4HCDA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
total genus 126
structure length 384
sequence length 384
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hcdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hcdA01
3OW1A 3DIPA 2ZADA 3I6EA 4GFIA 4EWJA 2QVHA 4GISA 1KD0A 3GD6A 3DG7A 3SJNA 1RVKA 7ENLA 3CAWA 3VCCA 3DG6A 1E9IA 1EBHA 2I5QA 3QTPA 4Z17A 2QJNA 3GY1A 3TWBA 4ZCWA 3DFYA 3R10A 1EBGA 1BKHA 3N4FA 3PWIA 3V5CA 2PA6A 4ENLA 2AL2B 3RR1A 3ZVHA 3I4KA 3K1GA 2HZGA 3R11A 2XH0A 3UJSA 2GGHA 3RO6A 3JZUA 4FI4A 3UJEA 4M0XA 5FJPA 3FVDA 3Q4DA 2CHRA 4E4FA 3QPEA 4IT1A 3DG3A 4IP5A 3UGVA 1OEPA 3VC5A 1P43A 2PP3A 3ZLGA 3RITA 1ONEA 2GGEA 3BOXA 5BOEA 1KKOA 3P0WA 4X2PA 2POZA 3PK7A 3RCYA 4HCHA 1ECQA 3TW9A 2OZTA 3DERA 3V3WA 3N4EA 2PTWA 4IZGA 2PTYA 2ONEA 2OX4A 3ES8A 4DHGA 1ELSA 3S47A 1MUCA 3N6JA 1MRAA 3JVAA 3P93A 5BOFA 3FCPA 2XGZA 3ZLFA 1XPYA 3JW7A 3FYYA 1FHUA 4JN8A 1SJDA 3VC6A 2PS2A 5IDZA 4IHCA 1F9CA 4E8GA 3D47A 3UXLA 1XS2A 5EU9A 1PDZA 2GGGA 2QJMA 3H8AA 3EEZA 3U4FA 1SJAA 4GGHA 3MQTA 3HPFA 4DX3A 4E5TA 4IL0A 3KUMA 3UXKA 3ZLHA 4H19A 1IYXA 1BQGA 2MNRA 2HNEA 3H70A 4HPNA 2PTZA 4F4RA 1R6WA 3V4BA 3FJ4A 4HCLA 4DN1A 4G7FA 5FJOA 3QKEA 6ENLA 3T8QA 3OP2A 1WUEA 3EKGA 4G8TA 3PFRA 3CYJA 2P3ZA 3V5FA 2RDXA 4GGBA 3SN1A 3ZVHB 3OZMA 4KWSA 2FYMA 2PPGA 1DTNA 1W6TA 1WUFA 4J3ZA 3GO2A 2XH2A 2MUCA 3UJFA 2GSHA 2PP0A 3T4WA 3Q45A 2QQ6A 1TKKA 4KT2A 3D46A 3DESA 2P8BA 3SN4A 2GGIA 2XH7A 3P3BA 2PSNA 4K8GA 4GIRA 4HYRA 5J04A 2HXTA 2ZC8A 2OKTA 4A6GA 1MNSA 2QJJA 5FJUA 1EC9A 1SJBA 3TWAA 3ES7A 1EC8A 3MZNA 3UJ2A 3VA8A 4YWSA 3SN0A 3R1ZA 3BSMA 2QDEA 2HXUA 3IJIA 2GL5A 3T9PA 3B97A 2PCEA 2OQYA 3DFHA 4HNCA 2OZ3A 2PMQA 3DDMA 3OPSA 1MDLA 4MKSA 2DW6A 2DW7A 3OZYA 3ZVIA 1JPMA 3STPA 4HCDA 4ZA0A 2NQLA 3R0UA 3DGBA 3IK4A 3TJIA 3IJLA 3THUA 1TZZA 5FJRA 3N6HA 3T6CA 1P48A 1JDFA 3R25A 1JPDX 3TJ4A 4A35A 4ROPA 3TTEA 4GYPC 4H2HA 1TE6A 1NU5A 1NELA 4DYEA 4JN7A 4FP1A 1L8PA 3MWCA 4DWDA 4K1WA 2OLAA 2P88A 3GC2A 4J1OA 3H7VA 1FHVA 3CK5A 2OZ8A 3QLDA 3MY9A 4KEMA 1JCTA 1R0MA 3UCCA 4MMWA 2OPJA 3U9IA 3ENLA 3I6TA 3S5SA 2PODA 3TQPA 1SJCA 2PP1A 2QGYA 3CXOA 1KKRA 3R0KA 4HNLA 2OO6A 4H1ZA 4KPLA 3VDGA 4MGGA 2P0IA 3QN3A 2XH4A 3NZGA 2QDDA 2PGWA 3DEQA 3RRAA 5FJTA 3TOYA 2AL1A 2FKPA 3MSYA 4GYPA 1MDRA 4K2SA 4M6UA 3OTRA 2P8CA 4H83A 2XSXA 3CT2A 3FV9A 3VFCA 1YEYA 2PU1A 2AL2A 1EC7A 2OFJA 3FXGA 3IJQA 3SSZA 4DXKA 3BJSA 3NO1A 2O56A 2PGEA 4HN8A 4JHMA 2GDQA 3RGTA 3H12A 3TCSA 3PWGA 3NFUA 4E4UA 3NXLA 2OVLA 3SQSA 1KCZA 5ENLA 3SBFA 3CB3A 2OG9A 2PTXA 2GGJA 3MKCA 2PU0A 2AKZA 3VCNA 4GMEA 3UCDA 4A3RA 1PDYA 4E6MA 2AKMA 3UJRA 2OQHA 4IL2A 3MUCA 4Z1YA 4IP4A
chains in the Genus database with same CATH superfamily
3RO8A 2Y88A 4A8IA 3GBEA 3IACA 2CZDA 5CGMA 3KBMA 3FAWA 1TTIA 9RUBA 2DT2A 3N3MA 6PTDA 4O14A 5AHEA 5CC5A 5A3HA 2V5JA 3TFCA 5ABTA 2VEKA 4LY8A 2VX4A 3RJYA 3QTPA 3C2VA 4AVOA 1B90A 1O60A 3A4JA 3EDEA 1LRTA 4PTNA 2J77A 2V5CA 2XIQA 3DFYA 4TU1A 4AD0A 2P76A 3WLLA 4K8DA 1BKHA 1XIIA 3VABA 3PWIA 3GC5A 1TPDA 1JUBA 4XTDA 4YTUA 4KCWA 3WH7A 3QY7A 3L4ZA 2AL2B 2DZTA 4ML9A 1W9UA 3NL3A 2YL5A 4LY4A 2FH6A 4DBDA 4YYFA 2HQMA 1RA5A 4EE9A 2C1HA 2W9MA 4UWMA 3FSUA 1HJVA 3UJEA 4US5D 5G4WA 3MBFA 3Q4DA 2XZ7A 3DHDA 3AJXA 1VEMA 1LL4A 4KCTA 5HDRA 1OT1A 1JZ7A 3GDBA 2WQDA 1WV2A 1TO3A 4RW5A 1UH4A 3DOPA 3B3DA 3UGVA 1UD6A 3OVGA 1W5NA 2V3FA 3ELFA 4QE4A 3SAZA 1BF6A 2OEMA 3GUWA 4HKPA 2VOTA 1ZCCA 1ITQA 1W1B1 2HMCA 3PTDA 5I3FA 4BF5A 4HN4A 4YTQA 4HHMA 4UOZA 1CXEA 2F9RA 4WR3A 2YL9A 4Z1DA 3ES8A 4DHGA 3CZEA 1IGWA 3ARWA 4ZOCA 5C9ZA 1KO0A 2QJGA 1V6UA 4U4MA 3VZZA 1DJHA 2RABA 1YIXA 1OFBA 1S38A 2GOKA 3B0XA 4V1XA 1XIJA 3BGAA 1ISYA 1XLFA 4PN2A 3GR8A 3U7VA 1LF1A 4C6PA 2DUXA 3WG6A 4LUJA 4A3YA 2GGGA 2QULA 4NJGA 3WQDA 4LU0A 1TZ7A 4DX3A 2FDMA 3V36A 3ARXA 2P3EA 3E74A 2MNRA 3C3UA 1F6PA 1BQCA 4S3DA 1FCQA 1N5WC 1HTIA 4HPNA 1HFBA 3SM0A 2OT1A 4ZOEA 3H23A 4MDPA 5I77A 1TJPA 1D7KA 3VIFA 4KF1A 4QSHA 3RLHA 1A5NC 1TCDA 3O8AA 4H4WA 3G22A 3L7RA 3OHIA 1E4LA 4CD7A 1H0GA 3H24A 1NEYA 4H4YA 2ZRYA 3PFRA 4XK2A 3VGHA 2BB0A 1B4KA 4AISA 4JTLA 4GQ0A 7REQA 2JGYA 2HVOA 3H2EA 3VNZA 1KFCA 4U5KA 1U22A 1XINA 1J01A 1LBMA 4AWTA 4PFMA 4PSPA 1WYIA 4R7JA 2WBKA 4DUOA 3AXHA 3A6OA 5K4ZA 1A5BA 2WLZA 1GEUA 4AWEA 3UW6A 3E9AA 5B7YA 1OYAA 5T91A 1WZAA 3H53A 1ZRQA 4PMVA 1IEXA 2JIEA 4HB7A 4W84A 1EWDA 1TKKA 5DY2A 1EXBA 4JEQA 3D46A 2JE8A 4JTEA 2FVMA 1WAUA 2ALDA 3M4HA 2F6XA 1G5AA 4A2RA 1XIFA 5BNKA 3GSMA 4CQBA 2OKTA 3PZ9A 3CV7A 2FTWA 3N2OA 3S1VA 2PDYA 4M8UA 2A3HA 4DJEA 1MEHA 4H01A 5G4HC 4FPSA 4GZIA 5C8BB 1IR1A 3LSBA 3CUIA 3HJEA 3QC3A 4MNLA 4QTGA 1PZ3A 2G0WA 1FXPA 2WHKA 1XM3A 3WLKX 1ZAJA 5TD4A 3TZFA 2V6AA 3K4DA 5CZTA 4NNCA 4ZQRA 8A3HA 2J74A 1XH2A 4PB4A 3WQOA 2P0OA 5BMWA 1WZLA 2ZC1A 2PLCA 4L80A 3IC9A 1I60A 4F79A 3MP4A 4IUOA 3BZGA 3O63A 3TW6A 1OC5A 4IQLA 4UTMA 2VCCA 3EPMA 4L9YA 4MY9A 4ZBCA 2EBNA 2V81A 1XLCA 1Z89A 2PD5A 1Q6CA 2Z28A 3KLLA 1QMLA 5EMJA 5A2CA 3LBMA 3W7HA 2G4FA 3DFOA 1UWTA 3KOYA 1OFOA 2BG5A 3TLLA 4DJEC 4EWND 1R86A 1DJZA 3HMCA 3U48A 3UNDA 5AYXA 4J9JA 1UR0A 5U25A 3VD4A 1ONWA 3W9ZA 4E2DA 3DGRA 3ARRA 1J0ZA 