2NVKX

Crystal structure of thioredoxin reductase from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
481
structure length
481
Chain Sequence
YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Biochemical Studies Reveal Differences in the Catalytic Mechanisms of Mammalian and Drosophila melanogaster Thioredoxin Reductases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords Thioredoxin Reductase
total genus 154
structure length 481
sequence length 481
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
X PF00890 FAD_binding_2 FAD binding domain
X PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2nvkX03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX02
4DNAA 4EQRA 4APNA 1OJAA 2FJEA 4EQXA 3NYEA 4D04A 5U1OA 3DGHA 3DK9A 1KSUA 4X9MA 3DK4A 2CULA 2E1MA 3AD8B 3FIMB 4C5OA 4FX9A 4NEWA 4OPLA 4CY6A 4H4RA 3FPZA 1DOBA 3ADAB 1DOCA 1LTXR 5U63A 3P1WA 4LA1A 3GWFA 4A5LA 1ZOVA 4BV6A 3B3RA 2VQBA 1YY5A 4GUVA 1HYUA 3CGDA 2YVJA 4GDEA 2QCUA 3UCLA 3CNSA 1F6MA 3LADA 2WDQA 4J33A 3RNMA 5JCMA 1CJ2A 3LZXA 1XDIA 1ZMCA 2B7RA 2VVLA 3CTYA 2V5ZA 5FS6A 4ZCDA 4H4ZA 2GQFA 3AE2A 3BI5A 2PYXA 1PJ7A 2WHDA 1V59A 3Q6JA 1F8SA 1O94A 2YLTA 4NZHA 2NPXA 1NG3A 5JCKA 1N4UA 4YKGA 1PBFA 4UDRA 4YSYA 3UKHA 1IUWA 2V3AA 4OCGA 1KF6A 1MOKA 4B68A 1NHQA 1L0VA 4J36A 3UOVA 4REKA 4YWOA 1GTHA 4NTEA 1JEHA 2V61A 3AD7B 3QSEA 2XDOA 3EPTA 1FECA 4ZN0A 4EMWA 5DBJA 2R9ZA 1DJQA 1GRTA 2XFUA 2BABA 1NG4A 2BYBA 4YT0A 2BC0A 2R0CA 1GEUA 2GR0A 2NVKX 2YVGA 1DOEA 4D03A 1N1PA 2ZZCA 5C2TA 3VQRA 5HXIA 1B4VA 3AYLA 3GSIA 4YSXA 1ZX9A 3FBSA 4DSGA 3CPIG 1H83A 4KPRA 4B63A 2GQWA 1D7YA 4C3YA 5KOXA 4A9WA 2C72A 3UTHA 5BULA 2GR3A 1TDEA 1D4DA 1CL0A 2YG3A 3AE3A 3P4PA 4Y4MA 1EL5A 2WDVA 5FMHA 2Y6QA 4IA5A 1NHPA 3I6DA 1KFYA 2RGHA 3CN8A 2X8CA 2XFOA 3QJ4A 1YQZA 3GWDA 2C76A 4TLZA 4A6NA 2B9YA 1N4VA 2BCPA 4TM3A 5BVAA 5IQ4A 3IHMA 2YLWA 1CJ4A 1X31B 2VQ7A 1PBDA 2OLOA 3NYFA 1LJ1A 1H84A 1OJ9A 2YG5A 4IV9A 4NTDA 1E7PA 4A7AA 2TPRA 3QSSA 3S61A 1BKWA 1LQTA 4RG4A 2GRTA 3UKAA 1ZP0A 2OALA 5HY5A 2BC1A 1GRBA 1AOGA 1KSSA 1N4WA 2ACZA 4A99A 3UP5A 2GR2A 3T37A 2VRLA 3NTDA 1EL7A 1E1MA 1NAAA 3BNMA 3CIRA 2BXRA 3AECA 3NRNA 4OPGA 2CFYA 4GCMA 1E1NA 3UP4A 4H4YA 3QSMA 4AOSA 4YTNA 2GEWA 1BF3A 1MXTA 2GH5A 2XVEA 1PJ5A 4U8MA 3F8PA 2XCGA 3CNTA 4Z2RA 1IUVA 2QA1A 3E1TA 2GAGB 2JBVA 3RHAA 3V3OA 3S5WA 4H4QA 5J60A 3NTAA 1F3PA 1S3EA 3BI2A 4ECHA 4H4SA 4H2NA 3VRAA 2BK3A 2XLPA 1E6EA 1PBCA 1PS9A 4JY2A 4H2QA 3BHKA 4J56A 1EL9A 1BGNA 1S3BA 2XLSA 3DJDA 1PBEA 3NK2X 3PO7A 5J7XA 2YVFA 2CDUA 2Z5YA 3HZLA 2DKHA 2V60A 1Q9IA 1BWCA 3RP8A 1Q1WA 2XLTA 3SQPA 2WQYA 1YKJA 3AEAA 4K2XA 5EOWA 4CNKA 1BZLA 1JNRA 4XXGA 1O95A 4K5SA 1PXCA 1E39A 1OJCA 2XFNA 2YR4A 2BS2A 2IVEA 3DJEA 4U8LA 3V3NA 1PN0A 3GMCA 1P2HA 1UKVG 2V3BA 4YSHA 1H6VA 2R46A 3KD9A 2WP6A 3ALJA 3KLJA 3COXA 1GSNA 4USRA 1F8RA 2IVDA 4I59A 5KRQA 2X8HA 2Q6UA 2XFPA 4C3XA 3CGCA 2XVIA 2WS3A 2QA2A 2EQ9A 3NK1X 4O5QA 2W0HA 2A87A 1D4EA 1JNZA 3IWAA 3VRBA 1QO8A 2E5VA 4H4VA 2Z5XA 3B6DA 4HA6A 4DGKA 1GT8A 3C4NA 2YR6A 3K7QX 5JCIA 4IA6A 2XLRA 1RSGA 4FK1A 3M13A 4U8JA 1GTEA 4WCTA 5KVHA 4YTMA 1GALA 3RP6A 1M64A 2AR8A 4TM0A 4K22A 3PS9A 5FS8A 4JNQA 2HQMA 2GAHB 1LVLA 1OJDA 4U8KA 2E4GA 1JRXA 4OPCA 1PJ6A 2WU2A 2BS3A 2OLNA 3CPJG 2YM1A 1PXBA 3DH9A 2JK6A 4J2WA 3CNJA 3BI4A 2R0GA 3JSKA 2AAQA 4Y4NA 3FMWA 3AE8A 1VDCA 2DKIA 1D4CA 3CNPA 1NHRA 4K5RA 3UTEA 1KDGA 4BK2A 4ICYA 3AEBA 2GMHA 3VR8A 4BK3A 1F8WA 5EB5A 2YLSA 2I0ZA 1IUSA 3H4KA 3ICRA 4H50A 4Z25A 4Z26A 2VRMA 4EMIA 4LU6A 1TRBA 5IPYA 3IF9A 1Y56A 5BRTA 3ALMA 3EANA 3AD9B 1PXAA 3AB1A 2XYOA 4CBQA 2C3DA 1VQWA 1GPEA 3GMBA 4NEVA 5FS9A 3WE0A 3SFDA 1IJHA 3ATQA 1LV0A 2Y6RA 3UOXA 2YG7A 1P2EA 3P9UA 4BURA 1E1KA 2Q0KA 5C3JA 3DA1A 2YLRA 4HB9A 3EF6A 4CY8A 4TLXA 3UKKA 1CBOA 1Y0PA 4U2SA 3C4AA 2R4JA 2QAEA 5ER0A 4GF7A 4BK1A 5GSNA 2RGJA 4H4WA 3AEDA 2FJDA 3BNUA 2JB2A 3UKQA 1FEAA 5FS7A 3CNDA 2WESA 2BA9A 4H2RA 2B7SA 1S2QA 1XHCA 1Z6LA 1W4XA 3AYJA 3QFAA 1GRFA 3R9UA 2FJBA 1QJDA 4EM3A 1CJCA 5EBKA 2X8GA 2EQ8A 4Z2UA 5KWFA 2UZZA 3GD4A 1ZY8A 1RP0A 4DSHA 2XLUA 3PVCA 2TMDA 4N9XA 3SGLA 3H8IA 3AE9A 3V76A 1IUUA 5HHFA 1VRQB 1GESA 1H81A 3KU9A 5LV9A 2RABA 3REDA 4OPUA 1SEZA 5JCNA 2B76A 3GRSA 3ICTA 1NENA 4E0VA 4BJZA 4YKFA 4XWZA 1H7XA 1GOSA 3QVPA 3M12A 3NN6X 4PABA 4TM1A 2C7GA 4Z24A 3UKLA 1NPXA 5KVIA 5EB4A 4OPTA 1ZKQA 3AYIA 1MO9A 2WOWA 3LXDA 2IIDA 2YR5A 3AE4A 2FJAA 5U25A 2RGOA 2VOUA 4U2TA 1ZMDA 2WDRA 3KVEA 3FG2P 4Z2TA 1LQUA 3DJJA 2R4EA 1K0JA 3NN0X 1B37A 3AEGA 3RP7A 1DXLA 2PHHA 2WBAA 2YM2A 4U8IA 4YXDA 4B64A 3CGBA 2WP9A 2J3NA 2BS4A 3UTGA 3AEFA 3GYJA 3GRTA 2OAMA 3NGCX 4BJYA 3QFBA 4KX6A 4AP1A 3G5SA 4K8DA 2GV8A 2XFQA 3KPFA 4CCRA 4O5UA 4M52A 5TR3A 1PDHA 2JAEA 4FDCB 1RYIA 3UTFA 2Q0LA 4B1BA 2EQ6A 2YAUA 2R45A 3UOZA 1GRGA 5IQ1A 3G5QA 4JNAA 5HYMA 1IUTA 1K0LA 3NLCA 2WP5A 1GERA 5JCLA 4IVMB 1FEBA 1L9CA 3NIXA 3I3LA 3CGEA 2C65A 2B9XA 3AE5A 1JU2A 3EAOA 3P4SA 1VG9A 4IVOB 2FBWA 3NT6A 1DJNA 1GNDA 3DMEA 4EM4A 4USQA 3UKFA 1XANA 3LOVA 1ZDLA 4CRTA 1NEKA 3AEEA 1XPQA 1QLBA 4H4UA 4GRTA 4J31A 4LIIA 1FCDA 2VVMA 4AOXA 4JN9A 2JKCA 3Q9TA 1B8SA 1ONFA 3AE1A 3BHFA 3D1CA 4YSZA 1TDNA 4B65A 4H4XA 4GDPA 3ISHA 2VVLG 3II4A 1CC4A 3KA7A 4B69A 2WPEA 2GVCA 1KNRA 4NTCA 4XWRA 5L46A 3DGZA 1IUXA 1GXFA 1PHHA 4X4JA 1H82A 2C70A 1GREA 4Y4LA 4Z43A 1CJ3A 2X3NA 2XVJA 3LB8A 4OPDA 1ZK7A 4H4TA 4MJWA 3LJPA 1GRHA 1Y56B 2WETA 1YQ4A 5KOWA 1TYPA 5CQFA 2H89A 4RG3A 3DJGX 3ZDNA 4H4PA 1BGJA 2XVFA 4PAAA 3GYIA 2F5ZA 4JQ9A 1ELIA 4P9SA 3O0HA 2R0PA 2BK4A 4Z44A 4A6NB 2C64A 2WU5A 2BACA 2YQUA 3NYCA 3L1RA 3URHA 1B5QA 4EIQA 2WOIA 4EQWA 4CNJA 2C67A 4B66A 1S2YA 1REOA 1LPFA 3DK8A 1CF3A 1FL2A 2EQ7A 1ZOYA 3ALLA 4U8OA 1H86A 4UDQA 1E1LA 2BCGG 3K7MX 3AXBA 1DODA 4FK1C 4J34A 1DNCA 5CKUA 4U2LA 1PBBA 4WX1A 1K4QA 3ZYXA 3SM8A 4GR1A 3GD3A 4EMJA 2YG4A 3OZ2A 2C75A 5GRTA 1TDOA 2BK5A 2XVHA 1TDKA 2GB0A 2YLZA 1TDFA 1FOHA 3AE7A 3ABVA 3NNEA 4OPIA 4A79A 4CCQA 4EIPA 4A65A 1H7WA 3ATRA 5M10A 4JY3A 1Q1RA 1JRYA 3IHGA 3P4QA 3LZWA 2X99A 3K7TA 4UP3A 4RSLA 3NHOX 1K0IA 4JDRA 1EL8A 2YWLA 1L9EA 3F8DA 3L8KA 3QVRA 3NH3X 2O9ZA 2ARDA 1JOAA 1VG0A 4C74A 2ZBWA 4K7ZA 3H8LA 1D5TA 3GDNA 1EBDA 4H7UA 1COYA 2GF3A 3UOYA 1GETA 2APGA 4C77A 3UKPA 2BXSA 1YQ3A 1NHSA 1GV4A 3ITJA 5BUKA 4EQSA 2GR1A 3P4RA 2VZ2A 3NK0X 2C66A 2A8XA 2OA1A 4X9NA 4UDPA 4ZCCA 1CC6A 2V6OA 4TM4A 2WPFA 2ZZBA 3IC9A 1M6IA 1CC2A 3C96A 2B9WA 3GDPA 4OVIA 5M0ZA 5KXJA 1CHUA 4YTPA 1NDAA 2H88A 3VR9A 3VRDB 3AE6A 4AT0A 1TYTA 3M0OA 3ICSA 2A89A 4AP3A 2CVJA 2JB1A 1GRAA 3NG7X 1JRZA 2C73A 3KKJA 2YG6A 4AT2A 3G5RA 3SFEA 2WOVA 1KNPA 1OJTA 2C3CA 3NKSA 4U8NA 4ADWA 4U8PA 2YLXA 3F8RA 3CPHG 3K30A 1D7LA 2JB3A 4I58A 2WPCA 2AQJA 4H2PA 2ZZ0A 2Q7VA 4B67A 3D8XA 1O5WA 4J57A 3AWIA 2X50A 3OC4A 2WEUA 1L9DA 2GMJA
chains in the Genus database with same CATH superfamily
