5JCNA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 130
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA02
4H2QA 1GXFA 1D7YA 1PBFA 2C3DA 1S3EA 1XPQA 3H8LA 3LJPA 4Z44A 2VRLA 3UTHA 3KLJA 2WOIA 2E4GA 3AE7A 2X50A 4P9SA 1H84A 2JBVA 4EQXA 4EQWA 4C3XA 3P4SA 1KSUA 1PBBA 3ICRA 2V61A 1MXTA 3AB1A 4CCQA 2OALA 3CTYA 4U2TA 4TLZA 5EB4A 4BJYA 2YM1A 2TPRA 4U8KA 1NENA 1TDEA 1VDCA 2BS4A 1S3BA 2X8CA 1Q1RA 1GPEA 1ELIA 3LADA 3CN8A 3QJ4A 4YTMA 3ICSA 3NK2X 1FEAA 4OPUA 1IUUA 5M10A 1Q9IA 4U8IA 1K0IA 1GNDA 1LPFA 1V59A 3EPTA 4RG4A 1IUTA 1EL7A 1OJTA 2RABA 2R0PA 3P1WA 3G5SA 2A87A 2HQMA 4NTEA 2VRMA 1CL0A 3QSSA 2GR0A 4FX9A 3CNSA 3CNJA 4DNAA 1TYPA 1EL8A 1VG9A 5C3JA 3I3LA 3UOYA 2GH5A 1GALA 5EBKA 3H8IA 3AYJA 2WS3A 2XLSA 4YSXA 1JU2A 2QA2A 2XFNA 4GRTA 3AE1A 2R0GA 2XVEA 3NTAA 4KPRA 1SEZA 4H4PA 4YWOA 3AD9B 4A7AA 4CNKA 3K7TA 1GRAA 1NDAA 3UKQA 2GMHA 4H4SA 5JCKA 5FS7A 1PBDA 3DA1A 5CQFA 1PJ6A 3M0OA 3NTDA 4Y4LA 2OA1A 4EMJA 4EQSA 1KNRA 2R46A 1LV0A 2EQ9A 2WDRA 2WU2A 2C3CA 4UDQA 3UKFA 3SM8A 2YAUA 1OJDA 1GV4A 1ZY8A 1ZK7A 1B4VA 2C73A 2R0CA 3AYLA 2C70A 2W0HA 2GB0A 4YSHA 2Y6QA 4X9MA 2V3BA 4E0VA 4OPIA 2XVFA 1CJ3A 1EL9A 2XVJA 3E1TA 2JB2A 1KFYA 2DKIA 4UDRA 1NHRA 2BC0A 3BHFA 4K22A 3VRDB 4PAAA 4BURA 2JB3A 4IVOB 4Z26A 3V3OA 1GERA 4Z2TA 2PYXA 1ZMDA 4OPLA 3CPHG 2C65A 3DJJA 3CIRA 5CKUA 3P4RA 4H4WA 2C7GA 2RGOA 4A99A 3UP5A 4YKFA 2YG6A 3RHAA 3R9UA 1GETA 2AAQA 4EMIA 1IJHA 4Z2RA 4AP3A 4B65A 1TRBA 2C72A 4PABA 1XANA 2ZZBA 2A89A 1PXCA 3VR9A 4XXGA 2EQ7A 2C75A 1UKVG 3GYIA 1L9CA 3NN6X 1X31B 5JCIA 3GD3A 1KF6A 1N1PA 3G5QA 2YG5A 3QSEA 1BF3A 2CULA 4TM1A 4C3YA 2WETA 3UKHA 1JNZA 4YTPA 4ZCDA 1FEBA 2XLRA 2PHHA 1HYUA 1B5QA 3QVRA 3B3RA 2X99A 3WE0A 2XVHA 2YM2A 1E39A 2O9ZA 1CHUA 1KNPA 3CNDA 3GWDA 4ICYA 1GRFA 4K7ZA 2WPFA 3UOVA 4IA6A 3ICTA 2WESA 5BULA 2V60A 2FJEA 1DOEA 3D1CA 5EOWA 3RP6A 2QCUA 3UTFA 3CGDA 3UKKA 3ZDNA 1CC4A 2APGA 1YQ4A 3C4NA 3M12A 2C64A 3SFDA 4B66A 1TDNA 3NT6A 4K2XA 4EM3A 4J56A 1MO9A 1IUWA 3AE3A 1ZDLA 1GT8A 2GQWA 3GMCA 1W4XA 3M13A 5HYMA 1CF3A 3L8KA 2NVKX 2VVLG 3NNEA 4ECHA 5C2TA 3AE4A 1GRGA 3IHMA 3O0HA 2XFUA 4H4ZA 4CCRA 4J36A 2WHDA 1GREA 3K7QX 5IQ1A 2JK6A 2V6OA 2WU5A 3KVEA 3C96A 2WP5A 1KDGA 3NRNA 1CBOA 1NG3A 5HXIA 3NIXA 2R45A 3G5RA 3RNMA 2XDOA 4AOXA 1VRQB 3RP8A 3PS9A 1BKWA 2B9YA 2YWLA 4TM0A 4LIIA 4A5LA 4FK1A 4RSLA 2WPCA 2JB1A 3V76A 3ADAB 4A9WA 1E6EA 4CBQA 4TLXA 1YKJA 1CJ4A 1Q1WA 2YLZA 3SGLA 4J34A 3FBSA 4A6NA 2RGHA 2XFOA 3NH3X 3ALLA 4WX1A 3DK4A 1TDKA 2E5VA 3VR8A 5KXJA 1K0JA 2YG3A 3AE9A 4U8PA 2Z5XA 4Z2UA 2WBAA 1DODA 1YY5A 4J31A 3GWFA 1F8SA 1GSNA 1QLBA 2WP9A 2YR6A 3IHGA 4GUVA 4NTDA 1S2YA 4U8MA 4J33A 1NHSA 2XFQA 1LQUA 1Z6LA 3OZ2A 4TM4A 3L1RA 1REOA 5IPYA 2WDQA 3KA7A 3II4A 3B6DA 4B64A 4UDPA 3DJGX 1GOSA 1CC2A 1NHQA 4JNQA 4XWZA 4H4UA 2Q7VA 5HHFA 4FDCB 3EAOA 3GD4A 4BJZA 4YT0A 3GMBA 3IWAA 4H4RA 5GRTA 2FJAA 3NHOX 2X8GA 3ABVA 2Q6UA 4X9NA 1GESA 3F8RA 2XCGA 2ARDA 1PBCA 4GCMA 2V3AA 4ZCCA 5M0ZA 2OLOA 4JDRA 4EQRA 2Q0KA 2YQUA 4JNAA 1H82A 5KRQA 1BGJA 4REKA 5J7XA 1N4VA 5J60A 2YG7A 2BXSA 1OJCA 3UCLA 4B69A 2C67A 2ZBWA 4WCTA 1GTHA 4YKGA 4USQA 3SFEA 4YXDA 3P4PA 4DGKA 1JEHA 1D4CA 1E7PA 2OAMA 3ALMA 4C74A 3Q9TA 2WPEA 3AEGA 4EIPA 4EIQA 1GRHA 2VQ7A 1IUSA 3KD9A 1O94A 3V3NA 4DSHA 1NEKA 2BACA 2R4JA 4JN9A 4GDEA 5EB5A 5DBJA 2YLSA 1MOKA 1DJQA 2VVMA 3BHKA 3FPZA 2VQBA 3EF6A 4BK3A 1IUVA 1Y56B 4OPDA 4Y4MA 4XWRA 4DSGA 1LQTA 1D4DA 3DJEA 5BUKA 1E1KA 2IVDA 4NEWA 2YLRA 3H4KA 4H7UA 1H83A 4OPGA 2F5ZA 1PXAA 4CNJA 3GRSA 1P2EA 1GRBA 4Z24A 1L9EA 4IA5A 4K5SA 5FMHA 4B63A 3GYJA 1IUXA 2GAHB 2ZZCA 1VG0A 4H4XA 3CPIG 2H89A 3LZWA 4GR1A 1B8SA 3COXA 3AE5A 1GEUA 2ACZA 2YVFA 1CJCA 2GV8A 1FECA 5FS8A 2X3NA 2YR4A 2E1MA 4HA6A 1XDIA 1FL2A 4CRTA 5HY5A 4GF7A 1L0VA 1LVLA 3GRTA 1CJ2A 2QA1A 1JNRA 3OC4A 1M6IA 5FS6A 1NPXA 3AE2A 3NLCA 4YSYA 2GQFA 1H6VA 3Q6JA 1RP0A 3GDNA 1JRXA 1PN0A 1F6MA 2VVLA 4CY6A 4I58A 1PJ5A 1BZLA 2R9ZA 4C77A 5U1OA 3QFAA 4N9XA 1N4WA 4CY8A 2R4EA 4O5UA 1DOCA 3QSMA 4O5QA 5ER0A 4K8DA 2BCGG 2BK4A 5LV9A 4AOSA 1F8WA 2TMDA 4D03A 2YG4A 1PS9A 2GMJA 1KSSA 5KOXA 1FOHA 4BV6A 1DJNA 3CPJG 3QVPA 3QFBA 1Y0PA 4H2PA 1TDOA 2B9XA 2B76A 1E1NA 2GR3A 1PHHA 4FK1C 4JY3A 3BNUA 1NG4A 1OJ9A 2ZZ0A 2YLTA 2OLNA 1D4EA 4A6NB 2GAGB 1COYA 1CC6A 1JRYA 1ZP0A 4ADWA 4H2RA 4U2LA 1DNCA 2BS2A 3KU9A 1K4QA 3DGHA 3CGBA 1K0LA 4ZN0A 3C4AA 4JY2A 1OJAA 1ZX9A 1RYIA 3BI5A 1TYTA 3BI4A 4AT2A 4A65A 4YSZA 1GTEA 3ITJA 3ZYXA 3URHA 3UKPA 3F8PA 2CDUA 1EL5A 1XHCA 2WQYA 4BK2A 1BGNA 1B37A 3KKJA 4Z25A 5KVIA 4H4YA 1H81A 5TR3A 5JCNA 1PBEA 3ALJA 3GSIA 3CNTA 2CFYA 4J2WA 1D5TA 1QO8A 1JOAA 3AEEA 2YLXA 4USRA 3IF9A 1BWCA 4OPTA 3PVCA 5U63A 1O95A 2BCPA 3NN0X 2A8XA 1H7WA 3UP4A 2XLTA 3S5WA 2BK5A 2I0ZA 2BXRA 2WDVA 1YQ3A 2BC1A 1P2HA 3LB8A 1F3PA 3NYEA 3AD8B 2FJBA 4K5RA 4TM3A 4AT0A 3FMWA 4U8JA 2XFPA 3VRBA 3UTGA 3ATRA 1EBDA 4EMWA 1N4UA 2AQJA 1O5WA 1LTXR 1F8RA 3DMEA 1RSGA 1JRZA 4H50A 4JQ9A 4H2NA 3SQPA 3K7MX 2XLPA 4AP1A 3P4QA 4BK1A 4Y4NA 3BI2A 3NKSA 2Y6RA 3DK8A 3DH9A 2GRTA 1E1LA 3PO7A 2GF3A 3LOVA 5KVHA 1VQWA 3CGCA 4OCGA 3LZXA 1ZMCA 2QAEA 5JCMA 3P9UA 4B1BA 1ZKQA 3NK0X 2Z5YA 4C5OA 4EM4A 3AE6A 3HZLA 2XVIA 3NGCX 2RGJA 4I59A 1FCDA 1GRTA 1AOGA 2H88A 4KX6A 3AYIA 2JKCA 2GEWA 1TDFA 4UP3A 2BYBA 2YLWA 2Q0LA 3LXDA 1PJ7A 1M64A 4HB9A 3FG2P 4B67A 4APNA 3UOXA 3GDPA 2XLUA 2AR8A 2FBWA 4J57A 3DJDA 3FIMB 4Z43A 3KPFA 5IQ4A 3S61A 1PDHA 2BA9A 3UOZA 3REDA 4NTCA 4GDPA 3UKLA 3VRAA 5BVAA 3EANA 4D04A 3AXBA 3AEFA 2WEUA 5GSNA 3NK1X 1QJDA 3DK9A 3ISHA 1S2QA 3BNMA 3AEAA 2XYOA 3CGEA 3AECA 3K30A 4H4VA 5FS9A 4IV9A 3AEDA 2UZZA 1D7LA 2EQ6A 4U2SA 2GVCA 2VZ2A 1ONFA 4H4QA 3UTEA 1DXLA 2GR2A 2GR1A 2BS3A 2C76A 3AEBA 4B68A 2DKHA 2WOVA 3NYFA 3AE8A 4MJWA 4X4JA 2B9WA 2X8HA 3D8XA 1E1MA 3IC9A 3DGZA 2EQ8A 2B7RA 2CVJA 2WOWA 4LU6A 1DOBA 1Y56A 4M52A 1LJ1A 1H7XA 5KWFA 2IIDA 4H4TA 4YTNA 4OVIA 5KOWA 4U8NA 3NYCA 1ZOVA 5BRTA 1YQZA 4RG3A 2JAEA 4LA1A 2B7SA 1L9DA 1H86A 4NZHA 3AD7B 3RP7A 4NEVA 2C66A 5U25A 2J3NA 2YVGA 5JCLA 2BABA 2IVEA 2FJDA 5L46A 2YVJA 4OPCA 2NPXA 2VOUA 3CNPA 3T37A 4U8OA 2YR5A 4IVMB 3I6DA 1ZOYA 3JSKA 2WP6A 3ATQA 2V5ZA 3F8DA 4A79A 1PXBA 1NHPA 3AWIA 4U8LA 3NG7X 1NAAA 3VQRA 2BK3A 3UKAA
chains in the Genus database with same CATH superfamily
