4HCDA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
rcsb
source organism Agrobacterium tumefaciens
total genus 126
structure length 384
sequence length 384
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hcdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hcdA01
3ZLFA 5ENLA 1MUCA 3OP2A 2GGJA 3S5SA 1WUFA 5J04A 2DW6A 3T6CA 3JVAA 1XPYA 3D47A 3R25A 3RRAA 1XS2A 3H7VA 2PGWA 3TWBA 3SSZA 2MUCA 2XH7A 3RO6A 3DERA 2QDEA 3UJEA 1BKHA 3GC2A 4H19A 4K1WA 3TJIA 1P48A 2DW7A 2OQHA 2OG9A 3UJSA 1R0MA 4HNCA 2O56A 4A6GA 3H12A 3QTPA 2P88A 3TJ4A 3B97A 1SJAA 3IK4A 3OPSA 3RR1A 4GFIA 2OZTA 3N6JA 3QN3A 3ZVIA 2XSXA 3VC5A 4H2HA 4JN7A 3QPEA 4E4UA 3ZVHA 3MUCA 3CYJA 3NO1A 2HZGA 3UCCA 3UXKA 2P8CA 3FXGA 1MNSA 3V5FA 4DYEA 1MDLA 3I4KA 2PGEA 3GD6A 3U4FA 1KD0A 1NELA 2QGYA 3ZLGA 3FYYA 2AKZA 1SJBA 5FJOA 3UJ2A 3DESA 4MMWA 3OZMA 3JW7A 4DWDA 3QKEA 4HYRA 3R0KA 4GYPA 2HNEA 4A3RA 1ONEA 4DN1A 3FV9A 4FI4A 1BQGA 3UJFA 2PSNA 3T4WA 1MRAA 2P8BA 2OQYA 3DFHA 4ROPA 4J3ZA 3T8QA 2GGIA 3I6EA 3MZNA 2XH0A 1WUEA 3OTRA 1KKRA 3I6TA 3TWAA 7ENLA 2PODA 3HPFA 3Q45A 2QJJA 4HN8A 3CK5A 2QJNA 3DG7A 3R0UA 3EKGA 2AKMA 1ECQA 4J1OA 2P0IA 4X2PA 4GISA 5BOEA 3ES8A 1MDRA 1W6TA 1SJDA 4KPLA 4DXKA 3UCDA 3SBFA 3VCCA 1E9IA 2OZ8A 1TZZA 1PDZA 3OZYA 3FVDA 1JDFA 3CB3A 1TE6A 2OVLA 2PA6A 3FJ4A 1FHVA 2PP3A 3DFYA 3DDMA 3NFUA 4IZGA 2POZA 4HPNA 4DX3A 4EWJA 2P3ZA 3PWGA 4H1ZA 4G7FA 4GYPC 1L8PA 5FJUA 2AL2B 3RCYA 3NXLA 5EU9A 3ES7A 3OW1A 1EC9A 1DTNA 3VCNA 2OZ3A 3EEZA 3K1GA 2PU1A 4A35A 2PTXA 4GMEA 2OX4A 3S47A 5FJRA 3CT2A 2CHRA 3R10A 1ELSA 1JPMA 3TCSA 1KCZA 2PTWA 3MWCA 2PP0A 2FYMA 3VDGA 1RVKA 2HXTA 4F4RA 3DG6A 3NZGA 3KUMA 3VA8A 1YEYA 3D46A 2GGHA 3STPA 2GSHA 3QLDA 2PMQA 2QJMA 4E8GA 1JPDX 2GGEA 2FKPA 2OFJA 3V4BA 3N4EA 3R1ZA 2ZC8A 3N6HA 4JN8A 1P43A 2PTZA 3N4FA 3H8AA 5IDZA 1EBHA 3FCPA 2XGZA 4G8TA 3BOXA 2MNRA 3CXOA 3PFRA 2GGGA 3MY9A 3TW9A 3GO2A 4E4FA 2NQLA 3SN4A 1F9CA 3SJNA 2OLAA 2QVHA 4IT1A 2QQ6A 4YWSA 3RGTA 3CAWA 3MKCA 4KEMA 1EBGA 4GGHA 4HCHA 2XH4A 2PU0A 4M0XA 4KWSA 3T9PA 4K2SA 1KKOA 1R6WA 3DGBA 1FHUA 2RDXA 4JHMA 1PDYA 1EC8A 4IL2A 3BSMA 3SQSA 5BOFA 4Z17A 4M6UA 3U9IA 3P0WA 3Q4DA 2XH2A 5FJPA 3IJQA 2HXUA 3SN1A 1OEPA 3UGVA 3ZVHB 2PTYA 3IJLA 4GGBA 3DG3A 3GY1A 1NU5A 2AL2A 3VC6A 3VFCA 2GL5A 2ONEA 4DHGA 1EC7A 2GDQA 4H83A 4KT2A 2OO6A 6ENLA 4HCDA 3ENLA 2PP1A 3P93A 3H70A 3TTEA 3BJSA 3V5CA 1JCTA 4ZCWA 3JZUA 3RITA 4Z1YA 4IL0A 1TKKA 4MKSA 4IHCA 2PCEA 3DIPA 3UXLA 4GIRA 3UJRA 4MGGA 3SN0A 5FJTA 2OPJA 3TQPA 2QDDA 1IYXA 3ZLHA 3PWIA 4IP5A 2AL1A 2PPGA 4K8GA 2OKTA 4ZA0A 3V3WA 3MSYA 3PK7A 3R11A 3IJIA 4ENLA 4FP1A 1SJCA 4E5TA 4HNLA 3DEQA 4HCLA 2PS2A 2I5QA 3MQTA 4E6MA 4IP4A 3TOYA 3THUA 3P3BA 2ZADA
chains in the Genus database with same CATH superfamily
1DJQA 1R3SA 4QBXA 1C29A 1Q1WA 3KCJA 3LV5A 4C6FA 2GWNA 5C9WA 3T78A 4XD4A 5J04A 2Z00A 4CU6A 1JRCA 1B9BA 2WBGA 4Z1BA 1EO7A 3IJ8A 3W86A 2Q3OA 4BEQA 2Y70A 1GOXA 1E73M 1TR9A 4XTDA 2PD9A 3M46A 3RO6A 3DYPA 5D32A 4PCTA 1ZS2A 3ABZA 3UF9A 1D2KA 2VNCA 3BLOA 1MW1A 1VAHA 2Y7EA 4L4OA 5DY2A 3W9ZA 4H9UA 4UTFA 4RZ4A 2ZDSA 4FOJA 4BCEA 1VQZA 1F3WA 4B9ZA 1RPKA 4IFRA 3U57A 3H12A 4WSHA 3URQA 3KVJA 1PTGA 4EACA 3OLGA 3IK4A 1EPXA 3VZXA 3E12A 3C0QA 3FK4A 2E9BA 1A53A 4A3YA 3ZVHA 1XPGA 1N82A 4ACZB 1JZ4A 1RD5A 3MCNA 2VKZG 2W5FA 4B91A 4DXXA 2IUZA 4LY8A 5MKGB 4G1NA 5BROA 1LLZA 1NOWA 3NWRA 1BVWA 1UB3A 1QHZA 3FYYA 1E70M 3STGA 4DJDA 3WBYA 1DXLA 1A49A 5AVNA 3JW7A 3QKEA 3NQ8A 4J9JA 3MCMA 3GQYA 1XBZA 3OIHA 2VR5A 2C1HA 3NZRA 1OJXA 1P7TA 1TYPA 3SRFA 1M7PA 4Q6XA 3FSUA 3IAPA 1OFOA 3LENA 3L4YA 4PN2A 3T0CA 4AVNA 5KMYA 2VCCA 1U1JA 4W8AA 3E2RA 4BF9A 3I6TA 4AFYA 1HW6A 1N62C 3SR6B 2O55A 5IDIA 2IKGA 1A5NC 2J7DA 3R0UA 3EX2A 1UD2A 3QSTA 1FWNA 1UR3M 4KIEA 2GVJA 3EWZA 4NAEA 1HO4A 1ZP4A 2JBMA 5LNRA 3B0VC 2V5CA 2VD9A 2AAMA 1GRBA 3W70A 4QG8A 3W02A 3DN5A 3IPWA 1H1YA 4YTTA 3M0LA 1TCDA 5C9RA 4F0HA 3TW6A 1IWPA 3PZTA 1TPUA 4FALA 3SSJA 1VLIA 5F2IA 2CU0A 3STCA 3FJ4A 1JEZA 3QQ1A 4AF0B 4PMVA 3DDMA 2A6NA 2VC7A 4GIEA 2DSVA 1XLJA 2WANA 2WBAA 4GUFA 1R7AA 3CLMA 3PG6A 4ZQPA 4A8LA 3V75A 1FDZA 1ESWA 3IACA 5DCEA 2EPKX 2J25A 2AL2B 2E9MA 3UNTA 4M7TA 1DTNA 1TQJA 4RW3A 1W5PA 3RLVA 3R13A 3A22A 3RLUA 1EJRC 1UWIA 1PIIA 1W1B1 1H4PA 1F6KA 4R33A 2D23A 1XYLA 3KZSA 3L0KA 3U2CA 1KTNA 2X42A 3OC4A 3RFAA 1DP0A 1PXGA 1UMYA 1VHCA 2GSHA 2HK0A 4J28A 4Q4OA 1KC7A 2V5KA 1VBJA 2B4GA 2QJMA 4REQB 1CGYA 1OGSA 4FXRA 4RZ6A 3FGCA 3WQDA 3IGHX 3LYEA 2X30A 4L56A 3TQVA 3H7RA 2XIIA 3R79A 4F3HA 2OGYA 4HKPA 4BF7A 1GKQA 5DEZA 1UUOA 3CUJA 5EMUA 4UTMA 1ZAJA 1JFXA 2G4FA 2GOKA 1EIXA 1W0MA 2E9LA 4ML9A 4XIMA 1E6SM 5KEZA 2FZBA 2VUNA 3LPFA 4TVDA 3VIMA 4TTUA 3LBCA 4HJFA 3U2OA 3MUY1 2Z26A 3BUVA 2PWDA 4GGHA 1DEDA 2VFEA 1TUXA 3EOSA 1RA0A 1G4EA 2QVNA 4HSNA 3BOFA 4CVWA 2ZFAA 2OSWA 4WY0F 3VGDA 1KGUA 5CC3A 3BMVA 2WV8A 5FEZA 4IPIA 4B2DA 5CJ5A 3IEBA 1QDSA 4XZNX 3P62A 3ARUA 1W3KA 3I7SA 4KFPA 5MHBA 2WC3A 2XINA 5JCNA 5HQMA 2E5AA 2PTYA 3AM9A 5AY7A 3UD6A 1BGAA 1WXZA 3IJLA 2VGGA 4JTLA 3R6IA 1B31A 1NU5A 2DP3A 4GPNA 4PUKA 2XUCA 1HZYA 5BXTA 2CBVA 3NURA 2IXUA 1N8WA 2E7FA 4KIRA 1DXEA 3P93A 5C7HA 