3O0HA

Crystal structure of glutathione reductase from bartonella henselae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
460
structure length
455
Chain Sequence
SFDFDLFVIGSGSGGVRAARLAGALGKRVAIAEEYRIGGTCVIRGCVPKKLYFYASQYAQEFSKSIGFGWKYADPIFNWEKLVAAKNKEISRLEGLYREGLQNSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNIKGSDLCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQVQSTENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFETTPDYDLITTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESRIVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSYVYENGEKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione reductase
publication title Crystal structure of glutathione reductase from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
total genus 145
structure length 455
sequence length 460
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3o0hA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA02
3AE2A 2RGHA 2VQ7A 1O5WA 1GOSA 4KX6A 3GYJA 3C4NA 4AOSA 2R0GA 1DOBA 2IIDA 2TMDA 3L1RA 2FJDA 4CRTA 3NN6X 1PXAA 4A5LA 3AYJA 3K7TA 4U8OA 4WCTA 4B68A 4CNJA 2AQJA 2OA1A 2YM2A 3BNUA 2YVGA 1MOKA 2C67A 4GDPA 4NTEA 1RP0A 1FECA 2JKCA 3QVPA 2NPXA 5JCIA 4C77A 1KF6A 2C72A 4D03A 4CCQA 4EIQA 3D8XA 2QA2A 4TM4A 1Q1RA 3T37A 1IUVA 4U2LA 2X8CA 3NHOX 3IWAA 4UDQA 3BI2A 5J7XA 5EB4A 4B66A 1K0LA 4ADWA 4NZHA 2WBAA 2ZZ0A 1CJCA 2V3AA 3ITJA 2IVEA 3DMEA 2GR1A 5U1OA 1BKWA 4DGKA 2GR0A 3CPHG 3PS9A 2XVJA 3NK1X 1LQTA 2F5ZA 3NK0X 3UKPA 3UOZA 2O9ZA 1EL8A 1ZKQA 1IUTA 1OJTA 3I3LA 2WDQA 2GB0A 3LZWA 4YKGA 2GVCA 1GEUA 1W4XA 2WP5A 2YQUA 1JRXA 3NIXA 4B65A 2WPEA 4OPDA 4RSLA 3NNEA 4OVIA 3CNPA 3ALJA 2VVLA 2W0HA 5M0ZA 1XHCA 4X4JA 3CGBA 2BS2A 4JNAA 4H4VA 2GMJA 1JNRA 4EQWA 3C4AA 2BC1A 1LV0A 1Z6LA 5IQ1A 1E1KA 2FBWA 1GRFA 4NEVA 3QSEA 4TLZA 3UTHA 2JAEA 5KWFA 1B4VA 2C70A 1S3BA 1F8WA 4AT2A 4D04A 4CBQA 1KFYA 4PAAA 3LB8A 1E1LA 1ZDLA 3NTDA 2ZZBA 3CNJA 3PVCA 4ECHA 3P4SA 2YLRA 3UKQA 5FS8A 4ZN0A 3B3RA 1F3PA 4XWZA 2CFYA 2YWLA 4YSHA 1KNRA 3LXDA 1QJDA 3LOVA 4C3XA 1IJHA 3DK4A 3GD3A 1K0IA 1PJ6A 2BCPA 3ICSA 4YTNA 1VQWA 3GRSA 1ZOVA 3CGEA 5L46A 1N4VA 4J2WA 5BULA 3GMCA 5ER0A 1P2HA 2GEWA 4Z26A 4GCMA 1XDIA 2C65A 1K4QA 1LJ1A 2XVEA 4U8NA 2X99A 4GDEA 4JNQA 2Z5XA 1YKJA 3NH3X 4TM3A 4OPUA 4BJZA 1PXBA 2GRTA 2DKHA 4EQSA 2YVJA 4BK1A 4E0VA 2R4EA 3GD4A 2APGA 2CVJA 3AEEA 1D4DA 2YR6A 3IC9A 3GMBA 3DJEA 3KD9A 1K0JA 1N4UA 2XFUA 1Y0PA 2E4GA 1ZK7A 1CF3A 1Y56A 1YQ4A 2OAMA 2WS3A 1DJNA 3CTYA 3HZLA 1KSSA 3CGCA 3ATQA 4FK1A 1TDKA 4MJWA 4GUVA 3UOXA 4APNA 1PBFA 1JNZA 3ISHA 2B76A 3PO7A 3ZYXA 1GPEA 1ONFA 3RHAA 1IUXA 3LJPA 1CHUA 1FEAA 4U8PA 4Y4LA 4Y4NA 4H7UA 2XDOA 2Y6QA 1S2QA 3UOVA 1DOEA 3QSSA 4C5OA 4Y4MA 1JRYA 1NHSA 2ARDA 3CNSA 3NKSA 4H4TA 3S5WA 1O95A 1NHPA 4BURA 2WDRA 3GWDA 5C2TA 2C3DA 2Q0LA 2XLUA 2WHDA 3AEFA 1NENA 4B63A 3R9UA 4AT0A 1JRZA 2BK4A 2WETA 2FJBA 4CNKA 4DSHA 1AOGA 5JCKA 4N9XA 3VRBA 1DODA 1VG9A 3CN8A 4H4QA 3AEGA 1L9EA 3RP7A 2ACZA 4KPRA 2H88A 1E6EA 1VG0A 4EMWA 2A87A 1NHRA 4H2QA 1BZLA 2RGJA 3AE6A 4TM1A 2B7SA 2XLTA 3F8DA 1BGJA 3AD8B 2QCUA 3V3NA 2OALA 2QA1A 1H7WA 3AE8A 4NTDA 1S3EA 2JBVA 3QVRA 2WPCA 4J31A 4CY6A 4HB9A 1VDCA 3KU9A 4J34A 2Q0KA 2WU2A 1NG4A 3COXA 1JEHA 2EQ6A 3GRTA 5KVIA 1TRBA 1M6IA 4EMJA 2YG7A 2XFPA 4M52A 1LQUA 1REOA 4XWRA 4J57A 2GV8A 3H4KA 2J3NA 3ALLA 3K7QX 5HXIA 2XVIA 3LADA 3AE1A 2V5ZA 4U8IA 1DXLA 2R9ZA 3OZ2A 3NRNA 5IPYA 1D5TA 4WX1A 4YXDA 5FS7A 2X8HA 1PBDA 2I0ZA 3KLJA 4U2TA 4Z2UA 2C7GA 5LV9A 4AP1A 1IUWA 3E1TA 1NG3A 3BI5A 4U8JA 2EQ7A 1JOAA 5KXJA 3AD9B 3AEDA 4K22A 4LIIA 1COYA 2B7RA 1O94A 1GXFA 4K8DA 2IVDA 2EQ8A 4UP3A 1IUUA 2B9WA 3GSIA 4UDRA 4A9WA 1PHHA 3AE3A 3GWFA 2X8GA 2NVKX 3DJGX 3EF6A 1EL5A 5KVHA 3UKKA 3UTEA 3REDA 1PJ5A 5EBKA 1N4WA 1QO8A 4HA6A 3DJJA 4BK3A 2OLOA 1X31B 4K7ZA 2GF3A 3G5RA 4BK2A 4REKA 2C73A 2GQFA 3V76A 2WOVA 1BGNA 1CBOA 3S61A 1CC6A 1EBDA 3VR9A 4A79A 1DOCA 3NGCX 1L9DA 1NAAA 1PJ7A 4GF7A 4Z2RA 2V60A 1VRQB 3FPZA 4A6NA 5BUKA 1CJ2A 2VZ2A 2YLSA 4JY3A 3VQRA 4H4SA 2XLSA 2ZZCA 4IA6A 2GMHA 3LZXA 4U2SA 3H8IA 4TM0A 5CQFA 5IQ4A 4TLXA 4DNAA 4OPGA 1ZOYA 1GESA 3DA1A 1F8RA 4LU6A 2BXRA 5JCNA 5GRTA 1IUSA 3P1WA 5JCMA 1CJ3A 2R0CA 1PBEA 2BK5A 2BS4A 3AB1A 1GSNA 5JCLA 3BHFA 3URHA 2WU5A 4YTPA 5FMHA 1H81A 2JB1A 3ICRA 4JDRA 1ZY8A 2C3CA 1LTXR 4Z44A 3NYCA 2TPRA 4ZCDA 2C75A 4B1BA 2VRLA 1FL2A 2BS3A 1H83A 5FS6A 2V61A 5BRTA 5EOWA 5KOWA 3M0OA 2Q6UA 3P4RA 1F8SA 3EPTA 2GR3A 2A8XA 3II4A 3FG2P 2XCGA 3EAOA 4I59A 1JU2A 4GR1A 5M10A 1UKVG 3P4PA 1ZMCA 5CKUA 3V3OA 1GV4A 4H4PA 2YG3A 4CCRA 4H2NA 1B37A 4JN9A 3SFDA 4Z43A 3AWIA 3ZDNA 5U63A 4JQ9A 4AP3A 3ABVA 4EIPA 3CPIG 4IV9A 4AOXA 4RG4A 3NG7X 1OJAA 3QFAA 1DNCA 3UP5A 1H84A 3RP6A 4B69A 4GRTA 1L9CA 2E1MA 1GETA 2GAHB 1PN0A 3D1CA 2RABA 3KKJA 1XANA 1MXTA 1B8SA 3QJ4A 5HY5A 1NEKA 5J60A 3CPJG 3GYIA 4BV6A 1GNDA 3M12A 2JK6A 3DGZA 3OC4A 1E7PA 2XVFA 5BVAA 3DK9A 2YLWA 1KSUA 3AYIA 1FCDA 1TDEA 2UZZA 1CL0A 2OLNA 1YQ3A 1MO9A 1BWCA 3NN0X 1TYPA 4NEWA 3AXBA 3B6DA 5DBJA 1QLBA 2C64A 3ATRA 2V3BA 1NHQA 3AE4A 3P4QA 5HYMA 4YSZA 3K7MX 4IVMB 1B5QA 1NPXA 4U8KA 4FDCB 4H4YA 1NDAA 2GQWA 3P9UA 4ICYA 1FEBA 2XLRA 4EM3A 2YLTA 4K5SA 1D7LA 4FK1C 4Z2TA 2R46A 4A6NB 2B9YA 2YLZA 1OJCA 3BNMA 1H6VA 2VQBA 4BJYA 2C66A 1ZP0A 2YG4A 3UTFA 2XFQA 1N1PA 2Q7VA 4U8LA 2YG6A 3AECA 3KVEA 3SGLA 3AEBA 4X9NA 1GRAA 1F6MA 2H89A 4J36A 2R4JA 3NYFA 2BYBA 1ELIA 3KA7A 4ZCCA 2XVHA 3VR8A 3K30A 3QFBA 1OJDA 2WPFA 2FJEA 2WEUA 4H50A 3AYLA 3NYEA 1GREA 3H8LA 1CC4A 4YTMA 3BHKA 4O5UA 3DH9A 4Z24A 4K5RA 2BA9A 2WP9A 2XFOA 4B67A 2AR8A 2QAEA 2JB2A 1GRGA 4H4RA 3IHMA 4A65A 4A99A 2GH5A 3JSKA 1GALA 2CDUA 1Y56B 3AE9A 3DJDA 4H4UA 4USQA 2RGOA 4DSGA 2DKIA 4UDPA 3UP4A 3DGHA 5EB5A 3F8RA 3UKFA 1V59A 1Q1WA 1PDHA 3UCLA 3VRAA 1EL9A 3AE5A 4EQXA 3UKHA 2AAQA 2HQMA 1YY5A 3SFEA 3ALMA 2GR2A 1BF3A 1H7XA 3AD7B 3FIMB 1ZMDA 2YR4A 1GERA 1DJQA 1D7YA 1CC2A 3FBSA 1GTHA 4OPIA 1PBBA 3EANA 4B64A 1H82A 2XFNA 4OPCA 2PYXA 3UOYA 4YSXA 1PBCA 1PXCA 2WQYA 2BC0A 4NTCA 4J33A 2R45A 2YAUA 1TYTA 1TDFA 2BK3A 3GDPA 3I6DA 4YKFA 2VVLG 5GSNA 4IVOB 3AEAA 3RP8A 3M13A 1D4EA 4C74A 2WOWA 4YSYA 4H2PA 5U25A 3WE0A 1GRTA 1E1MA 1GRHA 4IA5A 3L8KA 3NLCA 4CY8A 5KOXA 1EL7A 3QSMA 1D4CA 1L0VA 2XYOA 3NTAA 4FX9A 3UTGA 2WP6A 2Y6RA 3CIRA 2WOIA 4X9MA 2CULA 2E5VA 4YT0A 4OPTA 2C76A 1S2YA 2B9XA 4K2XA 1H86A 3GDNA 3IF9A 2WESA 2R0PA 1GT8A 3SQPA 3Q6JA 2YG5A 2YM1A 3CNDA 3SM8A 4JY2A 4USRA 4H4ZA 2BABA 5C3JA 3IHGA 4U8MA 3UKLA 2YLXA 3AE7A 3Q9TA 5HHFA 3O0HA 3RNMA 1P2EA 1GTEA 1ZX9A 3NT6A 2FJAA 4J56A 5FS9A 1LVLA 1PS9A 1FOHA 1E1NA 5KRQA 4EQRA 1M64A 4OPLA 2GAGB 4XXGA 3F8PA 5TR3A 4I58A 3G5SA 1Q9IA 2BXSA 2Z5YA 1KNPA 1OJ9A 2V6OA 2EQ9A 3VRDB 3DK8A 2BACA 2YVFA 2WDVA 2A89A 3CNTA 2X3NA 3NK2X 3UKAA 3KPFA 2YR5A 3ADAB 2VRMA 4Z25A 3CGDA 1KDGA 4C3YA 1SEZA 4PABA 4H4XA 4H2RA 3FMWA 4EM4A 3G5QA 4A7AA 1YQZA 1XPQA 4O5QA 4LA1A 4YWOA 1HYUA 1RYIA 2BCGG 4H4WA 3C96A 4RG3A 1TDNA 1LPFA 1TDOA 1RSGA 2VVMA 4P9SA 2PHHA 2VOUA 2XLPA 3ICTA 4OCGA 2X50A 1GRBA 1CJ4A 2ZBWA 1E39A 2JB3A 4EMIA 3BI4A
