2NVKX

Crystal structure of thioredoxin reductase from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
481
structure length
481
Chain Sequence
YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Biochemical Studies Reveal Differences in the Catalytic Mechanisms of Mammalian and Drosophila melanogaster Thioredoxin Reductases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords Thioredoxin Reductase
total genus 154
structure length 481
sequence length 481
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
X PF00890 FAD_binding_2 FAD binding domain
X PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2nvkX03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2nvkX02
1QLBA 4BURA 1RP0A 3UOZA 4JN9A 4K22A 3CNDA 4YTPA 4B67A 1LV0A 2BABA 3F8DA 3ISHA 4OPGA 3UP4A 3VRDB 4Z2UA 3NK1X 1ZDLA 4Z24A 4J33A 3Q9TA 1L9CA 2FJAA 3DK4A 1ZP0A 4H4WA 2ARDA 2RGHA 1EL9A 4JY3A 5HY5A 3H4KA 1GRHA 1TYPA 1ZY8A 4K7ZA 2WESA 4ZCDA 4Y4NA 5EB4A 4YSZA 3T37A 4FX9A 4NEWA 1E1KA 4EQRA 2BCPA 1L9DA 2WU2A 3ATRA 2XFQA 3OC4A 3AXBA 1KF6A 1TYTA 3I6DA 4A99A 1Q1WA 3CGDA 4H4TA 1NEKA 1JNRA 2VVMA 2WS3A 4X9NA 3QSSA 1GRTA 1ZMCA 2BACA 3UTHA 1TRBA 2X8CA 4EMWA 4I59A 2QCUA 2R0CA 1N4WA 1RSGA 1Y56B 1OJTA 2AR8A 3ATQA 3DJEA 1IJHA 4Z25A 4AOSA 4OCGA 2WPFA 1TDKA 2RGJA 3CNPA 2C3DA 2GR1A 1H84A 3CNJA 3UOVA 3P4RA 4YTMA 3UTGA 4H2PA 1PXBA 2YLRA 3AEFA 1CC2A 1FEAA 4H50A 5ER0A 2XYOA 4YXDA 1E1MA 3C96A 1LJ1A 1TDEA 2EQ6A 3COXA 4YSHA 3BI5A 3DGHA 4EMIA 3FIMB 1ZK7A 4X9MA 5M0ZA 1QO8A 3UKKA 3NT6A 3RP7A 2Q0KA 2OA1A 4YWOA 1B5QA 4CCQA 1QJDA 5C3JA 4CY6A 4AOXA 4H4QA 2C7GA 1FEBA 1E1NA 2WQYA 4U8LA 3AYIA 1F8WA 1XDIA 3AE6A 4YTNA 2VQ7A 4DGKA 3VR8A 4YKFA 4GDPA 4K5RA 3CGCA 4HB9A 1H86A 2GV8A 4A5LA 1B4VA 5FS6A 4H4VA 1EL5A 2C67A 2Q0LA 1B37A 3IF9A 4NTDA 2XFOA 4RG4A 4KX6A 1O5WA 2C70A 1PS9A 1VG0A 2VOUA 5DBJA 3NYCA 2YG5A 1LTXR 2YG6A 4TM4A 4YKGA 4NZHA 1Y0PA 2YR6A 3PO7A 1N4UA 2GEWA 4LU6A 4RSLA 3KLJA 4AP1A 4REKA 1E6EA 4U8IA 1D4CA 3M0OA 4IV9A 3LOVA 2C73A 4UDRA 1P2EA 2XLPA 5BULA 2X8GA 4P9SA 4KPRA 4BJYA 4H4RA 3ICRA 2Z5YA 1H7WA 3AYLA 2WPCA 2B76A 3UTEA 4NTEA 1CBOA 1PJ5A 1IUTA 4B64A 3FMWA 3ICSA 3V76A 4ZCCA 3B3RA 1CJ3A 3AECA 3ALJA 4Y4MA 2XFUA 5IQ1A 3AD7B 1CJCA 3II4A 2GR0A 2B7SA 1E7PA 1Q1RA 5IPYA 3QSMA 2EQ8A 1K0JA 2Q6UA 3SFDA 1NAAA 4GF7A 4GR1A 4EIQA 1EL7A 4FDCB 3IWAA 2Y6QA 3P4SA 5BRTA 1PBCA 5M10A 2V6OA 2R46A 4BJZA 4J57A 1S3EA 1CC4A 1H82A 2DKIA 3BI2A 2UZZA 3UKQA 3NRNA 3QFAA 3NN0X 2GAHB 2YVGA 2ZBWA 2WHDA 3NG7X 4JY2A 4BK2A 3VR9A 3G5SA 4N9XA 2YLXA 4ADWA 1DJQA 4B1BA 1GOSA 3KPFA 4H2QA 5KVIA 2DKHA 2E1MA 4B69A 1XANA 1JEHA 2YLZA 5JCIA 3UOYA 3KD9A 2FJBA 3QSEA 4ZN0A 3K7QX 4H2RA 2BK4A 1ZMDA 3K7TA 1REOA 2BA9A 1O94A 5HHFA 3AE8A 1NG3A 4J36A 2V3BA 4DSGA 4GCMA 3ICTA 4WX1A 1DXLA 1N1PA 5GSNA 3GD3A 1P2HA 3ABVA 1GEUA 5U25A 1S2QA 3V3OA 1K4QA 1NPXA 5FS7A 1K0LA 2GMJA 4UDQA 4C3XA 4EM3A 1PBDA 3K7MX 1PJ7A 2B9WA 3ADAB 5EOWA 2BK5A 2VQBA 4AT2A 4ICYA 4Z26A 1IUVA 1EL8A 3AE1A 3GYIA 2BC1A 1ZOVA 1MOKA 2YQUA 4H4XA 1DOBA 1NHQA 3P9UA 1YQ4A 4OPUA 1KSUA 2VVLA 2O9ZA 4DSHA 5KXJA 3ZDNA 3LXDA 4PABA 3AD8B 3G5RA 2C65A 4EMJA 2WOWA 3I3LA 2BS4A 2A89A 4CCRA 2X8HA 5CKUA 3VRAA 1ELIA 1E39A 2V3AA 1DODA 2BYBA 2YWLA 4GUVA 2XVEA 4OVIA 1YQZA 4NEVA 2WU5A 5GRTA 1FCDA 2BS3A 3ITJA 4H7UA 1GNDA 2GVCA 3S61A 3VQRA 5KOXA 4OPTA 3GRTA 1H83A 1GXFA 2YM2A 2W0HA 2XVFA 1ZKQA 2X50A 4XXGA 3UCLA 4H4YA 3RP6A 2JB1A 3BNUA 2JBVA 1D7LA 4U8MA 2J3NA 1PBEA 1GPEA 4APNA 1GTEA 4H4SA 4BV6A 1IUSA 1CJ4A 2YLTA 4GRTA 1PHHA 3Q6JA 1KFYA 2FJDA 4U8JA 1NDAA 3BI4A 3O0HA 2CDUA 3CPJG 2JAEA 3QVRA 2C3CA 2X3NA 3GDNA 3AE7A 4TM1A 4U2LA 3NGCX 3PVCA 3P4PA 3AE4A 2C75A 4H4UA 3LB8A 2EQ7A 4Z43A 1M6IA 2C76A 1BKWA 2R9ZA 5KRQA 2A87A 4J34A 1GV4A 2YLSA 1PJ6A 4YSXA 1NHSA 1E1LA 4JNQA 3VRBA 3CPHG 1GRBA 1JRZA 2YVJA 4U8PA 2E5VA 1BGJA 4BK1A 1GRFA 3CNTA 2XLSA 2HQMA 3NLCA 2YM1A 4D04A 4EIPA 4CRTA 1EBDA 1PXCA 4EM4A 1GESA 3JSKA 1FL2A 1FOHA 3AEEA 4JNAA 3D8XA 3NTAA 3BHFA 2R0GA 1GRAA 2WOVA 1IUXA 2WDVA 3M12A 4Z44A 3AE9A 2ACZA 3GMCA 2VRMA 1MXTA 2JKCA 3P1WA 2NVKX 4GDEA 4B65A 4LIIA 1GTHA 4A9WA 2WDRA 4M52A 1O95A 1F6MA 2WPEA 3S5WA 3H8IA 4H4ZA 2YVFA 2WP5A 1D4DA 4FK1C 1BWCA 1H7XA 3DJGX 3GD4A 2RABA 3BNMA 1PDHA 2YR5A 3NYFA 1BZLA 1VRQB 2YAUA 2BCGG 1DNCA 1GALA 4ECHA 2V61A 2FJEA 2XVIA 1Q9IA 4MJWA 2EQ9A 1D7YA 2QAEA 2IIDA 2WDQA 3LJPA 4UP3A 1V59A 1Z6LA 2PHHA 3SM8A 3ZYXA 2WP9A 2WETA 2OLNA 1X31B 2BK3A 4C74A 3NN6X 1B8SA 4CNKA 3NNEA 2GMHA 4K5SA 3E1TA 3H8LA 4IVOB 2C64A 5JCMA 2QA1A 1PN0A 1KSSA 3GDPA 3R9UA 5JCNA 3C4NA 2NPXA 4A65A 1XHCA 2WP6A 3QVPA 2BS2A 4Y4LA 1BF3A 3L1RA 3DJDA 2XLUA 1CHUA 4CBQA 2PYXA 1LQTA 2RGOA 1D4EA 3DA1A 2VZ2A 4IA6A 2V5ZA 1CC6A 1AOGA 2E4GA 2XDOA 2YR4A 2TMDA 4EQXA 3LZWA 4TLXA 1GERA 3IHMA 3KKJA 3UKHA 1F8SA 1SEZA 3P4QA 1OJCA 2BC0A 4CNJA 1F3PA 1VG9A 3NH3X 3GYJA 5HXIA 4IA5A 2VVLG 3SFEA 3URHA 2I0ZA 2R4EA 3BHKA 1YKJA 3V3NA 4XWZA 1N4VA 2GRTA 4DNAA 5HYMA 4EQWA 3HZLA 2Q7VA 2R45A 5J7XA 3NK0X 4C5OA 4Z2RA 3EAOA 4TM0A 5CQFA 3REDA 5U1OA 1W4XA 3KU9A 4OPLA 2TPRA 1OJ9A 2X99A 2AAQA 3GSIA 4XWRA 3UKAA 4X4JA 1VQWA 3G5QA 1GT8A 1PBFA 3LADA 4H2NA 1OJAA 3AYJA 1OJDA 3AB1A 2XFNA 3UKPA 2JB2A 2H88A 3NTDA 3NK2X 3AEDA 4OPDA 1L9EA 2GQFA 4J56A 4U2SA 4D03A 3SQPA 2JK6A 3M13A 1GSNA 5JCKA 2C66A 4O5UA 3EF6A 4A7AA 2OALA 5KWFA 1KNRA 1CJ2A 2XFPA 2AQJA 4J31A 4YSYA 3NHOX 4TLZA 4UDPA 4K8DA 1ONFA 3AE3A 4H4PA 3OZ2A 2B9XA 4U8OA 1S2YA 4USRA 3UP5A 5BVAA 2APGA 3UOXA 3GMBA 3KA7A 3CGBA 2QA2A 2R0PA 5TR3A 5L46A 1YY5A 2VRLA 3F8RA 2GH5A 4B66A 4E0VA 2ZZCA 5BUKA 4RG3A 1NHPA 3SGLA 1S3BA 5KOWA 1LPFA 3GRSA 1VDCA 2XLRA 3AE2A 5FS9A 2WEUA 1BGNA 3AEBA 4JQ9A 3CGEA 1JOAA 3AEAA 4TM3A 2F5ZA 3F8PA 1PBBA 5KVHA 4YT0A 4O5QA 3DGZA 2YG7A 4A6NB 4C77A 4K2XA 2YG4A 3DK9A 2V60A 3LZXA 1F8RA 1LQUA 2CFYA 1YQ3A 4WCTA 1TDNA 1NG4A 5FMHA 1UKVG 2XVJA 3RHAA 5FS8A 2FBWA 1JRYA 2Z5XA 1TDOA 3NIXA 4EQSA 3DMEA 2GR3A 3DK8A 5U63A 3DJJA 3AE5A 5IQ4A 1K0IA 4I58A 1FECA 2ZZ0A 1IUWA 2B7RA 2GB0A 1DJNA 3PS9A 5C2TA 1ZX9A 5LV9A 3EANA 1D5TA 1KDGA 3UKLA 2GAGB 1NENA 4B63A 3CTYA 2GR2A 3CN8A 4NTCA 4AT0A 1TDFA 3GWFA 2IVDA 4LA1A 1GRGA 4JDRA 3RNMA 1DOEA 3CNSA 1KNPA 2CVJA 2YG3A 4AP3A 1GETA 1H6VA 4C3YA 1JRXA 1JU2A 3CPIG 3GWDA 3AD9B 4CY8A 2WOIA 2YLWA 2H89A 4J2WA 3NYEA 1Y56A 1NHRA 3DH9A 2CULA 2R4JA 2XLTA 3L8KA 3ALMA 3CIRA 3K30A 1XPQA 3AWIA 2B9YA 1JNZA 4A79A 1CF3A 3FPZA 3D1CA 5EBKA 1GREA 2BXSA 3C4AA 2XVHA 4U2TA 1ZOYA 3FG2P 1IUUA 5JCLA 2Y6RA 1H81A 4U8KA 1M64A 3WE0A 4Z2TA 2ZZBA 3IHGA 3AEGA 3RP8A 1MO9A 1L0VA 4OPCA 2GQWA 2IVEA 3ALLA 1RYIA 3NKSA 1LVLA 4U8NA 1PXAA 3IC9A 3QJ4A 2XCGA 3FBSA 4USQA 3UTFA 3EPTA 2JB3A 1CL0A 4IVMB 4HA6A 2OAMA 4OPIA 5EB5A 2C72A 5J60A 3KVEA 2OLOA 4PAAA 2WBAA 2A8XA 4FK1A 1HYUA 4BK3A 2BXRA 3QFBA 1COYA 4A6NA 4B68A 3UKFA 1DOCA 2GF3A 3B6DA
chains in the Genus database with same CATH superfamily
