4E8GA

Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound mg
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
369
structure length
354
Chain Sequence
MKIAEIHVYAHDLSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Isomerase
total genus 116
structure length 354
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e8gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e8gA01
2OZ8A 1KKRA 1W6TA 1MDRA 3DDMA 3JZUA 3S47A 1MRAA 3T8QA 2QGYA 2RDXA 3CAWA 3MY9A 3TWBA 3TOYA 2PP0A 6ENLA 5FJOA 3VC5A 3R25A 3N6JA 3R10A 4G8TA 3VCNA 4GMEA 4ZCWA 2QJJA 2QVHA 2PP1A 2MNRA 4GISA 1FHVA 3FCPA 4GGBA 2FKPA 3CXOA 3OP2A 2P8CA 5BOEA 4JHMA 4M6UA 2PA6A 3UXKA 4DHGA 3HPFA 2OLAA 3SJNA 1IYXA 1F9CA 4KWSA 2OQHA 1KD0A 5FJTA 3NO1A 4HNCA 3H12A 2XH7A 3ES7A 4IP5A 2XH0A 1TE6A 4A35A 3T6CA 4JN7A 3ENLA 3T4WA 5FJUA 3TQPA 2CHRA 2GGEA 2HZGA 3TWAA 4EWJA 3QKEA 3TTEA 2HXUA 2PTZA 1EBGA 3B97A 3FV9A 4GYPA 1NU5A 2OX4A 4E4FA 3VFCA 3SN4A 2PTWA 4MGGA 2QDDA 2P0IA 3N6HA 1EBHA 2GDQA 2I5QA 2PPGA 3DEQA 3IJIA 3GO2A 5IDZA 3MWCA 3PK7A 1JDFA 5FJPA 3NXLA 2HNEA 2ONEA 1XPYA 1BQGA 3OPSA 1SJCA 5J04A 4HCLA 3OTRA 1DTNA 3DG6A 3FJ4A 2OQYA 1MDLA 3V3WA 7ENLA 3UJRA 4ZA0A 2GGGA 2AKMA 3DFHA 3VCCA 3GD6A 2XH4A 4MKSA 1P43A 4HCHA 4E6MA 3H7VA 3UCDA 2GL5A 4H83A 4GFIA 3UGVA 3RCYA 1JPMA 1YEYA 3FVDA 3ZVHA 4KT2A 3EEZA 2XSXA 4X2PA 3CK5A 3RGTA 2AKZA 2NQLA 5FJRA 2PS2A 4IT1A 3V5FA 2QJMA 2DW7A 3SN0A 5BOFA 3TW9A 3STPA 3UJEA 4GIRA 3OZMA 3N4EA 4M0XA 3OZYA 5ENLA 2OG9A 3P93A 2POZA 4E5TA 3TCSA 1EC7A 4HCDA 1E9IA 4IL0A 3S5SA 3T9PA 4K8GA 3VDGA 4IZGA 1L8PA 3CB3A 4DN1A 3I6TA 4HN8A 3ZLFA 1ONEA 1FHUA 2QDEA 2AL2B 3JW7A 3RO6A 3H8AA 3CYJA 3ZLGA 3SSZA 2FYMA 3IK4A 3SN1A 4J1OA 4KPLA 3QN3A 1XS2A 1ELSA 4DYEA 4ROPA 3H70A 4DX3A 4DXKA 3BOXA 3R11A 4KEMA 3ZVIA 1EC9A 2PTXA 3UJ2A 2PU0A 4FP1A 3TJIA 3ES8A 3MSYA 3TJ4A 3P3BA 1PDYA 1WUEA 1P48A 2ZADA 3UJFA 3CT2A 2OVLA 2ZC8A 4IHCA 1EC8A 4Z1YA 4E4UA 2OFJA 1NELA 2PP3A 3QPEA 4K2SA 2O56A 3GY1A 2XGZA 3V4BA 3RRAA 2P88A 2OZTA 1R0MA 3PFRA 3DG7A 3GC2A 4H2HA 3FXGA 3DIPA 3MKCA 4A3RA 3R1ZA 1JPDX 2PU1A 4GGHA 3N4FA 3Q45A 3P0WA 3QLDA 1WUFA 1SJBA 3VA8A 4K1WA 3PWGA 1TZZA 2OPJA 3MZNA 5EU9A 3ZLHA 2PGWA 1PDZA 1TKKA 3R0UA 4ENLA 3D46A 3EKGA 2QJNA 3QTPA 2PMQA 1RVKA 2AL2A 4GYPC 3MUCA 3JVAA 4G7FA 2AL1A 2XH2A 2P3ZA 2QQ6A 4DWDA 2GGIA 3DG3A 2PTYA 1KKOA 3DGBA 4E8GA 2HXTA 3OW1A 2GSHA 3KUMA 4MMWA 3RITA 3UXLA 2OZ3A 1SJAA 3ZVHB 2DW6A 3I6EA 3DFYA 3IJLA 2P8BA 4IL2A 4FI4A 3R0KA 2PODA 3V5CA 4IP4A 4HYRA 2OKTA 4HPNA 3NFUA 3U9IA 3NZGA 4H19A 4A6GA 2GGJA 1KCZA 4HNLA 1SJDA 3MQTA 3RR1A 2PGEA 2PCEA 3D47A 3Q4DA 1MNSA 3UJSA 3UCCA 3U4FA 3DESA 1JCTA 3VC6A 2GGHA 3THUA 4F4RA 1BKHA 3IJQA 4YWSA 3SQSA 3K1GA 3BSMA 1MUCA 3I4KA 1R6WA 4H1ZA 4J3ZA 3BJSA 3DERA 2OO6A 3SBFA 2MUCA 2PSNA 1OEPA 3FYYA 4JN8A 1ECQA 4Z17A 3PWIA
chains in the Genus database with same CATH superfamily
1EPVA 2X1RA 2ICSA 1KKRA 3LRKA 2J24A 4PUUA 2XIBA 1E6ZA 1EP3A 1F4HA 3MHGA 1Z69A 1UR9A 3HGJA 2FIQA 3MUXA 5CZKA 2E1WA 2HEJA 3FVMA 2W27A 5ABHA 3UXIA 1XWYA 4GA8A 3P84A 1I60A 5IHSA 1ITCA 1V08A 3KVJA 1HKIA 1KRAC 1Q5MA 4DUWA 3HV8A 4UMCA 2QJJA 2PP1A 3WL0A 4FNQA 3HPAA 1A5LC 3TFCA 3AS0A 2P8CA 4GUJA 1IEVA 4M6UA 5D33A 5LIYX 4EIVA 3S2LA 2OLAA 3C4UA 3OG3A 3N25A 2DVUA 3ZIZA 3VNZA 7REQB 3R07C 3NZQA 4DXXA 3SGGA 2ZX5A 3CMJA 5CSRA 2NUYA 5CPNA 1JZ8A 1J5TA 1ONXA 2BWGA 2V3DA 1AFSA 5FJTA 5M3WA 1FWEC 1FP8A 4TTGA 4H6QA 5EMLA 4JD4A 3LB8A 1B30A 5EMKA 4H4RA 2BGNE 3T4WA 2NVAA 4LBUA 1YE4A 4AEOA 4LF1A 1DWHM 4Q8TA 4O14A 1Q6FA 4GR1A 4RZ5A 4ERIA 3FYOA 4O17A 5KITA 3B97A 1DJXA 4AH7A 3PAJA 3GDMA 1LLZA 4B3KA 1MNZA 1NFBA 3NQEA 1JQVA 5T9CE 3IC9A 4I9TA 1LORA 1EGZA 4BK9A 3E0IA 4H9XA 1GXFA 5FL1A 1PZ1A 4QDMA 1RJRA 4K8HA 1J11A 3LBCA 1AA1B 2HDJA 1FEBA 3I3DA 3MCNA 2X40A 1QI4A 2WZHA 3GR8A 1M3UA 3ZSTA 3STFA 1EHNA 1EPXA 5CBJA 5CC7A 1NDWA 3WH8A 1V4YA 4PB5A 2HK0A 4CD7A 5JH1A 4A8RA 3WD1A 3R43A 3T2PA 3ZS4A 1WDWA 3HFTA 1EDGA 4FR1A 3BV7A 5HATA 5H8UA 1DXEA 4O1DA 4LA1A 3S1WA 4LUIA 4RX0A 2WSYA 5ECUA 4ZA0A 3CGTA 2DDXA 4Y9MA 2YA1A 3EX3A 4LYRA 1EF3A 3LQGA 4GFIA 5A94A 2Z7KA 3Q37A 3OC4A 1XUUA 3TXZA 3EEZA 1ZHAA 3MO7A 3BLOA 1GHRA 3RGTA 4WR3A 5CGMA 3JZEA 1DQUA 4WJ8A 4HNVA 2C1GA 4IQLA 4HPHA 4DZ5A 3ARTA 4MY9A 4Q33A 4GVFA 3NDZA 4IMEA 1OINA 1GVRA 2ZE3A 1GK8A 2X41A 4GIYA 3THDA 3VABA 2FMNA 4QJ4B 4MM1A 1E0XA 3W26A 3UA4A 3UWYA 4O12A 4YVVA 3CHEA 2EG6A 3WK1A 1T41A 3CQIA 1GUVA 2J3NA 4RXFA 2ZA3A 4PBGA 3IAPA 3K4WA 1DNCA 5AECA 2F9RA 1J2WA 4JY9A 3UY7A 4K38A 1YKWA 3BAXA 2EQ6A 3MMUA 2I14A 3TMQA 2KX9A 3QN3A 1UZ4A 1UKSA 2EG7A 2QS8A 3S42A 6REQB 1ONWA 4YIWA 3T8LA 4MLJA 1QTWA 4BHYA 3W7NA 2PTXA 1I2RA 3D0CA 3PBMA 1O6IA 1YNYA 4KESA 2E7FA 2VGIA 2O4QA 1PL9A 4MY8A 4XV0A 1GKPA 2EKCA 4I7VA 4GO9A 3L66A 3RCMA 1PUDA 3O1NA 1K8YA 2J62A 1EWEA 4IFKB 4K2SA 5G5HB 1E0TA 3OLIA 4DBEA 3RMEA 4HK6A 3RN6A 1VHNA 4QS5A 3ME3A 1PZ0A 4LUSA 2E28A 5EB8A 2BZNA 1JZ5A 4CVUA 1K4HA 4K3ZA 4AG0A 3WEOA 4GYKA 2GDUA 4A2RA 2O55A 5HMDA 4R9OA 1KO0A 1B9ZA 2EPMX 2ZUTA 1A5KC 1XLFA 1XBZA 3LHZA 3VIKA 2YL8A 1WDSA 1OFDA 2FMOA 4MJ2A 2X09A 5HUOA 1PIFA 3EDDA 4HMEA 1D9EA 4WRHA 2IPJA 2P53A 1KR1A 3LCHA 