chains in the Genus database with same CATH superfamily
4EWJA 2VQ7A 4KX6A 3GYJA 3CAWA 4AOSA 3L1RA 1W6TA 1ELSA 1BKHA 5FJTA 4CNJA 3R10A 2OA1A 3P0WA 2YVGA 2JKCA 5JCIA 3S47A 4CCQA 3D8XA 2QA2A 4TM4A 3T37A 1IUVA 4U2LA 3BI2A 4ADWA 1BKWA 4DGKA 4Z1YA 2XVJA 3TOYA 2O9ZA 1IUTA 1OJTA 1N63C 1FFVC 1W4XA 4B65A 3HPFA 2XGZA 4RSLA 4E8GA 1XHCA 4GIRA 1Z6LA 2FBWA 3I4KA 3FXGA 4IL0A 1S3BA 4GYPC 1KFYA 3NFUA 3PVCA 1XPYA 4ECHA 5FJPA 2OZ3A 3B3RA 4YSHA 1QJDA 3TWAA 1PJ6A 2POZA 2AL2A 3CGEA 1N4VA 4J2WA 2GEWA 1XDIA 1K4QA 1LJ1A 3B97A 2Z5XA 4TM3A 2GRTA 2DKHA 2GGEA 2APGA 2CVJA 3DJEA 3KD9A 2WS3A 4FK1A 2PODA 4DX3A 3PO7A 2B76A 3ZYXA 3RHAA 3LJPA 4U8PA 5FJOA 1H2IA 2Y6QA 4MKSA 2OZ8A 3QSSA 4HN8A 4Y4MA 4C5OA 2ARDA 3S5WA 1O95A 2C3DA 1NENA 4G6GA 4AT0A 2BK4A 1P48A 1N5XA 2FJBA 1AOGA 3VRBA 1L9EA 3RP7A 2P88A 3OPSA 4EMWA 1NHRA 2RGJA 3AD8B 3V3NA 3VC5A 2OALA 2XSXA 4G9KA 3H7VA 1S3EA 4HB9A 5FJUA 1VDCA 2Q0KA 2WU2A 2XFPA 2AL2B 4M52A 1T3QC 4GISA 4XWRA 3H4KA 2AKMA 3K7QX 4A35A 5IPYA 4YXDA 2PTWA 2X8HA 3D47A 1PBDA 3BI5A 4TVWA 2EQ7A 3AEDA 3FV9A 1PDZA 1GXFA 2EQ8A 1IUUA 3GSIA 1PHHA 1EL5A 2NVKX 3UTEA 3GC2A 5KVHA 1X2HA 3UJFA 1WUEA 1N4WA 2E3TA 4BK3A 2OLOA 1X31B 2GF3A 3DDMA 3G5RA 3T14A 2C73A 4M6UA 4DXKA 3VR9A 1DOCA 1VRQB 3N4FA 3JW7A 2GMHA 4TLXA 3PWIA 3HYWA 1GESA 3B9JB 1F8RA 4LU6A 5JCNA 2P8CA 3KPKA 1CJ3A 1R6WA 2R0CA 1PBEA 3DG3A 2BK5A 3AB1A 4K1WA 1H81A 1LTXR 2TPRA 4E4UA 3PWGA 4HNCA 2V61A 5KOWA 3M0OA 2Q6UA 1SJCA 1F8SA 3EPTA 2XCGA 3V3WA 3ENLA 3TCSA 5KNLA 4JN9A 2MNRA 4JQ9A 4AP3A 4EIPA 4IV9A 2QDDA 3RITA 2RABA 3CPJG 4BV6A 2JK6A 1E7PA 2HZGA 3DK9A 1KSUA 4A6GA 4A3RA 2UZZA 4K8GA 1CL0A 3NN0X 3AE4A 2QJMA 2XH7A 3ZVHA 1NDAA 2XLRA 2OPJA 2YLZA 3DESA 1ZP0A 3UTFA 1N1PA 3KVEA 2P8BA 1STZA 1F6MA 2W54A 2R4JA 2FKPA 1ELIA 3KA7A 2XVHA 2OZTA 1MDLA 4H50A 3H8LA 4YTMA 3DH9A 2BA9A 2XFOA 4B67A 3L5OA 1GRGA 4H4RA 4A99A 2QVHA 3EEZA 3AE9A 4H4UA 3UP4A 1E9IA 1OEPA 1Q1WA 3UKHA 2AAQA 1YY5A 3ALMA 3AD7B 3ES8A 4J3ZA 4G74A 1PXCA 2BC0A 3UTGA 4YKFA 3HYVA 3RP8A 3M13A 1SB3B 1GRTA 1E1MA 5KOXA 3L8KA 3NLCA 4CY8A 4M0XA 2BRAA 2OX4A 2XYOA 2WOIA 2E5VA 2C76A 3GDNA 3ZVHB 5KMPA 4JY2A 2BABA 3IHGA 4U8MA 3DG7A 3SZ0A 3AE7A 3Q9TA 5HHFA 1RVKA 1GTEA 1P2EA 5FS9A 3D46A 5KRQA 3GO2A 3IJLA 4OPLA 2GAGB 4XXGA 3F8PA 4I58A 3NRZB 3UXKA 1JPDX 1XS2A 3CB3A 3UKAA 3ADAB 3S5SA 1RYIA 4YWOA 4H4WA 1TDOA 2PHHA 3H12A 3ICTA 2ZBWA 1VDVA 2OG9A 1O5WA 2R0GA 4CRTA 2TMDA 3NN6X 1BQGA 4B68A 4WCTA 3BNUA 1FHVA 2C67A 4GDPA 4NTEA 1RP0A 1FECA 2NPXA 3I6EA 4C77A 2C72A 2P3ZA 4D03A 4EIQA 2X8CA 3NHOX 3IWAA 2V3AA 2IVEA 2HXUA 4KPLA 3CPHG 3PS9A 3NK1X 3UKPA 3UOZA 4KEMA 3I3LA 3LZWA 2WDQA 3HYXA 2YQUA 3NIXA 1EC8A 1FFUC 4ROPA 3ZLGA 3NNEA 4OVIA 3N4EA 4GGHA 1WYGA 5EU9A 4H4VA 2GMJA 2BC1A 2GGIA 1LV0A 5IQ1A 3NVWB 1E1KA 3QSEA 4TLZA 3D9XA 2C70A 3T6CA 4CBQA 4J1OA 3STPA 2YLRA 3UKQA 3DIPA 1L8PA 4XWZA 3QLDA 2YWLA 3LXDA 4C3XA 2BCPA 5L46A 5BULA 4Z26A 4MMWA 1KCZA 4JNQA 3NH3X 2R4EA 1D4DA 3EUB3 3IC9A 4G8TA 1K0JA 1CF3A 1Y56A 1YQ4A 2OAMA 3CTYA 3CGCA 3ATQA 4MGGA 3UJSA 4APNA 3IJIA 4IP5A 1JDFA 1ONFA 1FEAA 4Y4NA 3DFHA 1S2QA 1DOEA 1JRYA 1NHSA 3SX6A 3NVYB 1NHPA 4BURA 2WDRA 3GWDA 5C2TA 2PP3A 4B63A 1NELA 4DSHA 5JCKA 3Q4DA 3RGTA 4KPRA 2A87A 3AM9A 4JHMA 3OZYA 2B7SA 2XLTA 1BGJA 2QA1A 4NTDA 3QN3A 4J31A 1NG4A 3COXA 1JEHA 5KVIA 1TRBA 2YG7A 3VFCA 3AE1A 2V5ZA 2R9ZA 2I0ZA 3KLJA 4U2TA 3SJNA 1NG3A 4DWDA 3AD9B 4LIIA 2IVDA 1SJAA 2B9WA 4UDRA 3UKKA 3GWFA 2X8GA 3EF6A 1PJ5A 5EBKA 1QO8A 3DJJA 4G6HA 3OW1A 3NGCX 1L9DA 4Z2RA 4A6NA 5BUKA 4JY3A 3LZXA 4U2SA 4TM0A 4HNLA 1ZOYA 3DA1A 2BXRA 3P1WA 1IUSA 1FHUA 3URHA 3Q45A 2XH4A 2JB1A 4JDRA 4YWSA 3TW9A 2C75A 1NU5A 4B1BA 3TQPA 1H83A 5BRTA 3II4A 5M10A 6ENLA 3V3OA 1GV4A 3SFDA 3ZDNA 5U63A 3CPIG 5J04A 4RG4A 3UP5A 1L9CA 2E1MA 1PN0A 3D1CA 3QJ4A 5HY5A 3SZWA 1GNDA 3OC4A 5BVAA 2YLWA 1FCDA 1YQ3A 1TYPA 4NEWA 3B6DA 1JCTA 3N6HA 3P4QA 4YSZA 3A7RA 1NPXA 4FDCB 4EM3A 2R46A 4A6NB 1H6VA 2VQBA 2YG4A 3PK7A 2XFQA 3TJ4A 2Q7VA 4GYPA 2GDQA 2GGJA 3VCNA 1JPMA 1N62C 3VR8A 1OJDA 2WPFA 2FJEA 3AYLA 1GREA 2WP9A 2AR8A 2OFJA 4A65A 3JSKA 2CHRA 3CXOA 4USQA 2RGOA 4UDPA 3DGHA 1V59A 1PDHA 3UCLA 2ZC8A 1BF3A 1ZMDA 2YR4A 2MUCA 1GERA 4OPIA 3RRAA 4DN1A 4B64A 1H82A 4H1ZA 4OPCA 5KMSA 2WQYA 4NTCA 2R45A 2BK3A 2VVLG 4IVOB 3AN1A 4C74A 4YSYA 4H2PA 3WE0A 3NO1A 4IA5A 3QSMA 1D4CA 3NTAA 3OP2A 4FX9A 2WP6A 2Y6RA 4YT0A 4OPTA 1H86A 2R0PA 4HYRA 3SQPA 3Q6JA 3SM8A 4H4ZA 5C3JA 4IZGA 1KD0A 3NT6A 1ZX9A 2FJAA 4J56A 1LVLA 1E1NA 1S7MA 1M64A 1Q9IA 2BXSA 1KNPA 2EQ9A 3VRDB 2YVFA 4PABA 4EM4A 4O5QA 2PU0A 4LA1A 4E4FA 3C96A 3T9PA 4P9SA 4OCGA 3SN0A 2RGHA 1ZXIC 2GL5A 2PTZA 3UJ2A 1PXAA 3AYJA 3K7TA 4U8OA 2AQJA 3V5CA 3BSMA 1KF6A 4H83A 2NQLA 1Q1RA 2QGYA 4UDQA 4B66A 1K0LA 4NZHA 3DMEA 5U1OA 1JRPA 1LQTA 2F5ZA 3NK0X 1EL8A 3UJEA 3U9IA 2WPEA 2E5AA 4OPDA 2P0IA 2VVLA 4X4JA 3CGBA 2BS2A 4EQWA 3C4AA 7ENLA 3NXLA 1B4VA 2PSNA 1F8WA 4IT1A 2ZZBA 3CNJA 3P4SA 4ZN0A 1F3PA 5ENLA 1KNRA 4ZCWA 3DK4A 1IJHA 3ICSA 4YTNA 1VQWA 3GRSA 1ZOVA 1P2HA 2PP1A 4GCMA 2C65A 2XVEA 2X99A 4GDEA 2RDXA 1YKJA 3JVAA 4EQSA 4BK1A 3GD4A 3AEEA 2YR6A 2AKZA 3HW2A 1TKKA 1N4UA 2XFUA 1Y0PA 3HZLA 3SBFA 3I6TA 1TDKA 3SN1A 4MJWA 4GUVA 3UOXA 2PTYA 3T2ZA 3OTRA 4JN7A 3ISHA 1IUXA 3PG6A 4Y4LA 3CT2A 3MUCA 2Q0LA 2XLUA 2WHDA 5BOFA 3U4FA 2WETA 1DODA 3CN8A 1V97A 2ACZA 1VG0A 4H2QA 1BZLA 4TM1A 3F8DA 2QCUA 3AE8A 3CK5A 4CY6A 2WPCA 3MSYA 2C4CA 4J34A 1KKRA 3PFRA 3P93A 3GYXA 3GRTA 1M6IA 3MY9A 4HCHA 1LQUA 2GV8A 2J3NA 3IJQA 2XVIA 3LADA 4U8IA 1DXLA 1D5TA 4WX1A 5FS7A 4Z2UA 2C7GA 3A7AA 2PGWA 3E1TA 3T2KA 1JOAA 2FYMA 4K22A 1COYA 2B7RA 3MZNA 1O94A 2OLAA 4K8DA 4UP3A 2PTXA 4A9WA 3AE3A 3DJGX 3REDA 4HA6A 4K7ZA 3OZMA 4BK2A 4REKA 4GAVA 2GQFA 1CBOA 5JRBA 1NAAA 4GF7A 2GGGA 2V60A 1N61C 3FPZA 2OO6A 3VA8A 4H4SA 4FP1A 3H8IA 5CQFA 5IQ4A 3SSZA 4OPGA 5GRTA 2BS4A 3MQTA 2QJNA 1ZY8A 2C3CA 1PDYA 4ZCDA 3DERA 3T8QA 2VRLA 1FL2A 3T4WA 5FS6A 5EOWA 3DFYA 2PS2A 2GR3A 4I59A 3EAOA 1ZMCA 5CKUA 3ZLFA 2YG3A 4E6MA 2PGEA 1B37A 3AWIA 3IK4A 3ABVA 3FCPA 4AOXA 3ZVIA 3QFAA 1H84A 3VC6A 3RP6A 3QTPA 1GETA 3NZGA 2GAHB 4KT2A 3TTEA 1B8SA 5J60A 1NEKA 3M12A 3NVZB 2XVFA 3K1GA 1TDEA 3SN4A 2GSHA 1BWCA 3AXBA 5DBJA 3ATRA 1YEYA 5HYMA 1WUFA 3CMMA 4H4YA 2GGHA 3FVDA 4ICYA 4K5SA 2BRYA 4FK1C 1OJCA 4BJYA 5FJRA 4U8LA 4HPNA 4GMEA 2YG6A 3R25A 3AEBA 4X9NA 3R07C 2H89A 4J36A 3NYFA 2BYBA 4TVYA 4ZCCA 3K30A 2WEUA 3NYEA 3QKEA 4Z24A 2ZADA 1GALA 1Y56B 4DSGA 3UKFA 4HCDA 3VRAA 3AE5A 4EQXA 2QQ6A 2HQMA 3KUMA 3DGBA 4GFIA 3T0KA 3FIMB 1D7YA 1CC2A 3FBSA 1PBBA 3R0KA 2PYXA 4YSXA 4J33A 2YAUA 1TYTA 3I6DA 1EC9A 1D4EA 3BJSA 3V5FA 5U25A 3BOXA 1GRHA 3SQSA 3VCCA 3H8AA 3CIRA 4X9MA 2WESA 1N5WC 1GT8A 2YM1A 1MUCA 2PP0A 2YLXA 2OQHA 3MWCA 3O0HA 3RNMA 1F9CA 1PS9A 1FOHA 3NVVB 4EQRA 