3V5FA

Crystal structure of the mutant e234a of galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEAAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure of the mutant E234A of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
total genus 134
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v5fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v5fA01
2OLAA 1XPYA 2GL5A 3TJ4A 4KEMA 3ES8A 4H1ZA 4IZGA 3GD6A 4A3RA 3BSMA 3SN1A 4IT1A 2O56A 4M0XA 2OZTA 2ZC8A 5J04A 2RDXA 4ZA0A 3PWIA 3UJRA 2GGGA 1RVKA 3OZMA 3UGVA 5ENLA 4IP5A 2QDEA 2PP3A 3RRAA 4HN8A 1MNSA 3CT2A 2OG9A 2PU1A 3R11A 2OX4A 1EBGA 7ENLA 4KWSA 4GYPC 3CYJA 3TQPA 1TE6A 1W6TA 3N4FA 1ECQA 3VCCA 4X2PA 2PMQA 3UCCA 4HNCA 3FXGA 4DN1A 3TCSA 1KKOA 6ENLA 4K2SA 3V5FA 3NO1A 3HPFA 3ZLFA 3GO2A 3TJIA 2GSHA 3OPSA 3GY1A 2PP0A 3CB3A 3GC2A 3SQSA 2QQ6A 5FJTA 2I5QA 4MKSA 2OO6A 3R10A 2POZA 4H83A 2XH4A 3V4BA 4A35A 1KKRA 3DFHA 3DDMA 4GMEA 2QJJA 1EC8A 3NXLA 3MWCA 4DHGA 2OVLA 3Q4DA 2HZGA 5BOEA 3H12A 2PTWA 3N6HA 3R0KA 2P8BA 3UXLA 2GGEA 1TZZA 2DW7A 3ES7A 1XS2A 3P3BA 2PA6A 3B97A 3TWAA 4DXKA 3BOXA 3EKGA 1L8PA 4DYEA 4JN8A 3IJIA 3IK4A 4IHCA 3V3WA 3UXKA 4E4FA 2PGWA 2OZ8A 3VDGA 2PTYA 3DFYA 1IYXA 4Z17A 3RR1A 4JHMA 3FYYA 3S5SA 1MUCA 5BOFA 3Q45A 3STPA 4GYPA 4IL2A 2ONEA 1R6WA 1E9IA 3K1GA 1PDYA 3NFUA 2AL2A 4ROPA 3DIPA 2PSNA 1EBHA 3CK5A 4HCDA 1R0MA 3DEQA 2HXTA 2QGYA 3R1ZA 3SN4A 2FYMA 4A6GA 2XSXA 3H70A 4GIRA 1SJCA 3JW7A 4HCLA 3TWBA 3I6TA 3T9PA 4H2HA 3VCNA 2CHRA 2GGIA 4HCHA 3N4EA 4MGGA 4GGBA 4JN7A 1WUFA 3JZUA 2QDDA 1JDFA 2AL2B 2OQYA 3I4KA 1SJDA 4E4UA 4ENLA 3D46A 4FP1A 3ZLHA 1FHVA 4GGHA 3JVAA 1ONEA 3UJFA 1MDRA 3U4FA 3MZNA 3DG6A 4K1WA 2MUCA 3UJSA 1YEYA 5FJUA 2P8CA 4KT2A 3DG7A 3TTEA 2NQLA 4IP4A 3BJSA 2XH0A 1KD0A 3SBFA 4J1OA 2HXUA 1DTNA 4YWSA 2PPGA 3PFRA 3UCDA 3DG3A 2P3ZA 3FV9A 3IJLA 2OKTA 2ZADA 2HNEA 1F9CA 3MKCA 2GGHA 1KCZA 2MNRA 2XGZA 1SJBA 3IJQA 3R0UA 3MY9A 3OTRA 2DW6A 5FJRA 4HNLA 3H7VA 3SN0A 4Z1YA 3VFCA 4M6UA 3NZGA 3ZVHB 2OQHA 3DESA 1JPMA 3QN3A 3CXOA 3H8AA 2XH2A 3OZYA 2PTXA 3UJEA 4G8TA 2PP1A 3ZLGA 2GGJA 1P43A 3EEZA 3RCYA 1MDLA 4HYRA 3FVDA 2OZ3A 3VA8A 5FJOA 3T4WA 3RITA 3KUMA 1NU5A 2PU0A 4G7FA 3OP2A 2PTZA 3FJ4A 4K8GA 3QLDA 3QPEA 2P88A 4MMWA 3ENLA 2P0IA 2PODA 2PGEA 4J3ZA 3VC5A 4GFIA 1P48A 2OPJA 3ZVIA 1OEPA 4GISA 1JCTA 1NELA 2QJNA 3MUCA 2GDQA 3SJNA 3P93A 4HPNA 2AL1A 3QKEA 1JPDX 3PK7A 4E8GA 3UJ2A 4E6MA 3SSZA 2OFJA 3RGTA 2AKZA 3I6EA 1EC7A 2QJMA 4EWJA 4IL0A 1FHUA 2PS2A 2AKMA 3QTPA 3DGBA 3VC6A 3MQTA 3MSYA 4FI4A 3DERA 1BKHA 4E5TA 3ZVHA 3CAWA 2XH7A 1ELSA 1SJAA 1WUEA 4F4RA 3RO6A 3R25A 3TW9A 3PWGA 3TOYA 3T8QA 1TKKA 5FJPA 2FKPA 3N6JA 1MRAA 3D47A 3V5CA 4ZCWA 1BQGA 2PCEA 4H19A 3P0WA 2QVHA 5IDZA 1EC9A 4DX3A 5EU9A 3S47A 1PDZA 3U9IA 4KPLA 3FCPA 4DWDA 3OW1A 3THUA 3T6CA
chains in the Genus database with same CATH superfamily
1OWQA 3A3HA 4N4PA 4LAMA 3MWAA 4A3RA 3BSMA 3SN1A 4JYFA 1KXTA 4G1KA 1YDVA 2E4TA 1V93A 3P2VA 4C7DA 4ATWA 3QFBA 3W9ZA 3WZ0E 4WDXA 2QCCA 3AYVA 1ZXIC 1RVKA 2GGGA 2HRWA 1IEIA 4GPNA 3M5XA 4DUVA 1MSSA 3SUVA 3NQBA 3UD6A 2PP3A 1UQZA 2C3CA 2AMGA 3L4ZA 1TE1A 1RLDA 2ZOXA 3GH4A 5XIAA 3AIEA 4QJ1A 1C8YA 7ENLA 1UBPC 3A5FA 4X2RA 3H2NA 2GR2A 2D1ZA 3NL6A 3F5LA 3QVQA 1V4YA 1KQYA 4FEZA 1LRNA 4XSMA 1A5AA 1Y5WA 4PGLA 3Q6JA 4XZNX 2X1SA 2NV2A 3MDWA 4A8IA 3QQWA 1UD2A 5DQPA 6ENLA 4JQ4A 1BQCA 1T6MA 1KTCA 2Y89A 4Q8MA 1S3HA 1L6WA 3CEUA 1IWAA 3OPSA 4NX0A 4GIAA 4HPXA 5T91A 1A0DA 1YX1A 1E43A 3BLDA 1ITCA 1RVGA 4XZBA 4HA1A 3RCNA 3QV7A 3G1SA 3GS6A 4JD4A 3H4GA 3IWPA 3GQYA 1X7FA 3QBUA 1JDAA 4Z1DA 3R10A 4WDTA 5BOOA 2OYMA 1Q6GA 1KKRA 2I5GA 4ZE4A 1UKQA 4M56A 4FR6A 3NSMA 4TOQA 3WMSA 3CYVA 2DQWA 1UD6A 2OVLA 1MW1A 4HZ7A 2J78A 4U4MA 1RV8A 3PFMA 1E6QM 1OG0A 1Q2SA 3QC0A 2PTDA 4AEOA 3VD9A 3E0LA 4MNJA 2ZUSA 4JTKA 3AU2A 4QXIA 4M6PA 3NQVA 1XDJA 4E8CA 4B5VA 4GR1A 4UUIA 1AW5A 3LHZA 1E70M 4G7EB 3VMNA 3VKJA 4HU0A 1YPXA 4JKMA 5E0FA 4QG6A 3UZ5A 6PTDA 1E40A 4ONVA 1DHPA 4H4WA 1CB2A 2GYIA 3GXIA 4LVDA 1IV8A 1VD6A 4AW7A 4ROPA 2XIQA 4PRRA 5G1YA 2FYMA 1UB3A 4W5UA 4R9OA 3KRSA 1OZMA 3UVIA 1H60A 1XBYA 3SR6B 2WBAA 2EXOA 4JN7A 1GYMA 1L2UA 3T1GA 1QK0A 4DJFC 4C6MA 4RNJA 1V08A 3HMCA 4UTFA 2D3LA 5G4HC 3RMEA 4JGDA 2CZ5A 2GZXA 1SJDA 2ZZ7A 3JVAA 4L9XA 1MDRA 2E8YA 3KWSA 1DJWA 4QCEA 2V2DA 4KGLA 4G2DA 1Q7ZA 1EJVC 3APTA 1EO7A 3UG8A 1HTIA 2V82A 5FJIA 5F4XA 4NZJA 3QR3A 3AUOA 3W72A 3C3NA 3B0UX 4LVAA 5IBXC 2VEGA 2W61A 4Q8WA 1I2QA 1L0PA 3WUGA 1C9DA 2Z1SA 2WWDA 4RE0A 3SY1A 2QCGA 3AYTA 3FLUA 2ZKMX 3EOUA 3ZOAA 2NX1A 1FHLA 3R07C 1ZBVA 1R3QA 4MSSA 3CO4A 4PMRA 3MKCA 3ATYA 3L5OA 3PTDA 2X05A 2Q8ZA 2VI0A 4AMCA 2B31A 3BG9A 3FHQA 5FF3A 3WLKX 3BW3A 4H4SA 1B4KA 2FHBA 4P5UA 3SI9A 5AZ1A 1AL8A 1YNYA 2XN0A 4V1YA 2JEPA 3MP5A 3BAKA 3EXRA 2ZZ3A 3BAYA 4I5XA 1U30A 4QJ5B 1KCLA 3WQCA 3WMCA 1VENA 3NAVA 1KNWA 4PUUA 1A5UA 3RPDA 3ECQA 1ONWA 3LZ5A 4YPJA 1UROA 1QPOA 1IXQA 2Y1HA 3AN1A 3GG1A 1XIHA 4LUTB 1VP5A 4UTWA 3SGUA 1HKMA 1WNOA 3B03A 2XSAA 4HA3A 3RIKA 1R46A 4P8UA 4K8GA 1VFHA 3UR7A 4QDPA 1B3XA 3B4YA 4FXJA 1FDYA 4WJ8A 3QV6A 1LROA 2IUZA 2A21A 3UBPC 2DZSA 1F3TA 2JBMA 1ZJIA 4EOUA 4Z0SA 2X8GA 1S2WA 