5JCNA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 130
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA02
1FEAA 5JCKA 1LQTA 3T37A 4Z43A 5FS6A 3SM8A 4H4QA 1E1MA 3AEBA 1GRGA 4GUVA 3UKQA 4H4SA 4ICYA 2I0ZA 2WOIA 1O5WA 5JCMA 1OJTA 1OJAA 2CVJA 2DKHA 2OLOA 3FIMB 1SEZA 2WPFA 3NIXA 4X4JA 3H8LA 3UTHA 2BK3A 3NLCA 5KVHA 2J3NA 2Q0LA 4MJWA 3D1CA 1O94A 2BACA 2GH5A 2V6OA 2WPCA 1JRXA 1GREA 3ALLA 1S3BA 3UP5A 2R45A 1PBBA 5HHFA 1E7PA 4KPRA 2UZZA 2XYOA 2YLWA 1GRTA 4OPIA 5J7XA 4J33A 5EOWA 2XCGA 4NEVA 1QLBA 2YR6A 5EB4A 4E0VA 1YY5A 1IUWA 4OVIA 3R9UA 2JB1A 2XLUA 2YR4A 2XVFA 3M12A 4OPUA 2C3CA 3H4KA 5EBKA 3OZ2A 1JNZA 3UCLA 1N4WA 1CHUA 4UP3A 1VDCA 2OAMA 3AE6A 1MOKA 3O0HA 1EL7A 1FOHA 1JU2A 3F8DA 1ZMDA 2YG6A 1MXTA 4AT2A 2GVCA 4LA1A 1K4QA 5HYMA 3AEFA 4YSHA 3PS9A 1JEHA 5GSNA 1REOA 4AP1A 1PBCA 2GR0A 2EQ8A 4GF7A 5FS8A 4C3YA 3IHMA 5LV9A 5KRQA 1L9EA 2WESA 1ZK7A 1TYPA 4LIIA 5JCLA 1CC2A 1Y56B 3GYJA 3QVRA 3B6DA 4ZCDA 4B66A 3KU9A 4UDPA 3RP6A 1GOSA 1K0IA 3GYIA 4CRTA 2ZZCA 1E39A 2WETA 3L1RA 2VQBA 5U63A 1Q1RA 4AOSA 1RYIA 5FMHA 2C65A 1PXCA 3IHGA 3ZYXA 3LZWA 4O5QA 2V3BA 2WU2A 4NTDA 4NEWA 3RP7A 2FJDA 1CC4A 2C67A 4BJYA 5KXJA 4PABA 3BI2A 1GRAA 3RHAA 5CQFA 4CCRA 4GR1A 1GT8A 1FEBA 3K7QX 3IF9A 2GMHA 3KPFA 3M13A 4A99A 1DNCA 2TPRA 4WCTA 3AE2A 2C73A 2XLSA 4B63A 4Z24A 5JCIA 1LV0A 5GRTA 4H2PA 4TLZA 2V5ZA 4U8NA 3GD3A 2BA9A 3I6DA 4GDPA 4U8PA 2WP6A 3E1TA 3NYCA 4UDRA 1EL9A 1BKWA 4EQRA 2YG7A 2YQUA 4EMJA 5HY5A 1TDFA 2C72A 2Q6UA 4USQA 1NHRA 3D8XA 4AT0A 1P2EA 2EQ6A 3GDNA 4TLXA 4IA5A 3II4A 4J31A 1EBDA 3LXDA 1CC6A 1K0JA 3RP8A 4CY8A 1PBDA 1TYTA 3GRSA 1PHHA 2FJBA 4IA6A 2GQFA 1FECA 3DJGX 4H4PA 4H4VA 1Q9IA 3NN0X 4A5LA 2C75A 4Z2RA 3EPTA 3GRTA 2F5ZA 4TM0A 2BS4A 4X9MA 3AE9A 4YTMA 3UTGA 1XHCA 3PO7A 2JB3A 2X8CA 2YLSA 5HXIA 2Z5YA 5KOXA 3IWAA 1NEKA 1ZX9A 2OA1A 4KX6A 4H4YA 1D5TA 2VVLG 4RG3A 2B9XA 3EAOA 3AECA 4ADWA 3ATRA 1PN0A 1NAAA 1ZMCA 4C3XA 3DJDA 1W4XA 1JRZA 1PJ7A 2RABA 1RP0A 5KWFA 1GALA 4BK3A 3NG7X 1GXFA 1KSUA 2OALA 3AXBA 1V59A 1BGNA 3BHFA 2BC1A 1ZY8A 2GQWA 3QSSA 2H88A 3ICSA 2X8GA 1JOAA 3VR9A 1F8SA 1JRYA 3PVCA 2WDRA 4YSXA 4K5SA 2BCPA 3F8RA 3K30A 4H7UA 3UKAA 1ZOVA 4J34A 1QO8A 1KNPA 2GAHB 2Y6QA 4H4RA 3P1WA 1H82A 3AWIA 3ICTA 3VRBA 4BJZA 5C2TA 2YLZA 1NDAA 2CFYA 4EQXA 2W0HA 4YTPA 1VQWA 2YR5A 3NHOX 4BV6A 4XWRA 2JK6A 3QVPA 1GRFA 1CBOA 1CJ4A 3QSEA 1BZLA 4EMIA 1D7LA 2XDOA 2GV8A 2OLNA 3AEDA 3K7MX 4TM3A 4IVMB 3DJJA 1CL0A 2AQJA 3QJ4A 3LADA 3FPZA 4H4XA 1DJQA 2YLRA 4P9SA 1IJHA 2BS2A 1MO9A 4PAAA 4U8JA 3FBSA 3H8IA 4J2WA 1GEUA 4Y4MA 4AP3A 4EM4A 1Z6LA 5JCNA 1F6MA 1LPFA 1COYA 3DMEA 3UOZA 1NENA 1KF6A 4DSGA 4Z25A 2VZ2A 4OPLA 1M64A 1ZOYA 3KLJA 2WPEA 1X31B 4H2RA 2WP9A 4EMWA 1BF3A 1EL5A 1E1KA 2BXSA 2YLTA 3S5WA 1L0VA 4C77A 4DSHA 2GRTA 3GMBA 4Z26A 4CNJA 2B7RA 4OCGA 1B5QA 3EANA 5DBJA 4TM1A 3UTEA 3CPHG 3P4RA 3L8KA 1IUSA 3DH9A 4U8OA 2YM2A 4H4ZA 2BS3A 3SFDA 1OJCA 3QSMA 1DOEA 2ARDA 3CGBA 2YLXA 1S2YA 2YG4A 3NTAA 1IUTA 1P2HA 2E4GA 1LJ1A 4N9XA 2QA2A 4JY3A 2R4EA 4FK1C 2B9YA 2QCUA 1ZP0A 3NKSA 4Z2UA 4BURA 1L9DA 4FDCB 1N1PA 2GB0A 2E1MA 2E5VA 3GSIA 1KSSA 2JB2A 2JKCA 2XFQA 4JNAA 2ZZBA 1NG3A 3KKJA 4H50A 3DK9A 4H4WA 3C4AA 2YG5A 2ZBWA 3ABVA 4NTEA 1KDGA 1HYUA 2XVEA 3NYEA 3UOYA 1CJ2A 1GSNA 3ITJA 3REDA 3JSKA 1F8WA 1H84A 1AOGA 1H86A 4C74A 3P4SA 1XANA 4AOXA 2WU5A 3AE4A 3CIRA 4A65A 4ZCCA 3AD8B 2FBWA 2X99A 1TDOA 3AYLA 1N4UA 3UP4A 4OPDA 2APGA 2JAEA 3ALJA 4C5OA 3ISHA 4JDRA 2R4JA 1ZKQA 2Y6RA 2QAEA 1IUUA 3UKHA 4CCQA 1PXAA 3M0OA 2XVJA 3IC9A 1DJNA 4XWZA 4APNA 1M6IA 3CNSA 4J57A 1LTXR 2A8XA 2BCGG 2EQ9A 3DGHA 4OPCA 1TDEA 3BI5A 1OJDA 2CDUA 2YM1A 2BK4A 4K5RA 1F8RA 3AB1A 4FK1A 3GWFA 3AE8A 3SQPA 5CKUA 1PBEA 1F3PA 3UKKA 4A7AA 4U2LA 4K2XA 2C70A 4B68A 1B8SA 4B64A 4H4UA 3V3NA 1B37A 2X3NA 1OJ9A 2IIDA 2C66A 4IVOB 4U2TA 4FX9A 2WOVA 4B1BA 2GF3A 3P4QA 2NPXA 2WOWA 3K7TA 1TDKA 1ZDLA 4BK1A 2R0CA 4B67A 2WEUA 4EQSA 3P9UA 3AD7B 5C3JA 2WP5A 4U8KA 3AE7A 3UTFA 2WDVA 5BUKA 2C64A 4J36A 4HB9A 3AE5A 4J56A 3CPJG 5EB5A 1YQ4A 2V61A 1E1LA 3QFAA 3GWDA 3KA7A 5M10A 1H7XA 1YQ3A 2PHHA 1KFYA 1DXLA 3NN6X 3RNMA 2WQYA 4UDQA 4B65A 1D4EA 2V60A 2NVKX 1CJ3A 2R46A 3VQRA 1PDHA 3GMCA 4IV9A 2Q0KA 2Z5XA 4U8LA 1EL8A 2XVIA 2ACZA 2VQ7A 2FJEA 2VVMA 2YG3A 4D04A 5IQ4A 3UKLA 4YXDA 1QJDA 4RSLA 2A89A 2WBAA 3DK4A 4EM3A 2C76A 1GNDA 1D4CA 3VR8A 2VOUA 4A79A 2VRMA 3NGCX 2X8HA 2BABA 2O9ZA 1DODA 4JNQA 1IUVA 3C4NA 4JQ9A 3HZLA 3BHKA 4RG4A 2BYBA 3AYJA 2GR3A 4B69A 4YKGA 2XLRA 5BRTA 1PJ5A 1GRBA 3CNDA 2XFNA 3BNMA 1ELIA 1S3EA 1Y0PA 4EIPA 4YTNA 1FCDA 2AR8A 4U8MA 2R0PA 1NHPA 3UOXA 2R0GA 3CPIG 1B4VA 3G5QA 1UKVG 4ECHA 1GETA 1GTEA 3NTDA 2Q7VA 2QA1A 1TRBA 1GRHA 3NYFA 3VRAA 5BVAA 3GD4A 3CGEA 2FJAA 2B9WA 2XFPA 3I3LA 3OC4A 1O95A 4GRTA 1N4VA 4ZN0A 4H2NA 1PJ6A 1H6VA 4LU6A 1FL2A 3BI4A 4K22A 2C7GA 2CULA 1YQZA 3LOVA 5KOWA 4YSYA 1KNRA 2JBVA 4A6NA 2XLPA 2GAGB 3NNEA 2YWLA 3AEAA 2V3AA 3FG2P 3VRDB 4X9NA 1DOCA 2GR1A 2HQMA 5FS7A 1PS9A 4CY6A 4DGKA 4JY2A 2B76A 3F8PA 1CJCA 3AYIA 2R9ZA 2ZZ0A 3EF6A 4WX1A 1RSGA 4M52A 3CNJA 1D7YA 2EQ7A 5BULA 4O5UA 3ICRA 3ATQA 2YVJA 1LQUA 1CF3A 3V76A 4K8DA 1PXBA 1GPEA 1L9CA 5ER0A 3G5RA 3SGLA 3AE1A 4D03A 4OPTA 3URHA 3KVEA 1H81A 5J60A 4YT0A 2YAUA 5IPYA 3AEEA 3AD9B 2RGHA 3ADAB 5L46A 1NHSA 3Q9TA 4Z44A 3ZDNA 2WHDA 1VRQB 2A87A 3SFEA 1GESA 3AEGA 3DGZA 2WS3A 2H89A 4U8IA 1VG0A 5TR3A 2X50A 3BNUA 1Q1WA 4HA6A 3B3RA 3UOVA 2RGOA 3AE3A 4CBQA 5U1OA 2GR2A 2TMDA 1K0LA 2XFOA 3G5SA 4GDEA 4I58A 5U25A 1S2QA 4Y4NA 4YKFA 4YSZA 5KVIA 2BC0A 1YKJA 3CGCA 1H7WA 2DKIA 3NK1X 2C3DA 1E1NA 3C96A 3GDPA 3NT6A 5IQ1A 1H83A 3COXA 3LB8A 2BXRA 1GTHA 3KD9A 4OPGA 2BK5A 2AAQA 4Z2TA 1GERA 2IVDA 3DK8A 2VVLA 2RGJA 4REKA 2GMJA 4DNAA 3LZXA 4A6NB 1ONFA 3DA1A 4EQWA 5FS9A 2XVHA 1NHQA 3Q6JA 4U2SA 2XFUA 3CNTA 3NK2X 4GCMA 1JNRA 3UKFA 1NPXA 1BWCA 4A9WA 3NH3X 2PYXA 4JN9A 3QFBA 1IUXA 3WE0A 1VG9A 3NK0X 5M0ZA 3UKPA 4NZHA 4CNKA 4TM4A 4H2QA 1E6EA 2VRLA 2XLTA 3FMWA 3V3OA 3CTYA 4NTCA 1D4DA 4Y4LA 4XXGA 3LJPA 4BK2A 3CN8A 1GV4A 2WDQA 3ALMA 1PBFA 4I59A 4K7ZA 2YVGA 2B7SA 3CGDA 3CNPA 4EIQA 1XPQA 3P4PA 1TDNA 2GEWA 1Y56A 4USRA 1DOBA 1BGJA 2IVEA 1NG4A 2YVFA 3DJEA 4YWOA 3NRNA 4H4TA 1XDIA 1LVLA 3S61A
chains in the Genus database with same CATH superfamily
