1GV4A

Murine apoptosis-inducing factor (aif)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
490
structure length
490
Chain Sequence
TVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Mouse Apoptosis-Inducing Factor Aif
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords PROGRAMED CELL DEATH PROTEIN 8
total genus 149
structure length 490
sequence length 490
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1gv4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A01
3NN0X 2XFOA 1YKJA 4KX6A 3LXDA 2RABA 5M0ZA 3UTHA 1CL0A 2YAUA 1GT8A 3AE2A 4H4ZA 5U25A 4TM3A 4IVOB 1GSNA 4ZCCA 4GRTA 2J3NA 4CNJA 1RYIA 1KNRA 1TDFA 2V60A 4C5OA 2ZZCA 2ZZBA 4OPGA 3AYLA 2GMJA 4RG4A 3FMWA 3KA7A 2Z5YA 1CHUA 2BS3A 1GRAA 2WP5A 3QFBA 2IVEA 3ICSA 3HZLA 1N1PA 3VRAA 1ZKQA 5LV9A 1BWCA 3V3OA 2RGJA 2RGOA 3VQRA 2EQ7A 2B7RA 3IC9A 2BACA 1CC4A 1CBOA 4FK1C 4YSXA 1XANA 4U8PA 2GF3A 1NAAA 4B65A 4Y4NA 1OJDA 3AEEA 1H86A 3BI4A 4DNAA 3P9UA 4OPDA 3UP4A 4X4JA 1IUUA 3AE5A 3LZWA 3IHGA 3PS9A 4Z43A 2YLRA 3M12A 3NGCX 5GSNA 2XLUA 3CIRA 1GREA 3UOYA 4IVMB 4CNKA 3KPFA 3AE7A 3KD9A 2H89A 1CJ4A 3AE3A 1M64A 4M52A 1F3PA 2E5VA 2XFNA 4U8NA 4Z44A 2BK4A 1B4VA 1IUTA 1VG9A 3KKJA 2GQFA 1JRZA 4TLZA 2YLTA 1F8SA 3RHAA 3UKHA 1JU2A 3VR8A 3GYIA 1D7LA 4LIIA 2GQWA 1IUXA 1JRYA 4RG3A 3UOVA 1JNZA 1JNRA 3QSMA 5TR3A 4TM4A 4J36A 5HYMA 3AD7B 3REDA 3UP5A 3QSSA 1GRTA 1TYTA 4EM3A 4GDPA 4HA6A 4Y4LA 4YT0A 2JB1A 5J7XA 5JCNA 4ECHA 5FS6A 1CC2A 4UDQA 1H82A 2YLWA 2WETA 4J33A 4EQXA 4A79A 4KPRA 3FPZA 2OLNA 4ICYA 3NHOX 1NEKA 3S5WA 3UCLA 1PS9A 5BULA 3DJEA 2V61A 3AE9A 3EF6A 4K5RA 3GD4A 1PXBA 4B63A 4U2TA 2PYXA 1F6MA 2VVLG 4APNA 2C66A 3LJPA 3UTGA 2R0PA 2BXRA 3CNSA 3UTFA 5U63A 4OPUA 2CULA 2YVFA 3GMCA 3B6DA 4XWZA 1KDGA 1XPQA 4FX9A 1PXCA 5KWFA 1RP0A 3LOVA 1ZX9A 4K2XA 5J60A 2XVEA 3GSIA 1D5TA 2GRTA 5JCKA 1LQTA 3P4PA 2C7GA 2A87A 4O5QA 4UDRA 5EOWA 3SQPA 2CVJA 3RP8A 3UOZA 3CNDA 2VOUA 1FCDA 3B3RA 1IUWA 4WCTA 1Q9IA 4YKGA 1CF3A 4BJZA 1NENA 4J56A 4A7AA 1S3BA 2FJDA 3AEFA 2XCGA 5EB5A 2WDQA 5BRTA 4NTDA 1V59A 5JCMA 5KXJA 1DOCA 4OPCA 4RSLA 1NPXA 1E7PA 1K0JA 4BK3A 1CJ3A 3KU9A 2YG4A 1X31B 3NK1X 5U1OA 1H7XA 1DNCA 2BS4A 1PBFA 1LV0A 1GERA 2QA2A 1ZDLA 2XDOA 1DJNA 3AYIA 1TDKA 1VRQB 1JRXA 3AE8A 3Q9TA 3UTEA 4H4QA 4JN9A 4E0VA 2GR2A 4ZN0A 4OCGA 4U8KA 3SM8A 3CGCA 4NEWA 2GB0A 1ONFA 2R46A 3NLCA 3NYEA 2EQ6A 2JK6A 2BXSA 3O0HA 1FECA 1GRGA 2Q6UA 4YTNA 2BA9A 3Q6JA 1IJHA 2VQ7A 2WDRA 4H4SA 4C77A 3NYFA 3FIMB 5EBKA 1PHHA 3C4AA 4Z24A 2WP6A 1H81A 2Y6QA 2QAEA 1P2HA 1DOBA 3ABVA 3M0OA 2JKCA 3K7MX 1ELIA 2YLZA 4A9WA 3I3LA 2JAEA 1IUVA 3IWAA 5IQ1A 4EMIA 1M6IA 3GYJA 5HY5A 3OC4A 1MO9A 3LB8A 3F8RA 4U8IA 2CDUA 1FEBA 4Z25A 1KSUA 1N4WA 1E1KA 3DK8A 3AEBA 3BHKA 3BI2A 3FBSA 1EL5A 3KVEA 4EQRA 3GDNA 4IA5A 2H88A 4AOSA 4B68A 1JEHA 1DOEA 2V3AA 4JNAA 3II4A 2R0CA 3ITJA 5KVIA 1PBBA 2XLPA 3NRNA 1O94A 2WBAA 2BCGG 3BI5A 3H8LA 2BK5A 1VG0A 2B7SA 1VDCA 3JSKA 5L46A 4K8DA 2C64A 3F8DA 1L9DA 2HQMA 2ZZ0A 1PN0A 4JY2A 3OZ2A 1PBCA 2A89A 2PHHA 4H2PA 2NVKX 3RNMA 1S3EA 4NTEA 3NTAA 1NG3A 2C67A 4XWRA 1TYPA 5HXIA 1QJDA 2C76A 4JQ9A 2BS2A 2OAMA 2V3BA 2XVIA 3CTYA 3PVCA 4CY6A 2X99A 3CNJA 1OJ9A 4B67A 4C74A 2WPEA 1KF6A 1EBDA 4NEVA 1GV4A 2XLRA 3ADAB 2B9WA 3DH9A 3CNTA 2YG6A 4O5UA 4P9SA 4LU6A 3UKKA 3URHA 2EQ8A 3GRTA 1H83A 2C65A 3DJDA 3F8PA 4CCQA 4Z2RA 4H2NA 2ACZA 5JCIA 2YM1A 3AEAA 1DODA 1W4XA 2FBWA 2WQYA 3CGEA 2C70A 1GTHA 4YTMA 5BUKA 1KNPA 4UDPA 3ATQA 1Z6LA 2R4JA 4C3XA 2R4EA 2VVLA 4LA1A 4B64A 1ZMCA 1K4QA 2WESA 3RP6A 1GESA 2C72A 5EB4A 1S2QA 4Z2TA 1DXLA 3L8KA 3K30A 4Z26A 4NZHA 4REKA 1E39A 1UKVG 4EIPA 3CGDA 3CGBA 3DGZA 3D1CA 1CJCA 3UKFA 3V3NA 4MJWA 3D8XA 4X9MA 2WS3A 4H7UA 1KFYA 3AYJA 1ZK7A 4B69A 2R45A 1P2EA 2WU5A 1LPFA 1O95A 1GXFA 4GF7A 4U8OA 1MXTA 4WX1A 4J31A 2GV8A 4A5LA 2X8GA 4ADWA 1E6EA 1OJAA 3ALMA 2X50A 2DKHA 4D04A 3UKQA 3ICRA 3NTDA 3PO7A 2O9ZA 2AQJA 2WOIA 1NHRA 1FL2A 1PXAA 1PJ6A 1LVLA 2GR1A 3BNMA 2GH5A 2C73A 1BF3A 2QA1A 3ICTA 3CN8A 2C75A 2YR6A 3AB1A 3M13A 5IPYA 5FS8A 4OVIA 3DJJA 3G5RA 4OPLA 1BZLA 1EL7A 4PAAA 2Z5XA 4B1BA 2ZBWA 2ARDA 2YG3A 2C3CA 3ZYXA 1YQ3A 2YWLA 4AP1A 5C3JA 2JBVA 4ZCDA 4YXDA 3AE4A 3CPJG 2XFUA 4X9NA 1FEAA 3DA1A 4XXGA 2F5ZA 4GDEA 4U2LA 4H4WA 5FS9A 2VZ2A 3VRBA 4OPTA 1H84A 3VR9A 4K22A 1PDHA 2BK3A 2RGHA 3GDPA 3P1WA 4H4UA 3L1RA 3WE0A 1XDIA 2XVJA 2XVFA 3P4QA 4I59A 2GMHA 1QO8A 1EL9A 2WEUA 4YTPA 1BGNA 3NIXA 4DSHA 3RP7A 3AEDA 4H4PA 1CC6A 2Q0LA 3FG2P 3AWIA 4JNQA 4TM0A 1NHQA 5KRQA 2OLOA 3EANA 2V6OA 4AP3A 2AR8A 2XFQA 4GCMA 2EQ9A 1YY5A 3EAOA 5ER0A 2BYBA 3NT6A 4EQSA 1H7WA 3GWDA 3UKPA 1XHCA 2YLSA 1Q1RA 2NPXA 2B9XA 4D03A 1SEZA 2XVHA 4B66A 3H4KA 3AE1A 1ZMDA 3P4RA 1CJ2A 3IF9A 2VQBA 3CPIG 2GVCA 4TLXA 1IUSA 1E1NA 2R0GA 4USQA 5M10A 1ZY8A 4N9XA 3LADA 4H4YA 3R9UA 2W0HA 1F8WA 4JDRA 2C3DA 1PBDA 1NDAA 2BABA 3P4SA 1B5QA 1GEUA 2Q7VA 3G5SA 3AE6A 2WPCA 3ISHA 1L0VA 1D4DA 1B37A 1K0LA 1LJ1A 2APGA 2OA1A 4GUVA 2Q0KA 4A65A 1N4VA 1OJCA 4IA6A 1OJTA 4JY3A 3DK9A 5FMHA 4AT0A 3GWFA 2X8HA 1Y56A 3IHMA 3QVRA 2XFPA 2XLSA 3ALJA 3GD3A 5GRTA 4U8MA 5JCLA 3NG7X 3NH3X 4YKFA 2I0ZA 4NTCA 2WOWA 3I6DA 4GR1A 4H4TA 1S2YA 4H4VA 1YQ4A 4USRA 2GAGB 3E1TA 3K7QX 1GTEA 1GRBA 5IQ4A 3NK0X 1B8SA 3QVPA 2DKIA 4PABA 4A6NB 1EL8A 1TDOA 3K7TA 4BURA 3DJGX 1Y0PA 3NKSA 1FOHA 2YQUA 3AD9B 2OALA 3UOXA 3SFEA 2FJBA 4Y4MA 4EMWA 4J2WA 1TDNA 5DBJA 1BGJA 1REOA 1BKWA 2Y6RA 4K5SA 3DGHA 3CPHG 1GOSA 3AD8B 4CBQA 4I58A 1Q1WA 1GETA 1PJ7A 3NK2X 4U8LA 4A6NA 1TDEA 5FS7A 4TM1A 2WOVA 2TMDA 4EIQA 1E1MA 4BK2A 2AAQA 4K7ZA 1GALA 1TRBA 1D4EA 4H4XA 1L9CA 1AOGA 2B76A 2GEWA 3V76A 1GRFA 4H4RA 2YG7A 2BC1A 5CKUA 1D4CA 3QFAA 2E4GA 3NNEA 5HHFA 3BHFA 3ATRA 1ZP0A 1KSSA 4CRTA 4BK1A 2YVGA 1L9EA 3AECA 3LZXA 4CY8A 4YSYA 2B9YA 1RSGA 2UZZA 3BNUA 4EQWA 3AEGA 3QJ4A 4J57A 4YWOA 3EPTA 3DK4A 1NG4A 4YSZA 2IIDA 1Y56B 2YLXA 4IV9A 4U8JA 5BVAA 5KVHA 2V5ZA 2IVDA 1PJ5A 1VQWA 2R9ZA 4H50A 2QCUA 4EM4A 3T37A 4Z2UA 3SGLA 2GAHB 2VRLA 1MOKA 4AOXA 3DMEA 2BC0A 2WDVA 3ALLA 3AXBA 3UKAA 1ZOVA 1NHPA 2FJEA 1DJQA 2VVMA 4EMJA 5KOWA 2YR4A 4BV6A 1K0IA 1GPEA 1JOAA 2FJAA 4C3YA 2X3NA 4J34A 2E1MA 5KOXA 1YQZA 1ZOYA 2XYOA 2X8CA 3GRSA 3C4NA 4A99A 3NYCA 2WHDA 4FK1A 3KLJA 2A8XA 4H2QA 2YVJA 1COYA 3C96A 4CCRA 3CNPA 3ZDNA 1NHSA 2WPFA 1D7YA 1F8RA 3NN6X 1GNDA 2JB2A 4FDCB 1H6VA 1N4UA 1O5WA 2VRMA 3S61A 3GMBA 4AT2A 3H8IA 4HB9A 2BCPA 3VRDB 2WU2A 2CFYA 3SFDA 4DSGA 4H2RA 2WP9A 4U2SA 1LQUA 1LTXR 3QSEA 2TPRA 2JB3A 2YR5A 3G5QA 4BJYA 4DGKA 2GR0A 2XLTA 2YM2A 4OPIA 1GRHA 2GR3A 1PBEA 1QLBA 2YG5A 3COXA 4UP3A 3UKLA 4YSHA 5C2TA 1E1LA 5CQFA 1HYUA
chains in the Genus database with same CATH superfamily
