1GV4A

Murine apoptosis-inducing factor (aif)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
490
structure length
490
Chain Sequence
TVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Mouse Apoptosis-Inducing Factor Aif
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords PROGRAMED CELL DEATH PROTEIN 8
total genus 149
structure length 490
sequence length 490
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1gv4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A01
2E1MA 3I3LA 1QO8A 1LVLA 5FMHA 2JKCA 4H4PA 3SFDA 2J3NA 4JNAA 4RSLA 4B68A 3LADA 3NN6X 1V59A 2A89A 2PHHA 2C76A 3GDPA 2X99A 1PDHA 2XFPA 1XANA 3AE1A 1PN0A 3SFEA 3AD8B 4EQRA 1NG3A 1CHUA 1KNPA 2UZZA 2YVFA 3RNMA 2V6OA 3LJPA 2RGJA 2XVEA 3NKSA 4YTMA 2X50A 1BF3A 4B63A 4TLXA 2B9WA 3AE7A 2WP6A 1CJ4A 3LZXA 3VRAA 1LQTA 2XVHA 3ZDNA 1CJ2A 5GSNA 2GH5A 3DMEA 2BXRA 1YY5A 1OJTA 2V61A 3M0OA 2YLSA 4H2QA 2YG3A 5C2TA 2C65A 3BHKA 5M10A 1IUWA 4AP3A 2C70A 1K0IA 1Y0PA 4OPDA 5EB4A 2WS3A 1F8WA 2WPCA 2H89A 3AECA 4N9XA 2XLUA 4NTDA 4X9MA 4IA6A 3SQPA 5JCIA 4USQA 2R4EA 1ZOYA 3HZLA 2EQ6A 4C3XA 4U8MA 2GVCA 3CNTA 4HA6A 4YKGA 1N4UA 5KVHA 3CPJG 4J34A 1K0LA 3B6DA 3GWDA 5CQFA 4USRA 3UKAA 3UOYA 4YTNA 3DK8A 4NZHA 1TDOA 2GF3A 3G5QA 5FS8A 3UTFA 2F5ZA 2BA9A 4CRTA 2WP9A 2OA1A 2DKIA 4BK3A 3ALLA 1H81A 3AYJA 1JRZA 4FDCB 4A9WA 2YLZA 3CTYA 2Z5YA 2C64A 1N4WA 2GRTA 2ZZ0A 2YQUA 4H4WA 1BGNA 3EPTA 3H8LA 1DODA 3GSIA 5EB5A 4WX1A 4C5OA 1PBCA 1IUUA 3NRNA 5HXIA 1PBBA 3QVPA 4M52A 4OVIA 3ICRA 4B67A 1S2QA 1GERA 1PXCA 3ATQA 3AE9A 2BK5A 5HHFA 2BK3A 4PABA 5KOWA 1Q1RA 3CGEA 3DJJA 2GMHA 2TMDA 2VVLG 1CF3A 3UKPA 1GETA 1OJAA 3E1TA 3ALJA 2VOUA 2V3BA 1E39A 1K0JA 4A5LA 2XLSA 5BULA 4IVMB 1NDAA 3GRTA 1H83A 1F6MA 3AEAA 4JNQA 4GUVA 3K7MX 1FL2A 3D1CA 1LJ1A 1MO9A 1ZX9A 4BURA 3NGCX 3DGHA 4H4YA 3GMBA 4JY3A 1KF6A 2BS3A 2JBVA 2WU2A 4XWZA 2BYBA 3AE3A 3P4QA 4EMWA 1FOHA 4RG3A 1GT8A 3F8PA 4REKA 1VDCA 5BVAA 3P9UA 3KKJA 4APNA 1GSNA 3AEFA 2C67A 4NTEA 1DOBA 1CBOA 2Q0KA 4U8JA 1VRQB 4CY6A 2WEUA 3VR9A 2QA1A 2NVKX 1BGJA 3UP5A 3BI5A 2FJEA 1EL9A 1GRTA 1DNCA 1GRHA 4K2XA 4U8KA 2QA2A 2OLOA 1YQ4A 1PBDA 3CNSA 3AWIA 3L8KA 1GALA 1RSGA 1ELIA 2JAEA 2VVLA 2XLPA 1O95A 3AE2A 3JSKA 5CKUA 2YAUA 2GV8A 4H2PA 4TM0A 5JCNA 3AB1A 4H2NA 4EM4A 4YT0A 2YLWA 5HYMA 2R0PA 1E1NA 3K7QX 3GRSA 4UP3A 1ZMDA 4AOXA 4GCMA 3QFAA 2VQBA 2XVIA 3FPZA 3GD4A 2ZZBA 4DSGA 2ZZCA 2CVJA 3D8XA 4Z25A 2YLXA 4U8NA 4A99A 1DOCA 4B65A 2X3NA 3F8RA 4Y4LA 1ZDLA 5EBKA 3UOXA 2Q7VA 4H4XA 1GOSA 1ZP0A 1N1PA 3PO7A 4C3YA 2YR4A 1EL7A 4WCTA 1KSUA 1M6IA 2B76A 1YQZA 2VZ2A 3PVCA 1CJ3A 2YR5A 3IWAA 2Q6UA 4TM3A 4J56A 1XHCA 3OZ2A 2C3CA 1PBFA 1PXAA 2GEWA 4IV9A 4B1BA 4X9NA 3CPHG 4H4ZA 2R45A 3WE0A 3ADAB 4NEWA 3FBSA 4OPTA 3CN8A 1S3BA 3QFBA 3FG2P 2ARDA 4XXGA 4GRTA 1PS9A 1JOAA 2WOVA 1Z6LA 1IUVA 1NHRA 5DBJA 1MOKA 4B66A 3C4AA 3NK0X 1B5QA 3ALMA 5L46A 2X8GA 4DGKA 4Z43A 2FJBA 1DXLA 2JB3A 3UTEA 3V3NA 2YR6A 1GXFA 4D04A 1ZOVA 1AOGA 4EIPA 1JNRA 3GYJA 1LV0A 1IUXA 2XFNA 4A79A 4C74A 3AE4A 3GD3A 5U1OA 3AEBA 1COYA 4MJWA 3G5SA 2BC1A 2WQYA 4TM1A 3P4SA 4P9SA 1L0VA 2EQ8A 1REOA 1KDGA 3RHAA 3NNEA 1SEZA 1JRYA 2DKHA 2OLNA 4K5RA 4O5UA 3GMCA 3NK2X 4J36A 3V76A 3S61A 2C66A 4A65A 1CL0A 4U2LA 1KSSA 2WHDA 4GF7A 1LTXR 1Y56B 4I59A 3H8IA 4JDRA 1IUTA 3R9UA 2YG7A 1GRFA 4EQWA 2RABA 2JB2A 3CPIG 1PBEA 1D7YA 3UOVA 1VQWA 3UCLA 4KPRA 2R0GA 2Z5XA 4CCRA 2XFQA 3DJDA 4RG4A 2RGHA 1KFYA 3AE6A 1VG9A 2R4JA 2WP5A 4AP1A 1GESA 1TDNA 2FBWA 1ZMCA 4Z24A 1DJQA 2YG5A 2XYOA 2E5VA 3CNDA 3IHMA 2EQ9A 1K4QA 4EMJA 4CY8A 4H7UA 3PS9A 1NEKA 4JQ9A 2I0ZA 2GR1A 3NTAA 4ZCCA 2V5ZA 4UDQA 3LZWA 1F8SA 2OALA 2AAQA 1XDIA 1H86A 4U2SA 3P4PA 1GREA 1H6VA 1S3EA 4IVOB 5IQ1A 2APGA 3UTGA 3AEGA 4A7AA 1D4CA 3QSEA 3LXDA 2WBAA 4NEVA 4C77A 4D03A 1GEUA 3UKFA 3ICSA 4UDRA 3KU9A 1L9CA 3SGLA 3NLCA 5KRQA 1JRXA 2BC0A 3IC9A 3AXBA 2YVGA 2VRMA 1E1KA 4TLZA 1IJHA 4U8OA 1XPQA 1OJDA 4U8PA 3UKKA 2XDOA 4DSHA 1PJ7A 2YM2A 1BWCA 3NHOX 4OPCA 4YSHA 4JY2A 4UDPA 1F3PA 2C7GA 2XFUA 1D5TA 2BS4A 2XFOA 1PHHA 3AE8A 2BK4A 2GR3A 3QSSA 1EL8A 3NG7X 4LU6A 2QCUA 3UKQA 4GR1A 2GR0A 1S2YA 5GRTA 2IVEA 1FECA 5ER0A 2R9ZA 2E4GA 4YXDA 1HYUA 4AOSA 4I58A 2XCGA 3CNPA 2ZBWA 2QAEA 2JK6A 4X4JA 2XLRA 4K8DA 2WU5A 1O5WA 1QLBA 3UKLA 1CC6A 1FCDA 1OJCA 4ECHA 1GRAA 1B37A 5U25A 2IIDA 2V60A 3F8DA 1DOEA 1B4VA 4CNJA 4HB9A 1PJ6A 5C3JA 2R0CA 3DK4A 1ONFA 4AT2A 2A8XA 3II4A 4YWOA 2AR8A 1YKJA 3AD7B 2EQ7A 3OC4A 1E6EA 3KA7A 4BJZA 1ZY8A 2OAMA 3FMWA 1EL5A 3IHGA 3BNUA 4E0VA 3Q9TA 2CFYA 1NAAA 2ACZA 2AQJA 1Q1WA 3NIXA 2X8HA 4ZCDA 2VRLA 4YSZA 1NENA 4EQXA 1LQUA 5FS6A 1EBDA 2R46A 3ZYXA 2X8CA 4H4SA 2BS2A 3T37A 1GPEA 4B69A 2GR2A 4LIIA 5JCMA 5IPYA 1KNRA 1YQ3A 4GDEA 2GAGB 3GYIA 5IQ4A 1JEHA 1TDFA 3B3RA 2A87A 4H4RA 5J7XA 4Z44A 4TM4A 2V3AA 4U2TA 2GQWA 3URHA 4H4QA 4K7ZA 1H7WA 2RGOA 5M0ZA 2YWLA 2CULA 3AYLA 2XLTA 4XWRA 2FJAA 2B7RA 3NT6A 4H4TA 1DJNA 4YKFA 4AT0A 3AEEA 5KOXA 1E7PA 1MXTA 2WDVA 4A6NA 2C3DA 1GNDA 1NHPA 1TDKA 4J31A 4OPIA 1GRBA 1UKVG 2CDUA 3KD9A 3CGCA 4EQSA 2YVJA 3Q6JA 2GAHB 3REDA 3ATRA 4K5SA 3FIMB 1GV4A 3VQRA 4ICYA 3NH3X 4EMIA 1P2EA 3NN0X 3AYIA 1H7XA 3BNMA 5J60A 3RP6A 2BCPA 3IF9A 1NPXA 2Y6QA 3ISHA 1L9EA 4KX6A 1OJ9A 4LA1A 3QJ4A 4OCGA 4H2RA 3S5WA 2WETA 1CJCA 3AD9B 3AE5A 2XVJA 5JCKA 1TRBA 2WDRA 4K22A 1F8RA 2GQFA 3LB8A 4EM3A 2WESA 2YLTA 1CC4A 4BJYA 1ZKQA 4CBQA 1BZLA 3UKHA 5U63A 3EANA 1Q9IA 2VQ7A 1E1LA 2FJDA 4Y4MA 3DJEA 2B9YA 1O94A 3AEDA 3NYCA 3SM8A 4OPLA 3BI4A 5FS9A 1CC2A 1GTHA 1X31B 1NG4A 1PXBA 4OPUA 3KPFA 5BUKA 1RYIA 3G5RA 2HQMA 3UP4A 4ZN0A 3VR8A 2YG4A 3C4NA 3ICTA 3KLJA 5KXJA 3RP7A 1FEBA 3GDNA 3C96A 4YSYA 2WOWA 1D4EA 1TYPA 2BCGG 3ABVA 4U8LA 3GWFA 3P1WA 4J33A 3EF6A 5TR3A 1GTEA 4PAAA 1LPFA 3M13A 3VRBA 4BK1A 4Z2UA 4H4UA 1Y56A 4FK1A 1B8SA 1IUSA 3CGBA 2YG6A 3L1RA 4IA5A 2Y6RA 3LOVA 1JU2A 4FX9A 2W0HA 5HY5A 2GB0A 4J2WA 1VG0A 1ZK7A 3K7TA 1TDEA 4YTPA 4J57A 3BI2A 3O0HA 2C75A 2Q0LA 4ADWA 3NYFA 3H4KA 2B9XA 2B7SA 2H88A 2WDQA 4CCQA 1E1MA 2YLRA 3P4RA 3DA1A 2YM1A 4NTCA 1JNZA 4EIQA 1BKWA 5FS7A 2VVMA 3UOZA 2O9ZA 4Z26A 1P2HA 2BACA 3CIRA 5KVIA 4DNAA 1W4XA 4YSXA 2TPRA 3QSMA 3CGDA 1NHSA 1QJDA 2NPXA 4O5QA 3V3OA 4BK2A 3DH9A 5LV9A 3DJGX 3NYEA 4B64A 4Z2RA 4CNKA 2WOIA 5JCLA 2C72A 3K30A 1D7LA 3RP8A 5BRTA 4BV6A 1D4DA 5KWFA 4JN9A 1GRGA 3CNJA 1RP0A 1H82A 2C73A 2JB1A 2WPEA 3NK1X 3NTDA 3M12A 2BXSA 4FK1C 4GDPA 4H4VA 2GMJA 1NHQA 4OPGA 1N4VA 4U8IA 3DGZA 5EOWA 1TYTA 4H50A 1PJ5A 1L9DA 2PYXA 3BHFA 3I6DA 2WPFA 3DK9A 3COXA 3VRDB 3EAOA 3UTHA 4A6NB 1M64A 1H84A 3KVEA 4Y4NA 2IVDA 2XVFA 2BABA 4Z2TA 1FEAA 3ITJA 3QVRA
chains in the Genus database with same CATH superfamily
