4IT1A

Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
426
structure length
426
Chain Sequence
QSMKITRVTVTPIAFRDPPLLNASGIHEPFALRSIIEIESDNGYIGLGESYGDAPALAIQQQVQSQLIGLDPFNLNQLRRIVQTTVAAHKPASLAGAELAPGSHASKAVSNAYSAFEVAFLDLQARYLNVPLVDLLGGAVRDEVPFSAYLFFKYAQHVDSPYKPDNWGEALNEQQIVAQAARMIEAYGFKSIKLKAGTLPPEHEVACIKALKKAFPGYPLRIDPNGNWSLETSIRMAELLGDDLQYYEDPTPGLEGMAELHKRTGLPLATNMVVTDFDEFRRSVAQNSVQIVLADHHYWGGLRDTQTLAKMCDTFGLGVSMHSNSHLGISLMAMAHVAAAVPNLDYACDTHYPWQEPDEEVIKGGKLPIVDGCVKITRAPGLGLELDHDQLGKLHDQYLTCGIRQRDDVRQMQRYKPDWKALKPRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative glucarate dehydratase
publication title Crystal Structure of Enolase Pfl01_3283 from Pseudomonas Fluorescens
rcsb
source organism Pseudomonas fluorescens
total genus 149
structure length 426
sequence length 426
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4it1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4it1A01
3QPEA 4ZA0A 3TJIA 4E5TA 1XPYA 4IP4A 4GFIA 4MKSA 3DIPA 3V5CA 1TKKA 4M6UA 3EKGA 4GIRA 1EC7A 3Q4DA 2GSHA 3PWGA 3K1GA 1R0MA 4H1ZA 3EEZA 3Q45A 1SJDA 3OZYA 1TE6A 1P43A 3DFHA 3ZLFA 1SJCA 2GL5A 3QTPA 1NELA 1FHVA 2ONEA 3CK5A 3MWCA 5EU9A 3FCPA 2OG9A 3R0KA 4A6GA 3UGVA 2PSNA 2PTZA 3CXOA 3OZMA 3T9PA 2OKTA 4H2HA 3P3BA 2PA6A 2OPJA 2OZTA 3ZLGA 3R10A 4F4RA 2OQYA 3ZVIA 3SQSA 2POZA 3U4FA 2PS2A 2P8BA 2QGYA 3N6HA 2AL2A 4Z17A 4HCHA 3CT2A 3TQPA 4E8GA 3KUMA 3RCYA 4HYRA 3S5SA 3NXLA 1DTNA 2GGGA 3UCDA 4E4FA 1YEYA 1EC8A 3H12A 5FJOA 3UJFA 1NU5A 2XGZA 3MQTA 2ZC8A 2FKPA 1RVKA 4KT2A 3R11A 4GMEA 1ONEA 6ENLA 3FJ4A 2QQ6A 3P93A 2GGIA 1PDYA 4IHCA 3D46A 4Z1YA 1EBGA 1JCTA 2P3ZA 1BQGA 2QVHA 1MNSA 4ROPA 2DW7A 3T8QA 1P48A 1ELSA 3UJSA 5FJRA 4M0XA 3N4FA 5FJPA 2FYMA 2OVLA 3RITA 4GGBA 2OO6A 3SN1A 3TOYA 2RDXA 3THUA 1WUEA 2OX4A 2PGWA 2PODA 4DHGA 2XSXA 3I4KA 1EC9A 1KKRA 3V3WA 2OZ3A 2QDDA 5ENLA 4K8GA 4IZGA 2OQHA 3GY1A 2P8CA 4HNCA 3MKCA 4ZCWA 3U9IA 3ENLA 1W6TA 1SJAA 3IJQA 4KWSA 2AKMA 3ES8A 4K1WA 3S47A 3BJSA 4GGHA 3VC5A 2PTWA 3CAWA 4FI4A 3JW7A 1BKHA 3ZVHA 3R1ZA 1SJBA 3ZVHB 3SSZA 2MNRA 3R25A 3TCSA 1PDZA 1F9CA 2AKZA 1EBHA 4EWJA 4DWDA 3N6JA 3GO2A 1KKOA 3UCCA 2HZGA 4GISA 1OEPA 1JPMA 2PP3A 3PWIA 4A3RA 3NO1A 3VC6A 2AL2B 2NQLA 2DW6A 3NFUA 4G7FA 3I6EA 4H83A 2OZ8A 3FVDA 3T6CA 2MUCA 4HN8A 1KCZA 3JZUA 2HXTA 2P88A 3D47A 3BOXA 1JDFA 5IDZA 1MDRA 2QJJA 1E9IA 4JHMA 2QJMA 3SBFA 3OTRA 1IYXA 2XH7A 3UXLA 3R0UA 2QDEA 4JN7A 2XH4A 4YWSA 2OLAA 3DG7A 4J3ZA 5J04A 3DEQA 3TJ4A 4DXKA 2GGEA 3OW1A 3UJ2A 3IJIA 3PK7A 3B97A 1MDLA 1TZZA 4H19A 3SN0A 5FJTA 3MZNA 4E6MA 1MUCA 4E4UA 3DFYA 2GGJA 3V4BA 2XH0A 4DYEA 2PCEA 2CHRA 2PP1A 4MGGA 1FHUA 3FV9A 3T4WA 3GC2A 2HNEA 1R6WA 3DDMA 2ZADA 4K2SA 3VA8A 3P0WA 3VDGA 3RR1A 3DG3A 3NZGA 2PMQA 4IL2A 3SJNA 4GYPC 2P0IA 4ENLA 3GD6A 3IK4A 4G8TA 1KD0A 4DX3A 3MSYA 3OPSA 3OP2A 3ES7A 3VFCA 4FP1A 2PU0A 1ECQA 4HPNA 2GDQA 4X2PA 3CB3A 1JPDX 2PGEA 4IT1A 2GGHA 3BSMA 4A35A 3H7VA 5BOFA 3JVAA 1XS2A 2XH2A 3CYJA 2OFJA 3I6TA 4HNLA 4GYPA 3UJEA 4IL0A 3FXGA 3QLDA 3RGTA 3ZLHA 3RRAA 3RO6A 4KPLA 3VCCA 2QJNA 3MUCA 7ENLA 4MMWA 3IJLA 3DERA 4IP5A 2I5QA 2O56A 2PTYA 3QKEA 3STPA 2AL1A 3H70A 2PTXA 3PFRA 4HCDA 3DESA 3UJRA 3TW9A 3SN4A 1L8PA 5BOEA 3VCNA 4J1OA 3TWBA 4JN8A 3FYYA 3H8AA 3HPFA 3MY9A 2PPGA 3TTEA 4DN1A 4KEMA 2PU1A 3DGBA 1WUFA 1MRAA 4HCLA 5FJUA 3QN3A 2PP0A 3UXKA 2HXUA 3DG6A 3N4EA 3V5FA 3TWAA
chains in the Genus database with same CATH superfamily
