4E8GA

Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound mg
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
369
structure length
354
Chain Sequence
MKIAEIHVYAHDLSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Isomerase
total genus 116
structure length 354
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e8gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e8gA01
3S5SA 1NELA 3IJQA 3DG7A 2PPGA 3I6EA 3R10A 4ROPA 3VC5A 4MGGA 1WUEA 3T6CA 4M6UA 3TWBA 3V5CA 2FYMA 3HPFA 4GIRA 4J3ZA 3CXOA 2AL2A 2GGIA 2GDQA 1TKKA 4DX3A 3MWCA 3B97A 2QGYA 2XH7A 3R0KA 4MMWA 1P43A 1TZZA 4M0XA 3D47A 1KKOA 2MUCA 2QDEA 4GISA 4K1WA 3DG3A 4E4UA 4JN7A 3I6TA 3RITA 3OTRA 2P0IA 4IZGA 1MNSA 3D46A 3ZVHB 1W6TA 2OPJA 3UJRA 5IDZA 4E8GA 2QJMA 1MRAA 3IJLA 2XH0A 3VCCA 3DERA 3R1ZA 1EBGA 2P8CA 3RCYA 3PFRA 2ZADA 3N6HA 3QTPA 4H1ZA 1EC8A 2HZGA 4DXKA 3TJIA 2PP3A 3MUCA 4E4FA 1PDYA 2OQYA 3H12A 3CK5A 3MKCA 4X2PA 3DFHA 1ONEA 3FYYA 1KD0A 4A6GA 3ZVIA 3NXLA 3BOXA 3BJSA 3V3WA 3EEZA 3RO6A 2PA6A 3DEQA 3VA8A 4DYEA 3QPEA 3RGTA 1MUCA 2GGEA 1JPMA 3SN1A 1JCTA 4JN8A 3TW9A 4HCLA 1FHVA 2QQ6A 3OPSA 3GY1A 1ELSA 3N4EA 2PGEA 5BOEA 2PP0A 1SJBA 3U9IA 5FJOA 3JW7A 3CB3A 3DFYA 4GYPC 4IL0A 1NU5A 3FCPA 2AKMA 4GYPA 2OKTA 2XGZA 1TE6A 4HYRA 3UJSA 4GGBA 2GL5A 5FJUA 3TTEA 3QN3A 4GFIA 2PMQA 2QJNA 3P3BA 4E6MA 2PCEA 2OVLA 2DW6A 2P88A 4HNLA 3SN0A 2OZ8A 6ENLA 3OW1A 1KKRA 1IYXA 4KEMA 3GD6A 2GGJA 3OZYA 1ECQA 3N6JA 2QDDA 3P0WA 2NQLA 3VFCA 2PSNA 4IP4A 2GGGA 4IP5A 3MZNA 4A35A 3FJ4A 5FJTA 3H8AA 3N4FA 1EBHA 1MDRA 3DIPA 3MY9A 3TQPA 4K8GA 1MDLA 4DWDA 4J1OA 2OFJA 3NZGA 1FHUA 3CT2A 3P93A 2OO6A 3VCNA 3TCSA 5J04A 1R6WA 3FXGA 1SJCA 3JZUA 3UXLA 3KUMA 2QVHA 2XH4A 3Q4DA 4ENLA 3GC2A 4HNCA 7ENLA 3T4WA 4DN1A 2OG9A 4ZCWA 5FJRA 2PU0A 4G7FA 3TJ4A 3MQTA 3SN4A 4E5TA 3R11A 1RVKA 4Z1YA 4K2SA 5EU9A 2OZ3A 3PWIA 3T9PA 3DDMA 2GGHA 2ZC8A 4IL2A 2AKZA 2AL2B 3GO2A 3OP2A 3UJFA 4A3RA 4H19A 2MNRA 3UGVA 1SJDA 3RRAA 1E9IA 3TWAA 1EC9A 3ZVHA 4HCHA 3CAWA 3V5FA 3PK7A 1EC7A 1R0MA 4KT2A 2OQHA 2P3ZA 4ZA0A 1XPYA 4IHCA 3BSMA 3SJNA 1YEYA 3UXKA 2ONEA 4JHMA 3UCCA 3Q45A 3IK4A 2HNEA 4FI4A 3H7VA 3NFUA 3T8QA 3FVDA 4F4RA 2OX4A 3UJEA 3R25A 4KWSA 1JDFA 3QLDA 2PU1A 3FV9A 1KCZA 3VDGA 2CHRA 3DESA 3H70A 2DW7A 3DG6A 4IT1A 3OZMA 2OZTA 4H83A 4YWSA 3U4FA 1SJAA 4HCDA 3R0UA 3SSZA 2PODA 3MSYA 1P48A 3STPA 2PTXA 3K1GA 2HXUA 4HPNA 3RR1A 2PTWA 2P8BA 4KPLA 3ZLGA 2AL1A 3I4KA 1XS2A 2POZA 3ENLA 1F9CA 1DTNA 5ENLA 1BKHA 5FJPA 3ZLHA 2XH2A 3IJIA 4DHGA 3THUA 2PP1A 1JPDX 3QKEA 3TOYA 2O56A 4Z17A 3S47A 3ZLFA 3JVAA 2I5QA 1L8PA 3UJ2A 2FKPA 3DGBA 3PWGA 4H2HA 4FP1A 4MKSA 2HXTA 2GSHA 2PTZA 1OEPA 1BQGA 3ES7A 2PTYA 3ES8A 2OLAA 3V4BA 2PS2A 3UCDA 1WUFA 2QJJA 3VC6A 4GMEA 4GGHA 5BOFA 3EKGA 1PDZA 3SBFA 3NO1A 3SQSA 4G8TA 3CYJA 2RDXA 2XSXA 4HN8A 4EWJA 2PGWA
chains in the Genus database with same CATH superfamily
4JEQA 1GEQA 1K7EA 3GG1A 1Q45A 3I6EA 5DT7A 2YBTA 4Y8FA 1Q2SA 3AYVA 3WJZA 3GFZA 3VOJA 1W5OA 1J0ZA 4JTEA 3CV6A 4H4SA 3ELFA 4BK9A 1AD4A 4ERIA 2AQWA 3WYZA 3MTWA 3TWBA 1C90A 3AUOA 3DUGA 1B4KA 4JTKA 4J4KA 1K3UA 4GY7A 1NH6A 2DV0A 1TKKA 2ZICA 1XLIA 1ZAJA 4UCGA 3GH4A 2QGYA 2FB3A 3S8HA 1LBLA 3DYPA 2PRHA 2R94A 3KRBA 3B9AA 5DXYA 3ONCA 4DUOA 2PRMA 3ARYA 4LOCA 2MUCA 1K02A 5AKQA 2CLFA 1UZ4A 1ADDA 3GDMA 3VIHA 3B0VC 5C7VA 3NEVA 3WH6A 2ZUSA 1LWHA 3W1AA 3M41A 3INPA 3S0CA 1YDNA 1Q4WA 5F2MA 3P62A 1T99A 2ON3A 3VUPA 2XN1A 1MOKA 1KRCC 1VR6A 4Y9MA 4PE8A 1E43A 4EM4A 3CWNA 4PRWA 1UPMB 2P8CA 3C0SA 4W5ZA 3L9CA 2B4GA 4QDWA 1XH2A 4V28A 4ZBCA 1AQMA 3AS0A 2RFGA 2VX4A 2NX1A 4BKNA 2WOIA 2QPSA 4YU1A 4H4TA 2J74A 2GRTA 2GR0A 4WJ8A 5M3WA 3EEZA 3DZ1A 3WBAA 2BCPA 3VA8A 2F6UA 4XD3A 1MUWA 5DRIA 1R47A 3W0KA 5K7JA 4PA8A 3RGTA 2XIBA 4R34A 1EDQA 3O9NA 4LEQA 3K5XA 3EX1A 3V36A 2ZRVA 1V3JA 4OWGA 3CAQA 4BV6A 1LOQA 5LNRA 4QM1A 2P53A 3GY1A 4C1KA 4ZTYA 3QJAA 1N8WA 4ZE4A 2IQTA 2PDNA 5FCZA 4P7RA 1P6BA 3RM4A 1M6IA 1JFHA 1LDCA 3WL0A 1V08A 3UVIA 3QHNA 4FR6A 3SCVA 1TG7A 3R6IA 5M03A 1ISXA 3HTWA 3B8VA 1TPWA 5D2TA 3WJXA 3WD1A 1P7TA 3TTOA 1QOQA 2GJRA 2CNCA 1G7UA 4YTQA 3IVTA 3SQLA 1GQLA 4O8RA 1H7PA 3W1PA 3RX2A 1F6KA 2X1RA 3NIYA 3R89A 2WJZA 1LQAA 1O1ZA 5A6SA 2VTFA 4Q4SA 5GNYA 5FSEC 2CPUA 1XD1A 3Q6JA 4D6JA 3R13A 3SEPA 5C2GA 4ZL1A 4A2SA 4B92A 4KGLA 3M0HA 4H9XA 3UPWA 3TAOA 3EX4A 1GQKA 3G8RA 1QWGA 1XF0A 2E1WA 4RV3A 3M4HA 3F2CA 4E38A 3UXLA 4PB3A 3D0CA 4M56A 3HQOA 1W3JA 2A3LA 4DI8A 3G1DA 3W2LA 1NDAA 3VABA 2DUAA 2DQWA 2C16A 5HPCA 1YNPA 5H8UA 2BS9A 1NQ6A 1GOIA 4AD1A 2INZA 1RJPA 2J7CA 2QAEA 2FB2A 2AKZA 3AYTA 2PDYA 1XC6A 5A6TC 1VLIA 3LN3A 3GNOA 2YGYA 1TVNA 3N2MA 1CX9A 2BP1A 4RE2A 2W3RA 3CUXA 3PK7A 2PDWA 4M7TA 4DBDA 4KEZA 4XVDA 1V6YA 3XIMA 5D8WA 5ECVA 4ATLA 3GTFA 4IISA 1IR1A 1B54A 5EL1A 3BSMA 4YXGA 1B3VA 3UXKA 2BY3A 4YTRA 4XAZA 5AN7A 1AFSA 3KDNA 3QVQA 4FPSA 3RPTA 1X96A 2H90A 3SADA 3KCJA 1UR9A 2GLKA 5J5RA 1RV8A 1M1BA 3VD9A 2PDKA 4UTJA 2YA1A 5G2HA 3WLSA 4QQUA 1KM5A 4W87A 1UZ1A 3IUIA 1U83A 2GFTA 1OG0A 1VFTA 2BSLA 4NI3A 5CC7A 4QRNA 1IGSA 1H2JA 3F1QA 3E9AA 1XIMA 1VH7A 1PX8A 1GZJA 3R0UA 4P7NA 2ZUNA 4Z0JA 4DYKA 3LY0A 1UG6A 1R8LA 3R12A 3QR0A 