3O0HA

Crystal structure of glutathione reductase from bartonella henselae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
460
structure length
455
Chain Sequence
SFDFDLFVIGSGSGGVRAARLAGALGKRVAIAEEYRIGGTCVIRGCVPKKLYFYASQYAQEFSKSIGFGWKYADPIFNWEKLVAAKNKEISRLEGLYREGLQNSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNIKGSDLCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQVQSTENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFETTPDYDLITTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESRIVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSYVYENGEKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glutathione reductase from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
molecule keywords Glutathione reductase
total genus 145
structure length 455
sequence length 460
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3o0hA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA02
2XFNA 1ZK7A 3M0OA 3EANA 1LQUA 3KLJA 5BVAA 5HXIA 2JB1A 1NHRA 3RP6A 3NK0X 1PBEA 4B66A 2GR2A 1Z6LA 2TMDA 4D03A 4Z2UA 4YKFA 3BNUA 2YLWA 3F8DA 4APNA 4CY8A 1Q1RA 2R9ZA 4P9SA 3DGZA 2YR5A 3DK8A 2V3BA 5FS6A 1YQZA 1FL2A 3NK2X 2GR3A 2B76A 2O9ZA 2V61A 3C4NA 1P2HA 4M52A 3AEDA 2J3NA 2ACZA 4BK2A 5BUKA 3CTYA 3EPTA 4YSZA 4GF7A 4Z26A 4UDPA 3QFAA 1GETA 2YG6A 2EQ9A 3K30A 4OPDA 2GEWA 4Z2RA 2BACA 4GDEA 1B4VA 1Y0PA 2FJBA 4OPUA 2BA9A 3Q9TA 4XWRA 3G5QA 2WOWA 4JN9A 4WX1A 1S3EA 3IHGA 4H4UA 3UTEA 3CNSA 4NTDA 3KKJA 2BABA 3NTAA 4U8NA 1GREA 2YQUA 3PVCA 3VQRA 1B5QA 3S5WA 2WPFA 2Q6UA 3NRNA 3NK1X 2XLPA 1GXFA 2R0PA 2BC1A 3L1RA 1S3BA 1DOCA 5C2TA 2Y6QA 2BK4A 2C67A 3BI2A 4H7UA 4K22A 4YT0A 1CC2A 4NTCA 1NHSA 3BHKA 5ER0A 1H84A 4D04A 2XVFA 3OC4A 3LB8A 2WPEA 2BYBA 1ZY8A 2R4EA 3CGDA 3BI5A 4GDPA 1E1MA 1JNRA 4C3YA 4BK3A 2YLZA 4C74A 2RABA 1B8SA 1RYIA 5EB4A 3CNTA 4FX9A 3AYLA 4U8PA 2C65A 5J7XA 4ADWA 1GOSA 4OPCA 4RG3A 3BNMA 2CULA 1L9CA 1PJ6A 3P4PA 4MJWA 4JNAA 4O5QA 1PJ5A 3AE7A 3ABVA 2YR4A 3C4AA 2WU2A 5KOXA 4TM0A 1KF6A 4H4XA 1JRYA 5HYMA 4Z24A 5GSNA 1E39A 1PBDA 3QJ4A 2C64A 2C72A 2C76A 3GWFA 1H86A 1LTXR 4YSYA 3GDPA 1E1KA 3CGCA 3UOYA 2JB3A 2QA1A 4ZN0A 3UKLA 1EL5A 5JCLA 1NG4A 4AT0A 1LPFA 1TYPA 2GMHA 4TM3A 4A7AA 2FJDA 4LA1A 3DJJA 2XVIA 1PJ7A 1VDCA 2JKCA 1CJCA 1N4WA 1FECA 3K7MX 2OLNA 3SM8A 4UP3A 4CNKA 1GT8A 2YG5A 1BWCA 2DKHA 4KX6A 1LJ1A 2C7GA 4H2NA 4ECHA 4Y4MA 3VRBA 1VRQB 1COYA 1NEKA 1IUXA 1JEHA 3AE6A 2Q0KA 3RP7A 4EQSA 4EM4A 4Y4NA 2YAUA 3URHA 1HYUA 3AD7B 2HQMA 5GRTA 3AXBA 1JOAA 2BS2A 3FBSA 4NEVA 3I6DA 2WP5A 1L0VA 2W0HA 1GRTA 4YTMA 2GQFA 2XFPA 4U8MA 1K0LA 2RGJA 3GDNA 1CC4A 3RNMA 2VQBA 1H83A 2C75A 3EAOA 1D4CA 1F8RA 2GAGB 3AEEA 3DJGX 3AWIA 1YQ3A 3DA1A 4H4WA 3NYCA 5KWFA 1GTHA 3HZLA 4PABA 4X4JA 4DSGA 2VVMA 2WOVA 5EB5A 2OAMA 2PYXA 1M64A 4HA6A 1F6MA 1O94A 2VVLG 1DODA 4C77A 1EBDA 3UCLA 3JSKA 2B9XA 4J34A 3DMEA 1H82A 4BJZA 4JY2A 4USRA 1DOEA 3AD8B 4K5SA 1YY5A 1NDAA 3NYFA 2XLRA 2YLSA 2XLUA 2FBWA 3LOVA 1PXAA 3IWAA 4U8JA 1ZMDA 3UP4A 1BGNA 3CPHG 3UOXA 3PS9A 4ZCCA 4UDQA 4EMIA 1Q9IA 3NTDA 2OA1A 2Q7VA 4GR1A 4Z44A 3SFEA 3ATRA 2YVGA 4J2WA 2YLTA 4U2TA 1ELIA 2YR6A 2XCGA 4K5RA 4C3XA 3GMBA 4NTEA 1Y56B 2BC0A 1RP0A 4FK1A 3CNPA 1KNPA 2VQ7A 1EL8A 1PN0A 1ZOVA 3QVRA 3SGLA 3ALMA 3FIMB 1CBOA 4DGKA 5KVHA 3ZDNA 1DJQA 5HHFA 3WE0A 2IIDA 1GEUA 2X8HA 1H7WA 2E4GA 3NNEA 4C5OA 4FDCB 1CJ4A 2BS3A 3BHFA 3QSEA 5JCNA 3ADAB 1Y56A 3F8RA 4E0VA 2XLSA 1CJ2A 1TYTA 2YVJA 4A5LA 1V59A 3P4QA 3ICTA 1OJCA 2WS3A 5EBKA 2XFUA 1FEAA 4U8IA 1EL7A 4REKA 4ZCDA 2C73A 2H89A 1O5WA 2VVLA 4IVMB 4B1BA 2GF3A 1MO9A 3AYIA 5J60A 2WETA 3K7QX 3NYEA 1PXCA 5HY5A 2WOIA 3GD4A 5KXJA 2WPCA 1VG0A 1PBBA 3UKKA 3AE8A 3VRAA 2YG3A 3G5RA 1VG9A 4U8KA 2E5VA 4LIIA 5FS7A 4AOSA 2BS4A 3VRDB 4UDRA 1PBCA 1AOGA 3LADA 1ZDLA 1TDKA 3CGBA 1UKVG 4J36A 4PAAA 2I0ZA 2YVFA 2CDUA 5KOWA 1DOBA 2B9WA 5IQ1A 3UKHA 1TDOA 3SQPA 1TDNA 4JDRA 1PXBA 3B6DA 1NENA 3IC9A 4NZHA 2NVKX 3M13A 2YLXA 1H6VA 4J33A 4B65A 1IUSA 2XVJA 1CL0A 3ALLA 3CIRA 3CGEA 4H4VA 1OJTA 4YWOA 1PDHA 2E1MA 4TM4A 3UKQA 2QAEA 2ZZ0A 3UTGA 1GPEA 3NT6A 3DK4A 5JCIA 1F8WA 2GMJA 4TLZA 3ICSA 4A79A 3ALJA 3CNJA 4AP1A 1GSNA 1JU2A 4YXDA 3DK9A 3CN8A 4U8OA 4H4YA 2FJEA 2X99A 3GSIA 3GRTA 2XDOA 4CNJA 1IUUA 1XHCA 1E1LA 5M10A 1X31B 2PHHA 2APGA 4FK1C 1GRGA 2YLRA 4CCRA 4B68A 1GRBA 3AYJA 4KPRA 4O5UA 4B63A 3UOZA 1TDFA 1D4DA 2GVCA 3Q6JA 4IVOB 2WDQA 2RGOA 4CRTA 4EM3A 2B7SA 1LV0A 3IF9A 1GRFA 1FCDA 4A99A 5LV9A 1MXTA 1OJDA 2DKIA 2GB0A 2XVEA 3CPJG 4I58A 4Z43A 3V3OA 2YM1A 1E1NA 3DH9A 2BCGG 2YG7A 4OPLA 3EF6A 4XWZA 2R45A 3LJPA 1XDIA 2ZZBA 3OZ2A 1LVLA 3ZYXA 4A9WA 2R46A 3QSMA 3AEFA 1GERA 4YSXA 2Y6RA 1CHUA 2IVDA 2CVJA 3GD3A 2QA2A 3AD9B 3R9UA 4NEWA 3AECA 4USQA 1KDGA 1D4EA 1QLBA 3P9UA 1DJNA 2F5ZA 1ZP0A 4U8LA 3UTHA 3V76A 4LU6A 4H4QA 5U63A 4H2RA 1D5TA 1JRZA 1IUWA 2A89A 4A65A 3UKPA 1KSUA 1DNCA 2YWLA 1EL9A 1K0JA 4H2PA 4Z25A 2Q0LA 2GV8A 4H4RA 3NH3X 1OJAA 3S61A 5IQ4A 4H4PA 4EQRA 3H4KA 3QSSA 3RHAA 5FS8A 5IPYA 2JBVA 2XYOA 2TPRA 2C66A 2IVEA 2WU5A 4H4ZA 3ATQA 4DNAA 3DJDA 4GUVA 4BJYA 4CCQA 2BXRA 4EIPA 4HB9A 3NIXA 4BK1A 4A6NB 3C96A 4YTPA 1D7LA 1YKJA 3UOVA 3BI4A 5FMHA 1DXLA 3ICRA 1H7XA 5KVIA 3ISHA 2VRLA 3FMWA 4H50A 4H4SA 1BKWA 1F3PA 2JAEA 3UKAA 2WESA 4GCMA 4B69A 4X9NA 4EIQA 3RP8A 1BZLA 4H2QA 1NPXA 3UTFA 4A6NA 2FJAA 2BK5A 4X9MA 4AP3A 2V5ZA 2OALA 4JY3A 3COXA 4H4TA 1FOHA 2BK3A 3L8KA 2XVHA 1GESA 5C3JA 5DBJA 4YTNA 1JNZA 1XPQA 3FPZA 3LZXA 3P1WA 4EMWA 1N4UA 4K2XA 3GYIA 4IV9A 2GRTA 1REOA 2Z5YA 3FG2P 3VR8A 3UKFA 4OCGA 5JCKA 3CNDA 1L9EA 3O0HA 3CPIG 2V60A 4Z2TA 2B9YA 2H88A 1O95A 3K7TA 4EQXA 3NKSA 4TLXA 1YQ4A 4IA6A 3AE1A 4K8DA 3II4A 4K7ZA 1K4QA 2JB2A 1PS9A 1NG3A 3P4RA 3GMCA 3QVPA 1S2YA 3I3LA 1GV4A 5TR3A 3DGHA 1FEBA 3GRSA 5JCMA 1KFYA 4BURA 1ZOYA 5U25A 2GAHB 1PHHA 3H8LA 4B67A 4EMJA 3DJEA 4EQWA 2BCPA 2XFQA 2YG4A 3M12A 1GALA 1ZMCA 2R4JA 1ONFA 3KPFA 3AB1A 1LQTA 1K0IA 1SEZA 2XLTA 3KVEA 4IA5A 2ZZCA 4N9XA 3AE3A 1GRAA 1GTEA 4OPIA 1PBFA 1IJHA 1S2QA 5M0ZA 2V3AA 4GRTA 2ARDA 2QCUA 2EQ8A 1F8SA 2B7RA 3QFBA 1E7PA 1Q1WA 3KA7A 1XANA 4RG4A 3AEAA 5EOWA 4OVIA 3SFDA 3PO7A 2WQYA 2Z5XA 2XFOA 2A8XA 3AEBA 1L9DA 2WEUA 3ITJA 4Y4LA 1KNRA 1JRXA 2VZ2A 3D1CA 4ICYA 4J57A 5BULA 1NHPA 3REDA 2GH5A 4I59A 1KSSA 4YSHA 2BXSA 2UZZA 2WBAA 3E1TA 5L46A 2R0CA 2WP9A 4JNQA 3NN6X 5FS9A 3NLCA 4CBQA 2EQ6A 3LZWA 4BV6A 1ZX9A 1ZKQA 3AE9A 2ZBWA 1VQWA 3KD9A 4OPTA 4U2LA 4U2SA 3AE4A 3VR9A 2OLOA 2X3NA 4YKGA 2C3CA 4XXGA 5U1OA 1N4VA 2X50A 3B3RA 4AOXA 2EQ7A 2V6OA 3NG7X 4RSLA 2GR0A 3KU9A 1QO8A 5KRQA 3P4SA 2X8GA 1QJDA 2WDRA 2JK6A 3AE2A 1CC6A 3F8PA 3IHMA 3LXDA 1N1PA 4J56A 1RSGA 1IUVA 2WDVA 4TM1A 4OPGA 1E6EA 5CKUA 2C3DA 1W4XA 3D8XA 1GNDA 2AR8A 4B64A 2C70A 3AE5A 3NGCX 3UP5A 2WP6A 4DSHA 5BRTA 3G5SA 1TDEA 2R0GA 1BGJA 1TRBA 3V3NA 1D7YA 2RGHA 2AQJA 2AAQA 3H8IA 2CFYA 3T37A 1CJ3A 2NPXA 2X8CA 3NN0X 1OJ9A 3NHOX 1P2EA 2YM2A 1MOKA 4AT2A 2WHDA 1B37A 2VRMA 1NAAA 1GRHA 1CF3A 3GYJA 5CQFA 1BF3A 1M6IA 2VOUA 1H81A 4WCTA 4JQ9A 2GR1A 3AEGA 4CY6A 2A87A 3GWDA 4J31A 1IUTA 2GQWA 1NHQA
