1BQGA

The structure of the d-glucarate dehydratase protein from pseudomonas putida
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
411
structure length
399
Chain Sequence
GAPVITDLKVVPVAGHDSMLLNLSGAHGPLFTRNILILTDSSGHVGVGEVPGGEGIRKTLEDARHLLINQSIGNYQSLLNKVRNAFADLRIAVHAVTAVESALLDLLGQHLQVPVAALLGEGQQRDAVEMLGYLFYVGDRNKTDLGYRSEHEADNEWFRLRNKEALTPESVVALAEAAYDRYGFKDFKLKGGVLRGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTKEPLQIKGGLVEVPKKPGLGVELDWDALMKAHEVYKSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glucarate
molecule keywords D-GLUCARATE DEHYDRATASE
publication title Evolution of enzymatic activities in the enolase superfamily: crystal structure of (D)-glucarate dehydratase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 129
structure length 399
sequence length 411
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 1998-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bqgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bqgA01
3V5FA 2PP0A 3DESA 4G8TA 4ZCWA 2QQ6A 4ZA0A 4IL0A 3IJLA 3UXKA 3DG6A 4IT1A 4JN8A 4F4RA 3I6EA 3H8AA 3FCPA 3FJ4A 3P0WA 1P48A 4J1OA 4FP1A 3VCNA 3STPA 4E5TA 1SJAA 2O56A 3CT2A 3I6TA 2XH0A 4DWDA 3SN0A 3PWGA 1F9CA 3VC5A 1NU5A 1ONEA 3KUMA 3DDMA 1SJDA 3BJSA 2ONEA 3T6CA 4HYRA 3VFCA 4DXKA 3GC2A 4DX3A 2HXTA 3UJFA 4ENLA 4HCDA 3V5CA 1TKKA 1BKHA 3NXLA 3DG3A 3QLDA 2OZTA 4JHMA 2OQHA 3CB3A 4H83A 1OEPA 3DGBA 4HNCA 3Q45A 2XH2A 3MUCA 1SJCA 3UJSA 3TCSA 1TZZA 4GISA 2OLAA 3IK4A 3H7VA 2PTZA 3TJIA 4H2HA 1KD0A 1MDLA 3JW7A 1P43A 3OTRA 3UCCA 2XH4A 5FJUA 2HZGA 5FJRA 4HCLA 5FJOA 2QVHA 4HNLA 2OFJA 4GYPA 2P8CA 3I4KA 4GMEA 3T4WA 2OPJA 2OG9A 1FHVA 3OP2A 2PGEA 1RVKA 3GY1A 3Q4DA 3UJ2A 2AL1A 4H19A 3RO6A 1PDZA 4K8GA 3TOYA 1MNSA 5FJTA 2GGHA 2RDXA 3T8QA 3VDGA 3D47A 3ZLGA 3UJRA 2FKPA 3FV9A 3OPSA 1WUEA 3NFUA 3TWBA 3UCDA 1KKRA 3QKEA 3P3BA 3IJIA 3MSYA 1NELA 3ZVHB 3NO1A 3FVDA 3N6JA 2XH7A 3OW1A 3FXGA 4DN1A 2MUCA 1ELSA 1DTNA 3R0KA 4E6MA 3K1GA 2NQLA 3IJQA 4KEMA 3ZVHA 2P88A 5BOEA 3ZLFA 3U9IA 2PU0A 2GGGA 2PSNA 2GL5A 4MGGA 3ZLHA 3JZUA 3FYYA 4GIRA 2QJMA 3RCYA 3GO2A 3UXLA 2PP1A 3ENLA 4A35A 3CXOA 3SN1A 5J04A 1EC7A 3RGTA 3TTEA 3S47A 3THUA 1FHUA 3SBFA 2PP3A 2PODA 3SSZA 3MQTA 1KKOA 3DERA 3OZYA 4IP4A 3PK7A 2OZ8A 4GFIA 4DYEA 1WUFA 3B97A 3RR1A 5BOFA 2OO6A 3RITA 2DW7A 2AKZA 1IYXA 4YWSA 2PS2A 2GSHA 4MKSA 4G7FA 3P93A 3T9PA 4HCHA 2QJNA 4HN8A 3VC6A 2P3ZA 3H12A 4E4UA 4IL2A 4EWJA 3EKGA 2OKTA 1SJBA 3ES7A 3CYJA 4K2SA 3MY9A 3EEZA 3N4EA 3D46A 2XSXA 2PGWA 1TE6A 4Z1YA 3TQPA 1XPYA 2PCEA 2ZADA 3GD6A 3TJ4A 1BQGA 4KPLA 2PA6A 4ROPA 3R1ZA 2PMQA 3CAWA 4GGHA 4IP5A 1KCZA 2XGZA 2OVLA 4IZGA 3VA8A 3SQSA 3V3WA 2MNRA 3CK5A 3PWIA 4M0XA 4J3ZA 4FI4A 5FJPA 4A6GA 1PDYA 4JN7A 1MDRA 3RRAA 3ZVIA 4E4FA 3R10A 2I5QA 2OQYA 3DG7A 1JCTA 1ECQA 3MKCA 2CHRA 3TW9A 3H70A 3VCCA 3MZNA 1EC8A 1JDFA 3UJEA 2PPGA 3SN4A 5ENLA 3V4BA 1MRAA 2P8BA 3BOXA 3ES8A 2OX4A 2QGYA 2FYMA 3NZGA 4GYPC 1JPDX 2PTWA 5IDZA 3TWAA 4H1ZA 3U4FA 3BSMA 4Z17A 1MUCA 2HNEA 3QPEA 3JVAA 2PU1A 2QDDA 1L8PA 4KWSA 2GGIA 3R0UA 3S5SA 3R25A 3N4FA 1R6WA 3HPFA 2GGJA 1JPMA 4E8GA 4X2PA 3QN3A 1EBGA 2DW6A 3MWCA 2GDQA 3N6HA 3SJNA 2GGEA 4GGBA 3QTPA 2AKMA 2PTYA 3UGVA 1YEYA 1EC9A 3R11A 1XS2A 4HPNA 4M6UA 4IHCA 4KT2A 2QJJA 2AL2B 3DFYA 3DIPA 3DEQA 2QDEA 2POZA 3OZMA 5EU9A 4A3RA 6ENLA 4DHGA 7ENLA 2HXUA 2P0IA 4K1WA 2PTXA 2AL2A 2ZC8A 2OZ3A 1W6TA 3DFHA 3PFRA 4MMWA 1EBHA 1E9IA 1R0MA
chains in the Genus database with same CATH superfamily
4H8UA 3T8LA 4JQ3A 2XHYA 2X8GA 2FPVA 5JU6A 2A8XA 1EFZA 2VZOA 1ZCCA 3EMQA 4HKPA 2OO0A 3MP4A 2ESCA 1EA9C 1HP5A 1RALA 3B03A 3FDGA 1S2TA 3KBSA 4A05A 3ALGA 3WLKX 4EXQA 3WYZA 4PMUA 3VOIA 3S2MA 2FJKA 2VVSA 2XH0A 4EKJA 1QNSA 3WQOA 4H7VA 3L21A 1F76A 3SY1A 4REQB 1TV4A 5CEWA 5F4WA 3BJSA 2I9EA 3SGZA 5XIAA 4DXKA 3EUB3 3GDKA 3MUAA 4HPGA 4P7OA 3OLDA 2DUZA 3ZSTA 2E9MA 2ZZ7A 2CZFA 2GWNA 3AXXA 3C8FA 1BSLA 1XLKA 1X7IA 5T8GA 3VI2A 5HAOA 4IJBA 3B8UA 1X8CA 4XD6A 1E71M 2VC9A 4RZ5A 2OQHA 1OEPA 4MWAC 3OVGA 4Q4PA 3TP4A 1BYCA 1FDZA 3UYCA 4LVDA 3UJSA 2GFTA 1K8ZA 2QAEA 5D2VA 3G1DA 1ZKQA 3EOUA 1VH7A 2YB1A 4B90A 1W5PA 1MFUA 1LUCB 1SZEA 1PB0A 3MP3A 4RUBA 3EX3A 3OLIA 5FJUA 4P8WA 3LEPA 2VR2A 1XINA 3STFA 3OYZA 1J4EA 2PDLA 2R91A 2DZVA 2Z29A 2PDKA 1XYBA 4S3FA 3G1RA 3T4WA 3ARTA 3S1XA 5GJPA 3T42A 2WNWA 2XN2A 3PFMA 3WQ6A 4IUOA 2HROA 3NA8A 3Q4DA 2WSYA 2PGRA 1M41A 3V18A 3UY7A 2VZSA 3F5KA 1QBAA 2BFGA 2E3ZA 4ZB0A 2ASHA 2C71A 4BI7A 4MIMA 4RV8A 2J4GA 1XRVA 2GRTA 5FJTA 4DXVA 3VDGA 5AC7A 1I1WA 3GD3A 3K2GA 1BVNP 4JCLA 3IJ6A 3U57A 4CNNA 3QF0A 3C5QA 2ISFA 3UPWA 3ITYA 1JAKA 1DWIM 2XIJA 1Q6DA 3VIFA 1H7NA 1TYGA 3LGDA 1N82A 1V02A 1V77A 3LERA 1G67A 3MA8A 4F0MA 4JTDA 1RHCA 3VMOA 3IJ9A 2ZCGA 3FAXA 4IQLA 3ZLFA 2EKCA 4KCWA 2BGQA 1HF6A 1VFLA 1KXVA 2VFFA 1S2VA 4DJDA 3FXYA 4US5A 4AZGA 3UXLA 2D73A 4RE3A 1Y5WA 4DVOA 4EMIA 3ZYZA 3B4YA 5AYBA 4B5XA 1AH0A 4G6CA 1VF8A 4GHRA 3GKFA 3S2NA 1UHVA 1PX8A 3SSZA 3MSDA 5LA2A 4XZIA 3PNUA 2J6VA 2QS8A 3NVWB 2E1WA 2BVTA 2A7NA 2OZ8A 4ZODA 3MP5A 3DJGX 3QQWA 3APTA 3T09A 4FS9A 1OYBA 4Y9OA 3COTA 3WDHA 1FUYA 5I77A 1QW7A 3QQ1A 3TX9A 4XV0A 2FQIA 4B2DD 4HQVA 2JFEX 2B7NA 2VEPA 3KVLA 4DAFA 2C1HA 1E40A 3LGGA 