4H2QA 3LJPA 1S3EA 2C3DA 2E4GA 3PWGA 4EQWA 1PBBA 2V61A 2OALA 3CTYA 4U2TA 4TLZA 4BJYA 1N61C 3Q4DA 1GPEA 4A6GA 1Q9IA 4U8IA 2OFJA 2R0PA 3G5SA 1NU5A 2VRMA 1CL0A 4DYEA 4FX9A 1EL8A 3CT2A 4E5TA 3D46A 5EBKA 4YSXA 4GRTA 1XPYA 4YWOA 2P0IA 1NDAA 2GMHA 4H4SA 4IL0A 1PBDA 3DA1A 1KKRA 4EMJA 4EQSA 3SQSA 1KNRA 2R46A 2WU2A 4UDQA 1GV4A 1F9CA 4HCHA 2R0CA 4G6GA 4E0VA 4JN7A 2FKPA 3E1TA 2JB2A 2DKIA 4UDRA 2HXUA 4H2HA 4Z26A 1ZMDA 5CKUA 2C7GA 4YKFA 2YG6A 1GETA 4EMIA 1JPDX 3ETRB 4B65A 2C72A 2C75A 1SB3B 3GD3A 1FEBA 2X99A 2XVHA 1KNPA 4M0XA 1GRFA 2WPFA 1PDYA 2V60A 3D1CA 3SZCA 3MUCA 3ZLGA 3ZDNA 2APGA 3UCCA 3M12A 3SFDA 4K2XA 2P8BA 4J56A 3AE3A 3GMCA 2GGGA 1CF3A 3NNEA 3FVDA 1ECQA 2OZ3A 4H83A 3AE4A 3IHMA 5ENLA 2XFUA 3K7QX 2V6OA 2WU5A 3C96A 2GGEA 3NIXA 3I6EA 2XDOA 2E5AA 2QJJA 4A9WA 3ADAB 1E6EA 1CJ4A 1Q1WA 2OPJA 3GY1A 4J34A 4A6NA 3NH3X 5KXJA 1K0JA 2YG3A 2Z5XA 4Z2UA 2WBAA 4J31A 1GSNA 3NVVB 3IHGA 4HCLA 4GAPA 1NHSA 3OZ2A 4TM4A 2DW7A 1REOA 3L1RA 3VC5A 3DJGX 1CC2A 3T2YA 4JNQA 3GD4A 4BJZA 4X9NA 1GESA 3F8RA 2ARDA 2P3ZA 4ZCCA 3MSYA 3CK5A 5M0ZA 2OLOA 4DXKA 5J60A 3UCLA 4YXDA 3AEGA 3IJLA 2VQ7A 1IUSA 5DBJA 1MOKA 4GFIA 3MZNA 2VQBA 3UJFA 4DSGA 2IVDA 4NEWA 2F5ZA 4H19A 1P2EA 1GRBA 3I4KA 4K5SA 4B63A 1IUXA 2GAHB 1VG0A 3CPIG 3LZWA 1B8SA 4HA6A 1FECA 1FO4A 4CRTA 5HY5A 4GF7A 1PN0A 4CY6A 3ES7A 2R9ZA 4N9XA 5ER0A 4K8DA 2TMDA 1PS9A 2GMJA 1DJNA 3QVPA 1TDOA 2B9XA 2B76A 1PHHA 4FK1C 3BNUA 4YWSA 2PU0A 2OLNA 3SX6A 2GAGB 1CC6A 1JRYA 1ZP0A 5FJPA 1DNCA 2BS2A 2OKTA 1RYIA 3UJRA 4AT2A 3R0KA 4A65A 4YSZA 1GTEA 3HYVA 3ITJA 4NWZA 3F8PA 2CDUA 1XHCA 3KKJA 3A7RA 2GSHA 1PBEA 3AM9A 4J2WA 3CNTA 1QO8A 1JOAA 3IF9A 3SSZA 4OPTA 3PVCA 1O95A 3NN0X 3DGBA 3S5WA 2BC1A 1P2HA 3N4EA 3LB8A 4K5RA 2FJBA 5KMRA 4G7FA 4IHCA 2XH0A 2AQJA 1O5WA 1LTXR 2W55A 4H50A 4Z1YA 4AP1A 3P4QA 2GRTA 3LOVA 3TJ4A 3LZXA 3P9UA 4C5OA 2RGJA 3JW7A 3AYIA 3DG3A 3DG6A 2BYBA 3UJSA 2Q0LA 1PJ7A 4HB9A 4APNA 2FBWA 4J57A 4Z43A 3FIMB 5IQ4A 3DDMA 2AL2B 3FYYA 3UOZA 3VRAA 3R0UA 3EANA 3AXBA 5GSNA 3NK1X 3TQPA 1QJDA 3QTPA 1S2QA 2XYOA 3CGEA 3AECA 3K30A 4IV9A 3VA8A 2UZZA 1D7LA 2EQ6A 2GVCA 1ONFA 4B68A 3AEBA 2WOVA 4X4JA 4II2A 2QDDA 2XH4A 2EQ8A 2B7RA 4G8TA 1DOBA 1H7XA 4DHGA 4YTNA 5KOWA 4KEMA 3NVZB 5BRTA 1YQZA 3QKEA 2B7SA 3AD7B 4NEVA 5U25A 2YVGA 5JCLA 5L46A 2YVJA 4U8OA 2OO6A 2MNRA 3I6DA 3RR1A 2WP6A 3ATQA 4A79A 3DFHA 1NHPA 3B97A 1SJBA 3T6CA 1GXFA 1D7YA 3PK7A 4Z44A 7ENLA 3KLJA 2WOIA 2X50A 5JRBA 4C3XA 4EQXA 3P4SA 1KSUA 3ICRA 3AB1A 2PTYA 3RCYA 2GGJA 4U8KA 1S3BA 4YTMA 3NK2X 1JRPA 1LPFA 1IUTA 2A87A 4NTEA 4X2PA 3CNSA 1H2IA 1KD0A 4GAVA 5C3JA 3NVWB 3I3LA 1GALA 3MY9A 2XLSA 3AYJA 2QDEA 3AE1A 2XVEA 3NTAA 4KPRA 4A7AA 3K7TA 1EC7A 2W54A 3NVYB 1ELSA 1PJ6A 4Y4LA 2OA1A 3T2ZA 2WDRA 3HYWA 3SY4A 1ZY8A 3R1ZA 3AYLA 2GB0A 4X9MA 2V3BA 2XVFA 1CJ3A 3ZLHA 3VRDB 4PAAA 1GERA 2RGOA 1ONEA 3L5OA 3R9UA 2AAQA 2PP3A 4DWDA 3RGTA 2ZZBA 3VFCA 1L9CA 1N1PA 1BF3A 4E8GA 2CULA 4II3A 3OP2A 4TM1A 3UKHA 4GYPC 4ZCDA 1FFUC 2PHHA 3CNDA 4ICYA 1E39A 1CHUA 3R07C 4F4RA 3K1GA 3AMZA 5EOWA 4GIRA 1YQ4A 2C64A 4IL2A 3T14A 1MO9A 1ZDLA 1W4XA 5HYMA 5C2TA 3O0HA 3SR6B 3HPFA 1JDFA 2ZC8A 1E9IA 2JK6A 3KVEA 4IZGA 1KDGA 3NRNA 1CBOA 1NG3A 3UXLA 3RNMA 1VRQB 3RP8A 2YWLA 4LIIA 4FK1A 2WPCA 4FI4A 4TVWA 1YKJA 2P8CA 3VR8A 1TDKA 3AE9A 4U8PA 1DODA 1YY5A 2WP9A 1QLBA 5IPYA 4B64A 1P48A 4UDPA 4XWZA 4H4UA 5HHFA 5KNLA 3ZVIA 3GMBA 4YT0A 4H4RA 4ZA0A 2X8GA 2Q6UA 2P88A 3T4WA 1XS2A 3CXBA 2HZGA 4GCMA 2OLAA 3QN3A 5J7XA 4WCTA 4YKGA 4USQA 3P4PA 3CMMA 1N5WC 1JEHA 1D4CA 3V3WA 2PPGA 3KD9A 3V3NA 1O94A 1NEKA 4JN9A 4GDEA 5EB5A 3BHKA 3ENLA 3DG7A 5BUKA 3BJSA 3H4KA 2AL2A 2OG9A 1PXAA 4Z24A 3PWIA 4JN8A 3HW2A 4H1ZA 2X3NA 2E1MA 1FL2A 1LVLA 3OC4A 3NLCA 3N4FA 1P43A 2GQFA 3GDNA 1JRXA 2O56A 4I58A 3U9IA 1BZLA 3SN0A 4CY8A 4O5UA 1DOCA 3QSMA 2BCGG 5LV9A 4AOSA 2YG4A 4BV6A 1FIQB 3CPJG 4GGHA 4H2PA 1WYGA 4GISA 3A7AA 4HNLA 1K4QA 3DGHA 3SXIA 4ZN0A 3H7VA 1ZX9A 1TYTA 4FP1A 3ZYXA 3URHA 3UKPA 1EL5A 1B37A 4H4YA 1H81A 3SZ0A 3GSIA 5EU9A 3NXLA 2A8XA 3NRZB 1OEPA 5BOEA 2BXRA 1FFVC 3T0KA 3NYEA 3NS1B 4EMWA 4E6MA 1F8RA 3SQPA 3K7MX 2GGHA 4Y4NA 3NKSA 1MUCA 2Y6RA 3DK8A 1E1LA 2GF3A 4OCGA 1VQWA 4B1BA 5JCMA 1ZKQA 2Z5YA 3HZLA 4G74A 1GRTA 1AOGA 3EEZA 1M64A 3GDPA 2W3RA 3S61A 1RVKA 4NTCA 5BVAA 3AEFA 2PS2A 2OZTA 2POZA 3ISHA 4G73A 3AEDA 4U2SA 2HNEA 2GR2A 2DKHA 3AE8A 4MMWA 3PG6A 3D8XA 3CB3A 1R6WA 2CVJA 2WOWA 1Y56A 4M52A 3SJNA 4U8NA 1N63C 4GYPA 4NZHA 3RP7A 2C66A 2J3NA 2PP1A 2IVEA 2FJDA 4OPCA 2NPXA 3JSKA 1STZA 3P0WA 1VQZA 4U8LA 3NG7X 3VQRA 3UKAA 5KMPA 1PBFA 2MUCA 3H8LA 3UTHA 3AE7A 3FXGA 4P9SA 1H84A 2JBVA 1EBGA 1MDRA 2OZ8A 4CCQA 2TPRA 4IP5A 1NENA 4HYRA 2X8CA 1Q1RA 1ELIA 3LADA 3QJ4A 1FEAA 4OPUA 1IUUA 5M10A 3D9XA 3QLDA 4RG4A 1V59A 1EL7A 2HQMA 3STPA 2GR0A 2AL1A 2CHRA 3DEQA 2HXTA 3FCPA 2GH5A 3UOYA 3H8IA 2R0GA 4H4PA 4CNKA 1GRAA 3UKQA 3VCCA 5FS7A 3CAWA 5FJOA 5CQFA 3M0OA 3NTDA 1LV0A 2QJNA 3UKFA 3SM8A 2YAUA 3T31A 3UGVA 3VCNA 1ZK7A 1B4VA 2C73A 2W0HA 4YSHA 4OPIA 1KKOA 1EL9A 4G6HA 1NHRA 3BHFA 3GO2A 1MRAA 4BURA 4IVOB 2PYXA 3DJJA 3CIRA 3P4RA 4H4WA 3RHAA 1JCTA 1IJHA 4AP3A 4MGGA 1NELA 3OPSA 3VR9A 1PXCA 3GYXA 4XXGA 5J04A 2EQ7A 3I6TA 3GYIA 2XH7A 1KF6A 1X31B 2YG5A 3QSEA 1L8PA 2WETA 3QVRA 3B3RA 3WE0A 2O9ZA 4HNCA 3GWDA 1SJAA 4IA6A 3ICTA 3JVAA 5BULA 3P3BA 2FJEA 3RP6A 2PCEA 3MKCA 3UKKA 3CYJA 1CC4A 3AN1A 1ZXIC 4B66A 2E3TA 3SN1A 3RO6A 4EM3A 5KMSA 2OQYA 4KT2A 1GT8A 2VVLG 3IK4A 4H4ZA 2PP0A 4DX3A 2WP5A 2R45A 4AOXA 3PS9A 1BKWA 2B9YA 4A5LA 2GL5A 2JB1A 3V76A 4CBQA 4TLXA 2RGHA 3SN4A 3ALLA 1WUEA 4ROPA 2I5QA 3D47A 4U8MA 4J33A 1LQUA 4M6UA 3KA7A 3A7UA 3II4A 3B6DA 4Z17A 2OX4A 1NHQA 2Q7VA 4G9KA 3GD6A 4FDCB 1X2GA 3IWAA 5GRTA 2FJAA 1TZZA 3R11A 2XCGA 1EC9A 4JDRA 4EQRA 2Q0KA 1DTNA 2YQUA 3ES8A 5KRQA 1BGJA 3ZLFA 1OJCA 4B69A 2C67A 2ZBWA 1GTHA 4DGKA 2OAMA 4C74A 3T9PA 3Q9TA 2WPEA 4EIPA 4KPLA 5IDZA 2R4JA 3UXKA 2YLSA 1DJQA 2VVMA 3RRAA 3EF6A 1IUVA 1Y56B 3NZGA 4Y4MA 1LQTA 1D4DA 4H7UA 4OPGA 1H83A 4CNJA 3GRSA 1JROA 5FMHA 3GYJA 4H4XA 3OTRA 3THUA 3COXA 3AE5A 2ACZA 4IT1A 2YR4A 2GV8A 1XDIA 1CJ2A 1M6IA 3AE2A 1NPXA 3UCDA 4YSYA 3OW1A 3Q6JA 3H12A 2NQLA 1PJ5A 2PU1A 4C77A 2RDXA 3QFAA 2R4EA 4D03A 3DERA 3VDGA 1Y0PA 1E1NA 2GR3A 1NG4A 1OJ9A 1PDZA 3UJEA 3U4FA 1COYA 4H2RA 4U2LA 1K0LA 1OJAA 2ZADA 3IJQA 4HCDA 1N5XA 2QVHA 3V4BA 1BQGA 2WQYA 1T3QC 3QPEA 5KVIA 6ENLA 3V5FA 3ALJA 1EBHA 3NO1A 5U63A 2BCPA 1H7WA 2XLTA 3HYXA 2WDVA 1YQ3A 1KCZA 1F3PA 3AD8B 4TM3A 1SJCA 2XFPA 3VRBA 3ATRA 1N4UA 3DMEA 1RSGA 1JRZA 4JQ9A 4A35A 2XLPA 4BK1A 1BKHA 3BI2A 3DH9A 3PO7A 3RITA 1ZMCA 3NK0X 4EM4A 3AE6A 1N60C 3NGCX 4I59A 3OZMA 2JKCA 3NFUA 2XSXA 2GEWA 3OZYA 3FG2P 4ZCWA 3UOXA 4B67A 1FHVA 2OQHA 2XLUA 3DJDA 3KPFA 1PDHA 2BA9A 3REDA 4GDPA 3UKLA 5FJRA 3H70A 3DK9A 3BNMA 3AEAA 2QQ6A 2PODA 3UTEA 1TKKA 1DXLA 2C76A 2GR1A 2BS3A 3NYFA 2B9WA 2X8HA 3DGZA 1YEYA 4OVIA 3NYCA 4NNJA 2PTWA 4RG3A 4JHMA 3BOXA 2BABA 2VOUA 3CNPA 3T37A 2YR5A 5G5GB 1ZOYA 3F8DA 3FV9A 2W3SA 1PXBA 3AWIA 1NAAA 2BK3A 5BOFA 1XPQA 2VRLA 3SZFA 1MXTA 3EKGA 5EB4A 2YM1A 3TWAA 1TDEA 1VDCA 2QJMA 2BS4A 3EUB3 3CN8A 3ICSA 2FYMA 1K0IA 1GNDA 3EPTA 1OJTA 2RABA 3P1WA 1IYXA 3QSSA 3CNJA 4DNAA 3N6HA 1TYPA 1VG9A 2C4CA 4GMEA 2WS3A 1JU2A 2QA2A 2XFNA 2BRAA 5G5HB 1SEZA 3AD9B 2OVLA 3TWBA 1JPMA 4J1OA 3ZVHB 5JCKA 4HN8A 3TJIA 3UOVA 2EQ9A 2C3CA 1KN0A 1OJDA 