3IJQA

Structure of dipeptide epimerase from bacteroides thetaiotaomicron complexed with l-ala-d-glu; productive substrate binding.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
337
Chain Sequence
MKMTFFPYELKLRHVFTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTPDVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIHWLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRFKGVEVVNGKITLNDLPGIGVMKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Muconate cycloisomerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 107
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 5.1.1.20: L-Ala-D/L-Glu epimerase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ijqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ijqA01
3VCCA 7ENLA 3SSZA 2AKMA 1SJDA 4DHGA 5BOFA 4J3ZA 3SBFA 3NO1A 3FJ4A 3FYYA 3MZNA 3RO6A 3CK5A 2ONEA 3THUA 3N6HA 2P88A 4G7FA 1MDLA 3N4FA 4HCLA 3MY9A 1ECQA 5FJUA 2PU1A 3K1GA 3TJIA 2PP1A 4E5TA 1SJBA 3JW7A 4J1OA 4HPNA 3N4EA 4IZGA 4MGGA 3Q45A 3ES7A 4K2SA 3PK7A 3T6CA 1R0MA 4F4RA 3RGTA 2GGEA 4G8TA 2FYMA 4ZA0A 2MNRA 4GGHA 2OQHA 2PCEA 2XH2A 1WUEA 1TKKA 2ZC8A 2GGGA 1EC9A 3CT2A 3BSMA 3UJ2A 4GIRA 3IJLA 3NZGA 1JPDX 3UCCA 3RRAA 1EC8A 2PP0A 3ENLA 4HCDA 1MUCA 4KEMA 2O56A 4MMWA 2OVLA 3EKGA 4H83A 3FVDA 2OFJA 1MDRA 2XH4A 1EBHA 4M0XA 3JVAA 1XS2A 3ZVHA 2NQLA 3IJQA 3GC2A 3UJEA 3V5CA 3TW9A 4EWJA 3QTPA 3RITA 2XH0A 3DG3A 2QDEA 3VC6A 3TCSA 3VA8A 2PPGA 3UXKA 3SN0A 4IL0A 1FHUA 3OPSA 3U4FA 3UXLA 3R25A 3D47A 3QLDA 3R0UA 2PGWA 1JDFA 3DGBA 1DTNA 2OKTA 3MSYA 4GYPA 2P0IA 4IP5A 1YEYA 4HNCA 3IK4A 3ZLHA 3U9IA 3ZLFA 4HN8A 6ENLA 3TWBA 2OX4A 1RVKA 4Z1YA 3PFRA 3NXLA 4IP4A 2AL2B 3ZLGA 2GSHA 3ZVIA 4KT2A 1KD0A 2GGHA 2POZA 1KKOA 4E4UA 4FI4A 3SN1A 2ZADA 1P48A 2QQ6A 3FV9A 2QDDA 4E8GA 2PTXA 2HZGA 3DEQA 5J04A 3B97A 2AL1A 4HYRA 2PU0A 3UJRA 2P3ZA 2HNEA 4ENLA 1JPMA 4JN8A 1NU5A 2P8CA 5FJTA 3TWAA 3TQPA 5FJPA 1XPYA 1KKRA 3H8AA 4K1WA 3IJIA 2QVHA 3I4KA 4HCHA 4GGBA 3DERA 1FHVA 2OO6A 3V4BA 4KWSA 2PTWA 3R0KA 3TOYA 3VC5A 3Q4DA 3CXOA 4DX3A 1EBGA 4GISA 3CYJA 3PWIA 3N6JA 2OQYA 3QPEA 3BJSA 1E9IA 1L8PA 3RCYA 2QJJA 2XH7A 1PDYA 1F9CA 1EC7A 3QN3A 2MUCA 3SQSA 1WUFA 2GGJA 3HPFA 2FKPA 3MUCA 3FXGA 3SN4A 2HXUA 2OZ3A 2OLAA 4M6UA 3VCNA 3MQTA 3OZYA 2P8BA 4DYEA 3FCPA 2PODA 3R11A 4DN1A 4A3RA 1SJCA 3R10A 3BOXA 2PP3A 3H7VA 3QKEA 2DW6A 5IDZA 3PWGA 5EU9A 3T4WA 3I6EA 2HXTA 4ZCWA 3CAWA 1SJAA 3KUMA 4HNLA 3SJNA 1IYXA 3T8QA 4JN7A 3MWCA 3DG6A 2AKZA 3H70A 1BQGA 2QGYA 3GD6A 4MKSA 1R6WA 4GFIA 3DFHA 2OZTA 3T9PA 3OZMA 3VDGA 4IL2A 3R1ZA 2PTZA 3ES8A 3GO2A 1OEPA 3D46A 1TE6A 2GDQA 2PS2A 1BKHA 4Z17A 2OPJA 3MKCA 3OTRA 3H12A 1MNSA 2PMQA 4A35A 3TJ4A 1PDZA 4ROPA 5BOEA 3DESA 4A6GA 4KPLA 1ONEA 2QJNA 2OG9A 2RDXA 4DXKA 3JZUA 3GY1A 3P3BA 4GYPC 3TTEA 4H1ZA 3VFCA 2XGZA 1NELA 4K8GA 1ELSA 4IHCA 2PGEA 2PSNA 3STPA 4H19A 2CHRA 1MRAA 2PTYA 5FJRA 1W6TA 3DDMA 1JCTA 3S5SA 2I5QA 5ENLA 3V3WA 3RR1A 3P0WA 4IT1A 2GGIA 1P43A 3DIPA 3V5FA 3UGVA 3OP2A 4GMEA 2XSXA 3P93A 3I6TA 5FJOA 2GL5A 2DW7A 3EEZA 3OW1A 3DFYA 3UJSA 3ZVHB 3UCDA 1KCZA 2OZ8A 3DG7A 4E4FA 2QJMA 4YWSA 4FP1A 4JHMA 2AL2A 1TZZA 4DWDA 4X2PA 4H2HA 4E6MA 3S47A 3UJFA 2PA6A 3CB3A 3NFUA
chains in the Genus database with same CATH superfamily
3VCCA 3N3MA 3GIQA 3UZYA 1PXGA 4LY4A 1RPKA 1TYGA 2QMJA 3ISIX 2NW0A 3RNMA 3QGKC 3WELA 3WLRA 1GQNA 3LD5A 3VOCA 1V8EA 3LLFA 1B9BA 1ZP4A 3MUY1 4CQAA 3NQFA 3ITXA 1LQAA 2J8GA 1FCVA 3W37A 4LUTB 4QG9A 1S3HA 1ECQA 5FJUA 1TMHA 5G5IA 2QUTA 3HIJA 2JALA 1P0NA 3D0CA 2P0OA 5JXQA 5A2BA 3SJ3A 3DC0A 5CPQA 3ATYA 2DZUA 1GZJA 3PWAA 4F4RA 3PG9A 2OWXA 3PZTA 1BWKA 4UOZA 4UFLA 1RPXA 3VZYA 3W7OA 5CC3A 1G6CA 1BXBA 3QY8A 1O95A 3UPMA 1T96A 4AIOA 2V5KA 2XU2A 3FN9A 3MV01 4PCTA 1SMDA 1V0KA 5DBTA 4AW7A 5AECA 4A8LA 2PD9A 3W24A 4IUGA 1MW2A 3AYTA 1QMLA 3AYSA 2B7QA 3BW2A 4IQJA 4EPBC 2OVLA 3EKGA 1IE7C 3I4EA 1I0BA 1MDRA 2L5HA 4IGHA 1FDZA 4POCA 1OX5A 1J0HA 3CL8A 4AD4A 5I79A 1UG6A 3SY1A 2WMIB 2DUXA 3DKJA 3V5CA 4ERIA 1UP0A 3VIHA 3BQ6A 1MW0A 4Q7NA 4EWJA 3ZJ6A 3PZIA 1ISWA 2NVCA 4JDYA 4JYEA 3PULA 3UXKA 4W8AA 4Y7EA 3G2GA 3EX4A 5G1TA 4HNOA 3KS5A 2QAEA 3QZEA 4UBPC 2E25A 3ALFA 4O1CA 3G1VA 4PFMA 1IXQA 1EJ7L 2VWSA 3FEMA 3NSNA 3U9IA 2VEKA 1YQZA 5ABEA 4H8HA 3DXIA 1Q7MA 3AICA 4WLCA 3W6YA 1RVKA 2NVAA 2WVTA 2YPIA 4LUTA 3PBMA 3W9ZA 1AQ0A 1W9VA 5I5RA 1V7YA 1BF2A 1ZXIC 2W0HA 1SPQA 3BG5A 1E71M 4I5UA 3TKFA 3BLDA 7ODCA 1AW2A 3LOTA 1XIBA 3UVAA 4C7FA 3O3RA 1TRDA 1UH2A 1UJPA 1XW8A 2IXVA 3NJ3A 3C56A 2ZA2A 4AYGA 1GJUA 1T99A 4O13A 3RJYA 5I3IA 3MCMA 4XAPA 4YCPA 3RRXA 3UR8A 3W76A 3MO7A 5HXMA 4JN8A 3WUBA 3BAYA 4MPQA 2YR1A 5D09A 4LU0A 1AQHA 1E9ZB 1ZQ5A 3MUZ1 1QDSA 3NQMA 5D03A 1B4EA 4CUCA 3UG3A 3R8RA 5HR7A 2JF6A 5BCAA 3CAKA 5I2UA 3S6DA 4Z2JA 2FFCA 2ALRA 3EBVA 2ZUVA 2VGFA 2BNJA 2WMIA 4KWSA 2NZLA 4XZWA 4EXBA 2OKOA 1F07A 4PULA 1DYSA 3CT7A 1A53A 2V6OA 2EJ1A 3N19B 2CESA 2Y7EA 3SCNA 4QLJA 3TC3A 4E3VA 1AQFA 3EWDA 1A3XA 2SFPA 3TC7A 3W7PA 3WNPA 1W9XA 3CTTA 1B3WA 1XLAA 1WXZA 3W25A 3N2XA 2Z28A 2VDGA 3O16A 2GZXA 4DBSA 4GQQA 2A3AA 3W1PA 1TJ1A 3GG0A 1F3TA 2P8BA 2VC7A 3KVLA 2XVNA 5G2WA 3QFAA 1FIQB 4B9YA 1KLZA 5E0CA 1V0MA 4RCXA 3TMLA 5DFAA 1B3XA 