2NVKX

Crystal structure of thioredoxin reductase from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
481
structure length
481
Chain Sequence
YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioredoxin Reductase
publication title Structural and Biochemical Studies Reveal Differences in the Catalytic Mechanisms of Mammalian and Drosophila melanogaster Thioredoxin Reductases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 154
structure length 481
sequence length 481
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
X PF00890 FAD_binding_2 FAD binding domain
X PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2nvkX03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX02
4YT0A 4AT0A 1YY5A 4P9SA 5KVHA 1IUVA 2ACZA 2WDVA 4FK1C 2WQYA 3AYJA 1NG4A 4AOSA 4HB9A 3QJ4A 4B69A 1PBBA 1COYA 1REOA 3NN0X 1BGJA 1FECA 2BC0A 2BXRA 4H4TA 2YLZA 3NHOX 2XLRA 1LVLA 3P4QA 3REDA 1CBOA 4E0VA 2ZBWA 3NG7X 3FIMB 3CNSA 4FK1A 4OPGA 2WBAA 4B63A 2FJBA 1EL5A 1PDHA 3UTEA 4CY6A 3SM8A 4DNAA 1F8WA 3LXDA 2X8CA 3QVRA 3ADAB 4ZN0A 3P4PA 2Y6RA 4J36A 3UKAA 4YTMA 4Y4LA 4DSGA 4TM0A 4I59A 3NH3X 4H4UA 2Z5XA 2VZ2A 2XLSA 3SQPA 3M12A 1K0LA 3IHMA 2IVDA 3VR8A 1GRTA 1D4CA 4H4QA 3ALJA 4K5SA 3AEDA 1DOBA 1DOEA 2WU2A 3BI2A 3CNJA 2CDUA 4U8OA 4Z24A 1PS9A 2IIDA 4TLZA 4B64A 4CRTA 3D8XA 2C65A 3NTAA 1OJCA 3SGLA 1CJ3A 1E1KA 3VQRA 4DGKA 3PS9A 2Q7VA 2APGA 3AB1A 2C72A 3UOYA 3DK9A 2WDQA 1GTHA 4XWZA 3I6DA 4B1BA 4EQRA 3GD4A 1QLBA 4JNQA 5M10A 2C70A 3V3NA 2BABA 4GR1A 1O5WA 1KSUA 3URHA 1NPXA 1F8RA 2V3AA 4Z26A 4Y4NA 3FPZA 4A7AA 1GETA 1CHUA 2OA1A 3JSKA 2VRMA 3G5SA 4U8MA 5U25A 3AEFA 1CJ4A 1JNRA 5EBKA 4NTDA 2C3DA 1VRQB 1YQZA 4M52A 2Q0LA 3QFBA 3DK8A 4J56A 5BULA 2R4EA 5FS6A 2YG5A 1B37A 1KSSA 4BURA 2X8HA 4YSYA 2BCGG 1D4EA 5J60A 2YG6A 3AEEA 3AE9A 3F8RA 2XVIA 4A6NA 2EQ8A 3AE4A 4UDRA 2BS3A 3NNEA 4EMJA 3UOZA 2ZZBA 2B9WA 1IUWA 1PJ7A 2IVEA 2WEUA 3V76A 1PBFA 3ITJA 4J34A 5IPYA 2J3NA 1S2YA 4U8KA 1D7YA 1B5QA 3GMCA 4OPCA 1E6EA 1D4DA 3G5RA 1VG9A 4RG3A 2GR0A 4Z2TA 3NGCX 3AE5A 1ZK7A 2YLTA 3T37A 2B9YA 5U1OA 2VQBA 2GRTA 3KLJA 4LU6A 1TDFA 4H2NA 1GOSA 1N4WA 1PJ5A 1YQ3A 3EPTA 1H6VA 1ZDLA 3VR9A 3AEGA 3NYFA 2WP5A 1EL9A 3AD7B 4OPTA 1Q9IA 3GMBA 3P4SA 2NVKX 2YG7A 4Z25A 1LV0A 2XYOA 1E1LA 2YAUA 5CKUA 4O5UA 1X31B 1Y0PA 4ECHA 3QSMA 2YM1A 4RG4A 2GVCA 4MJWA 4J31A 1L9CA 3RNMA 1ZMCA 4ICYA 3UOVA 1H7WA 4USQA 3ZYXA 4EM3A 4A79A 5EB5A 3G5QA 2YLRA 1NHSA 3LADA 1NHQA 4X4JA 1GRAA 1UKVG 5HHFA 4GCMA 4J2WA 2YR6A 5BRTA 5LV9A 1H7XA 3ALMA 4U8NA 3C4AA 2B7RA 4GDEA 3DJJA 5KWFA 5HXIA 1NENA 3ICSA 4K5RA 4YXDA 3DJGX 3V3OA 2XFOA 1FCDA 2UZZA 2X50A 1NHRA 1YKJA 1KNRA 1P2HA 3II4A 1FL2A 3FBSA 1BZLA 5CQFA 2X99A 5KOXA 3GDPA 3FMWA 2YG4A 5EB4A 2WPEA 2GEWA 2Y6QA 4OPDA 4USRA 4H2RA 2A89A 4H2QA 2R45A 2V61A 2B76A 4TM3A 2O9ZA 1M6IA 4TM4A 2XLTA 4LIIA 4H4XA 2AQJA 2C75A 1JRXA 3IF9A 1FOHA 3NK0X 2X8GA 4H7UA 4JY2A 4UP3A 2JAEA 1IUTA 1CF3A 2GMJA 3I3LA 5KXJA 2JBVA 4Z43A 1OJDA 2YVFA 1NEKA 3CNPA 1BKWA 1L9DA 2WPFA 3Q6JA 2F5ZA 3AE8A 3AE1A 1N1PA 3C96A 4WCTA 4A6NB 4D03A 3NYCA 4YSHA 2R0CA 2JB2A 3UKFA 4C74A 3OZ2A 3K7MX 5IQ1A 4CNKA 5FS7A 1Z6LA 2BK4A 1O95A 3EF6A 2RABA 2XFUA 4KX6A 4ZCCA 4OPUA 5FS9A 4Y4MA 4EQXA 5GSNA 4FDCB 3DJDA 4H4WA 2PHHA 4XXGA 3KKJA 1D5TA 1EL8A 2YWLA 3NKSA 4B67A 1GTEA 1IUSA 3COXA 1VG0A 5U63A 3CGEA 3GWDA 1RP0A 2QA1A 2BS4A 1KDGA 4NTEA 2XFPA 3QSSA 2A87A 2YLSA 4AP3A 2FBWA 3K30A 2BACA 1JRZA 4GUVA 1JU2A 1RSGA 2WHDA 1N4UA 1P2EA 2WDRA 3BHFA 4UDPA 4ADWA 1NAAA 4DSHA 3VRAA 1DODA 3D1CA 2PYXA 2WESA 5M0ZA 2E1MA 3KD9A 4LA1A 2EQ9A 1YQ4A 3ABVA 4EQSA 4U8JA 1DNCA 3UOXA 1PXAA 2B7SA 4FX9A 2C7GA 4EMIA 3CPIG 1MO9A 1ZMDA 3NIXA 2WS3A 4APNA 2YLWA 2XCGA 4BJYA 2EQ7A 4PAAA 2GB0A 4J57A 2WOWA 1GPEA 1OJAA 2FJDA 2I0ZA 3DJEA 3F8DA 1GALA 4U2TA 1F3PA 4EQWA 4RSLA 1NDAA 4H4YA 3BHKA 1O94A 4ZCDA 1BF3A 1DOCA 3LZXA 3M0OA 1GRFA 3WE0A 3ATQA 2QA2A 3CNDA 3CGBA 2XVHA 3IHGA 4A65A 2AR8A 4BK1A 4C5OA 4CY8A 4JY3A 4JDRA 3EANA 4C3XA 1CC2A 5JCLA 1W4XA 1TDNA 1TDKA 1CJCA 1XPQA 1PN0A 2BK3A 3H8IA 4H4RA 1GNDA 1N4VA 2XDOA 3QSEA 4TLXA 4B68A 1B8SA 1JOAA 1LQUA 2OALA 3NLCA 1RYIA 2C64A 3GRTA 4GRTA 2GAHB 2TMDA 4X9NA 1TYTA 2R0PA 1H83A 2JK6A 5ER0A 2CVJA 1GRGA 3SFEA 3P4RA 1PXBA 5FS8A 2YQUA 2V3BA 3S61A 5JCNA 2ARDA 3UKLA 3DH9A 4Z44A 3ICRA 3GD3A 1E1NA 1K0IA 2BS2A 2GV8A 2XFQA 4D04A 3AECA 1TDOA 2OAMA 3DMEA 3NN6X 1E1MA 1L9EA 1LJ1A 1E7PA 2B9XA 1S3BA 3GSIA 3NYEA 5GRTA 4NZHA 3QVPA 4OCGA 4U8PA 3PO7A 1FEBA 1TDEA 4B66A 2WPCA 1PHHA 1JRYA 4H4PA 5TR3A 3H4KA 4C3YA 1LTXR 2YR5A 4K7ZA 3LOVA 1IUXA 4CCRA 2VOUA 5C3JA 1BGNA 3BNUA 3AE6A 4IVOB 3OC4A 5J7XA 2Z5YA 2GQWA 1F8SA 3M13A 3NT6A 1OJ9A 1Q1WA 2EQ6A 5KVIA 1PBCA 3KA7A 3DGZA 3AE3A 5BUKA 2VVMA 1DXLA 1XHCA 1DJQA 2QAEA 1QJDA 2DKHA 1JEHA 2V6OA 4JQ9A 1ZOVA 2GMHA 4H4SA 4GDPA 3S5WA 4REKA 5JCKA 1KNPA 4K22A 3K7QX 2GQFA 2JB1A 4C77A 1GRBA 3IC9A 4IA6A 2E5VA 3NK2X 2VVLG 2CULA 2Q6UA 1CC4A 4J33A 1H86A 4TM1A 2HQMA 2WOVA 4GF7A 3R9UA 1D7LA 2WP9A 3GWFA 3GDNA 4X9MA 2GAGB 5C2TA 4YTPA 4K2XA 3LZWA 3ATRA 4A9WA 2QCUA 4H50A 1ZOYA 3AEAA 4O5QA 3VRDB 3QFAA 3L8KA 3CN8A 3B3RA 4YKGA 2JKCA 1F6MA 1PBEA 2XFNA 3KU9A 2BYBA 5HYMA 4JN9A 1EBDA 1GV4A 3UKQA 2WP6A 1K4QA 1ELIA 2OLNA 3BI4A 1OJTA 1IUUA 4U8IA 3SFDA 1XDIA 2BCPA 1K0JA 5HY5A 1ZX9A 2VRLA 4EMWA 2V5ZA 1GSNA 4PABA 1S2QA 2W0HA 1NHPA 1XANA 4H4VA 1CL0A 3CPHG 2YVJA 3RP6A 4IVMB 4YSXA 1JNZA 1GT8A 1Y56A 2Q0KA 3EAOA 2ZZCA 2R46A 3AEBA 3AE2A 3VRBA 4A5LA 1TYPA 4YWOA 2C73A 2BC1A 3BI5A 2R0GA 2BA9A 2V60A 1IJHA 1EL7A 1KF6A 2XLUA 4U2SA 2XLPA 1NG3A 2FJAA 3RP8A 1VQWA 3AD9B 1PBDA 1VDCA 2C67A 3UKPA 3HZLA 2C3CA 3RP7A 1L0VA 3CGDA 1MOKA 1Q1RA 4CNJA 2R4JA 3LB8A 2RGJA 3RHAA 1MXTA 3DA1A 4UDQA 1CJ2A 3AYIA 4Z2UA 5DBJA 1GREA 1AOGA 1HYUA 2H88A 3UP4A 3ICTA 3AE7A 2AAQA 4HA6A 2DKIA 2GH5A 4IV9A 2C76A 3PVCA 4YKFA 1FEAA 4YSZA 3LJPA 1ZY8A 1H81A 2YLXA 3UKHA 2R9ZA 3AWIA 1BWCA 1E39A 2GR1A 1CC6A 2WETA 2OLOA 3C4NA 4OPLA 3ZDNA 1H84A 3H8LA 3CTYA 3UP5A 1PJ6A 2RGHA 5L46A 4BJZA 3L1RA 2A8XA 3UCLA 3O0HA 3FG2P 1KFYA 1ZP0A 3AXBA 5IQ4A 2VQ7A 2YM2A 1DJNA 3P1WA 4EIQA 2ZZ0A 4AT2A 1M64A 4YTNA 3NTDA 5BVAA 1B4VA 3UKKA 4NTCA 5JCIA 4EM4A 3E1TA 1ONFA 4KPRA 1GESA 3AYLA 3IWAA 3GRSA 2XVFA 1ZKQA 4OPIA 4Z2RA 1LPFA 1SEZA 3ALLA 3P9UA 4JNAA 4H2PA 4WX1A 3DGHA 3B6DA 2GR2A 2FJEA 3CPJG 4OVIA 3UTGA 4NEWA 3NRNA 4I58A 4BV6A 4IA5A 3CGCA 3DK4A 4NEVA 5JCMA 2BXSA 2JB3A 2NPXA 1GEUA 1S3EA 1PXCA 2GR3A 1LQTA 2X3NA 3KVEA 2WOIA 2YR4A 4U8LA 1GXFA 3Q9TA 2C66A 3CIRA 3NK1X 3ISHA 2WU5A 2CFYA 1TRBA 1GERA 3F8PA 2XVEA 2H89A 5FMHA 3AD8B 3CNTA 3K7TA 3BNMA 4CBQA 4AP1A 1GRHA 4B65A 2BK5A 3KPFA 2YG3A 4U2LA 4AOXA 1V59A 5EOWA 4A99A 2XVJA 1H82A 4EIPA 5KOWA 4H4ZA 4BK3A 3GYJA 2RGOA 2TPRA 3UTHA 4N9XA 4BK2A 2YVGA 2VVLA 4CCQA 1Y56B 1QO8A 3UTFA 5KRQA 2GF3A 4XWRA 4K8DA 2E4GA 3GYIA
chains in the Genus database with same CATH superfamily
