2NVKX

Crystal structure of thioredoxin reductase from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
481
structure length
481
Chain Sequence
YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Thioredoxin Reductase
publication title Structural and Biochemical Studies Reveal Differences in the Catalytic Mechanisms of Mammalian and Drosophila melanogaster Thioredoxin Reductases.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 154
structure length 481
sequence length 481
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
X PF00890 FAD_binding_2 FAD binding domain
X PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2nvkX03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX02
4GR1A 3BI4A 2R0PA 3NRNA 1NHQA 4RG4A 3DJDA 2V3BA 2C70A 2FJBA 4UDRA 4IVOB 5BVAA 3NN0X 3UKAA 1PDHA 5KVIA 3PS9A 1LJ1A 2WESA 4BV6A 3RP8A 4U8NA 2GR1A 1LVLA 2R9ZA 4B66A 5HXIA 2WP9A 3AE3A 4HA6A 2BK4A 2YWLA 3COXA 3GMBA 3AEFA 2ACZA 2VRMA 4Y4NA 5TR3A 1P2EA 3CNJA 1GERA 1GSNA 4IVMB 3UP4A 3UTHA 1FL2A 4B63A 3CNPA 1ZOYA 2WBAA 3DA1A 4A6NB 1GRAA 3UP5A 4GCMA 4J56A 1CBOA 1S2YA 3QVPA 2X99A 2YLSA 5KWFA 2QA1A 4ICYA 2HQMA 4EMIA 4UDQA 4C5OA 2OALA 2WOVA 3G5SA 1TDFA 5CKUA 3KD9A 4YXDA 3UKKA 4Z26A 4CCQA 1K0JA 4ZCCA 1KDGA 4U8IA 4YSHA 3H8IA 3K30A 2XLUA 2YLWA 2ZZCA 3BHFA 3NYFA 1X31B 3AE7A 1VG0A 3G5RA 4YSYA 2GMJA 4CY6A 4EIPA 5U1OA 3DJEA 4H4PA 1ZMCA 3FG2P 2YG7A 3CNSA 5M0ZA 4EQXA 1BZLA 4GF7A 1KNRA 1PXBA 2BC0A 2AR8A 2GVCA 1GRTA 3CNDA 3UCLA 1E7PA 2XVIA 3DGZA 4A99A 3G5QA 3KLJA 1Q1RA 1H7XA 3ICSA 5DBJA 4B68A 1LTXR 2R45A 4BK3A 2R46A 2E4GA 1NDAA 2WU2A 3UKHA 4ZN0A 1YY5A 1GRFA 4RG3A 2RGHA 1NHRA 2WP5A 1QLBA 1F8RA 3NNEA 3EAOA 4YWOA 2V5ZA 2CDUA 3NLCA 2XLRA 1NG3A 1MO9A 2GR2A 4Y4LA 1F8WA 1K0IA 4ADWA 1D4EA 2GRTA 3UKFA 5GSNA 4EIQA 4H2PA 2BS4A 3ABVA 3RHAA 2E5VA 2IIDA 1PBBA 2YG4A 5JCMA 1CF3A 5M10A 4H4ZA 5J60A 4H4SA 4B67A 1VDCA 4CNKA 4FX9A 3L1RA 3PVCA 1GPEA 4J57A 4B69A 3F8PA 3C96A 1BGNA 1EL5A 3CTYA 4C74A 4ZCDA 4X4JA 3GRSA 4CNJA 3VQRA 2E1MA 3ALJA 3AEEA 1ZX9A 3NTAA 1GRGA 2WDVA 2XLPA 2YG5A 1NPXA 1F6MA 2WQYA 3S5WA 5C3JA 4A5LA 1D7LA 4WX1A 3LOVA 3NT6A 1PS9A 3P9UA 5J7XA 1GXFA 4BJZA 4K5RA 3ALLA 4D03A 1GT8A 3NG7X 2VVMA 1BKWA 1CL0A 2GMHA 4JY3A 5HHFA 1ZKQA 1QJDA 2GR3A 1JNRA 3D8XA 3FIMB 2CULA 1S3EA 4FDCB 3Q6JA 1TDKA 4H7UA 2WDRA 3PO7A 3BI5A 5JCKA 4H4XA 1OJTA 2YR6A 3HZLA 1E6EA 3URHA 2BA9A 2Q6UA 2GEWA 1FCDA 2RGOA 1GTHA 3AXBA 4AP1A 3P4QA 3UOYA 4YKGA 1PXAA 2PYXA 4AOXA 4XXGA 2DKIA 1MXTA 1NENA 2VVLA 1DODA 2VQBA 2QAEA 1B8SA 3QSMA 2XFOA 3IC9A 3ZDNA 2TPRA 5JCIA 5L46A 1Q1WA 1E1KA 1Y56B 4EM4A 3I6DA 4B1BA 3ICRA 2XYOA 3KKJA 2IVDA 3V3NA 1CJCA 2QA2A 1L9DA 2YVGA 4K5SA 3UKLA 1KSSA 2GAHB 1Q9IA 3D1CA 3LZWA 1O94A 3VRAA 4JQ9A 1KF6A 4DNAA 2C67A 2YG3A 4NTCA 1M64A 4IA5A 1K4QA 1JU2A 5KVHA 3B3RA 3ITJA 2VZ2A 4EMJA 2JB3A 2A89A 2WS3A 2YM2A 3IWAA 1CJ3A 1UKVG 5C2TA 2R0GA 5FS6A 2V6OA 1B37A 3CGCA 2FJEA 2R0CA 1DOCA 3AD9B 3AE6A 3ZYXA 4BK1A 3L8KA 2Q0KA 4WCTA 2C75A 4YTNA 4HB9A 2WEUA 1HYUA 3ICTA 3OZ2A 2FJAA 3IF9A 1NG4A 1IUSA 4OVIA 2JKCA 2YLRA 3AE5A 4H2NA 3DH9A 4O5UA 1W4XA 3FPZA 4OPGA 4TM4A 4U8JA 3LB8A 2YVJA 2WPFA 1YQ4A 1ELIA 2X8HA 1DJNA 1OJAA 3P4PA 4A7AA 4C3XA 3BNMA 5ER0A 1Y0PA 2BC1A 2XLTA 3BHKA 3C4AA 1PBCA 5FS9A 3FMWA 3JSKA 4NTEA 1REOA 4TM0A 4LU6A 1RP0A 3QJ4A 2C73A 3GYIA 2XVHA 4X9MA 3GWFA 3M0OA 3GSIA 1CJ2A 1GV4A 5FS8A 4KPRA 4Z43A 2QCUA 3AEBA 1PXCA 4USQA 4H2QA 4Z25A 1TYTA 1JOAA 4I58A 3VR8A 5EBKA 1PBDA 4Z2RA 1V59A 4NEVA 2C3CA 2OA1A 4X9NA 4J36A 4GRTA 3ADAB 3CIRA 4UP3A 2EQ9A 4FK1C 4IA6A 2C72A 2C64A 1N4UA 2BXSA 1GTEA 2R4JA 4Z44A 3WE0A 1KSUA 1H86A 1BWCA 1GETA 2C7GA 1O95A 4K8DA 3UTFA 3AD7B 3GRTA 4AP3A 5FS7A 1RSGA 3GDNA 1CC4A 1CC2A 2VVLG 2WU5A 1PBFA 4YTPA 4TM3A 3CNTA 4U8MA 2B9YA 3K7TA 1ZMDA 2GH5A 1O5WA 3DJJA 3OC4A 2XCGA 2XLSA 4YTMA 4EM3A 2JK6A 2F5ZA 2BS3A 2WPEA 1Y56A 3RP7A 3H4KA 1EBDA 1JRXA 1L9CA 1N4VA 3LADA 1DJQA 1OJCA 1EL8A 5EB5A 2B7SA 2ZBWA 1OJDA 3DGHA 4K7ZA 2Y6QA 3GDPA 3P4SA 1COYA 1VRQB 2YVFA 4TLZA 5BRTA 3IHGA 3GWDA 4EQWA 2A87A 4XWRA 1TDNA 3KA7A 1RYIA 2XVEA 1FOHA 3KVEA 2GAGB 3DK9A 4YSXA 4TLXA 4J33A 3M12A 1NHPA 5FMHA 1GRBA 3SQPA 4K2XA 2O9ZA 1H81A 1IJHA 4U2LA 4A6NA 4USRA 3LZXA 4EMWA 2BCGG 1FEBA 1ZP0A 1CC6A 2C76A 2YLZA 3KU9A 4MJWA 4P9SA 1ZK7A 2FJDA 2XFUA 4Z24A 3NN6X 2C66A 1YQZA 5JCLA 3UKQA 2J3NA 4JNQA 1P2HA 4H4TA 5CQFA 2WOIA 4LIIA 3R9UA 4JY2A 2YLTA 1DOEA 3Q9TA 4U8KA 4YSZA 1LQTA 4H4WA 1EL7A 2X50A 3NKSA 4REKA 1IUXA 2A8XA 3BI2A 1VQWA 4OPTA 3AECA 3VRDB 3UKPA 4A79A 4KX6A 2JB1A 4U8LA 4AT2A 4E0VA 2NVKX 2XFNA 3B6DA 4BK2A 2V3AA 1JRZA 3QVRA 1PBEA 4OPCA 3UOZA 4D04A 3DMEA 1GALA 2C65A 4NTDA 4AT0A 3ALMA 4DSHA 1FEAA 2FBWA 2RABA 4H2RA 3NYCA 4OPLA 1K0LA 3BNUA 3CPJG 4PAAA 1YQ3A 1N1PA 3UTEA 3SM8A 5EB4A 3QFBA 3SFEA 2YR4A 2C3DA 4CRTA 1PHHA 2YLXA 4H4YA 2B7RA 1D7YA 3QFAA 4OPUA 2VRLA 2X8CA 1NAAA 2GV8A 3ATRA 4H4QA 3DK4A 4OPIA 2Y6RA 2B76A 4C3YA 2WPCA 3REDA 3UOXA 2B9WA 3CPHG 3P1WA 1D5TA 2ZZBA 1S2QA 1XPQA 5KXJA 1DXLA 2EQ7A 3I3LA 3M13A 2WETA 2NPXA 3AYJA 1TRBA 4GUVA 1GREA 1PJ6A 2BABA 3NIXA 2GR0A 3LXDA 4H4UA 1H82A 1E39A 5KOXA 2GQWA 2EQ6A 2YAUA 1CJ4A 1PJ5A 2YR5A 3AD8B 5BUKA 1XANA 3CPIG 3VR9A 1ONFA 4H4VA 3P4RA 2CVJA 1S3BA 3ATQA 3O0HA 3C4NA 2GF3A 2X3NA 3NYEA 4YKFA 1IUUA 1E1LA 2EQ8A 1KFYA 4GDPA 4CY8A 2BK3A 3EPTA 4CCRA 1JRYA 1F8SA 2DKHA 4JNAA 4TM1A 3EF6A 3AE1A 5HY5A 1BGJA 4JN9A 3VRBA 3AWIA 1PN0A 2YM1A 4J31A 3NHOX 3RNMA 1GESA 3UOVA 4M52A 1JNZA 2XVJA 1D4CA 3V3OA 2Z5YA 2XFPA 1JEHA 1XDIA 4N9XA 3AEAA 4NZHA 3EANA 2UZZA 2Q0LA 1GNDA 3RP6A 5LV9A 2CFYA 1IUWA 4AOSA 4CBQA 4J34A 1E1NA 2WHDA 3AYIA 2H88A 4ECHA 4FK1A 2H89A 2BYBA 3ISHA 4B65A 4EQRA 2WDQA 3F8RA 4GDEA 4OCGA 5JCNA 4H4RA 2RGJA 2YG6A 3E1TA 1F3PA 3CN8A 2BCPA 1ZDLA 1KNPA 2APGA 4DSGA 4Y4MA 3NK1X 2IVEA 2WOWA 4I59A 2GQFA 3GYJA 1BF3A 3QSEA 4U2TA 5BULA 4U8PA 5IPYA 2X8GA 1GOSA 3AB1A 3DK8A 1AOGA 2VQ7A 2XFQA 2AQJA 2BXRA 4YT0A 3SGLA 4BURA 2JB2A 3NTDA 2VOUA 3GD4A 4EQSA 4DGKA 4J2WA 4Z2UA 2TMDA 5HYMA 5KOWA 2ARDA 1TDOA 1LV0A 3II4A 4UDPA 2V60A 1DOBA 1TYPA 1GEUA 2OLOA 4LA1A 2Q7VA 3CGDA 3F8DA 3H8LA 4RSLA 3K7QX 1L9EA 4APNA 1PJ7A 2OAMA 3FBSA 1FECA 1YKJA 1TDEA 4K22A 1SEZA 5U25A 3AE4A 2JBVA 1OJ9A 3NGCX 2R4EA 4IV9A 2V61A 1N4WA 3NK2X 4U2SA 5IQ1A 4NEWA 2WP6A 2YQUA 4H50A 2BACA 2BK5A 2Z5XA 1D4DA 4XWZA 2PHHA 1B4VA 4O5QA 1ZOVA 1E1MA 4U8OA 5IQ4A 3DJGX 4BJYA 3AEDA 4Z2TA 2XDOA 3AYLA 5GRTA 5EOWA 3AEGA 4A9WA 3CGBA 3GD3A 4JDRA 2B9XA 3QSSA 2W0HA 1H84A 1H7WA 2GB0A 3CGEA 3S61A 3KPFA 3T37A 2AAQA 3UTGA 3LJPA 5U63A 1B5QA 1NEKA 3K7MX 1M6IA 1ZY8A 3AE8A 2XVFA 1MOKA 3V76A 3AE2A 1NHSA 2OLNA 1LQUA 1XHCA 4PABA 1H6VA 1LPFA 1L0VA 1CHUA 1IUTA 3NK0X 5KRQA 2BS2A 1VG9A 4OPDA 2JAEA 1IUVA 1EL9A 4A65A 2I0ZA 1Z6LA 2ZZ0A 3IHMA 4B64A 3NH3X 3AE9A 4C77A 1DNCA 1QO8A 1GRHA 3SFDA 1H83A 3GMCA
chains in the Genus database with same CATH superfamily
