3IJQA

Structure of dipeptide epimerase from bacteroides thetaiotaomicron complexed with l-ala-d-glu; productive substrate binding.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
337
Chain Sequence
MKMTFFPYELKLRHVFTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTPDVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIHWLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRFKGVEVVNGKITLNDLPGIGVMKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Isomerase
total genus 107
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 5.1.1.20: L-Ala-D/L-Glu epimerase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ijqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ijqA01
2QDEA 3CT2A 1KKRA 3DGBA 3QKEA 1MDLA 3TQPA 4HYRA 3R0UA 2RDXA 2MNRA 3QTPA 2OZ3A 4DWDA 2OFJA 3I6EA 2FKPA 3D47A 3CXOA 2OQHA 3GD6A 2OZ8A 4K8GA 1W6TA 2O56A 4GIRA 3VDGA 4H19A 2QGYA 1JPDX 3OTRA 3T6CA 3DESA 3OP2A 2OO6A 3RR1A 3Q4DA 3N6JA 2QJJA 3U9IA 4GFIA 3N6HA 5FJPA 1JPMA 3DFYA 3PWGA 4GYPA 3N4EA 2OLAA 2PPGA 3PWIA 3V5FA 1NELA 1BKHA 2QDDA 3ZLGA 2PU1A 4G7FA 5FJRA 4A35A 2PMQA 4MKSA 3DG7A 2XSXA 2MUCA 3NO1A 3CAWA 2ZADA 2GL5A 3JW7A 7ENLA 3STPA 2GGEA 4GISA 2PODA 3FCPA 4JN8A 3SQSA 4ZCWA 2OPJA 3IJQA 3GY1A 3RRAA 2AL2B 4A6GA 3DERA 1P48A 3ZVHA 1NU5A 3BJSA 3FVDA 4K2SA 4IP4A 2PTZA 4H2HA 3DDMA 4Z1YA 4KPLA 4M0XA 3UXLA 3U4FA 2HNEA 2HXTA 1R6WA 2AKMA 3PFRA 3MUCA 3UCDA 3UJSA 3SJNA 4KEMA 3T9PA 2P0IA 2PGEA 2GGJA 3VA8A 4HCDA 3H12A 3GO2A 1ECQA 3T4WA 3R0KA 2OQYA 2QVHA 4GYPC 1ONEA 3P0WA 2OX4A 3GC2A 2POZA 2I5QA 2ZC8A 3P3BA 3P93A 3R1ZA 4J3ZA 1JCTA 2QJMA 1EC8A 4IL2A 4K1WA 4DN1A 3ES7A 2PTWA 2PU0A 2OKTA 4X2PA 4HN8A 3R10A 4IT1A 3B97A 4E6MA 4HCHA 3SN4A 4MMWA 3OW1A 3CK5A 4ENLA 5J04A 3UJRA 3JVAA 5ENLA 1TZZA 1EC7A 3RO6A 3T8QA 2PGWA 2AKZA 2OG9A 3QPEA 3RCYA 3NXLA 4E5TA 3DFHA 1L8PA 4YWSA 1FHUA 1WUFA 2GGIA 3ZVHB 2GGHA 3UJ2A 3VC6A 1RVKA 3ZLHA 3TWBA 2PP1A 4F4RA 4E4UA 4E4FA 1E9IA 2CHRA 1MUCA 3ZLFA 1XPYA 3UJFA 4ZA0A 2GSHA 1MRAA 4FP1A 2QQ6A 3RITA 2PA6A 3TOYA 3NFUA 3OPSA 1SJCA 3THUA 3UCCA 1ELSA 3H70A 4A3RA 3R11A 3DG3A 3SBFA 4KT2A 3VC5A 4HNCA 2PSNA 3VFCA 3FV9A 4GGHA 2P8CA 3I4KA 4GMEA 1TKKA 2PS2A 1KD0A 3V3WA 3IJLA 4IP5A 3TWAA 3N4FA 3MY9A 2DW7A 3EEZA 2PP0A 3IK4A 1EC9A 2XH2A 3UGVA 2PCEA 1KCZA 2XGZA 3RGTA 4G8TA 4JHMA 1YEYA 3S47A 1OEPA 3FXGA 3SN1A 5FJTA 1R0MA 3JZUA 3EKGA 4DX3A 3I6TA 4Z17A 4DXKA 3DEQA 1FHVA 3ENLA 4HCLA 3ZVIA 3V4BA 3TCSA 1BQGA 1MDRA 1PDZA 2NQLA 4J1OA 2AL1A 3QN3A 3MZNA 1TE6A 3MSYA 1P43A 3BOXA 1SJBA 3PK7A 5IDZA 3CB3A 2DW6A 2FYMA 1DTNA 3SSZA 5EU9A 4E8GA 2HZGA 3VCNA 1EBHA 4HNLA 2PP3A 3VCCA 2PTYA 1EBGA 3Q45A 4IHCA 5FJOA 3SN0A 3TW9A 1SJAA 4HPNA 3R25A 3D46A 1KKOA 2XH0A 3UXKA 3H7VA 5FJUA 4JN7A 4KWSA 2HXUA 2PTXA 4DYEA 3HPFA 1IYXA 4M6UA 4FI4A 1MNSA 2GDQA 2P88A 3MKCA 3NZGA 3TJ4A 2QJNA 4H1ZA 2XH4A 4GGBA 3FJ4A 3MQTA 3H8AA 3OZYA 3BSMA 1F9CA 3MWCA 2OZTA 3V5CA 5BOEA 3DG6A 3TTEA 1WUEA 1JDFA 2P8BA 3IJIA 1XS2A 1SJDA 3K1GA 2ONEA 2GGGA 3FYYA 4IZGA 4H83A 4DHGA 4ROPA 5BOFA 2AL2A 2OVLA 3CYJA 3UJEA 2P3ZA 4EWJA 3QLDA 1PDYA 3DIPA 2XH7A 6ENLA 3ES8A 3TJIA 4IL0A 3OZMA 3KUMA 4MGGA 3S5SA
chains in the Genus database with same CATH superfamily
1FDZA 3ITGA 4QEEA 4JEQA 4YTUA 5LA1A 2VR4A 4L9YA 4J4KA 2P0OA 2C8NA 3WNPA 2IPWA 1Q6FA 2DSZA 3TJLA 2PWGA 1OFAA 3SIMA 4H04A 5JBEA 4JTQA 2QCEA 2QZRA 2DZBA 3MVTA 4FEZA 3T6CA 1FFUC 2F38A 2OKOA 2QCLA 3SQPA 1TMHA 1H7XA 2DZXA 3U9IA 7TIMA 5D9NA 3RF9A 2DSWA 3NSNA 3W75A 3S3GA 2C3ZA 2CYGA 1NELA 3E74A 2PU1A 5ABFA 3COTA 3WUBA 4C90A 1NH6A 3FGCA 3GS6A 2C0AA 5LIKX 4EX4A 2WO5A 3WQCA 5CEWA 1PKYA 3ALFA 1E5JA 5KITA 3CMJA 1OK6A 2QNEA 1LL6A 7ENLA 4FXRA 3LXDA 4GUGA 5E0KA 3O07A 1QTWA 4PR4A 1GQLA 4K6AA 1BPLB 1QPRA 2R9RA 2HS8A 2YCEA 3PSVA 1C9DA 3SQSA 3GU2A 1EFZA 1DQUA 4GINA 1P48A 1XLJA 4IP7A 4IP4A 3W76A 3AMKA 2W3SA 3BLFA 1LBLA 4OUIA 1D7KA 2AKMA 2PRLA 2EG7A 3MUCA 2GVJA 1OADA 3VU2A 2NSXA 4BI5A 4U31A 2JKAA 1NVMA 4A4AA 4P8UA 3W74A 4DUXA 1E40A 2ISFA 1VR6A 2X0YA 3C2FA 1HVXA 2CC0A 2XSBA 2ZZ0A 3GVGA 4LJ3A 3IACA 5HJYA 2H6RA 3GO2A 3ARPA 4UQ9A 3SRFA 5FF7A 3K4WA 3UZXA 4FOJA 4CQCA 1K7FA 2XHYA 2ZZ2A 2E6YA 1C91A 1QJWA 3WJXA 5CPQA 3GXIA 1TV8A 4WLCA 3MHUA 3OLIA 3NVYB 3F1QA 1AJZA 2PDHA 5KSWA 4HZMA 3PF3A 4DB7A 4C5YA 4GJJA 2XFYA 1F6PA 1UR4A 4C6NA 6REQB 1X6LA 3ZSTA 1GRGA 1M41A 5BXSA 1J9YA 3M0JA 1G4TA 4MSSA 3STGA 1HJQA 3A4XA 1OT1A 1Q2SA 1VLIA 4DWSA 3R8RA 1WZMA 2OG9A 2WJEA 4TO8A 4P7LA 3AIEA 4HYVA 3CV7A 3TC3A 2PURA 1CBGA 2WNQA 2DT0A 1KBIA 3GX9A 3GNRA 3OGRA 4YWSA 3LZ5A 2OEKA 4IMFA 3CWHA 1O5QA 2PP1A 3H2OA 4AFYA 2P3EA 1JG9A 3E5PA 3NPXA 2D3NA 5JU6A 1LLZA 1O66A 1XYZA 2CHOA 3WENA 3N18A 1GRFA 1JGIA 4FP1A 3ZR4A 1E4NA 1K02A 4QIUA 1RCXB 1T96A 2V38A 3P5ZA 2W5FA 1CGUA 5AYBA 1ELSA 2XYLA 4C1NA 4NZ3A 5CJ5A 1IR1A 1LOQA 3H24A 4FZIA 3SBFA 4JTRA 4PMQA 3W87A 1BAGA 1JCJA 4IMAA 1ZJIA 1ZZMA 4C5ZA 4LW7A 1JUBA 4Q7NA 4HN4A 2F6KA 2JBMA 3DN5A 4CCCA 4QQUA 1AW5A 1W9DM 4LAZA 4MY1A 4BI7A 1KD0A 3THDA 1LP6A 3A4WA 3Q67A 4AHPA 3WLNA 1V0LA 3ARUA 3S1UA 2O92A 2EF9A 2YDAA 2V2DA 1E6NA 1EC9A 4DQWA 3ITXA 1EF3A 3KXQA 3WL0A 2XGZA 2FHFA 2E7FA 1N8FA 2QIIA 4LYQA 1DE5A 5TD4A 4MDPA 1UR2A 4RNHA 4GBUA 