3O0HA

Crystal structure of glutathione reductase from bartonella henselae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
460
structure length
455
Chain Sequence
b'SFDFDLFVIGSGSGGVRAARLAGALGKRVAIAEEYRIGGTCVIRGCVPKKLYFYASQYAQEFSKSIGFGWKYADPIFNWEKLVAAKNKEISRLEGLYREGLQNSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNIKGSDLCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQVQSTENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFETTPDYDLITTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESRIVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSYVYENGEKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione reductase
publication title Crystal structure of glutathione reductase from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
total genus 145
structure length 455
sequence length 460
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3o0hA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA02
1Y56B 1H6VA 2F5ZA 3DMEA 4OCGA 4AP3A 5KRQA 3PVCA 1NDAA 3AWIA 4GF7A 1ZY8A 4H4RA 4A5LA 4A9WA 1REOA 2WQYA 3EPTA 3UKFA 1JRZA 2GVCA 2PHHA 4H4WA 4AT0A 3AYIA 3UTHA 3UTEA 2EQ8A 2C73A 1GRTA 2R46A 1JNZA 2C65A 2RGJA 2WU5A 2H89A 1YQ4A 5FS7A 4GR1A 3AE9A 2ZZCA 1GXFA 1TDOA 4CY6A 3GWDA 2XLSA 1E1MA 4GUVA 5ER0A 5LV9A 2RGHA 5U1OA 3AE6A 3AEDA 2GR0A 4BV6A 2JAEA 3H8IA 3P4PA 2WBAA 3LB8A 2X99A 4UDPA 1GNDA 2GR1A 2NVKX 1XANA 1P2EA 3OZ2A 1B5QA 1JRYA 2FJBA 4YT0A 4J36A 3NYEA 4C74A 2WDQA 1IUVA 1JNRA 3GDNA 4K8DA 4D03A 2V3AA 4PAAA 3DK4A 3ZDNA 4DSHA 3M12A 4CBQA 3BI4A 5FMHA 2C64A 3QFAA 3AE2A 3CNPA 3DJEA 2Q6UA 3GD4A 3C4AA 2VVLA 2R9ZA 1XHCA 2AAQA 4EMJA 1L0VA 3QSEA 4Z2UA 2GEWA 4U8PA 1ZX9A 4IVMB 2YR4A 4XXGA 3VRAA 4B65A 4BJZA 2GB0A 3GRTA 4B1BA 3V76A 1GTHA 1YY5A 1RSGA 2GAGB 4JN9A 2BCPA 1L9DA 4B68A 4FX9A 3ABVA 1ZMCA 1D4DA 4LA1A 2XVHA 4EIPA 1S2QA 4H4TA 2HQMA 1IUWA 2XLTA 5KVIA 1GALA 2A8XA 2OA1A 4X9MA 4CNKA 2XFUA 5U25A 3Q9TA 1GRAA 4ZCCA 2IVDA 4H7UA 2Y6RA 1AOGA 5J60A 4REKA 3RNMA 4A7AA 2WPCA 4FK1A 4C3XA 1Y0PA 1FOHA 3P4SA 4XWZA 3G5RA 1N4VA 1W4XA 4NZHA 5HYMA 1E39A 2CFYA 4PABA 3HZLA 2BC1A 1EL8A 3NTAA 3DA1A 4HA6A 3UOZA 5KOXA 1DXLA 2AR8A 1ZK7A 1ZDLA 5JCKA 3JSKA 5EOWA 4N9XA 1GEUA 1NPXA 3URHA 3AEAA 1MOKA 2W0HA 2X8GA 1CJ2A 3AYJA 4HB9A 4B69A 2WHDA 4YSYA 2WP6A 3NIXA 5KOWA 1N4UA 4YSXA 3ALMA 1GPEA 1OJAA 1KDGA 3SFDA 2EQ9A 1PXAA 2YAUA 1TDKA 2JK6A 1IUTA 3Q6JA 3CTYA 1F6MA 3I3LA 4O5QA 3UCLA 4YKGA 4EQXA 2A89A 5EB5A 1LJ1A 2R4JA 3BI5A 4H4PA 2YVGA 3GYIA 3T37A 1PHHA 3COXA 2X8HA 3QFBA 5JCLA 4J56A 1PBBA 1KNRA 2BS2A 5KWFA 3ATQA 3II4A 3ZYXA 1GV4A 1KF6A 2R4EA 3LADA 3QSSA 1EL5A 1BWCA 3VR8A 3P4QA 3CNTA 5HY5A 1E6EA 2XDOA 4USQA 2Y6QA 4A6NA 5IPYA 3CGEA 2FJDA 3UKAA 4EQWA 4ECHA 2YLWA 1Z6LA 3C4NA 4I58A 5CKUA 3S5WA 4H4QA 2YLTA 3UKPA 1CC6A 4RG3A 2YG7A 4Y4NA 4H50A 3F8PA 5U63A 3KA7A 1GOSA 3EANA 1K4QA 3FG2P 4KPRA 1QO8A 1H7WA 1OJTA 1LVLA 2C7GA 1VQWA 1E1LA 1TDEA 4C5OA 1NAAA 1TRBA 2EQ6A 2VOUA 2E4GA 3IC9A 4IA6A 3I6DA 4O5UA 1VG0A 1SEZA 1CBOA 4TM4A 5C3JA 3DJJA 5JCNA 2UZZA 3NKSA 2I0ZA 2Q0LA 4U8MA 3GRSA 1QLBA 1PN0A 2ACZA 3LOVA 3IHMA 3NLCA 4TM0A 4Z26A 2JB3A 4D04A 1CC2A 2XVEA 4A79A 2VVLG 3ALLA 2YG3A 3C96A 3FMWA 1S2YA 4P9SA 4YWOA 4A99A 4LIIA 2QA1A 1M64A 2B9WA 3L1RA 5JCMA 2VQBA 1K0LA 4UP3A 2EQ7A 3NT6A 1HYUA 5EBKA 1RYIA 2RGOA 3AE4A 3S61A 4JY3A 1LPFA 2YLXA 5BULA 2YLRA 4DGKA 4CRTA 1GETA 1D5TA 1H81A 2YVJA 1CL0A 3ISHA 4OPUA 2BYBA 3GDPA 3F8RA 1O5WA 3CPHG 3NTDA 4H4YA 2BS4A 4Y4LA 1Q1WA 1KFYA 2X50A 1FCDA 1B4VA 2VRLA 4KX6A 4NTEA 2BC0A 2VRMA 5KVHA 4C3YA 1F8WA 4H2RA 2TMDA 3K7MX 3M0OA 4A6NB 1EL7A 1CF3A 1PJ7A 2ARDA 1B37A 4X9NA 2C72A 2XCGA 4Z2TA 3ICTA 1FEAA 1F3PA 3UKQA 4OPGA 4AOSA 1CJCA 1ZKQA 2C75A 4OPCA 4YKFA 1EBDA 3SFEA 2FJEA 1ONFA 2WU2A 2VVMA 4Y4MA 5FS9A 4YSZA 5FS6A 2YLZA 1JOAA 2WOIA 3BNMA 3UP5A 4A65A 3AB1A 3AD8B 5BUKA 4USRA 1GT8A 2XVFA 2BK4A 3NH3X 3AEFA 4APNA 4GDPA 1N4WA 2C66A 4H2QA 2WDRA 4H4UA 3PO7A 1ZMDA 1E1NA 2JB1A 1BZLA 2C3CA 4JQ9A 3ADAB 5C2TA 4TM3A 4U2SA 1DOEA 3CNJA 3ICRA 3L8KA 4U8JA 1KNPA 4EMWA 5IQ4A 4Z43A 2BA9A 1IJHA 4WX1A 3GMCA 1QJDA 2XYOA 3NYFA 4FDCB 4BJYA 2O9ZA 3H8LA 3KD9A 2X3NA 3K30A 1GREA 3QVRA 4OPDA 4X4JA 1VDCA 2YG5A 1S3EA 5J7XA 2CVJA 2WDVA 1BKWA 2XFQA 4J31A 3DK8A 1RP0A 3NNEA 3AE3A 2DKHA 1V59A 3CGCA 1B8SA 3F8DA 3BHFA 4U8NA 2IVEA 1GRFA 2WETA 3O0HA 4MJWA 1NHPA 4AT2A 4CCQA 3AE5A 2C67A 2ZZBA 2BABA 3AEGA 2WESA 3NG7X 1GSNA 1D7LA 2GMHA 2C70A 4B64A 1KSUA 1K0IA 3UOYA 2BCGG 2V60A 1PBFA 2YG6A 3M13A 3RHAA 3V3NA 3VQRA 3NK0X 4EQRA 1X31B 1PXCA 1E7PA 2B76A 2BK3A 2BS3A 5FS8A 4J34A 2YVFA 1BF3A 2GQWA 3QJ4A 2BXSA 1ZOVA 1CJ4A 2WPEA 1GTEA 2GF3A 4JNAA 5M0ZA 3UTGA 4K22A 4YXDA 4EIQA 2XLRA 3IF9A 4CY8A 1PJ5A 1YKJA 1YQ3A 3GMBA 4FK1C 4TLXA 5IQ1A 2RABA 3NK2X 2GR2A 4Z2RA 5BRTA 1D7YA 3H4KA 4ADWA 4EM3A 4OVIA 4UDQA 1NENA 4GDEA 1ZOYA 2IIDA 3AEBA 3BNUA 3GYJA 4CNJA 4NEVA 2XFOA 4ICYA 2YLSA 1M6IA 4K7ZA 2Q7VA 2WP9A 4JY2A 4RG4A 4Z24A 4YTNA 3E1TA 1NHSA 1TDNA 2WOVA 1CC4A 1D4EA 3KKJA 1OJDA 3FPZA 2YQUA 1L9CA 1EL9A 1LV0A 3D1CA 3AD7B 4DSGA 2R0PA 2VQ7A 2WS3A 4I59A 5HHFA 4WCTA 4CCRA 2E1MA 3REDA 3P1WA 4B66A 3WE0A 3AEEA 1ELIA 2JBVA 2V3BA 3NRNA 4U8IA 4YTMA 3KVEA 4ZN0A 3UP4A 3NHOX 4TLZA 3ITJA 2OALA 3GSIA 1NG4A 2OAMA 5BVAA 2XVIA 1H83A 2PYXA 3PS9A 1TYTA 3DJDA 1JU2A 3SGLA 1JRXA 3DH9A 2DKIA 1PBEA 3SM8A 2B9XA 1O94A 3BI2A 3DGHA 4EM4A 2B7RA 5JCIA 4J57A 2APGA 2OLOA 2YWLA 2GV8A 2CDUA 2Q0KA 2B9YA 4IVOB 4OPLA 4UDRA 1H7XA 4BK1A 4ZCDA 2GAHB 2V6OA 1BGJA 3UTFA 2NPXA 5L46A 3NYCA 4AOXA 4DNAA 3CNSA 4NTDA 4NTCA 1KSSA 1GRHA 4GCMA 4U8OA 3UOVA 4OPTA 2GRTA 3VR9A 1TYPA 1TDFA 1Q9IA 3RP6A 4EQSA 3CPIG 1UKVG 2WPFA 1F8SA 2YR5A 1NEKA 4BK3A 2GR3A 4EMIA 2FJAA 3UKHA 1FECA 2E5VA 1N1PA 2Z5YA 4LU6A 2ZZ0A 1D4CA 1H84A 1DOCA 1DJNA 4TM1A 4B67A 2J3NA 1PS9A 4K2XA 4OPIA 4U2LA 3DK9A 2R0GA 3R9UA 2FBWA 3LZXA 1MO9A 4RSLA 4BK2A 1VRQB 2C76A 2XFPA 3KPFA 1PBCA 3QSMA 2R0CA 2XLPA 1LTXR 1MXTA 2V5ZA 2XLUA 4XWRA 3V3OA 2OLNA 4C77A 2H88A 2XFNA 2QCUA 3CIRA 3GD3A 3KLJA 3KU9A 2A87A 4J33A 3VRBA 3G5SA 4U8LA 1GRGA 3OC4A 1K0JA 3IWAA 4B63A 3IHGA 4H4VA 3GWFA 5EB4A 2AQJA 5TR3A 1FEBA 4H4ZA 1IUXA 1CJ3A 2R45A 1IUSA 2Z5XA 2XVJA 3RP8A 3CGBA 3DGZA 3AECA 4U2TA 1XPQA 3P4RA 1PDHA 1E1KA 2BACA 3AXBA 5HXIA 1GERA 4IV9A 1JEHA 1Q1RA 3UKLA 1FL2A 2GH5A 2JB2A 2QAEA 3NK1X 3CGDA 4JNQA 3NN6X 2V61A 2TPRA 3AE8A 2BK5A 1DJQA 3K7TA 2CULA 1Y56A 1COYA 2YR6A 2X8CA 2GMJA 2WEUA 2YM1A 1P2HA 1VG9A 2QA2A 1YQZA 3FBSA 3RP7A 4YSHA 5KXJA 3ICSA 3NN0X 4H2NA 4Z44A 1NHQA 1O95A 3CPJG 1NHRA 1L9EA 4K5SA 4IA5A 3AE7A 3LJPA 4J2WA 4BURA 5GRTA 3LZWA 4YTPA 1DOBA 3B6DA 1DNCA 2BXRA 3CNDA 1LQUA 1NG3A 1PBDA 4E0VA 4H4SA 3B3RA 2JKCA 3SQPA 3CN8A 3G5QA 4K5RA 2WOWA 3DJGX 3EAOA 4M52A 3D8XA 1PXBA 2B7SA 4U8KA 3QVPA 5CQFA 3AE1A 1DODA 1LQTA 4H2PA 1OJCA 1H82A 5GSNA 1IUUA 1S3BA 1ZP0A 3ALJA 3NGCX 1H86A 4JDRA 4GRTA 1F8RA 3P9UA 4Z25A 2YG4A 3EF6A 2C3DA 2VZ2A 1XDIA 1BGNA 3BHKA 5M10A 4AP1A 3ATRA 4H4XA 1OJ9A 1PJ6A 3VRDB 2WP5A 2YM2A 3UOXA 5DBJA 2ZBWA 3FIMB 3LXDA 3K7QX 1CHUA 3AYLA 4NEWA 3AD9B 1GESA 3UKKA 2GQFA 1GRBA
