4HCDA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
384
structure length
384
Chain Sequence
b'SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
molecule tags Isomerase
source organism Agrobacterium tumefaciens
publication title Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
rcsb
total genus 126
structure length 384
sequence length 384
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hcdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hcdA01
4FI4A 3TWAA 4Z1YA 2P8BA 2PP0A 1XPYA 4HCLA 1MUCA 3FCPA 3Q45A 3QN3A 3DG6A 3EKGA 3RO6A 3RITA 4K8GA 3T4WA 1R6WA 3ZLGA 3GD6A 2AL2B 3S5SA 1RVKA 4HCHA 3H8AA 3SN4A 3DFYA 1FHUA 1OEPA 2PMQA 3FJ4A 3JW7A 1XS2A 4HYRA 2RDXA 1ELSA 2OZ8A 2GDQA 3R0UA 3TTEA 2HZGA 2PTXA 1MRAA 3MY9A 3B97A 4J3ZA 3P3BA 1DTNA 2O56A 2PGEA 3RGTA 4KT2A 4ROPA 4GYPC 3T8QA 3VC6A 2PP3A 3STPA 3MKCA 3FV9A 3PFRA 7ENLA 5FJUA 3V4BA 3R25A 3NXLA 4IZGA 3N4FA 3NO1A 4IP4A 3DEQA 3V5CA 1TZZA 3CK5A 1P48A 3ZLFA 1EBGA 2GGIA 2PS2A 2OZ3A 4KPLA 1WUFA 3THUA 5FJRA 2QJNA 3BSMA 2I5QA 4MGGA 4HCDA 2OLAA 3PWIA 3TQPA 3ZVIA 4GGBA 3I6EA 3Q4DA 3UGVA 4GFIA 3H70A 2PP1A 3UJSA 2P3ZA 2XH2A 3QPEA 4JN8A 3ES8A 3OZMA 3R0KA 3KUMA 2PTZA 4A3RA 4DYEA 3DERA 2ZC8A 3P93A 4E4UA 3R10A 4E6MA 3CYJA 2P88A 2PU0A 1ONEA 1MNSA 2XSXA 3PK7A 2OQYA 3V3WA 3OZYA 4YWSA 2OFJA 2GGJA 4GYPA 3MUCA 3SJNA 3EEZA 4Z17A 3P0WA 3TJ4A 2PPGA 4GISA 1JPMA 4K1WA 1IYXA 3UJRA 1KD0A 2QQ6A 3OTRA 1P43A 2POZA 4J1OA 2GSHA 3CAWA 4E8GA 2OG9A 4IHCA 2GL5A 2PU1A 3DG3A 3IJIA 3IJLA 6ENLA 5BOEA 4F4RA 4HNCA 3MQTA 1EC7A 2XH0A 3UCCA 1YEYA 1KKRA 4GIRA 4DHGA 2ONEA 3VA8A 3ZLHA 3I6TA 2PSNA 4IP5A 4IT1A 5FJOA 3R1ZA 3R11A 3OW1A 3PWGA 2XH7A 2OO6A 2PA6A 2FYMA 2MUCA 3SBFA 3SQSA 3VDGA 3H12A 1PDYA 1WUEA 4IL2A 4DN1A 3QKEA 4HNLA 3ENLA 3UJ2A 3SN0A 2XGZA 1EC8A 4MKSA 3MWCA 4JHMA 2PGWA 2OPJA 3UCDA 3GO2A 2QGYA 3UJEA 3ES7A 1TKKA 3DG7A 1BQGA 3OPSA 3TCSA 3D47A 4JN7A 4M6UA 3OP2A 1EC9A 3RCYA 4GMEA 3T9PA 3FXGA 1E9IA 4H19A 2PTYA 1JDFA 3MZNA 4H2HA 2OQHA 4H1ZA 4ZCWA 2QDDA 3RRAA 5BOFA 4X2PA 1MDLA 4E5TA 2PTWA 2DW6A 4K2SA 3CXOA 4HN8A 3ZVHB 3QLDA 3H7VA 3D46A 3V5FA 1F9CA 3U9IA 2P8CA 3VC5A 1SJBA 3SSZA 4E4FA 5ENLA 2PCEA 1EBHA 2QJMA 3DFHA 4DX3A 4M0XA 2NQLA 3DDMA 4KWSA 1ECQA 2GGHA 4A35A 4H83A 2OX4A 3BOXA 4GGHA 3TW9A 1SJAA 1NU5A 3TWBA 3N6JA 2GGGA 4FP1A 4DXKA 2OZTA 3BJSA 4KEMA 1FHVA 1NELA 3UXKA 2OVLA 1SJCA 3S47A 1SJDA 3GY1A 2QJJA 2DW7A 3K1GA 4ZA0A 2AL2A 2FKPA 2AKZA 3SN1A 1BKHA 2ZADA 3NFUA 3VCCA 3IK4A 2P0IA 5IDZA 3FYYA 4HPNA 3T6CA 2OKTA 4DWDA 1W6TA 4EWJA 3UJFA 3VCNA 3CB3A 5EU9A 4G7FA 1L8PA 3NZGA 3TJIA 5FJTA 4G8TA 3DGBA 3TOYA 2HXTA 1JPDX 3DIPA 2GGEA 1KCZA 2MNRA 3RR1A 4ENLA 4IL0A 3JZUA 3ZVHA 4A6GA 3U4FA 2CHRA 3IJQA 3HPFA 2AL1A 3UXLA 2HXUA 1MDRA 2QDEA 2AKMA 3N6HA 3FVDA 3QTPA 3I4KA 3CT2A 4MMWA 2XH4A 1R0MA 2HNEA 1KKOA 1JCTA 3MSYA 3N4EA 5J04A 3DESA 1TE6A 2PODA 3GC2A 3VFCA 5FJPA 2QVHA 3JVAA 1PDZA
chains in the Genus database with same CATH superfamily
3T81A 2XZ7A 3KHDA 5HJLA 3VMOA 2QUTA 1E6XM 3WNPA 2X1RA 2VD9A 2ZRXA 3CUHA 3EKGA 1EX5A 4GKLA 3QMSA 2VWTA 5F4XA 1NHQA 1E55A 1GVFA 4GBDA 2WPGA 1R8LA 2CHNA 1FHUA 5FS9A 3KRUA 3U5YA 3PBMA 2BS9A 1MO9A 3UYIA 1NWRA 3M9YA 4C91A 2FHFA 4LF1A 3STGA 2DFAA 2RHGA 4IQJA 2VFFA 5FF3A 2BC0A 1DTNA 4M6VA 5I03A 4AZCA 1BYCA 3ID7A 3OGRA 4BI5A 4K7ZA 4CU6A 2Z00A 4KPRA 5DLCA 3VOCA 1DXFA 3ARPA 4KFPA 2OWCA 3R8RA 4GZJA 3LLDA 1VLIA 3L5LA 5DF0A 3LRMA 3PBWA 4TVCA 5GNZA 4TMCA 7ENLA 1G6CA 3T42A 1EA9C 1Y8BA 4HU8A 3H4KA 1TZZA 1F6KA 3I7SA 3IIPA 5EBUA 4XO7A 5DXYA 2Z1XA 5EA9A 1UYQA 2BP1A 4GYJA 2Z2AA 3F5LA 2WPBA 1LBFA 3BMXA 1NWTA 1BAGA 2OQLA 4B5SA 2Z2UA 3WEOA 3H2NA 5G2HA 3TTSA 2R1NA 3OA5A 3S46A 5EKYA 3TTOA 2YSWA 1LWHA 4HNVA 2PP1A 2VDGA 3TYBA 3ZQ9A 3AJXA 3VM5A 2FZBA 3L2LA 4ZFMA 4FB7A 3FSUA 4GI6A 5DRCA 1OBAA 1XYMA 4GACA 1TIWA 3LBCA 1HL8A 5D37A 1GGOA 4I8DA 4J3XA 4E38A 5G1TA 1FDZA 4ADTA 1J93A 4FNPA 4YYCA 3HQ1A 4RNHA 3MBDA 1TV3A 5I2UA 3K8LA 1EZ2A 1XANA 3ATYA 2NPXA 4APNA 1A5OC 4CN4A 4CQBA 3E38A 3AALA 1S38A 2EPNA 1Q6RA 1WXJA 1FXPA 2PB1A 4F0LA 1KBKA 4DXVA 5EBKA 2GQWA 2CWXA 4MWAA 3MWAA 3ZYZA 1UG6A 2QEZA 3EZ4A 4Q8MA 1OSEA 3A22A 3QGAC 4F0KA 4H9VA 2A7PA 5PTDA 2GL5A 3KBMA 2V5BA 2ZOXA 5I78A 4OBSA 3M0JA 4MWAD 4ZSTA 1EC7A 2ZXAA 3LI1A 4A2RA 3VNJA 2V30A 2VZTA 1XLCA 2VT0A 3Q67A 3W1XA 3I7QA 1QO5A 4G9PA 1V08A 3F4DA 5G5HB 3ZT6A 1KC7A 1Q63A 2IQDA 4P8VA 1FY6A 4BZYA 1M65A 1SZRA 1L6FA 4ZZ9A 2OWWA 4ML4A 4F2UA 1K7EA 3TFCA 1DWIM 3BCFA 3PZ9A 4IIFA 1W5PA 3L0GA 1UWTA 3VINA 4OOZA 1FA2A 4JFWA 3UD6A 2XGZA 2QCDB 4LAOA 4QXIA 1FOBA 3TU9A 3GU2A 3SADA 1EWDA 1TRIA 3I4EA 3UJEA 4IX0A 2VCAA 3UP8A 1XFBA 4IF2A 1ONXA 1KN0A 2XN2A 2PWGA 4RPPA 4B9ZA 4DBUA 4TVYA 1CGUA 4ZQMA 1RV8A 2RKXA 3W37A 3CGDA 4QQ3A 4ICMA 5H2ZA 3PJWA 2FFIA 2VC6A 1JROA 2RDWA 3WLSA 4WSKA 4Q8UA 3EDEA 3CEPA 4FF5A 4CCCA 8RUCA 4O10A 3EWCA 3NR0A 3G77A 1E1CA 5LYRA 4AZ5A 3RX2A 4FMVA 3A6OA 2V3GA 3UU0A 2HPIA 4TVDA 4JXCA 3N2TA 3M6DA 4LUSA 3BAYA 1ZHAA 4BQ4A 2V9DA 3W81A 4LBUA 2X50A 2Y63A 3IS4A 2GWGA 1SZNA 3IGUA 2C3DA 5MF5A 1LL6A 2P53A 1X2GA 4GRSA 4PN2A 2CFFA 3T40A 1H5VA 1D9EA 5DY2A 1IT7A 2H8ZA 2AKZA 1W3JA 5AYYA 1EJUC 2DH3A 5F1UA 