3O0HA

Crystal structure of glutathione reductase from bartonella henselae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
460
structure length
455
Chain Sequence
SFDFDLFVIGSGSGGVRAARLAGALGKRVAIAEEYRIGGTCVIRGCVPKKLYFYASQYAQEFSKSIGFGWKYADPIFNWEKLVAAKNKEISRLEGLYREGLQNSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNIKGSDLCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQVQSTENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFETTPDYDLITTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESRIVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSYVYENGEKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutathione reductase
publication title Crystal structure of glutathione reductase from Bartonella henselae
rcsb
source organism Bartonella henselae
total genus 145
structure length 455
sequence length 460
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3o0hA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA02
1NENA 2WPFA 1ZOYA 3CNDA 5HY5A 2B9YA 2EQ6A 5FS7A 3GDPA 4C3YA 1YY5A 2BS3A 3QJ4A 1LV0A 4XXGA 4H4VA 4KPRA 3CIRA 3NTAA 2GB0A 1L0VA 2BYBA 5J7XA 2E4GA 2O9ZA 2V60A 2I0ZA 1GXFA 2WBAA 2AR8A 2WOVA 4H4WA 3PS9A 2Y6QA 3DJJA 2YLXA 3UTHA 3KA7A 1S3BA 1DOEA 1VDCA 2GQFA 2OLNA 4JNAA 2XCGA 5JCMA 4I59A 2TPRA 3NK1X 2YR6A 4PABA 2WDQA 3RP8A 4K5SA 3CGEA 4U8LA 2R46A 2B9WA 3II4A 4Z24A 3CPIG 2BACA 4I58A 4UDPA 3CNSA 1GSNA 1H81A 2V61A 5LV9A 4DGKA 4K2XA 5KVIA 4J34A 2C3CA 3CPHG 2R4JA 1S2QA 3DA1A 4CNJA 4U8PA 1JRZA 2OALA 2XDOA 3BI5A 1LPFA 2FBWA 2WU2A 2YAUA 4EMIA 4K8DA 4Y4MA 3UKKA 4JY2A 1O94A 2B76A 3K7TA 1GESA 3AE1A 3SM8A 4IVMB 2TMDA 1PDHA 2OLOA 4H2RA 1OJDA 4AOSA 1ZMCA 4J2WA 2BA9A 5GRTA 2EQ7A 4WCTA 3CGBA 3JSKA 1TYPA 2YLWA 2X3NA 2BK5A 5EOWA 2BXSA 3DK9A 2W0HA 3AEBA 3C4AA 4NZHA 3FIMB 1NEKA 1W4XA 2HQMA 3LADA 2VRMA 4NTCA 2WP6A 2J3NA 5JCIA 3BHKA 3LZWA 4A65A 5HYMA 3K30A 4XWRA 3DK8A 2YM1A 2RGHA 1JU2A 1K0IA 5CQFA 4IVOB 2JB2A 2WHDA 3BNMA 1H86A 1IJHA 4TLXA 2H89A 1ZY8A 3UCLA 3GMCA 2YLRA 1XDIA 1IUVA 3NNEA 4BJZA 4D03A 1EL8A 2B7RA 1SEZA 2XFPA 2VVLA 4ECHA 4EIPA 2XFUA 3FMWA 3GMBA 3LXDA 3HZLA 1VQWA 2RGJA 5BRTA 4ZN0A 1KNPA 2QAEA 3V3NA 1O95A 4C74A 4FK1C 3ICRA 1CJ2A 3CNPA 3ALLA 4OCGA 3UKHA 2H88A 3S5WA 5BULA 3K7MX 1QLBA 1UKVG 4B1BA 3ZYXA 1ELIA 1KSUA 4ICYA 3QSSA 1PXAA 4J31A 3C4NA 4YSZA 1NPXA 2GF3A 2WU5A 4IA5A 5IQ4A 3AEDA 3H4KA 4Z43A 2EQ9A 2JBVA 3AEAA 1K4QA 4LA1A 1Q1WA 4Z2TA 2XVIA 3IC9A 2RGOA 3RP7A 1DODA 3F8RA 2EQ8A 2WEUA 3FPZA 3SFEA 2Y6RA 5L46A 3NN6X 2WOWA 3V76A 4Z44A 2WP9A 1GERA 2BXRA 4H4RA 3G5RA 3WE0A 4A6NA 3UOXA 4OPIA 4TM0A 4EQWA 1TDFA 1GRAA 4CRTA 5U63A 4GUVA 3L8KA 1N1PA 4JY3A 2AAQA 3CGCA 2E5VA 3AE8A 2UZZA 4NTDA 1GRGA 1CHUA 3NGCX 4CBQA 2GVCA 4Z2UA 3M12A 4Y4NA 1D4EA 2WDRA 1PJ6A 2V6OA 3AYIA 4UP3A 3UOZA 1L9CA 4B69A 4ADWA 4AT0A 3AE4A 4RG3A 1ZX9A 4U8NA 4YSHA 1MO9A 5M0ZA 3VRDB 5BVAA 1TDEA 2C67A 1PBBA 4JNQA 3UKPA 3RP6A 1JRYA 5U25A 4EIQA 2YG4A 1FOHA 2GR2A 3B3RA 2GR3A 2WESA 4GF7A 4Y4LA 3NLCA 4HA6A 1MOKA 1IUTA 2DKIA 4OVIA 4AOXA 4OPCA 4D04A 1GV4A 1OJAA 1KNRA 2IIDA 2VQBA 3LZXA 2B9XA 4TM4A 3Q6JA 4H2PA 1BGNA 2VVLG 3ADAB 3AEGA 3AE6A 3NG7X 2WP5A 1K0JA 3SGLA 2GQWA 4K5RA 3DJEA 1LJ1A 4TM3A 2APGA 1EL9A 3GRSA 5C3JA 1GREA 1DOCA 3AEFA 3UTFA 2BK4A 2R9ZA 4OPUA 4M52A 3CNJA 1D7LA 3FG2P 5ER0A 1PN0A 3NYCA 1ZDLA 1JRXA 2WDVA 1PXBA 2YG3A 3DK4A 3M0OA 4BJYA 1TDNA 4BK3A 1VRQB 2VZ2A 1E6EA 5KOXA 3UKFA 2CDUA 3Q9TA 1N4VA 3CPJG 3H8LA 1RSGA 1COYA 5HXIA 4U2TA 1HYUA 3GWDA 4AT2A 1F3PA 4OPGA 3ICTA 3KPFA 4UDRA 2WOIA 1H82A 2C66A 2YR4A 4K22A 5DBJA 4H4SA 2X8HA 1Z6LA 2C73A 2A89A 3F8PA 1GRBA 1ZK7A 2YG7A 2V3BA 2R0GA 2GRTA 3EAOA 1RP0A 2GV8A 2XVHA 4CCRA 1KF6A 3KKJA 3KU9A 1OJTA 2DKHA 2OAMA 1B4VA 2YLZA 1FEAA 1H7XA 3BI2A 4NTEA 4YWOA 1PBEA 1IUUA 4JN9A 1L9DA 1GRFA 3UOVA 4H4XA 3IHGA 3VR8A 4EQSA 1PS9A 2Q7VA 3ALJA 3VQRA 1D4CA 3O0HA 4LU6A 3AYJA 3E1TA 3UOYA 4A99A 4DSGA 2C75A 2C7GA 1CC2A 3CGDA 1REOA 2IVEA 4A9WA 3I6DA 1S3EA 3ABVA 4YKFA 2JKCA 4EM4A 1IUSA 1NG3A 1ZKQA 2QA2A 1PBFA 4K7ZA 2YVGA 1BWCA 3ATRA 3UTEA 3DH9A 4A5LA 1PBCA 2A87A 1D4DA 1LVLA 4MJWA 1VG0A 3EPTA 3P1WA 1GRTA 3D1CA 3VRAA 5KXJA 2RABA 2OA1A 3NRNA 4H2QA 4RSLA 4U8MA 1BKWA 3EF6A 5FS9A 2YLTA 2YVFA 3AE9A 3AYLA 1QJDA 1VG9A 4GDPA 4J36A 1PJ7A 4USRA 4AP3A 4YSYA 1LQTA 3AEEA 4YKGA 2BK3A 1OJ9A 5FS8A 2X99A 3URHA 1E1MA 2YR5A 5M10A 4H4YA 3OC4A 3P9UA 3ITJA 2GMHA 3CTYA 2F5ZA 1F6MA 2YG5A 1H6VA 3AE3A 3KD9A 3NHOX 1PBDA 3LB8A 2BCPA 4DNAA 3AE2A 2JB1A 1LTXR 3NYFA 1QO8A 3UP4A 2YLSA 3DGHA 4EMJA 5TR3A 4LIIA 4B67A 4U8OA 2Z5YA 2ZZ0A 3OZ2A 1S2YA 4WX1A 4EQRA 2BS2A 3P4PA 2XLPA 1PJ5A 1H84A 3IF9A 2ZZCA 3IWAA 3QSEA 3D8XA 1LQUA 3AECA 1Y56B 4B64A 4ZCCA 2YWLA 1GRHA 2X8CA 2FJDA 3NTDA 1ONFA 4GRTA 3QVPA 3AE5A 1Q9IA 3QSMA 1CL0A 4NEVA 3PVCA 1H7WA 1NAAA 3GRTA 1DNCA 3NH3X 1YKJA 1ZMDA 4EMWA 1AOGA 1YQ3A 2R45A 4H4ZA 4H4PA 3S61A 1CBOA 2B7SA 4OPLA 1TYTA 4H4UA 4EM3A 2BCGG 2C70A 3FBSA 4YXDA 4YTMA 4EQXA 1CJCA 2WETA 1YQ4A 4BURA 1DJQA 3G5SA 4U8IA 1GOSA 2Q0LA 4U8KA 2PHHA 1E39A 3GD4A 5U1OA 3COXA 4B63A 4YTPA 4P9SA 3AD9B 4X4JA 4FK1A 2C65A 4B66A 2C3DA 2CVJA 1NHRA 1XHCA 3GDNA 2WPEA 2BS4A 2A8XA 2VQ7A 1E7PA 1KFYA 2Z5XA 3KLJA 2YQUA 1K0LA 2XFNA 2NVKX 1L9EA 3AWIA 1PXCA 4YTNA 1KDGA 1KSSA 3NIXA 1FEBA 4CNKA 1Q1RA 1P2HA 4RG4A 3P4QA 4H4QA 3AE7A 1E1KA 3ISHA 5CKUA 2R4EA 3LOVA 1BZLA 2XVEA 1GNDA 4GCMA 1CC4A 1FL2A 3NT6A 4TM1A 1NG4A 2QA1A 3RHAA 2V5ZA 4OPTA 4AP1A 1TRBA 3AB1A 3REDA 2C76A 4U2SA 3NK0X 5JCLA 5EBKA 1GTHA 3NYEA 2GEWA 1BGJA 2GR1A 2FJBA 3UKQA 2XLTA 3VR9A 4N9XA 4JDRA 3C96A 3QVRA 1GEUA 1NHPA 1ZP0A 3RNMA 3UKLA 3V3OA 3EANA 4BK1A 1GALA 4JQ9A 2BC0A 1E1NA 2XYOA 2X8GA 2YVJA 1TDKA 3B6DA 1V59A 2IVDA 2ZBWA 2XFOA 3AD8B 2Q0KA 4H4TA 2XLUA 2XVFA 3CNTA 3NN0X 3AXBA 4IV9A 3VRBA 4BV6A 1RYIA 3KVEA 4FX9A 1NHSA 4YT0A 4B65A 2YG6A 4Z26A 2C64A 4FDCB 1EL5A 3I3LA 3LJPA 1X31B 4U2LA 3T37A 3UTGA 1NDAA 5C2TA 2XFQA 2JAEA 3L1RA 2GMJA 1ZOVA 3SFDA 5EB5A 2AQJA 2WQYA 1D5TA 2CULA 3GYIA 5KRQA 4J57A 4O5QA 2BC1A 2GR0A 4J33A 2XLSA 3UP5A 2JK6A 5FS6A 3UKAA 1CJ3A 1IUWA 4TLZA 4X9NA 1Y0PA 5EB4A 4X9MA 2Q6UA 2QCUA 4U8JA 4O5UA 3F8DA 4H50A 2V3AA 3ATQA 5IPYA 5KWFA 2JB3A 3DGZA 3PO7A 3QFBA 2VRLA 4IA6A 2ACZA 1TDOA 2FJEA 1DXLA 4J56A 1N4WA 4DSHA 1B5QA 1XPQA 2BABA 2ARDA 2GH5A 4BK2A 3DMEA 2XVJA 1H83A 3BHFA 3GWFA 5JCKA 1B8SA 2NPXA 1YQZA 1EL7A 2GAHB 3CN8A 1DOBA 3P4RA 4OPDA 5GSNA 1JEHA 4C3XA 2XLRA 3GSIA 3ICSA 4CY8A 1GT8A 1CJ4A 2CFYA 1E1LA 3ZDNA 4YSXA 4B68A 3BNUA 4CCQA 4H7UA 2VVMA 2WS3A 3DJDA 4USQA 4REKA 4XWZA 1CC6A 1M64A 1Y56A 1BF3A 5JCNA 2VOUA 4Z2RA 1F8WA 1PHHA 4KX6A 1M6IA 1B37A 4E0VA 3M13A 4GDEA 4PAAA 3SQPA 2YM2A 2PYXA 1DJNA 3K7QX 1EBDA 4CY6A 1FECA 3NKSA 1D7YA 4UDQA 2X50A 1MXTA 1F8SA 3NK2X 2E1MA 2R0CA 3GYJA 2C72A 3DJGX 3H8IA 4A79A 5KOWA 1JOAA 4HB9A 2ZZBA 3ALMA 3R9UA 1GETA 4GR1A 5FMHA 1FCDA 2GAGB 3AD7B 1JNRA 1OJCA 1O5WA 1P2EA 4A7AA 4ZCDA 3IHMA 2R0PA 1XANA 2WPCA 1IUXA 1F8RA 2FJAA 3BI4A 4APNA 5IQ1A 5J60A 4A6NB 4NEWA 5HHFA 5BUKA 4C5OA 3QFAA 1NHQA 1JNZA 3G5QA 4C77A 4Z25A 1N4UA 1GPEA 4H2NA 3P4SA 1GTEA 3GD3A 1CF3A 5KVHA
