4MMWA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium, l-xylarohydroxamate and l-lyxarohydroxamate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
381
structure length
381
Chain Sequence
MIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium, L-Xylarohydroxamate and L-Lyxarohydroxamate
rcsb
source organism Agrobacterium fabrum
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
total genus 137
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4mmwA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4mmwA01
3H8AA 1MUCA 3SN1A 2P8CA 4IL0A 3TCSA 4GIRA 3H7VA 3BOXA 3KUMA 1JCTA 2QVHA 3MUCA 4K8GA 2OLAA 3NXLA 4H19A 1EBHA 3R1ZA 4HCDA 4HN8A 1XPYA 2PODA 2XH2A 2XSXA 2ONEA 3BJSA 2PTYA 3TWAA 2XH0A 3VCNA 3D47A 1WUFA 1JPMA 1P48A 4E4UA 4JN8A 4Z17A 2GGEA 3RRAA 2OVLA 3CXOA 4G7FA 2DW6A 2HZGA 3UJSA 3DESA 3OTRA 3EKGA 2GL5A 3DEQA 3I6EA 2P88A 1BKHA 3DFYA 5FJUA 2PS2A 4GGBA 3T4WA 1EC8A 1TE6A 1R0MA 3OPSA 3UGVA 2FYMA 3STPA 3DG6A 4IP5A 5BOFA 3UJ2A 1EC9A 3TQPA 3FJ4A 3JVAA 4EWJA 2QJNA 3GC2A 2ZC8A 4YWSA 6ENLA 2NQLA 3DDMA 1DTNA 3OZMA 3VCCA 5BOEA 3ZVHA 3UCDA 3RR1A 5FJOA 4KPLA 3H70A 1SJBA 3MSYA 3U9IA 3ZLGA 1ONEA 3MKCA 3VDGA 4G8TA 1JDFA 3ES7A 4Z1YA 2GDQA 3GO2A 3IJQA 3RITA 3NFUA 5FJPA 2XH7A 4DN1A 1NELA 1IYXA 3TTEA 4X2PA 3T9PA 1ECQA 5FJRA 2OQYA 3CAWA 2PCEA 3UJFA 3TJ4A 2PU1A 4GYPC 3RGTA 2GGGA 3GD6A 3IK4A 3R0KA 4HCLA 3FYYA 3UXKA 3EEZA 4E5TA 3UCCA 4ZA0A 3VA8A 4KT2A 3S5SA 3R0UA 1XS2A 2PTZA 3VC5A 1BQGA 2OX4A 3VC6A 2AL2A 4DXKA 3RCYA 1PDZA 3CB3A 3ZLFA 2P3ZA 3CYJA 4E8GA 3PWGA 3ZVHB 3OP2A 2GSHA 1L8PA 3ENLA 2QJMA 3V5FA 5IDZA 3MQTA 1KKOA 3P0WA 3FV9A 2MNRA 4KEMA 1KKRA 4M6UA 1EBGA 3TWBA 2QDDA 2PTWA 5EU9A 3SQSA 3UJRA 3B97A 1MNSA 3R10A 3SJNA 2OZ8A 3DERA 3N4EA 3PFRA 4ZCWA 2O56A 4H2HA 4H83A 3QLDA 4H1ZA 3N4FA 3VFCA 3QKEA 3TW9A 3V4BA 3SSZA 4DYEA 4JN7A 2PTXA 2P0IA 3SN0A 4HCHA 4JHMA 3PWIA 3CT2A 2ZADA 1KD0A 3OW1A 3TOYA 3N6JA 2OZTA 4E4FA 4HNCA 4A6GA 3P93A 4GMEA 3SN4A 3R11A 2PGEA 2I5QA 1SJAA 2FKPA 1SJDA 2P8BA 1JPDX 2PMQA 3I6TA 3QTPA 2PSNA 3DFHA 3DIPA 3N6HA 4J3ZA 1NU5A 2QGYA 2PP1A 4FP1A 1FHVA 4IZGA 3I4KA 3ZLHA 2QDEA 4KWSA 4M0XA 2XH4A 4IT1A 4MMWA 3HPFA 2MUCA 3FVDA 1YEYA 3QN3A 3QPEA 1PDYA 4DX3A 3JZUA 3GY1A 4ENLA 1MDLA 3T6CA 1OEPA 4HYRA 2OO6A 2OPJA 2POZA 3RO6A 2PGWA 3MY9A 4A3RA 4A35A 2CHRA 4GISA 1FHUA 2QQ6A 3DG7A 3MWCA 2PA6A 3TJIA 2GGIA 3V3WA 3ZVIA 3P3BA 3UJEA 4MKSA 1TKKA 1MDRA 1KCZA 7ENLA 3JW7A 3ES8A 1TZZA 5ENLA 1ELSA 3SBFA 4FI4A 3BSMA 2OQHA 2AKZA 2RDXA 1MRAA 2PP3A 3FXGA 4DHGA 3D46A 5FJTA 1E9IA 2OG9A 2PU0A 4E6MA 3NO1A 3IJIA 2XGZA 4IL2A 3S47A 3H12A 1WUEA 2HXTA 1R6WA 4IHCA 2OZ3A 2HNEA 3U4FA 2PP0A 1SJCA 3THUA 4F4RA 3R25A 4HPNA 2AL2B 3Q4DA 2QJJA 3OZYA 3PK7A 4HNLA 4ROPA 3UXLA 3MZNA 4GYPA 3FCPA 3DGBA 3CK5A 1W6TA 2AL1A 2HXUA 1RVKA 2OKTA 4MGGA 3T8QA 4K2SA 2OFJA 1P43A 4GGHA 4IP4A 4GFIA 3Q45A 5J04A 4J1OA 3DG3A 3K1GA 3IJLA 4K1WA 2AKMA 3NZGA 2GGHA 4DWDA 1EC7A 2PPGA 1F9CA 2DW7A 3V5CA 2GGJA
chains in the Genus database with same CATH superfamily
1YQ2A 4D8LA 1TREA 1OJXA 3GXPA 4O4VA 4E2DA 4AU0A 2QVHA 3GNNA 2R1LA 5I2UA 2A21A 5GNXA 4NYUA 1TV7A 4ICMA 4Q8UA 2AQOA 2G4FA 2VZVA 2YL9A 4JX6A 3AJXA 1RY8A 1W9VA 1W9BM 4KCTA 1YLVA 1OFDA 3WQVA 3NOEA 1E3ZA 3TTYA 1NH6A 2DZUA 4HU4A 4XG1A 3C0QA 1SGJA 4YYFA 3UBPC 1PYFA 1YMYA 3L2IA 4WY0F 1UKQA 1VS1A 1E0VA 4MG4A 1Q6GA 4S3KA 1JRPA 2ICSA 4RE0A 4UNKA 3Q37A 4IG2B 1WKDA 3LCGA 3U2ZA 4D6GA 1XIGA 4TVWA 3O6YX 1M9HA 3AIVA 2P0OA 3A3HA 1Q5MA 1XLJA 3W1MA 3BAXA 2C1GA 4WKFA 4JBRA 4JS3A 3QMSA 5H1WA 4XAYA 3THCA 3BG3A 4J3WA 1OK4A 2GUBA 3DG6A 3MCNA 3DC0A 3GLCA 5IOBA 4IWWA 3AIBA 1H7OA 4A2SA 5DN1A 4DUOA 3LQGA 4O1BA 5TNVA 1ZBKA 4C6NA 3EB2A 1K4HA 1JCMP 4QJ1A 3EDFA 3W7CA 5FJOA 3FS2A 4WR3A 5D30A 2PB1A 4AEFA 2XIMA 3UFYA 3CLMA 1NIUA 4QNEA 5DT7A 3LU2A 4OVXA 1GTHA 3MHGA 4J3SA 3QLLA 1JL8A 2GJXA 4RXFA 1EQPA 1UYQA 3NVYB 2J7EA 1GRFA 1DJHA 5D9MA 4L65A 3GWQA 3MUZ1 3PG8A 2GR0A 1CECA 3NDOA 3G0XA 5CKSA 1FDJA 3VFLA 3EMQA 5G5HB 1UD2A 1DXIA 3W01A 3LHTA 1YRRA 5IFTA 4YCPA 5TF0A 3PF3A 4C5ZA 3SR6B 4JL1A 2YYUA 2E6AA 4HCLA 1UH3A 3UXKA 1IR2A 4E5TA 2BB0A 1CGYA 1LYXA 4DUXA 1CGUA 2INFA 3WSUA 1KFKA 4LXFA 3OBKA 4KT2A 3NDZA 3S5SA 2BOGX 4PTXA 3VC5A 3P74A 3WD3A 3KOXA 2XPKA 4R88A 1AA1B 4GJIA 5ABTA 4WDWA 4NL1A 1FP8A 1MZRA 2C18A 2WYSA 1ZPTA 1EPXA 5HAOA 1XBVA 4IICA 5XIMA 4WF7A 2QJMA 1CEOA 1US0A 1TV4A 2ZZ5A 3W76A 1K9TA 3DZ1A 1P4CA 1FHDA 3TWBA 3CWOX 2J7GA 1XIJA 2FIQA 4H50A 2AAQA 3K4DA 3VIMA 5A6BA 4TOQA 2FGLA 3VNZA 1VPXA 1O5QA 4KETA 3MUIA 1CXIA 3VE7A 4CD8A 3FGCA 2FMNA 4R34A 4CNOA 2X8CA 3VMNA 1US3A 2WZMA 1A5SA 3TYUA 2NVKX 1V79A 3T09A 1GOOA 3PBMA 1QPOA 4GI6A 1IXPA 1J79A 2OZTA 2V67A 4FAMA 2IQTA 1G7UA 1QWGA 4TIMA 2VC9A 4HZ8A 1QI3A 3W07A 3A3XA 5CSYA 4W87A 2D2GA 5CZKA 1J0HA 3EEGA 3UT0A 4E3TA 3L65A 5L9FA 3TTQA 5A94A 3ZT6A 4ZR8A 4BA0A 3UETA 1RAKA 1SZRA 2DP3A 1H6VA 1JZ4A 2R1NA 5F2IA 1TTPA 4RK8A 4WJEA 1TJ2A 4HOWA 5JIPA 1ZCOA 2F9RA 3TUUA 3GY1A 3NNTA 7TIMA 2VXNA 3VTRA 6XIAA 4FX7A 2OO6A 2CZ5A 4POCA 2DJXA 4DBWA 4XZWA 1ICQA 3L7RA 4H7ZA 3BANA 3KS5A 1ENUA 1OZMA 4A35A 4GR1A 3DI1A 2E8YA 2Z2UA 2H9AB 4YTTA 4ADUA 4GQ0A 1XIHA 3OA5A 1IXQA 