1GV4A

Murine apoptosis-inducing factor (aif)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
490
structure length
490
Chain Sequence
TVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROGRAMED CELL DEATH PROTEIN 8
publication title The Crystal Structure of the Mouse Apoptosis-Inducing Factor Aif
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 149
structure length 490
sequence length 490
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1gv4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A01
3S61A 3GMCA 1JRXA 1FEBA 2BXSA 3L1RA 3IF9A 1NENA 3NTAA 3AEBA 2WPCA 1PBEA 1GXFA 1GETA 4U8OA 1GREA 1S3BA 3DK4A 1YKJA 2Z5XA 5JCIA 4DGKA 4P9SA 4B64A 4H4XA 2YLSA 1IUVA 2C75A 3C4NA 1K0JA 3ABVA 1JRYA 4A5LA 3SFDA 1OJAA 5BRTA 2B7RA 4C5OA 1CC6A 2GAHB 4OCGA 5HYMA 4Z2RA 2GR2A 3GDNA 2GMJA 3ATQA 3NYEA 2B9XA 3AB1A 2PYXA 1GT8A 3IHGA 3ISHA 3QFAA 2C67A 4RG4A 1NHSA 3AYIA 1PS9A 2WU2A 4CCQA 5FMHA 2GR3A 3I6DA 4C77A 5KOWA 4A65A 2FJEA 4A79A 3UP5A 1Y56A 4ADWA 2VRMA 5IPYA 4ZCDA 2C3DA 3EF6A 1LQTA 2WQYA 2XFPA 3GMBA 4EQXA 3K7MX 2WU5A 3II4A 1CJ2A 1DOEA 1QJDA 2GEWA 1TYTA 4U8KA 1CHUA 1UKVG 1GALA 4Z24A 4YTNA 5BUKA 1AOGA 3ALLA 3R9UA 1TYPA 3OZ2A 4H4SA 3KA7A 2XLTA 3CN8A 1VG0A 1LVLA 4OPTA 2XDOA 4EIPA 1ZDLA 1B4VA 4J31A 2WHDA 4K2XA 3DMEA 4EMJA 1D4DA 3NKSA 3K30A 4U8NA 3FBSA 4OPLA 1B5QA 1EBDA 2YG6A 2BCPA 3CGDA 4CNKA 1JNRA 2YLXA 4EM3A 3GRTA 2YR5A 2OA1A 3GDPA 4PABA 3DGHA 2H88A 3UKPA 3V3OA 1O94A 2R4EA 1GNDA 3L8KA 3AE6A 3KD9A 1GSNA 1PBCA 3IC9A 1LV0A 1PJ6A 2VQ7A 2V5ZA 2BS2A 2XCGA 4B66A 1F3PA 4B63A 1IUWA 4IVOB 3G5RA 2PHHA 4O5UA 4Z26A 3C4AA 1E1LA 4EMWA 3P9UA 3AE5A 2X8HA 1RSGA 3FPZA 4XXGA 3RP7A 1OJDA 4OPCA 2HQMA 3DK8A 2QCUA 3REDA 4J57A 2XFNA 3UKQA 5KRQA 4Y4MA 2YVFA 3BHKA 4NZHA 1E39A 1H6VA 4TLZA 3ICTA 2XVFA 5M0ZA 2NVKX 3NT6A 4AOXA 2X8CA 1Y0PA 3VRAA 2JB3A 1XHCA 2OLOA 3P4RA 1GEUA 2CFYA 4B65A 3PVCA 4KX6A 3C96A 1PJ5A 4XWRA 1CJ4A 1KFYA 2CVJA 2C66A 3IWAA 2Z5YA 4A6NB 3NG7X 2C65A 1Q1WA 1IUUA 2V61A 3AEDA 2DKIA 3LB8A 4H4VA 4LIIA 2BS4A 2UZZA 3CPIG 4GCMA 4O5QA 4UDQA 2XFQA 2YLRA 3AD8B 3CPHG 3VRDB 1L9DA 4NEVA 1ZMCA 1FL2A 3CGCA 2BS3A 2VZ2A 2NPXA 1FECA 5FS6A 3KVEA 1ELIA 5U25A 3UKKA 3DGZA 3VQRA 1RP0A 4Y4NA 4AP1A 3M13A 3Q6JA 1BZLA 3CNJA 3LXDA 5FS7A 2YVJA 3LADA 4IVMB 2JB2A 2VVLA 4YSHA 4A9WA 2XVIA 1RYIA 2ZZ0A 2R0PA 4U2SA 3KKJA 4GDEA 3BI2A 1MOKA 2WOVA 2A8XA 4FX9A 2E4GA 3UTGA 3CIRA 1VG9A 4H2RA 4UP3A 1ZP0A 4H4UA 5IQ4A 5JCKA 3NHOX 1JU2A 1H83A 4J34A 1IUSA 1B8SA 5KVIA 1MXTA 1YQ4A 2RABA 3AEFA 3F8PA 3H8LA 1EL8A 3ATRA 4YWOA 3CNSA 3LOVA 2RGJA 5ER0A 2YG4A 1CC4A 1H7XA 5HHFA 3ICSA 3CNDA 3UOXA 3AYJA 1BF3A 4H4QA 3OC4A 4H4PA 4EQWA 1D7LA 1PDHA 4EMIA 1PN0A 1VDCA 2YWLA 3GSIA 4U8IA 1V59A 3VR8A 1QLBA 4A7AA 2RGOA 2BK4A 3AE1A 1L9EA 1NHPA 2VOUA 3P4PA 2WEUA 3B3RA 4GUVA 1F8WA 3M12A 4HA6A 3QJ4A 4J33A 1H7WA 2FJBA 1Q1RA 4Z2UA 1F6MA 3GD4A 1CC2A 3QFBA 1SEZA 1XANA 2YG7A 3AE4A 3EPTA 1ONFA 4U8PA 3NK2X 1COYA 1VRQB 3NIXA 4JNAA 1ZKQA 3EAOA 4APNA 1E1MA 3AE3A 4N9XA 3VR9A 4AP3A 3AEAA 2WPFA 2BK3A 1LPFA 3ZDNA 1PBBA 2JAEA 4C3XA 2R0GA 2I0ZA 3SGLA 3NN0X 1GTHA 2V6OA 2EQ8A 2QAEA 2JBVA 2OAMA 2V3AA 2GR1A 1DOCA 2GAGB 4YKFA 4GRTA 3P4SA 1PBFA 2AR8A 1O95A 3F8RA 4OPIA 3QSMA 4CY8A 5U63A 4J2WA 2Y6QA 3BNUA 5JCNA 2EQ9A 4H4YA 1ZX9A 3CGBA 1TDOA 3UCLA 4YTMA 4GR1A 3E1TA 1BKWA 1E1NA 2XVJA 1REOA 1ZMDA 1BGNA 4JY2A 2WETA 1NEKA 1Y56B 4BURA 4X9NA 2VRLA 2YVGA 4K5SA 5L46A 2E5VA 2IIDA 2B76A 2B9WA 1QO8A 3QSSA 1GRFA 3NYCA 1W4XA 3AD7B 4IA6A 2O9ZA 4U8MA 1BWCA 2Q6UA 3SM8A 2YM2A 3CTYA 3UKHA 3D1CA 4H4ZA 4Z25A 4MJWA 2CDUA 2XLUA 5FS9A 2VVMA 4H4TA 4H4WA 1M64A 1GRAA 2C7GA 2R4JA 2ZBWA 4HB9A 5J60A 2VQBA 2X8GA 2XFUA 2ZZBA 3FG2P 2Q0KA 4YT0A 3PS9A 5KVHA 2EQ6A 3UOZA 2YR6A 1F8RA 2RGHA 4BJZA 1DXLA 2R0CA 5HXIA 1S2YA 2YLZA 1PJ7A 1YY5A 2FBWA 4I59A 1Q9IA 2V60A 3PO7A 2YAUA 1NHRA 2C70A 5BVAA 1S2QA 3COXA 1NDAA 1EL9A 2XLSA 3KU9A 3NYFA 2C64A 3P4QA 3BI5A 4B69A 5CKUA 3UKFA 3NN6X 4GF7A 1VQWA 3Q9TA 4USRA 3NH3X 5EB5A 5JCMA 2H89A 5GSNA 1K0IA 2JK6A 1EL7A 1KF6A 4X9MA 2WOIA 1IJHA 1F8SA 1TDFA 3IHMA 4FK1C 2V3BA 1ZOVA 2WP6A 3T37A 5FS8A 5DBJA 4USQA 3V76A 2C3CA 3NK0X 4C74A 2YQUA 4TM1A 1NHQA 3AD9B 3NLCA 4CBQA 1TDKA 3AWIA 1FOHA 3GYIA 1H84A 4U2TA 1L9CA 2XLPA 3F8DA 2GRTA 4TLXA 4C3YA 2GQWA 1H81A 1OJCA 2YR4A 2B9YA 2FJAA 2BC0A 2BK5A 4OPGA 4JY3A 2E1MA 1CBOA 1IUTA 1P2EA 1N4WA 4K8DA 3ADAB 3SFEA 1CF3A 3AEGA 1GOSA 4K7ZA 1GPEA 2ACZA 4EQSA 3S5WA 3WE0A 2W0HA 3RP8A 2OALA 2YLTA 4RSLA 2QA2A 3AEEA 2BCGG 2C72A 1PHHA 1GRHA 2QA1A 2X3NA 3K7TA 1L0VA 1KSUA 3BHFA 2GR0A 1IUXA 1CL0A 1S3EA 3G5SA 3BNMA 4DSHA 5KWFA 2XFOA 2Q0LA 2IVDA 2A89A 5KOXA 4A99A 1PXAA 1TDNA 1GTEA 5J7XA 4KPRA 3CNPA 1FCDA 3GYJA 1N1PA 3ITJA 3GRSA 3O0HA 5TR3A 2APGA 1B37A 5EBKA 1D4EA 1N4UA 2X99A 2A87A 4DNAA 1NAAA 3UTFA 3I3LA 1ZK7A 4JDRA 3LJPA 3DJDA 1X31B 2R46A 1FEAA 4EQRA 1LJ1A 3NTDA 4BJYA 4BV6A 4YSYA 1ZY8A 1JOAA 2XVEA 4B68A 4YKGA 2WP9A 3UKLA 4H2PA 5BULA 4NEWA 1JEHA 1DJNA 2WESA 3GWDA 1O5WA 4Y4LA 1GESA 4EIQA 2XLRA 3LZWA 1D4CA 2YLWA 1XDIA 2WS3A 4M52A 2B7SA 3DJGX 1KDGA 2WBAA 2VVLG 5CQFA 3AE2A 2BC1A 1BGJA 1DJQA 4J56A 2BABA 2R9ZA 1DOBA 5HY5A 2X50A 2GH5A 3BI4A 4H50A 1OJTA 1JNZA 3K7QX 3EANA 3G5QA 4D04A 1D5TA 2GQFA 1H82A 3UKAA 3UTEA 4REKA 3QSEA 2BACA 4ECHA 2WP5A 3KPFA 4D03A 3QVPA 4CRTA 1LQUA 4H2QA 1TDEA 4YTPA 3GD3A 2WPEA 1M6IA 2WDRA 1HYUA 3NRNA 4IV9A 3UP4A 3RNMA 4XWZA 1GRTA 3KLJA 3CNTA 2BXRA 3B6DA 4B1BA 4TM3A 3RHAA 1OJ9A 2AQJA 3P1WA 2EQ7A 1KNRA 4NTDA 3CGEA 3GWFA 1GV4A 2C76A 3VRBA 3AYLA 2WOWA 2OLNA 4JNQA 2TMDA 2XYOA 5LV9A 3FIMB 3NGCX 4WCTA 2ZZCA 3UOVA 4BK1A 5C3JA 1GRBA 3QVRA 4U2LA 4FDCB 1DODA 1K4QA 4JQ9A 4JN9A 4IA5A 4K5RA 2YG5A 1XPQA 5U1OA 5IQ1A 1H86A 4TM4A 5JCLA 4B67A 3AXBA 4AT0A 4I58A 2WDQA 3M0OA 3ICRA 4UDRA 3ALMA 3H8IA 1E7PA 2C73A 4J36A 4CNJA 3DK9A 1E1KA 2JKCA 3AE7A 4H2NA 4A6NA 4DSGA 3SQPA 2GVCA 2XVHA 3AE8A 3H4KA 4ICYA 4BK2A 1DNCA 4K22A 2GF3A 4BK3A 1CJCA 1N4VA 3NNEA 2R45A 1PXCA 2WDVA 2Y6RA 4Z43A 2AAQA 3V3NA 2CULA 3FMWA 4LU6A 5M10A 3AE9A 2Q7VA 4OPUA 3DH9A 3D8XA 1E6EA 4UDPA 1MO9A 5KXJA 3UOYA 1NG3A 2IVEA 1PXBA 4X4JA 4CY6A 1GERA 1K0LA 4U8JA 3ZYXA 1PBDA 3JSKA 4RG3A 4WX1A 4LA1A 5EOWA 4YSXA 4YSZA 3HZLA 1EL5A 1JRZA 3DJEA 3RP6A 3URHA 4AT2A 1TRBA 4FK1A 4U8LA 4E0VA 4ZCCA 4H4RA 4AOSA 3DA1A 2ARDA 5EB4A 2TPRA 1KNPA 1CJ3A 2DKHA 4NTEA 4TM0A 4EM4A 2GV8A 2J3NA 1YQ3A 2YG3A 4CCRA 5C2TA 4H7UA 4Z2TA 4ZN0A 4YXDA 2F5ZA 2FJDA 2BYBA 2JB1A 3ALJA 4OVIA 1ZOYA 4NTCA 1NPXA 3DJJA 5GRTA 3AECA 1D7YA 4PAAA 4Z44A 1Z6LA 3CPJG 1P2HA 3UTHA 1GRGA 4OPDA 3LZXA 1LTXR 2YM1A 2BA9A 1YQZA 3NK1X 4GDPA 1NG4A 2GMHA 2GB0A 1KSSA
chains in the Genus database with same CATH superfamily