2FJEA 2FYMA 4EQXA 3NYEA 3DK9A 3U9IA 2E1MA 3FPZA 1DOBA 1LTXR 4A5LA 1ZOVA 3B3RA 2HNEA 4MGGA 1HYUA 4GDEA 5JRBA 1CJ2A 3T2KA 3HRDC 2WHDA 3Q6JA 1O94A 3MKCA 2YLTA 1NG3A 1N4UA 1FHVA 4YSYA 5FJUA 1RM6B 3DG6A 2I5QA 3S5SA 5KMRA 5DBJA 2R9ZA 3NFUA 1MUCA 1NG4A 2BC0A 2R0CA 1GEUA 2NVKX 1N1PA 3VQRA 3GSIA 3AYLA 1MNSA 1H83A 3UJRA 1D7YA 3D47A 2GR3A 1TDEA 1N60C 2YG3A 5FMHA 4IA5A 3I6DA 1NHPA 2AL2A 3T2ZA 3ENLA 1YQZA 2B9YA 4TM3A 1CJ4A 1MDLA 3ZVHB 1E7PA 2TPRA 3QSSA 1ZP0A 5FJTA 1AOGA 1KSSA 4HCHA 3UP5A 3DFYA 1NAAA 2BXRA 3AECA 1E1NA 2GEWA 2ZC8A 1PJ5A 4U8MA 4Z2RA 1IUVA 3I4KA 4KT2A 2JBVA 3V3OA 4H4QA 3SY4A 1E6EA 4H2QA 1EL9A 3BSMA 2XLSA 3CMMA 3R07C 1Q9IA 3SQPA 3AEAA 4K2XA 1BZLA 4XXGA 1E39A 1OJCA 2XFNA 4U8LA 3GMCA 3FXGA 1GSNA 2GGEA 4I59A 2XFPA 3NK1X 2W0HA 1XS2A 1JNZA 4J3ZA 3VRBA 4H4VA 3QKEA 5JCIA 3ZVHA 1RSGA 4FK1A 5KVHA 4TM0A 1LVLA 1T3QC 1OJDA 3SZWA 1NU5A 2PA6A 4OPCA 3KPKA 3DH9A 2JK6A 3CNJA 3JSKA 2R0GA 3DEQA 4IP4A 2DKIA 3UTEA 4K5RA 4E6MA 2YLSA 2I0ZA 3ICRA 4Z25A 3FV9A 4G73A 2XYOA 1GPEA 5FS9A 3TCSA 3ATQA 4Z17A 3P9UA 1S7MA 2Q0KA 3DA1A 2YLRA 3EF6A 1CBOA 1Y0PA 2R4JA 3SZFA 4H4WA 4H83A 4HNLA 1FEAA 3CAWA 2BA9A 2B7SA 3SXIA 1XHCA 2FJBA 1CJCA 3SZ0A 2XLUA 3NZGA 3PVCA 2OQYA 3UJSA 1GESA 1H81A 5LV9A 4OPUA 2B76A 3ICTA 2OLAA 3DIPA 3M12A 3JZUA 3T4WA 3NVVB 1NPXA 3GO2A 3AYIA 2GDQA 3T8QA 2RGOA 3UGVA 1LQUA 4U8IA 2WP9A 2J3NA 4JHMA 3AEFA 4AP1A 2GV8A 2OZTA 3UXKA 1RYIA 2Q0LA 3UOZA 5HYMA 1IUTA 1K0LA 1W6TA 2WP5A 2W54A 4GISA 4IVMB 1L9CA 3I3LA 3A7UA 2C65A 1JU2A 3P4SA 1VG9A 4IVOB 2FBWA 1GNDA 3DMEA 2PGWA 1FCDA 4JN9A 3Q9TA 1B8SA 2AKMA 1TDNA 4B65A 3PFRA 4B69A 3TWAA 1IUXA 4Z43A 1CJ3A 4OPDA 4MJWA 1GRHA 2QDDA 1TYPA 3H8AA 4H4PA 1BGJA 3DG3A 3EEZA 2OFJA 3N6JA 4II2A 2PS2A 3DGBA 2W3RA 3RO6A 4H1ZA 1CF3A 3ALLA 2EQ7A 1E1LA 3AXBA 3QLDA 1DNCA 1PBBA 4WX1A 1K4QA 3SM8A 2BK5A 2XVHA 4A79A 2GB0A 4YKGA 1TDFA 5M10A 3A7AA 4K2SA 2O9ZA 1JOAA 2ZBWA 1D5TA 4DN1A 3N4FA 3Q4DA 1GV4A 2VZ2A 2OA1A 4X9NA 4UDPA 3IC9A 4YTPA 1NDAA 3AE6A 4AT0A 3ETRB 2OG9A 4K8GA 1TYTA 1E9IA 3R1ZA 3STPA 5FJOA 2YG6A 3SBFA 3G5RA 7ENLA 1KNPA 2P8BA 4ADWA 2YLXA 3CPHG 3K30A 1JPDX 3DFHA 3D8XA 4J57A 3NVZB 1L9DA 4DNAA 4EQRA 1KSUA 4X9MA 2PTWA 2CULA 4FX9A 4MMWA 4OPLA 1JROA 5U63A 3P1WA 3GWFA 4GMEA 1BKHA 1YY5A 4GUVA 3CGDA 2YVJA 3P3BA 2QCUA 3UCLA 1MDRA 3CNSA 3LADA 2BRYA 1X2GA 2OVLA 2VVLA 4ZOHB 4ZCDA 5FS6A 1PDZA 3UKHA 3VCCA 4OCGA 4REKA 4YWOA 4NTEA 2PP3A 1SJAA 1FECA 3FYYA 3ZVIA 2XFUA 2BABA 2GR0A 2YVGA 1DOEA 1FFVC 2QGYA 2GQWA 5IDZA 2C72A 2AKZA 3NVWB 4H19A 1EL5A 3SQSA 3PK7A 1KFYA 2RGHA 3CN8A 2XFOA 2C76A 4TLZA 1PDYA 5BVAA 1MRAA 3TW9A 3IHMA 3V4BA 2VQ7A 3NYFA 4H2HA 1N4WA 5BOFA 4A99A 2PSNA 2GR2A 3T37A 3NTDA 1E1MA 2PU0A 4H4YA 2P88A 1KN0A 3F8PA 3BOXA 4IT1A 2XCGA 2QA1A 2PODA 5J60A 3NTAA 1F3PA 1S3EA 3VRAA 5FJRA 4G6GA 2XLPA 1PBCA 4JY2A 3VC5A 3QPEA 1BGNA 3PO7A 1KCZA 3HZLA 3V5CA 1Q1WA 4CNKA 1YKJA 3DG7A 1JNRA 2BS2A 1JCTA 3TJ4A 4HYRA 1PN0A 1P2HA 1UKVG 3KD9A 2WP6A 3COXA 1F8RA 3CGCA 2XSXA 3IWAA 1L8PA 4DGKA 1GT8A 5KMSA 2XH7A 2YR6A 2XLRA 3MY9A 4HN8A 1GTEA 3RP6A 1M64A 5FS8A 3TJIA 4E4FA 3R0UA 1JRXA 2BS3A 3CPJG 1PXBA 3BI4A 3IJQA 4Y4NA 1ELSA 3FMWA 1BQGA 3CNPA 1D4CA 1F8WA 5EB5A 3N6HA 4G8TA 4GIRA 3GC2A 3H4KA 4H50A 4Z26A 2VRMA 4EMIA 5IPYA 1Y56A 5BRTA 1PXAA 2OO6A 2C3DA 2W55A 3T31A 2YG7A 5C3JA 4TLXA 2O56A 3RCYA 5GSNA 2QVHA 2FJDA 3CB3A 3CT2A 3QFAA 4M0XA 1GRFA 5EBKA 5KWFA 4FP1A 3GD4A 3R0KA 4DSHA 4N9XA 1VRQB 2RABA 3REDA 5JCNA 3GRSA 4YKFA 2OPJA 1GOSA 4HCLA 3UJEA 1ZKQA 1MO9A 3AE4A 4G74A 4HNCA 2FJAA 1ZMDA 3FG2P 3DJJA 2R4EA 1K0JA 3AEGA 2YM2A 4B64A 3NVYB 3UTGA 3GYJA 3NRZB 3GRTA 3NGCX 3G5SA 3CYJA 2XFQA 4M52A 6ENLA 4DYEA 4FDCB 2EQ6A 2YAUA 2OQHA 3NLCA 3NS1B 3Q45A 3AE5A 3ZLHA 3NT6A 3MWCA 3HYXA 4MKSA 4J31A 4GRTA 4AOXA 4IL2A 3NXLA 2JKCA 1ONFA 4YSZA 3L5OA 4H4XA 4GDPA 3II4A 2GVCA 3DGZA 4X4JA 1H82A 1FO4A 1GREA 2X3NA 1ZK7A 4H4TA 2POZA 1Y56B 5CQFA 4RG3A 3DJGX 2HXUA 4PAAA 2F5ZA 4P9SA 1V97A 4A6NB 2C64A 2WU5A 3NYCA 3URHA 2XGZA 1WUFA 2WOIA 3SN1A 3CXOA 1ZOYA 4U8OA 4GFIA 1DODA 3ZYXA 1FOHA 3AE7A 3ABVA 3NNEA 4EIPA 4A65A 1H7WA 1JRYA 4UP3A 4RSLA 1K0IA 2YWLA 1L9EA 3F8DA 3L8KA 3NH3X 1SJBA 2QJJA 3H8LA 3R25A 1EBDA 1COYA 3K1GA 2BXSA 3V5FA 1YQ3A 5BUKA 3IJLA 5KMQA 4EQSA 3P4RA 2C66A 4ZCWA 5M0ZA 1P48A 1CHUA 3VRDB 3ICSA 3CK5A 2A89A 3NG7X 2JB1A 1GRAA 1JRZA 2C73A 4AT2A 4Z1YA 2WOVA 4A6GA 4U8NA 4U8PA 4A3RA 3F8RA 1F9CA 2AQJA 3SYIA 4H2PA 3AWIA 3GWDA 2GMJA 4APNA 4D04A 4DWDA 4IHCA 5U1OA 3DK4A 3SSZA 3FIMB 4C5OA 4NEWA 4H4RA 2VQBA 3AN1A 2XH2A 1F6MA 2WDQA 4J33A 3RNMA 5JCMA 1XDIA 2B7RA 4X2PA 4TVWA 3AE2A 3OTRA 1PJ7A 3RGTA 4NZHA 2NPXA 1PBFA 4UDRA 2V3AA 3EUB3 4B68A 5G5HB 4J36A 3UOVA 1GTHA 3H7VA 2XDOA 3U4FA 1SB3B 1DJQA 1GRTA 2BYBA 4YT0A 3UJ2A 3A7RA 4D03A 2ZZCA 1B4VA 1ZX9A 3D46A 4KPRA 4C3YA 3FJ4A 4GAVA 5BULA 4IL0A 1CL0A 4Y4MA 4IZGA 3QJ4A 3PWGA 4A6NA 1TKKA 2BCPA 1N4VA 5IQ4A 3JW7A 1PBDA 1OJ9A 2YG5A 4NTDA 2FKPA 1BKWA 4RG4A 2GRTA 3UKAA 2ACZA 1GRBA 3GD6A 2E3TA 1EL7A 3BNMA 3CIRA 3NRNA 3T0KA 4AOSA 2GGIA 2GH5A 3B97A 4TVYA 4JN8A 3DESA 4JN7A 3S5WA 3BI2A 1P43A 3VDGA 1EC7A 4H2NA 5FJPA 1PS9A 3BHKA 4J56A 3DJDA 1PBEA 2YVFA 2Z5YA 2DKHA 3T2YA 1O95A 1R6WA 3DJEA 2IVEA 4YSHA 2R46A 3ALJA 3KLJA 4C3XA 2WS3A 2EQ9A 3UCDA 3R11A 3S47A 1QO8A 2P3ZA 4ROPA 4YWSA 3AMZA 4ENLA 2PTZA 1TE6A 4IA6A 4U8JA 2W3SA 1GALA 2GAHB 2QQ6A 2MUCA 4E4UA 1JDFA 3VA8A 1PJ6A 2WU2A 4GAPA 2YM1A 3IK4A 4J2WA 1VDCA 1KDGA 4BK2A 4K1WA 2PP1A 2GMHA 3TTEA 4HPNA 1IUSA 2PTYA 1TRBA 3IF9A 3EANA 3AB1A 3GY1A 1VQWA 1STZA 4NEVA 3WE0A 4EWJA 1LV0A 2PU1A 2Y6RA 1P2EA 2C4CA 1EBGA 3PG6A 1FHUA 1E1KA 4HB9A 3UKKA 4U2SA 1N5XA 3C4AA 4BK1A 2RGJA 3MSYA 3BNUA 2JB2A 5FS7A 3CNDA 2WESA 4H2RA 1W4XA 2MNRA 3AYJA 2PTXA 4EM3A 2X8GA 2EQ8A 4Z2UA 2UZZA 1ZY8A 2HZGA 2TMDA 1N63C 3SGLA 3AE9A 3BJSA 1IUUA 5HHFA 3MUCA 2OZ8A 3KU9A 4G9KA 1SEZA 1JPMA 4E0VA 4XWZA 1EBHA 3QVPA 4A35A 3NN6X 4PABA 4Z24A 3UKLA 5EB4A 2WOWA 3LXDA 5U25A 2VOUA 2WDRA 3KVEA 4Z2TA 5EU9A 1B37A 3VCNA 2WBAA 1JRPA 3OZYA 2BS4A 2OAMA 4BJYA 4KX6A 2QDEA 3UJFA 5TR3A 2JAEA 3ZLGA 4NWZA 1GERA 3NIXA 3EAOA 1EC9A 3RITA 1KKRA 2RDXA 1YEYA 4EM4A 3UKFA 3LOVA 4CRTA 3AEEA 3ZLFA 3D9XA 1QLBA 4H4UA 4LIIA 4ZA0A 1WUEA 2VVMA 2DW7A 3QN3A 3AE1A 3BHFA 2ONEA 3UXLA 3ISHA 3FCPA 1CC4A 2WPEA 1KNRA 4NTCA 3HYWA 1GXFA 4Y4LA 3LB8A 2OX4A 3LJPA 3RR1A 3OZMA 5KOWA 3VFCA 4J1OA 3ZDNA 3SR6B 3O0HA 2R0PA 1OEPA 2BACA 1XPYA 3L1RA 1B5QA 3P0WA 1SJDA 4EQWA 2C67A 4B66A 4GGHA 1REOA 1LPFA 1FL2A 1H86A 3HPFA 4J34A 4FK1C 5CKUA 2YG4A 3OZ2A 2C75A 1TDOA 1KD0A 2OZ3A 4JY3A 1Q1RA 3P4QA 3IHGA 2X99A 1SJCA 3NHOX 4JDRA 4G6HA 2ARDA 4C74A 2GF3A 1GETA 2APGA 3UKPA 1NHSA 3NO1A 2P8CA 2E5AA 4ZCCA 1CC6A 4TM4A 3C96A 3GDPA 1VDVA 1WYGA 2H88A 2NQLA 5ENLA 3M0OA 4HCDA 4AP3A 3PWIA 1FFUC 2DW6A 3MZNA 3KKJA 3SFEA 1R0MA 1OJTA 2C3CA 1X2HA 1D7LA 3JVAA 4I58A 3OPSA 3MQTA 2ZZ0A 3OC4A 4KWSA 1OJAA 4E5TA 3DGHA 4NNJA 3AD8B 