3IJQA

Structure of dipeptide epimerase from bacteroides thetaiotaomicron complexed with l-ala-d-glu; productive substrate binding.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
337
Chain Sequence
b'MKMTFFPYELKLRHVFTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTPDVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIHWLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRFKGVEVVNGKITLNDLPGIGVMKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Isomerase
total genus 107
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 5.1.1.20: L-Ala-D/L-Glu epimerase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ijqA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ijqA01
3ZLHA 1KKOA 1XPYA 4HCHA 4IHCA 4DWDA 2QGYA 4JN7A 1NELA 3SN1A 3DDMA 3HPFA 3TWBA 2P8CA 3MZNA 4H19A 3V3WA 5BOEA 3I6EA 1WUFA 3H70A 2PTWA 2DW7A 4M0XA 2AL2A 1TZZA 3GD6A 4HCLA 3Q4DA 2PSNA 3THUA 3S47A 4A6GA 3DEQA 3GO2A 2AL1A 3VA8A 3RCYA 3Q45A 3EKGA 4GIRA 2PS2A 1FHVA 3T6CA 1BKHA 1KD0A 3PWGA 4DHGA 4YWSA 2P8BA 1TKKA 1KCZA 2O56A 3RR1A 3DFHA 3MSYA 2ZC8A 3VC5A 3UCCA 4IP5A 1MDLA 3ZLFA 4HNLA 3QTPA 2PU1A 3R0UA 4K8GA 1FHUA 4DN1A 2FKPA 1P48A 1EC7A 4J3ZA 1OEPA 4E6MA 4JHMA 2P3ZA 7ENLA 4K1WA 3UXLA 1ECQA 3CT2A 3P0WA 1TE6A 2ZADA 3OZMA 3QLDA 1EBHA 3P3BA 3NO1A 1SJCA 2POZA 2GDQA 5EU9A 3STPA 4FI4A 3R10A 4HNCA 6ENLA 3I4KA 3U4FA 2DW6A 4IT1A 3FVDA 3VFCA 4KPLA 2OLAA 2XH7A 2I5QA 3H12A 1MDRA 3T4WA 1WUEA 2MUCA 1BQGA 2GSHA 3FXGA 4X2PA 4G8TA 3S5SA 1DTNA 3VDGA 3U9IA 3SBFA 4H1ZA 3DG3A 2HXUA 2HXTA 3ZVHA 3BJSA 3BSMA 4ZA0A 3CYJA 4EWJA 1EC9A 1KKRA 4J1OA 3VCCA 3BOXA 3SN4A 2PP1A 3PFRA 3NXLA 2GL5A 2OVLA 3ES7A 3PWIA 1SJBA 3UJSA 5FJOA 4JN8A 3TWAA 2PGEA 4H2HA 2PPGA 2OKTA 2AKZA 3SN0A 3TTEA 2XH4A 3GY1A 3JZUA 4M6UA 3FCPA 3P93A 1YEYA 3UJEA 4MKSA 2ONEA 4IL2A 4F4RA 3EEZA 2OX4A 3CAWA 4HN8A 2GGHA 4HCDA 2P0IA 3FYYA 3KUMA 5IDZA 1XS2A 2GGIA 2XSXA 1JPDX 2XH0A 4GISA 3R1ZA 4KT2A 2CHRA 5FJPA 2FYMA 2QQ6A 3V4BA 3UJRA 3T9PA 3K1GA 3UGVA 4DXKA 1E9IA 2GGJA 3PK7A 1RVKA 3ZVIA 1PDZA 2QDDA 4ZCWA 3OZYA 3CB3A 3TCSA 4Z1YA 3RGTA 4E4FA 3R25A 3SSZA 3V5FA 1NU5A 5FJUA 2PODA 3B97A 2PCEA 2GGEA 2MNRA 2QJMA 4E5TA 1MUCA 2QDEA 3N4EA 4K2SA 2QJNA 4GFIA 3ENLA 2HZGA 4FP1A 1IYXA 3JW7A 3TOYA 2PP0A 2OZ3A 4GGBA 4ROPA 3MQTA 2OG9A 3RRAA 3UJ2A 3R0KA 3I6TA 2OZTA 3FV9A 3T8QA 4A3RA 3OTRA 4A35A 3UXKA 3NZGA 3D46A 2AL2B 1MRAA 3D47A 3ZLGA 2XGZA 3ES8A 1SJAA 2QJJA 3IJIA 1JPMA 3H7VA 3DIPA 3UJFA 3OP2A 4GGHA 3SJNA 2PGWA 4GMEA 2GGGA 4KWSA 2PU0A 3MKCA 4HYRA 2OZ8A 4E8GA 3DFYA 4DX3A 3TW9A 4ENLA 2OQYA 3UCDA 1JDFA 3N6JA 1F9CA 1EC8A 2OQHA 4MGGA 2NQLA 4GYPA 3H8AA 2OO6A 3IK4A 2OPJA 3DGBA 4Z17A 1W6TA 3DG6A 4G7FA 3N4FA 5FJRA 3QKEA 4GYPC 1R0MA 4IL0A 5ENLA 2PA6A 3DERA 1ELSA 4IP4A 3V5CA 2PP3A 1ONEA 2AKMA 2PMQA 3CK5A 3CXOA 3TJIA 4H83A 4IZGA 3GC2A 4MMWA 1R6WA 3SQSA 1SJDA 4E4UA 1P43A 3R11A 3MY9A 4HPNA 3TJ4A 3MUCA 3QPEA 4KEMA 1PDYA 1EBGA 3RO6A 2QVHA 3IJLA 3NFUA 5J04A 1JCTA 3IJQA 5FJTA 5BOFA 2P88A 2OFJA 3N6HA 3OPSA 3ZVHB 3QN3A 3VC6A 3OW1A 3RITA 2PTXA 1L8PA 2PTYA 1MNSA 3VCNA 3JVAA 3MWCA 4DYEA 2PTZA 3DESA 2XH2A 3TQPA 3DG7A 2HNEA 3FJ4A 2RDXA
chains in the Genus database with same CATH superfamily
4XWUA 2E77A 1A49A 4DWDA 4OE7A 1CX9A 1K77A 4UQAA 5BOEA 2WBAA 3CMJA 2Y89A 4PUMA 2POTA 4NJKA 4MKNA 3KOYA 3LCIA 3Q2DA 3RJYA 3QZ6A 3VIGA 1QT1A 3T09A 3Q4DA 3MCOA 2FJUB 3WQ8A 4QEEA 1ICPA 5FS7A 4WZHA 2HSAA 3EANA 1POJA 3VIKA 2RGMA 3DEQA 3GO2A 1AMYA 1P0NA 2OEKA 2YPIA 1VBHA 3CTTA 4C90A 3RIKA 3GYCA 3VDBA 1RBOB 4O1BA 2BHYA 1JCLA 4IP5A 1WXZA 4U2ZA 1GEQA 3QQ1A 1QOQA 3LLDA 4NVTA 2PU1A 2ZICA 3WLNA 1AVAA 3AWNA 1P1MA 2DSVA 2NQ9A 1K03A 2PWEA 4JHMA 1J8VA 1XDIA 3P0WA 4N2YA 4V27A 2WWDA 1AW2A 3AU6A 3UXIA 1UR0A 4Y2WA 1H50A 1Z32X 2QUNA 4LEQA 4J27A 4LUTB 1QWGA 2UY5A 1FKXA 3W83A 1ZSXA 5EBUA 4BHYA 4L56A 4H00A 2J78A 3GH7A 2ZZCA 3C2VA 1KQYA 2BY3A 1IIGA 4JTKA 3NYDA 4BURA 1VQZA 1TREA 3A4WA 5FJIA 4N4QA 1G7UA 3TU9A 2WWCA 2VFGA 5JBEA 4D8ZA 1NM9A 4PA8A 1GOWA 2CERA 2Q01A 1ICSA 2NT1A 4HVXA 5C8BB 3U9IA 4ZTXA 3VD9A 4FNRA 2E9MA 4EOUA 1LQ0A 3EOLA 3ZVHA 3DH7A 2ZZBA 3EBVA 5TIMA 1CXEA 4GIAA 3BSMA 3FHQA 1EH9A 1XLCA 2CLPA 1UPPA 1YPFA 3HW2A 1LUCB 2PP1A 3W2KA 1T8QA 5LNWA 1AH0A 1ZCOA 3KLJA 3NNTA 3W86A 1H51A 2IPJA 4DZ5A 2C6QA 1VFMA 2ATSA 3QJAA 4MB5A 3S5ZA 1B3WA 2PUZA 2A4AA 3F4DA 1VB9A 2J66A 5FSEC 2IQ0A 5IM51 2DT3A 1GOIA 4UCFA 3RX2A 3TAOA 2QGHA 3AHYA 3ITGA 2YIHA 1AZ1A 4M29A 2ZDRA 1T8XA 1TPEA 3W01A 2XUCA 2OX4A 1PKLA 3BLPX 2DVTA 2G3NA 1UH2A 3DJGX 3H21A 5C2GA 2VP8A 4BKNA 5JCNA 3MJMA 4JTIA 1VEOA 4IQDA 3SRDA 2VCAA 5FJPA 3GIYA 6TAAA 3QR3A 1OQFA 2O55A 4JTUA 3NPWA 3HG5A 3ARQA 2DQWA 3IK2A 2ICSA 4QXIA 4EQRA 4GJ1A 5E5CA 4QBXA 3WDIA 1EWDA 5C2CA 2V3DA 4QS6A 3OBEA 1OSEA 4DZHA 1YW1A 3D5HA 4ZB0A 3AFBA 3BW3A 1HJVA 4GE8A 1JRCA 1JCMP 3DHDA 2J8TA 4JYEA 4LQ1A 2GGEA 1VLWA 2QCNA 3LTYA 4TQTA 1HJSA 4B5NA 8XIMA 1W2PA 1KTBA 3FSUA 3O06A 3S2CA 5CPSA 3ZT7A 3EXSA 4HU0A 1IYXA 2CLKA 2I9UA 4UXDA 4GOAA 5TR3A 4FX9A 2PP0A 2B4GA 1LWHA 3M0XA 4NL1A 5JXQA 1H11A 4WGXA 3RRAA 2GVYA 4E4PA 4UTKA 3PNUA 3N3TA 5AHLA 1HXJA 2OEMA 3CGCA 2WPCA 3EAUA 7CGTA 4ICMA 3ANYA 3KVKA 1W1YA 2NZLA 9RUBA 4H7VA 4GXMA 