3S61A 4E8GA 1X2GA 3NTAA 3AEBA 1PBEA 1GETA 2QJMA 1WYGA 2Z5XA 3DK4A 4H4XA 2C75A 3ABVA 3BJSA 2B7RA 4G7FA 2GR2A 3ATQA 3NXLA 3AB1A 4H19A 3RITA 3DFHA 4G8TA 3ISHA 3AYIA 4CCQA 2GR3A 3I6DA 2FJEA 1Y56A 2OFJA 5IPYA 3NFUA 4MMWA 1DOEA 3SZFA 4U8KA 1CHUA 3R11A 3UJ2A 1AOGA 1TYPA 3OZ2A 4K2SA 3CN8A 1LVLA 1SJAA 2AKMA 1B4VA 3NKSA 2HXUA 1B5QA 1EBDA 3SN1A 3CGDA 4CNKA 4EM3A 3GRTA 3QPEA 3KD9A 1RM6B 1GSNA 1VQZA 3FYYA 1IUWA 2C4CA 2PHHA 4O5UA 3NRZB 1FO4A 1OJDA 2MUCA 3DK8A 2QCUA 5KRQA 4J57A 4ZCWA 2XFNA 3T2KA 3BHKA 4NNJA 1E39A 4AOXA 2X8CA 2JB3A 3P4RA 2PGWA 1YEYA 2C66A 3NG7X 2P8BA 3R10A 1Q1WA 4H4VA 4LIIA 3T9PA 3VRDB 2OPJA 2NPXA 1FHUA 3KVEA 1SB3B 3BSMA 1RP0A 4AP1A 4GGHA 3L5OA 4IVMB 5KMSA 2ZZ0A 3BI2A 2WOVA 2A8XA 3UTGA 3CIRA 3H70A 1JU2A 4J34A 1B8SA 3H8LA 4TVYA 1EL8A 3CNSA 3CNDA 3UOXA 1D7LA 1PDHA 2YWLA 4A7AA 1SJCA 3AE1A 1R0MA 2O56A 4HA6A 3TTEA 3NVWB 3EPTA 1XANA 1ONFA 3NIXA 3U9IA 3UCDA 3VR9A 2WPFA 3TWAA 3RRAA 3QLDA 3NN0X 1GTHA 2V6OA 2JBVA 2QAEA 2NQLA 4HCHA 3KPKA 4CY8A 4J2WA 3VCNA 3SSZA 3RR1A 2EQ9A 1ZX9A 3UCLA 2XVJA 1REOA 1BGNA 2WETA 2GGIA 1Y56B 2W54A 2B76A 1V97A 2P88A 3QSSA 1W4XA 3AD7B 2Q6UA 3D1CA 2CDUA 1GRAA 4H4WA 4H4TA 4IL2A 2ZZBA 1FHVA 3IJQA 2EQ6A 5HXIA 1Q9IA 2V60A 1NHRA 2XLSA 3KU9A 3D46A 1SJBA 5CKUA 3NN6X 3NH3X 2CHRA 5GSNA 2PTWA 1IJHA 3STPA 1TDFA 3CYJA 3CB3A 1R6WA 5FS8A 5DBJA 1NELA 3NLCA 3AMZA 3AWIA 2I5QA 3GYIA 2XLPA 1RVKA 2GQWA 3VFCA 2B9YA 4JY3A 1P2EA 1N4WA 2ACZA 4EQSA 1EC9A 4JN7A 3ZLGA 4RSLA 1GRHA 3K7TA 1L0VA 2GR0A 1IUXA 1S3EA 4DSHA 3QKEA 1GTEA 3CNPA 3EUB3 3ITJA 3ENLA 2APGA 1B37A 5EBKA 4DNAA 4MKSA 1FEAA 4ROPA 4BV6A 4YSYA 1JOAA 4GIRA 5BULA 4NEWA 3GWDA 4Y4LA 1GESA 4EIQA 4ZOHB 3LZWA 4M52A 3TOYA 1KDGA 1BGJA 4J56A 5FJPA 2XH4A 5HY5A 3BI4A 3K7QX 1H82A 4REKA 2HZGA 3UCCA 2WP5A 6ENLA 3KPFA 4CRTA 4YTPA 4HN8A 3NRNA 3UP4A 3R25A 3B6DA 2QGYA 2EQ7A 1GV4A 3AYLA 2OLNA 1BQGA 3NGCX 5C3JA 4U2LA 4FDCB 4K5RA 4E6MA 3N6HA 4AT0A 1P48A 3FVDA 4I58A 3M0OA 2GSHA 1E1KA 4H2NA 1X2HA 4DWDA 3NNEA 1PXCA 2AAQA 3V3NA 2CULA 3IJLA 3FMWA 4FI4A 4Z1YA 5KXJA 1PXBA 1K0LA 4U8JA 1PBDA 3Q45A 3HZLA 4IP5A 1EL5A 1JRZA 3DJEA 2FKPA 4FK1A 5EB4A 2TPRA 3ES8A 4EM4A 3S47A 4CCRA 4H7UA 2F5ZA 3K1GA 1ZOYA 4NTCA 1D7YA 5JRBA 3MSYA 2P3ZA 1NG4A 3HYVA 1KSSA 3A7UA 3GMCA 1JRXA 1N61C 1FEBA 2BXSA 3IF9A 4DN1A 5G5GB 1GXFA 1S3BA 1YKJA 1N63C 3B9JB 3T6CA 4B64A 2YLSA 2PMQA 4A5LA 3SFDA 3DERA 1OJAA 4C5OA 3TW9A 2GAHB 4OCGA 3GDNA 2GMJA 1MDLA 3QFAA 1JROA 2C67A 1NHSA 2XH7A 1PS9A 1N62C 5FMHA 4C77A 4A79A 2RDXA 4ZCDA 3N4FA 2WQYA 2XFPA 3K7MX 2WU5A 1QJDA 2GEWA 2OVLA 1UKVG 5BUKA 3ALLA 3R9UA 5FJUA 3GY1A 4IZGA 2QDDA 4J31A 2WHDA 4EMJA 1D4DA 3NVZB 4U8NA 3A7AA 4OPLA 4G6HA 2BCPA 2YLXA 4PABA 3DGHA 2W55A 3IC9A 2V5ZA 2BS2A 2XCGA 1F3PA 4Z26A 2X8HA 4M6UA 4OPCA 3UKQA 2YVFA 1F9CA 2XVFA 3DFYA 1Y0PA 1XHCA 2OLOA 3DEQA 2PODA 2OZ3A 1CJ4A 1P43A 4IL0A 2V61A 3CPIG 2DKIA 3LB8A 4O5QA 2XFQA 2YLRA 4MGGA 3CPHG 1L9DA 1DTNA 2BS3A 3PWGA 2VZ2A 2DW7A 2OQYA 3T14A 2OZ8A 3DIPA 3VQRA 2XH2A 3UJEA 5FS7A 2YVJA 2XVIA 1RYIA 4U2SA 2AL1A 5J04A 4GDEA 4FX9A 4A35A 4H2RA 4H4UA 5JCKA 1H83A 1IUSA 1YQ4A 2RABA 5BOEA 3F8PA 5KMPA 3ATRA 4YWOA 3I4KA 5ER0A 2YG4A 3UGVA 1H7XA 2PTZA 3H12A 3AYJA 4H4QA 4EMIA 1QLBA 2RGOA 1NHPA 4A3RA 3P4PA 3B3RA 4GUVA 1F8WA 3M12A 1Q1RA 1SEZA 3ZLHA 1E1MA 3AE3A 4N9XA 3AEAA 3UXKA 2DW6A 3ZDNA 2JAEA 3DDMA 3SN0A 4II3A 4GRTA 3ZVIA 3QSMA 5FJRA 5JCNA 3CGBA 2QQ6A 4GR1A 3E1TA 3AM9A 1JRPA 4HPNA 4X9NA 2VRLA 3SZCA 4K5SA 5L46A 3CXOA 3PK7A 2O9ZA 4U8MA 1BWCA 2E5AA 4H4ZA 1NU5A 2ZBWA 2C7GA 1M64A 3OPSA 3THUA 2ZADA 2XFUA 3PS9A 5KVHA 3UOZA 1F8RA 4ENLA 2R0CA 1S2YA 2YLZA 1PJ7A 1YY5A 5BVAA 4I59A 1SJDA 2C70A 3COXA 2C64A 3P3BA 3BI5A 3P4QA 2MNRA 2E3TA 4GF7A 4HCDA 4USRA 5EB5A 1KF6A 1WUFA 1E9IA 3T37A 3V76A 3NK0X 4C74A 1NHQA 1H84A 2GRTA 4TLXA 3CK5A 4F4RA 3RGTA 3DG7A 2BC0A 4ZA0A 3ZVHA 2BK5A 4OPGA 1CBOA 2OO6A 3ADAB 1CF3A 4K7ZA 3WE0A 3RP8A 1PHHA 2QA1A 4GYPC 5KWFA 3V5FA 2XFOA 3SQSA 3V4BA 4KEMA 1FCDA 2GL5A 2P0IA 1N4UA 1NAAA 3DJDA 3EEZA 3VDGA 1LJ1A 1ZY8A 4B68A 2XVEA 2WP9A 3UKLA 4H2PA 3UJRA 1H2IA 3H8AA 3DJGX 2WBAA 5CQFA 3AE2A 1DJQA 2BABA 3R1ZA 2GH5A 3R0KA 1OEPA 1JNZA 4D04A 3UTEA 3QSEA 2BACA 4D03A 4JHMA 4X2PA 2AL2A 1VDVA 3QVPA 1LQUA 3GD3A 3RNMA 1GRTA 3KLJA 4TM3A 2POZA 2GDQA 3P1WA 3GWFA 4G6GA 2WOWA 2TMDA 1FIQB 4WCTA 3UXLA 3UOVA 3T4WA 1DODA 4IA5A 1XPQA 5U1OA 4TM4A 2WDQA 3ICRA 4II2A 4J36A 2JKCA 3AE7A 2GVCA 1XPYA 3MUCA 1E6EA 2FYMA 3SY4A 4KWSA 4KT2A 3ZYXA 1KD0A 3JSKA 3RP6A 3URHA 4GFIA 1TRBA 4ZCCA 4H4RA 3ZLFA 2DKHA 3V3WA 2BYBA 2JB1A 3ALJA 2XH0A 1P2HA 3UTHA 3N4EA 3ZVHB 4A6GA 2YM1A 1YQZA 3NK1X 4JN8A 4Z2RA 4HYRA 3Q9TA 1NENA 2PA6A 2WPCA 1TKKA 5JCIA 4DGKA 1IUVA 5BRTA 3RCYA 5G5HB 2PGEA 2OQHA 2PYXA 1GT8A 2WU2A 4IP4A 3RO6A 4Z17A 4K8GA 4ADWA 2VRMA 3OZYA 2C3DA 3EF6A 3TWBA 1EBHA 1LQTA 4EQXA 3II4A 4YTNA 4Z24A 3ETRB 4H4SA 3KA7A 1VG0A 2XDOA 3DMEA 3DG3A 3K30A 3FBSA 1IYXA 2YG6A 2AL2B 1JNRA 2H88A 3V3OA 1O94A 1GNDA 1FFVC 3AE6A 3SYIA 2VQ7A 3I6TA 2OKTA 1XS2A 1E1LA 1EBGA 3AE5A 4XXGA 3FPZA 3RP7A 1N60C 3HRDC 4NZHA 1H6VA 3ICTA 5M0ZA 4H1ZA 3H7VA 2CFYA 4KX6A 2OZTA 1KFYA 4XWRA 3IWAA 2C65A 3AEDA 2PU1A 2BS4A 3AN1A 2UZZA 4GCMA 1MUCA 3AD8B 4NEVA 1ZMCA 1FL2A 2BRYA 3CGCA 5FS6A 3UKKA 3R07C 2P8CA 3Q6JA 1KKOA 3CNJA 4HNLA 3LADA 2JB2A 2VVLA 4A9WA 1N5WC 2R0PA 3KKJA 2QJNA 4UP3A 3FXGA 3NHOX 2XGZA 3UJSA 1MXTA 5KVIA 5BOFA 3JW7A 1ELSA 3AEFA 4YWSA 3LOVA 1CC4A 3ICSA 3OZMA 4IHCA 3OC4A 3TCSA 4H4PA 4EQWA 3GSIA 4U8IA 3VR8A 1V59A 3NVYB 3S5SA 4Z2UA 3SN4A 3AE4A 3QFBA 2YG7A 4U8PA 3NK2X 1COYA 2PCEA 4JNAA 4AP3A 2BK3A 1LPFA 1PBBA 2R0GA 2I0ZA 3SGLA 1BKHA 2EQ8A 2V3AA 3TJIA 2OAMA 1DOCA 3P4SA 1MNSA 4OPIA 4HCLA 1W6TA 5U63A 2Y6QA 3BNUA 3TQPA 4YTMA 3CMMA 1ZMDA 1NEKA 2QDEA 4BURA 2YVGA 1QO8A 3FV9A 4IA6A 3SBFA 3UKHA 4MJWA 2XLUA 5FS9A 2R4JA 5J60A 2X8GA 3V5CA 4YT0A 2RGHA 1DXLA 2FBWA 3PO7A 2YAUA 1NDAA 1T3QC 2QJJA 3QN3A 3CXBA 3UKFA 1VQWA 5JCMA 1PDYA 1K0IA 2JK6A 4X9MA 1F8SA 3VC6A 2V3BA 1ZOVA 5KNLA 4CBQA 1TDKA 1FOHA 4C3YA 1JDFA 1H81A 2YR4A 2E1MA 3HPFA 4GGBA 3HYXA 3NZGA 3SZWA 2BRAA 3S5WA 3FCPA 1EC8A 3MY9A 2BCGG 1KSUA 3G5SA 1CL0A 3BNMA 3P0WA 2PPGA 2A89A 1TZZA 4A99A 3QTPA 5J7XA 3PFRA 3O0HA 5TR3A 4GAPA 3UTFA 3I3LA 1S7MA 3LJPA 3NTDA 4BJYA 4EQRA 3T2YA 4YKGA 1JCTA 2WESA 1O5WA 2YLWA 4H2HA 3VCCA 2R9ZA 1DOBA 2X50A 4H50A 1OJTA 3G5QA 4ECHA 1ECQA 5FJOA 4H2QA 1TDEA 1HYUA 3CNTA 2BXRA 4B1BA 3RHAA 3BOXA 3ES7A 1OJ9A 2AQJA 1KNRA 3CGEA 2C76A 2PP1A 3OP2A 5LV9A 3FIMB 2ZZCA 1ONEA 4JN9A 2PTXA 2AKZA 4UDRA 3ALMA 3H8IA 1E7PA 3DG6A 4CNJA 2W3SA 4A6NA 4DSGA 3P93A 2XVHA 3AE8A 3H4KA 4BK2A 1DNCA 1N4VA 2R45A 2WDVA 2Y6RA 4Z43A 2ONEA 3AE9A 5EU9A 4OPUA 1MO9A 4DXKA 1FFUC 1NG3A 2IVEA 4X4JA 4CY6A 4YSXA 4LA1A 4YSZA 4E0VA 2ARDA 1CJ3A 4TM0A 2GV8A 1YQ3A 2YG3A 5C2TA 4Z2TA 4ZN0A 3GYXA 2PP0A 3DJJA 3AECA 3HW2A 4PAAA 4Z44A 3MQTA 4OPDA 2GMHA 4TLZA 3L1RA 3IJIA 4U8OA 1GREA 4GYPA 3OTRA 4P9SA 3C4NA 1K0JA 1JRYA 2W3RA 1TE6A 1MDRA 4J1OA 1CC6A 5HYMA 2OLAA 3NYEA 2B9XA 2GGGA 3MWCA 2ZC8A 3IHGA 4KPLA 3GC2A 1JPMA 