chains in the Genus database with same CATH superfamily
1NENA 4K1WA 5FS7A 3IJQA 2O56A 1YY5A 3QJ4A 2BYBA 1SJAA 2I0ZA 1GXFA 2Y6QA 2PGWA 4IZGA 1S3BA 3V5CA 2QVHA 2P88A 3HPFA 3H8AA 3V4BA 3CGEA 2R46A 4Z24A 2W55A 3CPIG 2BACA 2V61A 5KVIA 3CPHG 2R4JA 1S2QA 2PP0A 1JRZA 2OALA 3BI5A 2WU2A 4EMIA 3SM8A 1JPDX 2TMDA 3CGBA 1TYPA 4KPLA 3TJIA 3AEBA 3C4AA 4NZHA 4G74A 2VRMA 2J3NA 1OEPA 4A65A 4XWRA 3OP2A 2YM1A 2RGHA 3PK7A 2JB2A 2WHDA 3CK5A 4TVWA 2YLRA 4BJZA 3FMWA 3QPEA 3LXDA 2RGJA 2GGHA 2QAEA 2NQLA 1O95A 3V3NA 1JPMA 1CJ2A 1KSUA 4ICYA 1NPXA 2WU5A 2ZC8A 3AEDA 4Z43A 2Y6RA 5L46A 3V76A 4Z44A 4H4RA 3SN0A 4GAPA 4IP4A 5U63A 4GMEA 4K2SA 1TKKA 2E5VA 2UZZA 4NTDA 4Z2UA 3NGCX 3UOZA 4GGBA 4ADWA 4AT0A 4RG3A 1ZX9A 5BVAA 4HNCA 2GDQA 5M0ZA 3UKPA 4DN1A 4JNQA 1FOHA 4Y4LA 1IUTA 4D04A 2IIDA 1KNRA 2B9XA 3Q6JA 2OZ8A 2VVLG 1SJCA 1EL9A 3GRSA 1DOCA 3UTFA 4GYPC 2W3RA 1D7LA 1STZA 1PN0A 1PXBA 3NRZB 1TDNA 4BK3A 2CDUA 3UXKA 3Q9TA 1N4VA 3CPJG 1VQZA 1NU5A 3KPFA 1H82A 4K22A 4HN8A 5G5HB 3R11A 1GRBA 2R0GA 2HXUA 1H7XA 4H4XA 3BSMA 3UOYA 2IVEA 3L5OA 1NG3A 1PBFA 4A5LA 1KN0A 4K8GA 4H83A 3ZLFA 3SZCA 3P1WA 3RITA 3VRAA 5KXJA 2YLTA 1ONEA 3T31A 4YKGA 2BK3A 1OJ9A 2X99A 2YR5A 4H4YA 3OC4A 3P9UA 4G73A 2PODA 4MMWA 2F5ZA 3KD9A 3LB8A 2P8CA 2JB1A 1LTXR 3UP4A 2YLSA 2Z5YA 4M0XA 2ZZ0A 3PWIA 2RDXA 3OZYA 3DFHA 1H84A 3IF9A 2ZZCA 3IWAA 3VCNA 3D8XA 1Y56B 4H2HA 1GRHA 2FJDA 4GRTA 3QVPA 4DX3A 3QSMA 1CL0A 4NNJA 2R45A 4OPLA 2BCGG 3FBSA 3G5SA 2CHRA 2PHHA 3NO1A 4B63A 2OFJA 3AD9B 4FK1A 4B66A 2C3DA 1NHRA 1E7PA 3MSYA 2YQUA 3VC6A 1PXCA 4YTNA 1JCTA 1FEBA 4CNKA 1ECQA 4H4QA 2POZA 3T2ZA 4GCMA 1NG4A 1BKHA 3REDA 3R25A 5EBKA 2W54A 1BGJA 2FJBA 3FCPA 3DEQA 4JDRA 3C96A 1MRAA 1ZP0A 3UKLA 2X8GA 2IVDA 2Q0KA 2XVFA 2QJMA 1F9CA 1RYIA 4TVYA 1MUCA 4U2LA 3LJPA 4GFIA 1NDAA 5C2TA 2E5AA 2XFQA 2GMJA 3SFDA 1D5TA 3GYIA 4O5QA 4II2A 2GR0A 4J33A 2JK6A 1CJ3A 2BRAA 2QCUA 3F8DA 3UJSA 2JB3A 4IA6A 2VRLA 5G5GB 1TDOA 1N4WA 1B5QA 2ARDA 2XH2A 2GH5A 3DMEA 5KNLA 2XVJA 4JN7A 1H83A 3BHFA 3GWFA 2GAHB 1YQZA 1DOBA 5GSNA 4OPDA 1JEHA 2XLRA 3GSIA 3EUB3 3BNUA 2MNRA 4REKA 4XWZA 1Y56A 1BF3A 2VOUA 3UXLA 2OZ3A 4E0VA 3M13A 2YM2A 1DJNA 3SN4A 1D7YA 1MXTA 2E1MA 3SBFA 4A79A 3ZLHA 4HB9A 3ZVIA 2ZZBA 3AD7B 4A7AA 1O5WA 3IHMA 1XANA 4APNA 5BUKA 4H2NA 1GTEA 1CF3A 2WPFA 5HY5A 4ZA0A 2B9YA 3GDPA 1LV0A 4H4VA 1FHUA 3K1GA 1JROA 2OVLA 5J7XA 3D9XA 3QTPA 3BOXA 4H4WA 4HCDA 2GQFA 2OLNA 2PTZA 2XCGA 5JCMA 4I59A 3RP8A 3NFUA 2B9WA 1GSNA 1H81A 4J34A 2C3CA 3STPA 4U8PA 2XDOA 2YAUA 4JN8A 4K8DA 4Y4MA 1O94A 1GESA 4IVMB 2GGEA 4H2RA 1OJDA 2OQHA 3JVAA 4WCTA 2XH4A 3JSKA 2X3NA 1FIQB 2BK5A 3DK9A 2HQMA 1KD0A 1H2IA 3BHKA 3LZWA 5HYMA 3CB3A 5CQFA 3HRDC 4ENLA 4TLXA 3VCCA 2H89A 1ZY8A 1XDIA 1IUVA 3NNEA 1EL8A 1SEZA 2XFPA 4Z1YA 3GMBA 3HZLA 5BRTA 1KNPA 3CNPA 3ALLA 5BULA 3H12A 3K7MX 4GIRA 3SR6B 2AKMA 2OO6A 1PXAA 4J31A 3C4NA 3R0KA 5IQ4A 2JBVA 1K4QA 3IC9A 1DODA 2EQ8A 3TQPA 2OZTA 2WOWA 1GERA 3V3WA 3WE0A 4TM0A 3FXGA 1N1PA 2AAQA 3T2YA 3AE8A 4CBQA 1N5XA 3M12A 1D4EA 4UP3A 1L9CA 4IP5A 3AE4A 4U8NA 3VRDB 1TDEA 4EIQA 2GR2A 2GR3A 1X2HA 4OVIA 1OJAA 2VQBA 3CT2A 1BGNA 1SB3B 3ADAB 3AEGA 3AE6A 2WP5A 3SZ0A 4TM3A 4DYEA 1FHVA 1GREA 3CYJA 3VDGA 3CNJA 3UJFA 5ER0A 1JRXA 3I4KA 2AKZA 1E6EA 3CXBA 4IHCA 3H8LA 3TJ4A 1RSGA 1COYA 5HXIA 3QLDA 4UDRA 5DBJA 1ZK7A 4CCRA 1N5WC 1R0MA 2DKHA 1B4VA 3UTHA 1FEAA 3BI2A 3A7AA 4JN9A 3VR8A 1PS9A 4IT1A 3ALJA 1D4CA 3O0HA 4A99A 3EEZA 3I6DA 1S3EA 4YKFA 2JKCA 1IUSA 3EKGA 2QA2A 3DESA 2YVGA 3ATRA 3Q4DA 1VG0A 3D1CA 2OA1A 4H2QA 4RSLA 4U8MA 3EF6A 5FS9A 3AE9A 1VG9A 3NS1B 4YSYA 4G7FA 1E9IA 5FS8A 3CTYA 2HNEA 2YG5A 3AN1A 2XSXA 4DNAA 3AE2A 1QO8A 1P48A 3DGHA 4LIIA 3OZMA 4U8OA 3OZ2A 3TWAA 2FYMA 3P4PA 3HYXA 3NZGA 1EC8A 3RR1A 4B64A 4ZCCA 1Q9IA 1WUFA 3PVCA 4GAVA 1DNCA 3GYXA 1YQ3A 4H4PA 3S61A 1CBOA 3TW9A 4BURA 2Q0LA 4II3A 3COXA 4P9SA 2CVJA 3GDNA 3JZUA 2WPEA 1MDLA 2VQ7A 3S5SA 2NVKX 1L9EA 1KDGA 1KSSA 3ZVHB 1P2HA 3P4QA 3AE7A 3SZWA 1E1KA 3ISHA 1PDZA 3LOVA 1GNDA 1TRBA 3MZNA 1WUEA 4U2SA 5JCLA 4G6GA 1GEUA 2C4CA 3NVYB 3DGBA 1FFUC 4H4TA 3AXBA 4E6MA 3KVEA 4FX9A 2YG6A 1S7MA 2C64A 3T37A 3UTGA 3L1RA 1ZOVA 5EB5A 2WQYA 2CULA 2BC1A 3UP5A 3I6EA 5FS6A 5EB4A 1Y0PA 4HPNA 1FO4A 2V3AA 3ATQA 6ENLA 3DGZA 4M6UA 3ENLA 3QFBA 2FJEA 4J56A 2BABA 4E5TA 4BK2A 3MQTA 1RM6B 4MKSA 5JCKA 2NPXA 3CN8A 3P4RA 4C3XA 1E1LA 4A35A 4B68A 3PWGA 3DJDA 1CC6A 5JCNA 4J3ZA 3ES8A 3JW7A 3U4FA 2OG9A 4YWSA 2PYXA 3UJRA 3K7QX 3NKSA 2AL1A 3MUCA 2X50A 2C72A 5KOWA 3ALMA 2PU0A 1FCDA 1OJCA 4FI4A 5J60A 1IUXA 1F8RA 3V5FA 3AM9A 3OW1A 2FJAA 3BI4A 4NEWA 2PP1A 1JNZA 2EQ6A 3ES7A 2BS3A 4FP1A 3ZVHA 3N4EA 3CIRA 4KPRA 3NTAA 2GB0A 3MWCA 1FFVC 2O9ZA 2WOVA 3PS9A 3DJJA 2P3ZA 3KUMA 1DOEA 3RGTA 3SJNA 1BQGA 2YR6A 4PABA 3CAWA 4U8LA 1DTNA 3II4A 5LV9A 3CNSA 4DGKA 4JHMA 3R10A 2FBWA 1MDRA 1V97A 3UKKA 4JY2A 2B76A 4F4RA 3AE1A 2OLOA 3RCYA 4J2WA 3I6TA 5GRTA 2EQ7A 3DIPA 5EOWA 2BXSA 4DXKA 4E8GA 2W0HA 1W4XA 3LADA 4NTCA 2PU1A 2WP6A 2XH7A 5JCIA 3K30A 3DK8A 1K0IA 2PTXA 3BNMA 1IJHA 3N6JA 1N60C 3D46A 3UCLA 3GMCA 3SX6A 4D03A 2OKTA 2VVLA 4ECHA 4EIPA 1VQWA 4ZN0A 1NELA 4FK1C 3ICRA 4OCGA 2H88A 1EBHA 1QLBA 1UKVG 4B1BA 4E4UA 3ZYXA 5IDZA 3QSSA 2GF3A 2OX4A 3H4KA 3P0WA 2EQ9A 2QQ6A 4LA1A 1Q1WA 3RP7A 3F8RA 3FPZA 3SFEA 2WP9A 2QGYA 4OPIA 4EQWA 1TDFA 1GRAA 4MGGA 4KEMA 3CGCA 5J04A 3B9JB 3ZLGA 2V6OA 2E3TA 1MO9A 3FYYA 2GGIA 2QDEA 2C67A 1PBBA 3RP6A 1JRYA 3OTRA 2DW6A 2GL5A 3NLCA 4HA6A 1MOKA 1XPYA 4AOXA 5JRBA 3LZXA 4GGHA 4TM4A 1K0JA 3SGLA 2GQWA 1LJ1A 5FJRA 2APGA 3AEFA 2BK4A 3UCDA 2R9ZA 4OPUA 4NWZA 4M52A 3FG2P 3DK4A 3M0OA 2PTWA 1TE6A 1VRQB 3N6HA 4DWDA 3GWDA 1F3PA 1XS2A 2I5QA 2WOIA 2X8HA 2C73A 2YG7A 2V3BA 3EAOA 2XVHA 1KF6A 3KKJA 1OJTA 2OAMA 4UDPA 1KKRA 1IUUA 3IHGA 4EQSA 2Q7VA 3VQRA 4LU6A 3E1TA 1CC2A 3CGDA 1REOA 4A9WA 3ABVA 4EM4A 3UTEA 1PBCA 1LVLA 4MJWA 3EPTA 1GRTA 2RABA 4IL0A 3NRNA 3CXOA 2YVFA 2PTYA 3AYLA 4USRA 4AP3A 1P43A 3AEEA 1IYXA 3URHA 1E1MA 5M10A 3T6CA 2GMHA 1F6MA 5KMQA 1H6VA 3NHOX 1PBDA 3N4FA 2BCPA 3NYFA 2BRYA 5TR3A 4B67A 3SY4A 1S2YA 4WX1A 3T14A 3NVWB 3SZFA 4EQRA 2BS2A 2XLPA 1LQUA 2W3SA 2YWLA 2X8CA 5KMSA 4NEVA 3T9PA 2HZGA 3NH3X 1YKJA 3SYIA 1ZMDA 2P8BA 1AOGA 4H4ZA 2B7SA 1ZXIC 1TYTA 4EM3A 4YTMA 2WETA 1YQ4A 1DJQA 4U8IA 1GOSA 3GD4A 5U1OA 2C65A 3UGVA 2XFNA 1SJBA 3NIXA 4EWJA 4RG4A 1Q1RA 2GSHA 2QDDA 3UJ2A 5CKUA 2R4EA 1BZLA 2AL2A 1CC4A 1FL2A 3NT6A 3RHAA 4OPTA 4AP1A 5FJUA 3H70A 2XGZA 1GTHA 2GEWA 4N9XA 2OPJA 1MNSA 3V3OA 1JRPA 1GALA 3DDMA 4JQ9A 1E1NA 1TDKA 3HYWA 3AD8B 3CNTA 2XLUA 3NN0X 3VRBA 1NHSA 4B65A 4Z26A 4FDCB 3I3LA 1X31B 5KMPA 2AQJA 5KRQA 2XLSA 2OQYA 4X9MA 2Q6UA 2ONEA 4H50A 5KWFA 4GYPA 3TWBA 3R1ZA 1KKOA 4DSHA 3UCCA 2QJJA 1YEYA 3SXIA 1GT8A 2CFYA 1TZZA 2VVMA 