2NUYA 2CKRA 3QGAC 3TW7A 4AY7A 4DX3A 4Z17A 3F4NA 3P14A 1WB0A 3UBPC 4XZWA 3V7PA 3NQFA 4GNJA 4A8IA 2E25A 2W3RA 2GWGA 2EPKX 2VZUA 4GUIA 2W92A 3QLLA 1XDIA 4DPQA 3LGDA 1XQKA 5G2WA 1XLDA 1VFLA 3AHTA 3TOPA 3EX6A 2AL1A 3CHCA 3EOOA 5AYZA 1L6GA 3H2NA 4MZ8A 4G7EB 1XF0A 1BHGA 1CTNA 1N2VA 2CETA 3RYSA 3CB3A 1TA3A 3P8JA 3BAWA 4MVAA 1DTNA 4JHZA 3W7JA 3PZQA 4E8GA 3A13A 4IJRA 4C6LA 2WK2A 4H4ZA 1PTDA 7TAAA 1TJRA 1R3TA 2X8GA 1Q7ZA 4LT9A 3TW9A 4K36A 4AB4A 1GORA 2X7WA 4WY0F 4KEUA 2BC0A 1VCGA 4H41A 1PO9A 4CEXC 1LQ2A 5IHRA 1BXBA 4HU0A 4KFPA 3UY7A 3QQ1A 3ZSSA 1F4AA 5C9ZA 3M7WA 1BSLA 1ISZA 4M6UA 4FI4A 1I2PA 2WNWA 1U22A 4D8ZA 2MANA 1RR2A 4YN5A 3IVUA 3LPPA 3GIPA 2BODX 3NQ2A 5C5YA 1M6IA 4ZFCA 4AF0B 1XJBA 1YE4A 4GGBA 4LBSA 2VGGA 3BSMA 4AAJA 3HOJA 3VVGA 1O5KA 4NJKA 3ARTA 2P53A 4ZMGA 1VGAA 1XLMA 3SCPA 2X2YA 4PMOA 1VC4A 3TXVA 4EWND 3DFNA 2OOGA 4JDBA 2P8BA 2WMIA 3IJIA 5K4ZA 3PZIA 3AHVA 5KETA 3DZ1A 3QQ0A 4AZGA 4JN6A 2ONEA 4Y9OA 1OHLA 3G1VA 3RNDA 5D2YA 1OC6A 1B1YA 3D5HA 4DNAA 5D38A 3VFLA 4DUVA 4CUCA 4W8LA 4MNMA 1CB2A 3RDKA 6ENLA 1UP3A 2ZUSA 5A95A 1AL7A 2WAGA 2PRHA 1NWUA 3L2IA 2G41A 5DBTA 3VYLA 4M56A 1A0DA 1LUCB 4NT0A 4F48A 3LRLA 3V18A 3HV8A 4J56A 1XUUA 2ZICA 4C6DA 4BWLC 2OZ3A 1E4LA 1OFPA 4XKMA 3Q2DA 5A8MA 3EXTA 3PZGA 3T7VA 3EAOA 2OQHA 1Q4WA 4MTVA 4IX0A 1FX6A 3IIOA 2QULA 4E2VA 1QR7A 4AZ5A 2OZ8A 1Y5XA 4UNKA 2O56A 3ABZA 4AIEA 1O68A 1Y0EA 1JPDX 1SW0A 3Q4DA 1GZGA 3N6JA 1YLVA 2QJJA 1C3FA 1YDYA 2YBUA 5M17A 3HFTA 5IRPA 1ZAHA 1ZU8A 4ZOBA 3NVWB 1RP8A 4UFIA 5KMYA 1D8WA 1V5XA 4FK9A 4RE0A 2GJRA 4W9TA 3CXBA 2BXVA 2VFDA 4YPJA 1YNQA 1XQLA 3M1ZA 4NNAA 4GYKA 1OINA 4JTKA 3TYBA 3UWVA 1TUXA 3OOQA 3OIHA 4GBDA 1S2VA 1E9ZB 4P7OA 3FCPA 3HU7A 1ITXA 4LSBA 5CCZA 4FF5A 3WLPA 4GUHA 4MUZA 4G1NA 1WQ5A 4PULA 4RK8A 4ACZA 3KWSA 3KTXA 4CNOA 3W27A 3DGZA 4K2SA 1NWSA 3UXDA 4Y9MA 4M0XA 3BL3A 4EXQA 3VNKA 2O4MA 1F74A 3MVIA 3QMTA 3GKAA 4QR6A 2FDSA 5GJPA 1F7BA 4IUGA 3WH7A 2Q09A 2NVDA 3PTDA 1FWIC 3TROA 4W7WA 3QHMA 5G5IA 1UR0A 3VUPA 2ZA1A 1W1B1 5GPRA 3LDVA 1V6TA 2WPGA 4GY7A 1IXOA 1IV8A 3W23A 1ZP3A 1UOZA 3ZT5A 3B04A 1LROA 1OX4A 2RKXA 1KRAC 1TPB1 2Z4GA 3SCUA 2XU2A 4DJFD 3ZYZA 3AALA 3VABA 2YB1A 1JQVA 3CZJA 1KBBA 1H5VA 4AZ7A 1NOWA 1H2IA 3P84A 4BHYA 2XM1A 2W79A 2PU0A 4LANA 2ZX9A 2QLYA 3DI1A 1CECA 3CAQA 4E6MA 4AHOA 1UD4A 1A5UA 4GCAA 2I9UA 2J9XA 2E1WA 3GK0A 1G4SA 3DYMA 1MO0A 2Y1HA 4Q6XA 4QAWA 2V5BA 3KHJA 3L4WA 2QUUA 3UR8A 4YYCA 3CLMA 3U7BA 4UOQA 4NQ1A 3KM8A 1S5TA 4DYKA 3UG4A 4HZ7A 4F9DA 2BOGX 3B9NA 2CXGA 1KFWA 1RQEA 2C1IA 2JE8A 1AJ2A 2X1SA 2ZXAA 4H8NA 2YXXA 2IPFA 2YB4A 3UJFA 3MUXA 4A3QA 4A3HA 4OV9A 2GQ3A 1W1ZA 4UQDA 2PA6A 2YL5A 3QFEA 3W1AA 2RABA 1PCKA 3THUA 3UCCA 8CGTA 3OYZA 3T08A 1DIDA 2FJKA 3P0XA 3DX5A 4W84A 3EWYA 2YSWA 5G4HC 2WXDM 3CUIA 3TU9A 1L6YA 4LUTA 5BXTA 3FKKA 1J2WA 3W2KA 2ZX7A 3IGUA 1OWQA 4XZNX 1TVPA 3V3WA 4HYWA 1WA3A 3ELFA 2X30A 4JCLA 1US2A 1DJGA 7ODCA 3W7RA 3N4FA 1BD0A 3ANUA 1GTEA 3UWQA 2PDJA 4XZHA 4LOCA 3RLHA 3N15A 3F4WA 5HUPA 2Y5JA 3OHMB 2DVUA 4G8TA 3T09A 3AYSA 5H8PA 4IWWA 1G1YA 1Q6EA 3NNTA 3DI0A 3PUDA 2E40A 2I17A 1XRSA 2WVVA 2BY2A 2EEXA 3LU2A 3MI2A 3IUDA 2NSOA 3WFZA 2DVXA 1DXEA 3ENLA 1GVQA 3EYPA 4HCLA 3V4BA 3VKAA 1GW9A 1RPXA 3C61A 2FZ9A 1W1PA 3S8HA 1UR1A 2CWXA 1S39A 2GK1A 5I79A 3WJYA 1HFBA 2NQLA 4JBRA 3NCOA 4M7TA 2QUNA 4K38A 2XM2A 3VOHA 3PM6A 2D73A 3WD4A 3E5BA 2JGYA 4KKXA 5CPTA 1QO5A 2WJDA 3CLWA 2HZGA 2WLZA 4AD4A 3FHQA 4FF7A 2YDRA 4LVBA 5LNSA 1JEZA 1R3WA 2RHGA 3ME3A 4HNLA 1TPFA 3FSTA 3QPYA 3RCNA 2PTYA 1KBJA 1NF0A 4DBEA 4KCVA 5BNKA 3VNDA 2C16A 1R5YA 1PE1A 3LLFA 3H7VA 3W4RA 2ZDRA 3B9DA 3BLEA 1OC7A 2BY3A 1DE6A 1JD7A 2A3HA 1W54A 4WF7A 3LADA 1CGTA 4XKYB 3GVWA 2DEPA 3N2CA 2IQTA 1P0EA 2O4QA 4A8NA 1O12A 4DY1A 2F8QA 3H8AA 4ZSUA 4HGXA 4FNTA 4DVOA 1O6IA 3CGDA 3NGFA 3CQKA 4UFJA 3CMFA 1J11A 1OJTA 1I2OA 3B0YA 2VNCA 3HJZA 3IPWA 2HE8A 4R7JA 1PUDA 3CWOX 2GJXA 3W7EA 3EB2A 3OVGA 1XS2A 2W62A 4EXAA 1B57A 3W07A 2AGTA 1S3HA 3E3HA 2AL2A 2J66A 2Y5SA 3QEZA 1D9EA 5CQ1A 1TB3A 4UTMA 3AWNA 1PX8A 3V5OA 1VH7A 2Y63A 3CT2A 1AUSL 1HJVA 1OFOA 1MDLA 3PZVA 4H6EA 3B0VC 1BVZA 2WPBA 4B15A 2CDUA 4ZFMA 3NVTA 4Q4KA 3WFAA 1CLXA 2HPIA 3STCA 2FKPA 2FHCA 2OQLA 4N02A 4RNFA 1NOFA 1ZP4A 4WY0B 2GUBA 1QK0A 3W86A 2YFOA 5FI8A 4AZCB 3QXBA 1SVDA 5CAKA 4IPIA 4X60A 4AZIA 2DU2A 1NHSA 1W3KA 3N4EA 3ISIX 2OLAA 1PCWA 1IZJA 1BKHA 3G1XA 1TFVA 1MQQA 4GC3A 1JNEA 1V93A 2J7HA 3GXDA 4IIHA 4NZ5A 2J27A 1UWTA 3C6CA 4B5SA 1E51A 5FIPA 2DQWA 1FP8A 4L4MA 3WF3A 3GY1A 3M0MA 3AZRA 1RBOB 2WSKA 4Y9NA 1AD4A 3P6LA 1TIWA 3WJSA 2XJ7A 2XGIA 2F5ZA 1NU5A 2XFFA 3BJSA 3FVDA 1QNQA 3VOJA 4LNYA 3M0KA 4XO7A 3EMCA 3UXLA 1XH1A 2NXHA 2CLKA 3WH8A 4XSMA 3NUKA 4HJFA 4XTDA 1K77A 1LT8A 3BPWA 1LCOA 4KW2A 5E09A 4LS0A 1SFTA 2PWUA 1OABA 4FX8A 2BTMA 4C7DA 2OQYA 2R14A 2Y85A 1QVBA 1ONEA 4TVYA 3NL3A 4AD2A 2PF0A 2FVKA 4H3DA 5XINA 3WDQA 4UIOA 5FEXA 1J0KA 2POZA 4O13A 3BAIA 1R3RA 4YVXA 3UNTA 4CCEA 1H51A 2WPCA 2J13A 1ZALA 2HMCA 3R1ZA 4YHGA 1M04A 1UC4A 2Z6JA 3HMCA 1GQKA 3ES7A 2A3EA 3OU8A 1Q3NA 2G3MA 3K8MA 4FLQA 4TUFA 4QNWA 4XISA 5DF0A 4O14A 4Z2IA 5KEZA 1P0BA 1QPOA 3CAKA 4O1FA 1A4MA 3LGEA 4M6PA 3RLVA 4QCEA 4HU8A 2JIWA 1W3TA 1D3CA 