2ZADA 4CY6A 3ADAB 1DOCA 4LA1A 4BV6A 1KKOA 3QTPA 1N62C 3LZXA 1ZMCA 3CTYA 1VQZA 2V5ZA 4GYPC 4H4ZA 2GQFA 3BI5A 2PYXA 1V59A 1F8SA 5JCKA 1IUWA 1KF6A 1MOKA 1NHQA 1L0VA 4F4RA 3SX6A 1JEHA 2V61A 3AD7B 3QSEA 3EPTA 4ZN0A 4EMWA 2XH0A 5C2TA 5HXIA 1FIQB 4YSXA 3FBSA 4DSGA 3CPIG 4GYPA 4B63A 5KOXA 4A9WA 3UTHA 1N5WC 1ZXIC 4DX3A 1D4DA 3AE3A 2PMQA 3P4PA 2WDVA 2Y6QA 2X8CA 4DHGA 3SN0A 2GGGA 2YLWA 1X31B 2OLOA 1LJ1A 1H84A 4IV9A 3KUMA 4A7AA 3S61A 1LQTA 3THUA 2OALA 5HY5A 2BC1A 4G7FA 2VRLA 4OPGA 2CFYA 4GCMA 3UP4A 4YTNA 3QSMA 3GYXA 1BF3A 1MXTA 2XVEA 3CNTA 5G5GB 3E1TA 2GAGB 3RHAA 4ECHA 2HXTA 4H4SA 2BK3A 1ONEA 1S3BA 3NK2X 2OKTA 3V3WA 5J7XA 2CDUA 3DERA 2V60A 3RP8A 1BWCA 2XLTA 3T9PA 2WQYA 1NELA 5EOWA 4K5SA 1PXCA 3HYVA 2YR4A 2P0IA 3ES8A 3V3NA 2V3BA 1H6VA 4FI4A 4USRA 2IVDA 5KRQA 2X8HA 2Q6UA 2XVIA 2QA2A 4O5QA 2A87A 1D4EA 2E5VA 2Z5XA 3B6DA 3AM9A 4HA6A 3C4NA 3K7QX 3B9JB 3M13A 4WCTA 4YTMA 2AR8A 4K22A 1DTNA 3PS9A 4JNQA 2HQMA 3T14A 4U8KA 2E4GA 3I6TA 2OLNA 2GGJA 1RVKA 2AAQA 3AE8A 1NHRA 4ICYA 3AEBA 3VR8A 4BK3A 3IJIA 4LU6A 3ALMA 3AD9B 4CBQA 5J04A 3GMBA 2GGHA 3SFDA 1IJHA 3UOXA 3N4EA 4BURA 3SJNA 4CY8A 2QAEA 5ER0A 4GF7A 5BOEA 1TZZA 3AEDA 4II3A 3UKQA 3I6EA 2GL5A 3TWBA 1S2QA 1Z6LA 3R9UA 1QJDA 2QJMA 1RP0A 3T6CA 3H8IA 3V76A 3H12A 1NENA 4BJZA 1H7XA 2GSHA 4GGBA 4TM1A 2C7GA 5KVIA 4OPTA 3R10A 2IIDA 2YR5A 4U2TA 1H2IA 3NN0X 3RP7A 1DXLA 2PHHA 4YXDA 3CGBA 5KMPA 3QFBA 4K8DA 3KPFA 1ECQA 4CCRA 4O5UA 2CHRA 1PDHA 3UTFA 4B1BA 2R45A 1EC8A 3SZCA 1GRGA 5IQ1A 3G5QA 4JNAA 3UCCA 1IYXA 5JCLA 3TQPA 1FEBA 3OP2A 3CGEA 3EKGA 2B9XA 1DJNA 4USQA 1XANA 1ZDLA 1NEKA 1XPQA 2PPGA 3D1CA 3HW2A 4KPLA 2VVLG 3KA7A 4XWRA 5L46A 1PHHA 2C70A 2AL1A 2XVJA 2WETA 1YQ4A 2PGEA 2H89A 4KEMA 2XH4A 2XVFA 3GYIA 4JQ9A 1ELIA 2BK4A 4Z44A 2YQUA 4EIQA 4CNJA 2AL2B 1S2YA 3DK8A 2BRAA 4UDQA 2BCGG 3K7MX 1N61C 4U2LA 5KNLA 3CXBA 4GR1A 3GD3A 4EMJA 3TOYA 5GRTA 2YLZA 1TDKA 4OPIA 4CCQA 3ES7A 3FVDA 3ATRA 4IP5A 2PP0A 3LZWA 3K7TA 2QJNA 1EL8A 3OW1A 3QVRA 1VG0A 4K7ZA 3GDNA 4H7UA 3UOYA 4E8GA 4C77A 3VC6A 3ITJA 3DDMA 2GR1A 3NK0X 2A8XA 2PCEA 2V6OA 2WPFA 2ZZBA 1CC2A 1M6IA 2B9WA 4OVIA 5KXJA 3VR9A 2CVJA 3RRAA 3NKSA 4M6UA 2JB3A 3H70A 2WPCA 3SN4A 2Q7VA 4B67A 1O5WA 2X50A 2WEUA 4DXKA 3P93A
chains in the Genus database with same CATH topology
4DNAA 4EQRA 4APNA 1OJAA 2FJEA 4EQXA 3NYEA 4D04A 5U1OA 3DGHA 3DK9A 1KSUA 4X9MA 4NNJA 3DK4A 2CULA 2E1MA 3AD8B 3FIMB 4C5OA 4FX9A 4NEWA 4OPLA 4CY6A 4H4RA 3FPZA 1DOBA 3ADAB 1DOCA 1LTXR 5U63A 3P1WA 4LA1A 3GWFA 4A5LA 1ZOVA 4BV6A 3B3RA 2VQBA 1YY5A 4GUVA 1HYUA 3CGDA 2YVJA 4GDEA 2QCUA 3UCLA 3CNSA 1F6MA 3LADA 2WDQA 5JRBA 4J33A 2BRYA 3RNMA 5JCMA 1CJ2A 3LZXA 1XDIA 1ZMCA 2B7RA 3T2KA 2VVLA 3CTYA 2V5ZA 5FS6A 4ZCDA 4H4ZA 2GQFA 3AE2A 3BI5A 2PYXA 1PJ7A 2WHDA 1V59A 3Q6JA 1F8SA 1O94A 2YLTA 4NZHA 2NPXA 1NG3A 5JCKA 1N4UA 4YKGA 1PBFA 4UDRA 4YSYA 3UKHA 2V3AA 1IUWA 4OCGA 1KF6A 1MOKA 4B68A 1NHQA 1L0VA 4J36A 3UOVA 4REKA 3SX6A 4YWOA 1GTHA 4NTEA 1JEHA 2V61A 3AD7B 3QSEA 2XDOA 3EPTA 1FECA 4ZN0A 5KMRA 4EMWA 5DBJA 2R9ZA 1DJQA 1GRTA 2XFUA 2BABA 1NG4A 2BYBA 4YT0A 2BC0A 2R0CA 1GEUA 2GR0A 2NVKX 2YVGA 1DOEA 4D03A 1N1PA 2ZZCA 5C2TA 3VQRA 5HXIA 1B4VA 3AYLA 3GSIA 4YSXA 1ZX9A 3FBSA 4DSGA 3CPIG 1H83A 4KPRA 4B63A 2GQWA 1D7YA 4C3YA 5KOXA 4GAVA 4A9WA 2C72A 3UTHA 5BULA 2GR3A 1TDEA 1D4DA 1CL0A 2YG3A 3AE3A 3P4PA 4Y4MA 1EL5A 2WDVA 5FMHA 2Y6QA 4IA5A 1NHPA 3I6DA 1KFYA 2RGHA 3CN8A 3T2ZA 2X8CA 2XFOA 3QJ4A 1YQZA 3GWDA 2C76A 4TLZA 4A6NA 2B9YA 1N4VA 2BCPA 4TM3A 5BVAA 5IQ4A 3IHMA 2YLWA 1CJ4A 1X31B 2VQ7A 1PBDA 2OLOA 3NYFA 1LJ1A 1H84A 1OJ9A 2YG5A 4IV9A 4NTDA 1E7PA 4A7AA 2TPRA 3QSSA 3S61A 1BKWA 1LQTA 4RG4A 2GRTA 3UKAA 1ZP0A 2OALA 5HY5A 2BC1A 1GRBA 1AOGA 1KSSA 1N4WA 2ACZA 4A99A 3UP5A 2GR2A 3T37A 2VRLA 3NTDA 1EL7A 1E1MA 1NAAA 3BNMA 3CIRA 2BXRA 3AECA 3NRNA 4OPGA 3T0KA 2CFYA 4GCMA 1E1NA 3UP4A 4H4YA 3QSMA 4AOSA 4YTNA 3GYXA 2GEWA 1BF3A 1MXTA 2GH5A 2XVEA 1PJ5A 4U8MA 1KN0A 3F8PA 2XCGA 3CNTA 4Z2RA 1IUVA 2QA1A 3E1TA 2GAGB 2JBVA 3RHAA 3V3OA 3S5WA 4H4QA 5J60A 3NTAA 1F3PA 1S3EA 3BI2A 4ECHA 4H4SA 4H2NA 3VRAA 3SY4A 4G6GA 2BK3A 2XLPA 1E6EA 1PBCA 1PS9A 4JY2A 4H2QA 3BHKA 4J56A 1EL9A 1BGNA 1S3BA 2XLSA 3DJDA 1PBEA 3CMMA 3NK2X 3PO7A 5J7XA 2YVFA 2CDUA 2Z5YA 3HZLA 2DKHA 2V60A 1Q9IA 1BWCA 3RP8A 1Q1WA 2XLTA 3T2YA 3SQPA 2WQYA 1YKJA 3AEAA 4K2XA 5EOWA 4CNKA 1BZLA 1JNRA 4XXGA 1O95A 4K5SA 1PXCA 1E39A 1OJCA 2XFNA 2YR4A 2BS2A 2IVEA 3DJEA 3HYVA 4U8LA 3V3NA 1PN0A 3GMCA 2V3BA 1P2HA 1UKVG 4YSHA 1H6VA 2R46A 3KD9A 2WP6A 3ALJA 3KLJA 3COXA 1GSNA 4USRA 1F8RA 2IVDA 4I59A 5KRQA 2X8HA 2Q6UA 2XFPA 4C3XA 3CGCA 2XVIA 2WS3A 2QA2A 2EQ9A 3NK1X 4O5QA 2W0HA 2A87A 1D4EA 1JNZA 3IWAA 3VRBA 1QO8A 2E5VA 4H4VA 2Z5XA 3B6DA 4HA6A 4DGKA 1GT8A 5KMSA 3C4NA 2YR6A 3K7QX 5JCIA 4IA6A 2XLRA 1RSGA 4FK1A 3M13A 4U8JA 1GTEA 4WCTA 5KVHA 4YTMA 1GALA 3RP6A 1M64A 2AR8A 4TM0A 4K22A 3PS9A 5FS8A 4JNQA 2HQMA 2GAHB 1LVLA 3T14A 1OJDA 4U8KA 3SZWA 2E4GA 1JRXA 4OPCA 1PJ6A 2WU2A 3KPKA 4GAPA 2BS3A 2OLNA 3CPJG 2YM1A 1PXBA 3DH9A 2JK6A 4J2WA 3CNJA 3BI4A 2R0GA 3JSKA 2AAQA 4Y4NA 3FMWA 3AE8A 1VDCA 2DKIA 1D4CA 3CNPA 1NHRA 4K5RA 3UTEA 1KDGA 4BK2A 4ICYA 3AEBA 2GMHA 3VR8A 4BK3A 1F8WA 5EB5A 2YLSA 2I0ZA 1IUSA 3H4KA 3ICRA 4H50A 4Z25A 4Z26A 2VRMA 4EMIA 4G73A 4LU6A 1TRBA 5IPYA 3IF9A 1Y56A 5BRTA 3ALMA 3EANA 3AD9B 1PXAA 3AB1A 2XYOA 4CBQA 2C3DA 1VQWA 1GPEA 3GMBA 4NEVA 5FS9A 3WE0A 3T31A 3SFDA 1IJHA 3ATQA 1LV0A 2Y6RA 3UOXA 2YG7A 1P2EA 2C4CA 3P9UA 3PG6A 4BURA 1S7MA 1E1KA 2Q0KA 5C3JA 3DA1A 2YLRA 4HB9A 3EF6A 4CY8A 4TLXA 3UKKA 1CBOA 1Y0PA 4U2SA 3C4AA 2R4JA 2QAEA 5ER0A 4GF7A 4BK1A 5GSNA 2RGJA 3SZFA 4H4WA 3AEDA 2FJDA 4II3A 3BNUA 2JB2A 3UKQA 1FEAA 5FS7A 3CNDA 2WESA 2BA9A 4H2RA 2B7SA 1S2QA 3SXIA 1XHCA 1Z6LA 1W4XA 3AYJA 3QFAA 1GRFA 3R9UA 2FJBA 1QJDA 4EM3A 1CJCA 5EBKA 2X8GA 2EQ8A 3SZ0A 4Z2UA 5KWFA 2UZZA 3GD4A 1ZY8A 1RP0A 4DSHA 2XLUA 3PVCA 2TMDA 4N9XA 3SGLA 3H8IA 3AE9A 3V76A 1IUUA 5HHFA 1VRQB 1GESA 1H81A 3KU9A 5LV9A 4G9KA 2RABA 3REDA 4OPUA 1SEZA 5JCNA 2B76A 3GRSA 3ICTA 1NENA 4E0VA 4BJZA 4YKFA 4XWZA 1H7XA 1GOSA 3QVPA 3M12A 3NN6X 4PABA 4TM1A 2C7GA 4Z24A 3UKLA 1NPXA 5KVIA 5EB4A 4OPTA 1ZKQA 3AYIA 1MO9A 2WOWA 3LXDA 2IIDA 2YR5A 3AE4A 2FJAA 5U25A 2RGOA 2VOUA 1H2IA 1ZMDA 4G74A 2WDRA 4U2TA 3KVEA 3FG2P 4Z2TA 1LQUA 3DJJA 2R4EA 1K0JA 3NN0X 1B37A 3AEGA 3RP7A 1DXLA 2PHHA 2WBAA 2YM2A 4U8IA 4YXDA 4B64A 3CGBA 2WP9A 2J3NA 2BS4A 3UTGA 5KMPA 3AEFA 3GYJA 3GRTA 2OAMA 3NGCX 4BJYA 3QFBA 4KX6A 4AP1A 3G5SA 4K8DA 2GV8A 2XFQA 3KPFA 4CCRA 4O5UA 4M52A 5TR3A 1PDHA 2JAEA 4FDCB 1RYIA 3UTFA 2Q0LA 4B1BA 2EQ6A 2YAUA 2R45A 3UOZA 3SZCA 1GRGA 5IQ1A 3G5QA 4JNAA 4NWZA 1IUTA 1K0LA 3NLCA 2WP5A 5HYMA 1GERA 5JCLA 4IVMB 1FEBA 1L9CA 3NIXA 3I3LA 3CGEA 2C65A 2B9XA 3AE5A 1JU2A 3EAOA 3P4SA 1VG9A 4IVOB 2FBWA 3NT6A 1DJNA 1GNDA 3DMEA 4EM4A 4USQA 3UKFA 1XANA 3LOVA 1ZDLA 3HYXA 1NEKA 3AEEA 1XPQA 