5JCNA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
429
Chain Sequence
b'EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 130
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA02
4XWZA 3D8XA 2WESA 2FBWA 2OALA 4JN9A 4JNQA 4OPGA 1ZK7A 5L46A 5KWFA 3M12A 3AD8B 2JB3A 1X31B 1PJ5A 2W0HA 4YTPA 1IUSA 3S5WA 1D5TA 4H4YA 1OJCA 2RGJA 2Q7VA 3CPHG 4B1BA 4B64A 4H4QA 1IUXA 3L1RA 4IVMB 5KVIA 3IWAA 1XPQA 4JY3A 4Z26A 1P2EA 2ZZBA 3GRTA 4EQSA 2XFUA 3KD9A 1PBEA 2E1MA 2GV8A 5J60A 2GR2A 1LV0A 3AE5A 3EAOA 1E1KA 2H88A 3AE8A 3ICTA 1PJ7A 3ATQA 5GSNA 3RHAA 5BVAA 3QFAA 1YKJA 2I0ZA 2B7SA 4N9XA 1K0IA 4A6NA 3CNSA 2ACZA 4Z25A 3ZYXA 1CHUA 1RP0A 5JCKA 1KDGA 3AD7B 4Y4MA 2WDQA 4NEVA 3NYEA 4Z44A 1CBOA 1NAAA 4XXGA 4EIPA 2GR1A 3EPTA 1B8SA 3CTYA 2UZZA 3VRDB 3DJEA 4A7AA 4GF7A 4OCGA 3T37A 3UP4A 5JCLA 4B66A 3AEAA 2JB2A 3CGCA 1FEBA 2XVHA 2XFQA 1GRHA 4B65A 1TDFA 1XHCA 5KRQA 4RSLA 3AYLA 2RGOA 1CJCA 1Q1RA 4AOSA 1GALA 4APNA 1D7YA 3C4NA 4YSYA 1PXBA 2R0CA 3CNPA 3Q9TA 4H4RA 4NEWA 1H86A 3ABVA 4Z2UA 3NK2X 4EQWA 1ZP0A 1DJQA 3K7MX 1Y0PA 1PHHA 2E5VA 3SQPA 1KNPA 2Q6UA 3SM8A 3VR9A 1NPXA 4K5RA 3AEFA 4YKGA 2FJDA 2OLOA 5HXIA 1B5QA 2VVLG 3NIXA 4BJYA 3UOVA 2XDOA 5M10A 3RP6A 4YTMA 4Z24A 1DOBA 3REDA 1H81A 4AT0A 5BULA 4K7ZA 1ZOVA 1FOHA 3P4RA 2B9XA 2WU2A 4H4SA 1F8SA 3AXBA 3CNDA 2R45A 4C3YA 3G5SA 1DOCA 1GRTA 1YQ4A 4M52A 1TRBA 1GOSA 2XYOA 3D1CA 3OZ2A 4A99A 1E1NA 2FJBA 2ZBWA 1NG4A 2XFPA 4WX1A 3G5QA 4HB9A 4CRTA 4C3XA 2R46A 2YG5A 2WP5A 1RSGA 2Q0LA 4U8LA 4CY6A 1IUUA 4RG3A 3GD4A 2XVIA 3AE6A 3P9UA 4PABA 2B7RA 5U1OA 2C67A 1DODA 1F3PA 3QSMA 1H7XA 4LU6A 4H4PA 4EMIA 1FECA 3AEDA 2V6OA 4D04A 4TM0A 4J57A 2B76A 5KXJA 1VQWA 2WS3A 1TYPA 3B3RA 4TLXA 1AOGA 3QSSA 4Z2RA 1JU2A 4U2LA 4YSZA 3AE4A 3NYFA 3DJJA 4I58A 2PYXA 3ALJA 2VRMA 5DBJA 2C66A 3DH9A 1REOA 3QJ4A 4H7UA 3LZXA 1GTEA 3GWFA 2IVDA 5LV9A 3CPIG 4H4XA 4K2XA 3UTFA 3VQRA 4A65A 2YAUA 5M0ZA 2A89A 2H89A 4ICYA 1OJDA 4YXDA 1FEAA 1VG9A 3WE0A 4AOXA 3DK8A 4OPCA 3AEGA 2VOUA 2E4GA 3NGCX 4HA6A 3VRAA 3IHMA 3ADAB 1ZMCA 2CFYA 4YSXA 2BCPA 3DK4A 5ER0A 2OLNA 1GRGA 3ITJA 5KVHA 1ZX9A 1CJ4A 3GDNA 2FJEA 2Y6QA 2ARDA 4TM3A 2GAHB 4CCRA 1K4QA 3IC9A 1E1MA 2GF3A 4J56A 3II4A 3VR8A 1ELIA 1LQUA 2WPFA 1YQ3A 3CGEA 3PVCA 1OJAA 1BGNA 4D03A 2WEUA 4H4ZA 4IA5A 1GESA 3UTEA 1P2HA 1ZOYA 2WU5A 3H8LA 4BK2A 3DJGX 1Y56A 3UKLA 1E1LA 4KX6A 4CNJA 1N4UA 1DXLA 2VZ2A 2YVFA 1D4DA 4REKA 3NH3X 2PHHA 5FS9A 2XLUA 3P1WA 3UKFA 4NZHA 5IQ4A 2ZZ0A 3RNMA 4EM4A 1TDNA 3PO7A 1D4CA 1Q1WA 2RABA 4WCTA 3P4SA 3QSEA 1BGJA 1E7PA 2C64A 4GCMA 3CPJG 2BC1A 4USRA 1PBDA 3AE2A 4NTCA 3NK1X 1KF6A 1GETA 1PJ6A 1RYIA 1PS9A 1NHRA 1JNZA 2C65A 4BURA 3B6DA 3KKJA 3R9UA 2Z5XA 1PBBA 2GMJA 1F6MA 5JCMA 3NYCA 3KVEA 4BK1A 4GUVA 1S3EA 4U8PA 4U8JA 2VVMA 2WOWA 5FS6A 1L9CA 2XLRA 3M0OA 2V60A 2WOVA 2XLSA 2WDVA 2JBVA 2X3NA 3QVPA 2XLPA 4J33A 3LJPA 1GRFA 3AD9B 4K5SA 5FMHA 4FX9A 5HY5A 4H4VA 3UTHA 1PXAA 2BK3A 3GMCA 2YLZA 4TM1A 3GDPA 3FMWA 2X8CA 3GRSA 5FS7A 2V61A 1B37A 2R4EA 1ZY8A 2GQWA 1QJDA 2GH5A 4AT2A 1NENA 2BCGG 1Q9IA 4YT0A 1BWCA 1NHQA 5TR3A 3OC4A 2GVCA 3AYIA 1D4EA 5JCIA 4H2PA 2YG4A 4JQ9A 1JRZA 5EOWA 3V3NA 5CKUA 2BS3A 1O95A 4O5UA 2A8XA 1YY5A 4NTDA 4IA6A 1D7LA 1BZLA 4UP3A 2YR6A 1CJ3A 3RP8A 1ZDLA 3FG2P 2YLRA 2XVEA 4J31A 3ATRA 1H6VA 3BI2A 2XCGA 2XVJA 1FCDA 3AE3A 3GSIA 1EL8A 5EBKA 2EQ6A 2VRLA 2WBAA 2ZZCA 3UKAA 2AAQA 1IUWA 1H82A 4A5LA 1GEUA 3LADA 3FBSA 2YG7A 3NTDA 2JKCA 2VQ7A 1K0LA 4ZCDA 1B4VA 2WHDA 1BKWA 1ZKQA 3NHOX 1CC2A 3V76A 4A9WA 4CY8A 1DNCA 1V59A 1CC4A 1JEHA 4Z43A 1KSUA 3NN6X 2C3CA 4H4TA 2YM1A 2YR5A 3UOXA 5HYMA 2J3NA 2WPEA 3KA7A 1KNRA 2APGA 4USQA 3NN0X 3QFBA 2OA1A 1IJHA 4B67A 3F8DA 1GREA 2DKHA 3NT6A 1LJ1A 1GV4A 1GT8A 2BABA 3I6DA 3RP7A 3H4KA 2YM2A 1TDEA 3PS9A 3SGLA 1VRQB 5C2TA 2GRTA 5JCNA 1L9DA 4FK1C 1NEKA 2GB0A 1S3BA 2TMDA 1GRBA 2DKIA 3F8PA 3BHKA 2X8GA 1QO8A 4OPDA 1CL0A 3SFEA 4A6NB 2YG6A 4GRTA 4B68A 3CIRA 1DOEA 2X99A 4AP3A 3FIMB 4LIIA 4X9MA 1E39A 4Y4NA 3AEBA 4JNAA 2AQJA 3C96A 4Y4LA 5BUKA 3NTAA 2BS2A 5IQ1A 4TLZA 4TM4A 4A79A 2R9ZA 3FPZA 3CNJA 3V3OA 2YVGA 4EMJA 4GDEA 4OPUA 1H7WA 1O94A 3K30A 1JRYA 1QLBA 4H2RA 2GMHA 4EM3A 1IUTA 2B9YA 2BK5A 4ECHA 2XLTA 2TPRA 2F5ZA 4EMWA 4H4UA 3LB8A 1TDKA 2NVKX 1S2QA 2C73A 4MJWA 2X8HA 4P9SA 3KPFA 2BA9A 4UDQA 4X4JA 1M6IA 1MO9A 2XFNA 4OPTA 2WETA 2YLXA 3SFDA 1F8WA 1OJTA 3GYJA 3GYIA 2BXSA 3ICRA 4NTEA 3ALMA 4OVIA 3ZDNA 1Z6LA 3UTGA 2HQMA 4O5QA 4DSGA 4JY2A 2EQ8A 1LTXR 4B69A 3DMEA 4DSHA 1EL7A 3E1TA 3BI4A 4U8IA 3F8RA 3BNUA 4IV9A 2WOIA 1NDAA 2YR4A 3AE7A 4FK1A 3LXDA 4J36A 4OPLA 1JNRA 4OPIA 1GPEA 3UKHA 3K7TA 2R4JA 4KPRA 2A87A 1H84A 2B9WA 2AR8A 2QCUA 1ZMDA 2BXRA 1JRXA 5GRTA 3EF6A 1TYTA 2YQUA 2EQ7A 1LVLA 4U8KA 4K22A 2CVJA 3I3LA 2GR0A 5BRTA 1N4WA 4H50A 2C76A 3BNMA 3HZLA 3GMBA 4EQXA 3KLJA 1VDCA 2R0PA 4U2SA 1NG3A 4JDRA 3UCLA 2BYBA 1N1PA 1CJ2A 2EQ9A 1XANA 1GSNA 4EQRA 1HYUA 1EL9A 3AE9A 3AECA 2IVEA 3M13A 4PAAA 1ONFA 2JK6A 3DJDA 2YVJA 3DA1A 2V3BA 2JAEA 2GR3A 2YLSA 3DK9A 3GWDA 3AEEA 4LA1A 2QA1A 1MOKA 2IIDA 1H83A 4U8MA 3UKKA 3URHA 3CN8A 2FJAA 3BI5A 3AWIA 1TDOA 1EL5A 2Y6RA 3LOVA 1GERA 1JOAA 1KFYA 3CGDA 2JB1A 1PDHA 5U63A 2RGHA 3NK0X 1LPFA 5U25A 4U8NA 2V3AA 1KSSA 3L8KA 4C77A 3K7QX 4CBQA 4J34A 1LQTA 1EBDA 4U8OA 5HHFA 3S61A 1PN0A 2O9ZA 3JSKA 2NPXA 2CDUA 1M64A 5IPYA 5J7XA 2C72A 2YWLA 3NKSA 4C5OA 4ZCCA 1VG0A 3H8IA 2C70A 2CULA 1PBCA 4U2TA 1MXTA 4UDPA 1F8RA 3NNEA 2WP9A 3VRBA 1CF3A 4J2WA 4B63A 3NG7X 4H4WA 1S2YA 3NRNA 4GR1A 5EB5A 3AB1A 3NLCA 3UKQA 1GTHA 1L9EA 2WQYA 2V5ZA 1W4XA 1CC6A 2BK4A 3Q6JA 2Q0KA 3ISHA 3UP5A 2GQFA 3ICSA 5KOXA 4RG4A 4H2QA 1XDIA 3DGZA 3UOYA 4YWOA 2Z5YA 3P4PA 2OAMA 1E6EA 1NHSA 4EIQA 4C74A 1FL2A 1BF3A 3AYJA 4IVOB 3O0HA 4CCQA 2GEWA 1O5WA 2QA2A 4UDRA 2BS4A 3LZWA 3UOZA 3G5RA 4E0VA 4YKFA 2WPCA 1Y56B 2BC0A 3KU9A 4H2NA 4BV6A 4Z2TA 1DJNA 3CGBA 5FS8A 3IF9A 3EANA 3QVRA 1UKVG 2C3DA 1OJ9A 1N4VA 1IUVA 3CNTA 4AP1A 2BACA 3C4AA 3COXA 2VVLA 5C3JA 4BK3A 4CNKA 2QAEA 4X9NA 3P4QA 1GRAA 4GDPA 3BHFA 2VQBA 1GNDA 3GD3A 4I59A 1PBFA 4DGKA 4DNAA 2YG3A 2R0GA 4BJZA 1GXFA 3IHGA 2YLTA 3ALLA 4YSHA 1PXCA 1K0JA 3DGHA 3AE1A 5EB4A 5KOWA 1L0VA 2C75A 1SEZA 2XVFA 2GAGB 4FDCB 1COYA 1YQZA 2XFOA 4ZN0A 4XWRA 2X50A 5CQFA 2WDRA 3UKPA 4ADWA 4K8DA 2C7GA 2YLWA 2WP6A 4YTNA 1NHPA
chains in the Genus database with same CATH superfamily