2Y63A 3CEPA 4AZ6A 5E6YA 4GO8A 2X1UA 3G5EA 4AX7A 4WKAA 4W5ZA 3JVAA 3OLDA 2DSWA 5K3VA 3TQVA 5A6TC 1TV3A 3PN8A 1PZ2A 4XD4A 3HF3A 3PUOA 2A6LA 3B0XA 4W87A 5H6HA 1GTHA 4KRTA 2UBPC 4KH2A 3VKKA 3I4EA 3RDKA 3B8IA 1VZWA 4OTKA 3R0KA 4AEEA 4IP4A 3O3RA 1TZ7A 1LBMA 3GU9A 3F2BA 4FSAA 4HPXA 4ZTYA 4LUJA 3AICA 1UMLA 4GUIA 1TELA 2OKOA 1R9YA 3I7RA 3ECQA 3NVYB 2VO5A 5T26A 4HNLA 3UF9A 3BO9A 1Q6OA 3S5YA 2PZ0A 3G1SA 4XUGA 5C71A 2C0AA 4M8UA 1MMFA 4M3PA 2QAFA 4I90A 2YQUA 3RIKA 3VE7A 4O52A 4UCFA 4RJEA 3NL5A 4HZ8A 7ODCA 5HNRA 1OG6A 2J78A 3EKLA 4JN8A 4MYAA 2OTDA 3VMOA 4M81A 4Z2JA 1UBSA 1XQLA 1W6TA 1H4PA 1SO4A 2BVWA 3WQVA 3W74A 2YGYA 4PODA 1D7YA 4E2VA 4GQGA 2V5KA 1KM3A 1PEZA 1R3TA 3ARRA 3F4WA 4K7YA 3FKRA 1TPUA 1AVAA 2G96A 2Z1WA 3IK2A 3PULA 2V2CA 2I1OA 2V9DA 4K7VA 1C8YA 5BRQA 4U3CA 4D8AA 3M6YA 1BD0A 3KOZA 1R2RA 2ZZ5A 2ZRVA 3E2VA 4FF7A 1FCBA 1XIFA 3B8VA 4A8NA 2TAAA 3CC1A 4F66A 1TJPA 2HBXA 4CCDA 2PCQA 5BOEA 1H09A 4IPLA 3BVJA 3PVFA 4ICCX 2C18A 4C6IA 3M64A 2WMIB 4PN2A 2PLMA 2YLLA 1XIBA 3BG9A 4B2DD 3ZR5A 4W89A 1MW3A 1SFSA 1AQ0A 4JTLA 4GIEA 1PS9A 2VYOA 3G24A 1YMYA 3PF3A 1OX4B 3USBA 5F7UA 1JZ6A 4CQBA 1MQRA 3QR0A 1JOAA 4P5UA 2ZIDA 1V3JA 3EOSA 3KCOA 3H6OA 3C2RA 1WE5A 1PTGA 1TREA 3L4WA 2D2OA 1HUVA 2ACQA 1K02A 1UA3A 3MT1A 3BGAA 1H1ZA 2PTZA 5BMWA 3TR9A 4AWUA 2PWHA 5I00A 4UTIA 2EF9A 3L4ZA 4IIGA 1RP8A 4GYPA 3IGHX 2QCDB 3PZIA 3R4IA 4OZOA 2PTWA 2D3NA 4DVOA 2X1SA 4LCQA 3SADA 1J79A 4H9MA 1JZ2A 1KNWA 3VYLA 1AZ1A 3ZZ1A 3TH6A 5LA1A 4DLMA 1PWLA 3S1VA 4Q4SA 4KF1A 1K6WA 2RJGA 4K39A 1R7AA 3W88A 3QGAC 3SIMA 2GQ9A 1BLIA 1V0LA 3EWXA 4MUPA 1NWRA 3WFAA 3HQ1A 1EX1A 1SYTA 2NQJA 2PBGA 3HOJA 5LHEA 4LVBA 5U1OA 4ACZA 2Y62A 1EP1A 2G97A 3GWQA 2XWEA 3R89A 5DY2A 4GY0A 5CJ5A 3LHUA 2WCGA 2Y88A 1H5VA 2Z27A 1P7TB 1Y0EA 2EAWA 4F9DA 2X2GA 4EQSA 4YYFA 1B3YA 1JXKA 3RCYA 2NX1A 3VIPA 1GGOA 2OYLA 4EWND 4PUNA 1P1MA 1VFTA 4EPKA 3W7OA 3HPSA 4XKYB 5TNVA 4YTTA 1GYNA 7TIMA 2OYKA 3UP8A 4HNOA 1E51A 4JTKA 3VO0A 1P5BA 2VRKA 5AZ1A 4RNFA 1GZ1A 1OHLA 1V93A 5KSWA 2E67A 1XF0A 3FHQA 1K77A 2GQ3A 4BWLC 2FFIA 1O5KA 3VDGA 2RJHA 1EWDA 1XC6A 1GVQA 1P6WA 3WCZA 4OBSA 4DXVA 1VRXA 1RV8A 5C9UA 1I6NA 1FDJA 4H4UA 2XN0A 2BSLA 2W3RA 1S5MA 1PYFA 4ZVJA 4U10A 2QDGA 3CL8A 3H70A 4DX3A 1X2HA 3WK0A 1A49A 4LVFA 1TVNA 1TCDA 3PB0A 4EOUA 4OGZA 1CTNA 4KRZA 4D71A 1RH9A 1CW2A 1AZ2A 4CCCA 3AXKA 2VFDA 2XN2A 2R1MA 3E5PA 1WZMA 1P48A 4I9JA 1BG4A 1ZALA 2GZXA 2J8FA 4I9AA 5IM51 2ZC8A 5HNNA 1XGZA 2WMKA 1JGMA 4IPJA 5JCNA 4JQ1A 3FDKA 2V3FA 2QPXA 3IGXA 2WP5A 1VFFA 3GNDA 4IMDA 1XG3A 2Y7EA 2DORA 4JTDA 1LF1A 4F9JA 2E4TA 4MDOA 4UMAA 2CZ5A 1TV4A 3BSGA 5JQ9A 1S38A 1C8XA 4AY7A 3NQCA 3VIIA 3BAIA 4EAMA 4TVUA 5HK4A 2I7GA 3NVDA 2C1HA 4PL2A 1WUFA 4M7SA 2BVTA 1QNPA 1SJBA 1GONA 3BLEA 4QG9A 1G69A 3CV1A 2VD9A 4X61A 3A4JA 5LNWA 2GSEA 4EPDC 1GW1A 3MBFA 4UWMA 2QV5A 1EJUC 3F1QA 1CENA 1UD5A 4HA4A 4S3KA 1GRAA 1GPWA 2GGIA 2WHKA 2HBVA 1QOXA 2C14A 1OZMA 1EA0A 3GW0A 1LOQA 3W23A 1VQZA 3KUMA 1R3RA 1BGGA 5HPOA 3MMDA 1MUMA 1Q3NA 4Q8NA 4GUHA 1VBUA 2AAAA 2BC0A 2D0GA 8TIMA 4UQ9A 4IIEA 2QYGA 4H19A 2CU0A 1JAEA 4WY0A 1BZLA 2DVXA 3EA3A 4ZBCA 4Y9AA 2PWDA 3BGGA 3DCPA 2R24A 1B4KA 4UTHA 2PLJA 2VJXA 3NUKA 3NWRA 2RDTA 2V3EA 2Z26A 3FNDA 1A4MA 4XVEA 2Q02A 3PB2A 3W73A 3E3HA 3I4KA 4H1ZA 3BW2A 5GNZA 4J28A 1RQEA 1ZCCA 1ZBCA 3UR8A 3OQ8A 3BLIA 4QS6A 1V0KA 2C1IA 3GTFA 5H2ZA 4FNUA 1B3WA 1H7XA 3EX4A 1TMLA 3LSBA 3REQA 4LSBA 1TTIA 5CPMA 2INFA 4IIFA 4L65A 1QHOA 1SZNA 3NQ2A 1P0BA 4ONVA 2FPYA 3LPOA 1DXFA 1A5BA 1SW0A 3NL2A 3QHMA 4NQ1A 1KCLA 4DWSC 2TPSA 1C9DA 2BFGA 1HJUA 3GKAA 4GC3A 3BC9A 5MHBA 2WMJA 3VC5A 1EO7A 3R25A 3P7YA 1OSEA 2GUBA 5D2VA 2F2KA 2D20A 4UR8A 3FDGA 1QJWA 1RSCA 5GQBA 3H4KA 1V0MA 1OGGA 4Z2HA 1J6PA 2VQTA 3VOJA 4LBRA 3KXQA 1KFLA 2OJPA 1O68A 1IF2A 5G1TA 3VZZA 4JHMA 3FX4A 1JXJA 4GH3A 3I68A 3SJNA 4DYKA 4L9YA 3WK2A 5JCLA 3C0JA 1F07A 1Z44A 3B0UX 1K4GA 1US3A 1OB0A 3MZ2A 4H4VA 4RZBA 1F3XA 2OT1A 1EX5A 2AQVA 3HG5A 2NQ5A 3MW7A 1GSNA 4LWWA 4WY0F 4CQCA 4F0KA 4Q6JA 3SAZA 3CUFA 4Q8VA 3EBVA 1EJTC 5JRBA 1K70A 1J93A 2B4GA 2ON3A 4RW5A 3TQPA 4KQNA 3LEPA 3LM7A 2CZEA 3ONBA 3TTEA 1ME9A 4GXWA 3VXGA 1TTPA 1JPKA 3GW3A 2P3EA 4CD6A 1ENUA 1E0VA 3AZTA 4ZEPA 1T6MA 5A8MA 3OVQA 2R1KA 4Q4MA 4XBJA 4H8NA 2YL5A 2A6NA 2GDQA 1DJIA 4YHEA 1UH4A 3DGHA 3L7RA 3UPWA 4KBXA 1PSCA 4D8LA 4H4WA 3NQGA 2DJXA 1D7FA 3L23A 3VILA 1XLIA 1EJVC 3CZJA 3WH6A 3GD4A 3MP3A 2HNEA 3T09A 3QV6A 4DAIA 2F6UA 3MUZ1 1WA3A 1LOLA 3DFPA 4GY1A 4ADWA 3LSCA 3JS3A 2X7WA 2Y61A 2ZUMA 3BMWA 1V5XA 1ADSA 3WLKX 3O63A 2CPUA 1OFRA 4FHAA 3VIOA 3WJSA 1O7AA 3PTDA 1EJ7L 1P43A 3H7VA 1W8SA 1YEYA 3VOGA 4M24A 3DYPA 3NDYA 4O1AA 4O57A 4EX4A 4QJ1A 4HNTA 3TC6A 5D37A 3GXFA 3S2JA 1RQHA 1Q8AA 3LCWA 1AK5A 2OZ0A 3UD6A 3N12A 5D9PA 5G4HC 3SN0A 1R30A 1BYCA 3CAVA 1RY8A 3GQYA 4QITA 4LUSB 3UZJA 3H2NA 3H2MA 4AYGA 3ALFA 3W7QA 3IAQA 5ENLA 2XN1A 1GQNA 4B5WA 4JFTA 4P7RA 4XUYA 3S5SA 4P7LA 2VC6A 1NQKA 2HS8A 3DK9A 2DFAA 5A8NA 5IDIA 3B8WA 2Q01A 1XYFA 2YLAA 4E2DA 4HMCA 3DFQA 3N4AA 3CHVA 4HK5A 4IF2A 4NZFA 4DIAA 3NO3A 1TR9A 4HIBA 1M7PA 2J79A 2V82A 1OJXA 4J1OA 5EKYA 3IJ8A 1R3QA 1TUFA 1HFBA 2O92A 3M0HA 