1EYEA 3LCFA 2H90A 1QXLA 3F2CA 2BBFA 3ZO9A 3GVGA 1U83A 3W88A 1KFEA 2HVMA 5CXPA 2ZRUA 1K9FA 4WEVX 1Q6OA 2O9TA 4MTVA 4H1ZA 1JRPA 4EF8A 3OZPA 2EJ1A 3CZ8A 4XQ6A 5HXMA 3IK2A 2G3IA 2OOFA 1W54A 1R38A 3DEQA 4ZOAA 3E0IA 4DJDD 1A5LC 3SSZA 1BRLB 4FZIA 3GR7A 3EX3A 3PZNA 2DZBA 2QCDB 4LFYA 3WMSA 2X0HA 3C52A 4NEWA 1UIOA 4EQRA 4L65A 1VRDA 3ITXA 1HJQA 4BI7A 3FOKA 4OIFA 3GAKA 1QOQA 3GHTA 1GERA 4N6FA 5FEXA 1R5YA 4HA1A 5E0FA 1SSDA 2HRWA 2B7PA 2XWDA 2GGJA 2BC0A 4BK9A 2FMNA 3UPWA 5F2MA 3ANUA 2VWSA 4DM2A 1V3MA 1R87A 1M7JA 3DHFA 3SCTA 4DUXA 4NI3A 3EOLA 4PMYA 4KIEA 4E6MA 3VI2A 3STGA 4CCDA 2OQHA 3HPZA 1W5PA 1Q8AA 4ZQMA 1SO4A 2F2HA 4LXFA 1QK2A 3AMGA 1BG4A 2E9BA 4JPGA 1UZHA 2PDJA 3T78A 3W26A 5AFDA 1NOWA 1ENUA 1UWUA 1G4SA 1ISXA 4F2BA 1N60C 2VR5A 4UR7A 1MEWA 1NDAA 1GQJA 3JZEA 4OU1A 4LA1A 3PTKA 3QZEA 4ZCWA 3PZMA 4PMUA 2HBXA 3AXKA 1BTMA 4KERA 1N7KA 3G0SA 3U2EA 5ECUA 5KMYA 1OZQA 3BWWA 4LB3A 4I3GA 2HCVA 1CXKA 2BXZA 1FWIC 3BOFA 3N2MA 2GUYA 2XYLA 2PZ0A 3PS7A 5LGZA 3B0PA 1CI1A 4TTUA 1C90A 1Z6KA 4S23A 1FWJC 3PZOA 3MV01 3FA5A 3EX6A 2Y8KA 3TV8A 1O5XA 5F1UA 3UG8A 2GQWA 1NDZA 3GH7A 3H2CA 4Z1CA 2R82A 5AZ0A 4IQJA 2PDUA 3RHGA 1R85A 3RITA 3QPYA 2R1PA 3OVPA 3FHAA 2ZOXA 2YKKA 2W54A 1SFTA 1Z42A 3GXFA 1QWGA 4IJCA 3D3AA 3EBVA 4UFHA 3G1AA 3THAA 3HPSA 1T8XA 3BURA 1JF6A 1GQLA 4I6VA 3WUGA 4XUGA 4GYFA 1QT1A 2DZPA 3CQHA 3QGKC 4MADA 1PO9A 1MUCA 4MJ2A 3N3TA 3PHAA 4NAFA 4S39A 1F73A 1PIIA 1SM9A 1UWAA 4EM4A 2BY0A 3ZMRA 3F1QA 4JGDA 1JDAA 2Y7GA 1UOZA 2IPJA 2Y5JA 4BI6A 1TUFA 5FKYA 5HAOA 3WQCA 1EPVA 5JRBA 3NDOA 4C5ZA 1E0UA 5A6BA 5JIPA 2GZXA 4W7VA 4XZ9A 2RDTA 1VCGA 1HKMA 3LCGA 3MKKA 2H3DA 3EDFA 4QJ3B 2HPMA 2V30A 4LYKA 1AQFA 3AISA 2V3AA 4PBEA 2J7HA 4YCPA 4G8TA 1R7OA 1JROA 3VDBA 2XGIA 2P3ZA 4IMCA 4HGXA 2R24A 1WXYA 3VNYA 3SN1A 2RAGA 2E9MA 4RCXA 1YQ2A 5JVLA 1FP8A 1I0DA 4I9MA 1FWGC 1R3VA 4FDCB 3O6DA 4Q4RA 3AIWA 3BGJA 3RJXA 3ARSA 3I68A 4A05A 3N18A 4QG6A 4UTJA 4L6OA 3BL3A 2QXWA 5I5RA 1AG1O 3SCRA 1RSCA 3OA3A 1EJSC 3LS9A 3KLKA 3ETRB 3P3BA 3CC1A 3RX3A 1KFKA 3E49A 1AQ0A 2XSBA 1QPQA 1CGWA 1LT7A 1R2SA 4F40A 2CBJA 4G56A 1UC4A 1TV3A 2ZRXA 2G3JA 2WJEA 3GW3A 5LHEA 4C6IA 4GRTA 2G4JA 1V0LA 1ZENA 4PTMA 5HA7A 2D22A 2ACRA 2R14A 1E6RA 2ANUA 1UZ1A 1PTGA 4Y2WA 1BF2A 1H5YA 2QEZA 3ANVA 3AQUA 3CJPA 1YDNA 4ONVA 2A21A 1SMAA 3NGJA 1UJQA 3I7SA 5T9CE 2NV9A 1AMKA 2D1ZA 3B9EA 5KZMA 4WD0A 4QX4A 3T6CA 3CGTA 2TAAA 1WZKA 1KW1A 2ZZ1A 3TJ4A 3AXMA 1Y5WA 3AIRA 4K8EA 3S0CA 4GO9A 1F8IA 4YL2A 5A2BA 4H2HA 4GYJA 4LYRA 2ZA1A 3EEGA 4FP1A 2WP5A 2VGIA 1XBXA 3ATYA 2ZUWA 4O13A 1VYRA 1VFHA 4MJ4A 3PC0A 4H4ZA 1EDQA 4LV9A 2QLYA 2ISSA 1SU5A 1XDJA 2WNWA 1BWLA 2DZUA 2ZUSA 3A24A 3NSXA 3FGCB 1ZS2A 3PUOA 1F3EA 2NUYA 5HNTA 2ZZ2A 1M6JA 2PLKA 3L5OA 1XYFA 3A13A 5C2GA 2NUWA 2EG8A 1SJCA 1A3WA 1KKRA 1A3HA 1HJSA 4R9XA 2ZWZA 3SUSA 2OO6A 1FFVC 3BMVA 3AHXA 3W2MA 3A3WA 4XVEA 4HPJA 4NI8A 2XH4A 4EPBC 2PGWA 1JCLA 3AIUA 2AL1A 2FKPA 3WQPA 2JF6A 5D2VA 1KC7A 1UD2A 4LBRA 1JYVA 2V68A 5EMKA 1XIEA 3WJSA 2E5BA 3C2YA 4JOMA 2O56A 4LGXA 4GI6A 3KRUA 4GBDA 4XVDA 3VFLA 4PUJA 3IIOA 4CQ9A 3NQMA 1YTDA 1GRAA 5D9NA 4AF0A 1RA0A 3EA2A 4LEQA 5CBBA 2GVEA 3ITYA 5EL1A 1NWTA 4UFKA 2BGSA 1W8GA 3NJ3A 3VCNA 3KP0A 3W00A 3W86A 4PCTA 3UCDA 1VIWA 5HUPA 1QNSA 3VGBA 3F2DA 1OFPA 1U2YA 3TYEA 3LRMA 3MMWA 4O12A 1JQVA 1RD6A 5I3IA 4V27A 4H7VA 4URIA 1E72M 1W9DM 1QHPA 1MOKA 1VR6A 2Q01A 3H4GA 4J3VA 2O0TA 1CGVA 4FX7A 2IKIA 1V59A 3CM4A 5CPMA 4GA8A 2XIMA 3DG7A 3PZQA 1MUMA 2WBAA 5H8UA 3AALA 3NYZA 4M56A 3KS5A 1U1UA 1R3SA 3L8KA 2WMKA 3TWBA 2IPFA 3IS4A 2YR1A 3GNPA 1LLWA 3WLQA 3F5KA 3CZLA 4HU0A 3UWWA 1GXFA 3N25A 2NW0A 2QV5A 3Q58A 3WF3A 2OLSA 3UR7A 1AZ1A 1GETA 4HNTA 3UWZA 4LQ1A 1FWRA 1KCLA 3LZ5A 4M0XA 1OG0A 4RZ4A 3BK0A 1F74A 4CN4A 4QNWA 2Q3OA 1WKDA 1HG3A 3C2FA 2D0HA 4D2JA 3LQLA 1X2HA 2OEJA 3J7HA 2GGEA 1ADDA 1R2TA 3OIHA 3BCJA 1NSJA 1H5VA 3IGHX 3RNDA 2Z26A 3RX4A 2ZYFA 1BFNA 5DMMA 2VX7A 3BW2A 4ORIA 4N4PA 1GESA 1X97A 3CUFA 5HMEA 1ELSA 1WB0A 4TMCA 3PJTA 4C6LA 3H2OA 3VGEA 1KBKA 5A94A 4ZFMA 1UW9A 2QF8A 4JFUA 2YPIA 4JN8A 1R30A 2DSVA 1XLBA 1ZB5A 2XVGA 1SO3A 1PIGA 4IGMA 2SFPA 2VDGA 1QHOA 4QAIA 4UQBA 4AMAA 2PRHA 1FVPA 4UOJA 3SY5A 3GX9A 3U0HA 2VKZG 1HJWA 1ZDLA 2ISFA 1T96A 2J8GA 4H8NA 2XFRA 4S3KA 3WLNA 3W7LA 4QG8A 4MJZA 4A8NA 3V4BA 1A47A 5GNXA 1B31A 1GOXA 3PP7A 4UTWA 4F0RA 1FH7A 3RNMA 3T8QA 1OABA 3JRKA 3ITTA 3CYJA 2JKPA 3WH6A 3I3BA 4M6VA 3BG5A 3UP8A 1QW7A 1K9DA 2BOGX 3AWOA 2FYMA 4PR4A 1DVJA 3R4IA 4AEFA 5CPTA 2YCJA 1DJWA 4GH3A 3FX4A 1DJXA 2JBMA 1TG7A 4JTHA 3LX9A 2YVJA 4GWEA 3W25A 4L1GA 2B81A 2WNZA 4Q4SA 4HK6A 3LB8A 1PIFA 2QQ6A 1NTHA 5DMYA 1I75A 4LBUA 2W3ZA 1QNVA 3OC4A 3R8RA 3R94A 1T99A 1QCWA 1Z48A 2WWCA 1TCMA 3GIPA 1B0IA 3APTA 3SIMA 3C3NA 4MNMA 3T08A 1C3FA 2Y62A 1RPXA 2Y6ZA 4Y9NA 1CXLA 1JD9A 2NV2A 3O2LA 3QV8A 1XLMA 2OZ0A 4B5UA 1O4UA 3AIEA 1EC8A 4FA3A 4XIAA 2BX7A 4EXQA 5DLCA 4Q7NA 2WZTA 4GACA 2GL5A 2BGQA 4B5WA 3UU0A 1FWTA 3PM6A 4PE8A 1W1PA 5CPQA 4LC8A 5F4XA 2J4GA 1J2WA 1BD0A 2WOWA 3GU2A 3AZSA 3UZJA 3TMQA 1GV4A 1C29A 5HJXA 3BW4A 4JIEA 5EY5A 3HMJG 2JEPA 3IJLA 3DAQA 3ALGA 3CHEA 3VIMA 4YPJA 2PUZA 2Y7DA 4M7SA 