1BQGA

The structure of the d-glucarate dehydratase protein from pseudomonas putida
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
411
structure length
399
Chain Sequence
GAPVITDLKVVPVAGHDSMLLNLSGAHGPLFTRNILILTDSSGHVGVGEVPGGEGIRKTLEDARHLLINQSIGNYQSLLNKVRNAFADLRIAVHAVTAVESALLDLLGQHLQVPVAALLGEGQQRDAVEMLGYLFYVGDRNKTDLGYRSEHEADNEWFRLRNKEALTPESVVALAEAAYDRYGFKDFKLKGGVLRGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTKEPLQIKGGLVEVPKKPGLGVELDWDALMKAHEVYKSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the enolase superfamily: crystal structure of (D)-glucarate dehydratase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Glucarate
molecule keywords D-GLUCARATE DEHYDRATASE
total genus 129
structure length 399
sequence length 411
ec nomenclature ec 4.2.1.40: Glucarate dehydratase.
pdb deposition date 1998-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bqgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bqgA01
3S47A 3P3BA 2QJMA 3RITA 4Z1YA 4H1ZA 3THUA 2OVLA 4J1OA 4IP5A 4MKSA 4IHCA 3CXOA 4DXKA 3P93A 4HNCA 3FYYA 3BJSA 3I4KA 4EWJA 1FHVA 3IK4A 3MWCA 2AL2B 2QJNA 2P8CA 4H83A 3DG3A 2DW7A 4HNLA 1TKKA 1TE6A 3HPFA 3D46A 1JDFA 3ZLFA 3JZUA 4A3RA 2XH2A 2DW6A 3TOYA 2PTZA 3NZGA 4ZA0A 3R1ZA 1KKRA 3B97A 4E5TA 2PMQA 2ZADA 4DX3A 2PP3A 3FVDA 6ENLA 1XS2A 1BKHA 3N4EA 3I6EA 3FV9A 3NO1A 3U4FA 3DFHA 3UXKA 1ECQA 3MUCA 5FJUA 4GYPC 2PU0A 4KT2A 3Q45A 3UJSA 4HCHA 4JHMA 2QJJA 3VDGA 1EBGA 3JW7A 4HN8A 2P0IA 3QLDA 3UCDA 3VC6A 4E6MA 3T8QA 1W6TA 3FJ4A 4MMWA 3ZLHA 3ZVHA 2PTXA 2PGWA 1JPMA 2PCEA 2QDEA 4GIRA 1DTNA 2ONEA 2PS2A 1WUEA 3ENLA 1SJDA 4G7FA 2XH0A 1KD0A 2HZGA 1NU5A 1MDLA 2PODA 3N6HA 2PPGA 2CHRA 5ENLA 1RVKA 1JCTA 3TWAA 3R10A 3H8AA 2GGJA 3TWBA 5BOEA 4HCDA 2PP0A 2AKMA 2GGIA 2NQLA 4GMEA 3PWIA 3OTRA 2OX4A 3OW1A 3DG7A 3STPA 2O56A 1XPYA 2GGHA 3ZVHB 3UJRA 2HNEA 2P3ZA 4E8GA 4JN7A 2XH7A 3ES8A 4IL0A 3DDMA 4JN8A 3TJIA 3R0KA 3CK5A 3VC5A 3VFCA 1L8PA 3OPSA 4IL2A 1MNSA 3GY1A 3ZVIA 3RRAA 2PU1A 1ONEA 2POZA 3QKEA 4DWDA 1P43A 3T4WA 2AKZA 3NXLA 4GGBA 4YWSA 1EC7A 2OZTA 3SN4A 4ZCWA 2MUCA 3GD6A 1WUFA 4HCLA 3U9IA 4A6GA 3UJFA 2AL2A 2QDDA 1BQGA 2XGZA 1EC8A 2OZ3A 1FHUA 2OZ8A 7ENLA 3V5CA 4A35A 3IJIA 4ROPA 3T6CA 5IDZA 3ZLGA 3SN1A 2GDQA 2P88A 3PFRA 3TTEA 3R25A 2QVHA 3QN3A 1EBHA 4HPNA 3RR1A 1KKOA 2MNRA 3TQPA 5J04A 2PP1A 3ES7A 2GGGA 3N6JA 4MGGA 1SJAA 2AL1A 4GGHA 1NELA 3OP2A 3DESA 2HXTA 4H19A 2FKPA 4KWSA 2RDXA 5FJRA 3NFUA 3V5FA 1P48A 2ZC8A 2OKTA 3R0UA 3GC2A 3V4BA 2OQYA 3KUMA 1KCZA 3EKGA 3VCCA 1TZZA 4F4RA 2PTYA 3S5SA 2GL5A 4GFIA 3T9PA 3UJ2A 5BOFA 3GO2A 2XH4A 3MY9A 2PTWA 3EEZA 1SJBA 4J3ZA 3JVAA 1SJCA 3RO6A 4K1WA 2QQ6A 3IJLA 3VCNA 1YEYA 5FJOA 4DN1A 4DYEA 2PGEA 3D47A 3H70A 4GYPA 4HYRA 3MSYA 3TJ4A 4GISA 2OFJA 3FCPA 4K2SA 3TW9A 4E4UA 4KEMA 4X2PA 1IYXA 4M0XA 4Z17A 3H12A 3Q4DA 3PWGA 1OEPA 3H7VA 2OG9A 3CB3A 3RGTA 3MKCA 1R0MA 3UXLA 1PDZA 1EC9A 3MZNA 2QGYA 3UCCA 2PSNA 3DGBA 2HXUA 2FYMA 4FI4A 3N4FA 1MRAA 3CAWA 2OLAA 3FXGA 3UJEA 1R6WA 3R11A 1F9CA 4IP4A 3DFYA 4IT1A 2GGEA 3TCSA 1MDRA 3DG6A 3CT2A 3SQSA 3SBFA 3DIPA 2P8BA 3CYJA 2GSHA 1PDYA 2I5QA 3SSZA 3P0WA 3SJNA 3MQTA 2PA6A 3K1GA 4H2HA 4IZGA 5FJTA 4KPLA 3IJQA 3BOXA 3SN0A 3BSMA 3V3WA 1MUCA 2XSXA 5EU9A 3I6TA 2OPJA 2OQHA 1E9IA 4E4FA 4ENLA 3QTPA 3QPEA 3DEQA 3OZYA 5FJPA 2OO6A 3UGVA 4DHGA 3DERA 1ELSA 3RCYA 4M6UA 1JPDX 3OZMA 4G8TA 4FP1A 3PK7A 4K8GA 3VA8A
chains in the Genus database with same CATH superfamily
2ZXBA 5JCIA 2E5CA 4TO8A 3KDNA 3W3OA 2QJMA 4NAFA 3BAIA 4ZQNA 3FNDA 3N6QA 4GOAA 4H1ZA 3H2NA 5LKYA 3K8LA 3UYIA 1UZ1A 4Y9MA 1V93A 5U7SA 4AWUA 2PF0A 1QWKA 4JQ3A 3C3UA 3VD7A 4UOZA 2B7OA 4AVFA 4B2DD 2GK1A 4QXIA 3RJXA 4IPPA 3TYEA 2WZTA 3KHDA 3WH9A 4ZOEA 3D46A 4WXYA 2PDIA 3WEOA 2DW6A 3CHDA 4O0QA 4C5YA 2PURA 5AHIA 3AIWA 1RZMA 5CC5A 6ENLA 3DCPA 2NVKX 3BANA 4L80A 3H55A 3WNKA 5FAJA 3HPXA 1JNEA 5H8MA 1TPEA 5KZ6A 4FIQA 1Q13A 3V7PA 1CGTA 4B91A 1ECQA 5M1TA 4GYPC 2GUBA 1NDAA 3LTPA 2R14A 5EBUA 1E9LA 1SZRA 2V3FA 3VIFA 2YW3A 2J25A 2XZ7A 3C2OA 4H7ZA 1FWNA 3R94A 6A3HA 1EBGA 1GZGA 5JH2A 1IGSA 1NJJA 3TJLA 1PYFA 2YL9A 1JIBA 1ZBKA 2PDLA 1AL7A 3M44A 2PDJA 3B9DA 3QEZA 1P1MA 3N3TA 1CXIA 2QAFA 1KBKA 2UY2A 2QZRA 1NFPA 3JUGA 4R88A 4GVIA 4HU4A 5FAGA 1JL8A 4YTTA 4BURA 5AECA 2PBOA 2ATMA 5HDRA 2ZZ4A 1GVOA 2GGJA 1GG1A 4HCDA 4PBGA 2X05A 1JCNA 1ITUA 3R13A 3OC4A 4PRTA 3STPA 2P50A 4IGNA 3FIGA 2XUCA 4ZTXA 3OLIA 5GPRA 2X1TA 3BZGA 1FUYA 2XN1A 4K6AA 1UP3A 2QCCA 4GG9A 3R0KA 4JNYA 4CNPA 2F7FA 4N9CA 3V0SA 3P0XA 4GX9A 2Y0FA 1POKA 4PMQA 4YL2A 1ISVA 4YTSA 4LY4A 5C7HA 3T4WA 3S2NA 4DWSB 1R8LA 1SFLA 1HTIA 1Z8AA 5CZJA 1KRBC 1QPKA 4ACYA 3A5VA 3W7DA 1ICSA 5AVNA 4YVPA 3IEBA 1S2UA 1B3WA 3S1GA 4AF0B 3DBNA 5CH9A 3KDOA 2WPGA 3U9IA 3UJFA 1XLKA 3N3MA 1KM6A 1GOQA 4JEJA 4OHQA 1GW9A 4A3QA 1DXLA 1E4MM 4ZZ9A 2IXUA 2ABBA 3N73A 4ZQCA 3RO8A 3PZ9A 4O13A 1H2JA 1UWUA 3MUXA 3NCOA 4H4PA 2ATSA 3GNRA 3KBMA 4QBXA 3WQOA 1YRRA 2HV5A 5BROA 4YMZA 2YA0A 1T5AA 2WQPA 3LCGA 3LLXA 3VDBA 1IGWA 2XU2A 4QRNA 5H1WA 1POJA 1JFXA 1A0DA 4Q32A 4HYWA 1EBHA 2PTDA 3EX4A 3UVIA 1QOXA 2VX5A 5AKQA 2PD9A 4Z0JA 3LLDA 3ES7A 1X38A 5D4YA 2GJLA 1MYRA 1R38A 2VNCA 3NQ6A 5FF2A 3QJAA 1I0BA 1I2OA 1QJWA 