1KFKA 1V6WA 1UP0A 4IM4A 1AQHA 4FLSA 1BXNA 4XG1A 3R11A 4NIRA 4PUJA 4U2YA 4GKLA 4FP1A 3BW3A 2GJPA 1G7VA 2Y1HA 3BAWA 2V38A 1EIBA 3T0DA 2V5BA 3VZXA 3GXIA 1KGUA 1QU4A 3W28A 5K4ZA 2WHMA 1E1CB 4D6JA 2NQHA 3NOEA 2E6FA 5AHFA 4V1XA 2ZZBA 1S3TC 3LLFA 1WO2A 4LYPA 4PEEA 4AF0A 1U22A 4L1XA 3RLHA 3U48A 4WXZA 3QEZA 5A6BD 3PFRA 2D23A 3GDRA 4AISA 1NH6A 1FWCC 1CGYA 3IJ6A 4JS3A 1VYRA 5JMUA 4QP0A 2BHYA 3FA3A 1UR1A 3DECA 4UFKA 4ZO8A 1FTXA 1EYEA 3LY0A 1W1ZA 1UCWA 3K8LA 4WKHA 4FNSA 2INEA 2CBJA 1V3HA 5BMXA 3SDOA 2QCGA 3N9KA 3MZNA 3CQJA 1MZHA 3D46A 3QTPA 4US5D 1V8EA 3DHPA 5KEZA 3IJDA 1NY1A 4W9TA 2P5NA 1SSDA 4I6VA 3TLQA 3MWAA 1M6IA 3LNMA 4HU4A 2QQ6A 1P6BA 3WYZA 4RE0A 5E6ZA 1QCWA 1W3KA 2GWNA 3NURA 3QFAA 1NARA 3B8DA 2VKZG 5A2CA 2IW0A 3SUSA 1MVYA 4ZGYA 3OW1A 2GSHA 4UFMA 2L5HA 2WHJA 1ZTVA 3EWYA 4UQEA 1GVFA 2PWVA 3V5CA 5CPOA 1KN0A 1AW5A 5JIPA 3LI0A 1TWDA 3WQ8A 3HQOA 1E9LA 3LHYA 2GGJA 1VFMA 3GZAA 4H04A 4YTSA 4XZLX 1NM9A 1WBHA 3S2CA 1T96A 1SQ7A 2A7NA 1GOQA 2WKLA 5FEWA 2NQ9A 2X05A 1XLHA 3EOOA 2C19A 3RUBL 2I57A 3MDWA 2YW3A 1E72M 4NJJA 1Q45A 3MBDA 2EPLX 4PMNA 3W85A 1P6CA 5GJNA 2PRMA 3VOHA 1I2QA 2ZDSA 3DYMA 3FAWA 3CQ0A 1W1B1 4BWLA 4LC8A 3RILA 1W9VA 1UD3A 4C60A 5AC4A 3KL5A 2OZ8A 3DI1A 4HD5A 1OK4A 2EO7A 2G41A 3DKJA 3AUOA 2FJKA 1UBPC 2B7NA 2WANA 3B06A 2YDSA 3CMGA 3GLCA 4FPSA 1F8IA 3O2LA 1RZMA 4R34A 2J7BA 3NNTA 1H63A 1TA3A 2WQPA 1I0BA 1K9TA 3H26A 1N62C 3GSMA 1B5TA 1TQXA 3GG0A 2ZZ0A 2BX7A 3KP1A 5TIMA 4UQCA 2XG9A 2CZDA 4LOCA 4EPBC 3ERPA 1UQYA 3H53A 4NKCA 1WZAA 3C8FA 5FI8A 5AZ0A 2X0HA 2JGYA 1N5WC 1E15A 2I5IA 3A5VA 2HJPA 4ACZB 2GR3A 2YCIX 4GRTA 1IYXA 4EF9A 5K4XA 1DJQA 1N2VA 3P74A 3AS1A 1ZRQA 2Y7DA 3RPDA 2UY5A 2ZRZA 4FOJA 1DIDA 2WCSA 3WMSA 1BVNP 3VINA 2Q71A 3M46A 4N6FA 4EQWA 1RP9A 2ZWYA 1WKDA 4HHMA 4S3DA 1FFVC 3CPRA 3C5QA 5FJUA 2PB1A 1QOQA 2GSJA 4S38A 3VUSA 5C70A 1JYNA 4NZCA 1VDVA 2J74A 3EDJA 1LWHA 1CGXA 4E2OA 2VDHA 3SCSA 1EBGA 1ONRA 3SFKA 2GJLA 3M5ZA 1NWTA 3R8RA 2WO5A 4U5IA 1HG3A 2OX4A 3AQUA 2ZDRA 3W29A 3VZYA 3G1YA 4W4QA 2RGLA 4MGGA 1NWSA 3N18A 2UV8G 4NRSA 2J7DA 4WGHA 4FALA 1OK6A 5HMSA 3GVVA 2YDQA 3E0VA 4FX8A 3S0CA 1AL7A 1HXJA 2YL9A 4D6FA 3KOWA 4JBRA 3BAKA 3AMCA 3OPSA 2WQDA 3CIWA 5J04A 2ZCGA 2BCPA 4EP8C 1BSLA 3NPUA 3A3XA 2ABAA 3S2MA 4M56A 4ILSA 5KMYA 4AU0A 1DWAM 4MB3A 1XLGA 1J0YA 5CKSA 2HE5A 3R6IA 3N2MA 1YXCA 3ARSA 4DJDD 2BODX 4TV5A 3XISA 2X8GA 5JIWA 4CU7A 4PRWA 1E3XA 3P6LA 3ZVHA 1EH9A 3WNNA 5CSYA 4R5EA 4I7UA 4OE7A 4HGXA 1RQBA 5K7JA 2D69A 1GETA 4H4SA 4Z1CA 3B3DA 1PTDA 1R9XA 1PWMA 5DBUA 3S1UA 1E0WA 4PFMA 5FJIA 3U4AA 1D3CA 2O0TA 2ZUVA 3E5BA 4GIRA 3E2QA 1UASA 2BASA 2YFNA 1ZB5A 3B4UA 4FIQA 1XINA 4JTJA 4DWSA 1JDCA 2WV8A 2PDQA 2DZXA 2PC8A 3AHXA 4Y9OA 1R3VA 2J27A 1VFUA 5AHNA 3GHTA 1U1UA 3CB3A 2J66A 4DBWA 3ZLFA 3PZUA 3N17A 1ADOA 1FHUA 3EOUA 2QDEA 3DFNA 3WH7A 1V51A 4OKDA 1UZ1A 5A6AA 3A21A 3P8JA 5AYXA 3RX2A 3VOCA 1XS2A 3B9AA 1S5WA 4PMVA 1HQTA 1CCWB 4S3AA 3GZ3A 1S2UA 4YMZA 4IP7A 2VCBA 2YBVA 4GI6A 1US2A 4DM1A 1AODA 3IIZA 3RM8A 4GOAA 3TE9A 5AVNA 4M1RA 1CBGA 4O1EA 1BKSA 3VAVA 1UMYA 2HPMA 1WUEA 4CD5A 2ZADA 2Q09A 1VCFA 1OF8A 1F05A 2QCLA 3AMZA 3NDOA 4F3HA 1CT5A 4LBSA 1B0IA 2R94A 3P61A 3V4BA 3RRAA 4LXFA 4GZIA 3KLKA 3G8EA 3VMPA 1OFAA 3EA1A 1G67A 4Q4OA 4ZODA 3M6DA 4RKAA 3LUTA 1UWRA 1MW1A 2DH3A 5CJNA 3VD7A 3M44A 4O10A 2XFFA 2XYLA 7TAAA 4Q22A 4X3ZA 1M7OA 3REQB 3OO2A 1CGWA 4JDRA 1WDRA 4KEVA 3GXNA 3ARQA 8A3HA 4JIRA 4HA0A 2DT2A 1NPXA 2ZZ4A 1BYDA 4UUIA 1G4SA 4QQUA 1X8CA 3VOIA 2OQLA 2GR0A 2J13A 3HGSA 2BY2A 1OFQA 3USZA 4AHQA 2FZ9A 4IGHA 2ACSA 3QZAA 1IHIA 1Z8AA 4GQ0A 1PCWA 4JN6A 4K6AA 5L9FA 3WBWA 2D2JA 1U1JA 4BI7A 2XFWA 2QV4A 9XIMA 3KDOA 4B9YA 4CU6A 3GHSA 1H7NA 1CLXA 1P4CA 2WNNA 2GVJA 4IIHA 3SQLA 4NNBA 3W4RA 3KHDA 3OHMB 1GORA 4U5KA 5ABGA 2DSUA 4MNKA 1Q1WA 4PGLA 5C55A 3QQ0A 3M7WA 3CUXA 3FKKA 4NSBA 2PCEA 3GR7A 1PBGA 3VX1A 3II4A 1RUSA 1L6SA 3UJSA 3FJNA 1WKEA 2J7FA 5BXSA 2WBAA 3ZM8A 4QCEA 4JQ2A 1V3IA 3HPZA 3TYDA 3OA3A 4BF5A 1V6TA 1QXLA 3W53A 1H7WA 3II1A 3FEMA 4GVIA 1RPXA 4LPCA 4H4PA 4V15A 4O1FA 1YBQB 3QOMA 4JTQA 2DIKA 1GWJA 1CLVA 1XFBA 4GC4A 3H22A 2VFIA 5K9CA 2G95A 3CAWA 3MY9A 4MZ8A 3TWBA 1S5NA 4WF7A 3BJFA 1RBAA 2R82A 3W6MA 4JTHA 2FGLA 2ESCA 4D6CA 1VP5A 1B54A 1XDJA 5D05A 4OFCA 1M41A 4QLJA 1IZKA 4F0LA 4GMEA 2JF6A 4D6IA 2X7VA 1RCXB 3BAYA 3BGJA 3P0XA 3TK7A 2E6YA 1FCUA 3GVGA 3GXMA 3ARUA 5E93A 1ZZMA 3CYVA 1OCQA 1F9CA 1W9DM 4IPNB 4JL1A 1LBLA 3L2MA 4N9EA 1WDQA 1M5WA 2IMRA 4R85A 1KD0A 4DUOA 2NT0A 2E68A 1BWVA 1YDYA 1OY0A 1J12A 4HHLA 4HZMA 5FF4A 3FEQA 2GR1A 5GJPA 1E4LA 3G77A 4PH6A 4UBPC 4KFOA 1XRSA 2OOFA 2ISWA 4GNKB 2DIJA 3BSHA 4EMIA 5M5DA 4JN7A 2B81A 4JGDA 4JTFA 2DSKA 5JCIA 4IQEA 4B5VA 4WSJA 3NZRA 2RGMA 3CPGA 4ZQOA 3STEA 3KAOA 3EGJA 1FIQB 3FYPA 2PDJA 1V02E 2YBTA 1V03A 3A4XA 2R9RA 3KE0A 5CC3A 4HP5A 4IFRA 1F6YA 4NXSA 2YFOA 4YJ5A 3VFCA 2PFHA 3APGA 3I7QA 2WZEA 2IXVA 3PBYA 4LTSA 4X63A 1UIOA 3EOLA 1OC5A 3VGGA 1WNOA 1UZHA 4C7GA 5EY5A 1SMDA 1X39A 3AUJA 4H2CA 3VKCA 2XZ9A 3SM0A 3T78A 3VUPA 2WPBA 3A24A 1B90A 2O9TA 1SJCA 1DEDA 2PRLA 5I02A 4ICMA 2PDKA 2VURA 3G8RA 3NO5A 3WIJA 1JCYA 2ZOXA 3CL6A 4NILA 2OQYA 