1BQGA

The structure of the d-glucarate dehydratase protein from pseudomonas putida
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
411
structure length
399
Chain Sequence
b'GAPVITDLKVVPVAGHDSMLLNLSGAHGPLFTRNILILTDSSGHVGVGEVPGGEGIRKTLEDARHLLINQSIGNYQSLLNKVRNAFADLRIAVHAVTAVESALLDLLGQHLQVPVAALLGEGQQRDAVEMLGYLFYVGDRNKTDLGYRSEHEADNEWFRLRNKEALTPESVVALAEAAYDRYGFKDFKLKGGVLRGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTKEPLQIKGGLVEVPKKPGLGVELDWDALMKAHEVYKSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-GLUCARATE DEHYDRATASE
publication title Evolution of enzymatic activities in the enolase superfamily: crystal structure of (D)-glucarate dehydratase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Glucarate
total genus 129
structure length 399
sequence length 411
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 1998-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bqgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bqgA01
1EBHA 3VC5A 2ZADA 3R11A 5FJUA 4G7FA 2P0IA 3TCSA 4IL2A 3TTEA 3SSZA 3TWBA 3SJNA 3JVAA 1F9CA 3QTPA 3QPEA 5IDZA 3GO2A 3MSYA 2FKPA 1WUFA 2XH2A 2AL2A 4A35A 4GIRA 1JDFA 7ENLA 1WUEA 3Q4DA 2OX4A 3ZVIA 4DX3A 3MZNA 3ENLA 2PODA 1ONEA 4GGBA 4HN8A 3RRAA 2GGJA 3N6HA 3UCDA 3OP2A 3UJSA 2AKZA 4JN8A 2XSXA 2OLAA 4F4RA 3GC2A 4JHMA 3T8QA 2PU1A 3H12A 2GGIA 1E9IA 1NELA 2PA6A 2P8BA 4IP4A 2MUCA 4FI4A 2XH0A 1MDLA 3R0KA 2PP0A 3U4FA 4GFIA 1P48A 4M6UA 2HXUA 3TW9A 2NQLA 3IJIA 4M0XA 4H1ZA 4HYRA 1MUCA 3TQPA 4K8GA 2MNRA 4YWSA 4HPNA 3DGBA 3BSMA 3P3BA 2PGWA 2POZA 3MY9A 2OKTA 3KUMA 1SJDA 4KPLA 3RITA 4KT2A 1TE6A 4HCHA 1JCTA 4E8GA 2OQYA 3V3WA 3OTRA 3JZUA 2OQHA 3RO6A 2PTXA 4EWJA 2HXTA 1DTNA 2GDQA 2XH7A 1IYXA 1ELSA 3NZGA 4GISA 4GMEA 3IJQA 3UCCA 2PS2A 4JN7A 4ZCWA 4DHGA 1P43A 3ZLHA 3EKGA 3STPA 3TOYA 3THUA 3IK4A 4J1OA 3ZVHB 3VFCA 3R1ZA 4HNLA 2PGEA 3FCPA 3K1GA 1XPYA 2QJNA 3DFYA 1NU5A 3OW1A 1EC8A 2PCEA 3CB3A 3R10A 4J3ZA 2GGEA 3OZYA 1JPDX 3CYJA 4GYPA 2OZ8A 1SJCA 4GGHA 2XH4A 1FHVA 1SJAA 4E4FA 3P0WA 3P93A 1KKOA 3FJ4A 4E5TA 3V4BA 3D46A 4H2HA 3VCCA 3BJSA 1KKRA 3VCNA 4FP1A 2GL5A 4KEMA 2PP3A 3FYYA 4H83A 1OEPA 3I4KA 3IJLA 1PDZA 2PSNA 3GY1A 3DIPA 3DG7A 3FV9A 2GGHA 2CHRA 4Z17A 3I6TA 3R25A 4HCDA 3TJ4A 5FJPA 3PFRA 2OFJA 4IHCA 1MRAA 2PU0A 2PTZA 3RGTA 2QDEA 2GSHA 2GGGA 2P8CA 2QQ6A 3N4FA 1EC7A 3MWCA 1MNSA 3CAWA 4IZGA 2QVHA 1MDRA 1L8PA 3PK7A 2AKMA 3NFUA 4MMWA 5EU9A 3SN1A 4GYPC 2OPJA 3H7VA 3N4EA 5BOFA 3OZMA 2PP1A 4ZA0A 3UJRA 1R6WA 2OVLA 3PWGA 1EBGA 4H19A 3MQTA 1JPMA 1KD0A 3NXLA 3DERA 4K2SA 3TWAA 3U9IA 3V5CA 2QDDA 4DXKA 3N6JA 1R0MA 3SBFA 3CXOA 3CT2A 5ENLA 3DDMA 4MGGA 4HNCA 3DEQA 5FJOA 3DESA 3QLDA 3OPSA 2P88A 3ZLFA 3SQSA 3ES7A 3DFHA 3ZLGA 4DN1A 3UXLA 2RDXA 1ECQA 3VC6A 2OG9A 2OZ3A 5BOEA 3PWIA 5FJRA 4ROPA 3UJ2A 2PPGA 3RR1A 3UGVA 2PMQA 1PDYA 3H8AA 3JW7A 1XS2A 2QJJA 4IP5A 2FYMA 2OO6A 3VA8A 3UJFA 3DG3A 2DW6A 4X2PA 3RCYA 4K1WA 3FVDA 3VDGA 4ENLA 3UXKA 3BOXA 4IL0A 4E4UA 4A3RA 2ZC8A 2I5QA 1RVKA 2OZTA 3T6CA 4A6GA 4E6MA 3R0UA 3D47A 3I6EA 4HCLA 1BQGA 3GD6A 3MUCA 2P3ZA 1TZZA 3B97A 2HZGA 6ENLA 3ZVHA 3HPFA 2PTYA 3QKEA 2AL2B 2HNEA 5FJTA 1BKHA 3EEZA 1SJBA 3T9PA 1EC9A 4Z1YA 3SN4A 2QJMA 2QGYA 1KCZA 2XGZA 3QN3A 2O56A 3S5SA 4DYEA 1TKKA 1W6TA 4KWSA 3Q45A 4G8TA 3CK5A 4IT1A 3V5FA 3TJIA 4MKSA 3MKCA 1YEYA 2ONEA 3DG6A 3SN0A 5J04A 3S47A 2PTWA 3UJEA 3ES8A 3FXGA 3T4WA 2AL1A 1FHUA 4DWDA 2DW7A 3H70A 3NO1A
chains in the Genus database with same CATH superfamily
1MEWA 4Y7EA 4OIFA 4H4TA 1Q2SA 2WSYA 5BXRA 1UD3A 2CZFA 2VC7A 4UQDA 2XSBA 4R7WA 2GVJA 2DJXA 5IHSA 3LEPA 5LXEA 2AAQA 3O6CA 3URNA 4XZ9A 3WLMA 4QM1A 3KCOA 1FCUA 2X0YA 1H0IA 1JZ3A 3CEPA 1JOAA 2W63A 1TA3A 2FQIA 3OHIA 3ZVIA 1XC4A 3KTCA 1R3WA 3OIHA 1ZPTA 3MZNA 3GBEA 3U7VA 1AUSL 1NQ6A 1SFLA 5I3GA 1ONEA 2PWGA 1YNPA 2PDJA 3RRAA 4L1XA 1UASA 1MW0A 3BO9A 4QXIA 2OTDA 3OP2A 3KP0A 1MW2A 3T8QA 1UD4A 1VEPA 3IIOA 3CB8A 1B54A 2J79A 1Z89A 1ML1A 4C6BA 1NWSA 4L64A 3ELFA 4Q32A 1XIGA 2Y61A 4F48A 5A69A 4FX8A 4QEEA 2CDUA 1H61A 1EJUC 2P76A 5ABGA 3ARSA 3V18A 4J56A 1YBQA 3VOIA 2JF6A 3RITA 3Q65A 3NSMA 1OX4B 1HKVA 1ISWA 1GWJA 2D1ZA 2VC5A 2WHLA 1H5YA 4Y9AA 1CZ1A 4JOMA 2F6UA 1VFOA 5CG7A 1GONA 5E0CA 4RXFA 1X1NA 2XH7A 3IIVA 4D6HA 2EO7A 4I8YA 3QQWA 5MHBA 3G8RA 2VXNA 4V1XA 1GEUA 4DHGA 4Q4OA 4REQA 3WH8A 1CXLA 4B4HA 3LZ5A 3IK4A 3CUZA 4TMCA 4D72A 1HNYA 1GQLA 3VYLA 5DLCA 4GIAA 3W38A 3L2MA 2J74A 4EMJA 4UTHA 2GWNA 3W7HA 3DFYA 3AXHA 1RY8A 3OW1A 4ZSTA 1G7UA 1Q6EA 4ZSUA 3BAWA 5TF0A 3WLKX 4CQDA 1E4NA 4QIUA 4NEVA 3T0CA 5A8NA 3NGFA 3CHCA 1TVNA 4O8RA 3P0WA 5CAHA 5C9WA 2QYGA 3ZT6A 1KXTA 2FPTA 4FOUA 2Q8LA 2X42A 1M6JA 1DWGM 1RJQA 4XKMA 1C92A 3CUHA 4JYEA 2I16A 1UOKA 5IBXA 1GQKA 4QG9A 4EK7A 3GG7A 4RCXA 4XX6A 1E55A 3O07A 4BZYA 3PS7A 3TOPA 2GRTA 2VR4A 3QGAC 3FV9A 4FNUA 3BJFA 2VGBA 2GUUA 4KCVA 4PMXA 4P5UA 1QI0A 3HTWA 3CZKA 4W8AA 3A21A 2F6XA 3L4XA 3PFRA 3ECQA 4DEFA 4M6PA 2DV0A 4QSHA 2BVYA 1V51A 1R3VA 1EJTC 1JROA 2QDEA 1DXEA 5JRBA 3GNNA 1Q1RA 1TV4A 3MO4A 2YYTA 2EJ1A 3G2GA 3WLJA 3W1QA 1NFPA 3CTLA 3ABQA 4IZGA 4V1YA 4DJFA 1H11A 2BY0A 2O0TA 1JI2A 3GHRA 2FTYA 2Y2WA 3LD5A 4DVOA 5DBTA 4JL2A 4UC5A 4JBRA 1YIXA 2VUYA 3NQEA 2B31A 5KZ6A 1FWRA 