chains in the Genus database with same CATH superfamily
4HCLA 3EANA 1LQUA 3NK0X 4B66A 2TMDA 3F8DA 5IDZA 3ZYXA 5FS6A 2V61A 4YSZA 3VCCA 4GF7A 4UDPA 2EQ9A 4OPUA 4JHMA 3QKEA 3V4BA 3IHGA 3NTAA 1GREA 1KKOA 2WPFA 3NRNA 3ZLHA 2XLPA 1GXFA 2DW6A 3L1RA 1S3BA 2ZADA 2BK4A 2C67A 3BI2A 3I4KA 1CC2A 4NTCA 1NHSA 3BHKA 5ER0A 3OC4A 3LB8A 2WPEA 1ZY8A 3SZCA 2R4EA 3BI5A 2PU0A 1B8SA 5EB4A 4FX9A 3AYLA 4ADWA 1GOSA 4RG3A 2CULA 4GAPA 2PA6A 4MJWA 2YR4A 2WU2A 1F9CA 2PTWA 3CAWA 3IJLA 2QDEA 1PDYA 1E39A 2C76A 3GWFA 1LTXR 4YSYA 2OZ3A 4ZN0A 4ZCWA 3UKLA 3VC5A 1TYPA 2GMHA 3DJJA 2XH7A 3R11A 2YG5A 1LJ1A 2C7GA 3UJ2A 4H2HA 1BQGA 3AE6A 3URHA 1HYUA 2W0HA 1N60C 4YTMA 2RGJA 3DG3A 4JN7A 2VQBA 1H83A 3DJGX 3AWIA 3HZLA 5KMPA 3VA8A 3VFCA 1M64A 4JN8A 1FFVC 4C77A 1EBDA 3T0KA 4X2PA 4BJZA 4USRA 1R0MA 3ES8A 1R6WA 4K5SA 1JPDX 3Q45A 2YLSA 3LOVA 3UP4A 1BGNA 3R0KA 4EMIA 2OA1A 2Q7VA 2YVGA 3CK5A 4J2WA 2P0IA 3UXLA 3HYWA 3GMBA 4NTEA 3CNPA 3QVRA 3SGLA 3ALMA 3FIMB 1DJQA 3WE0A 4C5OA 2X8HA 1H7WA 4GYPA 4FDCB 3BHFA 3QSEA 5JCNA 1Y56A 3FVDA 4GGHA 2YVJA 1V59A 5EBKA 2C73A 4J3ZA 1MO9A 3AYIA 5J60A 2WETA 2P8CA 3GD4A 2WPCA 3A7AA 3N4FA 4G9KA 2QGYA 3G5RA 4U8KA 3TWBA 4LIIA 1XS2A 3VRDB 1ZDLA 1TDKA 4IHCA 4FI4A 2I0ZA 1N5XA 2OX4A 3UKHA 4JDRA 3B6DA 4NZHA 1H6VA 4B65A 3IK4A 3ALLA 2QAEA 1GPEA 3NT6A 3DK4A 4Z17A 2GMJA 4TLZA 3MZNA 3ALJA 3CNJA 4AP1A 1GSNA 1JU2A 4YXDA 4U8OA 4H4YA 2X99A 3GRTA 2OLAA 2FKPA 2PHHA 3H12A 4KPRA 2GVCA 1D4DA 2AL1A 4CRTA 5J04A 2B7SA 2ONEA 3IF9A 1GRFA 3T9PA 1OJDA 2GB0A 2XVEA 2YM1A 2BCGG 3D46A 3FCPA 1GERA 3AD9B 4II2A 1EC7A 3UTHA 1D5TA 2P3ZA 2A89A 3ZLFA 2PPGA 2PU1A 1K0JA 4H2PA 1ELSA 3H8AA 4H4RA 5IQ4A 4H4PA 3H4KA 2PTXA 3KPKA 4GUVA 2HXTA 3HRDC 5FJUA 4EIPA 4YTPA 3UOVA 4A6GA 1P43A 3CXBA 3ICRA 4M0XA 4F4RA 3PWIA 1F3PA 2JAEA 3UKAA 2WESA 4B69A 4X9NA 4EIQA 1BZLA 4JY3A 1MRAA 3L8KA 2XVHA 2HXUA 4YTNA 3FPZA 1N4UA 3UJRA 4K2XA 3FG2P 3UJFA 4KEMA 1L9EA 3CPIG 2H88A 1N61C 4IP5A 2RDXA 1JRPA 1K4QA 2JB2A 1S2YA 5TR3A 1FEBA 2GAHB 1PHHA 2BCPA 3KVEA 1ZMCA 1ONFA 2XLTA 1WUFA 1GRAA 4OPIA 1PBFA 1IJHA 4E4FA 4G6HA 5M0ZA 3QFBA 1E7PA 3TTEA 1H2IA 2Z5XA 2A8XA 3ITJA 4Y4LA 3SSZA 1JRXA 1SJAA 2OFJA 4H19A 5BULA 4NWZA 2GH5A 1KSSA 2BXSA 3NLCA 4CBQA 2PTYA 1ZKQA 3GYXA 4U2LA 1VQWA 3A7UA 4XXGA 1N4VA 3B3RA 1MUCA 2GR0A 1QO8A 5G5HB 2WDRA 3AE2A 1N1PA 3U9IA 3T14A 3N6JA 4TM1A 4OPGA 2C3DA 3D8XA 3AE5A 3UP5A 2QJJA 3SZFA 1TDEA 1BGJA 1TRBA 1D7YA 2CFYA 3T37A 3I6TA 3DFYA 1NAAA 3GYJA 3R1ZA 2VOUA 2XH2A 4JQ9A 3AEGA 4CY6A 1IUTA 3V5CA 3KLJA 5BVAA 3RP6A 2GR2A 4D03A 3BNUA 2YLWA 4APNA 2GR3A 2J3NA 5BUKA 3MKCA 3EPTA 4Z26A 3NVWB 3QFAA 4H1ZA 3K30A 2GEWA 4Z2RA 2BACA 1B4VA 2BA9A 3G5QA 2WOWA 4JN9A 1S3EA 3KUMA 3PVCA 3VQRA 1MNSA 2Q6UA 3NK1X 2BC1A 2Y6QA 5FJRA 3SJNA 4DHGA 3AN1A 2OVLA 3T31A 1H84A 2BYBA 2HNEA 2W55A 4GDPA 3CGDA 3SN1A 1JNRA 1FFUC 2RABA 2C65A 5J7XA 4OPCA 3HYXA 3EEZA 3R25A 5JRBA 5KOXA 3D9XA 2C72A 2W3RA 1H86A 2QA1A 1EL5A 4AT0A 1NG4A 4K2SA 5EU9A 4TM3A 1FECA 1KN0A 2DW7A 3NZGA 4H2NA 3IJIA 1JEHA 4EQSA 4EM4A 4Y4NA 2PSNA 2W3SA 2YAUA 3AD7B 3FBSA 1JOAA 2MUCA 2WP5A 3Q4DA 3DEQA 1L0VA 1K0LA 3UJEA 1CC4A 4IL0A 3GD6A 1F8RA 2GAGB 3AEEA 3NYCA 4X4JA 4DWDA 2WOVA 2PYXA 4HA6A 2VVLG 3JSKA 2B9XA 4J34A 2XLRA 2XLUA 1PXAA 3FJ4A 2E3TA 4ZCCA 4J1OA 1Q9IA 5KMSA 4U2TA 2GL5A 4K5RA 3ETRB 1Y56B 1JROA 1ZOVA 5KVHA 3ZDNA 5KMRA 2IIDA 3ZVHB 1TYTA 3BJSA 3ICTA 3RITA 5BOEA 1OJCA 1EL7A 4REKA 1O5WA 4IVMB 4B1BA 2GF3A 3K7QX 3NYEA 2WOIA 5KXJA 3UKKA 2YG3A 2E5VA 5FS7A 3TQPA 3LADA 3MY9A 3SYIA 3PFRA 1PXBA 1NENA 2NVKX 3M13A 1X2HA 4ENLA 2XVJA 3OTRA 1RVKA 3CGEA 3RO6A 1OJTA 4TM4A 4K8GA 3UKQA 2O56A 3DK9A 2XDOA 4CNJA 1XHCA 3OZMA 1E1LA 5M10A 1X31B 4ZA0A 4CCRA 4B68A 3SXIA 3AYJA 3VC6A 3GO2A 3UOZA 3FYYA 4IVOB 4MMWA 4EWJA 3P3BA 1FCDA 4A99A 3CPJG 3DH9A 3NXLA 2YG7A 4OPLA 3LJPA 3T2KA 2ZZBA 1LVLA 4II3A 1STZA 4YSXA 2Y6RA 3VDGA 1KCZA 1N62C 4USQA 3P9UA 3RR1A 4LU6A 4H2RA 4A65A 2Q0LA 1OJAA 7ENLA 4EQRA 3QSSA 5IPYA 2JBVA 3DJDA 2WU5A 4DNAA 4CCQA 4BK1A 3AM9A 1YKJA 3BI4A 3N6HA 2OQHA 3FMWA 4H50A 1BKWA 4GCMA 4E8GA 3SZ0A 4AP3A 4X9MA 2XGZA 3HPFA 4G6GA 3DESA 3P1WA 4E4UA 2BRYA 1ZXIC 3CNDA 3DIPA 4GAVA 1O95A 3K7TA 4EQXA 4K7ZA 4MKSA 3V3WA 3GMCA 3DGHA 5JCMA 3S47A 1ZOYA 4B67A 4EMJA 3T2ZA 1GALA 3D47A 2AKMA 3MWCA 3AB1A 2ZZCA 1GTEA 1S2QA 5FJTA 2ARDA 3TWAA 4K1WA 3KA7A 1XANA 3AEAA 1TE6A 4OVIA 3SFDA 2BRAA 1JCTA 2WQYA 2XFOA 3AEBA 3V5FA 2WEUA 2XH0A 3TW9A 1N5WC 3S5SA 4IP4A 5BOFA 4J57A 1NHPA 2GGGA 1S7MA 1TKKA 3RRAA 4YSHA 3E1TA 2EQ6A 4G73A 1SJCA 1MDRA 2X3NA 2V6OA 4RSLA 2PTZA 3P4SA 2X8GA 1CC6A 4J56A 2WDVA 1IUVA 2OPJA 2AR8A 5G5GB 4B64A 3UGVA 2WP6A 3G5SA 1PDZA 2NQLA 3V3NA 3H8IA 1CJ3A 2X8CA 3NN0X 3NHOX 1MOKA 1B37A 3U4FA 1GRHA 1EBHA 2GR1A 2GGIA 3GWDA 2GQWA 4Z25A 2XFNA 3M0OA 4IZGA 1NHRA 2JB1A 1PBEA 4GMEA 4YKFA 4CY8A 3QN3A 2R9ZA 5ENLA 4P9SA 3DK8A 1YEYA 2V3BA 1YQZA 3NK2X 2QVHA 4M52A 2ACZA 4OPDA 2FJBA 1JPMA 4H4UA 3UTEA 4NTDA 3KKJA 2BABA 2YQUA 1P48A 1B5QA 4KT2A 2PODA 3R07C 4H7UA 2POZA 4YT0A 4D04A 3CT2A 2QJMA 3AMZA 1E1MA 2OQYA 2YLZA 4C74A 3CNTA 4U8PA 3DERA 4DYEA 1PJ6A 4JNAA 3AE7A 1FO4A 1KKRA 3I6EA 4TM0A 1ECQA 4H4XA 5HYMA 4Z24A 2C64A 2QQ6A 2OKTA 3UOYA 1FIQB 2JB3A 1N63C 3NO1A 1SJDA 3NS1B 4A7AA 2FJDA 1VDCA 2JKCA 1CJCA 1N4WA 3K7MX 2OLNA 3SM8A 1GT8A 2DKHA 3BOXA 3H70A 3VRBA 1VRQB 4GGBA 1NEKA 2AL2A 2HQMA 3AXBA 2BS2A 4NEVA 2GQFA 4U8MA 3CB3A 3RNMA 2C75A 3EAOA 4GFIA 4H4WA 1GTHA 1X2GA 4Z1YA 4HNLA 2VVMA 2OAMA 1VDVA 4YWSA 3UCLA 3THUA 4JY2A 3UJSA 1YY5A 1NDAA 3NYFA 4DXKA 3R10A 4U8JA 3IWAA 1ZMDA 3CPHG 3UOXA 3DDMA 4G8TA 2GGJA 4GR1A 4Z44A 2YLTA 1ELIA 2XCGA 4C3XA 1RP0A 4FK1A 3ZVHA 3IJQA 2VQ7A 1EL8A 1PN0A 3MUCA 1CBOA 2E4GA 1CJ4A 2CHRA 3F8RA 4E0VA 1CJ2A 3PG6A 3ENLA 3SBFA 2OG9A 1TZZA 4ZCDA 2VVLA 3NVZB 1PXCA 1VG0A 4HNCA 1PBBA 3AE8A 3N4EA 3GY1A 3QPEA 2AL2B 1UKVG 2YVFA 2CDUA 1DOBA 2B9WA 3TCSA 1TDOA 3PK7A 1TDNA 3IC9A 3DFHA 1RM6B 1CL0A 2MNRA 3CIRA 3ES7A 4H4VA 2E1MA 1DTNA 4A79A 2OZTA 2W54A 3GC2A 2FJEA 3B9JB 2I5QA 4B63A 4O5UA 1TDFA 4A35A 4ZOHB 5LV9A 2DKIA 3V3OA 4DX3A 4XWZA 2R45A 3OZ2A 4A9WA 2R46A 3QSMA 3AEFA 2QA2A 3R9UA 1V97A 3AECA 2HZGA 1D4EA 4HN8A 3H7VA 1DJNA 2F5ZA 4U8LA 5FJPA 4H4QA 4TVYA 1IUWA 3UKPA 1KSUA 2XH4A 2YWLA 3S61A 5FS8A 3SX6A 5CKUA 2TPRA 4H4ZA 3ATQA 3CYJA 2PGWA 2BXRA 4HB9A 4M6UA 3RGTA 3OP2A 1FHVA 3ISHA 4H4SA 3RP8A 4H2QA 1NPXA 4A6NA 2FJAA 2P88A 2V5ZA 2OALA 4H4TA 1FOHA 2BK3A 3TJIA 5C3JA 1XPQA 3LZXA 4EMWA 2AKZA 3GYIA 2GRTA 2Z5YA 1WUEA 3VR8A 4IA6A 3AE1A 3II4A 1NELA 1PS9A 3P4RA 3I3LA 2PMQA 3H8LA 1KFYA 2C4CA 4BURA 5U25A 4EQWA 2XFQA 3CMMA 3KPFA 2R4JA 4IA5A 1K0IA 3FV9A 3R0UA 4N9XA 4DN1A 1OEPA 4GRTA 2EQ8A 4HCDA 6ENLA 2B7RA 3T2YA 4RG4A 3PWGA 3SY4A 3B97A 3T8QA 4G7FA 2GSHA 3JZUA 5KNLA 2OZ8A 2UZZA 2WBAA 5L46A 2R0CA 4KWSA 4BV6A 