3V5FA

Crystal structure of the mutant e234a of galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
b'SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEAAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure of the mutant E234A of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
molecule tags Lyase
total genus 134
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v5fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v5fA01
3SN0A 3R0KA 3H12A 3UJRA 4HCLA 3UXLA 3GO2A 1PDYA 3S5SA 1P48A 3V4BA 4G8TA 3ZLGA 2QDDA 1TE6A 3BSMA 1R0MA 2HNEA 4GMEA 2PTZA 3RRAA 2PCEA 2GDQA 3Q45A 4E5TA 3QKEA 3MUCA 5BOEA 3MY9A 1KKRA 1WUEA 3DESA 2OZ8A 3RR1A 4ZCWA 3S47A 2OG9A 2PA6A 4H83A 2ONEA 4DHGA 3FJ4A 3ZVHB 2AL2B 1JPDX 3IJQA 3CT2A 2RDXA 4HCDA 3ZVIA 4MGGA 1JDFA 2XSXA 3T6CA 5FJUA 4GFIA 1MDRA 3IK4A 3V5CA 1BQGA 3BJSA 2FYMA 3RITA 3FXGA 2DW6A 3N6HA 3OP2A 3UJSA 2OQHA 5EU9A 1W6TA 2XH0A 4HN8A 3EEZA 2GGGA 3P0WA 1TZZA 3D46A 3OTRA 4EWJA 3MKCA 3I6EA 1MUCA 3MSYA 4E4UA 4E6MA 1EC9A 4F4RA 3D47A 3T8QA 3TWBA 3CAWA 1E9IA 1XPYA 3H70A 1YEYA 3R0UA 4HNCA 3RO6A 3UCDA 4IP4A 4A3RA 6ENLA 3SQSA 3THUA 1ECQA 3H7VA 1WUFA 2P8BA 4K1WA 4IHCA 4H1ZA 3I6TA 3Q4DA 4JN7A 4YWSA 2QQ6A 3TQPA 2PGEA 2P0IA 2AKZA 1EC8A 4M0XA 1TKKA 3TW9A 3TJ4A 3STPA 3H8AA 4DWDA 5J04A 2OX4A 3QTPA 4IL0A 3NFUA 3VCNA 2QVHA 3OPSA 1SJBA 3EKGA 4M6UA 4GGBA 3DFHA 2PS2A 4DN1A 1EBGA 3DG7A 2QJNA 3GD6A 3NZGA 3MQTA 3FVDA 1PDZA 2PP1A 2FKPA 1RVKA 3DERA 2QJMA 1P43A 5FJOA 3BOXA 2QDEA 2XH7A 3K1GA 2CHRA 1KD0A 3GC2A 3R25A 2OZTA 3OZMA 3SSZA 2PODA 3FCPA 2MNRA 1OEPA 2ZADA 3SN1A 2AKMA 2OKTA 3T4WA 2AL1A 2OPJA 3R1ZA 4HNLA 3PK7A 1ELSA 3MZNA 2PTWA 4ENLA 4JN8A 4JHMA 3CXOA 2NQLA 4H19A 1ONEA 2XH2A 2XGZA 2O56A 3OZYA 4A35A 1JCTA 3ZLFA 1DTNA 2PPGA 3T9PA 3R11A 3FYYA 2PP0A 2POZA 2OQYA 3IJLA 2P8CA 3DGBA 3DG6A 2PU0A 3TTEA 3PFRA 3UJ2A 2PTXA 4Z17A 4E4FA 3FV9A 1EC7A 4HCHA 4GYPC 2MUCA 3N4EA 3JZUA 4ROPA 3U9IA 4DYEA 2DW7A 3DG3A 4J3ZA 3UJEA 2PSNA 4HYRA 3UXKA 1R6WA 5FJTA 5FJRA 3VC5A 3HPFA 3ZVHA 2AL2A 1EBHA 4IT1A 3CK5A 2PMQA 4A6GA 1KKOA 2OVLA 4MMWA 4HPNA 5ENLA 3SBFA 4KPLA 3SJNA 2HZGA 3I4KA 3R10A 4ZA0A 1SJDA 4GISA 2PU1A 4FP1A 4E8GA 3KUMA 3DFYA 1NELA 3CYJA 4GYPA 3UGVA 1NU5A 3VA8A 3VFCA 3CB3A 4Z1YA 2HXTA 2GGIA 3RGTA 2ZC8A 3N4FA 3PWGA 2PTYA 1FHUA 3VDGA 1SJCA 3VCCA 3DDMA 3JVAA 2PGWA 3TOYA 3UJFA 1IYXA 4KWSA 3SN4A 3DIPA 5BOFA 3P93A 3DEQA 3OW1A 4KEMA 3ES8A 7ENLA 4H2HA 4K8GA 4DXKA 2OO6A 2GL5A 3UCCA 1F9CA 1FHVA 1SJAA 2OZ3A 3N6JA 3NO1A 3P3BA 3RCYA 2QJJA 3V3WA 3QPEA 2GGEA 1MNSA 3B97A 3TCSA 3GY1A 1MRAA 2OLAA 2P88A 1MDLA 4IZGA 1L8PA 4G7FA 2PP3A 3JW7A 4K2SA 4IL2A 1XS2A 4J1OA 3V5FA 2P3ZA 3QLDA 4KT2A 4DX3A 2OFJA 5FJPA 3TWAA 1KCZA 4GIRA 2QGYA 4MKSA 3MWCA 1JPMA 3ENLA 3IJIA 4IP5A 2I5QA 3ES7A 1BKHA 3PWIA 3QN3A 4FI4A 3TJIA 4GGHA 2GGHA 3U4FA 4X2PA 2XH4A 2HXUA 3ZLHA 2GSHA 5IDZA 3NXLA 2GGJA 3VC6A
chains in the Genus database with same CATH superfamily
4O18A 1Q63A 3RJYA 3ANVA 4PEKA 3H12A 3LGDA 4X60A 4ZEPA 3UJRA 3QGVA 3IJ8A 2A7PA 1VBGA 1H0GA 5G1MA 1H7RA 1NF7A 3STGA 4LW7A 4MWAA 2QUTA 4JTLA 4GMEA 1IR2A 1WXJA 4A3QA 1T0OA 1QASA 3ARTA 4LYKA 2UBPC 4HA3A 1MUMA 3BPWA 4LANA 3H54A 3RLVA 3DESA 3W7OA 4ZOHB 3T8LA 4C6LA 1ZBCA 1AL7A 4DJDC 4EK7A 3D9XA 1J0YA 1EJVC 2J7GA 5AC6A 1D7FA 4L9ZA 3VE7A 1ZDLA 2X1RA 5GJMA 5BXRA 1Q6DA 5C5YA 3U7VA 3APYA 3LCHA 3GTFA 4K68A 1G4PA 1JZ5A 1OFPA 3L65A 1JDFA 2XSXA 1N62C 4FNRA 3PZVA 4XKYA 2C91A 4XK2A 2NXIA 1NHRA 2V3EA 3VFLA 4Z2LA 1MO9A 1C91A 1MUWA 1XYAA 1QW9A 5KVIA 2GPTA 1TVLA 1XP3A 3LHZA 3NZQA 4C5ZA 3NOEA 1YXYA 1UG6A 1NHSA 4EANA 3W1XA 3CBWA 4YU1A 1BKSA 1OFDA 4H8VA 4LBUA 1CI1A 3BLEA 1UCWA 2XVNA 4HK7A 4NG3A 1MQRA 3W23A 4N7QA 2PDPA 3TYDA 2CESA 5I24A 4H4VA 1JPHA 4V15A 4GCAA 1UR8A 4RDVA 4YLWA 4IP4A 1TYTA 3IUIA 3SQSA 5LA1A 4W7WA 1ECQA 4Z42C 2P8BA 1V7AA 5A3HA 3IVUA 1XRFA 4BQ5A 2BVWA 1KC7A 3KDOA 3NVWB 1AQMA 5ECUA 4JN7A 3K8LA 4NZCA 4LNYA 3K13A 3M7SA 1ME9A 3DI1A 3STPA 3HM7A 1EF2A 1ONXA 4R9XA 4MB1A 2Z28A 5K2ZA 1GG1A 3IPWA 4GRSA 4LAKA 3K5XA 4D71A 2V5BA 2CYGA 2PDJA 2PWFA 3IJ7A 1NHQA 5IHRA 2X41A 4KCWA 5I6SA 2H3DA 4WEVX 4WIWA 1Y5VA 2A5HA 1EO7A 4DN1A 1LLOA 4IH3A 2QCDA 1KFLA 4I8YA 2XG9A 3NQ2A 1PX3A 4BR1A 3ZR6A 3TNOA 3DAQA 4PODA 4QXIA 3W7GA 3PP7A 1FH9A 3SUUA 3AICA 4GLEA 4FB7A 1GOMA 1Z7AA 1RVKA 2O92A 3M44A 3TMQA 2V3AA 1QOXA 5KZDA 4NJKA 2YGYA 1JDEA 5CPLA 1QHOA 4DJEC 3GU9A 2OZTA 3FSUA 4QJ5B 1RLDA 2YOCA 2PODA 2CERA 4O11A 1AMKA 1W1PA 2VELA 3EWXA 4QHRA 3CM4A 5FS9A 4QCFA 4QDWA 1RP8A 3OODA 3LK6A 2BGSA 2VXNA 3VNIA 3T55A 1W9DM 2X2YA 1C9WA 4HNLA 2BXYA 2XDFA 4EOUA 5GJPA 2TMDA 1RJRA 1PZ2A 2E7FA 3C3UA 5TD4A 1LOSA 2VR4A 4NI3A 4UFIA 3CXOA 3D3FA 4QQUA 3G1XA 4QSFA 3WQ5A 1EDGA 3WKZA 2GFTA 2PDWA 3MT1A 3UD6A 4A2RA 2BZNA 4UR8A 3UEQA 4DLMA 5ABGA 2XIIA 2OQYA 1DWIM 3GFYA 4H4YA 2G4JA 3IJLA 3NJ3A 3IS4A 1MVYA 3CHEA 3QW4B 4R27A 2PUZA 2XUCA 5CJNA 5D04C 5C70A 1JYVA 5EBUA 3TE9A 4E4FA 1FWRA 3LRKA 1S39A 3OVQA 4DM2A 2VC7A 2V67A 2ZZ6A 4JX5A 4H9ZA 5T91A 3FK4A 2PDBA 3K46A 3UR7A 2ZA3A 1TELA 1SSDA 1H7XA 3U2ZA 1CIUA 2FPTA 3QVQA 4QDPA 5CPMA 1K6AA 4A6GA 6ALDA 1OM0A 4MNJA 4RKAA 4YWIA 1KN0A 2Y8VA 2HZGA 1EZ2A 1UWTA 