1GRGA 2ZX6A 3P62A 3BSHA 4PMQA 2VOTA 5HDRA 3NQBA 4MUPA 3STCA 1FWHC 1GYNA 1U30A 1BVZA 1EPXA 1BWKA 4DXKA 3POHA 3KLLA 3DDMA 1FBAA 4ZENA 3TXVA 2EF9A 4AEOA 2HNHA 5CBJA 4WR3A 2Y89A 3PZOA 1EO5A 1OM0A 3BH4A 2UWFA 3NO5A 3RRXA 3QY8A 2XVKA 3AICA 3UXLA 2P1FA 2VQUA 1XQLA 3LNPA 3C61A 4K3ZA 4NJGA 3H8AA 3BANA 1PCWA 3GU1A 7TIMA 4HPXA 2WVTA 1W37A 3RM8A 4NZ1A 1H7OA 4CEXC 1TYTA 1VENA 2OO6A 1E9LA 1CPUA 4IOTA 4WOQA 1QDSA 4Q7BA 4Q4RA 1NY1A 3N25A 5XINA 3AZRA 4GJJA 2XUCA 3UXKA 2EPOA 1NIUA 2A2IA 4E4UA 1XLHA 2YXXA 2YIHA 2E6DA 2WWDA 2O4MA 1IEXA 1EOKA 2O92A 4PUWA 4BQ4A 3V0TA 3NVWB 1FWWA 3S9YA 3LCIA 1RVKA 4IX2A 3LM3A 5U1OA 2YVGA 2ZZ1A 4LU0A 1RP8A 4RR4A 3MP4A 1FKXA 3TYBA 2H9AA 1ECEA 4HMCA 4ZGYA 2AMGA 2OXNA 5FOOA 4S38A 3UBPC 3QMTA 1AZ1A 1B3XA 4HK7A 1SO5A 3LTSA 1ONWA 4JHZA 4RNIA 4JTFA 2OSWA 2B0MA 3NIYA 3T9PA 1US0A 1KBJA 3GYEA 3TQKA 1O60A 1VPXA 2VZOA 3FHQA 1LL7A 2OLHA 3GVWA 4NSBA 3LHYA 7REQB 2BNJA 4H4SA 5HUPA 3DK4A 1EWEA 4V28A 1KXVA 1XLCA 4U3AA 3WUBA 1LOLA 2XIOA 1KXHA 3V5FA 4LEQA 3TJIA 4AY8A 2QW5A 4PB5A 3H4WA 3W7PA 4QLLA 5DXXA 3PTKA 4RE2A 2WM1A 1ITCA 4U5IA 3UR7A 1KM6A 1FECA 3VNZA 5D9PA 4K7YA 4NL1A 2HCVA 3P0XA 3FJNA 1M04A 1R2RA 5A2BA 4JX6A 1K8ZA 3L4YA 4XZNX 1TPB1 4HHMA 3GXFA 3DK9A 1I75A 5HK4A 1Y65A 3LK6A 1CGVA 1UP3A 1XYLA 1J5TA 3WEZA 3WBXA 1MMFA 4B3LA 3QR1A 4JIIX 1KFJA 1HO4A 3LLFA 4J40A 1ZFJA 3NVDA 1E1CA 3SSJA 3M0YA 1DJHA 1IEIA 4HZMA 3VDAA 1JPKA 1B4KA 4KPRA 4H6KA 2VRQA 1LORA 5BROA 3ZIZA 5AYIA 4TX6A 1XP3A 3TE9A 4IH3A 2HK0A 3E2VA 4JN8A 4PTWA 3G77A 3TAOA 3LENA 4HD5A 4O8AA 3TP4A 2OGJA 2FLIA 3F5LA 5AKQA 3ZR4A 2J62A 5FACA 1EB3A 3KTSA 3QH2A 6ALDA 2Y63A 3V35A 2YGYA 5EPDA 1BKSA 3ZJ6A 1AJ0A 4HTBA 2PWDA 3LN3A 4OE7A 5E09A 2HPMA 1E4IA 3T40A 2QV4A 5EBAA 1TRDA 3F1QA 4GFSA 1EYWA 1J10A 5C9RA 2NV2A 2OR2A 2GJPA 4FDCB 4BEUA 4LVDA 4KPLA 5F4SA 3A7UA 1D9EA 2X8HA 3RYSA 3BWWA 4EQXA 4ZOAA 4LAKA 3SCRA 3SADA 2QF7A 4NT0A 2V69A 2J7DA 1AW5A 1JCLA 1F3PA 1TTIA 1PV8A 2I9EA 3W2KA 2VURA 3OGVA 4LAUA 3AMGA 3EWWA 1K4HA 1CGUA 1XLFA 1TWIA 1LT8A 2FB3A 1M6IA 3W2LA 4GY1A 1H7NA 1QK2A 3TOYA 2E8ZA 2CHNA 2XIJA 4BQ5A 3NDYA 3FEQA 3STGA 3W2NA 5D8WA 1XRFA 3B8IA 3VDHA 2PGEA 1C8QA 4HN4A 2E6AA 4I9AA 2PCEA 1P6WA 1G6CA 2KZHA 3CLWA 3A7RA 4JYDA 4HSHA 1IIGA 4UFHA 5E9XA 2WC3A 1OIFA 3M43A 2GR1A 2IQ0A 5LIWX 4BHYA 4S39A 2GOKA 4GXPA 2F6KA 1UZDA 3L0KA 4HHHA 4EXQA 1GVOA 3K4WA 3WBWA 5C70A 2GDVA 2BS9A 4O0KA 5D04C 5BRQA 3OBAA 1QO2A 3UZJA 4PSPA 1FX6A 2OKOA 4MWAC 1L6GA 1GUVA 4LQ1A 4AD2A 3DG7A 1XX1A 1KM1A 4E4PA 4IIHA 4ERAA 4L6OA 3EDFA 4PMVA 1IWPA 2GGHA 1U2YA 4HKPA 1LYXA 4D6FA 1GTHA 3TJ4A 4MVAA 3ERPA 2BTMA 2V81A 1SO3A 1GORA 2RGMA 3A6OA 3R79A 2ZZ5A 4CQCA 5F2IA 2VGGA 3HURA 3I3DA 5D2WA 1OABA 1Z8AA 4L56A 4FK9A 2UBPC 1V6TA 1OFOA 2OWCA 4GR1A 4INFA 4YVPA 2DU2A 1QW9A 1BF2A 1MDRA 1L8PA 2VJXA 2E6FA 2VDIA 4GYPC 4Y2WA 5BW6A 3M41A 5LGZA 1KGWA 3NNTA 5AHLA 3H55A 3FDGA 3W9ZA 3ANYA 3UERA 2V3FA 2VFIA 3WD1A 4JL1A 4PMRA 2OVLA 2UY3A 2FIQA 3M16A 1PSCA 4FSAA 1MYRA 3GW0A 4UOQA 4B91A 1VBHA 3L5OA 1OY0A 1L9WA 2YKKA 2DIJA 1R0MA 3DBNA 1E1FA 5FJOA 3LPOA 2OX1A 2NW0A 4DJED 2X50A 4B5SA 4BS0A 3ZLFA 5C9ZA 3BVJA 2WNWA 2DY3A 5FL0A 4EX4A 1DIOA 5HJYA 1E1EA 2WSKA 2Y88A 5H6HA 5HXMA 1VZWA 5CZJA 4E2OA 3GAYA 3MCMA 4LVGA 4K7VA 3EA3A 4AZBA 3HB9A 3IIXA 1XM3A 1NARA 1KCLA 4IP5A 5T8GA 1UZ1A 4WKFA 1BSLA 3WQCA 3LRKA 1JNDA 3RF9A 4QJ5B 3MP5A 3W88A 3S4TA 6PTDA 2FFIA 4UTFA 1BZLA 2YB4A 1XCXA 3FVDA 4HJFA 4PCTA 5G5IA 1SSDA 4LCQA 1XFBA 1LG1A 1LLWA 1OJTA 3DJJA 2IPJA 2A3AA 2I5QA 2OZTA 5FJIA 5DX7A 2VQTA 3HQNA 2BLEA 4UQCA 5BXSA 2WKLA 3NRZB 1WDDA 2POTA 3GB6A 5LYRA 1P5BA 4NX0A 3VGHA 2OJPA 3MUCA 4QJ3B 3CEUA 4E38A 3M0KA 1LLOA 1SPQA 2ZUSA 5K9DA 2BGSA 3W1UA 2Q09A 2PD5A 3NZ1A 4DYKA 4ZOEA 1XYCA 4LPCA 5JCMA 2CLPA 1QVBA 2YDQA 1UR3M 1KCZA 1AODA 3O6YX 4RZ5A 4TV5A 2YSWA 1SFSA 2O56A 5M1TA 2J9XA 3BCJA 4MZYA 3BLKA 2WANA 1W1A1 2GOUA 4G5DA 3L2IA 1JQXA 3S2CA 2ONEA 1KW1A 4Q8VA 1YDOA 3LMZA 4ZFCA 1E0TA 5EMKA 1R9ZA 2UY2A 3E0IA 1VFHA 1FHUA 2AAMA 4MNMA 9XIMA 3PPHA 1AK5A 3ZJKA 1QI4A 1V0KA 3Q6JA 3UPBA 3CXBA 2WP6A 2GQ3A 4N4QA 1I4NA 3W7NA 1QOPA 1ZS2A 2BY2A 1EJSC 1RXOB 3CS2A 1W8GA 3EOLA 5BRBA 4FNTA 3NQMA 3IJ6A 3GHSA 4EQSA 4NNAA 3ALGA 1WUFA 2FDSA 2FH6A 4BQ2A 1HX0A 3P5YA 3HRDC 2YBUA 5T91A 3LV5A 4IPNB 4KEVA 3UNTA 3GH4A 1HL2A 1ZNNA 3WNOA 1EJVC 3VE9A 3T2QA 4DPPA 2JKAA 4IMAA 4QROA 1TREA 1DHPA 4OT7A 2G50A 3N6HA 4UCFA 4XUGA 4AIOA 2YYUA 2NXHA 4ZOHB 1MRQA 2VL4A 2A3EA 3H2NA 4I9TA 4U3CA 1DVJA 3CWNA 3VMNA 5CZ0A 4CNUA 5A6BD 4G7EB 2G3NA 4G1KA 3QPYA 2PRLA 2PZ0A 3QQ1A 3FSTA 2WBGA 3IV3A 3T78A 3LCHA 1VHCA 4MLRA 1KBLA 5LIKX 1WX0A 2CCRA 1JZ2A 1KLYA 4PL1A 2W0HA 3IJDA 3UR8A 2R91A 5AC6A 4WQ6A 1ADDA 2E28A 3VNYA 1F2JA 4LOCA 3S1XA 1P1XA 3WY1A 3PPGA 3L4TA 5U7SA 2CBJA 2YVJA 3E0LA 3N73A 4MKNA 1UKTA 5EL1A 1G1YA 3P81A 4IIGA 3U57A 1RQHA 3F2DA 3S9IA 5CLWA 4XTIA 3LERA 3H2CA 4DB7A 4AUBA 4DJDA 1LQ0A 2BY3A 1R9YA 1YMYA 1D7KA 1KGXA 3EMQA 4F0SA 3FSUA 1AA1B 4PUKA 2VEPA 2GJRA 1S46A 3VFCA 4ZB2A 1FWFC 4HNLA 2ISDA 1C9DA 4U10A 2O9PA 1JPDX 1O12A 2V3BA 1QBAA 3G1AA 3S5ZA 3MPGA 5HAOA 3O1NA 1JCMP 4I90A 4A8NA 4JCMA 2CEQA 1XLGA 3FJ4A 3LHZA 1OFAA 1OK6A 2WMHA 2YCLA 1KFWA 4APNA 4KFOA 1OG0A 2CERA 3ICJA 4X3ZA 1ADSA 1OJXA 4AD3A 4AVNA 