4RG4A 5KOWA 4A65A 3UP5A 3NS1B 3GMBA 1CJ2A 1TYTA 3D9XA 1GALA 1PDZA 2XLTA 4NWZA 1STZA 4OPTA 1WUEA 4EIPA 1ZDLA 4K2XA 4G73A 2YR5A 3GDPA 2OA1A 3UKPA 1ZXIC 4M0XA 2R4EA 3L8KA 1PBCA 1LV0A 1PJ6A 4B63A 4B66A 3HYWA 4IVOB 3G5RA 3C4AA 4EMWA 3P9UA 1RSGA 1MRAA 4E5TA 3GD6A 2HQMA 3REDA 2PS2A 4Y4MA 4H83A 2HNEA 3MZNA 2NVKX 3NT6A 1GEUA 3MKCA 4B65A 3PVCA 3C96A 1PJ5A 3SXIA 2CVJA 2Z5YA 4A6NB 3PG6A 1IUUA 3VRAA 4UDQA 3T2ZA 1KKRA 2PTYA 1FECA 1ELIA 1EC7A 5U25A 3DGZA 4Y4NA 3M13A 1BZLA 3SJNA 4G9KA 3LXDA 3DGBA 3VC5A 4YSHA 2PU0A 1MOKA 2E4GA 1VG9A 3A7RA 1ZP0A 5IQ4A 4GAVA 2RGJA 5HHFA 1BF3A 3EKGA 1PN0A 1VDCA 2BK4A 1L9EA 2VOUA 2WEUA 3QJ4A 4J33A 1H7WA 2FJBA 1F6MA 4TVWA 3GD4A 1CC2A 1VRQB 2GGEA 1ZKQA 3EAOA 4APNA 3KUMA 3PWIA 2XSXA 4C3XA 3CAWA 4IT1A 2GR1A 2GAGB 4YKFA 1PBFA 2AR8A 1O95A 3F8RA 4K1WA 4H4YA 1TDOA 1BKWA 1E1NA 4JY2A 1KN0A 2E5VA 2IIDA 2B9WA 1GRFA 3NYCA 4E4FA 3SM8A 2YM2A 3CTYA 7ENLA 3T0KA 4Z25A 2VVMA 3N6JA 4HB9A 2VQBA 3OW1A 4GMEA 2HXTA 3FG2P 2Q0KA 5IDZA 2YR6A 4BJZA 3DESA 2GGHA 1S2QA 1EL9A 3NYFA 4B69A 4EWJA 2H89A 5KMRA 3U4FA 1EL7A 2WOIA 3IHMA 4FK1C 2WP6A 4USQA 2C3CA 2YQUA 4TM1A 3AD9B 4U2TA 1L9CA 3F8DA 3UJFA 1OJCA 2FJAA 1IUTA 3SR6B 4K8DA 3SFEA 3AEGA 1GOSA 1GPEA 3NVVB 2W0HA 2GGJA 2OALA 2YLTA 2QA2A 3AEEA 2C72A 2X3NA 4E4UA 3BHFA 1L8PA 2Q0LA 2IVDA 5KOXA 4FP1A 3D47A 1PXAA 1TDNA 4KPRA 3GYJA 1N1PA 3SX6A 3GRSA 3CT2A 3I6EA 3Q4DA 1D4EA 2X99A 2A87A 1ZK7A 4JDRA 1N5XA 3FJ4A 3NO1A 1X31B 2R46A 3VA8A 1JEHA 1DJNA 3JVAA 2XLRA 1D4CA 2PSNA 1XDIA 2WS3A 2B7SA 2PP3A 2VVLG 2BC1A 3EANA 1D5TA 2GQFA 3UKAA 3GO2A 2WPEA 1M6IA 2WDRA 4IV9A 4XWZA 3T8QA 2QVHA 4NTDA 4G74A 3VRBA 1JPDX 4JNQA 2XYOA 4BK1A 1GRBA 3QVRA 3T31A 1K4QA 4JQ9A 2YG5A 4DYEA 3IK4A 1H86A 5IQ1A 5JCLA 4B67A 3AXBA 2C73A 3JZUA 5KMQA 3DK9A 3SZ0A 3SQPA 4ICYA 4K22A 2GF3A 4BK3A 1CJCA 4DHGA 3B97A 1KCZA 4LU6A 5M10A 2Q7VA 5FJTA 4GISA 3DH9A 3D8XA 4UDPA 3UOYA 1GERA 4RG3A 4WX1A 5EOWA 4DX3A 4AT2A 4U8LA 5ENLA 4AOSA 3DA1A 4HNCA 1KNPA 4NTEA 2J3NA 4J3ZA 2OG9A 4YXDA 3TJ4A 2FJDA 4OVIA 1NPXA 3R0UA 5GRTA 1Z6LA 3CPJG 1GRGA 3LZXA 1LTXR 2BA9A 2OX4A 4GDPA 2GB0A
chains in the Genus database with same CATH topology
3S61A 3GMCA 1JRXA 1FEBA 2BXSA 3L1RA 3IF9A 1NENA 3NTAA 3AEBA 2WPCA 1PBEA 1GXFA 1GETA 4U8OA 1GREA 1S3BA 3DK4A 1YKJA 2Z5XA 5JCIA 4DGKA 4P9SA 4B64A 4H4XA 2YLSA 1IUVA 2C75A 3C4NA 1K0JA 3ABVA 1JRYA 4A5LA 3SFDA 1OJAA 5BRTA 2B7RA 4C5OA 1CC6A 2GAHB 4OCGA 5HYMA 4Z2RA 2GR2A 3GDNA 2GMJA 3ATQA 3NYEA 2B9XA 3AB1A 2PYXA 1GT8A 3IHGA 3ISHA 3QFAA 2C67A 4RG4A 1NHSA 3AYIA 1PS9A 2WU2A 4CCQA 5FMHA 2GR3A 3I6DA 4C77A 5KOWA 4A65A 2FJEA 4A79A 3UP5A 1Y56A 4ADWA 2VRMA 5IPYA 4ZCDA 2C3DA 3EF6A 1LQTA 2WQYA 2XFPA 3GMBA 4EQXA 3K7MX 2WU5A 3II4A 1CJ2A 1DOEA 1QJDA 2GEWA 3SZFA 1TYTA 3D9XA 4U8KA 1CHUA 1UKVG 1GALA 4Z24A 4YTNA 5BUKA 1AOGA 3ALLA 3R9UA 1TYPA 3OZ2A 4H4SA 3KA7A 2XLTA 3CN8A 4NWZA 1VG0A 1LVLA 4OPTA 2XDOA 4EIPA 1ZDLA 1B4VA 4J31A 2WHDA 4K2XA 3DMEA 4EMJA 1D4DA 3NKSA 3K30A 4U8NA 3FBSA 4OPLA 1B5QA 1EBDA 2YG6A 4G6HA 4G73A 2BCPA 3CGDA 4CNKA 1JNRA 2YLXA 4EM3A 3GRTA 2YR5A 2OA1A 3GDPA 4PABA 3DGHA 2H88A 3UKPA 3V3OA 1O94A 2R4EA 1GNDA 3L8KA 3AE6A 3KD9A 1GSNA 1PBCA 3IC9A 1LV0A 1PJ6A 2VQ7A 2V5ZA 2BS2A 2XCGA 3SYIA 1F3PA 4B66A 4B63A 1IUWA 3HYWA 3G5RA 2C4CA 2PHHA 4IVOB 4O5UA 4Z26A 3C4AA 1E1LA 4EMWA 3P9UA 3AE5A 2X8HA 1RSGA 3FPZA 4XXGA 3RP7A 1OJDA 4OPCA 2HQMA 3DK8A 2QCUA 3REDA 4J57A 2XFNA 3UKQA 5KRQA 4Y4MA 2YVFA 3T2KA 3BHKA 4NZHA 4NNJA 1E39A 1H6VA 4TLZA 3ICTA 2XVFA 5M0ZA 2NVKX 3NT6A 4AOXA 2X8CA 1Y0PA 3VRAA 2JB3A 1XHCA 2OLOA 3P4RA 1GEUA 2CFYA 4B65A 3PVCA 4KX6A 3C96A 1PJ5A 4XWRA 1CJ4A 1KFYA 3SXIA 2CVJA 2C66A 3IWAA 2Z5YA 4A6NB 3NG7X 2C65A 3PG6A 1Q1WA 1IUUA 2V61A 3AEDA 2DKIA 3LB8A 4H4VA 4LIIA 2BS4A 2UZZA 3CPIG 4GCMA 4O5QA 4UDQA 2XFQA 2YLRA 3T2ZA 3AD8B 3CPHG 3VRDB 1L9DA 4NEVA 1ZMCA 1FL2A 2BRYA 3CGCA 2BS3A 2VZ2A 2NPXA 1FECA 5FS6A 3KVEA 1ELIA 5U25A 3UKKA 3T14A 3DGZA 3VQRA 1RP0A 4Y4NA 4AP1A 3M13A 3Q6JA 1BZLA 4G9KA 3CNJA 3LXDA 5FS7A 2YVJA 3LADA 3L5OA 4IVMB 2JB2A 2VVLA 4YSHA 4A9WA 5KMSA 2XVIA 1RYIA 2ZZ0A 2R0PA 4U2SA 3KKJA 4GDEA 3BI2A 1MOKA 2WOVA 2A8XA 4FX9A 2E4GA 3UTGA 3CIRA 1VG9A 4H2RA 4UP3A 1ZP0A 4H4UA 5IQ4A 5JCKA 3NHOX 1JU2A 1H83A 4J34A 1IUSA 1B8SA 5KVIA 1MXTA 1YQ4A 2RABA 3AEFA 3F8PA 3H8LA 1EL8A 5KMPA 3ATRA 4GAVA 4YWOA 3CNSA 3LOVA 2RGJA 5ER0A 2YG4A 1CC4A 1H7XA 5HHFA 3ICSA 3CNDA 3UOXA 3AYJA 1BF3A 4H4QA 3OC4A 4H4PA 4EQWA 1D7LA 1PDHA 4EMIA 1PN0A 1VDCA 2YWLA 3GSIA 4U8IA 1V59A 3VR8A 1QLBA 4A7AA 2RGOA 2BK4A 3AE1A 1L9EA 1NHPA 2VOUA 3P4PA 2WEUA 3B3RA 4GUVA 1F8WA 3M12A 4HA6A 3QJ4A 4J33A 1H7WA 2FJBA 1Q1RA 4Z2UA 1F6MA 3GD4A 1CC2A 3QFBA 1SEZA 1XANA 2YG7A 3AE4A 3EPTA 1ONFA 4U8PA 3NK2X 1COYA 1VRQB 3NIXA 4JNAA 1ZKQA 3EAOA 4APNA 1E1MA 3AE3A 4N9XA 3VR9A 4AP3A 3AEAA 2WPFA 2BK3A 1LPFA 3ZDNA 1PBBA 2JAEA 4C3XA 2R0GA 2I0ZA 3SGLA 3NN0X 1GTHA 2V6OA 2EQ8A 2QAEA 2V3AA 2JBVA 2OAMA 4II3A 2GR1A 1DOCA 2GAGB 4YKFA 4GRTA 3KPKA 3P4SA 1PBFA 2AR8A 1O95A 3F8RA 4OPIA 3QSMA 4CY8A 5U63A 4J2WA 2Y6QA 3BNUA 5JCNA 2EQ9A 4H4YA 1ZX9A 3CGBA 1TDOA 3UCLA 4YTMA 3CMMA 4GR1A 3E1TA 1BKWA 1E1NA 2XVJA 1REOA 1ZMDA 1BGNA 4JY2A 1KN0A 1NEKA 2WETA 1Y56B 4BURA 4X9NA 2VRLA 2YVGA 3SZCA 4K5SA 5L46A 2E5VA 2IIDA 2B76A 2B9WA 1QO8A 3QSSA 1GRFA 3NYCA 1W4XA 3AD7B 4IA6A 2O9ZA 4U8MA 1BWCA 2Q6UA 3SM8A 2YM2A 3CTYA 3UKHA 3D1CA 3T0KA 4H4ZA 4Z25A 4MJWA 2CDUA 2XLUA 5FS9A 2VVMA 4H4TA 4H4WA 1GRAA 1M64A 2C7GA 2R4JA 2ZBWA 4HB9A 5J60A 2VQBA 2X8GA 2XFUA 2ZZBA 3FG2P 2Q0KA 4YT0A 3PS9A 5KVHA 2EQ6A 3UOZA 2YR6A 1F8RA 2RGHA 4BJZA 1DXLA 2R0CA 5HXIA 1S2YA 2YLZA 1PJ7A 1YY5A 2FBWA 4I59A 1Q9IA 2V60A 3PO7A 2YAUA 1NHRA 2C70A 5BVAA 1S2QA 3COXA 1NDAA 1EL9A 2XLSA 3KU9A 3NYFA 2C64A 3P4QA 3BI5A 4B69A 5CKUA 3UKFA 3NN6X 4GF7A 1VQWA 3Q9TA 4USRA 3NH3X 5EB5A 5JCMA 2H89A 5KMRA 5GSNA 1K0IA 2JK6A 1EL7A 1KF6A 4X9MA 2WOIA 1IJHA 1F8SA 1TDFA 3IHMA 4FK1C 2V3BA 1ZOVA 5KNLA 2WP6A 3T37A 5FS8A 5DBJA 4USQA 3V76A 2C3CA 3NK0X 4C74A 2YQUA 4TM1A 1NHQA 3AD9B 3NLCA 4CBQA 1TDKA 3AWIA 1FOHA 3GYIA 1H84A 4U2TA 1L9CA 2XLPA 3F8DA 2GRTA 4TLXA 4C3YA 2GQWA 1H81A 1OJCA 2YR4A 2B9YA 2FJAA 2BC0A 2BK5A 4OPGA 4JY3A 2E1MA 1CBOA 1IUTA 1P2EA 1N4WA 3HYXA 4K8DA 3ADAB 3SFEA 1CF3A 3SZWA 3AEGA 1GOSA 2BRAA 4K7ZA 1GPEA 2ACZA 4EQSA 3S5WA 3WE0A 2W0HA 3RP8A 2OALA 2YLTA 4RSLA 2QA2A 3AEEA 2BCGG 2C72A 1PHHA 1GRHA 2QA1A 2X3NA 3K7TA 1L0VA 1KSUA 3BHFA 2GR0A 1IUXA 1CL0A 1S3EA 3G5SA 3BNMA 4DSHA 5KWFA 2XFOA 2Q0LA 2IVDA 2A89A 5KOXA 4A99A 1PXAA 1TDNA 1GTEA 5J7XA 4KPRA 3CNPA 1FCDA 3GYJA 1N1PA 3ITJA 3SX6A 3GRSA 3O0HA 5TR3A 2APGA 1B37A 5EBKA 1D4EA 1N4UA 2X99A 2A87A 4DNAA 1NAAA 4GAPA 3UTFA 3I3LA 1S7MA 1ZK7A 4JDRA 3LJPA 3DJDA 1X31B 2R46A 1FEAA 4EQRA 1LJ1A 3NTDA 3T2YA 4BV6A 4BJYA 4YSYA 1ZY8A 1JOAA 2XVEA 4B68A 4YKGA 2WP9A 3UKLA 4H2PA 5BULA 4NEWA 1JEHA 1DJNA 1H2IA 2WESA 3GWDA 1O5WA 4Y4LA 