1EC8A 2C70A 2Y6QA 2XVJA 3KUMA 1KFYA 2BC0A 4K22A 2JB3A 3V3OA 4Z2TA 4OPLA 1W6TA 3CPHG 2C65A 4A99A 3UP5A 4Z2RA 4K1WA 1TRBA 4PABA 1XANA 2A89A 3TOYA 4E4UA 1UKVG 3NN6X 1MDLA 5JCIA 3G5QA 4C3YA 1JNZA 1V97A 4YTPA 2XLRA 1HYUA 1B5QA 2YM2A 4K7ZA 2WESA 1DOEA 2QCUA 3UTFA 3CGDA 3C4NA 2ONEA 4K8GA 1TDNA 3NT6A 1IUWA 3M13A 2GQWA 3L8KA 2NVKX 4ECHA 1GRGA 4CCRA 4J36A 2WHDA 1GREA 5IQ1A 3T8QA 5HXIA 3IJIA 3G5RA 3UJ2A 4IP4A 3SBFA 3P93A 4TM0A 2PSNA 4RSLA 2YLZA 3SGLA 3FBSA 2XFOA 4WX1A 3DK4A 2E5VA 4MKSA 3MWCA 3GWFA 3B9JB 3TCSA 5FJTA 1F8SA 4GUVA 3H8AA 2YR6A 4NTDA 1S2YA 2XFQA 3BSMA 1Z6LA 2WDQA 1MNSA 1GOSA 3HRDC 4E4FA 3EAOA 3N6JA 3SYIA 3VC6A 2GGIA 3NHOX 3ABVA 3Q45A 2AKMA 1PBCA 2V3AA 1RM6B 4JNAA 1H82A 4REKA 1R0MA 2XH2A 1N4VA 2YG7A 2BXSA 3CXOA 3SFEA 3GC2A 1E7PA 3ALMA 1N62C 2BRYA 4EIQA 1GRHA 4DSHA 2BACA 3FPZA 2PGWA 4BK3A 4OPDA 4XWRA 3DJEA 2XGZA 1E1KA 2YLRA 4TVYA 1L9EA 4IA5A 3PFRA 1VDVA 2ZZCA 2H89A 4GR1A 1GEUA 2YVFA 1CJCA 5FS8A 1L0VA 3GRTA 2QA1A 1JNRA 5FS6A 1H6VA 2PTZA 1RP0A 1F6MA 2VVLA 5U1OA 1N4WA 4O5QA 2BK4A 1F8WA 1KSSA 1TE6A 5KOXA 1FOHA 3S5SA 3QFBA 2PMQA 4JY3A 3JZUA 2ZZ0A 2YLTA 1D4EA 3SZWA 4A6NB 2PTXA 4ADWA 5FJUA 3KU9A 4ZOHB 3CGBA 3TTEA 3C4AA 4JY2A 3BI5A 3BI4A 4A3RA 3KPKA 1FHUA 3T2KA 1X2HA 4BK2A 1BGNA 3DIPA 2GDQA 4Z25A 5TR3A 5JCNA 2CFYA 1D5TA 2PGEA 3AEEA 2YLXA 4USRA 1BWCA 3MQTA 4EWJA 3UP4A 2BK5A 2I0ZA 4AT0A 3FMWA 4U8JA 4HPNA 3UTGA 3R10A 1EBDA 4H2NA 5KVHA 3CGCA 5KMQA 2QAEA 2XVIA 1FCDA 3ZVHA 3TW9A 2H88A 4KX6A 4ENLA 4UP3A 1TDFA 2YLWA 3LXDA 2PA6A 2AR8A 2QGYA 1WUFA 4DN1A 4D04A 3R25A 2WEUA 4H4VA 5FS9A 2VZ2A 4H4QA 1S7MA 4MJWA 2AKZA 1E1MA 3IC9A 3DFYA 4LU6A 5KWFA 1LJ1A 2IIDA 4H4TA 1SJDA 1ZOVA 3S47A 3DESA 4GGBA 4LA1A 2JAEA 1L9DA 1H86A 3FJ4A 4J3ZA 4K2SA 4KWSA 4IVMB 3V5CA 2V5ZA 2DW6A
chains in the Genus database with same CATH topology
4H2QA 1GXFA 1D7YA 1PBFA 2C3DA 1S3EA 1XPQA 3H8LA 3LJPA 4Z44A 2VRLA 3UTHA 3KLJA 2WOIA 2E4GA 3AE7A 2X50A 4P9SA 5JRBA 1H84A 2JBVA 4EQXA 4EQWA 4C3XA 3P4SA 3SZFA 1KSUA 1PBBA 3ICRA 2V61A 1MXTA 3AB1A 4CCQA 2OALA 3CTYA 4U2TA 4TLZA 5EB4A 4BJYA 2YM1A 2TPRA 4U8KA 1NENA 1TDEA 1VDCA 2BS4A 1S3BA 2X8CA 1Q1RA 1GPEA 1ELIA 3LADA 3CN8A 3QJ4A 4YTMA 3ICSA 3NK2X 1FEAA 4OPUA 1IUUA 5M10A 3D9XA 1Q9IA 4U8IA 1K0IA 1GNDA 1LPFA 1V59A 3EPTA 4RG4A 1IUTA 1EL7A 1OJTA 2RABA 2R0PA 3P1WA 3G5SA 2A87A 2HQMA 4NTEA 2VRMA 1CL0A 3QSSA 2GR0A 4FX9A 3CNSA 3CNJA 1H2IA 4DNAA 1TYPA 4GAVA 1EL8A 1VG9A 5C3JA 3I3LA 2C4CA 3UOYA 2GH5A 1GALA 5EBKA 3H8IA 3AYJA 2WS3A 2XLSA 4YSXA 1JU2A 2QA2A 2XFNA 4GRTA 3AE1A 2R0GA 2XVEA 3NTAA 4KPRA 2BRAA 1SEZA 4H4PA 4YWOA 3AD9B 4A7AA 4CNKA 3K7TA 1GRAA 1NDAA 3UKQA 2GMHA 4H4SA 5JCKA 5FS7A 1PBDA 3DA1A 5CQFA 1PJ6A 3M0OA 3NTDA 4Y4LA 2OA1A 4EMJA 4EQSA 1KNRA 2R46A 1LV0A 2EQ9A 2WDRA 2WU2A 2C3CA 4UDQA 3T2ZA 3HYWA 1KN0A 3SM8A 2YAUA 3T31A 1OJDA 3UKFA 3SY4A 1GV4A 1ZY8A 1ZK7A 1B4VA 2C73A 2R0CA 3AYLA 4G6GA 2C70A 2W0HA 2GB0A 4YSHA 2Y6QA 4X9MA 2V3BA 4E0VA 4OPIA 2XVFA 1CJ3A 1EL9A 2XVJA 3E1TA 4G6HA 2JB2A 1KFYA 2DKIA 4UDRA 1NHRA 2BC0A 3BHFA 4K22A 5KMPA 3VRDB 4PAAA 4BURA 2JB3A 4IVOB 4Z26A 3V3OA 1GERA 4Z2TA 2PYXA 1ZMDA 4OPLA 3CPHG 2C65A 3DJJA 3CIRA 5CKUA 3P4RA 4H4WA 2C7GA 2RGOA 4A99A 3UP5A 4YKFA 2YG6A 3RHAA 3L5OA 3R9UA 1GETA 2AAQA 4EMIA 1IJHA 4Z2RA 4AP3A 4B65A 1TRBA 2C72A 4PABA 1XANA 2ZZBA 2A89A 1PXCA 3VR9A 3GYXA 4XXGA 2EQ7A 2C75A 1UKVG 3GYIA 1L9CA 3NN6X 1X31B 5JCIA 3GD3A 1KF6A 1N1PA 3G5QA 2YG5A 3QSEA 1BF3A 2CULA 4II3A 4TM1A 4C3YA 2WETA 3UKHA 1JNZA 4YTPA 4ZCDA 1FEBA 2XLRA 2PHHA 1HYUA 1B5QA 3QVRA 3B3RA 2X99A 3WE0A 2XVHA 2YM2A 1E39A 2O9ZA 1CHUA 1KNPA 3CNDA 3GWDA 4ICYA 1GRFA 4K7ZA 2WPFA 3UOVA 4IA6A 3ICTA 2WESA 5BULA 2V60A 2FJEA 1DOEA 3D1CA 5EOWA 3RP6A 2QCUA 3SZCA 3UTFA 3CGDA 3UKKA 3ZDNA 1CC4A 2APGA 1YQ4A 3C4NA 3M12A 2C64A 3SFDA 4B66A 1TDNA 3NT6A 4K2XA 4EM3A 4J56A 1MO9A 3T14A 5KMSA 1IUWA 3AE3A 1ZDLA 1GT8A 2GQWA 3GMCA 1W4XA 3M13A 5HYMA 1CF3A 3L8KA 2NVKX 2VVLG 3NNEA 4ECHA 5C2TA 3AE4A 1GRGA 3IHMA 3O0HA 2XFUA 4H4ZA 4CCRA 4J36A 2WHDA 1GREA 3K7QX 5IQ1A 2JK6A 2V6OA 2WU5A 3KVEA 3C96A 2WP5A 1KDGA 3NRNA 1CBOA 1NG3A 5HXIA 3NIXA 2R45A 3G5RA 3RNMA 2XDOA 4AOXA 1VRQB 3RP8A 3PS9A 1BKWA 2B9YA 2YWLA 4TM0A 4LIIA 4A5LA 4FK1A 4RSLA 2WPCA 2JB1A 3V76A 3ADAB 4A9WA 1E6EA 4CBQA 4TLXA 1YKJA 1CJ4A 1Q1WA 2YLZA 3SGLA 4J34A 3FBSA 4A6NA 2RGHA 2XFOA 3NH3X 3ALLA 4WX1A 3DK4A 1TDKA 2E5VA 3VR8A 5KXJA 1K0JA 2YG3A 3AE9A 4U8PA 2Z5XA 4Z2UA 2WBAA 1DODA 1YY5A 4J31A 3GWFA 1F8SA 1GSNA 1QLBA 2WP9A 2YR6A 3IHGA 4GUVA 4NTDA 1S2YA 4GAPA 4J33A 1NHSA 2XFQA 4U8MA 1LQUA 1Z6LA 3OZ2A 4TM4A 3L1RA 1REOA 5IPYA 2WDQA 3KA7A 3II4A 3B6DA 4B64A 4UDPA 3DJGX 1GOSA 1CC2A 1NHQA 4JNQA 4XWZA 3T2YA 4H4UA 2Q7VA 4G9KA 5HHFA 4FDCB 3EAOA 3GD4A 4BJZA 5KNLA 4YT0A 3GMBA 3SYIA 3IWAA 4H4RA 5GRTA 2FJAA 3NHOX 2X8GA 3ABVA 2Q6UA 4X9NA 1GESA 3F8RA 2XCGA 2ARDA 1PBCA 4GCMA 2V3AA 4ZCCA 5M0ZA 2OLOA 4JDRA 4EQRA 2Q0KA 2YQUA 4JNAA 1H82A 5KRQA 1BGJA 4REKA 5J7XA 1N4VA 5J60A 2YG7A 2BXSA 1OJCA 3UCLA 4B69A 2C67A 2ZBWA 4WCTA 1GTHA 4YKGA 4USQA 3SFEA 4YXDA 3P4PA 3CMMA 4DGKA 1JEHA 1D4CA 1E7PA 2OAMA 3ALMA 4C74A 3Q9TA 2WPEA 3AEGA 4EIPA 2BRYA 4EIQA 1GRHA 2VQ7A 1IUSA 3KD9A 1O94A 3V3NA 4DSHA 1NEKA 2BACA 2R4JA 4JN9A 4GDEA 5EB5A 5DBJA 2YLSA 1MOKA 1DJQA 2VVMA 3BHKA 3FPZA 2VQBA 3EF6A 4BK3A 1IUVA 1Y56B 4OPDA 4Y4MA 4XWRA 4DSGA 1LQTA 1D4DA 3DJEA 5BUKA 1E1KA 2IVDA 4NEWA 2YLRA 3H4KA 4H7UA 1H83A 4OPGA 2F5ZA 1PXAA 4CNJA 3GRSA 1P2EA 1GRBA 4Z24A 1L9EA 4IA5A 4K5SA 5FMHA 4B63A 3GYJA 1IUXA 2GAHB 2ZZCA 1VG0A 4H4XA 3CPIG 2H89A 3LZWA 4GR1A 1B8SA 3COXA 3AE5A 1GEUA 2ACZA 2YVFA 1CJCA 2GV8A 1FECA 5FS8A 2X3NA 2YR4A 2E1MA 4HA6A 1XDIA 1FL2A 4CRTA 5HY5A 4GF7A 1L0VA 1LVLA 3GRTA 1CJ2A 2QA1A 1JNRA 3OC4A 1M6IA 5FS6A 1NPXA 3AE2A 3NLCA 4YSYA 2GQFA 1H6VA 3Q6JA 1RP0A 3GDNA 1JRXA 1PN0A 1F6MA 2VVLA 4CY6A 4I58A 1PJ5A 1BZLA 2R9ZA 4C77A 5U1OA 3QFAA 4N9XA 1N4WA 4CY8A 2R4EA 4O5UA 1DOCA 3QSMA 4O5QA 5ER0A 4K8DA 2BCGG 2BK4A 5LV9A 4AOSA 1F8WA 2TMDA 4D03A 2YG4A 1PS9A 2GMJA 1KSSA 5KOXA 1FOHA 4BV6A 1DJNA 3CPJG 3QVPA 3QFBA 1Y0PA 4H2PA 1TDOA 2B9XA 2B76A 1E1NA 2GR3A 1PHHA 4FK1C 4JY3A 3BNUA 1NG4A 1OJ9A 2ZZ0A 2YLTA 2OLNA 1D4EA 3SZWA 4A6NB 3SX6A 2GAGB 1COYA 1CC6A 1JRYA 1ZP0A 4ADWA 4H2RA 4U2LA 1DNCA 2BS2A 3KU9A 1K4QA 3DGHA 3CGBA 1K0LA 3SXIA 4ZN0A 3C4AA 4JY2A 1OJAA 1ZX9A 1RYIA 3BI5A 1TYTA 3BI4A 4AT2A 4A65A 4YSZA 1GTEA 3HYVA 3ITJA 3KPKA 3T2KA 3URHA 4NWZA 3ZYXA 3UKPA 3F8PA 2CDUA 1EL5A 1XHCA 2WQYA 4BK2A 1BGNA 1B37A 3KKJA 4Z25A 5KVIA 4H4YA 1H81A 5TR3A 5JCNA 3SZ0A 1PBEA 3ALJA 3GSIA 3CNTA 2CFYA 4J2WA 1D5TA 1QO8A 1JOAA 3AEEA 2YLXA 4USRA 3IF9A 1BWCA 4OPTA 3PVCA 5U63A 1O95A 2BCPA 3NN0X 2A8XA 1H7WA 3UP4A 2XLTA 3S5WA 2BK5A 2I0ZA 3HYXA 2BXRA 2WDVA 1YQ3A 2BC1A 1P2HA 3LB8A 3T0KA 1F3PA 3NYEA 3AD8B 2FJBA 4K5RA 4TM3A 4AT0A 3FMWA 5KMRA 