4I9MA 1TELA 4JTFA 4PODA 1J96A 1R38A 3OP2A 4O12A 7REQA 5CKSA 3VGGA 2QMJA 2VR4A 5CPQA 5AN7A 4AIBA 4JS3A 2FZBA 3DFTA 1NTHA 4N6EA 1ZBVA 1UOZA 2D2GA 4BEUA 4Z2IA 4C6IA 4PMRA 1FDJA 1DKWA 4PUDA 2FVMA 3LXDA 2ASHA 3W7RA 2CU0A 2P53A 2WMIA 1N5XA 4XUGA 1A5SA 2PZ0A 3EWWA 1IZKA 2NV2A 3N4FA 4HA1A 5EYWA 2HBXA 4G56A 4UQCA 4UQDA 4QLLA 1GPFA 3TKFA 4DIAA 4S2BA 3DERA 1TTPA 2B7NA 4US6A 3FYPA 3GM8A 2DT0A 3II1A 2PP3A 4EXBA 1CLKA 2ZUMA 4JIPA 4TVUA 1MRQA 1VRXA 3DCPA 3MANA 1QNOA 4CVWA 5I02A 1I1XA 2C7FA 1GYLA 1SW3A 2CBJA 3SR6B 1C91A 3VZZA 5JH1A 3H26A 1GRBA 2GZXA 3WFAA 1MO9A 4LYPA 1XBVA 3H4XA 3TMLA 2O9PA 1XYMA 1TR9A 3W38A 1CBGA 5E0CA 2WSPA 4PUWA 4H4UA 1VFOA 4NJGA 3LCGA 1S3TC 1E56A 4O11A 3ZVHB 4H4IA 3QMTA 5G1MA 1JQXA 1PVNA 4JICA 3CUJA 3PZMA 3L8KA 3S5YA 2BG5A 3VYLA 4BWLA 1UMYA 3KZSA 3P82A 1H5YA 4LOCA 3H54A 1THFD 3UZXA 5KVIA 1GEHA 3BG9A 3V75A 3QV8A 2WMFA 1LQAA 1E6RA 3R8HA 3W7IA 1XKJA 1J5SA 1QI2A 4H04A 3FX4A 3N25A 3CAKA 3CQJA 1HN1A 2RAGA 3HPFA 3MZNA 1EIBA 2HVMA 2J47A 1YDYA 3M44A 2BY2A 4WEVX 2DFAA 4GWEA 1FWRA 3VKCA 1QW9A 4Z0SA 3KTXA 3GVQA 4U3CA 2J7HA 1GORA 2V5DA 2BVDA 3CV2A 1LRQA 3BLIA 1QO5A 4IJBA 1AQMA 5EMKA 3IGXA 1XLIA 3AMCA 3HV8A 3BAIA 2ISWA 4O52A 5CZJA 1VZWA 3UR2A 2R6OA 1S2AA 2RGLA 1EJVC 1NY1A 1OFBA 8TIMA 4O8RA 3SCUA 1GG1A 1ENUA 2O56A 4GRTA 2QUTA 4MUZA 2GVEA 3QY8A 2Z2AA 4HYVA 4AY7A 4FNUA 4P5UA 3DXIA 1QO2A 3QTPA 1TMHA 2AQOA 1FHUA 6REQA 1J11A 3AS2A 4E2OA 1S46A 2FGLA 1DVJA 4M81A 3TH6A 3CXBA 1UKTA 3VKAA 2TPRA 1LQ2A 4LNYA 3OZMA 4O16A 4UTUA 3URNA 3I6RA 1GQNA 1JXJA 1XYLA 1I2QA 1ZUAX 3IIVA 3RHGA 2B81A 4R33A 1QWKA 3M7WA 3BE7A 1B90A 3U7BA 1W9UA 2VFDA 2Z2UA 1JPHA 3VXGA 3A6OA 4JTRA 4NNCA 1XSKA 3SW6A 1M7PA 1MDRA 3T4WA 1XIJA 1BQGA 2WXDM 3WK0A 4H41A 4UTIA 2OJPA 3G6MA 2ZQ0A 4OTKA 2VVNA 3E0VA 1XLBA 4EX4A 1EGZA 3OQEA 4AD1A 3E49A 3S6DA 1B4KA 5F4XA 2VGFA 2VD9A 3OHMB 4MNLA 1GHRA 4G5DA 1S39A 2QIWA 3W1LA 4RNHA 7REQB 4P7NA 4J1OA 2VXNA 1Q6LA 4ERAA 1CXHA 3KDNA 4B9YA 2GL5A 4Q8WA 1B5TA 4J3TA 1XH0A 4WLCA 1Q7ZA 1HJXA 3OVRA 4EAYA 3RDKA 1YTDA 3L4UA 3L4YA 4A4AA 4S39A 1B1YA 2I16A 3QHNA 2ADAA 2WMIB 1FWTA 2WAGA 2NX3A 4M51A 4Q4OA 1VIZA 4QE4A 1XIIA 1EF2A 4Y6GA 4A2RA 3BGJA 1R9XA 2G4FA 3W0KA 3SUTA 3NVDA 1T96A 1GUVA 1KR1A 1XW8A 2AQVA 4APNA 3ATZA 1B2YA 3DK4A 2DJXA 2NQZA 3AXKA 5HNTA 1AK5A 3V36A 2OCZA 3LHYA 1G01A 2J8GA 3W73A 2AAAA 2PDFA 4LS1A 3W85A 2OTDA 2G97A 4GISA 5DT7A 4H4SA 2QUUA 3K1GA 3LEPA 3UGVA 1TRIA 1OK4A 2OYMA 1JYNA 2JKAA 1QR7A 2HQMA 3T1GA 1F8IA 1RVKA 2W67A 2R24A 2AOSA 1XD0A 3UGRA 5JUVA 3QOMA 3CB3A 1KLYA 4QFUA 1T40A 3SSZA 1YKWA 1U33A 5DBTA 1N55A 3KL5A 2BNJA 3W1UA 4L80A 5IOBA 2D23A 3LNMA 2CZ5A 3KCJA 1M7OA 2IS7A 4MNKA 1T99A 3N4EA 3EDDA 1GPWA 2WSQA 4LX4A 2JBMA 3KHDA 5HNUA 2E1DA 3I10A 3RU8X 4HHHA 3HFTA 2OWCA 1V6UA 4ATDA 3FJ6A 1Q6OA 1W5NA 4F0RA 2PDJA 2EG7A 3HMCA 4KEVA 3VMOA 1AMKA 4PL1A 4S3FA 4DLFA 4I5XA 3TYEA 1BZLA 2ZX5A 4H6KA 4ZO7A 4AD5A 3CPGA 1BAGA 3LS9A 3EWZA 5H91A 4MY9A 1FTXA 5D2XA 1FFQA 5CC6A 4DZIA 1B54A 2HISA 1JJKA 2TRSA 3A5VA 1K7FA 3DFYA 5H2ZA 3V7PA 3UZZA 3GG0A 4RR4A 5K4XA 1AW1A 3QFWA 4Y9AA 1DWAM 3R4IA 3STFA 2CZFA 5FJJA 4NUWA 5D38A 1KFKA 3QV6A 1REQA 2WPEA 5FJRA 1MXDA 2F6XA 1JEZA 5C9WA 4IPJA 3EA3A 2J27A 1B0IA 3TFCA 3BAKA 2A85A 4EVZA 1XKYA 4J40A 3W24A 4IGHA 3KWXA 4TXEA 4ZMGA 3R11A 1HF6A 1B30A 4U5KA 4H7ZA 5A95A 4EANA 2QKFA 1NWRA 3SQLA 2VKZG 1PDYA 5IFTA 4S3JA 2HTMA 3W82A 2BC1A 5A6TC 3KVMA 3B0UX 2Z1SA 2W62A 1DJYA 2Z1VA 1E6PA 3L2LA 4LYRA 1VLIA 4GIEA 3M4HA 2DIEA 3ITOA 4BF9A 1FFRA 1UG6A 1K7EA 3AYSA 4HMEA 1MNSA 5D02A 1DL3A 1ME8A 4FA3A 3NWRA 1XM3A 4HZ8A 1NOUA 3VVGA 5G4EA 1GVIA 3O8AA 4YCPA 3WK3A 5LIXX 2NLIA 3BZGA 3T0TA 1BQCA 2ZOXA 4BCEA 1QDSA 3AIVA 1E55A 3W1XA 3VU2A 3JR2A 1X98A 4LBRA 4TUFA 4C1LA 1CT5A 4RE2A 4NILA 3BQ5A 2VELA 1POKA 4TR9A 3SCNA 1CGXA 3BCJA 1YXCA 1XBYA 3C0JA 3BVJA 3LBOA 2X8HA 2C0HA 2PF8A 2QIIA 3E2VA 4DBWA 1UB3A 1M6JA 2O9RA 2V3EA 3GQYA 3N2OA 3F5LA 1AZ2A 4N9EA 1IXOA 2FIQA 1KBBA 2OKOA 4GC3A 3VZXA 3WL1A 2X1SA 3MYOA 3FXYA 2VC6A 3VINA 3VUSA 1Z69A 1QU4A 1I45A 3WF1A 3EWYA 5C9ZA 4PB5A 5EL1A 1J2BA 1KTNA 4YWIA 1UPMB 1F8WA 3GXMA 3UXLA 1E6SM 2GJNA 3OYZA 4O1FA 3F2CA 4NNAA 1H7OA 2HCVA 3SFKA 1E71M 4FI4A 2G8ZA 3UW6A 4RLIA 1MYRA 3E02A 4D6FA 3M9YA 7TAAA 3M5YA 3GUWA 2Y5EA 3N14A 3ITXA 4HTBA 4DPQA 2CEQA 5CCZA 4AIOA 2QCHA 3VE9A 4DM1A 1WUEA 1RCQA 4FOKA 4EXAA 4QDMA 3TQVA 3U8GA 3F03K 5FD0A 4H1ZA 3W88A 3GW0A 2C1HA 3C2OA 1UBSA 2A3CA 4N9BA 2YVFA 1H7RA 3INPA 1FA2A 1E1CB 1TR1A 3RMJA 4FO4A 3S83A 4Q8MA 4WR3A 1SJBA 3B03A 4GNKB 1M7XA 4EQWA 2PGEA 1LBLA 3II4A 2NXIA 1DIKA 1OCBA 2DU2A 2RKXA 4KWUA 4M6UA 1DQUA 2BX7A 4MNJA 4MWAC 1REQB 2XISA 3B9DA 4GO8A 4B3ZA 4HZ6A 1JZ4A 2INZA 2UWFA 4PRWA 4IL2A 3W81A 4XZWA 4NJHA 1LROA 3TXZA 3WLMA 4K7YA 1CB2A 2PC8A 2C3ZA 4HCDA 1PTDA 5IXEA 1C3FA 2V5JA 1S2CA 4NSBA 5BU6A 1DXLA 5FS8A 3PULA 2XH0A 3IRDA 4I9AA 4U2YA 2W5FA 4N9DA 3UJRA 2CW6A 3CEUA 4DXKA 1TB3A 1JCYA 3AXIA 2YXGA 3LRMA 4GLEA 1YNYA 4B4HA 2GDVA 3CQKA 2VZTA 4XKYA 3A4XA 2DJLA 4Z1YA 2J4GA 2D2JA 1ZAHA 3GBDA 2YCKX 1UH4A 3C2EA 2F5ZA 5CZTA 3S3GA 4D72A 3KL0A 1DPMA 2JEQA 3H2EA 5FEPA 3B97A 2V81A 2CPUA 2ACUA 3FSTA 1SZEA 3RLVA 2QDEA 2OB3A 4XAYA 2AMXA 2HZGA 1DWFM 2EAWA 