4MMWA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium, l-xylarohydroxamate and l-lyxarohydroxamate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
381
structure length
381
Chain Sequence
MIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal structure of D-glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium, L-Xylarohydroxamate and L-Lyxarohydroxamate
rcsb
source organism Agrobacterium fabrum
total genus 137
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4mmwA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4mmwA01
2HXTA 3GY1A 3VA8A 3U9IA 3D47A 2FKPA 3MSYA 5FJUA 4JHMA 3UJEA 2PTYA 2OQHA 2PS2A 3QLDA 2PGWA 3FYYA 3CYJA 3UJRA 1PDZA 3T8QA 4E4FA 1BQGA 4GGHA 3MUCA 4G7FA 3ES8A 3PFRA 2XH7A 4FI4A 1TE6A 3UJSA 2XH0A 3MWCA 3SN4A 2XSXA 3V4BA 2HNEA 3BSMA 4Z1YA 3IK4A 3OP2A 2AL2A 3V5FA 2P0IA 2QVHA 2POZA 1MNSA 3SBFA 4KEMA 1W6TA 1MDRA 3H7VA 1EC9A 1FHVA 4EWJA 4H19A 3H8AA 1TKKA 3RR1A 1KKRA 1SJAA 3SSZA 3DFYA 4HN8A 3OTRA 4ROPA 3RO6A 3VC6A 1MDLA 3S5SA 5ENLA 2AL1A 1PDYA 2XH2A 4IT1A 4DHGA 3CT2A 3UJ2A 2AKMA 1OEPA 3I4KA 3HPFA 1R6WA 3CK5A 3SQSA 5FJTA 3GD6A 4ZA0A 2GGIA 3IJIA 3ENLA 2P8CA 2GDQA 3MY9A 3THUA 3BOXA 2PGEA 3MQTA 2CHRA 3TW9A 3JVAA 2ZC8A 3R0KA 2OG9A 2RDXA 3UXKA 3DDMA 3T9PA 3DESA 2GGHA 3RRAA 3DFHA 5J04A 4HNCA 3MZNA 4H83A 2PU0A 3NFUA 1ELSA 6ENLA 1SJCA 1JPDX 4GGBA 3N6JA 3QN3A 3R25A 3JW7A 3ZLGA 3RITA 3OPSA 1YEYA 3UCCA 3ZLHA 4A35A 3DERA 1WUFA 3UXLA 4X2PA 2OO6A 1RVKA 1JDFA 4GYPA 3OZMA 2XGZA 4ENLA 2DW6A 3VCNA 3DG6A 3DG3A 4KWSA 3P0WA 4F4RA 4JN7A 4FP1A 3VDGA 2ONEA 1MUCA 1KD0A 4GMEA 2P88A 2PODA 4H1ZA 3N4FA 3T4WA 2OKTA 3STPA 3TWAA 4HCHA 4J1OA 4IL0A 1BKHA 4J3ZA 3DGBA 3MKCA 1EBGA 2OZTA 4G8TA 3OW1A 1R0MA 2QQ6A 5FJPA 3R10A 1JPMA 4HCDA 4IP4A 2PA6A 4HNLA 4K2SA 4ZCWA 1DTNA 3TJIA 4A3RA 4MGGA 4Z17A 4GYPC 1NU5A 5BOFA 3GC2A 3NO1A 1SJDA 1EC7A 3CXOA 2OZ3A 4IHCA 2HXUA 3SN0A 2I5QA 4GFIA 3Q45A 4KT2A 4IP5A 3S47A 2AL2B 3P3BA 2PMQA 1NELA 1F9CA 1KCZA 3FXGA 3QKEA 4H2HA 1P48A 3TJ4A 2MNRA 3UCDA 4DYEA 4E6MA 1MRAA 4DWDA 2HZGA 3B97A 3PWGA 4M0XA 3VCCA 3D46A 4MKSA 1IYXA 1KKOA 2PTXA 3R1ZA 3QTPA 4K1WA 2OVLA 3K1GA 7ENLA 2OLAA 3TQPA 3OZYA 4GIRA 2PTWA 3PWIA 2PP0A 3TCSA 4DXKA 3NXLA 4M6UA 3ZVHB 5IDZA 2P3ZA 4JN8A 1EC8A 3GO2A 5EU9A 3TOYA 1P43A 3Q4DA 1JCTA 3BJSA 3I6EA 4HCLA 3TTEA 3V3WA 4GISA 2GL5A 4E5TA 2QDEA 4MMWA 2PCEA 3RCYA 2QJMA 2AKZA 2MUCA 4A6GA 3R0UA 1ONEA 3H12A 2GGEA 3FJ4A 5FJRA 4HPNA 4IZGA 3CAWA 3ZVIA 3IJQA 1XS2A 1ECQA 2XH4A 1L8PA 1XPYA 5FJOA 4E4UA 3SN1A 2QJJA 3N4EA 3DG7A 2O56A 3VC5A 2OPJA 2OFJA 4HYRA 2OZ8A 2FYMA 2GSHA 3QPEA 1TZZA 3U4FA 3TWBA 3DEQA 3IJLA 3RGTA 3VFCA 1SJBA 3FV9A 2DW7A 2PSNA 3CB3A 4DX3A 2ZADA 3EEZA 2PU1A 1FHUA 3FVDA 4KPLA 3JZUA 1E9IA 2GGJA 2PP1A 4YWSA 2P8BA 3ZVHA 2QJNA 2OX4A 3EKGA 4E8GA 1WUEA 3V5CA 3ES7A 2PPGA 2NQLA 3FCPA 3H70A 2QGYA 3T6CA 3NZGA 3UGVA 3DIPA 3SJNA 5BOEA 3R11A 3PK7A 3KUMA 3N6HA 4K8GA 1EBHA 2QDDA 3UJFA 3I6TA 2GGGA 3ZLFA 4DN1A 2PTZA 2PP3A 3P93A 4IL2A 2OQYA
chains in the Genus database with same CATH superfamily
1T5AA 2E6AA 1U30A 4BFAA 3HG4A 4R85A 2H90A 4D6IA 3AYTA 1YDNA 1RLCL 2GWNA 1VLIA 2WMHA 1KFLA 1RUSA 5FJUA 3E74A 1IV8A 4XTIA 5A6TC 1M01A 3UR5A 2GQ3A 1XDJA 4TQTA 1YE4A 4YMZA 4JQ9A 4GIEA 3MWCA 1V59A 4US6A 1UW9A 3QZEA 1VCVA 3EAOA 5AECA 1G4TA 3LHWA 3BICA 2FPYA 1AL7A 1XH1A 1TTJA 1EJXC 4F0HA 7REQA 1M6JA 2GZXA 1OFEA 2CYGA 1BYBA 2FLIA 3T09A 3GNPA 2NW0A 2W0UA 4MUZA 2CLFA 2B4GA 4XVDA 4NZJA 1JYWA 4H6KA 4XD5A 3CPGA 1TKKA 2IPGA 3WJSA 5IBXC 1AQHA 4QM1A 4JN6A 2YXOA 4RNIA 3DKLA 2NLYA 3L4TA 4XX6A 4EXBA 3RR4A 1V6WA 2XH2A 2VFHA 5A6SA 4PMOA 2V8ZA 1ZCOA 1UKPA 3WDRA 3SRDA 4BA0A 4DO7A 4MLJA 4D6FA 2PWDA 4PC8A 3LMZA 4NZ3A 4TX6A 3CMGA 3WLHA 3BO9A 4DZIA 1UD3A 3VABA 5D37A 3MP5A 3UU0A 2PGEA 3MQTA 1W5NA 1N7KA 2SFPA 2WANA 3AMLA 3GDMA 1OZQA 4MTVA 4C6LA 1G69A 3SY8A 4Q4PA 2HQMA 2BCPA 4IMCA 4FO4A 4CQCA 3E38A 4HZ6A 4H83A 4DVOA 1N61C 1Y0EA 4FIQA 1JI2A 1QWKA 4DUWA 1H60A 3HGRA 1GONA 1ADOA 3ZLGA 1AFSA 3E9AA 1QNSA 1NHRA 4HHMA 2CZFA 4H7VA 2NQZA 3ID7A 4ROQA 4A35A 1A49A 2YA0A 2Z26A 5F1UA 3M0JA 3GG1A 2FVKA 4PTMA 3VYLA 4AY1A 3ZM8A 3QR0A 3DFNA 1VR6A 2YCKX 2G37A 4GFSA 3WJZA 4DO4A 4AZ6A 2DEPA 4FXJA 5HAOA 5U4NA 1CNVA 4LEFA 2F5ZA 4F8XA 4M8UA 2VGFA 3SB0A 3EMCA 4ORMA 5EBAA 2VO5A 3N2TA 4X60A 3VDGA 1Z6KA 2ZUSA 4NYUA 4FLQA 2DZWA 2EPKX 3T4WA 3W2MA 3BW3A 1U22A 2HE5A 3BLDA 4KFNA 4DF1A 1B3WA 4J3ZA 4PRWA 1A5KC 1B0IA 1H11A 3GVQA 1ZXIC 1R0MA 2IKGA 4HCDA 1NAL1 5DCEA 3UWQA 3UWVA 3ZQ9A 3GUWA 3N6QA 1AUSL 4MPQA 4RPPA 1GYLA 4HHLA 2QPUA 1V0MA 5I5RA 1GPFA 5CZSA 5FEPA 5LHFA 2E6FA 5G5IA 1ZDLA 1R7AA 4N2YA 2J8GA 3MHUA 4FF7A 4MJ4A 2X50A 3LXCA 1UROA 4Z0SA 3Q45A 1SO3A 4AVNA 1B31A 1UUOA 5DBUA 2ZFAA 2GQWA 1LROA 2J6XA 1K4HA 4S2BA 2VTFA 4MWAA 1SFTA 4DUVA 2C14A 1THFD 3FXGA 2BY1A 1PXGA 1US2A 3ALFA 3TJ4A 2MNRA 1E3XA 4FX7A 1XLFA 4Y2WA 1SR0A 1LRQA 5D4YA 2CU0A 3PANA 3CUJA 1V4YA 3G1VA 5DF0A 5MKGB 2PDIA 1KFBA 3F2DA 1GOWA 5HQMA 5IFTA 4BK9A 1ZLPA 4NT0A 3PZQA 2EG6A 3CNYA 4W8AA 5HMEA 1GHRA 1DJXA 4C5YA 1T40A 5EMMA 2BOGX 5E0FA 1J0HA 4G56A 3RLVA 2PDXA 3HQNA 2DT0A 4BHYA 4CVWA 1V7YA 1WZKA 4UMAA 3TMLA 1P7TA 3LERA 3U2OA 3LTYA 