3B05A 2Y8UA 5BRQA 4M19A 1U5VA 1IXPA 4NZFA 2ZTJA 4IP7A 3VNYA 3KE0A 2WKGA 3GG8A 4L5ZA 4HT3A 3VNJA 1UR3M 4OIFA 3CB8A 3HOJA 2V5KA 3EOEA 4F4RA 3R8RA 1OY0A 1MO9A 1K4QA 1QT1A 4GXPA 3NVTA 2QNEA 5JBDA 1EHNA 3WKZA 2H9AB 4TTUA 3LXAA 3GR4A 3NM1A 2ZKMX 1GV4A 2C6QA 2Y61A 1XBXA 2W91A 3QV8A 1MFUA 2QMKA 4DYJA 4Z2JA 5EBKA 1PIGA 1DXIA 2YVFA 4JFSA 1VJSA 1ZKQA 4R27A 4IGSA 1JZ4A 5BRBA 1JUKA 4HBKA 2JEQA 3EB4A 4AXNA 3WLJA 4GYPA 3DHDA 1WDPA 1LT8A 8XIAA 1E1FA 2H90A 3K5XA 3ZYZA 2X30A 4DPQA 3W38A 2QUNA 3GFYA 1RP9A 3G1FA 2UY3A 4J3UA 5EMKA 1IXQA 4DJEC 1GREA 2CZ5A 4PCFA 5D9NA 1XYLA 3T44A 2ISDA 4Z17A 1BF2A 1ZX9A 1KM0A 3EDDA 4PMDA 1IEVA 1FRBA 1OHLA 5I5RA 5I09A 4MYXA 4QCEA 2GJRA 1K9EA 2VJXA 2O4QA 4K7ZA 1B31A 4J9JA 4GUJA 1B4EA 3PG9A 4ZVJA 2XGIA 3CV6A 1F6YA 1TX2A 4G7EB 2YBVA 4IT1A 4EPDC 2WP6A 3VINA 3TAKA 5CLTA 3SQSA 3C6CA 4HYVA 3T42A 2BVYA 1Q63A 3M5YA 5JMUA 5AC8A 3W7IA 4C6OA 1FECA 1FH7A 3O7UA 3KOWA 2D23A 3LY0A 4BS0A 3H2OA 3GIPA 4Y7EA 5A6SA 2CU0A 3SN0A 1OSEA 1XJBA 2W79A 4I3GA 4C91A 3MZ2A 1GVIA 4Q22A 1ZQ5A 5DXYA 3QTPA 3QFAA 1CWYA 3GH7A 3DEQA 4Q8MA 3RILA 2NV1A 4ATWA 4RV8A 4AWTA 3UGVA 4QG9A 3HTWA 4G8TA 3STEA 3PK7A 3KOYA 1JAEA 1SU5A 4ROQA 1HJWA 3EEGA 1TV2A 3S1UA 1RLDA 1M01A 3MU7A 2OVLA 1EUAA 2WMHA 4UTTC 3UF9A 1V08A 3M5ZA 3WQGA 5IFPA 1QVBA 3PUGA 2OEMA 3WLLA 4H4TA 4CNNA 3HU7A 4W8BA 1UWIA 3M0LA 5HXMA 3VGFA 1DJZA 3NO3A 2B7NA 2PF8A 3L4XA 3W25A 4H50A 3HPFA 4X2RA 3FFSA 2YVJA 1P1XA 4DX3A 1FWAC 3GNNA 3DJJA 1OGGA 4XZ9A 3UY7A 4I5XA 3Q37A 1X39A 1UQYA 4PMZA 3WY1A 1GYNA 4RPPA 3TQKA 1AOGA 3MP3A 2PU0A 1HKJA 4XBSA 2J7HA 4NNBA 2CWXA 1O1HA 4IMGA 2XIBA 4X9SA 1OG0A 3P74A 4JHMA 1XIFA 4YVXA 4KWWA 3UERA 2J7CA 1NOUA 7TAAA 2Z1VA 1VBRA 2J3NA 4RZBA 2W3RA 2PWEA 4RZ5A 2DSUA 4NRSA 3NSXA 3RCNA 1B3ZA 4XSLA 3W7RA 3QFBA 3ZVHA 2YXOA 3QBUA 2PTXA 4EQSA 1XP3A 1P7TA 4C1LA 4O28A 2PUZA 1KLZA 3VMOA 4YCOA 4Q3MA 1US0A 2EKCA 1E6ZA 3G1YA 4KMQA 3W4RA 3E2VA 1MDLA 3C86A 1Z89A 3OVRA 5FCZA 4BHYA 3W7JA 1X8FA 4RK8A 3NRZB 2X1SA 1GKQA 3KBVA 4X60A 2AKMA 1MW1A 3VZZA 4ADTA 4RNJA 3SGZA 2ON3A 1HP5A 3M6DA 4HA4A 4B5SA 5AY7A 4AH7A 4XAZA 3VC5A 5DLCA 3GFXA 4OV4A 3A13A 3GNPA 1BZLA 3EBVA 4AZGA 4JR5A 3VFCA 3OB8A 1G01A 4Y9NA 2WZMA 3F5JA 3H4XA 1PS9A 3UD6A 4TVCA 2ZUTA 5E93A 4ZSTA 2EQ9A 1CXEA 4L56A 3PWAA 1WOBA 7CGTA 4QCFA 3MT1A 3DYOA 3ELFA 1J18A 1W32A 2WP5A 4Q8PA 1CW2A 4XBJA 4PCTA 2BOEX 2BVWA 4FZIA 1Z9AA 4OQVA 2ABAA 3W6YA 1BXBA 1UA3A 2W61A 1JI1A 1EL3A 2WOWA 2E9LA 1T96A 5FD0A 4XWUA 2Q8XA 2DORA 1WAUA 4PE8A 1BHGA 1EEPA 4JYDA 3W7EA 3BMXA 4WY0B 5CPMA 3PNUA 1XF0A 2D0HA 3UYCA 1XCWA 1TTJA 1Q8AA 3EPMA 4FLRA 3W2MA 1UMYA 4B3KA 5HQEA 2J6VA 1SSGA 4INFA 3A4XA 2BHZA 4P61A 1CZ1A 4HPNA 1QI2A 4UOJA 1GSNA 3WJYA 1JR1A 4AWSA 1KW1A 4H4RA 1OT1A 3M9YA 3OP2A 1NHSA 1GOOA 1BWLA 2FKPA 1ICPA 3AMDA 4KWSA 3IVUA 5CC3A 1EJXC 2ACSA 1N60C 3P81A 4DI8A 4JQ2A 1R30A 1OYCA 2O7SA 3PUDA 4UNIA 1SGJA 2PTYA 5E0FA 1VEPA 4NRRA 5BOFA 2GYIA 3AIEA 1DE6A 3JRKA 3CL6A 1NDZA 1SJBA 3TN4A 4Y9OA 4O17A 3UR8A 1UA7A 1NHRA 3IRSA 3KTCA 2QUUA 2G96A 1TV8A 3CZEA 2Q8LA 1YNQA 2VWTA 3CV2A 1RHCA 2WHJA 1ZHAA 2D24A 1MRQA 4JKKA 1TVLA 3ABXA 2WAGA 1F07A 1UKOA 4CNTA 4O16A 1LOSA 4B9YA 5HJLA 5A95A 4CD8A 3DKLA 3MVTA 1MVYA 3VIHA 3OJGA 3MSRA 4B4HA 2QCDA 1QI5A 5K2ZA 3B04A 4AU0A 4UQBA 1KM1A 1YADA 3OA3A 1DIKA 1QATA 1JD7A 1RA5A 1UIOA 3FXGA 5FS9A 3TVAA 3R11A 4PB3A 1ML1A 5EBAA 2VENA 3O1NA 2WCAA 1DIEA 4Q33A 4NXKA 3GXMA 3EKLA 3G1HA 1XLHA 3TCSA 1REQA 3CT2A 1G4SA 3NM3A 1Y8BA 3SBFA 4ZOBA 1M9HA 2X16A 4A8LA 3VNZA 3T0BA 1KM4A 1OGSA 5DCDA 2RHGA 3H21A 4J3SA 3NL5A 4LVDA 2WVSA 3HG3A 1WDDA 4WKFA 3K1GA 3QOMA 1BLIA 3I7SA 5T9CE 2FVKA 3EZ4A 4NHVA 2EAWA 1UR2A 1PX8A 4GY0A 4MY1A 1JJKA 3BW4A 4MNMA 3A7UA 3W7GA 2CXEA 3QFWA 3VIMA 3TNBA 5ABTA 1Q2SA 4JIRA 3UXIA 3H23A 5CJNA 1VENA 2DIEA 4FS9A 4XAGA 3E38A 2DJLA 3FYOA 1W1YA 5D04C 4GABA 4Q6JA 4HSHA 1FWWA 2AMXA 5FI8A 5I0DA 1TQJA 3LV6A 1H51A 2IMRA 3LCWA 3SZ8A 1T40A 1OJTA 4FP1A 4S38A 3NVVB 2INFA 2FFCA 2YCEA 4YWIA 1BYAA 5A8OA 2BB0A 5KZDA 2QJIA 2R91A 1NFBA 4NI3A 1VFFA 3HGJA 3PSWA 2E3ZA 1S5NA 4PMXA 1B4KA 3BV7A 4C90A 2ZRVA 3F5KA 4U5IA 3ICJA 3EPNA 1B54A 1SZFA 2CFYA 4C6BA 2I57A 4WY0A 5CPSA 4H9TA 1FBAA 3EX3A 1C91A 3UZJA 3UR5A 3O9NA 5E5CA 3GXIA 1VKFA 1KLYA 3GU9A 3THDA 3G22A 2C14A 3NQEA 5DFAA 4RXGA 3HN3A 3PBUA 1AH3A 2YLAA 1T7LA 3I6EA 3DFHA 1Q8JA 4IMDA 3GDMA 5FJUA 3XISA 3M0HA 3KP0A 4J40A 2IQDA 4WKHA 3V18A 2YCJA 3PB0A 1UPMB 2XFRA 2JQXA 4HN8A 1TJ1A 1E6RA 4IGMA 3PB2A 1XIEA 4NAEB 3QV6A 1KM3A 2V0TA 4MUPA 2INZA 3T0AA 4JTLA 2IPFA 1R7AA 4YXGA 1I9CB 4NU7A 3FJLA 4PCNA 4AW7A 5GVJA 4JCLA 1OYBA 1KD0A 3W2LA 2PODA 5ENLA 4CQ8A 2GUYA 3RX3A 1MQRA 2NQJA 3TC6A 3VMPA 5KVIA 3CQKA 2WQDA 1UJPA 3GZAA 3QC3A 1O4UA 5BXTA 1FQ0A 1JQVA 5HQLA 3TJIA 1WZLA 1XYBA 4KESA 3GU1A 2E6YA 3U2CA 1DKWA 3WX7A 2F6XA 1F4HA 3CLMA 3HM7A 1MNSA 4H8HA 4WD0A 2X0HA 4HOZA 1ZK7A 2DH2A 2OU4A 3W28A 2X42A 1MEWA 4HB7A 3NA8A 3NQBA 2VEIA 3KFTA 3NXLA 4IMAA 2DV0A 2ANUA 1H7OA 1IWBA 4ZCWA 3PF3A 4S3EA 2Z26A 4KWVA 3LXCA 1YTKA 5HR7A 1RAKA 4LCSA 1W3HA 3I3BA 5LXXA 4O52A 3PZTA 3F4VA 3C61A 2J74A 4DLMA 3QGVA 3SGGA 1N82A 3PP7A 2QCGA 1E5NA 1XFCA 2PDPA 3VIPA 3SN1A 4R7WA 3M6YA 3R5EA 2G3FA 3AXMA 4IMFA 4CEUC 1BYBA 4DZAA 1GOWA 4AZHA 3MUY1 