4HCDA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 384
sequence length 384
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hcdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hcdA01
2PTXA 3CXOA 3S47A 1MDRA 4H2HA 2GSHA 3OP2A 3SN0A 4DHGA 3IK4A 3UJFA 4GYPC 2PTYA 3Q45A 3RGTA 2GDQA 2POZA 4ZCWA 2PP0A 3MY9A 3MSYA 4IL0A 4H1ZA 3RR1A 3N4FA 1W6TA 3CT2A 3N4EA 3KUMA 3H7VA 3K1GA 3CB3A 2AL1A 3P93A 1KD0A 3V5FA 1RVKA 3GD6A 3I6EA 2FYMA 4IP5A 5FJRA 4DWDA 2PODA 3STPA 3T6CA 4A3RA 3SN1A 3CAWA 4Z17A 3H12A 2FKPA 2QQ6A 3ZVHB 5FJOA 2QJNA 3OTRA 2AKZA 4KPLA 3QTPA 3VCNA 2MUCA 2PCEA 3TWBA 3MUCA 4GISA 4G7FA 2XH4A 4H83A 3RCYA 3TTEA 3UJ2A 2PP1A 4JN7A 1JPMA 4J3ZA 3MWCA 7ENLA 3T9PA 5ENLA 1DTNA 1EC8A 1PDYA 3BOXA 3UJSA 2QJJA 2AKMA 3VFCA 3OZYA 3UJEA 2PA6A 1IYXA 2PP3A 3TJIA 3QKEA 4E4UA 3RITA 3MQTA 4H19A 4KWSA 2OZ8A 2OO6A 3UGVA 4G8TA 4YWSA 4E6MA 3GY1A 3PK7A 4KEMA 3P0WA 1R6WA 1MUCA 1EC7A 2XGZA 3T4WA 1TZZA 2P8CA 4MGGA 3TJ4A 3VC5A 1P48A 4HN8A 2GGJA 3FJ4A 5BOEA 3OZMA 3NZGA 3ZVHA 3UCCA 3VA8A 2PTWA 2ZC8A 1EBHA 3N6JA 4K8GA 2QDDA 3S5SA 1BKHA 2HXTA 3SSZA 3FXGA 3IJLA 1XS2A 4GGBA 4DXKA 2PTZA 2OQHA 3JW7A 3R0UA 4IHCA 1L8PA 2GL5A 5FJUA 4MMWA 4GYPA 4EWJA 4HYRA 3P3BA 3ES8A 2OKTA 1KKOA 2CHRA 5FJTA 3DERA 3QLDA 4DX3A 4JN8A 6ENLA 2OLAA 2XSXA 4GMEA 1SJDA 2I5QA 1E9IA 1P43A 2PPGA 3NXLA 3PFRA 2HXUA 4A35A 2OZ3A 3R25A 1TE6A 4K1WA 3MZNA 4ROPA 3TQPA 2ZADA 1NELA 5EU9A 1XPYA 3R11A 1R0MA 4E5TA 3IJQA 2PGEA 4A6GA 3MKCA 3NO1A 3EKGA 4E4FA 3HPFA 4GGHA 3H70A 3DG6A 4HCDA 3SN4A 1NU5A 4ENLA 4GFIA 3CK5A 3PWGA 3VC6A 3V3WA 3SBFA 3QPEA 1OEPA 2P8BA 2XH2A 3VDGA 1FHVA 3R1ZA 3VCCA 2DW7A 3DG3A 3OPSA 3RRAA 1WUEA 1MRAA 2OQYA 1F9CA 3SJNA 3FYYA 2OZTA 3GO2A 3TOYA 3I6TA 3OW1A 3UCDA 5FJPA 3ZLHA 3DIPA 2OG9A 3UXKA 2PSNA 3IJIA 3DESA 3BSMA 3DFHA 3DEQA 3DG7A 3ENLA 1ONEA 1JPDX 2ONEA 2PU1A 2PU0A 2QGYA 4IT1A 4HCLA 2HZGA 3DFYA 4KT2A 3THUA 3FVDA 3U9IA 2GGIA 2AL2A 4IP4A 1MNSA 4DN1A 1KKRA 3H8AA 2QJMA 3EEZA 3PWIA 1WUFA 4J1OA 2NQLA 1BQGA 1JDFA 3U4FA 1ECQA 1TKKA 3QN3A 2OPJA 3TCSA 3ES7A 1EBGA 2PGWA 2QVHA 3T8QA 5BOFA 3ZLGA 1PDZA 4E8GA 1KCZA 4JHMA 3SQSA 2OX4A 3GC2A 2P0IA 2QDEA 2O56A 3RO6A 4HPNA 1EC9A 4HCHA 2AL2B 2HNEA 1MDLA 3B97A 3NFUA 2PMQA 2XH7A 4IL2A 3N6HA 3I4KA 5J04A 4FP1A 3D46A 4F4RA 3FCPA 4GIRA 4K2SA 2RDXA 3UJRA 1YEYA 3BJSA 2GGGA 3UXLA 4HNCA 4M0XA 1ELSA 3DGBA 3ZLFA 3JZUA 2MNRA 4HNLA 3R0KA 4FI4A 2GGEA 4MKSA 4X2PA 3ZVIA 2DW6A 2P88A 4Z1YA 2PS2A 3V4BA 1SJCA 3Q4DA 3CYJA 3D47A 2P3ZA 2OVLA 4M6UA 5IDZA 2XH0A 1SJBA 3DDMA 2GGHA 1JCTA 3TWAA 4DYEA 4IZGA 4ZA0A 3JVAA 3FV9A 3V5CA 3TW9A 1FHUA 2OFJA 1SJAA 3R10A
chains in the Genus database with same CATH superfamily
1G4PA 2YCLB 4O16A 1KLZA 2X1TA 3BH4A 1CIUA 5HQLA 1MDRA 1EJXC 2DT3A 3O6YX 1RHCA 3W02A 3B9OA 1E4NA 1QPNA 3G6LA 2DZUA 1KM1A 2E3TA 4Y6GA 4BF9A 2W27A 3ANYA 4JL1A 3GBEA 1OGGA 4XISA 4PRWA 3VK5A 3IIVA 1M7JA 5DY2A 1TIMA 3KOXA 1X2HA 4UNIA 3PN8A 4AF0B 1KM2A 3DC0A 3GD4A 3KZSA 1C91A 4MFEA 4WR3A 3UT0A 1QI4A 2MANA 1Z42A 1ENUA 5DXYA 4FNSA 3CL7A 1WDSA 2X40A 4JCLA 4URIA 1EPXA 2ZKMX 3L8KA 1OYAA 4GX9A 1EF3A 3G8EA 4L4PA 5I03A 1OVDA 3ZS4A 3CT7A 3WCZA 2X42A 1UW9A 2J9YA 5I02A 1VFTA 1CLXA 4KW2A 2EG8A 4C6OA 4D8ZA 2EJ1A 2RABA 1GKQA 4MWAB 4QJ1A 3KBVA 5C8BB 3NQDA 5ENLA 2JGQA 4L9ZA 2XJ7A 2OQLA 1UC4A 3V16A 2HNHA 5HANA 5F1VA 1R3WA 1HZYA 1B90A 2C6QA 1V0MA 3WF4A 1IYXA 3TJIA 3G1XA 5AOUA 2QCMA 2D3NA 3Q65A 1EPVA 4WRHA 4G56A 1EH9A 1I1XA 1ZX9A 2WBGA 1JPKA 4OIFA 3VO0A 2Y7DA 3UQNA 1LM1A 3ERPA 1PTGA 4KMQA 1GT8A 3D3FA 2ZX8A 1XYLA 3WLIA 3ARVA 1EP2A 1U2YA 1KO0A 2H8XA 2D2GA 2P8CA 4ONVA 4E38A 1XLDA 1TJ2A 3F03K 2VEKA 5LNSA 2E6YA 2QNEA 3L68A 2CFYA 4FOKA 3PHAA 3VNJA 2EF9A 4H4PA 3N18A 4K8GA 2QDDA 3TMLA 2V5JA 4KFPA 4IG2A 1SR9A 4F2UA 1JJKA 4FX6M 2PLCA 4N9EA 3D0CA 3QR1A 1L2QA 1FP9A 4IGNA 5FACA 2WNWA 4MJ2A 4HZ6A 3AISA 1UR4A 3M0MA 3DFSA 1O6IA 3LENA 3QHOA 5H8PA 4WQ6A 3P8IA 4BQ4A 1V6WA 3EWXA 3B8DA 5GQBA 4AXKA 4WCJA 1SJDA 1WDRA 2ZE0A 4NL1A 1W3IA 1YDYA 2PPGA 4MLRA 3NXLA 3WQPA 4H8HA 2VC9A 4WKHA 2OZ3A 4IIGA 2HRWA 1XLAA 4AZCA 1VPXA 3T0DA 3H4WA 3MZNA 4PMXA 1TE1A 4ICMA 4GFSA 2DORA 2CFFA 4XO6A 2VC6A 3LB0A 5LGZA 2C0AA 1R0MA 1B30A 1QFEA 4GZ7A 1H4PA 1QHPA 1UR1A 4XKYA 4ORIA 4DZAA 6TAAA 1Z7AA 3DUGA 2C19A 4P7RA 1P0BA 4LQ1A 3H53A 3M47A 4JTCA 2BY1A 3V3WA 3TYUA 3EXTA 4IMGA 4W8AA 3LX9A 3L5MA 5A6LA 5A6TC 2PURA 3EWCA 5D32A 4H8NA 4R27A 3W74A 3EZ4A 3TTYA 2J6VA 4EXAA 2ZXDA 2WPFA 4S1FA 3GIYA 1DE6A 3HQOA 1K3UA 1SSGA 4XKMA 2E77A 3EMZA 2DU2A 2G41A 3A7AA 1BWLA 4HOXA 3KOYA 1UZ4A 4A3HA 1KFCA 4PTWA 4H4TA 2ZFAA 1DWIM 4ML9A 2VWTA 4U4MA 5ABFB 1V59A 1WDDA 3QHNA 4TX6A 5C55A 5GNXA 2ZZBA 3NQ8A 4H9YA 1R7AA 4UMAA 4HPGA 4PL2A 1RK5A 1FXQA 3W84A 3NAVA 1XM3A 3CZGA 3SECA 3WQVA 1XWYA 1WUFA 4XO7A 1JVNA 1WKYA 4PBEA 1UR2A 4IM4A 2IUZA 1NFGA 2OOFA 3AIQA 1G94A 1BD0A 1O1ZA 4EF9A 3TE9A 1JUBA 1E6ZA 2PUZA 3NL3A 5LIKX 3W1AA 2FPVA 2YBTA 3UZXA 1QMLA 5E5CA 2W9MA 5DELA 4Z2JA 1VQZA 3N9RA 2Y70A 1EFZA 1JIBA 2X30A 3PJWA 5DMMA 3P81A 4EPBC 3W70A 3EMQA 1XLCA 3LI0A 3TYZA 1THFD 3V18A 1QNPA 4UOZA 1H50A 1KBBA 1XPGA 3I4KA 3PZ9A 4FP1A 4PMUA 4H4YA 2RDXA 1XJBA 