2FQIA 4O8RA 4KMQA 2YA0A 1HL2A 3C0QA 1X96A 2GGGA 1H7PA 3AHZA 3PAOA 3VGDA 4PULA 3H23A 2EPNA 1JCLA 1ZP4A 5FS8A 4JTEA 4QFUA 4RNHA 2ZUWA 4H41A 3TYZA 4DEFA 4AF0B 5FAJA 1TJ0A 1GEHA 2PDCA 3E2RA 1A47A 2J9YA 4JKLA 3WDRA 5I6SA 5D8ZA 1DOSA 1ZGDA 4KETA 5HAOA 3FIGA 1KA9F 4IFOA 4M51A 4AX6A 3F4NA 2A3EA 1WYGA 2VC7A 3R94A 3KLLA 1VPXA 2DZUA 1E9IA 3T9PA 1OD8A 3HJZA 1SO5A 1V77A 1C3FA 4AVFA 3TN6A 4OU1A 4M6PA 2V3BA 4DN1A 1H60A 3GKFA 1Q6LA 1WDPA 3NTYA 4WD0A 5M1TA 3RO6A 3NEHA 3PR2A 3UQNA 2FHBA 3ANVA 1JCNA 1XKYA 2VUYA 5DLCA 3SSZA 3GNNA 1A5UA 2YAUA 3RK8A 1CNVA 2FDMA 2CLMA 4CQ9A 3CEUA 4AB4A 3LMZA 3A3HA 2V5LA 4ROPA 3OZOA 2VX5A 2Y6ZA 3AC0A 3CH0A 3H2CA 3OGRA 1W1VA 3W7MA 2ASHA 2QJGA 4AD1A 3Q58A 1F8WA 2PU0A 3CS2A 5D2XA 3TJIA 2PDYA 2H6RA 4EXBA 2WPGA 3W76A 3A12A 2VWSA 3M41A 3LHTA 3MU7A 2REQA 1H1YA 1R47A 1XYZA 2DY3A 1GG1A 3R0DA 3UNDA 3M43A 2I9UA 2EG8A 2F84A 3QQ1A 3TZNA 4E4UA 3URQA 5CZ0A 1TO3A 3P81A 1UKOA 1C91A 4OJYA 3HJEA 2B7QA 3WBXA 1H49A 3SB0A 4AZCA 2VCAA 4Q8WA 4Q7IA 1W9BM 1R0MA 4GBDA 2XIIA 3GC2A 5IFPA 5LXXA 3GIQA 3QW4B 1JPDX 1HJQA 5A6SA 5BYWA 4BA0A 4B2DA 2CFYA 4HHHA 1JEHA 3S9YA 3W2JA 5DQPA 1E40A 1WKFA 1RD6A 4LC6A 4IJCA 5CBBA 8RUCA 3ZT5A 3DFSA 3T55A 3ZQ9A 4PZVA 1W2PA 3BLLA 2CITA 4EF8A 1TTQA 1GYMA 1TA3B 3LQLA 3RPTA 2AL2A 3O6YX 3HURA 2Z1BA 1JJKA 3H54A 3VKDA 6A3HA 1NDAA 4FEZA 2WB5A 3NJ3A 5MKGA 2C16A 4UTWC 4GUFA 5I03A 1Y5XA 5I3GA 3NPXA 3W2LA 4GJJA 3UXLA 3S4TA 3T0CA 5FF3A 3NEVA 4HMDA 2BVDA 1AJ0A 3FY1A 5J5RA 2WSQA 1KFJA 4ORMA 3VGEA 3PZVA 4PFHA 1QI2A 3ZJ8A 3MI2A 2QF7A 6XIAA 3N6QA 4R33A 1W91A 4JNZA 1TYPA 3DGZA 3AHYA 3W9ZA 3KLJA 3WQ6A 5A95A 1FWIC 1LL6A 2YB4A 1BEUA 1XIJA 3W1NA 3H24A 2CLOA 2GVLA 4H6RA 2PZNA 1OABA 1F5ZA 2W62A 3THUA 3IJQA 4WDTA 3W22A 3BSMA 3EPNA 4XZWA 2SFPA 3WDIA 3WLJA 1R85A 3P2VA 3GU2A 4O16A 1G5AA 4JTUA 2ZUUA 3AWNA 2VELA 4K36A 3SY5A 4AIEA 1ZKQA 4N6EA 4DBUA 3GDTA 3S8HA 3OBEA 3PG6A 2ISSA 1XYMA 2FFCA 3LENA 2J25A 4OHQA 3BE7A 4TV6A 1EGMA 4B5XA 3UW6A 4YL2A 4PMQA 3CGCA 3NIYA 5BXPA 1H1NA 4J9JA 3ZR4A 3NZPA 1JZ4A 5IHRA 3URBA 3T05A 1UP2A 3DXIA 3N6JA 4QM1A 5FA5A 3WO8A 3W3OA 4TVDA 5LNRA 4WCJA 2UY4A 3W37A 1BGAA 4ALDA 2MNRA 3NSXA 1EEPA 5TAOA 3MV01 3OP2A 4OV4A 2NW0A 3SURA 1POKA 4C6DA 2X30A 3AIEA 3GIYA 1BQCA 1C90A 1EXPA 3IVSA 4KWSA 2CWNA 3ITOA 4G56A 2FVMA 3WQ5A 1KV8A 5TF0A 4NNCA 1SGJA 1H7RA 3WBAA 4G1KA 4C6FA 2VRQA 1QFEA 3VIMA 5E9AA 2BMBA 1FXQA 2Y8KA 1JNDA 4J40A 2PGRA 3ENLA 1EKOA 4MKNA 1VFHA 4GABA 1O1HA 4WLCA 2PDHA 4P8UA 5G1MA 1SFJA 3LPPA 1JFXA 3SUTA 4H01A 3ZXWA 2X1IA 2QUTA 2VC9A 3T0TA 4E4FA 3M0JA 1A50A 1PKYA 2GJRA 3K1DA 2P0IA 4B3ZA 1FBAA 3N6HA 1YPIA 2NVDA 3KRUA 2V2HA 1EJXC 1ME7A 1XISA 4DB7A 3CUZA 5DRCA 3L68A 4QE1A 1A53A 1AD4A 3AMGA 1KQYA 4XTDA 3LADA 3CAKA 1ZU8A 4AD5A 4LAZA 3TP4A 3WG6A 3NXFA 2G37A 3AIUA 4MDPA 2CLEA 3MO4A 4KIEA 3S5NA 3VMNA 1PHWA 1DJHA 5KZ6A 2A3LA 2JEPA 4C1NA 1LP6A 3L4VA 2CLLA 3WDHA 1OZQA 4DNMA 2TYSA 2WYSA 4E6MA 3C0SA 3U7BA 4W7WA 4QCFA 3TSMA 3M5YA 4WOZA 2UY2A 4ZQPA 3R8GA 4KT2A 1D8WA 5H1WA 2VEMA 3W84A 2BOGX 4AD4A 2HS6A 2OODA 1GZJA 2A0NA 4E8CA 1VIWA 3V75A 4QQ3A 1WOBA 2PS2A 3QOKA 4GI4A 3W25A 3THQA 2J77A 5HQLA 2E9BA 1X98A 2FTYA 3DHDA 4EXAA 1PE1A 5CC6A 1FWFC 5I3KA 1DL3A 3FK4A 2DSVA 2ZRUA 4L80A 4L7ZA 3BDKA 3BL3A 2POZA 2QW5A 5I78A 1DVJA 4IL0A 4MB1A 4PR4A 4A05A 3MC5A 4DJDC 4XSMA 1XGEA 2QUMA 8XIAA 2QHAA 5EMMA 3STCA 3EPMA 2Z6IA 1L6FA 4RV8A 2V30A 3GNRA 3CYJA 1Q7ZA 1SO3A 3BTNA 3HMCA 1U30A 4AC7C 3O9NA 4JKKA 2PDMA 2QMJA 4PUMA 1OC7A 4DRSA 2ZA1A 3COTA 1GOMA 1TV2A 4CCEA 3QC3A 2UY3A 3Q2DA 5BRPA 5ECVA 3LCIA 4Q8QA 3CZLA 3TSDA 1KQZA 3LXDA 1LCOA 2NSOA 3DH9A 1FHDA 1EC8A 1VHCA 5A8OA 2JIWA 1D2KA 1M01A 4LY4A 3KP0A 3M9YA 3ZWTA 3PUGA 2ZXQA 4HSHA 4CLMA 3UZ5A 3CXBA 4FS9A 1XM3A 4AY1A 3GRTA 5HANA 4G2DA 2BTMA 3DG7A 4GK8A 3PM6A 5E0KA 3SRHA 1VS1A 4A3YA 4P7NA 1W17A 3A4WA 3LZ5A 4REQA 1FH9A 3P82A 3AIWA 3SZ8A 1BYBA 1VENA 5CAHA 1EOKA 4BQ3A 4CNUA 3NZ1A 1X8FA 5J5DA 5EU9A 2FLIA 1AJ2A 1S2CA 3SY8A 3UT0A 1XCXA 4ENLA 1NHRA 3HIJA 1O60A 5DF0A 1GVIA 2G3JA 2CLKA 1E0UA 3K5XA 2VXNA 2AL1A 3MCMA 1U83A 1UP3A 3DG3A 3OVRA 4AXNA 2E6DA 2QIIA 5CPSA 1N5XA 2VTFA 2FZMA 4XAZA 5IRPA 4ZB5A 2HXTA 1Q6RA 3VDCA 4CNTA 1LQ0A 1TMHA 3I6EA 3B8TA 1L2QA 1UR3M 2IXUA 1W1TA 2VFHA 2D22A 2OSYA 1OG0A 2G4JA 3EMZA 3RNMA 1P0EA 2J7CA 6TIMA 5LKYA 1V79A 3C2FA 1MQPA 4FZIA 3RJXA 3C56A 2Z28A 2A3CA 3L9CA 3HG2A 1QNRA 3T4CA 3EYPA 2ACRA 1W3TA 1QNSA 1TPC1 2VNCA 3RU8X 1JD7A 4TX6A 1GW9A 4GNVA 1UWAA 2A5HA 1Z3NA 2ZYFA 2F6KA 5H91A 4F0MA 2NVCA 4DF0A 1ZNNA 1NSJA 3OQEA 3FYYA 1J6OA 3TONA 4L1WA 2A85A 3A3WA 3RR4A 5E5CA 3FG2P 1HL8A 3E9AA 1R3SA 3NA8A 3B04A 3S47A 4W8AA 4L6HA 3MUY1 3T8QA 1I9CB 4Z2KA 2YDAA 3EEGA 3ZWSA 1JVNA 3UR7A 2RDXA 3GC5A 3ANYA 2F5ZA 1L9WA 4HHPA 1TJ2A 1TX2A 4LT9A 3GTIA 1C8VA 1F2JA 3EXSA 4I8DA 2O7QA 3QJAA 5FL0A 4QNWA 3WBEA 2PAJA 2Z24A 4JIQA 3ITVA 2W66A 3TC7A 4GISA 1VD6A 4GNJA 1FWSA 3POHA 4UXDA 2BY3A 2J9ZA 2W6RA 2P1FA 2ACUA 2DGAA 1ICPA 4JX5A 3LV6A 3WJZA 3HPFA 4UFIA 3WK3A 7PTDA 4MHBA 1UD2A 4B15A 1YPXA 4Z1DA 1SZEA 4O15A 3J7HA 1QPQA 3T2QA 5HMFA 1XLLA 1ML1A 4WOQA 5AKQA 3W38A 5HWMA 3EOEA 4FB7A 3PPGA 2NXGA 3H12A 4LEFA 4U4MA 5CQ1A 5JCMA 