4MMWA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium, l-xylarohydroxamate and l-lyxarohydroxamate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
381
structure length
381
Chain Sequence
MIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal structure of D-glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium, L-Xylarohydroxamate and L-Lyxarohydroxamate
rcsb
source organism Agrobacterium fabrum
molecule tags Isomerase
total genus 137
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4mmwA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4mmwA01
4DYEA 2PTWA 3DDMA 3U9IA 3IJQA 3RITA 3RCYA 3R25A 3B97A 3FCPA 4IL2A 3GD6A 2OX4A 4H83A 2I5QA 4KPLA 1TE6A 4GYPC 2GL5A 3DFHA 4HYRA 1KKOA 1ELSA 3MY9A 4E4UA 3PWGA 4GFIA 3UCCA 3Q45A 3JZUA 1MUCA 3ZVHA 3UJ2A 1TKKA 3I6EA 4A3RA 3MQTA 3VC6A 2DW7A 3UCDA 3HPFA 4MKSA 3SN1A 1SJAA 4HCLA 3GO2A 2QDDA 1JPDX 4ROPA 3I4KA 2HXUA 2XH4A 1WUEA 2OZTA 3MKCA 1XS2A 1EC7A 4EWJA 3VCNA 1BQGA 2DW6A 4Z17A 2AKZA 2PTZA 5FJTA 5BOFA 2OPJA 2GGHA 2QJNA 2HXTA 1SJBA 4J1OA 3R0KA 4Z1YA 3N6HA 2HZGA 3D47A 4HNLA 3SN4A 4GGBA 3T4WA 3ZLFA 1MDLA 3D46A 3DEQA 3QKEA 4E5TA 2OZ8A 1R6WA 3EKGA 3BOXA 4J3ZA 3S5SA 2PP3A 1XPYA 2XH0A 4MGGA 1PDYA 2PU0A 3R1ZA 2FYMA 3I6TA 3ES8A 3BSMA 3VCCA 3EEZA 4K1WA 3DG3A 3OZMA 4H19A 3IK4A 3FJ4A 3OP2A 3T8QA 3PWIA 4ZCWA 5J04A 3FV9A 2MNRA 2OFJA 3TWBA 3TQPA 1MDRA 4HNCA 1OEPA 4H2HA 3Q4DA 1BKHA 3FXGA 1E9IA 2OG9A 3STPA 1IYXA 3TWAA 4M6UA 3TW9A 4JN8A 3VDGA 3H12A 4GGHA 2PA6A 1KD0A 3OW1A 3SBFA 2QDEA 2QGYA 4IZGA 2AL2B 4DWDA 3H8AA 2PGWA 4YWSA 3UJRA 4ENLA 2OLAA 3MSYA 2RDXA 3VFCA 3FVDA 1SJCA 3DERA 3CAWA 3PK7A 3QN3A 3SQSA 1DTNA 3H7VA 3TJ4A 1WUFA 2OO6A 3VC5A 2GGEA 4M0XA 5BOEA 2PTYA 2GGGA 3ENLA 4FP1A 2AL1A 3SN0A 3BJSA 4K8GA 2PMQA 3UGVA 2ZADA 4KEMA 3PFRA 3JW7A 4E8GA 3DFYA 1PDZA 2MUCA 5FJOA 5FJPA 2ONEA 3DG6A 3R10A 4HCHA 2NQLA 3SSZA 1P48A 3N6JA 3UJFA 1P43A 3V4BA 1SJDA 3QPEA 2QJJA 3N4FA 4ZA0A 1ECQA 3CXOA 1RVKA 3OZYA 3CK5A 1EC8A 3OTRA 5FJRA 3K1GA 4GIRA 3QTPA 3NFUA 3S47A 1JDFA 3T6CA 3TTEA 4IP5A 1KCZA 2GGIA 3NZGA 2ZC8A 3DESA 3U4FA 4JHMA 1JCTA 3SJNA 3TCSA 3GY1A 4X2PA 2XGZA 1NU5A 1NELA 2PPGA 2QVHA 1KKRA 3R11A 3ZVHB 3V5FA 2QQ6A 3IJIA 3NXLA 4GMEA 5IDZA 2AKMA 2PU1A 3RR1A 2PSNA 3OPSA 4FI4A 3V5CA 3DGBA 2OKTA 2HNEA 4MMWA 3UXLA 3GC2A 4DN1A 2PTXA 2PGEA 2XH2A 4K2SA 3T9PA 3TJIA 2P8BA 3P3BA 1FHVA 2PP0A 2AL2A 3MZNA 2POZA 4IL0A 4HCDA 3MWCA 2O56A 3CT2A 3ZVIA 3MUCA 3P93A 2GGJA 2PCEA 3DIPA 1FHUA 3H70A 4HPNA 3UJEA 4IHCA 3RRAA 3CB3A 3VA8A 2P3ZA 5FJUA 2GDQA 3P0WA 7ENLA 3JVAA 2CHRA 1YEYA 3QLDA 4JN7A 5EU9A 4E4FA 3DG7A 3ES7A 2XSXA 2OQYA 1L8PA 3IJLA 2FKPA 2GSHA 2P8CA 1MRAA 1W6TA 2P88A 2XH7A 3RO6A 2QJMA 3UJSA 4DX3A 3FYYA 1MNSA 3CYJA 3NO1A 3THUA 3KUMA 1EBHA 4IP4A 1TZZA 1F9CA 4GYPA 4DHGA 3UXKA 3V3WA 5ENLA 4A6GA 2OZ3A 1EBGA 1JPMA 4A35A 2OQHA 3RGTA 4G7FA 3N4EA 4GISA 4E6MA 2PODA 3TOYA 4F4RA 3ZLHA 1EC9A 4HN8A 1ONEA 1R0MA 4H1ZA 2PS2A 4G8TA 3ZLGA 2P0IA 2PP1A 2OVLA 4IT1A 4KT2A 4DXKA 6ENLA 3R0UA 4KWSA
chains in the Genus database with same CATH superfamily
4YTRA 4WGHA 5LIUX 2QZRA 3RITA 5LNRA 4LY4A 5ER0A 3OIXA 3VKJA 4ERAA 3WLJA 1YBQB 4NAEA 2IKJA 2J8TA 3B8TA 2JGYA 4MY1A 3A7UA 3DXIA 3QOMA 4L4OA 1FWDC 3S0CA 2ATMA 3ARXA 4F0HA 2Z1VA 1XW8A 4XAYA 3PWGA 4YPJA 4M7TA 1R8LA 4J2MA 3JZUA 1RJRA 5D9NA 1PTGA 2ZTJA 4Y8EA 1UR0A 4LC6A 4CNPA 2JKAA 4CD8A 2WMJA 5ECVA 1AH3A 1EEPA 1EEXA 4ALDA 3GD3A 5IRPA 3ABQA 1PSCA 1JRPA 4KCTA 3B05A 1RBLA 1AQ0A 2FZDA 3G1AA 4GY7A 4FB7A 4GRTA 3BAKA 1XM3A 3LPFA 3TNBA 1OFAA 1JGIA 2HV5A 3SCSA 1QNSA 3BAWA 3PPHA 1VFOA 4JHZA 3HG4A 4H8HA 4GI8A 3A5VA 4DVOA 5F2GA 1WUEA 2OZTA 1KBJA 2EHHA 1RY8A 3S2LA 1I75A 3MUAA 1WCGA 2DW6A 3CWHA 1O60A 1XR2A 5C6MA 2IQDA 2WXDM 4AWSA 2A5HA 5BOFA 1RXOB 5BZAA 1PX3A 4UFKA 1J5TA 4C6LA 1FKWA 1M6JA 4J1OA 5FF2A 1MRQA 2GUUA 2ZRUA 4J3SA 3P84A 1MFVA 2QF7A 1JCNA 4ADUA 3CQIA 9CGTA 1TPB1 4H9MA 3D46A 4FF5A 3LX9A 1XRSA 1I2PA 4UWMA 1ZBWA 1PTAA 1DJZA 3MB9A 3RMEA 2CZFA 1LQ0A 3ZR6A 1DORA 3BSMA 3TROA 4Q8OA 2Z2AA 3QQWA 4AYGA 2QW5A 4WJXA 3V16A 4K6AA 2WBKA 4NXSA 2CLIA 5DF0A 2A3HA 4DM1A 1E72M 3EOLA 1KM4A 4J7RA 4KETA 5TD4A 1LT7A 3SECA 1J0KA 5FF4A 2OSWA 5G2WA 4FNQA 1W9DM 1KCLA 3L0GA 3WH8A 2O9RA 2PUZA 1IYXA 1CGUA 2EQ7A 1RHCA 3H12A 4GLEA 1SW0A 3AICA 3AYTA 3QHNA 5FSDC 4XD6A 1AD4A 4C5YA 5JCLA 4OZOA 4FF7A 3DBPA 5E09A 2C15A 4JEQA 2NXIA 1H63A 5I5RA 1RA5A 1GZJA 4PH6A 4IPIA 2EG8A 3WNPA 3O0FA 2OLAA 1RVGA 1EIBA 4XZWA 4B9YA 3G1SA 1HL8A 3KZSA 4TVDA 1LVLA 4KRUA 3AC0A 4AY8A 4KEUA 5FS9A 3QVQA 4GUHA 4BS0A 4W9TA 3AISA 1T3QC 2XFRA 3E74A 1RP8A 2J13A 2QVNA 4EE9A 4OV4A 4MKVA 1ADDA 4LYRA 4WSJA 1O7AA 4MY9A 1Q85A 1XYMA 5B7YA 3S5NA 4UR7A 5CGTA 2JKEA 4TIMA 1AJZA 1SSGA 3AJXA 2DT3A 4D6FA 2C3CA 3N2CA 2ZADA 4JIPA 1WKDA 2DH2A 1EF3A 1IEXA 5EFFA 5IHSA 1EJWC 1L6WA 5FJPA 3GNPA 1VRXA 2D2HA 1JYWA 4R5EA 1VJSA 1F8MA 3BWWA 3WLIA 3BANA 4F2TA 2ACUA 1ICQA 1PV8A 2WANA 2WNNA 2YL5A 3WF1A 2V5CA 1U5JA 2YB4A 3OHMB 2WV8A 1IR1A 4NY2A 3VDCA 4N2YA 1K8XA 1HJSA 3PPCA 4JYEA 2CHOA 1HX0A 7A3HA 4TO8A 5IM51 3MO7A 3UXDA 3OTRA 1E3XA 3QTPA 2PF8A 1S2AA 3NFUA 3DFQA 1LZOA 2PDQA 3MWAA 1JPIA 3TIMA 4R33A 5C9RA 5IBXA 