1UUOA 1S2WA 3QYQA 4WIWA 4YVPA 3NQ6A 1UD2A 2DY3A 5AZ0A 2MNRA 1K4GA 5C6MA 1Z8AA 1V08A 4WLCA 1XBVA 3UWWA 5D09A 1P1MA 3AFBA 4NF7A 1UH4A 2FZ8A 3VNKA 2P88A 4GQ0A 1P6BA 1QW9A 3AXMA 3WFLA 1LRQA 2EXOA 3QZAA 3U5UA 5FCZA 1VBGA 4DAFA 2FMOA 2YIHA 1X38A 4N9BA 2E5BA 4W8LA 1XGZA 3PPGA 2EPOA 3FV9A 5I00A 1XIMA 5TIMA 3V5CA 6XIAA 5GJPA 1R30A 4NY2A 2JKPA 4B5VA 4BHYA 2PTXA 3DFOA 1KXQA 5KITA 5KVIA 2CETA 3LNPA 1FP8A 4LT9A 4H4UA 1VHCA 3KE0A 2R24A 1UH2A 2VDGA 5CQ1A 1XH0A 3BLLA 3VIJA 3W73A 2PTYA 3LLXA 5A1AA 1HVQA 3ITTA 4P8WA 2WMHA 3QY8A 1H5YA 1VCFA 3VCRA 1UWIA 4JEQA 3RU8X 3RXZA 1E73M 3CMGA 4S3GA 4QG9A 4YCPA 3P14A 3TN5A 3W76A 8RUCA 2GQ9A 4F40A 4JYDA 1TPWA 5EBKA 3LN3A 4NI8A 5H6HA 3R8RA 1ZMCA 4LCSA 4AH7A 2ESCA 4LUJA 2D24A 1GJUA 3OLGA 2GQWA 2GVGA 3I6EA 3BK0A 3Q94A 4QE4A 5DMYA 1KGUA 3P67A 1U5VA 2QQ6A 3P74A 3M46A 1VYRA 1OCNA 4N02A 4PCNA 1J2BA 4TR9A 3UG5A 1JEZA 4JKMA 3RO8A 4DUWA 1W8GA 1S1PA 2FZDA 4GKLA 3TWBA 3TTOA 3NVYB 4KIRA 1GV4A 4G7FA 2XH4A 1XHGA 2G95A 5EBAA 3PBVA 2ZX5A 3MUIA 1RP8A 2J3NA 4K36A 3ABSA 5FF4A 1UKSA 1UG6A 3IK2A 2BGSA 4Z2HA 4TMCA 2GUUA 1FFUC 3L2MA 5U4NA 4A3YA 4DJEA 4QBXA 2VCBA 3F2DA 1GETA 3LUTA 1US2A 2HMCA 4GYFA 1UZ1A 2BHYA 1W1YA 4H2CA 3L23A 1LL7A 2BTMA 3KZPA 4DWSA 2GQAA 2D1ZA 1DPMA 3M0HA 4HA3A 3DH9A 3A5FA 3TC3A 2A3LA 1K9FA 1QBAA 2C3DA 1OIMA 2PI6A 2XGZA 1SUXA 3BAJA 1AMKA 3QF0A 1EJTC 4CNUA 3S46A 3WH7A 3UZZA 4UWMA 3TA9A 2WMKA 4Q8UA 4GO8A 1K7FA 3PULA 2QUNA 3DKJA 5E1QA 5JUVA 4PRTA 3QM3A 1C93A 4PTXA 3VDCA 1CCWB 2GOUA 2NVDA 4KFOA 4Q6XA 5HPOA 1BPLB 2DUAA 4L65A 1X7FA 3MI3A 1VLWA 1LQAA 3I65A 3UCQA 4S2CA 1ISVA 1KQZA 2CZDA 1PZ2A 1NQKA 2F6XA 4OZOA 1BQCA 2UV8G 3TIMA 1V0KA 3L65A 5IBXC 3E0VA 3W1UA 3GQYA 4O1DA 3BDKA 1W1VA 3NQCA 3GVVA 4PFMA 1Y5WA 1EYWA 2I5IA 4HN4A 3E0LA 4GVFA 3VKJA 3BWWA 1JYVA 1KRMA 4O1CA 1BSLA 5A2BA 1UMLA 5KZMA 1G4SA 2G8ZA 5TAOA 2J7EA 1UC5A 2WSYA 4UTKA 1JZ4A 3R8GA 3WBWA 1GQIA 3SCUA 6CGTA 2PDWA 1HTIA 2YXXA 3WJSA 3AM9A 3C2RA 2FIQA 1OGBA 4LH8A 4RNIA 2J66A 5F4XA 3EOUA 1KLYA 4PN2A 4GIYA 3LTYA 3GXNA 4CVUA 3SEPA 2OLSA 1DV7A 4H6QA 3SCOA 4CN4A 1H5VA 4YTSA 2CYGA 1WBJA 4ICCX 3AJ7A 1AUSL 4O14A 3VAVA 2XM1A 2G3FA 1J0ZA 3NG3A 3DEQA 2H9AA 9XIMA 1BGAA 4W84A 4EXBA 2F7FA 3BLKA 3CWNA 5C7VA 1V6TA 4O0QA 3DENA 4KH2A 3VM5A 4UFJA 2BCPA 1TPEA 2ZZCA 3O8AA 1KFJA 5KVHA 4DPQA 1HQTA 1MNSA 3G1RA 4H50A 3LHZA 1RSCA 1IZCA 3DHUA 5K9XA 3NNTA 1W9UA 4J1OA 4DBEA 3K2GA 4MNLA 4RPPA 1QXLA 1EA0A 3ITGA 1PPIA 1W3LA 3QN3A 5AYYA 2XPKA 2QVHA 4QDPA 1K8CA 1ZBKA 2JK2A 2EO7A 4NZ1A 4JHMA 4DZIA 1ZS2A 4HTBA 3MDUA 4QTGA 1EDQA 3R8HA 3B0PA 4DXXA 1PTDA 1WDPA 1UR8A 4HD5A 4ATLA 1QNSA 3PZQA 4HPNA 1VKFA 4HCHA 4JIRA 2NSOA 3QFEA 3VI2A 3BL3A 3KCJA 4Y8FA 1AD1A 1XG3A 4GIRA 2PTDA 4ZQOA 4GD0A 4ERGA 2Q3RA 5ABTA 1MMFA 3LHUA 4Q8OA 2DZTA 5A6KA 1KC7A 1VCGA 4ZTYA 3S3GA 4LA1A 5CAKA 3AWNA 3CMJA 2FVKA 2BOFX 2D22A 2UBPC 5I3FA 5D2XA 4J40A 4JPGA 3WBYA 3QW4B 1HKVA 3CIVA 1JPHA 1W1A1 2XWEA 3EKLA 3IGXA 4HHPA 3B05A 1E4LA 1SJCA 1J0HA 4N7QA 4RE4A 1DJIA 3M7SA 3STGA 2GQ3A 5EBUA 3S5YA 1FFRA 4LW7A 3N15A 3UXDA 3SCQA 2Z4GA 1CNVA 3ZO9A 1H7WA 1WAUA 1XKYA 2OSXA 3HO8A 1GRTA 2F9RA 3FG2P 2P1FA 2VEMA 3TW9A 3CH0A 5D37A 4EQXA 1EB3A 1YDOA 5G5IA 3WBAA 5CPNA 1T96A 3W1XA 4INFA 4Y9PA 4X60A 3UXIA 3ALFA 1VGAA 2ZZ7A 2DQWA 1YTEA 3RGTA 2VXNA 2DSVA 1XFBA 3N3TA 3MY9A 2VEGA 4Z08A 3RJXA 3C3NA 4C1NB 1RP9A 1XLMA 5A8GA 5B80A 1ZMDA 4IL0A 4NNCA 3NYDA 2PDCA 4FF7A 4GI8A 1LUCA 4HIBA 4Z2KA 5DT5A 2WPCA 1JDAA 1V8EA 4RCXA 4FLSA 4QJ4B 4QX4A 4H4IA 4BURA 3GNXA 4HA1A 1DOSA 1OFAA 3P2VA 3PBUA 4PB3A 4DLFA 2BWGA 4EPKA 1JROA 4IXHA 4E3VA 3OTRA 4EIVA 3TC7A 4GJIA 2PD5A 3VDHA 4HPXA 1JRPA 4TV6A 4CNPA 2ZBTA 3AYSA 1RALA 2E25A 3W29A 1EOMA 4GYJA 1LOQA 1TV4A 3QMRA 4J3ZA 2EPLX 2DT0A 2XVNA 1TWIA 3ITVA 2EEXA 4N6EA 1KM6A 3EGJA 2JKAA 3EPMA 2XVKA 2VVNA 1EXBA 3UJEA 3S9IA 3CV6A 2X99A 3ZT7A 3DGZA 4AFYA 1SVDA 3VD3A 4LEFA 2FVLA 1DORA 2CBUA 2ZUVA 4UFHA 1QRQA 5GNYA 3G6MA 4UTUA 4P7OA 3WDRA 3GC4A 3M4HA 3SQLA 1M3UA 3N9SA 4PMVA 1I0DA 1ZTVA 5CC7A 1HX0A 2DH3A 2EG6A 4REQA 3GH5A 1CW2A 3WH5A 3ANUA 3OZMA 4HP5A 1WB0A 3KWSA 2VHLA 4IMAA 3WUBA 3PFMA 4JGDA 3PUEA 4AIOA 5FL1A 1E3ZA 3VOJA 1DWAM 2EPHA 4DXKA 2GR2A 3R5EA 1GSNA 4FZIA 3NM1A 1NAL1 5XIAA 3P3BA 2VX4A 4XZ9A 3TV8A 1UA3A 3SY1A 2CHRA 4LAKA 5FJTA 4O18A 3U3HA 3M0VA 4MDOA 5EMKA 3PZIA 4JN8A 1ZENA 2XSXA 3LGEA 5A8MA 1R9ZA 3EX6A 3ZT6A 5I24A 3SUVA 2HWGA 4DZHA 4XTIA 2QLYA 4S23A 1QOQA 4YTQA 1XL9A 2Z1SA 1GREA 1EIXA 1TR1A 3E6EA 4BKNA 2YB1A 4PSPA 4HJWA 4HSNA 3EDEA 1VYSX 3URHA 1H0GA 1D7KA 4L6HA 4ZQMA 5I3IA 4ACZB 4HNVA 1FFQA 3KOFA 5HWMA 3PTKA 4JL2A 4E2BA 2YLAA 4GUIA 4F0RA 3ZM8A 2NQ5A 1XD1A 3RK8A 2HS8A 5LGXA 1RK6A 1W8SA 2L5HA 4NJGA 3NPWA 2E68A 4NNBA 1E15A 3VCCA 4FNUA 1OX4A 2NT1A 2AQOA 2W54A 2NVCA 4KETA 4IIDA 1MRAA 3R07C 3EDKA 1OFDA 3CUJA 5D2YA 3BMXA 2WJFA 3URNA 5CBIA 3KLJA 5D30A 2J47A 3ARRA 3ZJKA 2QHAA 3BAKA 4TVDA 3G1AA 5FJIA 4JX5A 4LC8A 4M7SA 5HMSA 2VR4A 1PCWA 4PCSA 3IJIA 3TW6A 3RN6A 5A3HA 1UUQA 1CECA 3IJDA 3THDA 4LVFA 1OADA 3E0IA 1Q6QA 1LL4A 5FIPA 3GXMA 1UWTA 3CHDA 1GKRA 2HZGA 1OZQA 3DFYA 4RLIA 3H2EA 3K4AA 3SSJA 1EO7A 1X6NA 4TOQA 4A4AA 2BMBA 