1GV4A

Murine apoptosis-inducing factor (aif)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
490
structure length
490
Chain Sequence
b'TVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROGRAMED CELL DEATH PROTEIN 8
publication title The Crystal Structure of the Mouse Apoptosis-Inducing Factor Aif
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 149
structure length 490
sequence length 490
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1gv4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A01
4FDCB 3G5SA 3ZYXA 3QSSA 2Q0LA 4N9XA 1KSSA 4YSYA 2WOIA 4Z2TA 1F8SA 2B9WA 4O5UA 3UKAA 1LQUA 3AD8B 1LVLA 5BUKA 4I59A 2TPRA 3S61A 3KD9A 3UTFA 3NTDA 4DGKA 2QAEA 2WP6A 4J34A 1Y0PA 3AD7B 2YAUA 4EQXA 2AR8A 4H4SA 2R0GA 4OPDA 4REKA 4OPGA 4YKFA 4YTPA 2GR2A 3DMEA 3ALLA 2C67A 4UP3A 4BV6A 1PBDA 2C70A 3NKSA 4EIQA 4EMWA 1W4XA 2GMJA 3JSKA 4OCGA 1H86A 2XVJA 4Z43A 2X8GA 3BI2A 3SFDA 2BXRA 1ZX9A 2WPCA 3URHA 4NEVA 1COYA 2C64A 3ICTA 3OZ2A 1O5WA 4ECHA 2YVJA 2CFYA 1QLBA 2JKCA 1GSNA 5GSNA 4A6NB 1VRQB 2YG7A 3SFEA 1E39A 2YLWA 3AE3A 5CKUA 5KOXA 1S3BA 2YWLA 3AE2A 1N4WA 4Y4MA 2VOUA 4B63A 2BS3A 2BK5A 1KNPA 4OPIA 3AD9B 2DKHA 1FEAA 1TDFA 3GYJA 1REOA 1LV0A 1CC2A 3O0HA 2WPFA 1K4QA 5FS8A 4YWOA 3NYEA 1VDCA 2RGHA 2JBVA 4J57A 2YG5A 2CULA 4OVIA 4Z44A 4B68A 1FECA 3CGCA 2XLUA 3CNJA 1NAAA 2UZZA 5BVAA 1MOKA 4BK2A 1YQZA 3RP6A 2AQJA 4OPTA 2R4JA 4U8PA 4BK1A 2BK3A 1BF3A 1NEKA 4HB9A 3IHMA 4AOSA 3AYIA 3NYCA 1TDOA 4U8KA 3QVPA 3IHGA 1TYPA 1OJCA 2JAEA 5EB4A 3S5WA 4A9WA 3K30A 3GMCA 3ITJA 3UTGA 4CY8A 4EQWA 4USRA 4K7ZA 2HQMA 1N4UA 2BS2A 3P4SA 2O9ZA 2FBWA 2GH5A 3FMWA 2WOWA 2XFNA 1XHCA 3BNUA 4K5SA 4H2NA 5CQFA 2WS3A 4XXGA 4JN9A 5J7XA 4YXDA 2GR3A 3GD4A 4FX9A 2XLPA 4D03A 4EQRA 5JCMA 2B76A 2YLXA 3AECA 3NG7X 3REDA 4YSZA 3DJEA 4Z2UA 3DK4A 3ATRA 3LZXA 2VZ2A 1ZY8A 4CCQA 3P4PA 5HXIA 3RNMA 3UKHA 2C65A 1NENA 1PS9A 3II4A 2GQWA 3M13A 4KPRA 3RHAA 3FG2P 4TLXA 1XANA 1LQTA 1FCDA 1KDGA 2F5ZA 4H2QA 4IV9A 2WU5A 2PYXA 3QFAA 2EQ9A 4K22A 3FBSA 2WDVA 2YQUA 4NZHA 2GRTA 5LV9A 4H4XA 1NPXA 1PXCA 3NH3X 1CC6A 1EBDA 1GRTA 4M52A 4JDRA 2PHHA 1NHQA 2XFUA 4LU6A 4U2LA 2YR4A 1CHUA 1D4CA 3VR9A 1JU2A 2B9XA 4UDQA 4GRTA 3M0OA 5HY5A 2YVFA 3CIRA 1PJ7A 4GR1A 2XVEA 4A65A 4NTDA 3SM8A 3UKPA 5J60A 2Y6QA 1H81A 1Y56B 2YG3A 2R9ZA 4IVOB 1RSGA 2BK4A 4AP1A 1ONFA 1H83A 5FS6A 1PBCA 1YQ4A 4U8LA 5EB5A 3CGEA 1GV4A 4H4UA 1E1MA 1RP0A 1GRFA 1Q1WA 3GRTA 1QJDA 2C73A 2WDRA 3UKQA 4CBQA 2WQYA 1ZMDA 4OPUA 2XVIA 3GSIA 3UP5A 1XPQA 1NG3A 4YTMA 2B9YA 4AT2A 4JY2A 1IUTA 2X8CA 4XWZA 1Q1RA 1NG4A 3LXDA 5ER0A 2BCGG 3UTEA 1L0VA 1N4VA 3FPZA 4JQ9A 3QFBA 5EBKA 2OLOA 1BGJA 2OALA 3UCLA 2C3DA 2DKIA 4DSHA 4B67A 2C7GA 3G5QA 5FS7A 2R46A 2BA9A 3EF6A 3GDPA 4H4PA 5EOWA 3CPIG 2VRLA 2Z5YA 3AEAA 3ICSA 1L9EA 3NLCA 4OPLA 4CY6A 2QCUA 1ZDLA 4YSXA 2OA1A 4WCTA 1K0LA 3NK2X 4GDEA 3COXA 3KVEA 3QSEA 2C72A 4B64A 1PJ6A 4Z2RA 2WP9A 3P9UA 4EQSA 4JNAA 1TRBA 3DK9A 3AXBA 1IUXA 1B4VA 2FJBA 2R0CA 3OC4A 1DJQA 2XVHA 4BJYA 5BRTA 4Z25A 5KWFA 3QVRA 3EANA 1H82A 3UOZA 1H6VA 4A7AA 4PABA 1GT8A 4FK1C 4H4ZA 4LIIA 1E1KA 1ELIA 1L9CA 4H2RA 4YKGA 2NVKX 3B6DA 4EMIA 2APGA 4TM0A 4A5LA 1IUUA 5IQ4A 1DOEA 1S2YA 4AT0A 2XYOA 5C3JA 2Q6UA 2CDUA 4K8DA 1F8RA 3AYLA 3PO7A 2A89A 4X9NA 1IUSA 4AOXA 2WP5A 3ABVA 3ISHA 1N1PA 2YLTA 4IVMB 2V61A 1GTEA 3SGLA 3L8KA 5FS9A 2RGJA 2GEWA 2V3AA 3NT6A 3UKLA 5M10A 1IJHA 1B5QA 3UKKA 2YG4A 3KA7A 4B65A 2GR1A 4H4TA 3UKFA 1PDHA 4Z26A 1TYTA 2XLTA 3CNDA 1CJ4A 4KX6A 3NTAA 1FOHA 5FMHA 4TLZA 3QJ4A 3AB1A 4H4YA 1NHRA 2X8HA 3H8LA 2ZZCA 2R0PA 3ZDNA 4B1BA 3CPJG 3PS9A 4UDRA 4J33A 1F3PA 5JCIA 3B3RA 4E0VA 5KRQA 2OLNA 2JB1A 1ZOVA 2YR5A 4FK1A 2RGOA 3LZWA 4RG3A 2BC1A 3C4NA 3KPFA 3NGCX 2AAQA 4CCRA 1F6MA 4D04A 3LJPA 5KVIA 3D1CA 2ZZBA 3CNTA 1BZLA 1IUVA 4EM3A 3LOVA 1KNRA 5U1OA 5JCLA 3PVCA 4BURA 2YLZA 5KXJA 1IUWA 2YG6A 1PXAA 4ADWA 1O94A 1BGNA 1E7PA 2YLSA 1V59A 1D4EA 1D5TA 5GRTA 3AYJA 1LJ1A 1S2QA 1EL8A 4ZN0A 2C75A 2Q0KA 3BNMA 2XVFA 1GOSA 3BI4A 5IPYA 1OJDA 3DA1A 1FEBA 4H4WA 1H7WA 2GR0A 2BC0A 2VVMA 1L9DA 3GRSA 4H50A 2FJEA 4K2XA 3AE7A 4TM4A 2IVDA 2W0HA 5KVHA 2H89A 2V5ZA 2WHDA 3GWDA 4TM3A 5L46A 1B37A 3C96A 2WU2A 4A6NA 4P9SA 4JY3A 3WE0A 3AEGA 4C77A 2OAMA 2YLRA 5U25A 1DJNA 2VQBA 1GRGA 3V3OA 4GCMA 1D7LA 4CRTA 2BYBA 3IC9A 1DOBA 2XDOA 2E5VA 4U8JA 1K0JA 1KF6A 4H4QA 2C76A 2V3BA 3I3LA 5JCKA 4XWRA 3DGHA 1GEUA 1ZKQA 3H4KA 2E4GA 2Y6RA 3R9UA 4B69A 1EL9A 1P2EA 3VRBA 1CBOA 1TDNA 3KLJA 2WEUA 3HZLA 2V60A 2H88A 5M0ZA 2CVJA 3UTHA 2RABA 3CGBA 3UOXA 1RYIA 3F8DA 1OJ9A 3UP4A 2GAHB 2XLRA 2GMHA 1GESA 1PN0A 4IA5A 4UDPA 1JOAA 3CN8A 4C3XA 2WBAA 1X31B 3BHFA 3P4QA 1MO9A 4JNQA 4J31A 3L1RA 1HYUA 4PAAA 2VVLG 3VRDB 1DNCA 3BHKA 4DSGA 2ACZA 5U63A 2BXSA 3P4RA 1D4DA 3NK0X 2GB0A 3IF9A 4J36A 4TM1A 1ZOYA 1VG0A 2GQFA 2ZZ0A 1CJ3A 1JNZA 3VQRA 1FL2A 3ICRA 3M12A 4CNJA 2YR6A 1NHSA 1QO8A 3ALMA 1Z6LA 4USQA 1VQWA 3C4AA 2TMDA 5KOWA 2A87A 1E1NA 3KU9A 3LADA 1S3EA 4U8OA 1BKWA 4GF7A 1JNRA 4K5RA 4U8IA 3T37A 2E1MA 1JEHA 1VG9A 2WPEA 4I58A 2BCPA 3P1WA 3DGZA 4EM4A 5TR3A 4APNA 2VQ7A 1PBEA 3NN0X 2VVLA 3V3NA 3D8XA 4RG4A 4H7UA 1PHHA 2X3NA 2JB3A 3NN6X 3DJDA 2QA2A 3BI5A 1PXBA 2R4EA 1EL7A 2I0ZA 1GXFA 1P2HA 2XFOA 3H8IA 2J3NA 4ICYA 4BK3A 5C2TA 2B7RA 3GDNA 3NNEA 4ZCCA 3RP8A 1PBBA 3I6DA 4NTCA 1JRYA 2GAGB 1NDAA 3NYFA 4H4RA 3NIXA 2X99A 4A79A 3NK1X 1GERA 3G5RA 2FJAA 3Q6JA 1K0IA 3EAOA 3GWFA 3DJGX 5DBJA 3IWAA 2NPXA 2BACA 2XFQA 1M6IA 3FIMB 1O95A 3NHOX 5HHFA 3ATQA 3UOVA 2EQ8A 4EIPA 1B8SA 2YVGA 2XCGA 3AE8A 1Y56A 1SEZA 2ZBWA 3GYIA 1PJ5A 2BS4A 3LB8A 2FJDA 1AOGA 4CNKA 3K7TA 4EMJA 2WOVA 4J56A 3ALJA 1CC4A 4NTEA 3V76A 2BABA 3Q9TA 4DNAA 1GNDA 3F8RA 4U2TA 3CNSA 3KKJA 1NHPA 2V6OA 4AP3A 3AE1A 1GRHA 1M64A 4RSLA 1BWCA 1CJCA 5HYMA 4GUVA 4Z24A 1CL0A 3ADAB 1GPEA 3AE4A 4YT0A 3K7MX 2IIDA 3AEEA 3CTYA 1GTHA 1OJTA 2IVEA 2YM1A 4X4JA 3VR8A 3AE6A 5BULA 4U8NA 1H84A 2X50A 3RP7A 2WETA 3EPTA 1GREA 3DJJA 5JCNA 3CPHG 1EL5A 3E1TA 3K7QX 2WDQA 1CJ2A 2GVCA 3AEDA 4U8MA 1H7XA 4IA6A 3CNPA 1E6EA 4X9MA 1GRBA 2R45A 2XLSA 3AEFA 1MXTA 1JRXA 4WX1A 3VRAA 2C3CA 4J2WA 3NRNA 4ZCDA 4LA1A 4Y4NA 4H2PA 5IQ1A 4NEWA 4H4VA 1KFYA 1ZP0A 3AWIA 1TDEA 1GRAA 4B66A 1DODA 3AE5A 1YKJA 1D7YA 3GMBA 1JRZA 4OPCA 4C3YA 1YY5A 2QA1A 2Q7VA 4O5QA 2C66A 1DXLA 2JK6A 1LTXR 1Q9IA 1E1LA 1KSUA 3AE9A 1GETA 2GV8A 3UOYA 4C74A 1XDIA 1DOCA 4HA6A 1CF3A 1F8WA 3CGDA 4C5OA 1YQ3A 3QSMA 2EQ6A 3GD3A 4A99A 1ZMCA 2JB2A 1OJAA 2YM2A 2GF3A 2WESA 4YTNA 1TDKA 4MJWA 4GDPA 2A8XA 3AEBA 4Y4LA 1UKVG 2EQ7A 3DK8A 2VRMA 3DH9A 3F8PA 2ARDA 1GALA 3SQPA 1PBFA 4U2SA 2B7SA 4YSHA 1LPFA 4BJZA 2XFPA 2Z5XA 1ZK7A
chains in the Genus database with same CATH superfamily