1EO5A 3IEBA 3VKKA 5G1YA 5MHBA 4DM2A 4B92A 3CJPA 3PHAA 1W6TA 4F40A 1STZA 4B3KA 4XUGA 1A5SA 2VQTA 3QQ1A 4MDOA 3KXQA 1SFTA 3BAKA 3KLKA 3E12A 5AVNA 3SSJA 3CEUA 2J74A 4NQ1A 4I5XA 1JFXA 3TV8A 1VQZA 3WLRA 2PDIA 2XUCA 3UY7A 3PS7A 4M82A 2VX5A 4RZ4A 1SQ7A 2A8XA 3DENA 1YTDA 3QLLA 2WOVA 1NARA 3Q2DA 3TYEA 4NJKA 2AL1A 2HXUA 1MDRA 2Y7GA 3PBUA 1N60C 3EX1A 1GYMA 4BWLA 2DT2A 1GRBA 2DJXA 4J2MA 4M7SA 1U83A 3EB2A 5EFDA 4J40A 1IR1A 3PM6A 2W3ZA 4CCZA 1XJBA 1E72M 3MSYA 1B3XA 4PB3A 3PZQA 4K8DA 4UMAA 3VKDA 4XAFA 1A0CA 1JDCA 2PWEA 4RNFA 3W28A 3FNDA 4C1NB 2OLSA 1ISWA 1A5KC 5CSSA 3TFXA 5HUPA 4AYGA 2YBTA 2PP0A 1IT8A 1V3LA 3GHUA 1MUCA 2Q8LA 4Z08A 4EM4A 4QCEA 1Z48A 2WBKA 2F9RA 3DGHA 1W1A1 1R6WA 5BRQA 3WLNA 1A3WA 3KRZA 1D3GA 5L9FA 4FXJA 1S5VA 3EAUA 4LEFA 1E0UA 3W2NA 2J7EA 2GOKA 3MU7A 1UP2A 3QHMA 1IF2A 1KBLA 2GK1A 1HKIA 3W29A 2HZGA 1C8YA 5IM51 2DVXA 5I23A 4J3UA 3AMCA 1NTHA 1QATA 2XINA 2O56A 4NNCA 3B9DA 1H60A 5D2XA 2Z26A 3HTWA 3I3BA 3O6YX 4Y8EA 3B9JB 1OQFA 3VNIA 1N55A 4PMQA 4UFIA 3B8IA 4BQ5A 3BXWA 3O1NA 4UWMA 3OQEA 2FZNA 2FH6A 4ML9A 3A64A 5CKSA 4H4TA 3NQMA 1GRAA 3V4BA 1ZFJA 3R25A 1KV5A 2OJPA 2WVUA 4DLFA 1H1NA 1NFGA 2VD8A 2X16A 1VBHA 3LXDA 4PB5A 3CK5A 3W1AA 2X1SA 1V79A 3E49A 1MVYA 3RM9A 1GQLA 1QI5A 1XSKA 5HNNA 1W5QA 1O12A 4A8IA 1FUYA 3OVRA 4DNHA 2REQA 3W22A 5D04C 3UGVA 3C4UA 4MJ4A 5I24A 3H24A 5CGMA 1S2TA 2Z1WA 4WEVX 3C0QA 4ROQA 5CPQA 4XAZA 3L68A 3N9SA 4QAWA 1FWBC 4RXFA 1W56A 4JR5A 4ZENA 2DY3A 1CCWB 2PDGA 5JXQA 3M0KA 1VCVA 3O07A 2WM0A 3USBA 2QMJA 4E6MA 3U7BA 1MNSA 2WJDA 1UR0A 2WO5A 5ABHA 2I9EA 1OGBA 3F4NA 3NUKA 3NQCA 1E6ZA 1I1XA 3EEZA 3RX3A 4ICNA 3TH6A 3U2ZA 3TSDA 2PPGA 2W6RA 4NRSA 2Y89A 3KDOA 3TZFA 2HQAA 2PZ0A 2BV9A 1ITCA 1P7TA 1AD4A 1ISYA 1EEXA 2ZRYA 3QV8A 3C8NA 2OCZA 1ZNNA 3KL0A 4AZBA 4IPIA 1FWTA 1V02E 4HU4A 4OT7A 5A6BA 3GRSA 1VEMA 1XRFA 5GNXA 2VQUA 2GVLA 1FWIC 3ITLA 2CBIA 2R14A 5FD0A 3UYCA 1X8CA 1OIFA 4CU8A 3MJYA 4IP7A 3RK8A 2Y7DA 5A6MA 1NAL1 5AYXA 2OSXA 2W62A 3SCOA 1NQ6A 3LTYA 4Z1DA 1L6WA 4LPCA 1PDYA 4EK7A 4GVGA 2HE8A 2WC4A 1SFJA 3WELA 4IMDA 2A0NA 4Q8TA 4FX7A 3LCLA 5CC5A 1KGWA 4NXKA 3TAOA 4D6DA 3FAXA 4DJED 1XH2A 3ES7A 3PZTA 5A3HA 3K1DA 1C7SA 4RPQA 1OYCA 1J8VA 4UTMA 3GNXA 2ZX9A 1F6YA 2YYTA 1KFKA 2Y88A 1R3RA 4IWWA 4E2DA 4AWSA 4U31A 3STEA 3I10A 2IMRA 4O54A 1JZ4A 4QITA 4TOQA 4UTJA 4R34A 5DO8A 1FWGC 1QUMA 1UR2A 1TWZA 4HN8A 4AEEA 4QJ4B 2DP3A 3KS5A 2PEVA 3KP1A 3K5XA 2J88A 1F9CA 5FS6A 3VGFA 1A5NC 1SJBA 4QROA 3TIMA 5H1WA 1UWIA 1VYSX 5AB3A 1TG7A 1X6UA 4LS2A 1XD0A 3QR3A 2VGIA 1XIHA 1V0KA 2V3FA 2WVVB 3DXIA 1JD7A 4KGLA 3LYEA 3AUOA 5LXEA 3DYOA 2C0AA 5IDIA 2G3FA 1RHCA 2XM2A 3FOKA 3NXFA 4HT3A 4YVXA 3N2OA 4R33A 3A7RA 1CGWA 2VDHA 1MWOA 1DE6A 1UR4A 1YXYA 3VKCA 3WENA 1C90A 1X1OA 2X7WA 1YBQA 3FJNA 4QDMA 5AHLA 4O1FA 5CC3A 3VCCA 3QBUA 5A8MA 3RR4A 4Q8QA 1LP6A 1BVNP 4ZOAA 4KWVA 5RUBA 1JAKA 3ONBA 4JFUA 4PTWA 3IV3A 1PCWA 3GIPA 4O28A 3W2LA 5F1VA 4KETA 1OFDA 4EACA 4PC8A 4PUEA 3LNMA 3SI9A 3RPTA 2YL5A 2BOGX 1RH9A 3W88A 1W1PA 1V93A 4DUXA 1CLXA 2QJIA 2J6XA 4IL0A 1E1CB 1TPEA 1KRCC 4XX6A 4ICCX 3B8VA 1JPIA 1W9UA 4HA1A 3KZSA 3A4WA 1PB0A 3HPFA 3PUGA 4ASTA 4ZTXA 1XIGA 3HFYA 1D2KA 4MF4A 3P8JA 4DJDA 1E43A 1Z89A 4RR4A 3N11A 3LCXA 3CT2A 1Y65A 2DT0A 3EPOA 4GZIA 3LPFA 2X0YA 3LUTA 1ZGDA 4RE0A 4ORMA 4JX4A 3SUWA 3CMGA 1HP4A 2PODA 3TN5A 5ECUA 2FZ9A 3LK6A 3TTQA 3OG3A 3AWOA 1FH7A 1ZS2A 1AW5A 3WKZA 3DHFA 3OBKA 1IE7C 3IVTA 3RJXA 4IIHA 1KXVA 3T4WA 3F7JA 2QDHA 3GC5A 3S5SA 4C6PA 4GZEA 3S9ZA 1RZMA 1TPFA 4A4AA 3VMPA 2RGMA 3LMZA 3RMEA 1OCQA 1XS2A 4HYRA 3QR1A 2BY1A 4Q4KA 2PTXA 3PG8A 1TB3A 4J3ZA 1FXQA 4FZIA 5J5DA 1PIGA 2QUUA 2EQ7A 4ERAA 4ADUA 4W9TA 2J8GA 1TTPA 7ODCA 1BF6A 1ZP3A 4KT2A 3A3HA 2CIPA 1IZCA 3H21A 4MSSA 3H2EA 4PR4A 4DQWA 3WH7A 4HIBA 4QNEA 3ARZA 3T05A 5F4SA 1RA0A 3SJ3A 3DN5A 1XGDA 1M68A 3BC9A 4WDXA 3DK9A 5GVJA 4BF9A 1AVAA 1SSGA 2CNCA 5M5DA 4IZGA 3LN3A 3S9IA 1CPUA 4DF1A 1EJTC 2NLIA 3IK2A 4XQ6A 3K8MA 1JF6A 3V5CA 1ADOA 2TSYA 3T0CA 4FXSA 4DBEA 1GW1A 1SSDA 3EXRA 1OJXA 1H6VA 3BANA 1YW1A 1DJHA 3TMQA 2PDYA 4W89A 4XKYB 4D8LA 4MY8A 1P6BA 3SFWA 2AGTA 4HHLA 4LEQA 5CGQA 2BSLA 4Y96A 3MO7A 2HVNA 1JYNA 4NJJA 1D7KA 4OU1A 2PRMA 1XBYA 2BGSA 5BMXA 4UUIA 2WSKA 4US5D 3MHGA 1NDVA 1W17A 3WQPA 1JDEA 4TTGA 2ZX5A 3NRZB 4K3ZA 1VBUA 1W31A 4H4IA 4QJ3B 3NL3A 1SM9A 1QBAA 1V6UA 1UIOA 4XAGA 4N2YA 4X63A 1CW2A 3PJTA 5C7HA 3P0XA 1GKRA 4PUWA 3T4CA 5AYIA 1RPXA 1HIZA 2X8CA 3RILA 3W7PA 1XYFA 1CTNA 4X9SA 1DJQA 4IG2B 4LB3A 3HJEA 1Z44A 4JDRA 3MV01 3PZGA 5BW6A 3B8DA 3VNDA 4LY8A 3L0NA 4UOQA 3AHVA 3FXYA 3S2JA 5CPOA 1B0IA 1DHPA 3GR4A 3P60A 2GR3A 1M53A 2IPJA 4PL2A 3CAWA 2P3EA 2I14A 1YLVA 5DCDA 5F4WA 1S46A 4Q4RA 2OX1A 1T3QC 1YPFA 1VPXA 3BQ6A 1XFCA 3A7AA 5D9PA 3OHMB 3CLMA 1KKRA 1LRNA 3KBNA 4DELA 4HQVA 1CB2A 3GD4A 4YL2A 3H4GA 3OW1A 3WLIA 2WC7A 1IIGA 3ARXA 1TV8A 2XIJA 4ACYA 1HXJA 2EPMX 1OFAA 4F48A 3ORWA 1AJ0A 4QISA 1V7YA 2GVGA 3LSBA 4DN1A 2GVEA 4GH1A 3QKEA 4IPJA 1E1FA 1O4UA 2VJXA 3BV7A 1IEXA 5AHIA 2Z24A 4P7LA 1J18A 1K4HA 2INEA 4J5NA 1A47A 4J27A 3WJXA 3M5VA 2ISFA 1P1MA 3GG7A 2OZ0A 3LA4A 3IARA 2NT0A 3KFTA 3AMZA 2BTMA 4YVVA 3C3UA 1XRTA 3FEQA 1YE6A 3OLGA 5I00A 