4CRTA 3D9XA 1QLBA 4H4UA 4GRTA 4J31A 4LIIA 1FCDA 2VVMA 4AOXA 4JN9A 2JKCA 3Q9TA 1B8SA 1ONFA 3AE1A 3BHFA 3D1CA 4YSZA 1TDNA 4B65A 3L5OA 4H4XA 4GDPA 3ISHA 2VVLG 3II4A 1CC4A 3KA7A 4B69A 2WPEA 2GVCA 1KNRA 4NTCA 4XWRA 5L46A 3HYWA 3DGZA 1IUXA 1GXFA 1PHHA 4X4JA 1H82A 2C70A 1GREA 4Y4LA 4Z43A 1CJ3A 2X3NA 2XVJA 3LB8A 4OPDA 1ZK7A 4H4TA 4MJWA 3LJPA 1GRHA 1Y56B 2WETA 1YQ4A 5KOWA 1TYPA 5CQFA 2H89A 4RG3A 3DJGX 3ZDNA 4H4PA 1BGJA 2XVFA 4PAAA 3GYIA 2F5ZA 4JQ9A 1ELIA 4P9SA 3O0HA 2R0PA 2BK4A 4Z44A 4A6NB 2C64A 2WU5A 2BACA 4II2A 2YQUA 3NYCA 3L1RA 3URHA 1B5QA 4EIQA 2WOIA 4EQWA 4CNJA 2C67A 4B66A 1S2YA 1REOA 1LPFA 3DK8A 1CF3A 1FL2A 2EQ7A 1ZOYA 3ALLA 4U8OA 2BRAA 1H86A 4UDQA 1E1LA 2BCGG 3K7MX 3AXBA 1DODA 4FK1C 4J34A 1DNCA 5CKUA 4U2LA 1PBBA 4WX1A 5KNLA 1K4QA 3ZYXA 3SM8A 4GR1A 3GD3A 4EMJA 2YG4A 3OZ2A 2C75A 5GRTA 1TDOA 2BK5A 2XVHA 1TDKA 2GB0A 2YLZA 1TDFA 1FOHA 3AE7A 3ABVA 3NNEA 4OPIA 4A79A 4CCQA 4EIPA 4A65A 1H7WA 3ATRA 5M10A 4JY3A 1Q1RA 1JRYA 3IHGA 3P4QA 3LZWA 2X99A 3K7TA 4UP3A 4RSLA 3NHOX 1K0IA 4JDRA 1EL8A 2YWLA 1L9EA 3F8DA 4G6HA 3L8KA 3QVRA 3NH3X 2O9ZA 2ARDA 1JOAA 1VG0A 4C74A 2ZBWA 4K7ZA 3H8LA 1D5TA 3GDNA 1EBDA 4H7UA 1COYA 2GF3A 3UOYA 1GETA 2APGA 4C77A 3UKPA 2BXSA 1YQ3A 1NHSA 1GV4A 3ITJA 5BUKA 5KMQA 4EQSA 2GR1A 3P4RA 2VZ2A 3NK0X 2C66A 2A8XA 2OA1A 4X9NA 4UDPA 4ZCCA 1CC6A 2V6OA 4TM4A 2WPFA 2ZZBA 3IC9A 1M6IA 1CC2A 3C96A 2B9WA 3GDPA 4OVIA 5M0ZA 5KXJA 1CHUA 4YTPA 1NDAA 2H88A 3VR9A 3VRDB 3AE6A 4AT0A 1TYTA 3M0OA 3ICSA 2A89A 4AP3A 2CVJA 2JB1A 1GRAA 3NG7X 1JRZA 2C73A 3KKJA 2YG6A 4AT2A 3G5RA 3SFEA 2WOVA 1KNPA 1OJTA 2C3CA 3NKSA 4U8NA 4ADWA 4U8PA 2YLXA 3F8RA 3CPHG 3K30A 1D7LA 2JB3A 4I58A 2WPCA 2AQJA 3SYIA 4H2PA 2ZZ0A 2Q7VA 4B67A 3D8XA 1O5WA 4J57A 3AWIA 2X50A 3OC4A 2WEUA 1L9DA 2GMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNA A;  4EQR A;  4APN A;  1OJA A;  2FJE A;  4EQX A;  3NYE A;  4D04 A;  5U1O A;  3DGH A;  3DK9 A;  1KSU A;  4X9M A;  3DK4 A;  2CUL A;  2E1M A;  3AD8 B;  3FIM B;  4C5O A;  4FX9 A;  4NEW A;  4OPL A;  4CY6 A;  4H4R A;  3FPZ A;  1DOB A;  3ADA B;  1DOC A;  1LTX R;  5U63 A;  3P1W A;  4LA1 A;  3GWF A;  4A5L A;  1ZOV A;  4BV6 A;  3B3R A;  2VQB A;  1YY5 A;  4GUV A;  1HYU A;  3CGD A;  2YVJ A;  4GDE A;  2QCU A;  3UCL A;  3CNS A;  1F6M A;  3LAD A;  2WDQ A;  4J33 A;  3RNM A;  5JCM A;  1CJ2 A;  3LZX A;  1XDI A;  1ZMC A;  2B7R A;  2VVL A;  3CTY A;  2V5Z A;  5FS6 A;  4ZCD A;  4H4Z A;  2GQF A;  3AE2 A;  3BI5 A;  2PYX A;  1PJ7 A;  2WHD A;  1V59 A;  3Q6J A;  1F8S A;  1O94 A;  2YLT A;  4NZH A;  2NPX A;  1NG3 A;  5JCK A;  1N4U A;  4YKG A;  1PBF A;  4UDR A;  4YSY A;  3UKH A;  1IUW A;  2V3A A;  4OCG A;  1KF6 A;  1MOK A;  4B68 A;  1NHQ A;  1L0V A;  4J36 A;  3UOV A;  4REK A;  4YWO A;  1GTH A;  4NTE A;  1JEH A;  2V61 A;  3AD7 B;  3QSE A;  2XDO A;  3EPT A;  1FEC A;  4ZN0 A;  4EMW A;  5DBJ A;  2R9Z A;  1DJQ A;  1GRT A;  2XFU A;  2BAB A;  1NG4 A;  2BYB A;  4YT0 A;  2BC0 A;  2R0C A;  1GEU A;  2GR0 A;  2NVK X;  2YVG A;  1DOE A;  4D03 A;  1N1P A;  2ZZC A;  5C2T A;  3VQR A;  5HXI A;  1B4V A;  3AYL A;  3GSI A;  4YSX A;  1ZX9 A;  3FBS A;  4DSG A;  3CPI G;  1H83 A;  4KPR A;  4B63 A;  2GQW A;  1D7Y A;  4C3Y A;  5KOX A;  4A9W A;  2C72 A;  3UTH A;  5BUL A;  2GR3 A;  1TDE A;  1D4D A;  1CL0 A;  2YG3 A;  3AE3 A;  3P4P A;  4Y4M A;  1EL5 A;  2WDV A;  5FMH A;  2Y6Q A;  4IA5 A;  1NHP A;  3I6D A;  1KFY A;  2RGH A;  3CN8 A;  2X8C A;  2XFO A;  3QJ4 A;  1YQZ A;  3GWD A;  2C76 A;  4TLZ A;  4A6N A;  2B9Y A;  1N4V A;  2BCP A;  4TM3 A;  5BVA A;  5IQ4 A;  3IHM A;  2YLW A;  1CJ4 A;  1X31 B;  2VQ7 A;  1PBD A;  2OLO A;  3NYF A;  1LJ1 A;  1H84 A;  1OJ9 A;  2YG5 A;  4IV9 A;  4NTD A;  1E7P A;  4A7A A;  2TPR A;  3QSS A;  3S61 A;  1BKW A;  1LQT A;  4RG4 A;  2GRT A;  3UKA A;  1ZP0 A;  2OAL A;  5HY5 A;  2BC1 A;  1GRB A;  1AOG A;  1KSS A;  1N4W A;  2ACZ A;  4A99 A;  3UP5 A;  2GR2 A;  3T37 A;  2VRL A;  3NTD A;  1EL7 A;  1E1M A;  1NAA A;  3BNM A;  3CIR A;  2BXR A;  3AEC A;  3NRN A;  4OPG A;  2CFY A;  4GCM A;  1E1N A;  3UP4 A;  4H4Y A;  3QSM A;  4AOS A;  4YTN A;  2GEW A;  1BF3 A;  1MXT A;  2GH5 A;  2XVE A;  1PJ5 A;  4U8M A;  3F8P A;  2XCG A;  3CNT A;  4Z2R A;  1IUV A;  2QA1 A;  3E1T A;  2GAG B;  2JBV A;  3RHA A;  3V3O A;  3S5W A;  4H4Q A;  5J60 A;  3NTA A;  1F3P A;  1S3E A;  3BI2 A;  4ECH A;  4H4S A;  4H2N A;  3VRA A;  2BK3 A;  2XLP A;  1E6E A;  1PBC A;  1PS9 A;  4JY2 A;  4H2Q A;  3BHK A;  4J56 A;  1EL9 A;  1BGN A;  1S3B A;  2XLS A;  3DJD A;  1PBE A;  3NK2 X;  3PO7 A;  5J7X A;  2YVF A;  2CDU A;  2Z5Y A;  3HZL A;  2DKH A;  2V60 A;  1Q9I A;  1BWC A;  3RP8 A;  1Q1W A;  2XLT A;  3SQP A;  2WQY A;  1YKJ A;  3AEA A;  4K2X A;  5EOW A;  4CNK A;  1BZL A;  1JNR A;  4XXG A;  1O95 A;  4K5S A;  1PXC A;  1E39 A;  1OJC A;  2XFN A;  2YR4 A;  2BS2 A;  2IVE A;  3DJE A;  4U8L A;  3V3N A;  1PN0 A;  3GMC A;  1P2H A;  1UKV G;  2V3B A;  4YSH A;  1H6V A;  2R46 A;  3KD9 A;  2WP6 A;  3ALJ A;  3KLJ A;  3COX A;  1GSN A;  4USR A;  1F8R A;  2IVD A;  4I59 A;  5KRQ A;  2X8H A;  2Q6U A;  2XFP A;  4C3X A;  3CGC A;  2XVI A;  2WS3 A;  2QA2 A;  2EQ9 A;  3NK1 X;  4O5Q A;  2W0H A;  2A87 A;  1D4E A;  1JNZ A;  3IWA A;  3VRB A;  1QO8 A;  2E5V A;  4H4V A;  2Z5X A;  3B6D A;  4HA6 A;  4DGK A;  1GT8 A;  3C4N A;  2YR6 A;  3K7Q X;  5JCI A;  4IA6 A;  2XLR A;  1RSG A;  4FK1 A;  3M13 A;  4U8J A;  1GTE A;  4WCT A;  5KVH A;  4YTM A;  1GAL A;  3RP6 A;  1M64 A;  2AR8 A;  4TM0 A;  4K22 A;  3PS9 A;  5FS8 A;  4JNQ A;  2HQM A;  2GAH B;  1LVL A;  1OJD A;  4U8K A;  2E4G A;  1JRX A;  4OPC A;  1PJ6 A;  2WU2 A;  2BS3 A;  2OLN A;  3CPJ G;  2YM1 A;  1PXB A;  3DH9 A;  2JK6 A;  4J2W A;  3CNJ A;  3BI4 A;  2R0G A;  3JSK A;  2AAQ A;  4Y4N A;  3FMW A;  3AE8 A;  1VDC A;  2DKI A;  1D4C A;  3CNP A;  1NHR A;  4K5R A;  3UTE A;  1KDG A;  4BK2 A;  4ICY A;  3AEB A;  2GMH A;  3VR8 A;  4BK3 A;  1F8W A;  5EB5 A;  2YLS A;  2I0Z A;  1IUS A;  3H4K A;  3ICR A;  4H50 A;  4Z25 A;  4Z26 A;  2VRM A;  4EMI A;  4LU6 A;  1TRB A;  5IPY A;  3IF9 A;  1Y56 A;  5BRT A;  3ALM A;  3EAN A;  3AD9 B;  1PXA A;  3AB1 A;  2XYO A;  4CBQ A;  2C3D A;  1VQW A;  1GPE A;  3GMB A;  4NEV A;  5FS9 A;  3WE0 A;  3SFD A;  1IJH A;  3ATQ A;  1LV0 A;  2Y6R A;  3UOX A;  2YG7 A;  1P2E A;  3P9U A;  4BUR A;  1E1K A;  2Q0K A;  5C3J A;  3DA1 A;  2YLR A;  4HB9 A;  3EF6 A;  4CY8 A;  4TLX A;  3UKK A;  1CBO A;  1Y0P A;  4U2S A;  3C4A A;  2R4J A;  2QAE A;  5ER0 A;  4GF7 A;  4BK1 A;  5GSN A;  2RGJ A;  4H4W A;  3AED A;  2FJD A;  3BNU A;  2JB2 A;  3UKQ A;  1FEA A;  5FS7 A;  3CND A;  2WES A;  2BA9 A;  4H2R A;  2B7S A;  1S2Q A;  1XHC A;  1Z6L A;  1W4X A;  3AYJ A;  3QFA A;  1GRF A;  3R9U A;  2FJB A;  1QJD A;  4EM3 A;  1CJC A;  5EBK A;  2X8G A;  2EQ8 A;  4Z2U A;  5KWF A;  2UZZ A;  3GD4 