3UJRA 3G5SA 3R0UA 2Z5YA 1OJ9A 3DG6A 3UXLA 3DK8A 2A89A 5G5GB 3NK2X 1ONEA 2PU1A 3SZFA 2YR5A 2VRMA 2PPGA 4Z25A 3CGDA 1KDGA 4C3YA 3H70A 4H4XA 3FMWA 3G5QA 1XPQA 3GD6A 1TDNA 2XH0A 2VVMA 2VOUA 2XLPA 2X50A 1GRBA 2JB3A 3BI4A 2XH2A 5BOEA 3AE2A 4H19A 1GOSA 3SYIA 3C4NA 1DOBA 2IIDA 2FJDA 4ZA0A 4A5LA 3VDGA 4JN8A 3UCDA 2YM2A 1MOKA 1X2GA 3QVPA 4II2A 4IL2A 5J7XA 5EB4A 2WBAA 2ZZ0A 1CJCA 3ITJA 2GR1A 2GR0A 3CYJA 1ZKQA 4YKGA 3TWBA 2GB0A 2GVCA 4KWSA 1GEUA 2WP5A 1JRXA 2W3SA 2PCEA 3CXBA 3CNPA 3AMZA 3ALJA 2W0HA 5M0ZA 1SJDA 4JNAA 1JNRA 1GRFA 4NEVA 1MRAA 3UTHA 2JAEA 5KWFA 4AT2A 4D04A 3R11A 4PAAA 3LB8A 1E1LA 1ZDLA 3NTDA 5FS8A 4HCLA 1ECQA 2CFYA 3ETRB 1JROA 3LOVA 3ES7A 3GD3A 1K0IA 2QJJA 3GMCA 3T2YA 5ER0A 4U8NA 1EC7A 4OPUA 4BJZA 1PXBA 4E0VA 2YVJA 2W55A 3GMBA 1MNSA 2ONEA 2E4GA 1ZK7A 1FIQB 1DJNA 1KSSA 4DYEA 1PBFA 5KMRA 1JNZA 1GPEA 3A7UA 1CHUA 4H2HA 3NS1B 4H7UA 1KN0A 2XDOA 3UOVA 4K2SA 3CNSA 3NKSA 4H4TA 3AEFA 3R9UA 1JRZA 3THUA 4CNKA 1MDRA 4N9XA 1VG9A 4H4QA 3SXIA 3AEGA 2H88A 1E6EA 3AE6A 4F4RA 2PA6A 1H7WA 4ZOHB 2JBVA 3QVRA 3KU9A 2I5QA 2W3RA 2DW7A 2EQ6A 4EMJA 2AL1A 1REOA 4J57A 1TZZA 4DHGA 3ALLA 5HXIA 3T31A 4X2PA 3OZ2A 3NRNA 1SJBA 5KMQA 5LV9A 4AP1A 3ZLHA 4U8JA 1IUWA 1P43A 5KXJA 3SZCA 3N6JA 1N60C 3EKGA 3V76A 2WOVA 1BGNA 1IYXA 3S61A 1CC6A 1EBDA 4A79A 1PJ7A 1CJ2A 2VZ2A 2YLSA 3VQRA 2QDEA 3TJIA 2XLSA 2ZZCA 4IA6A 4DNAA 5JCMA 1GSNA 4FI4A 5JCLA 3BHFA 3FJ4A 2WU5A 4YTPA 5FMHA 4NWZA 3ICRA 4Z44A 3NYCA 1EBGA 2BS3A 3P4RA 1VQZA 2A8XA 3FYYA 3FG2P 3GY1A 1JU2A 4GR1A 4NNJA 1UKVG 4IP4A 3P4PA 4H4PA 4CCRA 4H2NA 4Z43A 4Z17A 2HNEA 3QPEA 3NG7X 1OJAA 1DNCA 4B69A 4GRTA 1RM6B 1KKOA 3KKJA 1XANA 3P3BA 1MXTA 4ENLA 3GYIA 5G5HB 1R0MA 3DGZA 3RO6A 1TE6A 3AYIA 2OLNA 3R1ZA 1MO9A 2OQYA 1QLBA 2C64A 2V3BA 1NHQA 3K7MX 4IVMB 1B5QA 4U8KA 5IDZA 2GQWA 3V4BA 3P9UA 1FEBA 2YLTA 4Z2TA 1D7LA 2B9YA 3BNMA 2C66A 3SGLA 3AECA 4G73A 1GRAA 3HRDC 2HXTA 4G7FA 1DTNA 3QFBA 3MKCA 1CC4A 3BHKA 4O5UA 2OVLA 3SY4A 4GAPA 4K5RA 2QAEA 2JB2A 3IHMA 2GH5A 2CDUA 3DJDA 2DKIA 5EB5A 3F8RA 1EL9A 1FO4A 3SFEA 2GR2A 2O56A 1H7XA 2DW6A 3RCYA 1DJQA 2PMQA 1GTHA 3EANA 2XFNA 2OKTA 3UOYA 1PBCA 3DEQA 1TDFA 1EBHA 3GDPA 5GSNA 3AEAA 2WOWA 4IHCA 1EL7A 1L0VA 2CULA 1S2YA 2B9XA 4K2XA 3IF9A 2YG5A 3CNDA 4USRA 3UKLA 3RR1A 5TR3A 3JZUA 4II3A 4E5TA 2V6OA 2BACA 2WDVA 3CNTA 2X3NA 3UGVA 3KPFA 3SR6B 1SEZA 4H2RA 4A7AA 1YQZA 4GGBA 2BCGG 4RG3A 1HYUA 1LPFA 1RSGA 3UCCA 1CJ4A 1E39A 4EMIA
chains in the Genus database with same CATH topology
3AE2A 2RGHA 2VQ7A 1O5WA 1GOSA 4KX6A 3GYJA 3SYIA 3C4NA 4AOSA 2R0GA 1DOBA 2IIDA 2TMDA 3L1RA 2FJDA 4CRTA 3NN6X 1PXAA 4A5LA 3AYJA 3K7TA 4U8OA 4WCTA 4B68A 4CNJA 2AQJA 2OA1A 2YM2A 3BNUA 2YVGA 1MOKA 2C67A 4GDPA 4NTEA 1RP0A 1FECA 2JKCA 3QVPA 2NPXA 5JCIA 4II2A 1KF6A 2C72A 4C77A 4D03A 4CCQA 4EIQA 3D8XA 2QA2A 4TM4A 1Q1RA 3T37A 1IUVA 4U2LA 2X8CA 3NHOX 3IWAA 4UDQA 3BI2A 5J7XA 5EB4A 4B66A 1K0LA 4ADWA 4NZHA 2WBAA 2ZZ0A 1CJCA 2V3AA 3ITJA 2IVEA 3DMEA 2GR1A 5U1OA 1BKWA 4DGKA 2GR0A 3CPHG 3PS9A 2XVJA 3NK1X 1LQTA 2F5ZA 3NK0X 3UKPA 3UOZA 2O9ZA 1EL8A 1ZKQA 1IUTA 1OJTA 3I3LA 2WDQA 2GB0A 3LZWA 4YKGA 2GVCA 3HYXA 1GEUA 1W4XA 2WP5A 2YQUA 1JRXA 3NIXA 4B65A 2WPEA 4OPDA 4RSLA 3NNEA 4OVIA 3CNPA 3ALJA 2VVLA 2W0HA 5M0ZA 1XHCA 4X4JA 3CGBA 2BS2A 4JNAA 4H4VA 2GMJA 1JNRA 4EQWA 3C4AA 2BC1A 1LV0A 1Z6LA 5IQ1A 1E1KA 2FBWA 1GRFA 4NEVA 3QSEA 4TLZA 3UTHA 2JAEA 5KWFA 1B4VA 3D9XA 2C70A 1S3BA 1F8WA 4AT2A 4D04A 4CBQA 1KFYA 4PAAA 3LB8A 1E1LA 1ZDLA 3NTDA 2ZZBA 3CNJA 3PVCA 4ECHA 3P4SA 2YLRA 3UKQA 5FS8A 4ZN0A 3B3RA 1F3PA 4XWZA 2CFYA 2YWLA 4YSHA 1KNRA 3LXDA 1QJDA 3LOVA 4C3XA 1IJHA 1K0IA 3DK4A 3GD3A 1PJ6A 2BCPA 3ICSA 4YTNA 1VQWA 3GRSA 1ZOVA 3CGEA 5L46A 1N4VA 4J2WA 5BULA 3GMCA 3T2YA 5ER0A 1P2HA 2GEWA 4Z26A 4GCMA 1XDIA 2C65A 1K4QA 1LJ1A 2XVEA 4U8NA 2X99A 4GDEA 4JNQA 2Z5XA 1YKJA 3NH3X 4TM3A 4OPUA 4BJZA 1PXBA 2GRTA 2DKHA 4EQSA 2YVJA 4BK1A 4E0VA 2R4EA 3GD4A 2APGA 2CVJA 3AEEA 1D4DA 2YR6A 3IC9A 3GMBA 3DJEA 3KD9A 1K0JA 1N4UA 2XFUA 1Y0PA 2E4GA 1ZK7A 1CF3A 1Y56A 1YQ4A 2OAMA 2WS3A 1DJNA 3CTYA 3HZLA 1KSSA 3CGCA 3ATQA 4FK1A 1TDKA 4MJWA 4GUVA 3UOXA 4APNA 3T2ZA 1PBFA 5KMRA 1JNZA 3ISHA 2B76A 3PO7A 3ZYXA 1GPEA 1ONFA 3RHAA 1IUXA 3LJPA 1CHUA 1FEAA 4U8PA 3PG6A 4Y4LA 4Y4NA 4H7UA 1KN0A 1H2IA 2XDOA 1S2QA 2Y6QA 3UOVA 1DOEA 3QSSA 4C5OA 4Y4MA 1JRYA 1NHSA 2ARDA 3CNSA 3NKSA 4H4TA 3S5WA 1O95A 1NHPA 4BURA 2WDRA 3GWDA 3SX6A 5C2TA 2C3DA 2Q0LA 2XLUA 2WHDA 3AEFA 1NENA 4G6GA 4B63A 3R9UA 4AT0A 1JRZA 2BK4A 2WETA 2FJBA 4CNKA 4DSHA 1AOGA 5JCKA 4N9XA 3VRBA 1DODA 1VG9A 3CN8A 4H4QA 3SXIA 3AEGA 1L9EA 3RP7A 2ACZA 4KPRA 2H88A 1E6EA 1VG0A 4EMWA 2A87A 1NHRA 4H2QA 1BZLA 2RGJA 3AE6A 4TM1A 2B7SA 2XLTA 3F8DA 1BGJA 3AD8B 2QCUA 3V3NA 2OALA 2QA1A 1H7WA 3AE8A 4G9KA 4NTDA 1S3EA 2JBVA 3QVRA 2WPCA 4J31A 4CY6A 4HB9A 1VDCA 2C4CA 3KU9A 2Q0KA 2WU2A 4J34A 1NG4A 3COXA 3GYXA 1JEHA 2EQ6A 3GRTA 5KVIA 1TRBA 1M6IA 4EMJA 2YG7A 2XFPA 4M52A 1LQUA 1REOA 4XWRA 4J57A 2GV8A 3H4KA 2J3NA 3ALLA 3K7QX 5HXIA 2XVIA 3T31A 3LADA 3AE1A 2V5ZA 4U8IA 1DXLA 2R9ZA 3OZ2A 3NRNA 5IPYA 1D5TA 4WX1A 4YXDA 5FS7A 2X8HA 1PBDA 2I0ZA 3KLJA 4U2TA 5KMQA 2C7GA 4Z2UA 5LV9A 4AP1A 1IUWA 3E1TA 1NG3A 3BI5A 4U8JA 3T2KA 2EQ7A 1JOAA 5KXJA 3AD9B 3AEDA 4K22A 4LIIA 1COYA 2B7RA 1O94A 1GXFA 4K8DA 2IVDA 2EQ8A 4UP3A 3SZCA 1IUUA 2B9WA 3GSIA 4UDRA 4A9WA 1PHHA 3AE3A 3GWFA 2X8GA 2NVKX 3DJGX 3EF6A 1EL5A 5KVHA 3UKKA 3UTEA 3REDA 1PJ5A 5EBKA 1N4WA 1QO8A 4HA6A 3DJJA 4BK3A 2OLOA 1X31B 4K7ZA 2GF3A 3G5RA 3T14A 4BK2A 4REKA 4GAVA 2C73A 2GQFA 4G6HA 3V76A 2WOVA 1BGNA 1CBOA 3S61A 1CC6A 1EBDA 3VR9A 4A79A 1DOCA 3NGCX 1L9DA 5JRBA 1NAAA 1PJ7A 4GF7A 4Z2RA 2V60A 1VRQB 3FPZA 4A6NA 5BUKA 1CJ2A 2VZ2A 2YLSA 4JY3A 3VQRA 4H4SA 2XLSA 2ZZCA 4IA6A 2GMHA 3LZXA 4U2SA 3H8IA 4TM0A 5CQFA 5IQ4A 4TLXA 4DNAA 4OPGA 1ZOYA 1GESA 3DA1A 3HYWA 1F8RA 4LU6A 2BXRA 5JCNA 5GRTA 1IUSA 3P1WA 3KPKA 5JCMA 1CJ3A 2R0CA 1PBEA 2BK5A 2BS4A 3AB1A 1GSNA 5JCLA 3BHFA 3URHA 2WU5A 4YTPA 5FMHA 4NWZA 1H81A 2JB1A 3ICRA 4JDRA 1ZY8A 2C3CA 1LTXR 4Z44A 3NYCA 2TPRA 4ZCDA 2C75A 4B1BA 2VRLA 1FL2A 2BS3A 1H83A 5FS6A 2V61A 5BRTA 5EOWA 5KOWA 3M0OA 2Q6UA 3P4RA 1F8SA 3EPTA 2GR3A 2A8XA 3II4A 3FG2P 2XCGA 3EAOA 4I59A 1JU2A 4GR1A 5M10A 4NNJA 1UKVG 3P4PA 1ZMCA 5CKUA 3V3OA 1GV4A 4H4PA 2YG3A 4CCRA 4H2NA 1B37A 4JN9A 3SFDA 4Z43A 3AWIA 5KNLA 3ZDNA 5U63A 4JQ9A 4AP3A 3ABVA 4EIPA 3CPIG 4IV9A 4AOXA 4RG4A 3NG7X 1OJAA 3QFAA 1DNCA 3UP5A 1H84A 3RP6A 4B69A 4GRTA 1L9CA 2E1MA 1GETA 2GAHB 1PN0A 3D1CA 2RABA 3KKJA 1XANA 1MXTA 1B8SA 3QJ4A 5HY5A 1NEKA 5J60A 3CPJG 3GYIA 3SZWA 4BV6A 1GNDA 3M12A 2JK6A 3DGZA 3OC4A 1E7PA 2XVFA 5BVAA 3DK9A 2YLWA 1KSUA 3AYIA 1FCDA 1TDEA 2UZZA 1CL0A 2OLNA 1YQ3A 1MO9A 1BWCA 3NN0X 1TYPA 4NEWA 3AXBA 3B6DA 5DBJA 1QLBA 2C64A 3ATRA 2V3BA 1NHQA 3AE4A 3P4QA 5HYMA 4YSZA 3K7MX 4IVMB 1B5QA 1NPXA 3CMMA 4U8KA 4FDCB 4H4YA 1NDAA 2GQWA 3P9UA 4ICYA 1FEBA 2XLRA 4EM3A 2BRYA 