4YT0A 2GGHA 2DW7A 2ACZA 2WDVA 4FK1C 3QJ4A 3AM9A 3NS1B 3NN0X 1FFVC 2YLZA 2XLRA 2ZBWA 3CMMA 3CNSA 1N61C 4OPGA 2FJBA 1PDHA 4CY6A 1F8WA 3LXDA 3JVAA 3QVRA 4GYPA 3ADAB 2ZADA 4ZN0A 4DSGA 2W3SA 4H4UA 2XLSA 3M12A 3VR8A 1GRTA 3AEDA 1DOBA 3BI2A 4U8OA 4Z24A 2CDUA 4B64A 3CB3A 3D8XA 3NTAA 3T8QA 2APGA 4XWZA 2RDXA 3GD4A 4JNQA 2C70A 3N6JA 4GR1A 2V3AA 3URHA 1F8RA 4FP1A 3FPZA 3UJFA 1CHUA 2OA1A 3JSKA 1CJ4A 5EBKA 2C3DA 4J56A 3DK8A 5BULA 1KSSA 4BURA 4DXKA 4YSYA 1SJAA 3F8RA 2XVIA 2BS3A 3NNEA 4EMJA 1IUWA 1PJ7A 5KMQA 1PBFA 3ITJA 4J34A 5IPYA 3GMCA 3RO6A 4OPCA 1VG9A 3NGCX 3DERA 2OO6A 2YLTA 5U1OA 4Z17A 1GOSA 3ZLHA 3AEGA 4E6MA 4ROPA 2YG7A 4Z25A 1E9IA 4Z1YA 5CKUA 4O5UA 3R11A 4ECHA 4J1OA 2OQHA 3SZCA 4ICYA 3ZYXA 3CAWA 1NHSA 1NHQA 2PP0A 5LV9A 2W3RA 1WUEA 3ALMA 4U8NA 3C4AA 3Q45A 5HXIA 4H2HA 4YXDA 3R0KA 5IDZA 3DG6A 2UZZA 2X50A 1NHRA 1YKJA 3II4A 1FL2A 3FV9A 2X99A 4OPDA 4H2QA 2R45A 4F4RA 2V61A 2O9ZA 3PG6A 2XLTA 4LIIA 2C75A 2AQJA 3NK0X 1CF3A 1OEPA 1NEKA 3CNPA 2QQ6A 3TWAA 3SN1A 3UJSA 3UKFA 4C74A 2MUCA 5FS9A 3RITA 4FDCB 3DJDA 3NRZB 2PHHA 3KKJA 2XFPA 2FBWA 1JU2A 3SYIA 3BHFA 1NAAA 4JN8A 3VRAA 4KT2A 3ABVA 3CXBA 2C7GA 1MO9A 3ZVIA 4BJYA 1OJAA 4DGKA 1GALA 4EQWA 4RSLA 4H4YA 3BHKA 1O94A 3MUCA 1F9CA 3LZXA 3CNDA 3CGBA 3VCCA 1VQZA 3SX6A 1XPQA 1TDNA 4I58A 4B68A 1EBGA 1RYIA 4GRTA 4X9NA 1H83A 2CVJA 5FS8A 2YQUA 2ARDA 2GV8A 4D04A 1TDOA 2GGJA 3DIPA 2QJJA 1T3QC 1E1MA 1L9EA 1E7PA 1S3BA 3IK4A 4OCGA 3TQPA 3PO7A 3CYJA 2QJMA 3N4FA 1SJCA 5TR3A 4KWSA 2HXTA 2YR5A 4K7ZA 2VOUA 5C3JA 4GMEA 1BGNA 5BOFA 3NFUA 3NT6A 1RVKA 1P43A 5KVIA 1PBCA 3KA7A 3SQSA 1JEHA 2V6OA 4IL0A 5JCKA 1KNPA 2JB1A 1GRBA 2OLAA 4IA6A 3NVYB 4HCLA 2VVLG 3V5FA 4J33A 4TM1A 2WOVA 1EC8A 4GF7A 3R9UA 2GGIA 3GWFA 5C2TA 3DEQA 5BOEA 4O5QA 3CN8A 2PGEA 3B3RA 3DGBA 2XFNA 5HYMA 1GV4A 1ELIA 4M6UA 1V97A 2VRLA 2V5ZA 5KMRA 2AKZA 3CPHG 4YSXA 1GT8A 2R46A 4IZGA 3VRBA 1X2HA 1ELSA 1KD0A 1BQGA 1EL7A 2XLPA 1NG3A 2FJAA 3RP8A 1VQWA 1PBDA 1VDCA 1STZA 3H70A 1H2IA 3DA1A 4UDQA 1GREA 1HYUA 2DKIA 3I6TA 1MUCA 2C76A 1JROA 1FEAA 3LJPA 1E39A 1CC6A 3GC2A 2OLOA 2MNRA 4GGHA 3UCLA 3FG2P 5IQ4A 2YM2A 1M64A 3NTDA 4K1WA 5BVAA 4NTCA 1R6WA 4EM4A 1ONFA 2XVFA 3ALLA 3P9UA 3DGHA 4OVIA 2NPXA 1PXCA 2GR3A 1P48A 2X3NA 2C66A 3CIRA 3NK1X 1JCTA 2NQLA 2XVEA 3UJEA 2BK5A 3KPFA 2YG3A 4EIPA 4AOXA 1V59A 1H82A 2TPRA 4BK2A 2YVGA 2VVLA 1Y56B 2GF3A 3R25A 4K8DA 1IYXA 4AT0A 1IUVA 2WQYA 3MY9A 3SZFA 1NG4A 1YEYA 4AOSA 4HB9A 1REOA 3FYYA 4JN7A 1BGJA 3A7RA 4GYPC 4H4TA 1LVLA 3D46A 4E0VA 4A3RA 3AMZA 4B63A 2OFJA 4TVWA 1N60C 2GSHA 3MSYA 2ZC8A 3NXLA 5KNLA 3UKAA 4I59A 3NH3X 1ECQA 2IVDA 3ALJA 1PS9A 4TLZA 1XS2A 4CRTA 4E4UA 2XH7A 3UOYA 2WDQA 1GTHA 3TTEA 2BRYA 4EQRA 1QLBA 4G74A 1O5WA 4MMWA 3UGVA 4U8MA 3ZVHB 3N4EA 1YQZA 1SB3B 1EC7A 3QFBA 2P8BA 1B37A 1XPYA 2YG6A 3AEEA 2EQ8A 4UDRA 3UOZA 2PTWA 1BKHA 2WEUA 1S2YA 5ENLA 4Z2TA 2GR0A 1ZK7A 3T37A 3N6HA 2VQBA 3KLJA 1TKKA 1ZDLA 3VR9A 3NYFA 3P4SA 2NVKX 3HPFA 1LV0A 1E1LA 4RG4A 1JPDX 1L9CA 1ZMCA 3GYXA 4EM3A 3EEZA 3G5QA 3HRDC 3P0WA 3GD6A 4X4JA 1UKVG 2YR6A 5BRTA 2OKTA 3DJJA 3PK7A 2I5QA 3DJGX 3S5SA 2XFOA 1FCDA 3FBSA 1BZLA 2PTXA 3GDPA 2YG4A 3H12A 5EB4A 2Y6QA 2A89A 4TM3A 4IT1A 3NO1A 3IF9A 4H4XA 2QGYA 4H7UA 1IUTA 2GMJA 5KMSA 4Z43A 2OX4A 3IJIA 1FHVA 1BKWA 4HN8A 3Q6JA 2F5ZA 3AE8A 2JB2A 5FS7A 1Z6LA 2BK4A 3EF6A 4NNJA 4ZCCA 5GSNA 3EUB3 1D5TA 4D03A 3QN3A 1IUSA 1VG0A 4ZOHB 2BS4A 1TE6A 3FXGA 2YLSA 3S47A 3ZLGA 2BACA 3QPEA 4DYEA 2WDRA 1P2EA 4ADWA 5M0ZA 2EQ9A 2P0IA 4FX9A 3HYXA 3NIXA 2WS3A 4APNA 3VDGA 3A7AA 2GB0A 4J57A 3DJEA 1GPEA 2FJDA 2I0ZA 1BF3A 1GRFA 2E3TA 3KPKA 3ATQA 3IHGA 2AR8A 4CY8A 4JDRA 4C3XA 1TDKA 1PN0A 4TLXA 1GNDA 3QSEA 1B8SA 1LQUA 2GAHB 1PXBA 3UKLA 3DH9A 3B9JB 3ICRA 1E1NA 2BS2A 4G6HA 3H7VA 1KN0A 3DMEA 3NN6X 3GSIA 4NZHA 3SZWA 4B66A 1PHHA 1JRYA 2OG9A 3SN0A 4NWZA 1N63C 3I6EA 3LOVA 1IUXA 1JPMA 3NVZB 2Z5YA 3M13A 1TZZA 1MRAA 3R10A 4K8GA 2QAEA 4JQ9A 4K22A 1MDRA 4C77A 3NK2X 3STPA 1H86A 2HQMA 4X9MA 4YTPA 4K2XA 3LZWA 2GDQA 3ATRA 2QCUA 4H50A 1ZOYA 3VRDB 3QFAA 3L8KA 3P93A 4M0XA 1PDYA 2XH2A 2CHRA 3UKQA 2OLNA 1OJTA 1IUUA 3R1ZA 2BCPA 1K0JA 1ZX9A 1GSNA 1CL0A 1XANA 4H4VA 4IVMB 2Q0KA 3AEBA 3EAOA 3ES8A 4A5LA 1EC9A 2C73A 3BI5A 1L8PA 2C67A 3RHAA 4Z2UA 5DBJA 1AOGA 2GH5A 4ZA0A 3PVCA 4YKFA 2PODA 3T6CA 1H81A 1NELA 1BWCA 3R07C 2POZA 1VDVA 3UXKA 3MQTA 3UP5A 3L1RA 2A8XA 3O0HA 1ZP0A 4AT2A 5JCIA 3UXLA 3E1TA 2HZGA 3GRSA 1LPFA 3UTGA 4NEWA 3TJ4A 3NRNA 3CGCA 3DK4A 4NEVA 2BXSA 2JB3A 1GEUA 4KEMA 1LQTA 3KVEA 2YR4A 1GXFA 2WU5A 1TRBA 1GERA 3RCYA 5FMHA 3AD8B 3CNTA 2GL5A 4AP1A 1GRHA 2PP3A 4U2LA 2XVJA 5KOWA 4H1ZA 2RGOA 3UTFA 5EU9A 5KRQA 4IHCA 3GYIA 1YY5A 3AYJA 3T2KA 3SY4A 1PBBA 1FECA 2BC0A 2BXRA 7ENLA 3FIMB 2WBAA 3SM8A 2P3ZA 2Y6RA 4YTMA 3MZNA 2O56A 4Y4LA 2Z5XA 2VZ2A 3SQPA 1K0LA 3SJNA 4X2PA 2WU2A 3B97A 2IIDA 3BJSA 2C65A 3TWBA 1CJ3A 3AB1A 2C72A 3DK9A 2AL2A 5M10A 2BABA 1KSUA 1NPXA 4Z26A 4Y4NA 3G5SA 4GIRA 5U25A 1JNRA 4TVYA 4NTDA 2HXUA 3TJIA 4M52A 4DHGA 5FS6A 2YG5A 2X8HA 4A6NA 3AE4A 2ZZBA 2B9WA 2IVEA 3V76A 2J3NA 4U8KA 4MKSA 1B5QA 1E6EA 1D4DA 3G5RA 1N62C 4RG3A 1R0MA 2OQYA 2DW6A 3MWCA 4LU6A 4H2NA 3EPTA 1PJ5A 1YQ3A 1H6VA 4HPNA 2WP5A 4ENLA 3QLDA 3AD7B 1Q9IA 3H8AA 2YAUA 1X31B 2YM1A 3D47A 3L5OA 3RNMA 3T14A 1H7WA 5EB5A 3OZMA 5G5GB 1FO4A 3DDMA 5HHFA 3UCCA 4G7FA 5KWFA 4GAPA 3ICSA 4K5RA 3CT2A 4H19A 3V3OA 1KNRA 4A35A 2GEWA 4H2RA 2B76A 1M6IA 4UP3A 1JRXA 1FOHA 2X8GA 2JAEA 2GGGA 5FJRA 5KXJA 2JBVA 3KUMA 2YVFA 1X2GA 3VA8A 1L9DA 3T2YA 1WYGA 1N1PA 4YSHA 2R0CA 3ETRB 3K7MX 3SBFA 4CNKA 1SJBA 3FVDA 3QKEA 1O95A 2XFUA 4KX6A 2PCEA 4OPUA 4EQXA 3GO2A 4H4WA 4XXGA 1EL8A 2YWLA 3NKSA 4B67A 1GTEA 5U63A 1RP0A 2PPGA 3D9XA 4HCHA 1KDGA 2XH0A 3QSSA 5JRBA 4G73A 3K30A 1JRZA 4GUVA 1RSGA 3R0UA 2PU1A 1N4UA 4UDPA 4DSHA 2HNEA 2PYXA 2WESA 3KD9A 4LA1A 4EQSA 5KMPA 1DNCA 3UOXA 2GGEA 3RGTA 2B7SA 1FHUA 1ZMDA 2XCGA 1JRPA 2EQ7A 4PAAA 2OVLA 2WOWA 3F8DA 4U2TA 1F3PA 3PFRA 1NDAA 4ZCDA 3M0OA 3WE0A 3DFHA 2QA2A 4YWSA 2QDDA 4C5OA 3EANA 1W4XA 3H8IA 1N4VA 2XDOA 3UCDA 2OALA 2OZ3A 3T2ZA 2JK6A 5ER0A 1GRGA 3SFEA 3DG3A 3P4RA 2AL1A 2V3BA 3S61A 5JCNA 6ENLA 2XFQA 1PDZA 2PU0A 5GRTA 4G8TA 3QVPA 1TDEA 2WPCA 3H4KA 4C3YA 1LTXR 3BNUA 4IVOB 3AE6A 3OC4A 5J7XA 2W54A 1F8SA 1Q1WA 2QVHA 1XHCA 1QJDA 1ZOVA 4GDPA 3K7QX 4G6GA 1KCZA 3T31A 2Q6UA 1D7LA 2WP9A 4ZCWA 4A9WA 3AEAA 4YKGA 1NU5A 2JKCA 1F6MA 3SN4A 3KU9A 2BYBA 4JN9A 3A7UA 3BI4A 4J3ZA 4U8IA 1XDIA 2W55A 3PWIA 5HY5A 4EMWA 3RRAA 4GAVA 4PABA 2W0HA 1NHPA 3RP6A 1JNZA 3AE2A 2ZZCA 1TYPA 4IP4A 2BC1A 2R0GA 2V60A 3VC5A 1IJHA 1KF6A 3HZLA 2C3CA 3RP7A 1L0VA 3CGDA 4DN1A 4CNJA 3Q4DA 1CJ2A 3NVVB 3IJQA 2H88A 4DX3A 2ONEA 2PS2A 4YSZA 1ZY8A 2YLXA 4HNLA 2PMQA 2WETA 3ZDNA 2XSXA 1H84A 3ZLFA 3CTYA 1PJ6A 2RGHA 3T0KA 5L46A 4BJZA 1KFYA 3AXBA 3SXIA 2VQ7A 4EIQA 4YTNA 4K2SA 3AYLA 3IWAA 4EWJA 4Z2RA 3BOXA 4JNAA 4WX1A 3B6DA 3CPJG 