1JCTA 5EFDA 4ADUA 1EUNA 5C70A 4Z1YA 2YGYA 2DZBA 2PB1A 4GQ0A 4MHBA 4S3EA 1HKIA 4JAWA 4XV0A 3YPIA 4O19A 4TXEA 3DIPA 1VGAA 4J3VA 3GBEA 1XBVA 2DZAA 2BDQA 4O10A 4ZQMA 4GVFA 5HUOA 3AICA 2W91A 3C0LA 3VKKA 4PB4A 4MB1A 1IWAA 1O60A 2AQOA 3P5ZA 4ZA0A 1OC6A 4PL2A 2WPBA 3VD3A 1H7XA 1QI4A 2BMBA 1HN1A 2XM2A 4EANA 3MANA 2A7PA 4OHQA 4LSBA 3S9IA 3NEVA 4DF0A 3GTFA 4MPQA 3MQTA 2IQDA 3MVIA 4TV5A 2VUYA 1WQ5A 4Q8WA 4UTTA 3IIVA 3LB8A 5M2FX 3NZ1A 4LC6A 2KAUC 3OP2A 2IW0A 4S3FA 3S5SA 1VFOA 3B4YA 5LKYA 3CTTA 3AU6A 3N9RA 3F5KA 1OFAA 3B9NA 1KM4A 3T0BA 1QUMA 3WLJA 1F3XA 4LNCA 4LRSA 3E02A 1NARA 1NH6A 4R9XA 3DJGX 3WH8A 4QSFA 1Y65A 3EMQA 1TUFA 4LCQA 5JBEA 1QPKA 4UQDA 4IIEA 4ADWA 3AROA 3QZEA 3L68A 1UA3A 1GZJA 2DSUA 1XIIA 1X8CA 3N2XA 3GHTA 1BWCA 3KLLA 2PLMA 1B57A 2P5NA 5LNUA 2FHFA 2ZRXA 2ZZ7A 4Q8UA 2C0HA 3I3BA 2NQ5A 4RX0A 2E5CA 2D3LA 3BH4A 4JYEA 1AH4A 2CDUA 2WYSA 3OZPA 3UCCA 5HBFA 1SQ7A 2YXGA 2CBUA 5FF0A 4GZ7A 3W38A 1HL9A 1XM3A 2VVNA 1P0DA 5L6UA 2FVLA 2JKPA 1GONA 1F05A 2D73A 4NAFA 1VQTA 1GZ1A 1XLMA 5A8QA 1KCKA 2VR2A 3PB2A 2BY1A 2ZUVA 1E40A 2IKIA 2WSPA 3SIMA 3M1ZA 4IMFA 3KTXA 5AYXA 4MMWA 3U8GA 3LK6A 1DWIM 3ABRA 1EO5A 4JTGA 1GT8A 2X0SA 3UJFA 3RM8A 5B80A 3BQ5A 4K1GA 1P0EA 4O1EA 1OVDA 3XISA 4LFYA 1WUEA 3KRBA 3GNNA 2ZXBA 2A3LA 2L5HA 3WZ0E 1UKPA 2OKOA 5DMYA 4CLMA 3ARPA 1KGXA 3C0JA 3WENA 2VENA 3BCJA 1ECQA 1W1YA 2P0IA 2ZZ5A 5FL0A 4PRTA 1TPFA 2C79A 4M7SA 1XLHA 3N9KA 1OCJA 1TE1A 4IMDA 3VIOA 1XRVA 1K9DA 3B06A 5DCBA 1EHNA 4A8RA 4NZ5A 4IOTA 2VX5A 3BG9A 1W1TA 4L6OA 4OUIA 4W87A 3PBWA 1OD8A 1UR2A 4GXPA 5CPNA 4F9JA 5IHRA 2C8NA 3OVQA 2POZA 3GYEA 4KEUA 1LP6A 4EAYA 1V6XA 2I1OA 4NXKA 1JAEA 1L8PA 3PJUA 4JQ2A 1B0IA 5A6KA 5BNKA 3BAYA 3ALGA 2F6KA 1PBGA 3DCPA 1BRLB 3NQDA 3NYDA 2VRQA 2CLMA 2AGTA 3BMXA 1VP5A 3HG2A 2D24A 3T55A 5K7JA 3PZ9A 3RPTA 2WK2A 3AJ7A 3SUVA 4AY8A 1BVZA 4PCFA 3FHQA 4CN1A 4WD0A 4GR1A 4QFUA 3USZA 1I6NA 3DECA 2FQIA 2YZ5A 1G1YA 1KR1A 2Q8XA 2RGLA 3JR2A 3OHIA 4KF1A 1A5BA 2GQ3A 1UD4A 3K46A 1GOOA 2PZNA 3AQUA 4R34A 3PZIA 3PPFA 1VEMA 4WZHA 5D9NA 1FWWA 4UC5A 5CG7A 5DN1A 5F4SA 3W7KA 5IDZA 4B2DD 5ECVA 2F7FA 1QWGA 3LCFA 3BARA 4AWSA 1UQYA 1MUMA 1S2CA 3GW3A 3G8EA 3DGZA 1UZ4A 4UFMA 4EMJA 1LCOA 3WELA 2YDSA 4GABA 4JQ3A 3DFPA 5DRIA 4I9JA 2G96A 1ODZA 1RCOB 2HS6A 3WNNA 3IK2A 1YE4A 2CXGA 1JCXA 1GYMA 4HSOA 4KS0A 3UW6A 3WDIA 2H3DA 2W79A 1KFCA 1ICPA 1J79A 3IJ6A 2DQXA 4K68A 3TNBA 3PAJA 4TX6A 4NSBA 5JUVA 2XJ7A 1SW7A 5G2HA 3WBEA 1H11A 2CERA 1D7FA 5C2CA 1V3MA 1LJYA 3B05A 3HQOA 4RV3A 5JXQA 4HHLA 4UMBA 1CB7B 4AG0A 5E6YA 4GY1A 3Q4DA 1QWKA 3S2LA 5D38A 2OXNA 1J2BA 4DM1A 3LLFA 4NL1A 3I7QA 4NP7A 1BLIA 1PYMA 2F84A 2A85A 3NM3A 2QUUA 3SO7A 4L65A 2G3IA 4HCDA 3ENLA 2HVNA 4HA3A 5I2UA 3TTEA 3GLCA 2Y7GA 2D1ZA 1XGEA 4J40A 5EBAA 3RITA 3CMGA 4OT7A 2I5IA 2Y0FA 4ZQOA 2H6RA 4UOJA 5AYIA 4O54A 3GDMA 1TWSA 3QHMA 3GXFA 1PX8A 3HBLA 3ARVA 4Y9OA 4NF7A 1QW8A 1S1RA 1LRTA 4PMXA 4AXKA 3OQ8A 4LXFA 1QPOA 1TWDA 1XW8A 1ZHAA 4J3WA 2W54A 4YXGA 4K8GA 1E1CB 5I77A 3V1HA 4JY9A 4CNNA 5GJPA 3W1MA 3O0KA 4PUEA 1L6GA 1VJSA 4ERGA 3LUTA 4RW5A 1N7KA 3WK0A 2OLHA 1JROA 2R14A 3R94A 4F0SA 4IG2B 3TV8A 5C71A 4XVEA 1NPXA 5D2VA 3E9AA 2WWDA 4QAWA 3CZEA 5HAOA 4UWMA 4LUJA 1CNVA 3EMCA 4WDWA 1GUVA 2FHBA 4RZBA 4HU8A 3DBPA 3IUIA 1WUFA 2QHAA 4AVFA 4DNHA 5CSYA 5FF3A 1FOBA 3VD9A 4P7LA 4A3HA 3IANA 5D4YA 5EPDA 1KFWA 2V5DA 1PO9A 2V5BA 4B4HA 1QI3A 2QYGA 1XFCA 2VX6A 3CHDA 3BZJA 5FL1A 1UH4A 2XH7A 4E2VA 1PS9A 2JIWA 1OG0A 4Q3MA 4XUYA 3NXFA 3WF3A 3FYOA 2OQHA 1EA0A 5IRPA 3CUIA 1Z89A 4HNCA 2I17A 1I2QA 3WJZA 3MWAA 4ICNA 2I56A 4C6LA 1Q4NX 3F2BA 2BGSA 1E55A 1V51A 1EHAA 2GR3A 2YDRA 4JN7A 1H7WA 2YBTA 4LJ3A 3PWAA 4PFHA 2FTPA 4PRWA 4XD6A 3M07A 3FXGA 5A1AA 3ANYA 3TEVA 1MDLA 2BY3A 2YFNA 2OLSA 3LD5A 2GK1A 1V6WA 2ZZBA 3TYUA 4R9OA 1VEOA 5KITA 4LANA 4O28A 3H2AA 1ZY8A 5JCIA 4C65A 2YDQA 3T2QA 4E2BA 3UR8A 1LM1A 4IJRA 1XIJA 3R0KA 3TC3A 5CBBA 4S3JA 5AYZA 4ZMGA 4GKTA 3FDGA 2WMHA 3BMWA 2X7WA 2QKFA 4WJEA 3OTRA 3TC6A 5T9BG 4UFIA 2CC0A 2CETA 2XVLA 4GJ1A 3TWAA 4O14A 2DJLA 4NUWA 1DOSA 2CLPA 3L5OA 1YDOA 4ORIA 4KCTA 1JCYA 3EEGA 4H4WA 4BK9A 3P81A 1F73A 4XQ6A 5IBXC 4XB3A 3M47A 5JH1A 3BCFA 2G5WA 3FSTA 3CIVA 4V28A 1RBOB 2NVCA 1XIHA 4WSJA 4PMUA 3UWZA 3WK2A 1DKWA 3NPUA 1H3GA 1JNEA 1HKVA 4AW7A 1HKMA 1T3QC 3ECQA 1TIWA 3W6LA 3NPVA 4QDMA 5HQLA 4HOZA 1V02A 3NFUA 3PF3A 5K3VA 3HZ3A 3VNIA 4UTWC 4I7UA 3HJEA 2GQ9A 2DZVA 1J12A 2FMOA 2RDWA 4A3QA 1DE6A 2WBKA 4GYPC 2WJDA 2IPWA 1IWBA 2GJLA 3NL5A 2VCBA 1JRPA 2QUMA 1E6PA 4UQ9A 3ONBA 2QPSA 1EF2A 2NX3A 4MF4A 4BY3A 4HB7A 4W7UA 4Z2KA 5D02A 1Y7VA 1UIOA 4I7VA 2NXGA 4MDOA 4Q8TA 1PKYA 4XAPA 2ZICA 1GYNA 3HJZA 4BKNA 4LUTB 1OD0A 1HJQA 4FX9A 4MB5A 1H60A 4H01A 1E1EA 3TYBA 4Q4KA 1ZRQA 1NFPA 1S5NA 4XKYB 4U33A 1PWLA 2J7GA 4DBUA 5G5HB 1L2UA 1UKTA 3BGJA 2OFJA 3O6CA 4GRTA 3MI6A 3LTSA 4H4VA 4XAGA 3L8KA 2CEQA 6ALDA 2TRSA 1MZHA 4CD4A 4B15A 1ZPTA 3UPMA 2XFWA 2Z7GA 4N0RA 3SN4A 5KZ6A 4ECLA 1LOSA 1EJXC 1CGXA 4K8DA 1PKNA 3MI2A 4P7QA 1XWYA 4ZZ9A 3O16A 2V8ZA 1JPHA 3FFSA 1XRFA 3EXSA 2PDPA 1IEWA 2VURA 1SYTA 1I0DA 4HCHA 2GRTA 4RLIA 1OHLA 4I5XA 1ZLPA 3FYPA 4K2SA 1W3IA 3EGJA 3H24A 