3ES7A 2XFOA 4KX6A 5FJPA 4G73A 3LXDA 3Q45A 2RABA 4GGBA 4TM3A 4ZCCA 2J3NA 1CHUA 3QN3A 3QFBA 2AL2A 3ICSA 3VDGA 4A35A 2XSXA 3VQRA 3CB3A 2B7RA 3D46A 4KEMA 4YSXA 1XANA 4B65A 4Y4NA 4DN1A 4OPDA 1IUUA 3AM9A 3AE5A 3LZWA 4TVYA 4IVMB 3UXKA 2H89A 1CJ4A 3AE3A 1F3PA 3SN0A 4Z44A 3KKJA 4TLZA 2YLTA 1F8SA 3UOVA 4RG3A 1JNRA 5TR3A 3DESA 1GRTA 1TYTA 4GDPA 4HA6A 4Y4LA 1VQZA 1NU5A 1CC2A 1NEKA 1PS9A 2V61A 4B63A 1FFUC 2VVLG 4APNA 1FHUA 3S5SA 3UTFA 3R07C 4OPUA 2CULA 2YVFA 3MWCA 1PXCA 5KWFA 1RP0A 3H8AA 3SZCA 5EOWA 3SQPA 3CNDA 2QDDA 4WCTA 1FHVA 4BJZA 3KPKA 3AEFA 2HXTA 5KXJA 3T4WA 1NPXA 1E7PA 3ZLFA 1CJ3A 1X31B 2QA2A 2XDOA 3AE8A 4E0VA 2QVHA 2GR2A 3SM8A 3CGCA 1ONFA 3NLCA 2JK6A 2O56A 4YTNA 2BA9A 2VQ7A 3R1ZA 2P0IA 1PHHA 3C4AA 1H81A 2Y6QA 2JAEA 3IWAA 2I5QA 1M6IA 1MO9A 4M0XA 3F8RA 4U8IA 1FEBA 1WUEA 3DK8A 3AEBA 3BI2A 3RGTA 4B68A 3NRNA 1O94A 4K8DA 2HXUA 1S3EA 4NTEA 2C67A 5HXIA 1PDYA 2V3BA 3CNJA 1OJ9A 2WPEA 4NEVA 4O5UA 3UKKA 2EQ8A 4Z2RA 3HPFA 2PODA 3FXGA 3CGEA 1STZA 5BUKA 1MNSA 4C3XA 3I4KA 3I6TA 1K4QA 5KMPA 3OTRA 2C72A 5EB4A 1S2QA 4Z2TA 3K30A 4Z26A 4IL2A 3TQPA 3CGDA 3DGZA 3D1CA 4MJWA 3SN4A 2WS3A 1P2EA 1NELA 2WU5A 1LPFA 2GV8A 3QKEA 1E6EA 2X50A 1X2HA 2DKHA 4D04A 3ICRA 3NTDA 1NHRA 4Z1YA 1LVLA 2MUCA 2GH5A 3BJSA 1BF3A 4Z17A 1T3QC 2C75A 3AB1A 3DJJA 3G5RA 4OPLA 4B1BA 2ZBWA 3KUMA 1YQ3A 2YWLA 2ONEA 3AE4A 4XXGA 4OPTA 1EBGA 1PDHA 2RGHA 4H4UA 3GD6A 2XVFA 3P4QA 2GMHA 4X2PA 3NIXA 3RP7A 1KD0A 2GGHA 3VC5A 2Q0LA 3FG2P 4JNQA 3TTEA 2OLOA 3EANA 2AR8A 2XFQA 1YY5A 3EAOA 3OW1A 1N5XA 1Q1RA 2XVHA 3P4RA 3THUA 3H7VA 3CPIG 1IUSA 3V4BA 1F8WA 2QJJA 2BABA 2Q7VA 3G5SA 5KMRA 2OA1A 2OFJA 4IA6A 1N63C 4E4FA 4DXKA 3QTPA 2XLSA 4YKFA 2I0ZA 3I6DA 1R6WA 4H4TA 1GTEA 5IQ4A 1R0MA 1TDOA 3NKSA 1Y0PA 3DJGX 3AD9B 2OALA 3SFEA 2FJBA 4EMWA 1REOA 3AD8B 1FIQB 1PJ7A 3NK2X 4U8LA 5FS7A 4TM1A 3MZNA 1P48A 3FJ4A 4K7ZA 1TRBA 1D4EA 1AOGA 2B76A 2YG7A 2E4GA 3ATRA 2GL5A 1ZP0A 4CRTA 1L9EA 4YSYA 3AEGA 4HCLA 3FYYA 2QJMA 5BVAA 1PJ5A 4IL0A 2QDEA 3GO2A 4GAVA 3UKAA 1DJQA 3FCPA 1K0IA 1GPEA 2X3NA 2E1MA 1YQZA 2XYOA 3OZYA 4A99A 2YVJA 4CCRA 5G5HB 4FDCB 3S61A 3H8IA 3VRDB 3SFDA 4H2RA 2WP9A 4U2SA 3QSEA 2TPRA 2JB3A 4BJYA 4DGKA 2XLTA 4UP3A 3T37A 1E1LA 5CQFA 3NN0X 4HNLA 1YKJA 2YAUA 1GT8A 5KMSA 5U25A 4GRTA 1KNRA 2V60A 2ZZCA 2Z5YA 2WP5A 2IVEA 3T9PA 3SJNA 1ZKQA 1BWCA 3IC9A 4II2A 1NAAA 1OJDA 3U4FA 4X4JA 3IK4A 1X2GA 2YLRA 2GGJA 3M12A 3KD9A 2E5VA 4U8NA 1B4VA 2FKPA 2GQFA 1JRZA 5JRBA 3RHAA 3N4FA 3GYIA 1D7LA 1JRYA 1IYXA 1JNZA 1BQGA 3K1GA 3HW2A 2JB1A 4ECHA 3RITA 2YLWA 2WETA 3NHOX 5BULA 3DJEA 4K5RA 3EF6A 2PS2A 2FYMA 3CAWA 4U2TA 1SJDA 1F6MA 4IT1A 4E4UA 3UJSA 2PTXA 2C66A 3LJPA 1JDFA 1TKKA 2R0PA 2BXRA 5U63A 4XWZA 4FX9A 3GSIA 4JN8A 1D5TA 5JCKA 4UDRA 3DG7A 1FCDA 3B3RA 1NENA 5EB5A 1V59A 4EWJA 3VFCA 1K0JA 2YG4A 3R11A 2GDQA 3VA8A 2BS4A 1GERA 1DJNA 1VRQB 1JRXA 2MNRA 4NEWA 2BXSA 3O0HA 1SJBA 3Q6JA 1DTNA 1IJHA 4C77A 2POZA 1N60C 4Z24A 1P2HA 2PMQA 3M0OA 4A9WA 1EC7A 3MQTA 1ONEA 3IJQA 3TWBA 4H19A 1KSUA 1N4WA 3ES8A 3FBSA 4AOSA 3D9XA 3GDNA 1JEHA 2V3AA 3DFYA 3II4A 2R0CA 3ITJA 5KVIA 3DDMA 3H8LA 3JSKA 5L46A 3L5OA 3F8DA 3I6EA 3UXLA 3AMZA 3SBFA 4JY2A 3QLDA 2A89A 2PHHA 3RCYA 3RNMA 4XWRA 1QJDA 4JQ9A 3T2KA 3PVCA 3CTYA 4CY6A 1KF6A 1GV4A 2B9WA 4P9SA 4LU6A 6ENLA 3URHA 2PA6A 2C65A 3UCCA 3CXOA 1W4XA 2FBWA 2WQYA 1KNPA 3ATQA 1Z6LA 2R4JA 2VVLA 4B64A 4LA1A 2ZC8A 3L8KA 4GYPC 4NZHA 4REKA 1UKVG 1JPMA 3IJLA 1CJCA 3UKFA 3D8XA 4NWZA 3AYJA 4E6MA 1VDVA 3TW9A 1O95A 1GXFA 4U8OA 4WX1A 2O9ZA 1FL2A 1PXAA 4HYRA 3GC2A 2QA1A 3ICTA 4ZCWA 1BZLA 4PAAA 3T6CA 1BKHA 2YG3A 2C3CA 4KWSA 4AP1A 1P43A 2JBVA 4ZCDA 4YXDA 3CPJG 2F5ZA 4H4WA 4GMEA 1H84A 3VR9A 3L1RA 1XDIA 2XVJA 3JW7A 2WEUA 2XH4A 4YTPA 4DSHA 4H4PA 1CC6A 1TE6A 4AP3A 2V6OA 2E3TA 2BYBA 4EQSA 1H7WA 3GWDA 4ROPA 2B9XA 1SEZA 3H4KA 3RRAA 4TLXA 1E1NA 5M10A 1ZY8A 4K1WA 1RVKA 1SJCA 2W0HA 4JDRA 2C3DA 1PBDA 2PGEA 1GEUA 2GGEA 4HN8A 2OVLA 2PP1A 3AN1A 4JY3A 3DK9A 5FMHA 4AT0A 3IHMA 3NH3X 2WOWA 4H4VA 1GRBA 1B8SA 2DKIA 3BSMA 3K7TA 2OZ8A 4Y4MA 5DBJA 3V5FA 3UJRA 1BKWA 3DGHA 3CPHG 4CBQA 4I58A 1Q1WA 2TMDA 3T0KA 3SYIA 3PWIA 1GALA 1FFVC 4H4XA 1L9CA 1GRFA 4H4RA 2BC1A 4GFIA 2ZADA 3BNUA 4EQWA 4J57A 3DK4A 1NG4A 2IIDA 1Y56B 1FO4A 4U8JA 5KVHA 2V5ZA 1VQWA 2R9ZA 4Z2UA 1MOKA 3DMEA 2BC0A 4IP4A 4EMJA 3DG3A 3P0WA 4C3YA 4J34A 5KOXA 3GRSA 3NRZB 3KLJA 3CT2A 3C96A 1COYA 3CNPA 3ZDNA 2WPFA 3DEQA 3NN6X 4IZGA 2JB2A 1EBHA 2AKZA 4AT2A 1SB3B 2P8BA 1LTXR 3UKLA 2YM2A 3COXA 1QLBA 3MUCA 4G8TA 1HYUA 3NVVB 5M0ZA 3UTHA 1CL0A 4H4ZA 3GYXA 1GSNA 5BOEA 1RYIA 3V3WA 2PP0A 2ZZBA 4OPGA 1N5WC 4RG4A 3KA7A 3TOYA 4GYPA 2W54A 2W3RA 3STPA 1N1PA 3V3OA 2RGJA 2RGOA 2EQ7A 2BACA 1CC4A 4GISA 1CBOA 4U8PA 3AEEA 2PTYA 3BI4A 4DNAA 5G5GB 3PS9A 4Z43A 2XLUA 5FJTA 4NNJA 3RO6A 1GREA 3ZVHA 3CIRA 3UOYA 3KPFA 3NVYB 2QGYA 1M64A 4H1ZA 2GSHA 1IUTA 1VG9A 3VR8A 2GQWA 4DWDA 1IUXA 4TM4A 4GGHA 3AD7B 3DFHA 4YT0A 3QSSA 4EM3A 5J7XA 5JCNA 5FS6A 1N62C 4EQXA 4KPRA 4ICYA 3UCLA 5FJOA 3GD4A 1PXBA 2PYXA 4HCDA 1F9CA 3B6DA 1KDGA 3LOVA 4K2XA 3VCNA 3SZ0A 5J60A 2XVEA 1LQTA 4O5QA 3RP8A 3UOZA 2CVJA 2VOUA 4YKGA 2QQ6A 4A7AA 1S3BA 2FJDA 2XCGA 5KMQA 5BRTA 5JCMA 3TCSA 4OPCA 1XPYA 2PTWA 4BK3A 3KU9A 4MKSA 1MDRA 1H7XA 1DNCA 5KNLA 2DW7A 3HYVA 1ZDLA 3AYIA 3UTEA 1TDKA 3Q9TA 4JN9A 4ZN0A 3FV9A 3PK7A 2GB0A 3NYEA 1FECA 1GRGA 1JRPA 4MMWA 1YEYA 4H4SA 3NYFA 3SR6B 3FIMB 5EBKA 3NZGA 2QAEA 3ABVA 1IUVA 3NO1A 1EC8A 5IQ1A 4EMIA 3GYJA 3P3BA 4Z25A 3BHKA 5LV9A 4IA5A 1EL5A 3KVEA 2H88A 1DOEA 4JNAA 4GIRA 4G9KA 4MGGA 1PBBA 2XLPA 2BK5A 2B7SA 1KKOA 3DG6A 2C64A 2RDXA 4H2PA 2NVKX 2OG9A 3NTAA 2C76A 2BS2A 2OAMA 2C4CA 4H2HA 4B67A 4C74A 1EBDA 4A6GA 2XLRA 1SJAA 5BOFA 4E5TA 3CNTA 3PWGA 3SX6A 3N6HA 3GRTA 1H83A 3DJDA 4K8GA 3EUB3 3AEAA 5JCIA 2YM1A 1DODA 1GTHA 3VC6A 4UDPA 4E8GA 2R4EA 3SQSA 1ZXIC 1ZMCA 3RP6A 4IHCA 2OQHA 1DXLA 2DW6A 3R0UA 1WYGA 3CGBA 3V3NA 2NQLA 4X9MA 4H7UA 1KFYA 4B69A 1ZK7A 2R45A 3NVZB 4GF7A 1W6TA 1H2IA 1OJAA 3PO7A 2AQJA 2XH7A 2WOIA 4FI4A 3NS1B 2PSNA 4TVWA 2XFUA 1FEAA 3DA1A 4GDEA 4U2LA 2VZ2A 3VRBA 3OP2A 2BK3A 3GDPA 3WE0A 4KPLA 4I59A 1EL9A 2P3ZA 3AEDA 3AWIA 1N61C 3ZLHA 4TM0A 1NHQA 4GCMA 3UKPA 2YLSA 4B66A 1ECQA 3EKGA 3IF9A 4USQA 4N9XA 3R9UA 3R25A 3SZWA 1NDAA 1B5QA 4G74A 1L0VA 2WPCA 4JN7A 1K0LA 1LJ1A 2APGA 4GUVA 1N4VA 1OJTA 4J3ZA 3ALJA 4U8MA 3P93A 3N6JA 4NTCA 4GR1A 1YQ4A 2GAGB 3E1TA 3K7QX 4F4RA 3N4EA 3NK0X 3JZUA 3QVPA 4G6HA 1EL8A 2YQUA 4IP5A 3UOXA 3Q4DA 5ENLA 4J2WA 4M6UA 2GGIA 4K5SA 1GOSA 1GETA 4A6NA 2WOVA 4EIQA 4BK2A 3NVWB 3V76A 5CKUA 2XH0A 5HHFA 3NNEA 4BK1A 3MY9A 2OZTA 2B9YA 2UZZA 3QJ4A 4GAPA 4IV9A 2QCUA 4H50A 4G7FA 4EM4A 4FP1A 2PTZA 3SGLA 3NXLA 2GAHB 2VRLA 4AOXA 3ALLA 2HZGA 3AXBA 1MRAA 2FJEA 5KOWA 4BV6A 3SXIA 1JOAA 2FJAA 1ZOYA 3C4NA 3T14A 2WHDA 4FK1A 1MDLA 1D7YA 3S47A 1GNDA 3GMBA 4HB9A 2BCPA 3H70A 2WU2A 2PPGA 2CFYA 4DSGA 1LQUA 3VCCA 3HYXA 4DX3A 1GRHA 2GR3A 2QJNA 3NFUA 2YG5A 4YSHA 2E5AA 1JROA 4ZA0A 3AE2A 2W3SA 4IVOB 4CNJA 1TDFA 3GY1A 4C5OA 3H12A 3AYLA 3ZVIA 2GMJA 3FMWA 2BS3A 2OZ3A 3R0KA 