2YFOA 4ZB0A 3DH9A 4APNA 5D2VA 1KKOA 2MNRA 4MOZA 2WLYA 4NZJA 1Q6LA 1L6WA 2XVNA 1F74A 4YU1A 3SCTA 1GKRA 2VL4A 1N5XA 4IIDA 2OWCA 2J27A 4UQ9A 1LRQA 3VILA 3ZT7A 3O8AA 1OQFA 5JIWA 3R0UA 4WXZA 1NFGA 4LA1A 3SI9A 1KCZA 3M5VA 1FCVA 4CQAA 2CLOA 4TU1A 5J5DA 5EMYA 4JIEA 3IGXA 3SRDA 5CBBA 3CBWA 4ZE5A 4EX4A 3VOJA 3AU2A 3DHFA 1E6QM 3HQ1A 3IGHX 3H4WA 3W88A 3N2XA 3G1XA 2F61A 4FX7A 4D8LA 1GEQA 4QEHA 4WDWA 3GBEA 3E9AA 3TEVA 3LSBA 1Y0EA 2D73A 1KGWA 1W1TA 4U3CA 1JRBA 4NILA 1GOMA 1ALDA 5I3JA 4K2SA 2VX7A 4S3CA 4TVDA 2J8FA 1JCXA 4WDUA 1EIBA 3S2JA 4RJEA 1GHSA 4V1YA 4UMAA 5AVHA 3AS0A 1F05A 2E4TA 3RGTA 3MKCA 4LTSA 5IFTA 1P4CA 1VS1A 3NNTA 2QGYA 4ADUA 1J2WA 3QVQA 2HXUA 3I10A 4FI4A 5AC7A 3GS6A 1XR2A 1XSKA 1Y7VA 1I6NA 1HIZA 1MXGA 4JHOA 2QAEA 3DZ1A 2PLKA 4GJ1A 4C6IA 1E71M 2WCGA 2WC3A 3W7OA 2GPTA 3KLKA 3N9KA 4W5UA 1QNVA 1J0ZA 3DIPA 1EBDA 5MF5A 1U30A 1GERA 1PZ2A 3BG9A 1HQTA 3AYSA 1AJ2A 4HA0A 4GI6A 1I4NA 1XH0A 5I3KA 1XLMA 5C6MA 2QPXA 1Q6RA 3AS1A 2BG5A 3RIKA 2ZZ3A 1XG4A 1TV5A 4RKAA 4V27A 3BSMA 2J13A 1FWGC 2G4JA 3W7CA 1SVDA 4B16A 1TPH1 1UW9A 3JS3A 1E9IA 1XI3A 4JKMA 4HZMA 3BMWA 2DUAA 2CESA 2EPNA 1E0VA 4DJDD 2FZ8A 2P10A 2ZZ2A 5K4ZA 3JU2A 2OGYA 2I14A 3QZ6A 1YQ2A 4DHGA 1KBBA 3DFOA 2AGTA 3KRBA 1TYTA 3CUZA 3PPCA 4BK9A 3UG8A 2NWRA 2FHFA 3P3BA 1SYTA 2YFNA 4AIOA 2Z24A 1HX0A 3OGVA 4UNLA 2P5NA 3ARXA 2XG9A 3NZPA 1JQXA 5I3GA 4M81A 2GH5A 2C16A 2YQUA 1PXGA 2GVEA 2QHAA 3AHYA 1FDJA 4REQA 4UB9A 3IK4A 1FEAA 3L2LA 1ISWA 4ZBCA 2P8CA 4ZENA 2ZRWA 2WM1A 4DB7A 3RMEA 4Q8NA 3EGJA 1E70M 3VIIA 4C6FA 2QV5A 1EXPA 1E56A 2NQHA 4ONVA 1QUMA 4OECA 1JGMA 3AS2A 1TTIA 1IWPA 3O6DA 1MQQA 3BCFA 3GVWA 3QYQA 1UWTA 3MMUA 4DLFA 4QQ3A 5EYWA 4PTMA 1BPLB 1HKVA 4MY8A 1GTHA 3Q45A 5MKGA 4F0RA 3QR0A 2HQMA 5CC7A 4PMVA 2HS6A 4ZQMA 4IPNB 3G5EA 2DZSA 1TMLA 2WHKA 3M1ZA 1UHVA 4YTRA 2DZVA 1FWEC 3NZRA 4IQLA 3UR2A 1V51A 3WDRA 3UCDA 3WQFA 3TIMA 3UPBA 1QNQA 1LL7A 1YPXA 3WQDA 2VEKA 3ZLHA 1CB7B 1EDQA 2RAGA 4CQBA 3M4HA 1XLDA 2QDEA 1PE1A 2F8QA 1YDNA 3WQ6A 1PL9A 3WH7A 1GRAA 2PPGA 1XBYA 1W1VA 2BS9A 4CU7A 1DWJM 3NQDA 3VFLA 1VBUA 1H7NA 3GC4A 4JIPA 2UBPC 1OFQA 3NPXA 1SW3A 4I6KA 4NAFB 2EPOA 4DNMA 4C6JA 3VUPA 4IL0A 3W22A 4NJGA 4GINA 2V8ZA 4V33A 4WJEA 3B9JB 4W88A 2QCFA 3WLIA 4G6CA 3L66A 2O9OA 1UZDA 4UQEA 3NYZA 2Z1KA 5CC6A 4XK2A 3POCA 4IJCA 2XVLA 4XKYA 3T7VA 3EA3A 1JEHA 2WMIB 4N4QA 1GJUA 1FOBA 4JTRA 2PDXA 4LC8A 3WF0A 1PV8A 5C70A 5EL1A 1V77A 4ICCX 5H2ZA 1DJNA 3IGUA 1FWSA 1KFLA 3C3NA 2PAJA 4F9DA 2BOFX 4HCLA 1VEMA 1OADA 2VFFA 5AC4A 3QTGA 4D6GA 2CFFA 2VGBA 1S5MA 1XRTA 5D37A 3W1UA 3TYAA 4NUWA 1F8MA 4FR6A 1Z69A 2R24A 4ROPA 1IT8A 3BAYA 1YLVA 1HO1A 1G7VA 1YDVA 3FAWA 1XISA 5CAKA 4MDOA 2TMDA 4O12A 3UWYA 3TQVA 1Q4WA 2V30A 4XB3A 2EG8A 4JX6A 4XX6A 1GPFA 5RUBA 3TNOA 4DWSD 2ZDRA 2YGYA 1FFUC 4AZBA 3IUIA 3CZKA 5J8LA 2BV9A 2GSJA 2TAAA 3RMJA 2O0TA 2PC4A 4UMBA 3B0UX 2YDSA 4RL3A 5JQ9A 1SJAA 3NPUA 3OG3A 4K8HA 1BTCA 1NQ6A 3SUSA 3IIZA 3KW3A 3V5OA 3DESA 1M68A 1XDLA 4O4WA 3PUEA 5K3VA 1P48A 1UH3A 4UNKA 3E2QA 2DZPA 2J79A 4FDCB 3K2GA 3NQ8A 1N63C 4FOJA 4QITA 4RW5A 3OZPA 3UA3A 2IW0A 4TQTA 5F2LA 3CTTA 1W5PA 5KZEA 5CKSA 1EGVA 4Q8WA 3A24A 1TUFA 3CJPA 3WFAA 1S2AA 3DI1A 1E40A 5A69A 1XKYA 2E67A 4Z2LA 1GGOA 1TR9A 1GRTA 5AFDA 1SZEA 1UG6A 3KVKA 4IX0A 1WQ5A 4C6QA 3K4WA 1ZY9A 2WPBA 2QV4A 4HTYA 5HOSA 1XUZA 3PHAA 1VLWA 1V3LA 3L4TA 2VMFA 3ITGA 3A12A 4GCXA 1THFD 3TW9A 3WK0A 4NNAA 3GVRA 1JGIA 1B2YA 3L65A 4ADWA 8TIMA 3UPWA 7REQA 2CBUA 3UWUA 3TYBA 2VX6A 2D69A 5A6KA 2VVNA 4PZVA 4JDYA 4A3UA 1QASA 1KBJA 1R3YA 1AZ1A 1PWMA 2A7NA 2Y5JA 1I45A 1JOAA 5M3WA 3PULA 1VFMA 1G0CA 2HDJA 4GH3A 1MRAA 2ISFA 4NG3A 2J8TA 2XN0A 3WL1A 1RM6B 3CQHA 3DFYA 2VEMA 5HMFA 1NP0A 4Z2HA 3EOUA 1UB3A 2ZZ0A 2ALDA 2PEVA 3IK2A 3TX9A 4QTGA 5E0KA 1VFTA 1PKLA 2I1OA 4FNTA 2JKPA 4DQWA 1PWLA 4OU1A 3MSGA 1U1HA 1LG2A 1GESA 1LYXA 1BXCA 4H2HA 4AG0A 1OYAA 1NP2A 2Z25A 1AQFA 3W00A 2W92A 2V2CA 1UUMA 4KIRA 3K8KA 4KEUA 4MPKA 1Q7ZA 3QKZA 4TX8A 4LY8A 4IFKB 3BC9A 1PZ3A 3ITTA 5A94A 3W7LA 2X0SA 9XIMA 2OLHA 2JFEX 1UJQA 4B15A 2FB3A 2OLSA 1MQPA 4AIEA 5FJPA 3WCZA 8RUCA 4ATLA 1ZBWA 2QCHA 4G1KA 3N9RA 3W1XA 1V0NA 2C0HA 1E6SM 3RM4A 3LX9A 3DFQA 1ZGDA 4BZYA 4K1GA 3S47A 1WYIA 1R47A 3N19B 4HPXA 2V3BA 2DUXA 4RE4A 4GNKB 2GQ9A 3CPRA 3SM0A 4LUTA 4C65A 3I4KA 3UESA 2YBUA 1TCMA 3T2QA 4S3GA 4IWWA 2OJPA 1SO5A 1WE5A 3MWCA 1O5XA 2E5DA 4WKAA 3DG3A 4MNLA 1FWHC 1R3VA 2BDQA 5F1UA 4JOMA 1DWAM 2FIQA 3ATZA 4A8RA 1AUSL 2ACQA 1K4GA 1EP1A 4ZA0A 1GVSA 2OYMA 3A4WA 1EF3A 4XUYA 3FG2P 5LGZA 4HOWA 1T99A 1WKDA 4M56A 4PMJA 4EIVA 3MKVA 2WMFA 1STZA 3KX6A 2Y8KA 1Q7MA 3ABRA 3CHCA 2EJAA 3FVMA 2D20A 2VGGA 4HOXA 1D2KA 2BY3A 2Y7DA 3FA4A 3V16A 4QJ5B 2O9PA 2HPMA 3LQLA 1ZJBA 4NQ1A 2CLIA 5C2XA 1F5ZA 3WK2A 5G5GB 2BZNA 5FEWA 2IPJA 2V2DA 2JIEA 4XZIA 3PPHA 3VAVA 1N2VA 5KTLA 5PTDA 3A9IA 1ZCOA 4HHMA 2V5CA 5D9MA 3QXBA 2L5HA 4A8IA 4YWOA 4DBEA 3LUTA 4Z42C 1VRDA 2OODA 3EWWA 3GBDA 3SO7A 3N6HA 2ZXAA 3VD9A 4UR9A 5G2HA 4PMOA 3SCUA 2V69A 3TWBA 1H6VA 3LQGA 5REQB 4Q8UA 3TFCA 4EOUA 4AISA 1U2YA 4GMEA 4OJYA 4QSHA 4EAYA 3ALGA 3VIKA 4I9TA 2Q6ZA 3R0DA 4AX6A 4US6A 1EPXA 1N62C 1DIOA 1P0KA 4JN8A 4P8WA 4BF9A 3WBEA 1O1ZA 4QQUA 3KHJA 3VZYA 2REQA 1EA9C 4ZFCA 2NSXA 1UKQA 2PU1A 