3WLNA 3KCJA 4IP5A 5HJXA 5HDRA 1IZJA 1VR6A 1OF6A 3LTYA 4UNKA 5FF7A 1Y5WA 4A21A 4JR5A 3UWQA 3LS9A 4UOQA 2TSYA 3TYUA 3PPFA 1DJNA 1BF6A 4Q4KA 2W67A 3FAXA 3H7UA 5LSMA 3SEPA 4N4QA 2YYUA 4BQ4A 1JDEA 2FH8A 1OFPA 3WQFA 4C6PA 5I5RA 1RJQA 5A6BA 2OLSA 2ZX9A 3T08A 1EBHA 4W8BA 4A2SA 1E5JA 4UTWA 3AU6A 4UZUA 3PSVA 2YXXA 1QW9A 1PX8A 1HO1A 2W3ZA 1LROA 3IJIA 1BWLA 4RR4A 1RM6B 5DXYA 3S2NA 4D72A 1GESA 4V1YA 3SO7A 3C0LA 5A6JA 2Y7GA 4WJXA 1QWGA 1WQ5A 3LOTA 1ZP3A 2BBFA 1HKVA 3CV2A 5DO8A 4Q8UA 3BWWA 3UU0A 4US5A 2EPKX 2VZTA 3WQDA 1TQJA 1ZK7A 2H90A 1A0DA 1TV8A 4AIOA 3WL1A 3IUIA 3UJRA 4K7ZA 3DFHA 1V97A 1GQIA 1PIIA 4QE4A 2REQB 2Q6ZA 1G01A 3U2OA 1IWAA 5DT5A 4O53A 2YL6A 4AEFA 3CNYA 4RXGA 4CQ8A 1SW3A 2QUVA 3S46A 4A22A 1ZMCA 3KBNA 2Z00A 3UERA 4C90A 3N9RA 4TIMA 1HNYA 4UZSA 3GUWA 5E09A 4LFYA 3OZMA 4TTUA 4AZHA 3EX2A 1XW8A 4C6LA 1Q6CA 2QCCA 4E38A 4HU0A 2XFRA 4L5ZA 4X60A 3L4XA 3MPGA 4HCDA 2A7RA 3MANA 3TTYA 2QF8A 2FHFA 3MHFA 3WY1A 4QISA 3UWEA 2ZUNA 1YDVA 3ABXA 4PEKA 1HKWA 4CUCA 1DXLA 2AL2B 4FLQA 4XD5A 5AC7A 4Y96A 3GFZA 4H4IA 3UWWA 2GK1A 4FA3A 3PZQA 4Z2IA 4JCLA 1JDAA 1U5VA 5HR6A 3E12A 4GINA 5MKGB 2POTA 1AW1A 3LDVA 3S3GA 4OWGA 4DWSD 2DT3A 1JAKA 3GNPA 4F0RA 4PCTA 1YDNA 1UR8A 3ITGA 4PMJA 1E55A 4D8ZA 1FCVA 3IVUA 2Y2WA 4L1GA 1PX3A 2OMAA 4HJFA 4TX8A 4C6OA 3MA8A 2VEKA 1WXYA 4PCPA 3IVTA 1OD0A 2O56A 3QKZA 4C6NA 2QT3A 3RHGA 2XTKA 4O19A 3VM7A 4GJIA 1NWUA 4ZB0A 1STZA 1U2YA 2P76A 2OT0A 3NGFA 5DT7A 1QI3A 1M04A 4UC5A 3N15A 1KFEA 2Z2BA 1J18A 1YHTA 4ZOCA 5F1VA 5CXPA 2Z29A 4GZ7A 3N1AA 2NPXA 3SUWA 5C0QA 3P5YA 4YU1A 1EHAA 2EPHA 1TUXA 2E5CA 2VR2A 5M2FX 4PBEA 1QDSA 6TAAA 1PPIA 1ITUA 2DZBA 3AIRA 3M0LA 3M0XA 3QV9A 1XDMA 4J27A 1N8WA 2OGYA 3CUGA 3IIOA 3ZT6A 2F2HA 1ZENA 5D2TA 4RV3A 4V2XA 3MUCA 4ADTA 3C61A 3H55A 5BU6A 3OVPA 4DYJA 4LCRA 4C6BA 1GHSA 2OU4A 4DWDA 9XIAA 3AHVA 4GZJA 1DWGM 1EO5A 2KAUC 1KKOA 2E9MA 1E73M 3LB0A 1XBYA 2BGSA 3PZMA 2IKJA 2DZVA 4QBXA 3W2NA 1JRCA 4FI4A 1DJZA 3ZYZA 3LHWA 4TX9A 4HYRA 4YVXA 4G1NA 4INFA 1W54A 3TR2A 3NQFA 4F8XA 3B9DA 4MAZA 1JNEA 3VIGA 4B16A 3IACA 2GDVA 3Q65A 1KCZA 2YZRA 1KGXA 1QPKA 3QYSA 3PG8A 1Q85A 3ABSA 1VAHA 4YVPA 4UQBA 1XL9A 5G5GB 2WPFA 1AMKA 1V7AA 5HQEA 4WHBA 3VC6A 1W2VA 4Q8MA 5H8MA 1AQMA 4P61A 5DELA 5D03A 5F2IA 4BCEA 4X0VA 3V1HA 3ITYA 2PLKA 4WQ6A 2V8ZA 4RPPA 4XZIA 3WX7A 4AWSA 2DH2A 3SUUA 3YPIA 4O18A 3TAKA 3O6DA 1KC7A 2PSNA 1TWIA 1XRVA 1LZOA 1AG1O 4DJDA 3B0VC 1H2JA 1LWIA 2DQXA 4PTDA 4QLKA 4CNOA 1VF8A 3QC0A 1WCGA 3EWZA 5GPRA 4O4WA 2YCKX 5JU6A 4MFEA 3ABOA 1UR0A 4L6DA 3SJ3A 1GEUA 2V69A 3RO8A 5C7HA 1PKLA 3BURA 5T91A 4Y9NA 4F2TA 4JEJA 2OLHA 3MP4A 4N9CA 2O9OA 1CLKA 4F79A 1S1RA 3BPWA 2OYMA 3AIQA 1TFVA 3PUEA 3WUBA 2E5BA 3NSNA 3OG2A 1T3QC 1S7MA 2EQ9A 3KS5A 1CWYA 1V6VA 2A7PA 5KZMA 3RX3A 5LA0A 2ALRA 3CQKA 1ZSXA 4OECA 1A80A 3AO0A 4H4XA 4GCAA 5I24A 3N73A 4QRNA 1DJYA 4DUVA 5LNVA 1TE6A 1NDYA 2NX9A 4GQBA 4XD3A 5FKYA 2CHRA 5A8QA 1E70M 1KRBC 1B3VA 4YYCA 1QHPA 5AYBA 5FOOA 4HB7A 4S3FA 4HMNA 1EB3A 1LUCA 1E6RA 1KWGA 4AHPA 3QR1A 2ZZ6A 1V3MA 3SN4A 3W7CA 4DNHA 1GOWA 1KXTA 5F2GA 4J35A 5LIXX 3TNBA 1NVMA 3W7LA 3PNUA 4MNJA 1TTJA 3U6WA 1ISVA 2DZTA 5U7SA 3W2KA 2ZQ0A 3DEQA 4X2RA 2GJXA 4H50A 1M03A 4PSRA 5LIUX 3P67A 1FFQA 2WVVA 3FJLA 1S2AA 3NXLA 4H3DA 1BQGA 4FIRA 3O6AA 3SFWA 5A6MA 5AHIA 1WAWA 3LHVA 4HCLA 1FQ0A 4YS1A 4I6KA 3M4HA 2BLEA 2Y89A 4BY3A 3V3WA 5D2YA 5KZEA 4W86A 3V0UA 1DWFM 1R87A 4FNPA 4HTBA 4MKSA 3O0FA 2PUZA 3L21A 4JNYA 2V5CA 1JPMA 3VDHA 2BB0A 3D3FA 4L4OA 1RBOB 3CK5A 4V28A 4AMCA 1JYXA 3C2OA 4I8YA 3NVZB 1Q4WA 3PJXA 4M6QA 4DO4A 5A2AA 3UWUA 3QZEA 3U8GA 4REQB 1DE5A 1FKWA 5HR7A 3F4DA 4XO7A 4GYJA 1CGUA 2O9PA 5DRIA 3VE9A 1GKQA 1VCVA 4H4ZA 2XIMA 1EXBA 1EC7A 2A21A 3GE7A 3BMVA 3A7UA 1S2TA 3SW6A 2YYTA 4IX2A 3AXMA 5JXQA 5D02A 2ZTJA 3I6TA 3AWOA 1DIOA 1I4NA 3GU1A 4ES4A 3KTSA 3BZJA 2QMKA 2WP6A 3ZR6A 3IK4A 3SN1A 3WQOA 5AB3A 3QVQA 2CZVA 1EUAA 1B3ZA 4KCWA 4FAMA 1JCMP 5FCZA 3VKAA 2CEQA 3BOXA 3Q67A 4WUIA 4A3UA 1A5NC 5C5YA 1YNPA 1ADDA 3MSYA 1DQWA 3P5ZA 1IXPA 5JUVA 3WMBA 4DM2A 5K2ZA 1FHLA 3KVKA 2C15A 2FTWA 2XVKA 3O0HA 3WLMA 4Z1YA 2XINA 3O8AA 3PTQA 1IWPA 1X7IA 4QJ5B 3U2CA 4F2BA 2D0FA 3L2LA 4XO6A 3GY1A 2D3LA 2BXZA 4CGTA 1N8FA 3E49A 4HU8A 4HT3A 3G3DA 1CB2A 4ICNA 2WJEA 3MKCA 4R7OA 4D6EA 1DIKA 2RABA 1HVQA 3EKZA 4D9PA 4ZQCA 3K13A 5C7VA 2QCFA 2BNJA 4S3CA 4LQ1A 4XQ6A 1BFNA 2X1TA 1JG9A 1KM4A 3TDFA 1NOUA 3MSRA 2UWFA 1YLVA 1TJ1A 2GUYA 3R0UA 3AOFA 2QJNA 1QW7A 1BVWA 1IT0A 4HZ7A 3GAKA 4GD0A 2E3TA 3WUFA 3WH9A 5I3HA 3WFZA 3VD5A 3TTQA 3ZT7A 2QXWA 2BS9A 1CI1A 3DGBA 3UPBA 1SZGA 3WFLA 1VC4A 4E8GA 2XSAA 1N82A 5MF5A 4FNRA 2XIQA 3QY6A 1YQ2A 3WLPA 4WVXA 3IJLA 3C3UA 3MDUA 4PTXA 3F5LA 2OKTA 1KBIA 3ZMRA 3NZGA 4CN4A 3NQMA 4KGJA 3LYEA 1FUYA 3MJYA 4B9ZA 3RR1A 3T7VA 1FA2A 2PGEA 3CWNA 3ICJA 2G3NA 1QMLA 1W9UA 3M7SA 4QLLA 2R8WA 2NUXA 3LD5A 4NJGA 4LCSA 4PRRA 2J7GA 2NQZA 4QX4A 2XM1A 4J3SA 2Y5SA 4XX6A 2OEMA 3CL7A 4FOKA 3A47A 2FZDA 2DUAA 3R13A 4N0RA 3LNPA 4WEVX 2O4MA 2BV9A 3PWIA 3NQ8A 1QAPA 4AIUA 4GACA 3G22A 2W3SA 1J0KA 3IEBA 5I79A 3K30A 2TRSA 2V81A 3BOLA 2WWDA 3W01A 1ISZA 4EMWA 5HA7A 3BQ6A 1ZX9A 2W0UA 5EMJA 1QR7A 