 3CGDA 5IPYA 4Y4LA 1VRQB 3UTEA 1CF3A 3NK0X 2WP9A 3L8KA 3UOVA 3H4KA 2Y6RA 2F5ZA 2OLNA 2GR3A 4OCGA 4BJZA 4J33A 3CGBA 3D8XA 1ELIA 1QO8A 3ICTA 2YWLA 2C65A 1GERA 3AE2A 3BNUA 2VRLA 3CPHG 1TDEA 3FPZA 1NHQA 3CNJA 4H4TA 2IVDA 3P4QA 4UDPA 4GCMA 1QJDA 1AOGA 4UDQA 1N1PA 1YQ4A 2C64A 4OVIA 4JQ9A 1FL2A 1EL7A 4IA5A 4M52A 1LTXR 3KA7A 2DKHA 2XCGA 3QVRA 4IVMB 4PABA 4H4UA 1E1KA 2C66A 1D7YA 3F8PA 1ZP0A 2R4JA 3T37A 3VR9A 2C75A 3CGEA 4UP3A 5M0ZA 5LV9A 4XWZA 1GXFA 4BURA 1KSUA 2GMHA 1DOEA 3K30A 1P2EA 2RABA 4H2PA 3NYEA 4B68A 4ECHA 2BA9A 2V3BA 2FJDA 4ZCDA 4EM4A 5HHFA 2FJEA 2VQ7A 5HXIA 1YY5A 4A6NA 3RNMA 1EL8A 3ICRA 3RP6A 2Z5XA 4ZN0A 1GESA 3NKSA 1EL9A 4LIIA 3GDPA 4B69A 3HZLA 2E5VA 3K7QX 2X99A 3NNEA 1O94A 3ATQA 4PAAA 2YG7A 3NIXA 3NK2X 3UTGA 3C4NA 5HYMA 5KWFA 3ISHA 2C73A 2WDVA 3BNMA 3C96A 4U8MA 1K0LA 2YG4A 4K8DA 2VRMA 2YG3A 1H82A 4EQSA 4J2WA 2R0PA 2YLXA 3GRTA 1B4VA 2WU2A 2XVFA 1LV0A 3EANA 3FMWA 3I6DA 5EB5A 2GRTA 4H4WA 2YM1A 3AB1A 1NHRA 1TRBA 1D7LA 4APNA 3SM8A 1CJ2A 3URHA 2Q0LA 4U8JA 3Q6JA 2BXRA 1FEAA 3AD9B 3CNSA 3QSMA 4X9MA 4O5UA 4GDPA 1ZDLA 3EPTA 4IVOB 4YTPA 2FJBA 4JNQA 4JNAA 2RGHA 1PJ7A 3D1CA 2IVEA 1PXBA 1O5WA 4TM0A 2GF3A 4ZCCA 3GSIA 4Z24A 1TYPA 3LZXA 4K5SA 5FS9A 4WX1A 3R9UA 4B65A 2BK5A 2PHHA 2R45A 3AEDA 2R0CA 3DA1A 3NRNA 4H2NA 1DNCA 4BK1A 4EIPA 4YKGA 3NH3X 3OC4A 5BVAA 1K0JA 5KXJA 4USRA 4K22A 1CJ4A 1D4CA 3ALMA 3VQRA 4RSLA 3IHGA 4B63A 1CJCA 1PHHA 2O9ZA 2GB0A 2FBWA 3H8LA 4OPUA 2AAQA 3AYLA 2JAEA 1YQZA 3ALJA 3BHKA 3F8RA 1IJHA 2WOIA 3PS9A 4JN9A 4B67A 4CBQA 2GQFA 5C2TA 2ARDA 1GV4A 1LQTA 4HB9A 1TDOA 1CHUA 1DOCA 3NN6X 1GRGA 2OA1A 3SFEA 2WBAA 4KPRA 2Q7VA 1PJ6A 2A89A 3GRSA 3M13A 4P9SA 4K2XA 1CL0A 1Y56A 4XXGA 1M64A 5J60A 3V3NA 4AT0A 3COXA 1Y56B 2WHDA 4EMIA 2GMJA 1JRZA 2CULA 1RYIA 1ZKQA 4BV6A 1M6IA 2BCGG 3DH9A 5IQ4A 3IWAA 1E1NA 1N4VA 1PS9A 1E1MA 4H2QA 1GRBA 4KX6A 4TLZA 2GAHB 3RP7A 1F6MA 1E6EA 4NZHA 1L9EA 3NTDA 3AE1A 1L9CA 3UCLA 2XVJA 1GNDA 3VR8A 3EAOA 1YKJA 2E4GA 3SQPA 5KOXA 4J34A 3RHAA 1PBFA 1MOKA 5U1OA 4E0VA 1ZK7A 3AD7B 3PO7A 1DODA 5J7XA 4TM1A 1L0VA 3AE6A 3NYCA 5GSNA 1BGNA 1MO9A 1KF6A 4OPTA 1B5QA 1P2HA 2ZZCA 5DBJA 4CCQA 1CBOA 1W4XA 2X50A 1JU2A 4GF7A 3QFAA 1D5TA 3BI2A 1NHSA 1TYTA 2BC1A 4Z2RA 3ADAB 2QA1A 4LA1A 4NEWA 2Q6UA 4IV9A 3DGHA 4H4XA 2V6OA 3LB8A 2YG5A 2JB2A 4X4JA 1CC4A 2WPEA 4CNJA 1N4WA 2OLOA 2XLTA 2XVEA 3AYJA 3DJGX 1H83A 2BC0A 2ZBWA 4NTDA 1ZX9A 4DNAA 2BACA 2IIDA 2V3AA 4CRTA 4H4PA 1H81A 2B9WA 1GEUA 3CTYA 2EQ8A 4A6NB 2V5ZA 1DXLA 1IUTA 4U8NA 2BABA 1N4UA 4CY8A 3F8DA 3AE8A 2C3CA 2YVFA 3BHFA 2X3NA 5JCLA 4C5OA 1JRXA 1E1LA 3CNTA 2B7SA 4B66A 2XDOA 1NDAA 1OJCA 3GMCA 1OJAA 4U8KA 4YSXA 1Y0PA 1S2QA 3OZ2A 3P4PA 4YSHA 2YLWA 1LVLA 3AE9A 4A65A 3KD9A 1OJ9A 3NYFA 3AWIA 1UKVG 1Z6LA 2YLRA 4WCTA 3UP5A 5C3JA 4J36A 5ER0A 3UTFA 4O5QA 5KVIA 1CJ3A 1RP0A 1Q1RA 3UOYA 2C76A 1GTEA 3K7TA 5JCMA 5JCIA 1JNZA 4J31A 2CFYA 1OJDA 3KPFA 4H2RA 3ZDNA 1H7WA 2E1MA 1XPQA 1B8SA 2YLZA 5HY5A 1K4QA 4ICYA 3G5RA 1F8WA 2B7RA 2YM2A 3NGCX 3VRDB 2XVHA 4J56A 2EQ9A 3NG7X 4EQWA 2X8CA 4NTEA 1NENA 1EL5A 4BK3A 3NHOX 3SGLA 1E7PA 1JOAA 4A79A 1REOA 4D03A 4TLXA 4A9WA 4EMWA 1BWCA 4BK2A 5EB4A 3V3OA 4JY3A 3IF9A 2QA2A 4A5LA 4C77A 4AP1A 5BRTA 2YLSA 1PBCA 1PN0A 2WU5A 4H4SA 3NLCA 1DJNA 1F8SA 2C72A 3DJDA 1GRTA 5EOWA 1BF3A 2Q0KA 2XFQA 3C4AA 3RP8A 3DJJA 4USQA 1X31B 3ICSA 1Q1WA 3DK9A 2R46A 3M12A 1SEZA 4MJWA 3V76A 1V59A 1KNRA 1JEHA 5JCNA 3CNPA 3GYIA 2YAUA 2WETA 1LQUA 2XFUA 1NG3A 3UKHA 2WOWA 4JDRA 4YKFA 4NEVA 3REDA 1BZLA 3AEBA 2GR1A 1H7XA 2X8HA 1H6VA 5U25A 4Y4MA 3II4A 3KKJA 4UDRA 1TDFA 3QJ4A 4DSGA 4EIQA 3AE7A 1GRFA 1LJ1A 4K5RA 1IUSA 4OPIA 2FJAA 1JRYA 3E1TA 3O0HA 4U2LA 3I3LA 2GVCA 2NPXA 1GTHA 3ABVA 3CPJG 5M10A 4FX9A 3ATRA 4U8IA 3NN0X 4ADWA 2QAEA 2WDRA 3DK4A 2CDUA 1F3PA 3CNDA 4H7UA 3GYJA 2AQJA 3CPIG 1ZMCA 4TM4A 1NG4A 1VQWA 1FCDA 2JB1A 1Q9IA 2R4EA 2BK4A 4BJYA 3FBSA 4C3XA 3AEGA 3B3RA 4A7AA 1CC2A 1S3BA 3ALLA 3QSSA 4H4RA 1LPFA 4RG3A 2A87A 1HYUA 4FDCB 4FK1C 1GREA 3M0OA 5U63A 1IUXA 3DMEA 3AEFA 4H50A
chains in the Genus database with same CATH superfamily
3Q9TA 2JK6A 3B97A 3SY4A 4AOSA 3VCCA 2XSXA 3SN0A 3UKPA 3CGCA 4YSZA 4H4ZA 2AR8A 2GQWA 1YQ3A 3IK4A 1GETA 2XFPA 1R6WA 5EU9A 3SN1A 1ONFA 4J57A 2WP6A 3JSKA 3FV9A 1MNSA 4CCRA 2OALA 2BXSA 2R9ZA 3UOZA 2C7GA 1XANA 4IA6A 5KOWA 2WEUA 3SZCA 2BS2A 2GH5A 3P9UA 4B1BA 4EQXA 2RGJA 1OEPA 2QCUA 4GAVA 3OP2A 3GDNA 4Z2TA 3D9XA 3GD3A 3MSYA 2APGA 5KVHA 2EQ6A 1JNRA 4YT0A 3FYYA 2NVKX 2BYBA 3VRBA 4U2TA 2W54A 3BI4A 3CIRA 3GWDA 5KRQA 1O95A 4DXKA 3DESA 4GRTA 4EWJA 5BUKA 2WPFA 1OJTA 3HYXA 3LJPA 4G9KA 1PDHA 2PYXA 1EC8A 3CN8A 1GT8A 3P4SA 4G7FA 4TM3A 3SZ0A 3IJIA 3IJQA 4HYRA 1S2YA 1KKOA 1KSSA 2QDEA 5FS8A 2XGZA 4HCHA 2XFOA 4DX3A 3DFYA 1D4DA 3AEAA 2YVGA 1KDGA 4E4UA 2XYOA 3PFRA 1RSGA 4HN8A 3RO6A 3SSZA 3A7UA 3KU9A 4DHGA 4U2SA 2BCPA 4GFIA 3IJLA 3TTEA 3VA8A 5GRTA 3SXIA 4A99A 4EQRA 3EKGA 1PBEA 1E39A 3QKEA 3S5WA 5IPYA 4Y4LA 4DWDA 3L8KA 3T4WA 3BJSA 3D8XA 1QO8A 2IVDA 1JROA 1N1PA 4JQ9A 3H70A 1LTXR 2XCGA 1TZZA 4PABA 4H4UA 3OW1A 2R4JA 3QPEA 1MDRA 4B68A 2RABA 2QDDA 2PTZA 2BA9A 2FJDA 5HHFA 5HXIA 2AL2B 2Z5XA 4ZN0A 1GESA 1EL9A 4LIIA 4B69A 3DIPA 2X99A 1O94A 3ATQA 3NK2X 3ISHA 3BNMA 2YG3A 4H19A 1H82A 4J2WA 3CK5A 2R0PA 1JPMA 3GRTA 3UCDA 3PWIA 2YM1A 1NHRA 1TRBA 3ES7A 4APNA 1CJ2A 4U8JA 3Q6JA 2BXRA 4J3ZA 4GDPA 4IVOB 4JNAA 3T14A 2IVEA 4Z24A 3GSIA 3T2YA 4WX1A 3AEDA 5BVAA 4YKGA 1K0JA 4A3RA 3IHGA 3H8LA 2O9ZA 4OPUA 2GB0A 3F8RA 3ZVHA 1IJHA 2FKPA 4CBQA 2GQFA 3THUA 1LQTA 3QTPA 4HB9A 1DOCA 3NN6X 2OA1A 3BOXA 3SZFA 4KPRA 1S7MA 3R10A 5J60A 3V3NA 3COXA 4EMIA 1JRZA 4BV6A 1F9CA 4MGGA 5KMRA 3RP7A 1E6EA 2OZ3A 1L9EA 1IYXA 1L9CA 5KOXA 3EAOA 1YKJA 2OZ8A 1PBFA 5U1OA 3UJFA 1P2HA 1CBOA 4GF7A 2X50A 4KT2A 1SJDA 1D5TA 1NHSA 3P3BA 4CNJA 1N4WA 3T31A 3MKCA 3DJGX 2IIDA 4CRTA 3CTYA 1DXLA 2BABA 4CY8A 4FP1A 2YVFA 4C5OA 1VQZA 2B7SA 2XH7A 2W3RA 3ZLGA 4YSXA 3GMCA 3HRDC 1OJAA 3OZ2A 3VCNA 1OJ9A 1H2IA 4M6UA 1UKVG 4WCTA 3UP5A 3Q4DA 5KVIA 3UOYA 1GTEA 1JNZA 2E1MA 1STZA 1MDLA 1K4QA 3HW2A 4ZOHB 1BQGA 1NENA 4BK3A 3S5SA 3NHOX 3VDGA 3SGLA 1E7PA 3UXLA 4EMWA 3MZNA 4A5LA 5BRTA 2YLSA 3JW7A 4H4SA 3FJ4A 1DJNA 1V97A 6ENLA 5EOWA 1BF3A 2Q0KA 2XFQA 3GYIA 5JCNA 3CNPA 2HXUA 5FJPA 3RRAA 1LQUA 2WOWA 4K8GA 1ONEA 4YKFA 1BZLA 3AEBA 1H7XA 1H6VA 5U25A 4EIQA 1GRFA 2QJMA 1LJ1A 5FJOA 1JRYA 2GVCA 2NPXA 3ABVA 4FX9A 1FHVA 3JZUA 4ADWA 3DK4A 1F3PA 2AQJA 2BK4A 3GYXA 4MKSA 4C3XA 3B3RA 1S3BA 4RG3A 4FK1C 3OZMA 5U63A 2P8BA 3PWGA 3KLJA 2FYMA 3DGZA 2ZC8A 