1BQGA

The structure of the d-glucarate dehydratase protein from pseudomonas putida
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
411
structure length
399
Chain Sequence
b'GAPVITDLKVVPVAGHDSMLLNLSGAHGPLFTRNILILTDSSGHVGVGEVPGGEGIRKTLEDARHLLINQSIGNYQSLLNKVRNAFADLRIAVHAVTAVESALLDLLGQHLQVPVAALLGEGQQRDAVEMLGYLFYVGDRNKTDLGYRSEHEADNEWFRLRNKEALTPESVVALAEAAYDRYGFKDFKLKGGVLRGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTKEPLQIKGGLVEVPKKPGLGVELDWDALMKAHEVYKSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-GLUCARATE DEHYDRATASE
molecule tags Glucarate
source organism Pseudomonas putida
publication title Evolution of enzymatic activities in the enolase superfamily: crystal structure of (D)-glucarate dehydratase from Pseudomonas putida.
pubmed doi rcsb
total genus 129
structure length 399
sequence length 411
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 1998-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bqgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bqgA01
2GGIA 5IDZA 3UCCA 3NXLA 3RGTA 3NFUA 3IJIA 4KEMA 4DHGA 2OFJA 3PWIA 3CT2A 3CXOA 2PMQA 2FKPA 3S5SA 1P43A 3ENLA 3UJSA 2PU0A 3DESA 4GIRA 4K8GA 2PS2A 4X2PA 1TKKA 2O56A 2NQLA 2OVLA 3T8QA 1SJCA 3TWAA 3SQSA 1FHUA 2OPJA 3MWCA 3D47A 3NZGA 3R25A 3UXLA 2OKTA 2FYMA 3IJLA 1JPDX 3UJRA 4GGBA 3MKCA 2ZC8A 3EEZA 2MUCA 1YEYA 3UJEA 4F4RA 3MUCA 1MDRA 1R0MA 4ZA0A 5J04A 3UXKA 4HCLA 4JN8A 3DG6A 3N6JA 1BKHA 2PTYA 3Q4DA 3K1GA 1EBGA 2P3ZA 2PTWA 3OZMA 4HCHA 4HCDA 3RCYA 3H7VA 3HPFA 3QTPA 3UGVA 1PDYA 3VCNA 1EC7A 3QLDA 1KCZA 3DG3A 3DFYA 3GC2A 2GL5A 4HN8A 1XPYA 2QGYA 3GD6A 2GGJA 1ONEA 3SJNA 3R10A 4HPNA 1R6WA 4H2HA 1NU5A 1MNSA 1SJAA 3JW7A 2OO6A 3OZYA 3H8AA 3BOXA 3GO2A 3RR1A 3H12A 3TW9A 1FHVA 1BQGA 1NELA 3P0WA 2QJJA 2QJMA 3OTRA 4M6UA 3R0KA 3DG7A 4HYRA 5BOFA 3RO6A 2PU1A 2ZADA 4KT2A 1KKOA 3DGBA 3SN4A 4ENLA 3CYJA 4K2SA 3FYYA 3ZLHA 3VCCA 3T6CA 4MGGA 1KKRA 3UCDA 3FV9A 2XSXA 4JHMA 3V5CA 4E5TA 3R0UA 4IP4A 2AL1A 4ROPA 1L8PA 4IL0A 4KWSA 1XS2A 1KD0A 4GYPA 4Z17A 4FI4A 2XH4A 3NO1A 3OW1A 4IP5A 4J3ZA 1IYXA 3JVAA 2I5QA 3DERA 3OP2A 3ZLFA 2GSHA 3STPA 3QPEA 5BOEA 4DYEA 3R11A 2AKMA 2GGHA 1TZZA 2XH2A 2XH0A 2GDQA 2OZ8A 3MQTA 3RITA 4DN1A 5FJRA 2PP1A 3MSYA 3TCSA 3VC6A 3SN0A 1F9CA 2OZTA 3UJFA 2AL2B 3TJIA 4GYPC 4E6MA 2OZ3A 4DX3A 3FXGA 2CHRA 5FJUA 1RVKA 1MDLA 4MMWA 1WUEA 2PTXA 3PWGA 3FJ4A 4GMEA 4E4FA 1EC9A 4M0XA 3EKGA 4YWSA 2PP3A 2QJNA 3BSMA 3UJ2A 3V3WA 3U9IA 4A6GA 2PPGA 3P93A 3I6EA 1MUCA 2PTZA 3V5FA 4H83A 1PDZA 2QQ6A 3DFHA 5FJOA 4J1OA 1TE6A 4Z1YA 5EU9A 1P48A 4MKSA 3TTEA 3TQPA 2P8BA 4H1ZA 2P88A 2P8CA 3CAWA 1SJBA 3VC5A 3THUA 4K1WA 1OEPA 3N4EA 3N6HA 3SBFA 1ELSA 3MZNA 4GISA 2DW6A 2HXTA 2PODA 3DEQA 4DXKA 4GGHA 1WUFA 2AL2A 4KPLA 3SN1A 3U4FA 4ZCWA 4GFIA 4E8GA 2HZGA 4G7FA 2PP0A 3VA8A 2QDDA 2GGGA 3B97A 3ZVHB 3IJQA 3DIPA 3V4BA 1E9IA 1EC8A 3DDMA 2PSNA 5ENLA 3S47A 3BJSA 2GGEA 2RDXA 3ES7A 2OG9A 2OQHA 2DW7A 4JN7A 3QN3A 4IHCA 2PA6A 3D46A 3ES8A 4H19A 4IT1A 2MNRA 2XGZA 6ENLA 3TWBA 3GY1A 1DTNA 3I6TA 3IK4A 3FCPA 2OX4A 3TOYA 1SJDA 4IL2A 3Q45A 5FJTA 3JZUA 3PFRA 2QVHA 2OQYA 4E4UA 3RRAA 2HNEA 2PCEA 3MY9A 4A3RA 4A35A 3FVDA 3N4FA 2QDEA 7ENLA 3VFCA 1W6TA 4HNLA 4IZGA 4HNCA 1JPMA 3T4WA 3TJ4A 3ZVIA 3QKEA 2P0IA 2HXUA 5FJPA 2XH7A 2POZA 1ECQA 2OLAA 2ONEA 4FP1A 3KUMA 3R1ZA 3T9PA 4DWDA 3SSZA 3ZVHA 3VDGA 4EWJA 4G8TA 1JCTA 3H70A 3ZLGA 1EBHA 3P3BA 1MRAA 3OPSA 2AKZA 3I4KA 3CK5A 1JDFA 3CB3A 3PK7A 2PGEA 2PGWA
chains in the Genus database with same CATH superfamily
3IIVA 4HA3A 2H9AA 5IDZA 1TTQA 3KRUA 3UCCA 1HKVA 4QE1A 2YJQA 4Q33A 1XBXA 3G1FA 3NQ6A 3CH9A 1B3XA 2A4AA 4HTYA 2VKZG 4WJEA 3CHEA 2OEJA 3WQWA 3WQFA 4NZJA 1N60C 4H9YA 3VOFA 1KM4A 3AMZA 2NQLA 1CTNA 1Q6DA 1W3IA 3IK2A 2YKKA 4EP8C 4MYAA 5GJMA 5C9RA 3W7QA 1G1YA 4B15A 2WYSA 3COTA 4XSLA 1UPMB 4ZQRA 4ACYA 2BOEX 4DBWA 4F4RA 1L2QA 4XZBA 3HGSA 4HT3A 2NX3A 1KV5A 3T0BA 1BKHA 1WDWA 4XWUA 1WZAA 1UOZA 4IP7A 2PDBA 2VX4A 1XH2A 1TWIA 3GC4A 3M0IA 1VKFA 3CL6A 1ZBKA 2W9MA 2J8FA 2YXXA 3TX9A 3S9ZA 4H2CA 2E3ZA 1SZFA 3PZMA 2IKJA 4JQ9A 1HJSA 1A3WA 3KL0A 3RXZA 4YJ5A 1GTHA 4XO7A 3TAKA 1XG4A 4AEEA 3IARA 2QPXA 4AD0A 2WKGA 3TN6A 1BQGA 1H61A 4QX4A 2GJPA 1BZLA 2GSEA 1KQZA 3HU7A 4U3CA 4GIYA 3PPHA 5I23A 2ZZ3A 4JBRA 3EB2A 5XIAA 4Z0JA 2CZFA 3W6YA 4NX5A 4JQ2A 2Y7EA 1KGXA 1VR6A 4AQLA 4NU7A 1MW3A 1US2A 1WX0A 3H7UA 3GDLA 3O6CA 1UKSA 3LUTA 1TZ9A 3LHUA 1WDPA 2V3FA 1KRAC 2ZXAA 1SW0A 3TMLA 1OC5A 3ARXA 4QISA 2W0UA 1SW7A 4PN2A 2J47A 1GONA 5A2CA 5AHFA 3ZYZA 1OABA 1UD6A 1NFGA 4AF0B 4GINA 3CGEA 2GUBA 2W6RA 1F2JA 2CESA 6REQB 3C2FA 4GC4A 1ZQ5A 1ME9A 2XVKA 2IPGA 4YWOA 1PO9A 3B8VA 3NO1A 3OW1A 3RO8A 5EFDA 4F0LA 2BLEA 2ZC1A 4CQ8A 2C71A 2J9ZA 3MHFA 2ZZ4A 3EXTA 4AHQA 1QJWA 3R11A 3BGGA 1LG2A 1Z44A 1NARA 2KX9A 4GO9A 5AZ0A 4AISA 3AI0A 1P1MA 1HIZA 2BX7A 4MJ4A 4AX6A 1J93A 2PWGA 1TVLA 3FK4A 3UJFA 3PPCA 1W9PA 4RXFA 2NQHA 4DO5A 1L2UA 4G7EA 5DLCA 4O0QA 1OYCA 1V6TA 3RX3A 1PKLA 2LLEA 4Q8QA 2A3LA 3UNTA 5A8NA 3BE7A 1C7TA 4I6VA 3SIMA 4WX2A 2WOVA 3TN5A 3LHYA 4F48A 3ZJ7A 3R8HA 3FOKA 1CB7B 3STEA 3P14A 4NJKA 1U30A 1LOSA 4AZ5A 1WDDA 5GNYA 1XC4A 1EF3A 3KTSA 4H6QA 1VPQA 2DUXA 4IQEA 4XKMA 1W1ZA 3FGCB 4HJFA 4KS0A 1W3TA 