2YLTA 1D7LA 4FK1C 4K5SA 4Z2TA 2R46A 4A6NB 2B9YA 2YLZA 1OJCA 3BNMA 1H6VA 2VQBA 4BJYA 2C66A 1ZP0A 2YG4A 3UTFA 2XFQA 1N1PA 2Q7VA 4U8LA 2YG6A 3AECA 3KVEA 3SGLA 3AEBA 4G73A 4X9NA 1GRAA 1F6MA 2H89A 4J36A 2R4JA 3NYFA 2BYBA 1ELIA 3KA7A 4ZCCA 2XVHA 3VR8A 3K30A 3QFBA 1OJDA 2WPFA 2FJEA 2WEUA 4H50A 3AYLA 3NYEA 1GREA 3H8LA 1CC4A 4YTMA 3BHKA 4O5UA 3SY4A 3DH9A 4Z24A 4GAPA 4K5RA 2BA9A 2WP9A 2XFOA 4B67A 3L5OA 2AR8A 2QAEA 2JB2A 1GRGA 4H4RA 3IHMA 4A65A 4A99A 2GH5A 3JSKA 1GALA 2CDUA 1Y56B 3AE9A 3DJDA 4H4UA 4USQA 2RGOA 4DSGA 2DKIA 4UDPA 3UP4A 3DGHA 5EB5A 3F8RA 3UKFA 1V59A 1Q1WA 1PDHA 3UCLA 3VRAA 1EL9A 3AE5A 4EQXA 3UKHA 2AAQA 2HQMA 1YY5A 3SFEA 3ALMA 2GR2A 1BF3A 1H7XA 3AD7B 3FIMB 3T0KA 1ZMDA 2YR4A 1GERA 1DJQA 1D7YA 1CC2A 3FBSA 1GTHA 4OPIA 1PBBA 3EANA 4B64A 1H82A 2XFNA 4G74A 4OPCA 5KMSA 2PYXA 3UOYA 4YSXA 1PBCA 1PXCA 2WQYA 2BC0A 4NTCA 4J33A 2R45A 2YAUA 1TYTA 1TDFA 2BK3A 3GDPA 3I6DA 4YKFA 2VVLG 5GSNA 4IVOB 3AEAA 3HYVA 3RP8A 3M13A 1D4EA 4C74A 2WOWA 4YSYA 4H2PA 5U25A 3WE0A 1GRTA 1E1MA 1GRHA 4IA5A 3L8KA 3NLCA 4CY8A 5KOXA 1EL7A 3QSMA 1D4CA 1L0VA 2BRAA 2XYOA 3NTAA 4FX9A 3UTGA 2WP6A 2Y6RA 3CIRA 2WOIA 4X9MA 2CULA 2E5VA 4YT0A 4OPTA 2C76A 1S2YA 2B9XA 4K2XA 1H86A 3GDNA 3IF9A 2WESA 2R0PA 5KMPA 1GT8A 3SQPA 3Q6JA 2YG5A 2YM1A 3CNDA 3SM8A 4JY2A 4USRA 4H4ZA 2BABA 5C3JA 3IHGA 4U8MA 3UKLA 2YLXA 3SZ0A 3AE7A 3Q9TA 5HHFA 3O0HA 3RNMA 1P2EA 1GTEA 1ZX9A 3NT6A 2FJAA 4J56A 5FS9A 1LVLA 1PS9A 1FOHA 1E1NA 5KRQA 4EQRA 1S7MA 1M64A 4OPLA 2GAGB 4XXGA 3F8PA 5TR3A 4I58A 3G5SA 1Q9IA 2BXSA 4II3A 2Z5YA 1KNPA 1OJ9A 2V6OA 2EQ9A 3VRDB 3DK8A 2BACA 2YVFA 2WDVA 2A89A 3CNTA 2X3NA 3NK2X 3SZFA 3UKAA 3KPFA 2YR5A 3ADAB 2VRMA 4Z25A 3CGDA 1KDGA 4C3YA 1SEZA 4PABA 4H4XA 4H2RA 3FMWA 4EM4A 3G5QA 4A7AA 1YQZA 1XPQA 4O5QA 4LA1A 4YWOA 1HYUA 1RYIA 2BCGG 4H4WA 3C96A 4RG3A 1TDNA 1LPFA 1TDOA 1RSGA 2VVMA 4P9SA 2PHHA 2VOUA 2XLPA 3ICTA 4OCGA 2X50A 1GRBA 1CJ4A 2ZBWA 1E39A 2JB3A 4EMIA 3BI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE2 A;  2RGH A;  2VQ7 A;  1O5W A;  1GOS A;  4KX6 A;  3GYJ A;  3C4N A;  4AOS A;  2R0G A;  1DOB A;  2IID A;  2TMD A;  3L1R A;  2FJD A;  4CRT A;  3NN6 X;  1PXA A;  4A5L A;  3AYJ A;  3K7T A;  4U8O A;  4WCT A;  4B68 A;  4CNJ A;  2AQJ A;  2OA1 A;  2YM2 A;  3BNU A;  2YVG A;  1MOK A;  2C67 A;  4GDP A;  4NTE A;  1RP0 A;  1FEC A;  2JKC A;  3QVP A;  2NPX A;  5JCI A;  4C77 A;  1KF6 A;  2C72 A;  4D03 A;  4CCQ A;  4EIQ A;  3D8X A;  2QA2 A;  4TM4 A;  1Q1R A;  3T37 A;  1IUV A;  4U2L A;  2X8C A;  3NHO X;  3IWA A;  4UDQ A;  3BI2 A;  5J7X A;  5EB4 A;  4B66 A;  1K0L A;  4ADW A;  4NZH A;  2WBA A;  2ZZ0 A;  1CJC A;  2V3A A;  3ITJ A;  2IVE A;  3DME A;  2GR1 A;  5U1O A;  1BKW A;  4DGK A;  2GR0 A;  3CPH G;  3PS9 A;  2XVJ A;  3NK1 X;  1LQT A;  2F5Z A;  3NK0 X;  3UKP A;  3UOZ A;  2O9Z A;  1EL8 A;  1ZKQ A;  1IUT A;  1OJT A;  3I3L A;  2WDQ A;  2GB0 A;  3LZW A;  4YKG A;  2GVC A;  1GEU A;  1W4X A;  2WP5 A;  2YQU A;  1JRX A;  3NIX A;  4B65 A;  2WPE A;  4OPD A;  4RSL A;  3NNE A;  4OVI A;  3CNP A;  3ALJ A;  2VVL A;  2W0H A;  5M0Z A;  1XHC A;  4X4J A;  3CGB A;  2BS2 A;  4JNA A;  4H4V A;  2GMJ A;  1JNR A;  4EQW A;  3C4A A;  2BC1 A;  1LV0 A;  1Z6L A;  5IQ1 A;  1E1K A;  2FBW A;  1GRF A;  4NEV A;  3QSE A;  4TLZ A;  3UTH A;  2JAE A;  5KWF A;  1B4V A;  2C70 A;  1S3B A;  1F8W A;  4AT2 A;  4D04 A;  4CBQ A;  1KFY A;  4PAA A;  3LB8 A;  1E1L A;  1ZDL A;  3NTD A;  2ZZB A;  3CNJ A;  3PVC A;  4ECH A;  3P4S A;  2YLR A;  3UKQ A;  5FS8 A;  4ZN0 A;  3B3R A;  1F3P A;  4XWZ A;  2CFY A;  2YWL A;  4YSH A;  1KNR A;  3LXD A;  1QJD A;  3LOV A;  4C3X A;  1IJH A;  3DK4 A;  3GD3 A;  1K0I A;  1PJ6 A;  2BCP A;  3ICS A;  4YTN A;  1VQW A;  3GRS A;  1ZOV A;  3CGE A;  5L46 A;  1N4V A;  4J2W A;  5BUL A;  3GMC A;  5ER0 A;  1P2H A;  2GEW A;  4Z26 A;  4GCM A;  1XDI A;  2C65 A;  1K4Q A;  1LJ1 A;  2XVE A;  4U8N A;  2X99 A;  4GDE A;  4JNQ A;  2Z5X A;  1YKJ A;  3NH3 X;  4TM3 A;  4OPU A;  4BJZ A;  1PXB A;  2GRT A;  2DKH A;  4EQS A;  2YVJ A;  4BK1 A;  4E0V A;  2R4E A;  3GD4 A;  2APG A;  2CVJ A;  3AEE A;  1D4D A;  2YR6 A;  3IC9 A;  3GMB A;  3DJE A;  3KD9 A;  1K0J A;  1N4U A;  2XFU A;  1Y0P A;  2E4G A;  1ZK7 A;  1CF3 A;  1Y56 A;  1YQ4 A;  2OAM A;  2WS3 A;  1DJN A;  3CTY A;  3HZL A;  1KSS A;  3CGC A;  3ATQ A;  4FK1 A;  1TDK A;  4MJW A;  4GUV A;  3UOX A;  4APN A;  1PBF A;  1JNZ A;  3ISH A;  2B76 A;  3PO7 A;  3ZYX A;  1GPE A;  1ONF A;  3RHA A;  1IUX A;  3LJP A;  1CHU A;  1FEA A;  4U8P A;  4Y4L A;  4Y4N A;  4H7U A;  2XDO A;  2Y6Q A;  1S2Q A;  3UOV A;  1DOE A;  3QSS A;  4C5O A;  4Y4M A;  1JRY A;  1NHS A;  2ARD A;  3CNS A;  3NKS A;  4H4T A;  3S5W A;  1O95 A;  1NHP A;  4BUR A;  2WDR A;  3GWD A;  5C2T A;  2C3D A;  2Q0L A;  2XLU A;  2WHD A;  3AEF A;  1NEN A;  4B63 A;  3R9U A;  4AT0 A;  1JRZ A;  2BK4 A;  2WET A;  2FJB A;  4CNK A;  4DSH A;  1AOG A;  5JCK A;  4N9X A;  3VRB A;  1DOD A;  1VG9 A;  3CN8 A;  4H4Q A;  3AEG A;  1L9E A;  3RP7 A;  2ACZ A;  4KPR A;  2H88 A;  1E6E A;  1VG0 A;  4EMW A;  2A87 A;  1NHR A;  4H2Q A;  1BZL A;  2RGJ A;  3AE6 A;  4TM1 A;  2B7S A;  2XLT A;  3F8D A;  1BGJ A;  3AD8 B;  2QCU A;  3V3N A;  2OAL A;  2QA1 A;  1H7W A;  3AE8 A;  4NTD A;  1S3E A;  2JBV A;  3QVR A;  2WPC A;  4J31 A;  4CY6 A;  4HB9 A;  1VDC A;  3KU9 A;  4J34 A;  2Q0K A;  2WU2 A;  1NG4 A;  3COX A;  1JEH A;  2EQ6 A;  3GRT A;  5KVI A;  1TRB A;  1M6I A;  4EMJ A;  2YG7 A;  2XFP A;  4M52 A;  1LQU A;  1REO A;  4XWR A;  4J57 A;  2GV8 A;  3H4K A;  2J3N A;  3ALL A;  3K7Q X;  5HXI A;  2XVI A;  3LAD A;  3AE1 A;  2V5Z A;  4U8I A;  1DXL A;  2R9Z A;  3OZ2 A;  3NRN A;  5IPY A;  1D5T A;  4WX1 A;  4YXD A;  5FS7 A;  2X8H A;  1PBD A;  2I0Z A;  3KLJ A;  4U2T A;  4Z2U A;  2C7G A;  5LV9 A;  4AP1 A;  1IUW A;  3E1T A;  1NG3 A;  3BI5 A;  4U8J A;  2EQ7 A;  1JOA A;  5KXJ A;  3AD9 B;  3AED A;  4K22 A;  4LII A;  1COY A;  2B7R A;  1O94 A;  1GXF A;  4K8D A;  2IVD A;  2EQ8 A;  4UP3 A;  1IUU A;  2B9W A;  3GSI A;  4UDR A;  4A9W A;  1PHH A;  3AE3 A;  3GWF A;  2X8G A;  2NVK X;  3DJG X;  3EF6 A;  1EL5 A;  5KVH A;  3UKK A;  3UTE A;  3RED A;  1PJ5 A;  5EBK A;  1N4W A;  1QO8 A;  4HA6 A;  3DJJ A;  4BK3 A;  2OLO A;  1X31 B;  4K7Z A;  2GF3 A;  3G5R A;  4BK2 A;  4REK A;  2C73 A;  2GQF A;  3V76 A;  2WOV A;  1BGN A;  1CBO A;  3S61 A;  1CC6 A;  1EBD A;  3VR9 A;  4A79 A;  1DOC A;  3NGC X;  1L9D A;  1NAA A;  1PJ7 A;  4GF7 A;  4Z2R A;  2V60 A;  1VRQ B;  3FPZ A;  4A6N A;  5BUK A;  1CJ2 A;  2VZ2 A;  2YLS A;  4JY3 A;  3VQR A;  4H4S A;  2XLS A;  2ZZC A;  4IA6 A;  2GMH A;  3LZX A;  4U2S A;  3H8I A;  4TM0 A;  5CQF A;  5IQ4 A;  4TLX A;  4DNA A;  4OPG A;  1ZOY A;  1GES A;  3DA1 A;  1F8R A;  4LU6 A;  2BXR A;  5JCN A;  5GRT A;  1IUS A;  3P1W A;  5JCM A;  1CJ3 A;  2R0C A;  1PBE A;  2BK5 A;  2BS4 A;  3AB1 A;  1GSN A;  5JCL