2W92A 2F38A 2VKZG 1XLLA 1V0KA 3ZSTA 3TXZA 2JIWA 2DY3A 1W9XA 4TV6A 3GXFA 2PU1A 4JHOA 4GACA 4JTEA 4JL2A 2CLKA 2YFNA 5CAHA 4P7QA 3W83A 1K9FA 1YE6A 2HE5A 4ML4A 4A21A 1STZA 4AC1X 3FJNA 3L21A 1QPKA 4Y90A 4PMOA 2QUVA 2ZC8A 3IARA 1TYGA 3G24A 3MCNA 5C2GA 8TIMA 2Z2BA 3DDMA 5G2IA 3UWQA 2WCAA 4HNNA 1EL3A 3MCOA 1IYXA 1DIDA 4EP8C 4O53A 3T0BA 5ABFA 1GONA 3HIJA 4WQ6A 1VBJA 3WJXA 2DV0A 7ENLA 2WKGA 2Z2AA 1V93A 4CNTA 4DNHA 3CAKA 1ZL1A 3R6IA 1F9CA 3WLHA 1G6CA 4YMZA 4ACZB 1GRFA 1M7JA 3HN3A 3APTA 1H2IA 3UERA 2PLMA 4UC5A 4CU8A 1GJPA 1ZBVA 4B9ZA 3G22A 2H6RA 2OU4A 3MYOA 1XHCA 2HVMA 4IWWA 2NV9A 2NVKX 2W54A 1OBAA 3C0SA 1L6GA 3P80A 2J66A 4EPEC 3B03A 4XQ6A 4G1KA 2DSUA 3EMQA 1I2OA 5HPCA 3U48A 2FMNA 2OT0A 4IM4A 1YDVA 3BVJA 1F07A 3BK0A 2VNCA 2C19A 5AC5A 1UKQA 3W2LA 4O1AA 4CCDA 4HU3A 1UKOA 3SFKA 2GR2A 1MEWA 2HBXA 3W3OA 2YCLB 3WENA 3RHGA 3BG3A 4B3LA 1N5XA 4XAZA 3KXQA 3M5ZA 4IMCA 3RX3A 3GE7A 4G1NA 1ISVA 3N14A 3HGJA 2VD9A 4RV3A 1FWSA 1OX6A 1TFVA 1A47A 1O4UA 4TX6A 1R0MA 3VKKA 2PDXA 4ZB0A 1RBLA 4UFJA 4J3TA 2VZSA 3D5HA 4X0NA 5HA7A 2WZIA 4HT3A 1E5NA 2C8NA 4H8UA 5LXXA 4MLJA 1XDJA 3A23A 1LVLA 2VZTA 4FSAA 3TYBA 3B06A 3I65A 1OFAA 3T0DA 3L5LA 3ZXWA 1O7AA 1VBUA 4GWEA 4GVIA 4WGXA 4AXNA 5A6SA 1JGMA 3ARUA 3OLGA 4RV8A 5DF0A 5F2MA 4WOQA 1DJHA 1N61C 2QZRA 3T0CA 1E1FA 1A5SA 4F79A 1XHGA 4MFEA 4AZ6A 1XLGA 1RPXA 1F74A 4L9XA 4NVTA 4QIUA 2ISFA 1IXNA 4CQCA 2V5KA 2Y5SA 1JQXA 1ZCCA 3KLJA 5EU9A 1UKTA 3NQDA 1TPUA 3AYTA 1P6BA 5I79A 1OCQA 2A3CA 3HMJG 1V0NA 4QAWA 4IFKA 2CLPA 3GSMA 1AK5A 1OG0A 1GQJA 4IUGA 1PZ1A 1YEYA 5D8ZA 1YNQA 1ZUAX 1YDNA 1JZ3A 4HNCA 4PCFA 2FLIA 6REQB 3E49A 1TPEA 4HYWA 4WOZA 2J75A 3EOEA 5G4HC 2E5BA 4PC8A 3MBDA 6ENLA 5HXMA 1KFEA 3HU7A 3SY1A 1V6YA 5FMHA 3W22A 4XVDA 2W62A 4EQSA 3ABRA 4K1WA 1DE5A 4IHCA 2E9LA 4H1ZA 4PEEA 1M41A 4O4WA 3UZJA 2BY3A 2CEQA 1E9ZB 2RDWA 1TCDA 3AJ7A 3HTWA 2E3TA 4YTTA 5HJXA 4AF0A 1N8WA 1GOXA 3GBDA 5KSWA 3AQUA 2Z27A 3O9NA 4A8RA 5FF7A 5JCIA 4OV4A 3G2GA 3NPXA 4XVEA 4W93A 1JDCA 3ELFA 1B54A 3VIFA 1US3A 1H7WA 4B2DA 4LVGA 1LQ0A 4IGSA 3R5EA 5D02A 3TAOA 2DT0A 3AXMA 3DJJA 5B80A 1B3YA 1RK6A 3WF4A 1C29A 4S3EA 1GYNA 2WPEA 2WPBA 3EXSA 2WSPA 4TR9A 2EJ1A 3R25A 1YX1A 3K2GA 4Q6XA 2DFAA 3TN6A 4G56A 4L6HA 1EA9C 3WQWA 4D6IA 2Y4SA 3IGHX 4AD0A 3Q37A 3V7PA 1O5XA 3SURA 1GHRA 1GW9A 3IIXA 2XFYA 1DWJM 3M5YA 1GOOA 1EGVA 4BKNA 5AFDA 4H50A 2QUUA 1EB3A 4REQA 2NQ5A 2V68A 3VNDA 4I5RA 3WEZA 4AU0A 4NAEA 4AC7C 3M5XA 1K9TA 1XCXA 4IPJA 2VX6A 2Q3RA 4A35A 4PRRA 3A6OA 4JIIX 3A22A 4HVXA 4GE8A 4CUCA 2P8CA 1JCXA 1O66A 4N9BA 2DH3A 2XM2A 3PG8A 3QH2A 1Q7QA 3CTLA 2PDNA 1FHDA 5K9CA 3VGDA 2QUNA 1VPXA 4HCHA 1W1VA 3V1PA 4UTJA 3R8GA 4GI8A 2O7SA 3N2BA 6XIAA 2W55A 5BMWA 5A6LA 4WK9A 4W88A 1W8GA 3LZ5A 5D9MA 4K7ZA 2ZA2A 3AMKA 3RF9A 4IQEA 3IC9A 4EXBA 3UXKA 2BGQA 4XZWA 2VZOA 1Q6QA 4GYJA 3TYEA 5EMYA 1B9BA 2DSKA 3CK5A 3VOHA 4HU4A 4J4KA 3VO0A 1IGWA 3J7HA 1AQHA 3AI0A 4KEVA 3COTA 2RKXA 3SBFA 3LV6A 2BGNE 2ZZ0A 3QFBA 3CIXA 4I7WA 1RCOB 4ATDA 2A3EA 3VDCA 4NYUA 4E8GA 3R8HA 2ZTJA 3W1LA 5IFPA 4UNKA 4GYPA 3ZMRA 3VA8A 4HA1A 3PUEA 4IX0A 3BAJA 1ECEA 1JVNA 4CD6A 3GC5A 3C5QA 4KRTA 2Q71A 1E51A 4Y9MA 1QWKA 5CC6A 3H23A 3L2IA 3TYAA 1W1A1 2FHBA 5BOFA 1EJ7L 3OW1A 1M7OA 3A7AA 4MWAE 4H00A 3BMXA 2H90A 3GD4A 3OYXA 5GNZA 1LJYA 4CVUA 4AYSA 2G3IA 2WJFA 3MB9A 4H8NA 4K8EA 3NO1A 5EMMA 4NZFA 4KS0A 3M5VA 3QPEA 2YXOA 4CNSA 1U5JA 1CXKA 4BQ3A 4FX8A 3VNJA 2I9EA 1P0DA 3S6DA 1JI2A 1AQFA 2JQXA 4JTUA 1HJSA 3GY1A 2YL5A 1QNSA 1BWCA 3ZQ9A 3AXHA 1IXOA 3DXIA 2WBAA 1CB7B 1Q13A 3UPBA 2DEPA 1UC5A 5J5RA 2Q3OA 2JE8A 2V2DA 3R4IA 3FG2P 3LTPA 5IHSA 1HX0A 3DFSA 3WLSA 3E0WA 4GZEA 1EQCA 2I5QA 1UZ4A 4ZXLA 1PHQA 3MO4A 4WKAA 4UCGA 1RPKA 1EXPA 4MB5A 4X2PA 3PTMA 1PZ3A 1AD4A 2G3MA 1KFJA 3ZJKA 1R85A 1DQXA 4GZJA 3RFAA 3TU9A 2WVVB 3I7QA 3E9AA 3MMWA 1ZP4A 1GZ1A 4E2DA 3QFWA 3O0KA 1Q5MA 2CZEA 4LF2A 2ON3A 3RLHA 2QUMA 2FPYA 2VJXA 4EM4A 1DEDA 2PCEA 1P6WA 1VIZA 4RXFA 1ME8A 2GZXA 1GRGA 3GFZA 3ATYA 3WH7A 4CU6A 5HMEA 5IM51 2IQTA 4JCMA 4HKPA 4N4QA 4Y8EA 5TBOA 2QPXA 3EXRA 1XC6A 4UQDA 4TUFA 4H83A 1EJSC 1Z3NA 2FVMA 2ZRYA 4Y9AA 1WZAA 4C1LA 1QVBA 4DUWA 1VF8A 2RGLA 3EWBX 1OT2A 1KM6A 1KTCA 5JH2A 3BLFA 5CPNA 4LUYA 5DBUA 2OELA 1UZ1A 3HURA 1V79A 2VCCA 5FESA 1DBTA 3QYSA 4WCJA 4DZHA 3S2JA 4ML9A 1ODUA 1E4IA 4ZMGA 5CLTA 3N2OA 3KBNA 2GGGA 1FEAA 3ARYA 2WCSA 3MKCA 5E6ZA 4JQ2A 1KCLA 4YVXA 2ZA1A 2PRLA 4ZQMA 2ZZCA 3CAWA 3BW2A 1VEPA 1XPYA 5D2TA 3RMEA 3WDPP 1GRBA 4KH2A 1MWOA 1GPFA 4DPQA 3C52A 4HTYA 3KWSA 3ZWTA 3LPFA 3WELA 2YB4A 2Q02A 3H7VA 1WUFA 2X30A 4PB3A 3MKKA 2Y70A 3TC6A 4RNIA 2EQ7A 4RDWA 4YWSA 4GYKA 2IKIA 1UKPA 3ZS4A 4CN6A 4Q4MA 1U2YA 4IPLA 4O0ZA 4WDXA 1ICQA 1VPYA 1TWWA 1TPB1 4DF1A 4M6QA 3NSXA 4XB3A 3JUGA 2CKRA 1RHCA 4QDMA 1ZS2A 3E5BA 5I03A 4V33A 4PA8A 3B0UX 2NQHA 4BI6A 3OPSA 2G3FA 3VAVA 1GVQA 3FN9A 1N82A 4NZJA 4QGCA 3DG7A 4WZHA 4QJ3B 1PX8A 1HJUA 3PG9A 1WKDA 5DEZA 3S9YA 4C7FA 2PP1A 4U31A 1E4MM 1IIGA 1E9LA 1Y8BA 1O5QA 4AEOA 1C90A 2FHFA 2PDGA 3TA9A 3VKCA 1DXEA 2QKFA 3WQ4A 1V97A 2CFFA 4NX5A 1MW1A 4A05A 4H7VA 2ZX9A 1V0LA 3B0YA 1WKFA 4ROQA 2J7EA 3WJSA 4NNAA 4AD1A 5HUOA 4ORIA 4ADTA 1J96A 3DN5A 2E6AA 1TIMA 