5JCNA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 130
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA02
4CNKA 1IUXA 3NRNA 1YQ3A 3H8IA 4UDRA 1E7PA 2GH5A 3II4A 1TYPA 2WEUA 3GSIA 3NK1X 1GRGA 4AT0A 3URHA 1YQ4A 1PBBA 3GYJA 2GEWA 4Z2TA 4PABA 3DK4A 4JQ9A 2BC0A 2YLTA 3DJEA 3LJPA 2BK4A 2V3BA 3NTAA 3GDPA 2BACA 2V61A 1JNZA 3P4RA 1DXLA 3AE8A 1B37A 1JRYA 4UDQA 4BK1A 2GAHB 1GREA 3AEDA 4PAAA 2YR5A 1GSNA 2CVJA 4J34A 4H4SA 3GDNA 4YSZA 2GB0A 5J7XA 2VOUA 1PJ5A 2CFYA 2GF3A 4GF7A 1GRBA 4U2TA 4C3XA 3AE3A 4U8NA 3DMEA 4B68A 3AYJA 2WDVA 4DNAA 4B66A 1PJ6A 2XCGA 4TLXA 4RG3A 1XHCA 1Q9IA 1CJ4A 2WESA 3C4NA 3RNMA 1EL9A 2XFPA 1N4WA 3AE7A 3WE0A 4USRA 1BWCA 3AXBA 4E0VA 4FK1A 2GR1A 5J60A 3SM8A 3QVRA 2YAUA 4J56A 2R0CA 5FS6A 1BGNA 3VR9A 1XPQA 2V6OA 4H4YA 4EMWA 3CGEA 2VQBA 3AB1A 4XWZA 1F8WA 1H82A 2J3NA 1P2HA 4Z26A 1D7YA 2QCUA 1BZLA 3GWFA 3RHAA 2EQ9A 2YLSA 3AYIA 1L9DA 5EBKA 5DBJA 2F5ZA 4FK1C 5CKUA 4EM3A 4IA6A 5TR3A 4B1BA 1H84A 3ITJA 2BC1A 1DNCA 1KNPA 2Q7VA 2Z5YA 2OLNA 2X99A 2A87A 3QFAA 4CY8A 1JRXA 3S61A 3AWIA 2C66A 4EQWA 5JCMA 4HA6A 1KDGA 3GMBA 4NEWA 1PXBA 2C73A 2V60A 3Q9TA 4XXGA 1N4VA 4BK2A 2YVGA 3UOXA 3AEFA 4UP3A 1F3PA 1L9CA 1NAAA 4GCMA 3DH9A 3EANA 2TMDA 2VRMA 4NTDA 4YXDA 2CULA 2ZZ0A 4Y4NA 3DGHA 3G5SA 4USQA 4APNA 2WPFA 2X8HA 5U25A 1S3EA 1TDFA 1TRBA 1VRQB 1REOA 3KLJA 1F8SA 2AR8A 3UTGA 2R46A 3M13A 3CNJA 1CJ2A 4CCRA 2RGJA 4H2QA 3DJJA 2R4EA 2XFOA 1E1MA 2PYXA 3ALLA 1KSUA 5KRQA 1OJTA 1P2EA 1PXCA 2E1MA 3NG7X 4K2XA 3VRBA 1GXFA 2WPEA 2VRLA 5HYMA 1E1KA 2XLPA 4IVMB 3GMCA 4Z24A 3S5WA 3ZDNA 4X9MA 4CBQA 2XLUA 2EQ7A 4WCTA 3KVEA 2QA1A 3AE1A 3LZXA 3NYEA 4H7UA 1L9EA 5JCLA 2ZBWA 2ACZA 1TDOA 1GTEA 1FECA 2C72A 4TM1A 5IQ1A 4U8OA 2B7RA 4U8MA 3UTHA 4C74A 3JSKA 1GT8A 4J2WA 1E1LA 4J36A 2WETA 2R9ZA 5KXJA 2VVLG 4A5LA 2YG3A 2AAQA 1CC2A 3KKJA 4YSXA 2R0GA 4Z25A 4A99A 2H89A 1B4VA 1JNRA 1KNRA 1VG9A 1MOKA 2XVIA 2JB1A 3I3LA 2Z5XA 1LJ1A 2WBAA 3AD7B 1BGJA 2B9YA 4A6NB 3CNSA 2RGHA 1JRZA 2X50A 4J57A 2WOWA 4MJWA 3EPTA 3UKPA 1EL8A 3K7QX 3LXDA 4EIQA 3AD8B 3VQRA 3UOZA 2X8CA 4EQRA 1IUWA 4TLZA 1E6EA 4AOSA 5KOXA 3F8DA 2WU2A 1LVLA 2C67A 2IIDA 3F8PA 4IA5A 1AOGA 3I6DA 3BHKA 2WS3A 2OA1A 1ZY8A 4EMJA 2C3CA 2RABA 2B9WA 2Q6UA 2YLRA 1ZK7A 3BI2A 3C4AA 3UOYA 4AP1A 2WDQA 4X9NA 1Q1WA 3NYCA 4OVIA 1OJAA 2XYOA 2HQMA 5GSNA 3PO7A 3UKLA 2ZZBA 2BXSA 1TYTA 4EQSA 2GV8A 2BS2A 4C5OA 4H4WA 1NHQA 3Q6JA 3D8XA 3KD9A 4K22A 2GR2A 5HY5A 1ELIA 3QSSA 3QSMA 4J33A 2A8XA 4BV6A 2YG5A 3NN6X 5BVAA 1BKWA 2XVHA 4A6NA 4OPGA 1D7LA 5EOWA 3D1CA 2FJBA 1BF3A 4BJZA 5EB5A 4H4PA 3BNMA 2WHDA 1Z6LA 1GALA 1TDKA 4OPUA 2NVKX 3R9UA 3OC4A 1LQTA 2A89A 2O9ZA 2XLTA 2YLWA 3AEBA 2XFQA 3AE2A 3V76A 4A9WA 1H7WA 1ZOYA 4OCGA 3LADA 2OALA 1MXTA 5KVHA 2DKIA 4D03A 1JOAA 4NEVA 2ARDA 4FDCB 4NZHA 4U8KA 3P4SA 4BJYA 4CRTA 1LTXR 3QFBA 3DK9A 1HYUA 1PN0A 2EQ8A 2YR6A 4NTEA 3NIXA 1DODA 1X31B 3GWDA 2JK6A 1DOEA 2BA9A 2YG6A 3ALMA 3V3NA 1VDCA 2JB2A 5U63A 3UKQA 4YSHA 3NK0X 4WX1A 1IUSA 4H4QA 2B76A 1IJHA 3HZLA 5KOWA 2BCPA 1CC4A 1B5QA 2YWLA 2FBWA 3ADAB 4U8IA 2XDOA 2YVJA 1GRHA 4C77A 1ZMDA 2GR0A 3O0HA 5ER0A 1K0IA 1KFYA 2C64A 3H8LA 1E1NA 4YTNA 2WP6A 1GETA 2R4JA 3CTYA 1NENA 3SFDA 4OPIA 1ZP0A 2DKHA 3UTEA 4UDPA 3LB8A 1GOSA 3T37A 1NHSA 4DSGA 1QO8A 1YY5A 2RGOA 2XFUA 3G5RA 1Y0PA 4YTPA 3UKHA 2BS3A 1S2QA 3OZ2A 2C7GA 1UKVG 3COXA 2V3AA 4GR1A 5KVIA 2APGA 4A65A 3GYIA 5M0ZA 3NT6A 4H2RA 4AP3A 3CGDA 1NEKA 4RG4A 3UKKA 1PBDA 2YQUA 3ICTA 2W0HA 2GMHA 4TM4A 4CNJA 2WOIA 3FIMB 2GRTA 3QVPA 3DK8A 1GRTA 2YVFA 1GEUA 1XANA 4H4TA 3E1TA 4EQXA 1CL0A 3CPHG 3ZYXA 3B3RA 5FS7A 2XLRA 4B64A 3NLCA 3L8KA 4LIIA 3RP6A 4YKGA 4B65A 1Q1RA 4B69A 4X4JA 2XFNA 4N9XA 2WP9A 3QSEA 4GRTA 2R0PA 1RYIA 3AEEA 4TM0A 4ADWA 1GRFA 4GDEA 2WPCA 2C75A 4CY6A 2FJEA 4OPDA 1Y56A 4ECHA 1DJQA 3CGCA 5U1OA 2ZZCA 5LV9A 1DOBA 3DA1A 3AEGA 3FPZA 1O95A 4GUVA 1YQZA 3NTDA 1D5TA 2QAEA 2E4GA 1TDEA 1PXAA 1L0VA 2X8GA 2R45A 2BCGG 5FMHA 5GRTA 1PS9A 3CPIG 4Z43A 1H83A 2BXRA 4H2PA 3GRTA 1ONFA 4JNQA 1K0JA 5L46A 3LOVA 4O5QA 2YM2A 2C3DA 4H4RA 1KF6A 3CIRA 3CN8A 2WDRA 3AEAA 3AECA 4GDPA 4EM4A 4H2NA 2B7SA 1FOHA 2OLOA 3B6DA 4AT2A 1B8SA 4IV9A 1F6MA 3NK2X 3PS9A 2YLZA 3F8RA 1IUTA 4M52A 4Z2RA 3CPJG 5FS9A 1FEAA 4KPRA 3UTFA 3NH3X 1QLBA 3IC9A 1H6VA 1LQUA 2C70A 2Y6RA 3P1WA 4ZN0A 3EAOA 1RSGA 2GVCA 4U8LA 4K7ZA 1V59A 3GD3A 3RP7A 3SFEA 3NKSA 4YTMA 5IPYA 2WQYA 2TPRA 4H4XA 4I59A 3H4KA 3C96A 2JAEA 2QA2A 1FCDA 5CQFA 4B67A 3EF6A 2VVMA 1QJDA 2AQJA 3VRDB 4JDRA 2V5ZA 3ICSA 1ZMCA 1ZOVA 2YG4A 3LZWA 1IUVA 2C65A 4JN9A 1COYA 1NPXA 1YKJA 3AD9B 3K30A 2XVJA 4U8PA 1W4XA 1XDIA 3UKFA 5BRTA 3GRSA 2VVLA 4K8DA 2UZZA 4ICYA 3VRAA 4NTCA 4XWRA 4I58A 4RSLA 2YG7A 3UP5A 1EBDA 1ZDLA 1M64A 2BK3A 1NDAA 4JY2A 2Q0KA 1F8RA 4H4ZA 2C76A 1IUUA 2WU5A 1GESA 1PHHA 1D4DA 4AOXA 4HB9A 1PDHA 2BABA 1NHRA 2H88A 1FEBA 4H50A 1K0LA 2VZ2A 2YM1A 1JEHA 2BK5A 5FS8A 4Z2UA 2E5VA 2FJDA 4JNAA 4IVOB 3L1RA 4YT0A 1VQWA 2JB3A 3REDA 3IF9A 3GD4A 3SQPA 1DJNA 4LA1A 2IVEA 3DGZA 5JCIA 1O5WA 4P9SA 4CCQA 2NPXA 1MO9A 1D4EA 2JKCA 1PBEA 3UP4A 1GNDA 3SGLA 5BUKA 3ATRA 3DJDA 1Y56B 1LV0A 2OAMA 3M0OA 3ALJA 2BS4A 4OPTA 2YR4A 2GQFA 3P9UA 3G5QA 3ABVA 1H7XA 2EQ6A 4REKA 3UOVA 1K4QA 2CDUA 3AE4A 1NG3A 1GRAA 2Y6QA 1S2YA 2FJAA 2WOVA 3FBSA 3ISHA 3CNDA 4U2LA 4OPCA 5KWFA 3CNPA 2JBVA 4Y4MA 5EB4A 4H4UA 2GMJA 1CJ3A 4H4VA 3IWAA 4EMIA 1GPEA 1H86A 4A79A 4B63A 2GR3A 1CF3A 4JY3A 5JCKA 2Q0LA 4YKFA 3KPFA 4ZCCA 1CHUA 5C2TA 3ICRA 1CBOA 2BYBA 1FL2A 1PBFA 3QJ4A 5M10A 4Z44A 4C3YA 1JU2A 5HXIA 1SEZA 3RP8A 3UCLA 4K5RA 1TDNA 3IHMA 4LU6A 1D4CA 3BNUA 2VQ7A 2B9XA 1DOCA 4BURA 1ZKQA 1NG4A 3BI4A 3BI5A 2XVFA 4TM3A 2XLSA 3V3OA 2WP5A 2PHHA 2IVDA 1GTHA 3VR8A 3NN0X 3NYFA 1EL5A 1PJ7A 2I0ZA 5JCNA 5IQ4A 1LPFA 3FMWA 3KA7A 1RP0A 3ATQA 1GV4A 2XVEA 4U2SA 4ZCDA 1CC6A 3M12A 3DJGX 4OPLA 3AE5A 3BHFA 4U8JA 3K7TA 1NHPA 1ZX9A 1O94A 1VG0A 4FX9A 4K5SA 3UKAA 1CJCA 1S3BA 1EL7A 1OJCA 3K7MX 1OJ9A 4J31A 4O5UA 4Y4LA 3NGCX 3PVCA 4BK3A 4DSHA 5BULA 3NHOX 1OJDA 2X3NA 3AYLA 3NNEA 3CGBA 2GAGB 5C3JA 1N1PA 1H81A 3KU9A 3AE9A 3FG2P 2GQWA 4YWOA 5HHFA 4EIPA 4DGKA 1M6IA 3IHGA 1GERA 2YLXA 1PBCA 3AE6A 4KX6A 3CNTA 1E39A 4YSYA 1KSSA 4A7AA 4D04A 3P4PA 1N4UA 3P4QA
chains in the Genus database with same CATH superfamily