1XLHA 3WQ6A 5A8QA 3GAKA 3QKEA 4BQ5A 1OJXA 5AHFA 2W79A 3TCEA 2UV8G 3I6EA 4QEEA 4OKDA 4Z1CA 3EDFA 1LDCA 4WSHA 3T42A 4HMNA 5EMJA 2ACSA 3T8QA 4S3AA 5IHSA 1BQCA 1H3GA 2J7CA 1CB7B 2ABBA 1A0CA 2WO5A 2A3EA 3SR6B 3T2PA 2HVOA 3RLUA 3T05A 1AODA 1GYLA 3R1ZA 4HZMA 4N9CA 3P5YA 1KGUA 3C0SA 4RV3A 1S1RA 1ADDA 1EP1A 3CH0A 2CYGA 3W7EA 2BVYA 1WDSA 3GLCA 5M2FX 1NAL1 4DY1A 3DESA 1OHLA 4H7ZA 1ONEA 4HBKA 3BLIA 1WKYA 3AZTA 2ZDSA 2IMRA 2YQUA 4RL3A 4IQLA 3W53A 3VKBA 1X38A 2VFHA 5H8MA 2WPBA 1NELA 4PTMA 4S2CA 4R5EA 1XLGA 1XLDA 2X40A 1QW9A 4NZJA 1TMLA 3BZGA 5GNXA 3STPA 5KINA 4XSLA 1V6YA 3VGEA 2QHAA 5K4ZA 1PX8A 1EUNA 1Z8AA 1P1MA 1ZBVA 1F61A 2ZX6A 3LI1A 4E0CA 3C2RA 3FNDA 2VVSA 3V5FA 5FCZA 1TWWA 1IT7A 3EX3A 4LV9A 4GMEA 3CUZA 3MVIA 1Z89A 3CIWA 3P93A 3AMLA 5FJOA 3T09A 3KLLA 2A79A 2FPTA 3GNNA 2QZRA 4GPNA 2YL5A 1Z69A 3SQLA 4QLLA 4L4MA 4XTIA 3VGFA 2GJPA 1R2SA 3M43A 1PIGA 2CZFA 2WV8A 5AC6A 4DWDA 1EOMA 3GTHA 5CZSA 6ALDA 3TQ0A 4JHOA 1EL3A 1Q66A 2IQTA 3RG6A 3L4UA 3MUXA 1AH4A 3NFUA 1HL8A 2FZBA 3BW3A 4H41A 2V9DA 5D9PA 3LBOA 3SBFA 4KRUA 1ZENA 1FH7A 3RO6A 3LPOA 3T8LA 4AC1X 2Z4GA 2J25A 1K70A 3PZMA 1GVEA 3CLMA 1XRSA 2ZVIA 4GE8A 1QI2A 1FWCC 4JQ3A 4HCLA 3VD4A 2E9BA 3E12A 1QOPA 3OG3A 3CZGA 4LVFA 4W9TA 2O92A 4YCOA 3MMWA 3L0GA 5I6SA 1H6VA 1NEYA 2VFIA 3ZR5A 3QYSA 2V5CA 4IIGA 4HPNA 3LCFA 3FYPA 3CASA 3WNLA 3CV1A 1MUWA 1I2NA 4A3QA 4DQWA 4PBEA 4G8TA 1F8WA 4H4YA 1SMAA 3VNJA 1YPIA 3R79A 4IIHA 3QH2A 2EAWA 2D2GA 3FLUA 5CPMA 4QM1A 2XH2A 4WRHA 4DJDA 1WUEA 3WLKX 2NQZA 3EYPA 1EGVA 4HPXA 5I06A 4G7EB 6TAAA 3V0SA 4HPHA 2D2OA 4WVXA 5I3JA 3VABA 3BXWA 2J77A 5AYIA 5BXTA 5A6BD 3G18A 4HB7A 1UR0A 3SRFA 3QOMA 3PAJA 3DGRA 1PKMA 3QFWA 1GVFA 1E3XA 4E8CA 1KC7A 3IVSA 2ZE3A 1IT0A 1LYXA 4O10A 2XH4A 1F3EA 1IWPA 1Q3NA 1XRVA 3S5OA 1JEZA 3HQ1A 2ZA1A 5FEWA 2J8TA 4LC6A 5DY3A 2NQLA 4FAMA 1TYPA 1TMQA 3GC2A 4BEQA 4B3ZA 1HJQA 3CV2A 1J93A 2DT0A 1FWNA 1QNOA 4QJ3B 2BMBA 2VOTA 1TTPA 3UXLA 3UG4A 3B8VA 4UFKA 4XD3A 4FHAA 4GINA 1JDFA 1Q6RA 1DJIA 4ERGA 1KB3A 1DEDA 3BCFA 1E3ZA 2Q71A 4YHGA 3NS1B 4LBRA 3U57A 2W4XA 4KFOA 3QQ0A 3UR5A 1X2HA 1SFJA 3W7JA 3CM4A 1H1NA 2XIMA 4YMZA 1KFEA 5KTLA 3VMPA 1A5AA 2C0HA 1KD0A 1W1PA 2D20A 2Z7GA 2VL4A 2PGRA 1R9YA 3TYDA 4TVUA 3AHYA 3B8DA 1NFGA 4Z1BA 1FWDC 4M7SA 4YIWA 4ZQRA 3DEQA 2WP6A 1SZEA 1J4EA 3DZ1A 1CT5A 1OCQA 1FBAA 3MDWA 1M7JA 1NDYA 2Z2AA 4NXKA 3U5UA 3C0JA 3GC4A 4H4QA 1O6IA 4B4HA 4NYYA 1NU5A 4HJWA 3R8GA 5BNKA 3QOKA 3I68A 4FR6A 3NQEA 2IKIA 1WKEA 3DENA 1X7IA 4MUZA 1FWAC 2WJDA 4S3FA 1VFOA 1N2VA 3M0XA 4HNNA 4O1DA 3ZT6A 3PBYA 1KKRA 1YPFA 3VIJA 3S3GA 1JZ2A 4JKKA 1A5CA 3IIPA 5EMUA 1GK8A 1R3SA 3I7RA 1K9EA 3VIKA 4V27A 1A3HA 3I65A 1JQXA 2JE8A 3BGGA 3KZPA 2PTWA 2QCGA 3CXOA 4GZ7A 5LGXA 4A22A 3OYXA 2GYIA 3GRIA 1T8QA 4W84A 1LPFA 1HJWA 1C8QA 1V97A 2VCAA 2AQWA 3BJSA 3E2SA 1L8PA 4AG0A 1XC4A 3IK2A 3EDDA 3QMSA 1KM3A 3BO9A 3KOFA 4P5UA 3DFTA 1Q6LA 4UOQA 1FECA 2E5BA 4HK6A 4I5XA 3KBWA 1K6WA 3MUCA 5IOBA 1PCWA 1ZU8A 3U3HA 1DJNA 3ABOA 1W3NA 1WP6A 3HM7A 3PPGA 3E2RA 2V63A 4HOZA 4BK9A 3SSJA 4X0NA 3JZEA 3VYLA 1R3WA 1IIGA 2E5CA 1JDDA 3G1RA 4L56A 3V35A 3NVTA 1XLCA 2J4GA 3KAOA 2ZQ0A 4ZE4A 1V5XA 2ZX9A 4F0HA 1H63A 4D8ZA 1KRMA 3R13A 2CU0A 3AU2A 3T4WA 1E56A 1I1WA 2CZVA 4MWAA 3R2GA 4NI3A 1FX6A 5JIPA 2X09A 2F2KA 2AGTA 1Y5XA 5LNRA 2V8ZA 1YDVA 3F5LA 1OD0A 1IYXA 3CEPA 1YTEA 4JTSA 3CO4A 2BC1A 3SCWA 1GWJA 3ONBA 3W2MA 1CWYA 3CIVA 2QGYA 3GH4A 5DQPA 1GOWA 1G4TA 3AYRA 2PC8A 1I4NA 3HQNA 3QY7A 3OZMA 3VDGA 1KQYA 3WUFA 3CUFA 3TDFA 3A47A 3ARSA 4D2JA 3WD2A 3LBMA 3TN5A 5LA1A 5BOEA 2FLIA 5HQEA 2GOUA 2R9ZA 2YXGA 1UQYA 1X1NA 2OG9A 2XFYA 2WBAA 3GRTA 1HJUA 3O6YX 2YCIX 1D3GA 4Z2HA 4OUIA 3WK2A 3JS3A 2OT1A 4O17A 4AHQA 3AAMA 3LPFA 3UNDA 1GRHA 4IOTA 5J5DA 5DRIA 2HNHA 4PEKA 3W1RA 3A7RA 4OTKA 4O12A 2Y5SA 1UZ4A 3LSBA 1TZ7A 2ZUWA 3R8HA 4ZSUA 2HWGA 3TR2A 1VH7A 3F4NA 4YWIA 1XIFA 3B40A 3CHDA 4FZIA 1OADA 2PI6A 5A94A 1LRTA 3LUTA 3PPCA 4PCNA 4A4AA 4PC8A 4AUBA 4DWSB 1JDEA 3M4HA 1JEHA 3B06A 3D3AA 2WOVA 3O6AA 4GOAA 4NQ1A 2HCVA 2TPRA 1GOOA 4KRZA 3E2QA 1QK0A 2WZEA 3ZVHB 1E6SM 3TQVA 1SW0A 4MZYA 1JCNA 3NWRA 1C8XA 1RZMA 3L5OA 4YWSA 4AEFA 2JK6A 4JHMA 2O9TA 2WM1A 3EMZA 2PWDA 1W1VA 1M3UA 3LENA 3PTDA 5AB3A 3SCVA 4NEVA 3HGOA 3NG3A 4CCZA 1WDQA 3M7WA 1TRIA 4RV8A 3EDEA 5KZ6A 4FF7A 4DYJA 5D9OA 3UZ5A 2VKZG 3FW6A 4UQDA 4PBGA 3IACA 4ZEPA 4K8DA 2XZ7A 3MY9A 3ZOAA 3WK1A 4AIEA 2PWGA 4L5ZA 3WSUA 1OQFA 3PM6A 3LY0A 1EYEA 4LANA 2WJFA 3ARXA 2PRLA 2V3EA 3KVMA 3E9AA 4YS1A 5JBDA 4LYPA 3THQA 1DXFA 4Z1AA 5JU6A 2QYGA 1ALDA 1LVLA 2NVKX 2V5LA 4PUKA 1GJPA 1SR9A 1P7TB 1HL9A 4IH3A 3LQLA 3GIYA 2YCLA 4S3GA 2D23A 3UWZA 1VBGA 1OFQA 3MYOA 2OJPA 2GJRA 1F6PA 1WV2A 3GYEA 1R87A 1A5MC 1V51A 4DWSA 5PTDA 4I8DA 3NYZA 4MTVA 4R7OA 2OFJA 3C5QA 5CPSA 3RN6A 2NQJA 3CO8A 1GVSA 1GEQA 3UPBA 3LHUA 1UWTA 3ZVHA 5JQ9A 3GXIA 1LLWA 4EMJA 1JPHA 1ITXA 4QITA 1Q7ZA 2WVVB 3UG8A 2XH0A 5HDRA 1KM1A 4LAUA 2ODOA 4E38A 1US2A 2D3LA 4LAZA 2G41A 4AIBA 1OX6A 1KXHA 2YBUA 3HG4A 4QROA 1UC4A 4I9JA 2I5IA 1IT8A 3N4AA 3IANA 3VUSA 2DSUA 3ZO9A 1BTMA 4WGHA 3S1WA 2AOSA 4LUYA 1HZYA 4HN8A 1BYAA 3UP8A 2QUUA 3L9CA 2TPSA 2V38A 3B8SA 3ABXA 4AHPA 2W3SA 2V68A 3AIBA 1SZNA 1F3PA 1TE1A 1FKXA 