3OW1A 1NHQA 2V3BA 2C70A 2FJBA 3UKAA 1PDHA 2OZ8A 4BV6A 1X2GA 3CMMA 2R9ZA 4B66A 2YWLA 3AEFA 2ACZA 4GMEA 4B63A 3CNPA 3FCPA 2WBAA 3ZVIA 1CBOA 2DW6A 3QVPA 2YLSA 5KWFA 4ICYA 4UDQA 2BRYA 1TZZA 3G5SA 4Z26A 1SB3B 4J1OA 1KDGA 4HNCA 4X2PA 3BHFA 3AM9A 3R0KA 4CY6A 4H4PA 4J3ZA 3CNSA 2BC0A 2AR8A 1GRTA 3CNDA 3TWAA 1WUEA 4NWZA 2GGGA 3ICSA 1YEYA 1LTXR 3T4WA 2WU2A 4II3A 1XS2A 4HPNA 4RG3A 2E5AA 1F8RA 4Y4LA 2RDXA 4ADWA 3SY4A 4TVWA 2GRTA 3ABVA 4G6GA 2YG4A 4K8GA 4H4SA 4CNKA 1GPEA 1BGNA 3GRSA 3VQRA 2E1MA 3RCYA 4GIRA 3UXKA 3NT6A 4BJZA 1GXFA 2VVMA 1BKWA 1CL0A 3ZLGA 2GR3A 3FIMB 1KCZA 3Q6JA 2PSNA 1TDKA 3BI5A 5JCKA 2YR6A 1OJTA 5KMPA 1FCDA 3AXBA 1PXAA 2PYXA 5IDZA 2VVLA 3DIPA 1B8SA 5JCIA 3NVVB 2HXTA 1Q1WA 3CB3A 3I6DA 3KKJA 1CJCA 2YVGA 2I5QA 1Q9IA 3T31A 4KPLA 1K4QA 4GISA 2A89A 2WS3A 3EEZA 2V6OA 1B37A 3ZYXA 4BK1A 2Q0KA 4WCTA 4HB9A 1HYUA 3SSZA 2JKCA 3DG3A 3FPZA 2YVJA 3B97A 2X8HA 1OJAA 3P4PA 3BNMA 2BC1A 5FS9A 3JSKA 3L5OA 4TM0A 4X9MA 2QCUA 2HNEA 1JOAA 1PBDA 1V59A 4NEVA 2C3CA 4J36A 3ADAB 3CIRA 2C4CA 2EQ9A 4FK1C 3R0UA 2BXSA 3WE0A 1BWCA 1O95A 3DFYA 3SBFA 3AD7B 3GRTA 2VVLG 2WU5A 3PWGA 3H8AA 4U8MA 2B9YA 2GH5A 2XCGA 2JK6A 2MUCA 1EBDA 1JRXA 1N4VA 1OJCA 1EL8A 3JZUA 4GFIA 4HCHA 3DGHA 4MKSA 3VC6A 3N6HA 4XWRA 4FP1A 3KVEA 3SZWA 4GYPA 2GDQA 3M12A 1GRBA 4A6NA 3UJEA 3AMZA 4EMWA 4H83A 1FEBA 1ZP0A 4Z24A 2C66A 1YQZA 3UKQA 2J3NA 5CQFA 4ROPA 3R9UA 1DOEA 4YSZA 3NKSA 4REKA 1IUXA 1MNSA 4OPTA 3UKPA 4A79A 4IZGA 4KX6A 2QJNA 3QVRA 1JRZA 4D04A 2PCEA 4AT0A 4DSHA 4PAAA 3AN1A 3QFBA 5BOFA 4H4YA 2B7RA 1NAAA 2OQYA 4OPIA 3OZMA 4C3YA 2WPCA 2P8BA 1WYGA 1D5TA 2ZZBA 1XPYA 3M13A 1EBHA 2WETA 2NPXA 3AYJA 1TRBA 1RM6B 1GREA 1BKHA 1E39A 5KOXA 2GQWA 5BUKA 1PJ5A 3UJSA 1XANA 2POZA 1ONFA 3RR1A 4E4UA 3ATQA 3O0HA 4YKFA 2EQ8A 4CCRA 4HCLA 1JRYA 4IP5A 4JNAA 3AE1A 4JN9A 3AWIA 2YM1A 1V97A 1JNZA 2XVJA 1D4CA 5FJOA 2QGYA 5FJUA 1WUFA 7ENLA 3VA8A 4NZHA 1SJAA 4AOSA 3AYIA 3R10A 3F8RA 2RGJA 2YG6A 1ECQA 1F3PA 3CN8A 1ZDLA 2APGA 4Y4MA 2IVEA 2GQFA 3QSEA 1BF3A 4U2TA 2VQ7A 4GAPA 3SGLA 3VCNA 4DGKA 4J2WA 2O56A 4UDPA 1DOBA 3T0KA 2PP3A 3HRDC 1FHUA 4IT1A 3S47A 3DESA 4APNA 3CAWA 4K22A 1SEZA 3NK2X 2Z5XA 2XH2A 3BSMA 1B4VA 2AL2B 1ZOVA 3DJGX 4Z2TA 2XDOA 4TVYA 5EOWA 3AEGA 4A9WA 3CGBA 3GD3A 4JDRA 1H84A 3CGEA 3KPFA 1B5QA 3K7MX 1EC7A 1M6IA 3VDGA 3DDMA 2P88A 1FHVA 1NHSA 4PABA 1P48A 3CXBA 4GGHA 3DG6A 1EL9A 4A65A 1R6WA 3T2KA 3AE9A 1DNCA 3ZLHA 1EC9A 1QO8A 3TJIA 3BI4A 2R0PA 2QJJA 4IVOB 3PS9A 1LJ1A 5HXIA 4DWDA 3COXA 3R25A 5TR3A 3SZ0A 1P2EA 1GERA 3HPFA 1L8PA 1FL2A 3DA1A 4GCMA 3KUMA 2BRAA 2HQMA 4YXDA 3V5FA 1K0JA 1FFVC 4U8IA 3K30A 2YLWA 3AE7A 1VG0A 4YSYA 5U1OA 3DJEA 2YG7A 1S7MA 5M0ZA 1PXBA 3G5QA 3T2ZA 1Q1RA 4IL2A 1TE6A 1NDAA 3QPEA 1NHRA 2WP5A 2XGZA 3EAOA 2CDUA 3NLCA 1MO9A 3FV9A 3IJLA 1N60C 1K0IA 3GD6A 3UKFA 2HZGA 2QQ6A 2E5VA 3CXOA 1CF3A 4H4ZA 4B67A 1VDCA 3L1RA 3F8PA 3C96A 3VC5A 2QVHA 4X4JA 4MGGA 4CNJA 3AEEA 1ZX9A 3NTAA 4H1ZA 1GRGA 1F6MA 3SYIA 3JW7A 5C3JA 4A5LA 3NO1A 1D7LA 3LOVA 3P9UA 3ZVHA 2GMHA 5HHFA 1ZKQA 1JNRA 4H19A 1S3EA 4H7UA 1SJBA 3HZLA 3FYYA 2Q6UA 3QN3A 4XXGA 2VQBA 3ZDNA 2TPRA 3ICRA 2XYOA 2QA2A 3LZWA 1O94A 3VRAA 4JQ9A 2C67A 3RGTA 1M64A 4HN8A 1JU2A 2VZ2A 4EMJA 2QJMA 2YM2A 1CJ3A 1UKVG 2R0CA 2P3ZA 4ZOHB 4YTNA 1IUSA 4H2NA 4O5UA 4OPGA 1W4XA 4U8JA 1PDZA 2WPFA 1YQ4A 1ELIA 5ER0A 2XLTA 4NTEA 2GGJA 2C73A 2XVHA 3GWFA 3RO6A 2QDDA 4I58A 3N4EA 4X9NA 3DEQA 4G6HA 2OPJA 2PP0A 2C72A 3NVZB 4AP3A 5FS7A 1RSGA 1CC4A 2GGIA 3CNTA 3K7TA 1ZMDA 1O5WA 1F9CA 3OP2A 3OC4A 2XLSA 4EM3A 3QKEA 2BS3A 2WPEA 2GGHA 3LADA 3NVWB 2ZBWA 2E3TA 4K7ZA 1COYA 4TLZA 3R11A 2A87A 3DK9A 1NHPA 5FMHA 3SQPA 4K2XA 2W54A 1IJHA 4U2LA 4E6MA 5FJPA 2PODA 2GL5A 3LZXA 2BCGG 2C76A 2YLZA 3KU9A 2GSHA 1ZK7A 1NU5A 3N4FA 4JNQA 1P2HA 4H4TA 2WOIA 1SJDA 3T9PA 2YLTA 4JY2A 2OFJA 1EL7A 5KMRA 2OO6A 4AT2A 3B6DA 1GALA 4DXKA 4NTDA 3ALMA 1FEAA 2FBWA 5FJRA 1K0LA 3MUCA 3CPJG 3SM8A 3TOYA 3SFEA 2YR4A 1D7YA 3QFAA 2VRLA 2X8CA 2OLAA 3REDA 2B9WA 1XPQA 5KXJA 2EQ7A 3I3LA 4GUVA 1PJ6A 4KWSA 3LXDA 2NQLA 2OX4A 2YAUA 4K1WA 3AD8B 1N5XA 3C4NA 4MMWA 3NRZB 1FFUC 1E1LA 1KFYA 3A7RA 5HY5A 3UXLA 4J31A 3NHOX 3RNMA 4M52A 3V3OA 3PWIA 5J04A 2Z5YA 1ONEA 3ETRB 1GNDA 5LV9A 1IUWA 3DG7A 4ECHA 3K1GA 4IP4A 3ISHA 2BYBA 4B65A 2XSXA 4EQRA 5JCNA 3I6TA 2WOWA 3GYJA 5BULA 2PTYA 5IPYA 4H2HA 3AB1A 4DX3A 3DK8A 2XFQA 1P43A 2VOUA 6ENLA 1TDOA 2V60A 2OLOA 2Q7VA 3CGDA 3FBSA 2OAMA 1YKJA 2JBVA 2HXUA 1OJ9A 4U2SA 3S5SA 4H50A 2BACA 1D4DA 4JN7A 5FJTA 1E9IA 2CHRA 3AEDA 4BJYA 3NZGA 3SZFA 3QSSA 3T37A 2AAQA 3ZLFA 3LJPA 5U63A 2W3RA 2XVFA 3SZCA 1LQUA 3UJ2A 3NK0X 5KRQA 1VG9A 4OPDA 1IUVA 1Z6LA 3IHMA 4B64A 3NH3X 4GR1A 3VFCA 1STZA 3NRNA 3H70A 4Z17A 4RG4A 2W3SA 5KVIA 3RP8A 4U8NA 2GR1A 2QDEA 4FI4A 3AE3A 2BK4A 1BQGA 1JROA 2VRMA 4IVMB 2PTWA 3UP4A 1ZOYA 3RITA 5KMQA 4A6NB 1ELSA 1S2YA 2X99A 4EMIA 2WOVA 3KD9A 3UKKA 4CCQA 4G7FA 3H8IA 2XLUA 3NYFA 2GMJA 4EQXA 1BZLA 4GF7A 2GVCA 3TTEA 2FKPA 1E7PA 2XVIA 3UCLA 3T2YA 3DGZA 3KLJA 5DBJA 4B68A 2R45A 2R46A 2E4GA 4II2A 3UKHA 1YY5A 3SN4A 1N5WC 1QLBA 3NNEA 2V5ZA 2XLRA 1NG3A 2GR2A 4G8TA 1F8WA 1MDLA 2PTXA 2DW7A 5GSNA 2BS4A 3RHAA 5JCMA 3I4KA 2ZC8A 4J57A 3CYJA 4F4RA 1EL5A 3CTYA 4C74A 4ZCDA 1SJCA 3H7VA 3ALJA 2ONEA 2XLPA 2YG5A 1NPXA 3S5WA 4WX1A 5J7XA 4D03A 4K5RA 3ALLA 1MRAA 1GT8A 1QJDA 3MZNA 2CULA 4FDCB 2WDRA 1FO4A 2XH0A 3PO7A 3CK5A 1E6EA 3URHA 4IHCA 2BA9A 2GEWA 3UOYA 3DERA 1MXTA 3QSMA 2XFOA 1KN0A 1Y56B 1E1KA 4EM4A 4B1BA 2IVDA 1L9DA 1FIQB 2GAHB 3D1CA 1KF6A 1EBGA 3EKGA 4DNAA 3Q4DA 5KVHA 3ITJA 3IWAA 3HYXA 3CGCA 2FJEA 1DOCA 3AD9B 2MNRA 5ENLA 2C75A 2WEUA 3OZ2A 2FJAA 3IF9A 4OVIA 3AE5A 2YLRA 4TM4A 3T8QA 1X2HA 3LB8A 4A7AA 4C3XA 3R1ZA 3IJIA 1Y0PA 3BHKA 3C4AA 3MSYA 1REOA 1RP0A 3QJ4A 1OEPA 3M0OA 2PPGA 3GSIA 1GV4A 5FS8A 4USQA 3VR8A 4G9KA 5EBKA 2OA1A 4GRTA 4UP3A 3FJ4A 4Z1YA 2ZADA 1GTEA 3U4FA 2C7GA 1MUCA 3UTFA 2AL1A 2PGWA 3GDNA 1CC2A 3UJRA 1PBFA 4YTPA 3SQSA 3DJJA 3PK7A 2F5ZA 3QLDA 3H4KA 4IL0A 1L9CA 5EB5A 2B7SA 2Y6QA 2YVFA 3GY1A 5BRTA 3IHGA 3GWDA 1FOHA 4YSXA 2XH4A 4HCDA 4MJWA 2GGEA 4P9SA 3NVYB 2XFUA 3IJQA 3NN6X 2PS2A 5JCLA 3T14A 4M6UA 4LIIA 2PMQA 1LQTA 2X50A 3BI2A 3VRDB 3I6EA 4E0VA 2NVKX 2W55A 2XFNA 2V3AA 4OPCA 5G5HB 3DMEA 2C65A 4NNJA 3CT2A 1JPDX 1YQ3A 5EB4A 4OPUA 3ATRA 4H4QA 2B76A 2PU0A 3UOXA 3BOXA 3P1WA 4K2SA 3Q45A 3EUB3 3NIXA 2GR0A 4H4UA 3SN1A 1CJ4A 2YR5A 3SXIA 4H4VA 3P4RA 1S3BA 2X3NA 3NYEA 4A3RA 3MY9A 2BK3A 3EPTA 2DKHA 3EF6A 3THUA 3B9JB 3R07C 1BGJA 1GESA 3UOVA 3ZVHB 1JEHA 1XDIA 4N9XA 3GO2A 3AEAA 2UZZA 2Q0LA 3RP6A 4CBQA 1E1NA 2H89A 4OCGA 1EC8A 3E1TA 4DSGA 1KNPA 4U8PA 1GOSA 3KPKA 1AOGA 4YT0A 4BURA 2JB2A 2OZ3A 3JVAA 2PA6A 4EQSA 2TMDA 5HYMA 5KOWA 2OG9A 2ARDA 1LV0A 3II4A 3FXGA 2FYMA 3F8DA 1VDVA 4RSLA 3H8LA 3K7QX 2OVLA 1L9EA 1JPMA 2PGEA 5U25A 3AE4A 2OZTA 3NGCX 4IV9A 1N4WA 4E8GA 2WP6A 2BK5A 4XWZA 2PHHA 4O5QA 1DTNA 