1GRAA 3HZLA 3VRAA 2PGWA 2OQYA 3SY4A 3TWAA 4FK1C 1MUCA 2GF3A 1H86A 2XH2A 3P9UA 3UP4A 3IHGA 3NGCX 5GSNA 3CXBA 4CNKA 3AE7A 4M52A 2XFNA 2BK4A 3OZMA 3UKHA 1JU2A 4H83A 3CYJA 4LIIA 3DIPA 3QSMA 5HYMA 4J36A 3REDA 3UP5A 4UDQA 1H82A 4J33A 4A79A 3FPZA 2OLNA 3S5WA 3AE9A 2XGZA 3UTGA 3CMMA 3OPSA 3CNSA 3GMCA 3DERA 1XPQA 1ZX9A 2GRTA 3P4PA 4EIPA 2C7GA 2A87A 2OPJA 1IUWA 1Q9IA 1CF3A 4J56A 2WDQA 4KT2A 4NTDA 1DOCA 4RSLA 3NK1X 5U1OA 1PBFA 1LV0A 3A7RA 4H4QA 2CHRA 4OCGA 4U8KA 2P8CA 2BRYA 1ELSA 2PCEA 2R46A 2EQ6A 2Q6UA 4J1OA 3DGBA 2WDRA 3T2ZA 2WP6A 1DOBA 1S7MA 2JKCA 1ELIA 3K7MX 2YLZA 3I3LA 5HY5A 3OC4A 4DYEA 3LB8A 2CDUA 3FVDA 3QPEA 1E1KA 4EQRA 5FJRA 2WBAA 2BCGG 3BI5A 1VG0A 1VDCA 1L9DA 3UJ2A 2HQMA 2ZZ0A 1PN0A 3OZ2A 1PBCA 1XS2A 1NG3A 1TYPA 3PFRA 2XVIA 3MKCA 2X99A 3ADAB 3DH9A 3R10A 2YG6A 3T31A 3F8PA 4CCQA 1KN0A 4H2NA 2ACZA 1KKRA 4HPNA 3JVAA 4ENLA 2C70A 4YTMA 4HNCA 2OX4A 2WESA 1GESA 4HCHA 2AL2B 1TZZA 1E39A 3T8QA 3TJIA 3A7UA 1L8PA 1RM6B 1EC9A 1MXTA 4J31A 4A5LA 2X8GA 4ADWA 4K2SA 3ALMA 3UKQA 3UCDA 1PJ6A 4II3A 2GR1A 3BNMA 3EEZA 2BRAA 2C73A 3CN8A 2YR6A 3SSZA 3M13A 5FS8A 5IPYA 4OVIA 1EL7A 2Z5XA 2ARDA 3ZYXA 5C3JA 4X9NA 3ZLGA 2PU1A 4JHMA 5FS9A 3PG6A 3HRDC 4K22A 3P1WA 1KCZA 5EU9A 3SN1A 2HNEA 1QO8A 1BGNA 3RR1A 1JCTA 4ZOHB 5KRQA 2EQ9A 5ER0A 3NT6A 1XHCA 3V5CA 5J04A 2NPXA 4D03A 3U9IA 1PDZA 3AE1A 1ZMDA 1CJ2A 2VQBA 2GVCA 2R0GA 3A7AA 3LADA 4H4YA 3UJEA 3P4SA 3ISHA 3AE6A 1D4DA 1B37A 3T2YA 4DHGA 4A65A 2Q0KA 1OJCA 2GGGA 4G6GA 3GWFA 2X8HA 1Y56A 3QVRA 2XFPA 3GD3A 5GRTA 5JCLA 3NG7X 1S2YA 4USRA 3HYWA 3ETRB 2PP3A 1WUFA 3UGVA 4PABA 4YWSA 4A6NB 3TJ4A 4BURA 1FOHA 4A3RA 2OLAA 1TDNA 1BGJA 3UJFA 2Y6RA 2P88A 1TDEA 2AKMA 3D47A 1OEPA 1E1MA 1V97A 2AAQA 2GEWA 1D4CA 3QFAA 2AL1A 5IDZA 3BHFA 1KSSA 4CY8A 3CK5A 2YVGA 3AECA 2OKTA 3LZXA 1RSGA 3ZVHB 1JPDX 4YWOA 3EPTA 4YSZA 2YLXA 2IVDA 7ENLA 2OO6A 3ENLA 2WDVA 1ZOVA 1NHPA 2VVMA 2YR4A 2X8CA 3NYCA 2A8XA 4H2QA 1NHSA 1F8RA 2W55A 1H6VA 1N4UA 1O5WA 3B9JB 3MSYA 2VRMA 2PU0A 3IJIA 3B97A 5FJUA 2YR5A 3SZFA 3G5QA 3BOXA 2GR0A 4OPIA 1PBEA 1E9IA 5C2TA
chains in the Genus database with same CATH topology
3NN0X 2XFOA 1YKJA 4KX6A 4G73A 3LXDA 2RABA 5M0ZA 3UTHA 1CL0A 2YAUA 1GT8A 3AE2A 5KMSA 4H4ZA 5U25A 4TM3A 3GYXA 4IVOB 1GSNA 4ZCCA 4GRTA 2J3NA 4CNJA 1RYIA 1KNRA 1TDFA 2V60A 4C5OA 2ZZCA 2ZZBA 4OPGA 3AYLA 2GMJA 4RG4A 3FMWA 3KA7A 2Z5YA 1CHUA 2BS3A 1GRAA 2WP5A 3QFBA 2IVEA 3ICSA 3HZLA 1N1PA 3VRAA 1ZKQA 5LV9A 1BWCA 3V3OA 2RGJA 2RGOA 3VQRA 2EQ7A 2B7RA 3SY4A 3IC9A 4II2A 2BACA 1CC4A 1CBOA 4FK1C 4YSXA 1XANA 4U8PA 2GF3A 1NAAA 4B65A 4Y4NA 1OJDA 3AEEA 1H86A 3BI4A 4DNAA 3P9UA 4OPDA 3UP4A 4X4JA 1IUUA 3AE5A 3LZWA 3IHGA 3PS9A 4Z43A 2YLRA 3M12A 3NGCX 5GSNA 2XLUA 4NNJA 3CIRA 1GREA 3UOYA 4IVMB 4CNKA 3KPFA 3AE7A 3KD9A 2H89A 1CJ4A 3AE3A 1M64A 4M52A 1F3PA 2E5VA 2XFNA 4U8NA 4Z44A 2BK4A 1B4VA 1IUTA 1VG9A 3KKJA 2GQFA 1JRZA 4TLZA 2YLTA 1F8SA 5JRBA 3RHAA 1JU2A 3UKHA 3VR8A 3GYIA 1D7LA 4LIIA 2GQWA 1IUXA 1JRYA 4RG3A 3UOVA 1JNZA 1JNRA 3QSMA 5TR3A 4TM4A 4J36A 5HYMA 3AD7B 3REDA 3UP5A 3QSSA 1GRTA 1TYTA 4EM3A 4GDPA 4HA6A 4Y4LA 4YT0A 2JB1A 5J7XA 5JCNA 4ECHA 5FS6A 1CC2A 4UDQA 1H82A 2YLWA 2WETA 4J33A 4EQXA 4A79A 4KPRA 3FPZA 2OLNA 4ICYA 3NHOX 1NEKA 3S5WA 3UCLA 1PS9A 5BULA 3DJEA 2V61A 3AE9A 3EF6A 4K5RA 3GD4A 1PXBA 4B63A 4U2TA 2PYXA 1F6MA 2VVLG 4APNA 2C66A 3LJPA 3UTGA 2R0PA 3CMMA 2BXRA 3CNSA 3UTFA 5U63A 4OPUA 2CULA 2YVFA 3GMCA 3B6DA 4XWZA 1KDGA 1XPQA 4FX9A 1PXCA 5KWFA 1RP0A 3LOVA 1ZX9A 4K2XA 3SZ0A 5J60A 2XVEA 3GSIA 3SZCA 1D5TA 2GRTA 5JCKA 1LQTA 3P4PA 2C7GA 2A87A 4O5QA 4UDRA 5EOWA 3SQPA 2CVJA 3RP8A 3UOZA 3CNDA 2VOUA 1FCDA 3B3RA 1IUWA 4WCTA 1Q9IA 4YKGA 1CF3A 4BJZA 1NENA 3KPKA 4J56A 4A7AA 1S3BA 2FJDA 3AEFA 2XCGA 5EB5A 2WDQA 5KMQA 5BRTA 4NTDA 1V59A 5JCMA 5KXJA 1DOCA 4OPCA 4RSLA 1NPXA 1E7PA 1K0JA 4BK3A 1CJ3A 3KU9A 2YG4A 1X31B 3NK1X 5U1OA 1H7XA 1DNCA 5KNLA 2BS4A 1PBFA 3HYVA 1LV0A 1GERA 2QA2A 1ZDLA 2XDOA 1DJNA 3AYIA 1TDKA 1VRQB 1JRXA 3AE8A 3Q9TA 3UTEA 4H4QA 4JN9A 4E0VA 2GR2A 4ZN0A 4OCGA 4U8KA 3SM8A 3CGCA 4NEWA 2BRYA 2GB0A 1ONFA 2R46A 3NLCA 3NYEA 2EQ6A 2JK6A 2BXSA 3O0HA 1FECA 1GRGA 2Q6UA 4YTNA 2BA9A 3Q6JA 1IJHA 2VQ7A 2WDRA 4H4SA 4C77A 3NYFA 3FIMB 3T2ZA 5EBKA 1PHHA 3C4AA 4Z24A 2WP6A 1H81A 2Y6QA 2QAEA 1P2HA 1DOBA 3ABVA 3M0OA 1S7MA 2JKCA 1ELIA 3K7MX 2YLZA 4A9WA 3I3LA 2JAEA 1IUVA 3IWAA 5IQ1A 4EMIA 1M6IA 3GYJA 5HY5A 3OC4A 1MO9A 3LB8A 3F8RA 4U8IA 2CDUA 1FEBA 4Z25A 1KSUA 1N4WA 1E1KA 3DK8A 3AEBA 3BHKA 3BI2A 3FBSA 1EL5A 3KVEA 3D9XA 4EQRA 3GDNA 2H88A 4AOSA 4B68A 1JEHA 2V3AA 1DOEA 4JNAA 4G9KA 3II4A 2R0CA 3ITJA 5KVIA 1PBBA 2XLPA 3NRNA 1O94A 2WBAA 2BCGG 3BI5A 3H8LA 2BK5A 1VG0A 2B7SA 1VDCA 3JSKA 5L46A 3L5OA 4K8DA 2C64A 3F8DA 1L9DA 2HQMA 2ZZ0A 1PN0A 4JY2A 3OZ2A 1PBCA 2A89A 2PHHA 4H2PA 2NVKX 3RNMA 1S3EA 4NTEA 3NTAA 1NG3A 2C67A 4XWRA 1TYPA 5HXIA 1QJDA 2C76A 4JQ9A 3T2KA 2V3BA 2BS2A 2C4CA 2OAMA 2XVIA 3CTYA 3PVCA 2X99A 4CY6A 3CNJA 1OJ9A 4IA5A 4B67A 2WPEA 1KF6A 4C74A 1EBDA 4NEVA 1GV4A 2XLRA 3ADAB 2B9WA 3DH9A 3CNTA 2YG6A 4O5UA 4P9SA 4LU6A 3UKKA 3SX6A 3T31A 3URHA 2EQ8A 3GRTA 1H83A 2C65A 3DJDA 3F8PA 4CCQA 1KN0A 4Z2RA 4H2NA 2ACZA 5JCIA 2YM1A 3AEAA 1DODA 1W4XA 2FBWA 2WQYA 3CGEA 2C70A 1GTHA 4YTMA 5BUKA 1KNPA 4UDPA 3ATQA 1Z6LA 2R4JA 4C3XA 2R4EA 2VVLA 4LA1A 4B64A 1ZMCA 1K4QA 2WESA 5KMPA 3RP6A 1GESA 2C72A 5EB4A 1S2QA 4Z2TA 1DXLA 3L8KA 3K30A 4Z26A 4NZHA 4REKA 1E39A 1UKVG 4EIPA 3CGDA 3CGBA 3DGZA 3D1CA 1CJCA 3UKFA 3V3NA 4MJWA 3D8XA 4NWZA 4X9MA 2WS3A 4H7UA 1KFYA 3AYJA 1ZK7A 4B69A 2R45A 1P2EA 2WU5A 1LPFA 1O95A 1GXFA 4GF7A 4U8OA 1MXTA 4WX1A 4J31A 2GV8A 4A5LA 2X8GA 4ADWA 1H2IA 1E6EA 1OJAA 2X50A 2DKHA 3ALMA 4D04A 3UKQA 3ICRA 3NTDA 3PO7A 2O9ZA 2AQJA 2WOIA 1NHRA 1FL2A 1PXAA 1PJ6A 4II3A 1LVLA 2GR1A 3BNMA 2GH5A 2BRAA 2C73A 1BF3A 2QA1A 3ICTA 3CN8A 2C75A 2YR6A 3AB1A 3M13A 5IPYA 5FS8A 4OVIA 3DJJA 3G5RA 4OPLA 1BZLA 1EL7A 4PAAA 2Z5XA 4B1BA 2ZBWA 2ARDA 2YG3A 2C3CA 3ZYXA 1YQ3A 2YWLA 4AP1A 5C3JA 2JBVA 4ZCDA 4YXDA 3AE4A 3CPJG 2XFUA 4X9NA 1FEAA 3DA1A 4XXGA 2F5ZA 4GDEA 4U2LA 4H4WA 5FS9A 3PG6A 2VZ2A 3VRBA 4OPTA 1H84A 3VR9A 4K22A 1PDHA 2BK3A 2RGHA 3GDPA 3P1WA 4H4UA 3L1RA 3WE0A 1XDIA 2XVJA 2XVFA 3P4QA 4I59A 2GMHA 1QO8A 1EL9A 2WEUA 4YTPA 1BGNA 3NIXA 4DSHA 3RP7A 3AEDA 4H4PA 1CC6A 2Q0LA 3FG2P 3AWIA 4JNQA 4TM0A 1NHQA 5KRQA 2OLOA 3EANA 2V6OA 4AP3A 2AR8A 2XFQA 4GCMA 2EQ9A 1YY5A 3EAOA 5ER0A 2BYBA 3NT6A 4EQSA 1H7WA 3GWDA 3UKPA 1XHCA 2YLSA 1Q1RA 2NPXA 2B9XA 4D03A 1SEZA 2XVHA 4B66A 3H4KA 3AE1A 1ZMDA 3P4RA 1CJ2A 3IF9A 2VQBA 3CPIG 2GVCA 4TLXA 1IUSA 1E1NA 2R0GA 4USQA 5M10A 1ZY8A 4N9XA 3LADA 4H4YA 3R9UA 2W0HA 1F8WA 4JDRA 3SZWA 2C3DA 1PBDA 1NDAA 2BABA 3P4SA 1B5QA 4G74A 1GEUA 2Q7VA 3G5SA 3AE6A 2WPCA 3ISHA 1L0VA 5KMRA 1D4DA 1B37A 1K0LA 1LJ1A 2APGA 3T2YA 2OA1A 4GUVA 2Q0KA 4A65A 1N4VA 1OJCA 4IA6A 1OJTA 4JY3A 