2RDXA 3W7CA 4JHMA 1EC8A 3A9IA 1RBAA 1SZFA 2WPEA 4W88A 2ACRA 1E6XM 3LTPA 3NSXA 3EPMA 3K4AA 4M19A 3CHCA 3LRMA 1WV2A 1J96A 2OT1A 2X1UA 2E6DA 4A05A 1E0TA 2RGMA 3ZVHB 4PL1A 4FOUA 2TAAA 4X22A 2YA0A 1FWGC 1VF8A 1JR1A 3HG3A 5GVJA 4PMJA 4QGCA 4W4QA 2YA1A 3BAIA 3GTXA 3A4AA 1HJUA 3DFTA 1LBLA 4DVOA 2W66A 1P0KA 3GH7A 5AHMA 4MJMA 2WMJA 4EF8A 2HCVA 2GOUA 2XISA 2DT2A 2DH3A 4JDRA 1P7TB 1ZJBA 3UQNA 2E6YA 4MLRA 2Y8VA 1GV4A 5EYWA 1JI2A 3GNRA 2PUZA 4JCLA 5JIPA 1FEAA 3NQFA 3ZLHA 4DO6A 3TK7A 1OF6A 3RXZA 1F07A 3NOYA 1DJYA 4BJHA 1DIKA 3SGUA 4EWND 4B9YA 4ZB5A 4HHMA 5B7YA 2EEXA 1KTBA 4CQ8A 2FH6A 4DQWA 3LM7A 2OTDA 1KXHA 2WPFA 3H21A 3K13A 1B54A 5FIPA 1JZ8A 2ZUUA 5EBUA 5A6TC 2PFHA 1TELA 3ARYA 3B8UA 1K4HA 5G4WA 3FEMA 4M8UA 4GI8A 1TTIA 2DZTA 2H3BA 2W3SA 2C14A 2PD5A 5D2YA 3QYQA 1NOFA 3QR1A 2FDSA 3QFBA 4L9YA 4DI8A 4G56A 4B5NA 4EMWA 2UWFA 3WD2A 3II4A 5F1VA 1RJQA 2QCDA 2PRLA 3OVPA 3QW4B 1R0MA 4Z2HA 3QQWA 3W7RA 2I7GA 4H4IA 4CN6A 1TPH1 3TJ4A 2F6UA 4MNJA 1AQFA 3AMZA 3GB6A 5H8MA 1JDEA 3JU2A 3BZGA 2V69A 1SVDA 3GR7A 1VCGA 3FA4A 3VNLA 2BVWA 1HKJA 3H55A 1H0IA 3CIXA 1A5KC 1TV4A 2HE5A 3OVGA 3S83A 3NYZA 1LWJA 3VTRA 3LEPA 3FLUA 3FGCB 3OO2A 4QG9A 3KBMA 2ZXAA 2VVSA 4WXZA 1MUWA 3DAQA 1Z69A 1VPQA 1XSJA 4JDYA 2GJXA 3GH5A 2RABA 1XLCA 4JTHA 2V5LA 2QCCA 3PTKA 4IQDA 3NL3A 3UG3A 4IISA 1E0UA 3UWYA 1M04A 2QXWA 5CPLA 2QJJA 3UYCA 3VNMA 3KLKA 2NV2A 5BW6A 5GNXA 4ZL1A 3MYPA 3VUSA 1E9YB 3IVUA 2YVJA 1W37A 5CAHA 5U25A 3GC5A 3GKAA 4Q33A 1OJTA 4BWLA 4LBRA 2Q8ZA 3S2CA 3PUEA 3N73A 1JJKA 4DXKA 2R1MA 1J0ZA 2V6AA 4YTSA 1C92A 1TTJA 1IQ8A 4U2ZA 4HMNA 2F38A 1CGVA 3RPMA 3UETA 3UVIA 1BXBA 1R30A 1FP8A 1W54A 2YIHA 3GDKA 5J8LA 5I07A 2NV1A 4CNOA 3KBJA 5E09A 4MZYA 3IUDA 3C52A 1TX0A 3V1PA 1Q66A 1RHCA 4KESA 2DFAA 4NI8A 1VHNA 3LRKA 1HJSA 2G97A 4B3KA 5TIMA 4NRSA 4ZSUA 2DUZA 1V6UA 3ZJ8A 1N60C 3N11A 3U48A 1HGWA 1TFVA 3TSDA 4U28A 3PB0A 4AHOA 4XBKA 2UY2A 4GUIA 3N4AA 5I3GA 1FWAC 1KRMA 1I2OA 1RVKA 2D2GA 4GXMA 1Y5VA 3ISIX 5KTLA 2NVDA 3E1F1 1NWRA 1JXJA 1EIBA 5HK4A 3WEMA 4HOXA 2DUXA 2YCLA 1QNRA 3G0XA 1JUBA 3V36A 1Q4WA 3O1NA 5GQBA 5C9XA 1S1PA 4PB3A 3N4EA 1YLVA 2WJZA 1XR2A 4QIUA 1TWIA 2TPSA 4A2RA 5T8GA 3G5EA 1XIFA 3CHVA 5HJYA 1IF2A 3UA3A 2YL6A 1P4CA 1KN0A 3WLHA 4RL3A 3VNJA 2YYTA 4DYKA 4J27A 3FHAA 4R88A 4ASTA 2DPEA 4AZBA 3FA3A 1HJXA 1ZZMA 1YXCA 3H54A 4JTRA 3EA1A 3CU2A 1UR0A 2OU4A 1KV5A 3RGTA 5CG0A 1JZ2A 3R5EA 1OCNA 3BOLA 2QNEA 1EQCA 2PU0A 2V3DA 4AHQA 2V2CA 4PUDA 4EPEC 3W85A 3M0MA 1FWFC 4EPBC 4FAMA 2E40A 3W1TA 3ARTA 3RR4A 1BEUA 1OGGA 4KFOA 4HK6A 3CGBA 4TUFA 3NVVB 5XINA 4NX0A 1LOLA 1QFEA 1XLKA 3IIZA 1FRBA 4F0RA 4UIOA 1XX1A 3B0UX 7CGTA 2BOFX 1FWIC 3UFYA 2ZX5A 4ZB2A 2J6XA 3VE7A 4Z2GA 4H4PA 4Y9NA 1RQBA 3MBDA 3TMQA 4XAZA 4P7RA 2B7PA 3P67A 4F0KA 1H1ZA 2ZUNA 4NAFB 1QOPA 3VGEA 2NT1A 1E4MM 5BWFA 3ZSSA 4MFEA 5FI8A 1KA9F 3PSWA 1H2JA 3V5CA 2XIQA 1KM6A 4QJ1A 1LF1A 2G3JA 2CESA 4FLSA 4RNIA 4YTUA 2BC0A 1K7FA 2V3BA 4MGGA 3SN0A 2OPJA 2YXOA 1XLGA 1BVNP 1AH3A 4W93A 5D8WA 3ARZA 1J6PA 4D6FA 1JPIA 3U4AA 2PDBA 1XDJA 2P76A 3IARA 3H23A 4A3UA 2J9ZA 4CNSA 3K4WA 1CGWA 2Y4SA 4HNLA 3K30A 3AU2A 3GNDA 2GJPA 4AZHA 4OUEA 4OGZA 3KLJA 3CHFA 4JFSA 3KRUA 1S38A 5HOSA 3SCTA 2WHKA 3AC0A 1Q7ZA 2OYMA 1VC4A 3TMLA 3NIYA 4EQWA 1H1NA 1H49A 1A0CA 3NZQA 1XC4A 3G6MA 4C6IA 1DIOA 2RUSA 2WSQA 1JPKA 2WZMA 3VGBA 1AW5A 1KO0A 2H8XA 1BD0A 1CXLA 1EX1A 5K9XA 3F2DA 2DV0A 1GEQA 3KBSA 1VFMA 4WIWA 5FSDC 3ITCA 1LG1A 3S46A 3FKRA 2HROA 4NNAA 4WDUA 1K6WA 3VM7A 1YNYA 5EL1A 3SCPA 3WNPA 3LCLA 4WKHA 2FPVA 3PPGA 4H3DA 1XQLA 3MV01 4H8HA 4IH3A 1QO2A 4GIYA 4LYQA 3LPOA 1OFEA 3S5OA 5AYBA 4UTKA 4A29A 3IV8A 1F8IA 3VKAA 1A4LA 2XIMA 3E0LA 4W9TA 4KH2A 3M7SA 3QF0A 3V5FA 3VOJA 1X6UA 3WF4A 1GSNA 3CL7A 1IXQA 4KWVA 3MDWA 3TTYA 4E2OA 3OB8A 5F7UA 4AD4A 5E1QA 2JF6A 3W00A 1NVMA 4O0KA 4Z2LA 3DHUA 4FS9A 2PAJA 3OBKA 3KOXA 4NX5A 3ETRB 3SY8A 1FKWA 4X9SA 1FH7A 3RX2A 1UH3A 4HYRA 5I78A 3O63A 4U10A 1E5JA 2C16A 1CX9A 1G67A 1O4UA 3H4GA 5EMMA 1W3LA 2PBGA 3I6EA 1T41A 3NO5A 3AXIA 3CV2A 2OODA 3B40A 3N34A 4BHYA 3HN3A 4GBDA 3AI0A 4R27A 2FGLA 3QW3A 2AQVA 3CK5A 1EGZA 2D20A 4HU0A 4JKKA 2WXDM 2VJXA 4OBTA 4JHZA 1F76A 3K5XA 1EQPA 1XRSA 3O05A 3VMOA 1K3UA 3AOFA 2GH5A 1CZ1A 2X50A 3EX4A 1X38A 2GR0A 2D2JA 4YCOA 1RBLA 5HMDA 2PDQA 4WR3A 3BLKA 1P0NA 1YDYA 2A3AA 1POKA 1V08A 5FJIA 4YU1A 1TZZA 4EM4A 2PRHA 3PHAA 3CAKA 3OZOA 1QBAA 2J13A 3AIBA 4YYCA 2YVGA 4KCWA 4NZ3A 1W32A 3PBYA 2FIQA 5H8UA 4YYFA 1ZALA 3FIGA 4H1ZA 3M44A 3FEQA 3UWEA 2VD8A 3GFYA 1QW9A 3PBVA 3N29A 3IGSA 5LA2A 1XGZA 1MMFA 2V30A 4UTJA 2OX4A 3UGRA 1WB0A 4IPJA 1ML1A 5BMWA 1KCZA 2PTWA 4HU4A 3A6OA 3NQ6A 3NA8A 4PR4A 3AMDA 3LQGA 1EP3A 4JX6A 4E3TA 5KETA 1GGOA 2YLLA 1U22A 1V0NA 2NQHA 3WQ5A 4INFA 3KWSA 2Y6ZA 2EGZA 2IMRA 1OB0A 1Q1RA 1B3YA 3TZFA 1WAUA 3LHUA 1V77A 4TVYA 4KFNA 4N6EA 2X8CA 3NVZB 1X2HA 5KZMA 2TSYA 3UP8A 4JN8A 3CWNA 3MMWA 3LZ3A 2CCRA 3WQOA 3ARQA 4JBRA 3PG9A 1UBSA 3WDQA 2C19A 5A8OA 4HU3A 3DKLA 3CJPA 3EA3A 4CD5A 4QRNA 5M03A 1ZAHA 4IGHA 4LS2A 1RCQA 4KETA 1YIXA 1NJJA 3TOPA 3FN9A 2QCFA 3AIUA 1GRFA 1XANA 3A21A 1TMLA 4DEFA 1Z44A 4U3AA 1A3HA 4ES4A 3S1WA 2PEVA 3OLIA 