3V5CA 3AYLA 3SN0A 3ES8A 5GRTA 1KKOA 1PDYA 1NEKA 1ZY8A 3AE2A 1XHCA 4YWSA 1L0VA 1LPFA 1IUTA 2BS2A 3UJFA 3H12A 3UCDA 1JRPA 4C77A 1H83A 3TW9A 3GMCA 3DJDA 3RRAA 4UDRA 5BVAA 3NN0X 4ZA0A 2WESA 1LVLA 2WP9A 4HA6A 3GMBA 4Y4NA 1VQZA 3CNJA 1GSNA 1W6TA 3UTHA 3N6JA 1GRAA 3UP5A 4J56A 2PTZA 3UGVA 2QA1A 4C5OA 2OALA 3VCCA 5CKUA 1TDFA 3U9IA 4ZCCA 4YSHA 2ZZCA 5G5GB 1X31B 3G5RA 3TWBA 4EIPA 1TKKA 1ZMCA 3FG2P 3GC2A 2AKMA 1KNRA 5EU9A 4A99A 1RVKA 1H7XA 3BJSA 3D46A 4BK3A 4ZN0A 1GRFA 4E5TA 2RGHA 4G74A 4YWOA 1T3QC 1D4EA 1NELA 4EIQA 4H2PA 4M0XA 2IIDA 1PBBA 5M10A 1N61C 5J60A 4FX9A 4A6GA 3PVCA 3MWCA 4B69A 1KKRA 3A7UA 4GGBA 4DN1A 2WDVA 2WQYA 1PS9A 1ZXIC 5JRBA 3NG7X 4JY3A 5KMSA 3D8XA 3P93A 1MDRA 3P3BA 4H4XA 2PU1A 3QTPA 2RGOA 4AP1A 1GTHA 3P4QA 4YKGA 4ENLA 4AOXA 2P0IA 2DKIA 3MQTA 1NENA 1DODA 2QAEA 3IC9A 1IYXA 5L46A 3V3NA 4K5SA 3UKLA 1KSSA 2YG3A 4NTCA 4IA5A 3B3RA 2JB3A 5C2TA 2R0GA 5FS6A 3AE6A 3L8KA 3T6CA 3ICTA 1NG4A 3DH9A 2AL2A 3TQPA 1DJNA 4HNLA 3D9XA 1PBCA 3FMWA 1JCTA 4LU6A 3GYIA 4ZCWA 1CJ2A 4KPRA 4Z43A 3AEBA 3DFHA 1N63C 3V4BA 1PXCA 4H2QA 1TYTA 4Z25A 4Z2RA 4KEMA 2AKZA 4IA6A 3TCSA 2C64A 1N4UA 2R4JA 4Z44A 1KSUA 1H86A 1H2IA 1GETA 4K8DA 5KNLA 4TM3A 4YTMA 3HYVA 1Y56A 4E4FA 3RP7A 4JN8A 1DJQA 1OJDA 2OQHA 3GDPA 3P4SA 1VRQB 2OKTA 4KT2A 4EQWA 1TDNA 3KA7A 1RYIA 2XVEA 2GAGB 4TLXA 4J33A 3NFUA 4EWJA 1H81A 2O9ZA 4USRA 1CC6A 3V3WA 2FJDA 3Q9TA 4U8KA 1N62C 4H4WA 2A8XA 1VQWA 3AECA 2JB1A 4U8LA 4BK2A 1PBEA 3UOZA 3STPA 2RABA 3SR6B 4H2RA 3NYCA 4OPLA 2PP1A 3BNUA 1N1PA 3UTEA 1JDFA 2C3DA 4CRTA 1PHHA 2YLXA 2GV8A 3DK4A 2Y6RA 3CPHG 3NXLA 4A35A 1S2QA 1DXLA 3HYWA 2BABA 3NS1B 1H82A 3FVDA 3TJ4A 2EQ6A 3OTRA 3CPIG 4JHMA 3VR9A 2CVJA 2GF3A 1IUUA 4GDPA 4CY8A 3SJNA 1F8SA 4TM1A 3SX6A 3VRBA 3DGBA 1PN0A 4GAVA 2XFPA 3PG6A 3EANA 2CFYA 4J34A 2WHDA 2H88A 4FK1A 2WDQA 4GDEA 4H4RA 3OZYA 2BCPA 3NK1X 4I59A 3OPSA 3A7AA 2X8GA 3HW2A 2AQJA 2BXRA 3NTDA 3GD4A 2P8CA 4Z2UA 2XH7A 4G73A 1TYPA 1GEUA 4LA1A 4DHGA 1R0MA 3IK4A 1PJ7A 1FECA 1TDEA 4GYPC 3D47A 2R4EA 5IQ1A 2V61A 4NEWA 2YQUA 4DYEA 3P0WA 4U8OA 1E1MA 5IQ4A 3GYXA 3UCCA 2B9XA 2W0HA 1H7WA 2GB0A 3S61A 3ENLA 4HYRA 3UTGA 3AE8A 1MOKA 3V76A 3MKCA 2OLNA 1H6VA 1CHUA 1KD0A 3PFRA 2JAEA 5BOEA 2I0ZA 2ZZ0A 3ES7A 1GRHA 3SFDA
chains in the Genus database with same CATH topology
4GR1A 3BI4A 2R0PA 3NRNA 1NHQA 4RG4A 3DJDA 2V3BA 2C70A 2FJBA 4UDRA 4IVOB 5BVAA 3NN0X 3UKAA 1PDHA 5KVIA 3PS9A 1LJ1A 2WESA 4BV6A 3RP8A 3CMMA 4U8NA 2GR1A 1LVLA 2R9ZA 4B66A 5HXIA 2WP9A 3AE3A 4HA6A 2BK4A 2YWLA 3COXA 3GMBA 3AEFA 2ACZA 2VRMA 4Y4NA 5TR3A 3SZ0A 1P2EA 3CNJA 1GERA 1GSNA 4IVMB 3UP4A 3UTHA 1FL2A 4B63A 3CNPA 1ZOYA 2WBAA 3DA1A 5KMQA 1GRAA 4A6NB 3UP5A 4GCMA 4J56A 1CBOA 1S2YA 3QVPA 2X99A 2YLSA 2BRAA 5KWFA 2QA1A 4ICYA 2HQMA 4EMIA 4UDQA 4C5OA 2BRYA 2OALA 2WOVA 3G5SA 1TDFA 5CKUA 3KD9A 4YXDA 3UKKA 4Z26A 4CCQA 1K0JA 4ZCCA 1KDGA 4U8IA 4YSHA 3H8IA 3K30A 2XLUA 2YLWA 2ZZCA 3BHFA 3NYFA 1X31B 3AE7A 1VG0A 3G5RA 4YSYA 2GMJA 4CY6A 4EIPA 5U1OA 3DJEA 4H4PA 1ZMCA 3FG2P 2YG7A 1S7MA 3CNSA 5M0ZA 4EQXA 1BZLA 4GF7A 1KNRA 1PXBA 2BC0A 2AR8A 2GVCA 1GRTA 3CNDA 3UCLA 1E7PA 2XVIA 3T2YA 3DGZA 4NWZA 3G5QA 4A99A 3KLJA 3T2ZA 1Q1RA 1H7XA 3ICSA 5DBJA 4B68A 1LTXR 2R45A 4BK3A 2R46A 2E4GA 1NDAA 2WU2A 4II3A 4II2A 1YY5A 1GRFA 4RG3A 2RGHA 3UKHA 4G74A 1NHRA 2WP5A 1QLBA 1F8RA 3NNEA 3EAOA 4YWOA 2V5ZA 2CDUA 3NLCA 2XLRA 1NG3A 1MO9A 2GR2A 4Y4LA 1F8WA 1K0IA 4ADWA 3SY4A 1D4EA 2GRTA 3UKFA 5GSNA 4EIQA 4H2PA 2BS4A 3ABVA 3RHAA 2E5VA 2IIDA 1PBBA 4G6GA 2YG4A 5JCMA 1CF3A 5M10A 4H4ZA 5J60A 4H4SA 4B67A 1VDCA 4CNKA 4FX9A 3L1RA 3PVCA 1GPEA 4J57A 4B69A 3F8PA 3C96A 1BGNA 1EL5A 3CTYA 4C74A 4ZCDA 4X4JA 3GRSA 4CNJA 3VQRA 2E1MA 3ALJA 3AEEA 1ZX9A 3NTAA 1GRGA 2WDVA 2XLPA 2YG5A 1NPXA 1F6MA 3SYIA 2WQYA 3S5WA 5C3JA 4A5LA 1D7LA 4WX1A 3LOVA 3NT6A 1PS9A 3P9UA 5J7XA 1GXFA 5JRBA 4K5RA 3ALLA 4BJZA 4D03A 1GT8A 3NG7X 2VVMA 1BKWA 1CL0A 2GMHA 4JY3A 5HHFA 1ZKQA 5KMSA 1QJDA 2GR3A 1JNRA 3D8XA 3FIMB 2CULA 1S3EA 4FDCB 3Q6JA 1TDKA 4H7UA 2WDRA 3PO7A 3BI5A 5JCKA 4H4XA 1OJTA 2YR6A 3HZLA 1E6EA 3URHA 2BA9A 5KMPA 2Q6UA 2GEWA 1FCDA 2RGOA 1GTHA 3AXBA 4AP1A 3P4QA 3UOYA 4YKGA 1PXAA 2PYXA 4AOXA 4XXGA 2DKIA 1MXTA 1NENA 2VVLA 1DODA 2VQBA 2QAEA 1B8SA 3QSMA 2XFOA 1KN0A 3IC9A 2TPRA 5JCIA 3ZDNA 5L46A 1Q1WA 1E1KA 1Y56B 4EM4A 3I6DA 4B1BA 3ICRA 2XYOA 3KKJA 2IVDA 3V3NA 1CJCA 2QA2A 1L9DA 2YVGA 4K5SA 3UKLA 1KSSA 2GAHB 1Q9IA 3D1CA 3LZWA 3T31A 1O94A 3VRAA 4JQ9A 1KF6A 4DNAA 2C67A 2YG3A 4NTCA 1M64A 4IA5A 1K4QA 1JU2A 5KVHA 3B3RA 3ITJA 2VZ2A 4EMJA 2JB3A 2A89A 2WS3A 2YM2A 3IWAA 1CJ3A 1UKVG 5C2TA 3HYXA 2R0GA 5FS6A 2V6OA 1B37A 3CGCA 2FJEA 2R0CA 1DOCA 3AD9B 3AE6A 3ZYXA 4BK1A 3L8KA 2Q0KA 4WCTA 2C75A 4YTNA 4HB9A 2WEUA 1HYUA 3ICTA 3OZ2A 2FJAA 3IF9A 1NG4A 1IUSA 4OVIA 2JKCA 2YLRA 3AE5A 4H2NA 3DH9A 4O5UA 1W4XA 3FPZA 4OPGA 4TM4A 4U8JA 3LB8A 2YVJA 2WPFA 1YQ4A 1ELIA 2X8HA 1DJNA 1OJAA 3P4PA 4A7AA 4C3XA 3BNMA 5ER0A 1Y0PA 2BC1A 2XLTA 3BHKA 3C4AA 3D9XA 5FS9A 1PBCA 3FMWA 3JSKA 3L5OA 4NTEA 1REOA 4TM0A 4LU6A 1RP0A 3QJ4A 2C73A 3GYIA 2XVHA 4X9MA 3GWFA 3M0OA 3GSIA 1CJ2A 1GV4A 5FS8A 4KPRA 4Z43A 2QCUA 3AEBA 1PXCA 4USQA 4H2QA 4Z25A 1TYTA 1JOAA 4G9KA 4I58A 5EBKA 1PBDA 3VR8A 1V59A 4NEVA 4Z2RA 2C3CA 2OA1A 4X9NA 4J36A 4GRTA 3ADAB 4G6HA 3CIRA 2C4CA 4UP3A 2EQ9A 4FK1C 4IA6A 2C72A 2C64A 1N4UA 2BXSA 1GTEA 2R4JA 4Z44A 3WE0A 1KSUA 1H86A 1BWCA 1H2IA 1GETA 2C7GA 1O95A 4K8DA 3UTFA 3AD7B 3GRTA 4AP3A 5FS7A 1RSGA 3GDNA 1CC4A 1CC2A 2VVLG 2WU5A 1PBFA 4YTPA 5KNLA 4TM3A 3CNTA 4U8MA 2B9YA 3K7TA 1ZMDA 2GH5A 1O5WA 3DJJA 3OC4A 2XCGA 2XLSA 3HYVA 4YTMA 4EM3A 2JK6A 2F5ZA 2BS3A 2WPEA 1Y56A 3RP7A 3H4KA 1EBDA 1JRXA 1L9CA 1N4VA 3LADA 1DJQA 1OJCA 1EL8A 5EB5A 2B7SA 2ZBWA 1OJDA 3DGHA 4K7ZA 2Y6QA 3GDPA 3P4SA 1COYA 1VRQB 2YVFA 4TLZA 5BRTA 3IHGA 3GWDA 4EQWA 2A87A 4XWRA 1TDNA 3KA7A 1RYIA 2XVEA 1FOHA 3KVEA 3SZWA 2GAGB 3DK9A 4YSXA 4TLXA 4J33A 3M12A 1NHPA 5FMHA 1GRBA 3SQPA 4K2XA 2O9ZA 1H81A 1IJHA 4U2LA 4A6NA 4USRA 3LZXA 4EMWA 2BCGG 1FEBA 1ZP0A 1CC6A 2C76A 2YLZA 3KU9A 4MJWA 4ZN0A 4P9SA 1ZK7A 2FJDA 2XFUA 4Z24A 3NN6X 2C66A 1YQZA 5JCLA 3UKQA 2J3NA 4JNQA 1P2HA 3T14A 4H4TA 5CQFA 2WOIA 4LIIA 3R9UA 4JY2A 2YLTA 1DOEA 3Q9TA 4U8KA 4YSZA 1LQTA 4H4WA 1EL7A 5KMRA 2X50A 3NKSA 4REKA 1IUXA 2A8XA 3BI2A 1VQWA 4OPTA 3AECA 3VRDB 3UKPA 4A79A 4KX6A 2JB1A 4U8LA 4AT2A 4E0VA 2NVKX 2XFNA 3B6DA 4BK2A 2V3AA 1JRZA 3QVRA 1PBEA 4OPCA 3UOZA 4D04A 3DMEA 1GALA 2C65A 4NTDA 4AT0A 4NNJA 3ALMA 4DSHA 1FEAA 2FBWA 2RABA 4H2RA 3NYCA 4OPLA 1K0LA 3BNUA 3CPJG 4PAAA 1YQ3A 1N1PA 3UTEA 3SM8A 5EB4A 3QFBA 3SFEA 2YR4A 2C3DA 4CRTA 1PHHA 2YLXA 4H4YA 2B7RA 1D7YA 3QFAA 4OPUA 2VRLA 2X8CA 1NAAA 2GV8A 3ATRA 4H4QA 3DK4A 4OPIA 2Y6RA 2B76A 4C3YA 2WPCA 3REDA 3UOXA 2B9WA 3CPHG 3P1WA 1D5TA 2ZZBA 1S2QA 1XPQA 5KXJA 1DXLA 2EQ7A 3I3LA 3M13A 2WETA 2NPXA 3AYJA 3HYWA 1TRBA 4GUVA 1GREA 1PJ6A 2BABA 3NIXA 