A;  3BHF A;  3URH A;  2WU5 A;  4YTP A;  5FMH A;  1H81 A;  2JB1 A;  3ICR A;  4JDR A;  1ZY8 A;  2C3C A;  1LTX R;  4Z44 A;  3NYC A;  2TPR A;  4ZCD A;  2C75 A;  4B1B A;  2VRL A;  1FL2 A;  2BS3 A;  1H83 A;  5FS6 A;  2V61 A;  5BRT A;  5EOW A;  5KOW A;  3M0O A;  2Q6U A;  3P4R A;  1F8S A;  3EPT A;  2GR3 A;  2A8X A;  3II4 A;  3FG2 P;  2XCG A;  3EAO A;  4I59 A;  1JU2 A;  4GR1 A;  5M10 A;  1UKV G;  3P4P A;  1ZMC A;  5CKU A;  3V3O A;  1GV4 A;  4H4P A;  2YG3 A;  4CCR A;  4H2N A;  1B37 A;  4JN9 A;  3SFD A;  4Z43 A;  3AWI A;  3ZDN A;  5U63 A;  4JQ9 A;  4AP3 A;  3ABV A;  4EIP A;  3CPI G;  4IV9 A;  4AOX A;  4RG4 A;  3NG7 X;  1OJA A;  3QFA A;  1DNC A;  3UP5 A;  1H84 A;  3RP6 A;  4B69 A;  4GRT A;  1L9C A;  2E1M A;  1GET A;  2GAH B;  1PN0 A;  3D1C A;  2RAB A;  3KKJ A;  1XAN A;  1MXT A;  1B8S A;  3QJ4 A;  5HY5 A;  1NEK A;  5J60 A;  3CPJ G;  3GYI A;  4BV6 A;  1GND A;  3M12 A;  2JK6 A;  3DGZ A;  3OC4 A;  1E7P A;  2XVF A;  5BVA A;  3DK9 A;  2YLW A;  1KSU A;  3AYI A;  1FCD A;  1TDE A;  2UZZ A;  1CL0 A;  2OLN A;  1YQ3 A;  1MO9 A;  1BWC A;  3NN0 X;  1TYP A;  4NEW A;  3AXB A;  3B6D A;  5DBJ A;  1QLB A;  2C64 A;  3ATR A;  2V3B A;  1NHQ A;  3AE4 A;  3P4Q A;  5HYM A;  4YSZ A;  3K7M X;  4IVM B;  1B5Q A;  1NPX A;  4U8K A;  4FDC B;  4H4Y A;  1NDA A;  2GQW A;  3P9U A;  4ICY A;  1FEB A;  2XLR A;  4EM3 A;  2YLT A;  4K5S A;  1D7L A;  4FK1 C;  4Z2T A;  2R46 A;  4A6N B;  2B9Y A;  2YLZ A;  1OJC A;  3BNM A;  1H6V A;  2VQB A;  4BJY A;  2C66 A;  1ZP0 A;  2YG4 A;  3UTF A;  2XFQ A;  1N1P A;  2Q7V A;  4U8L A;  2YG6 A;  3AEC A;  3KVE A;  3SGL A;  3AEB A;  4X9N A;  1GRA A;  1F6M A;  2H89 A;  4J36 A;  2R4J A;  3NYF A;  2BYB A;  1ELI A;  3KA7 A;  4ZCC A;  2XVH A;  3VR8 A;  3K30 A;  3QFB A;  1OJD A;  2WPF A;  2FJE A;  2WEU A;  4H50 A;  3AYL A;  3NYE A;  1GRE A;  3H8L A;  1CC4 A;  4YTM A;  3BHK A;  4O5U A;  3DH9 A;  4Z24 A;  4K5R A;  2BA9 A;  2WP9 A;  2XFO A;  4B67 A;  2AR8 A;  2QAE A;  2JB2 A;  1GRG A;  4H4R A;  3IHM A;  4A65 A;  4A99 A;  2GH5 A;  3JSK A;  1GAL A;  2CDU A;  1Y56 B;  3AE9 A;  3DJD A;  4H4U A;  4USQ A;  2RGO A;  4DSG A;  2DKI A;  4UDP A;  3UP4 A;  3DGH A;  5EB5 A;  3F8R A;  3UKF A;  1V59 A;  1Q1W A;  1PDH A;  3UCL A;  3VRA A;  1EL9 A;  3AE5 A;  4EQX A;  3UKH A;  2AAQ A;  2HQM A;  1YY5 A;  3SFE A;  3ALM A;  2GR2 A;  1BF3 A;  1H7X A;  3AD7 B;  3FIM B;  1ZMD A;  2YR4 A;  1GER A;  1DJQ A;  1D7Y A;  1CC2 A;  3FBS A;  1GTH A;  4OPI A;  1PBB A;  3EAN A;  4B64 A;  1H82 A;  2XFN A;  4OPC A;  2PYX A;  3UOY A;  4YSX A;  1PBC A;  1PXC A;  2WQY A;  2BC0 A;  4NTC A;  4J33 A;  2R45 A;  2YAU A;  1TYT A;  1TDF A;  2BK3 A;  3GDP A;  3I6D A;  4YKF A;  2VVL G;  5GSN A;  4IVO B;  3AEA A;  3RP8 A;  3M13 A;  1D4E A;  4C74 A;  2WOW A;  4YSY A;  4H2P A;  5U25 A;  3WE0 A;  1GRT A;  1E1M A;  1GRH A;  4IA5 A;  3L8K A;  3NLC A;  4CY8 A;  5KOX A;  1EL7 A;  3QSM A;  1D4C A;  1L0V A;  2XYO A;  3NTA A;  4FX9 A;  3UTG A;  2WP6 A;  2Y6R A;  3CIR A;  2WOI A;  4X9M A;  2CUL A;  2E5V A;  4YT0 A;  4OPT A;  2C76 A;  1S2Y A;  2B9X A;  4K2X A;  1H86 A;  3GDN A;  3IF9 A;  2WES A;  2R0P A;  1GT8 A;  3SQP A;  3Q6J A;  2YG5 A;  2YM1 A;  3CND A;  3SM8 A;  4JY2 A;  4USR A;  4H4Z A;  2BAB A;  5C3J A;  3IHG A;  4U8M A;  3UKL A;  2YLX A;  3AE7 A;  3Q9T A;  5HHF A;  3O0H A;  3RNM A;  1P2E A;  1GTE A;  1ZX9 A;  3NT6 A;  2FJA A;  4J56 A;  5FS9 A;  1LVL A;  1PS9 A;  1FOH A;  1E1N A;  5KRQ A;  4EQR A;  1M64 A;  4OPL A;  2GAG B;  4XXG A;  3F8P A;  5TR3 A;  4I58 A;  3G5S A;  1Q9I A;  2BXS A;  2Z5Y A;  1KNP A;  1OJ9 A;  2V6O A;  2EQ9 A;  3VRD B;  3DK8 A;  2BAC A;  2YVF A;  2WDV A;  2A89 A;  3CNT A;  2X3N A;  3NK2 X;  3UKA A;  3KPF A;  2YR5 A;  3ADA B;  2VRM A;  4Z25 A;  3CGD A;  1KDG A;  4C3Y A;  1SEZ A;  4PAB A;  4H4X A;  4H2R A;  3FMW A;  4EM4 A;  3G5Q A;  4A7A A;  1YQZ A;  1XPQ A;  4O5Q A;  4LA1 A;  4YWO A;  1HYU A;  1RYI A;  2BCG G;  4H4W A;  3C96 A;  4RG3 A;  1TDN A;  1LPF A;  1TDO A;  1RSG A;  2VVM A;  4P9S A;  2PHH A;  2VOU A;  2XLP A;  3ICT A;  4OCG A;  2X50 A;  1GRB A;  1CJ4 A;  2ZBW A;  1E39 A;  2JB3 A;  4EMI A;  3BI4 A; 
#chains in the Genus database with same CATH topology
 4EWJ A;  2VQ7 A;  4KX6 A;  3GYJ A;  3CAW A;  4AOS A;  3L1R A;  1W6T A;  1ELS A;  1BKH A;  5FJT A;  4CNJ A;  3R10 A;  2OA1 A;  3P0W A;  2YVG A;  2JKC A;  5JCI A;  3S47 A;  4CCQ A;  3D8X A;  2QA2 A;  4TM4 A;  3T37 A;  1IUV A;  4U2L A;  3BI2 A;  4ADW A;  1BKW A;  4DGK A;  4Z1Y A;  2XVJ A;  3TOY A;  2O9Z A;  1IUT A;  1OJT A;  1N63 C;  1FFV C;  1W4X A;  4B65 A;  3HPF A;  2XGZ A;  4RSL A;  4E8G A;  1XHC A;  4GIR A;  1Z6L A;  2FBW A;  3I4K A;  3FXG A;  4IL0 A;  1S3B A;  4GYP C;  1KFY A;  3NFU A;  3PVC A;  1XPY A;  4ECH A;  5FJP A;  2OZ3 A;  3B3R A;  4YSH A;  1QJD A;  3TWA A;  1PJ6 A;  2POZ A;  2AL2 A;  3CGE A;  1N4V A;  4J2W A;  2GEW A;  1XDI A;  1K4Q A;  1LJ1 A;  3B97 A;  2Z5X A;  4TM3 A;  2GRT A;  2DKH A;  2GGE A;  2APG A;  2CVJ A;  3DJE A;  3KD9 A;  2WS3 A;  4FK1 A;  2POD A;  4DX3 A;  3PO7 A;  2B76 A;  3ZYX A;  3RHA A;  3LJP A;  4U8P A;  5FJO A;  1H2I A;  2Y6Q A;  4MKS A;  2OZ8 A;  3QSS A;  4HN8 A;  4Y4M A;  4C5O A;  2ARD A;  3S5W A;  1O95 A;  2C3D A;  1NEN A;  4G6G A;  4AT0 A;  2BK4 A;  1P48 A;  1N5X A;  2FJB A;  1AOG A;  3VRB A;  1L9E A;  3RP7 A;  2P88 A;  3OPS A;  4EMW A;  1NHR A;  2RGJ A;  3AD8 B;  3V3N A;  3VC5 A;  2OAL A;  2XSX A;  4G9K A;  3H7V A;  1S3E A;  4HB9 A;  5FJU A;  1VDC A;  2Q0K A;  2WU2 A;  2XFP A;  2AL2 B;  4M52 A;  1T3Q C;  4GIS A;  4XWR A;  3H4K A;  2AKM A;  3K7Q X;  4A35 A;  5IPY A;  4YXD A;  2PTW A;  2X8H A;  3D47 A;  1PBD A;  3BI5 A;  4TVW A;  2EQ7 A;  3AED A;  3FV9 A;  1PDZ A;  1GXF A;  2EQ8 A;  1IUU A;  3GSI A;  1PHH A;  1EL5 A;  2NVK X;  3UTE A;  3GC2 A;  5KVH A;  1X2H A;  3UJF A;  1WUE A;  1N4W A;  2E3T A;  4BK3 A;  2OLO A;  1X31 B;  2GF3 A;  3DDM A;  3G5R A;  3T14 A;  2C73 A;  4M6U A;  4DXK A;  3VR9 A;  1DOC A;  1VRQ B;  3N4F A;  3JW7 A;  2GMH A;  4TLX A;  3PWI A;  3HYW A;  1GES A;  3B9J B;  1F8R A;  4LU6 A;  5JCN A;  2P8C A;  3KPK A;  1CJ3 A;  1R6W A;  2R0C A;  1PBE A;  3DG3 A;  2BK5 A;  3AB1 A;  4K1W A;  1H81 A;  1LTX R;  2TPR A;  4E4U A;  3PWG A;  4HNC A;  2V61 A;  5KOW A;  3M0O A;  2Q6U A;  1SJC A;  1F8S A;  3EPT A;  2XCG A;  3V3W A;  3ENL A;  3TCS A;  5KNL A;  4JN9 A;  2MNR A;  4JQ9 A;  4AP3 A;  4EIP A;  4IV9 A;  2QDD A;  3RIT A;  2RAB A;  3CPJ G;  4BV6 A;  2JK6 A;  1E7P A;  2HZG A;  3DK9 A;  1KSU A;  4A6G A;  4A3R A;  2UZZ A;  4K8G A;  1CL0 A;  3NN0 X;  3AE4 A;  2QJM A;  2XH7 A;  3ZVH A;  1NDA A;  2XLR A;  2OPJ A;  2YLZ A;  3DES A;  1ZP0 A;  3UTF A;  1N1P A;  3KVE A;  2P8B A;  1STZ A;  1F6M A;  2W54 A;  2R4J A;  2FKP A;  1ELI A;  3KA7 A;  2XVH A;  2OZT A;  1MDL A;  4H50 A;  