chains in the Genus database with same CATH superfamily
2GSHA 1XPYA 1NDAA 4A5LA 1REOA 2WQYA 2GVCA 3UTEA 2EQ8A 5EU9A 1GRTA 2GGIA 2R46A 1JNZA 2C65A 2RGJA 5FS7A 3DDMA 4CY6A 1IYXA 5LV9A 3AE6A 2JAEA 3P4PA 3ES7A 4UDPA 4ZA0A 1BKHA 2GR1A 2NVKX 4GGHA 3HRDC 4K2SA 1B5QA 4YT0A 3RRAA 1JDFA 2PP0A 4C74A 3DG6A 3GDNA 3ZDNA 3HYVA 5FMHA 3VC5A 3QFAA 3DFHA 3GD4A 1JRPA 2VVLA 1XHCA 4KEMA 2GDQA 3QSEA 2W3SA 3KUMA 1YY5A 4DXKA 4B68A 4YWSA 1D4DA 4EIPA 1S2QA 1KN0A 1GALA 2MUCA 3NXLA 4Z1YA 2XFUA 5U25A 1GRAA 5G5HB 3RR1A 2Y6RA 4REKA 4A7AA 2WPCA 3H8AA 4FK1A 4C3XA 3P4SA 4A6GA 3NTAA 1ZDLA 3PK7A 3AYJA 3URHA 3NIXA 3EKGA 5KOWA 1EC8A 3THUA 3SX6A 3I6TA 1GPEA 4ROPA 1PXAA 1IUTA 3QN3A 1F6MA 3BI5A 3P0WA 2PU0A 2OFJA 1PHHA 1WYGA 3QFBA 2BS2A 1GV4A 2XH0A 1BWCA 5KMRA 3P4QA 3IJLA 4USQA 5IPYA 3S5SA 3ETRB 1Z6LA 3C4NA 4I58A 2YG7A 3B9JB 4H50A 3KA7A 1GOSA 2OZTA 1H7WA 1OJTA 3SZWA 1WUFA 3GYXA 2VOUA 3I6DA 4O5UA 1SEZA 5C3JA 5JCNA 2I0ZA 2PCEA 2Q0LA 4U8MA 2ACZA 2JB3A 4Z17A 2P0IA 2YG3A 4LIIA 3L1RA 2EQ7A 3AE4A 4G6GA 3S61A 2P8CA 1L8PA 1GETA 3N6HA 1KCZA 3GDPA 3F8RA 3V3WA 1BQGA 2AL2A 3TJIA 3NTDA 2FKPA 3QPEA 3SJNA 2CHRA 4M6UA 2TMDA 3K7MX 2ARDA 1B37A 4Z2TA 1F3PA 4OPGA 4AOSA 1VQZA 2C75A 4YKFA 2FJEA 4Y4MA 1JOAA 2WOIA 3CMMA 3OZYA 3AD8B 4II2A 3CAWA 2BK4A 3AEFA 1N4WA 2WDRA 2JB1A 4TM3A 3V4BA 3OP2A 3BOXA 1IJHA 2POZA 3NYFA 3H8LA 1GREA 4A35A 1S3EA 2XSXA 2OKTA 3V5FA 4ZCWA 2DKHA 1V59A 3CGCA 1B8SA 2AL2B 4U8NA 2IVEA 3O0HA 3FJ4A 3NS1B 4HCDA 3NVZB 1GSNA 2XH2A 3PFRA 2YG6A 3VQRA 1X31B 5FS8A 2WPEA 3R07C 4DN1A 3DFYA 1PJ5A 1YKJA 4Z2RA 4TLXA 5BRTA 5IQ1A 3NK2X 1D7YA 3H4KA 2OQHA 2IIDA 3BNUA 7ENLA 1M6IA 2PGWA 3QKEA 2WP9A 3E1TA 1OJDA 3FPZA 1EL9A 1LV0A 2R0PA 3ZVHA 4CCRA 3P1WA 4B66A 3AEEA 2QGYA 3NRNA 4U8IA 4YTMA 3UP4A 2OAMA 1MRAA 2QDDA 3DJDA 1JU2A 2DKIA 1PBEA 3S47A 2B9XA 1O94A 5JCIA 4J57A 2APGA 2OLOA 4IVOB 4ZCDA 2V6OA 2GL5A 4FP1A 3A7UA 4NTCA 1GRHA 4OPTA 1TDFA 4EQSA 3A7AA 1NEKA 2BRYA 4KWSA 2FJAA 2E5VA 1N1PA 3BJSA 4B67A 1PS9A 4K2XA 3R9UA 2C76A 3KPFA 2R0CA 1LTXR 3GD6A 4C77A 2H88A 2QCUA 3KLJA 3VC6A 1GRGA 3OC4A 3T2KA 3IHGA 2AQJA 4GAVA 4J1OA 3FYYA 1E1KA 3AXBA 1JEHA 3GC2A 2JB2A 1H2IA 4JNQA 3CGDA 1Y56A 2YR6A 2WEUA 3K1GA 3RO6A 2QA2A 1NHQA 4K5SA 1DOBA 1DNCA 2BXRA 3CXBA 3CNDA 1NG3A 1PBDA 4E0VA 1JPDX 3CN8A 2GGJA 2WOWA 3D8XA 5CQFA 4FI4A 3T9PA 1LQTA 4H2PA 1H82A 1ZP0A 3ALJA 4GRTA 4Z25A 2YG4A 3EF6A 1XDIA 3BHKA 3DERA 3TTEA 2ZADA 2QDEA 4H4XA 2WP5A 3UOXA 3R11A 3VCCA 3UKKA 1RM6B 1GRBA 1Y56B 3PVCA 3AWIA 3IK4A 4HNLA 2PHHA 4H4WA 4II3A 3TWBA 3AYIA 3UTHA 2WU5A 4GR1A 1TKKA 1GXFA 2XLSA 3SSZA 3AEDA 2GR0A 2GGEA 1XANA 1SJAA 1JRYA 5KNLA 3NYEA 3UCCA 1IUVA 3DESA 3R0KA 4D03A 4K8GA 4KT2A 3CNPA 3JZUA 2GEWA 1ZX9A 4XXGA 3VRAA 4B65A 4B1BA 4JN9A 2GAGB 4NWZA 1L9DA 4FX9A 4H4TA 2HQMA 5KVIA 2QJJA 4X9MA 1AOGA 3RNMA 2GGHA 1NU5A 1W4XA 5HYMA 2CFYA 4PABA 2BC1A 1EL8A 3DA1A 4HA6A 1DXLA 2AR8A 1ZK7A 4N9XA 1NPXA 2WHDA 2AL1A 2WP6A 4YSXA 4A3RA 3SFDA 2YAUA 1TDKA 4YKGA 5EB5A 4H4PA 3T37A 3R10A 3HPFA 3II4A 3QSSA 3CNTA 3Q45A 1FIQB 2P3ZA 1E6EA 2XDOA 2QVHA 2FJDA 3UKAA 2YLWA 4H1ZA 2PGEA 1X2HA 3ENLA 1JPMA 1CC6A 5U63A 3FG2P 4E4UA 3QLDA 4KPRA 1VQWA 1STZA 3HYXA 1TRBA 2EQ6A 2E4GA 3IC9A 3HYWA 4E5TA 4IA6A 1VG0A 1QLBA 1SJCA 3R1ZA 2C4CA 3CB3A 1CC2A 2XVEA 2VVLG 4A79A 2QJMA 4E4FA 1S2YA 4YWOA 2B9WA 4GFIA 4UP3A 1K0LA 3NT6A 3AMZA 5EBKA 1LPFA 2YLXA 2YLRA 4DGKA 1D5TA 3ISHA 2YVJA 3N4FA 4GYPA 3MQTA 4G6HA 1KFYA 2P8BA 4ENLA 1B4VA 4NTEA 2BC0A 2VRMA 5KVHA 4C3YA 4H2RA 1ECQA 3U9IA 2C72A 2E5AA 3ICTA 3UKQA 1OEPA 1ZKQA 4TVWA 2OLAA 1EBDA 2VVMA 4IHCA 4E6MA 3BNMA 4A65A 3OW1A 4GDPA 2C66A 3ADAB 1BZLA 4JQ9A 5C2TA 2QQ6A 1W6TA 3CNJA 4EMWA 4DX3A 2XYOA 4BJYA 1TZZA 2YG5A 5J7XA 2CVJA 2XFQA 1BKWA 3DK8A 1RP0A 1EC9A 3BHFA 2WETA 2PTYA 2BABA 3AEGA 3NG7X 4MMWA 2GMHA 4B64A 3RHAA 1PBFA 3D47A 4EQRA 1PXCA 2BS3A 4J34A 2YVFA 3QJ4A 2GQWA 4JNAA 2XLRA 1YQ3A 2GR2A 4ADWA 4UDQA 4GDEA 3EEZA 4H2HA 2YLSA 2DW7A 4K7ZA 2Q7VA 1SJDA 4RG4A 1CC4A 3D1CA 4DSGA 2VQ7A 2WS3A 3REDA 1ELIA 4ZN0A 3GSIA 1NG4A 3IJIA 2XVIA 3PS9A 4MKSA 3SM8A 3SN0A 3BI2A 4EM4A 2YWLA 2CDUA 3ZLFA 4OPLA 5L46A 1KSSA 4H83A 4HPNA 2WPFA 1KD0A 3CYJA 3SR6B 1F8SA 4BK3A 4EMIA 1TE6A 2Z5YA 1H84A 4U2LA 1MO9A 3QSMA 3DG3A 1MXTA 2V5ZA 2XLUA 4XWRA 3V3OA 2OLNA 1S7MA 3SN4A 2XFNA 3CIRA 3GD3A 3VA8A 3G5SA 4B63A 3UJ2A 3AM9A 1IUXA 2R45A 3VFCA 2QJNA 4U2TA 4H19A 1PDHA 2BACA 4IV9A 5FJRA 2QAEA 3NK1X 3NN6X 1DJQA 1P2HA 1VG9A 3RP7A 3FBSA 3ICSA 3NN0X 5FJTA 3LZWA 5GRTA 3B6DA 1LQUA 3B3RA 2JKCA 4K5RA 3G5QA 3OTRA 3DJGX 1OJCA 5GSNA 1S3BA 1PDYA 1F8RA 3A7RA 3UGVA 2VZ2A 3SZFA 4AP1A 3VRDB 3FIMB 3AYLA 4NEWA 2PODA 1GESA 3DIPA 2GQFA 4OCGA 4AP3A 5KRQA 4IZGA 3EPTA 3UKFA 2XH7A 1E9IA 2H89A 1YQ4A 2ZZCA 3UXKA 3GWDA 1E1MA 3TW9A 4GUVA 5ER0A 5U1OA 4BV6A 1X2GA 3H8IA 3T4WA 2X99A 1P2EA 3DEQA 2WDQA 1JNRA 3NRZB 3P93A 2V3AA 4PAAA 4DSHA 4CBQA 3AE2A 2Q6UA 2AAQA 2HXUA 4U8PA 2YR4A 3OZMA 4BJZA 2GB0A 3GRTA 3V76A 5JRBA 1ZMCA 3H70A 3UJFA 4LA1A 2XLTA 2A8XA 2ZC8A 2OA1A 4CNKA 4ZCCA 3NVYB 1RVKA 1FOHA 4XWZA 3V5CA 1E39A 3HZLA 3UOZA 4ZOHB 3SN1A 3JSKA 1GEUA 3AEAA 1MOKA 2X8GA 3UJEA 3T0KA 3UJSA 1EC7A 3CTYA 3Q6JA 3I3LA 4EQXA 2A89A 2R4JA 2YVGA 3GYIA 5J04A 3COXA 2X8HA 2AKZA 1FHVA 4J56A 1KNRA 1F9CA 3MY9A 3ATQA 4IL2A 1ONEA 4M0XA 3BSMA 5G5GB 1KKRA 4A6NA 4EQWA 4ECHA 5CKUA 4HNCA 3S5WA 3NVWB 2YLTA 3UKPA 4Y4NA 3EANA 1SB3B 3ES8A 1E1LA 1TDEA 4G9KA 4C5OA 3ZLHA 5FJUA 5BOFA 4IP4A 3SZ0A 1CBOA 4TM4A 3DJJA 2UZZA 3NKSA 3IHMA 4TM0A 4Z26A 4D04A 3ALLA 4P9SA 4A99A 2PSNA 1YEYA 2PMQA 1RYIA 4IL0A 2RGOA 4JY3A 5BULA 3TJ4A 4CRTA 1H81A 4OPUA 4HN8A 3CPHG 2BS4A 2X50A 2VRLA 4KX6A 1F8WA 4A6NB 1EBGA 1CF3A 1PJ7A 1KKOA 2XCGA 1ELSA 1FEAA 1CJCA 3I4KA 3SFEA 2WU2A 5FS9A 3RITA 4YSZA 2YLZA 4X2PA 3UP5A 3AB1A 5BUKA 4USRA 1GT8A 3N6JA 1E1NA 2C3CA 4K1WA 1DOEA 4U8JA 3L8KA 2OQYA 1KNPA 3KPKA 5IQ4A 2BA9A 4J3ZA 4WX1A 3GMCA 1QJDA 4FDCB 2X3NA 3GO2A 3QVRA 4OPDA 4X4JA 1VDCA 4GISA 3NNEA 3F8DA 1GRFA 4MJWA 3D46A 1NHPA 3IJQA 3UJRA 2W3RA 2WESA 1D7LA 4GGBA 2C70A 1K0IA 3TWAA 2BCGG 2V60A 3M13A 3NK0X 2B76A 2BK3A 3OPSA 1N5WC 1CJ4A 2GF3A 5M0ZA 4YXDA 3UTGA 4K22A 4EIQA 5J60A 4FK1C 3GMBA 4MGGA 3T31A 2RABA 4EM3A 4OVIA 3AEBA 3GYJA 4G8TA 4NEVA 4DWDA 2PTXA 3R25A 4JY2A 4YTNA 1NHSA 1TDNA 2WOVA 3U4FA 1MUCA 5HHFA 2E1MA 3T6CA 2JBVA 2V3BA 3H12A 3ITJA 2OALA 1H83A 2PYXA 1N60C 1JRXA 3DH9A 3TCSA 2B9YA 4G7FA 3B97A 3NYCA 4AOXA 3VCNA 4GCMA 4U8OA 3UOVA 1TYPA 5IDZA 1Q9IA 4HCHA 3RP6A 3CPIG 2YR5A 2GR3A 1PDZA 3UKHA 3FVDA 4LU6A 4TM1A 4DYEA 2R0GA 2FBWA 3LZXA 4RSLA 1VRQB 1PBCA 3KU9A 2A87A 2DW6A 3TOYA 4J33A 4U8LA 3IWAA 3NFUA 4H4VA 3JW7A 3GWFA 3EUB3 5TR3A 1FEBA 4H4ZA 3MUCA 2XVJA 4JHMA 1XPQA 3P4RA 1FO4A 3MZNA 1Q1RA 3UKLA 2GH5A 3AE8A 2TPRA 2BK5A 1JROA 3FXGA 2FYMA 2CULA 