A;  1ZY8 A;  1RP0 A;  4DSH A;  2XLU A;  3PVC A;  2TMD A;  4N9X A;  3SGL A;  3H8I A;  3AE9 A;  3V76 A;  1IUU A;  5HHF A;  1VRQ B;  1GES A;  1H81 A;  3KU9 A;  5LV9 A;  2RAB A;  3RED A;  4OPU A;  1SEZ A;  5JCN A;  2B76 A;  3GRS A;  3ICT A;  1NEN A;  4E0V A;  4BJZ A;  4YKF A;  4XWZ A;  1H7X A;  1GOS A;  3QVP A;  3M12 A;  3NN6 X;  4PAB A;  4TM1 A;  2C7G A;  4Z24 A;  3UKL A;  1NPX A;  5KVI A;  5EB4 A;  4OPT A;  1ZKQ A;  3AYI A;  1MO9 A;  2WOW A;  3LXD A;  2IID A;  2YR5 A;  3AE4 A;  2FJA A;  5U25 A;  2RGO A;  2VOU A;  4U2T A;  1ZMD A;  2WDR A;  3KVE A;  3FG2 P;  4Z2T A;  1LQU A;  3DJJ A;  2R4E A;  1K0J A;  3NN0 X;  1B37 A;  3AEG A;  3RP7 A;  1DXL A;  2PHH A;  2WBA A;  2YM2 A;  4U8I A;  4YXD A;  4B64 A;  3CGB A;  2WP9 A;  2J3N A;  2BS4 A;  3UTG A;  3AEF A;  3GYJ A;  3GRT A;  2OAM A;  3NGC X;  4BJY A;  3QFB A;  4KX6 A;  4AP1 A;  3G5S A;  4K8D A;  2GV8 A;  2XFQ A;  3KPF A;  4CCR A;  4O5U A;  4M52 A;  5TR3 A;  1PDH A;  2JAE A;  4FDC B;  1RYI A;  3UTF A;  2Q0L A;  4B1B A;  2EQ6 A;  2YAU A;  2R45 A;  3UOZ A;  1GRG A;  5IQ1 A;  3G5Q A;  4JNA A;  5HYM A;  1IUT A;  1K0L A;  3NLC A;  2WP5 A;  1GER A;  5JCL A;  4IVM B;  1FEB A;  1L9C A;  3NIX A;  3I3L A;  3CGE A;  2C65 A;  2B9X A;  3AE5 A;  1JU2 A;  3EAO A;  3P4S A;  1VG9 A;  4IVO B;  2FBW A;  3NT6 A;  1DJN A;  1GND A;  3DME A;  4EM4 A;  4USQ A;  3UKF A;  1XAN A;  3LOV A;  1ZDL A;  4CRT A;  1NEK A;  3AEE A;  1XPQ A;  1QLB A;  4H4U A;  4GRT A;  4J31 A;  4LII A;  1FCD A;  2VVM A;  4AOX A;  4JN9 A;  2JKC A;  3Q9T A;  1B8S A;  1ONF A;  3AE1 A;  3BHF A;  3D1C A;  4YSZ A;  1TDN A;  4B65 A;  4H4X A;  4GDP A;  3ISH A;  2VVL G;  3II4 A;  1CC4 A;  3KA7 A;  4B69 A;  2WPE A;  2GVC A;  1KNR A;  4NTC A;  4XWR A;  5L46 A;  3DGZ A;  1IUX A;  1GXF A;  1PHH A;  4X4J A;  1H82 A;  2C70 A;  1GRE A;  4Y4L A;  4Z43 A;  1CJ3 A;  2X3N A;  2XVJ A;  3LB8 A;  4OPD A;  1ZK7 A;  4H4T A;  4MJW A;  3LJP A;  1GRH A;  1Y56 B;  2WET A;  1YQ4 A;  5KOW A;  1TYP A;  5CQF A;  2H89 A;  4RG3 A;  3DJG X;  3ZDN A;  4H4P A;  1BGJ A;  2XVF A;  4PAA A;  3GYI A;  2F5Z A;  4JQ9 A;  1ELI A;  4P9S A;  3O0H A;  2R0P A;  2BK4 A;  4Z44 A;  4A6N B;  2C64 A;  2WU5 A;  2BAC A;  2YQU A;  3NYC A;  3L1R A;  3URH A;  1B5Q A;  4EIQ A;  2WOI A;  4EQW A;  4CNJ A;  2C67 A;  4B66 A;  1S2Y A;  1REO A;  1LPF A;  3DK8 A;  1CF3 A;  1FL2 A;  2EQ7 A;  1ZOY A;  3ALL A;  4U8O A;  1H86 A;  4UDQ A;  1E1L A;  2BCG G;  3K7M X;  3AXB A;  1DOD A;  4FK1 C;  4J34 A;  1DNC A;  5CKU A;  4U2L A;  1PBB A;  4WX1 A;  1K4Q A;  3ZYX A;  3SM8 A;  4GR1 A;  3GD3 A;  4EMJ A;  2YG4 A;  3OZ2 A;  2C75 A;  5GRT A;  1TDO A;  2BK5 A;  2XVH A;  1TDK A;  2GB0 A;  2YLZ A;  1TDF A;  1FOH A;  3AE7 A;  3ABV A;  3NNE A;  4OPI A;  4A79 A;  4CCQ A;  4EIP A;  4A65 A;  1H7W A;  3ATR A;  5M10 A;  4JY3 A;  1Q1R A;  1JRY A;  3IHG A;  3P4Q A;  3LZW A;  2X99 A;  3K7T A;  4UP3 A;  4RSL A;  3NHO X;  1K0I A;  4JDR A;  1EL8 A;  2YWL A;  1L9E A;  3F8D A;  3L8K A;  3QVR A;  3NH3 X;  2O9Z A;  2ARD A;  1JOA A;  1VG0 A;  4C74 A;  2ZBW A;  4K7Z A;  3H8L A;  1D5T A;  3GDN A;  1EBD A;  4H7U A;  1COY A;  2GF3 A;  3UOY A;  1GET A;  2APG A;  4C77 A;  3UKP A;  2BXS A;  1YQ3 A;  1NHS A;  1GV4 A;  3ITJ A;  5BUK A;  4EQS A;  2GR1 A;  3P4R A;  2VZ2 A;  3NK0 X;  2C66 A;  2A8X A;  2OA1 A;  4X9N A;  4UDP A;  4ZCC A;  1CC6 A;  2V6O A;  4TM4 A;  2WPF A;  2ZZB A;  3IC9 A;  1M6I A;  1CC2 A;  3C96 A;  2B9W A;  3GDP A;  4OVI A;  5M0Z A;  5KXJ A;  1CHU A;  4YTP A;  1NDA A;  2H88 A;  3VR9 A;  3VRD B;  3AE6 A;  4AT0 A;  1TYT A;  3M0O A;  3ICS A;  2A89 A;  4AP3 A;  2CVJ A;  2JB1 A;  1GRA A;  3NG7 X;  1JRZ A;  2C73 A;  3KKJ A;  2YG6 A;  4AT2 A;  3G5R A;  3SFE A;  2WOV A;  1KNP A;  1OJT A;  2C3C A;  3NKS A;  4U8N A;  4ADW A;  4U8P A;  2YLX A;  3F8R A;  3CPH G;  3K30 A;  1D7L A;  2JB3 A;  4I58 A;  2WPC A;  2AQJ A;  4H2P A;  2ZZ0 A;  2Q7V A;  4B67 A;  3D8X A;  1O5W A;  4J57 A;  3AWI A;  2X50 A;  3OC4 A;  2WEU A;  1L9D A;  2GMJ A; 
#chains in the Genus database with same CATH topology
 2FJE A;  2FYM A;  4EQX A;  3NYE A;  3DK9 A;  3U9I A;  2E1M A;  3FPZ A;  1DOB A;  1LTX R;  4A5L A;  1ZOV A;  3B3R A;  2HNE A;  4MGG A;  1HYU A;  4GDE A;  5JRB A;  1CJ2 A;  3T2K A;  3HRD C;  2WHD A;  3Q6J A;  1O94 A;  3MKC A;  2YLT A;  1NG3 A;  1N4U A;  1FHV A;  4YSY A;  5FJU A;  1RM6 B;  3DG6 A;  2I5Q A;  3S5S A;  5KMR A;  5DBJ A;  2R9Z A;  3NFU A;  1MUC A;  1NG4 A;  2BC0 A;  2R0C A;  1GEU A;  2NVK X;  1N1P A;  3VQR A;  3GSI A;  3AYL A;  1MNS A;  1H83 A;  3UJR A;  1D7Y A;  3D47 A;  2GR3 A;  1TDE A;  1N60 C;  2YG3 A;  5FMH A;  4IA5 A;  3I6D A;  1NHP A;  2AL2 A;  3T2Z A;  3ENL A;  1YQZ A;  2B9Y A;  4TM3 A;  1CJ4 A;  1MDL A;  3ZVH B;  1E7P A;  2TPR A;  3QSS A;  1ZP0 A;  5FJT A;  1AOG A;  1KSS A;  4HCH A;  3UP5 A;  3DFY A;  1NAA A;  2BXR A;  3AEC A;  1E1N A;  2GEW A;  2ZC8 A;  1PJ5 A;  4U8M A;  4Z2R A;  1IUV A;  3I4K A;  4KT2 A;  2JBV A;  3V3O A;  4H4Q A;  3SY4 A;  1E6E A;  4H2Q A;  1EL9 A;  3BSM A;  2XLS A;  3CMM A;  3R07 C;  1Q9I A;  3SQP A;  3AEA A;  4K2X A;  1BZL A;  4XXG A;  1E39 A;  1OJC A;  2XFN A;  4U8L A;  3GMC A;  3FXG A;  1GSN A;  2GGE A;  4I59 A;  2XFP A;  3NK1 X;  2W0H A;  1XS2 A;  1JNZ A;  4J3Z A;  3VRB A;  4H4V A;  3QKE A;  5JCI A;  3ZVH A;  1RSG A;  4FK1 A;  5KVH A;  4TM0 A;  1LVL A;  1T3Q C;  1OJD A;  3SZW A;  1NU5 A;  2PA6 A;  4OPC A;  3KPK A;  3DH9 A;  2JK6 A;  3CNJ A;  3JSK A;  2R0G A;  3DEQ A;  4IP4 A;  2DKI A;  3UTE A;  4K5R A;  4E6M A;  2YLS A;  2I0Z A;  3ICR A;  4Z25 A;  3FV9 A;  4G73 A;  2XYO A;  1GPE A;  5FS9 A;  3TCS A;  3ATQ A;  4Z17 A;  3P9U A;  1S7M A;  2Q0K A;  3DA1 A;  2YLR A;  3EF6 A;  1CBO A;  1Y0P A;  2R4J A;  3SZF A;  4H4W A;  4H83 A;  4HNL A;  1FEA A;  3CAW A;  2BA9 A;  2B7S A;  3SXI A;  1XHC A;  2FJB A;  1CJC A;  3SZ0 A;  2XLU A;  3NZG A;  3PVC A;  2OQY A;  3UJS A;  1GES A;  1H81 A;  5LV9 A;  4OPU A;  2B76 A;  3ICT A;  2OLA A;  3DIP A;  3M12 A;  3JZU A;  3T4W A;  3NVV B;  1NPX A;  3GO2 A;  3AYI A;  2GDQ A;  3T8Q A;  2RGO A;  3UGV A;  1LQU A;  4U8I A;  2WP9 A;  2J3N A;  4JHM A;  3AEF A;  4AP1 A;  2GV8 A;  2OZT A;  3UXK A;  1RYI A;  2Q0L A;  3UOZ A;  5HYM A;  1IUT A;  1K0L A;  1W6T A;  2WP5 A;  2W54 A;  4GIS A;  4IVM B;  1L9C A;  3I3L A;  3A7U A;  2C65 A;  1JU2 A;  3P4S A;  1VG9 A;  4IVO B;  2FBW A;  1GND A;  3DME A;  2PGW A;  1FCD A;  4JN9 A;  3Q9T A;  1B8S A;  2AKM A;  1TDN A;  4B65 A;  3PFR A;  4B69 A;  3TWA A;  1IUX A;  4Z43 A;  1CJ3 A;  4OPD A;  4MJW A;  1GRH A;  2QDD A;  1TYP A;  3H8A A;  4H4P A;  1BGJ A;  3DG3 A;  3EEZ A;  2OFJ A;  3N6J A;  4II2 A;  2PS2 A;  3DGB A;  2W3R A;  3RO6 A;  4H1Z A;  1CF3 A;  3ALL A;  2EQ7 A;  1E1L A;  3AXB A;  3QLD A;  1DNC A;  1PBB