1F5ZA 1FKXA 4IP4A 4DN1A 3PZUA 3TA6A 2VGBA 4GYKA 1XH1A 2G50A 4J3UA 1TKKA 3TYAA 1FQ0A 2XUCA 1ZCCA 4JDBA 1QOPA 5JXQA 4LCRA 2ZVRA 4MKNA 4FMVA 3TYBA 1GVOA 4I5XA 1KGXA 3IJ9A 3W25A 3S5OA 3FW6A 3VGBA 1PVNA 3IJ6A 1ISZA 1I45A 2PCQA 3EUB3 1XSIA 1DWFM 4J2MA 2CEQA 3GHSA 3QV6A 5EFFA 3D46A 2YBUA 3CQIA 1UHVA 1W56A 3QV8A 4LUYA 3K46A 5T91A 5AKQA 4EANA 3BJSA 4CQAA 1KN0A 1ELSA 3LXCA 4GQRA 4QM1A 2IKHA 4PMOA 3XISA 4M6QA 4BI6A 1AH3A 1OD0A 1REQB 4CLMA 3QOKA 4FI4A 4YU1A 5D9MA 3RYSA 1ZHAA 3BCJA 3W2UA 3U5YA 3QOMA 4XAPA 5FS9A 2W3RA 1MI3A 5CSYA 1V51A 4DYKA 3NZQA 3TFXA 1KTNA 1DIEA 3QGAC 1I2QA 3G77A 5D2TA 3BICA 4H8UA 3B0VC 2NQHA 5KZ6A 1BEUA 4DUOA 1EUAA 4CUCA 1QPOA 1KQYA 2NUXA 5E0CA 1C8XA 1TYTA 3GTFA 3MMUA 1DVJA 3C2OA 1M7XA 1X7IA 4PL1A 1S38A 3VZYA 5CLTA 1VP5A 5TBOA 1TV8A 3WLOA 1NM9A 2GWGA 5D9OA 5C7HA 1CWYA 1DXFA 1QJWA 2EPMX 3WMCA 1RQEA 3S0CA 1GEHA 2AMGA 5HAOA 2WMIB 1NVMA 2PDJA 1W37A 4AZGA 3KXQA 2Y5JA 1YTDA 3E0FA 1MQRA 1CGTA 1PAMA 4CQDA 4I9JA 3GDRA 2LLEA 4LGXA 3RILA 3VILA 4NJJA 4ZXLA 3ZWTA 3ABQA 1Q2SA 1KTBA 3NM3A 1NHQA 3WUFA 4GVHA 3PAJA 1B4KA 4W87A 2QW5A 4DI9A 4NSBA 4M1BA 3T6CA 3I3BA 2G3JA 3CM4A 3H4XA 3UZJA 4FO4A 1P7TB 2WOVA 1W5QA 2BGNE 4KPLA 1DJZA 3VD9A 3KL5A 5DLCA 3HZ3A 2CITA 2PBOA 4KGLA 3A3WA 4B92A 1RBAA 4KBXA 1EGZA 4C6FA 3CHEA 1BRLA 2XFYA 1BWVA 3KRZA 1TJRA 2CXEA 4GNJA 1ZRQA 3WNOA 1EDTA 3OVRA 1EX5A 2WMFA 1L2UA 1OSEA 2CKRA 3WDIA 3PZMA 2PD9A 1E0UA 1Q3NA 5G4EA 1OCQA 3WD0A 1TMQA 4AUBA 4XD3A 4PA8A 1WNOA 1FH8A 1TVPA 1O94A 1XGEA 1B3YA 4S2BA 4AWSA 2EQ9A 2XIIA 1I0BA 3OYXA 2A3BA 4EPDC 2F8QA 5LIXX 1VLIA 1TSIA 4HNOA 1TMHA 2QCDB 1ZFJA 4F8XA 3E5PA 3PJUA 5F2LA 7ODCA 4XAZA 4UTWA 3A3XA 3SDOA 1EGMA 1YIXA 1K8YA 1GVSA 3F4VA 3NZPA 1DWHM 4JICA 1XHCA 1M41A 3CB8A 1I4NA 3NZGA 5F2IA 3EPOA 3PANA 1DJHA 3FDKA 2ZC8A 3LM3A 1S5MA 3O06A 5LIUX 2OJPA 3WG6A 1GVQA 1AW5A 3UYIA 2FHCA 4XBSA 2PWGA 3SADA 1XUUA 2A8XA 4W86A 3SRHA 1VRDA 3T7VA 5AC5A 1HL2A 4MZYA 2GUYA 4V28A 3ITYA 2OOGA 1E0XA 2V0TA 1Y5VA 1CTNA 1E1FA 2WAGA 4GVGA 2ACRA 4Q8MA 2GR3A 2OKTA 1ZY9A 1FBAA 3SRFA 3KTXA 4HA4A 3VE9A 2WMJA 5LNUA 1WKEA 2Y61A 2PWUA 3BMVA 1CGYA 4I9AA 3PFRA 4HB7A 3B8IA 4ZB2A 4NAFB 2OWWA 2DQXA 2Y89A 2NW0A 3PJTA 3ZYZA 4IJCA 4MB4A 4O1EA 1YDNA 2HPIA 2FZNA 2NV2A 1A5CA 1XIGA 4E5TA 4EXQA 5LSMA 1ISYA 5MKGB 6PTDA 4Q6JA 1IZKA 1M04A 2PDXA 2NX3A 2WVVB 2GR0A 1UWSA 5HOSA 4GRSA 4US5D 4LYQA 4IX0A 3LADA 1W1B1 4MIMA 3CUGA 4HSOA 2YYUA 3VDGA 4BA0A 2DIJA 5I5RA 2XU2A 5MF5A 2QDGA 3S4TA 1DTUA 4LEQA 5LA0A 3RF9A 4OBRA 4E8DA 4FR1A 3WBEA 2ZZ6A 1W3NA 2Y0FA 3G0UA 4LJ3A 3A5VA 4XV0A 1DNCA 2A5HA 1JG9A 2J74A 3U7VA 3TOYA 2PDPA 3GTHA 1JI2A 5TF0A 2CKSA 5GRTA 1QHZA 4J5NA 3R79A 4MZ1A 1SZNA 4IMDA 1T6MA 2OG9A 4LWWA 4P61A 5HDRA 4LYRA 3DI0A 1X1NA 1ONEA 3VDBA 4ZXOA 3FLUA 2ONEA 1AG1O 3U6WA 1BVZA 3SZ8A 1NIUA 1Z32X 4PSRA 4NXKA 3SCNA 3LCFA 1ZY8A 3EEGA 4PMNA 1WO2A 3W2NA 1G6CA 1W32A 3THUA 4FNPA 2P53A 4C6CA 1QR7A 2XIJA 3SCVA 3QSTA 1ODZA 1VPYA 1RA0A 2DVXA 3WH8A 3NDZA 3MDWA 2TYSA 4E2DA 3S9ZA 2PC8A 2ZXAA 3W82A 1SR0A 3VKCA 1EBGA 5A2CA 1J0IA 1P1XA 4C7FA 1JRBA 5AC7A 1V3LA 1MOKA 1PZ3A 3OEXA 3DYMA 4O1BA 1BYAA 3BAXA 3KS5A 1KGWA 3LB8A 2J7BA 3EF6A 3A4AA 1TPH1 1ZAHA 2AL2B 3FN9A 4AAJA 3QW3A 1J11A 3W53A 3NFUA 1R3VA 1V0NA 2JIWA 4IL2A 5CJ5A 4AD3A 1IEVA 1AFSA 1O60A 4RKAA 1N55A 4M0XA 5A6AA 4A8RA 3LLDA 3JZUA 1H7RA 3CUFA 5CZJA 4IFKA 3WSUA 4HNLA 3SQMA 1VBJA 4QFUA 3RUBL 4OHQA 3AMDA 4MKSA 4LB4A 2POTA 1UKTA 2E5DA 2REQB 3UPMA 2OSYA 3URBA 1JEHA 4Q8WA 2H90A 1PHWA 2PLMA 4RDZA 4PFHA 3FJLA 3EAOA 2PZ0A 1EX1A 3W38A 2JEQA 5DCEA 3FAWA 5GJMA 1AL8A 1UQZA 4RX0A 1XCFA 3REQA 3TNBA 1MEWA 1KV5A 1NARA 4CNTA 1FCUA 4GQBA 3S83A 2E3ZA 3UERA 3M1ZA 4LALA 1DJQA 2YL8A 3QQ0A 2P10A 2WCGA 1ME9A 1E6PA 4HA0A 2GDVA 3GDLA 3AMCA 3WQWA 2Z1VA 5E6YA 1B1YA 3W1PA 5HBFA 4XZLX 4YTTA 3JZEA 4WX2A 4UUIA 1XR2A 4KIEA 1PCKA 3ZSTA 3LPFA 2VELA 1QK0A 2NQ9A 5JCKA 3GU2A 4LAOA 4CNNA 4UTMA 2D0HA 2OGYA 1LTDA 4GINA 3AS2A 1XLEA 4WJ8A 3RR1A 4AISA 1YTKA 1V93A 5EKYA 2PDGA 1Y5XA 2Z29A 3KOWA 4KPRA 1W0MA 3BMWA 3AXXA 4EPEC 3H7VA 3IACA 3BUVA 4AWEA 4IISA 2Z1BA 3NL6A 2ASHA 3K4DA 3UPBA 3EWBX 3STPA 2VENA 3FJ6A 1LRNA 3E1F1 1V3MA 1V7AA 4LIIA 2GSEA 5FMHA 4YJ5A 4YIWA 3OLDA 3VNYA 2GJXB 4EMIA 4XVDA 5I09A 3EWYA 2DJXA 1LLZA 2X8GA 3MCOA 3A7RA 4WDTA 2VRJA 4YLWA 2PP1A 4AZHA 4FX9A 1N60C 1XF0A 4YHEA 2AGKA 3MVTA 2IKIA 1KB3A 2A0NA 2WSKA 2YCLA 3TROA 3GRTA 1BF2A 4O50A 1MNZA 1FEBA 3V0UA 4AVFA 1KM0A 2JKEA 4S39A 1Q6EA 3EOSA 1VIWA 1C8YA 1E56A 2QPXA 2A1YA 1TFVA 2XFRA 1HJQA 2PWVA 3MV11 1FWCC 3B9EA 4AF0A 3G5EA 4JQ1A 3RLHA 4Z0JA 3OVQA 2Z6IA 1QPQA 2CHOA 2WKJA 5H2ZA 1AOGA 1KXVA 4F2TA 4H4ZA 3L5AA 4G1NA 3PNUA 1J0JA 1PUDA 1W1PA 2GGJA 1GEQA 3HN3A 3I7QA 4IMEA 3QMTA 4Z1AA 4FR6A 2O9TA 3ZR4A 1WPCA 1XRSA 1TWZA 2I1OA 1E5NA 4TUFA 3FXGA 3BANA 3HGOA 3RMEA 2EG7A 4W7WA 4D6CA 3R89A 2Z2UA 3CQKA 4PMQA 1M68A 1E6NA 4C7GA 2FB2A 4C6EA 2VL4A 3KWXA 4S3JA 1LYXA 5IM51 5FJUA 2WC4A 1VFLA 1W3JA 4O53A 4F48A 4Z2GA 3ES8A 1IXOA 4IPIA 2E8YA 1Q7MA 4TIMA 1E4MM 4J4KA 3H26A 3TYCA 2GQ8A 4ICNA 1CEOA 3LPOA 3WK1A 2G37A 3M5XA 3V0TA 4WXZA 4JDYA 1RJQA 1XSJA 3U57A 3W75A 4N42A 4IMFA 5BROA 