5JCKA 3SM8A 3AEBA 4GUVA 5JCMA 3RGTA 3UTHA 2PGWA 3KPKA 2WPCA 3ALLA 1JPDX 4K2SA 4J33A 5EOWA 1QLBA 1SJCA 5EB4A 4E0VA 3VDGA 1YY5A 1R0MA 3R9UA 4F4RA 2C3CA 4GMEA 3O0HA 3F8DA 1XS2A 3HYVA 4G6HA 1K4QA 5HYMA 4AP1A 1PBCA 2GR0A 2NQLA 1L9EA 1ZK7A 4LIIA 5JCLA 1Y56B 3B6DA 3CXBA 3R1ZA 4AOSA 4MKSA 2C65A 2OQYA 3ZYXA 4O5QA 4NTDA 5KXJA 4NEWA 4PABA 1GT8A 3MZNA 2GSHA 3KPFA 3NS1B 4B63A 5GRTA 3GD3A 2BA9A 2WP6A 4KEMA 2OG9A 2YQUA 5HY5A 2Q6UA 4USQA 2GGJA 1KKRA 1P2EA 2EQ6A 3SZ0A 3LXDA 4CY8A 1TKKA 2FJBA 4IA6A 1Q9IA 4Z2RA 2C75A 3UTGA 5HXIA 5KOXA 2Z5YA 1NEKA 3T2KA 2VVLG 4RG3A 2B9XA 1V97A 2XH2A 3SN4A 2XH4A 2QJMA 1GALA 4G73A 1FFVC 1KSUA 1V59A 4E5TA 2X8GA 1JOAA 3VR9A 1F8SA 4GISA 2WDRA 1E9IA 3NVZB 2BCPA 3K30A 4H7UA 2PTYA 1QO8A 1KNPA 2P88A 3T4WA 1H2IA 4XWRA 3VCCA 1CBOA 4H1ZA 4EMIA 2OLNA 3DJJA 3EUB3 1MO9A 2BRYA 4AP3A 1Z6LA 1LPFA 1COYA 4DSGA 2O56A 1E1KA 2GRTA 3GMBA 4CNJA 4OCGA 1B5QA 3UTEA 1VQZA 4H83A 4HPNA 3CPHG 3P4RA 1IUSA 2YM2A 3IJQA 3SFDA 3SQSA 2ARDA 3CGBA 3HW2A 2PTWA 3NTAA 1P2HA 4N9XA 1ZP0A 4Z2UA 4BURA 1L9DA 3GSIA 2JB2A 2XFQA 4H4WA 2YG5A 2ZBWA 3ABVA 3R0KA 4MGGA 1KDGA 3UJEA 3GO2A 2ZC8A 3REDA 3JSKA 3MY9A 1IYXA 1N4UA 2APGA 2JAEA 1N62C 3NVYB 4ROPA 1ZKQA 2Y6RA 2QAEA 1IUUA 3M0OA 2XVJA 3CNSA 5KMSA 3CAWA 2EQ9A 3R10A 3DGHA 1TDEA 1OJDA 2CDUA 2YM1A 4K5RA 1F8RA 4A7AA 1F3PA 3S5SA 4FP1A 2X3NA 2IIDA 2C66A 3UJ2A 3A7AA 4IVOB 4FX9A 2PU1A 2WOWA 1ZDLA 5KMRA 3NFUA 2WEUA 4B67A 2WP5A 3V5FA 3SZFA 4U8KA 3UTFA 1L8PA 3RO6A 5BUKA 3AE5A 3EEZA 4G7FA 1EC7A 5EB5A 3KA7A 3GWDA 2PHHA 1KFYA 1DXLA 3VC6A 3NN6X 3RNMA 2WQYA 4B65A 2V60A 4IV9A 2XVIA 2ACZA 2FJEA 2C76A 2PPGA 2XH7A 4JQ9A 2GR3A 4YKGA 1JRPA 2XLRA 3DIPA 4EIPA 2R0PA 3CB3A 4HCDA 1UKVG 5ENLA 1GETA 2Q7VA 2QA1A 1GRHA 5BVAA 3CGEA 2FJAA 2B9WA 4ZN0A 3RRAA 4LU6A 1FL2A 2I5QA 2GGIA 4DYEA 4E4UA 2OZ3A 3NNEA 2V3AA 1CJCA 2ZZ0A 4WX1A 1RSGA 2P0IA 3CNJA 4JN7A 1CF3A 1GPEA 1L9CA 3KVEA 4YT0A 5IPYA 3AEEA 2RGHA 4Z44A 4DHGA 3DGZA 1VG0A 2PP3A 2X50A 3THUA 4HA6A 3B3RA 3UOVA 3P93A 5U1OA 2GR2A 3EKGA 4Y4NA 2BC0A 2FYMA 1S7MA 2OZ8A 2BXRA 2GGGA 4OPGA 4Z2TA 2VVLA 2GMJA 4DNAA 3ZVHA 1VDVA 1NHQA 3HPFA 4GCMA 3A7UA 2P3ZA 2PYXA 3QFBA 4NZHA 1ECQA 3ES8A 4X2PA 2XLTA 3FMWA 4NTCA 1PBFA 4I59A 2B7SA 3A7RA 1ONEA 3UJFA 4NNJA 1P43A 2OPJA 1NG4A 3DJEA 4YWOA 3NRNA 1LVLA 4HYRA 4ICYA 2I0ZA 2WOIA 1OJAA 1OJTA 2OLOA 1SEZA 4G6GA 3NIXA 3H8LA 2Q0LA 1O94A 1S3BA 1E7PA 4KPRA 2UZZA 4OPIA 2DW7A 3ZVHB 1IUWA 3T14A 3T6CA 1JNZA 1N4WA 1VDCA 2OAMA 3AE6A 3Q45A 1JU2A 2QQ6A 1EBGA 2BRAA 4IP5A 4LA1A 1MDLA 1ZXIC 3OPSA 2EQ8A 1N5XA 4C3YA 3IHMA 5KNLA 4IHCA 3UCDA 2WESA 1TYPA 4J3ZA 1CC2A 3GYJA 4ZCDA 3RP6A 1GOSA 1FIQB 2WETA 3TJIA 5FMHA 1PXCA 2OLAA 2V3BA 1CC4A 2C67A 5CQFA 4CCRA 4GR1A 1FEBA 3K7QX 4WCTA 3AE2A 1SJAA 4H2PA 4U8NA 3T2ZA 3E1TA 4UDRA 1EL9A 3U9IA 4EQRA 4HCLA 2C72A 3D8XA 4IA5A 3GC2A 3RP8A 3OZYA 3GRSA 3B97A 1FECA 4H4PA 4H4VA 4A5LA 4TM0A 2BS4A 4YTMA 3AE9A 3PO7A 2JB3A 2X8CA 3IWAA 2OA1A 4H4YA 3ATRA 1PN0A 3D9XA 4TVWA 4C3XA 3GY1A 2P8BA 1JRZA 1PJ7A 3T2YA 1GXFA 1BGNA 3BHFA 2BC1A 1ZY8A 1JRYA 4YSXA 2CHRA 3UKAA 2Y6QA 3L5OA 4HN8A 2AL1A 3I4KA 5C2TA 2YLZA 4EQXA 2YR5A 3NHOX 2JK6A 3OZMA 5KMPA 1CJ4A 1D7LA 1JPMA 3K7MX 3LADA 4H4XA 2BS2A 4PAAA 3JW7A 4EM4A 5JCNA 4IZGA 1NENA 2DW6A 1M64A 1STZA 4H2RA 1JCTA 3DG7A 2WP9A 3S5WA 1L0VA 3EANA 3BJSA 1OJCA 1DOEA 2YLXA 2W3SA 2E4GA 2GL5A 2QCUA 2PP0A 2GB0A 2E1MA 2OFJA 2PCEA 3V5CA 3DK9A 1SJDA 3RITA 3DDMA 3ETRB 2XVEA 3NYEA 3UJSA 4IT1A 1F8WA 1H84A 1AOGA 4C74A 4ZCCA 3AD8B 4HNCA 4OPDA 3ALJA 2R4JA 2RDXA 5FJRA 4CCQA 1PXAA 3IC9A 1M6IA 1LTXR 2BCGG 3BI5A 1MDRA 3AE8A 3SQPA 2PTXA 4K2XA 4ENLA 1B8SA 3V3NA 1B37A 1ELSA 3ZVIA 2WOVA 4KWSA 3P4QA 2OZTA 3SYIA 4EQSA 3AE7A 4II2A 2QDEA 3CXOA 4HB9A 4GAVA 4J56A 3CPJG 4JN8A 3VQRA 2R46A 2Q0KA 3SN0A 4FI4A 2VQ7A 2VVMA 4JHMA 2A89A 3DK4A 3N4FA 1T3QC 2VOUA 3GD6A 4JNQA 1IUVA 4RG4A 3BHKA 1N61C 3AYJA 3SN1A 5BRTA 4TVYA 1GRBA 3ES7A 1KD0A 3BNMA 1Y0PA 2AR8A 3G5QA 3ZLGA 1TRBA 3NYFA 3VRAA 3GD4A 1PJ6A 4G74A 4K22A 2C7GA 2CULA 3R25A 4A6NA 2XLPA 2YWLA 3B9JB 3VRDB 1DOCA 2HXUA 2HQMA 5FS7A 4CY6A 3NVVB 4JY2A 3I6EA 2B76A 3AYIA 2R9ZA 3T8QA 2YVJA 4EWJA 4D03A 3URHA 2OVLA 3Q9TA 3ZDNA 3ZLFA 1KKOA 2WHDA 1GESA 2QVHA 2H89A 4U8IA 5TR3A 3UJRA 3DFHA 3Q4DA 3NZGA 2XFOA 3G5SA 4I58A 1S2QA 4YKFA 1YKJA 2DKIA 3NT6A 3C96A 3COXA 3LB8A 3V4BA 4HNLA 2AAQA 1GERA 3DK8A 4A6NB 2XSXA 3Q6JA 2AKZA 3CNTA 1NPXA 5FJUA 3WE0A 3NK0X 5M0ZA 3UKPA 4H2QA 1E6EA 3V3OA 1D4DA 3CT2A 1KCZA 4BK2A 3S47A 3CN8A 1GV4A 2PGEA 3CNPA 4EIQA 3CYJA 2GEWA 1MRAA 1DOBA 1BGJA 2IVEA 4GGBA 1LQTA 3SJNA 4Z43A 3K1GA 4H4QA 2MNRA 3UKQA 2DKHA 2E5AA 2BK3A 3NLCA 5KVHA 2J3NA 4MJWA 3D1CA 2BACA 2GH5A 1MNSA 2V6OA 1JRXA 5HHFA 2XYOA 1GRTA 4GAPA 2HNEA 2XCGA 2YR6A 3AMZA 2JB1A 2XLUA 2XVFA 3M12A 4OPUA 2PMQA 2P8CA 3UCLA 1CHUA 3IJLA 1EL7A 4M0XA 1FOHA 3TWAA 1ZMDA 2GVCA 3AEFA 1JEHA 5GSNA 5FS8A 5LV9A 5KRQA 4E4FA 2PP1A 4UDPA 3GYIA 3LZWA 2WU2A 5KMQA 4BJYA 3BI2A 3RHAA 4K8GA 4A99A 1DNCA 4ZOHB 2C73A 2XLSA 5JCIA 4TLZA 3I6DA 4U8PA 4GDPA 1BKWA 2YG7A 4EMJA 1TDFA 1NHRA 4TLXA 3GDNA 1CC6A 3DJGX 3ENLA 3PWGA 3EPTA 3GRTA 2F5ZA 4X9MA 2YLSA 3IJIA 1ZX9A 1NAAA 1ZMCA 3DJDA 2RABA 5KWFA 3H7VA 1P48A 3AXBA 2GQWA 2H88A 3DG6A 3ICSA 4K5SA 1ZOVA 2QDDA 4H4RA 3P1WA 1PDYA 1H82A 3ICTA 2CFYA 4YTPA 2W0HA 1VQWA 3QVPA 3MQTA 1GRFA 2QJJA 3UKLA 1BZLA 2GV8A 4TM3A 4IVMB 3DGBA 1CL0A 3FPZA 4P9SA 1DJQA 3VCNA 3FXGA 4U8JA 1R6WA 3H8IA 4Y4MA 1F6MA 1DTNA 3DMEA 4Z25A 2WPEA 5EU9A 2BXSA 1BF3A 1EL5A 2YLTA 5DBJA 4TM1A 3L8KA 3DH9A 4H4ZA 2OKTA 5G5GB 3QSMA 2FKPA 2YG4A 2ZADA 3TQPA 2QA2A 3NKSA 3FV9A 3VFCA 2E5VA 4JNAA 1PDZA 2ZZBA 3QTPA 1NG3A 3SY4A 4NTEA 1GSNA 3ITJA 1H86A 4J1OA 3P4SA 2WU5A 1X2HA 3QN3A 3AYLA 3UP4A 3ISHA 4JDRA 3FVDA 3UKHA 1EC9A 4APNA 3RR1A 1FHVA 3NVWB 4FK1A 3UKKA 4U2LA 2C70A 3T0KA 4B68A 4B64A 3TTEA 3N6JA 3V3WA 3SXIA 4U2TA 1MUCA 2GF3A 5J04A 2HXTA 4BK1A 1NU5A 2OX4A 3P9UA 6ENLA 4MMWA 2C64A 2V61A 1E1LA 4UDQA 3GMCA 2Z5XA 1X2GA 4Z1YA 4D04A 3CMMA 1QJDA 2WBAA 4Z17A 3VR8A 3SSZA 4A79A 3UXKA 2BABA 2O9ZA 3HZLA 2BYBA 4H2HA 1SJBA 1PJ5A 3CNDA 3FCPA 2XFNA 1FHUA 1ELIA 2AKMA 1NHPA 3UOXA 2R0GA 3CPIG 1B4VA 1GTEA 3NTDA 2XFPA 1O95A 1H6VA 1YQZA 5KOWA 2JBVA 2GAGB 3FG2P 2ONEA 4X9NA 3DERA 2GR1A 4DGKA 2XGZA 2W55A 1D7YA 3SR6B 5BULA 4G9KA 4O5UA 3ICRA 4DXKA 4K8DA 1PXBA 3SZWA 5ER0A 3G5RA 3SGLA 3UCCA 5J60A 3JZUA 2E3TA 3RCYA 2YAUA 3AD9B 3ADAB 7ENLA 1NHSA 3TW9A 3SFEA 2HZGA 3P0WA 4GYPA 3NXLA 3DEQA 3BNUA 1Q1WA 3HYWA 4CBQA 3AE3A 1K0LA 4ECHA 2W3RA 4HCHA 4YSZA 5KVIA 3CGCA 3NK1X 2C3DA 5IQ1A 3D46A 3OP2A 2BK5A 4REKA 3LZXA 4II3A 4U2SA 1BWCA 4A9WA 1BQGA 4JN9A 1IUXA 1VG9A 4CNKA 4TM4A 2VRLA 2PU0A 5FJPA 3CTYA 3HYXA 3TCSA 4Y4LA 4XXGA 3QPEA 3GYXA 3CGDA 3PFRA 1XPQA 3P4PA 3OTRA 4USRA 2YVFA 3QKEA 1BKHA 3S61A 1FEAA 3T37A 5FS6A 1E1MA 1GRGA 4H4SA 1O5WA 2CVJA 3FIMB 3SBFA 4E6MA 1YEYA 2WPFA 2C4CA 4X4JA 2XH0A 3AM9A 4K1WA 1OEPA 1GREA 3UP5A 2R45A 1PBBA 5J7XA 2YLWA 4NEVA 1WUEA 4OVIA 2YR4A 3H4KA 5EBKA 3OZ2A 4UP3A 2PTZA 1MOKA 1WUFA 2YG6A 3IK4A 4KT2A 2OQHA 1MXTA 4AT2A 5IDZA 4YSHA 3PS9A 1REOA 4GF7A 4DX3A 3QVRA 1W6TA 4B66A 3KU9A 1K0IA 4CRTA 2ZZCA 1E39A 3L1RA 2VQBA 5U63A 1Q1RA 1RYIA 3IHGA 3RP7A 2FJDA 1GRAA 3IF9A 2GMHA 4DWDA 3M13A 2TPRA 4Z24A 1LV0A 2V5ZA 3NYCA 1TE6A 4AT0A 3T9PA 3II4A 4J31A 1EBDA 3VC5A 1K0JA 1PBDA 1TYTA 1PHHA 2AL2A 2GQFA 2PA6A 3NN0X 1XHCA 4KX6A 