1LWJA 3BAIA 3SQMA 2WWDA 3T9PA 4JICA 1FCVA 4LUTB 2RJGA 1U5JA 3A9IA 3WK3A 4C90A 4S2BA 4LA1A 3CL7A 3WDIA 1XLHA 4RLIA 4ZB2A 2H9AA 3REQA 4GX8A 1WXYA 2R1MA 3VNLA 3GIYA 3SSZA 1RQBA 1V0LA 5ENLA 1BYAA 4ONVA 3GW0A 5H8MA 4KWSA 4R88A 5CSYA 2GH5A 3CPRA 4DAIA 1NFBA 3OC4A 1UWQA 3GTXA 4H83A 2DEPA 3LPPA 2F5ZA 4AVNA 1TYPA 3CHVA 1MW3A 2WHLA 3N2BA 4JTRA 1VFLA 2ZZCA 3A12A 4W87A 5KZEA 2Z0IA 3WFZA 1PV8A 3K13A 1ISXA 3H23A 2DPEA 1SJDA 1E0TA 3SEPA 4DYKA 4KCUA 1C7TA 1ME7A 1BKHA 3KOZA 1EDTA 4LB4A 2QF7A 4U3AA 2DUXA 4L1WA 1HZYA 4J3VA 1FTXA 3VD5A 4HPGA 3UJFA 3GUWA 3N9RA 5BXPA 2PF0A 4DJEA 4TV5A 3AMKA 3LD5A 2BB0A 1Q6GA 3R58A 2VTFA 1A4LA 2E5DA 1WX0A 1KM5A 3DGRA 3MI2A 5BCAA 2ZE3A 1Y5XA 2A6NA 1ALDA 1BQCA 3ARVA 3RR1A 4PCNA 1LF1A 5JBEA 1QWGA 2A3EA 2VC5A 1F6PA 3F03K 5CC6A 3GG8A 3DYMA 4QRNA 1K77A 3G3MA 2A3AA 3LPOA 1TX0A 1HX0A 3NEHA 2VYOA 3NM3A 5I0DA 3VVGA 2OWXA 1J12A 1XRVA 1WZAA 3BURA 2E3ZA 1DVJA 3V75A 1K8XA 4X2RA 4TMBA 2E1DA 2HEJA 4W85A 2YVFA 1JUBA 2J24A 3RF9A 2DQWA 3WDRA 4I9TA 3A13A 4D6GA 4Q8PA 3ITTA 2DZWA 4L4MA 3JVAA 1KXTA 2DUZA 3EWWA 3CZKA 5D2WA 3PWAA 3F4CA 4CNSA 1VFTA 4HSOA 5JMUA 3OHIA 2YYUA 3RO6A 4CD6A 3G8RA 5HOSA 1DYSA 4HCHA 1C8XA 4H4SA 1Z9AA 3VD9A 3WF0A 2WANA 3GNRA 1TV7A 3CAKA 3PFMA 4HA3A 2YDAA 2PUZA 3JW7A 4AX6A 4C6FA 2CFYA 5IBXC 4AWUA 2X1UA 3A3WA 2GYIA 4CVWA 2D2JA 1OFBA 1ZQ5A 2BNJA 3VABA 3B97A 4CQ8A 2BASA 3GTNA 3MCOA 1H3GA 4DJDD 2FB3A 2TYSA 3GBEA 1NM9A 1R2SA 1VCFA 1BG9A 1JNEA 2PP3A 4UC5A 3UEQA 3VOFA 1ADSA 3AJ7A 1IHIA 3P14A 4FXFA 3S2MA 4O12A 2ZXQA 3W7LA 4MIMA 3NO1A 3T8LA 4US5A 3D9XA 1OY0A 3W27A 1P0DA 2CETA 2OGYA 4CNTA 1EBGA 2EG6A 5CPTA 1S2UA 4KKXA 5DXXA 1IEVA 1MW2A 2DZVA 3GYCA 4EE9A 3H53A 5CZTA 5IFTA 3DX5A 3WO8A 4MGGA 4HCDA 3GNOA 4GGBA 3TP4A 3SFKA 4WR3A 4YN5A 3G1YA 3QV6A 1HKMA 3LEPA 4G7EB 1G4SA 3N3TA 2ZZ7A 1WBHA 2OELA 1Q6FA 1FDJA 1UWUA 4LUYA 2A6LA 4PTMA 1U5VA 4X0VA 4LGXA 1Z69A 2WJZA 3UETA 2QPXA 2CBVA 1MEIA 2PU0A 4D71A 2YBVA 3PK7A 1MUMA 2FJUB 2BHYA 2GDVA 4JTHA 2V3AA 4ACZA 4S3BA 3SJNA 1LLOA 2O0TA 2C8NA 2V38A 1QI2A 2WHKA 1GVRA 3CUGA 3FA4A 4K1WA 4XKMA 2V63A 5FAJA 4PRTA 3WQVA 1VJSA 5HANA 2QPSA 1K9TA 3NEVA 1GWJA 4NP7A 2GSHA 4WCJA 1S5WA 1WDWA 4FSAA 3CWHA 4IHCA 2POTA 4YTRA 2EPKX 3W7IA 3EDFA 5F2IA 3PZIA 4JCMA 6ENLA 3AU6A 2QW5A 3IUDA 4AZ6A 5T9BG 1H49A 1K8YA 1XLFA 2DSUA 1ZJIA 2WZTA 4UFHA 5FJOA 4YMZA 1IXNA 3HU7A 2W66A 2YA0A 3KOXA 3VDGA 3NDOA 2PGRA 4C6OA 1W91A 3G6LA 2F84A 3FLUA 5JVLA 3BPWA 5JCLA 3N15A 1E1EA 1W3LA 4D2JA 2R24A 3D5HA 2GVYA 2ZZBA 4PH6A 1Q6DA 4S3CA 2Y1HA 4I5UA 4QE5A 4JQ3A 3DI1A 3P7YA 3U6WA 1J0ZA 1Q6EA 2Y4SA 4M1BA 3ZT5A 3CUZA 3EYPA 3QGVA 1I1WA 1EF3A 4O16A 3G5EA 3ISIX 5D4YA 1A0DA 2NXIA 2PBGA 4DY1A 1S2VA 2QDDA 1VYRA 4Z2JA 3GDKA 1UB3A 3CH9A 4PE8A 3CV1A 1Q6CA 3HGJA 4OIFA 1OM0A 4QEHA 4J28A 1WPCA 3H7VA 4NIRA 2Q09A 4MFEA 1BVWA 2DORA 1X38A 4MY9A 3NTYA 1Y5VA 4L5ZA 1K8ZA 3ITGA 4MDPA 5HDRA 2YPIA 2FGZA 4CNOA 1JI2A 3TSMA 4PCSA 4DF0A 1WBJA 4A35A 2EKCA 2GQ9A 5HWJA 1CZ1A 1X6LA 4A8NA 3REQB 1ME9A 5CPLA 3IIVA 1M7JA 4A8LA 4NZCA 4AD3A 4X22A 2PDFA 3VIMA 5LA1A 4TX9A 1SJCA 3OO2A 1A49A 1D3CA 5ABGA 1VFFA 1FHDA 4XZMX 1JQXA 1JZ5A 1DQWA 1EX1A 1TCDA 4WJXA 1TE1A 1LPFA 2NSXA 3DHPA 1U22A 1UZHA 3VCNA 3W7QA 3S6DA 4CKQA 3BICA 1PUDA 4A05A 4QSHA 3DFSA 5K4ZA 4XK2A 3TOYA 3F2CA 3KLJA 2Z1BA 4KFNA 1MZRA 5XINA 3AM9A 1JNDA 2QHAA 4HK6A 2GGEA 4JIHA 3ATZA 3E3HA 4EPKA 2V3DA 4JHZA 3APYA 1TJPA 2GSEA 1GRFA 1TMLA 4NI8A 4BJHA 3WL0A 4P7OA 1F3EA 4H4UA 4MFDA 1YKWA 4NZJA 1Z41A 3PPHA 1UJPA 4R5EA 3WFAA 3FFSA 5M03A 3O16A 5AECA 4XZLX 1S5TA 1XCWA 3WQEA 1W1IE 1C9WA 5JU6A 4OQVA 3OEXA 2PDJA 2Y5SA 3ITOA 1XLMA 3B05A 5FJPA 4LU0A 4YU1A 4I7WA 2VX7A 2VELA 1V5XA 3AXHA 3TWAA 2HROA 4NEVA 3N73A 3W84A 1CB7B 4Q6XA 3LX9A 2X1TA 1ZLPA 3N13A 3UG8A 4H41A 3AMDA 2VCBA 4IIGA 4E2BA 4DIAA 3H8AA 1Q6QA 3W7NA 1HVXA 4B16A 3RM4A 4F8XA 3W73A 1A5BA 2YL8A 8XIAA 1WB0A 4BK9A 2WSQA 4LAZA 1V3HA 4AWEA 5EMJA 1L8NA 3D3AA 4DUWA 3LHUA 4FNQA 1WDPA 3MUIA 4CEXC 2ZWYA 3HG5A 4GUGA 4L4PA 3RLUA 1LJYA 4H9YA 3PTQA 3G1SA 1XDIA 3UWQA 3GDLA 5E09A 3TC7A 4EVZA 4AF0A 3ABSA 1US3A 3PFRA 1XLBA 3ITCA 1UQZA 4FNTA 4ZQPA 1ME8A 1XDLA 3MVTA 2FJKA 4OUEA 2ZE0A 3CL6A 5EMMA 3DKJA 1PE1A 3RXZA 4U3CA 2GUBA 1K70A 2RH9A 2XVPA 4M3PA 3WK2A 4ZMGA 3ZLFA 3MCMA 4D6FA 3B4UA 2J6VA 4CEUC 2ESCA 1UMLA 1NF0A 2OZ3A 4PMZA 3P84A 1BTCA 3S1XA 1FWRA 2ISSA 1J01A 5FF0A 2JIEA 1IZJA 3OGVA 1P6WA 1VFUA 1RJRA 4G6CA 1WKFA 3VOGA 4MB4A 3OZOA 2Y7FA 3AFBA 2X8RA 3RM8A 1ZB5A 1ZMCA 1QVBA 1BRLA 3WMLA 3QC0A 1BZLA 1CBGA 2ZC8A 4E4UA 4H4ZA 1NDZA 3TN6A 1W3TA 4LCRA 2GFTA 2BVTA 3HURA 2J8TA 3MUCA 3A21A 3HJZA 3TDFA 3LTSA 3I3EA 3MVIA 2RJHA 2YCEA 1ESWA 6TAAA 2EQ9A 3GYEA 1KD0A 2QQ6A 1F7BA 1FWDC 4C1LA 3AIWA 1BGGA 2X09A 4JL1A 1XLJA 2BHUA 1ZBCA 4XTDA 2ZX8A 4J1OA 3KVJA 2H8XA 2X2YA 3KM8A 3RMJA 2CKSA 2Y5JA 1LG2A 1VD6A 3YPIA 5B7ZA 2Q71A 3MPGA 4S3GA 5CSRA 3TA6A 3KRSA 1T8QA 3BG3A 4JTQA 2ZICA 5G5GB 3W53A 1KTNA 4TU1A 2CLLA 1BYBA 2CLIA 3O8AA 3GM8A 3KOYA 3UPBA 2HPMA 3H7UA 2PSNA 1S2CA 2VP8A 4IT1A 2E1WA 1C92A 3Q37A 1AFSA 4XV0A 3APTA 4O4VA 2QCGA 3HB9A 2WXDM 4C6IA 4O0QA 1AK5A 4GXMA 1UBPC 4D6IA 4HNLA 4DZHA 2FMNA 5JBDA 5AC8A 4CD8A 1XLGA 3E5PA 5HULA 