1LOQA 5G1TA 1OFBA 4BI7A 3B8SA 1H63A 4WXYA 4RE0A 2XH4A 5CEWA 1GETA 3F4CA 3HG4A 2ZCGA 3SGZA 3EWUA 3IJ7A 3SJ3A 3GHRA 2BXZA 4C6EA 1Z32X 1HL2A 4TMBA 5CLTA 2J7FA 1ZUAX 1JCJA 1FHUA 4GC4A 3GVQA 5U4NA 1CEOA 3VIPA 4FNUA 3L2IA 5D04C 5CBJA 4MWAD 4NHVA 1UWTA 1ZCCA 3NS1B 5JIWA 1W9XA 4J3SA 2BB0A 4L80A 2HPIA 4MLJA 4MG4A 4MJ4A 4K8EA 2Q02A 1HX0A 1QASA 3A5VA 3MVTA 3QV7A 1RPXA 2CLKA 2GSJA 1BPLB 3WNMA 3PNZA 3HOJA 4JIHA 3C4UA 1YNPA 3RDKA 5T91A 2DVTA 3O0HA 5HINA 1C93A 3WMSA 1RVGA 3GFXA 2GK1B 4LC8A 2ONEA 1WE5A 4DHGA 1A0EA 1KV8A 4CD6A 4AAJA 3GXIA 1XH0A 5FA5A 1XP3A 4W8BA 1T40A 3JZUA 4DAIA 3WUEA 3UESA 5BWAA 5HA7A 4OQVA 5IFPA 1HKKA 3MP3A 2CLEA 3APTA 3SQMA 4RDZA 4WOZA 1E0WA 4O17A 3UXLA 5A8MA 3UJRA 3LMYA 3TQPA 3SY1A 1VBHA 4C6JA 3PWIA 5A8NA 2YB1A 2AL1A 2A2IA 3MP4A 1WCGA 3H2CA 4DRSA 4C90A 4QS6A 3W22A 5C5YA 1E0XA 4QJ3B 3LADA 1UP2A 3E0WA 1XYCA 4J3TA 3R43A 1ZDLA 2F2HA 4DBWA 2Z1KA 4E38A 4K36A 5LIYX 2WB5A 4Q4RA 4E8CA 3BWWA 5HJLA 5AECA 3W1LA 1VRDA 1P1MA 3JVAA 3XINA 1R38A 1M3UA 2VFDA 5AC7A 2ATSA 3QC0A 5HQEA 2F6XA 3BSHA 3H2FA 1Q6OA 3EF6A 3RRAA 1A3WA 1ZFJA 2X0YA 3BK0A 1GVYA 4JPGA 1M6JA 5CXPA 1ZXIC 2EQ6A 2XIOA 1V7AA 1XHCA 2HBVA 3RYSA 5LYRA 1TZ9A 1DHPA 1G7VA 4JTKA 3UJEA 4WKFA 3H4KA 1KCLA 5D37A 5E9XA 3VKJA 4C91A 2J7EA 5JU6A 2BASA 2FTYA 1R3QA 4DB7A 3S1XA 1TYTA 1KQYA 5HR6A 2OZTA 3N6JA 3VC5A 4V15A 2V3AA 1JL8A 2CBJA 3SCRA 3W1PA 1ZK7A 4O1FA 2OCZA 2F61A 1MW2A 3JUGA 4H00A 2R1PA 3S3GA 5ABEA 3A24A 1MQPA 5G4EA 3AYSA 1MVYA 1XDLA 2HPMA 3VDCA 2YZRA 5LIWX 5A6SA 3A7RA 1ZMCA 1FQ0A 3AWNA 1S5WA 1O68A 4JKLA 2ZWYA 3EDKA 3SUSA 5C0QA 1N8IA 1MRAA 4NU7A 4S39A 1F8WA 1CLVA 4K7YA 3W26A 3AO0A 5FJJA 1DQXA 5HMEA 3NGFA 2HEJA 2NUWA 4WY0A 3LHYA 1QBBA 2WWCA 2WJEA 2ZZ0A 3VABA 4Y7EA 3ZJ7A 3W4RA 4URIA 1DNCA 3WLNA 2G3FA 2I5GA 3QRHA 1O66A 3I6RA 4GISA 4YVVA 4M5PA 4PBGA 4KPLA 5B7ZA 3CL6A 3MT1A 3KWXA 3QHOA 1MEHA 1NDAA 4BV6A 1F5ZA 1VFSA 3SURA 4LS1A 2Q8LA 2A21A 1TCMA 2E4TA 4JTDA 1M03A 3CTLA 1KBIA 3C2YA 4PA8A 2QV4A 4JTTA 1LQ0A 1ME8A 2PA6A 1C8YA 3RX4A 1XI3A 2VX4A 5F1UA 4H4RA 2ACQA 2ZDRA 3W1AA 1C7TA 1VENA 3KS5A 3W27A 3OGVA 4P8UA 4G7FA 1IXNA 3SRHA 2DZWA 4JQ9A 3CL8A 4PTMA 4ZFMA 4EOUA 1FBAA 4A35A 2X1IA 1WKYA 1ELSA 3UZYA 1JYNA 2GYIA 5C2XA 2E5BA 5A6BD 1Z6KA 3KFTA 3N2TA 3G1YA 3VAVA 3LCIA 3W7GA 1CT5A 1DL3A 1ONRA 4GINA 3EWWA 4PUMA 3W2NA 5H6HA 3P0XA 4AD1A 2QCNA 3BAXA 2ATMA 4GI4A 3WLTA 3WH5A 5CAKA 3W3OA 1MQRA 1UC4A 1XIBA 1A80A 1W31A 4R3UA 2DIJA 1F61A 5TNVA 2XFFA 5DLCA 3N4FA 3VOIA 3GDTA 4LTSA 4O15A 3RU8X 2FB2A 3EANA 2UZ9A 4B90A 1LWHA 3HG5A 3ITYA 3HGOA 1RJPA 4JEJA 4H4SA 5GJMA 5CGMA 3RX3A 3N18A 4E4FA 5E9AA 3WSUA 2B0MA 4WKAA 3AHVA 3AISA 1K9TA 5D2WA 3WQWA 4MM1A 1H50A 3S4TA 4IFKA 2YVFA 4DWSC 2OLAA 2CIPA 3L5LA 4FXFA 4MZ8A 1OWQA 3LSCA 4QDPA 4H8UA 3QEZA 4Y9MA 3VIIA 2W67A 1HJVA 3WDHA 1PKMA 1ZAIA 2EPNA 1C9DA 1SZNA 3C2OA 5EA9A 2NUXA 3WNKA 1PVNA 2VEKA 1V97A 1D3HA 4LU0A 4QSHA 3W2JA 2QCDB 3GUWA 2NX9A 1EH9A 2NLIA 4IL2A 1J0KA 3VKDA 1H51A 3K2GA 3DHDA 1R86A 2YA2A 2OGJA 4DO5A 2PDJA 3CV7A 3TAKA 3S5NA 2VDIA 1WDPA 5CKSA 3A7UA 2V63A 2XH2A 2JK6A 3B0XA 1OX4A 1QPQA 2O9RA 4I9MA 3S2NA 3A3HA 4MDPA 1KBLA 1R9ZA 4OBSA 2QF8A 4GGBA 2E09A 2ZX9A 3MI3A 1K4QA 4FF7A 2E25A 3FY1A 1VLWA 3ZT6A 3CGDA 5FEXA 4XZ9A 2J47A 3BGGA 4MB3A 2GDQA 3OODA 2GQWA 4R7JA 4PTDA 5I0DA 1UWQA 4GK8A 5BOOA 1U5VA 3H70A 3QV9A 3LSBA 1M7JA 2QV5A 4YLWA 3SECA 2WCGA 3TJXA 3KW3A 2PWVA 5D2TA 2WOQA 2IXVA 3KP1A 2BSLA 2J27A 4O11A 4IL0A 7XIMA 3DZ1A 2X2YA 3D3AA 3E0VA 4DIAA 2D0FA 4GIRA 1FY6A 2GJXB 4D8LA 1O1HA 4UNKA 1UZDA 3QXBA 3G1AA 5C8BB 1S2TA 2J62A 3LPPA 1YXYA 5JCLA 1UUMA 4S38A 1PHWA 1LDCA 1OQFA 4JS3A 4QR6A 4X63A 1QCWA 2XSAA 1WXJA 3PFMA 1WPCA 3W24A 1GVEA 2V9DA 4HCLA 1WA3A 3G22A 4AYGA 4EP8C 5FOOA 3NVTA 2YAUA 1NFBA 4LQ1A 3IRDA 4PFMA 4UXDA 2W27A 1BG4A 3THUA 2ZA2A 2BXVA 2WVVA 1EPVA 1E1FA 1B3WA 1TRDA 4Z1DA 4XZLX 3O2LA 1ZY9A 2WMFA 4KEZA 5A94A 5G2WA 1LG2A 4G1KA 2DW6A 5CSRA 1SO5A 4AWUA 1IXOA 4GUHA 1L8NA 1Y5XA 2Y85A 4AUBA 3LB0A 1S5MA 4D1JA 3WY1A 4M80A 1GTEA 1M9HA 2PWUA 4EVZA 4PCNA 4PTNA 3SFKA 4NZFA 1VBGA 2QDEA 1XDIA 2VRJA 4EMIA 2Z24A 4MYXA 2DW7A 4ZOBA 4KCUA 3KOFA 5IBXA 2P0OA 4A6GA 3JZEA 4US5D 3RILA 3T2PA 4MY8A 2ZRUA 3OVRA 3TKFA 4LT9A 1G9HA 4BA0A 4IX2A 4P8VA 1SW3A 3ZVIA 5KVIA 1UJQA 2E77A 2OYLA 1B3OA 1XUUA 3Q67A 5ABTA 4DYEA 2HVOA 4OOZA 5TBOA 3LLXA 2DSZA 5I3IA 3SI9A 4AD0A 4IPPA 2BOEX 1NP0A 2YCLB 1A0DA 4A4AA 3SDOA 2ZWZA 3FAWA 4UTWA 1PSCA 3MUIA 3SB0A 4GYPA 3UNDA 2FPYA 4DN1A 4LBUA 1S3TC 3GFZA 3FV9A 3QFEA 3B4UA 4HD5A 1AA1B 1HVXA 1VYPX 1BQGA 1H7PA 3NCOA 4NNCA 5ABGA 2Z2UA 2OQYA 3S1UA 4J5NA 1AD4A 4WJ8A 1DWGM 4MWAE 3FNDA 3GTHA 3T8QA 4ACYA 4EKJA 4L61A 4XZIA 5FS9A 3G1RA 1NDYA 1NWTA 2VHLA 2Y5SA 4I8YA 3NZPA 3IJ9A 2WPCA 3GG1A 3WLPA 4TVUA 2FVMA 3GDBA 2QCMA 2J8FA 3HF3A 3QYSA 2X1TA 3AFBA 1YW1A 1GQIA 1HIZA 1M1BA 4IWWA 3WQVA 2ACUA 1XXXA 3WH7A 3OYXA 4J1OA 1MDRA 2GUUA 1VKFA 4CEUC 4IPNB 2DQWA 1LBFA 1C3FA 5KSWA 3SBFA 1A5AA 1O5KA 5C9UA 3KTCA 3VNKA 4AHPA 1HGYA 5HNUA 4GD0A 4IUGA 2WZHA 4IZGA 4XAFA 9XIAA 4EWJA 3TYDA 2YB4A 2TYSA 1U5HA 4JZ5A 1G6CA 5AHLA 4IP7A 5GPRA 1Z3NA 3SCUA 2NPXA 4WGHA 4K3ZA 3OW1A 2QIIA 1B90A 