3QPEA 1H1ZA 4ERGA 3VNMA 3EANA 1XGZA 3GS6A 3BAWA 4M6UA 1XLKA 1TR9A 3GAYA 1NH6A 1BSLA 3EDJA 4QQ3A 3CAQA 4IX0A 4LUIA 1OX6A 4RE3A 3WMCA 2V68A 3KOFA 3NQ7A 2ZXQA 3N2CA 3TK7A 1OWQA 2A4AA 4B2DA 5C6MA 3LA4A 3NYDA 1FWRA 4LY4A 3O07A 2PWDA 3W28A 1TTPA 1XD0A 1SJDA 4JICA 2A6LA 5CZJA 3OZYA 5HULA 3A9IA 4LJ3A 4M80A 3LN3A 5TNVA 4FX8A 5I79A 3DYPA 3TYUA 1ISYA 1UMLA 5LA0A 4U33A 2WK2A 3W0KA 4A6GA 4B5WA 2PSNA 1A0DA 3AROA 3MP3A 2O4MA 3CQHA 3TYEA 2OZTA 3DJJA 3ABRA 3R10A 3MC5A 4BEQA 4QJ5B 3W7IA 3DKLA 3AM9A 1OC7A 4NZFA 1QUMA 1UQYA 1CLVA 2B7OA 1FWFC 2Z1VA 5F1VA 2P8BA 1XL9A 3FXYA 2PGRA 3PN8A 3TQPA 3NSXA 4JDRA 4NUWA 3RCYA 4F48A 5ABFA 4YCOA 4XSMA 1KB3A 4FF7A 4GX9A 3E6EA 3GC5A 3MYPA 3O7UA 2GJLA 2VEPA 3KCLA 2VX5A 2WMIA 1HT6A 3DENA 1DIOA 3AXXA 5CAHA 1E5JA 2BOGX 2W54A 3UWYA 1A50A 1TPH1 1RSCA 3P93A 2WP5A 1V3MA 1OFRA 2D0GA 2VEMA 3R6IA 2WBAA 4Y2WA 3PC0A 1BYCA 3BMWA 3KBWA 4DBEA 1ISVA 3GHRA 2WJFA 4NZJA 2XN1A 3MB9A 2WHJA 2VC9A 4Y9PA 3COTA 3WD0A 1K70A 2D2HA 2AOSA 4GGBA 4UQ9A 3ZT5A 2GR1A 1XBXA 3NNTA 1V8EA 1BRLB 4ZOEA 4B5XA 4DUOA 4LANA 1VBUA 4U31A 1UD2A 3IRDA 4NAEB 3VKDA 4NEVA 2ZZ6A 3VIOA 3L5AA 4ADUA 3LX9A 1YADA 1JGIA 3EAUA 1B57A 3VFLA 1FUYA 3LLDA 2QJIA 1VYRA 4UTTC 3M0KA 3W85A 4GUJA 1TYGA 5C0QA 1GHSA 1ZXIC 2XINA 5LKYA 3IVUA 2PTWA 4Z2IA 1AG1O 4H7ZA 3JW7A 2G97A 2BASA 1BG4A 3W1RA 2DZPA 1J5TA 2G4JA 3EMQA 3H2NA 1OX4A 1YMYA 3FA5A 1QWKA 1M7JA 1OZMA 3NSMA 4CD4A 4UTMA 3OEXA 3Q6JA 5I02A 2FMOA 4OWGA 2YCKX 4PFMA 4M7SA 4I9JA 2ZRZA 3W6MA 1PZ3A 3N9SA 4EM3A 1FWDC 1FH8A 5C71A 2ACQA 7XIMA 5C55A 4G7FA 3PNUA 4MJ4A 3BO9A 3G6MA 3RU6A 5LXEA 4PUUA 2ZZ4A 3A3HA 4DI8A 1X96A 3WD2A 3AI0A 3WQGA 3CHDA 1PZ0A 1EJWC 3D47A 1Z3NA 3TQ0A 4JIRA 1ZMDA 3GR7A 3FS2A 4OV9A 4B5TA 6ALDA 1YBQB 4UC5A 1ENUA 3H2AA 4HHMA 3M5ZA 3AHVA 2CNCA 1E71M 4J2PA 2P3EA 4AWEA 3W71A 4YWSA 3DG7A 1VYPX 3C3UA 1GRFA 2AAMA 1I2PA 2R6OA 1LPFA 2PDPA 4RNIA 1H1YA 2W3ZA 7REQA 4UZUA 5LNSA 5LIWX 4UFJA 2Y24A 3LNPA 4HU4A 3M0IA 5CBIA 2WLZA 3ZWSA 3RX3A 3MS8A 1EDTA 3PZOA 1JUEA 3PZVA 1K7EA 1YDOA 2WWCA 1FWNA 4Z2GA 1HKWA 2FMNA 3WCZA 4WOZA 1RPKA 5JH2A 2A7RA 3ITXA 3F7JA 3W1TA 1F3WA 4X63A 2ZVRA 4AZ5A 1REQB 3BG3A 6REQA 2Y89A 3GZAA 3ZJ6A 2UY2A 4XK2A 4CNSA 1MO9A 2QCGA 3GDLA 3SZ8A 2WPFA 2WBGA 3B40A 3V5OA 2BX7A 2J7DA 3BCDA 2VWTA 1VS1A 3PTKA 4XAPA 3O16A 1TWSA 4XZBA 3WH5A 2H3BA 3ZT7A 1S5MA 4JPGA 1IZJA 3AUJA 3WH6A 4A35A 4CLMA 3DUGA 3M16A 3ARUA 3CO8A 1E6NA 3OGRA 4M1RA 3EOSA 2Y5SA 3S1GA 5FKYA 3S6DA 3WLHA 4C6FA 1XYAA 1KXQA 3LSBA 3DHPA 5C5YA 1J9YA 4J40A 1H50A 3PZTA 1GUVA 1B4EA 4UOZA 4KPLA 1BVNP 4EX4A 2QJNA 3GR8A 1FKWA 1B3VA 3ERPA 3TYAA 3GKFA 3AMLA 3QY6A 1KRBC 4HPGA 4APNA 4L64A 4H7VA 2JKPA 4HMCA 3TW6A 3KAOA 3DECA 5I3JA 2E8YA 4PTXA 1ZCCA 3OYZA 1NSJA 5D8WA 1RXOB 4WY0F 3TLQA 1W1VA 4XAYA 1P0NA 1QNRA 2NLYA 3GLCA 2CW6A 1A49A 1YDNA 4YN5A 1JPIA 3TTEA 4QJ3B 2YXOA 2J66A 4YTUA 1LF1A 1ISWA 5HNRA 3WQ6A 4LVFA 1W1ZA 1PYMA 2PDLA 2HXUA 5M03A 3I7QA 1EOKA 4GIYA 3TC6A 3FA3A 1YXYA 5FD0A 3AHXA 1A4MA 4FXRA 1Y0EA 1E43A 3O8AA 2R1PA 1KA9F 2GVGA 1J0IA 4UCGA 5TF0A 3CV7A 4P61A 2NW0A 4JQ1A 5A8PA 3QMRA 2GR2A 2R24A 1Q4WA 1XC6A 4DYKA 3VOIA 1O95A 4G5DA 5AHIA 1FWEC 3EEZA 1I2QA 4FXJA 3W1MA 1NFBA 1VF8A 1ESWA 4O11A 2E3ZA 4PTNA 4BJHA 3ISIX 3ZLFA 4IX2A 2VOMA 4YTTA 4GO8A 4S3EA 1TV4A 3VI2A 3MWCA 1I0DA 5G2WA 2FB2A 4F0MA 1VENA 1H09A 1WA3A 3EBVA 5EMKA 3PZNA 3GVRA 4ATWA 5G5GB 3CWOX 3CXOA 1PB0A 1K77A 2YZ5A 3MHFA 4IPPA 4QDWA 3P3BA 3W82A 2WM0A 2VMFA 1L0PA 3AWOA 3RMEA 