3D8XA 4GAPA 2WESA 2OALA 4JNQA 5KWFA 3M12A 3AD8B 2ONEA 4H4QA 4ENLA 3L1RA 5KMQA 4IVMB 1R0MA 1P2EA 2ZZBA 3EAOA 1E1KA 3AE8A 1PJ7A 5BVAA 1N5XA 2I0ZA 2PP3A 1K0IA 4A6NA 3CNSA 2DW7A 1MUCA 4H19A 1CHUA 5JCKA 3NYEA 2W3SA 3TJ4A 5KNLA 1SJDA 2I5QA 3VRDB 3DJEA 4OCGA 7ENLA 5BOFA 2XH7A 4B65A 1TDFA 2RGOA 1CJCA 1Q1RA 1D7YA 2PA6A 3Q9TA 1H86A 4KPLA 3ABVA 3NK2X 3K7MX 2W54A 1XS2A 2GGEA 2HNEA 4BJYA 1H81A 3P4RA 2B9XA 3EEZA 2WU2A 3CNDA 2R45A 1GOSA 2XYOA 3OZ2A 2FJBA 2ZBWA 4WX1A 4HB9A 4C3XA 3R11A 2WP5A 2NQLA 1RSGA 2Q0LA 3R0UA 4RG3A 2XVIA 3AE6A 2B7RA 5U1OA 1DODA 4H4PA 4EMIA 2V6OA 4D04A 2B76A 3S47A 1VQWA 5KXJA 2WS3A 4U2LA 2C66A 1PDZA 3QJ4A 3SN1A 1GTEA 3GWFA 2IVDA 3UTFA 1OJDA 3WE0A 3AEGA 3ADAB 3DK4A 2QJMA 3CXBA 3ITJA 2QGYA 1CJ4A 2FJEA 3RGTA 2ARDA 1K4QA 3IC9A 1E1MA 1ELIA 3CGEA 3PVCA 4D03A 3NRZB 1ZOYA 4BK2A 2PP1A 1N4UA 4HCDA 3NH3X 2XSXA 5FS9A 2XLUA 5IQ4A 2RABA 3P4SA 1BGJA 1E7PA 2C64A 3CPJG 2BC1A 4BURA 2Z5XA 3RCYA 1F6MA 4ROPA 3CB3A 5JCMA 3NYCA 3ZVHA 4BK1A 4GUVA 4G7FA 2XLRA 2QDDA 2ZC8A 3DFHA 4J33A 3SZWA 2OZTA 4K5SA 3UTHA 3SZCA 1PXAA 2P8CA 4KEMA 3GDPA 3FMWA 3GRSA 3T6CA 3VCNA 1ZY8A 1EC8A 2GQWA 2GH5A 3N4FA 1NHQA 1N60C 4HYRA 3DESA 2YG4A 4JQ9A 2BS3A 4GMEA 2A8XA 1D7LA 3TJIA 3TWAA 2YLRA 4J31A 3DERA 2XCGA 2VRLA 3SN4A 2WBAA 3UJFA 2VQ7A 3IJLA 3ES8A 4A9WA 3B97A 4CY8A 1CC4A 1KSUA 3U4FA 2YM1A 3NN0X 3QFBA 1IJHA 4B67A 3ZLGA 2BABA 2GRTA 3P3BA 2PS2A 3F8PA 2X8GA 1QO8A 2YG6A 3AEBA 5IQ1A 4TLZA 4A79A 3V3OA 3CNJA 2YVGA 1JRYA 2OQYA 1IUTA 1XPYA 1E9IA 2F5ZA 3LB8A 2OZ3A 1TDKA 4MJWA 2X8HA 2OX4A 2E5AA 2BA9A 3KPFA 1M6IA 3SFDA 3GYJA 3GYIA 3KPKA 2OKTA 3ZDNA 1LTXR 3DMEA 3BI4A 4IV9A 4J36A 4FK1A 4OPIA 1IYXA 3K7TA 2B9WA 2AR8A 2QCUA 1ZMDA 1TYTA 2YQUA 4H50A 3GMBA 3UCDA 2R0PA 1NG3A 3UCLA 2BYBA 1CJ2A 1XANA 1GSNA 3AE9A 3DJDA 1N61C 3DK9A 3ETRB 4DYEA 5JRBA 2Y6RA 3CGDA 2JB1A 2OO6A 1PDHA 3V5FA 2PGWA 1KSSA 4G73A 4C77A 4J34A 1EBDA 3S61A 2NPXA 2CDUA 5IPYA 3Q45A 4GIRA 2OLAA 4ZCCA 1PBCA 1CF3A 2AL2A 4IP5A 1L9EA 2WQYA 3I6TA 4H2HA 1CC6A 1W4XA 5KOXA 4H2QA 1XDIA 2P8BA 1X2GA 2PTWA 3UOYA 3P4PA 2OAMA 1E6EA 1BF3A 2FYMA 4E0VA 4YKFA 2WPCA 5ENLA 5FS8A 4AP1A 3CNTA 3C4AA 3COXA 2VVLA 4BK3A 4NNJA 1GRAA 4GDPA 2VQBA 2GL5A 2P0IA 2YG3A 2YLTA 1W6TA 5FJUA 3NS1B 4FDCB 1COYA 3UKPA 4K8DA 3ENLA 1KN0A 3IJIA 4OPGA 1ZK7A 5L46A 3OP2A 2W0HA 4YTPA 3H12A 1TKKA 1OJCA 4B64A 3UXKA 5KVIA 3IWAA 4JY3A 3KD9A 3GRTA 2E1MA 5J60A 2GR2A 3CXOA 1F9CA 3ICTA 2ACZA 4Y4MA 2WDQA 3T2ZA 2PP0A 3DEQA 4NWZA 3OW1A 1CBOA 1NAAA 1SB3B 3CTYA 4A7AA 5JCLA 3AEAA 3CGCA 3BOXA 1GALA 4APNA 3C4NA 4YSYA 2BRAA 4GYPA 4NEWA 2CHRA 1ZP0A 1Y0PA 2HZGA 4YKGA 5BOEA 1KD0A 2XDOA 1DOBA 5BULA 4K7ZA 1ZOVA 1EC9A 1FOHA 4H4SA 3D1CA 2XFPA 3G5QA 1NU5A 3P0WA 4G9KA 3VCCA 1JPDX 4G6GA 3QSMA 1F3PA 4TM0A 3EKGA 4J1OA 3B3RA 5FJOA 3AE4A 4I58A 3SQSA 5DBJA 3DH9A 4H7UA 4H4XA 3VQRA 2POZA 4KT2A 5G5GB 2PSNA 1FEAA 1MNSA 4AOXA 4OPCA 3FV9A 2CFYA 3QKEA 4H83A 4YSXA 5KVHA 1JDFA 2Y6QA 1RM6B 4CCRA 2GF3A 4J56A 3VFCA 3II4A 4E6MA 3VR8A 3D47A 1MDLA 1YQ3A 2W3RA 3CYJA 2WU5A 1Y56A 3UKLA 3SZFA 3KUMA 5FJRA 4KX6A 2PTXA 2VZ2A 4EWJA 2YVFA 2GGHA 3UKFA 4NZHA 4EM4A 1TDNA 4WCTA 3QSEA 4USRA 4IZGA 1PBDA 3NK1X 1KF6A 1PJ6A 1RYIA 1JNZA 3KKJA 3R9UA 3T0KA 1PBBA 2GMJA 5FJTA 1WUEA 2MUCA 3KVEA 3N6JA 3DDMA 2HXTA 4U8JA 5FS6A 3M0OA 2PTYA 2XLPA 1JCTA 3LJPA 1P43A 5HY5A 3T2YA 4GGBA 5FS7A 1NENA 4YT0A 1BWCA 3AYIA 4H2PA 3V3NA 1O95A 4NTDA 4MKSA 2YR6A 1CJ3A 3GSIA 3NXLA 3T8QA 3UKAA 3TOYA 1IUWA 4A5LA 2JKCA 1B4VA 2WHDA 3NHOX 3RITA 1JEHA 3NN6X 2C3CA 4ZCWA 4H4TA 3SSZA 5HYMA 3TWBA 2WPEA 3KA7A 3UGVA 3UJEA 1GT8A 4II2A 1TDEA 5C2TA 4FK1C 2GB0A 3GD6A 2BRYA 3SFEA 4A6NB 5G5HB 3FIMB 4Y4NA 2AQJA 3ES7A 3N6HA 2BS2A 3U9IA 4OPUA 1H7WA 3K30A 4H2RA 3NVVB 2XLTA 4EMWA 2C73A 2NVKX 3SGLA 4MGGA 4X4JA 1MO9A 2XFNA 3CK5A 2WETA 2YLXA 2BXSA 3ICRA 4NTEA 1N5WC 3RO6A 4DSHA 4DXKA 1EL7A 3E1TA 3F8RA 2WOIA 4HNCA 2AKMA 2XH2A 3HW2A 3PWIA 3IK4A 1SJCA 3R25A 2EQ7A 2GR0A 1N4WA 4EQXA 3NVZB 3MZNA 2OQHA 4JDRA 1N1PA 2EQ9A 3AECA 2IVEA 2JAEA 2GR3A 3B9JB 3AEEA 4H1ZA 3Q4DA 3N4EA 1MOKA 4JN7A 3P93A 3UKKA 2FJAA 1TDOA 3LOVA 5U63A 3NK0X 4U8NA 3L8KA 4K2SA 1DTNA 1P48A 5HHFA 2C72A 2YWLA 4C5OA 1TZZA 3H8IA 2CULA 1MXTA 4UDPA 3MY9A 3NNEA 4B63A 3NG7X 1S2YA 3NRNA 4GR1A 1JRPA 3UKQA 3HYXA 3ISHA 2GQFA 4RG4A 4IL2A 4K1WA 2Z5YA 1NHSA 4IVOB 4UDRA 3LZWA 3DG7A 3KU9A 4M0XA 4BV6A 3AN1A 3CGBA 1FIQB 1UKVG 2C3DA 1JPMA 1KKOA 2BACA 4GAVA 5C3JA 4CNKA 3GD3A 4DGKA 3IHGA 4YSHA 1PXCA 3SBFA 3DGHA 3AE1A 5EB4A 2C75A 2RDXA 3ZVHB 4YTNA 2C7GA 3A7UA 2WP6A 4XWZA 3OPSA 4YWSA 3NO1A 2FBWA 3I4KA 3PG6A 3JW7A 2JB3A 1IUSA 3PWGA 1D5TA 2RGJA 3CPHG 4GYPC 4Z26A 2XFUA 4TVYA 2GV8A 3PK7A 1LV0A 3DIPA 5GSNA 3RHAA 3QFAA 1YKJA 3MQTA 2B7SA 4N9XA 4Z25A 3ZYXA 3UJSA 1KDGA 3AD7B 1ONEA 3T14A 4NEVA 4Z44A 3T31A 2GR1A 2UZZA 3UXLA 3T37A 4B66A 3R07C 2JB2A 2XVHA 1YEYA 2FKPA 3JZUA 2PTZA 1XHCA 5KMPA 5KRQA 4RSLA 3AYLA 3HYVA 3FCPA 3QPEA 1PXBA 3CNPA 3FJ4A 2E5VA 3SQPA 3SM8A 4K5RA 2FJDA 2OLOA 1B5QA 2VVLG 5M10A 3RP6A 4Z24A 4G8TA 4AT0A 4ZA0A 4M6UA 1BQGA 4C3YA 1OEPA 4HPNA 1F8SA 1SJAA 1TRBA 4A99A 1E1NA 2GGGA 1NG4A 4CRTA 2R46A 2YG5A 4HNLA 4CY6A 3P9UA 2C67A 1H7XA 4LU6A 1FECA 4J57A 3NVYB 4TLXA 1AOGA 4Z2RA 2PPGA 1JU2A 3DJJA 3BJSA 2VRMA 3VC6A 3JVAA 1X2HA 5LV9A 3CPIG 4K2XA 2A89A 2H89A 1VG9A 3IHMA 4HN8A 3HYWA 2BCPA 5ER0A 1GRGA 1ZX9A 3SZ0A 2GAHB 1LQUA 2WPFA 1OJAA 2WEUA 3UTEA 1GESA 3DG6A 4REKA 1VQZA 3P1WA 3RNMA 3HPFA 4E4UA 4GCMA 1EC7A 2GGIA 3AE2A 3V5CA 3H8AA 1T3QC 3OZMA 3PFRA 2XGZA 1S3EA 2AL2B 1L9CA 2V60A 2WOVA 4HCHA 2XLSA 1FHVA 2X3NA 4DN1A 1WUFA 4FX9A 3NZGA 4JN8A 2BK3A 4TM1A 2X8CA 1B37A 1L8PA 4AT2A 2BCGG 5TR3A 3ZLFA 2GVCA 1D4EA 3AM9A 5JCIA 2P88A 5CKUA 1ZDLA 2XVEA 2DW6A 1FCDA 3AE3A 3SX6A 2OPJA 2AAQA 3HRDC 3IJQA 2YG7A 2OZ8A 2OVLA 1KCZA 4G6HA 1BKWA 3R10A 1V59A 3THUA 4Z43A 4K8GA 3UJRA 3SR6B 2PU0A 2E3TA 2OA1A 2AL1A 3CMMA 1LJ1A 1GV4A 3GO2A 3RP7A 1VDVA 3PS9A 1VRQB 3NFUA 5JCNA 3R0KA 3T9PA 2TMDA 2DKIA 3ZVIA 4OPDA 3ZLHA 4B68A 3CIRA 1DOEA 2X99A 4F4RA 4X9MA 4GFIA 3C96A 5BUKA 3NTAA 4EMJA 4GDEA 3K1GA 1O94A 2HXUA 2GMHA 2TPRA 3GC2A 4H4UA 1S2QA 4UDQA 2PMQA 3SJNA 1OJTA 3GY1A 3ALMA 4OVIA 3UTGA 4DSGA 3S5SA 4B69A 2EQ8A 3BNUA 1NDAA 3AE7A 1JNRA 3FYYA 1GPEA 3UKHA 2R4JA 1H84A 1JRXA 3VC5A 3DFYA 1LVLA 3I3LA 1JROA 2C76A 3BNMA 3M13A 2JK6A 2YVJA 3CT2A 2YLSA 3GWDA 2IIDA 2GDQA 3URHA 3CN8A 3BI5A 3AWIA 1JOAA 4FP1A 4DX3A 3K7QX 3OZYA 1PN0A 2O9ZA 3JSKA 2MNRA 5J7XA 1MRAA 1VG0A 2C70A 1F8RA 3STPA 3VRBA 1SJBA 4E4FA 1GTHA 3SN0A 2V5ZA 3Q6JA 2C4CA 2PCEA 3UP5A 3DGZA 2OG9A 4ZOHB 4YWOA 4EIQA 1FL2A 3AYJA 4CCQA 2QA2A 2BS4A 3QLDA 1Y56B 4H2NA 4Z2TA 2QVHA 1DJNA 3IF9A 3QVRA 1N62C 2QAEA 4X9NA 3P4QA 1H2IA 3BHFA 1PBFA 4BJZA 1GXFA 3TQPA 1K0JA 1L0VA 1SEZA 2GAGB 2XFOA 4X2PA 2X50A 2WDRA 1NELA 2YLWA 4DWDA 4JN9A 3A7RA 6ENLA 1X31B 1PJ5A 3T2KA 3S5WA 4H4YA 2Q7VA 4B1BA 1IUXA 1XPQA 4EQSA 1N63C 4HCLA 1PBEA 3FVDA 1FO4A 3AE5A 2H88A 3ATQA 1KKRA 1RP0A 3RR1A 1FFUC 4XXGA 4EIPA 3EPTA 1B8SA 4GF7A 3UP4A 2O56A 1FEBA 1ECQA 2XFQA 4E5TA 1GRHA 4AOSA 2R0CA 3MSYA 4H4RA 4Z2UA 4EQWA 1DJQA 1PHHA 1KNPA 2Q6UA 3VR9A 1NPXA 4G74A 1RVKA 3AEFA 5HXIA 3NIXA 5KMRA 3CAWA 3UOVA 4GGHA 4YTMA 3REDA 1FFVC 3L5OA 3AXBA 3G5SA 1DOCA 1GRTA 4IL0A 5EU9A 1YQ4A 3VDGA 4M52A 3VA8A 4A35A 2PODA 1V97A 4U8LA 1IUUA 3GYXA 