1GESA 4EIQA 2XLRA 3LZWA 1D4CA 2YLWA 1XDIA 2WS3A 4M52A 2B7SA 3DJGX 1KDGA 2WBAA 2VVLG 5CQFA 3AE2A 2BC1A 1BGJA 1DJQA 4J56A 2BABA 2R9ZA 1DOBA 5HY5A 2X50A 2GH5A 3BI4A 4H50A 1OJTA 1JNZA 3K7QX 3EANA 3G5QA 4D04A 1D5TA 2GQFA 1H82A 3UKAA 3UTEA 4REKA 3QSEA 2BACA 4ECHA 2WP5A 3KPFA 4D03A 3QVPA 4CRTA 1LQUA 4H2QA 1TDEA 4YTPA 3GD3A 2WPEA 1M6IA 2WDRA 1HYUA 3NRNA 4IV9A 3UP4A 3RNMA 4XWZA 1GRTA 3KLJA 3CNTA 2BXRA 3B6DA 4B1BA 4TM3A 3RHAA 1OJ9A 2AQJA 3P1WA 2EQ7A 1KNRA 4NTDA 3CGEA 3GWFA 1GV4A 2C76A 4G74A 3VRBA 3AYLA 2WOWA 4G6GA 2OLNA 4JNQA 2TMDA 2XYOA 5LV9A 3FIMB 3NGCX 4WCTA 2ZZCA 3UOVA 4BK1A 5C3JA 1GRBA 3QVRA 4U2LA 3T31A 4FDCB 1DODA 1K4QA 4JQ9A 4JN9A 4IA5A 4K5RA 2YG5A 1XPQA 5U1OA 5IQ1A 1H86A 4TM4A 5JCLA 4B67A 3AXBA 4AT0A 4I58A 2WDQA 3M0OA 3ICRA 4UDRA 3ALMA 3H8IA 1E7PA 2C73A 4II2A 5KMQA 4J36A 4CNJA 3DK9A 1E1KA 2JKCA 3AE7A 4H2NA 3SZ0A 4A6NA 4DSGA 3SQPA 2GVCA 2XVHA 3AE8A 3H4KA 4ICYA 4BK2A 1DNCA 4K22A 2GF3A 4BK3A 1CJCA 1N4VA 3NNEA 2R45A 1PXCA 2WDVA 2Y6RA 4Z43A 2AAQA 3V3NA 2CULA 3FMWA 4LU6A 5M10A 3AE9A 2Q7VA 4OPUA 3DH9A 3D8XA 1E6EA 3SY4A 4UDPA 1MO9A 5KXJA 3UOYA 1NG3A 2IVEA 1PXBA 4X4JA 4CY6A 1GERA 1K0LA 4U8JA 3ZYXA 1PBDA 3JSKA 4RG3A 4WX1A 4LA1A 5EOWA 4YSXA 4YSZA 3HZLA 1EL5A 1JRZA 3DJEA 3RP6A 3URHA 4AT2A 1TRBA 4FK1A 4U8LA 4E0VA 4ZCCA 4H4RA 4AOSA 3DA1A 2ARDA 5EB4A 2TPRA 1KNPA 1CJ3A 2DKHA 4NTEA 4TM0A 4EM4A 2GV8A 2J3NA 1YQ3A 2YG3A 4CCRA 5C2TA 4H7UA 4Z2TA 4ZN0A 4YXDA 2F5ZA 2FJDA 2BYBA 3GYXA 2JB1A 3ALJA 4OVIA 1ZOYA 4NTCA 1NPXA 3DJJA 5GRTA 3AECA 1D7YA 5JRBA 4PAAA 4Z44A 1Z6LA 3CPJG 1P2HA 3UTHA 1GRGA 4OPDA 3LZXA 1LTXR 2YM1A 2BA9A 1YQZA 3NK1X 4GDPA 1NG4A 2GMHA 3HYVA 2GB0A 1KSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S61 A;  3GMC A;  1JRX A;  1FEB A;  2BXS A;  3L1R A;  3IF9 A;  1NEN A;  3NTA A;  3AEB A;  2WPC A;  1PBE A;  1GXF A;  1GET A;  4U8O A;  1GRE A;  1S3B A;  3DK4 A;  1YKJ A;  2Z5X A;  5JCI A;  4DGK A;  4P9S A;  4B64 A;  4H4X A;  2YLS A;  1IUV A;  2C75 A;  3C4N A;  1K0J A;  3ABV A;  1JRY A;  4A5L A;  3SFD A;  1OJA A;  5BRT A;  2B7R A;  4C5O A;  1CC6 A;  2GAH B;  4OCG A;  5HYM A;  4Z2R A;  2GR2 A;  3GDN A;  2GMJ A;  3ATQ A;  3NYE A;  2B9X A;  3AB1 A;  2PYX A;  1GT8 A;  3IHG A;  3ISH A;  3QFA A;  2C67 A;  4RG4 A;  1NHS A;  3AYI A;  1PS9 A;  2WU2 A;  4CCQ A;  5FMH A;  2GR3 A;  3I6D A;  4C77 A;  5KOW A;  4A65 A;  2FJE A;  4A79 A;  3UP5 A;  1Y56 A;  4ADW A;  2VRM A;  5IPY A;  4ZCD A;  2C3D A;  3EF6 A;  1LQT A;  2WQY A;  2XFP A;  3GMB A;  4EQX A;  3K7M X;  2WU5 A;  3II4 A;  1CJ2 A;  1DOE A;  1QJD A;  2GEW A;  1TYT A;  4U8K A;  1CHU A;  1UKV G;  1GAL A;  4Z24 A;  4YTN A;  5BUK A;  1AOG A;  3ALL A;  3R9U A;  1TYP A;  3OZ2 A;  4H4S A;  3KA7 A;  2XLT A;  3CN8 A;  1VG0 A;  1LVL A;  4OPT A;  2XDO A;  4EIP A;  1ZDL A;  1B4V A;  4J31 A;  2WHD A;  4K2X A;  3DME A;  4EMJ A;  1D4D A;  3NKS A;  3K30 A;  4U8N A;  3FBS A;  4OPL A;  1B5Q A;  1EBD A;  2YG6 A;  2BCP A;  3CGD A;  4CNK A;  1JNR A;  2YLX A;  4EM3 A;  3GRT A;  2YR5 A;  2OA1 A;  3GDP A;  4PAB A;  3DGH A;  2H88 A;  3UKP A;  3V3O A;  1O94 A;  2R4E A;  1GND A;  3L8K A;  3AE6 A;  3KD9 A;  1GSN A;  1PBC A;  3IC9 A;  1LV0 A;  1PJ6 A;  2VQ7 A;  2V5Z A;  2BS2 A;  2XCG A;  4B66 A;  1F3P A;  4B63 A;  1IUW A;  4IVO B;  3G5R A;  2PHH A;  4O5U A;  4Z26 A;  3C4A A;  1E1L A;  4EMW A;  3P9U A;  3AE5 A;  2X8H A;  1RSG A;  3FPZ A;  4XXG A;  3RP7 A;  1OJD A;  4OPC A;  2HQM A;  3DK8 A;  2QCU A;  3RED A;  4J57 A;  2XFN A;  3UKQ A;  5KRQ A;  4Y4M A;  2YVF A;  3BHK A;  4NZH A;  1E39 A;  1H6V A;  4TLZ A;  3ICT A;  2XVF A;  5M0Z A;  2NVK X;  3NT6 A;  4AOX A;  2X8C A;  1Y0P A;  3VRA A;  2JB3 A;  1XHC A;  2OLO A;  3P4R A;  1GEU A;  2CFY A;  4B65 A;  3PVC A;  4KX6 A;  3C96 A;  1PJ5 A;  4XWR A;  1CJ4 A;  1KFY A;  2CVJ A;  2C66 A;  3IWA A;  2Z5Y A;  4A6N B;  3NG7 X;  2C65 A;  1Q1W A;  1IUU A;  2V61 A;  3AED A;  2DKI A;  3LB8 A;  4H4V A;  4LII A;  2BS4 A;  2UZZ A;  3CPI G;  4GCM A;  4O5Q A;  4UDQ A;  2XFQ A;  2YLR A;  3AD8 B;  3CPH G;  3VRD B;  1L9D A;  4NEV A;  1ZMC A;  1FL2 A;  3CGC A;  2BS3 A;  2VZ2 A;  2NPX A;  1FEC A;  5FS6 A;  3KVE A;  1ELI A;  5U25 A;  3UKK A;  3DGZ A;  3VQR A;  1RP0 A;  4Y4N A;  4AP1 A;  3M13 A;  3Q6J A;  1BZL A;  3CNJ A;  3LXD A;  5FS7 A;  2YVJ A;  3LAD A;  4IVM B;  2JB2 A;  2VVL A;  4YSH A;  4A9W A;  2XVI A;  1RYI A;  2ZZ0 A;  2R0P A;  4U2S A;  3KKJ A;  4GDE A;  3BI2 A;  1MOK A;  2WOV A;  2A8X A;  4FX9 A;  2E4G A;  3UTG A;  3CIR A;  1VG9 A;  4H2R A;  4UP3 A;  1ZP0 A;  4H4U A;  5IQ4 A;  5JCK A;  3NHO X;  1JU2 A;  1H83 A;  4J34 A;  1IUS A;  1B8S A;  5KVI A;  1MXT A;  1YQ4 A;  2RAB A;  3AEF A;  3F8P A;  3H8L A;  1EL8 A;  3ATR A;  4YWO A;  3CNS A;  3LOV A;  2RGJ A;  5ER0 A;  2YG4 A;  1CC4 A;  1H7X A;  5HHF A;  3ICS A;  3CND A;  3UOX A;  3AYJ A;  1BF3 A;  4H4Q A;  3OC4 A;  4H4P A;  4EQW A;  1D7L A;  1PDH A;  4EMI A;  1PN0 A;  1VDC A;  2YWL A;  3GSI A;  4U8I A;  1V59 A;  3VR8 A;  1QLB A;  4A7A A;  2RGO A;  2BK4 A;  3AE1 A;  1L9E A;  1NHP A;  2VOU A;  3P4P A;  2WEU A;  3B3R A;  4GUV A;  1F8W A;  3M12 A;  4HA6 A;  3QJ4 A;  4J33 A;  1H7W A;  2FJB A;  1Q1R A;  4Z2U A;  1F6M A;  3GD4 A;  1CC2 A;  3QFB A;  1SEZ A;  1XAN A;  2YG7 A;  3AE4 A;  3EPT A;  1ONF A;  4U8P A;  3NK2 X;  1COY A;  1VRQ B;  3NIX A;  4JNA A;  1ZKQ A;  3EAO A;  4APN A;  1E1M A;  3AE3 A;  4N9X A;  3VR9 A;  4AP3 A;  3AEA A;  2WPF A;  2BK3 A;  1LPF A;  3ZDN A;  1PBB A;  2JAE A;  4C3X A;  2R0G A;  2I0Z A;  3SGL A;  3NN0 X;  1GTH A;  2V6O A;  2EQ8 A;  2QAE A;  2JBV A;  2OAM A;  2V3A A;  2GR1 A;  1DOC A;  2GAG B;  4YKF A;  4GRT A;  3P4S A;  1PBF A;  2AR8 A;  1O95 A;  3F8R A;  4OPI A;  3QSM A;  4CY8 A;  5U63 A;  4J2W A;  2Y6Q A;  3BNU A;  5JCN A;  2EQ9 A;  4H4Y A;  1ZX9 A;  3CGB A;  1TDO A;  3UCL A;  4YTM A;  4GR1 A;  3E1T A;  1BKW A;  1E1N A;  2XVJ A;  1REO A;  1ZMD A;  1BGN A;  4JY2 A;  2WET A;  1NEK A;  1Y56 B;  4BUR A;  4X9N A;  2VRL A;  2YVG A;  4K5S A;  5L46 A;  2E5V A;  2IID A;  2B76 A;  2B9W A;  1QO8 A;  3QSS A;  1GRF A;  3NYC A;  1W4X A;  3AD7 B;  4IA6 A;  2O9Z A;  4U8M A;  1BWC A;  2Q6U A;  3SM8 A;  2YM2 A;  3CTY A;  3UKH A;  3D1C A;  4H4Z A;  4Z25 A;  4MJW A;  2CDU A;  2XLU A;  5FS9 A;  2VVM A;  4H4T A;  4H4W A;  1M64 A;  1GRA A;  2C7G A;  2R4J A;  2ZBW A;  4HB9 A;  5J60 A;  2VQB A;  2X8G A;  2XFU A;  2ZZB A;  3FG2 P;  2Q0K A;  4YT0 A;  3PS9 A;  5KVH A;  2EQ6 A;  3UOZ A;  2YR6 A;  1F8R A;  2RGH A;  4BJZ A;  1DXL A;  2R0C A;  5HXI A;  1S2Y A;  2YLZ A;  1PJ7 A;  1YY5 A;  2FBW A;  4I59 A;  1Q9I A;  2V60 A;  3PO7 A;  2YAU A;  1NHR A;  2C70 A;  5BVA A;  1S2Q A;  3COX A;  1NDA A;  1EL9 A;  2XLS A;  3KU9 A;  3NYF A;  2C64 A;  3P4Q A;  3BI5 A;  4B69 A;  5CKU A;  3UKF A;  3NN6 