1BQGA

The structure of the d-glucarate dehydratase protein from pseudomonas putida
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
411
structure length
399
Chain Sequence
GAPVITDLKVVPVAGHDSMLLNLSGAHGPLFTRNILILTDSSGHVGVGEVPGGEGIRKTLEDARHLLINQSIGNYQSLLNKVRNAFADLRIAVHAVTAVESALLDLLGQHLQVPVAALLGEGQQRDAVEMLGYLFYVGDRNKTDLGYRSEHEADNEWFRLRNKEALTPESVVALAEAAYDRYGFKDFKLKGGVLRGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTKEPLQIKGGLVEVPKKPGLGVELDWDALMKAHEVYKSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-GLUCARATE DEHYDRATASE
publication title Evolution of enzymatic activities in the enolase superfamily: crystal structure of (D)-glucarate dehydratase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Glucarate
total genus 129
structure length 399
sequence length 411
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 1998-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bqgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bqgA01
2QJMA 3ZLFA 1BQGA 3DEQA 2ONEA 1JPDX 2OLAA 2OZ8A 1MDLA 3N4EA 2XH7A 3GO2A 1KKOA 3RGTA 2CHRA 2PP3A 1TZZA 3S47A 3T9PA 2OQYA 2XGZA 3IJIA 3H70A 2GGHA 1L8PA 3DERA 4GIRA 1EBGA 1P48A 2DW6A 3PK7A 3Q4DA 2I5QA 3SQSA 4H19A 1SJBA 3JVAA 3V5CA 2GGJA 2QDEA 4Z17A 2PMQA 1FHUA 4E4FA 2FKPA 2PA6A 4ZA0A 1ONEA 5FJPA 3SJNA 2PTXA 3I4KA 3TWAA 1NELA 3T4WA 4IL2A 3OW1A 4HYRA 4GFIA 3I6TA 1R0MA 3OPSA 3MQTA 3RCYA 3DG6A 3UJFA 3QKEA 3R10A 4HNLA 4HNCA 3MUCA 1NU5A 2PODA 3RR1A 3D47A 3FYYA 4EWJA 2PGEA 1EC8A 3R25A 1RVKA 1MNSA 2QQ6A 2XH4A 1JDFA 1PDYA 3EKGA 3HPFA 2OKTA 3KUMA 3ES7A 3V5FA 4A35A 2GGIA 3R0KA 4IT1A 2PSNA 2AL2A 2PU0A 4K8GA 1FHVA 4E4UA 3TJ4A 3UXKA 3OZYA 2PPGA 2OZ3A 3MY9A 2QJNA 2PCEA 4HN8A 3N6JA 3B97A 3DFYA 3TW9A 3TQPA 2MUCA 3I6EA 1EC7A 4IHCA 2HNEA 3DG3A 2NQLA 3FXGA 4G7FA 3NO1A 2AL1A 3TCSA 4H1ZA 4X2PA 1EC9A 2MNRA 5FJOA 3MWCA 2P8CA 3ZLGA 4FI4A 3GC2A 4DYEA 4ENLA 3TOYA 4A3RA 1JCTA 3DFHA 3FCPA 4F4RA 3CK5A 1MUCA 2HZGA 3FJ4A 3BOXA 3GD6A 2OO6A 3JW7A 3VFCA 3TJIA 2GGEA 5ENLA 3DIPA 2O56A 1WUEA 4KPLA 3V3WA 2RDXA 2PS2A 2GL5A 3V4BA 4KEMA 1XPYA 6ENLA 3DDMA 4IL0A 1SJAA 3THUA 3IJQA 4DXKA 3H8AA 2PTYA 4IZGA 3VCNA 3CXOA 3S5SA 4ZCWA 4IP5A 4ROPA 3UJSA 2DW7A 2OFJA 1MRAA 1P43A 3DG7A 2PP1A 4E5TA 5EU9A 4HCHA 4KWSA 2XH0A 4GYPC 4J3ZA 3PWGA 3PFRA 3U4FA 3RRAA 3EEZA 3MZNA 3MSYA 1ECQA 3SBFA 2AL2B 3CYJA 3SSZA 3OZMA 3T6CA 3TTEA 3DGBA 3T8QA 1OEPA 1W6TA 2PTZA 2OQHA 1XS2A 2POZA 2P8BA 1TKKA 1KKRA 3RITA 1BKHA 3D46A 3N4FA 1KD0A 2P0IA 2ZADA 4HCDA 3NZGA 2QGYA 3ENLA 4JHMA 2AKZA 4J1OA 5J04A 3RO6A 4DWDA 3NXLA 2OX4A 1TE6A 4MMWA 3R11A 4KT2A 3ES8A 4M6UA 1PDZA 4MKSA 3OP2A 4Z1YA 3UJ2A 3FVDA 7ENLA 3Q45A 3N6HA 2HXTA 3ZLHA 2HXUA 4GMEA 1YEYA 2OVLA 3ZVHA 4DHGA 4YWSA 3UJEA 3UCDA 3H7VA 3JZUA 3TWBA 2OG9A 3P3BA 4GYPA 2XSXA 3BSMA 2P88A 2PGWA 4MGGA 3ZVIA 3FV9A 4GISA 2PP0A 3UXLA 1E9IA 3NFUA 3GY1A 3R1ZA 3UJRA 3IK4A 5BOFA 3VC5A 2PTWA 1IYXA 1F9CA 4DN1A 3BJSA 3UGVA 2GGGA 3VCCA 3VC6A 1SJDA 3P0WA 2GSHA 3R0UA 4E8GA 2FYMA 4A6GA 5FJRA 3CT2A 3VDGA 4K2SA 3U9IA 3P93A 4H2HA 3QPEA 1MDRA 1ELSA 3K1GA 2XH2A 3STPA 2OPJA 4FP1A 3SN0A 3CB3A 2OZTA 4JN8A 3CAWA 3QLDA 4H83A 4GGHA 3SN1A 2QVHA 3OTRA 1SJCA 3H12A 3PWIA 4DX3A 2ZC8A 4GGBA 2QJJA 3UCCA 1DTNA 3DESA 3SN4A 1JPMA 4HCLA 2QDDA 4E6MA 1R6WA 5FJTA 4IP4A 3MKCA 3IJLA 2P3ZA 1WUFA 2AKMA 2PU1A 4K1WA 3QN3A 3VA8A 4G8TA 5BOEA 3QTPA 4JN7A 4HPNA 1KCZA 1EBHA 2GDQA 3ZVHB 5IDZA 5FJUA 4M0XA
chains in the Genus database with same CATH superfamily
2CERA 1P5BA 1XM3A 2HVOA 1BVWA 1I2NA 2OGYA 4XSLA 4ES4A 3C2VA 2E6AA 3N9SA 3DENA 2RJHA 3VOIA 4PMYA 4QNEA 4AF0A 1HP5A 2AQWA 3KS6A 3KX6A 3WMLA 3QQWA 1FY6A 4O17A 1TPH1 1IIHA 4GY1A 1L8PA 2REQA 3CL8A 4LV9A 3WQCA 4KEVA 3W02A 4QE1A 4DM1A 1SZFA 2YFOA 2W67A 3TMQA 1D8WA 4UFKA 3IJDA 3ARUA 1NDYA 4GINA 1GW1A 1MFVA 1KCKA 1NDWA 4D71A 5HMEA 4J57A 4P8UA 4GO9A 4GR1A 3CMGA 1BYBA 1WBHA 1QMLA 2TODA 1UA3A 3TW7A 4LA1A 4IF2A 3RNDA 1V3JA 2CKSA 3VMNA 4UCFA 3EPOA 1TA3B 1A5KC 1KRMA 4GQRA 4XZHA 1E40A 2PDMA 2Z0IA 5CJNA 8RUCA 4FX7A 3VD4A 3S9YA 4GABA 2ZUTA 4LBSA 3NL2A 4IPJA 3ERPA 4RR4A 3O16A 5AOUA 1IE7C 5G5HB 3PB2A 4YIWA 5AYBA 3KHJA 3L9CA 3CYVA 2WWCA 1DHPA 4AB4A 3M6YA 5U25A 1A0DA 1XYLA 4N02A 2W92A 3DFSA 3DK4A 1G6CA 1MXSA 3PAOA 3I7RA 5T9CE 4AWUA 1EL3A 2ACUA 3B0VC 1YW1A 3HV9A 3VNYA 4IIGA 4I6VA 3VD9A 1JUKA 2W4XA 3S5ZA 2V68A 1CWYA 1E0UA 2V3FA 1JXJA 4ACZA 1MZRA 3M46A 2QAFA 5G5IA 2X05A 3NDOA 1K6AA 3CEPA 3PZGA 3WQ8A 1DXIA 3BW2A 1B3YA 4IT1A 4L5ZA 4C6CA 2WNQA 3EWXA 1V3KA 1HUVA 1LQ0A 1S5WA 1PKNA 4R3UA 2OZ3A 1E6PA 3B97A 2VZSA 3SR6B 3DBNA 5A3HA 1ZCOA 2PBOA 1MZHA 2MUCA 3WD2A 3WBYA 1ZS2A 3FKRA 2OYLA 4BWLC 2YDSA 2B31A 3RHGA 3LCWA 4ZQCA 3SI9A 3A21A 3TCSA 4H4TA 1UUOA 4X2PA 3CGEA 1OY0A 1P6CA 5HQEA 4IMGA 1FEAA 4GACA 4GY7A 3TCEA 1Q4NX 3OODA 1DIEA 1OF8A 3KTXA 3P5ZA 4V33A 3EOEA 2D0FA 1GERA 5FJJA 4QISA 4TVUA 3EMQA 3S0CA 7TIMA 5AY7A 4F4RA 3RFAA 2VGFA 4JTFA 3WL1A 4DLMA 3M0KA 3TYUA 5KZDA 1O95A 1H3GA 3I68A 2Z1SA 3HG2A 1LTDA 4TU1A 3EBVA 3NM3A 2PDIA 3BJFA 3QPZA 2QT3A 4HU0A 2V3DA 3DCPA 3URNA 4UNLA 2YW3A 4PTVA 3SCTA 3ARXA 5IXEA 4M6PA 3WUBA 1F6YA 4I7VA 5I0DA 2ATMA 4ROPA 2J7DA 5RUBA 5LA1A 3BGJA 4O54A 2A0NA 2FVKA 3SFKA 3VTRA 5KITA 3LLDA 