5B7YA 4PODA 3R0UA 2XVKA 2VR2A 2AGKA 3EDDA 4DYKA 3W1RA 4EAMA 3UWUA 1XF0A 2E3ZA 4UZUA 3WF4A 2HS6A 2X1SA 5HR6A 2ZX5A 2QV4A 4PB4A 2Z24A 4W9TA 3PB0A 3P61A 3GU2A 3P5YA 4S3GA 1M04A 1F3TA 1O66A 3QLLA 4YTUA 3G0UA 2D24A 2WNNA 5AHEA 1GREA 1MSSA 3KM8A 1SJBA 4R5EA 1FWHC 1RBLA 3EDJA 3LG3A 4IGSA 3BAXA 2EPNA 3BTNA 1KRCC 2GGJA 1G4PA 4XO7A 8RUCA 2QJNA 1WCGA 2P1FA 4TVCA 4JIRA 2J47A 3GLCA 2G3MA 3LTPA 1WA3A 2NVCA 1E0VA 2WSPA 4WDUA 4ML9A 5H2ZA 5IHRA 4PFMA 2V67A 4W86A 1EIXA 3CPRA 2VMFA 1ONXA 4JAWA 3LRLA 1EO5A 1RVGA 3KLKA 3R4IA 2Y7GA 4INFA 3UJFA 1DXLA 5JCKA 5CH9A 5EFFA 3FVMA 4C6JA 4WD0A 1TR1A 1Z9AA 4YNGA 1ZTVA 2HWGA 1Z69A 3LNMA 2R1LA 1HKIA 1TPB1 5EMYA 4FX8A 4W7WA 4M7TA 4F2BA 3PUDA 4OT7A 3FYYA 3STEA 2OLHA 3R2GA 4GGHA 4IIDA 5I2UA 3KFTA 4AG0A 3KOWA 1KFKA 1AH0A 3VDHA 4EPBC 4RKAA 1R3RA 1A5AA 2E7FA 3WEZA 1VB9A 3SN4A 4CD7A 4JX6A 1UJPA 4HN4A 3THDA 2CLLA 3IK4A 4NZ5A 4LAMA 3GKFA 5CPTA 4YIWA 4D8ZA 4QJ1A 2VFGA 1MNSA 4X63A 1TCMA 4PL1A 2WSYA 3IV3A 5CPMA 2V3EA 3WLOA 4Y8EA 3NQ7A 1IR1A 3ARPA 2YDRA 4LAOA 4GCXA 3WN6A 5I7GA 1FFUC 1PX4A 4A8NA 3KOXA 2YDSA 5JQ9A 3SSZA 4LW7A 4EWND 3MBFA 4UMCA 4MYXA 4Z2JA 6A3HA 2TPSA 3PAJA 4HB7A 4DWSD 1AJ2A 3B3DA 1WE5A 3M5ZA 1I45A 3RM8A 3AMGA 2WO5A 1JXKA 3GD4A 3B0XA 3O05A 3DI1A 3W1QA 1HL8A 4DXVA 5I3GA 1Q13A 2J8TA 1JZ5A 1XW8A 2J62A 5FAJA 4BWLC 4JNZA 3KAOA 4IGMA 2I5IA 2X30A 3RJYA 1BG4A 1RBOB 2OYLA 1YLVA 4FB7A 2O7QA 3WF1A 1KBBA 3MY9A 1ZB5A 3LBCA 3HFYA 4NHVA 3BOXA 1XC4A 4HZMA 2YW4A 3DYMA 3R0KA 3CHCA 2OG9A 3D5HA 3L2LA 2XVLA 3S2MA 3TK7A 1UR2A 2ZQ0A 1KM6A 5EBKA 3KS5A 2VC6A 2ZUUA 1ISWA 4UZSA 4MAZA 3S9YA 2WC7A 1ELSA 2NUXA 5XINA 2CW6A 1Q2SA 4GX8A 3AIQA 4H8HA 1CX9A 1DWJM 1XSJA 3T07A 3G22A 1GTEA 2V5BA 5A2BA 3IJ8A 2J7BA 3GBDA 1DJZA 4G1NA 1QMLA 5CC5A 3CWHA 2CESA 4I7UA 1SZNA 1RVKA 3P2VA 5D2VA 4ONVA 1GKQA 5HDRA 4AZGA 2HNHA 1VD6A 2EF9A 1W9VA 4LANA 4BCEA 4J5NA 1IEQA 4F4RA 2GQ8A 1KRBC 2A0NA 2VXNA 3LNPA 3CGBA 2ONEA 2Y7DA 2VEMA 3FS2A 3QFEA 1IGWA 4H1ZA 1N2VA 3FKRA 4UUIA 1PTGA 5A2CA 5BMWA 1GOXA 3WH5A 3O0KA 4X0VA 2Z00A 3A24A 3XIMA 1Q7MA 1EXPA 3TLLA 3Q6JA 3VIPA 5FS6A 2X1TA 1B5TA 3AROA 3DGBA 2GR3A 3SCNA 3UT0A 2PURA 4ZQRA 4WJXA 4H4UA 2D0HA 1IIGA 1Y5VA 1GEHA 4IOTA 1BF2A 3WUFA 2YIHA 1YXCA 1JL8A 1YPXA 1OY0A 3NZ1A 4Q8QA 1OG6A 2VELA 3WNPA 1F8IA 2R1PA 2I5GA 4PCNA 1OFQA 3WEMA 4CCEA 4M7SA 4B9ZA 3GC2A 3MP4A 3H26A 3GHTA 3AS0A 2C7FA 3FW6A 1XCWA 5TIMA 3ZWTA 3WMLA 2OZ3A 4JGDA 2DPEA 2Z2UA 3B8VA 2Z1WA 3IGSA 3P5ZA 2G3IA 3NQAA 4WOQA 3APYA 3F5KA 5TQLA 4H2HA 2WLZA 2C19A 4XSLA 3LQGA 4AZ5A 3M6DA 3UCDA 4E6MA 1KM4A 1J0KA 3S83A 4AZHA 1DV7A 2BB0A 3PC0A 3LDVA 2WJZA 3D46A 4P7RA 5HJXA 4ZTXA 4FA3A 3BAYA 4Q32A 3WQ6A 1QRQA 4A22A 4E2OA 2EQDA 4QEEA 3GVVA 4MY9A 1DYSA 4UTIA 1EJUC 4CQBA 3GO2A 2AAAA 2W55A 3WKZA 3V0UA 1W91A 3TROA 1GORA 1EPXA 3IPWA 3FA4A 5A6LA 1GOKA 3V3WA 2JE8A 2DT3A 2EGZA 1UD8A 3G18A 3VZYA 1MEIA 1M68A 1DTUA 3WLNA 4EQRA 1NH6A 1TV7A 1XIJA 4RE3A 4Q4RA 1G1YA 1H61A 2BY3A 3EB3A 2O9TA 2VQUA 4PUEA 4HPNA 4IZGA 3E12A 4NF7A 3CZGA 3AI0A 5HA7A 4F9JA 4OBRA 3PSVA 4H9UA 4MNKA 3UESA 4B3LA 2QNEA 1QO5A 2PWEA 3P80A 3WD1A 4BQ3A 3BPWA 4CN6A 1T41A 1LWJA 3G1AA 2OZ8A 3DGHA 3QPEA 4QDMA 3H24A 1IF2A 1A0CA 4PTNA 3UR7A 4K8DA 4B91A 5D05A 3MANA 1TQXA 4U2YA 4FSAA 2E40A 1RAKA 2D2JA 3UD6A 1VS1A 2BOFX 2RDTA 1E9IA 1Z48A 2PFHA 5GJMA 2DT2A 4D6CA 4XBJA 3WD3A 1GZGA 4NXSA 1LTDA 4ZSUA 1BYDA 2NXGA 2RJGA 2QGYA 4XO6A 3DHDA 3HG2A 3FN9A 3LLFA 4EIVA 1V03A 2W0HA 4FALA 2AQOA 3O6CA 2CPUA 3E5PA 4ZSTA 3HJZA 1A5CA 3FYOA 4ICNA 3WLRA 4U5IA 2PZ0A 5DMLA 5HOSA 1FH9A 1E4IA 4TU1A 4ZB2A 1JFHA 2PP3A 1E43A 1JGIA 5I3HA 3W7OA 1EHNA 2IQTA 5G4EA 4S3CA 3U0HA 3OYZA 4Y9OA 2R24A 4IMFA 4RE2A 1E73M 5LXXA 5DFAA 2CDUA 1VENA 1K70A 1RJQA 3GC4A 1AD4A 4EF9A 4IFRA 2I14A 5FJIA 1CCWB 4R9XA 3WFZA 4BEQA 4S38A 4FNTA 3R8RA 1BFNA 1QNRA 1BWLA 3AZSA 2ZA2A 3MMDA 2VFFA 4D1IA 2EQ8A 2FFIA 1JCXA 4GJIA 1JZ4A 4ZFMA 4N9EA 3GDLA 4KKXA 1E0TA 2WV8A 2ZRWA 3SCVA 1ENUA 3C0QA 4WUIA 1J6OA 1O7AA 3V36A 2PZNA 1GKPA 3H2EA 1K7EA 2YFOA 3UZ5A 3W0KA 5REQA 1E1FA 4HNVA 1HKKA 3SAZA 1CGVA 4KRUA 4HYVA 5A8GA 3EPMA 2I17A 3LGEA 2YCLA 2Q01A 4M3PA 2C6QA 2XSBA 1IE7C 3Q58A 3VXGA 3CHEA 2R8WA 3FDGA 2X8CA 4F0RA 3SQSA 1AD1A 1ZAIA 2UWFA 2YVGA 1TMLA 3CV6A 1NSJA 2XFRA 3PWAA 5AFDA 3NQDA 2OYMA 3WJWA 3EANA 4AHOA 2ZC8A 3C3UA 3OODA 3H54A 1KLYA 3UXKA 2RAGA 3W1PA 3B9JB 3P67A 5CPNA 5C2CA 1XIFA 4F66A 2ZZBA 4HPHA 4QDWA 2C0AA 5LIKX 2C0HA 4V27A 4URIA 1BPLB 4M82A 4BQ2A 3BSHA 2WM0A 3AN1A 3W4RA 2CLMA 1T7LA 3U2CA 3EBVA 1Q4NX 3EWZA 1OJTA 1C93A 5BYWA 3MU7A 5DXYA 1ME9A 3H7RA 1GRFA 1R3SA 2OO6A 3DFOA 2WZHA 2HVMA 4NXKA 1XLEA 3D0CA 1ONWA 1QT1A 4UFHA 1OG0A 3CZLA 3AO0A 1JUEA 3UETA 2CERA 1E6XM 2GRTA 2YLLA 4ACZA 1FFRA 1W9PA 3QV7A 4QGCA 1GRTA 3QPYA 4IPNB 1P0KA 1QNPA 3GDKA 2VQTA 3RAOA 3SGZA 3TWAA 3H2OA 3DBPA 4N6FA 1RZMA 5MHBA 1W8SA 3BSGA 5CJMA 3G0SA 4K37A 4C91A 2PRHA 3I7SA 1TX0A 1VYRA 3CZKA 2GJPA 2DH2A 1BQCA 1XIDA 1FUYA 3OW1A 3HIJA 3DK9A 5ABEA 5EMLA 4LEQA 2V68A 1UZ4A 2V81A 3A7RA 3DJGX 1FP9A 4LUIA 4R7JA 2OSWA 1NOWA 3ANVA 1J11A 1M65A 2VNCA 3N19B 3OIHA 1RHCA 1ZY9A 2YB1A 2PDNA 2PDUA 3ARTA 2FB3A 3VMNA 3RK8A 2QUUA 4ZZ9A 4IFKA 1YPIA 3L4YA 4DY1A 1SB3B 