2PDKA 3LNPA 4GK8A 3RLUA 4LGXA 1J6PA 4ZTYA 1HX0A 4NZ4A 4RLIA 3GH7A 4JIIX 3THUA 1OEPA 3NVWB 2GOUA 4C6QA 5CPQA 1FWCC 5IBXC 4ZOAA 2BNJA 3CUGA 1OZMA 1WYGA 3L21A 4H9VA 2PURA 2V38A 1PWMA 1A5LC 3ABQA 5HNRA 2RH9A 1HKKA 4NIRA 1QI4A 1P0NA 1CLVA 5GVJA 4JQAA 5H8MA 1E9IA 1WV2A 2A8XA 5KVIA 2INZA 2ZUWA 1TPEA 1PZ2A 3BLFA 2VOMA 2CW6A 5I0DA 4PUWA 5F2IA 3ITCA 4QE5A 1QOXA 4PSPA 3WG6A 2EAWA 1OFOA 1W32A 3B40A 5I77A 4IHCA 2BXVA 2CWNA 4WSJA 1UHVA 2XM1A 5I09A 1WOBA 3URNA 2ZUVA 2XIQA 5CBIA 4LBUA 2G50A 3PBMA 3PFRA 4LNCA 3PY2A 3HIJA 3NQDA 3ANUA 1YRRA 3M41A 3DC0A 4A35A 4O1FA 2NX9A 5B80A 1GETA 5EPDA 5LA1A 2PC8A 4L9ZA 4OBSA 4S3AA 1EJSC 5FJPA 3OYXA 2QXWA 3Q2DA 5CAHA 1EWEA 4ICMA 4AD2A 4FX8A 5FKYA 6PTDA 2GDVA 5CG0A 1EYWA 1K3UA 4M1RA 1V51A 3SCVA 1QDSA 4QHRA 3RDKA 4AWTA 1AMYA 1PKMA 5FS6A 4QIUA 1TR1A 3ZR4A 3LCIA 2R82A 3NXLA 3MO4A 3NL5A 3HG3A 4PMUA 4OHQA 3SZ8A 1Y8BA 2BMBA 3N13A 1UJQA 2FZ9A 3LTYA 3BJFA 4HNUA 2MANA 3B9EA 3BAKA 1P43A 4N6EA 4Q4OA 1VEPA 3T4CA 1G4PA 3OBAA 3W1UA 2Z1BA 3CIXA 3CUZA 4C1LA 5HR6A 3UXIA 2VXNA 4ZOBA 1SJCA 5U4NA 4LC6A 1JYVA 2WZEA 4B91A 4YN5A 5K9DA 1FHUA 1ZXIC 4I9MA 2JK6A 3KL5A 1MVYA 1OG6A 2PWHA 1S1PA 3HJZA 1BYCA 2WHKA 5E0FA 5IHSA 2W62A 1OC6A 1IWAA 2E6AA 2BODX 2VQUA 4XZ9A 4JX5A 2D22A 4A21A 3AAMA 3IGUA 2PGFA 4XD5A 2WKLA 3ZMRA 3LV6A 1UR3M 3AMDA 4H8UA 2EJ1A 4G1KA 3LBMA 1XW8A 3EKLA 4UR9A 1UR9A 5JCIA 2I7GA 4GQGA 3AZRA 4N02A 1UB3A 1Q1RA 3IWPA 3RR4A 1RUSA 2VMFA 5F4XA 3H2NA 2CLIA 4JTLA 4JTSA 3P62A 4LTSA 3WD4A 4BURA 1FHDA 4AEOA 1H0GA 2C3CA 3UBPC 1QT1A 3BZJA 4B9YA 2AAQA 5M17A 4OU1A 4B3ZA 1HQTA 1RJRA 5EA9A 3VMOA 3BC9A 2B81A 3GFYA 4L7ZA 3WMLA 5EMYA 3ABXA 3H8AA 1J11A 3W7GA 4DBEA 1LLOA 4Z42C 2CZEA 3P84A 4D2JA 1TV5A 2IPWA 4LU0A 4JTKA 3W1NA 1HF6A 2BOFX 4PCTA 1R38A 1V3MA 1TV2A 3S1WA 4HYRA 1XD0A 9CGTA 2HSAA 3HO8A 2QEZA 1STZA 1SM9A 5D2WA 1AH3A 3FDGA 1VBUA 1GRBA 4NQ1A 1JCYA 3VCCA 2Z2AA 3E1F1 4P8VA 1R2SA 4MGGA 1A5BA 3IVTA 1FKXA 3DFQA 4J5NA 4JOMA 3IJ7A 3SAZA 4R7OA 3SCWA 5EMKA 1Q7QA 5I3KA 1MQQA 3AMLA 5KZ6A 2YW4A 2WVSA 1NDVA 1K02A 1X2HA 3RNMA 4D8ZA 2HCVA 4G1NA 4J7RA 1GOMA 2OEMA 1VAHA 3AFBA 3QZAA 2Q71A 1CIUA 4LBSA 3Q67A 3MVIA 3P60A 1OX4A 2DGAA 3FXYA 3QJAA 2I5IA 2PDIA 7A3HA 1VRDA 4LQ1A 1WO2A 3UG4A 1H51A 3GE7A 3TR2A 7PTDA 2EHHA 3LN3A 4GFSA 4C6LA 6XIMA 4C6MA 1YMYA 3FIGA 4DWSA 1XYFA 1K77A 1ZSXA 3N11A 1GVEA 2J7DA 4LUJA 4A3YA 2YQUA 2GUYA 4F0HA 4XD6A 4ZR8A 4KEZA 1XFBA 4G5DA 1IT8A 1JZ2A 4B2DD 4DX3A 4GI4A 3MUZ1 2A5HA 5G2WA 3UFYA 3FXGA 4BQ5A 3PJXA 3UYIA 3C2VA 4MMWA 3SY5A 3LLDA 1H63A 1FP9A 1FXPA 1HNYA 5FS7A 3NQFA 2XIBA 4KCWA 5HNUA 1EUAA 4J40A 3G1VA 2IUZA 1XSJA 1F74A 1OFPA 2VRQA 3PG9A 1TV8A 4PH6A 4F66A 4PB4A 3ARWA 3DOPA 1BF2A 4Y90A 4JHZA 4CCCA 1F76A 5AC7A 1UIOA 4XAYA 1DVJA 4TVWA 1ITXA 2XTKA 2NXHA 1R3SA 3BW2A 1O6IA 2BB0A 2PGRA 3QOKA 2Z0IA 1P48A 3M47A 3AHTA 3KRBA 5FEWA 2PF0A 4MKVA 1XLKA 4RE3A 4MWAA 5E5CA 3CAWA 1WKFA 4ES4A 1UR2A 1F6YA 4K1WA 3LB8A 1NHSA 1XBVA 3A64A 3H2AA 4AC7C 2PBGA 1CGXA 4ATWA 2X50A 1W37A 3BK0A 1IEWA 1KM1A 3QGKC 4BEQA 3L2IA 1ICQA 1XLCA 1IQ8A 2HQMA 2QV5A 2EPLX 5K9CA 4OIFA 2VUYA 4D6IA 4O12A 4NXSA 4ACZB 4NYUA 5HWJA 3EWCA 1TTJA 3BJSA 1DV7A 3QPZA 4N9DA 3WMBA 3MJMA 1V08A 3IUHA 1H7RA 1NHRA 2BS9A 3QN3A 3EPNA 1OJTA 4KWVA 2CBJA 3FSTA 1XH0A 3PG8A 2AQWA 4XZWA 4GX8A 3NJ3A 2EQ9A 1VJZA 4U5KA 1JCNA 2CLHA 1IIGA 2JFEX 3UG3A 1VHCA 4YVXA 2XGIA 4R27A 4E38A 1DNCA 4YVPA 4B5XA 5G1MA 5CC7A 4E4UA 1M53A 2A6LA 4WDTA 2QYGA 3N4FA 3NPWA 1ZUAX 2A3CA 2W4XA 3IGSA 1AQFA 3ZVIA 4Z2LA 1UR1A 1W1B1 1F07A 4OOZA 2OLAA 4AEFA 3WLNA 1ZB5A 2Y5SA 2WM0A 2R1MA 1G4TA 5A94A 3WLPA 3T42A 3DK4A 5JQ9A 4BHYA 1SFLA 4LEFA 1Z69A 1LZOA 4G8TA 5GJPA 3RJYA 1YPFA 3M0MA 3P3BA 5FIPA 3VNLA 1UMLA 2QPUA 4J28A 4LS0A 3LQLA 3TC3A 4R9OA 2NQZA 2PFHA 5C2CA 2CHNA 2HK0A 3ZM8A 3CGTA 4JDBA 1YW1A 3IGHX 2E8ZA 1XDJA 5DY3A 5FAJA 2QUMA 3NL6A 2D0HA 4NSBA 2YVJA 3ENLA 1RLCL 1S5NA 1SZNA 2P5NA 2XHYA 2XDFA 4K8GA 1AJZA 3ZIZA 2HTMA 1FWTA 4WY0B 4F2BA 5AOUA 1J0ZA 5AECA 5CJ5A 5JBEA 2BGQA 5RUBA 2FDSA 3NM1A 4AH7A 3N3TA 3MCOA 4HHPA 1ZAIA 1CGVA 2GVJA 3H2CA 3MU7A 3WFZA 4FK9A 2YLAA 1VDVA 3QW4B 1AJ0A 3O63A 1XKJA 3EMQA 3MKCA 1W5PA 2ZC8A 2ZA1A 4JTRA 3B8DA 4XX6A 3EAOA 4DJEC 4MKNA 3U48A 1PZ1A 3GD4A 2EPHA 4N7QA 4UFLA 3L0GA 2J6XA 3O0KA 3T0AA 1OX5A 2Y8KA 1E51A 1WP6A 1ADSA 1H41A 2XIOA 4MSSA 3GNXA 4U2YA 2ESCA 5TR3A 3AJXA 4S2CA 4UZUA 1GG0A 1TG7A 1UASA 3R8GA 5CSSA 2D1ZA 3UZ5A 1OF8A 4WJ8A 4HPNA 3G22A 1OQFA 4ZQCA 1FEBA 4LAUA 1PCWA 3VYLA 3MCNA 2O9PA 1SJAA 5CC6A 2O4QA 2J66A 3BOXA 3MMWA 3HZ3A 2WNWA 3TW9A 1B9ZA 1K8XA 1YIXA 2XVLA 2C13A 3MZ2A 1YTEA 4G56A 3G77A 4FLOA 1FXQA 3SR6B 5E6ZA 4PMDA 4ZL1A 4MY1A 3R0KA 1GNXA 1X96A 4WDUA 4Q8WA 3C0LA 1XI3A 3IPWA 2D2GA 2OXNA 1TPH1 5AVNA 4J57A 1FCUA 2AAMA 3M07A 1GOWA 4JEJA 1UKOA 1TJ1A 2J88A 2XJ7A 4UTUA 2VM8A 3FV9A 3BAWA 1XP3A 3FSUA 3D0CA 4Y9MA 3W7KA 2ASHA 3LM7A 1CYGA 3TN4A 1TELA 5LGXA 2IS7A 5AZ1A 3WJZA 3IAQA 3WF1A 1NDAA 4Y96A 3MA8A 1FX6A 2GVLA 3ARYA 3MHUA 1ZMCA 1TCDA 4EM4A 5CQ1A 2RHGA 4C90A 4IP5A 4PCFA 5HMSA 3SRKA 2PDWA 1DHKA 4XISA 1RY8A 1OINA 4JAWA 5LNWA 2ZXBA 4YTRA 4OQVA 3AHZA 3NDYA 4H4PA 5G4WA 3T0CA 3GM8A 1XISA 1F7BA 3EBVA 4FSAA 1ZKQA 5I24A 2GGHA 1I9CB 4LUSB 3IJDA 2XH2A 5HMDA 5FJRA 2OTDA 2PP1A 1PB0A 4Q3MA 