3AWOA 3RR4A 1RD5A 1XDIA 4S39A 3H53A 1WKDA 4H8HA 3IVTA 4E3VA 4LT9A 3EPMA 1SJBA 2OTDA 1KC7A 4WDXA 3AWNA 2WANA 2D0GA 4J35A 4LCQA 1GEQA 1V02E 2ZADA 1SFLA 5E9XA 1E55A 3ECQA 3OVPA 1XLLA 1HNYA 4YVPA 3LHZA 2IKJA 2QPXA 3EOOA 1BYBA 1XH2A 3AMKA 4MZYA 4IF2A 4WLCA 4L1WA 4ROPA 2GSJA 4JIEA 4MAZA 2WSRA 1MW0A 5FF2A 3EMZA 4C1KA 2OGJA 3FJNA 3PBMA 4WJXA 3SUUA 1EJUC 1CT5A 2J7BA 4AX7A 4TIMA 2YQUA 1JRPA 2AQVA 4LJ3A 1OFQA 3N13A 2B7OA 1TZ7A 3BLFA 2OQYA 3W7RA 2XN1A 4J27A 4AXNA 1U33A 1XYZA 4DEFA 4CEXC 3CU2A 4BA0A 4IGHA 2WBKA 4WOZA 2FZDA 3WQGA 2QUNA 3L65A 5DRIA 3C61A 4N0RA 3O6DA 1BRLA 4HSOA 5LNSA 1VAHA 1BFNA 4XUYA 3U4FA 3V35A 3GSMA 4DLMA 2GUUA 3Q65A 4ADWA 1B3YA 1ZBWA 3AIVA 2E6AA 1Q5MA 1W1IE 4G9PA 4Q8PA 4R88A 2VCCA 1E70M 1Z9AA 2NLYA 3M5YA 1XDLA 1F61A 1F07A 3AYTA 1GRFA 3L4ZA 5GJNA 3UXDA 3JS3A 4OJYA 4F0LA 4X2PA 5DMNA 4S3AA 4AF0B 2QCGA 4IWWA 1UA3A 1EX5A 3AYVA 3SCRA 3UGVA 3VPLA 3R11A 4ML9A 4WDTA 4I5XA 4POCA 1HKMA 3VUSA 3W1XA 2Y7DA 5EMLA 2F6KA 3CAKA 4RDZA 2ATMA 3DEQA 3MB9A 3AIBA 4A3RA 1B30A 4UQEA 1JNDA 5HJXA 1FWGC 1EGVA 1CGVA 1XISA 3PBVA 4K7YA 2AL2A 3SRHA 1DNCA 1O6IA 3UY8A 4MTVA 4NZ4A 4PTNA 2TMDA 3NDOA 4ML4A 1K9TA 4M80A 3QW3A 5FS9A 4A2RA 3WUFA 4DWSD 8TIMA 4IL0A 3ZIZA 1CXKA 5A69A 4CU7A 1LRNA 2J74A 4JN8A 4XQ6A 1PX3A 2XIQA 3W72A 1POKA 3ITTA 1M7OA 3U4AA 3T44A 2VC5A 3QFWA 3WUEA 1E4NA 3CT2A 1GKPA 1MO0A 5REQA 1FH8A 4NJKA 3SN0A 1PKNA 4MUZA 1QNPA 5DX7A 1HUVA 3VZYA 3EX1A 1ZHAA 2Z4GA 1AODA 4DX3A 4HK6A 3W7PA 2FGLA 2ON3A 3SCOA 2WLZA 2VEKA 4Q4KA 3VKCA 3A4AA 4DF1A 4XZMX 3REQA 5IHSA 4Q32A 4PMQA 2QR6A 2PI6A 2VWTA 1UC4A 4FIQA 3GNRA 5HWMA 4PFMA 1TTPA 3DG3A 4GRTA 2R6OA 3TC3A 3AALA 3MYOA 3SUSA 1Q65A 3WF4A 3GBEA 1YKWA 3S5YA 3P2VA 4GQRA 4WOQA 1QWGA 5LKYA 2C16A 4A3YA 3LD5A 3THAA 3NQCA 2C79A 2WVSA 1EYEA 3JW7A 4L64A 4ZQCA 2GQWA 2BVYA 3F2CA 5CC3A 3ZSSA 1N62C 3G24A 3S1UA 1KRMA 1NFPA 2ALDA 5LA1A 4EM4A 3TZNA 2QMJA 1PSCA 1I2OA 4H4ZA 4MG4A 1QPKA 5FJOA 4GYPA 2YYUA 4MVAA 1UP3A 1R38A 2A0NA 3QMRA 4D6GA 2YYTA 1PZ1A 1IEXA 3LZ3A 1BVWA 1BXBA 1CB2A 3H4WA 3UJ2A 4AWSA 3B0XA 3B9NA 4AVNA 1E4LA 1E0TA 3UZWA 1JI2A 2ZZ5A 1JDEA 1UMLA 1VQZA 4FNSA 2IPJA 1GWJA 4ZSTA 5HR7A 1OCJA 1XFBA 4WRHA 3TQKA 1S5NA 2YVGA 4S3EA 4OFCA 4ZOBA 4DBSA 5I0DA 4H41A 3FK4A 3MI6A 1REQA 3SZ8A 3CS2A 4OOZA 5CZKA 1FWAC 3QKEA 3G8EA 4A3UA 1DP0A 4FXRA 4QJ5B 3PBWA 4AQLA 2A1YA 1PKMA 1QO2A 3KOYA 2JEPA 2W62A 4O52A 3VE9A 2OOGA 5EA9A 4CD5A 3GDLA 3SUWA 1HW6A 1ADSA 2A3AA 1KXTA 4I7WA 1L9WA 3BJTA 1IR1A 3NNTA 3M64A 3VMNA 2HBVA 3LQGA 4EAMA 1QVBA 2GL5A 4IMCA 1V6WA 4IP7A 4QG6A 2WOVA 4YHEA 1IXNA 1OIMA 4IICA 5A3HA 3L5LA 3NRZB 4LUJA 3MS8A 2WPBA 1JYNA 2EPOA 4NNAA 3MJYA 2DSZA 1KCLA 3NEHA 3KRSA 3S46A 4H8NA 1VRDA 3KX6A 4AEFA 5F4SA 3RX3A 1J11A 2BP1A 4PL2A 3A3HA 1D3GA 1RJQA 3DC8A 3EAUA 1W17A 4AIEA 3ABSA 3HFYA 1TVNA 4B5VA 1HKVA 3VIOA 3W1NA 1NDYA 2X50A 2A4AA 5D4YA 1J18A 3M5VA 2RDTA 4MKSA 3WMBA 3O1NA 1IIHA 4ASTA 2FVMA 5IFPA 2CLHA 2B7QA 4DBWA 4HNUA 4A29A 3GE7A 3CYJA 4HHMA 3UYIA 2Q8XA 5L6UA 1A0DA 3DGRA 1M53A 3HURA 3SUTA 1UP2A 3H2FA 3LY0A 1TPDA 1YX1A 1LWHA 1UBSA 3P8IA 3HF3A 3GTNA 3OBKA 4K39A 5LHEA 5DXYA 1FA2A 3AZSA 4GYJA 1OT2A 3TSMA 3CPUA 1UZHA 1I2PA 3UFYA 5TD4A 1XPGA 3QY6A 4XD5A 1QOQA 5A8NA 2OXNA 5C5YA 3UNDA 4Z2JA 3N18A 1AMKA 5EMJA 2MNRA 1YPXA 4DPPA 4NYYA 3OVRA 3BZJA 2XYLA 3R10A 3E0WA 1OFEA 4HSNA 4IPNB 3LPGA 1K03A 2HK1A 3HGRA 3B8TA 1B31A 1AG1O 3TYAA 1X6LA 3EDEA 4IH3A 1ODUA 4WXYA 3MANA 1ZSXA 1HJWA 1DJXA 2XSBA 1XKYA 4V1XA 4C91A 1OYCA 2VVNA 3LCIA 4LB4A 3N11A 5CPMA 3GRSA 4QS5A 1MSSA 1JOAA 5FKYA 6PTDA 3DYPA 2E40A 5E93A 3WBXA 2WKJA 1XI3A 5DMMA 3QZEA 1ECEA 2PDHA 2HE8A 2IPFA 4UQCA 1RVGA 4KWSA 1IQ8A 1CXEA 4GQQA 4URIA 3WQEA 3E6EA 4XAGA 1TV8A 2CW6A 3QGVA 2ZUNA 3VOCA 4AVFA 4LQ1A 4CUCA 4H7CA 4PBGA 2ZZ0A 4PCNA 1I4NA 1XS2A 2NX9A 2BY2A 4LS2A 4AAJA 2WCAA 1IT8A 3VNLA 1B3VA 2E28A 1D7FA 4DELA 4AMAA 5D9PA 4Q4QA 1RP8A 5D37A 1XSKA 2QW5A 4ZFCA 9XIMA 3EB3A 3NL6A 2OZ3A 3AN1A 2FFCA 3EXTA 1LL4A 4KWVA 3V5FA 4G2DA 1M68A 3SR7A 4E8CA 3TOPA 3M0XA 1UD2A 4H8VA 2BVWA 4Q8MA 4PUJA 1MEWA 3NURA 2E4TA 4Z0SA 1QXLA 3CTLA 1FFRA 2Q01A 1Q2SA 3FJ4A 1BWCA 2Y61A 1KLZA 3W25A 1R2TA 2V0TA 5HA7A 2PDYA 3EB2A 1NSJA 1JAEA 5LIWX 3TTQA 4FXJA 2Y5EA 4M82A 3GIYA 3D3AA 1IT7A 3VC5A 4JQ4A 3CGDA 3WNKA 2X41A 5F2GA 2E25A 4IXXA 1AH4A 4JTJA 3RPTA 5FF7A 1RCOB 5JCLA 4I5RA 4H01A 4GZEA 4ROQA 2HE5A 1AD1A 4AX6A 4UTTA 2BSLA 4REQA 1YIXA 1HKWA 4OV9A 1PBGA 4PMZA 4DJEA 2W9MA 4BWLC 5LNWA 4TMBA 3W85A 4F0RA 5DY3A 2XWEA 3ME3A 3WF2A 4C6LA 1ZNNA 1ZPTA 2WVVB 4AU0A 2BGNE 1ZRQA 3HA1A 4JBRA 5KINA 3Q45A 3TYUA 3K46A 3LDVA 4H9TA 4LAZA 4RL3A 2INEA 1C93A 1GVSA 2PBOA 1IIGA 2OQLA 4HJWA 4W9TA 5HK4A 1VCVA 4XZHA 2Z1VA 1GTEA 1W1TA 1XR2A 5A6BD 3B0VC 4NQ1A 1BTMA 1MMFA 4XSMA 4OUEA 1KRCC 2VMFA 1XCXA 1LUCA 3DK9A 3WQCA 3W2LA 3AZRA 1YBQB 2YZ5A 3DK8A 9RUBA 4NUWA 4O1AA 4MNMA 4Q7IA 1JCJA 3M47A 4E2BA 2PDXA 3DKLA 1J5TA 4GXMA 1EL3A 4GZJA 4R9OA 3VKJA 4C1LA 3PF3A 3GZAA 3KTXA 3AROA 2EG8A 1AMYA 3B8WA 4HNOA 3XINA 3W29A 2X2YA 3K8LA 3JRKA 4ONVA 2WMGA 2ZKMX 2ZDSA 4XISA 2CXGA 2CLOA 4KEVA 4GBUA 1JYWA 3AM9A 2J78A 3UCDA 3C0LA 2V2CA 3VMPA 3CGCA 3L4YA 5LIKX 3DFPA 1VFSA 3IK2A 2IXUA 2NZLA 4HK7A 1UWTA 3ARRA 2DV0A 3NL3A 5GNXA 1NELA 2P1FA 2O9TA 1UB3A 