4US5A 1TUXA 4NI3A 3R12A 4H2CA 5M3WA 1XSIA 3NA8A 3N14A 1VFFA 3M5XA 4W5UA 3RLUA 5EBKA 4JD4A 2AQOA 1YPXA 4OV4A 3BZGA 3ZJ8A 2C3CA 3BH4A 1IV8A 4HSHA 1BWLA 3TSBA 3VIIA 1M1BA 4FX8A 1CGXA 2I56A 2V6AA 2GDVA 3TAKA 3DC0A 2DZBA 3GHSA 2Q01A 4GE8A 3EKZA 5H8MA 3QGKC 4MNJA 5DCDA 3WLQA 1XKYA 3KOWA 3GDLA 5CBJA 4JDRA 5AC8A 3B04A 3UPWA 4PMXA 2D0HA 3ES8A 3S1XA 1QJWA 7ENLA 3GAYA 5LZLA 3R5EA 3UBPC 3SDOA 3FGCB 4MFDA 3WDQA 4DPQA 3W7DA 4DZAA 4WGXA 4QCFA 2NLYA 4IMDA 1EF3A 1G4PA 4GRTA 2FGBA 5A95A 3LS9A 2WOQA 3KFTA 1OGGA 3KRUA 4F48A 4IUGA 3OVQA 1IXOA 1JYVA 2QAEA 3NQ2A 3VIMA 4NAEA 3EX6A 4BQ2A 3WFLA 1EXBA 3WLMA 4AD5A 4GISA 2FZMA 3GU2A 3K13A 2X50A 2WBAA 3E5PA 3SB0A 3A4XA 1GCYA 1ICSA 2D24A 1ISWA 2BC0A 2CCRA 3C0SA 3LRMA 3QHMA 3UWEA 3R0UA 1H09A 4H9VA 3AN1A 1XLGA 3SZ8A 1UZ1A 3QPEA 3KP1A 1TVNA 3MU7A 4JDYA 4WR3A 1BXCA 1P4CA 3QC0A 3S8HA 2NPXA 3EKLA 2FZNA 4ZQPA 5XINA 3W82A 2IPGA 1ONWA 3UA3A 3VKJA 2XG9A 2OQLA 2OZTA 2P53A 1BYDA 3WD4A 1OFDA 2ZVIA 1PV8A 3R0DA 1J0YA 1G4EA 4E2OA 1M6IA 5FS9A 3WQWA 4HBKA 1BG9A 3S5NA 3W86A 4KEUA 1W9UA 1V6VA 4M80A 3B8SA 1SJCA 3CL7A 1W5QA 3UEQA 1DJZA 3ZQ9A 4LUIA 3TTYA 3B05A 4DM2A 2NUXA 1E6NA 2NZLA 2BVWA 4XBJA 2J9ZA 1W1YA 3O3RA 1VEPA 1QW8A 3KL5A 3UZXA 5JBDA 4HA3A 5FS6A 1Q7QA 3CPGA 1XRTA 1LROA 5CPOA 4M0XA 3BCJA 4LUJA 3ZM8A 1NDZA 4WKHA 1W3NA 3FIGA 1R3WA 4AYSA 2ONEA 4S23A 1GNXA 2C3ZA 1Q6OA 3PZQA 2VC6A 4O12A 4EXQA 1QNQA 2Z1XA 4YS1A 1AL8A 4P8WA 1FXPA 1X39A 2PP3A 1A5CA 5I3KA 4I90A 3LTPA 1ADDA 4O0ZA 1K4QA 3T9PA 1QNPA 4Z1BA 3IJIA 2FQIA 1EBGA 3NYZA 3W1QA 3IAQA 2BSLA 2FZ9A 1J5SA 1I60A 1PEZA 2NSXA 1XRFA 4KWOA 2GGJA 3TNBA 2NV9A 3N17A 2XJ7A 4BF5A 3BANA 3DYOA 1NFBA 2HK0A 3DFOA 1K70A 1XCWA 2PB1A 3WQEA 1XCFA 5C9RA 1EX1A 3GXMA 3KZSA 3WH7A 1NOWA 3CZ8A 4AWEA 5C9UA 1UWSA 1ZJHA 4UTTA 3G6MA 1QXLA 1Q7MA 1OX6A 3GHRA 4GVIA 4Y8FA 3E1F1 4MFEA 3P6LA 1B3OA 1QW7A 3EPMA 3QZAA 1PXGA 3QKEA 3UPBA 3HBLA 5H2ZA 4DNMA 4PUJA 5A8OA 2Z4GA 1B57A 3W73A 3RR1A 3AM9A 1GQIA 1JPIA 2NX9A 3FLUA 3ZMRA 4C6QA 3S46A 4LVGA 4IMAA 5C9XA 3LPPA 3KBWA 2C18A 4C6LA 2J27A 1JDCA 3QV8A 1Q1RA 4DEFA 3WNPA 1FO4A 3CLMA 3FA5A 1IWAA 4LRTA 2OCZA 5M03A 2AGTA 2Y7DA 3GKFA 1W5NA 4LOCA 3FJ6A 1AA1B 3NQBA 5FIPA 3ZWSA 2R1NA 4GUHA 4WLCA 2DSKA 4E4UA 2W9MA 3TR2A 4DNAA 4Q8PA 2O55A 2EPMX 3GB6A 2YYUA 1FOBA 2C19A 4FHAA 2YA0A 1X1OA 4D72A 1E1CA 2O0TA 1N63C 3LHYA 4N7QA 4ZEPA 1FWIC 2YOCA 2DT1A 4DELA 4OECA 4MWAC 3W22A 1VPYA 1ZBVA 1DYSA 8XIMA 1HTIA 4MNKA 4Y9AA 3LBCA 1VIWA 1M7JA 4B5XA 1M04A 4JTJA 1W9DM 1XLEA 1JZ4A 3SQMA 1XD1A 1DKWA 5ECUA 1XSKA 4EPEC 4N4QA 2BHZA 1ZTVA 3UNDA 4KMQA 1W9PA 4MZYA 2EG8A 3AS0A 1Q1WA 5CLWA 1E56A 3G8EA 5EBUA 1W3KA 4NVTA 3UZZA 3MT1A 3USZA 2GDUA 2JGYA 4JYEA 3GK0A 3V4BA 3CO8A 4Q22A 5FCZA 1B3XA 1NWRA 3H8AA 3AAMA 4HPJA 4LVFA 1FDJA 3OA5A 3DGRA 5E93A 1JNDA 1F8MA 5DBTA 4OHQA 3GYCA 2IPFA 4FX9A 2PZ0A 1FWCC 4CD7A 4XKYA 3IIOA 2ZDSA 3W01A 2XH0A 1ZRQA 2J9XA 3PFRA 1V4YA 2ISDA 1SR9A 2CXEA 3V75A 3GSMA 3GU9A 4D2JA 2WSKA 1XIIA 4DUXA 1BWVA 3ATYA 4UTLA 1OFEA 3HG5A 2CFFA 2X7WA 3HFYA 1D7KA 3B8TA 3BAKA 3PTMA 3TTEA 1DQXA 3MWAA 4HU3A 1W6TA 2VYOA 1W9XA 1HGYA 2IMRA 1LOQA 4HN4A 3QKZA 2GWNA 2QIIA 4TVDA 4Z2KA 3U0HA 1CGYA 3VZYA 4UWMA 1EGZA 3KRZA 3NQ7A 5BCAA 4CNNA 2BVYA 4DWSA 2C16A 1ZB5A 2BV9A 5REQB 2HCVA 3APYA 3TUUA 4L80A 2PWFA 3U2CA 4M7SA 4LTSA 3W7OA 4XUYA 2VC7A 5M1TA 1UW9A 9XIAA 3PTKA 3BW3A 3DGHA 2Z1WA 3N6HA 3BE7A 4JBRA 3ITTA 4QIUA 3M0IA 1QK2A 3H24A 3L4XA 5FA5A 1KV8A 5CC3A 3NR0A 3ABQA 3BLLA 4LWWA 1Q6QA 5FF4A 4WSHA 3P3BA 2XSXA 4E38A 1V8EA 5F7UA 2GH5A 2V5DA 4A05A 5HXMA 5AECA 3T55A 4AD0A 3PN8A 3UJRA 4J3SA 2F2HA 4LUYA 3S6TA 2P50A 3VIKA 2X8CA 1QNVA 3P0WA 3PY2A 2GSHA 3SCPA 5E70A 3R8HA 4PC8A 2HV5A 3Q37A 1QTWA 3EF6A 3KP0A 5DY3A 3ANUA 3WQGA 3PJXA 3SCWA 3NOEA 1EUNA 1NDAA 1SYTA 4JTHA 3CB3A 5D2VA 3S83A 1J96A 5JCLA 4CN6A 1BEUA 4AMAA 3COTA 2X40A 3B03A 3TEVA 5JVLA 4B4FA 1KGUA 3QH2A 3WQ4A 1PO9A 3ARRA 2QUTA 3CASA 1J79A 3LNPA 3SN4A 3W7QA 4BA0A 2QDDA 4E6MA 1NY1A 1R30A 5DXYA 4FLRA 4JYFA 4LSBA 2ZZ1A 5K3VA 1F3PA 1GVYA 2AMGA 4IPIA 3AHVA 4GI4A 3AMZA 3C61A 1KTCA 1X1ZA 4Q8VA 4NAFA 1VEMA 1IR1A 1W1PA 4ZO9A 1DXFA 1TV8A 4REQA 1LRTA 1Z89A 4FF5A 1EJTC 2ZRXA 4QQUA 4S3FA 3IPWA 3OGSA 1E4MM 3BC9A 4LUSB 1LQAA 1H5YA 1MDLA 3QMTA 3N2BA 3GD3A 5GPRA 1OWQA 1VJZA 4BF9A 2WMIA 3S1UA 4DVOA 4Q8NA 1RALA 1A5SA 3U6WA 3ZSTA 2NVCA 1ZP4A 2V8ZA 3W7KA 4DO6A 3WBEA 3UU0A 3SAZA 1R2RA 3EX1A 4LCSA 3KHDA 3AO0A 4JTCA 2QPUA 3ANYA 3RX2A 4ADWA 4Z17A 3HFTA 3DK9A 1FHUA 5JRBA 2FHCA 2OKOA 3O1NA 5LGXA 3EB2A 2VURA 2I9UA 4LYQA 4TIMA 4EXBA 5AYXA 3I4EA 4JZ5A 4GYJA 2V5BA 1GPWA 1TWDA 1EZWA 1VFMA 5JCKA 4PCPA 1R7OA 5DBUA 4ERGA 4A8IA 3MO4A 3CIVA 4NX5A 1O4UA 1K77A 3C6CA 5I3DA 4AD3A 2DVUA 3RCYA 4BK9A 1E1EA 4LC6A 3DZ1A 3GTHA 3RU8X 4PTMA 1ZBWA 5FF3A 4WUIA 1J01A 3MUCA 3IS4A 4XO7A 1TJ0A 5EYWA 2GJXB 2CLMA 1V7AA 5L9FA 2KAUC 2VDIA 5A8QA 1UMYA 1HKVA 3BLFA 3GLCA 1HKWA 5C5YA 1US2A 1PKYA 4UQAA 5I3GA 2PE4A 1HX0A 4GZ7A 4OTKA 4J28A 1W1B1 4U28A 4LB3A 1EIBA 5E6ZA 4BEUA 4F3HA 1DL3A 2XVPA 4JQ1A 2WLYA 3OLGA 4WDTA 1IF2A 3VI2A 1EYWA 4GLEA 3KWSA 3LCGA 3UFYA 3EOUA 4GX9A 4JICA 4O0QA 1FWDC 1WAWA 3PJWA 1RCXB 1I2RA 2IKJA 4PUKA 4NL1A 4MNLA 3NOYA 3U5YA 1JRPA 2ZTKA 1RBOB 2QHAA 1FWSA 5HNUA 3V7PA 4XZLX 