2INFA 4I9JA 3K30A 3TYZA 3ZJ8A 3C86A 3GK0A 3P3BA 1J18A 4W88A 1JJKA 2IXVA 4O8AA 1R87A 4LRTA 1KV8A 3JS3A 2G0WA 4QX4A 1MW3A 3MSDA 3GTHA 4XK2A 3URNA 5FF3A 1CB2A 1PKNA 4Y8FA 5LIWX 2BP1A 3UVAA 1LLWA 5DBTA 5HWMA 2GR2A 2XIBA 1E1EA 1FXPA 1JIBA 4S3AA 3NA8A 2E9LA 2PWVA 4GVIA 2QCEA 4JIHA 4I5XA 2YL9A 4Q33A 3EWCA 4JIEA 4GIRA 3BMWA 1LM1A 4KWVA 5FOOA 3AHXA 1JGMA 4CNUA 3KTCA 2O7SA 4KIRA 4ZGYA 3BC9A 3Q4DA 3BJSA 2FZMA 3UY8A 3IWPA 4XZIA 1IR2A 3WNOA 3FNDA 2FZNA 2YCIX 1MMFA 2ZVRA 3NG3A 3VIGA 1BRLB 4KWUA 4NASA 3H23A 2QS8A 4GJJA 4S3KA 1JDEA 3B8DA 3G1XA 1QHOA 1ZPTA 3RJXA 4HKPA 3ZVIA 2JGQA 3GW3A 1OIMA 4AW7A 5A8NA 1D8WA 5FJOA 2UY3A 3T05A 1FWGC 3KTSA 4DJDA 1PWLA 3TW7A 1ODZA 1YBQB 1LLZA 4C1NA 4GG9A 3VKJA 1GVQA 3CQHA 3ISIX 3MA8A 3SEPA 2XISA 4EOUA 1PIFA 2DQXA 3MC5A 3CWNA 1TRDA 3UA3A 4LTSA 4FOKA 1SQ7A 5D8WA 2BGQA 2XIQA 4PN2A 3FVDA 4NYYA 4AC1X 4CQDA 4N7QA 5M17A 2NLIA 3ZVHA 3SCTA 1PZ3A 4DF0A 2PDCA 4LY4A 5JCLA 3LRMA 3C56A 1LORA 3NVVB 4AISA 1LVLA 1QBAA 3APGA 5TF0A 5A94A 3NEHA 2FIQA 3EDKA 3BLKA 3DAQA 4GUGA 4HK6A 3B9OA 1ZUAX 4JTGA 1X6NA 4I9MA 1Q65A 4ZXOA 2B31A 1JF6A 3PK7A 3LB8A 3KUMA 1CTNA 3KBJA 3POCA 1UR0A 5M03A 3B8SA 2WCAA 3OZPA 1D9EA 1FKWA 1BGGA 1EO7A 4MB1A 3L7RA 4C65A 1SO6A 2QMJA 4LV4A 4WY0A 3U9IA 3GXIA 1JD7A 1OYAA 4UTTA 4JHMA 2YZRA 2NXIA 3QHMA 4D6DA 4MDOA 3GFYA 4HNUA 2PGWA 3T8QA 2V3DA 1ICSA 1I2NA 1SO5A 4NZFA 4HIBA 5AHNA 4H4TA 4YVPA 3V4BA 4A05A 1CYGA 2D0GA 5EA9A 5F4WA 3G8EA 3AIWA 3N3TA 2POTA 3I68A 5HK4A 1JPHA 2QUMA 5CPQA 1E72M 3ARXA 3A23A 1TV2A 3AC0A 4NSBA 1HKMA 1SPQA 5CJ5A 5LZLA 4M24A 5BU6A 3ELFA 1E71M 3H7VA 1V3MA 3QVQA 1D7YA 1HIZA 1UUQA 1D8CA 2BHZA 1YTEA 5AYBA 4EWJA 1DEDA 3AJ7A 2C71A 2CFYA 5C7HA 3WQGA 4JYDA 3WELA 3AWNA 2RKXA 3CC1A 3PJWA 1SJAA 1XISA 4QDPA 1V0LA 2YVJA 3S9IA 3OLIA 3B40A 4ROPA 3RO6A 3TYUA 3HGOA 1MEHA 1Q6LA 4E0CA 4CN1A 2VFDA 4ACZB 1PTAA 2VZUA 2PC4A 3TYEA 1OBAA 3C8NA 1J4EA 3NQVA 5HMFA 3AXKA 1ZMDA 4EKJA 4PULA 5I06A 4ASTA 3QOKA 3O06A 5HQEA 3T7VA 1SZGA 1UC4A 4K38A 1EWDA 3UWZA 1I2RA 4RLIA 1TPWA 3BXWA 3OB8A 1J0JA 1Y7VA 1JEHA 3AU6A 1W3KA 2WVVB 2V69A 2X1RA 4EK7A 3RIKA 1XM3A 2RGLA 3SCUA 3OU8A 4FHAA 4NVTA 4L7ZA 3SCRA 3C52A 1XV8A 3C4UA 2ZUNA 3GWQA 3OPSA 1YEYA 2F6XA 3WK2A 3RMEA 3Q65A 2Z1SA 2R14A 3EEGA 2ABBA 2BHUA 4M51A 3A5FA 4HGXA 4BI6A 1NF0A 4DUXA 3T44A 3GE7A 2VRJA 4MNJA 3OZMA 2XGZA 4RW3A 1HJVA 2ATMA 2VGGA 3COTA 1JAEA 1KFCA 5M3WA 2A2IA 3NURA 3NAVA 3T0TA 4GMEA 1X98A 3G1RA 4F9DA 3BV7A 1W37A 2GVJA 3ZS4A 4K7YA 2F84A 4G1KA 1ADSA 4QNWA 2FZ8A 3WDPP 1BXBA 5HNRA 1XL9A 1EYWA 4X3ZA 3RX4A 1AZ1A 4PCSA 4QSFA 2WOQA 4BI7A 3QMTA 3GBEA 4L80A 2OZTA 1E6SM 3TTSA 2ZX9A 4GHRA 3UXDA 4PBFA 4R27A 1ME7A 2WCGA 1UZHA 3A9BA 4IPLA 1UG6A 3M5VA 4R9OA 4NQ1A 4PZVA 3WNLA 4WIWA 3TJIA 4NKCA 3TSBA 2LLEA 4D9PA 2W92A 2WMJA 4PCPA 5BOFA 1M1BA 3UERA 5FF4A 1F2JA 3AS1A 4FLRA 3L2IA 3LBMA 1ZENA 3DH7A 4J3UA 3GFXA 3LCLA 4EQWA 2E5AA 2CHNA 2AMGA 3ZT7A 3VZXA 1QW8A 4DBSA 2R9RA 3SSJA 1VBJA 1GRBA 4WX2A 2BZNA 1P48A 2A3EA 4W5ZA 3RLGA 1LDCA 3BWWA 2Y7EA 3GH5A 1SSGA 1EA0A 4M0XA 4QP0A 3C0LA 1K3UA 1XKJA 4KFOA 1KWGA 2ZC1A 1GVSA 5AC7A 4O16A 4AY8A 4LF1A 2BWGA 4KH2A 1R9ZA 5JH2A 3IJDA 3WBXA 3SADA 3CIXA 4M6UA 3ZVHB 3L8KA 3ZT6A 1EXBA 1M7OA 2PDFA 1DWFM 4UMBA 2E5BA 1RP8A 3PNUA 3QYSA 4U33A 4ATDA 4HK5A 3G2GA 4GC4A 5KINA 3S2JA 3PJUA 2QZRA 1B1YA 1F74A 2GK1B 4JKLA 3N9SA 5C7VA 3E96A 2WOWA 2FFCA 3W7GA 5GPRA 3VDCA 4IQJA 2WMIB 1ONEA 1BD0A 5I77A 2E8YA 3HURA 3INPA 3G8RA 1BG9A 3IJQA 5ABHA 3STFA 5G2WA 3QPZA 2XH4A 3RFAA 4RX0A 1ICQA 3NCOA 4P8XA 4QRNA 4W85A 3BK0A 1W9BM 2H8XA 4WEVX 2E09A 3ARVA 1XUUA 1XIIA 1BVZA 4IJCA 2UV8G 1KR0A 1UPMB 4M52A 5LGZA 1V3IA 3NQ2A 4LH8A 3CEPA 3W7IA 3FV9A 1B9ZA 2PSNA 2ZADA 2E8ZA 4XIAA 4BJHA 4GINA 3MJMA 3AS2A 2P8BA 1CLKA 4FDCB 2XM2A 1XRVA 3EKGA 4E8GA 1WUEA 3G1FA 4IG2B 5GJNA 3BLPX 1QNQA 2W3RA 4O1AA 2XVPA 2D3NA 4LXFA 3NIYA 1R2RA 4JD4A 3W9ZA 1WYGA 2WOVA 4GVHA 3T6CA 5A6MA 1K6AA 1NQ6A 1WDPA 1QOXA 4HJFA 1RD5A 3PFMA 3UGVA 3PG6A 4C6EA 4UNIA 1KBIA 3NOEA 3AMZA 1C91A 4UQAA 7ODCA 3TC6A 3OGRA 4GX9A 4O52A 3O7UA 1W1YA 2QCMA 5I02A 5F4SA 2GGGA 1FWCC 4C7FA 3VKAA 4E3VA 3ARZA 3VVGA 3P93A 4LBSA 1FFQA 3VNYA 4DELA 5LNWA 3B05A 1O94A 1XG3A 4AX7A 1F5ZA 4ZQMA 5LXEA 2BC1A 1L2UA 4EX4A 1GVRA 2QF7A 1U5JA 1H4PA 2DIEA 1KGWA 4RXFA 4WRHA 4O0ZA 3WLQA 4C1LA 2QCDA 3Q37A 3BVJA 4W7UA 1NARA 2OEJA 1CGYA 2YFNA 3UJSA 3B04A 1XC6A 4PEKA 1J10A 2FMOA 5DX7A 3B0YA 2WP5A 1KB3A 3BSMA 3RPMA 2BC0A 2BBFA 4OQVA 4PMZA 4NU7A 4OJYA 3T78A 1TZ9A 4UNKA 3QV9A 4I8YA 1GNXA 4GVFA 2YBTA 3O8AA 4J2PA 2JEQA 2DFAA 3QC0A 3R12A 1D3GA 5LIUX 5IXEA 3A47A 5ER0A 2I16A 4CGTA 4H8VA 5A69A 1YNYA 3LK6A 3B9AA 1QJWA 3RR1A 4C60A 3OG3A 4UTTC 3WDHA 3E0VA 3M9YA 4GZIA 2E1DA 1UCWA 1K8CA 1WBJA 3B0PA 1L6WA 1XSKA 4S3FA 3SW6A 4DWSA 2WOIA 4Y9AA 4DHGA 3QZAA 4YVVA 2C13A 2J88A 3D6NA 4PTDA 2F7FA 5DEZA 5EL1A 4CCZA 2Y85A 2F6KA 3W53A 4EMJA 3ECQA 4ZA0A 1VFUA 1VGAA 1LPFA 2P8CA 4TTUA 3KEHA 3PZTA 4GIAA 4QLKA 3W1NA 3W6MA 1RCQA 2ZX7A 3GM8A 3ONCA 1EHAA 1RPXA 4GNJA 2PDWA 3M43A 4YN5A 3JVAA 3AALA 4MUPA 3EMZA 4MNLA 4FAMA 4REQB 2IQ0A 3VIMA 5J5DA 3B4YA 4CCDA 2XFWA 2YVFA 4NL1A 3QHNA 4RDWA 4JFUA 1CI1A 1XYLA 3USBA 3PY2A 4E8CA 1SZEA 4L6OA 