3O0HA

Crystal structure of glutathione reductase from bartonella henselae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
460
structure length
455
Chain Sequence
SFDFDLFVIGSGSGGVRAARLAGALGKRVAIAEEYRIGGTCVIRGCVPKKLYFYASQYAQEFSKSIGFGWKYADPIFNWEKLVAAKNKEISRLEGLYREGLQNSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNIKGSDLCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQVQSTENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFETTPDYDLITTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESRIVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSYVYENGEKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione reductase
publication title Crystal structure of glutathione reductase from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
total genus 145
structure length 455
sequence length 460
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3o0hA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3o0hA02
2GV8A 1E1MA 1IUVA 1REOA 4TM3A 1JOAA 4OCGA 4H4XA 1LQUA 4JY3A 1M64A 3GYJA 1RYIA 2WPFA 1DXLA 4H4RA 1BWCA 1OJCA 3RNMA 2XLRA 4H4TA 2IVEA 5L46A 4TLZA 2DKHA 2WBAA 1EL5A 2Z5XA 1GTHA 5IQ1A 4BK3A 5C2TA 3AE6A 2RABA 3LOVA 5JCKA 3QSMA 4HB9A 1OJTA 3AE2A 2BC1A 4NTDA 1L9EA 4CRTA 1XPQA 1OJ9A 1EBDA 3G5SA 2XLPA 4Z26A 4ECHA 3AECA 1VG9A 4Y4LA 2EQ6A 4DGKA 2I0ZA 1GRHA 4C77A 1FOHA 2FJBA 2C73A 4BJYA 3CGCA 4U8IA 3UOVA 1H7WA 4K8DA 4A99A 1Y56B 2BS2A 4Z2UA 2C3CA 4EIPA 4U8KA 3AEGA 5M10A 2Z5YA 1PXBA 3AE7A 3NK0X 2GR3A 4JQ9A 3IC9A 1PXCA 2BXSA 3JSKA 4OVIA 5EB4A 4N9XA 1K4QA 3DJJA 2J3NA 1JEHA 2A87A 4JDRA 2BA9A 3QJ4A 2GB0A 4YTNA 1GTEA 4M52A 3F8DA 1ZK7A 3P1WA 5EB5A 2NPXA 1IUSA 1B37A 3AEAA 3NRNA 2JB2A 4A5LA 2YG3A 2CVJA 1YKJA 4B68A 4O5QA 4A9WA 5U25A 2YVGA 2C7GA 3PS9A 4J33A 3UTFA 1FCDA 3ZYXA 3II4A 4YTMA 4IA5A 4D04A 1CHUA 3NK2X 2GVCA 5BUKA 1E1LA 3NH3X 3NTAA 1DOEA 4ICYA 1H81A 4FK1C 1NG4A 1LVLA 3F8RA 4U8PA 4NTCA 4K5RA 4TLXA 1GERA 3AD7B 4AOSA 4YXDA 3GWDA 2OALA 1BKWA 1BGJA 3DGZA 4U8NA 1K0JA 2YWLA 2R46A 3UKAA 2R4JA 2WU2A 4AT2A 2JB3A 4EQXA 1IJHA 4BV6A 4PAAA 3F8PA 2GMJA 5FS8A 4REKA 1S2QA 2WDVA 1GRFA 1EL9A 2R9ZA 3O0HA 2R0PA 5JCMA 2WP5A 5TR3A 4J56A 2XVHA 3LADA 2C76A 4P9SA 2YR6A 3QVPA 2CULA 1EL7A 3GD4A 1E6EA 3H8LA 1NHPA 4EQWA 3UCLA 5KXJA 2BC0A 3NK1X 2WOWA 3K30A 4GRTA 5U1OA 1UKVG 3SGLA 1JNRA 1N4WA 3OC4A 1FEAA 4CY6A 3P4RA 4XXGA 1GRAA 3G5RA 2YLTA 2W0HA 1CC6A 3K7TA 2ZZCA 3SFEA 2OA1A 1D4CA 1PXAA 4YTPA 1IUXA 1QJDA 1YQZA 4Y4NA 4EIQA 2E1MA 4H4VA 4H2PA 2OLOA 5C3JA 4B1BA 3AE9A 3IWAA 1H84A 2DKIA 3B3RA 1B5QA 2JK6A 3VRDB 3DK8A 1GEUA 3AWIA 2ARDA 1GRBA 2UZZA 1S3EA 4U2SA 3T37A 5FS7A 2FJAA 3IHGA 3ICSA 3EF6A 3G5QA 1CC2A 3ALMA 4U8OA 1CJCA 2V6OA 1E39A 4RG4A 3S5WA 4TM0A 1X31B 1ZOVA 1Y56A 5HHFA 3M13A 4A79A 3UKQA 1GSNA 4JY2A 2BCGG 3DH9A 4YSYA 1P2EA 2X3NA 2CDUA 3V76A 1PJ7A 2R4EA 2BS4A 2Q6UA 3UKLA 1Q1WA 1PJ5A 2APGA 1S3BA 3DK9A 1NHSA 1VRQB 3LB8A 1LTXR 2VRMA 3R9UA 1RP0A 2GQFA 2XVEA 3UOZA 4A6NB 1ZP0A 1CBOA 4DSGA 4YSHA 1GNDA 2IIDA 1W4XA 3P4PA 4B64A 2VVMA 3LZWA 1Z6LA 1LPFA 2C64A 2Q7VA 4U8JA 4CBQA 2BK5A 4ZN0A 1BF3A 2V61A 2WEUA 2C75A 4FX9A 5KOXA 3DJGX 1S2YA 1DJQA 3UOXA 4NTEA 4K2XA 3NTDA 1PN0A 3ALJA 2AAQA 3ITJA 3GDNA 3OZ2A 3P9UA 4AP3A 5J60A 2GH5A 3AEBA 4J31A 3DMEA 4JN9A 4FDCB 2F5ZA 4ADWA 4USQA 1TYPA 2GQWA 2WESA 1HYUA 3GDPA 3KLJA 1JRYA 2V3AA 3EPTA 1O95A 4LIIA 1KF6A 5HY5A 2B76A 3DK4A 1JNZA 3NN0X 3PO7A 1FL2A 2C3DA 2YLSA 2B9WA 3AXBA 3IHMA 4DNAA 3M12A 1NHQA 3UTEA 2YR5A 4U2TA 3ICRA 1PS9A 1F3PA 3CGDA 2GMHA 2RGHA 1H82A 4XWZA 3GMBA 2XFPA 4H4WA 2XFUA 3CPJG 2BXRA 4CCQA 3V3NA 4YKFA 2VZ2A 1M6IA 3UTHA 2X8CA 4DSHA 1DOCA 3AEEA 2JBVA 3RP7A 3NYEA 3AE5A 3QFBA 4I58A 3ISHA 2GAGB 4NZHA 5HXIA 2ZZ0A 3NN6X 1AOGA 3H8IA 2VOUA 1H6VA 2Q0LA 2FJEA 1JU2A 2PHHA 2XVJA 2ZZBA 2WP9A 4JNAA 2YG5A 3V3OA 2RGOA 2YLZA 1TDEA 2GEWA 4Z25A 1Q1RA 1CF3A 2VRLA 1ZMDA 2C72A 3AE3A 2YVFA 1GREA 2C70A 3GWFA 4OPDA 1L0VA 2B7RA 4H4ZA 1QLBA 3UP4A 5HYMA 5J7XA 2NVKX 4Z43A 2JAEA 4OPTA 2YVJA 4OPUA 1GRGA 3UKPA 2XVIA 1ZOYA 3AD8B 3GD3A 3K7MX 4CY8A 4GR1A 1GOSA 5KRQA 4B63A 1GRTA 5BULA 3LZXA 4ZCCA 4H2RA 1K0LA 4EQRA 1CC4A 4KPRA 3LXDA 2AR8A 2JKCA 4EMJA 3ABVA 3IF9A 1CJ3A 4MJWA 2V3BA 4J34A 4D03A 2X8GA 3NG7X 2QA2A 2XLTA 3VR8A 4H4YA 3UKHA 3CNPA 3CNDA 4EMIA 3D1CA 4U8LA 4ZCDA 3UTGA 3CNSA 4TM1A 4Z2TA 4I59A 2GR0A 2ZBWA 4A6NA 2H88A 4K7ZA 2BK4A 2ACZA 2EQ9A 2FJDA 1OJAA 5IQ4A 3L1RA 2YM2A 3CNTA 4PABA 4FK1A 3BI4A 5JCIA 3CIRA 2VVLG 3HZLA 3ATRA 3AEDA 4AOXA 2Y6RA 4J2WA 1GV4A 1QO8A 5DBJA 1NAAA 5KWFA 4E0VA 3ATQA 4WX1A 1NPXA 1VG0A 1FEBA 3DJEA 2YG6A 1NDAA 4LU6A 1D4EA 3ICTA 3EAOA 1PBFA 4HA6A 2WP6A 3Q6JA 2EQ8A 3NGCX 3REDA 1E1NA 4JNQA 1IUTA 1TDKA 2WPEA 1MXTA 1PBCA 1XHCA 2YM1A 1B8SA 4RSLA 2OLNA 2OAMA 5FMHA 1O94A 1TDOA 2O9ZA 3GYIA 1B4VA 2GR1A 3GRTA 4IA6A 4K5SA 3VQRA 3VR9A 4B67A 2JB1A 3KVEA 1EL8A 2C66A 3NYCA 3KA7A 2WETA 3DGHA 3B6DA 4YT0A 5CKUA 1ZDLA 2YAUA 3BHKA 3RP6A 2XLUA 3CGBA 3AEFA 1H7XA 2WPCA 1RSGA 4WCTA 1GT8A 5LV9A 2V5ZA 1F8RA 1LV0A 2VQ7A 4EQSA 4X4JA 1KSSA 2E5VA 1LQTA 2GF3A 2YQUA 1F8SA 2FBWA 1KFYA 2PYXA 1BZLA 1DJNA 2WU5A 3FMWA 4O5UA 4GUVA 3I6DA 3ALLA 2BCPA 1P2HA 4B69A 2BK3A 2BABA 2B7SA 3UP5A 3L8KA 1MO9A 4RG3A 4BK2A 2X99A 4IVOB 1H83A 1PJ6A 1Q9IA 3NYFA 5GRTA 1E7PA 3S61A 2GAHB 4C74A 2YLXA 1IUWA 3I3LA 4NEWA 1TDNA 2X50A 4H50A 4YKGA 1O5WA 5FS6A 5JCNA 2CFYA 4IV9A 4X9MA 3P4QA 2BACA 2XYOA 3BNMA 1JRXA 4EM4A 4A7AA 2WDRA 4H4QA 3UKFA 1L9CA 4EM3A 1F6MA 1L9DA 3ADAB 3QSSA 3QVRA 4Z44A 4A65A 2BS3A 3UKKA 5KVHA 3BI2A 3LJPA 3CTYA 4Z2RA 1F8WA 1VDCA 1VQWA 1YQ3A 4Z24A 5M0ZA 2XDOA 1GESA 3CPIG 3BHFA 1PBEA 2XCGA 3COXA 4USRA 1NENA 4C5OA 2H89A 5IPYA 3AE8A 3SM8A 3H4KA 2QAEA 1ZMCA 4H4UA 1JRZA 2R0CA 2VQBA 3KKJA 4U8MA 5GSNA 4C3XA 1TDFA 2XFNA 1GXFA 4H4PA 3PVCA 4BJZA 3RHAA 4CNJA 3NNEA 5KOWA 4GDPA 1H86A 3AE1A 4BURA 3BNUA 3Q9TA 5ER0A 2X8HA 1MOKA 2QA1A 2WOIA 4GDEA 3E1TA 3GRSA 1N4VA 3CPHG 3CNJA 2VVLA 3SQPA 5U63A 1OJDA 1V59A 1NHRA 1DNCA 1LJ1A 4AT0A 2A89A 3QFAA 1ZY8A 1PHHA 1XANA 4OPGA 2TMDA 3CGEA 4LA1A 3FIMB 2AQJA 1N1PA 3AYJA 1XDIA 4OPIA 3WE0A 3KD9A 4C3YA 4YSXA 3ZDNA 2WDQA 4U2LA 4TM4A 1CJ2A 3AD9B 3KPFA 4XWRA 3NLCA 3QSEA 1BGNA 3URHA 3GSIA 2TPRA 3AYLA 1N4UA 3NHOX 4K22A 3BI5A 1Y0PA 3DA1A 3M0OA 4J36A 2RGJA 1GPEA 4AP1A 2YG7A 1K0IA 3NT6A 2QCUA 2XFOA 4UDRA 3FG2P 5BRTA 2V60A 4UP3A 5JCLA 1NEKA 2E4GA 4NEVA 1SEZA 4X9NA 1DOBA 1NG3A 2YLWA 1TYTA 1COYA 3UOYA 1D4DA 4EMWA 2YG4A 3C96A 4GCMA 3P4SA 4H7UA 2R45A 3CN8A 4GF7A 4CCRA 3KU9A 1CL0A 2WQYA 1D7YA 1ZX9A 2A8XA 1KNPA 2IVDA 1KDGA 1KNRA 2R0GA 1GALA 3EANA 3SFDA 4B65A 4UDQA 4J57A 4H4SA 2XFQA 5BVAA 4IVMB 1D7LA 3FBSA 1KSUA 4B66A 2WHDA 4UDPA 1DODA 3AYIA 2GRTA 4H2NA 2XLSA 4OPLA 2Y6QA 1PDHA 3AE4A 2EQ7A 1TRBA 3C4NA 1E1KA 3FPZA 4KX6A 3GMCA 2Q0KA 5EBKA 1YQ4A 4CNKA 2YR4A 4YSZA 4APNA 1PBBA 3K7QX 1ONFA 1ZKQA 3VRBA 2WOVA 3AB1A 1GETA 5FS9A 1PBDA 2C65A 2B9YA 2C67A 3NKSA 4H2QA 4YWOA 1FECA 1CJ4A 2WS3A 3D8XA 3VRAA 3NIXA 5KVIA 3RP8A 2GR2A 1YY5A 3C4AA 2YLRA 1D5TA 1IUUA 2B9XA 2HQMA 2BYBA 3DJDA 2XVFA 4OPCA 4BK1A 4Y4MA 5EOWA 1ELIA 5CQFA