4HU0A 3TYBA 3KL5A 2PGRA 4I7UA 1A50A 5CSRA 1KV8A 2C79A 2IKJA 3FY1A 3KZSA 2X0SA 5HQLA 1GSNA 1J4EA 1DE5A 1XS2A 2J78A 1DTNA 1YMYA 3SJ3A 5LKYA 3ZLHA 4W4QA 4QXIA 4XIAA 1FRBA 3UBPC 1XBXA 3RNDA 3ANUA 3L4YA 4GXMA 4AVNA 2VNCA 4LW7A 1JNDA 2ZRUA 2V3EA 2DP3A 4P61A 3ITLA 4FP1A 1X6NA 2Y4SA 2Y7DA 1TTIA 1UCWA 4FZIA 4MUZA 2VEMA 4XD6A 2OLAA 3IS4A 1N5WC 2QJJA 4NNCA 3RDKA 5EMKA 4ACZB 5EPDA 2RUSA 4WGHA 5HQMA 5H91A 4M1BA 3T44A 3CQKA 3APTA 3MSDA 5CGTA 1T96A 1OD0A 1RPXA 1LT8A 2CLIA 3KBMA 1XRVA 3DG7A 4O11A 2J7FA 4XZWA 1SO3A 5TF0A 1RBOB 4LF1A 3HV8A 3G3DA 5D9MA 4QDMA 2I5GA 4Y2WA 4Y9AA 3SUSA 2PWGA 5FI8A 2HDJA 1PYMA 4WR3A 1KB3A 1FCBA 5T8GA 2G95A 2J3NA 2VWTA 6CGTA 5PTDA 2BG5A 4TVUA 2DH3A 3MVTA 4Q8OA 3EBVA 3SUTA 3UEQA 3W7OA 4BWLA 2Z26A 3CJPA 2XG9A 4LC6A 1ITQA 3VMOA 3HA1A 4LPCA 2ACSA 1EEXA 1JI1A 4HQVA 1LYXA 3TMQA 1P1XA 3OO2A 3U7VA 4WSKA 1FA2A 2Q71A 1UH2A 3IAQA 4DB7A 5A3HA 2O9OA 1HFBA 1NWUA 3EMCA 3BQ6A 2HCVA 4K8DA 4JN7A 3I6TA 5CG0A 4N9CA 5LIYX 1JI2A 1T3QC 4ADSA 4CNPA 1ICPA 4GPNA 4HU3A 5JIPA 7TAAA 3PP7A 2VCAA 4QE5A 1NP2A 3LB0A 2ZADA 1NFPA 4S3GA 2B81A 2YR1A 1ZP4A 1YDOA 1M7JA 1UWUA 5A6BA 1Z48A 2A6LA 1AD1A 4DZ5A 3CK5A 4B5VA 3N25A 1U5JA 3DFHA 4ATWA 1VCGA 4B9ZA 4Q22A 1OFEA 4RZ4A 1GRAA 2AGTA 3RM8A 3DEQA 2XZ7A 1EOMA 1V3MA 3ITXA 3LPPA 1TYGA 2QJHA 4DJEA 1UQZA 3RLGA 5KITA 1UH3A 4XD4A 1P0KA 3W37A 3O16A 4GVGA 3W1XA 4BR1A 4MUPA 5I06A 2DY3A 4HCLA 3RRXA 3FA5A 1XRFA 4CKQA 3FX4A 4XSLA 3G0UA 1OFRA 2WNNA 2PDXA 1SW0A 3EEGA 3EWCA 1JCNA 4FX8A 3PJTA 3DHDA 1W1PA 5JQ9A 3C0LA 2WPCA 2OQLA 4Q6XA 4FALA 5CSSA 1GOOA 4B3KA 3QEZA 7REQA 4PMVA 3ZT5A 3W71A 4BHYA 3GU9A 4B5XA 1F8IA 2QDGA 1IXOA 4B16A 1J5TA 3WD3A 1REQB 3I3BA 2QZRA 3VDBA 2GGJA 4NZ5A 3FXYA 1ECQA 1W9XA 3O6YX 4J40A 3D6NA 3DFTA 1SW7A 1LRQA 2Q8LA 4K1GA 1KFBA 1E1CB 4IP4A 4A21A 1VBGA 2JEQA 1CCWB 4REQB 2HPIA 1MDRA 1R2SA 4Q4MA 1W9UA 5TAOA 1TPDA 1AW5A 3QR1A 4D9PA 5BU9A 5L9FA 4F0KA 1FHUA 2B0MA 5CXPA 1DE6A 2VEPA 3ARTA 3S5ZA 3EWBX 2QVHA 2WJFA 3H22A 2KAUC 4LVFA 5BW6A 4LAMA 4Y9PA 1M01A 1Z41A 2OXNA 4KBXA 3VIFA 1F4HA 1ZJIA 4HOWA 4PULA 5EU9A 4LTSA 3TYZA 4XZLX 4XKMA 4MHBA 3HU7A 5RUBA 4H7ZA 4JTQA 5JCNA 1H41A 1S7MA 3UJFA 4J3XA 4MLJA 3GG0A 4D6DA 3RRAA 1Q6EA 2DORA 3MO4A 3B9NA 2ZZ0A 1OBAA 3GKFA 5IOBA 3I3EA 3R07C 1EC7A 4HU4A 5EBUA 3KRSA 1QI4A 5HDRA 3WQPA 2R24A 3PF3A 1G7VA 4NU7A 3SR6B 1QI0A 3O05A 3BO9A 5AYXA 2A3AA 4ZQMA 2HEJA 3VZXA 2CLMA 2WZHA 1P1MA 3C8NA 3IJ6A 3D3FA 1XDLA 5CJNA 1EP2A 4KWSA 1W1ZA 2ZA1A 3ARXA 1IHIA 4QBXA 4NAFA 4PGLA 4M6VA 3UZWA 4H4RA 1KCZA 5EMYA 4O14A 2YDQA 2CHRA 1H6VA 4ZOBA 2V0TA 1GREA 1DWJM 1SMAA 3CH9A 4DWSA 1LRTA 4KFNA 2TAAA 3CUIA 2YCEA 3BLEA 2OZTA 2C0AA 1BAGA 3CASA 3PBGA 2PWEA 4D71A 1HXJA 2PODA 1FXPA 2PTXA 1WDWA 2BASA 3STCA 1PB0A 3C61A 2VWSA 2YJQA 4PMJA 5E6ZA 5JUVA 3UR2A 3DYMA 4PYSA 1AH4A 4INFA 3N2CA 3TR2A 4I5UA 2WC7A 3SRKA 3WLJA 1BKHA 3M07A 3B9DA 5ECUA 3FGCB 1PCKA 4BI5A 2WJDA 4DJDC 4FLOA 2FLIA 4GJJA 3W7NA 1BRLA 3AIQA 4HOXA 1A5BA 2GJXA 3A7AA 3SCSA 2JF7A 3O0FA 2A3EA 4CU7A 3ZLFA 4GJIA 3ZZ1A 4TVDA 3BAJA 5FAJA 1O68A 1V3LA 3VD7A 2ZX8A 3QRHA 2NT1A 4NYUA 2RHGA 1KM0A 2VM8A 2Y1HA 1ZX9A 1FWAC 2VOMA 3MT1A 4UOZA 1ZTVA 3LADA 1GGOA 1PTGA 5BOFA 1V6WA 4FNUA 1KO0A 5LGXA 1XGEA 3CYJA 3KLKA 4Q8PA 3NPVA 8XIMA 4GY1A 4JCMA 3P80A 2DT2A 1G0CA 3EWWA 1O12A 4K7VA 3VVGA 4GI6A 2EJAA 4KESA 1W17A 2Q3OA 1T0OA 3VC5A 4ZB5A 1ZY8A 3K2GA 2EPNA 4LUSB 1GONA 3DKLA 4NJJA 4X9YA 1FWSA 3GNDA 4IOTA 4L6HA 3C2FA 2VRQA 2BVYA 4AEEA 1A47A 5ABGA 3CLWA 1GOMA 5FACA 1YW1A 2DSUA 1B31A 3TSBA 4EK7A 3EF6A 1PZ3A 1QNSA 3WBXA 2A7RA 3NEHA 2EBNA 1VFMA 3BQ5A 4MVAA 1NOFA 2FVKA 1UBPC 2HNHA 3AMCA 3CV2A 1WOAA 1OZMA 4LYPA 1KKOA 3M16A 3GVVA 2V6OA 1GQNA 1KCKA 4L7ZA 4LS1A 5I3FA 3CUJA 1UWSA 1H1YA 1YHTA 1GCYA 4R88A 5K9CA 3PG9A 1PS9A 2ZVRA 1ICQA 1ZK7A 2PDGA 3KWXA 2XVKA 2ZCGA 2J9ZA 4L1XA 1B90A 3O3RA 3GX9A 3AMLA 4GYKA 5I23A 4FXFA 3NVYB 3KBNA 4GO8A 4H3DA 3H21A 3SCNA 3LLXA 3R0DA 4I8DA 5EMLA 3UY8A 3WQCA 2WOWA 1M9HA 3DI0A 4X2PA 1OK6A 5LXEA 4K37A 4B5TA 3QOMA 4JFVA 2PURA 2EQ7A 5CJ5A 4JIIX 4D6IA 5E70A 3HF3A 5HNRA 2ZUMA 5E0CA 2PA6A 1UKOA 3A4AA 2UBPC 3K1DA 1QNVA 1M53A 2VEKA 2HV5A 4CD8A 3BOFA 4WDTA 1MUCA 1JPMA 3RG6A 1BZLA 2DIJA 3TONA 5JCKA 1V4YA 5TQLA 4WX2A 1EDTA 5CLTA 3AM9A 5AB3A 2TPSA 3CGCA 5BRPA 5D9PA 2YDRA 1B9BA 3AHVA 4NUWA 1NU5A 3NQCA 4GUJA 1TQJA 4LY4A 1TUFA 4IGHA 1UD4A 4JDYA 1JR1A 1V51A 1KM3A 5CAKA 3C56A 5K4ZA 1KBKA 4GFIA 4TTUA 4E6MA 2ABBA 3R79A 1JEHA 1EOKA 2JE8A 2RJHA 1MEWA 2P88A 2V5JA 4I5XA 2QYGA 2QJIA 2BGQA 4OE7A 3ME3A 3NQEA 3IJ7A 4I9TA 2D69A 1XLFA 4Q8UA 5K9XA 4AMCA 1W3TA 5I6SA 3ETRB 2NQLA 1OIMA 3PZOA 1WE5A 4C6NA 2GGGA 2BZNA 1BQCA 3WG6A 3W28A 4M51A 3O6DA 2VO5A 4TV5A 1UP0A 2BDQA 1CECA 1J0IA 3GNRA 2VMFA 4E4PA 1W37A 1A5NC 1JCJA 1BD0A 4WY0B 5HQEA 3PANA 3S5YA 4PB5A 5K4XA 1PVNA 2NPXA 4WKAA 3VI2A 5DCDA 3TLLA 2J7DA 3W29A 2D0GA 3A3HA 5TD4A 2OG9A 4Z2HA 2PU0A 4I9AA 3RFAA 3RMEA 5CGQA 3NRZB 5BOOA 3CPGA 1RJRA 4P7LA 3C2OA 3WD0A 1WPCA 4L6DA 4A05A 2OKOA 1G94A 5IM51 3OG3A 1KQZA 2ZXAA 3NR0A 2XYLA 2HRWA 3OP2A 3DH7A 2DSZA 4DNMA 3OLEA 4Q4PA 3RMJA 4WKHA 1EDGA 2CW6A 3W7EA 1EC9A 1UD6A 3BG9A 1ZMDA 4M81A 4K8HA 4W9TA 