1ZX9A 3AE9A 1JDFA 4YKGA 4U2SA 3HW2A 2X50A 3NG7X 1MDLA 3F8PA 3LXDA 4GYPC 3OZYA 4HYRA 4HCHA 4A3RA 4E5TA 1GNDA 1IYXA 1ONEA 2RGHA 2AQJA 2AAQA 3STPA 1P2EA 4AT2A 2E5AA 4MGGA 5CQFA 1CF3A 3MQTA 1FHUA 1BF3A 1M6IA 4WCTA 1W6TA 1NHQA 1ZK7A 5HXIA 1Z6LA 4Z2UA 1EC8A 1Q1RA 3DGZA 2YR5A 1FL2A 2B76A 2O9ZA 3C4NA 1P2HA 3AEDA 4BK2A 1VQZA 3CTYA 1SB3B 1GETA 2YG6A 1BKHA 4GDEA 1Y0PA 3Q9TA 4XWRA 4NNJA 4WX1A 1SJBA 3CNSA 4U8NA 3K1GA 3L5OA 3S5WA 2R0PA 1NU5A 1DOCA 5C2TA 4K22A 2XVFA 3SN4A 4C3YA 4BK3A 2PS2A 1RYIA 1XPYA 3BNMA 1L9CA 3P4PA 4O5QA 1PJ5A 3ABVA 3C4AA 1KF6A 1JRYA 2PP3A 5GSNA 1PBDA 3QJ4A 3JVAA 3GDPA 1E1KA 3CGCA 3UCDA 5JCLA 1LPFA 2QDDA 2OO6A 3CXOA 4LA1A 2XVIA 1PJ7A 4UP3A 4CNKA 1BWCA 4KX6A 4ECHA 4Y4MA 1COYA 2P8BA 1IUXA 1EC9A 2Q0KA 1KD0A 3RP7A 4HPNA 5GRTA 3I6DA 1L8PA 1GRTA 4G74A 2XFPA 3GDNA 3SR6B 2PP0A 1D4CA 1YQ3A 3DA1A 5KWFA 4PABA 4DSGA 3ZLGA 5EB5A 3T4WA 1F6MA 1O94A 1DODA 3DMEA 1H82A 1DOEA 3AD8B 3UXKA 2FBWA 3PS9A 4UDQA 3NTDA 3SFEA 3ATRA 4E6MA 3EKGA 2YR6A 2BC0A 3SQSA 1KNPA 4DGKA 5HHFA 1GEUA 3NNEA 3HYVA 1EBGA 2BS3A 3ADAB 2XLSA 4A5LA 3P4QA 2WS3A 2XFUA 4U8IA 1FEAA 2H89A 3NVYB 5HY5A 4KPLA 3VRAA 3UCCA 1VG9A 3MSYA 2QJNA 4AOSA 2BS4A 4UDRA 1PBCA 1AOGA 3CGBA 4J36A 4PAAA 5KOWA 3NFUA 5IQ1A 3SQPA 2YLXA 4J33A 1IUSA 4YWOA 1PDHA 2ZZ0A 3UTGA 2PGEA 4IL2A 5JCIA 4GIRA 1F8WA 3ICSA 3RCYA 5KMQA 3CN8A 5FJOA 3GSIA 1IUUA 2APGA 4FK1C 1GRGA 2YLRA 2GGHA 1T3QC 1GRBA 3VCNA 3Q6JA 2WDQA 2RGOA 4EM3A 1LV0A 3NRZB 1MXTA 3A7RA 4Z43A 3FXGA 4I58A 1E1NA 3OPSA 4TVWA 3EF6A 1XDIA 2GDQA 1E9IA 3TOYA 1CHUA 2IVDA 2CVJA 3GD3A 4NEWA 1KDGA 1QLBA 1ZP0A 3V76A 5U63A 1JRZA 3TJ4A 1DNCA 1EL9A 2GV8A 3NH3X 3RHAA 2XYOA 2C66A 4BJYA 2IVEA 3NVVB 3NIXA 4A6NB 3C96A 1D7LA 5FMHA 4FP1A 1DXLA 1H7XA 5KVIA 2VRLA 2ZC8A 3UTFA 2BK5A 3BSMA 3COXA 4H83A 1GESA 5DBJA 3SN0A 1JNZA 3T6CA 1REOA 2GGEA 3OW1A 3UKFA 4OCGA 5JCKA 3P93A 3O0HA 2V60A 4Z2TA 3QTPA 2B9YA 3NKSA 4TLXA 1YQ4A 4K8DA 1NG3A 3QVPA 4IT1A 1GV4A 2FYMA 3GRSA 3DJEA 2YG4A 3M12A 1LQTA 1SEZA 3AE3A 3DG7A 2V3AA 2QCUA 3SZWA 1F8SA 1Q1WA 5EOWA 3PO7A 1L9DA 1KNRA 2VZ2A 3D1CA 4ICYA 3REDA 4I59A 3DG6A 3EUB3 2WP9A 3DGBA 4JNQA 3NN6X 5FS9A 3LZWA 2ZBWA 4OPTA 3KD9A 3VR9A 3AE4A 2OLOA 2C3CA 5U1OA 4AOXA 2EQ7A 3KU9A 4ROPA 5KRQA 1QJDA 2JK6A 4IV9A 3IHMA 1RSGA 4GISA 1E6EA 1WYGA 1W4XA 2C70A 3NGCX 5BRTA 2PCEA 4DSHA 2R0GA 2NPXA 1OJ9A 2YM2A 3P0WA 2WHDA 2VRMA 1H81A 3ZVIA 3JW7A 2XSXA 2A87A 3QLDA 4J31A 2PP1A
chains in the Genus database with same CATH topology
2XFNA 1ZK7A 3M0OA 3EANA 1LQUA 3KLJA 5BVAA 5HXIA 2JB1A 1NHRA 3RP6A 3NK0X 1PBEA 4B66A 2GR2A 1Z6LA 2TMDA 4D03A 4Z2UA 3KVEA 4YKFA 3BNUA 2YLWA 3F8DA 4APNA 4CY8A 1Q1RA 2R9ZA 4P9SA 3DGZA 2YR5A 3DK8A 2V3BA 5FS6A 1YQZA 1FL2A 3NK2X 2GR3A 2B76A 2O9ZA 2V61A 3C4NA 1P2HA 4M52A 3AEDA 2J3NA 2ACZA 4BK2A 5BUKA 3CTYA 3EPTA 4YSZA 4GF7A 4Z26A 4UDPA 3QFAA 1GETA 2YG6A 2EQ9A 3K30A 4OPDA 2GEWA 4Z2RA 2BACA 4GDEA 1B4VA 1Y0PA 2FJBA 4OPUA 2BA9A 3Q9TA 4XWRA 3G5QA 2WOWA 4NNJA 4JN9A 4WX1A 1S3EA 3IHGA 4H4UA 3UTEA 3CNSA 4NTDA 3KKJA 2BABA 3NTAA 4U8NA 1GREA 2YQUA 3PVCA 3VQRA 3L5OA 1B5QA 3S5WA 2WPFA 2Q6UA 3NRNA 3NK1X 2XLPA 1GXFA 2R0PA 2BC1A 3L1RA 1S3BA 1DOCA 5C2TA 2Y6QA 2BK4A 2C67A 3BI2A 4H7UA 4K22A 4YT0A 1CC2A 4NTCA 1NHSA 3T31A 3BHKA 5ER0A 1H84A 4D04A 2XVFA 3OC4A 3LB8A 2WPEA 2BYBA 1ZY8A 3SZCA 2R4EA 3CGDA 3BI5A 4GDPA 1E1MA 1JNRA 4C3YA 4BK3A 2YLZA 4C74A 2RABA 1B8SA 1RYIA 5EB4A 3CNTA 4FX9A 3AYLA 4U8PA 2C65A 5J7XA 4ADWA 1GOSA 3HYXA 4OPCA 4RG3A 3BNMA 2CULA 4GAPA 1L9CA 1PJ6A 3P4PA 4MJWA 4JNAA 4O5QA 5JRBA 1PJ5A 3AE7A 3ABVA 2YR4A 3C4AA 2WU2A 5KOXA 4TM0A 1KF6A 4H4XA 1JRYA 5HYMA 4Z24A 3D9XA 5GSNA 1E39A 1PBDA 3QJ4A 2C64A 2C72A 2C76A 3GWFA 1H86A 1LTXR 4YSYA 3GDPA 1E1KA 3CGCA 3UOYA 2JB3A 2QA1A 4ZN0A 3UKLA 1EL5A 5JCLA 1NG4A 4AT0A 1LPFA 1TYPA 2GMHA 4TM3A 4A7AA 2FJDA 4LA1A 3DJJA 2XVIA 1PJ7A 1VDCA 2JKCA 1CJCA 1N4WA 1FECA 1KN0A 3K7MX 2OLNA 3SM8A 4UP3A 4CNKA 1GT8A 2YG5A 1BWCA 2DKHA 4KX6A 1LJ1A 2C7GA 4H2NA 4ECHA 4Y4MA 3VRBA 1VRQB 1COYA 1NEKA 1IUXA 1JEHA 3AE6A 2Q0KA 3RP7A 4EQSA 4EM4A 4Y4NA 2YAUA 3URHA 1HYUA 3AD7B 2HQMA 5GRTA 3AXBA 1JOAA 2BS2A 3FBSA 4NEVA 3I6DA 2WP5A 1L0VA 2W0HA 1GRTA 4G74A 4YTMA 2GQFA 2XFPA 4U8MA 1K0LA 2RGJA 3GDNA 1CC4A 3RNMA 2VQBA 1H83A 2C75A 3EAOA 1D4CA 1F8RA 2GAGB 3AEEA 3DJGX 3AWIA 1YQ3A 3DA1A 4H4WA 3NYCA 5KWFA 1GTHA 3HZLA 4PABA 4X4JA 4DSGA 5KMPA 2VVMA 2WOVA 5EB5A 2OAMA 2PYXA 1M64A 4HA6A 1F6MA 1O94A 2VVLG 1DODA 4C77A 1EBDA 3UCLA 3JSKA 2B9XA 4J34A 3T0KA 3DMEA 1H82A 4BJZA 4JY2A 4USRA 1DOEA 3AD8B 4K5SA 1YY5A 1NDAA 3NYFA 2XLRA 2YLSA 2XLUA 2FBWA 3LOVA 1PXAA 3IWAA 4U8JA 1ZMDA 3UP4A 1BGNA 3CPHG 3UOXA 3PS9A 4ZCCA 4UDQA 4EMIA 1Q9IA 3NTDA 2OA1A 2Q7VA 4GR1A 4Z44A 3SFEA 3ATRA 2YVGA 5KMSA 4J2WA 2YLTA 4U2TA 1ELIA 2YR6A 2XCGA 4K5RA 3HYWA 4C3XA 3GMBA 4NTEA 1Y56B 2BC0A 1RP0A 4FK1A 3CNPA 1KNPA 2VQ7A 1EL8A 1PN0A 1ZOVA 3QVRA 3SGLA 3ALMA 3FIMB 1CBOA 4DGKA 5KVHA 3ZDNA 1DJQA 5HHFA 3WE0A 2IIDA 5KMRA 1GEUA 2X8HA 1H7WA 2E4GA 3HYVA 3NNEA 4C5OA 4FDCB 1CJ4A 2BS3A 3BHFA 3QSEA 5JCNA 3ADAB 1Y56A 3F8RA 4E0VA 2XLSA 1CJ2A 1TYTA 2YVJA 4A5LA 1V59A 3PG6A 3ICTA 3P4QA 1OJCA 2WS3A 5EBKA 2XFUA 1FEAA 4U8IA 1EL7A 4REKA 4ZCDA 2C73A 2H89A 1O5WA 2VVLA 4IVMB 4B1BA 2GF3A 1MO9A 3AYIA 5J60A 2WETA 3K7QX 3NYEA 1PXCA 5HY5A 2WOIA 3GD4A 5KXJA 2WPCA 1VG0A 1PBBA 4G9KA 3UKKA 3AE8A 3VRAA 2YG3A 3G5RA 1VG9A 4U8KA 2E5VA 4LIIA 5FS7A 4AOSA 2BS4A 3VRDB 4UDRA 1PBCA 1AOGA 3LADA 1ZDLA 1TDKA 3CGBA 1UKVG 4J36A 4PAAA 2I0ZA 2YVFA 2CDUA 5KOWA 1DOBA 2B9WA 3SYIA 5IQ1A 3UKHA 1TDOA 3SQPA 1TDNA 4JDRA 1PXBA 3B6DA 1NENA 3IC9A 4NZHA 2NVKX 3M13A 2YLXA 1H6VA 4J33A 4B65A 1IUSA 2XVJA 1CL0A 3ALLA 3CIRA 3CGEA 4H4VA 1OJTA 4YWOA 1PDHA 2E1MA 4TM4A 3UKQA 2QAEA 2ZZ0A 3UTGA 1GPEA 3NT6A 3DK4A 5JCIA 1F8WA 2GMJA 4TLZA 3ICSA 4A79A 3ALJA 3CNJA 4AP1A 5KMQA 1GSNA 1JU2A 4YXDA 3DK9A 3CN8A 4U8OA 4H4YA 2FJEA 2X99A 3GSIA 3GRTA 2XDOA 4CNJA 1IUUA 1XHCA 1E1LA 5M10A 1X31B 2PHHA 2APGA 4FK1C 1GRGA 2YLRA 4CCRA 4B68A 1GRBA 3SXIA 3AYJA 4KPRA 4O5UA 4B63A 3UOZA 1TDFA 1D4DA 2GVCA 3Q6JA 4IVOB 2WDQA 2RGOA 4CRTA 4EM3A 2B7SA 1LV0A 3IF9A 1GRFA 1FCDA 4A99A 5LV9A 1MXTA 1OJDA 2DKIA 2GB0A 2XVEA 3CPJG 4I58A 4Z43A 3V3OA 2YM1A 1E1NA 3DH9A 2BCGG 2YG7A 4OPLA 3EF6A 4XWZA 2R45A 3H8LA 3LJPA 1XDIA 2ZZBA 3T2KA 3OZ2A 1LVLA 3ZYXA 4A9WA 2R46A 3QSMA 4II3A 3AEFA 1GERA 4YSXA 2Y6RA 1CHUA 2IVDA 2CVJA 3GD3A 2QA2A 3AD9B 3R9UA 4NEWA 3AECA 4II2A 4USQA 1KDGA 1D4EA 1QLBA 3P9UA 1DJNA 2F5ZA 1ZP0A 4U8LA 3UTHA 3V76A 4LU6A 4H4QA 5U63A 4H2RA 1D5TA 1JRZA 1IUWA 2A89A 4A65A 3UKPA 1KSUA 1DNCA 2YWLA 1EL9A 1K0JA 4H2PA 4Z25A 2Q0LA 2GV8A 4H4RA 3NH3X 1OJAA 3S61A 5IQ4A 4H4PA 4EQRA 3H4KA 3QSSA 3RHAA 5FS8A 5IPYA 3KPKA 3SX6A 2JBVA 2XYOA 2TPRA 2C66A 2IVEA 2WU5A 4H4ZA 3ATQA 4DNAA 3DJDA 4GUVA 4BJYA 4CCQA 2BXRA 4EIPA 4HB9A 3NIXA 4BK1A 4A6NB 3C96A 4YTPA 1D7LA 1YKJA 3UOVA 3BI4A 5FMHA 1DXLA 3ICRA 1H7XA 5KVIA 3ISHA 2VRLA 3FMWA 