3GVWA 5JCMA 5XIAA 4V1YA 3PBUA 2YCKX 1TR9A 1IWPA 3N1AA 4DO5A 4GD0A 3AIWA 4I6VA 4W8LA 2GJXB 4G7EB 1HQTA 3K8MA 2WK2A 4GA8A 1LBLA 3QR0A 1GORA 3E6EA 3LUTA 4M1BA 3IGUA 3WLNA 2DUAA 2DP3A 5IBXA 4RNJA 4D72A 2C6QA 2E0PA 2FB2A 3QQ0A 4N6FA 1W3NA 3VNZA 3OGVA 2CW6A 1S46A 2P5NA 4C6CA 4MFDA 4IIBA 4KEZA 1XBYA 3NQAA 1XIHA 2V8ZA 1KCXA 1A3XA 3AIEA 4KCVA 1N60C 1ZJBA 3SM0A 5G5GB 2GR0A 1E9YB 4ZTXA 5JQ9A 1F3XA 3H21A 4O1EA 2XISA 2DDXA 3N6QA 5M17A 3W25A 1B4EA 2FDSA 2DZUA 3LI1A 2WC4A 2NX3A 2DW7A 4G6CA 1JZ4A 2QMKA 1RJQA 4S3AA 2VZVA 2FFCA 5AYZA 4CKQA 3GB6A 2VVNA 4BWLC 2WHMA 2OJPA 4IT1A 1QT1A 4O10A 1PJ9A 4W87A 5C2XA 4X0VA 4EQRA 1GOQA 3M0JA 2HRWA 4UTWA 4W89A 2X99A 4ZA0A 4KRUA 1HFBA 2V3BA 1NDVA 2PDUA 1AQ0A 3WLIA 3NUKA 1OB0A 4V28A 4BEQA 4F40A 3VM5A 4XD6A 4XZNX 1HUVA 1NU5A 2OLHA 3VFCA 3F7JA 3WNMA 2D2GA 3ZJ8A 3S9ZA 3CEPA 1E5JA 1EXBA 4RR4A 4MOZA 4UMBA 1ZAHA 3P2VA 2B81A 1W5NA 3F5LA 3GR8A 3UZ5A 3E2SA 3DIPA 2P0OA 8CGTA 3CIVA 3AHTA 3OQ8A 4DXKA 3EDJA 2HWGA 4P8UA 3TW6A 4LY8A 4O1CA 5AZ0A 1FHVA 3AUJA 3GAYA 1QNRA 4US5A 3EMCA 3B9EA 1XI3A 5CZKA 3T44A 1F8IA 3A4WA 3CT7A 2HS6A 1RCQA 4PB4A 2EPOA 3EDFA 1F3EA 3PC0A 2IUZA 4PBGA 3CPGA 1L6WA 4QEEA 3BH4A 3UU0A 4W85A 4IZGA 5AHMA 3M7WA 3I10A 1L8PA 1HJXA 2NUYA 4UTMA 3LCLA 4BA0A 4DB7A 4OVXA 2ZTKA 1S5WA 3V5FA 5H2ZA 3H2CA 4MWAC 4H6EA 2EF9A 1XLDA 3VNLA 4WKHA 2G3JA 4RDYA 1Q3NA 1K4GA 1GPWA 4F9JA 3TJIA 3VGFA 1GQKA 1XR2A 3VIOA 2Y0FA 3WUEA 3EX4A 3LMYA 2C71A 1J6PA 2ZX5A 1ZALA 1KLZA 3L4YA 2WMJA 3Q94A 3CGDA 2DZBA 1NFPA 4PCPA 3L2MA 1A5LC 4K7YA 1A3WA 3C2YA 2GVYA 3EX1A 4NEWA 4ZB2A 1P48A 3PZTA 4S1FA 2XYLA 4L6DA 1HIZA 1MXSA 2Q01A 1PKLA 1AMYA 1W1IE 4IFOA 1XUUA 4ZQNA 4HB7A 3QFAA 1GEQA 3H26A 1TTQA 1RD5A 3WNNA 5HMDA 4H4XA 1NDZA 3OBAA 3KLKA 3PN8A 1OCNA 3KL5A 1HKMA 4ES4A 4A3HA 2X7VA 1CYGA 3T05A 3KLLA 2OGJA 3I3BA 4LCSA 4UQAA 3FA3A 4HCDA 3VIHA 3F2BA 3W02A 1L9WA 4MGGA 5HULA 5FJUA 2FGBA 3IK4A 4KWWA 2ZXQA 2YIHA 2DW6A 2Y7DA 2Y8UA 3SY8A 4JTAA 3WUGA 2VQTA 2VT0A 4AZGA 5CSSA 3WF3A 3NPUA 4RJEA 2F9RA 4O52A 3ABSA 3TFXA 3DENA 3H2NA 1GERA 3GZAA 1JFHA 1UWRA 3SCTA 1VH7A 4HPGA 3ZT7A 4HNVA 5K7JA 1E6PA 1LF1A 1T5AA 3IRSA 3UA4A 3VZZA 3U7BA 4ZOEA 1U5HA 4LX4A 1ISXA 2XIMA 2R8WA 4V27A 1VPQA 3TIMA 2V38A 1Y65A 1VS1A 4HSHA 4HZ7A 2J88A 4ZFCA 4QISA 3LB0A 2PLKA 1BQCA 3UW6A 3CHDA 1D2KA 1VBHA 4YPJA 4AWSA 4R5EA 1R38A 3RNMA 3FFSA 4XIAA 2POTA 2PC8A 2VEKA 1XD0A 4E3TA 1W3KA 7TIMA 4N9CA 1TJ1A 3PJXA 2OB3A 3HV8A 1EWDA 4XUGA 5I07A 3NQGA 4E2OA 2A85A 2Q6ZA 1SJBA 1H7NA 4MDPA 3DCPA 3NQVA 3ALFA 2FZMA 3PBWA 4S3KA 4JTJA 1LL6A 4TVDA 4HIBA 4O28A 1KCKA 2YBVA 4F9DA 2DH2A 1CXLA 1HJQA 1F5ZA 2HDJA 1VZWA 4JCLA 2PWHA 4TVUA 2WP5A 3SAZA 5LIKX 3OZPA 2FJUB 2CHRA 4B5VA 1UH2A 2VP8A 3G6MA 1K77A 1HJWA 3I3DA 1JG9A 2PDFA 1RSCA 2FZ8A 1FWHC 3WDJA 2CLOA 1CGUA 1V02A 1KGWA 3WNLA 2Z1KA 4H4SA 1PKMA 2OPJA 2PWUA 5DLCA 3T40A 1V3LA 1XIGA 1N8FA 3O6CA 1K7EA 4O15A 3OG2A 3H24A 1V8EA 3DECA 1UZHA 5JBEA 3I7RA 2JK2A 2WNNA 1AZ2A 4JQAA 3AU2A 2OT1A 4EX4A 1OK6A 4G2DA 3B8SA 2H9AB 2CLIA 2QGHA 2WOWA 3EKZA 2INEA 5CC3A 3RX2A 1UUOA 3W26A 1R3QA 3INPA 3PFRA 3G3MA 2Z24A 2HROA 4XKMA 3POCA 3C8FA 3H4XA 3H2FA 4PUMA 1YYAA 2GWNA 1QW7A 1DXIA 3SCUA 4CCEA 1SFJA 2ISSA 1OX4A 1VRDA 2X8RA 3EF6A 4MVAA 4GQRA 3UWUA 3S5YA 5AC8A 4KFOA 1BVZA 1W3JA 1PV8A 5BWAA 1XJBA 2NW0A 1A4MA 1XG3A 1JR1A 3C2FA 2AL2A 3WNPA 2OVLA 4LUSA 4QLJA 3P67A 4JTHA 3DK4A 1TA3A 4GIYA 3W73A 3EWDA 5AYXA 7A3HA 4INFA 1EIBA 4GHRA 3VABA 4FP1A 2A7RA 2Z1XA 5HATA 2V5LA 3VVGA 4JTTA 1YBQA 1E0XA 4QE1A 1V6VA 3KVJA 3WFZA 5DMYA 4PR4A 4HQVA 2OTDA 1MW3A 3EOUA 2VC9A 5GNYA 4LIIA 3HPXA 4Q8TA 4GIEA 2QNEA 3AS1A 2PTYA 5A6TC 3GNNA 4Y9NA 3REQA 1OG6A 2YKKA 3S2NA 1O12A 3W70A 2QXWA 3USZA 4DZIA 5HOSA 3BW4A 1GNXA 4NAFA 5IFTA 4KGJA 4G5DA 2DZXA 4QTGA 5C0QA 3TTYA 4FNPA 1QNOA 2DIEA 4C65A 1SO6A 1OGGA 2DSVA 1TJPA 3EUB3 2YW4A 2A79A 1IEWA 5KVHA 3LBOA 5LNSA 1I60A 1THFD 1Z9AA 4LC8A 2YQUA 2WB5A 3L0KA 5DX7A 5CZTA 4XAFA 3Q6JA 3VKJA 1V3IA 4XBJA 1RBOB 3EB3A 4TXEA 3JS3A 1P4CA 4KFPA 4F0HA 2J8GA 2GSEA 4JNZA 4KT2A 4DX3A 3LPOA 2G8ZA 2GQWA 1A5AA 2E28A 2QGYA 1D8WA 3N3TA 4WF7A 4GQBA 4H41A 1UOZA 3HQ1A 4ICMA 3KOWA 1W9BM 1H09A 2WZEA 1W37A 2HE8A 2PAJA 3CB8A 2X0HA 5BZAA 4H9MA 5FI8A 3FJ6A 5CSYA 5HWNA 4UZSA 3SN0A 3T0TA 3UVIA 4J40A 1I2NA 2FHCA 1H6VA 3OVPA 2VENA 3N9SA 4UNIA 4JYDA 1W3IA 3GKFA 2W61A 3M43A 5IXEA 3OHIA 4G8TA 4JFSA 3QZEA 1I2RA 4POCA 2YVGA 5LXEA 1E0UA 2EG6A 2ZZ1A 4P61A 3WL1A 3IIPA 3CXBA 2CXGA 3GIYA 1AH0A 1B3XA 2O0TA 3EA3A 3E96A 5DY3A 5M5DA 5EMUA 1ME7A 4APNA 1XIIA 2C14A 2EXOA 3H4GA 2Q8LA 2ONEA 4C1KA 4MB4A 2B7NA 3VIPA 4JD4A 1TMHA 4GQQA 5KZEA 4U10A 3WLLA 3PSVA 4FAMA 3T6CA 2EG8A 1EX1A 3TZNA 5JU6A 4FEZA 4MNMA 4GFIA 5CGQA 4GVFA 5FKYA 1LP6A 3WMLA 3SQLA 5A8MA 2YB1A 3RITA 3WDHA 4S2CA 7REQB 4Q22A 3L12A 4UTIA 1UR3M 5FF0A 4CNUA 1ZK7A 1MUCA 2WZTA 3OBKA 1BWLA 3V0UA 4CCCA 3SGUA 3VNYA 1CBGA 1XD1A 3W2NA 4AMAA 3AXKA 2J77A 1HO4A 3CTTA 3AOFA 3NQ6A 3S3GA 4D6HA 4LT9A 1R7OA 4J3UA 3TC7A 1E43A 1NWTA 4DVOA 2G96A 3KBSA 1WE5A 1BTCA 3AZTA 1M04A 1FTXA 1G9HA 1JCYA 1EP1A 4PBFA 4NRSA 1HKVA 2WVSA 5FEXA 2BVYA 2P0IA 4MPKA 3FEMA 3TJ4A 1F6YA 2Y5EA 1V5XA 2NT1A 3KWXA 4C6PA 3AC0A 2OX4A 