2NVKX

Crystal structure of thioredoxin reductase from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
481
structure length
481
Chain Sequence
b'YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioredoxin Reductase
publication title Structural and Biochemical Studies Reveal Differences in the Catalytic Mechanisms of Mammalian and Drosophila melanogaster Thioredoxin Reductases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 154
structure length 481
sequence length 481
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
X PF00890 FAD_binding_2 FAD binding domain
X PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2nvkX03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX02
2GRTA 4DSGA 5KXJA 1CHUA 3AE1A 1OJ9A 1GRGA 3M13A 5U1OA 4A5LA 1D4EA 4D03A 2XFQA 4OPLA 4DGKA 4AP3A 1TDFA 2WU5A 3G5SA 1CF3A 3BHFA 1TDNA 2YLXA 2JB1A 2QA2A 3LZXA 2GAHB 4JDRA 4U2LA 4LIIA 3GYIA 3UOYA 1DOCA 3ZDNA 2VVLA 3CNSA 1BKWA 4PAAA 1JRYA 4B65A 3CGEA 3SM8A 1GRHA 1LJ1A 3ICSA 5IPYA 2BK4A 4H4ZA 3AEAA 5LV9A 1QJDA 5ER0A 2YVFA 1NPXA 5C2TA 4EMWA 4BJYA 2YWLA 1ZMDA 3CGCA 3VQRA 2JB3A 1NHRA 3UKQA 5BUKA 4REKA 1JRXA 4BJZA 4LU6A 2BACA 3II4A 5JCNA 1Y56B 2FJAA 3LJPA 1DODA 4NTEA 3ITJA 1GRAA 3NYCA 4BURA 1ZOYA 1XDIA 1LVLA 2YLSA 1PDHA 4YKGA 2C65A 2WBAA 4BK2A 4A6NA 2GR0A 2ZZCA 2E4GA 1YY5A 3LADA 5EBKA 3DMEA 4OPUA 2C64A 2Y6QA 2WDVA 1PBFA 1PJ5A 4A7AA 3URHA 1H6VA 3DGZA 1Y0PA 2O9ZA 2XLUA 5C3JA 4A9WA 3DJEA 4OPTA 1D5TA 4DSHA 1IUTA 1ZOVA 1CJ3A 3KPFA 4YKFA 5JCKA 2X3NA 1D7LA 1PN0A 2YG6A 3P4PA 4H4TA 4AP1A 4BK3A 1RP0A 2GR2A 3FBSA 2OLOA 3DH9A 4CBQA 4IA6A 3AEGA 1O94A 4LA1A 3CPIG 1JNZA 1DXLA 4H50A 3O0HA 1O5WA 3M0OA 1LPFA 1JEHA 5KVIA 2BYBA 3REDA 2HQMA 3GWFA 2BC0A 2OLNA 4GDEA 4YSYA 4EMIA 2ACZA 3P4SA 1D4DA 1YQZA 3IC9A 1S3BA 2R45A 1UKVG 4YWOA 3G5QA 3NHOX 2C7GA 4YSHA 1S3EA 4EM3A 1DJQA 3AEDA 4GDPA 3AYLA 1JOAA 2YLTA 3CNPA 2YQUA 4TM4A 1N1PA 1M6IA 4RSLA 4U8OA 1KSSA 2XYOA 1B4VA 3BNUA 1MOKA 4J33A 4Y4MA 1RYIA 2WOVA 1PBBA 4UP3A 4XWRA 2Z5XA 1KNPA 2Z5YA 1NHPA 1VDCA 2GMHA 2YM1A 3UKKA 3ICTA 4J57A 1H7XA 1P2HA 3IHGA 1VG9A 3GYJA 5FS7A 3PVCA 3H8IA 3COXA 1OJAA 3AWIA 1GTEA 1PBCA 3EANA 3I6DA 5IQ1A 2C66A 3FG2P 1KFYA 3ADAB 3DK9A 3NN6X 3UKAA 1EBDA 1PXAA 1YQ3A 1K0IA 2B9WA 3AEEA 4C77A 1GRTA 3EAOA 1GESA 3IWAA 4X9NA 2WDRA 1F3PA 4TM3A 3UCLA 3GD3A 4A79A 1PXCA 4AT0A 5IQ4A 2V61A 2Q0LA 4NTDA 4H4WA 4A6NB 4EQRA 2GMJA 4CNKA 3G5RA 2CFYA 3AECA 4IVMB 2RGOA 3T37A 3D1CA 3K30A 1E1KA 3NRNA 3NYEA 1XPQA 2NVKX 1LV0A 2V6OA 2VRLA 1VQWA 2YG4A 3GD4A 3DGHA 2C70A 3AD9B 3AE5A 3L1RA 4MJWA 4H4PA 3UKFA 3F8RA 2B9XA 5HY5A 4USRA 2X50A 4YTMA 1TDEA 3S61A 4U2SA 4C5OA 1CC2A 4O5QA 4X9MA 1ELIA 1IUWA 3H4KA 4CY6A 2WOWA 1B37A 1L9CA 3DJDA 3AE3A 1S2YA 5GSNA 3RHAA 4EIQA 1PBEA 3B6DA 1IUXA 4U8IA 1E39A 3BI2A 1EL9A 5BRTA 3NYFA 2JBVA 3UTGA 2WQYA 3LB8A 2Q6UA 1KDGA 5KRQA 2GR3A 2OAMA 3FIMB 1FCDA 3K7TA 3GMBA 3QSMA 1F8WA 5BVAA 1H7WA 3AE9A 4H4SA 1QO8A 2JB2A 4K7ZA 3DJJA 1FECA 1GETA 2EQ9A 2X99A 3V3OA 2X8CA 2YAUA 2F5ZA 2XFUA 4FK1C 3QFAA 3ZYXA 4AT2A 4YTNA 2GEWA 3NIXA 4Z25A 3Q6JA 1E1MA 1VG0A 2WHDA 5HXIA 3NK1X 3AE8A 4UDQA 4OPIA 5EOWA 4B69A 2A89A 2R0PA 4GRTA 2QCUA 4Z2UA 2WPEA 4WX1A 1CJ2A 4WCTA 2VVMA 3V3NA 3ALJA 2JK6A 4B67A 1TDOA 4H2NA 3OC4A 4BV6A 2XFOA 1S2QA 3BHKA 3UOXA 3CPJG 3ATQA 3P4RA 4RG4A 4USQA 3HZLA 5JCIA 2OA1A 3H8LA 3NT6A 4JY3A 1L9DA 3RP6A 3V76A 2Q7VA 5HYMA 3PS9A 5BULA 4FDCB 1JU2A 2BXSA 2VQ7A 1BGJA 2V3BA 2WP9A 2YR5A 4E0VA 2GB0A 2GV8A 1DOBA 4OCGA 3AEFA 5JCLA 1REOA 4UDRA 3RNMA 3NLCA 1IUVA 2EQ7A 4APNA 5TR3A 2IIDA 3UOZA 3UKHA 2DKHA 3C4NA 1GNDA 1FL2A 4YSZA 3AD8B 2NPXA 1NG4A 1ZX9A 3FMWA 2B9YA 1B5QA 2GQFA 4D04A 5M10A 1PS9A 4N9XA 2X8HA 3CGDA 2VRMA 4NEWA 2BK5A 4P9SA 3AE2A 3UP5A 3ISHA 3SFEA 4OVIA 4A65A 3NG7X 1H86A 2R4JA 2XVFA 2UZZA 1MO9A 1FEAA 2YR4A 1ZP0A 3RP8A 4YT0A 5GRTA 1SEZA 1CBOA 1D7YA 1XHCA 2H88A 2BC1A 2C3DA 1DJNA 2WP6A 4U8PA 1IJHA 4H4YA 1CC4A 1E1LA 2BXRA 1GT8A 1Q9IA 3C96A 1CJCA 4B63A 3QSSA 4KX6A 5FS6A 1F8RA 1LTXR 3ABVA 2XLRA 3BNMA 1GXFA 3NGCX 1NEKA 1Z6LA 2IVDA 1HYUA 1FOHA 1H81A 2RABA 4GR1A 2GVCA 1W4XA 3SGLA 3CN8A 3BI5A 4PABA 4K8DA 2YLRA 4AOXA 1NENA 2E1MA 1TDKA 2RGHA 1MXTA 3FPZA 4FX9A 2Q0KA 5L46A 2FJDA 1N4UA 2XLPA 1BWCA 2WOIA 1N4WA 2BA9A 2YM2A 4J36A 2V3AA 2R0GA 4K2XA 1E7PA 1GTHA 1H84A 3ALMA 4JNAA 3AE7A 4K22A 4TLXA 1FEBA 2EQ8A 2C76A 2GAGB 1TYPA 2CULA 2XVJA 3Q9TA 3VR8A 4U8NA 5HHFA 1GOSA 1H83A 4H4QA 2XVIA 3CTYA 4HA6A 3L8KA 1Y56A 3CGBA 2XLTA 5EB5A 1X31B 3EPTA 4Z24A 2ZBWA 3AE4A 3NH3X 2YG7A 4JNQA 1OJDA 3LOVA 3D8XA 2YLWA 3OZ2A 3AB1A 4H4UA 4I59A 2WPFA 1NAAA 2C72A 4NTCA 4A99A 4J31A 3NK2X 2XDOA 1JNRA 4CNJA 4I58A 1ZK7A 1F8SA 1GEUA 2Y6RA 4X4JA 1ZMCA 2CDUA 1K0LA 4O5UA 4Z44A 1AOGA 2BCGG 5FS8A 2EQ6A 2C73A 4JQ9A 1GV4A 1F6MA 2B7RA 3ICRA 2TMDA 4H2RA 3NKSA 1DNCA 4ZCDA 5DBJA 3ALLA 5KWFA 1CC6A 1LQTA 3CNDA 3IHMA 2ZZBA 1PXBA 1CL0A 2DKIA 1E1NA 4H2QA 2QA1A 4EQWA 5CQFA 2WEUA 1GSNA 2XVHA 4B1BA 4J34A 3DJGX 3UKPA 3UTHA 3C4AA 2RGJA 4H4RA 3JSKA 4K5RA 1E6EA 4NZHA 5J60A 2C75A 1IUSA 2A87A 4H7UA 1H82A 2PYXA 3EF6A 4EQSA 1NHQA 4U8JA 2R46A 1PJ6A 4H2PA 3UKLA 3KA7A 4YTPA 1TYTA 4AOSA 1RSGA 3P1WA 2R0CA 3K7QX 2R4EA 3CNJA 2B76A 3LZWA 4BK1A 3UP4A 2X8GA 3ATRA 1TRBA 3CNTA 3NNEA 3UOVA 1M64A 4Y4LA 4EQXA 4IVOB 1NDAA 3GDNA 4U2TA 4U8KA 4XWZA 2IVEA 2VOUA 4DNAA 3GWDA 3I3LA 5CKUA 4Z43A 2YVGA 2XVEA 1NG3A 4KPRA 3NK0X 3QVRA 1OJTA 1Q1WA 1PBDA 2OALA 2APGA 2WETA 5M0ZA 4C3XA 2I0ZA 1O95A 1GRBA 3RP7A 2BCPA 5J7XA 1NHSA 1BF3A 1KSUA 4TLZA 4CCRA 4EIPA 3VRBA 2H89A 1EL8A 2WESA 4C3YA 3GSIA 3QSEA 1ONFA 1K0JA 3UTEA 3KU9A 3DA1A 1PJ7A 2W0HA 3F8DA 2ZZ0A 2A8XA 2YR6A 3AYJA 4B68A 2YVJA 4FK1A 1ZY8A 3QVPA 4Z2TA 3NTDA 2BS4A 2CVJA 1B8SA 3GDPA 4ZCCA 5KOWA 1N4VA 1PHHA 3AYIA 4NEVA 2TPRA 4EMJA 2E5VA 3DK8A 5JCMA 5U25A 1COYA 4RG3A 1BZLA 4J56A 3SFDA 3K7MX 3VRDB 1ZKQA 3AE6A 4JY2A 3DK4A 2BS2A 4Z26A 1XANA 3QFBA 4XXGA 1BGNA 4YSXA 1V59A 2B7SA 1GREA 3B3RA 4J2WA 3BI4A 5EB4A 2AAQA 2R9ZA 3AXBA 3NN0X 3WE0A 3GRTA 1CJ4A 2GH5A 3VR9A 2YG5A 4ADWA 3PO7A 1EL7A 1YKJA 1YQ4A 4B66A 3CIRA 3F8PA 2GQWA 5U63A 4TM1A 2FJBA 2JAEA 4YXDA 2GF3A 3SQPA 4U8MA 2ARDA 1Q1RA 3KKJA 4B64A 3E1TA 3GMCA 2V60A 4HB9A 3AD7B 4M52A 2V5ZA 3LXDA 3KD9A 4IV9A 3S5WA 4CCQA 4C74A 3KVEA 4H4XA 1D4CA 1OJCA 4GF7A 5FMHA 3NTAA 3VRAA 1VRQB 1K4QA 5KVHA 1L0VA 2QAEA 2WS3A 2YG3A 4Y4NA 2BS3A 1LQUA 4OPCA 2GR1A 2AQJA 3R9UA 1GPEA 2PHHA 3GRSA 4UDPA 3UTFA 4Z2RA 4TM0A 4H4VA 2BK3A 3M12A 5FS9A 1QLBA 1P2EA 4ZN0A 1GERA 2FBWA 2WPCA 3CPHG 2XFPA 4CY8A 3P4QA 4OPDA 4GCMA 2FJEA 4OPGA 4U8LA 1L9EA 1IUUA 4K5SA 2WU2A 2AR8A 3KLJA 4JN9A 4ECHA 1JRZA 2C67A 4ICYA 4CRTA 1ZDLA 2XLSA 2WP5A 1DOEA 2C3CA 2VZ2A 1GALA 3QJ4A 2BABA 2XCGA 4EM4A 1KF6A 2WDQA 1EL5A 1GRFA 2J3NA 1KNRA 4GUVA 2XFNA 4IA5A 3AEBA 2YLZA 2VVLG 3IF9A 3P9UA 5KOXA 2JKCA 2VQBA
chains in the Genus database with same CATH superfamily