3K7TA 1COYA 2GMJA 5KMQA 1MNSA 5KXJA 3MKCA 4H2NA 2PU1A 1NHRA 2OZ3A 3LJPA 4BURA 4YTPA 2OO6A 4JN8A 3FV9A 3SQPA 3EAOA 4M52A 1PXBA 3SYIA 3UCDA 1FFUC 1IUUA 1H86A 3NO1A 3T2ZA 1BGNA 2O56A 3STPA 3ATRA 1OJ9A 2YM2A 2ZBWA 3LXDA 2E3TA 1MDLA 1H6VA 2F5ZA 3DMEA 3R0UA 4GF7A 3JVAA 1ZY8A 3SBFA 4H4RA 4A9WA 3ZVIA 3PG6A 1JRZA 2OG9A 4AT0A 2C73A 3AE9A 1TDOA 3MSYA 2P88A 2RGHA 4HYRA 2WBAA 3LB8A 3SZCA 1GNDA 3OZ2A 2FJBA 4J36A 3CK5A 3SQSA 4K8DA 3DK4A 4KPLA 3M12A 3BI4A 4F4RA 2C64A 3DJEA 3C4AA 2R9ZA 4EMJA 1L0VA 4Z2UA 4IVMB 1GTHA 1RSGA 2BCPA 3ABVA 3NZGA 3UXLA 2OX4A 5KMSA 2XVHA 1IUWA 3Q9TA 2XGZA 2IVDA 4H7UA 1Y0PA 3VDGA 3G5RA 1N4VA 4NZHA 5KOXA 2HZGA 5JCKA 3T8QA 5EOWA 4HB9A 4YSYA 2W0HA 1CJ2A 4B69A 1N5XA 1N4UA 5FJOA 3ALMA 1OJAA 1KDGA 2EQ9A 4GIRA 4GAPA 2HXTA 2JK6A 5BVAA 4O5QA 3UCLA 1LJ1A 3CT2A 3CXOA 5JCLA 5ENLA 1PBBA 3I6EA 5KWFA 3ZYXA 1KF6A 2R4EA 3LADA 1N61C 1EL5A 3VR8A 4NNJA 5HY5A 2W55A 2Y6QA 3CGEA 4H4QA 4RG3A 3F8PA 1K4QA 1P48A 1QO8A 1LVLA 2C7GA 3GY1A 1NAAA 3MWCA 2HNEA 1EBHA 3GRSA 1PN0A 3LOVA 3NLCA 1N63C 3C96A 3SY4A 4EWJA 3FMWA 2QA1A 1M64A 5JCMA 2VQBA 4TVYA 1HYUA 3DG7A 1ZXIC 2PTWA 1CL0A 2BYBA 1O5WA 2PP1A 4H4YA 3QTPA 2PP3A 4Y4LA 1Q1WA 3H7VA 1FCDA 3T2YA 4DHGA 3M0OA 1EL7A 4X9NA 3FCPA 1FFVC 3TQPA 2RDXA 2PS2A 1VDVA 1XS2A 4OPCA 1ONFA 3N4EA 3DGBA 5FS6A 3NH3X 2XVFA 4APNA 3Q4DA 4H2QA 4H4UA 3ZVHB 1ZMDA 3PO7A 1T3QC 4G73A 4U2SA 3ICRA 2PTZA 4Z43A 2O9ZA 1R0MA 3KD9A 3K30A 2BRAA 2WDVA 4J31A 1JCTA 2NQLA 3AE3A 2GGGA 4AT2A 5FJPA 4CCQA 3AE5A 2C67A 2ZZBA 3SXIA 3AN1A 1KSUA 3UOYA 3V3NA 3L5OA 2XH4A 1E7PA 1BF3A 2BXSA 1ZOVA 1GTEA 2I5QA 4IP5A 3IF9A 4CY8A 2AKMA 1NENA 1ZOYA 4CNJA 1R6WA 2XFOA 4ICYA 4Z24A 1D4EA 3KKJA 2YQUA 1L9CA 3AD7B 4I59A 4WCTA 3WE0A 1N62C 3KVEA 3NHOX 4TLZA 1WUEA 4HCLA 1TYTA 3SGLA 3DGHA 2B7RA 2OZ8A 2GV8A 2Q0KA 4UDRA 1H7XA 4BK1A 2GAHB 1BGJA 3UTFA 2NPXA 4DNAA 3CNSA 4NTDA 4E8GA 2MNRA 3ZLGA 2GRTA 3VR9A 1P43A 1UKVG 5BOEA 2ONEA 2PPGA 1FECA 2ZZ0A 1D4CA 1DOCA 1DJNA 2J3NA 4OPIA 3DK9A 3P3BA 4BK2A 2XFPA 2XLPA 3RGTA 2OPJA 4GYPC 3VRBA 1NELA 1K0JA 2OVLA 2PA6A 1FHUA 5EB4A 3RCYA 1CJ3A 3PWIA 1IUSA 2Z5XA 3RP8A 3CGBA 3DGZA 3AECA 5HXIA 1GERA 1FL2A 2W54A 2V61A 3HW2A 2X8CA 1SJBA 2YM1A 4YSHA 1YQZA 6ENLA 4Z44A 1O95A 1MDRA 3CPJG 1L9EA 4IA5A 3AE7A 4J2WA 4H4SA 5KMPA 2B7SA 4U8KA 3QVPA 3AE1A 1DODA 4G74A 3D9XA 3NGCX 1DTNA 1V97A 4JDRA 3P9UA 2C3DA 4IT1A 5M10A 3PWGA 4JN7A 4GMEA 1PJ6A 5DBJA 3K7QX 1CHUA 3AD9B 3NVVB 3T14A
chains in the Genus database with same CATH topology
1Y56B 1H6VA 2F5ZA 3DMEA 4OCGA 4AP3A 5KRQA 3PVCA 1NDAA 3AWIA 4GF7A 1ZY8A 4H4RA 4A5LA 4A9WA 1REOA 2WQYA 3EPTA 3UKFA 1JRZA 3PG6A 2GVCA 2PHHA 4H4WA 4II3A 3AYIA 3UTHA 3UTEA 4AT0A 2EQ8A 2C73A 1GRTA 2R46A 1JNZA 2C65A 2RGJA 2WU5A 2H89A 1YQ4A 5FS7A 4GR1A 3AE9A 2ZZCA 1GXFA 1TDOA 4CY6A 3GWDA 2XLSA 1E1MA 4GUVA 5ER0A 5LV9A 2RGHA 5U1OA 3AE6A 3AEDA 2GR0A 4BV6A 2JAEA 3H8IA 3P4PA 2WBAA 3LB8A 2X99A 4UDPA 1GNDA 3SZCA 2GR1A 2NVKX 1XANA 1P2EA 3OZ2A 1B5QA 1JRYA 2FJBA 4YT0A 5KNLA 4J36A 3NYEA 4C74A 2WDQA 1IUVA 1JNRA 3GDNA 4K8DA 4D03A 2V3AA 4PAAA 3DK4A 3ZDNA 4DSHA 3HYVA 3M12A 4CBQA 3BI4A 5FMHA 2C64A 3QFAA 3AE2A 3CNPA 3DJEA 2Q6UA 3GD4A 3C4AA 2VVLA 2R9ZA 1XHCA 2AAQA 4EMJA 1L0VA 3QSEA 4Z2UA 2GEWA 4U8PA 1ZX9A 4IVMB 2YR4A 4XXGA 3VRAA 4B65A 4BJZA 2GB0A 3GRTA 4B1BA 3V76A 1GTHA 1YY5A 1RSGA 2GAGB 4JN9A 4NWZA 2BCPA 5JRBA 1L9DA 4B68A 4FX9A 3ABVA 1ZMCA 1D4DA 4LA1A 5KMSA 2XVHA 4EIPA 1S2QA 4H4TA 2HQMA 1IUWA 2XLTA 1KN0A 5KVIA 2A8XA 1GALA 2OA1A 4X9MA 4CNKA 2XFUA 5U25A 3Q9TA 1GRAA 4ZCCA 2IVDA 4H7UA 2Y6RA 1AOGA 5J60A 4REKA 3RNMA 4A7AA 2WPCA 4FK1A 4C3XA 1Y0PA 1FOHA 3P4SA 4XWZA 3G5RA 1N4VA 1W4XA 4NZHA 5HYMA 1E39A 2CFYA 4PABA 3HZLA 2BC1A 1EL8A 3NTAA 3DA1A 4HA6A 3UOZA 5KOXA 1DXLA 2AR8A 1ZK7A 1ZDLA 5JCKA 3JSKA 5EOWA 4N9XA 1GEUA 1NPXA 3URHA 3AEAA 1MOKA 2W0HA 2X8GA 1CJ2A 3AYJA 4HB9A 4B69A 2WHDA 4YSYA 2WP6A 3NIXA 5KOWA 1N4UA 4YSXA 3SX6A 3ALMA 1GPEA 1OJAA 1KDGA 3SFDA 2EQ9A 3T0KA 4GAPA 1PXAA 2YAUA 1TDKA 2JK6A 1IUTA 3Q6JA 3CTYA 1F6MA 3I3LA 4O5QA 3UCLA 4YKGA 4EQXA 2A89A 5EB5A 1LJ1A 2R4JA 3BI5A 4H4PA 2YVGA 3GYIA 3T37A 1PHHA 3COXA 2X8HA 3QFBA 5JCLA 4J56A 1PBBA 1KNRA 2BS2A 5KWFA 3ATQA 3II4A 3ZYXA 1GV4A 1KF6A 2R4EA 3LADA 3QSSA 1EL5A 1BWCA 5KMRA 3VR8A 3P4QA 3CNTA 4NNJA 5HY5A 1E6EA 2XDOA 4USQA 2Y6QA 4A6NA 5IPYA 3CGEA 2FJDA 3UKAA 4EQWA 4ECHA 2YLWA 1Z6LA 3C4NA 4I58A 5CKUA 3S5WA 4H4QA 2YLTA 3UKPA 1CC6A 4RG3A 2YG7A 4Y4NA 4H50A 3F8PA 5U63A 3KA7A 1GOSA 3EANA 1K4QA 3FG2P 4KPRA 1QO8A 1H7WA 1OJTA 1LVLA 2C7GA 1VQWA 1E1LA 1TDEA 3SZWA 4G9KA 3HYXA 4C5OA 3GYXA 1NAAA 1TRBA 2EQ6A 2VOUA 2E4GA 3IC9A 3HYWA 4IA6A 3I6DA 4O5UA 1VG0A 3SZ0A 1SEZA 1CBOA 4TM4A 5C3JA 3DJJA 5JCNA 2UZZA 3NKSA 2I0ZA 2Q0LA 4U8MA 3GRSA 1QLBA 1PN0A 2ACZA 3LOVA 3IHMA 3NLCA 4TM0A 4Z26A 2C4CA 2JB3A 1CC2A 2XVEA 4A79A 2VVLG 4D04A 3ALLA 2YG3A 3C96A 3SY4A 3FMWA 1S2YA 4P9SA 4YWOA 4A99A 4LIIA 2QA1A 1M64A 2B9WA 3L1RA 5JCMA 2VQBA 1K0LA 4UP3A 2EQ7A 3NT6A 1HYUA 5EBKA 1RYIA 2RGOA 3AE4A 4G6GA 3S61A 4JY3A 1LPFA 2YLXA 5BULA 2YLRA 4DGKA 4CRTA 1GETA 1D5TA 1H81A 2YVJA 1CL0A 3ISHA 4OPUA 2BYBA 3GDPA 3F8RA 1O5WA 3CPHG 3NTDA 4H4YA 4G6HA 2BS4A 4Y4LA 1Q1WA 1KFYA 2X50A 1FCDA 1B4VA 2VRLA 3T2YA 4KX6A 4NTEA 2BC0A 2VRMA 5KVHA 4C3YA 1F8WA 4H2RA 2TMDA 3K7MX 3M0OA 4A6NB 1EL7A 1CF3A 1PJ7A 2ARDA 1B37A 4X9NA 2C72A 2XCGA 4Z2TA 3ICTA 1FEAA 1F3PA 3UKQA 4OPGA 4AOSA 1CJCA 1ZKQA 2C75A 4OPCA 4YKFA 1EBDA 3SFEA 2FJEA 1ONFA 2WU2A 2VVMA 4Y4MA 5FS9A 4YSZA 5FS6A 2YLZA 1JOAA 2WOIA 3BNMA 3CMMA 3UP5A 4A65A 3AB1A 3AD8B 5BUKA 4II2A 4USRA 1GT8A 2XVFA 2BK4A 3NH3X 3AEFA 4APNA 4GDPA 1N4WA 2C66A 4H2QA 2WDRA 4H4UA 3PO7A 1ZMDA 1E1NA 4G73A 2JB1A 1BZLA 2C3CA 4JQ9A 3ADAB 5C2TA 4TM3A 4U2SA 1DOEA 3CNJA 3ICRA 3L8KA 4U8JA 1KNPA 3KPKA 4EMWA 5IQ4A 4Z43A 2BA9A 1IJHA 4WX1A 3GMCA 1QJDA 2XYOA 3NYFA 4FDCB 4BJYA 2O9ZA 3H8LA 3KD9A 2X3NA 3K30A 1GREA 3QVRA 4OPDA 4X4JA 1VDCA 2YG5A 1S3EA 5J7XA 2BRAA 2CVJA 2WDVA 1BKWA 2XFQA 4J31A 3DK8A 1RP0A 3NNEA 3AE3A 2DKHA 1V59A 3CGCA 1B8SA 3F8DA 3BHFA 4U8NA 2IVEA 1GRFA 2WETA 3O0HA 4MJWA 1NHPA 4AT2A 4CCQA 3AE5A 2C67A 2ZZBA 2BABA 3SXIA 3AEGA 2WESA 3NG7X 1GSNA 1D7LA 2GMHA 2C70A 4B64A 1KSUA 1K0IA 3UOYA 2BCGG 2V60A 1PBFA 2YG6A 3M13A 3RHAA 3V3NA 3VQRA 3NK0X 3L5OA 4EQRA 1X31B 1PXCA 1E7PA 2B76A 2BK3A 2BS3A 5FS8A 4J34A 2YVFA 1BF3A 2GQWA 3QJ4A 2BXSA 1ZOVA 1CJ4A 2WPEA 1GTEA 2GF3A 4JNAA 5M0ZA 3UTGA 4K22A 4YXDA 4EIQA 2XLRA 3IF9A 4CY8A 1PJ5A 1YKJA 1YQ3A 3GMBA 4FK1C 4TLXA 5IQ1A 2RABA 3NK2X 2GR2A 3T31A 4Z2RA 5BRTA 1D7YA 3H4KA 4ADWA 4EM3A 4OVIA 4UDQA 1NENA 4GDEA 1ZOYA 2IIDA 3AEBA 3BNUA 3GYJA 4CNJA 4NEVA 2XFOA 4ICYA 2YLSA 1M6IA 4K7ZA 2Q7VA 2WP9A 4JY2A 4RG4A 4Z24A 4YTNA 3E1TA 1NHSA 1TDNA 2WOVA 1CC4A 1D4EA 3KKJA 1OJDA 3FPZA 2YQUA 1L9CA 1EL9A 1LV0A 3D1CA 3AD7B 4DSGA 2R0PA 2VQ7A 2WS3A 4I59A 5HHFA 4WCTA 4CCRA 2E1MA 3REDA 3P1WA 4B66A 3WE0A 3AEEA 1ELIA 2JBVA 2V3BA 3NRNA 4U8IA 4YTMA 