2QF7A 4C7DA 1MWOA 2BC0A 3W00A 5MF5A 2WZTA 4DXVA 2ZADA 1P48A 4PUEA 1SVDA 4M7TA 1K77A 1UWQA 4F2UA 3PZVA 2UY2A 4HZ6A 5HOSA 3AFBA 3VE7A 4FX6M 1I2OA 4Q8NA 1XGEA 3S2LA 2VT0A 5G4HC 2PU0A 4JQ9A 1YRRA 2DT1A 5CSRA 1ZCOA 4M6VA 1XDIA 2E67A 4O4WA 1JRBA 1P7TA 2Z1WA 1P6BA 3CC1A 5FL1A 4JTUA 2DZPA 2QAFA 4LWWA 1K4GA 2Z1KA 2WCAA 3R0DA 3SCPA 4A2RA 3FHQA 1LRNA 1QHOA 4ZTYA 5ECVA 2FHFA 5I77A 4HN4A 4HA3A 1H7WA 4CNNA 4D1IA 3N6JA 4RW5A 1BWLA 2I9EA 3QHNA 5DXXA 4NVTA 1HF6A 2IW0A 1JCJA 3BH4A 2W6RA 1HIZA 2IPFA 1J79A 3A5VA 4RE2A 3LLDA 4QJ4B 4ZQNA 1EJTC 4IUOA 2RH9A 3AHTA 4GO8A 3GU1A 3SQSA 4REQB 1TFVA 4PGLA 2VD8A 3OYZA 4KS0A 1Q4WA 3C86A 1HT6A 3FXGA 3MVTA 1WYGA 4MNKA 3ABRA 1A5SA 3MSGA 2OLAA 4IMEA 2OWCA 3PTMA 2G3JA 1IEIA 1RP9A 3P61A 4ZB5A 5CBJA 2H9AA 2W61A 1FY6A 2VFDA 5T26A 1EYWA 2AAQA 4HKPA 1M41A 3VX1A 3T08A 4GZJA 1IWBA 1XCXA 2PDIA 5K2ZA 4WOZA 2DV0A 2Y1HA 3PBWA 4Q7IA 3CTLA 3FVMA 4OFCA 5I3GA 3ZR6A 1EHNA 1UOKA 2WHKA 1H09A 4QDMA 4W88A 3R07C 5HA7A 3AIEA 1KRCC 1WX0A 2XIIA 4J3UA 2YW4A 2JKAA 2WMFA 3E49A 1IZKA 1H11A 3QR3A 1MRQA 1XUUA 2YX0A 2VI0A 2J7BA 3TEVA 2PEVA 5TIMA 3AS3A 1SO6A 2CLOA 2Y89A 1GOKA 1XDJA 1JZ8A 4MAVA 4OIFA 3OHMB 4JDRA 1DQXA 1A0DA 1L9WA 2X99A 4X3ZA 3ABSA 1L6GA 1B3YA 3MKCA 1DORA 3QZAA 1NHRA 3W1UA 3W4RA 3AXHA 1V6XA 4ZOHB 1QPNA 4MLJA 3W22A 4O0QA 3K4DA 4EMIA 3NDZA 4O14A 1LROA 4PTXA 4S3EA 4QISA 3TFCA 3ZJ8A 1GQIA 1O68A 3LNMA 1I9CB 3M5XA 1XYLA 3MHUA 1B30A 1ML1A 3ZMRA 2ZRUA 5CSSA 4B5UA 4N9BA 3GBDA 3L7RA 1XR2A 1V3MA 2BY0A 2E3TA 1R3VA 4S3CA 5B80A 2VXNA 5EL1A 2VR4A 4GI4A 1SZRA 4O0ZA 1U2YA 3AU6A 2A3HA 3EA3A 4J56A 2HQAA 1TWZA 4U4MA 2UWFA 2AGKA 3IIZA 1UWSA 1ADSA 5A6JA 1XC6A 3UGVA 3IIOA 4H8NA 4TX6A 1NWUA 1FCBA 4JTKA 3DX5A 3NPUA 2W63A 5FSDC 1XQKA 5CBBA 4AX7A 2OB3A 3UPWA 3KLJA 4NAFA 4HU4A 3LHVA 4MKVA 3G8EA 2FVKA 3RX2A 1KCZA 4GXMA 3QMTA 4JR5A 2HK1A 4O28A 4Y9PA 1VP5A 4JIPA 4O0KA 1TZZA 4H4XA 4GR1A 1U1UA 5AY7A 4XAGA 3RO8A 5AHMA 4P7LA 7ENLA 1ZAHA 4C6BA 4PMUA 3S9IA 4MLRA 1SM9A 4MB5A 1UIOA 5D2YA 4B16A 4Q8QA 1MQPA 2Y5EA 3LEPA 3ABZA 3GK0A 4CD8A 4Z1DA 3KWSA 4PRRA 4IX0A 3FGCB 4H3DA 3RK8A 2YL8A 3BMWA 1NPXA 3IGUA 4HSOA 4LIIA 3KL5A 1VJSA 3GTFA 2C3DA 1Q6OA 2Z1XA 3EX2A 1FO4A 2NPXA 4NEWA 4QX4A 2JGYA 4E4PA 2NXHA 2F84A 3T0TA 5H6HA 2P10A 4NUWA 3LTPA 4IJBA 4XBJA 2PCEA 4FXRA 4MNMA 3QZ6A 3RJXA 4TVYA 4OE7A 3K13A 1ME9A 3GNOA 3QPZA 1JFXA 2P3EA 5G2HA 1D8WA 2ZE0A 1XDMA 3VKCA 5EBUA 3WLSA 5DLCA 4HNVA 3ENLA 1MUCA 3NM3A 4MWAE 2PLJA 3GWQA 3OEXA 1QNQA 1DJZA 3PZGA 4DAIA 3BDKA 2B7PA 3EOEA 1FKWA 3NQ7A 4E8DA 1MEHA 4FLOA 1UUMA 1FWIC 1XUZA 3WLMA 1L0PA 2OGJA 4EOUA 5AYXA 3WL0A 1E43A 5I03A 1I75A 3D47A 3QLDA 4QS5A 3IIXA 1GRFA 2WOIA 2P0IA 4IP5A 4IJCA 4PZVA 3GHRA 3ZLHA 4KCVA 3NO3A 3UF9A 1OIFA 1IF2A 1TPDA 1RBAA 2ISFA 2PB1A 1FWSA 2G4FA 2WHJA 3FGCA 5DCEA 1EX1A 3BJTA 4OHQA 4UTIA 3UY8A 4E2OA 1YKWA 4Q8TA 3LGDA 8CGTA 1XINA 3M0HA 1IEWA 5M17A 1HKVA 3SFWA 1E4LA 3N1AA 3G77A 2CKRA 4GIYA 4KERA 1XF0A 2XSAA 1EKOA 3SM0A 3V16A 3VFLA 1DQUA 1KTCA 2EXOA 3GM8A 4ZOBA 3GBEA 5J04A 1JULA 1HJXA 4J4KA 1ZAJA 4HYRA 3ZXWA 3MC5A 2C6QA 2GQ8A 3PZQA 3AI0A 2PD5A 3GQYA 3ITCA 4GXPA 3FHAA 4ENLA 3IJ7A 1JPMA 1OC5A 2J62A 3WF1A 2YXXA 1OT2A 4JIEA 1ITUA 3MYPA 1VRXA 3VD9A 4MFDA 3RYSA 5AZ0A 1U1HA 2VD9A 3CL7A 3C4UA 1Q85A 1BF6A 4O15A 3M16A 2BGNE 5FJPA 4J2MA 3BZJA 3BMVA 3IJ8A 4PR4A 2OEKA 2FDSA 3OIXA 2WSQA 1H1YA 4W86A 1Q1WA 2WM0A 4FNPA 4UQ9A 3TTQA 3W23A 3EXTA 1XPGA 1N82A 3BJFA 1QPOA 1CGTA 3N13A 5SWUA 3M47A 4GK8A 2HVNA 4M1BA 1XBVA 2DGAA 4NZ4A 4GZEA 2VRJA 2ZFAA 3AJ7A 2MUCA 3L2LA 1WUFA 4LC8A 1N8IA 1CDGA 5AHEA 5LIKX 2BVDA 2FKPA 2Q3OA 2INFA 3BW4A 1XH1A 3MDUA 2GDUA 3A5FA 4A3RA 4UMBA 2I1OA 1UR8A 1DOSA 2PDLA 1AH0A 1PZ2A 2QJHA 3HMCA 1J6OA 1FWTA 2CIPA 4XO6A 2ZZBA 1QWGA 9CGTA 4B91A 2YCEA 3WQDA 1UD4A 1K3UA 4HNLA 2QV5A 4ZGYA 4CN1A 1MSSA 1QOXA 4Q4PA 4RNIA 1UR3M 2YL9A 1YDNA 2Y2WA 3ANUA 2A7NA 5T9CE 2FZMA 3B9JB 4BF5A 1XLIA 4I8YA 3SAZA 2C14A 4Z17A 1VBUA 4EPEC 1MNSA 3TNOA 3KTSA 4FEZA 1GPWA 4V15A 1V93A 3E0VA 5LXEA 4DO5A 2VQUA 2OYKA 4DF0A 1LL4A 4K7VA 1W5NA 1NY1A 4P7OA 3HA1A 1FWJC 4ZQMA 2VEFA 2J9XA 2W5FA 4IHCA 2PGEA 4LA1A 3VGDA 4DEFA 3F4DA 3IGSA 2G96A 4XZNX 3BE7A 2OWWA 5ENLA 4JNZA 3TK7A 4JHZA 3HG2A 1IXOA 5JBFA 4LJ3A 1FQ0A 4K8HA 4CNOA 2ZBTA 4D1JA 1VYPX 3VILA 4N4PA 2PWEA 3DAQA 2Y7GA 2DW7A 3TP4A 4GNVA 2H8XA 4N6EA 3AXMA 1V3HA 4I3GA 3W1XA 1PKNA 3BK0A 3UWEA 3B8IA 4XBKA 1W9DM 2OZ8A 3GW0A 1ZP3A 1IGSA 3WNKA 4D6IA 3DHPA 1AJZA 3E5PA 4H2HA 3EPMA 2QDHA 3NVZB 3OQ8A 1ISYA 5GVJA 1UR9A 1FWBC 1LOLA 1G67A 1VRDA 1LUCB 3HBLA 4NZFA 1EO7A 3DYMA 4PUNA 3B8TA 1MOKA 2WP5A 2KZHA 1JCMP 3GR8A 1TQXA 3THUA 2DIJA 1MDLA 1J96A 3QRHA 1TX2A 3RF9A 4V33A 4C6NA 5LNVA 3NR0A 1QNRA 4DB7A 3LRLA 2GLKA 1RALA 1JL8A 1NF7A 4Y9OA 3DBPA 1ISVA 2DIKA 3AWNA 3TNBA 4K2SA 3T6CA 3OJGA 4BFAA 2NV1A 2XISA 3ICJA 4I9MA 4AU0A 1RJPA 4H9XA 2XG9A 1LP6A 5D2VA 4GY1A 1OFDA 2E1DA 3A4XA 1R3TA 3G6MA 3SCTA 2RHGA 3EEGA 4NYUA 1E0TA 1D7YA 2DSZA 2VX5A 3T2QA 3IEBA 4A8IA 3P0XA 2WPCA 2Z7KA 3N2MA 5C7HA 2DZTA 4WXZA 1QI0A 3IUDA 4LF1A 2FDMA 4ADUA 4JICA 3C3UA 2W27A 4PODA 4D6HA 3B9EA 1RR2A 5HQMA 4AXKA 4ONVA 4AEOA 4J3WA 2TRSA 2BTMA 2J8FA 2GSJA 2GJXB 1HKKA 5E6ZA 1S2AA 4EP8C 4MPKA 4Q8MA 1PTGA 