2VCCA 2WSRA 3PUGA 2XIJA 4GABA 1RCOB 4LVDA 2YL6A 2OWCA 4MKSA 3RCMA 3UQNA 9XIMA 1KCZA 4MWAD 1YXDA 4O1DA 1ZLPA 1F4HA 4UTWC 3P61A 4PTDA 2YVJA 1DJXA 2V5BA 4MAZA 2GSEA 4N6EA 3CGEA 4Y9PA 1NDAA 5AC8A 2E5BA 2PDWA 3RX4A 2WAGA 4WUIA 2A3HA 3PB0A 3EDEA 3UG3A 1TTQA 4X60A 1JXKA 5BCAA 2FMOA 4LVBA 3F4DA 2B81A 3IJIA 5L6UA 4RXGA 1LCOA 1GZ1A 3G1YA 1V3HA 4F3HA 5JVLA 4HPXA 4GQRA 2Y70A 1FP9A 4GYFA 3RYSA 4J2MA 3WJSA 1ZX9A 2GQWA 1NF0A 2OSYA 4KERA 2WMFA 1K6WA 3L4YA 4Q8PA 4UTJA 2VEKA 3VIHA 5FSEC 1OWQA 4LF1A 4O10A 3CS2A 1PAMA 4K3ZA 4F0LA 3TYAA 3QC3A 4LVAA 3OG3A 4AY1A 3BXWA 1CCWB 2X1SA 3H7RA 2GUUA 1VCVA 3TQVA 2C3DA 3PJXA 4HGXA 3G1VA 1EF3A 3OGRA 3QMRA 4IQEA 1HW6A 3IJLA 1ECEA 5FAJA 1C9DA 1JF5A 1XHCA 3ECQA 1T8XA 1V51A 1JD9A 1EB3A 4S23A 4CCDA 3ARSA 5K9DA 4C6FA 5G4WA 3OA3A 3SN1A 2XIOA 3SQPA 4DVOA 2PDFA 2ZZ0A 1CBGA 1MYRA 4U28A 3TCSA 2Z6JA 1KBIA 3M7WA 2QYGA 5E6YA 2J7DA 2B4GA 2DSKA 3LHVA 2HPMA 1P0NA 1XICA 2F84A 3MHFA 5K3VA 4LS2A 3CV7A 3B9DA 1E9LA 1H5YA 2WLZA 5H6HA 1P6BA 2ONEA 2WOWA 5CZTA 1OJTA 1LOQA 3AFBA 2JKPA 4EM3A 3QZAA 4F2BA 3GHSA 5EBKA 3FHAA 1GRBA 4C6QA 2XZ7A 3BQ5A 2E77A 3B40A 4G7FA 3Q65A 5C7VA 3UJSA 1ZP4A 2G3MA 2IQ0A 1H49A 1NQ6A 3R8GA 1QI4A 1A0EA 3I6EA 1EYWA 4QHRA 3NVDA 3QV9A 2E28A 4GVFA 2XISA 3M44A 3I3DA 2ON3A 3NA8A 4I6KA 1AG1O 3TMLA 4C91A 2W92A 1R0MA 2NQ5A 1F74A 1PUDA 2OOFA 3N2CA 3M43A 4H6KA 1IWPA 2D24A 4EWJA 1M7JA 1B3OA 2BSLA 3ITGA 2PLKA 1KM3A 3GB6A 2VFHA 3EAOA 3VCCA 3CXBA 2INEA 3DXIA 3KAOA 4Q8TA 3OLEA 5JQ9A 2D2OA 4WSKA 2VM8A 3U9IA 4US5A 7CGTA 3HJEA 3MKCA 4ERIA 3KX6A 3BPWA 1ZSXA 1CZ1A 2GDQA 5CAKA 2W9MA 1N62C 3TTEA 1BWVA 2E5CA 4JTDA 1AQ0A 2BFGA 1VRDA 4JQ3A 4F66A 3CAWA 2XHYA 3USZA 3LI1A 3R8RA 2OTDA 2JFEX 2GGGA 3TYEA 4RDZA 3G8RA 1VF8A 3R79A 3SSJA 3UCCA 1GETA 2PDGA 1LQ2A 3II4A 1VDVA 1UR3M 3W02A 1S3TC 2ZVIA 3M41A 3LG3A 4LAOA 1TPWA 3R7MA 3B8TA 1BF2A 1A5BA 3BDKA 5TAOA 5AC4A 2JALA 2OWWA 5D37A 1JYNA 3GH4A 1WQ5A 4NRSA 2NT0A 1W5MA 1KM1A 4QEEA 1PEZA 4K7VA 2EHHA 2JF7A 4O18A 3UZZA 5GJPA 3L5LA 3LYEA 2CHNA 1ZXIC 4IOTA 4NSBA 4PE8A 1NSJA 5I3HA 5EU9A 4D6EA 4QP0A 1PL9A 4ZE5A 3DFSA 3WD4A 4JIQA 2VFIA 4UUIA 4HNVA 3V5OA 4CQ9A 3I7QA 1HO4A 3PAJA 4GNKB 1W37A 3ARQA 4OECA 5D05A 1K77A 4JN7A 3HG3A 4DPPA 3GG1A 3RXZA 2QPSA 1IZKA 4XZIA 2VFFA 3R43A 1GG1A 1A0CA 1TV3A 1B9BA 3N1AA 4GI8A 4IIEA 1M6JA 1OB0A 2TODA 3PAOA 2OT1A 4MPKA 2GFTA 4QQ3A 3T0AA 1IT7A 3L68A 4EAMA 3R11A 1VEPA 4NY2A 3F2BA 1BG9A 3CJPA 3OYXA 3GVWA 3W7MA 4GKTA 3O06A 4ALDA 2QKFA 1XDJA 2HTMA 5IBXA 1X7IA 4HPJA 1H50A 4ZODA 3E0VA 1OYAA 1MEHA 1TJRA 3VPLA 5FEPA 3ITOA 3S5OA 5LA2A 4K6AA 1ZL1A 1H62A 3SI9A 4P8VA 2DZAA 1UUOA 2GJXB 4LTSA 4E8DA 3FNDA 5PTDA 3CO8A 1GQLA 3E2SA 4MY1A 3M6DA 3W88A 2D1ZA 3TYCA 2D0FA 5AN7A 1JYXA 1W31A 4GACA 4AZ7A 1CLVA 3W1UA 2UY4A 2WMHA 4H4SA 4MFDA 2UY5A 4MYXA 4RR4A 1BTMA 3STCA 1TCMA 4GFSA 3L0GA 4HSNA 1GVYA 4L9YA 1R87A 4O0QA 1HP5A 3LHYA 3SBFA 2RJHA 5GVJA 3A22A 4L4MA 3GZAA 3UZYA 3ZT5A 5FD0A 3R5EA 4O1AA 1F8IA 1JNEA 1XG3A 1GOQA 3DC8A 1OC6A 5D2TA 3AWOA 4WJXA 4FXSA 1VJIA 3GFYA 1KGWA 1Q45A 1EHAA 4L61A 4UNLA 1SFLA 2HXTA 3T81A 2TSYA 4E3VA 5CEWA 2TRSA 2YAUA 4IFKB 3ZWTA 4S3BA 1C7TA 2YYTA 2EPLX 2Y8UA 3CMJA 4A8LA 3SCQA 3VGEA 1EJ7L 4CN6A 2PLJA 2YXOA 2WHJA 2YA1A 1KTNA 4RX0A 2BG5A 2QLYA 3OLGA 2ZWYA 4R27A 3MS8A 5CPMA 1TZ7A 2RJGA 3Q2DA 3HO8A 2ZRYA 4JKLA 1UBPC 2J79A 3WD1A 1GVOA 2F7FA 1XDLA 5KTLA 1H63A 3DJGX 2X8GA 3GTXA 1LUCB 9RUBA 4YCOA 1J5SA 4JDYA 4PR4A 1GVSA 3EXSA 3GNOA 4O52A 1LL4A 1SFJA 4DUWA 3A6OA 3QYSA 3EZ4A 1GRTA 4MWAE 3C2RA 1BQCA 4AAJA 3WK2A 7REQB 2CW6A 3UY7A 1RJQA 4K8GA 3NDYA 4K1GA 5BXTA 1EJWC 4IJCA 1JGIA 1GRHA 4YTRA 2VYOA 3KOFA 4GX9A 3W83A 5A6AA 1ZAJA 4JKKA 2OELA 4PB3A 2XH2A 2YB1A 2EO7A 4L4LA 4KESA 4GX8A 2QCDA 1XWYA 2XSXA 4PH6A 4M6VA 5JXQA 1DHPA 4C6LA 3UERA 4L64A 3CIVA 4V15A 2QS8A 4JIRA 4B15A 4JN8A 4LUYA 5G1TA 3QHMA 1B3XA 2VFDA 1WZAA 1Y0EA 3CXOA 3NZQA 1UWSA 3V35A 4Q22A 1YDVA 2GL5A 3A9IA 4RZ6A 1H4PA 1WB0A 1W5OA 1NOWA 4IMEA 4V1XA 1KXHA 2EPNA 4MF4A 2EGZA 1KGXA 1DWAM 4GGBA 2QULA 2FHCA 1XP3A 4IM4A 5AECA 3QPYA 2QV5A 2DVXA 4PBFA 4L1WA 3FJ4A 3AXIA 2QJNA 1VQZA 5CC3A 1DE5A 1XYCA 4AX6A 4GD0A 4JIPA 4W93A 1GKQA 4UTUA 5G5IA 2J77A 4W7VA 2J7HA 3CHDA 5ABFA 2FZDA 4AZIA 2VEFA 2FFCA 5HR7A 4GBDA 4M3PA 1RVGA 3HPZA 5ABGA 4DN1A 4CNNA 5DY3A 3QQWA 2NW0A 3QSTA 3BSHA 1DWHM 4ADSA 5T8GA 2VGGA 1S5VA 1S5TA 1ZY8A 4AD1A 3B9AA 1IT0A 3KWXA 1QHPA 1B31A 3LNPA 1B30A 4Q4MA 5F4WA 4HPHA 3W1PA 3C5QA 2WO5A 1AJZA 1O66A 1VIWA 3R0UA 4B4HA 1OCJA 1FCBA 4CCZA 1S7MA 1ADSA 1GW9A 1ZGDA 1C29A 4NXSA 3VOGA 1KC7A 1WDDA 1XLHA 3L4WA 3VC6A 4JDBA 1DJWA 4QLKA 1LG2A 1XBZA 4D6IA 2DZWA 2Y5EA 3CYJA 3TR2A 1YHTA 3T8LA 2QV4A 3FLUA 3MQTA 1BXCA 1ZJBA 3OB8A 1TZ9A 3ABOA 3BCFA 1KKRA 3GD3A 3UA3A 1WNOA 4PMZA 4AZCB 3S1XA 5CJNA 1ISZA 1FVPA 1O7AA 1KBBA 1JCYA 1GEQA 1MNSA 2AMXA 1XR2A 1X2HA 3G77A 2O7SA 1FCQA 5I03A 4D6CA 3IGHX 5LXXA 4TMBA 5LA1A 2V2DA 3S3GA 2YQUA 2HS8A 5I00A 3TW9A 4PZVA 3I7SA 2CYGA 4XD6A 4UFLA 1VFTA 2DUXA 1KWGA 3CL6A 3V0TA 4MFEA 1M7XA 3BLOA 3EYPA 3WLPA 1YXCA 4HNCA 3HPSA 3UG4A 3CGBA 1Y7VA 1JZ7A 1T0OA 3GXNA 4LYQA 4O16A 4LIIA 1WAWA 1NP0A 3SY5A 4Q8VA 2E68A 3V75A 4KEUA 3M0MA 3FSUA 2J6VA 2DZXA 