4U8JA 2XFPA 3VRBA 3UTGA 3ATRA 1EBDA 4EMWA 1N4UA 2AQJA 1O5WA 1LTXR 1F8RA 3DMEA 1RSGA 1JRZA 4H50A 4JQ9A 4H2NA 3SQPA 3K7MX 2XLPA 4AP1A 3P4QA 4BK1A 4Y4NA 3BI2A 3NKSA 2Y6RA 3DK8A 3DH9A 2GRTA 1E1LA 3PO7A 2GF3A 3LOVA 5KVHA 1VQWA 3CGCA 4OCGA 3LZXA 1ZMCA 2QAEA 5JCMA 3P9UA 5KMQA 4B1BA 1ZKQA 3NK0X 2Z5YA 4C5OA 4EM4A 3AE6A 3HZLA 2XVIA 3NGCX 4G74A 2RGJA 4I59A 1FCDA 1GRTA 1AOGA 2H88A 4KX6A 3AYIA 2JKCA 2GEWA 1TDFA 4UP3A 2BYBA 2YLWA 2Q0LA 3LXDA 1PJ7A 1M64A 4HB9A 3FG2P 4B67A 4APNA 3UOXA 3GDPA 2XLUA 2AR8A 2FBWA 4J57A 3DJDA 3FIMB 4Z43A 3KPFA 5IQ4A 3S61A 1PDHA 2BA9A 3UOZA 3REDA 4NTCA 4GDPA 3UKLA 3VRAA 5BVAA 3EANA 4D04A 3AXBA 3AEFA 2WEUA 5GSNA 3NK1X 1QJDA 3DK9A 3ISHA 1S2QA 3BNMA 3AEAA 2XYOA 3CGEA 3AECA 3K30A 4H4VA 5FS9A 4G73A 4IV9A 3AEDA 2UZZA 1D7LA 2EQ6A 4U2SA 2GVCA 2VZ2A 1ONFA 4H4QA 3UTEA 1DXLA 2GR2A 2GR1A 2BS3A 2C76A 3AEBA 4B68A 2DKHA 1S7MA 2WOVA 3NYFA 3AE8A 4MJWA 4X4JA 2B9WA 3PG6A 2X8HA 3D8XA 4II2A 1E1MA 3IC9A 3DGZA 2EQ8A 2B7RA 2CVJA 2WOWA 4LU6A 1DOBA 1Y56A 4M52A 1LJ1A 1H7XA 5KWFA 2IIDA 4H4TA 4YTNA 4OVIA 5KOWA 4U8NA 3NYCA 4NNJA 1ZOVA 5BRTA 1YQZA 4RG3A 2JAEA 4LA1A 2B7SA 1L9DA 1H86A 4NZHA 3AD7B 3RP7A 4NEVA 2C66A 5U25A 2J3NA 2YVGA 5JCLA 2BABA 2IVEA 2FJDA 5L46A 2YVJA 4OPCA 2NPXA 2VOUA 3CNPA 3T37A 4U8OA 2YR5A 4IVMB 3I6DA 1ZOYA 3JSKA 2WP6A 3ATQA 2V5ZA 3F8DA 4A79A 1PXBA 1NHPA 3AWIA 4U8LA 3NG7X 1NAAA 3VQRA 2BK3A 3UKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2Q A;  1GXF A;  1D7Y A;  1PBF A;  2C3D A;  1S3E A;  1XPQ A;  3H8L A;  3LJP A;  4Z44 A;  2VRL A;  3UTH A;  3KLJ A;  2WOI A;  2E4G A;  3AE7 A;  2X50 A;  4P9S A;  1H84 A;  2JBV A;  4EQX A;  4EQW A;  4C3X A;  3P4S A;  1KSU A;  1PBB A;  3ICR A;  2V61 A;  1MXT A;  3AB1 A;  4CCQ A;  2OAL A;  3CTY A;  4U2T A;  4TLZ A;  5EB4 A;  4BJY A;  2YM1 A;  2TPR A;  4U8K A;  1NEN A;  1TDE A;  1VDC A;  2BS4 A;  1S3B A;  2X8C A;  1Q1R A;  1GPE A;  1ELI A;  3LAD A;  3CN8 A;  3QJ4 A;  4YTM A;  3ICS A;  3NK2 X;  1FEA A;  4OPU A;  1IUU A;  5M10 A;  1Q9I A;  4U8I A;  1K0I A;  1GND A;  1LPF A;  1V59 A;  3EPT A;  4RG4 A;  1IUT A;  1EL7 A;  1OJT A;  2RAB A;  2R0P A;  3P1W A;  3G5S A;  2A87 A;  2HQM A;  4NTE A;  2VRM A;  1CL0 A;  3QSS A;  2GR0 A;  4FX9 A;  3CNS A;  3CNJ A;  4DNA A;  1TYP A;  1EL8 A;  1VG9 A;  5C3J A;  3I3L A;  3UOY A;  2GH5 A;  1GAL A;  5EBK A;  3H8I A;  3AYJ A;  2WS3 A;  2XLS A;  4YSX A;  1JU2 A;  2QA2 A;  2XFN A;  4GRT A;  3AE1 A;  2R0G A;  2XVE A;  3NTA A;  4KPR A;  1SEZ A;  4H4P A;  4YWO A;  3AD9 B;  4A7A A;  4CNK A;  3K7T A;  1GRA A;  1NDA A;  3UKQ A;  2GMH A;  4H4S A;  5JCK A;  5FS7 A;  1PBD A;  3DA1 A;  5CQF A;  1PJ6 A;  3M0O A;  3NTD A;  4Y4L A;  2OA1 A;  4EMJ A;  4EQS A;  1KNR A;  2R46 A;  1LV0 A;  2EQ9 A;  2WDR A;  2WU2 A;  2C3C A;  4UDQ A;  3UKF A;  3SM8 A;  2YAU A;  1OJD A;  1GV4 A;  1ZY8 A;  1ZK7 A;  1B4V A;  2C73 A;  2R0C A;  3AYL A;  2C70 A;  2W0H A;  2GB0 A;  4YSH A;  2Y6Q A;  4X9M A;  2V3B A;  4E0V A;  4OPI A;  2XVF A;  1CJ3 A;  1EL9 A;  2XVJ A;  3E1T A;  2JB2 A;  1KFY A;  2DKI A;  4UDR A;  1NHR A;  2BC0 A;  3BHF A;  4K22 A;  3VRD B;  4PAA A;  4BUR A;  2JB3 A;  4IVO B;  4Z26 A;  3V3O A;  1GER A;  4Z2T A;  2PYX A;  1ZMD A;  4OPL A;  3CPH G;  2C65 A;  3DJJ A;  3CIR A;  5CKU A;  3P4R A;  4H4W A;  2C7G A;  2RGO A;  4A99 A;  3UP5 A;  4YKF A;  2YG6 A;  3RHA A;  3R9U A;  1GET A;  2AAQ A;  4EMI A;  1IJH A;  4Z2R A;  4AP3 A;  4B65 A;  1TRB A;  2C72 A;  4PAB A;  1XAN A;  2ZZB A;  2A89 A;  1PXC A;  3VR9 A;  4XXG A;  2EQ7 A;  2C75 A;  1UKV G;  3GYI A;  1L9C A;  3NN6 X;  1X31 B;  5JCI A;  3GD3 A;  1KF6 A;  1N1P A;  3G5Q A;  2YG5 A;  3QSE A;  1BF3 A;  2CUL A;  4TM1 A;  4C3Y A;  2WET A;  3UKH A;  1JNZ A;  4YTP A;  4ZCD A;  1FEB A;  2XLR A;  2PHH A;  1HYU A;  1B5Q A;  3QVR A;  3B3R A;  2X99 A;  3WE0 A;  2XVH A;  2YM2 A;  1E39 A;  2O9Z A;  1CHU A;  1KNP A;  3CND A;  3GWD A;  4ICY A;  1GRF A;  4K7Z A;  2WPF A;  3UOV A;  4IA6 A;  3ICT A;  2WES A;  5BUL A;  2V60 A;  2FJE A;  1DOE A;  3D1C A;  5EOW A;  3RP6 A;  2QCU A;  3UTF A;  3CGD A;  3UKK A;  3ZDN A;  1CC4 A;  2APG A;  1YQ4 A;  3C4N A;  3M12 A;  2C64 A;  3SFD A;  4B66 A;  1TDN A;  3NT6 A;  4K2X A;  4EM3 A;  4J56 A;  1MO9 A;  1IUW A;  3AE3 A;  1ZDL A;  1GT8 A;  2GQW A;  3GMC A;  1W4X A;  3M13 A;  5HYM A;  1CF3 A;  3L8K A;  2NVK X;  2VVL G;  3NNE A;  4ECH A;  5C2T A;  3AE4 A;  1GRG A;  3IHM A;  3O0H A;  2XFU A;  4H4Z A;  4CCR A;  4J36 A;  2WHD A;  1GRE A;  3K7Q X;  5IQ1 A;  2JK6 A;  2V6O A;  2WU5 A;  3KVE A;  3C96 A;  2WP5 A;  1KDG A;  3NRN A;  1CBO A;  1NG3 A;  5HXI A;  3NIX A;  2R45 A;  3G5R A;  3RNM A;  2XDO A;  4AOX A;  1VRQ B;  3RP8 A;  3PS9 A;  1BKW A;  2B9Y A;  2YWL A;  4TM0 A;  4LII A;  4A5L A;  4FK1 A;  4RSL A;  2WPC A;  2JB1 A;  3V76 A;  3ADA B;  4A9W A;  1E6E A;  4CBQ A;  4TLX A;  1YKJ A;  1CJ4 A;  1Q1W A;  2YLZ A;  3SGL A;  4J34 A;  3FBS A;  4A6N A;  2RGH A;  2XFO A;  3NH3 X;  3ALL A;  4WX1 A;  3DK4 A;  1TDK A;  2E5V A;  3VR8 A;  5KXJ A;  1K0J A;  2YG3 A;  3AE9 A;  4U8P A;  2Z5X A;  4Z2U A;  2WBA A;  1DOD A;  1YY5 A;  4J31 A;  3GWF A;  1F8S A;  1GSN A;  1QLB A;  2WP9 A;  2YR6 A;  3IHG A;  4GUV A;  4NTD A;  1S2Y A;  4U8M A;  4J33 A;  1NHS A;  2XFQ A;  1LQU A;  1Z6L A;  3OZ2 A;  4TM4 A;  3L1R A;  1REO A;  5IPY A;  2WDQ A;  3KA7 A;  3II4 A;  3B6D A;  4B64 A;  4UDP A;  3DJG X;  1GOS A;  1CC2 A;  1NHQ A;  4JNQ A;  4XWZ A;  4H4U A;  2Q7V A;  5HHF A;  4FDC B;  3EAO A;  3GD4 A;  4BJZ A;  4YT0 A;  3GMB A;  3IWA A;  4H4R A;  5GRT A;  2FJA A;  3NHO X;  2X8G A;  3ABV A;  2Q6U A;  4X9N A;  1GES A;  3F8R A;  2XCG A;  2ARD A;  1PBC A;  4GCM A;  2V3A A;  4ZCC A;  5M0Z A;  2OLO A;  4JDR A;  4EQR A;  2Q0K A;  2YQU A;  4JNA A;  1H82 A;  5KRQ A;  1BGJ A;  4REK A;  5J7X A;  1N4V A;  5J60 A;  2YG7 A;  2BXS A;  1OJC A;  3UCL A;  4B69 A;  2C67 A;  2ZBW A;  4WCT A;  1GTH A;  4YKG A;  4USQ A;  3SFE A;  4YXD A;  3P4P A;  4DGK A;  1JEH A;  1D4C A;  1E7P A;  2OAM A;  3ALM A;  4C74 A;  3Q9T A;  2WPE A;  3AEG A;  4EIP A;  4EIQ A;  1GRH A;  2VQ7 A;  1IUS A;  3KD9 A;  1O94 A;  3V3N A;  4DSH A;  1NEK A;  2BAC A;  2R4J A;  4JN9 A;  4GDE A;  5EB5 A;  5DBJ A;  2YLS A;  1MOK A;  1DJQ A;  2VVM A;  3BHK A;  3FPZ A;  2VQB A;  3EF6 A;  4BK3 A;  1IUV A;  1Y56 B;  4OPD A;  4Y4M A;  4XWR A;  4DSG A;  1LQT A;  1D4D A;  3DJE A;  5BUK A;  1E1K A;  2IVD A;  4NEW A;  2YLR A;  3H4K A;  4H7U A;  1H83 A;  4OPG A;  2F5Z A;  1PXA A;  4CNJ A;  3GRS A;  1P2E A;  1GRB A;  4Z24 A;  1L9E A;  4IA5 A;  4K5S A;  5FMH A;  4B63 A;  3GYJ A;  1IUX A;  2GAH B;  2ZZC A;  1VG0 A;  4H4X A;  3CPI G;  2H89 A;  3LZW A;  4GR1 A;  1B8S A;  3COX A;  3AE5 A;  1GEU A;  2ACZ A;  2YVF A;  