4E6MA 3N6HA 4OPLA 4DGKA 2P88A 2YLXA 5G5HB 2QA2A 2GAHB 4JDRA 3UOYA 1DOCA 3ZDNA 3SM8A 1LJ1A 3D9XA 1QJDA 2YVFA 1NPXA 4EMWA 2JB3A 1KKOA 3H70A 4IHCA 2FJAA 3UCCA 3ITJA 1ZOYA 3IJQA 1XDIA 4YKGA 4BK2A 1YY5A 2PU0A 5EBKA 3DMEA 1W6TA 4OPUA 2OZ3A 3ZVHB 2XH7A 3VFCA 3VDGA 1PJ5A 3FJ4A 4E4UA 3SBFA 2PGWA 3P4PA 2GR2A 4J3ZA 3AEGA 3SXIA 3ETRB 4LA1A 3CPIG 4H50A 3O0HA 1O5WA 1JEHA 5KVIA 2OLNA 1D4DA 1S3BA 1DJQA 1JOAA 2OPJA 1N1PA 3OZMA 1KSSA 3BNUA 4J33A 4NWZA 1KD0A 3IJLA 4JHMA 1NHPA 1VDCA 3ICTA 3PVCA 3GYJA 5FS7A 3JVAA 4Z1YA 3EANA 3I6DA 3T14A 3AEEA 1GESA 3UCLA 4AT0A 4A79A 2W3SA 2FKPA 3GD6A 2HZGA 3K30A 4A6GA 3NYEA 2YG4A 3UKFA 3AD9B 4USRA 3VC6A 3PG6A 4C5OA 4U2SA 4X9MA 4CY6A 3H4KA 3UJEA 5GSNA 1N5XA 1PBEA 1IUXA 1E39A 3BI2A 5BRTA 2C4CA 3UTGA 3LB8A 3MUCA 2QDDA 3K7TA 3GMBA 5BVAA 1H7WA 1QO8A 4K7ZA 5FJRA 2X99A 3QPEA 4YTNA 2GEWA 1E1MA 2WHDA 5HXIA 3TJ4A 2R0PA 2XH0A 1CJ2A 2VVMA 3IJIA 3ALJA 4B67A 1TDOA 4H2NA 1R6WA 3OC4A 3CPJG 4GGBA 3ATQA 4RG4A 4USQA 1X2HA 2OA1A 3V76A 1L9DA 1JU2A 4OCGA 3L5OA 4IP4A 5TR3A 1GNDA 1FL2A 4YSZA 3I6TA 1SB3B 2NPXA 3FVDA 1B5QA 4D04A 5M10A 5IDZA 1OEPA 3AE2A 3ISHA 3ES8A 1H86A 2XVFA 3RP8A 4KWSA 5GRTA 1SEZA 1CBOA 3SX6A 1DJNA 4H4YA 1BQGA 4KX6A 3BNMA 1E9IA 1GXFA 3NGCX 1NEKA 4JN8A 2GVCA 4M0XA 2Q0KA 2WOIA 3OTRA 4J36A 2ONEA 2OX4A 1TYPA 2CULA 3VR8A 3BOXA 1GOSA 1H83A 3HPFA 2XVIA 3CTYA 1Y56A 3EPTA 3R10A 3HYWA 3N6JA 4DWDA 3D46A 1ZK7A 2Y6RA 2CDUA 3PWGA 2EQ6A 3ENLA 2XSXA 4GGHA 2B7RA 4H2RA 1DNCA 4GFIA 3EKGA 1CC6A 3R11A 3IHMA 2DKIA 3D47A 1GSNA 2XVHA 4B1BA 1FFUC 4IP5A 1IYXA 4H4RA 1E6EA 5J60A 2PYXA 2GGIA 2PSNA 3BSMA 3KA7A 3K1GA 3TQPA 3UJFA 3P1WA 3PWIA 2R4EA 3V4BA 3LZWA 4BK1A 1TRBA 2OZTA 1M64A 4EQXA 1NDAA 3GDNA 4U8KA 3I3LA 1MDLA 1NG3A 4IT1A 2WETA 3CXBA 4C3XA 1N60C 1GRBA 3UJSA 1KSUA 1H2IA 2WESA 4C3YA 3GSIA 3QSEA 2GL5A 2ZZ0A 2A8XA 3UJRA 4FK1A 3SYIA 3I6EA 4MGGA 2QJNA 4RG3A 1BZLA 1VDVA 3SFDA 3SZ0A 3QFBA 1R0MA 2B7SA 2AAQA 2R9ZA 3NN0X 3GRTA 1CJ4A 3VR9A 3PO7A 4B66A 4KEMA 2GQWA 5U63A 4TM1A 3RRAA 2OLAA 3EUB3 1Q1RA 3KKJA 3GMCA 3AD7B 4IV9A 4CCQA 3GO2A 3SR6B 4C74A 4H4XA 1OJCA 3NTAA 1L0VA 5JRBA 2GR1A 2AQJA 3ES7A 3R9UA 3GRSA 3FV9A 1P2EA 2FBWA 2XFPA 3P4QA 1IUUA 4K5SA 3PK7A 2AR8A 1JRZA 2P8CA 1KF6A 1KNRA 1GRFA 4GUVA 2XFNA 4IA5A 3AEBA 1GRGA 4GISA 5U1OA 1D4EA 2XFQA 1TDFA 1CF3A 3BHFA 4U2LA 2XGZA 4LIIA 4HPNA 3N4EA 1BKWA 4PAAA 1JRYA 3ICSA 5IPYA 2BK4A 1EC7A 1NHRA 5BUKA 4REKA 4G6GA 2BACA 5JCNA 1Y56B 2AL1A 3T8QA 3NYCA 4BURA 1LVLA 2YLSA 1PDHA 2AKZA 2GR0A 1PDZA 2ZZCA 3SN1A 3H7VA 2Y6QA 2WDVA 5G5GB 1Y0PA 4A9WA 1CJ3A 4GAPA 1D7LA 2QGYA 1PN0A 2AKMA 4IA6A 3T4WA 1JNZA 2BYBA 1JPMA 2BC0A 1NELA 1YQZA 1MUCA 3IC9A 3THUA 1UKVG 2R45A 2GSHA 3G5QA 3NHOX 4YSHA 3AEDA 2YQUA 4Y4MA 4XWRA 3S5SA 2Z5YA 3UKKA 1F9CA 3IHGA 1VG9A 3COXA 3B9JB 3R1ZA 5IQ1A 1KFYA 1K0IA 3A7RA 3B97A 3IWAA 4X9NA 2WDRA 2V61A 2Q0LA 4NTDA 4CNKA 3G5RA 2CFYA 4IVMB 3SY4A 5BOEA 1E1KA 3V3WA 1VQWA 2C70A 4H4PA 3VCCA 3T31A 2X50A 1WUEA 3QTPA 4O5QA 3VCNA 2PCEA 1KKRA 4U8IA 3RGTA 1EL9A 3NYFA 5KRQA 3CYJA 2OAMA 3FIMB 1FCDA 1STZA 1FECA 2EQ9A 3V3OA 1FHVA 2X8CA 2F5ZA 2XFUA 3ZYXA 2PP0A 1MRAA 3NIXA 3AE8A 3S47A 4OPIA 4GRTA 2WPEA 4WCTA 3V3NA 4NNJA 2XFOA 4BV6A 3UOXA 3BHKA 3P4RA 3RP6A 3PS9A 2BXSA 1ECQA 2V3BA 3T2ZA 3UXLA 2GB0A 3AEFA 4F4RA 5JCLA 5FJTA 4UDRA 3UKHA 3C4NA 3FMWA 4II3A 4IL0A 4NEWA 3UP5A 4OVIA 1DTNA 1T3QC 3NG7X 4A65A 5FJOA 1MO9A 3V5CA 2P3ZA 1CC4A 1E1LA 1TKKA 1GT8A 3C96A 3NRZB 3ABVA 3RO6A 1Z6LA 2IVDA 1FOHA 1BKHA 3SGLA 4PABA 1NENA 2E1MA 1MXTA 5L46A 3JW7A 5J04A 4K2XA 1E7PA 4TLXA 4FI4A 3AE7A 2GAGB 3DG7A 3Q9TA 5KMPA 4U8NA 4H4QA 3L8KA 3CGBA 2ZBWA 3NH3X 3UCDA 3LOVA 3D8XA 3OZ2A 3AB1A 4H4UA 4I59A 2C72A 4J31A 2PA6A 1F8SA 4X4JA 3AMZA 1K0LA 5FS8A 4HCDA 3ICRA 1JRPA 2TMDA 2OVLA 3T2KA 3NKSA 5KNLA 5DBJA 1LQTA 3CNDA 1PXBA 1CL0A 1E1NA 5CQFA 2QA1A 4EQWA 2WEUA 3V5FA 3DJGX 3UTHA 2FYMA 4NZHA 3ZLFA 4H7UA 1H82A 1VQZA 2RDXA 4EQSA 4U8JA 2GGEA 4H2PA 3UKLA 4YTPA 5KMSA 2R0CA 3K7QX 4Y4LA 4IVOB 4HNLA 1XPYA 5CKUA 4Z43A 3QVRA 2OALA 5M0ZA 1JPDX 2I0ZA 4KT2A 2PTWA 4Z17A 1RVKA 4TLZA 4CCRA 2CHRA 3KU9A 1EBGA 1N63C 4IL2A 3DERA 1ZY8A 3DDMA 3SZFA 1N4VA 3U9IA 1MDRA 5JCMA 1ZKQA 3AE6A 1XANA 4YSXA 4GMEA 5EB4A 3BI4A 2GH5A 3NVVB 4A35A 2YG5A 4ADWA 1EL7A 1YQ4A 3PFRA 1PDYA 4G74A 4YXDA 4U8MA 4ZCWA 4HB9A 2V5ZA 2PODA 3LXDA 3FCPA 4E4FA 3CB3A 1ONEA 3M12A 4ZN0A 3CPHG 3DG3A 4GCMA 1L9EA 2WU2A 3KLJA 4ECHA 4CRTA 4X2PA 2WP5A 2P0IA 2BABA 4G8TA 2YLZA 3P9UA 3AE5A 2GRTA 2W3RA 5KXJA 1CHUA 3AE1A 1OJ9A 2OQYA 2QQ6A 1TDNA 3SJNA 3GYIA 3CK5A 3OW1A 3CNSA 4B65A 1GRHA 5LV9A 4BJYA 3DFHA 1ZMDA 2BRYA 3VQRA 5KMRA 3RCYA 1JRXA 4BJZA 3II4A 2PS2A 4NTEA 2C65A 2WBAA 3HW2A 1ELSA 2C64A 3FXGA 1H6VA 2PP3A 2XLUA 5C3JA 4OPTA 1D5TA 4DSHA 4YKFA 1ZOVA 2X3NA 3NZGA 4AP1A 4BK3A 2OLOA 4GIRA 2HQMA 3GWFA 4GDEA 4EMIA 2ACZA 3P4SA 3T9PA 2C7GA 4EM3A 3OPSA 4GDPA 3CNPA 4RSLA 2QJMA 2XYOA 4U8OA 1B4VA 1MOKA 4YWSA 1RYIA 3AN1A 2WOVA 3TJIA 4UP3A 2Z5XA 3GYXA 1KNPA 3TWAA 2GMHA 4J57A 3R25A 3H8IA 4G9KA 3DGBA 4FP1A 3ADAB 3FG2P 3DK9A 4II2A 1EBDA 1YQ3A 2B9WA 4GYPC 1GRTA 3EAOA 3GD3A 5IQ4A 2HNEA 2GGGA 4A6NB 2GMJA 3Q45A 3AECA 3T6CA 2RGOA 3EEZA 4H19A 3NRNA 2VRLA 2NVKX 2V6OA 3L1RA 3GD4A 3DGHA 5HY5A 3S61A 1CC2A 2OZ8A 1IUWA 2WOWA 1B37A 1L9CA 3DJDA 1S2YA 1WUFA 2WQYA 2Q6UA 1WYGA 3QN3A 2GR3A 3HRDC 2OO6A 1F8WA 4H4SA 2JB2A 3DJJA 1GETA 2YAUA 3QFAA 1VG0A 4K8GA 4UDQA 4Z2UA 2QCUA 2E3TA 1S2QA 3ZVIA 3HZLA 3NT6A 2Q7VA 3NO1A 4FDCB 4E0VA 3U4FA 2GV8A 1N62C 1DOBA 3NXLA 1P43A 2EQ7A 4APNA 1NG4A 2GQFA 1PS9A 2X8HA 3CGDA 3MQTA 2BK5A 2QDEA 4TVWA 3GC2A 2R4JA 1KN0A 2UZZA 3RITA 4YT0A 1D7YA 4EWJA 2WP6A 1IJHA 3STPA 2BXRA 1Q9IA 4ZOHB 2QVHA 1CJCA 3QLDA 4HYRA 2ZADA 1F8RA 1LTXR 1H81A 2RABA 3CN8A 3BI5A 4K8DA 3VA8A 3FPZA 4FX9A 3Q4DA 2FJDA 1N4UA 2XLPA 1BWCA 2BA9A 1N4WA 2YM2A 2V3AA 2R0GA 4JNAA 1GTHA 4K22A 2OKTA 1FEBA 2EQ8A 2XVJA 4HA6A 1KCZA 3UGVA 3NVWB 1X31B 2YG7A 4JNQA 2PTXA 2YLWA 3R0UA 3SSZA 2WPFA 1NAAA 3CXOA 2XDOA 1GEUA 1ZMCA 4Z44A 1AOGA 2C73A 1GV4A 4DYEA 1FIQB 2PU1A 3UKPA 2RGJA 3SQSA 4K5RA 1XS2A 2C75A 1IUSA 1NHQA 1JROA 2PTYA 1PJ6A 1SJDA 1RSGA 3DFYA 3CNJA 3UP4A 2X8GA 3UOVA 4U2TA 4XWZA 3ZLGA 2IVEA 2VOUA 3GWDA 2YVGA 2XVEA 3MKCA 4KPRA 1OJTA 1Q1WA 1PBDA 3UJ2A 3QKEA 1O95A 2BCPA 3NFUA 1TZZA 4EIPA 2O56A 1MNSA 1EL8A 2OQHA 1K0JA 3DA1A 1L8PA 2YR6A 3OZYA 3QVPA 3NTDA 2BS4A 3GDPA 1B8SA 5KOWA 1PHHA 3AYIA 4NEVA 4EMJA 3TWBA 3DK8A 2OFJA 5U25A 1EC8A 1COYA 4K1WA 3T2YA 3K7MX 6ENLA 4Z26A 3DK4A 3NS1B 4XXGA 4G73A 1BGNA 1V59A 1GREA 3AXBA 2POZA 4ENLA 3CIRA 3F8PA 2AL2A 2FJBA 2JAEA 1JCTA 4B64A 4J1OA 2V60A 2GDQA 4M52A 3KD9A 1D4CA 3MY9A 5FMHA 4GF7A 1VRQB 3DESA 1K4QA 3MZNA 5KVHA 2QAEA 4H2HA 4Y4NA 2BS3A 3KUMA 2PHHA 4Z2RA 4TM0A 4H4VA 3A7AA 1GERA 4CY8A 3BJSA 4ICYA 3P0WA 2XLSA 3DEQA 1DOEA 3QJ4A 4EM4A 1EL5A 2J3NA 3IF9A 2VQBA 4DSGA 1P48A 3M13A 4A5LA 1EC9A 4D03A 4AP3A 3N4FA 2WU5A 