1QO8A 1LVLA 3SFDA 2J3NA 3N4FA 1PN0A 3OP2A 3VCNA 4EQRA 3RNMA 2V6OA 2RGJA 3NKSA 4YTMA 2X50A 3UJSA 1BF3A 4TLXA 2WP6A 1CJ4A 1LQTA 2XVHA 2MNRA 5GSNA 2V61A 3M0OA 2YLSA 3BHKA 5M10A 4G74A 4OPDA 5EB4A 1F8WA 1R6WA 3SQPA 2GVCA 3NVVB 1X2HA 3GWDA 5CQFA 3DG6A 3DK8A 4NZHA 1P43A 1TDOA 3G5QA 3NS1B 5FS8A 3VC6A 4Z17A 1JRZA 4FDCB 3TW9A 4GYPC 2GRTA 2ZZ0A 4H4WA 1BGNA 3UXLA 3FVDA 1IUUA 1PBBA 1GERA 3ATQA 2VVLG 3E1TA 3ALJA 4IVMB 3SZWA 3GRTA 1H83A 4II2A 1SB3B 3K7MX 1FL2A 1LJ1A 2AL2A 3DGHA 4H4YA 4JY3A 5FJRA 2JBVA 5J04A 2PPGA 4EMWA 4REKA 1STZA 1VDCA 2GGJA 1GSNA 3AEFA 3ZLFA 1CBOA 1DOBA 3BI5A 3T2KA 1EL9A 1GRTA 4GAPA 2POZA 1PBDA 1BQGA 3L8KA 3OPSA 2YAUA 4TM0A 3GRSA 4UP3A 4GCMA 3MUCA 4Z25A 1DOCA 2X3NA 1KKOA 3UOXA 1N1PA 2OKTA 3PK7A 1EL7A 4H83A 1XS2A 2C3CA 2GEWA 2R45A 4NEWA 3FG2P 2ARDA 4XXGA 4GRTA 1Z6LA 5DBJA 4B66A 3NK0X 1B5QA 2QJNA 3UTEA 3V3NA 5FJTA 1ZOVA 1AOGA 1LV0A 2XFNA 4A79A 3AEBA 4MJWA 3P3BA 4KT2A 3P0WA 4EWJA 3BSMA 3NO1A 2DKHA 4K5RA 3GMCA 3NK2X 3S61A 4A65A 2XH4A 1GRFA 3NXLA 4EQWA 2RABA 1VQWA 1KFYA 3AE6A 2WP5A 4Z24A 3CNDA 4CY8A 3QTPA 4G9KA 3BOXA 3MSYA 1H6VA 5IQ1A 4G8TA 4NEVA 3HYVA 1GEUA 3ICSA 4UDRA 3OTRA 5KRQA 2BC0A 4U8OA 2VRMA 1OJDA 4U8PA 4YSHA 3PG6A 4E4FA 3S5SA 2PP1A 2BS4A 4K1WA 1S2YA 2IVEA 2PP0A 1QLBA 3NZGA 4ECHA 3D46A 3T0KA 1B37A 3T2YA 2IIDA 3DIPA 1B4VA 4CNJA 4HB9A 3MY9A 5C3JA 2R0CA 5FJUA 3HYWA 1N62C 4AT2A 2A8XA 3II4A 2OG9A 1EBGA 3KA7A 1E6EA 1ZY8A 3IHGA 4HPNA 2CFYA 1NAAA 2ACZA 1BKHA 2AQJA 3I4KA 3HYXA 4EQXA 3T4WA 5FS6A 2NQLA 3T37A 4G7FA 5EU9A 4LIIA 3RITA 4GDEA 4MKSA 4ROPA 3GYIA 4IP4A 1JEHA 7ENLA 2A87A 3URHA 2ZC8A 2FJAA 3FXGA 1RVKA 4DXKA 2FKPA 1E7PA 3I6EA 3ES7A 2C3DA 3U4FA 1GNDA 1NHPA 1TDKA 4J31A 3CXBA 1UKVG 3FYYA 3VQRA 1H7XA 3RP6A 1NPXA 3ISHA 4KX6A 4LA1A 3DESA 3NVWB 5JCKA 1TRBA 4K22A 2GQFA 4H19A 3LB8A 1JDFA 4CBQA 1Q9IA 2VQ7A 1O94A 3AEDA 3Q45A 3BI4A 5BOFA 1RYIA 2HQMA 3ICTA 2WOWA 1FO4A 1TYPA 1EC7A 2BCGG 3UCDA 3P1WA 4J33A 1S7MA 3M13A 4BK1A 4H4UA 3L1RA 3CYJA 1JU2A 4FX9A 4TVWA 2GB0A 1VG0A 1WUEA 1TDEA 4YTPA 3BI2A 2C75A 3EKGA 3DFHA 3P4RA 4EIQA 1W6TA 2HXTA 5KVIA 4YSXA 2PU1A 1NHSA 2NPXA 3V3OA 4E8GA 5LV9A 2OO6A 3K30A 1D7LA 4BV6A 5KWFA 3A7RA 3A7UA 2JB1A 4GDPA 4OPGA 4A3RA 5EOWA 1TYTA 4H50A 1L9DA 3BHFA 2WPFA 2OX4A 4Y4NA 1OEPA 3I3LA 4B68A 3NN6X 2A89A 3GDPA 1XANA 3T9PA 3ZDNA 3LZXA 3VRAA 3DMEA 4E5TA 1YY5A 3OZYA 4H2QA 2C65A 1IUWA 4DHGA 4AP3A 2C70A 1Y0PA 2XSXA 3UJ2A 1PDYA 4N9XA 3GC2A 4E4UA 4IA6A 2R4EA 1ZOYA 2PA6A 4HA6A 3CT2A 3UOYA 4YTNA 2GF3A 3QN3A 3UTFA 2BA9A 4CRTA 2WP9A 2OA1A 3H12A 3AYJA 4A9WA 3CTYA 4K8GA 2C64A 1N4WA 2YQUA 1RM6B 1V97A 1DODA 1PBCA 5HXIA 2PGWA 4M52A 1N61C 4B67A 3UXKA 2BK5A 3CGEA 2TMDA 3UKPA 3TWAA 3R07C 2V3BA 4A5LA 5BULA 1JPMA 1F6MA 5FJOA 3TWBA 3AEAA 1MO9A 1ZX9A 2OFJA 4GISA 1TKKA 3KPKA 2BS3A 4HCHA 2BYBA 3AE3A 3P4QA 3P9UA 2OQHA 2Q0KA 1VRQB 4CY6A 2WEUA 3VR9A 2NVKX 4HNCA 2PMQA 2FJEA 3IK4A 1KN0A 3ZLGA 2OLOA 2VVLA 1O95A 5CKUA 3VDGA 4H2NA 4EM4A 2YLWA 1E1NA 1ZMDA 3R10A 2PTZA 3F8RA 1KCZA 2Q7VA 4C3YA 3TJIA 3PO7A 4WCTA 3KUMA 1KSUA 2B76A 2YR5A 4TM3A 4J56A 2GGGA 2AKMA 1PBFA 2W55A 4H4ZA 4IT1A 5G5GB 4M6UA 1PS9A 5KMPA 1IUVA 1NHRA 3C4AA 5G5HB 3ALMA 2DW7A 2X8GA 4Z43A 1KD0A 4C74A 3AE4A 2PODA 2WQYA 4TM1A 1L0VA 3U9IA 2EQ8A 3RHAA 3NNEA 1SEZA 2OLNA 4J36A 2WHDA 4GF7A 1LTXR 4JDRA 3AM9A 2MUCA 3CPIG 1D7YA 3UCLA 4CCRA 2RGHA 1VG9A 4IZGA 1GESA 4AP1A 1TDNA 1ZMCA 2YG5A 4Z1YA 2E5VA 3IHMA 3ETRB 4JQ9A 4ZCCA 1F8SA 2OALA 1GREA 2APGA 3UTGA 3AEGA 4A7AA 3LXDA 2WBAA 4C77A 3KU9A 3SGLA 3NLCA 4E6MA 1JCTA 3IC9A 2YVGA 1IJHA 1XPQA 2XDOA 4DSHA 1PJ7A 2YM2A 1BWCA 4OPCA 3NVZB 4UDPA 1D5TA 2BK4A 1R0MA 1EL8A 3TCSA 1FIQB 4HNLA 3V5CA 1FECA 2R9ZA 1HYUA 2QAEA 4H2HA 2XLRA 3UKLA 4ENLA 2WU5A 4G6HA 1OJCA 1GRAA 5U25A 2V60A 3EUB3 4KEMA 2AR8A 4BJZA 3OC4A 3FMWA 3T2ZA 3BNUA 3NIXA 2PP3A 4YSZA 1EBDA 2XH2A 2BS2A 3ENLA 1MDLA 4B69A 3GD6A 1SJDA 3D47A 2GAGB 3OZMA 4GFIA 2GQWA 4H4QA 1H7WA 1MUCA 2YWLA 2CULA 4XWRA 2XLTA 2B7RA 4H4TA 1DJNA 4AT0A 3KD9A 3CGCA 3REDA 1GV4A 4ICYA 3NH3X 4EMIA 3BNMA 5J60A 2E5AA 2DW6A 1ONEA 3QJ4A 3AD9B 3DDMA 3AE5A 2WDRA 1TE6A 1F8RA 2ZADA 4BJYA 1ZKQA 1BZLA 3UKHA 3H7VA 2FJDA 3MZNA 3ZVHB 3NYCA 4OPLA 1GTHA 1X31B 3UCCA 1PXBA 4OPUA 1SJAA 3VR8A 4ZN0A 3C4NA 3KLJA 2C4CA 3GDNA 1WYGA 2OVLA 2QDDA 3EF6A 6ENLA 4Z2UA 3VRBA 4FK1A 2AL2B 2PTYA 2OQYA 1IUSA 2YG6A 4II3A 2Y6RA 3PWIA 3K7TA 3THUA 4G73A 3H4KA 2B7SA 2H88A 2WDQA 1E1MA 3R0KA 1NELA 3UOZA 3NFUA 2BACA 3CIRA 4DNAA 3HW2A 4B64A 4Z2RA 4MMWA 2C72A 2QQ6A 5KMRA 3ZVHA 1GRGA 3CNJA 1H82A 2PGEA 4FK1C 4H4VA 3N4EA 1NHQA 2W54A 4U8IA 2PTWA 4KPLA 2OPJA 2CHRA 2XVFA 5ENLA 1YEYA 4Z2TA 2RDXA 2E1MA 2JKCA 4H4PA 3LADA 1V59A 4JN7A 2C76A 1PDHA 3AE1A 3R0UA 1NG3A 2UZZA 2YVFA 2XVEA 3AE7A 1CJ2A 2GH5A 3DGBA 2BXRA 4NWZA 3TQPA 1K0IA 2WS3A 2WPCA 2H89A 4X9MA 1VQZA 5JCIA 4USQA 3HZLA 4C3XA 3MQTA 1N4UA 5KVHA 3CPJG 4GGHA 4J34A 1K0LA 1VDVA 4USRA 1FFVC 4ZOHB 4KWSA 4BK3A 3ALLA 1H81A 2GDQA 2YLZA 1N5XA 3H8LA 3GSIA 5EB5A 4C5OA 4MGGA 1S2QA 3AE9A 5HHFA 2BK3A 5KOWA 2GGHA 1Q1RA 1CF3A 1GETA 1OJAA 3N6HA 1T3QC 2VOUA 1MRAA 4IL0A 1K0JA 1NDAA 3PFRA 4GUVA 4DYEA 4BURA 3GMBA 1KF6A 2WU2A 1FOHA 3VFCA 3ES8A 3DEQA 1BGJA 3UP5A 4GIRA 1DNCA 1GRHA 2P0IA 4U8KA 3CNSA 1GALA 1RSGA 3NRZB 1ELIA 2O56A 5KNLA 2JAEA 3JSKA 3VC5A 4H2PA 3AB1A 5HYMA 1TZZA 2R0PA 3K7QX 3SZFA 3SX6A 3QFAA 3FPZA 4DSGA 2CVJA 4U8NA 3SXIA 4Y4LA 1ZDLA 5EBKA 1FFUC 3BJSA 2YR4A 2VZ2A 1YQZA 1CJ3A 2Q6UA 1XHCA 3RCYA 1PXAA 3CPHG 3WE0A 2HNEA 3ADAB 4OPTA 3TJ4A 1S3BA 3QFBA 1JOAA 3T6CA 1MDRA 4GAVA 5L46A 2FJBA 2YR6A 1JNRA 4HYRA 1IUXA 3T8QA 1COYA 3V5FA 2BC1A 3P4SA 2QGYA 3HRDC 3L5OA 3V3WA 2C66A 1CL0A 1Y56B 1IUTA 3R9UA 3H70A 2W3RA 1EC8A 2R0GA 2Z5XA 3FV9A 1N60C 2EQ9A 1K4QA 4YWSA 1NEKA 3CB3A 3NTAA 5KMSA 2AAQA 3SY4A 1S3EA 4IVOB 3CMMA 1F9CA 1D4CA 4D03A 3UKFA 3STPA 3AXBA 3PWGA 1E1KA 1E9IA 3IJIA 3UKKA 3R11A 4JY2A 1F3PA 4A99A 4LU6A 1PHHA 3AE8A 5C2TA 2GR3A 3N6JA 3NG7X 2QCUA 4GR1A 5GRTA 3CXOA 2P3ZA 4I58A 2XCGA 2ZBWA 3DERA 1MNSA 1O5WA 1FCDA 3S47A 2BRYA 3EEZA 3RGTA 4YWOA 3AD7B 2EQ7A 2OAMA 4E0VA 4ZCDA 3H8AA 1NENA 2P8CA 4H4SA 1GPEA 5JCMA 1KNRA 1YQ3A 3B9JB 5IQ4A 4H4RA 5J7XA 3GO2A 4FI4A 4TM4A 2V3AA 4U2TA 4DN1A 1ZXIC 3AYLA 3NT6A 4YKFA 4JHMA 3AEEA 5KOXA 1MXTA 2WDVA 1KKRA 1GRBA 1JRPA 2YVJA 4EQSA 2GAHB 3ATRA 4K5SA 3VA8A 1WUFA 3DFYA 3SZ0A 2FYMA 2BCPA 2Y6QA 1OJ9A 2OZTA 4H2RA 2WETA 1CJCA 2XVJA 3AMZA 1EBHA 2QJMA 1CC4A 3EANA 3FJ4A 4HN8A 5FS9A 1NG4A 3KPFA 3UP4A 2YG4A 5KXJA 3RP7A 4X2PA 3C96A 4YSYA 4FP1A 2AKZA 3RR1A 3ABVA 4U8LA 2PTXA 2GGEA 2BRAA 1LPFA 4HCLA 1Y56A 1NU5A 3CGBA 1ECQA 4IA5A 4H1ZA 5HY5A 4J2WA 1ZK7A 4J57A 3O0HA 2YLRA 3DA1A 3SN4A 2YM1A 4NTCA 2VVMA 1SJBA 3GYXA 2TPRA 3CGDA 1QJDA 4O5QA 4JN8A 4BK2A 3DH9A 3DJGX 3DG7A 3B97A 5BRTA 1D4DA 4JN9A 4J1OA 1RP0A 2C73A 3NK1X 3NTDA 3M12A 1PDZA 2GMJA 1N4VA 3DGZA 2PYXA 3I6DA 3COXA 4A6NB 1M64A 2IVDA 2QVHA 3ITJA 1P48A 5FMHA 4JNAA 3SN1A 4RSLA 3P93A 2PHHA 3SFEA 2X99A 2XFPA 3AD8B 4M0XA 1CHUA 1KNPA 3LJPA 4B63A 2AL1A 2B9WA 1XPYA 1OJTA 3MKCA 2YG3A 2XGZA 3AECA 4NTDA 2XLUA 