2O0TA 1NU5A 2UY3A 4MM1A 2EG7A 3W2LA 1ML1A 2ZRVA 4GYKA 5CXPA 3ZLHA 1JF6A 5HJYA 2RFGA 1KV8A 3VKDA 4MMWA 4MVAA 4QX4A 2MUCA 3FVDA 3LK6A 3NM3A 3DK9A 5E0FA 1QI2A 1Y5XA 1OC7A 4MB5A 2E6DA 1SZNA 3IRDA 3S2MA 3LCFA 2Q3OA 3NOYA 3H2OA 1UKTA 3NPXA 1UD8A 3LLXA 2Q09A 3RO6A 1EJUC 4JTKA 1EO5A 1GUVA 3SM0A 1Z44A 4DI8A 3NQGA 3L2MA 1FA2A 1J0JA 3GU1A 1CGXA 4JQ4A 2C71A 2E9BA 3DG7A 3I6RA 1XC6A 4XVDA 2NXIA 4EP8C 1FFRA 3IIVA 2VFEA 3ZVIA 1XLFA 2Y8KA 1XLLA 4LOCA 1TFVA 3AZRA 1TPEA 7ENLA 1A47A 1VZWA 2ZKMX 4YVXA 1UJQA 4BF7A 3T05A 3TSMA 4DXXA 5KVHA 1JZ2A 4N4PA 1Q4NX 2ISDA 3W1XA 1EOKA 2AKZA 4EKJA 4LALA 1Z42A 4GY7A 3VCRA 3L4UA 2PWVA 1TJ0A 3N2MA 1P0DA 2ZZ1A 2P1FA 3W6LA 1DE6A 4I9JA 1GHRA 5BYWA 3S6DA 3T2PA 1FY6A 3JR2A 2Y0FA 5REQB 3NO1A 3HRDC 1ICSA 3B0UX 4JTHA 2Z4GA 2WNWA 4QLLA 2UWFA 5I07A 1G1YA 4I5UA 4K8DA 1OYBA 1H5VA 2GSJA 5KEZA 3LV5A 4JKMA 1S5WA 1K7FA 2QJJA 3PPFA 3MB9A 4C60A 5A6KA 1LDCA 3MZNA 3WMSA 2X99A 4INFA 1CWYA 5I02A 4QRNA 4MWAB 5HATA 1POKA 2YDAA 5J8LA 3WFLA 3MUAA 3M46A 1JDAA 1SW3A 2OKTA 5F1UA 1JPIA 3VYLA 4GUJA 4NNAA 4YPJA 2A7NA 1ZQ5A 3EWBX 3W2UA 1A5UA 4MOZA 1H1YA 3UY8A 3LBCA 3LNMA 2X0HA 4LUTA 2XINA 4KEVA 1E1FA 3LERA 5EBAA 4N9BA 2YPIA 4AHOA 3NCOA 1F9CA 3OOQA 2Z27A 3MBFA 3LB8A 1QFEA 4BK9A 1EHNA 4N2YA 5HWNA 5IDIA 3WH9A 3CHCA 4LVFA 3W7PA 4W7UA 3MHUA 3NXLA 1QPQA 4AW7A 5CPNA 4RCXA 3BGJA 2FZ9A 4RV8A 1ITCA 2YA2A 4EF8A 2AQWA 1HL9A 4IGNA 4DEFA 1Q4WA 3ELFA 4M82A 3VKKA 2VX5A 3BARA 2HBXA 2GH5A 3S2CA 1KFCA 1V0NA 3EPNA 4C1NB 4CQ8A 3CUHA 1F07A 4EAYA 1WDWA 4R9OA 4H6QA 2ZZ4A 1TPH1 4X3ZA 5HNRA 1CGVA 2VRJA 2QAPA 1OT1A 2GOKA 1Q8JA 4MB1A 2NWRA 2V9DA 4B5SA 3BQ6A 4ML4A 1Q6EA 1KLZA 3G1DA 3HQPA 4TTUA 1I0DA 2PS2A 4QAIA 4C1KA 1VCGA 1NEYA 3OPSA 3UGVA 1PZ1A 2FYMA 2Q01A 3CQIA 1MOKA 3TQPA 1GONA 3CHFA 4XAFA 4W88A 4RW3A 1E1CA 3R8HA 5A8PA 2UZ9A 4ZB5A 1XSKA 4TVCA 2QF7A 1KM4A 4O12A 2PBOA 2PBGA 3S4TA 3FKKA 4M19A 3TMQA 3BG5A 3VOHA 3V18A 1EGMA 3RRXA 2BASA 2PLMA 1EXBA 2GVJA 1OGBA 1ONEA 3C0JA 3O0FA 4XTIA 1G9HA 1W8SA 4O0KA 4N9CA 4FEZA 4XV0A 3B8VA 2JKEA 3IGSA 3HB9A 4FXFA 3T07A 3HG5A 3VNIA 2G97A 2QVNA 1IYXA 4X2PA 2JBMA 1BXNA 3E12A 3UP8A 2YLLA 3KL5A 3MO7A 4JFWA 1QPKA 3GRTA 2J74A 1XGZA 3IK4A 5DLCA 5H8UA 1QK2A 4IXXA 1H1NA 4IFOA 2W55A 1C93A 1T7LA 4H9VA 2OOGA 7ODCA 3PZIA 2ISVA 4RV3A 5FJJA 3BAKA 2DH2A 6REQA 4QITA 4UQDA 3HGOA 3URHA 1PZ0A 1ZUAX 4BFAA 2HVMA 1NOFA 5AOUA 3U2OA 1MMFA 1UROA 1EP3A 3TA6A 3CB3A 2ZZ3A 2JE8A 2F2KA 3W0KA 2CLPA 4OHQA 1W0MA 3B06A 4AC1X 4G9PA 3MTWA 4TVUA 3WK0A 4K39A 3G0SA 3EXTA 1FH8A 3WDJA 2J9YA 1M04A 4A29A 1WX0A 1SO5A 3DGZA 1ITQA 3FXYA 1FWJC 3CL7A 5CZJA 1JQXA 2QGHA 1W1B1 3N4EA 2X30A 3PFRA 3VGBA 2JQXA 3LLFA 2J4GA 3NSMA 4JEQA 1BVNP 3HGRA 2Y88A 1AZ2A 1X1NA 3SN0A 3F7JA 4V27A 1ZJHA 2FDSA 4Y9NA 4JXCA 3AS1A 2WQDA 1QHZA 1H7NA 4M6QA 3O2LA 2WKJA 4HZ7A 3P8IA 1CLKA 5TR3A 1PWMA 3W1TA 5ABHA 3V1PA 5BU6A 2WMGA 3U48A 3SDOA 3VIOA 4Z2KA 3UGRA 4LNCA 1KCKA 3A64A 2OCZA 3GDRA 4TX6A 3RF9A 2XWEA 4JFSA 3N3TA 1N5XA 2E0PA 4ACZA 4M81A 1A53A 1XH1A 1W3IA 4MKVA 4Y2WA 3H21A 2GK1A 4IZGA 2V2HA 2VZTA 3B4YA 3H2NA 1DNCA 5F1VA 4FX8A 1BWLA 3DBNA 3SZ8A 2INZA 1ONFA 1JNDA 3HM7A 2QR6A 5FESA 3GNRA 1ZS2A 4ASTA 4FK9A 4HU3A 2E6YA 4RNIA 1DKWA 3NQ6A 1XINA 3OIHA 4DYJA 1WP6A 3E96A 3VDHA 5FA5A 2CLIA 1AL8A 1SSGA 2X1IA 3TXZA 4QNWA 3LMYA 3P3BA 1R3QA 2RGLA 1VQTA 1OZQA 5DMLA 4DO5A 3BK0A 4FIQA 3DYPA 4AD4A 5JCMA 3ARTA 3VGFA 1ZMCA 1IZJA 3DHPA 1P5BA 4GVHA 1L9WA 5K4XA 1E6XM 1RPXA 4EXQA 3HGSA 1VIZA 4DJDC 4ZGYA 4YMZA 2WZEA 1IV8A 3D46A 1DEDA 1W9PA 1SFTA 4DF1A 5FJTA 1V4YA 3M6YA 4S3AA 3TNBA 3VUPA 4W8BA 2ZWZA 3W7KA 5F2LA 4M7TA 1ISXA 1KM5A 4Q4KA 5CG7A 5BNKA 3THUA 1EJSC 2IKHA 4RNJA 4LEQA 4L6HA 2DDXA 3VILA 1NWRA 1DQXA 5KVIA 2HEJA 3N4AA 4TTGA 1CIUA 4DNAA 4CU7A 5FS9A 2PZNA 2CZFA 3KVMA 5ECUA 4ATDA 4A21A 4NG3A 2QEZA 4K68A 1PKMA 4JTQA 4XQ6A 1QW7A 2CXGA 2W67A 1V6UA 1K6AA 4GGHA 5DANA 3VD9A 3PJWA 5C9XA 3ANVA 3Q45A 1LG1A 1EDTA 4AWTA 3LENA 1UC5A 2B7QA 5DELA 3HPXA 1V6VA 3MSGA 5AZ0A 2A6NA 4AIBA 1LWIA 5EFDA 3VGHA 2ZX5A 3FAWA 5DXYA 1VAHA 5FF7A 2JEPA 3CUJA 5DT5A 3STGA 1N60C 3OGSA 8A3HA 1CGTA 3QR0A 2P8CA 4UZSA 3H6OA 4W5ZA 1GVIA 3OO2A 4HHHA 1U5HA 2WNZA 2OMAA 2OLAA 4HMNA 1W1VA 4IPPA 5HINA 2CCRA 5G1MA 4GJJA 4H4ZA 3GKFA 1R3RA 1D8CA 4OKDA 2PLCA 1XLAA 1IWAA 5A8NA 3EA3A 4PEEA 5KETA 1J01A 2HVOA 2W0UA 4JNMA 3P14A 3F4CA 1P48A 1WA3A 3HN3A 5DBUA 1DPMA 3NZPA 1JRCA 2R14A 4Q33A 1E0UA 4ZB2A 2I14A 3KBSA 3GNDA 4GZJA 4ZTYA 1CGWA 1OFRA 1AJ2A 3RR4A 1TO3A 4QG9A 3AIRA 3L66A 3XINA 1BKHA 5BMWA 1Z48A 3WLNA 5FJUA 3GH5A 4FO4A 2AMGA 2X0SA 4AISA 3CNYA 2A7PA 1W32A 3REQB 8RUCA 4IMCA 4KGLA 2HV5A 6TIMA 2Y7EA 1WDSA 2W61A 5GJMA 3WQ8A 1DTNA 3LPPA 8CGTA 4MUPA 1QNRA 1UKOA 4QISA 2IKIA 1GJUA 3IACA 3KRBA 2W3RA 2V0TA 3H70A 1SJBA 2OB3A 3MSYA 2WMKA 4M1RA 1KTBA 1VPQA 4XIMA 1EJVC 1AL7A 3IC9A 1UWTA 2VHLA 1AODA 3UZ5A 4Z1CA 4KRZA 4A8IA 1RJRA 5CJMA 2QPXA 3GTFA 1RLCL 1R85A 4DI9A 1UZ4A 2PU1A 3PJTA 1F8MA 4S3CA 3OVRA 1TWSA 4GCXA 2D69A 1I2RA 1U5JA 5AFDA 4Q4OA 3QZEA 3EXRA 3H2FA 4PSPA 4UTTC 2BHUA 4GG9A 3E2QA 1TELA 4HHLA 4J3TA 2XIIA 2VD9A 3QHNA 1PZ3A 2PTZA 3VMOA 3DFQA 5D9PA 3QV6A 3OLDA 3ZJ8A 2AGKA 4B2DD 1OBAA 3IJ6A 3UPWA 4M29A 