2PLJA 4NQ1A 2BFGA 2VWSA 1L6YA 5XIMA 3GVGA 1VFUA 2ZE3A 4FO4A 4GACA 3ZZ1A 4LUYA 2JGQA 2BNJA 3MWCA 4UCFA 5JH2A 3S2JA 1ZKQA 1H7RA 4GYKA 4JX4A 3GG7A 1JYWA 4P61A 4IMCA 2H9AA 4AMCA 3PP7A 3MO7A 2PMQA 1FEBA 3EOOA 2A3BA 1DJWA 4B5WA 1A5SA 1LRNA 1NIUA 4H6EA 3NG3A 4AD5A 1V3JA 2MANA 4G7EA 1J0JA 2C15A 3N6HA 5I3JA 4D1IA 1I75A 5J5RA 5D30A 2RKXA 1H2IA 1XBYA 3WK3A 3H53A 2FZDA 1BSIA 5FKYA 3APYA 1TJPA 1TTQA 3HURA 3CXOA 4WUIA 1R2TA 3MJYA 4AC7C 1DPMA 3BLIA 4B5UA 4OZOA 4RNJA 4FXSA 2BY0A 4LBSA 4GHRA 2KX9A 1F6YA 2VELA 3CQJA 3QMRA 3ZJKA 2XTKA 3M0YA 3TYZA 4YN5A 2F8QA 1YTKA 1H7OA 4LS0A 3WFLA 1QNVA 1F2JA 4E8DA 3N3TA 1RH9A 5CPSA 1DIDA 5K9CA 1OIMA 5EBKA 4FMVA 5CQ1A 3PZNA 2EAWA 2LLEA 4XZWA 4E3VA 4JL1A 5BRQA 1XSIA 4NJIA 3MU7A 1QI0A 3AZTA 3GYCA 2WVSA 2YL5A 3QVQA 3FJ6A 4MZ1A 1X7IA 3U5YA 3ALFA 1JQVA 4S3KA 4MWAC 2ABBA 1EWDA 4ZO6A 4QP0A 3TQ0A 3C0SA 5CGQA 1LT7A 2EPLX 1IEVA 2WO5A 1EWEA 3VVGA 1GOWA 3W07A 1SM9A 4Q8MA 4TO8A 4LF1A 4P7NA 5C7VA 3VC6A 3U7BA 3G1SA 3TN6A 3WJSA 1XIEA 5BRBA 2OO6A 1EA9C 2YKKA 3SAZA 4JTJA 4H2CA 2WQPA 3SCVA 4Z0SA 4OU1A 1YTEA 5A5WA 1CXEA 3T1GA 1TKKA 1CIUA 1JOAA 1S2WA 3GZ3A 5LIXX 4FLRA 1V59A 3T4CA 1W3NA 2PRMA 1LZOA 4PBEA 5FS8A 5LSMA 2X1RA 3R12A 4O0ZA 5E6ZA 4IICA 1IIGA 3G1HA 5LA0A 3C2VA 3PM6A 2NWSA 2NSXA 4UQBA 4ATWA 4O12A 2DZPA 1EDTA 1AQMA 1W9PA 4JDBA 1GNXA 4PUWA 3S1GA 1IGSA 1BYAA 3WX7A 2XG9A 3VIJA 4QQUA 4NG3A 2WJFA 1UZHA 1XD1A 4NIRA 4DBDA 4FNRA 4DJEC 1D7KA 3B8VA 1GOKA 2J66A 1JQXA 1W5NA 4HA0A 3BSGA 1MUCA 3W87A 2ZUMA 1K8CA 3PUDA 1XYFA 1W9UA 2INEA 3TR2A 4JHOA 4KGLA 1ZJHA 1VFFA 1XPYA 1J18A 1L2QA 4M24A 1JVNA 5AZ0A 2D3NA 4C6DA 3KOYA 1WKFA 2OMAA 3H6OA 1A5MC 4XO7A 4FNTA 2HMCA 3UZWA 4BURA 3GU9A 2OG9A 4Z2JA 1WDWA 1OC7A 3DC0A 4R7OA 3LHWA 1BKSA 1SUXA 3C5QA 4XZMX 2YL8A 3AMCA 5DELA 2I16A 3A23A 1EFZA 4GFIA 1W17A 1UD8A 4FF5A 4GRSA 2A6LA 5AHFA 2HNHA 4P8XA 2C6QA 2B7QA 1I9CB 1UG6A 4KPRA 4PMDA 2DSKA 4C1LA 3DGHA 3WEZA 1TJ1A 4Z08A 1K4GA 2PGEA 5HWMA 3WLIA 4PTXA 1KD0A 1OT2A 4Z42C 1GJUA 3BAKA 2CWXA 4IPLA 2WMGA 2J78A 3BO9A 2ZRYA 1UPPA 1LUCA 4QQ3A 3LCXA 5AC4A 4LB3A 2JIEA 3T7VA 1KXVA 3CC1A 1R3YA 3VDAA 1EOKA 1NHSA 4P7OA 1D3GA 2R1NA 2PF0A 1KTCA 4KCVA 4NEVA 1X39A 3Q94A 3USBA 3DENA 1PYFA 3MZNA 3SUWA 4GQGA 4GWEA 2A7NA 4CD7A 4FDCB 1F8MA 5HWNA 1EL3A 2RHGA 3COTA 3Q37A 4EK7A 3GU2A 3VGFA 2X8GA 5LIKX 1OGBA 3M0ZA 5A3HA 4ZOAA 1DWJM 2PDXA 2V68A 2Y5EA 3Q58A 3UR2A 1FECA 3TROA 4JKMA 1S5VA 1K8YA 3D6NA 3STFA 1XLFA 4LVAA 3A4JA 1A5CA 2EXOA 4UZUA 1TVPA 1PHQA 1V3LA 3SIZA 1E9IA 3WBWA 1R46A 3AXXA 2PDYA 1DJGA 2GQ8A 3G3MA 2ZRVA 4HPJA 1KXQA 4JN6A 2BGQA 4IXHA 3R8RA 1BWKA 5DX7A 3IV3A 4GG9A 3LXDA 5I7GA 3TR9A 3I10A 2W3RA 1GZGA 4QDWA 5LZLA 2VI0A 2QMKA 2X7VA 3ES7A 1TV7A 1F3PA 2OZ3A 3K1GA 3L7RA 2PDCA 3WQGA 4CQDA 2O4QA 2VT0A 3BW2A 1UCWA 2YCKX 1RR2A 3B04A 3EX6A 4RNFA 3VDGA 4D2JA 2GUYA 3KUMA 3PUGA 1XC6A 2YDAA 3LGGA 3HPZA 4M56A 3STPA 4LYRA 4RDVA 1Q6QA 2Z0IA 1W3JA 3PZUA 3VDBA 3GXDA 4FXJA 4DAFA 1UOZA 3KAOA 3UWQA 2Q71A 3R1ZA 2EQ7A 1NTHA 4HHHA 3H4WA 1YTDA 1ITUA 1N2VA 2G37A 2C0AA 2XVGA 1RAKA 1NM9A 2VQTA 2MNRA 3R7MA 1PTDA 3VMPA 4S3DA 5D05A 4X2RA 3FJNA 3NL6A 1WDRA 3L2LA 2PWEA 5PTDA 2HRWA 2NSOA 4C7FA 1RQHA 1TX2A 1AUSL 4J57A 3ZT5A 1PX3A 3BL3A 3DU0A 3B9OA 5TD4A 4IQJA 2BOGX 2EQ8A 4YWSA 5D9OA 3CAWA 2PDIA 3AS2A 2W62A 4M6VA 2E5DA 3CUGA 3WLQA 1HF6A 1NSJA 1JD9A 1XFBA 2AAQA 2P1FA 3O7UA 2PDNA 1EJVC 3ITTA 4CEXC 2GUBA 2REQA 3EYPA 1JDAA 2ZZ2A 1OYAA 3IIOA 3BC9A 2B31A 3ICJA 3L2MA 4AMAA 4MKNA 2X2GA 3SQSA 1FUYA 5IM51 2IQ0A 3L12A 2Q01A 4M6UA 3UWUA 1EXPA 4GBUA 1R3RA 3QR0A 4HZ6A 4D8ZA 2HXUA 3E0FA 1DXFA 5DY3A 3L4TA 3W6YA 1XDMA 3ANUA 2ZRZA 1ME9A 2IPGA 3DG3A 1SSDA 5HDRA 3R58A 4ZQRA 4LB4A 1E15A 4O1CA 1EJUC 1AVAA 2GL5A 1Y8BA 3EB3A 8XIMA 1RV8A 4MNMA 1U5JA 3FA5A 4PCSA 1QHOA 4DY1A 2Z2BA 2VDHA 3TW7A 4NZ4A 1C8QA 2VFGA 3LI1A 3T08A 2GFTA 2ZZCA 3GDLA 2QAPA 1RZMA 1U1HA 4N4QA 3KS6A 3S42A 5I3FA 1FCQA 5AC8A 2WNZA 1NHRA 1AW2A 5FJTA 5LGZA 3O07A 2QDDA 1G01A 1OG6A 3M5YA 1IR2A 1IYXA 3OEXA 1XCWA 2BHYA 3CUFA 1VR6A 3QBUA 4L6HA 4PUJA 4WY0B 3HGSA 3PK7A 2J3NA 4J35A 1EX5A 1KM1A 3KBVA 1SJCA 4NJJA 3SFWA 3O6AA 3TH6A 2ISFA 4RDYA 2WP5A 4Q8PA 3GNOA 2VGBA 1ZJAA 2H90A 1T6MA 1IE7C 2NWRA 4H4ZA 2DIEA 1ZCOA 1EOMA 2C3DA 3FX4A 1O5XA 4QM1A 1FWRA 5AYYA 2ZADA 5BXRA 1GORA 1AH0A 3TUUA 1EXBA 5ENLA 4PMZA 2E3ZA 4E0CA 5EMLA 2INFA 3VX1A 4M52A 1QMLA 2WLYA 1CCWB 2Y7DA 4XISA 2PGWA 3TWBA 3SSZA 4V2XA 3URHA 4B92A 3IIXA 3Q2DA 2MUCA 4O1DA 5HJXA 3W7HA 2X8HA 4UCGA 2WZIA 3IRSA 5K2ZA 1TV5A 5L9FA 3BCDA 4XX6A 2UY3A 1RP8A 4LYKA 2QUNA 2HV5A 1GKRA 1M53A 3WUFA 1BWLA 4L1GA 4MAVA 4J2PA 2YBUA 1SJAA 2BVTA 2ASHA 2CHOA 2PWHA 3UZZA 1JZ5A 1BWVA 4D6EA 1GK8A 2Q09A 3HIJA 2E28A 1XLDA 5LNSA 1VPYA 5HUPA 1IEQA 2VO5A 2AMXA 1GW1A 3EOUA 4C6CA 6TAAA 4S3CA 4GX9A 4F8XA 2WZEA 2D0HA 4YJ5A 1KCXA 1REQA 3ZWSA 4MNLA 3U6WA 3ZQ9A 1Q8AA 4FA3A 3CWHA 4GLEA 3P8JA 5KZDA 3P74A 3C3UA 4ML4A 2YL9A 2C3ZA 1KBBA 3HMCA 2V67A 2RJGA 4WCJA 5CC5A 3CEPA 3AMGA 7REQA 2X05A 4J3ZA 4ZBCA 2GGIA 4M6PA 3MPGA 2QULA 5I6SA 2QZRA 2CFYA 2XN1A 5LGXA 2JGYA 3LMZA 3KZPA 4IFKB 3GRIA 3WLMA 3Q45A 1TG7A 5JCMA 3HRDC 2J6VA 4QXIA 3DG7A 4XBJA 2NXHA 