1IWAA 3PBVA 1TVLA 1P48A 4M1BA 4ORMA 1LORA 4IIEA 3W28A 4GYPC 1ZX9A 1RQHA 1JZ4A 4GNVA 6A3HA 4M3PA 2ZTKA 2ZXBA 6CGTA 1TWWA 4U3CA 3B8UA 2R94A 3OBKA 2GDVA 1UKQA 2EHHA 3A9BA 3IUHA 4IMFA 5G2IA 2ZZ6A 4OOUA 4LIIA 1E9LA 1K6AA 3U4AA 2FVLA 4FLRA 1YADA 3VZXA 4D8AA 3TROA 1F05A 1HVXA 3E2SA 4DJDC 5T9BG 3GFXA 1K7FA 1UA7A 4RV8A 3QY8A 3SO7A 2GPTA 3WDJA 6XIAA 3O15A 3QLLA 4Q7IA 1O5QA 2ZDRA 3SW6A 3VX0A 3EWYA 3UZYA 1LYXA 4XAFA 3RLUA 3L0KA 3THQA 1O6IA 2JQXA 1SGJA 3MSYA 5AY7A 1NHSA 2J7FA 2UV8G 4IG2B 2NUXA 4N4QA 1ME7A 3SQPA 1KFBA 1UP0A 5TQLA 1NQ6A 4LF2A 1IZJA 3IJQA 2WOIA 3D5HA 2TPRA 4PSRA 1B3ZA 3KLJA 2NVDA 2PGEA 3WQ5A 5JBEA 2CHNA 4R34A 4R7WA 4AD5A 1L2UA 2X1IA 3IUIA 3QFBA 1WKYA 1YYAA 2RH9A 4AWUA 3O1NA 4WCJA 2J7CA 4A4AA 1KXVA 3MT1A 4E4UA 3CYVA 3NPWA 4NNAA 4AYGA 2GJRA 3HOJA 3S2MA 4GNJA 3MUZ1 4X2RA 2GVYA 3INPA 3NVYB 3IGSA 1F3WA 2X05A 5CSYA 2XFYA 2QPSA 5F2GA 4HOXA 3T2OA 3CPRA 2AKMA 1ZP4A 1MNZA 4DO7A 4B92A 2J7DA 2P1FA 3PSWA 1S2AA 4GJ1A 4Z1YA 1E0TA 2C6QA 3ITVA 2J7GA 3ERPA 2VQUA 3VD3A 1YXCA 2QVHA 1X1OA 3GK0A 4AVNA 3AROA 5LNRA 3OYXA 3SJNA 4EK7A 4HPHA 1FEBA 3B9DA 2E6DA 1R47A 2WHMA 3VCCA 4AF0B 4Z1BA 2PI6A 1W3KA 3LXDA 3A21A 1SW3A 3LN3A 1EX5A 1FWWA 3FN9A 8XIAA 3NZRA 4JHOA 3UPBA 3F4WA 4GYKA 4IX2A 4QGCA 1EBGA 3T0TA 2DJLA 5I03A 1HJUA 3ATZA 5D03A 1MO0A 3HV8A 4AD4A 4H4PA 1GEQA 1XIHA 3B4UA 3PAJA 5BROA 4CU6A 1ZCOA 5G1MA 3AHYA 2IUZA 5I00A 1XG3A 2VC5A 4MAZA 1XLDA 4PCFA 3BAYA 3SGGA 1JXKA 1PKMA 5FJPA 4E4FA 3SCOA 3N15A 4LVGA 3BV7A 3SGZA 3ARTA 2NQZA 3DG3A 5J5DA 1WDSA 4IM4A 1XIGA 4N7QA 2YBUA 3MMUA 1TYTA 1JZ3A 4HTBA 1KGXA 2WP6A 3BOXA 5D8WA 5BOEA 4PBGA 2E77A 4QROA 3CB8A 2OEKA 2ZX9A 5CH9A 3PK7A 3KEHA 4MZ1A 3TXVA 4HSOA 4WSKA 2PF0A 1MWOA 1UZDA 4CLMA 4DJFA 4YS1A 2VCAA 2OX4A 1RY8A 1IXQA 4Z2IA 1KCKA 3WLRA 5B80A 3U3HA 3GZAA 1JFHA 2XGZA 1S2WA 4ZQOA 5HWMA 2IMRA 6ALDA 2D2OA 1XPGA 3VAVA 3EX4A 2A85A 3MI3A 1DHPA 3N9SA 2QJMA 2V9DA 1J4EA 3OGSA 1W9XA 1H09A 2X0YA 1KXHA 2A3BA 5G5HB 1JCNA 1Q6FA 1DNCA 2HNEA 2DJXA 5LIYX 1KR1A 1E4NA 2ZX6A 5H8PA 1O66A 3WQGA 4LALA 4US5A 3W7NA 1QHZA 5FJOA 4R5EA 2R1NA 5DF0A 3QKEA 1KXQA 1M7XA 4KPRA 1DJGA 3GKFA 4H9XA 5DY3A 4ICMA 1V3KA 4OUEA 1L6WA 4X61A 2I5IA 3PNUA 2PAJA 3K5XA 1X7IA 2ZX7A 3UR8A 1X1ZA 4K1GA 3TN3A 3W1XA 3GO2A 3DBPA 3GWQA 3PY2A 4UTKA 5DX7A 1ZL1A 4ATDA 4BI5A 1VFSA 3AXIA 3EB3A 1K8ZA 4AU0A 2PLMA 5BYWA 3T0AA 2VQTA 1RCOB 3NA8A 4IGNA 4MZ8A 3BAJA 4RNJA 2F38A 4UQ9A 3ZT5A 3KFTA 1LP6A 2QJJA 1TZ9A 1SJBA 2I1OA 4A21A 4I7VA 3NQDA 2CYGA 5DT7A 1MQPA 4NJJA 4IUGA 3NR0A 3H21A 1XDLA 1MW1A 4ZGYA 3VZYA 5FD0A 4AZGA 4H04A 4PMZA 4AZCB 2WQPA 2Q71A 3EWBX 3VINA 3GTHA 4W5ZA 4J2PA 3ABSA 2VZTA 4NJIA 3UA4A 4DNAA 2B0MA 4LAKA 3S83A 4XD4A 3CV2A 5BU6A 3WLTA 4OWGA 1I6NA 1LOSA 2ZUVA 1K03A 3VK5A 1XISA 3THCA 4R7OA 3M43A 3S42A 1Q3NA 4NRSA 4UMBA 1MVYA 4GY0A 1WXZA 2GJLA 3KWSA 3AYTA 4TO8A 4Z2LA 1SR9A 3M5YA 4A35A 1EGVA 5FF7A 2J6XA 4QS6A 3I10A 1TIMA 1A0CA 2BVDA 2WVVA 1NHQA 3RN6A 2A5HA 5D02A 3IVUA 3M0JA 3GG7A 1GG1A 4BQ2A 1A49A 1JCTA 3CU2A 3GM8A 4KS0A 3KVJA 2C0HA 3URQA 2JF7A 3PF3A 3F5LA 3HG4A 3ALFA 3I6TA 1ZKQA 4JEJA 1JNDA 4W7WA 3TSBA 4E0CA 1HUVA 1W1YA 3N29A 4EX4A 1Q6EA 3W1QA 4LTSA 4W8BA 4C6CA 4Z42C 4CVUA 4LCQA 5CZSA 3RM9A 4QCFA 3FYPA 2ODOA 3P80A 3CO8A 3GH4A 3WNKA 3VGDA 5FI8A 4M51A 3ZQ9A 4L56A 1JJKA 1K8XA 3M16A 2AL2A 3MDWA 1SVDA 2G3NA 3ISIX 5A6KA 2BVYA 1KRBC 4XKMA 1KFJA 3BJSA 3O05A 5D09A 4J35A 3KTSA 1XANA 1H49A 5A95A 1FCVA 2JK2A 1TA3B 1M03A 4JHZA 1RP8A 3DGZA 1ZMCA 3TCSA 4I7WA 4UTUA 5FF0A 1JEZA 1NFBA 3AO0A 3SUTA 3LCIA 3PTMA 5ENLA 4XG1A 2E4TA 5D30A 5I02A 4GHRA 5A8QA 5DXXA 2AKZA 4H4VA 3LERA 3H2FA 3CLMA 2E09A 1LWIA 3VKBA 1Q6DA 3AZRA 1UH2A 4QJ1A 3GNNA 3UETA 2INEA 1JF5A 1GKRA 2ZZ7A 1GOQA 2DSUA 5LNSA 1YLVA 3OO2A 3SRDA 2ZADA 3KRSA 2GSEA 4H50A 4EWJA 2J9YA 3AJ7A 5DT5A 1YKWA 1UWSA 2PDKA 4BS0A 5DMNA 1KD0A 4H4RA 3PUDA 4JQ9A 2Y8UA 1Q63A 4E2VA 4X60A 2CC0A 1E51A 4WY0B 3MZ2A 3C86A 4MLJA 1M3UA 1P1XA 4XBJA 3LTYA 5FJIA 4BQ5A 3UVIA 3G1RA 4ACZB 4WY0A 1F3TA 1X6LA 3PPHA 3L65A 3USZA 3P0XA 2CLOA 3W72A 1I2QA 3LPFA 3P67A 1FY6A 1NY1A 2P50A 2HE8A 3ZVHA 1AH3A 2V5KA 1H1ZA 1QI4A 4HU3A 3DU0A 4IXXA 3JZUA 2BHYA 4FI4A 2ICSA 4NZCA 3S9ZA 1NHRA 5FCZA 2HE5A 5AN7A 3IVTA 3VTRA 2O9PA 2XINA 4IP5A 3W38A 1I9CB 3RCMA 2BLEA 2DZWA 3LM3A 2I7GA 3CWHA 2VR4A 4RJEA 1N62C 3I3DA 3G1FA 1DWFM 1VPQA 3UY8A 3QMSA 2PWDA 3QR0A 2WMIB 1VD6A 2YCLB 3M0HA 4Z08A 4MLRA 1E9YB 3CT7A 4P7OA 5MHBA 4QJ5B 1CZ1A 1UKSA 3F4NA 4UMCA 4N9BA 3FFSA 3SDOA 1NPXA 2OQLA 4TX8A 3M7SA 3P5YA 3GYCA 5TF0A 2NX3A 3VD7A 1KBIA 1CPUA 2NVKX 2PDQA 3WDQA 3FCPA 1JR1A 1IWBA 1H7XA 2VELA 1P0DA 3ITLA 1S1RA 5CSUA 5I78A 4WDUA 2ZUTA 1PDZA 3NDZA 3U4FA 2C14A 4GGHA 5G1YA 4AAJA 4AUBA 2ZRZA 4JFTA 4MVAA 4ZOBA 1R3WA 4XBSA 4YTSA 5CGTA 4B15A 5HPCA 1L9WA 1TSIA 4ICNA 5C71A 4RE0A 1WO2A 1M7PA 3A12A 2V38A 2C18A 4ATLA 4QITA 1CXHA 2QCMA 1BHGA 2DQXA 5I79A 5H91A 1ODUA 2PDNA 4GFSA 2WMGA 1WOAA 3EPNA 4QDPA 5EMYA 3QEZA 4CD8A 3P61A 1EF2A 4XWUA 1JYNA 1QNRA 2E6AA 4HPGA 2PPGA 4H4UA 1DTNA 2IXUA 5HQMA 2A79A 4NRRA 1EDTA 1UROA 4TUFA 4UNLA 1XLJA 5CGQA 4X63A 3T4WA 2ATMA 3AMCA 4AZ6A 4EQWA 2FPTA 1M9HA 4H9MA 3WH8A 