1GCYA 2Y24A 3V0TA 5H91A 4MG4A 1PX8A 2OWXA 1JI2A 1IEVA 4Q7BA 4DWSC 2OU4A 4Y2WA 3SW6A 4XO6A 3WLLA 3I6EA 4PUKA 5CQ1A 1C8VA 1GONA 3RUBL 3O3RA 3VC6A 4RNHA 1JCYA 1TCDA 1O95A 4K8DA 5JH1A 4UBPC 5TAOA 3TW9A 4ORIA 4ZQCA 1DQUA 5HK4A 3ERPA 3BOLA 3MCOA 2PRLA 2CWXA 1UIOA 4OQVA 1M9HA 3LHWA 4MNLA 3D0CA 2PURA 1ZFJA 3ONCA 5DXXA 1W9BM 2YBUA 3W7JA 4P7RA 1BQGA 1OFEA 3WELA 2P53A 4GH3A 8RUCA 1YBQB 3ABQA 3KFTA 2PDWA 1J18A 5U4NA 2WBKA 4S23A 5HXMA 1CXIA 2ON3A 1UPMB 1TPVA 2FH8A 4MWAD 5FEPA 1W0MA 4JTEA 5A8QA 1FWSA 4ZO9A 3VO0A 2V5KA 3BV4A 4IZGA 1EGVA 3SQPA 3B06A 3GD6A 1J0IA 2TPRA 3BC9A 4UWMA 4IIFA 4M0XA 3VE7A 4KESA 3RNDA 4AZCB 2A85A 3RK8A 3RMJA 4ZA0A 1KO0A 1QPRA 3L7RA 4PTNA 1DWFM 1R7OA 4RK8A 3H23A 2QDEA 3CH0A 4GABA 3DKJA 3RRAA 5FEXA 3RU8X 2WPFA 1XICA 4GD0A 4Y9OA 2Y63A 2ZWYA 5E1QA 1V0LA 4M1BA 1WAWA 3LCIA 3HZ3A 4GA8A 5AVHA 4CN4A 3E9AA 2A3AA 2FZDA 3TONA 4B5TA 3EA3A 4DN1A 2X7VA 3W24A 4ML9A 2YCLA 4LUIA 1OT1A 3ZLFA 3L67A 1JULA 2BVTA 3LY0A 2GSHA 5ABTA 3SCOA 4KKXA 1C7SA 2CXEA 2HK0A 2C15A 3CB3A 2GR3A 3F2CA 3G1AA 4HYVA 3VOIA 3IC9A 4HSHA 3EWBX 2BC0A 3GHRA 1MNZA 1XH0A 2FTYA 1THFD 2X1TA 2XH4A 3EOOA 3V4BA 3I3EA 2CKSA 4AB4A 4OBSA 1HKIA 3RO8A 1F76A 1I2PA 1HKVA 3A7UA 5H6HA 3B40A 4WOZA 3CIXA 2PDXA 1A4MA 1JQXA 3UFYA 2WLZA 2YDQA 2CLEA 3H12A 2PTWA 2J79A 3F7JA 3LM7A 4MDOA 5LNRA 1HIZA 3QYQA 1CXLA 1TWIA 4KCVA 2EHHA 4GY1A 4JCMA 3ANVA 1ZKQA 3ES7A 3WD3A 2VJXA 1YHTA 3UR8A 4XAPA 4ATLA 4LW7A 1V3KA 4GJIA 3UXKA 1LQAA 3EMZA 1ZGDA 1I75A 1VBHA 3OYXA 4O28A 1PKMA 1ML1A 2OGYA 4JYEA 2ONEA 3PTMA 3IGUA 2GFTA 3NFUA 1MFVA 4MYXA 4DXVA 5AC7A 2PDMA 1KFLA 1PTGA 2GVYA 3H70A 3PPGA 4IIDA 2X8RA 1I60A 3RM8A 2G97A 2ZRXA 4MVAA 4QSFA 4Z1AA 4NAFB 4XD5A 1WUFA 4BF5A 3L4XA 4GK8A 3GNDA 2HNHA 4RUBA 3HB9A 3ZR4A 2AL2B 5I24A 1MFUA 1IR2A 3LPOA 2PDCA 3I4KA 1V3LA 3GHUA 3WLNA 3WY1A 3ZLHA 1EF2A 4MY9A 3GFXA 4CNUA 4UTKA 5D8WA 2DUAA 2MUCA 1VFLA 3CL8A 1TPFA 4KWUA 3ITVA 2BHUA 4QGCA 1L2QA 3LRLA 4R27A 2PLJA 3PUOA 5CPNA 5BNKA 1FCVA 4M24A 5D2XA 2J88A 1NSJA 4Y7EA 5FKYA 1B3YA 4ZBCA 2CITA 3UCDA 2ZWZA 3KCOA 3QZEA 4ERAA 4DJDD 3EDDA 3PHAA 4ADTA 5XIMA 3I7QA 3GRIA 5JRBA 4JXCA 2E9BA 4OECA 2F6KA 2ZADA 3ETRB 2HNEA 1XR2A 1F9CA 5EFFA 1OJXA 5M3WA 4JKLA 4U2YA 3W1XA 3W1PA 2Y5EA 1GJPA 3GG0A 5PTDA 3A22A 4NT0A 4R7OA 3HURA 2BODX 1V7YA 1C7TA 3G77A 1XH1A 4JBRA 4M1RA 3UZXA 3AOFA 4OIFA 4PTMA 4YTQA 3HG5A 2DIJA 2ZUWA 4CNNA 3JS3A 1L6GA 4IGMA 1I1XA 1OFPA 3KRZA 3B8TA 2CPUA 5FIPA 3W53A 3WBWA 1W37A 1B30A 2UBPC 1WCGA 4XTIA 3OYZA 1A50A 4GG9A 2OT1A 1U22A 2GLKA 1S2AA 2A3BA 3P60A 1X98A 2NX3A 3T7VA 3ALGA 3OA3A 2OJPA 4HA4A 5FL1A 5AHIA 2X8HA 4XZHA 4NY2A 1EOKA 2IXVA 5HNTA 5LIKX 1XG3A 3FJ4A 2WMGA 4DNHA 4NZ4A 1E6XM 3GTIA 4V15A 5JCKA 3U2ZA 1XX1A 2WZMA 4D6IA 3AZSA 3MUZ1 1QW8A 4WSJA 1LLOA 3L0GA 2F2KA 5FF7A 4LV9A 3VVGA 2G3NA 4CNTA 4WOQA 1VEMA 2OEKA 2VD9A 4I9JA 5I79A 1GTEA 2EAWA 4WGHA 4GVIA 1NTHA 2J8FA 2XINA 1VYSX 3G6MA 4AC1X 3VZXA 2VENA 3LYEA 3SSZA 2DSUA 1KFKA 4PFMA 3MHUA 4IX0A 2A6NA 4JTAA 1OG6A 2QJMA 4EWJA 3WK1A 1F3WA 4W87A 5A8OA 3GU9A 2QLYA 3NQMA 5EA9A 2Z25A 2E6FA 3LPFA 5A6KA 3RYSA 1JZ6A 4BWLC 3TR2A 1SJAA 3QGAC 1WOBA 2P76A 3QMRA 1O7AA 3TOYA 2WP6A 2VNCA 4Z2JA 3NVDA 1KCKA 1QO5A 4Z42C 4TX6A 1C9WA 3TLQA 5IXEA 4GJ1A 4BEUA 4HPHA 1B54A 3OLDA 4GJJA 4PODA 1K8YA 3I3BA 3S4TA 1VQTA 3OIXA 2JK6A 1FP9A 4R7JA 4C6CA 4XUGA 3RJXA 2QV5A 4GNJA 3W7HA 1DWAM 1BYDA 1F5ZA 1MW0A 3CV1A 4GXWA 4N9DA 4PRTA 3QJAA 1CENA 4MWAA 3GVWA 4B5WA 4D6GA 1XGEA 2GQ8A 4I5UA 3OB8A 4AZ6A 5JBFA 1US0A 5J04A 5IFTA 4HP5A 1XLIA 1YDYA 3JR2A 2WNZA 3PWIA 3UJRA 3C2FA 3E2RA 1XCWA 4U33A 1V0NA 1VFFA 2WPBA 3PPHA 2BS9A 1Z8AA 4WJEA 3T08A 1RQEA 1MNSA 2ICSA 1JGMA 3GDBA 4QJ3B 2HVMA 3OGVA 2WJEA 3F4DA 1Q6EA 2E0PA 3CHDA 4QLJA 2Y0FA 4DAIA 4IJBA 1NEYA 1W6TA 3LMYA 1LT7A 1OGSA 4GRTA 5D02A 3VNJA 3ABRA 4JQ1A 1LG2A 1S2VA 3MO4A 4P8WA 4L6OA 3DJJA 4UCFA 2GSJA 3ZWSA 2B7OA 4CD7A 1RSCA 2NXIA 3KHDA 1ZL1A 4HK5A 3WCZA 4EE9A 2V3FA 3GC2A 4LYKA 4WCJA 4WEVX 1GVSA 1V03A 3EB4A 1UD5A 3LG3A 3WEOA 2QCHA 5I06A 4HOWA 2BNJA 1GOIA 4UTJA 5EB8A 4XBSA 2CXGA 1FCBA 2DIKA 3EOLA 4INFA 3M41A 2VD8A 3UXLA 3WQPA 2HDJA 3KBSA 3MP4A 1U83A 4B9YA 1TR1A 2YPIA 1GYLA 1HP5A 4O1FA 4O12A 4PULA 4LY4A 4LCRA 4MB1A 3LCWA 3O0FA 2DT2A 3WQGA 3NS1B 4H4QA 3HGJA 1M7PA 3NQ6A 2RDTA 4ZQRA 5H8MA 1IYXA 1RD6A 4W86A 4XZMX 1VKFA 4RNFA 1UWQA 4MOZA 1J5SA 1OQFA 4G6CA 1N2VA 4HB7A 2J7DA 4UMCA 1Q2RA 1QI4A 3CZLA 5FACA 4IL2A 3BW4A 3WDRA 4JDYA 4LY8A 1GW1A 3DEQA 4D6DA 4DF2A 5AHNA 3AWOA 3P5ZA 4GACA 4TVUA 5K3VA 4MZ8A 3R94A 5AHMA 2WKGA 2X1RA 5DY2A 3T9PA 4AXNA 3KLLA 4IICA 2X2YA 2PDYA 3KRBA 2KAUC 1ZUAX 5JMUA 1XHGA 4UFMA 1JEZA 3L21A 3GDKA 4H6EA 2J77A 4ADWA 3DENA 5C54A 5CLWA 1EH9A 2JKAA 4JX6A 4OE7A 3O63A 4EPEC 5BMWA 3WSUA 2EG7A 1XDLA 4UFIA 3UJSA 4XWUA 3IJ7A 1Q7QA 3SECA 3NOYA 1G9HA 3TTEA 1VH7A 4DO6A 1TX2A 3WF1A 5FSEC 5D05A 1FWIC 2CZVA 2NV9A 1A5LC 4PA8A 3GBEA 3PAOA 3HJZA 4GIYA 2Q01A 4FR1A 4D72A 4M81A 4JTGA 2XZ7A 1WYIA 3GVGA 3DGRA 3M0VA 4Q32A 4AC7C 4V2XA 6XIMA 1FXQA 1QHPA 3QGKC 5JIPA 4KFPA 1H49A 2ZCGA 4Z1YA 3G22A 3TZFA 2FDMA 1T0OA 3PZIA 3U6WA 1E9ZB 2CESA 3STGA 3RLGA 5BXTA 3SGZA 2VHLA 3DESA 2IPFA 1P6CA 1W1PA 1SFLA 