4H50A 4H4SA 1BKWA 1F3PA 2JAEA 3UKAA 2WESA 4GCMA 4B69A 4X9NA 4EIQA 3RP8A 1BZLA 4H2QA 1NPXA 3SZ0A 3UTFA 2FJAA 2BK5A 4X9MA 4A6NA 4AP3A 2V5ZA 2OALA 4JY3A 3COXA 4H4TA 1FOHA 2BK3A 4G6GA 3L8KA 2XVHA 1GESA 5C3JA 5DBJA 4YTNA 1JNZA 1XPQA 3FPZA 3LZXA 3P1WA 4EMWA 1N4UA 4K2XA 3GYIA 4IV9A 2GRTA 1REOA 2Z5YA 3FG2P 2BRYA 3VR8A 3UKFA 4OCGA 5JCKA 3CNDA 1L9EA 3O0HA 3CPIG 2V60A 4Z2TA 2B9YA 2H88A 4GAVA 1O95A 3K7TA 4EQXA 3NKSA 4TLXA 1YQ4A 4IA6A 3AE1A 4K8DA 3II4A 4K7ZA 1K4QA 2JB2A 1PS9A 1NG3A 3P4RA 3GMCA 3QVPA 1S2YA 3I3LA 1GV4A 5TR3A 3DGHA 1FEBA 3GRSA 5JCMA 1KFYA 4BURA 1ZOYA 5U25A 2C4CA 1PHHA 2GAHB 4B67A 4EMJA 3DJEA 3T2ZA 4EQWA 2BCPA 2XFQA 2YG4A 3M12A 1GALA 1ZMCA 2R4JA 1ONFA 3CMMA 3AB1A 1LQTA 1K0IA 1SEZA 2XLTA 3KPFA 4IA5A 2ZZCA 4N9XA 3AE3A 1GRAA 1GTEA 4OPIA 1PBFA 1IJHA 4G6HA 1S2QA 5M0ZA 2V3AA 4GRTA 2ARDA 2QCUA 3SZWA 2EQ8A 1F8SA 2B7RA 3QFBA 3T2YA 1E7PA 1Q1WA 3KA7A 1XANA 4RG4A 3AEAA 1H2IA 5EOWA 4OVIA 3SFDA 3PO7A 2BRAA 2WQYA 2Z5XA 2XFOA 2A8XA 3AEBA 1L9DA 2WEUA 3ITJA 4Y4LA 3SY4A 1KNRA 1JRXA 2VZ2A 3D1CA 4ICYA 4J57A 5BULA 1NHPA 4NWZA 2GH5A 3REDA 4I59A 1KSSA 1S7MA 5KNLA 4YSHA 2BXSA 2UZZA 2WBAA 3E1TA 5L46A 2R0CA 2WP9A 4JNQA 3NN6X 5FS9A 3NLCA 4CBQA 2EQ6A 3LZWA 4BV6A 1ZX9A 1ZKQA 3AE9A 2ZBWA 3GYXA 4G73A 1VQWA 3KD9A 4OPTA 4U2LA 4U2SA 3AE4A 3VR9A 2OLOA 2X3NA 4YKGA 2C3CA 4XXGA 5U1OA 1N4VA 2X50A 3B3RA 4AOXA 2EQ7A 2V6OA 3NG7X 4RSLA 2GR0A 3KU9A 1QO8A 5KRQA 3P4SA 2X8GA 1QJDA 2WDRA 2JK6A 3AE2A 1CC6A 3F8PA 3IHMA 3LXDA 1N1PA 4J56A 1RSGA 1IUVA 2WDVA 3T14A 4TM1A 4OPGA 1E6EA 5CKUA 2C3DA 1W4XA 3D8XA 1GNDA 2AR8A 4B64A 2C70A 3AE5A 3NGCX 3UP5A 2WP6A 4DSHA 5BRTA 3G5SA 1TDEA 2R0GA 3SZFA 1BGJA 1TRBA 3V3NA 1D7YA 2RGHA 2AQJA 2AAQA 3H8IA 2CFYA 3T37A 1CJ3A 2NPXA 2X8CA 3NN0X 1OJ9A 3NHOX 1P2EA 2YM2A 1MOKA 4AT2A 2WHDA 1B37A 2VRMA 1NAAA 1GRHA 1CF3A 3GYJA 5CQFA 1BF3A 1M6IA 2VOUA 1H81A 4WCTA 4JQ9A 2GR1A 3AEGA 4CY6A 2A87A 3GWDA 4J31A 1IUTA 2GQWA 1NHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFN A;  1ZK7 A;  3M0O A;  3EAN A;  1LQU A;  3KLJ A;  5BVA A;  5HXI A;  2JB1 A;  1NHR A;  3RP6 A;  3NK0 X;  1PBE A;  4B66 A;  2GR2 A;  1Z6L A;  2TMD A;  4D03 A;  4Z2U A;  4YKF A;  3BNU A;  2YLW A;  3F8D A;  4APN A;  4CY8 A;  1Q1R A;  2R9Z A;  4P9S A;  3DGZ A;  2YR5 A;  3DK8 A;  2V3B A;  5FS6 A;  1YQZ A;  1FL2 A;  3NK2 X;  2GR3 A;  2B76 A;  2O9Z A;  2V61 A;  3C4N A;  1P2H A;  4M52 A;  3AED A;  2J3N A;  2ACZ A;  4BK2 A;  5BUK A;  3CTY A;  3EPT A;  4YSZ A;  4GF7 A;  4Z26 A;  4UDP A;  3QFA A;  1GET A;  2YG6 A;  2EQ9 A;  3K30 A;  4OPD A;  2GEW A;  4Z2R A;  2BAC A;  4GDE A;  1B4V A;  1Y0P A;  2FJB A;  4OPU A;  2BA9 A;  3Q9T A;  4XWR A;  3G5Q A;  2WOW A;  4JN9 A;  4WX1 A;  1S3E A;  3IHG A;  4H4U A;  3UTE A;  3CNS A;  4NTD A;  3KKJ A;  2BAB A;  3NTA A;  4U8N A;  1GRE A;  2YQU A;  3PVC A;  3VQR A;  1B5Q A;  3S5W A;  2WPF A;  2Q6U A;  3NRN A;  3NK1 X;  2XLP A;  1GXF A;  2R0P A;  2BC1 A;  3L1R A;  1S3B A;  1DOC A;  5C2T A;  2Y6Q A;  2BK4 A;  2C67 A;  3BI2 A;  4H7U A;  4K22 A;  4YT0 A;  1CC2 A;  4NTC A;  1NHS A;  3BHK A;  5ER0 A;  1H84 A;  4D04 A;  2XVF A;  3OC4 A;  3LB8 A;  2WPE A;  2BYB A;  1ZY8 A;  2R4E A;  3CGD A;  3BI5 A;  4GDP A;  1E1M A;  1JNR A;  4C3Y A;  4BK3 A;  2YLZ A;  4C74 A;  2RAB A;  1B8S A;  1RYI A;  5EB4 A;  3CNT A;  4FX9 A;  3AYL A;  4U8P A;  2C65 A;  5J7X A;  4ADW A;  1GOS A;  4OPC A;  4RG3 A;  3BNM A;  2CUL A;  1L9C A;  1PJ6 A;  3P4P A;  4MJW A;  4JNA A;  4O5Q A;  1PJ5 A;  3AE7 A;  3ABV A;  2YR4 A;  3C4A A;  2WU2 A;  5KOX A;  4TM0 A;  1KF6 A;  4H4X A;  1JRY A;  5HYM A;  4Z24 A;  5GSN A;  1E39 A;  1PBD A;  3QJ4 A;  2C64 A;  2C72 A;  2C76 A;  3GWF A;  1H86 A;  1LTX R;  4YSY A;  3GDP A;  1E1K A;  3CGC A;  3UOY A;  2JB3 A;  2QA1 A;  4ZN0 A;  3UKL A;  1EL5 A;  5JCL A;  1NG4 A;  4AT0 A;  1LPF A;  1TYP A;  2GMH A;  4TM3 A;  4A7A A;  2FJD A;  4LA1 A;  3DJJ A;  2XVI A;  1PJ7 A;  1VDC A;  2JKC A;  1CJC A;  1N4W A;  1FEC A;  3K7M X;  2OLN A;  3SM8 A;  4UP3 A;  4CNK A;  1GT8 A;  2YG5 A;  1BWC A;  2DKH A;  4KX6 A;  1LJ1 A;  2C7G A;  4H2N A;  4ECH A;  4Y4M A;  3VRB A;  1VRQ B;  1COY A;  1NEK A;  1IUX A;  1JEH A;  3AE6 A;  2Q0K A;  3RP7 A;  4EQS A;  4EM4 A;  4Y4N A;  2YAU A;  3URH A;  1HYU A;  3AD7 B;  2HQM A;  5GRT A;  3AXB A;  1JOA A;  2BS2 A;  3FBS A;  4NEV A;  3I6D A;  2WP5 A;  1L0V A;  2W0H A;  1GRT A;  4YTM A;  2GQF A;  2XFP A;  4U8M A;  1K0L A;  2RGJ A;  3GDN A;  1CC4 A;  3RNM A;  2VQB A;  1H83 A;  2C75 A;  3EAO A;  1D4C A;  1F8R A;  2GAG B;  3AEE A;  3DJG X;  3AWI A;  1YQ3 A;  3DA1 A;  4H4W A;  3NYC A;  5KWF A;  1GTH A;  3HZL A;  4PAB A;  4X4J A;  4DSG A;  2VVM A;  2WOV A;  5EB5 A;  2OAM A;  2PYX A;  1M64 A;  4HA6 A;  1F6M A;  1O94 A;  2VVL G;  1DOD A;  4C77 A;  1EBD A;  3UCL A;  3JSK A;  2B9X A;  4J34 A;  3DME A;  1H82 A;  4BJZ A;  4JY2 A;  4USR A;  1DOE A;  3AD8 B;  4K5S A;  1YY5 A;  1NDA A;  3NYF A;  2XLR A;  2YLS A;  2XLU A;  2FBW A;  3LOV A;  1PXA A;  3IWA A;  4U8J A;  1ZMD A;  3UP4 A;  1BGN A;  3CPH G;  3UOX A;  3PS9 A;  4ZCC A;  4UDQ A;  4EMI A;  1Q9I A;  3NTD A;  2OA1 A;  2Q7V A;  4GR1 A;  4Z44 A;  3SFE A;  3ATR A;  2YVG A;  4J2W A;  2YLT A;  4U2T A;  1ELI A;  2YR6 A;  2XCG A;  4K5R A;  4C3X A;  3GMB A;  4NTE A;  1Y56 B;  2BC0 A;  1RP0 A;  4FK1 A;  3CNP A;  1KNP A;  2VQ7 A;  1EL8 A;  1PN0 A;  1ZOV A;  3QVR A;  3SGL A;  3ALM A;  3FIM B;  1CBO A;  4DGK A;  5KVH A;  3ZDN A;  1DJQ A;  5HHF A;  3WE0 A;  2IID A;  1GEU A;  2X8H A;  1H7W A;  2E4G A;  3NNE A;  4C5O A;  4FDC B;  1CJ4 A;  2BS3 A;  3BHF A;  3QSE A;  5JCN A;  3ADA B;  1Y56 A;  3F8R A;  4E0V A;  2XLS A;  1CJ2 A;  1TYT A;  2YVJ A;  4A5L A;  1V59 A;  3P4Q A;  3ICT A;  1OJC A;  2WS3 A;  5EBK A;  2XFU A;  1FEA A;  4U8I A;  1EL7 A;  4REK A;  4ZCD A;  2C73 A;  2H89 A;  1O5W A;  2VVL A;  4IVM B;  4B1B A;  2GF3 A;  1MO9 A;  3AYI A;  5J60 A;  2WET A;  3K7Q X;  3NYE A;  1PXC A;  5HY5 A;  2WOI A;  3GD4 A;  5KXJ A;  2WPC A;  1VG0 A;  1PBB A;  3UKK A;  3AE8 A;  3VRA A;  2YG3 A;  3G5R A;  1VG9 A;  4U8K A;  2E5V A;  4LII A;  5FS7 A;  4AOS A;  2BS4 A;  3VRD B;  4UDR A;  1PBC A;  1AOG A;  3LAD A;  1ZDL A;  1TDK A;  3CGB A;  1UKV G;  4J36 A;  4PAA A;  2I0Z A;  2YVF A;  2CDU A;  5KOW A;  1DOB A;  2B9W A;  5IQ1 A;  3UKH A;  1TDO A;  3SQP A;  1TDN A;  4JDR A;  1PXB A;  3B6D A;  1NEN A;  3IC9 A;  4NZH A;  2NVK X;  3M13 A;  2YLX A;  1H6V A;  4J33 A;  4B65 A;  1IUS A;  2XVJ A;  1CL0 A;  3ALL A;  3CIR A;  3CGE A;  4H4V A;  1OJT A;  4YWO A;  1PDH A;  2E1M A;  4TM4 A;  3UKQ A;  2QAE A;  2ZZ0 A;  3UTG A;  1GPE A;  3NT6 A;  3DK4 A;  5JCI A;  1F8W A;  2GMJ A;  4TLZ A;  3ICS A;  4A79 A;  3ALJ A;  3CNJ A;  4AP1 A;  1GSN A;  1JU2 A;  4YXD A;  3DK9 A;  3CN8 A;  4U8O A;  4H4Y A;  2FJE A;  2X99 A;  3GSI A;  3GRT A;  2XDO A;  4CNJ A;  