1GV4A

Murine apoptosis-inducing factor (aif)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
490
structure length
490
Chain Sequence
TVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROGRAMED CELL DEATH PROTEIN 8
publication title The Crystal Structure of the Mouse Apoptosis-Inducing Factor Aif
pubmed doi rcsb
source organism Mus musculus
total genus 149
structure length 490
sequence length 490
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1gv4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A01
1YQZA 1NEKA 1FEAA 2C73A 2VQBA 4B68A 5EB5A 1GRTA 2APGA 2BXRA 2BK4A 4K2XA 3GD3A 2IIDA 1F8SA 1M64A 3AE4A 3P4SA 1DOBA 2R4EA 4E0VA 1Y0PA 3K7QX 3REDA 3FMWA 5TR3A 1MOKA 5DBJA 5KOWA 1NHSA 5KVIA 4EQXA 3NH3X 4KX6A 5KXJA 1CBOA 1LJ1A 3NN0X 2BA9A 1KDGA 2YLTA 3COXA 1B8SA 3ABVA 4APNA 3DJDA 4K22A 4B1BA 2XFOA 3IF9A 2YAUA 2YVJA 1ZOVA 2VVLG 1X31B 4DSGA 4OPGA 2ZZBA 1LQTA 1NHPA 3KLJA 1EL7A 1CC4A 4H4RA 1TDFA 1LVLA 2H89A 2YR5A 3CPHG 2IVDA 1H83A 3P4RA 3Q6JA 1V59A 4BV6A 2YG3A 2HQMA 4Z24A 4AOSA 1YQ4A 2XCGA 5JCIA 1Q1WA 1ZOYA 2Q6UA 3GMBA 2YLWA 2WESA 2YG5A 1GRGA 3B3RA 2XDOA 1D5TA 3DA1A 3I6DA 3IWAA 4EIPA 4YTPA 3CNPA 4AT2A 1NG3A 1PHHA 3NIXA 5ER0A 3AE5A 3NTDA 3UKHA 1GETA 2YLXA 4EMWA 5BULA 2R45A 2ACZA 2A89A 5HY5A 2GQWA 2XLPA 5JCKA 3C96A 2BS3A 3ALJA 4Z2UA 1CHUA 1JNRA 4U8KA 1FL2A 5C2TA 2YR4A 4EIQA 2F5ZA 3ALMA 2A87A 5CKUA 4FX9A 1E7PA 2JB1A 4LU6A 3UTGA 4YSXA 3NYEA 3CGDA 4H2PA 4Z26A 2QA1A 1MXTA 3CPIG 4GR1A 4B65A 3AYJA 3NLCA 4YT0A 1TYTA 2WOWA 1NENA 2BS2A 1TDOA 2XVEA 1GV4A 4ECHA 3NK2X 1TYPA 1CJ2A 2YM1A 4USQA 4M52A 2FJDA 3AYIA 3UOVA 3NHOX 2BCGG 4C5OA 4CRTA 4AT0A 2GF3A 3BHFA 1GT8A 4C74A 1CL0A 4EMJA 1E6EA 1ZX9A 4A7AA 4HB9A 1L9CA 4GCMA 1BKWA 3GDPA 4U8LA 3G5QA 2X8GA 3QSMA 1D4DA 4U2LA 4A5LA 3GDNA 2PYXA 4NTCA 2EQ7A 1Z6LA 2R9ZA 1GXFA 1PXAA 4CNJA 2YG6A 4TLZA 3AWIA 3DH9A 2BCPA 2C72A 2GEWA 1S3EA 2Z5YA 1BGNA 3K7MX 3KA7A 3NN6X 2BS4A 4IV9A 4RSLA 1GRFA 1GRHA 4JN9A 2CVJA 2E5VA 1XHCA 5GSNA 1Y56A 4H2NA 3CNSA 3B6DA 5JCMA 3G5SA 3AB1A 1DOEA 2YWLA 2GB0A 4PAAA 1BGJA 2TPRA 2GMHA 2NVKX 1K4QA 2GR1A 3M13A 1GOSA 2GR2A 2XFQA 3UTFA 4BJZA 4OPCA 4GUVA 4YKFA 5EOWA 3AE1A 2Q0LA 4ADWA 4Z25A 2UZZA 2XFUA 1FEBA 3AD9B 1S2YA 1YQ3A 1VQWA 3V76A 2JAEA 1GEUA 4O5QA 4JNAA 4YTNA 4B67A 4K5RA 1F8RA 3UKAA 3BI5A 3BI2A 2DKHA 3AEDA 3LZXA 4Z44A 3SFDA 4B64A 1D7YA 3G5RA 4NEWA 3AE8A 2RGJA 1PJ7A 1GTEA 2OLNA 3UOYA 3DJJA 1TDKA 3SGLA 3DGHA 3AEFA 1K0JA 3CNTA 1E39A 2XLTA 4H50A 3ALLA 2R0CA 2WDVA 1JNZA 1EL9A 3CIRA 3GYJA 1AOGA 3NNEA 4TLXA 1PS9A 2R46A 3CPJG 3EPTA 1GSNA 2GQFA 3QVRA 1IUTA 4ZCCA 1NPXA 3F8DA 1ZMCA 5M0ZA 3RP7A 1KNRA 2WPEA 4IVMB 2GV8A 4GDPA 2B76A 4OCGA 4U8NA 3OC4A 3RHAA 2B9XA 4RG4A 2C76A 5EBKA 1IUWA 3RP8A 1N4VA 2WU2A 4JY3A 4D03A 3NK1X 3UOZA 1H6VA 2C65A 5CQFA 1VG0A 2XVFA 5M10A 3VRAA 5BUKA 3GRSA 5C3JA 2WP5A 4H4UA 2ARDA 3QJ4A 4UP3A 4GRTA 1O95A 2VZ2A 3EAOA 2I0ZA 1Y56B 4FK1A 1CC6A 2FJEA 2ZBWA 3Q9TA 2RGOA 2C70A 2OAMA 3QVPA 4H4ZA 4NZHA 4C3YA 3DMEA 3UTEA 1IUSA 5FS6A 1N1PA 3II4A 2RABA 4H2RA 4ZN0A 3I3LA 4YSHA 1F3PA 2H88A 1P2HA 5KRQA 2Q7VA 3M0OA 1VG9A 4NTDA 3UP4A 2JBVA 3DJEA 1N4WA 2X8HA 4BK1A 5IPYA 3LXDA 2QA2A 4B69A 1CJCA 1H81A 2FBWA 4BK3A 4U8IA 1DNCA 4C77A 1NDAA 2YG7A 4XXGA 4K8DA 3UKQA 1F6MA 4U2SA 3LZWA 3AXBA 2C7GA 4B66A 3D8XA 3P4QA 4H4XA 1LQUA 2BYBA 1TDEA 1QJDA 4H4TA 3GMCA 3JSKA 1O5WA 1RP0A 1LV0A 4FDCB 5BVAA 4EQSA 4YWOA 2GH5A 5L46A 4WX1A 3DK9A 2O9ZA 1GREA 4ZCDA 4H4VA 3AE7A 3K7TA 4AP1A 3NTAA 1GRAA 4OPTA 3AEEA 2R4JA 2XVJA 3BHKA 3KVEA 1FCDA 4IA6A 3UKFA 1EL8A 3IHGA 5IQ1A 1L0VA 1D4EA 2C67A 2Z5XA 1ZKQA 2C75A 3HZLA 4A6NA 4OPLA 3RP6A 2WETA 3QFAA 3QSSA 2C66A 4MJWA 4X9MA 1LPFA 1NHRA 2WOIA 1CC2A 2B9WA 2BABA 2YR6A 3SFEA 1M6IA 1S3BA 2V5ZA 3DJGX 3FG2P 2OLOA 1IUVA 4CNKA 4J36A 4AP3A 1K0IA 3CTYA 4K5SA 2TMDA 1GRBA 1PBBA 4CY6A 1H82A 2WDRA 1PBCA 3ITJA 1P2EA 2PHHA 1H7XA 3QFBA 5HXIA 2E1MA 4C3XA 4H4WA 1XANA 2XVIA 3O0HA 3E1TA 3ZDNA 4CY8A 2AAQA 3CGEA 5GRTA 2XLRA 2BC0A 1XPQA 4BJYA 1PN0A 3IC9A 2GVCA 4A99A 2BC1A 3ATRA 2GR3A 3AE3A 4J34A 1BWCA 4A65A 1OJ9A 1JRXA 3AEBA 5KWFA 4P9SA 4U2TA 3BNUA 2YG4A 1E1NA 1DJQA 1IUUA 2YVFA 3LJPA 2YLRA 4YKGA 2YLSA 2BK3A 1DJNA 1PDHA 3F8PA 4FK1C 5U1OA 2GMJA 3H4KA 4H4SA 2XVHA 2XYOA 3L1RA 2ZZ0A 3R9UA 3LADA 1D7LA 2GRTA 1KNPA 4A9WA 1GPEA 3URHA 4J56A 4IVOB 2WPFA 3AD8B 4H2QA 4XWZA 3FBSA 1SEZA 3IHMA 3UKPA 2JKCA 1ZP0A 2WP6A 3AE6A 3UTHA 4UDRA 3VRBA 3AD7B 1KSSA 4A79A 3H8LA 1F8WA 3KKJA 4A6NB 4BURA 5FS7A 3CGCA 3P1WA 3S5WA 4Z2TA 4LA1A 1OJAA 1HYUA 1VRQB 4USRA 2CDUA 4UDPA 3CGBA 3AE2A 3GRTA 4DSHA 2GAGB 4Y4NA 5JCNA 2X8CA 1FECA 2WBAA 3LOVA 1NAAA 3ATQA 1BF3A 5FMHA 3D1CA 3EF6A 3OZ2A 2VRLA 3NYCA 5KOXA 2EQ6A 3VRDB 1ZY8A 1H86A 4OPIA 5LV9A 3H8IA 3GSIA 2E4GA 1XDIA 2WP9A 2BACA 2CULA 3GYIA 4TM1A 1PJ5A 1B4VA 5FS9A 4EMIA 2XLUA 3P9UA 4ICYA 1PXCA 3T37A 1L9EA 1KFYA 1YY5A 5KVHA 4YXDA 4GF7A 5BRTA 2CFYA 4H4YA 2A8XA 1VDCA 2BK5A 3PO7A 1H84A 4Z43A 1COYA 1BZLA 2VVMA 3C4NA 4PABA 4U8MA 1O94A 1QO8A 1JU2A 1JRYA 1S2QA 1ZMDA 3ZYXA 1B37A 4NEVA 1PJ6A 3V3OA 1OJCA 4NTEA 2C3DA 1JEHA 1W4XA 4CCRA 3F8RA 2C3CA 1ZK7A 3DK4A 2WEUA 2EQ9A 1PBFA 2OALA 2WQYA 2V3BA 3NYFA 2JB2A 3ICTA 4U8PA 4EQWA 4RG3A 5U63A 3VR9A 3LB8A 4H4QA 1REOA 1ZDLA 2YQUA 4LIIA 3GWDA 3C4AA 4TM0A 4H7UA 2IVEA 3UOXA 3S61A 4XWRA 4IA5A 2V3AA 4X4JA 5JCLA 2B7SA 3ICSA 1E1MA 2OA1A 3KU9A 1PBEA 4REKA 1YKJA 3CNJA 3SQPA 3VR8A 4K7ZA 2WPCA 2X50A 5FS8A 5U25A 3FPZA 3SM8A 1N4UA 2WDQA 2RGHA 4OVIA 1Q1RA 3NT6A 1EBDA 1TRBA 4N9XA 4YTMA 2AQJA 1GESA 2B7RA 2XLSA 2WU5A 2VRMA 3UCLA 1LTXR 2JB3A 4U8OA 1OJTA 2J3NA 1KSUA 4Z2RA 1TDNA 3BNMA 2BXSA 4HA6A 3AEAA 3NRNA 2C64A 4JNQA 4D04A 3NGCX 1B5QA 2DKIA 1PXBA 4J57A 3NG7X 2GR0A 4TM3A 2YVGA 4OPDA 4CBQA 4KPRA 2Q0KA 2Y6RA 3NKSA 4U8JA 1GALA 3DK8A 2AR8A 4Y4LA 3AEGA 1DXLA 1E1KA 1NG4A 1JRZA 4J2WA 1D4CA 5J7XA 3P4PA 2VVLA 1PBDA 4EQRA 2X99A 4J31A 4AOXA 3GWFA 3EANA 1DODA 4Y4MA 4I58A 5IQ4A 3AECA 2YM2A 1EL5A 2GAHB 1RYIA 2VQ7A 3VQRA 3ICRA 4JDRA 1ONFA 4GDEA 5HHFA 2XFPA 3ADAB 2V61A 2VOUA 1GNDA 3PS9A 3NK0X 1IUXA 1E1LA 2V60A 2EQ8A 1QLBA 3AYLA 4B63A 5EB4A 1K0LA 2YLZA 3M12A 3BI4A 4H4PA 1JOAA 1L9DA 1OJDA 4TM4A 4BK2A 4YSYA 2XFNA 1MO9A 2JK6A 4O5UA 4JY2A 4WCTA 4DNAA 3RNMA 3ISHA 4UDQA 2R0GA 4I59A 1Q9IA 2V6OA 2ZZCA 1IJHA 3UP5A 1UKVG 3K30A 4CCQA 1DOCA 4YSZA 2B9YA 2FJAA 2WHDA 3KD9A 2QCUA 5HYMA 3L8KA 1NHQA 1GTHA 3DGZA 4JQ9A 1H7WA 1CJ3A 4EM4A 4J33A 3CN8A 2WS3A 3FIMB 1ELIA 3KPFA 2R0PA 3PVCA 1CJ4A 2WOVA 1FOHA 3GD4A 2NPXA 3V3NA 3UKKA 3QSEA 4EM3A 1KF6A 3CNDA 4X9NA 1CF3A 3WE0A 2Y6QA 2FJBA 3UKLA 2W0HA 1RSGA 2QAEA 4DGKA 4OPUA 3AE9A 1GERA 2X3NA 5J60A
chains in the Genus database with same CATH superfamily