3IARA 5JCLA 2QIWA 3OGRA 4MAVA 3WLOA 5BW6A 2XVNA 9CGTA 7PTDA 4RK8A 3VKAA 4C90A 4IIFA 1VFLA 2PDIA 2XU2A 3T0BA 3ZR4A 3LBOA 2ZZ0A 4L5ZA 3I7RA 5HMDA 1XHCA 1S5NA 2ACSA 4WY0F 4D8ZA 1BZLA 3RG6A 3QV6A 5F7UA 4N6EA 4LVDA 4P2VA 2V6OA 3TTSA 1V0KA 1M04A 1VDVA 2C0AA 3MHUA 3TYCA 1B3XA 3STPA 3MHFA 2ZCGA 4LT9A 4HCDA 4W86A 4UCFA 2TMDA 3SJ3A 5HK4A 1ADOA 4B4FA 1C91A 3W73A 3EAUA 3ZR5A 1GHSA 3IAQA 1XXXA 3BW3A 4QR6A 3JUGA 4PBFA 2VEMA 2EPNA 3C0LA 2VFFA 1UJPA 3OBAA 3FSTA 1FQ0A 3SCQA 3OBEA 4G7EB 4AZBA 1VC4A 1TIWA 2FTYA 4L6HA 1WP6A 1YRRA 2Z1XA 4DO6A 1JULA 3PN8A 1J0YA 1ICQA 1KTBA 2GR3A 2VFGA 4NILA 4JN7A 4G1NA 1M1BA 4GK8A 3VOHA 4A8RA 4BEUA 3UWVA 3VNMA 1E3ZA 1TPC1 1ITUA 4IXHA 4I9TA 3U9IA 2PWFA 5CJNA 3DFTA 3DC0A 3HO8A 2IS7A 3ANYA 5AKQA 2C15A 1NF0A 3GXMA 3R0KA 5D2YA 4AIBA 2PWUA 4F9JA 3NIYA 3M41A 3GFZA 1M68A 1V6XA 4CNTA 1X96A 3AXXA 4FNSA 4PZVA 1KM6A 3NL2A 3I65A 4YN5A 1EJWC 4JX4A 4ZR8A 4UTFA 2F2KA 1XLEA 5AOUA 5I09A 1GQIA 4F2UA 3QM3A 1EC7A 1M53A 3CUHA 2Y1HA 3GDLA 4A8LA 3TJXA 1KM1A 2INZA 1EO5A 2GDQA 3WL1A 5BOOA 1EGMA 3DGHA 3KVMA 3EKZA 2XFFA 3PJUA 3WUBA 1G6CA 1P0NA 1PCKA 1HKIA 3DHPA 5FL1A 1BPLB 2VMFA 1V3HA 4DUVA 3B9AA 4R9OA 1E6XM 3GNDA 4MWAC 4QRNA 1XSIA 3GTNA 1DWJM 1FH9A 3RXZA 3EF6A 1J0HA 4WKAA 2HQAA 3OLGA 5C9XA 2G3MA 3IANA 1POJA 1ZPTA 4Q22A 1F3XA 4DZAA 1AW5A 1UD4A 5TNVA 4HMDA 1HGYA 2WNQA 1B2YA 4P8VA 1WKFA 6TAAA 3NPUA 4RZ6A 3TC3A 2FB2A 5AYBA 3S9IA 4ZVJA 4AZ5A 4H7ZA 1PWMA 1DQXA 3LRKA 5IHSA 1E71M 1ZHAA 3U5YA 3RM4A 1CGXA 3OQEA 3W7JA 1IXNA 1REQB 3MHGA 1UWRA 2F8QA 3GY1A 4LV4A 2WPCA 2VJXA 4IIDA 3IPWA 4IX0A 2VZOA 3TNBA 1TA3A 4XAYA 4US6A 3QVQA 2ZTJA 4H6QA 1XIMA 3W6YA 4PMXA 2P10A 4NIRA 3UXAA 4HTYA 1XGEA 2HEJA 3R8GA 1B1YA 1KTCA 3L5MA 2O7SA 2VC7A 1POKA 3E0VA 4GBUA 1AA1B 1NF7A 1RBOB 5CEWA 1KQZA 1AD4A 3WH5A 4FLQA 2YOCA 2WCGA 3LLDA 1EZWA 3OGVA 1K70A 1VIZA 2CLMA 3C6CA 3W7KA 2A2IA 1C7TA 3UR5A 3MA8A 5AB3A 1DJNA 1IXPA 2BCPA 1JDDA 1G7UA 3UEQA 1V93A 2EF9A 1K4HA 3WK3A 3P0WA 5G5IA 1TPVA 4HCHA 4DZ5A 4DEFA 4PUMA 2A3CA 2W66A 2WKGA 1XSJA 4FXJA 3S6OA 3N4AA 1BEUA 3VOJA 2YCIX 3MMTA 1ZSXA 3GXDA 5D4YA 1K9EA 4R27A 1IIHA 1PWLA 1UC5A 4B5NA 1LBFA 3S6TA 1WKEA 3NM3A 4O15A 4D6GA 1FHUA 3EAOA 3N11A 1SJDA 3L23A 4EQSA 3N1AA 3VGFA 2VFDA 2F84A 1FWCC 2D24A 4EXBA 2C13A 3HPAA 3QV7A 3QMRA 4M5PA 4XZLX 5I3HA 3GTXA 4ZO6A 3CQJA 4O8RA 1Q4NX 3MPGA 1OX4B 4FS9A 3G1XA 4HCLA 2NSOA 4DJFC 1JCJA 2YZRA 1IGSA 1V6TA 2Z7KA 2ZUUA 5REQA 1Y5XA 2AQWA 1FP9A 1FUYA 5TR3A 1LL7A 1ZBWA 2BODX 4H41A 4FIQA 4I7UA 1C9DA 3BGGA 2DV0A 5EB8A 4AX6A 2DVUA 3M0ZA 3ZVHB 5C54A 4Q4QA 1JOAA 4KWSA 1FKWA 1MXSA 1GVOA 1TJ2A 4ADTA 1NP2A 3N14A 3GIQA 4PRTA 3KHDA 3PG9A 2BV9A 3WSUA 2O9OA 1TWIA 1U30A 5EMLA 2UWFA 4XZHA 1XGZA 3NZQA 1G0CA 1HZYA 4QEEA 3SN4A 4L4MA 2Y0FA 2QCEA 1J93A 4GX9A 3AIBA 3NG3A 1JZ6A 1EBDA 4ZXLA 1OD8A 4H8UA 5J04A 1RM6B 4JN6A 1MNSA 5FSEC 3NQ6A 1C8VA 1BTCA 1P1MA 1J96A 4DM1A 5DANA 4K7ZA 5ER0A 5EYWA 2V3GA 4JY8A 1SR0A 3CUJA 1QPKA 4JQ1A 4F2TA 3WK1A 1HKJA 5A8OA 4D6EA 2YA2A 4HJWA 3KS6A 2WWDA 3WX7A 3YPIA 4QLJA 3RLGA 1F4AA 3DI0A 3OZYA 3Q37A 2Z25A 3K4AA 2E8ZA 3W70A 4LWWA 3IJ8A 4QQUA 3ZM8A 1CECA 4HNNA 4NZFA 2WOVA 3IK4A 1SZGA 3TR9A 4MPQA 1ZTVA 1QTWA 4RUBA 5DELA 1VS1A 1XH0A 4O17A 5LIXX 5A8GA 3TTEA 2GK1A 5FL0A 4BEQA 2GJPA 1AFSA 1UKTA 1XIBA 5LA0A 1I45A 4O50A 3NVZB 1TYPA 1D7YA 2G50A 2V82A 2IQ0A 4FR6A 3QLDA 2IXVA 3GFYA 3VNJA 4AZIA 1O5KA 2E3TA 3ENLA 3MYOA 1V7YA 2Y70A 3GRTA 4IPNB 3SCUA 4AX7A 2RJHA 3BAXA 4XZBA 4R85A 4E2BA 1I1WA 5TIMA 3UYIA 1FHLA 5F1VA 1EO7A 1V02A 3RPMA 3V1PA 3TXZA 4DWSA 2P5NA 4ZQCA 5EKYA 4K2SA 1EP3A 4JYFA 4LEFA 4BCEA 4JIIX 1GZGA 3TYDA 3KRZA 3GR4A 1PHWA 2TRSA 2L5HA 1E15A 3TVAA 5EBAA 2PF8A 4WJXA 1BVWA 3VIPA 4IFKB 2PTDA 3KL3A 1VAHA 2D0GA 3MO7A 2Z1VA 3MANA 3G1DA 2FGZA 4NQ1A 1LG2A 1VP5A 1VQTA 1O1HA 1J5TA 1XUUA 4AQLA 1XYBA 5DMLA 1OFAA 4W7UA 1XQLA 3QC0A 1DXFA 3O16A 3MMDA 5FACA 5GVJA 1V0NA 3B8DA 2R9RA 3DXIA 4YHGA 1E70M 1E6ZA 1P6BA 1GRBA 5E93A 4FNUA 1BXBA 9XIMA 1RJQA 3MKCA 5L9FA 4P7LA 1ZJHA 4P7RA 3VXGA 4RZ5A 4O10A 3VDHA 2J8TA 1E1CB 3T0CA 1VLWA 3WLJA 4UTWC 3MJYA 4HQVA 1DKWA 4UTIA 3N19B 1RP9A 1JPIA 4H4XA 3OLIA 2W3SA 3STEA 3R58A 3DUGA 2ZA3A 3NDYA 2VOMA 1FWSA 1BYCA 4IL2A 3GHSA 1V77A 4PYSA 4DZHA 4J28A 4UUIA 4CQDA 5JH2A 4Y90A 5XINA 1L0PA 5AYYA 4DAFA 2X8RA 2C3CA 2Z2AA 2IQDA 4CEXC 1QAPA 1M5WA 2WJFA 3HF3A 5A6BD 1EBHA 2F5ZA 4MWAD 4PMDA 1R3RA 4QEHA 5AHMA 3LM7A 2EPLX 3A3HA 4L1WA 4CQ8A 2V5BA 1ZFJA 1DOSA 2GOUA 4N2YA 1DV7A 4GI9A 3NO5A 2ZBTA 3LUTA 1IT0A 4MUZA 3NQCA 1UUMA 2MANA 3PNZA 3L4UA 1LJYA 1SO5A 4JTRA 4E8CA 1A0EA 1VBRA 2XH0A 3EWWA 5K4XA 2XPKA 3AMDA 4B9YA 3BARA 3PZGA 2ABBA 4N0RA 3AYRA 3LTSA 3II4A 4ZXOA 1Q65A 1EX1A 4GC4A 4OKDA 5CCZA 4RKAA 4ZB2A 2PDPA 4KMQA 3Q6JA 4AHQA 1XBYA 4DBEA 5BWFA 3QR1A 3VM5A 1VH7A 3UWYA 1SZNA 5HNUA 1W8SA 4OQVA 4H4QA 2QUVA 4CNOA 1BYBA 1ONEA 1TV4A 3HG5A 3LGDA 5MKGB 2E25A 3SUVA 3BVJA 1W3JA 3KDOA 4RNIA 5GNZA 4HBKA 3RCYA 1ECQA 1H11A 3IV8A 3TA6A 4HNVA 3EDKA 4DIAA 4R88A 2PLJA 4W93A 2ADAA 4PRWA 3V3WA 4AY7A 5FS9A 4U5IA 3K1DA 1JCYA 4CNUA 5K2ZA 2EQ6A 4BR1A 4L64A 1MRAA 5KTLA 5J8LA 3CEUA 4LNYA 2YDQA 4HMEA 4UBPC 3W4RA 1US0A 