3HBLA 2FZNA 1TYTA 4HP5A 2I17A 2VUNA 1X7IA 4BY3A 5C2XA 1BVNP 2VR2A 3HF3A 3K5XA 1IV8A 1V6WA 1YE6A 2FQIA 1H49A 2I7GA 1JUBA 3FV9A 1OY0A 2FVKA 2XINA 1F4AA 2D2OA 3CWOX 4OHQA 4IXHA 3KZPA 4HJFA 2A0NA 1MRAA 4KGLA 2O7SA 3LCFA 4IX2A 1C9DA 1HJUA 2Q6ZA 4EF9A 3ZT6A 1JDCA 2ZWZA 3AC0A 1Q5MA 4HSNA 3MCMA 5HWNA 1XLDA 2GQ3A 4GFSA 4RNFA 2VGBA 1OYBA 2ZUUA 1IE7C 3AZRA 4J3VA 4Q6XA 2FZMA 3EOEA 3CQ0A 4MF4A 4O15A 2PDKA 3NQEA 4NAFA 4IQLA 3H2CA 3H8AA 1R9ZA 2WOWA 3NQ6A 4OU1A 1B9BA 3IK4A 3W26A 1VKFA 3MDUA 2PDWA 2Y0FA 1HJQA 1NP2A 3WQGA 3FN9A 1Q13A 1GJUA 3QW3A 2DZBA 1H5VA 2X8RA 2BHUA 4IL0A 1ZGDA 4PMOA 4PC8A 4OWGA 2PWDA 1RQHA 4JQ9A 3W53A 2EPKX 1V03A 2GH5A 5E9XA 3WYZA 1GZGA 4IFRA 4UFKA 3U2CA 5LNSA 4MMWA 2OEJA 1SJDA 1Z41A 1IWBA 4OIFA 1TVNA 3W2LA 5I5RA 2NUWA 3SGGA 4L6HA 1FXQA 5CC3A 3NZRA 3H55A 1MOKA 3MUCA 4UOQA 5CPOA 3E3HA 4IIHA 1WZKA 3WH5A 4CQ8A 1JCXA 2OSYA 4FNTA 4LBSA 5A8GA 4Y7EA 4YTRA 5C9XA 1MEIA 2ZTJA 2ZRXA 1JYVA 3OHIA 5LXXA 1JDAA 2GR0A 2VFIA 3E2QA 1NWTA 4F9DA 3WL0A 4C6KA 1FCQA 2C16A 3N9SA 2PTYA 4LC8A 1BKSA 5HAOA 3ZXWA 1Q66A 2UY3A 3ARUA 5I2UA 4U33A 1SO4A 2PLKA 4OGZA 1LWJA 3W6LA 2YAUA 2Q02A 2VRJA 2NPXA 3S0CA 3APGA 1BF6A 1UP2A 2WJZA 1W3HA 1GERA 4FDCB 2OLSA 3IIZA 2VENA 2VVSA 3SZ8A 5HNRA 3U5YA 2D3NA 3QV7A 3CGBA 2GVGA 1GESA 4HCHA 4HZMA 1ME7A 3WG6A 4Z0JA 1HZYA 1VFFA 1ZP4A 1ZNNA 3GDTA 3MI2A 4O0QA 3T44A 3VNZA 3KOZA 3PBVA 4WKFA 4B91A 3O3RA 1V02A 1NQ6A 1UUOA 3EWDA 1NHSA 4ADWA 1W8GA 2QUVA 1OIFA 3HPSA 3W9ZA 2EJAA 2CLOA 1K4HA 4JEQA 2NQJA 3G77A 2FGZA 4O1CA 1FY6A 3AIUA 1BKHA 2NVCA 3FK4A 1O1ZA 3TOPA 3WZ0E 3RR1A 4D6CA 3CM4A 4MY1A 3DENA 4ZR8A 3ELFA 3K46A 4ICCX 2GVJA 1C8QA 4XKYB 1DJZA 1XD1A 4H9ZA 3L5OA 2NWRA 4E6MA 4J3ZA 1E0WA 4NHVA 3LRLA 1F6YA 3QLDA 1EBHA 1V51A 1Y5WA 4H4WA 3K13A 1HP5A 3E12A 1S3HA 4YMZA 1SVDA 5EU9A 1JYXA 4HOWA 2Z24A 1V6YA 2OX1A 1WB0A 3EMZA 4HNVA 4R9XA 1GETA 1VFSA 3G1DA 4R88A 4GVFA 1LLWA 1V0LA 4UR7A 4QQ3A 2VX5A 3PUOA 4KPLA 3CTLA 2EG8A 1D8WA 3CUXA 3OGSA 4PBFA 1UW9A 2KZHA 5LIYX 3OLIA 3BARA 1M9HA 4XAPA 4A3YA 2VFHA 1FWJC 2IKHA 3K8KA 4US5D 2JKPA 4DRSA 2GQWA 5AB3A 2CYGA 4U28A 3TYBA 4B2DD 3QHOA 2A8XA 3BJSA 3JS3A 1HQTA 3SCSA 3BV7A 4WHBA 4UUIA 3WLSA 2YZRA 4ROQA 3CYJA 1QHOA 4MDPA 1KFWA 4S3CA 4UQ9A 4C7GA 1MQQA 5LHFA 1R7OA 2D0GA 3LCHA 4UTWC 1YX1A 5D9MA 5CSSA 3WJYA 5LNUA 1V0KA 4RK8A 4D6EA 3WBEA 3IIXA 4MJ2A 3WEZA 3CWHA 3RNMA 1G4PA 3WUBA 3PBMA 4TOQA 3SN0A 3PZQA 5J5DA 4YLWA 4HNUA 1QI0A 4JNMA 3NEHA 1WDWA 3EPNA 4HNOA 4GA8A 1V93A 1YEYA 1F61A 4DF0A 2XDFA 5CEWA 2ONEA 5FF0A 2PDNA 1HKWA 3AJ7A 1EDGA 4ZOCA 3V1HA 2QPSA 4KH2A 1YQZA 4IG2B 3NPXA 5HBFA 4EK7A 4DWSB 4W8BA 4QM1A 1EP1A 2W79A 3NPVA 3VDCA 4CUCA 2X50A 1WKYA 1ZBWA 1JPDX 3IJDA 2CHRA 1PKYA 2HK1A 3VPLA 4E3VA 4W7VA 3QOKA 1W0MA 4AEEA 3ABOA 1EHAA 3FA5A 1FX6A 5C6MA 5CQ1A 2VR5A 4P8UA 3ITCA 1S1PA 2ZUNA 2YA0A 5JCIA 1PDZA 3OZYA 3HPXA 1WDQA 5HQEA 3W3OA 4FXJA 4XZ9A 3QV9A 5FJUA 5HR7A 4PMNA 2HS6A 1GKQA 2VGGA 1OD0A 2YLAA 1E15A 1DBTA 2GPTA 3VX0A 4E5TA 3M0LA 3AXMA 2Y2WA 1HVQA 4L9ZA 2GOKA 3PS7A 3GNXA 1Q6CA 4DXVA 1R30A 5FI8A 2NV1A 3F2DA 3W1RA 3MUIA 5B80A 1WXJA 5D8WA 3LPFA 2EG6A 1H62A 3R8GA 1MEWA 1AG1O 1XIGA 4AZIA 3UZ5A 1UROA 3R43A 3T8QA 3MKVA 3CUIA 4FNSA 1IXPA 3V0SA 4QE1A 4W5ZA 3W7MA 5CJ5A 1TIMA 1KNWA 4MUPA 1XH1A 5ECVA 4QLKA 1QMLA 1TWDA 1HKJA 3L0NA 3LV5A 4GGHA 2QYGA 1E72M 3ZM8A 4PCFA 1TX2A 4HZ7A 4KS0A 2XVLA 3DKLA 1ISZA 2XN1A 2ATMA 4O54A 1A5NC 3W6MA 4JIRA 3C61A 3KXQA 2O4QA 4RDVA 3P80A 2EXOA 2VUYA 3LCWA 2Q3RA 1CXFA 2FLIA 3BLKA 4BZYA 1ZXIC 3CPUA 3BG5A 3W7PA 4J7RA 2OOFA 3RPTA 3K1DA 4LPCA 4I7VA 1R0MA 1TJ1A 4KPRA 4NASA 3T78A 3CQIA 2VYOA 1HW6A 4RZ5A 1I0DA 1YPXA 4PUJA 3QQ0A 2CWNA 3P60A 1G9HA 2PURA 4C6OA 2XG9A 2YCLB 3UWUA 5HANA 5I03A 3ZJ7A 3W72A 4MB4A 2W0UA 3POHA 3GNPA 4WJ8A 1C92A 1EF3A 5AHEA 1S5MA 4FF7A 3B4YA 3ZR4A 4HPNA 3K4AA 3SUUA 5HR6A 1QK0A 4NAEA 2VX4A 1MEHA 3SDOA 1ZTVA 4EF8A 5G4HC 3PVFA 5BOFA 2OFJA 2VZUA 3SGZA 1KTCA 5KZEA 3LXCA 3VC6A 1CGTA 1Q2SA 4MLRA 1QI5A 3C8FA 6CGTA 1W1VA 2E5CA 4D71A 4UFLA 4GYFA 3SUVA 3RR4A 1OWQA 2A1YA 1TA3A 3HM7A 1RY8A 4LANA 3VNYA 4CLMA 5LSMA 3EAOA 1UKPA 3M47A 2VHLA 1G4EA 1UD5A 3D0CA 2EQDA 5E6ZA 1CXLA 2PTDA 1U5VA 3URHA 1KKOA 1QI3A 4EMJA 1XPYA 2WZMA 3LENA 2A2IA 2IKJA 4F8XA 2XWEA 4B3LA 2SFPA 1XFBA 3GDBA 3FGCA 4CQAA 3BOLA 4JTEA 2E68A 1I0BA 3HOJA 2PTWA 2Z27A 3PZIA 1XLHA 4F2TA 2HPMA 3PY2A 2QAFA 3LSBA 1DHKA 1DXIA 4KFPA 3S47A 1Q4NX 5B7YA 3KWSA 4QSHA 2HS8A 4XAGA 4H3DA 3JZEA 3GC4A 2WLYA 1TWWA 4Q4QA 5ABEA 2YR1A 2PBGA 2E1WA 3AS1A 5HXMA 1C8YA 5EMUA 4LF2A 3FJNA 1OFEA 1N62C 3MSYA 3REQB 1YNQA 2BVWA 3WUGA 4WY0F 1MDLA 5C0QA 1OIMA 3L4ZA 4S3BA 3TJXA 1PJ9A 1J18A 3FFSA 4YWOA 2D22A 3OQ8A 1TPB1 3LI0A 4RW3A 5DY3A 4AAJA 2J7FA 1UMLA 4UTMA 3SY8A 1SJCA 1W3JA 1R2TA 2HROA 3MYPA 2Q8ZA 4AIUA 3STPA 1TUXA 1ZJIA 2GSJA 1P7TA 7A3HA 4G7EA 3AZSA 2IKIA 4A21A 4US5A 4AZCB 3GTHA 4S3KA 1A5LC 3VOGA 4PSRA 3WLRA 5TBOA 1LJYA 4B2DA 3AISA 1PCWA 1BRLA 2V6OA 4X2PA 4ERIA 1EA9C 3WQWA 1NOFA 3W7JA 2EO7A 3PANA 3LHZA 3LHVA 1R3YA 1FUYA 2Y5SA 1CECA 2JK2A 1TJPA 3CGDA 4W9TA 1UZDA 1VFTA 3S2JA 4PMZA 3OJGA 2J62A 4PN2A 4A8NA 4QAIA 5D9NA 1E43A 2PLJA 3R2GA 2BOEX 2CFFA 3GKFA 4MPQA 1PBGA 1YBQA 3H2NA 3CZ8A 4UMAA 4FIRA 