4FDCB 4N9XA 2WOIA 1LQUA 1LVLA 3KD9A 3NTDA 3SXIA 3RITA 2WP6A 1Y0PA 4OPDA 3N4FA 3P3BA 3DEQA 3B9JB 3R25A 4EMWA 1W4XA 4Z43A 3FV9A 2XVJA 1JRPA 2MUCA 4ECHA 2JKCA 1GSNA 4GISA 2QJMA 4KT2A 3SFEA 1E39A 4NWZA 1N62C 2QGYA 4EWJA 3H12A 1REOA 3O0HA 2WPFA 1K4QA 2QQ6A 2CHRA 2JBVA 4J57A 4OVIA 1FECA 2XLUA 5EU9A 3CNJA 2PTWA 1YQZA 4OPTA 1SJBA 4BK1A 2PCEA 1WUEA 1VQZA 3AYIA 3GMCA 3ITJA 1JCTA 2BS2A 3ZVHB 2O9ZA 2FBWA 3SSZA 2XH0A 4H2NA 2WS3A 5J7XA 4YXDA 2GR3A 2XLPA 2YLXA 2PSNA 1N5XA 4Z2UA 2HXUA 4F4RA 1PS9A 3M13A 3JW7A 4KPRA 3S5SA 4TLXA 3GO2A 1KDGA 4H2QA 2YQUA 2GRTA 2BRYA 4H4XA 4IZGA 3NH3X 1GRTA 4M52A 4LU6A 3PFRA 4IT1A 1JU2A 1EC9A 2YVFA 3CIRA 3SZWA 6ENLA 1H81A 1MDLA 5J04A 4IVOB 3BJSA 5JRBA 1ONFA 1PBCA 5EB5A 4Y4MA 1GV4A 4H4UA 2C73A 4CBQA 3R0KA 1KD0A 3UP5A 1XPQA 1FIQB 1Q1RA 2W3SA 1NG4A 3DESA 3UTEA 2P88A 3FPZA 2HNEA 3QFBA 2C7GA 1FHUA 5EOWA 1L9EA 4WCTA 1K0LA 3UGVA 3V4BA 3AXBA 2XVHA 4G73A 5FJOA 4PABA 4H4ZA 4H2RA 1L9CA 4YKGA 5IQ4A 4AT0A 1IUSA 3OW1A 3ABVA 3SGLA 4IVMB 1GTEA 3UKLA 3UKKA 4B65A 1NELA 2GR1A 4H4TA 4Z26A 1CJ4A 3ENLA 5FMHA 1T3QC 3QJ4A 3AB1A 4H4YA 2X8HA 2GDQA 3IK4A 3LZWA 3KPFA 2W54A 3TWBA 3VA8A 1BZLA 3FVDA 4BURA 2QVHA 2PTYA 1PXAA 2YLSA 3D46A 5GRTA 3AYJA 3A7RA 2PTXA 5IPYA 1H7WA 1KKRA 3GRSA 2IVDA 2W0HA 2WHDA 3C96A 2WU2A 4A6NA 1N5WC 3SYIA 1DJNA 1D7LA 3UCCA 3IC9A 1DOBA 1ELSA 3I3LA 3H4KA 3R9UA 4B69A 1P2EA 3SN1A 3KLJA 1S7MA 2H88A 3DIPA 2RABA 3CGBA 1OJ9A 2GAHB 4IA5A 4UDPA 1JOAA 4H19A 1HYUA 4PAAA 2VVLG 3T0KA 3P4RA 4GYPA 3IF9A 4GAVA 1JNZA 3VQRA 4GMEA 2XSXA 3ICRA 3CXBA 2YR6A 1NHSA 1QO8A 1Z6LA 4USQA 5KOWA 3LADA 3TJIA 2E1MA 4I58A 2BCPA 3P1WA 5TR3A 3NN0X 1PBEA 2PGWA 3D8XA 1N63C 3NN6X 4A5LA 1EL7A 2I0ZA 2XFOA 1V97A 5C2TA 1NU5A 3GDNA 3NNEA 3RP8A 1PBBA 1NDAA 2X99A 3NK1X 2FJAA 1K0IA 1M6IA 3FIMB 3ATQA 2XH2A 4EIPA 2ONEA 3T6CA 1B8SA 2XCGA 1Y56A 1SEZA 2BS4A 2FJDA 3SQSA 1MUCA 4NTEA 4U2TA 4AP3A 3AE1A 1M64A 3MWCA 3AE4A 2IIDA 3AEEA 3CTYA 1SB3B 2X50A 3U9IA 3PG6A 4TVYA 5JCNA 2WDQA 1WYGA 4U8MA 1H7XA 3RGTA 1MXTA 4WX1A 3NRNA 4ZCDA 1JROA 4H4VA 3AWIA 1TDEA 2OZTA 3GMBA 1SJAA 2C66A 1DXLA 1E1LA 1XDIA 1DOCA 1CF3A 1YQ3A 3GD3A 3T14A 3N6JA 1ZMCA 2JB2A 4YTNA 3QN3A 1TDKA 4MKSA 3F8PA 4ROPA 2PU0A 1GALA 3SQPA 4YSHA 2B7SA 2XFPA 1SJDA 4HYRA 2OZ3A 3OZMA 1MRAA 2GGJA 4Z2TA 2B9WA 3UKAA 3JZUA 3FYYA 3S61A 3Q4DA 2DW6A 2QAEA 4J34A 2R0GA 4H4SA 4MMWA 4YKFA 3CAWA 4UP3A 3R1ZA 4BV6A 1PBDA 3NKSA 3NZGA 1ECQA 2W55A 2GMJA 4OCGA 2C64A 3OZ2A 2YVJA 1QLBA 3NO1A 4A6NB 2YG7A 2YLWA 3AE3A 4GAPA 5FJPA 5CKUA 3DFHA 5KOXA 3VDGA 2YWLA 4B63A 1N4WA 2VOUA 1KNPA 3AD9B 1TDFA 3GYJA 1IYXA 3SY4A 3NVZB 3CGCA 5BVAA 3UJSA 1BF3A 1NEKA 4HB9A 3NYCA 4U8KA 4A9WA 3QVPA 3IHGA 1TKKA 3PWIA 4EQWA 1XHCA 4K5SA 5BOFA 4XXGA 3DG3A 1EBGA 4D03A 2B76A 3L5OA 2VZ2A 5HXIA 3UKHA 4JHMA 2GQWA 1YEYA 2WU5A 2EQ9A 1NPXA 1PXCA 1EBDA 2PHHA 1CHUA 1D4CA 3MZNA 2B9XA 3M0OA 4A65A 3T4WA 3SM8A 3I6EA 3CB3A 3I4KA 1Y56B 2YG3A 3OZYA 5FS6A 3CGEA 1E1MA 2WDRA 3QKEA 1EC8A 2HZGA 4OPUA 1DTNA 1NG3A 2B9YA 2O56A 1IUTA 5IDZA 1L0VA 4HN8A 2PTZA 1N4VA 3OP2A 4JQ9A 2OLOA 3FJ4A 3UCLA 1L8PA 4B67A 1OEPA 4G6GA 4HCLA 3G5QA 5FS7A 2R46A 2BA9A 2VRLA 3AEAA 3ICSA 3NLCA 2QCUA 3HPFA 2NQLA 4YSXA 3NK2X 4GDEA 3COXA 3QPEA 1IUXA 1B4VA 3OC4A 4K2SA 5BRTA 5KWFA 1H6VA 4FK1C 4LIIA 2NVKX 4EMIA 4TM0A 3TQPA 1DOEA 2Q6UA 3RCYA 2CDUA 4K8DA 4X9NA 4M0XA 3UXLA 2V3AA 3NT6A 2GEWA 1IJHA 1B5QA 3KA7A 1FFUC 2XLTA 4HCHA 4KX6A 2POZA 1FOHA 1E9IA 2C4CA 3ZDNA 3CPJG 3ES8A 2YR5A 2XGZA 3SZCA 3C4NA 1F6MA 1SJCA 3LJPA 2ZZBA 3CNTA 1IUVA 5U1OA 2YLZA 1IUWA 1BGNA 1E7PA 4G9KA 1H2IA 2GGGA 1LJ1A 1S2QA 3THUA 2XVFA 3BI4A 2OVLA 3DA1A 1FEBA 1L9DA 4II3A 1B37A 4P9SA 3WE0A 2OKTA 2OAMA 2YLRA 2VQBA 3MKCA 4CRTA 2GGHA 1KF6A 4H4QA 2C76A 4XWRA 1EL9A 2RDXA 1CBOA 4E4FA 2AL1A 3UTHA 4HNCA 3UOXA 3CN8A 2WBAA 3BHFA 3P4QA 4DN1A 1DNCA 2ACZA 5U63A 4GGBA 4J36A 3KUMA 2TMDA 1BKWA 3H8AA 1JNRA 3DGZA 3V3NA 4RG4A 5G5GB 3BI5A 3NVWB 1P2HA 2B7RA 3EEZA 3RR1A 2GAGB 4H4RA 4A79A 1GERA 3EAOA 3V5FA 3HYWA 3IWAA 2PP1A 2XH7A 3AE8A 3SR6B 1EC7A 3ETRB 4EMJA 2WOVA 4J56A 2P8BA 1CC4A 2BABA 3VCCA 4DNAA 1GRHA 1BWCA 1CJCA 4GUVA 1CL0A 3ADAB 1GPEA 4YT0A 3K7MX 2YM1A 3SBFA 1H84A 3EPTA 1CJ2A 2GVCA 3IJLA 2R45A 3AEFA 1JRXA 2C3CA 4H2PA 5IQ1A 3AE5A 1YKJA 1JRZA 4OPCA 4O5QA 2Q7VA 2JK6A 1LTXR 3UJEA 3UOYA 1F8WA 4C5OA 4FP1A 2GF3A 4A6GA 2PP3A 3VC5A 4IL2A 4Y4LA 3DK8A 2ARDA 1PBFA 4U2SA 3N6HA 1LPFA 2PMQA 3G5SA 3ZYXA 3QSSA 1KSSA 5KMPA 5BUKA 2TPRA 4DGKA 3GYXA 4G74A 3UJFA 4DYEA 3JSKA 3SFDA 3URHA 3ICTA 1COYA 2CFYA 4J1OA 1S3BA 4GFIA 2BK5A 2DKHA 3MUCA 5FS8A 4YWOA 3D9XA 4A3RA 2YG5A 2CULA 4Z44A 3HW2A 1NAAA 2UZZA 1BKHA 4BK2A 2AQJA 2R4JA 5FJTA 3BSMA 5EB4A 3TCSA 1TYPA 1OJCA 3K30A 4CY8A 3TOYA 3A7AA 4K7ZA 2HQMA 3P4SA 3FMWA 2WOWA 2XFNA 5CQFA 4JN9A 4E4UA 3DGBA 3GD4A 3T2YA 3VFCA 3AECA 4YSZA 3DJEA 3DK4A 3LZXA 3P4PA 1NENA 3RHAA 3GC2A 5FJRA 2OFJA 2F5ZA 3BOXA 3NVYB 2PYXA 4K22A 3FBSA 2WDVA 3DDMA 5LV9A 1FHVA 4U2LA 2YR4A 4GRTA 5HY5A 4GR1A 3UKPA 5J60A 2Y6QA 5KMRA 1JPDX 4YWSA 2R9ZA 4K1WA 1RSGA 3SN4A 4U8LA 2FYMA 1YQ4A 4B64A 4CCRA 1GRFA 3GRTA 2WQYA 1ZMDA 4AT2A 4XWZA 1F9CA 5ER0A 2BCGG 1TE6A 3V3WA 5EBKA 3ZLHA 2C3DA 2DKIA 4Z17A 3GDPA 4H4PA 3NFUA 4FI4A 3CPIG 4OPLA 4CY6A 1ZDLA 4IHCA 2OA1A 3H70A 3KVEA 2C72A 4Z2RA 1PJ6A 2WP9A 4EQSA 2R0CA 3QVRA 3T8QA 4E6MA 4A7AA 1GT8A 3STPA 3B6DA 3SZ0A 1WUFA 4Z1YA 2XYOA 2MNRA 3PK7A 3AYLA 1F8RA 3PO7A 2OG9A 2WP5A 2YLTA 4IL0A 3L8KA 2RGJA 3TWAA 2YG4A 3UKFA 1PDHA 1TYTA 3ZLFA 4KWSA 1P48A 4TLZA 2PU1A 4B1BA 3H8LA 1XPYA 2ZZCA 4UDRA 4J33A 1F3PA 3S47A 5JCIA 3B3RA 4E0VA 2AKMA 2OLNA 2JB1A 1ZOVA 2RGOA 4RG3A 3NGCX 1TZZA 3QLDA 3D1CA 3LOVA 1KNRA 4E5TA 1O94A 1RVKA 1V59A 1PDZA 3AN1A 3Q45A 1D5TA 1D4EA 1EL8A 1JPMA 2C75A 2Q0KA 1GOSA 1OJDA 1KCZA 2BC0A 2VVMA 4H50A 5KVHA 3CT2A 4C77A 1GRGA 3UJRA 2W3RA 4GIRA 1ZKQA 3NS1B 3VRBA 3VC6A 2WEUA 1RM6B 3MY9A 2V60A 5M0ZA 3F8DA 3UP4A 2ZC8A 2GMHA 1GESA 1PN0A 4C3XA 1MO9A 3L1RA 3VRDB 4DSGA 2BXSA 1ZOYA 1CJ3A 1VDVA 4HCDA 3R11A 3RO6A 3M12A 3DFYA 4CNJA 3ALMA 2E3TA 3U4FA 3C4AA 1E1NA 4U8IA 3T37A 1JEHA 2WPEA 4EM4A 4APNA 2X3NA 3DJDA 2QA2A 1PXBA 3AMZA 3H8IA 2J3NA 4ICYA 4NTCA 3GD6A 1JRYA 3UCDA 3GWFA 3DJGX 5DBJA 3UOVA 2EQ8A 4KPLA 3GYIA 1PJ5A 3LB8A 4CNKA 3K7TA 2P0IA 3ALJA 3NRZB 3R0UA 3Q9TA 3T2ZA 1R6WA 3CNSA 3KKJA 1NHPA 1R0MA 3SN0A 3CMMA 4RSLA 5HYMA 2FKPA 1GTHA 2IVEA 3VR8A 3AE6A 5BULA 3RP7A 4J3ZA 3V5CA 2PS2A 1GREA 1X2GA 3E1TA 2PP0A 1EL5A 3CPHG 3K7QX 4IA6A 1E6EA 4X9MA 3DG6A 3EUB3 2XLSA 3VRAA 3JVAA 4LA1A 4Y4NA 4NEWA 1GRAA 3HRDC 1DODA 2AL2A 3UJ2A 3P93A 1N60C 4A35A 2GV8A 4C74A 3CGDA 3QSMA 2EQ6A 4A99A 5FJUA 4DWDA 1OJAA 3VCNA 4GDPA 2A8XA 1UKVG 2EQ7A 4DHGA 4BJZA 2Z5XA 1ZK7A 2P3ZA 2Q0LA 3H7VA 4YSYA 2I5QA 4NNJA 1F8SA 4O5UA 2PODA 3AD8B 4G8TA 2XH4A 4I59A 1ZXIC 3UTFA 3AD7B 2YAUA 4EQXA 2AR8A 4REKA 4OPGA 3CXOA 4YTPA 2GR2A 3DMEA 4JN8A 3ALLA 2C67A 3ES7A 2C70A 1W6TA 4EIQA 3T9PA 1H86A 2X8GA 3BI2A 2BXRA 1ZX9A 2WPCA 4NEVA 1O5WA 3MSYA 3P0WA 5GSNA 1VRQB 2GSHA 2PGEA 3CYJA 1ONEA 3R07C 3AE2A 2BS3A 3DG7A 1KN0A 