1V6TA 2PCQA 3GX9A 5DT7A 4NZ1A 4JTFA 2Z4GA 2AKMA 4H8VA 1U1UA 1XH2A 2HJPA 3POHA 1DQUA 3ES8A 3L5AA 1TPB1 2B81A 3WLOA 4AX6A 4EPKA 4IMAA 2A3EA 5CH9A 3SCNA 1OIFA 4RV8A 3OGSA 3UCDA 1CGUA 4MY9A 3VCCA 3W7LA 2Z1SA 1PDZA 4NJGA 1LL7A 3CT7A 1UUQA 3DGRA 4HSHA 3CM4A 2WM0A 3DFYA 3THAA 1K70A 1ISWA 3RM4A 1W2PA 2AOSA 3EWCA 3M7WA 3VOGA 4MAZA 3PBMA 5C9ZA 3LCHA 3W71A 1H41A 5CPTA 3MA8A 1UWUA 3ATZA 3UXIA 3C2FA 3BANA 3EPNA 3NXLA 1BYDA 4ADSA 4LVBA 3E2VA 3PBGA 2CLHA 2PTXA 4GMEA 5U7SA 1P6CA 1SR9A 3GG0A 3ZMRA 1CWYA 3Q6JA 1YX1A 1VBRA 3P8IA 1ICQA 2BGNE 1GW9A 1W5QA 3TCSA 1NF7A 1PZ1A 1S39A 2JF7A 4DLFA 3M0KA 4F2UA 1IT0A 3P80A 4GH1A 5LXXA 1IT7A 1I2RA 1OT1A 2GGHA 5XIAA 4LX4A 5E0KA 4E8GA 1E3ZA 1WYIA 4Y9PA 1CXIA 1KFLA 1UR9A 1MXSA 4MJ2A 2Q6ZA 4CGTA 3TTOA 3V4BA 2R91A 2PLKA 1P43A 4ZXLA 1QOQA 3T2OA 3H22A 3H8AA 1MYRA 3WF2A 4C6KA 1ISVA 2INZA 4GH3A 1KLZA 4GQRA 4CU8A 3AUJA 4UTLA 2WVVB 5U1OA 3RO8A 2NZLA 4UMCA 2X09A 4I3GA 1MOKA 1G4SA 2A0NA 5EY5A 5I3HA 3GIYA 3T09A 2ISDA 4ATDA 4L9ZA 2KZHA 1J5TA 5I03A 2CZEA 2PE4A 1TVNA 2QCHA 4ZOEA 3APGA 2JKAA 1EBGA 3GXMA 4UR8A 1M41A 1R3WA 1BZLA 3HB9A 2BX7A 4POCA 4ZFCA 2A3CA 2V5JA 1LORA 4L64A 2ZXQA 4RE4A 4AIBA 6XIMA 1I1XA 2Z2AA 1R6WA 1HG3A 1Q5MA 3TP4A 1N63C 1QTWA 1H6VA 4GI9A 3KDOA 1DQWA 1GVIA 5H91A 5IHSA 3ABQA 1R2SA 3P84A 4LUSA 3DKJA 3GNXA 4GI6A 2WLZA 2NT0A 1YQZA 1LBMA 4N4PA 3LGDA 8TIMA 2QJIA 1RSCA 2IPFA 5EKYA 4EXAA 2BVDA 4UNIA 1E72M 2VTFA 1SMAA 1E6ZA 1NFGA 4N42A 1V6YA 4I7WA 4F66A 5K4ZA 2Z27A 1WX0A 3LQLA 1OYBA 1O94A 4H83A 3MJMA 5CZKA 2ODOA 4WSKA 4NYUA 4ZO7A 2I9UA 5AHNA 1WNOA 2Y8KA 1XKYA 3LXAA 2IPJA 4EPDC 2YW4A 3DX5A 1K7EA 4ZCWA 1XLLA 4NT0A 1E56A 3F4VA 2YFOA 3AMKA 1R3TA 5TR3A 1OYCA 4IIHA 2QGHA 3MBFA 3IGXA 1ALDA 4JCMA 3KDNA 3CV1A 3E96A 2X41A 4KEVA 2FZ9A 3IGUA 4E2DA 3AHYA 5AVHA 4Q8VA 3AS1A 1I1WA 2RJHA 1MXDA 1UZ1A 4JYFA 2OEJA 3AUOA 1N5WC 2FHCA 3IS4A 2HQAA 4C6MA 4LW7A 4LCSA 3P5YA 4K37A 4J3XA 3ATYA 5HPCA 3G1XA 4J4KA 4WEVX 2WKGA 4G2DA 3RJXA 1IT8A 3B9EA 2Y5JA 4CNUA 4AZ7A 3BLEA 3PR2A 1UD3A 2GPTA 1BXNA 2O7SA 3HTWA 3N2CA 1W2VA 1B3ZA 3M0IA 1FWSA 4QNWA 3ZLFA 3KXQA 2WZTA 8A3HA 3PUOA 3W75A 1JF5A 3SY5A 2VOTA 4X0VA 1CXKA 3WFAA 3MHUA 3L0GA 5I02A 3M0XA 5JBFA 4AC1X 5HATA 4XG1A 1ZTVA 2NXIA 5JCKA 1E4NA 2QS8A 2DVUA 3H7VA 1YBQB 3NQVA 5FS7A 1FFRA 4I9TA 5DMMA 1UOKA 1EKOA 4KKXA 2WP6A 5E93A 2VX7A 3GNPA 3GC4A 3MO4A 4H8NA 2BHUA 4AQLA 2XWDA 1TSIA 4S2CA 4XD5A 4GJJA 1P48A 3ZS4A 3UJSA 3VILA 2ZKMX 4MB4A 1X1ZA 2OSYA 3IC9A 4XAYA 2FDMA 5FAGA 1S2UA 3S9YA 3WUGA 3WIJA 3WN6A 5DXXA 2OSXA 1Q6DA 1K03A 2ANUA 4HK7A 3O6DA 4EQRA 3BLFA 1BTMA 4S23A 4H2HA 1XH1A 1M7OA 3VUPA 1CB2A 2UV8G 2P8CA 1UIPA 4M6QA 4XO6A 3L4VA 3HA1A 3HGRA 4MADA 4QS5A 2NQ9A 4AEOA 2CLOA 1PZ0A 3AZSA 2X0HA 2BTMA 2XWEA 2OWCA 3EPOA 1NWSA 1D3CA 4MKVA 5FMHA 2FJUB 3B03A 3DUGA 1QW7A 3UJ2A 2D0GA 4TTGA 2VFFA 1I45A 4DWDA 4CN4A 3M43A 1GJPA 1TMQA 4A3RA 1TREA 1EUAA 4XKYA 1EGVA 3D3FA 3W2UA 3URAA 3MP5A 2P8BA 5AHEA 3LS9A 4L1WA 4IJCA 1US0A 4RDWA 2XZ9A 1FH9A 5BRPA 4IMGA 2XH0A 4GNVA 4ZENA 3PN8A 4EAMA 4GVHA 3W7PA 1ZB5A 4WQ6A 3CZLA 3P60A 3NO3A 1GVOA 3DFNA 3W2MA 5JBDA 1X7FA 1IV8A 3A64A 4B5VA 1PE1A 2EQDA 3ANVA 5A6MA 4O8AA 4IGSA 3G0UA 3GIPA 6PTDA 1DWAM 3EDDA 4GVGA 1KM3A 5FSEC 3TCEA 3B8TA 3W72A 1FHDA 1SJDA 1YNQA 4AYSA 1WKDA 1MEIA 3DHFA 4HNNA 2JK2A 2VRKA 3B8WA 3WJWA 1H62A 1FWJC 2YX0A 4J2MA 4H9XA 2QAFA 4XKMA 4OTKA 1OM0A 2XN2A 2Y63A 2ZRWA 3CPRA 3OZYA 2C71A 1WAWA 4K7ZA 1I4NA 2VC5A 4YIWA 3CB3A 3IWPA 1RUSA 4LY4A 1YADA 4LEFA 4LAZA 1UD6A 1VB9A 1C7SA 2BY2A 4WDXA 4Z0JA 1NWUA 3BV4A 2J4GA 4DX3A 7TAAA 4DWSA 3MUZ1 2H8ZA 1AG1O 2J7HA 1GVRA 1AFSA 4B5XA 4V27A 1QNPA 5LHEA 3EEZA 5CBIA 3GSMA 3PNUA 3E0IA 3S0CA 4HYVA 3U7VA 4MIMA 1CTNA 5C55A 1V79A 3QOMA 2FYMA 1H09A 3FDKA 1AW1A 4G5DA 3RG6A 3GR8A 3VA8A 1YEYA 4GXWA 3HPSA 3ZIZA 2POTA 2EQ9A 4JYDA 3QLDA 3O8AA 4N7QA 2PURA 2OYKA 1SZEA 1B3VA 1HJWA 3MKVA 1SFLA 2GGEA 2JQXA 2O9OA 3TXVA 1R3VA 4HNUA 2FKPA 4AVOA 4ONVA 5IXEA 2VGFA 3CQHA 4LAKA 2PDFA 1X1OA 2VEMA 1I2PA 2R6OA 3WQEA 3CZKA 5H8PA 4DBSA 2ALDA 1FA2A 4EX4A 3CXBA 1IZKA 1MRQA 3VE9A 4C6OA 2VZTA 1YYAA 4YVXA 3WQ4A 3IVTA 4JOMA 4NAEB 4IT1A 4GQQA 3LERA 1KRAC 1HKWA 4NJKA 1TA3A 3NSMA 4LWWA 2AAAA 3P82A 2ZTKA 3TSMA 4XIAA 2A7RA 3TX9A 4PSRA 3JS3A 3PZMA 4XTIA 3W7QA 3T9PA 4JQ1A 2YJQA 2GDVA 4LAOA 2HISA 4HZ8A 3WEOA 3WNLA 4PMYA 3GWQA 1THFD 1K9EA 4HOWA 5DMNA 3E38A 4RJEA 4H7CA 2ZQ0A 3AIWA 3QMTA 3AALA 4UFKA 4DPQA 1IZJA 4JTCA 3MDUA 4H50A 3LM3A 3HQNA 1OK6A 1MZRA 1J8VA 1NDZA 2OZ0A 1JNDA 1HVQA 4D6IA 1ZMDA 4PEEA 4UZSA 2CWNA 2CFFA 3ONCA 1SZRA 3V5OA 1H7NA 1LUCB 2IS7A 2PP1A 1OCBA 3S2MA 9RUBA 3AYVA 3WG6A 3PZGA 2TODA 4L9XA 1XSKA 5CPOA 1UWSA 1Q45A 2WCSA 4WVXA 3SRKA 2W6RA 4D8AA 1XLIA 5JVLA 1Z41A 4JIQA 1NF0A 3T42A 3QSRA 3MV11 2I14A 2Y2WA 3KP0A 3W84A 4LVGA 4FNQA 3AIEA 4I6KA 5ABFA 3AS3A 4JTAA 2WQDA 4IP5A 4N9BA 4NASA 1TO3A 1JF6A 1WZAA 1T7LA 4ENLA 4GKLA 3C86A 4GO8A 1R9XA 2EPOA 1GTHA 4E5TA 4HHPA 4CKQA 2PS2A 2HWGA 4GA8A 1SB3B 4E6MA 4OOUA 4ATLA 3LTYA 4MUPA 1UKSA 1UKQA 3QM3A 3HFTA 4JTUA 1XRTA 1KW1A 4S1FA 3G1VA 4L5ZA 4EF9A 3S8HA 2XGBA 1HXJA 3GVWA 2P3EA 3LV6A 4RXGA 1PAMA 5HMSA 2DZSA 3CGTA 1VDVA 