2WS3A 4ZCWA 1EC7A 4USQA 1PHHA 1M6IA 1B37A 3S47A 4GDEA 3SQPA 1FECA 4UDQA 1F8SA 3R07C 3NK2X 3FV9A 2R0CA 3GYJA 3T2KA 3DJGX 3H8IA 1JOAA 3ETRB 2GGJA 2GAGB 2PCEA 1JNRA 4A6NB 5FJPA 3G5QA 1N4UA 3P4SA 3GD3A 4HCHA 1ZOYA 3CNDA 4C3YA 1N61C 4J1OA 1WYGA 3UJEA 4XXGA 1L0VA 1X2GA 2E4GA 2V60A 2AR8A 2WBAA 3FJ4A 2YLXA 3KA7A 1VDCA 4JNAA 3RRAA 5BOFA 2TPRA 3NK1X 2WDQA 4K5SA 4I58A 4K2XA 3DA1A 1VDVA 4CNJA 1LPFA 3PFRA 4E4FA 3K7TA 3PG6A 3IJIA 1PDHA 3OPSA 4AOSA 1ZMCA 2BA9A 2YLWA 3FIMB 1NEKA 3QN3A 1JU2A 3A7UA 4IVOB 2OLAA 1H86A 3KPKA 2B7RA 1SJDA 2XFUA 5KMRA 3DG3A 4C74A 3UKHA 3S5WA 1ELIA 5ENLA 3DERA 4KT2A 4YSZA 1JDFA 4IA5A 3AEAA 3VFCA 4Z2TA 2XVIA 2RGOA 3GO2A 4IL2A 2WEUA 3NN6X 2BXRA 3G5RA 4A6NA 3B97A 3UOXA 4CRTA 4GUVA 3L8KA 4JY3A 2PSNA 1GRGA 1CHUA 2GVCA 4Y4NA 2WDRA 1PJ6A 3AYIA 4B69A 4YSHA 5FJTA 5U25A 3DG6A 3NVVB 2YG4A 3B3RA 2WESA 4GF7A 2DKIA 4OPCA 1GV4A 4H2PA 3NG7X 1W6TA 4K5RA 3DJEA 2PGEA 5C3JA 4ROPA 3NYCA 1ZDLA 2P0IA 2WDVA 2YG3A 3NVZB 4BJYA 2VZ2A 3DG7A 5KOXA 3UKFA 3Q45A 4U2TA 1HYUA 4AT2A 4OPGA 3ICTA 2C66A 2YR4A 3T8QA 4H4SA 1Z6LA 2A89A 3F8PA 3T0KA 2GRTA 1RP0A 2GV8A 4H19A 3BJSA 4HYRA 3KU9A 3RO6A 1EBGA 4NTEA 2YLZA 5HHFA 4YWOA 1PBEA 1L9DA 1GRFA 3UOVA 3AYJA 4DSGA 2C75A 2C7GA 1ZKQA 2XH0A 3U9IA 1BWCA 3DH9A 2A87A 1D4DA 3SN1A 3VC5A 1BKWA 4H1ZA 3H7VA 2PA6A 2FKPA 4J36A 1QJDA 4GDPA 3TCSA 1PJ7A 1LQTA 1N63C 3TTEA 3ITJA 4DHGA 3AE3A 3NXLA 4EMJA 2QJNA 3AMZA 3MY9A 3CMMA 1PJ5A 3QSEA 3AECA 3P93A 3NTDA 4ZOHB 1ONFA 3AE5A 4HNLA 1H7WA 1NAAA 3GRTA 4EMWA 2GGGA 2DW7A 2MUCA 4G9KA 4H4UA 4HCLA 2C70A 4YXDA 4EQXA 1N62C 1CJCA 4A6GA 1R6WA 4U8KA 3P3BA 1E39A 4YTPA 4X4JA 4A3RA 1XHCA 2BS4A 2A8XA 1KFYA 3SQSA 2Z5XA 3KLJA 3MKCA 1K0LA 2PS2A 3AWIA 1KCZA 4G8TA 1L8PA 5EU9A 3D47A 2XVEA 3T4WA 4TM1A 2QA1A 2V5ZA 3AB1A 2C76A 3NK0X 4GISA 2AL2B 3NYEA 2GR1A 3VA8A 3UKQA 2XLTA 3HYVA 3VR9A 3QVRA 5BOEA 1NHPA 3RNMA 4G6HA 3EANA 4BK1A 3TOYA 4Z17A 2BC0A 2XYOA 3GD6A 2YVJA 3B6DA 1V59A 3FVDA 2ZBWA 2XFOA 1RVKA 3IJLA 4IV9A 4BV6A 3THUA 4YT0A 2PP3A 1EL5A 2JAEA 2HXTA 3GC2A 4J57A 1ELSA 3UKAA 1IUWA 4TLZA 4X9NA 4U8JA 4O5UA 3GY1A 5IPYA 3PO7A 2ACZA 1DXLA 5KVHA 1XPQA 1PDYA 1B8SA 1EL7A 3ICSA 1T3QC 3DFYA 3QKEA 4CY8A 2PMQA 1CJ4A 3ZDNA 4YSXA 2PPGA 4CCQA 4H7UA 1M64A 4Z2RA 1F8WA 3HW2A 4KX6A 3A7RA 4PAAA 1EBDA 4CY6A 3R0UA 7ENLA 3IK4A 1EC9A 5FJOA 2ZADA 3R9UA 1GETA 4GR1A 4X2PA 5FMHA 1P2EA 4ZCDA 2R0PA 2WPCA 5IQ1A 3SSZA 4KWSA 4C5OA 3QFAA 1NHQA 4C77A 4Z25A 1GPEA 4K7ZA
chains in the Genus database with same CATH topology
1NENA 2WPFA 1ZOYA 3CNDA 5HY5A 2B9YA 2EQ6A 5FS7A 3GDPA 4C3YA 1YY5A 2BS3A 3QJ4A 1LV0A 4XXGA 4H4VA 4KPRA 3CIRA 3NTAA 2GB0A 1L0VA 2BYBA 5J7XA 3D9XA 2E4GA 2O9ZA 2V60A 2I0ZA 1GXFA 2WBAA 2AR8A 2WOVA 4H4WA 3PS9A 2Y6QA 3DJJA 2YLXA 3UTHA 3KA7A 1S3BA 1DOEA 1VDCA 2GQFA 2OLNA 4JNAA 2XCGA 5JCMA 4I59A 2TPRA 3NK1X 2YR6A 4PABA 2WDQA 3RP8A 4K5SA 3CGEA 4U8LA 2R46A 2B9WA 3II4A 4Z24A 3CPIG 2BACA 4I58A 4UDPA 3CNSA 1GSNA 1H81A 2V61A 5LV9A 4DGKA 4K2XA 5KVIA 4J34A 2C3CA 3CPHG 2R4JA 1S2QA 3DA1A 4CNJA 4U8PA 1JRZA 2OALA 2XDOA 3BI5A 1LPFA 2FBWA 2WU2A 2YAUA 4EMIA 4K8DA 4Y4MA 3UKKA 4JY2A 1O94A 2B76A 3K7TA 1GESA 3AE1A 3SM8A 3PG6A 4IVMB 2TMDA 1PDHA 2OLOA 4H2RA 1OJDA 4AOSA 1ZMCA 4J2WA 2BA9A 5GRTA 2EQ7A 4WCTA 3CGBA 3JSKA 1TYPA 2YLWA 2X3NA 2BK5A 5EOWA 2BXSA 3DK9A 2W0HA 3AEBA 3C4AA 4NZHA 4G74A 3FIMB 1NEKA 1W4XA 2HQMA 3LADA 2VRMA 4NTCA 2WP6A 2J3NA 1H2IA 5JCIA 3BHKA 3LZWA 4A65A 5HYMA 3K30A 4XWRA 3DK8A 2YM1A 2RGHA 1JU2A 1K0IA 5CQFA 4IVOB 2JB2A 2WHDA 3BNMA 1H86A 1IJHA 4TLXA 2H89A 3KPKA 1ZY8A 3UCLA 3GMCA 2YLRA 1XDIA 1IUVA 3NNEA 3SX6A 4BJZA 4D03A 1EL8A 2B7RA 1SEZA 2XFPA 2VVLA 4ECHA 4EIPA 2XFUA 3FMWA 3GMBA 5KMRA 3LXDA 3HZLA 1VQWA 2RGJA 5BRTA 4ZN0A 1KNPA 2QAEA 3V3NA 1O95A 4C74A 4FK1C 3ICRA 1CJ2A 3CNPA 3ALLA 4OCGA 3UKHA 2H88A 3S5WA 5BULA 3K7MX 1QLBA 1UKVG 4B1BA 3ZYXA 1ELIA 1KSUA 4ICYA 3QSSA 1PXAA 4J31A 3C4NA 4YSZA 1NPXA 2GF3A 2WU5A 4IA5A 5IQ4A 3AEDA 3H4KA 4Z43A 2EQ9A 2JBVA 3AEAA 1K4QA 4LA1A 1Q1WA 4Z2TA 2XVIA 3IC9A 2RGOA 3RP7A 1DODA 3F8RA 2EQ8A 2WEUA 3FPZA 3SFEA 2Y6RA 5L46A 3NN6X 2WOWA 3V76A 4Z44A 2WP9A 1GERA 2BXRA 4H4RA 3G5RA 3WE0A 4A6NA 4GAPA 3UOXA 4OPIA 4TM0A 4EQWA 1TDFA 1GRAA 4CRTA 5U63A 4GUVA 3L8KA 1N1PA 4JY3A 2AAQA 3CGCA 2E5VA 3T2YA 3AE8A 2UZZA 4NTDA 1GRGA 1CHUA 3NGCX 4CBQA 2GVCA 4Z2UA 3M12A 4Y4NA 1D4EA 2WDRA 1PJ6A 2V6OA 3AYIA 4UP3A 3UOZA 1L9CA 4B69A 4ADWA 4AT0A 3AE4A 4RG3A 1ZX9A 4U8NA 4YSHA 1MO9A 5M0ZA 3VRDB 5BVAA 1TDEA 2C67A 1PBBA 4JNQA 3UKPA 3RP6A 1JRYA 5U25A 4EIQA 2YG4A 1FOHA 2GR2A 3B3RA 2GR3A 2WESA 4GF7A 4Y4LA 3NLCA 4HA6A 1MOKA 1IUTA 2DKIA 4OVIA 4AOXA 4OPCA 4D04A 1GV4A 5JRBA 1KNRA 1OJAA 2IIDA 2VQBA 2B9XA 3LZXA 4TM4A 3Q6JA 4H2PA 1BGNA 2VVLG 3ADAB 3AEGA 3AE6A 3NG7X 2WP5A 1K0JA 3SGLA 3SZ0A 2GQWA 4K5RA 3DJEA 1LJ1A 4TM3A 2APGA 1EL9A 3GRSA 5C3JA 1GREA 1DOCA 3AEFA 3UTFA 2BK4A 2R9ZA 4OPUA 4NWZA 4M52A 3CNJA 1D7LA 3FG2P 5ER0A 1PN0A 3NYCA 1ZDLA 1JRXA 2WDVA 1PXBA 2YG3A 3DK4A 3M0OA 4BJYA 1TDNA 4BK3A 1VRQB 2VZ2A 1E6EA 5KOXA 3UKFA 2CDUA 3Q9TA 1N4VA 3CPJG 3H8LA 1RSGA 1COYA 5HXIA 4U2TA 1HYUA 3GWDA 4AT2A 1F3PA 4OPGA 3ICTA 3KPFA 4UDRA 2WOIA 1H82A 2C66A 2YR4A 4K22A 5DBJA 4H4SA 2X8HA 1Z6LA 2C73A 2A89A 3F8PA 1GRBA 1ZK7A 2YG7A 2V3BA 2R0GA 2GRTA 3EAOA 1RP0A 2GV8A 2XVHA 3T0KA 1KF6A 3KKJA 3KU9A 1OJTA 2DKHA 2OAMA 1B4VA 2YLZA 1FEAA 1H7XA 3BI2A 4NTEA 4YWOA 1PBEA 1IUUA 4JN9A 1L9DA 1GRFA 3UOVA 4H4XA 3IHGA 3VR8A 4EQSA 1PS9A 2Q7VA 3ALJA 3VQRA 1D4CA 3O0HA 4LU6A 3AYJA 3E1TA 3UOYA 4A99A 4DSGA 2C75A 2C7GA 1CC2A 3CGDA 1REOA 2IVEA 4A9WA 3I6DA 1S3EA 3ABVA 4YKFA 2JKCA 4EM4A 1IUSA 3L5OA 1NG3A 1ZKQA 2QA2A 1PBFA 4K7ZA 2YVGA 1BWCA 3ATRA 3UTEA 3DH9A 4A5LA 1PBCA 1KN0A 1D4DA 2A87A 1LVLA 4MJWA 1VG0A 3EPTA 3SZCA 3P1WA 1GRTA 3D1CA 3VRAA 5KXJA 2RABA 2OA1A 3NRNA 4H2QA 4RSLA 4U8MA 1BKWA 3EF6A 5FS9A 2YLTA 2YVFA 3T31A 3AE9A 3AYLA 1QJDA 1VG9A 4GDPA 4J36A 1PJ7A 4USRA 4AP3A 4YSYA 1LQTA 3AEEA 4YKGA 2BK3A 1OJ9A 5FS8A 2X99A 3URHA 1E1MA 2YR5A 5M10A 4H4YA 3OC4A 3P9UA 3ITJA 4G73A 2GMHA 3CTYA 2F5ZA 1F6MA 2YG5A 1H6VA 3AE3A 3KD9A 3NHOX 5KMQA 1PBDA 3LB8A 2BCPA 4DNAA 3AE2A 2JB1A 1LTXR 3NYFA 1QO8A 3UP4A 2YLSA 3DGHA 2BRYA 4EMJA 5TR3A 4LIIA 4B67A 4U8OA 2Z5YA 3SY4A 2ZZ0A 3OZ2A 1S2YA 3CMMA 4WX1A 3T14A 3SZFA 4EQRA 2BS2A 3P4PA 2XLPA 1PJ5A 1H84A 3IF9A 2ZZCA 3IWAA 3QSEA 3HYXA 3D8XA 1LQUA 3AECA 1Y56B 4B64A 4ZCCA 2YWLA 1GRHA 2X8CA 2FJDA 3NTDA 1ONFA 4GRTA 3QVPA 3AE5A 5KMSA 1Q9IA 3QSMA 1CL0A 4NEVA 3PVCA 4GAVA 1H7WA 1NAAA 3GRTA 1DNCA 3NH3X 1YKJA 3SYIA 1ZMDA 4EMWA 3GYXA 1AOGA 4NNJA 1YQ3A 2R45A 4H4ZA 4H4PA 4G9KA 3S61A 1CBOA 2B7SA 4OPLA 1TYTA 4H4UA 4EM3A 2BCGG 2C70A 3FBSA 4YXDA 4YTMA 4EQXA 1CJCA 2WETA 1YQ4A 4BURA 1DJQA 3G5SA 4U8IA 1GOSA 2Q0LA 4II3A 4U8KA 2PHHA 1E39A 3GD4A 5U1OA 3COXA 4B63A 4YTPA 4P9SA 3AD9B 4X4JA 4FK1A 2C65A 4B66A 2C3DA 2CVJA 1NHRA 1XHCA 3GDNA 2WPEA 2BS4A 2A8XA 2VQ7A 1E7PA 1KFYA 2Z5XA 3KLJA 2YQUA 1K0LA 