4IIHA 3MV11 2G5WA 2AAAA 2O4MA 3WQEA 2E67A 1YNYA 1KBBA 1JCXA 4Q4MA 3Q2DA 3UXLA 1DQWA 3XIMA 1XS2A 3M6DA 3SY1A 4YJ5A 2CITA 1K1DA 1LRNA 3L4XA 5FAJA 2BY3A 4GXPA 2X7VA 4FB7A 3RRXA 4GUJA 1R2RA 2DDXA 3PJWA 2HS6A 5D2TA 1GW9A 3BJFA 3CWNA 1XLAA 2FGLA 2PWGA 2X42A 4HZMA 1OZMA 3W27A 4MWAB 4WRHA 2VD9A 3A4XA 2OXNA 1W2PA 3CQ0A 1QK0A 3LCWA 1X39A 3LPOA 4BWLA 5LA1A 2XVLA 1WBHA 5C9UA 2WPFA 4TQTA 1EB3A 2YIHA 4JDBA 4AIUA 2ZDSA 3ARUA 5D9OA 5E1QA 3M64A 4U10A 1TJRA 3WF1A 3B0VC 1W6TA 1LWJA 4KEVA 3AMKA 4NZ3A 4BY3A 3MU7A 1BSLA 1AMYA 1GGOA 2QMKA 1OHLA 2GSHA 3LCHA 3TAOA 4Q7BA 1U5JA 1TPWA 4MNJA 1SSGA 1TPEA 8CGTA 2O92A 1MQRA 4PUWA 4WX2A 4FF7A 2DP3A 4WJEA 2ACQA 4K38A 4UFLA 2RGLA 3GNXA 1X6NA 2JKEA 3JR2A 1FBAA 3EWZA 1G67A 4EKJA 2HS8A 2YL6A 3CZGA 1BVZA 3KL0A 3SN0A 4S1FA 2Z1BA 1FECA 3HGJA 5D33A 3W1AA 5IHRA 4JBRA 2KAUC 5E09A 3DDMA 3BXWA 5E0KA 1WE5A 3KBNA 1J9YA 4H9TA 3LPPA 1ESWA 4ZTXA 4ES4A 1FWNA 4ZTYA 1NDWA 1TTPA 3AZTA 1XYZA 3HU7A 1XP3A 4Z2GA 2C1GA 1TFVA 4Q8UA 2ASHA 1WZMA 3TK7A 4UTTA 3LZ3A 5I6SA 4LRSA 1W3TA 4RNHA 2ZXQA 3PG6A 4C5YA 4C1NB 1S5VA 2WAGA 4IISA 6TIMA 4LANA 5A6MA 4S3JA 4CU7A 4NL1A 4KWUA 2YFOA 3W85A 3KRBA 2WSKA 4KETA 3GBDA 4J1OA 4K6AA 1J8VA 4AVFA 3R7MA 5HUOA 2XM1A 4AEEA 1WOBA 5LXEA 5LGXA 1A5KC 2E5DA 2D2GA 2J78A 1J5SA 3TQPA 5BMXA 5C6MA 4U3AA 4LNCA 2YDSA 2Q8XA 1HKWA 3TN6A 3W71A 1H62A 4MWAA 4PMQA 3VIOA 2QDDA 2BOFX 1U5HA 3OG2A 5CZ0A 3K8LA 4Q4PA 2YW4A 4RPQA 1ISZA 1KLZA 3GDTA 4WGHA 2XSXA 1XRSA 3QXBA 4TOQA 2PU1A 4X9SA 1X1NA 1XQKA 1MMFA 4ASTA 3HW2A 1A3XA 4DWSC 3FAXA 3EWUA 4EM3A 4Q6JA 3PPGA 1JL8A 2OR2A 2QT3A 1UQYA 7ODCA 1PZ1A 3NQGA 5K3VA 2Z1SA 3WQ8A 1Q45A 1V51A 3IJ9A 4E2OA 5I2UA 3K46A 3FK4A 4LSBA 1P6WA 3EMQA 3PWAA 1UKOA 4ADWA 4F0KA 1Y7VA 5I3KA 1QNPA 4V15A 4EANA 4XV0A 3SBFA 3CPGA 3QR3A 3VNDA 4GJJA 2Q09A 1K9TA 1FWEC 3AN1A 4IQEA 2CESA 3NOYA 3AFBA 2PFHA 3ONCA 3PUEA 1XYCA 4LYPA 5H6HA 3P74A 3FHQA 2NWSA 2CLEA 2DPEA 1KGWA 4IMGA 5I06A 4OGZA 2G3FA 4RE4A 1MW0A 1EOMA 1O12A 2NX9A 1EJTC 3PZIA 3WDRA 2NWRA 4F3HA 3GD6A 1GHRA 3LYEA 3OJGA 1RVKA 4DO5A 2DSWA 3M0LA 7TIMA 3A23A 3WNLA 2I5QA 1TV7A 2GQ8A 1RH9A 3EXSA 3W2UA 4JKLA 4AD1A 3FXYA 3WN6A 1EKOA 3VE9A 1RQBA 1QPOA 1JIBA 2ZZ4A 3CV6A 3KOWA 1CBGA 3F2BA 4E4PA 2DZXA 1GJWA 3E0WA 2AMGA 4IFKA 3N17A 3W81A 3CGEA 2XTKA 1IWPA 1EF3A 3GVWA 2YW3A 1W1TA 4K37A 3MSGA 3GXPA 1MRQA 3R0DA 1BG9A 1Q66A 2NT1A 4YCOA 4DWSB 4F0LA 3S4TA 1H50A 3RO6A 4JTDA 2DSKA 5CAHA 3TH6A 1N8FA 1TREA 4DPQA 1T3QC 1XW8A 3G1VA 3PBGA 3FDKA 4LAUA 2J66A 4DUWA 1QOPA 1ZBVA 3KE0A 2V5DA 5BXTA 3IVSA 1ICPA 3EXRA 2AAQA 4RPPA 3H4XA 3GW0A 3GAYA 1FWFC 4O1DA 4W8AA 3MSDA 3T09A 1JAKA 1R3QA 3WKZA 2OZTA 3UESA 3GRIA 4PMRA 2WO5A 1UWQA 2OB3A 2QCHA 3DYMA 3TONA 1PSCA 1HN1A 3QYSA 2QPUA 1XHGA 3KOXA 3CIWA 2HSAA 1X98A 3B9JB 4WDTA 1QNQA 3F4DA 1AZ2A 3JVAA 4MY1A 5G4EA 3CIVA 3NVWB 4JQ4A 1V79A 3LTPA 3JW7A 4B3LA 3C0SA 1EIBA 5IDZA 1RCQA 4GINA 3D6NA 3N13A 1E5JA 2XHYA 4ZFCA 5EU9A 1QPNA 4TMBA 3CGCA 1HKVA 2JIWA 1JGIA 2Q8ZA 3STCA 2UY5A 3G6LA 3T05A 5JH1A 1WDDA 2QIIA 3B03A 5K9XA 4BF7A 1YTEA 3N2XA 3VGGA 1B3WA 1B9ZA 3SY8A 4YLWA 2HK1A 1R6WA 4LC6A 3UCQA 4PCNA 3W53A 2YGYA 3PBWA 4JL1A 1KWGA 3VOIA 5LHFA 3B9NA 5EGRA 3RILA 2ZE0A 1J6OA 1OBAA 4H2CA 2I16A 4ZE4A 4PL1A 4XZNX 5A6AA 1LOLA 3GNOA 4RE2A 1EWEA 3BC9A 3DJJA 1W17A 4UIOA 1J11A 1JNEA 1GVQA 3LGEA 3T0DA 1AK5A 4B3KA 3AWNA 1JZ8A 3H4WA 1B30A 1F4HA 5DRIA 1YBQA 3TTYA 2GJNA 3GTIA 2VD8A 3M5ZA 5FJJA 1KM2A 4MOZA 4IFOA 3WD4A 1EJUC 2C19A 3G18A 2VFHA 3MCOA 2JALA 3V75A 3EPOA 4EXAA 4O0QA 4R3UA 4H9ZA 3VA8A 5C0QA 1Q5MA 3LADA 4NSBA 1BWVA 3CS2A 4UCGA 3LOTA 3L4TA 4EAYA 3DENA 2PCEA 1GYMA 1FA2A 1YDYA 3VUSA 2H9AA 4OBSA 4H9YA 4KCUA 1TQXA 3O0KA 4UMAA 1KRCC 3E5PA 2HISA 1FRBA 3W02A 2YSWA 3FG2P 2O55A 3WD2A 3L68A 2EG6A 4JIRA 4AIEA 4I9JA 3STFA 4MF4A 1DE5A 1B4EA 1Q2RA 1A5CA 2DT1A 4C7DA 1H1YA 2WVVB 3AM9A 2J9ZA 4DI8A 3OHMB 3QHOA 5GQBA 2EXOA 2FFCA 4JYEA 4TVCA 3LBCA 3W7OA 3WBAA 2CKRA 1IR2A 1DXEA 4FSAA 4GO8A 4D71A 3UG5A 5CBJA 3BMXA 5LKYA 3EX2A 1GREA 2PGRA 3QGVA 1TR9A 1HW6A 1JYXA 2QUMA 4MMWA 2ZVIA 1ICSA 3AMZA 1Q6QA 2WC7A 2I17A 4B2DA 4G2DA 4H7CA 5BXSA 1W9VA 1KTNA 3QY6A 3BLOA 2OSYA 3ONBA 2DVXA 1F5ZA 2WJDA 4OBRA 4PCPA 1DXLA 4ZEPA 3LGGA 2X1TA 2P0IA 2A7RA 4GJIA 2B4GA 4MYXA 3ZR6A 1BWKA 4GYPA 3NNTA 1MDRA 5GNYA 2AAMA 2J8FA 4XX6A 3S46A 3FV9A 5E6YA 2QUUA 4HNUA 3BLEA 3FXGA 3C2RA 1YX1A 2HPIA 2WCSA 3WENA 2PDLA 4GKTA 2HNHA 3H12A 3K8MA 4ERGA 2EO7A 3VVGA 3NXLA 5EFDA 2CLLA 2REQB 4KFNA 3SQLA 3KL5A 1TUXA 4QE1A 2QCNA 2YBTA 2I9UA 1GVEA 2FZ9A 1LLZA 1PKNA 5HNNA 3QV9A 1V3IA 1BSIA 4H3DA 2YYTA 3G2GA 1A0DA 4GMEA 3TTQA 3LG3A 1TX0A 3WFLA 1RQEA 3APGA 1PDYA 4D1JA 3H2AA 3SRKA 3UWQA 3LXAA 3SCWA 3VD5A 1OC7A 4M24A 3HIJA 4CNPA 2Z27A 1L8NA 1J2BA 3NQAA 3E96A 3FKRA 3EWCA 4NKCA 3TU9A 1W5QA 1GQKA 3KX6A 2WSRA 4Q32A 1P7TA 2HWGA 7XIMA 3EMZA 3DK9A 3MI2A 6REQB 3D0CA 3MUAA 1N5XA 1A50A 3AI0A 1MW2A 4QJ4B 1E6QM 5FEZA 5A6TC 2W6RA 3H2NA 2CBIA 1LBLA 2DH3A 2VCBA 4Z0SA 4C6MA 3QZ6A 2VWTA 3LXBA 1XX1A 2ZZ5A 3WLSA 3HV9A 1A53A 1W1IE 1D8CA 5M2FX 3LCXA 1LUCB 2WVTA 3V5CA 2NVAA 1QI5A 1JZ5A 4ENLA 3R07C 2BHUA 4UR9A 2WXDM 1UB3A 3NQ8A 3R11A 1CEOA 1Q6GA 