4ZOEA 2QPUA 1Y7VA 3OZYA 5BMXA 1KXVA 1QMLA 3NYDA 1X7IA 1FRBA 4HPJA 5AC4A 4QNWA 4IOTA 2YDAA 3MPGA 1W9UA 1SUXA 4HYRA 3QW3A 1W9VA 4IMFA 2A79A 1E56A 3SCSA 2Y8UA 2G4FA 4IX2A 4C6JA 4M7SA 5F2IA 2YB1A 4L9ZA 3R6IA 1W8GA 1KRCC 1EIBA 5D2VA 4CNSA 1XLAA 2XVLA 3QLDA 2PLKA 1DJIA 2DZWA 3PF3A 3BJTA 1LCOA 4PMQA 5C9RA 1TIMA 2WZEA 4HHLA 1M7XA 5HPCA 4R7WA 1ISVA 3K4DA 2R94A 3BURA 3LM3A 4HJWA 3FY1A 4JL2A 4HNOA 3VOFA 3CS2A 3CBWA 4UFJA 1VIWA 2QCLA 3P93A 3WQFA 1XCXA 1FFRA 1FFQA 2FDSA 5C9ZA 4NASA 4JTLA 4OOUA 4O11A 4AVFA 4EIVA 2A3HA 2HV5A 3VXGA 4I9AA 3L12A 1JJKA 2PLCA 6REQB 1KRMA 4UOJA 3VZZA 3TJXA 1E4IA 1RP8A 3OG2A 3CL6A 3QTPA 3WQ8A 4DBWA 1D8WA 4RV3A 4WJXA 1KRAC 1LORA 4I7UA 4EQSA 5CZKA 2QCNA 4MKNA 2I9EA 3C0SA 4ZB0A 4ROQA 2W6RA 1EIXA 1Q4WA 3IV3A 4HTYA 2YGYA 3TEVA 1ME7A 4MY1A 3MBFA 1N62C 3DHFA 3DFSA 4XD4A 2ASHA 1A3WA 3PBGA 1ZY8A 1QXLA 4E2BA 4ZCWA 3GXMA 3KS5A 3IRDA 4LUTA 3PZNA 4TV5A 1N8WA 2DZTA 1XL9A 2PAJA 3TJLA 1JDCA 2BBFA 1FWTA 2ZTKA 4HU4A 2YVJA 4FIQA 5EBAA 3IIOA 4DWDA 1R9ZA 3A47A 2WCSA 4BJHA 3W74A 4GBUA 2OLAA 1VFOA 4O1CA 4LVBA 3MVIA 4N9EA 2DVUA 3C61A 3VX1A 4AF0A 1SO3A 1EB3A 2A0NA 4H4TA 2NQJA 4RDWA 1R5YA 4G56A 3DH9A 2BTMA 4O4VA 4RE4A 3FDGA 9XIAA 4JIRA 1SO6A 1DHKA 3V35A 3H2AA 3PANA 1KFBA 1E5NA 2E67A 3AIBA 4LBUA 2JEQA 3GB6A 2FFCA 3PJWA 3S5ZA 3TYEA 1EGMA 3CH9A 3GU1A 2RJGA 4AYGA 1HVXA 1W5MA 2H9AB 3IANA 2BY3A 3S83A 4QAIA 1M6JA 2P50A 3OOQA 2CFYA 1R38A 1I2OA 5D8ZA 4RXGA 3IIVA 1JZ2A 2QEZA 3L5AA 3M07A 3WJWA 1N82A 2E68A 4DWSB 4HNCA 1YADA 2VO5A 4R3UA 4RDYA 1OBAA 4CGTA 6TIMA 1QWKA 5LNVA 1QNOA 1M53A 3HPAA 1Y5XA 5G1TA 5REQB 3DFTA 3S2NA 3SSJA 1PX3A 4K8EA 2DH3A 1WDRA 3P7YA 4BFAA 2XIIA 1YBQA 2BDQA 4C60A 4TMCA 1LBLA 4Q33A 3OVQA 4TV6A 4WSKA 1B9ZA 1H3GA 4HKPA 3DFHA 1EP1A 2E09A 3WF2A 3ZT7A 1EC8A 4Y90A 3PB0A 1TUFA 1SZGA 4W93A 1GOKA 3R5EA 4S39A 4I90A 3QYSA 1Q7MA 3WDPP 2ISSA 4NJJA 3W02A 1XGZA 1GEQA 3QRHA 3B9OA 2WV8A 5LA2A 3UZYA 5RUBA 4AZCA 2PB1A 4MJMA 4PEEA 4KRUA 1TZ9A 4S3BA 3PNUA 1QVBA 3H2MA 1JYXA 3OZPA 4DYEA 3WF0A 3UGRA 3IK4A 3VD3A 2NXGA 1V3IA 3EPMA 1KV5A 3MSRA 5K9CA 1S5VA 4PMXA 4RE3A 3WJYA 1CI1A 3PPCA 1VFSA 2VFGA 3W75A 4IIEA 1B9BA 1J9YA 1HUVA 3CAQA 4TO8A 1GERA 1JAEA 1EBHA 2Q09A 4NKCA 2D2OA 2AAAA 2DQXA 1OHLA 3W7LA 1E3XA 4A3UA 3OG3A 1G5AA 3JW7A 5LHFA 2C3DA 3G1RA 5D2WA 1VC4A 1R2SA 5AOUA 3FAWA 5DO8A 4FNRA 1W3TA 1YDNA 4XD6A 3IIXA 1GPWA 1EWEA 1DJHA 3P14A 2RAGA 3WBYA 3SUTA 4GGHA 4MAZA 9CGTA 4HMNA 3VGBA 4DUOA 1FWBC 4EMJA 4QE4A 3H2FA 4FOJA 1I9CB 2AAMA 1FP8A 4QISA 3GDTA 4IQEA 3O06A 3FGCA 1MXDA 2J9XA 2Q3OA 4AX7A 1LUCB 4WVXA 2OEMA 2PPGA 2WHJA 3QY6A 3WD1A 4TVWA 3EDKA 3IJLA 2PWDA 4F79A 4AD2A 2FGLA 3E0FA 3HQOA 3PBVA 3C3UA 2NSOA 1SGJA 1KM4A 5HA7A 4H4ZA 1SMDA 2CLPA 3LV6A 1W9PA 1BVNP 2GDUA 5CC7A 2REQB 3U2CA 5HMDA 2DW6A 1A0CA 4I6KA 3RM9A 1FH7A 1ZRQA 1K9EA 2YJQA 1OF8A 2CZFA 4F0RA 4WKHA 1U5VA 2PDQA 3GU2A 4MUPA 3ZVHB 4OHQA 2D22A 4AY1A 1HL8A 4AHOA 3SUSA 4K6AA 3A4XA 2VX7A 3OHMB 1M03A 3GZ3A 3WJSA 2FZ9A 1Q6CA 1K7XA 2C0AA 4PCTA 3CTTA 2OZ3A 4NAFA 1KR1A 4W7VA 5FJOA 3T4WA 1K4GA 2XHYA 3HTWA 3W7CA 1K1DA 4W7UA 2H6RA 4JX5A 4R88A 1FBAA 3M5VA 4O53A 1HGWA 1JPHA 1K8CA 2PE4A 2YXOA 4NJKA 5M1TA 4IPJA 2P88A 1W3KA 1BVZA 2X09A 3B9EA 1OC5A 1TX0A 4J3ZA 4PMVA 4CD5A 3NURA 4K8HA 4IQJA 1HJSA 3R0DA 2DSKA 5A8GA 4J9JA 5LIUX 3BG5A 2CHOA 2J25A 3MUIA 4HTBA 3W2MA 5TR3A 1XM3A 2H3BA 1BF2A 1R85A 2FGZA 2Y70A 3EUB3 2YFOA 3NPWA 3L4UA 2ANUA 4ZENA 4CUCA 2QIIA 2UY4A 2CERA 4S3DA 2OLSA 3HQNA 4BQ2A 1LG1A 4JIQA 2Z29A 2AKZA 4WQ6A 5LZLA 3MUAA 1F6YA 1UR9A 4F8XA 3RPMA 4MF4A 5A8PA 1YMYA 5U25A 1XLKA 2PDHA 4GYFA 2ZX7A 3UESA 5FCZA 3QPYA 3FG2P 4ICCX 1MUWA 3UF9A 2O92A 3ZS4A 1XLBA 3W7IA 3QFAA 4UQDA 1E0UA 4LU0A 2WCGA 1ZCOA 1OX4B 3MYOA 3HFTA 1G4SA 5E6ZA 1DJXA 3THDA 4GE8A 3CMGA 1S3TC 2E3TA 3D47A 4IMGA 4J3WA 3H7UA 4PMNA 1YQ2A 1JFXA 4LB4A 2PCEA 3HO8A 4L64A 4H19A 1XBXA 1DYSA 3GIPA 4NZCA 1XBVA 2X1UA 3BCFA 3F5KA 1O5RA 3HU7A 2YYTA 1QI2A 1A5KC 5HQEA 1ZP4A 1Z41A 3DK4A 2X30A 3BLPX 1WDPA 2W9MA 3TYZA 4XAYA 1CIUA 3WQDA 1S5TA 1GRTA 2FLIA 1UWRA 4FLSA 3QV8A 4LSBA 3SQLA 3QHNA 4GC4A 4CNPA 1N63C 5I07A 4GIEA 5E70A 1PTAA 3KP0A 2V3GA 2J7EA 4LX4A 5C71A 3TA9A 2WZHA 2DZUA 3M9YA 2W27A 4E2VA 2PWGA 3CT2A 4HGXA 4K39A 2DEPA 2O9TA 1DXLA 1F4AA 2QUMA 1FHDA 1NDZA 2IPGA 3G0SA 3GIYA 1TE6A 3URNA 3DCPA 1XH2A 2OKOA 1ZP3A 3GDLA 2TPSA 3M7SA 3W6MA 2XVPA 1J96A 3QQ1A 3LOTA 3TA6A 5LNUA 3L2IA 1TMQA 3BCDA 2CBIA 2A1YA 4DF0A 2EKCA 3G8RA 1CPUA 5C9UA 4GYJA 4UTUA 3AMGA 4IP7A 3S6OA 2BVYA 2QDGA 1OX6A 5A6AA 4GINA 1NWRA 2PDNA 2DVXA 1OFDA 4O1BA 1UMLA 3LBMA 4PMUA 2RGLA 3S6TA 2X41A 3SRKA 4H83A 4S3CA 3BSHA 3CT7A 2HBVA 1DWJM 4J57A 4GMEA 2JKPA 1PL9A 2J6XA 1TMHA 3DBNA 3D3AA 2XG9A 4JTQA 5HINA 4K37A 3N34A 4QDMA 4GQQA 1GVOA 3R0KA 4LEQA 4LVFA 3TKFA 4XISA 4I6VA 2GGEA 1GOQA 3UQNA 3QFWA 1H50A 4A3HA 1PB0A 3CLMA 1J4EA 2PA6A 2BV9A 1NDVA 4IPNB 3MMTA 3BOXA 3ARXA 4FNQA 3LTPA 3ZR5A 3U2EA 1GK8A 2OZ8A 2V2CA 1JYVA 1GRFA 1V79A 1AJZA 4E3TA 2YVGA 3LMZA 3TTOA 1LRQA 5I3KA 4LCSA 5AHFA 3BZGA 3LPPA 1GG0A 3BLKA 3U0HA 2XFRA 5G5IA 5CBIA 1FWHC 1JZ5A 3DGZA 2IPJA 5CG0A 3W7NA 5IRPA 3K1GA 3QV9A 3NTYA 1KM1A 3MB9A 3T78A 4I8YA 2DZXA 