5HAOA 4O54A 1VR6A 2PE4A 3A3XA 1BXBA 2AL2A 4K8DA 4HA4A 3FHAA 3VKAA 3CPGA 3F2BA 2VP8A 3AMGA 1W1PA 4KQNA 1ODUA 5LIKX 2C3DA 4U3AA 5A6AA 3H4XA 4R53A 4XD6A 2BVTA 4H01A 1OCJA 1TVNA 3H2EA 4E0CA 3WO8A 4U28A 5A3HA 1F61A 3R11A 3N73A 1K1DA 3WK0A 2EF9A 5HMFA 2XIQA 1EBGA 3BDKA 3LCXA 1I1WA 3UWQA 3U7BA 3ATYA 3W9ZA 2B7NA 1EDQA 3N12A 1Q6CA 1U83A 3KCOA 3RRXA 1FEBA 1GOKA 4RCXA 3U3HA 5B7ZA 4D8ZA 1JDEA 4RE4A 1D3GA 4PGLA 2O9OA 1F07A 3NUKA 3KW3A 1T99A 2CBJA 2Y7GA 2J3NA 1W17A 3NRZB 2GRTA 3L4WA 1BEUA 1EEXA 4K8GA 5IXEA 1XIIA 2P8CA 1HXJA 2H3DA 4C65A 1XH2A 4QBXA 2IKJA 4W8BA 3GG7A 2CBUA 1CXIA 4BQ5A 3C61A 1FWWA 5DFAA 3URHA 3HPSA 4GNVA 3W26A 4LYQA 4JQ3A 5AB3A 4HSHA 1UQZA 5E93A 1VEOA 3NL6A 3HIJA 1GGOA 1AQHA 3PY2A 1TV2A 3BARA 1PDZA 1R3WA 2RKXA 5A8GA 3O0KA 2DZTA 1SZEA 1FO4A 4LC6A 1VFTA 4ECLA 1O7AA 3U2CA 3AYTA 2GSEA 1CGUA 4IGSA 2G3FA 4UUIA 1BYBA 2WJDA 3QPZA 4Q4OA 2BZNA 1P6BA 4IGHA 3NQ6A 1H6VA 4S38A 3WQOA 5D38A 2WMJA 3S2MA 3TNOA 4WCJA 3HGOA 3I6EA 4H83A 4MZ1A 3IIVA 2OT0A 4I3GA 4D6FA 1FH7A 3HPXA 1GRBA 4A3QA 1UH2A 2F84A 1SVDA 4LEFA 2WMIB 3OO2A 1FHDA 1JIBA 4J3UA 1Y65A 3W3OA 4DQWA 5IDZA 1F8IA 1A3HA 3RUBL 2QJJA 2QPUA 2DH2A 4Y6GA 4X0VA 5A8OA 3W1QA 4Y8EA 2IUZA 1F6PA 4D1IA 1R2SA 2ON3A 1IWBA 3W27A 3C56A 2CWXA 1JEZA 1NP0A 2OLAA 4DAIA 1Q65A 4X2RA 1AW2A 1MZHA 1V03A 1W56A 3R07C 2ZIDA 4F79A 1JULA 1C92A 3K30A 1YPIA 3EB3A 3IJIA 2UY5A 3REQB 3E0FA 2QJGA 3SN0A 3MDWA 1C8VA 3URAA 4YCPA 3QOMA 4XD3A 3IGSA 5XINA 1AJ0A 2CHRA 1ZK7A 5EMLA 3E74A 2NXGA 5M2FX 2E9MA 3GC2A 2HNEA 1UR4A 4QXIA 1EA0A 1X7FA 3LRKA 1ZMCA 3EKLA 3P81A 4AD1A 1S3TC 3NQMA 4FX9A 1KLZA 3T42A 3V16A 2J7GA 4WF7A 3SJNA 4ERAA 4GG9A 2XWDA 3AZSA 1EL3A 4XBKA 2FZNA 3CU2A 3VKKA 1KD0A 2D69A 3CT7A 4GXMA 3P8JA 4PRRA 2GWGA 2ZBTA 5DMYA 1EH9A 3BVJA 2VX7A 1ECQA 2CBIA 4MB3A 1XYLA 1E3XA 1XIJA 4H4SA 4DLMA 4GFSA 3I65A 4HOZA 4NZCA 3WQFA 4I8DA 1TIMA 3CV6A 1CT5A 4KGLA 3RGTA 1O60A 2W92A 2NSXA 3T08A 4TIMA 3R94A 3AISA 1K7XA 1DP0A 4JZ5A 4H7CA 4UFHA 1CGWA 1HJWA 3LCGA 3U4AA 2QPSA 3F4VA 3GNNA 1LOSA 3MKVA 4X22A 4N42A 3NZ1A 3B9EA 4YXGA 1RA0A 3UZZA 3B8SA 1XJBA 4R9XA 2QIWA 7REQB 1IZKA 2ZXDA 3POCA 4S3JA 1OK4A 4AZGA 3CV1A 3M4HA 3MBFA 1LLZA 2VEIA 3HO8A 2BC1A 4A3UA 2PPGA 2VJXA 3C0LA 4KEMA 5MHBA 2Z2UA 1W1B1 4GY7A 1O4UA 1PL9A 1WZKA 1B3ZA 3LCHA 5EYWA 3TZNA 3UXKA 4IJRA 1BYAA 3JUGA 4ICNA 3W7DA 3TWAA 4TU1A 3DC0A 1M65A 2W61A 4E5TA 4A8RA 1DIDA 5CC7A 2VFFA 2O7QA 3LXCA 3O15A 1FP9A 5I78A 2V5LA 3Q94A 4M6QA 3CLMA 4IOTA 1N61C 4GPNA 2WJEA 6PTDA 4Y9OA 4IIBA 2OZ0A 6REQB 2VFIA 1KRCC 1H41A 4R33A 4PB4A 2FFIA 5ABEA 2PDFA 3W7CA 1FQ0A 5HQEA 3GH5A 1WYIA 1YE6A 2IPFA 3Q45A 3VDBA 3SJ3A 4EMIA 2J7HA 3MZ2A 1CGYA 3QFAA 4ZOHB 3NQ8A 5EBKA 4PTMA 4Z0JA 4WD0A 4ZB0A 2XUCA 1T5AA 2DSZA 2B4GA 1J2BA 1BQCA 1BHGA 5F7UA 1TE1A 2X2GA 1SZFA 3VE7A 1XGEA 4R27A 4NZ4A 1K7FA 4OE7A 4HYVA 5E70A 2RJGA 3A22A 5REQA 3HQPA 2VC5A 1LTDA 4AMAA 4HIBA 3PZQA 1JQXA 3ZLGA 4AQLA 1K9EA 3FFSA 3W81A 1AODA 1TJPA 9CGTA 4GYJA 1EWDA 3IIXA 3CGBA 4DO4A 2FH6A 3EB4A 3LK6A 4YPJA 1UR8A 1QOXA 3CWNA 4UTWA 4F8XA 3N2BA 2BY3A 3NURA 1E72M 3K8LA 4C1KA 2V3AA 3N9KA 4KT2A 4RX0A 2ANUA 2HEJA 3W25A 3FJ4A 3QR0A 5D9MA 2Z24A 2IMRA 5C2CA 4UTUA 5I06A 5HWNA 3M6YA 3LXAA 1GT8A 3ABXA 2I14A 1ZKQA 2X8CA 1MNSA 3XISA 1QNVA 1WKDA 1L2QA 4GOAA 1WDWA 4PMZA 4Q4MA 3TTYA 3I7SA 4WXYA 3ZM8A 5EMYA 4W4QA 1H2JA 4M8UA 4O12A 1YDYA 3AXIA 4ZEPA 1ZBWA 4S2BA 1OIMA 2OZ3A 1OYAA 3PTDA 5LIXX 4H4RA 2J9YA 1G01A 4U5IA 4JXCA 4JTCA 1FCQA 