1F4AA 2XGBA 4AC7C 2Z00A 4DZAA 1OFOA 2NSOA 4BEUA 3SQLA 2AGKA 1JCXA 3D9XA 1UUQA 4QSHA 4DWSC 2V68A 2P88A 3WDPP 4MDOA 4D1JA 5EMMA 4YCPA 1FCBA 3UGRA 1XLEA 2ZX5A 3CNYA 3G1HA 4W7UA 1H3GA 4DO5A 1ZCOA 4D6FA 4QIUA 3R8HA 4XIMA 2EPNA 1EX1A 1QO5A 4OT7A 2OYLA 2C3ZA 1HJVA 3E5PA 3DZ1A 1YDNA 1Q1WA 4YMZA 4MB3A 1M6JA 3FSUA 2JF6A 1KFBA 3BLPX 2ICSA 2ISSA 3IRDA 4XKMA 3SQPA 4LY4A 4F48A 5HNNA 1ME9A 2AOSA 4GPNA 3CHEA 5A8GA 1VFOA 2G4FA 2C0HA 4C5YA 3V16A 4Q8OA 1SSDA 9CGTA 4EM3A 3ZR6A 2G3NA 2XM2A 1IYXA 2HK0A 2ZRWA 2BBFA 4ZL1A 3TN6A 3CQ0A 4AD3A 4LOCA 4V33A 3RMJA 5E0CA 4KQNA 3L68A 4RNIA 4WDUA 1RSCA 3CQIA 1TIWA 3M0IA 3UWVA 3P93A 2DZWA 1BG4A 4DO4A 3D6NA 1I1XA 1WCGA 4R53A 1QOPA 2O0TA 2QXWA 3T2QA 2YXOA 1KCKA 4PA8A 4HHPA 1W1VA 3HV9A 2L5HA 4DLFA 2XDFA 1QMLA 4JOMA 4RXFA 2Y5SA 4PRRA 3AHVA 3VTRA 2YL5A 2VKZG 4HT3A 4W7WA 1OCNA 2YDRA 3QHOA 1NVMA 3L4TA 3N9RA 4B5SA 5G1TA 1UUOA 1F05A 1KTNA 1US3A 3MUY1 4UZUA 1JFXA 1P0KA 2J47A 3A64A 1GG1A 1OFDA 3W71A 1TZ9A 2PMQA 1KTBA 2PBGA 2Y6ZA 4AZBA 4IGNA 1G01A 1B0IA 3TN5A 3WQFA 1C90A 4CQBA 1UWRA 4H4TA 5A2BA 4BS0A 1W9UA 4GCAA 5F7UA 5C0QA 5TIMA 4H2CA 1GRHA 5IM51 3B06A 1N8WA 4S2BA 3LRMA 3M41A 3N19B 5LA0A 3MMDA 1FP8A 3ONCA 3R4IA 1OF6A 3PB2A 1VFHA 2X1UA 4O1EA 3VCCA 4HPXA 5HNTA 1GVEA 2IQDA 3AJXA 4JTFA 4WZHA 1V79A 1SW0A 1W2PA 3VE7A 4HNTA 1UWSA 1G5AA 2NX3A 4CVUA 3LYEA 1RJRA 1SFSA 5IDIA 3QPEA 3QFBA 1XIGA 4J3UA 4XZWA 1WXJA 3LRLA 3T07A 2F9RA 3WEMA 1UD4A 1ZY9A 1DJQA 3R25A 2GGJA 1JPMA 1C29A 1FWWA 3RYSA 3A4WA 4NZ1A 1GJUA 1E15A 2QCHA 2ZTJA 2NWRA 2AKMA 2EJAA 3VIJA 2F2HA 1TPVA 4M6UA 3MVTA 1W8SA 3QSTA 4AF0A 7XIMA 1GETA 1I0DA 2OGYA 4C6PA 3HN3A 3KVMA 3OZMA 3STGA 3W7QA 4I9TA 4AD5A 6ENLA 3IUDA 3S9ZA 1UIPA 2ZC8A 2PDQA 3CO4A 4MJZA 1M03A 1XM3A 1NARA 1V3LA 3BLEA 4GJ1A 4JHZA 4PCPA 2YW4A 3NYDA 1JRBA 5M17A 3NQEA 3N2CA 3GW0A 4PSRA 5H8PA 2D23A 3R2GA 3UEQA 4OGZA 3I65A 4HJFA 3HM7A 4B4FA 1VPXA 4IG2B 4HU4A 3CHFA 1P48A 3FN9A 2PDJA 3RM4A 5TAOA 4LS0A 2C91A 2JE8A 3I6RA 5T91A 5MKGB 1MZHA 3BICA 4JTLA 3CAVA 3WQPA 4I7VA 4JQ1A 3C8NA 2PDPA 4QP0A 4HU8A 3W7HA 1DJNA 1W2VA 4Y9MA 3WBYA 3BMVA 2D69A 4V27A 1LT7A 1BG9A 3S2JA 1JGIA 4HCDA 4FZIA 4DNMA 2V6OA 2P10A 3GR4A 2Y63A 3NEVA 3RU8X 5J5DA 2WWDA 4U2YA 3DFOA 4AFYA 1HJXA 2PLKA 4Q4SA 1TUXA 2R1KA 1ZBCA 3W26A 3BCDA 3W4RA 3MUCA 1MW2A 2WKGA 5G2WA 1Q6RA 2VFGA 4ZR8A 2V3DA 4YTQA 3TJIA 1E6SM 4ZO8A 2DZPA 3MO7A 2ACSA 5D2XA 3FGCA 3FHQA 1IZKA 1ZAHA 2CBJA 3PTMA 3U2OA 1EDGA 4LVBA 5H6HA 2E9LA 4EXAA 1E9LA 5FL1A 2J8TA 4ACYA 3K4AA 1XIFA 3FA4A 5FJRA 4UTKA 3J7HA 3AMZA 5AC8A 3NQ7A 3KP0A 4NNBA 2VC7A 4HNLA 2X1TA 1JZ7A 1KM0A 3AICA 2CCRA 3SR6B 3WBEA 4UOQA 3UCQA 3GY1A 5E6YA 2NQJA 3MV01 2RABA 7CGTA 1A5NC 3NR0A 3KRZA 3C2EA 1FDYA 2GJXB 1V51A 4N4QA 4TO8A 3M0JA 4HTYA 1S39A 3RMEA 3EDDA 2JBMA 5LNUA 2W0UA 4Q8TA 4YLWA 3FJ6A 2W91A 3TNOA 3O05A 3A9BA 4GY1A 1T99A 4CQ8A 1GVIA 1SMAA 1UKSA 2ZX6A 1A5LC 5LNRA 1ZL1A 2ZWYA 4RLIA 5AHLA 1E6RA 2Z2UA 1D3CA 1GYLA 3CYVA 1VEPA 3K1GA 3UA4A 1PIFA 5BCAA 3O2LA 1FH7A 2BWGA 3TA6A 5XIMA 5BOEA 3QSRA 2G8ZA 1W1A1 3QGKC 4NU7A 1Q66A 2PSNA 3TQVA 5EMKA 4GIYA 3MVIA 3AIEA 4MDPA 4UCGA 4EE9A 1TV3A 4FX9A 1DWJM 2PC8A 4J3SA 3ENLA 4NHVA 3FKKA 4XKYB 1KM1A 2C1GA 3KCJA 3CMGA 4YHGA 3G3DA 5D9NA 4HBKA 2FTYA 2PWFA 5GRTA 3K1DA 4LAMA 2GR2A 2E5DA 2FB2A 3MBDA 4FX6M 4INFA 1H60A 1J8VA 4D8AA 1XIEA 2VX7A 3GM8A 2WP6A 1RCQA 4US6A 2ADAA 1ZENA 3M4HA 3U5YA 1XLIA 1THFD 1QASA 1XLCA 2WJEA 5AHMA 5G2HA 3VD5A 1BLIA 3UNTA 4G7FA 4JY8A 3HQNA 1FDJA 4MWAA 2AQOA 2HTMA 4HCHA 3PB0A 4PCSA 2QJNA 4WJEA 4OKDA 1SO3A 2KZHA 3U5UA 4H4XA 4IL2A 1P0BA 2FVKA 2XJ7A 3GW3A 1WZMA 2BZNA 3EZ4A 3NSMA 5D9MA 1Y7VA 3URAA 3G1VA 1TCMA 1GOWA 3GVRA 2UWFA 1TR1A 3BAYA 1B2YA 2HVOA 4WVXA 4ATDA 1K8YA 1W91A 3PBYA 3L66A 5CG0A 1XLBA 3GXIA 1S5WA 1SMDA 1QBBA 2YPIA 4YS1A 3G6MA 5LXXA 1JCYA 3W00A 4WIWA 4XD4A 1FVPA 3N9SA 3ZZ1A 2V3BA 1JPIA 2QCFA 4J3ZA 4C6MA 4A6GA 3V0UA 2BTMA 4RNHA 3L2MA 4PB3A 2BCPA 1V5XA 2J7HA 1EJ7L 1XLFA 1UD8A 1L6FA 2CLLA 4LH8A 3KTSA 2CBVA 4EAYA 1R3WA 2RKXA 1WDPA 4XVEA 2VENA 1IZCA 3QVQA 4ORIA 4TVUA 4Z2LA 2ZFAA 4Q4MA 1RAKA 1ZALA 2RUSA 4PEKA 2YLAA 3B4UA 1W9VA 3LCXA 1DTUA 2ISWA 1J0IA 4MWAE 3BGGA 4LTSA 2DP3A 2A7RA 4O4WA 4K68A 4FIRA 2VX5A 4A3HA 4CGTA 4XD3A 3QZAA 3E0LA 1A5AA 2XFRA 3RRXA 2J8GA 2J24A 1DXLA 3CWNA 3WCZA 2C15A 4MYAA 3A5FA 4L9ZA 5JVLA 2NVDA 1RQBA 4J40A 2D20A 1LP6A 1AFSA 1DQXA 1HIZA 4HP5A 4QFUA 2HQAA 4QLKA 4ZTYA 3DUGA 2X40A 3ITVA 3N73A 3W9ZA 4DJFD 5AHFA 3QTGA 5EYWA 3QC0A 4HOXA 1KO0A 3FVMA 5C2CA 4O19A 3CHCA 3WF3A 2YCKX 2PFHA 3D5HA 1FFQA 1CW2A 4PUWA 3POHA 5EL1A 1XDJA 3BG9A 2GK1B 2ZRYA 3DC0A 1LOQA 3GG1A 1LL7A 2VGIA 3EWUA 2WO5A 2J75A 3AC0A 3BDKA 1K9FA 1B90A 1BQCA 1AVAA 3GTFA 3LNPA 4F4RA 1ESWA 3M5XA 1RA0A 1DWAM 4IMFA 5CH9A 2YVJA 3I3EA 2DPEA 4GUIA 4GI4A 2NSXA 1CLXA 1Q63A 4W8BA 4R33A 1ZJBA 2G3IA 3CQKA 5BRBA 4W86A 3FKRA 4X60A 3GU9A 2NUWA 3F1QA 3KUMA 2PD9A 4JTIA 2VZUA 1LL6A 3QFAA 3NSXA 1XRTA 4PCFA 4S3CA 4Q4OA 2ZUWA 1EO7A 1FWCC 4QEHA 2AQWA 7TAAA 2WMFA 3V5CA 3WEZA 4Q3MA 1CWYA 3WLRA 5AECA 2OEMA 2XSAA 4AYGA 3NXLA 2XIBA 1VS1A 3IWPA 2WPGA 2LLEA 2W67A 4EPDC 3PBGA 5H2ZA 3SGUA 4GUHA 4HNCA 1ADOA 3I4EA 2GZXA 1J2WA 3EWXA 1BYDA 4L5ZA 1UD5A 2WVVA 3H2OA 3VGEA 4J56A 2PTZA 3UT0A 5M3WA 1DIKA 