5CQFA 1VDCA 1ZOYA 4EM3A 2C3DA 2J3NA 5IQ1A 2Y6QA 1WYGA 2TMDA 3P4RA 4EMJA 4XWRA 1XDIA 4N9XA 2YVJA 2VVLG 2NQLA 4OPGA 3IHMA 1D4EA 1VG0A 3SFDA 2BK3A 1PXCA 3ITJA 4GDEA 4G8TA 4D04A 2I5QA 1EBHA 5FS7A 3RR1A 1R0MA 2YG6A 4NNJA 1FIQB 2OVLA 1QLBA 2PTYA 3MY9A 2PP3A 3UKQA 4LU6A 4K1WA 3AD8B 3EF6A 3AE4A 3UJSA 2XLUA 3B6DA 3AE5A 1TKKA 4GYPC 4U8LA 5BULA 1NAAA 2GGJA 2X8GA 2EQ7A 1K0IA 4AT2A 3HYWA 1EC9A 2C70A 3AEEA 4E4FA 2JBVA 4HCDA 2B76A 2XH4A 2H89A 4GYPA 4Z26A 4YXDA 3AECA 1GALA 1VG9A 2GR2A 2GGGA 4JN8A 3KVEA 2GR0A 3GY1A 2B9XA 2YR6A 4A35A 2W0HA 1T3QC 1H86A 4OPDA 2YLTA 2MNRA 4K7ZA 4Y4NA 3UJRA 1XPYA 1BKWA 2XH2A 4X9NA 3VRAA 4YTNA 2OQYA 3NXLA 3ES8A 2ACZA 3H8IA 5FS6A 2WP5A 2VVMA 3TWBA 4DYEA 4G6GA 1COYA 3S47A 2JKCA 4DSHA 4M0XA 3CGDA 1VRQB 2WP9A 3H4KA 1ELIA 2PA6A 2C65A 3AE2A 3CPHG 3FPZA 2DW7A 3P4QA 1AOGA 3TWAA 4UDQA 1YQ4A 1PDZA 4MMWA 1EL7A 4IA5A 4M52A 3KA7A 2DKHA 4IT1A 1D7YA 1ZP0A 1DTNA 3NFUA 1SB3B 1GXFA 3K30A 3FCPA 1FFUC 4H2PA 3NYEA 2VQ7A 3NRZB 1YY5A 3ICRA 3NKSA 3GDPA 3HZLA 2E5VA 3NNEA 3NIXA 3C96A 2YG4A 4K8DA 4EQSA 4GGHA 2XVFA 3FMWA 4JN7A 3AB1A 3SM8A 2Q0LA 3QSMA 3R11A 4X9MA 4O5UA 3EPTA 4YTPA 1BKHA 2RGHA 2OPJA 1O5WA 4TM0A 5KMSA 3SZWA 3DG3A 3TJ4A 2R0CA 3AN1A 1DNCA 4BK1A 5KXJA 3NH3X 4K22A 3RGTA 1D4CA 4RSLA 1CJCA 4KPLA 2JAEA 3ALJA 4JHMA 2ARDA 3Q45A 2Q7VA 4P9SA 2GSHA 1Y56A 4XXGA 3EEZA 2GMJA 1ZKQA 3DH9A 3IWAA 1MUCA 1PS9A 4H2QA 1GRBA 3UCLA 1MOKA 4HPNA 3PO7A 4TM1A 1MO9A 4CCQA 1B5QA 2ZZCA 1JU2A 3H7VA 3BI2A 1TYTA 5ENLA 2PP1A 2Q6UA 5BOEA 2YG5A 4X4JA 4E8GA 2WPEA 3H12A 2XVEA 4TVYA 1H83A 2BC0A 4NTDA 4DNAA 2V3AA 3TOYA 4H4PA 1H81A 1GEUA 4A6NB 1IUTA 4U8NA 1N4UA 3DERA 2C3CA 2XDOA 1NDAA 3BSMA 1P43A 1S2QA 3P4PA 2POZA 4YSHA 3KD9A 3NYFA 3AWIA 1Z6LA 2YLRA 3ZLHA 1N5XA 1RP0A 4GIRA 3K7TA 4J31A 1OJDA 2ZADA 3KPFA 1P48A 4ICYA 7ENLA 3TQPA 2B7RA 2YM2A 2BRYA 3VRDB 2XVHA 5KMQA 3NG7X 2P8CA 1EL5A 1JOAA 2QJJA 1REOA 4D03A 1FO4A 4JY3A 1ELSA 3IF9A 4C77A 4AP1A 3NLCA 2C72A 3DJDA 1GRTA 3SR6B 3C4AA 3DJJA 2PSNA 3ICSA 3DK9A 4MJWA 1V59A 1X2HA 2YAUA 3STPA 3UKHA 3REDA 2PGEA 3N6JA 3SQSA 4Y4MA 3II4A 4UDRA 3TW9A 3QJ4A 1IUSA 3UJ2A 3QLDA 3E1TA 3U9IA 3NS1B 2CDUA 3GYJA 3CPIG 3DGBA 3FBSA 2W3SA 3QSSA 4H4RA 3VFCA 2AL1A 5FJUA 2P88A 3A7AA 1KD0A 3DMEA 2GAGB 3MWCA 3FG2P 2C67A 4IZGA 4C74A 4GUVA 3OPSA 1EBGA 2WESA 2XVIA 2PTXA 1IUUA 3CMMA 3VC6A 2B9YA 3GD6A 2Z5YA 4E5TA 1WUEA 1TDNA 4NTCA 1ZY8A 1ZMDA 3NK1X 4YTMA 3R1ZA 2WOVA 2OX4A 2RDXA 1KN0A 1DOBA 2V61A 2A8XA 3UKKA 1KKRA 2PU0A 2WPCA 1SJAA 3GD4A 3OZYA 4OPLA 3FVDA 3K1GA 4HA6A 1ZOVA 2BS4A 3DK8A 1FECA 2CVJA 3UCCA 3QFBA 3T2ZA 1PBBA 3GWFA 1GSNA 2GEWA 3GC2A 3WE0A 2P0IA 4YWOA 2YR5A 3UP4A 2ZZBA 1KCZA 2CHRA 3L1RA 2DKIA 1MXTA 5JRBA 4REKA 1CC6A 3LXDA 4K2SA 2H88A 3BI5A 3TCSA 1PDYA 5JCKA 4Z1YA 4I58A 5EBKA 2ONEA 1FOHA 4B64A 1N63C 4C3YA 3T2KA 1TDKA 2VQBA 1IUWA 3DEQA 4CNKA 1NEKA 3N6HA 5CKUA 5TR3A 2ZZ0A 4H4VA 5FMHA 2BS3A 2HQMA 2E5AA 1B37A 2YQUA 1N5WC 4YSYA 4FK1A 3L5OA 1NPXA 3QVPA 4H4YA 2VZ2A 3G5QA 3MQTA 2WQYA 1ECQA 1GRAA 1NHPA 3R07C 1N61C 2Y6RA 2F5ZA 5IDZA 2OLNA 4OCGA 4BJZA 4J33A 3CGBA 3ICTA 3BNUA 1E9IA 2VRLA 1TDEA 2AKZA 4UDPA 1QJDA 2C64A 3NVVB 3P0WA 1FL2A 3H8AA 4IVMB 3T0KA 3CAWA 3V3WA 3F8PA 3VR9A 4UP3A 5M0ZA 5LV9A 3T6CA 4BURA 2GMHA 1DOEA 4ECHA 1P2EA 3DG7A 4EM4A 4F4RA 3RNMA 1EL8A 3RP6A 2AL2A 5HYMA 4PAAA 2YG7A 4ENLA 3NVYB 2C73A 4U8MA 2WU2A 1B4VA 3I6DA 5EB5A 4H83A 1D7LA 4E6MA 3URHA 1FEAA 4A6GA 3I4KA 3SX6A 2FJBA 4JNQA 3D46A 3CT2A 1PXBA 4ZCCA 1TYPA 4K5SA 5FS9A 2BK5A 2R45A 4EIPA 2GL5A 4USRA 1CJ4A 3I6EA 3ALMA 3VQRA 2OO6A 4B63A 4B65A 1PHHA 2AAQA 3AYLA 3BHKA 2WOIA 3ENLA 3DG6A 3CYJA 4B67A 5C2TA 2O56A 1TDOA 3T9PA 1CHUA 1GRGA 3SFEA 1PJ6A 2A89A 1CL0A 1M64A 4AT0A 2PP0A 2CULA 1RYIA 1M6IA 2QGYA 2BCGG 3SJNA 1E1NA 1E1MA 4KX6A 4NZHA 2XVJA 3SQPA 4J34A 4E0VA 3AD7B 3AE6A 1BGNA 2OQHA 1KF6A 5DBJA 3QFAA 3ADAB 2QA1A 4LA1A 3DGHA 4H4XA 1FHUA 2OLOA 2XLTA 1ZX9A 1SJCA 2EQ8A 2OFJA 2PGWA 2QJNA 3AE8A 3BHFA 1JRXA 3CNTA 1Y0PA 4A65A 4O5QA 2C76A 5JCMA 5JCIA 4ZA0A 2PPGA 2CFYA 3ZDNA 3UXKA 3PG6A 4H1ZA 3NVZB 5HY5A 1F8WA 3NGCX 2PODA 4J56A 2DW6A 2EQ9A 4EQWA 4NTEA 3CB3A 3OTRA 5G5GB 4A9WA 1SJBA 1BWCA 5EB4A 3DDMA 5KNLA 4ZCWA 4Z17A 1PN0A 3RITA 3B9JB 1Q1WA 3V76A 1SEZA 1JEHA 2C4CA 2P3ZA 4NEVA 1X2GA 2MUCA 1TDFA 5BOFA 1ZXIC 4K5RA 4OPIA 2QQ6A 2FJAA 3O0HA 4U2LA 3RCYA 1GTHA 3CPJG 2OKTA 4U8IA 3HYVA 3MUCA 4HCLA 4IHCA 3NN0X 2QAEA 3V4BA 3CNDA 4H7UA 1ZMCA 2AKMA 1VQWA 2PMQA 1Q9IA 2R4EA 3AEGA 4A7AA 4TVWA 2A87A 1HYUA 3M0OA 3AEFA 4AP3A 4GMEA 3IC9A 1W6TA 4JY2A 4KWSA 3SN4A 3UTHA 4I59A 3G5SA 1MRAA 1FEBA 1PXAA 3DJEA 1DJQA 3I6TA 1IUVA 3LZWA 2OG9A 1JCTA 1BGJA 4U8PA 1PBDA 4H2HA 4H4QA 1L9DA 2E3TA 4OPCA 3UKFA 1GOSA 4J1OA 3GO2A 3K7MX 1KNPA 4Z44A 1GPEA 4GISA 1JDFA 3V5FA 4Z43A 2GGEA 4Z2UA 4Z25A 3QSEA 3FXGA 5J04A 2UZZA 2XLRA 2XLSA 4GR1A 2BRAA 1N62C 2I0ZA 3R25A 1F8RA 3UKLA 1S3EA 1PJ5A 1XHCA 1VDVA 3AE3A 3LOVA 4CY6A 3LADA 1KFYA 3S61A 2OAMA 2V60A 3NTAA 4DGKA 3UKAA 2GV8A 1EBDA 3AMZA 3AYIA 4U8OA 1TE6A 3NT6A 2TPRA 1RM6B 2R0GA 4RG4A 3P1WA 1H84A 5KMPA 3ZYXA 2RGOA 2VVLA 5L46A 3PVCA 1FFVC 4DN1A 2PU1A 3AXBA 1NELA 2XLPA 2HXTA 2GDQA 2JB3A 3GMBA 3T8QA 3NO1A 4IP5A 4FI4A 1L8PA 3UOXA 4AOXA 2WS3A 4II2A 2VOUA 2YR4A 2XFNA 2WDQA 1GRHA 3FIMB 2PCEA 1JRPA 3UTEA 1CF3A 3NK0X 3UOVA 3R0UA 2GR3A 3NVWB 2YWLA 1GERA 4X2PA 1NHQA 1XS2A 4H4TA 3CNJA 4GCMA 4GGBA 3CXBA 4OVIA 4HNCA 3AM9A 2OLAA 3QVRA 1E1KA 2C66A 3T37A 1WUFA 3CGEA 2C75A 3SYIA 4IL2A 4XWZA 1KSUA 2V3BA 4ZCDA 2FJEA 4G6HA 4A6NA 2QVHA 1JPDX 3N4EA 3K7QX 3UTGA 5KWFA 3C4NA 4G74A 2WDVA 1K0LA 3V5CA 2VRMA 2YLXA 3EANA 1LV0A 2GRTA 4H4WA 3SBFA 3JVAA 3TJIA 3AD9B 3CNSA 2XH0A 1ZDLA 3DFHA 3ZVHB 1PJ7A 3D1CA 2GF3A 3LZXA 3R9UA 2PHHA 3NRNA 4H2NA 3DA1A 3OC4A 4GAPA 2FBWA 1YQZA 1NU5A 4JN9A 3PS9A 1GV4A 4ROPA 3NZGA 2WBAA 3PK7A 3GRSA 3M13A 1EC7A 4K2XA 4KEMA 3P93A 1Y56B 2WHDA 2W55A 3EUB3 2GGIA 5IQ4A 1N4VA 4TLZA 2GAHB 1F6MA 3N4FA 5G5HB 2HZGA 3NTDA 3AE1A 3VR8A 1GNDA 2E4GA 3RHAA 2HNEA 4IP4A 1ZK7A 1DODA 5J7XA 1L0VA 3NYCA 5GSNA 3A7RA 4OPTA 1W4XA 2BC1A 4YWSA 4Z2RA 4NEWA 1N60C 4IV9A 2V6OA 3LB8A 2JB2A 1CC4A 3D47A 3AYJA 2ZBWA 2BACA 2B9WA 2V5ZA 3F8DA 2X3NA 5JCLA 1E1LA 4B66A 1OJCA 4U8KA 2YLWA 1LVLA 3AE9A 3UGVA 4G73A 5C3JA 4J36A 5ER0A 3ETRB 3UTFA 1CJ3A 1Q1RA 4H2RA 1H7WA 1XPQA 3UJEA 1B8SA 2YLZA 3G5RA 2X8CA 3VC5A 4A79A 5FJRA 3ZLFA 4TLXA 4BK2A 3V3OA 2QA2A 4IL0A 1PBCA 4NWZA 2WU5A 1F8SA 3KPKA 3RP8A 4USQA 1X31B 3R0KA 2R46A 3M12A 1KNRA 2WETA 2XFUA 3U4FA 1NG3A 4II3A 4JDRA 3ZVIA 2PS2A 1RVKA 2GR1A 3KUMA 2X8HA 3KKJA 3QN3A 4DSGA 3AE7A 1YEYA 3I3LA 5M10A 3ATRA 3CXOA 2WDRA 5FJTA 4TM4A 1NG4A 1FCDA 2JB1A 3HPFA 2PTWA 4BJYA 1CC2A 3ALLA 1LPFA 2GGHA 4FDCB 1GREA 4HNLA 1IUXA 2OZTA 4H50A