1TKKA 1PDZA 3DFHA 3EKGA 1MDLA 3I4KA 3URHA 3GYJA 4Z2TA 1E9IA 3NTAA 4YTPA 3LJPA 1JNZA 1DXLA 4UDQA 3AEDA 5J04A 4H4SA 2GB0A 2VOUA 4U2TA 4YWSA 1GRBA 2XSXA 3AYJA 1CJ4A 2WESA 3C4NA 3WE0A 1BWCA 4E0VA 2YAUA 2R0CA 4H4YA 1FFVC 3CT2A 1RVKA 3TWAA 1H82A 2J3NA 3SSZA 1BZLA 3RHAA 2EQ9A 3K1GA 2YLSA 3MWCA 4EM3A 2BC1A 4HNCA 2X99A 3UJ2A 1JRXA 3S61A 4EQWA 3FVDA 3R1ZA 2OZ8A 1N4VA 1F3PA 2AKMA 2VRMA 4NTDA 2ZZ0A 2PU0A 2WPFA 3THUA 4H2QA 1SJBA 3DJJA 2R4EA 2PYXA 1KSUA 1PXCA 2WPEA 5HYMA 1E1KA 4CBQA 2XLUA 2QA1A 5JCLA 4KWSA 3DG7A 3RCYA 2B7RA 1E1LA 2P88A 3RO6A 3KKJA 3DEQA 2QGYA 1B4VA 1KNRA 3R07C 2H89A 2XVIA 2JB1A 3I3LA 2WBAA 3H7VA 3CNSA 1JRZA 3CYJA 3EPTA 3LXDA 1SB3B 1P43A 3AD8B 5KMSA 3VQRA 4AOSA 3DDMA 3RGTA 4GAVA 2WS3A 2OA1A 3AMZA 2Q6UA 2YLRA 5KMQA 4X9NA 4OVIA 2OQHA 3T6CA 1P48A 3KD9A 4II3A 5BVAA 1BKWA 4OPGA 3STPA 1BF3A 4BJZA 3R9UA 2A89A 3AEBA 4A9WA 1ZOYA 4OCGA 3ETRB 1MXTA 1JOAA 4NEVA 4FDCB 4NZHA 1HYUA 3GWDA 2JK6A 4Z17A 2BA9A 3ZLGA 1YEYA 2JB2A 3VC6A 3UKQA 1IJHA 3HZLA 2BCPA 1CC4A 2YWLA 2BRAA 1GRHA 4YTNA 2R4JA 4F4RA 3T2KA 4DSGA 1YY5A 3G5RA 4G73A 4II2A 2C7GA 1UKVG 4A65A 2APGA 2W55A 3NT6A 1JPMA 1EC9A 3RR1A 3QVPA 2YVFA 4J3ZA 3ZYXA 1KD0A 2XLRA 5FJPA 3NLCA 2OLAA 2XFNA 1MRAA 2GGHA 3AEEA 4TM0A 1GRFA 3AM9A 3D9XA 5U1OA 5LV9A 3AEGA 3FPZA 4GUVA 2QQ6A 3CPIG 3UJSA 1H83A 3NZGA 4HCDA 3U4FA 1ONFA 4H4RA 1KF6A 3CN8A 4GDPA 1FOHA 2OLOA 4AT2A 3HYWA 1XS2A 2XH7A 5FS9A 3NS1B 3UTFA 4KEMA 2PCEA 1QLBA 3P1WA 1RSGA 1FIQB 2AL2A 4I59A 2QA2A 2VVMA 4JDRA 1ZMCA 3B9JB 4JN9A 5KNLA 1W4XA 4ICYA 3MKCA 3A7RA 4RSLA 3UP5A 1EBDA 1NDAA 2Q0KA 4JN7A 4H4ZA 2WU5A 1N60C 3VCNA 1PHHA 4AOXA 4HB9A 2VZ2A 4IVOB 3L1RA 1VQWA 2JB3A 3REDA 3GO2A 4CCQA 5BUKA 1Y56B 1LV0A 3M0OA 4OPTA 4ZOHB 3FCPA 4NNJA 2GSHA 2CDUA 3D46A 4U2LA 3ISHA 3CNDA 2JBVA 3NVYB 5C2TA 1H2IA 1CBOA 4C3YA 1JU2A 3RP8A 1NELA 1ECQA 2HXTA 4LU6A 4IT1A 2PA6A 4IL0A 3BI4A 3DERA 2IVDA 3P93A 3AN1A 1BQGA 5JCNA 5IQ4A 1LPFA 3SN4A 3FMWA 1RP0A 4H19A 1CC6A 1STZA 4OPLA 4U8JA 3K7TA 1NHPA 3UKAA 1S3BA 1EL7A 4J31A 3CGBA 5G5GB 3KU9A 2YLXA 1KSSA 1FO4A 1YQ3A 3SN0A 1E7PA 3GSIA 1GRGA 4AT0A 2BC0A 2V3BA 3A7UA 2BK4A 2BACA 1JROA 1B37A 1JRYA 1OEPA 3CXOA 2YR5A 4J34A 2ONEA 2CFYA 2I5QA 4C3XA 4U8NA 2OVLA 4B66A 2XCGA 4TLXA 1XHCA 4IZGA 4E5TA 3HPFA 3RNMA 2XFPA 2QDDA 3SM8A 5IDZA 1BGNA 1XPQA 3I6TA 3PWGA 2VQBA 3AB1A 2GL5A 3UXLA 3ENLA 4E8GA 3AYIA 2F5ZA 3T14A 4IA6A 1H84A 2P8CA 3ITJA 1DNCA 1KNPA 2Q7VA 3V3WA 3R25A 3AWIA 5JCMA 4DX3A 1KDGA 3GMBA 4DWDA 4NEWA 2C73A 1V97A 3AEFA 4UP3A 1L9CA 4IHCA 1MDRA 4USQA 1S3EA 1VRQB 1REOA 1F8SA 2R46A 2P3ZA 3CNJA 3SJNA 1CJ2A 1E1MA 3ALLA 3T9PA 5KRQA 4K2XA 2VRLA 4X9MA 4H83A 2QDEA 1GTEA 4KT2A 5IQ1A 4U8OA 4U8MA 3JSKA 1GT8A 2PP0A 4A3RA 4A5LA 4YSXA 4E4FA 1VG9A 1MOKA 2FKPA 2Z5XA 1LJ1A 1BGJA 2RGHA 1JPDX 4MJWA 3UKPA 3K7QX 1IUWA 5KOXA 1E6EA 5FJTA 2C67A 1AOGA 3I6DA 3BHKA 4HNLA 1ZY8A 2C3CA 1N62C 2E3TA 1ZK7A 3UOYA 3JW7A 3TW9A 3NYCA 2DW6A 3UKLA 4EQSA 1R0MA 5HY5A 3Q6JA 3D8XA 2A8XA 4BV6A 2YG5A 5EB5A 4H4PA 3S5SA 3UOXA 2XLTA 3V76A 3AE2A 2XH0A 3LADA 2OALA 2DKIA 3NFUA 2ZC8A 3IJIA 3ES8A 4NTEA 3KPKA 3ALMA 2CHRA 5U63A 4WX1A 2PTWA 3BOXA 4H4QA 2B76A 3IK4A 4U8IA 3EEZA 2OFJA 2XDOA 3O0HA 2GR0A 3H8LA 2PTZA 3CTYA 3SFDA 1NENA 3UTEA 1ZP0A 3RRAA 3T37A 2GGIA 3V5CA 1Y0PA 3OZ2A 1JDFA 4GR1A 3OW1A 3MQTA 4H2RA 3NRZB 3CGDA 1JCTA 4RG4A 1PBDA 2W0HA 4TM4A 4CNJA 3DK8A 1GEUA 1XANA 1TE6A 4H4TA 3B3RA 7ENLA 4N9XA 3NXLA 4ADWA 2WPCA 3DIPA 2C75A 1EBHA 1DJQA 2ZZCA 1TDEA 1L0VA 2BCGG 5GRTA 1PS9A 3EUB3 4H2PA 5L46A 2YM2A 2C3DA 4H2NA 1FHVA 1B8SA 4H1ZA 3PS9A 2YLZA 5JRBA 1IUTA 4M52A 4Z2RA 2XH4A 4KPRA 3NH3X 2RDXA 3EAOA 2GVCA 4U8LA 2OZTA 3SFEA 4YTMA 2WQYA 5CQFA 4B67A 2OQYA 3TJ4A 3C96A 1IYXA 3EF6A 3IJLA 4HYRA 1ZOVA 2PPGA 3A7AA 1IUVA 1COYA 1NPXA 3AD9B 1XDIA 2OG9A 2HZGA 4NTCA 3DGBA 1F8RA 3FJ4A 2GDQA 1GESA 1PDHA 2YM1A 4H50A 4G7FA 4Z2UA 5FS8A 4DYEA 3PFRA 4YT0A 3SQPA 4LA1A 1SJAA 5JCIA 4FP1A 1MO9A 2OO6A 2JKCA 3SGLA 3DJDA 2OAMA 4G6HA 4IL2A 3D47A 1KKRA 2EQ6A 4REKA 4HCHA 2Y6QA 3CNPA 4H4UA 3IWAA 4ZCCA 4GISA 3V4BA 1FL2A 1PBFA 3QJ4A 4Z44A 5HXIA 4G8TA 3UCLA 1MUCA 3IHMA 4HN8A 1NG4A 2XVFA 4TM3A 3TTEA 2PHHA 3VR8A 3DFYA 2AL2B 2I0ZA 2W54A 1SJDA 3KA7A 1GV4A 2XVEA 3M12A 3UJRA 3BHFA 4FX9A 4K5SA 1CJCA 3U9IA 5FJUA 3NHOX 3AYLA 4GMEA 5C3JA 4ROPA 3FG2P 4YWOA 1PBCA 3AE6A 2QVHA 4A7AA 3NIXA 4ZA0A 4CNKA 1IUXA 4UDRA 1TZZA 1TYPA 3NK1X 1PBBA 2YLTA 3DJEA 4JHMA 4M6UA 3SZFA 3AE8A 2GAHB 3SBFA 4PAAA 4YSZA 3GDNA 2GF3A 4B68A 3GYXA 3UGVA 2QJNA 4DNAA 1PJ6A 4IP4A 1EL9A 3AE7A 4USRA 3AXBA 5J60A 3ZVHA 4ENLA 3QVRA 4J56A 2V6OA 3KUMA 4EMWA 3TQPA 2OKTA 4XWZA 4Z26A 3SZ0A 3TWBA 3MSYA 5DBJA 5EBKA 5TR3A 3NVVB 3SN1A 2Z5YA 2OLNA 2A87A 3QFAA 4CY8A 2C66A 4HA6A 3OZYA 1FHUA 1PXBA 2AKZA 3Q9TA 3SZWA 4BK2A 2YVGA 3N6HA 4GCMA 2TMDA 2CULA 1WYGA 4APNA 1TRBA 3KLJA 3M13A 4CCRA 2RGJA 2XFOA 3NG7X 3VRBA 1GXFA 3VC5A 3R11A 2XLPA 3GMCA 4Z24A 3S5WA 4WCTA 3KVEA 3NYEA 3LZXA 4H7UA 4TVYA 5ENLA 2ZBWA 2ACZA 1TDOA 1FECA 4TVWA 4TM1A 3T4WA 3HYXA 3UTHA 3QKEA 4J2WA 5KXJA 3GC2A 2AAQA 3N4FA 2O56A 2R0GA 4Z25A 4A99A 1JNRA 3QPEA 2W3RA 3AD7B 3DESA 1S7MA 2WOWA 2QJJA 3ZLFA 2X8CA 4TLZA 3F8DA 2PS2A 2RABA 2PGEA 4X2PA 3T2YA 3BI2A 4MKSA 2WDQA 1Q1WA 3QN3A 2HQMA 5GSNA 3PO7A 2ZZBA 1TYTA 1BKHA 4C5OA 2GR2A 1ZXIC 1ELIA 3QSSA 3QSMA 2XVHA 5EOWA 3D1CA 1WUEA 2WHDA 1Z6LA 1GALA 1TDKA 4OPUA 2NVKX 3OC4A 2O9ZA 2OPJA 4ZCWA 2GGEA 1H7WA 3SR6B 4D03A 2ARDA 4CRTA 1ONEA 3P4SA 1LTXR 1PN0A 2EQ8A 2P8BA 1DODA 3HYVA 3V3NA 1VDCA 4YSHA 3TCSA 5KOWA 1B5QA 2FBWA 2YVJA 4GFIA 4C77A 2C64A 1K0IA 1KFYA 1GETA 4JN8A 4K8GA 3ES7A 4HPNA 4OPIA 2DKHA 4MGGA 2PP1A 4EWJA 1GOSA 1NHSA 4A6GA 1QO8A 3NVWB 2RGOA 2XFUA 2BS3A 1S2QA 4K2SA 1N5WC 2QJMA 3SX6A 3T8QA 3GYIA 3H8AA 4AP3A 1NEKA 3UKKA 3ICTA 3BSMA 2WOIA 3FIMB 1GRTA 1KCZA 3E1TA 1CL0A 3CXBA 4J1OA 1R6WA 3MY9A 4B64A 3L8KA 4YKGA 1Q1RA 3CK5A 4B69A 3IJQA 1F9CA 2R0PA 1RYIA 3OTRA 4GDEA 2FJEA 4ECHA 3UCCA 3CGCA 3I6EA 4MMWA 1DOBA 1O95A 1YQZA 2PGWA 1D5TA 2QAEA 3PK7A 4DN1A 5FMHA 4Z43A 1FFUC 3GRTA 4JNQA 1K0JA 3R10A 3LOVA 4O5QA 3QTPA 2WDRA 2W3SA 4GYPA 3SY4A 3FXGA 1EC8A 5KMPA 3IC9A 1H6VA 1LQUA 2C70A 2Y6RA 2HNEA 4K7ZA 1V59A 2PTXA 3RP7A 5IPYA 2TPRA 3FV9A 3VA8A 4H4XA 2JAEA 1FCDA 4GYPC 3UXKA 3VRDB 1MNSA 2V5ZA 3ICSA 3LZWA 1VQZA 2XVJA 4U8PA 3VRAA 2VVLA 2UZZA 2BK3A 1M64A 4E6MA 3T31A 1D4DA 1NHRA 1DTNA 1FEBA 1K0LA 2H88A 1W6TA 1JEHA 2BK5A 2E5VA 3B97A 2C4CA 3IF9A 3GD4A 2PMQA 1PBEA 2MNRA 1GNDA 3UP4A 3ATRA 2OX4A 3ALJA 2BS4A 2NQLA 3UCDA 1K4QA 3AE4A 3CMMA 1NG3A 1GRAA 1S2YA 2E5AA 5KWFA 5EU9A 4OPCA 4Y4MA 5EB4A 2GMJA 4H4VA 1GPEA 4B63A 4NWZA 1CF3A 2Q0LA 2BYBA 5M10A 2ZADA 4FI4A 3ZLHA 4E4UA 1SEZA 4K5RA 2VQ7A 1DOCA 3UJFA 2XLSA 3V3OA 2WP5A 1GTHA 3NN0X 3NYFA 1EL5A 1PJ7A 1RM6B 1WUFA 4KPLA 3AE5A 1ZX9A 1VG0A 3GY1A 1OJCA 5BULA 1OJ9A 4O5UA 4BK3A 2X3NA 1N1PA 4EIPA 4G74A 1M6IA 1GERA 4KX6A 3CNTA 1E39A 4YSYA 4D04A 3NRNA 3H8IA 2OZ3A 3V5FA 2GH5A 3II4A 2WEUA 1YQ4A 1JRPA 2GEWA 4PABA 3DK4A 4JQ9A 3GDPA 5KMRA 2V61A 3UJEA 3P4RA 2HXUA 4BK1A 1GREA 1GSNA 2CVJA 5J7XA 4GF7A 1PJ5A 2MUCA 3AE3A 3DMEA 2WDVA 4RG3A 1Q9IA 3SQSA 1N4WA 3CAWA 4FK1A 2GR1A 2PTYA 5FJOA 3Q45A 5FS6A 5G5HB 3VR9A 4GAPA 3R0UA 3CGEA 2GGGA 1F8WA 1P2HA 1D7YA 2QCUA 3GWFA 3CB3A 1L9DA 1KKOA 4FK1C 5CKUA 3PWIA 4B1BA 2V60A 4DHGA 4XXGA 1NAAA 3DH9A 3EANA 4YXDA 4Y4NA 3DGHA 3G5SA 2X8HA 1TDFA 5U25A 