1BQGA

The structure of the d-glucarate dehydratase protein from pseudomonas putida
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
411
structure length
399
Chain Sequence
GAPVITDLKVVPVAGHDSMLLNLSGAHGPLFTRNILILTDSSGHVGVGEVPGGEGIRKTLEDARHLLINQSIGNYQSLLNKVRNAFADLRIAVHAVTAVESALLDLLGQHLQVPVAALLGEGQQRDAVEMLGYLFYVGDRNKTDLGYRSEHEADNEWFRLRNKEALTPESVVALAEAAYDRYGFKDFKLKGGVLRGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTKEPLQIKGGLVEVPKKPGLGVELDWDALMKAHEVYKSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the enolase superfamily: crystal structure of (D)-glucarate dehydratase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Glucarate
molecule keywords D-GLUCARATE DEHYDRATASE
total genus 129
structure length 399
sequence length 411
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 1998-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bqgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bqgA01
3DG6A 2OLAA 2PP3A 2OZTA 3R25A 3UJFA 3TWBA 4Z17A 2OZ3A 2QGYA 3R1ZA 3TW9A 2QVHA 2OG9A 2GGEA 2DW6A 4IL0A 3QPEA 3D46A 3STPA 4IT1A 1TE6A 7ENLA 5FJTA 2FYMA 5BOEA 5FJOA 2QDDA 2OQYA 2P88A 3OW1A 3FYYA 3OZYA 1MRAA 3V4BA 3ZLGA 3SJNA 3QKEA 3TQPA 3VA8A 1OEPA 2GGJA 4MMWA 3T4WA 3ZVIA 2PCEA 3K1GA 3CB3A 1TZZA 2GDQA 1W6TA 1IYXA 2OPJA 3MZNA 3UGVA 3R10A 4H2HA 2AKMA 3D47A 1FHVA 2CHRA 3R0UA 2I5QA 2DW7A 3ES8A 2ONEA 3T9PA 3CYJA 3DIPA 4E8GA 3P0WA 1ELSA 4IP5A 3TTEA 3FJ4A 2PU0A 3DG7A 2POZA 1BKHA 3SBFA 1BQGA 4GIRA 1PDYA 1KCZA 4Z1YA 3QTPA 3BSMA 3ES7A 4HPNA 2OVLA 4E4FA 4G7FA 1L8PA 3S5SA 2P0IA 2XGZA 4FP1A 4A6GA 3RGTA 1WUFA 3MUCA 3NZGA 4MGGA 2PSNA 4H1ZA 4X2PA 4M6UA 2OZ8A 3VCCA 1EC9A 3ZVHB 4HN8A 3DEQA 2QJJA 3N4FA 3UXKA 4MKSA 3TJIA 4E4UA 3UCDA 3ZLHA 3I6EA 4HCHA 2MUCA 3GY1A 3Q4DA 2GGGA 4GFIA 3I6TA 4GYPA 4K2SA 1EC8A 2PPGA 4GISA 4GYPC 4H19A 4IP4A 1MDRA 1R0MA 3CK5A 2QJMA 2PP0A 3SN0A 2P3ZA 1SJBA 4DYEA 1JDFA 2P8BA 4J3ZA 4KT2A 3TOYA 1FHUA 3H8AA 3JW7A 1ECQA 3U9IA 2AL2A 1JPMA 3UCCA 4A3RA 2MNRA 3MSYA 1KD0A 1YEYA 3BOXA 1E9IA 3VCNA 2QJNA 2NQLA 4E5TA 4IHCA 3GD6A 3EEZA 4IL2A 1NU5A 4JHMA 2P8CA 4JN8A 1R6WA 4J1OA 3QLDA 3RCYA 3H12A 1P48A 2XH2A 2OKTA 2PA6A 1EBGA 3P93A 3ZLFA 2PU1A 3OZMA 2AL1A 5FJUA 3TJ4A 3GC2A 2XH7A 3PK7A 3IK4A 2XH0A 3VDGA 3V3WA 2OO6A 3RO6A 1PDZA 1SJAA 5FJPA 3EKGA 1SJDA 3N6JA 3IJLA 3U4FA 2HXUA 4GGBA 2PMQA 2PGWA 1WUEA 3R11A 6ENLA 3NXLA 3R0KA 5J04A 3FVDA 1TKKA 4ZA0A 4HNCA 3UJSA 3N4EA 3DESA 2ZADA 3N6HA 3GO2A 1P43A 3ENLA 3DDMA 4YWSA 3DGBA 2PODA 3P3BA 3CXOA 3V5FA 3RITA 3SN4A 3IJQA 2OFJA 3VC6A 3TWAA 3UXLA 1MNSA 3OPSA 1EC7A 2PTZA 4DN1A 4KWSA 5FJRA 3PWIA 4DXKA 4GMEA 4M0XA 4E6MA 1JPDX 3PFRA 4A35A 4DWDA 2GGHA 3VFCA 2XSXA 3I4KA 3DFYA 3IJIA 3FV9A 3CT2A 2QQ6A 3JVAA 3SSZA 3V5CA 4HYRA 1NELA 4K8GA 3H70A 1JCTA 4DX3A 2FKPA 3JZUA 3VC5A 2PP1A 3HPFA 3UJRA 4JN7A 1RVKA 3SQSA 1KKRA 4IZGA 3DERA 3RR1A 4KPLA 2OQHA 4GGHA 3T6CA 3FCPA 3Q45A 3UJ2A 3MWCA 2PTXA 3THUA 3RRAA 2QDEA 3SN1A 5IDZA 4KEMA 2O56A 4HCDA 3DFHA 3PWGA 3OTRA 1F9CA 4G8TA 5ENLA 2HZGA 1MDLA 3NO1A 2HNEA 2GGIA 2PGEA 2RDXA 3S47A 4ENLA 2GL5A 1XPYA 2XH4A 1MUCA 3H7VA 2PTYA 4F4RA 3UJEA 3TCSA 1DTNA 1XS2A 4H83A 3ZVHA 2OX4A 1ONEA 2HXTA 4EWJA 4HCLA 3OP2A 3MY9A 1SJCA 4ROPA 2GSHA 3CAWA 4ZCWA 3KUMA 1KKOA 2AKZA 3DG3A 4K1WA 3NFUA 4FI4A 2PS2A 3T8QA 3MKCA 3B97A 3BJSA 2AL2B 1EBHA 3QN3A 5BOFA 4DHGA 3MQTA 4HNLA 2ZC8A 3FXGA 5EU9A 2PTWA
chains in the Genus database with same CATH superfamily
3O0HA 3NVTA 5BMXA 2WK2A 3ARXA 4CD6A 4DJFD 4NIRA 4Q8MA 5K4ZA 3M0VA 3CWNA 4B3ZA 4QP0A 4DEFA 2WOWA 2GGEA 1Q6OA 4CNUA 3PWAA 1S7MA 3T2QA 1PIIA 2Q8ZA 5JCIA 1OG0A 4KCVA 4HA3A 2YB1A 3DFPA 3LHVA 4PB3A 3WD0A 4B2DD 1M65A 3V4BA 2Y6ZA 1Y8BA 3KCLA 3UY8A 5CBIA 1W5QA 4MMWA 3URNA 4HNNA 4CD8A 3H2OA 3PP7A 4H8NA 3MDUA 1OINA 3NZRA 2HSAA 2GDQA 1W6TA 1H7RA 1DV7A 1H60A 1KCXA 3S2MA 1GRGA 2Q3OA 1FXPA 1MNZA 2VDIA 1O66A 1LLOA 1O68A 1CIUA 5HPCA 1HTIA 2Y5JA 3NEVA 4UQDA 4ADSA 4E8GA 1GCYA 1WZAA 3EF6A 3FNDA 3PVFA 4AIUA 3IWPA 3G1FA 4IPLA 1L2QA 2C71A 4K8DA 4AISA 1HZYA 1K8ZA 3Q58A 3M5ZA 4CNNA 2VZVA 1FWSA 5J5RA 4S3JA 3W1TA 1KBIA 5HJXA 1XLAA 2VGIA 4P7RA 2R1LA 4Z1YA 3CO8A 1F6PA 2Y62A 2XVLA 4LANA 2ZTKA 3N2BA 4WIWA 1HVQA 2XM2A 3NVWB 1BHGA 2KZHA 4H9YA 4NF7A 3W75A 3W7JA 3WMBA 1U1HA 3KBNA 3UPBA 1JF5A 3XISA 1KW1A 2DZSA 1E4MM 5LYRA 2W3ZA 4OJYA 1JVNA 4C6BA 2NSXA 2J7HA 1A53A 2ZICA 2B7NA 3T40A 4LVDA 5F2IA 3GBEA 2GDVA 3W74A 5LXEA 1L9WA 5E0FA 3ITTA 4Q6XA 4Z2KA 4HPGA 3RX2A 2BSLA 1PO9A 5LHFA 4JTUA 2DSZA 4I6KA 4DPQA 1A4MA 1TPWA 3S5NA 4HNTA 4MJ2A 4OV4A 1XC6A 3LCXA 4QCFA 5EGRA 2C79A 5C9RA 4GRTA 5EMJA 2BGSA 1R0MA 4C6FA 1UD5A 1KGXA 4HK6A 4H01A 2XFFA 3A4XA 4KT2A 1FDJA 3WNKA 1E0VA 4DUXA 2PBGA 4FA3A 3R8GA 4LAMA 1IWPA 4G6CA 2KX9A 2MNRA 1KD0A 1YEYA 4CCEA 3D9XA 4W8AA 3SRHA 1ZALA 4CQ9A 1IWAA 3W70A 1ME8A 1NU5A 2JKAA 2YYTA 4PUWA 2R9RA 3GXIA 1WDRA 4J1OA 1GSNA 4PR4A 5A3HA 5M3WA 1VLWA 1LOSA 3WUEA 4A8LA 3SECA 2BASA 2FB2A 1YADA 1QK0A 1SZEA 2YCEA 3V35A 1OJXA 2OT1A 1REQA 1Q6LA 2WJFA 2WVVB 2YXOA 1A5LC 4DJDA 1W32A 3HZ3A 4Q4RA 1Q7MA 4Y9MA 5CPMA 2HXUA 4MWAB 3VD9A 5G1MA 2GUYA 1EIXA 2BHZA 3WNOA 4HSOA 1WUEA 2YL6A 3HV9A 4K39A 3R0KA 4CQBA 4DJEA 1YX1A 4HPXA 1DWIM 4X2RA 3UJSA 4JYFA 3O63A 