1D5TA 3EAOA 3AECA 4ADWA 4H19A 1W4XA 3R0UA 1RP0A 4IP4A 3R07C 3HRDC 4BK3A 3NG7X 2OALA 4ZCWA 3QSSA 3NO1A 3OW1A 4NWZA 2PODA 3PVCA 4GIRA 3F8RA 4J34A 4GGHA 2QGYA 2GAHB 3AWIA 3VRBA 4BJZA 1NDAA 4BV6A 2GDQA 3QSEA 2GGHA 2XDOA 3AEDA 2AL2B 2AQJA 3QJ4A 1EBHA 2YLRA 3MSYA 1IJHA 3FBSA 4J2WA 4ZA0A 1GEUA 1RVKA 1JROA 3UOZA 1KF6A 2VZ2A 4OPLA 1ZOYA 3KLJA 3DG3A 1X31B 1JDFA 4EMWA 4C77A 4DSHA 1FFUC 1SB3B 3UGVA 4Z26A 3DESA 2B7RA 4DN1A 3I6TA 4U8OA 4G8TA 4A6GA 2BS3A 3N6HA 3PWIA 3BOXA 1S2YA 1IUTA 1LJ1A 5BOFA 4JY3A 2R4EA 4FK1C 2B9YA 4FDCB 1N1PA 3TOYA 3FYYA 1KSSA 2JKCA 1F9CA 4KPLA 3KKJA 4H50A 3C4AA 3H12A 1KN0A 1HYUA 3U4FA 3UOYA 1CJ2A 1N60C 1XANA 4AOXA 3AE4A 3CIRA 4A65A 2FBWA 2X99A 1TDOA 4C5OA 3NRZB 5JRBA 1N63C 1DJNA 4XWZA 4J57A 2A8XA 4OPCA 4M6UA 2BK4A 3AB1A 3GWFA 5CKUA 1PBEA 2W54A 3STPA 3R11A 4H4UA 5FJOA 1OJ9A 3ZLHA 1N5WC 4B1BA 2NPXA 3K7TA 1TDKA 3SZCA 2R0CA 3AD7B 3T31A 5C3JA 3TJ4A 3BSMA 2WDVA 4GFIA 4J36A 1YQ4A 3QFAA 5M10A 1H7XA 1YQ3A 3H70A 3DFYA 1D4EA 2NVKX 1CJ3A 1PDHA 4U8LA 1EL8A 2YG3A 3KUMA 3SX6A 5IQ4A 4YXDA 4RSLA 4EM3A 1GNDA 1D4CA 1TZZA 5BOEA 3MKCA 2VRMA 3NGCX 2X8HA 3CK5A 3VA8A 1DODA 3UXLA 3C4NA 4B69A 5FJTA 5G5HB 3JVAA 3N4EA 1S3EA 1FO4A 4YTNA 1FCDA 4U8MA 3FJ4A 3AN1A 1WYGA 2PS2A 1EC8A 4IL0A 3I3LA 3OC4A 3MWCA 4GRTA 1N4VA 2POZA 4H2NA 4GYPC 3BI4A 3LOVA 3D47A 4YSYA 1KNRA 4E8GA 3AEAA 4YWSA 2OO6A 1PS9A 2MUCA 3F8PA 3EF6A 2GGEA 4M52A 3PK7A 2EQ7A 3ATQA 1NELA 1LQUA 3V76A 4IL2A 3AE1A 1XPYA 3H8AA 4OPTA 1H81A 5L46A 1VRQB 2A87A 3AEGA 2WS3A 3MUCA 2RGOA 3QLDA 2TMDA 4GDEA 5U25A 1H7WA 3P3BA 1E1NA 3GDPA 1H83A 1GTHA 3KD9A 1RM6B 2IVDA 2PSNA 2RGJA 2QJNA 1ONFA 3DA1A 4EQWA 5FS9A 2XVHA 2XFUA 3NK2X 1JNRA 3UKFA 4A35A 4A3RA 3NH3X 3TWBA 3LJPA 3PG6A 2WDQA 3ALMA 4K7ZA 2YVGA 1TDNA 1Y56A 4H4TA 1XDIA
chains in the Genus database with same CATH topology
1FEAA 5JCKA 1LQTA 3T37A 4Z43A 5FS6A 3SM8A 4H4QA 1E1MA 3AEBA 1GRGA 4GUVA 3UKQA 4H4SA 4ICYA 2I0ZA 2WOIA 1O5WA 5JCMA 1OJTA 1OJAA 2CVJA 2DKHA 2OLOA 3FIMB 1SEZA 2WPFA 4G6GA 3NIXA 2C4CA 3H8LA 4X4JA 2BK3A 3NLCA 3UTHA 5KVHA 2J3NA 2Q0LA 4MJWA 3KPKA 3D1CA 1O94A 2BACA 2GH5A 2V6OA 2WPCA 1JRXA 1GREA 3ALLA 1S3BA 3UP5A 2R45A 1PBBA 5HHFA 1E7PA 4KPRA 2UZZA 2XYOA 2YLWA 1GRTA 4GAPA 4OPIA 5J7XA 4J33A 5EOWA 2XCGA 4NEVA 1QLBA 2YR6A 5EB4A 4E0VA 1YY5A 1IUWA 3T14A 4OVIA 3R9UA 2JB1A 2XLUA 2YR4A 2XVFA 3M12A 4OPUA 2C3CA 3H4KA 5EBKA 3OZ2A 1JNZA 3UCLA 1N4WA 1CHUA 4UP3A 1VDCA 2OAMA 3AE6A 1MOKA 3O0HA 1EL7A 1FOHA 1JU2A 3F8DA 3HYVA 4G6HA 1ZMDA 2YG6A 2BRAA 1MXTA 4AT2A 2GVCA 4LA1A 1K4QA 5HYMA 3AEFA 4YSHA 3PS9A 1JEHA 5GSNA 1REOA 4AP1A 1PBCA 2GR0A 2EQ8A 4GF7A 5FS8A 4C3YA 3IHMA 5KNLA 5LV9A 5KRQA 1L9EA 2WESA 1ZK7A 1TYPA 4LIIA 5JCLA 1CC2A 1Y56B 3GYJA 3QVRA 3B6DA 4ZCDA 4B66A 3KU9A 4UDPA 3RP6A 1K0IA 1GOSA 3GYIA 4CRTA 2ZZCA 1E39A 2WETA 3L1RA 2VQBA 5U63A 1Q1RA 4AOSA 1RYIA 5FMHA 2C65A 1PXCA 3IHGA 3ZYXA 3LZWA 4O5QA 2V3BA 2WU2A 4NTDA 4NEWA 3RP7A 2FJDA 1CC4A 2C67A 5KMQA 4BJYA 4PABA 3BI2A 1GRAA 3RHAA 5CQFA 4CCRA 4GR1A 1GT8A 1FEBA 3K7QX 3IF9A 2GMHA 3KPFA 3M13A 4A99A 1DNCA 2TPRA 4WCTA 3AE2A 2C73A 2XLSA 4B63A 4Z24A 5JCIA 1LV0A 5GRTA 4H2PA 4TLZA 2V5ZA 4U8NA 3T2ZA 3GD3A 2BA9A 3I6DA 4GDPA 4U8PA 2WP6A 3E1TA 3NYCA 4UDRA 1EL9A 1BKWA 4EQRA 2YG7A 2YQUA 4EMJA 5HY5A 1TDFA 2C72A 2Q6UA 4USQA 1NHRA 3D8XA 4AT0A 1P2EA 2EQ6A 3GDNA 4TLXA 4IA5A 3II4A 3SZ0A 4J31A 1EBDA 3LXDA 1CC6A 1K0JA 3RP8A 4CY8A 1PBDA 1TYTA 3GRSA 1PHHA 2FJBA 4IA6A 2GQFA 1FECA 3DJGX 4H4PA 4H4VA 1Q9IA 3NN0X 4A5LA 2C75A 4Z2RA 3EPTA 3GRTA 2F5ZA 4TM0A 2BS4A 4X9MA 3AE9A 4YTMA 3UTGA 1XHCA 3PO7A 2JB3A 2X8CA 2YLSA 5HXIA 2Z5YA 5KOXA 3IWAA 1NEKA 1ZX9A 2OA1A 3T2KA 4KX6A 4H4YA 1D5TA 2VVLG 4RG3A 2B9XA 3EAOA 3AECA 4ADWA 3ATRA 1PN0A 3D9XA 1NAAA 1ZMCA 4C3XA 3DJDA 1W4XA 1JRZA 1PJ7A 2RABA 1RP0A 5KWFA 1GALA 4G73A 4BK3A 3T2YA 3NG7X 1GXFA 1KSUA 2OALA 3AXBA 1V59A 1BGNA 3BHFA 2BC1A 1ZY8A 2GQWA 3QSSA 2H88A 3ICSA 2X8GA 1JOAA 4NWZA 3VR9A 1F8SA 1JRYA 3PVCA 2WDRA 4YSXA 4K5SA 2BCPA 3F8RA 3K30A 4H7UA 3UKAA 1ZOVA 4J34A 1QO8A 1KNPA 2GAHB 2Y6QA 3L5OA 4H4RA 3P1WA 1H82A 3AWIA 3ICTA 3VRBA 4BJZA 5C2TA 1H2IA 2YLZA 1NDAA 2CFYA 4EQXA 2W0HA 4YTPA 1VQWA 2YR5A 3NHOX 4BV6A 4XWRA 2JK6A 3QVPA 5KMPA 1GRFA 1CBOA 1CJ4A 3QSEA 1BZLA 4EMIA 1D7LA 2XDOA 2GV8A 2OLNA 3AEDA 3K7MX 4TM3A 4IVMB 3DJJA 1CL0A 2AQJA 3QJ4A 3LADA 3FPZA 4H4XA 1DJQA 2YLRA 4P9SA 1IJHA 2BS2A 1MO9A 4PAAA 4U8JA 3FBSA 3H8IA 2BRYA 4J2WA 1GEUA 4Y4MA 4AP3A 4EM4A 1Z6LA 5JCNA 1F6MA 1LPFA 1COYA 3DMEA 3UOZA 1NENA 1KF6A 4DSGA 4Z25A 2VZ2A 4OPLA 1M64A 1ZOYA 3KLJA 2WPEA 1X31B 4H2RA 2WP9A 4EMWA 1BF3A 1EL5A 1E1KA 2BXSA 2YLTA 3S5WA 1L0VA 4C77A 4DSHA 2GRTA 3GMBA 4Z26A 4CNJA 2B7RA 4OCGA 1B5QA 3EANA 5DBJA 4TM1A 3UTEA 3CPHG 3P4RA 3L8KA 1IUSA 3DH9A 4U8OA 2YM2A 4H4ZA 2BS3A 3SFDA 1OJCA 3QSMA 1DOEA 2ARDA 3CGBA 2YLXA 1S2YA 2YG4A 3NTAA 1IUTA 1P2HA 2E4GA 1LJ1A 4N9XA 2QA2A 4JY3A 2R4EA 4FK1C 2B9YA 2QCUA 1ZP0A 3NKSA 4Z2UA 4BURA 1L9DA 4FDCB 1N1PA 2GB0A 2E1MA 2E5VA 3GSIA 1KSSA 2JB2A 2JKCA 2XFQA 4JNAA 2ZZBA 1NG3A 3KKJA 3SY4A 4H50A 3DK9A 4H4WA 3C4AA 2YG5A 1KN0A 2ZBWA 3ABVA 4NTEA 1KDGA 1HYUA 2XVEA 3NYEA 3UOYA 1CJ2A 1GSNA 3ITJA 3REDA 3JSKA 1F8WA 1H84A 1AOGA 1H86A 4C74A 3P4SA 1XANA 4AOXA 2WU5A 3AE4A 3CIRA 4A65A 4ZCCA 3AD8B 2FBWA 2X99A 1TDOA 3AYLA 1N4UA 3UP4A 4OPDA 2APGA 2JAEA 3ALJA 4C5OA 3ISHA 5JRBA 4JDRA 2R4JA 1ZKQA 2Y6RA 2QAEA 1IUUA 3UKHA 4CCQA 1PXAA 3M0OA 2XVJA 3IC9A 1DJNA 4XWZA 4APNA 1M6IA 3CNSA 5KMSA 4J57A 1LTXR 2A8XA 2BCGG 2EQ9A 3DGHA 4OPCA 1TDEA 3BI5A 1OJDA 2CDUA 2YM1A 2BK4A 4K5RA 1F8RA 3AB1A 4FK1A 3GWFA 3AE8A 3SQPA 5CKUA 1PBEA 1F3PA 3UKKA 4A7AA 4U2LA 4K2XA 2C70A 3T0KA 4B68A 1B8SA 4B64A 4H4UA 3V3NA 1B37A 2X3NA 1OJ9A 2IIDA 2C66A 4IVOB 4U2TA 3SXIA 4FX9A 2WOVA 4B1BA 2GF3A 3P4QA 2NPXA 2WOWA 3K7TA 1TDKA 1ZDLA 4BK1A 3SZCA 2R0CA 5KMRA 3SYIA 4B67A 2WEUA 4EQSA 3P9UA 3AD7B 3T31A 5C3JA 2WP5A 3SZFA 4U8KA 3AE7A 3UTFA 2WDVA 5BUKA 4II2A 2C64A 4J36A 4HB9A 3AE5A 4J56A 4GAVA 3CPJG 5EB5A 1YQ4A 2V61A 1E1LA 3QFAA 3GWDA 3KA7A 5M10A 1H7XA 1YQ3A 2PHHA 1KFYA 1DXLA 3NN6X 3RNMA 5KXJA 2WQYA 4UDQA 4B65A 1D4EA 2V60A 2NVKX 1CJ3A 2R46A 3VQRA 1PDHA 3GMCA 4IV9A 2Q0KA 2Z5XA 4U8LA 1EL8A 2XVIA 2ACZA 2VQ7A 2FJEA 2VVMA 2YG3A 3CMMA 3SX6A 3UKLA 4D04A 1QJDA 4RSLA 2A89A 4YXDA 5IQ4A 2WBAA 3DK4A 4EM3A 2C76A 1GNDA 1D4CA 3VR8A 2VOUA 4A79A 2VRMA 3NGCX 2X8HA 2BABA 2O9ZA 1DODA 4JNQA 1IUVA 3C4NA 4JQ9A 3HZLA 3BHKA 4RG4A 2BYBA 3AYJA 2GR3A 4B69A 4YKGA 2XLRA 5BRTA 1PJ5A 1GRBA 3CNDA 2XFNA 3BNMA 1ELIA 1S3EA 1Y0PA 4EIPA 4YTNA 1FCDA 2AR8A 4U8MA 2R0PA 1NHPA 3UOXA 2R0GA 3CPIG 1B4VA 3G5QA 1UKVG 4ECHA 1GETA 1GTEA 3NTDA 2Q7VA 2QA1A 1TRBA 1GRHA 3NYFA 3VRAA 5BVAA 3GD4A 3CGEA 2FJAA 2B9WA 2XFPA 3I3LA 3OC4A 1O95A 4GRTA 1N4VA 4ZN0A 4H2NA 1PJ6A 1H6VA 4LU6A 1FL2A 3BI4A 4G74A 4K22A 2C7GA 2CULA 1YQZA 