3PFRA 4C65A 1OX5A 4H9XA 3WLJA 2RDWA 1WQ5A 1DXFA 3LA4A 5CJMA 1OZQA 3NA8A 4H2HA 1E0UA 4L4PA 3UYIA 4H4VA 2XH4A 3WF0A 3W25A 4IGNA 4AMCA 1X97A 4JPGA 3AO0A 1KM1A 4M24A 4O53A 4Y9NA 2BTMA 2Z0IA 4WDWA 1ONXA 1ZL1A 2RJGA 2V82A 4I3GA 4MKSA 4RE0A 3VDAA 2C3CA 4HPJA 3N1AA 3GAKA 4F48A 2WKGA 5E6YA 2HRWA 4FNPA 2OYKA 2V3GA 2OXNA 2CXEA 1QNRA 2DUZA 3WLLA 1CGWA 1TV3A 5IDZA 4KCTA 1FH9A 1EGMA 4XD4A 2A5HA 2VQUA 1IIHA 1NVMA 3L7RA 3HGOA 4FXSA 4FF5A 3T2OA 1I2NA 3CL8A 1A3XA 3ZJ8A 3N9RA 2GGJA 3GFZA 3M0IA 2YBTA 4ES4A 1XCXA 2QF8A 3ZVIA 4PTVA 1LBMA 1KWKA 4CU6A 4YVVA 3UWYA 2WV8A 3U2EA 4PRTA 4GYJA 2CKRA 4JX6A 3OG3A 1E9YB 3QSRA 2D20A 3TLLA 3SO7A 1UYQA 3IRSA 4LGXA 5DRCA 2F9RA 4GI8A 3VNLA 2Y8KA 3S5NA 1OD8A 3DU0A 3N9KA 3NVZB 1XV8A 1OGGA 2QZRA 2OG9A 3VOIA 1ZPTA 3FOKA 1GQIA 4WVXA 1X1OA 4K36A 3BWWA 1D7KA 4H4QA 2D2HA 1WAWA 3UF9A 3FGCB 1HO1A 5I6SA 2X0HA 2PD5A 4A3RA 1LL4A 3PR2A 2WJFA 4JBRA 4TV5A 2BP1A 3VIMA 2XGZA 2RFGA 3C8NA 4X22A 1RA0A 4DELA 5CG7A 1PUDA 3DIPA 4PYSA 4ACYA 5D09A 4JAWA 5U25A 3OGRA 5SWUA 3VKKA 1JGIA 3WD0A 2PDQA 5XINA 3L21A 3HPZA 3N19B 3SY5A 4RZ6A 3E2SA 4G2DA 4A3QA 3TN6A 1EJ7L 5CC7A 2OQHA 4TO8A 2GJXA 2XSBA 3Q37A 4B5UA 1HKKA 1JD9A 2A3LA 2VEKA 3NGFA 3TN3A 2PF0A 4Y90A 5BU9A 3MP4A 3KRZA 3EX3A 4JYDA 1XR2A 4GYPC 4ZGYA 4AZ5A 1JF6A 5C70A 1LCOA 4PTNA 4WJEA 2PA6A 1VC4A 4QG6A 4PMQA 3GG8A 1XC6A 3TJLA 4C6CA 2ZUVA 3MJYA 4ATLA 4G7EB 2C13A 3RAOA 1YYAA 3XINA 3MMDA 1SYTA 1BTMA 1P43A 2H90A 1BWCA 1B3YA 3A3HA 2KX9A 1PHQA 3RX3A 3TN5A 2YXXA 4DLMA 1Q8JA 3H24A 4JQAA 1XYBA 3KBMA 3GRSA 3KLKA 4L61A 1U2YA 1JCTA 5AC7A 3MWAA 3IJQA 3LU2A 1C9WA 3W02A 3LLFA 2NSOA 3ABSA 3FAWA 3SIMA 1KR0A 4DNMA 4GUFA 2F84A 4Q3MA 5KITA 1YBQB 2QPUA 3DHPA 1VCFA 3UVAA 4LEFA 3T0AA 3CL7A 3KRBA 1HX0A 3F4NA 4EACA 4IOTA 3FKKA 2C1IA 3WKZA 1OZMA 4PGLA 3FNDA 4FOUA 3H22A 1GCYA 1L2UA 1IF2A 1DWGM 3NIYA 3AM9A 1OCNA 4NQ1A 3U3HA 4IMCA 1KRAC 5I79A 1VPQA 1QHZA 4JN7A 5LIUX 1MW2A 3UPMA 3NVTA 1DQXA 3DFOA 1RD6A 2FB2A 1A50A 3H70A 3S1GA 3I3DA 1TVPA 2GUUA 2O9OA 4P2VA 4Q22A 2WYSA 3MBDA 1LRNA 2ZRWA 4NNBA 3MDWA 1E3XA 1RH9A 3LHUA 4AIEA 1SO5A 4D6GA 1FHVA 4LU0A 3T6CA 1UHVA 3GTFA 1ADDA 1KCZA 4RNJA 3VC5A 4J9JA 4EE9A 5FAJA 3ZLFA 3MHUA 2J79A 3D6NA 4KIEA 1B9ZA 2P3ZA 4LXFA 2W63A 1ECQA 2X2GA 4AY8A 3IJ9A 3M64A 2ZADA 4WK9A 3VK5A 1EJXC 2X1IA 1ZY9A 1Q6FA 4D8AA 4TU1A 1A5OC 2F8QA 3F4WA 1QPOA 3FW6A 3O16A 4HBKA 5T26A 1G4TA 4HNCA 4YIWA 4S1FA 2I57A 4PFHA 2CXGA 3U4FA 1JGMA 3PJWA 1VEPA 4BI7A 4HSOA 5A5WA 2UY4A 4XISA 2J6XA 4ACZB 3HG4A 1E70M 2ZWYA 3DYPA 3BW2A 2XFWA 3ZS4A 4G8TA 4ZL1A 4JIHA 1US2A 2GWGA 3VDGA 1WDDA 3CBWA 2IXUA 1K8YA 2HXUA 2EPLX 4J3WA 2ABBA 2HXTA 1PZ2A 2W54A 3UETA 3W1TA 3VD4A 2FPYA 4QLJA 5D2VA 2FVLA 4EWJA 5GQBA 1TO3A 3CB8A 2C15A 1E6XM 4QQUA 4C1NA 5HJXA 2CWXA 3PWIA 4B5SA 4CEUC 3WIJA 3AMLA 3MO4A 3TK7A 1GKRA 2OKTA 3QZAA 2NQHA 4TVCA 2EQ8A 2WANA 3A23A 2YL9A 3CGEA 3L65A 3TR2A 3NDYA 3ONBA 4QNWA 1RP9A 2Z25A 1KBJA 1O66A 4MWAD 4AC1X 4F9JA 1L8NA 2A3AA 3GZ3A 4DJEC 2DUAA 3AUOA 4HA3A 1PS9A 1WDRA 2EQ6A 4H8VA 3ARXA 3MUZ1 2XSXA 2I1OA 1FWSA 4JR5A 5IHSA 3KTSA 2CNCA 4AU0A 5BXTA 3L0KA 2ZX7A 4LAMA 3MV01 1EJSC 1OVDA 1EOMA 4AB4A 2E8ZA 3DAQA 1SW0A 4KKXA 3UG4A 4E4FA 3R25A 3T42A 3M7SA 2YDAA 3LN3A 4MYAA 1CW2A 4FX8A 4A8RA 4H01A 2YGYA 2D69A 3UPWA 1Y8BA 1R2SA 2BB0A 1VJIA 4MB1A 2Z4GA 3DGRA 4XUYA 2ZRYA 5RUBA 2GOUA 2DZWA 1I2PA 2W27A 3NSNA 3JUGA 4IPPA 3WF4A 2Z1BA 2VCCA 1MSSA 2J7BA 1ZCCA 1GHSA 4BQ2A 3H4KA 4A2SA 5BWAA 3C2RA 1ALDA 1I9CB 2QULA 2QF7A 3VNJA 3NZGA 5EA9A 3KTCA 2BMBA 3EDKA 4XBSA 1F76A 1LWIA 3NPUA 4CQ9A 3NVVB 3IJIA 1JPMA 1EIXA 3ARRA 4N0RA 2YFOA 5F4WA 3LM3A 3CZJA 1GG0A 1QVBA 5LGZA 1J0YA 4AC7C 3PC0A 1DJQA 3K2GA 5TQLA 3A24A 4CGTA 4IFOA 4A29A 1JDFA 2C1GA 1CWYA 1XGZA 2V9DA 4AVFA 4K38A 3HTWA 2OGYA 2NUXA 4ZQRA 3OA5A 2A21A 2OPJA 1EP2A 5CZ0A 3BLEA 1B57A 1WYGA 4PUUA 1WX0A 1NHRA 1WV2A 2CHNA 1A5CA 1V97A 2CIPA 4NZ3A 4AX6A 3BCFA 5GJNA 1IZCA 1UP0A 3PZVA 3ZQ9A 1YADA 2FZ8A 1KM3A 2VD8A 2X1TA 4UFIA 1KM4A 3B0XA 1H41A 1R6WA 5CBJA 4JTJA 2J88A 4F79A 2X8CA 1S2VA 4FALA 1JEHA 3GHSA 1EKOA 5AOUA 1N82A 2PDBA 1AQHA 1FWHC 3H7UA 1M04A 1A5KC 1ADOA 1UASA 5LNVA 5AKQA 3DBNA 1K6AA 1OJXA 1E9LA 2PRMA 3GSMA 3F4VA 1LLZA 3ZIZA 3U6WA 3UPBA 4RXGA 1AJ2A 2W92A 1Z3NA 4QSFA 3LXBA 3OW1A 2WB5A 3N12A 2G50A 2BASA 2Y85A 1GOXA 1X39A 4XX6A 2Y4SA 3MB9A 3VCNA 5C54A 3VX1A 2BFGA 5KETA 3ABZA 3WH8A 1QW7A 4WX2A 2KAUC 2BXZA 3MUAA 5E0KA 3TQPA 4C1NB 3PG9A 4NEWA 1E9ZB 3HQOA 1B4EA 1D2KA 1KXVA 2HNEA 9CGTA 3LG3A 4EPBC 4QNEA 1WAUA 1QOPA 2D0HA 3A9BA 4IMEA 3EKZA 3B9NA 3HO8A 4TVWA 1ZJAA 2BHZA 3WBYA 4W8AA 1R3WA 3N17A 1TPFA 4IPNB 3N29A 2ZA2A 3I6EA 4HHLA 4M7TA 1PWMA 2PEVA 3VE7A 3AICA 1XCFA 3HQNA 1TZZA 4GBUA 1X2HA 4PMXA 1BVWA 3AU2A 2PSNA 6A3HA 4XO6A 1IR1A 3SQPA 4WJXA 3GRTA 2PDXA 4GQBA 1I8JA 4GIRA 3WLKX 4UCGA 2BV9A 3PWGA 3L4WA 1RLDA 3M0JA 3ORWA 3CUFA 3DFHA 3CV1A 4DUOA 3K8MA 3M1ZA 4GQRA 3SY1A 2E7FA 2YB4A 4W4QA 4PTMA 5LA1A 3OEXA 3ID7A 2ZZ2A 3KX6A 1YQ2A 3MI6A 4JTHA 3W7OA 4AZBA 1G0CA 7ENLA 1XLGA 1A4MA 4AEFA 4WXYA 4CNOA 4V15A 2H3BA 2WBGA 1DWIM 5REQA 2DSWA 4B5XA 1F7BA 4ZQCA 5H8MA 4HK5A 1GVEA 3G1XA 3R10A 4R53A 3PFMA 4NKCA 1JZ5A 2PI6A 4LALA 2DQXA 2F61A 2XH7A 3Q67A 1ML1A 3DGZA 3E96A 