2QDHA 5HMEA 1UWQA 1C9DA 1P43A 4URIA 2ZWYA 3L4VA 2PE4A 1R5YA 4AD2A 5CEWA 4OWGA 3SN4A 3MV01 4FXJA 3HIJA 3RLVA 4WZHA 4NSBA 5AYZA 5IOBA 1M03A 4BI5A 4GQRA 1TWIA 3ZR4A 3W7HA 5GNXA 3L23A 2WHMA 4DM1A 3NDYA 3T40A 1LVLA 3QQWA 3DFNA 2GLKA 3LDVA 4B5VA 4M1BA 2DZXA 3C0SA 3UWEA 4OBTA 3URNA 3QGKC 1P5BA 3EDJA 4A35A 1C93A 5XIAA 2X8HA 1KTBA 2DVUA 3VKKA 3ZSTA 4CNSA 4XQ6A 1BGAA 2XN2A 3EOLA 4LVGA 1Y5XA 1EYEA 3R43A 3ZWSA 5JRBA 4PFMA 1XC4A 1VEOA 2OB3A 4GQBA 1U22A 1I1WA 3R25A 1WXYA 2ODOA 2QVHA 2PRMA 2D2JA 3S83A 2GFTA 1KWKA 1P7TB 3AJ7A 4PTVA 5EMMA 1LG1A 2G3JA 1KN0A 3YPIA 2PDNA 1ADOA 1E4NA 3L12A 1AJZA 1EP3A 1C8XA 1VIZA 4J2PA 1ZAJA 1UH4A 5CGMA 4YNGA 3GXTA 2BGQA 4Z08A 4H19A 5BMXA 1TPDA 3W87A 1WP6A 1W3NA 3MHGA 3BG5A 5LYRA 4ACZA 1EJUC 4ECLA 5HNNA 3N25A 3POHA 2VDHA 1R3TA 2CERA 1QPOA 3EKGA 5LNUA 2CBIA 2A5HA 4FX9A 4LB4A 5SWUA 2FHBA 4L9XA 4NEWA 5I79A 2NXHA 3EWZA 4JTHA 4NZ4A 1WDSA 1M53A 2DT1A 1ZP4A 2Z29A 1QI4A 3B0XA 3TN6A 3HMJG 1RJRA 1F6KA 1QPNA 2QQ6A 4LVFA 1CYGA 5CJ5A 4LVAA 4H9MA 4S3DA 4HNOA 3L2MA 1OX5A 1NY1A 2WVUA 3TK7A 2Z1WA 3KBSA 2G5WA 4EF8A 2DGAA 1T41A 5DQPA 1VAHA 3TE9A 2OYKA 2NV9A 4QNEA 3WQVA 7TIMA 1X6UA 1D3HA 3KM8A 4K8EA 1DWHM 4JGDA 2YW4A 1MSSA 2TODA 3WUEA 2Y63A 3PTQA 2OG9A 3LXDA 4JDBA 3T05A 1NHPA 4GVFA 4W86A 4AHPA 4EACA 4C6NA 2Q71A 2TSYA 4KGJA 1TCDA 4MJ2A 3RLGA 3FS2A 3A4AA 3L21A 4JAWA 5IBXC 1GQJA 4WEVX 3C2YA 3K46A 3P6LA 4GUFA 3PTMA 1PTAA 4Q6XA 5AYXA 4DBSA 3G77A 4XBKA 4S2BA 1E0XA 1XX1A 5BXRA 3LHTA 4RE0A 2VQTA 5BRPA 2QF7A 4AEOA 3HRDC 4L7ZA 4AZIA 3DU0A 3VOHA 3GLCA 1JDCA 2C13A 3LU2A 3S1XA 4NYYA 3UT0A 5HANA 1O5RA 3QRHA 3V1HA 1CLXA 3THCA 1UD6A 3LPOA 1DYSA 3MCMA 2OEJA 1TSIA 2E5BA 2ZZCA 1JEZA 2VELA 3KBWA 1QR7A 4LS0A 4GX8A 4OOZA 2JK6A 3TTSA 1JXKA 1D8WA 4Z2KA 4A05A 3ITVA 3EOOA 4QIUA 1KFKA 4JKLA 2Z6IA 3DERA 4W87A 4WX2A 4GC3A 3SCSA 4AYSA 3FSUA 2VFIA 2WSYA 2E1WA 4FX8A 1A5AA 5U25A 3U57A 2JEPA 4GI9A 4MHBA 4Y2WA 4MNKA 3MWAA 2PC8A 1UBPC 3P93A 4HNCA 4HP5A 4NIRA 3RRXA 3R07C 3NUKA 1W2PA 5D2YA 1RLCL 1IT7A 5EY5A 1J0JA 1MEHA 4QFUA 2BHYA 3LRKA 3LTYA 1W5OA 2J7EA 3LS9A 3C0QA 3B4YA 2Y70A 1J6PA 4P8XA 4CCCA 2HEJA 2ZX8A 1BFNA 3VD5A 2ZOXA 2DZTA 4LNCA 1G1YA 1J12A 3NQFA 3U6WA 3L9CA 3SY8A 1LRNA 3ISIX 3QH2A 3GZ3A 4JFVA 5FSDC 4Z1AA 3WO8A 1XLGA 3SADA 4X9YA 3MI3A 3T1GA 1JDEA 5FS7A 1KBLA 3AUOA 4FOUA 3E12A 3WN6A 4AY7A 4O10A 1DP0A 1TWWA 4KCWA 4DZHA 3QLLA 1UMLA 4KT2A 5FS6A 2YCLA 4FNSA 1W1A1 1KXVA 3L4YA 4J35A 1A47A 1RSCA 2OGJA 1TR1A 2OYLA 5A6MA 2VUNA 4M24A 1S7MA 1TVNA 3QMTA 4QGCA 3F4NA 4X22A 1L2QA 3G2GA 4EP8C 4E6MA 3S2MA 3C2FA 4DIAA 2BNJA 1NTHA 3LERA 4B3ZA 5MHBA 4LCRA 1F2JA 1EDTA 1KR1A 5MKGB 4JCMA 3VUSA 1E0WA 3U3HA 4G5DA 3VCRA 3BGGA 4H4UA 3IACA 2CKRA 4GJIA 3RPMA 4TR9A 3N1AA 1B90A 1GETA 5BWFA 2DU2A 1NSJA 1ODUA 5G4HC 4HHLA 5A2BA 4F2TA 3QOKA 3CYVA 3PWIA 2Y2WA 1UD4A 3GTNA 3O15A 3ARZA 1NDWA 4WJXA 3ES8A 2Z1XA 1E4IA 2GSEA 4HNVA 1X6NA 4KERA 3ZR5A 3CK5A 2G0WA 4PUMA 4JTKA 1M6IA 3S1VA 3W75A 4K37A 4IL2A 1TUXA 4Z1BA 3TTOA 3ITLA 2AOSA 4RZ6A 1S2CA 4YWSA 3M0MA 5L6UA 2W63A 2QJHA 4LF2A 3T55A 1QNSA 5IDIA 2V2HA 3B3DA 3ZS4A 4L1XA 2MUCA 2NWSA 1M6JA 1TB3A 3GDKA 3REQB 3RJYA 2QDDA 3GXPA 2EQ7A 4UTKA 4JNMA 4WIWA 3U5YA 4OBSA 3OU8A 4IG2B 1EC8A 1YW1A 2WMIA 3LLFA 1RCOB 3WQWA 3OBKA 4DJFD 5LA1A 4NF7A 1ZAIA 3IJIA 3PBYA 4MADA 2GWGA 2V9DA 4LGXA 2J75A 1U1JA 3RNMA 1KCXA 4NXSA 5AN7A 3CNYA 3WD4A 1OC5A 1OCBA 3HBLA 3IVTA 2EKGA 2Z2UA 3HG2A 1QOQA 3IANA 4N9BA 4KWUA 4YIWA 1SMDA 2WZIA 3GD3A 1G67A 3IJ6A 3W1MA 1XPGA 3I68A 3LBCA 3VNKA 1KGXA 4Z1DA 1P6WA 3AWOA 4KRZA 2F6KA 1X2HA 3LZ3A 1UP2A 2C1HA 4YJ5A 5D05A 2C79A 3U2OA 3NSNA 1ZL1A 1PHQA 5I2UA 3A21A 3PBMA 1H7RA 1NWTA 1TZ7A 3ABOA 5FJRA 3UWQA 1H41A 2ZC8A 1Z44A 1GXFA 2QCEA 1A3HA 3HB9A 4GACA 4RUBA 5HAOA 4CCDA 1DJIA 2BOGX 1N8WA 3CC1A 3IPWA 1VHCA 3TMLA 3G24A 3LRMA 3GO2A 4CN6A 3BAKA 4CN4A 3W7MA 3ARRA 4E8CA 4UTMA 4DBDA 5D8WA 4J3ZA 3V36A 4RV3A 3TFXA 3RR4A 3URHA 3MA8A 3K13A 1YEYA 4DJED 2G3NA 1ME8A 4K8DA 2PZ0A 4DYEA 3K4DA 2E5AA 1PTDA 4XIMA 4UWMA 3CUFA 3P5YA 3TJ4A 5E09A 3NQ2A 4QHRA 4HQVA 4UFHA 2A0NA 2OFJA 5A5WA 2Y85A 4AD4A 1N5WC 3LCLA 4NJJA 1V02A 3DGRA 5KINA 1H5YA 4F0MA 1CIUA 1UC4A 3AZSA 2LLEA 3F2BA 3KRUA 3W23A 3QSRA 9RUBA 4MB3A 2W27A 3KOXA 1R0MA 3OVPA 1XD0A 1WX0A 3MZNA 1D7KA 2XYLA 1P6BA 3CM4A 1K70A 5GJPA 4GPNA 4GO8A 2Y89A 1BTMA 3BTNA 3F03K 2ZX5A 3IIVA 3LMZA 4Q4RA 1HP4A 1QO5A 3GTFA 4P7OA 2PWHA 2WJDA 1W3LA 3CQ0A 4DUXA 5TAOA 5HA7A 4S3AA 3SY5A 3HV8A 1DL3A 5LSMA 2CLEA 3CYJA 3GXDA 1JZ7A 4L6DA 5I3DA 1W5NA 5EKYA 4HZ8A 2P0OA 4O8AA 4O1BA 3OQ8A 1EA0A 3G0XA 4B3LA 3RHGA 3TONA 4D6EA 3NIYA 2CLFA 1RR2A 4KPLA 1XWYA 4CQCA 2DQXA 5CBJA 3SR7A 4EPKA 5I23A 2DSWA 3HFYA 1B9ZA 1IEXA 4D71A 4JN6A 2RH9A 2YLLA 3W2NA 2WNZA 1VJZA 3AISA 1AA1B 3GDBA 3KCJA 3E0FA 5T91A 4IIBA 1EP2A 1XIMA 1VPYA 4M3PA 4GY7A 3KAOA 3M0IA 2WC7A 4AIUA 1Z41A 1TPB1 3WLQA 4LT9A 1Q6QA 7A3HA 4PB5A 7ODCA 3BL3A 3OZMA 2IS7A 4BCEA 2ISSA 3CIVA 4R7OA 4KIEA 5CPLA 1L8NA 3NURA 3EB2A 2VCCA 5I24A 3GDLA 3LGGA 1ZALA 4UR8A 4HSOA 3CXOA 4YTUA 4I7UA 1FHVA 4WOQA 1J6OA 2XPKA 1TYPA 2Y6ZA 4H83A 5BNKA 1XLLA 4HJFA 2VGFA 4Z2IA 2PDBA 3O3RA 2Y8VA 1E15A 1XDIA 1VLIA 2C1IA 3R1ZA 2ZADA 3S0CA 1QK0A 3URQA 2QCMA 1M04A 4KETA 3VYLA 3DK9A 1JCYA 4AMCA 1MMFA 