X;  4GF7 A;  1VQW A;  3Q9T A;  4USR A;  3NH3 X;  5EB5 A;  5JCM A;  2H89 A;  5GSN A;  1K0I A;  2JK6 A;  1EL7 A;  1KF6 A;  4X9M A;  2WOI A;  1IJH A;  1F8S A;  1TDF A;  3IHM A;  4FK1 C;  2V3B A;  1ZOV A;  2WP6 A;  3T37 A;  5FS8 A;  5DBJ A;  4USQ A;  3V76 A;  2C3C A;  3NK0 X;  4C74 A;  2YQU A;  4TM1 A;  1NHQ A;  3AD9 B;  3NLC A;  4CBQ A;  1TDK A;  3AWI A;  1FOH A;  3GYI A;  1H84 A;  4U2T A;  1L9C A;  2XLP A;  3F8D A;  2GRT A;  4TLX A;  4C3Y A;  2GQW A;  1H81 A;  1OJC A;  2YR4 A;  2B9Y A;  2FJA A;  2BC0 A;  2BK5 A;  4OPG A;  4JY3 A;  2E1M A;  1CBO A;  1IUT A;  1P2E A;  1N4W A;  4K8D A;  3ADA B;  3SFE A;  1CF3 A;  3AEG A;  1GOS A;  4K7Z A;  1GPE A;  2ACZ A;  4EQS A;  3S5W A;  3WE0 A;  2W0H A;  3RP8 A;  2OAL A;  2YLT A;  4RSL A;  2QA2 A;  3AEE A;  2BCG G;  2C72 A;  1PHH A;  1GRH A;  2QA1 A;  2X3N A;  3K7T A;  1L0V A;  1KSU A;  3BHF A;  2GR0 A;  1IUX A;  1CL0 A;  1S3E A;  3G5S A;  3BNM A;  4DSH A;  5KWF A;  2XFO A;  2Q0L A;  2IVD A;  2A89 A;  5KOX A;  4A99 A;  1PXA A;  1TDN A;  1GTE A;  5J7X A;  4KPR A;  3CNP A;  1FCD A;  3GYJ A;  1N1P A;  3ITJ A;  3GRS A;  3O0H A;  5TR3 A;  2APG A;  1B37 A;  5EBK A;  1D4E A;  1N4U A;  2X99 A;  2A87 A;  4DNA A;  1NAA A;  3UTF A;  3I3L A;  1ZK7 A;  4JDR A;  3LJP A;  3DJD A;  1X31 B;  2R46 A;  1FEA A;  4EQR A;  1LJ1 A;  3NTD A;  4BJY A;  4BV6 A;  4YSY A;  1ZY8 A;  1JOA A;  2XVE A;  4B68 A;  4YKG A;  2WP9 A;  3UKL A;  4H2P A;  5BUL A;  4NEW A;  1JEH A;  1DJN A;  2WES A;  3GWD A;  1O5W A;  4Y4L A;  1GES A;  4EIQ A;  2XLR A;  3LZW A;  1D4C A;  2YLW A;  1XDI A;  2WS3 A;  4M52 A;  2B7S A;  3DJG X;  1KDG A;  2WBA A;  2VVL G;  5CQF A;  3AE2 A;  2BC1 A;  1BGJ A;  1DJQ A;  4J56 A;  2BAB A;  2R9Z A;  1DOB A;  5HY5 A;  2X50 A;  2GH5 A;  3BI4 A;  4H50 A;  1OJT A;  1JNZ A;  3K7Q X;  3EAN A;  3G5Q A;  4D04 A;  1D5T A;  2GQF A;  1H82 A;  3UKA A;  3UTE A;  4REK A;  3QSE A;  2BAC A;  4ECH A;  2WP5 A;  3KPF A;  4D03 A;  3QVP A;  4CRT A;  1LQU A;  4H2Q A;  1TDE A;  4YTP A;  3GD3 A;  2WPE A;  1M6I A;  2WDR A;  1HYU A;  3NRN A;  4IV9 A;  3UP4 A;  3RNM A;  4XWZ A;  1GRT A;  3KLJ A;  3CNT A;  2BXR A;  3B6D A;  4B1B A;  4TM3 A;  3RHA A;  1OJ9 A;  2AQJ A;  3P1W A;  2EQ7 A;  1KNR A;  4NTD A;  3CGE A;  3GWF A;  1GV4 A;  2C76 A;  3VRB A;  3AYL A;  2WOW A;  2OLN A;  4JNQ A;  2TMD A;  2XYO A;  5LV9 A;  3FIM B;  3NGC X;  4WCT A;  2ZZC A;  3UOV A;  4BK1 A;  5C3J A;  1GRB A;  3QVR A;  4U2L A;  4FDC B;  1DOD A;  1K4Q A;  4JQ9 A;  4JN9 A;  4IA5 A;  4K5R A;  2YG5 A;  1XPQ A;  5U1O A;  5IQ1 A;  1H86 A;  4TM4 A;  5JCL A;  4B67 A;  3AXB A;  4AT0 A;  4I58 A;  2WDQ A;  3M0O A;  3ICR A;  4UDR A;  3ALM A;  3H8I A;  1E7P A;  2C73 A;  4J36 A;  4CNJ A;  3DK9 A;  1E1K A;  2JKC A;  3AE7 A;  4H2N A;  4A6N A;  4DSG A;  3SQP A;  2GVC A;  2XVH A;  3AE8 A;  3H4K A;  4ICY A;  4BK2 A;  1DNC A;  4K22 A;  2GF3 A;  4BK3 A;  1CJC A;  1N4V A;  3NNE A;  2R45 A;  1PXC A;  2WDV A;  2Y6R A;  4Z43 A;  2AAQ A;  3V3N A;  2CUL A;  3FMW A;  4LU6 A;  5M10 A;  3AE9 A;  2Q7V A;  4OPU A;  3DH9 A;  3D8X A;  1E6E A;  4UDP A;  1MO9 A;  5KXJ A;  3UOY A;  1NG3 A;  2IVE A;  1PXB A;  4X4J A;  4CY6 A;  1GER A;  1K0L A;  4U8J A;  3ZYX A;  1PBD A;  3JSK A;  4RG3 A;  4WX1 A;  4LA1 A;  5EOW A;  4YSX A;  4YSZ A;  3HZL A;  1EL5 A;  1JRZ A;  3DJE A;  3RP6 A;  3URH A;  4AT2 A;  1TRB A;  4FK1 A;  4U8L A;  4E0V A;  4ZCC A;  4H4R A;  4AOS A;  3DA1 A;  2ARD A;  5EB4 A;  2TPR A;  1KNP A;  1CJ3 A;  2DKH A;  4NTE A;  4TM0 A;  4EM4 A;  2GV8 A;  2J3N A;  1YQ3 A;  2YG3 A;  4CCR A;  5C2T A;  4H7U A;  4Z2T A;  4ZN0 A;  4YXD A;  2F5Z A;  2FJD A;  2BYB A;  2JB1 A;  3ALJ A;  4OVI A;  1ZOY A;  4NTC A;  1NPX A;  3DJJ A;  5GRT A;  3AEC A;  1D7Y A;  4PAA A;  4Z44 A;  1Z6L A;  3CPJ G;  1P2H A;  3UTH A;  1GRG A;  4OPD A;  3LZX A;  1LTX R;  2YM1 A;  2BA9 A;  1YQZ A;  3NK1 X;  4GDP A;  1NG4 A;  2GMH A;  2GB0 A;  1KSS A; 
#chains in the Genus database with same CATH topology
 3S61 A;  4E8G A;  1X2G A;  3NTA A;  3AEB A;  1PBE A;  1GET A;  2QJM A;  1WYG A;  2Z5X A;  3DK4 A;  4H4X A;  2C75 A;  3ABV A;  3BJS A;  2B7R A;  4G7F A;  2GR2 A;  3ATQ A;  3NXL A;  3AB1 A;  4H19 A;  3RIT A;  3DFH A;  4G8T A;  3ISH A;  3AYI A;  4CCQ A;  2GR3 A;  3I6D A;  2FJE A;  1Y56 A;  2OFJ A;  5IPY A;  3NFU A;  4MMW A;  1DOE A;  3SZF A;  4U8K A;  1CHU A;  3R11 A;  3UJ2 A;  1AOG A;  1TYP A;  3OZ2 A;  4K2S A;  3CN8 A;  1LVL A;  1SJA A;  2AKM A;  1B4V A;  3NKS A;  2HXU A;  1B5Q A;  1EBD A;  3SN1 A;  3CGD A;  4CNK A;  4EM3 A;  3GRT A;  3QPE A;  3KD9 A;  1RM6 B;  1GSN A;  1VQZ A;  3FYY A;  1IUW A;  2C4C A;  2PHH A;  4O5U A;  3NRZ B;  1FO4 A;  1OJD A;  2MUC A;  3DK8 A;  2QCU A;  5KRQ A;  4J57 A;  4ZCW A;  2XFN A;  3T2K A;  3BHK A;  4NNJ A;  1E39 A;  4AOX A;  2X8C A;  2JB3 A;  3P4R A;  2PGW A;  1YEY A;  2C66 A;  3NG7 X;  2P8B A;  3R10 A;  1Q1W A;  4H4V A;  4LII A;  3T9P A;  3VRD B;  2OPJ A;  2NPX A;  1FHU A;  3KVE A;  1SB3 B;  3BSM A;  1RP0 A;  4AP1 A;  4GGH A;  3L5O A;  4IVM B;  5KMS A;  2ZZ0 A;  3BI2 A;  2WOV A;  2A8X A;  3UTG A;  3CIR A;  3H70 A;  1JU2 A;  4J34 A;  1B8S A;  3H8L A;  4TVY A;  1EL8 A;  3CNS A;  3CND A;  3UOX A;  1D7L A;  1PDH A;  2YWL A;  4A7A A;  1SJC A;  3AE1 A;  1R0M A;  2O56 A;  4HA6 A;  3TTE A;  3NVW B;  3EPT A;  1XAN A;  1ONF A;  3NIX A;  3U9I A;  3UCD A;  3VR9 A;  2WPF A;  3TWA A;  3RRA A;  3QLD A;  3NN0 X;  1GTH A;  2V6O A;  2JBV A;  2QAE A;  2NQL A;  4HCH A;  3KPK A;  4CY8 A;  4J2W A;  3VCN A;  3SSZ A;  3RR1 A;  2EQ9 A;  1ZX9 A;  3UCL A;  2XVJ A;  1REO A;  1BGN A;  2WET A;  2GGI A;  1Y56 B;  2W54 A;  2B76 A;  1V97 A;  2P88 A;  3QSS A;  1W4X A;  3AD7 B;  2Q6U A;  3D1C A;  2CDU A;  1GRA A;  4H4W A;  4H4T A;  4IL2 A;  2ZZB A;  1FHV A;  3IJQ A;  2EQ6 A;  5HXI A;  1Q9I A;  2V60 A;  1NHR A;  2XLS A;  3KU9 A;  3D46 A;  1SJB A;  5CKU A;  3NN6 X;  3NH3 X;  2CHR A;  5GSN A;  2PTW A;  1IJH A;  3STP A;  1TDF A;  3CYJ A;  3CB3 A;  1R6W A;  5FS8 A;  5DBJ A;  1NEL A;  3NLC A;  3AMZ A;  3AWI A;  2I5Q A;  3GYI A;  2XLP A;  1RVK A;  2GQW A;  3VFC A;  2B9Y A;  4JY3 A;  1P2E A;  1N4W A;  2ACZ A;  4EQS A;  1EC9 A;  4JN7 A;  3ZLG A;  4RSL A;  1GRH A;  3K7T A;  1L0V A;  2GR0 A;  1IUX A;  1S3E A;  4DSH A;  3QKE A;  1GTE A;  3CNP A;  3EUB 3;  3ITJ A;  3ENL A;  2APG A;  1B37 A;  5EBK A;  4DNA A;  4MKS A;  1FEA A;  4ROP A;  4BV6 A;  4YSY A;  1JOA A;  4GIR A;  5BUL A;  4NEW A;  3GWD A;  4Y4L A;  1GES A;  4EIQ A;  4ZOH B;  3LZW A;  4M52 A;  3TOY A;  1KDG A;  1BGJ A;  4J56 A;  5FJP A;  2XH4 A;  5HY5 A;  3BI4 A;  3K7Q X;  1H82 A;  4REK A;  2HZG A;  3UCC A;  2WP5 A;  6ENL A;  3KPF A;  4CRT A;  4YTP A;  4HN8 A;  3NRN A;  3UP4 A;  3R25 A;  3B6D A;  2QGY A;  2EQ7 A;  1GV4 