2GR2A 2FJEA 4IA5A 4BV6A 5JCMA 2WOIA 3AN1A 3Q9TA 3FJ4A 3VC6A 3ISHA 2CFYA 3NVWB 3F8PA 3DESA 2H89A 3K7TA 3OPSA 4B65A 4A99A 4H4ZA 4JHMA 4BK3A 3V3WA 3GYJA 3UTHA 4N9XA 1ZXIC 1MDLA 2RGJA 2PTYA 4P9SA 5KVHA 2OPJA 4G9KA 4B69A 4HNCA 1COYA 3NHOX 3P4QA 3REDA 1CBOA 3MKCA 3NG7X 3GY1A 4FK1A 1EL5A 1ONEA 3UTEA 2E5AA 4DNAA 2X8CA 3VFCA 1N5XA 3P4PA 4J36A 4TM0A 3V4BA 3IHMA 3P3BA 1D4CA 4H4QA 4K5SA 1MNSA 3CNJA 1DOEA 3CXOA 4GISA 3SR6B 1OJCA 4HCDA 3SGLA 1E1KA 3VQRA 3PS9A 2Q7VA 3OTRA 3I6DA 4B1BA 3U9IA 3JW7A 3V3NA 4GGBA 2OZ8A 4A7AA 1GETA 3OP2A 2VRMA 3T9PA 3AEFA 3THUA 1VRQB 4HYRA 2Q0LA 2R4EA 2BCGG 1D4EA 5J60A 3SZ0A 3AE9A 5G5HB 1D7YA 3AE5A 2C4CA 3DG7A 1KKRA 2B9YA 2GRTA 1TDFA 1N4WA 1N5WC 2PA6A 1EL9A 4OPTA 3GMBA 2XYOA 1SJDA 1Y0PA 3QSMA 2GVCA 4MJWA 4J31A 3U4FA 3UOVA 4A79A 4USQA 4E8GA 2YLRA 2PTZA 3LADA 1GRAA 4GCMA 4J2WA 5J04A 1H7XA 1W6TA 2B7RA 4GDEA 4II3A 1NENA 2AL2B 2AKMA 1P2HA 5CQFA 3FMWA 5FJOA 2PGWA 2WPEA 4USRA 4IL2A 3IJLA 4TM4A 4JY2A 5FJTA 3HYVA 3I3LA 1OJDA 3T4WA 2WPFA 3AE1A 3C96A 4WCTA 4A6NB 4E4FA 3NYCA 4E5TA 3OZ2A 5IQ1A 2XGZA 2RABA 3K1GA 4Y4MA 2QJNA 3COXA 3CGEA 3GWDA 2QA1A 4NTEA 2A87A 4AP3A 2WHDA 4DWDA 1DODA 3D1CA 2E1MA 1YQ4A 3DFYA 4U8JA 3OW1A 1PXAA 4EMIA 3CPIG 2YLWA 1DTNA 5FJPA 3TCSA 1DOCA 4A6GA 3I4KA 2XVHA 4A65A 4BK1A 3RR1A 4JY3A 1CC2A 5JCLA 2BK3A 1CJCA 4H4RA 2FYMA 1JOAA 4IP5A 3NLCA 2C64A 3GRTA 2XH4A 3HYWA 2TMDA 1TYTA 2R0PA 2PSNA 3NZGA 4Z44A 3FCPA 3GD3A 1FIQB 1K0IA 3AECA 2BRAA 2OAMA 4GFIA 3QTPA 3BSMA 3ENLA 1LJ1A 2B9XA 4FI4A 3NYEA 3V5CA 4U8PA 1FEBA 3PWGA 4H4PA 4CCRA 2GQWA 1OJ9A 2EQ6A 1RM6B 1WUFA 3DGZA 3AE3A 2QDEA 2VVMA 5BUKA 1DXLA 1DJQA 2DKHA 2GMHA 4H4SA 3TW9A 3S5WA 4REKA 3UJ2A 4H83A 2GQFA 3IC9A 2E5VA 3CK5A 2CULA 1CC4A 3HW2A 2P8CA 3TOYA 3GDNA 2GAGB 1KKOA 3JZUA 1PBEA 1FFUC 1EBDA 2WP6A 1K4QA 3SFDA 1S2QA 4MGGA 2YVJA 3SSZA 1Y56A 1S7MA 4YWOA 4II2A 2BA9A 2XLUA 4U2SA 3AD9B 3UKPA 1MOKA 1Q1RA 2R4JA 3ES7A 3OZYA 3LB8A 1MXTA 3AYIA 3EKGA 3UP4A 3ICTA 3AE7A 2AAQA 5FJUA 4HA6A 4IV9A 3UKHA 2R9ZA 3AWIA 1JDFA 2GR1A 3C4NA 4OPLA 3H8LA 4KPLA 3VCNA 1DJNA 3P1WA 2ZZ0A 2OZTA 1B4VA 3UKKA 4KPRA 1GESA 4OPIA 1ZKQA 2FKPA 2PP1A 1SEZA 4H2PA 3UJRA 1S3EA 4U8LA 2P88A 3BNMA 4CBQA 3ZVHA 5EOWA 4CCQA 1QO8A 1EBHA 4XWRA 2E4GA 5KOXA
chains in the Genus database with same CATH topology
4YT0A 4AT0A 1YY5A 4P9SA 5KVHA 1IUVA 2ACZA 2WDVA 4FK1C 4G9KA 2WQYA 3AYJA 3SZFA 1NG4A 3T2KA 4AOSA 4HB9A 3QJ4A 4B69A 3SY4A 1PBBA 1COYA 1REOA 3NN0X 1BGJA 1FECA 2BC0A 2BXRA 4H4TA 2YLZA 3NHOX 2XLRA 1LVLA 3P4QA 3REDA 1CBOA 4E0VA 2ZBWA 3NG7X 3FIMB 3CMMA 3CNSA 4FK1A 4OPGA 2WBAA 4B63A 2FJBA 1EL5A 1PDHA 3UTEA 4CY6A 3SM8A 4DNAA 1F8WA 3LXDA 2X8CA 3QVRA 3ADAB 4ZN0A 3P4PA 2Y6RA 4J36A 5KNLA 3UKAA 4YTMA 4Y4LA 4DSGA 4TM0A 4I59A 3NH3X 4H4UA 2Z5XA 2VZ2A 2XLSA 3SQPA 3M12A 1K0LA 3IHMA 2IVDA 3VR8A 1GRTA 1D4CA 4H4QA 3ALJA 4K5SA 3AEDA 1DOBA 1DOEA 2WU2A 3BI2A 3CNJA 2CDUA 4U8OA 4Z24A 1PS9A 2IIDA 4TLZA 4B64A 4CRTA 3D8XA 2C65A 3NTAA 1OJCA 3SGLA 1CJ3A 1E1KA 3VQRA 4DGKA 3PS9A 2Q7VA 2APGA 3AB1A 2C72A 3UOYA 3DK9A 2WDQA 1GTHA 4XWZA 3I6DA 4B1BA 2BRYA 4EQRA 3GD4A 1QLBA 4JNQA 5M10A 4G74A 2C70A 3V3NA 2BABA 4GR1A 1O5WA 1KSUA 2V3AA 1NPXA 3URHA 1F8RA 4Z26A 4Y4NA 3FPZA 4A7AA 1GETA 1CHUA 2OA1A 3JSKA 2VRMA 3G5SA 4U8MA 5U25A 3AEFA 1CJ4A 1JNRA 5EBKA 4NTDA 2C3DA 1VRQB 1YQZA 4M52A 2Q0LA 3QFBA 3DK8A 4J56A 5BULA 2R4EA 5FS6A 2YG5A 1B37A 1KSSA 4BURA 2X8HA 4YSYA 2BCGG 1D4EA 5J60A 2YG6A 3AEEA 3SZ0A 3AE9A 3F8RA 2XVIA 4A6NA 2EQ8A 3AE4A 4UDRA 2BS3A 3NNEA 4EMJA 3UOZA 2ZZBA 2B9WA 1IUWA 1PJ7A 2IVEA 2WEUA 5KMQA 3V76A 1PBFA 3ITJA 4J34A 5IPYA 2J3NA 1S2YA 4U8KA 1D7YA 1B5QA 3GMCA 4OPCA 1E6EA 1D4DA 3G5RA 1VG9A 4RG3A 2GR0A 4Z2TA 3NGCX 3AE5A 1ZK7A 2C4CA 2YLTA 3T37A 2B9YA 5U1OA 2VQBA 2GRTA 3KLJA 4LU6A 1TDFA 4H2NA 1GOSA 1N4WA 1PJ5A 1YQ3A 3EPTA 1H6VA 1ZDLA 3VR9A 3AEGA 3NYFA 2WP5A 1EL9A 3AD7B 4OPTA 1Q9IA 3GMBA 3P4SA 2NVKX 2YG7A 4Z25A 1LV0A 2XYOA 1E1LA 2YAUA 5CKUA 4O5UA 1X31B 1Y0PA 4ECHA 3QSMA 2YM1A 4RG4A 2GVCA 4MJWA 4J31A 1L9CA 3L5OA 3RNMA 1ZMCA 3SZCA 3T14A 3GYXA 4ICYA 1H7WA 4USQA 3UOVA 4EM3A 3ZYXA 4A79A 5EB5A 3G5QA 2YLRA 1NHSA 3LADA 1NHQA 4X4JA 1GRAA 1UKVG 5HHFA 4GCMA 4J2WA 2YR6A 5BRTA 5LV9A 1H7XA 3ALMA 4U8NA 3C4AA 2B7RA 4GDEA 3DJJA 5KWFA 4GAPA 5HXIA 4II3A 1NENA 3ICSA 4K5RA 4YXDA 3DJGX 3V3OA 2XFOA 1FCDA 2UZZA 2X50A 1NHRA 1YKJA 1KNRA 1P2HA 3II4A 1FL2A 3FBSA 1BZLA 5CQFA 2X99A 5KOXA 3GDPA 3FMWA 2YG4A 5EB4A 2WPEA 2GEWA 2Y6QA 4OPDA 4USRA 4H2RA 2A89A 4H2QA 2R45A 2V61A 2B76A 4TM3A 2O9ZA 1M6IA 4TM4A 3PG6A 2XLTA 4LIIA 4H4XA 2AQJA 2C75A 1JRXA 3IF9A 1FOHA 3NK0X 2X8GA 3HYVA 4H7UA 4JY2A 2JAEA 1IUTA 1CF3A 2GMJA 3I3LA 5KXJA 2JBVA 5KMSA 4Z43A 1OJDA 2YVFA 1NEKA 3CNPA 1BKWA 1L9DA 3T2YA 2WPFA 3Q6JA 2F5ZA 3AE8A 3AE1A 1N1PA 3C96A 4WCTA 4A6NB 4D03A 3NYCA 4YSHA 2R0CA 2JB2A 3UKFA 4C74A 3OZ2A 3K7MX 5IQ1A 4CNKA 5FS7A 1Z6LA 2BK4A 1O95A 3EF6A 4NNJA 2RABA 2XFUA 4KX6A 4ZCCA 4OPUA 5FS9A 4Y4MA 4EQXA 5GSNA 4FDCB 3DJDA 4H4WA 2PHHA 4XXGA 3KKJA 1D5TA 1EL8A 2YWLA 3NKSA 4B67A 1GTEA 1IUSA 3COXA 1VG0A 5U63A 3CGEA 3GWDA 1RP0A 2QA1A 2BS4A 3D9XA 1KDGA 4NTEA 2XFPA 3QSSA 2A87A 2YLSA 5JRBA 4AP3A 2FBWA 4G73A 3K30A 2BACA 1JRZA 4GUVA 1JU2A 1RSGA 2WHDA 3SYIA 1N4UA 1P2EA 2WDRA 3BHFA 4UDPA 4ADWA 1NAAA 4DSHA 3VRAA 1DODA 3D1CA 2PYXA 2WESA 5M0ZA 2E1MA 3KD9A 4LA1A 2EQ9A 1YQ4A 3ABVA 4EQSA 4U8JA 5KMPA 1DNCA 3UOXA 1PXAA 2B7SA 4FX9A 2C7GA 4EMIA 3CPIG 3HYXA 1MO9A 1ZMDA 3NIXA 2WS3A 4APNA 2YLWA 2XCGA 4BJYA 2EQ7A 4PAAA 2GB0A 4J57A 2WOWA 1GPEA 1OJAA 2FJDA 2I0ZA 3DJEA 3F8DA 1GALA 4U2TA 1F3PA 4EQWA 4RSLA 1NDAA 4H4YA 3BHKA 1O94A 4ZCDA 1BF3A 1DOCA 3LZXA 3M0OA 1GRFA 3KPKA 3WE0A 3ATQA 2QA2A 3CNDA 3CGBA 2XVHA 3IHGA 4A65A 2AR8A 4BK1A 4C5OA 4CY8A 4JY3A 4JDRA 3SX6A 3EANA 4C3XA 1CC2A 5JCLA 1W4XA 1TDNA 1TDKA 1CJCA 1XPQA 1PN0A 2BK3A 3H8IA 4H4RA 1GNDA 1N4VA 2XDOA 3QSEA 4TLXA 4B68A 1B8SA 1JOAA 1LQUA 2OALA 3NLCA 1RYIA 2C64A 3GRTA 3HYWA 4GRTA 2GAHB 2TMDA 4X9NA 1TYTA 2R0PA 1H83A 3T2ZA 2JK6A 5ER0A 2CVJA 1GRGA 3SFEA 3P4RA 1PXBA 5FS8A 2YQUA 2V3BA 3S61A 5JCNA 2ARDA 3UKLA 3DH9A 4Z44A 3ICRA 3GD3A 1E1NA 1K0IA 2BS2A 2GV8A 2XFQA 4D04A 3AECA 2BRAA 1TDOA 2OAMA 4G6HA 1KN0A 3DMEA 3NN6X 1E1MA 1L9EA 1LJ1A 1E7PA 2B9XA 1S3BA 3GSIA 3NYEA 5GRTA 4NZHA 3QVPA 4OCGA 4U8PA 3PO7A 1FEBA 3SZWA 1TDEA 4B66A 2WPCA 1PHHA 4UP3A 1JRYA 4H4PA 5TR3A 3H4KA 4NWZA 4C3YA 1LTXR 2YR5A 4K7ZA 3LOVA 1IUXA 4CCRA 2VOUA 5C3JA 1BGNA 3BNUA 3AE6A 4IVOB 3OC4A 5J7XA 2Z5YA 2GQWA 1F8SA 3M13A 3NT6A 1OJ9A 1Q1WA 2EQ6A 5KVIA 1PBCA 3KA7A 3DGZA 3AE3A 5BUKA 2VVMA 1DXLA 1XHCA 1DJQA 2QAEA 1QJDA 2DKHA 1JEHA 2V6OA 4JQ9A 1ZOVA 2GMHA 4H4SA 4GDPA 3S5WA 4REKA 5JCKA 1KNPA 4K22A 3K7QX 4G6GA 2GQFA 2JB1A 4C77A 3T31A 1GRBA 3IC9A 4IA6A 2E5VA 3NK2X 2VVLG 2CULA 2Q6UA 1CC4A 4J33A 1H86A 4TM1A 2HQMA 2WOVA 4GF7A 3R9UA 1D7LA 2WP9A 3GWFA 3GDNA 4X9MA 2GAGB 5C2TA 4YTPA 4K2XA 3LZWA 3ATRA 