4ZO8A 3WKZA 4C1NB 2VX7A 2XZ9A 2YXGA 4IMDA 1OX6A 3UG8A 2DZAA 3POCA 2VQTA 1GREA 3EOUA 3WDIA 4EK7A 3C3UA 4M6PA 4BF7A 1XINA 3M0XA 4UOZA 1B3OA 1POKA 1LTDA 1J5TA 3VM5A 1ZK7A 1ODZA 2GJXA 4O4VA 3ZJ8A 1PX3A 1TB3A 4L1WA 2C15A 4P8XA 4Q32A 6CGTA 1I45A 4QSFA 2DZTA 4A6GA 3HQ1A 5A6SA 4YIWA 3QBUA 2FZMA 2ZRZA 5FF7A 3I65A 4I9JA 5GPRA 3QHOA 4PTMA 4QITA 1JZ8A 4RZ5A 1X38A 4ZODA 3W1RA 3W84A 3AISA 3T2PA 5FJOA 2D2HA 3U6WA 1O95A 2VFIA 3NL2A 2OR2A 3RMEA 3B8IA 3N29A 3WLHA 1QASA 3H24A 5A8PA 3NQ7A 1TPFA 1XDIA 4MY9A 3FKKA 2W3RA 2CLEA 3SADA 5D4YA 1I0BA 1H3GA 5REQA 1XV8A 3VD4A 4EQSA 3HA1A 3MJYA 5LHEA 3LI0A 2WVVB 2DW6A 4ZXOA 3H22A 3O16A 2NXIA 2ZRVA 3QLLA 3TJXA 3WFAA 3SN1A 3VE9A 1DHPA 2WMKA 4HK7A 2HMCA 4PBEA 1OBAA 2GVEA 5FAGA 4QGCA 2D73A 3W1MA 2DPEA 3S6DA 4GBUA 1OC7A 3G1AA 4P8UA 3DFTA 3DFOA 4U4MA 5DCEA 3SQPA 1SUXA 3WH9A 3TYBA 4RL3A 2OG9A 1GKPA 4JY8A 1J0YA 1JIBA 5M5DA 5KITA 5T9CE 4OECA 2IXVA 3GAYA 1V02A 4ZQOA 1DQXA 2Z1SA 4NAFA 4UFJA 5DMLA 1TYTA 3IUDA 2NUYA 3PNZA 4WF7A 2EXOA 3KZPA 5D38A 4MZ1A 2PCEA 4BA0A 5TIMA 4LT9A 2A3BA 3W7OA 2YFOA 3SCRA 4HYVA 4IIGA 5K4ZA 1M7PA 5DRCA 3ZR6A 3YPIA 2HXUA 5A8QA 2EKCA 3FA3A 3LG3A 2HVNA 3MP5A 2QAFA 2FHCA 3EA2A 3UY7A 4M7TA 4M8UA 2A7RA 1ONFA 1RP9A 3U8GA 3ZVHA 3N3MA 3WH6A 4EWJA 1AD1A 3A12A 2Z24A 5D2YA 2BOGX 1R2TA 3OZPA 1SGJA 1Q66A 2ATSA 1DJYA 1VF8A 5TNVA 3PN8A 3N9KA 3V0TA 3CM4A 4IXHA 2V6OA 1I6NA 2ALRA 2PLMA 3HPXA 1JD7A 4HPJA 1MFVA 4JYDA 4C6JA 4DHGA 4HOXA 4JQ4A 3CXOA 2OWCA 3RFAA 4C91A 4GQ0A 2PU0A 4GVFA 1PYMA 4NXKA 2NLYA 2R1KA 1E6NA 3LLXA 3W75A 2PD9A 2OVLA 3VIOA 1BF6A 3LENA 2TMDA 3WQ6A 1SO6A 4DM1A 2ZZ0A 1I1XA 1QK0A 1LQ2A 2VHLA 3VOIA 2J79A 2BDQA 1Q2RA 5BXSA 7REQB 5JU6A 5AHLA 3R0DA 3UWEA 3GX9A 3LBCA 4TX8A 1XGDA 2OQLA 3QMRA 4GQQA 3TYEA 1W3HA 4E0CA 3W00A 3PZOA 2B0MA 3UXKA 1OGBA 1K8CA 1OCQA 4WKAA 2YYUA 1FWIC 3N6JA 3ABZA 1XLJA 2E67A 5ABGA 2WMHA 1P6BA 3CAVA 1JQXA 3PNUA 4L1GA 1WKEA 2GK1B 2DT0A 3TQVA 2JKEA 4IMAA 1NWRA 2VVNA 1XYMA 4AY1A 2WLYA 4LOCA 2CKSA 3MUAA 5LIYX 4C7GA 3GDMA 1QW7A 3EANA 5JCLA 1NPXA 3RG6A 3TW7A 4A22A 1Q5MA 3G0XA 1EGVA 2DVTA 1EJRC 1GPFA 3NYDA 2OZ0A 3TLLA 1EOMA 1DJXA 1Q4NX 1E4LA 2UY5A 1KR1A 3RR1A 1IEQA 3NQMA 3MCMA 4JFVA 4JX6A 3AMGA 4IFKB 4OGZA 1FWJC 3ITTA 1BLIA 4IGNA 3NS1B 2JF7A 4M51A 1YNYA 3CMJA 4M6UA 3V36A 3DGBA 3KAOA 4M7SA 4HNOA 1K9DA 3FYYA 1VCGA 1R3WA 3MMDA 3TA6A 4UC5A 5K7JA 2HQAA 4QAIA 4E2DA 2XG9A 2WPEA 3V7PA 2EG7A 4QCEA 4E5TA 3R0UA 4V1XA 1EOKA 1V59A 1BEUA 4FHAA 4EVZA 3AYVA 3EWXA 2FZBA 3QFAA 3NEVA 8XIMA 2OU4A 1XQKA 4HPGA 5J8LA 1NVMA 4JL1A 5L6UA 1JQVA 1FDJA 3KOWA 3FA5A 4NEWA 3AS1A 5A69A 3L0KA 5EBKA 2WWDA 3MT1A 1B9BA 1KD0A 2X42A 3SUUA 3K30A 1OIMA 1ONXA 1VH7A 4YCOA 5AYXA 3GTFA 1A5NC 3NG3A 1T40A 1LQAA 2NVAA 4IQLA 4KGLA 4CN4A 4LUTA 2C91A 3GTIA 1A47A 3THCA 1EO7A 1Q6QA 3A9IA 3KOXA 4WOQA 5EL1A 1N8FA 4GZEA 1U22A 3BCDA 3I3DA 1WZMA 2REQB 1MMFA 4MB5A 4Q4RA 2AMGA 1LYXA 2VGIA 3HG2A 3S9YA 1TV3A 3SECA 3UZYA 5EYWA 3TOPA 1V6YA 1HJWA 4LV9A 1RLDA 4GCAA 4MFDA 1XXXA 4K68A 3VKAA 1D8CA 1L0PA 3FJ4A 4GA8A 4GUGA 2EQ6A 3MS8A 4Y9AA 2XGBA 4LF1A 4AC1X 3KBNA 4H9MA 1CCWB 2Y7FA 1IF2A 1W5NA 3B0VC 3L65A 4H6EA 5EB8A 1UJPA 2PAJA 3FY1A 3SCOA 1S46A 1UA3A 1WZLA 1DTUA 4XKYB 2VL4A 1VPXA 4PMJA 1IR2A 3PUDA 1B0IA 4J1OA 2Y85A 2DZWA 3B0YA 4U33A 4UTMA 1DKWA 1UZ1A 3TTEA 4BQ4A 3E0LA 4AWUA 2P8BA 2V68A 3G1YA 1GWJA 3LRKA 4H1ZA 2GWGA 4W93A 2P8CA 3A3WA 4C6NA 2WHLA 2GPTA 2GSJA 1M65A 4HBKA 1BHGA 3CAKA 1O66A 1KBKA 1JYNA 4LVBA 1B30A 5AYZA 1BVWA 2ZE3A 4C65A 2Y0FA 1LRTA 3WNOA 2QDDA 3W53A 2PE4A 4E8DA 2R6OA 3KM8A 2GQAA 4GIEA 3NGJA 1UR4A 2VFFA 2Q09A 1E3XA 2TSYA 3DDMA 5CLTA 4ZE4A 2ON3A 3U2EA 1XBZA 3W1LA 4GXWA 4ZFCA 1H60A 1TX2A 1BWCA 4IWWA 5I3JA 5C9UA 1X1ZA 4IIHA 1Z41A 3FJLA 1GRTA 3DZ1A 1R3RA 3AJ7A 4BS0A 2DORA 3G1HA 1XIJA 4EE9A 4EKJA 1H11A 5HJYA 1DTNA 1QHZA 3N1AA 3F4CA 5U7SA 4IQDA 4X22A 1YDVA 1NP0A 3HQNA 4LCQA 3WQCA 2QMKA 2WBKA 2G4JA 5FSEC 1EXPA 1FDZA 2FH8A 2W3ZA 1CB2A 3QY6A 1MUWA 1BFNA 1DQUA 4QCFA 5D05A 2E9MA 2JQXA 4OZOA 2DIJA 4N2YA 3W6MA 1OD8A 2XH7A 2YAUA 3FEQA 3LB0A 4LAMA 2X1RA 1PCKA 1Z42A 3ARVA 4IIFA 3CZKA 4LS2A 1ENUA 1I4NA 2BY0A 1TA3B 5F1UA 2JEQA 4OBTA 2WSQA 1EBDA 1NM9A 3L4VA 3C61A 2ZUSA 3CZGA 5DRIA 4FO4A 2ZX6A 1R46A 2ZZ2A 1OFEA 3AC0A 3ME3A 4A4AA 1GV4A 2X7WA 4WGHA 1V6UA 2J6VA 2I1OA 3S46A 3LPGA 4K8DA 2QCLA 2YXOA 2G3NA 3RGTA 2IW0A 1RJQA 3CZLA 5CPLA 3XISA 3PAJA 1TTPA 3PTKA 1UQYA 1Q6GA 2F8QA 1J0HA 3PWIA 4GABA 4UFMA 1VFLA 5GQBA 3S5SA 3ZR5A 3TCEA 4E8CA 4P8WA 3WH7A 1O94A 1UA7A 2FZ8A 3OVPA 2WPFA 2W66A 3GNOA 4NG3A 4ADTA 1N82A 3Q6JA 4MADA 1GJWA 1GVFA 1UP0A 3S5OA 3UCQA 6A3HA 1MQRA 4UIOA 1PZ3A 3OEXA 3KEHA 1CBGA 3PJTA 3LYEA 3VIMA 4GKTA 3W23A 1XKYA 3K8LA 4TU1A 5A8GA 3U7VA 2WOWA 2BP1A 1TWZA 2HJPA 5DXXA 1G7UA 3VKDA 4Z2JA 1Q6OA 3UJRA 1UR0A 5HNTA 4LUIA 1H7WA 1MDRA 4ZA0A 3DGZA 2P3EA 3LZ3A 2QDGA 1AUSL 1L6WA 3GHRA 1KXVA 5K2ZA 3BLOA 3K1GA 3LK6A 2PRHA 3DK8A 3OZMA 4PUKA 1M7JA 4JYEA 1UWSA 1PYFA 4YTSA 3NO5A 4RK8A 3T81A 4HN8A 3CASA 3LXDA 5HUOA 3R43A 4LB3A 3MUIA 4NRRA 1DJQA 3ITXA 3SW6A 3S8HA 5HMEA 4O1BA 5ABTA 1R9XA 4H6RA 3BL3A 1F61A 3N6QA 3P0XA 4EPDC 5I03A 2DZVA 3L12A 4Z08A 1SO5A 2VCBA 1ZU8A 2AOSA 1J01A 6ALDA 2ZX8A 3LX9A 1N8WA 5LNRA 3CMFA 4WOZA 1NOFA 1HJQA 2QJJA 3UT0A 