3GU2A 3WMLA 3IUDA 4CCEA 4AYGA 4S2CA 3W81A 4W4QA 2D2OA 1EWDA 1OCNA 3UJSA 4I9AA 3V0TA 4AZCB 4GQ0A 1QBAA 3PBVA 3JW7A 3TR2A 4MFDA 1TV7A 1KM2A 4E3TA 2V67A 1IIGA 4BKNA 1W6TA 3CMFA 4M6PA 1W9UA 4W9TA 1QW9A 4PFHA 4JIHA 2TRSA 4ORMA 3I4EA 1A80A 5M2FX 3WJZA 2VR2A 1YTEA 1SMAA 1K9FA 1R86A 4LC6A 2G3MA 1VGAA 2GK1B 1DTUA 3A3HA 2CHRA 4OUIA 2RKXA 2BY0A 3U0HA 4LEQA 4BEQA 2CWNA 1G94A 3AHTA 4IGHA 5BOEA 4LS2A 4H4XA 3G8EA 1ZZMA 3U2EA 4QDPA 5FEPA 2WYSA 4PTWA 1DQWA 1ME9A 1XPYA 1E55A 4HIBA 3HMCA 1PSCA 4NAEA 3W37A 1R46A 1FH9A 1Q4NX 3I7QA 2Z1BA 3WBWA 3P2VA 3B8UA 1XLJA 1A49A 3FHQA 3PJXA 5FSEC 3CUJA 1C92A 4M5PA 1ZU8A 3LN3A 3PG8A 1B3VA 2A4AA 3B06A 3S5NA 3OGSA 3DAQA 1EJSC 3UW6A 5EA9A 5LIXX 3WMBA 1JCJA 1OD0A 5KSWA 4WGXA 5LIKX 2E9MA 2W0UA 4WCJA 4H04A 5IXEA 1FXQA 3LPPA 4X3ZA 4FMVA 4JEQA 1P0BA 3A64A 3TDFA 1I60A 2CNCA 8CGTA 3CZJA 1W37A 4HD5A 4PTXA 3RLUA 3VD4A 3PN8A 4WSJA 2O4MA 4PR4A 2VO5A 2E28A 3WLPA 7ENLA 3ZSSA 2XWEA 3NQVA 3E2SA 3MDWA 4M29A 1R3QA 3S6OA 4H4ZA 4H6KA 1BXNA 1GVQA 2FZNA 4D2JA 2VFHA 1LQ2A 3TAOA 3TH6A 4LBSA 1KRMA 5LIWX 2I5GA 1NAL1 2BVTA 4M51A 1V7YA 2CLLA 2IQTA 5I03A 1D7YA 1QXLA 3W84A 3CH9A 5DRIA 1TELA 2X7VA 3TQPA 2PP1A 3ZXWA 3P8JA 3S9YA 1FHDA 5F1VA 3E49A 3LRLA 4QDWA 2G50A 1A53A 3FXYA 5DX7A 5D2XA 5FKYA 1GRFA 4EF9A 4MLRA 1RA0A 1TQXA 1G69A 3N15A 2PDWA 3AAMA 3ORWA 2AAQA 3L5OA 1OF8A 2VDIA 1WAWA 3N11A 2B81A 3B9EA 3SFWA 4OZOA 3QF0A 2X8CA 1RPXA 1AZ2A 2DEPA 1ISXA 3HPZA 3LI1A 3CGCA 1S46A 3DYPA 2BSLA 2PTWA 4JXCA 3PJWA 4DF0A 2CKSA 3O6AA 2VC6A 1KQZA 3SSJA 1WZMA 1DORA 4ZB2A 3R58A 4CVUA 3AWNA 2CLHA 3MCNA 2NLIA 2XIQA 4E2DA 1FP9A 4A29A 1QHPA 3DYMA 4JTJA 3H70A 5BU9A 3MP5A 3GUWA 4NP7A 3H2AA 2C19A 5G4EA 5HNUA 1A3XA 1A50A 3W02A 1JYWA 4N6FA 4KEMA 1RUSA 4X2PA 4KW2A 1IYXA 1HL2A 3KCOA 3GVQA 3L2IA 1UROA 4MB5A 1OEPA 5A8NA 2CW6A 4AWEA 3UXLA 4N7QA 2PSNA 4Y8FA 4A21A 1F7BA 4EMJA 1XYAA 3LM3A 1XLEA 3P7YA 1WDQA 2J77A 3H53A 3NVDA 2ZYFA 3ABSA 4PBFA 4IFKA 3E5BA 4GUIA 4TMBA 3VTRA 2OSXA 4QAWA 1L6GA 4O0KA 1YBQA 5CPNA 2POTA 2V5DA 1KC7A 1FEBA 2P8BA 2OCZA 1TMHA 2VR5A 1CCWB 5FMHA 1X1ZA 2WWDA 3MVIA 3SQMA 5C9UA 4LNYA 5FJIA 3G1SA 1FCUA 4XZBA 3KVLA 3UP8A 3P14A 5ABGA 1D9EA 2PI6A 1R2RA 7XIMA 1FKWA 2O7QA 3N12A 2XHYA 3C0LA 4IPIA 1ZUAX 4ZO8A 1VBGA 2E68A 1BVWA 2WK2A 2FVMA 3S2LA 3GXNA 3TYCA 4I7WA 2RJHA 1Q6EA 3BK0A 2BODX 1V6VA 4CCZA 1ZCCA 1XDMA 3WL0A 4Q7IA 4ZODA 1DJGA 1HUVA 1UKPA 1DJYA 1SZNA 3G0UA 1ODZA 4Y90A 4O1DA 4W8LA 1CX9A 2JKEA 4HKPA 1WXZA 1M5WA 4FXFA 2ICSA 3BICA 2NW0A 3WQPA 4I7VA 9XIAA 4UTHA 3WUBA 4G7EA 2YVGA 3NEVA 1I2QA 3CWOX 4EWJA 2GUUA 1PPIA 5EPDA 1FFVC 4PSRA 3H2FA 1PBGA 4F0SA 4XG1A 3LSCA 1DHPA 2DW7A 4H6QA 2GRTA 3KZPA 1SW0A 4DRSA 1T8XA 2VZTA 3C0JA 1HVQA 2WM0A 3W7NA 4D8ZA 2PWDA 1MOKA 4N6EA 1BWKA 4XZMX 3CUGA 5K9XA 2ZZ7A 4PMRA 2ZUNA 3NAVA 2CZDA 4QDMA 4JX4A 2XDFA 2PP3A 3ARYA 3DBPA 3FKKA 3GH4A 4D6IA 4DPPA 1HZYA 3WD1A 3WSUA 3NO1A 4JTUA 4O4VA 3UXKA 1VF8A 2J8GA 4XIAA 5AC6A 2E0PA 4R34A 3I65A 2ESCA 4DO6A 1HKWA 1GRHA 4R9OA 4BWLC 4OE7A 4HCHA 1QHZA 4UFKA 5CPQA 4S1FA 3VOIA 4ASTA 1QTWA 3WQ4A 2QUMA 4J56A 1N55A 3UY8A 5EMUA 1S2WA 1HL9A 1EFZA 3LV5A 1VQTA 3R2GA 3LMYA 1KXQA 1RVGA 2BXYA 1QI0A 2J78A 4DO7A 4L61A 4CVWA 2INEA 1K02A 3LPGA 1DVJA 2PGWA 5A6JA 4GRTA 2ONEA 2DT3A 1BVZA 4Q4MA 1JROA 4G7FA 5HQMA 3B40A 2VFEA 3DC0A 4KCTA 4C60A 1TA3A 4KPRA 4BI7A 4HK5A 4QSFA 2B0MA 1RXOB 3EWCA 4E0CA 1W9PA 3EB3A 2FZDA 3RM9A 4JBRA 4JIQA 3PZQA 1V3IA 3GVGA 1TRDA 3LYEA 1EZWA 3USZA 4S39A 5EMJA 1XLCA 1GW1A 2EG6A 3WQ8A 4CUCA 5HWMA 4DY1A 4FALA 3NR0A 1K7XA 1SW7A 1L8PA 1UZ4A 4M80A 2PDCA 5M03A 3KLJA 4FNQA 3GY1A 4BY3A 2W66A 3RCMA 1NDYA 1ME7A 1H7XA 1J0IA 1J5TA 1CT5A 1RD5A 4R3UA 5FL1A 1NOFA 4C6CA 3SQPA 3GTXA 4ERIA 1L9WA 4B92A 3Q65A 1UR8A 3M0ZA 3AHVA 5BWAA 4GBDA 1WUFA 3NL3A 4A6GA 3K8MA 5TNVA 2V3DA 1G5AA 1SFJA 2OWWA 2OWXA 3OLEA 5HMSA 3QZAA 1PVNA 1NH6A 3PTDA 3HPAA 3WFLA 3ERPA 2GR0A 1OVDA 4GXWA 2XSBA 3EWXA 5E9XA 2YL5A 2P88A 3BV4A 3REQA 4AVNA 2FTWA 3QHMA 1E0UA 2G8ZA 2YPIA 1EO5A 3RPDA 4JTDA 3QN3A 1B3YA 3EX6A 3RR1A 3LCFA 2GR1A 1EYWA 4DO4A 1ENUA 1FVPA 3W0KA 3BLEA 2ZC1A 3AALA 4CD6A 5F7UA 3SCRA 1RPKA 5I3HA 4HPHA 3QPZA 2P53A 3Q6JA 3BLDA 1UD8A 2V3EA 2NUWA 4QEEA 4GC4A 2OKTA 1IR1A 2OQYA 1MUMA 1ZLPA 2BASA 3HURA 3W70A 1ISYA 4IQJA 1XIHA 3T9PA 4JQ9A 5FF0A 1IR2A 1NVMA 1UR9A 4S23A 1FWRA 3FAXA 4P8VA 5GRTA 3VNIA 4US5A 1J0HA 1VJIA 3VNMA 2V81A 1YE6A 2JKAA 3N2CA 3ZWTA 2HVNA 4FNPA 5BYWA 5FA5A 3AM9A 1H3GA 3GC5A 3IJLA 3L4ZA 2P1FA 4QE4A 1K03A 3D47A 4AHQA 3MSYA 1R3WA 1QWGA 1R2SA 2XVGA 4HU0A 3P61A 5KETA 3ANUA 4AMAA 2F2KA 1OIFA 4H9YA 3W73A 3CMGA 3Q67A 4PEEA 3UBPC 3K30A 4Q4OA 4C7DA 3AUJA 3LHZA 4P7LA 2X8GA 4LFYA 1UWAA 2WMGA 4TMCA 2VUYA 5D33A 3SUUA 1LPFA 3FY1A 4AXKA 4NX0A 1F9CA 4IP4A 1FWDC 4MSSA 3GHRA 2GGEA 2YB4A 2WSQA 3VOCA 4QE5A 2VT0A 3VOGA 1GZ1A 2FGLA 3OBEA 4FLOA 3GHSA 1ISZA 3EUB3 4PEKA 3E0IA 2GSHA 5HNTA 2BY2A 1W3TA 3SJNA 1EKOA 1JVNA 7REQB 2EQ6A 5AYIA 4QS5A 4XISA 2PA6A 2DP3A 1H4PA 3E0VA 3GHUA 4LV4A 4LH8A 4ZFMA 2XSAA 4JTFA 2V3AA 3O6YX 2WBGA 2E1DA 1SQ7A 4OT7A 1OK4A 1UH2A 1VZWA 1XLBA 2VZOA 4LAOA 1NM9A 1RQBA 5KMYA 4M7SA 3HV9A 4KCUA 3A4JA 1YXYA 4EQRA 3MCOA 1GUVA 3HJEA 3QZEA 2CZEA 4M6VA 3CV7A 4Q7NA 4AUBA 4OOUA 2HMCA 3N29A 1VCVA 3QY8A 