3KVEA 4ZN0A 3UP4A 3NHOX 4TLZA 3ITJA 2OALA 3GSIA 1NG4A 2OAMA 5BVAA 2XVIA 1H83A 2PYXA 3PS9A 1TYTA 3DJDA 1JU2A 3SGLA 1JRXA 3DH9A 2DKIA 1PBEA 3SM8A 2B9XA 1O94A 3BI2A 3DGHA 4EM4A 2B7RA 5JCIA 4J57A 2APGA 2OLOA 2YWLA 2GV8A 2CDUA 2Q0KA 2B9YA 4IVOB 4OPLA 4UDRA 1H7XA 4BK1A 4ZCDA 2GAHB 2V6OA 1BGJA 3UTFA 2NPXA 5L46A 3NYCA 4AOXA 4DNAA 3CNSA 4NTDA 4NTCA 1KSSA 1GRHA 4GCMA 4U8OA 3UOVA 4OPTA 2GRTA 3VR9A 1TYPA 1TDFA 1Q9IA 3RP6A 4EQSA 3CPIG 1UKVG 2WPFA 1F8SA 2YR5A 1NEKA 2BRYA 2GR3A 4BK3A 4EMIA 2FJAA 3UKHA 1FECA 2E5VA 1N1PA 2Z5YA 4LU6A 2ZZ0A 1D4CA 1H84A 1DOCA 1DJNA 4TM1A 4B67A 2J3NA 1PS9A 4K2XA 4OPIA 4U2LA 3DK9A 2R0GA 3R9UA 2FBWA 3LZXA 1MO9A 4RSLA 4BK2A 1VRQB 2C76A 2XFPA 3KPFA 1PBCA 3QSMA 2R0CA 2XLPA 1LTXR 1MXTA 2V5ZA 2XLUA 4XWRA 3V3OA 2OLNA 4C77A 1S7MA 2H88A 2XFNA 2QCUA 3CIRA 3GD3A 3KLJA 3KU9A 2A87A 4J33A 3VRBA 3G5SA 4U8LA 1GRGA 3OC4A 1K0JA 3IWAA 3T2KA 3IHGA 4B63A 4H4VA 3GWFA 5EB4A 2AQJA 5TR3A 1FEBA 4H4ZA 1IUXA 1CJ3A 2R45A 4GAVA 1IUSA 2Z5XA 2XVJA 3RP8A 3CGBA 3DGZA 3AECA 4U2TA 1XPQA 3P4RA 1PDHA 1E1KA 2BACA 3AXBA 5HXIA 1GERA 4IV9A 1JEHA 1Q1RA 3UKLA 1FL2A 2GH5A 2JB2A 1H2IA 2QAEA 3NK1X 3CGDA 4JNQA 3NN6X 2V61A 2TPRA 3AE8A 2BK5A 1DJQA 3K7TA 2CULA 1Y56A 1COYA 2YR6A 2X8CA 2GMJA 2WEUA 5KMQA 2YM1A 1P2HA 1VG9A 2QA2A 1YQZA 3FBSA 3RP7A 4YSHA 5KXJA 3ICSA 3NN0X 4H2NA 4Z44A 1NHQA 1O95A 3CPJG 1NHRA 1L9EA 4K5SA 4IA5A 3AE7A 3LJPA 4J2WA 4BURA 5GRTA 3LZWA 4YTPA 1DOBA 3B6DA 1DNCA 2BXRA 3CNDA 1LQUA 1NG3A 1PBDA 4E0VA 4H4SA 3B3RA 2JKCA 3SQPA 3CN8A 3G5QA 4K5RA 2WOWA 5KMPA 3DJGX 3EAOA 4M52A 3D8XA 1PXBA 2B7SA 4U8KA 3SYIA 3QVPA 5CQFA 3AE1A 1DODA 1LQTA 4G74A 3D9XA 4H2PA 1OJCA 1H82A 5GSNA 1IUUA 1S3BA 1ZP0A 3ALJA 3NGCX 1H86A 4JDRA 4GRTA 1F8RA 3P9UA 4Z25A 2YG4A 3EF6A 2C3DA 2VZ2A 1XDIA 3T2ZA 3SZFA 1BGNA 3BHKA 5M10A 4AP1A 3ATRA 4H4XA 1OJ9A 1PJ6A 3VRDB 2WP5A 2YM2A 3UOXA 5DBJA 2ZBWA 3FIMB 3LXDA 3K7QX 1CHUA 3AYLA 4NEWA 3AD9B 3T14A 1GESA 3UKKA 2GQFA 1GRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y56 B;  1H6V A;  2F5Z A;  3DME A;  4OCG A;  4AP3 A;  5KRQ A;  3PVC A;  1NDA A;  3AWI A;  4GF7 A;  1ZY8 A;  4H4R A;  4A5L A;  4A9W A;  1REO A;  2WQY A;  3EPT A;  3UKF A;  1JRZ A;  2GVC A;  2PHH A;  4H4W A;  4AT0 A;  3AYI A;  3UTH A;  3UTE A;  2EQ8 A;  2C73 A;  1GRT A;  2R46 A;  1JNZ A;  2C65 A;  2RGJ A;  2WU5 A;  2H89 A;  1YQ4 A;  5FS7 A;  4GR1 A;  3AE9 A;  2ZZC A;  1GXF A;  1TDO A;  4CY6 A;  3GWD A;  2XLS A;  1E1M A;  4GUV A;  5ER0 A;  5LV9 A;  2RGH A;  5U1O A;  3AE6 A;  3AED A;  2GR0 A;  4BV6 A;  2JAE A;  3H8I A;  3P4P A;  2WBA A;  3LB8 A;  2X99 A;  4UDP A;  1GND A;  2GR1 A;  2NVK X;  1XAN A;  1P2E A;  3OZ2 A;  1B5Q A;  1JRY A;  2FJB A;  4YT0 A;  4J36 A;  3NYE A;  4C74 A;  2WDQ A;  1IUV A;  1JNR A;  3GDN A;  4K8D A;  4D03 A;  2V3A A;  4PAA A;  3DK4 A;  3ZDN A;  4DSH A;  3M12 A;  4CBQ A;  3BI4 A;  5FMH A;  2C64 A;  3QFA A;  3AE2 A;  3CNP A;  3DJE A;  2Q6U A;  3GD4 A;  3C4A A;  2VVL A;  2R9Z A;  1XHC A;  2AAQ A;  4EMJ A;  1L0V A;  3QSE A;  4Z2U A;  2GEW A;  4U8P A;  1ZX9 A;  4IVM B;  2YR4 A;  4XXG A;  3VRA A;  4B65 A;  4BJZ A;  2GB0 A;  3GRT A;  4B1B A;  3V76 A;  1GTH A;  1YY5 A;  1RSG A;  2GAG B;  4JN9 A;  2BCP A;  1L9D A;  4B68 A;  4FX9 A;  3ABV A;  1ZMC A;  1D4D A;  4LA1 A;  2XVH A;  4EIP A;  1S2Q A;  4H4T A;  2HQM A;  1IUW A;  2XLT A;  5KVI A;  1GAL A;  2A8X A;  2OA1 A;  4X9M A;  4CNK A;  2XFU A;  5U25 A;  3Q9T A;  1GRA A;  4ZCC A;  2IVD A;  4H7U A;  2Y6R A;  1AOG A;  5J60 A;  4REK A;  3RNM A;  4A7A A;  2WPC A;  4FK1 A;  4C3X A;  1Y0P A;  1FOH A;  3P4S A;  4XWZ A;  3G5R A;  1N4V A;  1W4X A;  4NZH A;  5HYM A;  1E39 A;  2CFY A;  4PAB A;  3HZL A;  2BC1 A;  1EL8 A;  3NTA A;  3DA1 A;  4HA6 A;  3UOZ A;  5KOX A;  1DXL A;  2AR8 A;  1ZK7 A;  1ZDL A;  5JCK A;  3JSK A;  5EOW A;  4N9X A;  1GEU A;  1NPX A;  3URH A;  3AEA A;  1MOK A;  2W0H A;  2X8G A;  1CJ2 A;  3AYJ A;  4HB9 A;  4B69 A;  2WHD A;  4YSY A;  2WP6 A;  3NIX A;  5KOW A;  1N4U A;  4YSX A;  3ALM A;  1GPE A;  1OJA A;  1KDG A;  3SFD A;  2EQ9 A;  1PXA A;  2YAU A;  1TDK A;  2JK6 A;  1IUT A;  3Q6J A;  3CTY A;  1F6M A;  3I3L A;  4O5Q A;  3UCL A;  4YKG A;  4EQX A;  2A89 A;  5EB5 A;  1LJ1 A;  2R4J A;  3BI5 A;  4H4P A;  2YVG A;  3GYI A;  3T37 A;  1PHH A;  3COX A;  2X8H A;  3QFB A;  5JCL A;  4J56 A;  1PBB A;  1KNR A;  2BS2 A;  5KWF A;  3ATQ A;  3II4 A;  3ZYX A;  1GV4 A;  1KF6 A;  2R4E A;  3LAD A;  3QSS A;  1EL5 A;  1BWC A;  3VR8 A;  3P4Q A;  3CNT A;  5HY5 A;  1E6E A;  2XDO A;  4USQ A;  2Y6Q A;  4A6N A;  5IPY A;  3CGE A;  2FJD A;  3UKA A;  4EQW A;  4ECH A;  2YLW A;  1Z6L A;  3C4N A;  4I58 A;  5CKU A;  3S5W A;  4H4Q A;  2YLT A;  3UKP A;  1CC6 A;  4RG3 A;  2YG7 A;  4Y4N A;  4H50 A;  3F8P A;  5U63 A;  3KA7 A;  1GOS A;  3EAN A;  1K4Q A;  3FG2 P;  4KPR A;  1QO8 A;  1H7W A;  1OJT A;  1LVL A;  2C7G A;  1VQW A;  1E1L A;  1TDE A;  4C5O A;  1NAA A;  1TRB A;  2EQ6 A;  2VOU A;  2E4G A;  3IC9 A;  4IA6 A;  3I6D A;  4O5U A;  1VG0 A;  1SEZ A;  1CBO A;  4TM4 A;  5C3J A;  3DJJ A;  5JCN A;  2UZZ A;  3NKS A;  2I0Z A;  2Q0L A;  4U8M A;  3GRS A;  1QLB A;  1PN0 A;  2ACZ A;  3LOV A;  3IHM A;  3NLC A;  4TM0 A;  4Z26 A;  2JB3 A;  4D04 A;  1CC2 A;  2XVE A;  4A79 A;  2VVL G;  3ALL A;  2YG3 A;  3C96 A;  3FMW A;  1S2Y A;  4P9S A;  4YWO A;  4A99 A;  4LII A;  2QA1 A;  1M64 A;  2B9W A;  3L1R A;  5JCM A;  2VQB A;  1K0L A;  4UP3 A;  2EQ7 A;  3NT6 A;  1HYU A;  5EBK A;  1RYI A;  2RGO A;  3AE4 A;  3S61 A;  4JY3 A;  1LPF A;  2YLX A;  5BUL A;  2YLR A;  4DGK A;  4CRT A;  1GET A;  1D5T A;  1H81 A;  2YVJ A;  1CL0 A;  3ISH A;  4OPU A;  2BYB A;  3GDP A;  3F8R A;  1O5W A;  3CPH G;  3NTD A;  4H4Y A;  2BS4 A;  4Y4L A;  1Q1W A;  1KFY A;  2X50 A;  1FCD A;  1B4V A;  2VRL A;  4KX6 A;  4NTE A;  2BC0 A;  2VRM A;  5KVH A;  4C3Y A;  1F8W A;  4H2R A;  2TMD A;  3K7M X;  3M0O A;  4A6N B;  1EL7 A;  1CF3 A;  1PJ7 A;  2ARD A;  1B37 A;  4X9N A;  2C72 A;  2XCG A;  4Z2T A;  3ICT A;  1FEA A;  1F3P A;  3UKQ A;  4OPG A;  4AOS A;  1CJC A;  1ZKQ A;  2C75 A;  4OPC A;  4YKF A;  1EBD A;  3SFE A;  2FJE A;  1ONF A;  2WU2 A;  2VVM A;  4Y4M A;  5FS9 A;  4YSZ A;  5FS6 A;  2YLZ A;  1JOA A;  2WOI A;  3BNM A;  3UP5 A;  4A65 A;  3AB1 A;  3AD8 B;  5BUK A;  4USR A;  1GT8 A;  2XVF A;  2BK4 A;  3NH3 X;  3AEF A;  4APN A;  4GDP A;  1N4W A;  2C66 A;  4H2Q A;  2WDR A;  4H4U A;  3PO7 A;  1ZMD A;  1E1N A;  2JB1 A;  1BZL A;  2C3C A;  4JQ9 A;  3ADA B;  5C2T A;  4TM3 A;  4U2S A;  1DOE A;  3CNJ A;  3ICR A;  3L8K A;  4U8J A;  1KNP A;  4EMW A;  5IQ4 A;  4Z43 A;  2BA9 A;  1IJH A;  4WX1 A;  3GMC A;  1QJD A;  2XYO A;  3NYF A;  4FDC B;  4BJY A;  2O9Z A;  3H8L A;  3KD9 A;  2X3N A;  3K30 A;  1GRE A;  3QVR A;  4OPD A;  4X4J A;  1VDC A;  2YG5 A;  1S3E A;  5J7X A;  2CVJ A;  2WDV A;  1BKW A;  2XFQ A;  4J31 A;  3DK8 A;  