4EMJA 1RALA 1KLYA 4MJZA 1YHTA 3SO7A 3MHGA 2Z2UA 3DG7A 4NJGA 4YNGA 3VKCA 1FRBA 8TIMA 4PUMA 4KT2A 1A5UA 1JNDA 4K2SA 2PTDA 5AY7A 4X2RA 2OOFA 1IGWA 2WZHA 4MDPA 4PUNA 1NY1A 5M2FX 1KKRA 1UW9A 1UWRA 2X2YA 2YCLB 4W86A 3A21A 3SJ3A 4JHMA 3SQLA 1BQCA 3TJLA 1HO1A 4XD3A 2POTA 3MI6A 1L8PA 1T3QC 1SQ7A 3GXPA 3PS7A 3CL8A 3GU2A 3QW3A 2RJHA 1E1CA 4I90A 2PDYA 4P7LA 4PE8A 3NRZB 2DH2A 3AYSA 2FIQA 2OYLA 4XBSA 2FZDA 4FLQA 1A80A 1KXQA 3W01A 2R94A 1ZJIA 1PX4A 1LP6A 1REQA 2VEFA 4H04A 3UWZA 4J56A 1WKYA 2VVSA 2BHZA 4M80A 3OP2A 1ZZMA 5ECUA 4PMRA 3AQUA 5DCDA 4CLMA 4CKQA 3KCLA 3BQ5A 1ISZA 3WMCA 1RD6A 1W1PA 4DXVA 2PBOA 3H54A 1GVIA 8CGTA 2PB1A 3W27A 3AWNA 5AHNA 1BD0A 1KM5A 3HGJA 3TSMA 3TSDA 2EBNA 2CLLA 4JTFA 3A6OA 5CKSA 3P67A 1YE4A 1W8GA 3VILA 1YTDA 3O1NA 3T40A 4JPGA 4XO6A 3F03K 4CQ9A 1DBTA 3F4WA 4IIDA 5IFTA 1MDLA 2C19A 3TTYA 1WUEA 2PTXA 3W87A 2J9XA 1VS1A 4TV6A 2VWTA 3M0YA 4IM4A 1QHOA 2R1NA 4J4KA 4LPCA 4PZVA 5G4HC 1YTKA 5LXEA 2H8ZA 4US5A 4PYSA 2QJNA 1OIFA 1YDOA 2G8ZA 4EX4A 4GKLA 3CNYA 4IF2A 3O2LA 3EB4A 3GVQA 3M1ZA 2NV1A 1MUCA 4Q8MA 2YBUA 3WQGA 1FO4A 4MNJA 1UKPA 1FH7A 1NF7A 2CBVA 3ITOA 3T8LA 4MKSA 4ZFMA 2FJKA 4H7ZA 2VX5A 2OCZA 4XAPA 1Z89A 1DJWA 2EJAA 4GVGA 1G5AA 1LOLA 4BV6A 3SBFA 4OT7A 4US5D 1IEIA 5ABHA 2V2DA 3DEQA 2OSXA 2VEMA 3H23A 1VFTA 5KZDA 4W8LA 1TPB1 5JVLA 4E8GA 5IHRA 3PBWA 3QQ0A 5GNZA 1FH9A 5FJIA 3BICA 6TIMA 4DNAA 4MNLA 3MW7A 4BZYA 5HULA 1EC8A 1BXNA 3OIXA 4RNFA 4H8HA 3S2LA 1RA0A 4EQWA 1NDWA 2VJXA 4EXAA 3VDHA 1G4EA 4UQEA 3G5EA 4WGXA 1VIZA 1DE6A 4AHOA 4UMBA 3SCNA 1W9DM 5IRPA 3RPMA 1JG9A 4H19A 3THAA 3PBYA 1OHLA 1DJHA 3P61A 3ZT7A 3CS2A 4CNTA 1ZP4A 3K46A 1CXLA 2GR1A 1WB0A 4BJHA 3GR4A 4XTIA 5KINA 4DZHA 1JVNA 3IAPA 2WCAA 2OQYA 5DBTA 1GKQA 3N2XA 4HIBA 2EPNA 4ZMGA 1W31A 5AYIA 1W6TA 1EP1A 4HNLA 2ZA2A 5CPMA 5HMFA 3L4XA 1SZEA 4LS1A 5DT5A 1AL7A 1HJXA 2J74A 1QTWA 3N2OA 1K6AA 4F40A 3W7JA 4DZAA 3GDRA 3BVJA 4DWDA 2CDUA 4ORMA 2IKGA 3LBOA 2DZUA 2O55A 4DPQA 5D03A 3H26A 3S5YA 3R5EA 1DWJM 5EBUA 4RE2A 3ZSSA 4R53A 4TV5A 1W1A1 2UZ9A 2FB3A 3T78A 1AW1A 1MRQA 4XB3A 4ZSUA 2YB1A 3OHIA 4UQBA 2PDCA 3WLOA 1DXFA 3W70A 1E6QM 1P1XA 3SY8A 5F2GA 1W2VA 4JFWA 4QQUA 5HQLA 3W7NA 3KL3A 1EFZA 1FWAC 1N2VA 4A3QA 4AUBA 1BTMA 1TKKA 3B8TA 1YLVA 3U2ZA 1KFLA 3AIQA 3TSBA 3T8QA 4NZ3A 4QNWA 4LEQA 3SQSA 2QAEA 2ZRYA 1Q6LA 2PDQA 1LBFA 3WUEA 2RAGA 4Q8OA 1O68A 2R1PA 1C90A 4M6VA 2A1YA 4GNVA 4I7VA 1DWIM 2CZDA 1EP3A 2X16A 3B0UX 3ZFHA 2BY1A 2IXUA 2W3SA 3B4YA 3LPPA 5A8OA 1RJPA 2VFDA 3PPFA 3C0JA 3SDOA 3W76A 4BI5A 3W73A 3STCA 1TJ2A 4UTHA 4Q8PA 1HKMA 1ZTVA 2WNQA 3CV1A 4R5EA 4WIWA 1FCQA 3S1GA 1ISXA 2P3ZA 1YDNA 1ZBCA 3N15A 3UR5A 1W91A 1S5WA 2YCEA 1DWHM 3QC3A 3V1HA 2I5GA 3N17A 5A5WA 2RGLA 4PEKA 4WVXA 4QG6A 4KETA 1AG1O 1EC7A 3EWYA 3KHDA 1U5JA 3W7CA 1IE7C 3VKBA 3RX4A 3CGBA 3BQ6A 1KFWA 4MNKA 1ONEA 1DXEA 2YZ5A 1AOGA 4GHRA 5BZAA 4TOQA 2O0TA 5BXRA 4S3JA 2X7VA 3LY0A 3VGBA 3NXFA 1HT6A 4M29A 2CBIA 1WBHA 1M7OA 1C3FA 4Z1DA 1T6MA 1QW8A 1QNRA 4H41A 3V35A 4DRSA 1QNQA 3RK8A 3FFSA 4CD5A 1GRGA 4D1JA 1RQBA 3W26A 4UQAA 3OODA 1FWFC 1VBJA 1H7PA 3P2VA 2OOGA 3W1PA 3LHZA 4UTWA 2FTYA 3RJXA 4ADWA 1ZRQA 1IZKA 2TRSA 4V1YA 3UCDA 4GC3A 2J25A 2WMGA 1Y0EA 4F8XA 1MW0A 4LAOA 4IP4A 4NJJA 3AMKA 4JNYA 4MM1A 3D3AA 3GDKA 3GDTA 2Q3RA 4ROPA 1W9UA 4CNNA 3C52A 3TYDA 4IL0A 1LL6A 2ACQA 4S1FA 4J3XA 3EPMA 3M0ZA 3QXBA 4KWSA 5HBFA 1XS2A 2JIEA 2PWVA 3KOZA 4UNLA 3B9AA 3REQB 1R9YA 2WB5A 4RW5A 1QVBA 2QHAA 3SB0A 2Q3OA 3NAVA 1KTNA 5JH2A 1ESWA 3OLDA 2VC6A 2V3EA 2C0AA 5CGMA 3NZPA 1XYBA 4UMAA 4MUPA 1ZNNA 2CZ5A 2Y1HA 1YNQA 4KERA 3R6IA 4JIPA 4LX4A 1E4IA 4AFYA 2C16A 4IXXA 3UGRA 3PZIA 5DMNA 5D2TA 4DJDA 1E72M 4RE4A 2QCCA 2VP8A 4YHGA 5TF0A 2OLHA 2V69A 4UZSA 1GZ1A 2TODA 4IG2B 4DJFC 3NVDA 1Q13A 1GVYA 1DL3A 1HJUA 3K8MA 1BWKA 1Q45A 3B8UA 4C1KA 1LRNA 4DJDD 2G95A 1XUZA 4J27A 5HANA 4UR7A 1GW9A 1HKIA 2D3NA 1R47A 1E55A 3UVIA 4ZO7A 2EG8A 1JRPA 2JALA 3W2UA 2H8XA 3O9NA 4JFSA 2GQ9A 1RK6A 2C7FA 2EQDA 3ITGA 3TQPA 4YTTA 2VEGA 4KH2A 4NAEB 1Q8JA 3TA9A 4F0SA 3WF4A 4H3DA 3N9RA 4LCRA 3VC5A 3WBYA 1MXDA 2WPBA 3RLHA 2ZQ0A 1P0DA 3MZNA 4CCDA 4OV4A 4B5UA 5D37A 4ZQPA 2EGZA 4NVTA 2YL6A 1XG3A 2I57A 3WDJA 2NXGA 5AN7A 5I06A 1NJJA 1QNSA 4ZOHB 5H2ZA 2VFGA 1HL2A 3W28A 3B97A 1EZ2A 4GZ7A 3CWHA 3I6RA 4C5YA 2DVUA 3BCFA 3TKFA 2IPJA 1KBLA 2R14A 4AW7A 4N4PA 4QBXA 2X30A 1AVAA 4PUDA 3C8NA 2NUWA 5BU9A 4A2SA 2UWFA 3WBAA 3PZVA 3D46A 4C1NA 2OKOA 4LY8A 4RNHA 5HUPA 1XRSA 3LTPA 2G3JA 1K4GA 4HGXA 3VZZA 4JIRA 1PPIA 1TV4A 2FGBA 1J0KA 1DOSA 2GJXB 3VIIA 2HNEA 4MZYA 4DAFA 3BW4A 1X6UA 3GNPA 1PTGA 3NURA 5T26A 3VTRA 3VFCA 2I56A 3AHYA 1QOQA 1MXSA 3MV01 3UWWA 2XYLA 3HFTA 5FL0A 3P74A 3MMUA 5DCBA 3N19B 4DNMA 4YTUA 2WQPA 2ONEA 1YQZA 3VIPA 4AYGA 1ITCA 5T8GA 3GDBA 1JZ5A 1AFSA 2CLPA 1RCOB 1LRQA 5CG7A 4GQBA 3QZ6A 5A3HA 1YXYA 2QJGA 1KFCA 1BPLB 4IJBA 2PZNA 5FS8A 2Z29A 2GR2A 4BR1A 5JIPA 1FWSA 4Q4PA 2GGIA 2WVVA 3ZO9A 5HNNA 4ZO6A 4AY7A 1LT7A 3GS6A 3STGA 4GIAA 5EMJA 3F7JA 1J4EA 1XLLA 4EOUA 4E2VA 1PZ0A 1B57A 4C6KA 5BWFA 4S23A 2CERA 3NO3A 4X2PA 1E5JA 4L9XA 3FYPA 3TWAA 4QLJA 1I75A 1QFEA 1MZRA 2ZUNA 4AZCA 4LW7A 4S3DA 1XLBA 1MXGA 1O5XA 4WJXA 3N4AA 3AALA 4NRSA 5FEZA 3GW3A 3QR1A 4MLJA 2CLKA 1VD6A 3WZ0E 1W1YA 4NAFB 3GKFA 