3G5SA 2PP1A 3TW9A 2JB1A 3LZXA 3H12A 5ENLA 1FO4A 3IK4A 2VVLA 3CGEA 1SJAA 4H4ZA 3AEAA 5ER0A 3SN0A 5C2TA 3TOYA 2YWLA 3CGCA 3UKQA 4LU6A 3LJPA 1DODA 1GRAA 4ROPA 3I4KA 4A6NA 2E4GA 1NU5A 3LADA 1PBFA 4A7AA 3URHA 1N5WC 3DGZA 2O9ZA 3DJEA 4E8GA 1IUTA 3KPFA 5JCKA 3R0KA 2YG6A 4H4TA 1RP0A 3FBSA 3DH9A 4CBQA 1O94A 1DXLA 1JDFA 3P3BA 2I5QA 2NQLA 3M0OA 1LPFA 3REDA 4YSYA 4YWOA 3JZUA 3CT2A 1S3EA 3AYLA 2YLTA 4TM4A 1M6IA 5KMQA 7ENLA 1PBBA 3NVYB 2YM1A 1H7XA 1X2GA 1P2HA 1OJAA 3AWIA 1GTEA 1PBCA 3VC5A 2GGHA 2C66A 3UKAA 4DN1A 3NN6X 4KPLA 4G7FA 1PXAA 4C77A 1F3PA 4TM3A 1PXCA 3DG6A 4H4WA 4EQRA 2W55A 4HCHA 2PGEA 3T37A 3D1CA 4H83A 1LV0A 1XPQA 4MJWA 4HCLA 3CAWA 3F8RA 2B9XA 4GAVA 4YTMA 1TDEA 1ELIA 2DW7A 3AE3A 3TCSA 3RHAA 4EIQA 3B6DA 2JBVA 1KDGA 3QSMA 3AE9A 4G6HA 4FK1C 2AL2B 4AT2A 4Z25A 3HYXA 3Q6JA 4K2SA 3NK1X 5EOWA 4B69A 3AM9A 2A89A 2XH4A 1FHUA 5FJUA 4WX1A 4HNCA 2JK6A 2ZC8A 4JY3A 5JCIA 3H8LA 5HYMA 5BULA 2VQ7A 1BGJA 2WP9A 2YR5A 3HYVA 1S7MA 1ZXIC 1REOA 3OP2A 3RNMA 3NLCA 1IUVA 2IIDA 3UOZA 2DKHA 3AD8B 4M6UA 1ZX9A 3P93A 2B9YA 4N9XA 2VRMA 4P9SA 3SFEA 2PMQA 4ZA0A 2QJJA 4DX3A 2YR4A 1FEAA 1ZP0A 4DHGA 2W54A 3R07C 1XHCA 2H88A 2BC1A 2C3DA 4U8PA 4B63A 3QSSA 5FS6A 2XLRA 5BOFA 1SJCA 2HXTA 3A7UA 1HYUA 4GR1A 1W4XA 1YEYA 3SZWA 2YLRA 2PPGA 4AOXA 1TDKA 2RGHA 3ALMA 1H84A 4A3RA 2C76A 5HHFA 3TTEA 5EB5A 2XLTA 4Z24A 3NVZB 3AE4A 1OJDA 2P8BA 3KPKA 4NTCA 4A99A 3NK2X 1JNRA 4CNJA 4I58A 3ZVHA 4O5UA 2BCGG 4JQ9A 1F6MA 4ZCDA 3ALLA 5KWFA 2MNRA 2ZZBA 4H2QA 3MSYA 4J34A 3C4AA 3JSKA 2GGJA 2A87A 3CMMA 3EF6A 4GYPA 2R46A 1TE6A 1TYTA 4AOSA 2B76A 3ATRA 3CNTA 3NNEA 3UXKA 4DNAA 2MUCA 3FYYA 1EBHA 3SN4A 1FFVC 3NK0X 4TVYA 2APGA 4MMWA 4H1ZA 3RP7A 5J7XA 1NHSA 1BF3A 3VRBA 2H89A 4DXKA 1ONFA 3UTEA 1PJ7A 2W0HA 3F8DA 3AYJA 3DIPA 4B68A 2YVJA 4Z2TA 2CVJA 4ZCCA 2TPRA 3SZCA 2BRAA 2E5VA 3T0KA 4J56A 3VRDB 4JY2A 5FJPA 2BS2A 3RR1A 1N61C 2E5AA 3B3RA 4J2WA 3WE0A 3GY1A 4HN8A 1YKJA 2OG9A 3MWCA 4MKSA 1SJBA 2HXUA 2GF3A 3SQPA 2ARDA 3E1TA 3S5WA 3KVEA 2XH2A 3VRAA 2PTZA 4IZGA 2WS3A 2YG3A 4OPCA 1LQUA 1RM6B 1GPEA 4UDPA 3UTFA 2DW6A 2BK3A 5FS9A 1QLBA 3ZLHA 2WPCA 4OPDA 2FJEA 4OPGA 4U8LA 5EU9A 4JN9A 2C67A 1ZDLA 2C3CA 2VZ2A 1GALA 4E5TA 2XCGA 2WDQA 3H8AA 1V97A 2VVLG 4JN7A 5KOXA 2JKCA
chains in the Genus database with same CATH topology
2GRTA 4DSGA 5KXJA 1CHUA 3AE1A 1OJ9A 1GRGA 3M13A 5U1OA 4A5LA 1D4EA 4D03A 2XFQA 4OPLA 4DGKA 4AP3A 1TDFA 2WU5A 3G5SA 1CF3A 3BHFA 1TDNA 2YLXA 2JB1A 2QA2A 3LZXA 2GAHB 4JDRA 4U2LA 4LIIA 3GYIA 3UOYA 1DOCA 3ZDNA 2VVLA 3CNSA 1BKWA 4PAAA 1JRYA 4B65A 3CGEA 3SM8A 1GRHA 1LJ1A 3ICSA 5IPYA 2BK4A 4H4ZA 3AEAA 3D9XA 1QJDA 5LV9A 5ER0A 2YVFA 1NPXA 5C2TA 4EMWA 4BJYA 2YWLA 1ZMDA 3CGCA 2BRYA 3VQRA 2JB3A 1NHRA 3UKQA 5KMRA 5BUKA 4REKA 1JRXA 4G6GA 4BJZA 4LU6A 2BACA 3II4A 5JCNA 1Y56B 2FJAA 3LJPA 1DODA 4NTEA 3ITJA 1GRAA 3NYCA 4BURA 1ZOYA 1XDIA 1LVLA 2YLSA 1PDHA 4YKGA 2C65A 2WBAA 4BK2A 4A6NA 2GR0A 2ZZCA 2E4GA 1YY5A 3LADA 5EBKA 3DMEA 4OPUA 2C64A 2Y6QA 2WDVA 1PBFA 1PJ5A 4A7AA 3URHA 1H6VA 3DGZA 1Y0PA 2O9ZA 2XLUA 5C3JA 4A9WA 3DJEA 4OPTA 1D5TA 4DSHA 1IUTA 1ZOVA 1CJ3A 3KPFA 4YKFA 5JCKA 4GAPA 2X3NA 1D7LA 1PN0A 2YG6A 3P4PA 4H4TA 4AP1A 4BK3A 1RP0A 2GR2A 3FBSA 2OLOA 3DH9A 4CBQA 4IA6A 3AEGA 3SXIA 1O94A 4LA1A 3CPIG 1JNZA 1DXLA 4H50A 3O0HA 1O5WA 3M0OA 1LPFA 1JEHA 5KVIA 2BYBA 3REDA 2HQMA 3GWFA 2BC0A 2OLNA 4GDEA 4YSYA 4EMIA 2ACZA 3P4SA 1D4DA 1YQZA 3IC9A 1S3BA 2R45A 1UKVG 4YWOA 3G5QA 3NHOX 2C7GA 4YSHA 1S3EA 4EM3A 1DJQA 3AEDA 4GDPA 3AYLA 1JOAA 2YLTA 3CNPA 2YQUA 4TM4A 1N1PA 1M6IA 4RSLA 4U8OA 1KSSA 2XYOA 5KMQA 1B4VA 3BNUA 1MOKA 4J33A 4Y4MA 1RYIA 4NWZA 2WOVA 1PBBA 4UP3A 4XWRA 2Z5XA 3GYXA 1KNPA 2Z5YA 1NHPA 1VDCA 2GMHA 2YM1A 3UKKA 3ICTA 4J57A 1H7XA 1P2HA 3IHGA 1VG9A 3GYJA 5FS7A 3PVCA 3H8IA 3COXA 1OJAA 4G9KA 3AWIA 1GTEA 1PBCA 3EANA 3I6DA 5IQ1A 2C66A 3FG2P 1KFYA 3ADAB 3DK9A 3NN6X 4II2A 1EBDA 3T14A 1PXAA 1YQ3A 1K0IA 2B9WA 3AEEA 4C77A 1GRTA 3EAOA 1GESA 3IWAA 4X9NA 2WDRA 1F3PA 4TM3A 3UCLA 3GD3A 4A79A 1PXCA 4AT0A 5IQ4A 2V61A 2Q0LA 4NTDA 4H4WA 4A6NB 4EQRA 2GMJA 4CNKA 3G5RA 2CFYA 3AECA 4IVMB 3SY4A 2RGOA 3T37A 3D1CA 3K30A 1E1KA 3NRNA 3NYEA 1XPQA 2NVKX 1LV0A 2V6OA 2VRLA 1VQWA 2YG4A 3GD4A 3DGHA 2C70A 3AD9B 3AE5A 3L1RA 4MJWA 4H4PA 3UKFA 3F8RA 2B9XA 5HY5A 3T31A 4GAVA 2X50A 4USRA 4YTMA 3PG6A 1TDEA 4U2SA 3S61A 4C5OA 1CC2A 4O5QA 4X9MA 1ELIA 1IUWA 3H4KA 4CY6A 2WOWA 1B37A 1L9CA 3DJDA 3AE3A 1S2YA 5GSNA 3RHAA 4EIQA 1PBEA 3B6DA 1IUXA 4U8IA 1E39A 3BI2A 1EL9A 5BRTA 2C4CA 2JBVA 3NYFA 3UTGA 2WQYA 3LB8A 2Q6UA 1KDGA 5KRQA 2GR3A 2OAMA 3FIMB 1FCDA 3K7TA 3GMBA 3QSMA 1F8WA 5BVAA 1H7WA 3AE9A 4H4SA 1QO8A 2JB2A 4K7ZA 3DJJA 1FECA 1GETA 2EQ9A 2X99A 3V3OA 2X8CA 2YAUA 4G6HA 2F5ZA 2XFUA 4FK1C 3QFAA 3ZYXA 4AT2A 4YTNA 2GEWA 3NIXA 4Z25A 3HYXA 3Q6JA 1E1MA 1VG0A 2WHDA 5HXIA 3NK1X 3AE8A 4UDQA 4OPIA 5EOWA 4B69A 2A89A 2R0PA 4GRTA 2QCUA 4Z2UA 2WPEA 4WX1A 1CJ2A 4WCTA 2VVMA 3V3NA 4NNJA 3ALJA 2JK6A 4B67A 1TDOA 4H2NA 3OC4A 4BV6A 2XFOA 1S2QA 3BHKA 3UOXA 3CPJG 3ATQA 3P4RA 4RG4A 4USQA 3HZLA 5JCIA 2OA1A 3H8LA 3NT6A 4JY3A 1L9DA 3RP6A 3V76A 2Q7VA 5HYMA 3PS9A 5BULA 4FDCB 1JU2A 2BXSA 2VQ7A 1BGJA 2V3BA 2WP9A 2YR5A 3HYVA 4E0VA 3T2ZA 1S7MA 2GB0A 2GV8A 1DOBA 4OCGA 3AEFA 5JCLA 1REOA 4UDRA 3RNMA 3L5OA 3NLCA 1IUVA 2EQ7A 4APNA 5TR3A 2IIDA 3UOZA 3UKHA 2DKHA 3C4NA 1GNDA 1FL2A 4YSZA 3AD8B 2NPXA 1NG4A 1ZX9A 3FMWA 2B9YA 4II3A 3UKAA 1B5QA 2GQFA 4D04A 5M10A 1PS9A 4N9XA 2X8HA 3CGDA 2VRMA 4NEWA 2BK5A 4P9SA 3AE2A 3UP5A 3ISHA 3SFEA 4OVIA 4A65A 3NG7X 1H86A 2R4JA 1KN0A 2UZZA 1MO9A 1FEAA 2XVFA 1ZP0A 2YR4A 3RP8A 4YT0A 5GRTA 1SEZA 1CBOA 1D7YA 1XHCA 2H88A 2BC1A 2C3DA 3SX6A 1DJNA 2WP6A 4U8PA 1IJHA 4H4YA 1CC4A 1E1LA 2BXRA 1GT8A 1Q9IA 3C96A 1CJCA 4B63A 3QSSA 4KX6A 5FS6A 1F8RA 1LTXR 3ABVA 2XLRA 3BNMA 1GXFA 3NGCX 1NEKA 1Z6LA 2IVDA 1HYUA 1FOHA 1H81A 2RABA 4GR1A 2GVCA 1W4XA 3SGLA 3CN8A 3BI5A 4PABA 3SZWA 4K8DA 2YLRA 4AOXA 1NENA 2E1MA 1TDKA 2RGHA 1MXTA 3FPZA 4FX9A 2Q0KA 5L46A 2FJDA 1N4UA 2XLPA 1BWCA 2WOIA 1N4WA 2BA9A 2YM2A 4J36A 2V3AA 2R0GA 4K2XA 1E7PA 1GTHA 1H84A 3ALMA 4JNAA 3AE7A 4K22A 4TLXA 1FEBA 2EQ8A 2C76A 2GAGB 1TYPA 2CULA 2XVJA 3Q9TA 3VR8A 5KMPA 4U8NA 5HHFA 1GOSA 1H83A 4H4QA 2XVIA 3CTYA 4HA6A 3L8KA 1Y56A 3CGBA 2XLTA 5EB5A 1X31B 3EPTA 4Z24A 2ZBWA 3AE4A 3NH3X 2YG7A 4JNQA 1OJDA 3LOVA 3D8XA 2YLWA 3OZ2A 3AB1A 3HYWA 4H4UA 4I59A 3KPKA 2WPFA 1NAAA 2C72A 4NTCA 4A99A 4J31A 3NK2X 2XDOA 1JNRA 4CNJA 4I58A 1ZK7A 1F8SA 1GEUA 2Y6RA 4X4JA 1ZMCA 2CDUA 1K0LA 4O5UA 4Z44A 1AOGA 2BCGG 5FS8A 2EQ6A 2C73A 4JQ9A 1GV4A 1F6MA 2B7RA 3ICRA 2TMDA 4H2RA 3T2KA 3NKSA 1DNCA 5KNLA 4ZCDA 5DBJA 3ALLA 5KWFA 1CC6A 1LQTA 3CNDA 3IHMA 2ZZBA 1PXBA 1CL0A 2DKIA 1E1NA 4H2QA 2QA1A 4EQWA 5CQFA 2WEUA 1GSNA 2XVHA 4B1BA 4J34A 3DJGX 3UKPA 3UTHA 3C4AA 2RGJA 4H4RA 3JSKA 4K5RA 1E6EA 4NZHA 5J60A 2C75A 1IUSA 2A87A 3CMMA 1H82A 2PYXA 4H7UA 3EF6A 