3RFAA 1ZL1A 1O5RA 2J3NA 2QDEA 3CAVA 3MCNA 1EXPA 1G69A 2VZOA 3STGA 3U4FA 1GRAA 1RCQA 3E5BA 2VFFA 1XRFA 2CPUA 4LYKA 1OZMA 3LPGA 4HHLA 4LH8A 1GREA 3WFZA 3LPPA 1LUCA 2NUWA 3II4A 1TPC1 1UD8A 3HV8A 4H4UA 1LL7A 4HTYA 3DECA 4FALA 4AVFA 1JUEA 5HMEA 1IZJA 2QUMA 5EBAA 5I24A 2OX4A 3AZSA 2XFRA 4HA4A 4WF7A 2WCSA 3PFRA 4APNA 2AL2B 4CNTA 3VGBA 3CJPA 4HPJA 2W3RA 1TCDA 3BVJA 1HL2A 4L7ZA 3W7CA 5BRQA 1GORA 3GU2A 2O55A 3DJGX 3GU9A 3EDKA 1FUYA 2QGHA 4LFYA 3CZLA 1LOSA 3AHXA 4IIDA 5H91A 1L8NA 5G5HB 3D3FA 2REQA 4RE3A 1H7PA 4Q8VA 7A3HA 2XN2A 2PBOA 4GHRA 1DPMA 3NL6A 4DJDD 3LXDA 3V1PA 3SDOA 2V0TA 4O4VA 1SZFA 4KGLA 1LCOA 5IHRA 3L4ZA 4F0LA 1V03A 5E5CA 1A5NC 4H8UA 3DC8A 3WLTA 2R1PA 3W1LA 1OGBA 3AISA 1WBHA 1B57A 4LALA 4DNMA 3VMNA 3M64A 4K38A 4ROQA 4U5IA 1G4PA 2H6RA 4DM2A 3EWUA 1YHTA 4WSJA 1AK5A 4K1WA 4JN6A 1KXVA 4H4VA 3KRUA 3C2OA 3AROA 3PSWA 2BASA 4S1FA 4HCHA 1VQZA 1JFHA 1ZCCA 3V4BA 3WJYA 1D7FA 8RUCA 4GRTA 2GJXA 2FJUB 1EBGA 3EMCA 4GISA 1F7BA 4BURA 1WZLA 4D71A 3NOEA 3M44A 2VR5A 2BB0A 2OCZA 3O1NA 4UTWA 2RAGA 3QR1A 1ZK7A 1KV5A 4Y9NA 1FH8A 4O57A 3VO0A 3VNZA 3KS6A 1XP3A 1VYRA 2O7SA 4M19A 4LRTA 1PPIA 2QDGA 2WSYA 5XIAA 1J0YA 4GKTA 3V0TA 4B5NA 1G9HA 6A3HA 2WNQA 4ADSA 1NOWA 3S0CA 2ADAA 1UWUA 3WD0A 2PLCA 5LA0A 5JVLA 1RK6A 3EOUA 1GG0A 3GRSA 1OG0A 4ZCWA 2WPGA 2QPXA 3U0HA 1OB0A 2A8XA 2XWDA 4KIRA 4LB3A 1QVBA 1GCYA 2D73A 2R6OA 4I6VA 3AIWA 3UBPC 1QJWA 3GNRA 3RPTA 3HPXA 1TTIA 2C1GA 2A6LA 1EWDA 1KXTA 4NJKA 3M0MA 4ZENA 1V77A 2WLZA 3WK3A 1UR1A 2WCGA 5C7VA 3KRZA 2XFFA 2YZRA 1KBKA 4ROPA 4O8AA 1E55A 4PMVA 2YVJA 3QC0A 4UFJA 3INPA 4YXGA 2HBVA 2D24A 4DUWA 2EKCA 2EBNA 3W82A 4E2DA 1GRGA 2XDFA 3LHTA 5F4WA 1WB0A 4YN5A 3SQMA 2JF7A 4G2DA 4TMBA 4XZ9A 2QKFA 1OINA 4IQEA 4NZCA 4PYSA 5KMYA 3HV9A 3M6DA 4IM4A 5C2GA 3ARTA 3F7JA 2WANA 4EVZA 5E09A 4L4LA 1KBJA 3TE9A 1OG6A 4ZODA 1EF2A 4UZSA 4PUDA 4LQ1A 1E1EA 1EQPA 1XSIA 4QNEA 4AZ5A 4GUFA 4XUYA 1W9UA 4W89A 6XIAA 4L61A 2FJKA 4FNUA 3SIMA 4MB1A 3HTWA 1GQJA 4L6HA 2JEPA 1ONRA 5J5RA 3G24A 2W54A 4QQUA 3WUEA 4ERAA 1I2QA 1B3ZA 3DG7A 4XG1A 1IGWA 1VIWA 2IXUA 4MWAD 4S3DA 3S83A 4QQ3A 3BV7A 3ATZA 3KOZA 2YXOA 3PF3A 3WYZA 1C9WA 1TV4A 1FDJA 1E4MM 1K8CA 2PDUA 3OA3A 3PC0A 4UTTA 2VOMA 3RM9A 4F48A 4CD5A 3RDKA 5BOFA 1LQ0A 1VFFA 3L5LA 3DCPA 3LS9A 4JTGA 4HU3A 3U2CA 2J13A 1P0DA 2FPYA 4UXDA 3O0FA 3VDCA 1TJ0A 1S5TA 3N6HA 2OU4A 2RUSA 1WAUA 1UKQA 5K4XA 2C79A 3BAJA 3VKDA 3MSDA 3AUOA 1NVMA 5FEXA 4NJHA 3APTA 1UMLA 1GVYA 3HURA 1GONA 3PR2A 4J1OA 4BQ3A 3P8JA 1ISZA 3SCOA 2CHOA 3WMSA 1EJWC 3G1DA 1MFUA 4MUPA 1SB3B 4AMAA 4O1BA 1UD6A 4WHBA 3URQA 5H1WA 3CQIA 1QHZA 3V5OA 2ZC8A 1XYZA 4JTFA 1IWAA 2OODA 2HSAA 4DBEA 4JFSA 2OOFA 4QG6A 1QTWA 1DJQA 2YFOA 5AVNA 5EYWA 2C71A 5CQ1A 3NVWB 4H83A 3FVDA 3G6LA 1BRLB 1J2BA 1KTNA 1W91A 3IJ6A 1KBLA 1DJHA 4HHPA 2OTDA 4HMCA 2WXDM 1GKRA 3UJEA 4Y8FA 3T0CA 3MBDA 4AF0B 3WDIA 4XZIA 1I2RA 4Q8OA 1EJVC 4W93A 3QY6A 3DFSA 1AZ2A 3N73A 2VEPA 1MQQA 1J6PA 3R0UA 3BAKA 2EG7A 4IWWA 3H21A 2A0NA 4R7JA 2Z24A 5AC8A 1K02A 1REQA 3MBFA 4IFKB 2BX7A 1Q13A 4MDOA 4QNWA 4KIEA 1DVJA 2X8RA 4NF7A 3GH5A 3ITVA 2VZVA 3TOPA 3NEHA 2Z0IA 2GGHA 3B9DA 5A6MA 4MFEA 1TIMA 3TZFA 3IUHA 2BLEA 1KLYA 2PDPA 4FDCB 3SGZA 2AL1A 3NURA 2WZIA 1LLOA 2ISSA 4BHYA 1CLVA 3QQWA 4D8AA 1J18A 3FA3A 2D69A 1VLWA 2C19A 2QW5A 4WKFA 4O18A 3C8NA 5DBUA 5FMHA 4GUGA 3AS0A 2A6NA 1R8LA 5CPTA 4J7RA 2QEZA 1XPYA 3UXDA 1Y7VA 2BG5A 4U2ZA 4DWSD 2D2JA 1WDPA 1O5QA 1VFMA 1BRLA 1CXLA 1XIGA 3W26A 4P2VA 3CGDA 3MW7A 1LWJA 4GYJA 3W0KA 4PTVA 2ZRYA 4IG2B 4AWSA 2FZ9A 3TA9A 3MP4A 2E6DA 3W1TA 5I3FA 1Q4NX 1R86A 5JCKA 3B8UA 4AF0A 4PBFA 4X9SA 5IFPA 3A9BA 2Q8LA 5CC5A 2OQYA 1C7TA 1BD0A 3CYVA 2EPNA 1A5LC 3BC9A 3T55A 3N29A 7PTDA 1BEUA 1H7NA 1LG2A 5A8OA 3WQPA 2E68A 2WVUA 5FIPA 4F0KA 4PB4A 1LBMA 1UROA 3P7YA 2A4AA 5FJIA 4PMOA 1E15A 3AOFA 4H9MA 4FX9A 1V6VA 2VX6A 4N9EA 4PTNA 4CEUC 3LCGA 3QBUA 1QI3A 4IFKA 1ISXA 1AZ1A 3WK0A 2XTKA 4PMDA 1PB0A 4B2DD 1WZMA 4QGCA 1QI4A 1VKFA 2WC3A 5CJNA 3H7VA 1NDWA 4Y9AA 3BOFA 3WQGA 1O1ZA 4F79A 3MUAA 1HGYA 1HTIA 2WMKA 3SJNA 2G3FA 3U2ZA 2Z6IA 4JN7A 1JPIA 1QASA 1EP2A 2C0AA 1GT8A 2AKZA 3MUIA 3LERA 1KGXA 1R6WA 3WEMA 4JFTA 4NASA 1L6FA 1Q6QA 4AYSA 4ICNA 1OEPA 2DUAA 2QIWA 5D9MA 1TE6A 2CLFA 3CNYA 4GIAA 1A5BA 1UH3A 2ZZ2A 5LSMA 3GDMA 1OBAA 5A6TC 1XLBA 3UVIA 3M07A 4GJJA 1WCGA 1VB9A 1Q5MA 4X0VA 3LCWA 4UFMA 4RXFA 3RLGA 4AY8A 7CGTA 2PDXA 4LNYA 4A21A 4WY0B 4MNJA 1LF1A 4Z2KA 2AAAA 4IGSA 1JD9A 1NQKA 2E4TA 3S46A 1SUXA 1VQTA 4TXEA 1YMYA 4GACA 4H2CA 2ZKMX 3SGGA 3KHJA 2PDCA 2HVMA 2DZSA 1OT1A 2V3DA 2ATSA 2H3DA 3WLIA 3BSHA 3EAUA 2DJLA 1M68A 1BSIA 1RY0A 1NOFA 4RDYA 4EF8A 1AW5A 1OCJA 3PG6A 1UA7A 3OZPA 2YDSA 3P81A 5DCDA 4R34A 1TJRA 5H2ZA 3UT0A 4AZBA 4WIWA 2ZXQA 2F9RA 4Z0JA 5I3DA 5AZ1A 5AOUA 3WG6A 4PTDA 2BXZA 1DWIM 1OFRA 1AA1B 2VWTA 5TAOA 3H2FA 1TYTA 4DIAA 3LM3A 3URHA 2WQDA 4I7VA 2GH5A 3UJFA 1SGJA 4QSFA 5E0KA 1PEZA 2PA6A 3AYVA 3CB3A 4C6DA 3WFAA 4J28A 3XIMA 1GVOA 1IR2A 2OLSA 3HGRA 3FYYA 2V2CA 5H8UA 3EDJA 3L4WA 3TLQA 2XVGA 4G7FA 3N4FA 2ZVRA 2AQOA 8XIAA 1V6UA 5LXXA 1UP3A 2DPEA 3K1GA 4X22A 3W7KA 3KE0A 1VCGA 3HOJA 3JW7A 2ZXBA 1C92A 3FIGA 3FKKA 3FDGA 3QMRA 3CU2A 1BYDA 3TSDA 3GVWA 1UD3A 3AIVA 2F6KA 