4KT2A 3GG7A 4CN1A 4X9SA 1XRTA 1A5OC 1KFKA 2WVTA 3MDWA 4UNKA 4Q8TA 4D72A 4LVAA 3M7SA 4MSSA 3PUEA 4N6FA 3UWWA 3T05A 5LNVA 2ZA2A 4QHRA 4HP5A 3AYSA 3S2JA 4FI4A 5BROA 3VIIA 5IHSA 1WDPA 2H9AA 1JAEA 1VFUA 4C6DA 3PJUA 4TQTA 4WIWA 3LXBA 4WVXA 3QLDA 3MA8A 2W9MA 3W7MA 2W55A 3EPOA 4JICA 1TB3A 4CLMA 4QCEA 5E09A 3W27A 1YQ2A 1M7PA 1A4LA 2WMKA 5G2IA 4JNMA 4F66A 5MHBA 2V2CA 1H5YA 3C0JA 2UY2A 1WDDA 3H2AA 5IDIA 3STPA 1TJRA 2CKSA 4EPEC 3SUVA 3W4RA 4KPLA 2WM0A 1V59A 1OC6A 1YBQB 3OVRA 1AJ0A 7TIMA 4IIGA 1OQFA 1J6OA 3AHZA 1R86A 1K70A 3H26A 3EB4A 4OOUA 4ADWA 4LIIA 5FJIA 1LORA 2FQIA 4S38A 2CLLA 1CXHA 2W63A 1VCVA 3S47A 3W85A 4F2TA 3TZFA 4G2DA 1MQQA 3I3DA 1EIBA 2CU0A 4TUFA 4NVTA 3PWGA 3UW6A 2GZXA 1GXFA 2XIQA 3EX2A 1SB3B 1J8VA 1ICSA 3GHUA 2PWUA 4PMQA 3ES7A 4L80A 3DHPA 3H2MA 2RAGA 1AMYA 3CWOX 3M0XA 2X16A 3KX6A 4F48A 3W24A 2X99A 2E09A 3VKAA 2VQUA 4HNVA 4AAJA 4OT7A 5CH9A 2RJGA 3N3TA 4US6A 2XIMA 3SQSA 2NSOA 3E0FA 1D7YA 1A80A 3A24A 3WF0A 1JZ3A 1Q6LA 4DQWA 1L2UA 1H60A 3FFSA 4LFYA 1LL6A 3DHFA 2VZOA 4XX6A 1KLZA 5F2LA 4TO8A 1PYFA 2OGYA 4ZODA 4QGCA 1H50A 1XYZA 1E9ZB 3NOYA 3Q94A 2RGLA 1J9YA 2ZBTA 4XQ6A 5KTLA 2Z28A 3HBLA 1NDZA 4A2RA 4XUGA 5LA1A 4K68A 4KRUA 1E0UA 3WNNA 2B7PA 4GIRA 4JL2A 3B0XA 5HMEA 1QK0A 1EZWA 1DIKA 1QXLA 3ITTA 1P43A 1ZBWA 4KWVA 1P4CA 4MJ2A 3CZKA 4AX7A 2FMNA 4R7OA 3KTCA 2FH8A 3CIXA 4NJGA 2CFFA 5CPMA 3MMWA 4MIMA 4GUIA 1M7XA 3C86A 4O0ZA 3EWZA 1QAPA 5HNNA 4TX6A 1N62C 1HP4A 1LUCB 1MFVA 2NV9A 1EBGA 4HOZA 3VTRA 1GYNA 2CBUA 3S6TA 3JUGA 1VJZA 3MANA 4E4FA 1FWNA 2WB5A 2X05A 1WNOA 1KCXA 4ORMA 5I2UA 5I3JA 1VDVA 5CC3A 4EQXA 1XIEA 4QROA 1QDSA 3FDKA 3F2DA 4A6GA 1G4PA 3G18A 1RUSA 4J3SA 5LIXX 1JRBA 3EZ4A 4TMCA 4JFTA 1UB3A 2DVUA 3GRIA 3K4DA 2XDFA 1E0TA 1IR2A 2WCGA 4ZOEA 2GR3A 1UR3M 4JN8A 1B9ZA 1A5UA 4C1NB 1FHVA 2GH5A 4CVWA 1POKA 4QS5A 3BC9A 2YX0A 1L2QA 3DJJA 1CZ1A 3JW7A 1F8WA 1IZKA 2F61A 2WZMA 1DIEA 3W00A 2V2HA 2Y0FA 4NQ1A 1W0MA 2OKTA 3PG6A 3RJYA 1JAKA 4HYRA 4GGBA 4J2PA 5FJUA 1HG3A 2QCMA 2PMQA 4U10A 1WDSA 5DEZA 2FJKA 2WQDA 4JD4A 4QAIA 1UC5A 1LBFA 2XVPA 1RK6A 3M5ZA 3JS3A 3B8IA 1SO6A 3LUTA 5DCEA 3E5BA 2DSVA 3P0WA 5FKYA 4MWAB 3MHGA 1XP3A 3DFSA 4UNIA 3UR5A 4IG2A 4ZB0A 1W91A 3QPYA 4RE0A 2HJPA 4LQ1A 1A5KC 1UA3A 2WVUA 4QJ3B 4XB3A 3VO0A 5D05A 3TEVA 2F8QA 5HMFA 4B5NA 4EXAA 3V35A 1EGMA 4XK2A 2AMXA 3B8SA 3F4CA 5D2VA 3GIQA 4IGSA 2UY3A 1FWRA 1RD5A 5DY2A 1MMFA 5GNZA 1U1HA 3ECQA 1RHCA 2Y88A 4JL1A 2OT0A 4Z1YA 2CZEA 5D30A 1S3TC 3WQDA 1RA5A 1YTEA 1R46A 4JTDA 3TC6A 1J96A 4HJFA 3RF9A 5KSWA 1SO5A 5AC6A 3WQFA 2AAQA 3KAOA 2VXNA 4H19A 1GESA 5G1MA 1XISA 3B05A 1WO2A 1QI5A 3BL3A 3UFYA 4MWAD 2VFDA 3W7DA 4H9VA 4Q8NA 4QE1A 4B5WA 4AZIA 4IUOA 4EAMA 3O07A 3GVGA 4Z0SA 2V82A 3NL5A 1YEYA 3WNLA 1FWHC 3TYCA 1KA9F 5DANA 4HPXA 3RIKA 2HNEA 2MANA 1JF6A 4O16A 4OHQA 4JTSA 3PFMA 1KFCA 1DTUA 1LJYA 3EPNA 4QG6A 2ZXDA 4PL2A 5DXXA 4KS0A 1W1YA 3K8KA 1ZBCA 2J75A 3TK7A 2WWDA 3EDJA 4BA0A 3DKJA 2ZC1A 3H70A 2DW7A 3UU0A 1VBHA 2GVJA 1V02E 4IT1A 4NILA 2WP6A 1N82A 2INFA 1E9LA 4H83A 1W1VA 3UXAA 1NF7A 2AQVA 4NXSA 4UFKA 3MBDA 2WNWA 3F5KA 3A22A 4AD2A 3NZPA 3PZVA 3GH5A 1C9WA 1AVAA 1BYAA 3LBOA 4AIUA 1GW9A 5C6MA 2P8BA 1VPQA 4XO7A 1ZAIA 3FHAA 1JUKA 3J7HA 4X22A 1WBHA 4YL2A 1BYCA 4AHOA 1AQHA 3OODA 5D2WA 3GC5A 3NXFA 4EM3A 2J77A 4ASTA 3NYDA 1IEIA 4CEXC 4O13A 4PUNA 4PZVA 2J7EA 4YVXA 2VFGA 4PMYA 4MNMA 4K8EA 4EF9A 4M29A 4AY8A 5AHNA 3SECA 1GOXA 3OLIA 3FOKA 2IPFA 2PTZA 4NYYA 4HD5A 3CIVA 4ZENA 1X6UA 5ABHA 2CLOA 1JFXA 4WOZA 1LQ0A 4AXNA 4GMEA 1OFPA 3THAA 3II4A 1W1TA 3SBFA 3NO1A 1DP0A 1CLKA 3BAWA 3L4VA 3UZXA 5HATA 2XSXA 5BZAA 4L9YA 3B0PA 1U1UA 3S9YA 2A8XA 1LBMA 3VOFA 3IK2A 2QKFA 4H6QA 1I2PA 4P5UA 4U3AA 4UMCA 4PBEA 1WDRA 1XIFA 1BYBA 2V30A 4UQEA 4ZXOA 3BTNA 1MZRA 1W31A 4ZOAA 2DPEA 3CB8A 3TVAA 3CV1A 1DWHM 3APGA 3PC0A 5LYRA 1SZNA 1PZ2A 4IPIA 4W8BA 4F2BA 1AMKA 1BVZA 5AVHA 3VIOA 4CCDA 4B3ZA 4NNBA 5F1UA 3ARZA 2EO7A 2BV9A 5FAGA 5REQB 2DZXA 4OJYA 2FIQA 4WLCA 1UJQA 1A4MA 5C8BB 5MKGA 4XZ9A 3LSBA 1CIUA 1H5VA 1QW9A 1Q3NA 3FSUA 4DZHA 4JY9A 4IMAA 4S3FA 1BWCA 1UBSA 1E3XA 2VX7A 2DVTA 1X2HA 5CPTA 4O1DA 1L6GA 1S5NA 1MRAA 4M24A 3FDGA 4B4FA 2A3CA 4MDPA 1VZWA 4US5D 4YLWA 3RCYA 4RZBA 2E0PA 1JYWA 2VDHA 1EC8A 4DXKA 3I6RA 1JEZA 1OCJA 1TTPA 1MYRA 3FAXA 3BVJA 3PBYA 2IKIA 3C3UA 4LY8A 1PV8A 4E3TA 1GOWA 1OGGA 4NZ4A 2E25A 3W73A 4I7VA 2B7OA 3WQWA 3LCFA 2J88A 1B57A 4X63A 3QF0A 3ZWSA 5EY5A 3KBWA 4CN6A 2YVGA 3L0KA 2JKAA 1X1NA 3TKFA 1K03A 4LVGA 1YTDA 5A8PA 1CXLA 4GI9A 1RQHA 3IIXA 1VAHA 5U1OA 4JY8A 5IFPA 1MXDA 3QQ0A 1DXFA 4NJKA 4DM2A 5FJOA 4HK7A 2NVKX 3DH9A 4FNTA 2H3DA 4K6AA 4JIRA 3KOWA 4JOMA 3VD5A 3BV7A 1FFUC 1O7AA 1PL9A 5HK4A 2C1GA 3FJNA 1FWEC 3ORWA 5HPOA 5CBBA 3VD4A 3WDQA 3VM7A 3GWQA 2QEZA 4W8LA 3KVKA 3W25A 4Q4KA 5CZTA 3WEOA 3KP0A 4OV4A 1GRHA 3MJYA 3C0QA 1C93A 3N2BA 3WMCA 4MWAE 2O4QA 3CQJA 1Q8JA 1DQXA 3PTQA 1YLVA 2ZUVA 3BAKA 1RZMA 2KZHA 1QTWA 4MADA 4RL3A 1FQ0A 3IVSA 4J3VA 1KXTA 4H4QA 3FYPA 4P7QA 3ANVA 3BV4A 3MUIA 5HAOA 3N14A 4GCAA 4IJBA 1HJSA 2QAPA 5E0FA 2QCGA 2XM1A 3QY6A 3IUHA 1ME8A 4MNLA 1FCQA 3VOHA 3LQLA 3H4GA 4GUFA 3UWVA 2GQAA 2V38A 2J9XA 1J11A 3MY9A 1RBAA 