4EQSA 1NHQA 4U8JA 2R46A 1PJ6A 4H2PA 3UKLA 3KA7A 4YTPA 1TYTA 4AOSA 1RSGA 5KMSA 3P1WA 2R0CA 3K7QX 2R4EA 3CNJA 2B76A 3LZWA 4BK1A 3UP4A 2X8GA 3ATRA 1TRBA 3CNTA 3NNEA 3UOVA 1M64A 4Y4LA 4EQXA 4IVOB 1NDAA 3GDNA 4U2TA 4U8KA 4XWZA 2IVEA 2VOUA 4DNAA 3GWDA 3I3LA 5CKUA 4Z43A 2YVGA 2XVEA 1NG3A 4KPRA 3NK0X 3QVRA 1OJTA 1Q1WA 1PBDA 2OALA 2APGA 2WETA 5M0ZA 4C3XA 2I0ZA 1O95A 1GRBA 3RP7A 2BCPA 5J7XA 1NHSA 1BF3A 1KSUA 4TLZA 4CCRA 4EIPA 3VRBA 1H2IA 2H89A 1EL8A 2WESA 4C3YA 3GSIA 3QSEA 1ONFA 1K0JA 3UTEA 3KU9A 3DA1A 1PJ7A 2W0HA 3F8DA 2ZZ0A 2A8XA 2YR6A 3AYJA 4B68A 2YVJA 4FK1A 1ZY8A 3SYIA 3QVPA 4Z2TA 3NTDA 3SZFA 2BS4A 2CVJA 1B8SA 3GDPA 4ZCCA 5KOWA 1N4VA 1PHHA 3AYIA 4NEVA 2TPRA 3SZCA 4EMJA 2BRAA 2E5VA 3DK8A 5JCMA 3T0KA 5U25A 1COYA 4RG3A 1BZLA 4J56A 3SFDA 3T2YA 3K7MX 3VRDB 1ZKQA 3AE6A 4JY2A 3DK4A 2BS2A 3SZ0A 4Z26A 1XANA 3QFBA 4XXGA 4G73A 1BGNA 4YSXA 1V59A 2B7SA 1GREA 3B3RA 4J2WA 3BI4A 5EB4A 2AAQA 2R9ZA 3AXBA 3NN0X 3WE0A 3GRTA 1CJ4A 2GH5A 3VR9A 2YG5A 4ADWA 3PO7A 1EL7A 1YKJA 1YQ4A 4B66A 3CIRA 3F8PA 2GQWA 5U63A 4TM1A 2FJBA 2JAEA 4G74A 4YXDA 2GF3A 3SQPA 4U8MA 2ARDA 1Q1RA 3KKJA 4B64A 3E1TA 3GMCA 2V60A 4HB9A 3AD7B 4M52A 2V5ZA 3LXDA 3KD9A 4IV9A 3S5WA 4CCQA 4C74A 3KVEA 4H4XA 1D4CA 1OJCA 4GF7A 5FMHA 3NTAA 3VRAA 1VRQB 1K4QA 5KVHA 1L0VA 2QAEA 2WS3A 2YG3A 4Y4NA 5JRBA 2BS3A 1LQUA 4OPCA 2GR1A 2AQJA 3R9UA 1GPEA 2PHHA 3GRSA 4UDPA 3UTFA 4Z2RA 4TM0A 4H4VA 2BK3A 3M12A 5FS9A 1QLBA 1P2EA 4ZN0A 1GERA 2FBWA 2WPCA 3CPHG 2XFPA 4CY8A 3P4QA 4OPDA 4GCMA 2FJEA 4OPGA 4U8LA 1L9EA 1IUUA 4K5SA 2WU2A 2AR8A 3KLJA 4JN9A 4ECHA 1JRZA 2C67A 4ICYA 4CRTA 1ZDLA 2XLSA 2WP5A 1DOEA 2C3CA 2VZ2A 1GALA 3QJ4A 2BABA 2XCGA 4EM4A 1KF6A 2WDQA 1EL5A 1GRFA 2J3NA 1KNRA 4GUVA 2XFNA 4IA5A 3AEBA 2YLZA 2VVLG 3IF9A 3P9UA 5KOXA 2JKCA 2VQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRT A;  4DSG A;  5KXJ A;  1CHU A;  3AE1 A;  1OJ9 A;  1GRG A;  3M13 A;  5U1O A;  4A5L A;  1D4E A;  4D03 A;  2XFQ A;  4OPL A;  4DGK A;  4AP3 A;  1TDF A;  2WU5 A;  3G5S A;  1CF3 A;  3BHF A;  1TDN A;  2YLX A;  2JB1 A;  2QA2 A;  3LZX A;  2GAH B;  4JDR A;  4U2L A;  4LII A;  3GYI A;  3UOY A;  1DOC A;  3ZDN A;  2VVL A;  3CNS A;  1BKW A;  4PAA A;  1JRY A;  4B65 A;  3CGE A;  3SM8 A;  1GRH A;  1LJ1 A;  3ICS A;  5IPY A;  2BK4 A;  4H4Z A;  3AEA A;  5LV9 A;  1QJD A;  5ER0 A;  2YVF A;  1NPX A;  5C2T A;  4EMW A;  4BJY A;  2YWL A;  1ZMD A;  3CGC A;  3VQR A;  2JB3 A;  1NHR A;  3UKQ A;  5BUK A;  4REK A;  1JRX A;  4BJZ A;  4LU6 A;  2BAC A;  3II4 A;  5JCN A;  1Y56 B;  2FJA A;  3LJP A;  1DOD A;  4NTE A;  3ITJ A;  1GRA A;  3NYC A;  4BUR A;  1ZOY A;  1XDI A;  1LVL A;  2YLS A;  1PDH A;  4YKG A;  2C65 A;  2WBA A;  4BK2 A;  4A6N A;  2GR0 A;  2ZZC A;  2E4G A;  1YY5 A;  3LAD A;  5EBK A;  3DME A;  4OPU A;  2C64 A;  2Y6Q A;  2WDV A;  1PBF A;  1PJ5 A;  4A7A A;  3URH A;  1H6V A;  3DGZ A;  1Y0P A;  2O9Z A;  2XLU A;  5C3J A;  4A9W A;  3DJE A;  4OPT A;  1D5T A;  4DSH A;  1IUT A;  1ZOV A;  1CJ3 A;  3KPF A;  4YKF A;  5JCK A;  2X3N A;  1D7L A;  1PN0 A;  2YG6 A;  3P4P A;  4H4T A;  4AP1 A;  4BK3 A;  1RP0 A;  2GR2 A;  3FBS A;  2OLO A;  3DH9 A;  4CBQ A;  4IA6 A;  3AEG A;  1O94 A;  4LA1 A;  3CPI G;  1JNZ A;  1DXL A;  4H50 A;  3O0H A;  1O5W A;  3M0O A;  1LPF A;  1JEH A;  5KVI A;  2BYB A;  3RED A;  2HQM A;  3GWF A;  2BC0 A;  2OLN A;  4GDE A;  4YSY A;  4EMI A;  2ACZ A;  3P4S A;  1D4D A;  1YQZ A;  3IC9 A;  1S3B A;  2R45 A;  1UKV G;  4YWO A;  3G5Q A;  3NHO X;  2C7G A;  4YSH A;  1S3E A;  4EM3 A;  1DJQ A;  3AED A;  4GDP A;  3AYL A;  1JOA A;  2YLT A;  3CNP A;  2YQU A;  4TM4 A;  1N1P A;  1M6I A;  4RSL A;  4U8O A;  1KSS A;  2XYO A;  1B4V A;  3BNU A;  1MOK A;  4J33 A;  4Y4M A;  1RYI A;  2WOV A;  1PBB A;  4UP3 A;  4XWR A;  2Z5X A;  1KNP A;  2Z5Y A;  1NHP A;  1VDC A;  2GMH A;  2YM1 A;  3UKK A;  3ICT A;  4J57 A;  1H7X A;  1P2H A;  3IHG A;  1VG9 A;  3GYJ A;  5FS7 A;  3PVC A;  3H8I A;  3COX A;  1OJA A;  3AWI A;  1GTE A;  1PBC A;  3EAN A;  3I6D A;  5IQ1 A;  2C66 A;  3FG2 P;  1KFY A;  3ADA B;  3DK9 A;  3NN6 X;  3UKA A;  1EBD A;  1PXA A;  1YQ3 A;  1K0I A;  2B9W A;  3AEE A;  4C77 A;  1GRT A;  3EAO A;  1GES A;  3IWA A;  4X9N A;  2WDR A;  1F3P A;  4TM3 A;  3UCL A;  3GD3 A;  4A79 A;  1PXC A;  4AT0 A;  5IQ4 A;  2V61 A;  2Q0L A;  4NTD A;  4H4W A;  4A6N B;  4EQR A;  2GMJ A;  4CNK A;  3G5R A;  2CFY A;  3AEC A;  4IVM B;  2RGO A;  3T37 A;  3D1C A;  3K30 A;  1E1K A;  3NRN A;  3NYE A;  1XPQ A;  2NVK X;  1LV0 A;  2V6O A;  2VRL A;  1VQW A;  2YG4 A;  3GD4 A;  3DGH A;  2C70 A;  3AD9 B;  3AE5 A;  3L1R A;  4MJW A;  4H4P A;  3UKF A;  3F8R A;  2B9X A;  5HY5 A;  4USR A;  2X50 A;  4YTM A;  1TDE A;  3S61 A;  4U2S A;  4C5O A;  1CC2 A;  4O5Q A;  4X9M A;  1ELI A;  1IUW A;  3H4K A;  4CY6 A;  2WOW A;  1B37 A;  1L9C A;  3DJD A;  3AE3 A;  1S2Y A;  5GSN A;  3RHA A;  4EIQ A;  1PBE A;  3B6D A;  1IUX A;  4U8I A;  1E39 A;  3BI2 A;  1EL9 A;  5BRT A;  3NYF A;  2JBV A;  3UTG A;  2WQY A;  3LB8 A;  2Q6U A;  1KDG A;  5KRQ A;  2GR3 A;  2OAM A;  3FIM B;  1FCD A;  3K7T A;  3GMB A;  3QSM A;  1F8W A;  5BVA A;  1H7W A;  3AE9 A;  4H4S A;  1QO8 A;  2JB2 A;  4K7Z A;  3DJJ A;  1FEC A;  1GET A;  2EQ9 A;  2X99 A;  3V3O A;  2X8C A;  2YAU A;  2F5Z A;  2XFU A;  4FK1 C;  3QFA A;  3ZYX A;  4AT2 A;  4YTN A;  2GEW A;  3NIX A;  4Z25 A;  3Q6J A;  1E1M A;  1VG0 A;  2WHD A;  5HXI A;  3NK1 X;  3AE8 A;  4UDQ A;  4OPI A;  5EOW A;  4B69 A;  2A89 A;  2R0P A;  4GRT A;  2QCU A;  4Z2U A;  2WPE A;  4WX1 A;  1CJ2 A;  4WCT A;  2VVM A;  3V3N A;  3ALJ A;  2JK6 A;  4B67 A;  1TDO A;  4H2N A;  3OC4 A;  4BV6 A;  2XFO A;  1S2Q A;  3BHK A;  3UOX A;  3CPJ G;  3ATQ A;  3P4R A;  4RG4 A;  4USQ A;  3HZL A;  5JCI A;  2OA1 A;  3H8L A;  3NT6 A;  4JY3 A;  1L9D A;  3RP6 A;  3V76 A;  2Q7V A;  5HYM A;  3PS9 A;  5BUL A;  4FDC B;  1JU2 A;  2BXS A;  2VQ7 A;  1BGJ A;  2V3B A;  2WP9 A;  2YR5 A;  4E0V A;  2GB0 A;  2GV8 A;  1DOB A;  4OCG A;  3AEF A;  5JCL A;  1REO A;  4UDR A;  3RNM A;  3NLC A;  1IUV A;  2EQ7 A;  4APN A;  5TR3 A;  2IID A;  3UOZ A;  3UKH A;  2DKH A;  3C4N A;  1GND A;  1FL2 A;  4YSZ A;  3AD8 B;  2NPX A;  1NG4 A;  1ZX9 A;  3FMW A;  2B9Y A;  1B5Q A;  2GQF A;  4D04 A;  5M10 A;  1PS9 A;  4N9X A;  2X8H A;  3CGD A;  2VRM A;  4NEW A;  2BK5 A;  4P9S A;  3AE2 A;  3UP5 A;  3ISH A;  3SFE A;  4OVI A;  4A65 A;  3NG7 X;  1H86 A;  2R4J A;  2XVF A;  2UZZ A;  1MO9 A;  1FEA A;  2YR4 A;  1ZP0 A;  3RP8 A;  4YT0 A;  5GRT A;  1SEZ A;  1CBO A;  1D7Y A;  1XHC A;  2H88 A;  2BC1 A;  2C3D A;  1DJN A;  2WP6 A;  4U8P A;  1IJH A;  4H4Y A;  1CC4 A;  1E1L A;  2BXR A;  1GT8 A;  1Q9I A;  3C96 A;  1CJC A;  4B63 A;  3QSS A;  4KX6 A;  5FS6 A;  1F8R A;  1LTX R;  3ABV A;  2XLR A;  3BNM A;  1GXF A;  3NGC X;  1NEK A;  1Z6L A;  2IVD A;  1HYU A;  1FOH A;  1H81 