4ZXLA 4UFLA 3RLVA 2WQDA 3CC1A 1DWHM 1SO5A 3SUVA 5I09A 2TODA 3SEPA 4WDWA 4JN6A 1XIIA 1OINA 2ABAA 2X30A 1FHDA 4MM1A 2P8CA 1QU4A 2PLMA 1NWSA 2FH8A 4LWWA 5HJYA 4JX4A 4GYFA 3OOQA 3B8SA 4TOQA 1YBQA 1H41A 5IBXC 3W81A 1XLHA 2X42A 4OU1A 1EEPA 2WPEA 4N9EA 4H9UA 4R3UA 4PUEA 4RV3A 4S1FA 3F4CA 3U8GA 1Z7AA 4CD6A 1JDDA 3APGA 1P4CA 4JY9A 1MNSA 5FJJA 3BLKA 4PUKA 3QHNA 1JD9A 3K30A 3E2QA 3D47A 2CLEA 1GJPA 4ADUA 5G5GB 4H4WA 4LYPA 1ZMDA 2E77A 1JRCA 1FWFC 2W3SA 4IJCA 4UB9A 1K4QA 4MLRA 3TYCA 1I0BA 4YN5A 4JAWA 1CENA 4LV9A 1ISZA 3WK1A 5I3IA 3FXGA 1XYCA 1IEWA 1GORA 4FOKA 3QMSA 4EMJA 1OCBA 1VYPX 3N2TA 3TV8A 5FD0A 3EGJA 3R7MA 1MUMA 4H7ZA 2V5DA 4XIAA 1L6GA 4RR4A 3AS3A 2C3DA 1E5JA 2UY5A 4F8XA 3MC5A 2P5NA 1QPRA 5I24A 4GIRA 2OYKA 3ONBA 4M1BA 1KGWA 1O60A 1ICQA 4A35A 1A0CA 3S3GA 3MHGA 4PULA 5HMFA 1M1BA 4HZMA 1KM2A 4ZQPA 2PODA 3FS2A 3S8HA 2SFPA 2XIIA 1I45A 4GFIA 3VIGA 1EDQA 3WDQA 1QFEA 1EZWA 4IFOA 4BZYA 1GW9A 3GXTA 1HX0A 1W1PA 1OG0A 3L2LA 5KETA 5FEPA 4K8DA 1V7AA 3HG5A 4Y6GA 4S23A 4MSSA 1Z69A 2WZMA 3WLSA 4LY8A 3QEZA 2ZXBA 4D9PA 3M0YA 3G3MA 3L2IA 2OKTA 1EDTA 3ALFA 1WPCA 2ZZ6A 3AAMA 2PGWA 1TE6A 3TN4A 1TMLA 3LN3A 2I56A 4FXFA 5JCKA 4CNUA 1UKOA 4HMEA 1XQKA 2PLJA 1SR9A 3GD6A 3TJ4A 1BQGA 2YCEA 4Z2GA 1KFWA 4HPJA 1VLWA 3RX2A 2D2GA 4TX6A 4RPQA 4AD0A 1UR2A 1MW3A 1XWYA 5TBOA 4QAIA 1OX6A 1SVDA 1W3LA 4FNTA 4XSLA 3G0UA 4CQDA 3ZQ9A 3KW3A 4GI9A 3V1PA 3WNPA 1UWUA 3H54A 3BSHA 2D0FA 4V28A 2Z1SA 5FJPA 3KHJA 3LHUA 3AI0A 3MO4A 3NJ3A 3SM0A 5CZSA 2DIJA 3LXBA 3U6WA 1TIMA 4HTBA 5BXSA 3NUKA 2BC0A 3LCFA 1P0NA 1U30A 3DG7A 1I60A 1W0MA 1WDRA 3C2RA 5AZ1A 3RXZA 2WVTA 4L6HA 4FAMA 3HG3A 4M6VA 3SN4A 1GQIA 1ODZA 3SJ3A 4O50A 3WELA 5E9AA 1CX9A 5CZTA 4O0ZA 4PB5A 2WLYA 1DJHA 5TF0A 3V1HA 4P7RA 1E4MM 1OFBA 3AXIA 1XXXA 4TV5A 1H7OA 3KEHA 4BJHA 1DPMA 4D6IA 3EYPA 5D30A 4N6EA 1OX4B 4DBDA 1C92A 1K9DA 4XBJA 2YAUA 1P1XA 3CGEA 3P81A 1Q6OA 1GOQA 3PG6A 1JI1A 4NYUA 2V5LA 5F2IA 1R7AA 3AS2A 3UZXA 4N9BA 1G7UA 2EEXA 2CZ5A 2JIWA 3LTYA 1P0DA 4M56A 4HOZA 3L5MA 2C6QA 4UTLA 3CH9A 3IJ7A 4DJDD 2BXZA 1XUUA 4US5D 4BI6A 4CQCA 3EPOA 1S1RA 2X1RA 4DHGA 2B0MA 4K1WA 2X16A 5A6AA 4C6JA 4C6CA 3PTKA 1E3XA 1E9IA 1KFLA 5DRCA 1ISVA 1XLGA 4IJRA 1JDCA 2FZMA 1NHPA 3U7VA 2VFDA 3HPAA 4IPIA 3TJXA 5HJLA 4N7QA 2UV8G 1MXSA 3VNKA 3E3HA 3PSVA 3PN8A 4J1OA 1S3HA 1LRQA 2ZUVA 1DXEA 3MHFA 3HJEA 3ZO9A 5D8WA 1DJIA 1NOWA 3C2FA 1T7LA 4IG2A 2JGQA 2J27A 2C1IA 2R1MA 3GTIA 3AIRA 1KA9F 1BHGA 1WBHA 5LIYX 1RP9A 2ZZ3A 3GUGA 1M9HA 2Y0FA 1M7PA 3W0KA 1UKTA 5HMEA 2OWCA 2WC7A 4PMXA 1GHSA 1TKKA 4JDRA 3CWHA 4MB4A 1UD6A 5KEZA 1E4IA 1E1CB 2V3GA 1SZFA 1FRBA 3E12A 4TUFA 1A4LA 1TREA 5KMYA 1TJ1A 2VDIA 2H6RA 3R79A 2ZRVA 4YTTA 4ZBCA 3I7SA 4GI8A 3B8DA 2OWXA 1MDLA 3VIPA 2VP8A 4IX2A 1FX6A 4ZQMA 1J93A 4NF7A 3MCMA 2EG7A 4H9VA 2D22A 3M0VA 1QCWA 1MXDA 4AC1X 3P60A 3BG5A 1FXPA 3H2MA 2QVHA 2WM0A 3I4KA 4W87A 5B7ZA 2TAAA 1T96A 1VENA 2XN0A 3UXIA 1E72M 3EXSA 4EX4A 3UP8A 4NVTA 2PGEA 3ATYA 1VBJA 5FF3A 3GFZA 1S2UA 4KKXA 1K7FA 4DNAA 4JDBA 2NX1A 2QVNA 5KVHA 3WKZA 1LOSA 1ML1A 4K8GA 3ARXA 2PRLA 3L4WA 1B57A 2CESA 3T4CA 2DDXA 3GAYA 3PZ9A 2GJXA 2NV2A 3ZLGA 5A6KA 1TA3B 2BG5A 4DJFC 3FV9A 1MRQA 5BU6A 4UFIA 3KHDA 4TX8A 4GQ0A 1JIBA 4ILSA 5F2MA 1FWBC 2PB1A 3V7PA 2GUYA 4EPBC 2Y62A 3MSYA 3G1XA 3GWQA 2BX7A 3ZVHB 3THCA 1AL7A 3MCNA 4UR8A 4D2JA 3ZMRA 5A6LA 4YU1A 1WB0A 1EQCA 2GJRA 3NSNA 4KEMA 4Q22A 3RNDA 3I3DA 2VEFA 3LCHA 1GZGA 2NW0A 1YPIA 1QRQA 4U28A 3V0SA 1YDYA 4AZ5A 1R5YA 4LVAA 3JZUA 3LB8A 4PMRA 1UROA 3KTCA 1AJ0A 5HULA 4TV6A 4ZO9A 2BOFX 3VD7A 1XQLA 3TYEA 1RA5A 4XKYA 4AUBA 3MQTA 3TYZA 2VYOA 4GJJA 1FECA 3M0HA 4H4YA 2OZ0A 4O17A 3RR1A 2PWGA 4QDWA 4YNGA 4EQXA 2Q71A 2DW7A 1XIJA 2WHLA 3WDIA 4BWLA 1TUFA 1ENUA 2W4XA 1XFCA 3LOTA 2FIQA 1PWLA 2A5HA 4W8LA 2FGZA 3M0MA 4DM2A 5PTDA 2I5IA 3MBFA 1IEQA 1E9YB 4UQBA 1DHKA 4LNCA 3WMSA 2YDAA 1WQ5A 3Q37A 2W3RA 1XYMA 1F2JA 2DZUA 2RDWA 1YQ2A 4J4KA 1N8IA 4DNHA 4C6IA 5DBTA 1HQTA 4RXGA 3ARWA 4CCCA 2DIEA 1RJPA 1W1B1 1H51A 2EXOA 3CUFA 3W70A 3S5NA 2GDUA 2PGFA 4ZO6A 4IFKB 2PA6A 3GHSA 5CBIA 2CFYA 4Z42C 4QM1A 4GGHA 3FNDA 2JALA 3TMLA 1DXFA 3G1SA 1HFBA 3KLKA 2DSVA 4OOUA 5CSUA 1DJGA 1LG2A 4TMCA 1I6NA 4I9JA 4W5UA 3V36A 2VRQA 1MI3A 1ZJAA 1X1NA 4IX0A 4U2ZA 1PTAA 1MQRA 1B3ZA 3EX4A 4DF2A 1TVLA 3SY5A 1ECQA 3GU1A 3IACA 1S5MA 1GQNA 3NZ1A 3SCUA 2XUCA 3A3WA 5F1UA 4GXPA 2ZX7A 3MZNA 1EC8A 3UJEA 2PDIA 3UWWA 3WD4A 4A8RA 2XVPA 1M3UA 2WV8A 3KBVA 3TCEA 2XIOA 2V5BA 1JPDX 3F4WA 4PB4A 4GUFA 2NXGA 1RBLA 3PR2A 5FL0A 1VYRA 2FDMA 2VM8A 1KR1A 5AC4A 3ZJ7A 2RGLA 3KL5A 1XV8A 3NOEA 2FMNA 3VD9A 1NPXA 5JCMA 2QDHA 2XTKA 2WW5A 1VIWA 4NZ3A 2QULA 3CASA 4H4IA 4GGBA 1KBLA 4QTGA 1TX2A 1EC9A 2VDGA 1YDOA 4GH3A 3W22A 1UZ4A 4ERAA 3LUTA 4U5KA 3BXWA 2VO5A 1EJTC 4C90A 1GSNA 1XKJA 2PDWA 4GQGA 3WENA 5ECUA 1OGSA 3FA3A 1W6TA 1SW7A 4MMWA 3CQHA 3H24A 2E09A 3L8KA 1F3XA 4CLMA 1G69A 5FS8A 4DZHA 4G8TA 1UR3M 1REQB 3IJLA 1UW9A 4EPEC 2DT3A 1CCWB 2GK1A 1PTGA 3H8AA 3OU8A 1XRSA 3GYEA 3T0CA 4P2VA 3UR5A 3WDJA 2CZVA 3CMJA 3LLFA 3VCNA 1VR6A 4Z2IA 1FOBA 4DWDA 1E56A 5IHRA 1EOMA 4A8NA 4HVXA 1O94A 4S3DA 1R9YA 4KCUA 5JBDA 2GOKA 3DDMA 5TR3A 1K3UA 1XLAA 3KDNA 4QNWA 4QE1A 4Q8NA 2A3CA 3BAJA 2QPSA 5DCEA 4NRRA 3W1TA 5C6MA 3EWCA 