1SMDA 2ABBA 1KFLA 1FCVA 3ITXA 1E5JA 4LAMA 1F3WA 4RZ4A 3TONA 3TSDA 5JVLA 3CPRA 4E0CA 2V2CA 5IBXA 3C0LA 2QV4A 2VX6A 3P6LA 4G5DA 1TTJA 1KFKA 1RV8A 2VFEA 3IAPA 3FEQA 3Q2DA 5HUOA 3FEMA 2DSWA 1NDAA 2HQAA 2PDMA 2VZOA 3WDPP 5GVJA 1MW2A 1DHKA 1J79A 2W3SA 2FPTA 2Z6JA 4XD6A 1UR0A 3PBGA 1R46A 2ZYFA 2BX7A 3W7IA 4TMBA 3ZJ6A 2XZ7A 4AIBA 4B90A 1QWKA 2J78A 1FFVC 2CWXA 4DUVA 4NP7A 1JL8A 4LYPA 3DFHA 5CJNA 2D2OA 2DZVA 4QCFA 3G3MA 4YVVA 3EDDA 3E38A 3T44A 1JZ6A 2EKCA 1YNYA 4DJFC 3LEPA 4WVXA 1FWGC 5F4WA 5G1MA 1JDFA 3JU2A 1S5NA 3VM7A 2OPJA 3ES7A 4NAEA 5CSUA 3BOFA 3E49A 3QV9A 2QPSA 3WQDA 4HNNA 5ABGA 4KGJA 1KCZA 1WV2A 3OQEA 5ABHA 1AMYA 4FS9A 5E9AA 3T42A 1N2VA 1P6WA 3GKAA 2OYMA 5D9PA 4XZBA 1XLGA 4B3ZA 3SW6A 5D33A 2XIOA 3TR9A 4JCMA 1X8CA 5KEZA 1FWRA 4OUEA 4DJEC 1OM0A 2OO0A 3UVAA 4M80A 4PCFA 3ZLFA 1U33A 1FEAA 1TVLA 2GVLA 3GDKA 5KINA 3N73A 2V5LA 4K8HA 5T9BG 2NXGA 1BLIA 2YJQA 5LXEA 4LS1A 5KMYA 4NZJA 3FSUA 1GVIA 5ABFA 4O10A 4AY7A 4S3FA 4GC4A 3TR2A 1DXLA 2QZRA 3CGCA 3QR3A 1LP6A 2Y88A 3W7RA 4J7RA 3V0SA 2CCRA 4DUXA 1MFUA 4Z1DA 4M6UA 2Q8XA 4NIRA 3WF3A 1WCGA 3OGSA 1GGOA 4DRSA 2PDUA 2RKXA 4AC7C 1LQ0A 3AIRA 5AC8A 1VH7A 1QAPA 3E2RA 3HBLA 2NXIA 2XN1A 2NVKX 2A7RA 1PTAA 3W81A 3AYTA 2FVMA 4QITA 1HW6A 3M64A 4FXJA 3TTSA 1YLVA 4MOZA 1EWDA 5JU6A 4XQ6A 1A3WA 1O5XA 4H4SA 3MUZ1 1WXZA 2Y62A 1KNWA 3GRSA 4YWOA 3A9BA 3UJFA 3N6QA 4JTLA 3UP8A 2YVFA 2Y5EA 3WQCA 2RHGA 3AJXA 3W7JA 3WNNA 3T0BA 2F84A 3C2VA 1KBKA 5K9CA 4CQ8A 4CVWA 1DHPA 1OHLA 4JOMA 4XAFA 3VPLA 1BG9A 3HRDC 2CLMA 3K8KA 1UBSA 3GS6A 7REQB 3PS7A 1DJXA 1RR2A 3BXWA 3S6OA 2AL1A 1PZ0A 1HJUA 1C7TA 3B06A 3IWPA 2WPEA 2J7HA 1XIHA 3NSMA 3GR4A 4Q3MA 4BQ5A 4K39A 3EANA 2QCFA 1KM5A 3CAWA 4IJRA 3LPGA 4LSBA 2E4TA 2PRHA 4WGHA 1E0TA 3QTPA 4UZSA 3IV3A 5LHEA 4K1GA 1QU4A 2Q6ZA 3L2LA 3H55A 1V6UA 5HUPA 4HOZA 3LK6A 3GE7A 1F3PA 1VIZA 2VC7A 2HE8A 1K4HA 2OGJA 1WQ5A 2UWFA 2DSKA 3P61A 3EAUA 4YWIA 3LM7A 4CN6A 2FQIA 1PDYA 2R1KA 4APNA 2HV5A 5BRQA 2J13A 2QJJA 4Z1CA 2EHHA 5FF2A 4F0MA 2XVLA 4F66A 3QKEA 4E4UA 3T8LA 2D0GA 2NZLA 2WNZA 1N8WA 1S2UA 1RM6B 1MZHA 4MFDA 3PB0A 4C6MA 4CD8A 1AH4A 3ICJA 4G8TA 2JF7A 1N8FA 1E9YB 4JN6A 2D2HA 4RDVA 3MI6A 4OGZA 1GONA 3F5JA 3WJZA 1V0LA 3WD4A 4ERIA 4B5SA 3UBPC 4ZVJA 3M7WA 3BLOA 3AALA 5HQEA 1DE5A 2KZHA 3A22A 2NV1A 2ZA1A 4AEEA 4XTDA 1HL9A 2ZIDA 3L0KA 5BOEA 1UD6A 4H4XA 2FTWA 3SAZA 3I6RA 3DYPA 1DIDA 3MSDA 5IXEA 5IHSA 8CGTA 2BXZA 2WM1A 3E02A 2DZSA 5HR6A 4AG0A 2YXOA 1RY8A 1OG6A 4PEEA 4J9JA 4S3KA 1XW8A 1XISA 1R38A 4MMWA 5D4YA 1OJXA 4HYRA 2BB0A 3G2GA 1KKOA 1UJPA 4LFYA 3CIXA 1TA3A 4AIEA 3PWAA 1H61A 4DQWA 2R1MA 3BE7A 1I8JA 2GJPA 4K3ZA 1WE5A 3W01A 3LGDA 2XIQA 5MHBA 2ISWA 3CUHA 4Y2WA 2FDSA 3UA3A 4JTIA 3TQPA 4JXCA 1AQFA 3GW0A 2ZADA 3GG7A 2AAQA 1ZGDA 2DDXA 4BR1A 2DT1A 3MKCA 3ARSA 3AU6A 1E71M 1VQTA 5F2MA 4GY1A 1BF6A 3STFA 4US5A 1J5TA 4B5UA 1XCXA 3L67A 3TMQA 5JQ9A 3RPTA 3VGGA 5ECUA 3CGTA 1K02A 3EWUA 1XDMA 2C79A 4ENLA 2UY5A 2PF0A 4FIRA 1GKPA 1GZJA 1SW7A 1JOAA 4FALA 4Q4SA 3TK7A 1HF6A 5XINA 2DZAA 3VVGA 3TYDA 1MWOA 5HXMA 3VD5A 3LDVA 3I7RA 4BCEA 4B15A 1OQFA 3N11A 3WLRA 3PBWA 3FJNA 3ZLHA 2ZA2A 1ZL1A 4Q33A 3PBYA 3HGSA 2PDBA 4IPPA 2PSNA 2B31A 2GDUA 1IEWA 3CEUA 4PUUA 2C0HA 1M1BA 3GR8A 2XIMA 3W1LA 1SZGA 3BQ6A 2PU1A 1S2VA 3UG3A 2GK1B 3NWRA 3ZR6A 1PX8A 1OT2A 3A13A 1BZLA 4KT2A 3FVDA 3QZ6A 4MNJA 3NS1B 3MCMA 3OVGA 3T0TA 5FL0A 1QT1A 2J9XA 5BXTA 3U2OA 4B5XA 2TAAA 4RNFA 5A5WA 5G4WA 1AJZA 2PBGA 4M29A 3W27A 5FS7A 3W9ZA 1ITCA 3M9YA 5BOFA 1LBLA 1PDZA 1ME7A 3K13A 2W61A 3DECA 1TB3A 3ZQ9A 4R9XA 4CEUC 2WB5A 3RO6A 4EAMA 2ZRVA 1ZZMA 4HK6A 1T0OA 3M0JA 5C5YA 3NSXA 4H4QA 2QF7A 1T5AA 4DJFD 2NLIA 2YCJA 1CX9A 3O07A 4O11A 3GUWA 1GHRA 2ZWYA 4PCTA 4N9DA 1MXDA 3AYVA 1M6IA 4XSMA 3LZ5A 2ZRUA 3INPA 2A3CA 1QNRA 3UPWA 3ONBA 1RJRA 5D04C 1AD4A 1ESWA 5BXRA 1JZ2A 3I68A 2X0YA 4UOJA 1VAHA 1GQNA 3MTWA 3IUDA 4DY1A 4EE9A 3OHMB 3GXDA 4NXSA 1LT7A 8A3HA 4W85A 2VYOA 1W3TA 3LTPA 1TPUA 1NPXA 1AJ0A 1QBBA 1SJBA 4DF0A 2WCAA 3HQNA 3A4XA 3S1VA 3LV5A 3P5YA 4AY8A 3NVWB 3TWAA 4ZA0A 3UY8A 2VFFA 3NVVB 3AO0A 3AS3A 4A3QA 2X0SA 5FS6A 3VIHA 4QEEA 5C9ZA 3WLKX 4LV9A 5I6SA 3U2ZA 4V1XA 1HJWA 1QTWA 3WZ0E 3S47A 4NRRA 5G4HC 1TUFA 1NDYA 3TJXA 2XFFA 1OY0A 2YA0A 4IFOA 4UC5A 3B9AA 4LF2A 3MYOA 1L6WA 4MPQA 4HHMA 2NUWA 2WZEA 2E40A 3Q45A 1HP5A 1PIIA 1Q13A 1S39A 1D3GA 3UFYA 1AJ2A 1YYAA 2IXUA 1U1JA 1XICA 3GDBA 1BVWA 1ICSA 1TYGA 5J5RA 4NEVA 4AZBA 4JYEA 1GJPA 1STZA 5DANA 2C7FA 2CLKA 1OYCA 1UWQA 5I3DA 1TWDA 4PUMA 4PMZA 2CWNA 1G7UA 3CTLA 5M1TA 3N4EA 1TIWA 1TRIA 4PE8A 2YFOA 3LSCA 2D20A 3RMJA 1XIBA 2DIEA 4PULA 3NQBA 3KP0A 2FGBA 1EZ2A 2RAGA 5CPQA 4F0LA 1NP0A 3BARA 2B7PA 1A50A 2OT0A 1IV8A 3PBMA 3TFCA 3V35A 3C0SA 3AI0A 3SN1A 2A7PA 1UASA 4H3DA 1LRTA 3UZ5A 4X0VA 2QJNA 2GYIA 3VCNA 4CCEA 3PZGA 4WDWA 3UXAA 1YE6A 1POKA 1X97A 1BVNP 4ADSA 3B4YA 1ZSXA 4QROA 3S8HA 4V27A 1T7LA 4D6GA 3GYEA 3RCMA 1NEYA 1QI0A 2EAWA 2WANA 4LY4A 2WW5A 4FDCB 3WFZA 4OV4A 4M82A 5DBTA 4NX0A 3T9PA 2OWCA 2VZUA 2X7WA 3M5ZA 3EWWA 4TQTA 3A9IA 1M7OA 3BV4A 1Z3NA 4GABA 1N7KA 3II4A 3KAOA 3B8WA 1FX6A 3N2MA 4AZIA 3J7HA 1A4LA 1C7SA 1M7PA 1R3YA 4RNJA 