1RP0 A;  3NNE A;  3AE3 A;  2DKH A;  1V59 A;  3CGC A;  1B8S A;  3F8D A;  3BHF A;  4U8N A;  2IVE A;  1GRF A;  2WET A;  3O0H A;  4MJW A;  1NHP A;  4AT2 A;  4CCQ A;  3AE5 A;  2C67 A;  2ZZB A;  2BAB A;  3AEG A;  2WES A;  3NG7 X;  1GSN A;  1D7L A;  2GMH A;  2C70 A;  4B64 A;  1KSU A;  1K0I A;  3UOY A;  2BCG G;  2V60 A;  1PBF A;  2YG6 A;  3M13 A;  3RHA A;  3V3N A;  3VQR A;  3NK0 X;  4EQR A;  1X31 B;  1PXC A;  1E7P A;  2B76 A;  2BK3 A;  2BS3 A;  5FS8 A;  4J34 A;  2YVF A;  1BF3 A;  2GQW A;  3QJ4 A;  2BXS A;  1ZOV A;  1CJ4 A;  2WPE A;  1GTE A;  2GF3 A;  4JNA A;  5M0Z A;  3UTG A;  4K22 A;  4YXD A;  4EIQ A;  2XLR A;  3IF9 A;  4CY8 A;  1PJ5 A;  1YKJ A;  1YQ3 A;  3GMB A;  4FK1 C;  4TLX A;  5IQ1 A;  2RAB A;  3NK2 X;  2GR2 A;  4Z2R A;  5BRT A;  1D7Y A;  3H4K A;  4ADW A;  4EM3 A;  4OVI A;  4UDQ A;  1NEN A;  4GDE A;  1ZOY A;  2IID A;  3AEB A;  3BNU A;  3GYJ A;  4CNJ A;  4NEV A;  2XFO A;  4ICY A;  2YLS A;  1M6I A;  4K7Z A;  2Q7V A;  2WP9 A;  4JY2 A;  4RG4 A;  4Z24 A;  4YTN A;  3E1T A;  1NHS A;  1TDN A;  2WOV A;  1CC4 A;  1D4E A;  3KKJ A;  1OJD A;  3FPZ A;  2YQU A;  1L9C A;  1EL9 A;  1LV0 A;  3D1C A;  3AD7 B;  4DSG A;  2R0P A;  2VQ7 A;  2WS3 A;  4I59 A;  5HHF A;  4WCT A;  4CCR A;  2E1M A;  3RED A;  3P1W A;  4B66 A;  3WE0 A;  3AEE A;  1ELI A;  2JBV A;  2V3B A;  3NRN A;  4U8I A;  4YTM A;  3KVE A;  4ZN0 A;  3UP4 A;  3NHO X;  4TLZ A;  3ITJ A;  2OAL A;  3GSI A;  1NG4 A;  2OAM A;  5BVA A;  2XVI A;  1H83 A;  2PYX A;  3PS9 A;  1TYT A;  3DJD A;  1JU2 A;  3SGL A;  1JRX A;  3DH9 A;  2DKI A;  1PBE A;  3SM8 A;  2B9X A;  1O94 A;  3BI2 A;  3DGH A;  4EM4 A;  2B7R A;  5JCI A;  4J57 A;  2APG A;  2OLO A;  2YWL A;  2GV8 A;  2CDU A;  2Q0K A;  2B9Y A;  4IVO B;  4OPL A;  4UDR A;  1H7X A;  4BK1 A;  4ZCD A;  2GAH B;  2V6O A;  1BGJ A;  3UTF A;  2NPX A;  5L46 A;  3NYC A;  4AOX A;  4DNA A;  3CNS A;  4NTD A;  4NTC A;  1KSS A;  1GRH A;  4GCM A;  4U8O A;  3UOV A;  4OPT A;  2GRT A;  3VR9 A;  1TYP A;  1TDF A;  1Q9I A;  3RP6 A;  4EQS A;  3CPI G;  1UKV G;  2WPF A;  1F8S A;  2YR5 A;  1NEK A;  4BK3 A;  2GR3 A;  4EMI A;  2FJA A;  3UKH A;  1FEC A;  2E5V A;  1N1P A;  2Z5Y A;  4LU6 A;  2ZZ0 A;  1D4C A;  1H84 A;  1DOC A;  1DJN A;  4TM1 A;  4B67 A;  2J3N A;  1PS9 A;  4K2X A;  4OPI A;  4U2L A;  3DK9 A;  2R0G A;  3R9U A;  2FBW A;  3LZX A;  1MO9 A;  4RSL A;  4BK2 A;  1VRQ B;  2C76 A;  2XFP A;  3KPF A;  1PBC A;  3QSM A;  2R0C A;  2XLP A;  1LTX R;  1MXT A;  2V5Z A;  2XLU A;  4XWR A;  3V3O A;  2OLN A;  4C77 A;  2H88 A;  2XFN A;  2QCU A;  3CIR A;  3GD3 A;  3KLJ A;  3KU9 A;  2A87 A;  4J33 A;  3VRB A;  3G5S A;  4U8L A;  1GRG A;  3OC4 A;  1K0J A;  3IWA A;  4B63 A;  3IHG A;  4H4V A;  3GWF A;  5EB4 A;  2AQJ A;  5TR3 A;  1FEB A;  4H4Z A;  1IUX A;  1CJ3 A;  2R45 A;  1IUS A;  2Z5X A;  2XVJ A;  3RP8 A;  3CGB A;  3DGZ A;  3AEC A;  4U2T A;  1XPQ A;  3P4R A;  1PDH A;  1E1K A;  2BAC A;  3AXB A;  5HXI A;  1GER A;  4IV9 A;  1JEH A;  1Q1R A;  3UKL A;  1FL2 A;  2GH5 A;  2JB2 A;  2QAE A;  3NK1 X;  3CGD A;  4JNQ A;  3NN6 X;  2V61 A;  2TPR A;  3AE8 A;  2BK5 A;  1DJQ A;  3K7T A;  2CUL A;  1Y56 A;  1COY A;  2YR6 A;  2X8C A;  2GMJ A;  2WEU A;  2YM1 A;  1P2H A;  1VG9 A;  2QA2 A;  1YQZ A;  3FBS A;  3RP7 A;  4YSH A;  5KXJ A;  3ICS A;  3NN0 X;  4H2N A;  4Z44 A;  1NHQ A;  1O95 A;  3CPJ G;  1NHR A;  1L9E A;  4K5S A;  4IA5 A;  3AE7 A;  3LJP A;  4J2W A;  4BUR A;  5GRT A;  3LZW A;  4YTP A;  1DOB A;  3B6D A;  1DNC A;  2BXR A;  3CND A;  1LQU A;  1NG3 A;  1PBD A;  4E0V A;  4H4S A;  3B3R A;  2JKC A;  3SQP A;  3CN8 A;  3G5Q A;  4K5R A;  2WOW A;  3DJG X;  3EAO A;  4M52 A;  3D8X A;  1PXB A;  2B7S A;  4U8K A;  3QVP A;  5CQF A;  3AE1 A;  1DOD A;  1LQT A;  4H2P A;  1OJC A;  1H82 A;  5GSN A;  1IUU A;  1S3B A;  1ZP0 A;  3ALJ A;  3NGC X;  1H86 A;  4JDR A;  4GRT A;  1F8R A;  3P9U A;  4Z25 A;  2YG4 A;  3EF6 A;  2C3D A;  2VZ2 A;  1XDI A;  1BGN A;  3BHK A;  5M10 A;  4AP1 A;  3ATR A;  4H4X A;  1OJ9 A;  1PJ6 A;  3VRD B;  2WP5 A;  2YM2 A;  3UOX A;  5DBJ A;  2ZBW A;  3FIM B;  3LXD A;  3K7Q X;  1CHU A;  3AYL A;  4NEW A;  3AD9 B;  1GES A;  3UKK A;  2GQF A;  1GRB A; 
#chains in the Genus database with same CATH topology
 2GSH A;  1XPY A;  1NDA A;  4A5L A;  1REO A;  2WQY A;  2GVC A;  3UTE A;  2EQ8 A;  5EU9 A;  1GRT A;  2GGI A;  2R46 A;  1JNZ A;  2C65 A;  2RGJ A;  5FS7 A;  3DDM A;  4CY6 A;  1IYX A;  5LV9 A;  3AE6 A;  2JAE A;  3P4P A;  3ES7 A;  4UDP A;  4ZA0 A;  1BKH A;  2GR1 A;  2NVK X;  4GGH A;  3HRD C;  4K2S A;  1B5Q A;  4YT0 A;  3RRA A;  1JDF A;  2PP0 A;  4C74 A;  3DG6 A;  3GDN A;  3ZDN A;  3HYV A;  5FMH A;  3VC5 A;  3QFA A;  3DFH A;  3GD4 A;  1JRP A;  2VVL A;  1XHC A;  4KEM A;  2GDQ A;  3QSE A;  2W3S A;  3KUM A;  1YY5 A;  4DXK A;  4B68 A;  4YWS A;  1D4D A;  4EIP A;  1S2Q A;  1KN0 A;  1GAL A;  2MUC A;  3NXL A;  4Z1Y A;  2XFU A;  5U25 A;  1GRA A;  5G5H B;  3RR1 A;  2Y6R A;  4REK A;  4A7A A;  2WPC A;  3H8A A;  4FK1 A;  4C3X A;  3P4S A;  4A6G A;  3NTA A;  1ZDL A;  3PK7 A;  3AYJ A;  3URH A;  3NIX A;  3EKG A;  5KOW A;  1EC8 A;  3THU A;  3SX6 A;  3I6T A;  1GPE A;  4ROP A;  1PXA A;  1IUT A;  3QN3 A;  1F6M A;  3BI5 A;  3P0W A;  2PU0 A;  2OFJ A;  1PHH A;  1WYG A;  3QFB A;  2BS2 A;  1GV4 A;  2XH0 A;  1BWC A;  5KMR A;  3P4Q A;  3IJL A;  4USQ A;  5IPY A;  3S5S A;  3ETR B;  1Z6L A;  3C4N A;  4I58 A;  2YG7 A;  3B9J B;  4H50 A;  3KA7 A;  1GOS A;  2OZT A;  1H7W A;  1OJT A;  3SZW A;  1WUF A;  3GYX A;  2VOU A;  3I6D A;  4O5U A;  1SEZ A;  5C3J A;  5JCN A;  2I0Z A;  2PCE A;  2Q0L A;  4U8M A;  2ACZ A;  2JB3 A;  4Z17 A;  2P0I A;  2YG3 A;  4LII A;  3L1R A;  2EQ7 A;  3AE4 A;  4G6G A;  3S61 A;  2P8C A;  1L8P A;  1GET A;  3N6H A;  1KCZ A;  3GDP A;  3F8R A;  3V3W A;  1BQG A;  2AL2 A;  3TJI A;  3NTD A;  2FKP A;  3QPE A;  3SJN A;  2CHR A;  4M6U A;  2TMD A;  3K7M X;  2ARD A;  1B37 A;  4Z2T A;  1F3P A;  4OPG A;  4AOS A;  1VQZ A;  2C75 A;  4YKF A;  2FJE A;  4Y4M A;  1JOA A;  2WOI A;  3CMM A;  3OZY A;  3AD8 B;  4II2 A;  3CAW A;  2BK4 A;  3AEF A;  1N4W A;  2WDR A;  2JB1 A;  4TM3 A;  3V4B A;  3OP2 A;  3BOX A;  1IJH A;  2POZ A;  3NYF A;  3H8L A;  1GRE A;  4A35 A;  1S3E A;  2XSX A;  2OKT A;  3V5F A;  4ZCW A;  2DKH A;  1V59 A;  3CGC A;  1B8S A;  2AL2 B;  4U8N A;  2IVE A;  3O0H A;  3FJ4 A;  3NS1 B;  4HCD A;  3NVZ B;  1GSN A;  2XH2 A;  3PFR A;  2YG6 A;  3VQR A;  1X31 B;  5FS8 A;  2WPE A;  3R07 C;  4DN1 A;  3DFY A;  1PJ5 A;  1YKJ A;  4Z2R A;  4TLX A;  5BRT A;  5IQ1 A;  3NK2 X;  1D7Y A;  3H4K A;  2OQH A;  2IID A;  3BNU A;  7ENL A;  1M6I A;  2PGW A;  3QKE A;  2WP9 A;  3E1T A;  1OJD A;  3FPZ A;  1EL9 A;  1LV0 A;  2R0P A;  3ZVH A;  4CCR A;  3P1W A;  4B66 A;  3AEE A;  2QGY A;  3NRN A;  4U8I A;  4YTM A;  3UP4 A;  2OAM A;  1MRA A;  2QDD A;  3DJD A;  1JU2 A;  2DKI A;  