1X2HA 2AR8A 3UTGA 5BOEA 3HRDC 4H2HA 3S47A 1OJTA 1P2EA 2E1MA 1NU5A 4G9KA 3OP2A 4IVMB 3ZDNA 2EQ7A 3AE1A 1ELSA 1L9EA 3ZVIA 2C72A 4GGBA 4G6GA 4C74A 4J36A 2WETA 2R9ZA 2VVLG 2YG3A 3MUCA 1CC2A 2B9YA 4A6NB 2X50A 4J57A 3ZVHB 1EL8A 4EIQA 1X2GA 3UOZA 4EQRA 2WU2A 1LVLA 3DG6A 2IIDA 3F8PA 4IA5A 4EMJA 3FYYA 4GIRA 2B9WA 3P3BA 3C4AA 4AP1A 1OJAA 2XYOA 3N6JA 2BXSA 1EBGA 2GV8A 2BS2A 4H4WA 1NHQA 3PG6A 4K22A 3JZUA 3TJIA 4J33A 3NN6X 4A6NA 1D7LA 4K1WA 2FJBA 3BNMA 1LQTA 2YLWA 2XFQA 5KVHA 3RITA 4U8KA 4BJYA 3QFBA 3DK9A 2AL1A 4Z1YA 2YR6A 1X31B 1N63C 1DOEA 2YG6A 3NK0X 1IUSA 3VFCA 3ADAB 3T0KA 1ZMDA 5ER0A 1E1NA 2WP6A 4UDPA 3LB8A 3BJSA 3JVAA 3N4EA 3UKHA 3COXA 2V3AA 5KVIA 5M0ZA 2YQUA 2GMHA 3P0WA 2GRTA 4DXKA 4EQXA 1N5XA 3CPHG 4M0XA 5FS7A 4LIIA 3RP6A 4B65A 4X4JA 2WP9A 3QSEA 4GRTA 2PSNA 4GGHA 4CY6A 2FYMA 1N61C 4OPDA 1Y56A 1KN0A 3DA1A 3NTDA 2E4GA 3HW2A 1PXAA 2X8GA 2R45A 2BXRA 2BRYA 3Q4DA 3CIRA 2GGJA 3AEAA 3AECA 4EM4A 2B7SA 3R0KA 3L5OA 3B6DA 4IV9A 1F6MA 3NK2X 3F8RA 3CPJG 3H12A 1FEAA 1EC7A 4ZN0A 3GD3A 3VCCA 5BOFA 3NKSA 1SJCA 3H70A 3SZCA 3SYIA 3H4KA 1QJDA 2AQJA 1L8PA 1VDVA 2YG4A 2C65A 1YKJA 3K30A 6ENLA 3UKFA 5BRTA 3NO1A 3GRSA 4K8DA 4XWRA 4I58A 2YG7A 1ZDLA 4JY2A 2C76A 2XGZA 1IUUA 2BABA 2FJDA 4JNAA 1DJNA 2DW7A 2IVEA 3DGZA 1O5WA 4P9SA 2NPXA 4HCLA 1D4EA 3OZMA 4IP5A 2YR4A 2GQFA 3P9UA 3GD6A 3G5QA 3ABVA 3TOYA 1T3QC 1H7XA 3UOVA 2FJAA 2WOVA 3FBSA 1CJ3A 4A35A 4EMIA 4A79A 1H86A 2XH2A 2GR3A 2PP3A 4JY3A 5JCKA 4YKFA 3KPFA 1CHUA 3ICRA 1XPYA 2PODA 3T2ZA 3SXIA 1TDNA 1D4CA 3BNUA 3VDGA 2B9XA 4BURA 1ZKQA 2P0IA 3BI5A 1PDYA 2PU1A 5FJRA 3NVZB 3OPSA 3ATQA 4U2SA 4ZCDA 3DJGX 2POZA 1O94A 3K7MX 4Y4LA 3NGCX 3PVCA 4DSHA 1OJDA 3NNEA 3QLDA 2GAGB 3DG3A 1H81A 3AE9A 2GQWA 5HHFA 4DGKA 3IHGA 3MZNA 3P4PA 1N4UA 3P4QA
chains in the Genus database with same CATH topology
4CNKA 1IUXA 3NRNA 1YQ3A 3H8IA 4UDRA 1E7PA 2GH5A 3II4A 1TYPA 2WEUA 3GSIA 3NK1X 1GRGA 4AT0A 3URHA 1YQ4A 1PBBA 3GYJA 2GEWA 4Z2TA 4PABA 3DK4A 4JQ9A 2BC0A 2YLTA 3DJEA 3LJPA 2V3BA 2BK4A 3NTAA 3GDPA 5KMRA 2BACA 2V61A 1JNZA 3SZFA 3P4RA 1DXLA 3AE8A 1B37A 1JRYA 4UDQA 4BK1A 2GAHB 1GREA 3AEDA 4PAAA 2YR5A 1GSNA 2CVJA 4J34A 4H4SA 3GDNA 4YSZA 2GB0A 5J7XA 2VOUA 1PJ5A 2CFYA 2GF3A 4GF7A 1GRBA 4U2TA 4C3XA 3AE3A 4U8NA 3DMEA 4B68A 3GYXA 3AYJA 2WDVA 4DNAA 4B66A 1PJ6A 2XCGA 4TLXA 4RG3A 1XHCA 1Q9IA 1CJ4A 2WESA 3C4NA 3RNMA 1EL9A 2XFPA 1N4WA 3AE7A 3WE0A 4USRA 1BWCA 3AXBA 4E0VA 4FK1A 2GR1A 5J60A 3SM8A 3QVRA 2YAUA 4J56A 2R0CA 5FS6A 1BGNA 3VR9A 1XPQA 4GAPA 2V6OA 4H4YA 4EMWA 3CGEA 2VQBA 3AB1A 4XWZA 1F8WA 1H82A 2J3NA 1P2HA 4Z26A 1D7YA 3SZ0A 2QCUA 1BZLA 3GWFA 3RHAA 2EQ9A 2YLSA 3AYIA 1L9DA 5EBKA 5DBJA 2F5ZA 4FK1C 5CKUA 4EM3A 4IA6A 3T14A 5TR3A 4B1BA 1H84A 3ITJA 2BC1A 1DNCA 1KNPA 2Q7VA 2Z5YA 2OLNA 2X99A 2A87A 3QFAA 4CY8A 1JRXA 3S61A 3AWIA 2C66A 4EQWA 5JCMA 4HA6A 1KDGA 3GMBA 4NEWA 1PXBA 2C73A 2V60A 3Q9TA 4XXGA 1N4VA 3SZWA 4BK2A 2YVGA 3UOXA 3AEFA 4UP3A 1F3PA 1L9CA 1NAAA 4GCMA 3DH9A 3EANA 2TMDA 2VRMA 4NTDA 4YXDA 2CULA 2ZZ0A 4Y4NA 3DGHA 3G5SA 4USQA 4APNA 2WPFA 2X8HA 5U25A 1S3EA 1TDFA 1TRBA 1VRQB 1REOA 3KLJA 1F8SA 2AR8A 3UTGA 2R46A 3M13A 3CNJA 1CJ2A 4CCRA 2RGJA 4H2QA 3DJJA 2R4EA 2XFOA 1E1MA 2PYXA 3ALLA 1KSUA 5KRQA 1OJTA 1P2EA 1PXCA 2E1MA 3NG7X 4K2XA 3VRBA 1GXFA 2WPEA 2VRLA 4G9KA 5HYMA 1E1KA 2XLPA 4IVMB 3GMCA 4Z24A 3S5WA 3ZDNA 4X9MA 4CBQA 2XLUA 2EQ7A 4WCTA 3KVEA 2QA1A 3AE1A 3LZXA 3NYEA 4H7UA 1L9EA 5JCLA 2ZBWA 2ACZA 1TDOA 1GTEA 1FECA 2C72A 4TM1A 5IQ1A 3HYXA 4G6GA 4U8OA 2B7RA 4U8MA 3UTHA 4C74A 3JSKA 1GT8A 4J2WA 1E1LA 4J36A 2WETA 2R9ZA 5KXJA 2VVLG 4A5LA 2YG3A 2AAQA 1CC2A 3KKJA 4YSXA 2R0GA 4Z25A 4A99A 2H89A 1B4VA 1JNRA 1KNRA 1VG9A 1MOKA 2XVIA 2JB1A 3I3LA 2Z5XA 1LJ1A 2WBAA 3AD7B 1BGJA 2B9YA 4A6NB 1S7MA 3CNSA 2RGHA 1JRZA 2X50A 4J57A 2WOWA 4MJWA 3EPTA 3UKPA 1EL8A 3K7QX 3LXDA 4EIQA 5KMSA 3AD8B 3VQRA 3UOZA 2X8CA 4EQRA 1IUWA 4TLZA 1E6EA 4AOSA 5KOXA 3F8DA 2WU2A 1LVLA 2C67A 2IIDA 3F8PA 4IA5A 1AOGA 3I6DA 3BHKA 4GAVA 2WS3A 2OA1A 1ZY8A 4EMJA 2C3CA 2RABA 2B9WA 2Q6UA 2YLRA 1ZK7A 5KMQA 3BI2A 3C4AA 3T2YA 3UOYA 4AP1A 2WDQA 4X9NA 1Q1WA 3NYCA 4OVIA 1OJAA 2XYOA 2HQMA 5GSNA 3PO7A 3UKLA 2ZZBA 2BXSA 1TYTA 4EQSA 2GV8A 2BS2A 4C5OA 4H4WA 1NHQA 3Q6JA 3D8XA 3KD9A 3PG6A 2GR2A 4K22A 5HY5A 1ELIA 3QSSA 4II3A 3QSMA 4J33A 2A8XA 4BV6A 2YG5A 3NN6X 5BVAA 1BKWA 2XVHA 4A6NA 4OPGA 1D7LA 5EOWA 3D1CA 2FJBA 1BF3A 4BJZA 5EB5A 4H4PA 3BNMA 2WHDA 1Z6LA 1GALA 1TDKA 4OPUA 2NVKX 3R9UA 3OC4A 1LQTA 2A89A 2O9ZA 2XLTA 2YLWA 3AEBA 2XFQA 3AE2A 3V76A 4A9WA 1H7WA 1ZOYA 4OCGA 3LADA 2OALA 1MXTA 5KVHA 2DKIA 4D03A 1JOAA 4NEVA 2ARDA 4FDCB 4NZHA 4U8KA 3P4SA 4BJYA 4CRTA 1LTXR 3QFBA 3DK9A 1HYUA 1PN0A 2EQ8A 2YR6A 4NTEA 3NIXA 1DODA 1X31B 3GWDA 3KPKA 2JK6A 3HYVA 1DOEA 2BA9A 2YG6A 3ALMA 3V3NA 1VDCA 2JB2A 5U63A 3UKQA 4YSHA 3NK0X 4WX1A 1IUSA 4H4QA 2B76A 1IJHA 3HZLA 5KOWA 2BCPA 1CC4A 1B5QA 2YWLA 2FBWA 3ADAB 4U8IA 2BRAA 2XDOA 2YVJA 3T0KA 1GRHA 4C77A 1ZMDA 2GR0A 3O0HA 5ER0A 1K0IA 1KFYA 2C64A 3H8LA 1E1NA 4YTNA 2WP6A 1GETA 2R4JA 3CTYA 1NENA 3SFDA 4OPIA 1ZP0A 2DKHA 3UTEA 4UDPA 3LB8A 1GOSA 3T37A 3T2KA 1NHSA 4DSGA 1QO8A 1YY5A 2RGOA 2XFUA 3G5RA 1Y0PA 4G73A 4YTPA 4II2A 2BS3A 1S2QA 3OZ2A 2C7GA 3UKHA 1UKVG 3COXA 2V3AA 3SX6A 4GR1A 5KVIA 2APGA 4A65A 3GYIA 5M0ZA 3NT6A 4H2RA 4AP3A 3CGDA 1NEKA 4RG4A 3UKKA 1PBDA 2YQUA 3ICTA 2W0HA 2GMHA 4TM4A 4CNJA 2WOIA 3FIMB 2GRTA 3QVPA 3DK8A 1GRTA 2YVFA 1GEUA 1XANA 4H4TA 3E1TA 4EQXA 1CL0A 3CPHG 3ZYXA 3B3RA 5FS7A 2XLRA 4B64A 3NLCA 3L8KA 4LIIA 3RP6A 4YKGA 4B65A 1Q1RA 4B69A 4X4JA 2XFNA 4N9XA 2WP9A 3QSEA 4GRTA 2R0PA 1RYIA 3AEEA 4TM0A 4ADWA 1GRFA 4GDEA 2WPCA 2C75A 4CY6A 2FJEA 3D9XA 4OPDA 1Y56A 4ECHA 1DJQA 3CGCA 5U1OA 1KN0A 2ZZCA 5LV9A 1DOBA 3DA1A 3AEGA 3FPZA 1O95A 4GUVA 1YQZA 3NTDA 1D5TA 2QAEA 2E4GA 1TDEA 1PXAA 1L0VA 2X8GA 2R45A 2BCGG 5FMHA 5GRTA 1PS9A 3CPIG 4Z43A 1H83A 2BXRA 4H2PA 3GRTA 1ONFA 4JNQA 1K0JA 2BRYA 5L46A 3LOVA 4O5QA 2YM2A 2C3DA 4H4RA 1KF6A 3CIRA 3CN8A 2WDRA 3AEAA 3AECA 4GDPA 4EM4A 4H2NA 2B7SA 3L5OA 1FOHA 2OLOA 3B6DA 4AT2A 1B8SA 3HYWA 1F6MA 3NK2X 4IV9A 3PS9A 2YLZA 3F8RA 3SY4A 5JRBA 1IUTA 4M52A 4Z2RA 3CPJG 5FS9A 1FEAA 4KPRA 3UTFA 3NH3X 5KMPA 1QLBA 3IC9A 1H6VA 1LQUA 2C70A 2Y6RA 3P1WA 4ZN0A 3EAOA 1RSGA 2GVCA 4U8LA 4K7ZA 1V59A 3GD3A 3RP7A 3SFEA 3NKSA 4YTMA 3SZCA 5IPYA 2WQYA 2TPRA 4H4XA 3SYIA 4I59A 3H4KA 3C96A 2JAEA 2QA2A 1FCDA 5CQFA 4B67A 3EF6A 2VVMA 1QJDA 2AQJA 3VRDB 4JDRA 2V5ZA 3ICSA 1ZMCA 1ZOVA 2YG4A 3LZWA 1IUVA 2C65A 4JN9A 1COYA 1NPXA 1YKJA 3AD9B 3K30A 2XVJA 5KNLA 4U8PA 1W4XA 1XDIA 3UKFA 5BRTA 3GRSA 2VVLA 4K8DA 2UZZA 4ICYA 3VRAA 4NTCA 4XWRA 4I58A 4RSLA 2YG7A 3UP5A 1EBDA 1ZDLA 1M64A 2BK3A 1NDAA 4JY2A 2Q0KA 1F8RA 4H4ZA 2C76A 1IUUA 2WU5A 1GESA 1PHHA 3T31A 1D4DA 4AOXA 4HB9A 1PDHA 2BABA 1NHRA 2H88A 1FEBA 