3CQJA 2EPMX 1GWJA 4GKTA 2NVAA 4JTGA 2BBFA 4MKSA 1V59A 3FYYA 4HPJA 3BLLA 3O0HA 1VIWA 2EJ1A 5F4XA 3NQ7A 2DIKA 2FQIA 4GXMA 3MPGA 2VP8A 2E77A 1JDFA 4P5UA 2ZXQA 3ZT5A 3JZUA 5DMNA 1DQUA 3SFKA 3NZGA 4QG6A 2Z7KA 4CNOA 3CL7A 1OFPA 1BWVA 3G1AA 3PNZA 3AMZA 3Q2DA 5C2GA 3BW3A 3N4EA 2BTMA 1PTGA 1XIBA 4UTWC 3S9ZA 4GYKA 4I90A 5T8GA 3NDOA 3AN1A 3EOSA 3M7SA 1K9DA 2GJNA 2C18A 2DUZA 3R12A 3OYXA 1CGVA 4AD1A 1FWFC 3W85A 2OZ0A 3GDTA 3I3DA 1SR9A 1KXHA 1TO3A 2OT0A 5HULA 3FJ6A 2OELA 1W31A 4GLEA 3S6TA 3CU2A 2YB1A 2PCEA 3W26A 1PJ9A 2PS2A 5LZLA 3H6OA 4E2BA 2HZGA 1UWSA 2V3GA 3GXFA 3WK3A 2XVPA 3P67A 4L4PA 1K1DA 1VFLA 2JIWA 1LL4A 2F6UA 2BX7A 2X50A 4TX9A 2NV2A 3AHZA 3TW6A 3DG7A 3NEHA 3P8IA 2EXOA 1C8QA 3VIOA 2CLPA 3EANA 4KH2A 3MHUA 5DMYA 4XZHA 2PWFA 2HS8A 3M16A 2A1YA 2FZ9A 5AHFA 5CG7A 3VIJA 3BZJA 1OX4A 5G4WA 1AJ0A 2Z0IA 2E6FA 3DOPA 4H9VA 1G4EA 1H62A 1TWDA 1AVAA 3VKJA 2GVGA 2OEKA 3JZEA 3STFA 1Q7QA 3AO0A 2VC7A 1VQZA 2GVJA 3D5HA 4JY9A 4H4WA 1GK8A 2YSWA 3O63A 5FL0A 3GWQA 2GDUA 5LHFA 3TN5A 2W67A 1EPVA 1BGGA 4AX7A 4EQWA 1FWTA 2ZX7A 4J3VA 1PEZA 1XIIA 2DJXA 3EWUA 3A5FA 3CIXA 2YCLB 1F3TA 4LV9A 3Q94A 5D2WA 2J4GA 3RLHA 1FKXA 1GNXA 5IDZA 3AMKA 4XO6A 4LALA 3WJSA 4PRWA 1W9DM 4DAIA 3OEXA 1W2VA 1PAMA 4AEFA 3M0JA 3TMQA 4C6LA 2VVSA 3BGAA 1I0DA 4PMYA 4GZ7A 3A3WA 3R89A 2BY1A 3FW6A 4MNJA 1TJ2A 4ZMGA 1YNYA 2HQAA 2ZUUA 5I78A 3UWVA 3N9SA 4R7JA 3OVQA 3V1PA 5K9DA 3C2VA 4H4SA 1Q85A 4MGGA 1TPFA 4O0ZA 5IBXA 2VX4A 3SY1A 4CLMA 3W24A 3TW7A 2ZZBA 3UNDA 1CPUA 1XQKA 2EGZA 1GCYA 4NZCA 4YHEA 1JYNA 3W7KA 3AZRA 3AXHA 5KITA 1XRSA 3UVAA 4OV9A 1XGZA 3VCCA 1MXSA 2O9RA 3G3MA 3G1DA 1DJQA 4HZ7A 1RCQA 4RX0A 2FMOA 1RK6A 3CXBA 2EF9A 5TIMA 1JRPA 3RN6A 3N2BA 5A6BA 1W17A 1FA2A 4C6KA 2H3DA 3MS8A 3GD4A 1PIIA 2AQWA 4ZXLA 3LHVA 1BAGA 2YL8A 2CIPA 3TCEA 1AQMA 4HYRA 1TG7A 1W9VA 5I3FA 4AZ6A 1VC4A 3GRTA 1H7PA 2CETA 2YXGA 3WF1A 4Z0SA 1IZJA 1WDWA 1JYXA 3EAOA 2E6AA 2GR2A 3B4UA 4XUGA 4NY2A 1YDYA 4D1JA 3H7VA 3LTSA 5A6AA 3UNTA 3LB0A 2WVVA 3UXAA 1QO2A 3B9OA 1SFSA 1EC9A 3SCNA 3GNXA 2FYMA 3W7PA 3PZUA 1P0EA 3CAKA 3DGZA 3GK0A 2OLAA 4NVTA 4JTCA 1F8IA 1VFSA 4JFTA 3R4IA 1E6XM 4JTSA 2R1NA 5D30A 4L65A 4MB4A 2WJEA 2BCPA 2Y62A 1X8CA 3L7RA 4LXFA 1EF2A 2CBVA 3AQUA 1BVNP 2Q02A 1F76A 1MW2A 1VPQA 1OFBA 1VCFA 3P0WA 3KL0A 1FWBC 1QAPA 1JAKA 3E0LA 3MQTA 1HJVA 3SRHA 2ZZ6A 3BJTA 1XLAA 3RNDA 4HNNA 4GZIA 5FJTA 2EBNA 3AROA 3DFSA 2ACRA 1C3FA 3DC8A 1IWAA 1ZB5A 4ILSA 2V82A 3F4CA 5TBOA 3W1TA 3S4TA 1BWCA 1LWJA 2AQVA 3ZT6A 3D9XA 1O94A 1G7UA 4ENLA 4WJ8A 1BYCA 1WPCA 2OR2A 3KOFA 3IAPA 4MAZA 1MFVA 2NUXA 4C6MA 1VD6A 5LNSA 3PG6A 3T8LA 4AFYA 1GVRA 3TQ0A 1WO2A 2R1MA 1S3TC 2XFFA 1RV8A 1LM1A 3PBWA 4NX5A 3TP4A 3BOLA 2CHOA 4UUIA 1V6WA 1F73A 4NJKA 1XHCA 1JCMP 4WHBA 3WLHA 4XD3A 2OOFA 3FA3A 3QSTA 2REQB 1QNRA 1AODA 1TREA 1NWRA 5KEZA 4HA3A 4AZCA 5C55A 1Y65A 3VK5A 1LWHA 1GQKA 1XIGA 1PO9A 1XYFA 4B5UA 1E9YB 1KQYA 3HJZA 1C90A 4W85A 3NQMA 4EXBA 4OBRA 4PMNA 3VGBA 1R9ZA 4ML4A 5DCBA 4GE8A 1S1PA 1Y5VA 3SURA 2V5JA 3E02A 5D03A 2ZUVA 1OZMA 1BKHA 2VEFA 1TE1A 3KS6A 1DE5A 2PWUA 1JRCA 2YA2A 3WNOA 2OX1A 4ZOAA 4LB3A 3LG3A 1W5QA 4Q8VA 4A2SA 1NHQA 3L5AA 3L67A 2I7GA 2WNNA 1G9HA 3QMSA 1J96A 3IWPA 1ZMCA 2E8ZA 5AZ0A 4BQ5A 5CLWA 2QJJA 2WSRA 4I5RA 3VDGA 1S5VA 4LQ1A 1JF6A 2X0YA 2F38A 1O60A 2AAAA 4QP0A 2XJ7A 4EKJA 3EWBX 2ZX9A 3DX5A 3AIVA 2BC1A 4HTBA 5CSRA 2PDYA 1FH8A 1IXOA 3DXIA 1JPMA 2YXXA 4LU0A 2ZVIA 3FYPA 3ITCA 1WUEA 3GRSA 1W9XA 1XBVA 2VYOA 3T81A 5KZMA 3TU9A 1A5OC 4UTTA 3NS1B 5FF3A 3LADA 3T07A 3WELA 3ZJ6A 4D6FA 2NQLA 1Q2RA 5GNYA 4EXQA 1R9YA 2O56A 1K4HA 3EKZA 1PZ1A 4AY8A 1GOKA 2P3ZA 4L4OA 4JN7A 1F3WA 2NX3A 1LOLA 4OUEA 3CEPA 3RYSA 1RALA 4PULA 3II1A 2VC5A 2FGBA 4YTQA 4TVYA 3AMLA 4IOTA 4I6VA 3VXGA 1Z7AA 2BLEA 1FY6A 3M43A 4QISA 1EIXA 1LDCA 3MI2A 1ZENA 5REQA 2WW5A 4QX4A 4B2DA 1XLFA 2J6XA 4RXFA 3NTYA 4RPQA 2DZWA 4WLCA 1JZ3A 4K7YA 1ZPTA 3CPGA 4RDZA 3TYDA 3APYA 4DZIA 2IQ0A 3LM7A 3LOTA 2O55A 3RU8X 2VXNA 3V5CA 3D3FA 1MNZA 4MWAE 1EB3A 4V15A 3UGRA 4FSAA 3PR2A 4CEXC 1M1BA 3SRKA 1PHWA 5CG0A 1DJHA 1IE7C 4Y96A 1G6CA 4AIBA 3PFRA 5A8MA 4H8UA 1J93A 3URAA 4AB4A 4HMDA 4MZYA 3D0CA 1LWIA 3MDUA 4R33A 1Q6DA 2IKJA 2Y4SA 5DMLA 1LLWA 2YYTA 4CQDA 4IG2A 2UY4A 4J3TA 4XKYB 4B5TA 2ZX6A 4UTWA 1D8CA 4XVDA 4GI8A 1EOKA 2HXTA 3MW7A 5JH1A 1B0IA 3DHPA 4J3WA 2CC0A 5AYBA 1PCKA 3MKKA 3CS2A 3GIQA 3GC2A 4L64A 3T2PA 1GEUA 1LBLA 3KUMA 3VNDA 2XIOA 2D1ZA 3RX4A 1GG0A 5D8ZA 3MYPA 1Q1RA 2GL5A 1WA3A 2CITA 3UJ2A 1XFBA 1ZNNA 1RQHA 3EEZA 1GRGA 1V97A 3IJDA 3RF9A 2HPIA 3HPSA 4B90A 2D3NA 5C54A 2WCSA 1BKSA 2CPUA 2IKGA 3D6NA 2R6OA 3ITXA 3RXZA 3W1RA 4DN1A 3ANVA 2DSVA 4RCXA 1XICA 5HMDA 4EM4A 2HTMA 2H6RA 3G3DA 4H4YA 5ER0A 3CZGA 2R94A 5HATA 3N2MA 3ZMRA 2PDKA 3AXXA 3NPVA 1HGWA 4WSKA 2A3EA 3VIGA 3GG1A 5F2MA 4E4UA 2Y88A 1KO0A 3H7UA 2X1IA 2V6AA 1M3UA 3Q58A 4PBEA 2WLZA 4UQAA 1LOQA 4C1NB 5I07A 4RDVA 2G37A 3S42A 1UUQA 5D09A 1GJWA 1DWFM 4Y6GA 2HE5A 3W72A 3BAXA 3WLTA 1UR1A 1XV8A 2D2HA 2DFAA 5HNRA 2FJUB 1RH9A 4C7GA 3FGCA 4ZGYA 1DIDA 3SRFA 3CO4A 3S9IA 3AMCA 4DUOA 4YLWA 3ZR6A 4GVGA 2FLIA 2IPGA 1M7OA 3BOFA 2J7BA 1RJQA 3FDKA 3DUGA 3BH4A 4L4LA 4GZJA 1L6FA 4UMCA 3BOXA 4RZ4A 5A6LA 4OTKA 1H63A 5HPCA 1FDZA 1GVFA 1T0OA 4HK6A 2AQOA 