1HL8A 3SW6A 3VCNA 4JTIA 3CGCA 3CPUA 4ICNA 1QI2A 3PS7A 4NU7A 3N29A 1R87A 2VUNA 3GD6A 2A3BA 4GO9A 4TMCA 3W7RA 4EF9A 4AVOA 1TPVA 4PUUA 2FKPA 1FCUA 3RXZA 3P81A 5M1TA 5FJOA 4DBUA 4B5WA 1V6XA 1N63C 2WC3A 3B8TA 1GQLA 1Q85A 3GC2A 5EY5A 4Z2IA 3MHUA 2G95A 3S1UA 1E0TA 4MWAB 5JH1A 4XZMX 3H2AA 4C91A 1DWHM 1HNYA 2PC4A 4H6KA 4ZFMA 3T4WA 4M8UA 1DE6A 2AQWA 4K38A 4NIRA 4WDUA 2I17A 4R7JA 2ALDA 4PMVA 3EPMA 3K4WA 4NZ1A 5C9ZA 1VJIA 3ONBA 4MIMA 1BRLA 1QTWA 1AZ1A 3P62A 1VFHA 3BO9A 1PCWA 2PPGA 2YX0A 3T9PA 1YRRA 1XIJA 2POZA 2QF7A 4FMVA 4XKYB 3GIQA 3XIMA 3VGGA 3O8AA 5CPQA 2WJEA 1D3GA 3GR7A 5F2IA 4YN5A 3YPIA 2VFIA 4QAIA 3PZMA 4Z17A 3VIMA 1HL2A 3FV9A 3WLMA 5A6JA 4GYPC 1NEYA 4IX2A 4IXXA 3M0ZA 1RR2A 3CUXA 3P7YA 5AZ1A 4XTDA 3VXGA 1UP2A 1E70M 4LB3A 1POKA 5I00A 2R9ZA 1WZMA 5CC5A 3L9CA 1KXQA 4UUIA 3ITTA 1NQKA 2JK6A 1K6WA 4H9YA 4MTVA 1TPDA 3S2MA 2I7GA 3HO8A 2I1OA 1E1EA 1RBAA 4MZ1A 5CPSA 3O6DA 3TTSA 3OG3A 1XLAA 1SJDA 2VEIA 1RAKA 1X1OA 5BROA 4U3CA 4Y9PA 4XAYA 1PB0A 4MNLA 3EX2A 3AM9A 2ACSA 4K37A 4J35A 2YYUA 3LI0A 3EB2A 3ZIZA 3W4RA 2Y8KA 3FAWA 1KBKA 2WWDA 1TWIA 2CU0A 2GVEA 2DQXA 2PCQA 2G4FA 2RHGA 1AODA 4E0CA 5AHEA 2ZUUA 2QCDB 3AYRA 1CXFA 5HBFA 2YBTA 2AQOA 1R9XA 2J7HA 2PWVA 4OJYA 3F1QA 2PWGA 3CO4A 3B0XA 3HGSA 2GGEA 5E0FA 1VGAA 3PY2A 3AXXA 2D0FA 5EFFA 4AZCA 1FQ0A 1YHTA 4S3GA 2XIJA 4UCFA 2XIBA 3NQ7A 2FZDA 4G7FA 3DBNA 2XN1A 3JW7A 3PAOA 2W9MA 1F6PA 4KESA 2FMOA 5D2VA 1DOSA 1FH7A 1TZ9A 5TF0A 4M7SA 3LB8A 1ISZA 4ORMA 3PJTA 3TWAA 2RDTA 4JEQA 2REQA 5KINA 1GOIA 2OWCA 5HJYA 1ZGDA 4ATLA 1SMDA 3IJIA 1XSJA 1I6NA 1M68A 4F0SA 4EKJA 4BZYA 3N3MA 1XIFA 4P7RA 3B0PA 1PZ0A 5CKSA 1OJTA 3VGHA 5LSMA 1A5KC 3TH6A 1L8NA 3R12A 4PMUA 4M56A 2WHKA 2GRTA 1KXTA 2NSXA 3W6MA 3GDMA 5ABEA 1X8FA 5JCKA 4I3GA 5I78A 2Z25A 5I3DA 4O1FA 5JRBA 4IGHA 2R91A 1TE6A 1ZJAA 3RRAA 4Q7BA 3Q45A 5D2WA 1I8JA 1WKEA 2OYKA 2Y7EA 4IIEA 4LVAA 1W56A 5LNUA 4GNKB 1UA3A 5BOEA 3ABXA 1Z48A 1M7PA 4WX2A 2CWXA 5ABTA 1Y7VA 5A6BA 3H7RA 1FWAC 4O1DA 4LVFA 4NJJA 1VFMA 3RIKA 2E1DA 1Q1WA 4MYXA 3VCRA 4EVZA 4RZ4A 1XIMA 1QNQA 4L1GA 2YZRA 4AH7A 1YW1A 1EP2A 4WUIA 4AG0A 1FECA 7PTDA 2DU2A 3ITXA 3K1DA 4GPNA 4ZR8A 3NOYA 1SFTA 2GUYA 3IUHA 2V69A 2WMIA 3KBJA 3U2CA 4EWJA 1G4SA 1B0IA 3S5OA 2JIEA 2C3CA 3S2CA 4EQXA 5ABFB 3ITGA 1XRVA 4LGXA 4MJZA 1EX5A 2ZIDA 5C54A 1U33A 2PZNA 3BL3A 1OWQA 1DORA 1TVNA 4LU0A 1V02E 3HJZA 3L4VA 4YVVA 4LUTA 4ZL1A 3VMOA 3SADA 4WVXA 3W07A 2ZX6A 4JKKA 3LZ3A 3PZ9A 1MYRA 1FO4A 5DELA 4XO7A 1KBJA 1GVEA 4M5PA 1UR0A 4QM1A 4U2YA 2R24A 1RVGA 4OECA 2IS7A 2ZRXA 3MUXA 4NXKA 1HKKA 3DHFA 3EKLA 3EANA 3NURA 2F6UA 2IQ0A 2A2IA 2HQAA 3R89A 1KQYA 4M6UA 4GGBA 1BG9A 2CLMA 4K3ZA 3WK0A 4X9YA 2QJNA 3N2MA 3L66A 3PBGA 3FVDA 1ZTVA 2GH5A 4GKLA 3E2RA 4U5KA 4I90A 3M0VA 4FHAA 3AALA 1UZDA 4GJIA 1FXPA 5IBXC 2EAWA 2ZE3A 4M19A 4DUXA 4NJHA 3BJFA 4HU8A 1JOAA 3QW3A 4JGDA 1A49A 4YYFA 2J74A 4ZQRA 2CBUA 3F4DA 4PGLA 4RW3A 4NSBA 4DUOA 3EX6A 2CITA 3ZR4A 4K8HA 2X1IA 3BG5A 2ZADA 3A13A 3LMZA 5CG7A 3I3EA 4GFSA 4GO8A 1C8YA 2E9BA 4MM1A 2A21A 4B3ZA 3OJGA 3F4VA 1M6JA 4YIWA 4QP0A 4NKCA 4GC4A 3KS6A 1QI0A 2WBKA 2XN0A 4JHMA 1DJXA 2FZ9A 4WDWA 2G41A 2Q8ZA 4GH1A 3T2PA 3THCA 1UR4A 3C0JA 1UD4A 3BGAA 5AVHA 4A3UA 4F66A 1KWKA 3EWZA 3B3DA 3R11A 3UETA 2EQDA 1IR1A 3A47A 3FVMA 1D9EA 1OGSA 2ZUMA 3O3RA 4UTWC 1PTGA 1S5NA 3DYMA 3RPMA 3B04A 3FOKA 1UP3A 1MRQA 3GH4A 3L0NA 3DJGX 5I3FA 2VC5A 2E6YA 3BSGA 1TWZA 4ALDA 4ZBCA 1OABA 3EYPA 2VX4A 2GUBA 4IFKB 4JDYA 3LNMA 3WMCA 4EPDC 2I9UA 3ZR5A 4HMEA 4HJFA 4H4TA 1DYSA 1UASA 4M51A 1NTHA 1UBPC 4GUJA 1DIOA 4CD4A 4K6AA 2D24A 4PUWA 3GBEA 4HPNA 3UQNA 1KBIA 1P1MA 3AYVA 3CMJA 1KBBA 4PMDA 1S2VA 1IGSA 4ECLA 1S3TC 4RCXA 1WXYA 4MJMA 4UFMA 3LRLA 5AC4A 1AH4A 3W84A 1VEOA 3CB3A 2W0HA 5FL0A 3TN3A 3HV9A 4AF0B 4S3BA 3CV6A 4GNJA 3UNDA 1CW2A 3GHUA 3Q65A 4Q8PA 2PGRA 2FJKA 3TOYA 2BXZA 1HKIA 3RUBL 3SDOA 1X1NA 4DXXA 2QJIA 4NNBA 2PBGA 3H2MA 3Q2DA 1KR1A 3DC0A 4QJ4B 3AISA 2D0GA 4K8GA 4I9JA 3QPZA 4LTSA 2VGBA 4QNWA 4XBSA 1C8QA 1HZYA 5H1WA 4BS0A 4F2UA 3FHQA 1VHNA 2NX9A 3CUIA 1RQEA 4B92A 1BGGA 2BFGA 2V2CA 3GTNA 3FAXA 1IT0A 1V08A 2F8QA 2PRHA 4L61A 2E5DA 4DJFD 1C92A 4MUPA 4J2MA 4K2SA 3WLQA 2C3ZA 4DXVA 4YJ5A 4GINA 1L6YA 3JZEA 5I23A 5EBAA 1G7UA 4FIQA 2GQ8A 1KCZA 1XIEA 2QPSA 5LNWA 4PUNA 1CGVA 3KOZA 3LQGA 5CC7A 4FS9A 2DT3A 3PTKA 3E12A 1QBAA 1VFFA 5HNTA 3CU2A 1K3UA 4REQB 1PE1A 3PWIA 3T42A 3NTYA 4BK9A 2QCEA 3RLGA 4NAEB 1POJA 1W17A 5JBDA 2OSXA 4JNYA 3NVYB 4D1IA 4KIEA 3ZZ1A 4GX8A 1JI1A 4HA0A 4QROA 5JBFA 3S6TA 3QZAA 1XGZA 3WH6A 1Q65A 3T81A 4ERIA 1BF2A 3W1PA 1DJQA 4YVPA 1KWGA 4JTRA 5MKGA 3CGTA 1LDCA 5DFAA 2XFFA 1UUQA 2GQ3A 2GQ9A 1ZY9A 1D3CA 2BXVA 1OIFA 3URBA 1VFLA 2B4GA 1UWSA 1J18A 1UIOA 1HP4A 3QKEA 5CPOA 1EIXA 4WY0F 3VD7A 4XG1A 1Q7MA 2WMFA 1J79A 3WQCA 2D23A 2WSKA 4H6QA 3HOJA 2J79A 2UV8G 1HGWA 4LUIA 3NVDA 2VQUA 1XXXA 1GJWA 3HG5A 2ANUA 5I3GA 1WV2A 3BANA 4BI5A 1OYBA 1P7TA 3DH9A 3NVTA 3FLUA 2JKAA 3M4HA 1U83A 2J3NA 4O4VA 2XZ7A 1MDRA 1MSSA 5J8LA 4EMIA 1VQZA 4R9OA 2JBMA 3M1ZA 5G4EA 1R3YA 4JS3A 3MV01 1ZCOA 1YXDA 1GUVA 3N17A 3GVQA 2EEXA 3A5VA 2VHLA 2QCNA 3SGGA 2WLZA 1XISA 3D46A 3OTRA 3I6EA 3SCWA 4C1NA 4WSKA 2HISA 