4H50A 1K0LA 2VZ2A 2YM1A 1JEHA 2BK5A 5FS8A 4Z2UA 2E5VA 2FJDA 4JNAA 4IVOB 3L1RA 4YT0A 1VQWA 2JB3A 2C4CA 3REDA 3IF9A 3GD4A 3SQPA 1DJNA 4LA1A 2IVEA 3DGZA 5JCIA 1O5WA 4P9SA 4CCQA 2NPXA 1MO9A 1D4EA 2JKCA 1PBEA 3UP4A 1GNDA 3SGLA 5BUKA 3ATRA 3DJDA 1Y56B 1LV0A 2OAMA 3M0OA 4G6HA 3ALJA 2BS4A 4OPTA 2YR4A 2GQFA 3P9UA 3G5QA 3ABVA 1H7XA 2EQ6A 4REKA 4NNJA 3UOVA 1K4QA 2CDUA 3AE4A 1NG3A 3CMMA 1GRAA 2Y6QA 1S2YA 2FJAA 2WOVA 3FBSA 3ISHA 3CNDA 4U2LA 4OPCA 5KWFA 3CNPA 2JBVA 4Y4MA 5EB4A 4H4UA 2GMJA 1CJ3A 4H4VA 3IWAA 4EMIA 1GPEA 1H86A 4A79A 4B63A 4NWZA 2GR3A 1CF3A 4JY3A 5JCKA 2Q0LA 4YKFA 3KPFA 1H2IA 1CHUA 4ZCCA 5C2TA 3ICRA 1CBOA 2BYBA 1FL2A 1PBFA 3QJ4A 5M10A 4Z44A 3T2ZA 4C3YA 1JU2A 5HXIA 1SEZA 3SXIA 3RP8A 3UCLA 4K5RA 1TDNA 3IHMA 4LU6A 1D4CA 3BNUA 2VQ7A 2B9XA 1DOCA 4BURA 1ZKQA 1NG4A 3BI4A 3BI5A 2XVFA 4TM3A 2XLSA 3V3OA 2WP5A 2PHHA 2IVDA 1GTHA 3VR8A 3NN0X 3NYFA 1EL5A 1PJ7A 2I0ZA 5JCNA 5IQ4A 1LPFA 3FMWA 3KA7A 1RP0A 3ATQA 1GV4A 2XVEA 4U2SA 4ZCDA 1CC6A 3M12A 3DJGX 4OPLA 3AE5A 3BHFA 4U8JA 3K7TA 1NHPA 1ZX9A 1O94A 1VG0A 4FX9A 4K5SA 3UKAA 1CJCA 1S3BA 1EL7A 1OJCA 3K7MX 1OJ9A 4J31A 4O5UA 4Y4LA 3NGCX 3PVCA 4BK3A 4DSHA 5BULA 3NHOX 1OJDA 2X3NA 3AYLA 3NNEA 3CGBA 2GAGB 5C3JA 1N1PA 1H81A 3KU9A 3AE9A 3FG2P 2GQWA 4YWOA 5HHFA 4EIPA 4G74A 1M6IA 3IHGA 4DGKA 1GERA 2YLXA 1PBCA 3AE6A 4KX6A 3CNTA 1E39A 4YSYA 1KSSA 4A7AA 4D04A 3P4PA 1N4UA 3P4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CNK A;  1IUX A;  3NRN A;  1YQ3 A;  3H8I A;  4UDR A;  1E7P A;  2GH5 A;  3II4 A;  1TYP A;  2WEU A;  3GSI A;  3NK1 X;  1GRG A;  4AT0 A;  3URH A;  1YQ4 A;  1PBB A;  3GYJ A;  2GEW A;  4Z2T A;  4PAB A;  3DK4 A;  4JQ9 A;  2BC0 A;  2YLT A;  3DJE A;  3LJP A;  2BK4 A;  2V3B A;  3NTA A;  3GDP A;  2BAC A;  2V61 A;  1JNZ A;  3P4R A;  1DXL A;  3AE8 A;  1B37 A;  1JRY A;  4UDQ A;  4BK1 A;  2GAH B;  1GRE A;  3AED A;  4PAA A;  2YR5 A;  1GSN A;  2CVJ A;  4J34 A;  4H4S A;  3GDN A;  4YSZ A;  2GB0 A;  5J7X A;  2VOU A;  1PJ5 A;  2CFY A;  2GF3 A;  4GF7 A;  1GRB A;  4U2T A;  4C3X A;  3AE3 A;  4U8N A;  3DME A;  4B68 A;  3AYJ A;  2WDV A;  4DNA A;  4B66 A;  1PJ6 A;  2XCG A;  4TLX A;  4RG3 A;  1XHC A;  1Q9I A;  1CJ4 A;  2WES A;  3C4N A;  3RNM A;  1EL9 A;  2XFP A;  1N4W A;  3AE7 A;  3WE0 A;  4USR A;  1BWC A;  3AXB A;  4E0V A;  4FK1 A;  2GR1 A;  5J60 A;  3SM8 A;  3QVR A;  2YAU A;  4J56 A;  2R0C A;  5FS6 A;  1BGN A;  3VR9 A;  1XPQ A;  2V6O A;  4H4Y A;  4EMW A;  3CGE A;  2VQB A;  3AB1 A;  4XWZ A;  1F8W A;  1H82 A;  2J3N A;  1P2H A;  4Z26 A;  1D7Y A;  2QCU A;  1BZL A;  3GWF A;  3RHA A;  2EQ9 A;  2YLS A;  3AYI A;  1L9D A;  5EBK A;  5DBJ A;  2F5Z A;  4FK1 C;  5CKU A;  4EM3 A;  4IA6 A;  5TR3 A;  4B1B A;  1H84 A;  3ITJ A;  2BC1 A;  1DNC A;  1KNP A;  2Q7V A;  2Z5Y A;  2OLN A;  2X99 A;  2A87 A;  3QFA A;  4CY8 A;  1JRX A;  3S61 A;  3AWI A;  2C66 A;  4EQW A;  5JCM A;  4HA6 A;  1KDG A;  3GMB A;  4NEW A;  1PXB A;  2C73 A;  2V60 A;  3Q9T A;  4XXG A;  1N4V A;  4BK2 A;  2YVG A;  3UOX A;  3AEF A;  4UP3 A;  1F3P A;  1L9C A;  1NAA A;  4GCM A;  3DH9 A;  3EAN A;  2TMD A;  2VRM A;  4NTD A;  4YXD A;  2CUL A;  2ZZ0 A;  4Y4N A;  3DGH A;  3G5S A;  4USQ A;  4APN A;  2WPF A;  2X8H A;  5U25 A;  1S3E A;  1TDF A;  1TRB A;  1VRQ B;  1REO A;  3KLJ A;  1F8S A;  2AR8 A;  3UTG A;  2R46 A;  3M13 A;  3CNJ A;  1CJ2 A;  4CCR A;  2RGJ A;  4H2Q A;  3DJJ A;  2R4E A;  2XFO A;  1E1M A;  2PYX A;  3ALL A;  1KSU A;  5KRQ A;  1OJT A;  1P2E A;  1PXC A;  2E1M A;  3NG7 X;  4K2X A;  3VRB A;  1GXF A;  2WPE A;  2VRL A;  5HYM A;  1E1K A;  2XLP A;  4IVM B;  3GMC A;  4Z24 A;  3S5W A;  3ZDN A;  4X9M A;  4CBQ A;  2XLU A;  2EQ7 A;  4WCT A;  3KVE A;  2QA1 A;  3AE1 A;  3LZX A;  3NYE A;  4H7U A;  1L9E A;  5JCL A;  2ZBW A;  2ACZ A;  1TDO A;  1GTE A;  1FEC A;  2C72 A;  4TM1 A;  5IQ1 A;  4U8O A;  2B7R A;  4U8M A;  3UTH A;  4C74 A;  3JSK A;  1GT8 A;  4J2W A;  1E1L A;  4J36 A;  2WET A;  2R9Z A;  5KXJ A;  2VVL G;  4A5L A;  2YG3 A;  2AAQ A;  1CC2 A;  3KKJ A;  4YSX A;  2R0G A;  4Z25 A;  4A99 A;  2H89 A;  1B4V A;  1JNR A;  1KNR A;  1VG9 A;  1MOK A;  2XVI A;  2JB1 A;  3I3L A;  2Z5X A;  1LJ1 A;  2WBA A;  3AD7 B;  1BGJ A;  2B9Y A;  4A6N B;  3CNS A;  2RGH A;  1JRZ A;  2X50 A;  4J57 A;  2WOW A;  4MJW A;  3EPT A;  3UKP A;  1EL8 A;  3K7Q X;  3LXD A;  4EIQ A;  3AD8 B;  3VQR A;  3UOZ A;  2X8C A;  4EQR A;  1IUW A;  4TLZ A;  1E6E A;  4AOS A;  5KOX A;  3F8D A;  2WU2 A;  1LVL A;  2C67 A;  2IID A;  3F8P A;  4IA5 A;  1AOG A;  3I6D A;  3BHK A;  2WS3 A;  2OA1 A;  1ZY8 A;  4EMJ A;  2C3C A;  2RAB A;  2B9W A;  2Q6U A;  2YLR A;  1ZK7 A;  3BI2 A;  3C4A A;  3UOY A;  4AP1 A;  2WDQ A;  4X9N A;  1Q1W A;  3NYC A;  4OVI A;  1OJA A;  2XYO A;  2HQM A;  5GSN A;  3PO7 A;  3UKL A;  2ZZB A;  2BXS A;  1TYT A;  4EQS A;  2GV8 A;  2BS2 A;  4C5O A;  4H4W A;  1NHQ A;  3Q6J A;  3D8X A;  3KD9 A;  4K22 A;  2GR2 A;  5HY5 A;  1ELI A;  3QSS A;  3QSM A;  4J33 A;  2A8X A;  4BV6 A;  2YG5 A;  3NN6 X;  5BVA A;  1BKW A;  2XVH A;  4A6N A;  4OPG A;  1D7L A;  5EOW A;  3D1C A;  2FJB A;  1BF3 A;  4BJZ A;  5EB5 A;  4H4P A;  3BNM A;  2WHD A;  1Z6L A;  1GAL A;  1TDK A;  4OPU A;  2NVK X;  3R9U A;  3OC4 A;  1LQT A;  2A89 A;  2O9Z A;  2XLT A;  2YLW A;  3AEB A;  2XFQ A;  3AE2 A;  3V76 A;  4A9W A;  1H7W A;  1ZOY A;  4OCG A;  3LAD A;  2OAL A;  1MXT A;  5KVH A;  2DKI A;  4D03 A;  1JOA A;  4NEV A;  2ARD A;  4FDC B;  4NZH A;  4U8K A;  3P4S A;  4BJY A;  4CRT A;  1LTX R;  3QFB A;  3DK9 A;  1HYU A;  1PN0 A;  2EQ8 A;  2YR6 A;  4NTE A;  3NIX A;  1DOD A;  1X31 B;  3GWD A;  2JK6 A;  1DOE A;  2BA9 A;  2YG6 A;  3ALM A;  3V3N A;  1VDC A;  2JB2 A;  5U63 A;  3UKQ A;  4YSH A;  3NK0 X;  4WX1 A;  1IUS A;  4H4Q A;  2B76 A;  1IJH A;  3HZL A;  5KOW A;  2BCP A;  1CC4 A;  1B5Q A;  2YWL A;  2FBW A;  3ADA B;  4U8I A;  2XDO A;  2YVJ A;  1GRH A;  4C77 A;  1ZMD A;  2GR0 A;  3O0H A;  5ER0 A;  1K0I A;  1KFY A;  2C64 A;  3H8L A;  1E1N A;  4YTN A;  2WP6 A;  1GET A;  2R4J A;  3CTY A;  1NEN A;  3SFD A;  4OPI A;  1ZP0 A;  2DKH A;  3UTE A;  4UDP A;  3LB8 A;  1GOS A;  3T37 A;  1NHS A;  4DSG A;  1QO8 A;  1YY5 A;  2RGO A;  2XFU A;  3G5R A;  1Y0P A;  4YTP A;  3UKH A;  2BS3 A;  1S2Q A;  3OZ2 A;  2C7G A;  1UKV G;  3COX A;  2V3A A;  4GR1 A;  5KVI A;  2APG A;  4A65 A;  3GYI A;  5M0Z A;  3NT6 A;  4H2R A;  4AP3 A;  3CGD A;  1NEK A;  4RG4 A;  3UKK A;  1PBD A;  2YQU A;  3ICT A;  2W0H A;  2GMH A;  4TM4 A;  4CNJ A;  2WOI A;  3FIM B;  2GRT A;  3QVP A;  3DK8 A;  1GRT A;  2YVF A;  1GEU A;  1XAN A;  4H4T A;  3E1T A;  4EQX A;  1CL0 A;  3CPH G;  3ZYX A;  3B3R A;  5FS7 A;  2XLR A;  4B64 A;  3NLC A;  3L8K A;  4LII A;  3RP6 A;  4YKG A;  4B65 A;  1Q1R A;  4B69 A;  4X4J A;  2XFN