A;  3AYL A;  2OLN A;  1BQG A;  3NGC X;  5C3J A;  4U2L A;  4FDC B;  4K5R A;  4E6M A;  3N6H A;  4AT0 A;  1P48 A;  3FVD A;  4I58 A;  3M0O A;  2GSH A;  1E1K A;  4H2N A;  1X2H A;  4DWD A;  3NNE A;  1PXC A;  2AAQ A;  3V3N A;  2CUL A;  3IJL A;  3FMW A;  4FI4 A;  4Z1Y A;  5KXJ A;  1PXB A;  1K0L A;  4U8J A;  1PBD A;  3Q45 A;  3HZL A;  4IP5 A;  1EL5 A;  1JRZ A;  3DJE A;  2FKP A;  4FK1 A;  5EB4 A;  2TPR A;  3ES8 A;  4EM4 A;  3S47 A;  4CCR A;  4H7U A;  2F5Z A;  3K1G A;  1ZOY A;  4NTC A;  1D7Y A;  5JRB A;  3MSY A;  2P3Z A;  1NG4 A;  3HYV A;  1KSS A;  3A7U A;  3GMC A;  1JRX A;  1N61 C;  1FEB A;  2BXS A;  3IF9 A;  4DN1 A;  5G5G B;  1GXF A;  1S3B A;  1YKJ A;  1N63 C;  3B9J B;  3T6C A;  4B64 A;  2YLS A;  2PMQ A;  4A5L A;  3SFD A;  3DER A;  1OJA A;  4C5O A;  3TW9 A;  2GAH B;  4OCG A;  3GDN A;  2GMJ A;  1MDL A;  3QFA A;  1JRO A;  2C67 A;  1NHS A;  2XH7 A;  1PS9 A;  1N62 C;  5FMH A;  4C77 A;  4A79 A;  2RDX A;  4ZCD A;  3N4F A;  2WQY A;  2XFP A;  3K7M X;  2WU5 A;  1QJD A;  2GEW A;  2OVL A;  1UKV G;  5BUK A;  3ALL A;  3R9U A;  5FJU A;  3GY1 A;  4IZG A;  2QDD A;  4J31 A;  2WHD A;  4EMJ A;  1D4D A;  3NVZ B;  4U8N A;  3A7A A;  4OPL A;  4G6H A;  2BCP A;  2YLX A;  4PAB A;  3DGH A;  2W55 A;  3IC9 A;  2V5Z A;  2BS2 A;  2XCG A;  1F3P A;  4Z26 A;  2X8H A;  4M6U A;  4OPC A;  3UKQ A;  2YVF A;  1F9C A;  2XVF A;  3DFY A;  1Y0P A;  1XHC A;  2OLO A;  3DEQ A;  2POD A;  2OZ3 A;  1CJ4 A;  1P43 A;  4IL0 A;  2V61 A;  3CPI G;  2DKI A;  3LB8 A;  4O5Q A;  2XFQ A;  2YLR A;  4MGG A;  3CPH G;  1L9D A;  1DTN A;  2BS3 A;  3PWG A;  2VZ2 A;  2DW7 A;  2OQY A;  3T14 A;  2OZ8 A;  3DIP A;  3VQR A;  2XH2 A;  3UJE A;  5FS7 A;  2YVJ A;  2XVI A;  1RYI A;  4U2S A;  2AL1 A;  5J04 A;  4GDE A;  4FX9 A;  4A35 A;  4H2R A;  4H4U A;  5JCK A;  1H83 A;  1IUS A;  1YQ4 A;  2RAB A;  5BOE A;  3F8P A;  5KMP A;  3ATR A;  4YWO A;  3I4K A;  5ER0 A;  2YG4 A;  3UGV A;  1H7X A;  2PTZ A;  3H12 A;  3AYJ A;  4H4Q A;  4EMI A;  1QLB A;  2RGO A;  1NHP A;  4A3R A;  3P4P A;  3B3R A;  4GUV A;  1F8W A;  3M12 A;  1Q1R A;  1SEZ A;  3ZLH A;  1E1M A;  3AE3 A;  4N9X A;  3AEA A;  3UXK A;  2DW6 A;  3ZDN A;  2JAE A;  3DDM A;  3SN0 A;  4II3 A;  4GRT A;  3ZVI A;  3QSM A;  5FJR A;  5JCN A;  3CGB A;  2QQ6 A;  4GR1 A;  3E1T A;  3AM9 A;  1JRP A;  4HPN A;  4X9N A;  2VRL A;  3SZC A;  4K5S A;  5L46 A;  3CXO A;  3PK7 A;  2O9Z A;  4U8M A;  1BWC A;  2E5A A;  4H4Z A;  1NU5 A;  2ZBW A;  2C7G A;  1M64 A;  3OPS A;  3THU A;  2ZAD A;  2XFU A;  3PS9 A;  5KVH A;  3UOZ A;  1F8R A;  4ENL A;  2R0C A;  1S2Y A;  2YLZ A;  1PJ7 A;  1YY5 A;  5BVA A;  4I59 A;  1SJD A;  2C70 A;  3COX A;  2C64 A;  3P3B A;  3BI5 A;  3P4Q A;  2MNR A;  2E3T A;  4GF7 A;  4HCD A;  4USR A;  5EB5 A;  1KF6 A;  1WUF A;  1E9I A;  3T37 A;  3V76 A;  3NK0 X;  4C74 A;  1NHQ A;  1H84 A;  2GRT A;  4TLX A;  3CK5 A;  4F4R A;  3RGT A;  3DG7 A;  2BC0 A;  4ZA0 A;  3ZVH A;  2BK5 A;  4OPG A;  1CBO A;  2OO6 A;  3ADA B;  1CF3 A;  4K7Z A;  3WE0 A;  3RP8 A;  1PHH A;  2QA1 A;  4GYP C;  5KWF A;  3V5F A;  2XFO A;  3SQS A;  3V4B A;  4KEM A;  1FCD A;  2GL5 A;  2P0I A;  1N4U A;  1NAA A;  3DJD A;  3EEZ A;  3VDG A;  1LJ1 A;  1ZY8 A;  4B68 A;  2XVE A;  2WP9 A;  3UKL A;  4H2P A;  3UJR A;  1H2I A;  3H8A A;  3DJG X;  2WBA A;  5CQF A;  3AE2 A;  1DJQ A;  2BAB A;  3R1Z A;  2GH5 A;  3R0K A;  1OEP A;  1JNZ A;  4D04 A;  3UTE A;  3QSE A;  2BAC A;  4D03 A;  4JHM A;  4X2P A;  2AL2 A;  1VDV A;  3QVP A;  1LQU A;  3GD3 A;  3RNM A;  1GRT A;  3KLJ A;  4TM3 A;  2POZ A;  2GDQ A;  3P1W A;  3GWF A;  4G6G A;  2WOW A;  2TMD A;  1FIQ B;  4WCT A;  3UXL A;  3UOV A;  3T4W A;  1DOD A;  4IA5 A;  1XPQ A;  5U1O A;  4TM4 A;  2WDQ A;  3ICR A;  4II2 A;  4J36 A;  2JKC A;  3AE7 A;  2GVC A;  1XPY A;  3MUC A;  1E6E A;  2FYM A;  3SY4 A;  4KWS A;  4KT2 A;  3ZYX A;  1KD0 A;  3JSK A;  3RP6 A;  3URH A;  4GFI A;  1TRB A;  4ZCC A;  4H4R A;  3ZLF A;  2DKH A;  3V3W A;  2BYB A;  2JB1 A;  3ALJ A;  2XH0 A;  1P2H A;  3UTH A;  3N4E A;  3ZVH B;  4A6G A;  2YM1 A;  1YQZ A;  3NK1 X;  4JN8 A;  4Z2R A;  4HYR A;  3Q9T A;  1NEN A;  2PA6 A;  2WPC A;  1TKK A;  5JCI A;  4DGK A;  1IUV A;  5BRT A;  3RCY A;  5G5H B;  2PGE A;  2OQH A;  2PYX A;  1GT8 A;  2WU2 A;  4IP4 A;  3RO6 A;  4Z17 A;  4K8G A;  4ADW A;  2VRM A;  3OZY A;  2C3D A;  3EF6 A;  3TWB A;  1EBH A;  1LQT A;  4EQX A;  3II4 A;  4YTN A;  4Z24 A;  3ETR B;  4H4S A;  3KA7 A;  1VG0 A;  2XDO A;  3DME A;  3DG3 A;  3K30 A;  3FBS A;  1IYX A;  2YG6 A;  2AL2 B;  1JNR A;  2H88 A;  3V3O A;  1O94 A;  1GND A;  1FFV C;  3AE6 A;  3SYI A;  2VQ7 A;  3I6T A;  2OKT A;  1XS2 A;  1E1L A;  1EBG A;  3AE5 A;  4XXG A;  3FPZ A;  3RP7 A;  1N60 C;  3HRD C;  4NZH A;  1H6V A;  3ICT A;  5M0Z A;  4H1Z A;  3H7V A;  2CFY A;  4KX6 A;  2OZT A;  1KFY A;  4XWR A;  3IWA A;  2C65 A;  3AED A;  2PU1 A;  2BS4 A;  3AN1 A;  2UZZ A;  4GCM A;  1MUC A;  3AD8 B;  4NEV A;  1ZMC A;  1FL2 A;  2BRY A;  3CGC A;  5FS6 A;  3UKK A;  3R07 C;  2P8C A;  3Q6J A;  1KKO A;  3CNJ A;  4HNL A;  3LAD A;  2JB2 A;  2VVL A;  4A9W A;  1N5W C;  2R0P A;  3KKJ A;  2QJN A;  4UP3 A;  3FXG A;  3NHO X;  2XGZ A;  3UJS A;  1MXT A;  5KVI A;  5BOF A;  3JW7 A;  1ELS A;  3AEF A;  4YWS A;  3LOV A;  1CC4 A;  3ICS A;  3OZM A;  4IHC A;  3OC4 A;  3TCS A;  4H4P A;  4EQW A;  3GSI A;  4U8I A;  3VR8 A;  1V59 A;  3NVY B;  3S5S A;  4Z2U A;  3SN4 A;  3AE4 A;  3QFB A;  2YG7 A;  4U8P A;  3NK2 X;  1COY A;  2PCE A;  4JNA A;  4AP3 A;  2BK3 A;  1LPF A;  1PBB A;  2R0G A;  2I0Z A;  3SGL A;  1BKH A;  2EQ8 A;  2V3A A;  3TJI A;  2OAM A;  1DOC A;  3P4S A;  1MNS A;  4OPI A;  4HCL A;  1W6T A;  5U63 A;  2Y6Q A;  3BNU A;  3TQP A;  4YTM A;  3CMM A;  1ZMD A;  1NEK A;  2QDE A;  4BUR A;  2YVG A;  1QO8 A;  3FV9 A;  4IA6 A;  3SBF A;  3UKH A;  4MJW A;  2XLU A;  5FS9 A;  2R4J A;  5J60 A;  2X8G A;  3V5C A;  4YT0 A;  2RGH A;  1DXL A;  2FBW A;  3PO7 A;  2YAU A;  1NDA A;  1T3Q C;  2QJJ A;  3QN3 A;  3CXB A;  3UKF A;  1VQW A;  5JCM A;  1PDY A;  1K0I A;  2JK6 A;  4X9M A;  1F8S A;  3VC6 A;  2V3B A;  1ZOV A;  5KNL A;  4CBQ A;  1TDK A;  1FOH A;  4C3Y A;  1JDF A;  1H81 A;  2YR4 A;  2E1M A;  3HPF A;  4GGB A;  3HYX A;  3NZG A;  3SZW A;  2BRA A;  3S5W A;  3FCP A;  1EC8 A;  3MY9 A;  2BCG G;  1KSU A;  3G5S A;  1CL0 A;  3BNM A;  3P0W A;  2PPG A;  2A89 A;  1TZZ A;  4A99 A;  3QTP A;  5J7X A;  3PFR A;  3O0H A;  5TR3 A;  4GAP A;  3UTF A;  3I3L A;  1S7M A;  3LJP A;  3NTD A;  4BJY A;  4EQR A;  3T2Y A;  4YKG A;  1JCT A;  2WES A;  1O5W A;  2YLW A;  4H2H A;  3VCC A;  2R9Z A;  1DOB A;  2X50 A;  4H50 A;  1OJT A;  3G5Q A;  4ECH A;  1ECQ A;  5FJO A;  4H2Q A;  1TDE A;  1HYU A;  3CNT A;  2BXR A;  4B1B A;  3RHA A;  3BOX A;  3ES7 A;  1OJ9 A;  2AQJ A;  1KNR A;  3CGE A;  2C76 A;  2PP1 