3TYUA 1PHWA 2A3BA 5IRPA 3G1DA 3EWXA 2OPJA 4EQRA 1Q65A 4NASA 4M51A 4H2CA 1EQPA 4PSRA 4H9UA 1IWAA 5AC4A 3O2LA 1DP0A 4B3ZA 2R94A 1VEPA 4KBXA 3WLLA 1A53A 3NQDA 1GHSA 1I60A 1KFCA 5K2ZA 3T55A 2JBMA 4WZHA 3RCYA 1HQTA 1AQ0A 5XIMA 1KA9F 4NNBA 3GR8A 1JDFA 4FR1A 1OC7A 1S3HA 4JQ2A 2ZUSA 3EX6A 4ALDA 2WHJA 4ZQNA 3HPSA 5H91A 2GR0A 2R91A 3PZNA 3CXOA 3EKZA 2VOMA 5D2VA 1KFBA 3U8GA 3LB8A 2EF9A 2PCEA 1UD4A 2FFCA 2QJMA 2H6RA 3L4UA 4GD0A 3BLLA 1NPXA 4L80A 1H7PA 2YFNA 1GOMA 2WJFA 3E0FA 2XFRA 1M6JA 1FWCC 1EUAA 3NWRA 2PWDA 2A5HA 3PP7A 2W61A 3FS2A 2FDMA 4K1GA 4L6DA 3NNTA 1T96A 1XLKA 4ZR8A 4FP1A 4MJMA 1TUFA 2QUVA 1QASA 2OODA 2ABBA 2F2KA 2VFDA 2W27A 2DIKA 3CH0A 4L9YA 1BHGA 3VNZA 3NQEA 4L7ZA 4H8NA 3ABZA 1XL9A 1NOFA 2Y2WA 1Q66A 1KTBA 2CHOA 4UR7A 4D8ZA 3MJMA 4UTFA 4D72A 1L6GA 1EBDA 3UXAA 3L67A 1TPDA 2IQTA 2V68A 4Q7IA 2G37A 4QSFA 3GBDA 1PCKA 3MP3A 2D3NA 5C71A 3MMTA 1RUSA 4F9JA 1FKWA 1Q4WA 2V2DA 1AJZA 5MKGA 1W9XA 1KCZA 3S6TA 4BF5A 3W82A 4JNZA 3KBWA 3HQPA 4JTKA 4XVEA 3NSXA 4LS1A 4BEUA 2QDEA 3G1HA 3HFTA 4PTVA 4WY0A 4LVAA 1HGWA 3MMDA 2QAPA 3BW4A 3H22A 1QDSA 3O6DA 1VFSA 1UD5A 4PRWA 3WJYA 4KCVA 2WYSA 4LC8A 1UR1A 2VX6A 4TUFA 3QOKA 1VBGA 2HBVA 4CN1A 2ZUVA 3GC2A 3MO4A 3NVDA 1SW3A 2WVTA 4YJ5A 1KNWA 2WMKA 1QPRA 2XJ7A 3CQ0A 4U5IA 1QW8A 3TN4A 1W37A 2NXGA 1XPYA 4HSNA 4FX8A 4HCLA 4YCPA 1FCQA 3B0UX 2PLJA 1A0EA 2R9ZA 2REQB 2CXGA 3TXZA 3CV7A 3HRDC 4U33A 1RVKA 1ODZA 2XHYA 4DI8A 1GVEA 4IGSA 4QLJA 3T09A 2YX0A 1WNOA 1X1NA 1IWPA 3NSNA 3NDZA 4WGXA 1FWFC 1DQXA 2Q3RA 3CU2A 1XYBA 1UH2A 3FA3A 4DVOA 3AIVA 1U30A 3KZPA 3UXDA 4AEFA 3R0UA 3B40A 1K6WA 2NQHA 4QDWA 1KRMA 2CZFA 3MYPA 3TNBA 4IGHA 3W7MA 3TK7A 5JBFA 1G4EA 1GQIA 4DWSA 9RUBA 4MADA 2XZ9A 5KEZA 2ZBTA 2ZTJA 1BXCA 1GOKA 3T1GA 4CNNA 1X39A 1YYAA 4LYPA 3GXIA 4OECA 2WQPA 4DBWA 4W4QA 3IWPA 1GCYA 1U2YA 2Z7KA 3NXLA 7REQB 1BVZA 1KM3A 4RXGA 3EMQA 3DEQA 3GK0A 2E77A 4FX9A 4C1KA 4PMRA 5CZSA 3FA5A 5CXPA 4KPLA 3EMCA 3UESA 2P5NA 1NH6A 2XFFA 1LTDA 3UERA 1GOOA 1PBGA 2PWUA 3DFOA 2PWHA 1DJNA 2D1ZA 3R94A 1TWWA 2XIBA 3TLQA 4A8RA 4UQAA 3LDVA 1YDOA 1ZALA 1QPNA 1E51A 1XLEA 4UNKA 4UTIA 4H7VA 4JFVA 2V82A 2VFGA 2FIQA 3PAOA 3U57A 3UVIA 4C60A 3LGEA 1UUQA 4HTYA 1PZ2A 2CYGA 5REQA 1YPIA 1BRLB 3ABOA 3UR7A 5M17A 4Z17A 3R7MA 1EJRC 4C6EA 2PLCA 3ABQA 4JFSA 2W9MA 1F76A 1IYXA 2VFHA 3QVQA 4S3DA 4LV9A 2EO7A 3ABXA 1V3MA 5KSWA 5CBIA 2Z29A 3OLEA 3UZXA 2GRTA 2J66A 5KZDA 1QI4A 2VM8A 2QCNA 3N6QA 3SY8A 3NCOA 4H4PA 1NY1A 5LNSA 1KLZA 5BNKA 1YNYA 4OFCA 3RAOA 1UP3A 3M0HA 4IPLA 4IUOA 4XSLA 3UCCA 1DQUA 1Z7AA 4NILA 1YQ2A 2EPOA 3HQOA 1SO4A 3WD4A 3UG5A 3FVMA 2OO6A 3GVWA 6ALDA 2VO5A 4GI9A 3MSGA 3SBFA 1QO2A 1UP0A 3N2MA 4JIIX 2UY5A 2WOQA 3OYXA 3VKBA 1BGAA 5I77A 4RZ6A 3SCRA 1XINA 2CZDA 3WBWA 1UIPA 4BQ3A 2OT0A 4JYDA 4UQDA 3TYAA 1TFVA 1QT1A 1OD8A 4IQEA 3KP0A 4K68A 5DX7A 3W7OA 4LW7A 5U1OA 3AC0A 3ANVA 4LVGA 1ICPA 2V69A 1XUUA 4QQUA 5AHNA 4ZO9A 3S2NA 1GEHA 1V77A 3TLLA 3ALGA 2DSWA 1XI3A 5FL1A 3W7RA 1ISZA 3LY0A 1Y7VA 2JKEA 3BLKA 3TJXA 2C7FA 4H1ZA 3G1VA 4BHYA 3VIJA 5JRBA 4JCLA 2G0WA 1LROA 2V3EA 1XBZA 4ZOHB 3NQ2A 1NVMA 3S2CA 3NO3A 2C3CA 1DJYA 7XIMA 3U9IA 4NJGA 3HN3A 4ILSA 1V6YA 2DSZA 1MFVA 4M0XA 2C19A 1JDDA 3V16A 3EF6A 2QS8A 1C8VA 2YL9A 4BURA 1FWJC 4Y9AA 1F8MA 5D9OA 2J9XA 1XGEA 1THFD 4HU0A 3W72A 4EMIA 1BEUA 2O55A 1HKJA 1KBIA 1Y0EA 1BF2A 2G3JA 1N5XA 2BLEA 4CQCA 4WSJA 4DXKA 1WYIA 4X9YA 3C0LA 1ZY9A 2CC0A 4IIDA 1GEUA 1UQYA 2QUNA 2R1KA 2FDSA 4PMUA 4ZOBA 1ONRA 3NVVB 1UKQA 2ZADA 1W9DM 2R82A 4BCEA 3F2BA 5IDZA 3WN6A 3L9CA 2Y62A 3KDNA 2QCMA 2HCVA 2WLYA 1LG1A 4J4KA 3HV8A 3D6NA 4O17A 4OTKA 3XISA 5FJTA 3IGHX 2ZUNA 2HJPA 2YZ5A 1JL8A 4IMFA 5AC7A 2Z6IA 4NXSA 1QAPA 1D7FA 5C9RA 3FYPA 3TSBA 4B9YA 4A6GA 3V7PA 3WUFA 2BC1A 2VZSA 2D2HA 1DE5A 1M7OA 4E4PA 1X6NA 3DJGX 4FF7A 4JTCA 3HMJG 1B3YA 1ZPTA 3QSTA 2G8ZA 3TONA 4PCPA 1GVYA 2NWSA 3L21A 1JZ7A 1TZ7A 4I7VA 4HBKA 3PTKA 4PFHA 3I4KA 3EAOA 1A3HA 3RUBL 1RJPA 1EUNA 2BHZA 1OYAA 1CECA 5J8LA 3NZQA 3ZS4A 2E68A 4H7ZA 4H50A 2YJQA 4PMYA 3CWNA 2WKGA 1QPQA 4KWWA 2PF8A 6XIAA 3GG1A 4GHRA 1E6NA 2P1FA 4QG8A 1RQEA 2IKIA 5HUOA 3G1XA 4GO9A 1QHPA 1XRSA 3QH2A 3SGZA 4NY2A 4AB4A 2EBNA 4A3UA 4LCSA 1FVPA 3ZO9A 5D9NA 2I1OA 3VAVA 1YRRA 4JQ4A 3E74A 4H3DA 3C5QA 1W5MA 3WL1A 4P61A 1FH9A 3WFLA 1H5YA 4FALA 3EOSA 4YVPA 3W6MA 1TIMA 5T91A 4TXEA 4AHOA 3MY9A 3SUTA 4IXXA 3L5OA 2DZSA 3A4AA 3M5YA 4N9BA 2EEXA 1AH4A 4WXYA 3EOEA 4R27A 1AODA 1PKYA 1MQQA 4GC4A 1W3IA 3CS2A 4QBXA 4UR8A 5T26A 1G7VA 4H8HA 4QNWA 2IPWA 1LOLA 3CO4A 3W2JA 3WDQA 3W2MA 1UW9A 2PI6A 1UROA 3WLJA 4AIUA 3CV6A 2ZA3A 4GVHA 2C18A 1LOSA 5LXXA 1XSIA 4QE4A 3FSTA 3WMCA 3PJUA 3PBVA 4RDVA 3DGZA 1HUVA 4AZCB 3H2CA 2O9TA 4J56A 1HTIA 1ICSA 3ARYA 3BAJA 5FA5A 1P0NA 1PZ3A 1BWKA 2J7DA 4NF7A 1TYTA 5DBTA 5LNVA 4NX5A 4RV3A 3RU6A 3C52A 3SUSA 1XSJA 1FKXA 1TZ9A 4MPKA 5I3HA 3BLDA 2TMDA 5G4WA 1KCXA 3UJSA 1GYLA 3CPUA 3THQA 3AO0A 2I9UA 3G0UA 1EQCA 3BVJA 3DECA 3CAVA 2RFGA 2FHBA 4JAWA 4RV8A 2F2HA 5IHSA 6REQA 4NNAA 2YQUA 3W9ZA 3CIWA 1JYWA 3I65A 2ZA1A 3BLFA 1RA5A 3GIQA 2J7GA 5I6SA 3H2MA 1UCWA 2WZEA 3S1VA 4RW5A 3L5MA 1OFPA 1S2WA 5C70A 1W2VA 2Z7GA 1K1DA 2A3HA 5AVHA 1FWEC 4FA3A 4TTUA 