3RITA 3TWAA 5IDZA 1RP0A 4JN9A 2GGGA 4YTPA 4HCLA 4B67A 3ISHA 1ZDLA 4Z24A 3STPA 2FJAA 1ZP0A 4H4WA 4JY3A 5BOFA 2C4CA 3NVYB 2BCPA 3ATRA 4KWSA 2XFQA 3AXBA 1NEKA 3ES8A 1ZMCA 4I59A 1RSGA 1Y56B 1OJTA 3DJEA 4YTMA 3MSYA 1LJ1A 1TDEA 3COXA 4EMIA 4X9MA 3NT6A 3OP2A 1H2IA 2PU0A 1B5QA 1QJDA 5C3JA 3ZVIA 2C7GA 3R10A 1E1NA 1XDIA 4YTNA 4YKFA 5KMPA 4HB9A 1H86A 5FS6A 4G73A 3UJRA 4KX6A 1O5WA 2C70A 4G6GA 2VOUA 2P8CA 2YG5A 4LU6A 3KLJA 1MUCA 1E6EA 1D4CA 1IYXA 4NWZA 3N4EA 2QVHA 2WPCA 3FMWA 4ZCCA 3B3RA 3ALJA 3SQSA 1CJCA 1E7PA 1Q1RA 3MZNA 5IPYA 2QJJA 3IWAA 5M10A 1SJBA 2DKIA 3BI2A 4DHGA 1N5WC 4N9XA 3SN1A 4ADWA 2ZADA 3PWGA 3KPFA 4TVWA 5KVIA 1XANA 3L5OA 4ZN0A 3H8AA 3QPEA 3K7QX 4H2RA 3PWIA 5HHFA 2V3BA 3T9PA 3ABVA 4II3A 1GEUA 5U25A 5FS7A 1PBDA 2B9WA 1EC7A 2BK5A 2VQBA 4ICYA 1EL8A 2BC1A 1ZOVA 1MOKA 2YQUA 1DOBA 5KXJA 2VVLA 5G5HB 2C65A 4EMJA 2WOWA 3I3LA 2X8HA 3VRAA 1ELIA 3RGTA 2YWLA 2PTXA 4OVIA 4JN8A 3QKEA 3NVZB 5GRTA 1FCDA 4OPTA 3GRTA 1GXFA 2X50A 4U8MA 2J3NA 1GPEA 4APNA 4H4SA 4K2SA 4BV6A 2YLTA 1PHHA 4F4RA 3Q6JA 3BI4A 3O0HA 4ZA0A 1BQGA 3VC6A 3PVCA 3TJ4A 3JZUA 3LB8A 5KRQA 4J34A 1GV4A 1PJ6A 1NHSA 3VRBA 1DTNA 4U8PA 2E5VA 1BGJA 4BK1A 2HQMA 3NLCA 1ECQA 2YM1A 2PU1A 1EBDA 3AEEA 1FOHA 3OPSA 1IUXA 4Z44A 3OZYA 2WDRA 2GGIA 4M52A 1F6MA 3EKGA 4FK1C 3S47A 1H7XA 1MNSA 3NYFA 2E5AA 3SN0A 1DNCA 2W3RA 3DESA 2XVIA 3VCCA 1Q9IA 4MJWA 3NVVB 2IIDA 2WDQA 1V59A 3ZYXA 2BK3A 3NN6X 2GMHA 1PN0A 5JCNA 2PGWA 4A65A 7ENLA 3S5SA 3L1RA 4CBQA 2OFJA 2XLUA 4YWSA 1CC6A 4M0XA 2E4GA 1ONEA 2XDOA 4TLXA 3KKJA 3IHMA 3MWCA 1F8SA 1OJCA 2RDXA 1VG9A 3NH3X 3DIPA 3BHKA 1YKJA 4GIRA 3CYJA 3DG7A 2PMQA 2Q7VA 4E5TA 1EBGA 4IP4A 4GGHA 4Z2RA 3EAOA 4TM0A 4OPLA 2OVLA 3RRAA 1OJ9A 4XWRA 4X4JA 3G5QA 1V97A 1XPYA 2JB2A 3NK2X 3AEDA 1L9EA 4U2SA 4O5UA 3SQPA 2JK6A 3EF6A 3GYXA 1KNRA 2FYMA 4J31A 3NHOX 3OZ2A 5BVAA 2APGA 2QA2A 4IL2A 2R0PA 5TR3A 2VRLA 3F8RA 2ZZCA 1S3BA 3OW1A 3GRSA 1VDCA 5FS9A 3F8PA 5KMSA 4YT0A 2YG4A 3GD6A 4FI4A 3LZXA 1F8RA 1YQ3A 1FFVC 2XVJA 2FBWA 5U63A 3MQTA 3AE5A 2GSHA 2B7RA 3EANA 1D5TA 1KDGA 3UKLA 1NENA 1T3QC 2GR2A 3CN8A 3T14A 2AKMA 2HNEA 3RNMA 1DOEA 3GWDA 2WOIA 3CB3A 3UJSA 3K30A 2R4JA 1PDYA 2B9YA 1SJCA 2PPGA 1GREA 2XVHA 1ZOYA 2W55A 2ZZBA 3IHGA 1NU5A 3RP8A 1MO9A 1L0VA 2GQWA 1RYIA 3TWBA 1LVLA 3IC9A 3QJ4A 3TOYA 2JB3A 4IVMB 4HA6A 4OPIA 4PAAA 4FK1A 1HYUA 3QFBA 4GAPA 3UOZA 4G74A 3CNDA 2BABA 4G8TA 3F8DA 4OPGA 3UP4A 3NK1X 3SSZA 3DK4A 2RGHA 2ARDA 3H4KA 2WESA 5EB4A 3BJSA 4NEWA 1E1KA 4EQRA 3FXGA 1L9DA 3OC4A 3PG6A 3I6DA 1TRBA 4EMWA 1WUEA 2AR8A 4JN7A 5FJTA 1IJHA 4OCGA 3VC5A 3UOVA 1FEAA 4H50A 2XYOA 1E1MA 1FIQB 2W54A 3BI5A 3FIMB 5M0ZA 4CCQA 4U8LA 2DW7A 1MRAA 4K5RA 3CGCA 2GV8A 3IJQA 2C67A 4NTDA 4RG4A 1N61C 2OLAA 1PS9A 3V3WA 4YKGA 3PO7A 4RSLA 3I4KA 4U8IA 1KKOA 3M0OA 3LOVA 1P2EA 4P9SA 4KPRA 4BJYA 4H4RA 3ICRA 3AN1A 3R0UA 1CBOA 1IUTA 1CJ3A 3AECA 4II2A 6ENLA 4Y4MA 3AD7B 2B7SA 3QSMA 3MUCA 3FJ4A 4DWDA 3DG6A 4EIQA 4FDCB 1PBCA 4G9KA 1S3EA 2UZZA 3UKQA 1W6TA 2DW6A 3TW9A 3G5SA 2YLXA 3ZLHA 1DJQA 4B1BA 1GOSA 3DDMA 1WUFA 4H2QA 1JEHA 2YLZA 3QSEA 2OZ3A 1REOA 2BA9A 1O94A 3AE8A 4GCMA 3ICTA 1DXLA 1N1PA 5GSNA 1S2QA 2GMJA 4UDQA 4C3XA 3K7MX 4DYEA 4A35A 4AT2A 3CXOA 4GGBA 1IUVA 3CXBA 1NHQA 3P9UA 1YQ4A 4PABA 1MDLA 3IJIA 2A89A 5CKUA 1STZA 3OTRA 2XVEA 1YQZA 3ITJA 3IJLA 3VQRA 1ZKQA 4H4YA 3RP6A 3BNUA 3VFCA 2JBVA 3K1GA 3BSMA 4FP1A 1KFYA 1NDAA 3GDNA 2X3NA 4GISA 3AE7A 4U2LA 3P4PA 5BOEA 3AE4A 2C75A 4Z43A 4YSXA 1GRBA 1TKKA 2XLSA 4MMWA 3D46A 4KEMA 3JSKA 3CMMA 1GRAA 3M12A 2ACZA 1P48A 3GMCA 1MXTA 2JKCA 3P1WA 2NVKX 3PFRA 2QDDA 1GTHA 1O95A 2WP5A 3ENLA 3DJGX 1BZLA 1VRQB 2YAUA 1GALA 4ECHA 1R0MA 2V61A 2GL5A 2PHHA 2WP9A 2OLNA 3ZLGA 4C74A 1B8SA 4CNKA 2XH0A 1N62C 3E1TA 4IVOB 3JW7A 1EC9A 5JCMA 1KSSA 3GDPA 3DG3A 1XHCA 2PP1A 3QVPA 3DJDA 4HNCA 4IA6A 3LZWA 3R07C 1SEZA 4K1WA 3DERA 3SFEA 2I0ZA 2OZTA 3V3NA 1TE6A 4XWZA 1N4VA 2ZC8A 2OPJA 4DNAA 5CQFA 5U1OA 3T6CA 3I6TA 2TPRA 1SJAA 2X99A 2AAQA 2XGZA 3UKAA 2XH2A 1KKRA 1GT8A 3LADA 1OJDA 3NTDA 4OPDA 2GQFA 3T2KA 3M13A 5JCKA 2GGEA 1CJ2A 3AE3A 4U8OA 3D47A 1S2YA 3UP5A 3SBFA 4B66A 2GH5A 3RR1A 5FJUA 2XLRA 3AE2A 2WEUA 1BGNA 4JQ9A 3AEAA 2F5ZA 4O5QA 3DGZA 4C77A 4K2XA 1JRPA 1NELA 2OZ8A 1JROA 1JDFA 5FMHA 5FS8A 2Z5XA 1TDOA 3NIXA 4EQSA 3DMEA 3NO1A 2GB0A 4MKSA 3NS1B 3GWFA 1GRGA 1KNPA 1JRXA 3AD9B 4J2WA 1Y56A 1NHRA 2CULA 3L8KA 1CF3A 5EBKA 2BXSA 4A6GA 2Y6RA 1M64A 4Z2TA 3TTEA 3ALLA 5EB5A 1CL0A 2C72A 3A7AA 3KVEA 4H19A 3KPKA 4BK3A 4A6NA 4B68A 1WYGA 4BURA 4K22A 2HZGA 1LV0A 4Z2UA 1TZZA 4J33A 3I6EA 1EL9A 3CK5A 2PTWA 5HY5A 1GRHA 1TYPA 1ZY8A 2QGYA 4K7ZA 4E6MA 4ZCDA 3T37A 4FX9A 2WU2A 1TYTA 4H4TA 1JNRA 2VVMA 2WS3A 3QSSA 1GRTA 2BACA 1N4WA 3NVWB 3ATQA 4AOSA 2WPFA 2C3DA 2GR1A 1FFUC 3CNJA 3P4RA 3UTGA 4H2PA 1PXBA 3AEFA 1CC2A 5ER0A 4YXDA 3R25A 3C96A 3SYIA 3DGHA 1ZK7A 3UKKA 3RP7A 3NZGA 4YWOA 2XH7A 4H4QA 3B97A 1FEBA 4E4UA 3AYIA 1F8WA 2FKPA 2OQHA 3AE6A 3VR8A 4GDPA 1B4VA 2Q0LA 3IF9A 2XFOA 3HYWA 1VG0A 2CHRA 5DBJA 3NYCA 1LTXR 2YG6A 3AM9A 2YR6A 2BRYA 2PTYA 4REKA 4IV9A 2C73A 4UDRA 2XLPA 5BULA 2X8GA 1H7WA 3AYLA 2B76A 3UTEA 1PJ5A 3ICSA 3V76A 5IQ1A 1R6WA 1JCTA 2GR0A 4ROPA 3SFDA 4GF7A 2P88A 1EL7A 1X2GA 3P4SA 2AL2B 2V6OA 4BJZA 1CC4A 4H2HA 1H82A 3NRNA 3QFAA 3NN0X 2YVGA 3NG7X 3VR9A 3A7RA 3HPFA 2DKHA 4HCDA 2E1MA 4B69A 3UOYA 3KD9A 2FJBA 3DFHA 5EU9A 3UGVA 4J36A 2GDQA 4WX1A 3V3OA 1NPXA 4J1OA 4EM3A 2PP0A 1PJ7A 4IP5A 1EBHA 3AE1A 4H4XA 2GGJA 4OPUA 4DN1A 2O9ZA 4E4FA 3V4BA 3ZDNA 3LXDA 4X2PA 2V3AA 3KUMA 2BYBA 4GUVA 4ZCWA 4NEVA 4KT2A 3FCPA 4H7UA 3TJIA 3VCNA 3S61A 5KOXA 4GMEA 2YM2A 2XVFA 3TCSA 4XXGA 5KNLA 3UCLA 4TVYA 1D7LA 1PBEA 2MNRA 5G5GB 1CJ4A 4GRTA 3NFUA 3T2YA 3R11A 2FJDA 4U8JA 3CPJG 1RVKA 2JAEA 3QVRA 2C3CA 4TM1A 3NGCX 1P43A 4H4UA 1M6IA 2QQ6A 1OEPA 2A87A 3JVAA 4HPNA 4JNQA 2AKZA 4HN8A 1JRZA 2YVJA 1GRFA 3SXIA 4EIPA 3ZVHA 1N63C 1PXCA 4EM4A 1FL2A 4JNAA 3D8XA 3NTAA 3BHFA 2PCEA 3HRDC 2VRMA 4B65A 2PA6A 5FJPA 3Q4DA 4E8GA 2WPEA 4MGGA 3GD4A 2RABA 1PDHA 2GGHA 2BCGG 3UXLA 2FJEA 3U4FA 2QAEA 3LJPA 2WETA 1X31B 3BOXA 3UCCA 3ES7A 3NNEA 4K5SA 2QA1A 2BS2A 4Y4LA 3DEQA 1LQTA 1D4EA 3DA1A 2P8BA 2YR4A 1SB3B 3P4QA 2BC0A 4CNJA 3QLDA 3CAWA 1F3PA 1L8PA 4EWJA 4GYPA 4ENLA 4IA5A 2VVLG 4Z1YA 3URHA 3U9IA 2OX4A 4EQWA 3HZLA 3UJFA 5J7XA 4C5OA 1W4XA 3KU9A 3GSIA 1VQWA 3N6HA 2PP3A 4Z17A 1PBFA 1OJAA 3FYYA 3AB1A 3N6JA 4KPLA 2H88A 5LV9A 1E9IA 3P3BA 4IHCA 2XSXA 4TLZA 5J04A 3SZWA 2W3SA 1ONFA 3NXLA 4USRA 3KA7A 1FO4A 3CGBA 2PTZA 4H1ZA 5BUKA 4RG3A 1NHPA 3SGLA 5KOWA 1LPFA 3AEBA 1FHUA 4TM3A 2PGEA 2YG7A 2V60A 1BKHA 1TDNA 1X2HA 1JRYA 3UXKA 3SY4A 3DJJA 5IQ4A 5JRBA 3FV9A 5KMRA 4I58A 2ZZ0A 1IUWA 1DJNA 1ZX9A 4GFIA 4B63A 3CTYA 2XH4A 1TDFA 2IVDA 2YG3A 4AP3A 1H6VA 3V5FA 3CPIG 1JU2A 4C3YA 3T0KA 2YLWA 2H89A 2XLTA 3ALMA 3CIRA 3HYVA 1XPQA 3AWIA 1JNZA 3FPZA 1YEYA 3C4AA 4U2TA 3OZMA 3FG2P 3SN4A 1H81A 3WE0A 