A;  4N9X A;  2WP9 A;  3QSE A;  4GRT A;  2R0P A;  1RYI A;  3AEE A;  4TM0 A;  4ADW A;  1GRF A;  4GDE A;  2WPC A;  2C75 A;  4CY6 A;  2FJE A;  4OPD A;  1Y56 A;  4ECH A;  1DJQ A;  3CGC A;  5U1O A;  2ZZC A;  5LV9 A;  1DOB A;  3DA1 A;  3AEG A;  3FPZ A;  1O95 A;  4GUV A;  1YQZ A;  3NTD A;  1D5T A;  2QAE A;  2E4G A;  1TDE A;  1PXA A;  1L0V A;  2X8G A;  2R45 A;  2BCG G;  5FMH A;  5GRT A;  1PS9 A;  3CPI G;  4Z43 A;  1H83 A;  2BXR A;  4H2P A;  3GRT A;  1ONF A;  4JNQ A;  1K0J A;  5L46 A;  3LOV A;  4O5Q A;  2YM2 A;  2C3D A;  4H4R A;  1KF6 A;  3CIR A;  3CN8 A;  2WDR A;  3AEA A;  3AEC A;  4GDP A;  4EM4 A;  4H2N A;  2B7S A;  1FOH A;  2OLO A;  3B6D A;  4AT2 A;  1B8S A;  4IV9 A;  1F6M A;  3NK2 X;  3PS9 A;  2YLZ A;  3F8R A;  1IUT A;  4M52 A;  4Z2R A;  3CPJ G;  5FS9 A;  1FEA A;  4KPR A;  3UTF A;  3NH3 X;  1QLB A;  3IC9 A;  1H6V A;  1LQU A;  2C70 A;  2Y6R A;  3P1W A;  4ZN0 A;  3EAO A;  1RSG A;  2GVC A;  4U8L A;  4K7Z A;  1V59 A;  3GD3 A;  3RP7 A;  3SFE A;  3NKS A;  4YTM A;  5IPY A;  2WQY A;  2TPR A;  4H4X A;  4I59 A;  3H4K A;  3C96 A;  2JAE A;  2QA2 A;  1FCD A;  5CQF A;  4B67 A;  3EF6 A;  2VVM A;  1QJD A;  2AQJ A;  3VRD B;  4JDR A;  2V5Z A;  3ICS A;  1ZMC A;  1ZOV A;  2YG4 A;  3LZW A;  1IUV A;  2C65 A;  4JN9 A;  1COY A;  1NPX A;  1YKJ A;  3AD9 B;  3K30 A;  2XVJ A;  4U8P A;  1W4X A;  1XDI A;  3UKF A;  5BRT A;  3GRS A;  2VVL A;  4K8D A;  2UZZ A;  4ICY A;  3VRA A;  4NTC A;  4XWR A;  4I58 A;  4RSL A;  2YG7 A;  3UP5 A;  1EBD A;  1ZDL A;  1M64 A;  2BK3 A;  1NDA A;  4JY2 A;  2Q0K A;  1F8R A;  4H4Z A;  2C76 A;  1IUU A;  2WU5 A;  1GES A;  1PHH A;  1D4D A;  4AOX A;  4HB9 A;  1PDH A;  2BAB A;  1NHR A;  2H88 A;  1FEB A;  4H50 A;  1K0L A;  2VZ2 A;  2YM1 A;  1JEH A;  2BK5 A;  5FS8 A;  4Z2U A;  2E5V A;  2FJD A;  4JNA A;  4IVO B;  3L1R A;  4YT0 A;  1VQW A;  2JB3 A;  3RED A;  3IF9 A;  3GD4 A;  3SQP A;  1DJN A;  4LA1 A;  2IVE A;  3DGZ A;  5JCI A;  1O5W A;  4P9S A;  4CCQ A;  2NPX A;  1MO9 A;  1D4E A;  2JKC A;  1PBE A;  3UP4 A;  1GND A;  3SGL A;  5BUK A;  3ATR A;  3DJD A;  1Y56 B;  1LV0 A;  2OAM A;  3M0O A;  3ALJ A;  2BS4 A;  4OPT A;  2YR4 A;  2GQF A;  3P9U A;  3G5Q A;  3ABV A;  1H7X A;  2EQ6 A;  4REK A;  3UOV A;  1K4Q A;  2CDU A;  3AE4 A;  1NG3 A;  1GRA A;  2Y6Q A;  1S2Y A;  2FJA A;  2WOV A;  3FBS A;  3ISH A;  3CND A;  4U2L A;  4OPC A;  5KWF A;  3CNP A;  2JBV A;  4Y4M A;  5EB4 A;  4H4U A;  2GMJ A;  1CJ3 A;  4H4V A;  3IWA A;  4EMI A;  1GPE A;  1H86 A;  4A79 A;  4B63 A;  2GR3 A;  1CF3 A;  4JY3 A;  5JCK A;  2Q0L A;  4YKF A;  3KPF A;  4ZCC A;  1CHU A;  5C2T A;  3ICR A;  1CBO A;  2BYB A;  1FL2 A;  1PBF A;  3QJ4 A;  5M10 A;  4Z44 A;  4C3Y A;  1JU2 A;  5HXI A;  1SEZ A;  3RP8 A;  3UCL A;  4K5R A;  1TDN A;  3IHM A;  4LU6 A;  1D4C A;  3BNU A;  2VQ7 A;  2B9X A;  1DOC A;  4BUR A;  1ZKQ A;  1NG4 A;  3BI4 A;  3BI5 A;  2XVF A;  4TM3 A;  2XLS A;  3V3O A;  2WP5 A;  2PHH A;  2IVD A;  1GTH A;  3VR8 A;  3NN0 X;  3NYF A;  1EL5 A;  1PJ7 A;  2I0Z A;  5JCN A;  5IQ4 A;  1LPF A;  3FMW A;  3KA7 A;  1RP0 A;  3ATQ A;  1GV4 A;  2XVE A;  4U2S A;  4ZCD A;  1CC6 A;  3M12 A;  3DJG X;  4OPL A;  3AE5 A;  3BHF A;  4U8J A;  3K7T A;  1NHP A;  1ZX9 A;  1O94 A;  1VG0 A;  4FX9 A;  4K5S A;  3UKA A;  1CJC A;  1S3B A;  1EL7 A;  1OJC A;  3K7M X;  1OJ9 A;  4J31 A;  4O5U A;  4Y4L A;  3NGC X;  3PVC A;  4BK3 A;  4DSH A;  5BUL A;  3NHO X;  1OJD A;  2X3N A;  3AYL A;  3NNE A;  3CGB A;  2GAG B;  5C3J A;  1N1P A;  1H81 A;  3KU9 A;  3AE9 A;  3FG2 P;  2GQW A;  4YWO A;  5HHF A;  4EIP A;  4DGK A;  1M6I A;  3IHG A;  1GER A;  2YLX A;  1PBC A;  3AE6 A;  4KX6 A;  3CNT A;  1E39 A;  4YSY A;  1KSS A;  4A7A A;  4D04 A;  3P4P A;  1N4U A;  3P4Q A; 
#chains in the Genus database with same CATH topology
 1TKK A;  1PDZ A;  3DFH A;  3EKG A;  1MDL A;  3I4K A;  3URH A;  3GYJ A;  4Z2T A;  1E9I A;  3NTA A;  4YTP A;  3LJP A;  1JNZ A;  1DXL A;  4UDQ A;  3AED A;  5J04 A;  4H4S A;  2GB0 A;  2VOU A;  4U2T A;  4YWS A;  1GRB A;  2XSX A;  3AYJ A;  1CJ4 A;  2WES A;  3C4N A;  3WE0 A;  1BWC A;  4E0V A;  2YAU A;  2R0C A;  4H4Y A;  1FFV C;  3CT2 A;  1RVK A;  3TWA A;  1H82 A;  2J3N A;  3SSZ A;  1BZL A;  3RHA A;  2EQ9 A;  3K1G A;  2YLS A;  3MWC A;  4EM3 A;  2BC1 A;  4HNC A;  2X99 A;  3UJ2 A;  1JRX A;  3S61 A;  4EQW A;  3FVD A;  3R1Z A;  2OZ8 A;  1N4V A;  1F3P A;  2AKM A;  2VRM A;  4NTD A;  2ZZ0 A;  2PU0 A;  2WPF A;  3THU A;  4H2Q A;  1SJB A;  3DJJ A;  2R4E A;  2PYX A;  1KSU A;  1PXC A;  2WPE A;  5HYM A;  1E1K A;  4CBQ A;  2XLU A;  2QA1 A;  5JCL A;  4KWS A;  3DG7 A;  3RCY A;  2B7R A;  1E1L A;  2P88 A;  3RO6 A;  3KKJ A;  3DEQ A;  2QGY A;  1B4V A;  1KNR A;  3R07 C;  2H89 A;  2XVI A;  2JB1 A;  3I3L A;  2WBA A;  3H7V A;  3CNS A;  1JRZ A;  3CYJ A;  3EPT A;  3LXD A;  1SB3 B;  1P43 A;  3AD8 B;  5KMS A;  3VQR A;  4AOS A;  3DDM A;  3RGT A;  4GAV A;  2WS3 A;  2OA1 A;  3AMZ A;  2Q6U A;  2YLR A;  5KMQ A;  4X9N A;  4OVI A;  2OQH A;  3T6C A;  1P48 A;  3KD9 A;  4II3 A;  5BVA A;  1BKW A;  4OPG A;  3STP A;  1BF3 A;  4BJZ A;  3R9U A;  2A89 A;  3AEB A;  4A9W A;  1ZOY A;  4OCG A;  3ETR B;  1MXT A;  1JOA A;  4NEV A;  4FDC B;  4NZH A;  1HYU A;  3GWD A;  2JK6 A;  4Z17 A;  2BA9 A;  3ZLG A;  1YEY A;  2JB2 A;  3VC6 A;  3UKQ A;  1IJH A;  3HZL A;  2BCP A;  1CC4 A;  2YWL A;  2BRA A;  1GRH A;  4YTN A;  2R4J A;  4F4R A;  3T2K A;  4DSG A;  1YY5 A;  3G5R A;  4G73 A;  4II2 A;  2C7G A;  1UKV G;  4A65 A;  2APG A;  2W55 A;  3NT6 A;  1JPM A;  1EC9 A;  3RR1 A;  3QVP A;  2YVF A;  4J3Z A;  3ZYX A;  1KD0 A;  2XLR A;  5FJP A;  3NLC A;  2OLA A;  2XFN A;  1MRA A;  2GGH A;  3AEE A;  4TM0 A;  1GRF A;  3AM9 A;  3D9X A;  5U1O A;  5LV9 A;  3AEG A;  3FPZ A;  4GUV A;  2QQ6 A;  3CPI G;  3UJS A;  1H83 A;  3NZG A;  4HCD A;  3U4F A;  1ONF A;  4H4R A;  1KF6 A;  3CN8 A;  4GDP A;  1FOH A;  2OLO A;  4AT2 A;  3HYW A;  1XS2 A;  2XH7 A;  5FS9 A;  3NS1 B;  3UTF A;  4KEM A;  2PCE A;  1QLB A;  3P1W A;  1RSG A;  1FIQ B;  2AL2 A;  4I59 A;  2QA2 A;  2VVM A;  4JDR A;  1ZMC A;  3B9J B;  4JN9 A;  5KNL A;  1W4X A;  4ICY A;  3MKC A;  3A7R A;  4RSL A;  3UP5 A;  1EBD A;  1NDA A;  2Q0K A;  4JN7 A;  4H4Z A;  2WU5 A;  1N60 C;  3VCN A;  1PHH A;  4AOX A;  4HB9 A;  2VZ2 A;  4IVO B;  3L1R A;  1VQW A;  2JB3 A;  3RED A;  3GO2 A;  4CCQ A;  5BUK A;  1Y56 B;  1LV0 A;  3M0O A;  4OPT A;  4ZOH B;  3FCP A;  4NNJ A;  2GSH A;  2CDU A;  3D46 A;  4U2L A;  3ISH A;  3CND A;  2JBV A;  3NVY B;  5C2T A;  1H2I A;  1CBO A;  4C3Y A;  1JU2 A;  3RP8 A;  1NEL A;  1ECQ A;  2HXT A;  4LU6 A;  4IT1 A;  2PA6 A;  4IL0 A;  3BI4 A;  3DER A;  2IVD A;  3P93 A;  3AN1 A;  1BQG A;  5JCN A;  5IQ4 A;  1LPF A;  3SN4 A;  3FMW A;  1RP0 A;  4H19 A;  