1WYIA 4LEQA 5T9BG 4OV9A 4HA1A 4R9OA 3S2CA 4KGJA 3DH9A 4KKXA 4OUEA 1XCWA 4WD0A 1W3KA 1GJWA 4IISA 3G1YA 4K3ZA 2XUCA 1VFUA 3PUOA 2R9RA 3ARQA 2D0HA 2GSEA 1RAKA 5F1VA 3QKZA 3N12A 2Y7DA 1G7UA 3W6LA 4Z2LA 4JYFA 1HP4A 3UCCA 1XISA 5E9AA 4K37A 3VOGA 3ZJKA 1I1XA 1TR9A 3T1GA 3E1F1 2VYOA 1RJQA 4NXSA 2YKKA 3KBVA 4CVWA 3RILA 1AVAA 3IJDA 1XYMA 2PAJA 1NJJA 1VFTA 1PL9A 4BY3A 1D9EA 2E5DA 4ZXOA 4EMWA 1WE5A 1ECEA 4WKHA 3CS2A 3SUTA 4O50A 4AXNA 3RITA 2G3NA 1EOKA 1S5VA 4P8XA 1YQ2A 3D9XA 2PPGA 3WDRA 2PGFA 4AD1A 1XYFA 3TXVA 3PB0A 1FA2A 3QYQA 2J88A 5CGMA 3EWYA 1F8IA 2J6VA 3QHMA 3CMGA 4S3JA 3KXQA 5AN7A 5GJMA 1T0OA 2VMFA 1ME8A 5G1YA 4AZCB 3OHIA 3OLEA 3IRSA 3H4XA 2QCMA 3NQDA 2ZRWA 3ORWA 1AL7A 3S9YA 2V5BA 4KEUA 5IRPA 1A49A 1P1XA 4KWOA 1ZB5A 4HMDA 3ELFA 4EQXA 3M0LA 3ZLGA 1S7MA 3BLLA 2PFHA 3QV6A 3AIRA 2FGLA 1Y5VA 5DCBA 1F8MA 4FI4A 5HNNA 1KR0A 2CHNA 4ACZA 3HQPA 4PRTA 4RW3A 2C15A 3MO4A 4NRSA 3EPNA 1VYSX 1N8FA 1OYAA 4GFSA 3P6LA 4O19A 3BAXA 3VMOA 2DSWA 4O52A 1JR1A 1O1HA 3MP5A 1FCUA 1J01A 4H9TA 1MMFA 5FF7A 1EX5A 2WHMA 4LS1A 3OVPA 3F5JA 4DAFA 4GNJA 1R3RA 1VBHA 4Y6GA 1W3HA 4HPGA 2I17A 3F5KA 1FH9A 2WSRA 4E2VA 5HINA 3BAWA 5LIYX 4DBDA 2NSOA 3BSGA 3WD3A 5RUBA 3L8KA 1SZGA 1F5ZA 1T7LA 1QRQA 2C1IA 3VNMA 1M7XA 5AC5A 1VPQA 4RZ6A 1GOMA 5BROA 3W7RA 4C90A 3FA4A 3DERA 3BLFA 3NA8A 2OO6A 1NP2A 4L6OA 4MADA 3EB4A 4XAFA 4ZO6A 3RPDA 1KNWA 3KVKA 1QUMA 4XZMX 2HTMA 3QPEA 2IPWA 2BVWA 1XSJA 1B5TA 3GTXA 1PDYA 3VE9A 3PBGA 5EKYA 3CB8A 2WZHA 3HQOA 4FX8A 4RE0A 1VJIA 3BLPX 3OBKA 2GGJA 3SRDA 3HPFA 3HU7A 4AZCA 3NQBA 2X2YA 1ZFJA 2O7QA 2Z2BA 4CQDA 4B3LA 3TW7A 3LZ5A 4GH1A 1VIZA 1DNCA 1V3IA 3EB2A 3G0XA 3DH7A 1TPWA 4JTJA 2NVDA 5HWJA 1V59A 3K46A 4JIRA 3UZZA 4ZL1A 4XAZA 2WOQA 4ZR8A 5EU9A 4RDZA 1GYMA 2G8ZA 2E6AA 1AOGA 2HXTA 3GH7A 3W70A 2X30A 1SJAA 1LM1A 2B4GA 1V79A 3LHYA 3MSRA 1PV8A 5JCLA 1W5MA 3DHUA 3N25A 4GQBA 4DRSA 1BVZA 3H70A 4Z08A 4F0RA 3O8AA 3B8WA 3CPGA 1TPUA 5D2TA 1ZY9A 3UR7A 3L65A 4UNLA 1TVPA 4IMCA 4FLRA 2DSVA 4J3SA 5AVHA 4JEJA 1RM6B 2VGBA 1M53A 3QVQA 1EUAA 4OOUA 4O1EA 1ODUA 4A6GA 2EPKX 4G6CA 4W85A 3FSTA 4NI8A 2RKXA 3GZAA 3GY1A 1VZWA 4L80A 1RH9A 2G37A 3QGAC 3ITLA 1D8CA 4RR4A 1VHNA 3MANA 1C8VA 1S46A 3H54A 1S2TA 1NHQA 1OFAA 2QCDB 2Y63A 4H19A 4QFUA 1JRCA 1FFQA 2G97A 4ICMA 3NCOA 4DUXA 1XANA 4AH7A 2RABA 4NX0A 5DMMA 2I5QA 1QBBA 3E2VA 4GI8A 3EAOA 3V3WA 1GKPA 3P0WA 1I45A 5TBOA 4Z2IA 2J7HA 1UYQA 1IZCA 3OP2A 1H5YA 2Y8UA 1NSJA 1UBSA 4GUIA 3TTYA 2E5AA 3MMTA 3TA6A 1A50A 4MYXA 1O4UA 3GD3A 1XCFA 3DK4A 5DEZA 2QJMA 4L65A 3SO7A 3WQCA 2PWFA 3URBA 3KOYA 2LLEA 3R7MA 1MXDA 3GNXA 4LVDA 4E6MA 4WSKA 4HQVA 3Q58A 1MXGA 4DJED 4EXAA 1QO5A 2VZTA 3V75A 1ONFA 3OC4A 1GEUA 2ZZ6A 5ER0A 1QHPA 5KZEA 1QK2A 4IPJA 4DJFD 1OX4A 2X0SA 3TW6A 1DBTA 2FVMA 1AUSL 1UPMB 3QEZA 4WXYA 2UZ9A 3M41A 2PU1A 2EGZA 1WDDA 4JTQA 3EANA 3IS4A 1CX9A 4KCTA 4L1GA 1FEAA 4JX5A 1SJBA 4NY2A 1W1A1 1WDRA 3OGRA 3BG9A 4JFWA 1HFBA 5IXEA 1RBOB 3U2EA 1V4YA 2WKJA 3RGTA 4Q7BA 3PZ9A 3APYA 5D2XA 3EMQA 2WPEA 5BWFA 3E0FA 2IUZA 1HVQA 4ORMA 2QCDA 3EOLA 4RDVA 2GUBA 1TTQA 1UKTA 4PSPA 1EWEA 4EF9A 1X7FA 3HMJG 2XIJA 3N15A 3GS6A 3P67A 4G1KA 1QAPA 1XX1A 2J74A 4UTFA 2CLKA 4HCDA 3IUIA 1OY0A 3WBXA 1BZLA 4UFIA 1EJSC 2NUXA 4NJIA 2PWVA 3ITOA 1H0IA 5C8BB 1WKFA 4JKLA 1YDYA 1H1ZA 4JTLA 2BGSA 1XH2A 2BOEX 3ARZA 4ZOAA 1S3TC 3P82A 3LGGA 4JPGA 3VA8A 4EX4A 4KF1A 3MI3A 3VINA 1J11A 3TJXA 2XM2A 4FXFA 4H4SA 2HS6A 2X42A 3OGVA 1VGAA 1EZ2A 3AMKA 3WUGA 4HNCA 1GKQA 1EXBA 4EM3A 1OK6A 3G1FA 5HNTA 1JGIA 1UKPA 1F05A 3CUGA 1ZRQA 5DY2A 1KBBA 1QBAA 1SO4A 3PPHA 2E09A 3G0SA 3O07A 4DJDC 1U30A 4KH2A 2XJ7A 1O94A 3N9SA 4BQ2A 3WF0A 4JTHA 3NXLA 4NL1A 4IP4A 1BKSA 3IAPA 2NV9A 4LBSA 3GVQA 5CAKA 3FXYA 5A6AA 3AIUA 5JUVA 2JIWA 4UWMA 4E8GA 1BXCA 5F1UA 1ZKQA 3CGCA 3PNUA 3G1SA 1F2JA 4Q33A 3PJUA 1KN0A 3W71A 4LRSA 1W31A 2P3ZA 4KEVA 3K4AA 3SCRA 4A3HA 4CCEA 2WMGA 3CHEA 5FF2A 1R5YA 1D7KA 1IXNA 3M5VA 3WQ5A 3UA4A 5K9CA 4LUJA 3WDPP 4QXIA 3E96A 5CBIA 2WPFA 1V3JA 2D0GA 2X1SA 2OSXA 4QCFA 2H8ZA 5C9WA 1H7XA 1EA9C 4LEFA 4DF1A 2NQ9A 1EDTA 2X0HA 1XIHA 1F73A 2RJHA 4N02A 4AVNA 3TOYA 3L23A 5U25A 2X8HA 2Z1SA 3PWIA 1FWEC 1X96A 4JX4A 2UY3A 1GHRA 3KOXA 5HNRA 1PHQA 2Z2UA 1BG4A 1XICA 1UR4A 1WDWA 3O6CA 4UFHA 4AD5A 2W55A 5FF4A 1UKOA 4Q8UA 3NZ1A 1HKJA 3NPWA 2D1ZA 1EC7A 1XKJA 1TX0A 4H01A 3LB8A 2HE5A 5FI8A 1ZSXA 3G1AA 1NOUA 5F2GA 3VTRA 1HNYA 5AYZA 1U5HA 2Q8XA 5A2CA 1V3KA 1V3LA 4GZIA 1PBGA 4XTDA 5F2LA 3QV9A 4J3TA 3OZYA 1GOXA 1JZ6A 1SSGA 5KVIA 3GDTA 1K1DA 4K68A 4F66A 4EKJA 3M0YA 5FACA 3BOXA 1YPXA 2JEQA 2PP3A 1YXCA 3P62A 4TTGA 2WJZA 4PL2A 3REQB 3LCLA 4MYAA 4BQ4A 1W8SA 2ZZ1A 3BQ5A 3WQVA 2J79A 3WMBA 5DELA 3OU8A 1FFRA 4L9XA 4QDPA 1MW1A 4F8XA 3NZPA 3VGGA 4MNLA 4F2BA 1U22A 3MWCA 1KW1A 3ZZ1A 4YYFA 3U7BA 3WF3A 3M6YA 3IGXA 4GVGA 3S5ZA 4ZQCA 5G2IA 3T9PA 2F2HA 3U2OA 3ZR4A 1S38A 3ITYA 5CPNA 3ZS4A 3E6EA 1E40A 1S2WA 3U4AA 2JKEA 3GW3A 1LT7A 4TQTA 3A23A 3HN3A 2AAMA 4MSSA 4ML9A 3A7UA 1KRBC 2YW3A 3GFYA 1JVNA 1UD5A 3VNIA 5K7JA 1W1IE 4CU6A 4JTRA 1XBXA 2EQDA 1X6NA 1CGWA 3UEQA 3MKVA 3E74A 2J24A 5C5YA 2NQHA 1YYAA 2PSNA 2PRHA 1VBJA 3NM1A 1PAMA 1XXXA 1W6TA 4PRWA 2PWUA 3WBYA 4IIFA 4MWAC 1G4SA 3SUUA 3RU8X 3QLLA 