3Q45A 1SJDA 4OPCA 2IVEA 4IL0A 3PK7A 3GO2A 3NKSA 4U8NA 2XCGA 3UTFA 3EPTA 5J60A 2OAMA 2WBAA 2A8XA 3SZCA 2PSNA 3UJ2A 2BXRA 1COYA 3UKFA 2GRTA 1QLBA 4JHMA 3MKCA 3VRDB 3Q9TA 1L9CA 3DFYA 2P3ZA 3NRZB 4Y4NA 4YSZA 1VQZA 3CT2A 1KF6A 2OKTA 3T8QA 4A99A 1Q1WA 3CGDA 4X9NA 3UTHA 2X8CA 2QCUA 1JPMA 2R0CA 4Z25A 1TDKA 2RGJA 3CNPA 4GYPC 1H84A 5KMQA 2YLRA 3HW2A 2EQ6A 4YSHA 3D9XA 1QO8A 3ETRB 1KN0A 2Q0KA 2OA1A 3RCYA 4CY6A 4AOXA 3SR6B 2WQYA 2VQ7A 4DGKA 4ZOHB 4A5LA 1EL5A 4H4VA 1B37A 1JPDX 3H7VA 4TM4A 4NZHA 1Y0PA 1N4UA 2GEWA 4AP1A 1N5XA 2HXTA 2Z5YA 4HYRA 4NTEA 4B64A 3HYXA 4A3RA 2XFUA 3II4A 2EQ8A 1K0JA 2Q6UA 1NAAA 4GR1A 2Y6QA 3DGBA 5BRTA 2QJMA 2AL1A 2R46A 4J57A 1ZXIC 2GAHB 2ZBWA 4JY2A 2WHDA 3TQPA 1ELSA 4BK2A 3QN3A 1KCZA 1MDRA 5JCIA 2BK4A 1ZMDA 2E3TA 3K7TA 1NG3A 4DSGA 3GD3A 1P2HA 4K8GA 1K4QA 3R1ZA 1K0LA 3ADAB 3SX6A 5EOWA 4IT1A 4Z26A 2POZA 3GYIA 4J3ZA 2I5QA 1KSUA 4DSHA 4NNJA 3AD8B 3G5RA 3ZLFA 2BS4A 4CCRA 1E39A 1DODA 3UCDA 4IZGA 2WU5A 2BS3A 1GNDA 2GVCA 2HXUA 2OQYA 3QTPA 2O56A 1H83A 2W0HA 3T4WA 3SJNA 5ENLA 3R0KA 2JB1A 3H70A 3RO6A 1GTEA 3B9JB 1IUSA 5FJOA 2CDUA 2MUCA 1RM6B 1N60C 3VA8A 3UJEA 2EQ7A 2C76A 1BKWA 2R9ZA 2YLSA 3THUA 1E1LA 3CPHG 4M6UA 3CNTA 4H83A 4D04A 2OO6A 4CRTA 1FHVA 1GESA 2R0GA 2WOVA 2WDVA 3AE9A 1F9CA 3N4FA 4GDEA 4LIIA 2ONEA 4A9WA 3S5WA 3H8IA 4H4ZA 2YVFA 1D4DA 1BWCA 3BNMA 2YR5A 4HCHA 3SZFA 2EQ9A 1D7YA 4UP3A 1Z6LA 3SM8A 4HNLA 3SZ0A 4DXKA 3A7UA 3H8LA 2C64A 3R9UA 3C4NA 2NPXA 2WP6A 1BF3A 1CHUA 2PYXA 2RGOA 2VZ2A 2V5ZA 1AOGA 3UKHA 2TMDA 4EQXA 1GERA 3AMZA 3EUB3 2P0IA 3GYJA 5HXIA 2R4EA 5HYMA 2R45A 3NK0X 3REDA 4DX3A 4GAVA 4H2NA 3AYJA 2XFNA 3UKPA 3FVDA 4J56A 4D03A 1GSNA 2C66A 4A7AA 2OALA 5KWFA 2XFPA 2AQJA 4YSYA 4UDPA 4K8DA 4H4PA 1XS2A 2B9XA 3UOXA 3GMBA 3T2ZA 2NQLA 2PODA 5L46A 1YY5A 4E0VA 2BRAA 1EC8A 5FJRA 3CGEA 1JOAA 1PBBA 5KVHA 4A6NB 3DK9A 3P93A 2PS2A 1LQUA 2CFYA 4WCTA 3GC2A 1NG4A 1UKVG 3V5CA 3RHAA 3H12A 2QDEA 2GR3A 3DK8A 3T31A 3MY9A 1K0IA 1FECA 5C2TA 3PS9A 1PDZA 4G7FA 2GAGB 4NTCA 4AT0A 3GY1A 4LA1A 4JDRA 3CNSA 2CVJA 4CY8A 1GETA 2AL2A 3NYEA 3DH9A 4G6HA 2QJNA 4A79A 3P0WA 3D1CA 1IUUA 5JCLA 4U8KA 3ZVHB 3AEGA 1S7MA 1PXAA 3EEZA 3FBSA 4USQA 3VDGA 2OLOA 2OG9A 1VDVA 1KD0A 3IK4A 1DOCA 2GF3A 3B6DA
chains in the Genus database with same CATH topology
1QLBA 4BURA 1RP0A 3UOZA 4JN9A 4K22A 4G74A 3CNDA 4YTPA 4B67A 1LV0A 2BABA 3F8DA 3ISHA 4OPGA 3UP4A 3VRDB 4Z2UA 3NK1X 1ZDLA 4Z24A 4J33A 3Q9TA 1L9CA 2FJAA 3DK4A 1ZP0A 4H4WA 2ARDA 2RGHA 1EL9A 4JY3A 5HY5A 3H4KA 1GRHA 1TYPA 1ZY8A 4K7ZA 2WESA 4ZCDA 4Y4NA 5EB4A 2C4CA 4YSZA 3T37A 4FX9A 4NEWA 1E1KA 4EQRA 2BCPA 1L9DA 2WU2A 3ATRA 2XFQA 3OC4A 3PG6A 1KF6A 3AXBA 1TYTA 3I6DA 4A99A 1NEKA 1Q1WA 3CGDA 4H4TA 1JNRA 2VVMA 2WS3A 4X9NA 3QSSA 1GRTA 1ZMCA 2BACA 3UTHA 1TRBA 2X8CA 4EMWA 4I59A 2QCUA 2R0CA 1N4WA 1RSGA 1Y56B 1OJTA 2AR8A 3ATQA 3DJEA 1IJHA 4Z25A 4AOSA 4OCGA 2WPFA 1TDKA 2RGJA 3CNPA 2C3DA 2GR1A 1H84A 3CNJA 5KMQA 3P4RA 4YTMA 3UOVA 4H2PA 1PXBA 2YLRA 3UTGA 3AEFA 1CC2A 1FEAA 4H50A 5ER0A 2XYOA 4YXDA 1E1MA 3C96A 1LJ1A 1TDEA 3SYIA 2EQ6A 3COXA 4YSHA 3BI5A 3DGHA 4EMIA 3D9XA 3FIMB 1ZK7A 4X9MA 5M0ZA 1QO8A 3UKKA 3NT6A 3RP7A 1KN0A 1H2IA 2Q0KA 2OA1A 4YWOA 1B5QA 4CCQA 1QJDA 5C3JA 4CY6A 4AOXA 4H4QA 2C7GA 1FEBA 1E1NA 2WQYA 4U8LA 3AYIA 1F8WA 1XDIA 3AE6A 4YTNA 2VQ7A 4DGKA 3VR8A 4YKFA 5KMPA 4GDPA 4K5RA 3CGCA 4HB9A 1H86A 2GV8A 4A5LA 1B4VA 5FS6A 4H4VA 1EL5A 2C67A 4G73A 2Q0LA 1B37A 3IF9A 4NTDA 2XFOA 4RG4A 3HYWA 4KX6A 1O5WA 2C70A 1PS9A 1VG0A 4G6GA 2VOUA 5DBJA 3NYCA 2YG5A 1LTXR 2YG6A 4TM4A 4YKGA 4NZHA 1Y0PA 2YR6A 3PO7A 1N4UA 2GEWA 4LU6A 4RSLA 3KLJA 2BRYA 4AP1A 4REKA 1E6EA 4U8IA 1D4CA 3M0OA 4IV9A 3LOVA 2C73A 4UDRA 1P2EA 2XLPA 5BULA 4NWZA 2X8GA 4P9SA 4KPRA 4BJYA 4H4RA 3ICRA 2Z5YA 1H7WA 3AYLA 2WPCA 2B76A 3UTEA 4NTEA 1CBOA 1PJ5A 1IUTA 4B64A 3FMWA 3ICSA 3V76A 4ZCCA 3B3RA 1CJ3A 3AECA 3ALJA 3HYXA 4II2A 4Y4MA 2XFUA 5IQ1A 3AD7B 1CJCA 3II4A 2GR0A 2B7SA 1E7PA 1Q1RA 5IPYA 3QSMA 2EQ8A 1K0JA 2Q6UA 3SFDA 1NAAA 4GF7A 4GR1A 4EIQA 1EL7A 4FDCB 3IWAA 2Y6QA 3P4SA 5BRTA 1PBCA 5M10A 2V6OA 2R46A 4BJZA 4J57A 4G9KA 1S3EA 1CC4A 1H82A 2DKIA 3BI2A 2UZZA 3UKQA 3NRNA 3QFAA 3NN0X 2GAHB 2YVGA 2ZBWA 2WHDA 3NG7X 4JY2A 4BK2A 3VR9A 3G5SA 4N9XA 2YLXA 4ADWA 1DJQA 4B1BA 1GOSA 3KPFA 4H2QA 5KVIA 2DKHA 2E1MA 4B69A 1XANA 1JEHA 3L5OA 2YLZA 5JCIA 3UOYA 3KD9A 2FJBA 3QSEA 4ZN0A 3K7QX 4H2RA 2BK4A 1ZMDA 3K7TA 1REOA 2BA9A 1O94A 5HHFA 3AE8A 1NG3A 4J36A 2V3BA 4DSGA 4GCMA 3ICTA 4WX1A 1DXLA 1N1PA 5GSNA 3GD3A 1P2HA 3ABVA 1GEUA 5U25A 1S2QA 4II3A 1K4QA 1NPXA 5FS7A 1K0LA 2GMJA 4UDQA 4C3XA 4EM3A 1PBDA 3K7MX 1PJ7A 2B9WA 3ADAB 3SX6A 5EOWA 2BK5A 2VQBA 4AT2A 4ICYA 4Z26A 1IUVA 1EL8A 3V3OA 3AE1A 3GYIA 2BC1A 1ZOVA 1MOKA 2YQUA 4H4XA 1DOBA 1NHQA 3P9UA 1YQ4A 4OPUA 1KSUA 2VVLA 2O9ZA 4DSHA 5KXJA 3ZDNA 3LXDA 4NNJA 4PABA 3AD8B 3G5RA 2C65A 4EMJA 2WOWA 3I3LA 2BS4A 2A89A 4CCRA 2X8HA 5CKUA 3VRAA 1ELIA 1E39A 2V3AA 1DODA 2BYBA 2YWLA 4GUVA 2XVEA 4OVIA 1YQZA 4NEVA 2WU5A 5GRTA 1FCDA 2BS3A 3ITJA 4H7UA 1GNDA 2GVCA 3S61A 3VQRA 5KOXA 4OPTA 3GRTA 1H83A 1GXFA 2YM2A 2W0HA 2XVFA 1ZKQA 2X50A 4XXGA 5KNLA 3UCLA 4H4YA 3RP6A 2JB1A 3BNUA 2JBVA 1D7LA 4U8MA 2J3NA 1PBEA 1GPEA 4APNA 1GTEA 4H4SA 4BV6A 1IUSA 1CJ4A 2YLTA 4GRTA 1PHHA 3T2YA 3Q6JA 1KFYA 2FJDA 4U8JA 1NDAA 3BI4A 3O0HA 2CDUA 3CPJG 2JAEA 3QVRA 2C3CA 2X3NA 3GDNA 3AE7A 4TM1A 4U2LA 3NGCX 3PVCA 3P4PA 3AE4A 2C75A 4H4UA 3LB8A 2EQ7A 4Z43A 1M6IA 2C76A 1BKWA 2R9ZA 5KRQA 2A87A 4J34A 1GV4A 2YLSA 1PJ6A 4YSXA 1NHSA 1E1LA 4JNQA 3VRBA 3CPHG 1GRBA 1JRZA 2YVJA 4U8PA 2E5VA 1BGJA 4BK1A 1GRFA 3CNTA 2XLSA 2HQMA 3NLCA 3SXIA 2YM1A 4D04A 4EIPA 4CRTA 1EBDA 1PXCA 4EM4A 1GESA 3JSKA 1FL2A 1FOHA 3AEEA 4JNAA 3D8XA 3NTAA 3BHFA 3CMMA 2R0GA 1GRAA 2WOVA 1IUXA 2WDVA 3M12A 4Z44A 3AE9A 2ACZA 3GMCA 2VRMA 1MXTA 2JKCA 3P1WA 2NVKX 4GDEA 4B65A 4LIIA 1GTHA 4A9WA 2WDRA 4M52A 1O95A 1F6MA 2WPEA 3S5WA 3H8IA 4H4ZA 2YVFA 2WP5A 1D4DA 4FK1C 1BWCA 1H7XA 3DJGX 3GD4A 2RABA 3BNMA 1PDHA 2YR5A 3NYFA 1BZLA 1VRQB 2YAUA 2BCGG 1DNCA 1GALA 4ECHA 2V61A 3SZFA 2FJEA 2XVIA 1Q9IA 4MJWA 2EQ9A 1D7YA 2QAEA 2IIDA 2WDQA 3LJPA 4UP3A 1V59A 1Z6LA 2PHHA 3SM8A 3ZYXA 2WP9A 2WETA 2OLNA 3SZ0A 1X31B 2BK3A 4C74A 3NN6X 1B8SA 4CNKA 3NNEA 2GMHA 4K5SA 3E1TA 3H8LA 4IVOB 2C64A 5JCMA 2QA1A 1PN0A 1KSSA 3GDPA 3R9UA 5JCNA 3C4NA 2NPXA 4A65A 1XHCA 2WP6A 3QVPA 2BS2A 4Y4LA 1BF3A 3L1RA 3DJDA 2XLUA 1CHUA 4CBQA 2PYXA 1LQTA 2RGOA 1D4EA 3DA1A 2VZ2A 4IA6A 2V5ZA 1CC6A 1AOGA 2E4GA 2XDOA 2YR4A 2TMDA 4EQXA 3LZWA 4TLXA 1GERA 3IHMA 3KKJA 3UKHA 1F8SA 1SEZA 3P4QA 1OJCA 2BC0A 4CNJA 1F3PA 1VG9A 3NH3X 3GYJA 5HXIA 4IA5A 2VVLG 3SFEA 3URHA 2I0ZA 2R4EA 3BHKA 1YKJA 3V3NA 4XWZA 1N4VA 2GRTA 4DNAA 5HYMA 4EQWA 3HZLA 2Q7VA 2R45A 5J7XA 3NK0X 4C5OA 4Z2RA 3EAOA 4TM0A 5CQFA 3REDA 5U1OA 1W4XA 3KU9A 4OPLA 2TPRA 1OJ9A 2X99A 2AAQA 3GSIA 4XWRA 3UKAA 4X4JA 4GAVA 1VQWA 3G5QA 