4A9WA 2QCUA 4H50A 1ZOYA 3AEAA 4O5QA 3VRDB 3QFAA 3L8KA 3CN8A 3B3RA 4YKGA 2JKCA 1F6MA 1PBEA 2XFNA 3KU9A 2BYBA 5HYMA 4JN9A 1EBDA 1GV4A 3UKQA 2WP6A 1K4QA 1ELIA 2OLNA 3BI4A 1OJTA 1IUUA 4U8IA 3SFDA 1XDIA 2BCPA 1K0JA 5HY5A 1ZX9A 2VRLA 4EMWA 2V5ZA 4GAVA 1GSNA 4PABA 5KMRA 1S2QA 2W0HA 1NHPA 1XANA 4H4VA 1CL0A 3CPHG 2YVJA 3RP6A 4IVMB 4YSXA 1JNZA 1GT8A 1Y56A 2Q0KA 3EAOA 2ZZCA 2R46A 3AEBA 3AE2A 3VRBA 4A5LA 1S7MA 1TYPA 4YWOA 2C73A 4II2A 2BC1A 3BI5A 2R0GA 2BA9A 2V60A 1IJHA 1EL7A 1KF6A 2XLUA 4U2SA 2XLPA 1NG3A 2FJAA 3RP8A 1VQWA 3AD9B 1PBDA 1VDCA 2C67A 3UKPA 3HZLA 2C3CA 3RP7A 1L0VA 3CGDA 1MOKA 1Q1RA 4CNJA 1H2IA 2R4JA 3LB8A 2RGJA 3RHAA 1MXTA 3DA1A 4UDQA 1CJ2A 3AYIA 4Z2UA 5DBJA 1GREA 1AOGA 1HYUA 2H88A 3UP4A 3ICTA 3AE7A 2AAQA 4HA6A 2DKIA 2GH5A 4IV9A 2C76A 3PVCA 4YKFA 1FEAA 4YSZA 3LJPA 1ZY8A 1H81A 2YLXA 3UKHA 2R9ZA 3AWIA 1BWCA 1E39A 2GR1A 1CC6A 2WETA 2OLOA 3C4NA 4OPLA 3ZDNA 1H84A 3H8LA 3CTYA 3UP5A 1PJ6A 2RGHA 3T0KA 5L46A 4BJZA 3L1RA 2A8XA 3UCLA 3O0HA 3FG2P 1KFYA 1ZP0A 3AXBA 3SXIA 5IQ4A 2VQ7A 2YM2A 1DJNA 3P1WA 4EIQA 2ZZ0A 4AT2A 1M64A 4YTNA 3NTDA 5BVAA 1B4VA 3UKKA 4NTCA 5JCIA 4EM4A 3E1TA 1ONFA 4KPRA 1GESA 3AYLA 3IWAA 3GRSA 2XVFA 1ZKQA 4OPIA 4Z2RA 1LPFA 1SEZA 3ALLA 3P9UA 4JNAA 4H2PA 4WX1A 3DGHA 3B6DA 2GR2A 2FJEA 3CPJG 4OVIA 3UTGA 4NEWA 3NRNA 4I58A 4BV6A 4IA5A 3CGCA 3DK4A 4NEVA 5JCMA 2BXSA 2JB3A 2NPXA 1GEUA 1S3EA 1PXCA 2GR3A 1LQTA 2X3NA 3KVEA 2WOIA 2YR4A 4U8LA 1GXFA 3Q9TA 2C66A 3CIRA 3NK1X 3ISHA 2WU5A 2CFYA 1TRBA 1GERA 3F8PA 2XVEA 2H89A 5FMHA 3AD8B 3CNTA 3K7TA 3BNMA 4CBQA 4AP1A 1GRHA 4B65A 2BK5A 3KPFA 2YG3A 4U2LA 4AOXA 1V59A 5EOWA 4A99A 2XVJA 1H82A 4EIPA 5KOWA 4H4ZA 4BK3A 3GYJA 2RGOA 2TPRA 3UTHA 4N9XA 4BK2A 2YVGA 2VVLA 4CCQA 1Y56B 1QO8A 3UTFA 5KRQA 2GF3A 4XWRA 4K8DA 2E4GA 3GYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YT0 A;  4AT0 A;  1YY5 A;  4P9S A;  5KVH A;  1IUV A;  2ACZ A;  2WDV A;  4FK1 C;  2WQY A;  3AYJ A;  1NG4 A;  4AOS A;  4HB9 A;  3QJ4 A;  4B69 A;  1PBB A;  1COY A;  1REO A;  3NN0 X;  1BGJ A;  1FEC A;  2BC0 A;  2BXR A;  4H4T A;  2YLZ A;  3NHO X;  2XLR A;  1LVL A;  3P4Q A;  3RED A;  1CBO A;  4E0V A;  2ZBW A;  3NG7 X;  3FIM B;  3CNS A;  4FK1 A;  4OPG A;  2WBA A;  4B63 A;  2FJB A;  1EL5 A;  1PDH A;  3UTE A;  4CY6 A;  3SM8 A;  4DNA A;  1F8W A;  3LXD A;  2X8C A;  3QVR A;  3ADA B;  4ZN0 A;  3P4P A;  2Y6R A;  4J36 A;  3UKA A;  4YTM A;  4Y4L A;  4DSG A;  4TM0 A;  4I59 A;  3NH3 X;  4H4U A;  2Z5X A;  2VZ2 A;  2XLS A;  3SQP A;  3M12 A;  1K0L A;  3IHM A;  2IVD A;  3VR8 A;  1GRT A;  1D4C A;  4H4Q A;  3ALJ A;  4K5S A;  3AED A;  1DOB A;  1DOE A;  2WU2 A;  3BI2 A;  3CNJ A;  2CDU A;  4U8O A;  4Z24 A;  1PS9 A;  2IID A;  4TLZ A;  4B64 A;  4CRT A;  3D8X A;  2C65 A;  3NTA A;  1OJC A;  3SGL A;  1CJ3 A;  1E1K A;  3VQR A;  4DGK A;  3PS9 A;  2Q7V A;  2APG A;  3AB1 A;  2C72 A;  3UOY A;  3DK9 A;  2WDQ A;  1GTH A;  4XWZ A;  3I6D A;  4B1B A;  4EQR A;  3GD4 A;  1QLB A;  4JNQ A;  5M10 A;  2C70 A;  3V3N A;  2BAB A;  4GR1 A;  1O5W A;  1KSU A;  3URH A;  1NPX A;  1F8R A;  2V3A A;  4Z26 A;  4Y4N A;  3FPZ A;  4A7A A;  1GET A;  1CHU A;  2OA1 A;  3JSK A;  2VRM A;  3G5S A;  4U8M A;  5U25 A;  3AEF A;  1CJ4 A;  1JNR A;  5EBK A;  4NTD A;  2C3D A;  1VRQ B;  1YQZ A;  4M52 A;  2Q0L A;  3QFB A;  3DK8 A;  4J56 A;  5BUL A;  2R4E A;  5FS6 A;  2YG5 A;  1B37 A;  1KSS A;  4BUR A;  2X8H A;  4YSY A;  2BCG G;  1D4E A;  5J60 A;  2YG6 A;  3AEE A;  3AE9 A;  3F8R A;  2XVI A;  4A6N A;  2EQ8 A;  3AE4 A;  4UDR A;  2BS3 A;  3NNE A;  4EMJ A;  3UOZ A;  2ZZB A;  2B9W A;  1IUW A;  1PJ7 A;  2IVE A;  2WEU A;  3V76 A;  1PBF A;  3ITJ A;  4J34 A;  5IPY A;  2J3N A;  1S2Y A;  4U8K A;  1D7Y A;  1B5Q A;  3GMC A;  4OPC A;  1E6E A;  1D4D A;  3G5R A;  1VG9 A;  4RG3 A;  2GR0 A;  4Z2T A;  3NGC X;  3AE5 A;  1ZK7 A;  2YLT A;  3T37 A;  2B9Y A;  5U1O A;  2VQB A;  2GRT A;  3KLJ A;  4LU6 A;  1TDF A;  4H2N A;  1GOS A;  1N4W A;  1PJ5 A;  1YQ3 A;  3EPT A;  1H6V A;  1ZDL A;  3VR9 A;  3AEG A;  3NYF A;  2WP5 A;  1EL9 A;  3AD7 B;  4OPT A;  1Q9I A;  3GMB A;  3P4S A;  2NVK X;  2YG7 A;  4Z25 A;  1LV0 A;  2XYO A;  1E1L A;  2YAU A;  5CKU A;  4O5U A;  1X31 B;  1Y0P A;  4ECH A;  3QSM A;  2YM1 A;  4RG4 A;  2GVC A;  4MJW A;  4J31 A;  1L9C A;  3RNM A;  1ZMC A;  4ICY A;  3UOV A;  1H7W A;  4USQ A;  3ZYX A;  4EM3 A;  4A79 A;  5EB5 A;  3G5Q A;  2YLR A;  1NHS A;  3LAD A;  1NHQ A;  4X4J A;  1GRA A;  1UKV G;  5HHF A;  4GCM A;  4J2W A;  2YR6 A;  5BRT A;  5LV9 A;  1H7X A;  3ALM A;  4U8N A;  3C4A A;  2B7R A;  4GDE A;  3DJJ A;  5KWF A;  5HXI A;  1NEN A;  3ICS A;  4K5R A;  4YXD A;  3DJG X;  3V3O A;  2XFO A;  1FCD A;  2UZZ A;  2X50 A;  1NHR A;  1YKJ A;  1KNR A;  1P2H A;  3II4 A;  1FL2 A;  3FBS A;  1BZL A;  5CQF A;  2X99 A;  5KOX A;  3GDP A;  3FMW A;  2YG4 A;  5EB4 A;  2WPE A;  2GEW A;  2Y6Q A;  4OPD A;  4USR A;  4H2R A;  2A89 A;  4H2Q A;  2R45 A;  2V61 A;  2B76 A;  4TM3 A;  2O9Z A;  1M6I A;  4TM4 A;  2XLT A;  4LII A;  4H4X A;  2AQJ A;  2C75 A;  1JRX A;  3IF9 A;  1FOH A;  3NK0 X;  2X8G A;  4H7U A;  4JY2 A;  4UP3 A;  2JAE A;  1IUT A;  1CF3 A;  2GMJ A;  3I3L A;  5KXJ A;  2JBV A;  4Z43 A;  1OJD A;  2YVF A;  1NEK A;  3CNP A;  1BKW A;  1L9D A;  2WPF A;  3Q6J A;  2F5Z A;  3AE8 A;  3AE1 A;  1N1P A;  3C96 A;  4WCT A;  4A6N B;  4D03 A;  3NYC A;  4YSH A;  2R0C A;  2JB2 A;  3UKF A;  4C74 A;  3OZ2 A;  3K7M X;  5IQ1 A;  4CNK A;  5FS7 A;  1Z6L A;  2BK4 A;  1O95 A;  3EF6 A;  2RAB A;  2XFU A;  4KX6 A;  4ZCC A;  4OPU A;  5FS9 A;  4Y4M A;  4EQX A;  5GSN A;  4FDC B;  3DJD A;  4H4W A;  2PHH A;  4XXG A;  3KKJ A;  1D5T A;  1EL8 A;  2YWL A;  3NKS A;  4B67 A;  1GTE A;  1IUS A;  3COX A;  1VG0 A;  5U63 A;  3CGE A;  3GWD A;  1RP0 A;  2QA1 A;  2BS4 A;  1KDG A;  4NTE A;  2XFP A;  3QSS A;  2A87 A;  2YLS A;  4AP3 A;  2FBW A;  3K30 A;  2BAC A;  1JRZ A;  4GUV A;  1JU2 A;  1RSG A;  2WHD A;  1N4U A;  1P2E A;  2WDR A;  3BHF A;  4UDP A;  4ADW A;  1NAA A;  4DSH A;  3VRA A;  1DOD A;  3D1C A;  2PYX A;  2WES A;  5M0Z A;  2E1M A;  3KD9 A;  4LA1 A;  2EQ9 A;  1YQ4 A;  3ABV A;  4EQS A;  4U8J A;  1DNC A;  3UOX A;  1PXA A;  2B7S A;  4FX9 A;  2C7G A;  4EMI A;  3CPI G;  1MO9 A;  1ZMD A;  3NIX A;  2WS3 A;  4APN A;  2YLW A;  2XCG A;  4BJY A;  2EQ7 A;  4PAA A;  2GB0 A;  4J57 A;  2WOW A;  1GPE A;  1OJA A;  2FJD A;  2I0Z A;  3DJE A;  3F8D A;  1GAL A;  4U2T A;  1F3P A;  4EQW A;  4RSL A;  1NDA A;  4H4Y A;  3BHK A;  1O94 A;  4ZCD A;  1BF3 A;  1DOC A;  3LZX A;  3M0O A;  1GRF A;  3WE0 A;  3ATQ A;  2QA2 A;  3CND A;  3CGB A;  2XVH A;  3IHG A;  4A65 A;  2AR8 A;  4BK1 A;  4C5O A;  4CY8 A;  4JY3 A;  4JDR A;  3EAN A;  4C3X A;  1CC2 A;  5JCL A;  1W4X A;  1TDN A;  1TDK A;  1CJC A;  1XPQ A;  1PN0 A;  2BK3 A;  3H8I A;  4H4R A;  1GND A;  1N4V A;  2XDO A;  3QSE