1G5AA 2NZLA 3CUIA 3GXIA 1V7YA 1GVQA 5FF3A 2O55A 4HVXA 4R5EA 3GRTA 1S5NA 3DFPA 3UZ5A 1YPFA 4D9PA 3CAWA 5I24A 4F0SA 4ATLA 4DPQA 4O19A 3W88A 5C7VA 1JGMA 5D8ZA 3BK0A 2YQUA 1FWBC 2GDUA 5DMMA 1E6RA 5GJNA 2OYLA 1KKOA 3WUEA 1U30A 5G1TA 1XFCA 1LWIA 1G7VA 4DJFD 4QITA 2D2JA 4RPPA 1UWTA 3VC6A 2C0HA 1W3JA 4A8NA 4DF2A 2AL2B 2JGYA 2NQLA 4IPJA 3L4XA 3NFUA 3AXHA 4LCSA 2GLKA 4AF0A 3A21A 1NHRA 3D3FA 4BWLC 4LTSA 3CTLA 4AAJA 1PPIA 1T8XA 1DJQA 2F2HA 2HXTA 5LSMA 2V3FA 3IPWA 4MB4A 4JL1A 2PCQA 5JMUA 1H7XA 4WX2A 4TOQA 1YRRA 3W72A 1JCXA 2HE8A 3H2MA 2HPMA 3DAQA 1EB3A 4TO8A 2R1MA 4LA1A 3QJAA 4NSBA 1E1CA 4J3SA 4MB5A 2C15A 3PAOA 4Y96A 3UFYA 3IV3A 3O6YX 4CQDA 3UJ2A 4Y7EA 4CNOA 2VC6A 3EB2A 4B3KA 3C4UA 1BF6A 1TV8A 2X8GA 1V0MA 4E4UA 1CYGA 4HSNA 1I1XA 4C6PA 3PG8A 4D8LA 3NVWB 3LM3A 3ANVA 4D6JA 2INFA 2VURA 3CAVA 3WMLA 1FWGC 2W5FA 4TX6A 3TTSA 4UTHA 3DDMA 1JZ3A 5I0DA 3LXBA 3P0WA 3APTA 3RR1A 4LAZA 1RQEA 2VUYA 4FLQA 1IT8A 2PDJA 4KWUA 4MYAA 3LD5A 1IT0A 2Y85A 4DEFA 3WENA 2BBFA 1AFSA 3A7RA 2KZHA 1G67A 1J96A 3NG3A 2RABA 1W8SA 4O28A 3VKBA 1SW0A 1JYXA 4JEJA 3BQ5A 3XIMA 2E9LA 3C2YA 3W7NA 4K6AA 3PSVA 5CG0A 4QISA 1QPQA 3LPGA 4GNKB 2R1KA 1GESA 1MW1A 2V2HA 2E25A 2OFJA 3KRBA 3R13A 4ZOAA 3W86A 3M0YA 3UJEA 4YWOA 4LALA 3QTGA 3L8KA 3QLDA 4LBUA 5DY3A 3KTXA 4IMCA 3O63A 3FHQA 3CGDA 2F7FA 1A5AA 1XH0A 3BW4A 1B54A 1NFPA 3WMBA 3KE0A 1L6WA 1MQPA 4PBFA 3CH9A 3E49A 2EQDA 4KERA 3STPA 2X1UA 5I3KA 3EWDA 2CERA 1ZSXA 3QH2A 3KL5A 1ZB5A 2PTXA 4ZQNA 3NAVA 2JK6A 1EHAA 1CXFA 1UH3A 4UMCA 3B8IA 1CGXA 1A53A 4ZQMA 8RUCA 2VZOA 4M56A 4MNLA 1BVWA 1H5VA 4JDBA 4Z1DA 3TFXA 1JROA 4KCUA 5C9RA 3A4XA 2ZC1A 1QWGA 3SY8A 2YVJA 5EA9A 2D22A 5FJUA 1ONRA 5I07A 4AIOA 2BHYA 4XAGA 4W85A 3POHA 1LRQA 3H4KA 2V5JA 1TMQA 4JCMA 3P5YA 3VE9A 3R43A 1FWSA 4FLOA 3V5CA 1OG0A 1OD8A 3FN9A 3QFWA 5GJMA 4ADSA 4GUHA 2ZWYA 1UUMA 2VFDA 4D72A 4IQLA 1EGZA 3B0PA 3CIXA 1SFTA 4HGXA 1XH1A 3UR5A 3E96A 3SUWA 5LYRA 1IQ8A 1WXZA 5DCEA 1TPDA 3M0MA 1JEHA 1SJCA 1HJXA 3AQUA 3QHMA 4AVNA 7TAAA 3RHGA 3CBWA 1XICA 4M19A 4W84A 2C91A 3DU0A 1A3WA 4PC8A 5TQLA 1VBGA 2ZRXA 3AHYA 4XISA 4FHAA 5C70A 3R0KA 4FSAA 5LIUX 3GM8A 1SYTA 1KW1A 1LROA 3WJWA 3ZSSA 1IZCA 3ZVIA 4H8HA 3SQSA 3SCVA 1S7MA 2OGYA 2GR3A 1HX0A 4DJFA 1NJJA 2X09A 4HCHA 4JTUA 2X50A 3KUMA 4MJ2A 3UEQA 3K5XA 4MF4A 1V59A 2HQAA 2ISSA 3NQGA 5G4EA 5JCLA 5MF5A 3W7HA 4DM1A 2F5ZA 3W6YA 2E68A 1EC8A 5C9UA 3VNDA 1BGAA 1CXHA 1W3IA 2MANA 2QCDB 1L6YA 5E9XA 4Z1AA 1T96A 1ONEA 1W2PA 1RBOB 2YDRA 2J9XA 5G2HA 3KBVA 3UA4A 2VL4A 1AH3A 3LB8A 3N29A 4IXXA 3DI0A 1Z8AA 2B81A 1K02A 2X1IA 1NEYA 4ROPA 1VBJA 4LEQA 3M0JA 5JCIA 3LGDA 1EEPA 1TPVA 4CEUC 4E2DA 2BY0A 1I60A 2A2IA 3OHMB 5HR7A 2CHOA 5H1WA 1VHNA 3NYZA 1MEWA 2PODA 5KEZA 3OLEA 2XM1A 2INZA 3WF4A 1DWHM 3K4AA 4HT3A 4N9BA 4UR7A 5MKGA 4LOCA 5HWJA 4AD2A 3C2OA 3GY1A 4KWOA 1TSIA 1Q13A 4S23A 5HPOA 3GWQA 1QO5A 3U9IA 3I6RA 1FRBA 4DVOA 2OEJA 3KWSA 3M7WA 3BUVA 1JL8A 3CZKA 2BC0A 1BKHA 4WLCA 1DE5A 2MNRA 3R25A 1AOGA 1TWIA 1B4KA 1U2YA 1GYMA 5KINA 2FZ8A 1H3GA 4JHOA 2DZWA 5A94A 1CBGA 4JTJA 4MDPA 5TR3A 4KFOA 1BG9A 4LAUA 1GVEA 2WVSA 3B8WA 3CZEA 3TXZA 4BZYA 2JF6A 4NF7A 4NNCA 1W9DM 3TVAA 5BNKA 1WQ5A 5GQBA 1WDSA 3L4YA 1WKEA 3UA3A 3W76A 4PCPA 2P1FA 2RAGA 1Q3NA 4Y9MA 5DLCA 1NFGA 2WKLA 3G8EA 2WZIA 1D7YA 1K4GA 2VGFA 1EA9C 1GKPA 3VGBA 2GSJA 3FJ6A 5CQ1A 3AZTA 2VELA 2ZWZA 3WH8A 2Y7FA 1TX0A 1MDRA 4JTIA 3SQLA 4NY2A 3QSRA 2X42A 3Q37A 1B5TA 3CV2A 3DFNA 1TTJA 4I6VA 3QZEA 