4B5WA 1E0XA 1ZAIA 5ABTA 2GJNA 1ZK7A 1C7SA 3F7JA 3WQ4A 3H4KA 4UQAA 4WF7A 3AYSA 2W0HA 1S2AA 4UR9A 1KTCA 1HJSA 2VX4A 2OZTA 3WL0A 2OT0A 5M5DA 4E2VA 3MUIA 3GTXA 4UTWC 3UWEA 3VYLA 2D2HA 2YFOA 1V3JA 1B3WA 4LS1A 4H4VA 1WO2A 2NPXA 2H8XA 3QPYA 3TDFA 2YW3A 1ALDA 1LF1A 4EQRA 1DHPA 4GCXA 1Q6FA 2Q3RA 3K5XA 1AQMA 4J28A 3WFAA 1KLYA 2ZRZA 3W27A 3UCCA 2IS7A 4PYSA 3NZRA 2ZWZA 3B40A 1UH3A 3S1WA 4JTSA 3UF9A 3P5YA 3W2KA 5HNRA 3PPCA 3GNDA 2J62A 3M7SA 3R58A 4O10A 2P53A 4YPJA 5H91A 1VQTA 2ZVRA 2HWGA 3FSTA 4NAFB 4JPGA 3ABXA 4QEEA 4J2MA 1FHVA 3OP2A 4GC4A 3W7KA 4O1FA 4UFJA 5D38A 2J3NA 1CB7B 2PEVA 1FBAA 1G7VA 2YCJA 4Q33A 3HRDC 2RDXA 2J6XA 1ISYA 3BCJA 2NQZA 3RAOA 3QR3A 4Y9NA 4U10A 3N04A 1LOLA 4O57A 3THQA 4F0KA 3AZTA 2E7FA 4UFKA 1ITXA 2VUNA 2OYMA 2D3NA 1GYMA 3WJWA 3UPMA 3VIMA 3GZ3A 4JIHA 4LVGA 4GBDA 1OC7A 8RUCA 1XIDA 4KBXA 3KBJA 3WDRA 1QJWA 1EO5A 1IGSA 4PGLA 5D2WA 1JROA 1RCXB 1QNVA 1EGZA 3CLWA 2IKGA 3G6LA 4G1KA 1SO6A 3NO3A 3RCYA 2WZTA 1PCKA 4NL1A 5MHBA 1OFRA 2Z6JA 1JZ3A 1XG3A 1F8WA 1KQZA 5FEWA 3M6YA 5J8LA 3THUA 3SBFA 2RFGA 3LB0A 1HXJA 4X9SA 1J96A 3R13A 4UFMA 4HZ7A 1TPEA 4ICCX 4LBUA 3FA5A 3M0KA 4HSHA 3QHMA 3PTQA 3SCWA 2CHNA 3BJFA 3UWUA 1I2NA 3GVGA 3W82A 2Z2BA 1LBLA 1W8GA 1LLWA 1X6UA 4DJED 1CXIA 1W5NA 2YXXA 4UTFA 3TTSA 4S3GA 3DCPA 3B8IA 2ZOXA 3T0BA 3W24A 3PZUA 1ZBVA 1XYLA 7REQA 1FHLA 4DF0A 1POJA 3D46A 1A4MA 5GPRA 1R86A 4ZOHB 4UMAA 1T3QC 1F6PA 4KCTA 5GNYA 5DMLA 3O6CA 3W53A 4JYDA 5LGZA 3A7AA 3TNBA 6ALDA 1F5ZA 4QLLA 3RNMA 2XVKA 2VR5A 1C8QA 2FHFA 1PHWA 3MWAA 1VJSA 4JTGA 3SRKA 3VABA 2NQ9A 2EGZA 3ZT7A 2J13A 3B9EA 5T26A 4JNZA 4PMNA 1JDAA 1LWJA 4IZGA 4NSBA 2HMCA 4I6KA 1NH6A 1K8CA 1EIBA 2WHKA 2CIPA 5CPSA 4M0XA 4TX9A 5MF5A 4LVFA 5BZAA 3WNNA 1MDRA 3GHRA 3RRAA 3KZSA 1CLKA 1V0NA 3NAVA 3XISA 1JCTA 1WKYA 4BQ3A 4DZIA 3AQUA 2ZE3A 1EF3A 4DUOA 3H70A 2ZA1A 4AY8A 3CZLA 4XZLX 5AY7A 1PYFA 2CFFA 3A6OA 3WH9A 3TA9A 2WOQA 3ZJ8A 1YXYA 1UKPA 1LTDA 2PRHA 1Q85A 2V5KA 5C70A 1A5KC 3TVAA 3CUZA 5J5RA 4NI8A 4H1ZA 3WSUA 4OQVA 5D02A 1IR2A 3TEVA 1JYVA 1EBDA 4TVWA 3JVAA 4EACA 2EPHA 2ODOA 3PY2A 1IXQA 4KGLA 4GRSA 2DQXA 1VBRA 3HFTA 1NWRA 3CQJA 2TYSA 3NQVA 3DYMA 1JFHA 1GW1A 4U33A 4PFHA 4LA1A 4O11A 1OX4A 4HZ8A 1S7MA 2GDQA 2PDFA 3KVKA 5E6ZA 2BMBA 2VD9A 1ONRA 3IGXA 1QK0A 4F2UA 4KT2A 2QJJA 4B3ZA 1H6VA 3EWWA 3GD4A 3P5ZA 5AC6A 1VFFA 2POZA 3QJAA 4MY1A 5JUVA 1WNOA 1B4EA 2V30A 3VZXA 1L6SA 4W88A 1E9ZB 4ZOEA 4MZ8A 2VTFA 4XZNX 1PAMA 1QNRA 3AUOA 4I8YA 4OUIA 3UVIA 3T05A 3BW2A 4J5NA 5U4NA 1KXHA 2WWCA 2W66A 4H4UA 4XK2A 1AUSL 3AMCA 3USZA 4E5TA 4G5DA 2WXDM 2GPTA 2ZRXA 3BLOA 4JDYA 2X2GA 3NVVB 3AU2A 4TTUA 1NF0A 1RXOB 1DKWA 1ONEA 1RZMA 1V03A 3WQ8A 2ONEA 1PS9A 2V2DA 4FNRA 5K9CA 2PLCA 3RILA 1NDAA 1Y8BA 4P61A 5A95A 2QUMA 2WJFA 5C8BB 1H5VA 2ZUTA 3N34A 1J12A 1YTEA 1PHQA 1ZY8A 4PMYA 2CLMA 2CBIA 2OX1A 5A2AA 2X99A 3SFWA 1YQZA 3PG8A 2REQB 3TXVA 1GEUA 3WN6A 1PTDA 1XD0A 1B9ZA 1LJYA 2BXYA 1WDDA 3I3BA 1E1CA 3AIQA 4WHBA 2ZXDA 3NDYA 3E9AA 1LROA 2F2KA 3WEOA 1VP5A 3KM8A 3W2JA 5JMUA 1FO4A 3LXAA 2V2HA 4QG8A 3A21A 3SRDA 1LPFA 1P43A 3WX7A 3QMTA 4L6OA 1BF2A 1VCFA 4IQDA 4F0HA 1C8YA 2XWDA 5HOSA 2HZGA 2OSYA 3FEQA 1KRBC 1EYWA 2WSQA 5HNUA 4EXBA 3ABRA 3NIYA 4J3TA 3L0GA 2TPRA 4Z2HA 2OPJA 2NQ5A 5JCNA 1E43A 3N6QA 4NNCA 4L4OA 1W56A 2AL1A 1NDZA 1M5WA 4MKNA 4AHPA 1LLZA 4AXKA 4TQTA 3RX4A 4ZE5A 3MUXA 3EANA 1O68A 1CGYA 5DF0A 1CEOA 2DIKA 1NFGA 3G5EA 1T40A 2QPUA 1GKQA 1L6WA 4K7ZA 1IV8A 1RK6A 1K02A 1SQ7A 1TELA 4RNFA 5BXPA 2CERA 1TWZA 4CD8A 3C3NA 3GNOA 4CCZA 6REQB 1TA3A 4KRZA 3SY8A 4ZOCA 1VYSX 2YR1A 3FEMA 2F8QA 3N9KA 3ETRB 5A8MA 2XH7A 4PMOA 4TVYA 2PWHA 3BGAA 3VILA 1H61A 3ICJA 1XBXA 1O5KA 4O0KA 3ZVHA 5I3FA 4FX7A 1OF8A 3OQ8A 3LCGA 4H9MA 3HPSA 2XFYA 4I9MA 5D09A 3MDUA 2GGGA 3W84A 3GVVA 3NPWA 2YL9A 3LLXA 2GDVA 1B9BA 4IXHA 4BF7A 1MEIA 1X1ZA 4UTMA 1JF5A 4LALA 4CU6A 3RHGA 1O12A 5C9WA 3RU6A 3GG0A 3SCPA 5DXXA 1GOIA 3B05A 3KFTA 2PDNA 2QF7A 3EWDA 2GQAA 2VRKA 2E6FA 3PAOA 4M7TA 1FHUA 4F66A 3CH0A 3R5EA 4JTEA 4HA3A 1H0GA 3OZYA 4CQ9A 3BG3A 1ZJIA 2PZNA 4R5EA 3QM3A 4B9YA 1D9EA 2WJDA 1UPMB 3QKZA 3CEPA 2CWNA 3WK2A 4OZOA 1U2YA 2V5JA 1ISWA 1ZB5A 2QMKA 3OA5A 4MUPA 3ZOAA 3OG3A 3OEXA 2Y5JA 1M7XA 1UA7A 4J3XA 4PTWA 3W37A 4GKTA 1H5YA 3TFCA 3M0ZA 2EAWA 1AQ0A 3LZ5A 3WD0A 3W6LA 1I75A 5D03A 3UG4A 3PZNA 5A2CA 1RPKA 5CC5A 4BI5A 3VGBA 3LM3A 1WX0A 5HPCA 2FZ9A 3TQPA 5HWNA 4KIRA 1DV7A 1NDVA 2VT0A 1W9XA 2CYGA 2E8ZA 4QE4A 3N2BA 4L4LA 3EX6A 5AOUA 2PWDA 3W73A 2PAJA 3ZXWA 3VM5A 1TV2A 1GT8A 3ARPA 3CAWA 1KFKA 1R3VA 4FXSA 2D3LA 5IBXA 4IFKA 3NYZA 5HANA 2XVNA 1KWGA 3CV2A 1S46A 1W54A 3W7GA 3IGSA 4UIOA 4UWMA 3CV7A 3LTSA 1H7WA 4R9XA 4XB3A 1PJ9A 4DUVA 1D3HA 3PJXA 3KL0A 4LAKA 4A8IA 1FH9A 3G8RA 5AHIA 3VAVA 1FQ0A 4JGDA 1W3IA 4QBXA 3TLLA 5C9RA 1W37A 3V4BA 4D6HA 1QI3A 1N5WC 1H1NA 1T8XA 2OX4A 4F9JA 2FYMA 2G50A 4ZQOA 4LBRA 3URQA 4ORMA 1EXPA 3BUVA 1ONWA 3FGCB 3EF6A 2GGIA 4LCRA 5HBFA 4JQAA 1ZP4A 2A2IA 4OBRA 4H9ZA 1GOKA 2P0OA 3MWCA 3V75A 2GJLA 3G0SA 1UOZA 1EXBA 2PTYA 1TMQA 2WB5A 4LFYA 2HPMA 4I3GA 4K8HA 4TU1A 3CGBA 4EQSA 2A3BA 1A0EA 1AA1B 5FEZA 3MSGA 1N7KA 4QISA 3OQEA 2HXUA 4BEQA 1TSIA 4GY0A 1Q13A 4X3ZA 3AXHA 3NVTA 5DQPA 3ZJKA 1HVXA 1EJRC 2ZZ4A 3DFSA 1MXGA 2HNHA 2WCGA 4JNYA 