1OFEA 3H22A 1DPMA 1B3XA 1BF6A 3W7QA 4MF4A 1Q6OA 2A7RA 4RE3A 4HMNA 5A2AA 3PUOA 4GFSA 1EQCA 3VM7A 4PL2A 3P62A 3TA9A 2FDSA 1LJYA 3L8KA 4FLQA 3RCYA 4ZQRA 1ZDLA 3SCWA 1ZY8A 1XINA 3RX2A 2FGZA 3VA8A 1FFQA 1VP5A 3AJXA 2A2IA 4MJZA 4TXEA 5G1YA 3CGBA 3RITA 2A6LA 3M0YA 1YX1A 5DEZA 3UQNA 4JTTA 3THUA 4L9ZA 4M82A 1FCBA 3R79A 1IEQA 1GQLA 4MWAA 1J11A 1EUNA 2QUTA 2YOCA 3BCDA 1GVYA 1XGEA 1OGBA 5EFDA 1FWIC 2QJNA 4U33A 2ZVRA 5JVLA 2BC0A 1J9YA 4EK7A 3ALFA 2OO0A 3UG5A 3G1RA 2FH6A 4ZO9A 3IUHA 2GR3A 1OBAA 4PCPA 4FX6M 1L6YA 4QG8A 4QS6A 3WLNA 2PTZA 4C6DA 1FTXA 3GVVA 3VE7A 3P5ZA 3L4WA 4HMEA 3NVWB 2W62A 4Q8TA 2PGRA 3L0KA 2CBJA 3U4FA 2WPEA 3JR2A 4KRUA 4MZ8A 2NQZA 1SZGA 1PZ0A 4R85A 1HT6A 1WNOA 3MBDA 1V6UA 2CEQA 4XAFA 5A8GA 2NLYA 4P2VA 1OWQA 4DWSA 5GNZA 1H1NA 2QF8A 2QIIA 2P0IA 5C71A 3PZOA 4UR7A 2W3ZA 3VX0A 1MW0A 2QW5A 3T8QA 3TYZA 2GWNA 4FIRA 1WYGA 2WVTA 4UFJA 1WKFA 3C2RA 1DNCA 4TOQA 5G1MA 4JYFA 1E43A 2HE8A 2C3DA 4PSPA 1A0EA 3SAZA 1V3MA 4GIEA 5C8BB 3J7HA 2RUSA 4ORIA 2VRQA 1XD1A 4KFNA 3AHXA 4CQ9A 4PUJA 3WF4A 2PWGA 1WKEA 4LAUA 4KCVA 2GGIA 6XIAA 2B7PA 4P7NA 3N17A 1OM0A 3DFPA 5AHEA 1K9TA 2I9EA 1EH9A 4JTAA 4LUSA 1XL9A 4LW7A 4W7UA 2GQWA 3T09A 3PSVA 4IMCA 3S6DA 3AIBA 2PLMA 1ZS2A 1CB2A 1R87A 3IAQA 1JYVA 3H4GA 2C1GA 4XD4A 4PB4A 1US3A 3MO7A 5DY2A 3F2CA 1IIHA 2GVLA 2X2GA 5IM51 5D9PA 2WJZA 4LAKA 2XZ9A 3NVYB 4RR4A 1OD8A 4M8UA 3KVJA 3VKCA 5AB3A 5C9RA 6REQA 1WKYA 1W1PA 3OOQA 5CXPA 3A47A 3AIQA 1TFVA 3GD6A 4HZ6A 1X7IA 3SCQA 5LGXA 1ZAHA 1BQGA 4QR6A 2QMJA 2XGZA 4QLKA 1NWUA 1FHUA 3H2CA 5DT7A 2JK2A 2ZE3A 4AVOA 4GBUA 4PCSA 2KZHA 4MVAA 1K7FA 4MAVA 1OABA 1K8YA 4ERGA 5I00A 5JIPA 3W74A 3V0UA 1H5VA 1ITQA 2J66A 3GUGA 3TJXA 2MANA 3CZLA 5IRPA 4WUIA 1H60A 1TIWA 3NPWA 1E3XA 1VFOA 3E96A 3NDZA 3SW6A 2FFIA 1XIDA 1UOKA 3RPTA 4UC5A 3GX9A 2O92A 1OFOA 1YPFA 3N6JA 1J2BA 5H91A 3CO8A 2CXGA 3C56A 3ABQA 1TA3B 3LK6A 2YR1A 4MPQA 2YBTA 3W86A 3F4WA 2QUVA 3EXTA 1LBMA 4IJRA 3ID7A 3NL6A 4FPSA 3VVGA 3LGDA 4OVXA 1AK5A 2Y7EA 3BGJA 1MO0A 3WLRA 4HHHA 4EPBC 1I2NA 3EX2A 4X0VA 1U33A 3WYZA 1TZZA 3II4A 1CDGA 4YVVA 1TX0A 4YPJA 3SDOA 5I06A 1FXPA 2DVXA 4RW3A 5D2TA 2W5FA 2OQLA 4A3HA 4NNCA 2PFHA 3UZXA 3WNNA 1C8YA 4EWND 2QIWA 1F6PA 2X8RA 2HBVA 3TXVA 5D32A 1QNOA 4DUWA 1S3HA 4NT0A 1M7PA 3GH5A 3NQGA 3TC3A 1J8VA 2YZRA 5T9BG 2EPHA 3CHFA 3TC7A 3U2ZA 3GE7A 2E25A 4WSHA 5CZTA 3CH0A 3S3GA 3KL5A 3UPMA 4LYRA 4UZSA 1ONXA 3DI0A 4AEEA 4DJDC 2VTFA 3LD5A 4UOQA 1W8SA 2E40A 1UR0A 4U10A 4J28A 1H11A 4ZO7A 1HXJA 5FESA 2C71A 4XD5A 3AC0A 4AD5A 5I3IA 4IQEA 1PDZA 1JPHA 3F5LA 1H1ZA 1QPRA 3DGBA 5BOOA 1FCQA 5BXPA 4UXDA 1W9BM 2CLMA 3PAOA 3S46A 3WBAA 3M0KA 3B03A 4HU3A 1SB3B 3EPOA 2PLJA 4V2XA 4LS1A 2X1RA 3G18A 3G8RA 4ZXOA 1XXXA 1UYQA 5DN1A 3HQNA 1LL6A 3WBXA 4NZ5A 3TLQA 5E1QA 3ONBA 2WMKA 3MANA 3TTQA 3BLKA 1JULA 2FPVA 5BU6A 1GQIA 2Z7GA 2YDAA 4UFLA 6ALDA 5E70A 4S3JA 3WLKX 2TPSA 4A22A 4BWLA 3PS7A 1P6CA 1LF1A 4DJFA 3TLLA 3SGUA 3UXDA 1BG4A 5DANA 4DBUA 3VMNA 2VZVA 4PYSA 1CGUA 1YBQB 5DCEA 3KS5A 3OIXA 2Q8ZA 3RK8A 2OO6A 3W29A 2WSKA 4RNHA 4JDRA 1XRVA 6REQB 1VBJA 4MJ4A 4L6OA 4MKVA 1E6PA 1GQNA 2OKOA 4Z1YA 4AHOA 3E6EA 1J4EA 1DWGM 4UTIA 1WCGA 3VKBA 4F40A 4ZE4A 3ABZA 3WD0A 4J57A 3CWNA 5U1OA 4IICA 4IHCA 1A5BA 2PGFA 3IV8A 3N04A 1KM5A 1Q5MA 1EWEA 5LA0A 1K77A 1TPUA 2AL2B 2G3IA 2B7QA 4YHGA 2WSPA 1TYGA 2G41A 1IHIA 4GUHA 4GCAA 4XZLX 4ZTYA 4O50A 3T08A 1BQCA 1BG9A 4LAZA 1HKIA 2HNHA 3MUIA 3SIZA 3TOYA 2NPXA 4FEZA 3KL3A 3MMWA 1KTNA 4W84A 2FZBA 1KRAC 1JZ5A 4HGXA 2G97A 1MW3A 2KX9A 2H8ZA 3LHYA 4PN2A 3FVDA 2DIJA 1XS2A 3R8HA 2VZUA 5HINA 3FV9A 1S2VA 4H7CA 4Q4PA 4Q8OA 3VDAA 1UCWA 3GM8A 1GYMA 1UKTA 4N02A 2Q09A 1SSDA 3B8DA 3T0TA 3F7JA 1J0KA 3AIUA 3ZM8A 1A5MC 5ABFB 4IIGA 2WVVB 1LTDA 2GJPA 3SR6B 2VKZG 3BXWA 4GRSA 2KAUC 4TX6A 4QM1A 2JF7A 1FWCC 3O2LA 2J24A 1MWOA 1AH4A 3N14A 3SECA 1KTCA 4K39A 4U2ZA 3BAWA 3CUXA 3N2OA 1NF0A 2VURA 1PIFA 3UZZA 3FJ4A 4U2YA 4B5NA 4GYFA 1MXDA 3NO5A 3OG2A 3FA5A 4LYQA 2I9UA 5C2CA 2FH8A 1BSIA 1UWRA 3U4AA 3P84A 3DN5A 3DGHA 3ENLA 1OB0A 3WEMA 1RBLA 2ACUA 2BFGA 5DY3A 3WDPP 4EXAA 1EEXA 3GAKA 1G4TA 1B57A 1RVKA 3VOFA 1O66A 3SUTA 1XGDA 2EEXA 1EGZA 4TTGA 4DELA 2PDMA 3K4AA 4D9PA 3OTRA 4LRSA 5HWJA 1YXDA 3GKAA 1K6WA 4UQCA 3RDKA 3ZVHB 4A8NA 4U3AA 1SR0A 1W3JA 3BDKA 1TVPA 1RJPA 3HGRA 1CGWA 1UZHA 3WF3A 3DK8A 4FA3A 4CU8A 3CGDA 1OIMA 2YJQA 4UZUA 3TN3A 1HO4A 2PRLA 1ONEA 1UR4A 4IISA 2RGLA 1VR6A 3PBGA 1W3IA 4JTQA 1A4MA 5DMMA 1HNYA 4RDYA 4BQ4A 1R2TA 2PLCA 2XGBA 2VOTA 3LNPA 4ZSUA 2F84A 3GR8A 4PH6A 1EJWC 2ZZ5A 1ZJAA 4IX2A 5LNWA 4AD0A 3KTXA 6TIMA 2FTPA 2BWGA 5LHEA 1Q3NA 1MZHA 4NYUA 4GUGA 1UPPA 3OODA 3QFEA 3P82A 3BUVA 4MKNA 1DXEA 3VGGA 4W89A 1PKYA 3GTHA 2W55A 4PUNA 1MI3A 4ZL1A 3NYDA 1K8XA 3MSDA 3AXIA 4JX5A 4O11A 4IIHA 2Y7GA 2A3BA 2OSYA 3MMDA 3FSTA 2EG7A 4N2YA 3ARSA 1KCKA 1NQKA 1BSLA 4Y8EA 5G5HB 3L0GA 1HW6A 3BQ6A 3KCLA 4H9XA 1FFRA 2AAMA 3THQA 1UUOA 3IGSA 2YCIX 3W1LA 4DF1A 2W0HA 1V6YA 3G6MA 2C91A 1ZRQA 5E9AA 4FB7A 5AOUA 1FO4A 4AZ7A 2HROA 4G2DA 3CEUA 2ADAA 1XSJA 2XIIA 1UQZA 5CSUA 1YXCA 4IMEA 1YKWA 4S3BA 3LNMA 4JYEA 4IFOA 5HK4A 1Z48A 3OO2A 3OBAA 5G1TA 1ONRA 3IJ7A 3PZGA 3GW3A 3T0DA 1OT2A 3VNLA 4FXSA 3QGAC 1JUEA 4NL1A 3I7RA 5ECVA 1V3JA 3IJ8A 3KWXA 