3B97A 4TVWA 4OPIA 1FEAA 1P43A 1LV0A 1CC2A 3OPSA 3NYEA 1VDCA 4G6HA 2RGHA 4B68A 3R10A 1MOKA 3RP6A 4U8PA 4II2A 2BK3A 4G7FA 3IHMA 4AOSA 1TDOA 4ZA0A 2JAEA 3S5WA 3UTGA 4USRA 2GL5A 1N4UA 2GH5A 3BNUA 4M6UA 4FX9A 4GGHA 4EQRA 5JCMA 3D47A 3NG7X 3REDA 3ATRA 1ZY8A 4CCQA 2OLAA 3RNMA 2C65A 3II4A 3FG2P 1XANA 1LQTA 7ENLA 1FCDA 4IV9A 3QFAA 4E8GA 4NZHA 2QDEA 1CC6A 4JDRA 2XFUA 1NHQA 3VR9A 4UDQA 1PJ7A 2XVEA 4NTDA 4H2HA 4HPNA 4JN7A 1JDFA 2BK4A 4AP1A 1H83A 1RP0A 3UKQA 1Q1WA 1QJDA 2XVIA 3GSIA 3SX6A 3IJIA 4YTMA 4JY2A 2X8CA 3LXDA 1N61C 2QJNA 3SZFA 3K1GA 1BGJA 2OALA 4DXKA 4DSHA 3PWGA 2AKZA 3EF6A 2GGIA 2Z5YA 3QSEA 3P9UA 4JNAA 2QJJA 4X2PA 3DK9A 1TRBA 2FJBA 1DJQA 4BJYA 2AL2B 4Z25A 3EANA 1H82A 3UOZA 2P8CA 1MNSA 1ELIA 1E1KA 3TJ4A 1EBHA 2APGA 1IUUA 1S2YA 2PA6A 5C3JA 4AOXA 2A89A 2GGEA 3ISHA 1N1PA 2V61A 5FS9A 5M10A 2DW7A 3CNDA 4DX3A 3NTAA 4IP4A 1NHRA 2R0PA 3PS9A 5KRQA 4FK1A 2BC1A 4MGGA 4ENLA 2AAQA 1X2HA 4D04A 5KVIA 3KPKA 4EM3A 4H1ZA 5JCLA 3PVCA 5KXJA 3AM9A 2YG6A 4ADWA 3HYVA 3SJNA 4ZN0A 3BNMA 4H4WA 3DERA 2GR0A 2E5AA 4K2XA 4ZCWA 2FJEA 4TM4A 3AE7A 2H89A 4TM3A 2V5ZA 5L46A 3GWDA 2PPGA 3N4EA 3HYXA 4JY3A 3ZLGA 4K8GA 3AEGA 3T2KA 3GY1A 5U25A 3V3OA 2OX4A 3CK5A 4GCMA 1XS2A 2BYBA 2XDOA 2E5VA 4U8JA 1FO4A 1K0JA 5BOEA 2V3BA 5JCKA 3DGHA 1GEUA 2E4GA 2Y6RA 4HNLA 3UXKA 1TDNA 3HZLA 2CVJA 1MDRA 3OTRA 1RYIA 2XLRA 3TTEA 1X31B 3NXLA 4JNQA 4J31A 5KMSA 3BHKA 1D4DA 3NK0X 2GB0A 4TM1A 1VG0A 2GQFA 2ZZ0A 3EKGA 1FL2A 3IJQA 3FXGA 1VQWA 3ZVHA 2A87A 3KU9A 1S3EA 4U8OA 4GF7A 4K5RA 1VG9A 5G5HB 2VQ7A 2VVLA 1PDYA 4H7UA 1PHHA 2JB3A 2R4EA 1GXFA 4BK3A 3T31A 4ZCCA 3I6DA 3NYFA 3NIXA 3G5RA 5KMQA 3Q6JA 3QTPA 2NPXA 2BACA 2XFQA 5HHFA 3NHOX 1O95A 2YVGA 4KEMA 3FCPA 2ZBWA 2QDDA 1AOGA 2BRAA 2OO6A 3V76A 3F8RA 1GNDA 3MQTA 2V6OA 2OZ8A 3ZVIA 3RRAA 4Z24A 3I6TA 1BQGA 3NVVB 1OJTA 4X4JA 4U8NA 2WETA 3DJJA 3AEDA 2ZADA 3CNPA 1GRBA 4IP5A 2OPJA 4J2WA 4GYPC 1KFYA 1ZP0A 1KKOA 4H83A 3TW9A 4B66A 1D7YA 4C3YA 1YY5A 2QA1A 2HXTA 1Q9IA 1KSUA 3AE9A 1GETA 4HA6A 5KNLA 1FFVC 3A7UA 2YM2A 5ENLA 2WESA 2OQHA 4MJWA 4ZOHB 2OQYA 3AEBA 2VRMA 3DH9A 1STZA
chains in the Genus database with same CATH topology
4FDCB 3G5SA 3ZYXA 3QSSA 2Q0LA 4N9XA 1KSSA 4YSYA 2WOIA 4Z2TA 5KMPA 4NNJA 1F8SA 2B9WA 4O5UA 3UKAA 1LQUA 3AD8B 1LVLA 5BUKA 4I59A 2TPRA 3S61A 3KD9A 3UTFA 3NTDA 3SXIA 3GYXA 4DGKA 2QAEA 2WP6A 4J34A 1Y0PA 3AD7B 2YAUA 4EQXA 2AR8A 4H4SA 2R0GA 4G74A 4OPDA 4OPGA 4REKA 4YKFA 4YTPA 2GR2A 3DMEA 3ALLA 2C67A 4UP3A 4BV6A 1PBDA 2C70A 3NKSA 4EIQA 4EMWA 1W4XA 2GMJA 3JSKA 4OCGA 1H86A 2XVJA 4Z43A 2X8GA 3BI2A 3SFDA 2BXRA 1ZX9A 2WPCA 3URHA 4NEVA 1COYA 2C64A 3ICTA 3OZ2A 1O5WA 4ECHA 2YVJA 2CFYA 1QLBA 2JKCA 1GSNA 5GSNA 4A6NB 1VRQB 2YG7A 3SFEA 1E39A 2YLWA 3AE3A 4GAPA 4NWZA 5CKUA 5KOXA 1S3BA 2YWLA 3AE2A 1N4WA 4Y4MA 2VOUA 4B63A 2BS3A 2BK5A 1KN0A 1KNPA 4OPIA 3AD9B 2DKHA 1FEAA 1TDFA 3GYJA 3SY4A 1REOA 1LV0A 1CC2A 3O0HA 2WPFA 1K4QA 5FS8A 4YWOA 3D9XA 3NYEA 1VDCA 4G6HA 2RGHA 2JBVA 4J57A 2YG5A 2CULA 4OVIA 4Z44A 4B68A 1FECA 3CGCA 2XLUA 3CNJA 1NAAA 2UZZA 5BVAA 1MOKA 4BK2A 1YQZA 3RP6A 2AQJA 4OPTA 2R4JA 4U8PA 4II2A 4BK1A 2BK3A 1BF3A 1NEKA 4HB9A 3IHMA 4AOSA 3AYIA 3NYCA 1TDOA 4U8KA 3QVPA 3IHGA 1TYPA 1OJCA 2JAEA 5EB4A 3S5WA 4A9WA 3K30A 3GMCA 3ITJA 3UTGA 4CY8A 4EQWA 4USRA 4K7ZA 2HQMA 1N4UA 2BS2A 3P4SA 2O9ZA 2FBWA 2GH5A 3FMWA 2WOWA 2XFNA 1XHCA 3BNUA 4K5SA 4H2NA 5CQFA 2WS3A 4XXGA 4JN9A 5J7XA 4YXDA 2GR3A 3GD4A 4FX9A 2XLPA 4D03A 3T2YA 4EQRA 5JCMA 2B76A 2YLXA 3L5OA 3AECA 3NG7X 3REDA 4YSZA 3DJEA 4Z2UA 3DK4A 3ATRA 3LZXA 2VZ2A 1ZY8A 4CCQA 3P4PA 5HXIA 3RNMA 3UKHA 2C65A 1NENA 1PS9A 3II4A 2GQWA 3M13A 4KPRA 3RHAA 3FG2P 4TLXA 1XANA 1LQTA 1FCDA 1KDGA 2F5ZA 4H2QA 4IV9A 2WU5A 2PYXA 3QFAA 2EQ9A 4K22A 3FBSA 2WDVA 2YQUA 4NZHA 2GRTA 2BRYA 5LV9A 4H4XA 1NPXA 1PXCA 3NH3X 1CC6A 1EBDA 1GRTA 4M52A 4JDRA 2PHHA 1NHQA 2XFUA 4LU6A 4U2LA 2YR4A 1CHUA 1D4CA 3VR9A 1JU2A 2B9XA 4UDQA 4GRTA 3M0OA 5HY5A 2YVFA 3CIRA 1PJ7A 3SZWA 4GR1A 2XVEA 4A65A 4NTDA 3SM8A 3UKPA 5J60A 2Y6QA 1H81A 1Y56B 5KMRA 2YG3A 2R9ZA 4IVOB 1RSGA 2BK4A 5JRBA 4AP1A 1ONFA 1H83A 5FS6A 1PBCA 1YQ4A 4U8LA 5EB5A 3CGEA 1GV4A 4H4UA 1E1MA 1RP0A 1GRFA 1Q1WA 3GRTA 1QJDA 2C73A 2WDRA 3UKQA 4CBQA 2WQYA 1ZMDA 4OPUA 2XVIA 3GSIA 3SX6A 3UP5A 1XPQA 1NG3A 4YTMA 2B9YA 4AT2A 4JY2A 1IUTA 2X8CA 4XWZA 1Q1RA 1NG4A 3LXDA 5ER0A 2BCGG 3UTEA 1L0VA 1N4VA 3FPZA 3SZFA 4JQ9A 3QFBA 5EBKA 2OLOA 1BGJA 2OALA 3UCLA 2C3DA 2DKIA 4DSHA 4B67A 4G6GA 2C7GA 3G5QA 5FS7A 2R46A 2BA9A 3EF6A 3GDPA 4H4PA 5EOWA 3CPIG 2VRLA 2Z5YA 3AEAA 3ICSA 1L9EA 3NLCA 4OPLA 4CY6A 2QCUA 1ZDLA 4YSXA 2OA1A 4WCTA 1K0LA 3NK2X 4GDEA 3COXA 3KVEA 3QSEA 2C72A 4B64A 1PJ6A 4Z2RA 2WP9A 3P9UA 4EQSA 4JNAA 1TRBA 3DK9A 3AXBA 1IUXA 1B4VA 2FJBA 2R0CA 3OC4A 1DJQA 2XVHA 4G73A 4BJYA 5BRTA 4Z25A 5KWFA 3QVRA 3EANA 1H82A 3UOZA 1H6VA 4A7AA 4PABA 1GT8A 4FK1C 4H4ZA 4LIIA 1E1KA 1ELIA 1L9CA 4H2RA 4YKGA 2NVKX 3B6DA 3SZ0A 4EMIA 2APGA 4TM0A 4A5LA 1IUUA 5IQ4A 1DOEA 1S2YA 4AT0A 2XYOA 5C3JA 2Q6UA 2CDUA 4K8DA 1F8RA 3AYLA 3PO7A 2A89A 4X9NA 1IUSA 4AOXA 2WP5A 3ABVA 3ISHA 1N1PA 2YLTA 4IVMB 2V61A 1GTEA 3SGLA 3L8KA 2V3AA 5FS9A 2GEWA 2RGJA 3NT6A 3UKLA 5M10A 1IJHA 1B5QA 3UKKA 2YG4A 3KA7A 4B65A 2GR1A 4H4TA 3UKFA 1PDHA 4Z26A 1TYTA 2XLTA 3CNDA 1CJ4A 4KX6A 3NTAA 1FOHA 5FMHA 4TLZA 3QJ4A 3AB1A 4H4YA 2C4CA 1NHRA 2X8HA 3H8LA 2ZZCA 2R0PA 3ZDNA 4B1BA 3CPJG 3PS9A 4UDRA 4J33A 1F3PA 5JCIA 3B3RA 4E0VA 5KRQA 2OLNA 2JB1A 1ZOVA 2YR5A 4FK1A 2RGOA 3LZWA 4RG3A 3SZCA 2BC1A 3C4NA 3KPFA 3NGCX 2AAQA 4CCRA 1F6MA 4D04A 3LJPA 5KVIA 3D1CA 2ZZBA 3CNTA 1BZLA 1IUVA 3KPKA 4EM3A 3LOVA 1KNRA 5U1OA 5JCLA 3PVCA 4BURA 2YLZA 5KXJA 1IUWA 2YG6A 1PXAA 4ADWA 1O94A 1BGNA 3HYVA 1E7PA 2YLSA 1V59A 1D4EA 1D5TA 4G9KA 1H2IA 5GRTA 3AYJA 1LJ1A 1S2QA 1EL8A 4ZN0A 2C75A 2Q0KA 3BNMA 2XVFA 1GOSA 3BI4A 5IPYA 1OJDA 3DA1A 1FEBA 4H4WA 1H7WA 2GR0A 2BC0A 2VVMA 1L9DA 3GRSA 4H50A 2FJEA 4K2XA 3AE7A 4TM4A 2IVDA 4II3A 2W0HA 5KVHA 2H89A 2V5ZA 2WHDA 3GWDA 4TM3A 5L46A 1B37A 3C96A 2WU2A 4A6NA 4P9SA 3HYXA 4JY3A 3WE0A 3AEGA 3T2KA 4C77A 2OAMA 2YLRA 3SYIA 5U25A 1DJNA 2VQBA 1GRGA 3V3OA 4GCMA 1D7LA 4CRTA 2BYBA 3IC9A 1DOBA 2XDOA 2E5VA 4U8JA 1K0JA 1KF6A 4H4QA 2C76A 2V3BA 3I3LA 5JCKA 4XWRA 3DGHA 1GEUA 1ZKQA 3H4KA 2E4GA 2Y6RA 3R9UA 4B69A 1EL9A 1P2EA 3VRBA 1CBOA 1TDNA 3KLJA 2WEUA 3HZLA 1S7MA 2V60A 2H88A 5M0ZA 2CVJA 3UTHA 2RABA 3CGBA 3UOXA 1RYIA 3F8DA 1OJ9A 3UP4A 2GAHB 2XLRA 2GMHA 1GESA 1PN0A 4IA5A 4UDPA 1JOAA 3CN8A 4C3XA 2WBAA 1X31B 3BHFA 3P4QA 1MO9A 4JNQA 4J31A 3L1RA 1HYUA 4PAAA 2VVLG 5KMSA 3VRDB 1DNCA 3BHKA 3T0KA 4DSGA 2ACZA 5U63A 2BXSA 3P4RA 1D4DA 3NK0X 2GB0A 3IF9A 4J36A 4TM1A 1ZOYA 1VG0A 2GQFA 2ZZ0A 4GAVA 1CJ3A 1JNZA 3VQRA 1FL2A 3ICRA 3M12A 4CNJA 2YR6A 1NHSA 1QO8A 3ALMA 1Z6LA 4USQA 1VQWA 3C4AA 2TMDA 5KOWA 2A87A 1E1NA 3KU9A 3LADA 1S3EA 4U8OA 1BKWA 4GF7A 1JNRA 4K5RA 