chains in the Genus database with same CATH topology
4AP3A 3Q9TA 2GAGB 3KLJA 3IC9A 3FG2P 3DGZA 5CQFA 2JK6A 4JY2A 2C67A 4C74A 4GUVA 1VDCA 1ZOYA 3SY4A 4AOSA 4EM3A 2C3DA 2J3NA 4I59A 5IQ1A 3UTHA 3G5SA 2Y6QA 1FEBA 1PXAA 2TMDA 3DJEA 3P4RA 4EMJA 3UKPA 3CGCA 2WESA 1DJQA 4XWRA 1XDIA 4YSZA 4H4ZA 2XVIA 1IUVA 2AR8A 2GQWA 4N9XA 1YQ3A 1GETA 2XFPA 2YVJA 1IUUA 2VVLG 3CMMA 1ONFA 3LZWA 4J57A 4OPGA 2B9YA 2WP6A 3IHMA 1D4EA 3JSKA 4CCRA 1BGJA 2Z5YA 1VG0A 3SFDA 2BK3A 2BXSA 2OALA 2R9ZA 1PXCA 3ITJA 1TDNA 4NTCA 4U8PA 3UOZA 1PBDA 1XANA 1ZY8A 4H4QA 2C7GA 4IA6A 5KOWA 2WEUA 4GDEA 3SZCA 1L9DA 2BS2A 4OPCA 1ZMDA 3NK1X 4YTMA 4D04A 2GH5A 3P9UA 2WOVA 3UKFA 4B1BA 5FS7A 4EQXA 2RGJA 1KN0A 2YG6A 1DOBA 2V61A 4NNJA 2A8XA 1GOSA 1QLBA 3UKKA 2QCUA 3K7MX 4GAVA 1KNPA 4Z44A 1GPEA 3GDNA 3UKQA 4Z2TA 4LU6A 3D9XA 3GD3A 4Z43A 3AD8B 4Z2UA 2WPCA 3EF6A 3GD4A 3AE4A 2APGA 4OPLA 4Z25A 2XLUA 5KVHA 3B6DA 2EQ6A 1JNRA 4HA6A 3AE5A 4YT0A 1ZOVA 3QSEA 2NVKX 4U8LA 2BYBA 2BS4A 4U2TA 3VRBA 5BULA 1NAAA 2UZZA 3DK8A 3BI4A 1FECA 2XLRA 2XLSA 4GR1A 2CVJA 3CIRA 2X8GA 3QFBA 2BRAA 3T2ZA 2EQ7A 1K0IA 2I0ZA 1PBBA 3GWFA 3GWDA 4AT2A 5KRQA 1GSNA 1F8RA 1O95A 1S3EA 2GEWA 3HYWA 4YWOA 2C70A 3UKLA 2YR5A 1PJ5A 3AEEA 2JBVA 4GRTA 3WE0A 2B76A 1XHCA 2H89A 3UP4A 2ZZBA 3AE3A 4Z26A 3LOVA 4YXDA 3AECA 3L1RA 5BUKA 2WPFA 1OJTA 4CY6A 2DKIA 3LADA 1GALA 1VG9A 2GR2A 1KFYA 3HYXA 2OAMA 3S61A 3LJPA 1MXTA 1PDHA 3KVEA 2GR0A 4G9KA 2V60A 5JRBA 2PYXA 2B9XA 4REKA 1CC6A 3NTAA 3LXDA 3CN8A 2YR6A 4DGKA 2W0HA 1GT8A 1H86A 2H88A 3P4SA 3UKAA 2GV8A 4OPDA 4TM3A 1EBDA 2YLTA 3BI5A 4U8OA 3AYIA 3SZ0A 3NT6A 2TPRA 4K7ZA 4Y4NA 5JCKA 4I58A 5EBKA 1FOHA 1S2YA 4B64A 2R0GA 1BKWA 4RG4A 4C3YA 1KSSA 3T2KA 3P1WA 1H84A 1TDKA 5FS8A 2VQBA 5KMPA 2XFOA 4X9NA 3ZYXA 2RGOA 2VVLA 5L46A 1D4DA 3VRAA 4YTNA 3PVCA 1IUWA 3AEAA 2YVGA 1KDGA 3AXBA 4CNKA 2XYOA 2XLPA 1NEKA 5CKUA 2JB3A 5TR3A 2ZZ0A 1RSGA 3GMBA 2ACZA 3KU9A 4H4VA 5FMHA 4U2SA 3H8IA 2BCPA 5FS6A 2BS3A 2HQMA 4AOXA 1B37A 3UOXA 2WS3A 4II2A 2YQUA 2VOUA 2YR4A 2WP5A 5GRTA 4YSYA 3SXIA 4FK1A 3L5OA 2VVMA 2XFNA 4A99A 4EQRA 1NPXA 1COYA 2WDQA 1GRHA 4G6GA 2JKCA 3QVPA 4H4YA 1PBEA 2VZ2A 3G5QA 1E39A 3FIMB 2WQYA 1GRAA 4DSHA 1NHPA 3S5WA 3CGDA 5IPYA 4Y4LA 1VRQB 3UTEA 1CF3A 3NK0X 2WP9A 3L8KA 3UOVA 3H4KA 2Y6RA 2F5ZA 2OLNA 2GR3A 4OCGA 4BJZA 4J33A 3CGBA 3D8XA 1ELIA 1QO8A 3ICTA 2YWLA 2C65A 1GERA 3AE2A 3BNUA 2VRLA 3CPHG 1TDEA 3FPZA 1NHQA 3CNJA 4H4TA 2IVDA 3P4QA 4UDPA 4GCMA 1QJDA 1AOGA 4UDQA 1N1PA 1YQ4A 2C64A 4OVIA 4JQ9A 1FL2A 1EL7A 4IA5A 4M52A 1LTXR 3KA7A 2DKHA 2XCGA 3QVRA 4IVMB 4PABA 3T0KA 4H4UA 1E1KA 2C66A 1D7YA 4B63A 3F8PA 1ZP0A 2R4JA 3T37A 3VR9A 2C75A 3CGEA 4UP3A 5M0ZA 5LV9A 3SYIA 4XWZA 1GXFA 4BURA 1KSUA 2GMHA 1DOEA 3K30A 1P2EA 2RABA 4H2PA 3NYEA 4B68A 4ECHA 2V3BA 2BA9A 2FJDA 4ZCDA 4EM4A 5HHFA 2FJEA 2VQ7A 5HXIA 1YY5A 4G6HA 4A6NA 3RNMA 1EL8A 3ICRA 3RP6A 2Z5XA 4ZN0A 1GESA 3NKSA 1EL9A 4LIIA 3GDPA 4B69A 3HZLA 2E5VA 3K7QX 2X99A 3NNEA 1O94A 3ATQA 4PAAA 2YG7A 3NIXA 3NK2X 3UTGA 3C4NA 5HYMA 5KWFA 3ISHA 2C73A 2WDVA 3BNMA 3C96A 4G74A 1K0LA 4U8MA 2YG4A 4K8DA 2VRMA 2YG3A 1H82A 4EQSA 4J2WA 2R0PA 2YLXA 3GRTA 1B4VA 2WU2A 2XVFA 1LV0A 3EANA 3FMWA 3I6DA 5EB5A 2GRTA 4H4WA 2YM1A 3AB1A 1NHRA 1TRBA 1D7LA 4APNA 3SM8A 1CJ2A 3URHA 2Q0LA 4U8JA 3Q6JA 2BXRA 1FEAA 3AD9B 3CNSA 3QSMA 4X9MA 4O5UA 4GDPA 1ZDLA 3EPTA 4IVOB 4YTPA 3SX6A 2FJBA 4JNQA 4JNAA 2RGHA 1PJ7A 3D1CA 3T14A 2IVEA 1O5WA 1PXBA 4TM0A 2GF3A 4ZCCA 3GSIA 4Z24A 1TYPA 3LZXA 3T2YA 5KMSA 4K5SA 3SZWA 5FS9A 4WX1A 3R9UA 4B65A 2BK5A 2PHHA 2R45A 3AEDA 2R0CA 3DA1A 3NRNA 4H2NA 1DNCA 4BK1A 4EIPA 4YKGA 3NH3X 3OC4A 5BVAA 1K0JA 5KXJA 4USRA 4K22A 1CJ4A 1D4CA 3ALMA 3VQRA 4RSLA 3IHGA 4GAPA 1CJCA 1PHHA 2O9ZA 2GB0A 2FBWA 3H8LA 4OPUA 2AAQA 3AYLA 2JAEA 1YQZA 3ALJA 3BHKA 3F8RA 1IJHA 2WOIA 3PS9A 4JN9A 4B67A 4CBQA 2GQFA 5C2TA 2ARDA 1GV4A 1LQTA 4HB9A 1TDOA 1CHUA 1DOCA 3NN6X 1GRGA 2OA1A 3SFEA 3SZFA 2WBAA 4KPRA 2Q7VA 1S7MA 1PJ6A 2A89A 3GRSA 3M13A 4P9SA 4K2XA 1CL0A 1Y56A 4XXGA 1M64A 5J60A 3V3NA 4AT0A 3COXA 1Y56B 2WHDA 4EMIA 2GMJA 1JRZA 2CULA 1RYIA 1ZKQA 4BV6A 1M6IA 2BCGG 3DH9A 5IQ4A 3IWAA 1E1NA 1N4VA 1PS9A 5KMRA 1E1MA 4H2QA 1GRBA 4KX6A 4TLZA 2GAHB 3RP7A 1F6MA 1E6EA 4NZHA 1L9EA 3NTDA 3AE1A 1L9CA 3UCLA 2XVJA 1GNDA 3VR8A 3EAOA 1YKJA 2E4GA 3SQPA 5KOXA 4J34A 3RHAA 1PBFA 1MOKA 5U1OA 4E0VA 1ZK7A 3AD7B 3PO7A 1DODA 5J7XA 4TM1A 1L0VA 3AE6A 3NYCA 5GSNA 1BGNA 1MO9A 1KF6A 4OPTA 1B5QA 1P2HA 2ZZCA 5DBJA 4CCQA 1CBOA 1W4XA 2X50A 1JU2A 4GF7A 3QFAA 1D5TA 3BI2A 1NHSA 1TYTA 2BC1A 4Z2RA 3ADAB 2QA1A 4LA1A 4NEWA 2Q6UA 4IV9A 3DGHA 4H4XA 2V6OA 3LB8A 2YG5A 2JB2A 4X4JA 1CC4A 2WPEA 4CNJA 1N4WA 3T31A 2OLOA 2XLTA 2XVEA 3AYJA 3DJGX 1H83A 2BC0A 2ZBWA 4NTDA 1ZX9A 4DNAA 2V3AA 2BACA 2IIDA 4CRTA 4H4PA 1H81A 2B9WA 1GEUA 3CTYA 2EQ8A 4A6NB 2V5ZA 1DXLA 1IUTA 4U8NA 2BABA 1N4UA 4CY8A 3F8DA 3AE8A 2C3CA 2YVFA 3BHFA 2X3NA 5JCLA 4C5OA 1JRXA 1E1LA 3CNTA 2B7SA 4B66A 2XDOA 1NDAA 1OJCA 3GMCA 1OJAA 4U8KA 4YSXA 1Y0PA 1S2QA 3OZ2A 3P4PA 4YSHA 2YLWA 1LVLA 3AE9A 4A65A 3KD9A 1OJ9A 3NYFA 3AWIA 1H2IA 4G73A 1UKVG 1Z6LA 2YLRA 4WCTA 3UP5A 5C3JA 4J36A 5ER0A 3UTFA 4O5QA 5KVIA 1CJ3A 1RP0A 1Q1RA 3UOYA 2C76A 1GTEA 3K7TA 5JCMA 5JCIA 1JNZA 4J31A 2CFYA 1OJDA 3KPFA 4H2RA 3ZDNA 1H7WA 2E1MA 1XPQA 3PG6A 1B8SA 2YLZA 5HY5A 1K4QA 4ICYA 3G5RA 1F8WA 2B7RA 2YM2A 3NGCX 2BRYA 3VRDB 2XVHA 4J56A 5KMQA 2EQ9A 3NG7X 4EQWA 2X8CA 4NTEA 1NENA 1EL5A 4BK3A 3NHOX 3SGLA 1E7PA 1JOAA 4A79A 1REOA 4D03A 4TLXA 4A9WA 4EMWA 1BWCA 4BK2A 5EB4A 3V3OA 4JY3A 3IF9A 2QA2A 4A5LA 4C77A 4AP1A 5KNLA 5BRTA 2YLSA 1PBCA 1PN0A 4NWZA 2WU5A 4H4SA 3NLCA 1DJNA 1F8SA 2C72A 3DJDA 1GRTA 5EOWA 3KPKA 1BF3A 2Q0KA 2XFQA 3C4AA 3RP8A 3DJJA 4USQA 1X31B 3ICSA 1Q1WA 3DK9A 2R46A 3M12A 1SEZA 4MJWA 3V76A 1V59A 1KNRA 1JEHA 5JCNA 3CNPA 3GYIA 2YAUA 2WETA 1LQUA 2XFUA 1NG3A 3UKHA 2WOWA 2C4CA 4II3A 4JDRA 4YKFA 4NEVA 3REDA 1BZLA 3AEBA 2GR1A 1H7XA 2X8HA 1H6VA 5U25A 4Y4MA 3II4A 3KKJA 4UDRA 1TDFA 3QJ4A 4DSGA 4EIQA 3AE7A 1GRFA 1LJ1A 4K5RA 1IUSA 4OPIA 2FJAA 1JRYA 3E1TA 3O0HA 4U2LA 3I3LA 2GVCA 2NPXA 1GTHA 3ABVA 3CPJG 5M10A 4FX9A 3ATRA 4U8IA 3HYVA 3NN0X 4ADWA 2QAEA 2WDRA 3DK4A 2CDUA 1F3PA 3CNDA 4H7UA 3GYJA 2AQJA 3CPIG 1ZMCA 4TM4A 1NG4A 1VQWA 1FCDA 2JB1A 1Q9IA 2R4EA 2BK4A 4BJYA 3GYXA 3FBSA 4C3XA 3AEGA 3B3RA 4A7AA 1CC2A 1S3BA 3ALLA 3QSSA 4H4RA 1LPFA 4RG3A 