A;  4TLX A;  4B68 A;  1B8S A;  1JOA A;  1LQU A;  2OAL A;  3NLC A;  1RYI A;  2C64 A;  3GRT A;  4GRT A;  2GAH B;  2TMD A;  4X9N A;  1TYT A;  2R0P A;  1H83 A;  2JK6 A;  5ER0 A;  2CVJ A;  1GRG A;  3SFE A;  3P4R A;  1PXB A;  5FS8 A;  2YQU A;  2V3B A;  3S61 A;  5JCN A;  2ARD A;  3UKL A;  3DH9 A;  4Z44 A;  3ICR A;  3GD3 A;  1E1N A;  1K0I A;  2BS2 A;  2GV8 A;  2XFQ A;  4D04 A;  3AEC A;  1TDO A;  2OAM A;  3DME A;  3NN6 X;  1E1M A;  1L9E A;  1LJ1 A;  1E7P A;  2B9X A;  1S3B A;  3GSI A;  3NYE A;  5GRT A;  4NZH A;  3QVP A;  4OCG A;  4U8P A;  3PO7 A;  1FEB A;  1TDE A;  4B66 A;  2WPC A;  1PHH A;  1JRY A;  4H4P A;  5TR3 A;  3H4K A;  4C3Y A;  1LTX R;  2YR5 A;  4K7Z A;  3LOV A;  1IUX A;  4CCR A;  2VOU A;  5C3J A;  1BGN A;  3BNU A;  3AE6 A;  4IVO B;  3OC4 A;  5J7X A;  2Z5Y A;  2GQW A;  1F8S A;  3M13 A;  3NT6 A;  1OJ9 A;  1Q1W A;  2EQ6 A;  5KVI A;  1PBC A;  3KA7 A;  3DGZ A;  3AE3 A;  5BUK A;  2VVM A;  1DXL A;  1XHC A;  1DJQ A;  2QAE A;  1QJD A;  2DKH A;  1JEH A;  2V6O A;  4JQ9 A;  1ZOV A;  2GMH A;  4H4S A;  4GDP A;  3S5W A;  4REK A;  5JCK A;  1KNP A;  4K22 A;  3K7Q X;  2GQF A;  2JB1 A;  4C77 A;  1GRB A;  3IC9 A;  4IA6 A;  2E5V A;  3NK2 X;  2VVL G;  2CUL A;  2Q6U A;  1CC4 A;  4J33 A;  1H86 A;  4TM1 A;  2HQM A;  2WOV A;  4GF7 A;  3R9U A;  1D7L A;  2WP9 A;  3GWF A;  3GDN A;  4X9M A;  2GAG B;  5C2T A;  4YTP A;  4K2X A;  3LZW A;  3ATR A;  4A9W A;  2QCU A;  4H50 A;  1ZOY A;  3AEA A;  4O5Q A;  3VRD B;  3QFA A;  3L8K A;  3CN8 A;  3B3R A;  4YKG A;  2JKC A;  1F6M A;  1PBE A;  2XFN A;  3KU9 A;  2BYB A;  5HYM A;  4JN9 A;  1EBD A;  1GV4 A;  3UKQ A;  2WP6 A;  1K4Q A;  1ELI A;  2OLN A;  3BI4 A;  1OJT A;  1IUU A;  4U8I A;  3SFD A;  1XDI A;  2BCP A;  1K0J A;  5HY5 A;  1ZX9 A;  2VRL A;  4EMW A;  2V5Z A;  1GSN A;  4PAB A;  1S2Q A;  2W0H A;  1NHP A;  1XAN A;  4H4V A;  1CL0 A;  3CPH G;  2YVJ A;  3RP6 A;  4IVM B;  4YSX A;  1JNZ A;  1GT8 A;  1Y56 A;  2Q0K A;  3EAO A;  2ZZC A;  2R46 A;  3AEB A;  3AE2 A;  3VRB A;  4A5L A;  1TYP A;  4YWO A;  2C73 A;  2BC1 A;  3BI5 A;  2R0G A;  2BA9 A;  2V60 A;  1IJH A;  1EL7 A;  1KF6 A;  2XLU A;  4U2S A;  2XLP A;  1NG3 A;  2FJA A;  3RP8 A;  1VQW A;  3AD9 B;  1PBD A;  1VDC A;  2C67 A;  3UKP A;  3HZL A;  2C3C A;  3RP7 A;  1L0V A;  3CGD A;  1MOK A;  1Q1R A;  4CNJ A;  2R4J A;  3LB8 A;  2RGJ A;  3RHA A;  1MXT A;  3DA1 A;  4UDQ A;  1CJ2 A;  3AYI A;  4Z2U A;  5DBJ A;  1GRE A;  1AOG A;  1HYU A;  2H88 A;  3UP4 A;  3ICT A;  3AE7 A;  2AAQ A;  4HA6 A;  2DKI A;  2GH5 A;  4IV9 A;  2C76 A;  3PVC A;  4YKF A;  1FEA A;  4YSZ A;  3LJP A;  1ZY8 A;  1H81 A;  2YLX A;  3UKH A;  2R9Z A;  3AWI A;  1BWC A;  1E39 A;  2GR1 A;  1CC6 A;  2WET A;  2OLO A;  3C4N A;  4OPL A;  3ZDN A;  1H84 A;  3H8L A;  3CTY A;  3UP5 A;  1PJ6 A;  2RGH A;  5L46 A;  4BJZ A;  3L1R A;  2A8X A;  3UCL A;  3O0H A;  3FG2 P;  1KFY A;  1ZP0 A;  3AXB A;  5IQ4 A;  2VQ7 A;  2YM2 A;  1DJN A;  3P1W A;  4EIQ A;  2ZZ0 A;  4AT2 A;  1M64 A;  4YTN A;  3NTD A;  5BVA A;  1B4V A;  3UKK A;  4NTC A;  5JCI A;  4EM4 A;  3E1T A;  1ONF A;  4KPR A;  1GES A;  3AYL A;  3IWA A;  3GRS A;  2XVF A;  1ZKQ A;  4OPI A;  4Z2R A;  1LPF A;  1SEZ A;  3ALL A;  3P9U A;  4JNA A;  4H2P A;  4WX1 A;  3DGH A;  3B6D A;  2GR2 A;  2FJE A;  3CPJ G;  4OVI A;  3UTG A;  4NEW A;  3NRN A;  4I58 A;  4BV6 A;  4IA5 A;  3CGC A;  3DK4 A;  4NEV A;  5JCM A;  2BXS A;  2JB3 A;  2NPX A;  1GEU A;  1S3E A;  1PXC A;  2GR3 A;  1LQT A;  2X3N A;  3KVE A;  2WOI A;  2YR4 A;  4U8L A;  1GXF A;  3Q9T A;  2C66 A;  3CIR A;  3NK1 X;  3ISH A;  2WU5 A;  2CFY A;  1TRB A;  1GER A;  3F8P A;  2XVE A;  2H89 A;  5FMH A;  3AD8 B;  3CNT A;  3K7T A;  3BNM A;  4CBQ A;  4AP1 A;  1GRH A;  4B65 A;  2BK5 A;  3KPF A;  2YG3 A;  4U2L A;  4AOX A;  1V59 A;  5EOW A;  4A99 A;  2XVJ A;  1H82 A;  4EIP A;  5KOW A;  4H4Z A;  4BK3 A;  3GYJ A;  2RGO A;  2TPR A;  3UTH A;  4N9X A;  4BK2 A;  2YVG A;  2VVL A;  4CCQ A;  1Y56 B;  1QO8 A;  3UTF A;  5KRQ A;  2GF3 A;  4XWR A;  4K8D A;  2E4G A;  3GYI A; 
#chains in the Genus database with same CATH topology
 4YT0 A;  2GGH A;  2DW7 A;  2ACZ A;  2WDV A;  4FK1 C;  3QJ4 A;  3AM9 A;  3NS1 B;  3NN0 X;  1FFV C;  2YLZ A;  2XLR A;  2ZBW A;  3CMM A;  3CNS A;  1N61 C;  4OPG A;  2FJB A;  1PDH A;  4CY6 A;  1F8W A;  3LXD A;  3JVA A;  3QVR A;  4GYP A;  3ADA B;  2ZAD A;  4ZN0 A;  4DSG A;  2W3S A;  4H4U A;  2XLS A;  3M12 A;  3VR8 A;  1GRT A;  3AED A;  1DOB A;  3BI2 A;  4U8O A;  4Z24 A;  2CDU A;  4B64 A;  3CB3 A;  3D8X A;  3NTA A;  3T8Q A;  2APG A;  4XWZ A;  2RDX A;  3GD4 A;  4JNQ A;  2C70 A;  3N6J A;  4GR1 A;  2V3A A;  3URH A;  1F8R A;  4FP1 A;  3FPZ A;  3UJF A;  1CHU A;  2OA1 A;  3JSK A;  1CJ4 A;  5EBK A;  2C3D A;  4J56 A;  3DK8 A;  5BUL A;  1KSS A;  4BUR A;  4DXK A;  4YSY A;  1SJA A;  3F8R A;  2XVI A;  2BS3 A;  3NNE A;  4EMJ A;  1IUW A;  1PJ7 A;  5KMQ A;  1PBF A;  3ITJ A;  4J34 A;  5IPY A;  3GMC A;  3RO6 A;  4OPC A;  1VG9 A;  3NGC X;  3DER A;  2OO6 A;  2YLT A;  5U1O A;  4Z17 A;  1GOS A;  3ZLH A;  3AEG A;  4E6M A;  4ROP A;  2YG7 A;  4Z25 A;  1E9I A;  4Z1Y A;  5CKU A;  4O5U A;  3R11 A;  4ECH A;  4J1O A;  2OQH A;  3SZC A;  4ICY A;  3ZYX A;  3CAW A;  1NHS A;  1NHQ A;  2PP0 A;  5LV9 A;  2W3R A;  1WUE A;  3ALM A;  4U8N A;  3C4A A;  3Q45 A;  5HXI A;  4H2H A;  4YXD A;  3R0K A;  5IDZ A;  3DG6 A;  2UZZ A;  2X50 A;  1NHR A;  1YKJ A;  3II4 A;  1FL2 A;  3FV9 A;  2X99 A;  4OPD A;  4H2Q A;  2R45 A;  4F4R A;  2V61 A;  2O9Z A;  3PG6 A;  2XLT A;  4LII A;  2C75 A;  2AQJ A;  3NK0 X;  1CF3 A;  1OEP A;  1NEK A;  3CNP A;  2QQ6 A;  3TWA A;  3SN1 A;  3UJS A;  3UKF A;  4C74 A;  2MUC A;  5FS9 A;  3RIT A;  4FDC B;  3DJD A;  3NRZ B;  2PHH A;  3KKJ A;  2XFP A;  2FBW A;  1JU2 A;  3SYI A;  3BHF A;  1NAA A;  4JN8 A;  3VRA A;  4KT2 A;  3ABV A;  3CXB A;  2C7G A;  1MO9 A;  3ZVI A;  4BJY A;  1OJA A;  4DGK A;  1GAL A;  4EQW A;  4RSL A;  4H4Y A;  3BHK A;  1O94 A;  3MUC A;  1F9C A;  3LZX A;  3CND A;  3CGB A;  3VCC A;  1VQZ A;  3SX6 A;  1XPQ A;  1TDN A;  4I58 A;  4B68 A;  1EBG A;  1RYI A;  4GRT A;  4X9N A;  1H83 A;  2CVJ A;  5FS8 A;  2YQU A;  2ARD A;  2GV8 A;  4D04 A;  1TDO A;  2GGJ A;  3DIP A;  2QJJ A;  1T3Q C;  1E1M A;  1L9E A;  1E7P A;  1S3B A;  3IK4 A;  4OCG A;  3TQP A;  3PO7 A;  3CYJ A;  2QJM A;  3N4F A;  1SJC A;  5TR3 A;  4KWS A;  2HXT A;  2YR5 A;  4K7Z A;  2VOU A;  5C3J A;  4GME A;  1BGN A;  5BOF A;  3NFU A;  3NT6 A;  1RVK A;  1P43 A;  5KVI A;  1PBC A;  3KA7 A;  3SQS A;  1JEH A;  2V6O A;  4IL0 A;  5JCK A;  1KNP A;  2JB1 A;  1GRB A;  2OLA A;  4IA6 A;  3NVY B;  4HCL A;  2VVL G;  3V5F A;  4J33 A;  4TM1 A;  2WOV A;  1EC8 A;  4GF7 A;  3R9U A;  2GGI A;  3GWF A;  5C2T A;  3DEQ A;  5BOE A;  4O5Q A;  3CN8 A;  2PGE A;  3B3R A;  3DGB A;  2XFN A;  5HYM A;  