4F4RA 3CK5A 2QDEA 2EQ6A 4DWDA 4U8MA 3CNTA 4G6GA 4YKGA 2QJJA 3B6DA 3UKAA 2PCEA 2F5ZA 2DKIA 3MWCA 2Z5YA 2P88A 3EPTA 4IHCA 4WX1A 3SZCA 2P8BA 3NRNA 3JW7A 3QVPA 3A7AA 4OVIA 3ICRA 1PXCA 4PABA 2PU0A 3DJJA 3FCPA 2GMHA 1E39A 2XLSA 3SJNA 1IYXA 4JNQA 3D1CA 3NGCX 4XWZA 4RG3A 1GT8A 3F8PA 5BVAA 3KKJA 4APNA 2C67A 4NTEA 3OW1A 4U8JA 1FHVA 2QA1A 3TOYA 4K2XA 2QA2A 1YQ4A 3AWIA 2XLPA 3AE2A 3DG3A 2GV8A 5JCNA 4YT0A 4AOXA 3QLDA 3T14A 3JVAA 2VQBA 2XVIA 2PS2A 3GD4A 2ZZBA 2ZZCA 3D8XA 2YLXA 4B65A 4ZCWA 2XH7A 4H4XA 1GOSA 1ZP0A 3R1ZA 3HPFA 1M6IA 3PVCA 3IWAA 3UJRA 1H2IA 3OZ2A 4IV9A 4B1BA 4X9NA 3R25A 3FBSA 3CN8A 4HCDA 2WOVA 3IJQA 1MOKA 4DGKA 1DXLA 4A35A 2JB3A 1GXFA 4D04A 4EIPA 3GYJA 3I6TA 3GD3A 1X2GA 5U1OA 3G5SA 3SYIA 4P9SA 1REOA 1KDGA 1JRYA 5BOEA 4O5UA 3V76A 4U2LA 1KSSA 4I59A 3H8IA 2YG7A 2JB2A 1PBEA 3UOVA 4KPRA 2XFQA 3DJDA 4RG4A 2R4JA 2FBWA 1DJQA 2XYOA 5IDZA 4EMJA 4H7UA 3PS9A 2I0ZA 3T31A 2GR1A 2V5ZA 4UDQA 5JRBA 3AN1A 3LZWA 1H86A 1XDIA 4U2SA 4IP5A 3P4PA 3QSEA 1JPDX 3CAWA 3TTEA 1L9CA 1JRXA 3K1GA 4TLZA 3QPEA 3SN0A 3NHOX 2GSHA 2C7GA 2XFUA 2XFOA 3QSSA 3ZVIA 3UKQA 2GR0A 5ER0A 2E4GA 4YXDA 4AOSA 3CNPA 4ZA0A 2JK6A 4X4JA 4K8DA 1CC6A 3F8DA 1DOEA 1L8PA 1PJ6A 3DK4A 1ONFA 1YKJA 1EL5A 2OZ3A 3Q9TA 1JROA 1Q1WA 2X8HA 4J3ZA 2VRLA 1LQUA 1N5WC 2R46A 3ZYXA 2X8CA 4A6GA 4GGBA 2GR2A 5IPYA 1TDFA 1DTNA 3B3RA 4Z44A 4K7ZA 4DX3A 5M0ZA 2RGOA 3SQSA 3VCCA 3IJLA 3SR6B 3NVYB 2E3TA 4A6NA 1EC9A 3RO6A 4OPIA 1SJCA 2CDUA 3GY1A 3Q6JA 3FIMB 3NN0X 1P2EA 2GL5A 4GYPA 1FHUA 3Q4DA 3AYIA 3IF9A 1L9EA 4OCGA 3S5WA 4EM3A 2WESA 2YLTA 5U63A 1E1LA 3UJEA 4Y4MA 3DJEA 2OZ8A 2B9YA 3UJFA 3SM8A 1CC2A 3ZLHA 5BUKA 3G5RA 5KMQA 5FJPA 1FEBA 3D9XA 1D4EA 3GWFA 1ELSA 5TR3A 1GTEA 4PAAA 1B8SA 1N63C 3LOVA 2W0HA 2Q0LA 4K2SA 4ADWA 3NYFA 2GGIA 2B9XA 2W3SA 2ONEA 4CCQA 2HXUA 3SBFA 1JNZA 1BKWA 5FS7A 2O9ZA 4Z26A 1P2HA 3JZUA 2OLAA 1W4XA 3QSMA 3UGVA 3NYEA 4TVYA 4NNJA 2XH0A 4CNKA 2WOIA 5JCLA 3V4BA 3RP8A 3QKEA 2I5QA 2WPEA 2BXSA 3RRAA 4IL2A 2PSNA 4GMEA 3SSZA 1PJ5A 3DK9A 3VRDB 3EAOA 3UTHA 1H84A 2HZGA 3KVEA 2BABA 1FEAA 3QVRA
chains in the Genus database with same CATH topology
2E1MA 3I3LA 1QO8A 1LVLA 5FMHA 2JKCA 4H4PA 3SFDA 2J3NA 4JNAA 4RSLA 4B68A 3LADA 3NN6X 1V59A 2A89A 2PHHA 2C76A 3GDPA 2X99A 1PDHA 2XFPA 1XANA 3AE1A 1PN0A 3SFEA 3AD8B 4EQRA 1NG3A 1CHUA 1KNPA 2UZZA 2YVFA 3RNMA 2V6OA 3LJPA 2RGJA 2XVEA 3NKSA 4YTMA 2X50A 1BF3A 4B63A 4TLXA 2B9WA 3AE7A 2WP6A 1CJ4A 3LZXA 3VRAA 1LQTA 2XVHA 3ZDNA 1CJ2A 5GSNA 2GH5A 3DMEA 2BXRA 4NWZA 1YY5A 1OJTA 2V61A 3M0OA 2YLSA 4H2QA 2YG3A 5C2TA 2C65A 3BHKA 5M10A 1IUWA 4AP3A 2C70A 1K0IA 1Y0PA 4G74A 4OPDA 2WS3A 1F8WA 2WPCA 2H89A 3AECA 4N9XA 2XLUA 4NTDA 4X9MA 4IA6A 3SQPA 5JCIA 4USQA 2R4EA 1ZOYA 3HZLA 2EQ6A 4C3XA 4U8MA 2GVCA 3CNTA 4HA6A 4G6GA 4YKGA 1N4UA 5KVHA 3CPJG 4J34A 1K0LA 3B6DA 3GWDA 5CQFA 4USRA 3UKAA 3UOYA 4YTNA 3DK8A 4NZHA 1TDOA 2GF3A 3G5QA 5FS8A 3UTFA 2F5ZA 2BA9A 4CRTA 2WP9A 2OA1A 2DKIA 4BK3A 3ALLA 1H81A 3AYJA 1JRZA 4FDCB 4A9WA 2YLZA 3CTYA 2Z5YA 2C64A 1N4WA 2GRTA 2ZZ0A 2YQUA 4H4WA 1BGNA 3EPTA 3H8LA 1DODA 3GSIA 5EB5A 4WX1A 3SZCA 4C5OA 1PBCA 1IUUA 3NRNA 5HXIA 1PBBA 3QVPA 4M52A 4OVIA 3ICRA 4B67A 1S2QA 1GERA 1PXCA 3ATQA 3AE9A 2BK5A 5HHFA 2BK3A 4PABA 5KOWA 1Q1RA 3CGEA 3DJJA 2GMHA 2TMDA 2VVLG 1CF3A 3UKPA 1GETA 1OJAA 3E1TA 3ALJA 2VOUA 2V3BA 1E39A 1K0JA 4A5LA 2XLSA 5BULA 4IVMB 1NDAA 3SZWA 3GRTA 1H83A 1F6MA 3AEAA 4II2A 4JNQA 4GUVA 3K7MX 1FL2A 3D1CA 1LJ1A 1MO9A 1ZX9A 4BURA 3NGCX 3DGHA 4H4YA 3GMBA 4JY3A 1KF6A 3KPKA 2BS3A 2JBVA 2WU2A 4XWZA 2BYBA 3AE3A 3P4QA 4EMWA 1FOHA 4RG3A 1GT8A 3F8PA 4REKA 1VDCA 5BVAA 3P9UA 3KKJA 4APNA 1GSNA 3AEFA 2C67A 4NTEA 1DOBA 1CBOA 2Q0KA 4U8JA 1VRQB 4CY6A 2WEUA 3VR9A 2QA1A 2NVKX 1BGJA 3UP5A 3BI5A 3T2KA 2FJEA 1EL9A 1GRTA 1DNCA 1GRHA 1KN0A 4GAPA 4K2XA 2QA2A 2OLOA 4U8KA 1YQ4A 1PBDA 3CNSA 3AWIA 3L8KA 1GALA 1RSGA 1ELIA 5KNLA 2JAEA 2VVLA 2XLPA 1O95A 3AE2A 3JSKA 5CKUA 2YAUA 2GV8A 4H2PA 4TM0A 5JCNA 3AB1A 4H2NA 4EM4A 4YT0A 2YLWA 5HYMA 2R0PA 1E1NA 3K7QX 3GRSA 4UP3A 3SZFA 3SX6A 1ZMDA 3T14A 4AOXA 4GCMA 3QFAA 2VQBA 2XVIA 3FPZA 3GD4A 2ZZBA 4DSGA 2ZZCA 2CVJA 3D8XA 4Z25A 2YLXA 4U8NA 4A99A 1DOCA 4B65A 3SXIA 2X3NA 3F8RA 4Y4LA 1ZDLA 5EBKA 3UOXA 2Q7VA 4H4XA 1GOSA 1ZP0A 1N1PA 3PO7A 4C3YA 2YR4A 1EL7A 4WCTA 1KSUA 1M6IA 2B76A 1YQZA 2VZ2A 3PVCA 1CJ3A 2YR5A 3IWAA 1H2IA 2Q6UA 4TM3A 4J56A 1XHCA 3OZ2A 2C3CA 1PBFA 1PXAA 2GEWA 4IV9A 4B1BA 4X9NA 3CPHG 4H4ZA 2R45A 3WE0A 3ADAB 4NEWA 3FBSA 4OPTA 3CN8A 1S3BA 3QFBA 3FG2P 2ARDA 4XXGA 4GRTA 1PS9A 1JOAA 2WOVA 1Z6LA 1IUVA 1NHRA 5DBJA 1MOKA 4B66A 5KMPA 3C4AA 3NK0X 1B5QA 3ALMA 5L46A 2X8GA 4GAVA 4DGKA 2FJBA 1DXLA 2JB3A 3UTEA 4Z43A 3V3NA 2YR6A 1GXFA 4D04A 1ZOVA 1AOGA 4EIPA 1JNRA 3GYJA 1LV0A 1IUXA 2XFNA 4A79A 4C74A 3AE4A 3GD3A 5U1OA 3AEBA 1COYA 4MJWA 3G5SA 2BC1A 3SYIA 2WQYA 4TM1A 3P4SA 4P9SA 1L0VA 2EQ8A 1REOA 1KDGA 3RHAA 3NNEA 1SEZA 1JRYA 3L5OA 2DKHA 2OLNA 4K5RA 4O5UA 3GMCA 3NK2X 4J36A 3V76A 3S61A 2C66A 4A65A 1CL0A 4U2LA 1KSSA 2WHDA 4GF7A 1LTXR 1Y56B 4I59A 3H8IA 4JDRA 1IUTA 3R9UA 2YG7A 1GRFA 4EQWA 2RABA 2JB2A 3CPIG 1PBEA 1D7YA 3UOVA 1VQWA 3UCLA 4KPRA 2R0GA 2Z5XA 4CCRA 2XFQA 3DJDA 4RG4A 2RGHA 1KFYA 3AE6A 1VG9A 2R4JA 2WP5A 4AP1A 1GESA 1TDNA 2FBWA 1ZMCA 4Z24A 1DJQA 2YG5A 2XYOA 2E5VA 3CNDA 3IHMA 2EQ9A 1K4QA 4EMJA 4CY8A 4H7UA 3PS9A 1NEKA 4JQ9A 2I0ZA 3T31A 2GR1A 3NTAA 5KMSA 4ZCCA 2V5ZA 4UDQA 5JRBA 3LZWA 1F8SA 2OALA 4G9KA 2AAQA 1XDIA 1H86A 3SY4A 4U2SA 3P4PA 1GREA 1H6VA 1S3EA 4IVOB 5IQ1A 2APGA 3CMMA 3UTGA 3AEGA 4A7AA 1D4CA 3QSEA 3LXDA 2WBAA 4NEVA 3HYVA 4C77A 1GEUA 3UKFA 3ICSA 4D03A 4UDRA 3KU9A 1L9CA 3SGLA 3NLCA 5KRQA 1JRXA 2BC0A 3IC9A 3AXBA 2YVGA 2VRMA 1E1KA 4TLZA 1IJHA 4U8OA 1XPQA 1OJDA 4U8PA 3UKKA 2XDOA 4DSHA 1PJ7A 2YM2A 1BWCA 3NHOX 4OPCA 4YSHA 3PG6A 4JY2A 4UDPA 1F3PA 2C7GA 2XFUA 1D5TA 2BS4A 2XFOA 1PHHA 3AE8A 2BK4A 2GR3A 3QSSA 1EL8A 3NG7X 4LU6A 2QCUA 3UKQA 4GR1A 2GR0A 1S2YA 5GRTA 2IVEA 1FECA 5ER0A 2R9ZA 2E4GA 4YXDA 1HYUA 4AOSA 4I58A 2XCGA 3CNPA 2ZBWA 2QAEA 2JK6A 4X4JA 2XLRA 4K8DA 2WU5A 1O5WA 1QLBA 4G6HA 1CC6A 3UKLA 1FCDA 1OJCA 3T0KA 4ECHA 1GRAA 1B37A 5U25A 3T2YA 2IIDA 2V60A 3F8DA 1DOEA 1B4VA 4CNJA 2BRYA 4HB9A 1PJ6A 5C3JA 2R0CA 3DK4A 3HYWA 1ONFA 4AT2A 2A8XA 3II4A 4YWOA 2AR8A 1YKJA 3AD7B 2EQ7A 3OC4A 1E6EA 3KA7A 4BJZA 1ZY8A 2OAMA 3FMWA 3T2ZA 1EL5A 3IHGA 3BNUA 4E0VA 3Q9TA 2CFYA 1NAAA 2ACZA 2AQJA 1Q1WA 3NIXA 2X8HA 4ZCDA 2VRLA 3HYXA 4YSZA 1NENA 4EQXA 1LQUA 5FS6A 1EBDA 2R46A 3ZYXA 2X8CA 4H4SA 2BS2A 3T37A 1GPEA 4B69A 2GR2A 4LIIA 5JCMA 5IPYA 1KNRA 1YQ3A 4GDEA 2GAGB 3GYIA 5IQ4A 1JEHA 1TDFA 3B3RA 2A87A 4H4RA 5J7XA 4Z44A 4TM4A 2V3AA 4U2TA 2GQWA 3URHA 4H4QA 4K7ZA 1H7WA 2RGOA 5M0ZA 2YWLA 2CULA 3AYLA 2XLTA 4XWRA 2FJAA 2B7RA 3NT6A 4H4TA 1DJNA 4YKFA 4AT0A 3AEEA 5KOXA 1E7PA 1MXTA 2WDVA 4A6NA 2C3DA 1GNDA 1NHPA 1TDKA 4J31A 4OPIA 