4H6RA 1XXXA 3U2OA 1ME9A 3VVGA 2G41A 1NVMA 4FMVA 4HU4A 4HNUA 4B9ZA 3CZ8A 1SB3B 1W1PA 4NG3A 2J9YA 2DDXA 3MANA 2FTWA 3IGSA 1JL8A 4PMXA 3L7RA 2ZZBA 4IX0A 4Y96A 2Q01A 5HNTA 1O5KA 2EXOA 3VOCA 1UZHA 3WLTA 2BZNA 2WLYA 5BU6A 3HFYA 3MJMA 1N8IA 1XIDA 2WYSA 4FI4A 3TX9A 1N55A 2XH2A 5TAOA 4XVEA 1CI1A 1CGVA 3TQ0A 1T7LA 3AUJA 3QY8A 1FHVA 4PBFA 4N4PA 1BLIA 3DBNA 1Q6LA 4WJEA 4EF9A 4GINA 2RH9A 3GDTA 4RLIA 2CZEA 1ZFJA 2V63A 4MWAE 3S83A 2IQ0A 3FA4A 5LA1A 1DKWA 3WUFA 1J01A 3JS3A 1I2OA 1YIXA 3C6CA 3CHVA 1PKNA 1Y5XA 1J6PA 3TTOA 3O0HA 3LZ3A 2P3ZA 5EU9A 1TYPA 4PB3A 4NYYA 3H2FA 1W0MA 5AVHA 4R85A 4DJEC 4JIHA 1L8PA 4PODA 3IAPA 2GSHA 4H4IA 5E6ZA 5AN7A 4NEVA 1RJPA 2H8ZA 4GCXA 2O0TA 3CYJA 1T8QA 1JEHA 3TAKA 2WMKA 3PG9A 4D6GA 4MFEA 3MI2A 3F5JA 4CKQA 1GNXA 2QPSA 1W1B1 3N3MA 2BC0A 1FCQA 1J4EA 4OGZA 1KGXA 3F2CA 3JR2A 4HA4A 3ECQA 4GISA 5T9CE 5AHFA 3E0IA 3HV8A 2PODA 1E9LA 1UR8A 5BROA 3EX2A 3AZRA 2BY0A 4LBUA 2WMFA 4KMQA 4MY8A 5AC4A 5EMJA 3P5ZA 1RY0A 2VR5A 1JGMA 2OVLA 4K39A 2I14A 2XSBA 3WLRA 1VAHA 2NPXA 4JL2A 3W2MA 4FNUA 5GJPA 4Q7NA 3AS0A 4M19A 5JCIA 3EXTA 1F5ZA 4GACA 3QMRA 4JL1A 4HNNA 5AHIA 4DAIA 3BCJA 1FXPA 2ACSA 1H3GA 5DCEA 3DFHA 5BWFA 3DHDA 3E9AA 4CD7A 2ISFA 1KA9F 1OB0A 3E6EA 4IMFA 1FDJA 3U5UA 1X38A 1RQEA 3Q37A 2V82A 4LSBA 3UCDA 2B81A 3NL6A 5HR6A 1J5SA 3QGAC 3N12A 3CO4A 4LVDA 2CYGA 3ZXWA 4HCLA 1A5KC 1W31A 3QBUA 1G7UA 1LBFA 3EKLA 3L5MA 1AOGA 4ZODA 4ROPA 4FS9A 1NOUA 1KRCC 1G5AA 5E70A 1QATA 1GTHA 5DBTA 3F5LA 1JXJA 5FF3A 2OELA 3EX6A 2DORA 2PTZA 3E49A 5EL1A 3FA3A 4UZSA 1XPGA 2Y88A 3URBA 1HJWA 4LBSA 5FF0A 4H6KA 2FHBA 4EMWA 3C2FA 1NHPA 1DOSA 3WY1A 4HA1A 3QQ1A 2J75A 1XDIA 1EXBA 4E5TA 1KR1A 3CMJA 3W82A 4AIBA 4RNHA 3O63A 1R87A 3LY0A 3LD5A 3S5SA 3FJ6A 1OFBA 2FZBA 2XH0A 1G1YA 4XZIA 1IXNA 3SO7A 5CC3A 3M5YA 3EEZA 1UC5A 2A8XA 1S5TA 3DG3A 3KBNA 3ABSA 5AC5A 2QS8A 3S1UA 5REQB 3W7EA 3DN5A 1JULA 2J25A 4EPKA 5BU9A 3ETRB 1MDRA 1WQ5A 5G4EA 1U22A 2V30A 1VC4A 2ZUSA 4PFHA 2P50A 4UOJA 2PDLA 5D2WA 4PCNA 1XJBA 1KM5A 3MS8A 2ZYFA 3LBCA 2ZXBA 4Y9MA 3AROA 4NNBA 1FWSA 1EJTC 1LOQA 2QDEA 4F0KA 1D7KA 4PUMA 2GUBA 4RK8A 1ZMCA 1CXLA 3GG8A 3LUTA 3RYSA 3BJTA 3DGRA 3KZPA 3TYCA 1N62C 3C52A 2QCFA 2QYGA 3TYUA 1K6WA 3P8IA 3GRTA 4TVUA 1OFQA 1GWJA 3CHDA 1C8XA 1KQZA 1WDDA 3L5OA 5JRBA 3BH4A 3D3FA 1EJXC 5FI8A 4DO7A 1NP2A 4PC8A 4FNRA 2B31A 4IPJA 1O4UA 3NWRA 3R2GA 2D69A 3GTNA 1REQA 3LCFA 1JRBA 4M82A 2CXEA 3G1HA 1AODA 4HMNA 4FK9A 4GVIA 3L4YA 2VC6A 3RJYA 4A4AA 1E1CB 1UD5A 3WCZA 2XIOA 2FZNA 4JNYA 2XVGA 4UFLA 1KWKA 2I9EA 1ZBKA 4LYKA 5A1AA 4MFDA 4LS1A 1GPFA 1VPQA 4AVOA 1SZEA 3PBWA 4S2BA 1ZP4A 2XIQA 3U5YA 4US6A 3S1VA 5HXMA 4QEEA 1UA7A 4S3JA 1DJQA 1LUCA 2EAWA 3ATZA 1N82A 1HGWA 5DRIA 2J7DA 4LXFA 1I9CB 1KN0A 3E5BA 2RJHA 1PVNA 3QGKC 3R4IA 4Z1CA 3AUOA 3OU8A 3C2OA 5G1TA 3L8KA 3KLKA 1LCOA 4Q6JA 1NELA 4FEZA 1ZNNA 3LCLA 1OC6A 2CNCA 1BYCA 3F5KA 3IJIA 2ATSA 4WDUA 5HWMA 5G5HB 4QLLA 3DFNA 1P4CA 1GVQA 4DJEA 1MXSA 3UYIA 2JK2A 2VI0A 3U2CA 1X96A 3BLEA 5CJ5A 1VR6A 2HNEA 1W5MA 1O6IA 3SGZA 3DC0A 2P8BA 4DO5A 3CO8A 4AISA 1H7NA 4DO6A 3QHMA 2HWGA 3CUIA 5IHRA 2J79A 4FA3A 3EWCA 3H2AA 1TFVA 4ZO6A 1QMLA 2V8ZA 3TJLA 4S2CA 1AQFA 4RV8A 3QSRA 1B1YA 3CQJA 4A2SA 1DIOA 3QXBA 1DXEA 2WPEA 3AIRA 1MEHA 1EH9A 4JN7A 3QLDA 2WQDA 4OBSA 2ZX9A 3WQCA 1Y5WA 1S1PA 4XD5A 4D71A 1XHCA 4WJ8A 2ZX7A 5LNVA 3KRUA 3Q6JA 1GJPA 1STZA 4PR4A 4LFYA 1F07A 4JIIX 3NQEA 4QJ1A 4FXJA 4B5UA 4QAIA 1UD4A 1EB3A 3CV7A 4J57A 4IIEA 1VFFA 4AEOA 4DBUA 1C3FA 5ABFB 1V0LA 1I4NA 3T0BA 6TAAA 4BK9A 1A5MC 4PRRA 1DJYA 1GVEA 3G1XA 5M5DA 3SQLA 2PC4A 2OZ3A 1JPMA 4ML4A 1KCXA 1XISA 4E6MA 4UQEA 1A5NC 4KCUA 5AKQA 4ZOAA 1GEQA 4PFMA 3GHUA 1I2NA 1BTCA 5CQ1A 5FA5A 3DH9A 3GD6A 1XYZA 5I6SA 3HPAA 1XIEA 4HQVA 1ZU8A 2BODX 1UB3A 5D9MA 4D1JA 3PB0A 4BF5A 3O2LA 2R1PA 4MB5A 2HPIA 2VKZG 4GIAA 3HQNA 1JOAA 1QR7A 4LS2A 3GZAA 3PTQA 3SADA 3HMCA 4TX8A 4M6VA 4AWTA 3LV6A 4O15A 4HYRA 4GBDA 2JE8A 1B3OA 2FVKA 1RQHA 3OLIA 5DBUA 5D30A 3A23A 4WY0A 1CZ1A 1M3UA 2NVAA 3W76A 3QZAA 2WWDA 4X61A 4LNCA 1UUMA 2RAGA 4H7ZA 4GO8A 1RK5A 3RN6A 1VIZA 2UY4A 5A69A 4L4LA 7REQB 3VGBA 1JPDX 2I17A 2A4AA 1K8YA 4NAFA 4YTQA 2HXUA 4CQ9A 4H4WA 4I5RA 5HQMA 2ZUNA 5AHNA 3NDOA 3IWPA 1WDPA 5DLCA 2QJHA 2Z0IA 1X8FA 1Z42A 3LXCA 2J7CA 1G69A 5AZ0A 3ZMRA 4UMCA 2HXTA 1TE1A 1X6UA 1R3QA 2WMIA 3D47A 5HMFA 4MB3A 5D2TA 7CGTA 4JDYA 6XIMA 2O7QA 2JIEA 1IV8A 3AIEA 4HMCA 3GYEA 2J8FA 2BTMA 3NM1A 1FOBA 2Y4SA 1BKSA 4G7EA 4GUIA 4J3ZA 3WKZA 2G96A 1GOWA 4D72A 4RNJA 3LEPA 1XLFA 3R1ZA 3HOJA 2V2DA 3RPTA 3NZ1A 2F8QA 1X6LA 3OZMA 1JI1A 1N8WA 5A8PA 2ZICA 5EFDA 3JRKA 3H6OA 1VFUA 2PWFA 3LCXA 4HU8A 4Q7IA 3NZPA 1QNQA 3AALA 3WLHA 1X39A 3FKRA 4AVFA 3QW3A 4E8CA 1W1A1 1BYBA 4U2YA 3MMTA 3KL5A 3WBEA 1XUUA 3DC8A 4KIRA 1WDQA 3EA1A 4HK7A 1D8WA 1TWSA 4GXMA 2E1WA 3RCMA 3TWAA 4UUIA 4Z2KA 3BW3A 3SBFA 1CB2A 2ZVRA 1JVNA 1KFWA 1L6SA 2C16A 4DWDA 1E1FA 3GU9A 3TMLA 4BEUA 5K7JA 5I3KA 3FDGA 3ANUA 3CHFA 3HPZA 3LHUA 5EMLA 2NT1A 3SCOA 3QF0A 5JH1A 1ZAJA 3NSNA 3DERA 1OZQA 2WZIA 4BQ2A 3CAWA 3PK7A 3U8GA 3QN3A 1QPNA 1R86A 4WD0A 3PG8A 1UIOA 3OODA 5CJMA 1QI4A 2DSKA 4W5ZA 1E55A 5AYBA 3TXVA 1DPMA 5PTDA 2HSAA 5GNZA 1K4QA 1L6YA 4JN6A 5HPOA 