3WJZA 3PS7A 3BTNA 4W5ZA 3LHYA 2R14A 2PD5A 4IGSA 3OC4A 3AMDA 2NQHA 3LTPA 3UXKA 3DG6A 3H6OA 1FWDC 4MOZA 3FJLA 1BD0A 2Q02A 4W84A 3UZYA 3PHAA 2GVLA 3STPA 2WZEA 3GR7A 3P8JA 3PWGA 4IQEA 1F9CA 2C3CA 3C6CA 3VDHA 1UPPA 3PM6A 3HIJA 3UZZA 3BE7A 4KESA 2G95A 3BAXA 1GONA 2X8RA 2HXTA 4V1YA 4N02A 3KLJA 2PE4A 1YADA 4UQ9A 4X61A 1TRIA 2BGSA 5EFDA 5LGXA 2WSPA 4FNPA 2ISDA 4BFAA 5E09A 3T40A 2ZZ2A 1F7BA 3AOFA 5CPOA 1X38A 4PN2A 4PEEA 4L56A 1O66A 3EEGA 2CETA 1L0PA 4JHMA 4QHRA 3CB3A 3QRHA 3DGBA 1B3XA 2QJHA 2XH2A 4Q4RA 3POCA 3GKAA 1JXJA 4KEZA 5BMWA 2F84A 3GNNA 4O8RA 1TWWA 3LU2A 2A6LA 3W87A 1LRTA 2BLEA 1Z48A 2WHMA 4O13A 3TN3A 3W3OA 4L4MA 4EIVA 2I1OA 1ADDA 3BLIA 1WBJA 4K6AA 5CC7A 1XH0A 2HCVA 1NHRA 4RJEA 4MWAB 1GRBA 2G41A 4Y7EA 5BMXA 4LEQA 3W83A 4F3HA 3QR1A 4N2YA 4EF9A 4HYVA 4GMEA 4O8AA 4CNTA 2CKSA 1QNOA 2OG9A 1JQXA 4ZEPA 1JYXA 4Q7NA 1RVKA 5D2TA 4X2RA 3A7RA 3BL3A 3WLQA 4RE2A 2J9XA 4BURA 3B8VA 4NAFA 1H4PA 1EGMA 2BS9A 4LYRA 4GX9A 5T9BG 5EMYA 2VCAA 2EQDA 4H6QA 1ZAJA 3T78A 1L8NA 4DY1A 4NJIA 4WJ8A 4NXSA 1ITUA 2R82A 4PH6A 4C1NB 4LC6A 1F6KA 2VURA 4D6DA 4JX5A 5D33A 4QE5A 3TAKA 4Y90A 3VUPA 1KKRA 2XINA 1BPLB 1GZ1A 3H7UA 1H09A 2POTA 4WX2A 2WQPA 3T1GA 1DORA 2J8FA 1UC5A 3GH4A 3TONA 4KERA 4M51A 4W89A 1V59A 3OW1A 1R87A 5HR6A 3B9AA 3UG8A 3RG6A 3P61A 2PRMA 3F2BA 3H26A 4NIRA 3CV1A 1CXFA 1NJJA 4JTQA 1BTCA 1M65A 4M81A 5G4EA 3QR0A 3W2UA 3O0KA 3ISIX 3CGTA 2YA1A 1KV5A 2Q8LA 1E0WA 4P8XA 3NQ8A 5JQ9A 3P62A 2GR3A 2PP1A 1UWAA 4GO8A 1RR2A 4UCFA 3BW4A 5XINA 1PWMA 3W86A 4D71A 4OE7A 4AIUA 4B5TA 3G1AA 4JQ2A 4RK8A 4WGHA 3Q94A 4YWOA 1WKFA 1JQVA 4V2XA 1MWOA 3LHVA 3MHUA 1WUFA 2Y8VA 1V7YA 3ZT5A 2OO6A 3OLGA 3PWAA 4ADSA 4MY8A 2YDSA 4TR9A 2PDMA 2H9AB 1GRAA 2BC1A 4YWSA 3L12A 1YYAA 3EA2A 3PUEA 2CEQA 4D8LA 5LIXX 1XBVA 4NZFA 1HGYA 4LUIA 3DXIA 4KS0A 3CO8A 1OX5A 1FFUC 4HN8A 5AKQA 3BCFA 3WNLA 1IHIA 3AHZA 2R94A 3A22A 2CZEA 3KXQA 3N4EA 1VPYA 1SM9A 4JIPA 3VINA 2GQ3A 2XFFA 2GQ9A 4UTIA 4RDVA 3E0FA 1SSGA 1E3ZA 4IMGA 3GR8A 3DI0A 1D8WA 4JTTA 4NEVA 1SB3B 1W1YA 3MV11 4X63A 5FMHA 3TW6A 1OCQA 1IEVA 3VA8A 2OKOA 3DYOA 1OD8A 3C2VA 3AU6A 2YBTA 5CPLA 4KGJA 1WXYA 5C71A 2CPUA 2WMJA 4KWUA 2I5GA 3VXGA 3A24A 4FI4A 1PDYA 4JTUA 1DJYA 3QY8A 4DZ5A 4IMDA 5G5HB 4AY1A 2W5FA 5IRPA 4BK9A 3THDA 1NAL1 4WEVX 3N29A 4WSHA 1A47A 5EFFA 4DJFA 3VIIA 4DRSA 3DBNA 3BLDA 1KXQA 2PPGA 4B15A 1ZFJA 3B0UX 3BANA 4HNNA 1OVDA 3AIWA 1WYIA 1T6MA 4NZ5A 4ZE4A 3ES8A 2VFEA 4I7UA 4L7ZA 4PUDA 2BHZA 1N5XA 3HPZA 3AHXA 3TUUA 1W3KA 4E2OA 3A12A 4QNEA 4AWTA 2QLYA 2HSAA 1K8XA 3DENA 3QH2A 4JX6A 3S5SA 5AB3A 1M04A 4QQ3A 3VX1A 4Q8QA 3G77A 2V8ZA 1X6NA 8XIAA 1E6PA 3A23A 5AZ0A 4LF1A 3BGJA 1UD3A 1YEYA 1AW5A 1V4YA 1VEOA 2WMIB 1R46A 3EX2A 5LNVA 1GQJA 1UCWA 3MTWA 3NZQA 1MQPA 3GG8A 1OYAA 4NJHA 3BAIA 3VNZA 2P0IA 1A3HA 3MT1A 1A3WA 3OGVA 4E8DA 3PFRA 4W7VA 2YGYA 1CNVA 3OJGA 1QI4A 3OB8A 4AWUA 2ACRA 3PPHA 2DY3A 5H1WA 1X2GA 1YPFA 1Z44A 1IWPA 2J25A 3GTHA 1GG0A 3CZJA 1E73M 2J7GA 3PUDA 4B9ZA 4ADTA 1Q7QA 4OHQA 1IWAA 4HA0A 5I5RA 1G1YA 2Y85A 5CSRA 1UR0A 5CGTA 3S6TA 3EKLA 3QC3A 3S1VA 1E51A 4QX4A 1DQUA 2Y8KA 3UWQA 3E49A 4C65A 1O4UA 3NTYA 3LHTA 1E6XM 1V93A 1VGAA 4WUIA 1YDVA 4BY3A 2Z27A 5HINA 3ZWSA 1ZTVA 4UMCA 5D04C 1H62A 1J0YA 3QGAC 2PWVA 3VOFA 5L9FA 1CTNA 4E38A 2YA2A 4H9XA 4QDPA 4KETA 1TTJA 2BY1A 3W2NA 4AWEA 4E4PA 1SPQA 2E6YA 1GZJA 1CGXA 1XYAA 5LXEA 4RPPA 2WBAA 3W7JA 1SJCA 2REQA 1FWEC 3MU7A 2WOIA 2BODX 1CI1A 3BARA 4LW7A 1BEUA 3URBA 3LQLA 1A53A 2G5WA 4EWND 1D7KA 5FESA 3W7EA 5BRQA 3WD3A 3CZGA 2XH4A 1KGUA 4FK9A 2HEJA 2JKPA 3WF1A 2G3MA 3L5OA 4N42A 1E6ZA 2P50A 3BK0A 1VFTA 1CYGA 1U1JA 4C6DA 4M1RA 5BWAA 4G56A 2YX0A 2Y2WA 1V6VA 3LX9A 4H19A 3N17A 1K4HA 2WHJA 4ATLA 5BNKA 3AISA 5AC5A 3C3UA 3DK4A 3KOFA 4QS6A 1F3WA 2IMRA 1XGDA 3C4UA 3N2MA 5A6MA 1GK8A 1F3TA 2XG9A 3W1UA 3UJRA 3Q2DA 4PCTA 4NJGA 5AYZA 3OBEA 4R7OA 3TWBA 3BSGA 1YNPA 4OBTA 1I8JA 2IUZA 3AXKA 1Z42A 1FKXA 4Y9PA 1NWUA 3IIPA 2I7GA 4UQDA 1H11A 1R3QA 3FVDA 3AYRA 4NY2A 1PZ0A 1Z89A 4IIHA 4AY7A 6REQA 1EHAA 3M9YA 1CGWA 3LGEA 2A79A 4GNVA 1XHCA 2TSYA 3R0KA 5SWUA 4TVCA 5CPNA 4S2CA 4WKAA 1J01A 3AFBA 4KIEA 2ZZCA 5CGQA 1NDWA 2JKEA 2Q09A 4L6DA 2BNJA 1M01A 4MGGA 3SQMA 5KZEA 3IJDA 1JEHA 3VNDA 2HBXA 2V82A 1R2RA 2RJGA 4M29A 2WSKA 1NWTA 3NM1A 5KTLA 3SN1A 1CIUA 4AEEA 1TPB1 1Z3NA 2O9OA 3TTYA 2VEMA 1JZ4A 2WK2A 4P8VA 3N3MA 1G94A 3M0LA 3IIXA 1GGOA 3W02A 2C0AA 1GKRA 3T7VA 1P0EA 2DZTA 4DYKA 5I3JA 3P74A 3UA3A 2PURA 3RITA 2WPCA 2ZRUA 4NKCA 3TMQA 3CL6A 4BQ5A 4WD0A 1DJZA 3E0VA 3MYPA 1QW8A 1OGBA 3ITCA 4RW3A 1Q6EA 1J0ZA 3HGSA 2Z7KA 2Z24A 4UTWA 1KFCA 3W1QA 4Y2WA 1UOKA 2JEQA 5FJIA 2C13A 2VQUA 3P80A 3NQDA 2YXGA 3H12A 1W32A 2ZICA 2IXVA 4K2SA 3WK0A 3BQ5A 1VBUA 2G3FA 4FLRA 5EBKA 3HGOA 5KVIA 4K36A 1R3TA 3ZR5A 4H4RA 3TQ0A 3VVGA 4NRSA 3R89A 1YTDA 1UH2A 3R94A 4KH2A 3GBDA 2I17A 3ORWA 1GOOA 3PZGA 4K37A 1P6BA 3LADA 4C6BA 1XICA 2XM1A 3IIOA 3VDBA 1KCZA 4C7DA 4S3JA 4Y8EA 5FS7A 1X39A 4AYSA 3GVQA 4FPSA 4Z1DA 1R85A 1VPQA 1CLVA 1QAPA 3IS4A 4P5UA 5A8PA 4NAEB 2AAMA 1BGGA 5HQMA 1PV8A 5C2XA 3CBWA 3GK0A 2ZZ1A 3TW9A 2QDGA 5A94A 2TRSA 3V0TA 1JDFA 1WOBA 3CM4A 3EMCA 3PAJA 4G7EA 4LPCA 2HJPA 1I2RA 4L4PA 2QIWA 4M7SA 1MRAA 1PUDA 3UD6A 1M7JA 1R8LA 1TG7A 4LCSA 3TIMA 