4OBRA 4DWDA 2CC0A 3RN6A 3RAOA 3LLFA 3CBWA 3WLTA 5D09A 3UD6A 1MXGA 3FA4A 4HU8A 4IFKA 4YHEA 1A49A 2PDIA 1EP1A 1UWTA 2C1HA 2W6RA 1ZCCA 3UG8A 5EYWA 1S39A 4HT3A 1XSKA 4Q8WA 4XVEA 4CQ8A 4NAEA 4ZCWA 1RH9A 1S2UA 4C60A 3EA1A 3QR3A 3O2LA 1XDIA 3LM3A 3NG3A 2FPYA 1E6XM 3TCEA 3NO3A 4H4VA 1ZB5A 5A8GA 2Q01A 4X60A 1KFEA 4RLIA 2JALA 2I5IA 3JZEA 4O8AA 1BXNA 2MNRA 3E3HA 4H6EA 4NRRA 4H6RA 4S39A 4PCSA 2SFPA 1F73A 1NDVA 3IWPA 4GC3A 3NQ2A 2WBKA 3N34A 4UFIA 3MWAA 4GUHA 2Z2AA 1XLAA 1QPNA 4QSHA 1GORA 3LV5A 3LSCA 3S5NA 3BSHA 5KVHA 3GTHA 3V0UA 5C2CA 3M5VA 5I0DA 4H8VA 1O6IA 1S2CA 5AYBA 2CETA 4UMBA 1SSGA 4Q3MA 4LUJA 3SFWA 1XX1A 2OR2A 4UTWA 4NHVA 2XFYA 1KRBC 3ANYA 2CCRA 2DUZA 3NQAA 3QXBA 1UYQA 2WNZA 3D3AA 1TV3A 4Q4RA 1XICA 3DG6A 3O0KA 1QPOA 4IFRA 3QKZA 3H7RA 3PPCA 2YSWA 1PEZA 3GTXA 1LP6A 1VC4A 4PCPA 2R14A 1B3ZA 1XIJA 4AU0A 3BG5A 3GNPA 3SGUA 4N9DA 3Q65A 2PAJA 1DVJA 2J25A 4H2CA 1HKMA 2UZ9A 2YVFA 1SMDA 3WDRA 1RD6A 5I77A 3U3HA 5H1WA 1WXJA 1TRIA 1R7AA 2C6QA 1UR1A 4DBSA 1K4GA 3WK1A 3CEPA 1HNYA 1UIOA 3UZJA 2VI0A 3OIHA 1SYTA 3ABSA 6XIMA 4O17A 4LH8A 3BG3A 2VX5A 5HOSA 2DT3A 1HJVA 3JRKA 3MMDA 1JRCA 1DJNA 4NF7A 3NSXA 1KGWA 1ZS2A 4MM1A 2ALDA 1XXXA 2C3DA 3NQBA 4S3AA 1QMLA 4UOQA 2PDPA 3GQYA 2NQHA 5M1TA 5CQ1A 1XLEA 2E5AA 1SZRA 4J28A 4A3QA 5I3DA 3DFQA 3AXXA 2EPLX 3GXTA 1FWIC 3VILA 2OTDA 4XWUA 5DN1A 1FBAA 4D2JA 4QQ3A 3VKBA 1PZ1A 1JOAA 1VFFA 4J57A 1PIIA 3VKKA 4AY7A 4NZ1A 3K8LA 4WSJA 4EPDC 1JGIA 2R9ZA 3R10A 3FJLA 1GKQA 2X42A 1ZDLA 2X1SA 2PF8A 2DT1A 2PWDA 1I2NA 4URIA 3WLOA 1E6ZA 1WUEA 3UGRA 3GG8A 4EKJA 1E5NA 2ISDA 2FMOA 2VGFA 3PZMA 3ZJ8A 4M6UA 5M17A 1E5JA 1W9DM 5AOUA 3THDA 4UIOA 2GUUA 3UZ5A 3QMTA 3TQKA 3LMZA 1UMYA 1RY8A 3DK9A 1J5SA 4ZQPA 2GDQA 1S1PA 5FEWA 1DKWA 1EA9C 5DBTA 1FWWA 3R8RA 3HPXA 5ABFB 4GISA 4DJFD 5FS6A 1TREA 4PMRA 5KMYA 4XAFA 5D02A 1MNSA 2PDMA 1EIXA 5A2AA 2P76A 4FHAA 3QFWA 1NEYA 1NVMA 3HV9A 4MDOA 4E8GA 2FZ9A 3KFTA 3K46A 5XIAA 2XH0A 2AAMA 2HVNA 1XQLA 3ALFA 3WNKA 1GVYA 3NL3A 3GK0A 2A2IA 1H3GA 2WQPA 3NL6A 3QTGA 4Q4QA 1E55A 4L1GA 2I9EA 3E5PA 2R91A 3GDRA 3REQA 1WAWA 1KGUA 1XCWA 4UR7A 2ZUUA 3CWHA 2YB4A 1VKFA 4S3JA 3WENA 2AQOA 2VD9A 5BXTA 2GOKA 1OCBA 1N8IA 4FX6M 4JTRA 3GDTA 3KBVA 4LEFA 2CBIA 4S3CA 3PBWA 5HXMA 3P74A 2C7FA 3AIUA 3ZYZA 3NM1A 3BCFA 1SJBA 4X2RA 3TFXA 5CZ0A 1VJIA 2CWXA 2CDUA 3MMUA 3E2VA 2REQB 1D2KA 3FCPA 4KWUA 1LQ2A 1ODZA 3W7GA 1EWEA 2GL5A 1QWKA 2Y70A 4NSBA 3PTKA 3HQ1A 3QN3A 2YKKA 3KTXA 4C6OA 1VEOA 1H7OA 5BXRA 2JK6A 5B7ZA 4WDXA 1F5ZA 6PTDA 2CBJA 3VNZA 3ZQ9A 2FZ8A 1JZ6A 1UD5A 4DAIA 3LQGA 3NQGA 3AIBA 2HISA 3P61A 3GXFA 1HT6A 3E38A 1TZ7A 3VFCA 1VFOA 2Y2WA 5D2YA 3BH4A 4XV0A 1C8VA 1QHZA 4AW7A 1FP9A 2XGBA 1ZAHA 2JIWA 4JQ9A 3QQWA 2F7FA 1GRFA 1V0KA 5LIKX 4AWUA 1Z8AA 3GBDA 1BFNA 2QCDA 1QPQA 1FUYA 1XFCA 4GH1A 3TCSA 5J04A 3NM3A 4L65A 3IACA 3L12A 3S9ZA 1IEQA 4PTXA 2PDBA 2CKRA 2FFCA 4Q8MA 3T4WA 1HKJA 4EOUA 3H2EA 1UIPA 4PUEA 1BLIA 2GSEA 2Q3RA 1YTKA 1OC5A 3CZLA 1RVKA 3OB8A 4EXQA 1KTBA 3VNJA 3NQVA 4PTVA 3GDKA 1SO4A 3VU2A 2ACRA 5U25A 2V5DA 2R1NA 1I6NA 1N7KA 1FXQA 3DX5A 4IM4A 1W9BM 5U7SA 3VIPA 1SJDA 2DUXA 4RK8A 4LAKA 1N60C 1U22A 3UR8A 3GHRA 4YCPA 2GJNA 3ZVHA 3Q67A 4UTHA 1OD8A 4FOJA 4QNWA 2PD5A 2WKJA 1OX6A 2GVGA 2ISSA 5HMSA 1XLBA 4HSHA 5I7GA 2QULA 2HROA 2ANUA 1V5XA 4PTDA 1AA1B 3G1AA 2WPGA 4HB7A 2A4AA 1XHCA 3CGDA 4YTTA 1TYTA 4XSMA 4BF5A 5CPLA 4LRTA 4N6EA 3P6LA 1KC7A 3TTQA 2E4TA 3PUGA 1GPFA 3B8UA 4F4RA 2F2KA 4RDYA 2Z6JA 1PKMA 3W7LA 3P60A 3KZPA 1DORA 1CB2A 1VYSX 1FIQB 5G1YA 2V68A 5KZEA 1XIGA 4PCFA 3N17A 3U4AA 4LVDA 5A8MA 2D1ZA 1VRDA 1J12A 4AZCB 2VFEA 3T09A 2BOFX 3AIVA 4XBSA 3U2ZA 3F7JA 1C29A 2C18A 3SSZA 2ZYFA 1R85A 4C1LA 3ZSSA 1QI3A 3WF4A 4O53A 1H0IA 4JQ4A 1UH4A 4PCTA 1TMLA 1OABA 3BPWA 2AL1A 1Q66A 2G4FA 4F40A 3A23A 4O1BA 4IH3A 2WVVA 3EKLA 1G67A 5FJPA 3G1FA 4H4ZA 1HJUA 2J7BA 2C8NA 3KVMA 1H11A 1AQFA 3UERA 3CT7A 2CZ5A 3TIMA 3BW3A 2W92A 4DO5A 1IEXA 1KXHA 5JVLA 3GXDA 3PR2A 5J8LA 3M1ZA 2YLLA 3BMWA 2D3NA 4EIVA 3NPWA 4AYGA 2QIWA 3AFBA 3HFTA 4AVFA 5D8ZA 2I57A 4BF9A 4MF4A 5EMMA 1RVGA 4DBUA 4E0CA 5CSUA 4V33A 2PTYA 3ES8A 3RPDA 5HJXA 4JIEA 3ALGA 3EDEA 4GGHA 2YL6A 3E0LA 1TR9A 2R1KA 1VB9A 2FTPA 3L0GA 2RDXA 4U4MA 1G6CA 3QFAA 1NJJA 2ZDRA 4YTSA 2FPTA 3MKKA 4MJ4A 4RNFA 1MXSA 2GUYA 2QUVA 1DJQA 5CCZA 5FF4A 2X41A 1RJQA 3ABXA 1ISZA 3PZGA 4U33A 5LIWX 1NARA 4UQAA 1BG9A 3ARPA 1C8QA 5HUOA 3TA9A 4UTTA 4H8HA 4JQ3A 4PUDA 4TOQA 4LANA 2YXXA 2BX7A 2D2OA 2PB1A 2WM1A 5F7UA 1TWDA 3L23A 4I6VA 2YL8A 2VQTA 3W07A 3WUFA 4IMGA 4LC8A 4XISA 3ITGA 4O18A 3T2OA 1GUVA 1TZZA 2NWRA 4OBSA 4V15A 3SQMA 3AQUA 3KCLA 2ISFA 4JHZA 5DQPA 1YX1A 4K3ZA 1U33A 3WN6A 1WZAA 1Q6GA 1NOUA 1CBGA 4RXGA 1AW2A 3S9IA 5D4YA 3A4XA 4EE9A 4JDBA 1OYAA 3G8EA 3P14A 2OEJA 2NXHA 4UFJA 4I7WA 3G1XA 3TFCA 4B4HA 3UPBA 1Z69A 3L7RA 5I3IA 3TYDA 3PHAA 3ARWA 1YKWA 3HFYA 4UQCA 5HNUA 4PMNA 3BWWA 2OOGA 3GIPA 3L5LA 2CZDA 2EKCA 1DJHA 3AHYA 4G56A 3UWYA 4RUBA 4JIPA 4MWAA 4A8LA 4C6FA 4H4XA 1WKDA 2Z29A 1CT5A 1VHCA 4GIEA 2YFNA 4L56A 1KM1A 5C9ZA 2TSYA 3OPSA 1F07A 3MP5A 2PRLA 4JQ1A 1OG6A 3S83A 5KETA 3BLOA 4ZTXA 3A9BA 2E6AA 1FFVC 1TYPA 1B5TA 1EQPA 2BFGA 4D8LA 2QHAA 