2XFWA 2F2KA 4M19A 4NX5A 3W88A 5DO8A 1K6WA 4MY9A 5AC4A 1EJ7L 4WCJA 5FI8A 3GDKA 3W6MA 3DGBA 3EAOA 3AHYA 3VC6A 2W62A 2F8QA 3QR0A 5BXPA 3OPSA 1R3TA 1KLZA 3T1GA 1NAL1 3E9AA 8RUCA 4EANA 3B05A 4O0KA 1Q8JA 2E8ZA 2W6RA 3MUIA 4Q7NA 3AIQA 4IMFA 4GMEA 4NXKA 1DWFM 3CTLA 5AECA 4BF7A 3KE0A 5E70A 3LRKA 4NASA 2VR4A 3II1A 2P5NA 4OU1A 3DFQA 3U7BA 4PTMA 2VNCA 2WMHA 2H9AA 4NL1A 2Z1KA 5BU9A 1Y0EA 5IBXA 4XAYA 1K02A 5G4EA 3EXRA 3SGUA 4HPHA 2VUYA 4S38A 3L5LA 4WDUA 2TRSA 3WH8A 3VE7A 4IZGA 3W71A 4HMDA 1LQAA 3GG0A 2RKXA 3MUXA 1JPKA 1WDSA 4L56A 2ALRA 3W1XA 3GWQA 2ZVRA 2X1RA 3THUA 3SN1A 3DJGX 5IDZA 2E68A 1FO4A 3U3HA 3MI6A 3B9AA 2DZTA 1K70A 3KRBA 1OF6A 4ENLA 3IIVA 2X42A 5CC5A 2BXVA 3LDVA 2I7GA 1WKEA 4DF1A 3RMJA 1AMKA 5CC7A 1UMYA 3NA8A 1TRDA 1KBLA 2A3AA 2QLYA 4I5XA 1D7YA 3BK0A 3GXNA 3B8WA 3S3GA 5A5WA 3BZJA 1E43A 1SJCA 3N2XA 3C0JA 2D2HA 2RH9A 4B9ZA 5EA9A 1UPMB 4KEVA 3NYZA 2QMJA 4ZCWA 4BI6A 5M5DA 4GXWA 1RUSA 3WK1A 1TCDA 1XV8A 2ATMA 3GZAA 5HUOA 3JUGA 3HG5A 5HNRA 4B5VA 3WN6A 3WQDA 4GPNA 3TYUA 2WNQA 1ODUA 1TPUA 3B0XA 4RXFA 4IIFA 3A13A 2Z26A 4X9SA 2BFGA 2Z1WA 1FCBA 1CGYA 4H7CA 1TWWA 1KXHA 4EQXA 3QC3A 2V5BA 4UC5A 3WX7A 2NX3A 1O4UA 1FCQA 3UJFA 2VRQA 1F74A 3P0XA 1AQHA 2FVKA 3A24A 3LQLA 5CG0A 4LYPA 4JTKA 5CPOA 1YTEA 5A6AA 3M43A 1S3TC 3LNMA 4NAFA 4US5A 4PRRA 4FNRA 1SO4A 3DGZA 4O14A 1AH0A 3GFXA 7PTDA 2QDDA 2IKJA 1DJQA 1FH8A 3VDHA 3G8EA 3NPWA 1M53A 3C61A 1G5AA 1FDYA 4AY8A 4MFDA 2DGAA 3LERA 3O15A 4HIBA 1E9ZB 3TC6A 5A6SA 2OEKA 4JFTA 1EF2A 3UWYA 2JKPA 3THCA 3CB3A 4O4WA 3NPVA 5EBAA 3WH7A 3GTHA 2J9YA 4M29A 4DJFC 2ZFAA 2OELA 4W4QA 5K9DA 4WKFA 2WVUA 4KF1A 4KWUA 3WLQA 1VP5A 4C90A 4A8NA 3KWXA 1SR0A 1QNSA 1GZJA 1RV8A 3R7MA 4Y9PA 3WK3A 1SMDA 2C15A 5FKYA 4LAZA 3WLPA 2HVOA 2YA2A 3IVUA 3IRSA 4IMDA 1TRIA 2PLMA 3IIXA 3MP3A 2B0MA 2NLYA 3DZ1A 4Q22A 4LAKA 1ZLPA 4G5DA 1V6UA 2IKGA 2QR6A 3BSMA 1DHPA 3IV8A 5DBUA 1JCYA 3GZ3A 4NNBA 1DQUA 2DIEA 2QAEA 1VQZA 1L8PA 3W87A 3F2DA 1G4EA 3GU2A 4YHGA 1EGVA 2WMKA 3W6LA 3ZJKA 1BXBA 2GSJA 2ZDSA 3R13A 4QDPA 4V27A 3GNXA 4BQ5A 5E5CA 2YX0A 2E0PA 5PTDA 4EWND 4ZOHB 4PFHA 4O17A 4PMUA 2XN0A 2Z27A 1N5WC 4EK7A 2PDIA 4GRSA 2ZZ2A 1PPIA 3COTA 4IJCA 3ZJ6A 4I9JA 1D2KA 1TPEA 3OZPA 1E73M 1F3TA 4ZQMA 4L4OA 2X8HA 5TD4A 4ZENA 5DCBA 9XIAA 4HK7A 2YXXA 4UQEA 4A22A 5E6YA 1MDRA 1TA3A 4AHOA 4UOQA 1SJBA 2X0HA 1R86A 4TR9A 1FWCC 2ON3A 5XIMA 2OLHA 1QDSA 1H7PA 4N02A 3UCCA 1DVJA 1VBHA 3LK6A 4ZODA 3E5PA 4IL2A 4M80A 3LSCA 1RPXA 2PFHA 2ZE0A 3W3OA 3EXTA 4MUZA 4QS5A 1TWZA 2YZ5A 1LLZA 3AZSA 5ECUA 3KX6A 3FDKA 2INFA 5I7GA 4A29A 1PWMA 4MNLA 3HQ1A 4B5TA 3K2GA 2HQAA 1BSLA 4ZL1A 3TDFA 1S39A 4HJFA 2DDXA 3DI0A 2QW5A 1NOUA 1ZPTA 1PL9A 2D24A 5HQEA 4UQCA 3IJLA 3U4FA 3FHAA 1RSCA 1XI3A 4GO9A 4J5NA 3QY8A 2Z00A 3FVDA 1TKKA 1DL3A 2EXOA 5CPLA 2J66A 4GO8A 1OCNA 2WPBA 4QJ4B 4R33A 1F05A 3ENLA 5LNUA 3DHFA 4WDTA 1RY0A 3WJZA 1M68A 1ALDA 3CIVA 4Q32A 2CBUA 5T8GA 5CSUA 1UQZA 4KIRA 2VI0A 3IJQA 3KOZA 3WD2A 2DP3A 2Y70A 1FWIC 3WO8A 4A05A 3GH5A 3WMLA 4AZIA 1R9YA 3BVJA 4JCLA 4DXKA 4HBKA 4GY1A 2VGGA 2XUCA 4WF7A 1Z48A 2PDMA 2CLPA 1E6XM 5XINA 3F4WA 4DWDA 4Z1AA 3QFAA 4Q6JA 1I2QA 3VGGA 1VRXA 1EX5A 1W2PA 4QJ1A 5H8PA 1B1YA 4J56A 1B9ZA 2E5AA 1CWYA 1ZL1A 3ZXWA 2VKZG 3LRLA 1RD5A 3A21A 4U31A 2PP1A 3L23A 2ZUTA 2I5IA 4ICMA 4W89A 1Z41A 3QLLA 3G3DA 1ISZA 4TTGA 1MFUA 4JYEA 5HWJA 1JGIA 2PDXA 4CNOA 3GE7A 4L5ZA 3SFKA 2O56A 3TW6A 2ADAA 4CQAA 1XH0A 4LUYA 5ENLA 5AOUA 1UROA 2KAUC 3H7RA 5IRPA 1DPMA 4KEUA 4QLLA 4QS6A 2J4GA 1TVNA 3S83A 1L6WA 2PC8A 1UUQA 3F2CA 3W24A 2V2CA 4F4RA 4QR6A 4A2RA 1UC4A 3GM8A 2ZZ4A 1A47A 1T6MA 4GCAA 5LIXX 4GR1A 1MW3A 3SR6B 4D8AA 4D9PA 1GGOA 4J28A 4NZCA 3RN6A 4G2DA 1G01A 3WLHA 5C70A 1H7OA 4IQDA 3ARVA 3VGEA 3FY1A 3DN5A 2C0HA 4IGMA 2HBXA 3N9KA 4FI4A 5A8PA 3OLDA 2ZXAA 2GVYA 1BGGA 1MO0A 3LHZA 1V3JA 4YMZA 3O7UA 1IIGA 2FPVA 5GJNA 3GHUA 4WOZA 4RE3A 2NPXA 2X16A 5I3GA 3A3WA 4M8UA 2YFNA 3TVAA 4AF0B 3MQTA 2ZC8A 3TN4A 4WVXA 2BY2A 2QT3A 1ZY8A 4Y7EA 1R9XA 4ACZB 4ZFCA 2XIIA 4AG0A 4UTMA 4UBPC 4QRNA 4RJEA 4WZHA 4C1KA 2EPKX 1WDWA 1GZ1A 4PL2A 4Z17A 2OZ3A 3VZXA 3PZTA 3VX0A 3EWYA 1GRHA 3TYZA 3UZ5A 4IL0A 5HPOA 2J7FA 2QIWA 4S23A 3RLHA 2RHGA 2V3AA 1LLWA 3BGAA 1TJRA 5U1OA 3CMJA 3IARA 1UYQA 1W3JA 2D73A 4J3TA 3C52A 3GUWA 2WMGA 3M64A 4GFSA 5AC6A 5XIAA 3WBYA 4LOCA 4GJ1A 1VDVA 3EB3A 1T5AA 1P0KA 3D6NA 3T4WA 4IGNA 2A3CA 4HHPA 3S5OA 1OZMA 3CXBA 2X7VA 4BA0A 3VD3A 4ES4A 3IAQA 4HMCA 3N2CA 4XKYA 2WVTA 3MI3A 2VEGA 2J7EA 2QPXA 2PC4A 3R0UA 5HMSA 2WP5A 2WLYA 1YTKA 3GS6A 3GQYA 4HP5A 3VNKA 4TX6A 3NVVB 1X1ZA 4MB3A 2CKSA 3R89A 3PANA 1W1VA 2E3ZA 1BF2A 2CITA 2WZIA 2WM0A 1C7TA 4JIHA 4LB4A 4AEOA 3QMTA 1O60A 2V9DA 2VHLA 3B9EA 1ZS2A 4AD4A 2GVEA 2QCNA 3M5YA 4PBFA 3EEGA 2TYSA 4PTWA 1JCLA 3BZGA 1Q6CA 3LMZA 3A3HA 4P8WA 4RV3A 3PBUA 5K3VA 1F76A 2VEPA 1GRBA 5IHSA 4M51A 1DE5A 4W7WA 3LQGA 2QGHA 3ATYA 2DZXA 3EMQA 2YL5A 4O1EA 4WJ8A 1ZY9A 5IOBA 1CI1A 3G77A 4TVDA 4MYAA 3A7RA 2OZ0A 4UFKA 2EG6A 1OGBA 3E12A 3EWCA 2PPGA 3BLKA 4ZOEA 5ABGA 2NV2A 4FLQA 3AU2A 3TC3A 2I5GA 4H8VA 3RJXA 1J96A 3QGKC 5K7JA 3M9YA 1IZJA 4AVFA 5FS6A 2XZ7A 1VEMA 2AL2A 2WHLA 2HROA 4I7UA 2CLEA 4E2BA 5FF0A 1FCUA 2XFYA 3EEZA 4OUEA 3D3AA 1GOOA 3R5EA 3II4A 4JQAA 4MZ1A 1EUNA 