1R9ZA 3PZOA 4IT1A 5AYBA 4ATDA 3DIPA 2Y88A 1QNSA 4CD6A 1V7AA 4R3UA 3NL5A 3GVRA 3KL0A 4Q4RA 4XZHA 3THDA 4B5SA 2GL5A 3S8HA 1S5MA 3CZJA 1K7XA 3UXIA 1PYFA 5ABHA 4IJRA 3BGJA 1XQLA 4AEEA 4CD4A 3UZJA 2H3BA 4FP1A 4XZLX 3REQA 2O9OA 3COTA 3SUVA 4GO9A 1V08A 5CAHA 2ZCGA 1J12A 3BUVA 1DP0A 5I09A 1TUFA 2WWDA 2PRMA 4FIRA 4DHGA 3EXSA 4X9YA 5GQBA 4AY7A 1TV8A 2GVJA 3NO1A 1M04A 3MZNA 3W1MA 1CXEA 1TTJA 2Q3RA 3FYOA 1SYTA 4PUUA 1XWYA 4MWAB 3WENA 4BJHA 2PDGA 3K8LA 1JQVA 4JQ2A 3GR4A 3AIQA 4JQ1A 1JYVA 2ZRVA 4D6FA 5E70A 4F2TA 2FHBA 2NWSA 2C1HA 1PS9A 3PN8A 5FS7A 1ZAIA 1ME7A 1TWIA 2BOGX 4NNAA 1K9DA 2C18A 4ZSTA 4ALDA 3T44A 5CC6A 2I5GA 1TKKA 3A13A 4S23A 3D6NA 1WO2A 1Z7AA 4XUGA 4E3TA 1A80A 5HUPA 5LYRA 1OZQA 4FSAA 4W8LA 2WBKA 3H7RA 1KM6A 1W5QA 3M5YA 4EPDC 6CGTA 4IXXA 2PLKA 4U2YA 5EMYA 3I3DA 1S2VA 4Q3MA 4MMWA 5AHIA 1CLKA 4HSHA 5T91A 1HXJA 2R14A 5JBEA 1PX4A 2W9MA 4C6MA 1DKWA 2ISWA 3QXBA 4AC7C 3WQOA 4ATWA 2PDMA 1W3IA 2WZMA 3LCHA 4UR9A 3WJXA 3SECA 3TW9A 3L0NA 1OABA 4WDTA 4CGTA 3CIXA 2BHUA 2VUYA 2A1YA 3TCSA 4AISA 1TZ9A 3WKZA 1FXQA 3VOIA 4H4TA 3R25A 1X39A 1Q6DA 3G3MA 4NKCA 1TB3A 4GQRA 3LHZA 1ZS2A 1ADOA 1AW1A 3PTKA 2O0TA 1YEYA 4JY9A 5CJMA 4WY0F 4YLWA 3WEZA 3O15A 1TWSA 3CQKA 4LXFA 2NLIA 4MAZA 2VENA 4OU1A 1GZ1A 3LRKA 3O06A 4KW2A 4GIEA 1LZOA 3O7UA 1G5AA 5L6UA 1O7AA 1C3FA 4NZ3A 3NAVA 1RCXB 4E4UA 4ATLA 4DPQA 3CH9A 4C91A 1K9TA 1KQZA 2ZC1A 3ARVA 3VK5A 1GTHA 1KFCA 4DWSC 1X6LA 3NDYA 4M82A 5BMWA 4C6OA 2YB1A 2Q02A 1P0BA 4DYKA 3VNLA 1YNPA 2CZ5A 2HMCA 4DLMA 3GHSA 1NFPA 1J5TA 5GRTA 3THAA 4GC3A 4QAWA 1PSCA 1ZPTA 3SUSA 4US5A 4Q6XA 3CGEA 4AZGA 4JZ5A 3NL3A 4GX9A 1KWKA 4BF9A 3BARA 3WJZA 4L64A 4GRSA 4MB3A 4HK7A 1E0VA 4DO4A 3SW6A 4WDXA 3B4UA 1VBRA 2BCPA 3VDHA 2IPGA 3M0ZA 3AZRA 4YVPA 2PUZA 3I4KA 4R7WA 1ICSA 4ILSA 4D8LA 2HROA 1S2UA 4DUOA 3W73A 2VX4A 4IPPA 2VURA 1TG7A 3CV7A 4EACA 3NNTA 1VS1A 2DZXA 4NSBA 2V67A 2YCLB 3DK8A 2XH7A 3GXMA 5D32A 3KWXA 4O53A 1ZDLA 1XGZA 4W8BA 1SR0A 1B31A 3G3DA 1K03A 1M7OA 3RAOA 3UFYA 5FAJA 4HU0A 3S5YA 4M6UA 1I60A 4LAMA 1QI5A 1XFCA 1GW1A 1TCMA 3AN1A 3MI6A 4M81A 1EZWA 3DI0A 3GC5A 3N18A 3Q65A 2A2IA 4QDWA 3MA8A 2WVSA 5KVHA 3KTXA 5M1TA 1VEOA 1U1JA 3C0QA 3ME3A 3EWBX 3WLNA 2JFEX 4MY8A 3ARUA 1HKIA 3K4WA 3WNOA 1U5VA 3USZA 3GDRA 2QJGA 2PLMA 2YYTA 1E72M 1CXKA 1ZUAX 3IC9A 3CAWA 7TIMA 4GUHA 4NG3A 5D05A 3TYCA 1Q6EA 1MO0A 2W62A 2XGIA 2R82A 1QU4A 4L1WA 1MEWA 2X50A 1BQGA 2YA1A 1HP5A 3H7UA 1BFNA 3H4GA 3A6OA 1VLIA 4GFIA 5HK4A 4IL2A 2FTYA 3W7DA 1JGMA 3R89A 2GOKA 3D46A 2ZZ5A 3Q94A 4H4PA 4QEHA 1K9FA 4IQDA 4RE4A 4A35A 4O1FA 5CPLA 1AQMA 5FA5A 5HJLA 3W87A 1XYCA 2E1WA 3GUGA 3P3BA 2HK0A 1ITCA 2GQWA 2QCHA 3F1QA 3THCA 4F40A 2FGZA 5U7SA 4XK2A 4FA3A 3VIPA 4U28A 2PWHA 5AFDA 3EKZA 1VENA 3UXAA 4BEUA 3PJXA 3NSXA 5DMNA 3P5ZA 2R91A 3HRDC 2OQLA 4BCEA 1VCFA 1CYGA 1BAGA 3HJEA 2DQXA 3QJAA 3KFTA 5K9DA 1BG9A 4U3AA 2ZRXA 4ASTA 1GESA 3R58A 1I8JA 2CCRA 1TPFA 1VC4A 4W7VA 1Z44A 2XN0A 1LOQA 3KCLA 2B7OA 3UCDA 3KOWA 3BMXA 2OMAA 2BV9A 2CLHA 1UKSA 5IBXC 1Z32X 1GRBA 4S2BA 3MCOA 1DE5A 5A1AA 1HX0A 5IDIA 1YXYA 3P2VA 2FTPA 3GX9A 2DU2A 3UWYA 3S47A 2ZWZA 4V28A 1E6PA 4XX6A 4LSBA 4ML4A 3CQ0A 1KR1A 4TO8A 1SJDA 2ABAA 4JAWA 4J3ZA 3TR9A 2H9AB 4B2DA 3AS2A 4AMCA 4XISA 3KBNA 2X16A 3L67A 3H4KA 5CEWA 2WHLA 1G4EA 3BANA 3VPLA 4A29A 3OVQA 2VJXA 2W67A 2PDNA 1KFBA 1ITQA 2P88A 2YAUA 1NWTA 2OT0A 1YW1A 1B1YA 2FQIA 1KM5A 2X2GA 3B9AA 3W72A 3HF3A 2F7FA 2PP1A 3DHFA 1S2CA 3H26A 5EBKA 5D8ZA 2KX9A 4N7QA 1NWRA 1N5XA 1CZ1A 4GVIA 1IV8A 3PB2A 1RD6A 5D4YA 2PDQA 4LGXA 4ZA0A 3H22A 3OODA 1SW3A 1R2RA 3EF6A 1O60A 2G0WA 3OO2A 1XLMA 1NFBA 5TD4A 1CECA 3U7VA 3BSMA 4GIRA 3VKAA 3NZGA 3Q67A 4MY9A 1H60A 1RP8A 2GUUA 1JPDX 3GXDA 1EC8A 3R4IA 4FO4A 1E6RA 1VF8A 1Q2RA 1DTUA 1FXPA 2XINA 4I6KA 5A3HA 1N55A 3SQPA 2CKSA 5J8LA 4M29A 3T0DA 3GHUA 4A3YA 4JY8A 3RLVA 2XN1A 4GY0A 3RIKA 1XFBA 2E77A 3DG3A 1FWHC 2HISA 2XIOA 3H23A 3W86A 3QR0A 3SN0A 2VTFA 1QT1A 3SUWA 1W54A 1CPUA 1YLVA 4OV4A 4XBSA 1X1ZA 2WC4A 4XKYA 1YNYA 2PF8A 3WQFA 4C6PA 3LZ3A 5I0DA 4UMCA 1MO9A 5LNWA 4RUBA 4YHEA 2E40A 2EO7A 4GUJA 2Y70A 1GSNA 1E51A 2OYLA 3TN6A 4NAFB 3AJXA 1E5JA 3OBAA 3A4AA 4Z1YA 1TJPA 3OGSA 1NHPA 3QHOA 2DDXA 1E0WA 3QC3A 6REQB 1NTHA 4RZBA 5U4NA 1UP2A 2EKGA 1KXQA 3TYUA 1PTAA 5EY5A 3SCQA 4DI8A 1PIFA 1XDLA 3D5HA 4UNKA 4AWTA 2A5HA 3A24A 2PTXA 1FFUC 2HZGA 2AMGA 4MVAA 4XD4A 1JRPA 3FAXA 1UUQA 1G1YA 3BURA 3FJNA 5IBXA 3ZIZA 1KCKA 2FMOA 2NX3A 5DX7A 2BP1A 2YB4A 1EO5A 1Y65A 3SGUA 3TWAA 3TQPA 2IQ0A 3UYCA 4DI9A 5F2IA 1XBYA 4HT3A 3PJWA 4TX9A 2G3MA 3BL3A 4UIOA 4GX8A 1WQ5A 3FAWA 4C6CA 3C52A 4QE5A 4Q4MA 2CZDA 3FEQA 2KAUC 4Q8WA 3TYZA 4RNFA 2F8QA 1BTCA 4M80A 4Q4QA 3KCOA 1QXLA 3RM4A 5CSYA 5G5GB 3CL6A 3RR4A 1YNQA 3MT1A 4YTSA 3RMJA 1V0NA 1Q8AA 1OJTA 3DGZA 4BI5A 4AQLA 4NJJA 1V6WA 2CBIA 1QFEA 3E0WA 1R46A 5A8MA 1AD4A 4P7RA 2BXYA 4MM1A 3VNKA 2Z26A 1PKYA 4JL1A 4DYEA 4CNSA 1B4KA 4DNAA 4DN1A 1WAWA 4MJ4A 4IMGA 2G5WA 6REQA 2E0PA 2NV2A 1RUSA 5I3HA 1EF3A 4ZQOA 3NQ6A 3ETRB 1EDQA 1QW8A 3QSTA 4ICCX 4Q22A 3WDHA 1QNVA 2YOCA 4O11A 4N0RA 2GQ3A 3U5YA 1OFPA 3DYPA 2FMNA 1ENUA 2QJIA 1C91A 3LG3A 2FH8A 2QCCA 1C29A 3H55A 3FG2P 1H49A 3IV8A 1NDAA 2EQ8A 2O9PA 3OLIA 2OPJA 2DZVA 