1V08A 1QDSA 5D9MA 4UZUA 3T4CA 2WKLA 5XIMA 3KWXA 4V33A 1V4YA 5CSSA 1GTEA 1XBVA 3F4CA 5H1WA 3CMGA 4M6PA 3HQ1A 2IKHA 1OYCA 4K7YA 2FH8A 3AS3A 3A4WA 4GZJA 3VO0A 2TODA 5DQPA 3QW4B 2WC4A 4W88A 1YQZA 3L5AA 3ZLGA 4GG9A 3B8IA 1EXPA 1ZAHA 1XCXA 3UZ5A 2RKXA 5FA5A 2E6FA 4IPJA 3GHRA 3GXNA 1YTKA 4J3TA 3UZZA 4FX9A 2E1WA 1JYWA 3LENA 3ZT6A 4OOZA 1I2OA 4JNZA 4JQ2A 1SPQA 3T2PA 1D2KA 1Q6LA 1E9ZB 4PUNA 5I7GA 4JTUA 3W01A 4Z2JA 1KBLA 1XDMA 5AC5A 2J47A 4LX4A 2BFGA 3WEOA 5C9RA 3N6JA 3TJLA 1S46A 1SFSA 2O7QA 4J2MA 1CENA 5AVHA 2G41A 1DIOA 3W1LA 3VD9A 3REQA 3EXTA 1DHKA 2C3DA 2PS2A 1W31A 3A22A 5FOOA 1UZ4A 3DN5A 3M9YA 4Y96A 4F0SA 4NY2A 1OFQA 4MB1A 3W2KA 3W2LA 2V67A 2VRQA 4C6JA 1SJAA 4HHLA 1QPRA 3KUMA 3ZLHA 4AWSA 1KM4A 1BQGA 5HQEA 4KRTA 1VJZA 3G24A 3M46A 1RBLA 3LQGA 2Y4SA 2O4QA 3SB0A 3V18A 2AQOA 2G97A 3EA3A 1O95A 1NHPA 3A9IA 4O28A 1W37A 2Z1WA 2F6KA 4E3TA 4FAMA 1U1JA 6ENLA 1DJIA 1GSNA 4IIGA 1A5MC 3SR6B 4J3WA 3PZVA 1G4TA 4Y9AA 2ZIDA 1K8YA 3V5FA 2Z24A 2VEPA 5FF3A 3OZMA 3NZPA 2W92A 4IICA 4O1FA 1W3NA 4NVTA 1WUFA 3VILA 4O11A 1UP2A 3ZFHA 4ZB5A 2VVSA 1BYAA 1AQMA 3II1A 3W7QA 1VFFA 2FQIA 2A0NA 5K9CA 2WB5A 2G37A 5CG0A 3DBNA 1VYSX 3DESA 4I8YA 1RBAA 3Q65A 1S1PA 3QFEA 1XRFA 4CQCA 3HQOA 1RCXB 3S5ZA 1M7OA 1OK4A 2DUAA 3ITGA 5FJUA 3AYSA 3O6YX 4Z0JA 3TWAA 4CD4A 1TWZA 4DBWA 3DI1A 3FJNA 1VFMA 4FXSA 2VC6A 7A3HA 4P8XA 1OCBA 3VM7A 1UUOA 3W6MA 2Y24A 3M47A 3DFHA 1XFCA 2PMQA 1GCYA 5BRPA 4J4KA 4HP5A 1ZMDA 4S3FA 3VYLA 5H8MA 2XISA 3WD0A 1KWKA 1XGDA 4GVFA 1I0BA 1TTQA 2X0SA 2YL8A 3NEHA 2I56A 4CD6A 5A8MA 1S39A 3CHVA 1Y0EA 3WNPA 4B5XA 5E9XA 1B3VA 1O94A 1OB0A 2BVTA 4Q8MA 4KRUA 4D6HA 3TQVA 1XFBA 2VZVA 3M0VA 4JAWA 5U1OA 4AH7A 1GT8A 5C5YA 4KQNA 2E5AA 1NU5A 4TVWA 3SEPA 3QOKA 3FEQA 2Z6IA 2P88A 3LMYA 4LCRA 1F07A 3N6QA 2WK2A 8TIMA 2ZUNA 3L0NA 2TYSA 2Y89A 2VTFA 1UPMB 3L5LA 1K02A 4DWSD 2WMIA 1ML1A 1MUWA 3AMLA 1E0XA 3SQMA 4L7ZA 5I23A 2D69A 4GY1A 4O0ZA 4TX9A 1TWDA 4S38A 4WK9A 2DH2A 3KXQA 5D9PA 3TSDA 3COTA 1XL9A 3R89A 4KPLA 4RZBA 2V3EA 5HMSA 4JKKA 2CWNA 4PFHA 3PZUA 4R53A 2PDMA 2VL4A 3H54A 3OG3A 3PJXA 4OUIA 3TIMA 3KBSA 1UBPC 1E0WA 1RAKA 2P8CA 3KBVA 2GFTA 3CT2A 2HBVA 5LA2A 3B9OA 2WLYA 5AC7A 3U57A 3EA1A 1EP1A 1ZK7A 1OCNA 3UERA 4ZQNA 5G5GB 1GG0A 1ZLPA 2ZRWA 1Z8AA 3VNLA 3WD1A 3NUKA 4DY1A 3CTLA 3PWGA 3BG3A 5JCKA 4WSJA 1XKJA 3JS3A 1Q13A 2OSXA 1HL2A 4Y7EA 1HGWA 2YX0A 3UF9A 2OG9A 1W56A 3EMCA 1QW8A 3WLHA 3URAA 1IT8A 1H61A 2PU0A 1W91A 2WCAA 4DRSA 1UA3A 1GPFA 4KFPA 1A5AA 2C8NA 3IV3A 2Z29A 3LCLA 4GI8A 2E40A 3CQIA 1RVGA 2GWGA 1TE1A 1JDEA 2W61A 3LV5A 2O9RA 5HNRA 2YDRA 4INFA 1U5VA 4NZ4A 5SWUA 3MUCA 4FR1A 4IMDA 3WFZA 3HZ3A 1TPFA 4CUCA 1EJ7L 3LHZA 3WLIA 2ISVA 3GC4A 3NWRA 3HG3A 1V3LA 3O07A 1NM9A 3M0IA 2CCRA 2NVCA 4HMCA 1US2A 3EX1A 3MTWA 3AHZA 2CPUA 2KZHA 1B54A 3WDHA 1X6UA 1GOKA 3S1XA 1Q6RA 3V7PA 2NXHA 1SW7A 1XYLA 3E12A 3DYPA 2EQ8A 1OVDA 1DP0A 4Q8QA 4V2XA 3BSHA 1OT2A 2PDWA 1TRDA 2PZNA 3I4KA 5TAOA 4K39A 2HZGA 3MCNA 2Z00A 1QBBA 1QO5A 2WW5A 1HQTA 2GGHA 1VRXA 1Z32X 4D6JA 1CB7B 2DUZA 3P5ZA 1R46A 2CHOA 1XR2A 1AJ0A 3NTYA 3IAPA 4MM1A 5AECA 1R3TA 1ZGDA 1UUQA 3SRHA 4JCMA 4OHQA 1GRGA 1GVRA 2EPMX 5I3DA 4RX0A 1CW2A 3VC5A 1VBHA 1VCFA 4YXGA 2KX9A 3HJZA 4IJBA 1WA3A 4PH6A 3DHUA 3VNIA 4LVAA 4X2PA 3M0MA 2R1LA 2GRTA 2W91A 3DERA 2QKFA 1MXDA 5D38A 3MI6A 1CGUA 4DZIA 4JTGA 2FZNA 1I1XA 5FEPA 4HK5A 4K3ZA 1RD5A 4AB4A 1XPYA 4FHAA 4LPCA 2B7OA 3EGJA 1W1A1 2PWVA 4E3VA 1KNWA 3CASA 4H6EA 2VEIA 1L6SA 2QMJA 1F9CA 1DWIM 1J0KA 2W5FA 1VEOA 2QCDA 2D2HA 4UTLA 3GU1A 4EPKA 3TZNA 1FTXA 4H19A 3A3XA 3EKLA 4EP8C 2VNCA 3IUDA 1YE6A 1D9EA 1A80A 4WOQA 2PTZA 1JXJA 1JZ2A 5HINA 3TYZA 1JI2A 4X9YA 4ZO8A 2OWXA 2VGGA 3CMFA 3PBUA 2WPEA 4EQXA 3OVQA 3QTGA 4LBSA 3CH9A 3GRSA 2X8GA 4O53A 4LUSA 3LMZA 2VURA 4LS0A 4WXYA 1N2VA 3TN4A 3TUUA 2XFWA 2PURA 4RXGA 1UR1A 4UFJA 3G3MA 3DCPA 5JCMA 4MKVA 5DFAA 3WJYA 3W1TA 2ZZBA 3QHMA 2OELA 2A3EA 1R9ZA 1KBJA 4UQEA 1V6VA 2WM0A 1D7FA 1UQZA 4D6IA 1LRQA 5BZAA 4JFVA 4OE7A 1B9BA 4C65A 2QAFA 3DX5A 1BLIA 5A1AA 5ABFA 5C7VA 1H60A 2ABAA 3PBMA 5D8ZA 2P8BA 2XJ7A 4UFIA 4K8HA 4CN6A 1G7VA 3T07A 2XH7A 4K8GA 5C7HA 2HXTA 4GVGA 3P62A 1J10A 2J25A 3BAWA 4CD5A 2PB1A 1E4IA 4LUIA 4B90A 2X09A 1TB3A 3PPFA 1L6YA 3UWUA 4JICA 4Y9OA 2UY2A 4WKFA 5CG7A 4W9TA 4XBKA 2OTDA 3HBLA 3RYSA 1VGAA 3AS0A 3TE9A 2Y63A 3G0UA 2VC9A 1OD0A 4KKXA 3LA4A 1W3IA 2DIEA 1OCQA 1TV5A 3S2CA 4WJ8A 4CU8A 3ZVIA 3VKDA 4V28A 2B31A 4A22A 2PRLA 5I3JA 2CERA 1V6YA 2J79A 3NQVA 4PUKA 4S3AA 3USBA 4NZ5A 2DQWA 3GIYA 1HF6A 1RJPA 5JXQA 4ICCX 4DBSA 4XAGA 1GNXA 1TZZA 2GR1A 3H55A 1GK8A 2NQ5A 3DKJA 1VQZA 1KRMA 3IJDA 4KWOA 2Q8LA 3W7MA 2OX1A 4ZODA 4DVOA 2EKGA 5BRQA 1F8WA 1I4NA 5AHFA 1LT8A 3VIJA 2XN1A 3VKCA 3V0SA 1HL9A 1LOQA 2AOSA 4YHEA 1FHVA 2ZUMA 3PTQA 4PTVA 4XZIA 4NAEB 1WQ5A 1LM1A 4LUSB 4J57A 1MSSA 2CLHA 2QHAA 4JNYA 3LLFA 4CQAA 2ZVRA 1GPWA 2HROA 2PE4A 3TOPA 2PODA 1CLVA 4G9PA 4M19A 2QGYA 3CXOA 2A6NA 4DYKA 4AC1X 1DIEA 2CZ5A 3CQKA 4XKYA 1PXGA 3VOFA 1OINA 4IPIA 5FS7A 2YXOA 1DWAM 1ME9A 2NPXA 4NJKA 3S9YA 3TOYA 1GWJA 3FJLA 5HJLA 3MP3A 4GVHA 3E0LA 4MB3A 2CLIA 2NZLA 1OGBA 1PJ9A 4BQ4A 1YEYA 1BGGA 1J6PA 