4YMZA 5HMDA 5M5DA 4UTJA 2J7FA 1T41A 5D38A 3NOEA 4C1NA 2V63A 1EDGA 5AHFA 4H19A 1TJ0A 3FVMA 4FNQA 3CYVA 2IPFA 4HZ7A 4CD4A 2GR1A 3A4WA 3OODA 4B5TA 2R94A 3NGJA 2ZDRA 1OYBA 1Q7QA 1E55A 1YPFA 1QVBA 1A5KC 4GNKB 4DNMA 2VVSA 3VU2A 4H4VA 2UZ9A 2YVGA 3VOFA 4MGGA 4NNAA 1JF5A 2BY2A 4YTUA 3JR2A 3NVZB 4MUZA 3TOPA 5K9DA 1F3EA 3ARWA 3AMZA 3NDOA 3NQMA 2CBIA 2E09A 3GNNA 5T9CE 4YCOA 4CCDA 1B3XA 1I2RA 1J0YA 5C2CA 4RW3A 2BXYA 4X63A 3RX4A 2C91A 3GU9A 2BLEA 2G3NA 2PLKA 1XYBA 3QGKC 3LZ3A 1XG4A 1AODA 2JIEA 2B81A 2O4MA 1NDWA 3H4KA 2V3FA 3UNDA 1XX1A 4I6VA 4GXMA 1ZCOA 2X0HA 2X05A 2O9PA 4IICA 3BG9A 3CPGA 4M5PA 4K38A 1V02E 1ISXA 4O1AA 4B5NA 4DX3A 6ENLA 1TVNA 1ONFA 4MYAA 4TVWA 5REQB 2WLYA 2EGZA 1XYMA 1XRVA 2QYGA 1GNXA 1W3HA 2Q09A 2AQVA 5IOBA 5HQMA 2J79A 1WZKA 4O28A 3LHTA 3THQA 4KF1A 3IARA 2RJHA 2YFNA 4GY7A 3KOZA 1ZAIA 2DEPA 1GRFA 3WQOA 1AL7A 4QS6A 1XBZA 3T2OA 3CL6A 3RIKA 3WLLA 1J4EA 3WLTA 1Z41A 3W72A 4EVZA 1TWSA 3HV9A 1XV8A 3FYPA 4WSKA 3W7PA 1VFSA 1LWIA 4Q8TA 5C2XA 3CK5A 1XDLA 5CAHA 5HMFA 4AEOA 8XIMA 5BNKA 3R1ZA 5CXPA 2DP3A 3RRAA 4XAGA 3VOCA 3IVUA 1CLVA 2WHJA 4UCGA 2WXDM 4GH3A 3URQA 1TO3A 3MV01 3FA5A 1GUVA 2A6NA 4H01A 4H9TA 3SUUA 2F6UA 3PZOA 5FJPA 3HPZA 4X9YA 2W63A 3DCPA 1KCKA 2Z7KA 2EQ7A 2OWXA 4JNYA 3MHUA 4C60A 2BC1A 4DBUA 3DG7A 3EWDA 1XLKA 1BG4A 3VZZA 5FKYA 4JTGA 2YDAA 1VS1A 3SUTA 3RNMA 4J3XA 3TVAA 2WZTA 2Z1XA 2ZRZA 3NYZA 2OTDA 3KW3A 4QG8A 3HURA 4YHGA 3NRZB 3IVTA 5M3WA 3TLLA 2VNCA 4MPKA 4FAMA 1XCWA 4UQ9A 4EX4A 1EJRC 2FZMA 1E6XM 2G3IA 4AXNA 4CNOA 3AU2A 3EB4A 3BLDA 3PAOA 1OIFA 3PM6A 3BW4A 2QDEA 5I0DA 3VYLA 4L9XA 1RBOB 4K68A 4Q4RA 4AYGA 3JRKA 1B5TA 4H6EA 1WYGA 1SZFA 3N6HA 5J04A 2TMDA 3TLQA 1GW9A 4L6DA 3FCPA 1DJYA 1KBJA 4NHVA 1QASA 4MM1A 3PUGA 3KBWA 4D8AA 3USBA 2A3HA 1LLWA 1YQ2A 3KBSA 1OFEA 2JF6A 3ECQA 1L6YA 1EJVC 2YDRA 4PMDA 2CW6A 2ZXQA 1CXHA 1KWGA 1SSDA 2VO5A 1VYPX 4RV3A 2C15A 5AYIA 2UY4A 3GG8A 3TQVA 4UTWC 3VD7A 2P50A 1NHPA 2VOMA 4H00A 4GCXA 1GOQA 3MKVA 2VCCA 4LVDA 1V03A 3CHCA 3M5YA 3TNOA 3HU7A 1GQJA 2O9RA 4HZ8A 1GOMA 2XHYA 4U33A 3ZZ1A 1VBHA 3P62A 1JQXA 2VC5A 2E9BA 3GR7A 1P6CA 2FMNA 2HPMA 2BVYA 5FJJA 2YPIA 1GJWA 4EM3A 1FKWA 3OO2A 5BXPA 1KTCA 3TN6A 3E2SA 2Y1HA 4W89A 4RZ5A 1QK2A 2IXVA 1ZQ5A 1EHAA 4QEHA 3DFNA 3N4FA 5RUBA 3UESA 4MJ4A 3G1YA 4Z42C 2QAFA 2BGQA 4ZFCA 1NY1A 4S3EA 2Q71A 3IIZA 1KD0A 1KRBC 3I3DA 3V5FA 4F3HA 1HKKA 1REQA 3H21A 2PDIA 3KTSA 4DWDA 1N62C 1UP0A 2PODA 4PBFA 1YPXA 4RPQA 3HG5A 7TIMA 5BU9A 4I90A 3TAOA 1EJ7L 4X22A 2OLHA 1LG2A 1JDCA 4NX5A 2YDQA 1GRHA 4A05A 2PCEA 3KTCA 1GW1A 3SIZA 1LUCB 4FOJA 4UTLA 1MEHA 5IFPA 4ATWA 4HMNA 3A23A 2X8RA 4U2ZA 2HROA 4K7ZA 3FGCB 1H51A 1J5SA 3AIVA 1FOBA 3CV2A 1RY0A 4L9YA 4MLJA 5CEWA 1GG0A 3CEPA 4LBRA 5BZAA 4LPCA 3OJGA 1XYFA 5BU6A 2V6AA 4UFMA 1TMLA 3N2CA 2BHUA 2XSBA 1RPXA 1GVEA 1HJXA 1HN1A 2AKMA 5CKSA 3LMYA 3VFCA 1Q6RA 3F2CA 4OKDA 4KRTA 4FXSA 4DELA 3B8TA 4UCFA 3T2PA 2J8GA 1OG0A 1ZJIA 4PTDA 2ZOXA 4L6OA 1C9DA 4KWSA 3WO8A 1KXTA 3GK0A 1H1ZA 1OCBA 4JD4A 2E28A 1W9PA 3QFWA 1A3HA 4GUHA 4JAWA 3GHUA 3IJ8A 4DYJA 3T4WA 3OGRA 5C71A 4NYYA 5DF0A 1R2SA 2VT0A 2CZEA 4P5UA 1EHNA 5G1TA 2O55A 1JCMP 4ZB5A 2V5BA 1I1WA 3L4UA 4C7DA 4DB7A 1EQCA 1HFBA 3W6LA 1EWEA 4DM2A 3SRKA 2WZIA 1TTPA 1R5YA 2ISVA 3TTQA 1EEXA 3MT1A 2Z24A 2X41A 3LRKA 1UCWA 2GL5A 1FVPA 3IVSA 1IHIA 2VR2A 4GYPA 3RJYA 4H7VA 4KCUA 3T08A 2Y7EA 2Z25A 2CNCA 1AZ1A 2BFGA 1ALDA 1BWCA 3DERA 1TPC1 2WK2A 4AWTA 3WQGA 3G1DA 1GERA 3CQ0A 3IGUA 5HJXA 1OD8A 2HVOA 5HNTA 2YCEA 1N8IA 4D6EA 5FS8A 4WDXA 2QCEA 3UYCA 4Q32A 2XWDA 1FWJC 1PBGA 5F1UA 3C86A 1KWKA 3IIOA 1F4HA 4KCTA 4WSHA 2QCDA 4FEZA 4P8UA 1D3HA 4H9MA 3CNYA 1PE1A 4GQQA 4B3KA 3G8RA 5DBUA 1ML1A 3UWZA 2W55A 3AS1A 3W6MA 1XRTA 4TX8A 1TV5A 1Q6DA 3WEZA 1UP2A 1EKOA 5AC4A 4QP0A 1A5MC 2RFGA 3L4VA 4U2YA 4LS2A 3W7CA 3IIXA 4ACYA 1H60A 2VFHA 1J01A 3ANVA 1JFHA 3AIWA 1H63A 4LYKA 3LBCA 4MZ8A 4FF5A 4OVXA 3NO5A 2VCAA 1CGXA 3S6TA 1V3HA 3UXKA 1W5MA 4BV6A 5CGTA 4ZODA 3B9DA 7PTDA 2NPXA 2B7OA 3PY2A 3OZOA 3LA4A 1RJPA 2JE8A 4JDRA 2PRLA 1TV2A 3N04A 1WDWA 3AROA 4LUSA 1OX4B 1K9EA 4PB5A 4WF7A 4WUIA 2WHKA 1A5BA 1VFOA 2E5CA 4NAFA 3U8GA 1E1CB 4PTMA 3KL3A 2A6LA 3H8AA 2XG9A 3DJGX 1GOXA 3GB6A 2XN2A 1W1ZA 3L7RA 4GJJA 5MKGA 5I06A 3ABXA 4M51A 4OFCA 3TXZA 1XBXA 1V02A 2Y63A 4IIFA 3GG1A 2ZUSA 3WENA 3UWUA 3W4RA 3ARPA 3SGZA 2WVVA 1JCJA 4HNUA 4JTEA 4UQEA 1S2CA 3WLQA 1ME8A 1PSCA 1WOBA 2O56A 3ME3A 4DJFA 3T09A 4KWVA 5ECVA 2OXNA 3IGHX 5DMNA 1UB3A 2Z7GA 4W88A 3POCA 4FX8A 3UJRA 3TX9A 1LCOA 3ISIX 2PDFA 2F38A 1ZBVA 4L4MA 1F74A 3R43A 5BCAA 3VGFA 2CDUA 3ZXWA 2JGYA 1W9XA 3FA3A 4B16A 2I7GA 3R0KA 2GVJA 2QJHA 1SO4A 1OC5A 2XTKA 3N34A 2HK1A 3GFZA 4ZOCA 4P7QA 4S3BA 4GLEA 3BZGA 1GQLA 1JRCA 2OX1A 4NI3A 3IRSA 1O66A 2WWDA 3B9NA 3FAXA 3O0FA 1ECEA 4N9CA 3WQEA 4QAWA 4RXFA 2QF8A 3RLGA 1EJUC 1NP2A 3GDMA 3OBAA 5AC6A 2ZUWA 2J7CA 5CC6A 1OFRA 3R10A 1CXEA 4DF2A 2F61A 1XSKA 1IZJA 2R6OA 4K37A 3O63A 3MHGA 3RX3A 1ZDLA 2GFTA 2CERA 1F76A 1JGIA 2RH9A 1US0A 3N2BA 3V1HA 3W7DA 2YW4A 4MWAC 3TYEA 3N12A 4LY8A 4LB3A 3EB2A 3N2TA 1LORA 3H54A 2ZUTA 2C3CA 1T8XA 2E0PA 2OZ0A 1AVAA 4M1RA 1X96A 4GVIA 