1OK6A 1ZU8A 4DZHA 3ITCA 3KW3A 4E8GA 3ICJA 4CNTA 1H60A 5HQEA 2C16A 1ZAIA 3N17A 4DM1A 3RM9A 5LNVA 3W23A 3CGCA 1UHVA 4XUYA 1XYZA 3NQEA 1GOIA 3PTKA 2W4XA 5JUVA 3GFZA 4J27A 1NJJA 3CQJA 1HX0A 1LOLA 1C8QA 3M0XA 2ADAA 2GQ8A 1VEMA 2GWNA 2BGSA 4H1ZA 3HMJG 3MI3A 1SZFA 5GNYA 3EOSA 2WVUA 4DYEA 3U5UA 4JTLA 2PTXA 3GIQA 2ZZ2A 4KMQA 3TC3A 3O15A 3F5JA 3AN1A 3OW1A 3N29A 3VZZA 1LOSA 3UEQA 3OHIA 3L5AA 2D3LA 4Q3MA 4D9PA 1LQ0A 4RNHA 5EMKA 2WKLA 1FWGC 1YQZA 1P0BA 4ICNA 2ZRXA 4I3GA 5AHIA 3Q94A 1ISVA 1KR1A 2IPGA 1YTEA 3BE7A 3IIPA 4HU0A 1AMKA 1W8GA 1UH2A 1GZJA 3I6TA 1E4MM 3PFMA 4APNA 3A7AA 4W89A 1J6PA 1L6GA 3EOOA 2VFGA 1ZB5A 3RILA 2FH6A 1THFD 4C6PA 3BLFA 3QRHA 3MJMA 3RPDA 3ARWA 2ZTKA 1UPMB 3QR3A 4LY8A 3KCLA 4DF2A 1E9ZB 1LVLA 3IGXA 1SMAA 1JGMA 3GVQA 4QEHA 4X63A 3AOFA 1NDYA 1TUFA 1PTDA 2RABA 1ME9A 1I6NA 1CYGA 4JTJA 4HMDA 4OJYA 2OJPA 1XRTA 4JTEA 4LV4A 1VFLA 3MBDA 3QHOA 4UFIA 4CU8A 4HMCA 3MVIA 4UTWA 3DFPA 3WLKX 5I3IA 5FEXA 1C8YA 1J10A 3AMKA 3O63A 3UZWA 1UP3A 1VYPX 4B92A 3DKLA 1IGSA 4LQ1A 4RKAA 2IW0A 2BODX 3WQ5A 3CUIA 3P67A 3Q6JA 1B90A 2G3JA 2PDYA 1RD5A 3G18A 3UXDA 4NAEA 4HYWA 2GUYA 4GWEA 1O1HA 4YHEA 4PCPA 1JI2A 1GESA 2E5DA 1B0IA 3L0NA 1V6YA 4FLSA 1RK6A 3K13A 3L9CA 4XD3A 2TPRA 2QHAA 2I9UA 2PU0A 4MYAA 4E6MA 4GVGA 2HK1A 3S47A 1NHPA 1RP9A 2DZPA 4OBSA 2A1YA 1PTGA 2J88A 3AIWA 1FKXA 3B05A 3DHDA 2IQDA 1UJPA 5BXSA 4GZIA 2NX3A 1QASA 1UUQA 3RLGA 1N7KA 1MW2A 4NAFB 3ZS4A 2E1WA 2HWGA 3NVVB 4LB4A 1K9FA 1RSCA 1JZ8A 1QJWA 4HYVA 2X50A 4FA3A 1N82A 2WK2A 4ZO8A 4B5TA 4HOZA 2VDIA 5G4HC 2GZXA 1W3NA 2EJAA 1IEVA 4QG8A 1JCLA 1ZFJA 1P0KA 2ZA3A 5GJNA 3K1GA 3ARRA 4NZFA 4ACYA 4ROQA 2PTDA 3PSWA 1PE1A 5J5DA 3RMEA 4ZMGA 2C0HA 3V16A 3FGCB 1M6IA 2H8XA 3OVPA 4JY8A 4C6EA 1E3XA 5CGQA 2WPCA 2J25A 1X6UA 4ONVA 1JPHA 2R24A 3SFWA 2QUNA 3IARA 2XVNA 4BI7A 2YBTA 3ALFA 1QOXA 2FTPA 3WD0A 4GPNA 1HJXA 1WOAA 2HK0A 4JQ9A 1J6OA 2WBGA 5I79A 2H9AA 2Q71A 3GBDA 4FOJA 4AD3A 1L2UA 1FWRA 1R2SA 1NP2A 5G2HA 1Q7QA 1E5NA 1M03A 4AIOA 3LRLA 1PX8A 5MKGA 1XLIA 1LRTA 2E40A 2HQAA 3G3MA 3ZZ1A 3TFXA 3VOIA 3OQEA 1TWDA 2I5GA 3MDWA 4C7FA 2BBFA 2ZX8A 3BAWA 1VYRA 3OVQA 4HOXA 1AUSL 4CQCA 4FHAA 3T2OA 3OVGA 4REQA 4H9YA 1RV8A 4QAWA 2ASHA 4EACA 1SFSA 4CQAA 4DWSB 4GXPA 1EX5A 3VMPA 6ENLA 5AHEA 5AHNA 1D3HA 5HQMA 1N63C 2OT0A 1PIFA 5HNTA 1ZK7A 1QNVA 4HJWA 2VNCA 3OBEA 1OSEA 2XDFA 3F5KA 4JGDA 3N9SA 1QT1A 2OR2A 2I7GA 4B9ZA 4Z0SA 3T78A 1SVDA 1G0CA 1REQA 5T9CE 4H3DA 5FF3A 3L4TA 2V5DA 5A6LA 2E4TA 2VWTA 3AMDA 1QTWA 1D7KA 3MCMA 3P0XA 3GD6A 4OOUA 3SQMA 3WFAA 4MKNA 3AM9A 4AVNA 2DIKA 1W17A 2W3ZA 3PB2A 3LSCA 2XN2A 1EJTC 1J12A 3W1RA 5D32A 5FKYA 3HW2A 2WBAA 3GUGA 1A0DA 1UD3A 1HQTA 4Q32A 4DJED 1UQZA 3EOLA 1PDZA 5HJXA 4UMAA 1ISYA 1S1PA 2ZZBA 3MJYA 3RCNA 3ERPA 3OZPA 4EOUA 1VFOA 4HN4A 1MUWA 3RG6A 2DQXA 1IIGA 3LGEA 3TIMA 4EM4A 1GVRA 3WLLA 1XSJA 3HQOA 1W91A 3NPVA 2WHMA 3UJRA 4U5KA 1A49A 3AXKA 2HCVA 2D73A 4ZSTA 1BRLA 1FXQA 3TCEA 1HFBA 1EWDA 3HBLA 4ORMA 3GRSA 1UQYA 1S39A 3WL1A 2P0IA 3MI2A 2W63A 3MYPA 4JHMA 3W7GA 3QFEA 1VR6A 3WH5A 1ODZA 3CGTA 3W26A 4OOZA 1ADDA 4E4FA 3P93A 5JH2A 4AY8A 2V5LA 2VGIA 4PMYA 3EDJA 1SU5A 3CQKA 3TSBA 4AX7A 4QM1A 2FKPA 4PUKA 4PUNA 3B03A 2DZSA 1XANA 2G3FA 2ZDRA 1U5VA 1R7OA 1DWGM 4O1EA 3PZGA 4NJHA 2C91A 4C65A 4B3ZA 1UG6A 4FXRA 1NHQA 1FWBC 3ARUA 2NSOA 5FEZA 3TZNA 1EP2A 3I4KA 3TYZA 4JD4A 4DAIA 3IJ9A 1GPFA 3CZLA 3IGUA 1XYMA 3EX2A 1B4EA 1UP2A 4B5WA 5CPTA 4ENLA 2FB2A 3EA2A 2VP8A 4IMAA 3MP5A 5JU6A 3AIUA 4JTTA 2E3TA 1PX4A 3O0HA 2V82A 3CHVA 4Y9OA 4HB7A 2OSXA 5A6SA 3NL5A 5TBOA 3UA4A 2GWGA 3ZXWA 3O1NA 1FEBA 2CKSA 3NAVA 4MB4A 3E9AA 3LCWA 1P1MA 4NKCA 1L2QA 3WQEA 1P7TB 2O4QA 4B4FA 5A1AA 1F61A 1BWKA 2VELA 3V3WA 3EWUA 1A4LA 2QPUA 3U2EA 3WNLA 3S9ZA 3ZYZA 3GTNA 2Z24A 2ZRZA 5CSUA 1R3SA 2V6OA 1TPUA 2V6AA 2YBUA 2ZFAA 1TRIA 1UA7A 2NXGA 4XKYA 4G7EB 2E8ZA 4BS0A 3M5XA 2ZUNA 1HKWA 2ZQ0A 4S1FA 5A6MA 5K9XA 3E02A 4EMJA 5BU9A 2VGBA 5F2GA 3WD2A 3WK1A 3ZOAA 3UWZA 4IHCA 1JCNA 4H9UA 1XIMA 2Z1XA 3KL3A 1SJCA 3CASA 2ZBTA 2OKOA 4LYRA 4U4MA 4MZ8A 5A8MA 1GK8A 5G4EA 4R7WA 3IUHA 1MW1A 3LBMA 4HD5A 4YVVA 3VGGA 4A4AA 1VGAA 3WEMA 3W1LA 4UCGA 1PS9A 2PRMA 4GYJA 3RIKA 2CETA 2DU2A 1W9XA 3HFTA 2D3NA 2QUVA 1KQYA 3O7UA 2KAUC 1X8CA 4RZBA 2PDCA 3NYZA 5U1OA 3VABA 4DB7A 4Z1BA 2GQ3A 1EIXA 2A8XA 3THDA 3DK8A 3ZWSA 2JIEA 3GIPA 5K2ZA 1EL3A 1FH7A 5A5WA 4B5NA 4CVWA 3NZGA 2E9LA 4R33A 1GOMA 3WNPA 1R46A 1UC4A 4KKXA 3W28A 4ZSUA 4FX9A 3CQ0A 3WF2A 2WPBA 3BC9A 4UWMA 1GOKA 3NPUA 1FFQA 4TV5A 4M5PA 5LYRA 3MUCA 4JTSA 1FWEC 1ZBCA 3BLPX 4J7RA 4GK8A 4BKNA 3RUBL 3C6CA 1I75A 4EVZA 3WDRA 3PR2A 4AG0A 4PULA 3U4AA 1D7YA 5A8OA 2C1IA 1T6MA 4JQ2A 4QDMA 4A22A 2XH0A 4W9TA 3GDMA 1CB7B 4E4UA 2J8TA 3B9NA 4AVOA 5IM51 4IUOA 1SMDA 2FZ8A 1XIFA 3W87A 1Y8BA 2OVLA 3CO4A 1TB3A 1CNVA 1J0KA 4WKHA 1MXGA 2GVEA 2HZGA 2DT3A 4CQDA 3N13A 1W9DM 2CC0A 5C2GA 3B0YA 2BVWA 1XIDA 2OEKA 2XIQA 5KSWA 4W8AA 2FHBA 4ZQRA 3H55A 1RXOB 3BJTA 1WXJA 3R94A 2Y7GA 4FNPA 3NSNA 2BS9A 4Y90A 1KCLA 2QAFA 4B90A 1QUMA 1I2PA 1XD0A 4A8RA 3WH8A 4GUHA 4IP5A 5BOFA 1HUVA 3I7RA 3ME3A 3P7YA 1XW8A 1K7EA 1R38A 2B7NA 2IUZA 5BOEA 3GD4A 3NQ8A 5A2BA 4GI4A 4K36A 2ZXAA 3R13A 4AZ5A 5FMHA 