A;  3OP2 A;  5LV9 A;  3FIM B;  2ZZC A;  1ONE A;  4JN9 A;  2PTX A;  2AKZ A;  4UDR A;  3ALM A;  3H8I A;  1E7P A;  3DG6 A;  4CNJ A;  2W3S A;  4A6N A;  4DSG A;  3P93 A;  2XVH A;  3AE8 A;  3H4K A;  4BK2 A;  1DNC A;  1N4V A;  2R45 A;  2WDV A;  2Y6R A;  4Z43 A;  2ONE A;  3AE9 A;  5EU9 A;  4OPU A;  1MO9 A;  4DXK A;  1FFU C;  1NG3 A;  2IVE A;  4X4J A;  4CY6 A;  4YSX A;  4LA1 A;  4YSZ A;  4E0V A;  2ARD A;  1CJ3 A;  4TM0 A;  2GV8 A;  1YQ3 A;  2YG3 A;  5C2T A;  4Z2T A;  4ZN0 A;  3GYX A;  2PP0 A;  3DJJ A;  3AEC A;  3HW2 A;  4PAA A;  4Z44 A;  3MQT A;  4OPD A;  2GMH A;  4TLZ A;  3L1R A;  3IJI A;  4U8O A;  1GRE A;  4GYP A;  3OTR A;  4P9S A;  3C4N A;  1K0J A;  1JRY A;  2W3R A;  1TE6 A;  1MDR A;  4J1O A;  1CC6 A;  5HYM A;  2OLA A;  3NYE A;  2B9X A;  2GGG A;  3MWC A;  2ZC8 A;  3IHG A;  4KPL A;  3GC2 A;  1JPM A;  4RG4 A;  5KOW A;  4A65 A;  3UP5 A;  3NS1 B;  3GMB A;  1CJ2 A;  1TYT A;  3D9X A;  1GAL A;  1PDZ A;  2XLT A;  4NWZ A;  1STZ A;  4OPT A;  1WUE A;  4EIP A;  1ZDL A;  4K2X A;  4G73 A;  2YR5 A;  3GDP A;  2OA1 A;  3UKP A;  1ZXI C;  4M0X A;  2R4E A;  3L8K A;  1PBC A;  1LV0 A;  1PJ6 A;  4B63 A;  4B66 A;  3HYW A;  4IVO B;  3G5R A;  3C4A A;  4EMW A;  3P9U A;  1RSG A;  1MRA A;  4E5T A;  3GD6 A;  2HQM A;  3RED A;  2PS2 A;  4Y4M A;  4H83 A;  2HNE A;  3MZN A;  2NVK X;  3NT6 A;  1GEU A;  3MKC A;  4B65 A;  3PVC A;  3C96 A;  1PJ5 A;  3SXI A;  2CVJ A;  2Z5Y A;  4A6N B;  3PG6 A;  1IUU A;  3VRA A;  4UDQ A;  3T2Z A;  1KKR A;  2PTY A;  1FEC A;  1ELI A;  1EC7 A;  5U25 A;  3DGZ A;  4Y4N A;  3M13 A;  1BZL A;  3SJN A;  4G9K A;  3LXD A;  3DGB A;  3VC5 A;  4YSH A;  2PU0 A;  1MOK A;  2E4G A;  1VG9 A;  3A7R A;  1ZP0 A;  5IQ4 A;  4GAV A;  2RGJ A;  5HHF A;  1BF3 A;  3EKG A;  1PN0 A;  1VDC A;  2BK4 A;  1L9E A;  2VOU A;  2WEU A;  3QJ4 A;  4J33 A;  1H7W A;  2FJB A;  1F6M A;  4TVW A;  3GD4 A;  1CC2 A;  1VRQ B;  2GGE A;  1ZKQ A;  3EAO A;  4APN A;  3KUM A;  3PWI A;  2XSX A;  4C3X A;  3CAW A;  4IT1 A;  2GR1 A;  2GAG B;  4YKF A;  1PBF A;  2AR8 A;  1O95 A;  3F8R A;  4K1W A;  4H4Y A;  1TDO A;  1BKW A;  1E1N A;  4JY2 A;  1KN0 A;  2E5V A;  2IID A;  2B9W A;  1GRF A;  3NYC A;  4E4F A;  3SM8 A;  2YM2 A;  3CTY A;  7ENL A;  3T0K A;  4Z25 A;  2VVM A;  3N6J A;  4HB9 A;  2VQB A;  3OW1 A;  4GME A;  2HXT A;  3FG2 P;  2Q0K A;  5IDZ A;  2YR6 A;  4BJZ A;  3DES A;  2GGH A;  1S2Q A;  1EL9 A;  3NYF A;  4B69 A;  4EWJ A;  2H89 A;  5KMR A;  3U4F A;  1EL7 A;  2WOI A;  3IHM A;  4FK1 C;  2WP6 A;  4USQ A;  2C3C A;  2YQU A;  4TM1 A;  3AD9 B;  4U2T A;  1L9C A;  3F8D A;  3UJF A;  1OJC A;  2FJA A;  1IUT A;  3SR6 B;  4K8D A;  3SFE A;  3AEG A;  1GOS A;  1GPE A;  3NVV B;  2W0H A;  2GGJ A;  2OAL A;  2YLT A;  2QA2 A;  3AEE A;  2C72 A;  2X3N A;  4E4U A;  3BHF A;  1L8P A;  2Q0L A;  2IVD A;  5KOX A;  4FP1 A;  3D47 A;  1PXA A;  1TDN A;  4KPR A;  3GYJ A;  1N1P A;  3SX6 A;  3GRS A;  3CT2 A;  3I6E A;  3Q4D A;  1D4E A;  2X99 A;  2A87 A;  1ZK7 A;  4JDR A;  1N5X A;  3FJ4 A;  3NO1 A;  1X31 B;  2R46 A;  3VA8 A;  1JEH A;  1DJN A;  3JVA A;  2XLR A;  1D4C A;  2PSN A;  1XDI A;  2WS3 A;  2B7S A;  2PP3 A;  2VVL G;  2BC1 A;  3EAN A;  1D5T A;  2GQF A;  3UKA A;  3GO2 A;  2WPE A;  1M6I A;  2WDR A;  4IV9 A;  4XWZ A;  3T8Q A;  2QVH A;  4NTD A;  4G74 A;  3VRB A;  1JPD X;  4JNQ A;  2XYO A;  4BK1 A;  1GRB A;  3QVR A;  3T31 A;  1K4Q A;  4JQ9 A;  2YG5 A;  4DYE A;  3IK4 A;  1H86 A;  5IQ1 A;  5JCL A;  4B67 A;  3AXB A;  2C73 A;  3JZU A;  5KMQ A;  3DK9 A;  3SZ0 A;  3SQP A;  4ICY A;  4K22 A;  2GF3 A;  4BK3 A;  1CJC A;  4DHG A;  3B97 A;  1KCZ A;  4LU6 A;  5M10 A;  2Q7V A;  5FJT A;  4GIS A;  3DH9 A;  3D8X A;  4UDP A;  3UOY A;  1GER A;  4RG3 A;  4WX1 A;  5EOW A;  4DX3 A;  4AT2 A;  4U8L A;  5ENL A;  4AOS A;  3DA1 A;  4HNC A;  1KNP A;  4NTE A;  2J3N A;  4J3Z A;  2OG9 A;  4YXD A;  3TJ4 A;  2FJD A;  4OVI A;  1NPX A;  3R0U A;  5GRT A;  1Z6L A;  3CPJ G;  1GRG A;  3LZX A;  1LTX R;  2BA9 A;  2OX4 A;  4GDP A;  2GB0 A; 
#chains in the Genus database with same CATH homology
 3S61 A;  3GMC A;  1JRX A;  1FEB A;  2BXS A;  3L1R A;  3IF9 A;  1NEN A;  3NTA A;  3AEB A;  2WPC A;  1PBE A;  1GXF A;  1GET A;  4U8O A;  1GRE A;  1S3B A;  3DK4 A;  1YKJ A;  2Z5X A;  5JCI A;  4DGK A;  4P9S A;  4B64 A;  4H4X A;  2YLS A;  1IUV A;  2C75 A;  3C4N A;  1K0J A;  3ABV A;  1JRY A;  4A5L A;  3SFD A;  1OJA A;  5BRT A;  2B7R A;  4C5O A;  1CC6 A;  2GAH B;  4OCG A;  5HYM A;  4Z2R A;  2GR2 A;  3GDN A;  2GMJ A;  3ATQ A;  3NYE A;  2B9X A;  3AB1 A;  2PYX A;  1GT8 A;  3IHG A;  3ISH A;  3QFA A;  2C67 A;  4RG4 A;  1NHS A;  3AYI A;  1PS9 A;  2WU2 A;  4CCQ A;  5FMH A;  2GR3 A;  3I6D A;  4C77 A;  5KOW A;  4A65 A;  2FJE A;  4A79 A;  3UP5 A;  1Y56 A;  4ADW A;  2VRM A;  5IPY A;  4ZCD A;  2C3D A;  3EF6 A;  1LQT A;  2WQY A;  2XFP A;  3GMB A;  4EQX A;  3K7M X;  2WU5 A;  3II4 A;  1CJ2 A;  1DOE A;  1QJD A;  2GEW A;  3SZF A;  1TYT A;  3D9X A;  4U8K A;  1CHU A;  1UKV G;  1GAL A;  4Z24 A;  4YTN A;  5BUK A;  1AOG A;  3ALL A;  3R9U A;  1TYP A;  3OZ2 A;  4H4S A;  3KA7 A;  2XLT A;  3CN8 A;  4NWZ A;  1VG0 A;  1LVL A;  4OPT A;  2XDO A;  4EIP A;  1ZDL A;  1B4V A;  4J31 A;  2WHD A;  4K2X A;  3DME A;  4EMJ A;  1D4D A;  3NKS A;  3K30 A;  4U8N A;  3FBS A;  4OPL A;  1B5Q A;  1EBD A;  2YG6 A;  4G6H A;  4G73 A;  2BCP A;  3CGD A;  4CNK A;  1JNR A;  2YLX A;  4EM3 A;  3GRT A;  2YR5 A;  2OA1 A;  3GDP A;  4PAB A;  3DGH A;  2H88 A;  3UKP A;  3V3O A;  1O94 A;  2R4E A;  1GND A;  3L8K A;  3AE6 A;  3KD9 A;  1GSN A;  1PBC A;  3IC9 A;  1LV0 A;  1PJ6 A;  2VQ7 A;  2V5Z A;  2BS2 A;  2XCG A;  3SYI A;  1F3P A;  4B66 A;  4B63 A;  1IUW A;  3HYW A;  3G5R A;  2C4C A;  2PHH A;  4IVO B;  4O5U A;  4Z26 A;  3C4A A;  1E1L A;  4EMW A;  3P9U A;  3AE5 A;  2X8H A;  1RSG A;  3FPZ A;  4XXG A;  3RP7 A;  1OJD A;  4OPC A;  2HQM A;  3DK8 A;  2QCU A;  3RED A;  4J57 A;  2XFN A;  3UKQ A;  5KRQ A;  4Y4M A;  2YVF A;  3T2K A;  3BHK A;  4NZH A;  4NNJ A;  1E39 A;  1H6V A;  4TLZ A;  3ICT A;  2XVF A;  5M0Z A;  2NVK X;  3NT6 A;  4AOX A;  2X8C A;  1Y0P A;  3VRA A;  2JB3 A;  1XHC A;  2OLO A;  3P4R A;  1GEU A;  2CFY A;  4B65 A;  3PVC A;  4KX6 A;  3C96 A;  1PJ5 A;  4XWR A;  1CJ4 A;  1KFY A;  3SXI A;  2CVJ A;  2C66 A;  3IWA A;  2Z5Y A;  4A6N B;  3NG7 X;  2C65 A;  3PG6 A;  1Q1W A;  1IUU A;  2V61 A;  3AED A;  2DKI A;  3LB8 A;  4H4V A;  4LII A;  2BS4 A;  2UZZ A;  3CPI G;  4GCM A;  4O5Q A;  4UDQ A;  2XFQ A;  2YLR A;  3T2Z A;  3AD8 B;  3CPH G;  3VRD B;  1L9D A;  4NEV A;  1ZMC A;  1FL2 A;  2BRY A;  3CGC A;  2BS3 A;  2VZ2 A;  2NPX A;  1FEC A;  5FS6 A;  3KVE A;  1ELI A;  5U25 A;  3UKK A;  3T14 A;  3DGZ A;  3VQR A;  1RP0 A;  4Y4N A;  4AP1 A;  3M13 A;  3Q6J A;  1BZL A;  4G9K A;  3CNJ A;  3LXD A;  5FS7 