2XFNA 2NVKX 1L9EA 3AWIA 1PXCA 4YTNA 1KDGA 1KSSA 3NIXA 1FEBA 4CNKA 1Q1RA 1P2HA 4RG4A 3P4QA 4H4QA 3AE7A 3SZWA 1E1KA 3ISHA 5CKUA 2R4EA 3LOVA 1BZLA 3T2ZA 2XVEA 1GNDA 4CCRA 4GCMA 1CC4A 1FL2A 3NT6A 4TM1A 1NG4A 2QA1A 3RHAA 2V5ZA 4OPTA 4AP1A 1TRBA 3AB1A 3REDA 2C76A 4U2SA 3NK0X 5JCLA 5EBKA 1GTHA 3NYEA 4G6GA 2GEWA 1BGJA 2GR1A 2FJBA 3UKQA 2XLTA 3HYVA 3VR9A 4N9XA 4JDRA 3C96A 3QVRA 1GEUA 1NHPA 1ZP0A 3RNMA 4G6HA 3UKLA 3EANA 3V3OA 4BK1A 1GALA 2C4CA 4JQ9A 2BC0A 1E1NA 2XYOA 2X8GA 2YVJA 1TDKA 3B6DA 1V59A 3HYWA 2IVDA 2ZBWA 2XFOA 3AD8B 2Q0KA 4H4TA 2XLUA 2XVFA 3CNTA 3NN0X 3AXBA 4IV9A 3VRBA 4BV6A 1RYIA 3KVEA 4FX9A 1NHSA 4YT0A 4B65A 2YG6A 1S7MA 2C64A 4FDCB 1EL5A 3I3LA 3LJPA 1X31B 4U2LA 3T37A 4Z26A 3UTGA 1NDAA 5C2TA 2XFQA 5KMPA 2JAEA 3L1RA 2GMJA 1ZOVA 3SFDA 5EB5A 2AQJA 2WQYA 1D5TA 2CULA 3GYIA 5KRQA 4J57A 4O5QA 2BC1A 2GR0A 4J33A 2XLSA 4II2A 3UP5A 2JK6A 5FS6A 3UKAA 1CJ3A 1IUWA 4TLZA 4X9NA 1Y0PA 2BRAA 4X9MA 5EB4A 2Q6UA 2QCUA 4U8JA 4O5UA 3F8DA 2V3AA 4H50A 3ATQA 5IPYA 5KWFA 2JB3A 3DGZA 3PO7A 3QFBA 2VRLA 4IA6A 2ACZA 1TDOA 2FJEA 1DXLA 4J56A 1N4WA 4DSHA 1B5QA 1XPQA 2BABA 2ARDA 2GH5A 4BK2A 3DMEA 5KNLA 2XVJA 1H83A 3BHFA 3GWFA 5JCKA 1B8SA 2NPXA 1YQZA 1EL7A 2GAHB 3CN8A 1DOBA 3P4RA 4OPDA 5GSNA 1JEHA 4C3XA 2XLRA 3GSIA 3ICSA 3SXIA 4CY8A 1GT8A 1CJ4A 2CFYA 1E1LA 3ZDNA 4YSXA 4B68A 3BNUA 4CCQA 4H7UA 2VVMA 2WS3A 3DJDA 4USQA 4REKA 4XWZA 1CC6A 1M64A 1Y56A 1BF3A 5JCNA 2VOUA 4Z2RA 1F8WA 1PHHA 4KX6A 1M6IA 1B37A 4E0VA 3M13A 4GDEA 4PAAA 3SQPA 2YM2A 2PYXA 1DJNA 3K7QX 1EBDA 4CY6A 1FECA 3NKSA 1D7YA 4UDQA 2X50A 1MXTA 1F8SA 3NK2X 2E1MA 2R0CA 3GYJA 2C72A 3T2KA 3DJGX 3H8IA 4A79A 5KOWA 1JOAA 4HB9A 2ZZBA 3ALMA 3R9UA 1GETA 4GR1A 5FMHA 1FCDA 2GAGB 3AD7B 1JNRA 1OJCA 1O5WA 1P2EA 4A7AA 4ZCDA 3IHMA 2R0PA 1XANA 2WPCA 1IUXA 1F8RA 2FJAA 3BI4A 4APNA 5IQ1A 5J60A 4A6NB 4NEWA 5HHFA 5BUKA 4C5OA 3QFAA 1NHQA 1JNZA 3G5QA 4C77A 4Z25A 1N4UA 1GPEA 4H2NA 3P4SA 1GTEA 3GD3A 1CF3A 5KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEN A;  2WPF A;  1ZOY A;  3CND A;  5HY5 A;  2B9Y A;  2EQ6 A;  5FS7 A;  3GDP A;  4C3Y A;  1YY5 A;  2BS3 A;  3QJ4 A;  1LV0 A;  4XXG A;  4H4V A;  4KPR A;  3CIR A;  3NTA A;  2GB0 A;  1L0V A;  2BYB A;  5J7X A;  2E4G A;  2O9Z A;  2V60 A;  2I0Z A;  1GXF A;  2WBA A;  2AR8 A;  2WOV A;  4H4W A;  3PS9 A;  2Y6Q A;  3DJJ A;  2YLX A;  3UTH A;  3KA7 A;  1S3B A;  1DOE A;  1VDC A;  2GQF A;  2OLN A;  4JNA A;  2XCG A;  5JCM A;  4I59 A;  2TPR A;  3NK1 X;  2YR6 A;  4PAB A;  2WDQ A;  3RP8 A;  4K5S A;  3CGE A;  4U8L A;  2R46 A;  2B9W A;  3II4 A;  4Z24 A;  3CPI G;  2BAC A;  4I58 A;  4UDP A;  3CNS A;  1GSN A;  1H81 A;  2V61 A;  5LV9 A;  4DGK A;  4K2X A;  5KVI A;  4J34 A;  2C3C A;  3CPH G;  2R4J A;  1S2Q A;  3DA1 A;  4CNJ A;  4U8P A;  1JRZ A;  2OAL A;  2XDO A;  3BI5 A;  1LPF A;  2FBW A;  2WU2 A;  2YAU A;  4EMI A;  4K8D A;  4Y4M A;  3UKK A;  4JY2 A;  1O94 A;  2B76 A;  3K7T A;  1GES A;  3AE1 A;  3SM8 A;  4IVM B;  2TMD A;  1PDH A;  2OLO A;  4H2R A;  1OJD A;  4AOS A;  1ZMC A;  4J2W A;  2BA9 A;  5GRT A;  2EQ7 A;  4WCT A;  3CGB A;  3JSK A;  1TYP A;  2YLW A;  2X3N A;  2BK5 A;  5EOW A;  2BXS A;  3DK9 A;  2W0H A;  3AEB A;  3C4A A;  4NZH A;  3FIM B;  1NEK A;  1W4X A;  2HQM A;  3LAD A;  2VRM A;  4NTC A;  2WP6 A;  2J3N A;  5JCI A;  3BHK A;  3LZW A;  4A65 A;  5HYM A;  3K30 A;  4XWR A;  3DK8 A;  2YM1 A;  2RGH A;  1JU2 A;  1K0I A;  5CQF A;  4IVO B;  2JB2 A;  2WHD A;  3BNM A;  1H86 A;  1IJH A;  4TLX A;  2H89 A;  1ZY8 A;  3UCL A;  3GMC A;  2YLR A;  1XDI A;  1IUV A;  3NNE A;  4BJZ A;  4D03 A;  1EL8 A;  2B7R A;  1SEZ A;  2XFP A;  2VVL A;  4ECH A;  4EIP A;  2XFU A;  3FMW A;  3GMB A;  3LXD A;  3HZL A;  1VQW A;  2RGJ A;  5BRT A;  4ZN0 A;  1KNP A;  2QAE A;  3V3N A;  1O95 A;  4C74 A;  4FK1 C;  3ICR A;  1CJ2 A;  3CNP A;  3ALL A;  4OCG A;  3UKH A;  2H88 A;  3S5W A;  5BUL A;  3K7M X;  1QLB A;  1UKV G;  4B1B A;  3ZYX A;  1ELI A;  1KSU A;  4ICY A;  3QSS A;  1PXA A;  4J31 A;  3C4N A;  4YSZ A;  1NPX A;  2GF3 A;  2WU5 A;  4IA5 A;  5IQ4 A;  3AED A;  3H4K A;  4Z43 A;  2EQ9 A;  2JBV A;  3AEA A;  1K4Q A;  4LA1 A;  1Q1W A;  4Z2T A;  2XVI A;  3IC9 A;  2RGO A;  3RP7 A;  1DOD A;  3F8R A;  2EQ8 A;  2WEU A;  3FPZ A;  3SFE A;  2Y6R A;  5L46 A;  3NN6 X;  2WOW A;  3V76 A;  4Z44 A;  2WP9 A;  1GER A;  2BXR A;  4H4R A;  3G5R A;  3WE0 A;  4A6N A;  3UOX A;  4OPI A;  4TM0 A;  4EQW A;  1TDF A;  1GRA A;  4CRT A;  5U63 A;  4GUV A;  3L8K A;  1N1P A;  4JY3 A;  2AAQ A;  3CGC A;  2E5V A;  3AE8 A;  2UZZ A;  4NTD A;  1GRG A;  1CHU A;  3NGC X;  4CBQ A;  2GVC A;  4Z2U A;  3M12 A;  4Y4N A;  1D4E A;  2WDR A;  1PJ6 A;  2V6O A;  3AYI A;  4UP3 A;  3UOZ A;  1L9C A;  4B69 A;  4ADW A;  4AT0 A;  3AE4 A;  4RG3 A;  1ZX9 A;  4U8N A;  4YSH A;  1MO9 A;  5M0Z A;  3VRD B;  5BVA A;  1TDE A;  2C67 A;  1PBB A;  4JNQ A;  3UKP A;  3RP6 A;  1JRY A;  5U25 A;  4EIQ A;  2YG4 A;  1FOH A;  2GR2 A;  3B3R A;  2GR3 A;  2WES A;  4GF7 A;  4Y4L A;  3NLC A;  4HA6 A;  1MOK A;  1IUT A;  2DKI A;  4OVI A;  4AOX A;  4OPC A;  4D04 A;  1GV4 A;  1OJA A;  1KNR A;  2IID A;  2VQB A;  3LZX A;  2B9X A;  4TM4 A;  3Q6J A;  4H2P A;  1BGN A;  2VVL G;  3ADA B;  3AEG A;  3AE6 A;  3NG7 X;  2WP5 A;  1K0J A;  3SGL A;  2GQW A;  4K5R A;  3DJE A;  1LJ1 A;  4TM3 A;  2APG A;  1EL9 A;  3GRS A;  5C3J A;  1GRE A;  1DOC A;  3AEF A;  3UTF A;  2BK4 A;  2R9Z A;  4OPU A;  4M52 A;  3CNJ A;  1D7L A;  3FG2 P;  5ER0 A;  1PN0 A;  3NYC A;  1ZDL A;  1JRX A;  2WDV A;  1PXB A;  2YG3 A;  3DK4 A;  3M0O A;  4BJY A;  1TDN A;  4BK3 A;  1VRQ B;  2VZ2 A;  1E6E A;  5KOX A;  3UKF A;  2CDU A;  3Q9T A;  1N4V A;  3CPJ G;  3H8L A;  1RSG A;  1COY A;  5HXI A;  4U2T A;  1HYU A;  3GWD A;  4AT2 A;  1F3P A;  4OPG A;  3ICT A;  3KPF A;  4UDR A;  2WOI A;  1H82 A;  2C66 A;  2YR4 A;  4K22 A;  5DBJ A;  4H4S A;  2X8H A;  1Z6L A;  2C73 A;  2A89 A;  3F8P A;  1GRB A;  1ZK7 A;  2YG7 A;  2V3B A;  2R0G A;  2GRT A;  3EAO A;  1RP0 A;  2GV8 A;  2XVH A;  4CCR A;  1KF6 A;  3KKJ A;  3KU9 A;  1OJT A;  2DKH A;  2OAM A;  1B4V A;  2YLZ A;  1FEA A;  1H7X A;  3BI2 A;  4NTE A;  4YWO A;  1PBE A;  1IUU A;  4JN9 A;  1L9D A;  1GRF A;  3UOV A;  4H4X A;  3IHG A;  3VR8 A;  4EQS A;  1PS9 A;  2Q7V A;  3ALJ A;  3VQR A;  1D4C A;  3O0H A;  4LU6 A;  3AYJ A;  3E1T A;  3UOY A;  4A99 A;  4DSG A;  2C75 A;  2C7G A;  1CC2 A;  3CGD A;  1REO A;  2IVE A;  4A9W A;  3I6D A;  1S3E A;  3ABV A;  4YKF A;  2JKC A;  4EM4 A;  1IUS A;  1NG3 A;  1ZKQ A;  2QA2 A;  1PBF A;  4K7Z A;  2YVG A;  1BWC A;  3ATR A;  3UTE A;  3DH9 A;  4A5L A;  1PBC A;  2A87 A;  1D4D A;  1LVL A;  4MJW A;  1VG0 A;  3EPT A;  3P1W A;  1GRT A;  3D1C A;  3VRA A;  5KXJ A;  2RAB A;  2OA1 A;  3NRN A;  4H2Q A;  4RSL A;  4U8M A;  1BKW A;  3EF6 A;  5FS9 A;  2YLT A;  2YVF A;  3AE9 A;  3AYL A;  1QJD A;  1VG9 A;  4GDP A;  4J36 