4HB7A 5CGQA 3AMDA 3W07A 3I6EA 3C2OA 2VUYA 1S1PA 1CXIA 9RUBA 2R6OA 1TJ2A 5ABTA 2RDWA 3TAOA 3U2OA 2XZ9A 2I57A 1JUBA 4RZ6A 3BPWA 4AXKA 4QEHA 4MY1A 4AY7A 3PAJA 4UOQA 3DH9A 1HKJA 5GNZA 4YXGA 1EPXA 4MLRA 4GVFA 1V77A 3GC2A 4MG4A 1QOQA 2WOIA 4EM3A 1ZU8A 3GFYA 1P6WA 4NJGA 2CZVA 2DZXA 3N3TA 3BOXA 3JW7A 4W4QA 3NIYA 2WJEA 2VRQA 2HDJA 4KPLA 3V3WA 3EMZA 1SZEA 2JF6A 1A0CA 2V81A 3T2PA 1XPYA 3IWPA 4A3YA 2W3ZA 2RFGA 4PULA 4M52A 2OODA 1ONXA 3WK0A 3IIPA 1JD7A 5ECVA 2ACQA 2ZOXA 5E9AA 4E8DA 4H9ZA 4IPPA 1RV8A 2ACSA 1FCVA 1XLAA 1UP3A 4OJYA 1VH7A 1Y0EA 3CUFA 4CUCA 2WSQA 1RP8A 1U30A 2WNWA 4L4OA 2B7QA 2YGYA 3AZSA 2BHYA 4C7FA 3U4FA 1DORA 3NVYB 2DU2A 3TYCA 1ECQA 5HWMA 1FFQA 2GK1B 3SURA 4NI8A 4JFVA 4MB5A 1QK0A 3OQ8A 3V0UA 3RNMA 2CXGA 3QM3A 1QVBA 4UTHA 1I8JA 1LCOA 2CZDA 3VZXA 4C1LA 3TXZA 4LVDA 1XDIA 4AF0B 2VD9A 3BG5A 1XC4A 3RITA 2PDJA 3R89A 4JQ2A 1BKHA 1R86A 4S3EA 3NPWA 4RDYA 4QJ5B 3TC3A 3MBDA 1RAKA 2P0IA 2EHHA 3LI1A 3W83A 5HR7A 3MDWA 2H3BA 4NILA 3NZGA 2REQB 4TX9A 3RPTA 4DPPA 2JF7A 3ZR4A 2VNCA 4QAWA 2XZ7A 3CIWA 4KFNA 3U4AA 3BSGA 1NP2A 2EQ8A 4LQ1A 5E0FA 3VAVA 5A6BD 1F4AA 3H2FA 1HGWA 2BY2A 1L2QA 4MZ1A 4DHGA 2VR5A 3W29A 1OF6A 3CGBA 3TWBA 3O6DA 1Q6RA 4L64A 3BSHA 1GW9A 5LHFA 4FLSA 2GSJA 1E0XA 4BF7A 5CSSA 4C7GA 4M1RA 3ZJKA 3B4UA 2IPJA 3BV7A 3ZVIA 3G77A 1D3HA 1LWHA 4ATLA 1TQXA 1RJPA 2QW5A 3ALGA 4H8VA 3MUIA 3LK6A 3BJSA 1A80A 4Q4KA 4J3XA 4JIEA 4AX6A 1QR7A 1H7PA 3F03K 2NQJA 3IIZA 5KZMA 2PI6A 4PMUA 4PFMA 1G67A 1I6NA 4GD0A 2RH9A 3T0BA 3WH8A 2V2CA 4U10A 1NF0A 3TC6A 5BZAA 4JTKA 1QO5A 3RJXA 2EG6A 2NUYA 4JNZA 4S1FA 1TVPA 1SVDA 2JK2A 2NW0A 4KEZA 1TIWA 4BWLA 1JD9A 2E3ZA 4H83A 4X0VA 3SADA 3GNDA 1DWHM 4J2MA 2WHLA 3XISA 3HF3A 1ZJIA 1QAPA 2WOVA 1T7LA 4H4RA 3B8IA 3QZ6A 2WMGA 3FX4A 3T78A 3SEPA 3MP3A 2P1FA 3L5MA 4V1YA 1EP2A 3BCDA 3MKCA 4EAMA 3C8FA 3RAOA 3DJJA 3W0KA 1OFOA 2NT0A 3QN3A 4PMQA 4A21A 1RJQA 2Q71A 4I5RA 4QAIA 1K9DA 2NT1A 4JN7A 1KTBA 3VFLA 5GVJA 1E4NA 1EJRC 4WRHA 5AZ0A 2PLKA 4C7DA 5D4YA 3M6DA 2OU4A 2QJMA 4UTWC 1B54A 1E43A 1A47A 4F2TA 2OJPA 4S38A 2BVDA 4ZZ9A 3AU6A 4KF1A 3AYVA 1T3QC 3TVAA 4W85A 1GRHA 1OX4A 2ANUA 1PIFA 4XZIA 2G3MA 1NHSA 1N2VA 1G94A 3L68A 4QP0A 2JE8A 3GC5A 4PBGA 2DZAA 3JR2A 4GXPA 3VDHA 3LXBA 3EEGA 4KRUA 4EVZA 2WAGA 1ITXA 4KCWA 4MHBA 3RO8A 4JN6A 2QR6A 4KRTA 2QJIA 2FKPA 1EPVA 2CDUA 1UC4A 1TJRA 1X8FA 2QLYA 1JZ6A 2EQ7A 3LHTA 1RQBA 3OW1A 4HTBA 3NZPA 3H2OA 2QUUA 3A64A 4IG2A 2WZMA 2HWGA 3AZTA 3PBVA 3VIOA 4ICNA 3UG3A 3MQTA 3GIPA 1OGBA 1AQMA 3NTYA 2NVDA 4GZIA 3W75A 2XN0A 3GG8A 3ZZ1A 2VRKA 1XLBA 4A8RA 5E1QA 4IIFA 3D47A 1DIKA 3BG3A 3O05A 5A94A 4IX2A 4L1XA 4QS5A 4TVCA 2PGEA 1TJPA 2DT0A 1DXLA 3H7UA 2HVNA 3NO5A 2WKGA 4L9XA 4C6MA 3R25A 2R9ZA 4S39A 2A7PA 3E2RA 3EUB3 1V03A 1TYTA 3U48A 3A7RA 2E67A 2O9RA 4H3DA 2XYLA 5FAJA 1P7TB 3STGA 1NARA 4HYVA 4CCZA 4W7VA 3TJXA 1M7XA 1VFOA 2CLEA 3A7UA 4HNVA 2EKCA 3M5YA 2G5WA 1U5VA 2GUYA 3UXKA 2IQDA 1LPFA 1FVPA 3G1HA 2Z1BA 4TQTA 4QJ3B 1HKMA 2Y5SA 2VENA 4IQEA 3NQMA 4LEQA 1MUWA 1CGVA 2YL6A 3WYZA 4HIBA 3ECQA 4Q7BA 3ZO9A 1F61A 4AVFA 2E8ZA 3FXGA 4Q4MA 4RDVA 1TYGA 2V3AA 1WKEA 1CDGA 3SIMA 3VNJA 3NVDA 4H4XA 4Q6XA 2JQXA 4RV8A 5F4XA 3WQ5A 4XKMA 1LJYA 1LBFA 5D09A 2UY4A 3FFSA 4YVPA 3CHDA 3CK5A 5I2UA 5A8NA 5IFPA 2WO5A 3ORWA 4V15A 1ICQA 3C2RA 2E68A 3TJIA 5HUPA 5L6UA 4C6KA 1M6JA 3S6OA 7TAAA 4IX0A 1TFVA 1GRFA 1P1MA 1EUAA 3OBEA 3QMSA 6ENLA 3WUEA 4U4MA 1SFSA 2WNNA 1YPFA 1BSLA 4HMEA 2PTYA 3BQ5A 4IZGA 4NASA 3WF2A 4QG9A 2ZYFA 1XIEA 2AQVA 2PP1A 1XG4A 4H50A 2BZNA 2X41A 4O0KA 2ON3A 4BS0A 1YQ2A 4J3ZA 3HIJA 2EO7A 3E0WA 1E6QM 4PSRA 2WPBA 3D6NA 4KGJA 4K7YA 1I9CB 2DQXA 2NX1A 1QI0A 2XPKA 3ANVA 4JTRA 4BCEA 1T40A 3BLIA 3HGOA 3AI0A 2PLCA 3T7VA 4GIEA 1C90A 1KD0A 2ZADA 4GWEA 2VCAA 4OVXA 4ZOHB 4JHMA 3EWWA 1IXNA 1KR1A 1MQRA 3CTLA 3PZVA 4W84A 3KLJA 5HOSA 4DBWA 1JZ5A 3T81A 1FX6A 5K9CA 1VCGA 3U2ZA 3AHZA 1GYNA 4XQ6A 4PUMA 1H60A 5JCMA 2WMHA 3S2NA 4H9YA 3PZIA 2RJGA 3VGHA 2WVSA 3ITOA 3GHTA 3VOFA 4N6FA 3T08A 5IFTA 1XFCA 1MUMA 4Q4QA 4NSBA 4S2BA 1XHGA 2HE8A 2VT0A 5AHMA 3WD0A 3AICA 3CC1A 1YMYA 1W3IA 4K6AA 5CPQA 4YVXA 2XVLA 3EDKA 3W53A 2E7FA 3L4VA 1AFSA 3VC5A 3BZJA 3KVKA 2QS8A 5AVNA 2GGGA 4F8XA 4RL3A 1S2VA 4NZJA 3MCOA 1GRBA 3M47A 3R13A 4ZB2A 2OPJA 1VCFA 1TUFA 1MXDA 3HV8A 1VLIA 3P67A 4MWAA 3QQ1A 1UKOA 5AHFA 2Q3RA 3DHFA 5CGMA 3CAWA 1UR0A 3WH9A 1A4LA 3O63A 4LYKA 3T07A 4GGHA 3SN1A 2E4TA 4IMCA 2VFFA 4FK9A 1DWFM 1XYAA 3OHMB 4Y90A 3TN4A 3PWIA 2ZRVA 3CWHA 4ZGYA 1FWAC 3BMXA 1GVSA 3VNZA 3P2VA 1LRQA 1JPMA 4QG8A 3RDKA 2G4JA 3IJLA 3W1NA 4JIQA 4O57A 3W2LA 3UXIA 1H51A 1H11A 4GCXA 1EA9C 2PDNA 4BQ4A 4HZ6A 1UPPA 5FJUA 2F6XA 1UOKA 2VC9A 5D2YA 4JTIA 4HNOA 4AD1A 1BQGA 3H7RA 4HOXA 1WO2A 1TPDA 3IC9A 3C56A 3TOPA 1VKFA 2C15A 2QF8A 1XL9A 3MBFA 3URAA 3BVJA 1MEIA 3AIUA 4LCRA 1C7TA 3SIZA 4ZQRA 5DLCA 4GIRA 3EOSA 4S3GA 3RILA 5CSUA 4W8BA 4ONVA 4UQBA 1G69A 2J13A 3NGFA 3KBNA 8A3HA 3D3FA 2ZVRA 4E8CA 4JIHA 1RJRA 4PBEA 2YDAA 3CHFA 4EP8C 4PEKA 1DBTA 1HKKA 2QCFA 1XQLA 4EF9A 2PDFA 4XKYB 4YL2A 5CZ0A 2QEZA 3TWAA 4C6OA 1YPIA 1AH4A 1F05A 4IGSA 1GRAA 5E0CA 4DBUA 4PMNA 2WCGA 3FJLA 4HZ7A 6CGTA 1VBRA 3L5LA 7CGTA 1N8IA 4KGLA 4O8AA 4K37A 2Z2AA 2WJDA 1E0TA 1GOIA 2DSZA 2RDUA 3P81A 5FD0A 1G4TA 