1CJC A;  2GV8 A;  1FEC A;  5FS8 A;  2X3N A;  2YR4 A;  2E1M A;  4HA6 A;  1XDI A;  1FL2 A;  4CRT A;  5HY5 A;  4GF7 A;  1L0V A;  1LVL A;  3GRT A;  1CJ2 A;  2QA1 A;  1JNR A;  3OC4 A;  1M6I A;  5FS6 A;  1NPX A;  3AE2 A;  3NLC A;  4YSY A;  2GQF A;  1H6V A;  3Q6J A;  1RP0 A;  3GDN A;  1JRX A;  1PN0 A;  1F6M A;  2VVL A;  4CY6 A;  4I58 A;  1PJ5 A;  1BZL A;  2R9Z A;  4C77 A;  5U1O A;  3QFA A;  4N9X A;  1N4W A;  4CY8 A;  2R4E A;  4O5U A;  1DOC A;  3QSM A;  4O5Q A;  5ER0 A;  4K8D A;  2BCG G;  2BK4 A;  5LV9 A;  4AOS A;  1F8W A;  2TMD A;  4D03 A;  2YG4 A;  1PS9 A;  2GMJ A;  1KSS A;  5KOX A;  1FOH A;  4BV6 A;  1DJN A;  3CPJ G;  3QVP A;  3QFB A;  1Y0P A;  4H2P A;  1TDO A;  2B9X A;  2B76 A;  1E1N A;  2GR3 A;  1PHH A;  4FK1 C;  4JY3 A;  3BNU A;  1NG4 A;  1OJ9 A;  2ZZ0 A;  2YLT A;  2OLN A;  1D4E A;  4A6N B;  2GAG B;  1COY A;  1CC6 A;  1JRY A;  1ZP0 A;  4ADW A;  4H2R A;  4U2L A;  1DNC A;  2BS2 A;  3KU9 A;  1K4Q A;  3DGH A;  3CGB A;  1K0L A;  4ZN0 A;  3C4A A;  4JY2 A;  1OJA A;  1ZX9 A;  1RYI A;  3BI5 A;  1TYT A;  3BI4 A;  4AT2 A;  4A65 A;  4YSZ A;  1GTE A;  3ITJ A;  3ZYX A;  3URH A;  3UKP A;  3F8P A;  2CDU A;  1EL5 A;  1XHC A;  2WQY A;  4BK2 A;  1BGN A;  1B37 A;  3KKJ A;  4Z25 A;  5KVI A;  4H4Y A;  1H81 A;  5TR3 A;  5JCN A;  1PBE A;  3ALJ A;  3GSI A;  3CNT A;  2CFY A;  4J2W A;  1D5T A;  1QO8 A;  1JOA A;  3AEE A;  2YLX A;  4USR A;  3IF9 A;  1BWC A;  4OPT A;  3PVC A;  5U63 A;  1O95 A;  2BCP A;  3NN0 X;  2A8X A;  1H7W A;  3UP4 A;  2XLT A;  3S5W A;  2BK5 A;  2I0Z A;  2BXR A;  2WDV A;  1YQ3 A;  2BC1 A;  1P2H A;  3LB8 A;  1F3P A;  3NYE A;  3AD8 B;  2FJB A;  4K5R A;  4TM3 A;  4AT0 A;  3FMW A;  4U8J A;  2XFP A;  3VRB A;  3UTG A;  3ATR A;  1EBD A;  4EMW A;  1N4U A;  2AQJ A;  1O5W A;  1LTX R;  1F8R A;  3DME A;  1RSG A;  1JRZ A;  4H50 A;  4JQ9 A;  4H2N A;  3SQP A;  3K7M X;  2XLP A;  4AP1 A;  3P4Q A;  4BK1 A;  4Y4N A;  3BI2 A;  3NKS A;  2Y6R A;  3DK8 A;  3DH9 A;  2GRT A;  1E1L A;  3PO7 A;  2GF3 A;  3LOV A;  5KVH A;  1VQW A;  3CGC A;  4OCG A;  3LZX A;  1ZMC A;  2QAE A;  5JCM A;  3P9U A;  4B1B A;  1ZKQ A;  3NK0 X;  2Z5Y A;  4C5O A;  4EM4 A;  3AE6 A;  3HZL A;  2XVI A;  3NGC X;  2RGJ A;  4I59 A;  1FCD A;  1GRT A;  1AOG A;  2H88 A;  4KX6 A;  3AYI A;  2JKC A;  2GEW A;  1TDF A;  4UP3 A;  2BYB A;  2YLW A;  2Q0L A;  3LXD A;  1PJ7 A;  1M64 A;  4HB9 A;  3FG2 P;  4B67 A;  4APN A;  3UOX A;  3GDP A;  2XLU A;  2AR8 A;  2FBW A;  4J57 A;  3DJD A;  3FIM B;  4Z43 A;  3KPF A;  5IQ4 A;  3S61 A;  1PDH A;  2BA9 A;  3UOZ A;  3RED A;  4NTC A;  4GDP A;  3UKL A;  3VRA A;  5BVA A;  3EAN A;  4D04 A;  3AXB A;  3AEF A;  2WEU A;  5GSN A;  3NK1 X;  1QJD A;  3DK9 A;  3ISH A;  1S2Q A;  3BNM A;  3AEA A;  2XYO A;  3CGE A;  3AEC A;  3K30 A;  4H4V A;  5FS9 A;  4IV9 A;  3AED A;  2UZZ A;  1D7L A;  2EQ6 A;  4U2S A;  2GVC A;  2VZ2 A;  1ONF A;  4H4Q A;  3UTE A;  1DXL A;  2GR2 A;  2GR1 A;  2BS3 A;  2C76 A;  3AEB A;  4B68 A;  2DKH A;  2WOV A;  3NYF A;  3AE8 A;  4MJW A;  4X4J A;  2B9W A;  2X8H A;  3D8X A;  1E1M A;  3IC9 A;  3DGZ A;  2EQ8 A;  2B7R A;  2CVJ A;  2WOW A;  4LU6 A;  1DOB A;  1Y56 A;  4M52 A;  1LJ1 A;  1H7X A;  5KWF A;  2IID A;  4H4T A;  4YTN A;  4OVI A;  5KOW A;  4U8N A;  3NYC A;  1ZOV A;  5BRT A;  1YQZ A;  4RG3 A;  2JAE A;  4LA1 A;  2B7S A;  1L9D A;  1H86 A;  4NZH A;  3AD7 B;  3RP7 A;  4NEV A;  2C66 A;  5U25 A;  2J3N A;  2YVG A;  5JCL A;  2BAB A;  2IVE A;  2FJD A;  5L46 A;  2YVJ A;  4OPC A;  2NPX A;  2VOU A;  3CNP A;  3T37 A;  4U8O A;  2YR5 A;  4IVM B;  3I6D A;  1ZOY A;  3JSK A;  2WP6 A;  3ATQ A;  2V5Z A;  3F8D A;  4A79 A;  1PXB A;  1NHP A;  3AWI A;  4U8L A;  3NG7 X;  1NAA A;  3VQR A;  2BK3 A;  3UKA A; 
#chains in the Genus database with same CATH topology
 4H2Q A;  3LJP A;  1S3E A;  2C3D A;  2E4G A;  3PWG A;  4EQW A;  1PBB A;  2V61 A;  2OAL A;  3CTY A;  4U2T A;  4TLZ A;  4BJY A;  1N61 C;  3Q4D A;  1GPE A;  4A6G A;  1Q9I A;  4U8I A;  2OFJ A;  2R0P A;  3G5S A;  1NU5 A;  2VRM A;  1CL0 A;  4DYE A;  4FX9 A;  1EL8 A;  3CT2 A;  4E5T A;  3D46 A;  5EBK A;  4YSX A;  4GRT A;  1XPY A;  4YWO A;  2P0I A;  1NDA A;  2GMH A;  4H4S A;  4IL0 A;  1PBD A;  3DA1 A;  1KKR A;  4EMJ A;  4EQS A;  3SQS A;  1KNR A;  2R46 A;  2WU2 A;  4UDQ A;  1GV4 A;  1F9C A;  4HCH A;  2R0C A;  4G6G A;  4E0V A;  4JN7 A;  2FKP A;  3E1T A;  2JB2 A;  2DKI A;  4UDR A;  2HXU A;  4H2H A;  4Z26 A;  1ZMD A;  5CKU A;  2C7G A;  4YKF A;  2YG6 A;  1GET A;  4EMI A;  1JPD X;  3ETR B;  4B65 A;  2C72 A;  2C75 A;  1SB3 B;  3GD3 A;  1FEB A;  2X99 A;  2XVH A;  1KNP A;  4M0X A;  1GRF A;  2WPF A;  1PDY A;  2V60 A;  3D1C A;  3SZC A;  3MUC A;  3ZLG A;  3ZDN A;  2APG A;  3UCC A;  3M12 A;  3SFD A;  4K2X A;  2P8B A;  4J56 A;  3AE3 A;  3GMC A;  2GGG A;  1CF3 A;  3NNE A;  3FVD A;  1ECQ A;  2OZ3 A;  4H83 A;  3AE4 A;  3IHM A;  5ENL A;  2XFU A;  3K7Q X;  2V6O A;  2WU5 A;  3C96 A;  2GGE A;  3NIX A;  3I6E A;  2XDO A;  2E5A A;  2QJJ A;  4A9W A;  3ADA B;  1E6E A;  1CJ4 A;  1Q1W A;  2OPJ A;  3GY1 A;  4J34 A;  4A6N A;  3NH3 X;  5KXJ A;  1K0J A;  2YG3 A;  2Z5X A;  4Z2U A;  2WBA A;  4J31 A;  1GSN A;  3NVV B;  3IHG A;  4HCL A;  4GAP A;  1NHS A;  3OZ2 A;  4TM4 A;  2DW7 A;  1REO A;  3L1R A;  3VC5 A;  3DJG X;  1CC2 A;  3T2Y A;  4JNQ A;  3GD4 A;  4BJZ A;  4X9N A;  1GES A;  3F8R A;  2ARD A;  2P3Z A;  4ZCC A;  3MSY A;  3CK5 A;  5M0Z A;  2OLO A;  4DXK A;  5J60 A;  3UCL A;  4YXD A;  3AEG A;  3IJL A;  2VQ7 A;  1IUS A;  5DBJ A;  1MOK A;  4GFI A;  3MZN A;  2VQB A;  3UJF A;  4DSG A;  2IVD A;  4NEW A;  2F5Z A;  4H19 A;  1P2E A;  1GRB A;  3I4K A;  4K5S A;  4B63 A;  1IUX A;  2GAH B;  1VG0 A;  3CPI G;  3LZW A;  1B8S A;  4HA6 A;  1FEC A;  1FO4 A;  4CRT A;  5HY5 A;  4GF7 A;  1PN0 A;  4CY6 A;  3ES7 A;  2R9Z A;  4N9X A;  5ER0 A;  4K8D A;  2TMD A;  1PS9 A;  2GMJ A;  1DJN A;  3QVP A;  1TDO A;  2B9X A;  2B76 A;  1PHH A;  4FK1 C;  3BNU A;  4YWS A;  2PU0 A;  2OLN A;  3SX6 A;  2GAG B;  1CC6 A;  1JRY A;  1ZP0 A;  5FJP A;  1DNC A;  2BS2 A;  2OKT A;  1RYI A;  3UJR A;  4AT2 A;  3R0K A;  4A65 A;  4YSZ A;  1GTE A;  3HYV A;  3ITJ A;  4NWZ A;  3F8P A;  2CDU A;  1XHC A;  3KKJ A;  3A7R A;  2GSH A;  1PBE A;  3AM9 A;  4J2W A;  3CNT A;  1QO8 A;  1JOA A;  3IF9 A;  3SSZ A;  4OPT A;  3PVC A;  1O95 A;  3NN0 X;  3DGB A;  3S5W A;  2BC1 A;  1P2H A;  3N4E A;  3LB8 A;  4K5R A;  2FJB A;  5KMR A;  4G7F A;  4IHC A;  2XH0 A;  2AQJ A;  1O5W A;  1LTX R;  2W55 A;  4H50 A;  4Z1Y A;  4AP1 A;  3P4Q A;  2GRT A;  3LOV A;  3TJ4 A;  3LZX A;  3P9U A;  4C5O A;  2RGJ A;  3JW7 A;  3AYI A;  3DG3 A;  3DG6 A;  2BYB A;  3UJS A;  2Q0L A;  1PJ7 A;  4HB9 A;  4APN A;  2FBW A;  4J57 A;  4Z43 A;  3FIM B;  5IQ4 A;  