3W72A 1HUVA 4NAEA 2XIJA 4BJHA 3L5OA 1VQTA 1FUYA 1YHTA 2WZIA 1XV8A 3WD3A 3PJTA 4US6A 4Y2WA 4FALA 1M03A 2GGHA 3L7RA 2F6XA 4WSJA 3UXIA 4DELA 1EDQA 3ITLA 1M7JA 3I7SA 1NFPA 1TPH1 1NTHA 1WE5A 4DJEA 3VNIA 2QQ6A 3V0SA 1UIOA 4DM1A 4CU7A 3VD4A 2DZWA 3KOFA 2C91A 3G2GA 2XIBA 1IWBA 3W28A 5C71A 5A69A 4H4QA 3DFOA 1I1WA 1OX5A 3UYIA 1NDVA 1Z6KA 1LG1A 2FLIA 5EGRA 4KERA 4C1KA 3EB4A 3L4TA 4NX0A 1X2GA 1E4IA 2QCHA 2PGFA 2Q3RA 1V0KA 3IJ9A 1UR3M 3QBUA 1E6QM 3STFA 3WZ0E 1OGSA 2NLYA 4LB4A 1E1CA 3IUHA 3ATYA 3ZS4A 4LEFA 3WLRA 4DF1A 5A6BD 3VD9A 3GH7A 1I9CB 3MV11 4Q4PA 2OLHA 1WO2A 3BGGA 5DFAA 2E28A 3L65A 1EDTA 2IW0A 3ARWA 3ITYA 3B9JB 2QCDB 3SI9A 3GC5A 3PPFA 4I9JA 1EJRC 1A50A 4HPHA 1QUMA 3MUZ1 2A85A 1MQRA 1TTQA 3VZZA 4LU0A 1EF2A 1H1YA 1ADOA 1MXDA 3HB9A 2XIMA 1TJPA 4YTRA 1BTMA 4FMVA 3PBGA 2NX9A 3JUGA 3RIKA 4FLOA 4B91A 1OG6A 2EAWA 3E9AA 4U5IA 5E70A 2CLLA 4LAKA 4M1RA 1CPUA 1L6FA 3TSBA 2E3TA 3GSMA 3G18A 3S42A 3GH5A 4I9AA 4ONVA 3CPUA 4Q4QA 2V9DA 1FDYA 1MUWA 1XC4A 3OQEA 3VI2A 3U5UA 1T7LA 4L6HA 2PFHA 4IMDA 1K8ZA 4LVFA 3A5VA 2J8FA 2XH4A 2VRKA 3ARYA 2I5IA 2JQXA 5H91A 3CNYA 3SCWA 2XVPA 3O6DA 4B5NA 1A3WA 4QXIA 5C8BB 3S6TA 4HPGA 1XM3A 3G0SA 3LHVA 5CXPA 1DJYA 1H11A 4MKNA 2VURA 3MYOA 3DFSA 4DHGA 4GI9A 2B7QA 2VFFA 5HANA 2I16A 3ABQA 1WPCA 1R2TA 3UJEA 4Z2JA 4LCRA 3Q37A 2WCGA 3MJMA 3KX6A 2GRTA 4Q7BA 1JUEA 4NILA 2QDEA 3CMGA 3D0CA 4FXJA 3LXAA 1C8QA 1MSSA 2RDXA 3AMCA 3ITOA 3EWWA 2O0TA 3UU0A 3F7JA 4J5NA 2X05A 4RDWA 1YNPA 3LXCA 4CD6A 1NQKA 2OELA 3ZR5A 2VMFA 3VD5A 1B30A 4KRTA 1K8XA 5JXQA 4JS3A 1T3QC 2OYLA 1ALDA 3LTPA 1NHPA 4HTYA 4TU1A 3UA4A 1BRLA 3GNXA 1DP0A 4H9YA 1MNZA 1OJXA 2BBFA 1OY0A 3G1SA 5HNUA 1UJQA 3LQGA 1T8XA 3R6IA 3RR1A 2GVLA 3A9IA 3M46A 5FSDC 1GVIA 5I78A 5LXEA 4C65A 2NQJA 2BOFX 1J5SA 3NQAA 3CGCA 3DK9A 3A7RA 4B16A 3LG3A 3BJTA 3HW2A 4PTNA 3S2CA 4PCPA 1D7FA 3F4VA 4TVWA 1DV7A 4TX8A 1FWRA 4N6EA 2V69A 4D2JA 4EPKA 1R87A 1C90A 1ZTVA 3TA9A 3DJGX 2DT1A 3WEZA 2PTZA 3GDRA 3EANA 2OZ0A 2HXTA 4AVFA 1I4NA 1RQBA 2OB3A 1TPDA 3B4YA 3G3DA 3TAOA 1IIHA 2PLKA 2EPOA 1XIGA 2A6NA 2PGEA 3I68A 3LM3A 2VDIA 4CD7A 1JDCA 2VJXA 1BWVA 5LZLA 4PCSA 3IJ6A 4A05A 4GZJA 1X6UA 4MYAA 1H49A 2R94A 3B40A 3HM7A 5TIMA 4B5TA 5EYWA 3VKJA 1V03A 1OCJA 3BZGA 4JX4A 4YCOA 1W1TA 3FOKA 3P3BA 3IC9A 3I7QA 4JPGA 3ZWSA 3GNNA 5I3DA 4K1WA 3BUVA 2CLEA 3V16A 5D9PA 1K9TA 2ZWZA 4OZOA 4RZBA 3W1XA 1UBPC 3XIMA 4IT1A 4WUIA 1VYSX 4QROA 3MDWA 5JH1A 4AYGA 2VX5A 5I3KA 1CGYA 3N2XA 1VBJA 2B31A 1JYWA 3MCOA 4CN4A 5ENLA 1H6VA 4JKLA 2ZQ0A 3G0XA 4REQA 3GTXA 3G6MA 2J6XA 3S1GA 3PPHA 1KXQA 3OLDA 3BQ6A 1UUQA 3L4ZA 1J01A 3MSDA 1V59A 2WC4A 2ISVA 2V82A 1ONFA 3I3DA 3C52A 4F4RA 2J9YA 4E4UA 3VGGA 3H4XA 4JTCA 2DPEA 4BA0A 1I2RA 3U57A 4MB3A 2ZIDA 3BTNA 1JYVA 4B3KA 2CZEA 2WCSA 3WDJA 3WF4A 1V3HA 2F84A 1XPGA 2WNNA 2VEPA 3VGDA 1JPIA 4AMCA 3BE7A 3H70A 4OU1A 2VWSA 1J0IA 4JQ4A 1J18A 2ZFAA 3EAUA 3CGEA 4DI8A 4LPCA 2GR0A 1DORA 1GW1A 3HTWA 2WSPA 3NURA 1XX1A 5DY3A 2P50A 1UKPA 3QR0A 3WLTA 1JZ3A 3WYZA 5HQLA 1TWIA 3HPSA 1E0UA 3DH9A 1KNWA 1PZ0A 1OQFA 1EIBA 1KTNA 1WP6A 3WLKX 4IMEA 1RJQA 3SIZA 3SY5A 1UW9A 4CEUC 2WQDA 4JEJA 1KXHA 5DCBA 2X7VA 3UGRA 4HKPA 4EQXA 1LPFA 4MPKA 3L0NA 5K9DA 3W1QA 1R0MA 4NIRA 2J7GA 1AL8A 1NOUA 3GXPA 2B81A 2VL4A 1XYMA 4JIEA 1MDRA 2PEVA 4P8VA 3T0CA 1EP3A 2NT1A 3U7VA 4PMYA 3SGGA 3T4CA 1J4EA 1I8JA 5FF4A 1FKXA 7PTDA 3UWZA 3VO0A 1X8FA 3GXFA 4D6GA 1ISWA 2YCJA 3H2CA 2HBXA 1CCWB 4IISA 4NY2A 3L2MA 3EPNA 5DMLA 2PLCA 3PG8A 4YLWA 2W9MA 3SN0A 1T40A 1PL9A 2D2HA 4HNTA 3VIHA 4DXVA 3L9CA 3TNOA 2Z2AA 1BYDA 4JN7A 3RM9A 4JICA 1DQXA 4WOQA 1K6WA 4GH3A 1FCVA 1YTDA 3CPRA 3DU0A 4OHQA 1SFJA 4ZTYA 3I10A 3PB0A 4Q8WA 2ZA2A 1O7AA 2J7FA 2OOFA 1H7PA 4RV3A 4HOXA 1I0BA 3NR0A 4AIUA 1WDQA 1CI1A 4WVXA 3DAQA 2WV8A 6ALDA 3HIJA 4XAPA 4HHMA 4CQ9A 1KW1A 4DO7A 1XYAA 3AMZA 4PTMA 2ISSA 2ZVRA 1TELA 1O5XA 4O8RA 1RCQA 3CYVA 3V0UA 3QGKC 3VDHA 3EKLA 2ZRZA 3OBEA 2WHMA 2XN2A 3IIZA 1XICA 4ZOAA 4WDWA 3MKVA 2CZFA 4HSHA 3CWNA 4AIOA 1A53A 4LH8A 4WDTA 1V08A 2OVLA 5CZ0A 3OGSA 5D8ZA 5LNVA 3CYJA 3N25A 5I09A 3RX2A 5CPLA 1MW1A 1MW2A 1P7TB 2J77A 3H2EA 4D6IA 3PWGA 1OK4A 2CZDA 4XUGA 4BKNA 3CUFA 3BQ5A 3GHRA 3AXXA 2WHJA 3CV1A 5GNYA 2YIHA 5G1YA 2BGQA 1VFOA 3TQPA 1VF8A 2PDUA 3PR2A 1W91A 1RPKA 4JQ9A 4IXHA 5FD0A 2WJZA 3SUTA 3U0HA 3M41A 2V68A 3GD3A 4RL3A 2V3BA 1GV4A 2TODA 3LQLA 3AIVA 4QG6A 3ZJ8A 4WCJA 3QOMA 5FL1A 3MT1A 4UB9A 1GKQA 4ORIA 4L6OA 2OYKA 3TFXA 1K4HA 2WKLA 3BLLA 4C6FA 1RV8A 3CBWA 5CJNA 3N14A 3IGHX 3OP2A 3W73A 2OO6A 4D6FA 5C2CA 1S5WA 4H9UA 4GFIA 1K3UA 4J57A 3WMLA 2XIQA 3E2VA 3GXNA 1HL2A 4F0HA 4UC5A 5A6TC 1IWPA 4YJ5A 1U2YA 5ABEA 1TYPA 3DG7A 2PBOA 1TMQA 4QM1A 5TNVA 2QF8A 2ODOA 4ES4A 3ETRB 2D1ZA 2INEA 1VCFA 1UPPA 2YVFA 1MZHA 1J5TA 1N5WC 3FAXA 4ICNA 4S3BA 3U6WA 3C4UA 2FVMA 1JXKA 5F4WA 2OPJA 4MNKA 5FACA 4A6GA 3USBA 1M65A 4S3EA 4RZ6A 1VEMA 2OMAA 2WVVB 1EBDA 4HA4A 1MVYA 3KW3A 2NQZA 1PAMA 3SB0A 4GO9A 4NAFB 1GSNA 1R2RA 4PUKA 3WCZA 4M8UA 4H00A 3AXMA 4O53A 1ADSA 1W9BM 3EA1A 5LIUX 1FCUA 2Y2WA 3XINA 5I02A 1GOMA 2XUCA 1MOKA 3S4TA 4DNMA 1IE7C 3VKDA 3S2MA 4F40A 5ER0A 1DJZA 1TPC1 4XV0A 2TPRA 1S7MA 2ZDSA 1R3SA 5BMWA 3WQ8A 4OJYA 3RCMA 2CESA 1VHCA 3PZUA 3EPMA 