6ENLA 2PD5A 5BWAA 1GZJA 3W1UA 1KTNA 3MS8A 3B8TA 4M1BA 1TR9A 3LPGA 2A3BA 1PKYA 2X09A 3LPFA 4PMYA 3WF3A 4BF7A 2QYGA 2H9AB 5FF2A 4LV9A 4IQLA 2GR1A 1XBVA 3F4VA 4PMVA 2Q3OA 2Q09A 2QCGA 1JDFA 1VJIA 3NZPA 3C2RA 1XWYA 1C8QA 5RUBA 1JZ7A 3QOMA 1QOQA 1FKXA 1G5AA 2EQ7A 4H9XA 4MY1A 3DYOA 4EVZA 3GG7A 1KLZA 1QPNA 1CXHA 3G0XA 4CLMA 1KD0A 3BGJA 4N4QA 3QY7A 3CGCA 1AQMA 2R94A 3F4DA 3SY1A 1R3WA 3LLXA 2J7CA 1Q6GA 1QNOA 2QIWA 4XZMX 9RUBA 5K4ZA 3BJFA 1R9YA 3WLPA 4LNYA 5I79A 1GW1A 3ITCA 4U5KA 1IEXA 2NSXA 2JK2A 4QXIA 4ECLA 3G3DA 2CHOA 4GBUA 1Z41A 1O4UA 3RM9A 3R10A 1K6WA 2ZCGA 1MI3A 7CGTA 2BODX 4GRSA 2BVTA 5A6BD 4H2CA 5C9XA 3DHPA 3WYZA 4EAYA 1N5WC 1T8QA 3EA3A 1GHSA 4J3XA 3VIKA 1T0OA 3DECA 5DMYA 3GH4A 1NTHA 1FECA 5CPLA 2GUBA 2ZKMX 4HNNA 1AK5A 3GHSA 4MY8A 4R7WA 1UQYA 3IIXA 4RZ5A 4IXXA 1ZJHA 4AF0B 3TMQA 1XHGA 4UWMA 2VWTA 2CLOA 1EYEA 3DFSA 4LS1A 1YNPA 2ANUA 1XD1A 5EYWA 3WH6A 1IEWA 2ZDSA 1Z32X 3B97A 3VCCA 1T6MA 1IYXA 5I07A 5G1MA 5FA5A 2TAAA 3A4XA 2OVLA 3TQPA 1OX4A 1NWTA 2Z29A 3RPDA 1AW2A 3W7HA 1KA9F 1PYFA 3RX2A 1N62C 4QTGA 1AMYA 4QSHA 4CNPA 1AJ0A 1WNOA 2P3ZA 3WQVA 1BVNP 3IS4A 1I60A 3GD3A 3RF9A 3II1A 1ZJIA 2OGJA 5G2IA 1A4MA 2WNZA 3I6EA 1F6PA 2B0MA 3PTQA 5T26A 3AHYA 5HUPA 3CHDA 1ZGDA 3BL3A 2Z7KA 1JI1A 3E2VA 4IM4A 4XAPA 3QV8A 3KW3A 1DJWA 1K8ZA 5JU6A 3VOJA 1Q6CA 4HPJA 2ACQA 4Q8TA 1FFVC 1KQZA 3T0CA 3OHMB 1U1HA 4UBPC 1M9HA 1MRQA 2XZ7A 4QCEA 1VP5A 4HNTA 3PPHA 3BGAA 3ABZA 5DMNA 3IV8A 1KM1A 1JR1A 1C8YA 2XSAA 3EA1A 1JCLA 5E0KA 3EAUA 1SMDA 1V7AA 1TPFA 1KXTA 1RLDA 4JOMA 1H41A 1E55A 4KF1A 3W84A 2YBUA 5U1OA 4QAWA 1UH3A 3TN3A 3GU1A 2PRLA 3F1QA 3N14A 4JICA 4FXRA 5M5DA 3W7MA 3GKAA 4P2VA 3CGDA 4FXSA 1VCFA 4GK8A 4J3TA 3MPGA 3BCFA 2JF6A 1FDJA 2HPMA 1BGAA 5CSRA 3EOEA 1TTQA 4Q7NA 4O50A 5E93A 3DK8A 4NJKA 3OBAA 3UPWA 5LA1A 2OX1A 4ML4A 1F7BA 2E3TA 2DUZA 1LQ0A 3BG5A 2DVTA 2OQLA 4C5ZA 1WOBA 3VX1A 3K8MA 1OQFA 1BXNA 3S4TA 3FDKA 4LC8A 1OK6A 2ZRXA 3DGZA 5CSUA 1V3JA 1DVJA 3GXPA 1UWQA 4LVBA 1X2GA 3EWWA 5IDIA 3BAWA 9XIAA 2NV2A 4PMJA 1RK5A 3EOUA 3CYJA 4ZO9A 1FWFC 2HV5A 3ITOA 4BURA 1K02A 4NRSA 4NG3A 2DSVA 3MUCA 1QNVA 3ES8A 4DAIA 1VLWA 1OYBA 3B8WA 2DV0A 5DO8A 3AYVA 5HUOA 6REQB 4GACA 2J6VA 4AZCA 1OWQA 1JUBA 4D72A 4BI5A 2J9XA 1T3QC 4JCMA 3WFAA 9XIMA 1B4KA 3M07A 3TA9A 3DN5A 4LJ3A 4NJGA 1TYPA 4WR3A 4FIRA 3LS9A 3LCWA 3M44A 2VVSA 5DELA 3ARQA 3PZOA 1A47A 1JULA 3ANYA 1W32A 2DSKA 1VQZA 1C92A 3OTRA 8TIMA 4O14A 4KW2A 1JXJA 2RJHA 4LBUA 3JR2A 5LA2A 3MV01 1PTDA 4P61A 1K8YA 3PF3A 2PBOA 4DPQA 3EXSA 4IJRA 4DM2A 2DORA 1Q7QA 4AC7C 4ATWA 2W5FA 2ZVIA 1QXLA 3QBUA 2GGIA 2VD8A 3K8LA 3EKLA 1X2HA 3E2SA 3EWXA 3DHFA 1FWSA 3O3RA 3T42A 5C6MA 4LCRA 4N0RA 4KEVA 4O8RA 1LG2A 2X0SA 3U3HA 5D09A 2GJLA 2RDXA 3QSTA 4US5D 1U33A 4NAEA 5E5CA 4CEXC 2Q8XA 4A21A 5FSDC 5J04A 1BTCA 3FGCB 3MZNA 3SIMA 3FOKA 3L2MA 2A21A 1HP5A 6PTDA 1FH8A 4F2TA 1E4MM 1KCXA 2FPTA 3H53A 1XRTA 5KVHA 1UH4A 4DWSC 1LUCA 3FKKA 2EKCA 1VAHA 2IUZA 1HO1A 4XSMA 3L68A 4QBXA 3FHAA 3MV11 4EPEC 3FSUA 2YJQA 3CLWA 3GVRA 5BRPA 3KE0A 5AYZA 1RXOB 1TO3A 3PHAA 4P7LA 2GR0A 3L5OA 4JN7A 3W73A 2WP6A 1XIEA 4WQ6A 1KM2A 1UWUA 3W2UA 4L6HA 2BNJA 2P88A 2FZBA 4AH7A 2XINA 3W02A 5HWNA 3CV2A 2V5CA 1MFUA 2G50A 3W82A 1BKHA 1C7SA 4H4WA 2VKZG 2HMCA 3K5XA 1M7PA 5BXRA 4AD1A 4WDWA 4LYRA 2Z1KA 3CTLA 2FMNA 3VCRA 4DNMA 3DC8A 1FCQA 4YVXA 2W62A 4HNLA 4XZNX 2Y1HA 3LI1A 4RDZA 2ZZ2A 5HMSA 5KZEA 2C15A 1EJTC 3A64A 3V0TA 2QUTA 4OBTA 1DWIM 1DQUA 2I5QA 3GHRA 3CUFA 3F2CA 1WQ5A 2D23A 4JR5A 3WLLA 1LOSA 2ZBTA 3EGJA 1WV2A 4YXGA 4O57A 4GO9A 4A3UA 1OT1A 3CM4A 2X41A 4DPPA 3ONBA 3AIUA 4B4HA 3NVYB 2VX4A 1V93A 3NDZA 1MQQA 1G94A 4Q4MA 1XBZA 1GETA 2RABA 5HINA 1WKFA 4YYFA 2C79A 2PBGA 3CT7A 3NQEA 5BW6A 4O15A 1EEPA 1I2PA 1XLIA 3K1GA 2OLAA 3UZJA 2I7GA 4XUGA 5E9AA 4CVUA 4JIQA 4O10A 1E6RA 1H3GA 4O0QA 1RD6A 2JIWA 5HNNA 3PWIA 5E6YA 2PP0A 2R1MA 1JRCA 4NNAA 3KRSA 2PAJA 3EB2A 1PHQA 3RNDA 5IDZA 3O9NA 3HG5A 3WK3A 1EB3A 1G7VA 5BROA 4X9YA 2NT0A 2BGNE 5EGRA 1GRHA 5DMMA 3AWOA 2VX6A 2E1WA 4JBRA 1KQYA 2G4JA 4E5TA 3CXBA 1WXZA 2EG7A 3KP0A 4B5XA 2V9DA 5BRBA 3RCYA 3SI9A 2CBJA 2Z1BA 4FOJA 4TO8A 2OEMA 2ZRVA 3FX4A 1Q8JA 4GZ7A 5JUVA 4HPGA 3FJ4A 2YB4A 6TIMA 3A7AA 3FIGA 5KETA 2W61A 1XYCA 5BZAA 3O6AA 4OTKA 3G5EA 4TV6A 4ZL1A 3GXMA 4XKYB 3ME3A 4M81A 3HB9A 2WVTA 5FL0A 1QBBA 3SN1A 2NPXA 3EPOA 1HKJA 4O1FA 5D8ZA 3SGUA 1NIUA 3H4WA 2E6YA 2H8ZA 2Z25A 7A3HA 1AW1A 4GUIA 1XYFA 4M1RA 2PI6A 2Q8LA 1Q6RA 4GH1A 1U5VA 5DXXA 4C6BA 3DEQA 4GQGA 4HOXA 3CQIA 4H4XA 1G9HA 4Y7EA 4ZBCA 1EP1A 4DXXA 4AD5A 1FVPA 1C8XA 4K68A 1LRTA 1F07A 2DDXA 2OX4A 2TSYA 4PL2A 2VEFA 5EB8A 5H8PA 4NAFA 3HOJA 5CG7A 4AY7A 2Z6IA 1FEAA 2WNWA 3TYCA 1S7MA 1QHZA 3HTWA 4ADSA 2X1UA 1QO2A 1JOAA 1QOPA 4L6DA 2ZZCA 1YDYA 4FLSA 3DCPA 2WC3A 2V30A 3NO3A 2D73A 1Y65A 3NZGA 5EY5A 1RSCA 3DIPA 3H2MA 4WLCA 4K8GA 3CUGA 2KZHA 3SCWA 4MZ1A 5IHSA 1XANA 3U57A 2VCBA 4B15A 1F3WA 1LWHA 2A3HA 3VE7A 1S2TA 5G1TA 4W93A 1IQ8A 3VAVA 3C6CA 3WQEA 1VJSA 3VD3A 3KLLA 4JTEA 3NGFA 2FKPA 3NQGA 4JDRA 3ZIZA 2OXNA 1JRPA 4QJ5B 1E15A 3S9ZA 1CXEA 2RDUA 3KCLA 4A2RA 2DU2A 3UJEA 2PTYA 5DY2A 3KRZA 3CB8A 3UJRA 4XVEA 3E49A 3PZ9A 4G7FA 2YR1A 1LOQA 5CBJA 1TE6A 2Z6JA 