3DK9A 5FMHA 4G6GA 4AT0A 3GWFA 2X8HA 1Y56A 3IHMA 3QVRA 2XFPA 2XLSA 3ALJA 3GD3A 5GRTA 4U8MA 5JCLA 3NG7X 3NH3X 4YKFA 2I0ZA 4NTCA 2WOWA 3I6DA 4GR1A 4H4TA 1S2YA 4H4VA 1YQ4A 4USRA 2GAGB 3E1TA 3HYWA 1GTEA 3K7QX 1GRBA 5IQ4A 3NK0X 1B8SA 3QVPA 2DKIA 4PABA 4G6HA 4A6NB 1EL8A 1TDOA 3K7TA 4BURA 3DJGX 1Y0PA 3NKSA 1FOHA 2YQUA 3AD9B 2OALA 3UOXA 3SFEA 2FJBA 4Y4MA 4EMWA 4J2WA 1TDNA 5DBJA 1BGJA 1REOA 1BKWA 2Y6RA 4K5SA 3DGHA 3CPHG 1GOSA 3AD8B 4CBQA 4I58A 1Q1WA 1GETA 1PJ7A 3NK2X 4U8LA 4A6NA 1TDEA 5FS7A 4TM1A 2WOVA 2TMDA 4EIQA 1E1MA 3T0KA 3SYIA 4BK2A 2AAQA 4K7ZA 1GALA 1TRBA 1D4EA 4H4XA 1L9CA 1AOGA 2B76A 2GEWA 3V76A 1GRFA 4H4RA 2YG7A 2BC1A 5CKUA 1D4CA 3QFAA 2E4GA 3NNEA 5HHFA 3BHFA 3ATRA 1ZP0A 1KSSA 4CRTA 4BK1A 2YVGA 1L9EA 3AECA 3LZXA 4CY8A 4YSYA 2B9YA 1RSGA 2UZZA 3BNUA 4EQWA 3AEGA 3QJ4A 4J57A 4YWOA 3EPTA 3DK4A 1NG4A 4GAPA 4YSZA 2IIDA 1Y56B 2YLXA 4IV9A 4U8JA 5BVAA 5KVHA 2V5ZA 2IVDA 1PJ5A 1VQWA 2R9ZA 4H50A 2QCUA 4EM4A 3T37A 4Z2UA 3SGLA 2GAHB 2VRLA 1MOKA 4AOXA 4GAVA 3DMEA 2BC0A 2WDVA 3ALLA 3AXBA 3UKAA 1ZOVA 1NHPA 2FJEA 1DJQA 2VVMA 4EMJA 5KOWA 2YR4A 4BV6A 1K0IA 3SXIA 1GPEA 1JOAA 2FJAA 4C3YA 2X3NA 4J34A 2E1MA 5KOXA 1YQZA 1ZOYA 2XYOA 2X8CA 3GRSA 3C4NA 4A99A 3NYCA 3T14A 2WHDA 4FK1A 3KLJA 2A8XA 4H2QA 2YVJA 1COYA 3C96A 4CCRA 3CNPA 3ZDNA 1NHSA 2WPFA 1D7YA 1F8RA 3NN6X 1GNDA 2JB2A 4FDCB 1H6VA 1N4UA 1O5WA 2VRMA 3S61A 3GMBA 4AT2A 3H8IA 4HB9A 2BCPA 3VRDB 2WU2A 2CFYA 3SFDA 4DSGA 4H2RA 2WP9A 4U2SA 1LQUA 1LTXR 3QSEA 2TPRA 2JB3A 2YR5A 3SZFA 3G5QA 4BJYA 3HYXA 4DGKA 2GR0A 2XLTA 2YM2A 4OPIA 1GRHA 2GR3A 1PBEA 1QLBA 2YG5A 3COXA 4UP3A 3UKLA 4YSHA 5C2TA 1E1LA 5CQFA 1HYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NN0 X;  2XFO A;  1YKJ A;  4KX6 A;  3LXD A;  2RAB A;  5M0Z A;  3UTH A;  1CL0 A;  2YAU A;  1GT8 A;  3AE2 A;  4H4Z A;  5U25 A;  4TM3 A;  4IVO B;  1GSN A;  4ZCC A;  4GRT A;  2J3N A;  4CNJ A;  1RYI A;  1KNR A;  1TDF A;  2V60 A;  4C5O A;  2ZZC A;  2ZZB A;  4OPG A;  3AYL A;  2GMJ A;  4RG4 A;  3FMW A;  3KA7 A;  2Z5Y A;  1CHU A;  2BS3 A;  1GRA A;  2WP5 A;  3QFB A;  2IVE A;  3ICS A;  3HZL A;  1N1P A;  3VRA A;  1ZKQ A;  5LV9 A;  1BWC A;  3V3O A;  2RGJ A;  2RGO A;  3VQR A;  2EQ7 A;  2B7R A;  3IC9 A;  2BAC A;  1CC4 A;  1CBO A;  4FK1 C;  4YSX A;  1XAN A;  4U8P A;  2GF3 A;  1NAA A;  4B65 A;  4Y4N A;  1OJD A;  3AEE A;  1H86 A;  3BI4 A;  4DNA A;  3P9U A;  4OPD A;  3UP4 A;  4X4J A;  1IUU A;  3AE5 A;  3LZW A;  3IHG A;  3PS9 A;  4Z43 A;  2YLR A;  3M12 A;  3NGC X;  5GSN A;  2XLU A;  3CIR A;  1GRE A;  3UOY A;  4IVM B;  4CNK A;  3KPF A;  3AE7 A;  3KD9 A;  2H89 A;  1CJ4 A;  3AE3 A;  1M64 A;  4M52 A;  1F3P A;  2E5V A;  2XFN A;  4U8N A;  4Z44 A;  2BK4 A;  1B4V A;  1IUT A;  1VG9 A;  3KKJ A;  2GQF A;  1JRZ A;  4TLZ A;  2YLT A;  1F8S A;  3RHA A;  3UKH A;  1JU2 A;  3VR8 A;  3GYI A;  1D7L A;  4LII A;  2GQW A;  1IUX A;  1JRY A;  4RG3 A;  3UOV A;  1JNZ A;  1JNR A;  3QSM A;  5TR3 A;  4TM4 A;  4J36 A;  5HYM A;  3AD7 B;  3RED A;  3UP5 A;  3QSS A;  1GRT A;  1TYT A;  4EM3 A;  4GDP A;  4HA6 A;  4Y4L A;  4YT0 A;  2JB1 A;  5J7X A;  5JCN A;  4ECH A;  5FS6 A;  1CC2 A;  4UDQ A;  1H82 A;  2YLW A;  2WET A;  4J33 A;  4EQX A;  4A79 A;  4KPR A;  3FPZ A;  2OLN A;  4ICY A;  3NHO X;  1NEK A;  3S5W A;  3UCL A;  1PS9 A;  5BUL A;  3DJE A;  2V61 A;  3AE9 A;  3EF6 A;  4K5R A;  3GD4 A;  1PXB A;  4B63 A;  4U2T A;  2PYX A;  1F6M A;  2VVL G;  4APN A;  2C66 A;  3LJP A;  3UTG A;  2R0P A;  2BXR A;  3CNS A;  3UTF A;  5U63 A;  4OPU A;  2CUL A;  2YVF A;  3GMC A;  3B6D A;  4XWZ A;  1KDG A;  1XPQ A;  4FX9 A;  1PXC A;  5KWF A;  1RP0 A;  3LOV A;  1ZX9 A;  4K2X A;  5J60 A;  2XVE A;  3GSI A;  1D5T A;  2GRT A;  5JCK A;  1LQT A;  3P4P A;  2C7G A;  2A87 A;  4O5Q A;  4UDR A;  5EOW A;  3SQP A;  2CVJ A;  3RP8 A;  3UOZ A;  3CND A;  2VOU A;  1FCD A;  3B3R A;  1IUW A;  4WCT A;  1Q9I A;  4YKG A;  1CF3 A;  4BJZ A;  1NEN A;  4J56 A;  4A7A A;  1S3B A;  2FJD A;  3AEF A;  2XCG A;  5EB5 A;  2WDQ A;  5BRT A;  4NTD A;  1V59 A;  5JCM A;  5KXJ A;  1DOC A;  4OPC A;  4RSL A;  1NPX A;  1E7P A;  1K0J A;  4BK3 A;  1CJ3 A;  3KU9 A;  2YG4 A;  1X31 B;  3NK1 X;  5U1O A;  1H7X A;  1DNC A;  2BS4 A;  1PBF A;  1LV0 A;  1GER A;  2QA2 A;  1ZDL A;  2XDO A;  1DJN A;  3AYI A;  1TDK A;  1VRQ B;  1JRX A;  3AE8 A;  3Q9T A;  3UTE A;  4H4Q A;  4JN9 A;  4E0V A;  2GR2 A;  4ZN0 A;  4OCG A;  4U8K A;  3SM8 A;  3CGC A;  4NEW A;  2GB0 A;  1ONF A;  2R46 A;  3NLC A;  3NYE A;  2EQ6 A;  2JK6 A;  2BXS A;  3O0H A;  1FEC A;  1GRG A;  2Q6U A;  4YTN A;  2BA9 A;  3Q6J A;  1IJH A;  2VQ7 A;  2WDR A;  4H4S A;  4C77 A;  3NYF A;  3FIM B;  5EBK A;  1PHH A;  3C4A A;  4Z24 A;  2WP6 A;  1H81 A;  2Y6Q A;  2QAE A;  1P2H A;  1DOB A;  3ABV A;  3M0O A;  2JKC A;  3K7M X;  1ELI A;  2YLZ A;  4A9W A;  3I3L A;  2JAE A;  1IUV A;  3IWA A;  5IQ1 A;  4EMI A;  1M6I A;  3GYJ A;  5HY5 A;  3OC4 A;  1MO9 A;  3LB8 A;  3F8R A;  4U8I A;  2CDU A;  1FEB A;  4Z25 A;  1KSU A;  1N4W A;  1E1K A;  3DK8 A;  3AEB A;  3BHK A;  3BI2 A;  3FBS A;  1EL5 A;  3KVE A;  4EQR A;  3GDN A;  4IA5 A;  2H88 A;  4AOS A;  4B68 A;  1JEH A;  1DOE A;  2V3A A;  4JNA A;  3II4 A;  2R0C A;  3ITJ A;  5KVI A;  1PBB A;  2XLP A;  3NRN A;  1O94 A;  2WBA A;  2BCG G;  3BI5 A;  3H8L A;  2BK5 A;  1VG0 A;  2B7S A;  1VDC A;  3JSK A;  5L46 A;  4K8D A;  2C64 A;  3F8D A;  1L9D A;  2HQM A;  2ZZ0 A;  1PN0 A;  4JY2 A;  3OZ2 A;  1PBC A;  2A89 A;  2PHH A;  4H2P A;  2NVK X;  3RNM A;  1S3E A;  4NTE A;  3NTA A;  1NG3 A;  2C67 A;  4XWR A;  1TYP A;  5HXI A;  1QJD A;  2C76 A;  4JQ9 A;  2BS2 A;  2OAM A;  2V3B A;  2XVI A;  3CTY A;  3PVC A;  4CY6 A;  2X99 A;  3CNJ A;  1OJ9 A;  4B67 A;  4C74 A;  2WPE A;  1KF6 A;  1EBD A;  4NEV A;  1GV4 A;  2XLR A;  3ADA B;  2B9W A;  3DH9 A;  3CNT A;  2YG6 A;  4O5U A;  4P9S A;  4LU6 A;  3UKK A;  3URH A;  2EQ8 A;  3GRT A;  1H83 A;  2C65 A;  3DJD A;  3F8P A;  4CCQ A;  4Z2R A;  4H2N A;  2ACZ A;  5JCI A;  2YM1 A;  3AEA A;  1DOD A;  1W4X A;  2FBW A;  2WQY A;  3CGE A;  2C70 A;  1GTH A;  4YTM A;  5BUK A;  1KNP A;  4UDP A;  3ATQ A;  1Z6L A;  2R4J A;  4C3X A;  2R4E A;  2VVL A;  4LA1 A;  4B64 A;  1ZMC A;  1K4Q A;  2WES A;  3RP6 A;  1GES A;  2C72 A;  5EB4 A;  1S2Q A;  4Z2T A;  1DXL A;  3L8K A;  3K30 A;  4Z26 A;  4NZH A;  4REK A;  1E39 A;  1UKV G;  4EIP A;  3CGD A;  3CGB A;  3DGZ A;  3D1C A;  1CJC A;  3UKF A;  3V3N A;  4MJW A;  3D8X A;  4X9M A;  2WS3 A;  4H7U A;  1KFY A;  3AYJ A;  1ZK7 A;  4B69 A;  2R45 A;  1P2E A;  2WU5 A;  1LPF A;  1O95 A;  1GXF A;  4GF7 A;  4U8O A;  1MXT A;  4WX1 A;  4J31 A;  2GV8 A;  4A5L A;  2X8G A;  4ADW A;  1E6E A;  1OJA A;  3ALM A;  2X50 A;  2DKH A;  4D04 A;  3UKQ A;  3ICR A;  3NTD A;  3PO7 A;  2O9Z A;  2AQJ A;  2WOI A;  1NHR A;  1FL2 A;  1PXA A;  