A;  1PJ7 A;  4USR A;  4AP3 A;  4YSY A;  1LQT A;  3AEE A;  4YKG A;  2BK3 A;  1OJ9 A;  5FS8 A;  2X99 A;  3URH A;  1E1M A;  2YR5 A;  5M10 A;  4H4Y A;  3OC4 A;  3P9U A;  3ITJ A;  2GMH A;  3CTY A;  2F5Z A;  1F6M A;  2YG5 A;  1H6V A;  3AE3 A;  3KD9 A;  3NHO X;  1PBD A;  3LB8 A;  2BCP A;  4DNA A;  3AE2 A;  2JB1 A;  1LTX R;  3NYF A;  1QO8 A;  3UP4 A;  2YLS A;  3DGH A;  4EMJ A;  5TR3 A;  4LII A;  4B67 A;  4U8O A;  2Z5Y A;  2ZZ0 A;  3OZ2 A;  1S2Y A;  4WX1 A;  4EQR A;  2BS2 A;  3P4P A;  2XLP A;  1PJ5 A;  1H84 A;  3IF9 A;  2ZZC A;  3IWA A;  3QSE A;  3D8X A;  1LQU A;  3AEC A;  1Y56 B;  4B64 A;  4ZCC A;  2YWL A;  1GRH A;  2X8C A;  2FJD A;  3NTD A;  1ONF A;  4GRT A;  3QVP A;  3AE5 A;  1Q9I A;  3QSM A;  1CL0 A;  4NEV A;  3PVC A;  1H7W A;  1NAA A;  3GRT A;  1DNC A;  3NH3 X;  1YKJ A;  1ZMD A;  4EMW A;  1AOG A;  1YQ3 A;  2R45 A;  4H4Z A;  4H4P A;  3S61 A;  1CBO A;  2B7S A;  4OPL A;  1TYT A;  4H4U A;  4EM3 A;  2BCG G;  2C70 A;  3FBS A;  4YXD A;  4YTM A;  4EQX A;  1CJC A;  2WET A;  1YQ4 A;  4BUR A;  1DJQ A;  3G5S A;  4U8I A;  1GOS A;  2Q0L A;  4U8K A;  2PHH A;  1E39 A;  3GD4 A;  5U1O A;  3COX A;  4B63 A;  4YTP A;  4P9S A;  3AD9 B;  4X4J A;  4FK1 A;  2C65 A;  4B66 A;  2C3D A;  2CVJ A;  1NHR A;  1XHC A;  3GDN A;  2WPE A;  2BS4 A;  2A8X A;  2VQ7 A;  1E7P A;  1KFY A;  2Z5X A;  3KLJ A;  2YQU A;  1K0L A;  2XFN A;  2NVK X;  1L9E A;  3AWI A;  1PXC A;  4YTN A;  1KDG A;  1KSS A;  3NIX A;  1FEB A;  4CNK A;  1Q1R A;  1P2H A;  4RG4 A;  3P4Q A;  4H4Q A;  3AE7 A;  1E1K A;  3ISH A;  5CKU A;  2R4E A;  3LOV A;  1BZL A;  2XVE A;  1GND A;  4GCM A;  1CC4 A;  1FL2 A;  3NT6 A;  4TM1 A;  1NG4 A;  2QA1 A;  3RHA A;  2V5Z A;  4OPT A;  4AP1 A;  1TRB A;  3AB1 A;  3RED A;  2C76 A;  4U2S A;  3NK0 X;  5JCL A;  5EBK A;  1GTH A;  3NYE A;  2GEW A;  1BGJ A;  2GR1 A;  2FJB A;  3UKQ A;  2XLT A;  3VR9 A;  4N9X A;  4JDR A;  3C96 A;  3QVR A;  1GEU A;  1NHP A;  1ZP0 A;  3RNM A;  3UKL A;  3V3O A;  3EAN A;  4BK1 A;  1GAL A;  4JQ9 A;  2BC0 A;  1E1N A;  2XYO A;  2X8G A;  2YVJ A;  1TDK A;  3B6D A;  1V59 A;  2IVD A;  2ZBW A;  2XFO A;  3AD8 B;  2Q0K A;  4H4T A;  2XLU A;  2XVF A;  3CNT A;  3NN0 X;  3AXB A;  4IV9 A;  3VRB A;  4BV6 A;  1RYI A;  3KVE A;  4FX9 A;  1NHS A;  4YT0 A;  4B65 A;  2YG6 A;  4Z26 A;  2C64 A;  4FDC B;  1EL5 A;  3I3L A;  3LJP A;  1X31 B;  4U2L A;  3T37 A;  3UTG A;  1NDA A;  5C2T A;  2XFQ A;  2JAE A;  3L1R A;  2GMJ A;  1ZOV A;  3SFD A;  5EB5 A;  2AQJ A;  2WQY A;  1D5T A;  2CUL A;  3GYI A;  5KRQ A;  4J57 A;  4O5Q A;  2BC1 A;  2GR0 A;  4J33 A;  2XLS A;  3UP5 A;  2JK6 A;  5FS6 A;  3UKA A;  1CJ3 A;  1IUW A;  4TLZ A;  4X9N A;  1Y0P A;  5EB4 A;  4X9M A;  2Q6U A;  2QCU A;  4U8J A;  4O5U A;  3F8D A;  4H50 A;  2V3A A;  3ATQ A;  5IPY A;  5KWF A;  2JB3 A;  3DGZ A;  3PO7 A;  3QFB A;  2VRL A;  4IA6 A;  2ACZ A;  1TDO A;  2FJE A;  1DXL A;  4J56 A;  1N4W A;  4DSH A;  1B5Q A;  1XPQ A;  2BAB A;  2ARD A;  2GH5 A;  4BK2 A;  3DME A;  2XVJ A;  1H83 A;  3BHF A;  3GWF A;  5JCK A;  1B8S A;  2NPX A;  1YQZ A;  1EL7 A;  2GAH B;  3CN8 A;  1DOB A;  3P4R A;  4OPD A;  5GSN A;  1JEH A;  4C3X A;  2XLR A;  3GSI A;  3ICS A;  4CY8 A;  1GT8 A;  1CJ4 A;  2CFY A;  1E1L A;  3ZDN A;  4YSX A;  4B68 A;  3BNU A;  4CCQ A;  4H7U A;  2VVM A;  2WS3 A;  3DJD A;  4USQ A;  4REK A;  4XWZ A;  1CC6 A;  1M64 A;  1Y56 A;  1BF3 A;  5JCN A;  2VOU A;  4Z2R A;  1F8W A;  1PHH A;  4KX6 A;  1M6I A;  1B37 A;  4E0V A;  3M13 A;  4GDE A;  4PAA A;  3SQP A;  2YM2 A;  2PYX A;  1DJN A;  3K7Q X;  1EBD A;  4CY6 A;  1FEC A;  3NKS A;  1D7Y A;  4UDQ A;  2X50 A;  1MXT A;  1F8S A;  3NK2 X;  2E1M A;  2R0C A;  3GYJ A;  2C72 A;  3DJG X;  3H8I A;  4A79 A;  5KOW A;  1JOA A;  4HB9 A;  2ZZB A;  3ALM A;  3R9U A;  1GET A;  4GR1 A;  5FMH A;  1FCD A;  2GAG B;  3AD7 B;  1JNR A;  1OJC A;  1O5W A;  1P2E A;  4A7A A;  4ZCD A;  3IHM A;  2R0P A;  1XAN A;  2WPC A;  1IUX A;  1F8R A;  2FJA A;  3BI4 A;  4APN A;  5IQ1 A;  5J60 A;  4A6N B;  4NEW A;  5HHF A;  5BUK A;  4C5O A;  3QFA A;  1NHQ A;  1JNZ A;  3G5Q A;  4C77 A;  4Z25 A;  1N4U A;  1GPE A;  4H2N A;  3P4S A;  1GTE A;  3GD3 A;  1CF3 A;  5KVH A; 
#chains in the Genus database with same CATH topology
 1NEN A;  4K1W A;  5FS7 A;  3IJQ A;  2O56 A;  1YY5 A;  3QJ4 A;  2BYB A;  1SJA A;  2I0Z A;  1GXF A;  2Y6Q A;  2PGW A;  4IZG A;  1S3B A;  3V5C A;  2QVH A;  2P88 A;  3HPF A;  3H8A A;  3V4B A;  3CGE A;  2R46 A;  4Z24 A;  2W55 A;  3CPI G;  2BAC A;  2V61 A;  5KVI A;  3CPH G;  2R4J A;  1S2Q A;  2PP0 A;  1JRZ A;  2OAL A;  3BI5 A;  2WU2 A;  4EMI A;  3SM8 A;  1JPD X;  2TMD A;  3CGB A;  1TYP A;  4KPL A;  3TJI A;  3AEB A;  3C4A A;  4NZH A;  4G74 A;  2VRM A;  2J3N A;  1OEP A;  4A65 A;  4XWR A;  3OP2 A;  2YM1 A;  2RGH A;  3PK7 A;  2JB2 A;  2WHD A;  3CK5 A;  4TVW A;  2YLR A;  4BJZ A;  3FMW A;  3QPE A;  3LXD A;  2RGJ A;  2GGH A;  2QAE A;  2NQL A;  1O95 A;  3V3N A;  1JPM A;  1CJ2 A;  1KSU A;  4ICY A;  1NPX A;  2WU5 A;  2ZC8 A;  3AED A;  4Z43 A;  2Y6R A;  5L46 A;  3V76 A;  4Z44 A;  4H4R A;  3SN0 A;  4GAP A;  4IP4 A;  5U63 A;  4GME A;  4K2S A;  1TKK A;  2E5V A;  2UZZ A;  4NTD A;  4Z2U A;  3NGC X;  3UOZ A;  4GGB A;  4ADW A;  4AT0 A;  4RG3 A;  1ZX9 A;  5BVA A;  4HNC A;  2GDQ A;  5M0Z A;  3UKP A;  4DN1 A;  4JNQ A;  1FOH A;  4Y4L A;  1IUT A;  4D04 A;  2IID A;  1KNR A;  2B9X A;  3Q6J A;  2OZ8 A;  2VVL G;  1SJC A;  1EL9 A;  3GRS A;  1DOC A;  3UTF A;  4GYP C;  2W3R A;  1D7L A;  1STZ A;  1PN0 A;  1PXB A;  3NRZ B;  1TDN A;  4BK3 A;  2CDU A;  3UXK A;  3Q9T A;  1N4V A;  3CPJ G;  1VQZ A;  1NU5 A;  3KPF A;  1H82 A;  4K22 A;  4HN8 A;  5G5H B;  3R11 A;  1GRB A;  2R0G A;  2HXU A;  1H7X A;  4H4X A;  3BSM A;  3UOY A;  2IVE A;  3L5O A;  1NG3 A;  1PBF A;  4A5L A;  1KN0 A;  4K8G A;  4H83 A;  3ZLF A;  3SZC A;  3P1W A;  3RIT A;  3VRA A;  5KXJ A;  2YLT A;  1ONE A;  3T31 A;  4YKG A;  2BK3 A;  1OJ9 A;  2X99 A;  2YR5 A;  4H4Y A;  3OC4 A;  3P9U A;  4G73 A;  2POD A;  4MMW A;  2F5Z A;  3KD9 A;  3LB8 A;  2P8C A;  2JB1 A;  1LTX R;  3UP4 A;  2YLS A;  2Z5Y A;  4M0X A;  2ZZ0 A;  3PWI A;  2RDX A;  3OZY A;  3DFH A;  1H84 A;  3IF9 A;  2ZZC A;  3IWA A;  3VCN A;  3D8X A;  1Y56 B;  4H2H A;  1GRH A;  2FJD A;  4GRT A;  3QVP A;  4DX3 A;  3QSM A;  1CL0 A;  4NNJ A;  2R45 A;  4OPL A;  2BCG G;  3FBS A;  3G5S A;  2CHR A;  2PHH A;  3NO1 A;  4B63 A;  2OFJ A;  3AD9 B;  4FK1 A;  4B66 A;  2C3D A;  1NHR A;  1E7P A;  3MSY A;  2YQU A;  3VC6 A;  1PXC A;  4YTN A;  1JCT A;  1FEB A;  4CNK A;  1ECQ A;  4H4Q A;  2POZ A;  3T2Z A;  4GCM A;  1NG4 A;  1BKH A;  3RED A;  3R25 A;  5EBK A;  2W54 A;  1BGJ A;  2FJB A;  3FCP A;  3DEQ A;  4JDR A;  3C96 A;  1MRA A;  1ZP0 A;  3UKL A;  2X8G A;  2IVD A;  2Q0K A;  2XVF A;  2QJM A;  1F9C A;  1RYI A;  4TVY A;  1MUC A;  4U2L A;  3LJP A;  4GFI A;  1NDA