2A87A 1HYUA 4FDCB 4FK1C 1GREA 3M0OA 5U63A 1IUXA 3DMEA 3AEFA 4H50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP3 A;  3Q9T A;  2GAG B;  3KLJ A;  3IC9 A;  3FG2 P;  3DGZ A;  5CQF A;  2JK6 A;  4JY2 A;  2C67 A;  4C74 A;  4GUV A;  1VDC A;  1ZOY A;  4AOS A;  4EM3 A;  2C3D A;  2J3N A;  4I59 A;  5IQ1 A;  3UTH A;  3G5S A;  2Y6Q A;  1FEB A;  1PXA A;  2TMD A;  3DJE A;  3P4R A;  4EMJ A;  3UKP A;  3CGC A;  2WES A;  1DJQ A;  4XWR A;  1XDI A;  4YSZ A;  4H4Z A;  2XVI A;  1IUV A;  2AR8 A;  2GQW A;  4N9X A;  1YQ3 A;  1GET A;  2XFP A;  2YVJ A;  1IUU A;  2VVL G;  1ONF A;  3LZW A;  4J57 A;  4OPG A;  2B9Y A;  2WP6 A;  3IHM A;  1D4E A;  3JSK A;  4CCR A;  1BGJ A;  2Z5Y A;  1VG0 A;  3SFD A;  2BK3 A;  2BXS A;  2OAL A;  2R9Z A;  1PXC A;  3ITJ A;  1TDN A;  4NTC A;  4U8P A;  3UOZ A;  1PBD A;  1XAN A;  1ZY8 A;  4H4Q A;  2C7G A;  4IA6 A;  5KOW A;  2WEU A;  4GDE A;  1L9D A;  2BS2 A;  4OPC A;  1ZMD A;  3NK1 X;  4YTM A;  4D04 A;  2GH5 A;  3P9U A;  2WOV A;  3UKF A;  4B1B A;  5FS7 A;  4EQX A;  2RGJ A;  2YG6 A;  1DOB A;  2V61 A;  2A8X A;  1GOS A;  1QLB A;  3UKK A;  2QCU A;  3K7M X;  1KNP A;  4Z44 A;  1GPE A;  3GDN A;  3UKQ A;  4Z2T A;  4LU6 A;  3GD3 A;  4Z43 A;  3AD8 B;  4Z2U A;  2WPC A;  3EF6 A;  3GD4 A;  3AE4 A;  2APG A;  4OPL A;  4Z25 A;  2XLU A;  5KVH A;  3B6D A;  2EQ6 A;  1JNR A;  4HA6 A;  3AE5 A;  4YT0 A;  1ZOV A;  3QSE A;  2NVK X;  4U8L A;  2BYB A;  2BS4 A;  4U2T A;  3VRB A;  5BUL A;  1NAA A;  2UZZ A;  3DK8 A;  3BI4 A;  1FEC A;  2XLR A;  2XLS A;  4GR1 A;  2CVJ A;  3CIR A;  2X8G A;  3QFB A;  2EQ7 A;  1K0I A;  2I0Z A;  1PBB A;  3GWF A;  3GWD A;  4AT2 A;  5KRQ A;  1GSN A;  1F8R A;  1O95 A;  1S3E A;  2GEW A;  3UKL A;  4YWO A;  2C70 A;  3WE0 A;  2YR5 A;  1PJ5 A;  3AEE A;  2JBV A;  4GRT A;  2B76 A;  1XHC A;  2H89 A;  3UP4 A;  2ZZB A;  3AE3 A;  4Z26 A;  3LOV A;  4YXD A;  3AEC A;  3L1R A;  5BUK A;  2WPF A;  1OJT A;  4CY6 A;  2DKI A;  3LAD A;  1GAL A;  1VG9 A;  2GR2 A;  1KFY A;  3S61 A;  2OAM A;  3LJP A;  1MXT A;  1PDH A;  3KVE A;  2GR0 A;  2V60 A;  2PYX A;  2B9X A;  4REK A;  1CC6 A;  3NTA A;  3LXD A;  3CN8 A;  2YR6 A;  4DGK A;  2W0H A;  1GT8 A;  1H86 A;  2H88 A;  3P4S A;  3UKA A;  2GV8 A;  4OPD A;  4TM3 A;  1EBD A;  2YLT A;  3BI5 A;  4U8O A;  3AYI A;  3NT6 A;  2TPR A;  4K7Z A;  4Y4N A;  5JCK A;  4I58 A;  5EBK A;  1FOH A;  1S2Y A;  4B64 A;  2R0G A;  1BKW A;  4RG4 A;  4C3Y A;  1KSS A;  3P1W A;  1H84 A;  1TDK A;  5FS8 A;  2VQB A;  2XFO A;  4X9N A;  3ZYX A;  2RGO A;  2VVL A;  5L46 A;  1D4D A;  3VRA A;  4YTN A;  3PVC A;  1IUW A;  3AEA A;  2YVG A;  1KDG A;  3AXB A;  4CNK A;  2XYO A;  2XLP A;  1NEK A;  5CKU A;  2JB3 A;  5TR3 A;  2ZZ0 A;  1RSG A;  3GMB A;  2ACZ A;  3KU9 A;  4H4V A;  5FMH A;  4U2S A;  3H8I A;  2BCP A;  5FS6 A;  2BS3 A;  2HQM A;  4AOX A;  1B37 A;  3UOX A;  2WS3 A;  2YQU A;  2VOU A;  2YR4 A;  2WP5 A;  5GRT A;  4YSY A;  4FK1 A;  2VVM A;  2XFN A;  4A99 A;  4EQR A;  1NPX A;  1COY A;  2WDQ A;  1GRH A;  2JKC A;  3QVP A;  4H4Y A;  1PBE A;  2VZ2 A;  3G5Q A;  1E39 A;  3FIM B;  2WQY A;  1GRA A;  4DSH A;  1NHP A;  3S5W A;  3CGD A;  5IPY A;  4Y4L A;  1VRQ B;  3UTE A;  1CF3 A;  3NK0 X;  2WP9 A;  3L8K A;  3UOV A;  3H4K A;  2Y6R A;  2F5Z A;  2OLN A;  2GR3 A;  4OCG A;  4BJZ A;  4J33 A;  3CGB A;  3D8X A;  1ELI A;  1QO8 A;  3ICT A;  2YWL A;  2C65 A;  1GER A;  3AE2 A;  3BNU A;  2VRL A;  3CPH G;  1TDE A;  3FPZ A;  1NHQ A;  3CNJ A;  4H4T A;  2IVD A;  3P4Q A;  4UDP A;  4GCM A;  1QJD A;  1AOG A;  4UDQ A;  1N1P A;  1YQ4 A;  2C64 A;  4OVI A;  4JQ9 A;  1FL2 A;  1EL7 A;  4IA5 A;  4M52 A;  1LTX R;  3KA7 A;  2DKH A;  2XCG A;  3QVR A;  4IVM B;  4PAB A;  4H4U A;  1E1K A;  2C66 A;  1D7Y A;  3F8P A;  1ZP0 A;  2R4J A;  3T37 A;  3VR9 A;  2C75 A;  3CGE A;  4UP3 A;  5M0Z A;  5LV9 A;  4XWZ A;  1GXF A;  4BUR A;  1KSU A;  2GMH A;  1DOE A;  3K30 A;  1P2E A;  2RAB A;  4H2P A;  3NYE A;  4B68 A;  4ECH A;  2BA9 A;  2V3B A;  2FJD A;  4ZCD A;  4EM4 A;  5HHF A;  2FJE A;  2VQ7 A;  5HXI A;  1YY5 A;  4A6N A;  3RNM A;  1EL8 A;  3ICR A;  3RP6 A;  2Z5X A;  4ZN0 A;  1GES A;  3NKS A;  1EL9 A;  4LII A;  3GDP A;  4B69 A;  3HZL A;  2E5V A;  3K7Q X;  2X99 A;  3NNE A;  1O94 A;  3ATQ A;  4PAA A;  2YG7 A;  3NIX A;  3NK2 X;  3UTG A;  3C4N A;  5HYM A;  5KWF A;  3ISH A;  2C73 A;  2WDV A;  3BNM A;  3C96 A;  4U8M A;  1K0L A;  2YG4 A;  4K8D A;  2VRM A;  2YG3 A;  1H82 A;  4EQS A;  4J2W A;  2R0P A;  2YLX A;  3GRT A;  1B4V A;  2WU2 A;  2XVF A;  1LV0 A;  3EAN A;  3FMW A;  3I6D A;  5EB5 A;  2GRT A;  4H4W A;  2YM1 A;  3AB1 A;  1NHR A;  1TRB A;  1D7L A;  4APN A;  3SM8 A;  1CJ2 A;  3URH A;  2Q0L A;  4U8J A;  3Q6J A;  2BXR A;  1FEA A;  3AD9 B;  3CNS A;  3QSM A;  4X9M A;  4O5U A;  4GDP A;  1ZDL A;  3EPT A;  4IVO B;  4YTP A;  2FJB A;  4JNQ A;  4JNA A;  2RGH A;  1PJ7 A;  3D1C A;  2IVE A;  1PXB A;  1O5W A;  4TM0 A;  2GF3 A;  4ZCC A;  3GSI A;  4Z24 A;  1TYP A;  3LZX A;  4K5S A;  5FS9 A;  4WX1 A;  3R9U A;  4B65 A;  2BK5 A;  2PHH A;  2R45 A;  3AED A;  2R0C A;  3DA1 A;  3NRN A;  4H2N A;  1DNC A;  4BK1 A;  4EIP A;  4YKG A;  3NH3 X;  3OC4 A;  5BVA A;  1K0J A;  5KXJ A;  4USR A;  4K22 A;  1CJ4 A;  1D4C A;  3ALM A;  3VQR A;  4RSL A;  3IHG A;  4B63 A;  1CJC A;  1PHH A;  2O9Z A;  2GB0 A;  2FBW A;  3H8L A;  4OPU A;  2AAQ A;  3AYL A;  2JAE A;  1YQZ A;  3ALJ A;  3BHK A;  3F8R A;  1IJH A;  2WOI A;  3PS9 A;  4JN9 A;  4B67 A;  4CBQ A;  2GQF A;  5C2T A;  2ARD A;  1GV4 A;  1LQT A;  4HB9 A;  1TDO A;  1CHU A;  1DOC A;  3NN6 X;  1GRG A;  2OA1 A;  3SFE A;  2WBA A;  4KPR A;  2Q7V A;  1PJ6 A;  2A89 A;  3GRS A;  3M13 A;  4P9S A;  4K2X A;  1CL0 A;  1Y56 A;  4XXG A;  1M64 A;  5J60 A;  3V3N A;  4AT0 A;  3COX A;  1Y56 B;  2WHD A;  4EMI A;  2GMJ A;  1JRZ A;  2CUL A;  1RYI A;  1ZKQ A;  4BV6 A;  1M6I A;  2BCG G;  3DH9 A;  5IQ4 A;  3IWA A;  1E1N A;  1N4V A;  1PS9 A;  1E1M A;  4H2Q A;  1GRB A;  4KX6 A;  4TLZ A;  2GAH B;  3RP7 A;  1F6M A;  1E6E A;  4NZH A;  1L9E A;  3NTD A;  3AE1 A;  1L9C A;  3UCL A;  2XVJ A;  1GND A;  3VR8 A;  3EAO A;  1YKJ A;  2E4G A;  3SQP A;  5KOX A;  4J34 A;  3RHA A;  1PBF A;  1MOK A;  5U1O A;  4E0V A;  1ZK7 A;  3AD7 B;  3PO7 A;  1DOD A;  5J7X A;  4TM1 A;  1L0V A;  3AE6 A;  3NYC A;  5GSN A;  1BGN A;  1MO9 A;  1KF6 A;  4OPT A;  1B5Q A;  1P2H A;  2ZZC A;  5DBJ A;  4CCQ A;  1CBO A;  1W4X A;  2X50 A;  1JU2 A;  4GF7 A;  3QFA A;  1D5T A;  3BI2 A;  1NHS A;  1TYT A;  2BC1 A;  