2V3AA 1Q6CA 4O1FA 3VZYA 4TV5A 3EMCA 2E5AA 3GXFA 3B40A 1IXQA 4GYJA 3C86A 1OX4B 2D22A 2CHNA 4C6IA 1TCMA 5CXPA 2GOUA 5DRCA 1LYXA 4AF0B 2JALA 4O17A 2R91A 3U2ZA 4CNSA 2G97A 1XF0A 5JBFA 4LH8A 1NSJA 1W37A 3HU7A 1LQAA 1EBDA 2L5HA 3WMLA 4D1IA 1RLDA 4AD2A 4AUBA 1LL4A 4REQB 1FWRA 3C8FA 2WPBA 4HZMA 1GORA 2WZHA 1MOKA 2CZDA 1QJWA 3AMZA 3O6DA 1B3WA 1E0WA 3GTXA 3AIUA 2F38A 3VMPA 1S38A 2EQDA 1J93A 1UROA 1Z8AA 3FSUA 4GIRA 4QS6A 1JZ8A 1GHRA 4Z1AA 4KESA 4EXBA 4ROQA 2FMOA 4J28A 2WK2A 3NQBA 3PNZA 1E0VA 1R2RA 2WM1A 2FH6A 2EG7A 3PBMA 3RRXA 3GAKA 3MA8A 4OJYA 3W73A 3HB9A 1IF2A 1UWUA 4IPNB 2QVHA 3EDJA 2VX7A 3GVGA 3R11A 2QCDB 5IFPA 5CLTA 1VH7A 2ZIDA 3ZVHB 3EAOA 1WPCA 2R1MA 1JXKA 4Z08A 3RU8X 3WUBA 3IJ8A 5DY3A 3CT7A 1ZJBA 4FX9A 1ODUA 4APNA 2PSNA 1Z32X 4LNYA 2GVLA 1GQKA 3ZIZA 2X8HA 1PWLA 5SWUA 3SUSA 3DUGA 3SCTA 4ZSUA 4DJFC 3T2PA 1R3WA 1H49A 4X0NA 4KGLA 4YMZA 4W85A 3M0YA 3DX5A 1OINA 2E8ZA 3PSVA 3EDEA 3MWCA 2IQTA 1DJNA 4LUJA 1TYGA 4KW2A 1ZXIC 4AHQA 1GQNA 3E3HA 2G0WA 3AWNA 4MKNA 4EWND 1PKMA 2INEA 4D8LA 5DT5A 3W81A 2X2YA 1S2TA 3G0XA 3N9KA 4Q8NA 1GXFA 1Q1WA 4NZ1A 1WYIA 4O13A 5DXXA 3LTPA 1LG2A 3HGRA 1Q1RA 1GTEA 2X1SA 4GH3A 1OG0A 1GOQA 3OIHA 4LX4A 4I9TA 2GWGA 4AQLA 3REQA 2OSYA 1XLGA 3CGEA 3NO1A 5CBBA 3WEZA 2I9UA 1ICSA 2PWDA 4R9OA 1EGVA 4JAWA 1B54A 5CZ0A 1EYWA 3W37A 1TJ2A 1B5TA 5CC7A 1WXYA 3WL0A 1LDCA 1PX4A 4ZSTA 4FX7A 3W75A 4OFCA 4MDPA 3W4RA 4WX2A 3CTTA 2VZOA 1R0MA 3E0LA 4H04A 3M41A 3KVKA 3C0QA 2YCLB 2IPJA 3B8UA 2PZ0A 2Y61A 3V0UA 4TV6A 3WFLA 1WX0A 3CV1A 1WV2A 3DDMA 5A8QA 4WSKA 3VM5A 3VGDA 2HQAA 2YXXA 3TZFA 3W01A 4QNEA 3BO9A 2OODA 4MWAC 2VGGA 5A94A 1C7SA 3EB4A 4QNWA 4CCDA 3AYVA 4ES4A 5KZDA 4I9JA 4F3HA 3MHGA 4PCTA 3B0VC 3FDKA 2V2HA 3TN6A 3PVFA 5E9AA 3Q45A 4UFIA 3KP1A 3W29A 3DKLA 3Q65A 5BXSA 1TUXA 1DJWA 4DLFA 2Y8KA 3ARQA 3GNRA 3ATYA 3R8RA 2XM2A 2FVLA 4MLJA 1YDVA 1W9BM 2ODOA 1JCYA 4UFHA 4MKSA 4KFOA 4O52A 3GNXA 4WHBA 4FR1A 2QDDA 3O9NA 4S3EA 2BG5A 1OFRA 4YU1A 4B5VA 3FEMA 2YVFA 1OD0A 2DZUA 2OZ0A 3ZT5A 1B3VA 1GKQA 1XS2A 4EWJA 4MPQA 4O19A 1I8JA 4LV9A 4L7ZA 3BZJA 1UPMB 3DFTA 1VENA 3W1AA 2YW3A 4BHYA 2D0GA 2BXVA 4PCPA 3QJAA 1UR2A 1X7FA 3TUUA 1TPEA 4PULA 3C8NA 3G1YA 5DMMA 1SJBA 4XBJA 4FNSA 1SW3A 5L9FA 2RGMA 5D2VA 2OU4A 3QY6A 1ZDLA 3CYVA 1UD2A 2GRTA 2XIIA 4N9DA 1S46A 3N1AA 1KV5A 5AYXA 3OG3A 3EZ4A 1K9DA 2PP3A 3QC0A 4BJHA 4TX9A 4ZE4A 3BAYA 4ICCX 1J8VA 3I6TA 4M5PA 2E6FA 4W88A 1MVYA 1RM6B 3WQOA 4JCLA 1TR9A 4WLCA 1NWRA 3ZFHA 4DJDA 4P7NA 4Z42C 5A6BD 2Q09A 4DWSD 1RCOB 2ZX5A 3LGDA 1V0KA 4PMDA 3ZOAA 2OFJA 2INFA 3ARZA 2ZE3A 3HF3A 4BCEA 4H2HA 1EHAA 2WZMA 4NSBA 3IUHA 3DYOA 4A3HA 3LCWA 1BVWA 2OWWA 2GYIA 3QQ0A 1F4AA 4GY1A 1N60C 2GJLA 1K70A 3CZGA 1A0CA 3MCNA 2ZXAA 2V81A 3UNTA 5U7SA 5I3IA 1TVNA 4M1BA 1XBZA 4F0LA 4YVXA 2X05A 4NU7A 1LF1A 3GSMA 3H53A 1QHZA 3L0KA 4AZHA 5H8UA 1CYGA 1VJZA 3UCQA 5I3GA 1U1HA 2DP3A 3EUB3 2RDXA 1Q6FA 1H2JA 3VD5A 3UERA 4BF7A 3I65A 4Q33A 3RU6A 3K46A 2IXVA 4IOTA 4RV3A 1M6IA 1QUMA 4AVNA 3W7HA 2PWEA 5HINA 4M0XA 4PN2A 3KM8A 3NCOA 3LB8A 4D6IA 2GR0A 1J79A 1X2GA 1R5YA 3ARPA 1GRFA 3SCRA 4ZGYA 3M43A 1Y8BA 5E0CA 3W1LA 1EGZA 4DBWA 3QSTA 1BG9A 4OBTA 4BQ5A 4QCFA 1EZ2A 1UWQA 1IT8A 2YVJA 8RUCA 4IMEA 4HMDA 3FJLA 2PZNA 3CXOA 3OZYA 2Y5SA 4O0ZA 2MANA 4FO4A 5EMUA 3P60A 3IANA 5DFAA 4DJFA 5BXPA 4JTSA 5D2YA 5C70A 4FR6A 1F2JA 3C0SA 3U4FA 1HP5A 4W86A 4XZMX 2D73A 4HHPA 1EJSC 1SUXA 2YX0A 3DKJA 3P74A 5EMKA 4L65A 1NHRA 4X2PA 2OLHA 5I06A 4Q4MA 1QPKA 2J78A 2RDWA 4AZIA 3VD4A 2YCEA 3BV4A 4DI9A 1RPXA 4UNIA 1YW1A 3PC0A 3U7BA 2PU1A 3DYPA 3NYZA 2Y7EA 3O8AA 1XRVA 1E6RA 1FWAC 1HQTA 1VS1A 3ERPA 3G77A 1PHWA 3GC2A 1CXEA 1KCKA 3OGRA 3NVZB 1KTBA 1HKJA 4TUFA 2PP0A 1CGWA 3W6MA 1VEOA 4IIGA 3OBEA 2CLEA 1SSDA 3AS2A 1F74A 3CT2A 3L4XA 4L80A 1VIWA 3NPUA 3P93A 3NEVA 2A2IA 1FHUA 4RPPA 3VK5A 3ZZ1A 5JCKA 2P10A 4HPNA 3B0UX 3QGVA 1IIGA 3RRAA 5DMNA 4OT7A 1IXPA 3GU2A 1E1EA 3EXSA 3Q58A 2YL8A 3URQA 4XQ6A 3NVYB 4LAKA 4LC8A 2B4GA 2X1UA 3NVDA 4XAPA 1NF0A 5A6KA 1JDEA 3W7RA 4V27A 4MWAA 1ZB5A 4DY1A 3AHVA 3TDFA 2QMKA 1ZZMA 3UZ5A 3V0TA 1HG3A 2ZC1A 3QR1A 5FAJA 1UQZA 3T42A 3RGTA 4F66A 2E1DA 3DK8A 4I6KA 4FLRA 1MW3A 3G1RA 4FPSA 3ZLHA 1UCWA 1EQPA 2X0YA 1YRRA 1LROA 3ZLGA 4QHRA 1WBHA 2XFFA 4WXZA 5BNKA 3K13A 2VEMA 4PMQA 2HE8A 4FLOA 3D0CA 4EPBC 3T4CA 3E38A 3R25A 4LB3A 1QT1A 2DY3A 3LLDA 1O12A 1Q8AA 1XIMA 1AQHA 3MT1A 3KRBA 4H4RA 2C14A 3VIHA 3MI3A 4A3UA 1G6CA 2OR2A 1TPDA 3BAIA 4O53A 1US2A 3T08A 1OC5A 1J2WA 2VDHA 5FL1A 3WO8A 4O10A 2Q3RA 1M01A 4NZ5A 1L8NA 4FOKA 1XHGA 1R3YA 1I1WA 1DP0A 4B5WA 4AWEA 5XINA 1XCXA 4O1AA 3WQPA 4H9XA 3G1DA 3VC6A 2WP5A 3IVUA 2C79A 4RJEA 5EBAA 3BGAA 5E0FA 3OQEA 1MEWA 5JU6A 3AZSA 3EOSA 5H1WA 3BC9A 3I4KA 1VFLA 3WNOA 4ZO7A 1JZ3A 3LCIA 4JFUA 4RE3A 3GX9A 1K8CA 3FAXA 4GRSA 3W6LA 2WBGA 1HGYA 1XBYA 3PZQA 5AECA 1H11A 3L21A 1F05A 4I7VA 4ERGA 4S3GA 4B5NA 3TW6A 2NQHA 1F6PA 5CZKA 1WZMA 4Y2WA 4HNLA 4ZB2A 3IIPA 5CPLA 3ARWA 2YCJA 1YNYA 4M7SA 2FVMA 4ZBCA 1QPQA 3BOXA 2DUZA 3PFMA 3WDPP 1AZ2A 1NM9A 1POKA 3GW0A 4YHEA 4AZ5A 1E5JA 3SFKA 3VCCA 1KGWA 3PM6A 3PPGA 3VIFA 1E3ZA 3W38A 2ACQA 2D24A 3QY7A 2DUXA 2XZ7A 4J3TA 2GQWA 4XB3A 1BWLA 4F8XA 3HURA 1CWYA 4J27A 4C60A 