1GT8A 1PBFA 3LADA 4H2NA 1OJAA 3AYJA 1OJDA 3AB1A 2XFNA 3UKPA 2JB2A 2H88A 3NTDA 3NK2X 3AEDA 4OPDA 1L9EA 2GQFA 4J56A 4U2SA 4D03A 3SQPA 2JK6A 3M13A 1GSNA 5JCKA 2C66A 4O5UA 3EF6A 3T2KA 4A7AA 3GYXA 2OALA 5KWFA 1KNRA 1CJ2A 2XFPA 2AQJA 4J31A 4YSYA 3NHOX 4TLZA 3SZWA 4UDPA 4K8DA 1ONFA 3AE3A 4H4PA 3OZ2A 2B9XA 4U8OA 1S2YA 4USRA 3UP5A 5BVAA 2APGA 3UOXA 3GMBA 3KA7A 3CGBA 3T2ZA 2QA2A 2R0PA 5TR3A 5L46A 1YY5A 2VRLA 3F8RA 2GH5A 4B66A 4E0VA 2ZZCA 5BUKA 4RG3A 1NHPA 3SGLA 1S3BA 5KOWA 1LPFA 3GRSA 1VDCA 2BRAA 2XLRA 3AE2A 5FS9A 2WEUA 1BGNA 3AEBA 4JQ9A 3CGEA 1JOAA 3AEAA 4TM3A 2F5ZA 3F8PA 5KMSA 1PBBA 5KVHA 4YT0A 4O5QA 3DGZA 2YG7A 4A6NB 4C77A 4K2XA 2YG4A 3DK9A 2V60A 3LZXA 1F8RA 1LQUA 2CFYA 1YQ3A 4WCTA 1TDNA 1NG4A 5FMHA 1UKVG 2XVJA 3RHAA 5FS8A 2FBWA 1JRYA 2Z5XA 1TDOA 3NIXA 4EQSA 3SY4A 3DMEA 2GR3A 3DK8A 5U63A 3DJJA 3T31A 3AE5A 5IQ4A 5JRBA 1K0IA 5KMRA 4I58A 1FECA 2ZZ0A 1IUWA 2B7RA 2GB0A 1DJNA 3PS9A 5C2TA 1ZX9A 5LV9A 3EANA 1D5TA 1KDGA 3UKLA 2GAGB 1NENA 4B63A 3CTYA 2GR2A 3CN8A 4NTCA 3T14A 4AT0A 1TDFA 3GWFA 2IVDA 4LA1A 1GRGA 4JDRA 3RNMA 1DOEA 3CNSA 1KNPA 2CVJA 2YG3A 4AP3A 1GETA 1H6VA 4C3YA 1JRXA 1JU2A 3CPIG 3GWDA 3AD9B 4CY8A 3T0KA 2WOIA 2YLWA 2H89A 4J2WA 3NYEA 1Y56A 1NHRA 3DH9A 2CULA 2R4JA 2XLTA 3L8KA 3ALMA 3CIRA 3HYVA 3K30A 1XPQA 3AWIA 2B9YA 1JNZA 4G6HA 1CF3A 3FPZA 4A79A 3D1CA 5EBKA 1GREA 2BXSA 3C4AA 2XVHA 4U2TA 1ZOYA 3FG2P 1IUUA 5JCLA 2Y6RA 1H81A 4U8KA 1M64A 3WE0A 4Z2TA 2ZZBA 3IHGA 3AEGA 3RP8A 1MO9A 1L0VA 4OPCA 2GQWA 2IVEA 3ALLA 1RYIA 3NKSA 1LVLA 1S7MA 4U8NA 1PXAA 3IC9A 3QJ4A 2XCGA 3FBSA 4USQA 3UTFA 3EPTA 2JB3A 1CL0A 4IVMB 4HA6A 2OAMA 4OPIA 5EB5A 2C72A 5J60A 3KVEA 2OLOA 4PAAA 2WBAA 2A8XA 3KPKA 4FK1A 1HYUA 3SZCA 4BK3A 2BXRA 3QFBA 1COYA 4GAPA 4A6NA 4B68A 3UKFA 1DOCA 2GF3A 3B6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLB A;  4BUR A;  1RP0 A;  3UOZ A;  4JN9 A;  4K22 A;  3CND A;  4YTP A;  4B67 A;  1LV0 A;  2BAB A;  3F8D A;  3ISH A;  4OPG A;  3UP4 A;  3VRD B;  4Z2U A;  3NK1 X;  1ZDL A;  4Z24 A;  4J33 A;  3Q9T A;  1L9C A;  2FJA A;  3DK4 A;  1ZP0 A;  4H4W A;  2ARD A;  2RGH A;  1EL9 A;  4JY3 A;  5HY5 A;  3H4K A;  1GRH A;  1TYP A;  1ZY8 A;  4K7Z A;  2WES A;  4ZCD A;  4Y4N A;  5EB4 A;  4YSZ A;  3T37 A;  4FX9 A;  4NEW A;  1E1K A;  4EQR A;  2BCP A;  1L9D A;  2WU2 A;  3ATR A;  2XFQ A;  3OC4 A;  3AXB A;  1KF6 A;  1TYT A;  3I6D A;  4A99 A;  1Q1W A;  3CGD A;  4H4T A;  1NEK A;  1JNR A;  2VVM A;  2WS3 A;  4X9N A;  3QSS A;  1GRT A;  1ZMC A;  2BAC A;  3UTH A;  1TRB A;  2X8C A;  4EMW A;  4I59 A;  2QCU A;  2R0C A;  1N4W A;  1RSG A;  1Y56 B;  1OJT A;  2AR8 A;  3ATQ A;  3DJE A;  1IJH A;  4Z25 A;  4AOS A;  4OCG A;  2WPF A;  1TDK A;  2RGJ A;  3CNP A;  2C3D A;  2GR1 A;  1H84 A;  3CNJ A;  3UOV A;  3P4R A;  4YTM A;  3UTG A;  4H2P A;  1PXB A;  2YLR A;  3AEF A;  1CC2 A;  1FEA A;  4H50 A;  5ER0 A;  2XYO A;  4YXD A;  1E1M A;  3C96 A;  1LJ1 A;  1TDE A;  2EQ6 A;  3COX A;  4YSH A;  3BI5 A;  3DGH A;  4EMI A;  3FIM B;  1ZK7 A;  4X9M A;  5M0Z A;  1QO8 A;  3UKK A;  3NT6 A;  3RP7 A;  2Q0K A;  2OA1 A;  4YWO A;  1B5Q A;  4CCQ A;  1QJD A;  5C3J A;  4CY6 A;  4AOX A;  4H4Q A;  2C7G A;  1FEB A;  1E1N A;  2WQY A;  4U8L A;  3AYI A;  1F8W A;  1XDI A;  3AE6 A;  4YTN A;  2VQ7 A;  4DGK A;  3VR8 A;  4YKF A;  4GDP A;  4K5R A;  3CGC A;  4HB9 A;  1H86 A;  2GV8 A;  4A5L A;  1B4V A;  5FS6 A;  4H4V A;  1EL5 A;  2C67 A;  2Q0L A;  1B37 A;  3IF9 A;  4NTD A;  2XFO A;  4RG4 A;  4KX6 A;  1O5W A;  2C70 A;  1PS9 A;  1VG0 A;  2VOU A;  5DBJ A;  3NYC A;  2YG5 A;  1LTX R;  2YG6 A;  4TM4 A;  4YKG A;  4NZH A;  1Y0P A;  2YR6 A;  3PO7 A;  1N4U A;  2GEW A;  4LU6 A;  4RSL A;  3KLJ A;  4AP1 A;  4REK A;  1E6E A;  4U8I A;  1D4C A;  3M0O A;  4IV9 A;  3LOV A;  2C73 A;  4UDR A;  1P2E A;  2XLP A;  5BUL A;  2X8G A;  4P9S A;  4KPR A;  4BJY A;  4H4R A;  3ICR A;  2Z5Y A;  1H7W A;  3AYL A;  2WPC A;  2B76 A;  3UTE A;  4NTE A;  1CBO A;  1PJ5 A;  1IUT A;  4B64 A;  3FMW A;  3ICS A;  3V76 A;  4ZCC A;  3B3R A;  1CJ3 A;  3AEC A;  3ALJ A;  4Y4M A;  2XFU A;  5IQ1 A;  3AD7 B;  1CJC A;  3II4 A;  2GR0 A;  2B7S A;  1E7P A;  1Q1R A;  5IPY A;  3QSM A;  2EQ8 A;  1K0J A;  2Q6U A;  3SFD A;  1NAA A;  4GF7 A;  4GR1 A;  4EIQ A;  1EL7 A;  4FDC B;  3IWA A;  2Y6Q A;  3P4S A;  5BRT A;  1PBC A;  5M10 A;  2V6O A;  2R46 A;  4BJZ A;  4J57 A;  1S3E A;  1CC4 A;  1H82 A;  2DKI A;  3BI2 A;  2UZZ A;  3UKQ A;  3NRN A;  3QFA A;  3NN0 X;  2GAH B;  2YVG A;  2ZBW A;  2WHD A;  3NG7 X;  4JY2 A;  4BK2 A;  3VR9 A;  3G5S A;  4N9X A;  2YLX A;  4ADW A;  1DJQ A;  4B1B A;  1GOS A;  3KPF A;  4H2Q A;  5KVI A;  2DKH A;  2E1M A;  4B69 A;  1XAN A;  1JEH A;  2YLZ A;  5JCI A;  3UOY A;  3KD9 A;  2FJB A;  3QSE A;  4ZN0 A;  3K7Q X;  4H2R A;  2BK4 A;  1ZMD A;  3K7T A;  1REO A;  2BA9 A;  1O94 A;  5HHF A;  3AE8 A;  1NG3 A;  4J36 A;  2V3B A;  4DSG A;  4GCM A;  3ICT A;  4WX1 A;  1DXL A;  1N1P A;  5GSN A;  3GD3 A;  1P2H A;  3ABV A;  1GEU A;  5U25 A;  1S2Q A;  3V3O A;  1K4Q A;  1NPX A;  5FS7 A;  1K0L A;  2GMJ A;  4UDQ A;  4C3X A;  4EM3 A;  1PBD A;  3K7M X;  1PJ7 A;  2B9W A;  3ADA B;  5EOW A;  2BK5 A;  2VQB A;  4AT2 A;  4ICY A;  4Z26 A;  1IUV A;  1EL8 A;  3AE1 A;  3GYI A;  2BC1 A;  1ZOV A;  1MOK A;  2YQU A;  4H4X A;  1DOB A;  1NHQ A;  3P9U A;  1YQ4 A;  4OPU A;  1KSU A;  2VVL A;  2O9Z A;  4DSH A;  5KXJ A;  3ZDN A;  3LXD A;  4PAB A;  3AD8 B;  3G5R A;  2C65 A;  4EMJ A;  2WOW A;  3I3L A;  2BS4 A;  2A89 A;  4CCR A;  2X8H A;  5CKU A;  3VRA A;  1ELI A;  1E39 A;  2V3A A;  1DOD A;  2BYB A;  2YWL A;  4GUV A;  2XVE A;  4OVI A;  1YQZ A;  4NEV A;  2WU5 A;  5GRT A;  1FCD A;  2BS3 A;  3ITJ A;  4H7U A;  1GND A;  2GVC A;  3S61 A;  3VQR A;  5KOX A;  4OPT A;  3GRT A;  1H83 A;  1GXF A;  2YM2 A;  2W0H A;  2XVF A;  1ZKQ A;  2X50 A;  4XXG A;  3UCL A;  4H4Y A;  3RP6 A;  2JB1 A;  3BNU A;  2JBV A;  1D7L A;  4U8M A;  2J3N A;  1PBE A;  1GPE A;  4APN A;  1GTE A;  4H4S A;  4BV6 A;  1IUS A;  1CJ4 A;  2YLT A;  4GRT A;  1PHH A;  3Q6J A;  1KFY A;  2FJD A;  4U8J A;  1NDA A;  3BI4 A;  3O0H A;  2CDU A;  3CPJ G;  2JAE A;  3QVR A;  2C3C A;  2X3N A;  3GDN A;  3AE7 A;  4TM1 A;  4U2L A;  3NGC X;  3PVC A;  3P4P A;  3AE4 A;  2C75 A;  4H4U A;  3LB8 A;  2EQ7 A;  4Z43 A;  1M6I A;  2C76 A;  1BKW A;  2R9Z A;  5KRQ A;  2A87 A;  4J34 A;  1GV4 A;  2YLS A;  1PJ6 A;  4YSX A;  1NHS A;  1E1L A;  4JNQ A;  3VRB A;  3CPH G;  1GRB A;  1JRZ A;  2YVJ A;  4U8P A;  2E5V A;  1BGJ A;  4BK1 A;  1GRF A;  3CNT A;  2XLS A;  2HQM A;  3NLC A;  2YM1 A;  4D04 A;  4EIP A;  4CRT A;  1EBD A;  1PXC A;  4EM4 A;  1GES A;  3JSK A;  1FL2 A;  1FOH A;  3AEE A;  4JNA A;  3D8X A;  3NTA A;  3BHF A;  2R0G A;  1GRA A;  2WOV A;  1IUX A;  2WDV A;  3M12 A;  4Z44 A;  3AE9 A;  2ACZ A;  3GMC A;  2VRM A;  1MXT A;  2JKC A;  3P1W A;  