3ARYA 2VVSA 4EF8A 3CC1A 3UU0A 5AYYA 5AYBA 5A6JA 1MQQA 3CHFA 4EXBA 4TV5A 3NL3A 3IJ6A 4FNSA 1UMYA 4BQ4A 5F4WA 2HCVA 4D6IA 2VGBA 1RM6B 2E8ZA 4XZHA 2G8ZA 4QP0A 1DE6A 4XBSA 3M9YA 5FJTA 1TELA 3VNJA 3W73A 1NVMA 1XDJA 3AIEA 3LENA 4Q8NA 2OX1A 2GPTA 3SRDA 3WD1A 1QMLA 4LH8A 3OQ8A 3HG3A 3P5ZA 4N4PA 5FL1A 2ATSA 4AC1X 2VR5A 1RJPA 1WV2A 2C18A 3EX6A 1A80A 4WKAA 3WJYA 3PB2A 2QGHA 2CYGA 4AU0A 4ENLA 1MW0A 2GVJA 2D73A 3WFAA 2HQMA 1BWVA 2A7PA 3OVQA 3WUBA 2JIWA 2FHBA 5LNRA 3NL5A 4URIA 3DC8A 3W7QA 3L4ZA 4H9VA 2XYLA 4HPNA 4H4UA 4OBTA 2YPIA 3H7RA 4HD5A 2WHKA 1JPDX 2X16A 1KGWA 3ELFA 1W32A 5D02A 4DY1A 2ZOXA 4KGJA 1QNOA 1VJZA 4I5UA 2JEPA 4DUXA 3ATZA 3ITLA 4RK8A 1RBLA 1W5PA 4UTIA 4HMNA 4AZBA 1QHOA 3IK2A 9XIAA 1QO2A 4AF0B 2QAEA 5AC5A 4C6EA 3OVGA 5AHFA 4HOWA 4V27A 2VTFA 4TMCA 3DH9A 3AFBA 1OB0A 3NEHA 3EXTA 1X97A 3M5VA 3C8FA 1HW6A 5ER0A 2DQWA 3E5PA 3NIYA 1W54A 2Z2BA 3VNLA 1M03A 4H6RA 2VGGA 2VDIA 5K3VA 3S6TA 5C9WA 1E1CB 3LB0A 2WPGA 4MY1A 1L8PA 3ZR6A 3WBXA 1P6WA 5AC8A 2DUXA 1XBYA 4MTVA 2Y1HA 5JCMA 5H2ZA 2V5BA 1QPRA 2Z6JA 4POCA 3QV9A 3RNDA 3EX2A 4C6LA 3BCJA 4GINA 2E6YA 1RY8A 4XAZA 2POTA 2EQ8A 2Z1WA 1UD4A 3UT0A 1FWIC 1KM4A 1XCWA 1SFSA 3ONCA 5I77A 1V08A 1WZLA 2G4FA 3H26A 4ZA0A 2WCSA 3GR4A 4UWMA 4F2UA 4L6DA 3NPWA 3CPUA 3H4WA 4CQAA 4PMDA 3GTXA 3MMWA 2GUYA 3GB6A 3T07A 3NA8A 3PUDA 2GQ9A 3EWWA 3AOFA 3VDCA 2BS9A 3WMSA 3VNKA 3IGUA 1LWJA 5E6YA 1VLIA 1UR1A 4K7ZA 5CGTA 3S5NA 3QVQA 2WP6A 2JBMA 4KCTA 4BFAA 1FXQA 3K1GA 4NIRA 4DBSA 1SO3A 3GFZA 2WNNA 3O9NA 3GG8A 3E0LA 1L9WA 1QK0A 2J8GA 1GOWA 1PTAA 3EEGA 4PBEA 4B5NA 3IUHA 2FTYA 1I0BA 3HMCA 1VP5A 1FHVA 1NP2A 1EP1A 1XKJA 4IIEA 1ZRQA 3FG2P 4N4QA 4XSLA 1S2CA 4J27A 2C7FA 3O05A 4TUFA 1UB3A 1Q6DA 3B9DA 5AC6A 4HZ8A 3SCNA 4J5NA 1W9PA 3UNTA 1AQFA 3LY0A 4GYFA 1W5NA 4H8VA 2FB3A 1SW3A 3RLHA 1JZ2A 4EAYA 3ITCA 3QQ1A 2PS2A 3RAOA 2D23A 4UBPC 1UA3A 3RYSA 3WJZA 4MFEA 4WY0B 4JFSA 3E0WA 3GIYA 4C7DA 2WJZA 2QF8A 1WAWA 1EZWA 3N2XA 3SUSA 7ODCA 2P0OA 9XIMA 4LGXA 2NSOA 3N2OA 5GNYA 3MQTA 3VIPA 4G2DA 3TH6A 3SRFA 4Z1CA 2PC8A 3V75A 1NF0A 3BWWA 3ZMRA 4H04A 4IJCA 4ZO9A 3SQPA 5DQPA 1TWWA 5FMHA 3TMLA 1OT2A 3L7RA 4HA3A 3DOPA 4LCRA 5EB8A 1JI2A 2EQ9A 1ECEA 4JKMA 4M0XA 5HJLA 3EA2A 3ZJ7A 2XIIA 4Q32A 1PUDA 2OO6A 2OU4A 1YW1A 4EVZA 4ZSUA 4DUVA 1LBFA 3EX3A 2XSBA 4IIFA 1B90A 4S3AA 1QNQA 1XIEA 1X38A 1QOPA 3QHOA 3K13A 2X2YA 1X1NA 1QI0A 1UZHA 3TW7A 2Z29A 4IZGA 1XW8A 4ZGYA 2FVLA 1BWLA 1JAEA 2PDNA 2GJXA 2V69A 2W67A 4EMWA 4LRSA 4JQ9A 2GQ8A 3KVLA 4JY9A 1TVPA 5AECA 1KRMA 3BPWA 1GWJA 1LUCB 3SCQA 1O6IA 3RIKA 2VCBA 2E1DA 3ZVHA 4AHPA 1SJBA 2GOKA 2FDMA 4H9TA 4Q7IA 1LOQA 2VXNA 3OG3A 1WZMA 4EWND 3OC4A 4TX8A 3JRKA 4B5UA 3VGHA 1IXOA 3N6JA 1H7NA 3K46A 3GO2A 5JVLA 5HJXA 1DXFA 2EKGA 2JKAA 1VPYA 3CHEA 3W6LA 1PYFA 3LI0A 4LYPA 1W3HA 3VMPA 2WHMA 3L12A 3U2OA 1U1JA 4GHRA 3C2FA 3S9IA 2MUCA 1LCOA 4JIIX 3AU2A 4WSKA 5E9AA 4HOXA 1TTIA 1A5UA 4PMXA 4D2JA 3EWCA 3G1FA 5EFFA 1OADA 2E1WA 5F2IA 3SCUA 4W7VA 4K7YA 3VVGA 2DZXA 3BE7A 1YNYA 1CENA 5FF2A 2E9BA 4AWUA 3EWUA 2DZUA 1PHWA 2XH4A 4MJMA 1R3QA 4G56A 4GY1A 3VOCA 4LB4A 4NG3A 1E5NA 4RV3A 2ABAA 1IHIA 3PPCA 2WV8A 3WBYA 1S2WA 3CQ0A 1Q2SA 1DWAM 1CLXA 1UWIA 1TZZA 1SO4A 3V7PA 4Q33A 3MMDA 4W7WA 4B91A 4QG8A 2Z1XA 1H49A 1KBLA 8A3HA 2QUUA 3NOYA 5KZ6A 1XYFA 1UG6A 1F4AA 1ME8A 4IMAA 4LPCA 1GEHA 4H9MA 4QLLA 3H7UA 3BTNA 2WVVB 3F2CA 1UZ1A 3WLPA 3THCA 3PJXA 3SCOA 1CB2A 2VRKA 3GXMA 5A5WA 3NZGA 5CPQA 2V3DA 2PMQA 2ZRWA 