3H70A 3GD4A 4PABA 3AEDA 1TYPA 1S7MA 3QSSA 1PDYA 4YSZA 3NYFA 2PYXA 3ALJA 3R1ZA 1REOA 3LZXA 4DHGA 3A7AA 4A65A 2YAUA 5M0ZA 4KWSA 4ICYA 4YXDA 1EBHA 3DK8A 2VOUA 2E4GA 3NGCX 4HA6A 3VRAA 1ZMCA 1ELSA 2OLNA 4E8GA 1ZXIC 3GDNA 3SXIA 4TM3A 5KMSA 1BGNA 4H4ZA 4IA5A 1P2HA 3H8LA 3DJGX 1E1LA 4II3A 4CNJA 1DXLA 4J3ZA 1D4DA 2PHHA 3OTRA 2ZZ0A 3PO7A 1D4CA 1Q1WA 4NTCA 1GETA 1PS9A 1NHRA 2C65A 3B6DA 2PU1A 4GISA 4U8PA 2QJNA 2WOWA 2VVMA 3DG3A 4A6GA 3EUB3 2WDVA 2JBVA 3QVPA 1GRFA 4IHCA 3AD9B 5FMHA 1R6WA 4H4VA 3GMCA 2YLZA 2V61A 2R4EA 1QJDA 1Q9IA 3T4WA 3OC4A 1JRZA 5EOWA 3D46A 4FI4A 4O5UA 1YY5A 4IA6A 1BZLA 4UP3A 2QJJA 3FXGA 3RP8A 3FG2P 3ATRA 1H6VA 3BI2A 2W55A 2XVJA 1EL8A 5EBKA 2EQ6A 2GSHA 4JHMA 2ZZCA 1H82A 1GEUA 3LADA 3FBSA 3NTDA 1K0LA 4ZCDA 3NVWB 1ZKQA 5J04A 3QTPA 2OFJA 4Z17A 1CC2A 3V76A 1DNCA 2GGJA 2YR5A 3UOXA 2J3NA 1KNRA 2APGA 4USQA 3MKCA 3F8DA 1GREA 2DKHA 3NT6A 1BKHA 3I6DA 3H4KA 2YM2A 5IDZA 3MWCA 1L9DA 3UJ2A 1NEKA 1S3BA 1GRBA 3BHKA 3H7VA 5FJPA 1CL0A 4GRTA 4AP3A 4LIIA 3V3WA 1E39A 3SY4A 3TCSA 1WYGA 3D9XA 4JNAA 4Y4LA 4TM4A 2R9ZA 3FPZA 3UCCA 3TTEA 1QLBA 4EM3A 2B9YA 2BK5A 4ECHA 3AMZA 4P9SA 3QN3A 4OPTA 1F8WA 4IP4A 1Z6LA 2HQMA 4O5QA 4JY2A 3BSMA 4U8IA 3V4BA 2YR4A 4OPLA 3LXDA 1TE6A 4KPRA 2A87A 2BXRA 5GRTA 3EF6A 4U8KA 4K22A 2CVJA 5BRTA 3HZLA 3SYIA 3KLJA 1VDCA 4U2SA 4EQRA 1HYUA 1EL9A 4PAAA 1MDRA 1ONFA 3DA1A 2V3BA 2PGEA 4LA1A 2QA1A 1H83A 4U8MA 1FHUA 4Z1YA 2QQ6A 1EL5A 1GERA 1KFYA 4MMWA 2RGHA 1LPFA 3MUCA 4IT1A 5U25A 2V3AA 3DGBA 4CBQA 1LQTA 4U8OA 1M64A 3NKSA 2AKZA 4U2TA 2QDEA 2WP9A 4J2WA 4H4WA 2XH0A 2ZADA 5EB5A 3I6EA 3AB1A 3NLCA 3TW9A 2BK4A 2Q0KA 3ICSA 2P3ZA 4C74A 2XH4A 3O0HA 2GEWA 1O5WA 1STZA 3UOZA 3G5RA 2BC0A 3EANA 1OJ9A 1N4VA 1IUVA 4A3RA 3RRAA 1GNDA 1EBGA 4I59A 4TVWA 4DNAA 2R0GA 3ALLA 5KOWA 2XVFA 1YQZA 4ZN0A 4XWRA 5CQFA 4ADWA 1NHPA
chains in the Genus database with same CATH topology
4XWZA 3D8XA 4GAPA 1KN0A 2WESA 2FBWA 2OALA 4JN9A 4JNQA 3PG6A 1ZK7A 4OPGA 5L46A 5KWFA 3M12A 3AD8B 2JB3A 1X31B 1PJ5A 2W0HA 3T2KA 4YTPA 1IUSA 3S5WA 1D5TA 4H4YA 1OJCA 2RGJA 2Q7VA 3CPHG 4B1BA 4B64A 4H4QA 1IUXA 3L1RA 5KMQA 4IVMB 5KVIA 3IWAA 1XPQA 4JY3A 4Z26A 1P2EA 2ZZBA 3GRTA 4EQSA 2XFUA 3KD9A 1PBEA 2E1MA 2GV8A 5J60A 2GR2A 1LV0A 3AE5A 3EAOA 1E1KA 2H88A 3AE8A 3ICTA 1PJ7A 3ATQA 5GSNA 3RHAA 5BVAA 3QFAA 1YKJA 2I0ZA 2B7SA 4N9XA 1K0IA 4A6NA 3CNSA 2ACZA 4Z25A 3ZYXA 1CHUA 1RP0A 5JCKA 1KDGA 3AD7B 3T14A 4Y4MA 2WDQA 3T2ZA 4NEVA 3NYEA 4Z44A 5KNLA 4NWZA 1CBOA 1NAAA 3T31A 4XXGA 4EIPA 2GR1A 3EPTA 1B8SA 3CTYA 2UZZA 3VRDB 3DJEA 4A7AA 4GF7A 4OCGA 3T37A 3UP4A 5JCLA 4B66A 3AEAA 2JB2A 3CGCA 1FEBA 2XVHA 2XFQA 1GRHA 4B65A 1TDFA 1XHCA 5KMPA 5KRQA 4RSLA 3AYLA 2RGOA 3HYVA 1CJCA 1Q1RA 4AOSA 1GALA 4APNA 1D7YA 3C4NA 4YSYA 1PXBA 2R0CA 3CNPA 3Q9TA 2BRAA 4H4RA 4NEWA 1H86A 3ABVA 4Z2UA 3NK2X 4EQWA 1ZP0A 1DJQA 3K7MX 1Y0PA 1PHHA 2E5VA 3SQPA 1KNPA 2Q6UA 3SM8A 3VR9A 1NPXA 4G74A 4K5RA 3AEFA 4YKGA 2FJDA 2OLOA 5HXIA 1B5QA 2VVLG 3NIXA 4BJYA 5KMRA 3UOVA 2XDOA 5M10A 3RP6A 4YTMA 4Z24A 1DOBA 3REDA 1H81A 4AT0A 5BULA 4K7ZA 1ZOVA 1FOHA 3P4RA 2B9XA 3L5OA 4H4SA 1F8SA 2WU2A 3AXBA 2R45A 3CNDA 4C3YA 3G5SA 1DOCA 1GRTA 1YQ4A 4M52A 1TRBA 1GOSA 2XYOA 3D1CA 3OZ2A 4A99A 1E1NA 2FJBA 2ZBWA 1NG4A 2XFPA 4WX1A 3G5QA 4HB9A 4CRTA 4C3XA 4G9KA 2R46A 2YG5A 2WP5A 1RSGA 2Q0LA 4U8LA 4CY6A 1IUUA 3GYXA 4G6GA 4RG3A 3GD4A 2XVIA 3AE6A 3P9UA 4PABA 2B7RA 5U1OA 2C67A 1DODA 1F3PA 3QSMA 1H7XA 4LU6A 4H4PA 4EMIA 1FECA 3AEDA 2V6OA 4D04A 4TM0A 4J57A 2B76A 5KXJA 1VQWA 2WS3A 1TYPA 3B3RA 4TLXA 1AOGA 1S7MA 3QSSA 4Z2RA 1JU2A 4U2LA 4YSZA 3AE4A 3NYFA 3DJJA 4I58A 2PYXA 3ALJA 2VRMA 5DBJA 2C66A 3DH9A 1REOA 3QJ4A 4H7UA 3LZXA 1GTEA 3GWFA 2IVDA 5LV9A 3CPIG 4H4XA 4K2XA 3UTFA 3VQRA 4A65A 2YAUA 5M0ZA 2A89A 2H89A 4ICYA 1OJDA 4YXDA 1FEAA 1VG9A 3WE0A 4AOXA 3DK8A 4OPCA 3AEGA 2VOUA 2E4GA 3NGCX 4HA6A 3VRAA 3IHMA 3ADAB 1ZMCA 2CFYA 3HYWA 4YSXA 2BCPA 3DK4A 5ER0A 2OLNA 1GRGA 3ITJA 5KVHA 1ZX9A 1CJ4A 3GDNA 3SXIA 2FJEA 3SZ0A 2Y6QA 2ARDA 4TM3A 2GAHB 4CCRA 1K4QA 3IC9A 1E1MA 5KMSA 2GF3A 4J56A 3II4A 3VR8A 1ELIA 1LQUA 2WPFA 1YQ3A 3CGEA 3PVCA 1OJAA 1BGNA 4D03A 2WEUA 4H4ZA 4IA5A 1GESA 3UTEA 1P2HA 1ZOYA 2WU5A 3H8LA 4BK2A 3DJGX 1Y56A 3UKLA 3SZFA 1E1LA 4II3A 4KX6A 4CNJA 1N4UA 1DXLA 2VZ2A 2YVFA 1D4DA 4REKA 3NH3X 2PHHA 5FS9A 2XLUA 3P1WA 3UKFA 4NZHA 5IQ4A 2ZZ0A 3RNMA 4EM4A 1TDNA 3PO7A 1D4CA 1Q1WA 2RABA 4WCTA 3P4SA 3QSEA 1BGJA 1E7PA 2C64A 4GCMA 3CPJG 2BC1A 4USRA 1PBDA 3AE2A 4NTCA 3NK1X 1KF6A 1GETA 1PJ6A 1RYIA 1PS9A 1NHRA 1JNZA 2C65A 4BURA 3B6DA 3KKJA 3R9UA 3T0KA 2Z5XA 1PBBA 2GMJA 1F6MA 5JCMA 3NYCA 3KVEA 4BK1A 4GUVA 1S3EA 4U8PA 4U8JA 2VVMA 2WOWA 5FS6A 1L9CA 2XLRA 3M0OA 2V60A 2WOVA 2XLSA 2WDVA 2JBVA 2X3NA 3QVPA 2XLPA 4J33A 3LJPA 1GRFA 3SZWA 3AD9B 4K5SA 5FMHA 4FX9A 5HY5A 3T2YA 4H4VA 3UTHA 3SZCA 1PXAA 2BK3A 3GMCA 2YLZA 4TM1A 3GDPA 3FMWA 2X8CA 3GRSA 5FS7A 2V61A 1B37A 2R4EA 1ZY8A 2GQWA 1QJDA 2GH5A 4AT2A 1NENA 2BCGG 1Q9IA 4YT0A 1BWCA 1NHQA 5TR3A 3OC4A 2GVCA 3AYIA 1D4EA 5JCIA 4H2PA 2YG4A 4JQ9A 1JRZA 5EOWA 3V3NA 5CKUA 2BS3A 1O95A 4O5UA 2A8XA 1YY5A 4NTDA 4IA6A 1D7LA 1BZLA 4UP3A 2YR6A 1CJ3A 3RP8A 1ZDLA 3FG2P 2YLRA 2XVEA 4J31A 3ATRA 1H6VA 3BI2A 2XCGA 2XVJA 1FCDA 3AE3A 3GSIA 1EL8A 3SX6A 5EBKA 2EQ6A 2VRLA 2WBAA 2ZZCA 3UKAA 2AAQA 1IUWA 1H82A 4A5LA 1GEUA 3LADA 3FBSA 2YG7A 3NTDA 2JKCA 2VQ7A 1K0LA 4ZCDA 1B4VA 2WHDA 4G6HA 1BKWA 1ZKQA 3NHOX 1CC2A 3V76A 4A9WA 4CY8A 1DNCA 1V59A 1CC4A 1JEHA 4Z43A 1KSUA 3NN6X 2C3CA 4H4TA 2YM1A 2YR5A 3UOXA 5HYMA 2J3NA 2WPEA 3KA7A 1KNRA 2APGA 4USQA 3NN0X 3QFBA 2OA1A 1IJHA 4B67A 3F8DA 1GREA 2DKHA 3NT6A 3CMMA 1LJ1A 1GV4A 1GT8A 4II2A 2BABA 3I6DA 3RP7A 3H4KA 2YM2A 1TDEA 3PS9A 3SGLA 1VRQB 5C2TA 2GRTA 5JCNA 1L9DA 4FK1C 1NEKA 2GB0A 1S3BA 2TMDA 1GRBA 2DKIA 3F8PA 3BHKA 2X8GA 1QO8A 4OPDA 1CL0A 2BRYA 3SFEA 4A6NB 2YG6A 4GRTA 4B68A 3CIRA 1DOEA 2X99A 4AP3A 3FIMB 4LIIA 4X9MA 1E39A 4Y4NA 3AEBA 3SY4A 3D9XA 2AQJA 3C96A 4JNAA 4Y4LA 3NTAA 2BS2A 5BUKA 5IQ1A 4TLZA 4TM4A 4A79A 2R9ZA 3FPZA 3CNJA 3V3OA 2YVGA 4EMJA 4GDEA 4OPUA 1H7WA 1O94A 3K30A 1JRYA 1QLBA 4H2RA 2GMHA 4EM3A 1IUTA 2B9YA 2BK5A 4ECHA 2XLTA 2TPRA 2F5ZA 4EMWA 4H4UA 3LB8A 1TDKA 2NVKX 1S2QA 2C73A 4MJWA 2X8HA 4P9SA 3KPFA 2BA9A 4UDQA 4X4JA 1M6IA 1MO9A 2XFNA 4OPTA 2WETA 2YLXA 3SFDA 1F8WA 1OJTA 3GYJA 3GYIA 2BXSA 3ICRA 3KPKA 4NTEA 3ALMA 4OVIA 3ZDNA 1Z6LA 3UTGA 2HQMA 4O5QA 4DSGA 4JY2A 2EQ8A 1LTXR 4B69A 3DMEA 4DSHA 1EL7A 3E1TA 3BI4A 4U8IA 3F8RA 3BNUA 4IV9A 2WOIA 1NDAA 2YR4A 3AE7A 4FK1A 3LXDA 4J36A 4OPLA 1JNRA 4OPIA 1GPEA 3UKHA 3K7TA 2R4JA 4KPRA 2A87A 1H84A 2B9WA 2AR8A 2QCUA 1ZMDA 2BXRA 1JRXA 5GRTA 3EF6A 1TYTA 2YQUA 2EQ7A 1LVLA 4U8KA 4K22A 2CVJA 3I3LA 2GR0A 5BRTA 1N4WA 4H50A 2C76A 3BNMA 3HZLA 3GMBA 4EQXA 3SYIA 3KLJA 1VDCA 2R0PA 4U2SA 1NG3A 4JDRA 3UCLA 2BYBA 1N1PA 