2NVK X;  4GDE A;  4B65 A;  4LII A;  1GTH A;  4A9W A;  2WDR A;  4M52 A;  1O95 A;  1F6M A;  2WPE A;  3S5W A;  3H8I A;  4H4Z A;  2YVF A;  2WP5 A;  1D4D A;  4FK1 C;  1BWC A;  1H7X A;  3DJG X;  3GD4 A;  2RAB A;  3BNM A;  1PDH A;  2YR5 A;  3NYF A;  1BZL A;  1VRQ B;  2YAU A;  2BCG G;  1DNC A;  1GAL A;  4ECH A;  2V61 A;  2FJE A;  2XVI A;  1Q9I A;  4MJW A;  2EQ9 A;  1D7Y A;  2QAE A;  2IID A;  2WDQ A;  3LJP A;  4UP3 A;  1V59 A;  1Z6L A;  2PHH A;  3SM8 A;  3ZYX A;  2WP9 A;  2WET A;  2OLN A;  1X31 B;  2BK3 A;  4C74 A;  3NN6 X;  1B8S A;  4CNK A;  3NNE A;  2GMH A;  4K5S A;  3E1T A;  3H8L A;  4IVO B;  2C64 A;  5JCM A;  2QA1 A;  1PN0 A;  1KSS A;  3GDP A;  3R9U A;  5JCN A;  3C4N A;  2NPX A;  4A65 A;  1XHC A;  2WP6 A;  3QVP A;  2BS2 A;  4Y4L A;  1BF3 A;  3L1R A;  3DJD A;  2XLU A;  1CHU A;  4CBQ A;  2PYX A;  1LQT A;  2RGO A;  1D4E A;  3DA1 A;  2VZ2 A;  4IA6 A;  2V5Z A;  1CC6 A;  1AOG A;  2E4G A;  2XDO A;  2YR4 A;  2TMD A;  4EQX A;  3LZW A;  4TLX A;  1GER A;  3IHM A;  3KKJ A;  3UKH A;  1F8S A;  1SEZ A;  3P4Q A;  1OJC A;  2BC0 A;  4CNJ A;  1F3P A;  1VG9 A;  3NH3 X;  3GYJ A;  5HXI A;  4IA5 A;  2VVL G;  3SFE A;  3URH A;  2I0Z A;  2R4E A;  3BHK A;  1YKJ A;  3V3N A;  4XWZ A;  1N4V A;  2GRT A;  4DNA A;  5HYM A;  4EQW A;  3HZL A;  2Q7V A;  2R45 A;  5J7X A;  3NK0 X;  4C5O A;  4Z2R A;  3EAO A;  4TM0 A;  5CQF A;  3RED A;  5U1O A;  1W4X A;  3KU9 A;  4OPL A;  2TPR A;  1OJ9 A;  2X99 A;  2AAQ A;  3GSI A;  4XWR A;  3UKA A;  4X4J A;  1VQW A;  3G5Q A;  1GT8 A;  1PBF A;  3LAD A;  4H2N A;  1OJA A;  3AYJ A;  1OJD A;  3AB1 A;  2XFN A;  3UKP A;  2JB2 A;  2H88 A;  3NTD A;  3NK2 X;  3AED A;  4OPD A;  1L9E A;  2GQF A;  4J56 A;  4U2S A;  4D03 A;  3SQP A;  2JK6 A;  3M13 A;  1GSN A;  5JCK A;  2C66 A;  4O5U A;  3EF6 A;  4A7A A;  2OAL A;  5KWF A;  1KNR A;  1CJ2 A;  2XFP A;  2AQJ A;  4J31 A;  4YSY A;  3NHO X;  4TLZ A;  4UDP A;  4K8D A;  1ONF A;  3AE3 A;  4H4P A;  3OZ2 A;  2B9X A;  4U8O A;  1S2Y A;  4USR A;  3UP5 A;  5BVA A;  2APG A;  3UOX A;  3GMB A;  3KA7 A;  3CGB A;  2QA2 A;  2R0P A;  5TR3 A;  5L46 A;  1YY5 A;  2VRL A;  3F8R A;  2GH5 A;  4B66 A;  4E0V A;  2ZZC A;  5BUK A;  4RG3 A;  1NHP A;  3SGL A;  1S3B A;  5KOW A;  1LPF A;  3GRS A;  1VDC A;  2XLR A;  3AE2 A;  5FS9 A;  2WEU A;  1BGN A;  3AEB A;  4JQ9 A;  3CGE A;  1JOA A;  3AEA A;  4TM3 A;  2F5Z A;  3F8P A;  1PBB A;  5KVH A;  4YT0 A;  4O5Q A;  3DGZ A;  2YG7 A;  4A6N B;  4C77 A;  4K2X A;  2YG4 A;  3DK9 A;  2V60 A;  3LZX A;  1F8R A;  1LQU A;  2CFY A;  1YQ3 A;  4WCT A;  1TDN A;  1NG4 A;  5FMH A;  1UKV G;  2XVJ A;  3RHA A;  5FS8 A;  2FBW A;  1JRY A;  2Z5X A;  1TDO A;  3NIX A;  4EQS A;  3DME A;  2GR3 A;  3DK8 A;  5U63 A;  3DJJ A;  3AE5 A;  5IQ4 A;  1K0I A;  4I58 A;  1FEC A;  2ZZ0 A;  1IUW A;  2B7R A;  2GB0 A;  1DJN A;  3PS9 A;  5C2T A;  1ZX9 A;  5LV9 A;  3EAN A;  1D5T A;  1KDG A;  3UKL A;  2GAG B;  1NEN A;  4B63 A;  3CTY A;  2GR2 A;  3CN8 A;  4NTC A;  4AT0 A;  1TDF A;  3GWF A;  2IVD A;  4LA1 A;  1GRG A;  4JDR A;  3RNM A;  1DOE A;  3CNS A;  1KNP A;  2CVJ A;  2YG3 A;  4AP3 A;  1GET A;  1H6V A;  4C3Y A;  1JRX A;  1JU2 A;  3CPI G;  3GWD A;  3AD9 B;  4CY8 A;  2WOI A;  2YLW A;  2H89 A;  4J2W A;  3NYE A;  1Y56 A;  1NHR A;  3DH9 A;  2CUL A;  2R4J A;  2XLT A;  3L8K A;  3ALM A;  3CIR A;  3K30 A;  1XPQ A;  3AWI A;  2B9Y A;  1JNZ A;  4A79 A;  1CF3 A;  3FPZ A;  3D1C A;  5EBK A;  1GRE A;  2BXS A;  3C4A A;  2XVH A;  4U2T A;  1ZOY A;  3FG2 P;  1IUU A;  5JCL A;  2Y6R A;  1H81 A;  4U8K A;  1M64 A;  3WE0 A;  4Z2T A;  2ZZB A;  3IHG A;  3AEG A;  3RP8 A;  1MO9 A;  1L0V A;  4OPC A;  2GQW A;  2IVE A;  3ALL A;  1RYI A;  3NKS A;  1LVL A;  4U8N A;  1PXA A;  3IC9 A;  3QJ4 A;  2XCG A;  3FBS A;  4USQ A;  3UTF A;  3EPT A;  2JB3 A;  1CL0 A;  4IVM B;  4HA6 A;  2OAM A;  4OPI A;  5EB5 A;  2C72 A;  5J60 A;  3KVE A;  2OLO A;  4PAA A;  2WBA A;  2A8X A;  4FK1 A;  1HYU A;  4BK3 A;  2BXR A;  3QFB A;  1COY A;  4A6N A;  4B68 A;  3UKF A;  1DOC A;  2GF3 A;  3B6D A; 
#chains in the Genus database with same CATH topology
 3RIT A;  3TWA A;  5IDZ A;  1RP0 A;  4JN9 A;  2GGG A;  4YTP A;  4HCL A;  4B67 A;  3ISH A;  1ZDL A;  4Z24 A;  3STP A;  2FJA A;  1ZP0 A;  4H4W A;  4JY3 A;  5BOF A;  2C4C A;  3NVY B;  2BCP A;  3ATR A;  4KWS A;  2XFQ A;  3AXB A;  1NEK A;  3ES8 A;  1ZMC A;  4I59 A;  1RSG A;  1Y56 B;  1OJT A;  3DJE A;  4YTM A;  3MSY A;  1LJ1 A;  1TDE A;  3COX A;  4EMI A;  4X9M A;  3NT6 A;  3OP2 A;  1H2I A;  2PU0 A;  1B5Q A;  1QJD A;  5C3J A;  3ZVI A;  2C7G A;  3R10 A;  1E1N A;  1XDI A;  4YTN A;  4YKF A;  5KMP A;  4HB9 A;  1H86 A;  5FS6 A;  4G73 A;  3UJR A;  4KX6 A;  1O5W A;  2C70 A;  4G6G A;  2VOU A;  2P8C A;  2YG5 A;  4LU6 A;  3KLJ A;  1MUC A;  1E6E A;  1D4C A;  1IYX A;  4NWZ A;  3N4E A;  2QVH A;  2WPC A;  3FMW A;  4ZCC A;  3B3R A;  3ALJ A;  3SQS A;  1CJC A;  1E7P A;  1Q1R A;  3MZN A;  5IPY A;  2QJJ A;  3IWA A;  5M10 A;  1SJB A;  2DKI A;  3BI2 A;  4DHG A;  1N5W C;  4N9X A;  3SN1 A;  4ADW A;  2ZAD A;  3PWG A;  3KPF A;  4TVW A;  5KVI A;  1XAN A;  3L5O A;  4ZN0 A;  3H8A A;  3QPE A;  3K7Q X;  4H2R A;  3PWI A;  5HHF A;  2V3B A;  3T9P A;  3ABV A;  4II3 A;  1GEU A;  5U25 A;  5FS7 A;  1PBD A;  2B9W A;  1EC7 A;  2BK5 A;  2VQB A;  4ICY A;  1EL8 A;  2BC1 A;  1ZOV A;  1MOK A;  2YQU A;  1DOB A;  5KXJ A;  2VVL A;  5G5H B;  2C65 A;  4EMJ A;  2WOW A;  3I3L A;  2X8H A;  3VRA A;  1ELI A;  3RGT A;  2YWL A;  2PTX A;  4OVI A;  4JN8 A;  3QKE A;  3NVZ B;  5GRT A;  1FCD A;  4OPT A;  3GRT A;  1GXF A;  2X50 A;  4U8M A;  2J3N A;  1GPE A;  4APN A;  4H4S A;  4K2S A;  4BV6 A;  2YLT A;  1PHH A;  4F4R A;  3Q6J A;  3BI4 A;  3O0H A;  4ZA0 A;  1BQG A;  3VC6 A;  3PVC A;  3TJ4 A;  3JZU A;  3LB8 A;  5KRQ A;  4J34 A;  1GV4 A;  1PJ6 A;  1NHS A;  3VRB A;  1DTN A;  4U8P A;  2E5V A;  1BGJ A;  4BK1 A;  2HQM A;  3NLC A;  1ECQ A;  2YM1 A;  2PU1 A;  1EBD A;  3AEE A;  1FOH A;  3OPS A;  1IUX A;  4Z44 A;  3OZY A;  2WDR A;  2GGI A;  4M52 A;  1F6M A;  3EKG A;  4FK1 C;  3S47 A;  1H7X A;  1MNS A;  3NYF A;  2E5A A;  3SN0 A;  1DNC A;  2W3R A;  3DES A;  2XVI A;  3VCC A;  1Q9I A;  4MJW A;  3NVV B;  2IID A;  2WDQ A;  1V59 A;  3ZYX A;  2BK3 A;  3NN6 X;  2GMH A;  1PN0 A;  5JCN A;  2PGW A;  4A65 A;  7ENL A;  3S5S A;  3L1R A;  4CBQ A;  2OFJ A;  2XLU A;  4YWS A;  1CC6 A;  4M0X A;  2E4G A;  1ONE A;  2XDO A;  4TLX A;  3KKJ A;  3IHM A;  3MWC A;  1F8S A;  1OJC A;  2RDX A;  1VG9 A;  3NH3 X;  3DIP A;  3BHK A;  1YKJ A;  4GIR A;  3CYJ A;  3DG7 A;  2PMQ A;  2Q7V A;  4E5T A;  1EBG A;  4IP4 A;  4GGH A;  4Z2R A;  3EAO A;  4TM0 A;  4OPL A;  2OVL A;  3RRA A;  1OJ9 A;  4XWR A;  4X4J A;  3G5Q A;  1V97 A;  1XPY A;  2JB2 A;  3NK2 X;  3AED A;  1L9E A;  4U2S A;  4O5U A;  3SQP A;  2JK6 A;  3EF6 A;  3GYX