2E6AA 3C2FA 2V6AA 2QUMA 5EBUA 3FIGA 1B54A 1XLEA 4ICCX 1ZJHA 3W7EA 4XK2A 3QYSA 5CGTA 1TB3A 3KVKA 4UNKA 2PF0A 4JHOA 2AGTA 5AFDA 3C2OA 3SCWA 2AL1A 1TSIA 1TMHA 4IPJA 1BRLB 3BG9A 3ARZA 3BPWA 1Y65A 1UIOA 3C3UA 1BPLB 5FF3A 1ZMCA 1H49A 1GW9A 1V3HA 1GJUA 4ADTA 2PGWA 3S0CA 4B5UA 5J04A 4NRSA 4QISA 4CN1A 3GXDA 5LIUX 3DESA 4IMEA 4K7YA 3TJXA 4FNSA 3VNLA 1SZRA 3ID7A 1I75A 2Q6ZA 5CZTA 3GRTA 1CGWA 4F66A 4KCUA 3TQKA 1CLKA 2R24A 4GUFA 3W2UA 3GH7A 2E8YA 3OVQA 4XIAA 1XFBA 4Z0JA 1KRCC 2WBAA 4RDYA 1PVNA 1XRTA 4LVBA 4I5UA 5F2MA 5FJRA 2GQ3A 1FHDA 1P6BA 4Q8PA 1OVDA 5C71A 3WQVA 3V18A 4H9ZA 1TJ2A 3W7IA 4W86A 2YQUA 4EM4A 1G69A 3URAA 4UTUA 1GVQA 4GX9A 4EXQA 3PFRA 4J3WA 1J0JA 3TN3A 1B3WA 2XSXA 1YE4A 2WZHA 2ZZ3A 2I57A 4L1GA 2OX1A 1XWYA 2WBKA 3TE9A 1F8IA 1HGYA 2TPSA 2XIQA 2PDHA 2C8NA 3L8KA 4QEHA 3JZUA 4M56A 1KQYA 4I8DA 1ICPA 2QCDB 3TXVA 2DZWA 2W3SA 3I7SA 5KZDA 3BCFA 3MT1A 5AYXA 3RMEA 1BGAA 5EL1A 2VTFA 3AISA 4GGHA 5EYWA 3TTYA 2PDUA 3NRZB 4XBSA 4ONVA 5I06A 3BW3A 3BLEA 1ZP3A 2PBOA 4EPBC 4MAVA 2UBPC 4NAEA 4GQQA 1Z6KA 1QUMA 2EKGA 1D3GA 3DC8A 3EPNA 2HS6A 1VGAA 2HNEA 1YQ2A 1RM6B 2NT0A 1ZGDA 4U5IA 3U48A 5HJLA 4PGLA 1GEUA 1H0IA 1EZ2A 3DC0A 2V3BA 3P14A 2XISA 2C91A 4KERA 2EKCA 1JAKA 3NJ3A 2NW0A 1O1HA 1EPXA 3JZEA 2YDQA 2D3NA 4A3HA 1C7SA 4P7NA 5DEZA 1I8JA 1NVMA 4QFUA 3CV1A 1TCMA 2VRJA 4Q4PA 1B3VA 4UTWC 2VQTA 1PKNA 3W1NA 4R7OA 2WHMA 1YXCA 1XLLA 2X41A 3N19B 2B7PA 1SPQA 1V3LA 2TPRA 4IICA 1PXGA 1J79A 1LPFA 4UNIA 3CU2A 2QCHA 2Y85A 1AL7A 1DXLA 2YVGA 2XGBA 4DXXA 4GKLA 1TX2A 4D8LA 5JCLA 4AC7C 2F7FA 3A4JA 4BI7A 2E09A 5J5DA 2DJXA 1K7XA 1DWAM 3LI1A 3DH7A 4J2MA 3R1ZA 1KM3A 3CV2A 3N29A 4AZ7A 1JOAA 4ATDA 3KBSA 4FX6M 3DK8A 4N4PA 3RK8A 1KA9F 3XINA 3BWWA 5EBKA 1QPRA 1V03A 3NQ6A 1A49A 2OGJA 2V81A 3STFA 1XSIA 5FJTA 2CW6A 5K9CA 3R6IA 2W54A 1C3FA 2V68A 4PMVA 3WNNA 2JEPA 1CTNA 2GVLA 2VMFA 4IXXA 2ASHA 2WSRA 3M0LA 2FZBA 1XGEA 4GA8A 1HGWA 2CXEA 4GY0A 4DXVA 1JZ7A 3U2EA 4QSHA 1FH7A 3V0TA 5C54A 2FGZA 3ORWA 4R85A 1PWLA 1D8WA 1HN1A 2G41A 1D8CA 2TODA 2YBUA 2HVNA 3DIPA 4C6EA 4U10A 1V7YA 1YIXA 3I6RA 4FLOA 3A47A 1U33A 3TZFA 1C8QA 5HK4A 5CJNA 1CYGA 4QITA 1UZ1A 2ZRYA 2G8ZA 2CWNA 2YLLA 3F4VA 1IEVA 4NU7A 3LOTA 3GLCA 1FIQB 1KFCA 5C55A 3GH4A 3KZSA 4UIOA 2YIHA 3W7HA 5IDIA 3L66A 3GVRA 1VYSX 3PHAA 2OSYA 1XYMA 3GDTA 5MF5A 3HPSA 3VFLA 3AYVA 4V1XA 3AO0A 3NSNA 4I9MA 1GTEA 3GC5A 4AZHA 4Z1CA 2DUXA 3HA1A 1VYPX 2Z1VA 1JXJA 2GJXB 4WDXA 4J9JA 5CAKA 1JIBA 5ER0A 5FS8A 4LPCA 4HB7A 1FP9A 3IGHX 3P7YA 1BWLA 4FO4A 2BY1A 4F40A 3G0SA 2I56A 1RA0A 4H8UA 3MKVA 1P0EA 1DKWA 2CNCA 4B92A 2JIWA 3MYPA 5LGZA 1TYTA 2ZA2A 1WP6A 2FH6A 2X2GA 3G0XA 4KGJA 5DLCA 1ZTVA 5HULA 1ZJAA 1EA0A 1GJWA 2CDUA 2L5HA 3MKKA 2CLFA 4NILA 4GUIA 1V3KA 2QJMA 4UZUA 3ZZ1A 5HWNA 3TR9A 2P3ZA 1JDFA 1QAPA 1RLDA 1PIFA 1XYLA 4NHVA 2BOFX 3DKJA 3T81A 3KLJA 5HQMA 1Z42A 1DJXA 3C86A 1NOFA 2BHYA 4IQLA 5C9UA 3FA4A 3UQNA 2BOEX 2WC7A 3EPMA 4AFYA 1LRTA 4NYUA 3WG6A 3HRDC 4RPPA 4JHMA 1NWTA 1KFKA 2OSWA 3MHGA 1CT5A 4HK5A 3CUFA 1I45A 1RQEA 3MP5A 3QLDA 3RCYA 4E3VA 2WANA 3T4CA 2XH2A 1ZBVA 1TTJA 4OFCA 3AMGA 2G3NA 2PZNA 1NM9A 1H7WA 1XYZA 4A3QA 1CLXA 3OU8A 2B31A 3TQVA 1NPXA 3K8MA 2OO6A 1UG6A 3EBVA 3STGA 2PRMA 4PRTA 3DYOA 8XIMA 1RBAA 3H4GA 1CENA 1OFDA 2D0FA 1S3HA 3FAWA 5BRBA 4KBXA 1UD2A 2J47A 4C6DA 3D0CA 4LNCA 1FBAA 1IGWA 3GD4A 4PMXA 1W5OA 5HXMA 3AC0A 1Q6RA 3WMSA 3M41A 1OADA 1FEBA 1HL9A 4TVUA 1XCXA 3BAJA 3DJJA 4OIFA 3UNTA 3UZYA 1W54A 3POCA 4X0VA 5I79A 2Y5EA 3THAA 3I68A 1GQKA 2V3FA 1TZ7A 1EC7A 1LQ0A 5E9XA 4DN1A 1E56A 3PTMA 3A9BA 1XUZA 3E2RA 1WX0A 3VOCA 1YDOA 1N60C 2YPIA 3QHOA 4Z2HA 3R12A 1TELA 3ZIZA 4B16A 4A35A 3GXMA 2Y0FA 1WQ5A 2GUBA 2VZUA 3W23A 1V3IA 1OX4B 4FX7A 6ALDA 3NQDA 3ONCA 4M1BA 4GZEA 3TTSA 4XQ6A 4AAJA 1PAMA 3TNBA 1SO5A 4WR3A 2BVYA 2OJPA 5JBEA 4ZXLA 1GPFA 1TJ0A 2CLHA 4GKTA 4J57A 1R3YA 4GYFA 1V02A 3SQSA 3BAWA 2OKOA 1S38A 3MVTA 3KTCA 3QMSA 2HWGA 1JFHA 4G1NA 2HV5A 3SCTA 2QDEA 1EHNA 2VR5A 2Y8UA 3DFHA 4IPIA 3VNIA 1TTIA 2HS8A 1S5TA 4PTVA 1RLCL 3UR2A 1SMAA 3ZJ7A 4CKQA 3H7VA 1ISXA 3PUEA 4QAWA 2UZ9A 1F7BA 4GHRA 1XYFA 1UR0A 3DBPA 1Q4NX 4EWJA 4ZO6A 3TSMA 4BY3A 1OFEA 4FF5A 3CH9A 5U7SA 4OECA 4UTKA 1AJ0A 3OVPA 4KPRA 4JAWA 2GWNA 2V6OA 1G1YA 1MVYA 2OOFA 4Y2WA 3CO4A 3KP1A 4JBRA 3FOKA 1BXNA 1PTAA 3T0DA 1NFGA 1UQYA 3PJWA 3RX4A 1JZ2A 4EQWA 4JDBA 4ZQCA 3ZQ9A 5D8WA 2BTMA 5G2IA 1TMLA 4D6JA 2IPGA 1LG2A 2R91A 2AL2B 4W87A 2BV9A 3DAQA 2QV5A 3SUTA 4DM1A 4AIBA 1IQ8A 2PI6A 1LTDA 2HCVA 3EX4A 2P3EA 1VB9A 4NVTA 5M17A 5DCEA 5BU6A 3TW9A 3FAXA 2EBNA 4MF4A 1QNPA 3SUUA 2V5JA 1F61A 2DT3A 3VU2A 5DT7A 1PKMA 3W27A 2RGLA 2DQXA 4PBEA 4EQRA 4QE1A 1W9VA 1N63C 1LDCA 4JKKA 3WK2A 1RK5A 4UCGA 1FVPA 4JL1A 2V3GA 2WO5A 3ZLGA 1XINA 2Z2AA 4BWLC 5BRPA 3H26A 1TYGA 1H61A 1GEHA 3N2TA 3WK0A 1EGMA 4CQCA 3CQ0A 3OHMB 3WNMA 1WZMA 3FLUA 2C1IA 1L6YA 3LHUA 5TQLA 3GKFA 2OPJA 1UH3A 3SRFA 1XYAA 3QY6A 2AKMA 3WUGA 3HN3A 2CHRA 2DW7A 4PMYA 3SUSA 2BC1A 4JKMA 3VKJA 3MSDA 2PAJA 4YN5A 4HD5A 4AHPA 1N8WA 3KS6A 3P0WA 2WQDA 1SUXA 4FALA 4LV4A 4CNPA 1PX4A 3TTEA 1VFTA 3OOQA 4E4PA 3ABXA 3TMLA 1WZKA 1J0ZA 3BJTA 1FX6A 1OFBA 2OQLA 4WSHA 4JCMA 3QR3A 1N8FA 4QLKA 4I9TA 1BQGA 1OGGA 4C60A 2AQOA 5JCKA 1RR2A 4PBGA 3WF4A 4FLRA 