1CJ2A 2EQ9A 1XANA 1GSNA 4EQRA 1HYUA 1EL9A 3AE9A 3AECA 2IVEA 3M13A 4PAAA 1ONFA 2JK6A 3DJDA 2YVJA 3DA1A 2V3BA 2JAEA 2GR3A 2YLSA 3DK9A 3GWDA 3AEEA 4LA1A 2QA1A 1MOKA 2IIDA 1H83A 4U8MA 3UKKA 5JRBA 3URHA 3CN8A 2FJAA 3BI5A 3AWIA 1TDOA 1EL5A 2Y6RA 3LOVA 1GERA 1JOAA 1KFYA 3CGDA 2JB1A 1PDHA 5U63A 2RGHA 3NK0X 1LPFA 5U25A 4U8NA 2V3AA 1KSSA 3L8KA 4G73A 4C77A 3K7QX 4CBQA 4J34A 1LQTA 1EBDA 4U8OA 5HHFA 3S61A 1PN0A 2O9ZA 3JSKA 2NPXA 2CDUA 1M64A 5IPYA 5J7XA 2C72A 2YWLA 3NKSA 4C5OA 4ZCCA 1VG0A 3H8IA 2C70A 2CULA 1PBCA 4U2TA 1MXTA 4UDPA 1F8RA 3NNEA 2WP9A 3VRBA 1CF3A 4J2WA 4B63A 3NG7X 4H4WA 1S2YA 3NRNA 4GR1A 5EB5A 3AB1A 3NLCA 3UKQA 1GTHA 1L9EA 3HYXA 2WQYA 2V5ZA 1W4XA 1CC6A 2BK4A 3Q6JA 2Q0KA 2C4CA 3ISHA 3UP5A 2GQFA 3ICSA 5KOXA 4RG4A 4H2QA 1XDIA 3DGZA 3UOYA 4YWOA 2Z5YA 3P4PA 2OAMA 1E6EA 1NHSA 4EIQA 4C74A 1FL2A 1BF3A 3AYJA 4IVOB 3O0HA 4CCQA 2GEWA 1O5WA 2QA2A 4UDRA 2BS4A 3LZWA 3UOZA 3G5RA 4E0VA 4YKFA 2WPCA 1Y56B 2BC0A 3KU9A 4H2NA 4BV6A 4Z2TA 1DJNA 3CGBA 5FS8A 3IF9A 3EANA 3QVRA 1UKVG 2C3DA 1OJ9A 1N4VA 1IUVA 3CNTA 4AP1A 2BACA 3C4AA 4GAVA 3COXA 2VVLA 5C3JA 4BK3A 4CNKA 2QAEA 4X9NA 3P4QA 4NNJA 1H2IA 1GRAA 4GDPA 3BHFA 2VQBA 1GNDA 3GD3A 4I59A 1PBFA 4DGKA 4DNAA 2YG3A 2R0GA 4BJZA 1GXFA 3IHGA 2YLTA 3ALLA 4YSHA 1PXCA 1K0JA 3DGHA 3AE1A 5EB4A 5KOWA 1L0VA 2C75A 1SEZA 2XVFA 2GAGB 4FDCB 1COYA 1YQZA 2XFOA 4ZN0A 4XWRA 2X50A 5CQFA 2WDRA 3UKPA 4ADWA 4K8DA 2C7GA 2YLWA 2WP6A 4YTNA 1NHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWZ A;  3D8X A;  2WES A;  2FBW A;  2OAL A;  4JN9 A;  4JNQ A;  4OPG A;  1ZK7 A;  5L46 A;  5KWF A;  3M12 A;  3AD8 B;  2JB3 A;  1X31 B;  1PJ5 A;  2W0H A;  4YTP A;  1IUS A;  3S5W A;  1D5T A;  4H4Y A;  1OJC A;  2RGJ A;  2Q7V A;  3CPH G;  4B1B A;  4B64 A;  4H4Q A;  1IUX A;  3L1R A;  4IVM B;  5KVI A;  3IWA A;  1XPQ A;  4JY3 A;  4Z26 A;  1P2E A;  2ZZB A;  3GRT A;  4EQS A;  2XFU A;  3KD9 A;  1PBE A;  2E1M A;  2GV8 A;  5J60 A;  2GR2 A;  1LV0 A;  3AE5 A;  3EAO A;  1E1K A;  2H88 A;  3AE8 A;  3ICT A;  1PJ7 A;  3ATQ A;  5GSN A;  3RHA A;  5BVA A;  3QFA A;  1YKJ A;  2I0Z A;  2B7S A;  4N9X A;  1K0I A;  4A6N A;  3CNS A;  2ACZ A;  4Z25 A;  3ZYX A;  1CHU A;  1RP0 A;  5JCK A;  1KDG A;  3AD7 B;  4Y4M A;  2WDQ A;  4NEV A;  3NYE A;  4Z44 A;  1CBO A;  1NAA A;  4XXG A;  4EIP A;  2GR1 A;  3EPT A;  1B8S A;  3CTY A;  2UZZ A;  3VRD B;  3DJE A;  4A7A A;  4GF7 A;  4OCG A;  3T37 A;  3UP4 A;  5JCL A;  4B66 A;  3AEA A;  2JB2 A;  3CGC A;  1FEB A;  2XVH A;  2XFQ A;  1GRH A;  4B65 A;  1TDF A;  1XHC A;  5KRQ A;  4RSL A;  3AYL A;  2RGO A;  1CJC A;  1Q1R A;  4AOS A;  1GAL A;  4APN A;  1D7Y A;  3C4N A;  4YSY A;  1PXB A;  2R0C A;  3CNP A;  3Q9T A;  4H4R A;  4NEW A;  1H86 A;  3ABV A;  4Z2U A;  3NK2 X;  4EQW A;  1ZP0 A;  1DJQ A;  3K7M X;  1Y0P A;  1PHH A;  2E5V A;  3SQP A;  1KNP A;  2Q6U A;  3SM8 A;  3VR9 A;  1NPX A;  4K5R A;  3AEF A;  4YKG A;  2FJD A;  2OLO A;  5HXI A;  1B5Q A;  2VVL G;  3NIX A;  4BJY A;  3UOV A;  2XDO A;  5M10 A;  3RP6 A;  4YTM A;  4Z24 A;  1DOB A;  3RED A;  1H81 A;  4AT0 A;  5BUL A;  4K7Z A;  1ZOV A;  1FOH A;  3P4R A;  2B9X A;  2WU2 A;  4H4S A;  1F8S A;  3AXB A;  3CND A;  2R45 A;  4C3Y A;  3G5S A;  1DOC A;  1GRT A;  1YQ4 A;  4M52 A;  1TRB A;  1GOS A;  2XYO A;  3D1C A;  3OZ2 A;  4A99 A;  1E1N A;  2FJB A;  2ZBW A;  1NG4 A;  2XFP A;  4WX1 A;  3G5Q A;  4HB9 A;  4CRT A;  4C3X A;  2R46 A;  2YG5 A;  2WP5 A;  1RSG A;  2Q0L A;  4U8L A;  4CY6 A;  1IUU A;  4RG3 A;  3GD4 A;  2XVI A;  3AE6 A;  3P9U A;  4PAB A;  2B7R A;  5U1O A;  2C67 A;  1DOD A;  1F3P A;  3QSM A;  1H7X A;  4LU6 A;  4H4P A;  4EMI A;  1FEC A;  3AED A;  2V6O A;  4D04 A;  4TM0 A;  4J57 A;  2B76 A;  5KXJ A;  1VQW A;  2WS3 A;  1TYP A;  3B3R A;  4TLX A;  1AOG A;  3QSS A;  4Z2R A;  1JU2 A;  4U2L A;  4YSZ A;  3AE4 A;  3NYF A;  3DJJ A;  4I58 A;  2PYX A;  3ALJ A;  2VRM A;  5DBJ A;  2C66 A;  3DH9 A;  1REO A;  3QJ4 A;  4H7U A;  3LZX A;  1GTE A;  3GWF A;  2IVD A;  5LV9 A;  3CPI G;  4H4X A;  4K2X A;  3UTF A;  3VQR A;  4A65 A;  2YAU A;  5M0Z A;  2A89 A;  2H89 A;  4ICY A;  1OJD A;  4YXD A;  1FEA A;  1VG9 A;  3WE0 A;  4AOX A;  3DK8 A;  4OPC A;  3AEG A;  2VOU A;  2E4G A;  3NGC X;  4HA6 A;  3VRA A;  3IHM A;  3ADA B;  1ZMC A;  2CFY A;  4YSX A;  2BCP A;  3DK4 A;  5ER0 A;  2OLN A;  1GRG A;  3ITJ A;  5KVH A;  1ZX9 A;  1CJ4 A;  3GDN A;  2FJE A;  2Y6Q A;  2ARD A;  4TM3 A;  2GAH B;  4CCR A;  1K4Q A;  3IC9 A;  1E1M A;  2GF3 A;  4J56 A;  3II4 A;  3VR8 A;  1ELI A;  1LQU A;  2WPF A;  1YQ3 A;  3CGE A;  3PVC A;  1OJA A;  1BGN A;  4D03 A;  2WEU A;  4H4Z A;  4IA5 A;  1GES A;  3UTE A;  1P2H A;  1ZOY A;  2WU5 A;  3H8L A;  4BK2 A;  3DJG X;  1Y56 A;  3UKL A;  1E1L A;  4KX6 A;  4CNJ A;  1N4U A;  1DXL A;  2VZ2 A;  2YVF A;  1D4D A;  4REK A;  3NH3 X;  2PHH A;  5FS9 A;  2XLU A;  3P1W A;  3UKF A;  4NZH A;  5IQ4 A;  2ZZ0 A;  3RNM A;  4EM4 A;  1TDN A;  3PO7 A;  1D4C A;  1Q1W A;  2RAB A;  4WCT A;  3P4S A;  3QSE A;  1BGJ A;  1E7P A;  2C64 A;  4GCM A;  3CPJ G;  2BC1 A;  4USR A;  1PBD A;  3AE2 A;  4NTC A;  3NK1 X;  1KF6 A;  1GET A;  1PJ6 A;  1RYI A;  1PS9 A;  1NHR A;  1JNZ A;  2C65 A;  4BUR A;  3B6D A;  3KKJ A;  3R9U A;  2Z5X A;  1PBB A;  2GMJ A;  1F6M A;  5JCM A;  3NYC A;  3KVE A;  4BK1 A;  4GUV A;  1S3E A;  4U8P A;  4U8J A;  2VVM A;  2WOW A;  5FS6 A;  1L9C A;  2XLR A;  3M0O A;  2V60 A;  2WOV A;  2XLS A;  2WDV A;  2JBV A;  2X3N A;  3QVP A;  2XLP A;  4J33 A;  3LJP A;  1GRF A;  3AD9 B;  4K5S A;  5FMH A;  4FX9 A;  5HY5 A;  4H4V A;  3UTH A;  1PXA A;  2BK3 A;  3GMC A;  2YLZ A;  4TM1 A;  3GDP A;  3FMW A;  2X8C A;  3GRS A;  5FS7 A;  2V61 A;  1B37 A;  2R4E A;  1ZY8 A;  2GQW A;  1QJD A;  2GH5 A;  4AT2 A;  1NEN A;  2BCG G;  1Q9I A;  4YT0 A;  1BWC A;  1NHQ A;  5TR3 A;  3OC4 A;  2GVC A;  3AYI A;  1D4E A;  5JCI A;  4H2P A;  2YG4 A;  4JQ9 A;  1JRZ A;  5EOW A;  3V3N A;  5CKU A;  2BS3 A;  1O95 A;  4O5U A;  2A8X A;  1YY5 A;  4NTD A;  4IA6 A;  1D7L A;  1BZL A;  4UP3 A;  2YR6 A;  1CJ3 A;  3RP8 A;  1ZDL A;  3FG2 P;  2YLR A;  2XVE A;  4J31 A;  3ATR A;  1H6V A;  3BI2 A;  2XCG A;  2XVJ A;  1FCD A;  3AE3 A;  3GSI A;  1EL8 A;  5EBK A;  2EQ6 A;  2VRL A;  2WBA A;  2ZZC A;  3UKA A;  2AAQ A;  1IUW A;  1H82 A;  4A5L A;  1GEU A;  3LAD A;  3FBS A;  2YG7 A;  3NTD A;  2JKC A;  2VQ7 A;  1K0L A;  4ZCD A;  1B4V A;  2WHD A;  1BKW A;  1ZKQ A;  3NHO X;  1CC2 A;  3V76 A;  4A9W A;  4CY8 A;  1DNC A;  1V59 A;  1CC4 A;  1JEH A;  4Z43 A;  1KSU A;  3NN6 X;  2C3C A;  4H4T A;  2YM1 A;  2YR5 A;  3UOX A;  5HYM A;  2J3N A;  2WPE A;  3KA7 A;  1KNR A;  2APG A;  4USQ A;  3NN0 X;  3QFB A;  2OA1 A;  1IJH A;  4B67 A;  3F8D A;  1GRE A;  2DKH A;  3NT6 A;  1LJ1 A;  1GV4 A;  1GT8 A;  2BAB A;  3I6D