5FKYA 1BGGA 4HB7A 3BQ6A 3RMJA 1CIUA 4TVYA 5C2GA 2VWTA 3BK0A 2E8YA 1Q6RA 2NQZA 2QAFA 3CB8A 3OVRA 3QKZA 4KKXA 1M68A 2GJNA 3SUTA 4YYFA 3TU9A 1UR1A 4JQAA 5HMDA 3T7VA 1EYEA 2FHCA 3WD4A 1V6XA 4LU0A 3UQNA 2XIBA 4WDWA 4DYKA 1Q63A 4FNTA 4TXEA 3RDKA 3PN8A 1GVFA 2ZDSA 4URIA 1PB0A 3MSYA 1QOPA 3DAQA 4LRSA 1A5LC 1XLLA 3H2MA 3QRHA 1B2YA 1GHSA 2IPFA 1L6FA 3NOYA 4RE2A 1K7XA 1YDYA 2VO5A 2D23A 3LERA 3IIXA 2G95A 4CCZA 5LIKX 3NO3A 1YDNA 3EPMA 2B0MA 1IWBA 2FZ8A 4LA1A 3CS2A 5B80A 1JZ2A 4PCSA 2FB3A 3W53A 2OMAA 3MUIA 4K8GA 1GVYA 3KBMA 4W7WA 1KBLA 3R5EA 3LZ5A 2EQ6A 4KEMA 2QV5A 2OYKA 1GVOA 2X99A 4PL2A 1ZK7A 1FWIC 4HSHA 2FPVA 1ZJIA 4Q8PA 3VIOA 3CGCA 1A3WA 4H00A 1MUMA 1EHNA 1XLCA 1DXFA 3VNKA 1HL2A 4PMRA 1FDZA 2UY5A 3S1XA 3OJGA 4W84A 2PI6A 3BJFA 4H8NA 2GH5A 1K03A 4ZA0A 1PEZA 1ECQA 4IUGA 3KS6A 2QIIA 4ZTXA 1KFJA 1EC8A 1GYNA 5F4WA 1PZ2A 3AYSA 2PDHA 3T6CA 4MLRA 4PSPA 4TTUA 3QW4B 4Z1BA 2YL9A 4U2ZA 4RL3A 3WQ5A 2XPKA 3W2LA 3A9BA 1JCMP 4LS0A 3GR8A 1WAUA 3BPWA 3S8HA 1OYCA 3BOLA 3CASA 4AW7A 2BB0A 2J88A 1UH4A 4AD3A 1T40A 1W3KA 1HJVA 1BRLA 1WDRA 2RKXA 4XO6A 4LGXA 3RX3A 4A3YA 3AJ7A 4RNIA 3AN1A 4NX0A 4G1NA 2W61A 8TIMA 3BZGA 1EX5A 4R88A 3RLUA 4Y90A 2X09A 4RZ4A 2YXOA 4JTJA 1N63C 1DQXA 3LMZA 3VKAA 2DZTA 5LXEA 5LSMA 4EQRA 1OCJA 3R07C 2HQMA 1SU5A 4L1GA 3MUCA 1YNPA 3EANA 2WCGA 4XKYA 1UOKA 3HIJA 4FLSA 3L4VA 2DUAA 5FJUA 3GVQA 1OYBA 3JVAA 2X41A 3RO8A 1XLIA 1J6OA 5I00A 1OFPA 2OXNA 5FS8A 1BXNA 5TQLA 5CLWA 3T07A 5KMYA 9XIMA 2F5ZA 3M0VA 2G3FA 3MMUA 1VPYA 2A3CA 2RABA 3GNOA 2BV9A 2F6XA 4YTTA 1XDLA 3RNMA 3QZEA 4QX4A 2OGJA 1QNRA 1EDQA 2CBIA 3GR7A 1XX1A 1XIBA 3JZEA 4IP4A 2ZRVA 3NSXA 5CSUA 1FWJC 3UXKA 9RUBA 1RAKA 1AMKA 4QEHA 5DANA 2EQ8A 2XM1A 4B91A 1PX8A 4JTEA 3CMGA 4R7WA 3G1FA 3TC3A 1V02A 1UPPA 1TV8A 1HXJA 4EPDC 4KWUA 3CJPA 4BR1A 4UQAA 3MTWA 5DQPA 3SZ8A 3SFWA 3UZWA 3CUXA 4AD5A 3IV8A 2EF9A 4IT1A 4L6DA 4C1NA 1UJQA 3LXDA 1LRTA 4W87A 3IJQA 3AXIA 4H9YA 5EBKA 1XLBA 1MO9A 3NG3A 1JFXA 3NNTA 3RCYA 1CCWB 3M0HA 3MCMA 3EDFA 2E5DA 2QAEA 2A3EA 4W8AA 3QV9A 1CENA 1F73A 1MW2A 2J6VA 2X2GA 3URHA 4WDXA 4GVGA 3THAA 3CPRA 4LWWA 1CDGA 4LAOA 3L4WA 4WKHA 5HWJA 4H7VA 2OWCA 2PDGA 3VGGA 4PYSA 3ARSA 4JDBA 1K1DA 1ZUAX 3A3WA 1VKFA 2DSZA 6XIAA 3EMQA 5FL0A 4E4UA 1O66A 1I6NA 4NZ4A 3ME3A 2WHMA 4OV9A 3WH7A 4J9JA 2C6QA 3UJ2A 2WB5A 3VI2A 1KM2A 3B0YA 3RXZA 1FP9A 4J3XA 1A0EA 5LHFA 4O4WA 3SN1A 5LHEA 1M7XA 2AQOA 2ZZ6A 1K6AA 1S39A 1R3VA 5EPDA 1OT2A 2Y0FA 1RBOB 1VFMA 3UVAA 2WOIA 4IH3A 1EC7A 1V3HA 1VFHA 2HS8A 1BQGA 4GJJA 4MYXA 3A6OA 1MSSA 4A8RA 4DBEA 1PZ3A 3ID7A 3WEMA 1FWFC 3GU1A 4JEJA 1YLVA 2H8XA 3QFAA 3UA3A 2ZUVA 1C8YA 3IV3A 1X1OA 4HSOA 3MKVA 3QZ6A 4PMOA 4E2DA 3A5FA 3IIOA 3NDZA 3PSWA 3HBLA 3T8LA 3IC9A 5H2ZA 2XIJA 3DEQA 3LDVA 1XIIA 4GQ0A 3GQYA 4DUXA 4GA8A 4XIMA 3T05A 4DUOA 5DCBA 3CLMA 2DV0A 1LOSA 3HV9A 3ITYA 4BWLC 2JIWA 4BQ4A 1R3TA 3NQAA 3TJXA 5H6HA 3PWIA 4KPRA 1E71M 3N2BA 3E02A 4HNCA 2GJXB 3GD4A 3RX2A 3B9NA 4QE5A 5U25A 5JIPA 5DMYA 1VYRA 1SFJA 5MKGB 4PE8A 3IGUA 5CPSA 2X50A 4W5UA 3MHFA 2F6UA 1VB9A 3G8EA 2VX4A 1UP2A 2PA6A 4NNCA 2YZ5A 3OW1A 2PDYA 4G6CA 4PTWA 3UR2A 1L6GA 4GY0A 3UY8A 5I3HA 1EJVC 5GPRA 4QQ3A 1AUSL 1JFHA 3UG3A 4O54A 3RPDA 1H2IA 4GC4A 1KFBA 1W17A 4FIRA 3TYZA 1UKQA 3W7DA 1FTXA 4HMEA 3W23A 3FHQA 1V03A 4GH1A 3VE7A 4LEQA 4AX6A 1UKSA 1M5WA 3PS7A 2J3NA 4YCOA 3CUGA 2PBOA 1MQQA 4KIEA 2V67A 2AL1A 5C71A 2V3GA 4E0CA 1R7AA 1FXQA 2ZZ4A 3GR4A 3RJXA 2O4QA 2E9BA 2OKOA 4ZFMA 6TIMA 3HGOA 4H4YA 3P82A 2EKCA 2E09A 1FH7A 4EQXA 2PURA 3WQVA 3JW7A 2QT3A 1XUZA 2E7FA 4ZB0A 2O9PA 3MW7A 3P6LA 4NP7A 1UA3A 4TMBA 3DG6A 3UYCA 4JTGA 3AOFA 3I68A 1SO4A 2ZVIA 4J40A 1YXYA 3P14A 3S46A 4MZ8A 5F1UA 2F2HA 1P43A 4Z1DA 4O1CA 4MZYA 3H2EA 2H3BA 3MVTA 2ANUA 3W70A 3WBXA 4POCA 1GOIA 3EDDA 1OCQA 2YDRA 4MSSA 1NHSA 3NVVB 4OKDA 4GG9A 4V33A 3IPWA 3PUOA 1KM6A 3PNUA 4ZENA 5AHLA 4IJCA 3FYPA 4DO4A 1FP8A 4F9DA 3F4WA 3DESA 4JHMA 3GDRA 2GVJA 2Z7KA 3RM9A 5T91A 3LS9A 2F6KA 1H0GA 1PIIA 2WC7A 1QTWA 4AD4A 1A5BA 2FH8A 1V77A 2IPGA 2IW0A 1IEVA 2OWXA 2QXWA 4WKAA 1FWTA 3LBOA 1V0MA 2R1LA 3KCLA 3W2KA 1H7OA 1Q7QA 3BXWA 3F4VA 5T8GA 4YVPA 1GEUA 3E12A 2OKTA 2ZBTA 2VP8A 4K2SA 1GERA 2D2GA 1ZALA 2EJ1A 3T0AA 1MWOA 2W55A 3WL1A 3CUZA 4Q8MA 4EMIA 4HU3A 3TJIA 1W1YA 4L64A 3GG7A 5H8PA 2QJGA 5DN1A 2QCCA 1EPVA 3GC5A 3L66A 2AL2A 1XC6A 3GG1A 4M52A 2PD5A 4Q8UA 5FCZA 1H1YA 1PIGA 3V0SA 3AMGA 2WO5A 1OVDA 3IK2A 3POHA 4QG9A 3WELA 2I5GA 2JGQA 5KTLA 4Y9AA 1AW5A 3TP4A 4TTGA 1QNPA 5EBUA 4MJ4A 4DNHA 2ZUMA 4GFSA 4AAJA 4JTRA 1TVPA 3PBUA 2VUYA 4S3BA 5T26A 3L68A 4NQ1A 3EAUA 1FWWA 2VRKA 1PAMA 1MRAA 3OB8A 4LUTA 1E5NA 1IT0A 3RO6A 3VOFA 5F2LA 4C5ZA 3N29A 3ZO9A 5IFTA 5LNWA 2TPSA 4QIUA 3KRSA 5LXXA 4NASA 2I7GA 4NRSA 1WYGA 2G3NA 2EPLX 4ATDA 1W9VA 3Q2DA 2DH3A 3FVMA 3VNLA 5FEZA 4GK8A 2G4JA 3MO4A 3GWQA 3SRKA 3VMOA 1IEIA 2VRQA 2UBPC 3S3GA 1TPH1 2QDHA 1AJ2A 3ARVA 3KLJA 4JIEA 1TJ1A 1EOMA 4NZCA 5G2IA 2WVUA 2P0OA 3KTCA 3ISIX 3UESA 2PDKA 4CN1A 4C91A 1EJ7L 2VD8A 1GK8A 4AZCB 3ZR5A 3F4NA 1BYAA 1VCFA 5E1QA 3VU2A 1GV4A 3FW6A 5HANA 2F9RA 2XISA 5KETA 1BXBA 2E4TA 3FGCB 4B4FA 1XKYA 3LHTA 4Q6XA 3LOTA 1CEOA 4IPPA 1RH9A 3BARA 3N9SA 3B8SA 2D3LA 1YE4A 2YA0A 