5BROA 4X2RA 2OODA 5JBFA 5CG0A 3RILA 1P0BA 4BK9A 5CH9A 2QJIA 1TZ7A 1JYWA 2P76A 5K3VA 3O05A 1UUMA 4QROA 1M65A 3C0SA 3U2ZA 3A9IA 2ISDA 1KM5A 5D30A 3RUBL 1WZMA 1JDDA 5HMFA 3NM3A 4Y8FA 1UIOA 4RE4A 2A3HA 4NU7A 2TYSA 3MHFA 3MSRA 4BWLC 1N60C 1SO3A 3F5KA 1Q1RA 3ARVA 4MYXA 4H9TA 4HN4A 2XIBA 3Q65A 3NXLA 4X0NA 3G1AA 1D9EA 1VHCA 1KGXA 3NL3A 2EHHA 5A6JA 2I56A 2YA1A 3CZEA 4MWAA 4HB7A 4XKMA 5BZAA 4YTQA 3NQ2A 2J24A 4GUJA 4UQEA 4IXXA 1WDSA 3GDLA 4KFNA 1DXEA 5FF2A 1ZX9A 3NQCA 3N2MA 3G3MA 5JH2A 3B40A 3FCPA 4W89A 4XG1A 1DQWA 4LVFA 5CPNA 4LCQA 3KEHA 3UXDA 5JIWA 2VC9A 4EPKA 2QS8A 1XIBA 1JR1A 3N2BA 1US0A 3DC0A 3PPHA 4IGMA 3EGJA 4R27A 4TX8A 3QY7A 4GZEA 3FA4A 2BGNE 3ZSSA 3O6DA 3ARYA 1I1WA 5GNYA 5KMYA 4Z2JA 4O0KA 2QQ6A 1IT8A 4QIUA 2FJKA 1E9IA 2CBVA 1VBUA 4JX4A 1EX1A 2V3BA 4KF1A 1ITCA 5J5RA 4L5ZA 3MV11 1N8WA 4K3ZA 1H09A 5DO8A 2BXYA 3O15A 2OWXA 4PMJA 3MA8A 2J75A 5K9DA 1PL9A 3CGTA 4QDPA 1E0XA 3QW4B 3RLGA 1HIZA 5AYIA 2QCDB 2BOFX 3WCZA 3ENLA 3U48A 3W76A 3S2MA 1RXOB 1W5PA 3LBMA 3VCRA 5HMEA 2WKLA 3TNBA 3UJ2A 1YTEA 4NX5A 3EMQA 1DIDA 4G1NA 1SO6A 4TTGA 1RBAA 3OTRA 4A35A 1UWTA 5BXRA 4HPXA 3N15A 1XINA 3D47A 3ZLGA 5BCAA 3NCOA 3UYCA 4WY0A 2WVTA 4YYFA 4GACA 4LVGA 3WNOA 3PTMA 3R6IA 2GGGA 3C5QA 1OX4B 3MKCA 3BUVA 3GXPA 4CQCA 2PWGA 1UR1A 1ZALA 1O6IA 2QUMA 4UNKA 3I7RA 5F1UA 2ZZ1A 2R82A 4QEHA 3TROA 2G3JA 4QITA 1MWOA 3LUTA 2HK0A 1FCVA 2CLFA 3I7SA 3W7LA 4O1DA 1EJUC 1EX5A 3P74A 2JF7A 3SCRA 3DGBA 5D03A 3BC9A 1XRFA 1V6XA 2W66A 4KERA 4Z2GA 1R3RA 5C9RA 2X1UA 2J9XA 3C3UA 4UZUA 1CCWB 4AVNA 1NHQA 2ZXAA 1GYNA 3VAVA 1XGEA 5ENLA 3LQGA 3TC7A 3TYZA 3W7HA 4TTUA 1ZK7A 5REQB 4K7ZA 1SM9A 4DJFC 2ZTKA 3BLDA 3S5OA 4H83A 1RA5A 3HGSA 4IZGA 2V68A 5XIAA 1MQRA 4EQSA 2OOGA 4A3UA 1M01A 2XIJA 3TYDA 3CNYA 3GR8A 2GVLA 3VIJA 2ZXDA 1IEVA 3NQ8A 2ZUWA 2QLYA 4L4MA 3AYVA 3TVAA 1V08A 3PJTA 1V3IA 1X38A 3HZ3A 5EFFA 1J12A 5T8GA 5H6HA 2YW4A 2WQDA 2P3EA 4Q8TA 2NUYA 3LHTA 3NFUA 2HEJA 4YL2A 1G1YA 1KC7A 1RQEA 4X61A 5AYYA 4DM2A 2A6LA 3EOUA 4N42A 3BZJA 3ZWSA 1WO2A 5G2WA 1E4NA 3QN3A 3CHVA 4WCJA 4UBPC 1MMFA 1HUVA 3GNOA 1SFTA 1AH4A 3SSJA 3PBUA 3BPWA 1KV5A 3O7UA 3KW3A 1OADA 4JQ2A 4DYEA 1ZHAA 4BV6A 3AN1A 1NHPA 1GRHA 2QAEA 2R14A 3NL6A 1ESWA 4AZHA 2Y7DA 5CSRA 4GO9A 4JIIX 1GRAA 1AOGA 1EYWA 3R58A 2VNCA 1H2IA 1SU5A 4A05A 1G7VA 2R1NA 5IRPA 1FEAA 2UV8G 2VOTA 4S23A 3ABQA 2QGYA 3WFLA 3LPOA 1H1ZA 2BZNA 4O19A 5CPLA 1D8CA 2P8CA 4H19A 1BPLB 1VRDA 2G5WA 2ACSA 3URBA 3KBVA 4W86A 1AH3A 3NZ1A 3T0BA 4WKAA 4HNTA 1OT1A 2TAAA 3LK6A 3L5MA 4E2DA 1MFUA 4K39A 1W32A 3WD1A 4MAVA 1YIXA 3Q94A 4C6QA 2P0OA 1S1RA 3TE9A 4KQNA 4L9YA 1A5BA 1FEBA 1U1JA 3LERA 4W85A 1OGSA 5CLWA 5CAKA 3LCXA 2G3IA 2ZE3A 4IIGA 4M1RA 4JHZA 1OFOA 4J35A 1NFBA 1BEUA 4C6EA 4D6HA 4LUYA 3RU6A 1VJZA 3W2UA 1IXNA 4Q7NA 1AD1A 3EXRA 1KFJA 5XIMA 4Z2HA 1T6MA 4WIWA 2Q09A 1CYGA 4DN1A 1Q6DA 4UTTC 2WCGA 2XN2A 4Z42C 2RDTA 5G5GB 1OCJA 1TV5A 2VMFA 3GVVA 1BD0A 2TODA 4K1GA 1FH7A 1Y65A 4E8DA 1BGGA 3FKRA 4ADTA 2WMKA 4JN6A 2EJ1A 3KL3A 5A8QA 2G37A 5ABFA 2XIQA 4RZ4A 3EF6A 3ITVA 2BGQA 4U5IA 1AQFA 4H9MA 2WC7A 1DTNA 4M8UA 1TV2A 3T05A 1EUNA 1S5WA 3G1SA 3K4WA 2C71A 3F7JA 5M1TA 3SBFA 1V02E 3W7CA 1SSGA 5JQ9A 5A8NA 1FECA 3W75A 4QTGA 1BF2A 1A47A 4LY4A 4UTWA 2EKGA 2JALA 4WY0B 1O1HA 4P7QA 5HQLA 5GVJA 3B8DA 1PX4A 4XZIA 2OYLA 4FXRA 3KHJA 4H4RA 1PZ0A 2RHGA 3OLGA 3TSBA 4O1AA 4YTTA 3TYUA 3TC6A 1GWJA 3IS4A 3EEGA 4ZOBA 3WNNA 3KBJA 3L23A 2ZZ4A 2OMAA 1Q4WA 3HURA 2WVUA 5KZ6A 2WBKA 2PGRA 1UBPC 3W1QA 3GY1A 3JZUA 5M03A 4H4YA 3E0WA 4ZE4A 2Y7FA 3PTDA 3OLDA 4LVDA 3TA6A 4D6JA 2REQA 2NXGA 5BRBA 2V3AA 5FS9A 2GGHA 5DQPA 3W7GA 5T9CE 5A8MA 2CHOA 3FYYA 3MSDA 2YBVA 1U83A 5CGQA 4H9YA 3S9YA 4O13A 4D2JA 3VIOA 4PUEA 4DO4A 3H53A 1E4IA 2E5DA 2GK1A 4AD2A 3PM6A 4UTLA 3SUSA 2Q8XA 2YOCA 4LUIA 4JL2A 3J7HA 1XRTA 4PMVA 1X6UA 4TX9A 2DSZA 3WLOA 1LYXA 2TPSA 2OGJA 2QDGA 2HE8A 3LXAA 2J25A 4ZE5A 1H0IA 4O8AA 5BW6A 4XK2A 3VOFA 3E0IA 1F8MA 4U3AA 1IGSA 3GVWA 3ISIX 3V1PA 3DJJA 2XIIA 1TMQA 3KE0A 1DTUA 4Z2LA 1RJPA 4JD4A 3M5XA 2EPOA 2J13A 3KBNA 4TMBA 2R94A 3MS8A 1V3JA 3H2AA 3CIWA 3AQUA 5DT5A 3KCOA 4GFIA 3ZOAA 1PHWA 5KTLA 1C8XA 4PEEA 4X3ZA 4JL1A 2XWDA 2E09A 3NRZB 4HHPA 4V28A 5LGXA 4RV3A 3ICJA 3GTIA 3R0KA 1QHPA 3UVIA 4FZIA 3AI0A 2OT1A 1OFAA 4J5NA 5CJNA 3B0PA 3UG8A 1RV8A 1JRPA 4UNIA 1ECEA 1PSCA 1VH7A 1PPIA 1C29A 2QJJA 4ONVA 5HMDA 5LNRA 1CEOA 2YSWA 1YHTA 4GY7A 1U1HA 3MSGA 4NZJA 4IP7A 5TF0A 2DP3A 4C6JA 1DIOA 1FP8A 2VDGA 1BGAA 1GW1A 1O5RA 1HG3A 4EXQA 4RKAA 4CEXC 5DCDA 3UESA 4KRUA 3RRXA 2WO5A 2ZA1A 3PBGA 4C6MA 3MZ2A 2P1FA 3QSTA 1Q65A 4OOUA 3DYOA 2EEXA 4PEKA 3GH5A 3SCQA 1QPRA 1XWYA 3WK2A 1K9DA 3BLLA 3T2QA 2X40A 5AHMA 4F0MA 3HA1A 1KFEA 1NWUA 1NH6A 5HUOA 2VEPA 4IFKA 2FPTA 3QGAC 3SECA 1B3VA 4F40A 1L9WA 3PAOA 4IWWA 1FWIC 2YXOA 4XBKA 1Z89A 1UA7A 2FZDA 1OGBA 4CNSA 4UNLA 1FCUA 4NY2A 1EDTA 2DZVA 3SADA 4F0LA 1AUSL 1ISWA 3CUZA 4KRZA 3USZA 1PB0A 4JTCA 3TTYA 2FFCA 2PDHA 4M5PA 4DJDC 1FFUC 4R7WA 1AJZA 4NF7A 4R34A 3QPEA 5LHEA 3XISA 1EHNA 3FDGA 4DPPA 1J93A 4CNUA 3COTA 4AD0A 3NUKA 1W37A 1BXBA 1LOLA 2X16A 1SQ7A 2P88A 3C2FA 3C56A 3OYXA 3C2YA 3NQGA 1UC5A 1KXQA 1E1FA 2A7PA 1L8PA 2CBIA 4Y9MA 3BAWA 3QH2A 3TP4A 3I7QA 