4K8GA 2BK4A 3AE4A 1DOBA 1SJDA 3Q4DA 1Y0PA 3REDA 3FMWA 4GYPA 3NVVB 3NH3X 3AN1A 4G6GA 4ENLA 4ROPA 2FKPA 4B1BA 1DTNA 3L5OA 3TTEA 3TOYA 3SZWA 4M6UA 1CC4A 3P4RA 1V59A 4BV6A 4AOSA 4GGBA 1YQ4A 1Q1WA 3IJQA 3GMBA 3RRAA 3SSZA 5KMQA 2QJJA 2P88A 3DA1A 3CNPA 3NIXA 5ER0A 3NTDA 3UKHA 2YLXA 3ENLA 3SN1A 2ACZA 5HY5A 2XLPA 3C96A 3ALJA 4IT1A 4FX9A 1E7PA 2GL5A 2JB1A 2PMQA 4YSXA 3CGDA 4Z26A 3CPIG 4B65A 3NLCA 3UJSA 3S5SA 1GV4A 1P48A 3FXGA 2YM1A 2BCGG 3PG6A 1N5XA 3JW7A 1CL0A 4A7AA 1ZX9A 1L9CA 3G5QA 4U2LA 3UJEA 2P0IA 4NTCA 2EQ7A 2PTYA 1Z6LA 2R9ZA 5FJUA 2YG6A 4J1OA 3DH9A 1S3EA 2CVJA 2E5VA 1SB3B 5JCMA 2YWLA 1TKKA 4GYPC 3R1ZA 1GOSA 4OPCA 4GUVA 1EBGA 4ADWA 5KMRA 2JAEA 4O5QA 4YTNA 4B67A 4K5RA 3EEZA 1F8RA 2DKHA 3LZXA 1X2HA 3B97A 1TDKA 3AEFA 1K0JA 3DG3A 2XLTA 3ALLA 3CIRA 3KUMA 3NNEA 2GQFA 3QVRA 1IUTA 1NPXA 3F8DA 2GV8A 2OLAA 1N4VA 1BQGA 5BUKA 3GRSA 4H4UA 4UP3A 1JDFA 4GRTA 3MUCA 2RGOA 4X2PA 4NZHA 3CB3A 4C3YA 1N1PA 4H2RA 4HCDA 2H88A 1P2HA 2Q7VA 3M0OA 4KWSA 3UP4A 1H81A 2FBWA 4XXGA 3UXLA 3HRDC 4IP5A 3AXBA 4II2A 4B66A 1WUFA 3P4QA 4G73A 2GGGA 4WX1A 4ZCDA 4G74A 1EL8A 4TVYA 1L0VA 1ZKQA 3RP6A 2WETA 3QFAA 1MRAA 4X9MA 1LPFA 1CC2A 4MMWA 3SFEA 1WYGA 2OLOA 4J36A 4AP3A 1K0IA 2TMDA 2W3RA 1PBBA 1PBCA 3ITJA 1P2EA 2PHHA 3BOXA 3QFBA 5HXIA 2E1MA 2GDQA 1XANA 3E1TA 2XLRA 2BC0A 3IC9A 2GR3A 4J34A 4A65A 1OJ9A 2YG4A 2YLSA 2BK3A 3U9IA 2GMJA 3L1RA 4A9WA 3NXLA 1GPEA 4J56A 4IVOB 4XWZA 3UKPA 2WP6A 3AD7B 1W6TA 3H8LA 3H7VA 4BURA 2OFJA 4Z2TA 4LA1A 1R0MA 1HYUA 4USRA 4DSHA 2X8CA 3LOVA 1BF3A 3D1CA 1P43A 3NVZB 2VRLA 5BOEA 3NYCA 5KOXA 1ZY8A 1ELSA 5FS9A 4EMIA 3P9UA 1PXCA 1KFYA 2PA6A 4Z17A 5BRTA 2CFYA 3OTRA 5EU9A 2BK5A 1H84A 4PABA 1B37A 4NTEA 4CCRA 1PBFA 2WQYA 1T3QC 2V3BA 3ICTA 4GAVA 3R07C 3OZMA 4X4JA 2GGHA 1E1MA 2OA1A 3KU9A 3VR8A 3CNJA 3SQPA 3FPZA 2X50A 2PPGA 2WDQA 2RGHA 4OVIA 1Q1RA 1EBDA 2VRMA 2E3TA 1NU5A 1KSUA 1TDNA 1PDZA 3AEAA 2OZ3A 2DKIA 3NG7X 2GR0A 2YVGA 1GALA 3RGTA 2GGEA 3A7UA 1JRZA 1D4CA 2PP0A 3GWFA 4KPLA 2YM2A 4GDEA 5HHFA 2XFPA 4M0XA 3VC5A 1K0LA 3M12A 3BI4A 2HZGA 4H4PA 5FJTA 1JOAA 4G9KA 3CYJA 4JY2A 4DNAA 4UDQA 3UP5A 3K30A 1DOCA 2B9YA 2PS2A 4EWJA 2QCUA 5HYMA 1H7WA 3FIMB 1N5WC 5JRBA 1FOHA 3GD4A 1KF6A 1CF3A 1F9CA 1JCTA 2QAEA 4DGKA 3AE9A 5J60A 3T2YA 4G7FA 4B68A 1STZA 1GRTA 3MY9A 3H8AA 3P4SA 4DN1A 4E0VA 1N60C 3K7QX 5TR3A 5KOWA 1LJ1A 3COXA 4K22A 2XFOA 3IF9A 2YAUA 3GO2A 2QGYA 2VVLG 1SJBA 1EL7A 3IK4A 2H89A 1H83A 3Q6JA 2AL2B 2OO6A 4Z24A 1ZOYA 4IP4A 1D5TA 4EIPA 3VA8A 4AT2A 3T4WA 1GETA 2PU1A 4EMWA 5BULA 2R45A 4Z2UA 1JNRA 1VDVA 2YR4A 4EIQA 4MKSA 3UTGA 4LU6A 4H2PA 2QA1A 3AYJA 4C5OA 3AYIA 3NHOX 3HPFA 3V5FA 2GF3A 4E8GA 3N6JA 1GT8A 4GCMA 2X8GA 3QSMA 1D4DA 2QDDA 2PYXA 4CNJA 1NELA 3AWIA 2BCPA 4ZOHB 2Z5YA 3K7MX 3KA7A 3NN6X 5GSNA 1IYXA 1GRHA 4E6MA 1XHCA 2XGZA 4H2NA 3CNSA 3B6DA 3G5SA 3AB1A 3R0UA 4PAAA 2E5AA 1BGJA 2TPRA 4MGGA 3SJNA 5EOWA 3U4FA 3AE1A 4HNLA 2Q0LA 1WUEA 2UZZA 2POZA 1FEBA 3AD9B 1S2YA 1YQ3A 2QJMA 3CAWA 3BI5A 3BI2A 4Z44A 3SFDA 4B64A 1PJ7A 3DJJA 3SGLA 3DGHA 3JZUA 4H50A 2WDVA 4H83A 4IVMB 4GDPA 4OCGA 4U8NA 2PTWA 4J3ZA 1KCZA 2C76A 3RP8A 3NK1X 1H6VA 2C65A 3VRAA 3ZLFA 3EAOA 2I0ZA 3DDMA 4FK1A 2OAMA 4H4ZA 3EKGA 1XPYA 3DMEA 4DHGA 3UTEA 2RABA 4ZN0A 3I3LA 2NQLA 5KRQA 1VG9A 4NTDA 1N4WA 5BOFA 4BK1A 5IPYA 2XH2A 4BK3A 1DNCA 1NDAA 1EBHA 4K8DA 3QN3A 5ENLA 4U2SA 2XH7A 2C7GA 3D8XA 4HYRA 3R11A 4H4XA 4GGHA 3GMCA 4K2SA 5BVAA 3OZYA 2O9ZA 1GREA 3AE7A 4AP1A 3NTAA 1GRAA 4OPTA 3BHKA 3UKFA 1FCDA 2OKTA 3T31A 1D4EA 2C67A 2Z5XA 3HZLA 3SXIA 3QSSA 2C66A 1NHRA 2B9WA 2YR6A 2V5ZA 3DJGX 3CTYA 4K5SA 1GRBA 3GYXA 1N62C 1H7XA 3GD6A 3HYVA 3DG7A 3O0HA 3ZDNA 3CT2A 4H19A 2AAQA 4CY8A 5GRTA 1PN0A 4A99A 4E4FA 3V5CA 3DG6A 3ZVHA 2YVFA 3DFHA 4FK1C 3H4KA 4H4SA 2XYOA 1SJAA 3LADA 1KNPA 2GRTA 3FBSA 1SEZA 3IHMA 3RITA 1N63C 1R6WA 3AE6A 3K1GA 4UDRA 3VRBA 3T9PA 3CGCA 3P1WA 2GAGB 5JCNA 4E4UA 2O56A 3EF6A 4JN8A 3OZ2A 2EQ6A 3VRDB 2BACA 2CULA 3EUB3 1PJ5A 5KVHA 3TWAA 1TZZA 1COYA 3C4NA 4U8MA 1O94A 1JU2A 4NEVA 1OJCA 3SBFA 2C3DA 3VFCA 2XSXA 2GGJA 2YQUA 4LIIA 3C4AA 2IVEA 4IA5A 2HNEA 4REKA 1YKJA 4K7ZA 2WPCA 1N4UA 3NT6A 2PODA 3UCLA 1LTXR 3ZLHA 4U8OA 4HNCA 3CMMA 3BNMA 3TJ4A 2BXSA 3NRNA 2C64A 3NGCX 3MSYA 4CBQA 4U8JA 3DK8A 2AKZA 4J31A 4EQRA 3EANA 5KMPA 4I58A 4NNJA 5IQ4A 3AECA 1EL5A 1RYIA 2QQ6A 4JDRA 3PS9A 1GNDA 1RM6B 2EQ8A 3AYLA 3QKEA 4TM4A 4YSYA 2JK6A 3FYYA 3RNMA 2R0GA 4I59A 2V6OA 1IJHA 3A7RA 1XS2A 3L8KA 1NHQA 4JQ9A 3SQSA 3CN8A 1ELIA 2WOVA 3SR6B 3UKKA 3CNDA 3WE0A 2FJBA 2W0HA 4JHMA 1RSGA 2YLTA 4GAPA 1YQZA 1NEKA 1FEAA 3N4EA 2C73A 2VQBA 5EB5A 4K2XA 3T2KA 3GD3A 2IIDA 1F8SA 1M64A 3UJ2A 3FJ4A 2R4EA 5KVIA 5KXJA 3S47A 3ABVA 2YVJA 3PWGA 1X31B 1H2IA 3ETRB 1LQTA 1NHPA 1LVLA 1TE6A 2HQMA 3FV9A 2XCGA 3R10A 2Q6UA 3B3RA 2XDOA 2OPJA 1KKRA 3AE5A 2PTZA 3DESA 5KNLA 2OQHA 2A89A 2GQWA 2BS3A 1CHUA 2FYMA 4U8KA 1FL2A 2F5ZA 3ALMA 3MQTA 2MUCA 3NYEA 1MXTA 2P8BA 1TYTA 2WOWA 1NENA 3FCPA 1TDOA 2BS2A 4ECHA 3DEQA 2OVLA 3NK2X 4USQA 2FJDA 3UOVA 2RDXA 3BHFA 1E6EA 4HB9A 3GDPA 3TJIA 3GDNA 1PXAA 3SZCA 2GEWA 2C72A 6ENLA 2BS4A 4RSLA 1GRFA 4JN9A 1Y56A 2GB0A 3DIPA 3V3WA 2GMHA 3DGBA 1EC9A 2NVKX 1K4QA 1FFVC 3M13A 2XFQA 3UTFA 4BJZA 4YWSA 4YKFA 5J04A 4A6GA 4Z25A 4IL2A 3OPSA 1VQWA 2C4CA 3V76A 4JNAA 3PFRA 3UKAA 1ONEA 2RGJA 1GTEA 1JNZA 3DFYA 1EL9A 1PS9A 2R46A 3CPJG 1FO4A 3R0KA 5M0ZA 3V4BA 2W3SA 3RHAA 4RG4A 5EBKA 1IUWA 2WU2A 4D03A 4JY3A 3THUA 2AKMA 1VG0A 2ARDA 3QJ4A 4Z1YA 3ZVIA 2OX4A 1CC6A 2FJEA 3Q9TA 3QVPA 1S7MA 1IUSA 5FS6A 4HCLA 2ZC8A 4YSHA 1MDRA 2JBVA 3DJEA 3LXDA 2QA2A 4B69A 3STPA 1MUCA 4U8IA 3LZWA 2BYBA 1JPMA 1TDEA 1QJDA 1RP0A 4ZA0A 4EQSA 5L46A 3DK9A 3K7TA 4IA6A 3P93A 3KVEA 5IQ1A 4K1WA 4A6NA 4A3RA 4MJWA 2I5QA 1JROA 3SX6A 1M6IA 3FG2P 3I6TA 2DW7A 3GC2A 2WDRA 1FIQB 4C3XA 4H4WA 3CGEA 1XPQA 2BC1A 3ATRA 3AEBA 4A35A 5KWFA 4U2TA 1E1NA 2P3ZA 1IUUA 2QVHA 4YKGA 1KKOA 1L8PA 1YEYA 1DJNA 3UJFA 5U1OA 2ZZ0A 3R9UA 3MZNA 1BKHA 3MKCA 3VC6A 4H2QA 2JKCA 1ZP0A 3UTHA 3OW1A 4KEMA 3I6EA 4A79A 1F8WA 3KKJA 5FS7A 3Q45A 3S5WA 1OJAA 2CDUA 4UDPA 3CGBA 4Y4NA 2PSNA 2WBAA 3SN4A 1EC8A 3MWCA 4DWDA 2OZ8A 1H86A 5LV9A 3H8IA 3GSIA 4HCHA 2E4GA 1XDIA 2WP9A 3GYIA 4TM1A 1B4VA 2XLUA 4ICYA 3T37A 1L9EA 3DERA 1YY5A 4TVWA 4GF7A 2ONEA 3ZVHB 3IJLA 4H4YA 2A8XA 4ZCWA 1BZLA 2VVMA 1N61C 3ZYXA 1ZMDA 1PJ6A 3V3OA 1W4XA 2C3CA 3DK4A 2WEUA 2EQ9A 2OALA 3NYFA 2JB2A 4EQWA 4RG3A 5U63A 3VR9A 3LB8A 4H4QA 1REOA 1ZDLA 3BJSA 4H7UA 2OQYA 3UXKA 3UOXA 2W55A 1KN0A 4XWRA 2V3AA 3ICSA 2B7SA 3SYIA 1ECQA 5FS8A 3SM8A 2AQJA 2B7RA 2WU5A 1OJTA 2J3NA 4Z2RA 3TQPA 4JNQA 1PXBA 3NFUA 2Q0KA 2Y6RA 4Y4LA 1DXLA 3QTPA 1E1KA 1NG4A 5J7XA 4AOXA 3UCDA 4Y4MA 1DODA 3B9JB 3H12A 2VQ7A 2VOUA 3CXBA 2PTXA 2PGEA 1SJCA 1IUXA 1E1LA 1QLBA 2YLZA 3UCCA 1L9DA 3PWIA 1MNSA 1OJDA 2XFNA 4O5UA 1Q9IA 4CCQA 3SY4A 2FJAA 2WHDA 3DGZA 1GTHA 1CJ3A 4EM4A 4J33A 2HXUA 4DYEA 3KPFA 2R0PA 2NPXA 3QSEA 4X9NA 3UKLA 2OG9A 3VCNA 2APGA 2BXRA 3VCCA 2GGIA 3UJRA 2BRYA 3I4KA 3T6CA 3NZGA 1MOKA 5DBJA 4IZGA 1NHSA 4EQXA 4KX6A 