4UXDA 3AN1A 4XG1A 2R14A 2FH6A 3GYCA 3QC3A 5EMLA 3BCFA 2D23A 2EKGA 2BASA 3DYOA 4M7TA 3DC8A 1EIBA 1K03A 3WF1A 1CPUA 3BTNA 3LY0A 4L4LA 4OECA 2CLEA 2REQA 5IHRA 3C8NA 1GQKA 3CUIA 3CU2A 3FSTA 3C4UA 3M6YA 2XFWA 3NXFA 4D6IA 2ZUUA 4JIIX 3PTQA 1B2YA 1DKWA 3O05A 4AQLA 1G9HA 3ATYA 1MO9A 7CGTA 2DVTA 5DCBA 4J27A 2OELA 3QGVA 4Z0SA 3W7HA 1LF1A 1GPWA 2O0TA 4EM4A 2R82A 4GISA 5C2GA 2CC0A 1FWHC 3HGJA 3RCYA 2AAMA 1KXHA 3DKLA 4QCEA 5SWUA 1YQZA 4P8XA 1RH9A 3OQ8A 4AHPA 4MJMA 3UY7A 5TQLA 2GZXA 3H6OA 4BJHA 5J8LA 2J8FA 1BYCA 1J6PA 3MJMA 4H9XA 3KBNA 3E12A 4BZYA 4UR7A 1NDVA 1P5BA 1GYNA 1BRLB 3R13A 5EB8A 4NJHA 3CZEA 3LQGA 4UTIA 4GZEA 4Q22A 4E2VA 2F6KA 3R4IA 4JS3A 3DFTA 2AQWA 1I2OA 3E9AA 4WJXA 4JTQA 9XIAA 2YLLA 4HHHA 3TJ4A 1PEZA 1P48A 1OX5A 3P5ZA 3ELFA 3IV8A 3S5SA 3E74A 1R47A 1LROA 2BBFA 3LTSA 3RM9A 2GJXA 2R1PA 5CLWA 2JK6A 3TQ0A 3NPUA 3NTYA 5AVNA 4GY0A 4ZGYA 3O6CA 3EOLA 1FH7A 3WQ4A 1MO0A 3JW7A 3R0UA 1BTCA 2W79A 3XIMA 4GE8A 5FAGA 3DXIA 4R88A 1ZP3A 3AOFA 4U3AA 1AW2A 1BAGA 2ALRA 1GVRA 4HZMA 3C2FA 1JYNA 1ONXA 1CXKA 1C92A 5G2HA 1EUNA 1G67A 4L56A 1MW0A 2X7VA 3AZRA 4A35A 2NLYA 2YDSA 1M01A 3W7KA 3RU6A 3AZSA 1R9YA 4C6IA 3HG4A 3QR0A 3MSRA 1Q45A 5A8NA 3APGA 1GOIA 4IJBA 4JY8A 1PWMA 3K1DA 2ATSA 3T78A 4UZUA 2TPSA 1V3JA 5AHMA 5CGMA 4GO9A 3QEZA 1D9EA 3VIGA 3EKGA 3CMFA 1WBHA 2C1HA 4K8DA 1GXFA 2I16A 3UZWA 5FEZA 3CGEA 3SN4A 1PWLA 2Z26A 3C0QA 3SBFA 3XINA 2P8BA 2XH2A 2INEA 5JBFA 2DW7A 1G69A 1FIQB 3DHFA 2KAUC 4QHRA 3PJXA 5A6BA 3ZIZA 1UQYA 1A5OC 1RQHA 3SJNA 3KBMA 1WXJA 1B57A 1TPB1 3UGRA 5LIWX 3DGHA 3UCDA 5L9FA 3GIQA 4GIEA 4QLJA 5GNZA 4D6DA 1JZ8A 5U25A 4HK7A 2HE5A 4X2RA 3RDKA 5BWFA 4C1KA 5GJNA 3L4ZA 3BSMA 2YZRA 1O4UA 2VDHA 1JDEA 2GJLA 3G1FA 3K4WA 2C13A 7A3HA 2IQTA 2ICSA 4F0KA 3TN3A 3CUXA 3KS6A 2GGIA 5FSEC 2ALDA 1NWSA 1MXGA 1B9ZA 2X2YA 2P5NA 4F9DA 1BQGA 3U0HA 1T3QC 3B9JB 3GG0A 4CD5A 2VGIA 4GR1A 1ECQA 1DXEA 3TCSA 2Q8LA 4H6RA 1O5RA 3WJWA 2CZVA 3T8QA 4Q8VA 1K7EA 1IWPA 3LRLA 1NH6A 4CN1A 2FHBA 2QXWA 4KRUA 1QPKA 2E8ZA 2YYTA 5EMUA 3WQ5A 1EC9A 3WF0A 3VNIA 5AHEA 4ECLA 2BS9A 3MU7A 5HMEA 3L2IA 2VEFA 4NT0A 5CPTA 1F2JA 4DJDD 3WNMA 3RFAA 1RA5A 4WXYA 1ICQA 2ZZ5A 3WQFA 3M0XA 5KZDA 4J3SA 1U1UA 2WQDA 4P2VA 3BURA 4IIHA 2FB3A 4PUWA 4XZWA 3UA4A 3PR2A 4B9YA 2GGEA 3EMCA 5CBBA 5E0FA 2CLHA 3PNZA 4X3ZA 5AHIA 4JEJA 1Q2RA 4L1WA 1JNEA 1E9LA 1DP0A 2P3ZA 3R58A 3BJTA 4XIAA 3P0XA 1IWAA 3NJ3A 5HPCA 5LXXA 3W28A 2V8ZA 2GGHA 2IQDA 3H24A 1DWGM 1HJVA 1K6WA 1I75A 3T81A 1KRAC 2D2JA 4ZTXA 1IGSA 1SJAA 3BGJA 1QI3A 2QMJA 5FEWA 4MAVA 3CXOA 1MUWA 2A2IA 3M07A 3T40A 3L4XA 3QKZA 4HMDA 5CPSA 3DAQA 3EX2A 3VOGA 3EDFA 3WUEA 4DHGA 4GKTA 3GLCA 1CDGA 5FD0A 1MW3A 2C1IA 5EFDA 1CB7B 2XINA 2PP0A 1P4CA 2X1RA 1FXPA 5A8PA 3LERA 6REQB 4MHBA 3KL0A 7TAAA 3AUJA 1ADSA 4H1ZA 4B4FA 5L6UA 3GTNA 4GOAA 1YPIA 3COTA 1HVXA 4K7YA 3HG2A 3F5LA 1WAWA 3LS9A 3VNLA 3EA2A 3VIMA 1EP1A 2GJNA 5F7UA 3APYA 4JHZA 1PKLA 4QLKA 1US3A 1FWDC 4RDWA 1VD6A 5E93A 2QV5A 1VFFA 1SW0A 2OYLA 4MWAD 5KZEA 3DK9A 4KWWA 1FWIC 3UVIA 5A8QA 1GWJA 4LUTB 4IUGA 4ZE5A 4XZNX 4WY0F 5JBDA 1OK6A 4LBSA 5AN7A 4Z2LA 3AMLA 3FIGA 3VIIA 1DWJM 2X8CA 3WDJA 4BFAA 4H04A 3RG6A 4AMCA 2OEJA 4H83A 1A5SA 3BZJA 2GPTA 1NFBA 4HNTA 2DVUA 3KCOA 1X1ZA 3C8FA 3SGGA 4UQCA 3KDNA 2YA2A 3PUDA 3B8SA 3LV6A 4J2PA 4AMAA 2BDQA 5KTLA 4ZQCA 4W8BA 2R1NA 3WK0A 3ZFHA 4D1IA 3B8UA 3H2AA 3CO4A 2RJGA 4JTJA 1HO4A 3MQTA 3EB3A 4LOCA 1C8VA 3P84A 3AMGA 3MUAA 4NYUA 1FO4A 2OZ8A 1HG3A 1UPPA 3IANA 2OEMA 4EMJA 1CXIA 1JR1A 1F7BA 1HJSA 4GIAA 4FXFA 4KEMA 7REQA 2CXGA 2GVEA 4IPLA 2ZTKA 2PDLA 2INFA 1VJIA 3TC6A 1G01A 4HHLA 4DI8A 4O15A 4HN8A 4CQ9A 3SRDA 3MC5A 3TN4A 3UCCA 1R7OA 2PTWA 4KEZA 4UQBA 3N6JA 5DQPA 5HULA 1QDSA 4M56A 2ZRYA 4LRTA 4YTRA 2E1DA 4L4OA 2RGLA 1XS2A 1W54A 4IIEA 4D6FA 1FWTA 4ZZ9A 2WOIA 5AB3A 2OQHA 3W26A 1EF2A 4EWJA 4QSFA 4C6QA 2BOGX 3BLEA 1X39A 3DOPA 4XUGA 2XM2A 2BY0A 3UWVA 1S7MA 3HW2A 1O7AA 4IPNB 2QCCA 1BWKA 4F79A 2ZICA 1P43A 1ZJBA 3AMKA 1PL9A 2BVDA 2JBMA 2ZUNA 1JF6A 5D8ZA 4LVBA 3QY7A 4KRZA 4H7CA 2Y85A 4K1WA 3G3DA 1OWQA 1U1HA 2W4XA 4WD0A 1VEOA 4YVXA 5E70A 3MWAA 2VMFA 4PUNA 1Q6GA 3IJQA 1YXYA 3WLPA 5CPMA 5AFDA 2Q02A 2O4QA 3KHJA 4F0HA 1ZU8A 4GQGA 2W3ZA 4BY3A 1PB0A 2O7QA 3EOEA 4ZOEA 5FESA 2ZX6A 3VC6A 3FKKA 3W23A 1XLHA 2VZVA 5LYRA 2UY3A 3LNMA 3OPSA 1XIJA 3C6CA 5LIYX 2YB4A 2F2HA 3P60A 5K7JA 1A5UA 1X8FA 1LZOA 2ABAA 1IF2A 4EACA 4EKJA 1F9CA 2ZQ0A 1DIKA 5BYWA 4YYCA 2XISA 3MMTA 3WMSA 1ZXIC 1GG1A 2ZZ4A 2O7SA 4PMRA 5TD4A 2QJIA 2FTPA 1X2GA 1E6QM 1Q1WA 5JRBA 1FDZA 3ZJ8A 4PB4A 3QYSA 1PIGA 1JPDX 4JYFA 2I57A 2OODA 1Y8BA 1W1TA 3NGFA 3PPCA 5C9UA 2TRSA 1LBMA 5FAJA 2HBVA 3HOJA 1NSJA 2X1IA 1V6VA 4AZ5A 1GZGA 3GNPA 3U9IA 4ADWA 1XLJA 3PZVA 2QCLA 2HTMA 4AU0A 3A24A 3CJPA 1MVYA 3PWIA 5FF3A 3EOOA 1UZHA 3P80A 4Q7BA 1ZJAA 3UEQA 4QSHA 5JCLA 3D3AA 1Y65A 3BW3A 3H7UA 1S5TA 2ACQA 3SB0A 1RAKA 2G96A 4JTKA 4L1GA 4BS0A 1YMYA 3SQSA 1TQJA 4WY0A 1NF0A 2A3AA 2OX4A 3ARTA 4Q7NA 3HPSA 3E2QA 3FXYA 4AD2A 2VFIA 1EA9C 2E6AA 4MWAE 1MDLA 4XAYA 2XGIA 1R2TA 4PC8A 4ZENA 1PYMA 2BG5A 2FDMA 4DF1A 2J25A 2Z1WA 4DBSA 1NHSA 4C6DA 2JEPA 4NAEB 2GGGA 4XD5A 2WSPA 5PTDA 