3AHTA 3NS1B 2JKAA 3BLPX 4I9AA 5KETA 3H6OA 4PMNA 3AIVA 4O52A 3GG0A 2R8WA 1C8QA 1W5OA 4AG0A 3V35A 3QSTA 4JX6A 2ACUA 2WSQA 3WMCA 2PEVA 1ALDA 4P8WA 1H2IA 2CIPA 3C8NA 1UPPA 4XO6A 1FCUA 1TR1A 3SRFA 1NFPA 4JIHA 2WKJA 4XAPA 3ITCA 4DI9A 1EIXA 1ZJBA 3GH5A 4WIWA 3ZS4A 3PG8A 3W1PA 1PYFA 1WDQA 1YHTA 4GIEA 5I07A 1UH3A 4IMAA 2R6OA 3NURA 1F76A 4LVBA 3T2QA 3BH4A 3TW7A 1P6CA 3CV1A 2C1IA 4I5XA 4A3RA 2AGKA 4H00A 2XM2A 1VBUA 3V0TA 4EPDC 3L2MA 1PPIA 2VZUA 1XH1A 1PHQA 4B9ZA 4GQBA 4XB3A 3OA5A 4ZO7A 1GVIA 3WO8A 1VZWA 5CLTA 4FO4A 5LSMA 1QFEA 4QNEA 1K4GA 3B0UX 5LNWA 2R9ZA 1F6YA 2VX5A 4O1BA 3ZWTA 3M1ZA 2JK6A 3MC5A 2WPBA 3FY1A 2FFIA 4S3BA 5HULA 3LDVA 3SZ8A 3WQVA 2QJNA 1VFOA 2DT0A 3G8EA 3WK0A 1CIUA 2OOGA 1S7MA 1HP4A 4WDXA 3HM7A 2V2CA 4X0VA 1VENA 4UFMA 3W7CA 3QF0A 1R7AA 2V8ZA 1IHIA 4LVFA 5CPOA 2ZRVA 3PAOA 2OCZA 3W2NA 1A5SA 1RK6A 2YB1A 3N73A 1I2RA 3FVDA 1HP5A 4JTAA 1NFGA 4DELA 3UD6A 3A7UA 3TQ0A 5M5DA 4LS1A 4XSLA 1XDIA 4DAIA 5IFPA 4UOQA 3VIHA 2EAWA 2FDSA 3P6LA 1OQFA 1AUSL 3RF9A 3BAIA 1JRBA 1TTJA 4YWIA 2YDAA 4YTTA 4GLEA 2ALRA 2J88A 1L6FA 2QVNA 5IOBA 4BWLC 1S5MA 4RW3A 4JIPA 1XRTA 3R6IA 1H63A 1O5RA 1NDYA 1OCJA 2OODA 2ONEA 3PPCA 3C0JA 3SSJA 2X99A 3G6MA 1TWSA 3LHWA 3CUXA 2JFEX 5EMMA 2OMAA 4HA3A 2VXNA 4ZENA 2WMFA 3IRSA 3TMLA 4HA4A 1CGTA 2ZX5A 3H4KA 5E70A 2PDBA 1KV8A 3OLEA 2CLFA 2EJAA 1XD0A 4C6EA 3ID7A 4K7VA 4NG3A 3GS6A 4OVXA 5GJNA 4KIRA 2WNNA 3W07A 1NP0A 4WUIA 4ALDA 3B04A 1NH6A 4ZOHB 1F61A 4XD5A 4JCLA 3U2OA 5AHNA 3M0XA 4WZHA 5RUBA 1OADA 4W4QA 3B8TA 4GQQA 2WOQA 1O7AA 2G96A 1T8QA 3UT0A 4IGHA 4REQB 3H2MA 3GDKA 3UGRA 4MJMA 4XSMA 4U28A 2WANA 3VU2A 1IEVA 3AYVA 1XCFA 3S3GA 3KVLA 2X41A 3L0GA 4G1KA 4ML4A 4WQ6A 4O1CA 1D8WA 3XINA 4Z2HA 4FOJA 2BWGA 3T42A 2X16A 1AD1A 2D3LA 3FVMA 3VUPA 1RHCA 2EPOA 1O68A 2C7FA 2PC4A 3S5YA 1XLGA 2PDFA 1OJTA 1GW1A 3S2JA 4NP7A 4S3EA 4S3CA 2R91A 2BASA 4FOUA 3WH9A 3E38A 3WBWA 3VDAA 1C93A 4IG2A 2A8XA 3TDFA 1EFZA 2X7WA 5BXRA 1HO4A 4BFAA 1DORA 1LPFA 3G8RA 2WVUA 2Y5EA 2RGMA 5GRTA 4BHYA 1LL6A 3F5JA 2X2YA 3CGBA 1E4MM 3IIXA 1RZMA 3GG8A 1Y65A 4EMJA 4MIMA 4N42A 3NO3A 3M5XA 3BSMA 1OGSA 2I9EA 2D73A 5REQB 1JRCA 3BSGA 4QIUA 3WUEA 3IJIA 2GUBA 4QDWA 4M7TA 2OZ3A 4NASA 3R12A 3FIGA 3SI9A 1Q4WA 3CZJA 1ITXA 5DRCA 1OX4A 1KGUA 1UP3A 4I5UA 3BDKA 1RJRA 2E3ZA 3FGCA 3Q94A 3S6DA 1LQ0A 3KP1A 3RPTA 3XISA 2ZA2A 4UR8A 3W84A 3CEPA 1NWUA 1OIFA 3CL6A 3DGBA 4CGTA 3WF0A 4GD0A 4LAZA 1LG1A 4DJED 1DJQA 1TPH1 4E38A 1EYWA 9XIAA 4QSFA 1RUSA 1CB2A 4Q4KA 2EQDA 5A69A 3GUGA 3WL0A 1PTDA 1E3XA 4EVZA 3P7YA 3OZOA 1D3GA 2FVKA 4DYJA 1H4PA 3LEPA 4EAMA 3K4WA 2C91A 5KZDA 3GC2A 3ZOAA 3L21A 4KCVA 4PMJA 4XD6A 2QR6A 4GQRA 2Y7FA 4KEMA 3UCCA 3S8HA 5JBDA 2OPJA 1XWYA 1QRQA 4AW7A 2PD9A 3KCOA 1NJJA 3N9RA 1IF2A 1GKQA 1LDCA 1YMYA 3QQWA 2XDFA 3MVIA 1CWYA 3CAKA 1MQQA 1XSKA 3FKKA 4HD5A 2GYIA 4NYUA 1PS9A 2WMHA 4M6UA 1UMYA 4UNKA 3DC8A 5AYIA 1ZZMA 4UZSA 3L4WA 1VJSA 3AS2A 4HYVA 1TELA 1ECEA 4IOTA 1UOKA 3MSRA 1XYMA 3HN3A 2DEPA 1QATA 4M29A 5H2ZA 2X8HA 4JFWA 1PX4A 4FMVA 4U33A 4QLKA 2DIJA 1TVNA 1L2QA 3FYOA 1V8EA 3W87A 3B4YA 2OVLA 4FNTA 1KCZA 3BLKA 3HURA 4WKHA 5AHLA 2PTXA 1WNOA 4C6DA 3POCA 1EZ2A 1T6MA 1AQHA 2QCLA 3LHTA 3W1RA 4ZSUA 1KLYA 2IPWA 5FSDC 3U5UA 2GJXA 3WF2A 2X1RA 3CLWA 4NAEA 4UB9A 3N34A 1Y8BA 4GABA 2TPSA 1K6WA 1S3TC 3DG6A 2XIOA 5ABHA 4DXVA 3HQPA 1IQ8A 1QI0A 4RLIA 4W5UA 5E0CA 1VB9A 1AJ2A 3FA4A 3NAVA 3MP5A 3N2CA 5FS6A 2D23A 1SQ7A 1GOWA 5HPOA 4ACYA 2QPXA 1MW3A 3BMWA 5U7SA 3WBEA 2PA6A 1Q8JA 3N12A 3Q67A 1S2UA 1EJRC 2VEFA 4TX6A 3NYDA 3G3DA 3U6WA 5D2XA 4UTHA 1TMQA 5HJYA 5M3WA 2W3RA 4N9CA 5JCIA 4Q8TA 3NQ7A 1ZY8A 1XI3A 3TC6A 1ISVA 3EWXA 2EQ9A 3VMPA 5D2WA 4HPXA 3TR2A 4B3ZA 3K8KA 4M82A 5HR7A 1J79A 3ICJA 4GUIA 4NYYA 2J75A 4JZ5A 2DVTA 3IIVA 5FESA 4LUYA 1FOBA 1P43A 3UZWA 1SB3B 2BS9A 5B7ZA 1BWCA 2DSZA 1E6PA 4IPLA 2VM8A 3TW9A 3H7RA 4WDWA 3WF4A 1HKKA 4RV3A 3O9NA 1GTHA 2YYUA 1VPXA 3N4EA 3URNA 1E1FA 3AUOA 1D3HA 4MSSA 3IGXA 4S3GA 4KWVA 4TV5A 3ZJ7A 1FFRA 4F66A 2YVFA 5CPLA 3QZAA 2OYMA 1XRVA 5BOFA 4GKLA 3CUZA 1IZCA 7TAAA 2CLKA 4NJHA 2H6RA 4GR1A 3KOFA 3LPGA 1E55A 3TYAA 1WDPA 1RLCL 4OFCA 1OK6A 5BU9A 4HMNA 2WHJA 2PDXA 2B7QA 3EEZA 3W7RA 3VPLA 3W7IA 5I3GA 5E6ZA 4XTIA 3W1NA 3WJWA 4E5TA 1TMHA 4O54A 2ZZ3A 1IYXA 1SZRA 1QO2A 5L6UA 3W7GA 2DORA 2Y61A 1XIDA 4EPEC 5CPSA 2Z6JA 2VGFA 1W3HA 3LU2A 5D05A 1N55A 4CNNA 4I8DA 4NUWA 4LB4A 1ISWA 4PEKA 5DCEA 4B5VA 3O3RA 4MZYA 4I90A 3RIKA 2X2GA 1DYSA 1UR8A 2Z7GA 1YW1A 2VI0A 3ABRA 1PYMA 2F7FA 4PUDA 2FIQA 2YVGA 3GYEA 4JDRA 3S1WA 4E8DA 4J3ZA 3VE7A 3W1UA 1H6VA 5BXPA 2GH5A 3ZZ1A 3UJFA 4O1AA 4F0HA 4HHPA 4PULA 4G5DA 1OYBA 1FDJA 2GQAA 2NXGA 5BCAA 3KW3A 1Z9AA 1UR4A 3T1GA 4C1NA 3WQWA 2YCLA 1H7NA 2VT0A 2FZMA 3WBXA 3VMOA 1XD1A 4JNMA 4HYRA 4LYQA 3QQ0A 5TBOA 2ZC8A 4RL3A 2WYSA 4RXFA 1FX6A 3ABXA 2J6VA 1GOOA 3ES7A 3V16A 1FIQB 4YWSA 2QZRA 4MB5A 4Y9MA 4QDMA 1V0MA 1PZ2A 3O7UA 4JTQA 1FWDC 3N04A 4O0KA 4YVPA 3S1UA 4MYAA 1RY0A 4DNMA 2OQYA 2BNJA 4LH8A 1ZU8A 1G01A 1E56A 1GOIA 4EIVA 1G9HA 2C16A 3EWDA 3OPSA 4H6RA 3CBWA 3CO4A 1P0EA 3ZJ8A 3S5NA 4ZA0A 3R0UA 3S5OA 1AJZA 5C55A 3S1GA 3PSVA 4J40A 2V0TA 1EEPA 4NT0A 