1O5RA 5LNWA 3WQDA 2REQA 1PIFA 1KR1A 5IHRA 2Q8LA 3VIFA 1WE5A 3ABZA 1EUAA 4JKKA 2RH9A 4Y9AA 5J5DA 4TX9A 1MYRA 1TPB1 4WSHA 1U5HA 3OP2A 5DBUA 3OA3A 2ZX8A 4UQCA 3EUB3 1ZP3A 4IT1A 1GZJA 1DQUA 2HE5A 3RG6A 4B5VA 4CVWA 3W1PA 3Q58A 3WUFA 4FDCB 1E6ZA 5BRPA 1XS2A 2TAAA 5K9XA 1CB7B 1J0JA 1B9BA 2BXYA 1ZJBA 3QM3A 2Y7DA 2A3EA 2X1SA 3GIPA 1EJ7L 1ZY8A 3FXGA 1GJPA 1DPMA 3DYOA 1ZAIA 3KTCA 3KRZA 2ISFA 1OYCA 2WWDA 5BROA 3F4WA 1GYNA 4IQDA 1ZNNA 1KBJA 4IQEA 3UXIA 3GRSA 1Q63A 2ZZ0A 1Q7QA 3WIJA 1FFVC 4DJEC 5JQ9A 1FOBA 5L6UA 2QS8A 5BYWA 1M5WA 1Q4NX 3C6CA 4I9MA 4ONVA 4UNKA 3BANA 3UCQA 4TVCA 1TUFA 4E2BA 2NUXA 7TIMA 1RD5A 3L2IA 1K4QA 3BJTA 1B3YA 2YL9A 3DGBA 1LT8A 4S3DA 3IIPA 4JTGA 1Q1WA 4JNMA 5AYZA 4JNYA 1ADOA 1KR0A 3P74A 4DJED 3AN1A 1KFBA 4H3DA 1IF2A 2GQWA 4B3ZA 4O50A 3W1UA 1Q6OA 3DIPA 1O66A 4J3XA 1AVAA 3U5UA 1FWAC 5KVIA 3GTIA 1TKKA 1QCWA 1WZAA 2BGNE 3M0LA 1S5VA 4N9DA 4KEUA 3HMJG 3LMYA 4GIRA 3WLOA 1HFBA 4B9YA 1W91A 2Y7EA 1F3EA 3ARZA 2I9EA 3VYLA 5D32A 3UR2A 4F9JA 1TYPA 3WKZA 3Q4DA 2CLEA 5D37A 5JRBA 1UCWA 4HA0A 1HKVA 2DVTA 3V0UA 3H22A 1UKPA 1HP4A 1AMYA 4LIIA 2TYSA 4UQDA 1H2IA 4DBDA 1FECA 1IEQA 1V3IA 2VFHA 1N2VA 5ABGA 4DXVA 3HF3A 3S42A 2DQXA 3QGVA 4DZAA 3PBWA 4Q8QA 1RD6A 3BXWA 3OZMA 3OIXA 4HBKA 1OM0A 4LC8A 4J3VA 2Z25A 4H9YA 1EX5A 3DCPA 5IHSA 2OQYA 4PMVA 2ZZ5A 3LOTA 2QCHA 3EX4A 4HKPA 2QLYA 3OHIA 1ME7A 2VENA 3FK4A 5HXMA 4G1NA 1L8NA 1FA2A 2R82A 2A7NA 2J78A 1VPQA 2HVOA 1JI1A 2QUMA 4BA0A 2EJAA 2J6XA 4GRSA 1PZ2A 3WSUA 1I45A 2BLEA 4WKFA 4L80A 3IS4A 1IEVA 2HVMA 4O1BA 4OOZA 2GGIA 2CXEA 4PUDA 1QI5A 4IHCA 5FJIA 3D46A 4GZJA 2QF7A 4EANA 1V4YA 3GSMA 1BQGA 1NDYA 4RXGA 2PLJA 3P8IA 1GPWA 5KZMA 2DW7A 4B15A 3NVTA 5D30A 3BMXA 3W2KA 3N4FA 5DRIA 2GOUA 1OGBA 4LCQA 1I6NA 2YBUA 3THUA 3WLMA 3HB9A 2JKEA 1ONFA 4I7WA 3W74A 2XVPA 4A8LA 1JF5A 4PODA 4U10A 1EYWA 5CPNA 1U5VA 3VO0A 1XANA 5A6BA 5CSSA 3CUZA 4UFMA 4B4HA 1C8QA 1LG2A 3S2LA 2PFHA 3MSGA 5FL0A 3PFMA 3LNMA 1TFVA 4RDZA 4FX7A 1I4NA 3A24A 3GK0A 2YFNA 4ZTXA 1K3UA 4N02A 1ZBCA 3VKJA 1DHKA 2FZBA 3LZ3A 1VAHA 1XXXA 5HDRA 2D1ZA 1N5WC 1OIFA 2P53A 4FB7A 2WCGA 1ZFJA 4H4VA 2Y8KA 5IRPA 3DBPA 3S1XA 3LLFA 4NX0A 4P7OA 2J9ZA 1ADDA 3IGHX 2HZGA 4EXAA 2YFOA 3WLNA 4ZMGA 1C7SA 5XIAA 2W4XA 1V5XA 3PWAA 4IP7A 3HZ3A 1XRFA 3WLQA 1BKSA 2ZZCA 4BEUA 5CXPA 5A95A 3TCEA 4FK9A 3IJ8A 2FDSA 3BG9A 1KBBA 5I6SA 4IPLA 3M46A 1H7OA 4P5UA 4PUWA 3NCOA 4AZCA 1OC5A 5E1QA 1YQZA 3SBFA 2DFAA 4L56A 2EPHA 4O8AA 3VOGA 4AFYA 1ZALA 3C8NA 1PS9A 3EXSA 3LBOA 3GDMA 2HK0A 2F2KA 3BQ6A 3EXRA 2ZICA 4NJKA 3GNOA 3W87A 3H2OA 5BRBA 2ZE3A 4UR9A 1TMHA 4V1XA 3ZYZA 4CCCA 4A8IA 3N34A 4CNTA 2XG9A 2ZXAA 2C3CA 3ABSA 1PO9A 2IS7A 1O5QA 3UP8A 1G4SA 4IUGA 3A4WA 3GDBA 3MV11 1VBHA 4G6CA 4ZBCA 5AHLA 1AA1B 1VB9A 2PDWA 3FV9A 1Z69A 3G1YA 2J8FA 2B7QA 1GNXA 3N17A 5A1AA 4ZXOA 1VFFA 5C54A 2GYIA 3G0SA 3KS6A 1GYLA 2AMGA 2Q01A 3VDGA 1GW9A 1HP5A 3DG3A 2BDQA 4U3CA 2YXGA 2CLMA 4GZIA 5TD4A 2J7EA 2P0IA 4LVGA 4UMAA 5BZAA 4IIDA 1FFRA 3APYA 4G8TA 5CG7A 3P2VA 2WPEA 1VCVA 3DHFA 4TVYA 2ZZ2A 3VFCA 3ME3A 2QV4A 5DANA 5KETA 3B06A 3MO4A 3LEPA 3BICA 4IF2A 1VJIA 3D0CA 3DZ1A 3RN6A 2OWXA 1A5CA 5I09A 4JL2A 4MY9A 4JTTA 4EKJA 4GCXA 4GC3A 3VIJA 3CYJA 2BNJA 1W5MA 1TB3A 1WAUA 3UF9A 4GUGA 1TQJA 4GYPA 3W7EA 4IL0A 3MHUA 3SRHA 5DELA 1EP3A 1H5YA 4IM4A 2NQHA 1Q8AA 2NWRA 4JCLA 4LYKA 3F2DA 5FACA 2AQOA 1V77A 4PULA 2WMFA 2VDGA 3H55A 1M53A 4Q8MA 3V1HA 2ZTJA 4RNJA 4RPQA 2O56A 3RLVA 4RV8A 3TLLA 4IGMA 3T2PA 