4AAJA 1PX4A 2EQDA 4OOUA 5FESA 2IUZA 4LS0A 2CERA 3AU2A 2ISFA 1K9DA 5AYYA 1BHGA 3I10A 3M5VA 1LM1A 4V27A 3L0KA 5D04C 3W7GA 1Q1RA 5TQLA 3KHJA 1IZCA 3DAQA 4H9ZA 2W9MA 1MO0A 4RNIA 5A5WA 3GBDA 3W1QA 2V6AA 1SSGA 3UZZA 2JALA 2V5JA 2X16A 1TMQA 3QV7A 4PCSA 4HNCA 4CN1A 4YNGA 2H3BA 3AM9A 1WZLA 5F2LA 1F74A 2WC7A 2ISDA 1BWCA 2FGBA 1D3HA 4LV9A 3FLUA 4GPNA 1SPQA 4QEHA 4UQAA 1LPFA 2X99A 3ELFA 3ITCA 1F3EA 4MADA 4NYUA 5I07A 4XAYA 4Z0SA 4IMCA 2CLFA 2WVSA 2PD5A 2FPTA 2VOMA 5I3IA 1EDTA 4N02A 3GG1A 1YXDA 1LOSA 1RHCA 3L4UA 3TZFA 1RK5A 4C91A 3AFBA 2VL4A 1BSIA 2YVGA 3B9NA 2BXVA 4RUBA 2OSXA 2PF0A 2Y0FA 3RMJA 4ZQNA 4AZ7A 1ZLPA 1IT7A 3QQWA 3FOKA 2P50A 2VQUA 1DJGA 1MI3A 4DAFA 1QI5A 1M1BA 4PTMA 3W7DA 2AGKA 3O16A 2RDWA 2Z1XA 2GK1B 2VHLA 3L0NA 3PBUA 3HZ3A 1XLMA 4AZIA 4ERGA 4L56A 5JBFA 1MQQA 1FO4A 2YKKA 5BXTA 3ZFHA 3B9EA 3BICA 4UFHA 5ER0A 1LT8A 4BJHA 1MOKA 3TVAA 1P1XA 2E5AA 1L8NA 1XD0A 2H9AA 4IJBA 4N42A 4AD3A 1TJRA 1FWGC 4NU7A 5CH9A 3PZTA 4A29A 4GVHA 3BAJA 4M7TA 2HWGA 1ZAIA 5D32A 3THCA 2QUUA 3UCDA 2Y8UA 1XIMA 2RAGA 4IPPA 1OQFA 2C91A 4O1CA 2EEXA 5JH2A 1GOXA 2AKZA 4O50A 5FJRA 1T8XA 2DZSA 3IWPA 3S5OA 2QJMA 3WELA 3NQ7A 2RUSA 3W1PA 4PMRA 1IEXA 4APNA 1K4QA 3Q94A 3FN9A 1MW0A 2GH5A 5AHEA 4TR9A 4CKQA 2Q3OA 3VPLA 4M80A 4I7WA 1MRQA 4IPIA 5BROA 2IPWA 4WSHA 4C7FA 4CD8A 4GJ1A 5DY3A 3L65A 3HRDC 1MO9A 1JCJA 1WV2A 3AXXA 4DJFD 4DF1A 1OYAA 4M82A 1ZBVA 2C71A 2PDWA 1ONEA 3WZ0E 4C6EA 3OJGA 3JW7A 4P7QA 2C3CA 4GX9A 3OGSA 3QW3A 2PURA 3FHAA 4BURA 2IKGA 3F7JA 1W8GA 4KPLA 3MKKA 3PTMA 3P60A 3GTXA 5D9MA 1IQ8A 3VX0A 4H9YA 4NI3A 1ZY8A 2ZZ2A 3M0ZA 1R2TA 4KFNA 4QTGA 4LNYA 3VNLA 1C29A 5BRBA 4UTFA 4K37A 2G0WA 3V0SA 1E6XM 1BTCA 4MB5A 1VFOA 4WDUA 3W7EA 2WNQA 1RAKA 1YADA 5A1AA 1OYBA 3WNKA 3LTPA 1N63C 4MKVA 3HFYA 3WLHA 2XGZA 3WJXA 3M0YA 5D09A 2Y85A 4QHRA 4K1GA 4D6GA 5I06A 1GRTA 1FWHC 2PDNA 2ZZ1A 3KL3A 3V36A 5KZDA 4EM3A 3NQ6A 3W1RA 2WWCA 1FWBC 3G3MA 3NVWB 1R7OA 3WF4A 2XSBA 1TZ9A 1AQFA 1XPGA 4BZYA 3EB3A 1VYSX 4ACYA 1MEHA 2GPTA 3VGBA 1ZCOA 3OIHA 3DJJA 4ASTA 3LXAA 4UTLA 1QK0A 3TSBA 3VA8A 1X7FA 3H4GA 1TZZA 5KVHA 1KBKA 4TQTA 4DNAA 2F61A 1KR0A 1UD4A 1GQLA 2XFYA 4OV9A 1S2VA 1WXZA 3MUAA 1E4MM 1M53A 2DT1A 1UR2A 1YYAA 2FPVA 4Q6XA 4ZZ9A 1POJA 2GQWA 1TPB1 3W83A 4AVOA 5CGTA 1A0EA 2GUUA 1BTMA 4ZENA 4CCZA 4LGXA 4PYSA 3CZEA 4YTRA 4XZBA 1YTEA 1YDOA 2JFEX 3W1MA 3W82A 3IGSA 2OZ3A 4RW3A 4B5UA 4YN5A 3PG9A 1Y5VA 4U2ZA 2XZ7A 3DH7A 4C6KA 2WSKA 1Z42A 3TQKA 2WOQA 2X8HA 4KWWA 3CHFA 4UMBA 5HPCA 3D6NA 3CAQA 2JGQA 4WX2A 3UESA 3W27A 5HWNA 2G3FA 3U4FA 3AROA 3DESA 4JFUA 1LBFA 5LYRA 3VFLA 1V7YA 3RRXA 2CZFA 4H4TA 2PBOA 4NP7A 3SGZA 2EKGA 1XBXA 1R6WA 2WJFA 2BY0A 3QHNA 1UH3A 1O1ZA 3HQPA 1XIDA 1UC5A 3DHUA 4TU1A 2D24A 4FNTA 4UFJA 2J7EA 1LG1A 3R8HA 3T0AA 3URHA 1LUCB 4GLEA 1XIHA 5EMYA 4HYVA 3VIJA 3G18A 3DBNA 1E43A 3U0HA 2QGYA 3E6EA 2PTDA 4QNEA 1CX9A 6PTDA 6ENLA 2EQ7A 3AMKA 3FW6A 2VVSA 5A8GA 4PL1A 3NVVB 3KZPA 5DMMA 1TVLA 1OM0A 3WQEA 2GJXB 4H00A 4QXIA 3CJPA 4H9UA 2PWGA 3KRBA 2WVVB 4ZCWA 4Y2WA 4NY2A 3GNOA 3FCPA 3PSWA 2W5FA 4GGBA 5LZLA 2QCEA 2FZBA 3OA5A 1BXCA 2E8ZA 3LU2A 2A3BA 3STGA 3GC4A 5DEZA 1VQTA 2ZWZA 4CEXC 2V63A 1XFCA 1EGVA 1TX0A 1RA5A 1HW6A 4NT0A 3NO1A 5FEXA 3T07A 4IXHA 1H0IA 1DHKA 4XK2A 2XJ7A 3UYCA 1UKPA 3W7IA 3PFMA 3GM8A 4WSKA 4TMCA 4YCPA 5J8LA 2PWEA 3SCTA 2CHNA 4XZNX 2HZGA 3L0GA 3NYDA 3W2UA 1RCOB 4PMZA 3N2BA 1JF6A 3WMCA 4JTTA 1GZGA 1X1ZA 3CUJA 1VCGA 1KM6A 4G9PA 3LM3A 4ATDA 3CLMA 1RCQA 2GQAA 1QASA 3K4DA 2TODA 4PMDA 3QPYA 4LS1A 5AHMA 1OBAA 3G1DA 2I5QA 4Q8PA 4KW2A 4M6VA 4LRSA 3W24A 1EP2A 4CNPA 4OQVA 1EF2A 2ONEA 4F48A 3XIMA 4EQRA 1AOGA 1PZ3A 5E0CA 3TKFA 4S1FA 4XWUA 3DG6A 3ATYA 3EDKA 4D1IA 3HTWA 1IXQA 4UNLA 3MYOA 4XBSA 2D73A 3A9IA 4LAUA 3EPOA 5CG7A 4FLOA 3TYCA 1JYVA 2XH4A 4HCHA 3BQ5A 2OOGA 4JYDA 1EA9C 1I75A 2CKRA 3PBWA 2BHUA 2W4XA 5M17A 2ZXBA 1VJIA 3KBWA 4MWAD 4Z2GA 3NQVA 4KGLA 3E2SA 2DW7A 3WLLA 1W9PA 4LB4A 2GYIA 4OUEA 2QIWA 4IOTA 5G4EA 3STPA 4RNJA 3DYOA 1NTHA 4HA3A 3UFYA 3NM3A 3MVTA 2BC1A 1XYAA 1XR2A 1OVDA 1VLIA 2HISA 3PZOA 3IUDA 1IXOA 4NX0A 1E4NA 1FH7A 1XKJA 3M5XA 4IZGA 3AZSA 2WKGA 1L0PA 2QCNA 4LH8A 2XIJA 1SR0A 4YCOA 1RVGA 1VYPX 4Z42C 4PUKA 4A3QA 4Y6GA 1OJTA 3IRDA 4ADUA 4O1BA 1LRNA 3M0KA 3A5FA 1JZ7A 1NP2A 4S2CA 1W9XA 2C3DA 3QHOA 4ORIA 3VM5A 4HSNA 3DHFA 4HNNA 1QNVA 2C0HA 1EDQA 3TJ4A 1OWQA 1XRFA 1R3WA 4ZE5A 4PB3A 2UZ9A 5U25A 5REQA 4OT7A 2WLYA 1UG6A 4DUXA 2J7HA 2OFJA 5B7YA 4BS0A 4PTNA 3QR3A 2R6OA 3NVTA 2BXYA 1H11A 1VFLA 4GUGA 4IIBA 3GFXA 3TOPA 1QK2A 1N60C 3C2YA 5JBDA 2Z1KA 3QMRA 1A0CA 4JQ9A 4ECLA 4B4HA 1KM2A 4ERAA 3UEQA 4GFSA 3I7SA 2EPOA 5FS6A 3LGGA 4YWOA 3W75A 4RDYA 3Q45A 1B9BA 3RPMA 1NAL1 3BLKA 3B03A 3SY1A 1GKRA 4XSLA 1W5NA 5EYWA 1N7KA 4N2YA 2O7SA 3LBMA 4TOQA 4LVDA 3PWGA 1TWZA 3CTLA 1NQ6A 1G4EA 4NXKA 1E1FA 2OX1A 4KEZA 2PMQA 3Q6JA 1XH2A 1Z89A 5HQMA 1R86A 5ABTA 2HVNA 1NIUA 1WYIA 1DJWA 4R88A 1UUOA 4E8DA 1JI1A 3OIXA 1GEQA 4K8EA 2NUWA 1O5XA 5ABEA 3AIBA 4W7VA 2B0MA 2CETA 3BCDA 4RZ4A 2Z7GA 4ML9A 1KFCA 4MLRA 2EJAA 2JEQA 4DJEC 3QF0A 3R2GA 2PODA 1W5QA 2RKXA 5I2UA 2CCRA 3O06A 4HPNA 4TXEA 3PWAA 4CQAA 2V3GA 3LXBA 3EAOA 1G0CA 4ATWA 