A;  1KNR A;  2FYM A;  4J31 A;  3NHO X;  3OZ2 A;  5BVA A;  2APG A;  2QA2 A;  4IL2 A;  2R0P A;  5TR3 A;  2VRL A;  3F8R A;  2ZZC A;  1S3B A;  3OW1 A;  3GRS A;  1VDC A;  5FS9 A;  3F8P A;  5KMS A;  4YT0 A;  2YG4 A;  3GD6 A;  4FI4 A;  3LZX A;  1F8R A;  1YQ3 A;  1FFV C;  2XVJ A;  2FBW A;  5U63 A;  3MQT A;  3AE5 A;  2GSH A;  2B7R A;  3EAN A;  1D5T A;  1KDG A;  3UKL A;  1NEN A;  1T3Q C;  2GR2 A;  3CN8 A;  3T14 A;  2AKM A;  2HNE A;  3RNM A;  1DOE A;  3GWD A;  2WOI A;  3CB3 A;  3UJS A;  3K30 A;  2R4J A;  1PDY A;  2B9Y A;  1SJC A;  2PPG A;  1GRE A;  2XVH A;  1ZOY A;  2W55 A;  2ZZB A;  3IHG A;  1NU5 A;  3RP8 A;  1MO9 A;  1L0V A;  2GQW A;  1RYI A;  3TWB A;  1LVL A;  3IC9 A;  3QJ4 A;  3TOY A;  2JB3 A;  4IVM B;  4HA6 A;  4OPI A;  4PAA A;  4FK1 A;  1HYU A;  3QFB A;  4GAP A;  3UOZ A;  4G74 A;  3CND A;  2BAB A;  4G8T A;  3F8D A;  4OPG A;  3UP4 A;  3NK1 X;  3SSZ A;  3DK4 A;  2RGH A;  2ARD A;  3H4K A;  2WES A;  5EB4 A;  3BJS A;  4NEW A;  1E1K A;  4EQR A;  3FXG A;  1L9D A;  3OC4 A;  3PG6 A;  3I6D A;  1TRB A;  4EMW A;  1WUE A;  2AR8 A;  4JN7 A;  5FJT A;  1IJH A;  4OCG A;  3VC5 A;  3UOV A;  1FEA A;  4H50 A;  2XYO A;  1E1M A;  1FIQ B;  2W54 A;  3BI5 A;  3FIM B;  5M0Z A;  4CCQ A;  4U8L A;  2DW7 A;  1MRA A;  4K5R A;  3CGC A;  2GV8 A;  3IJQ A;  2C67 A;  4NTD A;  4RG4 A;  1N61 C;  2OLA A;  1PS9 A;  3V3W A;  4YKG A;  3PO7 A;  4RSL A;  3I4K A;  4U8I A;  1KKO A;  3M0O A;  3LOV A;  1P2E A;  4P9S A;  4KPR A;  4BJY A;  4H4R A;  3ICR A;  3AN1 A;  3R0U A;  1CBO A;  1IUT A;  1CJ3 A;  3AEC A;  4II2 A;  6ENL A;  4Y4M A;  3AD7 B;  2B7S A;  3QSM A;  3MUC A;  3FJ4 A;  4DWD A;  3DG6 A;  4EIQ A;  4FDC B;  1PBC A;  4G9K A;  1S3E A;  2UZZ A;  3UKQ A;  1W6T A;  2DW6 A;  3TW9 A;  3G5S A;  2YLX A;  3ZLH A;  1DJQ A;  4B1B A;  1GOS A;  3DDM A;  1WUF A;  4H2Q A;  1JEH A;  2YLZ A;  3QSE A;  2OZ3 A;  1REO A;  2BA9 A;  1O94 A;  3AE8 A;  4GCM A;  3ICT A;  1DXL A;  1N1P A;  5GSN A;  1S2Q A;  2GMJ A;  4UDQ A;  4C3X A;  3K7M X;  4DYE A;  4A35 A;  4AT2 A;  3CXO A;  4GGB A;  1IUV A;  3CXB A;  1NHQ A;  3P9U A;  1YQ4 A;  4PAB A;  1MDL A;  3IJI A;  2A89 A;  5CKU A;  1STZ A;  3OTR A;  2XVE A;  1YQZ A;  3ITJ A;  3IJL A;  3VQR A;  1ZKQ A;  4H4Y A;  3RP6 A;  3BNU A;  3VFC A;  2JBV A;  3K1G A;  3BSM A;  4FP1 A;  1KFY A;  1NDA A;  3GDN A;  2X3N A;  4GIS A;  3AE7 A;  4U2L A;  3P4P A;  5BOE A;  3AE4 A;  2C75 A;  4Z43 A;  4YSX A;  1GRB A;  1TKK A;  2XLS A;  4MMW A;  3D46 A;  4KEM A;  3JSK A;  3CMM A;  1GRA A;  3M12 A;  2ACZ A;  1P48 A;  3GMC A;  1MXT A;  2JKC A;  3P1W A;  2NVK X;  3PFR A;  2QDD A;  1GTH A;  1O95 A;  2WP5 A;  3ENL A;  3DJG X;  1BZL A;  1VRQ B;  2YAU A;  1GAL A;  4ECH A;  1R0M A;  2V61 A;  2GL5 A;  2PHH A;  2WP9 A;  2OLN A;  3ZLG A;  4C74 A;  1B8S A;  4CNK A;  2XH0 A;  1N62 C;  3E1T A;  4IVO B;  3JW7 A;  1EC9 A;  5JCM A;  1KSS A;  3GDP A;  3DG3 A;  1XHC A;  2PP1 A;  3QVP A;  3DJD A;  4HNC A;  4IA6 A;  3LZW A;  3R07 C;  1SEZ A;  4K1W A;  3DER A;  3SFE A;  2I0Z A;  2OZT A;  3V3N A;  1TE6 A;  4XWZ A;  1N4V A;  2ZC8 A;  2OPJ A;  4DNA A;  5CQF A;  5U1O A;  3T6C A;  3I6T A;  2TPR A;  1SJA A;  2X99 A;  2AAQ A;  2XGZ A;  3UKA A;  2XH2 A;  1KKR A;  1GT8 A;  3LAD A;  1OJD A;  3NTD A;  4OPD A;  2GQF A;  3T2K A;  3M13 A;  5JCK A;  2GGE A;  1CJ2 A;  3AE3 A;  4U8O A;  3D47 A;  1S2Y A;  3UP5 A;  3SBF A;  4B66 A;  2GH5 A;  3RR1 A;  5FJU A;  2XLR A;  3AE2 A;  2WEU A;  1BGN A;  4JQ9 A;  3AEA A;  2F5Z A;  4O5Q A;  3DGZ A;  4C77 A;  4K2X A;  1JRP A;  1NEL A;  2OZ8 A;  1JRO A;  1JDF A;  5FMH A;  5FS8 A;  2Z5X A;  1TDO A;  3NIX A;  4EQS A;  3DME A;  3NO1 A;  2GB0 A;  4MKS A;  3NS1 B;  3GWF A;  1GRG A;  1KNP A;  1JRX A;  3AD9 B;  4J2W A;  1Y56 A;  1NHR A;  2CUL A;  3L8K A;  1CF3 A;  5EBK A;  2BXS A;  4A6G A;  2Y6R A;  1M64 A;  4Z2T A;  3TTE A;  3ALL A;  5EB5 A;  1CL0 A;  2C72 A;  3A7A A;  3KVE A;  4H19 A;  3KPK A;  4BK3 A;  4A6N A;  4B68 A;  1WYG A;  4BUR A;  4K22 A;  2HZG A;  1LV0 A;  4Z2U A;  1TZZ A;  4J33 A;  3I6E A;  1EL9 A;  3CK5 A;  2PTW A;  5HY5 A;  1GRH A;  1TYP A;  1ZY8 A;  2QGY A;  4K7Z A;  4E6M A;  4ZCD A;  3T37 A;  4FX9 A;  2WU2 A;  1TYT A;  4H4T A;  1JNR A;  2VVM A;  2WS3 A;  3QSS A;  1GRT A;  2BAC A;  1N4W A;  3NVW B;  3ATQ A;  4AOS A;  2WPF A;  2C3D A;  2GR1 A;  1FFU C;  3CNJ A;  3P4R A;  3UTG A;  4H2P A;  1PXB A;  3AEF A;  1CC2 A;  5ER0 A;  4YXD A;  3R25 A;  3C96 A;  3SYI A;  3DGH A;  1ZK7 A;  3UKK A;  3RP7 A;  3NZG A;  4YWO A;  2XH7 A;  4H4Q A;  3B97 A;  1FEB A;  4E4U A;  3AYI A;  1F8W A;  2FKP A;  2OQH A;  3AE6 A;  3VR8 A;  4GDP A;  1B4V A;  2Q0L A;  3IF9 A;  2XFO A;  3HYW A;  1VG0 A;  2CHR A;  5DBJ A;  3NYC A;  1LTX R;  2YG6 A;  3AM9 A;  2YR6 A;  2BRY A;  2PTY A;  4REK A;  4IV9 A;  2C73 A;  4UDR A;  2XLP A;  5BUL A;  2X8G A;  1H7W A;  3AYL A;  2B76 A;  3UTE A;  1PJ5 A;  3ICS A;  3V76 A;  5IQ1 A;  1R6W A;  1JCT A;  2GR0 A;  4ROP A;  3SFD A;  4GF7 A;  2P88 A;  1EL7 A;  1X2G A;  3P4S A;  2AL2 B;  2V6O A;  4BJZ A;  1CC4 A;  4H2H A;  1H82 A;  3NRN A;  3QFA A;  3NN0 X;  2YVG A;  3NG7 X;  3VR9 A;  3A7R A;  3HPF A;  2DKH A;  4HCD A;  2E1M A;  4B69 A;  3UOY A;  3KD9 A;  2FJB A;  3DFH A;  5EU9 A;  3UGV A;  4J36 A;  2GDQ A;  4WX1 A;  3V3O A;  1NPX A;  4J1O A;  4EM3 A;  2PP0 A;  1PJ7 A;  4IP5 A;  1EBH A;  3AE1 A;  4H4X A;  2GGJ A;  4OPU A;  4DN1 A;  2O9Z A;  4E4F A;  3V4B A;  3ZDN A;  3LXD A;  4X2P A;  2V3A A;  3KUM A;  2BYB A;  4GUV A;  4ZCW A;  4NEV A;  4KT2 A;  3FCP A;  4H7U A;  3TJI A;  3VCN A;  3S61 A;  5KOX A;  4GME A;  2YM2 A;  2XVF A;  3TCS A;  4XXG A;  5KNL A;  3UCL A;  4TVY A;  1D7L A;  1PBE A;  2MNR A;  5G5G B;  1CJ4 A;  4GRT A;  3NFU A;  3T2Y A;  3R11 A;  2FJD A;  4U8J A;  3CPJ G;  1RVK A;  2JAE A;  3QVR A;  2C3C A;  4TM1 A;  3NGC X;  1P43 A;  4H4U A;  1M6I A;  2QQ6 A;  1OEP A;  2A87 A;  3JVA A;  4HPN A;  4JNQ A;  2AKZ A;  4HN8 A;  1JRZ A;  2YVJ A;  1GRF A;  3SXI A;  4EIP A;  3ZVH A;  1N63 C;  1PXC A;  4EM4 A;  1FL2 A;  4JNA A;  3D8X A;  3NTA A;  3BHF A;  2PCE A;  3HRD C;  2VRM A;  4B65 A;  2PA6 A;  5FJP A;  3Q4D A;  4E8G A;  2WPE A;  4MGG A;  3GD4 A;  2RAB A;  1PDH A;  2GGH A;  2BCG G;  3UXL A;  2FJE A;  3U4F A;  2QAE A;  3LJP A;  2WET A;  1X31 B;  3BOX A;  3UCC A;  3ES7 A;  3NNE A;  4K5S A;  2QA1 A;  2BS2 A;  4Y4L A;  3DEQ A;  1LQT A;  1D4E A;  3DA1 A;  2P8B A;  2YR4 A;  1SB3 B;  3P4Q A;  2BC0 A;  4CNJ A;  3QLD A;  3CAW A;  1F3P A;  1L8P A;  4EWJ A;  4GYP A;  4ENL A;  4IA5 A;  2VVL G;  4Z1Y A;  3URH A;  3U9I A;  2OX4 A;  4EQW A;  3HZL A;  3UJF A;  5J7X A;  4C5O A;  1W4X A;  3KU9 A;  3GSI A;  1VQW A;  3N6H A;  2PP3 A;  4Z17 A;  1PBF A;  1OJA A;  3FYY A;  3AB1 A;  3N6J A;  4KPL A;  2H88 A;  5LV9 A;  1E9I A;  3P3B A;  4IHC A;  