1PJ6 A;  1LVL A;  2GR1 A;  3BNM A;  2GH5 A;  2C73 A;  1BF3 A;  2QA1 A;  3ICT A;  3CN8 A;  2C75 A;  2YR6 A;  3AB1 A;  3M13 A;  5IPY A;  5FS8 A;  4OVI A;  3DJJ A;  3G5R A;  4OPL A;  1BZL A;  1EL7 A;  4PAA A;  2Z5X A;  4B1B A;  2ZBW A;  2ARD A;  2YG3 A;  2C3C A;  3ZYX A;  1YQ3 A;  2YWL A;  4AP1 A;  5C3J A;  2JBV A;  4ZCD A;  4YXD A;  3AE4 A;  3CPJ G;  2XFU A;  4X9N A;  1FEA A;  3DA1 A;  4XXG A;  2F5Z A;  4GDE A;  4U2L A;  4H4W A;  5FS9 A;  2VZ2 A;  3VRB A;  4OPT A;  1H84 A;  3VR9 A;  4K22 A;  1PDH A;  2BK3 A;  2RGH A;  3GDP A;  3P1W A;  4H4U A;  3L1R A;  3WE0 A;  1XDI A;  2XVJ A;  2XVF A;  3P4Q A;  4I59 A;  2GMH A;  1QO8 A;  1EL9 A;  2WEU A;  4YTP A;  1BGN A;  3NIX A;  4DSH A;  3RP7 A;  3AED A;  4H4P A;  1CC6 A;  2Q0L A;  3FG2 P;  3AWI A;  4JNQ A;  4TM0 A;  1NHQ A;  5KRQ A;  2OLO A;  3EAN A;  2V6O A;  4AP3 A;  2AR8 A;  2XFQ A;  4GCM A;  2EQ9 A;  1YY5 A;  3EAO A;  5ER0 A;  2BYB A;  3NT6 A;  4EQS A;  1H7W A;  3GWD A;  3UKP A;  1XHC A;  2YLS A;  1Q1R A;  2NPX A;  2B9X A;  4D03 A;  1SEZ A;  2XVH A;  4B66 A;  3H4K A;  3AE1 A;  1ZMD A;  3P4R A;  1CJ2 A;  3IF9 A;  2VQB A;  3CPI G;  2GVC A;  4TLX A;  1IUS A;  1E1N A;  2R0G A;  4USQ A;  5M10 A;  1ZY8 A;  4N9X A;  3LAD A;  4H4Y A;  3R9U A;  2W0H A;  1F8W A;  4JDR A;  2C3D A;  1PBD A;  1NDA A;  2BAB A;  3P4S A;  1B5Q A;  1GEU A;  2Q7V A;  3G5S A;  3AE6 A;  2WPC A;  3ISH A;  1L0V A;  1D4D A;  1B37 A;  1K0L A;  1LJ1 A;  2APG A;  2OA1 A;  4GUV A;  2Q0K A;  4A65 A;  1N4V A;  1OJC A;  4IA6 A;  1OJT A;  4JY3 A;  3DK9 A;  5FMH A;  4AT0 A;  3GWF A;  2X8H A;  1Y56 A;  3IHM A;  3QVR A;  2XFP A;  2XLS A;  3ALJ A;  3GD3 A;  5GRT A;  4U8M A;  5JCL A;  3NG7 X;  3NH3 X;  4YKF A;  2I0Z A;  4NTC A;  2WOW A;  3I6D A;  4GR1 A;  4H4T A;  1S2Y A;  4H4V A;  1YQ4 A;  4USR A;  2GAG B;  3E1T A;  3K7Q X;  1GTE A;  1GRB A;  5IQ4 A;  3NK0 X;  1B8S A;  3QVP A;  2DKI A;  4PAB A;  4A6N B;  1EL8 A;  1TDO A;  3K7T A;  4BUR A;  3DJG X;  1Y0P A;  3NKS A;  1FOH A;  2YQU A;  3AD9 B;  2OAL A;  3UOX A;  3SFE A;  2FJB A;  4Y4M A;  4EMW A;  4J2W A;  1TDN A;  5DBJ A;  1BGJ A;  1REO A;  1BKW A;  2Y6R A;  4K5S A;  3DGH A;  3CPH G;  1GOS A;  3AD8 B;  4CBQ A;  4I58 A;  1Q1W A;  1GET A;  1PJ7 A;  3NK2 X;  4U8L A;  4A6N A;  1TDE A;  5FS7 A;  4TM1 A;  2WOV A;  2TMD A;  4EIQ A;  1E1M A;  4BK2 A;  2AAQ A;  4K7Z A;  1GAL A;  1TRB A;  1D4E A;  4H4X A;  1L9C A;  1AOG A;  2B76 A;  2GEW A;  3V76 A;  1GRF A;  4H4R A;  2YG7 A;  2BC1 A;  5CKU A;  1D4C A;  3QFA A;  2E4G A;  3NNE A;  5HHF A;  3BHF A;  3ATR A;  1ZP0 A;  1KSS A;  4CRT A;  4BK1 A;  2YVG A;  1L9E A;  3AEC A;  3LZX A;  4CY8 A;  4YSY A;  2B9Y A;  1RSG A;  2UZZ A;  3BNU A;  4EQW A;  3AEG A;  3QJ4 A;  4J57 A;  4YWO A;  3EPT A;  3DK4 A;  1NG4 A;  4YSZ A;  2IID A;  1Y56 B;  2YLX A;  4IV9 A;  4U8J A;  5BVA A;  5KVH A;  2V5Z A;  2IVD A;  1PJ5 A;  1VQW A;  2R9Z A;  4H50 A;  2QCU A;  4EM4 A;  3T37 A;  4Z2U A;  3SGL A;  2GAH B;  2VRL A;  1MOK A;  4AOX A;  3DME A;  2BC0 A;  2WDV A;  3ALL A;  3AXB A;  3UKA A;  1ZOV A;  1NHP A;  2FJE A;  1DJQ A;  2VVM A;  4EMJ A;  5KOW A;  2YR4 A;  4BV6 A;  1K0I A;  1GPE A;  1JOA A;  2FJA A;  4C3Y A;  2X3N A;  4J34 A;  2E1M A;  5KOX A;  1YQZ A;  1ZOY A;  2XYO A;  2X8C A;  3GRS A;  3C4N A;  4A99 A;  3NYC A;  2WHD A;  4FK1 A;  3KLJ A;  2A8X A;  4H2Q A;  2YVJ A;  1COY A;  3C96 A;  4CCR A;  3CNP A;  3ZDN A;  1NHS A;  2WPF A;  1D7Y A;  1F8R A;  3NN6 X;  1GND A;  2JB2 A;  4FDC B;  1H6V A;  1N4U A;  1O5W A;  2VRM A;  3S61 A;  3GMB A;  4AT2 A;  3H8I A;  4HB9 A;  2BCP A;  3VRD B;  2WU2 A;  2CFY A;  3SFD A;  4DSG A;  4H2R A;  2WP9 A;  4U2S A;  1LQU A;  1LTX R;  3QSE A;  2TPR A;  2JB3 A;  2YR5 A;  3G5Q A;  4BJY A;  4DGK A;  2GR0 A;  2XLT A;  2YM2 A;  4OPI A;  1GRH A;  2GR3 A;  1PBE A;  1QLB A;  2YG5 A;  3COX A;  4UP3 A;  3UKL A;  4YSH A;  5C2T A;  1E1L A;  5CQF A;  1HYU A; 
#chains in the Genus database with same CATH topology
 3ES7 A;  2XFO A;  4KX6 A;  5FJP A;  4G73 A;  3LXD A;  3Q45 A;  2RAB A;  4GGB A;  4TM3 A;  4ZCC A;  2J3N A;  1CHU A;  3QN3 A;  3QFB A;  2AL2 A;  3ICS A;  3VDG A;  4A35 A;  2XSX A;  3VQR A;  3CB3 A;  2B7R A;  3D46 A;  4KEM A;  4YSX A;  1XAN A;  4B65 A;  4Y4N A;  4DN1 A;  4OPD A;  1IUU A;  3AM9 A;  3AE5 A;  3LZW A;  4TVY A;  4IVM B;  3UXK A;  2H89 A;  1CJ4 A;  3AE3 A;  1F3P A;  3SN0 A;  4Z44 A;  3KKJ A;  4TLZ A;  2YLT A;  1F8S A;  3UOV A;  4RG3 A;  1JNR A;  5TR3 A;  3DES A;  1GRT A;  1TYT A;  4GDP A;  4HA6 A;  4Y4L A;  1VQZ A;  1NU5 A;  1CC2 A;  1NEK A;  1PS9 A;  2V61 A;  4B63 A;  1FFU C;  2VVL G;  4APN A;  1FHU A;  3S5S A;  3UTF A;  3R07 C;  4OPU A;  2CUL A;  2YVF A;  3MWC A;  1PXC A;  5KWF A;  1RP0 A;  3H8A A;  3SZC A;  5EOW A;  3SQP A;  3CND A;  2QDD A;  4WCT A;  1FHV A;  4BJZ A;  3KPK A;  3AEF A;  2HXT A;  5KXJ A;  3T4W A;  1NPX A;  1E7P A;  3ZLF A;  1CJ3 A;  1X31 B;  2QA2 A;  2XDO A;  3AE8 A;  4E0V A;  2QVH A;  2GR2 A;  3SM8 A;  3CGC A;  1ONF A;  3NLC A;  2JK6 A;  2O56 A;  4YTN A;  2BA9 A;  2VQ7 A;  3R1Z A;  2P0I A;  1PHH A;  3C4A A;  1H81 A;  2Y6Q A;  2JAE A;  3IWA A;  2I5Q A;  1M6I A;  1MO9 A;  4M0X A;  3F8R A;  4U8I A;  1FEB A;  1WUE A;  3DK8 A;  3AEB A;  3BI2 A;  3RGT A;  4B68 A;  3NRN A;  1O94 A;  4K8D A;  2HXU A;  1S3E A;  4NTE A;  2C67 A;  5HXI A;  1PDY A;  2V3B A;  3CNJ A;  1OJ9 A;  2WPE A;  4NEV A;  4O5U A;  3UKK A;  2EQ8 A;  4Z2R A;  3HPF A;  2POD A;  3FXG A;  3CGE A;  1STZ A;  5BUK A;  1MNS A;  4C3X A;  3I4K A;  3I6T A;  1K4Q A;  5KMP A;  3OTR A;  2C72 A;  5EB4 A;  1S2Q A;  4Z2T A;  3K30 A;  4Z26 A;  4IL2 A;  3TQP A;  3CGD A;  3DGZ A;  3D1C A;  4MJW A;  3SN4 A;  2WS3 A;  1P2E A;  1NEL A;  2WU5 A;  1LPF A;  2GV8 A;  3QKE A;  1E6E A;  2X50 A;  1X2H A;  2DKH A;  4D04 A;  3ICR A;  3NTD A;  1NHR A;  4Z1Y A;  1LVL A;  2MUC A;  2GH5 A;  3BJS A;  1BF3 A;  4Z17 A;  1T3Q C;  2C75 A;  3AB1 A;  3DJJ A;  3G5R A;  4OPL A;  4B1B A;  2ZBW A;  3KUM A;  1YQ3 A;  2YWL A;  2ONE A;  3AE4 A;  4XXG A;  4OPT A;  1EBG A;  1PDH A;  2RGH A;  4H4U A;  3GD6 A;  2XVF A;  3P4Q A;  2GMH A;  4X2P A;  3NIX A;  3RP7 A;  1KD0 A;  2GGH A;  3VC5 A;  2Q0L A;  3FG2 P;  4JNQ A;  3TTE A;  2OLO A;  3EAN A;  2AR8 A;  2XFQ A;  1YY5 A;  3EAO A;  3OW1 A;  1N5X A;  1Q1R A;  2XVH A;  3P4R A;  3THU A;  3H7V A;  3CPI G;  1IUS A;  3V4B A;  1F8W A;  2QJJ A;  2BAB A;  2Q7V A;  3G5S A;  5KMR A;  2OA1 A;  2OFJ A;  4IA6 A;  1N63 C;  4E4F A;  4DXK A;  3QTP A;  2XLS A;  4YKF A;  2I0Z A;  3I6D A;  1R6W A;  4H4T A;  1GTE A;  5IQ4 A;  1R0M A;  1TDO A;  3NKS A;  1Y0P A;  3DJG X;  3AD9 B;  2OAL A;  3SFE A;  2FJB A;  4EMW A;  1REO A;  3AD8 B;  1FIQ B;  1PJ7 A;  3NK2 X;  4U8L A;  5FS7 A;  4TM1 A;  3MZN A;  1P48 A;  3FJ4 