1A3WA 3O6CA 5F2LA 4D1IA 1EKOA 2JBMA 3QRHA 4U2ZA 4EAYA 1JYVA 3S5SA 4M6QA 4TMCA 1M1BA 3W7KA 1KM0A 1W5PA 1FWWA 4ATLA 1VPYA 5FACA 4H04A 3SAZA 1QVBA 2O7SA 2OZ8A 2O92A 1FWHC 2QJJA 1Q66A 3KBMA 3I3EA 2HRWA 4Q8WA 1KC7A 4XO7A 5FA5A 1BYAA 4WY0B 2ZZ1A 3A5FA 1F2JA 1BLIA 5AYZA 3OYZA 1E0TA 2W55A 1NEYA 1YXYA 3P8JA 4K2SA 4W8LA 5I5RA 5JIPA 3M0KA 1G7UA 4HZ7A 2UY2A 4GYPC 1TWDA 4PRWA 2O9RA 3CK5A 5EFFA 2QJGA 2NUYA 1U2YA 1W3IA 1DJIA 4DJDD 3SR7A 1P7TA 2QF8A 4ZB5A 3S5YA 1BG4A 2W92A 3LU2A 4MWAD 3IGSA 1XM3A 2XN1A 1MSSA 1EP1A 4GVFA 1V6XA 4J3UA 1KCLA 2F5ZA 5G5IA 5KZMA 4XIMA 5JCMA 4P8VA 4DY1A 1MRQA 3AYSA 2A3HA 2BY0A 2HPMA 1QWGA 2XVKA 3WLTA 4B2DA 5E1QA 2BVDA 1MXGA 3EWUA 3M0XA 3B4YA 1V6YA 3KDNA 3C6CA 2W66A 2WWCA 1XSJA 5JUVA 3DFNA 1KN0A 3FJ6A 4XD4A 4LF1A 4MJZA 3GTIA 4O12A 2CBJA 3DX5A 5CSYA 1RH9A 2VWSA 2X09A 1UWRA 4H50A 3UZWA 3VX1A 3PAOA 1AA1B 5DRCA 5FIPA 4AVNA 4B3KA 1OC6A 2NZLA 1XKYA 2XYLA 3QR1A 1VCGA 3RF9A 1SW0A 4DBWA 4KWWA 4OHQA 3N6HA 1KM6A 2V2DA 3MI2A 4AIEA 1AZ1A 1ZSXA 4P61A 2XFRA 1MZRA 2XGIA 5EMLA 1HT6A 1KNWA 5A1AA 3B9OA 1C9DA 2FZ9A 4C6CA 3W72A 5D9NA 3PWIA 3RR4A 1EXPA 2R82A 3EWXA 4U2YA 4FDCB 5KITA 3PB0A 3TYDA 3H2MA 4H4RA 3UP8A 1EHAA 1OX5A 2BXYA 1CBGA 2NXIA 3IIPA 1IXNA 5D32A 4YTRA 3VFCA 2GSEA 3AUOA 2E9MA 3IJIA 4WX2A 4AW7A 4Y8FA 3AIVA 1RD6A 3GG7A 3PJUA 1BWKA 1Q13A 1G4SA 5I00A 1FWBC 1Q6QA 4GY7A 1KBJA 1WA3A 3WF1A 4N6FA 5T9CE 3EANA 3FHQA 5L9FA 4DF0A 1V93A 1UHVA 4ROQA 1JI2A 4QE4A 2GQWA 3FCPA 1K7FA 4QDMA 1WOAA 1EQPA 1K6AA 5EKYA 5ABFB 1NDZA 4JTCA 1F9CA 2VCAA 4BQ2A 3SQMA 3EX6A 3F4DA 4MAZA 3ISIX 3L65A 2PRHA 2E3TA 4DUVA 3BOLA 5HATA 3CQIA 3MUAA 4AWEA 4UTLA 4C1LA 1S2CA 1G4TA 2VELA 3WENA 5CAHA 5IBXC 5KTLA 4MNJA 5FF7A 4NY2A 4TIMA 3AMCA 3WF3A 3O3RA 3RCMA 3L9CA 5D30A 4OE7A 2O9PA 2GSHA 4R7WA 4GK8A 3CAWA 5DMNA 1RJQA 2VYOA 1X7FA 4AHQA 2QCDA 4FXFA 3NFUA 3W81A 4QDWA 1GNXA 3EAUA 3MO7A 1KFBA 4FNPA 4RX0A 4RZ4A 3BUVA 4XZHA 1DORA 1JQXA 3DENA 1QI3A 4PMJA 1OIMA 3RM4A 3VIJA 3TK7A 4LSBA 3QZAA 1JNDA 3U5UA 2R94A 1PZ0A 2DZBA 4XZIA 3NSXA 1J5SA 1J93A 3SY1A 3TW7A 3OLIA 3FKRA 4S2BA 1E9LA 4MM1A 4NX0A 4P2VA 2B7QA 3VGHA 2VZTA 1LYXA 2GOKA 1YDNA 1C9WA 4NKCA 1K9TA 1FRBA 1VQTA 1MW1A 2QVHA 2X1SA 2OG9A 3GX9A 4GNKB 5HWMA 2W9MA 3GB6A 5TF0A 1FWNA 3FS2A 1WAUA 2VFDA 3MCOA 4E2DA 5FCZA 2J79A 3S6TA 5JCNA 4WKHA 1Q65A 3QY7A 4S3KA 1CXIA 3C0LA 3OQ8A 1UB3A 1DBTA 1AJZA 4JQ1A 2BNJA 2YBVA 5TNVA 4JTRA 2R8WA 2FFIA 4IFOA 3ZVIA 3VM7A 3I65A 1TR9A 2C16A 3TAKA 1UOKA 1IT0A 3MHUA 3VM5A 1LORA 2ZUWA 1OT2A 2W3RA 3RM9A 3K5XA 4ERIA 4L1WA 3HGSA 1CXEA 4H2HA 1M03A 3UVIA 1UD3A 4UFHA 5H1WA 3PAJA 4IIHA 3MANA 3LBOA 1QHZA 4H00A 2DT2A 1T96A 1Q7ZA 1KXVA 5A2AA 1G7VA 4J7RA 3TXZA 3W73A 1LUCA 3VKAA 4IX0A 1ELSA 4J35A 3W25A 1QHPA 3SCSA 1TVLA 1AD1A 4L6DA 4FXSA 3TFCA 5FSEC 4PTXA 1ZX9A 3W22A 1W1A1 2X0SA 1XIJA 3GTXA 4GQ0A 1JR1A 3L0GA 1VFMA 3RAOA 3CHVA 4UUIA 1C90A 1QOXA 1XLIA 2PLJA 3WQWA 3RU6A 2A1YA 3ES7A 3SRDA 2OVLA 3B04A 1UASA 1K77A 4NAEB 3W82A 1WYGA 3QW3A 5AYBA 3E0LA 1Q6GA 3QHNA 1S5NA 1XGZA 1UA3A 1FHLA 4FP1A 4UQAA 1X97A 2IPWA 3INPA 5A8GA 2E1WA 3NO5A 4H1ZA 4POCA 3MMDA 4Q8TA 4N9CA 3LGGA 3USZA 3BV4A 1PB0A 3V7PA 2J24A 3PUGA 3WL1A 4EOUA 1HKKA 1FEAA 4JTQA 4LUSA 1UH2A 4AD2A 2G3MA 4HCHA 3W7NA 1Z9AA 4UTHA 3TKFA 3BV7A 2VWTA 3MUZ1 2VCBA 2F84A 4V33A 3N15A 5BMWA 2FMOA 2Z1BA 1HNYA 1JZ6A 2QV4A 4GQBA 4KFNA 1A3XA 4XUYA 3UR7A 1K8XA 3K1DA 1E5NA 3CAQA 3F2BA 2PDFA 5D2YA 1CGTA 4HOWA 2BGNE 3M6DA 5C2GA 3KBJA 4LV9A 1B4EA 1M01A 4FR1A 3CL6A 4E5TA 3UR5A 1SQ7A 3L4TA 1VLIA 1BVNP 4O53A 1KTNA 3EB2A 4Q8VA 1TTQA 4YLWA 4AUBA 3WQCA 5C5YA 6CGTA 1QBAA 3UD6A 1JPIA 1H1NA 3F7JA 1KR0A 2YL9A 3HQNA 4FPSA 4QX4A 3MSRA 1A5NC 3QV7A 1KM4A 4HVXA 2NQHA 1JAEA 1JDEA 1JGMA 1U5HA 1VS1A 1CGVA 1ITXA 1OYCA 3P82A 2XH7A 4ZSTA 1WDDA 2XH0A 2PDKA 4URIA 2H3BA 1PDZA 3AZRA 2FVMA 1ADSA 2Y8VA 2ZZCA 2J8FA 3AALA 3TLLA 5I3HA 1J0KA 1G67A 4GGBA 3QV6A 4INFA 1M9HA 4XBJA 1KBBA 1RBLA 4FMVA 4BCEA 3RLGA 1OYAA 3NEHA 3IACA 5D03A 3BL3A 1TPB1 2Q71A 2CU0A 3AN1A 5ABEA 3GO2A 4FLSA 3LB8A 1K4GA 3PNUA 2V2HA 1NFPA 4GG9A 3S2NA 3WZ0E 4EP8C 2R9ZA 1UD4A 5I2UA 5DANA 2Z2BA 2PTZA 1XQLA 3AXHA 5G4WA 1LM1A 3AUJA 1EDQA 4P8UA 3SO7A 2I9EA 5FESA 3U8GA 4E6MA 1YPIA 3CGDA 3ITYA 2VXNA 3RPDA 3CH0A 4MKNA 4UTWA 2WC3A 1IXQA 3G22A 3GRIA 1EJXC 2V63A 4QNEA 3CB8A 2WW5A 3JVAA 5D38A 2XIOA 2J8GA 5AB3A 1DXFA 2IKHA 1KXQA 4ML4A 4PSRA 3BGJA 1C93A 1HIZA 4IPPA 3HB9A 3UJRA 3OC4A 1VKFA 1KKRA 3A22A 1M7PA 1ME7A 3ARYA 3CGTA 1WKFA 4J3SA 2CC0A 5AKQA 2OMAA 2YBTA 4FX8A 2QCGA 2XN2A 2C19A 1OC7A 4W84A 2VVSA 3H2NA 3OTRA 2GQ9A 1L6GA 4G8TA 1Z32X 4P5UA 3VGDA 3FVMA 1P1XA 2PGEA 4M7SA 2HDJA 1XP3A 3N11A 4S3FA 5LKYA 5FF4A 4DLFA 1B4KA 2OCZA 1AD4A 4EX4A 3P8IA 1GWJA 3E49A 3HF3A 3BQ5A 4H83A 1EJRC 1XLDA 4Q7BA 4BEQA 3G1HA 4DWSA 1X6NA 3UT0A 3BCJA 1V0NA 4K8EA 4WHBA 3Q2DA 3OP2A 3UXAA 3R8HA 3KBVA 5RUBA 1YNQA 1ZK7A 4MB1A 4GINA 1PE1A 1Q45A 5E93A 3HJZA 4JYDA 4YTUA 1DJWA 4ZTXA 2PE4A 3URBA 4JNMA 2IXVA 3GUGA 2NWSA 1C8YA 2IPFA 1XG4A 4XVDA 4YTTA 4H6EA 3N34A 2J9ZA 4YHEA 5GJMA 2W27A 1Y5XA 1T3QC 3HG3A 1REQB 1W1PA 2WVVA 2PGFA 1JULA 4NJIA 4HNLA 3FXGA 4GXMA 1C92A 4F0KA 4JTAA 3AS1A 1QW9A 1IEWA 3W7LA 3L5MA 3ELFA 1ADDA 1I2RA 1F07A 4RL3A 2WOIA 2WKLA 1BYDA 3TWBA 