3C2EA 2XH0A 4WHBA 1OFBA 3R89A 4DNAA 1TB3A 4PUKA 4Z1YA 5BCAA 3S1GA 4Q4OA 3CLMA 1Y5WA 1UD6A 1O5RA 3KDOA 1SFLA 3M0VA 1QFEA 4IQEA 3ARRA 4NJIA 1XYZA 5FD0A 1ME8A 4LB4A 8XIAA 2GFTA 1QPRA 1XPGA 3UZWA 1O5QA 1KFEA 4S3EA 4DM1A 3CYVA 4JQ2A 5G2HA 5KMYA 4ES4A 5AZ0A 1GYMA 3WH8A 1FBAA 5JIWA 3VTRA 4H6QA 1DJYA 1EJWC 4IMGA 4XZHA 7XIMA 2TPRA 4AD0A 5A5WA 4L65A 4JQAA 1XLCA 1W9UA 1KCKA 2QJHA 3NQMA 2BSLA 4E2BA 4KCVA 4Y9NA 5I00A 1TPC1 1PJ9A 3VK5A 2QCCA 4IX0A 2BGSA 1LP6A 4UOJA 5A8QA 3TDFA 2WHMA 3VUPA 1S1RA 4JTFA 3MTWA 4Q4KA 2NUWA 3CZEA 3FK4A 3TR9A 2D0FA 2DZSA 3RILA 3NVWB 5EKYA 1LZOA 1ONFA 4HNCA 3ABQA 3O2LA 2DIJA 2F8QA 2EJAA 1MVYA 1AA1B 1ALDA 4B4FA 3L5LA 4UQCA 5LNVA 2XTKA 3PBYA 3XISA 1XSIA 3R25A 5CG0A 2WMKA 1TWDA 2RFGA 1TV3A 3ZLHA 1W2VA 4ADWA 3QFBA 1W5OA 2PDKA 1EH9A 1SW3A 2J27A 4DJFC 2L5HA 1E40A 4AD4A 4IIGA 3CZ8A 1FWIC 3S1VA 3VCNA 3UXAA 4D1JA 1V3KA 2XIMA 3K1DA 3MMWA 3SQPA 4RNJA 1XD0A 5K9CA 4C6OA 4PA8A 5JCIA 4CU7A 1E6PA 3DYPA 1AH4A 3EA2A 5FF7A 3QJAA 4GJ1A 3RM4A 4HCHA 1J5TA 3U2ZA 1S3HA 1GJWA 4NEVA 1TJRA 3GRTA 2QDHA 3QQWA 4FK9A 3UWEA 4C7GA 4KCUA 3UYIA 3LHZA 4KESA 3KXQA 4IP4A 5D9OA 3HJEA 5ECUA 4QQUA 4Z1CA 1UZ1A 3NDOA 3F4WA 1OVDA 2CLHA 1UC5A 4KEZA 4KPRA 3ZT5A 1S5VA 3S6DA 4EXQA 1H7RA 1A80A 4S1FA 3W01A 1PO9A 3K13A 1GEUA 1C7TA 3SUUA 4ZODA 3M0XA 3AAMA 3ZXWA 5HPCA 4TX9A 3W7JA 1NDVA 5AB3A 4JYFA 3IJ7A 3BANA 5A8MA 3VNIA 3WBAA 3G24A 1SZRA 3LI0A 5EMUA 1PYMA 4MKSA 3G3MA 3TTYA 3ABSA 1DXFA 4K1WA 4RV8A 1R3QA 4C6MA 4Y90A 1QW9A 3RU8X 1RQEA 2OELA 5EBUA 3W6LA 4AZBA 5EU9A 1TRIA 1ZBVA 1KO0A 3T4CA 2ISWA 2D2HA 1ZU8A 1F8WA 5GRTA 2VX7A 2PDBA 3BLEA 1EIBA 4WOZA 4MB3A 4Z2IA 4O13A 4DBUA 1SUXA 3OIXA 2Y70A 4IXHA 2EQ6A 1FEBA 3UGRA 2FGLA 4YCOA 3KDNA 2OU4A 2OGYA 3AUJA 3E0WA 4DLMA 3V18A 1FA2A 4U28A 1PPIA 1V6TA 3NEVA 3W25A 2VDIA 3O0HA 1XLJA 4ZO7A 4B5SA 2QV5A 1X6LA 1MNZA 1XHCA 3QFAA 4ZQOA 4MJMA 1VEPA 1VFFA 2REQB 5J8LA 2FYMA 4X0NA 4DO6A 2CBVA 3IJLA 3A4WA 4F79A 3RGTA 3GDBA 3VFCA 4QJ3B 2PU1A 2ZX8A 1H51A 3CL8A 1QDSA 4O54A 3NJ3A 3U4AA 1NOUA 1B3VA 1XH2A 1VRDA 3MWAA 4HMDA 4PMNA 3SO7A 4EMWA 2C1HA 3QMSA 1W1B1 2G3NA 3R5EA 1MO0A 2XM1A 3P82A 1P0EA 3AMCA 3F5JA 4G7EA 2A1YA 3AIVA 2HDJA 1QASA 1X96A 4EM3A 3OVQA 2O9OA 1RY8A 3VGBA 3SJNA 3HRDC 3LADA 3R11A 4J3WA 4C6NA 2VZTA 1EBHA 2XVGA 4B9YA 4AHQA 3PUGA 1E4LA 3SRFA 4DN1A 1V8EA 1WKEA 1IIHA 4QIUA 3ANUA 1LG1A 5FS7A 3C2YA 2IKIA 3FXYA 4K1GA 3PJTA 1XR2A 2VRKA 2WPCA 1V79A 1AG1O 2PWFA 3VA8A 3E3HA 2YDAA 3TYBA 3GC5A 4WXZA 4F40A 1S5TA 1GQIA 3QLDA 2VZSA 1NJJA 1KW1A 2QJIA 4G5DA 1OIFA 4FZIA 4I7VA 2BTMA 3RLUA 3SCSA 4FI4A 4LVAA 1OFRA 3H7UA 1F3PA 1IXNA 3VIJA 4H04A 2EJ1A 3L0NA 1NDYA 1EUNA 3WO8A 4UNLA 3DFPA 1XLLA 3V5FA 1HF6A 1IWPA 5G5HB 2RGMA 1QI2A 4ERAA 1GXFA 4EQSA 1YTDA 2QIIA 3WQOA 1QU4A 4B3KA 2QDGA 3VMOA 4NNCA 4NP7A 1EGZA 1VFOA 1FHVA 4LYQA 2WPGA 4LQ1A 4FX9A 1CB7B 4JX4A 4H7ZA 5JXQA 1KKRA 5AKQA 1TV5A 3BE7A 2DSWA 4HN8A 3GQYA 1FWAC 3PG8A 3W87A 3FAWA 3S5SA 5F1VA 5G5GB 3S1XA 1VIWA 1XRFA 3URQA 4EF8A 5D38A 2X7VA 5K3VA 3V1PA 1O1ZA 4HYWA 3GXNA 4JY9A 4DF2A 1GJUA 4D2JA 1J0YA 1OCBA 1SM9A 2UY2A 4NRRA 4L4LA 3IANA 5ABFB 4PBGA 4HVXA 4AD2A 4PEEA 1NOFA 4YHEA 3REQA 3W24A 3SGGA 4W7VA 4G2DA 1PAMA 3KOZA 1E1CA 2VGIA 3B0VC 2DGAA 3T8LA 2KAUC 3VM7A 1PKMA 2YX0A 1DWHM 4WJ8A 3QGAC 4NZ4A 3N18A 4MPKA 1XYBA 5HXMA 1SGJA 4ERIA 1RPKA 4QJ4B 2WB5A 3UCCA 1R47A 2C1GA 1U83A 3AZTA 3WBEA 1AVAA 1S2AA 1PIIA 4RK8A 2BY0A 4YYCA 3IUDA 2A7NA 1UH2A 3IIOA 1GVIA 3WCZA 3C2FA 2J7GA 2GJXA 1IEVA 4ZXLA 1DQWA 2EEXA 3THCA 3MCNA 5A8OA 1DIOA 2Q02A 1G67A 1V02E 2XIJA 3K46A 3RHGA 3GAYA 1F76A 2OKTA 1IGSA 2XN2A 1DXEA 3VDAA 3LGDA 2Y6ZA 4H9VA 3LMYA 1V6UA 4HA0A 3W00A 4B5WA 3U6WA 2FGBA 4HTBA 3VINA 2D20A 4Q8WA 3BARA 5HNUA 3VKDA 5BU9A 4IMAA 1NM9A 3UG3A 3NO5A 2W9MA 1JPMA 2NSOA 2J79A 4LY8A 2QT3A 4K2SA 5A6BA 5KITA 4U31A 1HXJA 3P7YA 4TVYA 1DXIA 2OWXA 3MYPA 4DJEC 1TV8A 1Q4WA 4CNNA 4WSKA 1N8WA 1TG7A 4W89A 3ZSTA 3WQDA 4NNBA 2XUCA 2J75A 2QR6A 3IJ6A 1NU5A 3LM3A 3G1YA 3N2XA 3NYDA 1GSNA 1GERA 3F5LA 4Z1BA 4QROA 3TXZA 2J9YA 1Q6FA 1TWZA 7REQB 1J0ZA 4C6QA 1VEOA 4Q8UA 3WQ4A 3QQ0A 3M46A 3K8KA 3G77A 1HKWA 4S3DA 4YL2A 4JZ5A 1XLBA 4R53A 3MDWA 2A5HA 4M6PA 3GIQA 3OLEA 4GO8A 1BF6A 1B3XA 1IZCA 2EPLX 2WBGA 3RCNA 1BSIA 3I3EA 1OCNA 4GWEA 1T8XA 3QMRA 1N8IA 4J7RA 5HULA 4LFYA 3BLIA 4LS0A 7ENLA 2V0TA 3GH7A 1FDYA 3HQ1A 1BKSA 1DOSA 2HS8A 5EFDA 1AW5A 4PB5A 1YTKA 2P10A 2O55A 4JTQA 3NXLA 1EC8A 3B8UA 3OHIA 1MOKA 4KIEA 4RDVA 4CNSA 3QM3A 4MOZA 5DRIA 3TTEA 1RR2A 3N73A 1M41A 3EOLA 3UPBA 3TN6A 3FLUA 1OCQA 1B90A 1QI0A 2QDEA 4HMCA 3RCMA 4Q8OA 3S3GA 3A9IA 1XH0A 1CGUA 1UWAA 2DQWA 2WVSA 3CMFA 4V1YA 3SCQA 3PPCA 1E56A 3H12A 1UYQA 3ABRA 3TYAA 3ITYA 3L67A 3TAOA 2VURA 4MKNA 4ZE4A 1OZMA 1HN1A 4ZMGA 2G3FA 1UR1A 4HZ8A 1ECQA 2QULA 5K9XA 1XBYA 4RPQA 4IISA 2GDUA 1ZCCA 1EJSC 2OPJA 4GCAA 4FOUA 1YDOA 3T0AA 2OT0A 3OG2A 5JVLA 1A5LC 4XAZA 1VFTA 4I90A 4UFLA 4WY0F 2QJGA 4LB3A 5LIYX 4LAKA 4RW5A 3EEZA 1JF5A 1FHUA 1W3NA 1S38A 1WDRA 4FR6A 3L5AA 4LC6A 3BAIA 7PTDA 1XXXA 1RCOB 3UP8A 1ZKQA 3IAPA 3PM6A 2JF7A 1P6WA 4GXPA 3G1SA 1GRGA 1LT8A 1WAWA 1JCNA 4L1WA 3I3BA 5BNKA 4JTSA 1CXIA 3S5OA 2DJLA 2ACRA 3VGEA 1MW0A 3ZR6A 4H9ZA 