1CC6 A;  1STZ A;  4OPL A;  4U8J A;  3K7T A;  1NHP A;  3UKA A;  1S3B A;  1EL7 A;  4J31 A;  3CGB A;  5G5G B;  3KU9 A;  2YLX A;  1KSS A;  1FO4 A;  1YQ3 A;  3SN0 A;  1E7P A;  3GSI A;  1GRG A;  4AT0 A;  2BC0 A;  2V3B A;  3A7U A;  2BK4 A;  2BAC A;  1JRO A;  1B37 A;  1JRY A;  1OEP A;  3CXO A;  2YR5 A;  4J34 A;  2ONE A;  2CFY A;  2I5Q A;  4C3X A;  4U8N A;  2OVL A;  4B66 A;  2XCG A;  4TLX A;  1XHC A;  4IZG A;  4E5T A;  3HPF A;  3RNM A;  2XFP A;  2QDD A;  3SM8 A;  5IDZ A;  1BGN A;  1XPQ A;  3I6T A;  3PWG A;  2VQB A;  3AB1 A;  2GL5 A;  3UXL A;  3ENL A;  4E8G A;  3AYI A;  2F5Z A;  3T14 A;  4IA6 A;  1H84 A;  2P8C A;  3ITJ A;  1DNC A;  1KNP A;  2Q7V A;  3V3W A;  3R25 A;  3AWI A;  5JCM A;  4DX3 A;  1KDG A;  3GMB A;  4DWD A;  4NEW A;  2C73 A;  1V97 A;  3AEF A;  4UP3 A;  1L9C A;  4IHC A;  1MDR A;  4USQ A;  1S3E A;  1VRQ B;  1REO A;  1F8S A;  2R46 A;  2P3Z A;  3CNJ A;  3SJN A;  1CJ2 A;  1E1M A;  3ALL A;  3T9P A;  5KRQ A;  4K2X A;  2VRL A;  4X9M A;  4H83 A;  2QDE A;  1GTE A;  4KT2 A;  5IQ1 A;  4U8O A;  4U8M A;  3JSK A;  1GT8 A;  2PP0 A;  4A3R A;  4A5L A;  4YSX A;  4E4F A;  1VG9 A;  1MOK A;  2FKP A;  2Z5X A;  1LJ1 A;  1BGJ A;  2RGH A;  1JPD X;  4MJW A;  3UKP A;  3K7Q X;  1IUW A;  5KOX A;  1E6E A;  5FJT A;  2C67 A;  1AOG A;  3I6D A;  3BHK A;  4HNL A;  1ZY8 A;  2C3C A;  1N62 C;  2E3T A;  1ZK7 A;  3UOY A;  3JW7 A;  3TW9 A;  3NYC A;  2DW6 A;  3UKL A;  4EQS A;  1R0M A;  5HY5 A;  3Q6J A;  3D8X A;  2A8X A;  4BV6 A;  2YG5 A;  5EB5 A;  4H4P A;  3S5S A;  3UOX A;  2XLT A;  3V76 A;  3AE2 A;  2XH0 A;  3LAD A;  2OAL A;  2DKI A;  3NFU A;  2ZC8 A;  3IJI A;  3ES8 A;  4NTE A;  3KPK A;  3ALM A;  2CHR A;  5U63 A;  4WX1 A;  2PTW A;  3BOX A;  4H4Q A;  2B76 A;  3IK4 A;  4U8I A;  3EEZ A;  2OFJ A;  2XDO A;  3O0H A;  2GR0 A;  3H8L A;  2PTZ A;  3CTY A;  3SFD A;  1NEN A;  3UTE A;  1ZP0 A;  3RRA A;  3T37 A;  2GGI A;  3V5C A;  1Y0P A;  3OZ2 A;  1JDF A;  4GR1 A;  3OW1 A;  3MQT A;  4H2R A;  3NRZ B;  3CGD A;  1JCT A;  4RG4 A;  1PBD A;  2W0H A;  4TM4 A;  4CNJ A;  3DK8 A;  1GEU A;  1XAN A;  1TE6 A;  4H4T A;  3B3R A;  7ENL A;  4N9X A;  3NXL A;  4ADW A;  2WPC A;  3DIP A;  2C75 A;  1EBH A;  1DJQ A;  2ZZC A;  1TDE A;  1L0V A;  2BCG G;  5GRT A;  1PS9 A;  3EUB 3;  4H2P A;  5L46 A;  2YM2 A;  2C3D A;  4H2N A;  1FHV A;  1B8S A;  4H1Z A;  3PS9 A;  2YLZ A;  5JRB A;  1IUT A;  4M52 A;  4Z2R A;  2XH4 A;  4KPR A;  3NH3 X;  2RDX A;  3EAO A;  2GVC A;  4U8L A;  2OZT A;  3SFE A;  4YTM A;  2WQY A;  5CQF A;  4B67 A;  2OQY A;  3TJ4 A;  3C96 A;  1IYX A;  3EF6 A;  3IJL A;  4HYR A;  1ZOV A;  2PPG A;  3A7A A;  1IUV A;  1COY A;  1NPX A;  3AD9 B;  1XDI A;  2OG9 A;  2HZG A;  4NTC A;  3DGB A;  1F8R A;  3FJ4 A;  2GDQ A;  1GES A;  1PDH A;  2YM1 A;  4H50 A;  4G7F A;  4Z2U A;  5FS8 A;  4DYE A;  3PFR A;  4YT0 A;  3SQP A;  4LA1 A;  1SJA A;  5JCI A;  4FP1 A;  1MO9 A;  2OO6 A;  2JKC A;  3SGL A;  3DJD A;  2OAM A;  4G6H A;  4IL2 A;  3D47 A;  1KKR A;  2EQ6 A;  4REK A;  4HCH A;  2Y6Q A;  3CNP A;  4H4U A;  3IWA A;  4ZCC A;  4GIS A;  3V4B A;  1FL2 A;  1PBF A;  3QJ4 A;  4Z44 A;  5HXI A;  4G8T A;  3UCL A;  1MUC A;  3IHM A;  4HN8 A;  1NG4 A;  2XVF A;  4TM3 A;  3TTE A;  2PHH A;  3VR8 A;  3DFY A;  2AL2 B;  2I0Z A;  2W54 A;  1SJD A;  3KA7 A;  1GV4 A;  2XVE A;  3M12 A;  3UJR A;  3BHF A;  4FX9 A;  4K5S A;  1CJC A;  3U9I A;  5FJU A;  3NHO X;  3AYL A;  4GME A;  5C3J A;  4ROP A;  3FG2 P;  4YWO A;  1PBC A;  3AE6 A;  2QVH A;  4A7A A;  3NIX A;  4ZA0 A;  4CNK A;  1IUX A;  4UDR A;  1TZZ A;  1TYP A;  3NK1 X;  1PBB A;  2YLT A;  3DJE A;  4JHM A;  4M6U A;  3SZF A;  3AE8 A;  2GAH B;  3SBF A;  4PAA A;  4YSZ A;  3GDN A;  2GF3 A;  4B68 A;  3GYX A;  3UGV A;  2QJN A;  4DNA A;  1PJ6 A;  4IP4 A;  1EL9 A;  3AE7 A;  4USR A;  3AXB A;  5J60 A;  3ZVH A;  4ENL A;  3QVR A;  4J56 A;  2V6O A;  3KUM A;  4EMW A;  3TQP A;  2OKT A;  4XWZ A;  4Z26 A;  3SZ0 A;  3TWB A;  3MSY A;  5DBJ A;  5EBK A;  5TR3 A;  3NVV B;  3SN1 A;  2Z5Y A;  2OLN A;  2A87 A;  3QFA A;  4CY8 A;  2C66 A;  4HA6 A;  3OZY A;  1FHU A;  1PXB A;  2AKZ A;  3Q9T A;  3SZW A;  4BK2 A;  2YVG A;  3N6H A;  4GCM A;  2TMD A;  2CUL A;  1WYG A;  4APN A;  1TRB A;  3KLJ A;  3M13 A;  4CCR A;  2RGJ A;  2XFO A;  3NG7 X;  3VRB A;  1GXF A;  3VC5 A;  3R11 A;  2XLP A;  3GMC A;  4Z24 A;  3S5W A;  4WCT A;  3KVE A;  3NYE A;  3LZX A;  4H7U A;  4TVY A;  5ENL A;  2ZBW A;  2ACZ A;  1TDO A;  1FEC A;  4TVW A;  4TM1 A;  3T4W A;  3HYX A;  3UTH A;  3QKE A;  4J2W A;  5KXJ A;  3GC2 A;  2AAQ A;  3N4F A;  2O56 A;  2R0G A;  4Z25 A;  4A99 A;  1JNR A;  3QPE A;  2W3R A;  3AD7 B;  3DES A;  1S7M A;  2WOW A;  2QJJ A;  3ZLF A;  2X8C A;  4TLZ A;  3F8D A;  2PS2 A;  2RAB A;  2PGE A;  4X2P A;  3T2Y A;  3BI2 A;  4MKS A;  2WDQ A;  1Q1W A;  3QN3 A;  2HQM A;  5GSN A;  3PO7 A;  2ZZB A;  1TYT A;  1BKH A;  4C5O A;  2GR2 A;  1ZXI C;  1ELI A;  3QSS A;  3QSM A;  2XVH A;  5EOW A;  3D1C A;  1WUE A;  2WHD A;  1Z6L A;  1GAL A;  1TDK A;  4OPU A;  2NVK X;  3OC4 A;  2O9Z A;  2OPJ A;  4ZCW A;  2GGE A;  1H7W A;  3SR6 B;  4D03 A;  2ARD A;  4CRT A;  1ONE A;  3P4S A;  1LTX R;  1PN0 A;  2EQ8 A;  2P8B A;  1DOD A;  3HYV A;  3V3N A;  1VDC A;  4YSH A;  3TCS A;  5KOW A;  1B5Q A;  2FBW A;  2YVJ A;  4GFI A;  4C77 A;  2C64 A;  1K0I A;  1KFY A;  1GET A;  4JN8 A;  4K8G A;  3ES7 A;  4HPN A;  4OPI A;  2DKH A;  4MGG A;  2PP1 A;  4EWJ A;  1GOS A;  1NHS A;  4A6G A;  1QO8 A;  3NVW B;  2RGO A;  2XFU A;  2BS3 A;  1S2Q A;  4K2S A;  1N5W C;  2QJM A;  3SX6 A;  3T8Q A;  3GYI A;  3H8A A;  4AP3 A;  1NEK A;  3UKK A;  3ICT A;  3BSM A;  2WOI A;  3FIM B;  1GRT A;  1KCZ A;  3E1T A;  1CL0 A;  3CXB A;  4J1O A;  1R6W A;  3MY9 A;  4B64 A;  3L8K A;  4YKG A;  1Q1R A;  3CK5 A;  4B69 A;  3IJQ A;  1F9C A;  2R0P A;  1RYI A;  3OTR A;  4GDE A;  2FJE A;  4ECH A;  3UCC A;  3CGC A;  3I6E A;  4MMW A;  1DOB A;  1O95 A;  1YQZ A;  2PGW A;  1D5T A;  2QAE A;  3PK7 A;  4DN1 A;  5FMH A;  4Z43 A;  1FFU C;  3GRT A;  4JNQ A;  1K0J A;  3R10 A;  3LOV A;  4O5Q A;  3QTP A;  2WDR A;  2W3S A;  4GYP A;  3SY4 A;  3FXG A;  1EC8 A;  5KMP A;  3IC9 A;  1H6V A;  1LQU A;  2C70 A;  2Y6R A;  2HNE A;  4K7Z A;  1V59 A;  2PTX A;  3RP7 A;  5IPY A;  2TPR A;  3FV9 A;  3VA8 A;  4H4X A;  2JAE A;  1FCD A;  4GYP C;  3UXK A;  3VRD B;  1MNS A;  2V5Z A;  3ICS A;  3LZW A;  1VQZ A;  2XVJ A;  4U8P A;  3VRA A;  2VVL A;  2UZZ A;  2BK3 A;  1M64 A;  4E6M A;  3T31 A;  1D4D A;  1NHR A;  1DTN A;  1FEB A;  1K0L A;  2H88 A;  1W6T A;  1JEH A;  2BK5 A;  2E5V A;  3B97 A;  2C4C A;  3IF9 A;  3GD4 A;  2PMQ A;  1PBE A;  2MNR A;  1GND A;  3UP4 A;  3ATR A;  2OX4 A;  3ALJ A;  2BS4 A;  2NQL A;  3UCD A;  1K4Q A;  3AE4 A;  3CMM A;  1NG3 A;  1GRA