1GV4 A;  1ELI A;  4M6U A;  1V97 A;  2VRL A;  2V5Z A;  5KMR A;  2AKZ A;  3CPH G;  4YSX A;  1GT8 A;  2R46 A;  4IZG A;  3VRB A;  1X2H A;  1ELS A;  1KD0 A;  1BQG A;  1EL7 A;  2XLP A;  1NG3 A;  2FJA A;  3RP8 A;  1VQW A;  1PBD A;  1VDC A;  1STZ A;  3H70 A;  1H2I A;  3DA1 A;  4UDQ A;  1GRE A;  1HYU A;  2DKI A;  3I6T A;  1MUC A;  2C76 A;  1JRO A;  1FEA A;  3LJP A;  1E39 A;  1CC6 A;  3GC2 A;  2OLO A;  2MNR A;  4GGH A;  3UCL A;  3FG2 P;  5IQ4 A;  2YM2 A;  1M64 A;  3NTD A;  4K1W A;  5BVA A;  4NTC A;  1R6W A;  4EM4 A;  1ONF A;  2XVF A;  3ALL A;  3P9U A;  3DGH A;  4OVI A;  2NPX A;  1PXC A;  2GR3 A;  1P48 A;  2X3N A;  2C66 A;  3CIR A;  3NK1 X;  1JCT A;  2NQL A;  2XVE A;  3UJE A;  2BK5 A;  3KPF A;  2YG3 A;  4EIP A;  4AOX A;  1V59 A;  1H82 A;  2TPR A;  4BK2 A;  2YVG A;  2VVL A;  1Y56 B;  2GF3 A;  3R25 A;  4K8D A;  1IYX A;  4AT0 A;  1IUV A;  2WQY A;  3MY9 A;  3SZF A;  1NG4 A;  1YEY A;  4AOS A;  4HB9 A;  1REO A;  3FYY A;  4JN7 A;  1BGJ A;  3A7R A;  4GYP C;  4H4T A;  1LVL A;  3D46 A;  4E0V A;  4A3R A;  3AMZ A;  4B63 A;  2OFJ A;  4TVW A;  1N60 C;  2GSH A;  3MSY A;  2ZC8 A;  3NXL A;  5KNL A;  3UKA A;  4I59 A;  3NH3 X;  1ECQ A;  2IVD A;  3ALJ A;  1PS9 A;  4TLZ A;  1XS2 A;  4CRT A;  4E4U A;  2XH7 A;  3UOY A;  2WDQ A;  1GTH A;  3TTE A;  2BRY A;  4EQR A;  1QLB A;  4G74 A;  1O5W A;  4MMW A;  3UGV A;  4U8M A;  3ZVH B;  3N4E A;  1YQZ A;  1SB3 B;  1EC7 A;  3QFB A;  2P8B A;  1B37 A;  1XPY A;  2YG6 A;  3AEE A;  2EQ8 A;  4UDR A;  3UOZ A;  2PTW A;  1BKH A;  2WEU A;  1S2Y A;  5ENL A;  4Z2T A;  2GR0 A;  1ZK7 A;  3T37 A;  3N6H A;  2VQB A;  3KLJ A;  1TKK A;  1ZDL A;  3VR9 A;  3NYF A;  3P4S A;  2NVK X;  3HPF A;  1LV0 A;  1E1L A;  4RG4 A;  1JPD X;  1L9C A;  1ZMC A;  3GYX A;  4EM3 A;  3EEZ A;  3G5Q A;  3HRD C;  3P0W A;  3GD6 A;  4X4J A;  1UKV G;  2YR6 A;  5BRT A;  2OKT A;  3DJJ A;  3PK7 A;  2I5Q A;  3DJG X;  3S5S A;  2XFO A;  1FCD A;  3FBS A;  1BZL A;  2PTX A;  3GDP A;  2YG4 A;  3H12 A;  5EB4 A;  2Y6Q A;  2A89 A;  4TM3 A;  4IT1 A;  3NO1 A;  3IF9 A;  4H4X A;  2QGY A;  4H7U A;  1IUT A;  2GMJ A;  5KMS A;  4Z43 A;  2OX4 A;  3IJI A;  1FHV A;  1BKW A;  4HN8 A;  3Q6J A;  2F5Z A;  3AE8 A;  2JB2 A;  5FS7 A;  1Z6L A;  2BK4 A;  3EF6 A;  4NNJ A;  4ZCC A;  5GSN A;  3EUB 3;  1D5T A;  4D03 A;  3QN3 A;  1IUS A;  1VG0 A;  4ZOH B;  2BS4 A;  1TE6 A;  3FXG A;  2YLS A;  3S47 A;  3ZLG A;  2BAC A;  3QPE A;  4DYE A;  2WDR A;  1P2E A;  4ADW A;  5M0Z A;  2EQ9 A;  2P0I A;  4FX9 A;  3HYX A;  3NIX A;  2WS3 A;  4APN A;  3VDG A;  3A7A A;  2GB0 A;  4J57 A;  3DJE A;  1GPE A;  2FJD A;  2I0Z A;  1BF3 A;  1GRF A;  2E3T A;  3KPK A;  3ATQ A;  3IHG A;  2AR8 A;  4CY8 A;  4JDR A;  4C3X A;  1TDK A;  1PN0 A;  4TLX A;  1GND A;  3QSE A;  1B8S A;  1LQU A;  2GAH B;  1PXB A;  3UKL A;  3DH9 A;  3B9J B;  3ICR A;  1E1N A;  2BS2 A;  4G6H A;  3H7V A;  1KN0 A;  3DME A;  3NN6 X;  3GSI A;  4NZH A;  3SZW A;  4B66 A;  1PHH A;  1JRY A;  2OG9 A;  3SN0 A;  4NWZ A;  1N63 C;  3I6E A;  3LOV A;  1IUX A;  1JPM A;  3NVZ B;  2Z5Y A;  3M13 A;  1TZZ A;  1MRA A;  3R10 A;  4K8G A;  2QAE A;  4JQ9 A;  4K22 A;  1MDR A;  4C77 A;  3NK2 X;  3STP A;  1H86 A;  2HQM A;  4X9M A;  4YTP A;  4K2X A;  3LZW A;  2GDQ A;  3ATR A;  2QCU A;  4H50 A;  1ZOY A;  3VRD B;  3QFA A;  3L8K A;  3P93 A;  4M0X A;  1PDY A;  2XH2 A;  2CHR A;  3UKQ A;  2OLN A;  1OJT A;  1IUU A;  3R1Z A;  2BCP A;  1K0J A;  1ZX9 A;  1GSN A;  1CL0 A;  1XAN A;  4H4V A;  4IVM B;  2Q0K A;  3AEB A;  3EAO A;  3ES8 A;  4A5L A;  1EC9 A;  2C73 A;  3BI5 A;  1L8P A;  2C67 A;  3RHA A;  4Z2U A;  5DBJ A;  1AOG A;  2GH5 A;  4ZA0 A;  3PVC A;  4YKF A;  2POD A;  3T6C A;  1H81 A;  1NEL A;  1BWC A;  3R07 C;  2POZ A;  1VDV A;  3UXK A;  3MQT A;  3UP5 A;  3L1R A;  2A8X A;  3O0H A;  1ZP0 A;  4AT2 A;  5JCI A;  3UXL A;  3E1T A;  2HZG A;  3GRS A;  1LPF A;  3UTG A;  4NEW A;  3TJ4 A;  3NRN A;  3CGC A;  3DK4 A;  4NEV A;  2BXS A;  2JB3 A;  1GEU A;  4KEM A;  1LQT A;  3KVE A;  2YR4 A;  1GXF A;  2WU5 A;  1TRB A;  1GER A;  3RCY A;  5FMH A;  3AD8 B;  3CNT A;  2GL5 A;  4AP1 A;  1GRH A;  2PP3 A;  4U2L A;  2XVJ A;  5KOW A;  4H1Z A;  2RGO A;  3UTF A;  5EU9 A;  5KRQ A;  4IHC A;  3GYI A;  1YY5 A;  3AYJ A;  3T2K A;  3SY4 A;  1PBB A;  1FEC A;  2BC0 A;  2BXR A;  7ENL A;  3FIM B;  2WBA A;  3SM8 A;  2P3Z A;  2Y6R A;  4YTM A;  3MZN A;  2O56 A;  4Y4L A;  2Z5X A;  2VZ2 A;  3SQP A;  1K0L A;  3SJN A;  4X2P A;  2WU2 A;  3B97 A;  2IID A;  3BJS A;  2C65 A;  3TWB A;  1CJ3 A;  3AB1 A;  2C72 A;  3DK9 A;  2AL2 A;  5M10 A;  2BAB A;  1KSU A;  1NPX A;  4Z26 A;  4Y4N A;  3G5S A;  4GIR A;  5U25 A;  1JNR A;  4TVY A;  4NTD A;  2HXU A;  3TJI A;  4M52 A;  4DHG A;  5FS6 A;  2YG5 A;  2X8H A;  4A6N A;  3AE4 A;  2ZZB A;  2B9W A;  2IVE A;  3V76 A;  2J3N A;  4U8K A;  4MKS A;  1B5Q A;  1E6E A;  1D4D A;  3G5R A;  1N62 C;  4RG3 A;  1R0M A;  2OQY A;  2DW6 A;  3MWC A;  4LU6 A;  4H2N A;  3EPT A;  1PJ5 A;  1YQ3 A;  1H6V A;  4HPN A;  2WP5 A;  4ENL A;  3QLD A;  3AD7 B;  1Q9I A;  3H8A A;  2YAU A;  1X31 B;  2YM1 A;  3D47 A;  3L5O A;  3RNM A;  3T14 A;  1H7W A;  5EB5 A;  3OZM A;  5G5G B;  1FO4 A;  3DDM A;  5HHF A;  3UCC A;  4G7F A;  5KWF A;  4GAP A;  3ICS A;  4K5R A;  3CT2 A;  4H19 A;  3V3O A;  1KNR A;  4A35 A;  2GEW A;  4H2R A;  2B76 A;  1M6I A;  4UP3 A;  1JRX A;  1FOH A;  2X8G A;  2JAE A;  2GGG A;  5FJR A;  5KXJ A;  2JBV A;  3KUM A;  2YVF A;  1X2G A;  3VA8 A;  1L9D A;  3T2Y A;  1WYG A;  1N1P A;  4YSH A;  2R0C A;  3ETR B;  3K7M X;  3SBF A;  4CNK A;  1SJB A;  3FVD A;  3QKE A;  1O95 A;  2XFU A;  4KX6 A;  2PCE A;  4OPU A;  4EQX A;  3GO2 A;  4H4W A;  4XXG A;  1EL8 A;  2YWL A;  3NKS A;  4B67 A;  1GTE A;  5U63 A;  1RP0 A;  2PPG A;  3D9X A;  4HCH A;  1KDG A;  2XH0 A;  3QSS A;  5JRB A;  4G73 A;  3K30 A;  1JRZ A;  4GUV A;  1RSG A;  3R0U A;  2PU1 A;  1N4U A;  4UDP A;  4DSH A;  2HNE A;  2PYX A;  2WES A;  3KD9 A;  4LA1 A;  4EQS A;  5KMP A;  1DNC A;  3UOX A;  2GGE A;  3RGT A;  2B7S A;  1FHU A;  1ZMD A;  2XCG A;  1JRP A;  2EQ7 A;  4PAA A;  2OVL A;  2WOW A;  3F8D A;  4U2T A;  1F3P A;  3PFR A;  1NDA A;  4ZCD A;  3M0O A;  3WE0 A;  3DFH A;  2QA2 A;  4YWS A;  2QDD A;  4C5O A;  3EAN A;  1W4X A;  3H8I A;  1N4V A;  2XDO A;  3UCD A;  2OAL A;  2OZ3 A;  3T2Z A;  2JK6 A;  5ER0 A;  1GRG A;  3SFE A;  3DG3 A;  3P4R A;  2AL1 A;  2V3B A;  3S61 A;  5JCN A;  6ENL A;  2XFQ A;  1PDZ A;  2PU0 A;  5GRT A;  4G8T A;  3QVP A;  1TDE A;  2WPC A;  3H4K A;  4C3Y A;  1LTX R;  3BNU A;  4IVO B;  3AE6 A;  3OC4 A;  5J7X A;  2W54 A;  1F8S A;  1Q1W A;  2QVH A;  1XHC A;  1QJD A;  1ZOV A;  4GDP A;  3K7Q X;  4G6G A;  1KCZ A;  3T31 A;  2Q6U A;  1D7L A;  2WP9 A;  4ZCW A;  4A9W A;  3AEA A;  4YKG A;  1NU5 A;  2JKC A;  1F6M A;  3SN4 A;  3KU9 A;  2BYB A;  4JN9 A;  3A7U