1MDLA 1CBOA 3FVDA 3NN0X 2BA9A 1KDGA 1B8SA 3T2ZA 4KT2A 4APNA 3DJDA 1ZOVA 4DSGA 1E9IA 4OPGA 2ZZBA 3KLJA 4H4RA 1TDFA 2YR5A 3CPHG 2IVDA 2YG3A 5JCIA 3IJIA 5G5HB 2YLWA 2WESA 2YG5A 4HN8A 1GRGA 3I6DA 3IWAA 4YTPA 1NG3A 4DXKA 1PHHA 2AL1A 4G8TA 3TWBA 5JCKA 2CHRA 5C2TA 2A87A 5CKUA 4GR1A 4YT0A 2XVEA 3GY1A 1TYPA 1CJ2A 4M52A 3ES8A 4CRTA 4AT0A 4C74A 4DX3A 4EMJA 1JRPA 1ZXIC 3D9XA 1BKWA 4U8LA 2PCEA 4A5LA 1GXFA 4TLZA 4IV9A 1FHUA 1BGNA 3KPKA 1DOEA 3CXOA 2GR1A 2GR2A 5FJPA 2XFUA 3CK5A 4G6HA 1GEUA 5FJOA 2PP1A 5FJRA 3AEDA 1D7YA 3G5RA 4GMEA 4NEWA 3AE8A 2OLNA 3UOYA 3ZLGA 3CNTA 1E39A 2R0CA 3TW9A 3GYJA 1AOGA 3NO1A 5KMSA 4TLXA 3EPTA 4IHCA 2XH0A 1GSNA 4ZCCA 1ZMCA 3RP7A 1KNRA 2WPEA 2B76A 1VQZA 3OC4A 4H1ZA 2B9XA 3UOZA 5CQFA 2XVFA 5M10A 2PU0A 3AMZA 5C3JA 2WP5A 1O95A 2VZ2A 1Y56B 3TCSA 2ZBWA 2C70A 3P3BA 3T14A 3II4A 4GFIA 2BRAA 1F3PA 2X8HA 1RVKA 1CJCA 4C77A 2YG7A 3UKQA 1PDYA 1F6MA 3HYXA 3H70A 3N6HA 1LQUA 4H4TA 3JSKA 1O5WA 1LV0A 4FDCB 4YWOA 2GH5A 4H2HA 4H4VA 3AEEA 2R4JA 2XVJA 3IHGA 2C75A 4OPLA 2WOIA 2BABA 4FP1A 1OEPA 1S3BA 1IUVA 4CNKA 4HPNA 2W54A 4CY6A 1H82A 4F4RA 2DW6A 2XVIA 4BJYA 2GVCA 4II3A 3AE3A 1BWCA 3SZ0A 1JRXA 4P9SA 3BNUA 1DJQA 3LJPA 2YLRA 3PK7A 3QLDA 1PDHA 5IDZA 3ES7A 3F8PA 2XVHA 1D7LA 3N4FA 3URHA 3BSMA 2WPFA 3AD8B 3T0KA 3UGVA 1KSSA 3OP2A 4A6NB 3A7AA 1FHVA 4GIRA 1VRQB 3AE2A 3GRTA 4JN7A 4FI4A 1FECA 1NAAA 3ATQA 5FMHA 4OPIA 3RCYA 3SN0A 3D47A 3HYWA 1V97A 3AM9A 3NVWB 4YXDA 1JPDX 3RR1A 3NS1B 1VDCA 2HXTA 3PO7A 4IL0A 4Z43A 1QO8A 1JRYA 1S2QA 3HW2A 1JEHA 3F8RA 1ZK7A 2XH4A 4U8PA 1X2GA 3GWDA 4TM0A 3S61A 5JCLA 1PBEA 2MNRA 5U25A 4N9XA 1TRBA 4YTMA 1GESA 2XLSA 2JB3A 3P0WA 4HA6A 4D04A 1B5QA 4J57A 3QPEA 2ZADA 4TM3A 4OPDA 4KPRA 3NKSA 5G5GB 2AR8A 3RO6A 3AEGA 2QDEA 4J2WA 3P4PA 2VVLA 1PBDA 2X99A 2GSHA 4E5TA 3JVAA 4GISA 2GAHB 3VQRA 3ICRA 1ONFA 3ADAB 2V61A 2QJNA 4NWZA 2P8CA 3NK0X 2V60A 4B63A 3R25A 5EB4A 3VDGA 3T8QA 3SZFA 2PGWA 4BK2A 2PP3A 1MO9A 2AL2A 3NVYB 4WCTA 3D46A 3ISHA 2ZZCA 1UKVG 4YSZA 3KD9A 2WS3A 1FFUC 3NRZB 1EC7A 3PVCA 2OZTA 1CJ4A 3V3NA 4EM3A 7ENLA 1KD0A 2Y6QA 4OPUA 1GERA 2X3NA
chains in the Genus database with same CATH topology
1YQZA 1NEKA 1FEAA 3T2YA 2C73A 2VQBA 4B68A 5EB5A 1GRTA 2APGA 2BXRA 2BK4A 4K2XA 3T2KA 2BRYA 3GD3A 2IIDA 1F8SA 1M64A 3AE4A 3P4SA 1DOBA 2R4EA 4E0VA 1Y0PA 3K7QX 3REDA 3FMWA 5TR3A 1MOKA 5DBJA 5KOWA 1NHSA 5KVIA 4EQXA 3NH3X 4KX6A 5KXJA 1CBOA 1LJ1A 3NN0X 4G6GA 2BA9A 1KDGA 2YLTA 3COXA 1B8SA 3ABVA 4APNA 3DJDA 4K22A 3T2ZA 2XFOA 3L5OA 4B1BA 3IF9A 2YAUA 2YVJA 1ZOVA 2VVLG 1X31B 4DSGA 3SZWA 1H2IA 4OPGA 2ZZBA 1LQTA 1NHPA 3KLJA 1EL7A 1CC4A 4H4RA 1TDFA 1LVLA 2H89A 2YR5A 3CPHG 2IVDA 1H83A 3P4RA 3Q6JA 1V59A 4BV6A 2YG3A 2HQMA 4Z24A 4AOSA 1YQ4A 2XCGA 5JCIA 1Q1WA 1ZOYA 2Q6UA 3GMBA 2YLWA 2WESA 2YG5A 5KMQA 1GRGA 3B3RA 2XDOA 1D5TA 3DA1A 3I6DA 3IWAA 4EIPA 4YTPA 3CNPA 4AT2A 1NG3A 1PHHA 3NIXA 5ER0A 3AE5A 3NTDA 3UKHA 1GETA 2YLXA 4EMWA 5BULA 5KNLA 2R45A 2ACZA 2A89A 5HY5A 2GQWA 2XLPA 5JCKA 3C96A 2BS3A 3ALJA 4Z2UA 1CHUA 1JNRA 4U8KA 1FL2A 5C2TA 2YR4A 4EIQA 2F5ZA 3ALMA 2A87A 5CKUA 4FX9A 1E7PA 2JB1A 4LU6A 3UTGA 4YSXA 3NYEA 3CGDA 4H2PA 4Z26A 2QA1A 1MXTA 3CPIG 4GR1A 4B65A 3AYJA 3NLCA 4YT0A 1TYTA 2WOWA 1NENA 2BS2A 1TDOA 2XVEA 1GV4A 4ECHA 3NK2X 1TYPA 1CJ2A 2YM1A 4USQA 4M52A 2FJDA 3AYIA 3UOVA 3NHOX 2BCGG 4C5OA 3PG6A 4CRTA 4AT0A 2GF3A 3BHFA 1GT8A 4C74A 1CL0A 4EMJA 1E6EA 1ZX9A 4A7AA 4HB9A 1L9CA 4GCMA 3D9XA 1BKWA 3GDPA 4U8LA 3G5QA 2X8GA 3QSMA 1D4DA 4U2LA 4A5LA 3GDNA 2PYXA 4NTCA 2EQ7A 1Z6LA 2R9ZA 1GXFA 1PXAA 4CNJA 3SZCA 2YG6A 4TLZA 3AWIA 3DH9A 2BCPA 2C72A 2GEWA 1S3EA 2Z5YA 1BGNA 3K7MX 3KA7A 3NN6X 2BS4A 4IV9A 4RSLA 1GRFA 1GRHA 4JN9A 2CVJA 2E5VA 1XHCA 5GSNA 3KPKA 1Y56A 4H2NA 3CNSA 3B6DA 5JCMA 3G5SA 3AB1A 1DOEA 2YWLA 2GB0A 4PAAA 1BGJA 2TPRA 2GMHA 2NVKX 1K4QA 2GR1A 3M13A 1GOSA 2GR2A 2XFQA 3UTFA 4BJZA 4OPCA 4GUVA 4YKFA 5EOWA 3AE1A 2Q0LA 4ADWA 4Z25A 2UZZA 2XFUA 5KMRA 4G6HA 1FEBA 3AD9B 1S2YA 1YQ3A 1VQWA 2C4CA 3V76A 2JAEA 1GEUA 4O5QA 4JNAA 4YTNA 4B67A 4K5RA 1F8RA 3UKAA 3BI5A 3BI2A 2DKHA 3AEDA 3LZXA 4Z44A 3SFDA 4B64A 1D7YA 3G5RA 4NEWA 3AE8A 2RGJA 1PJ7A 1GTEA 2OLNA 3UOYA 3DJJA 1TDKA 3SGLA 3DGHA 3AEFA 1K0JA 3CNTA 1E39A 2XLTA 4H50A 3ALLA 2R0CA 2WDVA 1JNZA 1EL9A 3CIRA 3GYJA 1AOGA 5KMSA 3NNEA 4TLXA 1PS9A 2R46A 3CPJG 3EPTA 1GSNA 2GQFA 3QVRA 1IUTA 4ZCCA 1NPXA 3F8DA 1ZMCA 5M0ZA 3RP7A 1KNRA 2WPEA 4IVMB 2GV8A 4GDPA 2B76A 4OCGA 4U8NA 3OC4A 3RHAA 2B9XA 4RG4A 2C76A 5EBKA 1IUWA 3RP8A 1N4VA 2WU2A 4JY3A 4D03A 3NK1X 3UOZA 1H6VA 2C65A 5CQFA 1VG0A 2XVFA 5M10A 3VRAA 5BUKA 3GRSA 5C3JA 2WP5A 4H4UA 2ARDA 3QJ4A 4UP3A 4GRTA 1O95A 2VZ2A 3EAOA 2I0ZA 1Y56B 4FK1A 1CC6A 2FJEA 2ZBWA 3Q9TA 2RGOA 2C70A 2OAMA 3QVPA 4H4ZA 4NZHA 4C3YA 1S7MA 3DMEA 3UTEA 1IUSA 3T14A 5FS6A 1N1PA 3II4A 2RABA 2BRAA 4H2RA 4ZN0A 3I3LA 4YSHA 1F3PA 2H88A 1P2HA 5KRQA 2Q7VA 3M0OA 1VG9A 4NTDA 3UP4A 2JBVA 3DJEA 1N4WA 2X8HA 4BK1A 5IPYA 3LXDA 2QA2A 4B69A 1CJCA 1H81A 2FBWA 4BK3A 4U8IA 1DNCA 4C77A 1NDAA 2YG7A 4XXGA 4K8DA 3UKQA 1F6MA 3HYXA 4U2SA 3LZWA 3AXBA 2C7GA 4II2A 3D8XA 4B66A 3P4QA 4H4XA 1LQUA 2BYBA 4G73A 1TDEA 1QJDA 4H4TA 3GMCA 3JSKA 1O5WA 1RP0A 1LV0A 4FDCB 5BVAA 4EQSA 4YWOA 2GH5A 5L46A 4WX1A 3DK9A 2O9ZA 1GREA 4ZCDA 4H4VA 3AE7A 3K7TA 4AP1A 3NTAA 1GRAA 4OPTA 3AEEA 2R4JA 2XVJA 3BHKA 3KVEA 1FCDA 4G74A 4IA6A 3UKFA 1EL8A 3IHGA 5IQ1A 3T31A 1L0VA 1D4EA 2C67A 2Z5XA 1ZKQA 2C75A 3HZLA 3SXIA 4A6NA 4OPLA 3RP6A 2WETA 3QFAA 3QSSA 2C66A 4MJWA 4X9MA 1LPFA 1NHRA 2WOIA 1CC2A 2B9WA 2BABA 2YR6A 3SFEA 1M6IA 1S3BA 3SX6A 2V5ZA 3DJGX 3FG2P 2OLOA 1IUVA 4CNKA 4J36A 4AP3A 1K0IA 3CTYA 4K5SA 2TMDA 1GRBA 1PBBA 3GYXA 4CY6A 1H82A 2WDRA 1PBCA 3ITJA 1P2EA 2PHHA 1H7XA 3QFBA 5HXIA 2E1MA 4C3XA 3HYVA 4H4WA 1XANA 2XVIA 3O0HA 3E1TA 3ZDNA 4CY8A 2AAQA 3CGEA 5GRTA 2XLRA 2BC0A 1XPQA 4BJYA 1PN0A 3IC9A 2GVCA 4A99A 2BC1A 4II3A 3ATRA 2GR3A 3AE3A 4J34A 1BWCA 4A65A 1OJ9A 3SZ0A 1JRXA 3AEBA 5KWFA 4P9SA 4U2TA 3BNUA 2YG4A 1E1NA 1DJQA 1IUUA 2YVFA 3LJPA 2YLRA 4YKGA 2YLSA 2BK3A 1DJNA 1PDHA 3F8PA 4FK1C 5U1OA 2GMJA 3H4KA 4H4SA 2XVHA 2XYOA 3L1RA 2ZZ0A 3R9UA 3LADA 1D7LA 2GRTA 1KNPA 4A9WA 1GPEA 3URHA 4J56A 4IVOB 2WPFA 3AD8B 4H2QA 4XWZA 3T0KA 3FBSA 1SEZA 3IHMA 3UKPA 2JKCA 1ZP0A 2WP6A 3AE6A 3UTHA 4UDRA 3VRBA 3AD7B 1KSSA 4A79A 3H8LA 1F8WA 3KKJA 4A6NB 4BURA 5FS7A 3CGCA 3P1WA 3S5WA 4Z2TA 4LA1A 1OJAA 1HYUA 1VRQB 4USRA 2CDUA 4UDPA 3CGBA 3AE2A 3GRTA 4DSHA 2GAGB 4Y4NA 5JCNA 2X8CA 1FECA 2WBAA 3LOVA 1NAAA 3ATQA 1BF3A 5FMHA 3D1CA 3EF6A 3OZ2A 2VRLA 3NYCA 5KOXA 2EQ6A 3VRDB 1ZY8A 1H86A 4OPIA 3HYWA 5LV9A 3H8IA 3GSIA 2E4GA 1XDIA 2WP9A 2BACA 2CULA 3GYIA 4TM1A 1PJ5A 1B4VA 5FS9A 4EMIA 2XLUA 3P9UA 4ICYA 1PXCA 3T37A 1L9EA 1KFYA 1YY5A 5KVHA 4YXDA 4GF7A 5BRTA 2CFYA 4H4YA 2A8XA 1VDCA 2BK5A 3PO7A 1H84A 4Z43A 1COYA 1BZLA 2VVMA 3C4NA 4PABA 4U8MA 1O94A 1QO8A 1JU2A 1JRYA 