A;  3RP7 A;  3H4K A;  2YM2 A;  1TDE A;  3PS9 A;  3SGL A;  1VRQ B;  5C2T A;  2GRT A;  5JCN A;  1L9D A;  4FK1 C;  1NEK A;  2GB0 A;  1S3B A;  2TMD A;  1GRB A;  2DKI A;  3F8P A;  3BHK A;  2X8G A;  1QO8 A;  4OPD A;  1CL0 A;  3SFE A;  4A6N B;  2YG6 A;  4GRT A;  4B68 A;  3CIR A;  1DOE A;  2X99 A;  4AP3 A;  3FIM B;  4LII A;  4X9M A;  1E39 A;  4Y4N A;  3AEB A;  4JNA A;  2AQJ A;  3C96 A;  4Y4L A;  5BUK A;  3NTA A;  2BS2 A;  5IQ1 A;  4TLZ A;  4TM4 A;  4A79 A;  2R9Z A;  3FPZ A;  3CNJ A;  3V3O A;  2YVG A;  4EMJ A;  4GDE A;  4OPU A;  1H7W A;  1O94 A;  3K30 A;  1JRY A;  1QLB A;  4H2R A;  2GMH A;  4EM3 A;  1IUT A;  2B9Y A;  2BK5 A;  4ECH A;  2XLT A;  2TPR A;  2F5Z A;  4EMW A;  4H4U A;  3LB8 A;  1TDK A;  2NVK X;  1S2Q A;  2C73 A;  4MJW A;  2X8H A;  4P9S A;  3KPF A;  2BA9 A;  4UDQ A;  4X4J A;  1M6I A;  1MO9 A;  2XFN A;  4OPT A;  2WET A;  2YLX A;  3SFD A;  1F8W A;  1OJT A;  3GYJ A;  3GYI A;  2BXS A;  3ICR A;  4NTE A;  3ALM A;  4OVI A;  3ZDN A;  1Z6L A;  3UTG A;  2HQM A;  4O5Q A;  4DSG A;  4JY2 A;  2EQ8 A;  1LTX R;  4B69 A;  3DME A;  4DSH A;  1EL7 A;  3E1T A;  3BI4 A;  4U8I A;  3F8R A;  3BNU A;  4IV9 A;  2WOI A;  1NDA A;  2YR4 A;  3AE7 A;  4FK1 A;  3LXD A;  4J36 A;  4OPL A;  1JNR A;  4OPI A;  1GPE A;  3UKH A;  3K7T A;  2R4J A;  4KPR A;  2A87 A;  1H84 A;  2B9W A;  2AR8 A;  2QCU A;  1ZMD A;  2BXR A;  1JRX A;  5GRT A;  3EF6 A;  1TYT A;  2YQU A;  2EQ7 A;  1LVL A;  4U8K A;  4K22 A;  2CVJ A;  3I3L A;  2GR0 A;  5BRT A;  1N4W A;  4H50 A;  2C76 A;  3BNM A;  3HZL A;  3GMB A;  4EQX A;  3KLJ A;  1VDC A;  2R0P A;  4U2S A;  1NG3 A;  4JDR A;  3UCL A;  2BYB A;  1N1P A;  1CJ2 A;  2EQ9 A;  1XAN A;  1GSN A;  4EQR A;  1HYU A;  1EL9 A;  3AE9 A;  3AEC A;  2IVE A;  3M13 A;  4PAA A;  1ONF A;  2JK6 A;  3DJD A;  2YVJ A;  3DA1 A;  2V3B A;  2JAE A;  2GR3 A;  2YLS A;  3DK9 A;  3GWD A;  3AEE A;  4LA1 A;  2QA1 A;  1MOK A;  2IID A;  1H83 A;  4U8M A;  3UKK A;  3URH A;  3CN8 A;  2FJA A;  3BI5 A;  3AWI A;  1TDO A;  1EL5 A;  2Y6R A;  3LOV A;  1GER A;  1JOA A;  1KFY A;  3CGD A;  2JB1 A;  1PDH A;  5U63 A;  2RGH A;  3NK0 X;  1LPF A;  5U25 A;  4U8N A;  2V3A A;  1KSS A;  3L8K A;  4C77 A;  3K7Q X;  4CBQ A;  4J34 A;  1LQT A;  1EBD A;  4U8O A;  5HHF A;  3S61 A;  1PN0 A;  2O9Z A;  3JSK A;  2NPX A;  2CDU A;  1M64 A;  5IPY A;  5J7X A;  2C72 A;  2YWL A;  3NKS A;  4C5O A;  4ZCC A;  1VG0 A;  3H8I A;  2C70 A;  2CUL A;  1PBC A;  4U2T A;  1MXT A;  4UDP A;  1F8R A;  3NNE A;  2WP9 A;  3VRB A;  1CF3 A;  4J2W A;  4B63 A;  3NG7 X;  4H4W A;  1S2Y A;  3NRN A;  4GR1 A;  5EB5 A;  3AB1 A;  3NLC A;  3UKQ A;  1GTH A;  1L9E A;  2WQY A;  2V5Z A;  1W4X A;  1CC6 A;  2BK4 A;  3Q6J A;  2Q0K A;  3ISH A;  3UP5 A;  2GQF A;  3ICS A;  5KOX A;  4RG4 A;  4H2Q A;  1XDI A;  3DGZ A;  3UOY A;  4YWO A;  2Z5Y A;  3P4P A;  2OAM A;  1E6E A;  1NHS A;  4EIQ A;  4C74 A;  1FL2 A;  1BF3 A;  3AYJ A;  4IVO B;  3O0H A;  4CCQ A;  2GEW A;  1O5W A;  2QA2 A;  4UDR A;  2BS4 A;  3LZW A;  3UOZ A;  3G5R A;  4E0V A;  4YKF A;  2WPC A;  1Y56 B;  2BC0 A;  3KU9 A;  4H2N A;  4BV6 A;  4Z2T A;  1DJN A;  3CGB A;  5FS8 A;  3IF9 A;  3EAN A;  3QVR A;  1UKV G;  2C3D A;  1OJ9 A;  1N4V A;  1IUV A;  3CNT A;  4AP1 A;  2BAC A;  3C4A A;  3COX A;  2VVL A;  5C3J A;  4BK3 A;  4CNK A;  2QAE A;  4X9N A;  3P4Q A;  1GRA A;  4GDP A;  3BHF A;  2VQB A;  1GND A;  3GD3 A;  4I59 A;  1PBF A;  4DGK A;  4DNA A;  2YG3 A;  2R0G A;  4BJZ A;  1GXF A;  3IHG A;  2YLT A;  3ALL A;  4YSH A;  1PXC A;  1K0J A;  3DGH A;  3AE1 A;  5EB4 A;  5KOW A;  1L0V A;  2C75 A;  1SEZ A;  2XVF A;  2GAG B;  4FDC B;  1COY A;  1YQZ A;  2XFO A;  4ZN0 A;  4XWR A;  2X50 A;  5CQF A;  2WDR A;  3UKP A;  4ADW A;  4K8D A;  2C7G A;  2YLW A;  2WP6 A;  4YTN A;  1NHP A; 
#chains in the Genus database with same CATH topology
 3D8X A;  4GAP A;  2WES A;  2OAL A;  4JNQ A;  5KWF A;  3M12 A;  3AD8 B;  2ONE A;  4H4Q A;  4ENL A;  3L1R A;  5KMQ A;  4IVM B;  1R0M A;  1P2E A;  2ZZB A;  3EAO A;  1E1K A;  3AE8 A;  1PJ7 A;  5BVA A;  1N5X A;  2I0Z A;  2PP3 A;  1K0I A;  4A6N A;  3CNS A;  2DW7 A;  1MUC A;  4H19 A;  1CHU A;  5JCK A;  3NYE A;  2W3S A;  3TJ4 A;  5KNL A;  1SJD A;  2I5Q A;  3VRD B;  3DJE A;  4OCG A;  7ENL A;  5BOF A;  2XH7 A;  4B65 A;  1TDF A;  2RGO A;  1CJC A;  1Q1R A;  1D7Y A;  2PA6 A;  3Q9T A;  1H86 A;  4KPL A;  3ABV A;  3NK2 X;  3K7M X;  2W54 A;  1XS2 A;  2GGE A;  2HNE A;  4BJY A;  1H81 A;  3P4R A;  2B9X A;  3EEZ A;  2WU2 A;  3CND A;  2R45 A;  1GOS A;  2XYO A;  3OZ2 A;  2FJB A;  2ZBW A;  4WX1 A;  4HB9 A;  4C3X A;  3R11 A;  2WP5 A;  2NQL A;  1RSG A;  2Q0L A;  3R0U A;  4RG3 A;  2XVI A;  3AE6 A;  2B7R A;  5U1O A;  1DOD A;  4H4P A;  4EMI A;  2V6O A;  4D04 A;  2B76 A;  3S47 A;  1VQW A;  5KXJ A;  2WS3 A;  4U2L A;  2C66 A;  1PDZ A;  3QJ4 A;  3SN1 A;  1GTE A;  3GWF A;  2IVD A;  3UTF A;  1OJD A;  3WE0 A;  3AEG A;  3ADA B;  3DK4 A;  2QJM A;  3CXB A;  3ITJ A;  2QGY A;  1CJ4 A;  2FJE A;  3RGT A;  2ARD A;  1K4Q A;  3IC9 A;  1E1M A;  1ELI A;  3CGE A;  3PVC A;  4D03 A;  3NRZ B;  1ZOY A;  4BK2 A;  2PP1 A;  1N4U A;  4HCD A;  3NH3 X;  2XSX A;  5FS9 A;  2XLU A;  5IQ4 A;  2RAB A;  3P4S A;  1BGJ A;  1E7P A;  2C64 A;  3CPJ G;  2BC1 A;  4BUR A;  2Z5X A;  3RCY A;  1F6M A;  4ROP A;  3CB3 A;  5JCM A;  3NYC A;  3ZVH A;  4BK1 A;  4GUV A;  4G7F A;  2XLR A;  2QDD A;  2ZC8 A;  3DFH A;  4J33 A;  3SZW A;  2OZT A;  4K5S A;  3UTH A;  3SZC A;  1PXA A;  2P8C A;  4KEM A;  3GDP A;  3FMW A;  3GRS A;  3T6C A;  3VCN A;  1ZY8 A;  1EC8 A;  2GQW A;  2GH5 A;  3N4F A;  1NHQ A;  1N60 C;  4HYR A;  3DES A;  2YG4 A;  4JQ9 A;  2BS3 A;  4GME A;  2A8X A;  1D7L A;  3TJI A;  3TWA A;  2YLR A;  4J31 A;  3DER A;  2XCG A;  2VRL A;  3SN4 A;  2WBA A;  3UJF A;  2VQ7 A;  3IJL A;  3ES8 A;  4A9W A;  3B97 A;  4CY8 A;  1CC4 A;  1KSU A;  3U4F A;  2YM1 A;  3NN0 X;  3QFB A;  1IJH A;  4B67 A;  3ZLG A;  2BAB A;  2GRT A;  3P3B A;  2PS2 A;  3F8P A;  2X8G A;  1QO8 A;  2YG6 A;  3AEB A;  5IQ1 A;  4TLZ A;  4A79 A;  3V3O A;  3CNJ A;  2YVG A;  1JRY A;  2OQY A;  1IUT A;  1XPY A;  1E9I A;  2F5Z A;  3LB8 A;  2OZ3 A;  1TDK A;  4MJW A;  2X8H A;  2OX4 A;  2E5A A;  2BA9 A;  3KPF A;  1M6I A;  3SFD A;  3GYJ A;  3GYI A;  3KPK A;  2OKT A;  3ZDN A;  1LTX R;  3DME A;  3BI4 A;  4IV9 A;  4J36 A;  4FK1 A;  4OPI A;  1IYX A;  3K7T A;  2B9W A;  2AR8 A;  2QCU A;  1ZMD A;  1TYT A;  2YQU A;  4H50 A;  3GMB A;  3UCD A;  2R0P A;  1NG3 A;  3UCL A;  2BYB A;  1CJ2 A;  1XAN A;  1GSN A;  3AE9 A;  3DJD A;  1N61 C;  3DK9 A;  3ETR B;  4DYE A;  5JRB A;  2Y6R A;  3CGD A;  2JB1 A;  2OO6 A;  1PDH A;  3V5F A;  2PGW A;  1KSS A;  4G73 A;  4C77 A;  4J34 A;  1EBD A;  3S61 A;  2NPX A;  2CDU A;  5IPY A;  3Q45 A;  4GIR A;  