chains in the Genus database with same CATH superfamily
1E1MA 1ZXIC 1M64A 2OG9A 4H4RA 1BWCA 3RNMA 4H4TA 2IVEA 2DKHA 1EL5A 5C2TA 5JCKA 2MUCA 3QSMA 1OJTA 3ZVHA 4NTDA 1L9EA 1WUFA 1EBDA 2XLPA 4Z26A 4U8IA 3T14A 1N60C 3NK0X 3IK4A 4FI4A 2A87A 1JEHA 1GTEA 2GGHA 1ZK7A 5EB5A 1B37A 3AEAA 2JB2A 4O5QA 2ZADA 5U25A 2YVGA 3PS9A 4IT1A 4J33A 3UTFA 4D04A 2GVCA 1E1LA 3Q45A 4ICYA 1H81A 4FK1C 4NTCA 2OX4A 4AOSA 3N4FA 1SJBA 5FS8A 1S2QA 1GRFA 4J3ZA 2R9ZA 3O0HA 5G5GB 3QVPA 1EL7A 3GD4A 3H8LA 5KXJA 1MUCA 3UJRA 2GGGA 2HNEA 4GRTA 4GYPA 4G74A 1JRPA 4XXGA 1GRAA 3G5RA 2W0HA 1CC6A 2ZZCA 1D4CA 1IUXA 2E1MA 3AE9A 3IWAA 5FJTA 3SR6B 1B5QA 2JK6A 3DK8A 1GEUA 3T0KA 2ARDA 3T37A 2FJAA 4H1ZA 3G5QA 5EU9A 2V6OA 4A3RA 3S5WA 1PDYA 1X31B 5HHFA 3UKQA 4JY2A 4YSYA 3V76A 1KKRA 4M0XA 2Q6UA 2APGA 1S3BA 1NHSA 1FFVC 1XPYA 4Z17A 2GQFA 4DSGA 3DFYA 4B64A 2VVMA 2BK5A 1RM6B 1BF3A 4II2A 1DJQA 3UOXA 3NTDA 4MKSA 3GDNA 2NQLA 3DMEA 4ADWA 1HYUA 3DK4A 1JNZA 3PO7A 1FL2A 3AXBA 3M12A 1NHQA 3ZLFA 4U2TA 3ICRA 1F3PA 2AL2B 2PA6A 4H4WA 2XFUA 3CPJG 1EC9A 2BXRA 1M6IA 4DXKA 2X8CA 3SX6A 1DOCA 3AEEA 3RP7A 1E9IA 3NN6X 1H6VA 2PHHA 2YG5A 1TDEA 2GEWA 1CF3A 4G6HA 3AE3A 4H4ZA 3UP4A 4G9KA 2JAEA 4OPUA 4E5TA 4E4FA 2PPGA 2XVIA 1ZOYA 3THUA 4IZGA 4ZCCA 4EQRA 4EMJA 4MJWA 2X8GA 4E6MA 4H4YA 4U8LA 2PP1A 1ELSA 4TM1A 4K2SA 4K8GA 4A6NA 2OLAA 3SBFA 1OJAA 5IQ4A 3L1RA 3CNTA 3KUMA 1FHUA 1FEBA 3EAOA 4HPNA 1TDKA 1B8SA 4RSLA 4DN1A 2OLNA 5FMHA 1B4VA 3NZGA 3NYCA 5CKUA 2P88A 3AEFA 3DDMA 2AL1A 3CMMA 3HYVA 2VQ7A 3U9IA 1LQTA 4EWJA 1F8SA 1BZLA 4O5UA 3SZ0A 2BABA 3UP5A 3T2KA 4RG3A 2X99A 3DFHA 3NYFA 1E7PA 4NNJA 4C74A 4NEWA 4H50A 2QJMA 1O5WA 3N6JA 2WDRA 4H4QA 1L9CA 3ADAB 3T31A 1F8WA 3NVYB 1VQWA 4Z24A 5M0ZA 3DIPA 1PBEA 4USRA 3GY1A 1JRZA 4C3XA 5GSNA 3PVCA 3NNEA 4BURA 3R0KA 3DEQA 2X8HA 2PTXA 2QA1A 2WOIA 3GRSA 3CPHG 3GYXA 1N61C 1V59A 1DNCA 2OZ3A 1ZY8A 1XANA 4OPGA 3RRAA 3AYJA 1XDIA 1BQGA 4YSXA 4C3YA 3ZDNA 1CJ2A 3KPFA 3URHA 2TPRA 3AYLA 1N4UA 3BI5A 4J36A 1GPEA 4AP1A 3AM9A 1S7MA 4NEVA 1D4DA 2W3SA 5IDZA 4H2HA 4CCRA 1CL0A 1KNRA 2R0GA 3SFDA 4J57A 4H4SA 4E8GA 3R25A 2O56A 2EQ7A 1E1KA 4X2PA 3BSMA 1ONFA 3T4WA 1PBDA 2C67A 1YY5A 2XGZA 2XVFA 3P93A 1FIQB 1ELIA 1REOA 1FFUC 3SN4A 4H4XA 1OEPA 4JY3A 3GYJA 2P0IA 3CYJA 1GTHA 5IQ1A 4ZOHB 2OZ8A 3AE6A 3LOVA 3AE2A 2BC1A 1XPQA 3I6EA 4HN8A 4ECHA 5BOFA 3AECA 1GRHA 3JZUA 4BJYA 3CGCA 3UOVA 4K8DA 2PODA 1EBGA 4HNLA 4EIPA 4U8KA 2XH7A 3V5CA 3IC9A 4OVIA 2PGEA 3QJ4A 3P1WA 4F4RA 4A5LA 2YG3A 2CVJA 4B68A 4YTMA 3P0WA 1CHUA 5BUKA 3NH3X 3NTAA 4K5RA 3GWDA 1BKWA 3DGZA 3UKAA 1IJHA 4BV6A 4PAAA 1EL9A 3ETRB 2C76A 4P9SA 1N5XA 1NHPA 4J1OA 3SYIA 4H19A 5FJUA 1UKVG 3SZFA 1DTNA 2YLTA 1PXAA 4YTPA 4Y4NA 3SQSA 4H4VA 5C3JA 3ES7A 3SN0A 3B3RA 1GRBA 3IJIA 5FS7A 3IHGA 4G8TA 3QKEA 3ALMA 4U8OA 4RG4A 4ROPA 1Y56A 3ZLHA 3RGTA 1P2EA 1PJ7A 2R4EA 2DW7A 1TZZA 2VRMA 3LB8A 3R9UA 3QN3A 4YSHA 1GNDA 3P4PA 3DG3A 3QPEA 3T6CA 3LZWA 2Q7VA 2C64A 4GFIA 4A35A 4ZN0A 4FX9A 3UJ2A 3DJGX 1S2YA 3HPFA 4K2XA 1PN0A 3ITJA 3OZ2A 3P9UA 2GH5A 4J31A 4JN9A 4FDCB 3KPKA 3KLJA 1JRYA 2PS2A 1P48A 3EPTA 1O95A 4LIIA 2MNRA 2B76A 2YLSA 3T8QA 3UTEA 2GMHA 2XFPA 2PMQA 5FJRA 4YKFA 3UTHA 4TVWA 3SXIA 3NYEA 3AE5A 4I58A 3STPA 3TJ4A 2ZZ0A 1AOGA 3H8IA 2VOUA 2Q0LA 4KEMA 2ZZBA 3V3OA 2RGOA 2YLZA 4Z25A 1ZMDA 1GREA 2I5QA 3OPSA 2C70A 5J7XA 5FJOA 2NVKX 3H12A 4TVYA 4GYPC 5G5HB 5KRQA 2CHRA 3LZXA 4G7FA 3FCPA 2AR8A 2JKCA 3IF9A 3DG7A 3VR8A 4HCLA 1R0MA 4EMIA 3CNSA 4HCDA 2BK4A 1NELA 4FK1A 3MQTA 3HZLA 3NVWB 3UJSA 3MWCA 2Y6RA 1GV4A 5DBJA 3PWGA 4ZCWA 3ATQA 1NPXA 2YG6A 1D4EA 5KMRA 2BRAA 3IJQA 2WPEA 2YM1A 1PBCA 1XHCA 3HYWA 3NS1B 3GYIA 5HXIA 4K5SA 3VR9A 2JB1A 3SSZA 4Z1YA 4YT0A 1ZDLA 3BHKA 3CGBA 1H7XA 1GT8A 5FJPA 3TW9A 2GF3A 1MDLA 3T2YA 2FBWA 1KFYA 2WU5A 4GUVA 2BCPA 1P2HA 3T2ZA 4B69A 2B7SA 4A6GA 1PJ6A 5GRTA 3S61A 3PK7A 2YLXA 1IUWA 4GAVA 5FS6A 5JCNA 2CFYA 4DYEA 2BACA 1JRXA 4EM4A 2W3RA 4Z44A 5J04A 3GC2A 3LJPA 2FKPA 3OZMA 3A7UA 1GESA 3RITA 2XCGA 4G73A 3SJNA 1NENA 1BKHA 5IPYA 3AE8A 3SM8A 3EUB3 2QAEA 3N6HA 4H4UA 2R0CA 3KKJA 1TDFA 4H4PA 4BJZA 1H86A 2HXUA 3AE1A 3AN1A 5ER0A 3DGBA 3E1TA 1N4VA 3SQPA 1OJDA 1NHRA 4AT0A 2GDQA 3DG6A 3QFAA 1PHHA 3A7RA 2TMDA 3H70A 3FIMB 4OPIA 3AD9B 3GSIA 4GMEA 2RGJA 2YG7A 5KNLA 4UDRA 2XFOA 5BRTA 1RVKA 2V60A 5JCLA 1SEZA 4X9NA 3MKCA 4H7UA 5BOEA 4GF7A 2WQYA 1KN0A 1D7YA 1ZX9A 4B65A 4UDQA 4GGHA 2XFQA 4IVMB 1D7LA 2WHDA 2OVLA 3AYIA 2GRTA 4OPLA 1PDHA 4KX6A 1V97A 5EBKA 3K7QX 3AB1A 2P8CA 2GGJA 4H2QA 4YWOA 1FECA 2AKZA 1TE6A 2GR2A 3C4AA 1SJCA 3VDGA 2BRYA 1D5TA 1IUUA 3ENLA 3DJDA 1JPDX 2GV8A 1FHVA 4OCGA 4ENLA 1RYIA 2WPFA 4HNCA 3FYYA 2QDEA 4G6GA 4BK3A 2RABA 4HB9A 2PTYA 3VCNA 3ZLGA 1OJ9A 3G5SA 1VG9A 4DX3A 4DGKA 2I0ZA 3MZNA 2C73A 1H7WA 4A99A 2BS2A 4Z2UA 2C3CA 5M10A 3AEGA 2Z5YA 1PXBA 2GR3A 4JQ9A 1PXCA 5EB4A 3FJ4A 4DWDA 3HYXA 3DJJA 2J3NA 4JDRA 2GB0A 4YTNA 4JN8A 3GO2A 1STZA 3F8DA 3CB3A 3MSYA 1YKJA 2C7GA 3P3BA 3ZYXA 3II4A 3NK2X 1DOEA 1NG4A 1LVLA 3F8RA 2XH0A 4TLXA 1GERA 3AD7B 4YXDA 4K1WA 4HCHA 2R46A 2WU2A 2WDVA 2R0PA 2WP5A 5TR3A 2XVHA 4GIRA 1E6EA 1KD0A 3UCLA 2WOWA 3K30A 3SGLA 1ECQA 3NVVB 2ONEA 1JNRA 5JRBA 1FEAA 4CY6A 1WUEA 1QJDA 4H2PA 2OLOA 4B1BA 2OQYA 2W55A 1FO4A 2DKIA 3VA8A 3NXLA 2UZZA 1L8PA 4U2SA 3ICSA 4II3A 3EF6A 4IL2A 3PWIA 3R0UA 1CC2A 4GISA 3VCCA 1KCZA 1E39A 1R6WA 1KKOA 1ZOVA 3M13A 3ZVIA 2BCGG 2CDUA 3I4KA 2QQ6A 4JN7A 1Q1WA 1PJ5A 1RP0A 2XVEA 4A6NB 1ZP0A 2OPJA 3V3WA 2IIDA 1W4XA 3R07C 1LPFA 4CBQA 2WEUA 2V61A 2C75A 5KOXA 2QJJA 4NTEA 2AAQA 4AP3A 5J60A 2F5ZA 3FVDA 2GQWA 2WESA 3GDPA 3TQPA 3CK5A 4HYRA 3IJLA 3NN0X 1XS2A 2C3DA 2B9WA 3IHMA 4DNAA 2YR5A 3R1ZA 1PS9A 3GMBA 5KMPA 3V3NA 2FYMA 4DSHA 3QFBA 4NZHA 2FJEA 3R10A 2XVJA 2OFJA 4MMWA 2ZC8A 3B97A 1JDFA 1JCTA 2YVFA 2B7RA 4E4UA 3V4BA 3VC6A 3AD8B 3GD3A 4GR1A 1GOSA 3NVZB 1GRTA 4NWZA 1CC4A 4KPRA 3ABVA 2V3BA 2QA2A 2XLTA 3CNPA 1W6TA 1JPMA 4Z2TA 2GR0A 2H88A 2EQ9A 3QLDA 2YM2A 4PABA 3ATRA 3NFUA 3TWAA 5KWFA 4H83A 4E0VA 1VG0A 3DJEA 3ICTA 1PBFA 4HA6A 2WP6A 3Q6JA 2EQ8A 3DESA 3NGCX 3REDA 1E1NA 1MXTA 4GAPA 1TDOA 1O94A 1EBHA 2O9ZA 2GGEA 2GR1A 3VQRA 4B67A 2AL2A 3KVEA 4M6UA 3OW1A 3DGHA 2PGWA 2YAUA 3RP6A 2WPCA 1RSGA 1F8RA 1LV0A 2PCEA 2E5VA 3PFRA 2YQUA 2PYXA 3FMWA 2BK3A 3K1GA 1MO9A 1H83A 2GAHB 3I3LA 4MGGA 3A7AA 4YKGA 1N63C 4X9MA 3P4QA 2XYOA 3S5SA 3UKFA 1F6MA 4GGBA 1L9DA 3QSSA 2BS3A 2QJNA 3UKKA 3BI2A 3CTYA 1YQ3A 3JW7A 2XDOA 3CPIG 3R11A 3BHFA 2PTZA 4C5OA 2H89A 2W54A 3H4KA 1ZMCA 2VQBA 2XFNA 4CNJA 3RHAA 3SZWA 4GDPA 3DERA 3BNUA 3CNJA 5U63A 4KWSA 1LJ1A 3SN1A 3VC5A 7ENLA 3CT2A 3CGEA 4LA1A 3WE0A 4U2LA 3L5OA 4XWRA 3QSEA 4K22A 1Y0PA 1K0IA 3NT6A 1SJDA 3FG2P 3Q4DA 1NG3A 3UOYA 4IP4A 4EMWA 2QVHA 3KU9A 2A8XA 1KNPA 3UXLA 3UCDA 5BVAA 1KSUA 3BJSA 