3LOVA 5KOWA 4YSYA 1KNRA 2JBVA 4A6NA 2XLPA 2GAGB 3NNEA 2YWLA 3AEAA 2V3AA 3FG2P 3VRDB 4X9NA 1DOCA 2GR1A 2HQMA 5FS7A 1PS9A 4CY6A 4DGKA 4JY2A 2B76A 3F8PA 1CJCA 3AYIA 2R9ZA 2ZZ0A 3EF6A 4WX1A 1RSGA 4M52A 3CNJA 1D7YA 2EQ7A 5BULA 4G9KA 4O5UA 3ICRA 3ATQA 2YVJA 1LQUA 1CF3A 3V76A 4K8DA 1PXBA 1GPEA 1L9CA 5ER0A 3G5RA 3SZWA 3SGLA 3AE1A 4D03A 4OPTA 3URHA 3KVEA 1H81A 5J60A 4YT0A 2YAUA 5IPYA 3AEEA 3AD9B 2RGHA 3ADAB 5L46A 1NHSA 3Q9TA 4Z44A 3ZDNA 2WHDA 1VRQB 2A87A 3SFEA 1GESA 3AEGA 3DGZA 2WS3A 2H89A 4U8IA 1VG0A 5TR3A 2X50A 3BNUA 1Q1WA 4HA6A 3B3RA 3UOVA 3HYWA 2RGOA 3AE3A 4CBQA 5U1OA 2GR2A 2TMDA 1K0LA 2XFOA 3G5SA 4GDEA 4I58A 5U25A 1S2QA 4Y4NA 4YKFA 4YSZA 5KVIA 2BC0A 1YKJA 3CGCA 1S7MA 1H7WA 2DKIA 3NK1X 2C3DA 1E1NA 3C96A 3GDPA 3NT6A 5IQ1A 1H83A 3COXA 3LB8A 2BXRA 1GTHA 3KD9A 4OPGA 2BK5A 2AAQA 4Z2TA 1GERA 2IVDA 3DK8A 2VVLA 2RGJA 4REKA 2GMJA 4DNAA 3LZXA 4II3A 4A6NB 1ONFA 3DA1A 4EQWA 5FS9A 2XVHA 1NHQA 3Q6JA 4U2SA 2XFUA 3CNTA 3NK2X 4GCMA 1JNRA 3UKFA 1NPXA 1BWCA 4A9WA 3NH3X 2PYXA 4JN9A 3QFBA 1IUXA 3WE0A 1VG9A 3NK0X 5M0ZA 3UKPA 4NZHA 4CNKA 4TM4A 4H2QA 1E6EA 2VRLA 2XLTA 3FMWA 3V3OA 3CTYA 3HYXA 4NTCA 1D4DA 4Y4LA 4XXGA 3LJPA 4BK2A 3CN8A 1GV4A 3PG6A 2WDQA 1PBFA 3ALMA 4I59A 4K7ZA 3GYXA 2YVGA 2B7SA 3CGDA 3CNPA 4EIQA 1XPQA 3P4PA 1TDNA 2GEWA 4NNJA 1Y56A 4USRA 1DOBA 1BGJA 2IVEA 1NG4A 2YVFA 3DJEA 4YWOA 3NRNA 4H4TA 1XDIA 1LVLA 3S61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEA A;  5JCK A;  1LQT A;  3T37 A;  4Z43 A;  5FS6 A;  3SM8 A;  4H4Q A;  1E1M A;  3AEB A;  1GRG A;  4GUV A;  3UKQ A;  4H4S A;  4ICY A;  2I0Z A;  2WOI A;  1O5W A;  5JCM A;  1OJT A;  1OJA A;  2CVJ A;  2DKH A;  2OLO A;  3FIM B;  1SEZ A;  2WPF A;  3NIX A;  4X4J A;  3H8L A;  3UTH A;  2BK3 A;  3NLC A;  5KVH A;  2J3N A;  2Q0L A;  4MJW A;  3D1C A;  1O94 A;  2BAC A;  2GH5 A;  2V6O A;  2WPC A;  1JRX A;  1GRE A;  3ALL A;  1S3B A;  3UP5 A;  2R45 A;  1PBB A;  5HHF A;  1E7P A;  4KPR A;  2UZZ A;  2XYO A;  2YLW A;  1GRT A;  4OPI A;  5J7X A;  4J33 A;  5EOW A;  2XCG A;  4NEV A;  1QLB A;  2YR6 A;  5EB4 A;  4E0V A;  1YY5 A;  1IUW A;  4OVI A;  3R9U A;  2JB1 A;  2XLU A;  2YR4 A;  2XVF A;  3M12 A;  4OPU A;  2C3C A;  3H4K A;  5EBK A;  3OZ2 A;  1JNZ A;  3UCL A;  1N4W A;  1CHU A;  4UP3 A;  1VDC A;  2OAM A;  3AE6 A;  1MOK A;  3O0H A;  1EL7 A;  1FOH A;  1JU2 A;  3F8D A;  1ZMD A;  2YG6 A;  1MXT A;  4AT2 A;  2GVC A;  4LA1 A;  1K4Q A;  5HYM A;  3AEF A;  4YSH A;  3PS9 A;  1JEH A;  5GSN A;  1REO A;  4AP1 A;  1PBC A;  2GR0 A;  2EQ8 A;  4GF7 A;  5FS8 A;  4C3Y A;  3IHM A;  5LV9 A;  5KRQ A;  1L9E A;  2WES A;  1ZK7 A;  1TYP A;  4LII A;  5JCL A;  1CC2 A;  1Y56 B;  3GYJ A;  3QVR A;  3B6D A;  4ZCD A;  4B66 A;  3KU9 A;  4UDP A;  3RP6 A;  1GOS A;  1K0I A;  3GYI A;  4CRT A;  2ZZC A;  1E39 A;  2WET A;  3L1R A;  2VQB A;  5U63 A;  1Q1R A;  4AOS A;  1RYI A;  5FMH A;  2C65 A;  1PXC A;  3IHG A;  3ZYX A;  3LZW A;  4O5Q A;  2V3B A;  2WU2 A;  4NTD A;  4NEW A;  3RP7 A;  2FJD A;  1CC4 A;  2C67 A;  4BJY A;  5KXJ A;  4PAB A;  3BI2 A;  1GRA A;  3RHA A;  5CQF A;  4CCR A;  4GR1 A;  1GT8 A;  1FEB A;  3K7Q X;  3IF9 A;  2GMH A;  3KPF A;  3M13 A;  4A99 A;  1DNC A;  2TPR A;  4WCT A;  3AE2 A;  2C73 A;  2XLS A;  4B63 A;  4Z24 A;  5JCI A;  1LV0 A;  5GRT A;  4H2P A;  4TLZ A;  2V5Z A;  4U8N A;  3GD3 A;  2BA9 A;  3I6D A;  4GDP A;  4U8P A;  2WP6 A;  3E1T A;  3NYC A;  4UDR A;  1EL9 A;  1BKW A;  4EQR A;  2YG7 A;  2YQU A;  4EMJ A;  5HY5 A;  1TDF A;  2C72 A;  2Q6U A;  4USQ A;  1NHR A;  3D8X A;  4AT0 A;  1P2E A;  2EQ6 A;  3GDN A;  4TLX A;  4IA5 A;  3II4 A;  4J31 A;  1EBD A;  3LXD A;  1CC6 A;  1K0J A;  3RP8 A;  4CY8 A;  1PBD A;  1TYT A;  3GRS A;  1PHH A;  2FJB A;  4IA6 A;  2GQF A;  1FEC A;  3DJG X;  4H4P A;  4H4V A;  1Q9I A;  3NN0 X;  4A5L A;  2C75 A;  4Z2R A;  3EPT A;  3GRT A;  2F5Z A;  4TM0 A;  2BS4 A;  4X9M A;  3AE9 A;  4YTM A;  3UTG A;  1XHC A;  3PO7 A;  2JB3 A;  2X8C A;  2YLS A;  5HXI A;  2Z5Y A;  5KOX A;  3IWA A;  1NEK A;  1ZX9 A;  2OA1 A;  4KX6 A;  4H4Y A;  1D5T A;  2VVL G;  4RG3 A;  2B9X A;  3EAO A;  3AEC A;  4ADW A;  3ATR A;  1PN0 A;  1NAA A;  1ZMC A;  4C3X A;  3DJD A;  1W4X A;  1JRZ A;  1PJ7 A;  2RAB A;  1RP0 A;  5KWF A;  1GAL A;  4BK3 A;  3NG7 X;  1GXF A;  1KSU A;  2OAL A;  3AXB A;  1V59 A;  1BGN A;  3BHF A;  2BC1 A;  1ZY8 A;  2GQW A;  3QSS A;  2H88 A;  3ICS A;  2X8G A;  1JOA A;  3VR9 A;  1F8S A;  1JRY A;  3PVC A;  2WDR A;  4YSX A;  4K5S A;  2BCP A;  3F8R A;  3K30 A;  4H7U A;  3UKA A;  1ZOV A;  4J34 A;  1QO8 A;  1KNP A;  2GAH B;  2Y6Q A;  4H4R A;  3P1W A;  1H82 A;  3AWI A;  3ICT A;  3VRB A;  4BJZ A;  5C2T A;  2YLZ A;  1NDA A;  2CFY A;  4EQX A;  2W0H A;  4YTP A;  1VQW A;  2YR5 A;  3NHO X;  4BV6 A;  4XWR A;  2JK6 A;  3QVP A;  1GRF A;  1CBO A;  1CJ4 A;  3QSE A;  1BZL A;  4EMI A;  1D7L A;  2XDO A;  2GV8 A;  2OLN A;  3AED A;  3K7M X;  4TM3 A;  4IVM B;  3DJJ A;  1CL0 A;  2AQJ A;  3QJ4 A;  3LAD A;  3FPZ A;  4H4X A;  1DJQ A;  2YLR A;  4P9S A;  1IJH A;  2BS2 A;  1MO9 A;  4PAA A;  4U8J A;  3FBS A;  3H8I A;  4J2W A;  1GEU A;  4Y4M A;  4AP3 A;  4EM4 A;  1Z6L A;  5JCN A;  1F6M A;  1LPF A;  1COY A;  3DME A;  3UOZ A;  1NEN A;  1KF6 A;  4DSG A;  4Z25 A;  2VZ2 A;  4OPL A;  1M64 A;  1ZOY A;  3KLJ A;  2WPE A;  1X31 B;  4H2R A;  2WP9 A;  4EMW A;  1BF3 A;  1EL5 A;  1E1K A;  2BXS A;  2YLT A;  3S5W A;  1L0V A;  4C77 A;  4DSH A;  2GRT A;  3GMB A;  4Z26 A;  4CNJ A;  2B7R A;  4OCG A;  1B5Q A;  3EAN A;  5DBJ A;  4TM1 A;  3UTE A;  3CPH G;  3P4R A;  3L8K A;  1IUS A;  3DH9 A;  4U8O A;  2YM2 A;  4H4Z A;  2BS3 A;  3SFD A;  1OJC A;  3QSM A;  1DOE A;  2ARD A;  3CGB A;  2YLX A;  1S2Y A;  2YG4 A;  3NTA A;  1IUT A;  1P2H A;  2E4G A;  1LJ1 A;  4N9X A;  2QA2 A;  4JY3 A;  2R4E A;  4FK1 C;  2B9Y A;  2QCU A;  1ZP0 A;  3NKS A;  4Z2U A;  4BUR A;  1L9D A;  4FDC B;  1N1P A;  2GB0 A;  2E1M A;  2E5V A;  3GSI A;  1KSS A;  2JB2 A;  2JKC A;  2XFQ A;  4JNA A;  2ZZB A;  1NG3 A;  3KKJ A;  4H50 A;  3DK9 A;  4H4W A;  3C4A A;  2YG5 A;  2ZBW A;  3ABV A;  4NTE A;  1KDG A;  1HYU A;  2XVE A;  3NYE A;  3UOY A;  1CJ2 A;  1GSN A;  3ITJ A;  3RED A;  3JSK A;  1F8W A;  1H84 A;  1AOG A;  1H86 A;  4C74 A;  3P4S A;  1XAN A;  4AOX A;  2WU5 A;  3AE4 A;  3CIR A;  4A65 A;  4ZCC A;  3AD8 B;  2FBW A;  2X99 A;  1TDO A;  3AYL A;  1N4U A;  3UP4 A;  4OPD A;  2APG A;  2JAE A;  3ALJ A;  4C5O A;  3ISH A;  4JDR A;  2R4J A;  1ZKQ A;  2Y6R A;  2QAE A;  1IUU A;  3UKH A;  4CCQ A;  1PXA A;  3M0O A;  2XVJ A;  3IC9 A;  1DJN A;  4XWZ A;  4APN A;  1M6I A;  3CNS A;  4J57 A;  1LTX R;  2A8X A;  2BCG G;  2EQ9 A;  3DGH A;  4OPC A;  1TDE A;  3BI5 A;  1OJD A;  2CDU A;  2YM1 A;  2BK4 A;  4K5R A;  1F8R A;  3AB1 A;  4FK1 A;  