1QNRA 4Z2HA 1ZP4A 2B7NA 3LXBA 4RX0A 3E2QA 3KVMA 1NDAA 4YYCA 4N6EA 3EF6A 4ALDA 3NQ2A 1RR2A 5D02A 1GETA 1YDVA 4MIMA 4DWSC 1M3UA 3ATZA 1TCDA 2YFOA 4A3UA 5TBOA 1MVYA 3TSMA 1J0HA 4GO9A 1NH6A 4RZ4A 5JUVA 4HCDA 4EPEC 3WQDA 1OC6A 2CLLA 1JYNA 1XSIA 4JQ4A 1NHSA 3ITGA 3RCMA 3ALFA 3FOKA 1H3GA 4UTKA 1O7AA 4I7WA 1KRBC 5A6SA 1VBJA 1JCJA 2WHJA 5ABFB 3FDKA 5AZ1A 4GPNA 2ZE3A 2BWGA 3MHFA 4UFKA 4N7QA 1HGYA 3WLHA 5FS7A 4ADSA 3VINA 1EBGA 1LZOA 3GHTA 3AU2A 2HK1A 4IMEA 2E5DA 4R34A 3EXTA 3PJUA 3M0IA 3B8WA 3KLJA 2FZNA 2XFYA 2Z1XA 1EP3A 2GVEA 1F8WA 1A5OC 4B5WA 4XISA 1KFEA 3ATYA 3DESA 3OPSA 3GUGA 3M0VA 2WZEA 4ROQA 4CVUA 2Z2UA 3GX9A 5HMSA 1XIDA 3WDRA 2V9DA 5ECUA 1UR1A 1F76A 1JNEA 3R12A 4WKHA 4J2PA 1FQ0A 4PBGA 1C7SA 1QASA 4GA8A 3VI2A 2QJHA 3LCWA 3RR1A 2D2JA 1IT8A 2DQWA 3C0JA 3UGVA 3P84A 3PG8A 1W9XA 2QJJA 2ZZ0A 3TZNA 3WNKA 3L65A 3W29A 5CBBA 2DP3A 3VA8A 3DG3A 3VNLA 5F2GA 2PDMA 5AVNA 3SW6A 4LCRA 2YA2A 2HPIA 5I23A 3ARZA 4IL0A 2CLIA 3ITTA 2X16A 4UTJA 4MTVA 4EACA 5JCNA 1YHTA 5TR3A 3W7RA 4DUOA 3T42A 1A5BA 2CESA 1FCBA 1DXFA 3BQ5A 4YYFA 5H91A 1QNQA 4AHQA 3G1XA 2P3ZA 3NEHA 4N2YA 3OVRA 1FWCC 3M1ZA 1PAMA 2IKGA 3TROA 1BYAA 1JZ4A 3UPMA 5G2WA 2BX7A 4ZOBA 4Z1YA 2NXGA 3SECA 4F0MA 2IQTA 4C6PA 3RNMA 3S6DA 3OJGA 2WMJA 1MXGA 5AHFA 2FPVA 3EZ4A 3K30A 2TPRA 5KZMA 5M3WA 1Z6KA 1XIEA 3F03K 3UG5A 1R3TA 3A47A 2EG6A 3W86A 2JBMA 4WSKA 4EMIA 4K37A 3C86A 5J04A 3O0FA 4C60A 7CGTA 1S2WA 4JEQA 3WQ8A 3WQVA 3SIMA 3G1VA 1ZX9A 4V15A 2E9BA 3M5ZA 3GIPA 4ATDA 3MWAA 3AOFA 5IFPA 5D4YA 4NYUA 2GR0A 5DT7A 1J5SA 4TO8A 5M5DA 1DXIA 4H2CA 5JCIA 1PYFA 2CFYA 2R1NA 1UC5A 3URAA 4YTSA 1AH0A 4ZOCA 4MFEA 3KRSA 3DJGX 2ZADA 3TTYA 3BLFA 3NOYA 5EBKA 2VHLA 3OO2A 1DIEA 1VGAA 3LHUA 3MYPA 4Z2KA 2GQWA 1R7AA 5C54A 2QF8A 3KXQA 1P0DA 1EUNA 4URIA 1KV5A 3B9EA 2QCNA 4XZBA 4XUYA 4H9MA 3MZ2A 4O1FA 4UTWA 2PWHA 3PZVA 1E6RA 1WUEA 4M80A 4FA3A 3IEBA 2JGYA 2OX4A 2CZEA 3TK7A 5DF0A 3T0TA 3VIPA 3AHZA 2ZA2A 3UCDA 2Y7EA 1S1PA 1OYCA 1TELA 4AD1A 3NQVA 3IWPA 2A4AA 2ZZCA 3RJYA 2QLYA 2PFHA 2ADAA 4AZHA 2XIBA 2IPGA 2DUZA 4MOZA 2ALRA 3QGVA 2PP0A 3CV7A 2IKJA 3TW9A 2FGBA 1AG1O 1OGSA 4PCFA 1BF6A 2H90A 2MNRA 3WYZA 2HBVA 4I5UA 3IPWA 4Q4PA 3S46A 2WC7A 3N34A 3WLSA 5BU6A 3G22A 2EPHA 3BSMA 3H2OA 3KCJA 5BWFA 5G2IA 1PZ2A 3AHTA 3W24A 3CMGA 2IW0A 1WE5A 2R9ZA 3A4AA 4PTDA 2TYSA 1DJYA 5F2LA 4JTUA 4ZQPA 4PCSA 1S3TC 4JFWA 1FUYA 3PZ9A 1SZEA 3OTRA 1RY0A 2W55A 3IARA 1A5NC 2E5AA 3SCPA 3I68A 3RFAA 4PTNA 2WSRA 4GI4A 2REQB 1TR9A 3M07A 2QDHA 2D73A 4MM1A 2PS2A 4GZEA 2HS8A 2Y8UA 4ZCWA 4PEEA 4UMCA 1EJ7L 2YX0A 4L4PA 3EKGA 1IZCA 3QMRA 1J8VA 1SZNA 4HU0A 1UD8A 4NI8A 1HJVA 4IXXA 3BGAA 6A3HA 2A5HA 3GDMA 3MKKA 1EZ2A 2YZ5A 5ABHA 1EXPA 3DECA 4AWTA 3CBWA 3LLXA 4QFUA 1JFXA 2NQZA 1HF6A 2IXVA 3P93A 3GR7A 1RH9A 1AOGA 3GDRA 4XK2A 2ABBA 1UG6A 3E0WA 1A49A 3E38A 3IGSA 1NAL1 2C3CA 4D9PA 3TJLA 3SRKA 3PUGA 3TN6A 1XUUA 5FJJA 1Y7VA 1GJWA 4YMZA 3MUIA 4JHOA 1PKLA 1QPRA 3LDVA 3OLDA 4TVCA 2GJLA 4MFDA 4B92A 3NGJA 3CV1A 3BW4A 5TD4A 4LVBA 1PIFA 4K7ZA 3K4DA 1SU5A 3KFTA 5C6MA 2KX9A 3QEZA 4C6DA 1BXBA 3QZ6A 4ZO8A 1HT6A 2EPLX 2ZRZA 2IMRA 1ICQA 4W8BA 5EMLA 5JCLA 1US3A 4WLCA 1VKFA 4HVXA 1V3JA 1N5WC 4Q8WA 1R2TA 3EPNA 2QVHA 1S5MA 4ERGA 1Q7QA 2P5NA 5HMDA 1VFUA 2W6RA 3F7JA 3W1NA 3P7YA 4ASTA 3LQLA 3VGGA 1OX6A 5FF3A 2QKFA 2CXEA 4FF5A 5BOOA 5I06A 5GPRA 1KV8A 2A79A 4DUWA 3WF0A 2G3JA 2PWVA 3CUXA 5E6YA 1IGWA 4W85A 4RZBA 1KBIA 3BJTA 5ENLA 3KOZA 4D6CA 4ERIA 4JR5A 2QPUA 2GK1B 1H7XA 4XD3A 3N3TA 3K8MA 3U6WA 4EVZA 4OKDA 1JUEA 4GVHA 3CL8A 1CDGA 1Q7MA 3ES7A 1DE6A 3USBA 4NKCA 4JTKA 2WCSA 2W3ZA 1EDGA 3FY1A 2VZTA 3UYCA 4WXYA 3DUGA 1QPQA 3TN3A 3PWAA 5BOEA 1Q6RA 3DI0A 1ZGDA 3MJYA 3ZMRA 3DKLA 4TVUA 1RCOB 3H2EA 4HZ6A 3A4JA 5LGXA 4L4OA 1G01A 3WQ5A 4NAFB 4QQUA 2XFFA 4P7NA 3QVQA 2HVNA 5HNTA 4LVFA 3MBFA 1NHQA 3LGEA 3LOTA 1Q5MA 3E1F1 4YXGA 2WV8A 4P8WA 2E7FA 2ESCA 1OCQA 3WX7A 2WZMA 4GOAA 1K8CA 5I3KA 3QHOA 1RCXB 3CUIA 3W27A 4E6MA 4UOJA 1K3UA 2QUNA 1WDPA 4MY9A 4GUGA 4Y8EA 2ATSA 3H23A 3VIIA 3GH7A 3LCGA 5C7VA 3A3WA 3MSDA 3N29A 2Z0IA 3HPZA 3QW3A 1BWLA 3USZA 5FJTA 3B0UX 5D9OA 4YTQA 4R9OA 3AM9A 5E6ZA 3OGRA 5E70A 4KWUA 4DUXA 2PLKA 4GVGA 4CNPA 1QFEA 3ORWA 4TX9A 3N18A 2VEFA 1XDIA 3ANVA 3HOJA 3QN3A 3G0UA 3V16A 4PUJA 5HWMA 3FNDA 1OF8A 4BF9A 4H41A 3XIMA 3MS8A 3CK5A 3W7EA 3W1LA 3DU0A 2OYKA 2GR3A 1TV8A 2V3DA 1V0NA 1QWKA 4LWWA 4QJ4B 5CQ1A 4YLWA 4JXCA 1I9CB 4FIQA 3TX9A 1N82A 2RGLA 4PCNA 1U1HA 1C90A 3D3AA 3G0SA 4NY2A 4E2VA 1TMHA 4O1DA 1UZHA 3Q67A 3FVMA 3MT1A 3UWWA 4B9YA 4HB7A 2R14A 3DGHA 1BVNP 3UG3A 4ECLA 3KBMA 3AHXA 3LBOA 4OFCA 3K13A 1JUBA 3PANA 2AL2A 3MV11 3FG2P 3KVLA 1DBTA 3G1SA 5I2UA 2BC0A 1Q6QA 3H2MA 1XV8A 3U5UA 3A3XA 5DMNA 5CG0A 2HRWA 4KQNA 3A13A 2W3RA 4HYVA 1GZGA 3EXSA 2Y8KA 2ZX7A 3UD6A 2XVPA 1NP0A 3F4VA 4JDBA 4M56A 1TV2A 3Q2DA 4MSSA 1V6UA 3LNMA 2FJKA 3T4CA 1STZA 4XBJA 5TIMA 5A6MA 1XD1A 5FAJA 3VD5A 4AYSA 4GIEA 4HA1A 1Y8BA 4B90A 2ZTJA 4GFIA 3G1YA 4EQWA 4YVXA 3TYAA 4CNNA 2Y4SA 3BDKA 2BB0A 1XG3A 2CLKA 2L5HA 4Q22A 1DJNA 2YQUA 3IUHA 3P82A 4J3UA 3GBDA 2EGZA 3P5ZA 5AB3A 2Q01A 5D9MA 3MY9A 1SJDA 3WBAA 1BTMA 1XLEA 3UQNA 4J3TA 1D7FA 4R33A 4B3KA 4ZB5A 3WZ0E 3F4NA 1V0MA 3HV9A 1P0BA 2YOCA 1I2RA 3B03A 1TQJA 3ZOAA 3RO6A 