2GR0A 3LXDA 4H4UA 1H82A 1E39A 5KOXA 2GQWA 2EQ6A 2YAUA 1CJ4A 1PJ5A 2YR5A 3AD8B 5BUKA 1XANA 3CPIG 3VR9A 1ONFA 3SXIA 4H4VA 3P4RA 2CVJA 1S3BA 3ATQA 3O0HA 3C4NA 2GF3A 2X3NA 3NYEA 4YKFA 1IUUA 1E1LA 2EQ8A 1KFYA 4GDPA 4CY8A 2BK3A 3EPTA 4CCRA 1JRYA 1F8SA 2DKHA 4JNAA 4TM1A 3SX6A 3EF6A 3AE1A 5HY5A 1BGJA 4JN9A 3VRBA 3AWIA 1PN0A 2YM1A 4GAVA 4J31A 3NHOX 3RNMA 1GESA 3UOVA 4M52A 1JNZA 2XVJA 1D4CA 3V3OA 2Z5YA 2XFPA 1JEHA 1XDIA 4N9XA 3PG6A 3AEAA 4NZHA 3EANA 2UZZA 2Q0LA 1GNDA 3RP6A 5LV9A 2CFYA 1IUWA 4AOSA 4CBQA 4J34A 1E1NA 2WHDA 3AYIA 2H88A 4ECHA 4FK1A 2H89A 2BYBA 3ISHA 4B65A 4EQRA 2WDQA 3F8RA 4GDEA 4OCGA 5JCNA 4H4RA 2RGJA 2YG6A 3E1TA 1F3PA 3CN8A 2BCPA 1ZDLA 1KNPA 2APGA 4DSGA 4Y4MA 3NK1X 2IVEA 2WOWA 4I59A 2GQFA 3GYJA 1BF3A 3QSEA 4U2TA 5BULA 4U8PA 5IPYA 2X8GA 1GOSA 3AB1A 3KPKA 3DK8A 1AOGA 2VQ7A 2XFQA 2AQJA 2BXRA 4GAPA 4YT0A 3SGLA 4BURA 2JB2A 3NTDA 2VOUA 3GD4A 4EQSA 4DGKA 4J2WA 4Z2UA 2TMDA 5HYMA 5KOWA 2ARDA 1TDOA 1LV0A 3II4A 4G73A 4UDPA 2V60A 1DOBA 1TYPA 1GEUA 3T0KA 2OLOA 4LA1A 2Q7VA 3CGDA 3F8DA 3H8LA 4RSLA 3K7QX 1L9EA 4APNA 1PJ7A 2OAMA 3FBSA 1FECA 1YKJA 1TDEA 4K22A 1SEZA 5U25A 3AE4A 2JBVA 1OJ9A 3NGCX 2R4EA 4IV9A 2V61A 1N4WA 3NK2X 4U2SA 5IQ1A 4NEWA 2WP6A 2YQUA 4H50A 2BACA 2BK5A 2Z5XA 1D4DA 4XWZA 2PHHA 1B4VA 4O5QA 1ZOVA 1E1MA 4U8OA 5IQ4A 3GYXA 3DJGX 4BJYA 3AEDA 4Z2TA 2XDOA 3AYLA 5GRTA 5EOWA 3AEGA 4A9WA 3CGBA 3SZFA 3GD3A 4JDRA 2B9XA 3QSSA 2W0HA 1H84A 1H7WA 2GB0A 3CGEA 3S61A 3KPFA 3T37A 2AAQA 3UTGA 3LJPA 5U63A 1B5QA 1NEKA 3K7MX 1M6IA 1ZY8A 3AE8A 2XVFA 1MOKA 3V76A 3AE2A 3SZCA 1NHSA 2OLNA 1LQUA 1XHCA 4PABA 1H6VA 1LPFA 1L0VA 1CHUA 1IUTA 3NK0X 5KRQA 2BS2A 1VG9A 4OPDA 2JAEA 1IUVA 1EL9A 4A65A 2I0ZA 1Z6LA 2ZZ0A 3IHMA 3T2KA 4B64A 3NH3X 3AE9A 4C77A 1DNCA 1QO8A 1GRHA 3SFDA 1H83A 3GMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR1 A;  3BI4 A;  2R0P A;  3NRN A;  1NHQ A;  4RG4 A;  3DJD A;  2V3B A;  2C70 A;  2FJB A;  4UDR A;  4IVO B;  5BVA A;  3NN0 X;  3UKA A;  1PDH A;  5KVI A;  3PS9 A;  1LJ1 A;  2WES A;  4BV6 A;  3RP8 A;  4U8N A;  2GR1 A;  1LVL A;  2R9Z A;  4B66 A;  5HXI A;  2WP9 A;  3AE3 A;  4HA6 A;  2BK4 A;  2YWL A;  3COX A;  3GMB A;  3AEF A;  2ACZ A;  2VRM A;  4Y4N A;  5TR3 A;  1P2E A;  3CNJ A;  1GER A;  1GSN A;  4IVM B;  3UP4 A;  3UTH A;  1FL2 A;  4B63 A;  3CNP A;  1ZOY A;  2WBA A;  3DA1 A;  4A6N B;  1GRA A;  3UP5 A;  4GCM A;  4J56 A;  1CBO A;  1S2Y A;  3QVP A;  2X99 A;  2YLS A;  5KWF A;  2QA1 A;  4ICY A;  2HQM A;  4EMI A;  4UDQ A;  4C5O A;  2OAL A;  2WOV A;  3G5S A;  1TDF A;  5CKU A;  3KD9 A;  4YXD A;  3UKK A;  4Z26 A;  4CCQ A;  1K0J A;  4ZCC A;  1KDG A;  4U8I A;  4YSH A;  3H8I A;  3K30 A;  2XLU A;  2YLW A;  2ZZC A;  3BHF A;  3NYF A;  1X31 B;  3AE7 A;  1VG0 A;  3G5R A;  4YSY A;  2GMJ A;  4CY6 A;  4EIP A;  5U1O A;  3DJE A;  4H4P A;  1ZMC A;  3FG2 P;  2YG7 A;  3CNS A;  5M0Z A;  4EQX A;  1BZL A;  4GF7 A;  1KNR A;  1PXB A;  2BC0 A;  2AR8 A;  2GVC A;  1GRT A;  3CND A;  3UCL A;  1E7P A;  2XVI A;  3DGZ A;  4A99 A;  3G5Q A;  3KLJ A;  1Q1R A;  1H7X A;  3ICS A;  5DBJ A;  4B68 A;  1LTX R;  2R45 A;  4BK3 A;  2R46 A;  2E4G A;  1NDA A;  2WU2 A;  3UKH A;  4ZN0 A;  1YY5 A;  1GRF A;  4RG3 A;  2RGH A;  1NHR A;  2WP5 A;  1QLB A;  1F8R A;  3NNE A;  3EAO A;  4YWO A;  2V5Z A;  2CDU A;  3NLC A;  2XLR A;  1NG3 A;  1MO9 A;  2GR2 A;  4Y4L A;  1F8W A;  1K0I A;  4ADW A;  1D4E A;  2GRT A;  3UKF A;  5GSN A;  4EIQ A;  4H2P A;  2BS4 A;  3ABV A;  3RHA A;  2E5V A;  2IID A;  1PBB A;  2YG4 A;  5JCM A;  1CF3 A;  5M10 A;  4H4Z A;  5J60 A;  4H4S A;  4B67 A;  1VDC A;  4CNK A;  4FX9 A;  3L1R A;  3PVC A;  1GPE A;  4J57 A;  4B69 A;  3F8P A;  3C96 A;  1BGN A;  1EL5 A;  3CTY A;  4C74 A;  4ZCD A;  4X4J A;  3GRS A;  4CNJ A;  3VQR A;  2E1M A;  3ALJ A;  3AEE A;  1ZX9 A;  3NTA A;  1GRG A;  2WDV A;  2XLP A;  2YG5 A;  1NPX A;  1F6M A;  2WQY A;  3S5W A;  5C3J A;  4A5L A;  1D7L A;  4WX1 A;  3LOV A;  3NT6 A;  1PS9 A;  3P9U A;  5J7X A;  1GXF A;  4BJZ A;  4K5R A;  3ALL A;  4D03 A;  1GT8 A;  3NG7 X;  2VVM A;  1BKW A;  1CL0 A;  2GMH A;  4JY3 A;  5HHF A;  1ZKQ A;  1QJD A;  2GR3 A;  1JNR A;  3D8X A;  3FIM B;  2CUL A;  1S3E A;  4FDC B;  3Q6J A;  1TDK A;  4H7U A;  2WDR A;  3PO7 A;  3BI5 A;  5JCK A;  4H4X A;  1OJT A;  2YR6 A;  3HZL A;  1E6E A;  3URH A;  2BA9 A;  2Q6U A;  2GEW A;  1FCD A;  2RGO A;  1GTH A;  3AXB A;  4AP1 A;  3P4Q A;  3UOY A;  4YKG A;  1PXA A;  2PYX A;  4AOX A;  4XXG A;  2DKI A;  1MXT A;  1NEN A;  2VVL A;  1DOD A;  2VQB A;  2QAE A;  1B8S A;  3QSM A;  2XFO A;  3IC9 A;  3ZDN A;  2TPR A;  5JCI A;  5L46 A;  1Q1W A;  1E1K A;  1Y56 B;  4EM4 A;  3I6D A;  4B1B A;  3ICR A;  2XYO A;  3KKJ A;  2IVD A;  3V3N A;  1CJC A;  2QA2 A;  1L9D A;  2YVG A;  4K5S A;  3UKL A;  1KSS A;  2GAH B;  1Q9I A;  3D1C A;  3LZW A;  1O94 A;  3VRA A;  4JQ9 A;  1KF6 A;  4DNA A;  2C67 A;  2YG3 A;  4NTC A;  1M64 A;  4IA5 A;  1K4Q A;  1JU2 A;  5KVH A;  3B3R A;  3ITJ A;  2VZ2 A;  4EMJ A;  2JB3 A;  2A89 A;  2WS3 A;  2YM2 A;  3IWA A;  1CJ3 A;  1UKV G;  5C2T A;  2R0G A;  5FS6 A;  2V6O A;  1B37 A;  3CGC A;  2FJE A;  2R0C A;  1DOC A;  3AD9 B;  3AE6 A;  3ZYX A;  4BK1 A;  3L8K A;  2Q0K A;  4WCT A;  2C75 A;  4YTN A;  4HB9 A;  2WEU A;  1HYU A;  3ICT A;  3OZ2 A;  2FJA A;  3IF9 A;  1NG4 A;  1IUS A;  4OVI A;  2JKC A;  2YLR A;  3AE5 A;  4H2N A;  3DH9 A;  4O5U A;  1W4X A;  3FPZ A;  4OPG A;  4TM4 A;  4U8J A;  3LB8 A;  2YVJ A;  2WPF A;  1YQ4 A;  1ELI A;  2X8H A;  1DJN A;  1OJA A;  3P4P A;  4A7A A;  4C3X A;  3BNM A;  5ER0 A;  1Y0P A;  2BC1 A;  2XLT A;  3BHK A;  3C4A A;  1PBC A;  5FS9 A;  3FMW A;  3JSK A;  4NTE A;  1REO A;  4TM0 A;  4LU6 A;  1RP0 A;  3QJ4 A;  2C73 A;  3GYI A;  2XVH A;  4X9M A;  3GWF A;  3M0O A;  3GSI A;  1CJ2 A;  1GV4 A;  5FS8 A;  4KPR A;  4Z43 A;  2QCU A;  3AEB A;  1PXC A;  4USQ A;  4H2Q A;  4Z25 A;  1TYT A;  1JOA A;  4I58 A;  3VR8 A;  5EBK A;  1PBD A;  4Z2R A;  1V59 A;  4NEV A;  2C3C A;  2OA1 A;  4X9N A;  4J36 A;  4GRT A;  3ADA B;  3CIR A;  4UP3 A;  2EQ9 A;  4FK1 C;  4IA6 A;  2C72 A;  2C64 A;  1N4U A;  2BXS A;  1GTE A;  2R4J A;  4Z44 A;  3WE0 A;  1KSU A;  1H86 A;  1BWC A;  1GET A;  2C7G A;  1O95 A;  4K8D A;  3UTF A;  3AD7 B;  3GRT A;  4AP3 A;  5FS7 A;  1RSG A;  3GDN A;  1CC4 A;  1CC2 A;  2VVL G;  2WU5 A;  1PBF A;  4YTP A;  4TM3 A;  3CNT A;  4U8M A;  2B9Y A;  3K7T A;  1ZMD A;  2GH5 A;  1O5W A;  3DJJ A;  3OC4 A;  2XCG A;  2XLS A;  4YTM A;  4EM3 A;  2JK6 A;  2F5Z A;  2BS3 A;  2WPE A;  1Y56 A;  3RP7 A;  3H4K A;  1EBD A;  1JRX A;  1L9C A;  1N4V A;  3LAD A;  1DJQ A;  1OJC A;  1EL8 A;  5EB5 A;  2B7S A;  2ZBW A;  1OJD A;  3DGH A;  4K7Z A;  2Y6Q A;  3GDP A;  3P4S A;  1COY A;  1VRQ B;  2YVF A;  4TLZ A;  5BRT A;  3IHG A;  3GWD A;  4EQW A;  2A87 A;  4XWR A;  1TDN A;  3KA7 A;  1RYI A;  2XVE