1Q6CA 3STEA 1AZ2A 4QJ5B 2NX1A 4IUOA 2EJ1A 1M5WA 2GLKA 3EAUA 4ZOCA 4H6KA 1TV2A 4W8LA 2CHNA 4GYFA 3R07C 1NP2A 1H5VA 3VI2A 2OT0A 5DFAA 1RA5A 3ELFA 1DE5A 3P61A 4AD3A 4H7ZA 1NEYA 2J7BA 4WK9A 3GE7A 3OG2A 2OWWA 1FWHC 4GZEA 3N19B 1CI1A 3ZWTA 3N04A 4PRRA 5ER0A 6CGTA 4LNYA 4D6DA 1KRBC 4C1NA 4LA1A 1S46A 2CKRA 5A95A 1J4EA 2ZVRA 2XGIA 3DHPA 3NAVA 3U4FA 4GCXA 4ERAA 1NELA 1X96A 3M41A 3AS0A 1KNWA 1QNSA 2WAGA 3DOPA 1B30A 3AXMA 3DESA 1XUZA 5CSSA 4NRRA 1ONEA 2O9PA 1JG9A 3W7DA 3RN6A 2QF7A 2PWGA 2E6FA 1RLDA 5BYWA 3T4WA 1J01A 3ORWA 3DFHA 4ROPA 1W9DM 2XVPA 4Q8QA 2CXEA 3PVFA 1W1PA 2W9MA 2TPRA 1T96A 2QDGA 3H2EA 1CLXA 1KKRA 7ENLA 2ZZ6A 3GVRA 1TJRA 1TRIA 3UXDA 4MOZA 1KRCC 3R0DA 2P53A 3CHEA 2C7FA 4HN8A 3BPWA 4DWSD 4F2BA 5I79A 3UXAA 1JI1A 3A3WA 2JE8A 3PZVA 3GTNA 3W1QA 4UTIA 1W3HA 1WO2A 4IGMA 3GHSA 3W7EA 1SZGA 1US3A 4HVXA 1NOUA 4H4UA 3NJ3A 2YCJA 1WP6A 1UQZA 1YRRA 3KOWA 5I5RA 4PODA 3O3RA 2REQB 2FPTA 1H0GA 3ZO9A 5FEPA 2BG5A 4DNAA 3WMBA 3I68A 3HW2A 1EYWA 3DK9A 3HPXA 4GCAA 1HO1A 3F03K 4MPKA 5EFFA 3ME3A 5MF5A 4DJDD 1VCVA 3GM8A 3W29A 3VIGA 3HU7A 1PCKA 2PP3A 1KBJA 2G95A 2J77A 3EBVA 4GUGA 3N13A 3LA4A 1E9ZB 4OECA 1OBAA 1B9ZA 1E9LA 3HQPA 3AYRA 4AWEA 4AZIA 1PV8A 1CPUA 1XYBA 3WLRA 5F2LA 4F48A 2X99A 1WOBA 4RKAA 5DRCA 1XICA 4H6RA 2DY3A 1JYXA 1PUDA 4QITA 4MJZA 3S47A 1YKWA 3DYOA 3WBXA 1V0KA 2CHRA 1QATA 2FTWA 4GY7A 3UY8A 1ZSXA 1XG4A 3N12A 2HXTA 3NPWA 3VDHA 4MVAA 3BLPX 3DG6A 1XIMA 1U2YA 2JKEA 1S7MA 4LAMA 1AL8A 1MEWA 1TTPA 3EDEA 3QY6A 4TVCA 4RE3A 5A8GA 4MWAA 4MTVA 1X6NA 4UNLA 3F4WA 3WNOA 1W9VA 3QHNA 4F0MA 1KGWA 4EQSA 1EJTC 1ZQ5A 1HP4A 1RCXB 5DANA 5A2CA 2PTZA 2VOMA 1XL9A 3CB8A 2XFYA 1ADDA 1PZ3A 4GJIA 1TV3A 3AMLA 3UY7A 4JFUA 3TNOA 2W63A 1YQ2A 2A3HA 2BVYA 2FZNA 3MY9A 5HANA 3TW9A 6REQA 3GO2A 2NQLA 4L1XA 2Y62A 1Q65A 3KBWA 4KRUA 5DXYA 4AWTA 3SJNA 2X16A 2G3MA 5FD0A 4M29A 1PIFA 2QQ6A 2HBXA 2CLIA 3NVYB 5G2IA 1OX6A 4HP5A 1RALA 3WCZA 1FWCC 2C1GA 2J79A 1EZ2A 2R9RA 3GTIA 4O1AA 1XCXA 8CGTA 2TMDA 3VOHA 3QY7A 4N9EA 4JIIX 3AIQA 4RE2A 1F3EA 4XD3A 5LNVA 1SW0A 3GRTA 2HDJA 1GEUA 3CWOX 4CU7A 4ZXOA 3L4ZA 3U9IA 4DJEA 1M65A 3II1A 4AXNA 1RK6A 5T9CE 3E5PA 4D6JA 5FJPA 4IQEA 4PH6A 3PBUA 1OEPA 3UGVA 1E5NA 3DFOA 3MS8A 3KRSA 1GXFA 2QT3A 4XK2A 1B3XA 3RJYA 4I90A 3LNMA 2W61A 4QX4A 3GY1A 3OYZA 3CQIA 1XYZA 2BLEA 5CJMA 1ADOA 2DU2A 5CZTA 2OO0A 2AMGA 1IIHA 4AIEA 4O13A 3WJXA 4KT2A 1REQB 2W92A 6ENLA 4Q7NA 1E3XA 4DJFC 4C6PA 4PBFA 3BJSA 1XHGA 2C18A 4JNZA 2WSYA 4LALA 1YHTA 3QV6A 4CCCA 3S1VA 1QK2A 3W2KA 4BEUA 1KFEA 3BW3A 3PULA 7REQB 3KHDA 3ERPA 3C56A 4S3AA 2ACSA 1QHPA 4L4MA 2WOWA 3W28A 1UPMB 4IQLA 1ADSA 3SUTA 4K38A 4NVTA 4NNBA 3THQA 3W37A 4JQAA 3ZT7A 3PAOA 4WDTA 2EO7A 1C91A 2VR4A 2ICSA 2YCEA 4CCEA 3GK0A 3TONA 3A3XA 1XD0A 3PS7A 1ZBWA 3KBNA 1LYXA 4OIFA 2PC8A 3WD1A 3VIFA 4U31A 5H2ZA 2J7CA 2WHJA 2WVTA 4UQCA 5GNYA 4Q8OA 2GSEA 4W85A 2E8ZA 3T6CA 1EB3A 1LL6A 1ENUA 4W89A 4HNTA 3R25A 1JRBA 4AU0A 2G41A 3TFCA 3V0TA 4X61A 4GNJA 2PF8A 4TVWA 3W76A 3ITVA 1JUKA 2ZC1A 2DEPA 3TIMA 3INPA 1C90A 1BKHA 3H2MA 4Q4MA 4GNKB 4IFOA 1UA7A 3I65A 4JIPA 3ZSTA 5C54A 1MI3A 3VNDA 1WBHA 3F7JA 2V2HA 2V3EA 3U5UA 1DHKA 3BJTA 3QFWA 4TIMA 1NDVA 3N14A 3V7PA 3CQKA 1G4TA 3OPSA 3R89A 3S6TA 4K39A 1XJBA 1BF2A 4PYSA 5LA1A 3MMUA 3L4WA 7PTDA 1GOQA 3CPGA 4E4UA 4H4TA 4Y90A 4FR1A 2PLCA 1WZLA 3LU2A 3F4DA 3OJGA 3UXKA 2X40A 4RPQA 4NILA 4B16A 3NDYA 4YMZA 4YNGA 3V0SA 4W84A 2QIWA 2Y1HA 3O6YX 2CBIA 3EWDA 1FCVA 3PJTA 5M17A 3EWBX 4GIAA 5DO8A 1SJBA 1JEHA 3EKLA 3DK4A 3B8IA 3SCWA 4W5ZA 1AOGA 1G7UA 2VXNA 1E4LA 4X3ZA 4AIUA 3G6LA 3KM8A 4DUWA 4R53A 3O15A 4FX6M 1BHGA 2VEGA 3K1DA 4IIDA 4KBXA 4QCEA 4ZB0A 2VGIA 4HTBA 3A12A 1XF0A 2DUAA 3MUXA 4OFCA 2WKLA 3B8DA 1NQKA 3CZGA 3W81A 1ZBCA 3GIQA 5T26A 1IZCA 5CZSA 4C5ZA 2VEFA 3W1UA 2ISWA 3HPFA 3UU0A 1GREA 2V3FA 4LCRA 4W7WA 1T99A 3LHVA 1TPDA 4N9DA 4ZTXA 3G1DA 4TX9A 2PDMA 4ALDA 3T05A 1V0LA 1AK5A 1R85A 1EJ7L 1FKXA 5AC5A 5A6BA 5BZAA 3O06A 3ABOA 2J8GA 1FTXA 2F2KA 3CO8A 3NSNA 3LGEA 4JGDA 4BQ4A 1VYSX 2D2HA 1ONXA 4B5SA 3F5LA 1FDYA 3T0DA 6A3HA 1GKPA 1L9WA 2GR1A 2E68A 3W82A 3DFSA 4UTUA 2QUTA 2WMKA 5I06A 3S6DA 5CCZA 4IIGA 3NQ2A 4LUSB 1GVSA 1MXGA 4FNPA 3N3MA 4GE8A 4L7ZA 2Z1WA 4W86A 2QLYA 1FWTA 3ABXA 3CUHA 1AQHA 1J93A 4DF2A 5HULA 4L6DA 5GRTA 1R9YA 3JRKA 4AD2A 4C6BA 4HPNA 3TJLA 3VZZA 3QH2A 2PGFA 4U3CA 3K8LA 3N15A 1PCWA 1S3HA 4XWUA 4YTQA 3AYTA 1DVJA 1QI2A 1D7YA 4UFHA 3M9YA 4XZHA 7TIMA 4S2BA 1ISYA 1YPIA 4JTQA 2OEKA 1Q6LA 3R10A 1HNYA 2WKJA 1V03A 3RK8A 3SM0A 5HWJA 2PP0A 5EGRA 3W73A 1X97A 4HMDA 3KCOA 4F4RA 4GVIA 1E6QM 3NZGA 1OFQA 3OOQA 3EB2A 2V38A 4L4PA 1PTAA 1A5UA 3CV6A 1E71M 3M4HA 1JDCA 1QU4A 1R5YA 5A6AA 4PTVA 4YHEA 2GZXA 5GJNA 3DI0A 4JIEA 3M5XA 4FLOA 1Q6EA 1ZBKA 3C8FA 3RCMA 1O6IA 4A8NA 3NPXA 4TV6A 3N6QA 5BU6A 2PGRA 3N9SA 1FP9A 1OADA 4YVPA 1EDQA 3BVJA 4Y6GA 5I3KA 1OCQA 3R2GA 4NKCA 1FH8A 4GUJA 4U4MA 1QO5A 4X60A 2FGBA 3PFRA 1HTIA 4AX7A 4DJED 3OHMB 3GKFA 3KEHA 4I8DA 1FXPA 4QNEA 1Q85A 1N5XA 1P1XA 5JRBA 1SO4A 3SEPA 1KB3A 2QVHA 4ILSA 4FLQA 3VMNA 4F9DA 3WQ6A 1QNQA 2A1YA 1DWFM 5TQLA 1L6WA 7ODCA 4LEQA 4H4XA 2OX1A 1UMLA 1RJRA 3ARSA 5HPOA 4M0XA 3WL1A 