2OLA A;  4ZCC A;  1PBC A;  1CF3 A;  2AL2 A;  4IP5 A;  1L9E A;  2WQY A;  3I6T A;  4H2H A;  1CC6 A;  1W4X A;  5KOX A;  4H2Q A;  1XDI A;  2P8B A;  1X2G A;  2PTW A;  3UOY A;  3P4P A;  2OAM A;  1E6E A;  1BF3 A;  2FYM A;  4E0V A;  4YKF A;  2WPC A;  5ENL A;  5FS8 A;  4AP1 A;  3CNT A;  3C4A A;  3COX A;  2VVL A;  4BK3 A;  4NNJ A;  1GRA A;  4GDP A;  2VQB A;  2GL5 A;  2P0I A;  2YG3 A;  2YLT A;  1W6T A;  5FJU A;  3NS1 B;  4FDC B;  1COY A;  3UKP A;  4K8D A;  3ENL A;  1KN0 A;  3IJI A;  4OPG A;  1ZK7 A;  5L46 A;  3OP2 A;  2W0H A;  4YTP A;  3H12 A;  1TKK A;  1OJC A;  4B64 A;  3UXK A;  5KVI A;  3IWA A;  4JY3 A;  3KD9 A;  3GRT A;  2E1M A;  5J60 A;  2GR2 A;  3CXO A;  1F9C A;  3ICT A;  2ACZ A;  4Y4M A;  2WDQ A;  3T2Z A;  2PP0 A;  3DEQ A;  4NWZ A;  3OW1 A;  1CBO A;  1NAA A;  1SB3 B;  3CTY A;  4A7A A;  5JCL A;  3AEA A;  3CGC A;  3BOX A;  1GAL A;  4APN A;  3C4N A;  4YSY A;  2BRA A;  4GYP A;  4NEW A;  2CHR A;  1ZP0 A;  1Y0P A;  2HZG A;  4YKG A;  5BOE A;  1KD0 A;  2XDO A;  1DOB A;  5BUL A;  4K7Z A;  1ZOV A;  1EC9 A;  1FOH A;  4H4S A;  3D1C A;  2XFP A;  3G5Q A;  1NU5 A;  3P0W A;  4G9K A;  3VCC A;  1JPD X;  4G6G A;  3QSM A;  1F3P A;  4TM0 A;  3EKG A;  4J1O A;  3B3R A;  5FJO A;  3AE4 A;  4I58 A;  3SQS A;  5DBJ A;  3DH9 A;  4H7U A;  4H4X A;  3VQR A;  2POZ A;  4KT2 A;  5G5G B;  2PSN A;  1FEA A;  1MNS A;  4AOX A;  4OPC A;  3FV9 A;  2CFY A;  3QKE A;  4H83 A;  4YSX A;  5KVH A;  1JDF A;  2Y6Q A;  1RM6 B;  4CCR A;  2GF3 A;  4J56 A;  3VFC A;  3II4 A;  4E6M A;  3VR8 A;  3D47 A;  1MDL A;  1YQ3 A;  2W3R A;  3CYJ A;  2WU5 A;  1Y56 A;  3UKL A;  3SZF A;  3KUM A;  5FJR A;  4KX6 A;  2PTX A;  2VZ2 A;  4EWJ A;  2YVF A;  2GGH A;  3UKF A;  4NZH A;  4EM4 A;  1TDN A;  4WCT A;  3QSE A;  4USR A;  4IZG A;  1PBD A;  3NK1 X;  1KF6 A;  1PJ6 A;  1RYI A;  1JNZ A;  3KKJ A;  3R9U A;  3T0K A;  1PBB A;  2GMJ A;  5FJT A;  1WUE A;  2MUC A;  3KVE A;  3N6J A;  3DDM A;  2HXT A;  4U8J A;  5FS6 A;  3M0O A;  2PTY A;  2XLP A;  1JCT A;  3LJP A;  1P43 A;  5HY5 A;  3T2Y A;  4GGB A;  5FS7 A;  1NEN A;  4YT0 A;  1BWC A;  3AYI A;  4H2P A;  3V3N A;  1O95 A;  4NTD A;  4MKS A;  2YR6 A;  1CJ3 A;  3GSI A;  3NXL A;  3T8Q A;  3UKA A;  3TOY A;  1IUW A;  4A5L A;  2JKC A;  1B4V A;  2WHD A;  3NHO X;  3RIT A;  1JEH A;  3NN6 X;  2C3C A;  4ZCW A;  4H4T A;  3SSZ A;  5HYM A;  3TWB A;  2WPE A;  3KA7 A;  3UGV A;  3UJE A;  1GT8 A;  4II2 A;  1TDE A;  5C2T A;  4FK1 C;  2GB0 A;  3GD6 A;  2BRY A;  3SFE A;  4A6N B;  5G5H B;  3FIM B;  4Y4N A;  2AQJ A;  3ES7 A;  3N6H A;  2BS2 A;  3U9I A;  4OPU A;  1H7W A;  3K30 A;  4H2R A;  3NVV B;  2XLT A;  4EMW A;  2C73 A;  2NVK X;  3SGL A;  4MGG A;  4X4J A;  1MO9 A;  2XFN A;  3CK5 A;  2WET A;  2YLX A;  2BXS A;  3ICR A;  4NTE A;  1N5W C;  3RO6 A;  4DSH A;  4DXK A;  1EL7 A;  3E1T A;  3F8R A;  2WOI A;  4HNC A;  2AKM A;  2XH2 A;  3HW2 A;  3PWI A;  3IK4 A;  1SJC A;  3R25 A;  2EQ7 A;  2GR0 A;  1N4W A;  4EQX A;  3NVZ B;  3MZN A;  2OQH A;  4JDR A;  1N1P A;  2EQ9 A;  3AEC A;  2IVE A;  2JAE A;  2GR3 A;  3B9J B;  3AEE A;  4H1Z A;  3Q4D A;  3N4E A;  1MOK A;  4JN7 A;  3P93 A;  3UKK A;  2FJA A;  1TDO A;  3LOV A;  5U63 A;  3NK0 X;  4U8N A;  3L8K A;  4K2S A;  1DTN A;  1P48 A;  5HHF A;  2C72 A;  2YWL A;  4C5O A;  1TZZ A;  3H8I A;  2CUL A;  1MXT A;  4UDP A;  3MY9 A;  3NNE A;  4B63 A;  3NG7 X;  1S2Y A;  3NRN A;  4GR1 A;  1JRP A;  3UKQ A;  3HYX A;  3ISH A;  2GQF A;  4RG4 A;  4IL2 A;  4K1W A;  2Z5Y A;  1NHS A;  4IVO B;  4UDR A;  3LZW A;  3DG7 A;  3KU9 A;  4M0X A;  4BV6 A;  3AN1 A;  3CGB A;  1FIQ B;  1UKV G;  2C3D A;  1JPM A;  1KKO A;  2BAC A;  4GAV A;  5C3J A;  4CNK A;  3GD3 A;  4DGK A;  3IHG A;  4YSH A;  1PXC A;  3SBF A;  3DGH A;  3AE1 A;  5EB4 A;  2C75 A;  2RDX A;  3ZVH B;  4YTN A;  2C7G A;  3A7U A;  2WP6 A;  4XWZ A;  3OPS A;  4YWS A;  3NO1 A;  2FBW A;  3I4K A;  3PG6 A;  3JW7 A;  2JB3 A;  1IUS A;  3PWG A;  1D5T A;  2RGJ A;  3CPH G;  4GYP C;  4Z26 A;  2XFU A;  4TVY A;  2GV8 A;  3PK7 A;  1LV0 A;  3DIP A;  5GSN A;  3RHA A;  3QFA A;  1YKJ A;  3MQT A;  2B7S A;  4N9X A;  4Z25 A;  3ZYX A;  3UJS A;  1KDG A;  3AD7 B;  1ONE A;  3T14 A;  4NEV A;  4Z44 A;  3T31 A;  2GR1 A;  2UZZ A;  3UXL A;  3T37 A;  4B66 A;  3R07 C;  2JB2 A;  2XVH A;  1YEY A;  2FKP A;  3JZU A;  2PTZ A;  1XHC A;  5KMP A;  5KRQ A;  4RSL A;  3AYL A;  3HYV A;  3FCP A;  3QPE A;  1PXB A;  3CNP A;  3FJ4 A;  2E5V A;  3SQP A;  3SM8 A;  4K5R A;  2FJD A;  2OLO A;  1B5Q A;  2VVL G;  5M10 A;  3RP6 A;  4Z24 A;  4G8T A;  4AT0 A;  4ZA0 A;  4M6U A;  1BQG A;  4C3Y A;  1OEP A;  4HPN A;  1F8S A;  1SJA A;  1TRB A;  4A99 A;  1E1N A;  2GGG A;  1NG4 A;  4CRT A;  2R46 A;  2YG5 A;  4HNL A;  4CY6 A;  3P9U A;  2C67 A;  1H7X A;  4LU6 A;  1FEC A;  4J57 A;  3NVY B;  4TLX A;  1AOG A;  4Z2R A;  2PPG A;  1JU2 A;  3DJJ A;  3BJS A;  2VRM A;  3VC6 A;  3JVA A;  1X2H A;  5LV9 A;  3CPI G;  4K2X A;  2A89 A;  2H89 A;  1VG9 A;  3IHM A;  4HN8 A;  3HYW A;  2BCP A;  5ER0 A;  1GRG A;  1ZX9 A;  3SZ0 A;  2GAH B;  1LQU A;  2WPF A;  1OJA A;  2WEU A;  3UTE A;  1GES A;  3DG6 A;  4REK A;  1VQZ A;  3P1W A;  3RNM A;  3HPF A;  4E4U A;  4GCM A;  1EC7 A;  2GGI A;  3AE2 A;  3V5C A;  3H8A A;  1T3Q C;  3OZM A;  3PFR A;  2XGZ A;  1S3E A;  2AL2 B;  1L9C A;  2V60 A;  2WOV A;  4HCH A;  2XLS A;  1FHV A;  2X3N A;  4DN1 A;  1WUF A;  4FX9 A;  3NZG A;  4JN8 A;  2BK3 A;  4TM1 A;  2X8C A;  1B37 A;  1L8P A;  4AT2 A;  2BCG G;  5TR3 A;  3ZLF A;  2GVC A;  1D4E A;  3AM9 A;  5JCI A;  2P88 A;  5CKU A;  1ZDL A;  2XVE A;  2DW6 A;  1FCD A;  3AE3 A;  3SX6 A;  2OPJ A;  2AAQ A;  3HRD C;  3IJQ A;  2YG7 A;  2OZ8 A;  2OVL A;  1KCZ A;  4G6H A;  1BKW A;  3R10 A;  1V59 A;  3THU A;  4Z43 A;  4K8G A;  3UJR A;  3SR6 B;  2PU0 A;  2E3T A;  2OA1 A;  2AL1 A;  3CMM A;  1LJ1 A;  1GV4 A;  3GO2 A;  3RP7 A;  1VDV A;  3PS9 A;  1VRQ B;  3NFU A;  5JCN A;  3R0K A;  3T9P A;  2TMD A;  2DKI A;  3ZVI A;  4OPD A;  3ZLH A;  4B68 A;  3CIR A;  1DOE A;  2X99 A;  4F4R A;  4X9M A;  4GFI A;  3C96 A;  5BUK A;  3NTA A;  4EMJ A;  4GDE A;  3K1G A;  1O94 A;  2HXU A;  2GMH A;  2TPR A;  3GC2 A;  4H4U A;  1S2Q A;  4UDQ A;  2PMQ A;  3SJN A;  1OJT A;  3GY1 A;  3ALM A;  4OVI A;  3UTG A;  4DSG A;  3S5S A;  4B69 A;  2EQ8 A;  3BNU A;  1NDA A;  3AE7 A;  1JNR A;  3FYY A;  1GPE A;  3UKH A;  2R4J A;  1H84 A;  1JRX A;  3VC5 A;  3DFY A;  1LVL A;  3I3L A;  1JRO A;  2C76 A;  3BNM A;  3M13 A;  2JK6 A;  2YVJ A;  3CT2 A;  2YLS A;  3GWD A;  2IID A;  2GDQ A;  3URH A;  3CN8 A;  3BI5 A;  3AWI A;  1JOA A;  4FP1 A;  4DX3 A;  3K7Q X;  3OZY A;  1PN0 A;  2O9Z A;  3JSK A;  2MNR A;  5J7X A;  1MRA A;  1VG0 A;  2C70 A;  1F8R A;  3STP A;  3VRB A;  1SJB A;  4E4F A;  1GTH A;  3SN0 A;  2V5Z