1ICSA 2BY1A 4A6GA 4N42A 2CLOA 3N29A 5AVNA 1R3SA 3E0WA 3TSDA 1BWCA 2O55A 1JZ8A 3W1QA 1VEOA 4BV6A 4NU7A 8A3HA 5G2HA 4D6JA 2D3NA 2DV0A 4YYCA 3DC8A 4EK7A 2XIMA 1XIFA 1R3VA 4TUFA 4Q8UA 3U4FA 2ZX9A 3DG6A 3N3TA 3V0UA 3BGJA 4RDVA 5F1VA 1GVYA 4U31A 3WFZA 4R34A 4W8AA 4LAUA 1KV8A 5DY3A 4KRZA 2AQOA 3KOXA 3O15A 2V0TA 2EO7A 1ZK7A 4WLCA 1ISYA 1GKRA 2YDRA 4Q3MA 3QSRA 2HXUA 3GHSA 4H7CA 2VRQA 2WXDM 2BOFX 3UXDA 3DG3A 1F8WA 1NDWA 5E0KA 4AZ5A 3IK2A 4B3ZA 1UWSA 2EGZA 3PTKA 3F5JA 4EM4A 2FVLA 3BJFA 3U7BA 3E1F1 1LQ0A 2Z2UA 3I68A 1OFOA 1S2UA 3R0UA 2J6VA 5BRPA 4KMQA 3OTRA 4LUSB 3QMTA 4LAZA 1CGUA 1OGBA 3V1HA 1J79A 4Z2IA 3LTSA 2Q8XA 3M16A 2CFFA 3PG6A 3QTGA 1XLCA 2PZNA 7TIMA 2AMXA 5JXQA 2OOGA 1HG3A 1XINA 1BYBA 2GOKA 2A7RA 2ZQ0A 3TSMA 2V81A 4S3KA 1XF0A 3S1XA 2OB3A 3LZ3A 1J0HA 3KOFA 3P80A 3NXFA 3C56A 3FSUA 2XN1A 3QEZA 4HU8A 1BKSA 3KEHA 3USZA 3CV2A 2H8XA 1WKYA 3IGHX 1Z42A 3IVSA 1Q1RA 4KPRA 2XFYA 3AHVA 3DFQA 2ACRA 3N14A 3THQA 1OFRA 2QS8A 4JTHA 3VDAA 2QJHA 3ZJ7A 3VOCA 2V3AA 4RPPA 1J8VA 1B3ZA 1A5CA 1WDDA 4IPIA 1IR1A 2FMOA 3EA1A 2WKLA 4PYSA 3MMWA 2X50A 2F61A 3NGJA 3STCA 1QUMA 1X97A 1I2NA 3DFPA 1WBJA 3O7UA 2YL9A 1EC7A 3JRKA 1I2RA 4GY0A 3AXMA 1JCJA 1M41A 1ZY9A 1UW9A 4KW2A 2BC1A 1S2CA 1WDQA 1X39A 2ZIDA 3R58A 4PC8A 3WL0A 5DFAA 5A6BD 4IF2A 4OVXA 5TBOA 4D8LA 1P1XA 1TCMA 2XH7A 3MV11 1HQTA 5KMYA 3H21A 2NZLA 1ZALA 2WQPA 2YLAA 2JF7A 3JUGA 3ZMRA 4EF9A 3O6DA 1S1PA 4HMEA 4KFOA 1Q8AA 3IUHA 3EA2A 4DBSA 1TZ7A 3ME3A 3E49A 3K8MA 2FKPA 5I3JA 4QG9A 3W23A 4YHEA 3N6JA 1JF5A 1LL6A 2YA0A 1FCQA 1W5NA 3RAOA 4DAFA 1JDEA 3LSBA 2CDUA 4AIBA 7TAAA 1JVNA 4RE2A 4IJCA 1NPXA 2NV1A 3PSWA 3SCWA 3MU7A 3LLFA 3CGCA 2E6DA 3O0HA 2BG5A 3KBNA 4S3GA 2H90A 5BU6A 1J0KA 1Q6QA 2GQAA 5LIWX 3VNIA 3TJ4A 3ES8A 4H1ZA 1JGIA 4L61A 4JY8A 5HULA 4WGXA 2XVKA 4F40A 4F9JA 1KFWA 4JIEA 1TG7A 1XYMA 2V69A 1G69A 2RDXA 2WOQA 4L1GA 3A7AA 1BYCA 1TJ2A 2VFIA 3W87A 3FN9A 1G6CA 2Z1VA 3FAXA 2FZNA 4BURA 3W81A 4TU1A 3B9DA 3W71A 2PFHA 1PO9A 3CQHA 2PU1A 5IBXA 1BSIA 1DJQA 4H4YA 1F73A 4RZ6A 1VS1A 2BGNE 4KWSA 1AD1A 4H01A 3NL3A 4QJ4B 1QJWA 3WNKA 4X2PA 1HJXA 3WMBA 3FXGA 3CV7A 3IS4A 1AW2A 5EKYA 3PM6A 3TCSA 3VDCA 2QCDB 2PDPA 4H9VA 4NNCA 4W7WA 1ONXA 3TN6A 3IGXA 4PL2A 3TQVA 1ICPA 3P8JA 3WNOA 1N55A 3W86A 4MIMA 2VWSA 1FWJC 2W4XA 3HG3A 3RPTA 1ONRA 1TV7A 3VIMA 3B9NA 2NSXA 1UKPA 3CUGA 5EMLA 4GNVA 1E15A 2ABAA 2ZA3A 4A35A 2GJXB 1IXOA 2NQ9A 1SFJA 4PUEA 4J2MA 4M29A 3AHYA 2WVTA 4RPQA 4D6FA 5HR7A 4MLJA 4N0RA 1NOFA 1DNCA 4UC5A 1GOOA 4GCAA 3A64A 3VYLA 1UWAA 4H04A 3KXQA 2YL8A 1SM9A 4TX9A 3FS2A 5JVLA 5ECUA 2PWFA 1V6YA 3Q94A 2C1IA 1A5BA 3VIPA 3IAPA 1XKYA 2VGBA 3EKGA 1EZ2A 3VOHA 4NRSA 1RY0A 1XUZA 5F1UA 5TQLA 1PZ0A 2H9AA 4AIUA 4F66A 1BFNA 1EX1A 4DBEA 1PSCA 2HE8A 3TH6A 3ZT6A 2FZMA 2ZTJA 3RR1A 1PCKA 1VFTA 3VINA 3VZYA 3N1AA 1RPKA 3LNPA 1ICQA 1UD3A 2WMIB 4D6HA 3MBDA 3H22A 3VD5A 1MI3A 1R6WA 3HW2A 1HVQA 1PDYA 3EX3A 4IG2B 1OYBA 1WE5A 3NQ7A 4PBEA 2OO0A 4YTRA 3W70A 2QGYA 4RZBA 2C71A 4H8UA 3QMSA 1IF2A 4RW3A 1TREA 3I6TA 5BW6A 1CGWA 3VMPA 3PULA 2GUUA 3CQ0A 3EOEA 1V5XA 4HCHA 4GGBA 4PSRA 4W4QA 1Q5MA 1AG1O 5REQA 1DIEA 4CLMA 3NM1A 2F38A 1SYTA 1I0BA 1UD8A 4H6QA 1VPQA 3P6LA 3G0XA 3SY8A 1ZAJA 3APGA 2QR6A 5LGZA 4LS0A 4F3HA 1KM3A 3W7RA 4YJ5A 1HJQA 5LIYX 3S9YA 3PZVA 4Y9MA 1WOAA 1FEBA 1EEXA 3SR7A 4DQWA 3W76A 3UNTA 1MW2A 2YYUA 2YVFA 2WC3A 3MHGA 1J2BA 1FX6A 3THAA 3DOPA 3URBA 1VYPX 4H6KA 3KLJA 4C6KA 5FAJA 2V6AA 3AXXA 4JNZA 4EPBC 3PFRA 1S5NA 4V1XA 1GV4A 4UNIA 1N8IA 2J27A 4IFRA 2I5IA 4S2BA 4X22A 3EEGA 3IJ8A 2W3ZA 3BAXA 1EJRC 1PZ3A 3MV01 3WYZA 4J5NA 4O8AA 1M6IA 2NQ5A 4N9CA 5E5CA 2HJPA 3WQEA 4MPKA 1XIIA 4EQWA 4ICNA 5B80A 3WG6A 1NM9A 1EQCA 4KETA 2VCAA 3QGVA 4JL1A 3PZUA 3W73A 1XWYA 5CPOA 3PJUA 2F84A 4QITA 1J01A 1E0XA 1TO3A 4A8RA 1RHCA 4R5EA 2OYLA 1REQA 3DYOA 4ZTYA 4ADUA 1MDLA 3EAUA 3EBVA 5HNNA 3GWQA 3IGSA 1M68A 1JUEA 4M51A 1TWZA 4C6LA 3FDKA 1MXSA 1K70A 2CZEA 1TYGA 1UA3A 1WDSA 1RBLA 4UQAA 4XK2A 2G3FA 3B8WA 1JPIA 3LI0A 3TYDA 3UYIA 4APNA 3P74A 2XDFA 1QHOA 1UOZA 3LLXA 4PR4A 3EPOA 3VGHA 4RZ5A 5FAGA 4IMAA 3W7OA 3GTFA 5C2GA 1PEZA 4RZ4A 1K9TA 3PPFA 1ISZA 3ZVIA 4HK7A 1LUCA 1W9XA 1D3GA 2DZPA 2GDQA 2Z6JA 1EDGA 1X6LA 3M0JA 3S5OA 1TJPA 4LEFA 1PZ1A 3NIYA 4IMCA 3WEZA 3R7MA 5HMFA 2GJNA 2KZHA 1KC7A 4QLLA 1TV5A 3VAVA 2REQA 4HD5A 4MB4A 5HUPA 4IL0A 1LF1A 2PS2A 1DJYA 3HGOA 1L6SA 4LYPA 2AGKA 1B4EA 3ZVHA 5G4EA 1PWLA 3A4JA 3LXCA 5A6BA 3PNZA 3KCLA 5ABGA 4JIPA 3QKZA 2O7QA 2VFDA 2EF9A 1EQPA 3WH5A 1SSGA 4XZLX 5FJPA 1EX5A 1P6BA 3V36A 4FDCB 4ACZB 3TMQA 1MRAA 1J6OA 1RPXA 3K1DA 2E3ZA 1BSLA 4Z1BA 1JOAA 1D8CA 1VHCA 1W5QA 3WQWA 3GFZA 3FHAA 2PUZA 3M6YA 3NZ1A 5CGQA 1P7TA 5IDZA 5DMLA 3W27A 3A24A 5T9BG 3S2CA 4L4MA 1NFGA 3PAJA 8XIMA 3G1DA 1H62A 1WZMA 4F0HA 1Z6KA 1V97A 3BOFA 3C86A 1BGAA 1A3HA 1ZBWA 3VGDA 2YIHA 3HFYA 1W3NA 3ARYA 3LCLA 3WD2A 3LRKA 2ATMA 2YAUA 1PVNA 1V3MA 4CQBA 4XKYB 3G3DA 4AD1A 4DO7A 1A4LA 1UKTA 4AXKA 4LB3A 4E3VA 4IP5A 1BYAA 4QQUA 1GVEA 1BZLA 3KVMA 1GORA 5DEZA 2IMRA 2WO5A 3OO2A 1Z69A 4FOUA 2NVAA 1C93A 1X8FA 3R11A 3LA4A 1F8MA 1UC5A 3QHOA 1HL2A 1VFMA 1XRFA 4TTUA 1U1UA 1ZB5A 3LGGA 4GHRA 2WK2A 4PCFA 3TQPA 3WLQA 