5H91A 3SB0A 2WNWA 3ITTA 4OBRA 6PTDA 3VD9A 2PB1A 3ITXA 3NPWA 4ZZ9A 5KZ6A 2DSVA 2WQPA 1MW1A 5FEWA 3WNKA 1BHGA 1ZY9A 4QAWA 4RZBA 1D8CA 1K9FA 3WLKX 4E2OA 2DIEA 2X1IA 2Z26A 1GVIA 1FHDA 3DK9A 4BWLA 1LRNA 4IQJA 5FSEC 5HUPA 2XYLA 5D4YA 4UOQA 1TTPA 3G8RA 1KWGA 1SZRA 4KWWA 2OPJA 3UWZA 4NJKA 2AAMA 3CWOX 2Y1HA 1SZFA 4O0QA 1HKMA 1RR2A 3TZNA 3F1QA 2V3BA 4GJIA 3EA3A 2VR4A 4H4SA 3FK4A 3QYSA 1GZGA 3ABRA 2X1TA 2VUNA 1UWIA 2Y89A 1FHLA 2YL6A 1NH6A 2BMBA 4ZE5A 4CVUA 2CITA 4F0RA 3RLHA 2J9ZA 1M1BA 4BY3A 4DAFA 4Q4SA 1HKKA 4C6KA 3EX3A 1P0DA 1S5MA 4IISA 2NX1A 3S2CA 1A3HA 4ZMGA 1XCFA 3APTA 5E9XA 1V7AA 4ORMA 1AD1A 3FXGA 2OG9A 4GOAA 3WK1A 2X30A 4U28A 4WUIA 7ODCA 1V3IA 3WJWA 3FOKA 1XLDA 3TK7A 1L9WA 4HPJA 4N9CA 4M29A 1X98A 1XKJA 2ZX8A 3STEA 1E70M 3IVTA 4ENLA 3QPYA 5HAOA 1YTDA 3KVMA 3MDUA 1JZ5A 1Q65A 4ADWA 3ALGA 1N5XA 1IIHA 1QBBA 3UG4A 2IKHA 1F8IA 3UFYA 2A7NA 3KX6A 2R1KA 3O6AA 4GZIA 2VC7A 5IBXC 1GOOA 4PUWA 3AXKA 3KW3A 1CW2A 2O55A 4KH2A 3TR2A 4K8EA 4F48A 2FPTA 4IFKB 2XG9A 4A05A 4C6QA 3ABXA 4H4TA 3G6MA 4GZJA 1EO7A 1W2PA 3LXBA 2W62A 4DQWA 3WK2A 3C2RA 3DI0A 3GXDA 4DF2A 3QOKA 5DELA 3LSCA 3TN5A 4CNTA 4J2PA 1TO3A 4N9EA 2E6YA 1F3PA 2ZX6A 4HHMA 2W79A 3SSZA 1J10A 1A0DA 1AH4A 3WD0A 3KDNA 1TRIA 2WVSA 4O1BA 3TYBA 1OF6A 2R9ZA 1W9PA 1DWHM 1ZGDA 3N11A 2EPKX 4GR1A 5AYZA 3SCQA 5BYWA 1HVXA 1FCBA 3OGVA 5I7GA 4GI9A 2F84A 2O92A 5BRBA 4XBKA 1KRAC 3GH5A 1KCZA 5F4SA 4MAZA 4S3DA 3ORWA 1X6NA 1IR2A 3ZT7A 2NVCA 3CGTA 1ZL1A 1EJRC 1V3LA 4YVVA 1PWMA 4M80A 2WNZA 3URAA 2YSWA 4QXIA 1VEPA 3C3UA 3LENA 4H7CA 1UW9A 4TVWA 2VC5A 3NQ8A 1EA0A 1P7TB 2O7SA 2WW5A 3N6QA 3NXLA 4DF0A 1VPXA 2GOKA 4NZ3A 4QISA 1F4HA 1TV5A 2R24A 1R46A 4LVBA 3SIMA 2V5JA 1ONRA 2PTXA 2CLOA 1DHKA 4S38A 2BWGA 3GTHA 2NW0A 3EYPA 2R8WA 2ZFAA 3WLLA 4JGDA 3FJNA 1K02A 1BYDA 1G67A 1JZ4A 1VJIA 1JQVA 4QE1A 5TBOA 4Q4QA 2G50A 2OGYA 4YL2A 2Y6ZA 3GXTA 4PMUA 3QEZA 3I6RA 4HU0A 3OEXA 2ADAA 4AC1X 4INFA 3EWZA 4Y9OA 2O56A 3C3NA 3VNJA 4G2DA 4J3WA 4EF8A 4HJFA 5HOSA 1NFPA 1V4YA 3GKFA 3IJDA 4JTUA 1U30A 5CZSA 4MZ1A 4QCEA 1FECA 8XIMA 4D9PA 1SFTA 3A7RA 4EAMA 4XG1A 1Q7MA 4UMBA 5K9DA 5EYWA 2QCGA 1UOZA 2RGLA 2OQYA 1KM1A 1OFDA 1ZS2A 4A2RA 2J7EA 4RXFA 3DU0A 2XH7A 3DK4A 2EO7A 2TSYA 4NHVA 2Y63A 3GXPA 2ACRA 1XSJA 3LCGA 1DYSA 2OT0A 3KTSA 5RUBA 1B57A 3PJUA 1WKYA 2ZDRA 2W66A 4UTTA 2DGAA 1K4GA 1EBGA 3GDMA 2OQHA 3SAZA 2UWFA 4AD0A 1PO9A 3VINA 1UD3A 1IGSA 4JTLA 2CPUA 1OGGA 3INPA 1B4KA 4DLMA 3SR6B 5D02A 1OFOA 3EPOA 3VX1A 2PDUA 3M1ZA 2FGBA 2O9OA 2VGIA 1E6QM 2D1ZA 4CCEA 3OBKA 1HN1A 2X0HA 3SGUA 1GUVA 4IPLA 4XZNX 3LQLA 1XQKA 2W54A 5K2ZA 5GNYA 4MJMA 3N2OA 3T0TA 3O07A 2I5QA 4GVHA 1OYAA 1GVSA 4JFTA 2ZZCA 4IGHA 2JF7A 3BVJA 3VMNA 4AHPA 5HDRA 3WD3A 3BV7A 1PE1A 3AIQA 3AMDA 4LCRA 4JCMA 4US5D 1XANA 3MV01 1BGAA 3KE0A 1H7XA 2EPOA 5BMXA 3WDQA 3WQ8A 1JNDA 1RPKA 1UKOA 2OB3A 4QG8A 2BVWA 3NL3A 1LOLA 4BF9A 3VKCA 5C54A 3GRSA 2PRHA 3M5VA 2G37A 3R89A 2HJPA 2Y8VA 2NQ5A 1GEHA 2VCBA 1MYRA 1VQTA 3C5QA 4OVXA 5DCDA 3T09A 3FY1A 3OYZA 2E25A 5GJNA 3RILA 2Z00A 1QCWA 2TODA 3OVPA 3N13A 1XGEA 2HTMA 3TYEA 1TG7A 5FJTA 4TOQA 4CQ8A 3WBWA 3UR7A 4UQ9A 4ZQCA 1JCJA 5D8ZA 4M1RA 2VEGA 4QR6A 5AC7A 3UZJA 3CPGA 3KLLA 3W7KA 4H50A 1D7YA 1W2VA 3WSUA 1R3SA 3CEUA 4MF4A 4DB7A 1O95A 3O7UA 3N2MA 1ZENA 4XX6A 4DPPA 2R9RA 4MUZA 3HJEA 1XPYA 4Q7BA 3CEPA 3LA4A 3W1RA 1F3EA 3LLFA 3FNDA 1PZ1A 3M64A 2HCVA 1UP3A 4KEZA 3ES8A 1JJKA 2VQUA 3TR9A 5EA9A 4QJ4B 1XLJA 4PTXA 4CN4A 3QTGA 3LBMA 2XN0A 3FV9A 2VVSA 3GW3A 2C1IA 3M9YA 1E6SM 4PZVA 1W3IA 1SO6A 4Q8QA 5CZTA 3WF4A 4AIUA 3VNIA 3VABA 1V51A 2UV8G 1UJPA 3AHZA 5XIMA 4BI6A 4N6EA 1B3YA 4FZIA 4I8YA 5CAHA 3NPVA 3PHAA 2GLKA 3W9ZA 1HW6A 4QROA 1CTNA 1V08A 2H9AB 3VYLA 3GVRA 1PPIA 4JTFA 4UTFA 2WVTA 4H9UA 1JUKA 2B7PA 3NRZB 3A64A 2OSXA 3ZT6A 1XGDA 3M7WA 1ZJHA 1E4IA 4K8DA 3LRKA 5AC8A 2NXGA 3BSHA 1QPRA 3OA5A 1FX6A 2DVUA 1NWSA 2OEMA 3AFBA 3BCFA 4RXGA 1GT8A 1DNCA 3IJ6A 3SQSA 4CEUC 1TA3B 4M6QA 4WOZA 3VNDA 7PTDA 2CKRA 5BOEA 4H4PA 2UY3A 5A2BA 3XINA 3VOHA 1J11A 4L9YA 1NOFA 3W7LA 1CLXA 2VX5A 1DWJM 2WOVA 4UQDA 2ZCGA 3WQ6A 3DHFA 1OD8A 3TYDA 1DWIM 1J0ZA 3GS6A 4PRTA 3GE7A 1JRCA 2WHJA 1EA9C 3DFYA 3LNPA 1F3WA 2X0SA 3APYA 5G1MA 4B3LA 4K7YA 1O5QA 4BFAA 1NWTA 1V0NA 2CBVA 4BZYA 2HISA 5D04C 2B7NA 1ICPA 3G22A 1E0XA 5A2CA 3RM4A 3PZMA 4EXAA 3S5YA 2VOTA 1FWCC 4IG2A 4D6EA 3POCA 4I9AA 1DJHA 2BHUA 3ANYA 2XDFA 1XWYA 2YBTA 1QNVA 2XFWA 3ITGA 2QJJA 1RK6A 2W5FA 3EOEA 4JQ1A 1HKWA 1FWEC 1F6KA 1EX1A 1UG6A 2E77A 1X97A 3Q94A 4Y8FA 1IZCA 2Z1SA 5AHEA 3W74A 4JTAA 1FEBA 3BTNA 4HZ7A 3N4AA 3VZXA 1JNEA 2ZC8A 4QSHA 3KHJA 5EB8A 3W7OA 3LN3A 1IEQA 3SGGA 2REQA 1UMLA 4HPHA 3CH9A 3OG2A 4AYSA 4GQRA 3VTRA 1W1TA 5I02A 3S4TA 1F6YA 4IMCA 5JCNA 1KXTA 1TPVA 4FHAA 3KDOA 1QK0A 5K3VA 4I3GA 4UTJA 1ITUA 1QAPA 5REQA 3W7CA 3B3DA 5CPTA 2PPGA 3CMFA 3COTA 3WJZA 1BPLB 4HPXA 5K9XA 1JF5A 2VEFA 1NQKA 2ZZ0A 1VEMA 3RR1A 4XSMA 1PYMA 2C1HA 2V5KA 3ZR4A 4CQCA 3AWOA 2VNCA 4DN1A 5A6TC 1CNVA 2PRLA 2VFGA 2EKGA 3ONCA 3TAOA 4LVAA 4FXRA 3WZ0E 4HTBA 2OCZA 3W84A 3H4GA 4IP7A 1D3HA 1WE5A 4MJZA 3OHIA 4V28A 5EY5A 2WNQA 4IL0A 3KP0A 3V75A 1XYBA 1R47A 3MBFA 1XL9A 3DIPA 2Z1WA 1OK4A 4IHCA 3SCUA 5C2XA 4GZ7A 