1IUU A;  1XHC A;  1E1L A;  5M10 A;  1X31 B;  2PHH A;  2APG A;  4FK1 C;  1GRG A;  2YLR A;  4CCR A;  4B68 A;  1GRB A;  3AYJ A;  4KPR A;  4O5U A;  4B63 A;  3UOZ A;  1TDF A;  1D4D A;  2GVC A;  3Q6J A;  4IVO B;  2WDQ A;  2RGO A;  4CRT A;  4EM3 A;  2B7S A;  1LV0 A;  3IF9 A;  1GRF A;  1FCD A;  4A99 A;  5LV9 A;  1MXT A;  1OJD A;  2DKI A;  2GB0 A;  2XVE A;  3CPJ G;  4I58 A;  4Z43 A;  3V3O A;  2YM1 A;  1E1N A;  3DH9 A;  2BCG G;  2YG7 A;  4OPL A;  3EF6 A;  4XWZ A;  2R45 A;  3LJP A;  1XDI A;  2ZZB A;  3OZ2 A;  1LVL A;  3ZYX A;  4A9W A;  2R46 A;  3QSM A;  3AEF A;  1GER A;  4YSX A;  2Y6R A;  1CHU A;  2IVD A;  2CVJ A;  3GD3 A;  2QA2 A;  3AD9 B;  3R9U A;  4NEW A;  3AEC A;  4USQ A;  1KDG A;  1D4E A;  1QLB A;  3P9U A;  1DJN A;  2F5Z A;  1ZP0 A;  4U8L A;  3UTH A;  3V76 A;  4LU6 A;  4H4Q A;  5U63 A;  4H2R A;  1D5T A;  1JRZ A;  1IUW A;  2A89 A;  4A65 A;  3UKP A;  1KSU A;  1DNC A;  2YWL A;  1EL9 A;  1K0J A;  4H2P A;  4Z25 A;  2Q0L A;  2GV8 A;  4H4R A;  3NH3 X;  1OJA A;  3S61 A;  5IQ4 A;  4H4P A;  4EQR A;  3H4K A;  3QSS A;  3RHA A;  5FS8 A;  5IPY A;  2JBV A;  2XYO A;  2TPR A;  2C66 A;  2IVE A;  2WU5 A;  4H4Z A;  3ATQ A;  4DNA A;  3DJD A;  4GUV A;  4BJY A;  4CCQ A;  2BXR A;  4EIP A;  4HB9 A;  3NIX A;  4BK1 A;  4A6N B;  3C96 A;  4YTP A;  1D7L A;  1YKJ A;  3UOV A;  3BI4 A;  5FMH A;  1DXL A;  3ICR A;  1H7X A;  5KVI A;  3ISH A;  2VRL A;  3FMW A;  4H50 A;  4H4S A;  1BKW A;  1F3P A;  2JAE A;  3UKA A;  2WES A;  4GCM A;  4B69 A;  4X9N A;  4EIQ A;  3RP8 A;  1BZL A;  4H2Q A;  1NPX A;  3UTF A;  4A6N A;  2FJA A;  2BK5 A;  4X9M A;  4AP3 A;  2V5Z A;  2OAL A;  4JY3 A;  3COX A;  4H4T A;  1FOH A;  2BK3 A;  3L8K A;  2XVH A;  1GES A;  5C3J A;  5DBJ A;  4YTN A;  1JNZ A;  1XPQ A;  3FPZ A;  3LZX A;  3P1W A;  4EMW A;  1N4U A;  4K2X A;  3GYI A;  4IV9 A;  2GRT A;  1REO A;  2Z5Y A;  3FG2 P;  3VR8 A;  3UKF A;  4OCG A;  5JCK A;  3CND A;  1L9E A;  3O0H A;  3CPI G;  2V60 A;  4Z2T A;  2B9Y A;  2H88 A;  1O95 A;  3K7T A;  4EQX A;  3NKS A;  4TLX A;  1YQ4 A;  4IA6 A;  3AE1 A;  4K8D A;  3II4 A;  4K7Z A;  1K4Q A;  2JB2 A;  1PS9 A;  1NG3 A;  3P4R A;  3GMC A;  3QVP A;  1S2Y A;  3I3L A;  1GV4 A;  5TR3 A;  3DGH A;  1FEB A;  3GRS A;  5JCM A;  1KFY A;  4BUR A;  1ZOY A;  5U25 A;  2GAH B;  1PHH A;  3H8L A;  4B67 A;  4EMJ A;  3DJE A;  4EQW A;  2BCP A;  2XFQ A;  2YG4 A;  3M12 A;  1GAL A;  1ZMC A;  2R4J A;  1ONF A;  3KPF A;  3AB1 A;  1LQT A;  1K0I A;  1SEZ A;  2XLT A;  3KVE A;  4IA5 A;  2ZZC A;  4N9X A;  3AE3 A;  1GRA A;  1GTE A;  4OPI A;  1PBF A;  1IJH A;  1S2Q A;  5M0Z A;  2V3A A;  4GRT A;  2ARD A;  2QCU A;  2EQ8 A;  1F8S A;  2B7R A;  3QFB A;  1E7P A;  1Q1W A;  3KA7 A;  1XAN A;  4RG4 A;  3AEA A;  5EOW A;  4OVI A;  3SFD A;  3PO7 A;  2WQY A;  2Z5X A;  2XFO A;  2A8X A;  3AEB A;  1L9D A;  2WEU A;  3ITJ A;  4Y4L A;  1KNR A;  1JRX A;  2VZ2 A;  3D1C A;  4ICY A;  4J57 A;  5BUL A;  1NHP A;  3RED A;  2GH5 A;  4I59 A;  1KSS A;  4YSH A;  2BXS A;  2UZZ A;  2WBA A;  3E1T A;  5L46 A;  2R0C A;  2WP9 A;  4JNQ A;  3NN6 X;  5FS9 A;  3NLC A;  4CBQ A;  2EQ6 A;  3LZW A;  4BV6 A;  1ZX9 A;  1ZKQ A;  3AE9 A;  2ZBW A;  1VQW A;  3KD9 A;  4OPT A;  4U2L A;  4U2S A;  3AE4 A;  3VR9 A;  2OLO A;  2X3N A;  4YKG A;  2C3C A;  4XXG A;  5U1O A;  1N4V A;  2X50 A;  3B3R A;  4AOX A;  2EQ7 A;  2V6O A;  3NG7 X;  4RSL A;  2GR0 A;  3KU9 A;  1QO8 A;  5KRQ A;  3P4S A;  2X8G A;  1QJD A;  2WDR A;  2JK6 A;  3AE2 A;  1CC6 A;  3F8P A;  3IHM A;  3LXD A;  1N1P A;  4J56 A;  1RSG A;  1IUV A;  2WDV A;  4TM1 A;  4OPG A;  1E6E A;  5CKU A;  2C3D A;  1W4X A;  3D8X A;  1GND A;  2AR8 A;  4B64 A;  2C70 A;  3AE5 A;  3NGC X;  3UP5 A;  2WP6 A;  4DSH A;  5BRT A;  3G5S A;  1TDE A;  2R0G A;  1BGJ A;  1TRB A;  3V3N A;  1D7Y A;  2RGH A;  2AQJ A;  2AAQ A;  3H8I A;  2CFY A;  3T37 A;  1CJ3 A;  2NPX A;  2X8C A;  3NN0 X;  1OJ9 A;  3NHO X;  1P2E A;  2YM2 A;  1MOK A;  4AT2 A;  2WHD A;  1B37 A;  2VRM A;  1NAA A;  1GRH A;  1CF3 A;  3GYJ A;  5CQF A;  1BF3 A;  1M6I A;  2VOU A;  1H81 A;  4WCT A;  4JQ9 A;  2GR1 A;  3AEG A;  4CY6 A;  2A87 A;  3GWD A;  4J31 A;  1IUT A;  2GQW A;  1NHQ A; 
#chains in the Genus database with same CATH topology
 4HCL A;  3EAN A;  1LQU A;  3NK0 X;  4B66 A;  2TMD A;  3F8D A;  5IDZ A;  3ZYX A;  5FS6 A;  2V61 A;  4YSZ A;  3VCC A;  4GF7 A;  4UDP A;  2EQ9 A;  4OPU A;  4JHM A;  3QKE A;  3V4B A;  3IHG A;  3NTA A;  1GRE A;  1KKO A;  2WPF A;  3NRN A;  3ZLH A;  2XLP A;  1GXF A;  2DW6 A;  3L1R A;  1S3B A;  2ZAD A;  2BK4 A;  2C67 A;  3BI2 A;  3I4K A;  1CC2 A;  4NTC A;  1NHS A;  3BHK A;  5ER0 A;  3OC4 A;  3LB8 A;  2WPE A;  1ZY8 A;  3SZC A;  2R4E A;  3BI5 A;  2PU0 A;  1B8S A;  5EB4 A;  4FX9 A;  3AYL A;  4ADW A;  1GOS A;  4RG3 A;  2CUL A;  4GAP A;  2PA6 A;  4MJW A;  2YR4 A;  2WU2 A;  1F9C A;  2PTW A;  3CAW A;  3IJL A;  2QDE A;  1PDY A;  1E39 A;  2C76 A;  3GWF A;  1LTX R;  4YSY A;  2OZ3 A;  4ZN0 A;  4ZCW A;  3UKL A;  3VC5 A;  1TYP A;  2GMH A;  3DJJ A;  2XH7 A;  3R11 A;  2YG5 A;  1LJ1 A;  2C7G A;  3UJ2 A;  4H2H A;  1BQG A;  3AE6 A;  3URH A;  1HYU A;  2W0H A;  1N60 C;  4YTM A;  2RGJ A;  3DG3 A;  4JN7 A;  2VQB A;  1H83 A;  3DJG X;  3AWI A;  3HZL A;  5KMP A;  3VA8 A;  3VFC A;  1M64 A;  4JN8 A;  1FFV C;  4C77 A;  1EBD A;  3T0K A;  4X2P A;  4BJZ A;  4USR A;  1R0M A;  3ES8 A;  1R6W A;  4K5S A;  1JPD X;  3Q45 A;  2YLS A;  3LOV A;  3UP4 A;  1BGN A;  3R0K A;  4EMI A;  2OA1 A;  2Q7V A;  2YVG A;  3CK5 A;  4J2W A;  2P0I A;  3UXL A;  3HYW A;  3GMB A;  4NTE A;  3CNP A;  3QVR A;  3SGL A;  3ALM A;  3FIM B;  1DJQ A;  3WE0 A;  4C5O A;  2X8H A;  1H7W A;  4GYP A;  4FDC B;  3BHF A;  3QSE A;  5JCN A;  1Y56 A;  3FVD A;  4GGH A;  2YVJ A;  1V59 A;  5EBK A;  2C73 A;  4J3Z A;  1MO9 A;  3AYI A;  5J60 A;  2WET A;  2P8C A;  3GD4 A;  2WPC A;  3A7A A;  3N4F A;  4G9K A;  2QGY A;  3G5R A;  4U8K A;  3TWB A;  4LII A;  1XS2 A;  3VRD B;  1ZDL A;  1TDK A;  4IHC A;  4FI4 A;  2I0Z A;  1N5X A;  2OX4 A;  3UKH A;  4JDR A;  3B6D A;  4NZH A;  1H6V A;  4B65 A;  3IK4 A;  3ALL A;  2QAE A;  1GPE A;  3NT6 A;  3DK4 A;  4Z17 A;  2GMJ A;  4TLZ A;  3MZN A;  3ALJ A;  3CNJ A;  4AP1 A;  1GSN A;  1JU2 A;  4YXD A;  4U8O A;  4H4Y A;  2X99 A;  3GRT A;  2OLA A;  2FKP A;  2PHH A;  3H12 A;  4KPR A;  2GVC A;  1D4D A;  2AL1 A;  4CRT A;  5J04 A;  2B7S A;  2ONE A;  3IF9 A;  1GRF A;  3T9P A;  1OJD A;  2GB0 A;  2XVE A;  2YM1 A;  2BCG G;  3D46 A;  3FCP A;  1GER A;  3AD9 B;  4II2 A;  1EC7 A;  3UTH A;  1D5T A;  2P3Z A;  2A89 A;  3ZLF A;  2PPG A;  2PU1 A;  1K0J A;  4H2P A;  1ELS A;  3H8A A;  4H4R A;  5IQ4 A;  4H4P A;  3H4K A;  2PTX A;  3KPK A;  4GUV A;  2HXT A;  3HRD C;  5FJU A;  4EIP A;  4YTP A;  3UOV A;  4A6G A;  1P43 A;  3CXB A;  3ICR A;  4M0X A;  4F4R A;  3PWI A;  1F3P A;  2JAE A;  3UKA A;  2WES A;  4B69 