2NQHA 4O28A 3MKKA 4X0VA 3SUSA 4GIAA 1DIOA 1PHQA 1G7VA 4G8TA 3EA1A 4DNHA 4S2CA 3RITA 4GCAA 2XH7A 2Y5SA 1GPWA 5AKQA 2W62A 1XC4A 1S38A 3SRDA 3PBGA 2ZZ6A 2PCEA 3FA3A 4ZO9A 2V68A 3LGGA 2B7OA 2FZNA 3CAKA 4TU1A 2WMIB 4H6RA 4IJRA 3A21A 1KXVA 3NQ7A 4IFKA 1WOBA 3QM3A 3RU8X 2IMRA 1HJUA 1ZRQA 2DT1A 4YHGA 5FIPA 2GVGA 4EE9A 3SJ3A 4YLWA 5BRPA 3F2CA 2R1KA 3VDBA 1IR1A 2QCNA 3W1AA 1FWCC 4D6JA 3N2TA 1TQXA 1JRBA 1UMLA 5LA0A 3AHZA 2B31A 3M0VA 3UPBA 4G1KA 1H7RA 5BZAA 5I09A 3ZR4A 4ECLA 5E5CA 3M0KA 4DBDA 1JAKA 1XCXA 4CD6A 1MW3A 5KZEA 1Q66A 3H23A 1TR9A 2ALDA 1ONXA 1RD6A 3SJNA 5D8ZA 2HJPA 3KTSA 4G1NA 4ZCWA 4BQ3A 4F0SA 2CLEA 2IXVA 3GAYA 4DUVA 4Y8FA 3AMZA 4O54A 3NXFA 4WGHA 3G6LA 3IV3A 3W7RA 2YCIX 4IPLA 4HJFA 2I17A 1VFFA 2PCQA 4DJFD 1SO4A 4Q6JA 1EZ2A 2E3ZA 2X42A 4ZOCA 2WCGA 1BYAA 5AHMA 2BGNE 2YCEA 4Q8OA 3AYRA 4QQUA 4HU8A 2PDLA 3IAQA 3GXFA 1Q6QA 1I2QA 3POHA 2X7WA 1VENA 3E2RA 1MXSA 2C3ZA 1TPB1 3CH0A 2PSNA 4W7WA 3G2GA 4R7JA 1MFUA 3EPMA 3UWEA 3VD7A 1UD5A 3WQPA 2XFFA 5M5DA 1OGSA 3BL3A 4Q7NA 1M01A 5ABEA 5AC7A 4PL1A 1NHSA 3PPGA 4XBSA 4HQVA 5EL1A 2QDGA 4YVPA 4JIIX 2I1OA 2FQIA 4KQNA 3OHMB 4KS0A 5EMMA 1W1TA 2WCAA 2WVVB 1I8JA 1ZBVA 3HZ3A 3C3UA 3MY9A 1TTJA 1E6SM 4JIEA 4ICCX 3TR9A 3M64A 3MWCA 1RPKA 1LRNA 1V0LA 4XO7A 3R89A 2Y62A 1FFUC 4JFVA 4PMRA 1S2TA 4JYDA 1GERA 3MV11 3IEBA 4C6IA 2OXNA 2OQHA 2WZIA 2V8ZA 2W54A 4WCJA 1XXXA 5FL0A 5FS8A 4UFKA 3L4XA 3A4AA 3LADA 5CC5A 2FVLA 3NS1B 3C8FA 2Z28A 1QI5A 3DFNA 2A3AA 4KCWA 1R6WA 1PZ2A 4PN2A 1XKYA 2PP0A 2DORA 4UR8A 2BY0A 1UB3A 1M7OA 2HBVA 4QDWA 4YN5A 4YIWA 3BOFA 4XVEA 4O1CA 3LTSA 4PUMA 4N02A 3PK7A 4AH7A 3N04A 3CPGA 1DHKA 4TQTA 5C6MA 1V3LA 5JBDA 3UZXA 1Y5VA 3N34A 4GO9A 4MZYA 1FDYA 2DIJA 2V30A 3WJXA 2R82A 4U2ZA 4AEOA 2YCLB 3N12A 5EMUA 2HXUA 3GHTA 3FYOA 4ZOHB 1G6CA 1Q7MA 2DFAA 1VYSX 2TPSA 4G56A 3LPOA 4BQ2A 2OFJA 1JJKA 4PCTA 3PZTA 4F9JA 1LWHA 3VIKA 2Z7GA 3MYOA 4PODA 1P6WA 2EKGA 2YW4A 3SURA 3U3HA 5EMJA 3W2NA 4WOQA 3MSDA 1CTNA 1BSLA 1T5AA 2G0WA 3K4AA 3DHUA 1R2TA 4XWUA 3B0XA 2J47A 5HR6A 3V5CA 5ER0A 4GRSA 1KRCC 2ESCA 2WPEA 1YDNA 3BOXA 3KUMA 5AHLA 2ACRA 3CUGA 4FALA 5EYWA 4KGJA 2GRTA 1N5WC 3FAXA 5HWMA 4WOZA 3TAOA 1W1ZA 4K8HA 1Q85A 5FAGA 1S2WA 3PZNA 4JHOA 1PPIA 4NI3A 2X05A 3NSXA 4BI6A 2UV8G 1JPMA 3NQDA 1A3WA 4NZCA 1OX4A 3RPTA 4H41A 4QFUA 1JZ6A 2ZXBA 4DO4A 4FIRA 1YTDA 3K8KA 1FTXA 3TV8A 3CPRA 3W2JA 2QXWA 4QTGA 4GHRA 4GO8A 4XSMA 1J0YA 5AYBA 4FNRA 4Z2GA 4G7EA 5LGZA 3DI0A 1J0ZA 2W79A 3V0SA 3BMVA 3DFYA 3JU2A 5KITA 1EC8A 1YXYA 2GJRA 1TYTA 2Z6IA 4I8DA 5HNUA 4LJ3A 5LIUX 4DWSC 2VC6A 2YDSA 1TPVA 3VU2A 3MMTA 3STFA 2V5KA 4AC7C 4H4WA 3KTXA 1TMHA 4XZNX 3DDMA 3WQGA 3W1NA 4PFHA 1XSIA 3EGJA 1AVAA 3N18A 3LXCA 3MZ2A 3BG9A 5DXXA 2H3DA 1DJNA 1RLDA 1WCGA 5D02A 1U22A 3CGDA 1GWJA 2PF8A 5IFPA 4ZXLA 1VFSA 3TKFA 3M7SA 3L12A 3DK4A 1DYSA 3WLJA 1GOXA 5LIYX 1DQWA 3W84A 2Y7FA 2R9ZA 2OO0A 2JGYA 1QU4A 4JTFA 3PN8A 3IIXA 5D09A 2NUXA 4PGLA 5IHSA 4ACZB 1OHLA 4FR6A 2BXVA 1SPQA 1WO2A 5JRBA 2RDUA 4MJ4A 3K30A 1Z41A 4FLOA 3BW3A 3PZQA 2OX4A 1MEWA 3VNYA 2AOSA 4D6DA 1FX6A 2EJ1A 3CZJA 2VZSA 3OZOA 3SCPA 4AQLA 3PZOA 4AYGA 5BMXA 1UA3A 2XVPA 3FV9A 2MNRA 3T2QA 4E0CA 1O5XA 1EIBA 4GKLA 3SCWA 4D72A 4N4QA 2PTWA 1E6NA 5D2VA 3SQSA 1B57A 3OQ8A 3NQMA 4NUWA 4CNUA 4EQRA 3IJDA 3HV9A 3VK5A 1FWWA 3CEPA 1B3YA 3KZSA 3EX6A 3GH7A 4H83A 1KBLA 3W38A 3QLDA 7A3HA 3N4FA 4PMQA 3BOLA 5FEWA 2E67A 5HMDA 4AMCA 2Z1SA 2VMFA 4XD4A 2VR2A 3CT2A 1DP0A 4KH2A 3AAMA 4AYSA 2DVUA 5BROA 2A3LA 2QUMA 4GVIA 3VKAA 3D6NA 3N6JA 3MC5A 3NYDA 3RFAA 1JQVA 3F1QA 2I5IA 2XZ9A 4LCSA 4ZENA 5GRTA 1RK5A 1FWNA 2I5QA 4IUGA 5H91A 3VNMA 4MY8A 3ZFHA 5G2IA 3UR5A 3QTPA 2ZTJA 2VURA 2O92A 4HVXA 2ZUVA 3LOTA 4I9MA 1WPCA 4NU7A 1FFVC 3M5ZA 2ZZCA 3TU9A 2QDEA 2YFOA 2XH4A 3H26A 3ZR6A 3TJLA 1VHCA 2O7QA 2J9XA 3C52A 1WV2A 1UZDA 1Q2SA 4DZAA 1HXJA 3GZ3A 4FLQA 4FNSA 1JEZA 1TIMA 1N8WA 3FSTA 3W1QA 1NHRA 1QNSA 5CC7A 4C5YA 2CHRA 4GISA 2FH8A 3QW4B 4IPJA 4LGXA 3W3OA 1WYIA 3FVMA 1W3JA 3KRUA 5E70A 3YPIA 4PMUA 1VJSA 3LCXA 4KFNA 3SR7A 4HT3A 3NZRA 1A4MA 4LBSA 2XGBA 1UZHA 3LXDA 1EP1A 5ENLA 2XVGA 3G1SA 1JFHA 4W84A 2RDXA 3AISA 1G4PA 3W29A 5LHFA 1V3MA 5EY5A 4F0HA 5FSDC 3PNUA 3V7PA 2VO5A 4PRTA 4X22A 1R86A 5I3DA 1J2WA 2Y85A 2ZXQA 1GJPA 1WDQA 2XGZA 4U2YA 5I5RA 4D2JA 1DJZA 3EWDA 4CKQA 5HMSA 4L9ZA 3ARVA 4JTRA 5H8MA 3AMGA 4LC8A 3GIYA 2YR1A 2A6LA 4Q6XA 2Y6ZA 5LZLA 2P5NA 5C2XA 2ATMA 2Y5JA 2RAGA 3FY1A 2PDMA 5CPQA 3PTMA 3CK5A 1H0IA 3SB0A 2DEPA 4MJMA 1LLOA 4P61A 2ZUTA 2WWDA 1B3VA 3KZPA 1NWUA 3FA4A 1F3PA 3B3DA 3LA4A 4UQCA 1HVXA 1OG6A 3SGZA 4N9EA 4DO7A 5J04A 4MWAC 3QQ0A 4J1OA 1GVFA 6XIMA 1Z69A 3AZTA 5AHFA 4UFMA 2GYIA 4S3DA 5DCBA 1Q6OA 5F4SA 1TJPA 3BAJA 5HJLA 1SO6A 4P8UA 1F73A 3NQAA 1UD4A 4GIRA 1K70A 2YOCA 2VOTA 3R6IA 2EG8A 1PTAA 3KCJA 3GVRA 5HULA 1GKRA 4H19A 3BZGA 1EBHA 2POTA 1WZMA 3R12A 4R9XA 4N9DA 1QWKA 2WM0A 1UCWA 3M5YA 2VZOA 1G4SA 3U7BA 2PEVA 5EKYA 4GRTA 4UTIA 3WQ6A 2YA0A 1TPC1 2PTYA 3VCNA 3K1DA 3LSBA 3S9YA 1DTUA 5CG0A 2CITA 2X40A 3NEVA 4OTKA 4S2BA 1RCXB 1V97A 3RM8A 2Z00A 2X0YA 3ALGA 1POJA 1V0KA 3RRAA 1W9UA 1WDRA 2Z0IA 1W5PA 5E1QA 5JMUA 1BYCA 1I1WA 3NZ1A 3WEOA 1M1BA 3II1A 1GRGA 3H4WA 5TIMA 