2IKGA 4KMQA 4X61A 2ZXBA 2IQDA 1SZFA 2ZZ7A 5IBXA 1NHQA 4HHLA 3QV7A 3LEPA 5FS9A 1EKOA 3TV8A 1MQPA 1UWIA 2YL5A 3RU8X 1KXQA 2PCEA 2DW6A 3LBMA 1KTCA 4PFMA 1W3IA 3H4XA 4GE8A 3TU9A 1QOXA 1TA3B 2FZDA 3CZJA 1IYXA 3W82A 4DPQA 3N13A 5CKSA 3VFLA 3QHMA 3VD3A 3OZYA 1SPQA 3R8GA 2VP8A 5E6YA 4Z2GA 1EL3A 4UWMA 2QLYA 1JDAA 2PSNA 1MUMA 4X0NA 2E9BA 4LX4A 4D8ZA 3R58A 1XD0A 3LGDA 3MZNA 3FJ4A 3DJGX 3VOGA 2YYUA 4AG0A 2G3FA 1R5YA 4GRSA 4NX5A 5JBDA 1UR0A 1RQEA 3A7RA 4K8GA 5G2WA 2A85A 3COTA 1TTJA 1XSIA 3GAYA 5AY7A 4CN4A 1AOGA 2ZUWA 5FL0A 4O4VA 2D24A 4GINA 4KPRA 4ENLA 2R8WA 3PAOA 2WZEA 1G9HA 1RLCL 3WQVA 4R7WA 2VEFA 5BRBA 4GFSA 4JTLA 5G1TA 4DJDD 4J27A 1A5CA 2VX6A 2VUYA 1CNVA 3T2QA 5JH2A 1GZGA 1UASA 5HA7A 3HPZA 2D3LA 4MJZA 4GX8A 1ME7A 1IXNA 1Y0EA 3CAVA 1DIOA 3LTSA 3TWAA 4B2DD 4DF0A 4UQDA 3EAOA 1K8CA 7ODCA 1QASA 5D2XA 1AQ0A 2YCJA 4RDZA 4RCXA 2P3ZA 2Y6ZA 4H9TA 1TUXA 3GW0A 3SJNA 4GIYA 4HNNA 4OGZA 3QYQA 3P5ZA 1YIXA 1JPIA 3AHXA 4O0KA 1OC7A 1J2WA 1EJTC 4YS1A 1HKVA 3MP3A 3WZ0E 2G96A 1I2QA 2W5FA 4FR1A 3T7VA 4KW2A 2ZVIA 3W7JA 4UTWC 4HPGA 3WLQA 4WZHA 3EPMA 1EEPA 4JZ5A 4G9PA 1K9TA 3FLUA 1UMLA 1AL8A 1TX2A 2VRKA 3OLGA 7A3HA 3SDOA 4YN5A 2ACUA 3AJ7A 1VFLA 2CLEA 1OFBA 1E6PA 4HTYA 4OTKA 2J24A 5BCAA 4S3EA 2WOQA 3VNIA 2WLZA 2ZWYA 4US5A 1JDEA 3NQ7A 2Z1SA 3S3GA 3CAKA 2RABA 3A13A 4ICCX 3RR1A 4L4PA 3G1HA 3H2NA 1V0NA 1DNCA 1HL2A 1BSLA 3KLLA 3TDFA 1Q1RA 1FY6A 4DRSA 4HK6A 1BGAA 1DHKA 4KEVA 4MB3A 4W7UA 3VNDA 1ZZMA 3ZWTA 4M19A 3WUEA 4J9JA 4XBKA 1GK8A 2O56A 5CLWA 5AECA 2W4XA 4PUMA 2WYSA 3W86A 3JVAA 3EXSA 5L6UA 1CGXA 4JTTA 4CQ9A 4Z1AA 2E67A 4HTBA 3F5LA 2GSHA 1EF2A 3W84A 1P7TB 5CJMA 1WUFA 2PDJA 3HW2A 3VCRA 2CXGA 3IIZA 2JIEA 1O66A 5DF0A 3EXRA 3SQPA 5CPOA 3BJFA 4IX0A 1FX6A 4KQNA 4PB4A 2G37A 5FOOA 3UQNA 3VPLA 1NIUA 3IJQA 4UOJA 4F0MA 1XIDA 1O94A 2PWFA 4ZB2A 2Y5SA 4JX6A 4CEUC 4L4MA 2DSWA 3AO0A 2ZUTA 1QATA 4NASA 3WD4A 4H50A 4O50A 1EX1A 1KV5A 1VQZA 2HSAA 3HIJA 4QIUA 3TNOA 3WNMA 4ERAA 4JTAA 3OU8A 2FYMA 4L1WA 4W5UA 2FDMA 2O9RA 2AL2A 4DUWA 1KRMA 2C1IA 3W88A 5LNSA 1O5QA 1JULA 4DX3A 3MWCA 3B97A 1DQUA 4KWOA 3NSNA 4DJFC 3WLLA 5I3KA 4YWOA 1Q5MA 4PEEA 1HO1A 3AIEA 1C7SA 1XGZA 4IX2A 2EPOA 1OZQA 2QMJA 4ZSUA 3SY1A 4GQRA 1OCNA 2VOTA 3AXMA 2OELA 3HM7A 1GHSA 3GDBA 4GNKB 1G4SA 3OGRA 1E56A 7XIMA 1K77A 1OX4B 3D46A 2F6XA 3PG8A 4XAYA 3RLVA 2VC5A 3LRKA 1XI3A 4RE4A 1OF6A 2OLSA 5FMHA 2YIHA 3EOLA 3DOPA 1MSSA 4O12A 2JGYA 3WF1A 1B3OA 4JFSA 1GHRA 4H1ZA 1LF1A 3AN1A 1DJGA 3SRFA 2X8RA 3H12A 1IQ8A 1B1YA 4AZHA 1TPVA 1XM3A 1X6LA 1D3GA 2X1TA 3GNXA 5G4HC 3OVPA 4Y9NA 2VDIA 4LCSA 3H2CA 1B4EA 3CPUA 3MYOA 1BGGA 3UNTA 3ABZA 1JPKA 1X7IA 3BE7A 1M65A 4WHBA 3C2RA 3MV01 4IFOA 3PZQA 3OYZA 4LV4A 1ITUA 1D8WA 4J5NA 4R9XA 3V5OA 3MCOA 3VYLA 1TFVA 3B40A 4UTIA 3P2VA 3KRZA 4MNKA 4O1FA 1DXIA 3LNPA 4D6FA 9XIAA 3EWXA 1BF6A 1R2TA 4AC7C 3SCQA 3RR4A 3RNMA 4QX4A 2ZKMX 1CGUA 4C91A 3TXZA 3MO7A 1GVOA 2Y85A 3IJDA 3S46A 1CXIA 3SCTA 1CLXA 1E6SM 1GETA 3TJLA 2NVDA 2PLCA 1XSJA 3CHEA 3WNOA 1F2JA 3GU2A 2OZ8A 1H62A 4GBDA 4HPJA 1X39A 1S2VA 1V03A 3DI1A 4APNA 4JN6A 2XIJA 3W1TA 2PBGA 3N6JA 3UZYA 5HUPA 1K7FA 1T8QA 2PCQA 3FW6A 3UCQA 2V9DA 4IQEA 5J5DA 2W62A 4NP7A 1QJWA 2YW3A 3FHQA 4XKYA 3LMYA 4LUTA 2Z2BA 3JU2A 1VEMA 1QCWA 3DENA 4FXSA 3VCNA 4BQ3A 3CUFA 3SB0A 2J13A 1HQTA 2PWHA 4HNTA 2ZTKA 1Z7AA 1MWOA 5E9AA 3T2PA 2EXOA 3N6QA 4IXHA 3MUZ1 3MHUA 2DZTA 3STFA 4QLKA 4C6PA 2WBGA 4IXXA 4MYXA 1CB7B 5C2XA 3AZRA 5DLCA 3URNA 4FIQA 3KOYA 5AZ0A 1SGJA 3T9PA 4GVHA 4FA3A 1FWGC 1W5MA 4AZGA 1TJ1A 1XRSA 3H55A 4TTGA 1Q7MA 5HWJA 4A3RA 1JG9A 2CITA 2HK0A 2VCBA 3KDOA 1DJIA 3CMGA 3WLPA 1Q6OA 1E9IA 4NKCA 4E3VA 3NJ3A 3ITYA 1E9YB 3W1LA 3ITOA 4UTMA 1EB3A 1GEHA 1DYSA 3T08A 2WC3A 2WOVA 6XIAA 1IWBA 1XYCA 2J8FA 3H54A 3VOIA 4GOAA 4W85A 5TR3A 3BMVA 5C0QA 2JBMA 3W1MA 7PTDA 1JRPA 1ZUAX 4QISA 2G5WA 3GU1A 3TJXA 2Y8VA 3HO8A 3MCMA 1E1FA 1RXOB 1WZLA 3CO4A 4GQ0A 1GVRA 3SUUA 4FMVA 1K9FA 1SR9A 1IWPA 2O4MA 3AMDA 3FV9A 3WD2A 5JCMA 2Y24A 4JYEA 3WMLA 4DVOA 1CGWA 2WV8A 2WHLA 4PSRA 2ZRYA 1PBGA 2J4GA 3NVWB 3KL3A 3U2CA 3OBKA 3LPFA 3BLFA 2HE5A 1VEPA 2WJEA 1JCLA 2V3AA 4HCDA 3UP8A 4MNJA 3UNDA 1FFRA 2ZE0A 3K1GA 2VR5A 3CL7A 2QVNA 4HPNA 4UZSA 2V63A 1AH0A 4TX9A 2YQUA 1FDZA 1AUSL 1F9CA 2TODA 1RK5A 5ER0A 4FB7A 1ZXIC 4JTGA 1U1JA 3THUA 2EJ1A 1KN0A 3BAIA 1N5XA 2JK2A 4DUVA 1TX0A 1EP3A 4UNLA 3W2MA 4Q7IA 5IXEA 1IGWA 1LVLA 5AHEA 3PN8A 1UROA 2I17A 3DGBA 5D03A 2VD8A 4H2HA 1GVIA 3POCA 7REQB 3DC8A 2OJPA 3T4CA 4JPGA 1VS1A 1QBBA 2A3BA 4Q8VA 4MKSA 5T9CE 5ABFA 2RKXA 1VFHA 4DEFA 2GPTA 2Z27A 4ONVA 3CHDA 1RA0A 3QPZA 1NP0A 2FDSA 2NZLA 3WLIA 3CGTA 1GVSA 3WUBA 1FHDA 2VCCA 1QW8A 3PS7A 1ME9A 1AL7A 4MFEA 2HQAA 3AISA 5H2ZA 4NZ3A 4RPPA 2XIOA 1NELA 1T6MA 1ZALA 5C70A 4NY2A 4GH3A 4O10A 3U57A 1FWCC 1P0BA 1IEWA 3A4WA 3GSMA 1GYLA 3W72A 1GRTA 2WBAA 3LM7A 1ZSXA 3T0BA 1UUOA 4DIAA 2DIEA 1U2YA 4WUIA 3MSRA 1SQ7A 2WHMA 3W7IA 1FH8A 1R2RA 5BWAA 4EX4A 1F76A 4LBSA 5GJMA 1EYEA 1VP5A 2NSXA 2GK1A 2GWNA 3U2OA 1JXKA 2PC4A 4J3ZA 1HO4A 3A3XA 1A5LC 1IIHA 5I3HA 3L68A 3KWSA 2D20A 1TPC1 4AVOA 1ISVA 2CYGA 2H8XA 4ICMA 3WH9A 2EQ9A 1TSIA 3IIVA 5I24A 1H2IA 4M6QA 3C3NA 