1N8IA 4BQ5A 3OIHA 3H23A 4PBGA 2V38A 1W3TA 5AFDA 4Q8QA 1CZ1A 1SR9A 5EMYA 1HNYA 5B7ZA 3MCNA 1KXHA 2WPBA 3THQA 1BYCA 1Q7QA 4JTLA 5H8PA 4R9OA 3A12A 3FJ4A 3OBKA 5AVHA 3W1MA 4H4ZA 3IJ8A 5JMUA 4B5VA 3TSMA 3CASA 2QCEA 4WDUA 3RLUA 1NFPA 2P10A 1VJSA 2FH8A 3U0HA 1FHLA 3WJWA 1ITUA 1JVNA 2OSWA 1LL6A 1NF0A 4DAFA 2REQB 1OC5A 2VRKA 4IMGA 4MJ4A 3L2MA 2HQAA 5A6MA 4IQEA 4LF1A 3ZSTA 4E8CA 2C0AA 2B7OA 5J8LA 3ATYA 1A3HA 4P8VA 1VS1A 2GK1B 5HUPA 3W7EA 1FRBA 1T41A 2PS2A 3CU2A 3R7MA 3SCTA 3DFQA 2P8BA 1FH8A 4AG0A 2P5NA 2EGZA 4UWMA 4YN5A 3TAKA 4Q4KA 1UR9A 2YDSA 4MFDA 3CHDA 3WH7A 4R3UA 2EPHA 3SRHA 4HNLA 4EAMA 4GQ0A 3BQ6A 1R7AA 4HQVA 5D2TA 5CXPA 3ONCA 2WP6A 1EOKA 2G96A 3LB0A 4Q33A 4MY8A 1TE6A 3B9AA 4I8YA 3EYPA 4DWSC 3UXAA 3QFAA 4TMCA 4C7DA 1XLAA 4QISA 3QMSA 3S2LA 2FFIA 2W6RA 5E1QA 1ITXA 1H61A 1TQJA 2V63A 4M56A 3M0ZA 4GCXA 1K7XA 5DRIA 3OVQA 2J74A 1Z8AA 2YCIX 3PZGA 1I6NA 2JIEA 1XIFA 2JFEX 2QJHA 4EP8C 3FXGA 4XQ6A 3BICA 1YDOA 1K9FA 1PO9A 3CZLA 1W3NA 1GKPA 2XPKA 2CLMA 2DZTA 2YYTA 4KWVA 2Q3OA 1O68A 1E5JA 2FMOA 2GUYA 1V0NA 3PTKA 3GB6A 4WOQA 2IMRA 2RDUA 3BOXA 3M0VA 2IXVA 2F6UA 2OVLA 1UQZA 1P0KA 1S2TA 3HMJG 5FJOA 2WMHA 1IEXA 4CN4A 2DVXA 4O10A 1SUXA 4NEVA 1AA1B 5DCBA 2WM0A 1C8VA 3TTEA 4Q6JA 3NEVA 1TV4A 1DJGA 3FS2A 1HKIA 4IFKB 2FTWA 3GXTA 3SJ3A 3ZMRA 1YE4A 4ZZ9A 4GKTA 1GVOA 3HQ1A 1QI4A 5FACA 3MHGA 4DJED 3O0KA 4MADA 3MBFA 6REQB 5LIWX 2C91A 3AIBA 3N2TA 3NQ7A 4L65A 4JTAA 5BMXA 4O50A 3RO8A 3QPZA 1QCWA 1HL2A 1KM0A 4YCOA 4DXXA 4YJ5A 4GIYA 2W3RA 5BRPA 1PCKA 4XVDA 1VAHA 4LW7A 3SCPA 2PAJA 1JZ7A 3EDFA 2VOMA 2VZVA 3W7KA 2UBPC 4YS1A 3B8IA 2BOGX 2X09A 5HPCA 1W54A 3W22A 2VWTA 4C6PA 3BCDA 4LNCA 2Q8LA 5DMNA 2WC4A 1J0HA 2RJHA 5FAGA 2CESA 2ZXBA 1RCXB 1YDVA 1F3PA 3FG2P 1MUCA 3LPGA 1MNZA 3OLEA 4LV9A 2H3DA 3HG2A 3AJXA 4TIMA 3EA2A 3CLWA 2YKKA 7ODCA 3WELA 4DUXA 2WSRA 2J77A 4JQ3A 4GGBA 3QGKC 1FWBC 3VKJA 2VO5A 1JPKA 2WHMA 1WZAA 2OZTA 2BY1A 2ZRZA 5MKGA 3AXHA 4LS2A 1UZHA 2QV4A 1X1NA 1W8SA 2F2KA 4ZXLA 2E6YA 3V16A 1US3A 4JOMA 2UZ9A 4S3EA 3I68A 4PCNA 3LRKA 3WD3A 2I14A 3LGDA 1XP3A 2BCPA 2RH9A 4HYRA 5IDIA 4E8GA 3L68A 3TW9A 2HWGA 4FEZA 2WZIA 4QP0A 3EWXA 3DX5A 1F74A 4NZFA 2QCCA 1GTEA 2DT2A 3FLUA 4GYPA 2VDHA 3KBSA 3DYMA 1F6PA 3DHUA 1W6TA 2PCQA 4JDYA 5JCMA 2INEA 1WNOA 4GUIA 1L6GA 3WQCA 4GK8A 5AC4A 4IF2A 2ACRA 4JNZA 5I3HA 2AKMA 3CZKA 2NX9A 2PMQA 2W55A 4MZ1A 3CXOA 2VEMA 4J3XA 4GXWA 4MM1A 2BLEA 2PLCA 3PNZA 1OABA 1GQKA 3AOFA 3AAMA 3PZ9A 2C18A 4PTDA 3MY9A 1H1YA 3VIFA 3UP8A 1LT7A 3PP7A 2ZZ5A 1PZ1A 1QAPA 2VWSA 4ZEPA 2YBUA 5BOOA 2WLZA 3BV4A 1Q6RA 2PWFA 3B8SA 5JRBA 2A3BA 2XM2A 1E6NA 1KBIA 3N6HA 5IBXA 5E70A 4X60A 3UA3A 2XZ7A 4J3SA 1KW1A 4RPPA 3OB8A 4RDYA 1ZB5A 5DBUA 4K8HA 4UFMA 4UR9A 3W2MA 3MWCA 4DVOA 3W28A 1ONRA 1K9EA 4WSHA 4UZSA 1F3TA 1EJRC 4C6FA 1GREA 4JKKA 2OELA 4DUVA 2Z6JA 5EFDA 4X9SA 3UU0A 1XBXA 1YLVA 1Z44A 3N04A 4IUGA 3UY7A 5ABTA 1Q85A 1SZRA 3G24A 5AHNA 4WRHA 1G6CA 3OGVA 3DDMA 3KLLA 1QNVA 3IPWA 1J9YA 4P61A 3VNDA 2OZ0A 3PWAA 1V7AA 3G6LA 1E73M 4CCZA 4BQ4A 2PLMA 1V3KA 1NF7A 2AL2A 3D3FA 4ZXOA 3WLQA 1JCNA 3TMQA 3CMGA 2Y62A 1NOWA 2E6AA 3THUA 4A6GA 3P61A 5F2LA 2AGTA 3KBWA 4KMQA 1MW1A 4DY1A 3V5OA 2X0YA 2O4MA 3EUB3 2X05A 2FDSA 2PDGA 5GRTA 2G3MA 3T08A 3VGEA 3HU7A 5LA0A 5K4ZA 1OB0A 1V6TA 1GW9A 5DMYA 5E0FA 4DO5A 4UTJA 3WLIA 1VFHA 1OFRA 1PX3A 1LDCA 3ALGA 1UZ4A 1FDYA 4ZB5A 1O5KA 4A8LA 5AY7A 1P48A 1QRQA 4RE3A 4ZB2A 1EC7A 4LAKA 1ZMDA 1H2JA 3OOQA 4UFHA 1TTQA 1GJPA 5KVHA 2J7EA 3HB9A 5HJLA 1WA3A 3P3BA 5FF7A 3DI0A 3A47A 3RM9A 1JULA 1KLZA 6ENLA 3IACA 3VABA 4C6BA 3RMEA 5F2IA 1WBJA 4DYKA 3JRKA 3FVDA 1Q3NA 3SCOA 3VFCA 4G6CA 2C8NA 3LTPA 2GJPA 5A2CA 3OC4A 5JIPA 3AMZA 1XLEA 1UIPA 3EB4A 5I00A 2PGFA 4GC4A 3GU9A 4M6VA 1GVQA 2D3LA 1ISYA 2V5LA 3DG3A 3NL5A 1F3XA 3NJ3A 4GXPA 2GR3A 3O0HA 4OKDA 3CUGA 1EPVA 1XFCA 3PUGA 1ODZA 2V5BA 2XYLA 1SSDA 2QHAA 4HOZA 3TR9A 2V67A 1KKRA 1YRRA 3TTSA 1LG2A 2V30A 1M68A 3GR4A 3E2RA 2VCBA 1QPKA 1NWSA 3MKKA 5LYRA 3E38A 4MJZA 1TV8A 1XUZA 4P7LA 2WCAA 5FL1A 4HTYA 3R0DA 3WQOA 1JL8A 3ARSA 1R46A 1CDGA 1UD8A 2AKZA 1G94A 1M53A 3NQFA 3W7NA 4DJEA 4IUOA 1QNPA 2ZUTA 2X42A 4I7UA 2GR1A 3P93A 1UJPA 2YDQA 4LJ3A 3APTA 3QR0A 1AW5A 4JXCA 2C3DA 4IMAA 4MAZA 2ISVA 3EWUA 3NR0A 3UQNA 1RAKA 1LL7A 5FCZA 3AIWA 2P0IA 4EWND 5A6SA 1XH2A 4RNIA 1XS2A 2PWUA 3GXNA 1L6FA 2D1ZA 4AY1A 5D05A 4DUWA 3W7QA 4ZODA 2ZUSA 3GTXA 3PZNA 3KOFA 1J0JA 1H0GA 3MI3A 1W1PA 2Y61A 3NQAA 4DO6A 1DJHA 2VL4A 1EJWC 2QDDA 2IPFA 3B9OA 8CGTA 3L0GA 4HJWA 4PSPA 3PUEA 4DQWA 2OSXA 1NIUA 2YL5A 2QNEA 3WUEA 1XDLA 1QBAA 3CV7A 1MFVA 4XTIA 5L9FA 1GSNA 2ALRA 2ZZ7A 4CD8A 2MNRA 5BMWA 2TSYA 4YVPA 5A2AA 5T9BG 3GVGA 5BXPA 1I4NA 1H63A 3BW4A 3W71A 2WOQA 1RK6A 3NL2A 3DFSA 1FP9A 3RPMA 1B31A 1KGUA 3C4UA 1RY0A 2Y24A 1ZKQA 5I06A 2WHKA 4QCFA 2VQTA 4QJ3B 3FJLA 4KIRA 3VGHA 2ZRUA 3D46A 3M0KA 2AL2B 1W3IA 2PDMA 4I7WA 2CITA 4JY9A 3ME3A 4GI6A 2E5AA 4FNQA 2Y6ZA 1I60A 1V0MA 2YB1A 3PG8A 3KS6A 1ZP3A 4JY8A 1TWZA 4WKHA 4LY8A 1TVLA 1BXCA 4ENLA 4LRSA 1GTHA 3IVSA 3N6JA 1F9CA 4O1EA 2ESCA 1TCMA 4DBUA 2BODX 3PBWA 5I07A 4I5RA 3R5EA 4TVYA 3C52A 1OCQA 1VBJA 3O07A 4HMDA 1PZ3A 3ETRB 4D1IA 4DEFA 4PCSA 2WZHA 1VPYA 3QKEA 2QJGA 1JDEA 1OFDA 