4Z2R A;  3ADA B;  2QA1 A;  4LA1 A;  4NEW A;  2Q6U A;  4IV9 A;  3DGH A;  4H4X A;  2V6O A;  3LB8 A;  2YG5 A;  2JB2 A;  4X4J A;  1CC4 A;  2WPE A;  4CNJ A;  1N4W A;  2OLO A;  2XLT A;  2XVE A;  3AYJ A;  3DJG X;  1H83 A;  2BC0 A;  2ZBW A;  4NTD A;  1ZX9 A;  4DNA A;  2BAC A;  2IID A;  2V3A A;  4CRT A;  4H4P A;  1H81 A;  2B9W A;  1GEU A;  3CTY A;  2EQ8 A;  4A6N B;  2V5Z A;  1DXL A;  1IUT A;  4U8N A;  2BAB A;  1N4U A;  4CY8 A;  3F8D A;  3AE8 A;  2C3C A;  2YVF A;  3BHF A;  2X3N A;  5JCL A;  4C5O A;  1JRX A;  1E1L A;  3CNT A;  2B7S A;  4B66 A;  2XDO A;  1NDA A;  1OJC A;  3GMC A;  1OJA A;  4U8K A;  4YSX A;  1Y0P A;  1S2Q A;  3OZ2 A;  3P4P A;  4YSH A;  2YLW A;  1LVL A;  3AE9 A;  4A65 A;  3KD9 A;  1OJ9 A;  3NYF A;  3AWI A;  1UKV G;  1Z6L A;  2YLR A;  4WCT A;  3UP5 A;  5C3J A;  4J36 A;  5ER0 A;  3UTF A;  4O5Q A;  5KVI A;  1CJ3 A;  1RP0 A;  1Q1R A;  3UOY A;  2C76 A;  1GTE A;  3K7T A;  5JCM A;  5JCI A;  1JNZ A;  4J31 A;  2CFY A;  1OJD A;  3KPF A;  4H2R A;  3ZDN A;  1H7W A;  2E1M A;  1XPQ A;  1B8S A;  2YLZ A;  5HY5 A;  1K4Q A;  4ICY A;  3G5R A;  1F8W A;  2B7R A;  2YM2 A;  3NGC X;  3VRD B;  2XVH A;  4J56 A;  2EQ9 A;  3NG7 X;  4EQW A;  2X8C A;  4NTE A;  1NEN A;  1EL5 A;  4BK3 A;  3NHO X;  3SGL A;  1E7P A;  1JOA A;  4A79 A;  1REO A;  4D03 A;  4TLX A;  4A9W A;  4EMW A;  1BWC A;  4BK2 A;  5EB4 A;  3V3O A;  4JY3 A;  3IF9 A;  2QA2 A;  4A5L A;  4C77 A;  4AP1 A;  5BRT A;  2YLS A;  1PBC A;  1PN0 A;  2WU5 A;  4H4S A;  3NLC A;  1DJN A;  1F8S A;  2C72 A;  3DJD A;  1GRT A;  5EOW A;  1BF3 A;  2Q0K A;  2XFQ A;  3C4A A;  3RP8 A;  3DJJ A;  4USQ A;  1X31 B;  3ICS A;  1Q1W A;  3DK9 A;  2R46 A;  3M12 A;  1SEZ A;  4MJW A;  3V76 A;  1V59 A;  1KNR A;  1JEH A;  5JCN A;  3CNP A;  3GYI A;  2YAU A;  2WET A;  1LQU A;  2XFU A;  1NG3 A;  3UKH A;  2WOW A;  4JDR A;  4YKF A;  4NEV A;  3RED A;  1BZL A;  3AEB A;  2GR1 A;  1H7X A;  2X8H A;  1H6V A;  5U25 A;  4Y4M A;  3II4 A;  3KKJ A;  4UDR A;  1TDF A;  3QJ4 A;  4DSG A;  4EIQ A;  3AE7 A;  1GRF A;  1LJ1 A;  4K5R A;  1IUS A;  4OPI A;  2FJA A;  1JRY A;  3E1T A;  3O0H A;  4U2L A;  3I3L A;  2GVC A;  2NPX A;  1GTH A;  3ABV A;  3CPJ G;  5M10 A;  4FX9 A;  3ATR A;  4U8I A;  3NN0 X;  4ADW A;  2QAE A;  2WDR A;  3DK4 A;  2CDU A;  1F3P A;  3CND A;  4H7U A;  3GYJ A;  2AQJ A;  3CPI G;  1ZMC A;  4TM4 A;  1NG4 A;  1VQW A;  1FCD A;  2JB1 A;  1Q9I A;  2R4E A;  2BK4 A;  4BJY A;  3FBS A;  4C3X A;  3AEG A;  3B3R A;  4A7A A;  1CC2 A;  1S3B A;  3ALL A;  3QSS A;  4H4R A;  1LPF A;  4RG3 A;  2A87 A;  1HYU A;  4FDC B;  4FK1 C;  1GRE A;  3M0O A;  5U63 A;  1IUX A;  3DME A;  3AEF A;  4H50 A; 
#chains in the Genus database with same CATH topology
 3Q9T A;  2JK6 A;  3B97 A;  3SY4 A;  4AOS A;  3VCC A;  2XSX A;  3SN0 A;  3UKP A;  3CGC A;  4YSZ A;  4H4Z A;  2AR8 A;  2GQW A;  1YQ3 A;  3IK4 A;  1GET A;  2XFP A;  1R6W A;  5EU9 A;  3SN1 A;  1ONF A;  4J57 A;  2WP6 A;  3JSK A;  3FV9 A;  1MNS A;  4CCR A;  2OAL A;  2BXS A;  2R9Z A;  3UOZ A;  2C7G A;  1XAN A;  4IA6 A;  5KOW A;  2WEU A;  3SZC A;  2BS2 A;  2GH5 A;  3P9U A;  4B1B A;  4EQX A;  2RGJ A;  1OEP A;  2QCU A;  4GAV A;  3OP2 A;  3GDN A;  4Z2T A;  3D9X A;  3GD3 A;  3MSY A;  2APG A;  5KVH A;  2EQ6 A;  1JNR A;  4YT0 A;  3FYY A;  2NVK X;  2BYB A;  3VRB A;  4U2T A;  2W54 A;  3BI4 A;  3CIR A;  3GWD A;  5KRQ A;  1O95 A;  4DXK A;  3DES A;  4GRT A;  4EWJ A;  5BUK A;  2WPF A;  1OJT A;  3HYX A;  3LJP A;  4G9K A;  1PDH A;  2PYX A;  1EC8 A;  3CN8 A;  1GT8 A;  3P4S A;  4G7F A;  4TM3 A;  3SZ0 A;  3IJI A;  3IJQ A;  4HYR A;  1S2Y A;  1KKO A;  1KSS A;  2QDE A;  5FS8 A;  2XGZ A;  4HCH A;  2XFO A;  4DX3 A;  3DFY A;  1D4D A;  3AEA A;  2YVG A;  1KDG A;  4E4U A;  2XYO A;  3PFR A;  1RSG A;  4HN8 A;  3RO6 A;  3SSZ A;  3A7U A;  3KU9 A;  4DHG A;  4U2S A;  2BCP A;  4GFI A;  3IJL A;  3TTE A;  3VA8 A;  5GRT A;  3SXI A;  4A99 A;  4EQR A;  3EKG A;  1PBE A;  1E39 A;  3QKE A;  3S5W A;  5IPY A;  4Y4L A;  4DWD A;  3L8K A;  3T4W A;  3BJS A;  3D8X A;  1QO8 A;  2IVD A;  1JRO A;  1N1P A;  4JQ9 A;  3H70 A;  1LTX R;  2XCG A;  1TZZ A;  4PAB A;  4H4U A;  3OW1 A;  2R4J A;  3QPE A;  1MDR A;  4B68 A;  2RAB A;  2QDD A;  2PTZ A;  2BA9 A;  2FJD A;  5HHF A;  5HXI A;  2AL2 B;  2Z5X A;  4ZN0 A;  1GES A;  1EL9 A;  4LII A;  4B69 A;  3DIP A;  2X99 A;  1O94 A;  3ATQ A;  3NK2 X;  3ISH A;  3BNM A;  2YG3 A;  4H19 A;  1H82 A;  4J2W A;  3CK5 A;  2R0P A;  1JPM A;  3GRT A;  3UCD A;  3PWI A;  2YM1 A;  1NHR A;  1TRB A;  3ES7 A;  4APN A;  1CJ2 A;  4U8J A;  3Q6J A;  2BXR A;  4J3Z A;  4GDP A;  4IVO B;  4JNA A;  3T14 A;  2IVE A;  4Z24 A;  3GSI A;  3T2Y A;  4WX1 A;  3AED A;  5BVA A;  4YKG A;  1K0J A;  4A3R A;  3IHG A;  3H8L A;  2O9Z A;  4OPU A;  2GB0 A;  3F8R A;  3ZVH A;  1IJH A;  2FKP A;  4CBQ A;  2GQF A;  3THU A;  1LQT A;  3QTP A;  4HB9 A;  1DOC A;  3NN6 X;  2OA1 A;  3BOX A;  3SZF A;  4KPR A;  1S7M A;  3R10 A;  5J60 A;  3V3N A;  3COX A;  4EMI A;  1JRZ A;  4BV6 A;  1F9C A;  4MGG A;  5KMR A;  3RP7 A;  1E6E A;  2OZ3 A;  1L9E A;  1IYX A;  1L9C A;  5KOX A;  3EAO A;  1YKJ A;  2OZ8 A;  1PBF A;  5U1O A;  3UJF A;  1P2H A;  1CBO A;  4GF7 A;  2X50 A;  4KT2 A;  1SJD A;  1D5T A;  1NHS A;  3P3B A;  4CNJ A;  1N4W A;  3T31 A;  3MKC A;  3DJG X;  2IID A;  4CRT A;  3CTY A;  1DXL A;  2BAB A;  4CY8 A;  4FP1 A;  2YVF A;  4C5O A;  1VQZ A;  2B7S A;  2XH7 A;  2W3R A;  3ZLG A;  4YSX A;  3GMC A;  3HRD C;  1OJA A;  3OZ2 A;  3VCN A;  1OJ9 A;  1H2I A;  4M6U A;  1UKV G;  4WCT A;  3UP5 A;  3Q4D A;  5KVI A;  3UOY A;  1GTE A;  1JNZ A;  2E1M A;  1STZ A;  1MDL A;  1K4Q A;  3HW2 A;  4ZOH B;  1BQG A;  1NEN A;  4BK3 A;  3S5S A;  3NHO X;  3VDG A;  3SGL A;  1E7P A;  3UXL A;  4EMW A;  3MZN A;  4A5L A;  5BRT A;  2YLS A;  3JW7 A;  4H4S A;  3FJ4 A;  1DJN A;  1V97 A;  6ENL A;  5EOW A;  1BF3 A;  2Q0K A;  2XFQ A;  3GYI A;  5JCN A;  3CNP A;  2HXU A;  5FJP A;  3RRA A;  1LQU A;  2WOW A;  4K8G A;  1ONE A;  4YKF A;  1BZL A;  3AEB A;  1H7X A;  1H6V A;  5U25 A;  4EIQ A;  1GRF A;  2QJM A;  1LJ1 A;  5FJO A;  1JRY A;  2GVC A;  2NPX A;  3ABV A;  4FX9 A;  1FHV A;  3JZU A;  4ADW A;  3DK4 A;  1F3P A;  2AQJ A;  2BK4 A;  3GYX A;  4MKS A;  4C3X A;  3B3R A;  1S3B A;  4RG3 A;  4FK1 C;  3OZM A;  5U63 A;  2P8B A;  3PWG A;  3KLJ A;  2FYM A;  3DGZ A;  2ZC8 A;  5CQF A;  1VDC A;  1ZOY A;  4EM3 A;  2C3D A;  2J3N A;  5IQ1 A;  2Y6Q A;  1WYG A;  2TMD A;  3P4R A;  4EMJ A;  4XWR A;  1XDI