A;  4WX1 A;  1K4Q A;  3SM8 A;  2BK5 A;  2XVH A;  4A79 A;  2GB0 A;  4YKG A;  1TDF A;  5M10 A;  3A7A A;  4K2S A;  2O9Z A;  1JOA A;  2ZBW A;  1D5T A;  4DN1 A;  3N4F A;  3Q4D A;  1GV4 A;  2VZ2 A;  2OA1 A;  4X9N A;  4UDP A;  3IC9 A;  4YTP A;  1NDA A;  3AE6 A;  4AT0 A;  3ETR B;  2OG9 A;  4K8G A;  1TYT A;  1E9I A;  3R1Z A;  3STP A;  5FJO A;  2YG6 A;  3SBF A;  3G5R A;  7ENL A;  1KNP A;  2P8B A;  4ADW A;  2YLX A;  3CPH G;  3K30 A;  1JPD X;  3DFH A;  3D8X A;  4J57 A;  3NVZ B;  1L9D A;  4DNA A;  4EQR A;  1KSU A;  4X9M A;  2PTW A;  2CUL A;  4FX9 A;  4MMW A;  4OPL A;  1JRO A;  5U63 A;  3P1W A;  3GWF A;  4GME A;  1BKH A;  1YY5 A;  4GUV A;  3CGD A;  2YVJ A;  3P3B A;  2QCU A;  3UCL A;  1MDR A;  3CNS A;  3LAD A;  2BRY A;  1X2G A;  2OVL A;  2VVL A;  4ZOH B;  4ZCD A;  5FS6 A;  1PDZ A;  3UKH A;  3VCC A;  4OCG A;  4REK A;  4YWO A;  4NTE A;  2PP3 A;  1SJA A;  1FEC A;  3FYY A;  3ZVI A;  2XFU A;  2BAB A;  2GR0 A;  2YVG A;  1DOE A;  1FFV C;  2QGY A;  2GQW A;  5IDZ A;  2C72 A;  2AKZ A;  3NVW B;  4H19 A;  1EL5 A;  3SQS A;  3PK7 A;  1KFY A;  2RGH A;  3CN8 A;  2XFO A;  2C76 A;  4TLZ A;  1PDY A;  5BVA A;  1MRA A;  3TW9 A;  3IHM A;  3V4B A;  2VQ7 A;  3NYF A;  4H2H A;  1N4W A;  5BOF A;  4A99 A;  2PSN A;  2GR2 A;  3T37 A;  3NTD A;  1E1M A;  2PU0 A;  4H4Y A;  2P88 A;  1KN0 A;  3F8P A;  3BOX A;  4IT1 A;  2XCG A;  2QA1 A;  2POD A;  5J60 A;  3NTA A;  1F3P A;  1S3E A;  3VRA A;  5FJR A;  4G6G A;  2XLP A;  1PBC A;  4JY2 A;  3VC5 A;  3QPE A;  1BGN A;  3PO7 A;  1KCZ A;  3HZL A;  3V5C A;  1Q1W A;  4CNK A;  1YKJ A;  3DG7 A;  1JNR A;  2BS2 A;  1JCT A;  3TJ4 A;  4HYR A;  1PN0 A;  1P2H A;  1UKV G;  3KD9 A;  2WP6 A;  3COX A;  1F8R A;  3CGC A;  2XSX A;  3IWA A;  1L8P A;  4DGK A;  1GT8 A;  5KMS A;  2XH7 A;  2YR6 A;  2XLR A;  3MY9 A;  4HN8 A;  1GTE A;  3RP6 A;  1M64 A;  5FS8 A;  3TJI A;  4E4F A;  3R0U A;  1JRX A;  2BS3 A;  3CPJ G;  1PXB A;  3BI4 A;  3IJQ A;  4Y4N A;  1ELS A;  3FMW A;  1BQG A;  3CNP A;  1D4C A;  1F8W A;  5EB5 A;  3N6H A;  4G8T A;  4GIR A;  3GC2 A;  3H4K A;  4H50 A;  4Z26 A;  2VRM A;  4EMI A;  5IPY A;  1Y56 A;  5BRT A;  1PXA A;  2OO6 A;  2C3D A;  2W55 A;  3T31 A;  2YG7 A;  5C3J A;  4TLX A;  2O56 A;  3RCY A;  5GSN A;  2QVH A;  2FJD A;  3CB3 A;  3CT2 A;  3QFA A;  4M0X A;  1GRF A;  5EBK A;  5KWF A;  4FP1 A;  3GD4 A;  3R0K A;  4DSH A;  4N9X A;  1VRQ B;  2RAB A;  3RED A;  5JCN A;  3GRS A;  4YKF A;  2OPJ A;  1GOS A;  4HCL A;  3UJE A;  1ZKQ A;  1MO9 A;  3AE4 A;  4G74 A;  4HNC A;  2FJA A;  1ZMD A;  3FG2 P;  3DJJ A;  2R4E A;  1K0J A;  3AEG A;  2YM2 A;  4B64 A;  3NVY B;  3UTG A;  3GYJ A;  3NRZ B;  3GRT A;  3NGC X;  3G5S A;  3CYJ A;  2XFQ A;  4M52 A;  6ENL A;  4DYE A;  4FDC B;  2EQ6 A;  2YAU A;  2OQH A;  3NLC A;  3NS1 B;  3Q45 A;  3AE5 A;  3ZLH A;  3NT6 A;  3MWC A;  3HYX A;  4MKS A;  4J31 A;  4GRT A;  4AOX A;  4IL2 A;  3NXL A;  2JKC A;  1ONF A;  4YSZ A;  3L5O A;  4H4X A;  4GDP A;  3II4 A;  2GVC A;  3DGZ A;  4X4J A;  1H82 A;  1FO4 A;  1GRE A;  2X3N A;  1ZK7 A;  4H4T A;  2POZ A;  1Y56 B;  5CQF A;  4RG3 A;  3DJG X;  2HXU A;  4PAA A;  2F5Z A;  4P9S A;  1V97 A;  4A6N B;  2C64 A;  2WU5 A;  3NYC A;  3URH A;  2XGZ A;  1WUF A;  2WOI A;  3SN1 A;  3CXO A;  1ZOY A;  4U8O A;  4GFI A;  1DOD A;  3ZYX A;  1FOH A;  3AE7 A;  3ABV A;  3NNE A;  4EIP A;  4A65 A;  1H7W A;  1JRY A;  4UP3 A;  4RSL A;  1K0I A;  2YWL A;  1L9E A;  3F8D A;  3L8K A;  3NH3 X;  1SJB A;  2QJJ A;  3H8L A;  3R25 A;  1EBD A;  1COY A;  3K1G A;  2BXS A;  3V5F A;  1YQ3 A;  5BUK A;  3IJL A;  5KMQ A;  4EQS A;  3P4R A;  2C66 A;  4ZCW A;  5M0Z A;  1P48 A;  1CHU A;  3VRD B;  3ICS A;  3CK5 A;  2A89 A;  3NG7 X;  2JB1 A;  1GRA A;  1JRZ A;  2C73 A;  4AT2 A;  4Z1Y A;  2WOV A;  4A6G A;  4U8N A;  4U8P A;  4A3R A;  3F8R A;  1F9C A;  2AQJ A;  3SYI A;  4H2P A;  3AWI A;  3GWD A;  2GMJ A;  4APN A;  4D04 A;  4DWD A;  4IHC A;  5U1O A;  3DK4 A;  3SSZ A;  3FIM B;  4C5O A;  4NEW A;  4H4R A;  2VQB A;  3AN1 A;  2XH2 A;  1F6M A;  2WDQ A;  4J33 A;  3RNM A;  5JCM A;  1XDI A;  2B7R A;  4X2P A;  4TVW A;  3AE2 A;  3OTR A;  1PJ7 A;  3RGT A;  4NZH A;  2NPX A;  1PBF A;  4UDR A;  2V3A A;  3EUB 3;  4B68 A;  5G5H B;  4J36 A;  3UOV A;  1GTH A;  3H7V A;  2XDO A;  3U4F A;  1SB3 B;  1DJQ A;  1GRT A;  2BYB A;  4YT0 A;  3UJ2 A;  3A7R A;  4D03 A;  2ZZC A;  1B4V A;  1ZX9 A;  3D46 A;  4KPR A;  4C3Y A;  3FJ4 A;  4GAV A;  5BUL A;  4IL0 A;  1CL0 A;  4Y4M A;  4IZG A;  3QJ4 A;  3PWG A;  4A6N A;  1TKK A;  2BCP A;  1N4V A;  5IQ4 A;  3JW7 A;  1PBD A;  1OJ9 A;  2YG5 A;  4NTD A;  2FKP A;  1BKW A;  4RG4 A;  2GRT A;  3UKA A;  2ACZ A;  1GRB A;  3GD6 A;  2E3T A;  1EL7 A;  3BNM A;  3CIR A;  3NRN A;  3T0K A;  4AOS A;  2GGI A;  2GH5 A;  3B97 A;  4TVY A;  4JN8 A;  3DES A;  4JN7 A;  3S5W A;  3BI2 A;  1P43 A;  3VDG A;  1EC7 A;  4H2N A;  5FJP A;  1PS9 A;  3BHK A;  4J56 A;  3DJD A;  1PBE A;  2YVF A;  2Z5Y A;  2DKH A;  3T2Y A;  1O95 A;  1R6W A;  3DJE A;  2IVE A;  4YSH A;  2R46 A;  3ALJ A;  3KLJ A;  4C3X A;  2WS3 A;  2EQ9 A;  3UCD A;  3R11 A;  3S47 A;  1QO8 A;  2P3Z A;  4ROP A;  4YWS A;  3AMZ A;  4ENL A;  2PTZ A;  1TE6 A;  4IA6 A;  4U8J A;  2W3S A;  1GAL A;  2GAH B;  2QQ6 A;  2MUC A;  4E4U A;  1JDF A;  3VA8 A;  1PJ6 A;  2WU2 A;  4GAP A;  2YM1 A;  3IK4 A;  4J2W A;  1VDC A;  1KDG A;  4BK2 A;  4K1W A;  2PP1 A;  2GMH A;  3TTE A;  4HPN A;  1IUS A;  2PTY A;  1TRB A;  3IF9 A;  3EAN A;  3AB1 A;  3GY1 A;  1VQW A;  1STZ A;  4NEV A;  3WE0 A;  4EWJ A;  1LV0 A;  2PU1 A;  2Y6R A;  1P2E A;  2C4C A;  1EBG A;  3PG6 A;  1FHU A;  1E1K A;  4HB9 A;  3UKK A;  4U2S A;  1N5X A;  3C4A A;  4BK1 A;  2RGJ A;  3MSY A;  3BNU A;  2JB2 A;  5FS7 A;  3CND A;  2WES A;  4H2R A;  1W4X A;  2MNR A;  3AYJ A;  2PTX A;  4EM3 A;  2X8G A;  2EQ8 A;  4Z2U A;  2UZZ A;  1ZY8 A;  2HZG A;  2TMD A;  1N63 C;  3SGL A;  3AE9 A;  3BJS A;  1IUU A;  5HHF A;  3MUC A;  2OZ8 A;  3KU9 A;  4G9K A;  1SEZ A;  1JPM A;  4E0V A;  4XWZ A;  1EBH A;  3QVP A;  4A35 A;  3NN6 X;  4PAB A;  4Z24 A;  3UKL A;  5EB4 A;  2WOW A;  3LXD A;  5U25 A;  2VOU A;  2WDR A;  3KVE A;  4Z2T A;  5EU9 A;  1B37 A;  3VCN A;  2WBA A;  1JRP A;  3OZY A;  2BS4 A;  2OAM A;  4BJY A;  4KX6 A;  2QDE A;  3UJF A;  5TR3 A;  2JAE A;  3ZLG A;  4NWZ A;  1GER A;  3NIX A;  3EAO A;  1EC9 A;  3RIT A;  1KKR A;  2RDX A;  1YEY A;  4EM4 A;  3UKF A;  3LOV A;  4CRT A;  3AEE A;  3ZLF A;  3D9X A;  1QLB A;  4H4U A;  4LII A;  4ZA0 A;  1WUE A;  2VVM A;  2DW7 A;  3QN3 A;  3AE1 A;  3BHF A;  2ONE A;  3UXL A;  3ISH A;  3FCP A;  1CC4 A;  2WPE A;  1KNR A;  4NTC A;  3HYW A;  1GXF A;  4Y4L A;  3LB8 A;  2OX4 A;  3LJP A;  3RR1 A;  3OZM A;  5KOW A;  3VFC A;  4J1O A;  3ZDN A;  3SR6 B;  3O0H A;  2R0P A;  1OEP A;  2BAC A;  1XPY A;  3L1R A;  1B5Q A;  3P0W A;  1SJD A;  