1S2QA 1ZMDA 3ZYXA 1B37A 4NEVA 1PJ6A 3V3OA 1OJCA 4NTEA 2C3DA 1JEHA 1W4XA 4CCRA 3F8RA 2C3CA 1ZK7A 3DK4A 2WEUA 2EQ9A 1PBFA 2OALA 2WQYA 2V3BA 3NYFA 2JB2A 3ICTA 4U8PA 4EQWA 4RG3A 5U63A 4GAVA 3VR9A 3LB8A 4H4QA 1REOA 1ZDLA 2YQUA 4LIIA 3GWDA 3C4AA 4TM0A 4H7UA 2IVEA 3UOXA 1KN0A 3S61A 4XWRA 4IA5A 2V3AA 4X4JA 5JCLA 2B7SA 3ICSA 1E1MA 2OA1A 3KU9A 1PBEA 4REKA 4GAPA 3SYIA 1YKJA 3CNJA 3SQPA 3VR8A 4K7ZA 2WPCA 2X50A 5FS8A 5U25A 3FPZA 3SM8A 1N4UA 2WDQA 2RGHA 4OVIA 1Q1RA 3NT6A 1EBDA 1TRBA 4N9XA 4YTMA 2AQJA 1GESA 2B7RA 2XLSA 2WU5A 2VRMA 3UCLA 1LTXR 2JB3A 4U8OA 1OJTA 2J3NA 1KSUA 4Z2RA 3CMMA 1TDNA 3BNMA 2BXSA 4HA6A 3AEAA 3NRNA 2C64A 4JNQA 4D04A 3NGCX 1B5QA 2DKIA 1PXBA 4J57A 3NG7X 2GR0A 4TM3A 2YVGA 4OPDA 4CBQA 4KPRA 2Q0KA 2Y6RA 3NKSA 4U8JA 1GALA 3DK8A 2AR8A 4Y4LA 3AEGA 1DXLA 1E1KA 1NG4A 1JRZA 4J2WA 1D4CA 5J7XA 3P4PA 2VVLA 1PBDA 4EQRA 2X99A 4J31A 4AOXA 3GWFA 3EANA 1DODA 4Y4MA 4I58A 4NNJA 5KMPA 5IQ4A 3AECA 2YM2A 1EL5A 2GAHB 1RYIA 2VQ7A 3VQRA 3ICRA 4JDRA 1ONFA 4GDEA 5HHFA 2XFPA 3ADAB 2V61A 2VOUA 1GNDA 3PS9A 4NWZA 3NK0X 1IUXA 1E1LA 2V60A 2EQ8A 1QLBA 3AYLA 4B63A 5EB4A 1K0LA 2YLZA 3M12A 3BI4A 4H4PA 1JOAA 1L9DA 3SZFA 1OJDA 4TM4A 4BK2A 4YSYA 2XFNA 4G9KA 1MO9A 2JK6A 4O5UA 4JY2A 4WCTA 4DNAA 3RNMA 3ISHA 4UDQA 2R0GA 4I59A 1Q9IA 2V6OA 2ZZCA 1IJHA 3UP5A 1UKVG 3K30A 4CCQA 1DOCA 4YSZA 2B9YA 3SY4A 2FJAA 2WHDA 3KD9A 2QCUA 5HYMA 3L8KA 1NHQA 1GTHA 3DGZA 4JQ9A 1H7WA 1CJ3A 4EM4A 4J33A 3CN8A 2WS3A 3FIMB 1ELIA 3KPFA 2R0PA 3PVCA 1CJ4A 2WOVA 5JRBA 1FOHA 3GD4A 2NPXA 3V3NA 3UKKA 3QSEA 4EM3A 1KF6A 3CNDA 4X9NA 1CF3A 3WE0A 2Y6QA 2FJBA 3UKLA 2W0HA 1RSGA 2QAEA 4DGKA 4OPUA 3AE9A 1GERA 2X3NA 5J60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQZ A;  1NEK A;  1FEA A;  2C73 A;  2VQB A;  4B68 A;  5EB5 A;  1GRT A;  2APG A;  2BXR A;  2BK4 A;  4K2X A;  3GD3 A;  2IID A;  1F8S A;  1M64 A;  3AE4 A;  3P4S A;  1DOB A;  2R4E A;  4E0V A;  1Y0P A;  3K7Q X;  3RED A;  3FMW A;  5TR3 A;  1MOK A;  5DBJ A;  5KOW A;  1NHS A;  5KVI A;  4EQX A;  3NH3 X;  4KX6 A;  5KXJ A;  1CBO A;  1LJ1 A;  3NN0 X;  2BA9 A;  1KDG A;  2YLT A;  3COX A;  1B8S A;  3ABV A;  4APN A;  3DJD A;  4K22 A;  4B1B A;  2XFO A;  3IF9 A;  2YAU A;  2YVJ A;  1ZOV A;  2VVL G;  1X31 B;  4DSG A;  4OPG A;  2ZZB A;  1LQT A;  1NHP A;  3KLJ A;  1EL7 A;  1CC4 A;  4H4R A;  1TDF A;  1LVL A;  2H89 A;  2YR5 A;  3CPH G;  2IVD A;  1H83 A;  3P4R A;  3Q6J A;  1V59 A;  4BV6 A;  2YG3 A;  2HQM A;  4Z24 A;  4AOS A;  1YQ4 A;  2XCG A;  5JCI A;  1Q1W A;  1ZOY A;  2Q6U A;  3GMB A;  2YLW A;  2WES A;  2YG5 A;  1GRG A;  3B3R A;  2XDO A;  1D5T A;  3DA1 A;  3I6D A;  3IWA A;  4EIP A;  4YTP A;  3CNP A;  4AT2 A;  1NG3 A;  1PHH A;  3NIX A;  5ER0 A;  3AE5 A;  3NTD A;  3UKH A;  1GET A;  2YLX A;  4EMW A;  5BUL A;  2R45 A;  2ACZ A;  2A89 A;  5HY5 A;  2GQW A;  2XLP A;  5JCK A;  3C96 A;  2BS3 A;  3ALJ A;  4Z2U A;  1CHU A;  1JNR A;  4U8K A;  1FL2 A;  5C2T A;  2YR4 A;  4EIQ A;  2F5Z A;  3ALM A;  2A87 A;  5CKU A;  4FX9 A;  1E7P A;  2JB1 A;  4LU6 A;  3UTG A;  4YSX A;  3NYE A;  3CGD A;  4H2P A;  4Z26 A;  2QA1 A;  1MXT A;  3CPI G;  4GR1 A;  4B65 A;  3AYJ A;  3NLC A;  4YT0 A;  1TYT A;  2WOW A;  1NEN A;  2BS2 A;  1TDO A;  2XVE A;  1GV4 A;  4ECH A;  3NK2 X;  1TYP A;  1CJ2 A;  2YM1 A;  4USQ A;  4M52 A;  2FJD A;  3AYI A;  3UOV A;  3NHO X;  2BCG G;  4C5O A;  4CRT A;  4AT0 A;  2GF3 A;  3BHF A;  1GT8 A;  4C74 A;  1CL0 A;  4EMJ A;  1E6E A;  1ZX9 A;  4A7A A;  4HB9 A;  1L9C A;  4GCM A;  1BKW A;  3GDP A;  4U8L A;  3G5Q A;  2X8G A;  3QSM A;  1D4D A;  4U2L A;  4A5L A;  3GDN A;  2PYX A;  4NTC A;  2EQ7 A;  1Z6L A;  2R9Z A;  1GXF A;  1PXA A;  4CNJ A;  2YG6 A;  4TLZ A;  3AWI A;  3DH9 A;  2BCP A;  2C72 A;  2GEW A;  1S3E A;  2Z5Y A;  1BGN A;  3K7M X;  3KA7 A;  3NN6 X;  2BS4 A;  4IV9 A;  4RSL A;  1GRF A;  1GRH A;  4JN9 A;  2CVJ A;  2E5V A;  1XHC A;  5GSN A;  1Y56 A;  4H2N A;  3CNS A;  3B6D A;  5JCM A;  3G5S A;  3AB1 A;  1DOE A;  2YWL A;  2GB0 A;  4PAA A;  1BGJ A;  2TPR A;  2GMH A;  2NVK X;  1K4Q A;  2GR1 A;  3M13 A;  1GOS A;  2GR2 A;  2XFQ A;  3UTF A;  4BJZ A;  4OPC A;  4GUV A;  4YKF A;  5EOW A;  3AE1 A;  2Q0L A;  4ADW A;  4Z25 A;  2UZZ A;  2XFU A;  1FEB A;  3AD9 B;  1S2Y A;  1YQ3 A;  1VQW A;  3V76 A;  2JAE A;  1GEU A;  4O5Q A;  4JNA A;  4YTN A;  4B67 A;  4K5R A;  1F8R A;  3UKA A;  3BI5 A;  3BI2 A;  2DKH A;  3AED A;  3LZX A;  4Z44 A;  3SFD A;  4B64 A;  1D7Y A;  3G5R A;  4NEW A;  3AE8 A;  2RGJ A;  1PJ7 A;  1GTE A;  2OLN A;  3UOY A;  3DJJ A;  1TDK A;  3SGL A;  3DGH A;  3AEF A;  1K0J A;  3CNT A;  1E39 A;  2XLT A;  4H50 A;  3ALL A;  2R0C A;  2WDV A;  1JNZ A;  1EL9 A;  3CIR A;  3GYJ A;  1AOG A;  3NNE A;  4TLX A;  1PS9 A;  2R46 A;  3CPJ G;  3EPT A;  1GSN A;  2GQF A;  3QVR A;  1IUT A;  4ZCC A;  1NPX A;  3F8D A;  1ZMC A;  5M0Z A;  3RP7 A;  1KNR A;  2WPE A;  4IVM B;  2GV8 A;  4GDP A;  2B76 A;  4OCG A;  4U8N A;  3OC4 A;  3RHA A;  2B9X A;  4RG4 A;  2C76 A;  5EBK A;  1IUW A;  3RP8 A;  1N4V A;  2WU2 A;  4JY3 A;  4D03 A;  3NK1 X;  3UOZ A;  1H6V A;  2C65 A;  5CQF A;  1VG0 A;  2XVF A;  5M10 A;  3VRA A;  5BUK A;  3GRS A;  5C3J A;  2WP5 A;  4H4U A;  2ARD A;  3QJ4 A;  4UP3 A;  4GRT A;  1O95 A;  2VZ2 A;  3EAO A;  2I0Z A;  1Y56 B;  4FK1 A;  1CC6 A;  2FJE A;  2ZBW A;  3Q9T A;  2RGO A;  2C70 A;  2OAM A;  3QVP A;  4H4Z A;  4NZH A;  4C3Y A;  3DME A;  3UTE A;  1IUS A;  5FS6 A;  1N1P A;  3II4 A;  2RAB A;  4H2R A;  4ZN0 A;  3I3L A;  4YSH A;  1F3P A;  2H88 A;  1P2H A;  5KRQ A;  2Q7V A;  3M0O A;  1VG9 A;  4NTD A;  3UP4 A;  2JBV A;  3DJE A;  1N4W A;  2X8H A;  4BK1 A;  5IPY A;  3LXD A;  2QA2 A;  4B69 A;  1CJC A;  1H81 A;  2FBW A;  4BK3 A;  4U8I A;  1DNC A;  4C77 A;  1NDA A;  2YG7 A;  4XXG A;  4K8D A;  3UKQ A;  1F6M A;  4U2S A;  3LZW A;  3AXB A;  2C7G A;  4B66 A;  3D8X A;  3P4Q A;  4H4X A;  1LQU A;  2BYB A;  1TDE A;  1QJD A;  4H4T A;  3GMC A;  3JSK A;  1O5W A;  1RP0 A;  1LV0 A;  4FDC B;  5BVA A;  4EQS A;  4YWO A;  2GH5 A;  5L46 A;  4WX1 A;  3DK9 A;  2O9Z A;  1GRE A;  4ZCD A;  4H4V A;  3AE7 A;  3K7T A;  4AP1 A;  3NTA A;  1GRA A;  4OPT A;  3AEE A;  2R4J A;  2XVJ A;  3BHK A;  3KVE A;  1FCD A;  4IA6 A;  3UKF A;  1EL8 A;  3IHG A;  5IQ1 A;  1L0V A;  1D4E A;  2C67 A;  2Z5X A;  1ZKQ A;  2C75 A;  3HZL A;  4A6N A;  4OPL A;  3RP6 A;  2WET A;  3QFA A;  3QSS A;  2C66 A;  4MJW A;  4X9M A;  1LPF A;  1NHR A;  2WOI A;  1CC2 A;  2B9W A;  2BAB A;  2YR6 A;  3SFE A;  1M6I A;  1S3B A;  2V5Z A;  3DJG X;  3FG2 P;  2OLO A;  1IUV A;  4CNK A;  4J36 A;  4AP3 A;  1K0I A;  3CTY A;  4K5S A;  2TMD A;  1GRB A;  1PBB A;  4CY6 A;  1H82 A;  2WDR A;  1PBC A;  3ITJ A;  1P2E A;  2PHH A;  1H7X A;  3QFB A;  5HXI A;  2E1M A;  4C3X A;  4H4W A;  1XAN A;  2XVI A;  3O0H A;  3E1T A;  3ZDN A;  4CY8 