A;  4N9X A;  2YVJ A;  2VVL G;  2NQL A;  4OPG A;  3IHM A;  1D4E A;  1VG0 A;  3SFD A;  2BK3 A;  1PXC A;  3ITJ A;  4GDE A;  4G8T A;  4D04 A;  2I5Q A;  1EBH A;  5FS7 A;  3RR1 A;  1R0M A;  2YG6 A;  4NNJ A;  1FIQ B;  2OVL A;  1QLB A;  2PTY A;  3MY9 A;  2PP3 A;  3UKQ A;  4LU6 A;  4K1W A;  3AD8 B;  3EF6 A;  3AE4 A;  3UJS A;  2XLU A;  3B6D A;  3AE5 A;  1TKK A;  4GYP C;  4U8L A;  5BUL A;  1NAA A;  2GGJ A;  2X8G A;  2EQ7 A;  1K0I A;  4AT2 A;  3HYW A;  1EC9 A;  2C70 A;  3AEE A;  4E4F A;  2JBV A;  4HCD A;  2B76 A;  2XH4 A;  2H89 A;  4GYP A;  4Z26 A;  4YXD A;  3AEC A;  1GAL A;  1VG9 A;  2GR2 A;  2GGG A;  4JN8 A;  3KVE A;  2GR0 A;  3GY1 A;  2B9X A;  2YR6 A;  4A35 A;  2W0H A;  1T3Q C;  1H86 A;  4OPD A;  2YLT A;  2MNR A;  4K7Z A;  4Y4N A;  3UJR A;  1XPY A;  1BKW A;  2XH2 A;  4X9N A;  3VRA A;  4YTN A;  2OQY A;  3NXL A;  3ES8 A;  2ACZ A;  3H8I A;  5FS6 A;  2WP5 A;  2VVM A;  3TWB A;  4DYE A;  4G6G A;  1COY A;  3S47 A;  2JKC A;  4DSH A;  4M0X A;  3CGD A;  1VRQ B;  2WP9 A;  3H4K A;  1ELI A;  2PA6 A;  2C65 A;  3AE2 A;  3CPH G;  3FPZ A;  2DW7 A;  3P4Q A;  1AOG A;  3TWA A;  4UDQ A;  1YQ4 A;  1PDZ A;  4MMW A;  1EL7 A;  4IA5 A;  4M52 A;  3KA7 A;  2DKH A;  4IT1 A;  1D7Y A;  1ZP0 A;  1DTN A;  3NFU A;  1SB3 B;  1GXF A;  3K30 A;  3FCP A;  1FFU C;  4H2P A;  3NYE A;  2VQ7 A;  3NRZ B;  1YY5 A;  3ICR A;  3NKS A;  3GDP A;  3HZL A;  2E5V A;  3NNE A;  3NIX A;  3C96 A;  2YG4 A;  4K8D A;  4EQS A;  4GGH A;  2XVF A;  3FMW A;  4JN7 A;  3AB1 A;  3SM8 A;  2Q0L A;  3QSM A;  3R11 A;  4X9M A;  4O5U A;  3EPT A;  4YTP A;  1BKH A;  2RGH A;  2OPJ A;  1O5W A;  4TM0 A;  5KMS A;  3SZW A;  3DG3 A;  3TJ4 A;  2R0C A;  3AN1 A;  1DNC A;  4BK1 A;  5KXJ A;  3NH3 X;  4K22 A;  3RGT A;  1D4C A;  4RSL A;  1CJC A;  4KPL A;  2JAE A;  3ALJ A;  4JHM A;  2ARD A;  3Q45 A;  2Q7V A;  4P9S A;  2GSH A;  1Y56 A;  4XXG A;  3EEZ A;  2GMJ A;  1ZKQ A;  3DH9 A;  3IWA A;  1MUC A;  1PS9 A;  4H2Q A;  1GRB A;  3UCL A;  1MOK A;  4HPN A;  3PO7 A;  4TM1 A;  1MO9 A;  4CCQ A;  1B5Q A;  2ZZC A;  1JU2 A;  3H7V A;  3BI2 A;  1TYT A;  5ENL A;  2PP1 A;  2Q6U A;  5BOE A;  2YG5 A;  4X4J A;  4E8G A;  2WPE A;  3H12 A;  2XVE A;  4TVY A;  1H83 A;  2BC0 A;  4NTD A;  4DNA A;  2V3A A;  3TOY A;  4H4P A;  1H81 A;  1GEU A;  4A6N B;  1IUT A;  4U8N A;  1N4U A;  3DER A;  2C3C A;  2XDO A;  1NDA A;  3BSM A;  1P43 A;  1S2Q A;  3P4P A;  2POZ A;  4YSH A;  3KD9 A;  3NYF A;  3AWI A;  1Z6L A;  2YLR A;  3ZLH A;  1N5X A;  1RP0 A;  4GIR A;  3K7T A;  4J31 A;  1OJD A;  2ZAD A;  3KPF A;  1P48 A;  4ICY A;  7ENL A;  3TQP A;  2B7R A;  2YM2 A;  2BRY A;  3VRD B;  2XVH A;  5KMQ A;  3NG7 X;  2P8C A;  1EL5 A;  1JOA A;  2QJJ A;  1REO A;  4D03 A;  1FO4 A;  4JY3 A;  1ELS A;  3IF9 A;  4C77 A;  4AP1 A;  3NLC A;  2C72 A;  3DJD A;  1GRT A;  3SR6 B;  3C4A A;  3DJJ A;  2PSN A;  3ICS A;  3DK9 A;  4MJW A;  1V59 A;  1X2H A;  2YAU A;  3STP A;  3UKH A;  3RED A;  2PGE A;  3N6J A;  3SQS A;  4Y4M A;  3II4 A;  4UDR A;  3TW9 A;  3QJ4 A;  1IUS A;  3UJ2 A;  3QLD A;  3E1T A;  3U9I A;  3NS1 B;  2CDU A;  3GYJ A;  3CPI G;  3DGB A;  3FBS A;  2W3S A;  3QSS A;  4H4R A;  3VFC A;  2AL1 A;  5FJU A;  2P88 A;  3A7A A;  1KD0 A;  3DME A;  2GAG B;  3MWC A;  3FG2 P;  2C67 A;  4IZG A;  4C74 A;  4GUV A;  3OPS A;  1EBG A;  2WES A;  2XVI A;  2PTX A;  1IUU A;  3CMM A;  3VC6 A;  2B9Y A;  3GD6 A;  2Z5Y A;  4E5T A;  1WUE A;  1TDN A;  4NTC A;  1ZY8 A;  1ZMD A;  3NK1 X;  4YTM A;  3R1Z A;  2WOV A;  2OX4 A;  2RDX A;  1KN0 A;  1DOB A;  2V61 A;  2A8X A;  3UKK A;  1KKR A;  2PU0 A;  2WPC A;  1SJA A;  3GD4 A;  3OZY A;  4OPL A;  3FVD A;  3K1G A;  4HA6 A;  1ZOV A;  2BS4 A;  3DK8 A;  1FEC A;  2CVJ A;  3UCC A;  3QFB A;  3T2Z A;  1PBB A;  3GWF A;  1GSN A;  2GEW A;  3GC2 A;  3WE0 A;  2P0I A;  4YWO A;  2YR5 A;  3UP4 A;  2ZZB A;  1KCZ A;  2CHR A;  3L1R A;  2DKI A;  1MXT A;  5JRB A;  4REK A;  1CC6 A;  3LXD A;  4K2S A;  2H88 A;  3BI5 A;  3TCS A;  1PDY A;  5JCK A;  4Z1Y A;  4I58 A;  5EBK A;  2ONE A;  1FOH A;  4B64 A;  1N63 C;  4C3Y A;  3T2K A;  1TDK A;  2VQB A;  1IUW A;  3DEQ A;  4CNK A;  1NEK A;  3N6H A;  5CKU A;  5TR3 A;  2ZZ0 A;  4H4V A;  5FMH A;  2BS3 A;  2HQM A;  2E5A A;  1B37 A;  2YQU A;  1N5W C;  4YSY A;  4FK1 A;  3L5O A;  1NPX A;  3QVP A;  4H4Y A;  2VZ2 A;  3G5Q A;  3MQT A;  2WQY A;  1ECQ A;  1GRA A;  1NHP A;  3R07 C;  1N61 C;  2Y6R A;  2F5Z A;  5IDZ A;  2OLN A;  4OCG A;  4BJZ A;  4J33 A;  3CGB A;  3ICT A;  3BNU A;  1E9I A;  2VRL A;  1TDE A;  2AKZ A;  4UDP A;  1QJD A;  2C64 A;  3NVV B;  3P0W A;  1FL2 A;  3H8A A;  4IVM B;  3T0K A;  3CAW A;  3V3W A;  3F8P A;  3VR9 A;  4UP3 A;  5M0Z A;  5LV9 A;  3T6C A;  4BUR A;  2GMH A;  1DOE A;  4ECH A;  1P2E A;  3DG7 A;  4EM4 A;  4F4R A;  3RNM A;  1EL8 A;  3RP6 A;  2AL2 A;  5HYM A;  4PAA A;  2YG7 A;  4ENL A;  3NVY B;  2C73 A;  4U8M A;  2WU2 A;  1B4V A;  3I6D A;  5EB5 A;  4H83 A;  1D7L A;  4E6M A;  3URH A;  1FEA A;  4A6G A;  3I4K A;  3SX6 A;  2FJB A;  4JNQ A;  3D46 A;  3CT2 A;  1PXB A;  4ZCC A;  1TYP A;  4K5S A;  5FS9 A;  2BK5 A;  2R45 A;  4EIP A;  2GL5 A;  4USR A;  1CJ4 A;  3I6E A;  3ALM A;  3VQR A;  2OO6 A;  4B63 A;  4B65 A;  1PHH A;  2AAQ A;  3AYL A;  3BHK A;  2WOI A;  3ENL A;  3DG6 A;  3CYJ A;  4B67 A;  5C2T A;  2O56 A;  1TDO A;  3T9P A;  1CHU A;  1GRG A;  3SFE A;  1PJ6 A;  2A89 A;  1CL0 A;  1M64 A;  4AT0 A;  2PP0 A;  2CUL A;  1RYI A;  1M6I A;  2QGY A;  2BCG G;  3SJN A;  1E1N A;  1E1M A;  4KX6 A;  4NZH A;  2XVJ A;  3SQP A;  4J34 A;  4E0V A;  3AD7 B;  3AE6 A;  1BGN A;  2OQH A;  1KF6 A;  5DBJ A;  3QFA A;  3ADA B;  2QA1 A;  4LA1 A;  3DGH A;  4H4X A;  1FHU A;  2OLO A;  2XLT A;  1ZX9 A;  1SJC A;  2EQ8 A;  2OFJ A;  2PGW A;  2QJN A;  3AE8 A;  3BHF A;  1JRX A;  3CNT A;  1Y0P A;  4A65 A;  4O5Q A;  2C76 A;  5JCM A;  5JCI A;  4ZA0 A;  2PPG A;  2CFY A;  3ZDN A;  3UXK A;  3PG6 A;  4H1Z A;  3NVZ B;  5HY5 A;  1F8W A;  3NGC X;  2POD A;  4J56 A;  2DW6 A;  2EQ9 A;  4EQW A;  4NTE A;  3CB3 A;  3OTR A;  5G5G B;  4A9W A;  1SJB A;  1BWC A;  5EB4 A;  3DDM A;  5KNL A;  4ZCW A;  4Z17 A;  1PN0 A;  3RIT A;  3B9J B;  1Q1W A;  3V76 A;  1SEZ A;  1JEH A;  2C4C A;  2P3Z A;  4NEV A;  1X2G A;  2MUC A;  1TDF A;  5BOF A;  1ZXI C;  4K5R A;  4OPI A;  2QQ6 A;  2FJA A;  3O0H A;  4U2L A;  3RCY A;  1GTH A;  3CPJ G;  2OKT A;  4U8I A;  3HYV A;  3MUC A;  4HCL A;  4IHC A;  3NN0 X;  2QAE A;  3V4B A;  3CND A;  4H7U A;  1ZMC A;  2AKM A;  1VQW A;  2PMQ A;  1Q9I A;  2R4E A;  3AEG A;  4A7A A;  4TVW A;  2A87 A;  1HYU A;  3M0O A;  3AEF A;  4AP3 A;  4GME A;  3IC9 A;  1W6T A;  4JY2 A;  4KWS A;  3SN4 A;  3UTH A;  4I59 A;  3G5S A;  1MRA A;  1FEB A;  1PXA A;  3DJE A;  1DJQ A;  3I6T A;  1IUV A;  3LZW A;  2OG9 A;  1JCT A;  1BGJ A;  4U8P A;  1PBD A;  4H2H A;  4H4Q A;  1L9D A;  2E3T A;  4OPC A;  3UKF A;  1GOS A;  4J1O A;  3GO2 A;  3K7M X;  1KNP A;  4Z44 A;  1GPE A;  4GIS A;  1JDF A;  3V5F A;  4Z43 A;  2GGE A;  4Z2U A;  4Z25 A;  3QSE A;  3FXG A;  5J04 A;  2UZZ A;  2XLR A;  2XLS A;  4GR1 A;  2BRA A;  1N62 C;  2I0Z A;  3R25 A;  1F8R A;  3UKL A;  1S3E A;  1PJ5 A;  1XHC A;  1VDV A;  3AE3 A;  3LOV A;  4CY6 A;  3LAD A;  1KFY A;  3S61 A;  2OAM A;  2V60 A;  3NTA A;  4DGK A;  3UKA A;  2GV8 A;  1EBD A;  3AMZ A;  3AYI A;  4U8O A;  1TE6 A;  3NT6 A;  2TPR A;  1RM6 B;  2R0G A;  4RG4 A;  3P1W A;  1H84 A;  5KMP A;  3ZYX A;  2RGO A;  2VVL A;  5L46 A;  3PVC A;  1FFV C;  4DN1 A;  2PU1 A;  3AXB A;  1NEL A;  2XLP A;  2HXT A;  2GDQ A;  2JB3 A;  3GMB A;  3T8Q A;  3NO1 A;  4IP5 A;  4FI4 A;  1L8P A;  3UOX A;  4AOX A;  2WS3 A;  4II2 A;  2VOU A;  2YR4 A;  2XFN A;  2WDQ A;  1GRH A;  3FIM B;  2PCE A;  1JRP A;  3UTE A;  1CF3 A;  3NK0 X;  3UOV A;  3R0U A;  2GR3 A;  3NVW B;  2YWL A;  1GER A;  4X2P A;  1NHQ A;  1XS2 A;  4H4T A;  3CNJ A;  4GCM A;  4GGB A;  3CXB A;  4OVI A;  4HNC A;  3AM9 A;  2OLA A;  3QVR A;  1E1K A;  2C66 A;  3T37 A;  1WUF A;  3CGE A;  2C75 A;  3SYI A;  4IL2 A;  4XWZ A;  1KSU A;  2V3B A;  4ZCD A;  2FJE A;  4G6H A;  4A6N A;  2QVH A;  1JPD X;  3N4E A;  3K7Q X;  3UTG A;  5KWF A;  3C4N A;  4G74 A;  2WDV A;  1K0L A;  3V5C A;  2VRM A;  2YLX A;  3EAN A;  1LV0 A;  2GRT A;  4H4W A;  3SBF A;  3JVA A;  3TJI A;  3AD9 B;  3CNS A;  2XH0 A;  1ZDL A;  3DFH A;  3ZVH B;  1PJ7 A;  3D1C A;  2GF3 A;  3LZX A;  3R9U A;  2PHH A;  3NRN A;  4H2N A;  3DA1 A;  3OC4 A;  4GAP A;  2FBW A;  1YQZ A;  1NU5 A;  4JN9 A;  3PS9 A;  1GV4 A;  4ROP A;  3NZG A;  2WBA A;  3PK7 A;  3GRS A;  3M13 A;  1EC7 A;  4K2X A;  4KEM A;  3P93 A;  1Y56 B;  2WHD A;  2W55 A;  3EUB 3;  2GGI A;  5IQ4 A;  1N4V A;  4TLZ A;  2GAH B;  1F6M A;  3N4F A;  5G5H B;  2HZG A;  3NTD A;  3AE1 A;  3VR8 A;  1GND A;  2E4G A;  3RHA A;  2HNE A;  4IP4 A;  1ZK7 A;  1DOD A;  5J7X A;  1L0V A;  3NYC A;  5GSN A;  3A7R A;  4OPT A;  1W4X A;  2BC1 A;  4YWS A;  4Z2R A;  4NEW A;  1N60 C;  4IV9 A;  2V6O A;  3LB8 A;  2JB2 A;  1CC4 A;  3D47 A;  3AYJ A;  2ZBW A;  2BAC A;  2B9W A;  2V5Z A;  3F8D A;  2X3N A;  5JCL A;  1E1L A;  4B66 A;  1OJC A;  4U8K A;  2YLW A;  1LVL A;  3AE9 A;  3UGV A;  4G73 A;  5C3J A;  4J36 A;  5ER0 A;  3ETR B;  3UTF A;  1CJ3 A;  1Q1R A;  4H2R A;  1H7W A;  1XPQ A;  3UJE A;  1B8S A;  2YLZ A;  3G5R A;  2X8C A;  3VC5 A;  4A79 A;  5FJR A;  3ZLF A;  4TLX A;  4BK2 A;  3V3O A;  2QA2 A;  4IL0 A;  1PBC A;  4NWZ A;  2WU5 A;  1F8S A;  3KPK A;  3RP8 A;  4USQ A;  1X31 B;  3R0K A;  2R46 A;  3M12 A;  1KNR A;  2WET A;  2XFU A;  3U4F A;  1NG3 A;  4II3 A;  4JDR A;  3ZVI A;  2PS2 A;  1RVK A;  2GR1 A;  3KUM A;  2X8H A;  3KKJ A;  3QN3 A;  4DSG A;  3AE7 A;  1YEY A;  3I3L A;  5M10 A;  3ATR A;  3CXO A;  2WDR A;  5FJT A;  4TM4 A;  1NG4 A;  1FCD A;  2JB1 A;  3HPF A;  2PTW A;  4BJY A;  1CC2 A;  3ALL A;  1LPF A;  2GGH A;  4FDC B;  1GRE A;  4HNL A;  1IUX A;  2OZT A;  4H50 A; 
#chains in the Genus database with same CATH homology
 4AP3 A;  3Q9T A;  2GAG B;  3KLJ A;  3IC9 A;  3FG2 P;  3DGZ A;  5CQF A;  2JK6 A;  4JY2 A;  2C67 A;  4C74 A;  4GUV A;  1VDC A;  1ZOY A;  3SY4 A;  4AOS A;  4EM3 A;  2C3D A;  2J3N A;  4I59 A;  5IQ1 A;  3UTH A;  3G5S A;  2Y6Q A;  1FEB A;  1PXA A;  2TMD A;  3DJE A;  3P4R A;  4EMJ A;  3UKP A;  3CGC A;  2WES A;  1DJQ A;  4XWR A;  1XDI A;  4YSZ A;  4H4Z A;  2XVI A;  1IUV A;  2AR8 A;  2GQW A;  4N9X A;  1YQ3 A;  1GET A;  2XFP A;  2YVJ A;  1IUU A;  2VVL G;  3CMM A;  1ONF A;  3LZW A;  4J57 A;  4OPG A;  2B9Y A;  2WP6 A;  3IHM A;  1D4E A;  3JSK A;  4CCR A;  1BGJ A;  2Z5Y A;  1VG0 A;  3SFD A;  2BK3 A;  2BXS A;  2OAL A;  2R9Z A;  1PXC A;  3ITJ A;  1TDN A;  4NTC A;  4U8P A;  3UOZ A;  1PBD A;  1XAN A;  1ZY8 A;  4H4Q A;  2C7G A;  4IA6 A;  5KOW A;  2WEU A;  4GDE A;  3SZC A;  1L9D A;  2BS2 A;  4OPC A;  1ZMD A;  3NK1 X;  4YTM A;  4D04 A;  2GH5 A;  3P9U A;  2WOV A;  3UKF A;  4B1B A;  5FS7 A;  4EQX A;  2RGJ A;  1KN0 A;  2YG6 A;  1DOB A;  2V61 A;  4NNJ A;  2A8X A;  1GOS A;  1QLB A;  3UKK A;  2QCU A;  3K7M X;  4GAV A;  1KNP A;  4Z44 A;  1GPE A;  3GDN A;  3UKQ A;  4Z2T A;  4LU6 A;  3D9X A;  3GD3 A;  4Z43 A;  3AD8 B;  4Z2U A;  2WPC A;  3EF6 A;  3GD4 A;  3AE4 A;  2APG A;  4OPL A;  4Z25 A;  2XLU A;  5KVH A;  3B6D A;  2EQ6 A;  1JNR A;  4HA6 A;  3AE5 A;  4YT0 A;  1ZOV A;  3QSE A;  2NVK X;  4U8L A;  2BYB A;  2BS4 A;  4U2T A;  3VRB A;  5BUL A;  1NAA A;  2UZZ A;  3DK8 A;  3BI4 A;  1FEC A;  2XLR A;  2XLS A;  4GR1 A;  2CVJ A;  3CIR A;  2X8G A;  3QFB A;  2BRA A;  3T2Z A;  2EQ7 A;  1K0I A;  2I0Z A;  1PBB A;  3GWF A;  3GWD A;  4AT2 A;  5KRQ A;  1GSN A;  1F8R A;  1O95 A;  1S3E A;  2GEW A;  3HYW A;  4YWO A;  2C70 A;  3UKL A;  2YR5 A;  1PJ5 A;  3AEE A;  2JBV A;  4GRT A;  3WE0 A;  2B76 A;  1XHC A;  2H89 A;  3UP4 A;  2ZZB A;  3AE3 A;  4Z26 A;  3LOV A;  4YXD A;  3AEC A;  3L1R A;  5BUK A;  2WPF A;  1OJT A;  4CY6 A;  2DKI A;  3LAD A;  1GAL A;  1VG9 A;  2GR2 A;  1KFY A;  3HYX A;  2OAM A;  3S61 A;  3LJP A;  1MXT A;  1PDH A;  3KVE A;  2GR0 A;  4G9K A;  2V60 A;  5JRB A;  2PYX A;  2B9X A;  4REK A;  1CC6 A;  3NTA A;  3LXD A;  3CN8 A;  2YR6 A;  4DGK A;  2W0H A;  1GT8 A;  1H86 A;  2H88 A;  3P4S A;  3UKA A;  2GV8 A;  4OPD A;  4TM3 A;  1EBD A;  2YLT A;  3BI5 A;  4U8O A;  3AYI A;  3SZ0 A;  3NT6 A;  2TPR A;  4K7Z A;  4Y4N A;  5JCK A;  4I58 A;  5EBK A;  1FOH A;  1S2Y A;  4B64 A;  2R0G A;  1BKW A;  4RG4 A;  4C3Y A;  1KSS A;  3T2K A;  3P1W A;  1H84 A;  1TDK A;  5FS8 A;  2VQB A;  5KMP A;  2XFO A;  4X9N A;  3ZYX A;  2RGO A;  2VVL A;  5L46 A;  1D4D A;  3VRA A;  4YTN A;  3PVC A;  1IUW A;  3AEA A;  2YVG A;  1KDG A;  3AXB A;  4CNK A;  2XYO A;  2XLP A;  1NEK A;  5CKU A;  2JB3 A;  5TR3 A;  2ZZ0 A;  1RSG A;  3GMB A;  2ACZ A;  3KU9 A;  4H4V A;  5FMH A;  4U2S A;  3H8I A;  2BCP A;  5FS6 A;  2BS3 A;  2HQM A;  4AOX A;  1B37 A;  3UOX A;  2WS3 A;  4II2 A;  2YQU A;  2VOU A;  2YR4 A;  2WP5 A;  5GRT A;  4YSY A;  3SXI A;  4FK1 A;  3L5O A;  2VVM A;  2XFN A;  4A99 A;  4EQR A;  1NPX A;  