4JX4A 1EDTA 1ZNNA 2YA0A 4AYGA 4L1WA 3WLKX 1RD6A 2OODA 1B5TA 1MW0A 3M0XA 4B5SA 1O6IA 4C6BA 1CT5A 4R34A 1ZJIA 1EKOA 2FH6A 5GPRA 1O60A 3HG4A 1TUFA 3UCDA 3IAPA 1T8QA 3AS2A 4Z2KA 3DFOA 2D2OA 5REQA 1Z44A 1VJZA 2HS8A 1P0KA 3FKRA 2IPFA 2TRSA 3S9IA 2QR6A 3C6CA 1SR0A 2VL4A 3DFQA 1J0ZA 2QQ6A 1E6XM 2TPSA 5F4SA 4KWVA 2VFGA 6PTDA 1EC8A 1O94A 1BLIA 1TUXA 5D30A 3TW9A 2ZWZA 5D33A 1KGUA 1R7AA 3AHZA 3ORWA 3QMTA 4Z1CA 4JTDA 4ZOBA 3VPLA 4H9XA 4WHBA 1QXLA 1H5VA 1T6MA 2C79A 2OYMA 1Q7ZA 2CLFA 3NQMA 4ADSA 2WPCA 1TV2A 2WO5A 2BOGX 4KFNA 4KCTA 1ITUA 3GG1A 3NZGA 4GUGA 2VCBA 1DJNA 1PXGA 1UWAA 4JYEA 4CCZA 2YPIA 1VB9A 1XBVA 2KAUC 3LGGA 1EGZA 2BP1A 1ZB5A 1ZAIA 1IXQA 1NFBA 2HBVA 3SSZA 1FEBA 2MNRA 3WF2A 1A5CA 2HMCA 3WJWA 2OSWA 3MC5A 3LEPA 9CGTA 3B9NA 1VLIA 5FAGA 1ZXIC 3N12A 3MHFA 3KE0A 4L7ZA 1GT8A 3MSGA 1VFSA 4KRZA 3GFXA 3GTHA 3MW7A 2AQVA 2R14A 4J2PA 2PWDA 3C56A 4NRRA 4JN8A 1PYFA 1GHSA 4LRSA 2QV5A 1FA2A 3HJEA 1VQTA 3RCNA 4DAFA 1FXQA 4C7DA 1XBZA 1V3HA 3LHTA 4TVYA 1Q2SA 3M6DA 4C7GA 2PF0A 3HZ3A 3VGBA 1JDDA 3EX3A 4PMRA 1E73M 1YLVA 1QI3A 5I2UA 1LLZA 1PIFA 1XUZA 2XTKA 4OKDA 1QO5A 4TOQA 1A50A 4E2BA 1CCWB 1K8YA 1RJPA 5FF2A 4A8NA 2F5ZA 3SIMA 2VWTA 3XINA 1W1YA 4P7OA 2J6VA 2PSNA 3GH5A 2PLCA 5DMNA 3WFLA 2OMAA 3CASA 4OTKA 1CGYA 1J5SA 4IMAA 2DJLA 2INFA 5IOBA 4EAYA 1NOWA 2B7PA 1IV8A 4HHHA 4DJED 2I57A 1X7FA 3HPAA 1R9ZA 2J7CA 1YDOA 5H6HA 5FCZA 3UWEA 3I7SA 3SJNA 1OQFA 1HTIA 1X38A 3SRHA 1H1YA 4V1XA 2QIIA 4ZQPA 3BLOA 3KUMA 4I5XA 1EQPA 4HSOA 5KTLA 5AB3A 4FA3A 3GTIA 1S2WA 3NM1A 5G1YA 1G0CA 3CH0A 4DI9A 4DWSA 3LPGA 1SQ7A 2QEZA 1JDAA 4CNNA 2GSJA 5LA2A 1JRCA 1QI4A 1S38A 2VFHA 4AWUA 3FNDA 4JDBA 4LV9A 4NEVA 3B40A 1PTAA 2X1UA 2AGTA 3EPOA 2BWGA 2NLIA 4H8HA 5M3WA 4X63A 1TQXA 4TO8A 1QHPA 2CLLA 1UP0A 1W9UA 4K8DA 5LIUX 2WSRA 2C13A 3M64A 3LHUA 3U5UA 3CUFA 3M47A 4R3UA 1PYMA 3W00A 1QUMA 2IXVA 3EWYA 1Z32X 2ZZ2A 1GGOA 2WMKA 2E3ZA 3UZXA 1A0EA 4FOJA 4XX6A 2CLEA 3PVFA 1MDLA 3G1RA 3POHA 1IWBA 3QGAC 3QSTA 6TAAA 4O1BA 1ZPTA 3WD1A 2GWGA 4IQJA 3QLDA 5FJPA 4Q8VA 2IW0A 1GYLA 1R47A 3TP4A 4KWUA 4F0MA 1E6NA 1J0JA 4JDRA 3G0XA 1Q4WA 2ZZBA 5E0CA 1R86A 2YLAA 3QMRA 3PZNA 3BV4A 2OSYA 1BYDA 1F76A 2DZVA 4ACYA 3FYPA 3LBMA 4XSLA 4A29A 5BOOA 3H4KA 3VC6A 2OEKA 1H51A 5K4XA 2QCHA 3L8KA 1US2A 3UR5A 2Z6IA 3MDWA 3TR2A 3GO2A 3AWNA 3W0KA 3S1VA 3VZXA 5ABHA 1QPNA 3V4BA 1TWDA 4QNEA 2WPGA 1KA9F 3N2TA 3W7IA 2OLSA 3ZOAA 3CLWA 3BWWA 4QBXA 3BQ5A 3W7NA 3MU7A 1UR1A 3FS2A 3CL7A 4JIRA 1Z89A 4FLOA 1KGXA 3WY1A 2DUZA 5M2FX 5XIMA 1IEXA 2HPIA 3MMDA 1CXHA 1FCQA 1XBXA 4GYFA 3CJPA 4DHGA 5CJMA 1LBFA 2GVGA 1I0BA 1B1YA 2VRJA 4QCEA 3G1HA 4YWOA 1DL3A 2WM0A 3KBVA 4H7ZA 1JZ8A 4XZIA 3E1F1 4QRNA 3TSBA 4J3XA 2NVAA 3NGJA 5DMLA 1JPKA 3A7RA 4DLFA 4UTFA 4I9TA 2UY5A 4ZODA 1BZLA 4WSJA 3WO8A 3W7JA 3PZIA 5I02A 1FDYA 3OB8A 3NAVA 4P7NA 3V0SA 4HN8A 2O9OA 3CO8A 5TNVA 1TZZA 3AO0A 1V51A 2OEMA 3AIBA 4Y8FA 3S1GA 3PTQA 4R7OA 1EC9A 1XYLA 3O7UA 3UG4A 1FP8A 3TWBA 1K1DA 3H70A 3F4CA 1KM2A 4TQTA 3CQJA 3G0UA 4A3RA 3P74A 4CEUC 4YTUA 4AW7A 4TVWA 1CGXA 3WFAA 4L64A 4XBKA 1KFWA 3BURA 1LROA 1UMLA 3BCJA 1H61A 4JFTA 3SECA 5CLWA 5F1UA 1UD3A 2QPUA 3HRDC 1K8ZA 3C0LA 1UQZA 3NYZA 2FTYA 1QU4A 1Q6LA 1Q6RA 3T2QA 4IIFA 3GVVA 5AN7A 4WY0A 4FNUA 4BF7A 2DSWA 2QDHA 3IJ6A 3A4XA 3KTSA 3W7KA 4IPPA 5E9XA 4HPJA 4OIFA 1WPCA 4AIOA 2X1SA 3AYSA 1BXBA 3G8RA 3NCOA 3TAKA 4ADUA 2V0TA 2ACUA 1FFVC 5A95A 3PJWA 3MUIA 4AVNA 1M01A 1WQ5A 4Q7IA 3UFYA 1IZJA 4W9TA 3C2OA 5HJLA 3N04A 5CZ0A 2GUUA 5GNXA 5T9CE 3QEZA 1EUNA 1O95A 4DBDA 2CC0A 1ZU8A 5LGXA 2QLYA 1OINA 1NSJA 3ZJ7A 5LZLA 3O06A 4HMCA 2OCZA 1XG4A 3PHAA 4KERA 1JAEA 3W7EA 4XAPA 2TPRA 2WNZA 4FNSA 2GJRA 2F6XA 3AZRA 4XSMA 4KPRA 2WP6A 3W1QA 9XIMA 3ISIX 5C2CA 5G1TA 4HMDA 1XX1A 3VKAA 3PNZA 2J4GA 1JCLA 3CS2A 4MSSA 2O56A 3FX4A 4C5YA 3N25A 3USBA 4AD3A 4CD8A 2PDIA 4A2SA 1J5TA 3QLLA 4JKMA 3DGHA 4KIRA 2W3ZA 2GR3A 3VMPA 1QPRA 1UD2A 3TTEA 3PJUA 4R88A 4MPQA 1CENA 2TYSA 3QMSA 1B3VA 3GTXA 5DXYA 4IP7A 3II4A 2WANA 2X40A 2P50A 1Q6CA 4E8DA 4U28A 4UQEA 1S7MA 3T08A 2GOUA 4ROPA 4LFYA 1ODZA 1ML1A 3WDQA 4PN2A 1O1HA 1NPXA 3KFTA 2QCCA 2BS9A 3WL0A 3C4UA 1XKYA 1JJKA 1MEIA 4TVCA 2W3RA 1ISWA 3WLPA 4LALA 2BSLA 5E5CA 3TOPA 3E0LA 1E40A 2HCVA 2PMQA 4D6CA 1H7PA 4LC6A 1J10A 4KPLA 2JEPA 2X1TA 1S2CA 4DYJA 3I68A 4AMCA 2XM1A 1VCFA 3M6YA 3W75A 2HNHA 3DFYA 3QHNA 1BSIA 1JD9A 1KLYA 3NL2A 3OA5A 2YW3A 3TQ0A 4TX9A 4QG6A 4EXAA 1SVDA 3W7LA 2ACRA 4A22A 1FOBA 1IHIA 3GXMA 1M5WA 2YR1A 4K1GA 5KZ6A 5D32A 2VDIA 4CGTA 3P93A 2GQAA 1I9CB 4MDOA 1AVAA 2VUYA 1J0KA 1FFUC 5A8GA 1XH0A 1V0MA 1SYTA 3LD5A 1F4AA 1S1PA 5HNRA 4FX6M 2IPGA 5H8MA 1PIIA 1PS9A 4U5IA 3WJZA 3CZGA 2G37A 4GBUA 4CD5A 1MRAA 1B30A 1EYEA 2F84A 3CQHA 4Z2GA 5GQBA 4UBPC 2W6RA 4XZHA 3WNKA 2VFEA 1B4KA 1Q6GA 2PDYA 4TTUA 4H6RA 2EBNA 3MUZ1 3FKKA 4DF2A 2F2KA 1WDDA 1LQ2A 5A94A 5H91A 2WNWA 3BXWA 4S38A 1H41A 2J8TA 3K30A 3NQEA 3DK8A 4FI4A 4PL2A 2AMXA 4ZE4A 3ME3A 1A5BA 1IF2A 4LVDA 3U4FA 1ALDA 2J7DA 3NG3A 1LTDA 1RXOB 4CNPA 5D05A 3LXCA 1I1WA 3GC4A 3AIRA 2R1MA 3W9ZA 2R6OA 4O0QA 3GG0A 2AAAA 4GX9A 2VI0A 2QCGA 3RLUA 5C55A 5AVNA 2LLEA 3OC4A 1R3TA 2YXXA 5BMXA 4JX6A 1OD8A 5EL1A 3IEBA 4IF2A 