4IP4A 5AYBA 2ALDA 5KZMA 1VYPX 3THAA 4PULA 1IGWA 4UOJA 4DJFD 1TV7A 3PPCA 2CZDA 1KFCA 4GY1A 3WD2A 2QXWA 3BL3A 2XIMA 2YCEA 2VC7A 2Y63A 3N13A 5I3GA 1PV8A 3QC0A 2BVYA 1LVLA 3TJ4A 3TFXA 3O9NA 2YVJA 4HYWA 3M0MA 3MT1A 4JTSA 2WOIA 1EBGA 1UKSA 3B8VA 4GY0A 1MVYA 2QVHA 5A3HA 1AL8A 3CIVA 1ZU8A 1J0IA 5U1OA 4KFOA 4J4KA 1UOKA 1QBBA 1XSJA 1ZFJA 5DF0A 1DWJM 3E74A 1J4EA 5D2WA 1XANA 2PWVA 1SZNA 3ALFA 4HU8A 1QFEA 1BWKA 1WPCA 3B8WA 1VD6A 1Z6KA 4K6AA 2XH2A 2IKGA 3GIPA 4C1KA 3DG7A 1F3EA 5DLCA 5CLTA 3EZ4A 3P67A 4DBSA 5D2YA 3P8JA 3PJUA 1K3UA 2I5IA 3QVQA 4EM3A 4JZ5A 4IHCA 3DH9A 3BAXA 1GEUA 4LWWA 3W7DA 1N61C 3BLOA 1JI2A 4INFA 4XSLA 2WOVA 1ZZMA 4NAFB 1JUEA 3BTNA 2ZX9A 3BAJA 2HV5A 3UWZA 4WDTA 1PIGA 5EMMA 5EKYA 8A3HA 1XDMA 2AL1A 3RCYA 1QUMA 5TAOA 1ZY8A 4Q4SA 4V1XA 4FMVA 1XDJA 1KD0A 3LLXA 3NO3A 1GJWA 1Y5XA 4LRTA 3TONA 3VZYA 3UG5A 3GVRA 1SR0A 5FF3A 4K8GA 3PZTA 1UR8A 4M3PA 5E93A 2E40A 4PTWA 2Y8VA 3LGGA 1XBZA 1M41A 1WZLA 2NW0A 1MUMA 1S5VA 2J9ZA 3CT2A 5AHFA 4QHRA 2QEZA 4S3GA 4LA1A 4K8DA 1TYGA 2PDCA 3K8LA 5DEZA 2BVTA 1ICQA 3K30A 3P5YA 5ECUA 3I4KA 4RZBA 1RUSA 4H2CA 4Q7BA 2ZVRA 5LA2A 3QFBA 4HOXA 4AUBA 3AYTA 3LBCA 1EYEA 2QCLA 1UZ1A 4MZYA 4BI5A 2X8GA 2ANUA 3MVTA 2E67A 2DORA 3S42A 1ODUA 1W9BM 4CD7A 3SAZA 1GOMA 1MXSA 1WKFA 5I7GA 3WMBA 1OINA 1TX0A 4DO7A 2OLHA 3TC3A 4MVAA 3IJ7A 4DYJA 4PL2A 3EOOA 1FWEC 1EO5A 4UQBA 4MSSA 1RBLA 2NVKX 3N18A 1OF8A 2NX1A 3NVWB 1W31A 2D24A 2X7WA 1TFVA 1X96A 4GZIA 3WY1A 1H3GA 3GDKA 3O6AA 1UA3A 1KFLA 2MANA 4WUIA 1E51A 2G3FA 2OO0A 4IIDA 3WMSA 2Z26A 4JQ1A 1FWCC 1V79A 3H7RA 1CXIA 2HBVA 4GG9A 2LLEA 3UWEA 4O14A 3AMDA 3AS0A 2VDIA 1CLVA 3AWOA 1IWPA 4Z1AA 2GWNA 2VFEA 3EPOA 4JCLA 4CNTA 2E0PA 1R2RA 4W8LA 3CO8A 2DUXA 1HO4A 2VZOA 4HN8A 4QG8A 4FK9A 4DNHA 1W5OA 4GVHA 5GNZA 4KEZA 3A21A 1GRTA 2BS9A 2FDMA 4YVXA 3VD7A 1H1NA 3R1ZA 4XAZA 1LG1A 2W91A 4OUEA 4LYKA 1CGUA 3SRKA 2XN0A 3PK7A 4LYQA 4GKLA 4C91A 5FEWA 4B5WA 1YPIA 5A6LA 2H6RA 2OR2A 4GJJA 3W29A 3STEA 3U57A 4ZCWA 3TX9A 1RZMA 1NARA 1R3QA 3TCSA 2QDHA 4IX0A 4J3UA 1GV4A 4GBDA 2WJDA 3LGEA 3BAYA 3NM1A 3CAVA 3A64A 1QJWA 4JKLA 5D8ZA 4L9XA 1XUUA 3GS6A 2V5CA 1XSIA 1TQXA 4IMFA 2PCEA 4I8DA 4MWAE 2QJMA 1X8CA 1XISA 3U7VA 4NT0A 3R89A 4B15A 4OBTA 4AWTA 2JK6A 3O6CA 4DF2A 5AC6A 5ER0A 3F2BA 1VENA 3JW7A 4I6VA 2NT0A 4TV6A 3WH6A 3ARPA 3QYSA 1YTKA 3I6TA 2W3ZA 4GUHA 3RM8A 4WQ6A 3FIGA 4WSKA 1XXXA 5FSDC 4CD4A 5EPDA 7TIMA 3ES8A 3NQMA 4J57A 4E38A 4Q8VA 1EZWA 1KRCC 2Y1HA 4R7OA 5CPTA 1W1B1 3GD4A 3NZQA 4UC5A 1XRSA 4GMEA 4KWSA 3QKZA 2W9MA 1KRBC 3QC3A 1E4LA 3L5LA 4DX3A 1PXGA 2PWHA 2XHYA 1W2VA 2WC3A 4DI9A 2JEPA 3IAQA 3UCDA 2I9EA 3E0FA 4GZJA 4KCWA 4B92A 3VIHA 2BY0A 2YCJA 4Z08A 1XHCA 3KOXA 1HGYA 3MTWA 4RL3A 4QJ1A 4H6EA 3DG6A 3VGFA 4DJFA 2NVDA 1GXFA 4F3HA 4LUJA 3A7UA 4S3DA 3G8RA 1FHDA 1VYSX 2UY2A 2OU4A 3GG7A 1SMAA 1RPXA 2WW5A 2WHJA 2OQLA 3A3XA 1U5JA 1JIBA 3O1NA 1XIMA 4OQVA 1YXDA 2XVKA 3M41A 5D9PA 4PE8A 3QRHA 5KINA 2YA2A 4O0ZA 4WXZA 1FFVC 5L6UA 3ZJ6A 1NFGA 5KEZA 1VYRA 3QM3A 4A22A 4DJDD 1YNPA 2VRQA 4M52A 3CV6A 4G9PA 3A7AA 4LUSA 1M1BA 3SR7A 4AHPA 5K9CA 4IGSA 1GNXA 5FJTA 1QK2A 1P0DA 1UWRA 3N2XA 4PUNA 2Z28A 2HPIA 1K8CA 4NRRA 2ACQA 1VCGA 3IUHA 3ZR6A 3U4AA 5E9AA 1OC6A 1TRDA 4GZ7A 1FIQB 3M6YA 2AAQA 4AHOA 1OFQA 5H1WA 3CUHA 4W7UA 1GRFA 2WSKA 1JAEA 1PIFA 1FO4A 2EPNA 1EL3A 5G2IA 3V0TA 6PTDA 1BSLA 1KN0A 3ZLHA 1XLLA 3PB2A 3NOEA 3GH4A 4F66A 2XTKA 2F2HA 1PTAA 3BO9A 3SN1A 1E1CA 2Y88A 4HU3A 4NZ1A 4PCTA 4K68A 4Y8EA 4UMCA 5EBAA 4W84A 2DW7A 4M0XA 3WBXA 3PZUA 5ABHA 1UWQA 1K70A 4PB3A 1UD6A 3VFLA 3GNNA 1IR2A 1VP5A 4RPQA 1C7SA 1V6VA 2B0MA 4PR4A 3L67A 3DN5A 3MVIA 4E3TA 5CGMA 4UTTA 2ZC8A 3ITLA 1J6PA 4V1YA 2EQ9A 2Y7GA 1VGAA 3L4TA 1GVSA 1SW7A 2A3EA 4E0CA 4GX9A 1OEPA 3M16A 4K1WA 1UD4A 2FH6A 3VIIA 1SFLA 2ZKMX 5HNNA 3AHZA 3NG3A 1WYIA 2VEGA 4NAEB 4DWSD 3KVLA 1QOXA 3N11A 3P14A 4LCSA 1EO7A 3B3DA 4D9PA 1XHGA 2E28A 1JD7A 2R1KA 1EEPA 4C60A 4WF7A 3IGUA 3M6DA 1Q6QA 3W84A 1GQLA 3WBAA 1TA3B 4UMBA 5LKYA 1JQVA 3RNDA 1XQKA 3CQHA 3DK8A 4YHEA 1DNCA 3OG2A 1IT7A 3E1F1 4RW5A 4X0VA 2IUZA 3GXDA 4XD6A 1P0EA 3QHMA 4MOZA 3N4AA 4QJ5B 1EC9A 2BBFA 4H4PA 2J7CA 3TTQA 5CZSA 3VCCA 4WGHA 2HDJA 4J56A 1M6IA 5F7UA 3DGHA 4LAOA 3G18A 2IW0A 1XL9A 4XD3A 3LM7A 2DZXA 4HSHA 1OK6A 1HP4A 3GC5A 2WZEA 3BMXA 3G1HA 2VT0A 1GT8A 1WCGA 4IJRA 3W07A 3OVPA 5C9UA 2WNNA 3L5AA 1TUFA 3TW7A 1JZ3A 2DY3A 1MO0A 4EM4A 2VZSA 4G1KA 1T7LA 1A0CA 2W3SA 4WSJA 4I9TA 3LOTA 4R7JA 7XIMA 1XIHA 3SCWA 1JFXA 2WSYA 4ZQMA 1PYMA 5DXYA 3TTOA 4U10A 5FS6A 2C79A 3NQVA 2E9LA 2CLHA 2BSLA 4MPKA 3V4BA 1A5AA 3URQA 3UNTA 2CCRA 4MZ8A 1XI3A 3GLCA 4XTDA 4LUSB 1F07A 4JYFA 1P7TB 1VDVA 2XJ7A 3GTNA 1IHIA 3LDVA 1S5NA 2JGYA 3M43A 3N2CA 3LMZA 3RGTA 5K9XA 4DAIA 3GAYA 5M3WA 4NZ4A 4XZLX 1K8XA 5CBIA 1BRLB 4ORIA 3THCA 3DFPA 3EDEA 3CL6A 2DSUA 1TPVA 4Q8OA 1NAL1 1KM6A 3RYSA 2ZYFA 3GXIA 1O4UA 4GINA 1S7MA 4Y9PA 3WNKA 4YXGA 4JDRA 1O94A 4K2SA 4YYCA 5LXEA 3QZEA 2ZE0A 4DBEA 1GRGA 3W37A 5AHIA 2V0TA 4EMWA 1T5AA 4XZNX 1WXYA 1O5QA 1E3ZA 2GSEA 3G1FA 3VD5A 2RABA 1AODA 4LT9A 3HJEA 2E25A 1ZDLA 1Z48A 4OUIA 3GRIA 1EQPA 1KFBA 2A6NA 3VOJA 3E6EA 1BVZA 1FWFC 1IXQA 4LIIA 2Q71A 5EBKA 1NDZA 3EOSA 2EF9A 5IFPA 1YDNA 1K8ZA 2Y70A 