2WPFA 1SFJA 2GYIA 4HZMA 2A8XA 2FH8A 1A5BA 3D46A 1E6PA 2E5CA 1RHCA 3G1RA 1OCBA 1WB0A 2HBVA 4HZ8A 1W3HA 3B3DA 4OBRA 4XZBA 5BOEA 4R7JA 2E9LA 1E55A 4I9AA 2FVLA 4XG1A 2FQIA 4UQ9A 3FKKA 2WSYA 1POKA 3OZYA 4DPPA 5E9AA 4RPQA 3SM0A 1YYAA 1FP8A 1TPC1 3KLKA 2Q09A 5L6UA 3LXBA 1XIHA 4DAIA 2ZX8A 5BROA 2VURA 3O06A 3V1HA 3C56A 1CX9A 1DWGM 4UMAA 5CC6A 5JU6A 5IXEA 1VJZA 3MZNA 3H22A 4S3AA 2DSVA 4AEEA 5K2ZA 3LB0A 3LCLA 1FKWA 2BMBA 2FDSA 2DU2A 1FCVA 4MTVA 1J18A 2XJ7A 1GTHA 3Q65A 1J0HA 1GQJA 4PC8A 5AZ0A 3E74A 3UG8A 3C0SA 1AUSL 3GVVA 3M5VA 3DK9A 3K8KA 3OBAA 4N42A 1VHNA 1XLFA 2YDSA 4KCTA 1AL8A 3W02A 1QW8A 3GXTA 2WSKA 1L6SA 5CLTA 3NL3A 3QGAC 3MHFA 1EEPA 1RPKA 3P67A 1ZHAA 3P5ZA 2XWDA 4AU0A 3LI0A 3MUCA 1LOLA 2REQB 1SZGA 2Y2WA 1XR2A 4MGGA 5F7UA 4O1CA 3W85A 1FXQA 1WOBA 3IAPA 2Y1HA 3L68A 1OFQA 1ZCOA 2JIEA 1HJVA 3NOEA 3UXKA 3MJYA 4MKSA 3NQAA 1XC4A 3TJIA 1AW5A 4LC6A 3QPYA 3V0SA 3VKCA 2BVWA 3TA6A 1CB7B 1MEWA 3QFBA 1PKLA 3PSWA 2A2IA 2GGGA 4FIRA 4U28A 4HU8A 1XSKA 2X40A 2ZUUA 4GISA 1XRSA 3V0UA 4L4MA 1TFVA 1NY1A 3OA5A 1Z7AA 3B03A 3LA4A 3QW4B 4FAMA 1XBXA 4NZ3A 4B5NA 5C6MA 1EJSC 1O94A 2JKEA 3PULA 4PMNA 1A5UA 4IXHA 4LBSA 5HNTA 5GNZA 2Q3RA 5LNSA 4LYKA 3W84A 4UFMA 4KRTA 4IFRA 1S2WA 3LG3A 1F4AA 5F4SA 4TVCA 1H62A 1B9BA 2NQLA 1ZBCA 3PTDA 3NL6A 4N9EA 2JGYA 1SO6A 4MVAA 3IANA 4L6OA 4OBSA 4DQWA 3CEPA 3GR4A 1EH9A 1P48A 3DXIA 2PA6A 5I3JA 5T26A 4F9DA 2GJPA 4C6NA 2YW4A 3T07A 3TN5A 3ZM8A 1E6QM 2DY3A 1UD6A 2POTA 1MO9A 2NQ9A 2XIJA 1NP0A 4DBDA 3KAOA 4PUKA 3T2PA 1TREA 3TYBA 1W37A 3UWEA 3CPRA 2FJUB 2QUUA 3VOJA 3V1PA 1JDDA 4IQEA 3AQUA 1T41A 3QQ0A 3UETA 5LNVA 4UR8A 3W2MA 2Z29A 4GCXA 4DBUA 4LCSA 3AMDA 3CZLA 3KVJA 1W5MA 1J4EA 5FEXA 1H3GA 1SYTA 1QW7A 2Y61A 3W29A 4HA0A 3CGEA 4N0RA 1KGUA 1W9DM 3CUXA 4JQ9A 4H9UA 2XSBA 4MWAA 4US5D 4TVWA 2FGLA 2TMDA 2PWUA 1KRMA 3CJPA 1BWVA 1CW2A 3B8DA 1IIHA 4ZOBA 3U6WA 1EYWA 1KTBA 4YYCA 1XLMA 2EQ9A 4WEVX 3W6YA 4GIAA 1S2AA 3O8AA 3ZOAA 3R43A 1TV7A 1E6SM 1UWQA 4JNZA 3DFYA 3DYPA 1MUWA 4E8DA 1ONWA 1CPUA 1I2PA 2E6FA 2EPOA 5D4YA 4HYRA 1NELA 1OD8A 1UPPA 3ABOA 2EJ1A 2VO5A 4DX3A 3KRUA 2C6QA 2B81A 2WCGA 5C9XA 3N18A 2G5WA 3PPGA 4HSHA 1C91A 1OJTA 1NTHA 2J7BA 4AZCB 1Q1WA 3THQA 3PWGA 1MMFA 1KM5A 2W63A 1MDLA 1X2HA 5A8QA 5LNRA 1FFRA 1BXCA 4KCWA 2HEJA 3QXBA 3P80A 1EO7A 3E0VA 4DZAA 2LLEA 1TUFA 3F03K 1TA3B 3ITXA 3WF0A 4IFKA 3NM1A 2OX4A 3H6OA 4X63A 1GJPA 1D3CA 2A3BA 3S5ZA 4H41A 4DO4A 1GVSA 3T0AA 3SUWA 1UMLA 1M5WA 3OYXA 4M6VA 1GYNA 2J77A 2WMIB 1EOMA 1S2VA 2ISFA 4DBEA 2PF8A 1JG9A 5AHLA 3CZJA 3T8QA 1VF8A 4JY9A 3PN8A 2Q02A 4WRHA 1IWBA 2D2OA 2UY3A 1DTUA 3KTXA 3L2LA 3BSHA 3ZSSA 4H2CA 4XAPA 2WZTA 3ARTA 4K37A 3LHYA 4Z2IA 4ZEPA 1EBHA 1L2UA 1GVYA 2WCSA 1RQBA 1LVLA 2BWGA 3TH6A 3LCWA 4JTSA 4DIAA 4DM2A 2PTWA 1ZENA 2EQ8A 3VDBA 3EPOA 2BG5A 2FTYA 3I7QA 3W38A 1W1B1 2FHBA 3BURA 4DYKA 3LCGA 2V5LA 2C3DA 4RE2A 1UCWA 1XBYA 2DW6A 5DCDA 4RUBA 1H50A 1J01A 3RYSA 2JGQA 4OT7A 1E70M 1N7KA 3Q67A 5IHRA 1QHOA 4HKPA 2OQYA 3AS3A 5CZSA 1MI3A 1GV4A 2Z6JA 5G5GB 2NVCA 1US2A 3GW0A 5D9PA 2H3DA 1PIGA 2I9UA 4UFIA 3LLDA 5A6JA 4O1DA 6REQB 3IVSA 5IFPA 4JNYA 2AOSA 3F5KA 1OFOA 2VENA 1ZMDA 2JF7A 4OWGA 3NQGA 1M41A 1RA5A 3Q37A 4TV6A 1FHVA 2CCRA 3OO2A 5C2XA 1C29A 1YMYA 1X8FA 1G9HA 1HP5A 3NXFA 4NZJA 3GW3A 4LU0A 1IEQA 5DX7A 4HOZA 1XFCA 1AZ2A 3P2VA 1EUAA 3QFEA 4GNJA 2WKJA 1NDAA 3AIBA 2OWCA 2OO0A 2FJKA 5C7VA 4DJDC 2YKKA 3H4XA 1TG7A 3OG3A 3LV6A 2CEQA 2E9BA 2VOMA 2JK6A 4IH3A 2DEPA 1GYMA 4S3DA 1R2SA 3WMCA 1VBJA 1Q6DA 4ZOCA 3BLPX 1R30A 4ECLA 3LEPA 4C6OA 3LLXA 2ABBA 4KGLA 3L7RA 2J25A 3MC5A 3L4WA 3W1RA 4CEXC 2ZBTA 1F8MA 3ARUA 2ZX9A 4I7VA 2W79A 3HGOA 1UR1A 3VCCA 1OCQA 2W61A 1I2NA 1OFRA 1U5JA 4QE5A 3EB4A 2BC0A 4UR7A 3ANYA 4LS1A 2Z7GA 1JF6A 2F9RA 1KWKA 3VNZA 3MDWA 4JTLA 5KZEA 3ZLHA 3GSMA 3PY2A 3ATZA 1OFAA 4MADA 3NL5A 3WLMA 1ZJIA 3VIKA 2VCCA 2VX6A 2HISA 2NUXA 1DNCA 4AD0A 4HHLA 3AHXA 5G4HC 4F0LA 3VOIA 2GVGA 4JHZA 4L61A 4R27A 3E6EA 3BXWA 1VFHA 3UXIA 2V0TA 4FXRA 1S5VA 3QGVA 4CEUC 3PTKA 4PODA 2UWFA 4AWTA 2R1NA 4IP7A 3F5JA 4NEWA 3HV8A 4PFMA 1AG1O 4XZNX 4S3GA 3ZS4A 3LM7A 5TAOA 2ZX6A 2O0TA 3EWDA 4HTBA 1X7IA 1YNYA 4ZO8A 3WQ5A 3AXMA 4L4LA 1HQTA 4NAFB 3RPTA 3N9RA 1TIWA 4MB4A 1AK5A 1VIZA 1JRPA 2X8GA 3UNDA 1GKQA 1ZNNA 1WBJA 2CZDA 3TUUA 2UY5A 3CUIA 3NQMA 3S1XA 4ZA0A 4HNCA 2GRTA 3P61A 3BLDA 3M5XA 4F9JA 4LYRA 3SW6A 2JQXA 5T9BG 1FTXA 3UYCA 4D6HA 4ZBCA 2B7OA 4EKJA 1VFUA 1QO5A 1K9EA 4YWSA 1XIIA 2CZ5A 2ZRVA 1GREA 4HU3A 3QM3A 2PODA 3V5FA 3EGJA 4O15A 3LN3A 3ZR5A 4HN4A 3IJ9A 4IX2A 2A6LA 2OGYA 4JL2A 3EOEA 4F0MA 3GNRA 4ZE5A 1WKYA 1ZKQA 2FMNA 3BOFA 4U4MA 1ZBWA 3BJFA 3TFXA 4BWLA 3S42A 5AHNA 4H6QA 3VUSA 2ICSA 4OTKA 1N2VA 1XLCA 4BF9A 4O4VA 4S2CA 3T42A 1BRLA 1E0WA 1CZ1A 4LEQA 3ANVA 1EQCA 3AI0A 1W1IE 5F4WA 4GZIA 5FJJA 1LWIA 3KL3A 5GRTA 3S9IA 1MEHA 3EX2A 1Q1RA 2FHCA 1XCFA 2QUNA 1AW1A 3CMFA 3S8HA 3HPFA 2Z1SA 4RDZA 1FFUC 1NWRA 4JFWA 1HVXA 1OB0A 1DIEA 3TU9A 4NYYA 3PPHA 4XZ9A 3ITVA 5CJMA 5REQB 4PB5A 2PTXA 1UP3A 1VCFA 2FTWA 5F1VA 5A2CA 1IT7A 4Q8UA 3W7DA 1ZDLA 5HINA 3VOFA 1A0DA 4DVOA 2X7WA 2H90A 3REQA 4IG2B 5M1TA 2VEIA 2VC9A 4FHAA 3BLLA 3UZXA 3C5QA 4CU6A 2ZRUA 2P10A 4MDPA 4M81A 1AQ0A 1DTNA 1XS2A 4PSPA 3ZVHA 1ZRQA 3BAIA 3IIOA 