1PBE A;  3S47 A;  2B9X A;  1O94 A;  5JCI A;  4J57 A;  2APG A;  2OLO A;  4IVO B;  4ZCD A;  2V6O A;  2GL5 A;  4FP1 A;  3A7U A;  4NTC A;  1GRH A;  4OPT A;  1TDF A;  4EQS A;  3A7A A;  1NEK A;  2BRY A;  4KWS A;  2FJA A;  2E5V A;  1N1P A;  3BJS A;  4B67 A;  1PS9 A;  4K2X A;  3R9U A;  2C76 A;  3KPF A;  2R0C A;  1LTX R;  3GD6 A;  4C77 A;  2H88 A;  2QCU A;  3KLJ A;  3VC6 A;  1GRG A;  3OC4 A;  3T2K A;  3IHG A;  2AQJ A;  4GAV A;  4J1O A;  3FYY A;  1E1K A;  3AXB A;  1JEH A;  3GC2 A;  2JB2 A;  1H2I A;  4JNQ A;  3CGD A;  1Y56 A;  2YR6 A;  2WEU A;  3K1G A;  3RO6 A;  2QA2 A;  1NHQ A;  4K5S A;  1DOB A;  1DNC A;  2BXR A;  3CXB A;  3CND A;  1NG3 A;  1PBD A;  4E0V A;  1JPD X;  3CN8 A;  2GGJ A;  2WOW A;  3D8X A;  5CQF A;  4FI4 A;  3T9P A;  1LQT A;  4H2P A;  1H82 A;  1ZP0 A;  3ALJ A;  4GRT A;  4Z25 A;  2YG4 A;  3EF6 A;  1XDI A;  3BHK A;  3DER A;  3TTE A;  2ZAD A;  2QDE A;  4H4X A;  2WP5 A;  3UOX A;  3R11 A;  3VCC A;  3UKK A;  1RM6 B;  1GRB A;  1Y56 B;  3PVC A;  3AWI A;  3IK4 A;  4HNL A;  2PHH A;  4H4W A;  4II3 A;  3TWB A;  3AYI A;  3UTH A;  2WU5 A;  4GR1 A;  1TKK A;  1GXF A;  2XLS A;  3SSZ A;  3AED A;  2GR0 A;  2GGE A;  1XAN A;  1SJA A;  1JRY A;  5KNL A;  3NYE A;  3UCC A;  1IUV A;  3DES A;  3R0K A;  4D03 A;  4K8G A;  4KT2 A;  3CNP A;  3JZU A;  2GEW A;  1ZX9 A;  4XXG A;  3VRA A;  4B65 A;  4B1B A;  4JN9 A;  2GAG B;  4NWZ A;  1L9D A;  4FX9 A;  4H4T A;  2HQM A;  5KVI A;  2QJJ A;  4X9M A;  1AOG A;  3RNM A;  2GGH A;  1NU5 A;  1W4X A;  5HYM A;  2CFY A;  4PAB A;  2BC1 A;  1EL8 A;  3DA1 A;  4HA6 A;  1DXL A;  2AR8 A;  1ZK7 A;  4N9X A;  1NPX A;  2WHD A;  2AL1 A;  2WP6 A;  4YSX A;  4A3R A;  3SFD A;  2YAU A;  1TDK A;  4YKG A;  5EB5 A;  4H4P A;  3T37 A;  3R10 A;  3HPF A;  3II4 A;  3QSS A;  3CNT A;  3Q45 A;  1FIQ B;  2P3Z A;  1E6E A;  2XDO A;  2QVH A;  2FJD A;  3UKA A;  2YLW A;  4H1Z A;  2PGE A;  1X2H A;  3ENL A;  1JPM A;  1CC6 A;  5U63 A;  3FG2 P;  4E4U A;  3QLD A;  4KPR A;  1VQW A;  1STZ A;  3HYX A;  1TRB A;  2EQ6 A;  2E4G A;  3IC9 A;  3HYW A;  4E5T A;  4IA6 A;  1VG0 A;  1QLB A;  1SJC A;  3R1Z A;  2C4C A;  3CB3 A;  1CC2 A;  2XVE A;  2VVL G;  4A79 A;  2QJM A;  4E4F A;  1S2Y A;  4YWO A;  2B9W A;  4GFI A;  4UP3 A;  1K0L A;  3NT6 A;  3AMZ A;  5EBK A;  1LPF A;  2YLX A;  2YLR A;  4DGK A;  1D5T A;  3ISH A;  2YVJ A;  3N4F A;  4GYP A;  3MQT A;  4G6H A;  1KFY A;  2P8B A;  4ENL A;  1B4V A;  4NTE A;  2BC0 A;  2VRM A;  5KVH A;  4C3Y A;  4H2R A;  1ECQ A;  3U9I A;  2C72 A;  2E5A A;  3ICT A;  3UKQ A;  1OEP A;  1ZKQ A;  4TVW A;  2OLA A;  1EBD A;  2VVM A;  4IHC A;  4E6M A;  3BNM A;  4A65 A;  3OW1 A;  4GDP A;  2C66 A;  3ADA B;  1BZL A;  4JQ9 A;  5C2T A;  2QQ6 A;  1W6T A;  3CNJ A;  4EMW A;  4DX3 A;  2XYO A;  4BJY A;  1TZZ A;  2YG5 A;  5J7X A;  2CVJ A;  2XFQ A;  1BKW A;  3DK8 A;  1RP0 A;  1EC9 A;  3BHF A;  2WET A;  2PTY A;  2BAB A;  3AEG A;  3NG7 X;  4MMW A;  2GMH A;  4B64 A;  3RHA A;  1PBF A;  3D47 A;  4EQR A;  1PXC A;  2BS3 A;  4J34 A;  2YVF A;  3QJ4 A;  2GQW A;  4JNA A;  2XLR A;  1YQ3 A;  2GR2 A;  4ADW A;  4UDQ A;  4GDE A;  3EEZ A;  4H2H A;  2YLS A;  2DW7 A;  4K7Z A;  2Q7V A;  1SJD A;  4RG4 A;  1CC4 A;  3D1C A;  4DSG A;  2VQ7 A;  2WS3 A;  3RED A;  1ELI A;  4ZN0 A;  3GSI A;  1NG4 A;  3IJI A;  2XVI A;  3PS9 A;  4MKS A;  3SM8 A;  3SN0 A;  3BI2 A;  4EM4 A;  2YWL A;  2CDU A;  3ZLF A;  4OPL A;  5L46 A;  1KSS A;  4H83 A;  4HPN A;  2WPF A;  1KD0 A;  3CYJ A;  3SR6 B;  1F8S A;  4BK3 A;  4EMI A;  1TE6 A;  2Z5Y A;  1H84 A;  4U2L A;  1MO9 A;  3QSM A;  3DG3 A;  1MXT A;  2V5Z A;  2XLU A;  4XWR A;  3V3O A;  2OLN A;  1S7M A;  3SN4 A;  2XFN A;  3CIR A;  3GD3 A;  3VA8 A;  3G5S A;  4B63 A;  3UJ2 A;  3AM9 A;  1IUX A;  2R45 A;  3VFC A;  2QJN A;  4U2T A;  4H19 A;  1PDH A;  2BAC A;  4IV9 A;  5FJR A;  2QAE A;  3NK1 X;  3NN6 X;  1DJQ A;  1P2H A;  1VG9 A;  3RP7 A;  3FBS A;  3ICS A;  3NN0 X;  5FJT A;  3LZW A;  5GRT A;  3B6D A;  1LQU A;  3B3R A;  2JKC A;  4K5R A;  3G5Q A;  3OTR A;  3DJG X;  1OJC A;  5GSN A;  1S3B A;  1PDY A;  1F8R A;  3A7R A;  3UGV A;  2VZ2 A;  3SZF A;  4AP1 A;  3VRD B;  3FIM B;  3AYL A;  4NEW A;  2POD A;  1GES A;  3DIP A;  2GQF A;  4OCG A;  4AP3 A;  5KRQ A;  4IZG A;  3EPT A;  3UKF A;  2XH7 A;  1E9I A;  2H89 A;  1YQ4 A;  2ZZC A;  3UXK A;  3GWD A;  1E1M A;  3TW9 A;  4GUV A;  5ER0 A;  5U1O A;  4BV6 A;  1X2G A;  3H8I A;  3T4W A;  2X99 A;  1P2E A;  3DEQ A;  2WDQ A;  1JNR A;  3NRZ B;  3P93 A;  2V3A A;  4PAA A;  4DSH A;  4CBQ A;  3AE2 A;  2Q6U A;  2AAQ A;  2HXU A;  4U8P A;  2YR4 A;  3OZM A;  4BJZ A;  2GB0 A;  3GRT A;  3V76 A;  5JRB A;  1ZMC A;  3H70 A;  3UJF A;  4LA1 A;  2XLT A;  2A8X A;  2ZC8 A;  2OA1 A;  4CNK A;  4ZCC A;  3NVY B;  1RVK A;  1FOH A;  4XWZ A;  3V5C A;  1E39 A;  3HZL A;  3UOZ A;  4ZOH B;  3SN1 A;  3JSK A;  1GEU A;  3AEA A;  1MOK A;  2X8G A;  3UJE A;  3T0K A;  3UJS A;  1EC7 A;  3CTY A;  3Q6J A;  3I3L A;  4EQX A;  2A89 A;  2R4J A;  2YVG A;  3GYI A;  5J04 A;  3COX A;  2X8H A;  2AKZ A;  1FHV A;  4J56 A;  1KNR A;  1F9C A;  3MY9 A;  3ATQ A;  4IL2 A;  1ONE A;  4M0X A;  3BSM A;  5G5G B;  1KKR A;  4A6N A;  4EQW A;  4ECH A;  5CKU A;  4HNC A;  3S5W A;  3NVW B;  2YLT A;  3UKP A;  4Y4N A;  3EAN A;  1SB3 B;  3ES8 A;  1E1L A;  1TDE A;  4G9K A;  4C5O A;  3ZLH A;  5FJU A;  5BOF A;  4IP4 A;  3SZ0 A;  1CBO A;  4TM4 A;  3DJJ A;  2UZZ A;  3NKS A;  3IHM A;  4TM0 A;  4Z26 A;  4D04 A;  3ALL A;  4P9S A;  4A99 A;  2PSN A;  1YEY A;  2PMQ A;  1RYI A;  4IL0 A;  2RGO A;  4JY3 A;  5BUL A;  3TJ4 A;  4CRT A;  1H81 A;  4OPU A;  4HN8 A;  3CPH G;  2BS4 A;  2X50 A;  2VRL A;  4KX6 A;  1F8W A;  4A6N B;  1EBG A;  1CF3 A;  1PJ7 A;  1KKO A;  2XCG A;  1ELS A;  1FEA A;  1CJC A;  3I4K A;  3SFE A;  2WU2 A;  5FS9 A;  3RIT A;  4YSZ A;  2YLZ A;  4X2P A;  3UP5 A;  3AB1 A;  5BUK A;  4USR A;  1GT8 A;  3N6J A;  1E1N A;  2C3C A;  4K1W A;  1DOE A;  4U8J A;  3L8K A;  2OQY A;  1KNP A;  3KPK A;  5IQ4 A;  2BA9 A;  4J3Z A;  4WX1 A;  3GMC A;  1QJD A;  4FDC B;  2X3N A;  3GO2 A;  3QVR A;  4OPD A;  4X4J A;  1VDC A;  4GIS A;  3NNE A;  3F8D A;  1GRF A;  4MJW A;  3D46 A;  1NHP A;  3IJQ A;  3UJR A;  2W3R A;  2WES A;  1D7L A;  4GGB A;  2C70 A;  1K0I A;  3TWA A;  2BCG G;  2V60 A;  3M13 A;  3NK0 X;  2B76 A;  2BK3 A;  3OPS A;  1N5W C;  1CJ4 A;  2GF3 A;  5M0Z A;  4YXD A;  3UTG A;  4K22 A;  4EIQ A;  5J60 A;  4FK1 C;  3GMB A;  4MGG A;  3T31 A;  2RAB A;  4EM3 A;  4OVI A;  3AEB A;  3GYJ A;  4G8T A;  4NEV A;  4DWD A;  2PTX A;  3R25 A;  4JY2 A;  4YTN A;  1NHS A;  1TDN A;  2WOV A;  3U4F A;  1MUC A;  5HHF A;  2E1M A;  3T6C A;  2JBV A;  2V3B A;  3H12 A;  3ITJ A;  2OAL A;  1H83 A;  2PYX A;  1N60 C;  1JRX A;  3DH9 A;  3TCS A;  2B9Y A;  4G7F A;  3B97 A;  3NYC A;  4AOX A;  3VCN A;  4GCM A;  4U8O A;  3UOV A;  1TYP A;  5IDZ A;  1Q9I A;  