A;  2RAB A;  4GR1 A;  2GVC A;  1W4X A;  3SGL A;  3CN8 A;  3BI5 A;  4PAB A;  4K8D A;  2YLR A;  4AOX A;  1NEN A;  2E1M A;  1TDK A;  2RGH A;  1MXT A;  3FPZ A;  4FX9 A;  2Q0K A;  5L46 A;  2FJD A;  1N4U A;  2XLP A;  1BWC A;  2WOI A;  1N4W A;  2BA9 A;  2YM2 A;  4J36 A;  2V3A A;  2R0G A;  4K2X A;  1E7P A;  1GTH A;  1H84 A;  3ALM A;  4JNA A;  3AE7 A;  4K22 A;  4TLX A;  1FEB A;  2EQ8 A;  2C76 A;  2GAG B;  1TYP A;  2CUL A;  2XVJ A;  3Q9T A;  3VR8 A;  4U8N A;  5HHF A;  1GOS A;  1H83 A;  4H4Q A;  2XVI A;  3CTY A;  4HA6 A;  3L8K A;  1Y56 A;  3CGB A;  2XLT A;  5EB5 A;  1X31 B;  3EPT A;  4Z24 A;  2ZBW A;  3AE4 A;  3NH3 X;  2YG7 A;  4JNQ A;  1OJD A;  3LOV A;  3D8X A;  2YLW A;  3OZ2 A;  3AB1 A;  4H4U A;  4I59 A;  2WPF A;  1NAA A;  2C72 A;  4NTC A;  4A99 A;  4J31 A;  3NK2 X;  2XDO A;  1JNR A;  4CNJ A;  4I58 A;  1ZK7 A;  1F8S A;  1GEU A;  2Y6R A;  4X4J A;  1ZMC A;  2CDU A;  1K0L A;  4O5U A;  4Z44 A;  1AOG A;  2BCG G;  5FS8 A;  2EQ6 A;  2C73 A;  4JQ9 A;  1GV4 A;  1F6M A;  2B7R A;  3ICR A;  2TMD A;  4H2R A;  3NKS A;  1DNC A;  4ZCD A;  5DBJ A;  3ALL A;  5KWF A;  1CC6 A;  1LQT A;  3CND A;  3IHM A;  2ZZB A;  1PXB A;  1CL0 A;  2DKI A;  1E1N A;  4H2Q A;  2QA1 A;  4EQW A;  5CQF A;  2WEU A;  1GSN A;  2XVH A;  4B1B A;  4J34 A;  3DJG X;  3UKP A;  3UTH A;  3C4A A;  2RGJ A;  4H4R A;  3JSK A;  4K5R A;  1E6E A;  4NZH A;  5J60 A;  2C75 A;  1IUS A;  2A87 A;  4H7U A;  1H82 A;  2PYX A;  3EF6 A;  4EQS A;  1NHQ A;  4U8J A;  2R46 A;  1PJ6 A;  4H2P A;  3UKL A;  3KA7 A;  4YTP A;  1TYT A;  4AOS A;  1RSG A;  3P1W A;  2R0C A;  3K7Q X;  2R4E A;  3CNJ A;  2B76 A;  3LZW A;  4BK1 A;  3UP4 A;  2X8G A;  3ATR A;  1TRB A;  3CNT A;  3NNE A;  3UOV A;  1M64 A;  4Y4L A;  4EQX A;  4IVO B;  1NDA A;  3GDN A;  4U2T A;  4U8K A;  4XWZ A;  2IVE A;  2VOU A;  4DNA A;  3GWD A;  3I3L A;  5CKU A;  4Z43 A;  2YVG A;  2XVE A;  1NG3 A;  4KPR A;  3NK0 X;  3QVR A;  1OJT A;  1Q1W A;  1PBD A;  2OAL A;  2APG A;  2WET A;  5M0Z A;  4C3X A;  2I0Z A;  1O95 A;  1GRB A;  3RP7 A;  2BCP A;  5J7X A;  1NHS A;  1BF3 A;  1KSU A;  4TLZ A;  4CCR A;  4EIP A;  3VRB A;  2H89 A;  1EL8 A;  2WES A;  4C3Y A;  3GSI A;  3QSE A;  1ONF A;  1K0J A;  3UTE A;  3KU9 A;  3DA1 A;  1PJ7 A;  2W0H A;  3F8D A;  2ZZ0 A;  2A8X A;  2YR6 A;  3AYJ A;  4B68 A;  2YVJ A;  4FK1 A;  1ZY8 A;  3QVP A;  4Z2T A;  3NTD A;  2BS4 A;  2CVJ A;  1B8S A;  3GDP A;  4ZCC A;  5KOW A;  1N4V A;  1PHH A;  3AYI A;  4NEV A;  2TPR A;  4EMJ A;  2E5V A;  3DK8 A;  5JCM A;  5U25 A;  1COY A;  4RG3 A;  1BZL A;  4J56 A;  3SFD A;  3K7M X;  3VRD B;  1ZKQ A;  3AE6 A;  4JY2 A;  3DK4 A;  2BS2 A;  4Z26 A;  1XAN A;  3QFB A;  4XXG A;  1BGN A;  4YSX A;  1V59 A;  2B7S A;  1GRE A;  3B3R A;  4J2W A;  3BI4 A;  5EB4 A;  2AAQ A;  2R9Z A;  3AXB A;  3NN0 X;  3WE0 A;  3GRT A;  1CJ4 A;  2GH5 A;  3VR9 A;  2YG5 A;  4ADW A;  3PO7 A;  1EL7 A;  1YKJ A;  1YQ4 A;  4B66 A;  3CIR A;  3F8P A;  2GQW A;  5U63 A;  4TM1 A;  2FJB A;  2JAE A;  4YXD A;  2GF3 A;  3SQP A;  4U8M A;  2ARD A;  1Q1R A;  3KKJ A;  4B64 A;  3E1T A;  3GMC A;  2V60 A;  4HB9 A;  3AD7 B;  4M52 A;  2V5Z A;  3LXD A;  3KD9 A;  4IV9 A;  3S5W A;  4CCQ A;  4C74 A;  3KVE A;  4H4X A;  1D4C A;  1OJC A;  4GF7 A;  5FMH A;  3NTA A;  3VRA A;  1VRQ B;  1K4Q A;  5KVH A;  1L0V A;  2QAE A;  2WS3 A;  2YG3 A;  4Y4N A;  2BS3 A;  1LQU A;  4OPC A;  2GR1 A;  2AQJ A;  3R9U A;  1GPE A;  2PHH A;  3GRS A;  4UDP A;  3UTF A;  4Z2R A;  4TM0 A;  4H4V A;  2BK3 A;  3M12 A;  5FS9 A;  1QLB A;  1P2E A;  4ZN0 A;  1GER A;  2FBW A;  2WPC A;  3CPH G;  2XFP A;  4CY8 A;  3P4Q A;  4OPD A;  4GCM A;  2FJE A;  4OPG A;  4U8L A;  1L9E A;  1IUU A;  4K5S A;  2WU2 A;  2AR8 A;  3KLJ A;  4JN9 A;  4ECH A;  1JRZ A;  2C67 A;  4ICY A;  4CRT A;  1ZDL A;  2XLS A;  2WP5 A;  1DOE A;  2C3C A;  2VZ2 A;  1GAL A;  3QJ4 A;  2BAB A;  2XCG A;  4EM4 A;  1KF6 A;  2WDQ A;  1EL5 A;  1GRF A;  2J3N A;  1KNR A;  4GUV A;  2XFN A;  4IA5 A;  3AEB A;  2YLZ A;  2VVL G;  3IF9 A;  3P9U A;  5KOX A;  2JKC A;  2VQB A; 
#chains in the Genus database with same CATH topology
 4E6M A;  3N6H A;  4OPL A;  4DGK A;  2P88 A;  2YLX A;  5G5H B;  2QA2 A;  2GAH B;  4JDR A;  3UOY A;  1DOC A;  3ZDN A;  3SM8 A;  1LJ1 A;  3D9X A;  1QJD A;  2YVF A;  1NPX A;  4EMW A;  2JB3 A;  1KKO A;  3H70 A;  4IHC A;  2FJA A;  3UCC A;  3ITJ A;  1ZOY A;  3IJQ A;  1XDI A;  4YKG A;  4BK2 A;  1YY5 A;  2PU0 A;  5EBK A;  3DME A;  1W6T A;  4OPU A;  2OZ3 A;  3ZVH B;  2XH7 A;  3VFC A;  3VDG A;  1PJ5 A;  3FJ4 A;  4E4U A;  3SBF A;  2PGW A;  3P4P A;  2GR2 A;  4J3Z A;  3AEG A;  3SXI A;  3ETR B;  4LA1 A;  3CPI G;  4H50 A;  3O0H A;  1O5W A;  1JEH A;  5KVI A;  2OLN A;  1D4D A;  1S3B A;  1DJQ A;  1JOA A;  2OPJ A;  1N1P A;  3OZM A;  1KSS A;  3BNU A;  4J33 A;  4NWZ A;  1KD0 A;  3IJL A;  4JHM A;  1NHP A;  1VDC A;  3ICT A;  3PVC A;  3GYJ A;  5FS7 A;  3JVA A;  4Z1Y A;  3EAN A;  3I6D A;  3T14 A;  3AEE A;  1GES A;  3UCL A;  4AT0 A;  4A79 A;  2W3S A;  2FKP A;  3GD6 A;  2HZG A;  3K30 A;  4A6G A;  3NYE A;  2YG4 A;  3UKF A;  3AD9 B;  4USR A;  3VC6 A;  3PG6 A;  4C5O A;  4U2S A;  4X9M A;  4CY6 A;  3H4K A;  3UJE A;  5GSN A;  1N5X A;  1PBE A;  1IUX A;  1E39 A;  3BI2 A;  5BRT A;  2C4C A;  3UTG A;  3LB8 A;  3MUC A;  2QDD A;  3K7T A;  3GMB A;  5BVA A;  1H7W A;  1QO8 A;  4K7Z A;  5FJR A;  2X99 A;  3QPE A;  4YTN A;  2GEW A;  1E1M A;  2WHD A;  5HXI A;  3TJ4 A;  2R0P A;  2XH0 A;  1CJ2 A;  2VVM A;  3IJI A;  3ALJ A;  4B67 A;  1TDO A;  4H2N A;  1R6W A;  3OC4 A;  3CPJ G;  4GGB A;  3ATQ A;  4RG4 A;  4USQ A;  1X2H A;  2OA1 A;  3V76 A;  1L9D A;  1JU2 A;  4OCG A;  3L5O A;  4IP4 A;  5TR3 A;  1GND A;  1FL2 A;  4YSZ A;  3I6T A;  1SB3 B;  2NPX A;  3FVD A;  1B5Q A;  4D04 A;  5M10 A;  5IDZ A;  1OEP A;  3AE2 A;  3ISH A;  3ES8 A;  1H86 A;  2XVF A;  3RP8 A;  4KWS A;  5GRT A;  1SEZ A;  1CBO A;  3SX6 A;  1DJN A;  4H4Y A;  1BQG A;  4KX6 A;  3BNM A;  1E9I A;  1GXF A;  3NGC X;  1NEK A;  4JN8 A;  2GVC A;  4M0X A;  2Q0K A;  2WOI A;  3OTR A;  4J36 A;  2ONE A;  2OX4 A;  1TYP A;  2CUL A;  3VR8 A;  3BOX A;  1GOS A;  1H83 A;  3HPF A;  2XVI A;  3CTY A;  1Y56 A;  3EPT A;  3R10 A;  3HYW A;  3N6J A;  4DWD A;  3D46 A;  1ZK7 A;  2Y6R A;  2CDU A;  3PWG A;  2EQ6 A;  3ENL A;  2XSX A;  4GGH A;  2B7R A;  4H2R A;  1DNC A;  4GFI A;  3EKG A;  1CC6 A;  3R11 A;  3IHM A;  2DKI A;  3D47 A;  1GSN A;  2XVH A;  4B1B A;  1FFU C;  4IP5 A;  1IYX A;  4H4R A;  1E6E A;  5J60 A;  2PYX A;  2GGI A;  2PSN A;  3BSM A;  3KA7 A;  3K1G A;  3TQP A;  3UJF A;  3P1W A;  3PWI A;  2R4E A;  3V4B A;  3LZW A;  4BK1 A;  1TRB A;  2OZT A;  1M64 A;  4EQX A;  1NDA A;  3GDN A;  4U8K A;  3I3L A;  1MDL A;  1NG3 A;  4IT1 A;  2WET A;  3CXB A;  4C3X A;  1N60 C;  1GRB A;  3UJS A;  1KSU A;  1H2I A;  2WES A;  4C3Y A;  