3GWF A;  3AE8 A;  3SQP A;  5CKU A;  1PBE A;  1F3P A;  3UKK A;  4A7A A;  4U2L A;  4K2X A;  2C70 A;  4B68 A;  1B8S A;  4B64 A;  4H4U A;  3V3N A;  1B37 A;  2X3N A;  1OJ9 A;  2IID A;  2C66 A;  4IVO B;  4U2T A;  4FX9 A;  2WOV A;  4B1B A;  2GF3 A;  3P4Q A;  2NPX A;  2WOW A;  3K7T A;  1TDK A;  1ZDL A;  4BK1 A;  2R0C A;  4B67 A;  2WEU A;  4EQS A;  3P9U A;  3AD7 B;  5C3J A;  2WP5 A;  4U8K A;  3AE7 A;  3UTF A;  2WDV A;  5BUK A;  2C64 A;  4J36 A;  4HB9 A;  3AE5 A;  4J56 A;  3CPJ G;  5EB5 A;  1YQ4 A;  2V61 A;  1E1L A;  3QFA A;  3GWD A;  3KA7 A;  5M10 A;  1H7X A;  1YQ3 A;  2PHH A;  1KFY A;  1DXL A;  3NN6 X;  3RNM A;  2WQY A;  4UDQ A;  4B65 A;  1D4E A;  2V60 A;  2NVK X;  1CJ3 A;  2R46 A;  3VQR A;  1PDH A;  3GMC A;  4IV9 A;  2Q0K A;  2Z5X A;  4U8L A;  1EL8 A;  2XVI A;  2ACZ A;  2VQ7 A;  2FJE A;  2VVM A;  2YG3 A;  4D04 A;  5IQ4 A;  3UKL A;  4YXD A;  1QJD A;  4RSL A;  2A89 A;  2WBA A;  3DK4 A;  4EM3 A;  2C76 A;  1GND A;  1D4C A;  3VR8 A;  2VOU A;  4A79 A;  2VRM A;  3NGC X;  2X8H A;  2BAB A;  2O9Z A;  1DOD A;  4JNQ A;  1IUV A;  3C4N A;  4JQ9 A;  3HZL A;  3BHK A;  4RG4 A;  2BYB A;  3AYJ A;  2GR3 A;  4B69 A;  4YKG A;  2XLR A;  5BRT A;  1PJ5 A;  1GRB A;  3CND A;  2XFN A;  3BNM A;  1ELI A;  1S3E A;  1Y0P A;  4EIP A;  4YTN A;  1FCD A;  2AR8 A;  4U8M A;  2R0P A;  1NHP A;  3UOX A;  2R0G A;  3CPI G;  1B4V A;  3G5Q A;  1UKV G;  4ECH A;  1GET A;  1GTE A;  3NTD A;  2Q7V A;  2QA1 A;  1TRB A;  1GRH A;  3NYF A;  3VRA A;  5BVA A;  3GD4 A;  3CGE A;  2FJA A;  2B9W A;  2XFP A;  3I3L A;  3OC4 A;  1O95 A;  4GRT A;  1N4V A;  4ZN0 A;  4H2N A;  1PJ6 A;  1H6V A;  4LU6 A;  1FL2 A;  3BI4 A;  4K22 A;  2C7G A;  2CUL A;  1YQZ A;  3LOV A;  5KOW A;  4YSY A;  1KNR A;  2JBV A;  4A6N A;  2XLP A;  2GAG B;  3NNE A;  2YWL A;  3AEA A;  2V3A A;  3FG2 P;  3VRD B;  4X9N A;  1DOC A;  2GR1 A;  2HQM A;  5FS7 A;  1PS9 A;  4CY6 A;  4DGK A;  4JY2 A;  2B76 A;  3F8P A;  1CJC A;  3AYI A;  2R9Z A;  2ZZ0 A;  3EF6 A;  4WX1 A;  1RSG A;  4M52 A;  3CNJ A;  1D7Y A;  2EQ7 A;  5BUL A;  4O5U A;  3ICR A;  3ATQ A;  2YVJ A;  1LQU A;  1CF3 A;  3V76 A;  4K8D A;  1PXB A;  1GPE A;  1L9C A;  5ER0 A;  3G5R A;  3SGL A;  3AE1 A;  4D03 A;  4OPT A;  3URH A;  3KVE A;  1H81 A;  5J60 A;  4YT0 A;  2YAU A;  5IPY A;  3AEE A;  3AD9 B;  2RGH A;  3ADA B;  5L46 A;  1NHS A;  3Q9T A;  4Z44 A;  3ZDN A;  2WHD A;  1VRQ B;  2A87 A;  3SFE A;  1GES A;  3AEG A;  3DGZ A;  2WS3 A;  2H89 A;  4U8I A;  1VG0 A;  5TR3 A;  2X50 A;  3BNU A;  1Q1W A;  4HA6 A;  3B3R A;  3UOV A;  2RGO A;  3AE3 A;  4CBQ A;  5U1O A;  2GR2 A;  2TMD A;  1K0L A;  2XFO A;  3G5S A;  4GDE A;  4I58 A;  5U25 A;  1S2Q A;  4Y4N A;  4YKF A;  4YSZ A;  5KVI A;  2BC0 A;  1YKJ A;  3CGC A;  1H7W A;  2DKI A;  3NK1 X;  2C3D A;  1E1N A;  3C96 A;  3GDP A;  3NT6 A;  5IQ1 A;  1H83 A;  3COX A;  3LB8 A;  2BXR A;  1GTH A;  3KD9 A;  4OPG A;  2BK5 A;  2AAQ A;  4Z2T A;  1GER A;  2IVD A;  3DK8 A;  2VVL A;  2RGJ A;  4REK A;  2GMJ A;  4DNA A;  3LZX A;  4A6N B;  1ONF A;  3DA1 A;  4EQW A;  5FS9 A;  2XVH A;  1NHQ A;  3Q6J A;  4U2S A;  2XFU A;  3CNT A;  3NK2 X;  4GCM A;  1JNR A;  3UKF A;  1NPX A;  1BWC A;  4A9W A;  3NH3 X;  2PYX A;  4JN9 A;  3QFB A;  1IUX A;  3WE0 A;  1VG9 A;  3NK0 X;  5M0Z A;  3UKP A;  4NZH A;  4CNK A;  4TM4 A;  4H2Q A;  1E6E A;  2VRL A;  2XLT A;  3FMW A;  3V3O A;  3CTY A;  4NTC A;  1D4D A;  4Y4L A;  4XXG A;  3LJP A;  4BK2 A;  3CN8 A;  1GV4 A;  2WDQ A;  3ALM A;  1PBF A;  4I59 A;  4K7Z A;  2YVG A;  2B7S A;  3CGD A;  3CNP A;  4EIQ A;  1XPQ A;  3P4P A;  1TDN A;  2GEW A;  1Y56 A;  4USR A;  1DOB A;  1BGJ A;  2IVE A;  1NG4 A;  2YVF A;  3DJE A;  4YWO A;  3NRN A;  4H4T A;  1XDI A;  1LVL A;  3S61 A; 
#chains in the Genus database with same CATH topology
 5JCK A;  3SM8 A;  3AEB A;  4GUV A;  5JCM A;  3RGT A;  3UTH A;  2PGW A;  3KPK A;  2WPC A;  3ALL A;  1JPD X;  4K2S A;  4J33 A;  5EOW A;  1QLB A;  1SJC A;  5EB4 A;  4E0V A;  3VDG A;  1YY5 A;  1R0M A;  3R9U A;  4F4R A;  2C3C A;  4GME A;  3O0H A;  3F8D A;  1XS2 A;  3HYV A;  4G6H A;  1K4Q A;  5HYM A;  4AP1 A;  1PBC A;  2GR0 A;  2NQL A;  1L9E A;  1ZK7 A;  4LII A;  5JCL A;  1Y56 B;  3B6D A;  3CXB A;  3R1Z A;  4AOS A;  4MKS A;  2C65 A;  2OQY A;  3ZYX A;  4O5Q A;  4NTD A;  5KXJ A;  4NEW A;  4PAB A;  1GT8 A;  3MZN A;  2GSH A;  3KPF A;  3NS1 B;  4B63 A;  5GRT A;  3GD3 A;  2BA9 A;  2WP6 A;  4KEM A;  2OG9 A;  2YQU A;  5HY5 A;  2Q6U A;  4USQ A;  2GGJ A;  1KKR A;  1P2E A;  2EQ6 A;  3SZ0 A;  3LXD A;  4CY8 A;  1TKK A;  2FJB A;  4IA6 A;  1Q9I A;  4Z2R A;  2C75 A;  3UTG A;  5HXI A;  5KOX A;  2Z5Y A;  1NEK A;  3T2K A;  2VVL G;  4RG3 A;  2B9X A;  1V97 A;  2XH2 A;  3SN4 A;  2XH4 A;  2QJM A;  1GAL A;  4G73 A;  1FFV C;  1KSU A;  1V59 A;  4E5T A;  2X8G A;  1JOA A;  3VR9 A;  1F8S A;  4GIS A;  2WDR A;  1E9I A;  3NVZ B;  2BCP A;  3K30 A;  4H7U A;  2PTY A;  1QO8 A;  1KNP A;  2P88 A;  3T4W A;  1H2I A;  4XWR A;  3VCC A;  1CBO A;  4H1Z A;  4EMI A;  2OLN A;  3DJJ A;  3EUB 3;  1MO9 A;  2BRY A;  4AP3 A;  1Z6L A;  1LPF A;  1COY A;  4DSG A;  2O56 A;  1E1K A;  2GRT A;  3GMB A;  4CNJ A;  4OCG A;  1B5Q A;  3UTE A;  1VQZ A;  4H83 A;  4HPN A;  3CPH G;  3P4R A;  1IUS A;  2YM2 A;  3IJQ A;  3SFD A;  3SQS A;  2ARD A;  3CGB A;  3HW2 A;  2PTW A;  3NTA A;  1P2H A;  4N9X A;  1ZP0 A;  4Z2U A;  4BUR A;  1L9D A;  3GSI A;  2JB2 A;  2XFQ A;  4H4W A;  2YG5 A;  2ZBW A;  3ABV A;  3R0K A;  4MGG A;  1KDG A;  3UJE A;  3GO2 A;  2ZC8 A;  3RED A;  3JSK A;  3MY9 A;  1IYX A;  1N4U A;  2APG A;  2JAE A;  1N62 C;  3NVY B;  4ROP A;  1ZKQ A;  2Y6R A;  2QAE A;  1IUU A;  3M0O A;  2XVJ A;  3CNS A;  5KMS A;  3CAW A;  2EQ9 A;  3R10 A;  3DGH A;  1TDE A;  1OJD A;  2CDU A;  2YM1 A;  4K5R A;  1F8R A;  4A7A A;  1F3P A;  3S5S A;  4FP1 A;  2X3N A;  2IID A;  2C66 A;  3UJ2 A;  3A7A A;  4IVO B;  4FX9 A;  2PU1 A;  2WOW A;  1ZDL A;  5KMR A;  3NFU A;  2WEU A;  4B67 A;  2WP5 A;  3V5F A;  3SZF A;  4U8K A;  3UTF A;  1L8P A;  3RO6 A;  5BUK A;  3AE5 A;  3EEZ A;  4G7F A;  1EC7 A;  5EB5 A;  3KA7 A;  3GWD A;  2PHH A;  1KFY A;  1DXL A;  3VC6 A;  3NN6 X;  3RNM A;  2WQY A;  4B65 A;  2V60 A;  4IV9 A;  2XVI A;  2ACZ A;  2FJE A;  2C76 A;  2PPG A;  2XH7 A;  4JQ9 A;  2GR3 A;  4YKG A;  1JRP A;  2XLR A;  3DIP A;  4EIP A;  2R0P A;  3CB3 A;  4HCD A;  1UKV G;  5ENL A;  1GET A;  2Q7V A;  2QA1 A;  1GRH A;  5BVA A;  3CGE A;  2FJA A;  2B9W A;  4ZN0 A;  3RRA A;  4LU6 A;  1FL2 A;  2I5Q A;  2GGI A;  4DYE A;  4E4U A;  2OZ3 A;  3NNE A;  2V3A A;  1CJC A;  2ZZ0 A;  4WX1 A;  1RSG A;  2P0I A;  3CNJ A;  4JN7 A;  1CF3 A;  1GPE A;  1L9C A;  3KVE A;  4YT0 A;  5IPY A;  3AEE A;  2RGH A;  4Z44 A;  4DHG A;  3DGZ A;  1VG0 A;  2PP3 A;  