3H8L A;  4YTM A;  3DH9 A;  2BA9 A;  2XFO A;  4B67 A;  3L5O A;  1GRG A;  4H4R A;  4A99 A;  2QVH A;  3EEZ A;  3AE9 A;  4H4U A;  3UP4 A;  1E9I A;  1OEP A;  1Q1W A;  3UKH A;  2AAQ A;  1YY5 A;  3ALM A;  3AD7 B;  3ES8 A;  4J3Z A;  4G74 A;  1PXC A;  2BC0 A;  3UTG A;  4YKF A;  3HYV A;  3RP8 A;  3M13 A;  1SB3 B;  1GRT A;  1E1M A;  5KOX A;  3L8K A;  3NLC A;  4CY8 A;  4M0X A;  2BRA A;  2OX4 A;  2XYO A;  2WOI A;  2E5V A;  2C76 A;  3GDN A;  3ZVH B;  5KMP A;  4JY2 A;  2BAB A;  3IHG A;  4U8M A;  3DG7 A;  3SZ0 A;  3AE7 A;  3Q9T A;  5HHF A;  1RVK A;  1GTE A;  1P2E A;  5FS9 A;  3D46 A;  5KRQ A;  3GO2 A;  3IJL A;  4OPL A;  2GAG B;  4XXG A;  3F8P A;  4I58 A;  3NRZ B;  3UXK A;  1JPD X;  1XS2 A;  3CB3 A;  3UKA A;  3ADA B;  3S5S A;  1RYI A;  4YWO A;  4H4W A;  1TDO A;  2PHH A;  3H12 A;  3ICT A;  2ZBW A;  1VDV A;  2OG9 A;  1O5W A;  2R0G A;  4CRT A;  2TMD A;  3NN6 X;  1BQG A;  4B68 A;  4WCT A;  3BNU A;  1FHV A;  2C67 A;  4GDP A;  4NTE A;  1RP0 A;  1FEC A;  2NPX A;  3I6E A;  4C77 A;  2C72 A;  2P3Z A;  4D03 A;  4EIQ A;  2X8C A;  3NHO X;  3IWA A;  2V3A A;  2IVE A;  2HXU A;  4KPL A;  3CPH G;  3PS9 A;  3NK1 X;  3UKP A;  3UOZ A;  4KEM A;  3I3L A;  3LZW A;  2WDQ A;  3HYX A;  2YQU A;  3NIX A;  1EC8 A;  1FFU C;  4ROP A;  3ZLG A;  3NNE A;  4OVI A;  3N4E A;  4GGH A;  1WYG A;  5EU9 A;  4H4V A;  2GMJ A;  2BC1 A;  2GGI A;  1LV0 A;  5IQ1 A;  3NVW B;  1E1K A;  3QSE A;  4TLZ A;  3D9X A;  2C70 A;  3T6C A;  4CBQ A;  4J1O A;  3STP A;  2YLR A;  3UKQ A;  3DIP A;  1L8P A;  4XWZ A;  3QLD A;  2YWL A;  3LXD A;  4C3X A;  2BCP A;  5L46 A;  5BUL A;  4Z26 A;  4MMW A;  1KCZ A;  4JNQ A;  3NH3 X;  2R4E A;  1D4D A;  3EUB 3;  3IC9 A;  4G8T A;  1K0J A;  1CF3 A;  1Y56 A;  1YQ4 A;  2OAM A;  3CTY A;  3CGC A;  3ATQ A;  4MGG A;  3UJS A;  4APN A;  3IJI A;  4IP5 A;  1JDF A;  1ONF A;  1FEA A;  4Y4N A;  3DFH A;  1S2Q A;  1DOE A;  1JRY A;  1NHS A;  3SX6 A;  3NVY B;  1NHP A;  4BUR A;  2WDR A;  3GWD A;  5C2T A;  2PP3 A;  4B63 A;  1NEL A;  4DSH A;  5JCK A;  3Q4D A;  3RGT A;  4KPR A;  2A87 A;  3AM9 A;  4JHM A;  3OZY A;  2B7S A;  2XLT A;  1BGJ A;  2QA1 A;  4NTD A;  3QN3 A;  4J31 A;  1NG4 A;  3COX A;  1JEH A;  5KVI A;  1TRB A;  2YG7 A;  3VFC A;  3AE1 A;  2V5Z A;  2R9Z A;  2I0Z A;  3KLJ A;  4U2T A;  3SJN A;  1NG3 A;  4DWD A;  3AD9 B;  4LII A;  2IVD A;  1SJA A;  2B9W A;  4UDR A;  3UKK A;  3GWF A;  2X8G A;  3EF6 A;  1PJ5 A;  5EBK A;  1QO8 A;  3DJJ A;  4G6H A;  3OW1 A;  3NGC X;  1L9D A;  4Z2R A;  4A6N A;  5BUK A;  4JY3 A;  3LZX A;  4U2S A;  4TM0 A;  4HNL A;  1ZOY A;  3DA1 A;  2BXR A;  3P1W A;  1IUS A;  1FHU A;  3URH A;  3Q45 A;  2XH4 A;  2JB1 A;  4JDR A;  4YWS A;  3TW9 A;  2C75 A;  1NU5 A;  4B1B A;  3TQP A;  1H83 A;  5BRT A;  3II4 A;  5M10 A;  6ENL A;  3V3O A;  1GV4 A;  3SFD A;  3ZDN A;  5U63 A;  3CPI G;  5J04 A;  4RG4 A;  3UP5 A;  1L9C A;  2E1M A;  1PN0 A;  3D1C A;  3QJ4 A;  5HY5 A;  3SZW A;  1GND A;  3OC4 A;  5BVA A;  2YLW A;  1FCD A;  1YQ3 A;  1TYP A;  4NEW A;  3B6D A;  1JCT A;  3N6H A;  3P4Q A;  4YSZ A;  3A7R A;  1NPX A;  4FDC B;  4EM3 A;  2R46 A;  4A6N B;  1H6V A;  2VQB A;  2YG4 A;  3PK7 A;  2XFQ A;  3TJ4 A;  2Q7V A;  4GYP A;  2GDQ A;  2GGJ A;  3VCN A;  1JPM A;  1N62 C;  3VR8 A;  1OJD A;  2WPF A;  2FJE A;  3AYL A;  1GRE A;  2WP9 A;  2AR8 A;  2OFJ A;  4A65 A;  3JSK A;  2CHR A;  3CXO A;  4USQ A;  2RGO A;  4UDP A;  3DGH A;  1V59 A;  1PDH A;  3UCL A;  2ZC8 A;  1BF3 A;  1ZMD A;  2YR4 A;  2MUC A;  1GER A;  4OPI A;  3RRA A;  4DN1 A;  4B64 A;  1H82 A;  4H1Z A;  4OPC A;  5KMS A;  2WQY A;  4NTC A;  2R45 A;  2BK3 A;  2VVL G;  4IVO B;  3AN1 A;  4C74 A;  4YSY A;  4H2P A;  3WE0 A;  3NO1 A;  4IA5 A;  3QSM A;  1D4C A;  3NTA A;  3OP2 A;  4FX9 A;  2WP6 A;  2Y6R A;  4YT0 A;  4OPT A;  1H86 A;  2R0P A;  4HYR A;  3SQP A;  3Q6J A;  3SM8 A;  4H4Z A;  5C3J A;  4IZG A;  1KD0 A;  3NT6 A;  1ZX9 A;  2FJA A;  4J56 A;  1LVL A;  1E1N A;  1S7M A;  1M64 A;  1Q9I A;  2BXS A;  1KNP A;  2EQ9 A;  3VRD B;  2YVF A;  4PAB A;  4EM4 A;  4O5Q A;  2PU0 A;  4LA1 A;  4E4F A;  3C96 A;  3T9P A;  4P9S A;  4OCG A;  3SN0 A;  2RGH A;  1ZXI C;  2GL5 A;  2PTZ A;  3UJ2 A;  1PXA A;  3AYJ A;  3K7T A;  4U8O A;  2AQJ A;  3V5C A;  3BSM A;  1KF6 A;  4H83 A;  2NQL A;  1Q1R A;  2QGY A;  4UDQ A;  4B66 A;  1K0L A;  4NZH A;  3DME A;  5U1O A;  1JRP A;  1LQT A;  2F5Z A;  3NK0 X;  1EL8 A;  3UJE A;  3U9I A;  2WPE A;  2E5A A;  4OPD A;  2P0I A;  2VVL A;  4X4J A;  3CGB A;  2BS2 A;  4EQW A;  3C4A A;  7ENL A;  3NXL A;  1B4V A;  2PSN A;  1F8W A;  4IT1 A;  2ZZB A;  3CNJ A;  3P4S A;  4ZN0 A;  1F3P A;  5ENL A;  1KNR A;  4ZCW A;  3DK4 A;  1IJH A;  3ICS A;  4YTN A;  1VQW A;  3GRS A;  1ZOV A;  1P2H A;  2PP1 A;  4GCM A;  2C65 A;  2XVE A;  2X99 A;  4GDE A;  2RDX A;  1YKJ A;  3JVA A;  4EQS A;  4BK1 A;  3GD4 A;  3AEE A;  2YR6 A;  2AKZ A;  3HW2 A;  1TKK A;  1N4U A;  2XFU A;  1Y0P A;  3HZL A;  3SBF A;  3I6T A;  1TDK A;  3SN1 A;  4MJW A;  4GUV A;  3UOX A;  2PTY A;  3T2Z A;  3OTR A;  4JN7 A;  3ISH A;  1IUX A;  3PG6 A;  4Y4L A;  3CT2 A;  3MUC A;  2Q0L A;  2XLU A;  2WHD A;  5BOF A;  3U4F A;  2WET A;  1DOD A;  3CN8 A;  1V97 A;  2ACZ A;  1VG0 A;  4H2Q A;  1BZL A;  4TM1 A;  3F8D A;  2QCU A;  3AE8 A;  3CK5 A;  4CY6 A;  2WPC A;  3MSY A;  2C4C A;  4J34 A;  1KKR A;  3PFR A;  3P93 A;  3GYX A;  3GRT A;  1M6I A;  3MY9 A;  4HCH A;  1LQU A;  2GV8 A;  2J3N A;  3IJQ A;  2XVI A;  3LAD A;  4U8I A;  1DXL A;  1D5T A;  4WX1 A;  5FS7 A;  4Z2U A;  2C7G A;  3A7A A;  2PGW A;  3E1T A;  3T2K A;  1JOA A;  2FYM A;  4K22 A;  1COY A;  2B7R A;  3MZN A;  1O94 A;  2OLA A;  4K8D A;  4UP3 A;  2PTX A;  4A9W A;  3AE3 A;  3DJG X;  3RED A;  4HA6 A;  4K7Z A;  3OZM A;  4BK2 A;  4REK A;  4GAV A;  2GQF A;  1CBO A;  5JRB A;  1NAA A;  4GF7 A;  2GGG A;  2V60 A;  1N61 C;  3FPZ A;  2OO6 A;  3VA8 A;  4H4S A;  4FP1 A;  3H8I A;  5CQF A;  5IQ4 A;  3SSZ A;  4OPG A;  5GRT A;  2BS4 A;  3MQT A;  2QJN A;  1ZY8 A;  2C3C A;  1PDY A;  4ZCD A;  3DER A;  3T8Q A;  2VRL A;  1FL2 A;  3T4W A;  5FS6 A;  5EOW A;  3DFY A;  2PS2 A;  2GR3 A;  4I59 A;  3EAO A;  1ZMC A;  5CKU A;  3ZLF A;  2YG3 A;  4E6M A;  2PGE A;  1B37 A;  3AWI A;  3IK4 A;  3ABV A;  3FCP A;  4AOX A;  3ZVI A;  3QFA A;  1H84 A;  3VC6 A;  3RP6 A;  3QTP A;  1GET A;  3NZG A;  2GAH B;  4KT2 A;  3TTE A;  1B8S A;  5J60 A;  1NEK A;  3M12 A;  3NVZ B;  2XVF A;  3K1G A;  1TDE A;  3SN4 A;  2GSH A;  1BWC A;  3AXB A;  5DBJ A;  3ATR A;  1YEY A;  5HYM A;  1WUF A;  3CMM A;  4H4Y A;  2GGH A;  3FVD A;  4ICY A;  4K5S A;  2BRY A;  4FK1 C;  1OJC A;  4BJY A;  5FJR A;  4U8L A;  4HPN A;  4GME A;  2YG6 A;  3R25 A;  3AEB A;  4X9N A;  3R07 C;  2H89 A;  4J36 A;  3NYF A;  2BYB A;  4TVY A;  4ZCC A;  3K30 A;  2WEU A;  3NYE A;  3QKE A;  4Z24 A;  2ZAD A;  1GAL A;  1Y56 B;  4DSG A;  3UKF A;  4HCD A;  