3PTMA 3OEXA 1M9HA 1LRTA 4GUJA 4IFKA 5EBAA 1F61A 1V6UA 2OKTA 2OR2A 4HN8A 4X2PA 5IFTA 4BURA 3RX3A 3NM3A 4H9ZA 3AMDA 3IEBA 1QW9A 3BO9A 3FEMA 1UKTA 4C6CA 4QCFA 2V2HA 1W3HA 4D6DA 4O17A 1E6PA 3UJRA 2Z2UA 4QS5A 4M7SA 4KBXA 4UTKA 3L12A 3WEMA 3NXLA 2C0HA 1X98A 3M0ZA 5B7ZA 1OIFA 2EHHA 3ZVHB 1KO0A 2WVSA 4YXGA 4QBXA 1EXPA 5TQLA 4J27A 5I3HA 4O1AA 4GQBA 3ID7A 1S5MA 4O57A 1F3XA 1ZAJA 5D32A 4GYJA 2KAUC 5CC3A 5HATA 3U5YA 5CG0A 2V2CA 2ZA3A 4L4OA 2NT0A 1OZMA 2YXOA 4EP8C 1GUVA 3VC5A 3RLGA 1K4GA 3OLGA 3IRSA 3TNBA 1X97A 1YPIA 3M64A 3AYVA 4ATLA 2HVNA 4ATWA 1EOKA 4YMZA 5D9OA 3E0VA 2HV5A 3KVMA 1UD2A 5FS7A 4FA3A 1J96A 2E9MA 1NQ6A 4Y7EA 3OB8A 5G2HA 3C2VA 2G3JA 2FTPA 1ICSA 4OE7A 5F7UA 3UGVA 4F2UA 3MI3A 3LB8A 1QO2A 4KIEA 1FO4A 3VIFA 3ABRA 4APNA 5MKGB 4TXEA 1SZRA 3KL0A 3RJXA 3KTCA 2BCPA 3CT7A 3BSHA 3GIQA 4QLKA 1Q1WA 3WQOA 3R12A 2VD9A 3HO8A 2QCMA 1XIMA 2Y0FA 2PD9A 1UD8A 3L67A 1X1NA 1QK2A 1TJ0A 5AYXA 5CGQA 1PDZA 4R53A 1HQTA 1E6RA 4BQ3A 1V02A 1G7VA 1Q6LA 4DJFC 3QW4B 3M0HA 1JI2A 3PAJA 5IDZA 1T8QA 1XIEA 3ZQ9A 1BVWA 1EO5A 5IDIA 1WZAA 3WQEA 1G69A 1WOAA 3V75A 4W7VA 4N4PA 1GK8A 3NM1A 1Z8AA 3T2QA 3IANA 2PP3A 3E49A 4S2BA 1KCKA 5M2FX 3E2SA 1EBGA 2A79A 2Y8UA 3ARSA 3D46A 1GPFA 3W83A 4LQ1A 3N11A 3T44A 1Z32X 3WDPP 5FJUA 4KWSA 1OYAA 3VM7A 3AHYA 3AIUA 1VPXA 3BMWA 4UCFA 3QC3A 2JF6A 3EX1A 1MNSA 3M16A 3L5AA 4S38A 3WLQA 4GI4A 2ZWYA 1XDLA 4R5EA 5MHBA 5TF0A 1GERA 2QPXA 4MFDA 2QJNA 4MWAA 5C7HA 1S2UA 3KOWA 4I9MA 1V8EA 2RGLA 1UCWA 4Z1CA 2FFIA 3B0XA 1JZ2A 3PTKA 1IEVA 1CXLA 2A7RA 4L1XA 1XG3A 3PPCA 2WP6A 3FLUA 4EF9A 4JIIX 1HJXA 2B7NA 3AIBA 3L0KA 4Q8VA 2FMOA 2EG8A 2FVLA 3MP4A 3BLOA 4Z2GA 3TH6A 1C7TA 2HTMA 2INZA 1M01A 5DMNA 3TW6A 2WVTA 1RM6B 3E96A 3GR7A 1XH2A 2EPHA 3LA4A 4XZIA 3QLDA 3IWPA 2BDQA 3TFCA 1DYSA 4POCA 3ES8A 4X0VA 4MJZA 4BCEA 5I6SA 2CFYA 4ZQMA 4IIFA 3AO0A 4GQGA 1C9WA 1FXPA 2GUYA 4F8XA 3AIRA 3WQVA 2A7NA 2YL6A 1WCGA 1JF6A 2WM0A 2QCNA 1KWGA 4I90A 3B9OA 4C6IA 3SW6A 1JOAA 2BV9A 3FKRA 4G6CA 2UY5A 2VGIA 6CGTA 2HVOA 1S1RA 5M03A 4V27A 2AQVA 3FDGA 1STZA 1HJUA 1TO3A 3TN4A 2GQWA 1UASA 4K8GA 4DXXA 1JULA 3HG3A 3AXIA 2X0HA 1BTCA 3PUOA 1MO9A 3BXWA 4FSAA 4ZR8A 1HXJA 4H4IA 4QS6A 2GR1A 2Y89A 1F8MA 1RAKA 3EOUA 3IGXA 4BEQA 2CZVA 2X50A 3DKJA 3VNZA 2FGBA 2NX3A 3PSWA 3QC0A 1W2PA 4HJWA 3FIGA 4MUPA 4AWUA 3N4AA 4H7VA 4UQCA 3TCEA 2JALA 5AHIA 2HPMA 3S46A 4GYFA 4N0RA 3UYCA 1CWYA 1HJWA 4PUDA 3URAA 2X1UA 4OECA 5ECUA 3WMBA 2P5NA 1PV8A 3IIVA 3WF0A 1SZNA 3C0JA 5K4XA 3S2JA 1R9ZA 3UG5A 2W0UA 4DJDA 2ANUA 2QDHA 2V3FA 4J35A 3TEVA 1U1UA 2R1KA 2WB5A 1TSIA 1VPQA 2PE4A 3DFQA 3P82A 1FIQB 1ZDLA 3KVLA 3KL3A 4HOWA 1ZKQA 2BFGA 1F8IA 5KZMA 2XWEA 3NZQA 3DHFA 4Q32A 3WLSA 2HQMA 1IEIA 3YPIA 3ANVA 5HPCA 5LIWX 4MM1A 3KBNA 4ADWA 4JFUA 4RNJA 1QNSA 1AZ2A 1QOXA 5B7YA 4I5UA 4GYPC 3EA3A 4GVHA 4BEUA 1OFEA 4TOQA 4HMDA 4PUUA 1EP1A 3EEGA 4C91A 3QZAA 1B3ZA 5A2CA 3KWXA 2XVGA 1FY6A 5IBXC 2YR1A 4LALA 2BVYA 4EM4A 1KM2A 2VT0A 4E2OA 1JZ8A 4I6VA 3WX7A 5CBIA 4XD6A 1XLIA 5I00A 2QS8A 1GVRA 3ANYA 4NP7A 1DXIA 3DC0A 3JVAA 4OFCA 2WSRA 2NW0A 4Z2KA 3RO6A 2JEPA 3RUBL 3KLLA 4LRTA 2WP5A 1GOIA 3G1HA 4E5TA 2GSJA 1ZX9A 4JTAA 5K9CA 2ZRWA 3GFXA 1L8PA 3CZGA 3DYOA 1ZBWA 1RVKA 3TQ0A 3TWBA 4I5RA 3AWOA 4NJGA 1I2NA 4D6EA 2CHRA 1FWBC 4B4FA 1A5CA 4W7UA 3CL7A 3ITCA 2D23A 3GG8A 1UUOA 4NRSA 4U2ZA 3T55A 3UZWA 1E70M 3LCGA 3RITA 1RCOB 1SJCA 4RCXA 1QRQA 2KZHA 2KX9A 4W5UA 3A21A 5A8NA 4Z2LA 2VCCA 3L4UA 2PBGA 4KT2A 5L6UA 1CGVA 4LCSA 4K8HA 2EQ8A 4GGHA 1S2CA 3DHPA 4MZ1A 2PS2A 1KM3A 4IP5A 3CIXA 3CV6A 3B9AA 3DH7A 1V4YA 8XIAA 3WK0A 4GVIA 3WMCA 2YYTA 3IK4A 4GIYA 3M0LA 4JFVA 4Q8PA 1RD5A 1YEYA 3THCA 2D0GA 3CUZA 3MANA 4HZ8A 4MY9A 6TIMA 1V0MA 2PWDA 2NQ5A 4EQSA 3SCNA 2E77A 4FNPA 2ZX8A 1BQGA 3ECQA 2YA1A 3BICA 1W9VA 3GTFA 3NS1B 5HJXA 1ZNNA 3PBMA 1HP5A 1Q66A 4IPLA 5EL1A 5HWJA 3W26A 2TYSA 3REQB 3NVDA 3EA2A 3C0SA 1BLIA 4GOAA 1FH9A 2FZDA 4HIBA 4LIIA 5REQA 4O16A 2F2KA 1NARA 1VZWA 3NDOA 4IQEA 5F1UA 1K9EA 5C7VA 3KVKA 3TN5A 3FA3A 4MOZA 1F6KA 1V77A 3NEVA 4QISA 1BWKA 3PBYA 3RU6A 3VINA 1SZGA 1SJAA 1HKIA 1DXFA 4PN2A 2YX0A 3W7CA 4XZ9A 1SU5A 1Y65A 3KBWA 3PS7A 3NVVB 3TZNA 2VVSA 3L21A 2PDBA 3EDFA 5D09A 2V5LA 1EHAA 1AH4A 2YCLB 4EANA 3TP4A 4PSPA 5BRQA 2YLLA 1F07A 4ZL1A 1GXFA 1CZ1A 1KRBC 3RPTA 3VIMA 1TZ9A 4PBFA 3GTIA 4BF7A 3VOCA 4PE8A 4M19A 4JTGA 3SEPA 1NHQA 3FJ4A 3UCQA 4S23A 3QHOA 1Y5VA 1FRBA 3PZTA 2IUZA 3VOIA 1HGYA 1QOPA 1WDSA 1XSIA 2GJPA 4CCDA 3WUGA 1GEQA 2P76A 4H4VA 3BVJA 1S1PA 3V5CA 4BZYA 1MXGA 4X61A 4R85A 3IJ7A 1WDPA 3UA3A 3O15A 3W7MA 2DGAA 3FAWA 1H50A 4MIMA 5DRCA 3R0DA 3DK8A 3GH4A 4IZGA 3AZSA 4NX5A 3AMGA 4RKAA 1IEQA 4Y6GA 3UNDA 1MEIA 2P3ZA 4UR9A 3LBOA 3C2OA 4JQ3A 1N63C 4H4XA 2ZYFA 3H2FA 3NQBA 1GREA 1QMLA 3NSMA 1YBQA 2HK1A 1KGWA 4IM4A 3DGBA 1E56A 1H7RA 5HBFA 1I0DA 2EKGA 5CBJA 4MLJA 3FYOA 5D9MA 1OF8A 1Q85A 1JPKA 5M3WA 1A47A 1QXLA 1SW3A 2VVNA 1EL3A 4XZLX 3GZAA 4JD4A 4DWDA 3RM8A 4UTWA 4LVAA 3KL5A 2V0TA 1JEHA 1X38A 1FWFC 3D47A 3CGBA 5U1OA 4DO6A 2X8RA 3W01A 3CXOA 3W7GA 1R9YA 4W4QA 3WBWA 3PANA 4GQQA 2BSLA 4AEFA 1AMYA 3DESA 1Z41A 4F3HA 1LG2A 3B05A 3QVQA 3BURA 1FHDA 3W24A 1YXYA 1WV2A 3MDUA 4GD0A 1EZ2A 4EAMA 4B90A 4L61A 2BWGA 1J2BA 