A;  3Q6J A;  2C4C A;  2PCE A;  3UP5 A;  3DGZ A;  2OG9 A;  4ZOH B;  4YWO A;  4EIQ A;  1FL2 A;  3AYJ A;  4CCQ A;  2QA2 A;  2BS4 A;  3QLD A;  1Y56 B;  4H2N A;  4Z2T A;  2QVH A;  1DJN A;  3IF9 A;  3QVR A;  1N62 C;  2QAE A;  4X9N A;  3P4Q A;  1H2I A;  3BHF A;  1PBF A;  4BJZ A;  1GXF A;  3TQP A;  1K0J A;  1L0V A;  1SEZ A;  2GAG B;  2XFO A;  4X2P A;  2X50 A;  2WDR A;  1NEL A;  2YLW A;  4DWD A;  4JN9 A;  3A7R A;  6ENL A;  1X31 B;  1PJ5 A;  3T2K A;  3S5W A;  4H4Y A;  2Q7V A;  4B1B A;  1IUX A;  1XPQ A;  4EQS A;  1N63 C;  4HCL A;  1PBE A;  3FVD A;  1FO4 A;  3AE5 A;  2H88 A;  3ATQ A;  1KKR A;  1RP0 A;  3RR1 A;  1FFU C;  4XXG A;  4EIP A;  3EPT A;  1B8S A;  4GF7 A;  3UP4 A;  2O56 A;  1FEB A;  1ECQ A;  2XFQ A;  4E5T A;  1GRH A;  4AOS A;  2R0C A;  3MSY A;  4H4R A;  4Z2U A;  4EQW A;  1DJQ A;  1PHH A;  1KNP A;  2Q6U A;  3VR9 A;  1NPX A;  4G74 A;  1RVK A;  3AEF A;  5HXI A;  3NIX A;  5KMR A;  3CAW A;  3UOV A;  4GGH A;  4YTM A;  3RED A;  1FFV C;  3L5O A;  3AXB A;  3G5S A;  1DOC A;  1GRT A;  4IL0 A;  5EU9 A;  1YQ4 A;  3VDG A;  4M52 A;  3VA8 A;  4A35 A;  2POD A;  1V97 A;  4U8L A;  1IUU A;  3GYX A;  3H70 A;  3GD4 A;  4PAB A;  3AED A;  1TYP A;  1S7M A;  3QSS A;  1PDY A;  4YSZ A;  3NYF A;  2PYX A;  3ALJ A;  3R1Z A;  1REO A;  3LZX A;  4DHG A;  3A7A A;  4A65 A;  2YAU A;  5M0Z A;  4KWS A;  4ICY A;  4YXD A;  1EBH A;  3DK8 A;  2VOU A;  2E4G A;  3NGC X;  4HA6 A;  3VRA A;  1ZMC A;  1ELS A;  2OLN A;  4E8G A;  1ZXI C;  3GDN A;  3SXI A;  4TM3 A;  5KMS A;  1BGN A;  4H4Z A;  4IA5 A;  1P2H A;  3H8L A;  3DJG X;  1E1L A;  4II3 A;  4CNJ A;  1DXL A;  4J3Z A;  1D4D A;  2PHH A;  3OTR A;  2ZZ0 A;  3PO7 A;  1D4C A;  1Q1W A;  4NTC A;  1GET A;  1PS9 A;  1NHR A;  2C65 A;  3B6D A;  2PU1 A;  4GIS A;  4U8P A;  2QJN A;  2WOW A;  2VVM A;  3DG3 A;  4A6G A;  3EUB 3;  2WDV A;  2JBV A;  3QVP A;  1GRF A;  4IHC A;  3AD9 B;  5FMH A;  1R6W A;  4H4V A;  3GMC A;  2YLZ A;  2V61 A;  2R4E A;  1QJD A;  1Q9I A;  3T4W A;  3OC4 A;  1JRZ A;  5EOW A;  3D46 A;  4FI4 A;  4O5U A;  1YY5 A;  4IA6 A;  1BZL A;  4UP3 A;  2QJJ A;  3FXG A;  3RP8 A;  3FG2 P;  3ATR A;  1H6V A;  3BI2 A;  2W55 A;  2XVJ A;  1EL8 A;  5EBK A;  2EQ6 A;  2GSH A;  4JHM A;  2ZZC A;  1H82 A;  1GEU A;  3LAD A;  3FBS A;  3NTD A;  1K0L A;  4ZCD A;  3NVW B;  1ZKQ A;  5J04 A;  3QTP A;  2OFJ A;  4Z17 A;  1CC2 A;  3V76 A;  1DNC A;  2GGJ A;  2YR5 A;  3UOX A;  2J3N A;  1KNR A;  2APG A;  4USQ A;  3MKC A;  3F8D A;  1GRE A;  2DKH A;  3NT6 A;  1BKH A;  3I6D A;  3H4K A;  2YM2 A;  5IDZ A;  3MWC A;  1L9D A;  3UJ2 A;  1NEK A;  1S3B A;  1GRB A;  3BHK A;  3H7V A;  5FJP A;  1CL0 A;  4GRT A;  4AP3 A;  4LII A;  3V3W A;  1E39 A;  3SY4 A;  3TCS A;  1WYG A;  3D9X A;  4JNA A;  4Y4L A;  4TM4 A;  2R9Z A;  3FPZ A;  3UCC A;  3TTE A;  1QLB A;  4EM3 A;  2B9Y A;  2BK5 A;  4ECH A;  3AMZ A;  4P9S A;  3QN3 A;  4OPT A;  1F8W A;  4IP4 A;  1Z6L A;  2HQM A;  4O5Q A;  4JY2 A;  3BSM A;  4U8I A;  3V4B A;  2YR4 A;  4OPL A;  3LXD A;  1TE6 A;  4KPR A;  2A87 A;  2BXR A;  5GRT A;  3EF6 A;  4U8K A;  4K22 A;  2CVJ A;  5BRT A;  3HZL A;  3SYI A;  3KLJ A;  1VDC A;  4U2S A;  4EQR A;  1HYU A;  1EL9 A;  4PAA A;  1MDR A;  1ONF A;  3DA1 A;  2V3B A;  2PGE A;  4LA1 A;  2QA1 A;  1H83 A;  4U8M A;  1FHU A;  4Z1Y A;  2QQ6 A;  1EL5 A;  1GER A;  1KFY A;  4MMW A;  2RGH A;  1LPF A;  3MUC A;  4IT1 A;  5U25 A;  2V3A A;  3DGB A;  4CBQ A;  1LQT A;  4U8O A;  1M64 A;  3NKS A;  2AKZ A;  4U2T A;  2QDE A;  2WP9 A;  4J2W A;  4H4W A;  2XH0 A;  2ZAD A;  5EB5 A;  3I6E A;  3AB1 A;  3NLC A;  3TW9 A;  2BK4 A;  2Q0K A;  3ICS A;  2P3Z A;  4C74 A;  2XH4 A;  3O0H A;  2GEW A;  1O5W A;  1STZ A;  3UOZ A;  3G5R A;  2BC0 A;  3EAN A;  1OJ9 A;  1N4V A;  1IUV A;  4A3R A;  3RRA A;  1GND A;  1EBG A;  4I59 A;  4TVW A;  4DNA A;  2R0G A;  3ALL A;  5KOW A;  2XVF A;  1YQZ A;  4ZN0 A;  4XWR A;  5CQF A;  4ADW A;  1NHP A; 
#chains in the Genus database with same CATH homology
 4XWZ A;  3D8X A;  4GAP A;  1KN0 A;  2WES A;  2FBW A;  2OAL A;  4JN9 A;  4JNQ A;  3PG6 A;  1ZK7 A;  4OPG A;  5L46 A;  5KWF A;  3M12 A;  3AD8 B;  2JB3 A;  1X31 B;  1PJ5 A;  2W0H A;  3T2K A;  4YTP A;  1IUS A;  3S5W A;  1D5T A;  4H4Y A;  1OJC A;  2RGJ A;  2Q7V A;  3CPH G;  4B1B A;  4B64 A;  4H4Q A;  1IUX A;  3L1R A;  5KMQ A;  4IVM B;  5KVI A;  3IWA A;  1XPQ A;  4JY3 A;  4Z26 A;  1P2E A;  2ZZB A;  3GRT A;  4EQS A;  2XFU A;  3KD9 A;  1PBE A;  2E1M A;  2GV8 A;  5J60 A;  2GR2 A;  1LV0 A;  3AE5 A;  3EAO A;  1E1K A;  2H88 A;  3AE8 A;  3ICT A;  1PJ7 A;  3ATQ A;  5GSN A;  3RHA A;  5BVA A;  3QFA A;  1YKJ A;  2I0Z A;  2B7S A;  4N9X A;  1K0I A;  4A6N A;  3CNS A;  2ACZ A;  4Z25 A;  3ZYX A;  1CHU A;  1RP0 A;  5JCK A;  1KDG A;  3AD7 B;  3T14 A;  4Y4M A;  2WDQ A;  3T2Z A;  4NEV A;  3NYE A;  4Z44 A;  5KNL A;  4NWZ A;  1CBO A;  1NAA A;  3T31 A;  4XXG A;  4EIP A;  2GR1 A;  3EPT A;  1B8S A;  3CTY A;  2UZZ A;  3VRD B;  3DJE A;  4A7A A;  4GF7 A;  4OCG A;  3T37 A;  3UP4 A;  5JCL A;  4B66 A;  3AEA A;  2JB2 A;  3CGC A;  1FEB A;  2XVH A;  2XFQ A;  1GRH A;  4B65 A;  1TDF A;  1XHC A;  5KMP A;  5KRQ A;  4RSL A;  3AYL A;  2RGO A;  3HYV A;  1CJC A;  1Q1R A;  4AOS A;  1GAL A;  4APN A;  1D7Y A;  3C4N A;  4YSY A;  1PXB A;  2R0C A;  3CNP A;  3Q9T A;  2BRA A;  4H4R A;  4NEW A;  1H86 A;  3ABV A;  4Z2U A;  3NK2 X;  4EQW A;  1ZP0 A;  1DJQ A;  3K7M X;  1Y0P A;  1PHH A;  2E5V A;  3SQP A;  1KNP A;  2Q6U A;  3SM8 A;  3VR9 A;  1NPX A;  4G74 A;  4K5R A;  3AEF A;  4YKG A;  2FJD A;  2OLO A;  5HXI A;  1B5Q A;  2VVL G;  3NIX A;  4BJY A;  5KMR A;  3UOV A;  2XDO A;  5M10 A;  3RP6 A;  4YTM A;  4Z24 A;  1DOB A;  3RED A;  1H81 A;  4AT0 A;  5BUL A;  4K7Z A;  1ZOV A;  1FOH A;  3P4R A;  2B9X A;  3L5O A;  4H4S A;  1F8S A;  2WU2 A;  3AXB A;  2R45 A;  3CND A;  4C3Y A;  3G5S A;  1DOC A;  1GRT A;  1YQ4 A;  4M52 A;  1TRB A;  1GOS A;  2XYO A;  3D1C A;  3OZ2 A;  4A99 A;  1E1N A;  2FJB A;  2ZBW A;  1NG4 A;  2XFP A;  4WX1 A;  3G5Q A;  4HB9 A;  4CRT A;  4C3X A;  4G9K A;  2R46 A;  2YG5 A;  2WP5 A;  1RSG A;  2Q0L A;  4U8L A;  4CY6 A;  1IUU A;  3GYX A;  4G6G A;  4RG3 A;  3GD4 A;  2XVI A;  3AE6 A;  3P9U A;  4PAB A;  2B7R A;  5U1O A;  2C67 A;  1DOD A;  1F3P A;  3QSM A;  1H7X A;  4LU6 A;  4H4P A;  4EMI A;  1FEC A;  3AED A;  2V6O A;  4D04 A;  4TM0 A;  4J57 A;  2B76 A;  5KXJ A;  1VQW A;  2WS3 A;  1TYP A;  3B3R A;  4TLX A;  1AOG A;  1S7M A;  3QSS A;  4Z2R A;  1JU2 A;  4U2L A;  4YSZ A;  3AE4 A;  3NYF A;  3DJJ A;  4I58 A;  2PYX A;  3ALJ A;  2VRM A;  5DBJ A;  2C66 A;  3DH9 A;  1REO A;  3QJ4 A;  4H7U A;  3LZX A;  1GTE A;  3GWF A;  2IVD A;  5LV9 A;  3CPI G;  4H4X A;  4K2X A;  3UTF A;  3VQR A;  4A65 A;  2YAU A;  5M0Z A;  2A89 A;  