2X50 A;  3THU A;  4HA6 A;  3B3R A;  3UOV A;  3P93 A;  5U1O A;  2GR2 A;  3EKG A;  4Y4N A;  2BC0 A;  2FYM A;  1S7M A;  2OZ8 A;  2BXR A;  2GGG A;  4OPG A;  4Z2T A;  2VVL A;  2GMJ A;  4DNA A;  3ZVH A;  1VDV A;  1NHQ A;  3HPF A;  4GCM A;  3A7U A;  2P3Z A;  2PYX A;  3QFB A;  4NZH A;  1ECQ A;  3ES8 A;  4X2P A;  2XLT A;  3FMW A;  4NTC A;  1PBF A;  4I59 A;  2B7S A;  3A7R A;  1ONE A;  3UJF A;  4NNJ A;  1P43 A;  2OPJ A;  1NG4 A;  3DJE A;  4YWO A;  3NRN A;  1LVL A;  4HYR A;  4ICY A;  2I0Z A;  2WOI A;  1OJA A;  1OJT A;  2OLO A;  1SEZ A;  4G6G A;  3NIX A;  3H8L A;  2Q0L A;  1O94 A;  1S3B A;  1E7P A;  4KPR A;  2UZZ A;  4OPI A;  2DW7 A;  3ZVH B;  1IUW A;  3T14 A;  3T6C A;  1JNZ A;  1N4W A;  1VDC A;  2OAM A;  3AE6 A;  3Q45 A;  1JU2 A;  2QQ6 A;  1EBG A;  2BRA A;  4IP5 A;  4LA1 A;  1MDL A;  1ZXI C;  3OPS A;  2EQ8 A;  1N5X A;  4C3Y A;  3IHM A;  5KNL A;  4IHC A;  3UCD A;  2WES A;  1TYP A;  4J3Z A;  1CC2 A;  3GYJ A;  4ZCD A;  3RP6 A;  1GOS A;  1FIQ B;  2WET A;  3TJI A;  5FMH A;  1PXC A;  2OLA A;  2V3B A;  1CC4 A;  2C67 A;  5CQF A;  4CCR A;  4GR1 A;  1FEB A;  3K7Q X;  4WCT A;  3AE2 A;  1SJA A;  4H2P A;  4U8N A;  3T2Z A;  3E1T A;  4UDR A;  1EL9 A;  3U9I A;  4EQR A;  4HCL A;  2C72 A;  3D8X A;  4IA5 A;  3GC2 A;  3RP8 A;  3OZY A;  3GRS A;  3B97 A;  1FEC A;  4H4P A;  4H4V A;  4A5L A;  4TM0 A;  2BS4 A;  4YTM A;  3AE9 A;  3PO7 A;  2JB3 A;  2X8C A;  3IWA A;  2OA1 A;  4H4Y A;  3ATR A;  1PN0 A;  3D9X A;  4TVW A;  4C3X A;  3GY1 A;  2P8B A;  1JRZ A;  1PJ7 A;  3T2Y A;  1GXF A;  1BGN A;  3BHF A;  2BC1 A;  1ZY8 A;  1JRY A;  4YSX A;  2CHR A;  3UKA A;  2Y6Q A;  3L5O A;  4HN8 A;  2AL1 A;  3I4K A;  5C2T A;  2YLZ A;  4EQX A;  2YR5 A;  3NHO X;  2JK6 A;  3OZM A;  5KMP A;  1CJ4 A;  1D7L A;  1JPM A;  3K7M X;  3LAD A;  4H4X A;  2BS2 A;  4PAA A;  3JW7 A;  4EM4 A;  5JCN A;  4IZG A;  1NEN A;  2DW6 A;  1M64 A;  1STZ A;  4H2R A;  1JCT A;  3DG7 A;  2WP9 A;  3S5W A;  1L0V A;  3EAN A;  3BJS A;  1OJC A;  1DOE A;  2YLX A;  2W3S A;  2E4G A;  2GL5 A;  2QCU A;  2PP0 A;  2GB0 A;  2E1M A;  2OFJ A;  2PCE A;  3V5C A;  3DK9 A;  1SJD A;  3RIT A;  3DDM A;  3ETR B;  2XVE A;  3NYE A;  3UJS A;  4IT1 A;  1F8W A;  1H84 A;  1AOG A;  4C74 A;  4ZCC A;  3AD8 B;  4HNC A;  4OPD A;  3ALJ A;  2R4J A;  2RDX A;  5FJR A;  4CCQ A;  1PXA A;  3IC9 A;  1M6I A;  1LTX R;  2BCG G;  3BI5 A;  1MDR A;  3AE8 A;  3SQP A;  2PTX A;  4K2X A;  4ENL A;  1B8S A;  3V3N A;  1B37 A;  1ELS A;  3ZVI A;  2WOV A;  4KWS A;  3P4Q A;  2OZT A;  3SYI A;  4EQS A;  3AE7 A;  4II2 A;  2QDE A;  3CXO A;  4HB9 A;  4GAV A;  4J56 A;  3CPJ G;  4JN8 A;  3VQR A;  2R46 A;  2Q0K A;  3SN0 A;  4FI4 A;  2VQ7 A;  2VVM A;  4JHM A;  2A89 A;  3DK4 A;  3N4F A;  1T3Q C;  2VOU A;  3GD6 A;  4JNQ A;  1IUV A;  4RG4 A;  3BHK A;  1N61 C;  3AYJ A;  3SN1 A;  5BRT A;  4TVY A;  1GRB A;  3ES7 A;  1KD0 A;  3BNM A;  1Y0P A;  2AR8 A;  3G5Q A;  3ZLG A;  1TRB A;  3NYF A;  3VRA A;  3GD4 A;  1PJ6 A;  4G74 A;  4K22 A;  2C7G A;  2CUL A;  3R25 A;  4A6N A;  2XLP A;  2YWL A;  3B9J B;  3VRD B;  1DOC A;  2HXU A;  2HQM A;  5FS7 A;  4CY6 A;  3NVV B;  4JY2 A;  3I6E A;  2B76 A;  3AYI A;  2R9Z A;  3T8Q A;  2YVJ A;  4EWJ A;  4D03 A;  3URH A;  2OVL A;  3Q9T A;  3ZDN A;  3ZLF A;  1KKO A;  2WHD A;  1GES A;  2QVH A;  2H89 A;  4U8I A;  5TR3 A;  3UJR A;  3DFH A;  3Q4D A;  3NZG A;  2XFO A;  3G5S A;  4I58 A;  1S2Q A;  4YKF A;  1YKJ A;  2DKI A;  3NT6 A;  3C96 A;  3COX A;  3LB8 A;  3V4B A;  4HNL A;  2AAQ A;  1GER A;  3DK8 A;  4A6N B;  2XSX A;  3Q6J A;  2AKZ A;  3CNT A;  1NPX A;  5FJU A;  3WE0 A;  3NK0 X;  5M0Z A;  3UKP A;  4H2Q A;  1E6E A;  3V3O A;  1D4D A;  3CT2 A;  1KCZ A;  4BK2 A;  3S47 A;  3CN8 A;  1GV4 A;  2PGE A;  3CNP A;  4EIQ A;  3CYJ A;  2GEW A;  1MRA A;  1DOB A;  1BGJ A;  2IVE A;  4GGB A;  1LQT A;  3SJN A;  4Z43 A;  3K1G A;  4H4Q A;  2MNR A;  3UKQ A;  2DKH A;  2E5A A;  2BK3 A;  3NLC A;  5KVH A;  2J3N A;  4MJW A;  3D1C A;  2BAC A;  2GH5 A;  1MNS A;  2V6O A;  1JRX A;  5HHF A;  2XYO A;  1GRT A;  4GAP A;  2HNE A;  2XCG A;  2YR6 A;  3AMZ A;  2JB1 A;  2XLU A;  2XVF A;  3M12 A;  4OPU A;  2PMQ A;  2P8C A;  3UCL A;  1CHU A;  3IJL A;  1EL7 A;  4M0X A;  1FOH A;  3TWA A;  1ZMD A;  2GVC A;  3AEF A;  1JEH A;  5GSN A;  5FS8 A;  5LV9 A;  5KRQ A;  4E4F A;  2PP1 A;  4UDP A;  3GYI A;  3LZW A;  2WU2 A;  5KMQ A;  4BJY A;  3BI2 A;  3RHA A;  4K8G A;  4A99 A;  1DNC A;  4ZOH B;  2C73 A;  2XLS A;  5JCI A;  4TLZ A;  3I6D A;  4U8P A;  4GDP A;  1BKW A;  2YG7 A;  4EMJ A;  1TDF A;  1NHR A;  4TLX A;  3GDN A;  1CC6 A;  3DJG X;  3ENL A;  3PWG A;  3EPT A;  3GRT A;  2F5Z A;  4X9M A;  2YLS A;  3IJI A;  1ZX9 A;  1NAA A;  1ZMC A;  3DJD A;  2RAB A;  5KWF A;  3H7V A;  1P48 A;  3AXB A;  2GQW A;  2H88 A;  3DG6 A;  3ICS A;  4K5S A;  1ZOV A;  2QDD A;  4H4R A;  3P1W A;  1PDY A;  1H82 A;  3ICT A;  2CFY A;  4YTP A;  2W0H A;  1VQW A;  3QVP A;  3MQT A;  1GRF A;  2QJJ A;  3UKL A;  1BZL A;  2GV8 A;  4TM3 A;  4IVM B;  3DGB A;  1CL0 A;  3FPZ A;  4P9S A;  1DJQ A;  3VCN A;  3FXG A;  4U8J A;  1R6W A;  3H8I A;  4Y4M A;  1F6M A;  1DTN A;  3DME A;  4Z25 A;  2WPE A;  5EU9 A;  2BXS A;  1BF3 A;  1EL5 A;  2YLT A;  5DBJ A;  4TM1 A;  3L8K A;  3DH9 A;  4H4Z A;  2OKT A;  5G5G B;  3QSM A;  2FKP A;  2YG4 A;  2ZAD A;  3TQP A;  2QA2 A;  3NKS A;  3FV9 A;  3VFC A;  2E5V A;  4JNA A;  1PDZ A;  2ZZB A;  3QTP A;  1NG3 A;  3SY4 A;  4NTE A;  1GSN A;  3ITJ A;  1H86 A;  4J1O A;  3P4S A;  2WU5 A;  1X2H A;  3QN3 A;  3AYL A;  3UP4 A;  3ISH A;  4JDR A;  3FVD A;  3UKH A;  1EC9 A;  4APN A;  3RR1 A;  1FHV A;  3NVW B;  4FK1 A;  3UKK A;  4U2L A;  2C70 A;  3T0K A;  4B68 A;  4B64 A;  3TTE A;  3N6J A;  3V3W A;  3SXI A;  4U2T A;  1MUC A;  2GF3 A;  5J04 A;  2HXT A;  4BK1 A;  1NU5 A;  2OX4 A;  3P9U A;  6ENL A;  4MMW A;  2C64 A;  2V61 A;  1E1L A;  4UDQ A;  3GMC A;  2Z5X A;  1X2G A;  4Z1Y A;  4D04 A;  3CMM A;  1QJD A;  2WBA A;  4Z17 A;  3VR8 A;  3SSZ A;  4A79 A;  3UXK A;  2BAB A;  2O9Z A;  3HZL A;  2BYB A;  4H2H A;  1SJB A;  1PJ5 A;  3CND A;  3FCP A;  2XFN A;  1FHU A;  1ELI A;  2AKM A;  1NHP A;  3UOX A;  2R0G A;  3CPI G;  1B4V A;  1GTE A;  3NTD A;  2XFP A;  1O95 A;  1H6V A;  1YQZ A;  5KOW A;  2JBV A;  2GAG B;  3FG2 P;  2ONE A;  4X9N A;  3DER A;  2GR1 A;  4DGK A;  2XGZ A;  2W55 A;  1D7Y A;  3SR6 B;  5BUL A;  4G9K A;  4O5U A;  3ICR A;  4DXK A;  4K8D A;  1PXB A;  3SZW A;  5ER0 A;  3G5R A;  3SGL A;  3UCC A;  5J60 A;  3JZU A;  2E3T A;  3RCY A;  2YAU A;  3AD9 B;  3ADA B;  7ENL A;  1NHS A;  3TW9 A;  3SFE A;  2HZG A;  3P0W A;  4GYP A;  3NXL A;  3DEQ A;  3BNU A;  1Q1W A;  3HYW A;  4CBQ A;  3AE3 A;  1K0L A;  4ECH A;  2W3R A;  4HCH A;  4YSZ A;  5KVI A;  3CGC A;  3NK1 