4K8EA 2WHJA 3F2BA 1PE1A 1QXLA 2C6QA 5FS9A 4QE4A 1XD1A 3NVYB 4I9TA 2FPTA 2CKRA 2HS8A 3DG6A 2IKHA 3OYZA 1E4MM 3SGUA 2CIPA 1OK6A 2PTWA 3HFYA 2ABBA 3IEBA 2BHYA 1K9EA 4FLRA 1PDYA 1GQJA 1ZL1A 2BWGA 3CTLA 1KCZA 3WQOA 3DFYA 3WQEA 4MAVA 1OX4B 2Z2BA 2PDGA 3CEUA 2HVOA 5FACA 5CSRA 2HRWA 3SUVA 4YYFA 3GD3A 2PD5A 3T0TA 1BSIA 1GYNA 2V3DA 2ZKMX 4Z1BA 3GO2A 2R8WA 1W3LA 4DWSB 1XDMA 4NI8A 1JD9A 2H9AB 1GQKA 3QV7A 2X1SA 1V6WA 1P0BA 1V02E 4MB4A 2DQWA 4C6OA 3NL3A 4ENLA 1FY6A 3C2YA 4US6A 2JE8A 3O8AA 4BK9A 3VVGA 2J13A 3W9ZA 2XIMA 1JOAA 3G1XA 2HV5A 4PRTA 2CLOA 3WSUA 1Z3NA 4CNUA 3LRLA 3HB9A 1QI2A 2EPMX 3DC8A 1OFBA 1E73M 4Y9PA 3WD2A 1FTXA 4JTJA 2TPSA 3NSMA 5G1YA 1ADDA 3WK1A 3IRDA 1WOAA 2X1IA 3EX4A 3SQMA 4X3ZA 3R2GA 1ZLPA 4Z17A 4YPJA 3ECQA 4R7WA 4BQ2A 4AYSA 2W5FA 1PSCA 4PMOA 3CQ0A 1PHWA 3U7BA 1IYXA 3PVFA 1JZ7A 3BAXA 2F6KA 5GRTA 3MBFA 4ONVA 5G5IA 1PIFA 4IUGA 2QS8A 1SZRA 4KMQA 2F61A 1O4UA 1ZENA 2UY4A 4TXEA 2ZA3A 1ZCCA 3DFSA 3N73A 4AVFA 3G8RA 3NQGA 1QPOA 3QGVA 1KR0A 2PDXA 3EDEA 3STFA 3WD3A 3EB3A 1M6IA 2VYOA 3CU2A 1QHPA 2A3EA 1ADOA 4QDMA 5MKGB 5A6LA 3ZJ6A 4BY3A 2X1TA 2J27A 6TAAA 1ZP3A 4MTVA 1UC5A 2RUSA 3EF6A 3GR7A 3W22A 1K70A 1GJUA 4O10A 1IXPA 4GI8A 1GORA 2QUUA 4ACZA 1S2CA 4P2VA 3TQ0A 4DJED 2Y5EA 4JTQA 2GQWA 3WNPA 3KTXA 5LXXA 3BSMA 1DWFM 1I2RA 4EXQA 2V5KA 3NVVB 4HSOA 3M4HA 3QSRA 4H83A 5D32A 3L4ZA 4DF0A 3CUXA 3BG5A 1JCJA 4GO8A 3EXSA 1K03A 3GTNA 1TE6A 5EMLA 1OT1A 3QKZA 4GQRA 4QXIA 4YWIA 2Z7KA 4ADUA 3A5FA 3QM3A 2GRTA 1TR9A 3A47A 2E40A 1YQ2A 3GUWA 4JY9A 2HBVA 2WOIA 5BU6A 4H50A 4MWAE 4KRUA 5BWAA 1FWNA 3ERPA 4GISA 5DY2A 3P5YA 1XIEA 4C7DA 4DXKA 3A7AA 2NV2A 3B3DA 1KCKA 1Q1WA 1XPGA 2CETA 3BLPX 3W2KA 1YADA 3WJXA 3SFWA 5A6AA 3S2MA 2GGGA 1RZMA 3EKZA 3B03A 4RR4A 1JFHA 4JKLA 2DDXA 3N12A 3IJQA 3NZQA 4HSNA 4PL1A 2PCQA 3CGDA 4ICNA 1O12A 3QQ1A 3WEOA 4PCPA 4PMXA 2WZIA 2G37A 3W81A 1UROA 5F4SA 4JS3A 2E25A 2PA6A 3GYCA 4F0KA 1M03A 5HOSA 1FFQA 1V0MA 4AZGA 3LCWA 4UTKA 2DT3A 3LADA 4LBRA 1A0EA 4G7EB 4B5WA 3TOYA 3W07A 3MP4A 3LCLA 3JZUA 4IGHA 4PC8A 4KRTA 8RUCA 2VO5A 8XIAA 1J2WA 1BG9A 4FF7A 2RKXA 2P53A 3W7HA 2E0PA 3EX6A 3HMJG 2DSUA 3A7UA 1UOKA 3AIBA 2W67A 5AC8A 1JPMA 3E0WA 3WJWA 4DLFA 3L8KA 4LY4A 3URBA 1PX8A 1LF1A 1HL9A 4R85A 2OSYA 4H4ZA 2ZTKA 4GUHA 4S3BA 3O7UA 3WLLA 4ZE5A 4JFTA 3ZS4A 3QY8A 1D7FA 2E6DA 4A8IA 3T08A 5KMYA 2DZBA 3V5OA 2WW5A 1EA0A 5E0CA 1KCXA 1MRAA 5DMMA 3I4KA 1OD0A 3I10A 3CB3A 2PGWA 7TIMA 3FX4A 2D20A 2IKIA 3CJPA 3CXBA 4UFHA 2DZSA 1TQJA 1W9VA 3BUVA 2DSWA 1MEIA 4UWMA 1X1NA 1XIGA 1KM6A 3LV5A 3CZJA 3GVGA 3M7WA 3H53A 3VE7A 1V3KA 4DUWA 1P6WA 3DXIA 1UBSA 1U83A 3LHWA 4H6KA 1E0UA 2CFYA 3DECA 5JUVA 3KCJA 4PTXA 1T96A 1K6WA 1VFHA 3H6OA 3AO0A 4X63A 1I2QA 3AXHA 4O57A 4DLMA 2YBTA 1XIHA 3PANA 1UWAA 5DN1A 5CZJA 5IFPA 4RV8A 3HM7A 3OVQA 4RE0A 5BXTA 1L6YA 3P5ZA 2MUCA 3O0HA 4ATLA 1JPKA 3DX5A 4JN8A 1YE6A 2GFTA 2KAUC 2ALDA 3CO8A 3EEGA 4PRWA 3FVMA 4YTQA 1LWJA 4MZ8A 3H7VA 4L6HA 1QI0A 1PHQA 3UGVA 2Z1KA 3NOYA 1ZALA 5FD0A 1C91A 3WUBA 3PUOA 3VCNA 1GKRA 2EG6A 1XPYA 1GT8A 1XLFA 1I8JA 2KZHA 5D30A 1Y5VA 4AIUA 3L23A 2NVKX 1LUCA 1X6LA 3S6TA 3SJNA 3B9NA 1N7KA 3O15A 1KXTA 4H2HA 5G5GB 2YW3A 2A7PA 3DYOA 3P80A 1ISWA 4KW2A 5CZ0A 4MWAD 5LNSA 1NWTA 2VCAA 4WY0F 2E77A 1V03A 4NL1A 2YPIA 4JICA 1XBYA 3MUY1 1GOIA 2X8HA 4MAZA 2DQXA 4L64A 1B2YA 2EF9A 3E0VA 3IV3A 4O17A 4LYKA 3MDWA 3K1DA 1AW2A 2J7GA 3UPMA 3GIYA 2QAPA 5BCAA 3NDZA 2IMRA 2P0OA 4LWWA 4H4VA 2QPSA 1AH4A 3UZJA 4YU1A 5CBJA 2I9UA 1OCJA 4HPHA 1AZ2A 3G1SA 1JUBA 3U5UA 3I4EA 4I7WA 5JMUA 5HWMA 3L4WA 4GYKA 2VZVA 1XIMA 5CZSA 3T05A 4F9JA 2X0SA 1BKSA 3N9SA 4GWEA 4JTEA 4JFUA 1S1RA 3O6DA 1EH9A 1SFJA 3KDNA 3VM7A 1H7XA 2CFFA 1CW2A 2BHUA 4GYPA 2VGFA 3JZEA 2QCHA 1VBGA 3OU8A 3TYUA 1A4MA 5A1AA 1TWSA 2AMXA 3ABOA 3C2RA 3MC5A 4L61A 1W3JA 3ZWSA 2ZVIA 1IXNA 4A8RA 2XSAA 2OZ8A 3M7SA 2VELA 4GBDA 4GXMA 4IGSA 4Q7BA 4NI3A 4PFHA 3EWWA 4EACA 1F9CA 1ONRA 1RXOB 4QS5A 1DXIA 5KEZA 3VDAA 1MUMA 1UQZA 1DEDA 3RPDA 4CNPA 3APYA 4XIAA 2J4GA 2ZIDA 4AZ6A 5FMHA 3VMPA 4NY2A 2F5ZA 8A3HA 2EQ7A 1NDYA 5C71A 3DFPA 1KWGA 2PP3A 3GLCA 4OTKA 4L1XA 3S83A 3P93A 1GK8A 2HE8A 2YR1A 2C79A 3SR7A 1QCWA 1OFQA 4EWND 3HGOA 4CUCA 4JKKA 4K7ZA 5I3DA 3PBVA 4LRTA 3SRDA 2CC0A 3L4YA 3BSHA 4B4FA 2ZCGA 5BRBA 1S3TC 2V5BA 4JTTA 3S1XA 1R5YA 4QG9A 4TMCA 1EWDA 3CO4A 3RAOA 3HGRA 2D2JA 1G7VA 4OE7A 4ROQA 2HEJA 3WNKA 4UCGA 1XYAA 2J8TA 4O53A 3RF9A 1E71M 4XK2A 3S9IA 2PP0A 2BVYA 3WDPP 3GXNA 5C6MA 5LKYA 3ZVHB 3TVAA 4W89A 2JKAA 2HK1A 3DHDA 3F4DA 4HVXA 1AK5A 3GNDA 2Y63A 3CV7A 3NZRA 5HK4A 5B7ZA 1YBQA 4GUFA 3W7DA 4PUEA 4Q6JA 3U4AA 1W8SA 3HQOA 4JN7A 1H2JA 3RCMA 3BLDA 3DAQA 3EOSA 1M1BA 4HU3A 4D1IA 4LA1A 3CWNA 4IT1A 4AX7A 1F3PA 5CGTA 4CNSA 4NZ1A 1VZWA 3WBWA 3LGEA 3PUEA 2DY3A 3KBJA 1K4QA 4AMAA 3CEPA 5HWNA 1ZMDA 3V0UA 1UWIA 3SRHA 1BSLA 3UD6A 3L5LA 2CPUA 1GEQA 2QVHA 3QSTA 1QBBA 5A6TC 1AL8A 3GXMA 2XU2A 5CJMA 1KO0A 2V30A 4JNZA 4O15A 1JZ3A 1UPPA 1DIEA 1SU5A 3BGAA 4ZOCA 1X97A 2GYIA 4LALA 7REQA 5FEPA 4JN6A 1YXDA 4PBGA 5AFDA 3CGCA 4CN1A 1UKQA 1V7AA 4DF2A 4POCA 1Z6KA 3TC7A 1E9LA 2RDTA 3WQVA 2QR6A 2QF8A 3QHNA 4UCFA 4ASTA 1GG1A 5I78A 1POJA 5EKYA 5BYWA 1LBMA 1CXHA 2W27A 1EPVA 1VYSX 3SIZA 3ZLGA 1EBHA 3G0SA 3OPSA 3P8IA 2GK1A 1QWKA 