3LZ5A 3RN6A 3R6IA 1QAPA 3OA3A 3C2OA 3CZJA 5AZ1A 1ZMCA 1K8XA 1JZ3A 3UZZA 1FOBA 1H7NA 4JTLA 1LCOA 4JTRA 1R30A 3WF0A 3FHQA 3SRKA 3SJ3A 1Q7ZA 5B7ZA 3EX3A 4GD0A 4I5RA 2PLMA 2QDDA 1EOKA 3N13A 2VX5A 3TX9A 2X42A 3E5BA 3FY1A 1E6QM 1PBGA 1DKWA 4W4QA 1R2SA 1DE5A 4UTFA 1K7FA 4AFYA 3LD5A 1QHPA 1UMYA 1SYTA 5GQBA 3MO7A 3TN4A 4PUNA 5LNRA 2ISFA 5FAGA 4AWUA 1TIMA 4P8UA 3GTNA 3S5NA 1DNCA 5C2XA 2IKHA 4FNRA 2YPIA 2I9EA 1CZ1A 4CQ8A 4UC5A 3REQB 1A4LA 4MWAB 4MLRA 3MUXA 1FIQB 2A6LA 4UFJA 1JDDA 1MUMA 2XSXA 3VGDA 1X7FA 4JTTA 3FFSA 2AL2A 4JKMA 3U8GA 1IT8A 1Q63A 2EXOA 3L4UA 4I5UA 5D32A 2WZEA 3IACA 5IM51 3CL7A 4JFWA 1R86A 1A53A 3CV7A 1HGWA 4BY3A 3QR3A 1CBGA 1DJIA 2ADAA 1ICPA 3CV1A 4JTAA 4J27A 1X1ZA 1ITQA 3DGRA 1VPXA 2AL1A 5U25A 1TE1A 3R8HA 3ZJ6A 5CZTA 4H9MA 2E9MA 3GDRA 1JG9A 1P7TB 1Q1RA 1E0UA 2C18A 5H6HA 2HK1A 4M56A 2NT1A 5DCBA 4IIFA 4O17A 1K03A 2VI0A 3LU2A 3WDJA 3QW4B 2YW3A 1W17A 1TWWA 3GRSA 2FGZA 4FXFA 3CBWA 2IS7A 1UBSA 4WSHA 1YRRA 1A3WA 4AU0A 1HX0A 3TC3A 1WKDA 3BMVA 2VENA 5DLCA 4US5A 1J79A 1LT7A 2XIIA 2DZPA 3CWOX 3STGA 1GPWA 2RUSA 2Z1XA 4K7VA 4NILA 3IEBA 1ISXA 1TTIA 1ITCA 4H9YA 1H2IA 4GYJA 4RE4A 3AXXA 4EE9A 3F4NA 4BV6A 3OGVA 1E5JA 3EX6A 4H8UA 4PUDA 4J2MA 1WDWA 3GG8A 2CZ5A 6ALDA 1JPKA 3CS2A 3VO0A 3L4XA 5ABTA 2JBMA 1MW2A 3KS6A 3TQVA 3QKZA 3T81A 1TMHA 2QLYA 4Q4QA 4MDPA 4O19A 3TAKA 4RZ6A 3TE9A 4KWOA 1V5XA 3PBWA 1SR9A 1HW6A 4MWAC 1XG4A 1TVLA 2WSKA 4XQ6A 5AVNA 2CITA 3I4EA 4M5PA 1J01A 5C0QA 4YHGA 1EKOA 5DN1A 3LHTA 2NV1A 1QI4A 2CZVA 4IL0A 2ZOXA 4KFPA 2ZZ4A 1TA3A 4GI9A 3FA5A 1T99A 3IIPA 1MW1A 1R3TA 3MKCA 2EKGA 1B57A 1Z89A 1DIDA 4IIEA 5H8UA 5I3IA 2OWWA 1HO4A 4QG8A 4YTQA 1EF2A 5C9ZA 5CCZA 2A8XA 3NYZA 3DZ1A 3UG5A 1BTMA 3LPPA 1UWSA 4AEOA 4ZOAA 3HV8A 4JL2A 1R38A 3OYXA 1H5YA 3CUIA 3WJXA 3W2LA 2F9RA 3MCOA 2GQAA 1A5SA 1RV8A 4DZAA 2P3EA 3LXAA 1TUXA 1O95A 3M0IA 4ADUA 1NWUA 2W63A 3FSTA 1RJRA 4JDYA 1I2OA 4DLFA 2DSZA 3R79A 4DI8A 4DUOA 4EACA 1AL8A 1V0NA 2CLPA 3A12A 1HL2A 4EQXA 2PUZA 4CU6A 2OT1A 2G96A 4GOAA 2VL4A 1I0DA 4I3GA 4MB4A 4LPCA 4XAYA 1ZQ5A 1KKOA 4H4SA 1EX5A 1XX1A 1JVNA 2VFEA 3GU9A 1NP0A 1JYVA 3LSBA 3ATYA 3R58A 1Q6DA 2C3ZA 1I0BA 1SO4A 4DNHA 1YW1A 5K2ZA 2WQDA 1SFJA 4DXKA 3W88A 1M7XA 2WHLA 3GIYA 1FWJC 4N6EA 4OV9A 3O63A 2XIOA 4P7QA 3S1UA 3B0UX 4AXNA 1CW2A 2PD9A 3EWDA 3MDUA 5CAKA 2QCNA 1J12A 1P1MA 1V51A 3W2NA 3LX9A 4MMWA 2GDVA 5FEZA 1R85A 2AKZA 1NF7A 4A6GA 4ACYA 1Y5XA 3AS3A 2GWGA 4RDYA 4DBDA 3E2QA 4AEEA 2X40A 3TJXA 1TJPA 2XPKA 3TUUA 4QISA 5GNZA 4Z2KA 3R13A 3EZ4A 1PWMA 1CGXA 5LKYA 2V5KA 1F73A 4XB3A 3HM7A 3LYEA 4E4UA 1E4NA 2NVDA 1DQXA 1UOKA 2ZA3A 3VC5A 3AXMA 1A5MC 1KN0A 4J56A 4HA4A 1VHNA 1VYPX 2FB2A 1FWRA 1WZLA 4IICA 3VOCA 3NWRA 1WDDA 1GOQA 1GOOA 1YXDA 4N02A 3TWBA 2WZTA 3ZR4A 3AQUA 2YDQA 4YCPA 2R9ZA 5E6ZA 3W72A 4I6KA 2O4MA 3VIHA 3BJTA 3BDKA 1WOAA 3VD9A 2UBPC 2YYTA 3WX7A 3ETRB 3VDBA 1GOIA 3DC0A 1IWAA 1VJZA 1WB0A 3ITLA 4AIEA 3O0FA 4F2UA 3L23A 1WAUA 4HU4A 5L9FA 1EL3A 5FS9A 1MO9A 2CXGA 2IPWA 4ZFCA 2BS9A 3IRSA 2ON3A 1W1VA 3SRHA 4AIUA 1M6IA 5DY3A 4Y6GA 1EUAA 3ICJA 1N63C 3W27A 1E70M 3O16A 4C6FA 4HMNA 2YGYA 3QGVA 1LYXA 3HU7A 5BOEA 5C9RA 2EO7A 4N9CA 3P8IA 3MBDA 1IXPA 4B5UA 3E0LA 5CLWA 4WKHA 1H1YA 5LNUA 2PTZA 3EWBX 1W9DM 4O28A 4AHPA 4M80A 2HXTA 3KHDA 3EOSA 1IEIA 1OB0A 3SR7A 3W7CA 3S42A 3KHJA 3D47A 3PUOA 1CLVA 2W54A 1GRAA 4UR8A 1RA0A 1S46A 3VI2A 4M6QA 2OQHA 5F2GA 4XBKA 4ZB0A 2C8NA 1BQGA 2NVAA 4GZEA 5I6SA 4OU1A 4KCWA 4CU8A 1H63A 1QATA 4CD8A 4TIMA 5I0DA 3GTIA 1UD2A 2ZDRA 2WLYA 2WKLA 2H3BA 2WWCA 3OP2A 2VGBA 5E9XA 3HPSA 4JL1A 3QH2A 3LPOA 1UP3A 1ZHAA 3OLDA 1D3HA 3VX0A 2D22A 1FCVA 2VEKA 2V6AA 1UOZA 1TJ0A 1OD0A 1HJUA 3PR2A 1H62A 1RJPA 3PBGA 1V6XA 4B5TA 1W5MA 1YKWA 1VFMA 4TUFA 3PBVA 1G4EA 3ZZ1A 5MKGA 1PKLA 2CKRA 1NPXA 2JK6A 4OUEA 1MDLA 2OEKA 3UWYA 1V97A 5ENLA 1CLXA 3SURA 1ZL1A 4F3HA 3S2CA 3UJ2A 3AFBA 4MAVA 3U48A 3VKBA 3CK5A 3ORWA 2J77A 5CBIA 4WCJA 3P84A 5DANA 3TZNA 3NS1B 2GDQA 2V3FA 3W22A 3TLQA 1VBUA 4OE7A 3WLTA 2WPFA 3RRXA 2ODOA 4JIPA 3AMDA 3M16A 2FHBA 3T2QA 3TW6A 1POJA 1OF6A 3DDMA 1WXJA 3DFHA 1UB3A 4NZCA 2TODA 2PLJA 1UJQA 1VBHA 3WMBA 3H2NA 3V35A 4ZOEA 4LUYA 1ZBCA 2FHFA 4RNFA 1XDIA 2ZXAA 1OHLA 4O0KA 5G4HC 1UWTA 3WNMA 3WEOA 5IOBA 1A5OC 1XYAA 3PP7A 1E0WA 3QF0A 4FNPA 4AIOA 5EPDA 4P5UA 3GIPA 4X2PA 1STZA 1JYNA 2HISA 1CT5A 2ZRYA 1K9TA 2EBNA 3VIIA 4ENLA 4XKMA 5GVJA 1PX8A 4W87A 3DG3A 3P0WA 2WYSA 4BWLA 1I2QA 4JNMA 3CHVA 1PHWA 2BLEA 4HZ7A 3VNDA 4GNVA 2YL5A 3A4AA 2PEVA 1H50A 2QEZA 3B9NA 4D71A 3NXFA 2E9BA 3PBUA 1TMQA 3NVZB 4HTYA 2QUVA 4LT9A 4UTWA 3S8HA 4B5NA 1QK2A 1R46A 1MYRA 3QGKC 4H4RA 3RU6A 2X2YA 2XGBA 1NY1A 3U2EA 3ALGA 4EPKA 1V08A 1HVXA 3MI6A 4A3RA 1SJDA 4LX4A 3KVLA 1EC7A 1IWBA 2OCZA 1KM0A 1KFJA 2QAPA 4PR4A 1UMLA 4EM4A 1XQKA 1UZDA 1KRMA 3BLLA 2HCVA 1DWGM 1NELA 4JXCA 2ISSA 4OHQA 4S3BA 3SUSA 4HK7A 3W85A 3UG4A 4DYEA 4PBEA 4IIHA 2OOGA 1TQJA 4O4WA 4H7CA 3PWGA 1EEXA 1EDGA 3HW2A 5D02A 3DU0A 2PTXA 4QR6A 4WSJA 4FEZA 3PZUA 5REQB 3O1NA 5CZKA 4OGZA 1HJXA 4GYKA 2VM8A 1FWNA 5BXSA 3EYPA 4H4VA 3TC7A 2FVMA 2NX3A 4BF5A 2YCLB 1PZ0A 2E5CA 2R6OA 4YWOA 1B2YA 3CEUA 3KRBA 4K7ZA 1OF8A 1FX6A 2RDWA 4Z2HA 2JKPA 1I1WA 3P6LA 3L5MA 