4HCH A;  3RP6 A;  3CPI G;  2YR5 A;  2GR3 A;  1PDZ A;  3UKH A;  3FVD A;  4LU6 A;  4TM1 A;  4DYE A;  2R0G A;  2FBW A;  3LZX A;  4RSL A;  1VRQ B;  1PBC A;  3KU9 A;  2A87 A;  2DW6 A;  3TOY A;  4J33 A;  4U8L A;  3IWA A;  3NFU A;  4H4V A;  3JW7 A;  3GWF A;  3EUB 3;  5TR3 A;  1FEB A;  4H4Z A;  3MUC A;  2XVJ A;  4JHM A;  1XPQ A;  3P4R A;  1FO4 A;  3MZN A;  1Q1R A;  3UKL A;  2GH5 A;  3AE8 A;  2TPR A;  2BK5 A;  1JRO A;  3FXG A;  2FYM A;  2CUL A;  3K7T A;  1COY A;  2GMJ A;  5KMQ A;  1MNS A;  5KXJ A;  3MKC A;  4H2N A;  2PU1 A;  1NHR A;  2OZ3 A;  3LJP A;  4BUR A;  4YTP A;  2OO6 A;  4JN8 A;  3FV9 A;  3SQP A;  3EAO A;  4M52 A;  1PXB A;  3SYI A;  3UCD A;  1FFU C;  1IUU A;  1H86 A;  3NO1 A;  3T2Z A;  1BGN A;  2O56 A;  3STP A;  3ATR A;  1OJ9 A;  2YM2 A;  2ZBW A;  3LXD A;  2E3T A;  1MDL A;  1H6V A;  2F5Z A;  3DME A;  3R0U A;  4GF7 A;  3JVA A;  1ZY8 A;  3SBF A;  4H4R A;  4A9W A;  3ZVI A;  3PG6 A;  1JRZ A;  2OG9 A;  4AT0 A;  2C73 A;  3AE9 A;  1TDO A;  3MSY A;  2P88 A;  2RGH A;  4HYR A;  2WBA A;  3LB8 A;  3SZC A;  1GND A;  3OZ2 A;  2FJB A;  4J36 A;  3CK5 A;  3SQS A;  4K8D A;  3DK4 A;  4KPL A;  3M12 A;  3BI4 A;  4F4R A;  2C64 A;  3DJE A;  3C4A A;  2R9Z A;  4EMJ A;  1L0V A;  4Z2U A;  4IVM B;  1GTH A;  1RSG A;  2BCP A;  3ABV A;  3NZG A;  3UXL A;  2OX4 A;  5KMS A;  2XVH A;  1IUW A;  3Q9T A;  2XGZ A;  2IVD A;  4H7U A;  1Y0P A;  3VDG A;  3G5R A;  1N4V A;  4NZH A;  5KOX A;  2HZG A;  5JCK A;  3T8Q A;  5EOW A;  4HB9 A;  4YSY A;  2W0H A;  1CJ2 A;  4B69 A;  1N5X A;  1N4U A;  5FJO A;  3ALM A;  1OJA A;  1KDG A;  2EQ9 A;  4GIR A;  4GAP A;  2HXT A;  2JK6 A;  5BVA A;  4O5Q A;  3UCL A;  1LJ1 A;  3CT2 A;  3CXO A;  5JCL A;  5ENL A;  1PBB A;  3I6E A;  5KWF A;  3ZYX A;  1KF6 A;  2R4E A;  3LAD A;  1N61 C;  1EL5 A;  3VR8 A;  4NNJ A;  5HY5 A;  2W55 A;  2Y6Q A;  3CGE A;  4H4Q A;  4RG3 A;  3F8P A;  1K4Q A;  1P48 A;  1QO8 A;  1LVL A;  2C7G A;  3GY1 A;  1NAA A;  3MWC A;  2HNE A;  1EBH A;  3GRS A;  1PN0 A;  3LOV A;  3NLC A;  1N63 C;  3C96 A;  3SY4 A;  4EWJ A;  3FMW A;  2QA1 A;  1M64 A;  5JCM A;  2VQB A;  4TVY A;  1HYU A;  3DG7 A;  1ZXI C;  2PTW A;  1CL0 A;  2BYB A;  1O5W A;  2PP1 A;  4H4Y A;  3QTP A;  2PP3 A;  4Y4L A;  1Q1W A;  3H7V A;  1FCD A;  3T2Y A;  4DHG A;  3M0O A;  1EL7 A;  4X9N A;  3FCP A;  1FFV C;  3TQP A;  2RDX A;  2PS2 A;  1VDV A;  1XS2 A;  4OPC A;  1ONF A;  3N4E A;  3DGB A;  5FS6 A;  3NH3 X;  2XVF A;  4APN A;  3Q4D A;  4H2Q A;  4H4U A;  3ZVH B;  1ZMD A;  3PO7 A;  1T3Q C;  4G73 A;  4U2S A;  3ICR A;  2PTZ A;  4Z43 A;  2O9Z A;  1R0M A;  3KD9 A;  3K30 A;  2BRA A;  2WDV A;  4J31 A;  1JCT A;  2NQL A;  3AE3 A;  2GGG A;  4AT2 A;  5FJP A;  4CCQ A;  3AE5 A;  2C67 A;  2ZZB A;  3SXI A;  3AN1 A;  1KSU A;  3UOY A;  3V3N A;  3L5O A;  2XH4 A;  1E7P A;  1BF3 A;  2BXS A;  1ZOV A;  1GTE A;  2I5Q A;  4IP5 A;  3IF9 A;  4CY8 A;  2AKM A;  1NEN A;  1ZOY A;  4CNJ A;  1R6W A;  2XFO A;  4ICY A;  4Z24 A;  1D4E A;  3KKJ A;  2YQU A;  1L9C A;  3AD7 B;  4I59 A;  4WCT A;  3WE0 A;  1N62 C;  3KVE A;  3NHO X;  4TLZ A;  1WUE A;  4HCL A;  1TYT A;  3SGL A;  3DGH A;  2B7R A;  2OZ8 A;  2GV8 A;  2Q0K A;  4UDR A;  1H7X A;  4BK1 A;  2GAH B;  1BGJ A;  3UTF A;  2NPX A;  4DNA A;  3CNS A;  4NTD A;  4E8G A;  2MNR A;  3ZLG A;  2GRT A;  3VR9 A;  1P43 A;  1UKV G;  5BOE A;  2ONE A;  2PPG A;  1FEC A;  2ZZ0 A;  1D4C A;  1DOC A;  1DJN A;  2J3N A;  4OPI A;  3DK9 A;  3P3B A;  4BK2 A;  2XFP A;  2XLP A;  3RGT A;  2OPJ A;  4GYP C;  3VRB A;  1NEL A;  1K0J A;  2OVL A;  2PA6 A;  1FHU A;  5EB4 A;  3RCY A;  1CJ3 A;  3PWI A;  1IUS A;  2Z5X A;  3RP8 A;  3CGB A;  3DGZ A;  3AEC A;  5HXI A;  1GER A;  1FL2 A;  2W54 A;  2V61 A;  3HW2 A;  2X8C A;  1SJB A;  2YM1 A;  4YSH A;  1YQZ A;  6ENL A;  4Z44 A;  1O95 A;  1MDR A;  3CPJ G;  1L9E A;  4IA5 A;  3AE7 A;  4J2W A;  4H4S A;  5KMP A;  2B7S A;  4U8K A;  3QVP A;  3AE1 A;  1DOD A;  4G74 A;  3D9X A;  3NGC X;  1DTN A;  1V97 A;  4JDR A;  3P9U A;  2C3D A;  4IT1 A;  5M10 A;  3PWG A;  4JN7 A;  4GME A;  1PJ6 A;  5DBJ A;  3K7Q X;  1CHU A;  3AD9 B;  3NVV B;  3T14 A; 
#chains in the Genus database with same CATH homology
 1Y56 B;  1H6V A;  2F5Z A;  3DME A;  4OCG A;  4AP3 A;  5KRQ A;  3PVC A;  1NDA A;  3AWI A;  4GF7 A;  1ZY8 A;  4H4R A;  4A5L A;  4A9W A;  1REO A;  2WQY A;  3EPT A;  3UKF A;  1JRZ A;  3PG6 A;  2GVC A;  2PHH A;  4H4W A;  4II3 A;  3AYI A;  3UTH A;  3UTE A;  4AT0 A;  2EQ8 A;  2C73 A;  1GRT A;  2R46 A;  1JNZ A;  2C65 A;  2RGJ A;  2WU5 A;  2H89 A;  1YQ4 A;  5FS7 A;  4GR1 A;  3AE9 A;  2ZZC A;  1GXF A;  1TDO A;  4CY6 A;  3GWD A;  2XLS A;  1E1M A;  4GUV A;  5ER0 A;  5LV9 A;  2RGH A;  5U1O A;  3AE6 A;  3AED A;  2GR0 A;  4BV6 A;  2JAE A;  3H8I A;  3P4P A;  2WBA A;  3LB8 A;  2X99 A;  4UDP A;  1GND A;  3SZC A;  2GR1 A;  2NVK X;  1XAN A;  1P2E A;  3OZ2 A;  1B5Q A;  1JRY A;  2FJB A;  4YT0 A;  5KNL A;  4J36 A;  3NYE A;  4C74 A;  2WDQ A;  1IUV A;  1JNR A;  3GDN A;  4K8D A;  4D03 A;  2V3A A;  4PAA A;  3DK4 A;  3ZDN A;  4DSH A;  3HYV A;  3M12 A;  4CBQ A;  3BI4 A;  5FMH A;  2C64 A;  3QFA A;  3AE2 A;  3CNP A;  3DJE A;  2Q6U A;  3GD4 A;  3C4A A;  2VVL A;  2R9Z A;  1XHC A;  2AAQ A;  4EMJ A;  1L0V A;  3QSE A;  4Z2U A;  2GEW A;  4U8P A;  1ZX9 A;  4IVM B;  2YR4 A;  4XXG A;  3VRA A;  4B65 A;  4BJZ A;  2GB0 A;  3GRT A;  4B1B A;  3V76 A;  1GTH A;  1YY5 A;  1RSG A;  2GAG B;  4JN9 A;  4NWZ A;  2BCP A;  5JRB A;  1L9D A;  4B68 A;  4FX9 A;  3ABV A;  1ZMC A;  1D4D A;  4LA1 A;  5KMS A;  2XVH A;  4EIP A;  1S2Q A;  4H4T A;  2HQM A;  1IUW A;  2XLT A;  1KN0 A;  5KVI A;  2A8X A;  1GAL A;  2OA1 A;  4X9M A;  4CNK A;  2XFU A;  5U25 A;  3Q9T A;  1GRA A;  4ZCC A;  2IVD A;  4H7U A;  2Y6R A;  1AOG A;  5J60 A;  4REK A;  3RNM A;  4A7A A;  2WPC A;  4FK1 A;  4C3X A;  1Y0P A;  1FOH A;  3P4S A;  4XWZ A;  3G5R A;  1N4V A;  1W4X A;  4NZH A;  5HYM A;  1E39 A;  2CFY A;  4PAB A;  3HZL A;  2BC1 A;  1EL8 A;  3NTA A;  3DA1 A;  4HA6 A;  3UOZ A;  5KOX A;  1DXL A;  2AR8 A;  1ZK7 A;  1ZDL A;  5JCK A;  3JSK A;  5EOW A;  4N9X A;  1GEU A;  1NPX A;  3URH A;  3AEA A;  1MOK A;  2W0H A;  2X8G A;  1CJ2 A;  3AYJ A;  4HB9 A;  4B69 A;  2WHD A;  4YSY A;  2WP6 A;  3NIX A;  5KOW A;  1N4U A;  4YSX A;  3SX6 A;  3ALM A;  1GPE A;  1OJA A;  1KDG A;  3SFD A;  2EQ9 A;  3T0K A;  4GAP A;  1PXA A;  2YAU A;  1TDK A;  2JK6 A;  1IUT A;  3Q6J A;  3CTY A;  1F6M A;  3I3L A;  4O5Q A;  3UCL A;  4YKG A;  4EQX A;  2A89 A;  5EB5 A;  1LJ1 A;  2R4J A;  3BI5 A;  4H4P A;  2YVG A;  3GYI A;  3T37 A;  1PHH A;  3COX A;  2X8H A;  3QFB A;  5JCL A;  4J56 A;  1PBB A;  1KNR A;  2BS2 A;  5KWF A;  3ATQ A;  3II4 A;  3ZYX A;  1GV4 A;  1KF6 A;  2R4E A;  3LAD A;  3QSS A;  1EL5 A;  1BWC A;  5KMR A;  3VR8 A;  3P4Q A;  3CNT A;  4NNJ A;  5HY5 A;  1E6E A;  2XDO A;  4USQ A;  2Y6Q