1JRBA 1QBAA 3WLJA 1AQHA 3WDHA 2BGSA 1OCNA 1EJVC 4GZ7A 1LQ0A 4EPEC 1XYBA 5C0QA 3UPBA 2Y8VA 3NO1A 4GACA 2NXGA 3TQVA 4C7GA 2HNHA 3ARXA 4IG2B 3O2LA 4D8AA 2Z1WA 1LRQA 1I1XA 4HPXA 3VGHA 1SR0A 4D6HA 3TX9A 2W0HA 4DZHA 1V3MA 4ZQNA 4Y8EA 2GQAA 2VUYA 1LYXA 3QR3A 1Q8JA 5HA7A 1RY8A 2GQ8A 2E5CA 9CGTA 4CN1A 3A7AA 4P61A 1UB3A 1WAUA 3FEQA 3GUWA 4DWSD 2PDMA 3W82A 1JFHA 4NXSA 3TIMA 5I3GA 4WD0A 3TMLA 1S46A 3LCWA 3NWRA 3MV01 3T4WA 3TTOA 5BWAA 1W56A 4IPNB 3S6OA 1R30A 4K37A 1EPVA 4MADA 4OQVA 3QPZA 1X39A 4ZENA 4AZBA 1OFQA 1Q6GA 2NV9A 3K30A 3MUY1 2PDWA 3A47A 3SUWA 3OODA 1N8IA 4CNSA 2J3NA 4S1FA 3W6LA 3I6RA 3P67A 3W7HA 1GGOA 4FAMA 2XTKA 2DJLA 3MHGA 3CIVA 1V3JA 1DJNA 2BX7A 5FAGA 2WJFA 3SUVA 3CK5A 5JCMA 3AROA 3AJXA 5FAJA 3GW3A 4MF4A 4E2BA 3HN3A 3T8QA 2G4JA 4GIEA 2CXEA 3SECA 2QYGA 3DCPA 4Q4RA 4DAFA 2E5BA 1PZ1A 2E68A 5CJMA 4M80A 4EQRA 5CKSA 5H1WA 2WPEA 4LGXA 3QMRA 1Q4NX 1A80A 2WC7A 1YQ2A 1H1ZA 1WDWA 1ZL1A 1XLLA 1JQXA 3K13A 4LFYA 3U48A 3OO2A 4NUWA 1TPUA 4O12A 3EZ4A 4JTEA 2X99A 4YL2A 3POCA 2CBUA 5E0CA 4GHRA 4UTHA 1N62C 3RO8A 2L5HA 3LCFA 2WPFA 3R11A 2ZX5A 3DG3A 4JY8A 3UZJA 5D37A 1FWHC 2DZUA 2HRWA 4U4MA 3LNMA 2ZCGA 3APYA 2QAPA 2VCAA 3M5XA 3QV9A 3GR4A 3LD5A 4J3WA 5I3IA 5K9XA 4LXFA 1HGWA 3NIYA 3XISA 1OC5A 3P62A 4LCQA 3G1DA 4ACYA 1DBTA 2YBVA 1O60A 3A4AA 2NUXA 5LIYX 1UMLA 4JIPA 3LBMA 3M5ZA 3H22A 2ZTJA 3WQ5A 1KN0A 3D9XA 4PBEA 3LGGA 2V3AA 4PBGA 1TV7A 1V0NA 4PRWA 4RW5A 2PF8A 2QCFA 3I6TA 3LS9A 3BAYA 2BZNA 2A4AA 4KGLA 3IRDA 1TV5A 1I60A 5DELA 4LV9A 5FSEC 4LTSA 3TJXA 3CTTA 3DGHA 3E0LA 2CKSA 4MWAE 4WHBA 1P43A 1JF5A 1SJBA 2ISDA 4M3PA 1B2YA 1W3LA 3FHAA 2UY2A 2WHLA 2V30A 4Q4SA 1JCNA 4I7WA 3RR4A 3OVPA 1XANA 4L1WA 4UTFA 2D3LA 3VCCA 4ZVJA 4AQLA 2HJPA 2VZOA 3QSTA 3SSJA 1XD0A 3T78A 1XWYA 3RX4A 3R25A 4CQBA 4YTQA 4AD3A 2BHYA 1M7XA 2I1OA 1E6XM 3TZFA 1TIMA 3AYTA 4RE4A 1GRHA 3LNPA 3W2MA 3R58A 4QP0A 2OSWA 2QGHA 2WBAA 4RDZA 5XIAA 5KZDA 3BG5A 1NWTA 4FNUA 1TTJA 1XR2A 1S2AA 4I9TA 3L5MA 1FA2A 1EWEA 4HPJA 1FH7A 1TZ7A 2BOEX 3KRUA 1ITQA 1IXPA 2CLPA 1PX4A 2ZRUA 4LAOA 1XYFA 4HQVA 1LT7A 4IGMA 4KS0A 4PRTA 4IQJA 1MYRA 4DO5A 4UXDA 4ROPA 2YW3A 3W85A 3AHZA 3RJYA 4KEVA 1T99A 4EIVA 4QDMA 3KBSA 4JQ1A 1B90A 5CLWA 5HR6A 4BQ4A 3KUMA 1PIFA 3AU2A 1NJJA 5BW6A 3AN1A 4UTIA 1VDVA 1J0YA 1WBHA 2VEFA 4KWVA 5BXPA 3GNDA 4OTKA 3R94A 3N34A 5D8WA 2I57A 4OVXA 1CB7B 1P4CA 3B8UA 3HURA 2YVJA 2PD5A 1QW7A 3L4YA 3UWEA 4BF5A 2R1NA 1ITUA 1FEAA 4WR3A 2CPUA 2QCCA 2V5CA 3W1TA 1ZQ5A 3P7YA 1BF6A 3MP5A 1W6TA 1JD9A 5DN1A 5HWNA 4GIRA 3ARZA 1GYNA 1KRCC 1RY0A 5BMXA 1YIXA 5FEPA 3RPMA 1VIWA 4MB5A 1EB3A 2HWGA 4JNZA 5A6JA 3T2OA 5FF0A 1BVNP 1JPMA 4PCTA 4GVGA 4WDXA 5C9UA 4J3VA 3HQPA 2YQUA 2CLOA 2ZUTA 3M43A 3ZLGA 9XIMA 5AOUA 4O52A 2YZ5A 5FJRA 2YL8A 2WMKA 1E71M 1HVQA 2WQPA 4MAVA 6REQA 1UWSA 3P5YA 5DANA 4H6RA 1VFUA 3QRHA 2FB2A 3WBAA 3A22A 2QUVA 2FZNA 3GW0A 2J8GA 3G22A 4O15A 1GNXA 4AVOA 5JBFA 4IQLA 1H0IA 1VPYA 4JAWA 4LVGA 3TLQA 3ZWTA 3TXZA 1UJPA 2YLAA 4HT3A 4KCTA 1HO4A 1A5LC 5A5WA 3B0PA 4P5UA 1N61C 3M6YA 1FCBA 3S1VA 5H6HA 1UZHA 2PDGA 1P6WA 1W17A 2IQ0A 2GPTA 4FXSA 2JF7A 3UCDA 3NZRA 3UJSA 2F7FA 4EACA 2CNCA 1XIBA 1XRTA 4NEVA 4M6VA 4PEKA 3LPGA 3W7DA 1VBHA 4J2PA 1IHIA 1S3TC 1WAWA 1TX2A 4F0MA 4J7RA 3V35A 1RP9A 2XVNA 3FG2P 1UIPA 1QPNA 1HKVA 1L2UA 2OEJA 1VRDA 3UETA 1TQJA 4R27A 1KM1A 3KS5A 3QYQA 4IFOA 1BWLA 1EC8A 1QFEA 1GZ1A 1UPMB 3G1AA 4MLRA 3HQNA 1EUNA 4WK9A 1WXJA 4N9DA 2YDQA 1JRPA 1ZY9A 3MS8A 3WN6A 5G2IA 2DJXA 2WMGA 1HNYA 3SN4A 4PCFA 4UFHA 2R91A 5LYRA 2W55A 4DI9A 2XPKA 3O9NA 2GZXA 3T2PA 2EBNA 3B8IA 2OWWA 4WJ8A 4XD5A 1QASA 4S39A 3RCYA 2ESCA 3I65A 2WKGA 3VE9A 4ICMA 1XLBA 1EWDA 5G5GB 1FHUA 4WXYA 3NQVA 3TYCA 1DIEA 4JTHA 5CSSA 3IIXA 1R86A 4G7EA 4KFNA 5HMFA 1PKLA 1NFBA 4ERAA 3N9KA 4D9PA 2ZUMA 3EDEA 1CLKA 4LNCA 3TOYA 2PGRA 3NFUA 1TPEA 1XLKA 1XGZA 5LXXA 2IS7A 1LJYA 1B5TA 2X1TA 1DIOA 3WNKA 4A3YA 3NAVA 3PJXA 1SQ7A 2DSKA 2AOSA 1XINA 4M24A 1PHQA 4PB4A 4FDCB 3CUXA 1B9BA 1KM6A 3CGTA 1BEUA 2BY1A 5E1QA 5E6ZA 5G4WA 3U3HA 2CERA 1LL4A 1WZKA 4JTFA 2O9PA 3MBDA 1SO4A 2B4GA 3AAMA 4UQAA 3C2EA 1LBFA 1EA9C 1CNVA 4B3ZA 5IM51 1C8XA 2ZOXA 1J93A 1R3VA 3QY6A 3LTYA 1QWKA 2CBJA 1DJWA 3E02A 1JDDA 2ABAA 2DW7A 3NDYA 3UZYA 3WH6A 2NQHA 2IKJA 1SZFA 2R9ZA 4AF0A 3WQ4A 2GR3A 1EH9A 3VNLA 2Z6IA 1RLDA 5K7JA 1QNVA 2QR6A 1V6XA 2FPYA 1SO3A 4K39A 4LX4A 2C71A 1G94A 4RR4A 5HINA 3W7PA 3VILA 3A9BA 3BJFA 3W0KA 5AVHA 5EMLA 3VIIA 4L80A 3GR8A 4LC8A 4OBTA 4V15A 2A21A 3WKZA 5FCZA 1D3HA 4Z1AA 2DSVA 3CUGA 3MSYA 4E8DA 1FWEC 3P81A 1FFQA 2BVTA 2GWNA 3W70A 4GK8A 2XFRA 4W93A 2A3AA 1XL9A 1EBHA 4GZEA 1GHRA 1SO5A 1J79A 1MFVA 2YCIX 2BNJA 3AS1A 4BK9A 3GBEA 2OSYA 2Z27A 4YYFA 3KCLA 2YA0A 2ZZCA 1QAPA 3KAOA 1M5WA 1RXOB 4KWWA 3BAKA 3MSGA 1XIIA 5A1AA 3CTLA 3VXGA 4BWLA 1ZJAA 2PTXA 4LYPA 4H4SA 4NASA 2ZKMX 4P7NA 2WZEA 3PVFA 2D2JA 2ZZ3A 1LWJA 3W81A 3WQDA 1UWUA 2PB1A 3A4JA 3NL2A 3HRDC 3KCJA 3W1MA 5H2ZA 2Y88A 5JUVA 3TYEA 2CFFA 3BCJA 2A1YA 3UVIA 3KDNA 3R4IA 4CVUA 3QW3A 2G0WA 2V6AA 3MWCA 1IZKA 2VC5A 3PBWA 5ABGA 4XWUA 2AGKA 2Q3OA 2RJHA 2C6QA 4JIHA 1RHCA 4ZTXA 4UMCA 1JZ7A 3EWBX 5A8QA 1DWHM 1RZMA 3AICA 3K1GA 5HJLA 4QDPA 1XISA 1FCQA 1ONRA 4ASTA 3N04A 3LN3A 