3GSI A;  3QSE A;  2GL5 A;  2ZZ0 A;  2A8X A;  3UJR A;  4FK1 A;  3SYI A;  3I6E A;  4MGG A;  2QJN A;  4RG3 A;  1BZL A;  1VDV A;  3SFD A;  3SZ0 A;  3QFB A;  1R0M A;  2B7S A;  2AAQ A;  2R9Z A;  3NN0 X;  3GRT A;  1CJ4 A;  3VR9 A;  3PO7 A;  4B66 A;  4KEM A;  2GQW A;  5U63 A;  4TM1 A;  3RRA A;  2OLA A;  3EUB 3;  1Q1R A;  3KKJ A;  3GMC A;  3AD7 B;  4IV9 A;  4CCQ A;  3GO2 A;  3SR6 B;  4C74 A;  4H4X A;  1OJC A;  3NTA A;  1L0V A;  5JRB A;  2GR1 A;  2AQJ A;  3ES7 A;  3R9U A;  3GRS A;  3FV9 A;  1P2E A;  2FBW A;  2XFP A;  3P4Q A;  1IUU A;  4K5S A;  3PK7 A;  2AR8 A;  1JRZ A;  2P8C A;  1KF6 A;  1KNR A;  1GRF A;  4GUV A;  2XFN A;  4IA5 A;  3AEB A;  1GRG A;  4GIS A;  5U1O A;  1D4E A;  2XFQ A;  1TDF A;  1CF3 A;  3BHF A;  4U2L A;  2XGZ A;  4LII A;  4HPN A;  3N4E A;  1BKW A;  4PAA A;  1JRY A;  3ICS A;  5IPY A;  2BK4 A;  1EC7 A;  1NHR A;  5BUK A;  4REK A;  4G6G A;  2BAC A;  5JCN A;  1Y56 B;  2AL1 A;  3T8Q A;  3NYC A;  4BUR A;  1LVL A;  2YLS A;  1PDH A;  2AKZ A;  2GR0 A;  1PDZ A;  2ZZC A;  3SN1 A;  3H7V A;  2Y6Q A;  2WDV A;  5G5G B;  1Y0P A;  4A9W A;  1CJ3 A;  4GAP A;  1D7L A;  2QGY A;  1PN0 A;  2AKM A;  4IA6 A;  3T4W A;  1JNZ A;  2BYB A;  1JPM A;  2BC0 A;  1NEL A;  1YQZ A;  1MUC A;  3IC9 A;  3THU A;  1UKV G;  2R45 A;  2GSH A;  3G5Q A;  3NHO X;  4YSH A;  3AED A;  2YQU A;  4Y4M A;  4XWR A;  3S5S A;  2Z5Y A;  3UKK A;  1F9C A;  3IHG A;  1VG9 A;  3COX A;  3B9J B;  3R1Z A;  5IQ1 A;  1KFY A;  1K0I A;  3A7R A;  3B97 A;  3IWA A;  4X9N A;  2WDR A;  2V61 A;  2Q0L A;  4NTD A;  4CNK A;  3G5R A;  2CFY A;  4IVM B;  3SY4 A;  5BOE A;  1E1K A;  3V3W A;  1VQW A;  2C70 A;  4H4P A;  3VCC A;  3T31 A;  2X50 A;  1WUE A;  3QTP A;  4O5Q A;  3VCN A;  2PCE A;  1KKR A;  4U8I A;  3RGT A;  1EL9 A;  3NYF A;  5KRQ A;  3CYJ A;  2OAM A;  3FIM B;  1FCD A;  1STZ A;  1FEC A;  2EQ9 A;  3V3O A;  1FHV A;  2X8C A;  2F5Z A;  2XFU A;  3ZYX A;  2PP0 A;  1MRA A;  3NIX A;  3AE8 A;  3S47 A;  4OPI A;  4GRT A;  2WPE A;  4WCT A;  3V3N A;  4NNJ A;  2XFO A;  4BV6 A;  3UOX A;  3BHK A;  3P4R A;  3RP6 A;  3PS9 A;  2BXS A;  1ECQ A;  2V3B A;  3T2Z A;  3UXL A;  2GB0 A;  3AEF A;  4F4R A;  5JCL A;  5FJT A;  4UDR A;  3UKH A;  3C4N A;  3FMW A;  4II3 A;  4IL0 A;  4NEW A;  3UP5 A;  4OVI A;  1DTN A;  1T3Q C;  3NG7 X;  4A65 A;  5FJO A;  1MO9 A;  3V5C A;  2P3Z A;  1CC4 A;  1E1L A;  1TKK A;  1GT8 A;  3C96 A;  3NRZ B;  3ABV A;  3RO6 A;  1Z6L A;  2IVD A;  1FOH A;  1BKH A;  3SGL A;  4PAB A;  1NEN A;  2E1M A;  1MXT A;  5L46 A;  3JW7 A;  5J04 A;  4K2X A;  1E7P A;  4TLX A;  4FI4 A;  3AE7 A;  2GAG B;  3DG7 A;  3Q9T A;  5KMP A;  4U8N A;  4H4Q A;  3L8K A;  3CGB A;  2ZBW A;  3NH3 X;  3UCD A;  3LOV A;  3D8X A;  3OZ2 A;  3AB1 A;  4H4U A;  4I59 A;  2C72 A;  4J31 A;  2PA6 A;  1F8S A;  4X4J A;  3AMZ A;  1K0L A;  5FS8 A;  4HCD A;  3ICR A;  1JRP A;  2TMD A;  2OVL A;  3T2K A;  3NKS A;  5KNL A;  5DBJ A;  1LQT A;  3CND A;  1PXB A;  1CL0 A;  1E1N A;  5CQF A;  2QA1 A;  4EQW A;  2WEU A;  3V5F A;  3DJG X;  3UTH A;  2FYM A;  4NZH A;  3ZLF A;  4H7U A;  1H82 A;  1VQZ A;  2RDX A;  4EQS A;  4U8J A;  2GGE A;  4H2P A;  3UKL A;  4YTP A;  5KMS A;  2R0C A;  3K7Q X;  4Y4L A;  4IVO B;  4HNL A;  1XPY A;  5CKU A;  4Z43 A;  3QVR A;  2OAL A;  5M0Z A;  1JPD X;  2I0Z A;  4KT2 A;  2PTW A;  4Z17 A;  1RVK A;  4TLZ A;  4CCR A;  2CHR A;  3KU9 A;  1EBG A;  1N63 C;  4IL2 A;  3DER A;  1ZY8 A;  3DDM A;  3SZF A;  1N4V A;  3U9I A;  1MDR A;  5JCM A;  1ZKQ A;  3AE6 A;  1XAN A;  4YSX A;  4GME A;  5EB4 A;  3BI4 A;  2GH5 A;  3NVV B;  4A35 A;  2YG5 A;  4ADW A;  1EL7 A;  1YQ4 A;  3PFR A;  1PDY A;  4G74 A;  4YXD A;  4U8M A;  4ZCW A;  4HB9 A;  2V5Z A;  2POD A;  3LXD A;  3FCP A;  4E4F A;  3CB3 A;  1ONE A;  3M12 A;  4ZN0 A;  3CPH G;  3DG3 A;  4GCM A;  1L9E A;  2WU2 A;  3KLJ A;  4ECH A;  4CRT A;  4X2P A;  2WP5 A;  2P0I A;  2BAB A;  4G8T A;  2YLZ A;  3P9U A;  3AE5 A;  2GRT A;  2W3R A;  5KXJ A;  1CHU A;  3AE1 A;  1OJ9 A;  2OQY A;  2QQ6 A;  1TDN A;  3SJN A;  3GYI A;  3CK5 A;  3OW1 A;  3CNS A;  4B65 A;  1GRH A;  5LV9 A;  4BJY A;  3DFH A;  1ZMD A;  2BRY A;  3VQR A;  5KMR A;  3RCY A;  1JRX A;  4BJZ A;  3II4 A;  2PS2 A;  4NTE A;  2C65 A;  2WBA A;  3HW2 A;  1ELS A;  2C64 A;  3FXG A;  1H6V A;  2PP3 A;  2XLU A;  5C3J A;  4OPT A;  1D5T A;  4DSH A;  4YKF A;  1ZOV A;  2X3N A;  3NZG A;  4AP1 A;  4BK3 A;  2OLO A;  4GIR A;  2HQM A;  3GWF A;  4GDE A;  4EMI A;  2ACZ A;  3P4S A;  3T9P A;  2C7G A;  4EM3 A;  3OPS A;  4GDP A;  3CNP A;  4RSL A;  2QJM A;  2XYO A;  4U8O A;  1B4V A;  1MOK A;  4YWS A;  1RYI A;  3AN1 A;  2WOV A;  3TJI A;  4UP3 A;  2Z5X A;  3GYX A;  1KNP A;  3TWA A;  2GMH A;  4J57 A;  3R25 A;  3H8I A;  4G9K A;  3DGB A;  4FP1 A;  3ADA B;  3FG2 P;  3DK9 A;  4II2 A;  1EBD A;  1YQ3 A;  2B9W A;  4GYP C;  1GRT A;  3EAO A;  3GD3 A;  5IQ4 A;  2HNE A;  2GGG A;  4A6N B;  2GMJ A;  3Q45 A;  3AEC A;  3T6C A;  2RGO A;  3EEZ A;  4H19 A;  3NRN A;  2VRL A;  2NVK X;  2V6O A;  3L1R A;  3GD4 A;  3DGH A;  5HY5 A;  3S61 A;  1CC2 A;  2OZ8 A;  1IUW A;  2WOW A;  1B37 A;  1L9C A;  3DJD A;  1S2Y A;  1WUF A;  2WQY A;  2Q6U A;  1WYG A;  3QN3 A;  2GR3 A;  3HRD C;  2OO6 A;  1F8W A;  4H4S A;  2JB2 A;  3DJJ A;  1GET A;  2YAU A;  3QFA A;  1VG0 A;  4K8G A;  4UDQ A;  4Z2U A;  2QCU A;  2E3T A;  1S2Q A;  3ZVI A;  3HZL A;  3NT6 A;  2Q7V A;  3NO1 A;  4FDC B;  4E0V A;  3U4F A;  2GV8 A;  1N62 C;  1DOB A;  3NXL A;  1P43 A;  2EQ7 A;  4APN A;  1NG4 A;  2GQF A;  1PS9 A;  2X8H A;  3CGD A;  3MQT A;  2BK5 A;  2QDE A;  4TVW A;  3GC2 A;  2R4J A;  1KN0 A;  2UZZ A;  3RIT A;  4YT0 A;  1D7Y A;  4EWJ A;  2WP6 A;  1IJH A;  3STP A;  2BXR A;  1Q9I A;  4ZOH B;  2QVH A;  1CJC A;  3QLD A;  4HYR A;  2ZAD A;  1F8R A;  1LTX R;  1H81 A;  2RAB A;  3CN8 A;  3BI5 A;  4K8D A;  3VA8 A;  3FPZ A;  4FX9 A;  3Q4D A;  2FJD A;  1N4U A;  2XLP A;  1BWC A;  2BA9 A;  1N4W A;  2YM2 A;  2V3A A;  2R0G A;  4JNA A;  1GTH A;  4K22 A;  2OKT A;  1FEB A;  2EQ8 A;  2XVJ A;  4HA6 A;  1KCZ A;  3UGV A;  3NVW B;  1X31 B;  2YG7 A;  4JNQ A;  2PTX A;  2YLW A;  3R0U A;  3SSZ A;  2WPF A;  1NAA A;  3CXO A;  2XDO A;  1GEU A;  1ZMC A;  4Z44 A;  1AOG A;  2C73 A;  1GV4 A;  4DYE A;  1FIQ B;  2PU1 A;  3UKP A;  2RGJ A;  3SQS A;  4K5R A;  1XS2 A;  2C75 A;  1IUS A;  1NHQ A;  1JRO A;  2PTY A;  1PJ6 A;  1SJD A;  1RSG A;  3DFY A;  3CNJ A;  3UP4 A;  2X8G A;  3UOV A;  4U2T A;  4XWZ A;  3ZLG A;  2IVE A;  2VOU A;  3GWD A;  2YVG A;  2XVE A;  3MKC A;  4KPR A;  1OJT A;  1Q1W A;  1PBD A;  3UJ2 A;  3QKE A;  1O95 A;  2BCP A;  3NFU A;  1TZZ A;  4EIP A;  2O56 A;  1MNS A;  1EL8 A;  2OQH A;  1K0J A;  3DA1 A;  1L8P A;  2YR6 A;  3OZY A;  3QVP A;  3NTD A;  2BS4 A;  3GDP A;  1B8S A;  5KOW A;  1PHH A;  3AYI A;  4NEV A;  4EMJ A;  3TWB A;  3DK8 A;  2OFJ A;  5U25 