3GW3A 2VOTA 3FJ6A 1E6PA 3T0AA 1J0IA 4DJFA 3N14A 4RZ5A 4Q32A 5IBXA 3LNPA 1KR1A 3O05A 3C2RA 5LZLA 4E2OA 4EAMA 2BG5A 1V51A 3APGA 3C3NA 2X0SA 3O15A 2G96A 1QCWA 2YB4A 5DEZA 3S1UA 4IOTA 3BGAA 4UFJA 1UKPA 1RQHA 2WB5A 1DJGA 1PL9A 3B0VC 1E6SM 3P82A 1OG0A 2OLHA 1PTGA 3CLWA 2QCLA 4XZHA 4YTQA 3PB2A 4HPHA 4XZIA 1ZU8A 3DFTA 3MP5A 3TX9A 1YE4A 2X99A 2QUMA 3V0UA 1UZ4A 1E5NA 4OGZA 3U0HA 2OT1A 1DXIA 1EOMA 1I2OA 5TD4A 3RPDA 1HJUA 1DORA 4AY7A 2BGNE 3MWCA 1QHZA 3AOFA 3GTFA 1TREA 3H55A 4PUUA 1M9HA 2GSJA 1WYGA 1Z6KA 4MWAC 1TKKA 3PVFA 4XD4A 1RK6A 1MEHA 2Z1SA 2WOIA 1NQKA 2B81A 5JUVA 2VRJA 3OPSA 3WG6A 4IJCA 3D47A 3OP2A 1UASA 5A2AA 1P0EA 2OXNA 3GNDA 3NQVA 3FY1A 3VOHA 2G3IA 4H2HA 1XIMA 2DSVA 7A3HA 4KF1A 1R7AA 1KGUA 3WX7A 1AH0A 3UWUA 3RRXA 5EY5A 5AZ0A 2HMCA 1BG4A 2OO0A 2WNWA 3W1UA 4O0ZA 2AAMA 2XVGA 4FR6A 1F3WA 3JUGA 4N6FA 3KOWA 3MUAA 3D46A 1KFJA 3TC6A 4ZVJA 2E8YA 4NZ4A 1EBHA 1O6IA 2ACSA 4DO4A 4UOJA 3IJ9A 2EJ1A 3VX1A 4MUPA 2FTYA 4I6VA 3H4WA 2KAUC 3UWZA 2QGHA 2V81A 4JTSA 1OX6A 4PRRA 5CG7A 4U10A 1E4MM 5DCEA 4C6LA 3BOXA 1PX8A 2XSBA 4YXGA 1OINA 2PDBA 4PBGA 1NDAA 1UC4A 1YPXA 4WVXA 2W3SA 1A3XA 3NQFA 1JCMP 1UHVA 4JFTA 4MAZA 5AYBA 3S5YA 1GVQA 1UOZA 2QJJA 1N5WC 1DWJM 3SN1A 4H01A 1PAMA 4N7QA 1KFLA 5A6SA 5FMHA 3IK4A 2DIJA 3XINA 1XLLA 4LF2A 1QNOA 2ZRWA 4G7FA 3E02A 3KBVA 3MUZ1 1XLAA 1EB3A 1J79A 4G8TA 3R89A 1IT0A 2BXVA 2ACRA 3D0CA 4JTJA 3L2IA 2YXXA 5HQLA 4WOZA 4AWTA 4HNNA 4I9JA 3WF3A 4F0MA 3QY8A 5D2TA 1PZ0A 3D3FA 3BJTA 1ML1A 1B90A 1DKWA 3P80A 3M5XA 3WD0A 2CHRA 2E67A 5DMMA 2NUYA 1BPLB 4O19A 1UWRA 3KVMA 3CGBA 4INFA 4LIIA 1CIUA 3TNOA 1K9DA 3W7KA 2AKMA 5E0CA 2HTMA 3TMLA 5D2YA 1S7MA 1B3ZA 3S1WA 4Y90A 1KO0A 4G2DA 3BE7A 4GA8A 1EJSC 4MMWA 3S5OA 2AGKA 2XVKA 3QF0A 4L4OA 4DZIA 1IGWA 1NP2A 4ADWA 1ZRQA 1VS1A 3N4EA 3GHTA 1E73M 4RZBA 1VP5A 2PDMA 1WAUA 1X1ZA 5EFFA 3N04A 4G56A 7PTDA 3ARUA 4ZOEA 2YDSA 4GPNA 4O13A 2DZTA 4C6KA 3UR5A 3WNNA 3Q65A 3NDYA 5FF2A 3OJGA 5G2WA 1FFUC 1CXLA 2BOFX 5E6YA 3IAQA 1XXXA 4JTGA 1M41A 4QCFA 4O11A 4W86A 1VCGA 4M1RA 5AC5A 1WCGA 1X98A 4WDWA 2ZZ6A 5BU9A 2RDXA 2JKPA 3AS0A 3WMBA 5A2BA 4LUIA 1NOUA 2Z25A 3GDRA 1OX5A 2NX3A 3IGXA 4DNAA 3VIIA 3F4WA 1DWGM 2G3MA 3LHTA 4XKYA 1UMYA 3RU8X 2FGLA 1I2RA 4UQCA 2E25A 5DY3A 3WLTA 2NVCA 3BCDA 3QFWA 5JCNA 1EPXA 1I0DA 2J25A 5LA0A 3WSUA 4AUBA 1US0A 2Z28A 2XVNA 1VDVA 3CNYA 3NQAA 4LYQA 3TYDA 3CZJA 4EXAA 3PZOA 3U5UA 2OU4A 1JAEA 1G1YA 4W84A 3MKKA 3N4FA 3DHUA 5I3JA 1QOPA 2EAWA 4LANA 3PTMA 3W7EA 1JG9A 1J5SA 2V8ZA 3TKFA 4DO6A 4AC1X 3AIRA 3C61A 4K8EA 3GHSA 2JALA 3GAYA 4L1XA 4IG2A 5A8PA 1MW0A 3ZR6A 1DOSA 4K6AA 4C5YA 5F2LA 1AMYA 3W00A 4OKDA 2G5WA 2E4TA 5HK4A 4NT0A 4Q7BA 1HO1A 1QPKA 1ZAJA 3K4DA 1HKWA 5A8NA 2A2IA 3WEZA 1CLKA 4CCEA 4XD6A 3QC3A 2A79A 4JN8A 4PEKA 1Q6OA 3R0KA 2PTZA 2WLZA 4AMCA 3M0IA 4LUTA 2WWCA 5DFAA 4DJFD 2VEIA 5LIXX 4WKFA 3R13A 1FWSA 1OC6A 4QM1A 4J35A 2ACQA 4Z0JA 4LSBA 2ZRZA 3II1A 1CX9A 3DH9A 1V3JA 3AHYA 2QLYA 4EKJA 5IFPA 1JXKA 3DZ1A 4H9MA 3CGCA 4WDUA 2W67A 1OGSA 2AMXA 4Q4SA 2VGGA 4PMNA 3MI3A 2XG9A 1UZ1A 7REQA 4UTLA 3RNMA 3ALFA 2GPTA 1GJUA 3UA3A 3WLKX 4C6CA 5HPCA 2UWFA 4LWWA 4F0SA 3QSRA 3R8GA 4JS3A 4TVUA 3DG3A 3P62A 3QHNA 1PKNA 2G3NA 1SO5A 4RDYA 3M0XA 1VHCA 5D33A 3Q58A 4N9DA 4Z42C 1XUZA 1WDRA 4IP5A 4KMQA 5LHEA 5DT5A 2IQ0A 3R1ZA 1GK8A 2FB2A 4UTWC 1OADA 3VIKA 3CGEA 2QIWA 5TF0A 1G7UA 1RLCL 3GNNA 3TROA 3KOFA 3WZ0E 2OKOA 3AS3A 3VTRA 1H4PA 3LPGA 3H12A 4XAPA 1XG3A 5C7VA 4DWSD 3N9KA 2JEPA 1MW1A 2XM1A 3ENLA 4IX2A 1SO3A 1DNCA 2YOCA 3WQ4A 4HK5A 3W76A 3WNOA 2ZXDA 2E9BA 3VDBA 1SZGA 3W7CA 2DGAA 4UMBA 3TQVA 3BAXA 4C5ZA 3M7SA 1TTIA 3CV2A 2WSPA 1TELA 3EKLA 1XIEA 2CERA 4R7OA 3MTWA 2VEMA 1UZDA 4BFAA 3DG7A 1KM0A 1BQGA 4J57A 3WUEA 4HHMA 1RCXB 4B5TA 3JS3A 1DWFM 5KITA 4I8YA 3RIKA 1AL7A 3TEVA 2YVGA 3KVLA 1EL3A 1ZAHA 4NHVA 4HVXA 4E5TA 3FAWA 1JD9A 2DW6A 5HA7A 3HA1A 1Z3NA 1POKA 2XN1A 4LAKA 1F74A 4K39A 3VGEA 4IFOA 4E4FA 4F79A 5CGTA 3LU2A 3CHEA 2TRSA 3KE0A 4DBSA 1O95A 2J9YA 4L4LA 3VPLA 2YVJA 5M2FX 1Q8JA 3M5ZA 3EPNA 1OX4B 5JCMA 1LQAA 2CZ5A 2W4XA 4EF9A 2Q3OA 4W8LA 1C9DA 3TW9A 3CO8A 5CSUA 3TWBA 3R07C 4O1BA 2QMKA 2W54A 3MSRA 4WIWA 2GGGA 2VKZG 4NVTA 1SU5A 2OZTA 1H11A 1BKSA 3EXSA 4LTSA 2OTDA 4IIEA 4ATLA 5JIPA 3S47A 2AAAA 3C86A 4IICA 4LYRA 5FEXA 4PZVA 4QJ1A 2P0IA 4IPNB 4GY7A 3MDUA 1JZ3A 2B7OA 4XTIA 3GSMA 5EYWA 4A3QA 3FJLA 2ABAA 4O1AA 1NSJA 2GJPA 3L2MA 1HNYA 3G22A 3DGBA 2VCCA 4JTUA 1ISVA 2PLMA 4HHPA 1N8WA 1R3TA 4WUIA 3SIMA 1TV5A 3CWOX 2FZDA 2JIWA 1H2JA 3M46A 2MNRA 3LS9A 2JEQA 3BTNA 1E0XA 5AZ1A 1QJWA 2CBJA 5AFDA 2YA2A 2FZMA 3SO7A 2QPUA 4FNUA 5H8UA 4RX0A 4L65A 1XD1A 1TMQA 2VGFA 1ECEA 3H2AA 3DKLA 3FW6A 2DIEA 2WCGA 3WK0A 4AVFA 2NVKX 2YCJA 3B0PA 3VCRA 3WLPA 3QTPA 1ZJHA 3BSGA 2PWFA 4MG4A 1ZZMA 3W3OA 2EPLX 1DIDA 1T99A 2XH4A 4UQEA 5E6ZA 1SR0A 3OYZA 4GZ7A 4LOCA 5BXRA 1S1PA 5I5RA 1E9ZB 3G0XA 1PWMA 1SUXA 3VFCA 3NGFA 2X05A 1PXGA 3N2CA 1B30A 2NQZA 3DFPA 5K3VA 1YTEA 3EEGA 5AN7A 4H4WA 3THDA 2HBXA 3C2YA 2QJHA 3B9EA 2WQDA 3UR2A 4JTLA 4CUCA 3RFAA 1FP9A 3Q45A 3GTHA 1NHPA 5ABEA 4K8GA 4GX9A 1UD3A 4ACZB 4UR9A 2XVLA 4M80A 3W86A 1EXPA 1TPUA 1F05A 2J9ZA 4NZFA 3WEMA 2PMQA 4H9XA 4PMDA 