3PZNA 1RZMA 1E71M 2O55A 4PMQA 4R9OA 2XVNA 1LG1A 4LCQA 4BZYA 1HKMA 5LHEA 1ONFA 1BVZA 3VIHA 5U4NA 3GAKA 4K1WA 5LXXA 1XIMA 2E4TA 5LA2A 4REQB 4CCDA 2YA1A 2RABA 2G3FA 4JTIA 3E2SA 4YU1A 4AZCA 4XB3A 5LSMA 3TYAA 5G5HB 3WLKX 1U1JA 4QG6A 3MMTA 3QN3A 4DHGA 3B0PA 3BAYA 3TP4A 4YVVA 2TAAA 8XIAA 3IC9A 1G6CA 5BRQA 3WBWA 1XYBA 1NHRA 1OIFA 3UA3A 3KOYA 1UWSA 3T7VA 3GXPA 2J6VA 2VEKA 4Q8OA 3S9YA 2EQ6A 1WXYA 4NZ5A 5JH2A 4R3UA 4H9VA 4H8HA 4CNTA 1MQPA 4H7VA 1S1RA 4C1NA 3MA8A 3PJXA 2EPHA 1EIBA 1MXSA 5FJOA 3GDBA 3VE9A 1GETA 2P88A 4HMEA 3OEXA 2O9OA 1FWAC 2MANA 1Z44A 1JNEA 1KRAC 3L4XA 5U25A 5LIKX 2REQA 4ICNA 3HQPA 2XWEA 1KRBC 4LS2A 1E51A 2CLOA 4ILSA 2VEFA 2WJEA 4A2SA 3OBKA 5C9ZA 1N55A 1SW7A 1K9DA 2HK0A 1ONXA 2W0UA 3OJGA 3NZPA 4YS1A 1K7EA 3NPUA 5BZAA 5EMYA 2DPEA 2G0WA 1LL6A 3T9PA 4RZBA 1JL8A 3A64A 1J8VA 3KDOA 1Q85A 3MU7A 2NT1A 1XLGA 3CV7A 1OGSA 4F48A 3FJ4A 3PBWA 3NS1B 1YKWA 2NX1A 4GUHA 1W1YA 3QTGA 5ABTA 4LWWA 3DCPA 1K8CA 1LT8A 1N82A 3W2JA 2XTKA 3WBXA 3QHMA 1W9PA 3FEMA 1PJ9A 2P76A 1DYSA 3NQ2A 4JZ5A 3MWAA 1LOQA 5H2ZA 3SCVA 1E40A 5LIYX 1CEOA 1UR3M 3L4YA 3PBMA 1V59A 3CL7A 3CWOX 4C6LA 3ITLA 4MIMA 4EAMA 2X8RA 1OD0A 3RGTA 4O1BA 1SZFA 1X1OA 2PSNA 4M6UA 4F8XA 1UJQA 3RRXA 1VD6A 3GKAA 3LHTA 2VDGA 2Y5SA 3CV6A 5FSDC 5CPQA 3UU0A 3EUB3 4W5UA 4PB4A 5HDRA 3UWVA 4RNHA 2V30A 1PKYA 4J2PA 3CEUA 4K6AA 4JIEA 4Z1DA 4GXPA 4U5KA 1HKVA 4JX5A 2PD9A 4GYPA 1QOPA 2YOCA 2PDNA 4IP4A 1H11A 3CNYA 4UNLA 1ODZA 3C2RA 1UC5A 4DYEA 3FJNA 2QAFA 1CCWB 4KRUA 3DGHA 4DJFA 5AC5A 1BF6A 3LTPA 3H2CA 3VIGA 1R47A 5FL0A 3BOXA 1E1EA 1FWEC 2F38A 3EX1A 2XVPA 3PNZA 3WD3A 1AH3A 1SFSA 2ZIDA 4H9TA 1ZB5A 4Q4QA 3OLGA 3URHA 1IZKA 2FZNA 1OFPA 2Q01A 3ZLFA 3HPZA 4NI3A 3VABA 3T55A 1EZWA 5FJUA 4ERAA 3IK4A 2EQ7A 4JN6A 5JH1A 3EKGA 2P50A 2NXHA 1UR2A 4GI4A 1TV5A 3NZ1A 3QMRA 4RXGA 4ALDA 2J62A 3R11A 4MJ4A 4YTQA 2CLLA 1QXLA 2EQDA 1IZCA 1PS9A 3M0MA 5KINA 3CHFA 4H4IA 4LY8A 5CZKA 5JMUA 1OCJA 3SQLA 2V38A 2WOQA 4DI8A 3P3BA 4S3CA 2CKRA 2CLIA 3MYOA 5I3FA 2OFJA 4LH8A 1JJKA 1YRRA 3T0BA 4AMAA 1BKSA 1DIOA 1G0CA 2DVXA 1Y5VA 1GRAA 3HW2A 3EA2A 1NJJA 4LS0A 4M1RA 4W5ZA 1QPOA 5F2GA 3CASA 3PZMA 4DNMA 1R7OA 5DRIA 3M44A 3OG2A 1FUYA 4XSLA 3ZT5A 4NJKA 5FL1A 1JUBA 3AXKA 4TQTA 3S1UA 3S1VA 1PYMA 3XIMA 1L6FA 1BEUA 2HMCA 4M6PA 2I1OA 4EACA 5DBTA 3PBYA 1W5NA 3DKLA 2J6XA 3RHGA 2HPIA 3U57A 3UA4A 1AJ2A 1XKJA 2F61A 1HFBA 1R8LA 3BCDA 1UKTA 1E0XA 5ABHA 3VUPA 2BCPA 1EJWC 3NVZB 3W07A 4AY1A 3EKZA 4Z42C 4IOTA 3O2LA 2C3CA 3T6CA 1TZ9A 1BWCA 1KV8A 4Z2JA 1FWDC 3L4VA 1W3LA 4RNIA 1W31A 4A8IA 3N12A 5JRBA 2ZYFA 4WXYA 3M7SA 1TV2A 3RO8A 5D2WA 4YYFA 3PB2A 2ZC1A 3WLRA 2J9XA 1V0LA 1D3HA 2WM1A 4JEJA 3TCSA 4NNAA 3LPPA 3ABSA 1YBQA 5I77A 2I17A 1QBBA 5G1YA 2E28A 2WXDM 3DU0A 1TQJA 4QCEA 4XAZA 3RILA 4ASTA 2D69A 3WQOA 5CKSA 3T09A 3FN9A 3NQ7A 1ADOA 3L4UA 4JDYA 4PE8A 4NT0A 1F73A 2Y8KA 3WUFA 3GU1A 2ZXQA 1MZHA 1E5JA 4Q4KA 4BK9A 4C7FA 3BGGA 4WGXA 2NSOA 3T78A 3LPGA 3PPFA 1EO5A 3NQCA 2JK2A 3WIJA 4GVIA 3TQ0A 1RQHA 3GR8A 2WWDA 1QNOA 4K1GA 3BC9A 4IJRA 4AD3A 2A7NA 3FSTA 1ONRA 2Z4GA 1P5BA 5KEZA 3ITGA 3E38A 4YVXA 5E09A 3NGJA 3HFYA 3CLWA 4GIYA 4WJEA 2OR2A 3U2CA 3WJSA 4XO6A 3N2OA 2PEVA 1HKIA 3ONBA 3OGRA 3W37A 3WFLA 3H2FA 1ENUA 3CYVA 3SCQA 4FOKA 3FJLA 4PMRA 3NPXA 3HMJG 2VVNA 4ACYA 3TX9A 1I6NA 4D6IA 3C4UA 4MUPA 4YJ5A 5FF2A 3U2ZA 1GESA 3P60A 1DJHA 3ZJ8A 4NJGA 3QKEA 2PDQA 1OEPA 4OOUA 4D6CA 1VRDA 1J0IA 3E1F1 3TLQA 2Y7DA 2EO7A 3O6DA 4IJBA 4O0QA 1O5RA 5KSWA 3C8NA 5LNWA 4W7VA 3UWQA 1OSEA 3UGVA 4UQBA 4QXIA 4K8HA 1SW3A 2IUZA 4TXEA 5I0DA 4JIQA 4JGDA 1FWJC 4CQDA 1T0OA 3WD4A 1IR1A 4CUCA 1O6IA 2V67A 5FAJA 4RDVA 4RW3A 4IP5A 5C9WA 4O52A 3W2NA 2PWGA 3AXXA 4KMQA 1WDPA 4Y9OA 4AIOA 3VZYA 3C3NA 3SBFA 4F3HA 1POJA 1H0GA 5EFDA 1OX4A 2VZOA 4FNTA 3F4NA 3B8SA 1GYLA 4YIWA 2ESCA 4G7FA 1PCWA 4FX9A 1XBVA 3N6QA 3SSJA 4J3VA 5D33A 5A6BA 4ADUA 2WPEA 3V16A 3ARWA 4IUOA 4CU8A 4A4AA 1AODA 2DQWA 1V0KA 1J9YA 1X8CA 3CAKA 2GJRA 3RU8X 3B8IA 2F6UA 1B3ZA 2CPUA 1NHPA 4HPJA 2Y89A 2QULA 2MUCA 3Q4DA 4UTJA 1C8XA 1LWJA 2G3JA 1HL2A 1V6VA 1VFLA 3ZWSA 3VPLA 1W0MA 4GZ7A 4H4VA 3KCJA 4W8BA 3VNMA 3SN0A 4GJJA 3HOJA 2X50A 4DUWA 1QPKA 3RX3A 1ZAIA 4D8ZA 2ZX7A 3H8AA 7REQA 1GQLA 1ECQA 3U9IA 1ICSA 3GR7A 3A12A 3QVQA 2WZMA 3L67A 2QXWA 1H2IA 4H4XA 3NO3A 4DB7A 4H3DA 2JF6A 1P1MA 1VBUA 1TX0A 5BNKA 9CGTA 1XG3A 4ZE4A 1QJWA 1X2GA 1DJNA 1GEQA 4XUGA 1HX0A 2OKTA 5HA7A 1UKQA 2GWGA 4RDWA 1HUVA 3EYPA 2E5BA 3NGFA 4W9TA 3PPCA 2WVSA 1W56A 1V08A 3TJ4A 5AC8A 1GW1A 3E3HA 3MCMA 2GJNA 4RR4A 3TTOA 2C1HA 1PZ1A 3CUGA 5DN1A 2QNEA 2Z0IA 3ALGA 2A4AA 3TIMA 4DBSA 4NJHA 2VOTA 4O18A 1UWAA 3FK4A 2PCQA 5AHMA 1VHCA 3F1QA 4ZB2A 4EQSA 3C2EA 3MB9A 3DFTA 6ENLA 3O6AA 3UG4A 5HAOA 3H2AA 2ZADA 3AMKA 3UYIA 3LCIA 3QQ1A 3SFWA 3ITCA 4ZMGA 4OZOA 4XZWA 3T0TA 4C1NB 1H09A 1OBAA 2PLCA 3GVGA 3CXOA 3CHDA 3MVIA 3H53A 3L21A 2ALDA 1NOWA 1MNSA 4H9MA 1FQ0A 3OGSA 4FNQA 3TN6A 3IGUA 4NRRA 5F1UA 1S2TA 3REQB 1E4LA 1YPXA 1ZJBA 4H9XA 2DSKA 3VNDA 4M0XA 4JIIX 1V77A 3WKZA 2FHFA 1FKXA 4GI6A 4AYGA 2PWFA 4I5RA 3AIEA 3I4KA 4GC4A 3TSDA 3FV9A 2NVKX 2WQPA 4K7ZA 3ETRB 3JRKA 2J3NA 1GRTA 2VP8A 4V1YA 2VX7A 3HURA 3WEMA 4AQLA 1OG6A 4WKAA 3G6LA 4CVUA 4JN7A 3STEA 4IPNB 4KRZA 3S46A 3GIPA 2IW0A 