4LBUA 4B91A 2YA0A 1D7KA 4YNGA 2EAWA 3BOLA 5DBUA 3EOEA 3O8AA 1F6PA 1V3IA 3WCZA 1V6XA 4JR5A 1H7RA 3A6OA 1RR2A 1V6UA 4QTGA 2PWVA 1XUZA 3A4JA 5D38A 3STEA 3UJRA 2DZWA 2TYSA 2QJMA 3DFPA 1HKKA 3UY7A 4RDVA 4FLRA 3VCCA 3GYEA 1HVQA 2E8YA 3R1ZA 1I2RA 3UG3A 3UPMA 1D9EA 3QTPA 1I9CB 1DL3A 2DJXA 3LGEA 2OQYA 5EB8A 2FFIA 3OC4A 4BEQA 1L8NA 3W1UA 3P8JA 1BXCA 1L6SA 1BSIA 3DXIA 3PBVA 2OWXA 3CC1A 1OK4A 4DZAA 4KKXA 3TC7A 2CERA 3PPFA 1NHSA 4JDRA 2WMGA 5LA0A 1XBYA 4NIRA 4DWSB 4DLMA 2J6VA 4DXXA 4W88A 1U5HA 1CTNA 4GWEA 2GVYA 1U30A 1SZGA 5CGMA 4LNYA 1W5PA 3QV9A 2Y89A 4ZVJA 3TP4A 2W0HA 3AXIA 3N29A 1XC4A 2DQXA 2YL9A 4TIMA 3N3MA 3UG4A 5JXQA 3TROA 4AXKA 5A95A 1R7OA 4DUXA 3P3BA 4QLLA 4C6CA 1AH3A 1BRLB 1UA7A 2GR2A 2GJXB 3KP1A 4HYVA 4BY3A 1OYCA 5I00A 3AUJA 1AK5A 3NCOA 4KRZA 4ML9A 5GJNA 3WL1A 4GG9A 4GZIA 3LK6A 1EZ2A 3HQNA 3M5YA 4F0LA 5EKYA 1TO3A 5FL1A 1Y5WA 2YCKX 1FWJC 1EJUC 1G69A 3O6CA 3N9KA 5CPNA 4WKFA 5BMWA 4DWSD 4JFWA 2GUBA 3KXQA 3VK5A 1EXBA 1X1ZA 5GRTA 1ZJBA 4O54A 8XIAA 2AAAA 2Q6ZA 2EPMX 4RJEA 4A3HA 4E8DA 1XKJA 3FG2P 3UR7A 4IWWA 4Q6JA 4AF0B 1JCMP 1EJXC 4AH7A 2BVWA 1HL8A 1V6VA 2Z7KA 4GKLA 2O7SA 4G7FA 3N9SA 5AZ1A 3LPOA 4PH6A 4IQDA 2NW0A 3FKKA 1L0PA 3OBEA 3DDMA 3MC5A 4PTMA 3TN3A 5C7HA 5EFFA 1XINA 3WDHA 2X8HA 3U48A 3GO2A 3ZM8A 1DXLA 5DX7A 3SIMA 3WMBA 4ZQNA 4PUUA 3ZXWA 4OKDA 3L8KA 4ZQCA 2ZZ4A 1LT7A 2ZWZA 5LIUX 2DJLA 1UR2A 3DAQA 2G3IA 5AYIA 3T42A 2GYIA 2WSPA 2H3BA 1GJPA 1HKIA 1RAKA 5CZSA 3DECA 3II1A 3MW7A 1JZ4A 1E72M 4ML4A 4OECA 4W84A 1MQRA 3GR8A 1CLVA 3P84A 4GIAA 4MYAA 4C6LA 3GTIA 1TPH1 3H6OA 4ZFCA 1QT1A 3EAUA 3RXZA 3F2BA 4IPJA 3LS9A 3Q58A 3HMCA 1LPFA 3FVDA 3OQEA 3ISIX 1FCVA 4OZOA 1CW2A 4YYFA 3IGSA 2O7QA 1JDFA 3CUZA 1F3XA 1E0WA 4RR4A 2Q09A 1JDDA 4H01A 1GTEA 1SFLA 1KCLA 2IXVA 4Z1CA 3BLDA 4IP7A 3U7BA 1MO0A 3IIOA 3OVGA 5A6JA 4H4PA 1O1HA 1HJQA 1ZRQA 5AHFA 3RK8A 1UKQA 1J93A 3W7HA 4RW3A 4IMEA 2QUUA 4U2ZA 4H9UA 3TTSA 4MLRA 1FH7A 1ECEA 3NNTA 4MY9A 3WK0A 4HSNA 1OB0A 2PC8A 2PTWA 4C90A 3EWYA 2BODX 3ENLA 3TYEA 3LCWA 3P82A 5ENLA 4A8RA 2VFHA 4C6IA 4WY0F 3G3MA 3N73A 3RLHA 2XH2A 3P8IA 5I07A 5D9OA 1XLLA 3KOFA 5DMYA 4B9YA 2E6YA 1KBJA 1W1IE 2CZFA 2I5QA 4JIQA 1BTCA 5EBAA 2YFOA 4MAVA 3WY1A 5I5RA 1GT8A 1E4IA 4HN4A 1IF2A 3A7UA 3AJXA 2PTDA 1UD8A 3LD5A 1M6JA 1W3KA 1BQGA 3MZ2A 2P5NA 1UWAA 3IRSA 4PODA 4WDUA 4MG4A 2EPKX 3T8LA 5AHMA 3EKGA 3O63A 3VMNA 4LS0A 4F8XA 3ZT6A 4CQDA 3Q37A 5C9RA 3RHGA 1D8CA 4NI8A 4HN8A 1H49A 4CNNA 1HZYA 1LG1A 2V5CA 3V18A 4ADUA 1W3LA 3CNYA 4ZQRA 3IJ8A 2BMBA 4S2BA 1TVLA 1N61C 4V1XA 3ITCA 3VKCA 4FX7A 3LXAA 4Z42C 4XTDA 4NZJA 1TV4A 3NPXA 3AU2A 1VBUA 3NWRA 1C92A 3CS2A 1TR1A 3RO8A 1I45A 1IZCA 1EYWA 2Z1VA 3ABRA 3VIGA 1XGDA 2PDQA 4ZO6A 3TC3A 2DSKA 3HQPA 1QNRA 3W9ZA 3VKJA 3WJYA 4BI6A 2G97A 3HPFA 3CXOA 2R6OA 1EJWC 1TCMA 5GQBA 1X7FA 1RCOB 5M2FX 3O1NA 3R0KA 2CZVA 3CHCA 1E15A 1TE1A 4M0XA 1ENUA 3CZEA 4JNYA 4KFPA 2JEPA 1CWYA 1DJXA 1YPFA 1EGVA 4CD6A 4X0VA 1ZJAA 1CEOA 3LTYA 2E40A 4EQSA 4IPNB 3BLLA 4AD5A 1UZDA 3PBUA 4PBFA 3GXNA 1JZ2A 5IDZA 1BWVA 3MS8A 2TMDA 4RNIA 3W3OA 4DJDA 3ABOA 2Z24A 4LAUA 3T81A 1G01A 3A5VA 2YVJA 3M46A 1TA3A 2FTYA 4RXFA 1AZ1A 5HULA 1KLYA 2Z1BA 1BXBA 3MKCA 4LV9A 1R9YA 4E2VA 3ZIZA 2WPBA 4UZUA 2H9AB 4B2DA 1NWSA 3WFZA 4AFYA 4Y9OA 1JYVA 3V3WA 1OCQA 1OX5A 4H9YA 3RO6A 1ZKQA 4WDWA 3KW3A 2CFYA 4LYRA 4P2VA 4GKTA 1XIBA 3UZZA 5DELA 1TPFA 1XLKA 3SCPA 3NZRA 1S1RA 2X30A 1FWTA 3W87A 2ADAA 1QPRA 3AI0A 1ITCA 1F7BA 3E0WA 4GD0A 4PMUA 4NXKA 3PUOA 1DEDA 2BHZA 2GQ9A 2VFFA 3DFYA 4IL0A 2W66A 3GXIA 3VKDA 4RE3A 3U6WA 3L4UA 4FF7A 1STZA 1TE6A 2YPIA 5BYWA 3B4YA 2QCHA 5CBJA 5U4NA 1OINA 4H04A 2QJNA 4U5IA 3T1GA 4H7CA 3U8GA 1C9DA 1BKSA 3SI9A 4FS9A 2E3ZA 3NS1B 2YLAA 1UP2A 4DF1A 2NQ5A 3EGJA 3OW1A 2X1IA 2QCFA 2GVEA 4YWIA 2E77A 4R9OA 1OFAA 3T40A 1Z3NA 2VZVA 2QF8A 2VC7A 2QDDA 4L64A 2HS6A 3W23A 4EWJA 4IP5A 1XW8A 3NZQA 3THQA 1ADSA 3ZJKA 1F61A 4HMNA 3ABQA 1GV4A 2R82A 1E40A 5T9BG 1SFSA 1TPUA 1MDLA 3ARVA 3VMPA 5C5YA 3PPGA 4XZIA 4LYQA 1VENA 2OO6A 1EHAA 2RDUA 2YCLB 4XZNX 1M3UA 2BGSA 1I0DA 1UKPA 4XTIA 1RP8A 3QC3A 1L6YA 6A3HA 4PMXA 7ENLA 2V3DA 2G41A 3EWDA 3S2MA 1LZOA 3SCRA 2Y7EA 4CD4A 1DIDA 4MY8A 1XBVA 4GVIA 3R11A 3H7UA 2OGJA 1Z89A 3MUXA 3PWIA 3OG2A 3Q2DA 3QZ6A 5K2ZA 1VIZA 3IGHX 1WZKA 3M64A 3E2RA 1XG3A 4DLFA 1R3RA 3AU6A 2V81A 1UPPA 2WLYA 1GJUA 4GYFA 3W2KA 1OGBA 2BWGA 2V3FA 3BGJA 2O9TA 3V5FA 1H1ZA 2YXGA 4AMAA 2WCSA 4U3CA 3B0YA 2VENA 4ZOHB 2J79A 3NYZA 2J27A 3AIWA 1R38A 3W6MA 2WHJA 4HZ6A 1W9PA 1H1NA 1S5WA 1SR0A 2VELA 1VHNA 1KM2A 3AICA 4BJHA 1CI1A 2W54A 4R7JA 3MP4A 4PL1A 3SGZA 2XPKA 3O0HA 1EUAA 4F3HA 1UUQA 3NFUA 3QY7A 4NZCA 1XPGA 3CZGA 3AZTA 4RW5A 2FGBA 1O95A 1JYXA 3GNNA 2PU1A 2QV4A 4Q4OA 5A8NA 2A0NA 3IAPA 4OUIA 4BWLC 3DESA 4FO4A 5C9WA 1Z32X 1PKYA 3HGJA 1XIHA 1Q7ZA 2X0YA 3FEQA 4H9ZA 3IVUA 4DNHA 3RCMA 4H8NA 4D6HA 1P48A 3HJZA 5G5GB 5EMJA 1Q65A 2VC6A 1FTXA 3IARA 1TPB1 3BW4A 2YA2A 3PSVA 5KZDA 3UWEA 2XSBA 2VGBA 2L5HA 3AWOA 1MFUA 1XIIA 4HK5A 2WZIA 5D32A 4Y6GA 4CNSA 1MW0A 1G4EA 4KCWA 4Z17A 4C65A 1TJ2A 5BWFA 1ODUA 4G1NA 4I90A 4CD5A 4AZ6A 4QLJA 3GC4A 1WDQA 4IMDA 3UYIA 1J0KA 3LV6A 5CPQA 2BXVA 3N19B 4P8VA 