1US3A 4XUGA 3KOFA 5HNUA 1DWAM 4JPGA 3CGDA 3SY1A 1B3XA 2GR2A 1CGYA 3VKBA 3A4XA 4CU7A 4IG2B 1FKXA 4LANA 2X8CA 5F7UA 4PGLA 1HP4A 4YWIA 3VXGA 1E9ZB 4G5DA 5A6BA 1XIJA 3CNYA 1H1NA 5J5DA 4DBSA 3SCPA 4AZGA 5CSRA 4PTVA 1EPXA 1UBPC 1VRDA 2TPRA 4H6EA 4MHBA 4BA0A 3I3DA 2FGZA 4RCXA 3A24A 1E1CA 1R7OA 5HATA 2REQB 4F4RA 2BASA 3EWUA 1NTHA 1LORA 1W3NA 1P6CA 2AMXA 1JQXA 5KITA 2ZRYA 4QDWA 4ZB5A 4ZO9A 5D38A 2E40A 4ZEPA 3WJYA 2J7BA 4JOMA 1JDAA 2WVVB 3E0WA 4EACA 1R2SA 4ECLA 2G4FA 4GYFA 1KFEA 3SI9A 4WXYA 1VLIA 2A3BA 3R7MA 4RPQA 5HJLA 5A5WA 4HOXA 5HQEA 3W7JA 4C6BA 3DFOA 2A21A 4CQBA 4BQ3A 2NUXA 3LU2A 2W67A 4NT0A 1FH8A 4LYPA 2OO0A 2R6OA 3OC4A 1ELSA 4UTKA 2PGRA 2QUTA 3KHDA 3GNNA 2YJQA 3LTSA 3W22A 2JKPA 4ACZB 3N19B 2AMGA 3SQPA 5FS7A 3HPFA 2QJIA 2YFOA 2A7PA 1BF6A 4DIAA 5D33A 3B8IA 3MC5A 1BF2A 3H21A 1SZNA 1FQ0A 4P8WA 3CUJA 3TCEA 1HT6A 4GD0A 4ICMA 3L65A 2VYOA 1T6MA 2W91A 2WPCA 2WM0A 3TH6A 2PDBA 4IQEA 1O1ZA 1NOWA 5J8LA 1W1ZA 3M5XA 3MKKA 2GGHA 3AXHA 4GNVA 3GFZA 1PCWA 4DWSB 4Z1YA 1Q4NX 1I1XA 5CPMA 2E3TA 1ADOA 2AOSA 3EKGA 5G5IA 2YQUA 4PMNA 4NUWA 3EWYA 4U5KA 4OU1A 5EMYA 2ZUWA 3NZRA 3FX4A 5BXRA 1QW8A 4IM4A 3LSBA 5ABFA 2RFGA 2YA1A 3OP2A 3T8QA 1DQWA 3WDIA 2DJLA 2EG6A 2PDMA 3OQ8A 4DYJA 2VTFA 2ZRWA 5CPNA 2ICSA 1YTEA 1XH0A 1UD8A 1OEPA 1CGTA 4YNGA 1RUSA 1E6PA 1Z41A 1WZKA 1XIHA 4JZ5A 2BOFX 3VDBA 1TZ7A 3K8KA 2CERA 1Q66A 1ALDA 4M81A 1H5YA 4FX8A 2Z1XA 4Q8TA 5EGRA 2X42A 4JY9A 4LUSB 5I03A 2QCMA 4NEWA 1TYTA 3O15A 4A22A 4DZAA 3B9JB 4YWSA 1C91A 1OABA 4NJGA 5MF5A 3LGEA 3ITCA 3C4UA 3QM3A 1A49A 3R13A 1TTQA 2J77A 2FGLA 4JYDA 2Q8ZA 5CBJA 3UGRA 3B04A 2XVNA 3VD3A 4I7UA 2A0NA 3TXZA 3VC5A 1UMYA 3NQGA 4HOWA 1DJIA 3TVAA 1UWTA 1ISWA 2VM8A 1QASA 3TTSA 4JTHA 4WKFA 7REQA 3LHVA 3UNDA 5A95A 4HYWA 5JXQA 1V93A 1H6VA 2C0HA 3EB2A 4L56A 2DZBA 1YHTA 2O4MA 4XTDA 1UR3M 3NOEA 1LLOA 1V02E 3M0JA 2NLYA 4LAZA 5IOBA 3EOOA 1Q6OA 5HR7A 3EWXA 3UJFA 6REQB 3CL8A 3LTYA 2PDFA 3NAVA 4QE4A 3UVIA 3WBYA 3HMJG 1LG1A 3N04A 1R3RA 2I56A 3UZYA 2OOGA 1G4PA 4JKLA 5D05A 5AYIA 4DRSA 4JFSA 3AO0A 3PZNA 3S47A 1QXLA 1C8VA 2VFFA 4IP5A 2YA2A 2GUYA 4MPKA 2YGYA 3A9IA 4HN4A 2ISDA 4L61A 4J4KA 1WB0A 3O6YX 3BUVA 3TTYA 3P62A 1XLKA 2ZUUA 1EIXA 4OE7A 4GNJA 3A22A 1XRFA 2WP6A 3K30A 2BOEX 1FWGC 4NYUA 2D0HA 3V5FA 2VELA 4MOZA 4Z2LA 4U33A 1JAKA 3SDOA 3W2UA 3FS2A 1WXZA 1ZCCA 1JUEA 3ITVA 4XAZA 4HD5A 3UXLA 1S1RA 3EF6A 4AZBA 1G01A 1B9ZA 3UETA 4IWWA 3K8LA 1CLKA 1K3UA 4LQ1A 5FEXA 3WQDA 4HP5A 2ASHA 4M6PA 5LGXA 2Z1KA 5TF0A 5DO8A 3L4ZA 5BCAA 4ZFCA 3WF0A 3AIWA 4W7UA 4QGCA 2CLLA 5EKYA 3W85A 4QS5A 3IRDA 2GDQA 7ENLA 1U33A 1ZQ5A 2W92A 3TSDA 1BSIA 1WBJA 4M56A 3C0LA 4WR3A 2GSJA 1TRDA 2BGNE 2QR6A 4MADA 1WA3A 2BCPA 1CXIA 3FXYA 1DE5A 1P1MA 1LTDA 1LPFA 3LPPA 1OX4A 3KCOA 3E2RA 4FSAA 2DSUA 3HQ1A 3THUA 2XZ9A 4UTMA 3I7RA 1DV7A 3KUMA 4XZLX 4QDPA 3CL6A 2E6AA 4AF0A 2BVYA 3DHPA 3WYZA 2C18A 4KGJA 1K7EA 1W3LA 4H4ZA 1NFBA 4JYFA 4REQA 1P1XA 4DF1A 3NVWB 3H2OA 1QU4A 4O18A 4X60A 5D9PA 2QCLA 6ENLA 3K1DA 5LA2A 5H8MA 4QJ5B 3ZSSA 3MI6A 3BW2A 4UR8A 1OWQA 3CH0A 3ZJ7A 3WD2A 1EOKA 1RP9A 4B3ZA 8XIAA 2ZZ2A 1Q6EA 3ELFA 1MMFA 3PZGA 1M03A 3ARUA 3HFTA 4GC3A 3GRIA 3FA5A 3BICA 1H7PA 4RW3A 3W71A 1SFSA 4ERIA 3PTKA 4NRRA 3L0NA 4EQWA 3M0MA 4JXCA 4O0KA 1VLWA 2Z4GA 1BVNP 1VHCA 3PP7A 2GK1B 2IMRA 2QCDA 3ZVHA 1ZBCA 1FA2A 1XICA 3PB2A 1MFUA 1B9BA 4AY7A 5JBEA 2DW7A 3W7IA 4YS1A 4D6HA 4DJDC 1WKEA 3HGJA 2J47A 3N73A 3NEHA 4WRHA 4P7LA 4BV6A 1KTNA 4TX6A 3EPNA 2JEPA 1NEYA 3WQ4A 1PL9A 3Q67A 1DL3A 4J3VA 4FIQA 1W5NA 1DVJA 2H90A 3ZJ6A 3NDYA 5M17A 3R12A 1EKOA 2E5BA 1FWNA 3G5EA 3NQ2A 1GKPA 3LHYA 4R7JA 2ZA3A 4I5XA 4OQVA 3GHTA 1L2QA 3SN4A 4K7VA 1XGZA 4ATLA 2OZ8A 4EVZA 1W8SA 3D6NA 3USBA 4XBSA 3U7VA 4ZXLA 2C71A 3PZTA 1J18A 1QFEA 3VDAA 3I3EA 4GVFA 5F1VA 2FJKA 1TWDA 3R0DA 1IE7C 2OEKA 3IIZA 3QFBA 1M7OA 3U6WA 3M5ZA 2OX1A 4E2VA 3H4KA 6A3HA 2HBXA 2QEZA 2QV4A 1Z69A 2NWSA 3STPA 4Z2GA 2V3EA 2YCLA 3CZLA 1MQRA 2HEJA 3HW2A 1R38A 2R94A 4O4VA 4QSFA 5ABGA 2DZVA 1ZKQA 5I2UA 1QI2A 4OOZA 4CD5A 4YXGA 3M0KA 1OT1A 2QCHA 3W02A 3RIKA 3E96A 1VBJA 3TTQA 1BXCA 4GX9A 1E40A 1HNYA 3H8AA 2PGWA 3BURA 3FHAA 3GIYA 4C6CA 4B15A 4LB4A 3WDRA 1RV8A 1RD5A 3S1WA 5AY7A 2F61A 1Q3NA 1TELA 3QC3A 5FD0A 2VEPA 4ZTYA 4C6EA 1Z3NA 4ZL1A 5E93A 4P61A 2QCEA 3BL3A 1E4LA 5KINA 1GYMA 3H7VA 5J5RA 3TJ4A 3S1GA 1CBGA 1S5NA 4AEEA 1XIFA 1U2YA 1K9TA 4S1FA 1OX6A 3I10A 4IICA 4GQBA 1E0UA 1E4NA 3TFCA 3SN0A 4X9YA 2NQ9A 1OJXA 3M0LA 4YJ5A 3ARYA 2PMQA 3HG5A 1TX0A 1CXKA 4HYVA 3AZTA 3KWSA 3M0XA 4E8GA 1QOXA 3AHTA 1PDZA 1OHLA 3TN4A 3NSMA 5TNVA 3I3BA 1THFD 4JR5A 5FJOA 4UOZA 3TA6A 1RCQA 1JROA 2C8NA 3B9OA 1RCXB 3PR2A 4JX5A 2I5IA 3N25A 2FZ9A 4IQLA 1XP3A 4UCGA 3KVJA 4W4QA 4DNAA 3NYDA 2VZSA 2QNEA 3W88A 3V1PA 1E15A 4MNJA 1XSIA 3D3AA 4GI6A 4IF2A 2XN2A 2ON3A 3KBVA 3L67A 4QG6A 4E3TA 1F3TA 4NAEB 2BS9A 4LPCA 4CU8A 3S2NA 3WLSA 1BG4A 1KFKA 2J7HA 1TTJA 4EKJA 1FH9A 3B0PA 1TV3A 4JTQA 2VURA 2W6RA 2YCKX 4GWEA 1XH1A 3NGFA 4Q8VA 1XSKA 2VVNA 1OFEA 2HVMA 1JAEA 1PS9A 1L0PA 1RJQA 3EKZA 1A4LA 1LQ2A 1S5VA 2ISWA 4AZ7A 2NV1A 4YN5A 4AZ6A 1CXFA 3G1VA 5LGZA 3A3XA 1UBSA 1ITCA 1UH3A 3P67A 4MNMA 4AH7A 3GTIA 3P61A 1UHVA 1FBAA 1ZJAA 1RA0A 