5C2GA 5A2AA 1FWBC 4NNBA 5H91A 1P7TB 4FR1A 2I9EA 3RCNA 3RUBL 2QZRA 1V4YA 1RCQA 4LFYA 2PDLA 3LXCA 4KEMA 3PB0A 2XIJA 1V97A 1AW5A 4RV3A 3M46A 4QRNA 3SGZA 3EAUA 3PULA 1ITUA 4HU0A 1J18A 2BASA 2WCSA 4I7UA 1H7OA 1XSIA 5E9XA 5L9FA 4JTUA 4JX4A 2B31A 1A5AA 4N6FA 5FEXA 2Z00A 3W7LA 1J2BA 1JULA 4CQAA 2V63A 3WNNA 2WHMA 1DIKA 1SPQA 4PCNA 3LMYA 1EJUC 2PDPA 3LLFA 4QQ3A 4TX6A 4CU8A 3MWCA 1AQ0A 4GRSA 2CCRA 1FQ0A 5E1QA 2OKTA 1RY0A 1F8WA 4ERAA 3L5AA 4N9BA 1UG6A 3M0HA 5AC4A 3FA4A 1YEYA 2VC5A 1FUYA 4XZNX 1H09A 2WJFA 3IC9A 3ALFA 4H4SA 1TRDA 4PEEA 2WK2A 3HF3A 1B1YA 3KP1A 4RPPA 1UYQA 3QTPA 3C5QA 3KBMA 1TJRA 3NQ8A 4GCXA 3IIXA 5I02A 5A95A 2W0HA 1RD5A 1WZKA 2CYGA 1H6VA 2WSRA 4XVDA 3C6CA 2GGJA 5CXPA 3B0PA 1EQCA 4V33A 4PR4A 4UFIA 3WLKX 1T0OA 3PZGA 4LUTB 4DI9A 1W2PA 1P5BA 4RX0A 3AUJA 2ADAA 3SCTA 3H12A 5I3IA 1VP5A 2C3ZA 5KTLA 4WZHA 4D9PA 2V8ZA 4B5VA 3PWAA 1D3GA 2V82A 2DH3A 3O07A 3QEZA 7XIMA 4FNTA 2H3DA 1UCWA 7TAAA 4YHEA 1KKOA 2ZWZA 4DWSD 3D9XA 1QI5A 4UNIA 3RNDA 3EWUA 3EDJA 4AD5A 3ZLHA 1FH8A 4X9YA 2ZRWA 3VNDA 3HPAA 3WN6A 3SY1A 4CD7A 4REQA 2X40A 4U31A 1EZWA 1XUUA 1C29A 5F4WA 5TBOA 1H2IA 3MKKA 4O13A 5D9NA 2FMNA 4MWAC 1CGTA 3UESA 4P5UA 3MV11 2QCDA 4Q6XA 3AZSA 3WDHA 3VNJA 4GLEA 3TC6A 1XWYA 3TZNA 1JROA 4O52A 3MBDA 3MB9A 1PL9A 1QO2A 2GSHA 3OVRA 1X39A 2ZUMA 3CQHA 1MW1A 4CD6A 5BOEA 3ALGA 1PIIA 1KGUA 4HMCA 1NEYA 3SUWA 3W24A 3RITA 4D8LA 4TUFA 3LNMA 4RDZA 3RRXA 4CQCA 4DY1A 4LVAA 2V5LA 3UPBA 1W3KA 3UWVA 1X6NA 1GVSA 2QIIA 1HFBA 4DI8A 4C60A 4LAZA 3AU2A 2Z26A 2Z4GA 4OWGA 2E6FA 1JDEA 1AH0A 1UR8A 2D0FA 1UUOA 1B4EA 1H5YA 5U1OA 3NDOA 1QMLA 1GGOA 2WSKA 4GMEA 2H3BA 1CZ1A 4W87A 4E4FA 4FA3A 3KLKA 1XC6A 1LT8A 3UZXA 1R8LA 2J7FA 2EQ8A 2Q8XA 1I2PA 4XZIA 4IFRA 4WRHA 4DJDC 2QLYA 2UBPC 3L67A 4QLLA 1HO4A 1UUQA 3OB8A 1PDZA 2QQ6A 3ZWTA 4WUIA 1I2OA 1XICA 2ZFAA 2V81A 3SCQA 3DENA 3GNNA 1EP2A 3WEZA 5TAOA 2O9OA 1SZGA 4Z1YA 3QFEA 3GR8A 1BYBA 4ATDA 4H01A 2YDSA 3P81A 1L6SA 1VQZA 1CPUA 2P88A 2ZZ7A 4YL2A 3HOJA 3B05A 4AXNA 3QR3A 4TVDA 1A53A 1EL3A 4DBDA 4TR9A 4AB4A 1H7NA 1WBJA 4OKDA 4KWOA 5DF0A 4WD0A 3I7QA 4KCUA 2PODA 2DIKA 3U2OA 3QR0A 3PG6A 4DUOA 4XTDA 3NSXA 4J3WA 4FIRA 1D9EA 4GFIA 3RN6A 1UC4A 1YPIA 1FWHC 2OB3A 4P7OA 4NX0A 3TR9A 2RDWA 1VFFA 3CC1A 3W25A 4EANA 2XFRA 2VDHA 4GJ1A 4UMCA 1VPYA 1QPRA 1BAGA 4JQ3A 2ISVA 1I0DA 3ES7A 2DW7A 4Q4MA 4W7VA 4OUEA 1RQEA 2B4GA 3UWYA 3THQA 3TWBA 3FAXA 4MDOA 4MJ2A 1F8IA 1V3HA 3CQJA 3UU0A 2IQ0A 4EMWA 4UB9A 3BDKA 4S38A 3BXWA 2BVTA 4BFAA 5KETA 2YB4A 2VEKA 4HNNA 3RHGA 3ABSA 2HDJA 1OGGA 4M81A 5C7VA 3AICA 3TIMA 5JH1A 3FDKA 2QIWA 4M3PA 4JR5A 4NJHA 5MHBA 3QV8A 3A4JA 2CZVA 3VD7A 3VIFA 3S5ZA 4IZGA 4D8AA 2PRMA 1KM3A 1CWYA 4H4IA 1TTIA 3AIRA 4LVDA 1C8XA 1JRCA 1CGWA 1CDGA 1S2TA 3HTWA 1O1HA 4FP1A 2YDQA 3TEVA 2PZ0A 4JTHA 3KUMA 4TVYA 1M01A 4H7VA 3ORWA 2Z1XA 4RDYA 5FF0A 3RU6A 3WD1A 4J3SA 3ZT6A 3TNOA 3GK0A 1RPXA 1OYBA 4L9YA 3RILA 1ICSA 1B3WA 3DFNA 3EPOA 3DHPA 1ZJAA 2GJLA 4I5RA 1L6GA 1ZAHA 3NCOA 4S3GA 1K7XA 3G8EA 3LDVA 1VRXA 3NFUA 2J7EA 5A6MA 3ITVA 3KRZA 1EJVC 3K5XA 2V5DA 1VFOA 5LA2A 4XBKA 3E2QA 1KFJA 1WCGA 2WVUA 4UQDA 2X1UA 2PS2A 4YYCA 3W6LA 1HTIA 2WNZA 5I3FA 5EFFA 4QFUA 3KFTA 4BWLA 4FX7A 4AHPA 4F3HA 3WJSA 1IT7A 3PBGA 1OCNA 3PJUA 1T7LA 1WPCA 4GJIA 2Y89A 3LI1A 1LBLA 3H21A 2FYMA 5TQLA 4IUOA 4X61A 4GGBA 2GLKA 4HA1A 3N25A 3OQ8A 5FSDC 2D0GA 1R0MA 1VYRA 2ATMA 3VGEA 1DIDA 3EOEA 4HOWA 2YCLA 3QYQA 1EHNA 3T55A 3S4TA 2C0HA 3CAQA 1C93A 2G96A 3TXVA 4X0NA 4RNIA 4UTTA 5C8BB 1BRLB 2Y7GA 5LYRA 3BGJA 3CUJA 1GRAA 1Q2SA 3W71A 1J5SA 4S39A 3CQKA 1PXGA 5B7YA 4AD4A 1ZY8A 4B3LA 3LSCA 3F4NA 1ZBWA 2D2OA 1EO5A 1W1TA 1NU5A 3PUGA 2YDRA 3NWRA 1H0IA 1F73A 1MZHA 3UY8A 3M6YA 4FAMA 4PTDA 3RLVA 1ZJHA 4HN4A 4IPLA 2O4MA 5XINA 3R13A 1CX9A 5LIXX 1OSEA 2X09A 1U2YA 1J10A 1O60A 1TPWA 1ICPA 4LUYA 2PUZA 2E1WA 2PU1A 4U3AA 3UYCA 4LF2A 4XZLX 4OJYA 5T91A 4W88A 4WQ6A 5K3VA 1CXKA 2FMOA 1E0VA 2XSXA 2ZRUA 2DU2A 1V5XA 3DUGA 1EF2A 4K7YA 4KESA 3TFXA 3URAA 2AL1A 3TU9A 3R7MA 4AU0A 1B4KA 4JYFA 2J78A 2WC4A 1WE5A 2OYKA 2I14A 4J2PA 1KQYA 4DIAA 4W7WA 3L5OA 2ZRXA 1ME8A 3CQIA 2XH4A 3QV6A 3DGRA 1NOWA 4J3ZA 3GTXA 3D6NA 4UTFA 5LIWX 2PDMA 3DERA 3WEMA 4B2DA 3NQ2A 2AQVA 2YDAA 1ALDA 4W5UA 3ZLFA 4EXBA 2XVNA 3A22A 2ZZCA 1XSKA 2AKMA 1E40A 5A6JA 4PSRA 1QPNA 2F9RA 1JZ4A 1X7FA 2XH0A 2V3GA 2GDQA 2G97A 3VXGA 3AROA 3OZOA 4GY7A 3N2BA 3TCSA 3A3HA 5CC3A 5AB3A 5LSMA 3HG5A 1BVNP 2JKPA 4J9JA 3LGDA 3F2DA 4H00A 2QCMA 5AC5A 1ZHAA 5FJUA 3WDQA 3DH9A 3GHTA 4GXPA 1M5WA 1NOUA 1DIOA 6XIAA 3ARRA 1NFPA 1DWGM 1GOKA 1XANA 2VURA 1MSSA 1CLXA 4IFKA 4Q4QA 3UJ2A 3ZJKA 3W02A 3CUIA 1K8ZA 3LCXA 3OBKA 3WMSA 3MYOA 1X98A 5FCZA 2GDUA 2FTWA 2V5JA 3V5FA 1KRCC 3RU8X 4AY8A 1CXFA 4Y8FA 4QEEA 1J96A 1XL9A 1UUMA 1JPIA 3DK9A 4WCJA 1XLIA 4MPKA 5CC5A 4RKAA 3QHMA 2YFNA 2V67A 3H2MA 3AYRA 1F8MA 4B9ZA 3FHQA 4L4MA 1QPKA 1V3LA 3SI9A 1Y65A 4O0KA 1SSDA 3WJYA 3IIPA 3QVQA 4MB1A 7CGTA 4HNVA 1CT5A 4HMDA 2INEA 1PKYA 1ZDLA 2AL2A 1TFVA 4Z2KA 3M0LA 4HZ8A 1EDGA 3DYPA 1W17A 1E6RA 2Q8ZA 3MMTA 1WA3A 3VA8A 3PFMA 3ITYA 3WH8A 2W61A 3BPWA 2PLKA 2Y70A 1WDQA 4P7QA 4I5UA 3TDFA 4LSBA 3OC4A 4I6KA 3WCZA 2Y24A 1VYPX 1GW1A 5JIWA 1O1ZA 2ZUUA 3WUFA 1W9XA 2OELA 5KZEA 5CH9A 1A3HA 2WC3A 4GNJA 1U33A 