4GQBA 1T5AA 3CQIA 4W8AA 4XZHA 4UR9A 1OX4A 4DJEC 1ZMCA 1PE1A 2NQZA 2OSYA 1KR1A 4IJRA 3GW3A 4QITA 4A4AA 1CXKA 4Q7NA 3S5SA 1T8XA 2XN0A 2QF7A 8CGTA 4OV9A 1JYNA 4R33A 2Z25A 1MW1A 3GLCA 4E8CA 4IG2B 1BG4A 1MRQA 3U0HA 3PY2A 4ROPA 1O5XA 2UWFA 5K3VA 3OEXA 3N11A 2YZRA 4XIMA 5HINA 3WLNA 4ZE5A 3URQA 4TVYA 3C5QA 3R8HA 2QNEA 3EDFA 4HYWA 1W56A 1O4UA 2W79A 2W67A 3SUWA 3TXVA 2CLPA 1A0DA 2OSXA 4MMWA 3S6OA 5B80A 1FCUA 4DPPA 2FJUB 1F8MA 4DM1A 4JX4A 1ISWA 4QNEA 4U31A 5DMLA 4Z08A 5BNKA 3BDKA 2GQWA 3DG3A 1S3HA 5GVJA 2BLEA 4NT0A 3WEMA 4WD0A 2FHFA 2PI6A 3BUVA 4YVVA 2F5ZA 1HUVA 2FZMA 2QR6A 3AROA 1UP3A 2Y8UA 1Z9AA 5K9DA 1PO9A 2O0TA 5LZLA 3HB9A 1E0XA 3NDZA 4LU0A 5A69A 2YYTA 3TTYA 9CGTA 2XVLA 1OM0A 4H41A 3BZGA 3TZNA 4DF2A 3ZO9A 1KBBA 3WLMA 4F0SA 1JVNA 1Q6FA 1MEIA 3KTSA 1VBJA 3CGEA 1E6RA 4L61A 4F0HA 3WEZA 5I02A 1OF8A 1THFD 2I7GA 4WXYA 3EA3A 1UWRA 1JZ5A 2X7WA 1BHGA 3VNLA 2NLYA 2V5KA 1FWDC 2WVSA 1YXDA 4W7WA 3OOQA 4KIEA 4UBPC 5T26A 5ABTA 2HS8A 1J18A 3QPEA 1V79A 3CLMA 2QUTA 1H09A 3ZOAA 3EANA 1IZJA 2FZBA 5FA5A 3MU7A 3O6AA 4G7EB 2F2HA 1NTHA 4QJ1A 1DPMA 4I3GA 4C6KA 2PP0A 4GR1A 4AD4A 3WQ5A 1RM6B 4QDPA 2E5CA 2WK2A 1KFJA 2AKMA 1BWKA 3PUDA 4O1EA 1IIGA 2ZOXA 3OHIA 1ZJHA 3DU0A 1UD3A 2F84A 2J7GA 4KF1A 5XINA 1J0JA 1OHLA 3ZR6A 2RDWA 4LRSA 4CVUA 2HVOA 1PCWA 1MVYA 3MPGA 1W8SA 1R3SA 2EKGA 6ENLA 1KKRA 3PSWA 4EPKA 3PZNA 4ACZA 3E2SA 5LA2A 5LXXA 4K39A 4WXZA 1EJVC 2QCNA 3THCA 1GOQA 3BAYA 3ATYA 3EUB3 4DWSC 1W3HA 4KERA 4U5KA 5LHEA 1E6NA 1LL4A 1Q6DA 3N15A 1PKNA 1EFZA 2LLEA 3BGAA 2VEIA 5A1AA 3CTLA 4O1CA 3LOTA 3H8AA 5FJTA 1JF5A 1WYIA 2OCZA 3WELA 4FK9A 2HMCA 1R3QA 2V5BA 2HBVA 2FVMA 1PUDA 3CT2A 5G5IA 1A0EA 2I1OA 3ZJ7A 2ISWA 3KUMA 3MBFA 1GOKA 4Z1BA 3ZR4A 1UWQA 3GKAA 4UCFA 1KBIA 4N9BA 1FHLA 5CG7A 5FF0A 1LWIA 4FDCB 3N2OA 1ZCOA 4KFOA 2WAGA 2OEMA 3LRMA 1TRDA 2V2DA 1F4AA 2JKEA 2GGHA 2ZE3A 2R1MA 5SWUA 3W53A 2V69A 4B5UA 3T07A 4YCOA 3WK2A 3EYPA 5KINA 4GK8A 3UGVA 3GR4A 4AD3A 3I7QA 4A8IA 1LL7A 2QUNA 4V2XA 4J56A 3CAWA 3GVQA 4J3TA 4YTUA 4CNOA 5MKGB 1Y7VA 4LXFA 2OQHA 3TYUA 2X2GA 4BCEA 3HG5A 3I7RA 4S2CA 1BVWA 1GKPA 2QT3A 4ECLA 3AMKA 5EMUA 2FZNA 3VIMA 3ONBA 1DXEA 1EO5A 1VYPX 3UCCA 2EQDA 4RNJA 3G22A 4PUJA 3S2CA 4V1YA 2XFRA 3A21A 2G50A 1XYLA 3AALA 3H7VA 2YDAA 3FYOA 1LTDA 1PJ9A 1TMQA 2OX4A 2BC1A 3GD3A 2BXZA 3WLHA 3WIJA 3NVTA 4PTWA 3LHVA 1Q4NX 3VDGA 2D0FA 4AC1X 1OJTA 3RLUA 2Z1WA 3GXMA 4AWTA 2NUYA 2DZBA 3EB2A 3SRDA 4UMAA 3W7QA 1SJAA 1D7FA 1HTIA 4MKVA 3S2NA 2ZZ1A 3RYSA 3OA5A 1ZGDA 4BZYA 2HXUA 3W6YA 3ZLGA 3LDVA 4RDWA 4UUIA 1IXQA 1ZBKA 1VQTA 3NVZB 2OU4A 2B7NA 3JR2A 4O1AA 1R3VA 1KW1A 4XO6A 9RUBA 4QCFA 4P8XA 2XVGA 1OSEA 3L2LA 2AGKA 3TE9A 2I9UA 3GUWA 3LGGA 1F74A 3MCNA 2E28A 4AIOA 3W74A 1REQA 4EAYA 2RH9A 3VZZA 4U2YA 3DN5A 3NTYA 3NVVB 2P50A 5C71A 1B0IA 2OYLA 2Z4GA 2IKHA 1H51A 1M68A 5JH1A 2E9LA 5DFAA 2PS2A 1E1CA 3HGOA 1XYAA 3O7UA 3W2JA 3K4WA 5HR7A 4IIHA 4R3UA 4M80A 4REQA 4IJCA 4IUGA 1WKFA 2INEA 1M03A 2J7HA 3N4AA 1CYGA 4E2DA 2NUXA 5A8QA 2DZSA 4HA0A 3IGXA 1K4HA 4AHPA 1TVPA 3CM4A 1WB0A 3M0YA 5CPSA 4GZ7A 2X7VA 4GQGA 1R9ZA 3QSRA 5CC6A 5BRQA 3HJEA 2OT1A 4IF2A 2A79A 3GE7A 5FS8A 4MGGA 1QUMA 2WWCA 3VNKA 1FDJA 2P3EA 1PAMA 4IFKB 3LCGA 1KM6A 2OLHA 3N12A 2E5DA 2G3MA 5LGZA 3LPGA 3TNBA 5AC5A 1US0A 1WOBA 4CGTA 3UETA 1XKYA 3M9YA 1TMHA 2RDTA 4NAEB 1PTAA 3NGFA 1YDVA 4MTVA 4GABA 3WBWA 2W0UA 3T0DA 3E6EA 1Q1WA 4OOZA 1DJYA 4L9ZA 1I60A 4RV8A 4UTKA 5HWNA 1G5AA 4C7DA 5G4EA 1YNQA 4JKKA 4Z2KA 4JAWA 3W75A 1XYFA 4Z2IA 3WH8A 3NQ8A 3A9IA 4FNRA 1HVXA 4DELA 2Y7GA 4JXCA 3SURA 2FTWA 3DFNA 2WSQA 3CUGA 3QBUA 5F4SA 2YOCA 3RX4A 4KETA 3RM9A 2QCEA 3CU2A 1LM1A 2GQ3A 4S3KA 5HANA 1AJ2A 2HZGA 5CZKA 3W2UA 1TTQA 4POCA 3L5OA 2EF9A 4O0QA 1WBJA 1VGAA 3M47A 1W2PA 3TQVA 2OOFA 5LSMA 1NWTA 3P5YA 4MOZA 3BOXA 1Q7QA 2G3JA 4AY1A 1M04A 4LA1A 4NX0A 1AJZA 1YPXA 3MV11 4TR9A 1T40A 2HVMA 3LG3A 4FX9A 4O28A 3C8FA 5AC7A 2NV1A 3ZT7A 3SN1A 1JCTA 3B0UX 3RCNA 5CZJA 3VGDA 4P8WA 3LERA 3WF2A 1PZ0A 4I8YA 4H9MA 2QQ6A 1L6WA 3O06A 2X40A 4Q33A 1PXGA 1CENA 1ELSA 4LT9A 2PGEA 3V0TA 3V16A 3FGCA 2WSRA 3W1RA 4AF0A 3WDJA 3GR7A 4R5EA 3EMZA 1V77A 1NDWA 4FOUA 2X8CA 6TIMA 4BQ5A 5GNXA 5HWMA 3SIZA 4GYPA 4QJ4B 5E1QA 2IPWA 2AMGA 3GRTA 3V1HA 2FGZA 2XTKA 2XFFA 3LZ3A 3M0VA 3B9EA 4KWWA 5CEWA 1YXCA 2BY2A 4D8AA 2DZAA 2VDGA 1RPKA 5E93A 2WXDM 4HNLA 1OIFA 1IT8A 1OJXA 2DGAA 2W27A 4TV6A 5CBIA 3VOCA 4O52A 3FKRA 4MZ1A 1XLHA 2QUMA 2XVNA 4DO4A 3CQ0A 4HHPA 4D6GA 2UY4A 3PULA 4I6KA 4FAMA 1HW6A 2CHNA 4A35A 4NG3A 4HSOA 1VIWA 3BK0A 3QW3A 1SW3A 3BARA 3N4FA 1TCDA 3NDYA 3PAJA 4GNJA 4H4YA 3IEBA 5GJPA 1SFJA 5LNWA 3SCWA 4LB3A 3F4WA 3P93A 4LUSA 4FXRA 1GNXA 2VC9A 3FXGA 5I09A 1JCXA 5F4WA 3HPSA 3QZAA 1GQJA 1W54A 5KEZA 5BMXA 3WX7A 2ACQA 2XUCA 3M5XA 3FA3A 3LI1A 3UWQA 3F03K 4PFHA 1R3WA 1GVEA 3GIYA 2OYMA 5A2BA 1K7XA 1RY0A 2EQ6A 3CQHA 4B5SA 2D0HA 3MHFA 4AEOA 3LBCA 2VR2A 3HG3A 3H23A 2XINA 4QG9A 5E5CA 3P0XA 3LHZA 3UESA 2O9PA 1WXZA 4JTIA 1IEVA 2FHCA 1X97A 3A5FA 1H61A 3QZEA 3TOPA 3SFKA 3UA4A 4ZA0A 3K13A 1WP6A 1XPYA 5F2IA 3C6CA 2UV8G 4XAPA 2J62A 5KVIA 5I79A 2O55A 3LCIA 1DWFM 1IWAA 4PC8A 4UFLA 2CXEA 3EDDA 3P67A 3IGUA 1BF2A 