2G4JA 3F5JA 2DJLA 2D0HA 2V69A 4C7GA 1XF0A 1Q2RA 3C0JA 3ANYA 2XPKA 4C5ZA 3N2XA 3WLJA 3C2YA 3A47A 4ZENA 2QUUA 4HIBA 3OZOA 3UPBA 4EOUA 1O5QA 4JIQA 3RJYA 3OHIA 1QT1A 4I8DA 4L9XA 1QNQA 1QI2A 2ZTKA 1ISXA 2GGEA 1DVJA 1LM1A 4HPNA 3TLQA 1G4EA 3CPGA 3PULA 1TTIA 1L2UA 1R9XA 3EAOA 1T5AA 1KBBA 3PPGA 1BSIA 2PUZA 4PR4A 3DIPA 3HO8A 3KLLA 4MFDA 4D6CA 1PPIA 3UR7A 5BRPA 3M1ZA 2VGFA 4ZFMA 1GNXA 1EBHA 1T41A 3E96A 5F2LA 2F6XA 3SECA 3DFNA 3UXAA 1ZMCA 2INFA 4QJ1A 1SYTA 2OMAA 2QQ6A 4ZA0A 4ZXOA 5BYWA 3P6LA 5B80A 4IT1A 1HL9A 2YLLA 1BWKA 1NOUA 4DO7A 1LQ2A 2DSWA 4J3VA 1SJAA 4LUTA 3SSJA 1FWJC 3IVUA 1EEXA 1B3OA 1V3MA 3PZTA 4UZSA 3SIMA 3CZEA 3STEA 1BWVA 3VFCA 4O1DA 1TX0A 4AD1A 4YL2A 5E1QA 4ZVJA 1FXQA 3AHTA 4R34A 3NO5A 4BF9A 3AMLA 1LBMA 3LMYA 4MJ2A 3WJSA 1LQ0A 1PL9A 3GS6A 3IANA 2HDJA 3K8MA 1YNYA 3KBWA 1GREA 2I14A 1BKHA 5FA5A 2W27A 2NVCA 1VZWA 3I7QA 5I3DA 1QHPA 1VFMA 4GA8A 4GKLA 3GH7A 2RDUA 2WNZA 3E02A 1ITQA 1S1PA 3KOXA 4FLOA 3II4A 2OLAA 4IUGA 6XIMA 3ABOA 1UJQA 1W3HA 4Z0JA 4ZTXA 5EPDA 3IJ8A 3N15A 2INZA 3N14A 3C52A 3KP1A 1YXCA 2WBGA 2CU0A 2WCSA 4GOAA 2XZ9A 1TMHA 3WLPA 3H4GA 2PC4A 2VGBA 3CHVA 3USBA 1V0KA 5ECVA 3LV5A 3AS0A 2Z1XA 2YIHA 4A4AA 4NILA 1TTQA 3TH6A 4O54A 1UUMA 4W85A 2O7QA 2JK6A 2PF0A 3WFZA 2EPLX 1Y5XA 5EB8A 1OIFA 2YKKA 3QBUA 2OWWA 2YDQA 1QTWA 7TIMA 8CGTA 4A8LA 4XAPA 4KPRA 3S4TA 4C1NA 4YTSA 4R7JA 4PODA 4RDYA 2X09A 1VDVA 1IXPA 4EVZA 5I23A 1TQJA 3BMXA 2R9RA 4FHAA 3WD1A 4UMBA 2EHHA 3W76A 4GH1A 1FKWA 1KW1A 7ODCA 1V8EA 3SO7A 3A13A 2RAGA 2VGGA 3NVDA 1YTKA 4UTUA 5JH2A 3U3HA 3MCOA 1UG6A 3NQ2A 4IIDA 3VNMA 5A8QA 3ZLHA 2O4MA 5KITA 2E1DA 4D6EA 4BR1A 1T8QA 2VX6A 2QJMA 1QOXA 2VD8A 3S1GA 3SFKA 2OU4A 4S3KA 4H6EA 3H2CA 3EWYA 3WK3A 3S83A 1GOMA 5J04A 3O0FA 1WZAA 3MMWA 2JF7A 2OEJA 5U7SA 4DQWA 3ARQA 2AMGA 3S47A 1UJPA 4DWSB 4GVIA 4QCFA 4UXDA 3Q6JA 2VXNA 3DERA 1OY0A 3M43A 5KSWA 3SCVA 3UW6A 2QAFA 4G1NA 3NQ6A 5GVJA 1JUEA 1Z32X 5CXPA 1TFVA 2D2JA 1RQEA 4QXIA 6XIAA 3G1YA 2F7FA 2B31A 3M07A 2IPGA 5C55A 4UNIA 1TJPA 2G37A 1U1UA 3IIVA 3KOZA 3GNXA 2H9AA 3T9PA 4C60A 5GNZA 3QPZA 4XAZA 4JYEA 5H8UA 3R6IA 4L1XA 1KWKA 2E3TA 3CL7A 2J7FA 3FOKA 3ES7A 4YWIA 3ZFHA 3R0DA 4MZ1A 5EKYA 3EEZA 4GG9A 3FYPA 4KWWA 4BKNA 2X7WA 2XSXA 3TW7A 3C86A 5DT5A 3CWOX 4B91A 3PZQA 1XGEA 2KX9A 3I7RA 3CZ8A 1PIIA 3PPFA 4GZIA 2VR4A 1VFUA 1XJBA 2Z1BA 4HD5A 1A5UA 1YRRA 5HQLA 2BY0A 1QW9A 2NUXA 4AZIA 3ZT6A 1X2HA 3DJJA 4P8UA 4CN4A 1B54A 4FX8A 2DH3A 1KN0A 1Q6GA 3SQSA 4MADA 2VC6A 2QCEA 3BV7A 3TE9A 4X22A 3WUGA 3GXDA 3T0AA 1GVFA 4M52A 3GDRA 4H50A 2DGAA 5AVHA 3H4XA 1HKJA 1FEBA 4IMAA 2E8YA 3S9YA 1ZUAX 2O9RA 3KRUA 2J9ZA 1XCWA 1H2IA 4Y9AA 1OADA 3IIZA 1KBIA 3MUZ1 2FZNA 2P8BA 1MOKA 1V97A 3IAPA 3SRFA 1MUCA 3PNZA 5CC6A 1L8PA 3QOKA 1N55A 1NP0A 4DI8A 3IV3A 1RY8A 4UOZA 2ZBTA 3GYCA 2DORA 4HYWA 3TZFA 1EBGA 3AIUA 3GHUA 3QTPA 1PCWA 3K4WA 1G4PA 1FCVA 4TXEA 4IHCA 1YMYA 3LPFA 1EJXC 1Z6KA 3BC9A 1QDSA 2A3LA 5ABEA 4FA3A 1NF7A 2OCZA 5G5IA 3VKKA 3ABQA 4DO6A 5DELA 5CKSA 2WMIA 2W79A 1P7TB 4IMEA 3DFHA 4JCMA 1R0MA 4Q7BA 1FCUA 4Z2KA 2W6RA 1F8IA 4JTCA 2I57A 1R3SA 3TSBA 3GVWA 3HQPA 3DH9A 1J5SA 2YSWA 5FACA 4P7LA 4NI3A 4AZCB 4BV6A 1GQLA 1BGAA 1KR0A 3EBVA 4JXCA 4M19A 3VFLA 4J57A 2MANA 3BOLA 1AW1A 4KFNA 3WL1A 3P84A 1OZMA 2J88A 3E2SA 1Q6CA 1S5VA 3HU7A 1HKIA 1SJDA 2IKIA 1XH1A 2EPKX 1EWEA 3L9CA 1HN1A 1N2VA 4AHQA 3GHTA 5I78A 2HPIA 2FDSA 1J6OA 5E0KA 1FWHC 4JKKA 1SR0A 2Y7GA 4NG3A 3GFYA 1IZJA 2Y88A 2PZ0A 4JKMA 2GQ8A 2WVUA 2DVUA 1Z8AA 4CKQA 1NEYA 3BPWA 5A8OA 3LXCA 3CUJA 2RH9A 3TR2A 3OODA 4QG9A 3W1RA 3N25A 1TJ2A 4H83A 3TK7A 1EHNA 1JCLA 2W54A 1JGMA 2DZBA 4OIFA 4LSBA 3DI1A 4PUNA 1F74A 1UMYA 3EDJA 5FF4A 3NVYB 3O8AA 4EPKA 4YTUA 4NXKA 2ISVA 1P5BA 3GFXA 3EB4A 3OTRA 1TYTA 3RFAA 2X8CA 4DXXA 2X1IA 3JZEA 2NLIA 7PTDA 4OBSA 5U25A 7A3HA 1K1DA 1F3PA 1EB3A 5LYRA 5D2YA 1TCDA 5FAJA 1SU5A 4QAWA 3KDOA 7REQB 4B16A 5HUPA 1U22A 4Q8WA 4FALA 1UH4A 1XGZA 1OT1A 3PVFA 3URNA 3RO6A 5BWFA 2ZVIA 2O92A 1KM6A 5K3VA 3R12A 4XX6A 1A3XA 2J7DA 3OIXA 2QUVA 4Z08A 3CZKA 1QI5A 1C8VA 1DWFM 2GGHA 1RV8A 1KBJA 4IPPA 1CZ1A 1R3RA 4PTDA 5E0FA 1UKQA 1JULA 5BXRA 5FOOA 3LM7A 2FKPA 3NM3A 1WUEA 5A6JA 3VD3A 2BOGX 3IV8A 4XBSA 3UG5A 2A7PA 2DQWA 2R1PA 5CCZA 4HHHA 3UZJA 4NASA 1XSJA 3IUHA 2R24A 4LF2A 2R1NA 5JRBA 1BXCA 1RD6A 2PF8A 4GD0A 3NCOA 3W1LA 1DIEA 3HGJA 1N63C 1SUXA 1JUKA 4MFEA 4MB1A 1Y65A 2D1ZA 4QSFA 3LI1A 3UESA 2QEZA 3W7IA 4H3DA 4Q6XA 1TQXA 4H6RA 1C3FA 3BWWA 1LT8A 4GZ7A 3U2ZA 1ZGDA 2EQ7A 4YVVA 6TIMA 2GVJA 3Q58A 4HA1A 4ZZ9A 3QY7A 2FVLA 1VD6A 3GIPA 3GDBA 1OSEA 2C19A 1PVNA 1GVYA 4LC8A 4JICA 4LAOA 1EPXA 4IP4A 2Y7EA 5JCIA 1JVNA 1K9EA 4XUGA 4B3KA 2IPWA 4C6EA 2E67A 2Q6ZA 1XBYA 1FTXA 1BVZA 3W1MA 5JXQA 4RNJA 2DZXA 1A5OC 2BVDA 3UETA 3OLEA 3EOSA 1QPNA 4Y8FA 1H1YA 5LIUX 1CGUA 1EIXA 3CTTA 1IEIA 1HO1A 1D7YA 3O6YX 2YJQA 3VC6A 2P3ZA 3LSCA 4AD2A 3AHYA 3TXZA 5CAHA 3CJPA 1OGGA 3ITXA 4QITA 1KBKA 1XP3A 1A5CA 4ZO7A 1YXDA 2QIIA 4GK8A 1HP4A 2BXVA 1H1ZA 3EKZA 1AJ2A 4JEQA 2YOCA 4GINA 4IIGA 3TYDA 4ICNA 2YL6A 3WH8A 1EPVA 3G18A 4GIEA 1K6AA 1F4HA 4LU0A 5I07A 2CKRA 2JGYA 5DLCA 1OWQA 2GWGA 3WLIA 3EOLA 3GAKA 5CJNA 1R9ZA 1B1YA 4XVDA 1JCNA 3V3WA 3HPXA 4A22A 1UZ1A 1FFVC 3H55A 4JEJA 3LRKA 3NZPA 3ZVIA 2A6NA 2WNNA 1K70A 