4U8IA 3T37A 2E1MA 1JEHA 1VG9A 2WPEA 4I58A 2BCPA 3P1WA 3DGZA 4EM4A 5TR3A 4APNA 2VQ7A 1PBEA 3NN0X 2VVLA 3V3NA 3D8XA 4RG4A 4H7UA 1PHHA 2X3NA 2JB3A 3NN6X 3DJDA 2QA2A 3BI5A 1PXBA 2R4EA 1EL7A 2I0ZA 1GXFA 1P2HA 2XFOA 3H8IA 2J3NA 4ICYA 4BK3A 5C2TA 3T31A 2B7RA 3GDNA 3NNEA 4ZCCA 3RP8A 1PBBA 3I6DA 4NTCA 1JRYA 2GAGB 1NDAA 3NYFA 4H4RA 3NIXA 2X99A 4A79A 3NK1X 1GERA 3G5RA 5KMQA 2FJAA 3Q6JA 1K0IA 3EAOA 3GWFA 3DJGX 5DBJA 3HYWA 3IWAA 2NPXA 2BACA 2XFQA 1M6IA 3FIMB 1O95A 3NHOX 5HHFA 3ATQA 3UOVA 2EQ8A 4EIPA 1B8SA 2YVGA 2XCGA 3AE8A 1Y56A 1SEZA 2ZBWA 3GYIA 1PJ5A 2BS4A 3LB8A 2FJDA 1AOGA 4CNKA 2BRAA 4EMJA 3K7TA 2WOVA 4J56A 3ALJA 1CC4A 4NTEA 3V76A 2BABA 3Q9TA 4DNAA 1GNDA 3F8RA 3T2ZA 4U2TA 3CNSA 3KKJA 1NHPA 2V6OA 4AP3A 3AE1A 1GRHA 1M64A 3CMMA 4RSLA 1BWCA 1CJCA 5HYMA 4GUVA 4Z24A 1CL0A 3ADAB 1GPEA 3AE4A 4YT0A 3K7MX 2IIDA 3AEEA 3CTYA 1GTHA 1OJTA 2IVEA 2YM1A 4X4JA 3VR8A 3AE6A 5BULA 4U8NA 1H84A 2X50A 3PG6A 3RP7A 2WETA 3EPTA 1GREA 3DJJA 5JCNA 3CPHG 1EL5A 3E1TA 3K7QX 2WDQA 1CJ2A 2GVCA 3AEDA 4U8MA 1H7XA 4IA6A 3CNPA 1E6EA 4X9MA 1GRBA 2R45A 2XLSA 3AEFA 1MXTA 1JRXA 4WX1A 3VRAA 2C3CA 4J2WA 3NRNA 4ZCDA 4LA1A 4Y4NA 4H2PA 5IQ1A 4NEWA 4H4VA 1KFYA 1ZP0A 3AWIA 1TDEA 1GRAA 4B66A 1DODA 3AE5A 1YKJA 1D7YA 3GMBA 1JRZA 4OPCA 4C3YA 1YY5A 2QA1A 2Q7VA 4O5QA 2C66A 1DXLA 2JK6A 1LTXR 1Q9IA 1E1LA 1KSUA 3AE9A 1GETA 2GV8A 3UOYA 4C74A 1XDIA 1DOCA 4HA6A 1CF3A 1F8WA 5KNLA 3CGDA 4C5OA 1YQ3A 3QSMA 2EQ6A 3GD3A 4A99A 3T14A 1ZMCA 2JB2A 1OJAA 2YM2A 2GF3A 2WESA 4YTNA 1TDKA 4MJWA 4GDPA 2A8XA 3AEBA 4Y4LA 1UKVG 2EQ7A 3DK8A 2VRMA 3DH9A 3F8PA 2ARDA 1GALA 3SQPA 1PBFA 4U2SA 2B7SA 4YSHA 1LPFA 4BJZA 2XFPA 2Z5XA 1ZK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FDC B;  3G5S A;  3ZYX A;  3QSS A;  2Q0L A;  4N9X A;  1KSS A;  4YSY A;  2WOI A;  4Z2T A;  1F8S A;  2B9W A;  4O5U A;  3UKA A;  1LQU A;  3AD8 B;  1LVL A;  5BUK A;  4I59 A;  2TPR A;  3S61 A;  3KD9 A;  3UTF A;  3NTD A;  4DGK A;  2QAE A;  2WP6 A;  4J34 A;  1Y0P A;  3AD7 B;  2YAU A;  4EQX A;  2AR8 A;  4H4S A;  2R0G A;  4OPD A;  4REK A;  4OPG A;  4YKF A;  4YTP A;  2GR2 A;  3DME A;  3ALL A;  2C67 A;  4UP3 A;  4BV6 A;  1PBD A;  2C70 A;  3NKS A;  4EIQ A;  4EMW A;  1W4X A;  2GMJ A;  3JSK A;  4OCG A;  1H86 A;  2XVJ A;  4Z43 A;  2X8G A;  3BI2 A;  3SFD A;  2BXR A;  1ZX9 A;  2WPC A;  3URH A;  4NEV A;  1COY A;  2C64 A;  3ICT A;  3OZ2 A;  1O5W A;  4ECH A;  2YVJ A;  2CFY A;  1QLB A;  2JKC A;  1GSN A;  5GSN A;  4A6N B;  1VRQ B;  2YG7 A;  3SFE A;  1E39 A;  2YLW A;  3AE3 A;  5CKU A;  5KOX A;  1S3B A;  2YWL A;  3AE2 A;  1N4W A;  4Y4M A;  2VOU A;  4B63 A;  2BS3 A;  2BK5 A;  1KNP A;  4OPI A;  3AD9 B;  2DKH A;  1FEA A;  1TDF A;  3GYJ A;  1REO A;  1LV0 A;  1CC2 A;  3O0H A;  2WPF A;  1K4Q A;  5FS8 A;  4YWO A;  3NYE A;  1VDC A;  2RGH A;  2JBV A;  4J57 A;  2YG5 A;  2CUL A;  4OVI A;  4Z44 A;  4B68 A;  1FEC A;  3CGC A;  2XLU A;  3CNJ A;  1NAA A;  2UZZ A;  5BVA A;  1MOK A;  4BK2 A;  1YQZ A;  3RP6 A;  2AQJ A;  4OPT A;  2R4J A;  4U8P A;  4BK1 A;  2BK3 A;  1BF3 A;  1NEK A;  4HB9 A;  3IHM A;  4AOS A;  3AYI A;  3NYC A;  1TDO A;  4U8K A;  3QVP A;  3IHG A;  1TYP A;  1OJC A;  2JAE A;  5EB4 A;  3S5W A;  4A9W A;  3K30 A;  3GMC A;  3ITJ A;  3UTG A;  4CY8 A;  4EQW A;  4USR A;  4K7Z A;  2HQM A;  1N4U A;  2BS2 A;  3P4S A;  2O9Z A;  2FBW A;  2GH5 A;  3FMW A;  2WOW A;  2XFN A;  1XHC A;  3BNU A;  4K5S A;  4H2N A;  5CQF A;  2WS3 A;  4XXG A;  4JN9 A;  5J7X A;  4YXD A;  2GR3 A;  3GD4 A;  4FX9 A;  2XLP A;  4D03 A;  4EQR A;  5JCM A;  2B76 A;  2YLX A;  3AEC A;  3NG7 X;  3RED A;  4YSZ A;  3DJE A;  4Z2U A;  3DK4 A;  3ATR A;  3LZX A;  2VZ2 A;  1ZY8 A;  4CCQ A;  3P4P A;  5HXI A;  3RNM A;  3UKH A;  2C65 A;  1NEN A;  1PS9 A;  3II4 A;  2GQW A;  3M13 A;  4KPR A;  3RHA A;  3FG2 P;  4TLX A;  1XAN A;  1LQT A;  1FCD A;  1KDG A;  2F5Z A;  4H2Q A;  4IV9 A;  2WU5 A;  2PYX A;  3QFA A;  2EQ9 A;  4K22 A;  3FBS A;  2WDV A;  2YQU A;  4NZH A;  2GRT A;  5LV9 A;  4H4X A;  1NPX A;  1PXC A;  3NH3 X;  1CC6 A;  1EBD A;  1GRT A;  4M52 A;  4JDR A;  2PHH A;  1NHQ A;  2XFU A;  4LU6 A;  4U2L A;  2YR4 A;  1CHU A;  1D4C A;  3VR9 A;  1JU2 A;  2B9X A;  4UDQ A;  4GRT A;  3M0O A;  5HY5 A;  2YVF A;  3CIR A;  1PJ7 A;  4GR1 A;  2XVE A;  4A65 A;  4NTD A;  3SM8 A;  3UKP A;  5J60 A;  2Y6Q A;  1H81 A;  1Y56 B;  2YG3 A;  2R9Z A;  4IVO B;  1RSG A;  2BK4 A;  4AP1 A;  1ONF A;  1H83 A;  5FS6 A;  1PBC A;  1YQ4 A;  4U8L A;  5EB5 A;  3CGE A;  1GV4 A;  4H4U A;  1E1M A;  1RP0 A;  1GRF A;  1Q1W A;  3GRT A;  1QJD A;  2C73 A;  2WDR A;  3UKQ A;  4CBQ A;  2WQY A;  1ZMD A;  4OPU A;  2XVI A;  3GSI A;  3UP5 A;  1XPQ A;  1NG3 A;  4YTM A;  2B9Y A;  4AT2 A;  4JY2 A;  1IUT A;  2X8C A;  4XWZ A;  1Q1R A;  1NG4 A;  3LXD A;  5ER0 A;  2BCG G;  3UTE A;  1L0V A;  1N4V A;  3FPZ A;  4JQ9 A;  3QFB A;  5EBK A;  2OLO A;  1BGJ A;  2OAL A;  3UCL A;  2C3D A;  2DKI A;  4DSH A;  4B67 A;  2C7G A;  3G5Q A;  5FS7 A;  2R46 A;  2BA9 A;  3EF6 A;  3GDP A;  4H4P A;  5EOW A;  3CPI G;  2VRL A;  2Z5Y A;  3AEA A;  3ICS A;  1L9E A;  3NLC A;  4OPL A;  4CY6 A;  2QCU A;  1ZDL A;  4YSX A;  2OA1 A;  4WCT A;  1K0L A;  3NK2 X;  4GDE A;  3COX A;  3KVE A;  3QSE A;  2C72 A;  4B64 A;  1PJ6 A;  4Z2R A;  2WP9 A;  3P9U A;  4EQS A;  4JNA A;  1TRB A;  3DK9 A;  3AXB A;  1IUX A;  1B4V A;  2FJB A;  2R0C A;  3OC4 A;  1DJQ A;  2XVH A;  4BJY A;  5BRT A;  4Z25 A;  5KWF A;  3QVR A;  3EAN A;  1H82 A;  3UOZ A;  1H6V A;  4A7A A;  4PAB A;  1GT8 A;  4FK1 C;  4H4Z A;  4LII A;  1E1K A;  1ELI A;  1L9C A;  4H2R A;  4YKG A;  2NVK X;  3B6D A;  4EMI A;  2APG A;  4TM0 A;  4A5L A;  1IUU A;  5IQ4 A;  1DOE A;  1S2Y A;  4AT0 A;  2XYO A;  5C3J A;  2Q6U A;  2CDU A;  4K8D A;  1F8R A;  3AYL A;  3PO7 A;  2A89 A;  4X9N A;  1IUS A;  4AOX A;  2WP5 A;  3ABV A;  3ISH A;  1N1P A;  2YLT A;  4IVM B;  2V61 A;  1GTE A;  3SGL A;  3L8K A;  5FS9 A;  2RGJ A;  2GEW A;  2V3A A;  3NT6 A;  3UKL A;  5M10 A;  1IJH A;  1B5Q A;  3UKK A;  2YG4 A;  3KA7 A;  4B65 A;  2GR1 A;  4H4T A;  3UKF A;  1PDH A;  4Z26 A;  1TYT A;  2XLT A;  3CND A;  1CJ4 A;  4KX6 A;  3NTA A;  1FOH A;  5FMH A;  4TLZ A;  3QJ4 A;  3AB1 A;  4H4Y A;  1NHR A;  2X8H A;  3H8L A;  2ZZC A;  2R0P A;  3ZDN A;  4B1B A;  3CPJ G;  3PS9 A;  4UDR A;  4J33 A;  1F3P A;  5JCI A;  3B3R A;  4E0V A;  5KRQ A;  2OLN A;  2JB1 A;  1ZOV A;  2YR5 A;  4FK1 A;  2RGO A;  3LZW A;  4RG3 A;  2BC1 A;  3C4N A;  3KPF A;  3NGC X;  2AAQ A;  4CCR A;  1F6M A;  4D04 A;  3LJP A;  5KVI A;  3D1C A;  2ZZB A;  3CNT A;  1BZL A;  1IUV A;  4EM3 A;  3LOV A;  1KNR A;  5U1O A;  5JCL A;  3PVC A;  4BUR A;  2YLZ A;  5KXJ A;  1IUW A;  2YG6 A;  1PXA A;  4ADW A;  1O94 A;  1BGN A;  1E7P A;  2YLS A;  1V59 A;  1D4E A;  1D5T A;  5GRT A;  3AYJ A;  1LJ1 A;  1S2Q A;  1EL8 