4EM4A 3F4CA 4JIHA 1K7FA 3C2EA 1E5NA 1X1OA 4L61A 1UD8A 4R7WA 4YPJA 3WF3A 1CYGA 4CVWA 1LLWA 3TTSA 3VNYA 1OT1A 2ZZCA 3N3MA 3EXTA 1A3XA 1K8CA 1US0A 3IV3A 3K1GA 2DVTA 5D4YA 1KLYA 3WN6A 4BFAA 1XSJA 4B4FA 5LIKX 4PMOA 1ODZA 1X38A 1MFUA 2NXIA 3BCJA 1JI2A 4GXMA 2FVLA 1RVKA 1JQXA 2F6XA 3KL0A 4FXJA 2VZUA 3D3AA 3I65A 5SWUA 3IRSA 3GTNA 1Q6GA 5BOOA 1MEIA 3MI3A 1AH4A 7XIMA 1NDZA 1KXHA 1I2NA 2C3ZA 1ISWA 1H51A 4PTWA 4RE2A 1KFBA 4TUFA 3SCVA 3W7RA 3G6LA 1CPUA 4LW7A 4UB9A 2B31A 5EBUA 1VLWA 4G8TA 3S9IA 1UA7A 3AJXA 5C8BB 1J0ZA 1ODUA 3OEXA 3CASA 4IGNA 3GK0A 1FWJC 4CNSA 1FWDC 3N3TA 3LCFA 3PNZA 3UXKA 5AYZA 5CAKA 3L4YA 2H9AB 3PZNA 3P8IA 1EFZA 4GHRA 2G4FA 1EEXA 4XTIA 1UJPA 3KBMA 1A3WA 1TB3A 3GH7A 1G94A 2Z25A 4KWVA 4E3TA 4JHOA 1VRDA 1W1A1 4H9VA 2HSAA 1FWNA 3ARWA 2A8XA 2DEPA 2W0HA 5T9BG 4P7OA 4UNIA 4Z08A 4OIFA 4A3HA 3URAA 3V0TA 2VM8A 3AALA 4KERA 5TR3A 3N13A 1E1CA 4MF4A 3TWAA 3TYBA 3DUGA 4QR6A 4JDBA 1V6UA 3C2VA 1PXGA 4H7VA 5B80A 5I09A 1HJXA 3ONCA 3CQHA 1VIZA 4H6KA 1OYCA 4J7RA 2CBVA 3MTWA 2E6AA 3SCNA 3GIPA 3KRZA 1W1IE 1XI3A 4Z1BA 1XHCA 3G2GA 4NJKA 3CZKA 2W79A 3DFOA 1IIHA 1XYBA 3HQNA 3S9ZA 5DCEA 5K9XA 4JTAA 2ZICA 3WDPP 4WY0B 1PJ9A 1ZUAX 3W71A 2E8YA 1O5RA 1H5YA 2QPUA 4QEEA 2IQDA 3CH9A 1L6YA 4UOZA 2WXDM 2AMGA 2AKMA 2Z0IA 4O4VA 3JU2A 3M0IA 1TIWA 2PRHA 5HUPA 1LLOA 2R1NA 3WEMA 5DMYA 5I3FA 4GI8A 3A4AA 3KBSA 3VD9A 3L5OA 2A3AA 1WXJA 4Q8OA 1NOFA 5C6MA 5D30A 3I6RA 1IGWA 3HPXA 3W70A 1EIXA 4EQXA 3DZ1A 3F5JA 5BOFA 3KVMA 4I5XA 1AJZA 2OCZA 2J8TA 4HPJA 2QR6A 1LRTA 1TPH1 4IMFA 3W6YA 3GTHA 3P93A 2J88A 5I3JA 4DELA 4XZMX 3LRLA 5CJMA 4XZ9A 2QEZA 1FFRA 1DORA 1BG9A 2CYGA 4AQLA 3EB4A 1VBRA 1E9YB 4C1KA 4LAMA 3UCQA 1FXPA 1QW8A 3T0BA 2J8GA 1L8PA 1GRBA 3HW2A 5I77A 3GVWA 1DQXA 2YVJA 1Q6DA 4EXQA 1CECA 4GH1A 5IXEA 1M7XA 4ZO6A 4GXPA 2FYMA 1E71M 2FVKA 5EFFA 3L67A 2FZNA 3AS3A 1D8CA 1XH1A 2QVNA 3CWHA 3F2DA 3B4YA 4KEMA 3SR6B 3QH2A 5XIMA 2I9EA 2DZWA 3H4WA 1EJWC 4BEQA 3W2MA 4AIBA 2OR2A 2EGZA 3LRMA 1Q2SA 3DENA 2J4GA 3UJFA 3MMTA 4DJFC 2OVLA 1IT8A 4KWUA 1AMYA 4PB4A 2X8CA 2V5DA 2PDXA 4L6OA 3IIXA 3LBOA 3PUDA 3SIZA 4RDWA 2O9RA 3OB8A 2PDPA 3KTXA 4UIOA 1YPFA 3TA9A 3UVIA 3BLFA 3EMCA 3HV9A 3CO4A 1RK6A 1HZYA 4H8VA 1ZAJA 2XU2A 3DU0A 2A4AA 2DT0A 3N4FA 2GVYA 5A6LA 2YIHA 2MANA 3QLDA 3FXYA 3UG5A 2VR4A 1F4AA 2ZZ3A 3IPWA 2QCHA 1CXIA 2OPJA 5C2XA 1OGSA 3RU6A 4XD6A 4QDPA 3TV8A 1DIEA 2OWWA 4NEVA 1U1HA 5FMHA 3H4XA 3UWZA 5AOUA 2VUNA 2P3ZA 4J3UA 1GOIA 4QAIA 2VDGA 3GDBA 4AVNA 2FHCA 3KWXA 3SCQA 4LEQA 4ZXLA 2J6XA 1ME8A 2VFEA 4GVGA 4LVAA 3T1GA 4E4PA 2YZ5A 3XINA 2Q8LA 4DO6A 3SCPA 1S3HA 3M1ZA 4HVXA 3NGJA 4NG3A 2DPEA 1CB7B 4QDWA 1EL3A 3O0KA 1K9EA 2PC4A 5HINA 1Q8JA 3RCNA 4XKMA 2XVPA 2AQWA 1PKMA 3WUGA 1F3WA 3E96A 4TVYA 3CGEA 3F4VA 1R9ZA 1HKJA 3D47A 3LG3A 3TYEA 1UJQA 2JIEA 1S39A 3WNOA 1E6QM 3T44A 1ITXA 4EVZA 2OEKA 3SQSA 1NFGA 1TV7A 1TV5A 3CIXA 4C5YA 1T5AA 3TXVA 3DC0A 3GG7A 1SFLA 2IQTA 3VOFA 1H61A 1TPEA 5IBXC 1L6WA 2Y5JA 4JCMA 2VFGA 1E3ZA 3C86A 2YPIA 3HGRA 3NCOA 1OX5A 4Y8FA 1MDRA 4M1BA 4R9XA 3GXTA 2PWUA 3G0XA 3VIFA 3DOPA 1VPQA 3LLDA 1UWIA 4M52A 3DBPA 4JXCA 3V7PA 2ZXAA 2YDRA 4BEUA 3MS8A 4HBKA 3C3NA 3TOYA 2RFGA 2ZXDA 4CN6A 2NWRA 4MIMA 1UW9A 4LF2A 4LU0A 4NZ5A 3GFYA 3SCWA 3MMWA 3GBEA 3RLUA 3QRHA 4ATLA 3VCNA 2OB3A 1PTAA 1R3YA 3RJYA 4FXRA 3AYVA 2JK2A 4AD0A 3F5KA 2QVHA 1FHVA 4G7EA 4E3VA 4UTUA 1W3HA 2PDIA 3CXOA 4HSOA 1W3LA 2V68A 1KLZA 3R58A 2PA6A 4FXSA 1KCXA 3VIHA 3IIPA 1LL7A 5G2HA 1LJYA 1HP5A 2WPEA 1LL4A 2CESA 1VBJA 3OYZA 1JULA 3BG5A 3U5UA 4IGMA 1F73A 3O6CA 3W1TA 1W37A 1QPRA 1C8QA 4H7ZA 3UZXA 5H8PA 4QIUA 4RPQA 2CLPA 1A5CA 1DWIM 1XXXA 4LUYA 1MUWA 3W1AA 1RBLA 4AD2A 5CGQA 2XH7A 4IIDA 4C6MA 3ES7A 1KM5A 4R53A 3VU2A 3JUGA 4B91A 4MSSA 3A23A 2VWTA 3NSMA 3W7KA 2OEJA 1YE6A 1HJVA 2WLZA 1L2UA 2VEPA 3HBLA 3B9JB 2QPSA 3N2TA 4BQ5A 1T8QA 2YSWA 4MPKA 3SRDA 1H2IA 5KVIA 3IJ7A 4GE8A 2H8ZA 1ZJAA 2VGFA 4DPQA 3WLQA 1TRIA 4NUWA 5F4XA 4ZOBA 1YNQA 3ATZA 3RFAA 1NU5A 5AVHA 3QBUA 1DP0A 1E56A 3KEHA 3UYIA 3W00A 3ABRA 2INZA 2GOUA 1PHQA 4HK7A 3WF2A 4IICA 4W85A 1UHVA 1GVYA 2RH9A 1J96A 2QKFA 2NV1A 3E02A 1KWKA 5DANA 3W7HA 4DJEA 1JGIA 4V33A 4PCNA 5CPQA 1IWBA 1E6NA 2PE4A 3FGCA 1NFPA 1K1DA 1JCXA 1Q4NX 3SRFA 3NRZB 5BXRA 3CO8A 1FOBA 4NZ1A 4KIRA 4EE9A 1ZJHA 1E9ZB 3MHUA 1MDLA 3QV8A 2XWDA 3GG8A 3AJ7A 2WW5A 2ZE0A 7ENLA 1V59A 1QHZA 1QPNA 4OBTA 2A1YA 2QLYA 5REQB 3EWCA 5I0DA 3WJYA 3E0WA 4ADSA 2DQWA 1Z32X 3FVDA 1IXNA 1IEIA 3QSTA 4JTGA 1XLBA 1RY0A 4LIIA 2J9XA 1GOKA 5E1QA 3CGBA 2GRTA 4NEWA 4C7DA 1ZFJA 5JCKA 1G9HA 2HK1A 3RLGA 1H50A 1M7JA 2G50A 4UTKA 3FA4A 4J56A 1AW2A 1QOPA 5C9WA 4M0XA 3K46A 3N2CA 2F8QA 1R46A 3QY8A 3WD2A 4EKJA 1XCWA 3KZSA 3QY7A 3KDNA 3DN5A 3A9BA 4FX6M 3NL3A 4P8WA 2JK6A 1W1YA 4GBUA 2VEIA 4B5NA 1XC4A 2YCEA 1A4LA 3UNTA 4MWAC 1YBQA 3C8NA 3O15A 4GX8A 2HROA 3QM3A 4BKNA 4AMAA 1J0IA 3WD0A 3AXHA 2DV0A 1XLEA 3OBAA 3QLLA 1ECEA 3ZVIA 3KWSA 2ZC1A 3LA4A 4I9MA 5B7ZA 3ES8A 2QZRA 1GYLA 3BOFA 3VDAA 1PDYA 5A3HA 3PS7A 4IHCA 4B5TA 1XH0A 2PP3A 4DI9A 4JTIA 4JTSA 3CLWA 2HCVA 2OELA 2AAQA 1UPMB 3L8KA 1DPMA 1SVDA 5C9RA 5FSDC 1EUNA 4KWOA 1SM9A 3UGRA 3TU9A 3DIPA 1C93A 1NHSA 