5DANA 4MB3A 1LORA 3PHAA 3UJFA 1HL9A 4IH3A 4XZHA 4ZVJA 2CLIA 1D3HA 3AIEA 2FHCA 5LZLA 1Q45A 2WHLA 3HPAA 1QTWA 3TIMA 3QYQA 1JZ8A 3NS1B 1J6OA 3D9XA 1EPXA 3GU1A 5EMLA 3S1VA 1QASA 4QR6A 1W1IE 1EC8A 1LZOA 2FMNA 5DCEA 4CNPA 4K8EA 2QCMA 2ZBTA 1EFZA 3IWPA 4QDWA 3IARA 4KGJA 4ECLA 3S8HA 4NJJA 2VI0A 1Q63A 1DHPA 3ABXA 4CN6A 2GJRA 5D4YA 5AC5A 2ZZ0A 3SFWA 2GR2A 4QCEA 3HN3A 3L12A 1ONEA 4DJDA 1ADSA 3LZ3A 5DY2A 3KAOA 2PRHA 3QFEA 3H4WA 2R91A 3SB0A 4ADUA 5K2ZA 2W61A 5CC5A 1FWGC 1R85A 1D7YA 1R87A 3M07A 5HK4A 3PF3A 1T3QC 4GX8A 3ECQA 4NJIA 5BYWA 2VURA 1F3WA 4ASTA 4PMDA 2PDPA 5J04A 2DGAA 4JTQA 2GYIA 3PSVA 4L7ZA 2VTFA 3UR8A 4Y96A 1UJQA 3N34A 4J28A 3OPSA 3P62A 2CLEA 3GUGA 4KWOA 3LQLA 1EQCA 1TPH1 3RITA 3IC9A 2GDUA 3BSGA 3BGGA 5DN1A 1L6WA 4ZSUA 2WVVA 4FX7A 2WPFA 1X1ZA 3N6QA 4NG3A 2FGBA 3H2OA 4ZO8A 1NEYA 4B3KA 3W1NA 3L66A 4BF7A 1TJRA 3NO5A 4PFMA 1IEWA 4CCDA 1X7FA 2B31A 1HGWA 4H9UA 4W93A 1MQPA 4S2CA 1IZJA 4MDOA 2GFTA 4L64A 1ZENA 2ISSA 2BWGA 3EDJA 3AYRA 5G2HA 3HV9A 4O18A 1UKOA 5TNVA 4AWUA 3CPRA 4PH6A 2QT3A 3GX9A 5A69A 3EB3A 4X9YA 1ITQA 1XYZA 2GJXB 2ZIDA 1SZGA 2ZDSA 4QAWA 1XRVA 4GUGA 4F0HA 1UWIA 2Z00A 3CYVA 4OZOA 2VX6A 2E8YA 1JXKA 3DC8A 3EKGA 3P81A 5HULA 1G67A 4CU7A 4XZBA 3C86A 3GHTA 3FEMA 3PBYA 4DHGA 1GZJA 1W1TA 4GD0A 3DKJA 1RQBA 3VMNA 3CMFA 1HT6A 4IG2A 1OJTA 3MP3A 4DWSA 4UTHA 4L4OA 1CLXA 1GVFA 4K37A 5C71A 3VKBA 3AMKA 2FKPA 4AVOA 3PUDA 3UWWA 3DHFA 4LB3A 2J7DA 3SEPA 3EX1A 1TYPA 3NO1A 5D37A 1U1UA 3NSMA 1LTDA 1TTIA 2DZPA 2J7GA 3W4RA 1OFPA 4IT1A 3D3AA 3RCMA 3S1XA 3G3DA 5JU6A 2OLAA 3V35A 2I5GA 3R12A 2D73A 3C6CA 3B8UA 5AECA 1TMLA 1JOAA 1RP8A 4ATWA 1A3WA 3W23A 2CZVA 4K7VA 4AYSA 4W7WA 4KESA 2XM1A 3KP0A 3E0LA 1Z42A 2G41A 1A53A 2PDIA 3B04A 4FAMA 3FHAA 4IPLA 2X7VA 3FA3A 1JRBA 5HPOA 4KCUA 1FOBA 3ZO9A 1VF8A 2W4XA 1Q7MA 4ZA0A 4XIAA 3LV6A 3ZFHA 3MMUA 3OIXA 1JNEA 4ZOEA 3CWNA 1HKMA 1OYAA 3VOHA 4JN8A 4NI8A 2GRTA 2D0FA 4JCMA 4ZO9A 1Q6GA 5FEXA 3QEZA 1OHLA 2YQUA 2NXHA 4XVEA 1VBGA 3Q6JA 4KW2A 4OJYA 3OU8A 3IIPA 3G0XA 4JKMA 4Q8NA 4BEQA 1W1A1 4OECA 2QCGA 4NXKA 3EEZA 2C14A 3LZ5A 3CZGA 2DIJA 4AX7A 4ZQOA 1DOSA 3P6LA 2G4JA 3T7VA 3ITYA 3WQEA 2PDYA 4JTDA 2GGIA 3T55A 3CJPA 1X2GA 1RD5A 2FTYA 2FYMA 1AFSA 2V6AA 3T9PA 1UQYA 4JIEA 3A5FA 2ZX6A 1FXPA 3STGA 1P4CA 3KS5A 5I3DA 1ZAJA 2XSAA 4FS9A 4IM4A 5I0DA 3EX4A 1DEDA 1KBKA 4LSBA 2J9YA 3QF0A 3WJXA 1XYCA 4LV4A 4RDWA 2YCLA 3OZPA 3NQBA 3WNPA 2Z1KA 1NU5A 1UR2A 3WQ6A 1QNQA 1VEMA 2PODA 4C6DA 3WDHA 2FPVA 1PTGA 2EPMX 1TJ0A 2PDLA 4FXFA 3OODA 2WVVB 2H8XA 1Z9AA 3P2VA 3EXTA 4GI9A 1ZS2A 3G8EA 1UD2A 4JEJA 3UR5A 4BF5A 1FQ0A 3GXFA 3MQTA 2XVNA 1MI3A 2V5KA 1FCBA 3M0HA 3BSHA 1NDYA 2O9TA 4PRRA 4RXFA 5A6KA 3OZOA 2VM8A 4MIMA 4JFUA 3UXKA 3VM7A 4H8UA 1JZ2A 1P6WA 2WMJA 3NOYA 1V8EA 2PD9A 1E5NA 1EXPA 1I75A 3KRSA 3TYCA 4J2PA 1V77A 3W70A 1B3XA 1I2RA 4F2BA 4REQA 5GJPA 2PGWA 1K1DA 3QLLA 3T8LA 3WF3A 4XIMA 3WNMA 3PB0A 4XO7A 4HMCA 2OZ8A 3HGJA 4Q4RA 3DUGA 2EQ7A 4PMUA 2ZRVA 2WP5A 4FX6M 1BYBA 3OBAA 2B7PA 3WQ5A 2Z7GA 4NX0A 8RUCA 4QE5A 3S2NA 2OO6A 1N2VA 3TCEA 9XIAA 4QG9A 2NQ5A 1V7YA 3MW7A 2NSXA 2XFRA 4JIQA 4IIFA 2XVPA 1ELSA 1VR6A 4PB4A 2EKCA 3CO4A 3REQA 1ZQ5A 3TJIA 2IQDA 3UNDA 5FA5A 1W3KA 3WQFA 4D1JA 1YMYA 1MW3A 2AMGA 3MP5A 1Q2RA 1ONFA 3W00A 2X2YA 3EX6A 2AAMA 4AWSA 4M1BA 4PMYA 4HA0A 4CCEA 1V3MA 4CQDA 1VCVA 1DIEA 3TQ0A 3AROA 4Q4PA 4AXKA 4AZCA 1ZAIA 5C7HA 3B4UA 3IV8A 3KP1A 1KWGA 3DI1A 1ZMCA 2PTXA 1SGJA 3GBEA 3TA9A 3M5VA 1GQJA 1LPFA 3B9EA 3L2IA 3CIXA 4RX0A 4ZFMA 4PBEA 1MW0A 3WQ4A 1N5WC 4BI6A 3R94A 1LOSA 2GQ8A 1JZ6A 2V2DA 3G1YA 1XIDA 3W2NA 4ML4A 2WVSA 1EA0A 3VIPA 4Q32A 3QQWA 3KRUA 1HTIA 1XJBA 1SZFA 1CGYA 3V3WA 5I77A 3B8TA 3S4TA 5U4NA 6XIAA 4EPDC 1P5BA 4NP7A 1UUQA 3RM4A 1K4QA 3IV3A 5A2BA 4HCLA 4IIEA 3APYA 5FKYA 3URAA 4FR1A 3W74A 4M80A 1L0PA 1R3TA 4NYYA 1K6WA 2FHFA 2XU2A 3Q45A 3IVUA 3GDRA 1SPQA 1ME9A 1NDVA 1WOBA 2R8WA 1Q8AA 3P5ZA 1TKKA 2VEFA 1KCLA 1Z7AA 2E3ZA 4MG4A 4NXSA 5D33A 2PBOA 5HWJA 4LTSA 2YFNA 3G2GA 1P6CA 4L1WA 4QX4A 3IAPA 4MLJA 3G1VA 4WOZA 1I2OA 3AIQA 3POCA 2WNQA 3KDOA 4LBUA 2ZZ3A 1EGVA 2CDUA 2CFYA 3A22A 4HK6A 4A8IA 1RM6B 1V3LA 3LX9A 5EMJA 1R47A 3FYOA 3DOPA 2ZC1A 3LMYA 1FBAA 1WE5A 4JTGA 1O12A 3CAQA 4UFJA 4LS0A 2DDXA 3AZTA 2A7RA 4AW7A 2H8ZA 1TPWA 2Z1XA 2X0SA 3FDKA 2HNHA 4V33A 1H4PA 4FLRA 1U30A 2DW6A 2Y8UA 3GWQA 4LFYA 4EIVA 5JCKA 3C0QA 3TDFA 1XG4A 1UWAA 3BJFA 3B0YA 1ZJBA 2E9BA 1KRMA 4O4WA 2B7QA 4ICNA 2QW5A 1TPC1 1V5XA 3N73A 3SQMA 1LT8A 4B9ZA 4H50A 1WP6A 1NJJA 3OVGA 1UWUA 4ZOAA 3ZJKA 3TZFA 3PAJA 4BR1A 2YL6A 3GNRA 3AMGA 1ZBKA 3BH4A 2WCSA 2NLYA 1XF0A 4E2VA 1S38A 2V3FA 2WKJA 4REQB 2XIOA 3L4XA 2R9ZA 1S2UA 1K9TA 3H6OA 5PTDA 2ZZ6A 5FMHA 2OT0A 2E3TA 4YTSA 2CZEA 3ES7A 3RPDA 3TSDA 4CD5A 2G0WA 1UR3M 1FWAC 1BG4A 2WNWA 4U31A 1G69A 5I78A 3R13A 1UWSA 4OFCA 4H9VA 2WMGA 1XQLA 5M2FX 1AL7A 1TCDA 1OC7A 4GRSA 3WX7A 5TD4A 1MXGA 1XCWA 3IJ6A 2VFFA 2HVOA 4F4RA 3ABRA 1JCJA 3UCQA 3P7YA 4H8NA 3UZJA 3C3NA 4OOZA 4HIBA 4HPHA 2FB3A 2NWSA 5I3KA 6TIMA 4ZFCA 5BXSA 1C90A 3WN6A 3F4CA 5G5IA 4KT2A 1CNVA 6XIMA 1JF5A 1MZHA 5EY5A 3V0UA 3Q58A 3UERA 1UCWA 4JFWA 2BC0A 3O63A 4ZQNA 4N4PA 2ZX8A 3A3WA 4F2UA 5AVNA 3USBA 4FLQA 4L1GA 3QR1A 4RJEA 1A5MC