A;  1EC8 A;  1COY A;  4K1W A;  3T2Y A;  3K7M X;  6ENL A;  4Z26 A;  3DK4 A;  3NS1 B;  4XXG A;  4G73 A;  1BGN A;  1V59 A;  1GRE A;  3AXB A;  2POZ A;  4ENL A;  3CIR A;  3F8P A;  2AL2 A;  2FJB A;  2JAE A;  1JCT A;  4B64 A;  4J1O A;  2V60 A;  2GDQ A;  4M52 A;  3KD9 A;  1D4C A;  3MY9 A;  5FMH A;  4GF7 A;  1VRQ B;  3DES A;  1K4Q A;  3MZN A;  5KVH A;  2QAE A;  4H2H A;  4Y4N A;  2BS3 A;  3KUM A;  2PHH A;  4Z2R A;  4TM0 A;  4H4V A;  3A7A A;  1GER A;  4CY8 A;  3BJS A;  4ICY A;  3P0W A;  2XLS A;  3DEQ A;  1DOE A;  3QJ4 A;  4EM4 A;  1EL5 A;  2J3N A;  3IF9 A;  2VQB A;  4DSG A;  1P48 A;  3M13 A;  4A5L A;  1EC9 A;  4D03 A;  4AP3 A;  3N4F A;  2WU5 A;  3G5S A;  2PP1 A;  3TW9 A;  2JB1 A;  3LZX A;  3H12 A;  5ENL A;  1FO4 A;  3IK4 A;  2VVL A;  3CGE A;  1SJA A;  4H4Z A;  3AEA A;  5ER0 A;  3SN0 A;  5C2T A;  3TOY A;  2YWL A;  3CGC A;  3UKQ A;  4LU6 A;  3LJP A;  1DOD A;  1GRA A;  4ROP A;  3I4K A;  4A6N A;  2E4G A;  1NU5 A;  3LAD A;  1PBF A;  4A7A A;  3URH A;  1N5W C;  3DGZ A;  2O9Z A;  3DJE A;  4E8G A;  1IUT A;  3KPF A;  5JCK A;  3R0K A;  2YG6 A;  4H4T A;  1RP0 A;  3FBS A;  3DH9 A;  4CBQ A;  1O94 A;  1DXL A;  1JDF A;  3P3B A;  2I5Q A;  2NQL A;  3M0O A;  1LPF A;  3RED A;  4YSY A;  4YWO A;  3JZU A;  3CT2 A;  1S3E A;  3AYL A;  2YLT A;  4TM4 A;  1M6I A;  5KMQ A;  7ENL A;  1PBB A;  3NVY B;  2YM1 A;  1H7X A;  1X2G A;  1P2H A;  1OJA A;  3AWI A;  1GTE A;  1PBC A;  3VC5 A;  2GGH A;  2C66 A;  3UKA A;  4DN1 A;  3NN6 X;  4KPL A;  4G7F A;  1PXA A;  4C77 A;  1F3P A;  4TM3 A;  1PXC A;  3DG6 A;  4H4W A;  4EQR A;  2W55 A;  4HCH A;  2PGE A;  3T37 A;  3D1C A;  4H83 A;  1LV0 A;  1XPQ A;  4MJW A;  4HCL A;  3CAW A;  3F8R A;  2B9X A;  4GAV A;  4YTM A;  1TDE A;  1ELI A;  2DW7 A;  3AE3 A;  3TCS A;  3RHA A;  4EIQ A;  3B6D A;  2JBV A;  1KDG A;  3QSM A;  3AE9 A;  4G6H A;  4FK1 C;  2AL2 B;  4AT2 A;  4Z25 A;  3HYX A;  3Q6J A;  4K2S A;  3NK1 X;  5EOW A;  4B69 A;  3AM9 A;  2A89 A;  2XH4 A;  1FHU A;  5FJU A;  4WX1 A;  4HNC A;  2JK6 A;  2ZC8 A;  4JY3 A;  5JCI A;  3H8L A;  5HYM A;  5BUL A;  2VQ7 A;  1BGJ A;  2WP9 A;  2YR5 A;  3HYV A;  1S7M A;  1ZXI C;  1REO A;  3OP2 A;  3RNM A;  3NLC A;  1IUV A;  2IID A;  3UOZ A;  2DKH A;  3AD8 B;  4M6U A;  1ZX9 A;  3P93 A;  2B9Y A;  4N9X A;  2VRM A;  4P9S A;  3SFE A;  2PMQ A;  4ZA0 A;  2QJJ A;  4DX3 A;  2YR4 A;  1FEA A;  1ZP0 A;  4DHG A;  2W54 A;  3R07 C;  1XHC A;  2H88 A;  2BC1 A;  2C3D A;  4U8P A;  4B63 A;  3QSS A;  5FS6 A;  2XLR A;  5BOF A;  1SJC A;  2HXT A;  3A7U A;  1HYU A;  4GR1 A;  1W4X A;  1YEY A;  3SZW A;  2YLR A;  2PPG A;  4AOX A;  1TDK A;  2RGH A;  3ALM A;  1H84 A;  4A3R A;  2C76 A;  5HHF A;  3TTE A;  5EB5 A;  2XLT A;  4Z24 A;  3NVZ B;  3AE4 A;  1OJD A;  2P8B A;  3KPK A;  4NTC A;  4A99 A;  3NK2 X;  1JNR A;  4CNJ A;  4I58 A;  3ZVH A;  4O5U A;  2BCG G;  4JQ9 A;  1F6M A;  4ZCD A;  3ALL A;  5KWF A;  2MNR A;  2ZZB A;  4H2Q A;  3MSY A;  4J34 A;  3C4A A;  3JSK A;  2GGJ A;  2A87 A;  3CMM A;  3EF6 A;  4GYP A;  2R46 A;  1TE6 A;  1TYT A;  4AOS A;  2B76 A;  3ATR A;  3CNT A;  3NNE A;  3UXK A;  4DNA A;  2MUC A;  3FYY A;  1EBH A;  3SN4 A;  1FFV C;  3NK0 X;  4TVY A;  2APG A;  4MMW A;  4H1Z A;  3RP7 A;  5J7X A;  1NHS A;  1BF3 A;  3VRB A;  2H89 A;  4DXK A;  1ONF A;  3UTE A;  1PJ7 A;  2W0H A;  3F8D A;  3AYJ A;  3DIP A;  4B68 A;  2YVJ A;  4Z2T A;  2CVJ A;  4ZCC A;  2TPR A;  3SZC A;  2BRA A;  2E5V A;  3T0K A;  4J56 A;  3VRD B;  4JY2 A;  5FJP A;  2BS2 A;  3RR1 A;  1N61 C;  2E5A A;  3B3R A;  4J2W A;  3WE0 A;  3GY1 A;  4HN8 A;  1YKJ A;  2OG9 A;  3MWC A;  4MKS A;  1SJB A;  2HXU A;  2GF3 A;  3SQP A;  2ARD A;  3E1T A;  3S5W A;  3KVE A;  2XH2 A;  3VRA A;  2PTZ A;  4IZG A;  2WS3 A;  2YG3 A;  4OPC A;  1LQU A;  1RM6 B;  1GPE A;  4UDP A;  3UTF A;  2DW6 A;  2BK3 A;  5FS9 A;  1QLB A;  3ZLH A;  2WPC A;  4OPD A;  2FJE A;  4OPG A;  4U8L A;  5EU9 A;  4JN9 A;  2C67 A;  1ZDL A;  2C3C A;  2VZ2 A;  1GAL A;  4E5T A;  2XCG A;  2WDQ A;  3H8A A;  1V97 A;  2VVL G;  4JN7 A;  5KOX A;  2JKC A; 
#chains in the Genus database with same CATH homology
 2GRT A;  4DSG A;  5KXJ A;  1CHU A;  3AE1 A;  1OJ9 A;  1GRG A;  3M13 A;  5U1O A;  4A5L A;  1D4E A;  4D03 A;  2XFQ A;  4OPL A;  4DGK A;  4AP3 A;  1TDF A;  2WU5 A;  3G5S A;  1CF3 A;  3BHF A;  1TDN A;  2YLX A;  2JB1 A;  2QA2 A;  3LZX A;  2GAH B;  4JDR A;  4U2L A;  4LII A;  3GYI A;  3UOY A;  1DOC A;  3ZDN A;  2VVL A;  3CNS A;  1BKW A;  4PAA A;  1JRY A;  4B65 A;  3CGE A;  3SM8 A;  1GRH A;  1LJ1 A;  3ICS A;  5IPY A;  2BK4 A;  4H4Z A;  3AEA A;  3D9X A;  1QJD A;  5LV9 A;  5ER0 A;  2YVF A;  1NPX A;  5C2T A;  4EMW A;  4BJY A;  2YWL A;  1ZMD A;  3CGC A;  2BRY A;  3VQR A;  2JB3 A;  1NHR A;  3UKQ A;  5KMR A;  5BUK A;  4REK A;  1JRX A;  4G6G A;  4BJZ A;  4LU6 A;  2BAC A;  3II4 A;  5JCN A;  1Y56 B;  2FJA A;  3LJP A;  1DOD A;  4NTE A;  3ITJ A;  1GRA A;  3NYC A;  4BUR A;  1ZOY A;  1XDI A;  1LVL A;  2YLS A;  1PDH A;  4YKG A;  2C65 A;  2WBA A;  4BK2 A;  4A6N A;  2GR0 A;  2ZZC A;  2E4G A;  1YY5 A;  3LAD A;  5EBK A;  3DME A;  4OPU A;  2C64 A;  2Y6Q A;  2WDV A;  1PBF A;  1PJ5 A;  4A7A A;  3URH A;  1H6V A;  3DGZ A;  1Y0P A;  2O9Z A;  2XLU A;  5C3J A;  4A9W A;  3DJE A;  4OPT A;  1D5T A;  4DSH A;  1IUT A;  1ZOV A;  1CJ3 A;  3KPF A;  4YKF A;  5JCK A;  4GAP A;  2X3N A;  1D7L A;  1PN0 A;  2YG6 A;  3P4P A;  4H4T A;  4AP1 A;  4BK3 A;  1RP0 A;  2GR2 A;  3FBS A;  2OLO A;  3DH9 A;  4CBQ A;  4IA6 A;  3AEG A;  3SXI A;  1O94 A;  4LA1 A;  3CPI G;  1JNZ A;  1DXL A;  4H50 A;  3O0H A;  1O5W A;  3M0O A;  1LPF A;  1JEH A;  5KVI A;  2BYB A;  3RED A;  2HQM A;  3GWF A;  2BC0 A;  2OLN A;  4GDE A;  4YSY A;  4EMI A;  2ACZ A;  3P4S A;  1D4D A;  1YQZ A;  3IC9 A;  1S3B A;  2R45 A;  1UKV G;  4YWO A;  3G5Q A;  3NHO X;  2C7G A;  4YSH A;  1S3E A;  4EM3 A;  1DJQ A;  3AED A;  4GDP A;  3AYL A;  1JOA A;  2YLT A;  3CNP A;  2YQU A;  4TM4 A;  1N1P A;  1M6I A;  4RSL A;  4U8O A;  1KSS A;  2XYO A;  5KMQ A;  1B4V A;  3BNU A;  1MOK A;  4J33 A;  4Y4M A;  1RYI A;  4NWZ A;  2WOV A;  1PBB A;  4UP3 A;  4XWR A;  2Z5X A;  3GYX A;  1KNP A;  2Z5Y A;  1NHP A;  1VDC A;  2GMH A;  2YM1 A;  3UKK A;  3ICT A;  4J57 A;  1H7X A;  1P2H A;  3IHG A;  1VG9 A;  3GYJ A;  5FS7 A;  3PVC A;  3H8I A;  3COX A;  1OJA A;  4G9K A;  3AWI A;  1GTE A;  1PBC A;  3EAN A;  3I6D A;  5IQ1 A;  2C66 A;  3FG2 P;  1KFY A;  3ADA B;  3DK9 A;  3NN6 X;  4II2 A;  1EBD A;  3T14 A;  1PXA A;  1YQ3 A;  1K0I A;  2B9W A;  3AEE A;  4C77 A;  1GRT A;  3EAO A;  1GES A;  3IWA A;  4X9N A;  2WDR A;  1F3P A;  4TM3 A;  3UCL A;  3GD3 A;  4A79 A;  1PXC A;  4AT0 A;  5IQ4 A;  2V61 A;  2Q0L A;  4NTD A;  4H4W A;  4A6N B;  4EQR A;  2GMJ A;  4CNK A;  3G5R A;  2CFY A;  3AEC A;  4IVM B;  3SY4 A;  2RGO A;  3T37 A;  3D1C A;  