4GNKB 3I7QA 3HG5A 5CKSA 2DQWA 4PTWA 4H50A 1TJ2A 3SFKA 1WOBA 2DVTA 3UWQA 3B0XA 4JEQA 1DIEA 4GYPC 3GG1A 5BXRA 5HAOA 3LM7A 1GV4A 2FGBA 3VFCA 3PNZA 1W32A 2ZUNA 2Z25A 1KCXA 5EB8A 2JGQA 2ZUUA 3NQ2A 2V5JA 4RNJA 1B90A 3PG8A 1WPCA 2BY1A 4PSRA 3RX3A 4M6PA 1MRAA 1W56A 3LSCA 5BMXA 2VVNA 4Y2WA 4Q8PA 2XSBA 3GR7A 3PHAA 3A3HA 2J66A 2WYSA 3A3WA 4ECLA 4DJEC 3S4TA 1G7VA 4FOUA 3KDNA 1UWIA 4AD2A 3S5NA 3CWHA 4JX6A 1Q65A 2WK2A 1KM0A 2DORA 1TPEA 1V0LA 2RJGA 3VM7A 5CGTA 1E4IA 2BSLA 4DJFC 4XVDA 2GVEA 3B05A 4PMNA 3TIMA 3LXCA 2VEMA 3AMDA 4JFUA 3LMZA 4FIQA 3WD4A 1SSDA 2VDIA 2BGQA 2VZSA 1VAHA 4GJ1A 3C6CA 2R1MA 2WMHA 3DHDA 3Q6JA 2CW6A 3VKKA 1LRQA 3RU6A 2ESCA 4PMZA 2QAPA 3HPZA 2AKMA 5CXPA 3ANVA 3ZJ7A 3CUJA 1JYNA 3W07A 3MMDA 4PB3A 1EPVA 3AXXA 2QCLA 4X61A 3OVGA 3ONCA 2FPVA 1HJVA 4QG8A 2WBGA 3RXZA 1GRTA 3W6MA 1W3LA 1ESWA 1ICPA 2QUVA 1UR2A 1US3A 3G8RA 2OEJA 3TJIA 4RLIA 1CTNA 3RHGA 1QCWA 1Y0EA 1RCOB 3M46A 1RY8A 3P60A 4ZE5A 4B5WA 4M56A 3LA4A 1G0CA 3ES7A 3T4CA 1R0MA 2EJAA 2XIBA 1JCYA 1PUDA 3L2IA 4ZXLA 4GCAA 3EOOA 4EAYA 2EQ6A 4FX7A 4LAOA 5HPOA 2CXEA 4U10A 3UJ2A 2OOGA 4TIMA 4HZ8A 1Q6GA 3LLXA 2W66A 2ZTJA 4LUIA 1NARA 3MJMA 4DZ5A 2P5NA 4B92A 3UESA 1MEIA 2D0FA 1XLLA 4NZ5A 4CQCA 3NUKA 3ALGA 2BOFX 2PC4A 4M0XA 4WJ8A 4V1YA 1NH6A 2B81A 2MANA 3B9NA 1VR6A 3KP0A 1QATA 3YPIA 2HPMA 2FB2A 1TSIA 4W5ZA 2VGGA 1XG3A 1D3CA 1QNPA 3URAA 2VC6A 4ZB0A 3F2CA 1WOAA 1THFD 2J7DA 2PCQA 4MJZA 3CZEA 1W9BM 2C3ZA 1YTKA 1L6WA 3DN5A 4FOKA 3R12A 2OLHA 4GYPA 4DO7A 2CERA 4AX6A 1GW9A 1ZX9A 3LNPA 2A3BA 4JCLA 2IQDA 4K7ZA 2VEGA 3LTSA 5FEPA 1KFLA 3CPRA 1GGOA 4WK9A 6TIMA 1T3QC 2ASHA 5CZKA 1RQEA 5D9NA 3LHWA 5D37A 3H4WA 1GOQA 4DJEA 2WLYA 1NWSA 5LHEA 1PZ3A 1AL8A 1XIIA 3OQEA 2QDDA 1EB3A 5HATA 3N6QA 1GQLA 8A3HA 5C6MA 3K1DA 1FWGC 4JXCA 4DJFA 5CCZA 1XSKA 2QULA 1GNXA 1MUMA 1WXYA 3B0YA 4KWUA 4WQ6A 1F4HA 3NQGA 2X7WA 1PZ1A 3N17A 2BS9A 2BDQA 4KBXA 2P8CA 5FJTA 2DZBA 2V81A 1M03A 4MZ8A 4PN2A 4G5DA 1Q8JA 4LW7A 5ABFB 1QWKA 4QE1A 4M24A 4YVVA 3S42A 5E9XA 1JJKA 1EEXA 4B5VA 4C5ZA 1TREA 3H24A 4IMFA 3IJIA 3WH9A 3KRBA 3CWNA 3KLKA 2HS8A 2NLYA 4TUFA 3WO8A 1A3WA 3AS1A 4FK9A 4F9JA 1A5UA 4MDPA 4GJIA 3R0KA 3Q4DA 2GR0A 1GERA 3FJLA 4NAEB 1XJBA 3JUGA 5A6SA 5DN1A 3I6RA 1GYNA 2BY2A 1W0MA 3GXPA 2WNZA 7TAAA 5BU6A 2GVLA 4GCXA 1NDZA 4ZB2A 4IPIA 4RX0A 1XLFA 2QS8A 4UQCA 4F0SA 1VPXA 2JKPA 3TXZA 2NX9A 4UC5A 4HNTA 4LBUA 4PCSA 3NSMA 3JRKA 3LCIA 4L9YA 1HKWA 1ZZMA 1QO2A 2OZ3A 3NQ8A 4HSNA 5HBFA 3L2MA 5FESA 1FFVC 1BLIA 3A4WA 3ZM8A 4IPNB 3MHFA 3S1GA 4HU8A 4GYFA 3C3NA 1SJCA 4IFOA 3R10A 1ZJBA 1RVGA 4PFHA 1J9YA 3PWGA 2OELA 1OF8A 3K8MA 3LXAA 4LF2A 4IGMA 2ALDA 2C13A 2RGMA 1RLDA 2GQ9A 1R3QA 1J0JA 2J7EA 3A64A 2X41A 3APGA 3LI0A 5HJYA 1KGWA 1SO5A 1GZGA 1ZJAA 1MFVA 3VZZA 3H2MA 3F4CA 1CCWB 4DXXA 3IAQA 1NQ6A 3C2FA 4IF2A 3HGJA 3VDAA 3BTNA 4U33A 2OZTA 2FVLA 3ES8A 4G7EA 3NPVA 1W2PA 4OOZA 1BWVA 3N2CA 5ABFA 4UTWC 5JCIA 3TFXA 2PMQA 3WLOA 1UH4A 4JNYA 2OXNA 2YFNA 1F4AA 1TV5A 2CBVA 3CZ8A 3V36A 3KBJA 2REQB 2YA0A 2V69A 3CMFA 4KWVA 2HQMA 1GEHA 4NAEA 2HJPA 3QV7A 1HVXA 2J6XA 2V3AA 4UR8A 3H2CA 4AIUA 4H6QA 3M5ZA 4P7NA 1JD7A 5GJNA 4PEEA 1HQTA 2XIQA 1O66A 4O54A 5T8GA 3UG5A 1QW7A 3TJLA 2GGIA 3N2TA 3LCXA 3SEPA 2VFGA 4ZOEA 1PWMA 3NQCA 3NRZB 4M5PA 2Z27A 4L4OA 1E9YB 3SI9A 3T81A 1OK4A 2FHCA 4FXSA 3W7HA 1XYBA 2BXVA 2R24A 4UB9A 3O6DA 3W2LA 4EQRA 2ACUA 1E6ZA 4GY7A 4E4FA 2V2HA 1XLEA 4HK5A 3EWCA 3WDQA 1JZ7A 4B15A 1E0UA 4X63A 4JQ4A 3O0HA 1JNDA 1E9LA 5FF0A 2WKLA 1ZALA 3W28A 3SSZA 2DT3A 2IKJA 2VC5A 5G4WA 4Y9MA 3LQGA 3VKJA 2NT1A 1XIEA 3N11A 1JNEA 4GD0A 5DT7A 2XVKA 2V82A 5LZLA 2VX7A 2GVGA 1IEXA 1XLJA 1FCQA 3DBNA 5EMLA 4CU8A 3A9IA 4A3UA 1IHIA 3ZWTA 1E1CB 4IP7A 4FS9A 1R2TA 4E5TA 4YJ5A 2EQ7A 2E8ZA 3EZ4A 1POKA 5LNSA 1YBQB 3N4EA 4QE4A 5KETA 2ZTKA 4M3PA 8XIMA 4NP7A 4BKNA 1XV8A 4GGHA 3ZT5A 2DZWA 3GDLA 2VR2A 3IGHX 2WSKA 4HHMA 3TTSA 3ECQA 1PKLA 2I56A 4JQAA 5FJJA 4MB4A 1W1YA 2ZIDA 3G0UA 3S9ZA 3W85A 1U83A 3RRAA 5EA9A 4TR9A 3NGFA 4KFNA 1XIJA 1W37A 5MKGB 5FF3A 4UTTC 1OYBA 2ZX7A 4AB4A 4HGXA 2DJXA 1DJXA 4CU7A 5EPDA 4HYWA 4TU1A 3TH6A 3B3DA 2Z29A 3LRMA 1E70M 4CQ8A 4XB3A 3HPSA 3EGJA 4H7VA 4P8VA 4JDBA 2YIHA 3PS7A 1X8CA 4E2BA 3HFYA 2RDUA 1BSLA 3IARA 4H9YA 4JOMA 1BXNA 1L2UA 4H6RA 1M7PA 1TV3A 2PZ0A 1JZ5A 1P0KA 2GK1B 1CGYA 3MSYA 4YYCA 5BRPA 2F6UA 2ZYFA 4CCDA 3UQNA 3H2AA 3S1XA 1J8VA 3GZ3A 5FS8A 2B0MA 4AZ6A 2C3CA 4MJ2A 4US6A 3XINA 4LTSA 5CH9A 4EAMA 5DT5A 3TWBA 1EDGA 1AMYA 1W1ZA 5FEZA 5E6YA 3OG2A 1U5JA 1PCKA 4JTCA 2F61A 3IVUA 1KA9F 1O12A 4Z2GA 2BZNA 2POZA 1UMYA 4KQNA 4YTRA 1E1CA 1E4NA 5A6LA 5C9ZA 4NHVA 4D6DA 5EFFA 1K8YA 1YBQA 2WW5A 5D38A 5DRCA 4RXGA 2Y61A 2BHZA 1D3HA 2DT2A 3M0VA 4M6QA 1K4QA 3S1VA 3NDOA 3M1ZA 5DF0A 2AQVA 3VM5A 2ON3A 3II1A 1DIOA 4JNMA 1JYXA 3S6TA 1YDOA 3TSBA 1OYCA 3MP3A 1UJQA 4GYKA 2CXGA 4IICA 1DJWA 1UWRA 3CWOX 2VCBA 5KZDA 1W3JA 4Q6JA 2JIEA 2QXWA 3PZUA 5MKGA 3WMLA 5ABTA 2BWGA 2A21A 4CNPA 3VXGA 1Y8BA 3G1HA 4DZIA 3IVTA 4F0MA 4NILA 2E28A 3GG8A 1N7KA 5BXPA 2Y8KA 1QPRA 2Q01A 2EPOA 4K6AA 1VCVA 3T07A 1KFKA 2VP8A 4Q4OA 1CLXA 3OA5A 3KW3A 2W0UA 3CLWA 1JDAA 4JIQA 3N3TA 3SRKA 2A7RA 3LN3A 3MV11 4Z0SA 4LYQA 3R43A 3QN3A 1TIWA 3NYDA 2D22A 2YYUA 3EA2A 4LT9A 