4UDPA 2XLSA 3AE4A 1TRBA 3CAWA 3TOYA 3C4NA 2Q0KA 4YSZA 4APNA 1ZKQA 3EEZA 3RR1A 3VRBA 1GETA 3S47A 3NKSA 2GL5A 2C65A 1CJ4A 3D8XA 3RP8A 1NU5A 1MDRA 2YLRA 2HQMA 2BYBA 4IP5A 3TCSA 4TM3A 1IUVA 5ENLA 3UJEA 1JOAA 1LQUA 3MY9A 1DXLA 1OJCA 2XLRA 4JHMA 5L46A 4TLZA 2WBAA 2Z5XA 1EC7A 2E3TA 1JROA 4CRTA 3BOXA 1N5WC 4Y4LA 2EQ6A 4C77A 1FOHA 2FJBA 3OTRA 1Y56B 1P43A 3AE7A 3T9PA 2BXSA 3JSKA 3SY4A 4N9XA 1K4QA 3B9JB 2BA9A 4M52A 2NPXA 3CXBA 1IUSA 3NRNA 4A9WA 1FCDA 3ZVHB 4IA5A 4U8PA 1H2IA 2OALA 1BGJA 4U8NA 1K0JA 2YWLA 2R4JA 4AT2A 2JB3A 4EQXA 4REKA 3F8PA 2GMJA 5JCMA 4J56A 3LADA 2YR6A 2CULA 4EQWA 2BC0A 3NK1X 5U1OA 4YWSA 1N4WA 3OC4A 3P4RA 3K7TA 3GD6A 3SFEA 2OA1A 1YQZA 4EIQA 3V5FA 3U4FA 1H84A 3VRDB 3AWIA 1S3EA 3AMZA 3H7VA 2RDXA 1CJCA 4TM0A 4A79A 1GSNA 3DH9A 4IL0A 2X3NA 2BS4A 3UKLA 1VRQB 3DK9A 3UOZA 1LTXR 2PP3A 1CBOA 3UXKA 1Z6LA 3FV9A 4U8JA 3ALJA 2PP0A 2QDDA 3AEBA 4USQA 1TYPA 2V3AA 1KF6A 5HY5A 3N4EA 3OZYA 3JVAA 4DHGA 2PU1A 3CGDA 2RGHA 1H82A 4XWZA 3EKGA 4CCQA 3TJIA 2VZ2A 2OQHA 2JBVA 3D47A 3D46A 1SB3B 3ISHA 2GAGB 1WYGA 2AKMA 1JU2A 2WP9A 3VFCA 2C4CA 4JNAA 1Q1RA 2VRLA 2C72A 3RO6A 2QGYA 3QTPA 3GWFA 4OPDA 1L0VA 3CXOA 1QLBA 5HYMA 4Z43A 4OPTA 2YVJA 1GRGA 3UKPA 1EC8A 3K7MX 4CY8A 3D9XA 4B63A 5BULA 4H2RA 1K0LA 3LXDA 4D03A 1CJ3A 4ZA0A 4J34A 1VDVA 3NG7X 6ENLA 3UKHA 3CNDA 3D1CA 4ZCDA 3UTGA 2P8BA 3HRDC 4I59A 2ZBWA 3TWBA 4K7ZA 2ACZA 2FJDA 3BI4A 5JCIA 3CIRA 2VVLG 4FP1A 3AEDA 4AOXA 4J2WA 1QO8A 3H8AA 1NAAA 3RCYA 4WX1A 1NDAA 4LU6A 1T3QC 2GGIA 4KPLA 4JNQA 1IUTA 2HXTA 3I6TA 2OAMA 4IA6A 3GRTA 1PDZA 1EL8A 2C66A 3KA7A 2WETA 3B6DA 2PU0A 2OO6A 2XSXA 2XLUA 4WCTA 5LV9A 2V5ZA 4EQSA 4X4JA 2PSNA 1KSSA 2POZA 3NRZB 1DJNA 2XH2A 3I6DA 3ALLA 3L8KA 1F9CA 4BK2A 4IVOB 1Q9IA 1TDNA 2X50A 2HZGA 4IV9A 1TKKA 3BNMA 3ES8A 4A7AA 4EM3A 3QVRA 4A65A 2E5AA 5KVHA 4Z2RA 1VDCA 1ONEA 2DW6A 3NO1A 3COXA 3OP2A 1MNSA 1SJAA 4U8MA 3HW2A 1GXFA 2OZTA 5KOWA 3UJFA 3Q9TA 2OKTA 1MOKA 4GDEA 4IHCA 1IYXA 2VVLA 1X2HA 1VQZA 1YEYA 2A89A 2AQJA 1N1PA 3KD9A 2WDQA 4TM4A 5KMQA 3NLCA 1BGNA 3MUCA 2P3ZA 3NHOX 3DA1A 3M0OA 2QCUA 4UP3A 1NEKA 2E4GA 3UCCA 1DOBA 2PTWA 2YLWA 1TYTA 1COYA 2YG4A 3C96A 4GCMA 3P4SA 2R45A 3CN8A 2IVDA 1KDGA 1GALA 3EANA 5KMSA 1MRAA 3FBSA 3UGVA 4B66A 2XH4A 2GSHA 1DODA 4H2NA 2Y6QA 3FXGA 4KT2A 3FPZA 3GMCA 1YQ4A 4CNKA 2YR4A 1PBBA 2WOVA 1N62C 5FS9A 3TTEA 2B9YA 3PG6A 2WS3A 3VRAA 3NIXA 5KVIA 2B9XA 3SZCA 4OPCA 4BK1A 4Y4MA 5EOWA 5CQFA 1X2GA
chains in the Genus database with same CATH topology
2GV8A 1E1MA 1IUVA 1REOA 4TM3A 1JOAA 4OCGA 4H4XA 1LQUA 4JY3A 1M64A 3GYJA 1RYIA 2WPFA 1DXLA 4H4RA 1BWCA 1OJCA 3RNMA 2XLRA 4H4TA 2IVEA 4G6GA 5L46A 4TLZA 2DKHA 2WBAA 1EL5A 2Z5XA 1GTHA 5IQ1A 4BK3A 5C2TA 3AE6A 2RABA 3LOVA 5JCKA 3QSMA 4HB9A 1OJTA 3AE2A 2BC1A 4NTDA 1L9EA 4CRTA 1XPQA 1OJ9A 1EBDA 3G5SA 2XLPA 4Z26A 4ECHA 3AECA 1VG9A 4Y4LA 2EQ6A 4DGKA 2I0ZA 1GRHA 4C77A 1FOHA 2FJBA 2C73A 4BJYA 3CGCA 4U8IA 3UOVA 1H7WA 4K8DA 4A99A 1Y56B 2BS2A 4Z2UA 2C3CA 4EIPA 4U8KA 3AEGA 5M10A 2Z5YA 1PXBA 3T14A 3AE7A 3NK0X 2GR3A 4JQ9A 3IC9A 1PXCA 2BXSA 3JSKA 4OVIA 5EB4A 3SY4A 3HYXA 4N9XA 1K4QA 3DJJA 2J3NA 1JEHA 2A87A 4JDRA 2BA9A 3QJ4A 2GB0A 4YTNA 1GTEA 4M52A 3F8DA 1ZK7A 3P1WA 5EB5A 2NPXA 1IUSA 1B37A 3AEAA 3NRNA 2JB2A 4A5LA 2YG3A 2CVJA 1YKJA 4B68A 4O5QA 4A9WA 5U25A 2YVGA 2C7GA 3PS9A 4J33A 3UTFA 1FCDA 3ZYXA 3II4A 4YTMA 4IA5A 4D04A 1CHUA 3NK2X 2GVCA 5BUKA 1E1LA 3NH3X 3NTAA 1DOEA 4ICYA 1H81A 4FK1C 1NG4A 1LVLA 3F8RA 4U8PA 4NTCA 1H2IA 4K5RA 1GERA 3AD7B 4TLXA 4AOSA 4YXDA 3GWDA 2OALA 1BKWA 1BGJA 3DGZA 4U8NA 1K0JA 2YWLA 2R46A 3UKAA 2R4JA 2WU2A 4AT2A 2JB3A 4EQXA 1IJHA 4BV6A 4PAAA 3F8PA 2GMJA 5FS8A 4REKA 1S2QA 2WDVA 1GRFA 1EL9A 2R9ZA 3O0HA 2R0PA 5JCMA 2WP5A 5TR3A 4J56A 2XVHA 3LADA 2C76A 4P9SA 2YR6A 3QVPA 2CULA 1EL7A 3GD4A 1E6EA 3H8LA 1NHPA 4EQWA 3UCLA 5KXJA 3SYIA 2BC0A 3NK1X 2WOWA 3K30A 4GRTA 5U1OA 1UKVG 3SGLA 3SZFA 4G74A 1JNRA 1N4WA 3OC4A 1FEAA 5JRBA 4CY6A 3P4RA 4XXGA 1GRAA 3G5RA 2YLTA 2W0HA 1CC6A 3K7TA 2ZZCA 3SFEA 2OA1A 1D4CA 1PXAA 4YTPA 1IUXA 1QJDA 1YQZA 4Y4NA 4EIQA 2E1MA 4H4VA 4H2PA 2OLOA 5C3JA 4B1BA 3AE9A 3IWAA 1H84A 2DKIA 3B3RA 1B5QA 2JK6A 3VRDB 3DK8A 1GEUA 3AWIA 3T0KA 2ARDA 1GRBA 2UZZA 1S3EA 4U2SA 3T37A 5FS7A 2FJAA 3IHGA 3ICSA 4II3A 3EF6A 3G5QA 1CC2A 3ALMA 4U8OA 1CJCA 2V6OA 1E39A 4RG4A 3S5WA 4TM0A 1X31B 1ZOVA 1Y56A 5HHFA 3M13A 4A79A 3UKQA 1GSNA 4JY2A 2BCGG 3DH9A 4YSYA 1P2EA 2X3NA 2CDUA 3V76A 1PJ7A 2R4EA 2BS4A 2Q6UA 3UKLA 1Q1WA 1PJ5A 2APGA 1S3BA 3DK9A 1NHSA 1VRQB 3LB8A 1LTXR 2VRMA 3R9UA 1RP0A 2GQFA 2XVEA 3UOZA 4A6NB 1ZP0A 1CBOA 4DSGA 4YSHA 1GNDA 2IIDA 1W4XA 3P4PA 4B64A 2VVMA 3LZWA 1Z6LA 1LPFA 2C64A 2Q7VA 4U8JA 4CBQA 2BK5A 4ZN0A 1BF3A 2V61A 2WEUA 2C75A 4II2A 4FX9A 5KOXA 3DJGX 1S2YA 1DJQA 3UOXA 4NTEA 4K2XA 3NTDA 1PN0A 3ALJA 2AAQA 3ITJA 3GDNA 3OZ2A 3P9UA 4AP3A 5J60A 2GH5A 3AEBA 4J31A 3DMEA 4JN9A 4FDCB 2F5ZA 4ADWA 4USQA 1TYPA 2GQWA 2WESA 1HYUA 3GDPA 3KPKA 3KLJA 1JRYA 2V3AA 3EPTA 1O95A 4LIIA 1KF6A 5HY5A 2B76A 3DK4A 1JNZA 3NN0X 3PO7A 1FL2A 2C3DA 2YLSA 2B9WA 3AXBA 3IHMA 4DNAA 3M12A 1NHQA 3UTEA 2YR5A 4U2TA 3ICRA 1PS9A 1F3PA 3CGDA 2GMHA 2RGHA 1H82A 4XWZA 3GMBA 2XFPA 4H4WA 5KMPA 2XFUA 3CPJG 2BXRA 4CCQA 3V3NA 4YKFA 2VZ2A 1M6IA 3UTHA 2X8CA 3SX6A 4DSHA 1DOCA 3AEEA 2JBVA 3RP7A 3SXIA 3NYEA 3AE5A 3QFBA 4I58A 3ISHA 2GAGB 4NZHA 5HXIA 2ZZ0A 3NN6X 1AOGA 3H8IA 2VOUA 1H6VA 2Q0LA 2FJEA 1JU2A 2PHHA 2XVJA 2ZZBA 2WP9A 2C4CA 4JNAA 2YG5A 3V3OA 2RGOA 2YLZA 1TDEA 2GEWA 4Z25A 1Q1RA 1CF3A 2VRLA 1ZMDA 2C72A 4G6HA 3AE3A 2YVFA 1GREA 2C70A 3GWFA 4OPDA 1L0VA 2B7RA 4H4ZA 1QLBA 3UP4A 5HYMA 5J7XA 2NVKX 4G9KA 2JAEA 4OPTA 2YVJA 4OPUA 1GRGA 3UKPA 4Z43A 2XVIA 1ZOYA 3AD8B 3GD3A 3K7MX 4CY8A 4GR1A 1GOSA 3D9XA 5KRQA 4B63A 1GRTA 5BULA 3LZXA 4ZCCA 4H2RA 4NWZA 1K0LA 4EQRA 1CC4A 4KPRA 3LXDA 2AR8A 2JKCA 4EMJA 3ABVA 3IF9A 1CJ3A 4MJWA 2V3BA 4J34A 4D03A 2X8GA 3NG7X 2QA2A 2XLTA 3VR8A 4H4YA 3UKHA 3CNPA 3CNDA 4EMIA 3D1CA 4U8LA 4ZCDA 3UTGA 3CNSA 4TM1A 4Z2TA 4I59A 2GR0A 2ZBWA 4A6NA 2H88A 4K7ZA 2BK4A 2ACZA 2EQ9A 2FJDA 1OJAA 5IQ4A 3L1RA 2YM2A 3CNTA 4PABA 4FK1A 3BI4A 5JCIA 3CIRA 2VVLG 3HZLA 3ATRA 3AEDA 4AOXA 2Y6RA 4J2WA 1GV4A 1QO8A 5DBJA 1NAAA 5KWFA 4E0VA 3ATQA 4WX1A 1NPXA 1VG0A 1FEBA 3DJEA 2YG6A 1NDAA 4LU6A 1D4EA 5KMRA 3ICTA 3EAOA 1PBFA 4HA6A 2WP6A 3Q6JA 2EQ8A 3NGCX 3REDA 1E1NA 2BRAA 4JNQA 1IUTA 1TDKA 2WPEA 1MXTA 1PBCA 1XHCA 2YM1A 4GAPA 1B8SA 4RSLA 3HYWA 2OLNA 2OAMA 5FMHA 1O94A 1TDOA 2O9ZA 3GYIA 1B4VA 2GR1A 3GRTA 4IA6A 4K5SA 3VQRA 3VR9A 4B67A 2JB1A 3KVEA 1EL8A 2C66A 3NYCA 3KA7A 2WETA 3DGHA 3B6DA 4YT0A 5CKUA 1ZDLA 2YAUA 3BHKA 3RP6A 2XLUA 3CGBA 3AEFA 1H7XA 2WPCA 1RSGA 4WCTA 1GT8A 5LV9A 2V5ZA 3CMMA 1F8RA 3HYVA 1LV0A 2VQ7A 4EQSA 4X4JA 1KSSA 2E5VA 1LQTA 2GF3A 2YQUA 1F8SA 2FBWA 1KFYA 3T2YA 2PYXA 1BZLA 1DJNA 2WU5A 3FMWA 4O5UA 4GUVA 3I6DA 3ALLA 2BCPA 1P2HA 3SZ0A 3T2ZA 4B69A 2BK3A 2BABA 2B7SA 3UP5A 3T2KA 3L8KA 