A;  3BI4 A;  4J3Z A;  4U8I A;  1XDI A;  2W55 A;  3PWI A;  5HY5 A;  4EMW A;  3RRA A;  4GAV A;  4PAB A;  2W0H A;  1NHP A;  3RP6 A;  1JNZ A;  3AE2 A;  2ZZC A;  1TYP A;  4IP4 A;  2BC1 A;  2R0G A;  2V60 A;  3VC5 A;  1IJH A;  1KF6 A;  3HZL A;  2C3C A;  3RP7 A;  1L0V A;  3CGD A;  4DN1 A;  4CNJ A;  3Q4D A;  1CJ2 A;  3NVV B;  3IJQ A;  2H88 A;  4DX3 A;  2ONE A;  2PS2 A;  4YSZ A;  1ZY8 A;  2YLX A;  4HNL A;  2PMQ A;  2WET A;  3ZDN A;  2XSX A;  1H84 A;  3ZLF A;  3CTY A;  1PJ6 A;  2RGH A;  3T0K A;  5L46 A;  4BJZ A;  1KFY A;  3AXB A;  3SXI A;  2VQ7 A;  4EIQ A;  4YTN A;  4K2S A;  3AYL A;  3IWA A;  4EWJ A;  4Z2R A;  3BOX A;  4JNA A;  4WX1 A;  3B6D A;  3CPJ G;  2GR2 A;  2FJE A;  4IA5 A;  4BV6 A;  5JCM A;  2WOI A;  3AN1 A;  3Q9T A;  3FJ4 A;  3VC6 A;  3ISH A;  2CFY A;  3NVW B;  3F8P A;  3DES A;  2H89 A;  3K7T A;  3OPS A;  4B65 A;  4A99 A;  4H4Z A;  4JHM A;  4BK3 A;  3V3W A;  3GYJ A;  3UTH A;  4N9X A;  1ZXI C;  1MDL A;  2RGJ A;  2PTY A;  4P9S A;  5KVH A;  2OPJ A;  4G9K A;  4B69 A;  4HNC A;  1COY A;  3NHO X;  3P4Q A;  3RED A;  1CBO A;  3MKC A;  3NG7 X;  3GY1 A;  4FK1 A;  1EL5 A;  1ONE A;  3UTE A;  2E5A A;  4DNA A;  2X8C A;  3VFC A;  1N5X A;  3P4P A;  4J36 A;  4TM0 A;  3V4B A;  3IHM A;  3P3B A;  1D4C A;  4H4Q A;  4K5S A;  1MNS A;  3CNJ A;  1DOE A;  3CXO A;  4GIS A;  3SR6 B;  1OJC A;  4HCD A;  3SGL A;  1E1K A;  3VQR A;  3PS9 A;  2Q7V A;  3OTR A;  3I6D A;  4B1B A;  3U9I A;  3JW7 A;  3V3N A;  4GGB A;  2OZ8 A;  4A7A A;  1GET A;  3OP2 A;  2VRM A;  3T9P A;  3AEF A;  3THU A;  1VRQ B;  4HYR A;  2Q0L A;  2R4E A;  2BCG G;  1D4E A;  5J60 A;  3SZ0 A;  3AE9 A;  5G5H B;  1D7Y A;  3AE5 A;  2C4C A;  3DG7 A;  1KKR A;  2B9Y A;  2GRT A;  1TDF A;  1N4W A;  1N5W C;  2PA6 A;  1EL9 A;  4OPT A;  3GMB A;  2XYO A;  1SJD A;  1Y0P A;  3QSM A;  2GVC A;  4MJW A;  4J31 A;  3U4F A;  3UOV A;  4A79 A;  4USQ A;  4E8G A;  2YLR A;  2PTZ A;  3LAD A;  1GRA A;  4GCM A;  4J2W A;  5J04 A;  1H7X A;  1W6T A;  2B7R A;  4GDE A;  4II3 A;  1NEN A;  2AL2 B;  2AKM A;  1P2H A;  5CQF A;  3FMW A;  5FJO A;  2PGW A;  2WPE A;  4USR A;  4IL2 A;  3IJL A;  4TM4 A;  4JY2 A;  5FJT A;  3HYV A;  3I3L A;  1OJD A;  3T4W A;  2WPF A;  3AE1 A;  3C96 A;  4WCT A;  4A6N B;  4E4F A;  3NYC A;  4E5T A;  3OZ2 A;  5IQ1 A;  2XGZ A;  2RAB A;  3K1G A;  4Y4M A;  2QJN A;  3COX A;  3CGE A;  3GWD A;  2QA1 A;  4NTE A;  2A87 A;  4AP3 A;  2WHD A;  4DWD A;  1DOD A;  3D1C A;  2E1M A;  1YQ4 A;  3DFY A;  4U8J A;  3OW1 A;  1PXA A;  4EMI A;  3CPI G;  2YLW A;  1DTN A;  5FJP A;  3TCS A;  1DOC A;  4A6G A;  3I4K A;  2XVH A;  4A65 A;  4BK1 A;  3RR1 A;  4JY3 A;  1CC2 A;  5JCL A;  2BK3 A;  1CJC A;  4H4R A;  2FYM A;  1JOA A;  4IP5 A;  3NLC A;  2C64 A;  3GRT A;  2XH4 A;  3HYW A;  2TMD A;  1TYT A;  2R0P A;  2PSN A;  3NZG A;  4Z44 A;  3FCP A;  3GD3 A;  1FIQ B;  1K0I A;  3AEC A;  2BRA A;  2OAM A;  4GFI A;  3QTP A;  3BSM A;  3ENL A;  1LJ1 A;  2B9X A;  4FI4 A;  3NYE A;  3V5C A;  4U8P A;  1FEB A;  3PWG A;  4H4P A;  4CCR A;  2GQW A;  1OJ9 A;  2EQ6 A;  1RM6 B;  1WUF A;  3DGZ A;  3AE3 A;  2QDE A;  2VVM A;  5BUK A;  1DXL A;  1DJQ A;  2DKH A;  2GMH A;  4H4S A;  3TW9 A;  3S5W A;  4REK A;  3UJ2 A;  4H83 A;  2GQF A;  3IC9 A;  2E5V A;  3CK5 A;  2CUL A;  1CC4 A;  3HW2 A;  2P8C A;  3TOY A;  3GDN A;  2GAG B;  1KKO A;  3JZU A;  1PBE A;  1FFU C;  1EBD A;  2WP6 A;  1K4Q A;  3SFD A;  1S2Q A;  4MGG A;  2YVJ A;  3SSZ A;  1Y56 A;  1S7M A;  4YWO A;  4II2 A;  2BA9 A;  2XLU A;  4U2S A;  3AD9 B;  3UKP A;  1MOK A;  1Q1R A;  2R4J A;  3ES7 A;  3OZY A;  3LB8 A;  1MXT A;  3AYI A;  3EKG A;  3UP4 A;  3ICT A;  3AE7 A;  2AAQ A;  5FJU A;  4HA6 A;  4IV9 A;  3UKH A;  2R9Z A;  3AWI A;  1JDF A;  2GR1 A;  3C4N A;  4OPL A;  3H8L A;  4KPL A;  3VCN A;  1DJN A;  3P1W A;  2ZZ0 A;  2OZT A;  1B4V A;  3UKK A;  4KPR A;  1GES A;  4OPI A;  1ZKQ A;  2FKP A;  2PP1 A;  1SEZ A;  4H2P A;  3UJR A;  1S3E A;  4U8L A;  2P88 A;  3BNM A;  4CBQ A;  3ZVH A;  5EOW A;  4CCQ A;  1QO8 A;  1EBH A;  4XWR A;  2E4G A;  5KOX A; 
#chains in the Genus database with same CATH homology
 4YT0 A;  4AT0 A;  1YY5 A;  4P9S A;  5KVH A;  1IUV A;  2ACZ A;  2WDV A;  4FK1 C;  4G9K A;  2WQY A;  3AYJ A;  3SZF A;  1NG4 A;  3T2K A;  4AOS A;  4HB9 A;  3QJ4 A;  4B69 A;  3SY4 A;  1PBB A;  1COY A;  1REO A;  3NN0 X;  1BGJ A;  1FEC A;  2BC0 A;  2BXR A;  4H4T A;  2YLZ A;  3NHO X;  2XLR A;  1LVL A;  3P4Q A;  3RED A;  1CBO A;  4E0V A;  2ZBW A;  3NG7 X;  3FIM B;  3CMM A;  3CNS A;  4FK1 A;  4OPG A;  2WBA A;  4B63 A;  2FJB A;  1EL5 A;  1PDH A;  3UTE A;  4CY6 A;  3SM8 A;  4DNA A;  1F8W A;  3LXD A;  2X8C A;  3QVR A;  3ADA B;  4ZN0 A;  3P4P A;  2Y6R A;  4J36 A;  5KNL A;  3UKA A;  4YTM A;  4Y4L A;  4DSG A;  4TM0 A;  4I59 A;  3NH3 X;  4H4U A;  2Z5X A;  2VZ2 A;  2XLS A;  3SQP A;  3M12 A;  1K0L A;  3IHM A;  2IVD A;  3VR8 A;  1GRT A;  1D4C A;  4H4Q A;  3ALJ A;  4K5S A;  3AED A;  1DOB A;  1DOE A;  2WU2 A;  3BI2 A;  3CNJ A;  2CDU A;  4U8O A;  4Z24 A;  1PS9 A;  2IID A;  4TLZ A;  4B64 A;  4CRT A;  3D8X A;  2C65 A;  3NTA A;  1OJC A;  3SGL A;  1CJ3 A;  1E1K A;  3VQR A;  4DGK A;  3PS9 A;  2Q7V A;  2APG A;  3AB1 A;  2C72 A;  3UOY A;  3DK9 A;  2WDQ A;  1GTH A;  4XWZ A;  3I6D A;  4B1B A;  2BRY A;  4EQR A;  3GD4 A;  1QLB A;  4JNQ A;  5M10 A;  4G74 A;  2C70 A;  3V3N A;  2BAB A;  4GR1 A;  1O5W A;  1KSU A;  2V3A A;  1NPX A;  3URH A;  1F8R A;  4Z26 A;  4Y4N A;  3FPZ A;  4A7A A;  1GET A;  1CHU A;  2OA1 A;  3JSK A;  2VRM A;  3G5S A;  4U8M A;  5U25 A;  3AEF A;  1CJ4 A;  1JNR A;  5EBK A;  4NTD A;  2C3D A;  1VRQ B;  1YQZ A;  4M52 A;  2Q0L A;  3QFB A;  3DK8 A;  4J56 A;  5BUL A;  2R4E A;  5FS6 A;  2YG5 A;  1B37 A;  1KSS A;  4BUR A;  2X8H A;  4YSY A;  2BCG G;  1D4E A;  5J60 A;  2YG6 A;  3AEE A;  3SZ0 A;  3AE9 A;  3F8R A;  2XVI A;  4A6N A;  2EQ8 A;  3AE4 A;  4UDR A;  2BS3 A;  3NNE A;  4EMJ A;  3UOZ A;  2ZZB A;  2B9W A;  1IUW A;  1PJ7 A;  2IVE A;  2WEU A;  5KMQ A;  3V76 A;  1PBF A;  3ITJ A;  4J34 A;  5IPY A;  2J3N A;  1S2Y A;  4U8K A;  1D7Y A;  1B5Q A;  3GMC A;  4OPC A;  1E6E A;  1D4D A;  3G5R A;  1VG9 A;  4RG3 A;  2GR0 A;  4Z2T A;  3NGC X;  3AE5 A;  1ZK7 A;  2C4C A;  2YLT A;  3T37 A;  2B9Y A;  5U1O A;  2VQB A;  2GRT A;  3KLJ A;  4LU6 A;  1TDF A;  4H2N A;  1GOS A;  1N4W A;  1PJ5 A;  1YQ3 A;  3EPT A;  1H6V A;  1ZDL A;  3VR9 A;  3AEG A;  3NYF A;  2WP5 A;  1EL9 A;  3AD7 B;  4OPT A;  1Q9I A;  3GMB A;  3P4S A;  2NVK X;  2YG7 A;  4Z25 A;  1LV0 A;  2XYO A;  1E1L A;  2YAU A;  5CKU A;  4O5U A;  1X31 B;  1Y0P A;  4ECH A;  3QSM A;  2YM1 A;  4RG4 A;  2GVC A;  4MJW A;  4J31 A;  1L9C A;  3L5O A;  3RNM A;  1ZMC A;  3SZC A;  3T14 A;  3GYX A;  4ICY A;  1H7W A;  4USQ A;  3UOV A;  4EM3 A;  3ZYX A;  4A79 A;  5EB5 A;  3G5Q A;  2YLR A;  1NHS A;  