3RJXA 2DVXA 4EWJA 1VRXA 3VNIA 3W87A 3KRBA 2V5LA 4CN4A 1THFD 2D69A 2WHKA 1VD6A 4GISA 3H54A 4NQ1A 1B9BA 3PPFA 1JFHA 1ZQ5A 4J9JA 1OSEA 2C71A 1DJXA 5C0QA 1PHQA 3TLLA 1AFSA 3GXDA 3VDBA 3ZVHB 2A7PA 2E3ZA 5FS9A 4WOZA 4HNUA 3PR2A 3CAVA 3LXAA 4PRWA 5I00A 1F3EA 1NU5A 2PDIA 3TU9A 3W84A 3GXMA 1GGOA 3ITVA 2PLMA 3GNXA 4LAMA 2X40A 4A22A 1GCYA 4H9TA 3TA6A 1ZY8A 4E4FA 1QR7A 2V5KA 2Z7GA 3W3OA 1S1RA 4HJWA 4Q6XA 3C2RA 1KKRA 1SW0A 3HFTA 2DZBA 4LUIA 4KEMA 3UVIA 4RV8A 2WZIA 3SY5A 3TR9A 1W1B1 3T1GA 1E70M 3WN6A 3OHMB 4M81A 1M03A 1B1YA 4WY0F 3HBLA 4JZ5A 1UC4A 4EANA 3RLVA 3WH7A 2ZBTA 4NXSA 2QCLA 1XGEA 4M51A 2BHYA 1ENUA 2HROA 4TR9A 4GX8A 1XIBA 3AZSA 5A6AA 3E0VA 2PDYA 5AHIA 3FA5A 4AXKA 1V77A 4UNIA 5E93A 3UWVA 2P8CA 4HNOA 2BOFX 3GDBA 1E0VA 3UVAA 3VUSA 3N14A 3W00A 2XJ7A 3O15A 5HA7A 3U4AA 3U48A 3AHYA 2BHZA 2NV1A 1BRLA 2A1YA 2IQDA 1M5WA 2ZRUA 4FNQA 3SJ3A 1UQYA 5BRPA 2OPJA 4Z1AA 3AQUA 3LQGA 4OGZA 1DKWA 2ZRYA 4GHRA 3N4EA 5CZKA 1UR2A 4EAMA 4R7OA 4OWGA 1DJGA 1RVGA 1WBJA 3UG4A 2PLJA 2ZZ7A 4RE0A 1KRMA 2C79A 1XYFA 2NV9A 3HN3A 4LBUA 3WQ4A 2BXVA 3DHUA 3UXAA 3SBFA 3B9AA 2PDLA 4FAMA 3ABSA 2G8ZA 1WAUA 4OU1A 3IAPA 2EQ7A 1P0EA 2FHCA 2PE4A 4G7EA 4MLJA 4UZUA 2D2HA 4WJ8A 1L0PA 1FHLA 1UH4A 2OYLA 5EY5A 3WUFA 3I7QA 3KBJA 4G1NA 3IANA 5CH9A 1B3OA 2VZVA 2XWEA 4QCFA 4R85A 1EJWC 1ZAHA 2QCCA 5I02A 1H6VA 1J0YA 1VCVA 1A5AA 1K6WA 4ACZB 1AL8A 4FXRA 1RPKA 3GTXA 3NM1A 4XWUA 4NRSA 2E3TA 2A3CA 4GKTA 3OVQA 1JD7A 5FESA 2VFGA 5G4EA 3OYXA 2J3NA 2QVNA 5IM51 3RCYA 3AS3A 3GFZA 3B9JB 3L5AA 3W7QA 4TU1A 3SCTA 4UOZA 5CZTA 4PUUA 1ISVA 3ZR5A 3Q94A 1FWJC 3BL3A 4YS1A 2P10A 3EB3A 3KDOA 4MPKA 1WKFA 4O1CA 2ZQ0A 1D2KA 1XLJA 4HZ7A 3S5YA 1KQZA 4GH1A 5I07A 1E4MM 4C6MA 2WOQA 1G9HA 3BQ6A 3T81A 2IKIA 3VILA 2JE8A 2J9YA 2FDMA 3JU2A 5I7GA 3W6YA 5AOUA 3EEZA 1AW2A 5KITA 3GD4A 1QI5A 3CAKA 3PF3A 3FK4A 1GT8A 4Z08A 2Z1KA 1SO6A 4MNKA 4AVOA 4I8DA 1GVFA 4CCCA 1YXCA 3M5YA 5HQLA 3PY2A 1U22A 2WMIB 3BV4A 2W67A 4HU4A 4NNBA 2FPYA 1CECA 2R8WA 2VRJA 4JIRA 4ZQNA 2QV5A 3KE0A 1GOQA 3HU7A 2BXYA 3NQFA 1G0CA 3WJZA 4RZ6A 5CSRA 3WDJA 3REQA 3BLOA 2GH5A 3DK8A 1DXLA 4K1GA 2PBOA 1QK0A 3HQOA 3RX4A 3T4WA 4DLFA 4UXDA 1L6FA 1XLIA 3QTGA 1RQBA 4QX4A 1Q6OA 2X1RA 2F61A 2G3IA 3I6RA 1W9VA 5HNUA 2QUMA 2J47A 3H70A 4NVTA 3E6EA 5EB8A 4L61A 4ZQRA 4DM1A 3ABXA 2CHOA 1A53A 5D2XA 1PKYA 2Z7KA 1HKJA 4GC4A 1J0ZA 2ATMA 5F4WA 3R11A 1N61C 2F5ZA 4LFYA 2XISA 3RPMA 2GSJA 5I03A 2AGTA 3PZUA 1NVMA 1V5XA 4A29A 5E5CA 1EHNA 3NDZA 1XKJA 2E9MA 2FZ9A 4XO6A 1WAWA 3UEQA 2EQDA 4EPDC 7ENLA 3OVGA 4AF0B 2CKSA 2J8FA 1FA2A 4AZGA 1FH9A 3MKVA 5ABFA 4GNJA 2I14A 3GTIA 1C9WA 3PZTA 4IMCA 4LANA 1H51A 4HTYA 3IRDA 3I7RA 1OD0A 4DXXA 4Q4MA 5JQ9A 1LJYA 4GWEA 3CZ8A 1ZMDA 3LCFA 1B3YA 5JBEA 1GQJA 4JHMA 1E6PA 1UD2A 3UF9A 2XIIA 3GLCA 6REQB 2INEA 3SCNA 3VD3A 3KWSA 1CGXA 5AFDA 2H6RA 1CWYA 1D3CA 1GG0A 1GOOA 2ZCGA 3A12A 3UETA 4DO5A 4F0RA 4HSOA 1HVQA 4H1ZA 1UUQA 2ZRWA 4UNKA 1JCYA 5MF5A 4HPNA 4PL2A 2PGWA 4U2YA 1P7TB 3RIKA 4C7GA 2J6VA 1G4SA 2H3DA 3NQAA 4K6AA 4AISA 1J6PA 4K8HA 4MJZA 5J5RA 1MOKA 1W0MA 3R8HA 1YNQA 2J24A 2R1MA 3EWCA 2V6OA 3TMQA 3TYCA 4HCHA 3SQLA 4HHLA 4RNJA 1V08A 5LZLA 4JIEA 1N7KA 1IQ8A 2GYIA 1ZSXA 5FS6A 4Q8QA 1V0LA 3V36A 3GG0A 3B05A 4IIEA 3THQA 2NLYA 4G56A 1QU4A 3EWBX 1MXSA 4IM4A 2INZA 4EM3A 3M0JA 4IPIA 9XIAA 1RBOB 5BWAA 3A5FA 1UUMA 3QQ0A 3WD4A 1M01A 1CCWB 2DPEA 5AYYA 1XJBA 4RJEA 1LRNA 2QJNA 1L6YA 2V3EA 1C8YA 3PAOA 1K70A 3EANA 1P1MA 4CLMA 4EPBC 4XSMA 1IGSA 4PZVA 1VYPX 4LS0A 1W9DM 1SJAA 1PIIA 1N8IA 1S38A 1R8LA 2JF7A 3D46A 3RPTA 3BXWA 3BJSA 4JAWA 4FP1A 3G1DA 4IISA 4AZ7A 3R07C 4ADUA 1KM0A 1XXXA 4H83A 2EQ8A 1OEPA 2A21A 1I2PA 3WL0A 3G6MA 2GVLA 4GI8A 3WNLA 1PS9A 1RPXA 2Y62A 1TYPA 2NUXA 4L5ZA 3I6TA 3GRIA 3TN5A 3FHAA 4UTUA 2PC4A 1XI3A 1N60C 3VGFA 1ITUA 1Q8JA 3PN8A 1E6ZA 1OFPA 2PTZA 3PZQA 1W3LA 2NT0A 3O9NA 5RUBA 3CYVA 5HQMA 3AXMA 3SCQA 4YWOA 3KL0A 2ZXBA 5AC4A 1XL9A 1UBSA 1MWOA 2ON3A 4JTJA 2C3ZA 5HINA 1KQYA 3PK7A 4C6JA 3NSNA 1VJIA 4IX0A 3BW3A 5FF0A 3LB0A 3LLDA 4NZFA 3PB2A 4X60A 3WMLA 3JZEA 4FXSA 4U5KA 4AIUA 5IBXC 3DERA 1Z44A 1JG9A 4LF2A 4K2SA 1J6OA 2GDUA 3TWAA 1IZJA 1CENA 4O4WA 4K68A 1DOSA 5FCZA 3BG9A 5C55A 2QCEA 3EAUA 4BJHA 3AMKA 5TAOA 3R8GA 3KBNA 3WK0A 1V3HA 3P8JA 4P7QA 5AECA 1LUCA 3W7JA 1VRDA 7A3HA 2VWTA 3WSUA 1MUWA 3NVYB 2XSAA 1IWBA 4O52A 3SQSA 2ISWA 1LVLA 1XLDA 3II4A 5AY7A 3SCVA 2CBVA 1IEWA 1FP8A 2FHBA 4DO4A 1JDEA 4M52A 3E2SA 3FLUA 1CGYA 3HW2A 1V6XA 4M5PA 2CLEA 5IDIA 1XS2A 3EB2A 3N9KA 2QHAA 2CLMA 3CH0A 3BARA 3FFSA 3B8DA 2O55A 4CU7A 4FX7A 4DJFC 3V1PA 2X41A 3QBUA 5A2CA 2WVSA 1BVWA 2BSLA 1B30A 3M4HA 4O11A 3JRKA 1DE5A 3VTRA 5H1WA 4CUCA 4M1BA 4ZR8A 1TMLA 4A6GA 2CW6A 2F2KA 4LAZA 1S5WA 2REQA 2PGRA 2YR1A 4L4LA 5C9UA 3ZWTA 2VNCA 3BURA 3SCWA 2Z28A 4MDPA 1NHRA 1A3HA 2YBVA 1U1UA 3ZZ1A 2HZGA 4L6HA 3A4XA 3W72A 2GLKA 3POCA 3B06A 1P4CA 3GKAA 1FVPA 1RQEA 3F4DA 4JTIA 1Z3NA 2Y85A 1SW7A 3T7VA 5K4ZA 4F2UA 3TN4A 1UA7A 3R89A 4AH7A 3NQ6A 5DQPA 1EO7A 1LRTA 3UY7A 2XIMA 4WKAA 4YPJA 1TTQA 4KWSA 4W8LA 3S0CA 1OF6A 4DNAA 1W1ZA 3KM8A 2VEMA 2V68A 1VEOA 1LRQA 1R47A 1UB3A 3S47A 4XB3A 2PTWA 1GKQA 3OVPA 2V67A 4ADTA 2DGAA 4GRSA 4O54A 5D9NA 4LF1A 1IEVA 4DWDA 4E0CA 3GTHA 2X2YA 1X1OA 4GACA 3APYA 