4EQW A;  2C67 A;  4B66 A;  4GGH A;  1REO A;  1LPF A;  1FL2 A;  1H86 A;  3HPF A;  4J34 A;  4FK1 C;  5CKU A;  2YG4 A;  3OZ2 A;  2C75 A;  1TDO A;  1KD0 A;  2OZ3 A;  4JY3 A;  1Q1R A;  3P4Q A;  3IHG A;  2X99 A;  1SJC A;  3NHO X;  4JDR A;  4G6H A;  2ARD A;  4C74 A;  2GF3 A;  1GET A;  2APG A;  3UKP A;  1NHS A;  3NO1 A;  2P8C A;  2E5A A;  4ZCC A;  1CC6 A;  4TM4 A;  3C96 A;  3GDP A;  1VDV A;  1WYG A;  2H88 A;  2NQL A;  5ENL A;  3M0O A;  4HCD A;  4AP3 A;  3PWI A;  1FFU C;  2DW6 A;  3MZN A;  3KKJ A;  3SFE A;  1R0M A;  1OJT A;  2C3C A;  1X2H A;  1D7L A;  3JVA A;  4I58 A;  3OPS A;  3MQT A;  2ZZ0 A;  3OC4 A;  4KWS A;  1OJA A;  4E5T A;  3DGH A;  4NNJ A;  3AD8 B;  2ZAD A;  4CY6 A;  3ADA B;  1DOC A;  4LA1 A;  4BV6 A;  1KKO A;  3QTP A;  1N62 C;  3LZX A;  1ZMC A;  3CTY A;  1VQZ A;  2V5Z A;  4GYP C;  4H4Z A;  2GQF A;  3BI5 A;  2PYX A;  1V59 A;  1F8S A;  5JCK A;  1IUW A;  1KF6 A;  1MOK A;  1NHQ A;  1L0V A;  4F4R A;  3SX6 A;  1JEH A;  2V61 A;  3AD7 B;  3QSE A;  3EPT A;  4ZN0 A;  4EMW A;  2XH0 A;  5C2T A;  5HXI A;  1FIQ B;  4YSX A;  3FBS A;  4DSG A;  3CPI G;  4GYP A;  4B63 A;  5KOX A;  4A9W A;  3UTH A;  1N5W C;  1ZXI C;  4DX3 A;  1D4D A;  3AE3 A;  2PMQ A;  3P4P A;  2WDV A;  2Y6Q A;  2X8C A;  4DHG A;  3SN0 A;  2GGG A;  2YLW A;  1X31 B;  2OLO A;  1LJ1 A;  1H84 A;  4IV9 A;  3KUM A;  4A7A A;  3S61 A;  1LQT A;  3THU A;  2OAL A;  5HY5 A;  2BC1 A;  4G7F A;  2VRL A;  4OPG A;  2CFY A;  4GCM A;  3UP4 A;  4YTN A;  3QSM A;  3GYX A;  1BF3 A;  1MXT A;  2XVE A;  3CNT A;  5G5G B;  3E1T A;  2GAG B;  3RHA A;  4ECH A;  2HXT A;  4H4S A;  2BK3 A;  1ONE A;  1S3B A;  3NK2 X;  2OKT A;  3V3W A;  5J7X A;  2CDU A;  3DER A;  2V60 A;  3RP8 A;  1BWC A;  2XLT A;  3T9P A;  2WQY A;  1NEL A;  5EOW A;  4K5S A;  1PXC A;  3HYV A;  2YR4 A;  2P0I A;  3ES8 A;  3V3N A;  2V3B A;  1H6V A;  4FI4 A;  4USR A;  2IVD A;  5KRQ A;  2X8H A;  2Q6U A;  2XVI A;  2QA2 A;  4O5Q A;  2A87 A;  1D4E A;  2E5V A;  2Z5X A;  3B6D A;  3AM9 A;  4HA6 A;  3C4N A;  3K7Q X;  3B9J B;  3M13 A;  4WCT A;  4YTM A;  2AR8 A;  4K22 A;  1DTN A;  3PS9 A;  4JNQ A;  2HQM A;  3T14 A;  4U8K A;  2E4G A;  3I6T A;  2OLN A;  2GGJ A;  1RVK A;  2AAQ A;  3AE8 A;  1NHR A;  4ICY A;  3AEB A;  3VR8 A;  4BK3 A;  3IJI A;  4LU6 A;  3ALM A;  3AD9 B;  4CBQ A;  5J04 A;  3GMB A;  2GGH A;  3SFD A;  1IJH A;  3UOX A;  3N4E A;  4BUR A;  3SJN A;  4CY8 A;  2QAE A;  5ER0 A;  4GF7 A;  5BOE A;  1TZZ A;  3AED A;  4II3 A;  3UKQ A;  3I6E A;  2GL5 A;  3TWB A;  1S2Q A;  1Z6L A;  3R9U A;  1QJD A;  2QJM A;  1RP0 A;  3T6C A;  3H8I A;  3V76 A;  3H12 A;  1NEN A;  4BJZ A;  1H7X A;  2GSH A;  4GGB A;  4TM1 A;  2C7G A;  5KVI A;  4OPT A;  3R10 A;  2IID A;  2YR5 A;  4U2T A;  1H2I A;  3NN0 X;  3RP7 A;  1DXL A;  2PHH A;  4YXD A;  3CGB A;  5KMP A;  3QFB A;  4K8D A;  3KPF A;  1ECQ A;  4CCR A;  4O5U A;  2CHR A;  1PDH A;  3UTF A;  4B1B A;  2R45 A;  1EC8 A;  3SZC A;  1GRG A;  5IQ1 A;  3G5Q A;  4JNA A;  3UCC A;  1IYX A;  5JCL A;  3TQP A;  1FEB A;  3OP2 A;  3CGE A;  3EKG A;  2B9X A;  1DJN A;  4USQ A;  1XAN A;  1ZDL A;  1NEK A;  1XPQ A;  2PPG A;  3D1C A;  3HW2 A;  4KPL A;  2VVL G;  3KA7 A;  4XWR A;  5L46 A;  1PHH A;  2C70 A;  2AL1 A;  2XVJ A;  2WET A;  1YQ4 A;  2PGE A;  2H89 A;  4KEM A;  2XH4 A;  2XVF A;  3GYI A;  4JQ9 A;  1ELI A;  2BK4 A;  4Z44 A;  2YQU A;  4EIQ A;  4CNJ A;  2AL2 B;  1S2Y A;  3DK8 A;  2BRA A;  4UDQ A;  2BCG G;  3K7M X;  1N61 C;  4U2L A;  5KNL A;  3CXB A;  4GR1 A;  3GD3 A;  4EMJ A;  3TOY A;  5GRT A;  2YLZ A;  1TDK A;  4OPI A;  4CCQ A;  3ES7 A;  3FVD A;  3ATR A;  4IP5 A;  2PP0 A;  3LZW A;  3K7T A;  2QJN A;  1EL8 A;  3OW1 A;  3QVR A;  1VG0 A;  4K7Z A;  3GDN A;  4H7U A;  3UOY A;  4E8G A;  4C77 A;  3VC6 A;  3ITJ A;  3DDM A;  2GR1 A;  3NK0 X;  2A8X A;  2PCE A;  2V6O A;  2WPF A;  2ZZB A;  1CC2 A;  1M6I A;  2B9W A;  4OVI A;  5KXJ A;  3VR9 A;  2CVJ A;  3RRA A;  3NKS A;  4M6U A;  2JB3 A;  3H70 A;  2WPC A;  3SN4 A;  2Q7V A;  4B67 A;  1O5W A;  2X50 A;  2WEU A;  4DXK A;  3P93 A; 
#chains in the Genus database with same CATH homology
 4DNA A;  4EQR A;  4APN A;  1OJA A;  2FJE A;  4EQX A;  3NYE A;  4D04 A;  5U1O A;  3DGH A;  3DK9 A;  1KSU A;  4X9M A;  4NNJ A;  3DK4 A;  2CUL A;  2E1M A;  3AD8 B;  3FIM B;  4C5O A;  4FX9 A;  4NEW A;  4OPL A;  4CY6 A;  4H4R A;  3FPZ A;  1DOB A;  3ADA B;  1DOC A;  1LTX R;  5U63 A;  3P1W A;  4LA1 A;  3GWF A;  4A5L A;  1ZOV A;  4BV6 A;  3B3R A;  2VQB A;  1YY5 A;  4GUV A;  1HYU A;  3CGD A;  2YVJ A;  4GDE A;  2QCU A;  3UCL A;  3CNS A;  1F6M A;  3LAD A;  2WDQ A;  5JRB A;  4J33 A;  2BRY A;  3RNM A;  5JCM A;  1CJ2 A;  3LZX A;  1XDI A;  1ZMC A;  2B7R A;  3T2K A;  2VVL A;  3CTY A;  2V5Z A;  5FS6 A;  4ZCD A;  4H4Z A;  2GQF A;  3AE2 A;  3BI5 A;  2PYX A;  1PJ7 A;  2WHD A;  1V59 A;  3Q6J A;  1F8S A;  1O94 A;  2YLT A;  4NZH A;  2NPX A;  1NG3 A;  5JCK A;  1N4U A;  4YKG A;  1PBF A;  4UDR A;  4YSY A;  3UKH A;  2V3A A;  1IUW A;  4OCG A;  1KF6 A;  1MOK A;  4B68 A;  1NHQ A;  1L0V A;  4J36 A;  3UOV A;  4REK A;  3SX6 A;  4YWO A;  1GTH A;  4NTE A;  1JEH A;  2V61 A;  3AD7 B;  3QSE A;  2XDO A;  3EPT A;  1FEC A;  4ZN0 A;  5KMR A;  4EMW A;  5DBJ A;  2R9Z A;  1DJQ A;  1GRT A;  2XFU A;  2BAB A;  1NG4 A;  2BYB A;  4YT0 A;  2BC0 A;  2R0C A;  1GEU A;  2GR0 A;  2NVK X;  2YVG A;  1DOE A;  4D03 A;  1N1P A;  2ZZC A;  5C2T A;  3VQR A;  5HXI A;  1B4V A;  3AYL A;  3GSI A;  4YSX A;  1ZX9 A;  3FBS A;  4DSG A;  3CPI G;  1H83 A;  4KPR A;  4B63 A;  2GQW A;  1D7Y A;  4C3Y A;  5KOX A;  4GAV A;  4A9W A;  2C72 A;  3UTH A;  5BUL A;  2GR3 A;  1TDE A;  1D4D A;  1CL0 A;  2YG3 A;  3AE3 A;  3P4P A;  4Y4M A;  1EL5 A;  2WDV A;  5FMH A;  2Y6Q A;  4IA5 A;  1NHP A;  3I6D A;  1KFY A;  2RGH A;  3CN8 A;  3T2Z A;  2X8C A;  2XFO A;  3QJ4 A;  1YQZ A;  3GWD A;  2C76 A;  4TLZ A;  4A6N A;  2B9Y A;  1N4V A;  2BCP A;  4TM3 A;  5BVA A;  5IQ4 A;  3IHM A;  2YLW A;  1CJ4 A;  1X31 B;  2VQ7 A;  1PBD A;  2OLO A;  3NYF A;  1LJ1 A;  1H84 A;  1OJ9 A;  2YG5 A;  4IV9 A;  4NTD A;  1E7P A;  4A7A A;  2TPR A;  3QSS A;  3S61 A;  1BKW A;  1LQT A;  4RG4 A;  2GRT A;  3UKA A;  1ZP0 A;  2OAL A;  5HY5 A;  2BC1 A;  1GRB A;  1AOG A;  1KSS A;  1N4W A;  2ACZ A;  4A99 A;  3UP5 A;  2GR2 A;  3T37 A;  2VRL A;  3NTD A;  1EL7 A;  1E1M A;  1NAA A;  3BNM A;  3CIR A;  2BXR A;  3AEC A;  3NRN A;  4OPG A;  3T0K A;  2CFY A;  4GCM A;  1E1N A;  3UP4 A;  4H4Y A;  3QSM A;  4AOS A;  4YTN A;  3GYX A;  2GEW A;  1BF3 A;  1MXT A;  2GH5 A;  2XVE A;  1PJ5 A;  4U8M A;  1KN0 A;  3F8P A;  2XCG A;  3CNT A;  4Z2R A;  1IUV A;  2QA1 A;  3E1T A;  2GAG B;  2JBV A;  3RHA A;  3V3O A;  3S5W A;  4H4Q A;  5J60 A;  3NTA A;  1F3P A;  1S3E A;  3BI2 A;  4ECH A;  4H4S A;  4H2N A;  3VRA A;  3SY4 A;  4G6G A;  2BK3 A;  2XLP A;  