1MO9A 4RG3A 4BK2A 2X99A 4IVOB 1H83A 1PJ6A 1Q9IA 3NYFA 5GRTA 1E7PA 3S61A 4NNJA 2GAHB 4C74A 2YLXA 1IUWA 3I3LA 4NEWA 1TDNA 2X50A 4H50A 4YKGA 4GAVA 1O5WA 5FS6A 5JCNA 2CFYA 4IV9A 4X9MA 3P4QA 2BACA 2XYOA 3BNMA 1JRXA 4EM4A 4A7AA 2WDRA 4H4QA 3UKFA 1L9CA 4EM3A 1F6MA 1L9DA 3ADAB 3QSSA 3QVRA 4Z44A 4A65A 2BS3A 3T31A 3UKKA 5KVHA 3BI2A 3LJPA 3CTYA 4Z2RA 1F8WA 1VDCA 1VQWA 1YQ3A 4Z24A 5M0ZA 2XDOA 1GESA 3CPIG 3BHFA 1PBEA 2XCGA 4G73A 3COXA 4USRA 1NENA 4C5OA 2H89A 5IPYA 3AE8A 3SM8A 3H4KA 2QAEA 1ZMCA 4H4UA 1JRZA 2R0CA 2VQBA 3KKJA 4U8MA 5GSNA 4C3XA 1TDFA 2XFNA 1GXFA 4H4PA 3PVCA 4BJZA 3RHAA 4CNJA 3SZWA 3NNEA 5KOWA 4GDPA 1H86A 3AE1A 4BURA 3BNUA 3Q9TA 5ER0A 2X8HA 1MOKA 2QA1A 2WOIA 4GDEA 3E1TA 3GRSA 1N4VA 3CPHG 3CNJA 2VVLA 3GYXA 3SQPA 5U63A 1OJDA 1V59A 1NHRA 1DNCA 1LJ1A 4AT0A 2A89A 3QFAA 1ZY8A 1PHHA 1XANA 4OPGA 2TMDA 3CGEA 4LA1A 3FIMB 2AQJA 1N1PA 3AYJA 1XDIA 4OPIA 3WE0A 3KD9A 4C3YA 4YSXA 3ZDNA 2WDQA 4U2LA 4TM4A 5KMQA 1CJ2A 3AD9B 3KPFA 3L5OA 4XWRA 3NLCA 3QSEA 1BGNA 3URHA 3GSIA 2TPRA 3AYLA 1N4UA 3NHOX 4K22A 3BI5A 1Y0PA 3DA1A 3M0OA 4J36A 2RGJA 1GPEA 4AP1A 2YG7A 1K0IA 3NT6A 5KNLA 1S7MA 2QCUA 2XFOA 4UDRA 3FG2P 5BRTA 2V60A 4UP3A 5JCLA 1NEKA 2E4GA 4NEVA 1SEZA 4X9NA 1DOBA 1NG3A 2YLWA 1TYTA 1COYA 3UOYA 1D4DA 4EMWA 2YG4A 3C96A 4GCMA 3P4SA 4H7UA 2R45A 3CN8A 4GF7A 4CCRA 3KU9A 1CL0A 2WQYA 1KN0A 1D7YA 1ZX9A 2A8XA 1KNPA 2IVDA 1KDGA 1KNRA 2R0GA 1GALA 3EANA 5KMSA 3SFDA 4B65A 4UDQA 4J57A 4H4SA 2XFQA 5BVAA 4IVMB 1D7LA 3FBSA 1KSUA 4B66A 2WHDA 4UDPA 1DODA 3AYIA 2GRTA 4H2NA 2XLSA 4OPLA 2Y6QA 1PDHA 3AE4A 2EQ7A 1TRBA 3C4NA 1E1KA 3FPZA 4KX6A 3GMCA 2Q0KA 5EBKA 1YQ4A 4CNKA 2YR4A 4YSZA 4APNA 1PBBA 3K7QX 1ONFA 1ZKQA 3VRBA 2WOVA 3AB1A 1GETA 5FS9A 1PBDA 2C65A 2B9YA 2C67A 3NKSA 4H2QA 3PG6A 1FECA 4YWOA 1CJ4A 2WS3A 3D8XA 3VRAA 3NIXA 5KVIA 3RP8A 2GR2A 1YY5A 3C4AA 2BRYA 2YLRA 1D5TA 1IUUA 2B9XA 2HQMA 2BYBA 3DJDA 3SZCA 2XVFA 4OPCA 4BK1A 4Y4MA 5EOWA 1ELIA 5CQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GV8 A;  1E1M A;  1IUV A;  1REO A;  4TM3 A;  1JOA A;  4OCG A;  4H4X A;  1LQU A;  4JY3 A;  1M64 A;  3GYJ A;  1RYI A;  2WPF A;  1DXL A;  4H4R A;  1BWC A;  1OJC A;  3RNM A;  2XLR A;  4H4T A;  2IVE A;  5L46 A;  4TLZ A;  2DKH A;  2WBA A;  1EL5 A;  2Z5X A;  1GTH A;  5IQ1 A;  4BK3 A;  5C2T A;  3AE6 A;  2RAB A;  3LOV A;  5JCK A;  3QSM A;  4HB9 A;  1OJT A;  3AE2 A;  2BC1 A;  4NTD A;  1L9E A;  4CRT A;  1XPQ A;  1OJ9 A;  1EBD A;  3G5S A;  2XLP A;  4Z26 A;  4ECH A;  3AEC A;  1VG9 A;  4Y4L A;  2EQ6 A;  4DGK A;  2I0Z A;  1GRH A;  4C77 A;  1FOH A;  2FJB A;  2C73 A;  4BJY A;  3CGC A;  4U8I A;  3UOV A;  1H7W A;  4K8D A;  4A99 A;  1Y56 B;  2BS2 A;  4Z2U A;  2C3C A;  4EIP A;  4U8K A;  3AEG A;  5M10 A;  2Z5Y A;  1PXB A;  3AE7 A;  3NK0 X;  2GR3 A;  4JQ9 A;  3IC9 A;  1PXC A;  2BXS A;  3JSK A;  4OVI A;  5EB4 A;  4N9X A;  1K4Q A;  3DJJ A;  2J3N A;  1JEH A;  2A87 A;  4JDR A;  2BA9 A;  3QJ4 A;  2GB0 A;  4YTN A;  1GTE A;  4M52 A;  3F8D A;  1ZK7 A;  3P1W A;  5EB5 A;  2NPX A;  1IUS A;  1B37 A;  3AEA A;  3NRN A;  2JB2 A;  4A5L A;  2YG3 A;  2CVJ A;  1YKJ A;  4B68 A;  4O5Q A;  4A9W A;  5U25 A;  2YVG A;  2C7G A;  3PS9 A;  4J33 A;  3UTF A;  1FCD A;  3ZYX A;  3II4 A;  4YTM A;  4IA5 A;  4D04 A;  1CHU A;  3NK2 X;  2GVC A;  5BUK A;  1E1L A;  3NH3 X;  3NTA A;  1DOE A;  4ICY A;  1H81 A;  4FK1 C;  1NG4 A;  1LVL A;  3F8R A;  4U8P A;  4NTC A;  4K5R A;  4TLX A;  1GER A;  3AD7 B;  4AOS A;  4YXD A;  3GWD A;  2OAL A;  1BKW A;  1BGJ A;  3DGZ A;  4U8N A;  1K0J A;  2YWL A;  2R46 A;  3UKA A;  2R4J A;  2WU2 A;  4AT2 A;  2JB3 A;  4EQX A;  1IJH A;  4BV6 A;  4PAA A;  3F8P A;  2GMJ A;  5FS8 A;  4REK A;  1S2Q A;  2WDV A;  1GRF A;  1EL9 A;  2R9Z A;  3O0H A;  2R0P A;  5JCM A;  2WP5 A;  5TR3 A;  4J56 A;  2XVH A;  3LAD A;  2C76 A;  4P9S A;  2YR6 A;  3QVP A;  2CUL A;  1EL7 A;  3GD4 A;  1E6E A;  3H8L A;  1NHP A;  4EQW A;  3UCL A;  5KXJ A;  2BC0 A;  3NK1 X;  2WOW A;  3K30 A;  4GRT A;  5U1O A;  1UKV G;  3SGL A;  1JNR A;  1N4W A;  3OC4 A;  1FEA A;  4CY6 A;  3P4R A;  4XXG A;  1GRA A;  3G5R A;  2YLT A;  2W0H A;  1CC6 A;  3K7T A;  2ZZC A;  3SFE A;  2OA1 A;  1D4C A;  1PXA A;  4YTP A;  1IUX A;  1QJD A;  1YQZ A;  4Y4N A;  4EIQ A;  2E1M A;  4H4V A;  4H2P A;  2OLO A;  5C3J A;  4B1B A;  3AE9 A;  3IWA A;  1H84 A;  2DKI A;  3B3R A;  1B5Q A;  2JK6 A;  3VRD B;  3DK8 A;  1GEU A;  3AWI A;  2ARD A;  1GRB A;  2UZZ A;  1S3E A;  4U2S A;  3T37 A;  5FS7 A;  2FJA A;  3IHG A;  3ICS A;  3EF6 A;  3G5Q A;  1CC2 A;  3ALM A;  4U8O A;  1CJC A;  2V6O A;  1E39 A;  4RG4 A;  3S5W A;  4TM0 A;  1X31 B;  1ZOV A;  1Y56 A;  5HHF A;  3M13 A;  4A79 A;  3UKQ A;  1GSN A;  4JY2 A;  2BCG G;  3DH9 A;  4YSY A;  1P2E A;  2X3N A;  2CDU A;  3V76 A;  1PJ7 A;  2R4E A;  2BS4 A;  2Q6U A;  3UKL A;  1Q1W A;  1PJ5 A;  2APG A;  1S3B A;  3DK9 A;  1NHS A;  1VRQ B;  3LB8 A;  1LTX R;  2VRM A;  3R9U A;  1RP0 A;  2GQF A;  2XVE A;  3UOZ A;  4A6N B;  1ZP0 A;  1CBO A;  4DSG A;  4YSH A;  1GND A;  2IID A;  1W4X A;  3P4P A;  4B64 A;  2VVM A;  3LZW A;  1Z6L A;  1LPF A;  2C64 A;  2Q7V A;  4U8J A;  4CBQ A;  2BK5 A;  4ZN0 A;  1BF3 A;  2V61 A;  2WEU A;  2C75 A;  4FX9 A;  5KOX A;  3DJG X;  1S2Y A;  1DJQ A;  3UOX A;  4NTE A;  4K2X A;  3NTD A;  1PN0 A;  3ALJ A;  2AAQ A;  3ITJ A;  3GDN A;  3OZ2 A;  3P9U A;  4AP3 A;  5J60 A;  2GH5 A;  3AEB A;  4J31 A;  3DME A;  4JN9 A;  4FDC B;  2F5Z A;  4ADW A;  4USQ A;  1TYP A;  2GQW A;  2WES A;  1HYU A;  3GDP A;  3KLJ A;  1JRY A;  2V3A A;  3EPT A;  1O95 A;  4LII A;  1KF6 A;  5HY5 A;  2B76 A;  3DK4 A;  1JNZ A;  3NN0 X;  3PO7 A;  1FL2 A;  2C3D A;  2YLS A;  2B9W A;  3AXB A;  3IHM A;  4DNA A;  3M12 A;  1NHQ A;  3UTE A;  2YR5 A;  4U2T A;  3ICR A;  1PS9 A;  1F3P A;  3CGD A;  2GMH A;  2RGH A;  1H82 A;  4XWZ A;  3GMB A;  2XFP A;  4H4W A;  2XFU A;  3CPJ G;  2BXR A;  4CCQ A;  3V3N A;  4YKF A;  2VZ2 A;  1M6I A;  3UTH A;  2X8C A;  4DSH A;  1DOC A;  3AEE A;  2JBV A;  3RP7 A;  3NYE A;  3AE5 A;  3QFB A;  4I58 A;  3ISH A;  2GAG B;  4NZH A;  5HXI A;  2ZZ0 A;  3NN6 X;  1AOG A;  3H8I A;  2VOU A;  1H6V A;  2Q0L A;  2FJE A;  1JU2 A;  2PHH A;  2XVJ A;  2ZZB A;  2WP9 A;  4JNA A;  2YG5 A;  3V3O A;  2RGO A;  2YLZ A;  1TDE A;  2GEW A;  4Z25 A;  1Q1R A;  1CF3 A;  2VRL A;  1ZMD A;  2C72 A;  3AE3 A;  2YVF A;  1GRE A;  2C70 A;  3GWF A;  4OPD A;  1L0V A;  2B7R A;  4H4Z A;  1QLB A;  3UP4 A;  5HYM A;  5J7X A;  2NVK X;  4Z43 A;  2JAE A;  4OPT A;  2YVJ A;  4OPU A;  1GRG A;  3UKP A;  2XVI A;  1ZOY A;  3AD8 B;  3GD3 A;  3K7M X;  4CY8 A;  4GR1 A;  1GOS A;  5KRQ A;  4B63 A;  1GRT A;  5BUL A;  3LZX A;  4ZCC A;  4H2R A;  1K0L A;  4EQR A;  1CC4 A;  4KPR A;  3LXD A;  2AR8 A;  2JKC A;  4EMJ A;  3ABV A;  3IF9 A;  1CJ3 A;  4MJW A;  2V3B A;  4J34 A;  4D03 A;  2X8G A;  3NG7 X;  2QA2 A;  2XLT A;  3VR8 A;  