A;  4ZN0 A;  2C75 A;  2Q0K A;  3BNM A;  2XVF A;  1GOS A;  3BI4 A;  5IPY A;  1OJD A;  3DA1 A;  1FEB A;  4H4W A;  1H7W A;  2GR0 A;  2BC0 A;  2VVM A;  1L9D A;  3GRS A;  4H50 A;  2FJE A;  4K2X A;  3AE7 A;  4TM4 A;  2IVD A;  2W0H A;  5KVH A;  2H89 A;  2V5Z A;  2WHD A;  3GWD A;  4TM3 A;  5L46 A;  1B37 A;  3C96 A;  2WU2 A;  4A6N A;  4P9S A;  4JY3 A;  3WE0 A;  3AEG A;  4C77 A;  2OAM A;  2YLR A;  5U25 A;  1DJN A;  2VQB A;  1GRG A;  3V3O A;  4GCM A;  1D7L A;  4CRT A;  2BYB A;  3IC9 A;  1DOB A;  2XDO A;  2E5V A;  4U8J A;  1K0J A;  1KF6 A;  4H4Q A;  2C76 A;  2V3B A;  3I3L A;  5JCK A;  4XWR A;  3DGH A;  1GEU A;  1ZKQ A;  3H4K A;  2E4G A;  2Y6R A;  3R9U A;  4B69 A;  1EL9 A;  1P2E A;  3VRB A;  1CBO A;  1TDN A;  3KLJ A;  2WEU A;  3HZL A;  2V60 A;  2H88 A;  5M0Z A;  2CVJ A;  3UTH A;  2RAB A;  3CGB A;  3UOX A;  1RYI A;  3F8D A;  1OJ9 A;  3UP4 A;  2GAH B;  2XLR A;  2GMH A;  1GES A;  1PN0 A;  4IA5 A;  4UDP A;  1JOA A;  3CN8 A;  4C3X A;  2WBA A;  1X31 B;  3BHF A;  3P4Q A;  1MO9 A;  4JNQ A;  4J31 A;  3L1R A;  1HYU A;  4PAA A;  2VVL G;  3VRD B;  1DNC A;  3BHK A;  4DSG A;  2ACZ A;  5U63 A;  2BXS A;  3P4R A;  1D4D A;  3NK0 X;  2GB0 A;  3IF9 A;  4J36 A;  4TM1 A;  1ZOY A;  1VG0 A;  2GQF A;  2ZZ0 A;  1CJ3 A;  1JNZ A;  3VQR A;  1FL2 A;  3ICR A;  3M12 A;  4CNJ A;  2YR6 A;  1NHS A;  1QO8 A;  3ALM A;  1Z6L A;  4USQ A;  1VQW A;  3C4A A;  2TMD A;  5KOW A;  2A87 A;  1E1N A;  3KU9 A;  3LAD A;  1S3E A;  4U8O A;  1BKW A;  4GF7 A;  1JNR A;  4K5R A;  4U8I A;  3T37 A;  2E1M A;  1JEH A;  1VG9 A;  2WPE A;  4I58 A;  2BCP A;  3P1W A;  3DGZ A;  4EM4 A;  5TR3 A;  4APN A;  2VQ7 A;  1PBE A;  3NN0 X;  2VVL A;  3V3N A;  3D8X A;  4RG4 A;  4H7U A;  1PHH A;  2X3N A;  2JB3 A;  3NN6 X;  3DJD A;  2QA2 A;  3BI5 A;  1PXB A;  2R4E A;  1EL7 A;  2I0Z A;  1GXF A;  1P2H A;  2XFO A;  3H8I A;  2J3N A;  4ICY A;  4BK3 A;  5C2T A;  2B7R A;  3GDN A;  3NNE A;  4ZCC A;  3RP8 A;  1PBB A;  3I6D A;  4NTC A;  1JRY A;  2GAG B;  1NDA A;  3NYF A;  4H4R A;  3NIX A;  2X99 A;  4A79 A;  3NK1 X;  1GER A;  3G5R A;  2FJA A;  3Q6J A;  1K0I A;  3EAO A;  3GWF A;  3DJG X;  5DBJ A;  3IWA A;  2NPX A;  2BAC A;  2XFQ A;  1M6I A;  3FIM B;  1O95 A;  3NHO X;  5HHF A;  3ATQ A;  3UOV A;  2EQ8 A;  4EIP A;  1B8S A;  2YVG A;  2XCG A;  3AE8 A;  1Y56 A;  1SEZ A;  2ZBW A;  3GYI A;  1PJ5 A;  2BS4 A;  3LB8 A;  2FJD A;  1AOG A;  4CNK A;  3K7T A;  4EMJ A;  2WOV A;  4J56 A;  3ALJ A;  1CC4 A;  4NTE A;  3V76 A;  2BAB A;  3Q9T A;  4DNA A;  1GND A;  3F8R A;  4U2T A;  3CNS A;  3KKJ A;  1NHP A;  2V6O A;  4AP3 A;  3AE1 A;  1GRH A;  1M64 A;  4RSL A;  1BWC A;  1CJC A;  5HYM A;  4GUV A;  4Z24 A;  1CL0 A;  3ADA B;  1GPE A;  3AE4 A;  4YT0 A;  3K7M X;  2IID A;  3AEE A;  3CTY A;  1GTH A;  1OJT A;  2IVE A;  2YM1 A;  4X4J A;  3VR8 A;  3AE6 A;  5BUL A;  4U8N A;  1H84 A;  2X50 A;  3RP7 A;  2WET A;  3EPT A;  1GRE A;  3DJJ A;  5JCN A;  3CPH G;  1EL5 A;  3E1T A;  3K7Q X;  2WDQ A;  1CJ2 A;  2GVC A;  3AED A;  4U8M A;  1H7X A;  4IA6 A;  3CNP A;  1E6E A;  4X9M A;  1GRB A;  2R45 A;  2XLS A;  3AEF A;  1MXT A;  1JRX A;  4WX1 A;  3VRA A;  2C3C A;  4J2W A;  3NRN A;  4ZCD A;  4LA1 A;  4Y4N A;  4H2P A;  5IQ1 A;  4NEW A;  4H4V A;  1KFY A;  1ZP0 A;  3AWI A;  1TDE A;  1GRA A;  4B66 A;  1DOD A;  3AE5 A;  1YKJ A;  1D7Y A;  3GMB A;  1JRZ A;  4OPC A;  4C3Y A;  1YY5 A;  2QA1 A;  2Q7V A;  4O5Q A;  2C66 A;  1DXL A;  2JK6 A;  1LTX R;  1Q9I A;  1E1L A;  1KSU A;  3AE9 A;  1GET A;  2GV8 A;  3UOY A;  4C74 A;  1XDI A;  1DOC A;  4HA6 A;  1CF3 A;  1F8W A;  3CGD A;  4C5O A;  1YQ3 A;  3QSM A;  2EQ6 A;  3GD3 A;  4A99 A;  1ZMC A;  2JB2 A;  1OJA A;  2YM2 A;  2GF3 A;  2WES A;  4YTN A;  1TDK A;  4MJW A;  4GDP A;  2A8X A;  3AEB A;  4Y4L A;  1UKV G;  2EQ7 A;  3DK8 A;  2VRM A;  3DH9 A;  3F8P A;  2ARD A;  1GAL A;  3SQP A;  1PBF A;  4U2S A;  2B7S A;  4YSH A;  1LPF A;  4BJZ A;  2XFP A;  2Z5X A;  1ZK7 A; 
#chains in the Genus database with same CATH topology
 4FDC B;  4N9X A;  2WOI A;  1LQU A;  1LVL A;  3KD9 A;  3NTD A;  3SXI A;  3RIT A;  2WP6 A;  1Y0P A;  4OPD A;  3N4F A;  3P3B A;  3DEQ A;  3B9J B;  3R25 A;  4EMW A;  1W4X A;  4Z43 A;  3FV9 A;  2XVJ A;  1JRP A;  2MUC A;  4ECH A;  2JKC A;  1GSN A;  4GIS A;  2QJM A;  4KT2 A;  3SFE A;  1E39 A;  4NWZ A;  1N62 C;  2QGY A;  4EWJ A;  3H12 A;  1REO A;  3O0H A;  2WPF A;  1K4Q A;  2QQ6 A;  2CHR A;  2JBV A;  4J57 A;  4OVI A;  1FEC A;  2XLU A;  5EU9 A;  3CNJ A;  2PTW A;  1YQZ A;  4OPT A;  1SJB A;  4BK1 A;  2PCE A;  1WUE A;  1VQZ A;  3AYI A;  3GMC A;  3ITJ A;  1JCT A;  2BS2 A;  3ZVH B;  2O9Z A;  2FBW A;  3SSZ A;  2XH0 A;  4H2N A;  2WS3 A;  5J7X A;  4YXD A;  2GR3 A;  2XLP A;  2YLX A;  2PSN A;  1N5X A;  4Z2U A;  2HXU A;  4F4R A;  1PS9 A;  3M13 A;  3JW7 A;  4KPR A;  3S5S A;  4TLX A;  3GO2 A;  1KDG A;  4H2Q A;  2YQU A;  2GRT A;  2BRY A;  4H4X A;  4IZG A;  3NH3 X;  1GRT A;  4M52 A;  4LU6 A;  3PFR A;  4IT1 A;  1JU2 A;  1EC9 A;  2YVF A;  3CIR A;  3SZW A;  6ENL A;  1H81 A;  1MDL A;  5J04 A;  4IVO B;  3BJS A;  5JRB A;  1ONF A;  1PBC A;  5EB5 A;  4Y4M A;  1GV4 A;  4H4U A;  2C73 A;  4CBQ A;  3R0K A;  1KD0 A;  3UP5 A;  1XPQ A;  1FIQ B;  1Q1R A;  2W3S A;  1NG4 A;  3DES A;  3UTE A;  2P88 A;  3FPZ A;  2HNE A;  3QFB A;  2C7G A;  1FHU A;  5EOW A;  1L9E A;  4WCT A;  1K0L A;  3UGV A;  3V4B A;  3AXB A;  2XVH A;  4G73 A;  5FJO A;  4PAB A;  4H4Z A;  4H2R A;  1L9C A;  4YKG A;  5IQ4 A;  4AT0 A;  1IUS A;  3OW1 A;  3ABV A;  3SGL A;  4IVM B;  1GTE A;  3UKL A;  3UKK A;  4B65 A;  1NEL A;  2GR1 A;  4H4T A;  4Z26 A;  1CJ4 A;  3ENL A;  5FMH A;  1T3Q C;  3QJ4 A;  3AB1 A;  4H4Y A;  2X8H A;  2GDQ A;  3IK4 A;  3LZW A;  3KPF A;  2W54 A;  3TWB A;  3VA8 A;  1BZL A;  3FVD A;  4BUR A;  2QVH A;  2PTY A;  1PXA A;  2YLS A;  3D46 A;  5GRT A;  3AYJ A;  3A7R A;  2PTX A;  5IPY A;  1H7W A;  1KKR A;  3GRS A;  2IVD A;  2W0H A;  2WHD A;  3C96 A;  2WU2 A;  4A6N A;  1N5W C;  3SYI A;  1DJN A;  1D7L A;  3UCC A;  3IC9 A;  1DOB A;  1ELS A;  3I3L A;  3H4K A;  3R9U A;  4B69 A;  1P2E A;  3SN1 A;  3KLJ A;  1S7M A;  2H88 A;  3DIP A;  2RAB A;  3CGB A;  1OJ9 A;  2GAH B;  4IA5 A;  4UDP A;  1JOA A;  4H19 A;  1HYU A;  4PAA A;  2VVL G;  3T0K A;  3P4R A;  4GYP A;  3IF9 A;  4GAV A;  1JNZ A;  3VQR A;  4GME A;  2XSX A;  3ICR A;  3CXB A;  2YR6 A;  1NHS A;  1QO8 A;  1Z6L A;  4USQ A;  5KOW A;  3LAD A;  3TJI A;  2E1M A;  4I58 A;  2BCP A;  3P1W A;  5TR3 A;  3NN0 X;  1PBE A;  2PGW A;  3D8X A;  1N63 C;  3NN6 X;  4A5L A;  1EL7 A;  2I0Z A;  2XFO A;  1V97 A;  5C2T A;  1NU5 A;  3GDN A;  3NNE A;  3RP8 A;  1PBB A;  1NDA A;  2X99 A;  3NK1 X;  2FJA A;  1K0I A;  1M6I A;  3FIM B;  3ATQ A;  2XH2 A;  4EIP A;  2ONE A;  3T6C A;  1B8S A;  2XCG A;  1Y56 A;  1SEZ A;  2BS4 