1E6E A;  1PBC A;  1PS9 A;  4JY2 A;  4H2Q A;  3BHK A;  4J56 A;  1EL9 A;  1BGN A;  1S3B A;  2XLS A;  3DJD A;  1PBE A;  3CMM A;  3NK2 X;  3PO7 A;  5J7X A;  2YVF A;  2CDU A;  2Z5Y A;  3HZL A;  2DKH A;  2V60 A;  1Q9I A;  1BWC A;  3RP8 A;  1Q1W A;  2XLT A;  3T2Y A;  3SQP A;  2WQY A;  1YKJ A;  3AEA A;  4K2X A;  5EOW A;  4CNK A;  1BZL A;  1JNR A;  4XXG A;  1O95 A;  4K5S A;  1PXC A;  1E39 A;  1OJC A;  2XFN A;  2YR4 A;  2BS2 A;  2IVE A;  3DJE A;  3HYV A;  4U8L A;  3V3N A;  1PN0 A;  3GMC A;  2V3B A;  1P2H A;  1UKV G;  4YSH A;  1H6V A;  2R46 A;  3KD9 A;  2WP6 A;  3ALJ A;  3KLJ A;  3COX A;  1GSN A;  4USR A;  1F8R A;  2IVD A;  4I59 A;  5KRQ A;  2X8H A;  2Q6U A;  2XFP A;  4C3X A;  3CGC A;  2XVI A;  2WS3 A;  2QA2 A;  2EQ9 A;  3NK1 X;  4O5Q A;  2W0H A;  2A87 A;  1D4E A;  1JNZ A;  3IWA A;  3VRB A;  1QO8 A;  2E5V A;  4H4V A;  2Z5X A;  3B6D A;  4HA6 A;  4DGK A;  1GT8 A;  5KMS A;  3C4N A;  2YR6 A;  3K7Q X;  5JCI A;  4IA6 A;  2XLR A;  1RSG A;  4FK1 A;  3M13 A;  4U8J A;  1GTE A;  4WCT A;  5KVH A;  4YTM A;  1GAL A;  3RP6 A;  1M64 A;  2AR8 A;  4TM0 A;  4K22 A;  3PS9 A;  5FS8 A;  4JNQ A;  2HQM A;  2GAH B;  1LVL A;  3T14 A;  1OJD A;  4U8K A;  3SZW A;  2E4G A;  1JRX A;  4OPC A;  1PJ6 A;  2WU2 A;  3KPK A;  4GAP A;  2BS3 A;  2OLN A;  3CPJ G;  2YM1 A;  1PXB A;  3DH9 A;  2JK6 A;  4J2W A;  3CNJ A;  3BI4 A;  2R0G A;  3JSK A;  2AAQ A;  4Y4N A;  3FMW A;  3AE8 A;  1VDC A;  2DKI A;  1D4C A;  3CNP A;  1NHR A;  4K5R A;  3UTE A;  1KDG A;  4BK2 A;  4ICY A;  3AEB A;  2GMH A;  3VR8 A;  4BK3 A;  1F8W A;  5EB5 A;  2YLS A;  2I0Z A;  1IUS A;  3H4K A;  3ICR A;  4H50 A;  4Z25 A;  4Z26 A;  2VRM A;  4EMI A;  4G73 A;  4LU6 A;  1TRB A;  5IPY A;  3IF9 A;  1Y56 A;  5BRT A;  3ALM A;  3EAN A;  3AD9 B;  1PXA A;  3AB1 A;  2XYO A;  4CBQ A;  2C3D A;  1VQW A;  1GPE A;  3GMB A;  4NEV A;  5FS9 A;  3WE0 A;  3T31 A;  3SFD A;  1IJH A;  3ATQ A;  1LV0 A;  2Y6R A;  3UOX A;  2YG7 A;  1P2E A;  2C4C A;  3P9U A;  3PG6 A;  4BUR A;  1S7M A;  1E1K A;  2Q0K A;  5C3J A;  3DA1 A;  2YLR A;  4HB9 A;  3EF6 A;  4CY8 A;  4TLX A;  3UKK A;  1CBO A;  1Y0P A;  4U2S A;  3C4A A;  2R4J A;  2QAE A;  5ER0 A;  4GF7 A;  4BK1 A;  5GSN A;  2RGJ A;  3SZF A;  4H4W A;  3AED A;  2FJD A;  4II3 A;  3BNU A;  2JB2 A;  3UKQ A;  1FEA A;  5FS7 A;  3CND A;  2WES A;  2BA9 A;  4H2R A;  2B7S A;  1S2Q A;  3SXI A;  1XHC A;  1Z6L A;  1W4X A;  3AYJ A;  3QFA A;  1GRF A;  3R9U A;  2FJB A;  1QJD A;  4EM3 A;  1CJC A;  5EBK A;  2X8G A;  2EQ8 A;  3SZ0 A;  4Z2U A;  5KWF A;  2UZZ A;  3GD4 A;  1ZY8 A;  1RP0 A;  4DSH A;  2XLU A;  3PVC A;  2TMD A;  4N9X A;  3SGL A;  3H8I A;  3AE9 A;  3V76 A;  1IUU A;  5HHF A;  1VRQ B;  1GES A;  1H81 A;  3KU9 A;  5LV9 A;  4G9K A;  2RAB A;  3RED A;  4OPU A;  1SEZ A;  5JCN A;  2B76 A;  3GRS A;  3ICT A;  1NEN A;  4E0V A;  4BJZ A;  4YKF A;  4XWZ A;  1H7X A;  1GOS A;  3QVP A;  3M12 A;  3NN6 X;  4PAB A;  4TM1 A;  2C7G A;  4Z24 A;  3UKL A;  1NPX A;  5KVI A;  5EB4 A;  4OPT A;  1ZKQ A;  3AYI A;  1MO9 A;  2WOW A;  3LXD A;  2IID A;  2YR5 A;  3AE4 A;  2FJA A;  5U25 A;  2RGO A;  2VOU A;  1H2I A;  1ZMD A;  4G74 A;  2WDR A;  4U2T A;  3KVE A;  3FG2 P;  4Z2T A;  1LQU A;  3DJJ A;  2R4E A;  1K0J A;  3NN0 X;  1B37 A;  3AEG A;  3RP7 A;  1DXL A;  2PHH A;  2WBA A;  2YM2 A;  4U8I A;  4YXD A;  4B64 A;  3CGB A;  2WP9 A;  2J3N A;  2BS4 A;  3UTG A;  5KMP A;  3AEF A;  3GYJ A;  3GRT A;  2OAM A;  3NGC X;  4BJY A;  3QFB A;  4KX6 A;  4AP1 A;  3G5S A;  4K8D A;  2GV8 A;  2XFQ A;  3KPF A;  4CCR A;  4O5U A;  4M52 A;  5TR3 A;  1PDH A;  2JAE A;  4FDC B;  1RYI A;  3UTF A;  2Q0L A;  4B1B A;  2EQ6 A;  2YAU A;  2R45 A;  3UOZ A;  3SZC A;  1GRG A;  5IQ1 A;  3G5Q A;  4JNA A;  4NWZ A;  1IUT A;  1K0L A;  3NLC A;  2WP5 A;  5HYM A;  1GER A;  5JCL A;  4IVM B;  1FEB A;  1L9C A;  3NIX A;  3I3L A;  3CGE A;  2C65 A;  2B9X A;  3AE5 A;  1JU2 A;  3EAO A;  3P4S A;  1VG9 A;  4IVO B;  2FBW A;  3NT6 A;  1DJN A;  1GND A;  3DME A;  4EM4 A;  4USQ A;  3UKF A;  1XAN A;  3LOV A;  1ZDL A;  3HYX A;  1NEK A;  3AEE A;  1XPQ A;  4CRT A;  3D9X A;  1QLB A;  4H4U A;  4GRT A;  4J31 A;  4LII A;  1FCD A;  2VVM A;  4AOX A;  4JN9 A;  2JKC A;  3Q9T A;  1B8S A;  1ONF A;  3AE1 A;  3BHF A;  3D1C A;  4YSZ A;  1TDN A;  4B65 A;  3L5O A;  4H4X A;  4GDP A;  3ISH A;  2VVL G;  3II4 A;  1CC4 A;  3KA7 A;  4B69 A;  2WPE A;  2GVC A;  1KNR A;  4NTC A;  4XWR A;  5L46 A;  3HYW A;  3DGZ A;  1IUX A;  1GXF A;  1PHH A;  4X4J A;  1H82 A;  2C70 A;  1GRE A;  4Y4L A;  4Z43 A;  1CJ3 A;  2X3N A;  2XVJ A;  3LB8 A;  4OPD A;  1ZK7 A;  4H4T A;  4MJW A;  3LJP A;  1GRH A;  1Y56 B;  2WET A;  1YQ4 A;  5KOW A;  1TYP A;  5CQF A;  2H89 A;  4RG3 A;  3DJG X;  3ZDN A;  4H4P A;  1BGJ A;  2XVF A;  4PAA A;  3GYI A;  2F5Z A;  4JQ9 A;  1ELI A;  4P9S A;  3O0H A;  2R0P A;  2BK4 A;  4Z44 A;  4A6N B;  2C64 A;  2WU5 A;  2BAC A;  4II2 A;  2YQU A;  3NYC A;  3L1R A;  3URH A;  1B5Q A;  4EIQ A;  2WOI A;  4EQW A;  4CNJ A;  2C67 A;  4B66 A;  1S2Y A;  1REO A;  1LPF A;  3DK8 A;  1CF3 A;  1FL2 A;  2EQ7 A;  1ZOY A;  3ALL A;  4U8O A;  2BRA A;  1H86 A;  4UDQ A;  1E1L A;  2BCG G;  3K7M X;  3AXB A;  1DOD A;  4FK1 C;  4J34 A;  1DNC A;  5CKU A;  4U2L A;  1PBB A;  4WX1 A;  5KNL A;  1K4Q A;  3ZYX A;  3SM8 A;  4GR1 A;  3GD3 A;  4EMJ A;  2YG4 A;  3OZ2 A;  2C75 A;  5GRT A;  1TDO A;  2BK5 A;  2XVH A;  1TDK A;  2GB0 A;  2YLZ A;  1TDF A;  1FOH A;  3AE7 A;  3ABV A;  3NNE A;  4OPI A;  4A79 A;  4CCQ A;  4EIP A;  4A65 A;  1H7W A;  3ATR A;  5M10 A;  4JY3 A;  1Q1R A;  1JRY A;  3IHG A;  3P4Q A;  3LZW A;  2X99 A;  3K7T A;  4UP3 A;  4RSL A;  3NHO X;  1K0I A;  4JDR A;  1EL8 A;  2YWL A;  1L9E A;  3F8D A;  4G6H A;  3L8K A;  3QVR A;  3NH3 X;  2O9Z A;  2ARD A;  1JOA A;  1VG0 A;  4C74 A;  2ZBW A;  4K7Z A;  3H8L A;  1D5T A;  3GDN A;  1EBD A;  4H7U A;  1COY A;  2GF3 A;  3UOY A;  1GET A;  2APG A;  4C77 A;  3UKP A;  2BXS A;  1YQ3 A;  1NHS A;  1GV4 A;  3ITJ A;  5BUK A;  5KMQ A;  4EQS A;  2GR1 A;  3P4R A;  2VZ2 A;  3NK0 X;  2C66 A;  2A8X A;  2OA1 A;  4X9N A;  4UDP A;  4ZCC A;  1CC6 A;  2V6O A;  4TM4 A;  2WPF A;  2ZZB A;  3IC9 A;  1M6I A;  1CC2 A;  3C96 A;  2B9W A;  3GDP A;  4OVI A;  5M0Z A;  5KXJ A;  1CHU A;  4YTP A;  1NDA A;  2H88 A;  3VR9 A;  3VRD B;  3AE6 A;  4AT0 A;  1TYT A;  3M0O A;  3ICS A;  2A89 A;  4AP3 A;  2CVJ A;  2JB1 A;  1GRA A;  3NG7 X;  1JRZ A;  2C73 A;  3KKJ A;  2YG6 A;  4AT2 A;  3G5R A;  3SFE A;  2WOV A;  1KNP A;  1OJT A;  2C3C A;  3NKS A;  4U8N A;  4ADW A;  4U8P A;  2YLX A;  3F8R A;  3CPH G;  3K30 A;  1D7L A;  2JB3 A;  4I58 A;  2WPC A;  2AQJ A;  3SYI A;  4H2P A;  2ZZ0 A;  2Q7V A;  4B67 A;  3D8X A;  1O5W A;  4J57 A;  3AWI A;  2X50 A;  3OC4 A;  2WEU A;  1L9D A;  2GMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...