3K30 A;  1E1K A;  3NRN A;  3NYE A;  1XPQ A;  2NVK X;  1LV0 A;  2V6O A;  2VRL A;  1VQW A;  2YG4 A;  3GD4 A;  3DGH A;  2C70 A;  3AD9 B;  3AE5 A;  3L1R A;  4MJW A;  4H4P A;  3UKF A;  3F8R A;  2B9X A;  5HY5 A;  3T31 A;  4GAV A;  2X50 A;  4USR A;  4YTM A;  3PG6 A;  1TDE A;  4U2S A;  3S61 A;  4C5O A;  1CC2 A;  4O5Q A;  4X9M A;  1ELI A;  1IUW A;  3H4K A;  4CY6 A;  2WOW A;  1B37 A;  1L9C A;  3DJD A;  3AE3 A;  1S2Y A;  5GSN A;  3RHA A;  4EIQ A;  1PBE A;  3B6D A;  1IUX A;  4U8I A;  1E39 A;  3BI2 A;  1EL9 A;  5BRT A;  2C4C A;  2JBV A;  3NYF A;  3UTG A;  2WQY A;  3LB8 A;  2Q6U A;  1KDG A;  5KRQ A;  2GR3 A;  2OAM A;  3FIM B;  1FCD A;  3K7T A;  3GMB A;  3QSM A;  1F8W A;  5BVA A;  1H7W A;  3AE9 A;  4H4S A;  1QO8 A;  2JB2 A;  4K7Z A;  3DJJ A;  1FEC A;  1GET A;  2EQ9 A;  2X99 A;  3V3O A;  2X8C A;  2YAU A;  4G6H A;  2F5Z A;  2XFU A;  4FK1 C;  3QFA A;  3ZYX A;  4AT2 A;  4YTN A;  2GEW A;  3NIX A;  4Z25 A;  3HYX A;  3Q6J A;  1E1M A;  1VG0 A;  2WHD A;  5HXI A;  3NK1 X;  3AE8 A;  4UDQ A;  4OPI A;  5EOW A;  4B69 A;  2A89 A;  2R0P A;  4GRT A;  2QCU A;  4Z2U A;  2WPE A;  4WX1 A;  1CJ2 A;  4WCT A;  2VVM A;  3V3N A;  4NNJ A;  3ALJ A;  2JK6 A;  4B67 A;  1TDO A;  4H2N A;  3OC4 A;  4BV6 A;  2XFO A;  1S2Q A;  3BHK A;  3UOX A;  3CPJ G;  3ATQ A;  3P4R A;  4RG4 A;  4USQ A;  3HZL A;  5JCI A;  2OA1 A;  3H8L A;  3NT6 A;  4JY3 A;  1L9D A;  3RP6 A;  3V76 A;  2Q7V A;  5HYM A;  3PS9 A;  5BUL A;  4FDC B;  1JU2 A;  2BXS A;  2VQ7 A;  1BGJ A;  2V3B A;  2WP9 A;  2YR5 A;  3HYV A;  4E0V A;  3T2Z A;  1S7M A;  2GB0 A;  2GV8 A;  1DOB A;  4OCG A;  3AEF A;  5JCL A;  1REO A;  4UDR A;  3RNM A;  3L5O A;  3NLC A;  1IUV A;  2EQ7 A;  4APN A;  5TR3 A;  2IID A;  3UOZ A;  3UKH A;  2DKH A;  3C4N A;  1GND A;  1FL2 A;  4YSZ A;  3AD8 B;  2NPX A;  1NG4 A;  1ZX9 A;  3FMW A;  2B9Y A;  4II3 A;  3UKA A;  1B5Q A;  2GQF A;  4D04 A;  5M10 A;  1PS9 A;  4N9X A;  2X8H A;  3CGD A;  2VRM A;  4NEW A;  2BK5 A;  4P9S A;  3AE2 A;  3UP5 A;  3ISH A;  3SFE A;  4OVI A;  4A65 A;  3NG7 X;  1H86 A;  2R4J A;  1KN0 A;  2UZZ A;  1MO9 A;  1FEA A;  2XVF A;  1ZP0 A;  2YR4 A;  3RP8 A;  4YT0 A;  5GRT A;  1SEZ A;  1CBO A;  1D7Y A;  1XHC A;  2H88 A;  2BC1 A;  2C3D A;  3SX6 A;  1DJN A;  2WP6 A;  4U8P A;  1IJH A;  4H4Y A;  1CC4 A;  1E1L A;  2BXR A;  1GT8 A;  1Q9I A;  3C96 A;  1CJC A;  4B63 A;  3QSS A;  4KX6 A;  5FS6 A;  1F8R A;  1LTX R;  3ABV A;  2XLR A;  3BNM A;  1GXF A;  3NGC X;  1NEK A;  1Z6L A;  2IVD A;  1HYU A;  1FOH A;  1H81 A;  2RAB A;  4GR1 A;  2GVC A;  1W4X A;  3SGL A;  3CN8 A;  3BI5 A;  4PAB A;  3SZW A;  4K8D A;  2YLR A;  4AOX A;  1NEN A;  2E1M A;  1TDK A;  2RGH A;  1MXT A;  3FPZ A;  4FX9 A;  2Q0K A;  5L46 A;  2FJD A;  1N4U A;  2XLP A;  1BWC A;  2WOI A;  1N4W A;  2BA9 A;  2YM2 A;  4J36 A;  2V3A A;  2R0G A;  4K2X A;  1E7P A;  1GTH A;  1H84 A;  3ALM A;  4JNA A;  3AE7 A;  4K22 A;  4TLX A;  1FEB A;  2EQ8 A;  2C76 A;  2GAG B;  1TYP A;  2CUL A;  2XVJ A;  3Q9T A;  3VR8 A;  5KMP A;  4U8N A;  5HHF A;  1GOS A;  1H83 A;  4H4Q A;  2XVI A;  3CTY A;  4HA6 A;  3L8K A;  1Y56 A;  3CGB A;  2XLT A;  5EB5 A;  1X31 B;  3EPT A;  4Z24 A;  2ZBW A;  3AE4 A;  3NH3 X;  2YG7 A;  4JNQ A;  1OJD A;  3LOV A;  3D8X A;  2YLW A;  3OZ2 A;  3AB1 A;  3HYW A;  4H4U A;  4I59 A;  3KPK A;  2WPF A;  1NAA A;  2C72 A;  4NTC A;  4A99 A;  4J31 A;  3NK2 X;  2XDO A;  1JNR A;  4CNJ A;  4I58 A;  1ZK7 A;  1F8S A;  1GEU A;  2Y6R A;  4X4J A;  1ZMC A;  2CDU A;  1K0L A;  4O5U A;  4Z44 A;  1AOG A;  2BCG G;  5FS8 A;  2EQ6 A;  2C73 A;  4JQ9 A;  1GV4 A;  1F6M A;  2B7R A;  3ICR A;  2TMD A;  4H2R A;  3T2K A;  3NKS A;  1DNC A;  5KNL A;  4ZCD A;  5DBJ A;  3ALL A;  5KWF A;  1CC6 A;  1LQT A;  3CND A;  3IHM A;  2ZZB A;  1PXB A;  1CL0 A;  2DKI A;  1E1N A;  4H2Q A;  2QA1 A;  4EQW A;  5CQF A;  2WEU A;  1GSN A;  2XVH A;  4B1B A;  4J34 A;  3DJG X;  3UKP A;  3UTH A;  3C4A A;  2RGJ A;  4H4R A;  3JSK A;  4K5R A;  1E6E A;  4NZH A;  5J60 A;  2C75 A;  1IUS A;  2A87 A;  3CMM A;  1H82 A;  2PYX A;  4H7U A;  3EF6 A;  4EQS A;  1NHQ A;  4U8J A;  2R46 A;  1PJ6 A;  4H2P A;  3UKL A;  3KA7 A;  4YTP A;  1TYT A;  4AOS A;  1RSG A;  5KMS A;  3P1W A;  2R0C A;  3K7Q X;  2R4E A;  3CNJ A;  2B76 A;  3LZW A;  4BK1 A;  3UP4 A;  2X8G A;  3ATR A;  1TRB A;  3CNT A;  3NNE A;  3UOV A;  1M64 A;  4Y4L A;  4EQX A;  4IVO B;  1NDA A;  3GDN A;  4U2T A;  4U8K A;  4XWZ A;  2IVE A;  2VOU A;  4DNA A;  3GWD A;  3I3L A;  5CKU A;  4Z43 A;  2YVG A;  2XVE A;  1NG3 A;  4KPR A;  3NK0 X;  3QVR A;  1OJT A;  1Q1W A;  1PBD A;  2OAL A;  2APG A;  2WET A;  5M0Z A;  4C3X A;  2I0Z A;  1O95 A;  1GRB A;  3RP7 A;  2BCP A;  5J7X A;  1NHS A;  1BF3 A;  1KSU A;  4TLZ A;  4CCR A;  4EIP A;  3VRB A;  1H2I A;  2H89 A;  1EL8 A;  2WES A;  4C3Y A;  3GSI A;  3QSE A;  1ONF A;  1K0J A;  3UTE A;  3KU9 A;  3DA1 A;  1PJ7 A;  2W0H A;  3F8D A;  2ZZ0 A;  2A8X A;  2YR6 A;  3AYJ A;  4B68 A;  2YVJ A;  4FK1 A;  1ZY8 A;  3SYI A;  3QVP A;  4Z2T A;  3NTD A;  3SZF A;  2BS4 A;  2CVJ A;  1B8S A;  3GDP A;  4ZCC A;  5KOW A;  1N4V A;  1PHH A;  3AYI A;  4NEV A;  2TPR A;  3SZC A;  4EMJ A;  2BRA A;  2E5V A;  3DK8 A;  5JCM A;  3T0K A;  5U25 A;  1COY A;  4RG3 A;  1BZL A;  4J56 A;  3SFD A;  3T2Y A;  3K7M X;  3VRD B;  1ZKQ A;  3AE6 A;  4JY2 A;  3DK4 A;  2BS2 A;  3SZ0 A;  4Z26 A;  1XAN A;  3QFB A;  4XXG A;  4G73 A;  1BGN A;  4YSX A;  1V59 A;  2B7S A;  1GRE A;  3B3R A;  4J2W A;  3BI4 A;  5EB4 A;  2AAQ A;  2R9Z A;  3AXB A;  3NN0 X;  3WE0 A;  3GRT A;  1CJ4 A;  2GH5 A;  3VR9 A;  2YG5 A;  4ADW A;  3PO7 A;  1EL7 A;  1YKJ A;  1YQ4 A;  4B66 A;  3CIR A;  3F8P A;  2GQW A;  5U63 A;  4TM1 A;  2FJB A;  2JAE A;  4G74 A;  4YXD A;  2GF3 A;  3SQP A;  4U8M A;  2ARD A;  1Q1R A;  3KKJ A;  4B64 A;  3E1T A;  3GMC A;  2V60 A;  4HB9 A;  3AD7 B;  4M52 A;  2V5Z A;  3LXD A;  3KD9 A;  4IV9 A;  3S5W A;  4CCQ A;  4C74 A;  3KVE A;  4H4X A;  1D4C A;  1OJC A;  4GF7 A;  5FMH A;  3NTA A;  3VRA A;  1VRQ B;  1K4Q A;  5KVH A;  1L0V A;  2QAE A;  2WS3 A;  2YG3 A;  4Y4N A;  5JRB A;  2BS3 A;  1LQU A;  4OPC A;  2GR1 A;  2AQJ A;  3R9U A;  1GPE A;  2PHH A;  3GRS A;  4UDP A;  3UTF A;  4Z2R A;  4TM0 A;  4H4V A;  2BK3 A;  3M12 A;  5FS9 A;  1QLB A;  1P2E A;  4ZN0 A;  1GER A;  2FBW A;  2WPC A;  3CPH G;  2XFP A;  4CY8 A;  3P4Q A;  4OPD A;  4GCM A;  2FJE A;  4OPG A;  4U8L A;  1L9E A;  1IUU A;  4K5S A;  2WU2 A;  2AR8 A;  3KLJ A;  4JN9 A;  4ECH A;  1JRZ A;  2C67 A;  4ICY A;  4CRT A;  1ZDL A;  2XLS A;  2WP5 A;  1DOE A;  2C3C A;  2VZ2 A;  1GAL A;  3QJ4 A;  2BAB A;  2XCG A;  4EM4 A;  1KF6 A;  2WDQ A;  1EL5 A;  1GRF A;  2J3N A;  1KNR A;  4GUV A;  2XFN A;  4IA5 A;  3AEB A;  2YLZ A;  2VVL G;  3IF9 A;  3P9U A;  5KOX A;  2JKC A;  2VQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...