5DFAA 3ARUA 3MKCA 1DOSA 4NAEA 3TU9A 2Y4SA 4M6PA 1TV5A 2ZQ0A 4L9YA 1VKFA 3DGZA 4FOUA 4JD4A 4DYJA 1YE6A 5K4ZA 3L23A 1DL3A 4XAFA 1XSIA 3SIZA 3VNJA 3PP7A 1Q7ZA 1HO4A 4QDMA 5IDZA 4WSJA 3TFXA 2RJHA 1AL8A 2A3EA 4LAUA 2CLIA 2QNEA 4F40A 2QDDA 4LNYA 3H2EA 2FHCA 3V5OA 3RK8A 3WLMA 2CLKA 5H8MA 3O07A 1WAWA 3ARYA 3OVQA 4GE8A 3K13A 2QCDB 3N6HA 1DIDA 3LCLA 3U2CA 3S6DA 3IGUA 3H21A 3VZZA 3VGHA 1C7TA 1P6WA 3T0TA 2QDEA 3DHPA 3HB9A 4IPLA 1Q3NA 5EU9A 2P76A 2CC0A 3ZR4A 1PXGA 3GXNA 1GESA 3NQAA 3CUGA 1WYGA 4PTMA 1OBAA 4MF4A 1R47A 4HMCA 1V3HA 3H7RA 4JFTA 3LA4A 4MJ4A 4XZ9A 2X8HA 1CDGA 3CT7A 5DCBA 3R8RA 3UU0A 2VL4A 2J7CA 3ID7A 3YPIA 5I06A 1UYQA 1FWSA 1UR1A 3P0WA 5AHNA 3O9NA 3NG3A 5DBUA 3N3TA 3RCMA 3MKKA 4GX8A 3KCLA 4FP1A 1AH3A 2NV1A 5AYXA 3WQDA 2OSXA 4J7RA 1SZRA 4DIAA 1UR8A 3B9JB 1G4SA 4MPKA 1OJXA 1V3KA 2ZX8A 1Y0EA 1EP1A 3TYBA 3ATZA 4OV4A 4B2DA 4HPHA 3WIJA 3SGGA 4ENLA 1YHTA 5CPTA 4X0NA 2FPYA 1TB3A 3I10A 2EJ1A 2YZRA 2V3FA 3HTWA 1VEMA 3UWYA 4WKFA 3SAZA 3SCQA 3TJLA 1JL8A 1S2CA 2HRWA 5CZJA 3QV7A 1VJIA 1CXLA 3W7LA 4L80A 1TWIA 2OLHA 1GOXA 4GXWA 3PANA 2BHUA 3TC6A 5I79A 1QPQA 5T9CE 3SB0A 4YYCA 1GV4A 3PZOA 3N12A 3WF0A 2EF9A 4ECLA 3QV8A 2FGBA 2H3DA 4I9AA 2Q8ZA 1D8CA 1JD7A 1TR9A 2AAAA 4CN6A 1FWNA 1TPWA 4LXFA 4U5IA 2GYIA 2C7FA 3S2LA 3DFQA 1US0A 4H4PA 4FDCB 2I9UA 2QT3A 4H6KA 3UVAA 1VC4A 4C6FA 4H9YA 1Q7MA 3AUJA 2QCCA 4RX0A 1CBGA 1GUVA 1PYMA 3VOHA 4LBSA 2UY2A 2X05A 4YCOA 2W92A 4BHYA 1GTHA 2VQTA 1KM3A 3ZJ6A 5K7JA 5BU9A 1WE5A 2FPTA 3LV6A 4PTXA 2FTPA 4MYXA 1AW2A 4KW2A 1PZ3A 3W38A 3MMTA 3EDFA 2OSWA 3DHFA 4DBUA 3LENA 3AO0A 3M7WA 1HL2A 3EDKA 3PC0A 3OPSA 4LRTA 1OABA 1J6PA 3WUBA 2G97A 1FEAA 1GPFA 2WC3A 4FLSA 3NGJA 3F03K 3HG4A 4JNMA 3S0CA 4Z1BA 3ZS4A 3O06A 4Q6JA 3RLHA 2HS6A 4B92A 3NQBA 1JNEA 3GXPA 4MPQA 1XBZA 3BZGA 4Z1CA 3WLTA 4J2PA 1H7PA 4C7FA 1WZKA 2YL8A 1QATA 4S38A 1EP2A 3C0SA 3EWBX 1H7RA 2EO7A 1ZP3A 4KFOA 3KAOA 3O6AA 4YIWA 2EKGA 4O53A 3C56A 1ZX9A 3GO2A 3VKDA 4CNOA 3QXBA 2ZXAA 3KWSA 3O7UA 4H00A 4CCEA 2E68A 4WK9A 1UASA 1AJZA 1XIMA 1EC7A 1JXKA 1BZLA 2FH6A 3FLUA 1UBPC 2YCLB 1TWSA 2VFHA 5TQLA 4TVDA 1QHOA 4N6FA 3I68A 1KKOA 5CJ5A 1NHSA 2VZTA 3P7YA 3ERPA 5KZ6A 1E0UA 5LHFA 4DWSA 4JZ5A 1SO4A 3RJXA 5JIPA 2RGMA 3M16A 2OODA 4ATWA 2AKZA 3AS1A 4O12A 3VGDA 3DHUA 5DEZA 3BOFA 3LI0A 4N9DA 4IQJA 1SFJA 1XDMA 2E6DA 3HV8A 4IM4A 3B3DA 1X97A 2GVGA 3W7OA 1H7XA 3D0CA 3ANUA 1MVYA 3M44A 4ALDA 1HKKA 4GABA 1OQFA 5EY5A 3U0HA 2ACUA 4K1GA 3PZVA 5F1VA 3EKGA 4LIIA 1JZ5A 1HVQA 2NXHA 2I16A 3WNMA 4LX4A 1PKYA 1B5TA 2CITA 4DPQA 1IF2A 3PSWA 5AN7A 3R07C 4WR3A 4LUYA 4Z1YA 1XRFA 1FWTA 1VBGA 3ARVA 2HV5A 5HQEA 3HBLA 1Q1RA 3TC7A 3F4NA 2Z28A 3HW2A 5BW6A 5FSDC 3B0PA 3A4JA 1U5JA 2G96A 4CNSA 2BB0A 3GX9A 1EJSC 3ZWTA 4U4MA 1Q8AA 5FI8A 3CLMA 1Q4NX 4PSPA 1GVQA 4JN7A 1ZDLA 1MYRA 3WLOA 3GNPA 3W88A 1S3TC 4AIOA 1W9PA 1AZ1A 4K7VA 2WMHA 5FSEC 3MDWA 3MZ2A 2QKFA 3OGRA 3W6MA 1RPXA 5ENLA 1J2BA 1XIHA 1DYSA 2CLPA 3LPOA 1XLMA 2QGYA 1O1HA 3WBAA 2BY3A 3STCA 3TWAA 4FNUA 4F2BA 1GHRA 1A5SA 3URHA 4KFPA 3E5BA 1VHNA 2HNEA 3U48A 4QLJA 2E5BA 5ABFB 4JL2A 4C6OA 1OK4A 3CAQA 4RW5A 1AD4A 2VRJA 5CJMA 2WZHA 3HPFA 1QUMA 3WMLA 3T81A 4XO7A 2DW6A 1XC6A 1KRAC 3LHWA 1VIZA 1PIGA 1ZLPA 3S5ZA 1UIOA 4DB7A 1JR1A 4HN4A 4AW7A 1DEDA 2IKHA 3BURA 3GDMA 1US2A 3W6YA 1V0MA 5GJMA 3IC9A 1K6WA 5EBUA 5U1OA 2Y7FA 3W1AA 2HQMA 3VIHA 3NDZA 5AYIA 4KRUA 5FCZA 1ONFA 5K2ZA 3M46A 3W7MA 4UR7A 1OD0A 1P7TA 2NV9A 4E0CA 3VGGA 4R85A 2DSKA 3CEUA 1MZRA 4HHLA 4JFVA 4IIBA 2V81A 4GACA 5BROA 4M3PA 1TPFA 5DN1A 3PJWA 3A5VA 1KFEA 4DJDC 2JIEA 1R30A 4NZJA 4QQUA 1EQPA 1PEZA 1EF2A 4AZCA 1S2WA 4DUWA 3S6OA 1J79A 3WMCA 3LXDA 1W9DM 4GY7A 4QROA 3F4VA 4KRTA 4JHOA 4ZMGA 3T6CA 3QOMA 3RPMA 3GC2A 3UG3A 2JK2A 5ER0A 5D9OA 3UJFA 2B81A 3PUOA 5G1YA 3IGHX 4CCDA 4A3QA 3DOPA 3H22A 2XGIA 3W23A 2EQ6A 4FO4A 2VNCA 1H49A 3NPUA 4R7WA 1ZXIC 1R7OA 4ZSUA 1AQFA 3EPNA 3CMFA 3TCSA 1TZZA 5DY2A 4QGCA 2O4QA 3DECA 3VCRA 3H7VA 4IISA 3NOYA 1TJRA 2H90A 2AMXA 4JFUA 1J0HA 4D8ZA 2Q3OA 2W3ZA 1LZOA 4PC8A 1S5TA 4WY0B 3W1PA 3CIVA 3BAWA 3LBMA 1U83A 3CUIA 2V38A 3OZPA 4PRWA 2VOTA 1TPC1 3F5LA 4NX5A 3NWRA 1DQWA 2GR1A 2C14A 4YVXA 1V6TA 4N4PA 5CBBA 4AZ6A 4BCEA 1DXIA 4MB5A 4OVXA 1KQYA 4XWUA 3DGHA 2B7PA 2Z6IA 3N1AA 3QFEA 2FLIA 1XUZA 2YVFA 3FAWA 3UQNA 3FHAA 1WKEA 3DU0A 3T08A 3BMWA 3HQOA 3GH5A 5FAGA 4W4QA 2FFIA 2J9YA 3T8QA 1A49A 2VEIA 3WJXA 1JG9A 1BXNA 3PBUA 1F6YA 3QV9A 3HZ3A 2DT0A 4GUGA 2ANUA 2QAPA 5CQ1A 1U5VA 4HMDA 1GVRA 4XZBA 3GB6A 2OT1A 3RDKA 1EKOA 1MNZA 3GRTA 1ME8A 2GVEA 2FJUB 3G22A 2DT2A 3NO1A 6CGTA 3CL8A 2V5CA 4NEWA 3IARA 2ZYFA 1GYNA 1DTNA 1EJVC 2NQLA 5TNVA 3IJQA 5AFDA 2ZUSA 5I02A 1P1MA 1HT6A 3CIWA 3CPRA 2VOMA 4JIRA 4UNLA 5GQBA 4RE0A 4F79A 3VKAA 3FYYA 2H3BA 4DM1A 5KZDA 3ABZA 1TE1A 2ABBA 1QR7A 1SZNA 4ACZB 5A1AA 1OZQA 5C7VA 3WH7A 2ZXQA 1BF6A 3MJMA 1ITCA 3II1A 4GYKA 2ZZBA 2Z25A 4H04A 3TTEA 2FTWA 2KAUC 2PP3A 3BQ6A 3IPWA 3E2VA 3LLDA 2YCIX 1R3YA 3RPDA 3VGFA 2XVLA 5FIPA 4A2SA 3VOGA 2E9BA 1C9DA 1QWKA 3MI2A 4JTRA 5FS6A 4GFSA 2AAQA 1TV7A 3KS5A 4PUUA 3RM9A 2C8NA 2HISA 3DH7A 2J79A 3GU2A 4HOWA 5CLWA 1M6IA 3OBAA 2E5CA 4FLQA 2YB4A 4EWJA 2CNCA 3NQGA 2WKLA 4XAYA 1Q6LA 3IVSA 3OIHA 1LQAA 4PRTA 4F0SA 3GIQA 4AZHA 1N60C 4LUS