A;  2FJD A;  3SQS A;  1MUC A;  4NTE A;  4U2T A;  4AP3 A;  3AE1 A;  1M64 A;  3MWC A;  3AE4 A;  2IID A;  3AEE A;  3CTY A;  1SB3 B;  2X50 A;  3U9I A;  3PG6 A;  4TVY A;  5JCN A;  2WDQ A;  1WYG A;  4U8M A;  1H7X A;  3RGT A;  1MXT A;  4WX1 A;  3NRN A;  4ZCD A;  1JRO A;  4H4V A;  3AWI A;  1TDE A;  2OZT A;  3GMB A;  1SJA A;  2C66 A;  1DXL A;  1E1L A;  1XDI A;  1DOC A;  1CF3 A;  1YQ3 A;  3GD3 A;  3T14 A;  3N6J A;  1ZMC A;  2JB2 A;  4YTN A;  3QN3 A;  1TDK A;  4MKS A;  3F8P A;  4ROP A;  2PU0 A;  1GAL A;  3SQP A;  4YSH A;  2B7S A;  2XFP A;  1SJD A;  4HYR A;  2OZ3 A;  3OZM A;  1MRA A;  2GGJ A;  4Z2T A;  2B9W A;  3UKA A;  3JZU A;  3FYY A;  3S61 A;  3Q4D A;  2DW6 A;  2QAE A;  4J34 A;  2R0G A;  4H4S A;  4MMW A;  4YKF A;  3CAW A;  4UP3 A;  3R1Z A;  4BV6 A;  1PBD A;  3NKS A;  3NZG A;  1ECQ A;  2W55 A;  2GMJ A;  4OCG A;  2C64 A;  3OZ2 A;  2YVJ A;  1QLB A;  3NO1 A;  4A6N B;  2YG7 A;  2YLW A;  3AE3 A;  4GAP A;  5FJP A;  5CKU A;  3DFH A;  5KOX A;  3VDG A;  2YWL A;  4B63 A;  1N4W A;  2VOU A;  1KNP A;  3AD9 B;  1TDF A;  3GYJ A;  1IYX A;  3SY4 A;  3NVZ B;  3CGC A;  5BVA A;  3UJS A;  1BF3 A;  1NEK A;  4HB9 A;  3NYC A;  4U8K A;  4A9W A;  3QVP A;  3IHG A;  1TKK A;  3PWI A;  4EQW A;  1XHC A;  4K5S A;  5BOF A;  4XXG A;  3DG3 A;  1EBG A;  4D03 A;  2B76 A;  3L5O A;  2VZ2 A;  5HXI A;  3UKH A;  4JHM A;  2GQW A;  1YEY A;  2WU5 A;  2EQ9 A;  1NPX A;  1PXC A;  1EBD A;  2PHH A;  1CHU A;  1D4C A;  3MZN A;  2B9X A;  3M0O A;  4A65 A;  3T4W A;  3SM8 A;  3I6E A;  3CB3 A;  3I4K A;  1Y56 B;  2YG3 A;  3OZY A;  5FS6 A;  3CGE A;  1E1M A;  2WDR A;  3QKE A;  1EC8 A;  2HZG A;  4OPU A;  1DTN A;  1NG3 A;  2B9Y A;  2O56 A;  1IUT A;  5IDZ A;  1L0V A;  4HN8 A;  2PTZ A;  1N4V A;  3OP2 A;  4JQ9 A;  2OLO A;  3FJ4 A;  3UCL A;  1L8P A;  4B67 A;  1OEP A;  4G6G A;  4HCL A;  3G5Q A;  5FS7 A;  2R46 A;  2BA9 A;  2VRL A;  3AEA A;  3ICS A;  3NLC A;  2QCU A;  3HPF A;  2NQL A;  4YSX A;  3NK2 X;  4GDE A;  3COX A;  3QPE A;  1IUX A;  1B4V A;  3OC4 A;  4K2S A;  5BRT A;  5KWF A;  1H6V A;  4FK1 C;  4LII A;  2NVK X;  4EMI A;  4TM0 A;  3TQP A;  1DOE A;  2Q6U A;  3RCY A;  2CDU A;  4K8D A;  4X9N A;  4M0X A;  3UXL A;  2V3A A;  3NT6 A;  2GEW A;  1IJH A;  1B5Q A;  3KA7 A;  1FFU C;  2XLT A;  4HCH A;  4KX6 A;  2POZ A;  1FOH A;  1E9I A;  2C4C A;  3ZDN A;  3CPJ G;  3ES8 A;  2YR5 A;  2XGZ A;  3SZC A;  3C4N A;  1F6M A;  1SJC A;  3LJP A;  2ZZB A;  3CNT A;  1IUV A;  5U1O A;  2YLZ A;  1IUW A;  1BGN A;  1E7P A;  4G9K A;  1H2I A;  2GGG A;  1LJ1 A;  1S2Q A;  3THU A;  2XVF A;  3BI4 A;  2OVL A;  3DA1 A;  1FEB A;  1L9D A;  4II3 A;  1B37 A;  4P9S A;  3WE0 A;  2OKT A;  2OAM A;  2YLR A;  2VQB A;  3MKC A;  4CRT A;  2GGH A;  1KF6 A;  4H4Q A;  2C76 A;  4XWR A;  1EL9 A;  2RDX A;  1CBO A;  4E4F A;  2AL1 A;  3UTH A;  4HNC A;  3UOX A;  3CN8 A;  2WBA A;  3BHF A;  3P4Q A;  4DN1 A;  1DNC A;  2ACZ A;  5U63 A;  4GGB A;  4J36 A;  3KUM A;  2TMD A;  1BKW A;  3H8A A;  1JNR A;  3DGZ A;  3V3N A;  4RG4 A;  5G5G B;  3BI5 A;  3NVW B;  1P2H A;  2B7R A;  3EEZ A;  3RR1 A;  2GAG B;  4H4R A;  4A79 A;  1GER A;  3EAO A;  3V5F A;  3HYW A;  3IWA A;  2PP1 A;  2XH7 A;  3AE8 A;  3SR6 B;  1EC7 A;  3ETR B;  4EMJ A;  2WOV A;  4J56 A;  2P8B A;  1CC4 A;  2BAB A;  3VCC A;  4DNA A;  1GRH A;  1BWC A;  1CJC A;  4GUV A;  1CL0 A;  3ADA B;  1GPE A;  4YT0 A;  3K7M X;  2YM1 A;  3SBF A;  1H84 A;  3EPT A;  1CJ2 A;  2GVC A;  3IJL A;  2R45 A;  3AEF A;  1JRX A;  2C3C A;  4H2P A;  5IQ1 A;  3AE5 A;  1YKJ A;  1JRZ A;  4OPC A;  4O5Q A;  2Q7V A;  2JK6 A;  1LTX R;  3UJE A;  3UOY A;  1F8W A;  4C5O A;  4FP1 A;  2GF3 A;  4A6G A;  2PP3 A;  3VC5 A;  4IL2 A;  4Y4L A;  3DK8 A;  2ARD A;  1PBF A;  4U2S A;  3N6H A;  1LPF A;  2PMQ A;  3G5S A;  3ZYX A;  3QSS A;  1KSS A;  5KMP A;  5BUK A;  2TPR A;  4DGK A;  3GYX A;  4G74 A;  3UJF A;  4DYE A;  3JSK A;  3SFD A;  3URH A;  3ICT A;  1COY A;  2CFY A;  4J1O A;  1S3B A;  4GFI A;  2BK5 A;  2DKH A;  3MUC A;  5FS8 A;  4YWO A;  3D9X A;  4A3R A;  2YG5 A;  2CUL A;  4Z44 A;  3HW2 A;  1NAA A;  2UZZ A;  1BKH A;  4BK2 A;  2AQJ A;  2R4J A;  5FJT A;  3BSM A;  5EB4 A;  3TCS A;  1TYP A;  1OJC A;  3K30 A;  4CY8 A;  3TOY A;  3A7A A;  4K7Z A;  2HQM A;  3P4S A;  3FMW A;  2WOW A;  2XFN A;  5CQF A;  4JN9 A;  4E4U A;  3DGB A;  3GD4 A;  3T2Y A;  3VFC A;  3AEC A;  4YSZ A;  3DJE A;  3DK4 A;  3LZX A;  3P4P A;  1NEN A;  3RHA A;  3GC2 A;  5FJR A;  2OFJ A;  2F5Z A;  3BOX A;  3NVY B;  2PYX A;  4K22 A;  3FBS A;  2WDV A;  3DDM A;  5LV9 A;  1FHV A;  4U2L A;  2YR4 A;  4GRT A;  5HY5 A;  4GR1 A;  3UKP A;  5J60 A;  2Y6Q A;  5KMR A;  1JPD X;  4YWS A;  2R9Z A;  4K1W A;  1RSG A;  3SN4 A;  4U8L A;  2FYM A;  1YQ4 A;  4B64 A;  4CCR A;  1GRF A;  3GRT A;  2WQY A;  1ZMD A;  4AT2 A;  4XWZ A;  1F9C A;  5ER0 A;  2BCG G;  1TE6 A;  3V3W A;  5EBK A;  3ZLH A;  2C3D A;  2DKI A;  4Z17 A;  3GDP A;  4H4P A;  3NFU A;  4FI4 A;  3CPI G;  4OPL A;  4CY6 A;  1ZDL A;  4IHC A;  2OA1 A;  3H70 A;  3KVE A;  2C72 A;  4Z2R A;  1PJ6 A;  2WP9 A;  4EQS A;  2R0C A;  3QVR A;  3T8Q A;  4E6M A;  4A7A A;  1GT8 A;  3STP A;  3B6D A;  3SZ0 A;  1WUF A;  4Z1Y A;  2XYO A;  2MNR A;  3PK7 A;  3AYL A;  1F8R A;  3PO7 A;  2OG9 A;  2WP5 A;  2YLT A;  4IL0 A;  3L8K A;  2RGJ A;  3TWA A;  2YG4 A;  3UKF A;  1PDH A;  1TYT A;  3ZLF A;  4KWS A;  1P48 A;  4TLZ A;  2PU1 A;  4B1B A;  3H8L A;  1XPY A;  2ZZC A;  4UDR A;  4J33 A;  1F3P A;  3S47 A;  5JCI A;  3B3R A;  4E0V A;  2AKM A;  2OLN A;  2JB1 A;  1ZOV A;  2RGO A;  4RG3 A;  3NGC X;  1TZZ A;  3QLD A;  3D1C A;  3LOV A;  1KNR A;  4E5T A;  1O94 A;  1RVK A;  1V59 A;  1PDZ A;  3AN1 A;  3Q45 A;  1D5T A;  1D4E A;  1EL8 A;  1JPM A;  2C75 A;  2Q0K A;  1GOS A;  1OJD A;  1KCZ A;  2BC0 A;  2VVM A;  4H50 A;  5KVH A;  3CT2 A;  4C77 A;  1GRG A;  3UJR A;  2W3R A;  4GIR A;  1ZKQ A;  3NS1 B;  3VRB A;  3VC6 A;  2WEU A;  1RM6 B;  3MY9 A;  2V60 A;  5M0Z A;  3F8D A;  3UP4 A;  2ZC8 A;  2GMH A;  1GES A;  1PN0 A;  4C3X A;  1MO9 A;  3L1R A;  3VRD B;  4DSG A;  2BXS A;  1ZOY A;  1CJ3 A;  1VDV A;  4HCD A;  3R11 A;  3RO6 A;  3M12 A;  3DFY A;  4CNJ A;  3ALM A;  2E3T A;  3U4F A;  3C4A A;  1E1N A;  4U8I A;  3T37 A;  1JEH A;  2WPE A;  4EM4 A;  4APN A;  2X3N A;  3DJD A;  2QA2 A;  1PXB A;  3AMZ A;  3H8I A;  2J3N A;  4ICY A;  4NTC A;  3GD6 A;  1JRY A;  3UCD A;  3GWF A;  3DJG X;  5DBJ A;  3UOV A;  2EQ8 A;  4KPL A;  3GYI A;  1PJ5 A;  3LB8 A;  4CNK A;  3K7T A;  2P0I A;  3ALJ A;  3NRZ B;  3R0U A;  3Q9T A;  3T2Z A;  1R6W A;  3CNS A;  3KKJ A;  1NHP A;  1R0M A;  3SN0 A;  3CMM A;  4RSL A;  5HYM A;  2FKP A;  1GTH A;  2IVE A;  3VR8 A;  3AE6 A;  5BUL A;  3RP7 A;  4J3Z A;  3V5C A;  2PS2 A;  1GRE A;  1X2G A;  3E1T A;  2PP0 A;  1EL5 A;  3CPH G;  3K7Q X;  4IA6 A;  1E6E