A;  2YVJ A;  3LAD A;  3L5O A;  4IVM B;  2JB2 A;  2VVL A;  4YSH A;  4A9W A;  5KMS A;  2XVI A;  1RYI A;  2ZZ0 A;  2R0P A;  4U2S A;  3KKJ A;  4GDE A;  3BI2 A;  1MOK A;  2WOV A;  2A8X A;  4FX9 A;  2E4G A;  3UTG A;  3CIR A;  1VG9 A;  4H2R A;  4UP3 A;  1ZP0 A;  4H4U A;  5IQ4 A;  5JCK A;  3NHO X;  1JU2 A;  1H83 A;  4J34 A;  1IUS A;  1B8S A;  5KVI A;  1MXT A;  1YQ4 A;  2RAB A;  3AEF A;  3F8P A;  3H8L A;  1EL8 A;  5KMP A;  3ATR A;  4GAV A;  4YWO A;  3CNS A;  3LOV A;  2RGJ A;  5ER0 A;  2YG4 A;  1CC4 A;  1H7X A;  5HHF A;  3ICS A;  3CND A;  3UOX A;  3AYJ A;  1BF3 A;  4H4Q A;  3OC4 A;  4H4P A;  4EQW A;  1D7L A;  1PDH A;  4EMI A;  1PN0 A;  1VDC A;  2YWL A;  3GSI A;  4U8I A;  1V59 A;  3VR8 A;  1QLB A;  4A7A A;  2RGO A;  2BK4 A;  3AE1 A;  1L9E A;  1NHP A;  2VOU A;  3P4P A;  2WEU A;  3B3R A;  4GUV A;  1F8W A;  3M12 A;  4HA6 A;  3QJ4 A;  4J33 A;  1H7W A;  2FJB A;  1Q1R A;  4Z2U A;  1F6M A;  3GD4 A;  1CC2 A;  3QFB A;  1SEZ A;  1XAN A;  2YG7 A;  3AE4 A;  3EPT A;  1ONF A;  4U8P A;  3NK2 X;  1COY A;  1VRQ B;  3NIX A;  4JNA A;  1ZKQ A;  3EAO A;  4APN A;  1E1M A;  3AE3 A;  4N9X A;  3VR9 A;  4AP3 A;  3AEA A;  2WPF A;  2BK3 A;  1LPF A;  3ZDN A;  1PBB A;  2JAE A;  4C3X A;  2R0G A;  2I0Z A;  3SGL A;  3NN0 X;  1GTH A;  2V6O A;  2EQ8 A;  2QAE A;  2V3A A;  2JBV A;  2OAM A;  4II3 A;  2GR1 A;  1DOC A;  2GAG B;  4YKF A;  4GRT A;  3KPK A;  3P4S A;  1PBF A;  2AR8 A;  1O95 A;  3F8R A;  4OPI A;  3QSM A;  4CY8 A;  5U63 A;  4J2W A;  2Y6Q A;  3BNU A;  5JCN A;  2EQ9 A;  4H4Y A;  1ZX9 A;  3CGB A;  1TDO A;  3UCL A;  4YTM A;  3CMM A;  4GR1 A;  3E1T A;  1BKW A;  1E1N A;  2XVJ A;  1REO A;  1ZMD A;  1BGN A;  4JY2 A;  1KN0 A;  1NEK A;  2WET A;  1Y56 B;  4BUR A;  4X9N A;  2VRL A;  2YVG A;  3SZC A;  4K5S A;  5L46 A;  2E5V A;  2IID A;  2B76 A;  2B9W A;  1QO8 A;  3QSS A;  1GRF A;  3NYC A;  1W4X A;  3AD7 B;  4IA6 A;  2O9Z A;  4U8M A;  1BWC A;  2Q6U A;  3SM8 A;  2YM2 A;  3CTY A;  3UKH A;  3D1C A;  3T0K A;  4H4Z A;  4Z25 A;  4MJW A;  2CDU A;  2XLU A;  5FS9 A;  2VVM A;  4H4T A;  4H4W A;  1GRA A;  1M64 A;  2C7G A;  2R4J A;  2ZBW A;  4HB9 A;  5J60 A;  2VQB A;  2X8G A;  2XFU A;  2ZZB A;  3FG2 P;  2Q0K A;  4YT0 A;  3PS9 A;  5KVH A;  2EQ6 A;  3UOZ A;  2YR6 A;  1F8R A;  2RGH A;  4BJZ A;  1DXL A;  2R0C A;  5HXI A;  1S2Y A;  2YLZ A;  1PJ7 A;  1YY5 A;  2FBW A;  4I59 A;  1Q9I A;  2V60 A;  3PO7 A;  2YAU A;  1NHR A;  2C70 A;  5BVA A;  1S2Q A;  3COX A;  1NDA A;  1EL9 A;  2XLS A;  3KU9 A;  3NYF A;  2C64 A;  3P4Q A;  3BI5 A;  4B69 A;  5CKU A;  3UKF A;  3NN6 X;  4GF7 A;  1VQW A;  3Q9T A;  4USR A;  3NH3 X;  5EB5 A;  5JCM A;  2H89 A;  5KMR A;  5GSN A;  1K0I A;  2JK6 A;  1EL7 A;  1KF6 A;  4X9M A;  2WOI A;  1IJH A;  1F8S A;  1TDF A;  3IHM A;  4FK1 C;  2V3B A;  1ZOV A;  5KNL A;  2WP6 A;  3T37 A;  5FS8 A;  5DBJ A;  4USQ A;  3V76 A;  2C3C A;  3NK0 X;  4C74 A;  2YQU A;  4TM1 A;  1NHQ A;  3AD9 B;  3NLC A;  4CBQ A;  1TDK A;  3AWI A;  1FOH A;  3GYI A;  1H84 A;  4U2T A;  1L9C A;  2XLP A;  3F8D A;  2GRT A;  4TLX A;  4C3Y A;  2GQW A;  1H81 A;  1OJC A;  2YR4 A;  2B9Y A;  2FJA A;  2BC0 A;  2BK5 A;  4OPG A;  4JY3 A;  2E1M A;  1CBO A;  1IUT A;  1P2E A;  1N4W A;  3HYX A;  4K8D A;  3ADA B;  3SFE A;  1CF3 A;  3SZW A;  3AEG A;  1GOS A;  2BRA A;  4K7Z A;  1GPE A;  2ACZ A;  4EQS A;  3S5W A;  3WE0 A;  2W0H A;  3RP8 A;  2OAL A;  2YLT A;  4RSL A;  2QA2 A;  3AEE A;  2BCG G;  2C72 A;  1PHH A;  1GRH A;  2QA1 A;  2X3N A;  3K7T A;  1L0V A;  1KSU A;  3BHF A;  2GR0 A;  1IUX A;  1CL0 A;  1S3E A;  3G5S A;  3BNM A;  4DSH A;  5KWF A;  2XFO A;  2Q0L A;  2IVD A;  2A89 A;  5KOX A;  4A99 A;  1PXA A;  1TDN A;  1GTE A;  5J7X A;  4KPR A;  3CNP A;  1FCD A;  3GYJ A;  1N1P A;  3ITJ A;  3SX6 A;  3GRS A;  3O0H A;  5TR3 A;  2APG A;  1B37 A;  5EBK A;  1D4E A;  1N4U A;  2X99 A;  2A87 A;  4DNA A;  1NAA A;  4GAP A;  3UTF A;  3I3L A;  1S7M A;  1ZK7 A;  4JDR A;  3LJP A;  3DJD A;  1X31 B;  2R46 A;  1FEA A;  4EQR A;  1LJ1 A;  3NTD A;  3T2Y A;  4BV6 A;  4BJY A;  4YSY A;  1ZY8 A;  1JOA A;  2XVE A;  4B68 A;  4YKG A;  2WP9 A;  3UKL A;  4H2P A;  5BUL A;  4NEW A;  1JEH A;  1DJN A;  1H2I A;  2WES A;  3GWD A;  1O5W A;  4Y4L A;  1GES A;  4EIQ A;  2XLR A;  3LZW A;  1D4C A;  2YLW A;  1XDI A;  2WS3 A;  4M52 A;  2B7S A;  3DJG X;  1KDG A;  2WBA A;  2VVL G;  5CQF A;  3AE2 A;  2BC1 A;  1BGJ A;  1DJQ A;  4J56 A;  2BAB A;  2R9Z A;  1DOB A;  5HY5 A;  2X50 A;  2GH5 A;  3BI4 A;  4H50 A;  1OJT A;  1JNZ A;  3K7Q X;  3EAN A;  3G5Q A;  4D04 A;  1D5T A;  2GQF A;  1H82 A;  3UKA A;  3UTE A;  4REK A;  3QSE A;  2BAC A;  4ECH A;  2WP5 A;  3KPF A;  4D03 A;  3QVP A;  4CRT A;  1LQU A;  4H2Q A;  1TDE A;  4YTP A;  3GD3 A;  2WPE A;  1M6I A;  2WDR A;  1HYU A;  3NRN A;  4IV9 A;  3UP4 A;  3RNM A;  4XWZ A;  1GRT A;  3KLJ A;  3CNT A;  2BXR A;  3B6D A;  4B1B A;  4TM3 A;  3RHA A;  1OJ9 A;  2AQJ A;  3P1W A;  2EQ7 A;  1KNR A;  4NTD A;  3CGE A;  3GWF A;  1GV4 A;  2C76 A;  4G74 A;  3VRB A;  3AYL A;  2WOW A;  4G6G A;  2OLN A;  4JNQ A;  2TMD A;  2XYO A;  5LV9 A;  3FIM B;  3NGC X;  4WCT A;  2ZZC A;  3UOV A;  4BK1 A;  5C3J A;  1GRB A;  3QVR A;  4U2L A;  3T31 A;  4FDC B;  1DOD A;  1K4Q A;  4JQ9 A;  4JN9 A;  4IA5 A;  4K5R A;  2YG5 A;  1XPQ A;  5U1O A;  5IQ1 A;  1H86 A;  4TM4 A;  5JCL A;  4B67 A;  3AXB A;  4AT0 A;  4I58 A;  2WDQ A;  3M0O A;  3ICR A;  4UDR A;  3ALM A;  3H8I A;  1E7P A;  2C73 A;  4II2 A;  5KMQ A;  4J36 A;  4CNJ A;  3DK9 A;  1E1K A;  2JKC A;  3AE7 A;  4H2N A;  3SZ0 A;  4A6N A;  4DSG A;  3SQP A;  2GVC A;  2XVH A;  3AE8 A;  3H4K A;  4ICY A;  4BK2 A;  1DNC A;  4K22 A;  2GF3 A;  4BK3 A;  1CJC A;  1N4V A;  3NNE A;  2R45 A;  1PXC A;  2WDV A;  2Y6R A;  4Z43 A;  2AAQ A;  3V3N A;  2CUL A;  3FMW A;  4LU6 A;  5M10 A;  3AE9 A;  2Q7V A;  4OPU A;  3DH9 A;  3D8X A;  1E6E A;  3SY4 A;  4UDP A;  1MO9 A;  5KXJ A;  3UOY A;  1NG3 A;  2IVE A;  1PXB A;  4X4J A;  4CY6 A;  1GER A;  1K0L A;  4U8J A;  3ZYX A;  1PBD A;  3JSK A;  4RG3 A;  4WX1 A;  4LA1 A;  5EOW A;  4YSX A;  4YSZ A;  3HZL A;  1EL5 A;  1JRZ A;  3DJE A;  3RP6 A;  3URH A;  4AT2 A;  1TRB A;  4FK1 A;  4U8L A;  4E0V A;  4ZCC A;  4H4R A;  4AOS A;  3DA1 A;  2ARD A;  5EB4 A;  2TPR A;  1KNP A;  1CJ3 A;  2DKH A;  4NTE A;  4TM0 A;  4EM4 A;  2GV8 A;  2J3N A;  1YQ3 A;  2YG3 A;  4CCR A;  5C2T A;  4H7U A;  4Z2T A;  4ZN0 A;  4YXD A;  2F5Z A;  2FJD A;  2BYB A;  3GYX A;  2JB1 A;  3ALJ A;  4OVI A;  1ZOY A;  4NTC A;  1NPX A;  3DJJ A;  5GRT A;  3AEC A;  1D7Y A;  5JRB A;  4PAA A;  4Z44 A;  1Z6L A;  3CPJ G;  1P2H A;  3UTH A;  1GRG A;  4OPD A;  3LZX A;  1LTX R;  2YM1 A;  2BA9 A;  1YQZ A;  3NK1 X;  4GDP A;  1NG4 A;  2GMH A;  3HYV A;  2GB0 A;  1KSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...