4WCJA 3QFWA 1XLLA 2YJQA 1NWUA 4B5TA 4D1IA 1J10A 3EB3A 1XHCA 5XIAA 1NQKA 1XGZA 4XWUA 1GK8A 1C93A 4D8LA 1D7YA 1P0DA 4FS9A 3LPFA 2EPKX 4MJMA 3DYPA 4ML9A 4X9SA 3ITLA 3T42A 1QFEA 3W24A 1MNSA 3PHAA 4B5UA 2B7NA 4CGTA 3AHXA 1UKSA 1JDFA 3QYQA 3TROA 5JIWA 3GXNA 4H7ZA 1RH9A 2FH6A 1YTEA 4HNUA 2E8YA 1BGAA 1BF6A 2IS7A 4K8HA 3WJYA 1TE1A 5ER0A 5IHSA 1ZMCA 1C9DA 4K8GA 3SUTA 1E71M 3DC8A 3THDA 3CL6A 3FS2A 1RCOB 1W91A 3C3UA 3O06A 3RPMA 2QJNA 2PCEA 3BAWA 4PTXA 2A3CA 3KEHA 1JEHA 1EP3A 2ZRZA 3QSTA 3ZR5A 1ISVA 2INZA 3L7RA 2D2HA 3NQCA 1V0MA 3CPRA 4UQ9A 1YLVA 1R3RA 3VUSA 3MCNA 4MJZA 2WPCA 3FDGA 1IGWA 3IRDA 2QXWA 5JU6A 1PIIA 4FR6A 5AB3A 5K2ZA 4KW2A 4G7FA 1S7MA 3VDCA 3HM7A 5AC5A 4R7OA 1EHAA 5I6SA 1HQTA 1KM2A 1P0NA 2PD9A 3NWRA 2OB3A 3G2GA 1LBLA 1JCTA 4LANA 3FOKA 2WWDA 4KESA 2DPEA 2DH2A 2Y0FA 4RK8A 1S46A 1J5TA 2C79A 4LU0A 5CJMA 3OLIA 1A5OC 2FHFA 3ZOAA 3G1YA 5I3JA 1FWGC 5FS8A 1CTNA 1PUDA 3NSNA 1NWTA 1SJAA 5TAOA 2W3RA 1E6RA 1GREA 4O18A 1QHZA 2XFYA 1WXZA 3CV1A 1T6MA 2XM1A 1ZENA 4W8AA 5DFAA 3UJSA 2XVKA 3LSBA 1MRAA 3TZFA 4KQNA 2R1KA 1GKPA 4AAJA 2D69A 3P5YA 6REQA 1SU5A 3KCOA 4GYPC 3OO2A 4BI5A 2W54A 4B2DA 3MZNA 3HGJA 3CB8A 2DP3A 2DT3A 3NZRA 4MNMA 4PUNA 1CPUA 1AG1O 5CC7A 4GNJA 4G5DA 2TSYA 2Z1VA 2W61A 2WW5A 2ZZ3A 4S2CA 2WMIB 3T0CA 5CC5A 4O8RA 4PTDA 3GX9A 4R5EA 1O66A 3UF9A 4JR5A 3WK1A 3M7WA 3CUJA 2DIKA 4JCLA 2AKZA 2X42A 3DFTA 4WJXA 2OX4A 2WB5A 2WSPA 1OC5A 5HDRA 1J0IA 1V97A 3MB9A 3M1ZA 4EPBC 1VZWA 3FVDA 4FPSA 1EWEA 3G0UA 3KL0A 3W87A 5E0KA 1K3UA 4RLIA 2BY1A 3A12A 1IEVA 2BB0A 3VE9A 2W63A 1W3LA 2JKPA 5BOOA 3FYPA 3UCDA 6PTDA 1UUMA 1F07A 3JZUA 3G1SA 4JKLA 2J7CA 3B40A 1S5NA 3G3MA 4AZHA 3U7BA 4QLJA 3CAKA 2IPWA 3RMJA 1NHPA 2JEQA 3MMWA 5GNYA 4BKNA 2CKRA 3PPHA 4I9TA 5A8MA 1VHNA 4F9DA 3TV8A 3SQLA 2J47A 3OU8A 4TTGA 5BRQA 1W2VA 2ISWA 4H4PA 4RE0A 1FBAA 1XPGA 1CZ1A 1HW6A 3NL3A 3OYZA 3KOFA 2ZKMX 1UR2A 1NSJA 4UOJA 4QJ4B 1ELSA 1N5WC 3QFAA 4DXVA 4JQ9A 1ZAIA 3GDKA 3NL5A 5EMLA 3DFPA 1OCNA 2Y2WA 1VFSA 1QPNA 1R3YA 4FP1A 2O9PA 5EBAA 3R8GA 4EQWA 4D6DA 2VMFA 1K7EA 1R38A 3QXBA 3B9NA 2A7NA 2OYMA 4HSNA 4NEVA 2DY3A 1TPEA 1X97A 3QGVA 1PB0A 4JNYA 3VKKA 2GVYA 2C1IA 3C0QA 3AUJA 3SFWA 1IWBA 3E2VA 3PBGA 3FSTA 2WPGA 4PRTA 4XZMX 2ZFAA 1JZ2A 1VP5A 2R91A 3UQNA 2PC4A 2QCDB 1DJHA 2BBFA 4ZE5A 1AUSL 3TA6A 4ZB0A 2WPEA 2PCQA 3L0NA 3WQOA 1V0LA 1RA0A 2PRLA 3O6AA 4EE9A 5CZJA 3PP7A 2NQHA 1HJQA 1C91A 3WELA 4DJEA 3W76A 4MDOA 3B0XA 3L8KA 3BGGA 4J5NA 4JX5A 1MWOA 5K4XA 1PTGA 1O1ZA 5FI8A 1YBQA 5FKYA 2YB1A 2GQ3A 3QV9A 3SO7A 4PFHA 1PL9A 1G4SA 4UOZA 4UMBA 4C6EA 2YFNA 4M81A 3GH5A 1GKRA 3BTNA 3IV8A 4H9TA 4B5VA 3V1HA 3DKLA 4HPHA 4Z2IA 1E3XA 1B31A 3DGZA 2QF7A 1B0IA 1TIMA 2FDSA 1JEZA 1QWGA 2PA6A 2I16A 3T4WA 2GFTA 4GO8A 5DMYA 4GFIA 1X6LA 4M56A 3NQDA 2VGGA 1GONA 1XV8A 4HK6A 3EDDA 4TX6A 5A6AA 1U1UA 1B1YA 3RXZA 4ZFMA 3CQIA 4NY2A 1BGGA 3VNLA 5KETA 3P80A 4WKAA 3THAA 2Z24A 4IFKA 5F2LA 2BOFX 2V69A 2WBGA 1Z6KA 3PUGA 3CUGA 3DBPA 1FWJC 4QITA 3T09A 3MKKA 5CG7A 2YIHA 3AIBA 2E9MA 2R8WA 1JPKA 2RGLA 1EC8A 4GZEA 3S9IA 4B3KA 1TJ1A 4PN2A 3CHVA 4C6DA 4Y2WA 3TYZA 1GGOA 2TRSA 3NQFA 1WOBA 2QQ6A 5F1VA 2YKKA 1GEUA 3EANA 2DEPA 3LQLA 4J3WA 4US5D 2P5NA 3NZQA 1KM6A 4M7TA 1KBBA 2HROA 3LHUA 4UIOA 1QUMA 1VGAA 4HA0A 3ES7A 2E9LA 2BWGA 3R0KA 3K46A 1CX9A 4O4WA 3VVGA 4RDZA 4WK9A 4BR1A 3UZ5A 4YCPA 2JALA 4DJDA 1A49A 1KW1A 5CAKA 3GNXA 1V93A 2ALRA 4G7EB 4LF1A 3SRKA 1WDRA 4L6HA 1AH3A 4H9MA 1AZ2A 1PIGA 2XSAA 4R9OA 5DMMA 3TQPA 1F4HA 2PRHA 5HNNA 5EY5A 4CNUA 2DH3A 3T0AA 3AFBA 3WENA 1RK5A 3BMVA 1SZGA 4ROQA 2CW6A 1E4IA 2ALDA 1FCBA 1F73A 1M65A 1RP9A 2W27A 2GJRA 1ZX9A 1VS1A 4O4VA 1VRXA 2DJLA 4TR9A 3TOYA 2YSWA 3GRIA 4H4QA 1K9TA 1RQHA 2HZGA 4X2RA 1BFNA 4QGCA 3IVUA 4GY0A 4ZQNA 1Q65A 1CXLA 1SO3A 5JCNA 2GGEA 5ENLA 3DIPA 4LF2A 4H6RA 2QGHA 2UBPC 3HQOA 1XCXA 1AZ1A 4FEZA 2XIQA 4YHGA 2DIJA 3UESA 4YTTA 3GR7A 1UKPA 4DXKA 3MJMA 4Q6JA 2WVVB 3L5AA 3WMSA 5A69A 2F9RA 1TRDA 2QV5A 4UTWA 5DRIA 1OIMA 1D3GA 1GOMA 4B5WA 1AQ0A 1VBJA 1KCLA 2TPRA 1VFHA 5A2BA 5DCEA 3STFA 4A22A 2FTYA 4MPQA 3N73A 3GDRA 2C1HA 5G4HC 1JCLA 4ZXOA 3W2UA 3SBFA 2OSXA 3GXIA 4ICMA 2FHBA 4M19A 4EMWA 4CNPA 5G2IA 3KDNA 1XLIA 4A3QA 3N6QA 3WJZA 4ADTA 3QY6A 5I3IA 1KNWA 1KM1A 3WIJA 1S2WA 3DFQA 2VZVA 2POZA 3CXBA 3E12A 1A50A 1KKRA 2Q8ZA 4L9YA 1SGJA 1ISXA 5CC6A 3KVMA 1AW1A 2QNEA 3KBMA 4AISA 2E6DA 4ZTXA 4IXHA 5F2GA 2GQ9A 4AVNA 5HNTA 3NQGA 1TE6A 3GH4A 4D6GA 5FL0A 4MMWA 1LT8A 1XH1A 4AEFA 3VM7A 1V3IA 1TREA 2QJGA 3NVTA 9CGTA 2V5LA 4NJIA 4ZO7A 4CD5A 1HL9A 2GSEA 3DOPA 1ZJBA 1M7PA 2OVLA 3GR4A 2PURA 3LM7A 2E1DA 1V3HA 3M0LA 1ZJAA 5IBXC 1EA0A 3ITGA 4IG2B 2XHYA 2OG9A 2Y5JA 2R1PA 3AXHA 5A5WA 2DSVA 1A5LC 3WQPA 4JX6A 2PGWA 3H23A 4HP5A 1SZRA 4R53A 2J4GA 1R2SA 2GOKA 4NNAA 4HMDA 3SSJA 5HJXA 2I7GA 3TX9A 1I0BA 1RZMA 3P60A 3PS7A 5C7HA 1EJWC 5C70A 1JCMP 1I2OA 4A6GA 1GT8A 4Q8WA 1YQZA 2BLEA 1NH6A 5D33A 4EWND 1BWCA 3BXWA 3K1GA 2HS6A 1U5JA 5AHEA 3IVTA 5HWNA 3QW3A 1K1DA 4FNPA 1VLWA 3OIXA 3WLHA 1CGTA 4JKKA 2XN1A 2NXHA 4JNMA 3GIYA 1SQ7A 2Y1HA 5FF0A 3W7LA 2VR4A 2YCEA 2YW4A 4B5SA 1SW3A 4XIAA 1YTDA 3OTRA 2F84A 1DE5A 1FA2A 1C29A 4YYFA 1Q7ZA 5AZ1A 3K4AA 2ZC8A 4GGBA 4AZBA 2IXUA 2V0TA 1XC6A 4GOAA 1C8VA 3LZ5A 4PRRA 1NDVA 3FHQA 