A;  4K7Z A;  1TRB A;  1D4E A;  1AOG A;  2B76 A;  2YG7 A;  2E4G A;  3ATR A;  2GL5 A;  1ZP0 A;  4CRT A;  1L9E A;  4YSY A;  3AEG A;  4HCL A;  3FYY A;  2QJM A;  5BVA A;  1PJ5 A;  4IL0 A;  2QDE A;  3GO2 A;  4GAV A;  3UKA A;  1DJQ A;  3FCP A;  1K0I A;  1GPE A;  2X3N A;  2E1M A;  1YQZ A;  2XYO A;  3OZY A;  4A99 A;  2YVJ A;  4CCR A;  5G5H B;  4FDC B;  3S61 A;  3H8I A;  3VRD B;  3SFD A;  4H2R A;  2WP9 A;  4U2S A;  3QSE A;  2TPR A;  2JB3 A;  4BJY A;  4DGK A;  2XLT A;  4UP3 A;  3T37 A;  1E1L A;  5CQF A;  3NN0 X;  4HNL A;  1YKJ A;  2YAU A;  1GT8 A;  5KMS A;  5U25 A;  4GRT A;  1KNR A;  2V60 A;  2ZZC A;  2Z5Y A;  2WP5 A;  2IVE A;  3T9P A;  3SJN A;  1ZKQ A;  1BWC A;  3IC9 A;  4II2 A;  1NAA A;  1OJD A;  3U4F A;  4X4J A;  3IK4 A;  1X2G A;  2YLR A;  2GGJ A;  3M12 A;  3KD9 A;  2E5V A;  4U8N A;  1B4V A;  2FKP A;  2GQF A;  1JRZ A;  5JRB A;  3RHA A;  3N4F A;  3GYI A;  1D7L A;  1JRY A;  1IYX A;  1JNZ A;  1BQG A;  3K1G A;  3HW2 A;  2JB1 A;  4ECH A;  3RIT A;  2YLW A;  2WET A;  3NHO X;  5BUL A;  3DJE A;  4K5R A;  3EF6 A;  2PS2 A;  2FYM A;  3CAW A;  4U2T A;  1SJD A;  1F6M A;  4IT1 A;  4E4U A;  3UJS A;  2PTX A;  2C66 A;  3LJP A;  1JDF A;  1TKK A;  2R0P A;  2BXR A;  5U63 A;  4XWZ A;  4FX9 A;  3GSI A;  4JN8 A;  1D5T A;  5JCK A;  4UDR A;  3DG7 A;  1FCD A;  3B3R A;  1NEN A;  5EB5 A;  1V59 A;  4EWJ A;  3VFC A;  1K0J A;  2YG4 A;  3R11 A;  2GDQ A;  3VA8 A;  2BS4 A;  1GER A;  1DJN A;  1VRQ B;  1JRX A;  2MNR A;  4NEW A;  2BXS A;  3O0H A;  1SJB A;  3Q6J A;  1DTN A;  1IJH A;  4C77 A;  2POZ A;  1N60 C;  4Z24 A;  1P2H A;  2PMQ A;  3M0O A;  4A9W A;  1EC7 A;  3MQT A;  1ONE A;  3IJQ A;  3TWB A;  4H19 A;  1KSU A;  1N4W A;  3ES8 A;  3FBS A;  4AOS A;  3D9X A;  3GDN A;  1JEH A;  2V3A A;  3DFY A;  3II4 A;  2R0C A;  3ITJ A;  5KVI A;  3DDM A;  3H8L A;  3JSK A;  5L46 A;  3L5O A;  3F8D A;  3I6E A;  3UXL A;  3AMZ A;  3SBF A;  4JY2 A;  3QLD A;  2A89 A;  2PHH A;  3RCY A;  3RNM A;  4XWR A;  1QJD A;  4JQ9 A;  3T2K A;  3PVC A;  3CTY A;  4CY6 A;  1KF6 A;  1GV4 A;  2B9W A;  4P9S A;  4LU6 A;  6ENL A;  3URH A;  2PA6 A;  2C65 A;  3UCC A;  3CXO A;  1W4X A;  2FBW A;  2WQY A;  1KNP A;  3ATQ A;  1Z6L A;  2R4J A;  2VVL A;  4B64 A;  4LA1 A;  2ZC8 A;  3L8K A;  4GYP C;  4NZH A;  4REK A;  1UKV G;  1JPM A;  3IJL A;  1CJC A;  3UKF A;  3D8X A;  4NWZ A;  3AYJ A;  4E6M A;  1VDV A;  3TW9 A;  1O95 A;  1GXF A;  4U8O A;  4WX1 A;  2O9Z A;  1FL2 A;  1PXA A;  4HYR A;  3GC2 A;  2QA1 A;  3ICT A;  4ZCW A;  1BZL A;  4PAA A;  3T6C A;  1BKH A;  2YG3 A;  2C3C A;  4KWS A;  4AP1 A;  1P43 A;  2JBV A;  4ZCD A;  4YXD A;  3CPJ G;  2F5Z A;  4H4W A;  4GME A;  1H84 A;  3VR9 A;  3L1R A;  1XDI A;  2XVJ A;  3JW7 A;  2WEU A;  2XH4 A;  4YTP A;  4DSH A;  4H4P A;  1CC6 A;  1TE6 A;  4AP3 A;  2V6O A;  2E3T A;  2BYB A;  4EQS A;  1H7W A;  3GWD A;  4ROP A;  2B9X A;  1SEZ A;  3H4K A;  3RRA A;  4TLX A;  1E1N A;  5M10 A;  1ZY8 A;  4K1W A;  1RVK A;  1SJC A;  2W0H A;  4JDR A;  2C3D A;  1PBD A;  2PGE A;  1GEU A;  2GGE A;  4HN8 A;  2OVL A;  2PP1 A;  3AN1 A;  4JY3 A;  3DK9 A;  5FMH A;  4AT0 A;  3IHM A;  3NH3 X;  2WOW A;  4H4V A;  1GRB A;  1B8S A;  2DKI A;  3BSM A;  3K7T A;  2OZ8 A;  4Y4M A;  5DBJ A;  3V5F A;  3UJR A;  1BKW A;  3DGH A;  3CPH G;  4CBQ A;  4I58 A;  1Q1W A;  2TMD A;  3T0K A;  3SYI A;  3PWI A;  1GAL A;  1FFV C;  4H4X A;  1L9C A;  1GRF A;  4H4R A;  2BC1 A;  4GFI A;  2ZAD A;  3BNU A;  4EQW A;  4J57 A;  3DK4 A;  1NG4 A;  2IID A;  1Y56 B;  1FO4 A;  4U8J A;  5KVH A;  2V5Z A;  1VQW A;  2R9Z A;  4Z2U A;  1MOK A;  3DME A;  2BC0 A;  4IP4 A;  4EMJ A;  3DG3 A;  3P0W A;  4C3Y A;  4J34 A;  5KOX A;  3GRS A;  3NRZ B;  3KLJ A;  3CT2 A;  3C96 A;  1COY A;  3CNP A;  3ZDN A;  2WPF A;  3DEQ A;  3NN6 X;  4IZG A;  2JB2 A;  1EBH A;  2AKZ A;  4AT2 A;  1SB3 B;  2P8B A;  1LTX R;  3UKL A;  2YM2 A;  3COX A;  1QLB A;  3MUC A;  4G8T A;  1HYU A;  3NVV B;  5M0Z A;  3UTH A;  1CL0 A;  4H4Z A;  3GYX A;  1GSN A;  5BOE A;  1RYI A;  3V3W A;  2PP0 A;  2ZZB A;  4OPG A;  1N5W C;  4RG4 A;  3KA7 A;  3TOY A;  4GYP A;  2W54 A;  2W3R A;  3STP A;  1N1P A;  3V3O A;  2RGJ A;  2RGO A;  2EQ7 A;  2BAC A;  1CC4 A;  4GIS A;  1CBO A;  4U8P A;  3AEE A;  2PTY A;  3BI4 A;  4DNA A;  5G5G B;  3PS9 A;  4Z43 A;  2XLU A;  5FJT A;  4NNJ A;  3RO6 A;  1GRE A;  3ZVH A;  3CIR A;  3UOY A;  3KPF A;  3NVY B;  2QGY A;  1M64 A;  4H1Z A;  2GSH A;  1IUT A;  1VG9 A;  3VR8 A;  2GQW A;  4DWD A;  1IUX A;  4TM4 A;  4GGH A;  3AD7 B;  3DFH A;  4YT0 A;  3QSS A;  4EM3 A;  5J7X A;  5JCN A;  5FS6 A;  1N62 C;  4EQX A;  4KPR A;  4ICY A;  3UCL A;  5FJO A;  3GD4 A;  1PXB A;  2PYX A;  4HCD A;  1F9C A;  3B6D A;  1KDG A;  3LOV A;  4K2X A;  3VCN A;  3SZ0 A;  5J60 A;  2XVE A;  1LQT A;  4O5Q A;  3RP8 A;  3UOZ A;  2CVJ A;  2VOU A;  4YKG A;  2QQ6 A;  4A7A A;  1S3B A;  2FJD A;  2XCG A;  5KMQ A;  5BRT A;  5JCM A;  3TCS A;  4OPC A;  1XPY A;  2PTW A;  4BK3 A;  3KU9 A;  4MKS A;  1MDR A;  1H7X A;  1DNC A;  5KNL A;  2DW7 A;  3HYV A;  1ZDL A;  3AYI A;  3UTE A;  1TDK A;  3Q9T A;  4JN9 A;  4ZN0 A;  3FV9 A;  3PK7 A;  2GB0 A;  3NYE A;  1FEC A;  1GRG A;  1JRP A;  4MMW A;  1YEY A;  4H4S A;  3NYF A;  3SR6 B;  3FIM B;  5EBK A;  3NZG A;  2QAE A;  3ABV A;  1IUV A;  3NO1 A;  1EC8 A;  5IQ1 A;  4EMI A;  3GYJ A;  3P3B A;  4Z25 A;  3BHK A;  5LV9 A;  4IA5 A;  1EL5 A;  3KVE A;  2H88 A;  1DOE A;  4JNA A;  4GIR A;  4G9K A;  4MGG A;  1PBB A;  2XLP A;  2BK5 A;  2B7S A;  1KKO A;  3DG6 A;  2C64 A;  2RDX A;  4H2P A;  2NVK X;  2OG9 A;  3NTA A;  2C76 A;  2BS2 A;  2OAM A;  2C4C A;  4H2H A;  4B67 A;  4C74 A;  1EBD A;  4A6G A;  2XLR A;  1SJA A;  5BOF A;  4E5T A;  3CNT A;  3PWG A;  3SX6 A;  3N6H A;  3GRT A;  1H83 A;  3DJD A;  4K8G A;  3EUB 3;  3AEA A;  5JCI A;  2YM1 A;  1DOD A;  1GTH A;  3VC6 A;  4UDP A;  4E8G A;  2R4E A;  3SQS A;  1ZXI C;  1ZMC A;  3RP6 A;  4IHC A;  2OQH A;  1DXL A;  2DW6 A;  3R0U A;  1WYG A;  3CGB A;  3V3N A;  2NQL A;  4X9M A;  4H7U A;  1KFY A;  4B69 A;  1ZK7 A;  2R45 A;  3NVZ B;  4GF7 A;  1W6T A;  1H2I A;  1OJA A;  3PO7 A;  2AQJ A;  2XH7 A;  2WOI A;  4FI4 A;  3NS1 B;  2PSN A;  4TVW A;  2XFU A;  1FEA A;  3DA1 A;  4GDE A;  4U2L A;  2VZ2 A;  3VRB A;  3OP2 A;  2BK3 A;  3GDP A;  3WE0 A;  4KPL A;  4I59 A;  1EL9 A;  2P3Z A;  3AED A;  3AWI A;  1N61 C;  3ZLH A;  4TM0 A;  1NHQ A;  4GCM A;  3UKP A;  2YLS A;  4B66 A;  1ECQ A;  3EKG A;  3IF9 A;  4USQ A;  4N9X A;  3R9U A;  3R25 A;  3SZW A;  1NDA A;  1B5Q A;  4G74 A;  1L0V A;  2WPC A;  4JN7 A;  1K0L A;  1LJ1 A;  2APG A;  4GUV A;  1N4V A;  1OJT A;  4J3Z A;  3ALJ A;  4U8M A;  3P93 A;  3N6J A;  4NTC A;  4GR1 A;  1YQ4 A;  2GAG B;  3E1T A;  3K7Q X;  4F4R A;  3N4E A;  3NK0 X;  3JZU A;  3QVP A;  4G6H A;  1EL8 A;  2YQU A;  4IP5 A;  3UOX