3DDM A;  2AL2 B;  3FYY A;  3UOZ A;  3VRA A;  3R0U A;  3EAN A;  3AXB A;  5GSN A;  3NK1 X;  3TQP A;  1QJD A;  3QTP A;  1S2Q A;  2XYO A;  3CGE A;  3AEC A;  3K30 A;  4IV9 A;  3VA8 A;  2UZZ A;  1D7L A;  2EQ6 A;  2GVC A;  1ONF A;  4B68 A;  3AEB A;  2WOV A;  4X4J A;  4II2 A;  2QDD A;  2XH4 A;  2EQ8 A;  2B7R A;  4G8T A;  1DOB A;  1H7X A;  4DHG A;  4YTN A;  5KOW A;  4KEM A;  3NVZ B;  5BRT A;  1YQZ A;  3QKE A;  2B7S A;  3AD7 B;  4NEV A;  5U25 A;  2YVG A;  5JCL A;  5L46 A;  2YVJ A;  4U8O A;  2OO6 A;  2MNR A;  3I6D A;  3RR1 A;  2WP6 A;  3ATQ A;  4A79 A;  3DFH A;  1NHP A;  3B97 A;  1SJB A;  3T6C A;  1GXF A;  1D7Y A;  3PK7 A;  4Z44 A;  7ENL A;  3KLJ A;  2WOI A;  2X50 A;  5JRB A;  4C3X A;  4EQX A;  3P4S A;  1KSU A;  3ICR A;  3AB1 A;  2PTY A;  3RCY A;  2GGJ A;  4U8K A;  1S3B A;  4YTM A;  3NK2 X;  1JRP A;  1LPF A;  1IUT A;  2A87 A;  4NTE A;  4X2P A;  3CNS A;  1H2I A;  1KD0 A;  4GAV A;  5C3J A;  3NVW B;  3I3L A;  1GAL A;  3MY9 A;  2XLS A;  3AYJ A;  2QDE A;  3AE1 A;  2XVE A;  3NTA A;  4KPR A;  4A7A A;  3K7T A;  1EC7 A;  2W54 A;  3NVY B;  1ELS A;  1PJ6 A;  4Y4L A;  2OA1 A;  3T2Z A;  2WDR A;  3HYW A;  3SY4 A;  1ZY8 A;  3R1Z A;  3AYL A;  2GB0 A;  4X9M A;  2V3B A;  2XVF A;  1CJ3 A;  3ZLH A;  3VRD B;  4PAA A;  1GER A;  2RGO A;  1ONE A;  3L5O A;  3R9U A;  2AAQ A;  2PP3 A;  4DWD A;  3RGT A;  2ZZB A;  3VFC A;  1L9C A;  1N1P A;  1BF3 A;  4E8G A;  2CUL A;  4II3 A;  3OP2 A;  4TM1 A;  3UKH A;  4GYP C;  4ZCD A;  1FFU C;  2PHH A;  3CND A;  4ICY A;  1E39 A;  1CHU A;  3R07 C;  4F4R A;  3K1G A;  3AMZ A;  5EOW A;  4GIR A;  1YQ4 A;  2C64 A;  4IL2 A;  3T14 A;  1MO9 A;  1ZDL A;  1W4X A;  5HYM A;  5C2T A;  3O0H A;  3SR6 B;  3HPF A;  1JDF A;  2ZC8 A;  1E9I A;  2JK6 A;  3KVE A;  4IZG A;  1KDG A;  3NRN A;  1CBO A;  1NG3 A;  3UXL A;  3RNM A;  1VRQ B;  3RP8 A;  2YWL A;  4LII A;  4FK1 A;  2WPC A;  4FI4 A;  4TVW A;  1YKJ A;  2P8C A;  3VR8 A;  1TDK A;  3AE9 A;  4U8P A;  1DOD A;  1YY5 A;  2WP9 A;  1QLB A;  5IPY A;  4B64 A;  1P48 A;  4UDP A;  4XWZ A;  4H4U A;  5HHF A;  5KNL A;  3ZVI A;  3GMB A;  4YT0 A;  4H4R A;  4ZA0 A;  2X8G A;  2Q6U A;  2P88 A;  3T4W A;  1XS2 A;  3CXB A;  2HZG A;  4GCM A;  2OLA A;  3QN3 A;  5J7X A;  4WCT A;  4YKG A;  4USQ A;  3P4P A;  3CMM A;  1N5W C;  1JEH A;  1D4C A;  3V3W A;  2PPG A;  3KD9 A;  3V3N A;  1O94 A;  1NEK A;  4JN9 A;  4GDE A;  5EB5 A;  3BHK A;  3ENL A;  3DG7 A;  5BUK A;  3BJS A;  3H4K A;  2AL2 A;  2OG9 A;  1PXA A;  4Z24 A;  3PWI A;  4JN8 A;  3HW2 A;  4H1Z A;  2X3N A;  2E1M A;  1FL2 A;  1LVL A;  3OC4 A;  3NLC A;  3N4F A;  1P43 A;  2GQF A;  3GDN A;  1JRX A;  2O56 A;  4I58 A;  3U9I A;  1BZL A;  3SN0 A;  4CY8 A;  4O5U A;  1DOC A;  3QSM A;  2BCG G;  5LV9 A;  4AOS A;  2YG4 A;  4BV6 A;  1FIQ B;  3CPJ G;  4GGH A;  4H2P A;  1WYG A;  4GIS A;  3A7A A;  4HNL A;  1K4Q A;  3DGH A;  3SXI A;  4ZN0 A;  3H7V A;  1ZX9 A;  1TYT A;  4FP1 A;  3ZYX A;  3URH A;  3UKP A;  1EL5 A;  1B37 A;  4H4Y A;  1H81 A;  3SZ0 A;  3GSI A;  5EU9 A;  3NXL A;  2A8X A;  3NRZ B;  1OEP A;  5BOE A;  2BXR A;  1FFV C;  3T0K A;  3NYE A;  3NS1 B;  4EMW A;  4E6M A;  1F8R A;  3SQP A;  3K7M X;  2GGH A;  4Y4N A;  3NKS A;  1MUC A;  2Y6R A;  3DK8 A;  1E1L A;  2GF3 A;  4OCG A;  1VQW A;  4B1B A;  5JCM A;  1ZKQ A;  2Z5Y A;  3HZL A;  4G74 A;  1GRT A;  1AOG A;  3EEZ A;  1M64 A;  3GDP A;  2W3R A;  3S61 A;  1RVK A;  4NTC A;  5BVA A;  3AEF A;  2PS2 A;  2OZT A;  2POZ A;  3ISH A;  4G73 A;  3AED A;  4U2S A;  2HNE A;  2GR2 A;  2DKH A;  3AE8 A;  4MMW A;  3PG6 A;  3D8X A;  3CB3 A;  1R6W A;  2CVJ A;  2WOW A;  1Y56 A;  4M52 A;  3SJN A;  4U8N A;  1N63 C;  4GYP A;  4NZH A;  3RP7 A;  2C66 A;  2J3N A;  2PP1 A;  2IVE A;  2FJD A;  4OPC A;  2NPX A;  3JSK A;  1STZ A;  3P0W A;  1VQZ A;  4U8L A;  3NG7 X;  3VQR A;  3UKA A;  5KMP A;  1PBF A;  2MUC A;  3H8L A;  3UTH A;  3AE7 A;  3FXG A;  4P9S A;  1H84 A;  2JBV A;  1EBG A;  1MDR A;  2OZ8 A;  4CCQ A;  2TPR A;  4IP5 A;  1NEN A;  4HYR A;  2X8C A;  1Q1R A;  1ELI A;  3LAD A;  3QJ4 A;  1FEA A;  4OPU A;  1IUU A;  5M10 A;  3D9X A;  3QLD A;  4RG4 A;  1V59 A;  1EL7 A;  2HQM A;  3STP A;  2GR0 A;  2AL1 A;  2CHR A;  3DEQ A;  2HXT A;  3FCP A;  2GH5 A;  3UOY A;  3H8I A;  2R0G A;  4H4P A;  4CNK A;  1GRA A;  3UKQ A;  3VCC A;  5FS7 A;  3CAW A;  5FJO A;  5CQF A;  3M0O A;  3NTD A;  1LV0 A;  2QJN A;  3UKF A;  3SM8 A;  2YAU A;  3T31 A;  3UGV A;  3VCN A;  1ZK7 A;  1B4V A;  2C73 A;  2W0H A;  4YSH A;  4OPI A;  1KKO A;  1EL9 A;  4G6H A;  1NHR A;  3BHF A;  3GO2 A;  1MRA A;  4BUR A;  4IVO B;  2PYX A;  3DJJ A;  3CIR A;  3P4R A;  4H4W A;  3RHA A;  1JCT A;  1IJH A;  4AP3 A;  4MGG A;  1NEL A;  3OPS A;  3VR9 A;  1PXC A;  3GYX A;  4XXG A;  5J04 A;  2EQ7 A;  3I6T A;  3GYI A;  2XH7 A;  1KF6 A;  1X31 B;  2YG5 A;  3QSE A;  1L8P A;  2WET A;  3QVR A;  3B3R A;  3WE0 A;  2O9Z A;  4HNC A;  3GWD A;  1SJA A;  4IA6 A;  3ICT A;  3JVA A;  5BUL A;  3P3B A;  2FJE A;  3RP6 A;  2PCE A;  3MKC A;  3UKK A;  3CYJ A;  1CC4 A;  3AN1 A;  1ZXI C;  4B66 A;  2E3T A;  3SN1 A;  3RO6 A;  4EM3 A;  5KMS A;  2OQY A;  4KT2 A;  1GT8 A;  2VVL G;  3IK4 A;  4H4Z A;  2PP0 A;  4DX3 A;  2WP5 A;  2R45 A;  4AOX A;  3PS9 A;  1BKW A;  2B9Y A;  4A5L A;  2GL5 A;  2JB1 A;  3V76 A;  4CBQ A;  4TLX A;  2RGH A;  3SN4 A;  3ALL A;  1WUE A;  4ROP A;  2I5Q A;  3D47 A;  4U8M A;  4J33 A;  1LQU A;  4M6U A;  3KA7 A;  3A7U A;  3II4 A;  3B6D A;  4Z17 A;  2OX4 A;  1NHQ A;  2Q7V A;  4G9K A;  3GD6 A;  4FDC B;  1X2G A;  3IWA A;  5GRT A;  2FJA A;  1TZZ A;  3R11 A;  2XCG A;  1EC9 A;  4JDR A;  4EQR A;  2Q0K A;  1DTN A;  2YQU A;  3ES8 A;  5KRQ A;  1BGJ A;  3ZLF A;  1OJC A;  4B69 A;  2C67 A;  2ZBW A;  1GTH A;  4DGK A;  2OAM A;  4C74 A;  3T9P A;  3Q9T A;  2WPE A;  4EIP A;  4KPL A;  5IDZ A;  2R4J A;  3UXK A;  2YLS A;  1DJQ A;  2VVM A;  3RRA A;  3EF6 A;  1IUV A;  1Y56 B;  3NZG A;  4Y4M A;  1LQT A;  1D4D A;  4H7U A;  4OPG A;  1H83 A;  4CNJ A;  3GRS A;  1JRO A;  5FMH A;  3GYJ A;  4H4X A;  3OTR A;  3THU A;  3COX A;  3AE5 A;  2ACZ A;  4IT1 A;  2YR4 A;  2GV8 A;  1XDI A;  1CJ2 A;  1M6I A;  3AE2 A;  1NPX A;  3UCD A;  4YSY A;  3OW1 A;  3Q6J A;  3H12 A;  2NQL A;  1PJ5 A;  2PU1 A;  4C77 A;  2RDX A;  3QFA A;  2R4E A;  4D03 A;  3DER A;  3VDG A;  1Y0P A;  1E1N A;  2GR3 A;  1NG4 A;  1OJ9 A;  1PDZ A;  3UJE A;  3U4F A;  1COY A;  4H2R A;  4U2L A;  1K0L A;  1OJA A;  2ZAD A;  3IJQ A;  4HCD A;  1N5X A;  2QVH A;  3V4B A;  1BQG A;  2WQY A;  1T3Q C;  3QPE A;  5KVI A;  6ENL A;  3V5F A;  3ALJ A;  1EBH A;  3NO1 A;  5U63 A;  2BCP A;  1H7W A;  2XLT A;  3HYX A;  2WDV A;  1YQ3 A;  1KCZ A;  1F3P A;  3AD8 B;  4TM3 A;  1SJC A;  2XFP A;  3VRB A;  3ATR A;  1N4U A;  3DME A;  1RSG A;  1JRZ A;  4JQ9 A;  4A35 A;  2XLP A;  4BK1 A;  1BKH A;  3BI2 A;  3DH9 A;  3PO7 A;  3RIT A;  1ZMC A;  3NK0 X;  4EM4 A;  3AE6 A;  1N60 C;  3NGC X;  4I59 A;  3OZM A;  2JKC A;  3NFU A;  2XSX A;  2GEW A;  3OZY A;  3FG2 P;  4ZCW A;  3UOX A;  4B67 A;  1FHV A;  2OQH A;  2XLU A;  3DJD A;  3KPF A;  1PDH A;  2BA9 A;  3RED A;  4GDP A;  3UKL A;  5FJR A;  3H70 A;  3DK9 A;  3BNM A;  3AEA A;  2QQ6 A;  2POD A;  3UTE A;  1TKK A;  1DXL A;  2C76 A;  2GR1 A;  2BS3 A;  3NYF A;  2B9W A;  2X8H A;  3DGZ A;  1YEY A;  4OVI A;  3NYC A;  4NNJ A;  2PTW A;  4RG3 A;  4JHM A;  3BOX A;  2BAB A;  2VOU A;  3CNP A;  3T37 A;  2YR5 A;  5G5G B;  1ZOY A;  3F8D A;  3FV9 A;  2W3S A;  1PXB A;  3AWI A;  1NAA A;  2BK3 A;  5BOF A;  1XPQ A;  2VRL A;  3SZF A;  1MXT A;  3EKG A;  5EB4 A;  2YM1 A;  3TWA A;  1TDE A;  1VDC A;  2QJM A;  2BS4 A;  3EUB 3;  3CN8 A;  3ICS A;  2FYM A;  1K0I A;  1GND A;  3EPT A;  1OJT A;  2RAB A;  3P1W A;  1IYX A;  3QSS A;  3CNJ A;  4DNA A;  3N6H A;  1TYP A;  1VG9 A;  2C4C A;  4GME A;  2WS3 A;  1JU2 A;  2QA2 A;  2XFN A;  2BRA A;  5G5H B;  1SEZ A;  3AD9 B;  2OVL A;  3TWB A;  1JPM A;  4J1O A;  3ZVH B;  5JCK A;  4HN8 A;  3TJI A;  3UOV A;  2EQ9 A;  2C3C A;  1KN0 A;  1OJD A;  1EC8 A;  2C70 A;  2Y6Q A;  2XVJ A;  3KUM A;  1KFY A;  2BC0 A;  4K22 A;  2JB3 A;  3V3O A;  4Z2T A;  4OPL A;  1W6T A;  3CPH G;  2C65 A;  4A99 A;  3UP5 A;  4Z2R A;  4K1W A;  1TRB A;  4PAB A;  1XAN A;  2A89 A;  3TOY A;  4E4U A;  1UKV G;  3NN6 X;  1MDL A;  5JCI A;  3G5Q A;  4C3Y A;  1JNZ A;  1V97 A;  4YTP A;  2XLR A;  1HYU A;  1B5Q A;  2YM2 A;  4K7Z A;  2WES A;  1DOE A;  2QCU A;  3UTF A;  3CGD A;  3C4N A;  2ONE A;  4K8G A;  1TDN A;  3NT6 A;  1IUW A;  3M13 A;  2GQW A;  3L8K A;  2NVK X;  4ECH A;  1GRG A;  4CCR A;  4J36 A;  2WHD A;  1GRE A;  5IQ1 A;  3T8Q A;  5HXI A;  3IJI A;  3G5R A;  3UJ2 A;  4IP4 A;  3SBF A;  3P93 A;  4TM0 A;  2PSN A;  4RSL A;  2YLZ A;  3SGL A;  3FBS A;  2XFO A;  4WX1 A;  3DK4 A;  2E5V A;  4MKS A;  3MWC A;  3GWF A;  3B9J B;  3TCS A;  5FJT A;  1F8S A;  4GUV A;  3H8A A;  2YR6 A;  4NTD A;  1S2Y A;  2XFQ A;  3BSM A;  1Z6L A;  2WDQ A;  1MNS A;  1GOS A;  3HRD C;  4E4F A;  3EAO A;  3N6J A;  3SYI A;  3VC6 A;  2GGI A;  3NHO X;  3ABV A;  3Q45 A;  2AKM A;  1PBC A;  2V3A A;  1RM6 B;  4JNA A;  1H82 A;  4REK A;  1R0M A;  2XH2 A;  1N4V A;  2YG7 A;  2BXS A;  3CXO A;  3SFE A;  3GC2 A;  1E7P A;  3ALM A;  1N62 C;  2BRY A;  4EIQ A;  1GRH A;  4DSH A;  2BAC A;  3FPZ A;  2PGW A;  4BK3 A;  4OPD A;  4XWR A;  3DJE A;  2XGZ A;  1E1K A;  2YLR A;  4TVY A;  1L9E A;  4IA5 A;  3PFR A;  1VDV A;  2ZZC A;  2H89 A;  4GR1 A;  1GEU A;  2YVF A;  1CJC A;  5FS8 A;  1L0V A;  3GRT A;  2QA1 A;  1JNR A;  5FS6 A;  1H6V A;  2PTZ A;  1RP0 A;  1F6M A;  2VVL A;  5U1O A;  1N4W A;  4O5Q A;  2BK4 A;  1F8W A;  1KSS A;  1TE6 A;  5KOX A;  1FOH A;  3S5S A;  3QFB A;  2PMQ A;  4JY3 A;  3JZU A;  2ZZ0 A;  2YLT A;  1D4E A;  3SZW A;  4A6N B;  2PTX A;  4ADW A;  5FJU A;  3KU9 A;  4ZOH B;  3CGB A;  3TTE A;  3C4A A;  4JY2 A;  3BI5 A;  3BI4 A;  4A3R A;  3KPK A;  1FHU A;  3T2K A;  1X2H A;  4BK2 A;  1BGN A;  3DIP A;  2GDQ A;  4Z25 A;  5TR3 A;  5JCN A;  2CFY A;  1D5T A;  2PGE A;  3AEE A;  2YLX A;  4USR A;  1BWC A;  3MQT A;  4EWJ A;  3UP4 A;  2BK5 A;  2I0Z A;  4AT0 A;  3FMW A;  4U8J A;  4HPN A;  3UTG A;  3R10 A;  1EBD A;  4H2N A;  5KVH A;  3CGC A;  5KMQ A;  2QAE A;  2XVI A;  1FCD A;  3ZVH A;  3TW9 A;  2H88 A;  4KX6 A;  4ENL A;  4UP3 A;  1TDF A;  2YLW A;  3LXD A;  2PA6 A;  2AR8 A;  2QGY A;  1WUF A;  4DN1 A;  4D04 A;  3R25 A;  2WEU A;  4H4V A;  5FS9 A;  2VZ2 A;  4H4Q A;  1S7M A;  4MJW A;  2AKZ A;  1E1M A;  3IC9 A;  3DFY A;  4LU6 A;  5KWF A;  1LJ1 A;  2IID A;  4H4T A;  1SJD A;  1ZOV A;  3S47 A;  3DES A;  4GGB A;  4LA1 A;  2JAE A;  1L9D A;  1H86 A;  3FJ4 A;  4J3Z A;  4K2S A;  4KWS A;  4IVM B;  3V5C A;  2V5Z A;  2DW6 A; 
#chains in the Genus database with same CATH homology
 4H2Q A;  1GXF A;  1D7Y A;  1PBF A;  2C3D A;  1S3E A;  1XPQ A;  3H8L A;  3LJP A;  4Z44 A;  2VRL A;  3UTH A;  3KLJ A;  2WOI A;  2E4G A;  3AE7 A;  2X50 A;  4P9S A;  5JRB A;  1H84 A;  2JBV A;  4EQX A;  4EQW A;  4C3X A;  3P4S A;  3SZF A;  1KSU A;  1PBB A;  3ICR A;  2V61 A;  1MXT A;  3AB1 A;  4CCQ A;  2OAL A;  3CTY A;  4U2T A;  4TLZ A;  5EB4 A;  4BJY A;  2YM1 A;  2TPR A;  4U8K A;  1NEN A;  1TDE A;  1VDC A;  2BS4 A;  1S3B A;  2X8C A;  1Q1R A;  1GPE A;  1ELI A;  3LAD A;  3CN8 A;  3QJ4 A;  4YTM A;  3ICS A;  3NK2 X;  1FEA A;  4OPU A;  1IUU A;  5M10 A;  3D9X A;  1Q9I A;  4U8I A;  1K0I A;  1GND A;  1LPF A;  1V59 A;  3EPT A;  4RG4 A;  1IUT A;  1EL7 A;  1OJT A;  2RAB A;  2R0P A;  3P1W A;  3G5S A;  2A87 A;  2HQM A;  4NTE A;  2VRM A;  1CL0 A;  3QSS A;  2GR0 A;  4FX9 A;  3CNS A;  3CNJ A;  1H2I A;  4DNA A;  1TYP A;  4GAV A;  1EL8 A;  1VG9 A;  5C3J A;  3I3L A;  2C4C A;  3UOY A;  2GH5 A;  1GAL A;  5EBK A;  3H8I A;  3AYJ A;  2WS3 A;  2XLS A;  4YSX A;  1JU2 A;  2QA2 A;  2XFN A;  4GRT A;  3AE1 A;  2R0G A;  2XVE A;  3NTA A;  4KPR A;  2BRA A;  1SEZ A;  4H4P A;  4YWO A;  3AD9 B;  4A7A A;  4CNK A;  3K7T A;  1GRA A;  1NDA A;  3UKQ A;  2GMH A;  4H4S A;  5JCK A;  5FS7 A;  1PBD A;  3DA1 A;  5CQF A;  1PJ6 A;  3M0O A;  3NTD A;  4Y4L A;  2OA1 A;  4EMJ A;  4EQS A;  1KNR A;  2R46 A;  1LV0 A;  2EQ9 A;  2WDR A;  2WU2 A;  2C3C A;  4UDQ A;  3T2Z A;  3HYW A;  1KN0 A;  3SM8 A;  2YAU A;  3T31 A;  1OJD A;  3UKF A;  3SY4 A;  1GV4 A;  1ZY8 A;  1ZK7 A;  1B4V A;  2C73 A;  2R0C A;  3AYL A;  4G6G A;  2C70 A;  2W0H A;  2GB0 A;  4YSH A;  2Y6Q A;  4X9M A;  2V3B A;  4E0V A;  4OPI A;  2XVF A;  1CJ3 A;  1EL9 A;  2XVJ A;  3E1T A;  4G6H A;  2JB2 A;  1KFY A;  2DKI A;  4UDR A;  1NHR A;  2BC0 A;  3BHF A;  4K22 A;  5KMP A;  3VRD B;  4PAA A;  4BUR A;  2JB3 A;  4IVO B;  4Z26 A;  3V3O A;  1GER A;  4Z2T A;  2PYX A;  1ZMD A;  4OPL A;  3CPH G;  2C65 A;  3DJJ A;  3CIR A;  5CKU A;  3P4R A;  4H4W A;  2C7G A;  2RGO A;  4A99 A;  3UP5 A;  4YKF A;  2YG6 A;  3RHA A;  3L5O A;  3R9U A;  1GET A;  2AAQ A;  4EMI A;  1IJH A;  4Z2R A;  4AP3 A;  4B65 A;  1TRB A;  2C72 A;  4PAB A;  1XAN A;  2ZZB A;  2A89 A;  1PXC A;  3VR9 A;  3GYX A;  4XXG A;  2EQ7 A;  2C75 A;  1UKV G;  3GYI A;  1L9C A;  3NN6 X;  1X31 B;  5JCI A;  3GD3 A;  1KF6 A;  1N1P A;  3G5Q A;  2YG5 A;  3QSE A;  1BF3 A;  2CUL A;  4II3 A;  4TM1 A;  4C3Y A;  2WET A;  3UKH A;  1JNZ A;  4YTP A;  4ZCD A;  1FEB A;  2XLR A;  2PHH A;  1HYU A;  1B5Q A;  3QVR A;  3B3R A;  2X99 A;  3WE0 A;  2XVH A;  2YM2 A;  1E39 A;  2O9Z A;  1CHU A;  1KNP A;  3CND A;  3GWD A;  4ICY A;  1GRF A;  4K7Z A;  2WPF A;  3UOV A;  4IA6 A;  3ICT A;  2WES A;  5BUL A;  2V60 A;  2FJE A;  1DOE A;  3D1C A;  5EOW A;  3RP6 A;  