A;  4X9N A;  4EIQ A;  1BZL A;  4JY3 A;  1MRA A;  3L8K A;  2XVH A;  2HXU A;  4YTN A;  3FPZ A;  1N4U A;  3UJR A;  4K2X A;  3FG2 P;  3UJF A;  4KEM A;  1L9E A;  3CPI G;  2H88 A;  1N61 C;  4IP5 A;  2RDX A;  1JRP A;  1K4Q A;  2JB2 A;  1S2Y A;  5TR3 A;  1FEB A;  2GAH B;  1PHH A;  2BCP A;  3KVE A;  1ZMC A;  1ONF A;  2XLT A;  1WUF A;  1GRA A;  4OPI A;  1PBF A;  1IJH A;  4E4F A;  4G6H A;  5M0Z A;  3QFB A;  1E7P A;  3TTE A;  1H2I A;  2Z5X A;  2A8X A;  3ITJ A;  4Y4L A;  3SSZ A;  1JRX A;  1SJA A;  2OFJ A;  4H19 A;  5BUL A;  4NWZ A;  2GH5 A;  1KSS A;  2BXS A;  3NLC A;  4CBQ A;  2PTY A;  1ZKQ A;  3GYX A;  4U2L A;  1VQW A;  3A7U A;  4XXG A;  1N4V A;  3B3R A;  1MUC A;  2GR0 A;  1QO8 A;  5G5H B;  2WDR A;  3AE2 A;  1N1P A;  3U9I A;  3T14 A;  3N6J A;  4TM1 A;  4OPG A;  2C3D A;  3D8X A;  3AE5 A;  3UP5 A;  2QJJ A;  3SZF A;  1TDE A;  1BGJ A;  1TRB A;  1D7Y A;  2CFY A;  3T37 A;  3I6T A;  3DFY A;  1NAA A;  3GYJ A;  3R1Z A;  2VOU A;  2XH2 A;  4JQ9 A;  3AEG A;  4CY6 A;  1IUT A;  3V5C A;  3KLJ A;  5BVA A;  3RP6 A;  2GR2 A;  4D03 A;  3BNU A;  2YLW A;  4APN A;  2GR3 A;  2J3N A;  5BUK A;  3MKC A;  3EPT A;  4Z26 A;  3NVW B;  3QFA A;  4H1Z A;  3K30 A;  2GEW A;  4Z2R A;  2BAC A;  1B4V A;  2BA9 A;  3G5Q A;  2WOW A;  4JN9 A;  1S3E A;  3KUM A;  3PVC A;  3VQR A;  1MNS A;  2Q6U A;  3NK1 X;  2BC1 A;  2Y6Q A;  5FJR A;  3SJN A;  4DHG A;  3AN1 A;  2OVL A;  3T31 A;  1H84 A;  2BYB A;  2HNE A;  2W55 A;  4GDP A;  3CGD A;  3SN1 A;  1JNR A;  1FFU C;  2RAB A;  2C65 A;  5J7X A;  4OPC A;  3HYX A;  3EEZ A;  3R25 A;  5JRB A;  5KOX A;  3D9X A;  2C72 A;  2W3R A;  1H86 A;  2QA1 A;  1EL5 A;  4AT0 A;  1NG4 A;  4K2S A;  5EU9 A;  4TM3 A;  1FEC A;  1KN0 A;  2DW7 A;  3NZG A;  4H2N A;  3IJI A;  1JEH A;  4EQS A;  4EM4 A;  4Y4N A;  2PSN A;  2W3S A;  2YAU A;  3AD7 B;  3FBS A;  1JOA A;  2MUC A;  2WP5 A;  3Q4D A;  3DEQ A;  1L0V A;  1K0L A;  3UJE A;  1CC4 A;  4IL0 A;  3GD6 A;  1F8R A;  2GAG B;  3AEE A;  3NYC A;  4X4J A;  4DWD A;  2WOV A;  2PYX A;  4HA6 A;  2VVL G;  3JSK A;  2B9X A;  4J34 A;  2XLR A;  2XLU A;  1PXA A;  3FJ4 A;  2E3T A;  4ZCC A;  4J1O A;  1Q9I A;  5KMS A;  4U2T A;  2GL5 A;  4K5R A;  3ETR B;  1Y56 B;  1JRO A;  1ZOV A;  5KVH A;  3ZDN A;  5KMR A;  2IID A;  3ZVH B;  1TYT A;  3BJS A;  3ICT A;  3RIT A;  5BOE A;  1OJC A;  1EL7 A;  4REK A;  1O5W A;  4IVM B;  4B1B A;  2GF3 A;  3K7Q X;  3NYE A;  2WOI A;  5KXJ A;  3UKK A;  2YG3 A;  2E5V A;  5FS7 A;  3TQP A;  3LAD A;  3MY9 A;  3SYI A;  3PFR A;  1PXB A;  1NEN A;  2NVK X;  3M13 A;  1X2H A;  4ENL A;  2XVJ A;  3OTR A;  1RVK A;  3CGE A;  3RO6 A;  1OJT A;  4TM4 A;  4K8G A;  3UKQ A;  2O56 A;  3DK9 A;  2XDO A;  4CNJ A;  1XHC A;  3OZM A;  1E1L A;  5M10 A;  1X31 B;  4ZA0 A;  4CCR A;  4B68 A;  3SXI A;  3AYJ A;  3VC6 A;  3GO2 A;  3UOZ A;  3FYY A;  4IVO B;  4MMW A;  4EWJ A;  3P3B A;  1FCD A;  4A99 A;  3CPJ G;  3DH9 A;  3NXL A;  2YG7 A;  4OPL A;  3LJP A;  3T2K A;  2ZZB A;  1LVL A;  4II3 A;  1STZ A;  4YSX A;  2Y6R A;  3VDG A;  1KCZ A;  1N62 C;  4USQ A;  3P9U A;  3RR1 A;  4LU6 A;  4H2R A;  4A65 A;  2Q0L A;  1OJA A;  7ENL A;  4EQR A;  3QSS A;  5IPY A;  2JBV A;  3DJD A;  2WU5 A;  4DNA A;  4CCQ A;  4BK1 A;  3AM9 A;  1YKJ A;  3BI4 A;  3N6H A;  2OQH A;  3FMW A;  4H50 A;  1BKW A;  4GCM A;  4E8G A;  3SZ0 A;  4AP3 A;  4X9M A;  2XGZ A;  3HPF A;  4G6G A;  3DES A;  3P1W A;  4E4U A;  2BRY A;  1ZXI C;  3CND A;  3DIP A;  4GAV A;  1O95 A;  3K7T A;  4EQX A;  4K7Z A;  4MKS A;  3V3W A;  3GMC A;  3DGH A;  5JCM A;  3S47 A;  1ZOY A;  4B67 A;  4EMJ A;  3T2Z A;  1GAL A;  3D47 A;  2AKM A;  3MWC A;  3AB1 A;  2ZZC A;  1GTE A;  1S2Q A;  5FJT A;  2ARD A;  3TWA A;  4K1W A;  3KA7 A;  1XAN A;  3AEA A;  1TE6 A;  4OVI A;  3SFD A;  2BRA A;  1JCT A;  2WQY A;  2XFO A;  3AEB A;  3V5F A;  2WEU A;  2XH0 A;  3TW9 A;  1N5W C;  3S5S A;  4IP4 A;  5BOF A;  4J57 A;  1NHP A;  2GGG A;  1S7M A;  1TKK A;  3RRA A;  4YSH A;  3E1T A;  2EQ6 A;  4G73 A;  1SJC A;  1MDR A;  2X3N A;  2V6O A;  4RSL A;  2PTZ A;  3P4S A;  2X8G A;  1CC6 A;  4J56 A;  2WDV A;  1IUV A;  2OPJ A;  2AR8 A;  5G5G B;  4B64 A;  3UGV A;  2WP6 A;  3G5S A;  1PDZ A;  2NQL A;  3V3N A;  3H8I A;  1CJ3 A;  2X8C A;  3NN0 X;  3NHO X;  1MOK A;  1B37 A;  3U4F A;  1GRH A;  1EBH A;  2GR1 A;  2GGI A;  3GWD A;  2GQW A;  4Z25 A;  2XFN A;  3M0O A;  4IZG A;  1NHR A;  2JB1 A;  1PBE A;  4GME A;  4YKF A;  4CY8 A;  3QN3 A;  2R9Z A;  5ENL A;  4P9S A;  3DK8 A;  1YEY A;  2V3B A;  1YQZ A;  3NK2 X;  2QVH A;  4M52 A;  2ACZ A;  4OPD A;  2FJB A;  1JPM A;  4H4U A;  3UTE A;  4NTD A;  3KKJ A;  2BAB A;  2YQU A;  1P48 A;  1B5Q A;  4KT2 A;  2POD A;  3R07 C;  4H7U A;  2POZ A;  4YT0 A;  4D04 A;  3CT2 A;  2QJM A;  3AMZ A;  1E1M A;  2OQY A;  2YLZ A;  4C74 A;  3CNT A;  4U8P A;  3DER A;  4DYE A;  1PJ6 A;  4JNA A;  3AE7 A;  1FO4 A;  1KKR A;  3I6E A;  4TM0 A;  1ECQ A;  4H4X A;  5HYM A;  4Z24 A;  2C64 A;  2QQ6 A;  2OKT A;  3UOY A;  1FIQ B;  2JB3 A;  1N63 C;  3NO1 A;  1SJD A;  3NS1 B;  4A7A A;  2FJD A;  1VDC A;  2JKC A;  1CJC A;  1N4W A;  3K7M X;  2OLN A;  3SM8 A;  1GT8 A;  2DKH A;  3BOX A;  3H70 A;  3VRB A;  1VRQ B;  4GGB A;  1NEK A;  2AL2 A;  2HQM A;  3AXB A;  2BS2 A;  4NEV A;  2GQF A;  4U8M A;  3CB3 A;  3RNM A;  2C75 A;  3EAO A;  4GFI A;  4H4W A;  1GTH A;  1X2G A;  4Z1Y A;  4HNL A;  2VVM A;  2OAM A;  1VDV A;  4YWS A;  3UCL A;  3THU A;  4JY2 A;  3UJS A;  1YY5 A;  1NDA A;  3NYF A;  4DXK A;  3R10 A;  4U8J A;  3IWA A;  1ZMD A;  3CPH G;  3UOX A;  3DDM A;  4G8T A;  2GGJ A;  4GR1 A;  4Z44 A;  2YLT A;  1ELI A;  2XCG A;  4C3X A;  1RP0 A;  4FK1 A;  3ZVH A;  3IJQ A;  2VQ7 A;  1EL8 A;  1PN0 A;  3MUC A;  1CBO A;  2E4G A;  1CJ4 A;  2CHR A;  3F8R A;  4E0V A;  1CJ2 A;  3PG6 A;  3ENL A;  3SBF A;  2OG9 A;  1TZZ A;  4ZCD A;  2VVL A;  3NVZ B;  1PXC A;  1VG0 A;  4HNC A;  1PBB A;  3AE8 A;  3N4E A;  3GY1 A;  3QPE A;  2AL2 B;  1UKV G;  2YVF A;  2CDU A;  1DOB A;  2B9W A;  3TCS A;  1TDO A;  3PK7 A;  1TDN A;  3IC9 A;  3DFH A;  1RM6 B;  1CL0 A;  2MNR A;  3CIR A;  3ES7 A;  4H4V A;  2E1M A;  1DTN A;  4A79 A;  2OZT A;  2W54 A;  3GC2 A;  2FJE A;  3B9J B;  2I5Q A;  4B63 A;  4O5U A;  1TDF A;  4A35 A;  4ZOH B;  5LV9 A;  2DKI A;  3V3O A;  4DX3 A;  4XWZ A;  2R45 A;  3OZ2 A;  4A9W A;  2R46 A;  3QSM A;  3AEF A;  2QA2 A;  3R9U A;  1V97 A;  3AEC A;  2HZG A;  1D4E A;  4HN8 A;  3H7V A;  1DJN A;  2F5Z A;  4U8L A;  5FJP A;  4H4Q A;  4TVY A;  1IUW A;  3UKP A;  1KSU A;  2XH4 A;  2YWL A;  3S61 A;  5FS8 A;  3SX6 A;  5CKU A;  2TPR A;  4H4Z A;  3ATQ A;  3CYJ A;  2PGW A;  2BXR A;  4HB9 A;  4M6U A;  3RGT A;  3OP2 A;  1FHV A;  3ISH A;  4H4S A;  3RP8 A;  4H2Q A;  1NPX A;  4A6N A;  2FJA A;  2P88 A;  2V5Z A;  2OAL A;  4H4T A;  1FOH A;  2BK3 A;  3TJI A;  5C3J A;  1XPQ A;  3LZX A;  4EMW A;  2AKZ A;  3GYI A;  2GRT