3FGCB 1CGYA 2NSOA 2YX0A 2Y5SA 3F2DA 2CDUA 1CI1A 1O68A 4HA1A 2PZNA 4FO4A 2I16A 4HHPA 1SJCA 2XVKA 3I3EA 2WNQA 1LUCB 4GJJA 4DI9A 2RABA 1VDVA 1FWJC 3W27A 4LUJA 2D0GA 3PJTA 4WVXA 2X41A 1KR0A 1DV7A 3EX1A 4O54A 1BRLA 2VGIA 2VD8A 1LRTA 1OX6A 3MMTA 4EE9A 2A79A 2VQUA 4DWSC 3ITOA 1L0PA 3HG4A 5JUVA 4F0LA 5FEXA 4ZO6A 1KGUA 1CTNA 3OZOA 3H12A 2C3ZA 4A4AA 1RCXB 1QW8A 4GR1A 2A85A 1XYCA 4LIIA 2XM1A 1A5UA 2I17A 4MZ1A 5C9WA 3CTLA 3UCCA 3W6LA 2FHCA 2NZLA 3EAUA 3ZQ9A 4W8AA 2ZXDA 3AI0A 3UJEA 3G0SA 1VCGA 1OCJA 2JF6A 3H24A 4NEVA 3VGHA 1TMQA 1R9XA 3DJGX 2G4FA 1YHTA 1RK5A 3CUHA 1VPXA 4UIOA 1QRQA 3AS3A 4GNVA 4EANA 3SJ3A 2ZUSA 4XTDA 3N34A 4PL1A 3W1NA 3VGEA 1QMLA 4D6JA 3WNLA 4AY1A 3SCVA 4E8DA 4QLJA 4A2RA 2C7FA 5J5RA 4Q4KA 1N61C 4F0KA 4H6RA 4DF2A 3MUAA 4FF7A 2XSXA 4HNTA 3U7VA 3I6TA 4UTUA 1DJXA 2ISVA 1VFHA 3SQLA 4KEVA 3E3HA 2YYUA 5LNRA 2CHNA 4BEUA 4PMUA 4ZQPA 4FR1A 1XH2A 3AOFA 3CASA 5CSSA 2J7FA 4H8VA 5C9XA 1UD3A 2XISA 4JQAA 4Q7BA 4NASA 4WF7A 2BGNE 3ZO9A 3QR3A 4DYKA 5HJXA 1B30A 4N9EA 1PYMA 1OFAA 4LJ3A 4IXXA 2XFYA 3OLDA 4JL2A 5A1AA 3WJXA 9CGTA 1TPVA 2NX1A 3N2TA 2QT3A 3HF3A 3W9ZA 1RBOB 2GZXA 3CZ8A 1S1RA 3FDGA 1A5SA 4HNLA 3WDQA 2E9BA 4FAMA 1TE6A 3IARA 2PDUA 1V02E 4GI4A 4GNJA 2VCAA 3FKRA 5A3HA 4C7FA 3QR1A 5L9FA 1B9BA 1P0DA 3EMZA 2XM2A 4GH1A 2PMQA 4HN4A 4MWAB 3QY7A 4G9PA 4IUGA 2D3LA 4UTLA 2I56A 3ZJ7A 1V4YA 4GHRA 1CXFA 4P7QA 4POCA 4XD6A 2GQ3A 1VYSX 3MUCA 1G4PA 1U5HA 4GWEA 4S3FA 1OG6A 2PDFA 5KVHA 2VRJA 4LRTA 3IC9A 2QCDB 6XIMA 4IF2A 2ISWA 1KB3A 1CLVA 3B9AA 5M17A 1RP8A 1DBTA 3OHIA 3AXKA 3XINA 3KXQA 1ZXIC 3QLDA 5BW6A 2PCQA 1QDSA 4UBPC 4WR3A 2IKIA 2A6NA 3KBNA 1IF2A 3BARA 3FX4A 2NVCA 1EJ7L 5CBIA 1T3QC 5CQ1A 1B1YA 3IIPA 1SJDA 1WB0A 3WLSA 3VDHA 1LUCA 3EMCA 1RQEA 2ZRXA 2WJFA 3WEZA 8A3HA 2E09A 3N18A 1CXKA 3CMJA 4CD5A 1T6MA 4D6DA 2QLYA 4ZOHB 6PTDA 2QULA 2OMAA 3BMVA 1JUBA 3L4UA 1ITXA 3R8GA 4D6HA 1EO7A 2W6RA 1ONFA 3UJRA 1D3CA 4TVUA 4HVXA 5G2IA 3MC5A 1X1OA 2WC4A 4WY0F 4KF1A 3WNPA 4J2MA 1UD2A 4X61A 3NJ3A 1JD9A 4P7RA 4XKMA 3CL8A 5H8PA 3QKEA 4EMWA 1JDAA 4DWDA 4GGBA 3H2MA 4QNWA 1X97A 4H41A 2RDWA 3ITYA 1W91A 3BLIA 1A4LA 1K3UA 2E7FA 4KKXA 1E1EA 1V03A 2XIMA 2Z27A 4HJWA 3NOEA 3EWYA 2TPRA 1CXHA 1FX6A 1H0GA 1UD5A 1W8GA 3C2EA 1F61A 1EOMA 3B8TA 3ARVA 3DECA 1TIMA 4KQNA 4RE2A 1UBSA 1K6AA 4W7VA 5FS8A 4M6QA 2EPKX 1RY0A 4MWAC 3EA1A 1V0LA 4JQ4A 3WIJA 2VC9A 3IS4A 3S2CA 3M7WA 3WQCA 4PODA 2WB5A 1AW2A 7PTDA 5A2CA 3H4KA 4C6PA 3W1PA 4DEFA 3E0WA 3TTEA 2QKFA 3IVSA 3LBMA 2Z00A 3A7RA 3CAVA 1AD1A 4S3KA 3LHWA 1CECA 3QW4B 1I75A 2O9TA 4K3ZA 5DT5A 3MP4A 4R5EA 2ZWZA 3UZ5A 4JFUA 5J04A 3QYSA 3XIMA 2W3SA 2QPUA 2VEGA 1SO4A 4IQDA 5HWNA 3KEHA 1QK2A 2FPYA 4H4VA 3ZIZA 1H50A 2RDXA 4F3HA 1XUUA 5A8PA 3SCOA 1E1CB 3A23A 4K36A 1C7TA 4LUYA 2EHHA 2YAUA 4QAIA 3EF6A 3WFZA 3EA2A 2QAPA 3AICA 1W0MA 4O14A 4XVEA 3HZ3A 1NIUA 4K68A 3FK4A 4K1WA 2ZRYA 2Q01A 1JZ8A 2CYGA 1GRBA 1SM9A 3TA6A 1X7FA 2VEPA 2R1LA 1EHAA 2J9YA 3TOPA 3W1AA 1K7EA 2Z2BA 3UG3A 3HG5A 4O1FA 1HJQA 3CQIA 3HGSA 3B0YA 1XYMA 5TQLA 3HQOA 5BXSA 1E9ZB 1B3OA 1EX1A 3O0FA 4O1CA 5BMWA 3STCA 1EXBA 4IPLA 4UTFA 2ASHA 2D0FA 3Q4DA 1GOXA 1EGMA 1DOSA 3ZJKA 1KBIA 4AAJA 1KCLA 3UCQA 2BVDA 3CB3A 4B5XA 3KRZA 1I8JA 1NF7A 1K8CA 1VRXA 1TRIA 3CGTA 1RBAA 3F1QA 3AZTA 4E3VA 3BWWA 3QY6A 1H09A 2ZCGA 4W5ZA 1NEYA 4I9MA 1V5XA 4OKDA 1ZP3A 1I1XA 1TZ9A 1CNVA 1HG3A 3VM5A 1QI3A 1TTPA 2PDGA 1UC5A 2Z28A 3DG6A 3NGFA 2A3AA 2RFGA 3OVGA 3WD3A 3EDFA 3VZXA 2CCRA 5I7GA 2VCBA 2C3CA 3LPFA 2VM8A 3NQCA 1SFTA 2BXZA 4AC1X 5F2IA 3TZNA 1GEHA 3P60A 4YS1A 4DAFA 3MV11 1AMYA 1HJUA 3QPYA 5E6YA 3WH8A 3N4AA 3IJQA 4JS3A 4FHAA 1MUCA 1N7KA 3WD2A 3MJMA 1H1YA 5FACA 2W9MA 2BMBA 4MG4A 4N9DA 3M46A 3ARWA 4PUUA 3GYCA 4E4FA 1XC6A 4MJMA 3S8HA 2IKHA 3AFBA 5FEZA 3QPEA 3C8NA 4O8RA 3FHAA 3TSBA 3GIYA 1IQ8A 2R1PA 4AQLA 1GONA 3GYEA 3VKDA 1LQ0A 1JPIA 1VBHA 1ELSA 1BEUA 1OZQA 4XAPA 3IJ9A 3ARQA 1FDYA 3U8GA 2NT0A 1Z6KA 2ZA3A 3OLGA 4DJEA 1TTQA 4DXXA 1LBFA 1GHRA 1NWSA 4B9ZA 5I77A 1UOZA 4N0RA 3G1VA 2HWGA 1ZSXA 2ALRA 4ES4A 4NZ1A 1ZJIA 4LANA 1NDVA 1Q45A 5B7YA 4JFWA 3ZFHA 3LA4A 3T0CA 1IZKA 4WOZA 4FOKA 1QNPA 1ESWA 3NVZB 2EQDA 2FMNA 3BW2A 2QEZA 5F2GA 4PRRA 4AD3A 4C1NA 4A3RA 2XH2A 2E8YA 3W07A 4KBXA 4D6CA 2WOVA 1KKRA 4KEZA 4E5TA 2J88A 4J5NA 1ITCA 4CD4A 1ZJHA 2J9ZA 4DNAA 3LXBA 3M47A 3SIMA 2QDGA 2F5ZA 3LI0A 4O57A 4F8XA 4REQB 3CHVA 3USBA 1MEIA 2PD5A 3C5QA 4H6EA 1YNPA 2B31A 1LT7A 1E5JA 1B5TA 1YDOA 1JPKA 2OSWA 3MO4A 3CIWA 1WBHA 3U48A 4HMCA 3BO9A 3BLPX 1QPQA 3M0XA 1XRFA 5LNVA 1D7FA 4JPGA 5F4WA 5A6TC 3SEPA 3VC6A 2HK0A 3URBA 3U7BA 3U5UA 1X2GA 1KA9F 5AC5A 1LROA 3TROA 2Y1HA 1QFEA 3UR7A 4N4PA 3BE7A 4TUFA 4J27A 1JCTA 2IUZA 5CJMA 4NJHA 3WNMA 2WZHA 4TIMA 3RUBL 5TR3A 1AMKA 2PP0A 5BZAA 2OX4A 2A3CA 4F66A 3CWHA 3B0PA 2WHLA 2GGHA 1Z3NA 3A22A 1VYPX 5HPOA 1AQHA 4E8GA 4G1NA 1F8WA 2PB1A 2B4GA 3T78A 4UFMA 3KOZA 2ZRUA 5E0CA 2D2GA 5LXEA 4US5D 2QPSA 2ZICA 4QJ4B 2RJGA 4L4MA 5DRCA 4RNIA 2JBMA 1Z42A 4GYJA 1S5WA 5BCAA 5K7JA 2F9RA 2SFPA 1HVXA 3NXFA 5K4XA 3EDKA 2WKLA 4MDPA 1XBZA 6CGTA 1E4LA 2EQ8A 4PUDA 4IH3A 5C0QA 1VH7A 2V63A 5G5IA 4LBUA 1R3SA 2BGSA 3LBOA 3ZZ1A 3W76A 3M5XA 1XHGA 1DHKA 4JICA 5M5DA 2DPEA 3I6RA 4BR1A 1NPXA 1HGYA 1VB9A 2VWSA 3WF2A 2OZ8A