4JDRA 3A13A 2QMJA 6ENLA 5BOOA 2J3NA 5HR7A 5FJJA 1P0KA 1OY0A 1DJGA 1JCLA 3HQPA 2NWSA 1PTDA 2W92A 1WXYA 1TVNA 3VUPA 3WNLA 2GVGA 4WY0A 3MO7A 3AYTA 1MO0A 1A5KC 3IIOA 3DJGX 3RRAA 5ABFA 3CPGA 3GBDA 4U10A 1M41A 3GTHA 1D2KA 2IQTA 1BXBA 4KF1A 4A8NA 3W7RA 4IIBA 3SUTA 4Q8TA 3WY1A 4GZIA 4WXYA 1E0TA 2W54A 4HQVA 4JKMA 2DSVA 4HP5A 1TO3A 1PIGA 2L5HA 3CZEA 1FFUC 4MHBA 3A9BA 1Z8AA 4NNCA 4WXZA 2DV0A 2IPFA 4O18A 3VDGA 2X99A 3WK2A 1LORA 4DQWA 2XVPA 3H70A 3IUIA 1EJTC 1JEHA 4XUYA 4PULA 3QFBA 4GPNA 1FEAA 4ZVJA 1R3VA 2QUTA 4XD4A 3W2LA 2JGYA 3E2VA 1OGSA 1EA9C 4UQCA 1WQ5A 1V79A 2NPXA 5BNKA 3FNDA 3SUSA 4O8RA 4PUUA 3C4UA 1SR9A 4C6BA 1J8VA 3IIZA 3ATZA 3PC0A 3UJSA 1C8YA 4E4PA 1TUXA 4KEUA 1EX1A 2X41A 3DESA 4RCXA 4OFCA 4GIRA 1GVRA 3BG9A 2WP6A 1V3JA 1XLDA 2O56A 4DBUA 4D6HA 3KOFA 1PS9A 4EF8A 3H4KA 2OYMA 3GHSA 2NQ5A 2F2KA 1KXHA 3WLJA 3GVRA 2Y62A 2QDHA 4LVGA 3NZGA 4PMNA 4AF0A 3R25A 4FB7A 1K7EA 3UXLA 2CBUA 2WBGA 3VDCA 4NP7A 1G01A 1D3HA 2B7NA 4EAYA 2CNCA 3NVTA 3P6LA 1UD2A 3R89A 2PDHA 5J04A 3IV8A 3EMCA 3FAWA 2V5CA 1EGMA 3XIMA 5DANA 4CEXC 3L7RA 1GVQA 3LA4A 4L6DA 1RM6B 4KKXA 3VIHA 1EBGA 3RCYA 1B5TA 4GI6A 2EEXA 3TAOA 5FL1A 3CV6A 1MW2A 4HK6A 3HJEA 3GAKA 3QLDA 1XYCA 3DG3A 2FVKA 4WEVX 2BGSA 2QUNA 2QGYA 5F2MA 4V15A 2EPKX 4PB3A 2OO0A 2ZX7A 4WDWA 5LHFA 3FLUA 3O3RA 1V6XA 5AHIA 2ACUA 4L4OA 3LERA 1VEOA 3LU2A 1JGMA 1W1IE 4LYPA 3ID7A 2OO6A 1B54A 3W86A 3KVJA 3HMCA 3C3NA 1SYTA 1U1HA 1FKWA 3P0WA 1TJ0A 2E9BA 1JPHA 4NZCA 3OTRA 2ABAA 2ZVRA 1T41A 5J5RA 3PR2A 3IVUA 2ZADA 1VLWA 3IVSA 4Y9OA 4CCEA 1WAUA 2CXGA 5FF3A 1HKJA 3TTOA 2A85A 4GZJA 3E2SA 1SFSA 2WMJA 3G1RA 5LIKX 3NPVA 1QK2A 1E0WA 3QZEA 3MI2A 3NQCA 3NM3A 3VNIA 3ICJA 1EX5A 4FXRA 3L5MA 2DIEA 4H4QA 3K4AA 4DZ5A 3L66A 3EX1A 3EDFA 4K36A 3WBXA 5CPNA 1RCXB 3BCJA 1E70M 2YCKX 3GFZA 4XBJA 4TTGA 4IISA 2VRKA 1SR0A 3VNYA 1MQPA 1XYLA 1GEUA 1VB9A 4H9XA 1JZ6A 1FHLA 5ER0A 2VR2A 4S3FA 1SFTA 4NAEA 4IPPA 4JHOA 3BSGA 2VDIA 1SSGA 2WMFA 3RPTA 1UD4A 5JBFA 3AS0A 1Q6CA 1TZZA 3ZXWA 2BCPA 1C8VA 3LCFA 2BXZA 3CMGA 4GNKB 5DO8A 4FNPA 3VC6A 3HV8A 2J62A 3TJIA 2DSZA 4GYPC 3VD5A 1E1EA 1GESA 4XVEA 3B8SA 1LUCB 3R94A 4K37A 5LA0A 3KZSA 2WSYA 4FR6A 2XM2A 2QGHA 3NSNA 3PWGA 4HZMA 5I00A 4WDXA 2JIWA 2NVCA 3CYVA 4DBSA 4Y9NA 3EKGA 2V0TA 3M43A 1GOQA 3VGHA 1GRFA 1SMAA 1FBAA 2PPGA 1BWVA 3KBWA 3MWAA 4W84A 1DYSA 3I6EA 5F1VA 4DELA 3NEHA 3TV8A 4JQ1A 3ARTA 3OO2A 4KCTA 3SSJA 3HPZA 2V9DA 4OBRA 1JR1A 3WQDA 3CLMA 4GY1A 4OUIA 1TUFA 4HD5A 1VENA 3U5YA 5EGRA 4XG1A 3VABA 3H4WA 4HA4A 3WLSA 4D71A 5BXPA 1DPMA 5HJLA 1SJBA 3DKLA 4PGLA 4DUXA 1VFUA 5H8PA 3V1PA 4PTVA 5AC6A 2BY3A 4B5TA 1X2GA 2A3AA 1NQKA 1TVPA 3BH4A 3GBEA 2ACRA 2Z6JA 3OQEA 3RM4A 5CLWA 5IDIA 1S38A 4KPLA 2D23A 1Q6RA 1JCMP 3OJGA 4M19A 3DI1A 3NPUA 5DMYA 4GYFA 2VWSA 3B06A 3N04A 4NHVA 1E6XM 1QBAA 4EPEC 2P76A 1JJKA 3ZQ9A 3P7YA 1KW1A 3V4BA 3CWOX 4L4PA 5F7UA 3SEPA 1NWUA 3E96A 3QV9A 3O6YX 4RPQA 3NGFA 4CD8A 2IQDA 4GX9A 3UETA 1XIIA 3TROA 5KZMA 4ZGYA 4YCPA 3ES8A 4MB3A 3VKKA 1UD8A 4XQ6A 1YPXA 3JUGA 1TPVA 2NUXA 1C8QA 3BAIA 2HE5A 4WK9A 1W9BM 3EDKA 3E9AA 3MTWA 1FIQB 1DQWA 1JYXA 1W0MA 4KIRA 1GZGA 3FKRA 1OADA 3VAVA 3RYSA 3H7RA 2ZOXA 5DXYA 3EWDA 4IX0A 1RPKA 4C6DA 2HNHA 5ECVA 1YXCA 3FEMA 3WELA 1FWEC 4V27A 1KFBA 3PJWA 5REQB 2QJHA 1F3EA 3BURA 3GQYA 1XLEA 4MLRA 1AQMA 3VIGA 2PF8A 2ZICA 5LIUX 4MYXA 5CJNA 2YIHA 2BG5A 1EEPA 3SSZA 1VIWA 1LROA 1IXQA 2GH5A 3GG7A 1T99A 4M52A 4KRZA 5I5RA 4LC8A 1E4NA 1KTBA 2R9ZA 1RR2A 1WKDA 1GHRA 4UTWC 1IR1A 3BAYA 4CU6A 3S1UA 5DELA 2X8CA 1NWSA 1W1VA 2PDFA 4HNTA 4XIMA 3IJIA 1FWGC 4AXKA 3UWUA 1Q6FA 4XSMA 3CHDA 4GD0A 1A50A 3UR7A 2ZXQA 1IEVA 5HXMA 3V16A 4JTCA 3UEQA 1AZ1A 2O92A 5IBXA 3Q37A 5IOBA 1HXJA 1HP4A 4NKCA 1EDQA 3AU6A 2UV8G 2P1FA 4N4QA 1YBQB 2OODA 2J7HA 1ML1A 3EXRA 4BI6A 1NP2A 1P6CA 3BG3A 1QATA 2VD9A 3AXMA 1FWRA 1J79A 4B5NA 3NZ1A 4TIMA 1XLGA 3LQGA 2I17A 1UMYA 3N2MA 4AZIA 4S3EA 4R88A 1CGUA 4L4LA 3E0IA 3IJLA 2XSBA 3UA4A 2BY2A 1RP8A 1KCLA 2ZZ6A 4HMNA 3C86A 4QJ5B 4YS1A 3W74A 1H62A 2PI6A 3PHAA 2ZZBA 3CUFA 2WC7A 5H6HA 1JRBA 1KFKA 3HRDC 1KC7A 3Q4DA 4DO4A 1OYAA 1PUDA 4FXJA 1R3TA 4HCDA 4QS6A 3LM3A 3AXIA 3LSBA 3OA5A 4DJFA 5D9OA 2XN2A 1Z32X 2PDJA 1OCBA 4P7NA 2VZOA 1LM1A 3LXAA 4JCLA 2OGJA 2GL5A 1Q4WA 2ZX5A 2Y5JA 2QCFA 2ZYFA 1KTCA 4UR8A 4FOUA 4ERGA 3PZTA 5E09A 4GY0A 4B92A 4MUZA 5IM51 1PWLA 3BWWA 1QRQA 1KA9F 1Q7ZA 3ZZ1A 3F4VA 3PB2A 1QU4A 5JCMA 2NT0A 1DJNA 2C14A 1EPXA 3BOLA 3GG1A 5D04C 2REQA 2VCCA 3POHA 5I7GA 2QJMA 4DEFA 2DZXA 1IXOA 3OGRA 1R7AA 2FZNA 1ONWA 1JL8A 4ZZ9A 1GOXA 2FFIA 5BOFA 2WOQA 5MKGA 4HYWA 1WDRA 3VPLA 1LL7A 2J77A 3PZNA 1UZ4A 3A4WA 1PBGA 3UG5A 3AIUA 4M24A 4FOKA 3N2CA 3OLIA 3NA8A 2YL8A 3B0XA 4MWAB 2DFAA 2R9RA 3ANYA 3UA3A 3KP0A 3CV2A 1A5CA 5BMWA 1G69A 5HDRA 4ZBCA 1A4LA 2XZ7A 4A05A 4GOAA 1PJ9A 1TJPA 1V3IA 3S2CA 5FOOA 4APNA 3WLTA 3CLWA 2OX1A 3WQ4A 1F4HA 5LGZA 2AGKA 5DEZA 5TD4A 1SB3B 4A8LA 3MKVA 2HVMA 1ZPTA 3CB8A 3OLEA 4LRSA 4GJJA 2WPGA 1UZHA 3QPEA 1J0JA 5CSUA 1FCBA 3H4GA 4X60A 3O0FA 1P4CA 4L80A 1XGEA 1ZY9A 2WJDA 3PTMA 3MQTA 3E2RA 4O11A 1FFVC 3MSDA 1NFBA 3SN0A 3UERA 1BWLA 2VR4A 2WZMA 1DE5A 3AS2A 3NQVA 2X8GA 3ONCA 1AJ2A 3WLMA 3LHTA 1R85A 2BGNE 3NR0A 3W72A 1T8QA 2VTFA 3QF0A 2EO7A 3TFCA 4UOQA 4N9EA 3VUSA 