A;  1FOH A;  3KVE A;  2GAG B;  3DK9 A;  4YSX A;  4TLX A;  4J33 A;  3M12 A;  1NHP A;  5FMH A;  1GRB A;  3SQP A;  4K2X A;  2O9Z A;  1H81 A;  1IJH A;  4U2L A;  4A6N A;  4USR A;  3LZX A;  4EMW A;  2BCG G;  1FEB A;  1ZP0 A;  1CC6 A;  2C76 A;  2YLZ A;  3KU9 A;  4MJW A;  4P9S A;  1ZK7 A;  2FJD A;  2XFU A;  4Z24 A;  3NN6 X;  2C66 A;  1YQZ A;  5JCL A;  3UKQ A;  2J3N A;  4JNQ A;  1P2H A;  4H4T A;  5CQF A;  2WOI A;  4LII A;  3R9U A;  4JY2 A;  2YLT A;  1DOE A;  3Q9T A;  4U8K A;  4YSZ A;  1LQT A;  4H4W A;  1EL7 A;  2X50 A;  3NKS A;  4REK A;  1IUX A;  2A8X A;  3BI2 A;  1VQW A;  4OPT A;  3AEC A;  3VRD B;  3UKP A;  4A79 A;  4KX6 A;  2JB1 A;  4U8L A;  4AT2 A;  4E0V A;  2NVK X;  2XFN A;  3B6D A;  4BK2 A;  2V3A A;  1JRZ A;  3QVR A;  1PBE A;  4OPC A;  3UOZ A;  4D04 A;  3DME A;  1GAL A;  2C65 A;  4NTD A;  4AT0 A;  3ALM A;  4DSH A;  1FEA A;  2FBW A;  2RAB A;  4H2R A;  3NYC A;  4OPL A;  1K0L A;  3BNU A;  3CPJ G;  4PAA A;  1YQ3 A;  1N1P A;  3UTE A;  3SM8 A;  5EB4 A;  3QFB A;  3SFE A;  2YR4 A;  2C3D A;  4CRT A;  1PHH A;  2YLX A;  4H4Y A;  2B7R A;  1D7Y A;  3QFA A;  4OPU A;  2VRL A;  2X8C A;  1NAA A;  2GV8 A;  3ATR A;  4H4Q A;  3DK4 A;  4OPI A;  2Y6R A;  2B76 A;  4C3Y A;  2WPC A;  3RED A;  3UOX A;  2B9W A;  3CPH G;  3P1W A;  1D5T A;  2ZZB A;  1S2Q A;  1XPQ A;  5KXJ A;  1DXL A;  2EQ7 A;  3I3L A;  3M13 A;  2WET A;  2NPX A;  3AYJ A;  1TRB A;  4GUV A;  1GRE A;  1PJ6 A;  2BAB A;  3NIX A;  2GR0 A;  3LXD A;  4H4U A;  1H82 A;  1E39 A;  5KOX A;  2GQW A;  2EQ6 A;  2YAU A;  1CJ4 A;  1PJ5 A;  2YR5 A;  3AD8 B;  5BUK A;  1XAN A;  3CPI G;  3VR9 A;  1ONF A;  4H4V A;  3P4R A;  2CVJ A;  1S3B A;  3ATQ A;  3O0H A;  3C4N A;  2GF3 A;  2X3N A;  3NYE A;  4YKF A;  1IUU A;  1E1L A;  2EQ8 A;  1KFY A;  4GDP A;  4CY8 A;  2BK3 A;  3EPT A;  4CCR A;  1JRY A;  1F8S A;  2DKH A;  4JNA A;  4TM1 A;  3EF6 A;  3AE1 A;  5HY5 A;  1BGJ A;  4JN9 A;  3VRB A;  3AWI A;  1PN0 A;  2YM1 A;  4J31 A;  3NHO X;  3RNM A;  1GES A;  3UOV A;  4M52 A;  1JNZ A;  2XVJ A;  1D4C A;  3V3O A;  2Z5Y A;  2XFP A;  1JEH A;  1XDI A;  4N9X A;  3AEA A;  4NZH A;  3EAN A;  2UZZ A;  2Q0L A;  1GND A;  3RP6 A;  5LV9 A;  2CFY A;  1IUW A;  4AOS A;  4CBQ A;  4J34 A;  1E1N A;  2WHD A;  3AYI A;  2H88 A;  4ECH A;  4FK1 A;  2H89 A;  2BYB A;  3ISH A;  4B65 A;  4EQR A;  2WDQ A;  3F8R A;  4GDE A;  4OCG A;  5JCN A;  4H4R A;  2RGJ A;  2YG6 A;  3E1T A;  1F3P A;  3CN8 A;  2BCP A;  1ZDL A;  1KNP A;  2APG A;  4DSG A;  4Y4M A;  3NK1 X;  2IVE A;  2WOW A;  4I59 A;  2GQF A;  3GYJ A;  1BF3 A;  3QSE A;  4U2T A;  5BUL A;  4U8P A;  5IPY A;  2X8G A;  1GOS A;  3AB1 A;  3DK8 A;  1AOG A;  2VQ7 A;  2XFQ A;  2AQJ A;  2BXR A;  4YT0 A;  3SGL A;  4BUR A;  2JB2 A;  3NTD A;  2VOU A;  3GD4 A;  4EQS A;  4DGK A;  4J2W A;  4Z2U A;  2TMD A;  5HYM A;  5KOW A;  2ARD A;  1TDO A;  1LV0 A;  3II4 A;  4UDP A;  2V60 A;  1DOB A;  1TYP A;  1GEU A;  2OLO A;  4LA1 A;  2Q7V A;  3CGD A;  3F8D A;  3H8L A;  4RSL A;  3K7Q X;  1L9E A;  4APN A;  1PJ7 A;  2OAM A;  3FBS A;  1FEC A;  1YKJ A;  1TDE A;  4K22 A;  1SEZ A;  5U25 A;  3AE4 A;  2JBV A;  1OJ9 A;  3NGC X;  2R4E A;  4IV9 A;  2V61 A;  1N4W A;  3NK2 X;  4U2S A;  5IQ1 A;  4NEW A;  2WP6 A;  2YQU A;  4H50 A;  2BAC A;  2BK5 A;  2Z5X A;  1D4D A;  4XWZ A;  2PHH A;  1B4V A;  4O5Q A;  1ZOV A;  1E1M A;  4U8O A;  5IQ4 A;  3DJG X;  4BJY A;  3AED A;  4Z2T A;  2XDO A;  3AYL A;  5GRT A;  5EOW A;  3AEG A;  4A9W A;  3CGB A;  3GD3 A;  4JDR A;  2B9X A;  3QSS A;  2W0H A;  1H84 A;  1H7W A;  2GB0 A;  3CGE A;  3S61 A;  3KPF A;  3T37 A;  2AAQ A;  3UTG A;  3LJP A;  5U63 A;  1B5Q A;  1NEK A;  3K7M X;  1M6I A;  1ZY8 A;  3AE8 A;  2XVF A;  1MOK A;  3V76 A;  3AE2 A;  1NHS A;  2OLN A;  1LQU A;  1XHC A;  4PAB A;  1H6V A;  1LPF A;  1L0V A;  1CHU A;  1IUT A;  3NK0 X;  5KRQ A;  2BS2 A;  1VG9 A;  4OPD A;  2JAE A;  1IUV A;  1EL9 A;  4A65 A;  2I0Z A;  1Z6L A;  2ZZ0 A;  3IHM A;  4B64 A;  3NH3 X;  3AE9 A;  4C77 A;  1DNC A;  1QO8 A;  1GRH A;  3SFD A;  1H83 A;  3GMC A; 
#chains in the Genus database with same CATH topology
 3OW1 A;  1NHQ A;  2V3B A;  2C70 A;  2FJB A;  3UKA A;  1PDH A;  2OZ8 A;  4BV6 A;  1X2G A;  3CMM A;  2R9Z A;  4B66 A;  2YWL A;  3AEF A;  2ACZ A;  4GME A;  4B63 A;  3CNP A;  3FCP A;  2WBA A;  3ZVI A;  1CBO A;  2DW6 A;  3QVP A;  2YLS A;  5KWF A;  4ICY A;  4UDQ A;  2BRY A;  1TZZ A;  3G5S A;  4Z26 A;  1SB3 B;  4J1O A;  1KDG A;  4HNC A;  4X2P A;  3BHF A;  3AM9 A;  3R0K A;  4CY6 A;  4H4P A;  4J3Z A;  3CNS A;  2BC0 A;  2AR8 A;  1GRT A;  3CND A;  3TWA A;  1WUE A;  4NWZ A;  2GGG A;  3ICS A;  1YEY A;  1LTX R;  3T4W A;  2WU2 A;  4II3 A;  1XS2 A;  4HPN A;  4RG3 A;  2E5A A;  1F8R A;  4Y4L A;  2RDX A;  4ADW A;  3SY4 A;  4TVW A;  2GRT A;  3ABV A;  4G6G A;  2YG4 A;  4K8G A;  4H4S A;  4CNK A;  1GPE A;  1BGN A;  3GRS A;  3VQR A;  2E1M A;  3RCY A;  4GIR A;  3UXK A;  3NT6 A;  4BJZ A;  1GXF A;  2VVM A;  1BKW A;  1CL0 A;  3ZLG A;  2GR3 A;  3FIM B;  1KCZ A;  3Q6J A;  2PSN A;  1TDK A;  3BI5 A;  5JCK A;  2YR6 A;  1OJT A;  5KMP A;  1FCD A;  3AXB A;  1PXA A;  2PYX A;  5IDZ A;  2VVL A;  3DIP A;  1B8S A;  5JCI A;  3NVV B;  2HXT A;  1Q1W A;  3CB3 A;  3I6D A;  3KKJ A;  1CJC A;  2YVG A;  2I5Q A;  1Q9I A;  3T31 A;  4KPL A;  1K4Q A;  4GIS A;  2A89 A;  2WS3 A;  3EEZ A;  2V6O A;  1B37 A;  3ZYX A;  4BK1 A;  2Q0K A;  4WCT A;  4HB9 A;  1HYU A;  3SSZ A;  2JKC A;  3DG3 A;  3FPZ A;  2YVJ A;  3B97 A;  2X8H A;  1OJA A;  3P4P A;  3BNM A;  2BC1 A;  5FS9 A;  3JSK A;  3L5O A;  4TM0 A;  4X9M A;  2QCU A;  2HNE A;  1JOA A;  1PBD A;  1V59 A;  4NEV A;  2C3C A;  4J36 A;  3ADA B;  3CIR A;  2C4C A;  2EQ9 A;  4FK1 C;  3R0U A;  2BXS A;  3WE0 A;  1BWC A;  1O95 A;  3DFY A;  3SBF A;  3AD7 B;  3GRT A;  2VVL G;  2WU5 A;  3PWG A;  3H8A A;  4U8M A;  2B9Y A;  2GH5 A;  2XCG A;  2JK6 A;  2MUC A;  1EBD A;  1JRX A;  1N4V A;  1OJC A;  1EL8 A;  3JZU A;  4GFI A;  4HCH A;  3DGH A;  4MKS A;  3VC6 A;  3N6H A;  4XWR A;  4FP1 A;  3KVE A;  3SZW A;  4GYP A;  2GDQ A;  3M12 A;  1GRB A;  4A6N A;  3UJE A;  3AMZ A;  4EMW A;  4H83 A;  1FEB A;  1ZP0 A;  4Z24 A;  2C66 A;  1YQZ A;  3UKQ A;  2J3N A;  5CQF A;  4ROP A;  3R9U A;  1DOE A;  4YSZ A;  3NKS A;  4REK A;  1IUX A;  1MNS A;  4OPT A;  3UKP A;  4A79 A;  4IZG A;  4KX6 A;  2QJN A;  3QVR A;  1JRZ A;  4D04 A;  2PCE A;  4AT0 A;  4DSH A;  4PAA A;  3AN1 A;  3QFB A;  5BOF A;  4H4Y A;  2B7R A;  1NAA A;  2OQY A;  4OPI A;  3OZM A;  4C3Y A;  2WPC A;  2P8B A;  1WYG A;  1D5T A;  2ZZB A;  1XPY A;  3M13 A;  1EBH A;  2WET A;  2NPX A;  3AYJ A;  1TRB A;  1RM6 B;  1GRE A;  1BKH A;  1E39 A;  5KOX A;  2GQW A;  5BUK A;  1PJ5 A;  3UJS A;  1XAN A;  2POZ A;  1ONF A;  3RR1 A;  4E4U A;  3ATQ A;  3O0H A;  4YKF A;  2EQ8 A;  4CCR A;  4HCL A;  1JRY A;  4IP5 A;  4JNA A;  3AE1 A;  4JN9 A;  3AWI A;  2YM1 A;  1V97 A;  1JNZ A;  2XVJ A;  1D4C A;  5FJO A;  2QGY A;  5FJU A;  1WUF A;  7ENL A;  3VA8 A;  4NZH A;  1SJA A;  4AOS A;  3AYI A;  3R10 A;  3F8R A;  2RGJ A;  2YG6 A;  1ECQ A;  1F3P A;  3CN8 A;  1ZDL A;  2APG A;  4Y4M A;  2IVE A;  2GQF A;  3QSE A;  1BF3 A;  4U2T A;  2VQ7 A;  4GAP A;  3SGL A;  3VCN A;  4DGK A;  4J2W A;  2O56 A;  4UDP A;  1DOB A;  3T0K A;  2PP3 A;  3HRD C;  1FHU A;  4IT1 A;  3S47 A;  3DES A;  4APN A;  3CAW A;  4K22 A;  1SEZ A;  3NK2 X;  2Z5X A;  2XH2 A;  3BSM A;  1B4V A;  2AL2 B;  1ZOV A;  3DJG X;  4Z2T A;  2XDO A;  4TVY A;  5EOW A;  3AEG A;  4A9W A;  3CGB A;  3GD3 A;  4JDR A;  1H84 A;  3CGE A;  3KPF A;  1B5Q A;  3K7M X;  1EC7 A;  1M6I A;  3VDG A;  3DDM A;  2P88 A;  1FHV A;  1NHS A;  4PAB A;  1P48 A;  3CXB A;  4GGH A;  3DG6 A;  1EL9 A;  4A65 A;  1R6W A;  3T2K A;  3AE9 A;  1DNC A;  3ZLH A;  1EC9 A;  1QO8 A;  3TJI A;  3BI4 A;  2R0P A;  2QJJ A;  4IVO B;  3PS9 A;  1LJ1 A;  5HXI A;  4DWD A;  3COX A;  3R25 A;  5TR3 A;  3SZ0 A;  1P2E A;  1GER A;  3HPF A;  1L8P A;  1FL2 A;  3DA1 A;  4GCM A;  3KUM A;  2BRA A;  2HQM A;  4YXD A;  3V5F A;  1K0J A;  1FFV C;  4U8I A;  3K30 A;  2YLW A;  3AE7 A;  1VG0 A;  4YSY A;  5U1O A;  3DJE A;  2YG7 A;  1S7M A;  5M0Z A;  1PXB A;  3G5Q A;  3T2Z A;  1Q1R A;  4IL2 A;  1TE6 A;  1NDA A;  3QPE A;  1NHR A;  2WP5 A;  2XGZ A;  3EAO A;  2CDU A;  3NLC A;  1MO9 A;  3FV9 A;  3IJL A;  1N60 C;  1K0I A;  3GD6 A;  3UKF A;  2HZG A;  2QQ6 A;  2E5V A;  3CXO A;  1CF3 A;  4H4Z A;  4B67 A;  1VDC A;  3L1R A;  3F8P A;  3C96 A;  3VC5 A;  2QVH A;  4X4J A;  4MGG A;  4CNJ A;  3AEE A;  1ZX9 A;  3NTA A;  4H1Z A;  1GRG A;  1F6M A;  3SYI A;  3JW7 A;  5C3J A;  4A5L A;  3NO1 A;  1D7L A;  3LOV A;  3P9U A;  3ZVH A;  2GMH A;  5HHF A;  1ZKQ A;  1JNR A;  4H19 A;  1S3E A;  4H7U A;  1SJB A;  3HZL A;  3FYY A;  2Q6U A;  3QN3 A;  4XXG A;  2VQB A;  3ZDN A;  2TPR A;  3ICR A;  2XYO A;  2QA2 A;  3LZW A;  1O94 A;  3VRA A;  4JQ9 A;  2C67 A;  3RGT A;  1M64 A;  4HN8 A;  1JU2 A;  2VZ2 A;  4EMJ A;  2QJM A;  2YM2 A;  1CJ3 A;  1UKV G;  2R0C A;  2P3Z A;  4ZOH B;  4YTN A;  1IUS A;  4H2N A;  4O5U A;  4OPG A;  1W4X A;  4U8J A;  1PDZ A;  2WPF A;  1YQ4 A;  1ELI A;  5ER0 A;  2XLT A;  4NTE A;  2GGJ A;  2C73 A;  2XVH A;  3GWF A;  3RO6 A;  2QDD A;  4I58 A;  3N4E A;  4X9N A;  3DEQ A;  4G6H A;  2OPJ A;  2PP0 A;  2C72 A;  3NVZ B;  4AP3 A;  5FS7 A;  1RSG A;  1CC4 A;  2GGI A;  3CNT A;  3K7T A;  1ZMD A;  1O5W A;  1F9C A;  3OP2 A;  3OC4 A;  2XLS A;  4EM3 A;  3QKE A;  2BS3 A;  2WPE A;  2GGH A;  3LAD A;  3NVW B;  2ZBW A;  2E3T A;  4K7Z A;  1COY A;  4TLZ A;  3R11 A;  2A87 A;  3DK9 A;  1NHP A;  5FMH A;  3SQP A;  4K2X A;  2W54 A;  1IJH A;  4U2L A;  4E6M A;  5FJP A;  2POD A;  2GL5 A;  3LZX A;  2BCG G;  2C76 A;  2YLZ A;  3KU9 A;  2GSH A;  1ZK7 A;  1NU5 A;  3N4F A;  4JNQ A;  1P2H A;  4H4T A;  2WOI A;  1SJD A;  3T9P A;  2YLT A;  4JY2 A;  2OFJ A;  1EL7 A;  5KMR A;  2OO6 A;  4AT2 A;  3B6D A;  1GAL A;  4DXK A;  4NTD A;  3ALM A;  1FEA A;  2FBW A;  5FJR A;  1K0L A;  3MUC A;  3CPJ G;  3SM8 A;  3TOY A;  3SFE A;  2YR4 A;  1D7Y A;  3QFA A;  2VRL A;  2X8C A;  2OLA A;  3RED A;  2B9W A;  1XPQ A;  5KXJ A;  2EQ7 A;  3I3L A;  4GUV A;  1PJ6 A;  4KWS A;  3LXD A;  2NQL A;  2OX4 A;  2YAU A;  4K1W A;  3AD8 B;  1N5X A;  3C4N A;  4MMW A;  3NRZ B;  1FFU C;  1E1L A;  1KFY A;  3A7R A;  5HY5 A;  3UXL A;  4J31 A;  3NHO X;  3RNM A;  4M52 A;  3V3O A;  3PWI A;  5J04 A;  2Z5Y A;  1ONE A;  3ETR B;  1GND A;  5LV9 A;  1IUW A;  3DG7 A;  4ECH A;  3K1G A;  4IP4 A;  3ISH A;  2BYB A;  4B65 A;  2XSX A;  4EQR A;  5JCN A;  3I6T A;  2WOW A;  3GYJ A;  5BUL A;  2PTY A;  5IPY A;  4H2H A;  3AB1 A;  4DX3 A;  3DK8 A;  2XFQ A;  1P43 A;  2VOU A;  6ENL A;  1TDO A;  2V60 A;  2OLO A;  2Q7V A;  3CGD A;  3FBS A;  2OAM A;  1YKJ A;  2JBV A;  2HXU A;  1OJ9 A;  4U2S A;  3S5S A;  4H50 A;  2BAC A;  1D4D A;  4JN7 A;  5FJT A;  1E9I A;  2CHR A;  3AED A;  4BJY A;  3NZG A;  3SZF A;  3QSS A;  3T37 A;  2AAQ A;  3ZLF A;  3LJP A;  5U63 A;  2W3R A;  2XVF A;  3SZC A;  1LQU A;  3UJ2 A;  3NK0 X;  5KRQ A;  1VG9 A;  4OPD A;  1IUV A;  1Z6L A;  3IHM A;  4B64 A;  3NH3 X;  4GR1 A;  3VFC A;  1STZ A;  3NRN A;  3H70 A;  4Z17 A;  4RG4 A;  2W3S A;  5KVI A;  3RP8 A;  4U8N A;  2GR1 A;  2QDE A;  4FI4 A;  3AE3 A;  2BK4 A;  1BQG A;  1JRO A;  2VRM A;  4IVM B;  2PTW A;  3UP4 A;  1ZOY A;  3RIT A;  5KMQ A;  4A6N B;  1ELS A;  1S2Y A;  2X99 A;  4EMI A;  2WOV A;  3KD9 A;  3UKK A;  4CCQ A;  4G7F A;  3H8I A;  2XLU A;  3NYF A;  2GMJ A;  4EQX A;  1BZL A;  4GF7 A;  2GVC A;  3TTE A;  2FKP A;  1E7P A;  2XVI A;  3UCL A;  3T2Y A;  3DGZ A;  3KLJ A;  5DBJ A;  4B68 A;  2R45 A;  2R46 A;  2E4G A;  4II2 A;  3UKH A;  1YY5 A;  3SN4 A;  1N5W C;  1QLB A;  3NNE A;  2V5Z A;  2XLR A;  1NG3 A;  2GR2 A;  4G8T A;  1F8W A;  1MDL A;  2PTX A;  2DW7 A;  5GSN A;  2BS4 A;  3RHA A;  5JCM A;  3I4K A;  2ZC8 A;  4J57 A;  3CYJ A;  4F4R A;  1EL5 A;  3CTY A;  4C74 A;  4ZCD A;  1SJC A;  3H7V A;  3ALJ A;  2ONE A;  2XLP A;  2YG5 A;  1NPX A;  3S5W A;  4WX1 A;  5J7X A;  4D03 A;  4K5R A;  3ALL A;  1MRA A;  1GT8 A;  1QJD A;  3MZN A;  2CUL A;  4FDC B;  2WDR A;  1FO4 A;  2XH0 A;  3PO7 A;  3CK5 A;  1E6E A;  3URH A;  4IHC A;  2BA9 A;  2GEW A;  3UOY A;  3DER A;  1MXT A;  3QSM A;  2XFO A;  1KN0 A;  1Y56 B;  1E1K A;  4EM4 A;  4B1B A;  2IVD A;  1L9D A;  1FIQ B;  2GAH B;  3D1C A;  1KF6 A;  1EBG A;  3EKG A;  4DNA A;  3Q4D A;  5KVH A;  3ITJ A;  3IWA A;  3HYX A;  3CGC A;  2FJE A;  1DOC A;  3AD9 B;  2MNR A;  5ENL A;  2C75 A;  2WEU A;  3OZ2 A;  2FJA A;  3IF9 A;  4OVI A;  3AE5 A;  2YLR A;  4TM4 A;  3T8Q A;  1X2H A;  3LB8 A;  4A7A A;  4C3X A;  3R1Z A;  3IJI A;  1Y0P A;  3BHK A;  3C4A A;  3MSY A;  1REO A;  1RP0 A;  3QJ4 A;  1OEP A;  3M0O A;  2PPG A;  3GSI A;  1GV4 A;  5FS8 A;  4USQ A;  3VR8 A;  4G9K A;  5EBK A;  2OA1 A;  4GRT A;  4UP3 A;  3FJ4 A;  4Z1Y A;  2ZAD A;  1GTE A;  3U4F A;  2C7G A;  1MUC A;  3UTF A;  2AL1 A;  2PGW A;  3GDN A;  1CC2 A;  3UJR A;  1PBF A;  4YTP A;  3SQS A;  3DJJ A;  3PK7 A;  2F5Z A;  3QLD A;  3H4K A;  4IL0 A;  1L9C A;  5EB5 A;  2B7S A;  2Y6Q A;  2YVF A;  3GY1 A;  5BRT A;  3IHG A;  3GWD A;  1FOH A;  4YSX A;  2XH4 A;  4HCD A;  4MJW A;  2GGE A;  4P9S A;  3NVY B;  2XFU A;  3IJQ A;  3NN6 X;  2PS2 A;  5JCL A;  3T14 A;  4M6U A;  4LII A;  2PMQ A;  1LQT A;  2X50 A;  3BI2 A;  3VRD B;  3I6E A;  4E0V A;  2NVK X;  2W55 A;  2XFN A;  2V3A A;  4OPC A;  5G5H B;  3DME A;  2C65 A;  4NNJ A;  3CT2 A;  1JPD X;  1YQ3 A;  5EB4 A;  4OPU A;  3ATR A;  4H4Q A;  2B76 A;  2PU0 A;  3UOX A;  3BOX A;  3P1W A;  4K2S A;  3Q45 A;  3EUB 3;  3NIX A;  2GR0 A;  4H4U A;  3SN1 A;  1CJ4 A;  2YR5 A;  3SXI A;  4H4V A;  3P4R A;  1S3B A;  2X3N A;  3NYE