2QCU A;  3SZC A;  3UTF A;  3CGD A;  3UKK A;  3ZDN A;  1CC4 A;  2APG A;  1YQ4 A;  3C4N A;  3M12 A;  2C64 A;  3SFD A;  4B66 A;  1TDN A;  3NT6 A;  4K2X A;  4EM3 A;  4J56 A;  1MO9 A;  3T14 A;  5KMS A;  1IUW A;  3AE3 A;  1ZDL A;  1GT8 A;  2GQW A;  3GMC A;  1W4X A;  3M13 A;  5HYM A;  1CF3 A;  3L8K A;  2NVK X;  2VVL G;  3NNE A;  4ECH A;  5C2T A;  3AE4 A;  1GRG A;  3IHM A;  3O0H A;  2XFU A;  4H4Z A;  4CCR A;  4J36 A;  2WHD A;  1GRE A;  3K7Q X;  5IQ1 A;  2JK6 A;  2V6O A;  2WU5 A;  3KVE A;  3C96 A;  2WP5 A;  1KDG A;  3NRN A;  1CBO A;  1NG3 A;  5HXI A;  3NIX A;  2R45 A;  3G5R A;  3RNM A;  2XDO A;  4AOX A;  1VRQ B;  3RP8 A;  3PS9 A;  1BKW A;  2B9Y A;  2YWL A;  4TM0 A;  4LII A;  4A5L A;  4FK1 A;  4RSL A;  2WPC A;  2JB1 A;  3V76 A;  3ADA B;  4A9W A;  1E6E A;  4CBQ A;  4TLX A;  1YKJ A;  1CJ4 A;  1Q1W A;  2YLZ A;  3SGL A;  4J34 A;  3FBS A;  4A6N A;  2RGH A;  2XFO A;  3NH3 X;  3ALL A;  4WX1 A;  3DK4 A;  1TDK A;  2E5V A;  3VR8 A;  5KXJ A;  1K0J A;  2YG3 A;  3AE9 A;  4U8P A;  2Z5X A;  4Z2U A;  2WBA A;  1DOD A;  1YY5 A;  4J31 A;  3GWF A;  1F8S A;  1GSN A;  1QLB A;  2WP9 A;  2YR6 A;  3IHG A;  4GUV A;  4NTD A;  1S2Y A;  4GAP A;  4J33 A;  1NHS A;  2XFQ A;  4U8M A;  1LQU A;  1Z6L A;  3OZ2 A;  4TM4 A;  3L1R A;  1REO A;  5IPY A;  2WDQ A;  3KA7 A;  3II4 A;  3B6D A;  4B64 A;  4UDP A;  3DJG X;  1GOS A;  1CC2 A;  1NHQ A;  4JNQ A;  4XWZ A;  3T2Y A;  4H4U A;  2Q7V A;  4G9K A;  5HHF A;  4FDC B;  3EAO A;  3GD4 A;  4BJZ A;  5KNL A;  4YT0 A;  3GMB A;  3SYI A;  3IWA A;  4H4R A;  5GRT A;  2FJA A;  3NHO X;  2X8G A;  3ABV A;  2Q6U A;  4X9N A;  1GES A;  3F8R A;  2XCG A;  2ARD A;  1PBC A;  4GCM A;  2V3A A;  4ZCC A;  5M0Z A;  2OLO A;  4JDR A;  4EQR A;  2Q0K A;  2YQU A;  4JNA A;  1H82 A;  5KRQ A;  1BGJ A;  4REK A;  5J7X A;  1N4V A;  5J60 A;  2YG7 A;  2BXS A;  1OJC A;  3UCL A;  4B69 A;  2C67 A;  2ZBW A;  4WCT A;  1GTH A;  4YKG A;  4USQ A;  3SFE A;  4YXD A;  3P4P A;  3CMM A;  4DGK A;  1JEH A;  1D4C A;  1E7P A;  2OAM A;  3ALM A;  4C74 A;  3Q9T A;  2WPE A;  3AEG A;  4EIP A;  2BRY A;  4EIQ A;  1GRH A;  2VQ7 A;  1IUS A;  3KD9 A;  1O94 A;  3V3N A;  4DSH A;  1NEK A;  2BAC A;  2R4J A;  4JN9 A;  4GDE A;  5EB5 A;  5DBJ A;  2YLS A;  1MOK A;  1DJQ A;  2VVM A;  3BHK A;  3FPZ A;  2VQB A;  3EF6 A;  4BK3 A;  1IUV A;  1Y56 B;  4OPD A;  4Y4M A;  4XWR A;  4DSG A;  1LQT A;  1D4D A;  3DJE A;  5BUK A;  1E1K A;  2IVD A;  4NEW A;  2YLR A;  3H4K A;  4H7U A;  1H83 A;  4OPG A;  2F5Z A;  1PXA A;  4CNJ A;  3GRS A;  1P2E A;  1GRB A;  4Z24 A;  1L9E A;  4IA5 A;  4K5S A;  5FMH A;  4B63 A;  3GYJ A;  1IUX A;  2GAH B;  2ZZC A;  1VG0 A;  4H4X A;  3CPI G;  2H89 A;  3LZW A;  4GR1 A;  1B8S A;  3COX A;  3AE5 A;  1GEU A;  2ACZ A;  2YVF A;  1CJC A;  2GV8 A;  1FEC A;  5FS8 A;  2X3N A;  2YR4 A;  2E1M A;  4HA6 A;  1XDI A;  1FL2 A;  4CRT A;  5HY5 A;  4GF7 A;  1L0V A;  1LVL A;  3GRT A;  1CJ2 A;  2QA1 A;  1JNR A;  3OC4 A;  1M6I A;  5FS6 A;  1NPX A;  3AE2 A;  3NLC A;  4YSY A;  2GQF A;  1H6V A;  3Q6J A;  1RP0 A;  3GDN A;  1JRX A;  1PN0 A;  1F6M A;  2VVL A;  4CY6 A;  4I58 A;  1PJ5 A;  1BZL A;  2R9Z A;  4C77 A;  5U1O A;  3QFA A;  4N9X A;  1N4W A;  4CY8 A;  2R4E A;  4O5U A;  1DOC A;  3QSM A;  4O5Q A;  5ER0 A;  4K8D A;  2BCG G;  2BK4 A;  5LV9 A;  4AOS A;  1F8W A;  2TMD A;  4D03 A;  2YG4 A;  1PS9 A;  2GMJ A;  1KSS A;  5KOX A;  1FOH A;  4BV6 A;  1DJN A;  3CPJ G;  3QVP A;  3QFB A;  1Y0P A;  4H2P A;  1TDO A;  2B9X A;  2B76 A;  1E1N A;  2GR3 A;  1PHH A;  4FK1 C;  4JY3 A;  3BNU A;  1NG4 A;  1OJ9 A;  2ZZ0 A;  2YLT A;  2OLN A;  1D4E A;  3SZW A;  4A6N B;  3SX6 A;  2GAG B;  1COY A;  1CC6 A;  1JRY A;  1ZP0 A;  4ADW A;  4H2R A;  4U2L A;  1DNC A;  2BS2 A;  3KU9 A;  1K4Q A;  3DGH A;  3CGB A;  1K0L A;  3SXI A;  4ZN0 A;  3C4A A;  4JY2 A;  1OJA A;  1ZX9 A;  1RYI A;  3BI5 A;  1TYT A;  3BI4 A;  4AT2 A;  4A65 A;  4YSZ A;  1GTE A;  3HYV A;  3ITJ A;  3KPK A;  3T2K A;  3URH A;  4NWZ A;  3ZYX A;  3UKP A;  3F8P A;  2CDU A;  1EL5 A;  1XHC A;  2WQY A;  4BK2 A;  1BGN A;  1B37 A;  3KKJ A;  4Z25 A;  5KVI A;  4H4Y A;  1H81 A;  5TR3 A;  5JCN A;  3SZ0 A;  1PBE A;  3ALJ A;  3GSI A;  3CNT A;  2CFY A;  4J2W A;  1D5T A;  1QO8 A;  1JOA A;  3AEE A;  2YLX A;  4USR A;  3IF9 A;  1BWC A;  4OPT A;  3PVC A;  5U63 A;  1O95 A;  2BCP A;  3NN0 X;  2A8X A;  1H7W A;  3UP4 A;  2XLT A;  3S5W A;  2BK5 A;  2I0Z A;  3HYX A;  2BXR A;  2WDV A;  1YQ3 A;  2BC1 A;  1P2H A;  3LB8 A;  3T0K A;  1F3P A;  3NYE A;  3AD8 B;  2FJB A;  4K5R A;  4TM3 A;  4AT0 A;  3FMW A;  5KMR A;  4U8J A;  2XFP A;  3VRB A;  3UTG A;  3ATR A;  1EBD A;  4EMW A;  1N4U A;  2AQJ A;  1O5W A;  1LTX R;  1F8R A;  3DME A;  1RSG A;  1JRZ A;  4H50 A;  4JQ9 A;  4H2N A;  3SQP A;  3K7M X;  2XLP A;  4AP1 A;  3P4Q A;  4BK1 A;  4Y4N A;  3BI2 A;  3NKS A;  2Y6R A;  3DK8 A;  3DH9 A;  2GRT A;  1E1L A;  3PO7 A;  2GF3 A;  3LOV A;  5KVH A;  1VQW A;  3CGC A;  4OCG A;  3LZX A;  1ZMC A;  2QAE A;  5JCM A;  3P9U A;  5KMQ A;  4B1B A;  1ZKQ A;  3NK0 X;  2Z5Y A;  4C5O A;  4EM4 A;  3AE6 A;  3HZL A;  2XVI A;  3NGC X;  4G74 A;  2RGJ A;  4I59 A;  1FCD A;  1GRT A;  1AOG A;  2H88 A;  4KX6 A;  3AYI A;  2JKC A;  2GEW A;  1TDF A;  4UP3 A;  2BYB A;  2YLW A;  2Q0L A;  3LXD A;  1PJ7 A;  1M64 A;  4HB9 A;  3FG2 P;  4B67 A;  4APN A;  3UOX A;  3GDP A;  2XLU A;  2AR8 A;  2FBW A;  4J57 A;  3DJD A;  3FIM B;  4Z43 A;  3KPF A;  5IQ4 A;  3S61 A;  1PDH A;  2BA9 A;  3UOZ A;  3RED A;  4NTC A;  4GDP A;  3UKL A;  3VRA A;  5BVA A;  3EAN A;  4D04 A;  3AXB A;  3AEF A;  2WEU A;  5GSN A;  3NK1 X;  1QJD A;  3DK9 A;  3ISH A;  1S2Q A;  3BNM A;  3AEA A;  2XYO A;  3CGE A;  3AEC A;  3K30 A;  4H4V A;  5FS9 A;  4G73 A;  4IV9 A;  3AED A;  2UZZ A;  1D7L A;  2EQ6 A;  4U2S A;  2GVC A;  2VZ2 A;  1ONF A;  4H4Q A;  3UTE A;  1DXL A;  2GR2 A;  2GR1 A;  2BS3 A;  2C76 A;  3AEB A;  4B68 A;  2DKH A;  1S7M A;  2WOV A;  3NYF A;  3AE8 A;  4MJW A;  4X4J A;  2B9W A;  3PG6 A;  2X8H A;  3D8X A;  4II2 A;  1E1M A;  3IC9 A;  3DGZ A;  2EQ8 A;  2B7R A;  2CVJ A;  2WOW A;  4LU6 A;  1DOB A;  1Y56 A;  4M52 A;  1LJ1 A;  1H7X A;  5KWF A;  2IID A;  4H4T A;  4YTN A;  4OVI A;  5KOW A;  4U8N A;  3NYC A;  4NNJ A;  1ZOV A;  5BRT A;  1YQZ A;  4RG3 A;  2JAE A;  4LA1 A;  2B7S A;  1L9D A;  1H86 A;  4NZH A;  3AD7 B;  3RP7 A;  4NEV A;  2C66 A;  5U25 A;  2J3N A;  2YVG A;  5JCL A;  2BAB A;  2IVE A;  2FJD A;  5L46 A;  2YVJ A;  4OPC A;  2NPX A;  2VOU A;  3CNP A;  3T37 A;  4U8O A;  2YR5 A;  4IVM B;  3I6D A;  1ZOY A;  3JSK A;  2WP6 A;  3ATQ A;  2V5Z A;  3F8D A;  4A79 A;  1PXB A;  1NHP A;  3AWI A;  4U8L A;  3NG7 X;  1NAA A;  3VQR A;  2BK3 A;  3UKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...