4MF4A 2BG5A 3AIUA 4F2TA 1SGJA 2V2CA 1JAEA 4XD5A 1IXQA 4XKYA 3WK1A 1PZ0A 5KINA 2I5IA 3WQPA 3UA3A 2WVVA 4EF8A 3SR7A 2XVLA 4QAIA 4WZHA 3JUGA 1XIMA 3GRTA 1HJQA 1R3RA 3L0GA 5FSEC 1XRTA 4NAEB 1QUMA 2D3LA 2ZWYA 2QCDA 1ODZA 1N62C 1OYAA 1K9FA 1VH7A 1W9UA 2B81A 2J4GA 1HFBA 2RABA 3SEPA 1TJ0A 2G4JA 4UTIA 1HJWA 1XANA 4Q4KA 2FH8A 2WOIA 1F6YA 3K5XA 1POKA 4DF0A 4AW7A 2EXOA 3LGGA 1EJRC 3GC2A 1R3SA 2OT1A 1XH1A 4H8NA 3SRDA 3NURA 4L80A 2OELA 2GK1A 3R0KA 3W2MA 5CPQA 3C8FA 3E74A 3TQPA 1TG7A 4XG1A 1KR0A 4FLSA 4HOWA 1ITQA 2WB5A 2X0HA 3TC6A 6CGTA 1R85A 4C65A 4ZO9A 5I78A 1X6UA 3KWXA 1O5QA 2QJGA 1WKYA 4LB3A 3QR0A 5BMWA 4O57A 4DBSA 3T2PA 3CV2A 2HS6A 3KUMA 1E0UA 1QOXA 3CZJA 4EPKA 4E2BA 4QHRA 4LUTA 2OWXA 4PMNA 2E67A 3JZUA 3GXPA 3EX3A 1MXDA 4XIMA 3V0UA 5K7JA 1M7XA 2TPSA 3NZGA 4IJRA 3UCCA 1TIMA 1B90A 3L4UA 1BSIA 1P6BA 2BHUA 3NA8A 3ITOA 4Q33A 3VMOA 5FEWA 2FZDA 2W0UA 2X8RA 4O19A 3HJEA 4TUFA 3FCPA 1EOMA 3K1GA 4LT9A 1FWNA 1UIPA 2CITA 3WJXA 1Z48A 3AISA 2DH3A 5LNUA 3LPGA 4J3ZA 3WF4A 4J57A 1DJQA 4MJMA 3W82A 1F3TA 1HKKA 3N11A 3PBWA 1RLDA 3LSBA 4O28A 1VFSA 3GNOA 1FCQA 4WSHA 4ATWA 2H8ZA 2Z26A 1XCWA 2WNZA 3GZ3A 4GQQA 4GUHA 1DYSA 3EA1A 4QP0A 1S2UA 1I2OA 1VYRA 3MU7A 2OEJA 4M82A 1K7XA 3L4VA 5D2TA 1C8XA 3LYEA 4QAWA 4DYJA 3PBVA 3M6YA 4HMEA 2J7BA 4KKXA 3QV6A 2ZX8A 1W8SA 4IPLA 4JTCA 5K2ZA 3T0DA 3DIPA 1Q66A 2FMNA 1NDVA 3R43A 2E25A 4AXNA 2WLYA 4X0NA 1T99A 1I60A 2ANUA 1QW8A 3AS1A 3BK0A 1PB0A 1V7YA 2W4XA 4ZEPA 1VQTA 1KXQA 1FXQA 3KVKA 1M68A 4Y90A 3DCPA 1ZB5A 1FIQB 3CWOX 3NO3A 1F8IA 4WD0A 4X9YA 3RDKA 3ZR6A 3HJZA 4FO4A 4GXMA 1C7TA 1ZCOA 2XDFA 5K9XA 2XFRA 3VIMA 3W7CA 4JGDA 3PZNA 3NOEA 1H4PA 5FMHA 2Y5EA 4S3BA 4H4VA 3A64A 4OBRA 4KGLA 4KETA 4UQAA 3KOWA 4UTLA 3TC7A 5HOSA 1BFNA 3WL1A 4AMCA 2WJDA 3UJRA 3PSVA 3MB9A 3VOHA 3W83A 4XAYA 1EX5A 1KD0A 1Y0EA 4QE1A 4EP8C 2DT3A 2QDDA 2XHYA 1VCGA 4H00A 2E68A 4C1NA 4B5NA 5CSSA 2CLHA 4HA4A 3QLDA 2P88A 3HMJG 1W31A 1ONFA 1U5VA 3WBEA 1ISZA 4IQLA 2GJXB 1I1WA 2CKRA 4HA3A 1PX3A 5A6JA 3L2LA 1XRSA 4P61A 1XIIA 5I5RA 1SFTA 5G5GB 1F73A 1A5CA 1PBGA 3AWNA 4P8VA 3LZ3A 2BCPA 5EMMA 4UUIA 2DDXA 2DZWA 3S1VA 4JFVA 3R8RA 4LY4A 4KRTA 1E73M 1CTNA 1H62A 4JNYA 4N42A 1EJXC 4ENLA 2OOGA 4JICA 3CHEA 4IPPA 3DHFA 2ZDRA 2GVYA 3IVTA 2RFGA 4GZJA 3MMUA 3ANUA 2WJZA 5U25A 1XF0A 1TZZA 4JYFA 3VKBA 3GFYA 3ZVHA 2CBIA 4LC6A 2CWNA 2JK2A 1R87A 3MUXA 2DFAA 4RKAA 2EPMX 1LQAA 1DWFM 3MI2A 3AWOA 4Y9MA 1EQCA 4RLIA 5FEPA 1TA3B 1EP2A 3CUJA 1JQVA 4NZJA 3AIVA 1JJKA 5C9XA 4IGNA 3H2FA 3S5SA 4H9XA 2YW4A 1TPC1 3VCRA 1W6TA 3O06A 4Q8OA 4DLMA 1WYGA 4X0VA 1YXYA 1PWLA 5KZDA 2Z6JA 3M47A 2VZSA 3EGJA 1YTDA 3GM8A 1XYAA 2WQDA 1T40A 2PF0A 4WGXA 3GW3A 3VVGA 1I0BA 1PL9A 1SMDA 3H53A 3W07A 3EWDA 2DW7A 4FNSA 5M03A 1UBPC 3ID7A 1TUXA 3EA2A 2XN0A 4GUJA 3UY8A 2A6LA 4EE9A 4D1IA 1RA0A 4KESA 1POJA 2QAFA 5DMMA 1XRVA 3SSZA 1M65A 4KWVA 3TWBA 3SJNA 5H8PA 2NLIA 3TA9A 1YBQB 3ARTA 1F9CA 1DNCA 4BI5A 2JFEX 2Y7FA 4DJFD 3NPWA 2Y0FA 3WQGA 1GEQA 2WJEA 1KFKA 2VKZG 3JS3A 4O1AA 2G0WA 3SUWA 3R58A 2PODA 4D6EA 1TJ1A 4ZQMA 3N9RA 4W7WA 2GGJA 4TMBA 3IVSA 3CHVA 5A95A 1BQCA 1G94A 4O0ZA 3B0PA 1GYLA 3H12A 3F4CA 3FKRA 3W7KA 1KTBA 2P8BA 4PSRA 4ZL1A 4JTSA 4UR8A 2W3SA 1S2AA 3WMBA 4TXEA 2VR5A 1WV2A 4IIDA 3SQMA 3RR4A 1HTIA 4H04A 1EGMA 1MUCA 1V6YA 4TX8A 3B9NA 1LLZA 4LV9A 1Q7ZA 3WLOA 3WMSA 2X30A 4D71A 2V8ZA 4CD6A 1TQXA 3EKZA 3DYOA 4UQBA 3G1HA 3W37A 5EBUA 2ZX9A 3C56A 1GOXA 3RHGA 1HGWA 4O1BA 1F4AA 2VZUA 1E40A 3W7DA 1VB9A 3N2MA 1NP2A 2OQHA 1X97A 1RBLA 3I7SA 1H7WA 3L5MA 4EF9A 1NQKA 4AAJA 4J27A 3C3NA 2HXTA 2GDQA 4RW5A 4S3GA 3FW6A 1E51A 4XVDA 2B7QA 4CN1A 1PCKA 2C7FA 4GZ7A 4IUGA 2X05A 3H7RA 5KETA 4QDWA 1J93A 3VNMA 3PNZA 1KTCA 1JD9A 1CXIA 4MZ1A 4B2DD 4JQ2A 1A5LC 4Q8NA 3TJXA 2J7FA 2QS8A 5GJPA 3M7SA 5HMFA 2VELA 5JU6A 1I2QA 4I5XA 1CI1A 1EC8A 3CB3A 1U5JA 3SAZA 1UKSA 2OU4A 4OECA 3TR2A 3NQCA 4ZODA 3L9CA 4CQ8A 1K8XA 4Q7IA 2DUXA 3G3DA 4F0KA 3RU6A 3IGUA 1ICSA 3KHJA 2CPUA 3IC9A 5I0DA 3LUTA 3O6AA 1TWSA 4DNHA 5A6LA 2VGIA 4ZZ9A 3QY7A 1YKWA 4QG6A 2DORA 4U31A 3M0XA 4W7UA 4D1JA 4LCSA 1XBVA 2GQ9A 5HPCA 2NQJA 3WNNA 1L6WA 5LA1A 4FMVA 3AUOA 3W76A 2ZXDA 3GXNA 2CHRA 1SZRA 2V82A 1K9DA 1SVDA 4DJDC 3R25A 1PO9A 1XSKA 1H7RA 3SQPA 1MRAA 2Z24A 1WOAA 3GVQA 1RJRA 4MY8A 3C0SA 3OQ8A 1RA5A 2VWSA 4C1LA 4QS6A 3LHTA 1QI2A 4WCJA 2IPWA 2Z25A 2WP5A 4O1EA 1SZGA 1WDQA 3TSBA 4QDMA 5D33A 1ZRQA 3SM0A 4IG2A 1X7IA 5F1VA 6XIMA 1I45A 2JKEA 4QBXA 4WHBA 2PP1A 1KFBA 3DGZA 4LXFA 2CZ5A 2W27A 4PR4A 4ZTYA 3SIZA 4FALA 4MZ8A 3ZFHA 4H19A 3MQTA 1JPMA 3CHFA 5G4WA 4H7ZA 2BVDA 5C2XA 1GVEA 4GVFA 1Q2RA 2PDHA 3LBMA 4EIVA 3C0QA 2OOFA 3LY0A 1CIUA 1JVNA 4DI8A 1WDSA 1OIMA 3SRHA 2QNEA 5C8BB 3A5VA 6TAAA 3KOXA 1HVXA 4DBUA 3BGGA 2XU2A 3S8HA 3AROA 1G4PA 1KWKA 3U8GA 1Q13A 4DN1A 3ZS4A 2OGYA 3MDWA 3HGRA 3WLPA 1WCGA 4WUIA 1Q65A 3ZT5A 5FF4A 3PSWA 4KW2A 1JF5A 1UJQA 4PCPA 3W75A 3JW7A 5D05A 1ZHAA 3W1RA 1P7TA 2Z6IA 1UZ4A 1DEDA 3PG9A 1CB2A 1D3GA 8XIAA 3L7RA 3MANA 3UJFA 1O5KA 4YTTA 3CHDA 3ITLA 3RUBL 2PDCA 1LF1A 1TJPA 3CQKA 1PHWA 1PIGA 3W7MA 3WBYA 5KMYA 1JUKA 5GJMA 1JR1A 2B4GA 5I6SA 1R38A 1IZKA 1W9BM 3PJWA 5DY2A 3GC5A 3VX0A 3H22A 1F05A 3FYOA 1G7VA 1XLAA 2FFCA 3EYPA 2YCJA 4RDWA 4PFHA 3QOKA 3I65A 1SUXA 4HU8A 