2V67A 1JYXA 4TO8A 4N4PA 4C6NA 4MUPA 3DGBA 2V3DA 3SCTA 1NOFA 1G7VA 4I6KA 3OA3A 2VWSA 3I7SA 2V5KA 3HM7A 1TCMA 5D9NA 3VNZA 1YXDA 4I7WA 1E4IA 1LLOA 4MY9A 4C6BA 4HPJA 3LHWA 3QRHA 2D3LA 2GK1A 4UNKA 3TZNA 3NSNA 3D47A 5B7YA 3SCRA 1OZMA 3ZMRA 3MB9A 1RLDA 1S2TA 3O6DA 2G3MA 2X2GA 4MB1A 1H2JA 2NT0A 3DDMA 3RM4A 1XI3A 3MYPA 3KM8A 3WH9A 3APTA 2QPUA 4EOUA 1R3RA 2DSUA 4NILA 3VE7A 1UD3A 1TPDA 3K8LA 1AA1B 3STCA 3VNMA 1A5LC 3GC5A 1E6RA 1J8VA 4AHOA 3KLKA 4ZO6A 2P3EA 2GVYA 3IK4A 1TPFA 3PB2A 3TSMA 3GZAA 1W3KA 4ZE4A 4ES4A 1XLFA 2E9LA 2GSJA 5JCIA 1KR0A 1YDVA 3CHFA 4LX4A 4GH1A 4YL2A 5BOOA 1PHQA 3GX9A 1MSSA 2BHZA 3FS2A 3LCGA 1YBQB 1A53A 2C3ZA 5AVHA 5BMWA 5I78A 1HXJA 4MJZA 5CJMA 3PP7A 1QNVA 3W7OA 3CASA 2YA1A 1ZUAX 2CLPA 5AYBA 4GRTA 2HS6A 1YE4A 1FDJA 3VX1A 1NFPA 3H12A 2NSXA 2FKPA 2NX1A 4R5EA 2PE4A 5FJOA 5CC5A 1NQ6A 2GOKA 4PBGA 2MUCA 2WV8A 4JFTA 5T8GA 5A95A 3GNDA 3OU8A 3CUZA 4O0ZA 5A2AA 3AYRA 4C5YA 1YADA 1F61A 5H8MA 2G4FA 1DL3A 3EX3A 1GEUA 4XBKA 1Q66A 1P0DA 2C18A 1TRDA 2DZBA 1W5OA 1OF8A 1IT8A 3S2MA 5CZKA 4A2SA 4IH3A 1BXBA 3UJSA 1ZLPA 4QS5A 4TU1A 3O2LA 1V79A 3PC0A 5FEPA 3TU9A 1IR1A 1R3SA 3BC9A 3ZOAA 2H3BA 3ABZA 3W7NA 5JIWA 3W85A 3W37A 2OO6A 4C6JA 4YWSA 3KCLA 1K9DA 4KCVA 1B3WA 3L5LA 3MI2A 1MUCA 4JX4A 3O0HA 4UB9A 1A0DA 4JTFA 1XANA 2J8TA 4G7EB 1WKDA 4DAIA 3L66A 3VIPA 1VZWA 3KX6A 2BZNA 3G1SA 2ADAA 1JUKA 3GIPA 3QZEA 1EL3A 3V1PA 4PR4A 4ILSA 1U5HA 3N9KA 2J88A 4PMYA 4W7UA 1LWHA 3SSZA 2W67A 1A47A 4GPNA 3QFBA 1W91A 3WF2A 3HV8A 1P0EA 1I2NA 4JFSA 3ID7A 1V6YA 2J4GA 5LNRA 1W9VA 1J96A 2ZZ3A 1VHNA 1K9TA 4FNTA 5D2VA 5D03A 4J28A 2ZTJA 5I2UA 1ZBWA 3T05A 2W92A 3H2CA 3Q37A 3SIMA 3BO9A 2ZWZA 3NIYA 3BAIA 1FHDA 5BRPA 3CL8A 2WOWA 1H1YA 3ITOA 5HATA 2VQTA 3KHDA 4GZIA 1U5JA 3A47A 1QI2A 4K8EA 2V30A 4AIUA 1FHLA 4FLQA 1J12A 1D3CA 1VF8A 4M8UA 5DCDA 4NJIA 2W6RA 3R7MA 1XPYA 3MMDA 1AH0A 3R0DA 1SFJA 4C6LA 2PGEA 4HYWA 1H1NA 2D0FA 5I79A 2C71A 1TA3B 2WNQA 3I4EA 3VOHA 1QHOA 3DN5A 3N17A 1HKMA 4C90A 4M52A 4GFIA 2VEIA 2B7NA 3BLIA 4W93A 4E3TA 4KCWA 3N1AA 1OC7A 3FY1A 2WKGA 2NWRA 1E6SM 3CZKA 4LCQA 3W7MA 4A8NA 1GRBA 3IJ7A 3S9YA 2INZA 5I3KA 3AHTA 3GO2A 4RZ6A 1LBFA 3FK4A 3LI1A 4HJFA 2ZX9A 4XZHA 3W3OA 4WSJA 3DESA 4GI9A 5EMJA 4CU6A 4HCLA 3B0XA 5REQA 4JIQA 4BF5A 4ZO7A 4I8YA 4GWEA 4PTNA 3QXBA 1E0WA 4M3PA 2QUVA 1UWAA 4Q8PA 2BV9A 3OA5A 3SCWA 3BG5A 2FLIA 1W5NA 1I9CB 5FI8A 2BVWA 1BGGA 1H11A 2B0MA 4P7LA 4R3UA 1IIGA 3MP3A 3GC2A 2EPNA 1RBLA 2QCGA 3KVLA 1R87A 1LVLA 4DJDA 4ZMGA 3RPDA 1UKOA 1SZRA 2R91A 1X1OA 3SO7A 4RXGA 1FDYA 3HJEA 4ROQA 4Q4OA 3PTDA 3W7QA 4NQ1A 2R8WA 5LNWA 2IKGA 4S3DA 1DBTA 1Q85A 1H6VA 3GAKA 1OBAA 3CO8A 4CD6A 5F4SA 4HNCA 2YZ5A 1JNDA 2DUZA 2WVSA 2OT1A 4FHAA 3N14A 3OYZA 1E1EA 2XSAA 4X9SA 2J7DA 4KESA 4QAIA 4Z1YA 4V15A 3V4BA 3QTGA 2HQMA 1K8XA 1YKWA 3CYJA 3OVPA 5DO8A 2ZUMA 1UOZA 4A8IA 1GORA 2HVNA 4XB3A 4CCCA 3TUUA 2I14A 1GK8A 3C3UA 4UNLA 1J6OA 5H91A 4DYEA 5CGQA 1FHUA 2OFJA 2WCSA 4Q8QA 3KVKA 4H8VA 4PMJA 2BSLA 4ADUA 3G24A 2PEVA 4UMCA 4P8VA 3UZYA 2ZX7A 4BI5A 2BNJA 3DJJA 4O54A 4GUFA 3OP2A 1TG7A 1Q6FA 3MP4A 5EMMA 1S46A 1ZK7A 2WSQA 1AQHA 4Y90A 4GYPC 1G5AA 2XVGA 1UIPA 1K8ZA 4JIEA 2CU0A 3GVRA 2ISFA 3WX7A 4M19A 3U2EA 5A6JA 1ITXA 4W9TA 3MSYA 4D1JA 4MNMA 5JIPA 3NPVA 1F8WA 1GVFA 3ZT5A 3CT2A 2ZRWA 4A3UA 4O17A 1H0IA 3MCNA 3L4WA 4QR6A 3SFKA 3NO3A 1S3HA 2VEPA 3BGAA 5E9XA 6XIMA 3AHZA 3SM0A 2Z1KA 1Q1RA 2PWFA 2X1UA 4MWAA 5H1WA 2ODOA 3RPMA 4FNRA 4A3RA 2BXVA 4NZ4A 4Z17A 3VINA 3M0IA 1IIHA 1I2PA 5CPLA 1LWJA 3ZVHB 2AKZA 3OLIA 3WJYA 4JQ4A 1JAKA 3GH4A 4H7ZA 2DV0A 5BRBA 1PYFA 1QW7A 2GJRA 4ZFMA 9CGTA 3LRMA 3P8JA 3CQJA 4ZQNA 3AHXA 1PO9A 4A8LA 2CESA 4BEQA 3MO7A 2C16A 3BW2A 1FWSA 3GVGA 4HSHA 5G2IA 4M81A 3IUIA 4GUJA 5H8UA 4MADA 5A69A 1JPMA 3LCHA 1V4YA 3EPNA 3LPPA 4LVAA 2YQUA 1DTNA 2PDHA 3VXGA 4NZ3A 1Q8AA 3MA8A 4FK9A 3HQ1A 3BLFA 2WP5A 4JTUA 3OZYA 1QNQA 2PA6A 2V81A 4PUEA 2PF8A 1E0VA 3WNLA 3D5HA 1YNQA 1HGYA 3GKFA 1SB3B 3GXTA 3NA8A 2E5AA 1SU5A 1A0CA 1VPQA 5HNRA 4L64A 1JAEA 2V68A 4E6MA 2QT3A 1TJ1A 3GY1A 5HK4A 4DZ5A 2XIBA 3UG8A 4N2YA 2YR1A 3G0SA 4LC6A 1UD8A 3P0WA 4OWGA 1EC7A 4PYSA 3GW3A 4XUYA 1F6KA 3ABOA 2Z27A 3LG3A 3VDAA 1RVGA 3S1UA 2R1LA 3DFQA 1RUSA 1W2VA 5DRIA 4OBTA 1YHTA 5K4XA 3JS3A 2GH5A 1CI1A 1LDCA 4KEVA 3VA8A 4UIOA 3IC9A 2WO5A 4W5ZA 5CBJA 1R9XA 2HXTA 2ZVIA 3D6NA 1JQVA 4Z2IA 1Q8JA 4MB3A 1XLIA 1XIFA 1CB2A 3VZXA 4W7VA 4GGBA 1IR2A 4EQWA 1SFSA 1PX3A 3FGCA 5D02A 3M0ZA 1TCDA 3G22A 3O16A 3S42A 3WLHA 4G1KA 2EQ8A 4OE7A 2QUTA 3AIUA 2FGLA 3WEMA 3CAKA 1I60A 2IW0A 1SFLA 2YL6A 2NQZA 1MQQA 5LHFA 3WY1A 4JNMA 3PG8A 3JUGA 3W0KA 3VGHA 3CWHA 2FJKA 4IX2A 4HKPA 1MFVA 5AYZA 2Y5SA 4ROPA 3CHVA 5DX7A 1XGDA 4JKLA 3AZTA 3OB8A 3N25A 3NZ1A 1ADOA 2O9OA 4V33A 2PLJA 4V2XA 4TVCA 2VUNA 4NRSA 3TAKA 4LANA 1Z69A 2V6OA 2B7QA 1B3ZA 1AZ2A 1Y7VA 3HPAA 1NWUA 1NTHA 3VIOA 3GXPA 3MS8A 4I8DA 2IKJA 4UR8A 4DO4A 3U2CA 1XUZA 3PWGA 4H41A 1QUMA 3SR7A 3GH7A 1HKJA 3R94A 2BY3A 3C0JA 1TZ7A 1UWRA 1Q6LA 1WZMA 4N0RA 4GHRA 5FF0A 3OLEA 1N5WC 4XBJA 4HPHA 3IRDA 2QR6A 1VFMA 3ARZA 3CLWA 4BI7A 2IPGA 4XZIA 1QI5A 1UKQA 1IEXA 3DIPA 4A29A 3OC4A 2JFEX 1DJGA 4JTTA 