2VWSA 3AIVA 2SFPA 2FFIA 3N2XA 3TN3A 2V9DA 1UZ1A 3IIVA 4RNFA 4KERA 1UR4A 2GPTA 2FJUB 1NDYA 4PEKA 2DIJA 2YDSA 1V6WA 1XG3A 2TRSA 4KCWA 5B7ZA 1SM9A 2QF8A 4V1XA 2PDWA 1YQ2A 3PPFA 3PJTA 1HJQA 3CWNA 4HBKA 5AB3A 4HPGA 3PAJA 3ES7A 1KO0A 4C6MA 3MP4A 2E5CA 1ZPTA 2O9TA 1LRQA 2C1GA 3IJLA 4F0SA 2CWNA 2E9MA 3AAMA 3E0FA 3VX0A 3WK0A 2DJXA 3BG5A 4HOZA 2NXHA 4I5UA 5K4ZA 1QRQA 4H2CA 2V38A 3FYYA 1DEDA 1A47A 4GX8A 3VOIA 4MG4A 1F9CA 2I16A 2J6XA 2YVGA 4UTHA 2OT1A 3W1QA 3TSMA 3BGJA 3LRMA 1PCKA 3VNMA 1US0A 1GG1A 3TOYA 1A53A 3UA4A 3GHSA 3DECA 1JCXA 2VR2A 2YFNA 3RX4A 2Y85A 4KQNA 3S9YA 3WFZA 1X2HA 1VCGA 4MTVA 1ZRQA 1DXLA 3WBAA 4OTKA 1H7RA 1UZDA 3UD6A 1PJ9A 1HL9A 3SR7A 1HF6A 1U83A 3V5OA 1YXCA 4B2DA 1SZGA 4IIBA 2Y2WA 3GNDA 3M6YA 2WJDA 1LLWA 2FDMA 4H83A 4GKLA 3NUKA 1EP2A 1PXGA 1HFBA 4B16A 3PUEA 1M41A 1I2RA 3MY9A 1ZAHA 1S2WA 3VFLA 1ODZA 1H0IA 4JD4A 4LUYA 4UQCA 2QUUA 3W25A 3WDHA 3QFWA 1XYFA 1FCVA 4K1GA 2QULA 3VE9A 1J2BA 4OHQA 1K4HA 2R82A 2WLZA 3IAQA 1XLEA 1V7YA 1AA1B 1JYVA 3TC6A 2Q71A 1SYTA 4JY8A 4MM1A 5CSSA 1SMDA 4Q22A 1V59A 2J9XA 3H22A 4NILA 2CLPA 4FOJA 4DI8A 1D3GA 3D5HA 3KL3A 2FFCA 3H4WA 2WHLA 3GUWA 3OVGA 2V69A 1A5UA 3AM9A 2QJNA 1XI3A 3R0KA 2HZGA 2PE4A 5G5GB 2JBMA 4LVGA 4GQGA 5D37A 1ONXA 3W7PA 3B9AA 3PANA 2GZXA 2BY2A 1CX9A 3G0UA 3DYMA 3VIIA 2XVLA 3WUEA 4H4XA 1IHIA 1O68A 4UR9A 2DU2A 1B4EA 5D8WA 4U4MA 2DZAA 4M3PA 4FLQA 1OM0A 1NHQA 2NUYA 3G0SA 2MNRA 2TYSA 3CU2A 2PGFA 4XZBA 3SRFA 3CUHA 3MUXA 3SW6A 4UCFA 3GBEA 5E0KA 3IACA 7TAAA 1HUVA 3B4UA 4NIRA 2R14A 4IJBA 1W3HA 2EPNA 3BLOA 4XAGA 3FFSA 3NPXA 3KAOA 3AI0A 3BDKA 2P53A 3TEVA 4IMAA 5HMSA 3LADA 3CZJA 2XFYA 1QW7A 1N5WC 1JPKA 4XSLA 2DSWA 2W4XA 1ZSXA 4XISA 4C6NA 1KFLA 2X7VA 2PCQA 1UUOA 4W93A 4O57A 1EQCA 1SO3A 3MUY1 4N6FA 3L23A 4D6DA 3GXIA 3LPOA 1G4TA 2HPMA 2OEJA 3UPWA 4KFPA 3C61A 1OADA 4TR9A 5LKYA 3VGEA 1DIEA 4ASTA 3W1UA 1O94A 5ABTA 2J8GA 4AD1A 1RLCL 2BGQA 3PF3A 1UWAA 1H1ZA 4PTDA 5HWNA 2YR1A 3NR0A 2PD9A 1J12A 3AU6A 1A5AA 4DEFA 1A3XA 4YWOA 4P8XA 3K4WA 4HIBA 1AH0A 1EUNA 3TLQA 4L4MA 2MUCA 2NV9A 3UWVA 3OO2A 4N02A 2Z2UA 2ZE0A 2Y70A 3PZUA 3B4YA 1P48A 2VT0A 1KLYA 3WF3A 2GVEA 3MSDA 4LAUA 1NY1A 2D20A 4HSNA 3AMKA 2ZZ7A 5CEWA 1SJDA 3A7AA 1J0IA 4LVFA 5AVNA 1XBVA 5A8GA 2BDQA 1MZHA 1RVKA 2C3ZA 2H6RA 1HVQA 1BSLA 4X9SA 4C6JA 2J24A 2OJPA 1WP6A 5JUVA 1QI3A 4AIOA 4IGNA 3G2GA 2V5LA 1W1VA 3PULA 5K9CA 5C7HA 1CLVA 2W3ZA 4AU0A 2E28A 1XYLA 3DFSA 5HPCA 4IGMA 3GFXA 1JG9A 3II1A 4HGXA 3UWEA 2DZWA 2BHYA 3AXXA 3LI0A 5FAGA 1F8WA 1XIGA 3QH2A 4W89A 1TCDA 3GY1A 5LNSA 3DZ1A 2G3JA 4FOUA 3SIZA 2C7FA 1UP0A 2PLCA 1KKRA 4CNOA 4UTWC 1J9YA 5LA0A 5I79A 4JIRA 3W2NA 5IDZA 3V18A 4U10A 2PDPA 1BAGA 4RX0A 4TVCA 4MIMA 1FIQB 4LW7A 4TQTA 3F2DA 5L6UA 3O05A 3TV8A 3UWWA 4NI8A 3H23A 3ZYZA 1H61A 3B8VA 4UFMA 4QP0A 4JX6A 2NX9A 1CB7B 2ZTKA 3BLDA 2POZA 5U1OA 4ZXOA 2WPGA 3VIGA 3OA3A 4IXHA 3AMCA 2PCEA 3SEPA 3G3DA 4LCQA 4CGTA 1XC4A 1ZHAA 3ZWSA 4IGSA 1VZWA 2JFEX 3DOPA 3GIPA 4NJIA 3ZM8A 2GR3A 4B5SA 2AGKA 1ISYA 1YEYA 5A8MA 8CGTA 4H9ZA 2A3AA 3P5YA 2YLLA 1NJJA 1AVAA 1WNOA 4NF7A 4Z0SA 1KFCA 4A29A 1W6TA 1W91A 2D0FA 4IIHA 3VOJA 2BHZA 2QJMA 2E67A 1MNSA 3CQKA 1MNZA 4DUVA 1XQLA 2WBAA 1JF6A 4DXXA 9XIAA 1R9ZA 2X8GA 3CAKA 1MI3A 5HA7A 1QO2A 4O1DA 3GYCA 1XH2A 1UIPA 3WIJA 1XV8A 4YCPA 2POTA 1GQLA 2WCSA 3EX4A 3SUVA 5A3HA 5I78A 5A6MA 1EC9A 2VENA 5HK4A 1K77A 3TKFA 1ZBVA 2Q8LA 1YX1A 1WKFA 4DXKA 3VGFA 2RUSA 3NQFA 3BAXA 1EDTA 3WF2A 4R3UA 2J7FA 1XLHA 2OOFA 2GVYA 1YPFA 3CQHA 4X3ZA 2PC8A 4QFUA 1M7PA 2OX4A 1FUYA 3BLLA 4AFYA 1XRTA 4KPLA 5BWAA 4C7FA 1TE6A 4CD4A 1O5XA 3S6TA 4UBPC 3QR0A 5HJYA 3T55A 2IUZA 5FS6A 4O16A 1X7IA 3CHCA 3SSJA 3N17A 1FWHC 3GB6A 4N9BA 1WO2A 5K4XA 1QHOA 2YYTA 1AL8A 4JQ4A 3MCOA 4DZ5A 4HZ6A 1Q4WA 1DJXA 3IJ9A 3CL7A 3THDA 1AZ1A 1VFSA 1T5AA 2XH4A 3O6CA 4D8AA 1REQB 3QPZA 2C3DA 1M65A 1PZ0A 1I2QA 4Z17A 4L9XA 2AKZA 5D09A 2GFTA 3UU0A 4DELA 1GZ1A 4B4HA 4GQQA 4KWVA 2WSRA 3NS1B 2W0HA 4W8BA 1V3MA 4ZOBA 1OGSA 2VCAA 3ZLFA 5G1YA 3OOQA 1GYLA 4LUIA 2KX9A 1R6WA 5CC5A 2NVDA 3IEBA 3THQA 4E4PA 1LUCB 4I90A 4ZOHB 3M44A 2KAUC 5EMMA 1P0KA 1B30A 3PTDA 3R79A 1GGOA 3BQ5A 4W7VA 4JTIA 2J27A 3VUSA 3RR4A 3VNZA 2DZSA 3A21A 4V1YA 5BXTA 5J04A 2GWNA 2OTDA 1U5VA 3A4WA 3BGGA 3WFAA 4GUJA 5KSWA 2WJZA 1T96A 1BTMA 2HNHA 3A4JA 1V6YA 3E5PA 3MPGA 1VHNA 2YCIX 3NZQA 2Z1BA 3HTWA 4M6UA 2Q6ZA 4JN8A 3C56A 3H7UA 3W26A 2NUWA 1GW1A 1AW2A 3BMVA 3O1NA 3W7NA 3HQPA 1XDJA 1Q6QA 2DQWA 4CN6A 4L1XA 3L4UA 3PTMA 1EP3A 1I0BA 3UP8A 1GRGA 3UJRA 4JDRA 3W1NA 1OBAA 1TPUA 4CEXC 4AMAA 3F7JA 1E51A 1ISZA 2BFGA 2EGZA 1EL3A 3WEOA 4MUPA 2QUNA 2VD9A 3N2TA 1Z44A 3TE9A 1XFCA 1FFUC 2WJFA 1O1HA 1SQ7A 1AQMA 1DTNA 1F3XA 1SPQA 3S9ZA 1QNOA 3MSRA 1UKTA 4PMJA 3UBPC 2ZZ1A 1YADA 4H9TA 4JBRA 1GCYA 1VBHA 2Z28A 3VNYA 5C5YA 3I7QA 1H41A 2BLEA 3BJSA 3DENA 3H26A 2INZA 4YTSA 1VD6A 3E0VA 1ZCOA 1G0CA 3LPGA 4S39A 1JUBA 3KCJA 3QLLA 1UZ4A 1W9UA 1KXHA 4OOUA 4I6VA 2ONEA 3TYAA 4HCHA 2WKJA 1JYNA 3SRHA 1TX2A 4UTWA 2CXGA 2P76A 4ZR8A 3OZPA 1H50A 1UR9A 4U5IA 3H55A 3UPMA 2DFAA 3ANVA 1XD1A 1G7VA 4CQAA 5JVLA 3RFAA 1AMYA 2JF6A 1FWBC 1N61C 5C0QA 1H4PA 3CK5A 3B0XA 4E8DA 1R9XA 2X40A 3TTEA 2J66A 3U2EA 2DVXA 4PB5A 