4AFYA 3OIHA 3A9BA 1PBGA 1XSKA 4GY0A 1OX4B 4ADWA 5FJIA 1YPIA 1KKRA 1TWSA 5FEWA 1FWCC 5FIPA 3O0HA 1SSGA 2OZ8A 3W1MA 2PDQA 5C71A 1VYRA 2AL2B 1WYGA 5K9XA 3TUUA 4LUSB 2RDXA 3EA2A 3PBVA 2QV4A 2OR2A 1TA3B 4AEFA 1J9YA 3URQA 2IQDA 3PULA 2ZC1A 2X2GA 1BQGA 2E1WA 2FYMA 1YBQB 2ZX7A 3GR4A 2OXNA 1BPLB 2XH0A 4RZBA 1I45A 3BCDA 3MSYA 4E4UA 1OFOA 4NNCA 3D47A 4FOUA 1TTIA 3REQB 1QOQA 1J93A 3H2OA 2PB1A 1JAKA 1XF0A 4AWEA 2DZPA 2WYSA 1EHNA 4D8AA 3GHTA 4NAFB 2JF7A 4ZQOA 3KOFA 1SFSA 1S5VA 3GU1A 5C9XA 3HQOA 3E0IA 1WYIA 3AROA 2WCGA 2NT0A 2XWDA 2BTMA 1H1ZA 1T7LA 2NXGA 4L56A 1Q4NX 1B90A 1OVDA 4FLRA 2DZAA 4GBDA 3GVGA 4HOZA 1JYXA 1TKKA 3N34A 3G5EA 3P60A 2QF8A 4P5UA 1A3HA 1ONRA 4DWDA 4HK5A 3NZRA 3W53A 4GK8A 6A3HA 4GNVA 1CX9A 1GYMA 4OUIA 4WSHA 3TV8A 1UD6A 2XFRA 4LJ3A 3VE9A 4DO7A 2VEPA 9RUBA 3GDLA 1WO2A 2WM1A 3WMSA 4AISA 1DHKA 1E1CA 4S2BA 1VFOA 5LA0A 4LRTA 2ZVIA 4ATWA 1GKQA 4ZE5A 1V03A 2QJMA 4XWUA 1NY1A 2BHUA 1KW1A 4RX0A 2CKSA 2DIJA 3ITVA 4MB3A 4WLCA 5JXQA 4J28A 3CUGA 1K7FA 4Q4RA 3GIPA 4C6FA 3UG5A 4B5NA 1BF6A 2G97A 3CQIA 1QJWA 3BLKA 1WAUA 5C9WA 4ILSA 5I77A 1B3ZA 3G1FA 1SW0A 4QLLA 3OGRA 2W0UA 1K8XA 3B8UA 1KM4A 4QE4A 3RK8A 2YYTA 3HPZA 1I75A 3NSMA 1GESA 3G8EA 2EPHA 3KAOA 2PTWA 5FJJA 4AZIA 2WVUA 4Y7EA 3W37A 3MV11 4WR3A 3CIWA 3KOYA 2E6FA 3A4AA 4LV4A 4UIOA 5E9AA 2C15A 3HFTA 3UZYA 1DVJA 2HVNA 2WNQA 2ZXBA 3SRKA 4E2VA 2DVXA 2ZUNA 1CZ1A 1TRIA 4LQ1A 2F2HA 3AMZA 3FHAA 3V36A 5LIYX 1EWEA 4IOTA 5FAJA 5D2XA 3CGBA 2GVJA 3C61A 2QDGA 2G50A 3W76A 5A8QA 2WC7A 2J7BA 4EACA 1CNVA 2OWWA 2ZX8A 3G1YA 3WLRA 2DVTA 1XQKA 2RABA 4ZSUA 4L65A 3DG3A 3QC3A 2HJPA 4DELA 4Q8OA 2B7QA 3M0KA 5U1OA 2V3GA 4B16A 1LRQA 3NZ1A 1XLIA 4H4UA 3DHUA 3ARQA 3GRIA 3P0XA 3CMFA 3LU2A 1QNPA 3CLMA 3STEA 3MUY1 1HW6A 3QBUA 2CZ5A 1AJ0A 1NP0A 3WEMA 2VM8A 3KBWA 2XFWA 2PDHA 2X7WA 1BWVA 1HKJA 4OE7A 1BYBA 4M7TA 3GXDA 1FWWA 1R2SA 4LWWA 2WLYA 3R79A 3D6NA 4EPBC 2WQPA 4KETA 4QJ1A 1FHUA 1OT1A 4FX7A 1SJCA 7ODCA 1CLVA 4C6OA 4IIDA 3BG9A 3B8WA 1HXJA 3W24A 3UJFA 1JEHA 4AZBA 1GWJA 3G0SA 4IG2A 4GI9A 3QHMA 3GWQA 5D8WA 4H2HA 3MI6A 4H4QA 2J9ZA 4QLKA 4AQLA 2GL5A 4F8XA 3AIQA 3VGEA 3WH8A 3V35A 3W1UA 1H7OA 3LTYA 4FXFA 1LRNA 5EMJA 4AXKA 4JZ5A 3TONA 4RPQA 1DQUA 3WD0A 1YPFA 3SR7A 4I8DA 4S23A 1BAGA 4NQ1A 4GR1A 1XKJA 1KTBA 5H8UA 4F0LA 4YCPA 2Y5JA 5CBBA 2OFJA 4GIRA 3DGRA 1HN1A 4R33A 1EH9A 3ENLA 4ZO8A 1FWJC 1LT7A 1R5YA 4Q8WA 4NY2A 1UW9A 4OOZA 4GGHA 2GGHA 3G3DA 3LERA 1TV3A 3S46A 1FP9A 4FLSA 4ZXOA 5FF4A 3VDHA 5K4ZA 3ZLHA 1BRLB 3GDRA 5C9RA 5LHFA 2GGJA 3SR6B 4FXJA 3VINA 3LM3A 2V63A 3R0KA 3QV9A 1LG1A 2ASHA 2C7FA 4C6JA 2CZFA 1PUDA 3VIIA 3W1AA 3SQMA 4YTRA 2O7QA 3URAA 1WZKA 1UKSA 3NYDA 4GQGA 5CG0A 1Z8AA 3W1NA 3AMDA 4DI8A 2E25A 3R07C 2Z7GA 5M03A 5CZSA 4E5TA 1UUMA 3SSJA 2ZE0A 2O9PA 5AHLA 3TYCA 4EPKA 1OK4A 3S8HA 1UWIA 2OG9A 2V3DA 2BY2A 3DUGA 4NASA 4ZQCA 4BEUA 4H2CA 1EPXA 1TREA 4JY9A 4WJEA 1EZWA 4IIGA 4D9PA 2QMJA 1N5WC 4O50A 1A80A 2BHYA 2WKLA 3WBXA 4MWAD 2Z2UA 6CGTA 5JVLA 4URIA 4LS0A 1P1XA 1OCJA 2ISDA 3N6HA 2OQHA 1XYCA 1OFBA 1W6TA 5BU6A 2FGZA 3NDOA 4UFLA 2Y62A 3BSHA 1T3QC 5TR3A 3VX0A 5A6MA 2CFYA 2G3NA 4H4WA 1E9IA 1LM1A 3H6OA 2J27A 2WJZA 3PF3A 1C8VA 1EJWC 3WN6A 1VYPX 4PULA 4PH6A 1H62A 1A5OC 2C0HA 3ZT5A 4AHQA 4B90A 2DPEA 4PUEA 4PUDA 3W6YA 3PAJA 3UWVA 1KTNA 2JEQA 2XGIA 4IMDA 1MNZA 1PPIA 3GVRA 1TPH1 2V6AA 4QS6A 1ZQ5A 3WQDA 3DFTA 3CZLA 5HINA 3FGCA 3APGA 1EBDA 5CH9A 3GDTA 1UYQA 2DSZA 4AZCB 1S2TA 1XINA 2O9RA 3PUOA 3DYPA 5J04A 5CSRA 5DRCA 3A24A 3QTPA 4JEJA 3BTNA 3M07A 3PPGA 2F61A 3NL5A 4IJBA 2REQB 5TQLA 3EKGA 3DFHA 3BOLA 3ITLA 2EQ9A 3KCLA 4H4IA 3N19B 1VKFA 3MHGA 3WMBA 8XIAA 3LADA 2X0YA 3CAQA 2JKPA 3GS6A 3AHXA 2QHAA 1XGDA 2C3DA 3DYOA 4XIMA 1DIKA 4XISA 1OC7A 2E09A 3GXTA 3GRSA 3AS0A 4LA1A 4M6PA 1FDZA 1W8SA 4Z08A 1W5MA 1SO5A 5CGMA 1GOKA 1FFRA 4OZOA 3VNKA 1UD8A 2FVLA 5KZMA 3THQA 1IT7A 2Z7KA 1BD0A 1GZJA 3EGJA 3FCPA 4RE0A 1JULA 3GG8A 1DNCA 3LLDA 1S5MA 1DTUA 3TYUA 4DZ5A 4GVHA 2GLKA 5G2HA 3AN1A 2ZZ5A 5J5DA 3VM7A 4QFUA 1SO3A 2VD8A 4Z1AA 3PK7A 1PCKA 5HPOA 4LCQA 4WXYA 3NXFA 2GJPA 4ENLA 1JYNA 1NARA 2OKOA 4MLRA 5D09A 3OZYA 4JIPA 5DT5A 3WDIA 3L2LA 4QQ3A 4ZOAA 2YA1A 2UZ9A 1XLFA 4UFHA 2QS8A 2X8GA 5EA9A 4Z0JA 5A69A 1CLKA 1TPWA 3WEOA 3NL6A 3UJ2A 1XLJA 2CIPA 4BFAA 4C6QA 3FDGA 2WMIB 2ZKMX 4I7VA 3RCMA 3LN3A 4A4AA 1KM3A 3QYQA 4D1JA 3JZUA 1VCGA 4DYEA 5A5WA 3W72A 1K70A 1KQZA 4DWSC 4UWMA 1OZQA 4J3ZA 3CHFA 4UR7A 2YCEA 3DI0A 1K8CA 5AHIA 4WJ8A 1KRBC 5FJTA 1RUSA 5FJRA 3LRMA 4GRTA 3ZVHA 3SIZA 3G77A 4N9DA 4BI7A 2IPWA 1NDWA 1J12A 2A3LA 3BLLA 3RDKA 2VVSA 3QQWA 4ERAA 2QAEA 1J2BA 1Q2RA 1LRTA 1A5MC 4LUTB 3UT0A 2D22A 5BNKA 1NDAA 1OD0A 3VU2A 3S2LA 3B9DA 1PSCA 1JF6A 1NELA 1IE7C 6TIMA 3BLIA 4MHBA 5FS7A 2ZCGA 4HK6A 1IIHA 4B4HA 4CNOA 3LOTA 1EEPA 3RGTA 2OO0A 1W2VA 3KZPA 3PWGA 4NXSA 4OV9A 2WBGA 3C2EA 2VDHA 3A7UA 1W1TA 3NPWA 2R1LA 3DEQA 1TTPA 4N6EA 4Q4OA 3MJMA 3FJLA 1EFZA 1FY6A 2YLLA 2IPJA 5CEWA 3L5OA 5DN1A 3R94A 3RCYA 3BOFA 2Q09A 3B0VC 4H9VA 2ZQ0A 1G4TA 1SB3B 3KX6A 3EOOA 1OF8A 3P61A 3TCSA 4O54A 3F4NA 3VIJA 2OLAA 1W32A 2VX5A 5F4XA 3N15A 4MY9A 4YCOA 1TVPA 1VAHA 5D38A 1X96A 5E09A 3UG3A 2V2HA 3CUZA 1XS2A 3TYZA 2PWEA 