A;  2AAQ A;  3CGE A;  5GRT A;  2XLR A;  2BC0 A;  1XPQ A;  4BJY A;  1PN0 A;  3IC9 A;  2GVC A;  4A99 A;  2BC1 A;  3ATR A;  2GR3 A;  3AE3 A;  4J34 A;  1BWC A;  4A65 A;  1OJ9 A;  1JRX A;  3AEB A;  5KWF A;  4P9S A;  4U2T A;  3BNU A;  2YG4 A;  1E1N A;  1DJQ A;  1IUU A;  2YVF A;  3LJP A;  2YLR A;  4YKG A;  2YLS A;  2BK3 A;  1DJN A;  1PDH A;  3F8P A;  4FK1 C;  5U1O A;  2GMJ A;  3H4K A;  4H4S A;  2XVH A;  2XYO A;  3L1R A;  2ZZ0 A;  3R9U A;  3LAD A;  1D7L A;  2GRT A;  1KNP A;  4A9W A;  1GPE A;  3URH A;  4J56 A;  4IVO B;  2WPF A;  3AD8 B;  4H2Q A;  4XWZ A;  3FBS A;  1SEZ A;  3IHM A;  3UKP A;  2JKC A;  1ZP0 A;  2WP6 A;  3AE6 A;  3UTH A;  4UDR A;  3VRB A;  3AD7 B;  1KSS A;  4A79 A;  3H8L A;  1F8W A;  3KKJ A;  4A6N B;  4BUR A;  5FS7 A;  3CGC A;  3P1W A;  3S5W A;  4Z2T A;  4LA1 A;  1OJA A;  1HYU A;  1VRQ B;  4USR A;  2CDU A;  4UDP A;  3CGB A;  3AE2 A;  3GRT A;  4DSH A;  2GAG B;  4Y4N A;  5JCN A;  2X8C A;  1FEC A;  2WBA A;  3LOV A;  1NAA A;  3ATQ A;  1BF3 A;  5FMH A;  3D1C A;  3EF6 A;  3OZ2 A;  2VRL A;  3NYC A;  5KOX A;  2EQ6 A;  3VRD B;  1ZY8 A;  1H86 A;  4OPI A;  5LV9 A;  3H8I A;  3GSI A;  2E4G A;  1XDI A;  2WP9 A;  2BAC A;  2CUL A;  3GYI A;  4TM1 A;  1PJ5 A;  1B4V A;  5FS9 A;  4EMI A;  2XLU A;  3P9U A;  4ICY A;  1PXC A;  3T37 A;  1L9E A;  1KFY A;  1YY5 A;  5KVH A;  4YXD A;  4GF7 A;  5BRT A;  2CFY A;  4H4Y A;  2A8X A;  1VDC A;  2BK5 A;  3PO7 A;  1H84 A;  4Z43 A;  1COY A;  1BZL A;  2VVM A;  3C4N A;  4PAB A;  4U8M A;  1O94 A;  1QO8 A;  1JU2 A;  1JRY A;  1S2Q A;  1ZMD A;  3ZYX A;  1B37 A;  4NEV A;  1PJ6 A;  3V3O A;  1OJC A;  4NTE A;  2C3D A;  1JEH A;  1W4X A;  4CCR A;  3F8R A;  2C3C A;  1ZK7 A;  3DK4 A;  2WEU A;  2EQ9 A;  1PBF A;  2OAL A;  2WQY A;  2V3B A;  3NYF A;  2JB2 A;  3ICT A;  4U8P A;  4EQW A;  4RG3 A;  5U63 A;  3VR9 A;  3LB8 A;  4H4Q A;  1REO A;  1ZDL A;  2YQU A;  4LII A;  3GWD A;  3C4A A;  4TM0 A;  4H7U A;  2IVE A;  3UOX A;  3S61 A;  4XWR A;  4IA5 A;  2V3A A;  4X4J A;  5JCL A;  2B7S A;  3ICS A;  1E1M A;  2OA1 A;  3KU9 A;  1PBE A;  4REK A;  1YKJ A;  3CNJ A;  3SQP A;  3VR8 A;  4K7Z A;  2WPC A;  2X50 A;  5FS8 A;  5U25 A;  3FPZ A;  3SM8 A;  1N4U A;  2WDQ A;  2RGH A;  4OVI A;  1Q1R A;  3NT6 A;  1EBD A;  1TRB A;  4N9X A;  4YTM A;  2AQJ A;  1GES A;  2B7R A;  2XLS A;  2WU5 A;  2VRM A;  3UCL A;  1LTX R;  2JB3 A;  4U8O A;  1OJT A;  2J3N A;  1KSU A;  4Z2R A;  1TDN A;  3BNM A;  2BXS A;  4HA6 A;  3AEA A;  3NRN A;  2C64 A;  4JNQ A;  4D04 A;  3NGC X;  1B5Q A;  2DKI A;  1PXB A;  4J57 A;  3NG7 X;  2GR0 A;  4TM3 A;  2YVG A;  4OPD A;  4CBQ A;  4KPR A;  2Q0K A;  2Y6R A;  3NKS A;  4U8J A;  1GAL A;  3DK8 A;  2AR8 A;  4Y4L A;  3AEG A;  1DXL A;  1E1K A;  1NG4 A;  1JRZ A;  4J2W A;  1D4C A;  5J7X A;  3P4P A;  2VVL A;  1PBD A;  4EQR A;  2X99 A;  4J31 A;  4AOX A;  3GWF A;  3EAN A;  1DOD A;  4Y4M A;  4I58 A;  5IQ4 A;  3AEC A;  2YM2 A;  1EL5 A;  2GAH B;  1RYI A;  2VQ7 A;  3VQR A;  3ICR A;  4JDR A;  1ONF A;  4GDE A;  5HHF A;  2XFP A;  3ADA B;  2V61 A;  2VOU A;  1GND A;  3PS9 A;  3NK0 X;  1IUX A;  1E1L A;  2V60 A;  2EQ8 A;  1QLB A;  3AYL A;  4B63 A;  5EB4 A;  1K0L A;  2YLZ A;  3M12 A;  3BI4 A;  4H4P A;  1JOA A;  1L9D A;  1OJD A;  4TM4 A;  4BK2 A;  4YSY A;  2XFN A;  1MO9 A;  2JK6 A;  4O5U A;  4JY2 A;  4WCT A;  4DNA A;  3RNM A;  3ISH A;  4UDQ A;  2R0G A;  4I59 A;  1Q9I A;  2V6O A;  2ZZC A;  1IJH A;  3UP5 A;  1UKV G;  3K30 A;  4CCQ A;  1DOC A;  4YSZ A;  2B9Y A;  2FJA A;  2WHD A;  3KD9 A;  2QCU A;  5HYM A;  3L8K A;  1NHQ A;  1GTH A;  3DGZ A;  4JQ9 A;  1H7W A;  1CJ3 A;  4EM4 A;  4J33 A;  3CN8 A;  2WS3 A;  3FIM B;  1ELI A;  3KPF A;  2R0P A;  3PVC A;  1CJ4 A;  2WOV A;  1FOH A;  3GD4 A;  2NPX A;  3V3N A;  3UKK A;  3QSE A;  4EM3 A;  1KF6 A;  3CND A;  4X9N A;  1CF3 A;  3WE0 A;  2Y6Q A;  2FJB A;  3UKL A;  2W0H A;  1RSG A;  2QAE A;  4DGK A;  4OPU A;  3AE9 A;  1GER A;  2X3N A;  5J60 A; 
#chains in the Genus database with same CATH topology
 4K8G A;  2BK4 A;  3AE4 A;  1DOB A;  1SJD A;  3Q4D A;  1Y0P A;  3RED A;  3FMW A;  4GYP A;  3NVV B;  3NH3 X;  3AN1 A;  4G6G A;  4ENL A;  4ROP A;  2FKP A;  4B1B A;  1DTN A;  3L5O A;  3TTE A;  3TOY A;  3SZW A;  4M6U A;  1CC4 A;  3P4R A;  1V59 A;  4BV6 A;  4AOS A;  4GGB A;  1YQ4 A;  1Q1W A;  3IJQ A;  3GMB A;  3RRA A;  3SSZ A;  5KMQ A;  2QJJ A;  2P88 A;  3DA1 A;  3CNP A;  3NIX A;  5ER0 A;  3NTD A;  3UKH A;  2YLX A;  3ENL A;  3SN1 A;  2ACZ A;  5HY5 A;  2XLP A;  3C96 A;  3ALJ A;  4IT1 A;  4FX9 A;  1E7P A;  2GL5 A;  2JB1 A;  2PMQ A;  4YSX A;  3CGD A;  4Z26 A;  3CPI G;  4B65 A;  3NLC A;  3UJS A;  3S5S A;  1GV4 A;  1P48 A;  3FXG A;  2YM1 A;  2BCG G;  3PG6 A;  1N5X A;  3JW7 A;  1CL0 A;  4A7A A;  1ZX9 A;  1L9C A;  3G5Q A;  4U2L A;  3UJE A;  2P0I A;  4NTC A;  2EQ7 A;  2PTY A;  1Z6L A;  2R9Z A;  5FJU A;  2YG6 A;  4J1O A;  3DH9 A;  1S3E A;  2CVJ A;  2E5V A;  1SB3 B;  5JCM A;  2YWL A;  1TKK A;  4GYP C;  3R1Z A;  1GOS A;  4OPC A;  4GUV A;  1EBG A;  4ADW A;  5KMR A;  2JAE A;  4O5Q A;  4YTN A;  4B67 A;  4K5R A;  3EEZ A;  1F8R A;  2DKH A;  3LZX A;  1X2H A;  3B97 A;  1TDK A;  3AEF A;  1K0J A;  3DG3 A;  2XLT A;  3ALL A;  3CIR A;  3KUM A;  3NNE A;  2GQF A;  3QVR A;  1IUT A;  1NPX A;  3F8D A;  2GV8 A;  2OLA A;  1N4V A;  1BQG A;  5BUK A;  3GRS A;  4H4U A;  4UP3 A;  1JDF A;  4GRT A;  3MUC A;  2RGO A;  4X2P A;  4NZH A;  3CB3 A;  4C3Y A;  1N1P A;  4H2R A;  4HCD A;  2H88 A;  1P2H A;  2Q7V A;  3M0O A;  4KWS A;  3UP4 A;  1H81 A;  2FBW A;  4XXG A;  3UXL A;  3HRD C;  4IP5 A;  3AXB A;  4II2 A;  4B66 A;  1WUF A;  3P4Q A;  4G73 A;  2GGG A;  4WX1 A;  4ZCD A;  4G74 A;  1EL8 A;  4TVY A;  1L0V A;  1ZKQ A;  3RP6 A;  2WET A;  3QFA A;  1MRA A;  4X9M A;  1LPF A;  1CC2 A;  4MMW A;  3SFE A;  1WYG A;  2OLO A;  4J36 A;  4AP3 A;  1K0I A;  2TMD A;  2W3R A;  1PBB A;  1PBC A;  3ITJ A;  1P2E A;  2PHH A;  3BOX A;  3QFB A;  5HXI A;  2E1M A;  2GDQ A;  1XAN A;  3E1T A;  2XLR A;  2BC0 A;  3IC9 A;  2GR3 A;  4J34 A;  4A65 A;  1OJ9 A;  2YG4 A;  2YLS A;  2BK3 A;  3U9I A;  2GMJ A;  3L1R A;  4A9W A;  3NXL A;  1GPE A;  4J56 A;  4IVO B;  4XWZ A;  3UKP A;  2WP6 A;  3AD7 B;  1W6T A;  3H8L A;  3H7V A;  4BUR A;  2OFJ A;  4Z2T A;  4LA1 A;  1R0M A;  1HYU A;  4USR A;  4DSH A;  2X8C A;  3LOV A;  1BF3 A;  3D1C A;  1P43 A;  3NVZ B;  2VRL A;  5BOE A;  3NYC A;  5KOX A;  1ZY8 A;  1ELS A;  5FS9 A;  4EMI A;  3P9U A;  1PXC A;  1KFY A;  2PA6 A;  4Z17 A;  5BRT A;  2CFY A;  3OTR A;  5EU9 A;  2BK5 A;  1H84 A;  4PAB A;  1B37 A;  4NTE A;  4CCR A;  1PBF A;  2WQY A;  1T3Q C;  2V3B A;  3ICT A;  4GAV A;  3R07 C;  3OZM A;  4X4J A;  2GGH A;  1E1M A;  2OA1 A;  3KU9 A;  3VR8 A;  3CNJ A;  3SQP A;  3FPZ A;  2X50 A;  2PPG A;  2WDQ A;  2RGH A;  4OVI A;  1Q1R