3WLNA 4EKJA 1JI1A 4UNLA 1GOWA 3IUDA 1PPIA 3KL5A 4JFSA 3C2VA 3RNDA 3W26A 4QTGA 2XWDA 2HWGA 2OZ0A 3B04A 1ZBVA 1TJRA 4NP7A 3ABZA 2BZNA 5DN1A 4J3SA 4BURA 5FD0A 4Z2JA 1DIKA 3WJSA 2C16A 3CIVA 2PZNA 1WBHA 4Z1CA 1ZJIA 3SN0A 3KX6A 4GYFA 3HIJA 4LY8A 3AAMA 3A9BA 1HKIA 2HSAA 3IJ9A 1BG4A 2OO0A 3LA4A 3FXGA 4FR6A 4GQBA 3SUSA 4F79A 2WBAA 1XSJA 4DZHA 4ZE5A 4HA0A 3PBGA 3BUVA 2DIKA 3CZLA 2A3BA 1WP6A 3LS9A 1ZDLA 4H8VA 3QRHA 3NO1A 3TMLA 4CU8A 1GRBA 4JIHA 4AU0A 4O13A 2VFEA 3IIPA 4ZXLA 5C2CA 3NL3A 3ARRA 3JVAA 3WLIA 3ITCA 4IF2A 3N19B 4A35A 1FFRA 3HA1A 4GIRA 2FTWA 4J3XA 1VLIA 3VAVA 1VIWA 3LHVA 2EG8A 1FTXA 2AQWA 3D3FA 5XIAA 1ODUA 4LH8A 3AC0A 2EQ6A 2EEXA 3T09A 4BCEA 4HN8A 3CGDA 2AKZA 1KM3A 4H3DA 1M1BA 3INPA 3B8SA 5FS8A 1FEBA 2PU1A 3GG8A 3AS0A 2VR2A 1NELA 2XZ7A 4QJ1A 3WKZA 5D09A 1A47A 3E2RA 2BFGA 3GS6A 3OLIA 4H4YA 1Q6FA 5G1TA 3U4FA 1P48A 2W9MA 1GQIA 2A8XA 1R30A 1EFZA 2INFA 3AO0A 1E9YB 4H7VA 4UIOA 3GDTA 4L65A 1XYMA 1TWDA 1XGZA 1OYBA 3PTDA 1ZP3A 4Q8TA 1JCNA 1X96A 5U4NA 1LWIA 1Q85A 5KVHA 4IGHA 2C15A 1VFLA 2EPNA 2WKJA 3PUEA 4V2XA 3KL3A 1QHOA 1DTUA 3QHNA 4UTWC 1XWYA 4L9YA 2C1HA 2EQ9A 2UY5A 2VEIA 2ZIDA 4JTRA 3PVFA 3WLRA 2FZBA 3O0HA 1ZUAX 4MAZA 4NEWA 4S1FA 1S5TA 5MKGA 3VOGA 3O2LA 4CD5A 1QBBA 2YA1A 4GMEA 3IJQA 3S9ZA 1IEQA 4ORIA 4E3TA 2VM8A 3DOPA 3W22A 1RUSA 5J8LA 4QE5A 5IHRA 2FMOA 2QDGA 4LUSB 3OIXA 4KEZA 4J1OA 3APGA 1A4LA 4YNGA 4HQVA 1ZLPA 3CQJA 4Y9OA 3ZYZA 1B9ZA 1XYZA 2G3FA 1XQKA 1XPGA 4GGHA 3L68A 4IXHA 2DSKA 2J77A 3XINA 2GUBA 5A8OA 5I3FA 1O94A 3UG8A 3TIMA 3H4XA 3VOCA 1YLVA 3M46A 2J27A 4M29A 1YXDA 3FYYA 1KFCA 2E9LA 3CNYA 3VD7A 4NZ4A 4OOUA 3OGSA 1NOWA 2QCGA 1GSNA 5EKYA 1OCNA 4LRTA 4RNFA 5EFDA 1CXFA 3SUUA 3OEXA 3GNPA 2PU0A 3R4IA 2BOEX 1AQHA 1NF7A 3CUFA 1FDZA 4EM4A 1ZJAA 1U33A 5K9CA 2PRMA 4AFYA 4Q8UA 4WY0B 1DP0A 3PPCA 4H4RA 2X1UA 4M7TA 3CAWA 1VP5A 3EPMA 4H7CA 5PTDA 5JH1A 5DFAA 5H8UA 3NFUA 4PUEA 2Y5JA 4AEEA 3W74A 1H60A 8TIMA 1QXLA 3KP1A 3WJWA 1WZLA 4CU6A 1V3IA 4UR7A 1AL7A 4H6QA 4YCPA 2G41A 1PX8A 4KS0A 2WLZA 1M9HA 2OEMA 3B4YA 4O16A 2A6NA 1WNOA 1NDZA 2XFWA 5T26A 2UZ9A 3DFHA 1M53A 1BAGA 1W5QA 1OD8A 1TE1A 2VDGA 1XR2A 3NL5A 3WNMA 1CBGA 1AD4A 4AMAA 3WH9A 3AS2A 1KFLA 3FIGA 2YL8A 3LXDA 1G4TA 3EX4A 1HQTA 2NPXA 4DXVA 2X1SA 2ZZ6A 4A05A 3B8UA 2V5BA 1OFDA 3V0SA 4Z0JA 1ZALA 4H8UA 1YPFA 4RE4A 4GBUA 3L4ZA 3VGEA 1YQZA 4X2PA 1CGTA 4K1WA 3W53A 2FGLA 2FJUB 2PDUA 2P0OA 1A0DA 4NG3A 1IXOA 3P74A 4MB3A 3CZGA 4Z2LA 3KBSA 3FA3A 1RALA 3GU9A 4GKLA 4JTGA 4GYJA 2QUUA 2GR2A 4QRNA 4YN5A 1FXPA 3GC4A 3QMSA 2GQ8A 4GNKB 2CYGA 4JY8A 2PDBA 5LNVA 1Q6GA 5AVHA 3LRLA 1YX1A 3M7WA 1XICA 4B5UA 1OVDA 4LTSA 1H0GA 1I2NA 3CAQA 2Y5SA 3CV6A 1BKHA 1R7OA 1XBYA 3R94A 1IIHA 1EC9A 2WHMA 1CGWA 3SN4A 2QJMA 2D2OA 1RV8A 3DZ1A 2WBKA 4WDWA 2VRKA 1V8EA 2QMJA 2Z1WA 3TTSA 4DBEA 3WDPP 3CMFA 3DG6A 5REQB 2ISFA 5I79A 2ZUWA 2C13A 1UKQA 4Q7NA 4CQBA 4HNTA 1UPMB 5T9BG 1BWCA 4WSJA 1MEIA 1WYIA 3VNJA 5JBFA 4R88A 3SCUA 5T9CE 1QATA 3SRFA 3GFXA 3R0DA 3LG3A 4L7ZA 5LIXX 1O66A 1LT7A 3BG5A 2E8YA 3UR5A 2P0IA 2V5CA 2QCMA 1Q3NA 5I77A 3CMJA 3UNDA 1NWTA 1OCBA 1R5YA 3NVTA 4S2BA 3GO2A 3L67A 3IIZA 2DZPA 2GZXA 1VCFA 2V2HA 3GIQA 2CXGA 4PTVA 1HJXA 3UZ5A 4NF7A 5FA5A 2NT1A 4MPQA 2YXGA 1Y5VA 3S2NA 4W88A 3D6NA 5CPLA 2XM1A 4BF7A 2X99A 2QT3A 1TSIA 3WD2A 3SFWA 4BA0A 4JY9A 5DY3A 1ZAIA 2OCZA 2HVOA 2CNCA 3L12A 2NUYA 4KERA 1OHLA 1EYEA 1I6NA 3W02A 1KB3A 2VEGA 2XSXA 3VO0A 1XIJA 5E0FA 3OOQA 2WWCA 1JEHA 3WFLA 2O9OA 1CX9A 4IP4A 4TTUA 6TIMA 1M7OA 1UROA 2ZKMX 1KO0A 5AYBA 1E5JA 3C3UA 3DHDA 3UCQA 2C0HA 1XLKA 2R1KA 1FH7A 2HQAA 1TPEA 1TIWA 4ZMGA 4YWSA 2YCLB 3T8LA 2Q3OA 4AIEA 3OLGA 1LBFA 1OX5A 3NQGA 2OSXA 2NZLA 1EF2A 2F2HA 4JS3A 2DT0A 4F0LA 4KT2A 3TAKA 7TAAA 2R1LA 3MMWA 2WAGA 2YPIA 3VIOA 3VDCA 2F7FA 2Z1BA 1ZKQA 4KCTA 3DFNA 4J7RA 4IJCA 3D0CA 5BNKA 4DAFA 4PMDA 5ER0A 4RXGA 1LBMA 1AW1A 3UR2A 1EEXA 3SY8A 2NX9A 2FVMA 3UXIA 4L4MA 3DYMA 2VVSA 1QAPA 2ACQA 3R1ZA 3WQEA 4GJ1A 5DBUA 1XPYA 3BMXA 4XAGA 1BWVA 4BKNA 2NVKX 3DYPA 4GC3A 3F2BA 1MQRA 4LS2A 1SJCA 4HT3A 4YWIA 2ALDA 4A2RA 3EMCA 1ZBKA 5JMUA 1L2QA 1QO5A 3ARVA 3LV6A 4JN6A 3VCCA 4P7LA 4GG9A 5DMYA 1LM1A 3A7AA 1JPHA 4HNNA 3CGBA 4GQGA 4IIBA 2PP3A 1SB3B 1AJ2A 4MWAD 1OZQA 4CN6A 3SGUA 3I4KA 1XD0A 2VC6A 4I5RA 1L2UA 3V1HA 3VD9A 1OX4A 1PDZA 4L1WA 1B2YA 2DUAA 3UFYA 1IE7C 3EXRA 4LJ3A 2ASHA 2XVNA 3E12A 1JYWA 1EKOA 1ZJHA 4C6CA 4H4ZA 5D32A 1F5ZA 4R3UA 4D6DA 4JX5A 1OINA 4UTMA 2R9RA 4I3GA 4JQ1A 2VCAA 1V02A 3WJYA 3BAYA 3BTNA 3VKKA 1IXPA 1CXKA 4IP7A 1DJZA 5AC7A 4W4QA 2DEPA 8RUCA 4G6CA 3Q37A 1X1ZA 4NX5A 2QR6A 3U2CA 3D5HA 1TMQA 3NXFA 3HFYA 1XHCA 3LSCA 4AZIA 4H4XA 3E96A 1Z69A 3O63A 4MYXA 1GTEA 1A5SA 1TV7A 3ZWSA 4A3QA 1CB7B 4GI6A 2C18A 2F84A 3EOOA 2YDRA 3ME3A 4AC7C 4UCGA 1X7FA 2XIQA 2YJQA 1R2SA 1HG3A 1N55A 5CPSA 1UR8A 2ZICA 3GKFA 1EDTA 5IXEA 3VXGA 1MEHA 2PB1A 2Y1HA 3CXOA 2XYLA 2TMDA 4HNCA 1ZMCA 5GNXA 1GOMA 2ZZBA 2ZXAA 4JIQA 4GIYA 1JZ8A 1MW3A 4DJEC 1CLXA 3DFTA 3ZLGA 1MFUA 3GG1A 2XVGA 1REQB 1FWSA 2NWRA 1Q1WA 1UD5A 7XIMA 4FLRA 1CW2A 2W5FA 3QY6A 4IMFA 3QFBA 2CFFA 1JDCA 1PDYA 1DQXA 1FO4A 3OG3A 2RAGA 3GAKA 2ISSA 4MWAB 3LX9A 3T0BA 3MVTA 1F4HA 4DO6A 3TEVA 1TPUA 1LCOA 1Q6CA 2YL9A 5DANA 3WQWA 3KBWA 2HE8A 3VDGA 1Z9AA 3DX5A 