3OLIA 3S9YA 2EG8A 4HZ8A 3T2PA 1HKVA 3WBEA 1PTAA 3QR0A 4MZ8A 4JTTA 1PYFA 1EWEA 2YLLA 1VPYA 2W5FA 1CGYA 1RJQA 3RGTA 1N8IA 5ABFB 3BCJA 3PZMA 4GIAA 4P7QA 4ROPA 1JPKA 2OOFA 2INZA 1VKFA 3VKJA 4H4XA 3ZFHA 1CI1A 1XIIA 2QCFA 5JQ9A 4QIUA 1TRDA 4KQNA 4UTTC 3TTYA 1I2PA 4ZXLA 4GFSA 1FX6A 1TWDA 5BXTA 1P5BA 3OLDA 1HP5A 4C6MA 3S8HA 4HA0A 1EH9A 4KRUA 4D6HA 3BMWA 1RK5A 5A6JA 3NVWB 1AQFA 2R9RA 2VVNA 4J2PA 3WJZA 1NHRA 2R1LA 3AYSA 1RAKA 4LNYA 1RLDA 4YNGA 4V28A 5D03A 4FHAA 3QYSA 3ZSSA 1K9FA 2ICSA 2Y8KA 4IUGA 3W02A 4V33A 4B4HA 1W3NA 1YDYA 3SCUA 4AVOA 1CGTA 5FJJA 2HSAA 3Q4DA 3AXMA 4OWGA 4X0NA 3PANA 1PWLA 4OV4A 2YIHA 1UKSA 3COTA 2PDPA 3OZMA 4FLQA 2CU0A 4WOQA 5CJNA 5I3IA 2WP6A 2NZLA 4KEVA 4K37A 4REQB 4H6KA 4LC6A 1SZEA 4C7DA 3DERA 1UKOA 1GZ1A 3UXIA 2HK1A 1DWAM 3R10A 5EPDA 1GTHA 3BDKA 5AHMA 1I9CB 2J79A 1OT1A 3TC3A 3GH4A 3G24A 2BZNA 4D1IA 2G50A 2XSAA 4TVWA 3GB6A 1H7NA 4DM1A 5A94A 1W1ZA 1QI3A 1PIIA 1B9ZA 2ADAA 4HKPA 4B5VA 1JPMA 2H3DA 4YTTA 3LGGA 3QY7A 3WQCA 2WBGA 4DPQA 3NG3A 3W85A 3MUXA 4XUYA 1VIWA 3WD1A 3VZXA 1YADA 5EL1A 2ZUTA 1AW1A 5U7SA 1KLYA 5BRPA 2YCLB 4DAFA 1N7KA 3L4ZA 1Q85A 5DCBA 2CLEA 4XD3A 4WJ8A 4TX8A 2Y61A 4AZGA 1F3TA 3NPVA 4HOXA 1DV7A 5KVIA 4U5KA 4GRTA 5J5RA 4NSBA 4GIRA 3ZLHA 1U33A 3UPMA 3I6TA 4S1FA 1B3OA 4PL1A 3L4TA 5DN1A 4Q33A 4EOUA 5EBAA 2NW0A 3HIJA 2VGBA 2MUCA 5C9ZA 4DO7A 1EXBA 1FQ0A 1QNPA 3MV11 3VE7A 1ONFA 1IR2A 2V67A 1GPFA 1G0CA 4JQ9A 3UJ2A 4JY8A 3R8HA 2ZIDA 4AIBA 3SN0A 4UNIA 3MS8A 2PGWA 4NL1A 4H04A 1OB0A 3UCDA 2TPRA 3NS1B 3UWEA 1RXOB 4C1NA 2IPFA 3VO0A 1AL8A 5AHFA 3BG9A 2ZXBA 1H1YA 5F2MA 3AICA 2ACUA 4M6UA 3WQOA 5A6AA 4QGCA 4H19A 4TV6A 4JEJA 3IUHA 3MZNA 2OQHA 3KS6A 4PMJA 4WY0B 1ZMDA 1F61A 2VR4A 3SURA 3B9OA 4Y9MA 3W23A 2V3BA 3MW7A 5A6LA 1F07A 1B4KA 4OZOA 1V6WA 4KIEA 3KWSA 1H09A 3KW3A 3LXBA 4AAJA 1K02A 2NT1A 1O66A 3EMZA 4P8XA 1TJ2A 2GGHA 4AHPA 2QT3A 1AD1A 1KBJA 1ZCOA 4QLLA 2QNEA 1SW7A 1H0GA 4GGHA 1W1VA 2Y7EA 5FAGA 4F3HA 1NU5A 5E0FA 1YHTA 1EP3A 1E5JA 5U4NA 2W3RA 3GY1A 4CGTA 4DUOA 4F2BA 2PDXA 3WH8A 4LS0A 1O5XA 2YCKX 3IRDA 3W1NA 3W71A 4XISA 2C3ZA 1BTMA 1UR8A 3B0XA 3PF3A 4L9ZA 2Z4GA 3EX3A 1TX2A 2JK2A 3KCOA 5EU9A 2QIIA 3UBPC 2VENA 2PD9A 1IZKA 2WBAA 2F38A 3M64A 2V5CA 3KTCA 1TWIA 4UCFA 1CGVA 3A4XA 1KCKA 3MANA 5C9XA 4QS6A 3SRFA 2ZC1A 1T7LA 3SCNA 1HL9A 4ZSUA 4E8DA 3WCZA 3ERPA 2J77A 4UCGA 1HO4A 2WM1A 3W6LA 1KQZA 3M0ZA 1LBLA 1QBBA 3H54A 4L1GA 3AN1A 4OUIA 4RUBA 2A85A 4FK9A 3CUXA 2P10A 1QMLA 4LCQA 2GQ3A 3K8KA 3VYLA 3MMUA 4W5ZA 2GDUA 1JZ2A 1CWYA 3POHA 1R3YA 3RLGA 2YA1A 3UNDA 3UG4A 3GDTA 4XZWA 3QQWA 5E70A 4GYFA 1WE5A 4FLSA 4M81A 7TIMA 3URAA 4FXRA 1A5LC 2C1GA 1UJQA 3SGGA 2EHHA 2G4JA 2BX7A 4Y9NA 2CZEA 2O9PA 4UNLA 4PBFA 3AAMA 1IXQA 3AUJA 3OGSA 4MJ2A 3LHVA 3FDKA 1KRBC 4FX6M 3BK0A 4QLKA 5A1AA 4CD7A 4HNOA 1JF5A 4O50A 5E1QA 4F9DA 1R87A 3GUGA 5REQB 1EDGA 2ATMA 4O15A 3GG0A 4XBJA 5K9CA 4OV9A 1LOQA 4HB7A 4IH3A 1UKTA 5A6KA 4RE3A 4XZBA 3P3BA 2WC3A 2HRWA 1L6YA 3M43A 1KRAC 3URQA 4ECLA 4XB3A 3SGUA 3GHRA 4AW7A 5A8GA 2F7FA 1US2A 1UA3A 2A1YA 2WPCA 3PAJA 1LRQA 4IJRA 3DBPA 1ZSXA 4N42A 4DLMA 4AD5A 3DC8A 4BV6A 1W9VA 4WXZA 2J78A 4N9CA 2E6AA 4JYFA 3AYVA 4EPDC 1B9BA 1I45A 5DT7A 1Q2SA 3DC0A 1XH0A 4LH8A 1E0WA 4NJIA 3W07A 3OQ8A 2GGIA 4DZAA 2QXWA 1LWIA 5ABTA 3ANUA 1UH4A 1WUFA 1VB9A 1JPHA 4MAVA 4OJYA 1H41A 3WY1A 3ARQA 4LUSB 1DHKA 4JTDA 4WX2A 1W8SA 4FO4A 2A21A 4V1XA 1J0YA 3GU1A 1XPGA 3UT0A 5HQEA 4RNJA 4ERGA 2NLYA 3QPEA 1OVDA 3WK1A 1E3XA 4IXHA 3CZLA 2NVDA 3EXTA 2QCCA 3MI6A 1OC5A 2WW5A 3Q94A 3W7GA 3WH5A 4PBEA 1AW2A 1V8EA 3FN9A 3VDCA 4S3FA 3NZPA 4P7RA 1RCQA 2GR1A 4GNKB 1QR7A 4UTTA 3S4TA 2BY3A 5CJ5A 2XSXA 3C2VA 3G1AA 2VURA 1BD0A 2O4QA 3OZYA 1UPMB 3FKKA 1PX3A 2ZRUA 4X61A 3HG3A 2Q8XA 1WOAA 2RDUA 3KRBA 3EB4A 1JRCA 3HQNA 1IXPA 3HM7A 3BZGA 2E7FA 1T8XA 1HN1A 3NGJA 3SCSA 1GRGA 4CD5A 3OTRA 4NRRA 3W6YA 3ECQA 3DK8A 2EQ6A 3O9NA 3S0CA 4DBDA 5GRTA 2PU1A 2DT3A 3UGRA 3OB8A 3IJIA 2DT1A 4F4RA 4FLOA 3SCPA 1D8WA 4O0KA 4DI9A 4LBSA 5CCZA 3OG2A 3QQ0A 2Y24A 4RE4A 1L9WA 1XX1A 1OFEA 4F0RA 1JIBA 1XGZA 3KCJA 4KRZA 1VFHA 5JIWA 1FEAA 2OSYA 2PA6A 3SQSA 1V6TA 4MYXA 3BOFA 3P8IA 2P0OA 1OFOA 4HK7A 4KGJA 4IMEA 1R3WA 1G9HA 5MKGB 3B8TA 3NSMA 1XG4A 3E2VA 1EJ7L 4JHMA 4KCWA 1KM1A 2JF6A 3W74A 4MTVA 3L7RA 5TIMA 2QGYA 4RJEA 1TA3B 3N34A 2F6UA 3QFEA 3ARTA 4EQXA 1SMDA 2Z1KA 4HD5A 4YHEA 4QAIA 3QFBA 4MB3A 3RLHA 3BWWA 3ARRA 1JXJA 3SAZA 3EOLA 3NQ6A 2FPTA 2TAAA 4GQQA 1R46A 4G1NA 1EC9A 1LZOA 3EOUA 3N4AA 1E9IA 3S2LA 3UF9A 3W2KA 3WBAA 4AZIA 4MYAA 1M7PA 3ZWTA 2BY2A 5K7JA 4FIRA 1TWSA 1MDLA 1NF7A 1BSLA 2PTWA 1OWQA 3LZ5A 1FWAC 3QEZA 3ABRA 5U25A 1Q13A 2NQ9A 3ICJA 4ZO8A 3F1QA 3JRKA 1TA3A 3V5FA 4AD2A 1A4MA 4CQ9A 5FESA 3A47A 3TVAA 1LUCB 3IIOA 2PZNA 3U2OA 1T41A 3LM3A 5KMYA 1E71M 1GREA 2ISDA 4BEQA 3FYOA 1NIUA 2VEKA 2IS7A 2WMIB 3L8KA 4XSMA 1XC6A 2JKAA 2WZHA 3S42A 3LCWA 4GXWA 4NG3A 3VILA 2EG7A 3T0DA 4WF7A 3U2EA 1KXQA 4PYSA 5EGRA 4UIOA 3K1GA 4ZA0A 2IXUA 1V0MA 3A3XA 1Q6LA 3VOIA 3E6EA 2TPSA 3GXTA 1V59A 4EPBC 1AMKA 3NQBA 3NURA 5LNRA 3KBJA 4AFYA 5LHFA 1PJ9A 3LXCA 3NZGA 2PCQA 4UMCA 4QP0A 3DYPA 5E93A 2D20A 5A95A 5E0KA 5CPSA 1GW9A 2VR2A 1J0HA 1FWNA 3LXAA 