A;  1EBD A;  2VRM A;  2E3T A;  1NU5 A;  1KSU A;  1TDN A;  1PDZ A;  3AEA A;  2OZ3 A;  2DKI A;  3NG7 X;  2GR0 A;  2YVG A;  1GAL A;  3RGT A;  2GGE A;  3A7U A;  1JRZ A;  1D4C A;  2PP0 A;  3GWF A;  4KPL A;  2YM2 A;  4GDE A;  5HHF A;  2XFP A;  4M0X A;  3VC5 A;  1K0L A;  3M12 A;  3BI4 A;  2HZG A;  4H4P A;  5FJT A;  1JOA A;  4G9K A;  3CYJ A;  4JY2 A;  4DNA A;  4UDQ A;  3UP5 A;  3K30 A;  1DOC A;  2B9Y A;  2PS2 A;  4EWJ A;  2QCU A;  5HYM A;  1H7W A;  3FIM B;  1N5W C;  5JRB A;  1FOH A;  3GD4 A;  1KF6 A;  1CF3 A;  1F9C A;  1JCT A;  2QAE A;  4DGK A;  3AE9 A;  5J60 A;  3T2Y A;  4G7F A;  4B68 A;  1STZ A;  1GRT A;  3MY9 A;  3H8A A;  3P4S A;  4DN1 A;  4E0V A;  1N60 C;  3K7Q X;  5TR3 A;  5KOW A;  1LJ1 A;  3COX A;  4K22 A;  2XFO A;  3IF9 A;  2YAU A;  3GO2 A;  2QGY A;  2VVL G;  1SJB A;  1EL7 A;  3IK4 A;  2H89 A;  1H83 A;  3Q6J A;  2AL2 B;  2OO6 A;  4Z24 A;  1ZOY A;  4IP4 A;  1D5T A;  4EIP A;  3VA8 A;  4AT2 A;  3T4W A;  1GET A;  2PU1 A;  4EMW A;  5BUL A;  2R45 A;  4Z2U A;  1JNR A;  1VDV A;  2YR4 A;  4EIQ A;  4MKS A;  3UTG A;  4LU6 A;  4H2P A;  2QA1 A;  3AYJ A;  4C5O A;  3AYI A;  3NHO X;  3HPF A;  3V5F A;  2GF3 A;  4E8G A;  3N6J A;  1GT8 A;  4GCM A;  2X8G A;  3QSM A;  1D4D A;  2QDD A;  2PYX A;  4CNJ A;  1NEL A;  3AWI A;  2BCP A;  4ZOH B;  2Z5Y A;  3K7M X;  3KA7 A;  3NN6 X;  5GSN A;  1IYX A;  1GRH A;  4E6M A;  1XHC A;  2XGZ A;  4H2N A;  3CNS A;  3B6D A;  3G5S A;  3AB1 A;  3R0U A;  4PAA A;  2E5A A;  1BGJ A;  2TPR A;  4MGG A;  3SJN A;  5EOW A;  3U4F A;  3AE1 A;  4HNL A;  2Q0L A;  1WUE A;  2UZZ A;  2POZ A;  1FEB A;  3AD9 B;  1S2Y A;  1YQ3 A;  2QJM A;  3CAW A;  3BI5 A;  3BI2 A;  4Z44 A;  3SFD A;  4B64 A;  1PJ7 A;  3DJJ A;  3SGL A;  3DGH A;  3JZU A;  4H50 A;  2WDV A;  4H83 A;  4IVM B;  4GDP A;  4OCG A;  4U8N A;  2PTW A;  4J3Z A;  1KCZ A;  2C76 A;  3RP8 A;  3NK1 X;  1H6V A;  2C65 A;  3VRA A;  3ZLF A;  3EAO A;  2I0Z A;  3DDM A;  4FK1 A;  2OAM A;  4H4Z A;  3EKG A;  1XPY A;  3DME A;  4DHG A;  3UTE A;  2RAB A;  4ZN0 A;  3I3L A;  2NQL A;  5KRQ A;  1VG9 A;  4NTD A;  1N4W A;  5BOF A;  4BK1 A;  5IPY A;  2XH2 A;  4BK3 A;  1DNC A;  1NDA A;  1EBH A;  4K8D A;  3QN3 A;  5ENL A;  4U2S A;  2XH7 A;  2C7G A;  3D8X A;  4HYR A;  3R11 A;  4H4X A;  4GGH A;  3GMC A;  4K2S A;  5BVA A;  3OZY A;  2O9Z A;  1GRE A;  3AE7 A;  4AP1 A;  3NTA A;  1GRA A;  4OPT A;  3BHK A;  3UKF A;  1FCD A;  2OKT A;  3T31 A;  1D4E A;  2C67 A;  2Z5X A;  3HZL A;  3SXI A;  3QSS A;  2C66 A;  1NHR A;  2B9W A;  2YR6 A;  2V5Z A;  3DJG X;  3CTY A;  4K5S A;  1GRB A;  3GYX A;  1N62 C;  1H7X A;  3GD6 A;  3HYV A;  3DG7 A;  3O0H A;  3ZDN A;  3CT2 A;  4H19 A;  2AAQ A;  4CY8 A;  5GRT A;  1PN0 A;  4A99 A;  4E4F A;  3V5C A;  3DG6 A;  3ZVH A;  2YVF A;  3DFH A;  4FK1 C;  3H4K A;  4H4S A;  2XYO A;  1SJA A;  3LAD A;  1KNP A;  2GRT A;  3FBS A;  1SEZ A;  3IHM A;  3RIT A;  1N63 C;  1R6W A;  3AE6 A;  3K1G A;  4UDR A;  3VRB A;  3T9P A;  3CGC A;  3P1W A;  2GAG B;  5JCN A;  4E4U A;  2O56 A;  3EF6 A;  4JN8 A;  3OZ2 A;  2EQ6 A;  3VRD B;  2BAC A;  2CUL A;  3EUB 3;  1PJ5 A;  5KVH A;  3TWA A;  1TZZ A;  1COY A;  3C4N A;  4U8M A;  1O94 A;  1JU2 A;  4NEV A;  1OJC A;  3SBF A;  2C3D A;  3VFC A;  2XSX A;  2GGJ A;  2YQU A;  4LII A;  3C4A A;  2IVE A;  4IA5 A;  2HNE A;  4REK A;  1YKJ A;  4K7Z A;  2WPC A;  1N4U A;  3NT6 A;  2POD A;  3UCL A;  1LTX R;  3ZLH A;  4U8O A;  4HNC A;  3CMM A;  3BNM A;  3TJ4 A;  2BXS A;  3NRN A;  2C64 A;  3NGC X;  3MSY A;  4CBQ A;  4U8J A;  3DK8 A;  2AKZ A;  4J31 A;  4EQR A;  3EAN A;  5KMP A;  4I58 A;  4NNJ A;  5IQ4 A;  3AEC A;  1EL5 A;  1RYI A;  2QQ6 A;  4JDR A;  3PS9 A;  1GND A;  1RM6 B;  2EQ8 A;  3AYL A;  3QKE A;  4TM4 A;  4YSY A;  2JK6 A;  3FYY A;  3RNM A;  2R0G A;  4I59 A;  2V6O A;  1IJH A;  3A7R A;  1XS2 A;  3L8K A;  1NHQ A;  4JQ9 A;  3SQS A;  3CN8 A;  1ELI A;  2WOV A;  3SR6 B;  3UKK A;  3CND A;  3WE0 A;  2FJB A;  2W0H A;  4JHM A;  1RSG A;  2YLT A;  4GAP A;  1YQZ A;  1NEK A;  1FEA A;  3N4E A;  2C73 A;  2VQB A;  5EB5 A;  4K2X A;  3T2K A;  3GD3 A;  2IID A;  1F8S A;  1M64 A;  3UJ2 A;  3FJ4 A;  2R4E A;  5KVI A;  5KXJ A;  3S47 A;  3ABV A;  2YVJ A;  3PWG A;  1X31 B;  1H2I A;  3ETR B;  1LQT A;  1NHP A;  1LVL A;  1TE6 A;  2HQM A;  3FV9 A;  2XCG A;  3R10 A;  2Q6U A;  3B3R A;  2XDO A;  2OPJ A;  1KKR A;  3AE5 A;  2PTZ A;  3DES A;  5KNL A;  2OQH A;  2A89 A;  2GQW A;  2BS3 A;  1CHU A;  2FYM A;  4U8K A;  1FL2 A;  2F5Z A;  3ALM A;  3MQT A;  2MUC A;  3NYE A;  1MXT A;  2P8B A;  1TYT A;  2WOW A;  1NEN A;  3FCP A;  1TDO A;  2BS2 A;  4ECH A;  3DEQ A;  2OVL A;  3NK2 X;  4USQ A;  2FJD A;  3UOV A;  2RDX A;  3BHF A;  1E6E A;  4HB9 A;  3GDP A;  3TJI A;  3GDN A;  1PXA A;  3SZC A;  2GEW A;  2C72 A;  6ENL A;  2BS4 A;  4RSL A;  1GRF A;  4JN9 A;  1Y56 A;  2GB0 A;  3DIP A;  3V3W A;  2GMH A;  3DGB A;  1EC9 A;  2NVK X;  1K4Q A;  1FFV C;  3M13 A;  2XFQ A;  3UTF A;  4BJZ A;  4YWS A;  4YKF A;  5J04 A;  4A6G A;  4Z25 A;  4IL2 A;  3OPS A;  1VQW A;  2C4C A;  3V76 A;  4JNA A;  3PFR A;  3UKA A;  1ONE A;  2RGJ A;  1GTE A;  1JNZ A;  3DFY A;  1EL9 A;  1PS9 A;  2R46 A;  3CPJ G;  1FO4 A;  3R0K A;  5M0Z A;  3V4B A;  2W3S A;  3RHA A;  4RG4 A;  5EBK A;  1IUW A;  2WU2 A;  4D03 A;  4JY3 A;  3THU A;  2AKM A;  1VG0 A;  2ARD A;  3QJ4 A;  4Z1Y A;  3ZVI A;  2OX4 A;  1CC6 A;  2FJE A;  3Q9T A;  3QVP A;  1S7M A;  1IUS A;  5FS6 A;  4HCL A;  2ZC8 A;  4YSH A;  1MDR A;  2JBV A;  3DJE A;  3LXD A;  2QA2 A;  4B69 A;  3STP A;  1MUC A;  4U8I A;  3LZW A;  2BYB A;  1JPM A;  1TDE A;  1QJD A;  1RP0 A;  4ZA0 A;  4EQS A;  5L46 A;  3DK9 A;  3K7T A;  4IA6 A;  3P93 A;  3KVE A;  5IQ1 A;  4K1W A;  4A6N A;  4A3R A;  4MJW A;  2I5Q A;  1JRO A;  3SX6 A;  1M6I A;  3FG2 P;  3I6T A;  2DW7 A;  3GC2 A;  2WDR A;  1FIQ B;  4C3X A;  4H4W A;  3CGE A;  1XPQ A;  2BC1 A;  3ATR A;  3AEB A;  4A35 A;  5KWF A;  4U2T A;  1E1N A;  2P3Z A;  1IUU A;  2QVH A;  4YKG A;  1KKO A;  1L8P A;  1YEY A;  1DJN A;  3UJF A;  5U1O A;  2ZZ0 A;  3R9U A;  3MZN A;  1BKH A;  3MKC A;  3VC6 A;  4H2Q A;  2JKC A;  1ZP0 A;  3UTH A;  3OW1 A;  4KEM A;  3I6E A;  4A79 A;  1F8W A;  3KKJ A;  5FS7 A;  3Q45 A;  3S5W A;  1OJA A;  2CDU A;  4UDP A;  3CGB A;  4Y4N A;  2PSN A;  2WBA A;  3SN4 A;  1EC8 A;  3MWC A;  4DWD A;  2OZ8 A;  1H86 A;  5LV9 A;  3H8I A;  3GSI A;  4HCH A;  2E4G A;  1XDI A;  2WP9 A;  3GYI A;  4TM1 A;  1B4V A;  2XLU A;  4ICY A;  3T37 A;  1L9E A;  3DER A;  1YY5 A;  4TVW A;  4GF7 A;  2ONE A;  3ZVH B;  3IJL A;  4H4Y A;  2A8X A;  4ZCW A;  1BZL A;  2VVM A;  1N61 C;  3ZYX A;  1ZMD A;  1PJ6 A;  3V3O A;  1W4X A;  2C3C A;  3DK4 A;  2WEU A;  2EQ9 A;  2OAL A;  3NYF A;  2JB2 A;  4EQW A;  4RG3 A;  5U63 A;  3VR9 A;  3LB8 A;  4H4Q A;  1REO A;  1ZDL A;  3BJS A;  4H7U