X;  2C3D A;  5IQ1 A;  3D46 A;  3OP2 A;  2BK5 A;  4REK A;  3LZX A;  4II3 A;  4U2S A;  1BWC A;  4A9W A;  1BQG A;  4JN9 A;  1IUX A;  1VG9 A;  4CNK A;  4TM4 A;  2VRL A;  2PU0 A;  5FJP A;  3CTY A;  3HYX A;  3TCS A;  4Y4L A;  4XXG A;  3QPE A;  3GYX A;  3CGD A;  3PFR A;  1XPQ A;  3P4P A;  3OTR A;  4USR A;  2YVF A;  3QKE A;  1BKH A;  3S61 A;  1FEA A;  3T37 A;  5FS6 A;  1E1M A;  1GRG A;  4H4S A;  1O5W A;  2CVJ A;  3FIM B;  3SBF A;  4E6M A;  1YEY A;  2WPF A;  2C4C A;  4X4J A;  2XH0 A;  3AM9 A;  4K1W A;  1OEP A;  1GRE A;  3UP5 A;  2R45 A;  1PBB A;  5J7X A;  2YLW A;  4NEV A;  1WUE A;  4OVI A;  2YR4 A;  3H4K A;  5EBK A;  3OZ2 A;  4UP3 A;  2PTZ A;  1MOK A;  1WUF A;  2YG6 A;  3IK4 A;  4KT2 A;  2OQH A;  1MXT A;  4AT2 A;  5IDZ A;  4YSH A;  3PS9 A;  1REO A;  4GF7 A;  4DX3 A;  3QVR A;  1W6T A;  4B66 A;  3KU9 A;  1K0I A;  4CRT A;  2ZZC A;  1E39 A;  3L1R A;  2VQB A;  5U63 A;  1Q1R A;  1RYI A;  3IHG A;  3RP7 A;  2FJD A;  1GRA A;  3IF9 A;  2GMH A;  4DWD A;  3M13 A;  2TPR A;  4Z24 A;  1LV0 A;  2V5Z A;  3NYC A;  1TE6 A;  4AT0 A;  3T9P A;  3II4 A;  4J31 A;  1EBD A;  3VC5 A;  1K0J A;  1PBD A;  1TYT A;  1PHH A;  2AL2 A;  2GQF A;  2PA6 A;  3NN0 X;  1XHC A;  4KX6 A;  1D5T A;  3EAO A;  3AEC A;  4ADW A;  4H19 A;  1W4X A;  3R0U A;  1RP0 A;  4IP4 A;  3R07 C;  3HRD C;  4BK3 A;  3NG7 X;  2OAL A;  4ZCW A;  3QSS A;  3NO1 A;  3OW1 A;  4NWZ A;  2POD A;  3PVC A;  4GIR A;  3F8R A;  4J34 A;  4GGH A;  2QGY A;  2GAH B;  3AWI A;  3VRB A;  4BJZ A;  1NDA A;  4BV6 A;  2GDQ A;  3QSE A;  2GGH A;  2XDO A;  3AED A;  2AL2 B;  2AQJ A;  3QJ4 A;  1EBH A;  2YLR A;  3MSY A;  1IJH A;  3FBS A;  4J2W A;  4ZA0 A;  1GEU A;  1RVK A;  1JRO A;  3UOZ A;  1KF6 A;  2VZ2 A;  4OPL A;  1ZOY A;  3KLJ A;  3DG3 A;  1X31 B;  1JDF A;  4EMW A;  4C77 A;  4DSH A;  1FFU C;  1SB3 B;  3UGV A;  4Z26 A;  3DES A;  2B7R A;  4DN1 A;  3I6T A;  4U8O A;  4G8T A;  4A6G A;  2BS3 A;  3N6H A;  3PWI A;  3BOX A;  1S2Y A;  1IUT A;  1LJ1 A;  5BOF A;  4JY3 A;  2R4E A;  4FK1 C;  2B9Y A;  4FDC B;  1N1P A;  3TOY A;  3FYY A;  1KSS A;  2JKC A;  1F9C A;  4KPL A;  3KKJ A;  4H50 A;  3C4A A;  3H12 A;  1KN0 A;  1HYU A;  3U4F A;  3UOY A;  1CJ2 A;  1N60 C;  1XAN A;  4AOX A;  3AE4 A;  3CIR A;  4A65 A;  2FBW A;  2X99 A;  1TDO A;  4C5O A;  3NRZ B;  5JRB A;  1N63 C;  1DJN A;  4XWZ A;  4J57 A;  2A8X A;  4OPC A;  4M6U A;  2BK4 A;  3AB1 A;  3GWF A;  5CKU A;  1PBE A;  2W54 A;  3STP A;  3R11 A;  4H4U A;  5FJO A;  1OJ9 A;  3ZLH A;  1N5W C;  4B1B A;  2NPX A;  3K7T A;  1TDK A;  3SZC A;  2R0C A;  3AD7 B;  3T31 A;  5C3J A;  3TJ4 A;  3BSM A;  2WDV A;  4GFI A;  4J36 A;  1YQ4 A;  3QFA A;  5M10 A;  1H7X A;  1YQ3 A;  3H70 A;  3DFY A;  1D4E A;  2NVK X;  1CJ3 A;  1PDH A;  4U8L A;  1EL8 A;  2YG3 A;  3KUM A;  3SX6 A;  5IQ4 A;  4YXD A;  4RSL A;  4EM3 A;  1GND A;  1D4C A;  1TZZ A;  5BOE A;  3MKC A;  2VRM A;  3NGC X;  2X8H A;  3CK5 A;  3VA8 A;  1DOD A;  3UXL A;  3C4N A;  4B69 A;  5FJT A;  5G5H B;  3JVA A;  3N4E A;  1S3E A;  1FO4 A;  4YTN A;  1FCD A;  4U8M A;  3FJ4 A;  3AN1 A;  1WYG A;  2PS2 A;  1EC8 A;  4IL0 A;  3I3L A;  3OC4 A;  3MWC A;  4GRT A;  1N4V A;  2POZ A;  4H2N A;  4GYP C;  3BI4 A;  3LOV A;  3D47 A;  4YSY A;  1KNR A;  4E8G A;  3AEA A;  4YWS A;  2OO6 A;  1PS9 A;  2MUC A;  3F8P A;  3EF6 A;  2GGE A;  4M52 A;  3PK7 A;  2EQ7 A;  3ATQ A;  1NEL A;  1LQU A;  3V76 A;  4IL2 A;  3AE1 A;  1XPY A;  3H8A A;  4OPT A;  1H81 A;  5L46 A;  1VRQ B;  2A87 A;  3AEG A;  2WS3 A;  3MUC A;  2RGO A;  3QLD A;  2TMD A;  4GDE A;  5U25 A;  1H7W A;  3P3B A;  1E1N A;  3GDP A;  1H83 A;  1GTH A;  3KD9 A;  1RM6 B;  2IVD A;  2PSN A;  2RGJ A;  2QJN A;  1ONF A;  3DA1 A;  4EQW A;  5FS9 A;  2XVH A;  2XFU A;  3NK2 X;  1JNR A;  3UKF A;  4A35 A;  4A3R A;  3NH3 X;  3TWB A;  3LJP A;  3PG6 A;  2WDQ A;  3ALM A;  4K7Z A;  2YVG A;  1TDN A;  1Y56 A;  4H4T A;  1XDI A; 
#chains in the Genus database with same CATH homology
 1FEA A;  5JCK A;  1LQT A;  3T37 A;  4Z43 A;  5FS6 A;  3SM8 A;  4H4Q A;  1E1M A;  3AEB A;  1GRG A;  4GUV A;  3UKQ A;  4H4S A;  4ICY A;  2I0Z A;  2WOI A;  1O5W A;  5JCM A;  1OJT A;  1OJA A;  2CVJ A;  2DKH A;  2OLO A;  3FIM B;  1SEZ A;  2WPF A;  4G6G A;  3NIX A;  2C4C A;  3H8L A;  4X4J A;  2BK3 A;  3NLC A;  3UTH A;  5KVH A;  2J3N A;  2Q0L A;  4MJW A;  3KPK A;  3D1C A;  1O94 A;  2BAC A;  2GH5 A;  2V6O A;  2WPC A;  1JRX A;  1GRE A;  3ALL A;  1S3B A;  3UP5 A;  2R45 A;  1PBB A;  5HHF A;  1E7P A;  4KPR A;  2UZZ A;  2XYO A;  2YLW A;  1GRT A;  4GAP A;  4OPI A;  5J7X A;  4J33 A;  5EOW A;  2XCG A;  4NEV A;  1QLB A;  2YR6 A;  5EB4 A;  4E0V A;  1YY5 A;  1IUW A;  3T14 A;  4OVI A;  3R9U A;  2JB1 A;  2XLU A;  2YR4 A;  2XVF A;  3M12 A;  4OPU A;  2C3C A;  3H4K A;  5EBK A;  3OZ2 A;  1JNZ A;  3UCL A;  1N4W A;  1CHU A;  4UP3 A;  1VDC A;  2OAM A;  3AE6 A;  1MOK A;  3O0H A;  1EL7 A;  1FOH A;  1JU2 A;  3F8D A;  3HYV A;  4G6H A;  1ZMD A;  2YG6 A;  2BRA A;  1MXT A;  4AT2 A;  2GVC A;  4LA1 A;  1K4Q A;  5HYM A;  3AEF A;  4YSH A;  3PS9 A;  1JEH A;  5GSN A;  1REO A;  4AP1 A;  1PBC A;  2GR0 A;  2EQ8 A;  4GF7 A;  5FS8 A;  4C3Y A;  3IHM A;  5KNL A;  5LV9 A;  5KRQ A;  1L9E A;  2WES A;  1ZK7 A;  1TYP A;  4LII A;  5JCL A;  1CC2 A;  1Y56 B;  3GYJ A;  3QVR A;  3B6D A;  4ZCD A;  4B66 A;  3KU9 A;  4UDP A;  3RP6 A;  1K0I A;  1GOS A;  3GYI A;  4CRT A;  2ZZC A;  1E39 A;  2WET A;  3L1R A;  2VQB A;  5U63 A;  1Q1R A;  4AOS A;  1RYI A;  5FMH A;  2C65 A;  1PXC A;  3IHG A;  3ZYX A;  3LZW A;  4O5Q A;  2V3B A;  2WU2 A;  4NTD A;  4NEW A;  3RP7 A;  2FJD A;  1CC4 A;  2C67 A;  5KMQ A;  4BJY A;  4PAB A;  3BI2 A;  1GRA A;  3RHA A;  5CQF A;  4CCR A;  4GR1 A;  1GT8 A;  1FEB A;  3K7Q X;  3IF9 A;  2GMH A;  3KPF A;  3M13 A;  4A99 A;  1DNC A;  2TPR A;  4WCT A;  3AE2 A;  2C73 A;  2XLS A;  4B63 A;  4Z24 A;  5JCI A;  1LV0 A;  5GRT A;  4H2P A;  4TLZ A;  2V5Z A;  4U8N A;  3T2Z A;  3GD3 A;  2BA9 A;  3I6D A;  4GDP A;  4U8P A;  2WP6 A;  3E1T A;  3NYC A;  4UDR A;  1EL9 A;  1BKW A;  4EQR A;  2YG7 A;  2YQU A;  4EMJ A;  5HY5 A;  1TDF A;  2C72 A;  2Q6U A;  4USQ A;  1NHR A;  3D8X A;  4AT0 A;  1P2E A;  2EQ6 A;  3GDN A;  4TLX A;  4IA5 A;  3II4 A;  3SZ0 A;  4J31 A;  1EBD A;  3LXD A;  1CC6 A;  1K0J A;  3RP8 A;  4CY8 A;  1PBD A;  1TYT A;  3GRS A;  1PHH A;  2FJB A;  4IA6 A;  2GQF A;  1FEC A;  3DJG X;  4H4P A;  4H4V A;  1Q9I A;  3NN0 X;  4A5L A;  2C75 A;  4Z2R A;  3EPT A;  3GRT A;  2F5Z A;  4TM0 A;  2BS4 A;  4X9M A;  3AE9 A;  4YTM A;  3UTG A;  1XHC A;  3PO7 A;  2JB3 A;  2X8C A;  2YLS A;  5HXI A;  2Z5Y A;  5KOX A;  3IWA A;  1NEK A;  1ZX9 A;  2OA1 A;  3T2K A;  4KX6 A;  4H4Y A;  1D5T A;  2VVL G;  4RG3 A;  2B9X A;  3EAO A;  3AEC A;  4ADW A;  