4H4Y A;  3UKH A;  3CNP A;  3CND A;  4EMI A;  3D1C A;  4U8L A;  4ZCD A;  3UTG A;  3CNS A;  4TM1 A;  4Z2T A;  4I59 A;  2GR0 A;  2ZBW A;  4A6N A;  2H88 A;  4K7Z A;  2BK4 A;  2ACZ A;  2EQ9 A;  2FJD A;  1OJA A;  5IQ4 A;  3L1R A;  2YM2 A;  3CNT A;  4PAB A;  4FK1 A;  3BI4 A;  5JCI A;  3CIR A;  2VVL G;  3HZL A;  3ATR A;  3AED A;  4AOX A;  2Y6R A;  4J2W A;  1GV4 A;  1QO8 A;  5DBJ A;  1NAA A;  5KWF A;  4E0V A;  3ATQ A;  4WX1 A;  1NPX A;  1VG0 A;  1FEB A;  3DJE A;  2YG6 A;  1NDA A;  4LU6 A;  1D4E A;  3ICT A;  3EAO A;  1PBF A;  4HA6 A;  2WP6 A;  3Q6J A;  2EQ8 A;  3NGC X;  3RED A;  1E1N A;  4JNQ A;  1IUT A;  1TDK A;  2WPE A;  1MXT A;  1PBC A;  1XHC A;  2YM1 A;  1B8S A;  4RSL A;  2OLN A;  2OAM A;  5FMH A;  1O94 A;  1TDO A;  2O9Z A;  3GYI A;  1B4V A;  2GR1 A;  3GRT A;  4IA6 A;  4K5S A;  3VQR A;  3VR9 A;  4B67 A;  2JB1 A;  3KVE A;  1EL8 A;  2C66 A;  3NYC A;  3KA7 A;  2WET A;  3DGH A;  3B6D A;  4YT0 A;  5CKU A;  1ZDL A;  2YAU A;  3BHK A;  3RP6 A;  2XLU A;  3CGB A;  3AEF A;  1H7X A;  2WPC A;  1RSG A;  4WCT A;  1GT8 A;  5LV9 A;  2V5Z A;  1F8R A;  1LV0 A;  2VQ7 A;  4EQS A;  4X4J A;  1KSS A;  2E5V A;  1LQT A;  2GF3 A;  2YQU A;  1F8S A;  2FBW A;  1KFY A;  2PYX A;  1BZL A;  1DJN A;  2WU5 A;  3FMW A;  4O5U A;  4GUV A;  3I6D A;  3ALL A;  2BCP A;  1P2H A;  4B69 A;  2BK3 A;  2BAB A;  2B7S A;  3UP5 A;  3L8K A;  1MO9 A;  4RG3 A;  4BK2 A;  2X99 A;  4IVO B;  1H83 A;  1PJ6 A;  1Q9I A;  3NYF A;  5GRT A;  1E7P A;  3S61 A;  2GAH B;  4C74 A;  2YLX A;  1IUW A;  3I3L A;  4NEW A;  1TDN A;  2X50 A;  4H50 A;  4YKG A;  1O5W A;  5FS6 A;  5JCN A;  2CFY A;  4IV9 A;  4X9M A;  3P4Q A;  2BAC A;  2XYO A;  3BNM A;  1JRX A;  4EM4 A;  4A7A A;  2WDR A;  4H4Q A;  3UKF A;  1L9C A;  4EM3 A;  1F6M A;  1L9D A;  3ADA B;  3QSS A;  3QVR A;  4Z44 A;  4A65 A;  2BS3 A;  3UKK A;  5KVH A;  3BI2 A;  3LJP A;  3CTY A;  4Z2R A;  1F8W A;  1VDC A;  1VQW A;  1YQ3 A;  4Z24 A;  5M0Z A;  2XDO A;  1GES A;  3CPI G;  3BHF A;  1PBE A;  2XCG A;  3COX A;  4USR A;  1NEN A;  4C5O A;  2H89 A;  5IPY A;  3AE8 A;  3SM8 A;  3H4K A;  2QAE A;  1ZMC A;  4H4U A;  1JRZ A;  2R0C A;  2VQB A;  3KKJ A;  4U8M A;  5GSN A;  4C3X A;  1TDF A;  2XFN A;  1GXF A;  4H4P A;  3PVC A;  4BJZ A;  3RHA A;  4CNJ A;  3NNE A;  5KOW A;  4GDP A;  1H86 A;  3AE1 A;  4BUR A;  3BNU A;  3Q9T A;  5ER0 A;  2X8H A;  1MOK A;  2QA1 A;  2WOI A;  4GDE A;  3E1T A;  3GRS A;  1N4V A;  3CPH G;  3CNJ A;  2VVL A;  3SQP A;  5U63 A;  1OJD A;  1V59 A;  1NHR A;  1DNC A;  1LJ1 A;  4AT0 A;  2A89 A;  3QFA A;  1ZY8 A;  1PHH A;  1XAN A;  4OPG A;  2TMD A;  3CGE A;  4LA1 A;  3FIM B;  2AQJ A;  1N1P A;  3AYJ A;  1XDI A;  4OPI A;  3WE0 A;  3KD9 A;  4C3Y A;  4YSX A;  3ZDN A;  2WDQ A;  4U2L A;  4TM4 A;  1CJ2 A;  3AD9 B;  3KPF A;  4XWR A;  3NLC A;  3QSE A;  1BGN A;  3URH A;  3GSI A;  2TPR A;  3AYL A;  1N4U A;  3NHO X;  4K22 A;  3BI5 A;  1Y0P A;  3DA1 A;  3M0O A;  4J36 A;  2RGJ A;  1GPE A;  4AP1 A;  2YG7 A;  1K0I A;  3NT6 A;  2QCU A;  2XFO A;  4UDR A;  3FG2 P;  5BRT A;  2V60 A;  4UP3 A;  5JCL A;  1NEK A;  2E4G A;  4NEV A;  1SEZ A;  4X9N A;  1DOB A;  1NG3 A;  2YLW A;  1TYT A;  1COY A;  3UOY A;  1D4D A;  4EMW A;  2YG4 A;  3C96 A;  4GCM A;  3P4S A;  4H7U A;  2R45 A;  3CN8 A;  4GF7 A;  4CCR A;  3KU9 A;  1CL0 A;  2WQY A;  1D7Y A;  1ZX9 A;  2A8X A;  1KNP A;  2IVD A;  1KDG A;  1KNR A;  2R0G A;  1GAL A;  3EAN A;  3SFD A;  4B65 A;  4UDQ A;  4J57 A;  4H4S A;  2XFQ A;  5BVA A;  4IVM B;  1D7L A;  3FBS A;  1KSU A;  4B66 A;  2WHD A;  4UDP A;  1DOD A;  3AYI A;  2GRT A;  4H2N A;  2XLS A;  4OPL A;  2Y6Q A;  1PDH A;  3AE4 A;  2EQ7 A;  1TRB A;  3C4N A;  1E1K A;  3FPZ A;  4KX6 A;  3GMC A;  2Q0K A;  5EBK A;  1YQ4 A;  4CNK A;  2YR4 A;  4YSZ A;  4APN A;  1PBB A;  3K7Q X;  1ONF A;  1ZKQ A;  3VRB A;  2WOV A;  3AB1 A;  1GET A;  5FS9 A;  1PBD A;  2C65 A;  2B9Y A;  2C67 A;  3NKS A;  4H2Q A;  4YWO A;  1FEC A;  1CJ4 A;  2WS3 A;  3D8X A;  3VRA A;  3NIX A;  5KVI A;  3RP8 A;  2GR2 A;  1YY5 A;  3C4A A;  2YLR A;  1D5T A;  1IUU A;  2B9X A;  2HQM A;  2BYB A;  3DJD A;  2XVF A;  4OPC A;  4BK1 A;  4Y4M A;  5EOW A;  1ELI A;  5CQF A; 
#chains in the Genus database with same CATH topology
 1E1M A;  1ZXI C;  1M64 A;  2OG9 A;  4H4R A;  1BWC A;  3RNM A;  4H4T A;  2IVE A;  2DKH A;  1EL5 A;  5C2T A;  5JCK A;  2MUC A;  3QSM A;  1OJT A;  3ZVH A;  4NTD A;  1L9E A;  1WUF A;  1EBD A;  2XLP A;  4Z26 A;  4U8I A;  3T14 A;  1N60 C;  3NK0 X;  3IK4 A;  4FI4 A;  2A87 A;  1JEH A;  1GTE A;  2GGH A;  1ZK7 A;  5EB5 A;  1B37 A;  3AEA A;  2JB2 A;  4O5Q A;  2ZAD A;  5U25 A;  2YVG A;  3PS9 A;  4IT1 A;  4J33 A;  3UTF A;  4D04 A;  2GVC A;  1E1L A;  3Q45 A;  4ICY A;  1H81 A;  4FK1 C;  4NTC A;  2OX4 A;  4AOS A;  3N4F A;  1SJB A;  5FS8 A;  1S2Q A;  1GRF A;  4J3Z A;  2R9Z A;  3O0H A;  5G5G B;  3QVP A;  1EL7 A;  3GD4 A;  3H8L A;  5KXJ A;  1MUC A;  3UJR A;  2GGG A;  2HNE A;  4GRT A;  4GYP A;  4G74 A;  1JRP A;  4XXG A;  1GRA A;  3G5R A;  2W0H A;  1CC6 A;  2ZZC A;  1D4C A;  1IUX A;  2E1M A;  3AE9 A;  3IWA A;  5FJT A;  3SR6 B;  1B5Q A;  2JK6 A;  3DK8 A;  1GEU A;  3T0K A;  2ARD A;  3T37 A;  2FJA A;  4H1Z A;  3G5Q A;  5EU9 A;  2V6O A;  4A3R A;  3S5W A;  1PDY A;  1X31 B;  5HHF A;  3UKQ A;  4JY2 A;  4YSY A;  3V76 A;  1KKR A;  4M0X A;  2Q6U A;  2APG A;  1S3B A;  1NHS A;  1FFV C;  1XPY A;  4Z17 A;  2GQF A;  4DSG A;  3DFY A;  4B64 A;  2VVM A;  2BK5 A;  1RM6 B;  1BF3 A;  4II2 A;  1DJQ A;  3UOX A;  3NTD A;  4MKS A;  3GDN A;  2NQL A;  3DME A;  4ADW A;  1HYU A;  3DK4 A;  1JNZ A;  3PO7 A;  1FL2 A;  3AXB A;  3M12 A;  1NHQ A;  3ZLF A;  4U2T A;  3ICR A;  1F3P A;  2AL2 B;  2PA6 A;  4H4W A;  2XFU A;  3CPJ G;  1EC9 A;  2BXR A;  1M6I A;  4DXK A;  2X8C A;  3SX6 A;  1DOC A;  3AEE A;  3RP7 A;  1E9I A;  3NN6 X;  1H6V A;  2PHH A;  2YG5 A;  1TDE A;  2GEW A;  1CF3 A;  4G6H A;  3AE3 A;  4H4Z A;  3UP4 A;  4G9K A;  2JAE A;  4OPU A;  4E5T A;  4E4F A;  2PPG A;  2XVI A;  1ZOY A;  3THU A;  4IZG A;  4ZCC A;  4EQR A;  4EMJ A;  4MJW A;  2X8G A;  4E6M A;  4H4Y A;  4U8L A;  2PP1 A;  1ELS A;  4TM1 A;  4K2S A;  4K8G A;  4A6N A;  2OLA A;  3SBF A;  1OJA A;  5IQ4 A;  3L1R A;  3CNT A;  3KUM A;  1FHU A;  1FEB A;  3EAO A;  4HPN A;  1TDK A;  1B8S A;  4RSL A;  4DN1 A;  2OLN A;  5FMH A;  1B4V A;  3NZG A;  3NYC A;  5CKU A;  2P88 A;  3AEF A;  3DDM A;  2AL1 A;  3CMM A;  3HYV A;  2VQ7 A;  3U9I A;  1LQT A;  4EWJ A;  1F8S A;  1BZL A;  4O5U A;  3SZ0 A;  2BAB A;  3UP5 A;  3T2K A;  4RG3 A;  2X99 A;  3DFH A;  3NYF A;  1E7P A;  4NNJ A;  4C74 A;  4NEW A;  4H50 A;  2QJM A;  1O5W A;  3N6J A;  2WDR A;  4H4Q A;  1L9C A;  3ADA B;  3T31 A;  1F8W A;  3NVY B;  1VQW A;  4Z24 A;  5M0Z A;  3DIP A;  1PBE A;  4USR A;  3GY1 A;  1JRZ A;  4C3X A;  5GSN A;  3PVC A;  3NNE A;  4BUR A;  3R0K A;  3DEQ A;  