A;  2OQY A;  3UXK A;  3UOX A;  2W55 A;  1KN0 A;  4XWR A;  2V3A A;  3ICS A;  2B7S A;  3SYI A;  1ECQ A;  5FS8 A;  3SM8 A;  2AQJ A;  2B7R A;  2WU5 A;  1OJT A;  2J3N A;  4Z2R A;  3TQP A;  4JNQ A;  1PXB A;  3NFU A;  2Q0K A;  2Y6R A;  4Y4L A;  1DXL A;  3QTP A;  1E1K A;  1NG4 A;  5J7X A;  4AOX A;  3UCD A;  4Y4M A;  1DOD A;  3B9J B;  3H12 A;  2VQ7 A;  2VOU A;  3CXB A;  2PTX A;  2PGE A;  1SJC A;  1IUX A;  1E1L A;  1QLB A;  2YLZ A;  3UCC A;  1L9D A;  3PWI A;  1MNS A;  1OJD A;  2XFN A;  4O5U A;  1Q9I A;  4CCQ A;  3SY4 A;  2FJA A;  2WHD A;  3DGZ A;  1GTH A;  1CJ3 A;  4EM4 A;  4J33 A;  2HXU A;  4DYE A;  3KPF A;  2R0P A;  2NPX A;  3QSE A;  4X9N A;  3UKL A;  2OG9 A;  3VCN A;  2APG A;  2BXR A;  3VCC A;  2GGI A;  3UJR A;  2BRY A;  3I4K A;  3T6C A;  3NZG A;  1MOK A;  5DBJ A;  4IZG A;  1NHS A;  4EQX A;  4KX6 A;  1MDL A;  1CBO A;  3FVD A;  3NN0 X;  2BA9 A;  1KDG A;  1B8S A;  3T2Z A;  4KT2 A;  4APN A;  3DJD A;  1ZOV A;  4DSG A;  1E9I A;  4OPG A;  2ZZB A;  3KLJ A;  4H4R A;  1TDF A;  2YR5 A;  3CPH G;  2IVD A;  2YG3 A;  5JCI A;  3IJI A;  5G5H B;  2YLW A;  2WES A;  2YG5 A;  4HN8 A;  1GRG A;  3I6D A;  3IWA A;  4YTP A;  1NG3 A;  4DXK A;  1PHH A;  2AL1 A;  4G8T A;  3TWB A;  5JCK A;  2CHR A;  5C2T A;  2A87 A;  5CKU A;  4GR1 A;  4YT0 A;  2XVE A;  3GY1 A;  1TYP A;  1CJ2 A;  4M52 A;  3ES8 A;  4CRT A;  4AT0 A;  4C74 A;  4DX3 A;  4EMJ A;  1JRP A;  1ZXI C;  3D9X A;  1BKW A;  4U8L A;  2PCE A;  4A5L A;  1GXF A;  4TLZ A;  4IV9 A;  1FHU A;  1BGN A;  3KPK A;  1DOE A;  3CXO A;  2GR1 A;  2GR2 A;  5FJP A;  2XFU A;  3CK5 A;  4G6H A;  1GEU A;  5FJO A;  2PP1 A;  5FJR A;  3AED A;  1D7Y A;  3G5R A;  4GME A;  4NEW A;  3AE8 A;  2OLN A;  3UOY A;  3ZLG A;  3CNT A;  1E39 A;  2R0C A;  3TW9 A;  3GYJ A;  1AOG A;  3NO1 A;  5KMS A;  4TLX A;  3EPT A;  4IHC A;  2XH0 A;  1GSN A;  4ZCC A;  1ZMC A;  3RP7 A;  1KNR A;  2WPE A;  2B76 A;  1VQZ A;  3OC4 A;  4H1Z A;  2B9X A;  3UOZ A;  5CQF A;  2XVF A;  5M10 A;  2PU0 A;  3AMZ A;  5C3J A;  2WP5 A;  1O95 A;  2VZ2 A;  1Y56 B;  3TCS A;  2ZBW A;  2C70 A;  3P3B A;  3T14 A;  3II4 A;  4GFI A;  2BRA A;  1F3P A;  2X8H A;  1RVK A;  1CJC A;  4C77 A;  2YG7 A;  3UKQ A;  1PDY A;  1F6M A;  3HYX A;  3H70 A;  3N6H A;  1LQU A;  4H4T A;  3JSK A;  1O5W A;  1LV0 A;  4FDC B;  4YWO A;  2GH5 A;  4H2H A;  4H4V A;  3AEE A;  2R4J A;  2XVJ A;  3IHG A;  2C75 A;  4OPL A;  2WOI A;  2BAB A;  4FP1 A;  1OEP A;  1S3B A;  1IUV A;  4CNK A;  4HPN A;  2W54 A;  4CY6 A;  1H82 A;  4F4R A;  2DW6 A;  2XVI A;  4BJY A;  2GVC A;  4II3 A;  3AE3 A;  1BWC A;  3SZ0 A;  1JRX A;  4P9S A;  3BNU A;  1DJQ A;  3LJP A;  2YLR A;  3PK7 A;  3QLD A;  1PDH A;  5IDZ A;  3ES7 A;  3F8P A;  2XVH A;  1D7L A;  3N4F A;  3URH A;  3BSM A;  2WPF A;  3AD8 B;  3T0K A;  3UGV A;  1KSS A;  3OP2 A;  4A6N B;  3A7A A;  1FHV A;  4GIR A;  1VRQ B;  3AE2 A;  3GRT A;  4JN7 A;  4FI4 A;  1FEC A;  1NAA A;  3ATQ A;  5FMH A;  4OPI A;  3RCY A;  3SN0 A;  3D47 A;  3HYW A;  1V97 A;  3AM9 A;  3NVW B;  4YXD A;  1JPD X;  3RR1 A;  3NS1 B;  1VDC A;  2HXT A;  3PO7 A;  4IL0 A;  4Z43 A;  1QO8 A;  1JRY A;  1S2Q A;  3HW2 A;  1JEH A;  3F8R A;  1ZK7 A;  2XH4 A;  4U8P A;  1X2G A;  3GWD A;  4TM0 A;  3S61 A;  5JCL A;  1PBE A;  2MNR A;  5U25 A;  4N9X A;  1TRB A;  4YTM A;  1GES A;  2XLS A;  2JB3 A;  3P0W A;  4HA6 A;  4D04 A;  1B5Q A;  4J57 A;  3QPE A;  2ZAD A;  4TM3 A;  4OPD A;  4KPR A;  3NKS A;  5G5G B;  2AR8 A;  3RO6 A;  3AEG A;  2QDE A;  4J2W A;  3P4P A;  2VVL A;  1PBD A;  2X99 A;  2GSH A;  4E5T A;  3JVA A;  4GIS A;  2GAH B;  3VQR A;  3ICR A;  1ONF A;  3ADA B;  2V61 A;  2QJN A;  4NWZ A;  2P8C A;  3NK0 X;  2V60 A;  4B63 A;  3R25 A;  5EB4 A;  3VDG A;  3T8Q A;  3SZF A;  2PGW A;  4BK2 A;  2PP3 A;  1MO9 A;  2AL2 A;  3NVY B;  4WCT A;  3D46 A;  3ISH A;  2ZZC A;  1UKV G;  4YSZ A;  3KD9 A;  2WS3 A;  1FFU C;  3NRZ B;  1EC7 A;  3PVC A;  2OZT A;  1CJ4 A;  3V3N A;  4EM3 A;  7ENL A;  1KD0 A;  2Y6Q A;  4OPU A;  1GER A;  2X3N A; 
#chains in the Genus database with same CATH homology
 1YQZ A;  1NEK A;  1FEA A;  3T2Y A;  2C73 A;  2VQB A;  4B68 A;  5EB5 A;  1GRT A;  2APG A;  2BXR A;  2BK4 A;  4K2X A;  3T2K A;  2BRY A;  3GD3 A;  2IID A;  1F8S A;  1M64 A;  3AE4 A;  3P4S A;  1DOB A;  2R4E A;  4E0V A;  1Y0P A;  3K7Q X;  3RED A;  3FMW A;  5TR3 A;  1MOK A;  5DBJ A;  5KOW A;  1NHS A;  5KVI A;  4EQX A;  3NH3 X;  4KX6 A;  5KXJ A;  1CBO A;  1LJ1 A;  3NN0 X;  4G6G A;  2BA9 A;  1KDG A;  2YLT A;  3COX A;  1B8S A;  3ABV A;  4APN A;  3DJD A;  4K22 A;  3T2Z A;  2XFO A;  3L5O A;  4B1B A;  3IF9 A;  2YAU A;  2YVJ A;  1ZOV A;  2VVL G;  1X31 B;  4DSG A;  3SZW A;  1H2I A;  4OPG A;  2ZZB A;  1LQT A;  1NHP A;  3KLJ A;  1EL7 A;  1CC4 A;  4H4R A;  1TDF A;  1LVL A;  2H89 A;  2YR5 A;  3CPH G;  2IVD A;  1H83 A;  3P4R A;  3Q6J A;  1V59 A;  4BV6 A;  2YG3 A;  2HQM A;  4Z24 A;  4AOS A;  1YQ4 A;  2XCG A;  5JCI A;  1Q1W A;  1ZOY A;  2Q6U A;  3GMB A;  2YLW A;  2WES A;  2YG5 A;  5KMQ A;  1GRG A;  3B3R A;  2XDO A;  1D5T A;  3DA1 A;  3I6D A;  3IWA A;  4EIP A;  4YTP A;  3CNP A;  4AT2 A;  1NG3 A;  1PHH A;  3NIX A;  5ER0 A;  3AE5 A;  3NTD A;  3UKH A;  1GET A;  2YLX A;  4EMW A;  5BUL A;  5KNL A;  2R45 A;  2ACZ A;  2A89 A;  5HY5 A;  2GQW A;  2XLP A;  5JCK A;  3C96 A;  2BS3 A;  3ALJ A;  4Z2U A;  1CHU A;  1JNR A;  4U8K A;  1FL2 A;  5C2T A;  2YR4 A;  4EIQ A;  2F5Z A;  3ALM A;  2A87 A;  5CKU A;  4FX9 A;  1E7P A;  2JB1 A;  4LU6 A;  3UTG A;  4YSX A;  3NYE A;  3CGD A;  4H2P A;  4Z26 A;  2QA1 A;  1MXT A;  3CPI G;  4GR1 A;  4B65 A;  3AYJ A;  3NLC A;  4YT0 A;  1TYT A;  2WOW A;  1NEN A;  2BS2 A;  1TDO A;  2XVE A;  1GV4 A;  4ECH A;  3NK2 X;  1TYP A;  1CJ2 A;  2YM1 A;  4USQ A;  4M52 A;  2FJD A;  3AYI A;  3UOV A;  3NHO X;  2BCG G;  4C5O A;  3PG6 A;  4CRT A;  4AT0 A;  2GF3 A;  3BHF A;  1GT8 A;  4C74 A;  1CL0 A;  4EMJ A;  1E6E A;  1ZX9 A;  4A7A A;  4HB9 A;  1L9C A;  4GCM A;  3D9X A;  1BKW A;  3GDP A;  4U8L A;  3G5Q A;  2X8G A;  3QSM A;  1D4D A;  4U2L A;  4A5L A;  3GDN A;  2PYX A;  4NTC A;  2EQ7 A;  1Z6L A;  2R9Z A;  1GXF A;  1PXA A;  4CNJ A;  3SZC A;  2YG6 A;  4TLZ A;  3AWI A;  3DH9 A;  2BCP A;  2C72 A;  2GEW A;  1S3E A;  2Z5Y A;  1BGN A;  3K7M X;  3KA7 A;  3NN6 X;  2BS4 A;  4IV9 A;  4RSL A;  1GRF A;  1GRH A;  4JN9 A;  2CVJ A;  2E5V A;  1XHC A;  5GSN A;  3KPK A;  1Y56 A;  4H2N A;  3CNS A;  3B6D A;  5JCM A;  3G5S A;  3AB1 A;  1DOE A;  2YWL A;  2GB0 A;  4PAA A;  1BGJ A;  2TPR A;  2GMH A;  2NVK X;  1K4Q A;  2GR1 A;  3M13 A;  1GOS A;  2GR2 A;  2XFQ A;  3UTF A;  4BJZ A;  4OPC A;  4GUV A;  4YKF A;  5EOW A;  3AE1 A;  2Q0L A;  4ADW A;  4Z25 A;  2UZZ A;  2XFU A;  5KMR A;  4G6H A;  1FEB A;  3AD9 B;  1S2Y A;  1YQ3 A;  1VQW A;  2C4C A;  3V76 A;  2JAE A;  1GEU