3N34A 1RVKA 3G0UA 4Z2IA 3OBEA 3M0VA 4IPIA 3EZ4A 5JCKA 2D3LA 4M0XA 4E3TA 1QR7A 3W3OA 4OVXA 3EWBX 2WMIB 3M0KA 3LD5A 3QMSA 4CQBA 4GACA 4O1AA 3LCHA 1XIBA 3ARSA 1TQXA 2ISDA 1LDCA 1GEHA 4HHMA 4C6CA 4C6FA 1PEZA 2WKJA 1T8XA 1O5QA 2FLIA 1EXBA 2GR0A 1E9ZB 5BROA 2NX1A 3W7IA 4U28A 3IRSA 4AZBA 2E6YA 2VZTA 4W5ZA 1LVLA 1WXZA 4HOZA 2A3HA 4O14A 1AODA 1OWQA 4MOZA 2NQJA 2TYSA 4JIHA 1IWBA 1S5TA 2QCDB 2HXTA 4Z2GA 2A7NA 1F4AA 2PLJA 1R87A 4ZCWA 2ZZ1A 3KX6A 2XVGA 1KBJA 4WHBA 4R3UA 3UP8A 3C8FA 1R7OA 1Q65A 1RK5A 2BSLA 4DNHA 4GVHA 1HZYA 4Q7IA 4UNKA 4GUJA 3E02A 2FTPA 3S42A 2CHOA 3AOFA 1GCYA 3A3XA 2GGEA 2G3FA 1E9YB 2RDXA 2DJLA 4K38A 2NV9A 1N63C 3FG2P 3ANVA 1SMDA 1XHGA 3CHVA 4RZ4A 1QOPA 4HHHA 2BBFA 4UXDA 2XGZA 3W1QA 1GZJA 4CQDA 1NQ6A 3GY1A 4J2MA 2PLCA 4IG2A 4IMEA 3M5XA 2WANA 3UW6A 3WYZA 5K4XA 4AD3A 4H8NA 3FGCA 2QVNA 3S2JA 5HPOA 5JBDA 3PZUA 2DUAA 1EJ7L 3TQKA 3WDRA 1JXKA 2BV9A 4NASA 3B9OA 1N55A 4B4HA 5I6SA 4JXCA 3ONBA 3UWQA 2GZXA 1TPC1 4IJRA 4BF5A 2P50A 3ARZA 2AGTA 2XIIA 1VCVA 2OT0A 4RXGA 4LAKA 3Q65A 1NHPA 1K1DA 3OOQA 2WSPA 3QC0A 3FHAA 3CIWA 3SFKA 3OG2A 5E70A 1V8EA 3AUOA 1US3A 4KQNA 1KBIA 2CXEA 2YL9A 5XIMA 3TH6A 3GZ3A 3BV4A 3KW3A 2WQDA 1MNZA 1RV8A 2NT1A 3IJ8A 3W83A 3IANA 4ZEPA 3P8JA 1K9TA 4FLSA 4LYRA 4UTIA 1JAKA 3VKJA 3BTNA 4O1EA 2YBVA 2OFJA 4ICCX 3MI3A 4DJFD 3EDDA 3T2OA 4EPBC 3PZQA 2PMQA 1H1ZA 4QDPA 3W1AA 4M5PA 1VCFA 3ITLA 4MFEA 4P7RA 2VOTA 3C0QA 3NQBA 3OHMB 1TMLA 2UY3A 5D8ZA 1J9YA 3GH4A 5C9XA 4IFOA 1XH1A 1KWKA 4RNJA 2DEPA 4HU4A 3D47A 1S2UA 4IMGA 3IS4A 4FALA 1Q7MA 3AIEA 5LNVA 4KFNA 3QTGA 4HK5A 1CENA 3VK5A 3EEZA 3UJEA 1RVGA 3MUCA 1TSIA 1A0CA 3E49A 2RDUA 5E6YA 1F3XA 4FXFA 3RMJA 1WNOA 3CZ8A 2NZLA 3DCPA 1JF6A 4TO8A 4LUSA 2GQ3A 3E38A 4DZIA 3GU9A 3GC2A 3VNMA 2W79A 1EUNA 4RJEA 4NF7A 3U57A 4GRTA 2G5WA 2YCIX 3BMXA 4PTWA 2WWCA 1LLWA 4LV4A 3CHCA 2ZWYA 5CPOA 4IMFA 1MNSA 3CHFA 3U0HA 2HS6A 3W7MA 1R9ZA 3OZYA 1F3WA 1E56A 2QUVA 3LRMA 3RIKA 4JD4A 1R3YA 1IZCA 1NH6A 3TN3A 4KGJA 4Q8VA 2J75A 4OOUA 2PC4A 1UH3A 4C6EA 1XLMA 4ERIA 4AIOA 1D7YA 3SN4A 3CYJA 3TNBA 1XRTA 3DHUA 2V3BA 4NNAA 2J7BA 2GUUA 2Z27A 2P10A 4RZBA 4CEUC 3E3HA 3K8KA 3V5CA 2A6NA 2FVLA 3F5KA 4G6CA 4DF1A 3M5YA 4O28A 2B7OA 2GJRA 3PBUA 4F79A 3ZOAA 2F7FA 4FZIA 1OB0A 1VBRA 4Y2WA 4HTBA 4K3ZA 5EBAA 3VX1A 1S3HA 3JVAA 2ZTJA 4PFMA 1IZJA 1VC4A 1Y5XA 3EX3A 1TE1A 3GW0A 3EA3A 1XRFA 5MF5A 3VOCA 1VQTA 3N2TA 4L56A 4DYEA 1PTAA 4KEVA 2HWGA 4QG8A 2Z1VA 3QY7A 4AZHA 4A3UA 4H4UA 1GHSA 2A0NA 5CGQA 3VCRA 4DJEA 3TK7A 2QJIA 5A6BD 2HISA 2Q01A 2RJGA 2YVFA 1CXEA 4Y7EA 4UQ9A 3TONA 1ZAJA 3KOYA 1E43A 1YX1A 1ZFJA 4CN6A 4DPPA 1NF0A 1TX0A 4EQXA 2FQIA 1Q85A 1K4HA 4HB7A 1JDDA 2CHRA 5ABEA 4AMCA 4I3GA 3THDA 3BAJA 4DYJA 3NNTA 4HPXA 1A5OC 2FPYA 2J7CA 4J3UA 3M64A 5U25A 1KGWA 4LJ3A 1DJIA 4UTJA 3W4RA 3KRSA 3RLGA 3G1DA 1SVDA 3TTSA 1QNOA 4KFPA 3WF3A 4LCSA 2GWNA 1E1CB 1TMQA 2OWXA 3MYPA 3TYAA 4GUIA 4EQRA 3QYSA 3BZGA 4KFOA 2ZZ5A 1L8NA 1REQB 1OT2A 4M56A 2PWUA 3BW3A 3KLLA 2C8NA 2XFYA 4IMCA 2ANUA 3VIJA 1N8IA 3QH2A 3GG0A 2H6RA 3W38A 1TIWA 3HPSA 3APTA 3T1GA 4QROA 1V7YA 4GG9A 1C7SA 1ELSA 2BVDA 7ODCA 5I3HA 1JDCA 3GKAA 1DJZA 3EUB3 3W85A 1WUFA 3VOHA 2YOCA 4TVCA 2A2IA 2OLSA 2V3AA 4JIQA 2WZTA 4O1CA 5DT7A 1KBBA 1H5VA 2OJPA 2Y2WA 4ZB2A 2BXYA 3GNRA 3T7VA 4CVUA 1UWQA 1XLAA 5DX7A 4FEZA 3IJ6A 4TQTA 1THFD 5ENLA 3S47A 4PMYA 1D7KA 1S5VA 2Z28A 3CBWA 2YSWA 4WKFA 1BTCA 1XYZA 1EB3A 4UBPC 2A21A 1LQ0A 1P7TA 4OV9A 4WLCA 3WBEA 3B9DA 4A29A 4MNMA 3H55A 9XIAA 4LVFA 4RZ6A 4ZB5A 1K7FA 4X0VA 2VEPA 4FOJA 1TWDA 3E5BA 4QR6A 4ILSA 4WSHA 3A5VA 3C56A 5BRQA 3I6TA 3WK3A 2YA0A 2QKFA 3IK4A 5IXEA 1OM0A 1SJDA 2CITA 1S7MA 3A23A 3B8WA 4W4QA 1HN1A 4G2DA 4HJWA 4ADSA 4C6PA 4HZ6A 2DUZA 1R3QA 4A3RA 1GSNA 1S5MA 1N5XA 2R1LA 4FXSA 3TZFA 3BOFA 3GXTA 5FF2A 2E68A 4HNCA 2O7QA 3VU2A 4BF9A 2FFCA 2GQ8A 3C2EA 3MSRA 1ISVA 4TVUA 5FF4A 1E15A 2HROA 4D6JA 5M03A 1US0A 1DWAM 3U3HA 4QAWA 1XRVA 3HG4A 3R1ZA 2E5CA 3T9PA 2DVXA 4LANA 3DN5A 3V18A 1GYMA 1KFEA 3G2GA 4UTLA 4S2BA 3WLQA 3R8RA 1L6FA 1KRMA 1BVZA 1LCOA 2AKZA 3CK5A 5G4EA 5SWUA 4ML4A 1OFRA 3PK7A 1F6KA 1JI2A 3QFWA 3F2CA 4XAFA 3RM9A 1YNPA 3AXKA 3CPRA 3JR2A 2E5BA 4FPSA 1ISYA 3VZYA 5AYYA 4KBXA 4R34A 2EKGA 3UR2A 5A8MA 1F6PA 3S0CA 3TW6A 1HUVA 4H4XA 2WJEA 2FGLA 1F5ZA 2GOKA 4D6EA 1Z9AA 4PMVA 4Q7NA 4JL2A 3R07C 2C18A 1LL4A 4IGMA 4C5ZA 4W9TA 5EY5A 3U2CA 1JI1A 1KNWA 3WENA 2SFPA 3SM0A 2XWEA 2WNNA 3EMZA 2HPMA 4L6OA 4ZOEA 2C1HA 6REQA 2FPVA 5C2XA 2E5DA 1GOOA 4QDWA 4ZENA 1S2VA 3UVAA 1W54A 1TYPA 1W5OA 3TMQA 1FFRA 2Q6ZA 3Q94A 3APGA 2ZX9A 4Q22A 1H4PA 1IIHA 1H1NA 1UIPA 2YCJA 4JTAA 4E2OA 4FX6M 1KV8A 4ALDA 4Y8EA 2PTYA 3VIKA 5ABFB 3E12A 1J0IA 2Z6IA 4R9XA 3TXZA 3TTQA 4P61A 5G2HA 4FIQA 3I7RA 5HAOA 4GI9A 3QRHA 1M68A 3ISIX 4M82A 2OT1A 2AQOA 1Y5WA 2G0WA 2W63A 1W56A 1V0NA 3GWQA 4LIIA 3VX0A 1LG1A 3JW7A 1Z7AA 3BO9A 3AHXA 5HINA 3L2MA 4LXFA 2CLFA 5HA7A 1VJSA 3KWXA 4M1BA 3AIWA 3DHFA 4MY8A 2WXDM 3NPXA 4AD1A 4K7VA 4L5ZA 4A2RA 4F2UA 1B3VA 4XKYA 4Q8NA 3M6DA 3DYMA 3MP3A 1YYAA 9RUBA 5FA5A 3MVTA 3LPFA 3WFLA 1TREA 3URHA 1FWDC 3MPGA 5HQEA 3O06A 1MOKA 3INPA 1H49A 2Y7DA 2FGZA 2FDMA 1OFAA 4O4WA 3PF3A 3W1TA 5D8WA 1XDLA 1HG3A 1SW3A 3BV7A 3HV9A 4D72A 2ICSA 1XJBA 4QLKA 3E74A 4ZXLA 3M9YA 2GR3A<