3QFBA 3KVKA 3H4GA 4JTCA 1MUMA 1QNOA 2HE8A 3EAUA 4MNJA 3CT7A 4M80A 3NVZB 1K9DA 1VBRA 1IXOA 3T4WA 3R0DA 1QI0A 3AXXA 5K7JA 4IXHA 1X7FA 1EUAA 1EC9A 1TPDA 4NJGA 3GHRA 1PWLA 1N8IA 4JPGA 3AIEA 1KFJA 5I06A 2EEXA 4XZMX 2BP1A 2OEMA 2QUTA 2JK6A 1KFLA 1US2A 4D1IA 3NM1A 4LT9A 1J96A 1IE7C 2XYLA 5HNNA 3VDGA 2Q8LA 4AUBA 1LF1A 3MA8A 1A50A 4UQEA 4DQWA 2NUWA 3U0HA 3IJQA 4KBXA 4LYKA 5C70A 3LLDA 2BVDA 1XIBA 1YPIA 4DPQA 1IEIA 3DECA 4O19A 3UVIA 1HIZA 1VBHA 4U10A 3UWQA 1TV5A 3CB8A 3TROA 2X2YA 2B0MA 3WQWA 1W3LA 2E7FA 3EOUA 4Z2IA 1HZYA 1W1YA 1B3ZA 3AHTA 4FF5A 3PUOA 3AUOA 1EKOA 3U57A 3PHAA 4U5IA 4HMEA 3ZJ7A 2J78A 1V59A 1E4NA 1XBYA 4JX4A 3BV7A 3FN9A 3HIJA 4ZO7A 2GSHA 3OLIA 1UWIA 3AXHA 3FDGA 5DRCA 5IDZA 3S2LA 4LRTA 3M0YA 1PYMA 3F4VA 3URAA 1ZTVA 4IIDA 3PVFA 4GC3A 3DAQA 3R10A 1B2YA 5LKYA 1R3YA 3VNKA 4Q8WA 2EF9A 3BICA 2GR1A 1I0BA 2HMCA 1MVYA 3V4BA 4I90A 3OODA 4RE2A 1NM9A 1R7AA 2PF0A 3P60A 4BHYA 3TOYA 3TN5A 2ABBA 4FLRA 3WX7A 2PDJA 2OZ0A 3WMCA 3W7JA 4OU1A 1V5XA 1E9YB 4B2DA 1NAL1 1G94A 2PGFA 2YXXA 4JYFA 1RBOB 4IGHA 2D23A 2BXZA 1JPDX 1AK5A 1PXGA 5D9NA 3M4HA 2WSYA 4IG2A 1SSDA 3IWPA 4TX9A 1PCKA 1JZ3A 2J3NA 2OGJA 3T7VA 5I24A 3GK0A 5CJ5A 2E6FA 5HMFA 4YTSA 2DIEA 5LXEA 3N2XA 4WIWA 3QN3A 1Z89A 1A80A 4Y96A 3RJYA 2DT2A 2Y4SA 3JZUA 1VJZA 2WQPA 1L6FA 1UKSA 1KW1A 1TE1A 1I9CB 2WSKA 3NQCA 4UMBA 3WNMA 1KBKA 1E71M 2QCCA 1WKYA 5AC6A 3AMCA 3KS6A 3WQ4A 3H2EA 4J40A 4AFYA 1IEQA 4W5UA 1X97A 5D33A 1U83A 4GY0A 1U2YA 2Y7DA 3WNOA 4DJEA 5FS6A 1XLDA 2ZRWA 5CBJA 4EX4A 1MQRA 4PMJA 2Q6ZA 4QE5A 1OX6A 1BZLA 3HURA 3GSMA 3RJXA 2WANA 5EA9A 3TVAA 4A05A 2H3BA 4MADA 1TMQA 4PTMA 5KZ6A 3CH9A 4WKAA 5AVHA 3G1FA 3UWYA 3BO9A 3GR8A 1DV7A 1PIGA 1T99A 4QIUA 4H4VA 4NXKA 2IKJA 1FKWA 2ZE0A 3FXGA 4K7ZA 3PUEA 3BV4A 4NZ3A 1ME7A 1QOPA 1KQZA 2WLYA 2WBKA 3QQ1A 2DSVA 3DBPA 2Q8ZA 4UNIA 1EF2A 4PBEA 1YNPA 5M3WA 2ZICA 5AVNA 3HQ1A 3QF0A 3JS3A 3FW6A 2DT0A 4HPNA 4WDUA 4E2BA 2NVAA 1OYCA 4AD5A 5T91A 4LAZA 4F40A 3IANA 4AXKA 3BURA 5E09A 3S83A 1J4EA 3K46A 2X1TA 4UTLA 3BVJA 4RL3A 3LCIA 4PSRA 3WBXA 2VWSA 3PUDA 3T8QA 3VZXA 3EMZA 3SCNA 4CN4A 2VI0A 2EXOA 2YZ5A 1GZGA 3IIZA 1DWJM 3HJZA 1AOGA 1CENA 3DG3A 3P2VA 3A4JA 3NGFA 3T44A 5I3JA 1ONWA 4XTDA 4UR9A 3KBMA 1OINA 1K8CA 1CXEA 4EPBC 3DGHA 5A8QA 1XV8A 2CEQA 3CUZA 4JICA 4KCUA 2WNQA 5AYIA 2G8ZA 1C9WA 5SWUA 3IVSA 1HO1A 5LNWA 1T3QC 1PSCA 5DF0A 4PRWA 3BLEA 1OIFA 2PODA 3NQVA 1MEIA 1OADA 2PWFA 1XKJA 5DFAA 3AIQA 1Q3NA 3FEMA 1TVPA 2GK1B 1XLMA 4TMCA 4LA1A 3S1WA 1WBHA 1BG4A 5DY2A 5CPOA 1SZEA 1E43A 1JFXA 5LIWX 4RDVA 3GC5A 1JPKA 3S5ZA 2ZZ7A 1K02A 1G4TA 3S2JA 1TWWA 2DW6A 2F6KA 6ALDA 4J56A 1JXJA 4DZIA 2A3EA 1BGAA 2BVYA 2E09A 3PS7A 3GVVA 2G3NA 2CHOA 3DEQA 3MT1A 3EF6A 4PL2A 4QDPA 2I16A 1NY1A 1SO3A 1UWRA 1Q8AA 5BXPA 3MI6A 4BWLC 1OC5A 1LL7A 3UJ2A 1FWFC 2P3EA 1GV4A 4XBJA 1F3TA 1R5YA 2PUZA 3RLHA 3MWAA 1ITUA 1RALA 4L9XA 4RE3A 2VZUA 2Y89A 4KPLA 3ISIX 2OYMA 4UXDA 1RH9A 2CERA 1TYPA 4P7QA 1JDFA 2BX7A 3D5HA 2VKZG 4NNBA 3Q67A 3O6DA 5FJPA 2ACQA 3W82A 1ZHAA 1XLCA 2B7PA 3EX3A 4WX2A 4H4QA 1XL9A 1FQ0A 4H8NA 3GYCA 3PZMA 3T4CA 3OU8A 3E5PA 1OCQA 1ALDA 4EMIA 3LTYA 1OGGA 4M56A 4WQ6A 1NPXA 3D3AA 2V63A 3LHZA 1F3EA 4WHBA 5A8GA 2NZLA 5JCIA 2C0AA 3TP4A 4IP7A 3DGRA 2ZUUA 3T08A 5C9ZA 2AGTA 4F9DA 4NYYA 3EMCA 3H54A 4X61A 2W27A 4Z2HA 4LY4A 2VX7A 3ORWA 4KWOA 2CKRA 2OYKA 1B5TA 1XCWA 3RCYA 5A6BD 1DJIA 1XFCA 2EG6A 1H7WA 3ZLFA 3PWGA 3AC0A 1KM0A 3PZVA 3OP2A 4IF2A 3CZ8A 3QY8A 2HPIA 4FX6M 4K38A 3WJYA 1L8PA 4IX2A 4URIA 3V5FA 1EX1A 3N6QA 1XISA 4C6OA 4O8RA 5A2CA 4LF2A 4W8LA 1OX5A 4GY1A 2PDIA 3UVAA 1AW2A 3ABRA 4DF0A 4WXYA 2CLKA 4RZ4A 2V81A 2VJXA 5MF5A 8XIMA 3SRFA 4Q4QA 4RPQA 3TW6A 3LTPA 2OODA 3GW3A 3LN3A 1NOUA 2GR2A 4HPGA 1MZHA 5CAHA 4HCHA 5DMMA 1ZBWA 1BFNA 4B91A 1NVMA 4DO6A 1DBTA 2ZE3A 4PMXA 3EANA 3NL6A 4S3JA 1P6CA 4IISA 4M6PA 5M2FX 4GINA 3A3WA 1HL8A 1GQNA 3KL0A 2ZDSA 3BCJA 4F48A 4WD0A 3OBAA 1XLGA 3COTA 4L80A 3CU2A 3H7UA 6A3HA 5JCKA 1KR0A 3RAOA 1O4UA 3EWZA 4I7VA 1RA5A 1T41A 1ZJAA 1DIEA 4E2VA 3IIOA 4GC4A 4QCEA 4G2DA 3URQA 1GSNA 1LPFA 3PZUA 4L56A 1HKVA 1SQ7A 3WY1A 1GJWA 3ZR5A 1GGOA 2GVLA 1YBQA 3KBWA 3HFYA 3VKJA 4CQBA 1L8NA 2Y2WA 2VRKA 2YB4A 2VEIA 3C8NA 3N15A 4H01A 1GG0A 2FZMA 3H24A 4GJ1A 3T6CA 2GJNA 3VOCA 2OPJA 1JUBA 3U6WA 4JDRA 4C6BA 5I78A 4QJ5B 1UWUA 2EPHA 3TTSA 3UXIA 1XHGA 2E5AA 1XRSA 2QNEA 4UBPC 3VI2A 2A2IA 2CBJA 2GGIA 5FL1A 4DLFA 1OFAA 1K3UA 3GG7A 1LBFA 1MO9A 4IIGA 3C56A 4HIBA 3B04A 4QBXA 3BW4A 3GX9A 1F3WA 1FIQB 1KCXA 4FI4A 4WVXA 5DEZA 2QCDB 2DSUA 1V93A 1T8QA 5EB8A 1W5NA 5H2ZA 4A3HA 4YS1A 1AQMA 3QPZA 1E9IA 1NFPA 1RZMA 3BH4A 4GQQA 3WKZA 4WJ8A 1EJRC 2G50A 4PTWA 2QUUA 3A13A 1HN1A 4IL2A 1C91A 4ZTXA 1LORA 3O6CA 1BVZA 4TUFA 3M0IA 4QG6A 1V7YA 1R8LA 5LNRA 4W4QA 1V6TA 4QJ3B 4H7CA 1H61A 2YJQA 1XD1A 3L21A 7TAAA 4MJZA 2HROA 3SCUA 3UZJA 5I3FA 2F8QA 3S0CA 4NIRA 3FCPA 2J62A 2ZUSA 1FWDC 3U8GA 2VVNA 3VUSA 3KLJA 4ZOBA 4JTGA 3LQLA 4GIEA 2G96A 1A5MC 2NPXA 1YADA 1QO5A 2CU0A 3IUDA 1A5AA 3DCPA 4DLMA 2JK2A 4GUIA 4GFIA 5G1YA 1E4IA 3H2CA 4UQBA 1V3IA 4XIAA 1KRAC 4OT7A 3GG8A 1KWKA 1TRDA 3E0LA 2ACUA 3PBYA 3CC1A 4ES4A 3KDOA 4ZOAA 3W6MA 2Q3RA 2CXEA 1HJVA 2R1PA 1YKWA 2D2HA 