1WUFA 3M0MA 2CC0A 2PU1A 5SWUA 1W2PA 4R85A 2G97A 3BAIA 4AEOA 1UKQA 5C6MA 1E9LA 1EBHA 3TYEA 1TCMA 1OD0A 1W9VA 5D9PA 2IW0A 4NT0A 2YA2A 5AHNA 1CLVA 3VOHA 4Q4SA 4DUOA 4MDPA 1NP0A 2JFEX 3A13A 4JDBA 4Z1DA 4F0LA 4Z0JA 1G9HA 3QF0A 1BRLB 4O14A 3WNOA 2PDGA 2NXGA 1QW9A 3NQEA 1FCQA 2EJAA 1QU4A 3CEUA 3NYDA 3ZT6A 4G6CA 4JIPA 3AXKA 1O5KA 4A8LA 4UR8A 5BU9A 4PBFA 3LI0A 3RM4A 3WDIA 3T8LA 3L4TA 1AVAA 3PG9A 4APNA 1H49A 2WHMA 2XU2A 3LNMA 1UWTA 3WLIA 2YVJA 1S3TC 4KIRA 4GHRA 5HWJA 1CEOA 5DQPA 4ZODA 3UXAA 3WMCA 1H6VA 2V38A 3SJNA 1SSGA 2OYKA 1GKQA 1HT6A 4AUBA 3GXFA 3VO0A 1NOFA 1CYGA 2NX3A 5DMNA 2J7EA 1H1NA 1WNOA 5HQMA 4NIRA 2ZDRA 1CB2A 3W88A 2ZXQA 3QOMA 1EF2A 1VPXA 1X38A 3C52A 3N1AA 4UUIA 4TX8A 2H9AA 3G1AA 3EA2A 3GTIA 4CNTA 1XDJA 4QXIA 4UQEA 2WLZA 3NEHA 4GH1A 5LSMA 2ZZ5A 5A6LA 2XSBA 1RVKA 4XBSA 1XX1A 1RA5A 1SFTA 2E77A 3M44A 1LG1A 3IUHA 1JROA 3SCQA 3CNYA 1V6UA 2OOFA 3O6CA 1JZ3A 5A6SA 4D1JA 1FWNA 2W62A 2ZA3A 3QMRA 3REQA 2EPLX 2VOTA 1UH4A 2QUMA 1UKTA 2EF9A 1US3A 1R9ZA 3EAUA 3VXGA 4ZO6A 5D9NA 1BG4A 3HW2A 3TJ4A 4JTLA 3PZOA 1F7BA 2FPYA 3C0LA 3A4JA 2WQDA 1GOKA 1SO4A 3EXRA 1V6WA 4PUDA 1CGWA 4W7WA 4H8HA 4E3VA 1EC7A 4ZTYA 3LSCA 5LKYA 3VKAA 2VVSA 3UZJA 3G0XA 4DWSD 5F4WA 3T4CA 4UR7A 2VI0A 1L6GA 2FMNA 3H4KA 4MY8A 3SRHA 4JFUA 3WFAA 1NWSA 3FHAA 4H4ZA 5H8PA 1VC4A 2W91A 2ABAA 1WZAA 1H5VA 3W00A 4W86A 3CMFA 3BOLA 3FJ4A 2GRTA 2VFHA 4PR4A 4YNGA 1OD8A 2OSYA 3E38A 3CQKA 1PZ3A 1TV5A 3RLGA 4BHYA 2X0SA 1K7FA 3PBWA 3DDMA 4BV6A 5IDIA 3ELFA 3ZWTA 2RDTA 1F8WA 5BU6A 5EFDA 5CPMA 1OFQA 5H1WA 3IIXA 3WD1A 4FALA 1OC6A 1QBAA 1ML1A 4IP5A 2TAAA 3CAVA 1KWGA 3DG7A 4E5TA 2V82A 3D0CA 1EYEA 2QYGA 3FW6A 3BLKA 3ID7A 3HRDC 1UBPC 4YCOA 1G0CA 3CH9A 4MUZA 5GQBA 1BYAA 1ZQ5A 4Z2JA 2QUVA 4AW7A 4CKQA 4W87A 2HTMA 2IQ0A 3PZMA 2DZUA 1T5AA 2H90A 2GUUA 5D2XA 3AYRA 3T6CA 4O1EA 3W4RA 1SR0A 3BAXA 4H01A 3B3DA 1VQTA 4K68A 1GVOA 5CLTA 3MKVA 1R2TA 3S6DA 3EDFA 2OR2A 1E0WA 1KLYA 1YNYA 4DIAA 5D05A 5JIPA 4JFSA 3CZLA 4QHRA 2V3BA 1H7WA 1E55A 3R11A 3LBOA 2OT0A 5HMSA 3AXXA 1XD0A 2PDPA 1YE4A 2GYIA 2HXTA 3ZLHA 3G1VA 1LZOA 3S1GA 2FLIA 1F6KA 3G24A 1F74A 3M0ZA 3UJEA 4ZQMA 3Q67A 5D02A 5HA7A 3EPNA 1XIDA 4FXRA 3TN5A 4U5IA 4XV0A 3UVAA 3B9OA 1XBZA 1AJ2A 4LAKA 4MJ2A 5AYZA 2HSAA 1VJIA 2YXGA 3RX3A 5G4WA 2UY3A 4HHHA 4JCMA 2FZ8A 1GJWA 3W2NA 2CBIA 4JTSA 4W5ZA 4DZ5A 3TFXA 5FEXA 2A3AA 3KZPA 3OZPA 1XLKA 1UR3M 2HPMA 2OOGA 3IANA 4LYRA 2ABBA 1SO5A 3EOLA 4LB4A 2QCGA 1JF5A 2NSOA 3VGBA 2YCKX 3MHFA 4K8EA 3TMLA 4ADUA 1TA3A 2WC7A 3H4GA 4Q7NA 1EJSC 4UMCA 3N3MA 1EH9A 3HGRA 3EA1A 1OJXA 1OYAA 4F0RA 4H4IA 4AX7A 2OTDA 1G1YA 1R87A 1R6WA 4S3JA 3IRSA 3GBDA 1KTNA 3VA8A 4G8TA 4RE2A 1YIXA 3W26A 3TYDA 2FZDA 4CQBA 3N11A 4W9TA 2PWEA 4DYJA 5LIYX 4UR9A 4HU8A 3M0HA 3AWNA 2E6FA 3EX4A 4IUOA 3DEQA 2OLAA 1ZFJA 2AAAA 1JYWA 1B3WA 4Z2LA 2ZWYA 4C6FA 1XLJA 3GO2A 4U33A 1EBDA 2GPTA 1J0KA 1LL4A 1QPQA 1WYGA 3P84A 2OQYA 4EX4A 3SCUA 2QCNA 3VIHA 2A2IA 2PLMA 3QOKA 4KIEA 3ARVA 2PDHA 2VM8A 5HMDA 5B80A 2PDBA 1EIXA 1OG0A 1GTEA 1TCDA 4I8DA 1QO2A 2NV2A 1DV7A 3Q6JA 4PMZA 1B30A 4FNTA 1P0KA 2FPVA 1G7VA 4HMNA 5A6KA 3MP4A 1J2BA 4FB7A 4DY1A 3OLDA 3HO8A 2VHLA 3WDJA 1RBAA 4HYRA 4H7VA 4GA8A 1X2GA 4IISA 1FHDA 2PWVA 1KR0A 2HVMA 3M5ZA 1S39A 1R0MA 3CUZA 4DUWA 3LCFA 4MZ8A 5C9WA 1DJIA 3K2GA 3W1LA 4NZ1A 4K39A 3IACA 4M3PA 2CU0A 2WYSA 5LIUX 5CEWA 5JH1A 2Y62A 4QROA 1Q2SA 4HQVA 3GZAA 2QAPA 4FNUA 4O16A 4QX4A 1LLZA 5DT5A 3CS2A 5MF5A 1PDYA 5PTDA 4JQ3A 4YU1A 3L2MA 1PX3A 2D20A 1W0MA 4XUGA 1JDDA 4A29A 3MMUA 2QUNA 3C5QA 3IAPA 2TPSA 1GYMA 4GBDA 4AIUA 3PG8A 1CXKA 4D8ZA 3FN9A 1NOUA 1EZ2A 2ISSA 1VQZA 4YWIA 1UZHA 1AL7A 4E4PA 1HZYA 4WOQA 3QR1A 3ABZA 1ZL1A 3OG2A 1KM0A 2V67A 4IHCA 5KINA 3ABSA 1G01A 3S2LA 2BGQA 2NQLA 4HJFA 4INFA 1CNVA 1BWKA 1YXYA 2PAJA 1KBKA 1ZXIC 1O1HA 3ZXWA 1J0JA 3LPGA 5HULA 4BURA 4CCCA 4HU4A 1HN1A 8CGTA 3ABRA 3GTNA 5LNSA 3AIRA 1XXXA 3WH5A 4W7UA 2VEFA 4ORMA 3LTYA 4H41A 4ZL1A 3FY1A 3KE0A 3LXAA 1H7OA 5JXQA 1E0VA 1PAMA 1J18A 3VKCA 1GHRA 2W66A 4I9JA 4KCVA 3UR7A 2ZXDA 1OGSA 1LOSA 2B7PA 3ISIX 3A7AA 4H6EA 1JXKA 4M6VA 3IARA 3N2CA 3KDOA 2X8GA 4JXCA 1L2UA 1TPFA 1QNSA 1B4KA 1HO4A 2E5AA 3LGEA 3CZEA 4F66A 2WVTA 2IQTA 1HNYA 3S2MA 4MY9A 1UUQA 4NRSA 3SUUA 4U3AA 4AD2A 2C8NA 1EP1A 3CYJA 3WK3A 3TR9A 1JDEA 5F1UA 5LA2A 1VEOA 3OZMA 1GQLA 1I1XA 4NZ5A 3TONA 2C1GA 2WCSA 4WVXA 1E6SM 2PTZA 3NEVA 1OFAA 1KRAC 3LUTA 4P7NA 2PFHA 1PWMA 3WQ6A 3YPIA 1V6XA 1WDPA 2FJUB 3FA4A 4F9JA 4MB3A 3D46A 1DJGA 3PJTA 1OC7A 3SECA 1QHOA 3MHGA 4J1OA 4ZO8A 3RO6A 4O50A 5TD4A 4UC5A 3TW6A 3NJ3A 1GVIA 1ZNNA 3LCHA 3A3HA 1PDZA 4MKSA 1KM4A 2G8ZA 3W7PA 3POCA 3TSMA 1OZMA 1US0A 3WF4A 4GMEA 3EWZA 1QWKA 3QGAC 4YPJA 1TPB1 1OINA 2L5HA 3ZJ6A 1MW2A 1DWAM 4M82A 1IT0A 2IUZA 1XISA 3N19B 1JZ8A 2XIJA 2YDQA 2YBTA 3WH6A 3PPCA 1V79A 4QBXA 1AW5A 2WKLA 4XVEA 5LNVA 2F61A 1KRBC 2YXXA 3RU6A 3AIWA 5E9XA 5HR6A 4GRSA 3WLSA 2QMKA 2ZXBA 4IFKB 2CHOA 1REQA 2WSYA 3MCMA 2DZPA 1IYXA 3CLWA 3KRSA 3P62A 1NHRA 4UXDA 4EANA 1ZUAX 1EB3A 2GQWA 2BMBA 1L6WA 5I7GA 2F2KA 4C6NA 4M1BA 1UWAA 4PGLA 1KXHA 1MDRA 1WX0A 3A5FA 3WSUA 3OG3A 3VOCA 1N8FA 2F7FA 5EB8A 2RABA 1GXFA 3TXVA 2POTA 4WSKA 4HKPA 4AZCB 3URBA 1CLXA 5LNWA 3UGRA 2NLIA 1GVRA 4LNYA 1W3HA 1YE6A 4PMOA 3OVPA 