A;  3Q4D A;  5ENL A;  4J2W A;  4M6U A;  2GGI A;  4K5S A;  1GOS A;  1GET A;  4A6N A;  2WOV A;  4EIQ A;  4BK2 A;  3NVW B;  3V76 A;  5CKU A;  2XH0 A;  5HHF A;  3NNE A;  4BK1 A;  3MY9 A;  2OZT A;  2B9Y A;  2UZZ A;  3QJ4 A;  4GAP A;  4IV9 A;  2QCU A;  4H50 A;  4G7F A;  4EM4 A;  4FP1 A;  2PTZ A;  3SGL A;  3NXL A;  2GAH B;  2VRL A;  4AOX A;  3ALL A;  2HZG A;  3AXB A;  1MRA A;  2FJE A;  5KOW A;  4BV6 A;  3SXI A;  1JOA A;  2FJA A;  1ZOY A;  3C4N A;  3T14 A;  2WHD A;  4FK1 A;  1MDL A;  1D7Y A;  3S47 A;  1GND A;  3GMB A;  4HB9 A;  2BCP A;  3H70 A;  2WU2 A;  2PPG A;  2CFY A;  4DSG A;  1LQU A;  3VCC A;  3HYX A;  4DX3 A;  1GRH A;  2GR3 A;  2QJN A;  3NFU A;  2YG5 A;  4YSH A;  2E5A A;  1JRO A;  4ZA0 A;  3AE2 A;  2W3S A;  4IVO B;  4CNJ A;  1TDF A;  3GY1 A;  4C5O A;  3H12 A;  3AYL A;  3ZVI A;  2GMJ A;  3FMW A;  2BS3 A;  2OZ3 A;  3R0K A;  1GRA A;  3HZL A;  3VRA A;  2PGW A;  2OQY A;  3SY4 A;  3TWA A;  4FK1 C;  1MUC A;  2GF3 A;  1H86 A;  2XH2 A;  3P9U A;  3UP4 A;  3IHG A;  3NGC X;  5GSN A;  3CXB A;  4CNK A;  3AE7 A;  4M52 A;  2XFN A;  2BK4 A;  3OZM A;  3UKH A;  1JU2 A;  4H83 A;  3CYJ A;  4LII A;  3DIP A;  3QSM A;  5HYM A;  4J36 A;  3RED A;  3UP5 A;  4UDQ A;  1H82 A;  4J33 A;  4A79 A;  3FPZ A;  2OLN A;  3S5W A;  3AE9 A;  2XGZ A;  3UTG A;  3CMM A;  3OPS A;  3CNS A;  3GMC A;  3DER A;  1XPQ A;  1ZX9 A;  2GRT A;  3P4P A;  4EIP A;  2C7G A;  2A87 A;  2OPJ A;  1IUW A;  1Q9I A;  1CF3 A;  4J56 A;  2WDQ A;  4KT2 A;  4NTD A;  1DOC A;  4RSL A;  3NK1 X;  5U1O A;  1PBF A;  1LV0 A;  3A7R A;  4H4Q A;  2CHR A;  4OCG A;  4U8K A;  2P8C A;  2BRY A;  1ELS A;  2PCE A;  2R46 A;  2EQ6 A;  2Q6U A;  4J1O A;  3DGB A;  2WDR A;  3T2Z A;  2WP6 A;  1DOB A;  1S7M A;  2JKC A;  1ELI A;  3K7M X;  2YLZ A;  3I3L A;  5HY5 A;  3OC4 A;  4DYE A;  3LB8 A;  2CDU A;  3FVD A;  3QPE A;  1E1K A;  4EQR A;  5FJR A;  2WBA A;  2BCG G;  3BI5 A;  1VG0 A;  1VDC A;  1L9D A;  3UJ2 A;  2HQM A;  2ZZ0 A;  1PN0 A;  3OZ2 A;  1PBC A;  1XS2 A;  1NG3 A;  1TYP A;  3PFR A;  2XVI A;  3MKC A;  2X99 A;  3ADA B;  3DH9 A;  3R10 A;  2YG6 A;  3T31 A;  3F8P A;  4CCQ A;  1KN0 A;  4H2N A;  2ACZ A;  1KKR A;  4HPN A;  3JVA A;  4ENL A;  2C70 A;  4YTM A;  4HNC A;  2OX4 A;  2WES A;  1GES A;  4HCH A;  2AL2 B;  1TZZ A;  1E39 A;  3T8Q A;  3TJI A;  3A7U A;  1L8P A;  1RM6 B;  1EC9 A;  1MXT A;  4J31 A;  4A5L A;  2X8G A;  4ADW A;  4K2S A;  3ALM A;  3UKQ A;  3UCD A;  1PJ6 A;  4II3 A;  2GR1 A;  3BNM A;  3EEZ A;  2BRA A;  2C73 A;  3CN8 A;  2YR6 A;  3SSZ A;  3M13 A;  5FS8 A;  5IPY A;  4OVI A;  1EL7 A;  2Z5X A;  2ARD A;  3ZYX A;  5C3J A;  4X9N A;  3ZLG A;  2PU1 A;  4JHM A;  5FS9 A;  3PG6 A;  3HRD C;  4K22 A;  3P1W A;  1KCZ A;  5EU9 A;  3SN1 A;  2HNE A;  1QO8 A;  1BGN A;  3RR1 A;  1JCT A;  4ZOH B;  5KRQ A;  2EQ9 A;  5ER0 A;  3NT6 A;  1XHC A;  3V5C A;  5J04 A;  2NPX A;  4D03 A;  3U9I A;  1PDZ A;  3AE1 A;  1ZMD A;  1CJ2 A;  2VQB A;  2GVC A;  2R0G A;  3A7A A;  3LAD A;  4H4Y A;  3UJE A;  3P4S A;  3ISH A;  3AE6 A;  1D4D A;  1B37 A;  3T2Y A;  4DHG A;  4A65 A;  2Q0K A;  1OJC A;  2GGG A;  4G6G A;  3GWF A;  2X8H A;  1Y56 A;  3QVR A;  2XFP A;  3GD3 A;  5GRT A;  5JCL A;  3NG7 X;  1S2Y A;  4USR A;  3HYW A;  3ETR B;  2PP3 A;  1WUF A;  3UGV A;  4PAB A;  4YWS A;  4A6N B;  3TJ4 A;  4BUR A;  1FOH A;  4A3R A;  2OLA A;  1TDN A;  1BGJ A;  3UJF A;  2Y6R A;  2P88 A;  1TDE A;  2AKM A;  3D47 A;  1OEP A;  1E1M A;  1V97 A;  2AAQ A;  2GEW A;  1D4C A;  3QFA A;  2AL1 A;  5IDZ A;  3BHF A;  1KSS A;  4CY8 A;  3CK5 A;  2YVG A;  3AEC A;  2OKT A;  3LZX A;  1RSG A;  3ZVH B;  1JPD X;  4YWO A;  3EPT A;  4YSZ A;  2YLX A;  2IVD A;  7ENL A;  2OO6 A;  3ENL A;  2WDV A;  1ZOV A;  1NHP A;  2VVM A;  2YR4 A;  2X8C A;  3NYC A;  2A8X A;  4H2Q A;  1NHS A;  1F8R A;  2W55 A;  1H6V A;  1N4U A;  1O5W A;  3B9J B;  3MSY A;  2VRM A;  2PU0 A;  3IJI A;  3B97 A;  5FJU A;  2YR5 A;  3SZF A;  3G5Q A;  3BOX A;  2GR0 A;  4OPI A;  1PBE A;  1E9I A;  5C2T A; 
#chains in the Genus database with same CATH homology
 3NN0 X;  2XFO A;  1YKJ A;  4KX6 A;  4G73 A;  3LXD A;  2RAB A;  5M0Z A;  3UTH A;  1CL0 A;  2YAU A;  1GT8 A;  3AE2 A;  5KMS A;  4H4Z A;  5U25 A;  4TM3 A;  3GYX A;  4IVO B;  1GSN A;  4ZCC A;  4GRT A;  2J3N A;  4CNJ A;  1RYI A;  1KNR A;  1TDF A;  2V60 A;  4C5O A;  2ZZC A;  2ZZB A;  4OPG A;  3AYL A;  2GMJ A;  4RG4 A;  3FMW A;  3KA7 A;  2Z5Y A;  1CHU A;  2BS3 A;  1GRA A;  2WP5 A;  3QFB A;  2IVE A;  3ICS A;  3HZL A;  1N1P A;  3VRA A;  1ZKQ A;  5LV9 A;  1BWC A;  3V3O A;  2RGJ A;  2RGO A;  3VQR A;  2EQ7 A;  2B7R A;  3SY4 A;  3IC9 A;  4II2 A;  2BAC A;  1CC4 A;  1CBO A;  4FK1 C;  4YSX A;  1XAN A;  4U8P A;  2GF3 A;  1NAA A;  4B65 A;  4Y4N A;  1OJD A;  3AEE A;  1H86 A;  3BI4 A;  4DNA A;  3P9U A;  4OPD A;  3UP4 A;  4X4J A;  1IUU A;  3AE5 A;  3LZW A;  3IHG A;  3PS9 A;  4Z43 A;  2YLR A;  3M12 A;  3NGC X;  5GSN A;  2XLU A;  4NNJ A;  3CIR A;  1GRE A;  3UOY A;  4IVM B;  4CNK A;  3KPF A;  3AE7 A;  3KD9 A;  2H89 A;  1CJ4 A;  3AE3 A;  1M64 A;  4M52 A;  1F3P A;  2E5V A;  2XFN A;  4U8N A;  4Z44 A;  2BK4 A;  1B4V A;  1IUT A;  1VG9 A;  3KKJ A;  2GQF A;  1JRZ A;  4TLZ A;  2YLT A;  1F8S A;  5JRB A;  3RHA A;  1JU2 A;  3UKH A;  3VR8 A;  3GYI A;  1D7L A;  4LII A;  2GQW A;  1IUX A;  1JRY A;  4RG3 A;  3UOV A;  1JNZ A;  1JNR A;  3QSM A;  5TR3 A;  4TM4 A;  4J36 A;  5HYM A;  3AD7 B;  3RED A;  3UP5 A;  3QSS A;  1GRT A;  1TYT A;  4EM3 A;  4GDP A;  4HA6 A;  4Y4L A;  4YT0 A;  2JB1 A;  5J7X A;  5JCN A;  4ECH A;  5FS6 A;  1CC2 A;  4UDQ A;  1H82 A;  2YLW A;  2WET A;  4J33 A;  4EQX A;  4A79 A;  4KPR A;  3FPZ A;  2OLN A;  4ICY A;  3NHO X;  1NEK A;  3S5W A;  3UCL A;  1PS9 A;  5BUL A;  3DJE A;  2V61 A;  3AE9 A;  3EF6 A;  4K5R A;  3GD4 A;  1PXB A;  4B63 A;  4U2T A;  2PYX A;  1F6M A;  2VVL G;  4APN A;  2C66 A;  3LJP A;  3UTG A;  2R0P A;  3CMM A;  2BXR A;  3CNS A;  3UTF A;  5U63 A;  4OPU A;  2CUL A;  2YVF A;  3GMC A;  3B6D A;  4XWZ A;  1KDG A;  1XPQ A;  4FX9 A;  1PXC A;  5KWF A;  1RP0 A;  3LOV A;  1ZX9 A;  4K2X A;  3SZ0 A;  5J60 A;  2XVE A;  3GSI A;  3SZC A;  1D5T A;  2GRT A;  5JCK A;  1LQT A;  3P4P A;  2C7G A;  2A87 A;  4O5Q A;  4UDR A;  5EOW A;  3SQP A;  2CVJ A;  3RP8 A;  3UOZ A;  3CND A;  2VOU A;  1FCD A;  3B3R A;  1IUW A;  4WCT A;  1Q9I A;  4YKG A;  1CF3 A;  4BJZ A;  1NEN A;  3KPK A;  4J56 A;  4A7A A;  1S3B A;  2FJD A;  3AEF A;  2XCG A;  5EB5 A;  2WDQ A;  5KMQ A;  5BRT A;  4NTD A;  1V59 A;  5JCM A;  5KXJ A;  1DOC A;  4OPC A;  4RSL A;  1NPX A;  1E7P A;  1K0J A;  4BK3 A;  1CJ3 A;  3KU9 A;  2YG4 A;  1X31 B;  3NK1 X;  5U1O A;  1H7X A;  1DNC A;  5KNL A;  2BS4 A;  1PBF A;  3HYV A;  1LV0 A;  1GER A;  2QA2 A;  1ZDL A;  2XDO A;  1DJN A;  3AYI A;  1TDK A;  1VRQ B;  