2H89 A;  4ICY A;  1OJD A;  4YXD A;  1FEA A;  1VG9 A;  3WE0 A;  4AOX A;  3DK8 A;  4OPC A;  3AEG A;  2VOU A;  2E4G A;  3NGC X;  4HA6 A;  3VRA A;  3IHM A;  3ADA B;  1ZMC A;  2CFY A;  3HYW A;  4YSX A;  2BCP A;  3DK4 A;  5ER0 A;  2OLN A;  1GRG A;  3ITJ A;  5KVH A;  1ZX9 A;  1CJ4 A;  3GDN A;  3SXI A;  2FJE A;  3SZ0 A;  2Y6Q A;  2ARD A;  4TM3 A;  2GAH B;  4CCR A;  1K4Q A;  3IC9 A;  1E1M A;  5KMS A;  2GF3 A;  4J56 A;  3II4 A;  3VR8 A;  1ELI A;  1LQU A;  2WPF A;  1YQ3 A;  3CGE A;  3PVC A;  1OJA A;  1BGN A;  4D03 A;  2WEU A;  4H4Z A;  4IA5 A;  1GES A;  3UTE A;  1P2H A;  1ZOY A;  2WU5 A;  3H8L A;  4BK2 A;  3DJG X;  1Y56 A;  3UKL A;  3SZF A;  1E1L A;  4II3 A;  4KX6 A;  4CNJ A;  1N4U A;  1DXL A;  2VZ2 A;  2YVF A;  1D4D A;  4REK A;  3NH3 X;  2PHH A;  5FS9 A;  2XLU A;  3P1W A;  3UKF A;  4NZH A;  5IQ4 A;  2ZZ0 A;  3RNM A;  4EM4 A;  1TDN A;  3PO7 A;  1D4C A;  1Q1W A;  2RAB A;  4WCT A;  3P4S A;  3QSE A;  1BGJ A;  1E7P A;  2C64 A;  4GCM A;  3CPJ G;  2BC1 A;  4USR A;  1PBD A;  3AE2 A;  4NTC A;  3NK1 X;  1KF6 A;  1GET A;  1PJ6 A;  1RYI A;  1PS9 A;  1NHR A;  1JNZ A;  2C65 A;  4BUR A;  3B6D A;  3KKJ A;  3R9U A;  3T0K A;  2Z5X A;  1PBB A;  2GMJ A;  1F6M A;  5JCM A;  3NYC A;  3KVE A;  4BK1 A;  4GUV A;  1S3E A;  4U8P A;  4U8J A;  2VVM A;  2WOW A;  5FS6 A;  1L9C A;  2XLR A;  3M0O A;  2V60 A;  2WOV A;  2XLS A;  2WDV A;  2JBV A;  2X3N A;  3QVP A;  2XLP A;  4J33 A;  3LJP A;  1GRF A;  3SZW A;  3AD9 B;  4K5S A;  5FMH A;  4FX9 A;  5HY5 A;  3T2Y A;  4H4V A;  3UTH A;  3SZC A;  1PXA A;  2BK3 A;  3GMC A;  2YLZ A;  4TM1 A;  3GDP A;  3FMW A;  2X8C A;  3GRS A;  5FS7 A;  2V61 A;  1B37 A;  2R4E A;  1ZY8 A;  2GQW A;  1QJD A;  2GH5 A;  4AT2 A;  1NEN A;  2BCG G;  1Q9I A;  4YT0 A;  1BWC A;  1NHQ A;  5TR3 A;  3OC4 A;  2GVC A;  3AYI A;  1D4E A;  5JCI A;  4H2P A;  2YG4 A;  4JQ9 A;  1JRZ A;  5EOW A;  3V3N A;  5CKU A;  2BS3 A;  1O95 A;  4O5U A;  2A8X A;  1YY5 A;  4NTD A;  4IA6 A;  1D7L A;  1BZL A;  4UP3 A;  2YR6 A;  1CJ3 A;  3RP8 A;  1ZDL A;  3FG2 P;  2YLR A;  2XVE A;  4J31 A;  3ATR A;  1H6V A;  3BI2 A;  2XCG A;  2XVJ A;  1FCD A;  3AE3 A;  3GSI A;  1EL8 A;  3SX6 A;  5EBK A;  2EQ6 A;  2VRL A;  2WBA A;  2ZZC A;  3UKA A;  2AAQ A;  1IUW A;  1H82 A;  4A5L A;  1GEU A;  3LAD A;  3FBS A;  2YG7 A;  3NTD A;  2JKC A;  2VQ7 A;  1K0L A;  4ZCD A;  1B4V A;  2WHD A;  4G6H A;  1BKW A;  1ZKQ A;  3NHO X;  1CC2 A;  3V76 A;  4A9W A;  4CY8 A;  1DNC A;  1V59 A;  1CC4 A;  1JEH A;  4Z43 A;  1KSU A;  3NN6 X;  2C3C A;  4H4T A;  2YM1 A;  2YR5 A;  3UOX A;  5HYM A;  2J3N A;  2WPE A;  3KA7 A;  1KNR A;  2APG A;  4USQ A;  3NN0 X;  3QFB A;  2OA1 A;  1IJH A;  4B67 A;  3F8D A;  1GRE A;  2DKH A;  3NT6 A;  3CMM A;  1LJ1 A;  1GV4 A;  1GT8 A;  4II2 A;  2BAB A;  3I6D A;  3RP7 A;  3H4K A;  2YM2 A;  1TDE A;  3PS9 A;  3SGL A;  1VRQ B;  5C2T A;  2GRT A;  5JCN A;  1L9D A;  4FK1 C;  1NEK A;  2GB0 A;  1S3B A;  2TMD A;  1GRB A;  2DKI A;  3F8P A;  3BHK A;  2X8G A;  1QO8 A;  4OPD A;  1CL0 A;  2BRY A;  3SFE A;  4A6N B;  2YG6 A;  4GRT A;  4B68 A;  3CIR A;  1DOE A;  2X99 A;  4AP3 A;  3FIM B;  4LII A;  4X9M A;  1E39 A;  4Y4N A;  3AEB A;  3SY4 A;  3D9X A;  2AQJ A;  3C96 A;  4JNA A;  4Y4L A;  3NTA A;  2BS2 A;  5BUK A;  5IQ1 A;  4TLZ A;  4TM4 A;  4A79 A;  2R9Z A;  3FPZ A;  3CNJ A;  3V3O A;  2YVG A;  4EMJ A;  4GDE A;  4OPU A;  1H7W A;  1O94 A;  3K30 A;  1JRY A;  1QLB A;  4H2R A;  2GMH A;  4EM3 A;  1IUT A;  2B9Y A;  2BK5 A;  4ECH A;  2XLT A;  2TPR A;  2F5Z A;  4EMW A;  4H4U A;  3LB8 A;  1TDK A;  2NVK X;  1S2Q A;  2C73 A;  4MJW A;  2X8H A;  4P9S A;  3KPF A;  2BA9 A;  4UDQ A;  4X4J A;  1M6I A;  1MO9 A;  2XFN A;  4OPT A;  2WET A;  2YLX A;  3SFD A;  1F8W A;  1OJT A;  3GYJ A;  3GYI A;  2BXS A;  3ICR A;  3KPK A;  4NTE A;  3ALM A;  4OVI A;  3ZDN A;  1Z6L A;  3UTG A;  2HQM A;  4O5Q A;  4DSG A;  4JY2 A;  2EQ8 A;  1LTX R;  4B69 A;  3DME A;  4DSH A;  1EL7 A;  3E1T A;  3BI4 A;  4U8I A;  3F8R A;  3BNU A;  4IV9 A;  2WOI A;  1NDA A;  2YR4 A;  3AE7 A;  4FK1 A;  3LXD A;  4J36 A;  4OPL A;  1JNR A;  4OPI A;  1GPE A;  3UKH A;  3K7T A;  2R4J A;  4KPR A;  2A87 A;  1H84 A;  2B9W A;  2AR8 A;  2QCU A;  1ZMD A;  2BXR A;  1JRX A;  5GRT A;  3EF6 A;  1TYT A;  2YQU A;  2EQ7 A;  1LVL A;  4U8K A;  4K22 A;  2CVJ A;  3I3L A;  2GR0 A;  5BRT A;  1N4W A;  4H50 A;  2C76 A;  3BNM A;  3HZL A;  3GMB A;  4EQX A;  3SYI A;  3KLJ A;  1VDC A;  2R0P A;  4U2S A;  1NG3 A;  4JDR A;  3UCL A;  2BYB A;  1N1P A;  1CJ2 A;  2EQ9 A;  1XAN A;  1GSN A;  4EQR A;  1HYU A;  1EL9 A;  3AE9 A;  3AEC A;  2IVE A;  3M13 A;  4PAA A;  1ONF A;  2JK6 A;  3DJD A;  2YVJ A;  3DA1 A;  2V3B A;  2JAE A;  2GR3 A;  2YLS A;  3DK9 A;  3GWD A;  3AEE A;  4LA1 A;  2QA1 A;  1MOK A;  2IID A;  1H83 A;  4U8M A;  3UKK A;  5JRB A;  3URH A;  3CN8 A;  2FJA A;  3BI5 A;  3AWI A;  1TDO A;  1EL5 A;  2Y6R A;  3LOV A;  1GER A;  1JOA A;  1KFY A;  3CGD A;  2JB1 A;  1PDH A;  5U63 A;  2RGH A;  3NK0 X;  1LPF A;  5U25 A;  4U8N A;  2V3A A;  1KSS A;  3L8K A;  4G73 A;  4C77 A;  3K7Q X;  4CBQ A;  4J34 A;  1LQT A;  1EBD A;  4U8O A;  5HHF A;  3S61 A;  1PN0 A;  2O9Z A;  3JSK A;  2NPX A;  2CDU A;  1M64 A;  5IPY A;  5J7X A;  2C72 A;  2YWL A;  3NKS A;  4C5O A;  4ZCC A;  1VG0 A;  3H8I A;  2C70 A;  2CUL A;  1PBC A;  4U2T A;  1MXT A;  4UDP A;  1F8R A;  3NNE A;  2WP9 A;  3VRB A;  1CF3 A;  4J2W A;  4B63 A;  3NG7 X;  4H4W A;  1S2Y A;  3NRN A;  4GR1 A;  5EB5 A;  3AB1 A;  3NLC A;  3UKQ A;  1GTH A;  1L9E A;  3HYX A;  2WQY A;  2V5Z A;  1W4X A;  1CC6 A;  2BK4 A;  3Q6J A;  2Q0K A;  2C4C A;  3ISH A;  3UP5 A;  2GQF A;  3ICS A;  5KOX A;  4RG4 A;  4H2Q A;  1XDI A;  3DGZ A;  3UOY A;  4YWO A;  2Z5Y A;  3P4P A;  2OAM A;  1E6E A;  1NHS A;  4EIQ A;  4C74 A;  1FL2 A;  1BF3 A;  3AYJ A;  4IVO B;  3O0H A;  4CCQ A;  2GEW A;  1O5W A;  2QA2 A;  4UDR A;  2BS4 A;  3LZW A;  3UOZ A;  3G5R A;  4E0V A;  4YKF A;  2WPC A;  1Y56 B;  2BC0 A;  3KU9 A;  4H2N A;  4BV6 A;  4Z2T A;  1DJN A;  3CGB A;  5FS8 A;  3IF9 A;  3EAN A;  3QVR A;  1UKV G;  2C3D A;  1OJ9 A;  1N4V A;  1IUV A;  3CNT A;  4AP1 A;  2BAC A;  3C4A A;  4GAV A;  3COX A;  2VVL A;  5C3J A;  4BK3 A;  4CNK A;  2QAE A;  4X9N A;  3P4Q A;  4NNJ A;  1H2I A;  1GRA A;  4GDP A;  3BHF A;  2VQB A;  1GND A;  3GD3 A;  4I59 A;  1PBF A;  4DGK A;  4DNA A;  2YG3 A;  2R0G A;  4BJZ A;  1GXF A;  3IHG A;  2YLT A;  3ALL A;  4YSH A;  1PXC A;  1K0J A;  3DGH A;  3AE1 A;  5EB4 A;  5KOW A;  1L0V A;  2C75 A;  1SEZ A;  2XVF A;  2GAG B;  4FDC B;  1COY A;  1YQZ A;  2XFO A;  4ZN0 A;  4XWR A;  2X50 A;  5CQF A;  2WDR A;  3UKP A;  4ADW A;  4K8D A;  2C7G A;  2YLW A;  2WP6 A;  4YTN A;  1NHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...