4YIWA 3W2UA 2D20A 4Q8PA 2VVNA 3W6MA 5CJNA 3A4WA 3CGTA 3C2FA 3NG3A 2PWUA 1E6SM 2J75A 3D47A 4JKLA 4L9XA 1W3HA 5A1AA 5HANA 1I8JA 3HPFA 2E1WA 5B7YA 4TVYA 3CT7A 2I1OA 5LA0A 4I7VA 2JK6A 3K2GA 3KW3A 4LVAA 2XPKA 5FSDC 3AALA 1SJBA 4W89A 1Q63A 1PTGA 2WSQA 1AH4A 2QULA 3UZWA 5AHEA 1KGUA 4LYQA 3GZAA 1XDLA 4GRTA 3M5XA 1VIZA 3II1A 3AN1A 4H9YA 1IT7A 4YL2A 3MCNA 2D22A 4N9CA 1WKEA 3FGCB 2BOGX 1A5UA 4ATLA 1KBBA 4HZ8A 3PBYA 3GK0A 1LQ2A 1RJPA 3K8KA 2WOVA 3WIJA 1EUAA 3MA8A 3N1AA 4MJ4A 4IQDA 2BASA 3LMYA 4PH6A 4A21A 1SO4A 2A85A 4M8UA 2ZC1A 5CXPA 3VK5A 1TV3A 3BOLA 2V38A 2EKGA 1GZJA 4S3FA 1BEUA 3MI6A 1DORA 3GTFA 3SO7A 2GSEA 4HOZA 3NVVB 1D8WA 3VMPA 1W54A 3P60A 2XH2A 3EX2A 1KC7A 4POCA 1V6VA 4OUEA 4QCEA 3PZIA 3N2OA 1HN1A 4CD8A 2W54A 3TNBA 4AD5A 2OSYA 1OFRA 1OADA 1R86A 7REQA 4ZQOA 2VX4A 3UT0A 1ZXIC 1B3WA 5JVLA 1UWSA 1HP5A 3R6IA 3GR4A 2X8CA 4QS5A 1R3YA 1TB3A 4O53A 3URQA 5CGTA 1KBKA 4F4RA 4B2DA 2GGIA 3MCOA 2PTDA 4GVIA 1LOQA 4C5ZA 2AAAA 5EMJA 2TODA 1ME7A 1Z7AA 1TJ2A 2J6XA 2QAEA 2CWXA 2OQLA 1GOKA 1O5RA 3CQ0A 1Q45A 5HBFA 3IGXA 1YYAA 2I57A 4K8GA 3I10A 1Z41A 2E4TA 4HNVA 2F9RA 1RAKA 2H8XA 5CC5A 2V2DA 1N8FA 3P2VA 4L1GA 5HQEA 4KBXA 4C6KA 4V33A 2HJPA 1W1TA 2NX3A 3N2TA 1Q4NX 4H50A 4RE3A 2RH9A 2OKTA 4RK8A 5TQLA 2QCFA 1ZENA 1XYBA 1W5OA 5I3IA 4N02A 4E8GA 1O1ZA 3IJ7A 3PJTA 1ZU8A 2DZSA 2FHFA 5M17A 5CJ5A 2VGFA 2XM2A 4UMAA 1T96A 1G69A 1NOFA 3G24A 2BMBA 1DJIA 3EWZA 3BLEA 4B15A 3BCDA 3OA5A 3BMWA 4HIBA 4GBDA 4LEFA 4FB7A 4AX7A 4R5EA 2YFNA 3AXIA 2RKXA 1ZL1A 4DZAA 5H8MA 4LA1A 1W3JA 1W32A 4PRTA 3CIWA 4FZIA 1K02A 2Z27A 4NJHA 2OZ8A 3H7UA 4Y6GA 4E8DA 2MANA 1VBUA 2BGQA 4RL3A 4NUWA 3M0LA 4E5TA 1W3KA 1SM9A 3S6OA 4ML4A 3VCNA 1B57A 2VTFA 3SGGA 4U4MA 5DCBA 1KM2A 3VUPA 3TTOA 1CT5A 2NVDA 4KF1A 4OVXA 3W85A 4DWSD 3I4EA 3B8TA 4CNSA 5ECVA 3NUKA 1NEYA 2JALA 3NZPA 4N6FA 3S1UA 2RDWA 4QLKA 3RO8A 1GV4A 4BWLA 3OB8A 1UA3A 3EKLA 1EL3A 3R7MA 4GO8A 3L21A 4OTKA 3RGTA 3SZ8A 3U2EA 4UTTA 1RD6A 1VFMA 1US2A 1TX2A 3VNKA 3DKJA 4GCAA 2VO5A 4XZMX 3H4GA 4LW7A 3NS1B 4JCLA 1OT2A 2EPKX 1GERA 1MNSA 3W25A 3ITYA 1E6QM 1KR1A 1C91A 1XHGA 3F2CA 4DAIA 2IS7A 3B0VC 1LDCA 3MSRA 4B5VA 3N12A 5HNRA 1FH8A 3HG5A 3VIKA 1K9EA 3AMCA 3G1FA 2VMFA 3NAVA 4ZA0A 4Q8MA 4H6EA 3C2YA 3VGDA 3P8IA 2YXOA 2R94A 3NXLA 3TZFA 3CU2A 1ESWA 3HM7A 4H9VA 2Z29A 3E0FA 4NNCA 3CT2A 4H8HA 9RUBA 4EQRA 1F6PA 1SR9A 2D0FA 3L66A 2CC0A 4WIWA 3LI1A 1S7MA 3MTWA 3W7IA 1YQ2A 4F0HA 2HDJA 1NJJA 3CTTA 3BAKA 2C8NA 5D8ZA 5DXYA 1T0OA 2PWFA 3WQFA 3IK2A 1T41A 2OZ3A 2VC9A 7PTDA 4ROPA 1ZJBA 5AYXA 4AVFA 4JQ9A 3EWXA 3CQIA 3SURA 3AIQA 3UA4A 4HSNA 2J8TA 4A3YA 1XLBA 1XC6A 1V3LA 4DWSB 3H24A 4NASA 1Q4WA 3AIBA 3NPXA 4CCDA 3WEOA 2HEJA 3OQEA 3LPFA 3FXYA 1TO3A 3LI0A 2GQAA 2ZUNA 4FHAA 4BR1A 2ZWZA 1UJPA 3RMJA 3GRSA 2FGZA 4XBKA 3U2OA 3QXBA 2QUVA 3G8EA 3N2BA 4OJYA 4WDTA 3QF0A 2V0TA 3BE7A 1UWUA 4LUSA 4ML9A 3XISA 4ICCX 2J7HA 3GQYA 2J25A 4NHVA 3QKEA 4CD7A 4CGTA 3PFMA 1H09A 1JF6A 2AL2B 3WF1A 4CVWA 4X9SA 3R13A 1MQQA 1V03A 1XINA 1OC5A 4QGCA 4EXAA 1XKYA 4MUZA 5BMXA 4ICMA 3HO8A 1TKKA 2VCBA 1JGIA 2I56A 3HV8A 3TFCA 1ISXA 1N8WA 3WQ6A 4JTAA 4U33A 5CEWA 2W92A 3GYCA 4MKSA 3MKCA 2NQ9A 1EP1A 3CL6A 2PAJA 5GRTA 2DZVA 2HQMA 1S5NA 4KMQA 4P8UA 1LL4A 5BXPA 1WA3A 1TCMA 1UIOA 3U0HA 4Z2IA 2QEZA 1FWBC 4IMGA 3URBA 1GVYA 1PTAA 3W7OA 4M19A 3SDOA 2B7PA 3NCOA 2G97A 3TYEA 2JIWA 4OHQA 2W66A 4XTDA 1MSSA 3GHUA 2J78A 4KFPA 1CNVA 1EF3A 3EDEA 8XIMA 2WJFA 3VIHA 1L8NA 4WY0A 1XBXA 1T5AA 1AZ2A 5AHNA 3TCEA 4PTMA 4QG8A 3H26A 1JDFA 2YL5A 1VEMA 2GFTA 1KCXA 2WZHA 4PUDA 3P80A 2PBGA 3GVGA 4FLQA 2DQXA 3ENLA 3V75A 3UZZA 4N4PA 4GJIA 3OYZA 2HE5A 2E1DA 2FTPA 4L9ZA 2DZTA 3YPIA 4AWSA 3FYPA 3UJSA 3ARQA 4GYKA 5BU9A 1K8YA 1TPH1 1VAHA 4W5ZA 3C6CA 3RN6A 2WNQA 4J2MA 1JZ5A 2Z1VA 1IR2A 5H2ZA 2RHGA 4ADWA 3WENA 1TWWA 2PDXA 4DJEA 1GRHA 1Y5WA 2XH0A 3NPUA 4US5D 1VHNA 3W28A 3EWYA 2WKGA 4M6UA 2HXUA 2IPFA 4WK9A 3GSMA 2WM0A 2WNNA 3C2OA 1JPIA 3CPRA 3DGBA 3A9IA 2OODA 1GZ1A 1XISA 1JL8A 4WJEA 4C91A 1UCWA 1FWEC 3URHA 2ZUUA 4XBSA 3WFAA 1E0WA 4TV6A 5GNYA 2E5BA 1WOBA 1H41A 4ILSA 4MAVA 4U28A 3NR0A 5C7HA 1IF2A 3NTYA 5EMUA 2DSWA 1EIXA 3CPUA 4PA8A 4XAPA 1QOQA 1X39A 3ETRB 4JN7A 2E09A 3STFA 1BXCA 3P67A 4JPGA 4LV4A 1FRBA 3RAOA 4DNMA 2Q02A 3N2XA 4IPJA 1KRAC 1P6CA 5M2FX 3ZSSA 4JTEA 2YL6A 4KRZA 3QV7A 5XIMA 4A8LA 1BRLB 4DZ5A 3ZJ8A 3RILA 1VJSA 3AMDA 1XIFA 3P6LA 3V5OA 3G18A 4JNZA 1FHVA 1JRPA 4E8CA 1YPIA 3V4BA 2JQXA 3GH5A 1OC7A 2F38A 2WOWA 2G4FA 4KIRA 4P2VA 2RJGA 3AYTA 5GVJA 3VIJA 3EOEA 4EXBA 5HMEA 3DENA 3VZYA 2OEKA 3K46A 5A8GA 4JEJA 3IAQA 3H2AA 5J5DA 3GY1A 1X8CA 4M3PA 1K1DA 2JIEA 5REQA 3LCXA 3KDNA 1VR6A 4IFKB 4F3HA 3B9DA 4NJIA 4X22A 3W1PA 4YVVA 1HIZA 1YDYA 1TPVA 1ZZMA 4RW3A 5FJPA 2OFJA 3NPVA 4IHCA 4LIIA 4ONVA 1VLWA 3VFLA 3GTNA 4NJKA 4XD4A 1H49A 2DT1A 5DELA 1BG9A 3RLUA 5BXTA 2GGGA 1TZ7A 1T3QC 3PB0A 1BYCA 4FPSA 2VX6A 4GCXA 1YTKA 4A2SA 3SFKA 1EC7A 1D8CA 2V5DA 1GPWA 3MWCA 2ZYFA 4JTHA 3CO8A 1V6WA 2XG9A 3EDKA 3R5EA 2CZVA 5CKSA 1BTCA 1UYQA 5EMYA 1YNYA 4PUNA 1AH3A 2OMAA 5JBDA 1S2CA 3HF3A 3O6DA 4UMBA 5DCEA 5G1YA 5BOFA 3CPGA 4MYAA 5ABTA 2R82A 4XSLA 4CQ9A 4FX9A 3FN9A 1NHPA 2V3AA 1W5MA 5FF2A 4GQ0A 3S42A 3DGRA 3L4WA 4C6OA 3G1RA 3MI3A 3FEMA 2HV5A 4BK9A 