1HJXA 5MF5A 5KZ6A 4LF2A 1GTHA 1KQYA 4MPKA 3W01A 4C6QA 1J01A 4MZ8A 3EDKA 4EXBA 4LUIA 3QFEA 3DC0A 1I1XA 3BAXA 3CPRA 3VE9A 4RNHA 1UHVA 3CGBA 3BZJA 4PBGA 5A6KA 1XLCA 1RBLA 2IQ0A 4YVPA 4M1RA 3MVIA 2VR4A 5JCIA 1HL9A 5FD0A 2PLJA 3REQB 3B9OA 1KR0A 1X98A 4NEVA 3GFXA 1B3WA 4A3UA 1X38A 3SAZA 1VCFA 4AIEA 1Q6CA 3OA3A 1V97A 4GZEA 1CPUA 3A12A 3TX9A 3WO8A 4PMZA 2VL4A 1QNPA 1AG1O 2QAFA 3N2TA 5HBFA 3L21A 1BYDA 1YADA 3GH7A 4D1JA 1BVNP 3E0IA 3DYOA 3TMLA 1XR2A 1DWAM 2ZZBA 4DHGA 1IT0A 2HQMA 3DHUA 5M5DA 4JS3A 1HKWA 3RU6A 3W70A 3QQ1A 4H6KA 3AC0A 3NL2A 3N18A 3L66A 2DZPA 3H4WA 5B7YA 3CHFA 4N7QA 2ICSA 3G24A 2HXTA 4FNQA 1XLMA 3ZFHA 5HJYA 1KBLA 1NF0A 4PRRA 1ADOA 1QW7A 2R1PA 1PWLA 3XISA 1H7WA 2Y7FA 2GJPA 3WLKX 5H8MA 4WK9A 2QW5A 3I10A 1XYMA 2EHHA 2VZUA 4PUWA 4WY0A 4UFHA 2VT0A 1W2VA 2ZQ0A 3SR7A 4MB5A 1DV7A 3S1UA 1H0GA 3UT0A 2PPGA 1JQXA 3GFYA 4DZIA 3N04A 3BCJA 4HA4A 1V6TA 3QGAC 3I65A 2QDHA 1ALDA 1HGWA 3AS2A 3OZPA 4L4OA 3L4XA 2Y5EA 4CU6A 1EJ7L 2QCDB 1LRNA 3KHJA 4AHQA 3PZTA 3H2OA 4P7OA 3M6DA 3URAA 4YPJA 3STGA 3VIKA 1EBDA 1C8YA 4I5RA 3BMXA 4KIRA 2VYOA 2OO0A 2E6DA 3WKZA 2DVXA 1KRAC 1GEUA 1Q8AA 4C6MA 6TAAA 2GGIA 3WFAA 4FSAA 3OJGA 4GACA 1M5WA 3LXCA 4ZGYA 2PZNA 1ZFJA 4RPQA 2Q02A 2J66A 5EBKA 4GX9A 3QSTA 3ID7A 3MI3A 2QDEA 5FSDC 3ATZA 3QFBA 4N4PA 2J6XA 4E4UA 1HJWA 2HWGA 5D9NA 4ROQA 3UG5A 1S5VA 2ZTJA 3OTRA 1FFQA 3W2NA 4IZGA 2QS8A 3G1RA 4FLSA 4ICNA 2C71A 4H4WA 2FGLA 1H63A 3ZVHB 3CMFA 4OVXA 4F2UA 3B3DA 3G6MA 3IV3A 5EGRA 1FECA 3OGVA 3CL6A 3I4EA 4LS2A 3EX6A 2XGIA 3C2YA 3VZYA 3M7WA 1YE4A 1CGYA 3GD4A 5I03A 2XIIA 3E49A 3L2MA 4C6JA 1PIFA 2XFWA 4NJIA 5D37A 4L9XA 3VINA 1POJA 5AC4A 2ZX6A 2ODOA 3NXLA 1PKLA 5LHFA 3L5MA 3V7PA 2QIIA 4DYEA 2J9YA 6REQB 3OQ8A 4MAZA 4FXJA 4N02A 4BQ4A 3AMGA 1KWGA 2QGHA 1P0DA 3HGRA 3VIJA 6ALDA 3F4NA 4AIBA 3NQMA 4GZJA 1MI3A 3UXDA 2YCLA 1QO5A 3FS2A 1GWJA 5DT5A 5F4XA 5BOEA 1EH9A 3W76A 1QI2A 1YBQA 3MYPA 1C3FA 3DGZA 1J0HA 4UTFA 4FIRA 3W1NA 2ESCA 2CLKA 1I8JA 2EG8A 4M3PA 3CB3A 3ARRA 2F6KA 1JCYA 4JTJA 2VFIA 5IHRA 1SSDA 2HBXA 2WSYA 1PX3A 1FKXA 3G5EA 4F0RA 1V93A 3VUSA 4CQAA 2WVVB 4E2BA 5JBFA 1V7AA 4E2OA 3GS6A 2PDUA 1CGTA 2ZZ3A 5HJLA 1XH1A 4ALDA 2C15A 2W91A 3KBSA 4GJ1A 3L2IA 1WA3A 4ZO9A 4IMCA 2ZIDA 4XAGA 2QXWA 4TU1A 2DU2A 1BEUA 1OFDA 2WMHA 8RUCA 4UXDA 4WF7A 2GQ8A 3AWNA 3VDCA 1ITXA 1CXFA 5C55A 2DZUA 1J0YA 1HGYA 4S3BA 2C19A 3F5JA 4M7SA 2X8GA 1FWBC 3BW2A 2CESA 1QBAA 3DGRA 4YIWA 1E71M 4C6BA 2QPXA 3NSMA 3TAKA 3PWAA 3AYRA 3SY8A 4Z1DA 1JUBA 2YBUA 1JPHA 2ATSA 3WBEA 4IIBA 5DO8A 2EQ8A 3WFLA 4L6OA 2B31A 3M6YA 1R6WA 3GZAA 2X0HA 1XANA 4QFUA 1QHPA 1XQKA 4HNCA 1YDYA 3CUHA 4IQLA 4W7VA 3UF9A 3BANA 2HK1A 4DN1A 1TWSA 4BURA 3TJ4A 4QR6A 1C7TA 4GI8A 3KCOA 4K2SA 1X8FA 4KCVA 3QGKC 4DXVA 1ZENA 4HZ8A 3SM0A 4K7ZA 2PLMA 3QV6A 2V5LA 2RGMA 2C3CA 3W38A 4OIFA 4C7GA 4AUBA 4ZFMA 2XU2A 5A2CA 4TXEA 1JNEA 2V6AA 3PPHA 3WQ4A 5CC5A 3G1SA 2D22A 4LCQA 2E8ZA 4OUEA 3EX3A 3ARQA 4ES4A 3LZ5A 2DH2A 1LUCA 1Q6RA 3IIPA 4WGXA 1UC4A 1E51A 1TZ9A 4HIBA 1QVBA 3KHDA 2BY0A 2QMKA 3QY8A 3OZOA 2A7PA 3DGHA 5H8PA 1UJPA 2ONEA 3PJXA 3Q45A 4YJ5A 3IK4A 2EG6A 1SZEA 2NVCA 4LWWA 3KVLA 4FNPA 3VX0A 2R9RA 3W6LA 3TYAA 3M0KA 4V27A 4TMBA 4JTCA 4BF7A 1EHNA 4GQQA 4Q7BA 1OGSA 2WMIB 1M7OA 1EO7A 1OFQA 4DAFA 4PSPA 1Z44A 3W02A 5BXSA 1I75A 1XLJA 2D73A 3KM8A 3T55A 2WZTA 1W8GA 1XBZA 5I78A 2V8ZA 4CCCA 4C1NA 3GRSA 2PLKA 1ISYA 4WJEA 4OFCA 1F3WA 2ALRA 4AYSA 4YWSA 4RX0A 5JRBA 2G4JA 3S5OA 4Y90A 1W1B1 3FK4A 3FN9A 4JCLA 5AFDA 3V75A 5T91A 3S1VA 4L5ZA 1N2VA 4L4LA 4UTLA 4J3WA 2WKLA 3B03A 4IIFA 1ZP3A 4OQVA 3AAMA 2OMAA 4I9JA 1BWLA 4LYKA 1KNWA 3I68A 3A3WA 3OVQA 3TOYA 3HRDC 1RCQA 1V0LA 4NRSA 3NOEA 3M0JA 3V0SA 1JDCA 2E9MA 2BGNE 2FKPA 2BVDA 4EVZA 4XG1A 2ASHA 4EQWA 5A8OA 1B3XA 4GO9A 1DWGM 2GDUA 4XD5A 4M52A 5A6MA 4QEHA 1W5QA 1QR7A 4WJXA 1Q63A 4EMWA 4IMFA 1WZMA 1OWQA 1Y8BA 1D3HA 2G0WA 5BU6A 3LXDA 3B8DA 3MDUA 1TV8A 3SGGA 2VRJA 1NHPA 1ONWA 4G1KA 4X3ZA 1RALA 3D5HA 3B9JB 1PSCA 4JFUA 3PVFA 1XJBA 4ZZ9A 1NY1A 3MSGA 1UOZA 3AXKA 1IT7A 5DCBA 3CZ8A 4I9MA 4JBRA 2X2YA 1ONFA 3R5EA 1XYBA 1SVDA 1UQYA 3IV8A 2Z1XA 2PBOA 1RSCA 2NUWA 1IXPA 4IIEA 3T6CA 2NX3A 3V5CA 8TIMA 3LYEA 3POHA 4Y8EA 1WKEA 3S1WA 3LX9A 3VGHA 4CCZA 1A3XA 4G7EA 2XH7A 3MMTA 2XWDA 2ISVA 3S1XA 2E3TA 1RQBA 4C5YA 1K4QA 4GVFA 3TQ0A 4WEVX 4LNCA 3D47A 3WUGA 1EA0A 2CIPA 4S3DA 3WH7A 3UXIA 1UR8A 2YAUA 1A3HA 3MI6A 3ICJA 3E02A 1UKSA 3GZ3A 4QE4A 3W83A 5A5WA 4EQRA 2WNQA 2WMJA 2P0IA 2YCIX 4ZO7A 1W6TA 2ZDSA 3GDLA 1OVDA 2W61A 2VVSA 1A5SA 3WBYA 3P81A 3IJLA 4XBJA 2QCCA 1Y5VA 4C7FA 5IFTA 4PCNA 3DERA 1H4PA 3H2FA 1QO2A 4R27A 4MFDA 5JMUA 3BURA 2Q8XA 4FF5A 3CL8A 4M6PA 3WK3A 3LTPA 3FYYA 1KD0A 2VHLA 1SUXA 2R1LA 4IICA 1MW2A 3OYXA 3IC9A 2QV5A 4O15A 1VJSA 2NLIA 1EGZA 1KXVA 1GVFA 3GXPA 2HE8A 1J10A 1US2A 3GYCA 4JYDA 3SCOA 3FIGA 1OT1A 3H53A 3VNYA 3M0IA 3W81A 3ZR5A 1P0EA 3IRDA 2GGEA 1SM9A 4JQAA 2BVTA 1KM4A 1WV2A 3APYA 3M0LA 1ML1A 3E74A 3WQOA 4Y96A 5HR6A 2EPHA 5CAHA 2W3ZA 2VZTA 2Z2UA 3KVJA 4IGNA 4GYPC 3E0VA 5DY3A 4GUGA 1RP9A 1JUEA 2XGZA 1UUMA 4GYJA 4R85A 2WC4A 3B4UA 4KH2A 1K8XA 3NPUA 3UJSA 1TPEA 1NSJA 3TTEA 4Q32A 3RILA 3LCXA 3S6DA 1JZ8A