A;  4A3R A;  3MY9 A;  2BK3 A;  3EPT A;  2DKH A;  3EF6 A;  3THU A;  3B9J B;  3R07 C;  1BGJ A;  1GES A;  3UOV A;  3ZVH B;  1JEH A;  1XDI A;  4N9X A;  3GO2 A;  3AEA A;  2UZZ A;  2Q0L A;  3RP6 A;  4CBQ A;  1E1N A;  2H89 A;  4OCG A;  1EC8 A;  3E1T A;  4DSG A;  1KNP A;  4U8P A;  1GOS A;  3KPK A;  1AOG A;  4YT0 A;  4BUR A;  2JB2 A;  2OZ3 A;  3JVA A;  2PA6 A;  4EQS A;  2TMD A;  5HYM A;  5KOW A;  2OG9 A;  2ARD A;  1LV0 A;  3II4 A;  3FXG A;  2FYM A;  3F8D A;  1VDV A;  4RSL A;  3H8L A;  3K7Q X;  2OVL A;  1L9E A;  1JPM A;  2PGE A;  5U25 A;  3AE4 A;  2OZT A;  3NGC X;  4IV9 A;  1N4W A;  4E8G A;  2WP6 A;  2BK5 A;  4XWZ A;  2PHH A;  4O5Q A;  1DTN A;  3V5C A;  3AYL A;  3SN0 A;  3ES8 A;  5GRT A;  1KKO A;  1PDY A;  1NEK A;  1ZY8 A;  3AE2 A;  1XHC A;  4YWS A;  1L0V A;  1LPF A;  1IUT A;  2BS2 A;  3UJF A;  3H12 A;  3UCD A;  1JRP A;  4C77 A;  1H83 A;  3TW9 A;  3GMC A;  3DJD A;  3RRA A;  4UDR A;  5BVA A;  3NN0 X;  4ZA0 A;  2WES A;  1LVL A;  2WP9 A;  4HA6 A;  3GMB A;  4Y4N A;  1VQZ A;  3CNJ A;  1GSN A;  1W6T A;  3UTH A;  3N6J A;  1GRA A;  3UP5 A;  4J56 A;  2PTZ A;  3UGV A;  2QA1 A;  4C5O A;  2OAL A;  3VCC A;  5CKU A;  1TDF A;  3U9I A;  4ZCC A;  4YSH A;  2ZZC A;  5G5G B;  1X31 B;  3G5R A;  3TWB A;  4EIP A;  1TKK A;  1ZMC A;  3FG2 P;  3GC2 A;  2AKM A;  1KNR A;  5EU9 A;  4A99 A;  1RVK A;  1H7X A;  3BJS A;  3D46 A;  4BK3 A;  4ZN0 A;  1GRF A;  4E5T A;  2RGH A;  4G74 A;  4YWO A;  1T3Q C;  1D4E A;  1NEL A;  4EIQ A;  4H2P A;  4M0X A;  2IID A;  1PBB A;  5M10 A;  1N61 C;  5J60 A;  4FX9 A;  4A6G A;  3PVC A;  3MWC A;  4B69 A;  1KKR A;  3A7U A;  4GGB A;  4DN1 A;  2WDV A;  2WQY A;  1PS9 A;  1ZXI C;  5JRB A;  3NG7 X;  4JY3 A;  5KMS A;  3D8X A;  3P93 A;  1MDR A;  3P3B A;  4H4X A;  2PU1 A;  3QTP A;  2RGO A;  4AP1 A;  1GTH A;  3P4Q A;  4YKG A;  4ENL A;  4AOX A;  2P0I A;  2DKI A;  3MQT A;  1NEN A;  1DOD A;  2QAE A;  3IC9 A;  1IYX A;  5L46 A;  3V3N A;  4K5S A;  3UKL A;  1KSS A;  2YG3 A;  4NTC A;  4IA5 A;  3B3R A;  2JB3 A;  5C2T A;  2R0G A;  5FS6 A;  3AE6 A;  3L8K A;  3T6C A;  3ICT A;  1NG4 A;  3DH9 A;  2AL2 A;  3TQP A;  1DJN A;  4HNL A;  3D9X A;  1PBC A;  3FMW A;  1JCT A;  4LU6 A;  3GYI A;  4ZCW A;  1CJ2 A;  4KPR A;  4Z43 A;  3AEB A;  3DFH A;  1N63 C;  3V4B A;  1PXC A;  4H2Q A;  1TYT A;  4Z25 A;  4Z2R A;  4KEM A;  2AKZ A;  4IA6 A;  3TCS A;  2C64 A;  1N4U A;  2R4J A;  4Z44 A;  1KSU A;  1H86 A;  1H2I A;  1GET A;  4K8D A;  5KNL A;  4TM3 A;  4YTM A;  3HYV A;  1Y56 A;  4E4F A;  3RP7 A;  4JN8 A;  1DJQ A;  1OJD A;  2OQH A;  3GDP A;  3P4S A;  1VRQ B;  2OKT A;  4KT2 A;  4EQW A;  1TDN A;  3KA7 A;  1RYI A;  2XVE A;  2GAG B;  4TLX A;  4J33 A;  3NFU A;  4EWJ A;  1H81 A;  2O9Z A;  4USR A;  1CC6 A;  3V3W A;  2FJD A;  3Q9T A;  4U8K A;  1N62 C;  4H4W A;  2A8X A;  1VQW A;  3AEC A;  2JB1 A;  4U8L A;  4BK2 A;  1PBE A;  3UOZ A;  3STP A;  2RAB A;  3SR6 B;  4H2R A;  3NYC A;  4OPL A;  2PP1 A;  3BNU A;  1N1P A;  3UTE A;  1JDF A;  2C3D A;  4CRT A;  1PHH A;  2YLX A;  2GV8 A;  3DK4 A;  2Y6R A;  3CPH G;  3NXL A;  4A35 A;  1S2Q A;  1DXL A;  3HYW A;  2BAB A;  3NS1 B;  1H82 A;  3FVD A;  3TJ4 A;  2EQ6 A;  3OTR A;  3CPI G;  4JHM A;  3VR9 A;  2CVJ A;  2GF3 A;  1IUU A;  4GDP A;  4CY8 A;  3SJN A;  1F8S A;  4TM1 A;  3SX6 A;  3VRB A;  3DGB A;  1PN0 A;  4GAV A;  2XFP A;  3PG6 A;  3EAN A;  2CFY A;  4J34 A;  2WHD A;  2H88 A;  4FK1 A;  2WDQ A;  4GDE A;  4H4R A;  3OZY A;  2BCP A;  3NK1 X;  4I59 A;  3OPS A;  3A7A A;  2X8G A;  3HW2 A;  2AQJ A;  2BXR A;  3NTD A;  3GD4 A;  2P8C A;  4Z2U A;  2XH7 A;  4G73 A;  1TYP A;  1GEU A;  4LA1 A;  4DHG A;  1R0M A;  3IK4 A;  1PJ7 A;  1FEC A;  1TDE A;  4GYP C;  3D47 A;  2R4E A;  5IQ1 A;  2V61 A;  4NEW A;  2YQU A;  4DYE A;  3P0W A;  4U8O A;  1E1M A;  5IQ4 A;  3GYX A;  3UCC A;  2B9X A;  2W0H A;  1H7W A;  2GB0 A;  3S61 A;  3ENL A;  4HYR A;  3UTG A;  3AE8 A;  1MOK A;  3V76 A;  3MKC A;  2OLN A;  1H6V A;  1CHU A;  1KD0 A;  3PFR A;  2JAE A;  5BOE A;  2I0Z A;  2ZZ0 A;  3ES7 A;  1GRH A;  3SFD A; 
#chains in the Genus database with same CATH homology
 4GR1 A;  3BI4 A;  2R0P A;  3NRN A;  1NHQ A;  4RG4 A;  3DJD A;  2V3B A;  2C70 A;  2FJB A;  4UDR A;  4IVO B;  5BVA A;  3NN0 X;  3UKA A;  1PDH A;  5KVI A;  3PS9 A;  1LJ1 A;  2WES A;  4BV6 A;  3RP8 A;  3CMM A;  4U8N A;  2GR1 A;  1LVL A;  2R9Z A;  4B66 A;  5HXI A;  2WP9 A;  3AE3 A;  4HA6 A;  2BK4 A;  2YWL A;  3COX A;  3GMB A;  3AEF A;  2ACZ A;  2VRM A;  4Y4N A;  5TR3 A;  3SZ0 A;  1P2E A;  3CNJ A;  1GER A;  1GSN A;  4IVM B;  3UP4 A;  3UTH A;  1FL2 A;  4B63 A;  3CNP A;  1ZOY A;  2WBA A;  3DA1 A;  5KMQ A;  1GRA A;  4A6N B;  3UP5 A;  4GCM A;  4J56 A;  1CBO A;  1S2Y A;  3QVP A;  2X99 A;  2YLS A;  2BRA A;  5KWF A;  2QA1 A;  4ICY A;  2HQM A;  4EMI A;  4UDQ A;  4C5O A;  2BRY A;  2OAL A;  2WOV A;  3G5S A;  1TDF A;  5CKU A;  3KD9 A;  4YXD A;  3UKK A;  4Z26 A;  4CCQ A;  1K0J A;  4ZCC A;  1KDG A;  4U8I A;  4YSH A;  3H8I A;  3K30 A;  2XLU A;  2YLW A;  2ZZC A;  3BHF A;  3NYF A;  1X31 B;  3AE7 A;  1VG0 A;  3G5R A;  4YSY A;  2GMJ A;  4CY6 A;  4EIP A;  5U1O A;  3DJE A;  4H4P A;  1ZMC A;  3FG2 P;  2YG7 A;  1S7M A;  3CNS A;  5M0Z A;  4EQX A;  1BZL A;  4GF7 A;  1KNR A;  1PXB A;  2BC0 A;  2AR8 A;  2GVC A;  1GRT A;  3CND A;  3UCL A;  1E7P A;  2XVI A;  3T2Y A;  3DGZ A;  4NWZ A;  3G5Q A;  4A99 A;  3KLJ A;  3T2Z A;  1Q1R A;  1H7X A;  3ICS A;  5DBJ A;  4B68 A;  1LTX R;  2R45 A;  4BK3 A;  2R46 A;  2E4G A;  1NDA A;  2WU2 A;  4II3 A;  4II2 A;  1YY5 A;  1GRF A;  4RG3 A;  2RGH A;  3UKH A;  4G74 A;  1NHR A;  2WP5 A;  1QLB A;  1F8R A;  3NNE A;  3EAO A;  4YWO A;  2V5Z A;  2CDU A;  3NLC A;  2XLR A;  1NG3 A;  1MO9 A;  2GR2 A;  4Y4L A;  1F8W A;  1K0I A;  4ADW A;  3SY4 A;  1D4E A;  2GRT A;  3UKF A;  5GSN A;  4EIQ A;  4H2P A;  2BS4 A;  3ABV A;  3RHA A;  2E5V A;  2IID A;  1PBB A;  4G6G A;  2YG4 A;  5JCM A;  1CF3 A;  5M10 A;  4H4Z A;  5J60 A;  4H4S A;  4B67 A;  1VDC A;  4CNK A;  4FX9 A;  3L1R A;  3PVC A;  1GPE A;  4J57 A;  4B69 A;  3F8P A;  3C96 A;  1BGN A;  1EL5 A;  3CTY A;  4C74 A;  4ZCD A;  4X4J A;  3GRS A;  4CNJ A;  3VQR A;  2E1M A;  3ALJ A;  3AEE A;  1ZX9 A;  3NTA A;  1GRG A;  2WDV A;  2XLP A;  2YG5 A;  1NPX A;  1F6M A;  3SYI A;  2WQY A;  3S5W A;  5C3J A;  4A5L A;  1D7L A;  4WX1 A;  3LOV A;  3NT6 A;  1PS9 A;  3P9U A;  5J7X A;  1GXF A;  5JRB A;  4K5R A;  3ALL A;  4BJZ A;  4D03 A;  1GT8 A;  3NG7 X;  2VVM A;  1BKW A;  1CL0 A;  2GMH A;  4JY3 A;  5HHF A;  1ZKQ A;  5KMS A;  1QJD A;  2GR3 A;  1JNR A;  3D8X A;  3FIM B;  2CUL A;  1S3E A;  4FDC B;  3Q6J A;  1TDK A;  4H7U A;  2WDR A;  3PO7 A;  3BI5 A;  5JCK A;  4H4X A;  1OJT A;  2YR6 A;  3HZL A;  1E6E A;  3URH A;  2BA9 A;  5KMP A;  2Q6U A;  2GEW A;  1FCD A;  2RGO A;  1GTH A;  3AXB A;  