3ATR A;  1PN0 A;  3D9X A;  1NAA A;  1ZMC A;  4C3X A;  3DJD A;  1W4X A;  1JRZ A;  1PJ7 A;  2RAB A;  1RP0 A;  5KWF A;  1GAL A;  4G73 A;  4BK3 A;  3T2Y A;  3NG7 X;  1GXF A;  1KSU A;  2OAL A;  3AXB A;  1V59 A;  1BGN A;  3BHF A;  2BC1 A;  1ZY8 A;  2GQW A;  3QSS A;  2H88 A;  3ICS A;  2X8G A;  1JOA A;  4NWZ A;  3VR9 A;  1F8S A;  1JRY A;  3PVC A;  2WDR A;  4YSX A;  4K5S A;  2BCP A;  3F8R A;  3K30 A;  4H7U A;  3UKA A;  1ZOV A;  4J34 A;  1QO8 A;  1KNP A;  2GAH B;  2Y6Q A;  3L5O A;  4H4R A;  3P1W A;  1H82 A;  3AWI A;  3ICT A;  3VRB A;  4BJZ A;  5C2T A;  1H2I A;  2YLZ A;  1NDA A;  2CFY A;  4EQX A;  2W0H A;  4YTP A;  1VQW A;  2YR5 A;  3NHO X;  4BV6 A;  4XWR A;  2JK6 A;  3QVP A;  5KMP A;  1GRF A;  1CBO A;  1CJ4 A;  3QSE A;  1BZL A;  4EMI A;  1D7L A;  2XDO A;  2GV8 A;  2OLN A;  3AED A;  3K7M X;  4TM3 A;  4IVM B;  3DJJ A;  1CL0 A;  2AQJ A;  3QJ4 A;  3LAD A;  3FPZ A;  4H4X A;  1DJQ A;  2YLR A;  4P9S A;  1IJH A;  2BS2 A;  1MO9 A;  4PAA A;  4U8J A;  3FBS A;  3H8I A;  2BRY A;  4J2W A;  1GEU A;  4Y4M A;  4AP3 A;  4EM4 A;  1Z6L A;  5JCN A;  1F6M A;  1LPF A;  1COY A;  3DME A;  3UOZ A;  1NEN A;  1KF6 A;  4DSG A;  4Z25 A;  2VZ2 A;  4OPL A;  1M64 A;  1ZOY A;  3KLJ A;  2WPE A;  1X31 B;  4H2R A;  2WP9 A;  4EMW A;  1BF3 A;  1EL5 A;  1E1K A;  2BXS A;  2YLT A;  3S5W A;  1L0V A;  4C77 A;  4DSH A;  2GRT A;  3GMB A;  4Z26 A;  4CNJ A;  2B7R A;  4OCG A;  1B5Q A;  3EAN A;  5DBJ A;  4TM1 A;  3UTE A;  3CPH G;  3P4R A;  3L8K A;  1IUS A;  3DH9 A;  4U8O A;  2YM2 A;  4H4Z A;  2BS3 A;  3SFD A;  1OJC A;  3QSM A;  1DOE A;  2ARD A;  3CGB A;  2YLX A;  1S2Y A;  2YG4 A;  3NTA A;  1IUT A;  1P2H A;  2E4G A;  1LJ1 A;  4N9X A;  2QA2 A;  4JY3 A;  2R4E A;  4FK1 C;  2B9Y A;  2QCU A;  1ZP0 A;  3NKS A;  4Z2U A;  4BUR A;  1L9D A;  4FDC B;  1N1P A;  2GB0 A;  2E1M A;  2E5V A;  3GSI A;  1KSS A;  2JB2 A;  2JKC A;  2XFQ A;  4JNA A;  2ZZB A;  1NG3 A;  3KKJ A;  3SY4 A;  4H50 A;  3DK9 A;  4H4W A;  3C4A A;  2YG5 A;  1KN0 A;  2ZBW A;  3ABV A;  4NTE A;  1KDG A;  1HYU A;  2XVE A;  3NYE A;  3UOY A;  1CJ2 A;  1GSN A;  3ITJ A;  3RED A;  3JSK A;  1F8W A;  1H84 A;  1AOG A;  1H86 A;  4C74 A;  3P4S A;  1XAN A;  4AOX A;  2WU5 A;  3AE4 A;  3CIR A;  4A65 A;  4ZCC A;  3AD8 B;  2FBW A;  2X99 A;  1TDO A;  3AYL A;  1N4U A;  3UP4 A;  4OPD A;  2APG A;  2JAE A;  3ALJ A;  4C5O A;  3ISH A;  5JRB A;  4JDR A;  2R4J A;  1ZKQ A;  2Y6R A;  2QAE A;  1IUU A;  3UKH A;  4CCQ A;  1PXA A;  3M0O A;  2XVJ A;  3IC9 A;  1DJN A;  4XWZ A;  4APN A;  1M6I A;  3CNS A;  5KMS A;  4J57 A;  1LTX R;  2A8X A;  2BCG G;  2EQ9 A;  3DGH A;  4OPC A;  1TDE A;  3BI5 A;  1OJD A;  2CDU A;  2YM1 A;  2BK4 A;  4K5R A;  1F8R A;  3AB1 A;  4FK1 A;  3GWF A;  3AE8 A;  3SQP A;  5CKU A;  1PBE A;  1F3P A;  3UKK A;  4A7A A;  4U2L A;  4K2X A;  2C70 A;  3T0K A;  4B68 A;  1B8S A;  4B64 A;  4H4U A;  3V3N A;  1B37 A;  2X3N A;  1OJ9 A;  2IID A;  2C66 A;  4IVO B;  4U2T A;  3SXI A;  4FX9 A;  2WOV A;  4B1B A;  2GF3 A;  3P4Q A;  2NPX A;  2WOW A;  3K7T A;  1TDK A;  1ZDL A;  4BK1 A;  3SZC A;  2R0C A;  5KMR A;  3SYI A;  4B67 A;  2WEU A;  4EQS A;  3P9U A;  3AD7 B;  3T31 A;  5C3J A;  2WP5 A;  3SZF A;  4U8K A;  3AE7 A;  3UTF A;  2WDV A;  5BUK A;  4II2 A;  2C64 A;  4J36 A;  4HB9 A;  3AE5 A;  4J56 A;  4GAV A;  3CPJ G;  5EB5 A;  1YQ4 A;  2V61 A;  1E1L A;  3QFA A;  3GWD A;  3KA7 A;  5M10 A;  1H7X A;  1YQ3 A;  2PHH A;  1KFY A;  1DXL A;  3NN6 X;  3RNM A;  5KXJ A;  2WQY A;  4UDQ A;  4B65 A;  1D4E A;  2V60 A;  2NVK X;  1CJ3 A;  2R46 A;  3VQR A;  1PDH A;  3GMC A;  4IV9 A;  2Q0K A;  2Z5X A;  4U8L A;  1EL8 A;  2XVI A;  2ACZ A;  2VQ7 A;  2FJE A;  2VVM A;  2YG3 A;  3CMM A;  3SX6 A;  3UKL A;  4D04 A;  1QJD A;  4RSL A;  2A89 A;  4YXD A;  5IQ4 A;  2WBA A;  3DK4 A;  4EM3 A;  2C76 A;  1GND A;  1D4C A;  3VR8 A;  2VOU A;  4A79 A;  2VRM A;  3NGC X;  2X8H A;  2BAB A;  2O9Z A;  1DOD A;  4JNQ A;  1IUV A;  3C4N A;  4JQ9 A;  3HZL A;  3BHK A;  4RG4 A;  2BYB A;  3AYJ A;  2GR3 A;  4B69 A;  4YKG A;  2XLR A;  5BRT A;  1PJ5 A;  1GRB A;  3CND A;  2XFN A;  3BNM A;  1ELI A;  1S3E A;  1Y0P A;  4EIP A;  4YTN A;  1FCD A;  2AR8 A;  4U8M A;  2R0P A;  1NHP A;  3UOX A;  2R0G A;  3CPI G;  1B4V A;  3G5Q A;  1UKV G;  4ECH A;  1GET A;  1GTE A;  3NTD A;  2Q7V A;  2QA1 A;  1TRB A;  1GRH A;  3NYF A;  3VRA A;  5BVA A;  3GD4 A;  3CGE A;  2FJA A;  2B9W A;  2XFP A;  3I3L A;  3OC4 A;  1O95 A;  4GRT A;  1N4V A;  4ZN0 A;  4H2N A;  1PJ6 A;  1H6V A;  4LU6 A;  1FL2 A;  3BI4 A;  4G74 A;  4K22 A;  2C7G A;  2CUL A;  1YQZ A;  3LOV A;  5KOW A;  4YSY A;  1KNR A;  2JBV A;  4A6N A;  2XLP A;  2GAG B;  3NNE A;  2YWL A;  3AEA A;  2V3A A;  3FG2 P;  3VRD B;  4X9N A;  1DOC A;  2GR1 A;  2HQM A;  5FS7 A;  1PS9 A;  4CY6 A;  4DGK A;  4JY2 A;  2B76 A;  3F8P A;  1CJC A;  3AYI A;  2R9Z A;  2ZZ0 A;  3EF6 A;  4WX1 A;  1RSG A;  4M52 A;  3CNJ A;  1D7Y A;  2EQ7 A;  5BUL A;  4G9K A;  4O5U A;  3ICR A;  3ATQ A;  2YVJ A;  1LQU A;  1CF3 A;  3V76 A;  4K8D A;  1PXB A;  1GPE A;  1L9C A;  5ER0 A;  3G5R A;  3SZW A;  3SGL A;  3AE1 A;  4D03 A;  4OPT A;  3URH A;  3KVE A;  1H81 A;  5J60 A;  4YT0 A;  2YAU A;  5IPY A;  3AEE A;  3AD9 B;  2RGH A;  3ADA B;  5L46 A;  1NHS A;  3Q9T A;  4Z44 A;  3ZDN A;  2WHD A;  1VRQ B;  2A87 A;  3SFE A;  1GES A;  3AEG A;  3DGZ A;  2WS3 A;  2H89 A;  4U8I A;  1VG0 A;  5TR3 A;  2X50 A;  3BNU A;  1Q1W A;  4HA6 A;  3B3R A;  3UOV A;  3HYW A;  2RGO A;  3AE3 A;  4CBQ A;  5U1O A;  2GR2 A;  2TMD A;  1K0L A;  2XFO A;  3G5S A;  4GDE A;  4I58 A;  5U25 A;  1S2Q A;  4Y4N A;  4YKF A;  4YSZ A;  5KVI A;  2BC0 A;  1YKJ A;  3CGC A;  1S7M A;  1H7W A;  2DKI A;  3NK1 X;  2C3D A;  1E1N A;  3C96 A;  3GDP A;  3NT6 A;  5IQ1 A;  1H83 A;  3COX A;  3LB8 A;  2BXR A;  1GTH A;  3KD9 A;  4OPG A;  2BK5 A;  2AAQ A;  4Z2T A;  1GER A;  2IVD A;  3DK8 A;  2VVL A;  2RGJ A;  4REK A;  2GMJ A;  4DNA A;  3LZX A;  4II3 A;  4A6N B;  1ONF A;  3DA1 A;  4EQW A;  5FS9 A;  2XVH A;  1NHQ A;  3Q6J A;  4U2S A;  2XFU A;  3CNT A;  3NK2 X;  4GCM A;  1JNR A;  3UKF A;  1NPX A;  1BWC A;  4A9W A;  3NH3 X;  2PYX A;  4JN9 A;  3QFB A;  1IUX A;  3WE0 A;  1VG9 A;  3NK0 X;  5M0Z A;  3UKP A;  4NZH A;  4CNK A;  4TM4 A;  4H2Q A;  1E6E A;  2VRL A;  2XLT A;  3FMW A;  3V3O A;  3CTY A;  3HYX A;  4NTC A;  1D4D A;  4Y4L A;  4XXG A;  3LJP A;  4BK2 A;  3CN8 A;  1GV4 A;  3PG6 A;  2WDQ A;  1PBF A;  3ALM A;  4I59 A;  4K7Z A;  3GYX A;  2YVG A;  2B7S A;  3CGD A;  3CNP A;  4EIQ A;  1XPQ A;  3P4P A;  1TDN A;  2GEW A;  4NNJ A;  1Y56 A;  4USR A;  1DOB A;  1BGJ A;  2IVE A;  1NG4 A;  2YVF A;  3DJE A;  4YWO A;  3NRN A;  4H4T A;  1XDI A;  1LVL A;  3S61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...