2BOEX 1YTKA 2ICSA 2ISWA 4U33A 1ZMCA 1QK0A 3KVLA 2OQLA 3G18A 4X61A 4CEXC 5U4NA 3M0HA 1BHGA 3UYIA 3LYEA 3MKVA 3EEGA 1ZBWA 1KO0A 4L4PA 1H63A 4XAGA 4UXDA 3NDZA 3EPNA 3RNDA 4Z2HA 3OEXA 3S1XA 5T9BG 5BU9A 4Q32A 2I56A 2QAPA 3P14A 4LCRA 1TB3A 5DT7A 2VGGA 3BGJA 3GXIA 3W2MA 3QOMA 4HHMA 1TV5A 1Y5XA 2R9RA 4GI6A 2QJGA 3GKAA 4C6IA 4N9EA 1A5NC 1CGTA 3VI2A 2X8HA 3BSMA 1Q66A 3RAOA 2FQIA 3LG3A 2ADAA 1RA0A 2GDQA 3DU0A 3BAKA 4W8BA 5FF3A 2A4AA 4WJXA 2ZRVA 3LBCA 3STCA 3KHJA 2AAQA 1FKWA 2NV2A 1C7TA 1X7IA 2YXGA 4GIAA 2E9MA 4Z1DA 1XDLA 3FJ4A 4L9YA 5FSDC 3IJQA 4Y2WA 5KETA 2YAUA 1Q6FA 1JD7A 2FTWA 2UWFA 4MAVA 3CL8A 3LCFA 4Q6JA 5HMSA 2Z6JA 5SWUA 2WAGA 3HQNA 4FF5A 3UR8A 4MZ8A 3OP2A 3FXGA 3UGRA 4AY1A 3EEZA 4AD5A 2G0WA 3R0DA 4TTGA 1E3XA 1DKWA 3HA1A 4OU1A 3T8QA 3ARSA 3FSTA 3S6OA 3RJXA 5HR7A 3FY1A 2DVUA 4ZZ9A 4Q8NA 3ID7A 2GK1A 5F7UA 3T7VA 4RZ5A 1FWBC 3CAVA 4IMGA 1YQ2A 1JXKA 4FR6A 3CWOX 2Y6ZA 1LLWA 1WDWA 3CQKA 3UCQA 4FF7A 1N7KA 1ZKQA 3KCOA 4CU7A 1AL8A 3VILA 1G1YA 1FH8A 4QITA 4IUOA 3WF1A 2ZZ3A 3N73A 3WUBA 2PGEA 2ACQA 5B7ZA 4M0XA 1K4QA 1D7KA 3SCNA 1L2UA 2PDLA 3EMZA 5C7VA 1XWYA 2WVTA 2EKGA 4DO6A 2NZLA 2TSYA 1L2QA 4GZIA 4JTSA 1M1BA 3FDKA 2WXDM 5FL1A 4B91A 1LWJA 2EKCA 7TAAA 2D2JA 3LHYA 5BWFA 3CWHA 3NVZB 2CNCA 3MJYA 3ABZA 1NH6A 4IIHA 4PCTA 4MKVA 3RPDA 3TSDA 3W81A 3UWWA 3UESA 3DHPA 3BGGA 4CVWA 2ZRWA 1W3HA 2QDEA 3TMLA 2D20A 4B5XA 3TNBA 3TN4A 5MKGB 4MF4A 4G9PA 3TVAA 2J24A 3A21A 1BGAA 4HYVA 1XYFA 5ECVA 3CMGA 3F2CA 2QT3A 4H04A 2QCFA 1SR9A 2IKJA 4W4QA 3ATZA 1MI3A 2XN2A 1HJVA 4AX6A 5FD0A 3O0FA 4FPSA 4B2DD 3W7DA 2R94A 2TAAA 3LCIA 1OYCA 3DKLA 4AHPA 4AZ7A 3N9RA 4CD7A 1TIWA 3L5MA 1P7TB 4BURA 3JU2A 1OJXA 1K7XA 2E67A 4D2JA 3LV5A 1ENUA 1ICPA 5K9DA 1XM3A 2CETA 3PSWA 5HQLA 4AD2A 1NWRA 1KV8A 4GQ0A 2NX1A 4W5UA 4Z2JA 5AHNA 3NWRA 3W2UA 2ATSA 1NFGA 3AMGA 2PZ0A 1EA0A 1MFVA 1A53A 3CV7A 4AVFA 1EC7A 3W38A 1QATA 1H50A 2XSAA 2NPXA 4H4PA 4OT7A 1QDSA 1J01A 3O07A 4C1NB 3AAMA 1DXLA 4UNLA 4IJRA 1NJJA 2D73A 3NR0A 2MANA 3VC5A 3ICJA 4PMNA 3MANA 1EO5A 1OX5A 4Q4KA 4MMWA 1YTDA 2NV1A 3ECQA 2WJDA 5D03A 5ENLA 4GJJA 5REQB 4YNGA 3HW2A 3ITOA 4IGNA 1B3WA 3PBYA 5CJ5A 2YA2A 3BJTA 4Y6GA 4JAWA 1KM5A 4GISA 4D6DA 3QY6A 1XANA 2VEGA 4RNHA 3WQEA 1XH2A 4LY4A 1JQVA 4LAUA 4XUYA 3LM7A 4PB5A 3ZFHA 3ANUA 1E3ZA 1F2JA 4WKFA 3WG6A 4CQ8A 2C16A 5FS6A 1CDGA 3DK9A 4RE4A 3NA8A 2PGWA 1W0MA 4DQWA 4N2YA 5AHFA 4ERGA 1TQJA 3BZGA 3NQCA 3OIXA 1XL9A 2W66A 4KEMA 4RW5A 2PD5A 1HVQA 5E6YA 5BW6A 4OBSA 3QV8A 3KL3A 2YVJA 3V3WA 2D0HA 4RLIA 2JGYA 4X2RA 3B8DA 4C6MA 3V1HA 2WV8A 3N18A 4PUKA 1SFLA 3BMVA 1PX4A 1GZGA 3KM8A 2RAGA 3MPGA 2EPLX 2EQ8A 3IRDA 3QOKA 2PP3A 3CZEA 2W67A 1HF6A 3K4AA 2J25A 4LUJA 3UZWA 2GR1A 3DZ1A 4B5TA 3GH7A 3T09A 3KOXA 5EFDA 5A2AA 3LX9A 4GOAA 4IP5A 1OYAA 3AU6A 2YSWA 2V3FA 3P8IA 3OZOA 1E6SM 1LYXA 1LWIA 2J9XA 3W7MA 2FDMA 3ZWSA 3CGEA 4PCNA 1Q8AA 1LWHA 2HXUA 4DY1A 4UTTA 4Q4SA 2WZMA 3OOQA 1GVFA 4FOKA 4DBWA 2W4XA 1ICSA 4JYFA 1VFTA 2VC6A 1CTNA 3HGOA 4L4OA 1BFNA 3KTXA 4Y9OA 5DBTA 4B4FA 3IIVA 4PE8A 3S5SA 3H55A 1E72M 2DQWA 2GDVA 4CLMA 3GRTA 1LORA 2WZHA 5DO8A 2TODA 1E56A 3P8JA 3W01A 1TPC1 1GETA 1NWUA 2BASA 4O8AA 1FCBA 1ADSA 4W5ZA 1WBJA 3DH7A 4ZCWA 3TKFA 5AKQA 3MYPA 1S2AA 4I7UA 5LNRA 5I3KA 3UVAA 3EDEA 1RH9A 3LY0A 4NL1A 3SUWA 1OY0A 4M81A 3GUGA 1S2UA 3UWZA 1H0IA 3HBLA 2FZNA 3CH9A 2BC0A 1K03A 1S1RA 4UQBA 2XPKA 3B8VA 4B15A 4C60A 4W7UA 2ZDRA 1HG3A 1UWUA 2IXUA 4H7CA 3DBPA 1XW8A 4FXRA 4JQ3A 3TJXA 1SMAA 1MMFA 1EJRC 5I09A 4QR6A 4HNTA 4DWSB 3PB0A 2HVOA 4LYRA 1UPPA 3VK5A 2VTFA 3AIUA 3V0TA 1X6NA 1NQ6A 3WQ6A 4XTIA 2ZYFA 1G5AA 3A12A 1REQB 3GDKA 4A8IA 1D8CA 1FVPA 3RO6A 2EPKX 1AJZA 3WCZA 1R3RA 1Q45A 1X6UA 2YFOA 1U1UA 2ZRZA 4L1XA 3TQKA 4UFKA 1A5UA 4AZHA 4JTKA 1G4EA 2BX7A 4BF5A 8XIMA 1XQLA 2A0NA 3IGXA 5RUBA 3UPWA 3JR2A 1E6RA 1MO0A 2AKZA 1EGMA 1H5YA 2QIWA 5G5HB 1FWFC 4Q4PA 2RGMA 4XD3A 1ZMDA 1XH1A 1XLEA 2Z1SA 1SW3A 4I9AA 4IQLA 4S3CA 3W29A 3GX9A 1ISYA 2VGFA 4DPPA 1LL7A 5A2BA 3LS9A 3KRUA 3L7RA 4JTCA 1A0DA 4QX4A 1B2YA 2J6XA 1GRTA 1QRQA 3QGKC 4MKNA 3W85A 5A2CA 1UD5A 1PDZA 1QK2A 3D0CA 1TMLA 4AD4A 4MY1A 4IGMA 3AIVA 4NZ4A 3NM3A 4DNAA 3WJYA 1N55A 2XVGA 3WQOA 1VR6A 2FIQA 4PTDA 1B9ZA 3PBMA 5U7SA 3UXAA 1HKWA 1GKPA 1UHVA 1XC4A 4HNOA 4M24A 4KBXA 2WKJA 1TO3A 1GVOA 3L68A 4AZ5A 4J57A 1J11A 1LUCA 1RCXB 5G2WA 3IANA 3PPHA 2CHNA 5A1AA 2AKMA 2PTDA 2OKTA 4FXSA 2B31A 2XVLA 2HEJA 1XYBA 1JNDA 1I2PA 4H01A 2Y88A 3MZNA 3A4JA 1QHZA 2W79A 4I9MA 2VRQA 2CLHA 5DXXA 4H19A 3D3AA 1ADDA 1P6CA 2P10A 4GG9A 4O19A 4CN4A 1NAL1 1JCTA 4MG4A 3CZ8A 1AW2A 3VD9A 2GOKA 2O9TA 2VR5A 4LBSA 1CWYA 3AHVA 1E15A 1W31A 1W5OA 1K9DA 1JRBA 2I14A 4HTBA 1V6UA 4HSNA 3CQ0A 4C6KA 3ABQA 1QNVA 4FZIA 2Z4GA 4PCSA 3BICA 3I4EA 1PL9A 4NYYA 4EQWA 3N4EA 3WIJA 4HU0A 1V59A 3G6LA 2YDRA 1EF3A 1OADA 1TX0A 4JN6A 1BXCA 2P76A 4PZVA 3BV7A 1XICA 4F2TA 5LKYA 1LOLA 2V6OA 5I5RA 3QY8A 1DJGA 1G67A 4R7WA 5HDRA 3T78A 2QCMA 5CCZA 4KEUA 4BV6A 3LCWA 3AZSA 3BAIA 2IKGA 2YDAA 3R58A 5KMYA 2Z00A 1XIDA 4ICCX 3DOPA 3MI2A 1R9YA 3EOSA 3O63A 3RX4A 3ZSSA 1XLMA 3QPYA 2DZWA 1ZP3A 3QV6A 1WX0A 3I4KA 1AUSL 1LOQA 1L0PA 3AS3A 2NWSA 1R3VA 1XDIA 4PTWA 3CYJA 3S5NA 3ITCA 