3AMZA 5C5YA 2EQDA 3BPWA 4JPGA 1Q45A 4D1IA 3NL5A 4EMWA 3DECA 3FSTA 4GCXA 1OX4A 3NPVA 3A9BA 4ZQOA 4AEEA 3PB2A 4HZ6A 3W4RA 2CLLA 4C7GA 1TVLA 3MSGA 3KBWA 3GXNA 4B3LA 3WLPA 1O5KA 3A6OA 2J3NA 3M0HA 5FS8A 3AUJA 2UY2A 4LF2A 2GPTA 4O14A 2YBVA 3U7VA 4UQCA 1UZDA 2Y7DA 4GQGA 1EZWA 2CHNA 3I10A 3H55A 4C1KA 4OUIA 2Z1WA 2QV4A 3NQGA 1EYWA 4ZODA 2QJIA 5DCEA 3C5QA 3DUGA 4W89A 4WR3A 3R89A 2CLMA 2FMNA 3QLLA 3MWCA 4K1GA 3W2JA 4ZFMA 1MQRA 1W3IA 2L5HA 4HMCA 3D9XA 4NJIA 3NEHA 5D30A 3B97A 2J7HA 4DXKA 5I3DA 4DPPA 1GVIA 2Z1KA 3WLIA 1QRQA 3IARA 3C2RA 2OT0A 3HIJA 3ICJA 3KL3A 3VILA 2UWFA 1H5YA 1T8QA 1SO4A 4M7TA 2DUXA 3A3WA 1KA9F 1PHQA 1ODZA 5CSUA 1VHNA 3M5ZA 2Z0IA 3APYA 1IXNA 2JGQA 1S46A 4YXGA 1SJCA 2W91A 2PDUA 4UB9A 2CLIA 4US6A 4MGGA 1R3RA 5ER0A 2CEQA 2ADAA 3ARZA 4BWLA 1OB0A 5HJXA 2GVJA 2F6XA 1IGSA 3PZTA 3VNDA 4PTWA 1W54A 1GJWA 4K1WA 4WDUA 5DXYA 4P2VA 3E5PA 1EOMA 3EX1A 3S2JA 3CV6A 1Z9AA 1PJ9A 2G3MA 1YEYA 3REQB 5BYWA 1GESA 1VLIA 4F2BA 4WUIA 3UPMA 1OINA 5DBTA 3CZJA 3P5YA 3EDEA 2XH0A 4OTKA 2WSRA 1X1OA 2VR4A 3MI6A 4AD4A 2ZUUA 1DTNA 4HVXA 1MUMA 3AROA 5K9DA 1XQLA 1X6NA 2QGHA 1G4PA 1M7JA 3IRSA 2J24A 5CGTA 4JQ3A 1BXNA 3LK6A 1BTCA 1K6AA 3VKDA 3AMCA 2Y4SA 4XQ6A 4E0CA 3HV9A 1X2GA 3AQUA 1OD0A 1DWHM 2VWTA 5C9WA 1ODUA 3PBMA 3T42A 5BU9A 1UC4A 2OSWA 3H24A 2OQLA 4MM1A 4HQVA 3IIPA 4NVTA 3NQ8A 1WXYA 4K3ZA 5BXSA 3F4NA 3SFKA 1AZ2A 4M6QA 3B0VC 3UJEA 1RP9A 2PBGA 2P5NA 2QF7A 1M65A 3BLEA 1P43A 4O0KA 1BWLA 3NZPA 4ZQPA 1XC4A 4YVVA 4YTTA 4Z1CA 4CNOA 1AA1B 2WPEA 1XIGA 1HGYA 3GAYA 1B3OA 1X38A 3C2EA 3MC5A 4P7QA 4W9TA 2GK1B 4YNGA 3ZJ6A 3BSGA 1B3VA 2NUWA 2PU0A 2J4GA 1P6WA 4PZVA 4WSHA 1FWCC 1RXOB 3IIZA 3S6DA 2PTZA 1MEWA 3NVZB 2VOTA 4W8BA 4A29A 1SZFA 3KP1A 4GQRA 4BA0A 4C6QA 4TTGA 5C6MA 2J8GA 1Q3NA 3TAOA 1GETA 3L2MA 2E28A 4S3EA 2PGRA 2ZXQA 1YPIA 4NZ5A 3W3OA 3OLIA 1K4QA 3S46A 2PGFA 1F6PA 2A3CA 3WK0A 4YTUA 1GVQA 4X61A 4B15A 3HV8A 3PK7A 1A47A 1E71M 1PKYA 4KWWA 4E6MA 1UR1A 4Y96A 2D0FA 4IM4A 4OFCA 5A3HA 3RGTA 5E9XA 3F2BA 5A94A 1GG1A 1WZKA 2ZUNA 3WH9A 4LUSA 4MADA 1BRLA 1BHGA 1TPEA 4GUFA 4XZWA 4FK9A 1J10A 4ZOBA 5BWFA 2VRJA 3OBKA 2VYOA 4CQCA 4L1WA 3MSYA 4PUWA 3KVJA 3CAWA 4ZTXA 5LKYA 3S42A 3ZO9A 1IT8A 5JBEA 2OCZA 1NFPA 3ZXWA 5KETA 4XSLA 3RX2A 1MO9A 2NWSA 3BQ6A 1V59A 1JI1A 3LENA 1I0DA 4CEUC 1KGWA 1TTPA 2VC6A 2DORA 1GHSA 4YWOA 1Z7AA 3ITYA 3LCGA 2Z00A 3C0JA 1O66A 3KBMA 3P84A 5A2AA 3RLVA 3RX3A 3UWQA 3WUEA 1FWNA 1JAKA 5FD0A 1LOSA 4JTCA 4EPDC 2ISVA 2XSBA 3P0WA 2ZBTA 1KXQA 4ZGYA 3OBAA 1RCOB 1PDZA 3U9IA 4JTTA 2CYGA 1TVNA 1J5TA 3FCPA 1YPFA 4H7ZA 4B5XA 4H7VA 1UH3A 3W22A 2IQDA 2ZZ0A 2QAEA 5CSRA 3H54A 1XGDA 4LS1A 3LXDA 5LIXX 1Q6OA 3U2OA 3BAWA 3H26A 1EL3A 5CJ5A 4O17A 1JYWA 3EB2A 3BE7A 1W1IE 1Q6FA 1TPB1 3RNMA 3WFLA 1GQNA 3TTSA 3NVVB 2EPKX 3UGVA 1RJPA 3LHTA 3K30A 3CL7A 5GQBA 3CU2A 3VKKA 1R87A 4ATDA 2ZX8A 5H2ZA 5DRCA 5I00A 2YA2A 2DFAA 3I7SA 3FFSA 5DMNA 3W38A 1JCXA 1ZMCA 4YU1A 4GVGA 4US5A 3BMVA 3A7RA 4J3VA 4DLMA 4KIRA 3G5EA 1SMAA 2KX9A 4YN5A 2XZ9A 4E38A 5C2CA 3LHVA 1A53A 1OC7A 2PMQA 4Q6XA 4Q8OA 3B0PA 4ZOCA 1U2YA 2Y8VA 1VBGA 3S1VA 1ME8A 2PI6A 2ZDRA 2B0MA 2QCEA 1E9LA 4JN6A 1FECA 3THCA 3V5FA 3NO1A 7XIMA 1PWMA 2Z1BA 5I02A 3T05A 3LHYA 4NP7A 3C2OA 3WUFA 3TX9A 1SW3A 1KM6A 2QQ6A 4H9MA 1V0KA 1OYAA 2DVTA 4PBFA 5DN1A 2O4QA 2XU2A 3A21A 1S38A 3E5BA 1JL8A 2VXNA 4LOCA 4QR6A 3TSBA 4F0MA 4DY1A 4DHGA 1E4MM 5HWJA 3Q4DA 1P4CA 3OHIA 3W29A 5J5DA 1XSJA 3KBJA 2NUYA 2G5WA 3L4YA 4DJDC 1TZZA 1SSDA 3BARA 3P3BA 1AMYA 5CSYA 1OCQA 1SFTA 2E9MA 2VC9A 5E09A 3AIUA 2IS7A 2PGWA 4AYSA 1XLLA 4JY9A 5AKQA 3R13A 5JCNA 1UWUA 5D9NA 2JALA 3VDGA 4J3XA 1HL9A 2PWUA 3KVLA 1XIDA 1A5NC 1WV2A 1K8XA 2E1DA 1D3HA 1R30A 3B8SA 1GKPA 1E1FA 2YX0A 4HCDA 2HXTA 4D2JA 3SN4A 3HM7A 4C5ZA 2WHMA 1HJVA 1PXGA 3N4AA 2EG6A 4I9TA 3F4VA 3NPUA 1NHSA 5HPOA 1ECEA 4ALDA 2VZSA 2IQ0A 2GDVA 4Q7IA 2OQYA 2GQ3A 1ITQA 4YTSA 1DOSA 1UP3A 1FXPA 1U1JA 4XX6A 1ONEA 3UJFA 5CBJA 1XDIA 2DPEA 1R9XA 3BTNA 2FTWA 2WM1A 1AVAA 2NWRA 3AIVA 2GJXA 3QC3A 1OCBA 2P8CA 1Q1WA 4F2UA 4KT2A 1IZCA 3NR0A 3LTYA 2ODOA 4N6FA 4CU7A 1TYTA 2IKGA 3PS7A 1FIQB 3BLOA 5DT5A 1CXKA 1ZQ5A 2PCQA 4BI7A 2X42A 2NUXA 3EDFA 1E55A 3QPZA 2WSPA 1SW0A 1V6WA 1PZ2A 4L4LA 4L6HA 4GUHA 1FQ0A 3SGGA 3UT0A 4M5PA 1G4TA 2XGZA 2NQHA 3QSTA 3U4AA 1O94A 1FWWA 4P7OA 3NVWB 1BGGA 3UZWA 3WBXA 2WMIA 2WKJA 3TFXA 4ZMGA 3GLCA 1R3YA 2HQAA 1UYQA 3CXOA 1DKWA 1RA0A 2ZX5A 3H8AA 3VFLA 3TDFA 3QHMA 4PL1A 2A7NA 5J8LA 1WZAA 5LGXA 3WBEA 4XUYA 4KWVA 1NOUA 1V8EA 3N18A 3W0KA 2FPVA 2GGJA 3BMXA 3BVJA 4XIAA 1XI3A 2Y5JA 3LQGA 3GRSA 3W1MA 3N17A 4LH8A 1V02A 2SFPA 5A2BA 1G1YA 5AYZA 3KL0A 3T55A 3WK3A 3A13A 5CBBA 4JFSA 3VM7A 3N25A 1NFBA 4JQAA 2ZVRA 2E1WA 3VNYA 1GYNA 5J5RA 4GVHA 2Z2BA 4MMWA 3ENLA 3LBOA 2WWCA 3AYRA 2E8ZA 3NVYB 1X8CA 2QAPA 2Y5SA 3GZAA 1P48A 1XW8A 1JNDA 1OCNA 1KLZA 3F4CA 1QPNA 2LLEA 1GRGA 4H9ZA 1YTDA 4K7VA 4KERA 5H8PA 4HOXA 2GH5A 3EKLA 3KHJA 2TODA 4Q7NA 4HPNA 3HRDC 4JFUA 3LDVA 1TJ1A 1EKOA 1XV8A 4XAZA 4E8GA 1NHRA 2QUVA 4A8LA 3FKKA 1UKSA 2J13A 4QRNA 1EP2A 1IEWA 3MANA 4PMZA 3MI3A 5CLTA 3VCRA 7CGTA 2FIQA 4JEJA 4JKKA 3L5MA 1IWBA 5T26A 2IKHA 3IJ9A 3PZMA 3UP8A 5CAKA 