2XSX A;  4TLZ A;  5J04 A;  3SZW A;  2W3S A;  1ONF A;  3NXL A;  4USR A;  3KA7 A;  1FO4 A;  3CGB A;  2PTZ A;  4H1Z A;  5BUK A;  4RG3 A;  1NHP A;  3SGL A;  5KOW A;  1LPF A;  3AEB A;  1FHU A;  4TM3 A;  2PGE A;  2YG7 A;  2V60 A;  1BKH A;  1TDN A;  1X2H A;  1JRY A;  3UXK A;  3SY4 A;  3DJJ A;  5IQ4 A;  5JRB A;  3FV9 A;  5KMR A;  4I58 A;  2ZZ0 A;  1IUW A;  1DJN A;  1ZX9 A;  4GFI A;  4B63 A;  3CTY A;  2XH4 A;  1TDF A;  2IVD A;  2YG3 A;  4AP3 A;  1H6V A;  3V5F A;  3CPI G;  1JU2 A;  4C3Y A;  3T0K A;  2YLW A;  2H89 A;  2XLT A;  3ALM A;  3CIR A;  3HYV A;  1XPQ A;  3AWI A;  1JNZ A;  3FPZ A;  1YEY A;  3C4A A;  4U2T A;  3OZM A;  3FG2 P;  3SN4 A;  1H81 A;  3WE0 A;  3Q45 A;  1SJD A;  4OPC A;  2IVE A;  4IL0 A;  3PK7 A;  3GO2 A;  3NKS A;  4U8N A;  2XCG A;  3UTF A;  3EPT A;  5J60 A;  2OAM A;  2WBA A;  2A8X A;  3SZC A;  2PSN A;  3UJ2 A;  2BXR A;  1COY A;  3UKF A;  2GRT A;  1QLB A;  4JHM A;  3MKC A;  3VRD B;  3Q9T A;  1L9C A;  3DFY A;  2P3Z A;  3NRZ B;  4Y4N A;  4YSZ A;  1VQZ A;  3CT2 A;  1KF6 A;  2OKT A;  3T8Q A;  4A99 A;  1Q1W A;  3CGD A;  4X9N A;  3UTH A;  2X8C A;  2QCU A;  1JPM A;  2R0C A;  4Z25 A;  1TDK A;  2RGJ A;  3CNP A;  4GYP C;  1H84 A;  5KMQ A;  2YLR A;  3HW2 A;  2EQ6 A;  4YSH A;  3D9X A;  1QO8 A;  3ETR B;  1KN0 A;  2Q0K A;  2OA1 A;  3RCY A;  4CY6 A;  4AOX A;  3SR6 B;  2WQY A;  2VQ7 A;  4DGK A;  4ZOH B;  4A5L A;  1EL5 A;  4H4V A;  1B37 A;  1JPD X;  3H7V A;  4TM4 A;  4NZH A;  1Y0P A;  1N4U A;  2GEW A;  4AP1 A;  1N5X A;  2HXT A;  2Z5Y A;  4HYR A;  4NTE A;  4B64 A;  3HYX A;  4A3R A;  2XFU A;  3II4 A;  2EQ8 A;  1K0J A;  2Q6U A;  1NAA A;  4GR1 A;  2Y6Q A;  3DGB A;  5BRT A;  2QJM A;  2AL1 A;  2R46 A;  4J57 A;  1ZXI C;  2GAH B;  2ZBW A;  4JY2 A;  2WHD A;  3TQP A;  1ELS A;  4BK2 A;  3QN3 A;  1KCZ A;  1MDR A;  5JCI A;  2BK4 A;  1ZMD A;  2E3T A;  3K7T A;  1NG3 A;  4DSG A;  3GD3 A;  1P2H A;  4K8G A;  1K4Q A;  3R1Z A;  1K0L A;  3ADA B;  3SX6 A;  5EOW A;  4IT1 A;  4Z26 A;  2POZ A;  3GYI A;  4J3Z A;  2I5Q A;  1KSU A;  4DSH A;  4NNJ A;  3AD8 B;  3G5R A;  3ZLF A;  2BS4 A;  4CCR A;  1E39 A;  1DOD A;  3UCD A;  4IZG A;  2WU5 A;  2BS3 A;  1GND A;  2GVC A;  2HXU A;  2OQY A;  3QTP A;  2O56 A;  1H83 A;  2W0H A;  3T4W A;  3SJN A;  5ENL A;  3R0K A;  2JB1 A;  3H70 A;  3RO6 A;  1GTE A;  3B9J B;  1IUS A;  5FJO A;  2CDU A;  2MUC A;  1RM6 B;  1N60 C;  3VA8 A;  3UJE A;  2EQ7 A;  2C76 A;  1BKW A;  2R9Z A;  2YLS A;  3THU A;  1E1L A;  3CPH G;  4M6U A;  3CNT A;  4H83 A;  4D04 A;  2OO6 A;  4CRT A;  1FHV A;  1GES A;  2R0G A;  2WOV A;  2WDV A;  3AE9 A;  1F9C A;  3N4F A;  4GDE A;  4LII A;  2ONE A;  4A9W A;  3S5W A;  3H8I A;  4H4Z A;  2YVF A;  1D4D A;  1BWC A;  3BNM A;  2YR5 A;  4HCH A;  3SZF A;  2EQ9 A;  1D7Y A;  4UP3 A;  1Z6L A;  3SM8 A;  4HNL A;  3SZ0 A;  4DXK A;  3A7U A;  3H8L A;  2C64 A;  3R9U A;  3C4N A;  2NPX A;  2WP6 A;  1BF3 A;  1CHU A;  2PYX A;  2RGO A;  2VZ2 A;  2V5Z A;  1AOG A;  3UKH A;  2TMD A;  4EQX A;  1GER A;  3AMZ A;  3EUB 3;  2P0I A;  3GYJ A;  5HXI A;  2R4E A;  5HYM A;  2R45 A;  3NK0 X;  3RED A;  4DX3 A;  4GAV A;  4H2N A;  3AYJ A;  2XFN A;  3UKP A;  3FVD A;  4J56 A;  4D03 A;  1GSN A;  2C66 A;  4A7A A;  2OAL A;  5KWF A;  2XFP A;  2AQJ A;  4YSY A;  4UDP A;  4K8D A;  4H4P A;  1XS2 A;  2B9X A;  3UOX A;  3GMB A;  3T2Z A;  2NQL A;  2POD A;  5L46 A;  1YY5 A;  4E0V A;  2BRA A;  1EC8 A;  5FJR A;  3CGE A;  1JOA A;  1PBB A;  5KVH A;  4A6N B;  3DK9 A;  3P93 A;  2PS2 A;  1LQU A;  2CFY A;  4WCT A;  3GC2 A;  1NG4 A;  1UKV G;  3V5C A;  3RHA A;  3H12 A;  2QDE A;  2GR3 A;  3DK8 A;  3T31 A;  3MY9 A;  1K0I A;  1FEC A;  5C2T A;  3PS9 A;  1PDZ A;  4G7F A;  2GAG B;  4NTC A;  4AT0 A;  3GY1 A;  4LA1 A;  4JDR A;  3CNS A;  2CVJ A;  4CY8 A;  1GET A;  2AL2 A;  3NYE A;  3DH9 A;  4G6H A;  2QJN A;  4A79 A;  3P0W A;  3D1C A;  1IUU A;  5JCL A;  4U8K A;  3ZVH B;  3AEG A;  1S7M A;  1PXA A;  3EEZ A;  3FBS A;  4USQ A;  3VDG A;  2OLO A;  2OG9 A;  1VDV A;  1KD0 A;  3IK4 A;  1DOC A;  2GF3 A;  3B6D A; 
#chains in the Genus database with same CATH homology
 1QLB A;  4BUR A;  1RP0 A;  3UOZ A;  4JN9 A;  4K22 A;  4G74 A;  3CND A;  4YTP A;  4B67 A;  1LV0 A;  2BAB A;  3F8D A;  3ISH A;  4OPG A;  3UP4 A;  3VRD B;  4Z2U A;  3NK1 X;  1ZDL A;  4Z24 A;  4J33 A;  3Q9T A;  1L9C A;  2FJA A;  3DK4 A;  1ZP0 A;  4H4W A;  2ARD A;  2RGH A;  1EL9 A;  4JY3 A;  5HY5 A;  3H4K A;  1GRH A;  1TYP A;  1ZY8 A;  4K7Z A;  2WES A;  4ZCD A;  4Y4N A;  5EB4 A;  2C4C A;  4YSZ A;  3T37 A;  4FX9 A;  4NEW A;  1E1K A;  4EQR A;  2BCP A;  1L9D A;  2WU2 A;  3ATR A;  2XFQ A;  3OC4 A;  3PG6 A;  1KF6 A;  3AXB A;  1TYT A;  3I6D A;  4A99 A;  1NEK A;  1Q1W A;  3CGD A;  4H4T A;  1JNR A;  2VVM A;  2WS3 A;  4X9N A;  3QSS A;  1GRT A;  1ZMC A;  2BAC A;  3UTH A;  1TRB A;  2X8C A;  4EMW A;  4I59 A;  2QCU A;  2R0C A;  1N4W A;  1RSG A;  1Y56 B;  1OJT A;  2AR8 A;  3ATQ A;  3DJE A;  1IJH A;  4Z25 A;  4AOS A;  4OCG A;  2WPF A;  1TDK A;  2RGJ A;  3CNP A;  2C3D A;  2GR1 A;  1H84 A;  3CNJ A;  5KMQ A;  3P4R A;  4YTM A;  3UOV A;  4H2P A;  1PXB A;  2YLR A;  3UTG A;  3AEF A;  1CC2 A;  1FEA A;  4H50 A;  5ER0 A;  2XYO A;  4YXD A;  1E1M A;  3C96 A;  1LJ1 A;  1TDE A;  3SYI A;  2EQ6 A;  3COX A;  4YSH A;  3BI5 A;  3DGH A;  4EMI A;  3D9X A;  3FIM B;  1ZK7 A;  4X9M A;  5M0Z A;  1QO8 A;  3UKK A;  3NT6 A;  3RP7 A;  1KN0 A;  1H2I A;  2Q0K A;  2OA1 A;  4YWO A;  1B5Q A;  4CCQ A;  1QJD A;  5C3J A;  4CY6 A;  4AOX A;  4H4Q A;  2C7G A;  1FEB A;  1E1N A;  2WQY A;  4U8L A;  3AYI A;  1F8W A;  1XDI A;  3AE6 A;  4YTN A;  2VQ7 A;  4DGK A;  3VR8 A;  4YKF A;  5KMP A;  4GDP A;  4K5R A;  3CGC A;  4HB9 A;  1H86 A;  2GV8 A;  4A5L A;  1B4V A;  5FS6 A;  4H4V A;  1EL5 A;  2C67 A;  4G73 A;  2Q0L A;  1B37 A;  3IF9 A;  4NTD A;  2XFO A;  4RG4 A;  3HYW A;  4KX6 A;  1O5W A;  2C70 A;  1PS9 A;  1VG0 A;  4G6G A;  2VOU A;  5DBJ A;  3NYC A;  2YG5 A;  1LTX R;  2YG6 A;  4TM4 A;  4YKG A;  4NZH A;  1Y0P A;  2YR6 A;  3PO7 A;  1N4U A;  2GEW A;  4LU6 A;  4RSL A;  3KLJ A;  2BRY A;  4AP1 A;  4REK A;  1E6E A;  4U8I A;  1D4C A;  3M0O A;  4IV9 A;  3LOV A;  2C73 A;  4UDR A;  1P2E A;  2XLP A;  5BUL A;  4NWZ A;  2X8G A;  4P9S A;  4KPR A;  4BJY A;  4H4R A;  3ICR A;  2Z5Y A;  1H7W A;  3AYL A;  2WPC A;  2B76 A;  3UTE A;  4NTE A;  1CBO A;  1PJ5 A;  1IUT A;  4B64 A;  3FMW A;  3ICS A;  3V76 A;  4ZCC A;  3B3R A;  1CJ3 A;  3AEC A;  3ALJ A;  3HYX A;  4II2 A;  4Y4M A;  2XFU A;  5IQ1 A;  3AD7 B;  1CJC A;  3II4 A;  2GR0 A;  2B7S A;  1E7P A;  1Q1R A;  5IPY A;  3QSM A;  2EQ8 A;  1K0J A;  2Q6U A;  3SFD A;  1NAA A;  4GF7 A;  4GR1 A;  4EIQ A;  1EL7 A;  4FDC B;  3IWA A;  2Y6Q A;  3P4S A;  5BRT A;  1PBC A;  5M10 A;  2V6O A;  2R46 A;  4BJZ A;  4J57 A;  4G9K A;  1S3E A;  1CC4 A;  