A;  1S2Y A;  2E5A A;  5KWF A;  5EU9 A;  4OPC A;  4Y4M A;  5EB4 A;  2GMJ A;  4H4V A;  1GPE A;  4B63 A;  4NWZ A;  1CF3 A;  2Q0L A;  2BYB A;  5M10 A;  2ZAD A;  4FI4 A;  3ZLH A;  4E4U A;  1SEZ A;  4K5R A;  2VQ7 A;  1DOC A;  3UJF A;  2XLS A;  3V3O A;  2WP5 A;  1GTH A;  3NN0 X;  3NYF A;  1EL5 A;  1PJ7 A;  1RM6 B;  1WUF A;  4KPL A;  3AE5 A;  1ZX9 A;  1VG0 A;  3GY1 A;  1OJC A;  5BUL A;  1OJ9 A;  4O5U A;  4BK3 A;  2X3N A;  1N1P A;  4EIP A;  4G74 A;  1M6I A;  1GER A;  4KX6 A;  3CNT A;  1E39 A;  4YSY A;  4D04 A;  3NRN A;  3H8I A;  2OZ3 A;  3V5F A;  2GH5 A;  3II4 A;  2WEU A;  1YQ4 A;  1JRP A;  2GEW A;  4PAB A;  3DK4 A;  4JQ9 A;  3GDP A;  5KMR A;  2V61 A;  3UJE A;  3P4R A;  2HXU A;  4BK1 A;  1GRE A;  1GSN A;  2CVJ A;  5J7X A;  4GF7 A;  1PJ5 A;  2MUC A;  3AE3 A;  3DME A;  2WDV A;  4RG3 A;  1Q9I A;  3SQS A;  1N4W A;  3CAW A;  4FK1 A;  2GR1 A;  2PTY A;  5FJO A;  3Q45 A;  5FS6 A;  5G5H B;  3VR9 A;  4GAP A;  3R0U A;  3CGE A;  2GGG A;  1F8W A;  1P2H A;  1D7Y A;  2QCU A;  3GWF A;  3CB3 A;  1L9D A;  1KKO A;  4FK1 C;  5CKU A;  3PWI A;  4B1B A;  2V60 A;  4DHG A;  4XXG A;  1NAA A;  3DH9 A;  3EAN A;  4YXD A;  4Y4N A;  3DGH A;  3G5S A;  2X8H A;  1TDF A;  5U25 A;  1X2H A;  2AR8 A;  3UTG A;  5BOE A;  3HRD C;  4H2H A;  3S47 A;  1OJT A;  1P2E A;  2E1M A;  1NU5 A;  4G9K A;  3OP2 A;  4IVM B;  3ZDN A;  2EQ7 A;  3AE1 A;  1ELS A;  1L9E A;  3ZVI A;  2C72 A;  4GGB A;  4G6G A;  4C74 A;  4J36 A;  2WET A;  2R9Z A;  2VVL G;  2YG3 A;  3MUC A;  1CC2 A;  2B9Y A;  4A6N B;  2X50 A;  4J57 A;  3ZVH B;  1EL8 A;  4EIQ A;  1X2G A;  3UOZ A;  4EQR A;  2WU2 A;  1LVL A;  3DG6 A;  2IID A;  3F8P A;  4IA5 A;  4EMJ A;  3FYY A;  4GIR A;  2B9W A;  3P3B A;  3C4A A;  4AP1 A;  1OJA A;  2XYO A;  3N6J A;  2BXS A;  1EBG A;  2GV8 A;  2BS2 A;  4H4W A;  1NHQ A;  3PG6 A;  4K22 A;  3JZU A;  3TJI A;  4J33 A;  3NN6 X;  4A6N A;  1D7L A;  4K1W A;  2FJB A;  3BNM A;  1LQT A;  2YLW A;  2XFQ A;  5KVH A;  3RIT A;  4U8K A;  4BJY A;  3QFB A;  3DK9 A;  2AL1 A;  4Z1Y A;  2YR6 A;  1X31 B;  1N63 C;  1DOE A;  2YG6 A;  3NK0 X;  1IUS A;  3VFC A;  3ADA B;  3T0K A;  1ZMD A;  5ER0 A;  1E1N A;  2WP6 A;  4UDP A;  3LB8 A;  3BJS A;  3JVA A;  3N4E A;  3UKH A;  3COX A;  2V3A A;  5KVI A;  5M0Z A;  2YQU A;  2GMH A;  3P0W A;  2GRT A;  4DXK A;  4EQX A;  1N5X A;  3CPH G;  4M0X A;  5FS7 A;  4LII A;  3RP6 A;  4B65 A;  4X4J A;  2WP9 A;  3QSE A;  4GRT A;  2PSN A;  4GGH A;  4CY6 A;  2FYM A;  1N61 C;  4OPD A;  1Y56 A;  1KN0 A;  3DA1 A;  3NTD A;  2E4G A;  3HW2 A;  1PXA A;  2X8G A;  2R45 A;  2BXR A;  2BRY A;  3Q4D A;  3CIR A;  2GGJ A;  3AEA A;  3AEC A;  4EM4 A;  2B7S A;  3R0K A;  3L5O A;  3B6D A;  4IV9 A;  1F6M A;  3NK2 X;  3F8R A;  3CPJ G;  3H12 A;  1FEA A;  1EC7 A;  4ZN0 A;  3GD3 A;  3VCC A;  5BOF A;  3NKS A;  1SJC A;  3H70 A;  3SZC A;  3SYI A;  3H4K A;  1QJD A;  2AQJ A;  1L8P A;  1VDV A;  2YG4 A;  2C65 A;  1YKJ A;  3K30 A;  6ENL A;  3UKF A;  5BRT A;  3NO1 A;  3GRS A;  4K8D A;  4XWR A;  4I58 A;  2YG7 A;  1ZDL A;  4JY2 A;  2C76 A;  2XGZ A;  1IUU A;  2BAB A;  2FJD A;  4JNA A;  1DJN A;  2DW7 A;  2IVE A;  3DGZ A;  1O5W A;  4P9S A;  2NPX A;  4HCL A;  1D4E A;  3OZM A;  4IP5 A;  2YR4 A;  2GQF A;  3P9U A;  3GD6 A;  3G5Q A;  3ABV A;  3TOY A;  1T3Q C;  1H7X A;  3UOV A;  2FJA A;  2WOV A;  3FBS A;  1CJ3 A;  4A35 A;  4EMI A;  4A79 A;  1H86 A;  2XH2 A;  2GR3 A;  2PP3 A;  4JY3 A;  5JCK A;  4YKF A;  3KPF A;  1CHU A;  3ICR A;  1XPY A;  2POD A;  3T2Z A;  3SXI A;  1TDN A;  1D4C A;  3BNU A;  3VDG A;  2B9X A;  4BUR A;  1ZKQ A;  2P0I A;  3BI5 A;  1PDY A;  2PU1 A;  5FJR A;  3NVZ B;  3OPS A;  3ATQ A;  4U2S A;  4ZCD A;  3DJG X;  2POZ A;  1O94 A;  3K7M X;  4Y4L A;  3NGC X;  3PVC A;  4DSH A;  1OJD A;  3NNE A;  3QLD A;  2GAG B;  3DG3 A;  1H81 A;  3AE9 A;  2GQW A;  5HHF A;  4DGK A;  3IHG A;  3MZN A;  3P4P A;  1N4U A;  3P4Q A; 
#chains in the Genus database with same CATH homology
 4CNK A;  1IUX A;  3NRN A;  1YQ3 A;  3H8I A;  4UDR A;  1E7P A;  2GH5 A;  3II4 A;  1TYP A;  2WEU A;  3GSI A;  3NK1 X;  1GRG A;  4AT0 A;  3URH A;  1YQ4 A;  1PBB A;  3GYJ A;  2GEW A;  4Z2T A;  4PAB A;  3DK4 A;  4JQ9 A;  2BC0 A;  2YLT A;  3DJE A;  3LJP A;  2V3B A;  2BK4 A;  3NTA A;  3GDP A;  5KMR A;  2BAC A;  2V61 A;  1JNZ A;  3SZF A;  3P4R A;  1DXL A;  3AE8 A;  1B37 A;  1JRY A;  4UDQ A;  4BK1 A;  2GAH B;  1GRE A;  3AED A;  4PAA A;  2YR5 A;  1GSN A;  2CVJ A;  4J34 A;  4H4S A;  3GDN A;  4YSZ A;  2GB0 A;  5J7X A;  2VOU A;  1PJ5 A;  2CFY A;  2GF3 A;  4GF7 A;  1GRB A;  4U2T A;  4C3X A;  3AE3 A;  4U8N A;  3DME A;  4B68 A;  3GYX A;  3AYJ A;  2WDV A;  4DNA A;  4B66 A;  1PJ6 A;  2XCG A;  4TLX A;  4RG3 A;  1XHC A;  1Q9I A;  1CJ4 A;  2WES A;  3C4N A;  3RNM A;  1EL9 A;  2XFP A;  1N4W A;  3AE7 A;  3WE0 A;  4USR A;  1BWC A;  3AXB A;  4E0V A;  4FK1 A;  2GR1 A;  5J60 A;  3SM8 A;  3QVR A;  2YAU A;  4J56 A;  2R0C A;  5FS6 A;  1BGN A;  3VR9 A;  1XPQ A;  4GAP A;  2V6O A;  4H4Y A;  4EMW A;  3CGE A;  2VQB A;  3AB1 A;  4XWZ A;  1F8W A;  1H82 A;  2J3N A;  1P2H A;  4Z26 A;  1D7Y A;  3SZ0 A;  2QCU A;  1BZL A;  3GWF A;  3RHA A;  2EQ9 A;  2YLS A;  3AYI A;  1L9D A;  5EBK A;  5DBJ A;  2F5Z A;  4FK1 C;  5CKU A;  4EM3 A;  4IA6 A;  3T14 A;  5TR3 A;  4B1B A;  1H84 A;  3ITJ A;  2BC1 A;  1DNC A;  1KNP A;  2Q7V A;  2Z5Y A;  2OLN A;  2X99 A;  2A87 A;  3QFA A;  4CY8 A;  1JRX A;  3S61 A;  3AWI A;  2C66 A;  4EQW A;  5JCM A;  4HA6 A;  1KDG A;  3GMB A;  4NEW A;  1PXB A;  2C73 A;  2V60 A;  3Q9T A;  4XXG A;  1N4V A;  3SZW A;  4BK2 A;  2YVG A;  3UOX A;  3AEF A;  4UP3 A;  1F3P A;  1L9C A;  1NAA A;  4GCM A;  3DH9 A;  3EAN A;  2TMD A;  2VRM A;  4NTD A;  4YXD A;  2CUL A;  2ZZ0 A;  4Y4N A;  3DGH A;  3G5S A;  4USQ A;  4APN A;  2WPF A;  2X8H A;  5U25 A;  1S3E A;  1TDF A;  1TRB A;  1VRQ B;  1REO A;  3KLJ A;  1F8S A;  2AR8 A;  3UTG A;  2R46 A;  3M13 A;  3CNJ A;  1CJ2 A;  4CCR A;  2RGJ A;  4H2Q A;  3DJJ A;  2R4E A;  2XFO A;  1E1M A;  2PYX A;  3ALL A;  1KSU A;  5KRQ A;  1OJT A;  1P2E A;  1PXC A;  2E1M A;  3NG7 X;  4K2X A;  3VRB A;  1GXF A;  2WPE A;  2VRL A;  4G9K A;  5HYM A;  1E1K A;  2XLP A;  4IVM B;  3GMC A;  4Z24 A;  3S5W A;  3ZDN A;  4X9M A;  4CBQ A;  2XLU A;  2EQ7 A;  4WCT A;  3KVE A;  2QA1 A;  3AE1 A;  3LZX A;  3NYE A;  4H7U A;  1L9E A;  5JCL A;  2ZBW A;  2ACZ A;  1TDO A;  1GTE A;  1FEC A;  2C72 A;  4TM1 A;  5IQ1 A;  3HYX A;  4G6G A;  4U8O A;  2B7R A;  4U8M A;  3UTH A;  4C74 A;  3JSK A;  1GT8 A;  4J2W A;  1E1L A;  4J36 A;  2WET A;  2R9Z A;  5KXJ A;  2VVL G;  4A5L A;  2YG3 A;  2AAQ A;  1CC2 A;  3KKJ A;  4YSX A;  2R0G A;  4Z25 A;  4A99 A;  2H89 A;  1B4V A;  1JNR A;  1KNR A;  1VG9 A;  1MOK A;  2XVI A;  2JB1 A;  