1GVQA 2WCSA 3GM8A 1TA3A 4EXAA 1KXQA 3H4KA 1TIWA 3CUXA 1PKYA 3PP7A 3CM4A 3ID7A 1ME8A 2JEQA 2Y24A 3W27A 3P81A 2C79A 1RCQA 5F7UA 4PUWA 3WNKA 2Y63A 3T55A 3GRIA 4KIEA 4AF0A 4U33A 1F6PA 1QHOA 2Y1HA 1WYGA 2O9TA 3JRKA 2J7FA 2HRWA 3CV2A 4FF7A 2AAAA 3IK2A 1S2CA 1X2GA 4DRSA 2HDJA 4M8UA 2DZBA 1FRBA 1QBAA 2FVMA 3PG9A 1DQUA 6REQB 4RUBA 5CSRA 1UASA 2CLMA 1XYAA 4KFPA 4TV6A 1TQJA 3O6AA 3LCHA 3I65A 3W75A 1DIDA 1ZP3A 3KEHA 1MW0A 5IBXC 5T9BG 3SCRA 4A8NA 3PPHA 4AF0B 1E1CB 5D2WA 1GTEA 4DAFA 2DSZA 3L23A 5JBFA 4O13A 3B8WA 4MUZA 1ZY9A 3B8DA 1ZZMA 2EQ6A 3L5MA 4P7LA 1G69A 5TD4A 5KMYA 3B8UA 3GC2A 4IPNB 2DGAA 3CQHA 4H2CA 1FO4A 1H1ZA 1UPPA 4Z08A 4EPKA 2Y8VA 2HSAA 3W70A 2QZRA 1GQIA 4LVGA 4AZCA 2WJEA 4H9XA 2WC3A 4PB4A 4BURA 4GUFA 1ZDLA 1TUXA 3SUWA 2P53A 3LHUA 3EUB3 2WPFA 3KDNA 1Z8AA 4UQAA 4LS1A 5F4XA 4RW5A 1PX3A 3L4VA 2DJLA 3TQ0A 2PC8A 2BY2A 2WP6A 2D20A 2QIWA 2REQA 2VEMA 3RNMA 1IEWA 3UR7A 3WENA 1K1DA 4LW7A 3PANA 2XVLA 1M3UA 3QV8A 3R0KA 2WOQA 3ITYA 1EPVA 1SW0A 1KO0A 3P6LA 4D6FA 3MKVA 3W25A 1HT6A 1H09A 3RK8A 3QVQA 4AWUA 1GYMA 1M68A 3EKLA 3OGVA 3SADA 2I57A 5EMYA 1BGGA 3BJFA 1J93A 3EX4A 4F0KA 4UCFA 2W91A 3MW7A 3AQUA 4NJIA 3MPGA 2BDQA 1V02A 1ZNNA 4E8CA 3VXGA 1KKOA 5D03A 2A7RA 2QCMA 3AROA 3BTNA 2GOUA 3M07A 1W1PA 1NDVA 4IIFA 1YIXA 3SY8A 3V1HA 3EBVA 4V33A 4ATWA 1MO0A 1AFSA 1VRXA 2R9RA 4I9TA 3KLLA 2NV9A 1QMLA 1S5MA 2DY3A 3U2CA 4PBGA 3W86A 3VOJA 3AO0A 3WQCA 4XSLA 4MJ2A 4BJHA 1XX1A 2ZOXA 4B3LA 3L4ZA 3WLOA 4A3YA 3C3NA 2VUNA 1X96A 3PWIA 2FPVA 3TW7A 3E0IA 2ZADA 2OEJA 5E0CA 1Z7AA 1I45A 1NARA 4Q7BA 4HKPA 5KZMA 3IV8A 2EQ7A 2WZTA 4MNLA 5BXRA 1QXLA 2DZVA 3RNDA 4H04A 3HG4A 3E0FA 4WXZA 1GNXA 2G41A 3DHFA 1YDYA 3ZSSA 2O9PA 4GIYA 4V1YA 2NVDA 4ZZ9A 1ITXA 4J3ZA 4UB9A 3ZSTA 4EANA 1O1ZA 4PB5A 4L4OA 3UW6A 3V36A 3PJUA 2G95A 2J9ZA 3CTTA 4DELA 4LS0A 3BSGA 4PUEA 2WOVA 2YDRA 7REQA 3HPFA 4DWSA 2C13A 1X1OA 2ISWA 1R2RA 3DKJA 4RNFA 3QC0A 2POZA 4P2VA 1XH0A 4EK7A 4LU0A 1EDGA 1A3XA 3B9EA 2YL5A 2PURA 3MANA 1C7SA 3ABQA 3W85A 4A3RA 1ODUA 1OF6A 4F2TA 3IUIA 2Z1KA 3WG6A 5D04C 2IPJA 2C7FA 1L6WA 1PKLA 2Z1WA 4Z2LA 5JCLA 4JTUA 1A5CA 1RR2A 1O94A 5D38A 4U3AA 3WLHA 4GOAA 2VUYA 1TKKA 1MDRA 3DUGA 2CDUA 3ONBA 3QOKA 3LDVA 3M0LA 4DJFC 3WBEA 4EIVA 1EOMA 4G6CA 4XZHA 4RPPA 2WMIA 4RE4A 2PD9A 1UR9A 1NWSA 4RDWA 1MRAA 4GA8A 4TO8A 3P5YA 3TN4A 2WJZA 4GNJA 2W5FA 3AXMA 1IWBA 4V28A 3TJXA 1EGVA 1JYWA 4NJKA 2PP3A 1UBSA 4DHGA 3FX4A 5HXMA 2BWGA 1YW1A 3UG8A 4MB3A 1PJ9A 1SZGA 3MO4A 2V3AA 2BOFX 3CLWA 3LMZA 4C6CA 4MLRA 3EDDA 3CWNA 3INPA 2NQ9A 4K7YA 3HU7A 4B5VA 5DQPA 3R07C 3HV8A 3U4FA 2NT1A 1W1A1 4XBKA 4H4PA 4QLJA 4LCQA 3KBJA 2AL2B 3SW6A 3EPOA 4LC6A 1XDMA 4JFUA 3THQA 4OV4A 3P8JA 3WL0A 5BWFA 5XINA 5JBEA 1KFWA 4AD0A 4GYPA 1BF6A 4D8ZA 1D2KA 1LP6A 4IFRA 3B0VC 3W7OA 3HGJA 4ZVJA 2J6XA 2KX9A 3WH7A 1EJXC 4HSHA 3E2VA 2ZX6A 4TR9A 4CEUC 4AWSA 4K2SA 4P5UA 2QJHA 3ONCA 1XYLA 4OBRA 4IP4A 4ML9A 5AYYA 3PBWA 1S5NA 2V2CA 3W7LA 3SECA 3I3BA 1K8YA 4C7GA 1DXFA 2VEGA 3W74A 2NX9A 4DNMA 1E51A 2J7CA 4XAPA 4LUJA 4PUUA 1QPRA 1CDGA 3S5YA 1E70M 3WH6A 4UTFA 4O17A 3CBWA 5EGRA 4M52A 3VE9A 4WY0A 3DFTA 4DBEA 4FOKA 3R58A 4XKMA 1J18A 1Q65A 4ZFMA 1SUXA 3S8HA 1OY0A 1GOWA 1RJPA 5I3GA 4H9MA 4Y8EA 3I3EA 1OFEA 3LB0A 3B9JB 3GXIA 3BJSA 4X9YA 3TWAA 2X16A 4UIOA 4X9SA 1MFVA 1QATA 1CI1A 2VTFA 3O0KA 4YWIA 5HK4A 4C90A 3NL3A 2ALRA 4H9TA 1GQKA 1KM6A 1FWAC 3PNZA 1WXZA 3LS9A 3O3RA 5LNSA 3BUVA 4MHBA 3DESA 3HTWA 1JYVA 4DYKA 1VBJA 3TFCA 2J8FA 1QO2A 3GDLA 1VCFA 1VLIA 1V8EA 3NJ3A 3VM7A 2Z1BA 1TE6A 1VD6A 5LSMA 4D6HA 3STPA 1TG7A 3EWXA 2VCBA 1PHWA 1S2AA 3WO8A 2NQLA 2Z29A 5EFFA 4J28A 2WJFA 3APTA 2REQB 3VDAA 4QGCA 4G5DA 4DBSA 1KLYA 2J66A 4HBKA 3ZLGA 5DCEA 3BWWA 4IMGA 3QTGA 1QOQA 2PE4A 1AZ1A 1XIEA 1E6RA 4QS6A 1BLIA 1X6NA 4HTYA 1E0TA 2CLFA 3FIGA 4LRSA 3T9PA 4UOQA 1JCJA 1CXHA 1ECQA 3VNLA 2XGIA 1J9YA 2Z2BA 3WLMA 5HWJA 3SCTA 1AH0A 3GU9A 3PC0A 3SIMA 3CMGA 1VC4A 2RDWA 1DL3A 1YTKA 3ETRB 1JIBA 2GDUA 2PC4A 3UF9A 5C9WA 4PMVA 1X6LA 3TNOA 2ZA2A 4J5NA 2ZCGA 1XFBA 1JUKA 1V3KA 4F0MA 3O07A 1M5WA 3QV7A 4LB3A 3LPGA 4OUEA 4NHVA 1O5RA 3ZMRA 2VRQA 5B80A 4WK9A 3MP4A 3CZGA 4L1GA 4OIFA 2RUSA 2EPKX 1H2IA 5LIXX 3A23A 4LNYA 2WWCA 4OWGA 4KPRA 5CLTA 5AC5A 3E3HA 2C15A 4JQ1A 3W22A 3VAVA 2F6UA 1VP5A 2W3SA 1AH3A 3B97A 4RLIA 4XD5A 3VX0A 2YCJA 4R5EA 1HVQA 1QRQA 1QK0A 1LJYA 3L5OA 1XGDA 3LM7A 1PVNA 3O8AA 3FK4A 3W7IA 4LX4A 1YPXA 4C1LA 1N2VA 5CBIA 4V2XA 3RN6A 4ATLA 1LM1A 3N2BA 1OABA 1DIKA 3WEZA 2PI6A 5E9XA 1XQLA 1K8XA 3DYOA 4ZEPA 5HOSA 4YXGA 5CGMA 2WVSA 3KOZA 1HJQA 1F4AA 3PWAA 2WM1A 4A6GA 1JULA 3LY0A 4B16A 4FPSA 1H3GA 5U25A 3A12A 4XK2A 3LXAA 1LBLA 1JDEA 2XUCA 4XAZA 4HA1A 1FEAA 1KV5A 1TVLA 2FTYA 1BVWA 3UYCA 1YE6A 2ANUA 1UWAA 4LUSA 3N6HA 4ZQCA 1WZKA 5AZ1A 1JROA 2GVYA 1FHVA 4XO6A 5CC6A 1HKMA 3EB4A 2OWXA 1VKFA 4QE1A 1ZKQA 4IT1A 1YEYA 3VZYA 1G01A 3G1XA 1MQQA 5CPSA 3GUWA 4NNCA 1ISWA 4NAEB 4NI8A 1OCNA 2A85A 3WN6A 3VX1A 3QOMA 3PTDA 4HYRA 1L6SA 3TYBA 1F76A 3SQLA 4YL2A 1WE5A 4PMDA 2PGWA 2L5HA 3V0UA 2EBNA 2PZ0A 2BLEA 2ZC1A 3SIZA 2EAWA 3QEZA 1J0IA 1DWIM 3FA5A 4JIHA 2PDQA 4IGMA 2PA6A 3F4NA 3AYVA 1M7PA 5I7GA 3GC4A 3AU2A 3DOPA 2QIIA 3A5FA 1TX0A 3Q58A 2ACSA 