3GH7A 4J7RA 4G1NA 5HNRA 3G5EA 4L61A 3WBAA 1AK5A 1MMFA 3GDMA 4H8NA 1Y7VA 2QCLA 1KXQA 3PUDA 2Y8VA 1I75A 5FJTA 1A3WA 3U2EA 3RYSA 3JU2A 4H6KA 2DIEA 1N82A 4TUFA 3L4UA 2D2JA 3WLNA 1P0BA 3AYTA 3VX1A 4ZE4A 1Z44A 2Q3OA 2CLPA 1ZBCA 1F5ZA 1XDLA 2QIWA 3STCA 3ZLFA 3AQUA 3ARTA 3L5OA 5C2GA 4LAOA 1JPDX 1KFEA 3IEBA 5EMYA 1ISYA 1LL6A 3AJXA 3L0KA 1KKOA 1SZNA 2CHRA 2J79A 2ZX7A 1RR2A 1XIHA 3A23A 1TV3A 4LUTB 1XICA 3F4VA 4AIOA 2BTMA 1P48A 3SY1A 3C3NA 2I5IA 3FA3A 2X99A 2I5QA 2JK6A 1ME8A 3RM9A 1FKWA 1ZPTA 3AHTA 2VFIA 5FEWA 1V5XA 3NURA 4Y7EA 1VENA 3O07A 1LWIA 4PODA 2X1UA 4PH6A 2X7VA 1AD4A 1ONEA 3OOQA 4YMZA 3I4KA 4OOUA 2QV4A 5D38A 4KFPA 3ARPA 4AVOA 3EA3A 3WLPA 4TXEA 3N9RA 4C65A 2X30A 3CZGA 1XANA 2OX1A 4J27A 5KMYA 5CAHA 4NRRA 1H2IA 4DNHA 1UD2A 4NZ4A 4N2YA 1DPMA 5HPOA 3LEPA 1H7XA 2RKXA 5FAGA 4QS6A 1JFXA 2NVKX 1CENA 1QI5A 3TIMA 4HYWA 3WJXA 3W1UA 1XBYA 3R10A 1EOMA 3HQPA 3HOJA 4BI7A 3KAOA 2AOSA 2PODA 2WMKA 1F8IA 2EXOA 5LNRA 3LV5A 3S3GA 1ESWA 3WBXA 1ZAHA 1KQZA 4O1DA 2E0PA 2OEMA 3SW6A 4JY8A 1M53A 1YXCA 1ITQA 4HK7A 3A47A 2ZE0A 3H6OA 1C92A 4AEEA 4NYYA 3I6RA 2OKTA 4KWWA 3QV6A 3VD5A 1A5AA 4B15A 4XK2A 4B4HA 1TPVA 1UMLA 3N2TA 1XLFA 3Q58A 4QCEA 1TWZA 1NHQA 4UCGA 3ZIZA 4US6A 4M51A 1ITUA 1TSIA 3LRLA 2XGBA 1IIGA 2WJFA 3AC0A 1TMLA 3OA3A 3M64A 2D73A 3E02A 1XDMA 3U8GA 3ABXA 2FGLA 5HINA 2PDKA 1MW3A 5M17A 3AIEA 5C0QA 8TIMA 4IP7A 2Z28A 1JCYA 3U5UA 1GOXA 3SM0A 2DZTA 5LXXA 4H1ZA 4ICCX 4E2VA 3W7RA 1XJBA 4OV9A 3LB0A 3DHDA 1TR1A 5TQLA 1QOPA 4S3CA 1J11A 4A2SA 1BTCA 2ZX6A 2V6OA 1O94A 1GZJA 7PTDA 1PVNA 5TNVA 3S9ZA 3FCPA 2XDFA 2ZBTA 2WMFA 4RNHA 3CUIA 1CT5A 3T44A 4H4YA 3F2BA 4DWSC 4FDCB 3IJ8A 4C60A 4GH3A 3K5XA 3WL0A 1HJUA 1H62A 5I79A 2X0HA 4H00A 3CXOA 3UT0A 2WZIA 3D9XA 4RPQA 1J8VA 3LBMA 3A4AA 2GZXA 4N9CA 5HAOA 1RQEA 1GJPA 3E0FA 2J78A 1SFJA 4GQ0A 3S5OA 1UD8A 3RRAA 1F76A 2QJHA 2VFDA 1X98A 3EWDA 1UASA 2DUXA 3TZNA 3B9DA 2R82A 4S3BA 2HBXA 2AL2B 3F4WA 1VF8A 3R07C 1NAL1 2V5KA 3B9EA 3MYPA 3SGGA 4AZ6A 4MWAD 1ZMDA 3T8QA 4RZ5A 3M7SA 4H4SA 4IMFA 1B3ZA 2PDXA 2CHNA 1TKKA 2VQUA 2BGNE 5I00A 4GUJA 2YCLA 1E4LA 1K8XA 2YLAA 5J04A 4IIDA 1UD4A 1ZY9A 3NXLA 4U31A 1UP0A 4KFOA 3AOFA 4ILSA 1FWRA 3K30A 3GE7A 2VFEA 3W72A 4R7JA 1B3VA 3W3OA 1YEYA 1PSCA 2CEQA 3U57A 3KVJA 1Q6EA 5HQLA 1XYZA 3TK7A 2NQZA 3B9JB 2A3HA 4OQVA 4MOZA 1JZ7A 2C0AA 1PHQA 3TKFA 1LLOA 4LUSA 1W8SA 3EZ4A 3QPYA 3N04A 5BXRA 3O6YX 3LGDA 1OIFA 1A5NC 2VZOA 4IJBA 3UXLA 1FWFC 4NEWA 1LQ2A 2FB3A 3A5VA 3CAQA 4X61A 2H9AB 3GUGA 3B8VA 4LIIA 1TZ9A 4YYCA 4GI6A 1ZZMA 1QNRA 3R58A 4OT7A 2IKHA 4FIQA 4EKJA 2BOEX 3OBAA 4E8GA 1XRSA 1E9ZB 2Y4SA 4U5KA 1OFBA 3OLEA 5FACA 3VDGA 3KCJA 4K2SA 1UG6A 1FP8A 2OWWA 4OUEA 3C2YA 3VE7A 3CGDA 4GUFA 1TWSA 3RR4A 4NNBA 1Z9AA 3CPUA 2W3SA 3RIKA 1W8GA 3CHCA 1LVLA 1XIJA 4WY0A 1QPOA 3ONCA 2O92A 5TBOA 3SN0A 1GWJA 1WKFA 1JYNA 3LRKA 3LV6A 3AROA 3HQNA 3K4WA 2PWDA 1VYPX 2J25A 4MPKA 1ICPA 1ZBKA 2WM0A 1H7NA 2ZIDA 4J4KA 3XINA 2D23A 4XO6A 3PFMA 3CZKA 4L6OA 4IQJA 3EX3A 1CW2A 3DU0A 1WB0A 1IQ8A 2FVLA 4V1XA 3NQAA 2G96A 3V35A 3H2CA 2FZBA 4HCLA 3LADA 2VGIA 2UWFA 2GJXA 2ZRUA 3VILA 3WNMA 2EGZA 2DDXA 3LENA 3ZT7A 2J3NA 3MZ2A 3SUVA 3VU2A 5FMHA 1VPQA 5GJPA 2P10A 2BXYA 4BEQA 3UNTA 3WQVA 3H53A 1KO0A 4MYAA 1OK6A 1MSSA 4RDWA 3ZVHB 1UQYA 2XWEA 4AQLA 2Y89A 2Y70A 2QDGA 5A2CA 2YDRA 4HTYA 5GJMA 3RLHA 3TTOA 3UWWA 4GXWA 2Z1KA 5AYYA 4I9AA 3CU2A 3E0LA 5DANA 2XH7A 4CU8A 3W6MA 3H2MA 4EMIA 5I06A 5EL1A 4FXFA 4GCAA 3GUWA 3S47A 1H1ZA 3H2EA 1JF6A 4NUWA 3BUVA 3W6YA 5C2CA 1QPKA 4UBPC 1AD1A 4POCA 4PEEA 2BFGA 1J0HA 4OOZA 3M43A 5AFDA 3KRBA 4HHMA 3CH0A 5KTLA 1DHKA 5LYRA 2VXNA 4MB4A 3WQFA 1GZ1A 2A3LA 2PTDA 5CZTA 2PMQA 2W55A 3LD5A 1WOAA 3QZEA 1Z69A 2E1WA 4U2YA 1VCVA 2F6KA 2YYTA 4LCQA 2VDHA 1R3VA 1J6PA 3E49A 3R4IA 3MSDA 3LU2A 2FTWA 4R34A 1XW8A 3GYEA 2RGMA 5CPLA 4AWTA 1Z7AA 2VGBA 1RK6A 1W5PA 1GVEA 5FSDC 1UD3A 3AU2A 1K8CA 1B2YA 3PJUA 4CEUC 5EFFA 3LLFA 3P61A 3FYYA 4CCDA 1VBGA 5AHIA 4AMCA 1I4NA 3VZZA 1M7OA 3QC3A 1QNOA 1JRCA 3APGA 4CN1A 1ZCCA 4K36A 3I10A 1I2QA 3KTSA 1S38A 3B8WA 3V36A 4GG9A 4B2DD 3CHEA 2PGRA 4KBXA 4F0SA 1E9YB 4OBTA 3V5FA 2GR1A 1GTHA 3ZSSA 2GK1A 3NCOA 2PSNA 2BGSA 4ZOCA 1ZHAA 4GQBA 4GFSA 2BS9A 1FHVA 4QLLA 3CTTA 2CITA 1MO0A 4IIEA 4ATDA 4ALDA 1TPC1 3H54A 1CXHA 4NHVA 3L0GA 1M68A 3PF3A 1V3LA 1PWLA 2BHUA 2ZZ6A 2HNEA 3DG3A 3UYIA 4JFWA 4AC7C 1B9ZA 2Z7KA 1U22A 2CWXA 4KERA 4AFYA 3GRSA 2HE5A 3BLEA 4JTAA 4Q3MA 2CLKA 3MWCA 1PHWA 2BNJA 4IFRA 1CCWB 4FA3A 2PDCA 1DVJA 2YL5A 2Q02A 3DFHA 2Z2UA 4IICA 3F4NA 2X0YA 1OADA 3DKJA 1Q6GA 3DX5A 4OBRA 5CZSA 4O1AA 3HB9A 1K9FA 5BWAA 1L8NA 4FIRA 3VCRA 2J9YA 1GSNA 4GQQA 3MUZ1 3W7HA 2XFWA 2RDXA 1TWWA 1POKA 3W7CA 4YTRA 1MVYA 2NQ9A 2W79A 3M4HA 1L6YA 4Y9NA 2ZXAA 3L4ZA 3C2EA 4H4VA 4CU6A 3E5BA 4P8XA 2X8HA 2YPIA 2VX5A 1UB3A 1EO5A 3BOFA 5AVHA 3UVIA 1JUEA 4ACZB 4B90A 1E51A 1GPFA 3RPDA 1DJXA 2A21A 3EX2A 4ZOEA 1H0GA 4IOTA 3HGSA 3K8LA 5CSYA 1TYPA 3URHA 1NPXA 4GQGA 4O53A 2EBNA 1FFVC 1C7SA 3DGBA 1YDVA 2MANA 1IWPA 1HFBA 4TMBA 4I6KA 1JL8A 3LGGA 4BY3A 2GR2A 5CSRA 3PR2A 3OQEA 2WSRA 3GS6A 5K7JA 1VDVA 4AC1X 3WNKA 1U1HA 2HK1A 4KT2A 1I2PA 3OEXA 2Y5EA 3CWNA 4BQ3A 2CZEA 3PTQA 3EWYA 4PTNA 4HMCA 1ZDLA 2DSUA 3AXIA 3CO4A 3LCLA 1ZKQA 1K8YA 3ARSA 