4JKKA 4A21A 4LF1A 4GUFA 1GQIA 2PLJA 2X16A 5FJIA 3BMXA 4GO9A 4H3DA 4HNTA 3RG6A 5I09A 5BRPA 3HZ3A 3EDKA 2XGZA 4US5A 2W3SA 1NU5A 4NJJA 1OK6A 3NL2A 1JIBA 3UXIA 4WY0B 1M53A 4J35A 2GJXA 1LM1A 2R1NA 3W83A 5IXEA 4D8ZA 1HO4A 1E6XM 3OPSA 1DE6A 2E68A 5JMUA 2PLKA 3A4AA 4O8RA 5MKGA 3CC1A 3P8JA 2A79A 3NO5A 3UZXA 1C9DA 5GNXA 2Y7GA 1HIZA 1P0EA 2D2JA 2EPMX 4NAFB 5LIXX 2ZRXA 4GHRA 5BMWA 4EM3A 2DT1A 2YIHA 4GBUA 4NL1A 4F40A 2WJEA 3VAVA 1V6VA 2ZWYA 3M07A 4AIEA 1BWKA 2ZRZA 2ZZ5A 4Q4OA 4ZQRA 1BD0A 2WMIB 2VDGA 4CU6A 4JFVA 3MUZ1 2ALDA 3DG7A 5F4XA 4G7EB 3CV6A 2G8ZA 2P8CA 2GVGA 3VILA 3WDJA 4DZIA 1A80A 1LT8A 3UJSA 3W2JA 1A4MA 2Y7FA 2RDTA 1TWZA 4J5NA 1Q2RA 2CESA 3QMSA 4HKPA 2P3EA 4IFOA 2A85A 2XINA 4Y9PA 3BG9A 1KC7A 5I23A 4Z2HA 2PDJA 1G4SA 3HN3A 4NI3A 2QLYA 2EEXA 1UYQA 1N2VA 2JK6A 3IUIA 4S3KA 1ONEA 4ZO8A 4H1ZA 3WQEA 3HRDC 5HNNA 4GNKB 2PP1A 1D3CA 2HK0A 2PRMA 3M0ZA 5AYYA 4V15A 1EUAA 3HM7A 4IIDA 3HO8A 3GVWA 4GKTA 1DQUA 3IUDA 4HNOA 4I9MA 1Y0EA 2ISVA 4BKNA 1MEIA 3AQUA 3C2YA 3NXFA 1WZLA 4IL2A 1LWHA 4LBRA 3RM8A 1NF7A 1WXJA 1GONA 5FMHA 4P7RA 1YPXA 4Z2JA 4C6OA 1UH2A 4GYPC 1KKOA 3S6DA 1KM0A 3UCCA 1GOMA 3BMWA 5IDIA 5HQLA 2QUVA 4AC7C 1F61A 1LLZA 3PBGA 3UWUA 3P7YA 2DIKA 4WDTA 5CGQA 1TKKA 1FDYA 2PDNA 5FEPA 3I6EA 2XIMA 5C8BB 3KTXA 3F4CA 3U48A 4WOQA 3UW6A 3W1MA 4H4UA 1NARA 4IUOA 4E38A 1SJAA 1T41A 3DHUA 1TVLA 3WG6A 5BRQA 2PFHA 3BAJA 3O0KA 1ZTVA 1MZRA 3AHYA 4GE8A 1TMQA 2CEQA 4JFWA 4M24A 2BY1A 5GRTA 4IMGA 1BWVA 3LGGA 5CAKA 4P8VA 3YPIA 4AWUA 5CZJA 2AAQA 3R8GA 1XYAA 1FEAA 3H7RA 3STFA 3AMLA 4OECA 3TSBA 4ADSA 3CGBA 2DZPA 3N34A 4RDWA 4QLJA 4UTIA 3T4WA 1A5SA 4PEEA 4JS3A 3QKEA 2CKSA 1ZX9A 1HJUA 1TSIA 3KOYA 3T78A 4D2JA 2BBFA 5KZMA 1EFZA 1S5WA 3IS4A 3NQCA 2BXYA 1UC4A 3W6YA 3PG6A 2GQAA 2HMCA 4MGGA 2GJRA 2CW6A 2YPIA 4LTSA 1UASA 4K1WA 5I3FA 4H19A 1SR9A 3KOZA 5CKSA 1MW0A 2J4GA 3L12A 4PRWA 5AZ1A 1M04A 3MMDA 3NTYA 1NWUA 1Z6KA 1RBAA 3E2QA 1T99A 4KBXA 1E0TA 5DY2A 1R2TA 4NJHA 3TQPA 3V35A 2Z6JA 3VOGA 5I24A 1IEWA 3Q4DA 4O28A 1BKHA 2XWEA 3L2IA 3CUFA 2DQXA 3IGXA 3B8WA 2DT0A 1QVBA 3S9IA 1Q5MA 1C7TA 1WDWA 2Z25A 4GGHA 2WMGA 2BNJA 1TJ0A 1EXPA 1JD7A 3K5XA 1S2UA 3TOPA 3ZJKA 4LALA 3RUBL 5M3WA 3PZ9A 2CLHA 4AZCA 5ECUA 7XIMA 3GH4A 1E73M 3S5ZA 4WF7A 4ZQPA 1MXGA 3VCRA 1KQYA 1VGAA 3EWWA 3VFCA 4ZQMA 5G4HC 3FVDA 2P5NA 3N15A 2VXNA 1OZMA 3FGCA 5C55A 3B9EA 1QBAA 1TIWA 3ZQ9A 1Y7VA 5GJMA 3WX7A 4ATWA 1WUFA 5JCMA 2GGEA 3S2JA 3MYPA 3CZKA 3STGA 2AQWA 1SVDA 3ENLA 3WUGA 2UY2A 4UZUA 3EMZA 2NVKX 1HZYA 1EO5A 2Y7DA 1RALA 1R9YA 4XZHA 3MP5A 2UZ9A 3W1PA 3REQB 1U5HA 3W7MA 4WZHA 3UGVA 3HG2A 3CV2A 1SMAA 2Z24A 3TMQA 5LNUA 3PZVA 1M9HA 1KLZA 5TR3A 1L2UA 2OYMA 1E6ZA 1E4MM 1X8CA 1I60A 2VOMA 2XVPA 3TC7A 2ZXDA 1XDMA 1Q6DA 1PIFA 2WPFA 3MMWA 2WZTA 4FX6M 2QAPA 5FJRA 5DMLA 4BEQA 1LBMA 4G1KA 5F2MA 1EWDA 2DT2A 4HTYA 4WGXA 2VZUA 3T0DA 4RZ5A 4JHOA 2CLMA 1LL6A 2EBNA 3LLXA 2I1OA 4MNKA 4PB4A 5JH2A 1TTIA 4O11A 1J0JA 2V2CA 4QDMA 3GH7A 4QITA 5BOOA 2ZZ3A 1DIKA 3GC4A 3TLLA 2NQJA 2QQ6A 4WY0F 1EZWA 1DHPA 4P5UA 3N3TA 4Q4RA 4K8HA 1TMLA 3QYQA 1KBBA 1IGWA 1XLMA 4LIIA 3ZJ8A 4MMWA 3U0HA 4UTTC 1NIUA 2PGEA 3GDLA 3W7GA 1OCBA 3F4DA 4HK6A 2ZA1A 3SCNA 1JD9A 1JDDA 1OY0A 2W27A 3L4TA 2PEVA 4JQ3A 1FCUA 2FZMA 1PKLA 2Q3OA 3MZNA 4GZEA 4LOCA 4R7OA 3WNLA 3GFYA 4GJ1A 1V79A 3DH7A 2H3DA 3DCPA 3WD1A 1OJTA 2G3IA 2X7WA 3OLDA 2VFHA 3WLNA 2QHAA 3CB3A 1TQJA 3W00A 4Z2IA 2V5BA 5CCZA 1TIMA 3U4AA 3MDWA 4E4FA 1B0IA 2XSXA 3P2VA 4CUCA 3CIWA 1EF2A 1FFVC 5A8OA 4IFKA 1PHQA 4XUYA 3CTLA 3EWBX 2KZHA 4H8VA 4R53A 4XIAA 3L2MA 4GPNA 2WC4A 3FEQA 2P1FA 4HJWA 3UG5A 3PY2A 2VMFA 3C0JA 1TV4A 1ECEA 4GYPA 3WH6A 4MDOA 5CC6A 2ALRA 2W9MA 1RZMA 1WZAA 4HZ8A 2A6NA 1W9XA 2XJ7A 2HROA 2V6AA 3M0IA 1GSNA 5CG0A 4FNPA 4JQ2A 2DVTA 4AG0A 2BC1A 4EAYA 3M16A 4ONVA 2F7FA 4QRNA 4G8TA 4PUUA 3E2VA 1TJPA 4H8UA 3VM7A 4KT2A 1EDGA 3SUUA 4EPEC 3WQWA 4QM1A 3G6LA 4RUBA 1AK5A 4XVDA 1TZ9A 2I57A 3LM3A 2XUCA 4WIWA 4XD4A 1MXDA 4KS0A 5BW6A 4UMAA 4YLWA 1OX5A 1V8EA 3LMYA 1AW1A 3B97A 2Z6IA 1OSEA 3UT0A 2OYLA 3T44A 3BLPX 1YMYA 3VDHA 4Y9NA 2WSQA 1NP0A 4GFIA 2VX6A 3CIXA 3B9DA 4LJ3A 4BI7A 1TV2A 2FTYA 3SY8A 4WEVX 1P7TA 1IZKA 1C29A 5LYRA 3M6DA 4Q4KA 4F2BA 1ME7A 3DGZA 1LP6A 1ML1A 4CNNA 4I8DA 3GXMA 5C2CA 1ZAIA 2BX7A 2RHGA 4GYKA 4UFJA 3GO2A 4DJED 1GJWA 2ESCA 1BWCA 1O5RA 4L5ZA 3BLFA 3ONBA 3WMBA 1FY6A 1OC7A 5HBFA 1GW9A 3DI1A 2CC0A 2TAAA 3O06A 2VDIA 3W28A 3K4AA 1ITQA 1NDWA 3WNMA 1UKPA 3T0CA 2CWXA 3WN6A 5I3DA 5M03A 3N6HA 3S5OA 1VBUA 2YB1A 4GGBA 1Q45A 3MBDA 5C9XA 2IXUA 2XHYA 4CD6A 2HVOA 1KV8A 4UQBA 4XK2A 2PDCA 4EM4A 2ZKMX 2Y24A 2NT0A 4HNVA 4G56A 2Y5EA 2YOCA 3NM3A 2QUMA 1CT5A 2YXGA 1QWGA 1IWAA 3IJ7A 3SY5A 2W3RA 3GIQA 3VIKA 1KXQA 3FJ4A 2ZA2A 4NXKA 4XWUA 1G94A 4ZCWA 4PBEA 3LB0A 1F76A 3TWBA 3P81A 4TU1A 4EIVA 2HE5A 2RJGA 3VIJA 1YE6A 3H2NA 1HKVA 2VC9A 3CPUA 4AEFA 3I7SA 2Z29A 2A7RA 4X2RA 3L5AA 4B90A 3R94A 3C2EA 1QI5A 1VYPX 3TNOA 2NSXA 2CZVA 3RNDA 2CLKA 4PA8A 4KF1A 1P6BA 5G4WA 1TPC1 5XIAA 1KB3A 2WMHA 1GESA 4CNUA 4RKAA 4UNLA 3GG0A 2PWUA 4MAVA 2A1YA 4YTUA 3FN9A 2YBUA 3LYEA 2YBVA 5C9UA 3VIMA 1VF8A 3DFPA 2OO6A 3OGSA 1GRTA 2FB2A 3GK0A 3W1TA 4H6QA 1XYCA 3W87A 1OCNA 4GI4A 1CECA