2X8H A;  2PTX A;  2QA1 A;  2WOI A;  3GRS A;  3CPH G;  3GYX A;  1N61 C;  1V59 A;  1DNC A;  2OZ3 A;  1ZY8 A;  1XAN A;  4OPG A;  3RRA A;  3AYJ A;  1XDI A;  1BQG A;  4YSX A;  4C3Y A;  3ZDN A;  1CJ2 A;  3KPF A;  3URH A;  2TPR A;  3AYL A;  1N4U A;  3BI5 A;  4J36 A;  1GPE A;  4AP1 A;  3AM9 A;  1S7M A;  4NEV A;  1D4D A;  2W3S A;  5IDZ A;  4H2H A;  4CCR A;  1CL0 A;  1KNR A;  2R0G A;  3SFD A;  4J57 A;  4H4S A;  4E8G A;  3R25 A;  2O56 A;  2EQ7 A;  1E1K A;  4X2P A;  3BSM A;  1ONF A;  3T4W A;  1PBD A;  2C67 A;  1YY5 A;  2XGZ A;  2XVF A;  3P93 A;  1FIQ B;  1ELI A;  1REO A;  1FFU C;  3SN4 A;  4H4X A;  1OEP A;  4JY3 A;  3GYJ A;  2P0I A;  3CYJ A;  1GTH A;  5IQ1 A;  4ZOH B;  2OZ8 A;  3AE6 A;  3LOV A;  3AE2 A;  2BC1 A;  1XPQ A;  3I6E A;  4HN8 A;  4ECH A;  5BOF A;  3AEC A;  1GRH A;  3JZU A;  4BJY A;  3CGC A;  3UOV A;  4K8D A;  2POD A;  1EBG A;  4HNL A;  4EIP A;  4U8K A;  2XH7 A;  3V5C A;  3IC9 A;  4OVI A;  2PGE A;  3QJ4 A;  3P1W A;  4F4R A;  4A5L A;  2YG3 A;  2CVJ A;  4B68 A;  4YTM A;  3P0W A;  1CHU A;  5BUK A;  3NH3 X;  3NTA A;  4K5R A;  3GWD A;  1BKW A;  3DGZ A;  3UKA A;  1IJH A;  4BV6 A;  4PAA A;  1EL9 A;  3ETR B;  2C76 A;  4P9S A;  1N5X A;  1NHP A;  4J1O A;  3SYI A;  4H19 A;  5FJU A;  1UKV G;  3SZF A;  1DTN A;  2YLT A;  1PXA A;  4YTP A;  4Y4N A;  3SQS A;  4H4V A;  5C3J A;  3ES7 A;  3SN0 A;  3B3R A;  1GRB A;  3IJI A;  5FS7 A;  3IHG A;  4G8T A;  3QKE A;  3ALM A;  4U8O A;  4RG4 A;  4ROP A;  1Y56 A;  3ZLH A;  3RGT A;  1P2E A;  1PJ7 A;  2R4E A;  2DW7 A;  1TZZ A;  2VRM A;  3LB8 A;  3R9U A;  3QN3 A;  4YSH A;  1GND A;  3P4P A;  3DG3 A;  3QPE A;  3T6C A;  3LZW A;  2Q7V A;  2C64 A;  4GFI A;  4A35 A;  4ZN0 A;  4FX9 A;  3UJ2 A;  3DJG X;  1S2Y A;  3HPF A;  4K2X A;  1PN0 A;  3ITJ A;  3OZ2 A;  3P9U A;  2GH5 A;  4J31 A;  4JN9 A;  4FDC B;  3KPK A;  3KLJ A;  1JRY A;  2PS2 A;  1P48 A;  3EPT A;  1O95 A;  4LII A;  2MNR A;  2B76 A;  2YLS A;  3T8Q A;  3UTE A;  2GMH A;  2XFP A;  2PMQ A;  5FJR A;  4YKF A;  3UTH A;  4TVW A;  3SXI A;  3NYE A;  3AE5 A;  4I58 A;  3STP A;  3TJ4 A;  2ZZ0 A;  1AOG A;  3H8I A;  2VOU A;  2Q0L A;  4KEM A;  2ZZB A;  3V3O A;  2RGO A;  2YLZ A;  4Z25 A;  1ZMD A;  1GRE A;  2I5Q A;  3OPS A;  2C70 A;  5J7X A;  5FJO A;  2NVK X;  3H12 A;  4TVY A;  4GYP C;  5G5H B;  5KRQ A;  2CHR A;  3LZX A;  4G7F A;  3FCP A;  2AR8 A;  2JKC A;  3IF9 A;  3DG7 A;  3VR8 A;  4HCL A;  1R0M A;  4EMI A;  3CNS A;  4HCD A;  2BK4 A;  1NEL A;  4FK1 A;  3MQT A;  3HZL A;  3NVW B;  3UJS A;  3MWC A;  2Y6R A;  1GV4 A;  5DBJ A;  3PWG A;  4ZCW A;  3ATQ A;  1NPX A;  2YG6 A;  1D4E A;  5KMR A;  2BRA A;  3IJQ A;  2WPE A;  2YM1 A;  1PBC A;  1XHC A;  3HYW A;  3NS1 B;  3GYI A;  5HXI A;  4K5S A;  3VR9 A;  2JB1 A;  3SSZ A;  4Z1Y A;  4YT0 A;  1ZDL A;  3BHK A;  3CGB A;  1H7X A;  1GT8 A;  5FJP A;  3TW9 A;  2GF3 A;  1MDL A;  3T2Y A;  2FBW A;  1KFY A;  2WU5 A;  4GUV A;  2BCP A;  1P2H A;  3T2Z A;  4B69 A;  2B7S A;  4A6G A;  1PJ6 A;  5GRT A;  3S61 A;  3PK7 A;  2YLX A;  1IUW A;  4GAV A;  5FS6 A;  5JCN A;  2CFY A;  4DYE A;  2BAC A;  1JRX A;  4EM4 A;  2W3R A;  4Z44 A;  5J04 A;  3GC2 A;  3LJP A;  2FKP A;  3OZM A;  3A7U A;  1GES A;  3RIT A;  2XCG A;  4G73 A;  3SJN A;  1NEN A;  1BKH A;  5IPY A;  3AE8 A;  3SM8 A;  3EUB 3;  2QAE A;  3N6H A;  4H4U A;  2R0C A;  3KKJ A;  1TDF A;  4H4P A;  4BJZ A;  1H86 A;  2HXU A;  3AE1 A;  3AN1 A;  5ER0 A;  3DGB A;  3E1T A;  1N4V A;  3SQP A;  1OJD A;  1NHR A;  4AT0 A;  2GDQ A;  3DG6 A;  3QFA A;  1PHH A;  3A7R A;  2TMD A;  3H70 A;  3FIM B;  4OPI A;  3AD9 B;  3GSI A;  4GME A;  2RGJ A;  2YG7 A;  5KNL A;  4UDR A;  2XFO A;  5BRT A;  1RVK A;  2V60 A;  5JCL A;  1SEZ A;  4X9N A;  3MKC A;  4H7U A;  5BOE A;  4GF7 A;  2WQY A;  1KN0 A;  1D7Y A;  1ZX9 A;  4B65 A;  4UDQ A;  4GGH A;  2XFQ A;  4IVM B;  1D7L A;  2WHD A;  2OVL A;  3AYI A;  2GRT A;  4OPL A;  1PDH A;  4KX6 A;  1V97 A;  5EBK A;  3K7Q X;  3AB1 A;  2P8C A;  2GGJ A;  4H2Q A;  4YWO A;  1FEC A;  2AKZ A;  1TE6 A;  2GR2 A;  3C4A A;  1SJC A;  3VDG A;  2BRY A;  1D5T A;  1IUU A;  3ENL A;  3DJD A;  1JPD X;  2GV8 A;  1FHV A;  4OCG A;  4ENL A;  1RYI A;  2WPF A;  4HNC A;  3FYY A;  2QDE A;  4G6G A;  4BK3 A;  2RAB A;  4HB9 A;  2PTY A;  3VCN A;  3ZLG A;  1OJ9 A;  3G5S A;  1VG9 A;  4DX3 A;  4DGK A;  2I0Z A;  3MZN A;  2C73 A;  1H7W A;  4A99 A;  2BS2 A;  4Z2U A;  2C3C A;  5M10 A;  3AEG A;  2Z5Y A;  1PXB A;  2GR3 A;  4JQ9 A;  1PXC A;  5EB4 A;  3FJ4 A;  4DWD A;  3HYX A;  3DJJ A;  2J3N A;  4JDR A;  2GB0 A;  4YTN A;  4JN8 A;  3GO2 A;  1STZ A;  3F8D A;  3CB3 A;  3MSY A;  1YKJ A;  2C7G A;  3P3B A;  3ZYX A;  3II4 A;  3NK2 X;  1DOE A;  1NG4 A;  1LVL A;  3F8R A;  2XH0 A;  4TLX A;  1GER A;  3AD7 B;  4YXD A;  4K1W A;  4HCH A;  2R46 A;  2WU2 A;  2WDV A;  2R0P A;  2WP5 A;  5TR3 A;  2XVH A;  4GIR A;  1E6E A;  1KD0 A;  3UCL A;  2WOW A;  3K30 A;  3SGL A;  1ECQ A;  3NVV B;  2ONE A;  1JNR A;  5JRB A;  1FEA A;  4CY6 A;  1WUE A;  1QJD A;  4H2P A;  2OLO A;  4B1B A;  2OQY A;  2W55 A;  1FO4 A;  2DKI A;  3VA8 A;  3NXL A;  2UZZ A;  1L8P A;  4U2S A;  3ICS A;  4II3 A;  3EF6 A;  4IL2 A;  3PWI A;  3R0U A;  1CC2 A;  4GIS A;  3VCC A;  1KCZ A;  1E39 A;  1R6W A;  1KKO A;  1ZOV A;  3M13 A;  3ZVI A;  2BCG G;  2CDU A;  3I4K A;  2QQ6 A;  4JN7 A;  1Q1W A;  1PJ5 A;  1RP0 A;  2XVE A;  4A6N B;  1ZP0 A;  2OPJ A;  3V3W A;  2IID A;  1W4X A;  3R07 C;  1LPF A;  4CBQ A;  2WEU A;  2V61 A;  2C75 A;  5KOX A;  2QJJ A;  4NTE A;  2AAQ A;  4AP3 A;  5J60 A;  2F5Z A;  3FVD A;  2GQW A;  2WES A;  3GDP A;  3TQP A;  3CK5 A;  4HYR A;  3IJL A;  3NN0 X;  1XS2 A;  2C3D A;  2B9W A;  3IHM A;  4DNA A;  2YR5 A;  3R1Z A;  1PS9 A;  3GMB A;  5KMP A;  3V3N A;  2FYM A;  4DSH A;  3QFB A;  4NZH A;  2FJE A;  3R10 A;  2XVJ A;  2OFJ A;  4MMW A;  2ZC8 A;  3B97 A;  1JDF A;  1JCT A;  2YVF A;  2B7R A;  4E4U A;  3V4B A;  3VC6 A;  3AD8 B;  3GD3 A;  4GR1 A;  1GOS A;  3NVZ B;  1GRT A;  4NWZ A;  1CC4 A;  4KPR A;  3ABV A;  2V3B A;  2QA2 A;  2XLT A;  3CNP A;  1W6T A;  1JPM A;  4Z2T A;  2GR0 A;  2H88 A;  2EQ9 A;  3QLD A;  2YM2 A;  4PAB A;  3ATR A;  3NFU A;  3TWA A;  5KWF A;  4H83 A;  4E0V A;  1VG0 A;  3DJE A;  3ICT A;  1PBF A;  4HA6 A;  2WP6 A;  3Q6J A;  2EQ8 A;  3DES A;  3NGC X;  3RED A;  1E1N A;  1MXT A;  4GAP A;  1TDO A;  1O94 A;  1EBH A;  2O9Z A;  2GGE A;  2GR1 A;  3VQR A;  4B67 A;  2AL2 A;  3KVE A;  4M6U A;  3OW1 A;  3DGH A;  2PGW A;  2YAU A;  3RP6 A;  2WPC A;  1RSG A;  1F8R A;  1LV0 A;  2PCE A;  2E5V A;  3PFR A;  2YQU A;  2PYX A;  3FMW A;  2BK3 A;  3K1G A;  1MO9 A;  1H83 A;  2GAH B;  3I3L A;  4MGG A;  3A7A A;  4YKG A;  1N63 C;  4X9M A;  3P4Q A;  2XYO A;  3S5S A;  3UKF A;  1F6M A;  4GGB A;  1L9D A;  3QSS A;  2BS3 A;  2QJN A;  3UKK A;  3BI2 A;  3CTY A;  1YQ3 A;  3JW7 A;  2XDO A;  3CPI G;  3R11 A;  3BHF A;  2PTZ A;  4C5O A;  2H89 A;  2W54 A;  3H4K A;  1ZMC A;  2VQB A;  2XFN A;  4CNJ A;  3RHA A;  3SZW A;  4GDP A;  3DER A;  3BNU A;  3CNJ A;  5U63 A;  4KWS A;  1LJ1 A;  3SN1 A;  3VC5 A;  7ENL A;  3CT2 A;  3CGE A;  4LA1 A;  3WE0 A;  4U2L A;  3L5O A;  4XWR A;  3QSE A;  4K22 A;  1Y0P A;  1K0I A;  3NT6 A;  1SJD A;  3FG2 P;  3Q4D A;  1NG3 A;  3UOY A;  4IP4 A;  4EMW A;  2QVH A;  3KU9 A;  2A8X A;  1KNP A;  3UXL A;  3UCD A;  5BVA A;  1KSU A;  3BJS A;  4UDP A;  2XLS A;  3AE4 A;  1TRB A;  3CAW A;  3TOY A;  3C4N A;  2Q0K A;  4YSZ A;  4APN A;  1ZKQ A;  3EEZ A;  3RR1 A;  3VRB A;  1GET A;  3S47 A;  3NKS A;  2GL5 A;  2C65 A;  1CJ4 A;  3D8X A;  3RP8 A;  1NU5 A;  1MDR A;  2YLR A;  2HQM A;  2BYB A;  4IP5 A;  3TCS A;  4TM3 A;  1IUV A;  5ENL A;  3UJE A;  1JOA A;  1LQU A;  3MY9 A;  1DXL A;  1OJC A;  2XLR A;  4JHM A;  5L46 A;  4TLZ A;  2WBA A;  2Z5X A;  1EC7 A;  2E3T A;  1JRO A;  4CRT A;  3BOX A;  1N5W C;  4Y4L A;  2EQ6 A;  4C77 A;  1FOH A;  2FJB A;  3OTR A;  1Y56 B;  1P43 A;  3AE7 A;  3T9P A;  2BXS A;  3JSK A;  3SY4 A;  4N9X A;  1K4Q A;  3B9J B;  2BA9 A;  4M52 A;  2NPX A;  3CXB A;  1IUS A;  3NRN A;  4A9W A;  1FCD A;  3ZVH B;  4IA5 A;  4U8P A;  1H2I A;  2OAL A;  1BGJ A;  4U8N A;  1K0J A;  2YWL A;  2R4J A;  4AT2 A;  2JB3 A;  4EQX A;  4REK A;  3F8P A;  2GMJ A;  5JCM A;  4J56 A;  3LAD A;  2YR6 A;  2CUL A;  4EQW A;  2BC0 A;  3NK1 X;  5U1O A;  4YWS A;  1N4W A;  3OC4 A;  3P4R A;  3K7T A;  3GD6 A;  3SFE A;  2OA1 A;  1YQZ A;  4EIQ A;  3V5F A;  3U4F A;  1H84 A;  3VRD B;  3AWI A;  1S3E A;  3AMZ A;  3H7V A;  2RDX A;  1CJC A;  4TM0 A;  4A79 A;  1GSN A;  3DH9 A;  4IL0 A;  2X3N A;  2BS4 A;  3UKL A;  1VRQ B;  3DK9 A;  3UOZ A;  1LTX R;  2PP3 A;  1CBO A;  3UXK A;  1Z6L A;  3FV9 A;  4U8J A;  3ALJ A;  2PP0 A;  2QDD A;  3AEB A;  4USQ A;  1TYP A;  2V3A A;  1KF6 A;  5HY5 A;  3N4E A;  3OZY A;  3JVA A;  4DHG A;  2PU1 A;  3CGD A;  2RGH A;  1H82 A;  4XWZ A;  3EKG A;  4CCQ A;  3TJI A;  2VZ2 A;  2OQH A;  2JBV A;  3D47 A;  3D46 A;  1SB3 B;  3ISH A;  2GAG B;  1WYG A;  2AKM A;  1JU2 A;  2WP9 A;  3VFC A;  2C4C A;  4JNA A;  1Q1R A;  2VRL A;  2C72 A;  3RO6 A;  2QGY A;  3QTP A;  3GWF A;  4OPD A;  1L0V A;  3CXO A;  1QLB A;  5HYM A;  4Z43 A;  4OPT A;  2YVJ A;  1GRG A;  3UKP A;  1EC8 A;  3K7M X;  4CY8 A;  3D9X A;  4B63 A;  5BUL A;  4H2R A;  1K0L A;  3LXD A;  4D03 A;  1CJ3 A;  4ZA0 A;  4J34 A;  1VDV A;  3NG7 X;  6ENL A;  3UKH A;  3CND A;  3D1C A;  4ZCD A;  3UTG A;  2P8B A;  3HRD C;  4I59 A;  2ZBW A;  3TWB A;  4K7Z A;  2ACZ A;  2FJD A;  3BI4 A;  5JCI A;  3CIR A;  2VVL G;  4FP1 A;  3AED A;  4AOX A;  4J2W A;  1QO8 A;  3H8A A;  1NAA A;  3RCY A;  4WX1 A;  1NDA A;  4LU6 A;  1T3Q C;  2GGI A;  4KPL A;  4JNQ A;  1IUT A;  2HXT A;  3I6T A;  2OAM A;  4IA6 A;  3GRT A;  1PDZ A;  1EL8 A;  2C66 A;  3KA7 A;  2WET A;  3B6D A;  2PU0 A;  2OO6 A;  2XSX A;  2XLU A;  4WCT A;  5LV9 A;  2V5Z A;  4EQS A;  4X4J A;  2PSN A;  1KSS A;  2POZ A;  3NRZ B;  1DJN A;  2XH2 A;  3I6D A;  3ALL A;  3L8K A;  1F9C A;  4BK2 A;  4IVO B;  1Q9I A;  1TDN A;  2X50 A;  2HZG A;  4IV9 A;  1TKK A;  3BNM A;  3ES8 A;  4A7A A;  4EM3 A;  3QVR A;  4A65 A;  2E5A A;  5KVH A;  4Z2R A;  1VDC A;  1ONE A;  2DW6 A;  3NO1 A;  3COX A;  3OP2 A;  1MNS A;  1SJA A;  4U8M A;  3HW2 A;  1GXF A;  2OZT A;  5KOW A;  3UJF A;  3Q9T A;  2OKT A;  1MOK A;  4GDE A;  4IHC A;  1IYX A;  2VVL A;  1X2H A;  1VQZ A;  1YEY A;  2A89 A;  2AQJ A;  1N1P A;  3KD9 A;  2WDQ A;  4TM4 A;  5KMQ A;  3NLC A;  1BGN A;  3MUC A;  2P3Z A;  3NHO X;  3DA1 A;  3M0O A;  2QCU A;  4UP3 A;  1NEK A;  2E4G A;  3UCC A;  1DOB A;  2PTW A;  2YLW A;  1TYT A;  1COY A;  2YG4 A;  3C96 A;  4GCM A;  3P4S A;  2R45 A;  3CN8 A;  2IVD A;  1KDG A;  1GAL A;  3EAN A;  5KMS A;  1MRA A;  3FBS A;  3UGV A;  4B66 A;  2XH4 A;  2GSH A;  1DOD A;  4H2N A;  2Y6Q A;  3FXG A;  4KT2 A;  3FPZ A;  3GMC A;  1YQ4 A;  4CNK A;  2YR4 A;  1PBB A;  2WOV A;  1N62 C;  5FS9 A;  3TTE A;  2B9Y A;  3PG6 A;  2WS3 A;  3VRA A;  3NIX A;  5KVI A;  2B9X A;  3SZC A;  4OPC A;  4BK1 A;  4Y4M A;  5EOW A;  5CQF A;  1X2G A; 
#chains in the Genus database with same CATH homology
 2GV8 A;  1E1M A;  1IUV A;  1REO A;  4TM3 A;  1JOA A;  4OCG A;  4H4X A;  1LQU A;  4JY3 A;  1M64 A;  3GYJ A;  1RYI A;  2WPF A;  1DXL A;  4H4R A;  1BWC A;  1OJC A;  3RNM A;  2XLR A;  4H4T A;  2IVE A;  4G6G A;  5L46 A;  4TLZ A;  2DKH A;  2WBA A;  1EL5 A;  2Z5X A;  1GTH A;  5IQ1 A;  4BK3 A;  5C2T A;  3AE6 A;  2RAB A;  3LOV A;  5JCK A;  3QSM A;  4HB9 A;  1OJT A;  3AE2 A;  2BC1 A;  4NTD A;  1L9E A;  4CRT A;  1XPQ A;  1OJ9 A;  1EBD A;  3G5S A;  2XLP A;  4Z26 A;  4ECH A;  3AEC A;  1VG9 A;  4Y4L A;  2EQ6 A;  4DGK A;  2I0Z A;  1GRH A;  4C77 A;  1FOH A;  2FJB A;  2C73 A;  4BJY A;  3CGC A;  4U8I A;  3UOV A;  1H7W A;  4K8D A;  4A99 A;  1Y56 B;  2BS2 A;  4Z2U A;  2C3C A;  4EIP A;  4U8K A;  3AEG A;  5M10 A;  2Z5Y A;  1PXB A;  3T14 A;  3AE7 A;  3NK0 X;  2GR3 A;  4JQ9 A;  3IC9 A;  1PXC A;  2BXS A;  3JSK A;  4OVI A;  5EB4 A;  3SY4 A;  3HYX A;  4N9X A;  1K4Q A;  3DJJ A;  2J3N A;  1JEH A;  2A87 A;  4JDR A;  2BA9 A;  3QJ4 A;  2GB0 A;  4YTN A;  1GTE A;  4M52 A;  3F8D A;  1ZK7 A;  3P1W A;  5EB5 A;  2NPX A;  1IUS A;  1B37 A;  3AEA A;  3NRN A;  2JB2 A;  4A5L A;  2YG3 A;  2CVJ A;  1YKJ A;  4B68 A;  4O5Q A;  4A9W A;  5U25 A;  2YVG A;  2C7G A;  3PS9 A;  4J33 A;  3UTF A;  1FCD A;  3ZYX A;  3II4 A;  4YTM A;  4IA5 A;  4D04 A;  1CHU A;  3NK2 X;  2GVC A;  5BUK A;  1E1L A;  3NH3 X;  3NTA A;  1DOE A;  4ICY A;  1H81 A;  4FK1 C;  1NG4 A;  1LVL A;  3F8R A;  4U8P A;  4NTC A;  1H2I A;  4K5R A;  1GER A;  3AD7 B;  4TLX A;  4AOS A;  4YXD A;  3GWD A;  2OAL A;  1BKW A;  1BGJ A;  3DGZ A;  4U8N A;  1K0J A;  2YWL A;  2R46 A;  3UKA A;  2R4J A;  2WU2 A;  4AT2 A;  2JB3 A;  4EQX A;  1IJH A;  4BV6 A;  4PAA A;  3F8P A;  2GMJ A;  5FS8 A;  4REK A;  1S2Q A;  2WDV A;  1GRF A;  1EL9 A;  2R9Z A;  3O0H A;  2R0P A;  5JCM A;  2WP5 A;  5TR3 A;  4J56 A;  2XVH A;  3LAD A;  2C76 A;  4P9S A;  2YR6 A;  3QVP A;  2CUL A;  1EL7 A;  3GD4 A;  1E6E A;  3H8L A;  1NHP A;  4EQW A;  3UCL A;  5KXJ A;  3SYI A;  2BC0 A;  3NK1 X;  2WOW A;  3K30 A;  4GRT A;  5U1O A;  1UKV G;  3SGL A;  3SZF A;  4G74 A;  1JNR A;  1N4W A;  3OC4 A;  1FEA A;  5JRB A;  4CY6 A;  3P4R A;  4XXG A;  1GRA A;  3G5R A;  2YLT A;  2W0H A;  1CC6 A;  3K7T A;  2ZZC A;  3SFE A;  2OA1 A;  1D4C A;  1PXA A;  4YTP A;  1IUX A;  1QJD A;  1YQZ A;  4Y4N A;  4EIQ A;  2E1M A;  4H4V A;  4H2P A;  2OLO A;  5C3J A;  4B1B A;  3AE9 A;  3IWA A;  1H84 A;  2DKI A;  3B3R A;  1B5Q A;  2JK6 A;  3VRD B;  3DK8 A;  1GEU A;  3AWI A;  3T0K A;  2ARD A;  1GRB A;  2UZZ A;  1S3E A;  4U2S A;  3T37 A;  5FS7 A;  2FJA A;  3IHG A;  3ICS A;  4II3 A;  3EF6 A;  3G5Q A;  1CC2 A;  3ALM A;  4U8O A;  1CJC A;  2V6O