4RV8A 4UQBA 2D0GA 3JZEA 2VC5A 4XTDA 1AQ0A 1MZRA 1KBKA 5L6UA 1K6WA 2DGAA 1JDDA 1ISXA 1J0JA 1A80A 1FWDC 2GVLA 2O9OA 3QW4B 1QASA 1HW6A 1TKKA 4J35A 3CQJA 3GKFA 4S1FA 1UZ1A 2PD5A 4C6EA 1HNYA 4GC3A 3N2TA 4PUDA 5HJYA 3NZQA 5CEWA 3B4UA 4ASTA 4K7YA 2EQ6A 2VC7A 4X63A 5LYRA 2QUNA 2VVNA 4H3DA 1XFBA 5I3FA 5EU9A 2XISA 2JIWA 2QMKA 1WXJA 3E02A 5MHBA 3DHDA 4AVNA 3BLLA 2NQZA 1EJ7L 1MO0A 2FJUB 4OWGA 3WN6A 3W85A 3UWEA 3NQ2A 1WZLA 2B7NA 1ZHAA 1O68A 4Q4PA 1TV4A 4ZXOA 4ZB2A 3TN5A 3N2CA 3GFYA 2ZXBA 2OGJA 1HKKA 1W91A 2ZC8A 3W83A 3AS2A 3T2PA 5A8NA 4PN2A 5TD4A 2ZZ5A 2FH6A 2VX6A 1TMLA 3F2DA 1UG6A 1QO2A 3FYPA 1LM1A 4TVCA 2ZUTA 3OC4A 2DP3A 3SCPA 3VUPA 2VOMA 2WJDA 3FX4A 1NWUA 3CUXA 4C5YA 2CZDA 4IISA 3WLOA 2VCCA 4DIAA 3XINA 3K8LA 5BXRA 4LBRA 1TTQA 2F9RA 1XSKA 5BRBA 3O05A 4E8DA 5D38A 4UMBA 2EQ8A 4D71A 3BLIA 4AX6A 3AC0A 4NYUA 5C7HA 3GG7A 4KEVA 2ZE0A 4ACZA 5LA0A 2UV8G 3NDOA 3GDMA 4G5DA 2VURA 4IMDA 5DMYA 1A5SA 3GY1A 3E6EA 3AI0A 3SQSA 1MXGA 3PUEA 3AJ7A 3GDRA 2OO6A 4FLQA 2DU2A 3PSVA 1RA5A 3N19B 1W9DM 1UHVA 2QJJA 3PP7A 2Q3RA 3O0KA 5CJMA 1R86A 1TPH1 2CLFA 3L23A 1Z89A 2VR2A 3VTRA 3PG9A 1FUYA 3W6YA 2NLYA 4J3TA 3SAZA 2ESCA 2VGIA 2WSKA 3RX4A 2VP8A 3N11A 3M0KA 3LGDA 4LANA 4FXRA 3MI2A 1OM0A 2ZZ1A 2ZE3A 4UFKA 2VEMA 4LJ3A 1A0EA 3WLSA 3T4CA 1Y5VA 4FO4A 4B5SA 5LNWA 1XQKA 4QQ3A 2DT1A 3DFYA 5CAHA 2C8NA 3W7DA 1JRBA 2X7WA 1PX4A 3L8KA 2QPXA 4GRSA 1XRVA 2EPLX 2C1GA 7PTDA 1Q6DA 1KFJA 5EMMA 5JCIA 1LL4A 4DM2A 3VD7A 1AH0A 2V9DA 4WY0F 4A4AA 5CPTA 2XSXA 2J47A 1HZYA 2FVKA 1DL3A 5HANA 5TIMA 1XCFA 4HCLA 1XG4A 2BOGX 1K4HA 2ATSA 3LCHA 1GKQA 2TYSA 2C0HA 2XJ7A 6A3HA 4LVGA 1LZOA 3RDKA 3T44A 1YW1A 2BB0A 3KAOA 2PWEA 5CPMA 4ENLA 3W07A 3GVRA 2BY0A 1TWWA 2EJAA 3R79A 3FK4A 2D69A 1TJRA 1WKEA 1MW3A 4Y8FA 2YW4A 1SW7A 2YOCA 3AAMA 1YNPA 3NZRA 5I78A 1CECA 4AIOA 3W37A 2Y2WA 1T8XA 1KD0A 1QAPA 1W5PA 3STFA 1DXFA 5KVIA 2CKRA 1GJUA 1EEPA 3ABOA 3QM3A 3NJ3A 1VBJA 5I23A 1JYNA 1Z32X 4FS9A 3GC4A 4ACYA 3Q65A 4XV0A 1GEUA 1AFSA 3FKRA 4TXEA 5F2LA 1PIFA 2INFA 4LC6A 1O60A 2WB5A 1OIFA 3LX9A 4C6NA 3AWNA 5K2ZA 2DSWA 1WXZA 5HJLA 4DNAA 3WQ5A 5C8BB 1IQ8A 1KWKA 3QN3A 3CHCA 2TMDA 1WKDA 2PDIA 3BAJA 4O19A 2PTXA 2I17A 2PP1A 1XLJA 3M46A 4QHRA 3RCYA 1CGVA 3FVDA 5SWUA 3IJDA 1CYGA 1FOBA 2CW6A 3POHA 3CNYA 5ABEA 2DUZA 4R85A 3CQIA 1UR0A 4FF5A 4H00A 4KIEA 5FL0A 1TYPA 4YWIA 1VAHA 1OCJA 4Q4KA 3TVAA 4F0SA 3CASA 4G7FA 3GTNA 1NAL1 4AQLA 1LL7A 4I7WA 1XLFA 4ZR8A 1P5BA 3REQA 3ZM8A 2FHFA 3UVAA 2W66A 1R2TA 4XO7A 3TXVA 5DMMA 5DX7A 3ITXA 5I0DA 3OQEA 1V7AA 1FH8A 1GVFA 1TV8A 4AUBA 2OPJA 3EWYA 4GX9A 3PZOA 1J6PA 3CIWA 3VGGA 2E7FA 1D7YA 3M0XA 1JCTA 4CD6A 3MUCA 2WHLA 3B0XA 3OBEA 1BF6A 1OABA 3HGRA 8CGTA 1UZ4A 4MJ2A 1CLKA 1LJYA 1NQKA 2F6UA 2I56A 4M80A 4OKDA 5AY7A 3SM0A 3PBWA 3CXBA 1PAMA 2A3EA 2AKMA 3DGBA 4PH6A 1DE5A 3MQTA 2P1FA 4L5ZA 3G0UA 1ZNNA 2GUYA 5AFDA 2NLIA 2Z27A 4PCPA 1FWEC 4CKQA 1ELSA 2XWEA 1UP0A 4MY8A 4UNKA 2XGBA 4H9XA 4B5NA 3B04A 3V0SA 3N9RA 2WVUA 3BMWA 3H4WA 4J3UA 1FH9A 2VFHA 1NIUA 3BXWA 3SO7A 3K8KA 2GJPA 2I16A 4L4PA 1G01A 4REQB 2PEVA 4U10A 5M2FX 4XVDA 3M0YA 1WBHA 4YYFA 1QNSA 1VCFA 4WXZA 1XLGA 3EMCA 1JPKA 3M47A 3LEPA 3LLDA 5IDIA 1UP2A 5FA5A 3I7RA 1XC6A 4QDWA 2G4JA 3N15A 2I14A 3LUTA 2VUNA 2Q6ZA 1SPQA 4DBUA 1QPKA 2GL5A 4S3FA 2HVNA 5BWAA 2POTA 4JR5A 1RALA 2O56A 3OVRA 4G9PA 3RXZA 1ADDA 3WLRA 5BXPA 3VK5A 2B4GA 5EY5A 4C6PA 4Q8NA 2ZC1A 3PVFA 1EA0A 3MSDA 4ML4A 1UR8A 4PTVA 1PIGA 4LALA 5AYYA 1V6XA 2PBOA 3NQFA 1V51A 3RJYA 3CUFA 2DZVA 2FFIA 4O16A 3GM8A 3R4IA 4XBJA 3H6OA 1VZWA 3UYCA 3M6DA 1RK6A 1SR9A 3AMLA 1QNPA 1AZ1A 4WIWA 3TOPA 4H4XA 3AZRA 1EDQA 2D73A 4LBSA 2V5JA 3IVUA 3GIQA 2QCMA 3C2VA 1OFQA 3IACA 1BEUA 3WBAA 1NWTA 2AQVA 1Q6LA 1CXHA 3GO2A 2PDJA 3EX2A 1E4LA 1GTHA 3SEPA 2PP0A 4A05A 2D23A 1OX5A 4HK6A 1UR2A 3DAQA 3U57A 1O12A 1SQ7A 4OBTA 2VUYA 3WLJA 3WNLA 5LSMA 2GUBA 3SDOA 3VNLA 4OJYA 3ABZA 2P3EA 6XIAA 1MQPA 1LQ2A 3U48A 3FA4A 4G7EA 1R47A 3KW3A 2YCIX 5BROA 1Y0EA 1XKJA 3TUUA 4H50A 2CLKA 2V3DA 3HPSA 4Q4MA 1OF6A 2V3EA 4Q6JA 1U5JA 1D9EA 1JUKA 5HOSA 2DH2A 3J7HA 2V2HA 1RH9A 3UXAA 1VEPA 1JUBA 4JN8A 3V3WA 4E4FA 4MFDA 3UG3A 4AY7A 2ALRA 5BRQA 5IM51 3E2VA 4JHMA 1LP6A 4JFVA 4TR9A 1MUCA 3MYPA 3STPA 4NUWA 1UMYA 5EL1A 2OODA 2PWHA 2QUTA 1L6FA 1ZTVA 2BASA 3QR0A 4XKMA 3MCNA 3NVTA 5D32A 1EXPA 4TVDA 3CO8A 3WDIA 5CZTA 3CWHA 4KBXA 4TVYA 2J7GA 4H2HA 1CLXA 8XIAA 5FJJA 2WMJA 2GGIA 4DBDA 3S9ZA 2HS8A 4CQAA 3UWUA 4EXBA 3FEQA 4OU1A 3UNDA 4B91A 4C1LA 3FXYA 1AODA 1UASA 4GFSA 3D46A 5EMUA 3GC5A 2G3JA 4ZE5A 4QEHA 2MANA 3I65A 4B2DD 1STZA 5IOBA 1X1ZA 1TRIA 2CIPA 2A8XA 2V63A 2PRHA 4EQXA 2JIEA 2OYKA 5EFDA 4PB4A 3GK0A 1XYZA 2Y7EA 3EWXA 3HPZA 3SBFA 4ZSUA 5KSWA 3FYOA 3VMOA 1V6VA 5A6JA 4C6IA 2P3ZA 3EDJA 2YA1A 4GBDA 4MPQA 3LGEA 4D8ZA 1QOPA 3OIHA 2WMHA 4RCXA 4GXPA 4CVUA 5A95A 3PWAA 3UG5A 4D6CA 1W3LA 1JFHA 5GPRA 3NPXA 2HQMA 3R8GA 1MEIA 1NARA 4RX0A 4HNLA 3VOGA 1VCVA 2FHCA 1T7LA 1H61A 2E25A 1EJUC 1ZS2A 2PDGA 2R1KA 3KL5A 1RQHA 4BQ4A 2C19A 1IZKA 3PBYA 4JX4A 2O0TA 4IIBA 3CZ8A 1JG9A 2WYSA 1L9WA 3GTXA 1TR9A 5T8GA 1AJ2A 1ZLPA 2YKKA 3M0MA 3PZ9A 3UY7A 3A4WA 3AXKA 4FXFA 3KUMA 3NM3A 1NU5A 3RF9A 2VFFA 2ISDA 