A;  4X9M A;  3DG6 A;  3EUB 3;  2XLS A;  3VRA A;  3JVA A;  4LA1 A;  4Y4N A;  4NEW A;  1GRA A;  3HRD C;  1DOD A;  2AL2 A;  3UJ2 A;  3P93 A;  1N60 C;  4A35 A;  2GV8 A;  4C74 A;  3CGD A;  3QSM A;  2EQ6 A;  4A99 A;  5FJU A;  4DWD A;  1OJA A;  3VCN A;  4GDP A;  2A8X A;  1UKV G;  2EQ7 A;  4DHG A;  4BJZ A;  2Z5X A;  1ZK7 A;  2P3Z A;  2Q0L A;  3H7V A;  4YSY A;  2I5Q A;  4NNJ A;  1F8S A;  4O5U A;  2POD A;  3AD8 B;  4G8T A;  2XH4 A;  4I59 A;  1ZXI C;  3UTF A;  3AD7 B;  2YAU A;  4EQX A;  2AR8 A;  4REK A;  4OPG A;  3CXO A;  4YTP A;  2GR2 A;  3DME A;  4JN8 A;  3ALL A;  2C67 A;  3ES7 A;  2C70 A;  1W6T A;  4EIQ A;  3T9P A;  1H86 A;  2X8G A;  3BI2 A;  2BXR A;  1ZX9 A;  2WPC A;  4NEV A;  1O5W A;  3MSY A;  3P0W A;  5GSN A;  1VRQ B;  2GSH A;  2PGE A;  3CYJ A;  1ONE A;  3R07 C;  3AE2 A;  2BS3 A;  3DG7 A;  1KN0 A;  3B97 A;  4TVW A;  4OPI A;  1FEA A;  1P43 A;  1LV0 A;  1CC2 A;  3OPS A;  3NYE A;  1VDC A;  4G6H A;  2RGH A;  4B68 A;  3R10 A;  1MOK A;  3RP6 A;  4U8P A;  4II2 A;  2BK3 A;  4G7F A;  3IHM A;  4AOS A;  1TDO A;  4ZA0 A;  2JAE A;  3S5W A;  3UTG A;  4USR A;  2GL5 A;  1N4U A;  2GH5 A;  3BNU A;  4M6U A;  4FX9 A;  4GGH A;  4EQR A;  5JCM A;  3D47 A;  3NG7 X;  3RED A;  3ATR A;  1ZY8 A;  4CCQ A;  2OLA A;  3RNM A;  2C65 A;  3II4 A;  3FG2 P;  1XAN A;  1LQT A;  7ENL A;  1FCD A;  4IV9 A;  3QFA A;  4E8G A;  4NZH A;  2QDE A;  1CC6 A;  4JDR A;  2XFU A;  1NHQ A;  3VR9 A;  4UDQ A;  1PJ7 A;  2XVE A;  4NTD A;  4H2H A;  4HPN A;  4JN7 A;  1JDF A;  2BK4 A;  4AP1 A;  1H83 A;  1RP0 A;  3UKQ A;  1Q1W A;  1QJD A;  2XVI A;  3GSI A;  3SX6 A;  3IJI A;  4YTM A;  4JY2 A;  2X8C A;  3LXD A;  1N61 C;  2QJN A;  3SZF A;  3K1G A;  1BGJ A;  2OAL A;  4DXK A;  4DSH A;  3PWG A;  2AKZ A;  3EF6 A;  2GGI A;  2Z5Y A;  3QSE A;  3P9U A;  4JNA A;  2QJJ A;  4X2P A;  3DK9 A;  1TRB A;  2FJB A;  1DJQ A;  4BJY A;  2AL2 B;  4Z25 A;  3EAN A;  1H82 A;  3UOZ A;  2P8C A;  1MNS A;  1ELI A;  1E1K A;  3TJ4 A;  1EBH A;  2APG A;  1IUU A;  1S2Y A;  2PA6 A;  5C3J A;  4AOX A;  2A89 A;  2GGE A;  3ISH A;  1N1P A;  2V61 A;  5FS9 A;  5M10 A;  2DW7 A;  3CND A;  4DX3 A;  3NTA A;  4IP4 A;  1NHR A;  2R0P A;  3PS9 A;  5KRQ A;  4FK1 A;  2BC1 A;  4MGG A;  4ENL A;  2AAQ A;  1X2H A;  4D04 A;  5KVI A;  3KPK A;  4EM3 A;  4H1Z A;  5JCL A;  3PVC A;  5KXJ A;  3AM9 A;  2YG6 A;  4ADW A;  3HYV A;  3SJN A;  4ZN0 A;  3BNM A;  4H4W A;  3DER A;  2GR0 A;  2E5A A;  4K2X A;  4ZCW A;  2FJE A;  4TM4 A;  3AE7 A;  2H89 A;  4TM3 A;  2V5Z A;  5L46 A;  3GWD A;  2PPG A;  3N4E A;  3HYX A;  4JY3 A;  3ZLG A;  4K8G A;  3AEG A;  3T2K A;  3GY1 A;  5U25 A;  3V3O A;  2OX4 A;  3CK5 A;  4GCM A;  1XS2 A;  2BYB A;  2XDO A;  2E5V A;  4U8J A;  1FO4 A;  1K0J A;  5BOE A;  2V3B A;  5JCK A;  3DGH A;  1GEU A;  2E4G A;  2Y6R A;  4HNL A;  3UXK A;  1TDN A;  3HZL A;  2CVJ A;  1MDR A;  3OTR A;  1RYI A;  2XLR A;  3TTE A;  1X31 B;  3NXL A;  4JNQ A;  4J31 A;  5KMS A;  3BHK A;  1D4D A;  3NK0 X;  2GB0 A;  4TM1 A;  1VG0 A;  2GQF A;  2ZZ0 A;  3EKG A;  1FL2 A;  3IJQ A;  3FXG A;  1VQW A;  3ZVH A;  2A87 A;  3KU9 A;  1S3E A;  4U8O A;  4GF7 A;  4K5R A;  1VG9 A;  5G5H B;  2VQ7 A;  2VVL A;  1PDY A;  4H7U A;  1PHH A;  2JB3 A;  2R4E A;  1GXF A;  4BK3 A;  3T31 A;  4ZCC A;  3I6D A;  3NYF A;  3NIX A;  3G5R A;  5KMQ A;  3Q6J A;  3QTP A;  2NPX A;  2BAC A;  2XFQ A;  5HHF A;  3NHO X;  1O95 A;  2YVG A;  4KEM A;  3FCP A;  2ZBW A;  2QDD A;  1AOG A;  2BRA A;  2OO6 A;  3V76 A;  3F8R A;  1GND A;  3MQT A;  2V6O A;  2OZ8 A;  3ZVI A;  3RRA A;  4Z24 A;  3I6T A;  1BQG A;  3NVV B;  1OJT A;  4X4J A;  4U8N A;  2WET A;  3DJJ A;  3AED A;  2ZAD A;  3CNP A;  1GRB A;  4IP5 A;  2OPJ A;  4J2W A;  4GYP C;  1KFY A;  1ZP0 A;  1KKO A;  4H83 A;  3TW9 A;  4B66 A;  1D7Y A;  4C3Y A;  1YY5 A;  2QA1 A;  2HXT A;  1Q9I A;  1KSU A;  3AE9 A;  1GET A;  4HA6 A;  5KNL A;  1FFV C;  3A7U A;  2YM2 A;  5ENL A;  2WES A;  2OQH A;  4MJW A;  4ZOH B;  2OQY A;  3AEB A;  2VRM A;  3DH9 A;  1STZ A; 
#chains in the Genus database with same CATH homology
 4FDC B;  3G5S A;  3ZYX A;  3QSS A;  2Q0L A;  4N9X A;  1KSS A;  4YSY A;  2WOI A;  4Z2T A;  5KMP A;  4NNJ A;  1F8S A;  2B9W A;  4O5U A;  3UKA A;  1LQU A;  3AD8 B;  1LVL A;  5BUK A;  4I59 A;  2TPR A;  3S61 A;  3KD9 A;  3UTF A;  3NTD A;  3SXI A;  3GYX A;  4DGK A;  2QAE A;  2WP6 A;  4J34 A;  1Y0P A;  3AD7 B;  2YAU A;  4EQX A;  2AR8 A;  4H4S A;  2R0G A;  4G74 A;  4OPD A;  4OPG A;  4REK A;  4YKF A;  4YTP A;  2GR2 A;  3DME A;  3ALL A;  2C67 A;  4UP3 A;  4BV6 A;  1PBD A;  2C70 A;  3NKS A;  4EIQ A;  4EMW A;  1W4X A;  2GMJ A;  3JSK A;  4OCG A;  1H86 A;  2XVJ A;  4Z43 A;  2X8G A;  3BI2 A;  3SFD A;  2BXR A;  1ZX9 A;  2WPC A;  3URH A;  4NEV A;  1COY A;  2C64 A;  3ICT A;  3OZ2 A;  1O5W A;  4ECH A;  2YVJ A;  2CFY A;  1QLB A;  2JKC A;  1GSN A;  5GSN A;  4A6N B;  1VRQ B;  2YG7 A;  3SFE A;  1E39 A;  2YLW A;  3AE3 A;  4GAP A;  4NWZ A;  5CKU A;  5KOX A;  1S3B A;  2YWL A;  3AE2 A;  1N4W A;  4Y4M A;  2VOU A;  4B63 A;  2BS3 A;  2BK5 A;  1KN0 A;  1KNP A;  4OPI A;  3AD9 B;  2DKH A;  1FEA A;  1TDF A;  3GYJ A;  3SY4 A;  1REO A;  1LV0 A;  1CC2 A;  3O0H A;  2WPF A;  1K4Q A;  5FS8 A;  4YWO A;  3D9X A;  3NYE A;  1VDC A;  4G6H A;  2RGH A;  2JBV A;  4J57 A;  2YG5 A;  2CUL A;  4OVI A;  4Z44 A;  4B68 A;  1FEC A;  3CGC A;  2XLU A;  3CNJ A;  1NAA A;  2UZZ A;  5BVA A;  1MOK A;  4BK2 A;  1YQZ A;  3RP6 A;  2AQJ A;  4OPT A;  2R4J A;  4U8P A;  4II2 A;  4BK1 A;  2BK3 A;  1BF3 A;  1NEK A;  4HB9 A;  3IHM A;  4AOS A;  3AYI A;  3NYC A;  1TDO A;  4U8K A;  3QVP A;  3IHG A;  1TYP A;  1OJC A;  2JAE A;  5EB4 A;  3S5W A;  4A9W A;  3K30 A;  3GMC A;  3ITJ A;  3UTG A;  4CY8 A;  4EQW A;  4USR A;  4K7Z A;  2HQM A;  1N4U A;  2BS2 A;  3P4S A;  2O9Z A;  2FBW A;  2GH5 A;  3FMW A;  2WOW A;  2XFN A;  1XHC A;  3BNU A;  4K5S A;  4H2N A;  5CQF A;  2WS3 A;  4XXG A;  4JN9 A;  5J7X A;  4YXD A;  2GR3 A;  3GD4 A;  4FX9 A;  2XLP A;  4D03 A;  3T2Y A;  4EQR A;  5JCM A;  2B76 A;  2YLX A;  3L5O A;  3AEC A;  3NG7 X;  3RED A;  4YSZ A;  3DJE A;  4Z2U A;  3DK4 A;  3ATR A;  3LZX A;  2VZ2 A;  1ZY8 A;  4CCQ A;  3P4P A;  5HXI A;  3RNM A;  3UKH A;  2C65 A;  1NEN A;  1PS9 A;  3II4 A;  2GQW A;  3M13 A;  4KPR A;  3RHA A;  3FG2 P;  4TLX A;  1XAN A;  1LQT A;  1FCD A;  1KDG A;  2F5Z A;  4H2Q A;  4IV9 A;  2WU5 A;  2PYX A;  3QFA A;  2EQ9 A;  4K22 A;  3FBS A;  2WDV A;  2YQU A;  4NZH A;  2GRT A;  2BRY A;  5LV9 A;  4H4X A;  1NPX A;  1PXC A;  3NH3 X;  1CC6 A;  1EBD A;  1GRT A;  4M52 A;  4JDR A;  2PHH A;  1NHQ A;  2XFU A;  4LU6 A;  4U2L A;  2YR4 A;  1CHU A;  1D4C A;  3VR9 A;  1JU2 A;  2B9X A;  4UDQ A;  4GRT A;  3M0O A;  5HY5 A;  2YVF A;  3CIR A;  1PJ7 A;  3SZW A;  4GR1 A;  2XVE A;  4A65 A;  4NTD A;  3SM8 