3VRA A;  3AE5 A;  4EQX A;  2QQ6 A;  2HQM A;  3KUM A;  3DGB A;  4GFI A;  3T0K A;  3FIM B;  1D7Y A;  1CC2 A;  3FBS A;  1PBB A;  3R0K A;  2PYX A;  4YSX A;  4J33 A;  2YAU A;  1TYT A;  3I6D A;  1EC9 A;  1D4E A;  3BJS A;  3V5F A;  5U25 A;  3BOX A;  1GRH A;  3SQS A;  3VCC A;  3H8A A;  3CIR A;  4X9M A;  2WES A;  1N5W C;  1GT8 A;  2YM1 A;  1MUC A;  2PP0 A;  2YLX A;  2OQH A;  3MWC A;  3O0H A;  3RNM A;  1F9C A;  1PS9 A;  1FOH A;  3NVV B;  4EQR A;  3UJR A;  3G5S A;  3R0U A;  2Z5Y A;  1OJ9 A;  3DG6 A;  3UXL A;  3DK8 A;  2A89 A;  5G5G B;  3NK2 X;  1ONE A;  2PU1 A;  3SZF A;  2YR5 A;  2VRM A;  2PPG A;  4Z25 A;  3CGD A;  1KDG A;  4C3Y A;  3H70 A;  4H4X A;  3FMW A;  3G5Q A;  1XPQ A;  3GD6 A;  1TDN A;  2XH0 A;  2VVM A;  2VOU A;  2XLP A;  2X50 A;  1GRB A;  2JB3 A;  3BI4 A;  2XH2 A;  5BOE A;  3AE2 A;  4H19 A;  1GOS A;  3SYI A;  3C4N A;  1DOB A;  2IID A;  2FJD A;  4ZA0 A;  4A5L A;  3VDG A;  4JN8 A;  3UCD A;  2YM2 A;  1MOK A;  1X2G A;  3QVP A;  4II2 A;  4IL2 A;  5J7X A;  5EB4 A;  2WBA A;  2ZZ0 A;  1CJC A;  3ITJ A;  2GR1 A;  2GR0 A;  3CYJ A;  1ZKQ A;  4YKG A;  3TWB A;  2GB0 A;  2GVC A;  4KWS A;  1GEU A;  2WP5 A;  1JRX A;  2W3S A;  2PCE A;  3CXB A;  3CNP A;  3AMZ A;  3ALJ A;  2W0H A;  5M0Z A;  1SJD A;  4JNA A;  1JNR A;  1GRF A;  4NEV A;  1MRA A;  3UTH A;  2JAE A;  5KWF A;  4AT2 A;  4D04 A;  3R11 A;  4PAA A;  3LB8 A;  1E1L A;  1ZDL A;  3NTD A;  5FS8 A;  4HCL A;  1ECQ A;  2CFY A;  3ETR B;  1JRO A;  3LOV A;  3ES7 A;  3GD3 A;  1K0I A;  2QJJ A;  3GMC A;  3T2Y A;  5ER0 A;  4U8N A;  1EC7 A;  4OPU A;  4BJZ A;  1PXB A;  4E0V A;  2YVJ A;  2W55 A;  3GMB A;  1MNS A;  2ONE A;  2E4G A;  1ZK7 A;  1FIQ B;  1DJN A;  1KSS A;  4DYE A;  1PBF A;  5KMR A;  1JNZ A;  1GPE A;  3A7U A;  1CHU A;  4H2H A;  3NS1 B;  4H7U A;  1KN0 A;  2XDO A;  3UOV A;  4K2S A;  3CNS A;  3NKS A;  4H4T A;  3AEF A;  3R9U A;  1JRZ A;  3THU A;  4CNK A;  1MDR A;  4N9X A;  1VG9 A;  4H4Q A;  3SXI A;  3AEG A;  2H88 A;  1E6E A;  3AE6 A;  4F4R A;  2PA6 A;  1H7W A;  4ZOH B;  2JBV A;  3QVR A;  3KU9 A;  2I5Q A;  2W3R A;  2DW7 A;  2EQ6 A;  4EMJ A;  2AL1 A;  1REO A;  4J57 A;  1TZZ A;  4DHG A;  3ALL A;  5HXI A;  3T31 A;  4X2P A;  3OZ2 A;  3NRN A;  1SJB A;  5KMQ A;  5LV9 A;  4AP1 A;  3ZLH A;  4U8J A;  1IUW A;  1P43 A;  5KXJ A;  3SZC A;  3N6J A;  1N60 C;  3EKG A;  3V76 A;  2WOV A;  1BGN A;  1IYX A;  3S61 A;  1CC6 A;  1EBD A;  4A79 A;  1PJ7 A;  1CJ2 A;  2VZ2 A;  2YLS A;  3VQR A;  2QDE A;  3TJI A;  2XLS A;  2ZZC A;  4IA6 A;  4DNA A;  5JCM A;  1GSN A;  4FI4 A;  5JCL A;  3BHF A;  3FJ4 A;  2WU5 A;  4YTP A;  5FMH A;  4NWZ A;  3ICR A;  4Z44 A;  3NYC A;  1EBG A;  2BS3 A;  3P4R A;  1VQZ A;  2A8X A;  3FYY A;  3FG2 P;  3GY1 A;  1JU2 A;  4GR1 A;  4NNJ A;  1UKV G;  4IP4 A;  3P4P A;  4H4P A;  4CCR A;  4H2N A;  4Z43 A;  4Z17 A;  2HNE A;  3QPE A;  3NG7 X;  1OJA A;  1DNC A;  4B69 A;  4GRT A;  1RM6 B;  1KKO A;  3KKJ A;  1XAN A;  3P3B A;  1MXT A;  4ENL A;  3GYI A;  5G5H B;  1R0M A;  3DGZ A;  3RO6 A;  1TE6 A;  3AYI A;  2OLN A;  3R1Z A;  1MO9 A;  2OQY A;  1QLB A;  2C64 A;  2V3B A;  1NHQ A;  3K7M X;  4IVM B;  1B5Q A;  4U8K A;  5IDZ A;  2GQW A;  3V4B A;  3P9U A;  1FEB A;  2YLT A;  4Z2T A;  1D7L A;  2B9Y A;  3BNM A;  2C66 A;  3SGL A;  3AEC A;  4G73 A;  1GRA A;  3HRD C;  2HXT A;  4G7F A;  1DTN A;  3QFB A;  3MKC A;  1CC4 A;  3BHK A;  4O5U A;  2OVL A;  3SY4 A;  4GAP A;  4K5R A;  2QAE A;  2JB2 A;  3IHM A;  2GH5 A;  2CDU A;  3DJD A;  2DKI A;  5EB5 A;  3F8R A;  1EL9 A;  1FO4 A;  3SFE A;  2GR2 A;  2O56 A;  1H7X A;  2DW6 A;  3RCY A;  1DJQ A;  2PMQ A;  1GTH A;  3EAN A;  2XFN A;  2OKT A;  3UOY A;  1PBC A;  3DEQ A;  1TDF A;  1EBH A;  3GDP A;  5GSN A;  3AEA A;  2WOW A;  4IHC A;  1EL7 A;  1L0V A;  2CUL A;  1S2Y A;  2B9X A;  4K2X A;  3IF9 A;  2YG5 A;  3CND A;  4USR A;  3UKL A;  3RR1 A;  5TR3 A;  3JZU A;  4II3 A;  4E5T A;  2V6O A;  2BAC A;  2WDV A;  3CNT A;  2X3N A;  3UGV A;  3KPF A;  3SR6 B;  1SEZ A;  4H2R A;  4A7A A;  1YQZ A;  4GGB A;  2BCG G;  4RG3 A;  1HYU A;  1LPF A;  1RSG A;  3UCC A;  1CJ4 A;  1E39 A;  4EMI A; 
#chains in the Genus database with same CATH homology
 3AE2 A;  2RGH A;  2VQ7 A;  1O5W A;  1GOS A;  4KX6 A;  3GYJ A;  3SYI A;  3C4N A;  4AOS A;  2R0G A;  1DOB A;  2IID A;  2TMD A;  3L1R A;  2FJD A;  4CRT A;  3NN6 X;  1PXA A;  4A5L A;  3AYJ A;  3K7T A;  4U8O A;  4WCT A;  4B68 A;  4CNJ A;  2AQJ A;  2OA1 A;  2YM2 A;  3BNU A;  2YVG A;  1MOK A;  2C67 A;  4GDP A;  4NTE A;  1RP0 A;  1FEC A;  2JKC A;  3QVP A;  2NPX A;  5JCI A;  4II2 A;  1KF6 A;  2C72 A;  4C77 A;  4D03 A;  4CCQ A;  4EIQ A;  3D8X A;  2QA2 A;  4TM4 A;  1Q1R A;  3T37 A;  1IUV A;  4U2L A;  2X8C A;  3NHO X;  3IWA A;  4UDQ A;  3BI2 A;  5J7X A;  5EB4 A;  4B66 A;  1K0L A;  4ADW A;  4NZH A;  2WBA A;  2ZZ0 A;  1CJC A;  2V3A A;  3ITJ A;  2IVE A;  3DME A;  2GR1 A;  5U1O A;  1BKW A;  4DGK A;  2GR0 A;  3CPH G;  3PS9 A;  2XVJ A;  3NK1 X;  1LQT A;  2F5Z A;  3NK0 X;  3UKP A;  3UOZ A;  2O9Z A;  1EL8 A;  1ZKQ A;  1IUT A;  1OJT A;  3I3L A;  2WDQ A;  2GB0 A;  3LZW A;  4YKG A;  2GVC A;  3HYX A;  1GEU A;  1W4X A;  2WP5 A;  2YQU A;  1JRX A;  3NIX A;  4B65 A;  2WPE A;  4OPD A;  4RSL A;  3NNE A;  4OVI A;  3CNP A;  3ALJ A;  2VVL A;  2W0H A;  5M0Z A;  1XHC A;  4X4J A;  3CGB A;  2BS2 A;  4JNA A;  4H4V A;  2GMJ A;  1JNR A;  4EQW A;  3C4A A;  2BC1 A;  1LV0 A;  1Z6L A;  5IQ1 A;  1E1K A;  2FBW A;  1GRF A;  4NEV A;  3QSE A;  4TLZ A;  3UTH A;  2JAE A;  5KWF A;  1B4V A;  3D9X A;  2C70 A;  1S3B A;  1F8W A;  4AT2 A;  4D04 A;  4CBQ A;  1KFY A;  4PAA A;  3LB8 A;  1E1L A;  1ZDL A;  3NTD A;  2ZZB A;  3CNJ A;  3PVC A;  4ECH A;  3P4S A;  2YLR A;  3UKQ A;  5FS8 A;  4ZN0 A;  3B3R A;  1F3P A;  4XWZ A;  2CFY A;  2YWL A;  4YSH A;  1KNR A;  3LXD A;  1QJD A;  3LOV A;  4C3X A;  1IJH A;  1K0I A;  3DK4 A;  3GD3 A;  1PJ6 A;  2BCP A;  3ICS A;  4YTN A;  1VQW A;  3GRS A;  1ZOV A;  3CGE A;  5L46 A;  1N4V A;  4J2W A;  5BUL A;  3GMC A;  3T2Y A;  5ER0 A;  1P2H A;  2GEW A;  4Z26 A;  4GCM A;  1XDI A;  2C65 A;  1K4Q A;  1LJ1 A;  2XVE A;  4U8N A;  2X99 A;  4GDE A;  4JNQ A;  2Z5X A;  1YKJ A;  3NH3 X;  4TM3 A;  4OPU A;  4BJZ A;  1PXB A;  2GRT A;  2DKH A;  4EQS A;  2YVJ A;  4BK1 A;  4E0V A;  2R4E A;  3GD4 A;  2APG A;  2CVJ A;  3AEE A;  1D4D A;  2YR6 A;  3IC9 A;  3GMB A;  3DJE A;  3KD9 A;  1K0J A;  1N4U A;  2XFU A;  1Y0P A;  2E4G A;  1ZK7 A;  1CF3 A;  1Y56 A;  1YQ4 A;  2OAM A;  2WS3 A;  1DJN A;  3CTY A;  3HZL A;  1KSS A;  3CGC A;  3ATQ A;  4FK1 A;  1TDK A;  4MJW A;  4GUV A;  3UOX A;  4APN A;  3T2Z A;  1PBF A;  5KMR A;  1JNZ A;  3ISH A;  2B76 A;  3PO7 A;  3ZYX A;  1GPE A;  1ONF A;  3RHA A;  1IUX A;  3LJP A;  1CHU A;  1FEA A;  4U8P A;  3PG6 A;  4Y4L A;  4Y4N A;  4H7U A;  1KN0 A;  1H2I A;  2XDO A;  1S2Q A;  2Y6Q A;  3UOV