3LAD A;  1NHQ A;  4X4J A;  1GRA A;  1UKV G;  5HHF A;  4GCM A;  4J2W A;  2YR6 A;  5BRT A;  5LV9 A;  1H7X A;  3ALM A;  4U8N A;  3C4A A;  2B7R A;  4GDE A;  3DJJ A;  5KWF A;  4GAP A;  5HXI A;  4II3 A;  1NEN A;  3ICS A;  4K5R A;  4YXD A;  3DJG X;  3V3O A;  2XFO A;  1FCD A;  2UZZ A;  2X50 A;  1NHR A;  1YKJ A;  1KNR A;  1P2H A;  3II4 A;  1FL2 A;  3FBS A;  1BZL A;  5CQF A;  2X99 A;  5KOX A;  3GDP A;  3FMW A;  2YG4 A;  5EB4 A;  2WPE A;  2GEW A;  2Y6Q A;  4OPD A;  4USR A;  4H2R A;  2A89 A;  4H2Q A;  2R45 A;  2V61 A;  2B76 A;  4TM3 A;  2O9Z A;  1M6I A;  4TM4 A;  3PG6 A;  2XLT A;  4LII A;  4H4X A;  2AQJ A;  2C75 A;  1JRX A;  3IF9 A;  1FOH A;  3NK0 X;  2X8G A;  3HYV A;  4H7U A;  4JY2 A;  2JAE A;  1IUT A;  1CF3 A;  2GMJ A;  3I3L A;  5KXJ A;  2JBV A;  5KMS A;  4Z43 A;  1OJD A;  2YVF A;  1NEK A;  3CNP A;  1BKW A;  1L9D A;  3T2Y A;  2WPF A;  3Q6J A;  2F5Z A;  3AE8 A;  3AE1 A;  1N1P A;  3C96 A;  4WCT A;  4A6N B;  4D03 A;  3NYC A;  4YSH A;  2R0C A;  2JB2 A;  3UKF A;  4C74 A;  3OZ2 A;  3K7M X;  5IQ1 A;  4CNK A;  5FS7 A;  1Z6L A;  2BK4 A;  1O95 A;  3EF6 A;  4NNJ A;  2RAB A;  2XFU A;  4KX6 A;  4ZCC A;  4OPU A;  5FS9 A;  4Y4M A;  4EQX A;  5GSN A;  4FDC B;  3DJD A;  4H4W A;  2PHH A;  4XXG A;  3KKJ A;  1D5T A;  1EL8 A;  2YWL A;  3NKS A;  4B67 A;  1GTE A;  1IUS A;  3COX A;  1VG0 A;  5U63 A;  3CGE A;  3GWD A;  1RP0 A;  2QA1 A;  2BS4 A;  3D9X A;  1KDG A;  4NTE A;  2XFP A;  3QSS A;  2A87 A;  2YLS A;  5JRB A;  4AP3 A;  2FBW A;  4G73 A;  3K30 A;  2BAC A;  1JRZ A;  4GUV A;  1JU2 A;  1RSG A;  2WHD A;  3SYI A;  1N4U A;  1P2E A;  2WDR A;  3BHF A;  4UDP A;  4ADW A;  1NAA A;  4DSH A;  3VRA A;  1DOD A;  3D1C A;  2PYX A;  2WES A;  5M0Z A;  2E1M A;  3KD9 A;  4LA1 A;  2EQ9 A;  1YQ4 A;  3ABV A;  4EQS A;  4U8J A;  5KMP A;  1DNC A;  3UOX A;  1PXA A;  2B7S A;  4FX9 A;  2C7G A;  4EMI A;  3CPI G;  3HYX A;  1MO9 A;  1ZMD A;  3NIX A;  2WS3 A;  4APN A;  2YLW A;  2XCG A;  4BJY A;  2EQ7 A;  4PAA A;  2GB0 A;  4J57 A;  2WOW A;  1GPE A;  1OJA A;  2FJD A;  2I0Z A;  3DJE A;  3F8D A;  1GAL A;  4U2T A;  1F3P A;  4EQW A;  4RSL A;  1NDA A;  4H4Y A;  3BHK A;  1O94 A;  4ZCD A;  1BF3 A;  1DOC A;  3LZX A;  3M0O A;  1GRF A;  3KPK A;  3WE0 A;  3ATQ A;  2QA2 A;  3CND A;  3CGB A;  2XVH A;  3IHG A;  4A65 A;  2AR8 A;  4BK1 A;  4C5O A;  4CY8 A;  4JY3 A;  4JDR A;  3SX6 A;  3EAN A;  4C3X A;  1CC2 A;  5JCL A;  1W4X A;  1TDN A;  1TDK A;  1CJC A;  1XPQ A;  1PN0 A;  2BK3 A;  3H8I A;  4H4R A;  1GND A;  1N4V A;  2XDO A;  3QSE A;  4TLX A;  4B68 A;  1B8S A;  1JOA A;  1LQU A;  2OAL A;  3NLC A;  1RYI A;  2C64 A;  3GRT A;  3HYW A;  4GRT A;  2GAH B;  2TMD A;  4X9N A;  1TYT A;  2R0P A;  1H83 A;  3T2Z A;  2JK6 A;  5ER0 A;  2CVJ A;  1GRG A;  3SFE A;  3P4R A;  1PXB A;  5FS8 A;  2YQU A;  2V3B A;  3S61 A;  5JCN A;  2ARD A;  3UKL A;  3DH9 A;  4Z44 A;  3ICR A;  3GD3 A;  1E1N A;  1K0I A;  2BS2 A;  2GV8 A;  2XFQ A;  4D04 A;  3AEC A;  2BRA A;  1TDO A;  2OAM A;  4G6H A;  1KN0 A;  3DME A;  3NN6 X;  1E1M A;  1L9E A;  1LJ1 A;  1E7P A;  2B9X A;  1S3B A;  3GSI A;  3NYE A;  5GRT A;  4NZH A;  3QVP A;  4OCG A;  4U8P A;  3PO7 A;  1FEB A;  3SZW A;  1TDE A;  4B66 A;  2WPC A;  1PHH A;  4UP3 A;  1JRY A;  4H4P A;  5TR3 A;  3H4K A;  4NWZ A;  4C3Y A;  1LTX R;  2YR5 A;  4K7Z A;  3LOV A;  1IUX A;  4CCR A;  2VOU A;  5C3J A;  1BGN A;  3BNU A;  3AE6 A;  4IVO B;  3OC4 A;  5J7X A;  2Z5Y A;  2GQW A;  1F8S A;  3M13 A;  3NT6 A;  1OJ9 A;  1Q1W A;  2EQ6 A;  5KVI A;  1PBC A;  3KA7 A;  3DGZ A;  3AE3 A;  5BUK A;  2VVM A;  1DXL A;  1XHC A;  1DJQ A;  2QAE A;  1QJD A;  2DKH A;  1JEH A;  2V6O A;  4JQ9 A;  1ZOV A;  2GMH A;  4H4S A;  4GDP A;  3S5W A;  4REK A;  5JCK A;  1KNP A;  4K22 A;  3K7Q X;  4G6G A;  2GQF A;  2JB1 A;  4C77 A;  3T31 A;  1GRB A;  3IC9 A;  4IA6 A;  2E5V A;  3NK2 X;  2VVL G;  2CUL A;  2Q6U A;  1CC4 A;  4J33 A;  1H86 A;  4TM1 A;  2HQM A;  2WOV A;  4GF7 A;  3R9U A;  1D7L A;  2WP9 A;  3GWF A;  3GDN A;  4X9M A;  2GAG B;  5C2T A;  4YTP A;  4K2X A;  3LZW A;  3ATR A;  4A9W A;  2QCU A;  4H50 A;  1ZOY A;  3AEA A;  4O5Q A;  3VRD B;  3QFA A;  3L8K A;  3CN8 A;  3B3R A;  4YKG A;  2JKC A;  1F6M A;  1PBE A;  2XFN A;  3KU9 A;  2BYB A;  5HYM A;  4JN9 A;  1EBD A;  1GV4 A;  3UKQ A;  2WP6 A;  1K4Q A;  1ELI A;  2OLN A;  3BI4 A;  1OJT A;  1IUU A;  4U8I A;  3SFD A;  1XDI A;  2BCP A;  1K0J A;  5HY5 A;  1ZX9 A;  2VRL A;  4EMW A;  2V5Z A;  4GAV A;  1GSN A;  4PAB A;  5KMR A;  1S2Q A;  2W0H A;  1NHP A;  1XAN A;  4H4V A;  1CL0 A;  3CPH G;  2YVJ A;  3RP6 A;  4IVM B;  4YSX A;  1JNZ A;  1GT8 A;  1Y56 A;  2Q0K A;  3EAO A;  2ZZC A;  2R46 A;  3AEB A;  3AE2 A;  3VRB A;  4A5L A;  1S7M A;  1TYP A;  4YWO A;  2C73 A;  4II2 A;  2BC1 A;  3BI5 A;  2R0G A;  2BA9 A;  2V60 A;  1IJH A;  1EL7 A;  1KF6 A;  2XLU A;  4U2S A;  2XLP A;  1NG3 A;  2FJA A;  3RP8 A;  1VQW A;  3AD9 B;  1PBD A;  1VDC A;  2C67 A;  3UKP A;  3HZL A;  2C3C A;  3RP7 A;  1L0V A;  3CGD A;  1MOK A;  1Q1R A;  4CNJ A;  1H2I A;  2R4J A;  3LB8 A;  2RGJ A;  3RHA A;  1MXT A;  3DA1 A;  4UDQ A;  1CJ2 A;  3AYI A;  4Z2U A;  5DBJ A;  1GRE A;  1AOG A;  1HYU A;  2H88 A;  3UP4 A;  3ICT A;  3AE7 A;  2AAQ A;  4HA6 A;  2DKI A;  2GH5 A;  4IV9 A;  2C76 A;  3PVC A;  4YKF A;  1FEA A;  4YSZ A;  3LJP A;  1ZY8 A;  1H81 A;  2YLX A;  3UKH A;  2R9Z A;  3AWI A;  1BWC A;  1E39 A;  2GR1 A;  1CC6 A;  2WET A;  2OLO A;  3C4N A;  4OPL A;  3ZDN A;  1H84 A;  3H8L A;  3CTY A;  3UP5 A;  1PJ6 A;  2RGH A;  3T0K A;  5L46 A;  4BJZ A;  3L1R A;  2A8X A;  3UCL A;  3O0H A;  3FG2 P;  1KFY A;  1ZP0 A;  3AXB A;  3SXI A;  5IQ4 A;  2VQ7 A;  2YM2 A;  1DJN A;  3P1W A;  4EIQ A;  2ZZ0 A;  4AT2 A;  1M64 A;  4YTN A;  3NTD A;  5BVA A;  1B4V A;  3UKK A;  4NTC A;  5JCI A;  4EM4 A;  3E1T A;  1ONF A;  4KPR A;  1GES A;  3AYL A;  3IWA A;  3GRS A;  2XVF A;  1ZKQ A;  4OPI A;  4Z2R A;  1LPF A;  1SEZ A;  3ALL A;  3P9U A;  4JNA A;  4H2P A;  4WX1 A;  3DGH A;  3B6D A;  2GR2 A;  2FJE A;  3CPJ G;  4OVI A;  3UTG A;  4NEW A;  3NRN A;  4I58 A;  4BV6 A;  4IA5 A;  3CGC A;  3DK4 A;  4NEV A;  5JCM A;  2BXS A;  2JB3 A;  2NPX A;  1GEU A;  1S3E A;  1PXC A;  2GR3 A;  1LQT A;  2X3N A;  3KVE A;  2WOI A;  2YR4 A;  4U8L A;  1GXF A;  3Q9T A;  2C66 A;  3CIR A;  3NK1 X;  3ISH A;  2WU5 A;  2CFY A;  1TRB A;  1GER A;  3F8P A;  2XVE A;  2H89 A;  5FMH A;  3AD8 B;  3CNT A;  3K7T A;  3BNM A;  4CBQ A;  4AP1 A;  1GRH A;  4B65 A;  2BK5 A;  3KPF A;  2YG3 A;  4U2L A;  4AOX A;  1V59 A;  5EOW A;  4A99 A;  2XVJ A;  1H82 A;  4EIP A;  5KOW A;  4H4Z A;  4BK3 A;  3GYJ A;  2RGO A;  2TPR A;  3UTH A;  4N9X A;  4BK2 A;  2YVG A;  2VVL A;  4CCQ A;  1Y56 B;  1QO8 A;  3UTF A;  5KRQ A;  2GF3 A;  4XWR A;  4K8D A;  2E4G A;  3GYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...