2NVAA 3PUGA 4HNOA 3HGRA 2A3LA 2ZZ3A 4D6GA 2RDWA 1RK5A 5IBXA 3CGEA 3VNYA 4O1EA 4YHEA 1N55A 1XLJA 4UR8A 3E9AA 3U0HA 5D2VA 3E02A 5D04C 4MWAC 4B9ZA 4IUOA 3MY9A 3U2ZA 2QR6A 2J27A 4Q4SA 2OCZA 1E4LA 1PWMA 2PU1A 4H4PA 3URBA 1J8VA 4HK6A 3PANA 5KTLA 2YOCA 1QNPA 1J0YA 1UWQA 1SM9A 3LU2A 1HJVA 3P60A 1XISA 3QRHA 2XIMA 4PMYA 2DZSA 3KXQA 3WYZA 4LVAA 3L67A 1E3ZA 3AYSA 4JTHA 3ZJ8A 2OEMA 4MWAD 1NWSA 4CCEA 1M04A 1TG7A 1CEOA 1OABA 1TX2A 1WXYA 3PBMA 1UKSA 1GVYA 4EQXA 1HVXA 3KEHA 1FKXA 3H21A 1F3TA 4NI8A 5HMEA 1UWUA 1OZQA 1JRBA 1DWJM 4HNNA 5DEZA 4DJDD 1KM1A 3KOXA 3E2RA 2VRJA 1TE6A 1R87A 3KDNA 3MP4A 3GXTA 5DY2A 3LGEA 2IKGA 2GL5A 2BG5A 2XVLA 1JD7A 1FBAA 3GVVA 3WLSA 4A2RA 1E55A 3Q2DA 1FDYA 1XFBA 3TFCA 4K7VA 3UESA 4C1NB 2VRQA 4W88A 2J25A 4AYSA 3ABOA 1OYBA 4H2HA 3W2MA 4ZZ9A 4BQ2A 1KTNA 3KL0A 2OPJA 5JH1A 3FY1A 1TWDA 3CWHA 1F6YA 3IVTA 3M07A 3ZFHA 4TXEA 3U57A 1HQTA 1GOIA 2F38A 1A5BA 3VD7A 3K2GA 4GVIA 4R7JA 2QUNA 4E8GA 1SR9A 1E40A 3AIVA 4FALA 3B0UX 3VABA 2HK1A 3AAMA 3NXLA 3CZGA 4US5A 1DTNA 2ZKMX 4JFWA 4U4MA 3EWZA 1DJNA 3GD3A 3GHSA 1GTHA 3N6QA 1NU5A 3VNIA 4BF9A 2ZC8A 3P62A 1G9HA 5FS7A 2Y62A 3WLKX 2D3NA 1PV8A 1VZWA 3IRSA 4MUPA 4HJFA 1B3XA 2BVDA 9RUBA 1KM0A 3W1AA 1JCTA 4IXHA 4LQ1A 3PZIA 4F2BA 4NZ3A 2R9ZA 1XRTA 5CZ0A 5BMXA 1RAKA 3TXVA 2JGQA 1Z41A 4C91A 2HV5A 4FO4A 4JTQA 1OG6A 3PTQA 3KLLA 3TOYA 3GG0A 1RCQA 3QQWA 1V93A 2QYGA 4MYXA 1TA3B 3TX9A 2BTMA 3HQ1A 2V82A 3G5EA 4M3PA 3LXDA 4QJ1A 1H63A 2QCMA 3M6DA 4D71A 1KFJA 2D3LA 2F8QA 3FSUA 3BSGA 4HB7A 3KRSA 1GVFA 4I5RA 3PULA 3B8TA 1RQBA 2CHNA 1SPQA 2GZXA 2Y8VA 5A2BA 4H6KA 3KVJA 3ZO9A 1SJAA 2WQPA 5J5RA 1HGYA 4U5KA 2RUSA 2CDUA 4XZIA 2CPUA 2EAWA 3VIKA 5HNNA 5FF0A 3DGHA 3DK8A 2ACSA 4OOUA 2Y70A 1ZLPA 1GQKA 3OLIA 1Q6LA 2Z7GA 2I1OA 1OEPA 4GQBA 1J10A 1WOAA 4GIAA 4DZHA 3MSRA 1W1A1 3LTYA 5JBFA 5M5DA 5HK4A 3R5EA 1HNYA 4NJIA 3ARPA 3T7VA 1E73M 4IPNB 4EPBC 3GXFA 3UG3A 4QE4A 1T8QA 3ZIZA 3FDKA 1PSCA 5J8LA 2EGZA 3SFKA 3E2VA 1V3HA 1WDRA 3BG5A 4RDVA 3L68A 3NPVA 1NOUA 2QJMA 1SZRA 4EQRA 1QOQA 3KP0A 1UUQA 3BURA 1MSSA 4W5UA 3HA1A 1H4PA 4CN4A 1XIMA 2PD5A 3SDOA 2YCLA 5U25A 2GGEA 3HGJA 4JR5A 1VGAA 4Q8VA 1BTCA 3VXGA 4O15A 4ZQCA 3R0DA 5CPTA 3L2MA 1MFVA 3DFYA 3W22A 3WLJA 4HSOA 2IQTA 3QQ0A 2D2GA 1TZ7A 5JIPA 3MU7A 3AJ7A 4QX4A 1XD1A 5I3FA 2VUNA 1RPXA 4MAVA 4U2YA 1R6WA 4B3LA 3ETRB 4CQBA 2PDQA 1EWEA 3TNBA 1MEIA 3KP1A 1GEUA 4TVWA 4MWAA 5HNUA 2FGBA 3S9ZA 5A8NA 1P0EA 1QI3A 1VD6A 4L6OA 3AALA 4A21A 3D6NA 5FF4A 2I17A 1VIZA 2VEFA 4PL2A 2VR4A 4O14A 4DJDA 1PKLA 4FZIA 2QW5A 3TYDA 4KW2A 5LIYX 4GJ1A 3W75A 3WQEA 2NQ9A 3T0DA 1V7AA 3TYZA 1KLYA 2QCNA 3CIVA 2NV9A 2GGHA 3L0NA 3S1UA 3H7VA 3CUJA 2GDVA 3GDRA 2OELA 1DNCA 1W3KA 2TPSA 1NDAA 1JRPA 1EQPA 1FFQA 4IIGA 1QAPA 3GH7A 4J9JA 2DT2A 1FCBA 4YHGA 1F74A 2X30A 4S1FA 4WR3A 1CWYA 4FOJA 1US3A 4HU3A 1S38A 2YDAA 5AVHA 4LW7A 8XIMA 4QGCA 3IUDA 3STCA 3Q65A 3G18A 1C93A 3QKEA 1Z48A 3W29A 4KFPA 2AL1A 1AZ2A 2BXVA 6A3HA 5C8BB 2FPVA 1CXLA 3NVZB 4GQ0A 4TTGA 2YCEA 2P10A 3D3AA 3SR7A 1KXVA 4AEEA 3W07A 6XIMA 3T55A 1H1NA 3P67A 5EBUA 5FEPA 1OC6A 2DSWA 4J3WA 1MOKA 3TWBA 4BF7A 2PRMA 1LP6A 2BV9A 1TRIA 4HTYA 1PBGA 3KHDA 4DN1A 1MW2A 2P50A 3W83A 4BCEA 3GU2A 3F03K 3V5FA 3G22A 1YYAA 4TV6A 2VOTA 3TJIA 1OJXA 2ZYFA 2OMAA 3GW0A 3M64A 4MKSA 4R3UA 4WJEA 3MUY1 1PX8A 3TYCA 3FA4A 4DBWA 4N7QA 4QNWA 4H6EA 1EX1A 3WJXA 1XBVA 2O7SA 4W7UA 4C5ZA 1NF7A 6XIAA 3H4GA 1IE7C 1UUOA 2Z27A 2ZX9A 3NO5A 4WK9A 2QEZA 3PWGA 1V3LA 