3F5JA 3LBMA 5LNWA 1LVLA 2ISWA 5DELA 4AX7A 5HMSA 1PYMA 4UFKA 3QV7A 3HOJA 3GXNA 3UZ5A 4CCDA 2FGBA 1N2VA 3IJQA 3WQ8A 3VDHA 1XWYA 3MUY1 1E9LA 1J5TA 3FIGA 4IM4A 1JOAA 4Y9PA 1XCFA 1V6XA 4HU3A 5FSEC 3BL3A 4FOKA 2XIIA 1GG1A 5I3FA 1J0JA 3GLCA 1X7FA 1LT7A 5LIUX 1R0MA 3EWBX 1KKOA 4FNSA 4UQBA 3LG3A 1CNVA 1UH3A 4O53A 1YIXA 3G3DA 1ZJAA 3GVGA 1XBVA 4NKCA 3H4XA 3ARSA 1OCJA 1I0BA 4ZE4A 4U2YA 4ZOCA 1GQJA 3T7VA 5E9AA 1P7TB 4Q8VA 3GDBA 4JZ5A 1HJWA 1GETA 2CLFA 2FPVA 4PA8A 3IPWA 4DYJA 2DUAA 3UPWA 3VGGA 1RPKA 4QEEA 2P50A 4UQ9A 1BFNA 2DZUA 4H4VA 5I3GA 3NM1A 3WQ5A 1HJVA 4GVIA 1TV4A 1M3UA 2GQ8A 2VWSA 1KW1A 3HPZA 4Z2GA 2DQXA 4LAUA 4M6PA 4JKKA 1E3ZA 1I4NA 7TAAA 5L6UA 5CC7A 3SRDA 1UWSA 1C8QA 1SZFA 1BLIA 3HG2A 5HWMA 4HJFA 1XH1A 1ZUAX 2DU2A 1OABA 4MWAB 4LNCA 3FDGA 3BGJA 2OGJA 5M1TA 2XGIA 3URHA 4K7YA 1AA1B 4WDTA 3VGDA 3AYRA 4W5UA 3GZAA 4D6CA 4DEFA 3M44A 4HJWA 4GC3A 4IQDA 1A80A 1NDWA 2JE8A 1HT6A 2V5JA 1IEWA 3EWZA 1O5KA 2V5DA 2NV1A 3G0SA 3SUUA 4RDZA 3W01A 3C2EA 2ATSA 1AJ2A 3B9AA 1TPWA 3TYCA 2CW6A 1SW0A 5FL0A 1QRQA 4H7CA 3R4IA 3THUA 2ON3A 1SMAA 1HW6A 4F2TA 2QJNA 4A21A 2EKGA 4AZHA 2F6KA 1XYAA 1TPH1 4IFKA 1SFLA 3V36A 2Q02A 4YLWA 4MM1A 2PRLA 1V3IA 1JVNA 1W32A 4JL2A 2ASHA 5HMDA 3EDDA 3AHXA 1FH8A 4JKMA 4DYEA 2ODOA 4Z0SA 4HOWA 5D02A 1XQLA 3AI0A 1VENA 1UD6A 1PVNA 1TYGA 1ZJBA 1MYRA 4FEZA 3J7HA 4GKTA 1FIQB 1XHCA 4S3KA 2ZZ5A 4GWEA 2OFJA 4BQ2A 7CGTA 3S6OA 1PTDA 3L12A 4E3VA 2C15A 5D05A 2O92A 2FQIA 3M4HA 1TJ1A 2E6YA 4AIEA 5TBOA 2VL4A 2XPKA 3FKRA 2WZIA 4AD4A 3QGKC 5G1MA 4LVFA 4Q7NA 3AIBA 1GRTA 1VAHA 4E8GA 2GVJA 3VM7A 4J3TA 5CLWA 1TTJA 3PPFA 1AZ2A 3CAQA 3FHAA 1F8WA 3TQ0A 1YMYA 3WF2A 1VRXA 2XH0A 3W7HA 1U1JA 4DZ5A 3R11A 3K46A 3MSDA 1WOBA 3CT7A 3N19B 1S2AA 2PC4A 1VF8A 3N12A 3SM0A 2XYLA 1TTQA 4JQAA 1XIJA 1F4HA 4MZ1A 5BXSA 1SGJA 2FH8A 5C5YA 2GJRA 4B3LA 3GRTA 1VBRA 2BXZA 3E96A 4EIVA 1V6VA 4Q22A 4MKSA 1QOXA 1Q4NX 4W88A 2YZRA 5CPMA 4QJ5B 5FEWA 3L66A 1B3WA 3KVKA 2Q8ZA 3LZ3A 1CXIA 1LCOA 5DRIA 2XU2A 2PTYA 4NAEA 1VH7A 1ZCCA 3IJ6A 3V0TA 1W1B1 1DXEA 1SPQA 4HMEA 5HJXA 1B1YA 2G97A 1YNPA 4K2SA 1OK6A 1V97A 2ALDA 3GE7A 3IRSA 3VUPA 2OEMA 1OZQA 2DSKA 4HYVA 5KZMA 3CMJA 4FNRA 4WD0A 5C9UA 1SB3B 4PULA 4W93A 5CQ1A 2BFGA 4D6EA 4H4QA 4RE2A 1JI1A 4A3YA 5CZ0A 1ECQA 1TUXA 2QZRA 4AY1A 4HA4A 3NQ8A 1W9PA 1REQA 3BOLA 1YXDA 1WKYA 2Y8VA 3SW6A 5H6HA 1W1TA 1X96A 4HNTA 3LOTA 3LV6A 2Y0FA 4C6NA 1QPOA 3K30A 4MLJA 5HXMA 3WYZA 1UD2A 2Z1VA 1EP1A 2OVLA 3A9BA 1ONWA 1Q1WA 2VFIA 3W70A 5LSMA 3CZGA 3UNTA 2E0PA 5C9WA 2NX1A 1TJ0A 1XDJA 5AY7A 3BW2A 1W54A 2EQ8A 4ZGYA 2ZZ4A 3ELFA 4N4QA 3NL5A 4HSHA 1W9BM 1O5QA 2RGLA 3EWUA 2WKLA 3LHYA 2D2GA 3F2DA 2Y85A 4PTNA 2BVWA 3CGTA 4JDYA 3GH5A 2FHCA 5HNTA 6TIMA 2QAEA 1J9YA 1PO9A 1OK4A 3WNLA 4DNMA 4ENLA 2CLKA 2NVAA 3RLVA 3T2QA 4JGDA 4JX5A 2QKFA 1CXEA 3U4FA 4AIOA 1JQVA 1CXFA 1RM6B 3THCA 5CBJA 2V6OA 4O52A 1K4QA 2HWGA 4Y7EA 1ICQA 3VZYA 2PDLA 2WJEA 2UBPC 2B4GA 2GJXA 5LKYA 2IKHA 1GERA 2I17A 5K4XA 1QK2A 1UWAA 2E40A 1WDSA 2PAJA 1G4TA 4KWOA 1KCLA 3W4RA 3CTTA 3QW3A 4O57A 2WMGA 2W92A 4PSPA 1LUCA 4LAMA 4J3SA 3RCNA 3F4VA 1R9ZA 1HF6A 4F0HA 4Q4MA 3DESA 1VYPX 1UR3M 4C6JA 1UR9A 2YCLA 4HZ7A 1Z32X 4KFOA 1ZENA 2CXEA 1YQZA 4FI4A 2P8BA 5SWUA 3VNMA 2GJLA 2NQ5A 4DJEC 3KHJA 1XQKA 2BXYA 3SY5A 1VJZA 2Y5EA 1T40A 5C55A 3DUGA 1YDVA 3PSWA 3SN4A 1HFBA 1ZAIA 4HNUA 4AMAA 1JJKA 1H63A 1E6RA 1RBAA 4GQRA 3V18A 2OZ8A 2GDQA 1ZK7A 4NAFA 1GZJA 3EA3A 1PKLA 3HPXA 2JK6A 3HV9A 1O94A 3ZSTA 1FFRA 3TR9A 1DBTA 1P4CA 1D8CA 1DIOA 1OF8A 4WQ6A 1M7XA 2D0FA 4M52A 3L5AA 4AY8A 3MKVA 3OIXA 3C0SA 4GYPC 3LI0A 4C7GA 1BSIA 1RALA 1RD6A 2I5IA 1CEOA 4AISA 3O0FA 2ZFAA 2PFHA 2E6FA 4AU0A 4CN6A 4D9PA 3DBNA 3SCWA 1BXNA 3SCTA 3CQJA 1F8IA 3EOOA 3P67A 4PEEA 3H2FA 3E0LA 2KZHA 3GNPA 4AD1A 2CLPA 2G41A 2F6XA 2NXHA 2PLKA 3OBEA 4GIYA 1MQRA 4HZMA 3XIMA 2J13A 2A3CA 2V5KA 3CQIA 2C14A 4DWSC 1XF0A 1J6PA 1K3UA 5LGZA 3NPWA 2H90A 3S1GA 2V6AA 1J2BA 5FJRA 4YTSA 4GQBA 1OIMA 3TQPA 4Q4QA 1P0KA 6REQB 4ATWA 5FEPA 1TVNA 3O0HA 3TQKA 1H1ZA 4PODA 2CBUA 3O3RA 1MUWA 3WLMA 5HNUA 3VE9A 4C6BA 1DXLA 4GUJA 3GXMA 1QK0A 5FACA 5AYZA 5TQLA 3FHQA 4GJIA 3B8SA 1KXHA 4TO8A 3VOJA 1EYWA 1LM1A 3MB9A 4R9OA 1NWUA 2C79A 2J7BA 5B80A 1P1XA 3CYJA 2P88A 4GG9A 4Z2KA 3WQWA 5A2CA 4RCXA 4YIWA 8XIMA 1GSNA 1ZKQA 4LXFA 4E3TA 1M5WA 3QOMA 3EGJA 2GGJA 4MUZA 3GXFA 1DL3A 4HTBA 2PDKA 2INFA 4I3GA 1CXKA 3WNMA 1OYBA 5EMLA 5ECVA 2YGYA 1MO0A 3VIOA 4C7FA 1W0MA 1GOQA 1R5YA 3UR8A 3N29A 4P8UA 4S3AA 3BQ5A 1CLVA 4XZ9A 5JH2A 1S1RA 4S3EA 1E40A 3UY8A 5BOEA 3PY2A 1WDQA 3DFQA 3FGCB 1GRHA 2VRKA 3H7RA 4IISA 1F4AA 6XIMA 5LIWX 3PWGA 3W1QA 8CGTA 1XLIA 3CHCA 1O68A 2WMFA 3WH9A 1C93A 3MZ2A 3UVAA 2A7NA 4IFKB 1WUEA 4LJ3A 3UQNA 1HL2A 2CPUA 5G5IA 1N62C 2ZZ3A 5A69A 3EBVA 2OOGA 3FGCA 4JBRA 2FVLA 5A8QA 4B5NA 3ME3A 1B54A 3NQGA 1A5AA 1MI3A 1K7XA 2FVKA 2ZUWA 4KIRA 4ZL1A 5C54A 4I5RA 1PEZA 5GJNA 1G67A 2KX9A 2W0UA 1EHAA 1X2HA 1Q8AA 4MNKA 3TCSA 3F5KA 2DZBA 2QCDA 3H2OA 2PC8A 2D0HA 3PB0A 2ZCGA 1DJXA 1H51A 1DIEA 5B7YA 5TNVA 1C91A 4XBSA 4N02A 5ABFA 3BUVA 1GONA 1OFRA 4AEOA 5BOFA 3LCIA 1L0PA 2MANA 4H6QA 2WZMA 1HG3A 3M47A 1HJSA 5IOBA 4XBKA 3FG2P 3AXIA 4JD4A 3VC5A 3GRIA 