A;  2Z5Y A;  1WUE A;  3VR8 A;  4IA6 A;  3AE1 A;  3II4 A;  1NEL A;  1PS9 A;  3P4R A;  3I3L A;  2PMQ A;  3H8L A;  1KFY A;  2C4C A;  4BUR A;  5U25 A;  4EQW A;  2XFQ A;  3CMM A;  3KPF A;  2R4J A;  4IA5 A;  1K0I A;  3FV9 A;  3R0U A;  4N9X A;  4DN1 A;  1OEP A;  4GRT A;  2EQ8 A;  4HCD A;  6ENL A;  2B7R A;  3T2Y A;  4RG4 A;  3PWG A;  3SY4 A;  3B97 A;  3T8Q A;  4G7F A;  2GSH A;  3JZU A;  5KNL A;  2OZ8 A;  2UZZ A;  2WBA A;  5L46 A;  2R0C A;  4KWS A;  4BV6 A;  1ZX9 A;  3AE9 A;  1JDF A;  4YKG A;  4U2S A;  3HW2 A;  2X50 A;  3NG7 X;  1MDL A;  3F8P A;  3LXD A;  4GYP C;  3OZY A;  4HYR A;  4HCH A;  4A3R A;  4E5T A;  1GND A;  1IYX A;  1ONE A;  2RGH A;  2AQJ A;  2AAQ A;  3STP A;  1P2E A;  4AT2 A;  2E5A A;  4MGG A;  5CQF A;  1CF3 A;  3MQT A;  1FHU A;  1BF3 A;  1M6I A;  4WCT A;  1W6T A;  1NHQ A;  1ZK7 A;  5HXI A;  1Z6L A;  4Z2U A;  1EC8 A;  1Q1R A;  3DGZ A;  2YR5 A;  1FL2 A;  2B76 A;  2O9Z A;  3C4N A;  1P2H A;  3AED A;  4BK2 A;  1VQZ A;  3CTY A;  1SB3 B;  1GET A;  2YG6 A;  1BKH A;  4GDE A;  1Y0P A;  3Q9T A;  4XWR A;  4NNJ A;  4WX1 A;  1SJB A;  3CNS A;  4U8N A;  3K1G A;  3L5O A;  3S5W A;  2R0P A;  1NU5 A;  1DOC A;  5C2T A;  4K22 A;  2XVF A;  3SN4 A;  4C3Y A;  4BK3 A;  2PS2 A;  1RYI A;  1XPY A;  3BNM A;  1L9C A;  3P4P A;  4O5Q A;  1PJ5 A;  3ABV A;  3C4A A;  1KF6 A;  1JRY A;  2PP3 A;  5GSN A;  1PBD A;  3QJ4 A;  3JVA A;  3GDP A;  1E1K A;  3CGC A;  3UCD A;  5JCL A;  1LPF A;  2QDD A;  2OO6 A;  3CXO A;  4LA1 A;  2XVI A;  1PJ7 A;  4UP3 A;  4CNK A;  1BWC A;  4KX6 A;  4ECH A;  4Y4M A;  1COY A;  2P8B A;  1IUX A;  1EC9 A;  2Q0K A;  1KD0 A;  3RP7 A;  4HPN A;  5GRT A;  3I6D A;  1L8P A;  1GRT A;  4G74 A;  2XFP A;  3GDN A;  3SR6 B;  2PP0 A;  1D4C A;  1YQ3 A;  3DA1 A;  5KWF A;  4PAB A;  4DSG A;  3ZLG A;  5EB5 A;  3T4W A;  1F6M A;  1O94 A;  1DOD A;  3DME A;  1H82 A;  1DOE A;  3AD8 B;  3UXK A;  2FBW A;  3PS9 A;  4UDQ A;  3NTD A;  3SFE A;  3ATR A;  4E6M A;  3EKG A;  2YR6 A;  2BC0 A;  3SQS A;  1KNP A;  4DGK A;  5HHF A;  1GEU A;  3NNE A;  3HYV A;  1EBG A;  2BS3 A;  3ADA B;  2XLS A;  4A5L A;  3P4Q A;  2WS3 A;  2XFU A;  4U8I A;  1FEA A;  2H89 A;  3NVY B;  5HY5 A;  4KPL A;  3VRA A;  3UCC A;  1VG9 A;  3MSY A;  2QJN A;  4AOS A;  2BS4 A;  4UDR A;  1PBC A;  1AOG A;  3CGB A;  4J36 A;  4PAA A;  5KOW A;  3NFU A;  5IQ1 A;  3SQP A;  2YLX A;  4J33 A;  1IUS A;  4YWO A;  1PDH A;  2ZZ0 A;  3UTG A;  2PGE A;  4IL2 A;  5JCI A;  4GIR A;  1F8W A;  3ICS A;  3RCY A;  5KMQ A;  3CN8 A;  5FJO A;  3GSI A;  1IUU A;  2APG A;  4FK1 C;  1GRG A;  2YLR A;  2GGH A;  1T3Q C;  1GRB A;  3VCN A;  3Q6J A;  2WDQ A;  2RGO A;  4EM3 A;  1LV0 A;  3NRZ B;  1MXT A;  3A7R A;  4Z43 A;  3FXG A;  4I58 A;  1E1N A;  3OPS A;  4TVW A;  3EF6 A;  1XDI A;  2GDQ A;  1E9I A;  3TOY A;  1CHU A;  2IVD A;  2CVJ A;  3GD3 A;  4NEW A;  1KDG A;  1QLB A;  1ZP0 A;  3V76 A;  5U63 A;  1JRZ A;  3TJ4 A;  1DNC A;  1EL9 A;  2GV8 A;  3NH3 X;  3RHA A;  2XYO A;  2C66 A;  4BJY A;  2IVE A;  3NVV B;  3NIX A;  4A6N B;  3C96 A;  1D7L A;  5FMH A;  4FP1 A;  1DXL A;  1H7X A;  5KVI A;  2VRL A;  2ZC8 A;  3UTF A;  2BK5 A;  3BSM A;  3COX A;  4H83 A;  1GES A;  5DBJ A;  3SN0 A;  1JNZ A;  3T6C A;  1REO A;  2GGE A;  3OW1 A;  3UKF A;  4OCG A;  5JCK A;  3P93 A;  3O0H A;  2V60 A;  4Z2T A;  3QTP A;  2B9Y A;  3NKS A;  4TLX A;  1YQ4 A;  4K8D A;  1NG3 A;  3QVP A;  4IT1 A;  1GV4 A;  2FYM A;  3GRS A;  3DJE A;  2YG4 A;  3M12 A;  1LQT A;  1SEZ A;  3AE3 A;  3DG7 A;  2V3A A;  2QCU A;  3SZW A;  1F8S A;  1Q1W A;  5EOW A;  3PO7 A;  1L9D A;  1KNR A;  2VZ2 A;  3D1C A;  4ICY A;  3RED A;  4I59 A;  3DG6 A;  3EUB 3;  2WP9 A;  3DGB A;  4JNQ A;  3NN6 X;  5FS9 A;  3LZW A;  2ZBW A;  4OPT A;  3KD9 A;  3VR9 A;  3AE4 A;  2OLO A;  2C3C A;  5U1O A;  4AOX A;  2EQ7 A;  3KU9 A;  4ROP A;  5KRQ A;  1QJD A;  2JK6 A;  4IV9 A;  3IHM A;  1RSG A;  4GIS A;  1E6E A;  1WYG A;  1W4X A;  2C70 A;  3NGC X;  5BRT A;  2PCE A;  4DSH A;  2R0G A;  2NPX A;  1OJ9 A;  2YM2 A;  3P0W A;  2WHD A;  2VRM A;  1H81 A;  3ZVI A;  3JW7 A;  2XSX A;  2A87 A;  3QLD A;  4J31 A;  2PP1 A; 
#chains in the Genus database with same CATH homology
 2XFN A;  1ZK7 A;  3M0O A;  3EAN A;  1LQU A;  3KLJ A;  5BVA A;  5HXI A;  2JB1 A;  1NHR A;  3RP6 A;  3NK0 X;  1PBE A;  4B66 A;  2GR2 A;  1Z6L A;  2TMD A;  4D03 A;  4Z2U A;  3KVE A;  4YKF A;  3BNU A;  2YLW A;  3F8D A;  4APN A;  4CY8 A;  1Q1R A;  2R9Z A;  4P9S A;  3DGZ A;  2YR5 A;  3DK8 A;  2V3B A;  5FS6 A;  1YQZ A;  1FL2 A;  3NK2 X;  2GR3 A;  2B76 A;  2O9Z A;  2V61 A;  3C4N A;  1P2H A;  4M52 A;  3AED A;  2J3N A;  2ACZ A;  4BK2 A;  5BUK A;  3CTY A;  3EPT A;  4YSZ A;  4GF7 A;  4Z26 A;  4UDP A;  3QFA A;  1GET A;  2YG6 A;  2EQ9 A;  3K30 A;  4OPD A;  2GEW A;  4Z2R A;  2BAC A;  4GDE A;  1B4V A;  1Y0P A;  2FJB A;  4OPU A;  2BA9 A;  3Q9T A;  4XWR A;  3G5Q A;  2WOW A;  4NNJ A;  4JN9 A;  4WX1 A;  1S3E A;  3IHG A;  4H4U A;  3UTE A;  3CNS A;  4NTD A;  3KKJ A;  2BAB A;  3NTA A;  4U8N A;  1GRE A;  2YQU A;  3PVC A;  3VQR A;  3L5O A;  1B5Q A;  3S5W A;  2WPF A;  2Q6U A;  3NRN A;  3NK1 X;  2XLP A;  1GXF A;  2R0P A;  2BC1 A;  3L1R A;  1S3B A;  1DOC A;  5C2T A;  2Y6Q A;  2BK4 A;  2C67 A;  3BI2 A;  4H7U A;  4K22 A;  4YT0 A;  1CC2 A;  4NTC A;  1NHS A;  3T31 A;  3BHK A;  5ER0 A;  1H84 A;  4D04 A;  2XVF A;  3OC4 A;  3LB8 A;  2WPE A;  2BYB A;  1ZY8 A;  3SZC A;  2R4E A;  3CGD A;  3BI5 A;  4GDP A;  1E1M A;  1JNR A;  4C3Y A;  4BK3 A;  2YLZ A;  4C74 A;  2RAB A;  1B8S A;  1RYI A;  5EB4 A;  3CNT A;  4FX9 A;  3AYL A;  4U8P A;  2C65 A;  5J7X A;  4ADW A;  1GOS A;  3HYX A;  4OPC A;  4RG3 A;  3BNM A;  2CUL A;  4GAP A;  1L9C A;  1PJ6 A;  3P4P A;  4MJW A;  4JNA A;  4O5Q A;  5JRB A;  1PJ5 A;  3AE7 A;  3ABV A;  2YR4 A;  3C4A A;  2WU2 A;  5KOX A;  4TM0 A;  1KF6 A;  4H4X A;  1JRY A;  5HYM A;  4Z24 A;  3D9X A;  5GSN A;  1E39 A;  1PBD A;  3QJ4 A;  2C64 A;  2C72 A;  2C76 A;  3GWF A;  1H86 A;  1LTX R;  4YSY A;  3GDP A;  1E1K A;  3CGC A;  3UOY A;  2JB3 A;  2QA1 A;  4ZN0 A;  3UKL A;  1EL5 A;  5JCL A;  1NG4 A;  4AT0 A;  1LPF A;  1TYP A;  2GMH A;  4TM3 A;  4A7A A;  2FJD A;  4LA1 A;  3DJJ A;  2XVI A;  1PJ7 A;  1VDC A;  2JKC A;  1CJC A;  1N4W A;  1FEC A;  1KN0 A;  3K7M X;  2OLN A;  3SM8 A;  4UP3 A;  4CNK A;  1GT8 A;  2YG5 A;  1BWC A;  2DKH A;  4KX6 A;  1LJ1 A;  2C7G A;  4H2N A;  4ECH A;  4Y4M A;  3VRB A;  1VRQ B;  1COY A;  1NEK A;  1IUX A;  1JEH A;  3AE6 A;  2Q0K A;  3RP7 A;  4EQS A;  4EM4 A;  4Y4N A;  2YAU A;  3URH A;  1HYU A;  3AD7 B;  2HQM A;  5GRT A;  3AXB A;  1JOA A;  2BS2 A;  3FBS A;  4NEV A;  3I6D A;  2WP5 A;  1L0V A;  2W0H A;  1GRT A;  4G74 A;  4YTM A;  2GQF A;  2XFP A;  4U8M A;  1K0L A;  2RGJ A;  3GDN A;  1CC4 A;  3RNM A;  2VQB A;  1H83 A;  2C75 A;  3EAO A;  1D4C A;  1F8R A;  2GAG B;  3AEE A;  3DJG X;  