1GRBA 1UKVG 2CDUA 3KD9A 3CGCA 4EQSA 2YVJA 3Q6JA 2GAHB 3REDA 3ATRA 4K5SA 3FIMB 1GV4A 3VQRA 4ICYA 3NH3X 4EMIA 1P2EA 3NN0X 3AYIA 1H7XA 3BNMA 5J60A 3SZ0A 3RP6A 2BCPA 3IF9A 1NPXA 2Y6QA 3ISHA 1L9EA 4KX6A 1OJ9A 4LA1A 3QJ4A 4OCGA 4H2RA 3S5WA 2WETA 1CJCA 3AD9B 3AE5A 2XVJA 5JCKA 1TRBA 2WDRA 4K22A 1F8RA 5EB4A 2GQFA 3LB8A 4EM3A 2WESA 2YLTA 1CC4A 4BJYA 1ZKQA 4CBQA 1BZLA 3UKHA 5U63A 3EANA 1Q9IA 2VQ7A 1E1LA 2FJDA 4Y4MA 3DJEA 2B9YA 1O94A 3AEDA 3NYCA 3SM8A 4OPLA 3BI4A 5FS9A 1CC2A 1GTHA 1X31B 1NG4A 1PXBA 4OPUA 3KPFA 5BUKA 1RYIA 3G5RA 2HQMA 3UP4A 4ZN0A 3VR8A 2YG4A 3C4NA 3ICTA 5KMQA 3KLJA 2C4CA 5KXJA 3RP7A 1FEBA 3GDNA 3D9XA 3C96A 4YSYA 2WOWA 1D4EA 1TYPA 2BCGG 3ABVA 4U8LA 3GWFA 3P1WA 4J33A 3EF6A 2BRAA 5TR3A 1GTEA 4PAAA 1LPFA 1S7MA 3M13A 3VRBA 4BK1A 4Z2UA 4H4UA 1Y56A 4FK1A 1B8SA 1IUSA 3CGBA 2YG6A 3L1RA 4IA5A 2Y6RA 4II3A 3LOVA 1JU2A 4FX9A 2W0HA 5HY5A 2GB0A 4J2WA 1VG0A 1ZK7A 3K7TA 1TDEA 4YTPA 4J57A 3BI2A 3O0HA 2C75A 2Q0LA 4G73A 4ADWA 3NYFA 3H4KA 2B9XA 2B7SA 2H88A 2WDQA 4CCQA 1E1MA 2YLRA 3P4RA 3DA1A 2YM1A 4NTCA 1JNZA 4EIQA 1BKWA 5FS7A 2VVMA 3UOZA 2O9ZA 4Z26A 3GYXA 1P2HA 2BACA 3CIRA 5KVIA 4DNAA 1W4XA 4YSXA 2TPRA 3QSMA 3CGDA 1NHSA 1QJDA 2NPXA 4O5QA 3V3OA 4BK2A 3DH9A 5LV9A 3DJGX 3NYEA 4NNJA 4B64A 4Z2RA 4CNKA 2WOIA 5JCLA 2C72A 3K30A 1D7LA 3RP8A 5BRTA 4BV6A 5KMRA 1D4DA 5KWFA 4JN9A 1GRGA 3CNJA 1RP0A 1H82A 2C73A 2JB1A 2WPEA 3NK1X 3NTDA 3M12A 2BXSA 4FK1C 4GDPA 4H4VA 2GMJA 1NHQA 4OPGA 1N4VA 4U8IA 3DGZA 5EOWA 1TYTA 4H50A 1PJ5A 1L9DA 2PYXA 3BHFA 3I6DA 2WPFA 3DK9A 3COXA 3VRDB 3EAOA 3UTHA 4A6NB 1M64A 1H84A 3KVEA 4Y4NA 2IVDA 2XVFA 2BABA 4Z2TA 1FEAA 3ITJA 3QVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1M A;  3I3L A;  1QO8 A;  1LVL A;  5FMH A;  2JKC A;  4H4P A;  3SFD A;  2J3N A;  4JNA A;  4RSL A;  4B68 A;  3LAD A;  3NN6 X;  1V59 A;  2A89 A;  2PHH A;  2C76 A;  3GDP A;  2X99 A;  1PDH A;  2XFP A;  1XAN A;  3AE1 A;  1PN0 A;  3SFE A;  3AD8 B;  4EQR A;  1NG3 A;  1CHU A;  1KNP A;  2UZZ A;  2YVF A;  3RNM A;  2V6O A;  3LJP A;  2RGJ A;  2XVE A;  3NKS A;  4YTM A;  2X50 A;  1BF3 A;  4B63 A;  4TLX A;  2B9W A;  3AE7 A;  2WP6 A;  1CJ4 A;  3LZX A;  3VRA A;  1LQT A;  2XVH A;  3ZDN A;  1CJ2 A;  5GSN A;  2GH5 A;  3DME A;  2BXR A;  1YY5 A;  1OJT A;  2V61 A;  3M0O A;  2YLS A;  4H2Q A;  2YG3 A;  5C2T A;  2C65 A;  3BHK A;  5M10 A;  1IUW A;  4AP3 A;  2C70 A;  1K0I A;  1Y0P A;  4OPD A;  5EB4 A;  2WS3 A;  1F8W A;  2WPC A;  2H89 A;  3AEC A;  4N9X A;  2XLU A;  4NTD A;  4X9M A;  4IA6 A;  3SQP A;  5JCI A;  4USQ A;  2R4E A;  1ZOY A;  3HZL A;  2EQ6 A;  4C3X A;  4U8M A;  2GVC A;  3CNT A;  4HA6 A;  4YKG A;  1N4U A;  5KVH A;  3CPJ G;  4J34 A;  1K0L A;  3B6D A;  3GWD A;  5CQF A;  4USR A;  3UKA A;  3UOY A;  4YTN A;  3DK8 A;  4NZH A;  1TDO A;  2GF3 A;  3G5Q A;  5FS8 A;  3UTF A;  2F5Z A;  2BA9 A;  4CRT A;  2WP9 A;  2OA1 A;  2DKI A;  4BK3 A;  3ALL A;  1H81 A;  3AYJ A;  1JRZ A;  4FDC B;  4A9W A;  2YLZ A;  3CTY A;  2Z5Y A;  2C64 A;  1N4W A;  2GRT A;  2ZZ0 A;  2YQU A;  4H4W A;  1BGN A;  3EPT A;  3H8L A;  1DOD A;  3GSI A;  5EB5 A;  4WX1 A;  4C5O A;  1PBC A;  1IUU A;  3NRN A;  5HXI A;  1PBB A;  3QVP A;  4M52 A;  4OVI A;  3ICR A;  4B67 A;  1S2Q A;  1GER A;  1PXC A;  3ATQ A;  3AE9 A;  2BK5 A;  5HHF A;  2BK3 A;  4PAB A;  5KOW A;  1Q1R A;  3CGE A;  3DJJ A;  2GMH A;  2TMD A;  2VVL G;  1CF3 A;  3UKP A;  1GET A;  1OJA A;  3E1T A;  3ALJ A;  2VOU A;  2V3B A;  1E39 A;  1K0J A;  4A5L A;  2XLS A;  5BUL A;  4IVM B;  1NDA A;  3GRT A;  1H83 A;  1F6M A;  3AEA A;  4JNQ A;  4GUV A;  3K7M X;  1FL2 A;  3D1C A;  1LJ1 A;  1MO9 A;  1ZX9 A;  4BUR A;  3NGC X;  3DGH A;  4H4Y A;  3GMB A;  4JY3 A;  1KF6 A;  2BS3 A;  2JBV A;  2WU2 A;  4XWZ A;  2BYB A;  3AE3 A;  3P4Q A;  4EMW A;  1FOH A;  4RG3 A;  1GT8 A;  3F8P A;  4REK A;  1VDC A;  5BVA A;  3P9U A;  3KKJ A;  4APN A;  1GSN A;  3AEF A;  2C67 A;  4NTE A;  1DOB A;  1CBO A;  2Q0K A;  4U8J A;  1VRQ B;  4CY6 A;  2WEU A;  3VR9 A;  2QA1 A;  2NVK X;  1BGJ A;  3UP5 A;  3BI5 A;  2FJE A;  1EL9 A;  1GRT A;  1DNC A;  1GRH A;  4K2X A;  4U8K A;  2QA2 A;  2OLO A;  1YQ4 A;  1PBD A;  3CNS A;  3AWI A;  3L8K A;  1GAL A;  1RSG A;  1ELI A;  2JAE A;  2VVL A;  2XLP A;  1O95 A;  3AE2 A;  3JSK A;  5CKU A;  2YAU A;  2GV8 A;  4H2P A;  4TM0 A;  5JCN A;  3AB1 A;  4H2N A;  4EM4 A;  4YT0 A;  2YLW A;  5HYM A;  2R0P A;  1E1N A;  3K7Q X;  3GRS A;  4UP3 A;  1ZMD A;  4AOX A;  4GCM A;  3QFA A;  2VQB A;  2XVI A;  3FPZ A;  3GD4 A;  2ZZB A;  4DSG A;  2ZZC A;  2CVJ A;  3D8X A;  4Z25 A;  2YLX A;  4U8N A;  4A99 A;  1DOC A;  4B65 A;  2X3N A;  3F8R A;  4Y4L A;  1ZDL A;  5EBK A;  3UOX A;  2Q7V A;  4H4X A;  1GOS A;  1ZP0 A;  1N1P A;  3PO7 A;  4C3Y A;  2YR4 A;  1EL7 A;  4WCT A;  1KSU A;  1M6I A;  2B76 A;  1YQZ A;  2VZ2 A;  3PVC A;  1CJ3 A;  2YR5 A;  3IWA A;  2Q6U A;  4TM3 A;  4J56 A;  1XHC A;  3OZ2 A;  2C3C A;  1PBF A;  1PXA A;  2GEW A;  4IV9 A;  4B1B A;  4X9N A;  3CPH G;  4H4Z A;  2R45 A;  3WE0 A;  3ADA B;  4NEW A;  3FBS A;  4OPT A;  3CN8 A;  1S3B A;  3QFB A;  3FG2 P;  2ARD A;  4XXG A;  4GRT A;  1PS9 A;  1JOA A;  2WOV A;  1Z6L A;  1IUV A;  1NHR A;  5DBJ A;  1MOK A;  4B66 A;  3C4A A;  3NK0 X;  1B5Q A;  3ALM A;  5L46 A;  2X8G A;  4DGK A;  4Z43 A;  2FJB A;  1DXL A;  2JB3 A;  3UTE A;  3V3N A;  2YR6 A;  1GXF A;  4D04 A;  1ZOV A;  1AOG A;  4EIP A;  1JNR A;  3GYJ A;  1LV0 A;  1IUX A;  2XFN A;  4A79 A;  4C74 A;  3AE4 A;  3GD3 A;  5U1O A;  3AEB A;  1COY A;  4MJW A;  3G5S A;  2BC1 A;  2WQY A;  4TM1 A;  3P4S A;  4P9S A;  1L0V A;  2EQ8 A;  1REO A;  1KDG A;  3RHA A;  3NNE A;  1SEZ A;  1JRY A;  2DKH A;  2OLN A;  4K5R A;  4O5U A;  3GMC A;  3NK2 X;  4J36 A;  3V76 A;  3S61 A;  2C66 A;  4A65 A;  1CL0 A;  4U2L A;  1KSS A;  2WHD A;  4GF7 A;  1LTX R;  1Y56 B;  4I59 A;  3H8I A;  4JDR A;  1IUT A;  3R9U A;  2YG7 A;  1GRF A;  4EQW A;  2RAB A;  2JB2 A;  3CPI G;  1PBE A;  1D7Y A;  3UOV A;  1VQW A;  3UCL A;  4KPR A;  2R0G A;  2Z5X A;  4CCR A;  2XFQ A;  3DJD A;  4RG4 A;  2RGH A;  1KFY A;  3AE6 A;  1VG9 A;  2R4J A;  2WP5 A;  4AP1 A;  1GES A;  1TDN A;  2FBW A;  1ZMC A;  4Z24 A;  1DJQ A;  2YG5 A;  2XYO A;  2E5V A;  3CND A;  3IHM A;  2EQ9 A;  1K4Q A;  4EMJ A;  4CY8 A;  4H7U A;  3PS9 A;  1NEK A;  4JQ9 A;  2I0Z A;  2GR1 A;  3NTA A;  4ZCC A;  2V5Z A;  4UDQ A;  3LZW A;  1F8S A;  2OAL A;  2AAQ A;  1XDI A;  1H86 A;  4U2S A;  3P4P A;  1GRE A;  1H6V A;  1S3E A;  4IVO B;  5IQ1 A;  2APG A;  3UTG A;  3AEG A;  4A7A A;  1D4C A;  3QSE A;  3LXD A;  2WBA A;  4NEV A;  4C77 A;  4D03 A;  1GEU A;  3UKF A;  3ICS A;  4UDR A;  3KU9 A;  1L9C A;  3SGL A;  3NLC A;  5KRQ A;  1JRX A;  2BC0 A;  3IC9 A;  3AXB A;  2YVG A;  2VRM A;  1E1K A;  4TLZ A;  1IJH A;  4U8O A;  1XPQ A;  1OJD A;  4U8P A;  3UKK A;  