A;  5C2T A;  2E5A A;  2XFQ A;  2GMJ A;  3SFD A;  1D5T A;  3GYI A;  4O5Q A;  4II2 A;  2GR0 A;  4J33 A;  2JK6 A;  1CJ3 A;  2BRA A;  2QCU A;  3F8D A;  3UJS A;  2JB3 A;  4IA6 A;  2VRL A;  5G5G B;  1TDO A;  1N4W A;  1B5Q A;  2ARD A;  2XH2 A;  2GH5 A;  3DME A;  5KNL A;  2XVJ A;  4JN7 A;  1H83 A;  3BHF A;  3GWF A;  2GAH B;  1YQZ A;  1DOB A;  5GSN A;  4OPD A;  1JEH A;  2XLR A;  3GSI A;  3EUB 3;  3BNU A;  2MNR A;  4REK A;  4XWZ A;  1Y56 A;  1BF3 A;  2VOU A;  3UXL A;  2OZ3 A;  4E0V A;  3M13 A;  2YM2 A;  1DJN A;  3SN4 A;  1D7Y A;  1MXT A;  2E1M A;  3SBF A;  4A79 A;  3ZLH A;  4HB9 A;  3ZVI A;  2ZZB A;  3AD7 B;  4A7A A;  1O5W A;  3IHM A;  1XAN A;  4APN A;  5BUK A;  4H2N A;  1GTE A;  1CF3 A;  2WPF A;  5HY5 A;  4ZA0 A;  2B9Y A;  3GDP A;  1LV0 A;  4H4V A;  1FHU A;  3K1G A;  1JRO A;  2OVL A;  5J7X A;  3D9X A;  3QTP A;  3BOX A;  4H4W A;  4HCD A;  2GQF A;  2OLN A;  2PTZ A;  2XCG A;  5JCM A;  4I59 A;  3RP8 A;  3NFU A;  2B9W A;  1GSN A;  1H81 A;  4J34 A;  2C3C A;  3STP A;  4U8P A;  2XDO A;  2YAU A;  4JN8 A;  4K8D A;  4Y4M A;  1O94 A;  1GES A;  4IVM B;  2GGE A;  4H2R A;  1OJD A;  2OQH A;  3JVA A;  4WCT A;  2XH4 A;  3JSK A;  2X3N A;  1FIQ B;  2BK5 A;  3DK9 A;  2HQM A;  1KD0 A;  1H2I A;  3BHK A;  3LZW A;  5HYM A;  3CB3 A;  5CQF A;  3HRD C;  4ENL A;  4TLX A;  3VCC A;  2H89 A;  1ZY8 A;  1XDI A;  1IUV A;  3NNE A;  1EL8 A;  1SEZ A;  2XFP A;  4Z1Y A;  3GMB A;  3HZL A;  5BRT A;  1KNP A;  3CNP A;  3ALL A;  5BUL A;  3H12 A;  3K7M X;  4GIR A;  3SR6 B;  2AKM A;  2OO6 A;  1PXA A;  4J31 A;  3C4N A;  3R0K A;  5IQ4 A;  2JBV A;  1K4Q A;  3IC9 A;  1DOD A;  2EQ8 A;  3TQP A;  2OZT A;  2WOW A;  1GER A;  3V3W A;  3WE0 A;  4TM0 A;  3FXG A;  1N1P A;  2AAQ A;  3T2Y A;  3AE8 A;  4CBQ A;  1N5X A;  3M12 A;  1D4E A;  4UP3 A;  1L9C A;  4IP5 A;  3AE4 A;  4U8N A;  3VRD B;  1TDE A;  4EIQ A;  2GR2 A;  2GR3 A;  1X2H A;  4OVI A;  1OJA A;  2VQB A;  3CT2 A;  1BGN A;  1SB3 B;  3ADA B;  3AEG A;  3AE6 A;  2WP5 A;  3SZ0 A;  4TM3 A;  4DYE A;  1FHV A;  1GRE A;  3CYJ A;  3VDG A;  3CNJ A;  3UJF A;  5ER0 A;  1JRX A;  3I4K A;  2AKZ A;  1E6E A;  3CXB A;  4IHC A;  3H8L A;  3TJ4 A;  1RSG A;  1COY A;  5HXI A;  3QLD A;  4UDR A;  5DBJ A;  1ZK7 A;  4CCR A;  1N5W C;  1R0M A;  2DKH A;  1B4V A;  3UTH A;  1FEA A;  3BI2 A;  3A7A A;  4JN9 A;  3VR8 A;  1PS9 A;  4IT1 A;  3ALJ A;  1D4C A;  3O0H A;  4A99 A;  3EEZ A;  3I6D A;  1S3E A;  4YKF A;  2JKC A;  1IUS A;  3EKG A;  2QA2 A;  3DES A;  2YVG A;  3ATR A;  3Q4D A;  1VG0 A;  3D1C A;  2OA1 A;  4H2Q A;  4RSL A;  4U8M A;  3EF6 A;  5FS9 A;  3AE9 A;  1VG9 A;  3NS1 B;  4YSY A;  4G7F A;  1E9I A;  5FS8 A;  3CTY A;  2HNE A;  2YG5 A;  3AN1 A;  2XSX A;  4DNA A;  3AE2 A;  1QO8 A;  1P48 A;  3DGH A;  4LII A;  3OZM A;  4U8O A;  3OZ2 A;  3TWA A;  2FYM A;  3P4P A;  3HYX A;  3NZG A;  1EC8 A;  3RR1 A;  4B64 A;  4ZCC A;  1Q9I A;  1WUF A;  3PVC A;  4GAV A;  1DNC A;  3GYX A;  1YQ3 A;  4H4P A;  3S61 A;  1CBO A;  3TW9 A;  4BUR A;  2Q0L A;  4II3 A;  3COX A;  4P9S A;  2CVJ A;  3GDN A;  3JZU A;  2WPE A;  1MDL A;  2VQ7 A;  3S5S A;  2NVK X;  1L9E A;  1KDG A;  1KSS A;  3ZVH B;  1P2H A;  3P4Q A;  3AE7 A;  3SZW A;  1E1K A;  3ISH A;  1PDZ A;  3LOV A;  1GND A;  1TRB A;  3MZN A;  1WUE A;  4U2S A;  5JCL A;  4G6G A;  1GEU A;  2C4C A;  3NVY B;  3DGB A;  1FFU C;  4H4T A;  3AXB A;  4E6M A;  3KVE A;  4FX9 A;  2YG6 A;  1S7M A;  2C64 A;  3T37 A;  3UTG A;  3L1R A;  1ZOV A;  5EB5 A;  2WQY A;  2CUL A;  2BC1 A;  3UP5 A;  3I6E A;  5FS6 A;  5EB4 A;  1Y0P A;  4HPN A;  1FO4 A;  2V3A A;  3ATQ A;  6ENL A;  3DGZ A;  4M6U A;  3ENL A;  3QFB A;  2FJE A;  4J56 A;  2BAB A;  4E5T A;  4BK2 A;  3MQT A;  1RM6 B;  4MKS A;  5JCK A;  2NPX A;  3CN8 A;  3P4R A;  4C3X A;  1E1L A;  4A35 A;  4B68 A;  3PWG A;  3DJD A;  1CC6 A;  5JCN A;  4J3Z A;  3ES8 A;  3JW7 A;  3U4F A;  2OG9 A;  4YWS A;  2PYX A;  3UJR A;  3K7Q X;  3NKS A;  2AL1 A;  3MUC A;  2X50 A;  2C72 A;  5KOW A;  3ALM A;  2PU0 A;  1FCD A;  1OJC A;  4FI4 A;  5J60 A;  1IUX A;  1F8R A;  3V5F A;  3AM9 A;  3OW1 A;  2FJA A;  3BI4 A;  4NEW A;  2PP1 A;  1JNZ A;  2EQ6 A;  3ES7 A;  2BS3 A;  4FP1 A;  3ZVH A;  3N4E A;  3CIR A;  4KPR A;  3NTA A;  2GB0 A;  3MWC A;  1FFV C;  2O9Z A;  2WOV A;  3PS9 A;  3DJJ A;  2P3Z A;  3KUM A;  1DOE A;  3RGT A;  3SJN A;  1BQG A;  2YR6 A;  4PAB A;  3CAW A;  4U8L A;  1DTN A;  3II4 A;  5LV9 A;  3CNS A;  4DGK A;  4JHM A;  3R10 A;  2FBW A;  1MDR A;  1V97 A;  3UKK A;  4JY2 A;  2B76 A;  4F4R A;  3AE1 A;  2OLO A;  3RCY A;  4J2W A;  3I6T A;  5GRT A;  2EQ7 A;  3DIP A;  5EOW A;  2BXS A;  4DXK A;  4E8G A;  2W0H A;  1W4X A;  3LAD A;  4NTC A;  2PU1 A;  2WP6 A;  2XH7 A;  5JCI A;  3K30 A;  3DK8 A;  1K0I A;  2PTX A;  3BNM A;  1IJH A;  3N6J A;  1N60 C;  3D46 A;  3UCL A;  3GMC A;  3SX6 A;  4D03 A;  2OKT A;  2VVL A;  4ECH A;  4EIP A;  1VQW A;  4ZN0 A;  1NEL A;  4FK1 C;  3ICR A;  4OCG A;  2H88 A;  1EBH A;  1QLB A;  1UKV G;  4B1B A;  4E4U A;  3ZYX A;  5IDZ A;  3QSS A;  2GF3 A;  2OX4 A;  3H4K A;  3P0W A;  2EQ9 A;  2QQ6 A;  4LA1 A;  1Q1W A;  3RP7 A;  3F8R A;  3FPZ A;  3SFE A;  2WP9 A;  2QGY A;  4OPI A;  4EQW A;  1TDF A;  1GRA A;  4MGG A;  4KEM A;  3CGC A;  5J04 A;  3B9J B;  3ZLG A;  2V6O A;  2E3T A;  1MO9 A;  3FYY A;  2GGI A;  2QDE A;  2C67 A;  1PBB A;  3RP6 A;  1JRY A;  3OTR A;  2DW6 A;  2GL5 A;  3NLC A;  4HA6 A;  1MOK A;  1XPY A;  4AOX A;  5JRB A;  3LZX A;  4GGH A;  4TM4 A;  1K0J A;  3SGL A;  2GQW A;  1LJ1 A;  5FJR A;  2APG A;  3AEF A;  2BK4 A;  3UCD A;  2R9Z A;  4OPU A;  4NWZ A;  4M52 A;  3FG2 P;  3DK4 A;  3M0O A;  2PTW A;  1TE6 A;  1VRQ B;  3N6H A;  4DWD A;  3GWD A;  1F3P A;  1XS2 A;  2I5Q A;  2WOI A;  2X8H A;  2C73 A;  2YG7 A;  2V3B A;  3EAO A;  2XVH A;  1KF6 A;  3KKJ A;  1OJT A;  2OAM A;  4UDP A;  1KKR A;  1IUU A;  3IHG A;  4EQS A;  2Q7V A;  3VQR A;  4LU6 A;  3E1T A;  1CC2 A;  3CGD A;  1REO A;  4A9W A;  3ABV A;  4EM4 A;  3UTE A;  1PBC A;  1LVL A;  4MJW A;  3EPT A;  1GRT A;  2RAB A;  4IL0 A;  3NRN A;  3CXO A;  2YVF A;  2PTY A;  3AYL A;  4USR A;  4AP3 A;  1P43 A;  3AEE A;  1IYX A;  3URH A;  1E1M A;  5M10 A;  3T6C A;  2GMH A;  1F6M A;  5KMQ A;  1H6V A;  3NHO X;  1PBD A;  3N4F A;  2BCP A;  3NYF A;  2BRY A;  5TR3 A;  4B67 A;  3SY4 A;  1S2Y A;  4WX1 A;  3T14 A;  3NVW B;  3SZF A;  4EQR A;  2BS2 A;  2XLP A;  1LQU A;  2W3S A;  2YWL A;  2X8C A;  5KMS A;  4NEV A;  3T9P A;  2HZG A;  3NH3 X;  1YKJ A;  3SYI A;  1ZMD A;  2P8B A;  1AOG A;  4H4Z A;  2B7S A;  1ZXI C;  1TYT A;  4EM3 A;  4YTM A;  2WET A;  1YQ4 A;  1DJQ A;  4U8I A;  1GOS A;  3GD4 A;  5U1O A;  2C65 A;  3UGV A;  2XFN A;  1SJB A;  3NIX A;  4EWJ A;  4RG4 A;  1Q1R A;  2GSH A;  2QDD A;  3UJ2 A;  5CKU A;  2R4E A;  1BZL A;  2AL2 A;  1CC4 A;  1FL2 A;  3NT6 A;  3RHA A;  4OPT A;  4AP1 A;  5FJU A;  3H70 A;  2XGZ A;  1GTH A;  2GEW A;  4N9X A;  2OPJ A;  1MNS A;  3V3O A;  1JRP A;  1GAL A;  3DDM A;  4JQ9 A;  1E1N A;  1TDK A;  3HYW A;  3AD8 B;  3CNT A;  2XLU A;  3NN0 X;  3VRB A;  1NHS A;  4B65 A;  4Z26 A;  4FDC B;  3I3L A;  1X31 B;  5KMP A;  2AQJ A;  5KRQ A;  2XLS A;  2OQY A;  4X9M A;  2Q6U A;  2ONE A;  4H50 A;  5KWF A;  4GYP A;  3TWB A;  3R1Z A;  1KKO A;  4DSH A;  3UCC A;  2QJJ A;  1YEY A;  3SXI A;  1GT8 A;  2CFY A;  1TZZ A;  2VVM A;  2WS3 A;  4ZCW A;  1EC7 A;  4USQ A;  1PHH A;  1M6I A;  1B37 A;  3S47 A;  4GDE A;  3SQP A;  1FEC A;  4UDQ A;  1F8S A;  3R07 C;  3NK2 X;  3FV9 A;  2R0C A;  3GYJ A;  3T2K A;  3DJG X;  3H8I A;  1JOA A;  3ETR B;  2GGJ A;  2GAG B;  2PCE A;  1JNR A;  4A6N B;  5FJP A;  3G5Q A;  1N4U A;  3P4S A;  3GD3 A;  4HCH A;  1ZOY A;  3CND A;  4C3Y A;  1N61 C;  4J1O A;  1WYG A;  3UJE A;  4XXG A;  1L0V A;  1X2G A;  2E4G A;  2V60 A;  2AR8 A;  2WBA A;  3FJ4 A;  2YLX A;  3KA7 A;  1VDC A;  4JNA A;  3RRA A;  5BOF A;  2TPR A;  3NK1 X;  2WDQ A;  4K5S A;  4I58 A;  4K2X A;  3DA1 A;  1VDV A;  4CNJ A;  1LPF A;  3PFR A;  4E4F A;  3K7T A;  3PG6 A;  3IJI A;  1PDH A;  3OPS A;  4AOS A;  1ZMC A;  2BA9 A;  2YLW A;  3FIM B;  1NEK A;  3QN3 A;  1JU2 A;  3A7U A;  4IVO B;  2OLA A;  1H86 A;  3KPK A;  2B7R A;  1SJD A;  2XFU A;  5KMR A;  3DG3 A;  4C74 A;  3UKH A;  3S5W A;  1ELI A;  5ENL A;  3DER A;  4KT2 A;  4YSZ A;  1JDF A;  4IA5 A;  3AEA A;  3VFC A;  4Z2T A;  2XVI A;  2RGO A;  3GO2 A;  4IL2 A;  2WEU A;  3NN6 X;  2BXR A;  3G5R A;  4A6N A;  3B97 A;  3UOX A;  4CRT A;  4GUV A;  3L8K A;  4JY3 A;  2PSN A;  1GRG A;  1CHU A;  2GVC A;  4Y4N A;  2WDR A;  1PJ6 A;  3AYI A;  4B69 A;  4YSH A;  5FJT A;  5U25 A;  3DG6 A;  3NVV B;  2YG4 A;  3B3R A;  2WES A;  4GF7 A;  2DKI A;  4OPC A;  1GV4 A;  4H2P A;  3NG7 X;  1W6T A;  4K5R A;  3DJE A;  2PGE A;  5C3J A;  4ROP A;  3NYC A;  1ZDL A;  2P0I A;  2WDV A;  2YG3 A;  3NVZ B;  4BJY A;  2VZ2 A;  3DG7 A;  5KOX A;  3UKF A;  3Q45 A;  4U2T A;  1HYU A;  4AT2 A;  4OPG A;  3ICT A;  2C66 A;  2YR4 A;  3T8Q A;  4H4S A;  1Z6L A;  2A89 A;  3F8P A;  3T0K A;  2GRT A;  1RP0 A;  2GV8 A;  4H19 A;  3BJS A;  4HYR A;  3KU9 A;  3RO6 A;  1EBG A;  4NTE A;  2YLZ A;  5HHF A;  4YWO A;  1PBE A;  1L9D A;  1GRF A;  3UOV A;  3AYJ A;  4DSG A;  2C75 A;  2C7G A;  1ZKQ A;  2XH0 A;  3U9I A;  1BWC A;  3DH9 A;  2A87 A;  1D4D A;  3SN1 A;  3VC5 A;  1BKW A;  4H1Z A;  3H7V A;  2PA6 A;  2FKP A;  4J36 A;  1QJD A;  4GDP A;  3TCS A;  1PJ7 A;  1LQT A;  1N63 C;  3TTE A;  3ITJ A;  4DHG A;  3AE3 A;  3NXL A;  4EMJ A;  2QJN A;  3AMZ A;  3MY9 A;  3CMM A;  1PJ5 A;  3QSE A;  3AEC A;  3P93 A;  3NTD A;  4ZOH B;  1ONF A;  3AE5 A;  4HNL A;  1H7W A;  1NAA A;  3GRT A;  4EMW A;  2GGG A;  2DW7 A;  2MUC A;  4G9K A;  4H4U A;  4HCL A;  2C70 A;  4YXD A;  4EQX A;  1N62 C;  1CJC A;  4A6G A;  1R6W A;  4U8K A;  3P3B A;  1E39 A;  4YTP A;  4X4J A;  4A3R A;  1XHC A;  2BS4 A;  2A8X A;  1KFY A;  3SQS A;  2Z5X A;  3KLJ A;  3MKC A;  1K0L A;  2PS2 A;  3AWI A;  1KCZ A;  4G8T A;  1L8P A;  5EU9 A;  3D47 A;  2XVE A;  3T4W A;  4TM1 A;  2QA1 A;  2V5Z A;  3AB1 A;  2C76 A;  3NK0 X;  4GIS A;  2AL2 B;  3NYE A;  2GR1 A;  3VA8 A;  3UKQ A;  2XLT A;  3HYV A;  3VR9 A;  3QVR A;  5BOE A;  1NHP A;  3RNM A;  4G6H A;  3EAN A;  4BK1 A;  3TOY A;  4Z17 A;  2BC0 A;  2XYO A;  3GD6 A;  2YVJ A;  3B6D A;  1V59 A;  3FVD A;  2ZBW A;  2XFO A;  1RVK A;  3IJL A;  4IV9 A;  4BV6 A;  3THU A;  4YT0 A;  2PP3 A;  1EL5 A;  2JAE A;  2HXT A;  3GC2 A;  4J57 A;  1ELS A;  3UKA A;  1IUW A;  4TLZ A;  4X9N A;  4U8J A;  4O5U A;  3GY1 A;  5IPY A;  3PO7 A;  2ACZ A;  1DXL A;  5KVH A;  1XPQ A;  1PDY A;  1B8S A;  1EL7 A;  3ICS A;  1T3Q C;  3DFY A;  3QKE A;  4CY8 A;  2PMQ A;  1CJ4 A;  3ZDN A;  4YSX A;  2PPG A;  4CCQ A;  4H7U A;  1M64 A;  4Z2R A;  1F8W A;  3HW2 A;  4KX6 A;  3A7R A;  4PAA A;  1EBD A;  4CY6 A;  3R0U A;  7ENL A;  3IK4 A;  1EC9 A;  5FJO A;  2ZAD A;  3R9U A;  1GET A;  4GR1 A;  4X2P A;  5FMH A;  1P2E A;  4ZCD A;  2R0P A;  2WPC A;  5IQ1 A;  3SSZ A;  4KWS A;  4C5O A;  3QFA A;  1NHQ A;  4C77 A;  4Z25 A;  1GPE A;  4K7Z A; 
#chains in the Genus database with same CATH homology
 1NEN A;  2WPF A;  1ZOY A;  3CND A;  5HY5 A;  2B9Y A;  2EQ6 A;  5FS7 A;  3GDP A;  4C3Y A;  1YY5 A;  2BS3 A;  3QJ4 A;  1LV0 A;  4XXG A;  4H4V A;  4KPR A;  3CIR A;  3NTA A;  2GB0 A;  1L0V A;  2BYB A;  5J7X A;  3D9X A;  2E4G A;  2O9Z A;  2V60 A;  2I0Z A;  1GXF A;  2WBA A;  2AR8 A;  2WOV A;  4H4W A;  3PS9 A;  2Y6Q A;  3DJJ A;  2YLX A;  3UTH A;  3KA7 A;  1S3B A;  1DOE A;  1VDC A;  2GQF A;  2OLN A;  4JNA A;  2XCG A;  5JCM A;  4I59 A;  2TPR A;  3NK1 X;  2YR6 A;  4PAB A;  2WDQ A;  3RP8 A;  4K5S A;  3CGE A;  4U8L A;  2R46 A;  2B9W A;  3II4 A;  4Z24 A;  3CPI G;  2BAC A;  4I58 A;  4UDP A;  3CNS A;  1GSN A;  1H81 A;  2V61 A;  5LV9 A;  4DGK A;  4K2X A;  5KVI A;  4J34 A;  2C3C A;  3CPH G;  2R4J A;  1S2Q A;  3DA1 A;  4CNJ A;  4U8P A;  1JRZ A;  2OAL A;  2XDO A;  3BI5 A;  1LPF A;  2FBW A;  2WU2 A;  2YAU A;  4EMI A;  4K8D A;  4Y4M A;  3UKK A;  4JY2 A;  1O94 A;  2B76 A;  3K7T A;  1GES A;  3AE1 A;  3SM8 A;  3PG6 A;  4IVM B;  2TMD A;  1PDH A;  2OLO A;  4H2R A;  1OJD A;  4AOS A;  1ZMC A;  4J2W A;  2BA9 A;  5GRT A;  2EQ7 A;  4WCT A;  3CGB A;  3JSK A;  1TYP A;  2YLW A;  2X3N A;  2BK5 A;  5EOW A;  2BXS A;  3DK9 A;  2W0H A;  3AEB A;  3C4A A;  4NZH A;  4G74 A;  3FIM B;  1NEK A;  1W4X A;  2HQM A;  3LAD A;  2VRM A;  4NTC A;  2WP6 A;  2J3N A;  1H2I A;  5JCI A;  3BHK A;  3LZW A;  4A65 A;  5HYM A;  3K30 A;  4XWR A;  3DK8 A;  2YM1 A;  2RGH A;  1JU2 A;  1K0I A;  5CQF A;  4IVO B;  2JB2 A;  2WHD A;  3BNM A;  1H86 A;  1IJH A;  4TLX A;  2H89 A;  3KPK A;  1ZY8 A;  3UCL A;  3GMC A;  2YLR A;  1XDI A;  1IUV A;  3NNE A;  3SX6 A;  4BJZ A;  4D03 A;  1EL8 A;  2B7R A;  1SEZ A;  2XFP A;  2VVL A;  4ECH A;  4EIP A;  2XFU A;  3FMW A;  3GMB A;  5KMR A;  3LXD A;  3HZL A;  1VQW A;  2RGJ A;  5BRT A;  4ZN0 A;  1KNP A;  2QAE A;  3V3N A;  1O95 A;  4C74 A;  4FK1 C;  3ICR A;  1CJ2 A;  3CNP A;  3ALL A;  4OCG A;  3UKH A;  2H88 A;  3S5W A;  5BUL A;  3K7M X;  1QLB A;  1UKV G;  4B1B A;  3ZYX A;  1ELI A;  1KSU A;  4ICY A;  3QSS A;  1PXA A;  4J31 A;  3C4N A;  4YSZ A;  1NPX A;  2GF3 A;  2WU5 A;  4IA5 A;  5IQ4 A;  3AED A;  3H4K A;  4Z43 A;  2EQ9 A;  2JBV A;  3AEA A;  1K4Q A;  4LA1 A;  1Q1W A;  4Z2T A;  2XVI A;  3IC9 A;  2RGO A;  3RP7 A;  1DOD A;  3F8R A;  2EQ8 A;  2WEU A;  3FPZ A;  3SFE A;  2Y6R A;  5L46 A;  3NN6 X;  2WOW A;  3V76 A;  4Z44 A;  2WP9 A;  1GER A;  2BXR A;  4H4R A;  3G5R A;  3WE0 A;  4A6N A;  4GAP A;  3UOX A;  4OPI A;  4TM0 A;  4EQW A;  1TDF A;  1GRA A;  4CRT A;  5U63 A;  4GUV A;  3L8K A;  1N1P A;  4JY3 A;  2AAQ A;  3CGC A;  2E5V A;  3T2Y A;  3AE8 A;  2UZZ A;  4NTD A;  1GRG A;  1CHU A;  3NGC X;  4CBQ A;  2GVC