A;  1E39 A;  4RG4 A;  3S5W A;  4TM0 A;  1X31 B;  1ZOV A;  1Y56 A;  5HHF A;  3M13 A;  4A79 A;  3UKQ A;  1GSN A;  4JY2 A;  2BCG G;  3DH9 A;  4YSY A;  1P2E A;  2X3N A;  2CDU A;  3V76 A;  1PJ7 A;  2R4E A;  2BS4 A;  2Q6U A;  3UKL A;  1Q1W A;  1PJ5 A;  2APG A;  1S3B A;  3DK9 A;  1NHS A;  1VRQ B;  3LB8 A;  1LTX R;  2VRM A;  3R9U A;  1RP0 A;  2GQF A;  2XVE A;  3UOZ A;  4A6N B;  1ZP0 A;  1CBO A;  4DSG A;  4YSH A;  1GND A;  2IID A;  1W4X A;  3P4P A;  4B64 A;  2VVM A;  3LZW A;  1Z6L A;  1LPF A;  2C64 A;  2Q7V A;  4U8J A;  4CBQ A;  2BK5 A;  4ZN0 A;  1BF3 A;  2V61 A;  2WEU A;  2C75 A;  4II2 A;  4FX9 A;  5KOX A;  3DJG X;  1S2Y A;  1DJQ A;  3UOX A;  4NTE A;  4K2X A;  3NTD A;  1PN0 A;  3ALJ A;  2AAQ A;  3ITJ A;  3GDN A;  3OZ2 A;  3P9U A;  4AP3 A;  5J60 A;  2GH5 A;  3AEB A;  4J31 A;  3DME A;  4JN9 A;  4FDC B;  2F5Z A;  4ADW A;  4USQ A;  1TYP A;  2GQW A;  2WES A;  1HYU A;  3GDP A;  3KPK A;  3KLJ A;  1JRY A;  2V3A A;  3EPT A;  1O95 A;  4LII A;  1KF6 A;  5HY5 A;  2B76 A;  3DK4 A;  1JNZ A;  3NN0 X;  3PO7 A;  1FL2 A;  2C3D A;  2YLS A;  2B9W A;  3AXB A;  3IHM A;  4DNA A;  3M12 A;  1NHQ A;  3UTE A;  2YR5 A;  4U2T A;  3ICR A;  1PS9 A;  1F3P A;  3CGD A;  2GMH A;  2RGH A;  1H82 A;  4XWZ A;  3GMB A;  2XFP A;  4H4W A;  5KMP A;  2XFU A;  3CPJ G;  2BXR A;  4CCQ A;  3V3N A;  4YKF A;  2VZ2 A;  1M6I A;  3UTH A;  2X8C A;  3SX6 A;  4DSH A;  1DOC A;  3AEE A;  2JBV A;  3RP7 A;  3SXI A;  3NYE A;  3AE5 A;  3QFB A;  4I58 A;  3ISH A;  2GAG B;  4NZH A;  5HXI A;  2ZZ0 A;  3NN6 X;  1AOG A;  3H8I A;  2VOU A;  1H6V A;  2Q0L A;  2FJE A;  1JU2 A;  2PHH A;  2XVJ A;  2ZZB A;  2WP9 A;  2C4C A;  4JNA A;  2YG5 A;  3V3O A;  2RGO A;  2YLZ A;  1TDE A;  2GEW A;  4Z25 A;  1Q1R A;  1CF3 A;  2VRL A;  1ZMD A;  2C72 A;  4G6H A;  3AE3 A;  2YVF A;  1GRE A;  2C70 A;  3GWF A;  4OPD A;  1L0V A;  2B7R A;  4H4Z A;  1QLB A;  3UP4 A;  5HYM A;  5J7X A;  2NVK X;  4G9K A;  2JAE A;  4OPT A;  2YVJ A;  4OPU A;  1GRG A;  3UKP A;  4Z43 A;  2XVI A;  1ZOY A;  3AD8 B;  3GD3 A;  3K7M X;  4CY8 A;  4GR1 A;  1GOS A;  3D9X A;  5KRQ A;  4B63 A;  1GRT A;  5BUL A;  3LZX A;  4ZCC A;  4H2R A;  4NWZ A;  1K0L A;  4EQR A;  1CC4 A;  4KPR A;  3LXD A;  2AR8 A;  2JKC A;  4EMJ A;  3ABV A;  3IF9 A;  1CJ3 A;  4MJW A;  2V3B A;  4J34 A;  4D03 A;  2X8G A;  3NG7 X;  2QA2 A;  2XLT A;  3VR8 A;  4H4Y A;  3UKH A;  3CNP A;  3CND A;  4EMI A;  3D1C A;  4U8L A;  4ZCD A;  3UTG A;  3CNS A;  4TM1 A;  4Z2T A;  4I59 A;  2GR0 A;  2ZBW A;  4A6N A;  2H88 A;  4K7Z A;  2BK4 A;  2ACZ A;  2EQ9 A;  2FJD A;  1OJA A;  5IQ4 A;  3L1R A;  2YM2 A;  3CNT A;  4PAB A;  4FK1 A;  3BI4 A;  5JCI A;  3CIR A;  2VVL G;  3HZL A;  3ATR A;  3AED A;  4AOX A;  2Y6R A;  4J2W A;  1GV4 A;  1QO8 A;  5DBJ A;  1NAA A;  5KWF A;  4E0V A;  3ATQ A;  4WX1 A;  1NPX A;  1VG0 A;  1FEB A;  3DJE A;  2YG6 A;  1NDA A;  4LU6 A;  1D4E A;  5KMR A;  3ICT A;  3EAO A;  1PBF A;  4HA6 A;  2WP6 A;  3Q6J A;  2EQ8 A;  3NGC X;  3RED A;  1E1N A;  2BRA A;  4JNQ A;  1IUT A;  1TDK A;  2WPE A;  1MXT A;  1PBC A;  1XHC A;  2YM1 A;  4GAP A;  1B8S A;  4RSL A;  3HYW A;  2OLN A;  2OAM A;  5FMH A;  1O94 A;  1TDO A;  2O9Z A;  3GYI A;  1B4V A;  2GR1 A;  3GRT A;  4IA6 A;  4K5S A;  3VQR A;  3VR9 A;  4B67 A;  2JB1 A;  3KVE A;  1EL8 A;  2C66 A;  3NYC A;  3KA7 A;  2WET A;  3DGH A;  3B6D A;  4YT0 A;  5CKU A;  1ZDL A;  2YAU A;  3BHK A;  3RP6 A;  2XLU A;  3CGB A;  3AEF A;  1H7X A;  2WPC A;  1RSG A;  4WCT A;  1GT8 A;  5LV9 A;  2V5Z A;  3CMM A;  1F8R A;  3HYV A;  1LV0 A;  2VQ7 A;  4EQS A;  4X4J A;  1KSS A;  2E5V A;  1LQT A;  2GF3 A;  2YQU A;  1F8S A;  2FBW A;  1KFY A;  3T2Y A;  2PYX A;  1BZL A;  1DJN A;  2WU5 A;  3FMW A;  4O5U A;  4GUV A;  3I6D A;  3ALL A;  2BCP A;  1P2H A;  3SZ0 A;  3T2Z A;  4B69 A;  2BK3 A;  2BAB A;  2B7S A;  3UP5 A;  3T2K A;  3L8K A;  1MO9 A;  4RG3 A;  4BK2 A;  2X99 A;  4IVO B;  1H83 A;  1PJ6 A;  1Q9I A;  3NYF A;  5GRT A;  1E7P A;  3S61 A;  4NNJ A;  2GAH B;  4C74 A;  2YLX A;  1IUW A;  3I3L A;  4NEW A;  1TDN A;  2X50 A;  4H50 A;  4YKG A;  4GAV A;  1O5W A;  5FS6 A;  5JCN A;  2CFY A;  4IV9 A;  4X9M A;  3P4Q A;  2BAC A;  2XYO A;  3BNM A;  1JRX A;  4EM4 A;  4A7A A;  2WDR A;  4H4Q A;  3UKF A;  1L9C A;  4EM3 A;  1F6M A;  1L9D A;  3ADA B;  3QSS A;  3QVR A;  4Z44 A;  4A65 A;  2BS3 A;  3T31 A;  3UKK A;  5KVH A;  3BI2 A;  3LJP A;  3CTY A;  4Z2R A;  1F8W A;  1VDC A;  1VQW A;  1YQ3 A;  4Z24 A;  5M0Z A;  2XDO A;  1GES A;  3CPI G;  3BHF A;  1PBE A;  2XCG A;  4G73 A;  3COX A;  4USR A;  1NEN A;  4C5O A;  2H89 A;  5IPY A;  3AE8 A;  3SM8 A;  3H4K A;  2QAE A;  1ZMC A;  4H4U A;  1JRZ A;  2R0C A;  2VQB A;  3KKJ A;  4U8M A;  5GSN A;  4C3X A;  1TDF A;  2XFN A;  1GXF A;  4H4P A;  3PVC A;  4BJZ A;  3RHA A;  4CNJ A;  3SZW A;  3NNE A;  5KOW A;  4GDP A;  1H86 A;  3AE1 A;  4BUR A;  3BNU A;  3Q9T A;  5ER0 A;  2X8H A;  1MOK A;  2QA1 A;  2WOI A;  4GDE A;  3E1T A;  3GRS A;  1N4V A;  3CPH G;  3CNJ A;  2VVL A;  3GYX A;  3SQP A;  5U63 A;  1OJD A;  1V59 A;  1NHR A;  1DNC A;  1LJ1 A;  4AT0 A;  2A89 A;  3QFA A;  1ZY8 A;  1PHH A;  1XAN A;  4OPG A;  2TMD A;  3CGE A;  4LA1 A;  3FIM B;  2AQJ A;  1N1P A;  3AYJ A;  1XDI A;  4OPI A;  3WE0 A;  3KD9 A;  4C3Y A;  4YSX A;  3ZDN A;  2WDQ A;  4U2L A;  4TM4 A;  5KMQ A;  1CJ2 A;  3AD9 B;  3KPF A;  3L5O A;  4XWR A;  3NLC A;  3QSE A;  1BGN A;  3URH A;  3GSI A;  2TPR A;  3AYL A;  1N4U A;  3NHO X;  4K22 A;  3BI5 A;  1Y0P A;  3DA1 A;  3M0O A;  4J36 A;  2RGJ A;  1GPE A;  4AP1 A;  2YG7 A;  1K0I A;  3NT6 A;  5KNL A;  1S7M A;  2QCU A;  2XFO A;  4UDR A;  3FG2 P;  5BRT A;  2V60 A;  4UP3 A;  5JCL A;  1NEK A;  2E4G A;  4NEV A;  1SEZ A;  4X9N A;  1DOB A;  1NG3 A;  2YLW A;  1TYT A;  1COY A;  3UOY A;  1D4D A;  4EMW A;  2YG4 A;  3C96 A;  4GCM A;  3P4S A;  4H7U A;  2R45 A;  3CN8 A;  4GF7 A;  4CCR A;  3KU9 A;  1CL0 A;  2WQY A;  1KN0 A;  1D7Y A;  1ZX9 A;  2A8X A;  1KNP A;  2IVD A;  1KDG A;  1KNR A;  2R0G A;  1GAL A;  3EAN A;  5KMS A;  3SFD A;  4B65 A;  4UDQ A;  4J57 A;  4H4S A;  2XFQ A;  5BVA A;  4IVM B;  1D7L A;  3FBS A;  1KSU A;  4B66 A;  2WHD A;  4UDP A;  1DOD A;  3AYI A;  2GRT A;  4H2N A;  2XLS A;  4OPL A;  2Y6Q A;  1PDH A;  3AE4 A;  2EQ7 A;  1TRB A;  3C4N A;  1E1K A;  3FPZ A;  4KX6 A;  3GMC A;  2Q0K A;  5EBK A;  1YQ4 A;  4CNK A;  2YR4 A;  4YSZ A;  4APN A;  1PBB A;  3K7Q X;  1ONF A;  1ZKQ A;  3VRB A;  2WOV A;  3AB1 A;  1GET A;  5FS9 A;  1PBD A;  2C65 A;  2B9Y A;  2C67 A;  3NKS A;  4H2Q A;  3PG6 A;  1FEC A;  4YWO A;  1CJ4 A;  2WS3 A;  3D8X A;  3VRA A;  3NIX A;  5KVI A;  3RP8 A;  2GR2 A;  1YY5 A;  3C4A A;  2BRY A;  2YLR A;  1D5T A;  1IUU A;  2B9X A;  2HQM A;  2BYB A;  3DJD A;  3SZC A;  2XVF A;  4OPC A;  4BK1 A;  4Y4M A;  5EOW A;  1ELI A;  5CQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...