3CYVA 3TXVA 1RP9A 1GJWA 2CWNA 1NJJA 2J7FA 3QZ6A 3K4AA 3RX4A 1H7WA 1UC5A 5HMFA 1XBXA 4FS9A 4PMXA 3PZUA 3BMVA 5BOOA 3QXBA 1MQPA 1SJAA 4JYEA 1XIFA 2DZXA 3M0YA 1E56A 4ORIA 3E1F1 1CXHA 4B5UA 5CH9A 4W7WA 3TA9A 2WPFA 4WKAA 4Q8NA 1IIHA 1XC4A 2W63A 3WQGA 4PUKA 1QNSA 3VU2A 3IJDA 4K8HA 3NAVA 3B0YA 1WKEA 5HJYA 3VNKA 3HF3A 3PBYA 5KVHA 3WUGA 3SDOA 3TW7A 6CGTA 4GY1A 1ITUA 1KBBA 3S3GA 1JCYA 3AHTA 3SCQA 1C3FA 3EPMA 3VI2A 3WH6A 1WZMA 2E9LA 4JNYA 2HXTA 3SZ8A 3PC0A 3E0WA 2ZDSA 4DXXA 4I7UA 3ZJKA 3DIPA 3PG6A 4L6HA 1VEOA 3PUEA 1EYEA 4M19A 2X7VA 3I7RA 4G7EA 3USZA 1Q3NA 1XP3A 1UA7A 2W79A 3JZUA 3GR7A 3ZVHA 4QG6A 1U5HA 3QTGA 3WF1A 4US6A 4FAMA 4A29A 4UTKA 1WP6A 3QPYA 4I9AA 4EM3A 2GLKA 3UXLA 4GQ0A 4QE1A 2YKKA 1GPWA 4MJZA 3MMWA 4NJHA 4ZFCA 4UOZA 1L2QA 5C0QA 1GESA 4LRSA 3N6HA 3FVDA 3NQ7A 3C56A 2EGZA 3POCA 3AU2A 3EANA 5CAHA 2QF8A 2NQJA 8A3HA 5DMYA 4RKAA 4AG0A 4B15A 4PUJA 4HN4A 3UZWA 4CQAA 4Y6GA 4PCFA 4KW2A 4Q8OA 3B06A 1ZTVA 4GIEA 3R2GA 1VRDA 1YTKA 1O1ZA 3AISA 3EWDA 1EIXA 2QAFA 3VMNA 1XM3A 4MPQA 3G2GA 1HKKA 2B7NA 5FF7A 2D69A 2D0GA 4S23A 4Z1BA 2CZVA 4HOZA 4PB4A 5A8OA 1ELSA 3WJWA 3QYQA 4YHGA 4CNPA 2L5HA 1Y5WA 3TTEA 1UBSA 3E0VA 1O7AA 1R86A 3H26A 3GXDA 1DWHM 1VBJA 3U4AA 2VX4A 1FECA 3I3DA 4TQTA 4GCXA 5HNRA 1E15A 5I7GA 3BAWA 4DO5A 3E2SA 1PKMA 5F7UA 4EP8C 5KETA 3AZRA 3VC6A 2C1HA 1PPIA 3RDKA 2PDQA 3IIZA 4NZ5A 2ANUA 3UG3A 4D1JA 2GJXB 1OJTA 4HMDA 2DZAA 4POCA 1OT2A 5T9CE 3ZT7A 1TR1A 4JY9A 3B03A 1NWSA 4O8RA 1H7XA 1JZ6A 1JDAA 1RBLA 1AH3A 3QPZA 1ITQA 2DVUA 1TJRA 4PUNA 3W7JA 1OF6A 4PMOA 3TZNA 4F66A 2P76A 4HPXA 3W1MA 3HGSA 3BSMA 4EX4A 4IGNA 4A22A 1JCLA 2A4AA 2XWDA 4AXNA 3PWIA 1QNRA 3JR2A 2I5GA 3ZVIA 4IPPA 3BO9A 1L2UA 2BVYA 2D73A 1IEQA 9XIMA 3SCVA 5AOUA 1B3VA 2PURA 3GKFA 2QYGA 4XD5A 4ZBCA 2WMIA 1N8FA 1YNQA 3KUMA 3WLOA 4AHQA 1KFWA 5FJIA 4A3RA 3PN8A 5C6MA 1D7YA 4NAFB 1FFVC 3T78A 4ZTYA 2DJLA 3VGHA 2DVTA 2BGQA 1KR0A 1PZ1A 3K4WA 3AXKA 3V3WA 3DU0A 1MFUA 4HHHA 4IGMA 3TJ4A 1UUMA 4GISA 2PE4A 5FS7A 3W0KA 1JULA 3IGSA 2C13A 1JCJA 3BGGA 5GNYA 1WZLA 4FPSA 5D8ZA 3HGOA 2E8ZA 4ZEPA 1PS9A 1IEIA 2EQDA 4LVDA 2V2HA 3SR6B 2BCPA 4J3WA 3LBOA 4GK8A 4EAYA 4GNVA 1WDDA 3A4JA 3VD4A 2CEQA 3EWYA 2XISA 4H9ZA 1XICA 1AG1O 1YX1A 3VA8A 4MKVA 3DH7A 2RABA 3ZR5A 3CUFA 3LSCA 4IMGA 3M16A 3O6AA 2FYMA 2YAUA 3E9AA 3TE9A 1BWCA 3LGDA 5FIPA 4Z2IA 3C2OA 2E3TA 2CDUA 1XCXA 2WHMA 3G1FA 1SVDA 5BWFA 3C2FA 2XN0A 4BKNA 4D6JA 3GKAA 4W7VA 1WO2A 1LRTA 2WNZA 4Y9OA 4AXKA 1O5RA 1X97A 5CJMA 4G1KA 4GINA 1OX4A 1PX4A 1F2JA 5BWAA 2OB3A 2PGFA 4FLRA 3M6YA 4DRSA 1K8CA 4D8AA 1E4LA 3SY1A 2VNCA 4JN7A 3FX4A 3HMCA 9XIAA 4NX0A 5DANA 4DF2A 2WNNA 4UTUA 4GUHA 4ZB5A 4MVAA 2WNQA 1TPC1 2RAGA 3W7DA 2VFEA 1GKPA 1I75A 3UW6A 2X8GA 3TW6A 4HMNA 3LV5A 5HR6A 1H62A 1V02A 1XHGA 2ZVIA 2AQWA 1X7IA 2JGYA 4NYUA 5KTLA 2WOWA 3GZ3A 5HR7A 3JU2A 3WQFA 2X8HA 2P8CA 5D38A 2ZKMX 3A7UA 3TAKA 2JFEX 1QTWA 2XIQA 3VFLA 2GJNA 4DX3A 2NQLA 3DDMA 4N4PA 3DHDA 4W8BA 1VGAA 2HS6A 4S3JA 5D09A 3SQPA 1EA0A 3N17A 1M6IA 4FOJA 4DUVA 4UZSA 1GEQA 4H8UA 5KZ6A 3N6JA 1CDGA 4Z2LA 4WLCA 1UD8A 3BJSA 2FTWA 1FHVA 3NZRA 2BBFA 1SFSA 3QMRA 3EDJA 3CMFA 1J4EA 2AL2A 3PJXA 3QKZA 5FSDC 5A6BD 5I06A 3W38A 1XDMA 4GE8A 1B4EA 1DIKA 4XVDA 1J10A 1JYVA 4XZNX 3M7WA 1TO3A 2FPYA 4EWJA 4O1EA 1MXSA 3DAQA 3CB3A 2W0HA 3V1PA 1H2IA 2BWGA 2ALRA 3NVZB 3RCMA 4ZO6A 2I57A 4UTWA 1LQ2A 2YFOA 3CZ8A 3CXBA 3A23A 3KWXA 3LM7A 1QXLA 1XV8A 3KAOA 3WNKA 3FEMA 2ZUMA 3VXGA 1J2WA 2DV0A 2OYKA 3MYOA 4CU7A 1SYTA 3L4YA 3CZEA 3U7VA 2V2CA 3BARA 4BI7A 4AF0B 1LDCA 3CQHA 2OEKA 1P6CA 3P5YA 1E9YB 1JGIA 4B4FA 4GJ1A 1JR1A 2G4FA 1K6AA 3IJ7A 4ZQRA 4CVUA 3NO5A 1CENA 1D3HA 2WSYA 4ZODA 2YW4A 1I2NA 3VGBA 4WHBA 3V1HA 3VK5A 3L23A 2ZZ2A 1LQ0A 1KB3A 2VVSA 3EDKA 1GQNA 3URNA 4RNIA 3PR2A 3SECA 4YYFA 2SFPA 1GXFA 2QVNA 3CIXA 3TR2A 4ZQOA 4QS5A 2E6DA 3W1TA 1TV2A 1M01A 1PDZA 2PBOA 5KINA 1YBQB 1UOKA 3WLQA 1OD0A 2XWEA 2YB1A 3AZTA 2D22A 3FCPA 3QN3A 3TJLA 3M07A 3I6RA 1G69A 2VEPA 3AMGA 4LYKA 4GNJA 3ZLGA 3LLFA 4YTUA 3LENA 3BLEA 4UFMA 3TYZA 4MOZA 2X42A 4JOMA 5LNUA 3FJ4A 3KBSA 2VRQA 2HDJA 1G5AA 4W7UA 1TSIA 2AQVA 1AUSL 1BWLA 1Q7QA 2J7CA 1Q45A 5JCIA 3NVTA 4L6OA 2FTPA 3KX6A 3GQYA 2PGEA 1EGZA 3TCEA 3PTDA 2R1PA 1VHNA 4B2DD 2A7RA 1RCOB 3S5NA 2WCSA 3STPA 5JH1A 3RJYA 3MKCA 3FV9A 5FKYA 2GUUA 4L56A 2UY2A 4WSHA 2YCIX 3MCNA 4HGXA 4JIEA 3AIQA 4QR6A 1JCNA 4AH7A 3INPA 4Q6JA 4ES4A 4Y2WA 5I09A 1J6OA 1QNVA 1A5UA 3W26A 4O14A 2VR5A 4JTEA 1P48A 1Q2RA 2VXNA 1VPQA 2YR1A 1S39A 1F5ZA 3L65A 2PS2A 1XKJA 4GABA 1KFEA 1GOWA 1V4YA 4PMVA 3T08A 3GH7A 1E0VA 3L4WA 5CLTA 3CB8A 3DI0A 1NFPA 5GPRA 4B91A 2CKRA 1R30A 4QTGA 3NZ1A 2OLAA 2VUYA 3NYDA 4GQGA 1FWWA 3I6EA 4GFIA 2YXGA 3TOPA 4IJBA 4XWUA 4X60A 4Z2HA 4QDPA 1DJZA 1REQB 2PWVA 3BLIA 1TCMA 3PZVA 3ES8A 3ANYA 4LQ1A 1VFMA 3ZWSA 3OU8A 4M8UA 5CG0A 1LL7A 3DFNA 4KEUA 3O0KA 1JUEA 4UTHA 2QULA 5G2IA 1S5NA 3VZZA 1N61C 1P0BA 4WRHA 1ONEA 3WIJA 1HJQA 3ITVA 4H4YA 1QU4A 3CUIA 2YLAA 2HVMA 4FDCB 1ADDA 1MEWA 1FWHC 5D9MA 4B5WA 3VIGA 1H0IA 2BMBA 1EOKA 3QJAA 1V7AA 4KH2A 2XIOA 5HATA 2B31A 3CM4A 2AAQA 1F3XA 1DPMA 2J4GA 3CQKA 4BWLC 5DMNA 3B04A 2A3LA 3RO8A 2CLMA 3O6CA 3EB3A 1GHRA 3OVGA 6PTDA