3GVQA 4QE5A 5A8PA 4PC8A 1FDZA 5FJRA 2GVJA 4IH3A 3RCNA 1VBJA 1OFDA 3VIGA 2DZVA 3BO9A 3ECQA 4ROPA 5HMFA 3W0KA 4GPNA 2ZQ0A 4ATWA 1AVAA 5JU6A 3OVRA 3TQKA 1JAEA 4DYEA 1L8PA 1IIGA 1OX6A 2NLYA 4AMCA 3GD3A 2OLAA 3H7VA 2YFNA 1UIPA 1OSEA 1I2NA 1H1NA 2A3AA 1PZ0A 2BVWA 1ONRA 1EUAA 2FTPA 3BLLA 1ZXIC 5CKSA 2IKJA 4Z2KA 3UXDA 3W3OA 3S5SA 4QBXA 2YCEA 3BICA 5CBIA 4Y8EA 1Q85A 2YLAA 2GWNA 2X50A 4H4IA 1EA0A 2PCQA 5LNVA 4CCZA 4C6FA 1GRHA 1HNYA 1XLIA 2BGNE 4KFOA 1F2JA 2HDJA 1YPXA 3NGFA 3OTRA 1TV8A 4FOKA 2R1KA 1K8CA 1EDGA 3RK8A 3T81A 3T55A 2W0UA 4LAMA 3QYQA 5J5RA 1W5MA 1R8LA 1HO1A 2CZEA 4L1XA 3KCJA 1UKPA 1FFUC 1ODZA 3I3EA 1A5UA 1UMLA 3NFUA 3N2TA 2AGTA 1QUMA 3MWAA 3SQSA 2HK0A 3B8WA 4GUHA 2GUUA 4UC5A 3G5EA 1GUVA 3D9XA 2VRKA 3CB3A 3TYUA 2QDGA 5FAGA 5LZLA 1A5OC 3APYA 4A3QA 1RK5A 1N63C 3FW6A 2PBGA 5EMUA 4P61A 3UYCA 4DNHA 1VFTA 3LLXA 3E0FA 1YXYA 4GQGA 4LUTA 3KVKA 3UA3A 1WAWA 2TSYA 3GG1A 2NQJA 1G4EA 3SCVA 6XIMA 2VX6A 3SR7A 3VKKA 3C8FA 2BDQA 2UY3A 4TIMA 4J3SA 3P8IA 3R5EA 3UQNA 5DXYA 4FNRA 4DB7A 3NXFA 4GUGA 3A7AA 7ENLA 2BHZA 4ROQA 2QF7A 3G0XA 2J9XA 1KFLA 3SGUA 3WQFA 4TVDA 1VJIA 3BZJA 2VUYA 1ZNNA 3ZSTA 2FHFA 1W9BM 3PB0A 4FX6M 1FO4A 3F7JA 4QG9A 5IM51 1FKXA 5HATA 4CN1A 1W2VA 3ARVA 1F8MA 1JPHA 4FNPA 1VBGA 2GK1B 1SZFA 1XUZA 3AU2A 3TEVA 4F9DA 2FHBA 1S2VA 1EOKA 3EOUA 4JY9A 5C2XA 4H9UA 4TVYA 4UTTC 4KGLA 3D3FA 2ZXDA 1N8WA 4AZCA 2J13A 1Z44A 3HTWA 5ABGA 1JQXA 3DK4A 5LXXA 4C1LA 1EHAA 3LHVA 4O4VA 2J7EA 3KM8A 1X7FA 2WZHA 2CBVA 5E5CA 3NZ1A 2WPGA 4GCXA 2POZA 3WCZA 4PUUA 1OF8A 3EB4A 3UWEA 3DKLA 4DPPA 4W89A 4QISA 4P7NA 2H3BA 4DF1A 4FNQA 4PTXA 4YYCA 3MJMA 5IDIA 2PDHA 4YTRA 3ABOA 1E43A 1ZUAX 1SFLA 1V7AA 2PRMA 3GLCA 5HANA 1GEHA 1NWRA 2GLKA 1EP2A 3FA3A 3IIPA 1OWQA 4MFDA 4MFEA 1RR2A 3UG3A 4JD4A 1BAGA 1KA9F 1AL8A 1CDGA 4S2CA 3KCLA 3CL8A 4C60A 4E8GA 4FXRA 2AQVA 4EOUA 1F3PA 5F4WA 4L4OA 1N61C 4JTKA 2RFGA 1KR0A 3HPFA 4TXEA 3ORWA 3PR2A 1JGMA 1VCVA 4BF9A 5GJPA 1I8JA 4FF5A 4U31A 2CXEA 3RDKA 4J56A 3EYPA 3GVVA 4DJDA 4XKYB 2QCFA 1JEHA 3OOQA 4F4RA 2EPHA 1HT6A 3EUB3 4LUTB 4POCA 4AIOA 4GNKB 3TFXA 2OYKA 1T41A 3CHDA 3DJGX 1K7EA 1HL8A 4AEOA 1H0IA 1WUEA 1XLLA 2YB4A 1C7SA 4Q8OA 4A3HA 3LXCA 5LIWX 1R3YA 3O6AA 2FJKA 2YZ5A 3WQ4A 3V1HA 1TQJA 4PMOA 5E9AA 4LCSA 1FWBC 4GGBA 4D1IA 2ZKMX 8XIMA 2BY1A 1PKLA 3ABZA 1FCBA 5HBFA 1SMDA 3AIQA 4RDWA 4M6QA 3TCEA 1BRLA 3GKAA 5D32A 4A2SA 4I6KA 2PP0A 4FIRA 4KT2A 1GVSA 1GKPA 1X2GA 1LLOA 4XZWA 3EOSA 3U2CA 2NSXA 4PL2A 1DWHM 2H8ZA 1P4CA 2ON3A 3L4VA 4U2ZA 1QI2A 1HJXA 4Q8NA 1NIUA 1EL3A 2GQ9A 4YIWA 3WLMA 4YVXA 4DQWA 3EOEA 2QV4A 2WSYA 4Q6XA 4BQ3A 3UJ2A 3CGDA 1HX0A 2WSPA 4OTKA 4JTFA 2JGQA 3ABQA 2R1MA 1TYGA 3B06A 1QR7A 3KBJA 1BYDA 3DH7A 3OIXA 3BCFA 4HOZA 3CHCA 3LD5A 4HSNA 4M1RA 1RALA 1ZJAA 3LI1A 4W8LA 1K7XA 3WEMA 4NX0A 2NV1A 1LCOA 4MDOA 4LS2A 4CEUC 2NQLA 3HPXA 4AD2A 4JQ3A 2DGAA 3I7QA 5AHIA 5IRPA 1YNQA 1R9YA 4Z1AA 2G8ZA 3ZJ6A 3N6HA 4KESA 1ONFA 2QUTA 2E1DA 3R25A 3OQ8A 3HGSA 1TJ0A 3CHFA 2DU2A 5G2HA 4N9DA 4NHVA 2YQUA 3NEVA 3RMJA 3NVDA 1E73M 5KINA 5IBXA 3SURA 3DZ1A 3MWCA 4K1WA 4NNBA 3ZYZA 3GD4A 5A6LA 1NQKA 1CXFA 3TA9A 3TKFA 5HWJA 1B5TA 1REQA 8RUCA 1CGYA 5LYRA 1R0MA 2BOEX 3C5QA 5KVIA 1V02E 3LV6A 4XIMA 4H9VA 3O06A 3CIXA 1CTNA 4UQAA 3BE7A 3C56A 5M1TA 2FLIA 3RLVA 2FPVA 1AW2A 2Y2WA 4PCSA 3WBYA 1P0BA 4F48A 1FWHC 3R8HA 3HFTA 3LHYA 2FJUB 2W55A 4MGGA 5T8GA 4HT3A 3V5OA 2A4AA 2ATSA 4H83A 4AZHA 4K36A 1W32A 2C71A 4L9XA 2D20A 2OFJA 4A29A 5LIKX 2QS8A 3PUGA 5M17A 3NO1A 2OWWA 4N9EA 1WDWA 4IPPA 3RGTA 3VOGA 4HVXA 5K7JA 3EANA 3C61A 4IFRA 4B91A 3M44A 5EA9A 3AUJA 4RE3A 2W79A 2PBOA 3A64A 5CQ1A 4HZ7A 3BJTA 2Z2BA 4ZZ9A 4IMEA 1E5NA 3T8LA 4PEEA 4L4LA 2CW6A 2HJPA 3SADA 1JI1A 3TAKA 3AAMA 3NCOA 3QQ1A 3AU6A 3EDJA 3MKVA 1OFEA 3L9CA 3BPWA 3IEBA 3M0YA 5G2WA 2CFFA 3EOOA 1MZHA 3NQBA 4BKNA 1BVNP 3RM8A 2IPGA 2Y5SA 3KTCA 4O4WA 3MS8A 3CTTA 3I6EA 4GFIA 4YU1A 4PTWA 1GZJA 3B40A 4S2BA 5JCNA 5KVHA 3L67A 1UHVA 3LK6A 4P5UA 3OB8A 4ILSA 3LY0A 4FX8A 4JIQA 4H4SA 1M01A 5EFFA 2REQA 3G1YA 1MFVA 3BLDA 3IJ7A 1E9IA 4JKMA 1G1YA 4LF1A 1QW9A 1VLIA 1XF0A 2VRJA 5KZ6A 1GRFA 2QGHA 2QDHA 2OLHA 3QOMA 3UY7A 3UNTA 2BMBA 1H2JA 2GQ3A 3DECA 3PZTA 3GHUA 2CETA 2QJIA 1NOFA 3A7RA 3R10A 1FHDA 2VZSA 3R2GA 4PB5A 2ZX8A 3T7VA 1IEWA 3W37A 3DH9A 2BC1A 1THFD 4H8VA 3BQ5A 1W1VA 2QUNA 3CAVA 5U4NA 1EQCA 2RDWA 4Y8FA 4ZE5A 3WQ6A 1PKYA 4I5RA 3W76A 4APNA 4AXNA 1V97A 3I4EA 4WVXA 1OIMA 4IGSA 4ERIA 3QPEA 1XC4A 1P7TB 4FLOA 3SFWA 1JVNA 5AC4A 4IP7A 1OEPA 2PP3A 4OECA 3GZ3A 1OGGA 3L2LA 1KKOA 1Z3NA 1Q7ZA 3V0UA 2J24A 5I24A 3QMTA 2Z2UA 1VYPX 3WZ0E 3GTFA 4ZQPA 3IWPA 3BOLA 4OT7A 3WY1A 3GXTA 2OKOA 3RAOA 2PTWA 3RMEA 1I2PA 3PB2A 3WUFA 4G7EA 3G1HA 3CZKA 4TR9A 3CWOX 4Q8PA 4D9PA 1BXCA 3DFNA 1LVLA 1XLHA 2VO5A 2G95A 2BXYA 3O0HA 1W3LA 2CWXA 3URBA 5D04C 1Y5VA 1KXTA 1EUNA 1OY0A 2XIJA 2RJGA 1X38A 4ZO9A 1LZOA 3KOZA 4O16A 3D47A 2E28A 4AHPA 3H8AA 1AL7A 4QCEA 3KZPA 3MBDA 3FEMA 4JTSA 4JTJA 1TVPA 4GE8A 4IL0A 4BURA 2A6LA 3UXKA 1ZY9A 1HXJA 3OYZA 2QCGA 1EJXC 2Z4GA 1VKFA 1XBZA 3L2IA 3WYZA 4JTIA 3SUWA 1NWSA 2F6UA 5EBKA 1JPKA 2CFYA 1MEIA 5AC8A 1M41A 3W1MA 1DXIA 4O1EA 3TP4A 3T44