4KWSA 4ICCX 3EMZA 5I23A 2EHHA 2W3ZA 5ECUA 3T0AA 2J9YA 3HQ1A 2G3NA 3M0VA 3E49A 4XSMA 1PDYA 2FZMA 1SO3A 2BCPA 2QPXA 4KRTA 3NQMA 3OQEA 3VK5A 3W7IA 5BCAA 4HMEA 3ID7A 1Z8AA 3KHJA 1V3HA 2AQWA 5DF0A 3WF1A 2RDUA 4HMCA 1VJIA 4ROQA 5DQPA 3EKZA 1T8QA 1CGTA 4C7GA 2FLIA 3EDFA 1W8SA 2GVYA 2VYOA 3SN1A 3WL0A 4PUNA 3A7AA 1WKEA 1J2WA 3LLDA 3T8LA 1TJ2A 1O5RA 3GVVA 3UVAA 2VM8A 1EBDA 2JEQA 5G4HC 2O4MA 1VRXA 1KM0A 4D71A 1ZGDA 3VFCA 1EC7A 3WDPP 2VWTA 2YSWA 4WGXA 4QE5A 1VJZA 4AH7A 3TN3A 1MFVA 2G4JA 3DH7A 2HS8A 1UYQA 5REQA 1PKLA 3K8MA 1CXFA 1L6FA 2BHZA 2QDHA 4ERIA 3MMTA 1MWOA 5BXPA 3TA6A 3MSGA 1BSLA 3E5BA 4Q7IA 3F2CA 2Z7KA 2BXYA 2DT1A 3W1NA 3NQGA 3W2LA 2WC7A 1GQJA 3HFYA 1NHQA 1WBJA 4D6CA 1V6VA 2PPGA 2QCGA 2Z1VA 1VIZA 2OKTA 4JEQA 4US5A 2G8ZA 5D09A 2VP8A 3OLEA 1X8FA 3TN5A 4OJYA 4BR1A 4IGNA 3IIPA 4RR4A 1EJSC 4QEEA 3UT0A 3BICA 2FZ8A 2WOIA 1BYBA 4PZVA 3ITGA 2GJNA 1YPXA 3WLSA 1K6AA 4DZIA 2NQJA 2VDGA 3P3BA 3FVMA 1V7YA 3UPBA 2XN0A 1I8JA 4K8HA 3UPWA 1Z42A 2GGJA 5AFDA 3KL3A 1Y5WA 1KM2A 3L0NA 3N2OA 5CSUA 3KTSA 5K4XA 3PSVA 3WD3A 2QMJA 1XS2A 3W7OA 4Y9AA 2ZX6A 3SCSA 2UY5A 3CUZA 1MW3A 3VNZA 2Y24A 3DERA 2XHYA 1K8XA 4HN4A 3VD4A 3NRZB 1Q3NA 4DWSB 3DFQA 3WKZA 3H2NA 1C8VA 3TE9A 4K1WA 3S5ZA 4JD4A 4LV9A 1OY0A 4H04A 4FHAA 1RY0A 4AEEA 1DJXA 2O56A 2QR6A 4HTYA 2VZSA 4H9YA 3I3DA 3URBA 1HL8A 3A47A 4EIVA 3QMSA 3UBPC 3WMLA 4Y8EA 3XIMA 3RR1A 3VD5A 1GG1A 4ZQCA 1QJWA 3W88A 5J5DA 2XSXA 1FXQA 4CVUA 2ZX8A 4H7VA 1OF8A 3NO1A 2XM1A 3PANA 1A50A 3TVAA 4FK9A 2V3GA 3HMJG 2F9RA 2PDKA 2R24A 1WDSA 3I4KA 3NL2A 2V0TA 1IHIA 3GD6A 4Y2WA 1J0IA 4ZE4A 3QV8A 2QGYA 1GRHA 5E0FA 2O7QA 3ZLGA 4GZJA 2AKZA 4HQVA 3VKBA 2WW5A 5FF7A 5FJOA 3BE7A 4HK5A 4RCXA 1S2VA 2HNEA 1OC5A 1GVFA 1TPWA 2WOVA 1FDJA 3SW6A 4UOZA 2PSNA 1GJWA 1QRQA 4Y96A 5F4WA 2VCAA 3GXTA 4B3ZA 4I9AA 2VC9A 1XV8A 3LOTA 1XGDA 3N2MA 4CQAA 2PODA 3E6EA 4OBRA 3BAJA 4RK8A 3LPGA 3NOEA 3ZFHA 5IFTA 1ZP3A 3GH4A 1TA3B 2R9ZA 3M0JA 4H4QA 3AXHA 2EG7A 3C6CA 4DI9A 1GCYA 4N9CA 3CZ8A 2ZUWA 2ZX7A 3GUGA 4JX5A 2Y89A 4KW2A 5D9MA 1JULA 2Z1XA 1J6OA 3LBMA 4XVDA 5M1TA 3QZ6A 3PG8A 2XPKA 1TB3A 4JFVA 1KXTA 1Z48A 4DBEA 1E51A 1TE6A 2OVLA 1FHVA 1UR1A 3SADA 4YHGA 4CNTA 2XU2A 4UFLA 3CAVA 3LXCA 4DJDC 2W4XA 3U0HA 1R47A 4LUIA 2OR2A 4C7DA 3PWGA 4JL2A 1DXIA 3ZR6A 5AC6A 5FJUA 3PC0A 3LY0A 1VIWA 3O9NA 5EU9A 5FF2A 2IQTA 3WF0A 4ZODA 1XIGA 4HIBA 1E6RA 3E2SA 5HNRA 3TU9A 5F4XA 4PUUA 3L66A 4N6FA 1JPMA 3H2OA 3M6YA 4DYJA 4FX8A 4TQTA 5LIUX 4XBSA 1GESA 1JFHA 3UG5A 2NV9A 4B3LA 3GG8A 2VFIA 5ABFB 4PMNA 3W7MA 1DORA 4CCDA 3U2EA 3M6DA 2OB3A 2W0UA 4DF1A 1PWMA 4FX7A 3T81A 4Q6JA 3IVSA 2PDLA 4PMOA 4ZO9A 1ISXA 3FW6A 1RQEA 1ME7A 3CH0A 3CS2A 1TZ7A 1P5BA 2V2DA 1AODA 1KFJA 2WNQA 3FCPA 2XGZA 3DI1A 3UZXA 1E43A 3L5MA 4GX8A 4G8TA 1I0BA 3OBEA 4MFDA 1W9BM 4DPPA 1JUEA 1EZWA 3L4UA 4CUCA 4ZOHB 1CBGA 3ABSA 3SRDA 1XLBA 4UR7A 3CPUA 4Y8FA 3LX9A 3OG3A 1OFPA 2DIKA 1YDNA 4YCPA 1FWEC 1XQKA 2WMIA 3P6LA 4TU1A 3BGAA 1I2NA 3QLLA 1ZX9A 4YPJA 4AISA 1W56A 3KOZA 1PEZA 2BODX 3AWOA 5HMFA 4WRHA 4G9PA 2OOFA 4YTRA 4A8IA 4CNPA 5AB3A 4QLJA 4O52A 4XSLA 1CENA 3CQ0A 1KR0A 5D03A 5LNWA 1VFLA 5EMJA 2W55A 3LCGA 3SUUA 3OBAA 2IKHA 3G2GA 3UCQA 1Q13A 4V33A 3GAKA 4HZMA 2OELA 1ITQA 2ZE0A 1CDGA 1HQTA 1WZMA 3VINA 1RLCL 3A9BA 3DJJA 2C3CA 3RPDA 4C1NB 4S3BA 4ZE5A 1JAKA 3ZJ6A 4QTGA 2YBVA 4DUOA 4ZEPA 1UR8A 4A22A 3P7YA 2R8WA 2B7OA 1XKJA 4NZJA 1F6PA 2PBOA 4MKSA 5CPMA 3M64A 2RH9A 1LPFA 2C13A 3NQBA 1B5TA 5DMLA 2OQLA 3AHXA 2PC4A 3W23A 3GXPA 1JZ6A 2A8XA 4JR5A 5A8PA 3MUAA 3I4EA 2ZUTA 2YYUA 3NDZA 5BMXA 3OLDA 1V3KA 3V3WA 3GRSA 3SCQA 3IJIA 1MQQA 4N02A 4FP1A 1XIDA 1SFJA 3GS6A 2QW5A 3VOFA 1W3TA 1VZWA 2CPUA 4DZAA 4H9MA 3G0SA 4KWUA 3AIVA 4ZVJA 3DXIA 4P2VA 5A6JA 4C6QA 4IP4A 1H61A 2XIJA 2CZFA 3WLKX 5DBUA 3QQ0A 3U2ZA 3REQA 2R94A 1B4EA 4H41A 2Y8UA 5EMKA 1T5AA 2FH8A 1JDDA 2WNWA 4PE8A 2NVKX 4KMQA 3EB4A 3IUHA 1FIQB 2ZA1A 3S6OA 4JXCA 3N2BA 4HA1A 2ZVIA 2BBFA 4ORMA 2DT3A 1WYGA 2Z29A 2R1KA 3E74A 5BU9A 2ZIDA 1MO0A 1Q6GA 4H19A 2VZVA 5RUBA 1WOAA 5G5IA 3WD4A 1Q2SA 3NQEA 3E2QA 4M51A 3QTPA 4GC3A 4WOQA 3OIXA 3B97A 3UG8A 2E1DA 4LH8A 3CEUA 4LRTA 3QN3A 4NYYA 4O1BA 2J75A 3LXBA 2WHMA 2PDGA 4PC8A 2HZGA 1QPRA 3BV7A 3M16A 1XINA 1TPC1 4JTEA 4IXXA 4HYWA 5I00A 5FAJA 3PZOA 2NW0A 1RK5A 1TPEA 1SMDA 4MWAB 2J24A 4F0LA 4QHRA 3LCWA 3C2EA 1AQ0A 3V16A 2OOGA 1ITCA 1F74A 4UTTC 2V82A 5G5GB 4W7VA 3MTWA 1RXOB 2NQZA 4C1KA 6TIMA 1FWBC 2VEPA 1SFSA 1AMYA 2C91A 4K7VA 1J0HA 2FFCA 3RM9A 1IEXA 3WDRA 2YOCA 3L9CA 2WC4A 1UC5A 6REQB 4LYPA 4AZCA 3F1QA 4X9YA 3G77A 2P50A 4BF5A 3HM7A 1GHRA 1YXDA 3LZ5A 1Q2RA 2O9TA 2QJHA 4NZCA 3GD4A 3GR4A 2R82A 2QJNA 1TMHA 3MZ2A 3U3HA 4FEZA 4JIRA 1X2GA 3TA9A 3C61A 4QJ4B 3BTNA 1LVLA 2FFIA 4P8WA 2E1WA 2Y61A 5ABHA 1YPFA 1ISZA 1PJ9A 1QPNA 3I7RA 4HPXA 4M1BA 1K9FA 3TXZA 4FIQA 1GHSA 2X1SA 1B1YA 5DCDA 1PZ2A 1FVPA 3EUB3 4Q4QA 1C9WA 1DJHA 4HBKA 1UASA 1JDFA 1G0CA 1V93A 1K1DA 1A5OC 1CXHA 1ODUA 3BLDA 1XLAA 2P3ZA 4H9ZA 4NJHA 3MSDA 4TOQA 4DO4A 4FSAA 1Z7AA 1KFKA 3RCYA 5FESA 3ZR5A 3NQAA 4A21A 4KWOA 3VCNA 3W01A 4UTHA 3PTDA 2DT0A 3QJAA 3CT2A 4L4LA 3NQCA 1FWDC 4H9TA 4KGJA 2IKJA 4RXFA 2VZOA 3GU1A