2XDO A;  4DSH A;  1PJ7 A;  2YM2 A;  1BWC A;  3NHO X;  4OPC A;  4YSH A;  4JY2 A;  4UDP A;  1F3P A;  2C7G A;  2XFU A;  1D5T A;  2BS4 A;  2XFO A;  1PHH A;  3AE8 A;  2BK4 A;  2GR3 A;  3QSS A;  1EL8 A;  3NG7 X;  4LU6 A;  2QCU A;  3UKQ A;  4GR1 A;  2GR0 A;  1S2Y A;  5GRT A;  2IVE A;  1FEC A;  5ER0 A;  2R9Z A;  2E4G A;  4YXD A;  1HYU A;  4AOS A;  4I58 A;  2XCG A;  3CNP A;  2ZBW A;  2QAE A;  2JK6 A;  4X4J A;  2XLR A;  4K8D A;  2WU5 A;  1O5W A;  1QLB A;  3UKL A;  1CC6 A;  1FCD A;  1OJC A;  4ECH A;  1GRA A;  1B37 A;  5U25 A;  2IID A;  2V60 A;  3F8D A;  1DOE A;  1B4V A;  4CNJ A;  4HB9 A;  1PJ6 A;  5C3J A;  2R0C A;  3DK4 A;  1ONF A;  4AT2 A;  2A8X A;  3II4 A;  4YWO A;  2AR8 A;  1YKJ A;  3AD7 B;  2EQ7 A;  3OC4 A;  1E6E A;  3KA7 A;  4BJZ A;  1ZY8 A;  2OAM A;  3FMW A;  1EL5 A;  3IHG A;  3BNU A;  4E0V A;  3Q9T A;  2CFY A;  1NAA A;  2ACZ A;  2AQJ A;  1Q1W A;  3NIX A;  2X8H A;  4ZCD A;  2VRL A;  4YSZ A;  1NEN A;  4EQX A;  1LQU A;  5FS6 A;  1EBD A;  2R46 A;  3ZYX A;  2X8C A;  4H4S A;  2BS2 A;  3T37 A;  1GPE A;  4B69 A;  2GR2 A;  4LII A;  5JCM A;  5IPY A;  1KNR A;  1YQ3 A;  4GDE A;  2GAG B;  3GYI A;  5IQ4 A;  1JEH A;  1TDF A;  3B3R A;  2A87 A;  4H4R A;  5J7X A;  4Z44 A;  4TM4 A;  2V3A A;  4U2T A;  2GQW A;  3URH A;  4H4Q A;  4K7Z A;  1H7W A;  2RGO A;  5M0Z A;  2YWL A;  2CUL A;  3AYL A;  2XLT A;  4XWR A;  2FJA A;  2B7R A;  3NT6 A;  4H4T A;  1DJN A;  4YKF A;  4AT0 A;  3AEE A;  5KOX A;  1E7P A;  1MXT A;  2WDV A;  4A6N A;  2C3D A;  1GND A;  1NHP A;  1TDK A;  4J31 A;  4OPI A;  1GRB A;  1UKV G;  2CDU A;  3KD9 A;  3CGC A;  4EQS A;  2YVJ A;  3Q6J A;  2GAH B;  3RED A;  3ATR A;  4K5S A;  3FIM B;  1GV4 A;  3VQR A;  4ICY A;  3NH3 X;  4EMI A;  1P2E A;  3NN0 X;  3AYI A;  1H7X A;  3BNM A;  5J60 A;  3RP6 A;  2BCP A;  3IF9 A;  1NPX A;  2Y6Q A;  3ISH A;  1L9E A;  4KX6 A;  1OJ9 A;  4LA1 A;  3QJ4 A;  4OCG A;  4H2R A;  3S5W A;  2WET A;  1CJC A;  3AD9 B;  3AE5 A;  2XVJ A;  5JCK A;  1TRB A;  2WDR A;  4K22 A;  1F8R A;  2GQF A;  3LB8 A;  4EM3 A;  2WES A;  2YLT A;  1CC4 A;  4BJY A;  1ZKQ A;  4CBQ A;  1BZL A;  3UKH A;  5U63 A;  3EAN A;  1Q9I A;  2VQ7 A;  1E1L A;  2FJD A;  4Y4M A;  3DJE A;  2B9Y A;  1O94 A;  3AED A;  3NYC A;  3SM8 A;  4OPL A;  3BI4 A;  5FS9 A;  1CC2 A;  1GTH A;  1X31 B;  1NG4 A;  1PXB A;  4OPU A;  3KPF A;  5BUK A;  1RYI A;  3G5R A;  2HQM A;  3UP4 A;  4ZN0 A;  3VR8 A;  2YG4 A;  3C4N A;  3ICT A;  3KLJ A;  5KXJ A;  3RP7 A;  1FEB A;  3GDN A;  3C96 A;  4YSY A;  2WOW A;  1D4E A;  1TYP A;  2BCG G;  3ABV A;  4U8L A;  3GWF A;  3P1W A;  4J33 A;  3EF6 A;  5TR3 A;  1GTE A;  4PAA A;  1LPF A;  3M13 A;  3VRB A;  4BK1 A;  4Z2U A;  4H4U A;  1Y56 A;  4FK1 A;  1B8S A;  1IUS A;  3CGB A;  2YG6 A;  3L1R A;  4IA5 A;  2Y6R A;  3LOV A;  1JU2 A;  4FX9 A;  2W0H A;  5HY5 A;  2GB0 A;  4J2W A;  1VG0 A;  1ZK7 A;  3K7T A;  1TDE A;  4YTP A;  4J57 A;  3BI2 A;  3O0H A;  2C75 A;  2Q0L A;  4ADW A;  3NYF A;  3H4K A;  2B9X A;  2B7S A;  2H88 A;  2WDQ A;  4CCQ A;  1E1M A;  2YLR A;  3P4R A;  3DA1 A;  2YM1 A;  4NTC A;  1JNZ A;  4EIQ A;  1BKW A;  5FS7 A;  2VVM A;  3UOZ A;  2O9Z A;  4Z26 A;  1P2H A;  2BAC A;  3CIR A;  5KVI A;  4DNA A;  1W4X A;  4YSX A;  2TPR A;  3QSM A;  3CGD A;  1NHS A;  1QJD A;  2NPX A;  4O5Q A;  3V3O A;  4BK2 A;  3DH9 A;  5LV9 A;  3DJG X;  3NYE A;  4B64 A;  4Z2R A;  4CNK A;  2WOI A;  5JCL A;  2C72 A;  3K30 A;  1D7L A;  3RP8 A;  5BRT A;  4BV6 A;  1D4D A;  5KWF A;  4JN9 A;  1GRG A;  3CNJ A;  1RP0 A;  1H82 A;  2C73 A;  2JB1 A;  2WPE A;  3NK1 X;  3NTD A;  3M12 A;  2BXS A;  4FK1 C;  4GDP A;  4H4V A;  2GMJ A;  1NHQ A;  4OPG A;  1N4V A;  4U8I A;  3DGZ A;  5EOW A;  1TYT A;  4H50 A;  1PJ5 A;  1L9D A;  2PYX A;  3BHF A;  3I6D A;  2WPF A;  3DK9 A;  3COX A;  3VRD B;  3EAO A;  3UTH A;  4A6N B;  1M64 A;  1H84 A;  3KVE A;  4Y4N A;  2IVD A;  2XVF A;  2BAB A;  4Z2T A;  1FEA A;  3ITJ A;  3QVR A; 
#chains in the Genus database with same CATH topology
 1QO8 A;  1LVL A;  3SFD A;  2J3N A;  3N4F A;  1PN0 A;  3OP2 A;  3VCN A;  4EQR A;  3RNM A;  2V6O A;  2RGJ A;  3NKS A;  4YTM A;  2X50 A;  3UJS A;  1BF3 A;  4TLX A;  2WP6 A;  1CJ4 A;  1LQT A;  2XVH A;  2MNR A;  5GSN A;  2V61 A;  3M0O A;  2YLS A;  3BHK A;  5M10 A;  4G74 A;  4OPD A;  5EB4 A;  1F8W A;  1R6W A;  3SQP A;  2GVC A;  3NVV B;  1X2H A;  3GWD A;  5CQF A;  3DG6 A;  3DK8 A;  4NZH A;  1P43 A;  1TDO A;  3G5Q A;  3NS1 B;  5FS8 A;  3VC6 A;  4Z17 A;  1JRZ A;  4FDC B;  3TW9 A;  4GYP C;  2GRT A;  2ZZ0 A;  4H4W A;  1BGN A;  3UXL A;  3FVD A;  1IUU A;  1PBB A;  1GER A;  3ATQ A;  2VVL G;  3E1T A;  3ALJ A;  4IVM B;  3SZW A;  3GRT A;  1H83 A;  4II2 A;  1SB3 B;  3K7M X;  1FL2 A;  1LJ1 A;  2AL2 A;  3DGH A;  4H4Y A;  4JY3 A;  5FJR A;  2JBV A;  5J04 A;  2PPG A;  4EMW A;  4REK A;  1STZ A;  1VDC A;  2GGJ A;  1GSN A;  3AEF A;  3ZLF A;  1CBO A;  1DOB A;  3BI5 A;  3T2K A;  1EL9 A;  1GRT A;  4GAP A;  2POZ A;  1PBD A;  1BQG A;  3L8K A;  3OPS A;  2YAU A;  4TM0 A;  3GRS A;  4UP3 A;  4GCM A;  3MUC A;  4Z25 A;  1DOC A;  2X3N A;  1KKO A;  3UOX A;  1N1P A;  2OKT A;  3PK7 A;  1EL7 A;  4H83 A;  1XS2 A;  2C3C A;  2GEW A;  2R45 A;  4NEW A;  3FG2 P;  2ARD A;  4XXG A;  4GRT A;  1Z6L A;  5DBJ A;  4B66 A;  3NK0 X;  1B5Q A;  2QJN A;  3UTE A;  3V3N A;  5FJT A;  1ZOV A;  1AOG A;  1LV0 A;  2XFN A;  4A79 A;  3AEB A;  4MJW A;  3P3B A;  4KT2 A;  3P0W A;  4EWJ A;  3BSM A;  3NO1 A;  2DKH A;  4K5R A;  3GMC A;  3NK2 X;  3S61 A;  4A65 A;  2XH4 A;  1GRF A;  3NXL A;  4EQW A;  2RAB A;  1VQW A;  1KFY A;  3AE6 A;  2WP5 A;  4Z24 A;  3CND A;  4CY8 A;  3QTP A;  4G9K A;  3BOX A;  3MSY A;  1H6V A;  5IQ1 A;  4G8T A;  4NEV A;  3HYV A;  1GEU A;  3ICS A;  4UDR A;  3OTR A;  5KRQ A;  2BC0 A;  4U8O A;  2VRM A;  1OJD A;  4U8P A;  4YSH A;  3PG6 A;  4E4F A;  3S5S A;  2PP1 A;  2BS4 A;  4K1W A;  1S2Y A;  2IVE A;  2PP0 A;  1QLB A;  3NZG A;  4ECH A;  3D46 A;  3T0K A;  1B37 A;  3T2Y A;  2IID A;  3DIP A;  1B4V A;  4CNJ A;  4HB9 A;  3MY9 A;  5C3J A;  2R0C A;  5FJU A;  3HYW A;  1N62 C;  4AT2 A;  2A8X A;  3II4 A;  2OG9 A;  1EBG A;  3KA7 A;  1E6E A;  1ZY8 A;  3IHG A;  4HPN A;  2CFY A;  1NAA A;  2ACZ A;  1BKH A;  2AQJ A;  3I4K A;  3HYX A;  4EQX A;  3T4W A;  5FS6 A;  2NQL A;  3T37 A;  4G7F A;  5EU9 A;  4LII A;  3RIT A;  4GDE A;  4MKS A;  4ROP A;  3GYI A;  4IP4 A;  1JEH A;  7ENL A;  2A87 A;  3URH A;  2ZC8 A;  2FJA A;  3FXG A;  1RVK A;  4DXK A;  2FKP A;  1E7P A;  3I6E A;  3ES7 A;  2C3D A;  3U4F A;  1GND A;  1NHP A;  1TDK A;  4J31 A;  3CXB A;  1UKV G;  3FYY A;  3VQR A;  1H7X A;  3RP6 A;  1NPX A;  3ISH A;  4KX6 A;  4LA1 A;  3DES A;  3NVW B;  5JCK A;  1TRB A;  4K22 A;  2GQF A;  4H19 A;  3LB8 A;  1JDF A;  4CBQ A;  1Q9I A;  2VQ7 A;  1O94 A;  3AED A;  3Q45 A;  