1H82 A;  2DKI A;  3BI2 A;  2UZZ A;  3UKQ A;  3NRN A;  3QFA A;  3NN0 X;  2GAH B;  2YVG A;  2ZBW A;  2WHD A;  3NG7 X;  4JY2 A;  4BK2 A;  3VR9 A;  3G5S A;  4N9X A;  2YLX A;  4ADW A;  1DJQ A;  4B1B A;  1GOS A;  3KPF A;  4H2Q A;  5KVI A;  2DKH A;  2E1M A;  4B69 A;  1XAN A;  1JEH A;  3L5O A;  2YLZ A;  5JCI A;  3UOY A;  3KD9 A;  2FJB A;  3QSE A;  4ZN0 A;  3K7Q X;  4H2R A;  2BK4 A;  1ZMD A;  3K7T A;  1REO A;  2BA9 A;  1O94 A;  5HHF A;  3AE8 A;  1NG3 A;  4J36 A;  2V3B A;  4DSG A;  4GCM A;  3ICT A;  4WX1 A;  1DXL A;  1N1P A;  5GSN A;  3GD3 A;  1P2H A;  3ABV A;  1GEU A;  5U25 A;  1S2Q A;  4II3 A;  1K4Q A;  1NPX A;  5FS7 A;  1K0L A;  2GMJ A;  4UDQ A;  4C3X A;  4EM3 A;  1PBD A;  3K7M X;  1PJ7 A;  2B9W A;  3ADA B;  3SX6 A;  5EOW A;  2BK5 A;  2VQB A;  4AT2 A;  4ICY A;  4Z26 A;  1IUV A;  1EL8 A;  3V3O A;  3AE1 A;  3GYI A;  2BC1 A;  1ZOV A;  1MOK A;  2YQU A;  4H4X A;  1DOB A;  1NHQ A;  3P9U A;  1YQ4 A;  4OPU A;  1KSU A;  2VVL A;  2O9Z A;  4DSH A;  5KXJ A;  3ZDN A;  3LXD A;  4NNJ A;  4PAB A;  3AD8 B;  3G5R A;  2C65 A;  4EMJ A;  2WOW A;  3I3L A;  2BS4 A;  2A89 A;  4CCR A;  2X8H A;  5CKU A;  3VRA A;  1ELI A;  1E39 A;  2V3A A;  1DOD A;  2BYB A;  2YWL A;  4GUV A;  2XVE A;  4OVI A;  1YQZ A;  4NEV A;  2WU5 A;  5GRT A;  1FCD A;  2BS3 A;  3ITJ A;  4H7U A;  1GND A;  2GVC A;  3S61 A;  3VQR A;  5KOX A;  4OPT A;  3GRT A;  1H83 A;  1GXF A;  2YM2 A;  2W0H A;  2XVF A;  1ZKQ A;  2X50 A;  4XXG A;  5KNL A;  3UCL A;  4H4Y A;  3RP6 A;  2JB1 A;  3BNU A;  2JBV A;  1D7L A;  4U8M A;  2J3N A;  1PBE A;  1GPE A;  4APN A;  1GTE A;  4H4S A;  4BV6 A;  1IUS A;  1CJ4 A;  2YLT A;  4GRT A;  1PHH A;  3T2Y A;  3Q6J A;  1KFY A;  2FJD A;  4U8J A;  1NDA A;  3BI4 A;  3O0H A;  2CDU A;  3CPJ G;  2JAE A;  3QVR A;  2C3C A;  2X3N A;  3GDN A;  3AE7 A;  4TM1 A;  4U2L A;  3NGC X;  3PVC A;  3P4P A;  3AE4 A;  2C75 A;  4H4U A;  3LB8 A;  2EQ7 A;  4Z43 A;  1M6I A;  2C76 A;  1BKW A;  2R9Z A;  5KRQ A;  2A87 A;  4J34 A;  1GV4 A;  2YLS A;  1PJ6 A;  4YSX A;  1NHS A;  1E1L A;  4JNQ A;  3VRB A;  3CPH G;  1GRB A;  1JRZ A;  2YVJ A;  4U8P A;  2E5V A;  1BGJ A;  4BK1 A;  1GRF A;  3CNT A;  2XLS A;  2HQM A;  3NLC A;  3SXI A;  2YM1 A;  4D04 A;  4EIP A;  4CRT A;  1EBD A;  1PXC A;  4EM4 A;  1GES A;  3JSK A;  1FL2 A;  1FOH A;  3AEE A;  4JNA A;  3D8X A;  3NTA A;  3BHF A;  3CMM A;  2R0G A;  1GRA A;  2WOV A;  1IUX A;  2WDV A;  3M12 A;  4Z44 A;  3AE9 A;  2ACZ A;  3GMC A;  2VRM A;  1MXT A;  2JKC A;  3P1W A;  2NVK X;  4GDE A;  4B65 A;  4LII A;  1GTH A;  4A9W A;  2WDR A;  4M52 A;  1O95 A;  1F6M A;  2WPE A;  3S5W A;  3H8I A;  4H4Z A;  2YVF A;  2WP5 A;  1D4D A;  4FK1 C;  1BWC A;  1H7X A;  3DJG X;  3GD4 A;  2RAB A;  3BNM A;  1PDH A;  2YR5 A;  3NYF A;  1BZL A;  1VRQ B;  2YAU A;  2BCG G;  1DNC A;  1GAL A;  4ECH A;  2V61 A;  3SZF A;  2FJE A;  2XVI A;  1Q9I A;  4MJW A;  2EQ9 A;  1D7Y A;  2QAE A;  2IID A;  2WDQ A;  3LJP A;  4UP3 A;  1V59 A;  1Z6L A;  2PHH A;  3SM8 A;  3ZYX A;  2WP9 A;  2WET A;  2OLN A;  3SZ0 A;  1X31 B;  2BK3 A;  4C74 A;  3NN6 X;  1B8S A;  4CNK A;  3NNE A;  2GMH A;  4K5S A;  3E1T A;  3H8L A;  4IVO B;  2C64 A;  5JCM A;  2QA1 A;  1PN0 A;  1KSS A;  3GDP A;  3R9U A;  5JCN A;  3C4N A;  2NPX A;  4A65 A;  1XHC A;  2WP6 A;  3QVP A;  2BS2 A;  4Y4L A;  1BF3 A;  3L1R A;  3DJD A;  2XLU A;  1CHU A;  4CBQ A;  2PYX A;  1LQT A;  2RGO A;  1D4E A;  3DA1 A;  2VZ2 A;  4IA6 A;  2V5Z A;  1CC6 A;  1AOG A;  2E4G A;  2XDO A;  2YR4 A;  2TMD A;  4EQX A;  3LZW A;  4TLX A;  1GER A;  3IHM A;  3KKJ A;  3UKH A;  1F8S A;  1SEZ A;  3P4Q A;  1OJC A;  2BC0 A;  4CNJ A;  1F3P A;  1VG9 A;  3NH3 X;  3GYJ A;  5HXI A;  4IA5 A;  2VVL G;  3SFE A;  3URH A;  2I0Z A;  2R4E A;  3BHK A;  1YKJ A;  3V3N A;  4XWZ A;  1N4V A;  2GRT A;  4DNA A;  5HYM A;  4EQW A;  3HZL A;  2Q7V A;  2R45 A;  5J7X A;  3NK0 X;  4C5O A;  4Z2R A;  3EAO A;  4TM0 A;  5CQF A;  3RED A;  5U1O A;  1W4X A;  3KU9 A;  4OPL A;  2TPR A;  1OJ9 A;  2X99 A;  2AAQ A;  3GSI A;  4XWR A;  3UKA A;  4X4J A;  4GAV A;  1VQW A;  3G5Q A;  1GT8 A;  1PBF A;  3LAD A;  4H2N A;  1OJA A;  3AYJ A;  1OJD A;  3AB1 A;  2XFN A;  3UKP A;  2JB2 A;  2H88 A;  3NTD A;  3NK2 X;  3AED A;  4OPD A;  1L9E A;  2GQF A;  4J56 A;  4U2S A;  4D03 A;  3SQP A;  2JK6 A;  3M13 A;  1GSN A;  5JCK A;  2C66 A;  4O5U A;  3EF6 A;  3T2K A;  4A7A A;  3GYX A;  2OAL A;  5KWF A;  1KNR A;  1CJ2 A;  2XFP A;  2AQJ A;  4J31 A;  4YSY A;  3NHO X;  4TLZ A;  3SZW A;  4UDP A;  4K8D A;  1ONF A;  3AE3 A;  4H4P A;  3OZ2 A;  2B9X A;  4U8O A;  1S2Y A;  4USR A;  3UP5 A;  5BVA A;  2APG A;  3UOX A;  3GMB A;  3KA7 A;  3CGB A;  3T2Z A;  2QA2 A;  2R0P A;  5TR3 A;  5L46 A;  1YY5 A;  2VRL A;  3F8R A;  2GH5 A;  4B66 A;  4E0V A;  2ZZC A;  5BUK A;  4RG3 A;  1NHP A;  3SGL A;  1S3B A;  5KOW A;  1LPF A;  3GRS A;  1VDC A;  2BRA A;  2XLR A;  3AE2 A;  5FS9 A;  2WEU A;  1BGN A;  3AEB A;  4JQ9 A;  3CGE A;  1JOA A;  3AEA A;  4TM3 A;  2F5Z A;  3F8P A;  5KMS A;  1PBB A;  5KVH A;  4YT0 A;  4O5Q A;  3DGZ A;  2YG7 A;  4A6N B;  4C77 A;  4K2X A;  2YG4 A;  3DK9 A;  2V60 A;  3LZX A;  1F8R A;  1LQU A;  2CFY A;  1YQ3 A;  4WCT A;  1TDN A;  1NG4 A;  5FMH A;  1UKV G;  2XVJ A;  3RHA A;  5FS8 A;  2FBW A;  1JRY A;  2Z5X A;  1TDO A;  3NIX A;  4EQS A;  3SY4 A;  3DME A;  2GR3 A;  3DK8 A;  5U63 A;  3DJJ A;  3T31 A;  3AE5 A;  5IQ4 A;  5JRB A;  1K0I A;  5KMR A;  4I58 A;  1FEC A;  2ZZ0 A;  1IUW A;  2B7R A;  2GB0 A;  1DJN A;  3PS9 A;  5C2T A;  1ZX9 A;  5LV9 A;  3EAN A;  1D5T A;  1KDG A;  3UKL A;  2GAG B;  1NEN A;  4B63 A;  3CTY A;  2GR2 A;  3CN8 A;  4NTC A;  3T14 A;  4AT0 A;  1TDF A;  3GWF A;  2IVD A;  4LA1 A;  1GRG A;  4JDR A;  3RNM A;  1DOE A;  3CNS A;  1KNP A;  2CVJ A;  2YG3 A;  4AP3 A;  1GET A;  1H6V A;  4C3Y A;  1JRX A;  1JU2 A;  3CPI G;  3GWD A;  3AD9 B;  4CY8 A;  3T0K A;  2WOI A;  2YLW A;  2H89 A;  4J2W A;  3NYE A;  1Y56 A;  1NHR A;  3DH9 A;  2CUL A;  2R4J A;  2XLT A;  3L8K A;  3ALM A;  3CIR A;  3HYV A;  3K30 A;  1XPQ A;  3AWI A;  2B9Y A;  1JNZ A;  4G6H A;  1CF3 A;  3FPZ A;  4A79 A;  3D1C A;  5EBK A;  1GRE A;  2BXS A;  3C4A A;  2XVH A;  4U2T A;  1ZOY A;  3FG2 P;  1IUU A;  5JCL A;  2Y6R A;  1H81 A;  4U8K A;  1M64 A;  3WE0 A;  4Z2T A;  2ZZB A;  3IHG A;  3AEG A;  3RP8 A;  1MO9 A;  1L0V A;  4OPC A;  2GQW A;  2IVE A;  3ALL A;  1RYI A;  3NKS A;  1LVL A;  1S7M A;  4U8N A;  1PXA A;  3IC9 A;  3QJ4 A;  2XCG A;  3FBS A;  4USQ A;  3UTF A;  3EPT A;  2JB3 A;  1CL0 A;  4IVM B;  4HA6 A;  2OAM A;  4OPI A;  5EB5 A;  2C72 A;  5J60 A;  3KVE A;  2OLO A;  4PAA A;  2WBA A;  2A8X A;  3KPK A;  4FK1 A;  1HYU A;  3SZC A;  4BK3 A;  2BXR A;  3QFB A;  1COY A;  4GAP A;  4A6N A;  4B68 A;  3UKF A;  1DOC A;  2GF3 A;  3B6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...