3OLDA 4GC4A 2GK1A 4LB4A 5A6KA 1X8FA 4HJFA 4QS6A 1T41A 1FWRA 1DIKA 5HJXA 2FB3A 4QLKA 1EGZA 2I16A 1Q45A 4M8UA 3POHA 1MYRA 1RSCA 1S39A 4NU7A 4DF2A 4XIMA 4EQSA 1XM3A 3WF2A 1F76A 5GNYA 3STFA 4WJXA 2J27A 1LORA 1FDYA 5IDZA 3PJTA 4PMQA 1CXFA 4QTGA 4H4ZA 2V3FA 3R94A 4FB7A 3NZRA 3WH7A 4KPRA 4R85A 1M01A 3VVGA 1H61A 1DXIA 4GWEA 2ZUTA 1REQB 1GPFA 5LA2A 2YCKX 2OEMA 4RPPA 3CHFA 3L4YA 3SZ8A 1XG4A 1JUKA 2RFGA 4US5D 1FEBA 2FIQA 4W5UA 1Z3NA 1KCLA 1WA3A 1KFWA 1XI3A 5KEZA 1EA0A 3TZNA 2Z1BA 1H50A 1PDZA 4GG9A 3PVFA 2CEQA 3A22A 4FNSA 2C16A 3VNYA 2GR3A 3W88A 2A7PA 7XIMA 1R3YA 1RJRA 1ELSA 2J9ZA 4C1NB 3UR2A 2ANUA 2JBMA 3G1XA 1RV8A 1OWQA 1LJYA 2PTYA 1JCTA 2WVVA 5E93A 3KBSA 5K3VA 3P84A 4CN4A 3QW4B 3LK6A 1UD2A 4RJEA 4P61A 1JAEA 3GD4A 3DFQA 1W3TA 1EQCA 1NM9A 5FD0A 3E38A 5CSUA 4OBTA 3WQ4A 5LHFA 3I6TA 5E0FA 2TODA 4DM1A 4H4IA 3EEZA 2PDHA 5FS9A 3PBVA 3B0UX 2NSXA 1FOBA 3ZYZA 5KZMA 5BU9A 4RKAA 1ZY8A 5JIWA 2P53A 3WNMA 1F3WA 3FOKA 1Q6CA 3E0LA 1K7FA 3QW3A 5BZAA 3W29A 2Q6ZA 4JBRA 2X1UA 2XVLA 3MTWA 1YTDA 5HUOA 4ZFMA 3TMQA 5K9XA 4DBWA 3TYEA 2D2HA 5C9XA 4WGXA 4UTUA 4ZMGA 4I90A 4LCRA 4I5RA 2AMXA 1F3XA 2ZWYA 2BVTA 4UQAA 4UZUA 1SFTA 4P8UA 3N34A 4GLEA 3ITGA 2WC7A 3VNDA 2NXGA 3W7QA 4EXQA 1H5VA 3O0KA 2ZZ0A 4WX2A 5ECUA 2ZUMA 1OC7A 1OGGA 1XGDA 4LX4A 4H04A 4L1XA 3UYIA 3IJ9A 1LWHA 5BOOA 2X1RA 5LIXX 1FRBA 3BCJA 4MGGA 2E6YA 1DWGM 3Q45A 4J9JA 4XSMA 3ID7A 3PK7A 2GJNA 2GVYA 2ZDRA 3LDVA 5HWNA 4LUSB 4ZVJA 1K8XA 3HJZA 4DLFA 5DMYA 1BVWA 4C1NA 4YPJA 3GVGA 3GFZA 1CIUA 3ZSTA 1CNVA 1H41A 1EC9A 3WBEA 1EJXC 2PF0A 5D30A 3HGSA 3KRSA 1ONWA 3NVVB 2QF8A 1LL6A 3TQKA 3WN6A 3WIJA 1HGWA 4KEMA 1FP9A 4REQA 3TTOA 3CUHA 1EBHA 1UASA 3AUJA 4UUIA 4S39A 2GR1A 1Z41A 2J7GA 3MJYA 2PDFA 4JTEA 3Q2DA 4TTUA 3QTPA 2HEJA 1E73M 2CWNA 1X6UA 1E5NA 1B0IA 3B4YA 4OGZA 5TNVA 4TMCA 5C55A 4J2PA 2PGWA 4M1RA 2J9YA 3DGBA 2HPIA 1OCNA 1CGXA 3KBMA 5LIUX 2ZZ3A 3WLHA 9RUBA 5A8PA 2XHYA 2OO0A 4Y8EA 3N04A 3WH6A 2OSWA 1SFLA 4F3HA 1VFHA 2CLPA 2CNCA 2INZA 2I7GA 2ZA3A 4DELA 3SRHA 5D04C 3FA5A 4EWND 3P74A 3KL3A 3A3XA 2GSHA 4X60A 3WD1A 1KKOA 3VX0A 4C6KA 3VZXA 1AD1A 2PE4A 4UTLA 3WY1A 3O05A 4IMDA 3C2YA 1FHDA 1SFSA 4B90A 3UA3A 4PUWA 3PUDA 3ZSSA 4HD5A 1CXHA 1EIBA 2GPTA 5HMDA 1C90A 2FZ8A 1AJ2A 2XWEA 4QHRA 4LUSA 3BAIA 3A4JA 3KHDA 5G4EA 1JDCA 2DSKA 2HNEA 4TVCA 4CQBA 2R8WA 3C61A 3DOPA 2GR2A 5AHLA 4EPKA 1RA0A 3T7VA 2GJLA 3AWOA 3FY1A 5A2AA 1MXSA 3GDBA 3I7SA 3C2EA 5I02A 3KX6A 3T0AA 4DNHA 1FWFC 4PMJA 2E8YA 4V2XA 3GXNA 4EIVA 3UCQA 1L2QA 1VEMA 1H0GA 1T40A 4DX3A 1EH9A 4GABA 4AVOA 1DWHM 4CKQA 4G9PA 7REQB 1E9IA 4MHBA 1P0EA 2Y24A 2PDBA 3R6IA 1F9CA 5A5WA 4D6GA 4LY8A 2Q8ZA 4HVXA 3GHTA 1SW7A 2ZXDA 2GWGA 1Q6FA 4ES4A 5EFDA 4GH3A 3QV8A 3EX6A 3AALA 4WDUA 3UZWA 1XH0A 3F2DA 4IIEA 1GVRA 4AWUA 3GDKA 3GYCA 3UWUA 3W1NA 3GB6A 4BI7A 1CB2A 1T6MA 3AMGA 3DI1A 3S6OA 3VUPA 2WKGA 2WNNA 1TVNA 3TSMA 4PE8A 4O8RA 2PDWA 3TYBA 2XGBA 4ORIA 1WKDA 4R53A 1EIXA 4UOJA 3LYEA 1DHKA 1M5WA 3ARYA 2E3ZA 3F03K 1C7SA 5CLTA 1B9ZA 3ITTA 4LAKA 3SY8A 3EB3A 1C8YA 3VOJA 4CN6A 3A7AA 4H6EA 5BXSA 2BY3A 4B4FA 2YBVA 1GETA 3ZQ9A 1M6JA 3B9OA 2GDQA 2PS2A 1BKHA 3UW6A 3TROA 1JZ4A 4ACZB 2GUYA 2VEIA 4B5XA 3PSVA 3TUUA 1C93A 4M51A 1MI3A 3B03A 4M52A 1Z9AA 1OD8A 4PA8A 4C6FA 4ZFCA 5FAGA 1Z48A 2XGZA 4AZIA 3LU2A 2BODX 2FTWA 4O1AA 4JYDA 4D6CA 2QIIA 5REQB 1R7AA 7REQA 3ABQA 1C9DA 1GQKA 2JK2A 2CHRA 3BLEA 1BGAA 2G4JA 5IFTA 4JTAA 1UZDA 1MQRA 2NQ5A 4K39A 2DH3A 4GQ0A 2YDAA 2HRWA 3I3EA 2R1LA 4N9DA 1UPPA 3LTYA 2EPHA 3VD3A 4ZO7A 3VAVA 1WZAA 2IKHA 3NQVA 3M0KA 3DFYA 3U48A 1BGGA 1OFEA 3U8GA 3PUGA 4LYRA 3HZ3A 4DUVA 3PPFA 2YA2A 5TR3A 1TPH1 5C2XA 3BWWA 4H8VA 1Q2SA 3L4TA 4I9TA 1E0XA 2CFFA 5GNZA 5AC4A 4H00A 3CPUA 4PMYA 5BWAA 3OZOA 3VGHA 4QCEA 2J7FA 2C91A 1G94A 1G01A 3EXRA 1DXLA 2BFGA 3CHCA 1EGMA 3UNTA 3H6OA 3SURA 3FJ4A 4J40A 3NVYB 2YLLA 1ZGDA 1DXEA 4WCJA 1BYBA 5U1OA 3BCDA 1F74A 3K30A 3VOHA 4JTIA 2OZ0A 3GVVA 3W3OA 4XIAA 4JIIX 3K5XA 4CVUA 3CAQA 2DZAA 1XLKA 3OVRA 5M3WA 4DVOA 3F2BA 1LG1A 4I7WA 1TVLA 1H62A 4LOCA 3EA1A 4CLMA 1PHWA 1FHLA 1VPYA 4FLSA 4NIRA 1PO9A 1W1B1 3T78A 3BGAA 5C54A 1J2WA 3P80A 1IR1A 5REQA 4H9UA 4PH6A 1RQHA 2QV4A 2GGGA 2PTDA 1H7OA 3CT2A 4RPQA 3B0PA 1CW2A 5D8WA 3O9NA 1GG1A 2O56A 4CCCA 4L6DA 2HE8A 2R1KA 2XZ9A 5FSEC 1Q63A 3A12A 4JCMA 1CI1A 3PANA 2Y62A 4HMEA 3EUB3 1GUVA 4NNBA 2E9LA 4XWUA 5F4XA 2OYMA 4ZO8A 4GI6A 2F6XA 2PZNA 4C6IA 3L66A 4IIBA 1VDVA 1B3OA 4BWLC 1UHVA 3NL2A 9XIMA 3V18A 4OECA 3USBA 3U6WA 4PL1A 3OPSA 4AWEA 1RQBA 3MPGA 2V6AA 1L6YA 1YADA 3UZXA 3QTGA 3FK4A 1DTNA 2OKTA 2WB5A 2J75A 4IMAA 5A8GA 1HKMA 4Q4KA 4UCFA 4YNGA 3GKAA 3SADA 6ENLA 1ZBCA 3WLQA 5M5DA 5G1MA 4OQVA 1LTDA 1VD6A 4YL2A 3S2NA 3TVAA 3KEHA 1YE4A 4ACYA 1EP3A 4OBRA 1MVYA 1DIDA 2YDQA 3C0LA 1B2YA 3BOLA 2CFYA 2QCFA 2YBTA 1RLCL 4ZOCA 5FOOA 3NXFA 3W2JA 3LBCA 2VNCA 1GOIA 1ZTVA 1H7RA 4QJ1A 2TAAA 2ZZCA 1EEPA 1HO4A 1QPQA 2VM8A 4EANA 3OOQA 2Z00A 1OX4B 4QIUA 3C2VA 5C0QA 4WR3A 3UJRA 3H53A 1DV7A 3UGRA 3ERPA 2VZUA 3AXIA 1J0IA 1A5KC 4UR7A 4I9AA 1EPXA 1PX3A 3W7LA 1QOQA 5HR6A 2VCCA 3WLPA 3ANYA 3GXTA 3NTYA 1HO1A 2CWXA 1SO3A 1DWAM 4JGDA 4BS0A 1W1TA 2YSWA 3W27A 3V7PA 2QVHA 3E0IA 3NGJA 5I78A 5JH1A 4IX2A 3CQHA 4XD5A