3BI4 A;  5BOF A;  1RYI A;  2HQM A;  3ICT A;  2WOW A;  1FO4 A;  1TYP A;  1EC7 A;  2BCG G;  3UCD A;  3P1W A;  4J33 A;  1S7M A;  3M13 A;  4BK1 A;  4H4U A;  3L1R A;  3CYJ A;  1JU2 A;  4FX9 A;  4TVW A;  2GB0 A;  1VG0 A;  1WUE A;  1TDE A;  4YTP A;  3BI2 A;  2C75 A;  3EKG A;  3DFH A;  3P4R A;  4EIQ A;  1W6T A;  2HXT A;  5KVI A;  4YSX A;  2PU1 A;  1NHS A;  2NPX A;  3V3O A;  4E8G A;  5LV9 A;  2OO6 A;  3K30 A;  1D7L A;  4BV6 A;  5KWF A;  3A7R A;  3A7U A;  2JB1 A;  4GDP A;  4OPG A;  4A3R A;  5EOW A;  1TYT A;  4H50 A;  1L9D A;  3BHF A;  2WPF A;  2OX4 A;  4Y4N A;  1OEP A;  3I3L A;  4B68 A;  3NN6 X;  2A89 A;  3GDP A;  1XAN A;  3T9P A;  3ZDN A;  3LZX A;  3VRA A;  3DME A;  4E5T A;  1YY5 A;  3OZY A;  4H2Q A;  2C65 A;  1IUW A;  4DHG A;  4AP3 A;  2C70 A;  1Y0P A;  2XSX A;  3UJ2 A;  1PDY A;  4N9X A;  3GC2 A;  4E4U A;  4IA6 A;  2R4E A;  1ZOY A;  2PA6 A;  4HA6 A;  3CT2 A;  3UOY A;  4YTN A;  2GF3 A;  3QN3 A;  3UTF A;  2BA9 A;  4CRT A;  2WP9 A;  2OA1 A;  3H12 A;  3AYJ A;  4A9W A;  3CTY A;  4K8G A;  2C64 A;  1N4W A;  2YQU A;  1RM6 B;  1V97 A;  1DOD A;  1PBC A;  5HXI A;  2PGW A;  4M52 A;  1N61 C;  4B67 A;  3UXK A;  2BK5 A;  3CGE A;  2TMD A;  3UKP A;  3TWA A;  3R07 C;  2V3B A;  4A5L A;  5BUL A;  1JPM A;  1F6M A;  5FJO A;  3TWB A;  3AEA A;  1MO9 A;  1ZX9 A;  2OFJ A;  4GIS A;  1TKK A;  3KPK A;  2BS3 A;  4HCH A;  2BYB A;  3AE3 A;  3P4Q A;  3P9U A;  2OQH A;  2Q0K A;  1VRQ B;  4CY6 A;  2WEU A;  3VR9 A;  2NVK X;  4HNC A;  2PMQ A;  2FJE A;  3IK4 A;  1KN0 A;  3ZLG A;  2OLO A;  2VVL A;  1O95 A;  5CKU A;  3VDG A;  4H2N A;  4EM4 A;  2YLW A;  1E1N A;  1ZMD A;  3R10 A;  2PTZ A;  3F8R A;  1KCZ A;  2Q7V A;  4C3Y A;  3TJI A;  3PO7 A;  4WCT A;  3KUM A;  1KSU A;  2B76 A;  2YR5 A;  4TM3 A;  4J56 A;  2GGG A;  2AKM A;  1PBF A;  2W55 A;  4H4Z A;  4IT1 A;  5G5G B;  4M6U A;  1PS9 A;  5KMP A;  1IUV A;  1NHR A;  3C4A A;  5G5H B;  3ALM A;  2DW7 A;  2X8G A;  4Z43 A;  1KD0 A;  4C74 A;  3AE4 A;  2POD A;  2WQY A;  4TM1 A;  1L0V A;  3U9I A;  2EQ8 A;  3RHA A;  3NNE A;  1SEZ A;  2OLN A;  4J36 A;  2WHD A;  4GF7 A;  1LTX R;  4JDR A;  3AM9 A;  2MUC A;  3CPI G;  1D7Y A;  3UCL A;  4CCR A;  2RGH A;  1VG9 A;  4IZG A;  1GES A;  4AP1 A;  1TDN A;  1ZMC A;  2YG5 A;  4Z1Y A;  2E5V A;  3IHM A;  3ETR B;  4JQ9 A;  4ZCC A;  1F8S A;  2OAL A;  1GRE A;  2APG A;  3UTG A;  3AEG A;  4A7A A;  3LXD A;  2WBA A;  4C77 A;  3KU9 A;  3SGL A;  3NLC A;  4E6M A;  1JCT A;  3IC9 A;  2YVG A;  1IJH A;  1XPQ A;  2XDO A;  4DSH A;  1PJ7 A;  2YM2 A;  1BWC A;  4OPC A;  3NVZ B;  4UDP A;  1D5T A;  2BK4 A;  1R0M A;  1EL8 A;  3TCS A;  1FIQ B;  4HNL A;  3V5C A;  1FEC A;  2R9Z A;  1HYU A;  2QAE A;  4H2H A;  2XLR A;  3UKL A;  4ENL A;  2WU5 A;  4G6H A;  1OJC A;  1GRA A;  5U25 A;  2V60 A;  3EUB 3;  4KEM A;  2AR8 A;  4BJZ A;  3OC4 A;  3FMW A;  3T2Z A;  3BNU A;  3NIX A;  2PP3 A;  4YSZ A;  1EBD A;  2XH2 A;  2BS2 A;  3ENL A;  1MDL A;  4B69 A;  3GD6 A;  1SJD A;  3D47 A;  2GAG B;  3OZM A;  4GFI A;  2GQW A;  4H4Q A;  1H7W A;  1MUC A;  2YWL A;  2CUL A;  4XWR A;  2XLT A;  2B7R A;  4H4T A;  1DJN A;  4AT0 A;  3KD9 A;  3CGC A;  3RED A;  1GV4 A;  4ICY A;  3NH3 X;  4EMI A;  3BNM A;  5J60 A;  2E5A A;  2DW6 A;  1ONE A;  3QJ4 A;  3AD9 B;  3DDM A;  3AE5 A;  2WDR A;  1TE6 A;  1F8R A;  2ZAD A;  4BJY A;  1ZKQ A;  1BZL A;  3UKH A;  3H7V A;  2FJD A;  3MZN A;  3ZVH B;  3NYC A;  4OPL A;  1GTH A;  1X31 B;  3UCC A;  1PXB A;  4OPU A;  1SJA A;  3VR8 A;  4ZN0 A;  3C4N A;  3KLJ A;  2C4C A;  3GDN A;  1WYG A;  2OVL A;  2QDD A;  3EF6 A;  6ENL A;  4Z2U A;  3VRB A;  4FK1 A;  2AL2 B;  2PTY A;  2OQY A;  1IUS A;  2YG6 A;  4II3 A;  2Y6R A;  3PWI A;  3K7T A;  3THU A;  4G73 A;  3H4K A;  2B7S A;  2H88 A;  2WDQ A;  1E1M A;  3R0K A;  1NEL A;  3UOZ A;  3NFU A;  2BAC A;  3CIR A;  4DNA A;  3HW2 A;  4B64 A;  4Z2R A;  4MMW A;  2C72 A;  2QQ6 A;  5KMR A;  3ZVH A;  1GRG A;  3CNJ A;  1H82 A;  2PGE A;  4FK1 C;  4H4V A;  3N4E A;  1NHQ A;  2W54 A;  4U8I A;  2PTW A;  4KPL A;  2OPJ A;  2CHR A;  2XVF A;  5ENL A;  1YEY A;  4Z2T A;  2RDX A;  2E1M A;  2JKC A;  4H4P A;  3LAD A;  1V59 A;  4JN7 A;  2C76 A;  1PDH A;  3AE1 A;  3R0U A;  1NG3 A;  2UZZ A;  2YVF A;  2XVE A;  3AE7 A;  1CJ2 A;  2GH5 A;  3DGB A;  2BXR A;  4NWZ A;  3TQP A;  1K0I A;  2WS3 A;  2WPC A;  2H89 A;  4X9M A;  1VQZ A;  5JCI A;  4USQ A;  3HZL A;  4C3X A;  3MQT A;  1N4U A;  5KVH A;  3CPJ G;  4GGH A;  4J34 A;  1K0L A;  1VDV A;  4USR A;  1FFV C;  4ZOH B;  4KWS A;  4BK3 A;  3ALL A;  1H81 A;  2GDQ A;  2YLZ A;  1N5X A;  3H8L A;  3GSI A;  5EB5 A;  4C5O A;  4MGG A;  1S2Q A;  3AE9 A;  5HHF A;  2BK3 A;  5KOW A;  2GGH A;  1Q1R A;  1CF3 A;  1GET A;  1OJA A;  3N6H A;  1T3Q C;  2VOU A;  1MRA A;  4IL0 A;  1K0J A;  1NDA A;  3PFR A;  4GUV A;  4DYE A;  4BUR A;  3GMB A;  1KF6 A;  2WU2 A;  1FOH A;  3VFC A;  3ES8 A;  3DEQ A;  1BGJ A;  3UP5 A;  4GIR A;  1DNC A;  1GRH A;  2P0I A;  4U8K A;  3CNS A;  1GAL A;  1RSG A;  3NRZ B;  1ELI A;  2O56 A;  5KNL A;  2JAE A;  3JSK A;  3VC5 A;  4H2P A;  3AB1 A;  5HYM A;  1TZZ A;  2R0P A;  3K7Q X;  3SZF A;  3SX6 A;  3QFA A;  3FPZ A;  4DSG A;  2CVJ A;  4U8N A;  3SXI A;  4Y4L A;  1ZDL A;  5EBK A;  1FFU C;  3BJS A;  2YR4 A;  2VZ2 A;  1YQZ A;  1CJ3 A;  2Q6U A;  1XHC A;  3RCY A;  1PXA A;  3CPH G;  3WE0 A;  2HNE A;  3ADA B;  4OPT A;  3TJ4 A;  1S3B A;  3QFB A;  1JOA A;  3T6C A;  1MDR A;  4GAV A;  5L46 A;  2FJB A;  2YR6 A;  1JNR A;  4HYR A;  1IUX A;  3T8Q A;  1COY A;  3V5F A;  2BC1 A;  3P4S A;  2QGY A;  3HRD C;  3L5O A;  3V3W A;  2C66 A;  1CL0 A;  1Y56 B;  1IUT A;  3R9U A;  3H70 A;  2W3R A;  1EC8 A;  2R0G A;  2Z5X A;  3FV9 A;  1N60 C;  2EQ9 A;  1K4Q A;  4YWS A;  1NEK A;  3CB3 A;  3NTA A;  5KMS A;  2AAQ A;  3SY4 A;  1S3E A;  4IVO B;  3CMM A;  1F9C A;  1D4C A;  4D03 A;  3UKF A;  3STP A;  3AXB A;  3PWG A;  1E1K A;  1E9I A;  3IJI A;  3UKK A;  3R11 A;  4JY2 A;  1F3P A;  4A99 A;  4LU6 A;  1PHH A;  3AE8 A;  5C2T A;  2GR3 A;  3N6J A;  3NG7 X;  2QCU A;  4GR1 A;  5GRT A;  3CXO A;  2P3Z A;  4I58 A;  2XCG A;  2ZBW A;  3DER A;  1MNS A;  1O5W A;  1FCD A;  3S47 A;  2BRY A;  3EEZ A;  3RGT A;  4YWO A;  3AD7 B;  2EQ7 A;  2OAM A;  4E0V A;  4ZCD A;  3H8A A;  1NEN A;  2P8C A;  4H4S A;  1GPE A;  5JCM A;  1KNR A;  1YQ3 A;  3B9J B;  5IQ4 A;  4H4R A;  5J7X A;  3GO2 A;  4FI4 A;  4TM4 A;  2V3A A;  4U2T A;  4DN1 A;  1ZXI C;  3AYL A;  3NT6 A;  4YKF A;  4JHM A;  3AEE A;  5KOX A;  1MXT A;  2WDV A;  1KKR A;  1GRB A;  1JRP A;  2YVJ A;  4EQS A;  2GAH B;  3ATR A;  4K5S A;  3VA8 A;  1WUF A;  3DFY A;  3SZ0 A;  2FYM A;  2BCP A;  2Y6Q A;  1OJ9 A;  2OZT A;  4H2R A;  2WET A;  1CJC A;  2XVJ A;  3AMZ A;  1EBH A;  2QJM A;  1CC4 A;  3EAN A;  3FJ4 A;  4HN8 A;  5FS9 A;  1NG4 A;  3KPF A;  3UP4 