A;  4O5Q A;  4JNA A;  4YTN A;  4B67 A;  4K5R A;  1F8R A;  3UKA A;  3BI5 A;  3BI2 A;  2DKH A;  3AED A;  3LZX A;  4Z44 A;  3SFD A;  4B64 A;  1D7Y A;  3G5R A;  4NEW A;  3AE8 A;  2RGJ A;  1PJ7 A;  1GTE A;  2OLN A;  3UOY A;  3DJJ A;  1TDK A;  3SGL A;  3DGH A;  3AEF A;  1K0J A;  3CNT A;  1E39 A;  2XLT A;  4H50 A;  3ALL A;  2R0C A;  2WDV A;  1JNZ A;  1EL9 A;  3CIR A;  3GYJ A;  1AOG A;  5KMS A;  3NNE A;  4TLX A;  1PS9 A;  2R46 A;  3CPJ G;  3EPT A;  1GSN A;  2GQF A;  3QVR A;  1IUT A;  4ZCC A;  1NPX A;  3F8D A;  1ZMC A;  5M0Z A;  3RP7 A;  1KNR A;  2WPE A;  4IVM B;  2GV8 A;  4GDP A;  2B76 A;  4OCG A;  4U8N A;  3OC4 A;  3RHA A;  2B9X A;  4RG4 A;  2C76 A;  5EBK A;  1IUW A;  3RP8 A;  1N4V A;  2WU2 A;  4JY3 A;  4D03 A;  3NK1 X;  3UOZ A;  1H6V A;  2C65 A;  5CQF A;  1VG0 A;  2XVF A;  5M10 A;  3VRA A;  5BUK A;  3GRS A;  5C3J A;  2WP5 A;  4H4U A;  2ARD A;  3QJ4 A;  4UP3 A;  4GRT A;  1O95 A;  2VZ2 A;  3EAO A;  2I0Z A;  1Y56 B;  4FK1 A;  1CC6 A;  2FJE A;  2ZBW A;  3Q9T A;  2RGO A;  2C70 A;  2OAM A;  3QVP A;  4H4Z A;  4NZH A;  4C3Y A;  1S7M A;  3DME A;  3UTE A;  1IUS A;  3T14 A;  5FS6 A;  1N1P A;  3II4 A;  2RAB A;  2BRA A;  4H2R A;  4ZN0 A;  3I3L A;  4YSH A;  1F3P A;  2H88 A;  1P2H A;  5KRQ A;  2Q7V A;  3M0O A;  1VG9 A;  4NTD A;  3UP4 A;  2JBV A;  3DJE A;  1N4W A;  2X8H A;  4BK1 A;  5IPY A;  3LXD A;  2QA2 A;  4B69 A;  1CJC A;  1H81 A;  2FBW A;  4BK3 A;  4U8I A;  1DNC A;  4C77 A;  1NDA A;  2YG7 A;  4XXG A;  4K8D A;  3UKQ A;  1F6M A;  3HYX A;  4U2S A;  3LZW A;  3AXB A;  2C7G A;  4II2 A;  3D8X A;  4B66 A;  3P4Q A;  4H4X A;  1LQU A;  2BYB A;  4G73 A;  1TDE A;  1QJD A;  4H4T A;  3GMC A;  3JSK A;  1O5W A;  1RP0 A;  1LV0 A;  4FDC B;  5BVA A;  4EQS A;  4YWO A;  2GH5 A;  5L46 A;  4WX1 A;  3DK9 A;  2O9Z A;  1GRE A;  4ZCD A;  4H4V A;  3AE7 A;  3K7T A;  4AP1 A;  3NTA A;  1GRA A;  4OPT A;  3AEE A;  2R4J A;  2XVJ A;  3BHK A;  3KVE A;  1FCD A;  4G74 A;  4IA6 A;  3UKF A;  1EL8 A;  3IHG A;  5IQ1 A;  3T31 A;  1L0V A;  1D4E A;  2C67 A;  2Z5X A;  1ZKQ A;  2C75 A;  3HZL A;  3SXI A;  4A6N A;  4OPL A;  3RP6 A;  2WET A;  3QFA A;  3QSS A;  2C66 A;  4MJW A;  4X9M A;  1LPF A;  1NHR A;  2WOI A;  1CC2 A;  2B9W A;  2BAB A;  2YR6 A;  3SFE A;  1M6I A;  1S3B A;  3SX6 A;  2V5Z A;  3DJG X;  3FG2 P;  2OLO A;  1IUV A;  4CNK A;  4J36 A;  4AP3 A;  1K0I A;  3CTY A;  4K5S A;  2TMD A;  1GRB A;  1PBB A;  3GYX A;  4CY6 A;  1H82 A;  2WDR A;  1PBC A;  3ITJ A;  1P2E A;  2PHH A;  1H7X A;  3QFB A;  5HXI A;  2E1M A;  4C3X A;  3HYV A;  4H4W A;  1XAN A;  2XVI A;  3O0H A;  3E1T A;  3ZDN A;  4CY8 A;  2AAQ A;  3CGE A;  5GRT A;  2XLR A;  2BC0 A;  1XPQ A;  4BJY A;  1PN0 A;  3IC9 A;  2GVC A;  4A99 A;  2BC1 A;  4II3 A;  3ATR A;  2GR3 A;  3AE3 A;  4J34 A;  1BWC A;  4A65 A;  1OJ9 A;  3SZ0 A;  1JRX A;  3AEB A;  5KWF A;  4P9S A;  4U2T A;  3BNU A;  2YG4 A;  1E1N A;  1DJQ A;  1IUU A;  2YVF A;  3LJP A;  2YLR A;  4YKG A;  2YLS A;  2BK3 A;  1DJN A;  1PDH A;  3F8P A;  4FK1 C;  5U1O A;  2GMJ A;  3H4K A;  4H4S A;  2XVH A;  2XYO A;  3L1R A;  2ZZ0 A;  3R9U A;  3LAD A;  1D7L A;  2GRT A;  1KNP A;  4A9W A;  1GPE A;  3URH A;  4J56 A;  4IVO B;  2WPF A;  3AD8 B;  4H2Q A;  4XWZ A;  3T0K A;  3FBS A;  1SEZ A;  3IHM A;  3UKP A;  2JKC A;  1ZP0 A;  2WP6 A;  3AE6 A;  3UTH A;  4UDR A;  3VRB A;  3AD7 B;  1KSS A;  4A79 A;  3H8L A;  1F8W A;  3KKJ A;  4A6N B;  4BUR A;  5FS7 A;  3CGC A;  3P1W A;  3S5W A;  4Z2T A;  4LA1 A;  1OJA A;  1HYU A;  1VRQ B;  4USR A;  2CDU A;  4UDP A;  3CGB A;  3AE2 A;  3GRT A;  4DSH A;  2GAG B;  4Y4N A;  5JCN A;  2X8C A;  1FEC A;  2WBA A;  3LOV A;  1NAA A;  3ATQ A;  1BF3 A;  5FMH A;  3D1C A;  3EF6 A;  3OZ2 A;  2VRL A;  3NYC A;  5KOX A;  2EQ6 A;  3VRD B;  1ZY8 A;  1H86 A;  4OPI A;  3HYW A;  5LV9 A;  3H8I A;  3GSI A;  2E4G A;  1XDI A;  2WP9 A;  2BAC A;  2CUL A;  3GYI A;  4TM1 A;  1PJ5 A;  1B4V A;  5FS9 A;  4EMI A;  2XLU A;  3P9U A;  4ICY A;  1PXC A;  3T37 A;  1L9E A;  1KFY A;  1YY5 A;  5KVH A;  4YXD A;  4GF7 A;  5BRT A;  2CFY A;  4H4Y A;  2A8X A;  1VDC A;  2BK5 A;  3PO7 A;  1H84 A;  4Z43 A;  1COY A;  1BZL A;  2VVM A;  3C4N A;  4PAB A;  4U8M A;  1O94 A;  1QO8 A;  1JU2 A;  1JRY A;  1S2Q A;  1ZMD A;  3ZYX A;  1B37 A;  4NEV A;  1PJ6 A;  3V3O A;  1OJC A;  4NTE A;  2C3D A;  1JEH A;  1W4X A;  4CCR A;  3F8R A;  2C3C A;  1ZK7 A;  3DK4 A;  2WEU A;  2EQ9 A;  1PBF A;  2OAL A;  2WQY A;  2V3B A;  3NYF A;  2JB2 A;  3ICT A;  4U8P A;  4EQW A;  4RG3 A;  5U63 A;  4GAV A;  3VR9 A;  3LB8 A;  4H4Q A;  1REO A;  1ZDL A;  2YQU A;  4LII A;  3GWD A;  3C4A A;  4TM0 A;  4H7U A;  2IVE A;  3UOX A;  1KN0 A;  3S61 A;  4XWR A;  4IA5 A;  2V3A A;  4X4J A;  5JCL A;  2B7S A;  3ICS A;  1E1M A;  2OA1 A;  3KU9 A;  1PBE A;  4REK A;  4GAP A;  3SYI A;  1YKJ A;  3CNJ A;  3SQP A;  3VR8 A;  4K7Z A;  2WPC A;  2X50 A;  5FS8 A;  5U25 A;  3FPZ A;  3SM8 A;  1N4U A;  2WDQ A;  2RGH A;  4OVI A;  1Q1R A;  3NT6 A;  1EBD A;  1TRB A;  4N9X A;  4YTM A;  2AQJ A;  1GES A;  2B7R A;  2XLS A;  2WU5 A;  2VRM A;  3UCL A;  1LTX R;  2JB3 A;  4U8O A;  1OJT A;  2J3N A;  1KSU A;  4Z2R A;  3CMM A;  1TDN A;  3BNM A;  2BXS A;  4HA6 A;  3AEA A;  3NRN A;  2C64 A;  4JNQ A;  4D04 A;  3NGC X;  1B5Q A;  2DKI A;  1PXB A;  4J57 A;  3NG7 X;  2GR0 A;  4TM3 A;  2YVG A;  4OPD A;  4CBQ A;  4KPR A;  2Q0K A;  2Y6R A;  3NKS A;  4U8J A;  1GAL A;  3DK8 A;  2AR8 A;  4Y4L A;  3AEG A;  1DXL A;  1E1K A;  1NG4 A;  1JRZ A;  4J2W A;  1D4C A;  5J7X A;  3P4P A;  2VVL A;  1PBD A;  4EQR A;  2X99 A;  4J31 A;  4AOX A;  3GWF A;  3EAN A;  1DOD A;  4Y4M A;  4I58 A;  4NNJ A;  5KMP A;  5IQ4 A;  3AEC A;  2YM2 A;  1EL5 A;  2GAH B;  1RYI A;  2VQ7 A;  3VQR A;  3ICR A;  4JDR A;  1ONF A;  4GDE A;  5HHF A;  2XFP A;  3ADA B;  2V61 A;  2VOU A;  1GND A;  3PS9 A;  4NWZ A;  3NK0 X;  1IUX A;  1E1L A;  2V60 A;  2EQ8 A;  1QLB A;  3AYL A;  4B63 A;  5EB4 A;  1K0L A;  2YLZ A;  3M12 A;  3BI4 A;  4H4P A;  1JOA A;  1L9D A;  3SZF A;  1OJD A;  4TM4 A;  4BK2 A;  4YSY A;  2XFN A;  4G9K A;  1MO9 A;  2JK6 A;  4O5U A;  4JY2 A;  4WCT A;  4DNA A;  3RNM A;  3ISH A;  4UDQ A;  2R0G A;  4I59 A;  1Q9I A;  2V6O A;  2ZZC A;  1IJH A;  3UP5 A;  1UKV G;  3K30 A;  4CCQ A;  1DOC A;  4YSZ A;  2B9Y A;  3SY4 A;  2FJA A;  2WHD A;  3KD9 A;  2QCU A;  5HYM A;  3L8K A;  1NHQ A;  1GTH A;  3DGZ A;  4JQ9 A;  1H7W A;  1CJ3 A;  4EM4 A;  4J33 A;  3CN8 A;  2WS3 A;  3FIM B;  1ELI A;  3KPF A;  2R0P A;  3PVC A;  1CJ4 A;  2WOV A;  5JRB A;  1FOH A;  3GD4 A;  2NPX A;  3V3N A;  3UKK A;  3QSE A;  4EM3 A;  1KF6 A;  3CND A;  4X9N A;  1CF3 A;  3WE0 A;  2Y6Q A;  2FJB A;  3UKL A;  2W0H A;  1RSG A;  2QAE A;  4DGK A;  4OPU A;  3AE9 A;  1GER A;  2X3N A;  5J60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...