4PCNA 3OGVA 1Q7MA 3M0IA 1M3UA 1WKEA 1V6YA 3DIPA 3NOYA 5F2MA 4JKKA 4XVEA 1JL8A 3KRSA 4C6JA 3RLUA 3FXYA 4KESA 1EXBA 2VM8A 4L4PA 1WNOA 4LC6A 3OVRA 1TVNA 1PX3A 2AAAA 1KKRA 4EE9A 3W2NA 1DL3A 2IPJA 4HYRA 2D0FA 4GXWA 1Q13A 1XD1A 3LI1A 3TE9A 4HK5A 3RHGA 3UEQA 3FA4A 2GUUA 1E1EA 2ZUUA 4WGHA 1HL9A 4DUOA 5ABHA 2CW6A 3SDOA 1H09A 2D2OA 3MB9A 4D8LA 3TKFA 1CXFA 1UA3A 2IXVA 4GFSA 4LF2A 1KRMA 2CLHA 5BYWA 1UROA 4NXKA 1QPQA 2PDPA 1IT0A 3DFYA 3A6OA 1FFVC 1UOKA 4W8AA 1LTDA 3PUGA 3PWIA 4GKTA 1B3YA 2JIEA 2Y62A 1W5OA 1P0NA 2PMQA 4HNUA 1GVEA 4H4UA 4KMQA 4PUWA 2ISWA 3DBNA 3AU6A 3S2LA 2IKGA 1XGDA 4BF9A 1Y7VA 1PYFA 2NVKX 4AEEA 4S2CA 3WQFA 4UTTC 1EUAA 2J7BA 4H2HA 3DDMA 3PAOA 4JGDA 4ZSTA 2X1IA 2H9AB 3G77A 2DIJA 3WNMA 1F6YA 4JXCA 3AUOA 1EJUC 3LLDA 2NVAA 1XUZA 1NAL1 1WXYA 3VDBA 3URQA 5BOOA 1UWIA 4FOKA 4CN6A 5U4NA 3LMZA 3ZXWA 4MJ2A 3NA8A 5M5DA 3NZPA 4HCDA 4B5UA 4HP5A 2Y5EA 4AH7A 3KRZA 1OBAA 5C9WA 4DJED 1A5MC 3P0WA 2G50A 3UG3A 4D72A 1AD1A 4UTTA 1ZFJA 2DDXA 2WMFA 2UY3A 1VRXA 3URBA 3W2UA 3AZTA 3TDFA 4UTJA 3TN6A 3WH5A 1R7AA 1XLEA 4NZ1A 4RJEA 5LNUA 1XH0A 2X41A 2HEJA 1FH8A 2PTWA 1O4UA 3WLLA 3GDKA 3LENA 3M4HA 3GFYA 1GETA 5E9AA 2NXIA 3NQ8A 4GXPA 1TUFA 3GG0A 2ON3A 5CSUA 1QU4A 3L0GA 3VOGA 1V6VA 2PWVA 1L9WA 1OFBA 4QEHA 3N29A 1K1DA 3L4XA 2JK6A 3GDMA 3VZXA 3L8KA 1H1NA 1BKSA 5D2XA 4FX9A 1U5HA 2GGIA 1L0PA 2INFA 3VC6A 4YHEA 3JS3A 1VQZA 1YRRA 4IQDA 1NF7A 3O05A 1POJA 4UR8A 1XYLA 1E6ZA 1OFDA 2LLEA 3BLDA 3VGEA 1QNPA 4R7OA 4ATDA 1MRAA 1M7OA 4HMEA 1LZOA 4W89A 2W63A 3GM8A 2Z00A 4D71A 1KLZA 4CNUA 4GPNA 2YJQA 1XW8A 1FBAA 1PTGA 3W88A 3WBYA 4XAZA 3U2OA 4GE8A 3I4KA 1A5AA 3WJWA 1TKKA 1PWMA 5BROA 1I6NA 4ZGYA 2E5DA 2HDJA 3DHDA 1Z48A 4AVNA 4Q8TA 3TLLA 1SO6A 3CEUA 4H7ZA 4FLRA 4XKYA 2WZMA 4C7FA 1EGMA 5IHSA 2PCEA 4ZB5A 2FZ8A 2CLIA 1ITCA 3PJUA 2CLMA 1LBMA 1S38A 1R9XA 1UWQA 1XLFA 2PWEA 5F2GA 1JZ4A 4S3CA 1W3NA 1GJPA 3LCLA 1LRNA 1NDZA 1PIIA 4FO4A 3NPUA 2REQA 4KPRA 4GX9A 3ZM8A 1DWJM 1UH3A 1GYMA 3W02A 3TC6A 4FIRA 3J7HA 1MW3A 3LBCA 1QBBA 2UY4A 3HF3A 1NP2A 4K8EA 3S1XA 4M51A 2DY3A 2Z25A 1OD0A 4A22A 2HS6A 3LI0A 4ERIA 2DQXA 2ACUA 1UQYA 4PTVA 4HZ6A 1HN1A 3EOEA 4LBRA 1S5VA 3IGSA 4ML9A 4LF1A 1DXLA 1FVPA 3K4AA 4RLIA 3H21A 4B5WA 3GXTA 2OGJA 3HG5A 1E5NA 2OXNA 4W5ZA 3LB0A 2A5HA 3NPWA 4QX4A 2Y4SA 4DLMA 3Q45A 2QEZA 4FS9A 2QT3A 3DFPA 2POTA 3W53A 2WOWA 5J8LA 4MZYA 1YXDA 4XAFA 3GDBA 2HBVA 2X09A 3LCHA 3VNYA 1RH9A 2V5DA 2X1RA 1REQB 3EXRA 2XISA 3HPFA 4AEOA 1VJIA 1GTHA 4AZCA 1HTIA 2GDQA 3T0TA 3LUTA 5AHLA 3SJ3A 1Q2RA 2PUZA 5G1MA 1H63A 1M68A 1BXCA 4YS1A 1BGGA 5AKQA 4GG9A 3NO5A 3ONCA 3OZYA 3E0FA 2Z1KA 3EGJA 1MXSA 1R46A 4MNJA 3LRMA 1N55A 2TRSA 5IFPA 1F5ZA 1Q45A 3O6YX 5EPDA 3DG6A 5FS6A 4CD4A 2VQTA 3UD6A 1LQAA 3GZ3A 2DV0A 1U5JA 1XIJA 4I5XA 3MU7A 2ZZBA 1M6JA 3EX3A 1KXTA 4NI3A 1ME7A 1ZJBA 2Q71A 2VP8A 4JTTA 1EP2A 4JHOA 2QJHA 4C6EA 1GOQA 1AODA 2FGZA 4JKMA 4Y9AA 2ZXBA 5HAOA 3N2TA 1GG0A 1DTUA 3BV4A 4DBDA 5HUOA 4FNSA 3VM5A 1W5QA 1OD8A 1C29A 5AECA 4L64A 1Z3NA 1ZBVA 1QWGA 4JCMA 2E9LA 4DBUA 1IEXA 4C60A 3HPXA 4IMCA 2HISA 3VIJA 4X63A 4LUSB 3E1F1 1QHZA 4QLLA 2DVTA 3CH9A 1W0MA 1CYGA 2Z7KA 1YX1A 1NY1A 1ZUAX 3BOFA 1IIGA 1J0JA 2VCBA 3OVQA 3OTRA 1RUSA 2WWDA 3WLIA 3SRDA 1PPIA 2FFCA 4ORMA 1QPKA 3HG2A 3SAZA 2AAQA 5FJPA 1E1FA 3NQDA 4AD5A 1AQFA 1XBZA 3QM3A 4FNQA 4UFMA 3UXAA 1WDDA 4XG1A 1E0VA 1XBXA 4RDYA 4JNYA 2EQ7A 3VDAA 5I77A 4CNPA 3LV5A 4MKSA 1JFXA 1VBUA 2CBVA 3N3TA 3CPGA 1HKMA 2VUNA 2J9ZA 3ATZA 1ISYA 4HMCA 1W1VA 5GVJA 2WOIA 1C8VA 5CGMA 1GYLA 2PDXA 4E8CA 5A6AA 3JW7A 3MP3A 1G7UA 4B2DA 1B54A 1T6MA 7REQB 1B3XA 4F2TA 1J6PA 2Z26A 5C9RA 4GC4A 2GOKA 2Q8XA 2VENA 2C79A 3N2MA 1N82A 1OX6A 3BLPX 3N17A 5ABTA 5EFDA 1Z44A 3EOSA 4KIRA 1XIDA 4LS2A 3H54A 2XVKA 3SQLA 3ONBA 2I7GA 4IJCA 4Z1YA 1JCLA 2C7FA 4KPLA 3BLIA 1JYXA 3GD4A 2DZSA 1RALA 3EWXA 4U3AA 1KCXA 4CD8A 4IPPA 1PHWA 4DUWA 4E38A 2C14A 4PRRA 4BS0A 3QJAA 3GWQA 1Z42A 1JAKA 3GLCA 5HNTA 4H9TA 1UKSA 2ADAA 5JIPA 1SFLA 3WNNA 1RJRA 3CZ8A 3GYEA 3WNLA 2PDLA 2NZLA 1ECQA 2IQDA 3IJDA 4M29A 5G5HB 1LVLA 2OODA 4DF0A 1GOKA 2J25A 1RLCL 2OX4A 3TMQA 3H26A 2O7SA 3BW4A 4Q3MA 4O19A 1E6SM 4I6KA 4XAGA 1GESA 5ABFB 2VEMA 3GG7A 3ITVA 1TV2A 3FGCB 1LOLA 3B97A 3RU8X 1FDJA 5HK4A 3C3UA 3DYPA 1UR8A 4MMWA 5KINA 4KF1A 1OCBA 1TZZA 3MBFA 1ZLPA 3H55A 5C54A 4I7VA 1F3WA 3GNPA 2AKZA 4R7WA 2CZ5A 1NFGA 4H4TA 3TTSA 1IXQA 4IF2A 2QCDA 3MSRA 3IK2A 3T40A 1XIHA 3GHTA 3B3DA 3UR7A 5T8GA 3RAOA 2GVEA 3TSMA 2QPUA 4Z1DA 3M0YA 3UWUA 2O9RA 4S3KA 4XZMX 4CKQA 1MFUA 1E55A 3G0UA 3ZLFA 1TCMA 3AOFA 1HIZA 1RK6A 1UC5A 3QHNA 5HXMA 2BHZA 4U2YA 1Z9AA 3IUIA 2W27A 2GH5A 2C15A 1H7WA 2W54A 3WF1A 4TIMA 2FJUB 1K8YA 3A23A 2FB3A 4A29A 4L7ZA 5AC6A 3O7UA 5AZ0A 4PUMA 4HA1A 4GMEA 2ABBA 4B5XA 4H4PA 3QZEA 1ISVA 1XDJA 1MUMA 1JROA 3NQGA 4NYYA 4F2BA 4JTIA 3WMSA 3FYPA 4RXGA 4PTWA 3EX4A 2EJ1A 3E12A 1NDAA 4JOMA 2JFEX 3N3MA 4WX2A 1A0CA 2TSYA 4CNTA 3KBMA 4JHMA 4DWSC 4B5VA 1ZRQA 2YA2A 1PB0A 5BXRA 1R85A 2CLFA 3TTQA 4FPSA 3FXGA 3SN1A 3Q65A 1XIFA 3F5KA 4Q4MA 5EMMA 4DWSB 2E67A 2AMXA 5CAHA 3EDJA 2W91A 2VFIA 1W31A 4I8DA 2SFPA 4A21A 4K7ZA 4XD4A 2RAGA 4L65A 5GJMA 1GVFA 4EPDC 3LSCA 2JEQA 3LCIA 1DJQA 1MQPA 2VFGA 1VFFA 4UMAA 