A;  2YG4 A;  5KXJ A;  3RP7 A;  4X2P A;  3C96 A;  4YSY A;  4FP1 A;  2AKZ A;  3RR1 A;  3ABV A;  4U8L A;  2PTX A;  2GGE A;  2BRA A;  1LPF A;  4HCL A;  1Y56 A;  1NU5 A;  3CGB A;  1ECQ A;  4IA5 A;  4H1Z A;  5HY5 A;  4J2W A;  1ZK7 A;  4J57 A;  3O0H A;  2YLR A;  3DA1 A;  3SN4 A;  2YM1 A;  4NTC A;  2VVM A;  1SJB A;  3GYX A;  2TPR A;  3CGD A;  1QJD A;  4O5Q A;  4JN8 A;  4BK2 A;  3DH9 A;  3DJG X;  3DG7 A;  3B97 A;  5BRT A;  1D4D A;  4JN9 A;  4J1O A;  1RP0 A;  2C73 A;  3NK1 X;  3NTD A;  3M12 A;  1PDZ A;  2GMJ A;  1N4V A;  3DGZ A;  2PYX A;  3I6D A;  3COX A;  4A6N B;  1M64 A;  2IVD A;  2QVH A;  3ITJ A;  1P48 A;  5FMH A;  4JNA A;  3SN1 A;  4RSL A;  3P93 A;  2PHH A;  3SFE A;  2X99 A;  2XFP A;  3AD8 B;  4M0X A;  1CHU A;  1KNP A;  3LJP A;  4B63 A;  2AL1 A;  2B9W A;  1XPY A;  1OJT A;  3MKC A;  2YG3 A;  2XGZ A;  3AEC A;  4NTD A;  2XLU A;  4F4R A;  3CK5 A;  2QDE A;  2EQ6 A;  4DWD A;  4U8M A;  3CNT A;  4G6G A;  4YKG A;  2QJJ A;  3B6D A;  3UKA A;  2PCE A;  2F5Z A;  2DKI A;  3MWC A;  2Z5Y A;  2P88 A;  3EPT A;  4IHC A;  4WX1 A;  3SZC A;  2P8B A;  3NRN A;  3JW7 A;  3QVP A;  3A7A A;  4OVI A;  3ICR A;  1PXC A;  4PAB A;  2PU0 A;  3DJJ A;  3FCP A;  2GMH A;  1E39 A;  2XLS A;  3SJN A;  1IYX A;  4JNQ A;  3D1C A;  3NGC X;  4XWZ A;  4RG3 A;  1GT8 A;  3F8P A;  5BVA A;  3KKJ A;  4APN A;  2C67 A;  4NTE A;  3OW1 A;  4U8J A;  1FHV A;  2QA1 A;  3TOY A;  4K2X A;  2QA2 A;  1YQ4 A;  3AWI A;  2XLP A;  3AE2 A;  3DG3 A;  2GV8 A;  5JCN A;  4YT0 A;  4AOX A;  3QLD A;  3T14 A;  3JVA A;  2VQB A;  2XVI A;  2PS2 A;  3GD4 A;  2ZZB A;  2ZZC A;  3D8X A;  2YLX A;  4B65 A;  4ZCW A;  2XH7 A;  4H4X A;  1GOS A;  1ZP0 A;  3R1Z A;  3HPF A;  1M6I A;  3PVC A;  3IWA A;  3UJR A;  1H2I A;  3OZ2 A;  4IV9 A;  4B1B A;  4X9N A;  3R25 A;  3FBS A;  3CN8 A;  4HCD A;  2WOV A;  3IJQ A;  1MOK A;  4DGK A;  1DXL A;  4A35 A;  2JB3 A;  1GXF A;  4D04 A;  4EIP A;  3GYJ A;  3I6T A;  3GD3 A;  1X2G A;  5U1O A;  3G5S A;  3SYI A;  4P9S A;  1REO A;  1KDG A;  1JRY A;  5BOE A;  4O5U A;  3V76 A;  4U2L A;  1KSS A;  4I59 A;  3H8I A;  2YG7 A;  2JB2 A;  1PBE A;  3UOV A;  4KPR A;  2XFQ A;  3DJD A;  4RG4 A;  2R4J A;  2FBW A;  1DJQ A;  2XYO A;  5IDZ A;  4EMJ A;  4H7U A;  3PS9 A;  2I0Z A;  3T31 A;  2GR1 A;  2V5Z A;  4UDQ A;  5JRB A;  3AN1 A;  3LZW A;  1H86 A;  1XDI A;  4U2S A;  4IP5 A;  3P4P A;  3QSE A;  1JPD X;  3CAW A;  3TTE A;  1L9C A;  1JRX A;  3K1G A;  4TLZ A;  3QPE A;  3SN0 A;  3NHO X;  2GSH A;  2C7G A;  2XFU A;  2XFO A;  3QSS A;  3ZVI A;  3UKQ A;  2GR0 A;  5ER0 A;  2E4G A;  4YXD A;  4AOS A;  3CNP A;  4ZA0 A;  2JK6 A;  4X4J A;  4K8D A;  1CC6 A;  3F8D A;  1DOE A;  1L8P A;  1PJ6 A;  3DK4 A;  1ONF A;  1YKJ A;  1EL5 A;  2OZ3 A;  3Q9T A;  1JRO A;  1Q1W A;  2X8H A;  4J3Z A;  2VRL A;  1LQU A;  1N5W C;  2R46 A;  3ZYX A;  2X8C A;  4A6G A;  4GGB A;  2GR2 A;  5IPY A;  1TDF A;  1DTN A;  3B3R A;  4Z44 A;  4K7Z A;  4DX3 A;  5M0Z A;  2RGO A;  3SQS A;  3VCC A;  3IJL A;  3SR6 B;  3NVY B;  2E3T A;  4A6N A;  1EC9 A;  3RO6 A;  4OPI A;  1SJC A;  2CDU A;  3GY1 A;  3Q6J A;  3FIM B;  3NN0 X;  1P2E A;  2GL5 A;  4GYP A;  1FHU A;  3Q4D A;  3AYI A;  3IF9 A;  1L9E A;  4OCG A;  3S5W A;  4EM3 A;  2WES A;  2YLT A;  5U63 A;  1E1L A;  3UJE A;  4Y4M A;  3DJE A;  2OZ8 A;  2B9Y A;  3UJF A;  3SM8 A;  1CC2 A;  3ZLH A;  5BUK A;  3G5R A;  5KMQ A;  5FJP A;  1FEB A;  3D9X A;  1D4E A;  3GWF A;  1ELS A;  5TR3 A;  1GTE A;  4PAA A;  1B8S A;  1N63 C;  3LOV A;  2W0H A;  2Q0L A;  4K2S A;  4ADW A;  3NYF A;  2GGI A;  2B9X A;  2W3S A;  2ONE A;  4CCQ A;  2HXU A;  3SBF A;  1JNZ A;  1BKW A;  5FS7 A;  2O9Z A;  4Z26 A;  1P2H A;  3JZU A;  2OLA A;  1W4X A;  3QSM A;  3UGV A;  3NYE A;  4TVY A;  4NNJ A;  2XH0 A;  4CNK A;  2WOI A;  5JCL A;  3V4B A;  3RP8 A;  3QKE A;  2I5Q A;  2WPE A;  2BXS A;  3RRA A;  4IL2 A;  2PSN A;  4GME A;  3SSZ A;  1PJ5 A;  3DK9 A;  3VRD B;  3EAO A;  3UTH A;  1H84 A;  2HZG A;  3KVE A;  2BAB A;  1FEA A;  3QVR A; 
#chains in the Genus database with same CATH homology
 2E1M A;  3I3L A;  1QO8 A;  1LVL A;  5FMH A;  2JKC A;  4H4P A;  3SFD A;  2J3N A;  4JNA A;  4RSL A;  4B68 A;  3LAD A;  3NN6 X;  1V59 A;  2A89 A;  2PHH A;  2C76 A;  3GDP A;  2X99 A;  1PDH A;  2XFP A;  1XAN A;  3AE1 A;  1PN0 A;  3SFE A;  3AD8 B;  4EQR A;  1NG3 A;  1CHU A;  1KNP A;  2UZZ A;  2YVF A;  3RNM A;  2V6O A;  3LJP A;  2RGJ A;  2XVE A;  3NKS A;  4YTM A;  2X50 A;  1BF3 A;  4B63 A;  4TLX A;  2B9W A;  3AE7 A;  2WP6 A;  1CJ4 A;  3LZX A;  3VRA A;  1LQT A;  2XVH A;  3ZDN A;  1CJ2 A;  5GSN A;  2GH5 A;  3DME A;  2BXR A;  4NWZ A;  1YY5 A;  1OJT A;  2V61 A;  3M0O A;  2YLS A;  4H2Q A;  2YG3 A;  5C2T A;  2C65 A;  3BHK A;  5M10 A;  1IUW A;  4AP3 A;  2C70 A;  1K0I A;  1Y0P A;  4G74 A;  4OPD A;  2WS3 A;  1F8W A;  2WPC A;  2H89 A;  3AEC A;  4N9X A;  2XLU A;  4NTD A;  4X9M A;  4IA6 A;  3SQP A;  5JCI A;  4USQ A;  2R4E A;  1ZOY A;  3HZL A;  2EQ6 A;  4C3X A;  4U8M A;  2GVC A;  3CNT A;  4HA6 A;  4G6G A;  4YKG A;  1N4U A;  5KVH A;  3CPJ G;  4J34 A;  1K0L A;  3B6D A;  3GWD A;  5CQF A;  4USR A;  3UKA A;  3UOY A;  4YTN A;  3DK8 A;  4NZH A;  1TDO A;  2GF3 A;  3G5Q A;  5FS8 A;  3UTF A;  2F5Z A;  2BA9 A;  4CRT A;  2WP9 A;  2OA1 A;  2DKI A;  4BK3 A;  3ALL A;  1H81 A;  3AYJ A;  1JRZ A;  4FDC B;  4A9W A;  2YLZ A;  3CTY A;  2Z5Y A;  2C64 A;  1N4W A;  2GRT A;  2ZZ0 A;  2YQU A;  4H4W A;  1BGN A;  3EPT A;  3H8L A;  1DOD A;  3GSI A;  5EB5 A;  4WX1 A;  3SZC A;  4C5O A;  1PBC A;  1IUU A;  3NRN A;  5HXI A;  1PBB A;  3QVP A;  4M52 A;  4OVI A;  3ICR A;  4B67 A;  1S2Q A;  1GER A;  1PXC A;  3ATQ A;  3AE9 A;  2BK5 A;  5HHF A;  2BK3 A;  4PAB A;  5KOW A;  1Q1R A;  3CGE A;  3DJJ A;  2GMH A;  2TMD A;  2VVL G;  1CF3 A;  3UKP A;  1GET A;  1OJA A;  3E1T A;  3ALJ A;  2VOU A;  2V3B A;  1E39 A;  1K0J A;  4A5L A;  2XLS A;  5BUL A;  4IVM B;  1NDA A;  3SZW A;  3GRT A;  1H83 A;  1F6M A;  3AEA A;  4II2 A;  4JNQ A;  4GUV A;  3K7M X;  1FL2 A;  3D1C A;  1LJ1 A;  1MO9 A;  1ZX9 A;  4BUR A;  3NGC X;  3DGH A;  4H4Y A;  3GMB A;  4JY3 A;  1KF6 A;  3KPK A;  2BS3 A;  2JBV A;  2WU2 A;  4XWZ A;  2BYB A;  3AE3 A;  3P4Q A;  4EMW A;  1FOH A;  4RG3 A;  1GT8 A;  3F8P A;  4REK A;  1VDC A;  5BVA A;  3P9U A;  3KKJ A;  4APN A;  1GSN A;  3AEF A;  2C67 A;  4NTE A;  1DOB A;  1CBO A;  2Q0K A;  4U8J A;  1VRQ B;  4CY6 A;  2WEU A;  3VR9 A;  2QA1 A;  2NVK X;  1BGJ A;  3UP5 A;  3BI5 A;  3T2K A;  2FJE A;  1EL9 A;  1GRT A;  1DNC A;  1GRH A;  1KN0 A;  4GAP A;  4K2X A;  2QA2 A;  2OLO A;  4U8K A;  1YQ4 A;  1PBD A;  3CNS A;  3AWI A;  3L8K A;  1GAL A;  1RSG A;  1ELI A;  5KNL A;  2JAE A;  2VVL A;  2XLP A;  1O95 A;  3AE2 A;  3JSK A;  5CKU A;  2YAU A;  2GV8 A;  4H2P A;  4TM0 A;  5JCN A;  3AB1 A;  4H2N A;  