4AP1 A;  3P4Q A;  3UOY A;  4YKG A;  1PXA A;  2PYX A;  4AOX A;  4XXG A;  2DKI A;  1MXT A;  1NEN A;  2VVL A;  1DOD A;  2VQB A;  2QAE A;  1B8S A;  3QSM A;  2XFO A;  1KN0 A;  3IC9 A;  2TPR A;  5JCI A;  3ZDN A;  5L46 A;  1Q1W A;  1E1K A;  1Y56 B;  4EM4 A;  3I6D A;  4B1B A;  3ICR A;  2XYO A;  3KKJ A;  2IVD A;  3V3N A;  1CJC A;  2QA2 A;  1L9D A;  2YVG A;  4K5S A;  3UKL A;  1KSS A;  2GAH B;  1Q9I A;  3D1C A;  3LZW A;  3T31 A;  1O94 A;  3VRA A;  4JQ9 A;  1KF6 A;  4DNA A;  2C67 A;  2YG3 A;  4NTC A;  1M64 A;  4IA5 A;  1K4Q A;  1JU2 A;  5KVH A;  3B3R A;  3ITJ A;  2VZ2 A;  4EMJ A;  2JB3 A;  2A89 A;  2WS3 A;  2YM2 A;  3IWA A;  1CJ3 A;  1UKV G;  5C2T A;  3HYX A;  2R0G A;  5FS6 A;  2V6O A;  1B37 A;  3CGC A;  2FJE A;  2R0C A;  1DOC A;  3AD9 B;  3AE6 A;  3ZYX A;  4BK1 A;  3L8K A;  2Q0K A;  4WCT A;  2C75 A;  4YTN A;  4HB9 A;  2WEU A;  1HYU A;  3ICT A;  3OZ2 A;  2FJA A;  3IF9 A;  1NG4 A;  1IUS A;  4OVI A;  2JKC A;  2YLR A;  3AE5 A;  4H2N A;  3DH9 A;  4O5U A;  1W4X A;  3FPZ A;  4OPG A;  4TM4 A;  4U8J A;  3LB8 A;  2YVJ A;  2WPF A;  1YQ4 A;  1ELI A;  2X8H A;  1DJN A;  1OJA A;  3P4P A;  4A7A A;  4C3X A;  3BNM A;  5ER0 A;  1Y0P A;  2BC1 A;  2XLT A;  3BHK A;  3C4A A;  3D9X A;  5FS9 A;  1PBC A;  3FMW A;  3JSK A;  3L5O A;  4NTE A;  1REO A;  4TM0 A;  4LU6 A;  1RP0 A;  3QJ4 A;  2C73 A;  3GYI A;  2XVH A;  4X9M A;  3GWF A;  3M0O A;  3GSI A;  1CJ2 A;  1GV4 A;  5FS8 A;  4KPR A;  4Z43 A;  2QCU A;  3AEB A;  1PXC A;  4USQ A;  4H2Q A;  4Z25 A;  1TYT A;  1JOA A;  4G9K A;  4I58 A;  5EBK A;  1PBD A;  3VR8 A;  1V59 A;  4NEV A;  4Z2R A;  2C3C A;  2OA1 A;  4X9N A;  4J36 A;  4GRT A;  3ADA B;  4G6H A;  3CIR A;  2C4C A;  4UP3 A;  2EQ9 A;  4FK1 C;  4IA6 A;  2C72 A;  2C64 A;  1N4U A;  2BXS A;  1GTE A;  2R4J A;  4Z44 A;  3WE0 A;  1KSU A;  1H86 A;  1BWC A;  1H2I A;  1GET A;  2C7G A;  1O95 A;  4K8D A;  3UTF A;  3AD7 B;  3GRT A;  4AP3 A;  5FS7 A;  1RSG A;  3GDN A;  1CC4 A;  1CC2 A;  2VVL G;  2WU5 A;  1PBF A;  4YTP A;  5KNL A;  4TM3 A;  3CNT A;  4U8M A;  2B9Y A;  3K7T A;  1ZMD A;  2GH5 A;  1O5W A;  3DJJ A;  3OC4 A;  2XCG A;  2XLS A;  3HYV A;  4YTM A;  4EM3 A;  2JK6 A;  2F5Z A;  2BS3 A;  2WPE A;  1Y56 A;  3RP7 A;  3H4K A;  1EBD A;  1JRX A;  1L9C A;  1N4V A;  3LAD A;  1DJQ A;  1OJC A;  1EL8 A;  5EB5 A;  2B7S A;  2ZBW A;  1OJD A;  3DGH A;  4K7Z A;  2Y6Q A;  3GDP A;  3P4S A;  1COY A;  1VRQ B;  2YVF A;  4TLZ A;  5BRT A;  3IHG A;  3GWD A;  4EQW A;  2A87 A;  4XWR A;  1TDN A;  3KA7 A;  1RYI A;  2XVE A;  1FOH A;  3KVE A;  3SZW A;  2GAG B;  3DK9 A;  4YSX A;  4TLX A;  4J33 A;  3M12 A;  1NHP A;  5FMH A;  1GRB A;  3SQP A;  4K2X A;  2O9Z A;  1H81 A;  1IJH A;  4U2L A;  4A6N A;  4USR A;  3LZX A;  4EMW A;  2BCG G;  1FEB A;  1ZP0 A;  1CC6 A;  2C76 A;  2YLZ A;  3KU9 A;  4MJW A;  4ZN0 A;  4P9S A;  1ZK7 A;  2FJD A;  2XFU A;  4Z24 A;  3NN6 X;  2C66 A;  1YQZ A;  5JCL A;  3UKQ A;  2J3N A;  4JNQ A;  1P2H A;  3T14 A;  4H4T A;  5CQF A;  2WOI A;  4LII A;  3R9U A;  4JY2 A;  2YLT A;  1DOE A;  3Q9T A;  4U8K A;  4YSZ A;  1LQT A;  4H4W A;  1EL7 A;  5KMR A;  2X50 A;  3NKS A;  4REK A;  1IUX A;  2A8X A;  3BI2 A;  1VQW A;  4OPT A;  3AEC A;  3VRD B;  3UKP A;  4A79 A;  4KX6 A;  2JB1 A;  4U8L A;  4AT2 A;  4E0V A;  2NVK X;  2XFN A;  3B6D A;  4BK2 A;  2V3A A;  1JRZ A;  3QVR A;  1PBE A;  4OPC A;  3UOZ A;  4D04 A;  3DME A;  1GAL A;  2C65 A;  4NTD A;  4AT0 A;  4NNJ A;  3ALM A;  4DSH A;  1FEA A;  2FBW A;  2RAB A;  4H2R A;  3NYC A;  4OPL A;  1K0L A;  3BNU A;  3CPJ G;  4PAA A;  1YQ3 A;  1N1P A;  3UTE A;  3SM8 A;  5EB4 A;  3QFB A;  3SFE A;  2YR4 A;  2C3D A;  4CRT A;  1PHH A;  2YLX A;  4H4Y A;  2B7R A;  1D7Y A;  3QFA A;  4OPU A;  2VRL A;  2X8C A;  1NAA A;  2GV8 A;  3ATR A;  4H4Q A;  3DK4 A;  4OPI A;  2Y6R A;  2B76 A;  4C3Y A;  2WPC A;  3RED A;  3UOX A;  2B9W A;  3CPH G;  3P1W A;  1D5T A;  2ZZB A;  1S2Q A;  1XPQ A;  5KXJ A;  1DXL A;  2EQ7 A;  3I3L A;  3M13 A;  2WET A;  2NPX A;  3AYJ A;  3HYW A;  1TRB A;  4GUV A;  1GRE A;  1PJ6 A;  2BAB A;  3NIX A;  2GR0 A;  3LXD A;  4H4U A;  1H82 A;  1E39 A;  5KOX A;  2GQW A;  2EQ6 A;  2YAU A;  1CJ4 A;  1PJ5 A;  2YR5 A;  3AD8 B;  5BUK A;  1XAN A;  3CPI G;  3VR9 A;  1ONF A;  3SXI A;  4H4V A;  3P4R A;  2CVJ A;  1S3B A;  3ATQ A;  3O0H A;  3C4N A;  2GF3 A;  2X3N A;  3NYE A;  4YKF A;  1IUU A;  1E1L A;  2EQ8 A;  1KFY A;  4GDP A;  4CY8 A;  2BK3 A;  3EPT A;  4CCR A;  1JRY A;  1F8S A;  2DKH A;  4JNA A;  4TM1 A;  3SX6 A;  3EF6 A;  3AE1 A;  5HY5 A;  1BGJ A;  4JN9 A;  3VRB A;  3AWI A;  1PN0 A;  2YM1 A;  4GAV A;  4J31 A;  3NHO X;  3RNM A;  1GES A;  3UOV A;  4M52 A;  1JNZ A;  2XVJ A;  1D4C A;  3V3O A;  2Z5Y A;  2XFP A;  1JEH A;  1XDI A;  4N9X A;  3PG6 A;  3AEA A;  4NZH A;  3EAN A;  2UZZ A;  2Q0L A;  1GND A;  3RP6 A;  5LV9 A;  2CFY A;  1IUW A;  4AOS A;  4CBQ A;  4J34 A;  1E1N A;  2WHD A;  3AYI A;  2H88 A;  4ECH A;  4FK1 A;  2H89 A;  2BYB A;  3ISH A;  4B65 A;  4EQR A;  2WDQ A;  3F8R A;  4GDE A;  4OCG A;  5JCN A;  4H4R A;  2RGJ A;  2YG6 A;  3E1T A;  1F3P A;  3CN8 A;  2BCP A;  1ZDL A;  1KNP A;  2APG A;  4DSG A;  4Y4M A;  3NK1 X;  2IVE A;  2WOW A;  4I59 A;  2GQF A;  3GYJ A;  1BF3 A;  3QSE A;  4U2T A;  5BUL A;  4U8P A;  5IPY A;  2X8G A;  1GOS A;  3AB1 A;  3KPK A;  3DK8 A;  1AOG A;  2VQ7 A;  2XFQ A;  2AQJ A;  2BXR A;  4GAP A;  4YT0 A;  3SGL A;  4BUR A;  2JB2 A;  3NTD A;  2VOU A;  3GD4 A;  4EQS A;  4DGK A;  4J2W A;  4Z2U A;  2TMD A;  5HYM A;  5KOW A;  2ARD A;  1TDO A;  1LV0 A;  3II4 A;  4G73 A;  4UDP A;  2V60 A;  1DOB A;  1TYP A;  1GEU A;  3T0K A;  2OLO A;  4LA1 A;  2Q7V A;  3CGD A;  3F8D A;  3H8L A;  4RSL A;  3K7Q X;  1L9E A;  4APN A;  1PJ7 A;  2OAM A;  3FBS A;  1FEC A;  1YKJ A;  1TDE A;  4K22 A;  1SEZ A;  5U25 A;  3AE4 A;  2JBV A;  1OJ9 A;  3NGC X;  2R4E A;  4IV9 A;  2V61 A;  1N4W A;  3NK2 X;  4U2S A;  5IQ1 A;  4NEW A;  2WP6 A;  2YQU A;  4H50 A;  2BAC A;  2BK5 A;  2Z5X A;  1D4D A;  4XWZ A;  2PHH A;  1B4V A;  4O5Q A;  1ZOV A;  1E1M A;  4U8O A;  5IQ4 A;  3GYX A;  3DJG X;  4BJY A;  3AED A;  4Z2T A;  2XDO A;  3AYL A;  5GRT A;  5EOW A;  3AEG A;  4A9W A;  3CGB A;  3SZF A;  3GD3 A;  4JDR A;  2B9X A;  3QSS A;  2W0H A;  1H84 A;  1H7W A;  2GB0 A;  3CGE A;  3S61 A;  3KPF A;  3T37 A;  2AAQ A;  3UTG A;  3LJP A;  5U63 A;  1B5Q A;  1NEK A;  3K7M X;  1M6I A;  1ZY8 A;  3AE8 A;  2XVF A;  1MOK A;  3V76 A;  3AE2 A;  3SZC A;  1NHS A;  2OLN A;  1LQU A;  1XHC A;  4PAB A;  1H6V A;  1LPF A;  1L0V A;  1CHU A;  1IUT A;  3NK0 X;  5KRQ A;  2BS2 A;  1VG9 A;  4OPD A;  2JAE A;  1IUV A;  1EL9 A;  4A65 A;  2I0Z A;  1Z6L A;  2ZZ0 A;  3IHM A;  3T2K A;  4B64 A;  3NH3 X;  3AE9 A;  4C77 A;  1DNC A;  1QO8 A;  1GRH A;  3SFD A;  1H83 A;  3GMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...