5D2YA 5L6UA 1Q1WA 2GL5A 4GZJA 5HANA 1GQKA 3XINA 3B8IA 2E68A 2C91A 3P14A 5D2WA 2Y8KA 3IUHA 2FPVA 1P0NA 2G95A 3R0DA 2X99A 3WUEA 5FL1A 5F2LA 1J93A 4JTIA 3LTSA 1TYTA 1H7PA 3CAWA 4NJJA 4CD5A 4JS3A 4H8NA 3WD2A 4UQBA 3N3MA 2WM1A 3EXTA 5CJNA 3T1GA 4IIBA 3VNZA 3KWSA 2BVWA 1XPYA 1D7KA 4PRRA 3AUOA 4JHOA 3N4EA 4F0MA 3W1LA 3JU2A 3VM5A 2ZYFA 1K4QA 4ILSA 3N2OA 4O1DA 5GNYA 3U4FA 2VUNA 1NFPA 3SUTA 1GGOA 2E28A 5CQ1A 2DW7A 3F2BA 4NEWA 2NQHA 1LBFA 1EDQA 2J74A 4DZ5A 4HU0A 1X39A 4RV3A 1ONRA 4EMIA 1ZS2A 6CGTA 3W71A 4OOZA 3ZSSA 2PPGA 1DWAM 3PPFA 1VKFA 3GSMA 3GUGA 3NTYA 3BOFA 4AWTA 4JY8A 3LSCA 1X8CA 5JBDA 2G5WA 3MMTA 4WZHA 1VEMA 1NFGA 3W28A 2HEJA 4DYJA 2HTMA 3H2FA 1GG0A 4U3AA 4BEUA 4GQRA 1MXGA 4JTKA 1XGDA 3I6TA 1S5MA 2GVLA 5F2IA 5HWJA 3TP4A 1TVNA 2Z0IA 3CAVA 5LSMA 4E4PA 4ERGA 1E51A 3SY5A 4IL2A 5CC7A 2Y89A 3ARWA 4UOQA 4B92A 1TWIA 4XZLX 2PDLA 3P81A 3BH4A 4IFKB 2UY5A 2X8HA 3N2MA 2F61A 4GNKB 1PDZA 2OMAA 3GS6A 3QZ6A 3NQ6A 2QCFA 5JMUA 1L9WA 3NVTA 4CCCA 4JPGA 3W37A 2PLCA 4OOUA 3RLHA 3N9RA 3PULA 3QEZA 4F0KA 3RX3A 5AHMA 5H91A 3VNLA 4LUTA 1TREA 3I10A 2HNEA 1B30A 3QSRA 4ZTYA 6XIAA 4UFKA 3PTKA 4IWWA 4JX5A 2UZ9A 1C8VA 1CXLA 3W74A 1D2KA 4GA8A 4RJEA 1W1ZA 2QVHA 3FA3A 1F3EA 5IFPA 3CIVA 3SBFA 5HJYA 4KEMA 2XZ9A 1OABA 4GRTA 1GG1A 1W6TA 2R1KA 4V33A 3UWWA 2GJNA 4TOQA 2WMGA 1OGBA 3BURA 8CGTA 2Y62A 2I9UA 3WF2A 1PS9A 4HJWA 3M7SA 4D6GA 2GQ9A 1MXSA 3NNTA 2W66A 2FH6A 3RNMA 3RO8A 1CGTA 9CGTA 1REQA 2JKEA 3W76A 4MKVA 3TEVA 3W75A 4Z2GA 4QE1A 2J66A 3WQCA 3VNMA 3T0BA 1CDGA 2ALDA 4L56A 4L4OA 1V3HA 3NSXA 2BY2A 4D8LA 4E8DA 3N11A 4HA3A 1G6CA 1IXOA 1PSCA 1WZMA 3OQ8A 4A3YA 4UTLA 3CTTA 4C1NB 4QFUA 3W7EA 4RL3A 2J78A 2Z27A 3M0HA 5D2XA 1GQLA 4UFIA 4J3SA 1TCDA 1CPUA 3A4JA 1SW0A 3LXDA 4KWWA 1A0EA 1F6YA 2E25A 4ZVJA 3UZYA 1ODUA 3EWUA 4C90A 2OOFA 2W91A 1OC7A 3KCOA 3DENA 4AZIA 4K39A 3IVSA 2VYOA 3W7PA 2ATSA 3L21A 2ZXBA 3HZ3A 3MVTA 3AIBA 1FWBC 3DERA 3UZXA 5ECVA 4W84A 2XG9A 1OYCA 3WY1A 3RG6A 4UTKA 5CPOA 2NVKX 1W54A 1G01A 1W3HA 3MB9A 3DUGA 4NX5A 5E70A 1KV5A 5M2FX 3EWYA 2BXVA 4MSSA 3M0LA 4JTDA 3VIOA 4XAGA 2VP8A 3B06A 2TYSA 2WXDM 2Y61A 3N4FA 4IX2A 3HMJG 1SSDA 3NDYA 5BMXA 2PDPA 3TU9A 2WSRA 1N5XA 1BXCA 3GNXA 2HQAA 4QCFA 3TNOA 2EAWA 1FXQA 3MYOA 5JH1A 4B2DD 3V0SA 2J9ZA 2OSXA 1HG3A 3WUBA 3QXBA 2QQ6A 1C29A 4V15A 4WY0B 3RYSA 1L2QA 1QCWA 3C2VA 5AHLA 3R43A 4JKKA 3N34A 2JIEA 3N9KA 5HPOA 4ZCWA 5HJLA 3W86A 5LGXA 3I7RA 2WBAA 4APNA 1P0BA 3KVMA 4MGGA 2ZZ6A 2P5NA 3MKKA 5CLTA 2GSEA 2FTPA 2WPEA 3QFWA 4IHCA 3CASA 2NUYA 3GX9A 2QPXA 4GFIA 3TKFA 4A2SA 5XIAA 4JQ4A 1X8FA 4BF9A 4ZE5A 1X1NA 1YQZA 1F9CA 2PWGA 1KCZA 3L65A 1EGVA 4ICCX 3NR0A 5TR3A 5D9NA 1R3YA 2Y5JA 3O15A 1PVNA 3WSUA 4J4KA 1AJZA 4AWEA 4GKTA 4UTWC 4Q7IA 3W7LA 1WP6A 3C0SA 3PTMA 2V3GA 4DJDC 1YNQA 1GKRA 2XJ7A 4K6AA 4LS2A 3LHVA 2EPOA 5SWUA 3UA4A 4O1CA 4Q7BA 2BMBA 2PTWA 1H49A 5AYYA 2ZIDA 3SCPA 1P1XA 2CKSA 1DHKA 3BAKA 4KETA 3ZYZA 2VFIA 4HPXA 1LL7A 3HPXA 1XLMA 4L4PA 1D7FA 2FZDA 1TPDA 3A3XA 4C7DA 1AH3A 1W8GA 3TZFA 4A8IA 4QNEA 3VGGA 3TCEA 5KZMA 1JDCA 1UHVA 3PZNA 4WGXA 1OJXA 3LV5A 1UIOA 4BQ5A 4DZHA 3MUZ1 3A21A 5I03A 1LOLA 5JCNA 3NL3A 1XKYA 3GHUA 3VD7A 3FJ6A 4AQLA 3MSGA 2E0PA 3LHYA 3DK4A 4XIMA 2J24A 4D6EA 1AQFA 3K4DA 1RM6B 1OK4A 3H6OA 1H0IA 3PBMA 1PX3A 2WAGA 4PB3A 3KVJA 4UTHA 1U2YA 2VDHA 1LL6A 1W3JA 1PE1A 1PV8A 3E0FA 1O12A 3RPTA 1KXHA 3AISA 1TYGA 4DX3A 3MUIA 2ZX6A 1HKVA 2V5LA 2X0HA 2BOEX 4LUTB 2CLIA 3DFQA 5PTDA 3L4WA 1GYNA 3CAKA 1KFWA 3PPGA 4FMVA 5I24A 2QCHA 3EXRA 3V5CA 2ASHA 4Q3MA 1TVPA 3GG0A 1ZNNA 1EJRC 3ZOAA 4XTDA 2VRQA 1M3UA 1YXYA 4MHBA 2P53A 3M41A 2GVGA 2ZUTA 1UWRA 1NDAA 4YLWA 2C3DA 4QE5A 1EX1A 1E6ZA 4J9JA 1P5BA 4Q8PA 2WNQA 3D3FA 1VF8A 5K4XA 5CXPA 3I65A 2YXGA 3STCA 3L9CA 4LOCA 1REQB 3U5YA 1MUWA 2PDMA 1YHTA 3JZEA 3ARSA 4IMDA 2J7HA 3WMSA 1VCGA 3UNDA 3NQFA 4H01A 3MSRA 2VWSA 1XLGA 3V16A 2ACUA 4P7OA 3ITGA 4Z1DA 1UR8A 4E4FA 3TYDA 2ESCA 2ZE0A 2ZUWA 3H2CA 4LCSA 2XN1A 4YPJA 5F2MA 3V5OA 5AOUA 2CC0A 2CEQA 4WF7A 3A13A 1R5YA 4GH3A 4N42A 4ZENA 2OB3A 3HBLA 2NXHA 2ZXQA 4Z1AA 4O4VA 1VH7A 1NEYA 4PFHA 2NQ9A 1EQCA 3N2BA 3W81A 1PCKA 3TFXA 1HUVA 1POKA 2A79A 2VC5A 2WMFA 5C70A 1EBDA 2WHKA 4N4PA 2GOKA 1O5KA 1HP4A 5LNSA 3DFYA 4LBRA 4H4ZA 3KL0A 1K77A 1KR1A 2HBVA 1HJQA 1CEOA 1KGXA 3T0DA 3VOHA 4IT1A 2AKMA 1OEPA 4ICMA 1NHSA 5I3KA 3EMQA 1R6WA 4V2XA 4C6KA 1IXQA 4LAUA 2FJKA 1NVMA 1GEQA 3EPNA 4Y96A 1H5VA 2ICSA 1BRLA 5T91A 1BWVA 3GYCA 3Q67A 5T9BG 3FAXA 4ZQPA 3C61A 3T2PA 3TW9A 3IARA 2FDSA 1OFOA 4CUCA 1OFAA 2DZTA 3UR8A 3W1TA 1ZY8A 5F4XA 4AWSA 4BZYA 1XIMA 5GNXA 1JQVA 1M5WA 3S2LA 1QW7A 3NZQA 3EX1A 1EZ2A 1TELA 3KX6A 1MWOA 1SJCA 3G1DA 3PS7A 3DI0A 1EA9C 4MF4A 1P4CA 4RCXA 1YBQA 3HQPA 4L9XA 1VFHA 3N4AA 5C54A 1UQZA 2VDGA 1V0KA 2JQXA 2FVLA 2ABAA 3M4HA 1O5XA 1TPUA 1GVEA 3LUTA 3LLDA 1V6VA 2DW6A 2TRSA 3W7QA 3VOIA 5HNTA 1ZAHA 3W07A 3CGEA 3BG9A 1A5UA 1Q6QA 2ISDA 2D2GA 3NQ8A 3SUWA 2DUAA 1PCWA 3B9DA 2IMRA 1PIGA 5AC5A 4LA1A 1I6NA 1QR7A 2CFFA 5FEXA 5CZJA 4PYSA 1NDWA 4PE8A 3TSDA 3VKKA 5FJPA 4ATLA 2V82A 3ITTA 1XLDA 3ITVA 4J35A 3NL2A 2I57A 1D3CA 3W70A 2QCDB 2VT0A 1B3YA 4GR1A 4KERA 2IQDA 1Y8BA 4HT3A 2HK0A 4DJFD 3V75A 3QY6A 3CH0A 