A;  3UKP A;  5J60 A;  2Y6Q A;  1H81 A;  1Y56 B;  5KMR A;  2YG3 A;  2R9Z A;  4IVO B;  1RSG A;  2BK4 A;  5JRB A;  4AP1 A;  1ONF A;  1H83 A;  5FS6 A;  1PBC A;  1YQ4 A;  4U8L A;  5EB5 A;  3CGE A;  1GV4 A;  4H4U A;  1E1M A;  1RP0 A;  1GRF A;  1Q1W A;  3GRT A;  1QJD A;  2C73 A;  2WDR A;  3UKQ A;  4CBQ A;  2WQY A;  1ZMD A;  4OPU A;  2XVI A;  3GSI A;  3SX6 A;  3UP5 A;  1XPQ A;  1NG3 A;  4YTM A;  2B9Y A;  4AT2 A;  4JY2 A;  1IUT A;  2X8C A;  4XWZ A;  1Q1R A;  1NG4 A;  3LXD A;  5ER0 A;  2BCG G;  3UTE A;  1L0V A;  1N4V A;  3FPZ A;  3SZF A;  4JQ9 A;  3QFB A;  5EBK A;  2OLO A;  1BGJ A;  2OAL A;  3UCL A;  2C3D A;  2DKI A;  4DSH A;  4B67 A;  4G6G A;  2C7G A;  3G5Q A;  5FS7 A;  2R46 A;  2BA9 A;  3EF6 A;  3GDP A;  4H4P A;  5EOW A;  3CPI G;  2VRL A;  2Z5Y A;  3AEA A;  3ICS A;  1L9E A;  3NLC A;  4OPL A;  4CY6 A;  2QCU A;  1ZDL A;  4YSX A;  2OA1 A;  4WCT A;  1K0L A;  3NK2 X;  4GDE A;  3COX A;  3KVE A;  3QSE A;  2C72 A;  4B64 A;  1PJ6 A;  4Z2R A;  2WP9 A;  3P9U A;  4EQS A;  4JNA A;  1TRB A;  3DK9 A;  3AXB A;  1IUX A;  1B4V A;  2FJB A;  2R0C A;  3OC4 A;  1DJQ A;  2XVH A;  4G73 A;  4BJY A;  5BRT A;  4Z25 A;  5KWF A;  3QVR A;  3EAN A;  1H82 A;  3UOZ A;  1H6V A;  4A7A A;  4PAB A;  1GT8 A;  4FK1 C;  4H4Z A;  4LII A;  1E1K A;  1ELI A;  1L9C A;  4H2R A;  4YKG A;  2NVK X;  3B6D A;  3SZ0 A;  4EMI A;  2APG A;  4TM0 A;  4A5L A;  1IUU A;  5IQ4 A;  1DOE A;  1S2Y A;  4AT0 A;  2XYO A;  5C3J A;  2Q6U A;  2CDU A;  4K8D A;  1F8R A;  3AYL A;  3PO7 A;  2A89 A;  4X9N A;  1IUS A;  4AOX A;  2WP5 A;  3ABV A;  3ISH A;  1N1P A;  2YLT A;  4IVM B;  2V61 A;  1GTE A;  3SGL A;  3L8K A;  2V3A A;  5FS9 A;  2GEW A;  2RGJ A;  3NT6 A;  3UKL A;  5M10 A;  1IJH A;  1B5Q A;  3UKK A;  2YG4 A;  3KA7 A;  4B65 A;  2GR1 A;  4H4T A;  3UKF A;  1PDH A;  4Z26 A;  1TYT A;  2XLT A;  3CND A;  1CJ4 A;  4KX6 A;  3NTA A;  1FOH A;  5FMH A;  4TLZ A;  3QJ4 A;  3AB1 A;  4H4Y A;  2C4C A;  1NHR A;  2X8H A;  3H8L A;  2ZZC A;  2R0P A;  3ZDN A;  4B1B A;  3CPJ G;  3PS9 A;  4UDR A;  4J33 A;  1F3P A;  5JCI A;  3B3R A;  4E0V A;  5KRQ A;  2OLN A;  2JB1 A;  1ZOV A;  2YR5 A;  4FK1 A;  2RGO A;  3LZW A;  4RG3 A;  3SZC A;  2BC1 A;  3C4N A;  3KPF A;  3NGC X;  2AAQ A;  4CCR A;  1F6M A;  4D04 A;  3LJP A;  5KVI A;  3D1C A;  2ZZB A;  3CNT A;  1BZL A;  1IUV A;  3KPK A;  4EM3 A;  3LOV A;  1KNR A;  5U1O A;  5JCL A;  3PVC A;  4BUR A;  2YLZ A;  5KXJ A;  1IUW A;  2YG6 A;  1PXA A;  4ADW A;  1O94 A;  1BGN A;  3HYV A;  1E7P A;  2YLS A;  1V59 A;  1D4E A;  1D5T A;  4G9K A;  1H2I A;  5GRT A;  3AYJ A;  1LJ1 A;  1S2Q A;  1EL8 A;  4ZN0 A;  2C75 A;  2Q0K A;  3BNM A;  2XVF A;  1GOS A;  3BI4 A;  5IPY A;  1OJD A;  3DA1 A;  1FEB A;  4H4W A;  1H7W A;  2GR0 A;  2BC0 A;  2VVM A;  1L9D A;  3GRS A;  4H50 A;  2FJE A;  4K2X A;  3AE7 A;  4TM4 A;  2IVD A;  4II3 A;  2W0H A;  5KVH A;  2H89 A;  2V5Z A;  2WHD A;  3GWD A;  4TM3 A;  5L46 A;  1B37 A;  3C96 A;  2WU2 A;  4A6N A;  4P9S A;  3HYX A;  4JY3 A;  3WE0 A;  3AEG A;  3T2K A;  4C77 A;  2OAM A;  2YLR A;  3SYI A;  5U25 A;  1DJN A;  2VQB A;  1GRG A;  3V3O A;  4GCM A;  1D7L A;  4CRT A;  2BYB A;  3IC9 A;  1DOB A;  2XDO A;  2E5V A;  4U8J A;  1K0J A;  1KF6 A;  4H4Q A;  2C76 A;  2V3B A;  3I3L A;  5JCK A;  4XWR A;  3DGH A;  1GEU A;  1ZKQ A;  3H4K A;  2E4G A;  2Y6R A;  3R9U A;  4B69 A;  1EL9 A;  1P2E A;  3VRB A;  1CBO A;  1TDN A;  3KLJ A;  2WEU A;  3HZL A;  1S7M A;  2V60 A;  2H88 A;  5M0Z A;  2CVJ A;  3UTH A;  2RAB A;  3CGB A;  3UOX A;  1RYI A;  3F8D A;  1OJ9 A;  3UP4 A;  2GAH B;  2XLR A;  2GMH A;  1GES A;  1PN0 A;  4IA5 A;  4UDP A;  1JOA A;  3CN8 A;  4C3X A;  2WBA A;  1X31 B;  3BHF A;  3P4Q A;  1MO9 A;  4JNQ A;  4J31 A;  3L1R A;  1HYU A;  4PAA A;  2VVL G;  5KMS A;  3VRD B;  1DNC A;  3BHK A;  3T0K A;  4DSG A;  2ACZ A;  5U63 A;  2BXS A;  3P4R A;  1D4D A;  3NK0 X;  2GB0 A;  3IF9 A;  4J36 A;  4TM1 A;  1ZOY A;  1VG0 A;  2GQF A;  2ZZ0 A;  4GAV A;  1CJ3 A;  1JNZ A;  3VQR A;  1FL2 A;  3ICR A;  3M12 A;  4CNJ A;  2YR6 A;  1NHS A;  1QO8 A;  3ALM A;  1Z6L A;  4USQ A;  1VQW A;  3C4A A;  2TMD A;  5KOW A;  2A87 A;  1E1N A;  3KU9 A;  3LAD A;  1S3E A;  4U8O A;  1BKW A;  4GF7 A;  1JNR A;  4K5R A;  4U8I A;  3T37 A;  2E1M A;  1JEH A;  1VG9 A;  2WPE A;  4I58 A;  2BCP A;  3P1W A;  3DGZ A;  4EM4 A;  5TR3 A;  4APN A;  2VQ7 A;  1PBE A;  3NN0 X;  2VVL A;  3V3N A;  3D8X A;  4RG4 A;  4H7U A;  1PHH A;  2X3N A;  2JB3 A;  3NN6 X;  3DJD A;  2QA2 A;  3BI5 A;  1PXB A;  2R4E A;  1EL7 A;  2I0Z A;  1GXF A;  1P2H A;  2XFO A;  3H8I A;  2J3N A;  4ICY A;  4BK3 A;  5C2T A;  3T31 A;  2B7R A;  3GDN A;  3NNE A;  4ZCC A;  3RP8 A;  1PBB A;  3I6D A;  4NTC A;  1JRY A;  2GAG B;  1NDA A;  3NYF A;  4H4R A;  3NIX A;  2X99 A;  4A79 A;  3NK1 X;  1GER A;  3G5R A;  5KMQ A;  2FJA A;  3Q6J A;  1K0I A;  3EAO A;  3GWF A;  3DJG X;  5DBJ A;  3HYW A;  3IWA A;  2NPX A;  2BAC A;  2XFQ A;  1M6I A;  3FIM B;  1O95 A;  3NHO X;  5HHF A;  3ATQ A;  3UOV A;  2EQ8 A;  4EIP A;  1B8S A;  2YVG A;  2XCG A;  3AE8 A;  1Y56 A;  1SEZ A;  2ZBW A;  3GYI A;  1PJ5 A;  2BS4 A;  3LB8 A;  2FJD A;  1AOG A;  4CNK A;  2BRA A;  4EMJ A;  3K7T A;  2WOV A;  4J56 A;  3ALJ A;  1CC4 A;  4NTE A;  3V76 A;  2BAB A;  3Q9T A;  4DNA A;  1GND A;  3F8R A;  3T2Z A;  4U2T A;  3CNS A;  3KKJ A;  1NHP A;  2V6O A;  4AP3 A;  3AE1 A;  1GRH A;  1M64 A;  3CMM A;  4RSL A;  1BWC A;  1CJC A;  5HYM A;  4GUV A;  4Z24 A;  1CL0 A;  3ADA B;  1GPE A;  3AE4 A;  4YT0 A;  3K7M X;  2IID A;  3AEE A;  3CTY A;  1GTH A;  1OJT A;  2IVE A;  2YM1 A;  4X4J A;  3VR8 A;  3AE6 A;  5BUL A;  4U8N A;  1H84 A;  2X50 A;  3PG6 A;  3RP7 A;  2WET A;  3EPT A;  1GRE A;  3DJJ A;  5JCN A;  3CPH G;  1EL5 A;  3E1T A;  3K7Q X;  2WDQ A;  1CJ2 A;  2GVC A;  3AED A;  4U8M A;  1H7X A;  4IA6 A;  3CNP A;  1E6E A;  4X9M A;  1GRB A;  2R45 A;  2XLS A;  3AEF A;  1MXT A;  1JRX A;  4WX1 A;  3VRA A;  2C3C A;  4J2W A;  3NRN A;  4ZCD A;  4LA1 A;  4Y4N A;  4H2P A;  5IQ1 A;  4NEW A;  4H4V A;  1KFY A;  1ZP0 A;  3AWI A;  1TDE A;  1GRA A;  4B66 A;  1DOD A;  3AE5 A;  1YKJ A;  1D7Y A;  3GMB A;  1JRZ A;  4OPC A;  4C3Y A;  1YY5 A;  2QA1 A;  2Q7V A;  4O5Q A;  2C66 A;  1DXL A;  2JK6 A;  1LTX R;  1Q9I A;  1E1L A;  1KSU A;  3AE9 A;  1GET A;  2GV8 A;  3UOY A;  4C74 A;  1XDI A;  1DOC A;  4HA6 A;  1CF3 A;  1F8W A;  5KNL A;  3CGD A;  4C5O A;  1YQ3 A;  3QSM A;  2EQ6 A;  3GD3 A;  4A99 A;  3T14 A;  1ZMC A;  2JB2 A;  1OJA A;  2YM2 A;  2GF3 A;  2WES A;  4YTN A;  1TDK A;  4MJW A;  4GDP A;  2A8X A;  3AEB A;  4Y4L A;  1UKV G;  2EQ7 A;  3DK8 A;  2VRM A;  3DH9 A;  3F8P A;  2ARD A;  1GAL A;  3SQP A;  1PBF A;  4U2S A;  2B7S A;  4YSH A;  1LPF A;  4BJZ A;  2XFP A;  2Z5X A;  1ZK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...