1TTIA 1RZMA 4GBDA 3N29A 4WKFA 2QGYA 3B03A 5DMLA 4W4QA 1JCYA 3NEVA 2PDNA 1X6UA 1KV8A 1OABA 4BWLC 2Y4SA 1KKRA 1MZRA 1FWAC 2PAJA 2QJMA 1SFTA 5I7GA 3VMNA 2NWSA 2G4JA 1TZ9A 3FHAA 2WLZA 1TUXA 1PXGA 1ICPA 3CLMA 1XBYA 2ZA3A 3OGVA 2PGWA 3OBKA 2OMAA 2ZZ0A 3NDYA 1LL6A 1V3IA 3LXBA 1JZ3A 1WA3A 3R2GA 4L1XA 4GNVA 4ML4A 4LUIA 3EX4A 2ACSA 4RE2A 2Q8ZA 1M5WA 2HNEA 1J9YA 5A6SA 2QGHA 3B97A 2PMQA 1SM9A 3CQHA 3O9NA 1VFHA 1S5WA 3POHA 4F4RA 3WBXA 1OFOA 5JH2A 1AK5A 3ATZA 4O12A 3RCNA 4IXXA 1GTHA 4S3AA 4U28A 1I6NA 2BVTA 4H4WA 1O1HA 2WM0A 2B4GA 4JQ9A 3M16A 9RUBA 4AEFA 5BW6A 1QPRA 2A3EA 1UH3A 1POJA 2DW6A 4LAUA 1JZ7A 2VM8A 3WH6A 1UD4A 5CG0A 1RQBA 1XDJA 1DQUA 4UR9A 2YL5A 1JYWA 1ZAJA 4ZO8A 1E1CA 5FEXA 3YPIA 4AZ7A 3NQEA 3WMLA 4JTSA 2XH0A 1F73A 2OR2A 1OC6A 2I9UA 1F6YA 3STEA 4IP7A 2V9DA 1VENA 4HU8A 5ABEA 4QQUA 1IT0A 5C0QA 2FTYA 2VX7A 3T07A 4DBDA 3GM8A 3CPUA 3A3HA 5U7SA 3S5ZA 4HMEA 3BAWA 2Z28A 2OCZA 2ISDA 1J0KA 3GBDA 5CH9A 5FA5A 4Q4PA 2PC4A 2KX9A 2R9RA 4PCPA 1D8CA 1JXJA 3ARYA 5HJYA 4ZCWA 1FWEC 2NQJA 1NF7A 4HVXA 2JALA 3DH7A 2HISA 4RL3A 4XWUA 1C90A 5HJLA 1RPKA 4ZSTA 2VP8A 1IEIA 1GPFA 3GXIA 1SW3A 2WWCA 2Y6ZA 3QJAA 1OK4A 1F8IA 2TSYA 1A3XA 4G2DA 1S3TC 1XYZA 3VNDA 3UWYA 1GCYA 3HG3A 3NR0A 4IGHA 2E9MA 1JD7A 2QMKA 4LNYA 5AHNA 3OOQA 1RVKA 5FJRA 3BQ5A 4IP5A 1T99A 1G4EA 1S1RA 3SUWA 3DBPA 4P7NA 3LCXA 4IG2B 4QJ5B 5K3VA 3BCDA 4OBSA 2WPBA 5E0KA 4RDYA 4JTRA 1Q5MA 3M44A 4B2DD 4DVOA 1ZNNA 2Y24A 4EAYA 2VRQA 4I5RA 2H3DA 5A6MA 1M6JA 1B3VA 2DSZA 4MG4A 2QULA 2Y7FA 3CH9A 1TV7A 2Q01A 1R8LA 4R53A 4U5IA 1EC8A 1UMYA 6ALDA 1OJTA 1R86A 3E3HA 2ZC1A 4O57A 1ZJHA 3TDFA 1YW1A 4AZCB 3EKZA 3CC1A 3PG6A 2ZDSA 3TCEA 3L21A 1GYMA 2OEKA 1KRCC 4AB4A 3UGVA 3W24A 1TR9A 1E51A 4GXWA 2PB1A 5C9XA 4XKYB 4CEXC 1TZZA 4UFLA 3WIJA 3G0XA 3O3RA 3N3MA 1F3XA 3TW7A 3QVQA 3T0AA 3AAMA 1QO2A 3UR2A 1CYGA 2W0HA 1XIIA 2WJZA 2DGAA 5EY5A 3AQUA 3GTIA 3M5VA 4LU0A 1PJ9A 4BQ2A 3QHMA 3EYPA 3IJLA 2ON3A 2OYKA 1PKYA 2CLLA 2PTZA 4OV9A 1PIFA 1QCWA 1GOOA 1SO6A 4QDWA 5LA2A 3KBJA 4RE3A 3H23A 1VBRA 1OCJA 3FYOA 3NQAA 4KERA 4US6A 3FHQA 3MMWA 3H2NA 1A4MA 2VUYA 3SY5A 2Y2WA 4PH6A 4RJEA 3RLUA 1SZEA 1GYLA 1B0IA 1NOUA 4B4HA 3EBVA 3V7PA 2VDIA 2ZE3A 3EX1A 1OFPA 4ZOBA 4QE5A 3WLJA 3FNDA 4C91A 4BQ3A 1KFBA 3CWOX 3PSVA 3MBFA 2V2DA 3NL2A 2WHLA 4TX9A 4B91A 3R11A 2X09A 1WP6A 1EOKA 4A6GA 5AECA 2DFAA 2VKZG 4J3WA 1ONRA 5E6ZA 3UNTA 2VZTA 4GBUA 4FB7A 4GGHA 4IIBA 4AVNA 4O8RA 1VEMA 2G97A 3DG6A 1B54A 1FCQA 3MPGA 4QIUA 1FWNA 3NL5A 2WOQA 3QQWA 3LLFA 4AVOA 2E1WA 1CXFA 2WKLA 4D8LA 4YXGA 2PDKA 4PUKA 1IEQA 1DJWA 1QNOA 5JH1A 2WBAA 3DG3A 4I7UA 4Y96A 5C70A 3B40A 1OF6A 3VIKA 2OKOA 2DPEA 3IS4A 3FYYA 1EXPA 3AXIA 4QDMA 3TEVA 4A2RA 5IRPA 1H49A 5I3JA 1N63C 3UR7A 4DLMA 4UTTC 1XC4A 4Y9MA 2QCHA 5A94A 1EBDA 1HO1A 3IPWA 3ARQA 3ENLA 2HEJA 4FSAA 3H2FA 3SY8A 4ZEPA 2FH8A 1X6LA 3NQ7A 1R2RA 1WYIA 4J57A 4IT1A 3K5XA 4OOUA 2Z0IA 3HA1A 3TQKA 2V38A 4UOQA 1ZBCA 2ISSA 4I3GA 4F9JA 4YN5A 3UU0A 4H4RA 2O92A 4AHQA 4HTYA 1VDVA 7XIMA 4C6PA 1QO5A 2IPJA 3U4FA 4HT3A 5JBEA 3G1HA 1GTEA 3CV7A 1ZB5A 3BG3A 3PTMA 1KR1A 5CC3A 4DO6A 4LUSB 3UF9A 3CZLA 2PZNA 4AD0A 5GPRA 3W87A 4LTSA 3TSBA 1XINA 4KQNA 5LA1A 4TTGA 2FFCA 4GC3A 4GG9A 3NVTA 3AIEA 4FX7A 3NUKA 2HCVA 4MAZA 2HK0A 1U30A 3BOLA 3T55A 2C14A 3BLPX 4O0KA 1XIEA 1UJQA 4BF7A 2E67A 4Y9NA 2PGRA 3UXLA 3W86A 1CGUA 3M0LA 3WNKA 1LJYA 3NZRA 2WVUA 5AY7A 1NWTA 2EQ6A 4MTVA 4KKXA 3QPZA 5C9WA 3N2OA 4UTFA 4C1LA 2Z00A 1WX0A 1H2IA 2DUXA 5G5GB 1E72M 1F07A 3ZVIA 4JX6A 1BKSA 4QE1A 1VB9A 1G1YA 1SQ7A 4HK5A 4NEWA 1RXOB 3VTRA 1C3FA 2ZZ2A 3HMJG 4KWUA 4JBRA 1PKNA 1F8MA 4O52A 3OG3A 2CPUA 4B5WA 2IS7A 5DEZA 4WOQA 1L6FA 5CSRA 2ACUA 3W7EA 3FOKA 1KFWA 1GOWA 3W83A 3KRUA 5U1OA 3SFWA 3F5KA 3GHRA 5G1YA 1FA2A 2QEZA 3WD2A 2PDQA 5HINA 4TVUA 3SN0A 1UUMA 1CXLA 3LOTA 3GTXA 4HU3A 3W7GA 3Q58A 4PODA 1C29A 1M53A 2A4AA 3IUHA 4MYXA 3U4AA 3ARUA 1KW1A 3V36A 1HT6A 4POCA 3UR5A 1H7NA 2G0WA 1HP4A 2CLOA 3VMOA 1V6XA 4DWSB 3HFTA 1W6TA 3TZFA 1XQKA 2YKKA 3F4WA 1BXNA 3K1GA 3B0YA 1E70M 4B3LA 3W2KA 4DO7A 2WJEA 3HIJA 4OT7A 4UBPC 3W2LA 4AX6A 3LXDA 4GXPA 1L9WA 2GRTA 4XIMA 4IGSA 1N82A 4B9ZA 2VURA 1JCXA 3PSWA 2QUMA 3A64A 4M6PA 1QW8A 3MZ2A 4UQDA 3TTEA 1ITUA 2V82A 3W1QA 4NKCA 1LG1A 3DU0A 3GD3A 2QIIA 4F2BA 2JQXA 3RRXA 8XIAA 2I5GA 4LAZA 4KFNA 4MDPA 3BOXA 1SYTA 3MJYA 3CGBA 3WL1A 1Z6KA 1TYPA 2V3BA 4JIPA 2WVTA 4U3CA 4O19A 2D69A 3WDQA 6A3HA 3WLSA 1L6SA 6REQA 1KFEA 2YL9A 2FZ9A 2XZ9A 4WKAA 4WZHA 3USZA 3N2XA 4EP8C 4RNHA 3VKKA 3DFPA 4R7WA 1EP3A 3O7UA 3DX5A 3B3DA 3SCPA 1ITQA 2QCNA 1WKFA 3S1GA 3WNPA 1F6PA 1UPMB 3M41A 1E3XA 1JUEA 3RAOA 3ONCA 5M03A 3LCIA 1W5PA 3WD1A 1TJPA 4GK8A 1Y0EA 3VC5A 3QMSA 1TPVA 5T26A 4CGTA 3W7LA 4S3CA 1J93A 2YW3A 4MSSA 1SMAA 3CIWA 1EBHA 4LUTA 3W1RA 2X8HA 1J18A 4NZFA 5E09A 4Y8EA 1LQ2A 1HUVA 4ZOAA 1RD6A 1TX0A 1Q63A 1HKWA 1KBIA 1B9BA 3IIPA 4Q4QA 4QNWA 4R34A 1U22A 3HGRA 3LD5A 1IXNA 4M24A 2H6RA 1L6GA 3NQVA 4WJEA 5CZ0A 2W91A 4QXIA 4ACZA 2VZSA 1UIOA 2H9AB 3PVFA 2WC7A 4R85A 2DH2A 4OQVA 1E9IA 2PWEA 1PV8A 2Q3OA 4M6VA 5HNUA 2HXUA 3WELA 1MRQA 5CG7A 4NZ5A 1IQ8A 3R25A 3L12A 4J3TA 1TE6A 3H7RA 4Q4KA 1V7YA