A;  4Z2U A;  3M12 A;  4Y4N A;  1D4E A;  2WDR A;  1PJ6 A;  2V6O A;  3AYI A;  4UP3 A;  3UOZ A;  1L9C A;  4B69 A;  4ADW A;  4AT0 A;  3AE4 A;  4RG3 A;  1ZX9 A;  4U8N A;  4YSH A;  1MO9 A;  5M0Z A;  3VRD B;  5BVA A;  1TDE A;  2C67 A;  1PBB A;  4JNQ A;  3UKP A;  3RP6 A;  1JRY A;  5U25 A;  4EIQ A;  2YG4 A;  1FOH A;  2GR2 A;  3B3R A;  2GR3 A;  2WES A;  4GF7 A;  4Y4L A;  3NLC A;  4HA6 A;  1MOK A;  1IUT A;  2DKI A;  4OVI A;  4AOX A;  4OPC A;  4D04 A;  1GV4 A;  5JRB A;  1KNR A;  1OJA A;  2IID A;  2VQB A;  2B9X A;  3LZX A;  4TM4 A;  3Q6J A;  4H2P A;  1BGN A;  2VVL G;  3ADA B;  3AEG A;  3AE6 A;  3NG7 X;  2WP5 A;  1K0J A;  3SGL A;  3SZ0 A;  2GQW A;  4K5R A;  3DJE A;  1LJ1 A;  4TM3 A;  2APG A;  1EL9 A;  3GRS A;  5C3J A;  1GRE A;  1DOC A;  3AEF A;  3UTF A;  2BK4 A;  2R9Z A;  4OPU A;  4NWZ A;  4M52 A;  3CNJ A;  1D7L A;  3FG2 P;  5ER0 A;  1PN0 A;  3NYC A;  1ZDL A;  1JRX A;  2WDV A;  1PXB A;  2YG3 A;  3DK4 A;  3M0O A;  4BJY A;  1TDN A;  4BK3 A;  1VRQ B;  2VZ2 A;  1E6E A;  5KOX A;  3UKF A;  2CDU A;  3Q9T A;  1N4V A;  3CPJ G;  3H8L A;  1RSG A;  1COY A;  5HXI A;  4U2T A;  1HYU A;  3GWD A;  4AT2 A;  1F3P A;  4OPG A;  3ICT A;  3KPF A;  4UDR A;  2WOI A;  1H82 A;  2C66 A;  2YR4 A;  4K22 A;  5DBJ A;  4H4S A;  2X8H A;  1Z6L A;  2C73 A;  2A89 A;  3F8P A;  1GRB A;  1ZK7 A;  2YG7 A;  2V3B A;  2R0G A;  2GRT A;  3EAO A;  1RP0 A;  2GV8 A;  2XVH A;  3T0K A;  1KF6 A;  3KKJ A;  3KU9 A;  1OJT A;  2DKH A;  2OAM A;  1B4V A;  2YLZ A;  1FEA A;  1H7X A;  3BI2 A;  4NTE A;  4YWO A;  1PBE A;  1IUU A;  4JN9 A;  1L9D A;  1GRF A;  3UOV A;  4H4X A;  3IHG A;  3VR8 A;  4EQS A;  1PS9 A;  2Q7V A;  3ALJ A;  3VQR A;  1D4C A;  3O0H A;  4LU6 A;  3AYJ A;  3E1T A;  3UOY A;  4A99 A;  4DSG A;  2C75 A;  2C7G A;  1CC2 A;  3CGD A;  1REO A;  2IVE A;  4A9W A;  3I6D A;  1S3E A;  3ABV A;  4YKF A;  2JKC A;  4EM4 A;  1IUS A;  3L5O A;  1NG3 A;  1ZKQ A;  2QA2 A;  1PBF A;  4K7Z A;  2YVG A;  1BWC A;  3ATR A;  3UTE A;  3DH9 A;  4A5L A;  1PBC A;  1KN0 A;  1D4D A;  2A87 A;  1LVL A;  4MJW A;  1VG0 A;  3EPT A;  3SZC A;  3P1W A;  1GRT A;  3D1C A;  3VRA A;  5KXJ A;  2RAB A;  2OA1 A;  3NRN A;  4H2Q A;  4RSL A;  4U8M A;  1BKW A;  3EF6 A;  5FS9 A;  2YLT A;  2YVF A;  3T31 A;  3AE9 A;  3AYL A;  1QJD A;  1VG9 A;  4GDP A;  4J36 A;  1PJ7 A;  4USR A;  4AP3 A;  4YSY A;  1LQT A;  3AEE A;  4YKG A;  2BK3 A;  1OJ9 A;  5FS8 A;  2X99 A;  3URH A;  1E1M A;  2YR5 A;  5M10 A;  4H4Y A;  3OC4 A;  3P9U A;  3ITJ A;  4G73 A;  2GMH A;  3CTY A;  2F5Z A;  1F6M A;  2YG5 A;  1H6V A;  3AE3 A;  3KD9 A;  3NHO X;  5KMQ A;  1PBD A;  3LB8 A;  2BCP A;  4DNA A;  3AE2 A;  2JB1 A;  1LTX R;  3NYF A;  1QO8 A;  3UP4 A;  2YLS A;  3DGH A;  2BRY A;  4EMJ A;  5TR3 A;  4LII A;  4B67 A;  4U8O A;  2Z5Y A;  3SY4 A;  2ZZ0 A;  3OZ2 A;  1S2Y A;  3CMM A;  4WX1 A;  3T14 A;  3SZF A;  4EQR A;  2BS2 A;  3P4P A;  2XLP A;  1PJ5 A;  1H84 A;  3IF9 A;  2ZZC A;  3IWA A;  3QSE A;  3HYX A;  3D8X A;  1LQU A;  3AEC A;  1Y56 B;  4B64 A;  4ZCC A;  2YWL A;  1GRH A;  2X8C A;  2FJD A;  3NTD A;  1ONF A;  4GRT A;  3QVP A;  3AE5 A;  5KMS A;  1Q9I A;  3QSM A;  1CL0 A;  4NEV A;  3PVC A;  4GAV A;  1H7W A;  1NAA A;  3GRT A;  1DNC A;  3NH3 X;  1YKJ A;  3SYI A;  1ZMD A;  4EMW A;  3GYX A;  1AOG A;  4NNJ A;  1YQ3 A;  2R45 A;  4H4Z A;  4H4P A;  4G9K A;  3S61 A;  1CBO A;  2B7S A;  4OPL A;  1TYT A;  4H4U A;  4EM3 A;  2BCG G;  2C70 A;  3FBS A;  4YXD A;  4YTM A;  4EQX A;  1CJC A;  2WET A;  1YQ4 A;  4BUR A;  1DJQ A;  3G5S A;  4U8I A;  1GOS A;  2Q0L A;  4II3 A;  4U8K A;  2PHH A;  1E39 A;  3GD4 A;  5U1O A;  3COX A;  4B63 A;  4YTP A;  4P9S A;  3AD9 B;  4X4J A;  4FK1 A;  2C65 A;  4B66 A;  2C3D A;  2CVJ A;  1NHR A;  1XHC A;  3GDN A;  2WPE A;  2BS4 A;  2A8X A;  2VQ7 A;  1E7P A;  1KFY A;  2Z5X A;  3KLJ A;  2YQU A;  1K0L A;  2XFN A;  2NVK X;  1L9E A;  3AWI A;  1PXC A;  4YTN A;  1KDG A;  1KSS A;  3NIX A;  1FEB A;  4CNK A;  1Q1R A;  1P2H A;  4RG4 A;  3P4Q A;  4H4Q A;  3AE7 A;  3SZW A;  1E1K A;  3ISH A;  5CKU A;  2R4E A;  3LOV A;  1BZL A;  3T2Z A;  2XVE A;  1GND A;  4CCR A;  4GCM A;  1CC4 A;  1FL2 A;  3NT6 A;  4TM1 A;  1NG4 A;  2QA1 A;  3RHA A;  2V5Z A;  4OPT A;  4AP1 A;  1TRB A;  3AB1 A;  3RED A;  2C76 A;  4U2S A;  3NK0 X;  5JCL A;  5EBK A;  1GTH A;  3NYE A;  4G6G A;  2GEW A;  1BGJ A;  2GR1 A;  2FJB A;  3UKQ A;  2XLT A;  3HYV A;  3VR9 A;  4N9X A;  4JDR A;  3C96 A;  3QVR A;  1GEU A;  1NHP A;  1ZP0 A;  3RNM A;  4G6H A;  3UKL A;  3EAN A;  3V3O A;  4BK1 A;  1GAL A;  2C4C A;  4JQ9 A;  2BC0 A;  1E1N A;  2XYO A;  2X8G A;  2YVJ A;  1TDK A;  3B6D A;  1V59 A;  3HYW A;  2IVD A;  2ZBW A;  2XFO A;  3AD8 B;  2Q0K A;  4H4T A;  2XLU A;  2XVF A;  3CNT A;  3NN0 X;  3AXB A;  4IV9 A;  3VRB A;  4BV6 A;  1RYI A;  3KVE A;  4FX9 A;  1NHS A;  4YT0 A;  4B65 A;  2YG6 A;  1S7M A;  2C64 A;  4FDC B;  1EL5 A;  3I3L A;  3LJP A;  1X31 B;  4U2L A;  3T37 A;  4Z26 A;  3UTG A;  1NDA A;  5C2T A;  2XFQ A;  5KMP A;  2JAE A;  3L1R A;  2GMJ A;  1ZOV A;  3SFD A;  5EB5 A;  2AQJ A;  2WQY A;  1D5T A;  2CUL A;  3GYI A;  5KRQ A;  4J57 A;  4O5Q A;  2BC1 A;  2GR0 A;  4J33 A;  2XLS A;  4II2 A;  3UP5 A;  2JK6 A;  5FS6 A;  3UKA A;  1CJ3 A;  1IUW A;  4TLZ A;  4X9N A;  1Y0P A;  2BRA A;  4X9M A;  5EB4 A;  2Q6U A;  2QCU A;  4U8J A;  4O5U A;  3F8D A;  2V3A A;  4H50 A;  3ATQ A;  5IPY A;  5KWF A;  2JB3 A;  3DGZ A;  3PO7 A;  3QFB A;  2VRL A;  4IA6 A;  2ACZ A;  1TDO A;  2FJE A;  1DXL A;  4J56 A;  1N4W A;  4DSH A;  1B5Q A;  1XPQ A;  2BAB A;  2ARD A;  2GH5 A;  4BK2 A;  3DME A;  5KNL A;  2XVJ A;  1H83 A;  3BHF A;  3GWF A;  5JCK A;  1B8S A;  2NPX A;  1YQZ A;  1EL7 A;  2GAH B;  3CN8 A;  1DOB A;  3P4R A;  4OPD A;  5GSN A;  1JEH A;  4C3X A;  2XLR A;  3GSI A;  3ICS A;  3SXI A;  4CY8 A;  1GT8 A;  1CJ4 A;  2CFY A;  1E1L A;  3ZDN A;  4YSX A;  4B68 A;  3BNU A;  4CCQ A;  4H7U A;  2VVM A;  2WS3 A;  3DJD A;  4USQ A;  4REK A;  4XWZ A;  1CC6 A;  1M64 A;  1Y56 A;  1BF3 A;  5JCN A;  2VOU A;  4Z2R A;  1F8W A;  1PHH A;  4KX6 A;  1M6I A;  1B37 A;  4E0V A;  3M13 A;  4GDE A;  4PAA A;  3SQP A;  2YM2 A;  2PYX A;  1DJN A;  3K7Q X;  1EBD A;  4CY6 A;  1FEC A;  3NKS A;  1D7Y A;  4UDQ A;  2X50 A;  1MXT A;  1F8S A;  3NK2 X;  2E1M A;  2R0C A;  3GYJ A;  2C72 A;  3T2K A;  3DJG X;  3H8I A;  4A79 A;  5KOW A;  1JOA A;  4HB9 A;  2ZZB A;  3ALM A;  3R9U A;  1GET A;  4GR1 A;  5FMH A;  1FCD A;  2GAG B;  3AD7 B;  1JNR A;  1OJC A;  1O5W A;  1P2E A;  4A7A A;  4ZCD A;  3IHM A;  2R0P A;  1XAN A;  2WPC A;  1IUX A;  1F8R A;  2FJA A;  3BI4 A;  4APN A;  5IQ1 A;  5J60 A;  4A6N B;  4NEW A;  5HHF A;  5BUK A;  4C5O A;  3QFA A;  1NHQ A;  1JNZ A;  3G5Q A;  4C77 A;  4Z25 A;  1N4U A;  1GPE A;  4H2N A;  3P4S A;  1GTE A;  3GD3 A;  1CF3 A;  5KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...