1RALA 3KCLA 2WJZA 3P80A 3G1AA 2X2YA 3W7JA 3PPHA 3VD3A 3PC0A 1WOAA 4BI5A 3ZO9A 1GRFA 4TO8A 3ZLHA 4E2BA 1TKKA 2HRWA 1LG2A 3AXIA 3CGDA 3GXDA 1LQ2A 3EKGA 3QMTA 5ABFA 5D8WA 3NOYA 2IKIA 3U57A 1QVBA 4BF7A 1J0HA 3CZGA 4C6CA 1I1WA 3CIVA 4WJEA 4G7FA 1XDIA 3BLPX 2X0SA 5BW6A 2NVKX 3BW4A 3PP7A 1XQKA 5BNKA 4LAOA 4MYXA 3M47A 3W1XA 2H8XA 1VEPA 1XSKA 4KRUA 3ZVHB 2NX3A 4MOZA 4NYYA 4H4QA 1MXGA 1HL9A 4IL2A 4NAEA 5DCBA 3D9XA 1CXFA 4J4KA 1K7EA 3OVGA 4JPGA 3NM1A 4KPRA 3NFUA 2F7FA 4XVDA 4PMXA 4YHGA 3OYXA 4HTYA 1SJDA 2C8NA 5FSEC 3U3HA 4F0HA 4US6A 1J0JA 1JUBA 4LNCA 1SW7A 1V6YA 1KGWA 5F1UA 2GGHA 5LNUA 4KCTA 1VB9A 2WZIA 4DWSB 4HU3A 2ZX6A 5AC5A 1M6JA 5EBAA 3VKJA 1GJUA 1BF2A 3UG3A 4NJIA 3LX9A 3SQMA 1N61C 2ZVIA 4CNNA 3W07A 2CWXA 2VI0A 1FDYA 3BZGA 4DF2A 1O4UA 3KTCA 1GTEA 2RDUA 3SCRA 1Z7AA 3WDQA 1KV5A 4PTVA 3GHRA 1TE1A 4I3GA 1G4TA 4EMJA 3DGRA 4Y7EA 1F6PA 4J3VA 2EXOA 4AZ5A 1FP9A 5FIPA 5G2WA 3WD3A 2QULA 4J5NA 5EA9A 4EAYA 2VR5A 5FJJA 4OVXA 1IV8A 3G0SA 4QE5A 3MV11 4GIAA 4W8LA 5HNTA 4MG4A 5AYIA 4DO7A 5EBKA 4Y90A 4DJFA 5G5IA 4JYFA 4IMAA 4DHGA 4S39A 5CPLA 5C9ZA 1HJSA 2A79A 2OO0A 3NS1B 1ONFA 1VGAA 2W63A 3N14A 3CUIA 2HQMA 2ZKMX 4E0CA 3KVLA 4GZEA 4TVCA 2HMCA 5A2BA 3V18A 1I1XA 4LS2A 5G1YA 1XICA 1GT8A 1SZFA 2BHZA 1CIUA 2G8ZA 2XDFA 3ABQA 4LRTA 1OX6A 4UR9A 4ZL1A 1ZBWA 3T2OA 2VDIA 3NAVA 3UZYA 3NPWA 3VI2A 1CXLA 2XGIA 2HTMA 4DZIA 3KX6A 1GVOA 1RA0A 3I3EA 1AH0A 1ZDLA 4D1JA 1FWAC 3WLSA 1LYXA 3DK4A 1VBGA 1H6VA 4ZFCA 4NAFA 2G3MA 4GG9A 4IMGA 1F3TA 3RAOA 3SR7A 4MFDA 5XINA 4IX0A 3ARZA 1B3XA 1OC6A 2IPGA 1TPFA 2ANUA 3WQ4A 4NASA 1W3IA 4PE8A 3IUHA 2YX0A 1J4EA 1BAGA 2BOEX 3MVIA 3WNPA 4DZHA 3WD4A 2ODOA 5C9XA 5TD4A 1HJWA 3WQCA 3N11A 3N29A 1UZDA 4L4LA 3U2EA 4W84A 1WPCA 3GB6A 4RK8A 5DX7A 3LERA 3O07A 3TTOA 5T8GA 2XGBA 3G6MA 5C2CA 1YW1A 1VEMA 3AMDA 1DTNA 3CUHA 3GVQA 3KBJA 5CLTA 5I3DA 2P10A 2DZAA 3VCCA 4JEQA 4PMUA 4H83A 1O5QA 2OSWA 3WQPA 3TN4A 1EJSC 1AD1A 3NR0A 3ZJ7A 3K2GA 1OCNA 2FJUB 3RM4A 2V2DA 1W5PA 3RG6A 2J75A 5IBXA 1TPDA 4IT1A 3V5FA 3GYCA 4S3BA 3VNMA 4POCA 2CLIA 1WP6A 3TMLA 4JL2A 1I2PA 3H2OA 1EJRC 3TW9A 4NZ4A 4GQRA 2HNHA 1AUSL 3S6TA 2XUCA 1J9YA 1W32A 1JPIA 4ZSUA 3L12A 1XIGA 2OG9A 4FO4A 3WEZA 2NXHA 3ZOAA 4HNUA 3B0YA 3TJXA 4K8GA 4ZXOA 2XHYA 1NF7A 1XSIA 1O66A 1PKNA 1SR9A 4RDVA 4ZSTA 2QAPA 1NJJA 1L6GA 3O7UA 1HX0A 4GY7A 4HKPA 1Q65A 1M9HA 4JQ3A 1O95A 5HULA 3EX1A 3VVGA 2Y8VA 4BQ2A 3IARA 3RLVA 5I7GA 4DY1A 2GOKA 1ZPTA 1VEOA 3V5OA 2W55A 3D5HA 5DMLA 1S5TA 1UD6A 5CCZA 5F4SA 3RXZA 4IJRA 3C6CA 4IG2A 1XG4A 4JFVA 2CXGA 3GH5A 1QBAA 3UJ2A 1TYGA 3AYRA 3KM8A 3HB9A 5DMNA 5G2IA 3P3BA 2XVGA 3MJMA 4WXYA 3PZGA 2V6OA 1Q13A 1OCBA 3UY8A 4FMVA 3LTSA 4ZO9A 4MJ4A 3CT2A 2OGJA 1GNXA 3VCRA 2QJIA 3RF9A 3V35A 1R5YA 2E0PA 2WOVA 1K9FA 2WVTA 4JAWA 3TNOA 3ITTA 1GPFA 4O0ZA 4XAPA 1JF5A 3SECA 5LGZA 1RR2A 4MWAE 4GWEA 3A7AA 4NL1A 2JQXA 5CC5A 3LMYA 2VC5A 3EWBX 2FZ8A 4H2HA 4J3XA 1QBBA 2ZX7A 4A3RA 1CEOA 1UOKA 1LWJA 1WAUA 4H8HA 2PU1A 1WX0A 4EK7A 2DU2A 4AZGA 3P0WA 3IANA 5C54A 3HMJG 2WM0A 5FF2A 1TWSA 4EANA 3VNJA 3CPUA 2ZA2A 2NWSA 5AY7A 1IIGA 4O11A 2PGWA 6CGTA 3BK0A 2GVGA 3LCXA 1Q7MA 1KCKA 1MW2A 1X6LA 2CKSA 4ZB2A 2ZZ7A 3R79A 3GHUA 5FAGA 4JQ4A 1LQAA 4K8DA 3LGDA 3MSGA 2VZVA 4MAVA 2WBKA 1KTBA 4HA1A 3ARPA 1UROA 5AN7A 4MNMA 3CMFA 1Z41A 3BLDA 4G7EB 1DTUA 1Q6QA 2CNCA 1ZS2A 5G4WA 4UTTC 5JVLA 1Q6EA 1DHPA 3ZJ6A 3MB9A 3MSDA 4JX6A 2ATSA 3BMXA 2CHOA 3TYAA 3KRSA 3W72A 3B0PA 4A6GA 5CLWA 3WNMA 3EF6A 2CLHA 2A3HA 1M68A 3IJ9A 3KS6A 4Q3MA 4B5SA 2NSXA 3EDEA 3GRIA 1BRLA 1JCTA 3UVAA 2ABBA 1IGSA 2AQOA 1G7UA 3EA2A 3A7RA 4F4RA 3VTRA 1MSSA 1LDCA 1X97A 1JDDA 4NNAA 3VKBA 4DO5A 2X8RA 3CHDA 1TWWA 2WKJA 3H2AA 2OO6A 3ITXA 5PTDA 3GDLA 1VH7A 4OOZA 1G1YA 3G1RA 2QGHA 4LANA 4DQWA 4J57A 1LTDA 4Z17A 4PBFA 2WZMA 3VGHA 1MZRA 4PMYA 1HF6A 1SU5A 2WSRA 3DDMA 2CBIA 2KZHA 3CTTA 3ARVA 4KS0A 4LX4A 4MWAA 1TCMA 4AXKA 4HYWA 1U5JA 5CEWA 4Q7BA 2PP0A 5FJOA 4PUDA 2BGQA 4OBRA 1JL8A 1GVEA 3QPZA 3FA5A 5HJLA 3THAA 5AC6A 3R10A 4R27A 1ISYA 1I2OA 2D0HA 4QSHA 1ESWA 3HGOA 1OGBA 1DBTA 1K03A 2IQ0A 3QZ6A 2ZRXA 2FKPA 3SCOA 4YWIA 3FGCB 2WJDA 2E1DA 1K8XA 3BG3A 4NI8A 1BPLB 3LCLA 3LK6A 3L5AA 4S23A 1GCYA 3AYTA 3VNIA 4AZCB 2HV5A 1J5SA 1I8JA 1H7OA 1Q63A 2XPKA 3A6OA 2OQHA 3V1PA 4LYQA 2NT1A 2WNWA 4MB4A 4C6JA 1DV7A 1JFHA 2NLIA 1ZMDA 1C9WA 1P0KA 4Q4PA 1FWTA 2Y24A 2QUNA 1XV8A 1JZ3A 3WENA 2XH0A 4LJ3A 4JQAA 3T6CA 4UR7A 4CU8A 3P62A 4RZ6A 2I56A 1UWSA 3KOXA 4JFSA 1REQA 1B3OA 1UUQA 1YX1A 4PUEA 4ZQMA 4EWJA 1CDGA 3PANA 1QPOA 1VBHA 2GJNA 2AGTA 4ZFMA 3HO8A 3WF1A 2E3ZA 1FWRA 3MP5A 3EXRA 4JIPA 1TYTA 1YRRA 1QUMA 3N2OA 2ISVA 2EQ8A 2VX6A 3PY2A 4GQQA 1UH2A 1OFEA 3WUEA 1EZWA 4B90A 2E25A 1HT6A 2E77A 3WQWA 1ZL1A 4LAKA 1WBJA 3GO2A 4O28A 4H9TA 5EFDA 5IDZA 1B1YA 3MWCA 3PK7A 5KTLA 4AHOA 5FJPA 1F76A 2PDFA 1XPYA 3TAOA 1KBBA 5JBEA 1IR2A 2JKPA 1XBVA 3AS2A 4FR6A 3TW6A 2VRJA 1XHGA 4YTQA 3FJ4A 3WNLA 1V6XA 1YTDA 4EACA 1UB3A 3N34A 1XD1A 3BANA 2FTPA 3GD6A 4J3TA 5FD0A 4DBSA 2GL5A 1RXOB 5D9NA 3TN3A 3H2EA 4EPEC 4QJ3B 1SB3B 3MYPA 3OU8A 3M07A 4JZ5A 2NQLA 1GREA 1ITQA 4AWEA 5E9XA 4NJHA 1XLCA 4W7UA 1YTKA 1KRMA 4O8AA 1IEWA 3WDJA 1FX6A 5A69A