4EM4 A;  4YT0 A;  2YLW A;  5HYM A;  2R0P A;  1E1N A;  3K7Q X;  3GRS A;  4UP3 A;  3SZF A;  3SX6 A;  1ZMD A;  3T14 A;  4AOX A;  4GCM A;  3QFA A;  2VQB A;  2XVI A;  3FPZ A;  3GD4 A;  2ZZB A;  4DSG A;  2ZZC A;  2CVJ A;  3D8X A;  4Z25 A;  2YLX A;  4U8N A;  4A99 A;  1DOC A;  4B65 A;  3SXI A;  2X3N A;  3F8R A;  4Y4L A;  1ZDL A;  5EBK A;  3UOX A;  2Q7V A;  4H4X A;  1GOS A;  1ZP0 A;  1N1P A;  3PO7 A;  4C3Y A;  2YR4 A;  1EL7 A;  4WCT A;  1KSU A;  1M6I A;  2B76 A;  1YQZ A;  2VZ2 A;  3PVC A;  1CJ3 A;  2YR5 A;  3IWA A;  1H2I A;  2Q6U A;  4TM3 A;  4J56 A;  1XHC A;  3OZ2 A;  2C3C A;  1PBF A;  1PXA A;  2GEW A;  4IV9 A;  4B1B A;  4X9N A;  3CPH G;  4H4Z A;  2R45 A;  3WE0 A;  3ADA B;  4NEW A;  3FBS A;  4OPT A;  3CN8 A;  1S3B A;  3QFB A;  3FG2 P;  2ARD A;  4XXG A;  4GRT A;  1PS9 A;  1JOA A;  2WOV A;  1Z6L A;  1IUV A;  1NHR A;  5DBJ A;  1MOK A;  4B66 A;  5KMP A;  3C4A A;  3NK0 X;  1B5Q A;  3ALM A;  5L46 A;  2X8G A;  4GAV A;  4DGK A;  2FJB A;  1DXL A;  2JB3 A;  3UTE A;  4Z43 A;  3V3N A;  2YR6 A;  1GXF A;  4D04 A;  1ZOV A;  1AOG A;  4EIP A;  1JNR A;  3GYJ A;  1LV0 A;  1IUX A;  2XFN A;  4A79 A;  4C74 A;  3AE4 A;  3GD3 A;  5U1O A;  3AEB A;  1COY A;  4MJW A;  3G5S A;  2BC1 A;  3SYI A;  2WQY A;  4TM1 A;  3P4S A;  4P9S A;  1L0V A;  2EQ8 A;  1REO A;  1KDG A;  3RHA A;  3NNE A;  1SEZ A;  1JRY A;  3L5O A;  2DKH A;  2OLN A;  4K5R A;  4O5U A;  3GMC A;  3NK2 X;  4J36 A;  3V76 A;  3S61 A;  2C66 A;  4A65 A;  1CL0 A;  4U2L A;  1KSS A;  2WHD A;  4GF7 A;  1LTX R;  1Y56 B;  4I59 A;  3H8I A;  4JDR A;  1IUT A;  3R9U A;  2YG7 A;  1GRF A;  4EQW A;  2RAB A;  2JB2 A;  3CPI G;  1PBE A;  1D7Y A;  3UOV A;  1VQW A;  3UCL A;  4KPR A;  2R0G A;  2Z5X A;  4CCR A;  2XFQ A;  3DJD A;  4RG4 A;  2RGH A;  1KFY A;  3AE6 A;  1VG9 A;  2R4J A;  2WP5 A;  4AP1 A;  1GES A;  1TDN A;  2FBW A;  1ZMC A;  4Z24 A;  1DJQ A;  2YG5 A;  2XYO A;  2E5V A;  3CND A;  3IHM A;  2EQ9 A;  1K4Q A;  4EMJ A;  4CY8 A;  4H7U A;  3PS9 A;  1NEK A;  4JQ9 A;  2I0Z A;  3T31 A;  2GR1 A;  3NTA A;  5KMS A;  4ZCC A;  2V5Z A;  4UDQ A;  5JRB A;  3LZW A;  1F8S A;  2OAL A;  4G9K A;  2AAQ A;  1XDI A;  1H86 A;  3SY4 A;  4U2S A;  3P4P A;  1GRE A;  1H6V A;  1S3E A;  4IVO B;  5IQ1 A;  2APG A;  3CMM A;  3UTG A;  3AEG A;  4A7A A;  1D4C A;  3QSE A;  3LXD A;  2WBA A;  4NEV A;  3HYV A;  4C77 A;  1GEU A;  3UKF A;  3ICS A;  4D03 A;  4UDR A;  3KU9 A;  1L9C A;  3SGL A;  3NLC A;  5KRQ A;  1JRX A;  2BC0 A;  3IC9 A;  3AXB A;  2YVG A;  2VRM A;  1E1K A;  4TLZ A;  1IJH A;  4U8O A;  1XPQ A;  1OJD A;  4U8P A;  3UKK A;  2XDO A;  4DSH A;  1PJ7 A;  2YM2 A;  1BWC A;  3NHO X;  4OPC A;  4YSH A;  3PG6 A;  4JY2 A;  4UDP A;  1F3P A;  2C7G A;  2XFU A;  1D5T A;  2BS4 A;  2XFO A;  1PHH A;  3AE8 A;  2BK4 A;  2GR3 A;  3QSS A;  1EL8 A;  3NG7 X;  4LU6 A;  2QCU A;  3UKQ A;  4GR1 A;  2GR0 A;  1S2Y A;  5GRT A;  2IVE A;  1FEC A;  5ER0 A;  2R9Z A;  2E4G A;  4YXD A;  1HYU A;  4AOS A;  4I58 A;  2XCG A;  3CNP A;  2ZBW A;  2QAE A;  2JK6 A;  4X4J A;  2XLR A;  4K8D A;  2WU5 A;  1O5W A;  1QLB A;  4G6H A;  1CC6 A;  3UKL A;  1FCD A;  1OJC A;  3T0K A;  4ECH A;  1GRA A;  1B37 A;  5U25 A;  3T2Y A;  2IID A;  2V60 A;  3F8D A;  1DOE A;  1B4V A;  4CNJ A;  2BRY A;  4HB9 A;  1PJ6 A;  5C3J A;  2R0C A;  3DK4 A;  3HYW A;  1ONF A;  4AT2 A;  2A8X A;  3II4 A;  4YWO A;  2AR8 A;  1YKJ A;  3AD7 B;  2EQ7 A;  3OC4 A;  1E6E A;  3KA7 A;  4BJZ A;  1ZY8 A;  2OAM A;  3FMW A;  3T2Z A;  1EL5 A;  3IHG A;  3BNU A;  4E0V A;  3Q9T A;  2CFY A;  1NAA A;  2ACZ A;  2AQJ A;  1Q1W A;  3NIX A;  2X8H A;  4ZCD A;  2VRL A;  3HYX A;  4YSZ A;  1NEN A;  4EQX A;  1LQU A;  5FS6 A;  1EBD A;  2R46 A;  3ZYX A;  2X8C A;  4H4S A;  2BS2 A;  3T37 A;  1GPE A;  4B69 A;  2GR2 A;  4LII A;  5JCM A;  5IPY A;  1KNR A;  1YQ3 A;  4GDE A;  2GAG B;  3GYI A;  5IQ4 A;  1JEH A;  1TDF A;  3B3R A;  2A87 A;  4H4R A;  5J7X A;  4Z44 A;  4TM4 A;  2V3A A;  4U2T A;  2GQW A;  3URH A;  4H4Q A;  4K7Z A;  1H7W A;  2RGO A;  5M0Z A;  2YWL A;  2CUL A;  3AYL A;  2XLT A;  4XWR A;  2FJA A;  2B7R A;  3NT6 A;  4H4T A;  1DJN A;  4YKF A;  4AT0 A;  3AEE A;  5KOX A;  1E7P A;  1MXT A;  2WDV A;  4A6N A;  2C3D A;  1GND A;  1NHP A;  1TDK A;  4J31 A;  4OPI A;  1GRB A;  1UKV G;  2CDU A;  3KD9 A;  3CGC A;  4EQS A;  2YVJ A;  3Q6J A;  2GAH B;  3RED A;  3ATR A;  4K5S A;  3FIM B;  1GV4 A;  3VQR A;  4ICY A;  3NH3 X;  4EMI A;  1P2E A;  3NN0 X;  3AYI A;  1H7X A;  3BNM A;  5J60 A;  3SZ0 A;  3RP6 A;  2BCP A;  3IF9 A;  1NPX A;  2Y6Q A;  3ISH A;  1L9E A;  4KX6 A;  1OJ9 A;  4LA1 A;  3QJ4 A;  4OCG A;  4H2R A;  3S5W A;  2WET A;  1CJC A;  3AD9 B;  3AE5 A;  2XVJ A;  5JCK A;  1TRB A;  2WDR A;  4K22 A;  1F8R A;  5EB4 A;  2GQF A;  3LB8 A;  4EM3 A;  2WES A;  2YLT A;  1CC4 A;  4BJY A;  1ZKQ A;  4CBQ A;  1BZL A;  3UKH A;  5U63 A;  3EAN A;  1Q9I A;  2VQ7 A;  1E1L A;  2FJD A;  4Y4M A;  3DJE A;  2B9Y A;  1O94 A;  3AED A;  3NYC A;  3SM8 A;  4OPL A;  3BI4 A;  5FS9 A;  1CC2 A;  1GTH A;  1X31 B;  1NG4 A;  1PXB A;  4OPU A;  3KPF A;  5BUK A;  1RYI A;  3G5R A;  2HQM A;  3UP4 A;  4ZN0 A;  3VR8 A;  2YG4 A;  3C4N A;  3ICT A;  5KMQ A;  3KLJ A;  2C4C A;  5KXJ A;  3RP7 A;  1FEB A;  3GDN A;  3D9X A;  3C96 A;  4YSY A;  2WOW A;  1D4E A;  1TYP A;  2BCG G;  3ABV A;  4U8L A;  3GWF A;  3P1W A;  4J33 A;  3EF6 A;  2BRA A;  5TR3 A;  1GTE A;  4PAA A;  1LPF A;  1S7M A;  3M13 A;  3VRB A;  4BK1 A;  4Z2U A;  4H4U A;  1Y56 A;  4FK1 A;  1B8S A;  1IUS A;  3CGB A;  2YG6 A;  3L1R A;  4IA5 A;  2Y6R A;  4II3 A;  3LOV A;  1JU2 A;  4FX9 A;  2W0H A;  5HY5 A;  2GB0 A;  4J2W A;  1VG0 A;  1ZK7 A;  3K7T A;  1TDE A;  4YTP A;  4J57 A;  3BI2 A;  3O0H A;  2C75 A;  2Q0L A;  4G73 A;  4ADW A;  3NYF A;  3H4K A;  2B9X A;  2B7S A;  2H88 A;  2WDQ A;  4CCQ A;  1E1M A;  2YLR A;  3P4R A;  3DA1 A;  2YM1 A;  4NTC A;  1JNZ A;  4EIQ A;  1BKW A;  5FS7 A;  2VVM A;  3UOZ A;  2O9Z A;  4Z26 A;  3GYX A;  1P2H A;  2BAC A;  3CIR A;  5KVI A;  4DNA A;  1W4X A;  4YSX A;  2TPR A;  3QSM A;  3CGD A;  1NHS A;  1QJD A;  2NPX A;  4O5Q A;  3V3O A;  4BK2 A;  3DH9 A;  5LV9 A;  3DJG X;  3NYE A;  4NNJ A;  4B64 A;  4Z2R A;  4CNK A;  2WOI A;  5JCL A;  2C72 A;  3K30 A;  1D7L A;  3RP8 A;  5BRT A;  4BV6 A;  5KMR A;  1D4D A;  5KWF A;  4JN9 A;  1GRG A;  3CNJ A;  1RP0 A;  1H82 A;  2C73 A;  2JB1 A;  2WPE A;  3NK1 X;  3NTD A;  3M12 A;  2BXS A;  4FK1 C;  4GDP A;  4H4V A;  2GMJ A;  1NHQ A;  4OPG A;  1N4V A;  4U8I A;  3DGZ A;  5EOW A;  1TYT A;  4H50 A;  1PJ5 A;  1L9D A;  2PYX A;  3BHF A;  3I6D A;  2WPF A;  3DK9 A;  3COX A;  3VRD B;  3EAO A;  3UTH A;  4A6N B;  1M64 A;  1H84 A;  3KVE A;  4Y4N A;  2IVD A;  2XVF A;  2BAB A;  4Z2T A;  1FEA A;  3ITJ A;  3QVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...