5T8GA 1UZ4A 3TYAA 2H3DA 2VX6A 4YTQA 3OZOA 4AZ5A 2DZWA 3G0SA 4DJED 1NF7A 1QI4A 1HL8A 1W37A 3NQVA 3UD6A 4IWWA 5CZKA 3SUWA 2ODOA 2A1YA 2P88A 1W5OA 1HF6A 5G1TA 3CT7A 2CLHA 1FTXA 1KBJA 3R43A 1W3TA 1W32A 6ALDA 2VVNA 3OGRA 4L65A 1EJXC 2G95A 1TRIA 1K4HA 5BOFA 7REQA 1R9XA 3N12A 2D2OA 1LRNA 3L65A 2DUAA 3SCNA 3UETA 1SJDA 1EDTA 2ZQ0A 3A6OA 1ZY8A 4V27A 1DEDA 1W5MA 5KSWA 3LCIA 3CT2A 1I1WA 1PJ9A 2VUNA 1JCXA 4GJ1A 4XG1A 4A2RA 2OLHA 1WDSA 3D5HA 1RCQA 4EMJA 1KC7A 1N60C 2FMOA 1MW0A 3TN3A 4NNCA 3V5OA 1IZJA 3MC5A 4LGXA 3MVIA 3QLDA 5AC7A 3EXTA 2FPTA 4IFOA 4XAGA 2OXNA 1JGMA 2YL8A 4URIA 1YXDA 1XSJA 3S1WA 4UQDA 2WC3A 3VNMA 2X09A 1LDCA 4DX3A 5K4ZA 3SY5A 5HUOA 4O15A 3DESA 2DT2A 4GX8A 2ZZBA 2YL9A 2X16A 3WJSA 2PWHA 4RNJA 4IP4A 4MJ4A 3HJZA 1ONRA 3I65A 3WF1A 4YLWA 3W84A 2GDQA 3NPUA 1VHCA 2ICSA 5DELA 1NQ6A 4YWOA 2J66A 3UA4A 1J93A 3BURA 5A6MA 4NAEB 1RXOB 2TMDA 4F2BA 1P7TA 1H4PA 3EYPA 3KXQA 3TC7A 3N2OA 1F3XA 3WNLA 1J4EA 1CXEA 1EDGA 4RZ4A 1FH7A 4XZNX 4Y9PA 3MUXA 4DJDD 4G56A 1S2UA 2J7HA 3H70A 1PYFA 4E2BA 3TNOA 5U4NA 5KEZA 2ZUUA 2E40A 3LG3A 4GNVA 3WUGA 3PG6A 3ARQA 4Z08A 3UY7A 1UPMB 4K38A 2CLFA 5MHBA 5EA9A 1N55A 2WMJA 3WBWA 4YHEA 5J5DA 1UP2A 4J2PA 4QLKA 5CPNA 4E4FA 3FVMA 2Y8UA 3MMTA 1YRRA 2D3LA 1QASA 4W89A 2XIOA 3QFEA 1JOAA 3N29A 5J5RA 1LLWA 5GJNA 3CZJA 1CECA 2NV1A 1BVZA 1EEXA 3A9BA 1NM9A 2A7RA 1KCXA 4HHPA 3WDRA 1JRBA 2OWXA 4GJJA 3DG6A 3E6EA 3ZR6A 1DTUA 5FOOA 4QM1A 2G50A 3O0HA 4JTQA 1SW0A 5E6YA 4H9UA 5F2MA 1PYMA 1O12A 4C1NA 1T99A 1TTJA 1M5WA 1JQVA 4H8UA 4CU7A 3NPVA 4Q4RA 3GDBA 1RVGA 5LA0A 4UFMA 1IEXA 1C8QA 1IZCA 3TH6A 5MKGA 2HISA 1Q8JA 4JTGA 1A5UA 3PB0A 4LY4A 3IGHX 4CQ9A 1FIQB 3AS2A 1E6XM 3OHIA 1QCWA 2Z2BA 3GNRA 2GJLA 2V2DA 3GRTA 1K03A 4Q4PA 3CMJA 1R3QA 3KTCA 3PPFA 4I7WA 4LC8A 3BK0A 3MY9A 4NZ3A 4ZQOA 1TB3A 1J9YA 1EEPA 4GNKB 1BLIA 2VOMA 4HN8A 3AS1A 4WQ6A 1K4GA 5BRBA 4JTUA 1KBLA 3NVVB 4S3DA 3SCRA 1REQB 2YBVA 2IKGA 3QRHA 1V02A 4YTUA 4AXNA 2BODX 3VDAA 3KW3A 3HMCA 4Q8MA 1Y5XA 4UZUA 1PPIA 5CPSA 4JOMA 1XF0A 3T2QA 4MLJA 3DECA 3GW0A 4IXXA 4FNRA 3ZLGA 4ACYA 4L4MA 1WDWA 1WDDA 3UG5A 3AALA 4DYEA 1PKLA 2YZRA 2W0UA 4JTTA 4WX2A 4JAWA 1MUCA 1ZAJA 3HG4A 4ZFCA 2WP6A 4PE8A 3G1DA 1LT7A 3VFCA 1FWWA 1GOOA 2O56A 1WUEA 3SY8A 3UWVA 1IEIA 4W93A 2XIIA 4WSJA 5A2AA 1XR2A 2CBJA 1KLZA 1RHCA 4CD4A 1VBHA 5DMLA 4KEMA 4L4LA 4LS0A 4IL0A 4EPDC 4G1KA 1DOSA 4KH2A 4ZSUA 3HPXA 2PDLA 2CIPA 3GW3A 2JGQA 4GUGA 2YLLA 1GRGA 4ORIA 1P43A 4OBSA 2C13A 3QBUA 1BVNP 3PWGA 1EKOA 1KBIA 4D8AA 3FAWA 1UR8A 3T0TA 1WPCA 3W27A 2V3EA 4CVWA 5IRPA 4KRZA 1XRVA 4B16A 2UY2A 5BNKA 5CG0A 3RMEA 4QDWA 4GC3A 4FLQA 2F5ZA 4XIMA 3WEMA 2J7FA 2OGJA 2E5DA 2QKFA 4DO5A 4TV5A 1E1CB 3RX4A 4PYSA 4DF2A 4AH7A 4XX6A 5F4SA 4HNTA 3V18A 3L2LA 1KFJA 1UC5A 4UTKA 4BFAA 4C1KA 3AMKA 7ODCA 3G18A 1OT2A 4D6CA 3RUBL 4EAYA 4PB5A 2E25A 4GIAA 4CQCA 3MANA 1YKWA 3STEA 4GIYA 5CJ5A 4AWSA 3A3WA 3AIVA 3NZ1A 1DWGM 1UWQA 2VCCA 4JPGA 4DRSA 3N2XA 1NIUA 4IPNB 3BSMA 4U3CA 2XVNA 3IGSA 2ISVA 4Z0SA 5CGTA 1A3XA 2WV8A 1E9IA 2Z26A 1KM5A 3R1ZA 1O5XA 2CESA 3LTSA 4DJFD 4DBEA 1DJYA 5BROA 4EQSA 4PL2A 3G1XA 4DZHA 5FJRA 3EOOA 2V5CA 3CQJA 1TG7A 4I5UA 1ONFA 3TA9A 3WDHA 2XUCA 3STPA 3DFNA 4MAZA 2NXIA 3QQ0A 3GNOA 2Z00A 2WOWA 4R88A 1FDZA 3CV2A 4TOQA 3GFZA 2JBMA 3ITCA 1L9WA 3ZJ7A 1A5MC 3VK5A 3WLRA 3INPA 1W56A 4DWSB 5D04C 3ETRB 1UZDA 2C14A 2C3DA 1O5RA 2QJJA 3ITXA 2EPHA 2ZUWA 2HQAA 4XAZA 1OM0A 3BG9A 3MS8A 1KFBA 1NFGA 3GG7A 2EJ1A 4TMCA 1XFBA 5EMMA 1GVQA 3PBUA 2B7OA 1BHGA 4Y8EA 2FJKA 1N61C 1ME7A 1GQNA 1WBJA 4FSAA 1O5QA 4E2DA 2YAUA 2RUSA 4ERAA 3RGTA 1JGIA 5IHRA 2AAQA 1TZZA 1TV7A 3F5KA 3VGFA 3QHNA 1THFD 3CV7A 3LHZA 5HBFA 1W1TA 4V2XA 4AIEA 3LM3A 2VZUA 1GQJA 3WLLA 4WKFA 5TR3A 3BGAA 4X3ZA 5CBBA 4H19A 1V7YA 3LHVA 1D3CA 4RNFA 3V5CA 3WLTA 1VFTA 2AGKA 4I7UA 4Q8OA 1FCUA 2PDUA 2XWDA 1UYQA 4WZHA 3WDPP 4IMEA 5EMUA 1TVLA 4ZA0A 1OT1A 2ZRYA 4AYGA 1LYXA 2I14A 3QY7A 1TPUA 3E74A 1Q13A 4OFCA 4QNWA 4C6IA 1FRBA 4NZCA 2PF0A 1A4MA 2B81A 1S2TA 5F2IA 1ZK7A 4HPXA 3UXDA 5EMJA 3M16A 1Q8AA 5EGRA 4FNSA 2VJXA 5K9XA 3AWOA 3QY8A 1SSDA 3H4XA 4MF4A 1UBSA 1MNZA 5HATA 2J8GA 4TVYA 4AU0A 2Y7FA 2YXOA 1M01A 4QG6A 1UA7A 1JFHA 3CGCA 1JR1A 3LY0A 3OJGA 3VM5A 2YCLB 5A6TC 3W28A 4LPCA 1KFKA 3QHOA 1EJ7L 1KV5A 1LP6A 4FNQA 4NAFB 3VUPA 4YN5A 3QR0A 2YA1A 2A5HA 3CM4A 3CJPA 3ATZA 3WD3A 4REQB 2R9RA 3WJWA 2B0MA 2BVTA 4M8UA 4MYXA 3HPFA 5BXSA 3KUMA 3UZYA 1Z42A 4FR1A 5DT7A 4HJWA 5CH9A 5I23A 3QV7A 4OKDA 1C8YA 4I8YA 1E70M 4RZBA 3CUHA 3B9AA 2E3TA 2O4MA 1R85A 3G22A 1UH2A 1FQ0A 2Z6IA 3DFYA 3IJ7A 3TW9A 2ZZ7A 4RNIA 4PCNA 5CXPA 1O68A 6TIMA 4WGHA 1F3EA 3N18A 2SFPA 4L9ZA 4GBUA 5BW6A 2YVFA 1X96A 2MNRA 1YTKA 4FLOA 4TTUA 2Y7GA 2EQ6A 2W6RA 1XP3A 3F5LA 3E2SA 4LVBA 5BMWA 5AYIA 3HTWA 4E0CA 3DXIA 3VKBA 4WY0B 3GVVA 1FDYA 3G1FA 1M9HA 4WJ8A 1XLCA 3W2JA 2NUWA 2G37A 1WZLA 3NDYA 4AZGA 4O1FA 5DRCA 3Q94A 3LMZA 4J56A 3WCZA 1EHNA 3W25A 1IZKA 4HD5A 1SUXA 4LV4A 3S5SA 1UQZA 2Y61A 1FKXA 4BZYA 5KZEA 3HPZA 1V02E 1D8CA 1Z8AA 1GRTA 4KETA 3W7GA 5JH2A 2JIWA 4JEQA 2DGAA 3I3BA 3B8UA 4LAMA 1AQHA 1KWKA 4TV6A 4R27A 5DN1A 2C0HA 4NYUA 1OG6A 3C86A 4QJ1A 3VIFA 4D9PA 3HN3A 2D2GA 1W1VA 3F2CA 4AHQA 2OO0A 2WC4A 3UG8A 2VX4A 2CZ5A 4QDMA 2G3FA 3H55A 2E9BA 4PB3A 