2AAQA 2BVDA 1FP8A 4TV5A 3IGHX 3KOFA 2O4QA 4TX8A 3PTDA 4QG6A 1J96A 2VZOA 2YCEA 3K4AA 1FCUA 3WENA 1GZ1A 3GXTA 3NQCA 3FJNA 3F03K 3H22A 3ABXA 3F7JA 3LM7A 4A8RA 5D9MA 1YE6A 1W31A 5F7UA 2DVXA 1KBJA 1OADA 3AIEA 4XD6A 3H21A 2PGRA 2OODA 4F48A 2VEPA 4H4QA 1Q6EA 3LCFA 3DFTA 1CGWA 2YA2A 3L0KA 4D6HA 3UFYA 4DWSB 3EOOA 1XP3A 1XIHA 3W26A 4KBXA 2Q71A 4HD5A 1OX6A 1FWEC 3II4A 4W5UA 1VQTA 4PSPA 3LCGA 3OJGA 3SQLA 3KWXA 1W1TA 4IUOA 2G8ZA 3QW3A 1EZWA 2ZUMA 4GXWA 5AHIA 1DPMA 2B7QA 1PUDA 2QJMA 2XVNA 3MP3A 4XWUA 1K9DA 1NDZA 3I7QA 3TJLA 4ZO8A 4QEHA 1S2CA 1W3IA 4GKLA 1Z3NA 2YL8A 3PNZA 4EPDC 1U1UA 2ZUVA 4U4MA 1DP0A 1FHLA 4LAZA 2GVEA 1XLHA 2QJJA 2WVVA 2D69A 3DG7A 3OEXA 3KVKA 4M19A 4GY0A 5I23A 1RY0A 1UKQA 5FSEC 1QI5A 3CO8A 3L0GA 3ITXA 2HVNA 4FLOA 3GAKA 3MI3A 2W4XA 1T96A 3HF3A 3PG9A 4WJEA 1R2TA 3KZSA 3TV8A 4KPLA 4AIBA 4QQ3A 3MHGA 4PCFA 5EMJA 4IGNA 4YTRA 1B3OA 3S0CA 3WZ0E 1MZRA 3R07C 2AQVA 1XIBA 2Y63A 4PCTA 3MHFA 1NWRA 1Z7AA 4PUUA 1W1IE 2XYLA 4YU1A 4HSNA 3ZWSA 1OC6A 3WQ5A 5HBFA 2CZEA 2GOUA 4L9YA 3KL5A 3N6HA 2A3LA 4H41A 1P6BA 1GESA 3ZLFA 1PZ2A 3OBEA 5BOOA 4JFSA 4ZB5A 4GUHA 2VVNA 1GWJA 4H6EA 4C6IA 1LJYA 1RALA 3W29A 1E3ZA 2J7EA 1UWIA 1W3TA 3N29A 4PMXA 3MW7A 2WJDA 2D2OA 3BMXA 2Y2WA 3GFZA 2W27A 2PDJA 1XUZA 2XH7A 1C9DA 3S1WA 3UG8A 1GJPA 4YWIA 2W6RA 3L4VA 4GPNA 2CWXA 3TQKA 1IT0A 3WL0A 4PMUA 1J2WA 3N17A 3MUY1 4AXKA 3CJPA 3DXIA 5M1TA 3CQJA 4IFOA 4GY1A 1OX4B 2Z2BA 5FF0A 1AMKA 3PZIA 1MDRA 4W8BA 1OM0A 3WUGA 2OJPA 1LBLA 2FHCA 2YZ5A 4AD3A 4H19A 4OWGA 4B16A 4DIAA 5G4WA 3W1XA 3WH9A 1TJ2A 4V1XA 4UQDA 4LF2A 1CENA 3VNJA 3OVGA 1EF3A 4XZ9A 3LZ3A 3NSNA 5FESA 4KEUA 4MJ2A 2ZA1A 1RK6A 3MZ2A 4IH3A 1W9XA 4GQBA 5AYIA 3KBVA 3CT2A 3GXFA 3IRDA 4ALDA 4LWWA 3THQA 3TXVA 3SDOA 5DT7A 3KBMA 2GK1A 1RA5A 3M5YA 1ZJBA 5FCZA 3N15A 4C6CA 2P0OA 1PL9A 4WDTA 4IP7A 1I9CB 3BLOA 2WMIA 1HQTA 2A7RA 4E38A 1UKSA 2CHRA 1IZKA 1KM3A 4OV4A 4BKNA 3DESA 3KP1A 1JZ2A 3LQLA 4GYFA 1JDAA 3VOFA 3WBYA 1GVFA 2V2HA 4JTCA 1UP2A 2ZZ5A 1GV4A 2F2KA 2PU0A 2VOMA 1YQ2A 2WKGA 1W1PA 5CPSA 5I09A 2WBKA 4RNHA 4HU3A 2QKFA 3RITA 5E1QA 4Z2LA 1OCJA 3Q94A 1CECA 3AHTA 3CQKA 2HJPA 1MXDA 3SECA 2V3BA 4GXMA 2X05A 4J57A 4JIIX 3K2GA 2TMDA 4GYPA 4B90A 5K9DA 4CNOA 4QLLA 4KWSA 1ZBKA 4IUGA 1NP2A 3GZ3A 1F6KA 3HPZA 1YPFA 2ZICA 3T2OA 3WLMA 1MQRA 3TR2A 4IG2A 2VD9A 4GQ0A 5C9WA 2PTDA 2CBIA 4UR7A 1JUKA 4IF2A 1QK0A 4FNUA 1CXFA 1V3LA 4J1OA 3IGXA 3R7MA 3LCIA 2YQUA 2G4FA 2DUXA 3M5XA 4HA1A 2QAEA 3AMKA 1FRBA 1QI3A 4GUJA 5A6KA 1HVQA 1E9ZB 5IRPA 1L6YA 4TVWA 1DTNA 2YOCA 4QHRA 3P8JA 3G6MA 4AMCA 4UQ9A 4Z17A 1UIPA 1F4AA 3NPWA 1HJWA 4RR4A 2HRWA 4PGLA 1FWWA 2BFGA 4AZCB 2GUYA 2WVUA 2P50A 3ARUA 3ABOA 4I9AA 3M6YA 1Q5MA 3P74A 2PDHA 4Q8MA 2B81A 3WNNA 4Q4SA 3QYQA 3QKEA 2Y88A 2ZZ0A 1XYMA 1TPEA 1JCYA 2W3ZA 1XJBA 1MRAA 3NGJA 1ZP4A 4DWDA 2W3SA 5BRQA 3S46A 5AYXA 5FEWA 3H4XA 5JRBA 4L9ZA 3C8FA 2X8RA 4FR1A 3M47A 3H2AA 2CCRA 5C9UA 2JFEX 4MB5A 3MI2A 1JFXA 3HG3A 4HHHA 1NHPA 1UPPA 2Y8VA 1DIKA 3AYRA 4JN8A 1WX0A 4P8VA 2VR4A 4DJED 2ZRZA 3D3AA 1Z44A 5E09A 4AX6A 3KTXA 1BVWA 1ZBWA 4PMQA 3DJJA 3GYEA 2G41A 4WDXA 3QR1A 4GISA 1EDTA 4NUWA 4QG9A 3NVDA 5AHFA 1UR3M 4AVOA 3PAOA 3B9EA 1F61A 2YA1A 1O68A 4WGHA 5KTLA 2XU2A 1OINA 1HT6A 4NAEB 1N8FA 3W23A 3CIWA 2QMKA 3PVFA 2Z7GA 1XS2A 3HV9A 1XCFA 4JTJA 4N9BA 2ZTJA 3LY0A 3ZJ7A 2V38A 1NFBA 2AOSA 2Q6ZA 4AUBA 3GNNA 1VFSA 4GBDA 1BAGA 4AYSA 1S3TC 2GYIA 1LUCB 4REQA 3O07A 2OFJA 4HYRA 3PUEA 3Q2DA 2GSHA 4WXYA 4J3VA 3GDTA 4MJZA 2QUNA 3CPUA 1L0PA 3VUSA 1ZSXA 1G7UA 4IMEA 4N9DA 7TIMA 2ZWYA 5C5YA 4YWSA 1I75A 2H9AA 5H8MA 4DI9A 2OO0A 5XIMA 2Y5SA 5CEWA 3URHA 3ES7A 4ZR8A 1DL3A 2WJEA 1GTHA 3T40A 3NRZB 1Z42A 3L12A 4MADA 5I3DA 3FCPA 2IKJA 2YYUA 4QS6A 1BYCA 3TVAA 1DE6A 1RCXB 1HJSA 2VCCA 4IPPA 3MKVA 3UPMA 1XFBA 4UFMA 2V3AA 4H6RA 1UA3A 1FHDA 4M29A 5D2TA 5I78A 2RH9A 1KWKA 4M6VA 5D9PA 1TSIA 2JKAA 4FF5A 1ISZA 4PUJA 2CNCA 4C6PA 4F0SA 1OX5A 2OQYA 5C8BB 4LCQA 3SCOA 3GY1A 4IPJA 1MEWA 1PEZA 3B03A 3VGHA 1UKTA 2EPHA 4K8HA 3R94A 3BZGA 1C90A 4XISA 1HFBA 4MFDA 3WLKX 1LF1A 2IPJA 2IW0A 1F4HA 1ITUA 3HPAA 2GVYA 3A6OA 4FNQA 3C5QA 3MUAA 2Y7FA 4Y9MA 3CUXA 3SQMA 4OZOA 1XCXA 1N55A 4X61A 3ZR5A 4AF0A 1OFDA 2POZA 1XGEA 3SUVA 1WPCA 2BXZA 3WK1A 2XGIA 3OA5A 3U5UA 5I3JA 2QXWA 1I4NA 3QTGA 3WBWA 1DJGA 3H8AA 3UVIA 3ZFHA 3BLFA 2YKKA 3WL1A 2XHYA 1JD9A 3NZRA 2YCJA 2J3NA 1J8VA 3P62A 4FX6M 5JBEA 2O9PA 2W79A 1LBMA 1R7OA 1O6IA 4DAFA 2AGTA 1U1JA 2PDYA 1M03A 3I4KA 4MZ8A 3LXBA 1TUFA 1JQXA 1R3VA 1JRBA 3HPFA 3AICA 5FMHA 3IJIA 3ENLA 3WFLA 2PDQA 1A3XA 3DBNA 2PC8A 2O92A 4TXEA 3LN3A 3TH6A 2AAMA 2FH8A 3DKJA 3LENA 4RXGA 1GW9A 4QS5A 3VMPA 1QTWA 4J40A 2CZDA 4DQWA 2WHJA 2NQJA 1KXQA 1LRNA 1XBXA 2GGHA 4TVUA 3R8GA 3RRAA 4O12A 2WC4A 3WJYA 3URBA 3G6LA 3IC9A 1S39A 5MF5A 3AOFA 3OVPA 1H7XA 4QE4A 2XFYA 3BW2A 1B4EA 1VZWA 3U7VA 4B5VA 1AODA 3UBPC 2WZMA 1JPDX 4H50A 1A3HA 3QN3A 3OO2A 3JW7A 3T55A 3A5VA 4AAJA 3AIRA 1DHPA 2X1IA 2Y4SA 3DH9A 3BUVA 3QY8A 2A3CA 1UA7A 1C3FA 4NAFB 4OFCA 3KL3A 1UD4A 3GNOA 3APTA 3O6YX 2Z28A 4LUSA 4YTSA 4MFEA 1RP9A 1F3XA 3BGGA 2ACSA 4L1GA 4U10A 4HOZA 1LL4A 2J4GA 3L4ZA 3WH7A 1GCYA 3V1HA 4A3QA 4FNSA 3IVUA 1F8MA 1B54A 1JZ6A 3WD0A 1N60C