3I3L A;  2Z5X A;  1LJ1 A;  2WBA A;  3AD7 B;  1BGJ A;  2B9Y A;  4A6N B;  1S7M A;  3CNS A;  2RGH A;  1JRZ A;  2X50 A;  4J57 A;  2WOW A;  4MJW A;  3EPT A;  3UKP A;  1EL8 A;  3K7Q X;  3LXD A;  4EIQ A;  5KMS A;  3AD8 B;  3VQR A;  3UOZ A;  2X8C A;  4EQR A;  1IUW A;  4TLZ A;  1E6E A;  4AOS A;  5KOX A;  3F8D A;  2WU2 A;  1LVL A;  2C67 A;  2IID A;  3F8P A;  4IA5 A;  1AOG A;  3I6D A;  3BHK A;  4GAV A;  2WS3 A;  2OA1 A;  1ZY8 A;  4EMJ A;  2C3C A;  2RAB A;  2B9W A;  2Q6U A;  2YLR A;  1ZK7 A;  5KMQ A;  3BI2 A;  3C4A A;  3T2Y A;  3UOY A;  4AP1 A;  2WDQ A;  4X9N A;  1Q1W A;  3NYC A;  4OVI A;  1OJA A;  2XYO A;  2HQM A;  5GSN A;  3PO7 A;  3UKL A;  2ZZB A;  2BXS A;  1TYT A;  4EQS A;  2GV8 A;  2BS2 A;  4C5O A;  4H4W A;  1NHQ A;  3Q6J A;  3D8X A;  3KD9 A;  3PG6 A;  2GR2 A;  4K22 A;  5HY5 A;  1ELI A;  3QSS A;  4II3 A;  3QSM A;  4J33 A;  2A8X A;  4BV6 A;  2YG5 A;  3NN6 X;  5BVA A;  1BKW A;  2XVH A;  4A6N A;  4OPG A;  1D7L A;  5EOW A;  3D1C A;  2FJB A;  1BF3 A;  4BJZ A;  5EB5 A;  4H4P A;  3BNM A;  2WHD A;  1Z6L A;  1GAL A;  1TDK A;  4OPU A;  2NVK X;  3R9U A;  3OC4 A;  1LQT A;  2A89 A;  2O9Z A;  2XLT A;  2YLW A;  3AEB A;  2XFQ A;  3AE2 A;  3V76 A;  4A9W A;  1H7W A;  1ZOY A;  4OCG A;  3LAD A;  2OAL A;  1MXT A;  5KVH A;  2DKI A;  4D03 A;  1JOA A;  4NEV A;  2ARD A;  4FDC B;  4NZH A;  4U8K A;  3P4S A;  4BJY A;  4CRT A;  1LTX R;  3QFB A;  3DK9 A;  1HYU A;  1PN0 A;  2EQ8 A;  2YR6 A;  4NTE A;  3NIX A;  1DOD A;  1X31 B;  3GWD A;  3KPK A;  2JK6 A;  3HYV A;  1DOE A;  2BA9 A;  2YG6 A;  3ALM A;  3V3N A;  1VDC A;  2JB2 A;  5U63 A;  3UKQ A;  4YSH A;  3NK0 X;  4WX1 A;  1IUS A;  4H4Q A;  2B76 A;  1IJH A;  3HZL A;  5KOW A;  2BCP A;  1CC4 A;  1B5Q A;  2YWL A;  2FBW A;  3ADA B;  4U8I A;  2BRA A;  2XDO A;  2YVJ A;  3T0K A;  1GRH A;  4C77 A;  1ZMD A;  2GR0 A;  3O0H A;  5ER0 A;  1K0I A;  1KFY A;  2C64 A;  3H8L A;  1E1N A;  4YTN A;  2WP6 A;  1GET A;  2R4J A;  3CTY A;  1NEN A;  3SFD A;  4OPI A;  1ZP0 A;  2DKH A;  3UTE A;  4UDP A;  3LB8 A;  1GOS A;  3T37 A;  3T2K A;  1NHS A;  4DSG A;  1QO8 A;  1YY5 A;  2RGO A;  2XFU A;  3G5R A;  1Y0P A;  4G73 A;  4YTP A;  4II2 A;  2BS3 A;  1S2Q A;  3OZ2 A;  2C7G A;  3UKH A;  1UKV G;  3COX A;  2V3A A;  3SX6 A;  4GR1 A;  5KVI A;  2APG A;  4A65 A;  3GYI A;  5M0Z A;  3NT6 A;  4H2R A;  4AP3 A;  3CGD A;  1NEK A;  4RG4 A;  3UKK A;  1PBD A;  2YQU A;  3ICT A;  2W0H A;  2GMH A;  4TM4 A;  4CNJ A;  2WOI A;  3FIM B;  2GRT A;  3QVP A;  3DK8 A;  1GRT A;  2YVF A;  1GEU A;  1XAN A;  4H4T A;  3E1T A;  4EQX A;  1CL0 A;  3CPH G;  3ZYX A;  3B3R A;  5FS7 A;  2XLR A;  4B64 A;  3NLC A;  3L8K A;  4LII A;  3RP6 A;  4YKG A;  4B65 A;  1Q1R A;  4B69 A;  4X4J A;  2XFN A;  4N9X A;  2WP9 A;  3QSE A;  4GRT A;  2R0P A;  1RYI A;  3AEE A;  4TM0 A;  4ADW A;  1GRF A;  4GDE A;  2WPC A;  2C75 A;  4CY6 A;  2FJE A;  3D9X A;  4OPD A;  1Y56 A;  4ECH A;  1DJQ A;  3CGC A;  5U1O A;  1KN0 A;  2ZZC A;  5LV9 A;  1DOB A;  3DA1 A;  3AEG A;  3FPZ A;  1O95 A;  4GUV A;  1YQZ A;  3NTD A;  1D5T A;  2QAE A;  2E4G A;  1TDE A;  1PXA A;  1L0V A;  2X8G A;  2R45 A;  2BCG G;  5FMH A;  5GRT A;  1PS9 A;  3CPI G;  4Z43 A;  1H83 A;  2BXR A;  4H2P A;  3GRT A;  1ONF A;  4JNQ A;  1K0J A;  2BRY A;  5L46 A;  3LOV A;  4O5Q A;  2YM2 A;  2C3D A;  4H4R A;  1KF6 A;  3CIR A;  3CN8 A;  2WDR A;  3AEA A;  3AEC A;  4GDP A;  4EM4 A;  4H2N A;  2B7S A;  3L5O A;  1FOH A;  2OLO A;  3B6D A;  4AT2 A;  1B8S A;  3HYW A;  1F6M A;  3NK2 X;  4IV9 A;  3PS9 A;  2YLZ A;  3F8R A;  3SY4 A;  5JRB A;  1IUT A;  4M52 A;  4Z2R A;  3CPJ G;  5FS9 A;  1FEA A;  4KPR A;  3UTF A;  3NH3 X;  5KMP A;  1QLB A;  3IC9 A;  1H6V A;  1LQU A;  2C70 A;  2Y6R A;  3P1W A;  4ZN0 A;  3EAO A;  1RSG A;  2GVC A;  4U8L A;  4K7Z A;  1V59 A;  3GD3 A;  3RP7 A;  3SFE A;  3NKS A;  4YTM A;  3SZC A;  5IPY A;  2WQY A;  2TPR A;  4H4X A;  3SYI A;  4I59 A;  3H4K A;  3C96 A;  2JAE A;  2QA2 A;  1FCD A;  5CQF A;  4B67 A;  3EF6 A;  2VVM A;  1QJD A;  2AQJ A;  3VRD B;  4JDR A;  2V5Z A;  3ICS A;  1ZMC A;  1ZOV A;  2YG4 A;  3LZW A;  1IUV A;  2C65 A;  4JN9 A;  1COY A;  1NPX A;  1YKJ A;  3AD9 B;  3K30 A;  2XVJ A;  5KNL A;  4U8P A;  1W4X A;  1XDI A;  3UKF A;  5BRT A;  3GRS A;  2VVL A;  4K8D A;  2UZZ A;  4ICY A;  3VRA A;  4NTC A;  4XWR A;  4I58 A;  4RSL A;  2YG7 A;  3UP5 A;  1EBD A;  1ZDL A;  1M64 A;  2BK3 A;  1NDA A;  4JY2 A;  2Q0K A;  1F8R A;  4H4Z A;  2C76 A;  1IUU A;  2WU5 A;  1GES A;  1PHH A;  3T31 A;  1D4D A;  4AOX A;  4HB9 A;  1PDH A;  2BAB A;  1NHR A;  2H88 A;  1FEB A;  4H50 A;  1K0L A;  2VZ2 A;  2YM1 A;  1JEH A;  2BK5 A;  5FS8 A;  4Z2U A;  2E5V A;  2FJD A;  4JNA A;  4IVO B;  3L1R A;  4YT0 A;  1VQW A;  2JB3 A;  2C4C A;  3RED A;  3IF9 A;  3GD4 A;  3SQP A;  1DJN A;  4LA1 A;  2IVE A;  3DGZ A;  5JCI A;  1O5W A;  4P9S A;  4CCQ A;  2NPX A;  1MO9 A;  1D4E A;  2JKC A;  1PBE A;  3UP4 A;  1GND A;  3SGL A;  5BUK A;  3ATR A;  3DJD A;  1Y56 B;  1LV0 A;  2OAM A;  3M0O A;  4G6H A;  3ALJ A;  2BS4 A;  4OPT A;  2YR4 A;  2GQF A;  3P9U A;  3G5Q A;  3ABV A;  1H7X A;  2EQ6 A;  4REK A;  4NNJ A;  3UOV A;  1K4Q A;  2CDU A;  3AE4 A;  1NG3 A;  3CMM A;  1GRA A;  2Y6Q A;  1S2Y A;  2FJA A;  2WOV A;  3FBS A;  3ISH A;  3CND A;  4U2L A;  4OPC A;  5KWF A;  3CNP A;  2JBV A;  4Y4M A;  5EB4 A;  4H4U A;  2GMJ A;  1CJ3 A;  4H4V A;  3IWA A;  4EMI A;  1GPE A;  1H86 A;  4A79 A;  4B63 A;  4NWZ A;  2GR3 A;  1CF3 A;  4JY3 A;  5JCK A;  2Q0L A;  4YKF A;  3KPF A;  1H2I A;  1CHU A;  4ZCC A;  5C2T A;  3ICR A;  1CBO A;  2BYB A;  1FL2 A;  1PBF A;  3QJ4 A;  5M10 A;  4Z44 A;  3T2Z A;  4C3Y A;  1JU2 A;  5HXI A;  1SEZ A;  3SXI A;  3RP8 A;  3UCL A;  4K5R A;  1TDN A;  3IHM A;  4LU6 A;  1D4C A;  3BNU A;  2VQ7 A;  2B9X A;  1DOC A;  4BUR A;  1ZKQ A;  1NG4 A;  3BI4 A;  3BI5 A;  2XVF A;  4TM3 A;  2XLS A;  3V3O A;  2WP5 A;  2PHH A;  2IVD A;  1GTH A;  3VR8 A;  3NN0 X;  3NYF A;  1EL5 A;  1PJ7 A;  2I0Z A;  5JCN A;  5IQ4 A;  1LPF A;  3FMW A;  3KA7 A;  1RP0 A;  3ATQ A;  1GV4 A;  2XVE A;  4U2S A;  4ZCD A;  1CC6 A;  3M12 A;  3DJG X;  4OPL A;  3AE5 A;  3BHF A;  4U8J A;  3K7T A;  1NHP A;  1ZX9 A;  1O94 A;  1VG0 A;  4FX9 A;  4K5S A;  3UKA A;  1CJC A;  1S3B A;  1EL7 A;  1OJC A;  3K7M X;  1OJ9 A;  4J31 A;  4O5U A;  4Y4L A;  3NGC X;  3PVC A;  4BK3 A;  4DSH A;  5BUL A;  3NHO X;  1OJD A;  2X3N A;  3AYL A;  3NNE A;  3CGB A;  2GAG B;  5C3J A;  1N1P A;  1H81 A;  3KU9 A;  3AE9 A;  3FG2 P;  2GQW A;  4YWO A;  5HHF A;  4EIP A;  4G74 A;  1M6I A;  3IHG A;  4DGK A;  1GER A;  2YLX A;  1PBC A;  3AE6 A;  4KX6 A;  3CNT A;  1E39 A;  4YSY A;  1KSS A;  4A7A A;  4D04 A;  3P4P A;  1N4U A;  3P4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...