3OP2A 2X16A 2QJGA 1XYFA 1C92A 2WMKA 1RCXB 2RFGA 1AH3A 3M0LA 3QPEA 3H2OA 1POJA 3MP3A 1RCQA 2XVGA 5DBUA 4EANA 4ERGA 2ZA1A 2VGGA 2QULA 4P7LA 4WF7A 1TVPA 4OV4A 3P61A 1M01A 2V5CA 1OEPA 4BS0A 3N2XA 5MF5A 3B8VA 1CBGA 3SRDA 2RDWA 1NELA 1J0YA 5U1OA 3T81A 2WVSA 3B8DA 5I09A 2AL1A 1OSEA 1YQZA 4U3AA 3WNNA 1IIGA 1JPDX 2DY3A 4HIBA 5D2TA 4FNTA 2DJXA 4YMZA 3CGBA 1E0WA 3QFEA 3U5YA 4Q8PA 1PCWA 1ZAIA 1FHUA 4NG3A 2YCKX 3BGAA 4FNUA 4FMVA 5HDRA 4IWWA 3ZR6A 4GI8A 1HFBA 4ZEPA 4FNPA 2NW0A 4NNBA 2R1NA 4WY0B 1N5WC 3OGRA 1NF7A 2ZUVA 2NT0A 1P0BA 4O57A 1GXFA 4JNYA 1YLVA 4IPLA 3XIMA 4EP8C 5FOOA 4FXSA 4Z0JA 2PDLA 1BTMA 2J7FA 3WH8A 3GYCA 2QVHA 1A3XA 3BQ5A 5D9MA 2VDIA 5ECVA 1EC9A 2AOSA 3W25A 4J2PA 4JIIX 1XIBA 2ABBA 3NL2A 1K77A 4KPLA 1H2IA 3IUDA 1CGYA 3R12A 3T6CA 4F0KA 1G4EA 2ZRZA 4NHVA 1LYXA 4HBKA 1V02E 2R1PA 4MNKA 4AZBA 3N13A 4ORMA 4DYKA 4CN6A 1B3WA 4AD3A 5EMKA 3URQA 4WDWA 3RN6A 2Z24A 1CNVA 2BCPA 3UWYA 4IUGA 4PSPA 3C0QA 4LCQA 2C18A 3VU2A 3P0XA 1QCWA 2EG8A 3G8EA 5HWMA 4AF0B 1NP2A 1UR4A 3SADA 4UFLA 4HZMA 4AZHA 2VZVA 4PE8A 2GWGA 3OVPA 1EXBA 3RRXA 4KRTA 5LXEA 1GPFA 4I3GA 2R1LA 4TIMA 3W88A 4EACA 3NWRA 1QTWA 2PDKA 5CZJA 4B4HA 3MKVA 3ISIX 1KKOA 4C6FA 2Q02A 1O6IA 4YCOA 4OBRA 2CBUA 3HPFA 2R9ZA 1AJ0A 3URHA 4QNEA 4KF1A 3TC7A 2NT1A 3AIWA 3GUWA 3LCXA 4C91A 3FIGA 3E2SA 9RUBA 3WDJA 2GR1A 3UA4A 3WQVA 1B1YA 4HMDA 1B5TA 2I5QA 1EJTC 1WX0A 4J56A 1EJWC 4GUJA 1VBUA 1XIEA 4HNVA 1I1WA 4JTJA 4CEXC 4CCDA 4PMDA 1XD0A 5DF0A 4R53A 4Y9AA 2R9RA 2VEKA 2HISA 5G5GB 1TPC1 4DJEC 1LOLA 3GNNA 3TR9A 2ZUMA 2XM1A 2WSQA 3W84A 4ZQNA 2X0HA 5FS6A 4DB7A 3TWAA 4HHPA 2A7PA 4BI6A 5CCZA 1EYEA 2Z2AA 4GZ7A 2ZRWA 3W1NA 1HX0A 4XB3A 4CQDA 4DF1A 3C4UA 3W26A 4AAJA 2VKZG 3TQKA 4IFOA 4O4WA 3MT1A 4GI4A 3P81A 4R9XA 2XWDA 4GYPA 3G1FA 3DK9A 1NY1A 3TQ0A 3WD0A 1E1CB 1H0GA 1GZ1A 4AEFA 3H53A 4PBGA 2AL2A 1NHQA 2V8ZA 4F48A 4OT7A 3SY5A 3CAKA 4IJRA 3UZJA 2VDHA 2WCAA 1KWGA 1AQMA 5D33A 1OFBA 2OOFA 5A1AA 1WQ5A 4QS6A 3POCA 5CGMA 4H9UA 3ANUA 3Q58A 2A6LA 4G1NA 3D3FA 1E9YB 4A2SA 4E4UA 4FP1A 4EF8A 3ZJKA 1FHVA 2X0SA 5D37A 1EO5A 4AG0A 2E9LA 3VUSA 3VNKA 3K5XA 4B2DA 3VKBA 4WK9A 5AC8A 4M19A 3SRFA 4EXQA 1QWGA 1K7FA 1OY0A 3WIJA 3LSCA 3E0IA 3WF4A 3AFBA 3BJSA 1XD1A 4L6DA 3OLGA 3CUJA 2QPSA 4IIHA 3VKCA 2V5BA 4J1OA 3LNMA 5F2MA 3SCVA 2WMFA 3USBA 4Q4OA 1TA3B 1LWHA 4B9ZA 4YCPA 1US2A 2X0YA 3OLEA 3DKLA 5B7ZA 3VGEA 1KGUA 4CD4A 3F4WA 3SB0A 4U3CA 3AZTA 4X3ZA 3VGFA 2FGBA 5GNYA 1IGWA 1KCZA 3FGCB 3IJQA 3GR4A 3MS8A 6TAAA 1GRAA 2ZXDA 3H7VA 3SN0A 4ZXLA 5GJMA 3VD4A 4CQ8A 3K13A 3ITGA 4M6UA 2HVOA 2IXUA 2VEIA 4IQDA 4DO4A 3UG4A 5MKGB 3GR7A 2E5AA 4Y9PA 3O6CA 4LWWA 2X99A 4ECLA 1EHAA 1XLMA 4Q4RA 5KINA 3MVTA 1QNRA 4HA0A 3H7RA 3VDBA 2INZA 4ZL1A 4U5IA 1XUUA 4DJFD 3SCRA 4AZ7A 5ABHA 4QEEA 1SB3B 1KB3A 3HG2A 4P8VA 4H4UA 1PHWA 2HK1A 3RITA 2V6OA 3WQ6A 3Q37A 4DRSA 2DT3A 2PC4A 4PCSA 1XPGA 2R6OA 1VJZA 1VDVA 5I5RA 1PTDA 3CGEA 2G37A 1E0VA 2A5HA 3WJZA 1UUOA 4LA1A 3VC5A 1BG9A 4C65A 1RK5A 4NIRA 4GFIA 1GWJA 4DPQA 1TFVA 4JTUA 4ZO8A 2HWGA 1J93A 4ES4A 2Z6IA 3EMQA 1DJNA 4ZO6A 3TTYA 3VIOA 2GVGA 3H4XA 1FKWA 3N2OA 1UQYA 1KW1A 1FFUC 2QNEA 2BHYA 1NJJA 1HXJA 3KCJA 1VPYA 4QG8A 2YZ5A 5ABFB 1K03A 3DERA 2R8WA 1HT6A 1H51A 4JAWA 1PKNA 4UTMA 2R24A 4D8AA 5DCDA 3WF3A 3AMDA 6ALDA 4UOZA 4AZIA 4ERIA 4NI3A 2P10A 1VJIA 3HPXA 3FJNA 1CX9A 2WAGA 3ZFHA 1S39A 3O6YX 3UETA 1GVRA 2J7BA 4QP0A 1BWKA 4QSHA 1GUVA 2ZRUA 2HEJA 4H2CA 4J27A 2X8CA 4O1DA 4RJEA 2JFEX 4UMAA 4JIHA 3HMJG 3C8NA 5H8UA 3L66A 1JXJA 5E0CA 2G50A 1FEAA 3HQPA 5AYBA 4LYRA 2W0HA 4JCLA 1QOXA 1DTUA 1BPLB 4WZHA 2GR0A 1I8JA 1DJZA 3K4WA 3S1UA 2VCBA 3G2GA 1QATA 4DO5A 4UTTC 1CWYA 5HQMA 2HPMA 4J3SA 4XBKA 2VX4A 4IFKB 3STEA 4HOZA 4DWSD 4CN1A 5FS9A 1SFSA 5ENLA 3CGDA 1VRDA 2W79A 3TYAA 3ZQ9A 1WAUA 2YW3A 3MHFA 1MYRA 3GUGA 1GRBA 3NA8A 4JTIA 2W3RA 2WC7A 4JFWA 3GNXA 4UR9A 3C2YA 1A49A 4Q8VA 1KBIA 2G95A 1AMKA 2E5BA 3N4FA 1NVMA 3VCCA 4DLFA 3CTLA 1RBOB 1VCGA 1ZJBA 2YDSA 3KVKA 3COTA 2VQUA 4PMOA 4B5UA 1Q6RA 5FESA 1D7KA 3S2LA 4IQLA 1OYCA 1VJSA 3IAQA 1YYAA 3C0LA 3BK0A 3LV5A 1VQZA 3LCFA 2Z7KA 4UIOA 2ZRVA 4REQA 3EANA 1R3TA 2ISWA 3TJIA 1UJPA 4PMJA 2R14A 3CUZA 1O5QA 2VVSA 5FI8A 4E2OA 4NEVA 1EDTA 4IIGA 4D6EA 2W3SA 1E5JA 1QI5A 3TMLA 2EBNA 1N8FA 1GRHA 3AXHA 5A5WA 3WH6A 3VIGA 5I7GA 1JF6A 4UFHA 3FA5A 2FZ8A 1Q8JA 1SU5A 2W54A 1G7UA 2EQ7A 1DJGA 2ZX6A 3LD5A 2OTDA 2HZGA 4YLWA 3N6HA 5E93A 1YE6A 2P8BA 3E3HA 1D3CA 4DYJA 4L56A 4GXMA 1IWPA 4QLKA 5I03A 1XS2A 1M3UA 2WPCA 2RH9A 4FALA 3DN5A 1ALDA 5HUOA 1YRRA 1ESWA 1L8PA 4MZYA 2ZA2A 1JQVA 3CMFA 3NDYA 2YXXA 4S3JA 3GRTA 1BAGA 3RG6A 4Z2KA 4Z17A 1DEDA 1DXIA 3FYYA 3VABA 3Q45A 3O9NA 3ARRA 1E9IA 1J2WA 1VRXA 4YHGA 3N9KA 2RDUA 2VR5A 2ZZ6A 2BXYA 1UUQA 3F03K 4GWEA 3AMKA 4HHHA 4QE1A 4W8LA 1TJ0A 2RKXA 2WJZA 2Z28A 2EJ1A 3TWBA 2IKIA 3AHTA 3GX9A 1MEHA 2BVWA 1KBJA 2CNCA 2QXWA 1M7OA 4DZHA 4N9BA 1TTIA 4LUJA 5GRTA 1UWIA 3O16A 1C91A 3FEMA 2Y88A 1CLVA 1FWGC 4FF7A 2QCFA 5E9AA 1S5WA 4V28A 2NVDA 4HT3A 3S0CA 1OVDA 3TROA 2AAQA 3B9JB 1U5HA 1W8SA 3CEPA 1E1EA 4AVOA 3SIMA 3WDHA 1ZBKA 2HS6A 1J12A 3BAIA 1K3UA 5D2YA 4FA3A 2D2HA 3DG7A 5U7SA 2NQLA 2VRKA 3MMDA 1P0KA 3C52A 