1BYAA 4P8WA 4MZYA 2HXTA 2SFPA 1F7BA 3GG7A 4WDTA 3TZFA 2H8XA 1X98A 1VHCA 1Y0EA 4GY7A 4WY0B 4IMFA 1EJTC 4LS2A 3VTRA 2PDMA 1GVRA 1QPQA 1RY8A 3NL3A 2XZ9A 3SRDA 4L5ZA 2V81A 2ZFAA 4X22A 2XGBA 1BXNA 3VD3A 3CYVA 4EIVA 3UF9A 1SPQA 3UCCA 4CQDA 1U5VA 3A3WA 3ANYA 3P3BA 4JPGA 2C1HA 3THAA 3VDAA 2QJHA 3PZOA 4GUHA 1GVSA 2G5WA 3E0VA 3FYOA 1H3GA 1WA3A 1US0A 3DGZA 1DIEA 3F5KA 1DXFA 5CXPA 1JZ2A 1KXHA 2P88A 3TEVA 1MXGA 4F0RA 3U6WA 1FFQA 3PNUA 3GNRA 2I16A 4J1OA 3O2LA 4O17A 2P3ZA 4Z1BA 1LZOA 2E8ZA 4IICA 5JIPA 1N8IA 3B9JB 4W86A 3B05A 1TE1A 4WGHA 4C6NA 4LNCA 1YXCA 5DY2A 1JUEA 3RG6A 4H4ZA 4US5D 3UY8A 2GJNA 3RM4A 1YE4A 4EAMA 3W7CA 3ITYA 4DZAA 4GXMA 4AX7A 4AB4A 2A3AA 1UA7A 3GDBA 3T1GA 4UMCA 1FDJA 4O14A 2KZHA 3RM9A 4U2ZA 1P0NA 4OHQA 1PVNA 3NSNA 1PIGA 2C1IA 3CUJA 4YL2A 3FIGA 3V5OA 3BMWA 4GXWA 2CPUA 4F0KA 3MY9A 4JFUA 1OC5A 4O0KA 1UPMB 1CEOA 1TV7A 2ZRUA 4D8LA 3OQEA 3BUVA 1DPMA 2YDSA 1JZ6A 3UY7A 3S5ZA 1YPXA 3K8KA 3EA1A 2EO7A 5LHEA 3EAOA 5I3HA 2VYOA 3IAQA 3ZT6A 4UTHA 3MP5A 3W6LA 2CBVA 4PMZA 3GK0A 3V5CA 4LF1A 1XLCA 3W2JA 1B57A 3GXPA 2PRMA 3TTQA 4K39A 5CAKA 1WDPA 3SCRA 3BZJA 1GEHA 1S5TA 3SCVA 4OGZA 5KEZA 3SJ3A 1GXFA 2A7NA 3BQ6A 4IFRA 3ZM8A 1HP5A 1SZGA 2EG7A 2X50A 4E6MA 3RYSA 1T8XA 4V2XA 1V3KA 3SUSA 4C6DA 4DUVA 3BLPX 4ZENA 1XFBA 2PBOA 3R0UA 1ITQA 1UH4A 3MCMA 1DJZA 4AEEA 4JIEA 3EWCA 3O6AA 4NZ5A 3WD4A 1EPVA 1EUAA 3MP3A 2DT1A 2YL8A 1AFSA 4PTMA 3E0FA 1XFCA 1EJUC 1UJQA 3GNDA 1UR9A 2XU2A 3AJXA 2ZBTA 1JEZA 2BY0A 1ZBKA 4E4PA 3TQPA 2XVKA 3LXBA 4N42A 1K02A 1UC4A 4D8ZA 1VCVA 3M0YA 1ZLPA 1Z41A 2EPNA 3GM8A 3RILA 1GQIA 1RM6B 1PHWA 5DANA 4FALA 3W7HA 3OLIA 1K9EA 4H9UA 1UBSA 3GHSA 4HNUA 4M80A 4JTQA 2HTMA 3RM8A 1D3HA 1FWIC 3HQPA 3SUTA 4JIHA 1E6ZA 3S1WA 3LXAA 1O5KA 2FTPA 4ACZA 1Y5WA 1LPFA 1R2RA 4GZ7A 1GKRA 3THDA 4IPIA 3HG3A 2Q8XA 3L4UA 4K36A 3W27A 2PI6A 3SB0A 1P43A 1SGJA 4OBRA 3BOXA 1UH3A 1WKYA 1TCMA 4YXGA 4IISA 2DZSA 2DUXA 5FEZA 3B9AA 1Z6KA 5A6AA 1ZY8A 1VP5A 1GG0A 4JOMA 3LSCA 2VX7A 1X1ZA 4YHGA 4P8XA 5DCDA 4AAJA 3B8IA 1PWLA 3BE7A 3URNA 4YHEA 1YMYA 3VIGA 2AL1A 2ZXAA 3KRSA 3AUOA 3MVIA 3WBYA 1WAWA 3VOFA 5LGZA 4L6OA 3GLCA 1M3UA 2YCLA 2NQLA 1W9PA 2XGZA 4NJGA 3ZLFA 2NLYA 4GJ1A 1JPIA 1ZHAA 3FYYA 1VFUA 3OO2A 2BHZA 2ZUTA 2JF6A 4GVGA 1ZSXA 1XCFA 3H22A 5GRTA 2PF8A 2V5CA 3QV7A 3NEHA 2PTXA 1M03A 5E93A 1NIUA 3SRFA 1XRTA 1OFRA 2MUCA 2EHHA 1DV7A 3W88A 3SQPA 4HPHA 2W27A 3TW7A 3GNXA 2ZDSA 3CPRA 2X0SA 1IWAA 1G94A 2VWSA 4FDCB 3TLQA 1G69A 2O4QA 4HYRA 4RNFA 1SUXA 1AJ2A 3HPFA 1C7SA 1E55A 4R53A 1JL8A 3V16A 1DJYA 1OGBA 4X9SA 2YCJA 4HD5A 5D2YA 4GKTA 1KR0A 1R8LA 1BVWA 1KM0A 4N02A 1A4LA 4JBRA 1O68A 3R10A 4AIEA 3RR4A 5DMMA 5MF5A 2CBJA 3TR9A 4UB9A 1IXPA 3GZ3A 3CNYA 2H3BA 1O1ZA 4DJFA 3KL0A 1YADA 5H8PA 3TXVA 5HQMA 3U3HA 2ZWYA 3C3NA 1AW5A 3N4FA 3UG8A 4LYPA 3TK7A 3VDGA 1O5RA 1F3PA 1W5PA 4UZUA 5I3JA 1YNYA 3VX1A 1KBLA 3P84A 6REQA 3LA4A 3FA5A 3NEVA 5BCAA 3IACA 1GEUA 3MMTA 3VKDA 3NS1B 1SJAA 1ZZMA 4XZBA 2OX1A 4LAZA 1E1CB 2X42A 4CQAA 4B9YA 1D7YA 4XZLX 2F7FA 2C1GA 1WOAA 3LGEA 3C0QA 2NUWA 1GCYA 3R8RA 4XV0A 1E71M 3A9IA 1I4NA 3W7QA 1F4HA 3IK2A 1V4YA 1DWAM 4YS1A 1S3HA 3FW6A 4ASTA 1NOFA 3WDRA 2AGKA 5MHBA 4UTUA 4IJCA 1EYWA 3VD4A 3CUHA 3UYCA 4MKSA 1QR7A 1H4PA 3IVTA 1SU5A 3IUDA 4R85A 3N11A 3U4AA 3WQVA 2GVLA 1F8MA 3RMJA 1JF5A 4RXGA 1GSNA 4GUIA 1XPGA 2NUXA 3O1NA 3QM3A 2FFIA 5E1QA 5BXSA 1Q1RA 5HQEA 4PRTA 4RK8A 1E6QM 1BWKA 4NZ3A 3AHYA 1TTJA 4M82A 3SY5A 5IDZA 1I1XA 5JMUA 1TJ2A 2DORA 2L5HA 5I06A 3BW3A 4FO4A 2ALRA 3EXTA 1W54A 2EQ6A 4HCLA 3BCFA 3G1DA 4HZMA 3PZGA 2W3SA 3OBEA 2XHYA 3M0IA 5HMFA 3CWNA 3UR2A 1KFKA 2AAMA 2PTZA 3B9OA 3SCPA 1X2HA 1UQYA 2DGAA 5A8OA 2P1FA 3MUCA 3WK2A 4PTVA 3KRBA 1H49A 5EMLA 3RR1A 1J0IA 3BC9A 3FA4A 2OYLA 5CBJA 1YKWA 3VZYA 1M6IA 3UWYA 4PTXA 1WOBA 2NVDA 3CT2A 4P2VA 2VZUA 8RUCA 3G1SA 1Z42A 4X3ZA 3TLLA 3KP0A 2FB3A 1WXZA 3NRZB 2PE4A 3A5FA 1NWSA 2OEJA 2D69A 4ZB5A 4IPNB 1R3WA 1OF6A 3AMLA 3M9YA 1HL9A 1X2GA 4Q8MA 4QS5A 4NJIA 3LQLA 4GCXA 2YDQA 4C90A 1XLHA 1U30A 5FEPA 4UTKA 5HWMA 1VD6A 2YBUA 4YTQA 3GW3A 3GNOA 2A8XA 3WLOA 4MNKA 3W74A 5E0KA 5FS8A 1WBHA 2ZVRA 4DJDA 3QTGA 3STFA 1UB3A 4RE3A 2PD9A 4HOWA 4J56A 4ZO9A 3MDUA 4IG2B 3WNOA 1V6WA 2CXEA 2VO5A 3S4TA 3E02A 1DP0A 1DWFM 2DZTA 2JALA 4PMYA 3WD2A 2VFFA 3PANA 3IV8A 1F6KA 1AA1B 1TG7A 1VJSA 2O55A 4N0RA 4PUJA 2B7OA 3BDKA 3UA3A 4FNQA 4HA4A 1LQAA 3MVTA 2Z29A 2HQMA 1LL4A 5L9FA 3I6TA 1Q6OA 3QR1A 4NP7A 1GV4A 3GD3A 4EMWA 2P53A 1KRMA 1AH3A 1FWGC 3OLDA 3CHCA 3E2QA 4LS1A 1H1NA 3WH5A 3PR2A 4WXZA 1X8CA 3VYLA 4IL0A 1WCGA 2HPMA 2BCPA 4BJHA 4FIRA 1FBAA 3DFPA 3LNPA 1EOKA 5BXTA 1DHPA 3T4CA 2HK1A 4RZ6A 4NF7A 2FPVA 2KX9A 3UP8A 4L4LA 1GRHA 4ZSTA 2R1KA 1X39A 2RDUA 4Q8UA 4UOJA 4BF9A 4JTGA 4W84A 1MW2A 1MQQA 3DFNA 1QCWA 5FA5A 1BTMA 1PAMA 2E77A 5EYWA 3V18A 3MP4A 1J6OA 2BODX 2WMHA 4HP5A 1OFEA 2OOFA 3VMNA 3MMUA 1RA5A 1TR1A 3PUGA 1IZCA 2CBIA 4AHOA 2FZBA 4DRSA 4DAIA 2CWNA 3DX5A 1M9HA 3P82A 1P5BA 1REQA 3RU6A 1NHPA 3NGFA 1IEIA 3TROA 1E4LA 6XIMA 1ZFJA 4AIUA 5TIMA 1GTHA 4PMJA 3F03K 3NNTA 3QJAA 4FNTA 2E40A 1M7XA 4PTNA 4DYKA 2OOGA 1L6SA 3WZ0E 1TRDA 3Q58A 4P7LA 3UXIA 2WVVA 3VOCA 4DJEA 1DTNA 1W3LA 3IVSA 2RH9A