5C9RA 5KZDA 2RKXA 1TYGA 1XM3A 4GI9A 3VD3A 4OV9A 1N61C 3WLIA 1ZENA 3G1AA 3ZJ6A 1TX2A 1SR0A 3GNPA 4O14A 2QCGA 4ZFCA 4H6EA 4XKYB 3SCVA 1I1XA 4PCSA 3NGJA 2FGZA 4O57A 1IZCA 1MXDA 3F4WA 5BW6A 5BOOA 4FNTA 3LUTA 3TYDA 5A69A 1CB2A 3VD4A 4ZBCA 4H8UA 4J3VA 1OCBA 1RHCA 4AD2A 2RGMA 4UFHA 5IXEA 1H11A 4FOUA 1X8FA 3VIFA 1G67A 4DBUA 5FACA 3LZ3A 5T26A 3AICA 1YBQB 1HNYA 3KRSA 5IRPA 1DORA 2H6RA 3TE9A 1UD6A 1BD0A 2O9RA 2VT0A 5D8WA 4KEZA 4ILSA 2ZX7A 1EYEA 3ABZA 1I4NA 1RVKA 3K4WA 3TH6A 2KZHA 4H7VA 4BI5A 4X2RA 4Z2JA 3ABXA 2DUAA 2Q8XA 3QGVA 4CD5A 1TTIA 1JEHA 2ISFA 5HUPA 4QSHA 1QCWA 4YYCA 4JN6A 2YDQA 3RX2A 4GUGA 4K8EA 1Z9AA 2VC7A 1H7PA 5RUBA 1MQPA 3QGKC 1UR4A 2ZIDA 5C0QA 5C9UA 4ZQPA 3EWWA 5LNUA 4PMNA 4GZ7A 5HBFA 3EWCA 4OQVA 1VB9A 1MUCA 4AWEA 2GJLA 5CSSA 4Q4RA 4D8AA 3PBVA 4ZO6A 1XRFA 1WKEA 3DJJA 4K37A 1UR0A 1XG4A 3FJNA 2C14A 3ARZA 3R1ZA 4UOJA 3BMWA 4HCDA 4I5XA 4PTNA 1QPNA 3HG2A 3SY1A 3VIIA 1LWJA 1XPYA 1I60A 2AAMA 3RMJA 3UNDA 3E6EA 1A5LC 1JR1A 2XTKA 1Q7ZA 3KOYA 4XB3A 1Q6CA 1V3JA 3TC6A 2BTMA 3QSRA 4GBUA 4Z17A 4I8YA 2XIBA 3QZ6A 4NZJA 3M16A 3AWNA 1QVBA 4AIEA 1BYBA 3GKAA 2CBUA 3OTRA 3PSVA 3H4XA 4DJDD 2ZXDA 3L2LA 1MI3A 4WRHA 3H2AA 2X1UA 2PWHA 2C19A 2G37A 4ERAA 4BF9A 1S46A 4NZ1A 3WIJA 1JZ5A 3BCDA 1ZAHA 5DO8A 9XIAA 1H2JA 3S6OA 3UWUA 1C8XA 1CX9A 4YWSA 1F7BA 1KFEA 2FFIA 4YTUA 1QW9A 3XIMA 3MSRA 2C8NA 1FXPA 4KRUA 3FJLA 1UP0A 3C2FA 3KXQA 4HA0A 1G4EA 1GHSA 3H53A 3WF0A 4Z0JA 2W0HA 3MVTA 3LPFA 1PBGA 2V3EA 3NFUA 1YPFA 2GR3A 1MSSA 4DJFA 5AB3A 4CLMA 4CVUA 5H8PA 3HQNA 2EQ8A 3PG6A 4ORIA 5K9CA 3WDHA 1RBAA 3W24A 2PWEA 2V5JA 3UWVA 2YIHA 3UNTA 3BGGA 1U33A 5BWAA 3N9RA 2TAAA 3UESA 1HKJA 4ZA0A 1IGWA 3VA8A 4NJJA 3GTHA 2P10A 3TDFA 4Z1DA 1RP8A 2BXYA 3KFTA 5CZSA 1T40A 2PDHA 4NZ4A 1BWCA 3P62A 1M65A 4HNNA 1FWTA 1SR9A 2WB5A 3WDIA 3IJ8A 4WZHA 4WSJA 2QCFA 5A6TC 1GREA 4F8XA 3K8MA 1UH4A 4ZXOA 2BHZA 3A7UA 5GQBA 3LHWA 2IXUA 1WZLA 3WZ0E 3AS3A 4OFCA 1EBGA 1K9EA 4GQBA 3WUBA 3BLIA 3S2NA 5A3HA 3PTQA 3TONA 3URBA 1D9EA 3VM5A 3W53A 5C55A 4D71A 4QCFA 4WLCA 5CQ1A 3B4UA 3MV01 4DZ5A 2ZUMA 3VFCA 3KVJA 3KVLA 1EQCA 4RZ5A 4CD7A 4LWWA 4NX5A 2A3CA 2CBVA 3WBWA 1R30A 2GQAA 3T0TA 4OGZA 3OIXA 3T0DA 5LHEA 3NPWA 1V77A 4P8WA 2IPWA 1Z32X 2BNJA 4OUIA 4GQGA 1GT8A 1SJDA 2P8BA 3CYVA 4DM2A 3CIWA 3BZJA 1W54A 2PMQA 3A7RA 1I2OA 1EWEA 3S42A 3DIPA 3UWWA 4FP1A 4JFTA 3SUTA 2W6RA 3R2GA 3QY7A 4O15A 3M0HA 4I7UA 5HPCA 1V08A 1TVNA 4PUDA 3VO0A 3DFOA 2RHGA 4MZ1A 3HF3A 4HK6A 1GYNA 3WLQA 2X2GA 1F6KA 3L0KA 1BPLB 3OYZA 4I7WA 2YGYA 1FDZA 1B54A 3AI0A 1AH4A 1UR1A 1CW2A 1RQEA 2PAJA 1KTCA 1BSIA 5LGXA 1R3TA 4H8HA 3LCLA 1D3GA 1LT8A 2VR4A 3B9OA 3CMFA 1OFBA 4UTMA 3ZJKA 5DBTA 4BZYA 5MKGB 4KF1A 4U3CA 4F79A 1U1JA 5EMLA 1W1IE 4HTBA 3AS2A 3ES8A 1TZZA 3RU6A 4A3QA 2JKAA 4FDCB 1DVJA 1TWZA 4WDTA 1C90A 5XIAA 1R9ZA 4FNQA 2ISSA 2DUZA 4NZ5A 4N7QA 2R6OA 2H8ZA 1XUZA 1RBLA 3VNJA 3K5XA 3W81A 2OG9A 4LAKA 3WLSA 2WC4A 1TPFA 2XM2A 2FPTA 5HA7A 3G1HA 2ZRUA 4J3XA 3ABSA 2HNEA 1JOAA 1FWHC 4JCLA 4AMAA 1JVNA 4NX0A 5KINA 4BF5A 4JYEA 1V6XA 3Q4DA 3C2YA 2FB3A 1LBMA 2YL8A 2FPYA 2TYSA 4H00A 3UR8A 1E0WA 1EGZA 4HNLA 3UXLA 1AD1A 2PWDA 4ZL1A 5HQLA 4H4TA 4MLJA 4MAVA 1LT7A 4MWAA 4HZ6A 4HNUA 1XGEA 3VVGA 1PB0A 6CGTA 5JCNA 3GDKA 4AXNA 5FOOA 1F8WA 1WAUA 2WPGA 1IF2A 1JDCA 2WHLA 3NO3A 5FF2A 1UIOA 3EOEA 1P43A 3ITXA 4D1JA 8TIMA 3GXMA 4E4PA 1ADOA 4R53A 5EPDA 4TXEA 2Z1VA 1XYFA 4HNOA 4IIHA 4DIAA 3DX5A 3H22A 4EQWA 2YX0A 5EBUA 5GPRA 2AKMA 4WEVX 2NX1A 4CCCA 3C2EA 3OJGA 1GYLA 4EQSA 2GGJA 4PFMA 2WXDM 4HSOA 2QCEA 2Q02A 2X41A 1GEHA 4IL0A 3SGUA 2V3DA 2CIPA 2CZDA 3W2KA 1CT5A 1JCTA 1EFZA 2XU2A 4AVFA 3N2OA 3RHGA 1HF6A 1E0XA 4J9JA 2OGYA 4EF9A 4HN8A 2TMDA 2F6XA 4NRRA 5D2XA 3TOPA 4PC8A 4BY3A 4IQDA 4YJ5A 1HG3A 3RX3A 3TXVA 1OD8A 4AHQA 1XLKA 4O8AA 3AHYA 3USBA 1O60A 3BGAA 3WQFA 2QCHA 3EB3A 3VNDA 4XZLX 4XX6A 3WLTA 2XWDA 1BKSA 2NQZA 3C0SA 1OX4B 2NSXA 4QE4A 1H41A 3SUVA 4E38A 2F5ZA 1XIIA 1CLXA 4JZ5A 3P82A 2OYLA 3C0LA 2GJPA 1FBAA 2P88A 2WOIA 1BRLB 3C86A 1JDDA 4QR6A 4OBTA 3NUKA 1BTCA 1E56A 5ECVA 3CHEA 2CNCA 4YNGA 1OF8A 1YYAA 3W7DA 4B5XA 3JVAA 3QFAA 3D0CA 3E49A 4DJDA 4ZQMA 3VKCA 2VENA 4NILA 4KW2A 3UD6A 1QR7A 3ZVHA 4CEXC 4JHZA 2D0GA 5I0DA 3HMCA 4HK7A 4RDYA 2WKGA 2H90A 3NVTA 1OFOA 3S1GA 1VH7A 1ICPA 5HUOA 1QNPA 1EDQA 3DN5A 3D3FA 1Z3NA 3K2GA 1U30A 3L67A 2PGRA 4IMDA 3P84A 2PWGA 3GR7A 3WQOA 5C2CA 3FFSA 3MMWA 4NAFA 2FGBA 3KHJA 1IEXA 2FDMA 3E74A 3SUUA 3TJ4A 1YNQA 1O6IA 3I68A 3XISA 2NQJA 2OU4A 2UY2A 3THAA 4ADWA 3KTCA 3WF1A 3NTYA 1QBBA 4AZ6A 1IHIA 3E1F1 5U4NA 3GDTA 1S1RA 2A3BA 2XSBA 3T0BA 5FF4A 2FTWA 2BY1A 1E4LA 2HS6A 3QY6A 4DXKA 2A5HA 1X38A 2XVKA 1B9ZA 2BZNA 4JNYA 4MDPA 4IJBA 1W2PA 4Q8NA 4JAWA 2J7BA 3ZVHB 4NEVA 1NTHA 3A5VA 2YCKX 1AQHA 2V69A 3P0WA 4EPDC 1S3HA 1KBJA 5FCZA 3CIXA 3NQ2A 3RM4A 2QDDA 3GG0A 3LZ5A 3CPUA 2NWSA 2CWNA 3J7HA 4Q8QA 3NQFA 3DERA 2CZEA 4P7RA 4CUCA 3O9NA 1AW1A 2O55A 3E0WA 2BC0A 5G5GB 3QKEA 3O16A 3K8LA 3TX9A 3SSZA 4L6DA 1Q6FA 4N42A 3WNNA 4DY1A 2PD5A 4JL2A 3G22A 4J57A 3N73A 2AQVA 4LAUA 1XDIA 1LRQA 1LUCA 4M7SA 4NQ1A 1M53A 1U1UA 3S5NA 2XSAA 1DXLA 4LEFA 2X09A 3S6TA 3IPWA 2E1DA 1E40A 1QNQA 2QT3A 2BV9A 4PCFA 3QW3A 3AYTA