A;  4A6N A;  5IPY A;  3CGE A;  2FJD A;  3UKA A;  4EQW A;  4ECH A;  2YLW A;  1Z6L A;  3C4N A;  4I58 A;  5CKU A;  3S5W A;  4H4Q A;  2YLT A;  3UKP A;  1CC6 A;  4RG3 A;  2YG7 A;  4Y4N A;  4H50 A;  3F8P A;  5U63 A;  3KA7 A;  1GOS A;  3EAN A;  1K4Q A;  3FG2 P;  4KPR A;  1QO8 A;  1H7W A;  1OJT A;  1LVL A;  2C7G A;  1VQW A;  1E1L A;  1TDE A;  3SZW A;  4G9K A;  3HYX A;  4C5O A;  3GYX A;  1NAA A;  1TRB A;  2EQ6 A;  2VOU A;  2E4G A;  3IC9 A;  3HYW A;  4IA6 A;  3I6D A;  4O5U A;  1VG0 A;  3SZ0 A;  1SEZ A;  1CBO A;  4TM4 A;  5C3J A;  3DJJ A;  5JCN A;  2UZZ A;  3NKS A;  2I0Z A;  2Q0L A;  4U8M A;  3GRS A;  1QLB A;  1PN0 A;  2ACZ A;  3LOV A;  3IHM A;  3NLC A;  4TM0 A;  4Z26 A;  2C4C A;  2JB3 A;  1CC2 A;  2XVE A;  4A79 A;  2VVL G;  4D04 A;  3ALL A;  2YG3 A;  3C96 A;  3SY4 A;  3FMW A;  1S2Y A;  4P9S A;  4YWO A;  4A99 A;  4LII A;  2QA1 A;  1M64 A;  2B9W A;  3L1R A;  5JCM A;  2VQB A;  1K0L A;  4UP3 A;  2EQ7 A;  3NT6 A;  1HYU A;  5EBK A;  1RYI A;  2RGO A;  3AE4 A;  4G6G A;  3S61 A;  4JY3 A;  1LPF A;  2YLX A;  5BUL A;  2YLR A;  4DGK A;  4CRT A;  1GET A;  1D5T A;  1H81 A;  2YVJ A;  1CL0 A;  3ISH A;  4OPU A;  2BYB A;  3GDP A;  3F8R A;  1O5W A;  3CPH G;  3NTD A;  4H4Y A;  4G6H A;  2BS4 A;  4Y4L A;  1Q1W A;  1KFY A;  2X50 A;  1FCD A;  1B4V A;  2VRL A;  3T2Y A;  4KX6 A;  4NTE A;  2BC0 A;  2VRM A;  5KVH A;  4C3Y A;  1F8W A;  4H2R A;  2TMD A;  3K7M X;  3M0O A;  4A6N B;  1EL7 A;  1CF3 A;  1PJ7 A;  2ARD A;  1B37 A;  4X9N A;  2C72 A;  2XCG A;  4Z2T A;  3ICT A;  1FEA A;  1F3P A;  3UKQ A;  4OPG A;  4AOS A;  1CJC A;  1ZKQ A;  2C75 A;  4OPC A;  4YKF A;  1EBD A;  3SFE A;  2FJE A;  1ONF A;  2WU2 A;  2VVM A;  4Y4M A;  5FS9 A;  4YSZ A;  5FS6 A;  2YLZ A;  1JOA A;  2WOI A;  3BNM A;  3CMM A;  3UP5 A;  4A65 A;  3AB1 A;  3AD8 B;  5BUK A;  4II2 A;  4USR A;  1GT8 A;  2XVF A;  2BK4 A;  3NH3 X;  3AEF A;  4APN A;  4GDP A;  1N4W A;  2C66 A;  4H2Q A;  2WDR A;  4H4U A;  3PO7 A;  1ZMD A;  1E1N A;  4G73 A;  2JB1 A;  1BZL A;  2C3C A;  4JQ9 A;  3ADA B;  5C2T A;  4TM3 A;  4U2S A;  1DOE A;  3CNJ A;  3ICR A;  3L8K A;  4U8J A;  1KNP A;  3KPK A;  4EMW A;  5IQ4 A;  4Z43 A;  2BA9 A;  1IJH A;  4WX1 A;  3GMC A;  1QJD A;  2XYO A;  3NYF A;  4FDC B;  4BJY A;  2O9Z A;  3H8L A;  3KD9 A;  2X3N A;  3K30 A;  1GRE A;  3QVR A;  4OPD A;  4X4J A;  1VDC A;  2YG5 A;  1S3E A;  5J7X A;  2BRA A;  2CVJ A;  2WDV A;  1BKW A;  2XFQ A;  4J31 A;  3DK8 A;  1RP0 A;  3NNE A;  3AE3 A;  2DKH A;  1V59 A;  3CGC A;  1B8S A;  3F8D A;  3BHF A;  4U8N A;  2IVE A;  1GRF A;  2WET A;  3O0H A;  4MJW A;  1NHP A;  4AT2 A;  4CCQ A;  3AE5 A;  2C67 A;  2ZZB A;  2BAB A;  3SXI A;  3AEG A;  2WES A;  3NG7 X;  1GSN A;  1D7L A;  2GMH A;  2C70 A;  4B64 A;  1KSU A;  1K0I A;  3UOY A;  2BCG G;  2V60 A;  1PBF A;  2YG6 A;  3M13 A;  3RHA A;  3V3N A;  3VQR A;  3NK0 X;  3L5O A;  4EQR A;  1X31 B;  1PXC A;  1E7P A;  2B76 A;  2BK3 A;  2BS3 A;  5FS8 A;  4J34 A;  2YVF A;  1BF3 A;  2GQW A;  3QJ4 A;  2BXS A;  1ZOV A;  1CJ4 A;  2WPE A;  1GTE A;  2GF3 A;  4JNA A;  5M0Z A;  3UTG A;  4K22 A;  4YXD A;  4EIQ A;  2XLR A;  3IF9 A;  4CY8 A;  1PJ5 A;  1YKJ A;  1YQ3 A;  3GMB A;  4FK1 C;  4TLX A;  5IQ1 A;  2RAB A;  3NK2 X;  2GR2 A;  3T31 A;  4Z2R A;  5BRT A;  1D7Y A;  3H4K A;  4ADW A;  4EM3 A;  4OVI A;  4UDQ A;  1NEN A;  4GDE A;  1ZOY A;  2IID A;  3AEB A;  3BNU A;  3GYJ A;  4CNJ A;  4NEV A;  2XFO A;  4ICY A;  2YLS A;  1M6I A;  4K7Z A;  2Q7V A;  2WP9 A;  4JY2 A;  4RG4 A;  4Z24 A;  4YTN A;  3E1T A;  1NHS A;  1TDN A;  2WOV A;  1CC4 A;  1D4E A;  3KKJ A;  1OJD A;  3FPZ A;  2YQU A;  1L9C A;  1EL9 A;  1LV0 A;  3D1C A;  3AD7 B;  4DSG A;  2R0P A;  2VQ7 A;  2WS3 A;  4I59 A;  5HHF A;  4WCT A;  4CCR A;  2E1M A;  3RED A;  3P1W A;  4B66 A;  3WE0 A;  3AEE A;  1ELI A;  2JBV A;  2V3B A;  3NRN A;  4U8I A;  4YTM A;  3KVE A;  4ZN0 A;  3UP4 A;  3NHO X;  4TLZ A;  3ITJ A;  2OAL A;  3GSI A;  1NG4 A;  2OAM A;  5BVA A;  2XVI A;  1H83 A;  2PYX A;  3PS9 A;  1TYT A;  3DJD A;  1JU2 A;  3SGL A;  1JRX A;  3DH9 A;  2DKI A;  1PBE A;  3SM8 A;  2B9X A;  1O94 A;  3BI2 A;  3DGH A;  4EM4 A;  2B7R A;  5JCI A;  4J57 A;  2APG A;  2OLO A;  2YWL A;  2GV8 A;  2CDU A;  2Q0K A;  2B9Y A;  4IVO B;  4OPL A;  4UDR A;  1H7X A;  4BK1 A;  4ZCD A;  2GAH B;  2V6O A;  1BGJ A;  3UTF A;  2NPX A;  5L46 A;  3NYC A;  4AOX A;  4DNA A;  3CNS A;  4NTD A;  4NTC A;  1KSS A;  1GRH A;  4GCM A;  4U8O A;  3UOV A;  4OPT A;  2GRT A;  3VR9 A;  1TYP A;  1TDF A;  1Q9I A;  3RP6 A;  4EQS A;  3CPI G;  1UKV G;  2WPF A;  1F8S A;  2YR5 A;  1NEK A;  2BRY A;  2GR3 A;  4BK3 A;  4EMI A;  2FJA A;  3UKH A;  1FEC A;  2E5V A;  1N1P A;  2Z5Y A;  4LU6 A;  2ZZ0 A;  1D4C A;  1H84 A;  1DOC A;  1DJN A;  4TM1 A;  4B67 A;  2J3N A;  1PS9 A;  4K2X A;  4OPI A;  4U2L A;  3DK9 A;  2R0G A;  3R9U A;  2FBW A;  3LZX A;  1MO9 A;  4RSL A;  4BK2 A;  1VRQ B;  2C76 A;  2XFP A;  3KPF A;  1PBC A;  3QSM A;  2R0C A;  2XLP A;  1LTX R;  1MXT A;  2V5Z A;  2XLU A;  4XWR A;  3V3O A;  2OLN A;  4C77 A;  1S7M A;  2H88 A;  2XFN A;  2QCU A;  3CIR A;  3GD3 A;  3KLJ A;  3KU9 A;  2A87 A;  4J33 A;  3VRB A;  3G5S A;  4U8L A;  1GRG A;  3OC4 A;  1K0J A;  3IWA A;  3T2K A;  3IHG A;  4B63 A;  4H4V A;  3GWF A;  5EB4 A;  2AQJ A;  5TR3 A;  1FEB A;  4H4Z A;  1IUX A;  1CJ3 A;  2R45 A;  4GAV A;  1IUS A;  2Z5X A;  2XVJ A;  3RP8 A;  3CGB A;  3DGZ A;  3AEC A;  4U2T A;  1XPQ A;  3P4R A;  1PDH A;  1E1K A;  2BAC A;  3AXB A;  5HXI A;  1GER A;  4IV9 A;  1JEH A;  1Q1R A;  3UKL A;  1FL2 A;  2GH5 A;  2JB2 A;  1H2I A;  2QAE A;  3NK1 X;  3CGD A;  4JNQ A;  3NN6 X;  2V61 A;  2TPR A;  3AE8 A;  2BK5 A;  1DJQ A;  3K7T A;  2CUL A;  1Y56 A;  1COY A;  2YR6 A;  2X8C A;  2GMJ A;  2WEU A;  5KMQ A;  2YM1 A;  1P2H A;  1VG9 A;  2QA2 A;  1YQZ A;  3FBS A;  3RP7 A;  4YSH A;  5KXJ A;  3ICS A;  3NN0 X;  4H2N A;  4Z44 A;  1NHQ A;  1O95 A;  3CPJ G;  1NHR A;  1L9E A;  4K5S A;  4IA5 A;  3AE7 A;  3LJP A;  4J2W A;  4BUR A;  5GRT A;  3LZW A;  4YTP A;  1DOB A;  3B6D A;  1DNC A;  2BXR A;  3CND A;  1LQU A;  1NG3 A;  1PBD A;  4E0V A;  4H4S A;  3B3R A;  2JKC A;  3SQP A;  3CN8 A;  3G5Q A;  4K5R A;  2WOW A;  5KMP A;  3DJG X;  3EAO A;  4M52 A;  3D8X A;  1PXB A;  2B7S A;  4U8K A;  3SYI A;  3QVP A;  5CQF A;  3AE1 A;  1DOD A;  1LQT A;  4G74 A;  3D9X A;  4H2P A;  1OJC A;  1H82 A;  5GSN A;  1IUU A;  1S3B A;  1ZP0 A;  3ALJ A;  3NGC X;  1H86 A;  4JDR A;  4GRT A;  1F8R A;  3P9U A;  4Z25 A;  2YG4 A;  3EF6 A;  2C3D A;  2VZ2 A;  1XDI A;  3T2Z A;  3SZF A;  1BGN A;  3BHK A;  5M10 A;  4AP1 A;  3ATR A;  4H4X A;  1OJ9 A;  1PJ6 A;  3VRD B;  2WP5 A;  2YM2 A;  3UOX A;  5DBJ A;  2ZBW A;  3FIM B;  3LXD A;  3K7Q X;  1CHU A;  3AYL A;  4NEW A;  3AD9 B;  3T14 A;  1GES A;  3UKK A;  2GQF A;  1GRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...