4KPLA 3G3MA 1WXJA 3WCZA 4OVXA 3S2CA 2D23A 1JZ3A 2G95A 3EOOA 1QATA 4Y9NA 4H4UA 2DZPA 2IQ0A 4H4SA 1NSJA 1XH1A 1YTDA 4YVPA 2F2HA 3ERPA 3UY7A 1JUKA 3WLOA 4L64A 5DQPA 1F6YA 3FX4A 3SCNA 4NXSA 4GLEA 1A5SA 2GGIA 2Y7FA 1F3WA 4ML9A 3E0FA 2GL5A 3LADA 4S39A 1TE1A 2QCMA 4Z2LA 3LBCA 2XH4A 3ARSA 1L0PA 4WK9A 3I3BA 1R3VA 3LPOA 4EMJA 2CZFA 1TMQA 2GR0A 1A50A 4LXFA 1KGWA 3O16A 2BY3A 3S6OA 3LXDA 1FY6A 4RK8A 1K1DA 1F4HA 2NVAA 1LZOA 4FEZA 2WBGA 1MOKA 2BS9A 3UEQA 1Q6FA 1GVIA 2Q8XA 2J7DA 3EDEA 4DF2A 3N04A 2NQ5A 4LBRA 2ISDA 5AVNA 3KFTA 2YLAA 4N9BA 3B97A 1QMLA 2XPKA 4LX4A 3WJYA 3ARPA 4GH3A 3ZSTA 5BOFA 3ZWTA 5HR7A 1CB2A 4DNHA 3UZJA 2A85A 4WXZA 1K4QA 4IISA 1W8SA 2D3LA 3OODA 1SFLA 2OLAA 4GBUA 3WEZA 1U1UA 2DIJA 3EDKA 3R25A 5A8MA 2WJDA 5CJ5A 2DFAA 3NQ8A 4F2TA 3NYDA 3C2VA 3NDZA 3KBWA 1K3UA 3STPA 4G7EB 1IEXA 8TIMA 4I7WA 4RLIA 5A6BD 5MHBA 7ENLA 4NEVA 5CLWA 4QQUA 1DJYA 4RCXA 1AOGA 1F8WA 3QZ6A 3LY0A 1QTWA 4PCFA 3T44A 4P7LA 4IWWA 3P81A 3G0UA 4ZO7A 4QLJA 4PTDA 4LA1A 3GYCA 2W5FA 4L7ZA 4ZR8A 5HBFA 1TJ1A 3R58A 3R10A 1BVWA 4MNKA 3K8LA 3MO4A 3BICA 3CQKA 1E1CB 2GDUA 3PZ9A 1PTGA 1WE5A 4D6FA 1LWHA 2HE8A 2QCFA 4IF2A 4JTFA 3W7RA 3O0FA 1XLHA 1JCNA 2WNZA 3GDMA 3VKKA 2UY4A 5BXTA 2PZ0A 3MCNA 3M0YA 5CGMA 1BKHA 5B7ZA 2FZ8A 1ZQ5A 4GE8A 1O5KA 4ZZ9A 4E4FA 5ABFA 3UG3A 4DAFA 4TV5A 1Q4WA 3RNMA 4O11A 2ZX5A 4KFOA 4M52A 1V79A 2XVGA 1UZHA 2EHHA 2HE5A 4MZYA 1LRQA 4A6GA 2ZKMX 2O9TA 3NZGA 2SFPA 4JQ2A 3EX3A 2VFGA 4KETA 1GOKA 3NVDA 3B0UX 3DEQA 4C7DA 4Y6GA 2C7FA 5LGXA 3N3TA 3CTTA 2PWEA 5D09A 1J5TA 3IUIA 1I60A 4NI8A 4WY0F 2VRKA 1R3WA 4UMBA 1YPFA 5AY7A 2ZUSA 2J13A 4GFIA 3CM4A 3I6TA 2ISVA 2Z24A 1KB3A 2VDHA 2Y7EA 2VGFA 2QCCA 2RDTA 4IMCA 3Q94A 2PP0A 3LCFA 3VK5A 2ZZ6A 1TQXA 1E6NA 4B5WA 4J3ZA 1VYRA 2A6NA 3FDGA 3PZOA 4ATWA 2B4GA 2Y24A 3VCNA 3WDHA 2EG8A 2PDYA 2QJNA 3MV11 5DELA 2V8ZA 1GOXA 1UD8A 3WFZA 4JN8A 2XIBA 4C65A 4WLCA 1R6WA 3DFSA 4PN2A 3QZEA 2FPYA 3IGXA 1XDMA 1XW8A 3LXCA 3P6LA 3PBGA 1SZNA 4JIPA 3N17A 1GT8A 1ECEA 1SGJA 3W7OA 3LUTA 3WBAA 4MJMA 1SJDA 2VL4A 3N6JA 2VC5A 2A0NA 4IIBA 4O0ZA 4IGHA 1J11A 1DJGA 3GTNA 2J27A 4IMGA 1CGUA 4B5XA 1BTMA 3EXSA 2YCJA 4BF5A 4LVGA 3WH5A 1OQFA 2C1GA 5FS7A 1U83A 3ABQA 5I24A 1B3OA 3I3DA 6PTDA 4BJHA 3ME3A 1LL7A 2EJAA 4N9DA 4O1FA 4US6A 3TWAA 2DH3A 4MOZA 3UVAA 3SZ8A 3W00A 3DHUA 1K4HA 1OK4A 3UWZA 3VGFA 4LIIA 3V75A 6TIMA 4S3BA 1MW0A 2R1KA 2FZDA 5K9XA 3KOFA 1FFQA 4F0SA 4OOZA 2YCLA 1JD9A 1QASA 3W7PA 3SSZA 1DJZA 2CYGA 4HOXA 3MMUA 1QPQA 1ME9A 3CC1A 3GFZA 1TPVA 2WB5A 3TJLA 1UWUA 5MKGB 4HNVA 3LXAA 1JEHA 2YB4A 4N6EA 1HO4A 2V3EA 3OBEA 2P53A 3WLNA 2DJLA 3C8FA 1RVGA 3GYEA 2G97A 2RJHA 4GWEA 5HR6A 5AN7A 2R1MA 5LA1A 1N62C 4WY0A 2PWVA 1QK2A 4KKXA 4DJEC 1V3MA 2GOUA 3NO1A 2NWRA 5T91A 1IE7C 7XIMA 2RDXA 4K36A 1XDIA 4W93A 1DXIA 2QEZA 1HO1A 3B8UA 3UJEA 4GYJA 4A3YA 4O10A 5HQLA 3TYEA 3TZNA 3HG4A 3ALFA 1VFOA 4HCLA 3BQ6A 4ZSUA 4EPKA 3L0KA 4XAFA 4JTJA 1TYPA 2EAWA 3W0KA 3SCPA 4JXCA 2YL8A 3VXGA 1DWJM 4JD4A 1KFEA 3CUHA 1OZQA 1UR8A 1NDWA 4N4QA 3AJXA 2DT0A 2AAAA 2PLKA 4LALA 1W3KA 4ACZA 2WP6A 2VEMA 4WSJA 4XD6A 1P7TB 1MFVA 2GJLA 3APYA 7REQB 1O1ZA 3MKCA 3MMWA 3AMZA 3BJSA 3RIKA 1BAGA 4DZ5A 1W9UA 2GR3A 1O7AA 1RCQA 4HYWA 1R2TA 4OKDA 5HUPA 3C2YA 2GK1B 4E2VA 3HJEA 4NP7A 3FGCA 1D7FA 2PP3A 5I6SA 2WV8A 3DBNA 3S6DA 2OLSA 4LYQA 2ZCGA 4K3ZA 4O8AA 3VVGA 4L9ZA 3SB0A 1GG1A 4BEUA 3QV9A 4L4PA 2FIQA 3QPEA 5CBBA 4IM4A 5EMUA 1EA9C 3F5LA 4CU7A 3GNNA 1GZGA 1UWTA 3B8VA 2QPUA 1US3A 1Z3NA 5DMLA 3MV01 4AX7A 4DNAA 4LAOA 6TAAA 3PC0A 2XM1A 4KFPA 3EOUA 5GNXA 4MHBA 2FZMA 1WBHA 3BAXA 1UKSA 1RK6A 2NXGA 1GRFA 2E6DA 3E5BA 3M07A 4J4KA 4MY1A 4EF9A 2INEA 4LW7A 1G94A 3K4WA 3AZTA 4UOJA 1AW2A 3WQ4A 3VKBA 2I16A 1LL4A 4CNSA 2ONEA 2CERA 3NQBA 4EM3A 1VEOA 4IIGA 3W53A 4F2BA 1F3XA 2VC7A 4UXDA 2YDRA 4JY8A 1VH7A 4TX8A 3M0JA 2HVMA 3WBEA 3TA9A 1P6WA 2QHAA 3N13A 2VD8A 3DG7A 3AU6A 1GXFA 3FYOA 1HJUA 4GVHA 1FWTA 4UTTA 5CEWA 3MW7A 3UGRA 4ZGYA 2JE8A 2J88A 1VBRA 1E15A 2XHYA 4GYKA 4HNUA 3QTPA 3GHRA 3NVYB 3C0QA 1XIFA 2BB0A 1OWQA 1FA2A 1BYBA 4DZHA 2IS7A 2CWXA 1UBPC 1I1WA 2ACUA 1S5MA 2P0IA 2XGZA 3G1VA 2OYLA 1Q63A 1HW6A 4HGXA 3HPAA 2DZUA 1W9BM 4QAIA 2PUZA 4OQVA 3B9NA 3TR2A 2JEQA 2YYUA 3A4WA 4G56A 1EC9A 1SVDA 2D0GA 4LBUA 3AS0A 3ARRA 4DI9A 5LZLA 3S4TA 3VGBA 4H6RA 3KWSA 2HNHA 4N7QA 2V82A 4LQ1A 2AMGA 2Z2UA 3VOGA 2IQTA 1JEZA 1X38A 2DVTA 3B8TA 2D2GA 4EPEC 1TPFA 4GD0A 2ZZ7A 5BXRA 3H54A 3UZZA 1H1ZA 3PZIA 3CZGA 2I14A 1JCJA 1EXBA 1JCXA 1BZLA 2VT0A 1MXDA 2ZA1A 3VNJA 1GVFA 4JQ3A 2BX7A 7TIMA 4QG9A 5EMMA 3UR8A 2P8BA 1ML1A 4TVYA 2VR2A 2NV1A 2PWDA 2V3DA 2WPCA 1ZXIC 1I0DA 1OC5A 1GK8A 3RLUA 5IFTA 3K4AA 2QZRA 1AH4A 3WJWA 1GOIA 4RW5A 1TVPA 4C6IA 3TV8A 3W1PA 1MYRA 1JPHA 3HMCA 4DO6A 5ECVA 3BARA 4R5EA 1XDJA 3KHDA 1W91A 4ORMA 3L2IA 4QIUA 1O95A 1EBGA 4Q4SA 1X6UA 1K9FA 5CSSA 4BQ3A 4XD5A 4HZ6A 2ACRA 4ZFMA 4LUSB 1DQXA 2PU1A 2X05A 4NNCA 3WQ8A 2GQ8A 2DORA 4JTHA 4AXKA 2E77A 1QFEA 1FOBA 4FSAA 1LT7A 3R2GA 3MUY1 3PZVA 1CNVA 3GAYA 1UR4A 4JFVA 1XXXA 3MS8A 3LSBA 1BSIA 4H7ZA 5B7YA 3NXLA 1EWDA 3WDIA 5A8OA 4JDRA 3N4EA 2EF9A 4YTSA 3VD7A 3HPXA 4BURA 5CPNA 2WMFA 4XKYB 1JZ8A 4MYXA 3NWRA 3VCRA 7A3HA 1AMYA 1E1CA 2ZOXA 3WYZA 5BWFA 2WJZA 3CGBA 4HMNA 4PUDA 2G37A 1JZ4A 