1JRX A;  3AE8 A;  3Q9T A;  3UTE A;  4H4Q A;  4JN9 A;  4E0V A;  2GR2 A;  4ZN0 A;  4OCG A;  4U8K A;  3SM8 A;  3CGC A;  4NEW A;  2BRY A;  2GB0 A;  1ONF A;  2R46 A;  3NLC A;  3NYE A;  2EQ6 A;  2JK6 A;  2BXS A;  3O0H A;  1FEC A;  1GRG A;  2Q6U A;  4YTN A;  2BA9 A;  3Q6J A;  1IJH A;  2VQ7 A;  2WDR A;  4H4S A;  4C77 A;  3NYF A;  3FIM B;  3T2Z A;  5EBK A;  1PHH A;  3C4A A;  4Z24 A;  2WP6 A;  1H81 A;  2Y6Q A;  2QAE A;  1P2H A;  1DOB A;  3ABV A;  3M0O A;  1S7M A;  2JKC A;  1ELI A;  3K7M X;  2YLZ A;  4A9W A;  3I3L A;  2JAE A;  1IUV A;  3IWA A;  5IQ1 A;  4EMI A;  1M6I A;  3GYJ A;  5HY5 A;  3OC4 A;  1MO9 A;  3LB8 A;  3F8R A;  4U8I A;  2CDU A;  1FEB A;  4Z25 A;  1KSU A;  1N4W A;  1E1K A;  3DK8 A;  3AEB A;  3BHK A;  3BI2 A;  3FBS A;  1EL5 A;  3KVE A;  3D9X A;  4EQR A;  3GDN A;  2H88 A;  4AOS A;  4B68 A;  1JEH A;  2V3A A;  1DOE A;  4JNA A;  4G9K A;  3II4 A;  2R0C A;  3ITJ A;  5KVI A;  1PBB A;  2XLP A;  3NRN A;  1O94 A;  2WBA A;  2BCG G;  3BI5 A;  3H8L A;  2BK5 A;  1VG0 A;  2B7S A;  1VDC A;  3JSK A;  5L46 A;  3L5O A;  4K8D A;  2C64 A;  3F8D A;  1L9D A;  2HQM A;  2ZZ0 A;  1PN0 A;  4JY2 A;  3OZ2 A;  1PBC A;  2A89 A;  2PHH A;  4H2P A;  2NVK X;  3RNM A;  1S3E A;  4NTE A;  3NTA A;  1NG3 A;  2C67 A;  4XWR A;  1TYP A;  5HXI A;  1QJD A;  2C76 A;  4JQ9 A;  3T2K A;  2V3B A;  2BS2 A;  2C4C A;  2OAM A;  2XVI A;  3CTY A;  3PVC A;  2X99 A;  4CY6 A;  3CNJ A;  1OJ9 A;  4IA5 A;  4B67 A;  2WPE A;  1KF6 A;  4C74 A;  1EBD A;  4NEV A;  1GV4 A;  2XLR A;  3ADA B;  2B9W A;  3DH9 A;  3CNT A;  2YG6 A;  4O5U A;  4P9S A;  4LU6 A;  3UKK A;  3SX6 A;  3T31 A;  3URH A;  2EQ8 A;  3GRT A;  1H83 A;  2C65 A;  3DJD A;  3F8P A;  4CCQ A;  1KN0 A;  4Z2R A;  4H2N A;  2ACZ A;  5JCI A;  2YM1 A;  3AEA A;  1DOD A;  1W4X A;  2FBW A;  2WQY A;  3CGE A;  2C70 A;  1GTH A;  4YTM A;  5BUK A;  1KNP A;  4UDP A;  3ATQ A;  1Z6L A;  2R4J A;  4C3X A;  2R4E A;  2VVL A;  4LA1 A;  4B64 A;  1ZMC A;  1K4Q A;  2WES A;  5KMP A;  3RP6 A;  1GES A;  2C72 A;  5EB4 A;  1S2Q A;  4Z2T A;  1DXL A;  3L8K A;  3K30 A;  4Z26 A;  4NZH A;  4REK A;  1E39 A;  1UKV G;  4EIP A;  3CGD A;  3CGB A;  3DGZ A;  3D1C A;  1CJC A;  3UKF A;  3V3N A;  4MJW A;  3D8X A;  4NWZ A;  4X9M A;  2WS3 A;  4H7U A;  1KFY A;  3AYJ A;  1ZK7 A;  4B69 A;  2R45 A;  1P2E A;  2WU5 A;  1LPF A;  1O95 A;  1GXF A;  4GF7 A;  4U8O A;  1MXT A;  4WX1 A;  4J31 A;  2GV8 A;  4A5L A;  2X8G A;  4ADW A;  1H2I A;  1E6E A;  1OJA A;  2X50 A;  2DKH A;  3ALM A;  4D04 A;  3UKQ A;  3ICR A;  3NTD A;  3PO7 A;  2O9Z A;  2AQJ A;  2WOI A;  1NHR A;  1FL2 A;  1PXA A;  1PJ6 A;  4II3 A;  1LVL A;  2GR1 A;  3BNM A;  2GH5 A;  2BRA A;  2C73 A;  1BF3 A;  2QA1 A;  3ICT A;  3CN8 A;  2C75 A;  2YR6 A;  3AB1 A;  3M13 A;  5IPY A;  5FS8 A;  4OVI A;  3DJJ A;  3G5R A;  4OPL A;  1BZL A;  1EL7 A;  4PAA A;  2Z5X A;  4B1B A;  2ZBW A;  2ARD A;  2YG3 A;  2C3C A;  3ZYX A;  1YQ3 A;  2YWL A;  4AP1 A;  5C3J A;  2JBV A;  4ZCD A;  4YXD A;  3AE4 A;  3CPJ G;  2XFU A;  4X9N A;  1FEA A;  3DA1 A;  4XXG A;  2F5Z A;  4GDE A;  4U2L A;  4H4W A;  5FS9 A;  3PG6 A;  2VZ2 A;  3VRB A;  4OPT A;  1H84 A;  3VR9 A;  4K22 A;  1PDH A;  2BK3 A;  2RGH A;  3GDP A;  3P1W A;  4H4U A;  3L1R A;  3WE0 A;  1XDI A;  2XVJ A;  2XVF A;  3P4Q A;  4I59 A;  2GMH A;  1QO8 A;  1EL9 A;  2WEU A;  4YTP A;  1BGN A;  3NIX A;  4DSH A;  3RP7 A;  3AED A;  4H4P A;  1CC6 A;  2Q0L A;  3FG2 P;  3AWI A;  4JNQ A;  4TM0 A;  1NHQ A;  5KRQ A;  2OLO A;  3EAN A;  2V6O A;  4AP3 A;  2AR8 A;  2XFQ A;  4GCM A;  2EQ9 A;  1YY5 A;  3EAO A;  5ER0 A;  2BYB A;  3NT6 A;  4EQS A;  1H7W A;  3GWD A;  3UKP A;  1XHC A;  2YLS A;  1Q1R A;  2NPX A;  2B9X A;  4D03 A;  1SEZ A;  2XVH A;  4B66 A;  3H4K A;  3AE1 A;  1ZMD A;  3P4R A;  1CJ2 A;  3IF9 A;  2VQB A;  3CPI G;  2GVC A;  4TLX A;  1IUS A;  1E1N A;  2R0G A;  4USQ A;  5M10 A;  1ZY8 A;  4N9X A;  3LAD A;  4H4Y A;  3R9U A;  2W0H A;  1F8W A;  4JDR A;  3SZW A;  2C3D A;  1PBD A;  1NDA A;  2BAB A;  3P4S A;  1B5Q A;  4G74 A;  1GEU A;  2Q7V A;  3G5S A;  3AE6 A;  2WPC A;  3ISH A;  1L0V A;  5KMR A;  1D4D A;  1B37 A;  1K0L A;  1LJ1 A;  2APG A;  3T2Y A;  2OA1 A;  4GUV A;  2Q0K A;  4A65 A;  1N4V A;  1OJC A;  4IA6 A;  1OJT A;  4JY3 A;  3DK9 A;  5FMH A;  4G6G A;  4AT0 A;  3GWF A;  2X8H A;  1Y56 A;  3IHM A;  3QVR A;  2XFP A;  2XLS A;  3ALJ A;  3GD3 A;  5GRT A;  4U8M A;  5JCL A;  3NG7 X;  3NH3 X;  4YKF A;  2I0Z A;  4NTC A;  2WOW A;  3I6D A;  4GR1 A;  4H4T A;  1S2Y A;  4H4V A;  1YQ4 A;  4USR A;  2GAG B;  3E1T A;  3HYW A;  1GTE A;  3K7Q X;  1GRB A;  5IQ4 A;  3NK0 X;  1B8S A;  3QVP A;  2DKI A;  4PAB A;  4G6H A;  4A6N B;  1EL8 A;  1TDO A;  3K7T A;  4BUR A;  3DJG X;  1Y0P A;  3NKS A;  1FOH A;  2YQU A;  3AD9 B;  2OAL A;  3UOX A;  3SFE A;  2FJB A;  4Y4M A;  4EMW A;  4J2W A;  1TDN A;  5DBJ A;  1BGJ A;  1REO A;  1BKW A;  2Y6R A;  4K5S A;  3DGH A;  3CPH G;  1GOS A;  3AD8 B;  4CBQ A;  4I58 A;  1Q1W A;  1GET A;  1PJ7 A;  3NK2 X;  4U8L A;  4A6N A;  1TDE A;  5FS7 A;  4TM1 A;  2WOV A;  2TMD A;  4EIQ A;  1E1M A;  3T0K A;  3SYI A;  4BK2 A;  2AAQ A;  4K7Z A;  1GAL A;  1TRB A;  1D4E A;  4H4X A;  1L9C A;  1AOG A;  2B76 A;  2GEW A;  3V76 A;  1GRF A;  4H4R A;  2YG7 A;  2BC1 A;  5CKU A;  1D4C A;  3QFA A;  2E4G A;  3NNE A;  5HHF A;  3BHF A;  3ATR A;  1ZP0 A;  1KSS A;  4CRT A;  4BK1 A;  2YVG A;  1L9E A;  3AEC A;  3LZX A;  4CY8 A;  4YSY A;  2B9Y A;  1RSG A;  2UZZ A;  3BNU A;  4EQW A;  3AEG A;  3QJ4 A;  4J57 A;  4YWO A;  3EPT A;  3DK4 A;  1NG4 A;  4GAP A;  4YSZ A;  2IID A;  1Y56 B;  2YLX A;  4IV9 A;  4U8J A;  5BVA A;  5KVH A;  2V5Z A;  2IVD A;  1PJ5 A;  1VQW A;  2R9Z A;  4H50 A;  2QCU A;  4EM4 A;  3T37 A;  4Z2U A;  3SGL A;  2GAH B;  2VRL A;  1MOK A;  4AOX A;  4GAV A;  3DME A;  2BC0 A;  2WDV A;  3ALL A;  3AXB A;  3UKA A;  1ZOV A;  1NHP A;  2FJE A;  1DJQ A;  2VVM A;  4EMJ A;  5KOW A;  2YR4 A;  4BV6 A;  1K0I A;  3SXI A;  1GPE A;  1JOA A;  2FJA A;  4C3Y A;  2X3N A;  4J34 A;  2E1M A;  5KOX A;  1YQZ A;  1ZOY A;  2XYO A;  2X8C A;  3GRS A;  3C4N A;  4A99 A;  3NYC A;  3T14 A;  2WHD A;  4FK1 A;  3KLJ A;  2A8X A;  4H2Q A;  2YVJ A;  1COY A;  3C96 A;  4CCR A;  3CNP A;  3ZDN A;  1NHS A;  2WPF A;  1D7Y A;  1F8R A;  3NN6 X;  1GND A;  2JB2 A;  4FDC B;  1H6V A;  1N4U A;  1O5W A;  2VRM A;  3S61 A;  3GMB A;  4AT2 A;  3H8I A;  4HB9 A;  2BCP A;  3VRD B;  2WU2 A;  2CFY A;  3SFD A;  4DSG A;  4H2R A;  2WP9 A;  4U2S A;  1LQU A;  1LTX R;  3QSE A;  2TPR A;  2JB3 A;  2YR5 A;  3SZF A;  3G5Q A;  4BJY A;  3HYX A;  4DGK A;  2GR0 A;  2XLT A;  2YM2 A;  4OPI A;  1GRH A;  2GR3 A;  1PBE A;  1QLB A;  2YG5 A;  3COX A;  4UP3 A;  3UKL A;  4YSH A;  5C2T A;  1E1L A;  5CQF A;  1HYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...