4TX9A 3RM4A 2Z1BA 1W5PA 2ZRVA 4GRSA 4XBJA 3WD2A 4X9YA 1VEOA 3WELA 3G6LA 3VCNA 2BS9A 3MI6A 7CGTA 4Z0SA 4C1NB 1A0EA 4GI8A 2D24A 3N19B 4O1CA 3H23A 3NYZA 3BWWA 1P6BA 1XDMA 4GH1A 2IXUA 2B7OA 3BARA 3UXKA 4JQAA 2ZZ5A 3PTQA 1TREA 1GRAA 3CZLA 3KBJA 3H2AA 2BG5A 3TK7A 5I07A 2H3BA 1EPXA 3I4EA 3BW3A 4PB5A 2ZC1A 3UZ5A 1D8CA 4QJ5B 3NZGA 5KZEA 2VGFA 2EXOA 1HJSA 4H50A 2F2HA 1Q5MA 2FTYA 4JFWA 2GR2A 3OJGA 1VD6A 5CZTA 4V33A 1SPQA 4O4VA 4RNIA 1UZDA 1TYTA 4CD5A 4DBSA 1JDFA 2H90A 3M5VA 3TYZA 1S5NA 2ASHA 4WJEA 3IS4A 2WM1A 1SJDA 2HCVA 4Q8MA 1IT7A 2Z7GA 1IR2A 1V3IA 1LOSA 3B06A 4MG4A 1PKMA 6XIAA 1TA3B 2ZUVA 1VLWA 4W8BA 3PNZA 1WXZA 4XTIA 6PTDA 3ZIZA 4DAIA 1FKWA 3L23A 3QKEA 2JGQA 2PLJA 1H5YA 1B3WA 1QW8A 1QHOA 3QTPA 4LVDA 3NPVA 1ZAIA 3NQ7A 3F2DA 4XB3A 4US5A 2QPSA 1FWSA 3CB8A 1RK5A 1TRDA 3TYAA 3W29A 3FSUA 4AZHA 3AJ7A 2R1MA 3O63A 2VRQA 3LCXA 1EX1A 1OZQA 4JYDA 1J10A 2A0NA 2OGYA 1YADA 3SZ8A 3II4A 2QJGA 1WBJA 4EMJA 4NJIA 1AG1O 3LX9A 3POHA 4GWEA 2ZVIA 5U7SA 2WOVA 3N6HA 4LUIA 1QI5A 4ZE5A 4MB1A 1JR1A 3ZR6A 2XIOA 2Y7EA 3S9ZA 4U33A 4K8DA 2QHAA 4YNGA 1E0XA 3NVZB 4C6MA 1W3JA 4F0SA 1BYCA 4H9VA 4G7FA 2NUWA 4PL2A 1DIKA 4A35A 3SCTA 5CBBA 2V5KA 3BCDA 4INFA 1Z7AA 2Z24A 2ZXDA 3ZJ7A 3VOFA 3WLMA 4EPBC 1TVLA 2NLIA 3LHTA 3O6CA 4K1GA 2WMIB 4XIAA 1W8SA 1CDGA 1ODUA 2GFTA 2PODA 4JN8A 4QE4A 1LLOA 4NHVA 3IJQA 3OA3A 3KOZA 3G8RA 1Y5WA 4OGZA 1K4QA 3EOLA 1G67A 1VYPX 3B9EA 4C6BA 5EY5A 1L6WA 1DKWA 2VZSA 3PPGA 5JH2A 3VPLA 2ZBTA 3FY1A 3BGJA 1MRQA 4L1GA 3WEOA 3GQYA 4R9OA 5C6MA 5KVIA 3O8AA 3UERA 4MFEA 4M6QA 5FEZA 5A6KA 4M52A 1EHNA 3NG3A 4HNOA 3B4UA 3BAJA 4P7RA 2QXWA 3GVRA 1FWGC 1Z89A 5PTDA 2V3GA 3MMWA 4UQEA 1B4KA 4LUYA 4AW7A 1B9ZA 2DZTA 4KETA 1EJSC 2PCQA 2R1PA 4FHAA 4PL1A 2VO5A 3T05A 2QV5A 3F03K 4OBRA 1JJKA 3EDDA 4KH2A 2I5QA 3N9RA 4A3UA 2QJIA 4CNNA 1WYGA 1HT6A 1JCYA 1BF2A 4UZUA 3BC9A 3GFZA 3P93A 2PDQA 3HQOA 4XD3A 2EJAA 4WEVX 4J3ZA 4PODA 3CQHA 4FR6A 3CHFA 5E5CA 1L8NA 2VFEA 2QVNA 4X9SA 2J75A 3VUSA 4WXZA 1KB3A 1UR9A 3WQGA 2RGMA 1FWTA 1VIZA 3IAPA 3AUJA 3SADA 4Q8OA 5LHEA 2QUMA 5JRBA 1PKNA 4HK6A 4GI6A 3H7UA 2QF7A 3HGSA 4NKCA 5JCKA 2VC6A 5FJIA 1WKYA 3URNA 2NX1A 2PGWA 2ZXQA 4PFMA 2BY0A 2OT0A 4ACZB 2VEIA 5HQEA 1QT1A 1OSEA 3GYCA 3WBEA 1WUFA 1M1BA 2F61A 3GB6A 2VX4A 3QQWA 2DH2A 2E6AA 2XGBA 4KRZA 1VFTA 3W1LA 3T81A 3LEPA 2Z1XA 2FPTA 1R3QA 5DEZA 1XPYA 2FMNA 3PNUA 1JZ6A 1TWWA 5SWUA 3R89A 5DCDA 2X40A 4LEQA 3OPSA 1B4EA 2EO7A 2WMJA 2BB0A 5HNRA 1CENA 2C19A 4AHQA 4IIGA 3EMQA 2O9TA 1EQCA 3SY1A 2PSNA 1VAHA 3FV9A 1ECEA 1OX4B 3MYPA 3DGRA 3MJYA 3ARVA 4UR7A 1HF6A 1ME8A 2TAAA 1ZBCA 1UWRA 1FWJC 3LHYA 4MHBA 4AISA 9XIAA 5FEWA 1YNYA 2PP0A 3GDTA 1E72M 3P2VA 1KTBA 3RGTA 3HGJA 3EF6A 1X1ZA 3R13A 1Q8AA 1JZ5A 1EKOA 4NF7A 2HROA 4CU6A 2RJGA 1EZWA 4PMDA 3W84A 1XBVA 4N2YA 2EG6A 3U8GA 2TPSA 3SCRA 3TCSA 1T41A 3W1RA 4ZQOA 3QH2A 1KA9F 3OLEA 3MZ2A 4MWAD 4D1JA 3S5NA 3H4GA 1RBAA 1CEOA 1S2TA 5HWMA 3AHXA 3S1WA 1EEPA 2VRJA 3AFBA 3HG4A 4MB4A 1P7TA 2DW6A 2FYMA 1FQ0A 3O16A 5EMYA 2BC1A 3S6DA 4G9PA 3KZSA 5LKYA 4GKLA 1VYRA 4D6JA 4IICA 4P7QA 2A3LA 5I3FA 5K3VA 2J74A 2E8ZA 1IF2A 2Y61A 4IHCA 4AY1A 1SYTA 1AVAA 1OGGA 1JGMA 1UHVA 4KCUA 3W38A 2IKHA 3MWAA 1X6NA 1TWDA 2Y7GA 4J3SA 1XSKA 4LUTB 2QKFA 2I9EA 4JYEA 4LUJA 3DJJA 1LL7A 2HXUA 3HFYA 4EMIA 4QE5A 1HKKA 3GIYA 1P1MA 3OG2A 3N2BA 4A2SA 5KTLA 4WQ6A 1LWHA 5HNNA 3SY8A 3R43A 3UPMA 5DT7A 2CU0A 3ITTA 3WQPA 1D2KA 3WUFA 4NI8A 4W87A 2FZMA 5AN7A 5HMEA 2VFHA 2FH6A 1A5OC 4ZOCA 2G3IA 3RFAA 5CGTA 5KVHA 3G8EA 3EB3A 1B0IA 3T8LA 4PSRA 4JZ5A 2GK1B 3FYYA 3CHVA 3DUGA 3V1HA 1D7YA 1SMDA 1K9DA 2G37A 1BQCA 4IGSA 3H7RA 4YCPA 1TQXA 2ZE3A 1DJIA 3AXKA 1NHRA 2OWXA 1F4HA 3S5SA 5I3JA 3W6YA 4PYSA 4JTJA 5CZKA 2Z29A 4GY1A 4NAFA 4LYKA 2C3DA 1VB9A 3R0UA 4EQWA 3MC5A 5CSYA 3HJEA 4DJDD 1GHSA 3H6OA 2VR5A 5I06A 2E4TA 3I6EA 4UTLA 3E2RA 4JL2A 2X8CA 3OIXA 3LSBA 3EX2A 1W3IA 1BSIA 3S0CA 2RDUA 5C9XA 4O0ZA 4JFSA 3KDOA 1V51A 2IKIA 1N5XA 1EQPA 4ZB2A 3TQKA 3URHA 1KTCA 2FIQA 2HSAA 3DECA 3NGJA 2Q02A 5D4YA 3WUEA 5FF3A 1VP5A 3NL5A 2CEQA 3V5FA 2X0SA 3M6DA 1LF1A 3MUAA 4RZ4A 1YYAA 3LHWA 1QNOA 4RE2A 1FP9A 1OYBA 1FWWA 3RMEA 1YPXA 4PUEA 4QNEA 2MUCA 3DXIA 4PFHA 2XN0A 2GJXB 1CX9A 3RMJA 2GL5A 3CC1A 1XGEA 4Q8UA 3P80A 5JQ9A 2BXZA 4ZQCA 4F79A 2Z28A 3SUSA 2AL2B 2PC8A 2UBPC 4JR5A 3U2CA 1UP0A 3LZ3A 1NEYA 8A3HA 3MUIA 4IH3A 4WDUA 5HR7A 3ZVHA 5BRBA 2VD8A 1HG3A 2REQB 2A8XA 4JX5A 4HOZA 1SZEA 1H62A 1HKWA 2VZVA 4EVZA 1K03A 4BQ2A 2B7PA 3ZFHA 1LDCA 3KRBA 1Q1RA 4CQ8A 4MJMA 5LNRA 4CU8A 4K68A 4EXBA 3KP1A 1JCXA 5TR3A 3EWZA 4ZO8A 4WRHA 2QAFA 2QW5A 2VGBA 1DHKA 3EWCA 3OBAA 2OTDA 1YW1A 3SCOA 3UG8A 1HKJA 3U2ZA 2GGJA 1ODZA 3LHUA 3WK1A 4DBWA 1HZYA 2PRMA 3GAKA 4JL1A 3PJWA 1T0OA 2E09A 3M07A 3N9SA 5HMSA 1MWOA 1IGWA 1VBRA 1W5NA 1RD6A 3GVVA 3KLKA 4NJJA 4UBPC 5T9CE 4M81A 2WHKA 4N7QA 3M5YA 4UZSA 4IL2A 2BP1A 4Q33A 1E43A 5A2BA 4TV5A 3QYSA 2DZPA 4ML4A 3LM7A 3BH4A 2E0PA 3DHUA 5C2GA 5TAOA 2JKPA 3BZJA 4HCHA 3K1DA 5MKGA 3OW1A 3FNDA 4ENLA 1OG0A 5J04A 3C2RA 4WGXA 2GJLA 3JRKA 5EMKA 5AHMA 3T0BA 5D03A 5I2UA 3CQIA 3PUEA 1WOBA 1JI1A 1H0GA 3WD0A 1VJZA 5T91A 2VYOA 4TTGA 3S2NA 2J7CA 2GJNA 3L5LA 3UJ2A 3WSUA 1BG4A 3ZLHA 2Y7FA 2UZ9A 4E4FA 1UH4A 