1ITUA 3VPLA 3A4AA 4UTHA 2J62A 2R1MA 2E77A 1P0EA 3WQ4A 4IUOA 1KM0A 2XFFA 1AUSL 3C8FA 1ITXA 4BR1A 3CUIA 5XINA 2GGHA 4GX8A 1D2KA 4LNYA 1YKWA 2Y85A 1FWRA 3N9SA 4IH3A 2CBJA 1IZJA 3VFCA 1CZ1A 1UBSA 3B8UA 1WYGA 2BMBA 2VDGA 1JPMA 3CZKA 1UPPA 1KGXA 3MJYA 5I77A 4MNMA 4PFHA 4G8TA 2BGSA 4FAMA 4BQ5A 2Y8KA 3WNMA 4HZ8A 2D20A 5CXPA 1O4UA 3EX6A 1KLYA 5DANA 4DJFA 5CSSA 3D6NA 5D9PA 1H0IA 2XPKA 3VX0A 4ICMA 3Q67A 3W1UA 3HBLA 4YS1A 3H4KA 1K02A 5HATA 3PN8A 1GQIA 3S3GA 4L4OA 5HMSA 1DP0A 1FTXA 1ZDLA 2PDBA 1RJRA 4O50A 3G1XA 3E0VA 4EM3A 3GKAA 3ZJ8A 3T0BA 4PTXA 4XZ9A 1Q65A 4BEQA 1F3EA 1BVWA 2YZRA 6REQA 1JZ7A 1F61A 3QQ0A 2BOEX 4B92A 4WXYA 3UPWA 4BK9A 2JQXA 3W28A 3QKEA 1NDAA 2OMAA 1IEQA 1H5VA 1VGAA 2C6QA 5A2CA 3DXIA 4O18A 4O1EA 3UJ2A 2C7FA 4GH1A 3NG3A 3SCQA 4XAGA 2QZRA 4WRHA 2O4MA 2J75A 3TP4A 3UXIA 2E40A 1TPWA 3U8GA 3GVVA 3GXPA 1IXPA 4NAEB 3PUDA 1H7NA 3L4VA 4FOKA 4DJDA 1F8IA 1BKHA 3M0ZA 4PUNA 5KEZA 1W3HA 2FB2A 1UR3M 5KZDA 1G67A 2QKFA 4L9YA 3RO6A 3XISA 5FF2A 3PWGA 3V1PA 2EQ9A 1LOQA 1G7VA 5D9OA 5LNSA 4UXDA 3T8LA 4EX4A 1OADA 1U33A 1ZSXA 4FX7A 3W7KA 2WOVA 4ZO7A 1SZNA 2XGIA 1KTNA 3O8AA 5A6LA 2WQDA 1RM6B 4UR8A 5CC5A 2O9RA 5I3IA 4V33A 4MLRA 1IEXA 4LS2A 1E6NA 2D24A 1EJXC 2V30A 3DHPA 3ITCA 1FKXA 3AS3A 3KX6A 4LXFA 3WLTA 3W7MA 4H4IA 1RZMA 1BWVA 2WM0A 4PMYA 5A6MA 1W1TA 1IHIA 3AM9A 1TTJA 5EPDA 1E6ZA 1RJQA 2PZ0A 1Q13A 4OV9A 5LXXA 2EKGA 4FZIA 1F7BA 3K2GA 3OZMA 3QF0A 4DWSA 2WOIA 1M04A 4JTRA 3MUXA 1OIMA 1WO2A 3UWZA 2OG9A 5CKSA 1G94A 4NZ1A 1O1ZA 4MYAA 1KM2A 5FEZA 5G4WA 1V6TA 1ADOA 2BY2A 3TFCA 3EX4A 1UH4A 3KZSA 4WY0A 4D9PA 3BO9A 4CQ9A 4UTWC 2WW5A 3CM4A 2W0UA 1WPCA 3NQDA 1W5OA 2JF6A 4KCUA 4X0NA 3AU6A 2HPIA 1IIHA 1H2JA 4H6RA 5CC3A 3NQAA 1GQKA 3KLKA 2EPOA 5FF4A 2I57A 4H8NA 4DUWA 2J66A 3AALA 1QNVA 1QBBA 4WD0A 3KTSA 4PCNA 2WVVB 4OOZA 4IGHA 1ZBCA 3ARUA 4QTGA 2X2GA 3NO5A 3CQKA 2OEJA 4M6VA 4DI8A 1XYLA 2E6YA 4JQ2A 4LUYA 3EWUA 5FSDC 1S7MA 3AXIA 1UA7A 1R3WA 3L2LA 1OJTA 3BICA 1V3HA 3DFNA 4O0ZA 1SZEA 3BL3A 1RR2A 3W1TA 3RLHA 5M5DA 2W63A 1TSIA 4M82A 5CPLA 1RBAA 2BHZA 3S5SA 2PD9A 5BOFA 1C29A 2PC8A 3CPRA 2OLHA 3E74A 1EBDA 4AD0A 4FNSA 1JD9A 3TLLA 1W1A1 1QW9A 1YNQA 1KFCA 4GY7A 4UOQA 3AJXA 4P8XA 2I9UA 5JCLA 1G0CA 2HCVA 1UD4A 4GIRA 4J40A 3IEBA 1FFVC 1W2VA 1E6PA 1QHZA 2ALDA 3I4EA 5H1WA 2QDDA 1F2JA 1JCNA 4B90A 3NCOA 3VIJA 3WFAA 3FNDA 4JNMA 4U2ZA 3A12A 2NX9A 2ZYFA 3MZNA 3N6QA 5HAOA 1YXYA 3ZWTA 2HROA 3GW3A 1X1NA 4JYDA 4W85A 3GNRA 1J0ZA 3WUBA 3UPBA 1S5MA 4GQ0A 2UZ9A 4H9YA 3L65A 4JS3A 2EPNA 3NNTA 3OEXA 5FMHA 2PF8A 4HPGA 3AO0A 4RR4A 4QROA 3T0DA 3RFAA 3W2UA 4N02A 1JRPA 3EWDA 3DX5A 3TC6A 4FSAA 1CCWB 3N2BA 3T0TA 3WD4A 4KCTA 2Z4GA 2MNRA 5CPQA 4XG1A 1K7EA 2HTMA 1H63A 1YIXA 4IXXA 5D04C 2YFNA 1VB9A 3NQEA 4GZEA 2V3BA 3M5YA 3ANYA 3CPGA 4BF7A 1E1CA 2VQTA 2F8QA 4K7ZA 3SIZA 1EUAA 2C3ZA 2G96A 2Z7GA 1S2TA 1RQBA 1NOWA 1KXHA 5GJPA 1C90A 3R43A 3DBPA 5F4WA 4C1NB 3LHUA 4Q4SA 4F2TA 3R8HA 4BQ3A 2R91A 1OK4A 1DV7A 3LBCA 4W84A 5C55A 3WJXA 3TIMA 4A8NA 1KBBA 1A5OC 2C79A 4MB5A 7REQB 1PUDA 5AECA 1OFAA 4BI5A 2RHGA 3G18A 2QVNA 2Y7GA 4J7RA 5FS7A 4QS5A 1REQB 3PZGA 4P7NA 4XVEA 3PR2A 2E5DA 2VEFA 1WA3A 4EKJA 5EBKA 4PTDA 4URIA 3GE7A 2BLEA 3L0NA 4S3AA 2DZAA 3EOSA 1YDOA 1C3FA 2J7CA 4US5D 3ORWA 3G1VA 3W1LA 1HO4A 1XRTA 2ZZCA 1TA3A 1GW9A 1TV2A 1UZHA 2VL4A 3GBDA 4JFTA 5KITA 5GNXA 1H1YA 1VF8A 2DSZA 3TAKA 1TWSA 1QR7A 3CWNA 2OFJA 3PJXA 1SO5A 3URAA 4N4QA 1K8ZA 3V7PA 1ME9A 4Z2HA 1XLEA 4HNNA 5DT7A 3V5OA 2ZDSA 3VKAA 4LT9A 4ZOAA 3V75A 3EYPA 3T09A 1WUEA 5MKGA 2XIJA 4F4RA 3VIIA 3HGSA 4ZQMA 1WB0A 3R25A 2E6AA 3CLWA 3T8QA 1CXFA 4EAYA 4Q8QA 1UOKA 2B7PA 5DLCA 4NYYA 3ARQA 1CW2A 3N12A 1VR6A 5CJNA 4DUXA 3ARWA 3V5CA 2YCEA 2PDFA 3CAVA 2Z26A 4N2YA 3LS9A 3UR2A 3GNOA 1T40A 4DX3A 3S47A 1SZRA 4KWOA 4XZIA 4AZGA 3KM8A 3V16A 4H8VA 5KZEA 4A22A 1B2YA 1W1B1 2CETA 3UCQA 4KEMA 1Z3NA 1MVYA 2WLYA 3FJ6A 4EXAA 4H4PA 3NEVA 1OK6A 1EJSC 1P7TB 2A3LA 1B31A 5EMYA 5I6SA 3G1YA 3DGHA 4H4VA 3CPUA 1ADSA 4NL1A 3W7EA 3ZYZA 2PRMA 3KZPA 4U28A 3WNPA 4H8HA 2BP1A 1CGXA 2YBTA 1LWIA 3P62A 3GXTA 5TF0A 2VELA 3BGGA 4MJZA 4AU0A 3CUHA 2G3IA 3CHVA 3IJ6A 1V6UA 4UQ9A 1XP3A 2YR1A 1OT2A 5ABFA 2G0WA 2DIEA 2IKJA 5EMJA 3CYJA 2BGQA 2VTFA 4C6DA 1ECQA 2XVNA 3M43A 1E6RA 1CB7B 2DDXA 3DHUA 3RM4A 3WX7A 4QCFA 1PKLA 1RLCL 1GGOA 4I8DA 3ARPA 3GVQA 1EPVA 3DYMA 2WZIA 4FLOA 1GOXA 4TMBA 3GSMA 1LRTA 3MCMA 3WQOA 1Q85A 5F4SA 4FLRA 4LGXA 3EWZA 2GQWA 1LBFA 1DIDA 1H6VA 1OZQA 5FJTA 3E38A 3PBUA 5F7UA 3BWWA 3T2OA 3ABXA 1TELA 3M4HA 1IT0A 1AW1A 1HP4A 2AGTA 1AD4A 4HNTA 2NVCA 1GEHA 2V67A 4GZJA 2RGMA 1HJUA 2I7GA 4LRSA 1QOQA 3WL1A 5K7JA 1DBTA 4LAKA 4HU3A 2W55A 1NQ6A 4D1JA 2F5ZA 3UZZA 3NOEA 3HN3A 2JKEA 5I3HA 1V0MA 4M52A 3O6AA 1W32A 4YVPA 2C14A 4IFKA 1VLWA 3U5UA 4U5KA 3BDKA 1DXEA 1KRBC 1ZX9A 2D2JA 4NNAA 1WKFA 4C90A 1EF3A 3S8HA 2YCJA 3MO7A 5A6TC 4KEUA 3PTQA 4LC8A 2GSEA 3GAKA 4IPPA 4LFYA 4GI6A 3R2GA 4NX5A 2OWCA 2OWWA 4RL3A 3W01A 1H7RA 3DIPA 2WSYA 3CK5A 3R8RA 1GNXA 4GZIA 1PYFA 1CT5A 1T99A 1VYRA 1W1YA 3TCEA 2WJFA 4AH7A 2GJLA 4K38A 4LNCA 4UNLA 1JEHA 2CHRA 4GQBA 3TW7A 2WZTA 4EPKA 4X0VA 4JTSA 4MKVA 4RKAA 3UWWA 3ITLA 4MWAC 4NJHA 3GTHA<