1COY A;  2WDQ A;  1GRH A;  4G6G A;  2JKC A;  3QVP A;  4H4Y A;  1PBE A;  2VZ2 A;  3G5Q A;  1E39 A;  3FIM B;  2WQY A;  1GRA A;  4DSH A;  1NHP A;  3S5W A;  3CGD A;  5IPY A;  4Y4L A;  1VRQ B;  3UTE A;  1CF3 A;  3NK0 X;  2WP9 A;  3L8K A;  3UOV A;  3H4K A;  2Y6R A;  2F5Z A;  2OLN A;  2GR3 A;  4OCG A;  4BJZ A;  4J33 A;  3CGB A;  3D8X A;  1ELI A;  1QO8 A;  3ICT A;  2YWL A;  2C65 A;  1GER A;  3AE2 A;  3BNU A;  2VRL A;  3CPH G;  1TDE A;  3FPZ A;  1NHQ A;  3CNJ A;  4H4T A;  2IVD A;  3P4Q A;  4UDP A;  4GCM A;  1QJD A;  1AOG A;  4UDQ A;  1N1P A;  1YQ4 A;  2C64 A;  4OVI A;  4JQ9 A;  1FL2 A;  1EL7 A;  4IA5 A;  4M52 A;  1LTX R;  3KA7 A;  2DKH A;  2XCG A;  3QVR A;  4IVM B;  4PAB A;  3T0K A;  4H4U A;  1E1K A;  2C66 A;  1D7Y A;  4B63 A;  3F8P A;  1ZP0 A;  2R4J A;  3T37 A;  3VR9 A;  2C75 A;  3CGE A;  4UP3 A;  5M0Z A;  5LV9 A;  3SYI A;  4XWZ A;  1GXF A;  4BUR A;  1KSU A;  2GMH A;  1DOE A;  3K30 A;  1P2E A;  2RAB A;  4H2P A;  3NYE A;  4B68 A;  4ECH A;  2V3B A;  2BA9 A;  2FJD A;  4ZCD A;  4EM4 A;  5HHF A;  2FJE A;  2VQ7 A;  5HXI A;  1YY5 A;  4G6H A;  4A6N A;  3RNM A;  1EL8 A;  3ICR A;  3RP6 A;  2Z5X A;  4ZN0 A;  1GES A;  3NKS A;  1EL9 A;  4LII A;  3GDP A;  4B69 A;  3HZL A;  2E5V A;  3K7Q X;  2X99 A;  3NNE A;  1O94 A;  3ATQ A;  4PAA A;  2YG7 A;  3NIX A;  3NK2 X;  3UTG A;  3C4N A;  5HYM A;  5KWF A;  3ISH A;  2C73 A;  2WDV A;  3BNM A;  3C96 A;  4G74 A;  1K0L A;  4U8M A;  2YG4 A;  4K8D A;  2VRM A;  2YG3 A;  1H82 A;  4EQS A;  4J2W A;  2R0P A;  2YLX A;  3GRT A;  1B4V A;  2WU2 A;  2XVF A;  1LV0 A;  3EAN A;  3FMW A;  3I6D A;  5EB5 A;  2GRT A;  4H4W A;  2YM1 A;  3AB1 A;  1NHR A;  1TRB A;  1D7L A;  4APN A;  3SM8 A;  1CJ2 A;  3URH A;  2Q0L A;  4U8J A;  3Q6J A;  2BXR A;  1FEA A;  3AD9 B;  3CNS A;  3QSM A;  4X9M A;  4O5U A;  4GDP A;  1ZDL A;  3EPT A;  4IVO B;  4YTP A;  3SX6 A;  2FJB A;  4JNQ A;  4JNA A;  2RGH A;  1PJ7 A;  3D1C A;  3T14 A;  2IVE A;  1O5W A;  1PXB A;  4TM0 A;  2GF3 A;  4ZCC A;  3GSI A;  4Z24 A;  1TYP A;  3LZX A;  3T2Y A;  5KMS A;  4K5S A;  3SZW A;  5FS9 A;  4WX1 A;  3R9U A;  4B65 A;  2BK5 A;  2PHH A;  2R45 A;  3AED A;  2R0C A;  3DA1 A;  3NRN A;  4H2N A;  1DNC A;  4BK1 A;  4EIP A;  4YKG A;  3NH3 X;  3OC4 A;  5BVA A;  1K0J A;  5KXJ A;  4USR A;  4K22 A;  1CJ4 A;  1D4C A;  3ALM A;  3VQR A;  4RSL A;  3IHG A;  4GAP A;  1CJC A;  1PHH A;  2O9Z A;  2GB0 A;  2FBW A;  3H8L A;  4OPU A;  2AAQ A;  3AYL A;  2JAE A;  1YQZ A;  3ALJ A;  3BHK A;  3F8R A;  1IJH A;  2WOI A;  3PS9 A;  4JN9 A;  4B67 A;  4CBQ A;  2GQF A;  5C2T A;  2ARD A;  1GV4 A;  1LQT A;  4HB9 A;  1TDO A;  1CHU A;  1DOC A;  3NN6 X;  1GRG A;  2OA1 A;  3SFE A;  3SZF A;  2WBA A;  4KPR A;  2Q7V A;  1S7M A;  1PJ6 A;  2A89 A;  3GRS A;  3M13 A;  4P9S A;  4K2X A;  1CL0 A;  1Y56 A;  4XXG A;  1M64 A;  5J60 A;  3V3N A;  4AT0 A;  3COX A;  1Y56 B;  2WHD A;  4EMI A;  2GMJ A;  1JRZ A;  2CUL A;  1RYI A;  1ZKQ A;  4BV6 A;  1M6I A;  2BCG G;  3DH9 A;  5IQ4 A;  3IWA A;  1E1N A;  1N4V A;  1PS9 A;  5KMR A;  1E1M A;  4H2Q A;  1GRB A;  4KX6 A;  4TLZ A;  2GAH B;  3RP7 A;  1F6M A;  1E6E A;  4NZH A;  1L9E A;  3NTD A;  3AE1 A;  1L9C A;  3UCL A;  2XVJ A;  1GND A;  3VR8 A;  3EAO A;  1YKJ A;  2E4G A;  3SQP A;  5KOX A;  4J34 A;  3RHA A;  1PBF A;  1MOK A;  5U1O A;  4E0V A;  1ZK7 A;  3AD7 B;  3PO7 A;  1DOD A;  5J7X A;  4TM1 A;  1L0V A;  3AE6 A;  3NYC A;  5GSN A;  1BGN A;  1MO9 A;  1KF6 A;  4OPT A;  1B5Q A;  1P2H A;  2ZZC A;  5DBJ A;  4CCQ A;  1CBO A;  1W4X A;  2X50 A;  1JU2 A;  4GF7 A;  3QFA A;  1D5T A;  3BI2 A;  1NHS A;  1TYT A;  2BC1 A;  4Z2R A;  3ADA B;  2QA1 A;  4LA1 A;  4NEW A;  2Q6U A;  4IV9 A;  3DGH A;  4H4X A;  2V6O A;  3LB8 A;  2YG5 A;  2JB2 A;  4X4J A;  1CC4 A;  2WPE A;  4CNJ A;  1N4W A;  3T31 A;  2OLO A;  2XLT A;  2XVE A;  3AYJ A;  3DJG X;  1H83 A;  2BC0 A;  2ZBW A;  4NTD A;  1ZX9 A;  4DNA A;  2V3A A;  2BAC A;  2IID A;  4CRT A;  4H4P A;  1H81 A;  2B9W A;  1GEU A;  3CTY A;  2EQ8 A;  4A6N B;  2V5Z A;  1DXL A;  1IUT A;  4U8N A;  2BAB A;  1N4U A;  4CY8 A;  3F8D A;  3AE8 A;  2C3C A;  2YVF A;  3BHF A;  2X3N A;  5JCL A;  4C5O A;  1JRX A;  1E1L A;  3CNT A;  2B7S A;  4B66 A;  2XDO A;  1NDA A;  1OJC A;  3GMC A;  1OJA A;  4U8K A;  4YSX A;  1Y0P A;  1S2Q A;  3OZ2 A;  3P4P A;  4YSH A;  2YLW A;  1LVL A;  3AE9 A;  4A65 A;  3KD9 A;  1OJ9 A;  3NYF A;  3AWI A;  1H2I A;  4G73 A;  1UKV G;  1Z6L A;  2YLR A;  4WCT A;  3UP5 A;  5C3J A;  4J36 A;  5ER0 A;  3UTF A;  4O5Q A;  5KVI A;  1CJ3 A;  1RP0 A;  1Q1R A;  3UOY A;  2C76 A;  1GTE A;  3K7T A;  5JCM A;  5JCI A;  1JNZ A;  4J31 A;  2CFY A;  1OJD A;  3KPF A;  4H2R A;  3ZDN A;  1H7W A;  2E1M A;  1XPQ A;  3PG6 A;  1B8S A;  2YLZ A;  5HY5 A;  1K4Q A;  4ICY A;  3G5R A;  1F8W A;  2B7R A;  2YM2 A;  3NGC X;  2BRY A;  3VRD B;  2XVH A;  4J56 A;  5KMQ A;  2EQ9 A;  3NG7 X;  4EQW A;  2X8C A;  4NTE A;  1NEN A;  1EL5 A;  4BK3 A;  3NHO X;  3SGL A;  1E7P A;  1JOA A;  4A79 A;  1REO A;  4D03 A;  4TLX A;  4A9W A;  4EMW A;  1BWC A;  4BK2 A;  5EB4 A;  3V3O A;  4JY3 A;  3IF9 A;  2QA2 A;  4A5L A;  4C77 A;  4AP1 A;  5KNL A;  5BRT A;  2YLS A;  1PBC A;  1PN0 A;  4NWZ A;  2WU5 A;  4H4S A;  3NLC A;  1DJN A;  1F8S A;  2C72 A;  3DJD A;  1GRT A;  5EOW A;  3KPK A;  1BF3 A;  2Q0K A;  2XFQ A;  3C4A A;  3RP8 A;  3DJJ A;  4USQ A;  1X31 B;  3ICS A;  1Q1W A;  3DK9 A;  2R46 A;  3M12 A;  1SEZ A;  4MJW A;  3V76 A;  1V59 A;  1KNR A;  1JEH A;  5JCN A;  3CNP A;  3GYI A;  2YAU A;  2WET A;  1LQU A;  2XFU A;  1NG3 A;  3UKH A;  2WOW A;  2C4C A;  4II3 A;  4JDR A;  4YKF A;  4NEV A;  3RED A;  1BZL A;  3AEB A;  2GR1 A;  1H7X A;  2X8H A;  1H6V A;  5U25 A;  4Y4M A;  3II4 A;  3KKJ A;  4UDR A;  1TDF A;  3QJ4 A;  4DSG A;  4EIQ A;  3AE7 A;  1GRF A;  1LJ1 A;  4K5R A;  1IUS A;  4OPI A;  2FJA A;  1JRY A;  3E1T A;  3O0H A;  4U2L A;  3I3L A;  2GVC A;  2NPX A;  1GTH A;  3ABV A;  3CPJ G;  5M10 A;  4FX9 A;  3ATR A;  4U8I A;  3HYV A;  3NN0 X;  4ADW A;  2QAE A;  2WDR A;  3DK4 A;  2CDU A;  1F3P A;  3CND A;  4H7U A;  3GYJ A;  2AQJ A;  3CPI G;  1ZMC A;  4TM4 A;  1NG4 A;  1VQW A;  1FCD A;  2JB1 A;  1Q9I A;  2R4E A;  2BK4 A;  4BJY A;  3GYX A;  3FBS A;  4C3X A;  3AEG A;  3B3R A;  4A7A A;  1CC2 A;  1S3B A;  3ALL A;  3QSS A;  4H4R A;  1LPF A;  4RG3 A;  2A87 A;  1HYU A;  4FDC B;  4FK1 C;  1GRE A;  3M0O A;  5U63 A;  1IUX A;  3DME A;  3AEF A;  4H50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...