4HPGA 1RPXA 3N9KA 4WDXA 4LRSA 4GI9A 2V30A 1OB0A 1J12A 1WV2A 3L2IA 4Q4OA 2HS8A 3GD4A 1FH9A 2WZHA 1VR6A 5C7VA 3WEZA 2C91A 1HG3A 3UR5A 3TTQA 2R1MA 2EKGA 5IOBA 2FVMA 3K1DA 2QPSA 3MW7A 1F2JA 2QCDA 3LQGA 3MYOA 1Y5WA 2EQDA 4QTGA 5JUVA 3L23A 1M3UA 4L56A 3R94A 1SMDA 4UFIA 2CLIA 1RUSA 3W7MA 3CQ0A 2D3NA 5D32A 2XISA 1GVFA 4JKMA 2PGFA 1GYLA 2HPIA 3P74A 4LVAA 2RHGA 1BYCA 3WO8A 3ONBA 3BAJA 2A3BA 2PWGA 4K3ZA 3GY1A 3EAOA 3GZ3A 2TYSA 3NSXA 1BKSA 4Z1AA 4ML4A 5D03A 2OZ0A 4LBRA 1PKMA 4DJEC 3LERA 3BMWA 3BJTA 4NJKA 3OBKA 4DF1A 3GFXA 4O13A 3LHWA 3GTFA 1Y65A 3VMPA 2ZZ0A 4H2HA 2EEXA 3LMYA 3GVQA 1UH3A 3ARWA 3TQVA 1R9YA 1CXFA 1XBXA 3W37A 1P1XA 1U1JA 2PC8A 1QI3A 3W85A 1X6NA 1KA9F 5G1MA 1VFLA 1V59A 4YVVA 4PB4A 4RUBA 4M29A 4DQWA 2VEGA 2R1LA 3XIMA 5B7YA 2WANA 1K9EA 1W31A 2FH8A 4CVUA 4FAMA 3TE9A 1WYIA 4CCEA 3CWOX 5U7SA 2WHKA 2VO5A 2A6LA 1UIOA 3GKAA 3VGDA 4MSSA 1DP0A 5LHEA 4XAPA 3AIQA 1JCJA 1DTNA 1WAUA 3QEZA 2DUZA 3AMCA 4IIHA 2P3ZA 3M0JA 5D8ZA 1WZMA 1FWEC 4H7CA 2VKZG 1MO9A 3CIXA 1MRQA 4C5YA 4LW7A 4DBDA 1IT8A 3SCSA 5BXPA 1ODZA 3BLPX 1OCBA 4O11A 3WQDA 2C6QA 1PX4A 3JZEA 5ABFA 3GR8A 3TP4A 2EQ9A 3R2GA 4GUIA 4RJEA 4IPLA 1HJWA 1F6PA 4TVWA 3FAXA 2OWCA 1WCGA 5I3FA 2H8ZA 1I0DA 2WM1A 3W1MA 3KLKA 4NKCA 3ZT5A 1AMYA 4TO8A 2XGZA 3G8RA 5A1AA 3O9NA 5C55A 3KBJA 2BOGX 1RLCL 3MP5A 4G7EA 1OSEA 1JAEA 1SJBA 2LLEA 4XTDA 3JUGA 2BXVA 3JVAA 1KM3A 4DAFA 2ZX8A 1MYRA 1XIBA 1YNPA 1X1NA 5I03A 5D30A 1QPRA 1ZSXA 3LDVA 1XH0A 1T8QA 3PSWA 3B8DA 3G3DA 1WZKA 4C6PA 4DJDC 1OFPA 1MI3A 1SMAA 4S3KA 1AH0A 3AISA 1T96A 2DV0A 1DJWA 3W81A 5G1YA 4OIFA 4N4PA 2VEIA 3QFBA 1GZGA 4K7ZA 1B9BA 1U5HA 4RCXA 1UWUA 4E3TA 3SCOA 1DWJM 6TAAA 1JJKA 1TELA 1GOWA 3UJFA 3ITVA 3IIVA 1ALDA 4PUWA 4FXSA 1X6UA 4CNOA 3KOZA 1PCKA 4KCTA 2YCJA 4LX4A 2FGZA 1Q4WA 2WVVA 5D2TA 3ICJA 1P6BA 3WF3A 3NQ6A 1C9WA 4PCFA 3E2QA 5IM51 4ZXLA 3V1PA 4HHLA 5E5CA 2HRWA 3II4A 4Q33A 2F38A 2GGIA 2WNZA 5ABGA 1OX4B 4IQLA 4KS0A 4XD5A 2YR1A 2PF8A 2A85A 4AIBA 5A8GA 4L6DA 4CQ8A 2PDWA 4XZWA 3VIJA 1V0KA 3W1TA 3WX7A 3POHA 2I9EA 4WDUA 3M9YA 3TYBA 3F1QA 7REQB 5C71A 1J2WA 1R46A 1S1RA 3R6IA 1KRCC 5DCBA 4AHPA 3AMLA 3S5YA 1GQKA 5LXEA 4HK5A 1GESA 2O9TA 5FJOA 4FI4A 2GUBA 4A3RA 3A24A 3FYOA 4QE4A 3GD6A 1XYFA 2NQ5A 2DSWA 1WDQA 2PDQA 1B5TA 1TWIA 4IM4A 4Y9OA 2A79A 2X2YA 1FEBA 1W1IE 4B3LA 1TX0A 1V08A 5I09A 2GL5A 1XYMA 2O4QA 3A22A 2FIQA 1MEHA 4EXAA 3IJ6A 3NPXA 4WXZA 5EPDA 5C2XA 2ZTJA 1POJA 3DHUA 1N62C 3FG2P 4X63A 4M6QA 4HCHA 3EGJA 2Z29A 3EEZA 3G6LA 1JYXA 3MSYA 1VD6A 4FX6M 2GJPA 3ALFA 4F40A 4WHBA 1VBUA 3T1GA 3VOGA 1XQKA 1XYCA 3DAQA 4ZVJA 1OABA 4DUVA 1W54A 3W7JA 2H6RA 5E09A 2Q8XA 4JYDA 4EPKA 4HVXA 2CLOA 3II1A 2P8BA 3EWBX 3OIHA 1ODUA 3KBSA 2X8RA 2HEJA 5G4EA 1AJZA 3N34A 4AZ7A 1X7FA 3CUXA 1F3TA 4MB1A 2QGYA 1EQCA 3EWCA 2VEMA 1CIUA 3TJLA 4ZB5A 2DZVA 2OT1A 4AY8A 1RM6B 3S2CA 1MFUA 1XLDA 1S3HA 3UJ2A 4LJ3A 3Q45A 4JS3A 3APTA 3BDKA 4R9XA 3WLKX 1FH8A 1GG0A 4S3AA 4HOWA 1TX2A 4PUEA 2V2HA 3L12A 2CBUA 4HZ8A 5JMUA 5JBEA 3DUGA 2JKEA 2DJXA 3PZTA 4LT9A 2G4FA 2GQAA 1Q45A 1E73M 5HMFA 3DK8A 3ITYA 4AG0A 4JL1A 2XFFA 1V6TA 3PWAA 1BRLA 4PMJA 3P8IA 5CQ1A 3UW6A 3ME3A 2J24A 1LM1A 3O0FA 2CETA 3IK4A 4RX0A 2PTWA 1Q6CA 1W9BM 2V3GA 3NM1A 4MM1A 4PTWA 2QZRA 3UZWA 3OYXA 4C1NB 1E15A 2FYMA 1VB9A 1WKDA 3WLOA 1EDQA 2ASHA 1CLKA 1UCWA 2UZ9A 3U9IA 1L6SA 1IEQA 4JIIX 4OE7A 4MADA 4MVAA 1XGDA 3F4CA 3HU7A 3V16A 2YBUA 3UWUA 1Q2RA 2I5GA 5MKGB 4P2VA 1FWHC 3GVWA 1QI2A 4GI8A 1IXQA 3GBEA 2V9DA 4DJFC 3LX9A 2XIBA 4A8NA 5TF0A 4UTMA 3FKKA 4UFLA 1UJPA 1V3MA 1K02A 2Q6ZA 1KN0A 3PZNA 4Q7IA 3LN3A 3MUAA 3FDKA 2Z6JA 4W8LA 4WOZA 1JG9A 1JI1A 6A3HA 1H1YA 3EMCA 4PA8A 5A8PA 2FTPA 1TMHA 1YDNA 2QCHA 5HK4A 2A4AA 2YB4A 3H21A 1GUVA 3NGJA 1CI1A 2AKMA 3BLDA 1YADA 3FK4A 3EDEA 3Q65A 2XTKA 4I9MA 2ISFA 4H6QA 3RN6A 5G5GB 5FEPA 3F7JA 3FEQA 3IUDA 1E1FA 1EJUC 3O8AA 2JEPA 2QVNA 4IGNA 5FL1A 1PCWA 3EWUA 1Z41A 2QCMA 1SO6A 4N42A 2OZ8A 3GNNA 4HGXA 3SGUA 1WQ5A 2X1IA 2O7SA 3ARZA 4QRNA 1OHLA 2E28A 2C7FA 5I3HA 4RW3A 2CYGA 1UD6A 4XB3A 4FOKA 3FSUA 3WFZA 2Q09A 4IGHA 3PK7A 3VNKA 4IGMA 3W38A 3GXDA 3TTSA 1B90A 3UR2A 3RG6A 3U7VA 3LLXA 3GNPA 4L7ZA 5I02A 1OCQA 1C8XA 1W17A 3DYMA 3MI6A 3EXSA 4GVHA 1NELA 5DO8A 4OZOA 4PUUA 4MWAB 2DVXA 3IGUA 2J7BA 3KS5A 1YNQA 4QFUA 3S2JA 4EACA 4CD6A 1F3WA 2XVGA 3DHPA 3TDFA 4ERIA 5U1OA 3HZ3A 4CEXC 1KB3A 4WXYA 3N15A 1V0NA 2GWGA 4MUPA 3WUFA 3AJ7A 3TU9A 1XYBA 1OJTA 3NXFA 5BWFA 1LL7A 2ACRA 4HNLA 1I45A 2R94A 2W5FA 1H2JA 3KLLA 3TN6A 1JULA 4JL2A 1OCJA 4DB7A 1JI2A 1G5AA 2QDHA 2O7QA 3JS3A 1ZP3A 3W1RA 1MW1A 3TQKA 2VFGA 4FXJA 3WG6A 4NG3A 3A9IA 2X1SA 4J9JA 4KCUA 4B92A 1HXJA 1AODA 1X8CA 2D1ZA 3MPGA 5HJYA 1HVQA 1U33A 5FEZA 4FZIA 4QDPA 4P7RA 3HMJG 4LBUA 2QMJA 1E5JA 3EKGA 2YZ5A 3NDZA 4BJHA 1JAKA 1QBBA 1VJSA 4FOJA 1DIOA 8XIAA 1R5YA 2NWSA 3H22A 4NXKA 1R3TA 5FS7A 2DZSA 4AY1A 2J7GA 3OZYA 2PPGA 1LUCA 3HG3A 3WMBA 3MV11 3WF0A 3N6JA 2VWTA 3B0PA 3P0XA 3UWZA 1GG1A 1GEHA 4C6JA 3LA4A 3GDTA 2A8XA 3GXTA 4Z2GA 5G2WA 5FF2A 1B4EA 1WP6A 3GTXA 3WNNA 1W1A1 3GVGA 1EC9A 2IXVA 4MTVA 2VQTA 3UWYA 2W0HA 2G3IA 1YX1A 1D9EA 3O0KA 1PBGA 1E5NA 4DYKA 5DF0A 4ADSA 5ABHA 5FF7A 1ADSA 3R8RA 1Y8BA 1N5XA 2ZX5A 5T91A 1W3JA 3W70A 4DI9A 1UHVA 3NAVA 3MO7A 1QT1A 2GOUA