2WSPA 3KVMA 1CXFA 4LF2A 5E6ZA 3TTQA 2ZDRA 2DIKA 4ZB0A 3DYMA 4KS0A 1O12A 4WOQA 1LRNA 5I23A 3U0HA 3NUKA 4QG8A 4GACA 3BMWA 1HJXA 3BDKA 1NQ6A 2DT1A 2PRLA 3GG1A 2ACQA 4J40A 4MKVA 1XISA 3CT2A 2CBIA 2FGBA 1BQCA 2EPLX 2D2JA 1JCTA 3IJ8A 4Q7IA 4QGCA 2D1ZA 4TMBA 4AX6A 5LA0A 1Z89A 1YLVA 4B4HA 4RZ6A 4ZQPA 1E9YB 3ICJA 4ZQOA 2FLIA 4JX4A 3THDA 4JTGA 4TX9A 1TV8A 3KZPA 1M6JA 2H9AB 2J7GA 4H4PA 4ZQNA 1VEPA 4KEMA 4H4QA 1UUMA 5B80A 7CGTA 1KFJA 4WD0A 2EG7A 1CGXA 4XWUA 1OT1A 4HSNA 1GVOA 3G1AA 4EXBA 3M47A 6XIAA 5I02A 3CUZA 3NSMA 3JS3A 3VIOA 3UBPC 3AHTA 5CBJA 1MUCA 1PHQA 2PTYA 1VJSA 1WCGA 9XIMA 3SEPA 3BSGA 2GFTA 1QRQA 2YW3A 1KLYA 2EPNA 3FEQA 5AZ1A 2CETA 3DFOA 5H91A 4M82A 3QV8A 3N4AA 1SFTA 3BLIA 2CHOA 1B3XA 3FA5A 1RAKA 1LJYA 4G9PA 1T40A 3QEZA 3STCA 3CBWA 4Y8EA 3DUGA 3E2QA 5DMMA 3T08A 3R07C 3QPZA 2OTDA 2OWXA 4BHYA 5HNNA 3AROA 3F4CA 3EZ4A 2YAUA 3HM7A 3QOMA 1A0EA 2YDAA 4R9XA 4UOZA 1IXPA 3VZZA 1J6PA 1QOQA 5G2WA 5LIWX 3PF3A 2RFGA 3MBDA 1ZAHA 2ACSA 5I3DA 3B0VC 1PZ3A 2C13A 3A9IA 1HXJA 4LGXA 3AIUA 3B9JB 1GG0A 2BOGX 2VX4A 3OVGA 1LBLA 4FR6A 3NQEA 1RBOB 4N2YA 4KIEA 1VR6A 5C8BB 2NX9A 2A79A 1H41A 4KWVA 4NUWA 4LUJA 1F3EA 4GI8A 4J3XA 2VFHA 4X9YA 1V8EA 4YWIA 1XHCA 1EJVC 3HGRA 1JQVA 1MQRA 4C5YA 2J8TA 2BGQA 4IT1A 3YPIA 1HP4A 4MLJA 4MB5A 3VMOA 4H4YA 3PM6A 3AXIA 3W1UA 4GBDA 1XGDA 3ITOA 1QNQA 3M1ZA 1PV8A 1A5KC 3K46A 3M6YA 3E02A 4ZXOA 2C3ZA 3SJNA 1KTCA 1QI0A 3FYPA 3NR0A 4FNUA 3J7HA 1V6WA 3DK4A 3ZYZA 1DIKA 1I0BA 3OA3A 2ZZ0A 1AQFA 4Q8NA 1TZZA 4IMAA 5FOOA 3EKLA 4JEQA 1JZ5A 2P0OA 2QIIA 3IK2A 4Z0SA 2PDWA 3WQGA 3HTWA 3GVWA 3G1DA 5D2TA 3SURA 4M7TA 1ISVA 1WYIA 4FS9A 1GERA 5JIWA 1LBMA 1IF2A 3LBMA 3PZQA 5A6MA 5HJYA 3CWHA 2F6KA 3AIWA 4ZQRA 1XLBA 3W1AA 1JDAA 1GKPA 1QNVA 3M46A 1MW2A 1ITQA 1EOKA 1JYNA 4I6VA 2WNWA 1Q2RA 5M03A 3H2EA 3KM8A 3PTQA 6A3HA 1QPNA 1PDYA 2ZVIA 1Q3NA 2HK1A 2ZZ5A 4HPNA 3E2VA 2CHNA 1XJBA 3W7CA 3BANA 5I09A 4Q4MA 2QPSA 1WUFA 3L4ZA 2GUUA 1KFWA 3W83A 4LCRA 4X2PA 2QF7A 3WQFA 3UPWA 3EWBX 2AQVA 1LBFA 5DF0A 3VNYA 5EPDA 5GVJA 3CGCA 1H5YA 3N4FA 3NAVA 4L1XA 3VMNA 4HA4A 3B40A 4E4UA 4AH7A 3R0DA 4AMCA 3GY1A 3N73A 4ERGA 5AYIA 3GNDA 4MZ8A 5CH9A 3H4KA 3CZ8A 3EMCA 3NDYA 1HL8A 1R2RA 2V5DA 1E1FA 4XX6A 4CCCA 3V36A 3DHDA 2WC4A 3NOYA 3SCRA 1RJPA 4GZJA 4BFAA 3W86A 4F0RA 3HU7A 3JW7A 3D3FA 3IVTA 4KEZA 1EX1A 4C6KA 1JPMA 4C6QA 1A5OC 4LVAA 5CZ0A 4LB3A 1E9IA 3UESA 4QBXA 1V7AA 4IHCA 1IV8A 3O0KA 2P8CA 2W0HA 1HF6A 2O7QA 3CIXA 1XF0A 5DXYA 3S1GA 4X3ZA 4HU4A 1H7XA 3KL0A 1EF3A 4C5ZA 2YCIX 4XSMA 3HO8A 1HKJA 2GLKA 1WAWA 3P74A 3KS5A 1X1NA 2FTPA 3MZ2A 4YL2A 3ZT7A 5D8ZA 1IT8A 3GC2A 4TTUA 4QEEA 1HG3A 1LCOA 3RO6A 1UKPA 1SJAA 4IGSA 1UOZA 5EMKA 2DH2A 1B3YA 4LAUA 3M0IA 5M2FX 4YPJA 1YDVA 5HANA 2GK1A 3GHSA 3FA3A 5JBFA 1A5CA 1V4YA 1GOWA 3RJYA 3L5AA 4CQ8A 2Z25A 3B0YA 5AHEA 3BG3A 4B5SA 3KOWA 3L12A 1ISYA 4EXAA 4D72A 2D22A 1M04A 1X39A 3DOPA 4GUGA 2VM8A 1ITCA 4PULA 4DO5A 2A7RA 4CD7A 4FF7A 3SN4A 5BW6A 4QSFA 5FAGA 4PA8A 2VUNA 2DSUA 4Q3MA 3WJXA 3WQEA 3USBA 1V0MA 3H55A 4UFJA 4GX8A 1PHWA 4HU0A 4X60A 1ZZMA 3LYEA 1EJUC 2EEXA 2W4XA 3ABRA 1JPDX 1XD0A 3WDQA 4PCPA 4DUOA 1JCMP 2P1FA 2G96A 4B9YA 3P5YA 4RNJA 3U4AA 3URQA 5E0KA 4BR1A 4IQJA 1WPCA 4NSBA 3IJ6A 3H70A 5KVIA 3L2MA 1LP6A 4DWSD 1RP8A 1GOQA 3A3XA 1Q5MA 4JR5A 4FXJA 1R38A 1FECA 4GVGA 3GHTA 4MWAC 3KRZA 2X0YA 2ZUVA 5E0CA 3B06A 3IIZA 2J75A 4NG3A 5AHIA 2AAMA 3CHEA 3UJ2A 1CXKA 3EWWA 3TC7A 4K7VA 1YHTA 3MWCA 4NZ4A 4MSSA 3LZ3A 2WSQA 3ZT6A 2QCEA 1PYFA 2WCAA 8CGTA 5I03A 2IXUA 1DIDA 2XSAA 3S47A 3H21A 1LROA 1TPDA 1ZFJA 9RUBA 4HTYA 4NZFA 1IEIA 1B0IA 4Z1BA 1PCKA 4CGTA 2ZE3A 3UWWA 3IRDA 4ZOAA 1ONEA 4C6MA 5CQ1A 4RZ5A 1W1TA 2CZEA 5MKGA 1XIEA 2BHUA 5A6TC 3KUMA 3LENA 4QJ5B 3W7MA 3LX9A 3BMVA 1DP0A 3UG5A 1XD1A 3UXDA 4AWSA 1TWIA 4AZGA 2C18A 5FMHA 3NQVA 3LMYA 1WNOA 4K38A 4L6HA 1BG9A 1EB3A 4PH6A 1J2BA 1XDLA 3AWOA 1P6CA 1IR2A 3WNPA 2DV0A 1NARA 4O19A 1A0CA 4GIEA 2E25A 1B57A 1O5XA 3CLMA 1JRCA 1K8YA 2OEJA 1PSCA 3TROA 3VILA 1RP9A 1R3RA 1WZLA 5C7HA 1HJWA 1R87A 1T7LA 2QYGA 2G50A 2UV8G 1TE6A 2AMXA 2NV9A 1NFBA 4PEKA 2CESA 1UP0A 3CHCA 3SCUA 2DUAA 3FGCB 3OW1A 4V2XA 1EDTA 3LZ5A 1MRAA 3GG8A 3WUBA 4H6KA 1NHSA 4KW2A 3TQPA 3BE7A 3SUVA 5JVLA 3RDKA 1I1XA 3LS9A 4MG4A 2PDBA 2RUSA 4O1AA 7ODCA 2VJXA 3CS2A 1I4NA 2E1DA 4Y9AA 3MP4A 2EPMX 2WOVA 4D6EA 2FDMA 3EOLA 4XVEA 1JDCA 1H2JA 4RE0A 1NWUA 4C6PA 1NDVA 3CYJA 4DRSA 4GUJA 2FPTA 1XRFA 3SQPA 3VKDA 2BP1A 2DZVA 3NNTA 1R3QA 1B31A 2Z6IA 3VAVA 2YVFA 4HHHA 1UUOA 3SIZA 3NTYA 4U3CA 4PL1A 1GPWA 4WDWA 2POZA 3LGDA 4HYVA 3CQJA 1DXEA 1PX3A 3KL5A 3GBDA 1RJRA 2GJXA 2Z28A 5I78A 2OYMA 4EF8A 3WH6A 5CC3A 1EGZA 1RXOB 4CN6A 1S5WA 3BTNA 4FZIA 1IHIA 2FB3A 2ZUMA 4K68A 3KOXA 6REQA 3O6YX 3K13A 4F0HA 2OXNA 2CIPA 4YXGA 4L9XA 1F5ZA 3SADA 1CXHA 1T99A 3SIMA 4MDOA 4KH2A 3N14A 4M3PA 1TIMA 5I3KA 1H4PA 1VAHA 2J74A 4HN8A 1VJIA 4U3AA 2O4QA 4R34A 2WMJA 4JKLA 3AIRA 3I6EA 4ZO9A 4QQ3A 2GPTA 4EMWA 1M7JA 3RUBL 2WMIA 3VOHA 2XU2A 2E40A 4AXNA 2ZUNA 2WHJA 4H19A 4LTSA 4YCOA 3O05A 3M0HA 3RM8A 1M7XA 3O1NA 1DQWA 1EP2A 4O54A 2OWWA 4GC3A 4XBKA 1EBDA 3MSYA 1STZA 4GNVA 3W28A 4E2OA 1OABA 2R6OA 1UR9A 4DZIA 2PDLA 3K4DA 5DT5A 1W2VA 3TNOA 2HJPA 5KETA 3RPMA 1XBZA 1VFSA 1THFD 4L65A 2XIMA