3PZ9A 4ZQRA 2Y8KA 3BGAA 2O9OA 5A6LA 1GQNA 2GSHA 1X8CA 4BY3A 1KQZA 4R88A 4DJFA 3EWDA 1DWFM 4KCWA 1KFBA 1B3VA 6A3HA 4HB7A 4RX0A 4JIQA 1ISXA 4DNHA 1XLAA 1YE6A 2DSUA 4KFOA 3WLHA 4K7YA 1FXQA 2ACSA 4DYJA 1W2VA 2FPVA 1TYGA 4W85A 1VBGA 1AOGA 4E3TA 1U5VA 1U83A 3B8VA 3RRXA 2DIEA 2VTFA 3FX4A 5EBKA 4AXKA 2I56A 5FKYA 3B8TA 3MHFA 6XIMA 3UR5A 4J3XA 1JCMP 3BSGA 1W5MA 4A8LA 5DY2A 3ZO9A 4G56A 4UWMA 1CIUA 1XFCA 1ADDA 2D2GA 4H2CA 2R8WA 1W1IE 4UOJA 4H8VA 4Y9PA 1UD3A 4RZ5A 3HPAA 4DXKA 1IZCA 1XCFA 3DFTA 4NAEB 2YL9A 2BGNE 4EAYA 1PSCA 1LLWA 4J9JA 4OOUA 5A8GA 1W9UA 4DRSA 5EFFA 4ROQA 4GLEA 4DJEC 3PULA 5AYYA 1E0WA 3QN3A 4LY4A 1R3YA 2NWSA 4AC7C 4O10A 4IXXA 1DQWA 2V3DA 4H4YA 4K7VA 2YXGA 1TRIA 4AWSA 2W3ZA 1GEHA 4BQ5A 4NU7A 4J40A 2V3EA 4YVVA 1FWNA 3SSZA 4O1BA 4FOUA 4R34A 1TWZA 1UZ1A 4NG3A 5GQBA 2E3ZA 5JVLA 4FX6M 3MMDA 3G3MA 1ICPA 3I3BA 1EOMA 1CT5A 3L2LA 5FJOA 3W7OA 3OZPA 2PDYA 4MKVA 4XUYA 2VQUA 3I3EA 2PLMA 1EYWA 2XH0A 3TA6A 1OCQA 2O7QA 3FFSA 4RUBA 2WLYA 2ZTKA 3BW2A 3GHSA 3N12A 2EPNA 3R79A 4K3ZA 3RN6A 4DYEA 4QHRA 3TTYA 4OWGA 3LXBA 2RDTA 3DC8A 3H53A 4HTBA 4PGLA 4LAUA 3B8SA 4OKDA 5AC4A 5I0DA 3CUHA 3VIKA 5I24A 1GT8A 1EYEA 7XIMA 4ZO9A 2NQ9A 1E1CB 3ZJKA 4W88A 1AH0A 2RDWA 3WFLA 1E9LA 3QTGA 1AMKA 3ZJ6A 3CIWA 2QMJA 1QI4A 3S9YA 2E1DA 3ZT7A 1ZMCA 1UWAA 1P6CA 5D2VA 3SCQA 1EJXC 1ZCCA 1CW2A 3VKCA 3VX0A 3TYUA 2WKJA 3JU2A 2GSEA 3TONA 1HL8A 3EWUA 3R2GA 4Z1BA 2H8XA 2FDMA 4XAYA 3NRZB 4H83A 4Y96A 4H9XA 4JIRA 3AIWA 4PUNA 3UPWA 4ADTA 5EKYA 3M0VA 4V28A 3CASA 3SUUA 4LS1A 1ZK7A 3OZMA 1T5AA 5HOSA 4NZ4A 3EDKA 3SQMA 1GVOA 4U28A 3LPOA 4P8WA 3WG6A 5AC5A 3LV6A 1U1HA 4GVFA 2MNRA 3B03A 4P8XA 5LSMA 2UV8G 5EB8A 4PMRA 4GO8A 3EPOA 2OFJA 4IMGA 4Z2HA 1JRCA 3C8FA 5BWFA 2ACQA 1CXKA 1YTEA 4DF2A 2WSYA 4PC8A 3K8LA 4Y90A 7A3HA 2EKCA 3MPGA 4URIA 3IJ8A 4HNNA 1DJXA 3HZ3A 4QE1A 1VENA 1DWGM 4GYPA 2OX1A 3F2CA 1TV4A 2DUAA 3G5EA 8RUCA 3E0WA 3ORWA 3A5FA 1E3ZA 5DMMA 2ZUNA 1RJPA 5IBXA 5CH9A 5B80A 3KEHA 3N13A 4M1BA 4ILSA 1SSDA 2VOTA 1TPVA 3LYEA 3CAWA 1XFBA 4QG8A 1NWRA 4GIAA 5AYIA 1NPXA 4L6DA 1SUXA 4WSKA 3W1UA 3INPA 4ZCWA 3E2QA 5CZJA 2D69A 2X42A 3S9IA 3RRAA 3BV7A 3HGOA 2R6OA 3DERA 5D05A 1EEXA 1DWIM 3O1NA 3AS2A 4CGTA 3E6EA 4HU4A 1THFD 2WZHA 1GPWA 2ALRA 3AYRA 5MF5A 3WD1A 3VDCA 3PBVA 3U4FA 2NWRA 2HNEA 8TIMA 1CXHA 3R5EA 2QCGA 5EA9A 4O0QA 2ALDA 4X0NA 3SJNA 1GOWA 2VX6A 2P0IA 3NOEA 4HVXA 5IXEA 5U25A 2Y7DA 1N60C 1GVYA 2BLEA 1PS9A 1BRLB 3WK3A 3GUGA 3A3HA 2BASA 4Q8QA 4AXNA 4E4PA 1XC6A 3HBLA 4X22A 4XO6A 2ZC8A 1ZHAA 4V2XA 3TSDA 4F66A 3H4WA 1TWSA 1BG9A 3PZNA 4HMNA 2WOQA 2P10A 1JCTA 2F9RA 2W4XA 5F4SA 1TR1A 2QJMA 3ZZ1A 4IIDA 1GKRA 3PG9A 4GJ1A 1P0DA 2GDVA 4XX6A 3LK6A 2OLSA 3WO8A 4DLFA 4UMBA 3ZMRA 1A5SA 4B9ZA 2GVGA 1QATA 4BI6A 4AWEA 1GOXA 4X2RA 4YWIA 3KOXA 2EGZA 3PN8A 3S5ZA 3ABXA 3RG6A 1PZ3A 3CZKA 3SR6B 5HQMA 3BANA 1L2QA 2VEKA 1G0CA 4Q6JA 3REQA 5BCAA 1Q6CA 4RV8A 1E9IA 1MUCA 4UFKA 5FOOA 5CSRA 4XVDA 3EUB3 1GKPA 4DO4A 3PFMA 1IQ8A 1BZLA 4AMAA 3UY8A 2J62A 1VCVA 4A3RA 2A3BA 1KFJA 1WKFA 3KBVA 4UNLA 3C0QA 1CLVA 1W1A1 2W6RA 2P8CA 2G4FA 3LOTA 4TV6A 5DBUA 2O55A 5HDRA 2VWTA 4XIMA 1C92A 2V67A 1ICQA 1Q6DA 3AISA 3WNOA 1ZXIC 5A6MA 1SSGA 3F4CA 4L5ZA 2YCLA 5I03A 2H3DA 3PY2A 3D3AA 3ARRA 3NXFA 3D3FA 4ZEPA 3WF2A 4CLMA 2XH2A 3UR2A 1KCZA 2CHNA 3UF9A 3MMTA 1UQZA 4PMXA 2Q8LA 4CQDA 3A24A 5I5RA 3S47A 1MW0A 4ZZ9A 4MDOA 1B31A 4QDWA 5GRTA 5IOBA 1VHNA 2YVGA 4REQB 3F5JA 3R7MA 2WC3A 4ZBCA 3VMOA 3KE0A 3M9YA 3ZVIA 5CC6A 4ALDA 3LHZA 4OT7A 4GY0A 1JUKA 3AIQA 2TMDA 4LBUA 2PDKA 1Q7QA 2YBTA 5A2AA 3W9ZA 5AFDA 4L4LA 2J79A 2CWNA 2EQ9A 1KFLA 3BOXA 4ERGA 4GZIA 3UW6A 3O6AA 5M1TA 2YYUA 1TJ2A 4H4RA 1XSJA 1E4MM 3BAXA 2J24A 4TVUA 2VKZG 3DENA 1QCWA 5AZ1A 1XHCA 1E15A 4N9CA 1DWAM 5AC7A 5DMYA 1XHGA 1KKOA 1POKA 4JY9A 5G4EA 5A6BA 2GQ9A 5DT5A 1F2JA 4XBKA 3QOKA 3CU2A 1US0A 3W7LA 2PAJA 1VFSA 1AQ0A 4HD5A 1EIXA 3GVQA 3MKCA 1PBGA 2PI6A 4NJHA 3V1PA 2NVCA 1W8GA 3TJ4A 1TG7A 2J47A 2QV4A 4GUFA 3I7RA 1XCXA 3KTSA 4WOZA 1Z69A 1F3PA 3RPDA 4J2MA 5CLTA 2WYSA 3GE7A 2HQAA 4ZQPA 2OZTA 4QITA 5AB3A 2C18A 2PTDA 3GXMA 3HMJG 5F2IA 3L66A 3IAQA 3SCSA 3ABOA 1WUEA 2OEMA 3IV3A 4IG2A 2YKKA 4PZVA 4MNLA 3ARQA 3CZEA 4O8AA 1X1OA 4DZAA 1A3HA 1PDYA 5F1VA 1FHLA 2C3CA 1H41A 4C1LA 1JDEA 2YZRA 4BFAA 3GG1A 1JPHA 2VXNA 2DZVA 3PHAA 3U2EA 4PMZA 2Q01A 1Q63A 3K5XA 4RXFA 2Z1SA 2J7DA 1XYCA 2BMBA 4JTSA 1R2SA 2CIPA 3QV6A 4CQAA 4RDVA 3BCFA 4U5KA 3GD6A 3KVJA 2I5GA 3O0FA 1F76A 3VGFA 4AYSA 4XBSA 3VDGA 4H19A 1QDSA 2QGYA 1NM9A 5CG7A 3F2BA 4C6OA 1XXXA 2E6FA 4LY8A 4GXMA 1MI3A 2V8ZA 3TUUA 1XI3A 2OJPA 4XSLA 3P74A 3NQCA 3WDIA 3IARA 4QAIA 5DXXA 5I7GA 1SB3B 1YDVA 5DXYA 1MMFA 1DEDA 3BMXA 3VGBA 1IT8A 4IIEA 4JX6A 3AC0A 4ZO6A 4QRNA 4JFTA 4JNMA 2GGEA 3CQJA 4TMBA 1RA5A 4DM2A 2DT2A 1F8WA 2E9BA 1K8CA 3AXHA 2XFWA 1XP3A 5AVNA 1DVJA 2XDFA 4PMJA 4WZHA 4GR1A 3HPZA 2E8YA 4S3FA 2JK2A 4E3VA 4NEWA 1VKFA 1KXVA 5D02A 1R6WA 1GJUA 4QTGA 1PEZA 4H7CA 1MZRA 4NYUA 1M7PA 4KEMA 4ZOEA 2D22A 4EM3A 2R82A 5D2TA 1Q65A 1MEWA 1VS1A 4R3UA 2XIIA 3RK8A 1KM0A 4NZCA 1W1YA 1TTPA 2WBGA 3VA8A 4U3CA 2BXYA 3H12A 3JZEA 3C56A 1AFSA 2IMRA 1KGXA 2Y70A 2VC9A 1F05A 3QR1A 4UCGA 4WKAA 1QI3A 4GABA 4QQ3A 1UD6A 3GDLA