A;  1DOE A;  3QSS A;  4C5O A;  4Y4M A;  1JRY A;  1NHS A;  2ARD A;  3CNS A;  3NKS A;  4H4T A;  3S5W A;  1O95 A;  1NHP A;  4BUR A;  2WDR A;  3GWD A;  3SX6 A;  5C2T A;  2C3D A;  2Q0L A;  2XLU A;  2WHD A;  3AEF A;  1NEN A;  4G6G A;  4B63 A;  3R9U A;  4AT0 A;  1JRZ A;  2BK4 A;  2WET A;  2FJB A;  4CNK A;  4DSH A;  1AOG A;  5JCK A;  4N9X A;  3VRB A;  1DOD A;  1VG9 A;  3CN8 A;  4H4Q A;  3SXI A;  3AEG A;  1L9E A;  3RP7 A;  2ACZ A;  4KPR A;  2H88 A;  1E6E A;  1VG0 A;  4EMW A;  2A87 A;  1NHR A;  4H2Q A;  1BZL A;  2RGJ A;  3AE6 A;  4TM1 A;  2B7S A;  2XLT A;  3F8D A;  1BGJ A;  3AD8 B;  2QCU A;  3V3N A;  2OAL A;  2QA1 A;  1H7W A;  3AE8 A;  4G9K A;  4NTD A;  1S3E A;  2JBV A;  3QVR A;  2WPC A;  4J31 A;  4CY6 A;  4HB9 A;  1VDC A;  2C4C A;  3KU9 A;  2Q0K A;  2WU2 A;  4J34 A;  1NG4 A;  3COX A;  3GYX A;  1JEH A;  2EQ6 A;  3GRT A;  5KVI A;  1TRB A;  1M6I A;  4EMJ A;  2YG7 A;  2XFP A;  4M52 A;  1LQU A;  1REO A;  4XWR A;  4J57 A;  2GV8 A;  3H4K A;  2J3N A;  3ALL A;  3K7Q X;  5HXI A;  2XVI A;  3T31 A;  3LAD A;  3AE1 A;  2V5Z A;  4U8I A;  1DXL A;  2R9Z A;  3OZ2 A;  3NRN A;  5IPY A;  1D5T A;  4WX1 A;  4YXD A;  5FS7 A;  2X8H A;  1PBD A;  2I0Z A;  3KLJ A;  4U2T A;  5KMQ A;  2C7G A;  4Z2U A;  5LV9 A;  4AP1 A;  1IUW A;  3E1T A;  1NG3 A;  3BI5 A;  4U8J A;  3T2K A;  2EQ7 A;  1JOA A;  5KXJ A;  3AD9 B;  3AED A;  4K22 A;  4LII A;  1COY A;  2B7R A;  1O94 A;  1GXF A;  4K8D A;  2IVD A;  2EQ8 A;  4UP3 A;  3SZC A;  1IUU A;  2B9W A;  3GSI A;  4UDR A;  4A9W A;  1PHH A;  3AE3 A;  3GWF A;  2X8G A;  2NVK X;  3DJG X;  3EF6 A;  1EL5 A;  5KVH A;  3UKK A;  3UTE A;  3RED A;  1PJ5 A;  5EBK A;  1N4W A;  1QO8 A;  4HA6 A;  3DJJ A;  4BK3 A;  2OLO A;  1X31 B;  4K7Z A;  2GF3 A;  3G5R A;  3T14 A;  4BK2 A;  4REK A;  4GAV A;  2C73 A;  2GQF A;  4G6H A;  3V76 A;  2WOV A;  1BGN A;  1CBO A;  3S61 A;  1CC6 A;  1EBD A;  3VR9 A;  4A79 A;  1DOC A;  3NGC X;  1L9D A;  5JRB A;  1NAA A;  1PJ7 A;  4GF7 A;  4Z2R A;  2V60 A;  1VRQ B;  3FPZ A;  4A6N A;  5BUK A;  1CJ2 A;  2VZ2 A;  2YLS A;  4JY3 A;  3VQR A;  4H4S A;  2XLS A;  2ZZC A;  4IA6 A;  2GMH A;  3LZX A;  4U2S A;  3H8I A;  4TM0 A;  5CQF A;  5IQ4 A;  4TLX A;  4DNA A;  4OPG A;  1ZOY A;  1GES A;  3DA1 A;  3HYW A;  1F8R A;  4LU6 A;  2BXR A;  5JCN A;  5GRT A;  1IUS A;  3P1W A;  3KPK A;  5JCM A;  1CJ3 A;  2R0C A;  1PBE A;  2BK5 A;  2BS4 A;  3AB1 A;  1GSN A;  5JCL A;  3BHF A;  3URH A;  2WU5 A;  4YTP A;  5FMH A;  4NWZ A;  1H81 A;  2JB1 A;  3ICR A;  4JDR A;  1ZY8 A;  2C3C A;  1LTX R;  4Z44 A;  3NYC A;  2TPR A;  4ZCD A;  2C75 A;  4B1B A;  2VRL A;  1FL2 A;  2BS3 A;  1H83 A;  5FS6 A;  2V61 A;  5BRT A;  5EOW A;  5KOW A;  3M0O A;  2Q6U A;  3P4R A;  1F8S A;  3EPT A;  2GR3 A;  2A8X A;  3II4 A;  3FG2 P;  2XCG A;  3EAO A;  4I59 A;  1JU2 A;  4GR1 A;  5M10 A;  4NNJ A;  1UKV G;  3P4P A;  1ZMC A;  5CKU A;  3V3O A;  1GV4 A;  4H4P A;  2YG3 A;  4CCR A;  4H2N A;  1B37 A;  4JN9 A;  3SFD A;  4Z43 A;  3AWI A;  5KNL A;  3ZDN A;  5U63 A;  4JQ9 A;  4AP3 A;  3ABV A;  4EIP A;  3CPI G;  4IV9 A;  4AOX A;  4RG4 A;  3NG7 X;  1OJA A;  3QFA A;  1DNC A;  3UP5 A;  1H84 A;  3RP6 A;  4B69 A;  4GRT A;  1L9C A;  2E1M A;  1GET A;  2GAH B;  1PN0 A;  3D1C A;  2RAB A;  3KKJ A;  1XAN A;  1MXT A;  1B8S A;  3QJ4 A;  5HY5 A;  1NEK A;  5J60 A;  3CPJ G;  3GYI A;  3SZW A;  4BV6 A;  1GND A;  3M12 A;  2JK6 A;  3DGZ A;  3OC4 A;  1E7P A;  2XVF A;  5BVA A;  3DK9 A;  2YLW A;  1KSU A;  3AYI A;  1FCD A;  1TDE A;  2UZZ A;  1CL0 A;  2OLN A;  1YQ3 A;  1MO9 A;  1BWC A;  3NN0 X;  1TYP A;  4NEW A;  3AXB A;  3B6D A;  5DBJ A;  1QLB A;  2C64 A;  3ATR A;  2V3B A;  1NHQ A;  3AE4 A;  3P4Q A;  5HYM A;  4YSZ A;  3K7M X;  4IVM B;  1B5Q A;  1NPX A;  3CMM A;  4U8K A;  4FDC B;  4H4Y A;  1NDA A;  2GQW A;  3P9U A;  4ICY A;  1FEB A;  2XLR A;  4EM3 A;  2BRY A;  2YLT A;  1D7L A;  4FK1 C;  4K5S A;  4Z2T A;  2R46 A;  4A6N B;  2B9Y A;  2YLZ A;  1OJC A;  3BNM A;  1H6V A;  2VQB A;  4BJY A;  2C66 A;  1ZP0 A;  2YG4 A;  3UTF A;  2XFQ A;  1N1P A;  2Q7V A;  4U8L A;  2YG6 A;  3AEC A;  3KVE A;  3SGL A;  3AEB A;  4G73 A;  4X9N A;  1GRA A;  1F6M A;  2H89 A;  4J36 A;  2R4J A;  3NYF A;  2BYB A;  1ELI A;  3KA7 A;  4ZCC A;  2XVH A;  3VR8 A;  3K30 A;  3QFB A;  1OJD A;  2WPF A;  2FJE A;  2WEU A;  4H50 A;  3AYL A;  3NYE A;  1GRE A;  3H8L A;  1CC4 A;  4YTM A;  3BHK A;  4O5U A;  3SY4 A;  3DH9 A;  4Z24 A;  4GAP A;  4K5R A;  2BA9 A;  2WP9 A;  2XFO A;  4B67 A;  3L5O A;  2AR8 A;  2QAE A;  2JB2 A;  1GRG A;  4H4R A;  3IHM A;  4A65 A;  4A99 A;  2GH5 A;  3JSK A;  1GAL A;  2CDU A;  1Y56 B;  3AE9 A;  3DJD A;  4H4U A;  4USQ A;  2RGO A;  4DSG A;  2DKI A;  4UDP A;  3UP4 A;  3DGH A;  5EB5 A;  3F8R A;  3UKF A;  1V59 A;  1Q1W A;  1PDH A;  3UCL A;  3VRA A;  1EL9 A;  3AE5 A;  4EQX A;  3UKH A;  2AAQ A;  2HQM A;  1YY5 A;  3SFE A;  3ALM A;  2GR2 A;  1BF3 A;  1H7X A;  3AD7 B;  3FIM B;  3T0K A;  1ZMD A;  2YR4 A;  1GER A;  1DJQ A;  1D7Y A;  1CC2 A;  3FBS A;  1GTH A;  4OPI A;  1PBB A;  3EAN A;  4B64 A;  1H82 A;  2XFN A;  4G74 A;  4OPC A;  5KMS A;  2PYX A;  3UOY A;  4YSX A;  1PBC A;  1PXC A;  2WQY A;  2BC0 A;  4NTC A;  4J33 A;  2R45 A;  2YAU A;  1TYT A;  1TDF A;  2BK3 A;  3GDP A;  3I6D A;  4YKF A;  2VVL G;  5GSN A;  4IVO B;  3AEA A;  3HYV A;  3RP8 A;  3M13 A;  1D4E A;  4C74 A;  2WOW A;  4YSY A;  4H2P A;  5U25 A;  3WE0 A;  1GRT A;  1E1M A;  1GRH A;  4IA5 A;  3L8K A;  3NLC A;  4CY8 A;  5KOX A;  1EL7 A;  3QSM A;  1D4C A;  1L0V A;  2BRA A;  2XYO A;  3NTA A;  4FX9 A;  3UTG A;  2WP6 A;  2Y6R A;  3CIR A;  2WOI A;  4X9M A;  2CUL A;  2E5V A;  4YT0 A;  4OPT A;  2C76 A;  1S2Y A;  2B9X A;  4K2X A;  1H86 A;  3GDN A;  3IF9 A;  2WES A;  2R0P A;  5KMP A;  1GT8 A;  3SQP A;  3Q6J A;  2YG5 A;  2YM1 A;  3CND A;  3SM8 A;  4JY2 A;  4USR A;  4H4Z A;  2BAB A;  5C3J A;  3IHG A;  4U8M A;  3UKL A;  2YLX A;  3SZ0 A;  3AE7 A;  3Q9T A;  5HHF A;  3O0H A;  3RNM A;  1P2E A;  1GTE A;  1ZX9 A;  3NT6 A;  2FJA A;  4J56 A;  5FS9 A;  1LVL A;  1PS9 A;  1FOH A;  1E1N A;  5KRQ A;  4EQR A;  1S7M A;  1M64 A;  4OPL A;  2GAG B;  4XXG A;  3F8P A;  5TR3 A;  4I58 A;  3G5S A;  1Q9I A;  2BXS A;  4II3 A;  2Z5Y A;  1KNP A;  1OJ9 A;  2V6O A;  2EQ9 A;  3VRD B;  3DK8 A;  2BAC A;  2YVF A;  2WDV A;  2A89 A;  3CNT A;  2X3N A;  3NK2 X;  3SZF A;  3UKA A;  3KPF A;  2YR5 A;  3ADA B;  2VRM A;  4Z25 A;  3CGD A;  1KDG A;  4C3Y A;  1SEZ A;  4PAB A;  4H4X A;  4H2R A;  3FMW A;  4EM4 A;  3G5Q A;  4A7A A;  1YQZ A;  1XPQ A;  4O5Q A;  4LA1 A;  4YWO A;  1HYU A;  1RYI A;  2BCG G;  4H4W A;  3C96 A;  4RG3 A;  1TDN A;  1LPF A;  1TDO A;  1RSG A;  2VVM A;  4P9S A;  2PHH A;  2VOU A;  2XLP A;  3ICT A;  4OCG A;  2X50 A;  1GRB A;  1CJ4 A;  2ZBW A;  1E39 A;  2JB3 A;  4EMI A;  3BI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...