3NYDA 3WD3A 2JGQA 4MGGA 5GJNA 3I3EA 4DF2A 4GX9A 3GDKA 1OG6A 5A6BA 3AZTA 2ISVA 2O4QA 1GKPA 3ARWA 4AD0A 3C4UA 2ZVRA 1UMYA 2VX7A 3G0XA 1TYGA 4G9PA 4R27A 2NWSA 1H5VA 1HO1A 2A3HA 5A2AA 3ZO9A 2RDXA 2R24A 2OG9A 2WK2A 1UWAA 3PWIA 5FJRA 3U7BA 3UJ2A 3IUIA 3GD3A 3O7UA 3EB4A 3WG6A 4H9UA 1J9YA 1HKWA 1ONXA 4QEHA 1J0KA 4QNEA 1A3WA 1XH2A 2OLSA 2AGKA 3E5BA 3HGSA 3REQB 1UKPA 4EAYA 1ADOA 3E02A 1K9TA 3QZEA 3UESA 2DW6A 3OC4A 4XZHA 4TQTA 1SW3A 4Z1BA 2GJNA 4LNCA 4MY1A 2FVLA 4JIPA 3HG2A 2AMXA 3W6LA 4LSBA 1X38A 4BQ3A 2YDSA 3HGJA 3R0UA 4PGLA 3CJPA 1B0IA 1VPQA 1GREA 1UW9A 1SMAA 1PEZA 5FKYA 3AFBA 2Y6ZA 1FCVA 3DN5A 3SGZA 4M7SA 4ZBCA 3B8VA 1SZFA 2DSVA 3RLGA 4W87A 1KA9F 3W1TA 3S3GA 5LA2A 1EEPA 2PDPA 4MG4A 3W70A 1EX1A 4K38A 3CUGA 3EOSA 4K36A 4C6NA 1OQFA 3CL7A 4UFJA 4PRRA 4KRUA 3Q45A 4D6GA 1XFCA 1V02E 4CEUC 2BDQA 4WX2A 4R7JA 5AC5A 3QSRA 1YEYA 4DM2A 4V27A 1GEHA 1GRTA 4B5XA 1T8QA 3W71A 4OBSA 3ES8A 3CO4A 4KEUA 1WO2A 2HMCA 2ZZ4A 4IUOA 1V4YA 2AL1A 4J4KA 3L5LA 1KM4A 2BY1A 2PD9A 2ODOA 2WCAA 1HL8A 3OBKA 5F4XA 4LS1A 5I3HA 1UKOA 4C6QA 4W84A 4OV9A 5HJLA 1PZ3A 1S39A 2J13A 3GDLA 3N9SA 1QNVA 3TCSA 1HKMA 3W01A 1PXGA 1V97A 3DC0A 3PBUA 2RUSA 3ARXA 1S3HA 5BYWA 4HBKA 2NQ5A 2D0HA 3VX1A 3NL2A 3UWUA 1W9PA 1IV8A 2FKPA 3W1AA 4FIRA 4TIMA 3CGEA 3Q4DA 3TW6A 1ISYA 1VBGA 1QJWA 4HGXA 1CLVA 3MMTA 4D2JA 4D6JA 3AXKA 2TRSA 1OBAA 1YTEA 2W79A 4PMUA 3ARPA 3WO8A 3MHGA 3KRZA 1WXJA 5JIPA 2A7RA 3GUWA 2MUCA 3AYRA 1VPYA 3E5PA 1MDLA 1YE6A 4AEFA 2BC1A 5KTLA 1R46A 5ABEA 3N4AA 2NQLA 3C52A 3PC0A 4FOKA 4XAFA 2O9RA 5IOBA 3MHUA 4KCWA 4C6IA 2IXUA 1MO9A 1REQA 3IJ8A 1V7AA 3T55A 1EGZA 5FAGA 1P0KA 1OGGA 3PNUA 8A3HA 1NOUA 1UHVA 5CGMA 1MQPA 3N2CA 2YBTA 3R2GA 5E9AA 3VIGA 1OFBA 4M6QA 2GPTA 4PMOA 1C3FA 4PE8A 1TPWA 3TTQA 3WF3A 2RDUA 1OFQA 1I0DA 4MWAA 1ALDA 1W2PA 3CH9A 5I24A 3EX1A 4DF1A 2X09A 3UWEA 4PN2A 1DTNA 3MW7A 3VE7A 4PFMA 2G95A 1M7JA 4CQAA 5K3VA 1RM6B 4DIAA 2EBNA 1W1VA 3KS6A 5EGRA 2XGBA 2C1IA 1TR1A 2XN1A 2Y70A 3RMEA 5BZAA 1NTHA 4PMJA 4FEZA 4WRHA 1FWDC 3NM3A 2R6OA 1E5NA 3CM4A 2ZXQA 1ICPA 3TNOA 5GNZA 4QE4A 4WJXA 3N04A 2ZUVA 2GGEA 3OZYA 4GYPA 4IQEA 3KOYA 5JH2A 4Z2GA 1FWAC 4TVDA 2AOSA 4NXKA 1PTDA 1GHRA 3HG4A 2D23A 1OCJA 2PDKA 2TSYA 2OB3A 3U5YA 1YRRA 2GL5A 1X6LA 3VD4A 1XLLA 4KGJA 4MDOA 4I6VA 5CBIA 3GR8A 1DWIM 1H2IA 4JD4A 3QR3A 4IFOA 5D30A 1TUFA 2NQHA 1QPOA 1KNWA 1H1YA 1LUCB 4PYSA 3NYZA 3OODA 4D8AA 4IGMA 2E0PA 4Z17A 5BCAA 3FGCA 4EOUA 3T08A 4P8XA 3RXZA 1MNZA 3O05A 2J8GA 3ITXA 5KEZA 3WFZA 1WXZA 1G67A 1BYBA 4XV0A 4AZCB 2QPXA 2GSHA 3PUOA 3MUZ1 3TFXA 1SR0A 3EDJA 4LNYA 2WVUA 2Z1SA 4NJJA 2QQ6A 3UXDA 1PUDA 4UZSA 1HJUA 5FEZA 3WQOA 3FAWA 4Z42C 1EQPA 1A3XA 1SFJA 5LIYX 5AC8A 5EU9A 2QAPA 1X2GA 4FLOA 4TOQA 2J88A 3QGKC 4H4WA 1N63C 2WC4A 1QNOA 2DSZA 3DH7A 4LYRA 4N9DA 4CNOA 2FZ8A 1X6NA 4ICNA 2XGIA 3PUDA 1QRQA 4JTQA 3QFWA 3DEQA 3OBEA 4KCUA 5JCKA 1RP9A 1B31A 3TW7A 4US6A 1HW6A 4O10A 1WQ5A 3S1WA 3VKAA 2Q8XA 3VIFA 4OQVA 1W1PA 4FX6M 1R9XA 3TYUA 1PX4A 1ECQA 5B80A 1U83A 1DJWA 3WLQA 2PPGA 3S1GA 4JTLA 2WYSA 4PUMA 4QSFA 2WPEA 4AIBA 2FYMA 4PODA 1W1IE 3VOJA 3O3RA 3UGRA 1H1NA 1QPKA 4LRSA 1KN0A 3F5KA 4AHOA 4IIFA 4GY7A 4DRSA 4A3RA 5LKYA 2QIWA 2OYMA 3MDUA 5DT5A 1GW9A 2C19A 3KHDA 3QM3A 3WCZA 3GXTA 4ES4A 1F8MA 3T6CA 1F61A 2XTKA 3SB0A 3W2JA 2HTMA 2BV9A 4HCLA 4XKYB 5A5WA 1DIDA 5C2GA 3LADA 2YLAA 2X7VA 3ZT7A 2WVVB 1J11A 3GD6A 3TC3A 4OZOA 3AYSA 4LX4A 1JULA 3B97A 1ZK7A 6ENLA 1UOZA 3QFEA 3KZPA 3VNDA 3LU2A 3B0YA 1L6SA 1EA9C 1JRCA 4JNMA 1B5TA 4CNTA 2QCDB 2RJHA 4NILA 4UFLA 4GABA 1QW7A 4FOJA 3GU2A 3CLMA 5A8QA 1O68A 4QDPA 2YZRA 1V93A 3VGBA 2ZZ3A 5LHFA 2EAWA 4G8TA 3BLDA 4NAFA 1UD6A 4C6EA 4F66A 3OU8A 1GKRA 5CSYA 2QIIA 2CU0A 4MB4A 1UWQA 2WMGA 2ZZ2A 3PULA 4LBRA 1JEZA 3VABA 3WK2A 4DY1A 3C2EA 1K6AA 4ZB0A 1RK6A 3K4AA 4X63A 1J96A 1B3VA 2EHHA 1EPVA 3GIYA 4XIAA 3WUEA 4GE8A 5KZEA 1QNSA 5FJUA 4G7FA 5LXXA 3TTEA 4IL2A 5A6KA 1TVLA 3QPEA 1WZAA 1I1XA 2EG7A 1PWMA 3EMZA 4HPJA 2QPSA 4LUTB 4XVEA 1H1ZA 2D2GA 1RSCA 3JR2A 4FXJA 3DBPA 2X7WA 4H9ZA 3NSXA 3HMCA 4FNPA 2D3NA 1A80A 5EA9A 2W61A 1GVRA 3KLKA 1JZ7A 5LNWA 5HWJA 3WK3A 2YLLA 4AZ5A 4DELA 4LYKA 5CCZA 3WUGA 5F7UA 1DL3A 1LP6A 1XUZA 1ONRA 4B3ZA 1YDNA 4AYGA 1W3IA 4FI4A 5CPNA 1E0XA 3IJIA 4HOXA 4GD0A 3H21A 1V59A 3COTA 1NFGA 4GI9A 5A6TC 2ACUA 1S2TA 4YTUA 4FR1A 4GLEA 1E72M 1J2BA 1RHCA 3HPXA 1TX0A 3LGDA 1EDQA 4UQ9A 5L9FA 1X98A 3CGCA 3H6OA 2WPCA 3KCLA 2ZFAA 2OQYA 3BC9A 3LTPA 4JX4A 4DWSA 3A23A 2PTXA 2KAUC 2HISA 1KTNA 2PWEA 4AD4A 4NZCA 5A94A 3QV9A 2GWGA 1IYXA 4ZO6A 1OFEA 3DI1A 4GUFA 5LSMA 1UMLA 3LHWA 1T8XA 3HPAA 4AY7A 3NZQA 3UWQA 1KM5A 1GVIA 1BGAA 3W81A 3BW2A 3MUAA 4N9BA 3THUA 4GZIA 4BV6A 3RM4A 3PHAA 1JXJA 3FX4A 4H01A 5LIUX 4W86A 4Q3MA 1TVPA 4NYYA 4XAZA 4Q6JA 3B4UA 3CYJA 5CJMA 4RNHA 1OK4A 4W9TA 4WGHA 4WVXA 1NDWA 1KKOA 3IRSA 1QT1A 1GYMA 1EXBA 5CPMA 2C14A 3BLIA 3C8NA 1FDJA 2DIEA 4C1NB 3NQ7A 1OGBA 2SFPA 2YA0A 1DPMA 3P61A 3LM7A 1KRCC 1W17A 1YPXA 2NX1A 1OB0A 3OZOA 2JEQA 3N15A 3HZ3A 3QHMA 2WMKA 1K7EA 4RV3A 4YCOA 1RD5A 1WB0A 1MZHA 4I7UA 3ABRA 3IVUA 2VFDA 3G5EA 2WW5A 2BBFA 4IJBA 2ZRVA 5FIPA 4X61A 1W5NA 3THDA 5G5HB 1V3MA 1WZMA 2AKMA 1K77A 2JKPA 3N6QA 3IV8A 1S5VA 1ZCCA 9CGTA 4WDUA 4RDZA 3DFOA 1DQUA 1AQMA 4QLJA<