3AWI A;  1YQ3 A;  3DA1 A;  4H4W A;  3NYC A;  5KWF A;  1GTH A;  3HZL A;  4PAB A;  4X4J A;  4DSG A;  5KMP A;  2VVM A;  2WOV A;  5EB5 A;  2OAM A;  2PYX A;  1M64 A;  4HA6 A;  1F6M A;  1O94 A;  2VVL G;  1DOD A;  4C77 A;  1EBD A;  3UCL A;  3JSK A;  2B9X A;  4J34 A;  3T0K A;  3DME A;  1H82 A;  4BJZ A;  4JY2 A;  4USR A;  1DOE A;  3AD8 B;  4K5S A;  1YY5 A;  1NDA A;  3NYF A;  2XLR A;  2YLS A;  2XLU A;  2FBW A;  3LOV A;  1PXA A;  3IWA A;  4U8J A;  1ZMD A;  3UP4 A;  1BGN A;  3CPH G;  3UOX A;  3PS9 A;  4ZCC A;  4UDQ A;  4EMI A;  1Q9I A;  3NTD A;  2OA1 A;  2Q7V A;  4GR1 A;  4Z44 A;  3SFE A;  3ATR A;  2YVG A;  5KMS A;  4J2W A;  2YLT A;  4U2T A;  1ELI A;  2YR6 A;  2XCG A;  4K5R A;  3HYW A;  4C3X A;  3GMB A;  4NTE A;  1Y56 B;  2BC0 A;  1RP0 A;  4FK1 A;  3CNP A;  1KNP A;  2VQ7 A;  1EL8 A;  1PN0 A;  1ZOV A;  3QVR A;  3SGL A;  3ALM A;  3FIM B;  1CBO A;  4DGK A;  5KVH A;  3ZDN A;  1DJQ A;  5HHF A;  3WE0 A;  2IID A;  5KMR A;  1GEU A;  2X8H A;  1H7W A;  2E4G A;  3HYV A;  3NNE A;  4C5O A;  4FDC B;  1CJ4 A;  2BS3 A;  3BHF A;  3QSE A;  5JCN A;  3ADA B;  1Y56 A;  3F8R A;  4E0V A;  2XLS A;  1CJ2 A;  1TYT A;  2YVJ A;  4A5L A;  1V59 A;  3PG6 A;  3ICT A;  3P4Q A;  1OJC A;  2WS3 A;  5EBK A;  2XFU A;  1FEA A;  4U8I A;  1EL7 A;  4REK A;  4ZCD A;  2C73 A;  2H89 A;  1O5W A;  2VVL A;  4IVM B;  4B1B A;  2GF3 A;  1MO9 A;  3AYI A;  5J60 A;  2WET A;  3K7Q X;  3NYE A;  1PXC A;  5HY5 A;  2WOI A;  3GD4 A;  5KXJ A;  2WPC A;  1VG0 A;  1PBB A;  4G9K A;  3UKK A;  3AE8 A;  3VRA A;  2YG3 A;  3G5R A;  1VG9 A;  4U8K A;  2E5V A;  4LII A;  5FS7 A;  4AOS A;  2BS4 A;  3VRD B;  4UDR A;  1PBC A;  1AOG A;  3LAD A;  1ZDL A;  1TDK A;  3CGB A;  1UKV G;  4J36 A;  4PAA A;  2I0Z A;  2YVF A;  2CDU A;  5KOW A;  1DOB A;  2B9W A;  3SYI A;  5IQ1 A;  3UKH A;  1TDO A;  3SQP A;  1TDN A;  4JDR A;  1PXB A;  3B6D A;  1NEN A;  3IC9 A;  4NZH A;  2NVK X;  3M13 A;  2YLX A;  1H6V A;  4J33 A;  4B65 A;  1IUS A;  2XVJ A;  1CL0 A;  3ALL A;  3CIR A;  3CGE A;  4H4V A;  1OJT A;  4YWO A;  1PDH A;  2E1M A;  4TM4 A;  3UKQ A;  2QAE A;  2ZZ0 A;  3UTG A;  1GPE A;  3NT6 A;  3DK4 A;  5JCI A;  1F8W A;  2GMJ A;  4TLZ A;  3ICS A;  4A79 A;  3ALJ A;  3CNJ A;  4AP1 A;  5KMQ A;  1GSN A;  1JU2 A;  4YXD A;  3DK9 A;  3CN8 A;  4U8O A;  4H4Y A;  2FJE A;  2X99 A;  3GSI A;  3GRT A;  2XDO A;  4CNJ A;  1IUU A;  1XHC A;  1E1L A;  5M10 A;  1X31 B;  2PHH A;  2APG A;  4FK1 C;  1GRG A;  2YLR A;  4CCR A;  4B68 A;  1GRB A;  3SXI A;  3AYJ A;  4KPR A;  4O5U A;  4B63 A;  3UOZ A;  1TDF A;  1D4D A;  2GVC A;  3Q6J A;  4IVO B;  2WDQ A;  2RGO A;  4CRT A;  4EM3 A;  2B7S A;  1LV0 A;  3IF9 A;  1GRF A;  1FCD A;  4A99 A;  5LV9 A;  1MXT A;  1OJD A;  2DKI A;  2GB0 A;  2XVE A;  3CPJ G;  4I58 A;  4Z43 A;  3V3O A;  2YM1 A;  1E1N A;  3DH9 A;  2BCG G;  2YG7 A;  4OPL A;  3EF6 A;  4XWZ A;  2R45 A;  3H8L A;  3LJP A;  1XDI A;  2ZZB A;  3T2K A;  3OZ2 A;  1LVL A;  3ZYX A;  4A9W A;  2R46 A;  3QSM A;  4II3 A;  3AEF A;  1GER A;  4YSX A;  2Y6R A;  1CHU A;  2IVD A;  2CVJ A;  3GD3 A;  2QA2 A;  3AD9 B;  3R9U A;  4NEW A;  3AEC A;  4II2 A;  4USQ A;  1KDG A;  1D4E A;  1QLB A;  3P9U A;  1DJN A;  2F5Z A;  1ZP0 A;  4U8L A;  3UTH A;  3V76 A;  4LU6 A;  4H4Q A;  5U63 A;  4H2R A;  1D5T A;  1JRZ A;  1IUW A;  2A89 A;  4A65 A;  3UKP A;  1KSU A;  1DNC A;  2YWL A;  1EL9 A;  1K0J A;  4H2P A;  4Z25 A;  2Q0L A;  2GV8 A;  4H4R A;  3NH3 X;  1OJA A;  3S61 A;  5IQ4 A;  4H4P A;  4EQR A;  3H4K A;  3QSS A;  3RHA A;  5FS8 A;  5IPY A;  3KPK A;  3SX6 A;  2JBV A;  2XYO A;  2TPR A;  2C66 A;  2IVE A;  2WU5 A;  4H4Z A;  3ATQ A;  4DNA A;  3DJD A;  4GUV A;  4BJY A;  4CCQ A;  2BXR A;  4EIP A;  4HB9 A;  3NIX A;  4BK1 A;  4A6N B;  3C96 A;  4YTP A;  1D7L A;  1YKJ A;  3UOV A;  3BI4 A;  5FMH A;  1DXL A;  3ICR A;  1H7X A;  5KVI A;  3ISH A;  2VRL A;  3FMW A;  4H50 A;  4H4S A;  1BKW A;  1F3P A;  2JAE A;  3UKA A;  2WES A;  4GCM A;  4B69 A;  4X9N A;  4EIQ A;  3RP8 A;  1BZL A;  4H2Q A;  1NPX A;  3SZ0 A;  3UTF A;  2FJA A;  2BK5 A;  4X9M A;  4A6N A;  4AP3 A;  2V5Z A;  2OAL A;  4JY3 A;  3COX A;  4H4T A;  1FOH A;  2BK3 A;  4G6G A;  3L8K A;  2XVH A;  1GES A;  5C3J A;  5DBJ A;  4YTN A;  1JNZ A;  1XPQ A;  3FPZ A;  3LZX A;  3P1W A;  4EMW A;  1N4U A;  4K2X A;  3GYI A;  4IV9 A;  2GRT A;  1REO A;  2Z5Y A;  3FG2 P;  2BRY A;  3VR8 A;  3UKF A;  4OCG A;  5JCK A;  3CND A;  1L9E A;  3O0H A;  3CPI G;  2V60 A;  4Z2T A;  2B9Y A;  2H88 A;  4GAV A;  1O95 A;  3K7T A;  4EQX A;  3NKS A;  4TLX A;  1YQ4 A;  4IA6 A;  3AE1 A;  4K8D A;  3II4 A;  4K7Z A;  1K4Q A;  2JB2 A;  1PS9 A;  1NG3 A;  3P4R A;  3GMC A;  3QVP A;  1S2Y A;  3I3L A;  1GV4 A;  5TR3 A;  3DGH A;  1FEB A;  3GRS A;  5JCM A;  1KFY A;  4BUR A;  1ZOY A;  5U25 A;  2C4C A;  1PHH A;  2GAH B;  4B67 A;  4EMJ A;  3DJE A;  3T2Z A;  4EQW A;  2BCP A;  2XFQ A;  2YG4 A;  3M12 A;  1GAL A;  1ZMC A;  2R4J A;  1ONF A;  3CMM A;  3AB1 A;  1LQT A;  1K0I A;  1SEZ A;  2XLT A;  3KPF A;  4IA5 A;  2ZZC A;  4N9X A;  3AE3 A;  1GRA A;  1GTE A;  4OPI A;  1PBF A;  1IJH A;  4G6H A;  1S2Q A;  5M0Z A;  2V3A A;  4GRT A;  2ARD A;  2QCU A;  3SZW A;  2EQ8 A;  1F8S A;  2B7R A;  3QFB A;  3T2Y A;  1E7P A;  1Q1W A;  3KA7 A;  1XAN A;  4RG4 A;  3AEA A;  1H2I A;  5EOW A;  4OVI A;  3SFD A;  3PO7 A;  2BRA A;  2WQY A;  2Z5X A;  2XFO A;  2A8X A;  3AEB A;  1L9D A;  2WEU A;  3ITJ A;  4Y4L A;  3SY4 A;  1KNR A;  1JRX A;  2VZ2 A;  3D1C A;  4ICY A;  4J57 A;  5BUL A;  1NHP A;  4NWZ A;  2GH5 A;  3RED A;  4I59 A;  1KSS A;  1S7M A;  5KNL A;  4YSH A;  2BXS A;  2UZZ A;  2WBA A;  3E1T A;  5L46 A;  2R0C A;  2WP9 A;  4JNQ A;  3NN6 X;  5FS9 A;  3NLC A;  4CBQ A;  2EQ6 A;  3LZW A;  4BV6 A;  1ZX9 A;  1ZKQ A;  3AE9 A;  2ZBW A;  3GYX A;  4G73 A;  1VQW A;  3KD9 A;  4OPT A;  4U2L A;  4U2S A;  3AE4 A;  3VR9 A;  2OLO A;  2X3N A;  4YKG A;  2C3C A;  4XXG A;  5U1O A;  1N4V A;  2X50 A;  3B3R A;  4AOX A;  2EQ7 A;  2V6O A;  3NG7 X;  4RSL A;  2GR0 A;  3KU9 A;  1QO8 A;  5KRQ A;  3P4S A;  2X8G A;  1QJD A;  2WDR A;  2JK6 A;  3AE2 A;  1CC6 A;  3F8P A;  3IHM A;  3LXD A;  1N1P A;  4J56 A;  1RSG A;  1IUV A;  2WDV A;  3T14 A;  4TM1 A;  4OPG A;  1E6E A;  5CKU A;  2C3D A;  1W4X A;  3D8X A;  1GND A;  2AR8 A;  4B64 A;  2C70 A;  3AE5 A;  3NGC X;  3UP5 A;  2WP6 A;  4DSH A;  5BRT A;  3G5S A;  1TDE A;  2R0G A;  3SZF A;  1BGJ A;  1TRB A;  3V3N A;  1D7Y A;  2RGH A;  2AQJ A;  2AAQ A;  3H8I A;  2CFY A;  3T37 A;  1CJ3 A;  2NPX A;  2X8C A;  3NN0 X;  1OJ9 A;  3NHO X;  1P2E A;  2YM2 A;  1MOK A;  4AT2 A;  2WHD A;  1B37 A;  2VRM A;  1NAA A;  1GRH A;  1CF3 A;  3GYJ A;  5CQF A;  1BF3 A;  1M6I A;  2VOU A;  1H81 A;  4WCT A;  4JQ9 A;  2GR1 A;  3AEG A;  4CY6 A;  2A87 A;  3GWD A;  4J31 A;  1IUT A;  2GQW A;  1NHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...