1R86A 3N04A 5FSDC 3DH7A 4IICA 3TSDA 3MCNA 2J79A 1P43A 1HKKA 1TJ2A 1CLKA 1JCJA 2WNZA 2WAGA 3CK5A 1ZZMA 3P6LA 1UH4A 5EU9A 5A6MA 3MUZ1 4DZ5A 5HPCA 1PTDA 4UMBA 2EG6A 4AD3A 3UGVA 3FIGA 3ONBA 2YL6A 2OKTA 3MP5A 2WYSA 3EKZA 2ZUSA 1OINA 1RJRA 4NJJA 2AGTA 4KIRA 4O57A 2NQZA 4QG9A 3S0CA 4HHHA 4NAFB 1R7OA 4GYKA 3PM6A 2IQDA 1D8WA 3S5SA 3WUGA 3BLIA 5KSWA 1JFHA 2UY3A 1XLDA 3HM7A 2ZX5A 3KTSA 5H6HA 4H8UA 1FP8A 3OBEA 3WNLA 1UASA 2XGZA 2NQ5A 3BL3A 1KTBA 4YIWA 3UWZA 2FJKA 3FKRA 4GMEA 2A79A 1DXIA 4AD0A 2OQLA 2A21A 3DFOA 3EZ4A 5K7JA 3DJGX 3VOHA 4G7EB 1ZQ5A 3SFWA 1TPC1 4L9YA 4OUIA 1IT7A 4AHOA 3W84A 1H7PA 1KGXA 3B8UA 3CEPA 3VM5A 4L9XA 4AIUA 3ALFA 2GK1A 4WOQA 3UJSA 4UOJA 1UKQA 3C5QA 1SW7A 1GTEA 2X41A 4CN1A 3SQMA 4DHGA 1DQWA 1WBHA 3OLDA 3USZA 2CKRA 3I4KA 3S8HA 1XWYA 4H4QA 4CEXC 3FYPA 3SI9A 1JYNA 2OQHA 3KVMA 3T81A 2GUBA 4JN6A 3UPWA 3PPHA 5HUPA 3QY7A 3TR2A 4JX5A 2V30A 4C60A 3TC7A 4WJ8A 1YHTA 2B31A 2ISVA 5BWFA 1EUNA 4PMNA 1JG9A 2O0TA 2O92A 4ML4A 4F3HA 1BAGA 4GGHA 3CUHA 3VU2A 3ANUA 4Q8TA 4S3FA 2NX1A 1DJWA 3OYXA 4KF1A 4ACYA 3QOKA 4C7FA 5DN1A 3C0JA 4K68A 1F9CA 3KBMA 1VDVA 4JTEA 1EF2A 3WNKA 4Q4KA 4PUMA 3IJDA 4NKCA 1BYDA 2V9DA 4RW3A 2TMDA 4GISA 3GYEA 3W7JA 4K1GA 3GTFA 3TTQA 1KQYA 4C6OA 3KBSA 4YTQA 4EXQA 4GVFA 1HO4A 4TR9A 3MUXA 4IQJA 3R58A 2CXGA 1IIHA 2DZBA 4J2MA 1K8XA 1EJVC 2RGLA 1VHCA 4Y8FA 3PB0A 1WKFA 3PSWA 3IAPA 2OYKA 1XYZA 4O13A 4MVAA 4V33A 1TRDA 3BAYA 3MI6A 4AUBA 4QLJA 1XYMA 1IIGA 2ZRVA 3R12A 4QS6A 1DWFM 5C9ZA 2DJLA 4LB3A 2QJHA 4PSRA 1SSGA 3N19B 4FOUA 3QFEA 4C7GA 4LAKA 2YIHA 1QHPA 2YW4A 3S1VA 5AYXA 4IJBA 3QR1A 1EJSC 2C6QA 1ISZA 1LBLA 1MDLA 2ZDRA 1FWCC 5M1TA 2WXDM 3CMGA 1YKWA 3FYOA 3AS0A 5G4HC 2EPMX 3VGGA 4GXWA 2PP1A 2QCLA 4QDMA 7A3HA 3ID7A 4FNRA 1VFHA 4XVEA 1E70M 4HZ7A 3WQWA 3MWAA 4GZEA 1L6FA 2PGFA 2HDJA 4O1CA 4KBXA 4HZ6A 4KEZA 4REQB 3TN6A 3VGFA 1VRXA 4FNTA 2QULA 2E5BA 1K8ZA 1P0DA 4BS0A 2W3RA 4RE0A 4GY0A 1NWUA 4W9TA 3QW3A 1Y8BA 5DCBA 2OOFA 2CKSA 2C1IA 4YTSA 1T3QC 2DZAA 2OR2A 1W9VA 3NM1A 1IXNA 3G3DA 1EXPA 3M5XA 4NJGA 4DWSD 1QI2A 1LM1A 1CXEA 4KCVA 2Y5EA 3I6TA 2UWFA 1A5OC 5CZTA 1S46A 4X9YA 1Q45A 3QPYA 1N8WA 3A47A 2E5DA 1V6YA 3WF3A 3GQYA 4JTFA 1JPKA 2EPLX 3V0SA 5AN7A 3PR2A 1YTEA 3WNNA 3LTSA 3EDKA 4C6CA 1STZA 3HFTA 5IM51 2E09A 2WC7A 2GVYA 3NDOA 1OF6A 1XLGA 1KV5A 3SY5A 1IR1A 4BF5A 3DHDA 1VFSA 3B4UA 4FR1A 1TPWA 5AOUA 3TZFA 1GCYA 4O52A 1UP0A 4NVTA 2XGBA 4PCSA 4C6QA 4HN4A 2E0PA 4BI6A 5I3IA 1XHGA 3GTHA 3UR8A 5BOEA 4W93A 3UVIA 4BQ3A 1W5OA 3TAOA 2PWFA 1WXJA 1I9CB 3FYYA 1XI3A 2XVKA 5D2YA 4AD4A 2E28A 2PDYA 4DPPA 3BLPX 2X8RA 3KZSA 3IVSA 1VIWA 2Q02A 5CBJA 1TJ1A 3RJXA 1GETA 4AHQA 3WEOA 1POJA 3VMOA 1Q2RA 5HNTA 4TQTA 4MWAB 2XHYA 3TTOA 5FESA 2DT0A 1CIUA 1F4HA 2W6RA 3ORWA 2ZRUA 4JY8A 1LLWA 1ITXA 4KFNA 1UD3A 1AH0A 1KM5A 2G50A 4PMUA 3QSTA 3UG5A 1BFNA 4ILSA 3WQ5A 1YX1A 3AXMA 4NP7A 3KVKA 1US2A 4NU7A 1E9YB 4GH1A 2X05A 1FXPA 3UPMA 4UTWC 2CWNA 1GQNA 2ONEA 1V3JA 7PTDA 1ZDLA 3GKAA 3LM7A 2XN0A 1RZMA 2WPBA 1KFEA 3WDHA 1MZRA 5GPRA 2Z6IA 3T9PA 2IPGA 5FEZA 1DJGA 1PKYA 4A4AA 1JXKA 3HPAA 2H6RA 2XFYA 3AS1A 4JIEA 1GVOA 3BSHA 1R3SA 3VD4A 5HINA 4XB3A 5DX7A 1ZHAA 3U4FA 3UZJA 1EIBA 3SSJA 3CUGA 2NUWA 2OWCA 2V5DA 3STEA 2F6KA 1R30A 2VFEA 1PKMA 5ABFB 2WW5A 3D5HA 3GUGA 3H54A 1US0A 1YEYA 1A5NC 4OECA 4LU0A 4P7QA 3WG6A 1XIBA 1N63C 2NUYA 3TAKA 4MHBA 3B9AA 3W1LA 4I5XA 2OYMA 1Z7AA 3R4IA 2GFTA 3MMTA 4FOKA 4UFKA 3MCOA 2QQ6A 4JD4A 3LLXA 3N3MA 2WHLA 3RM9A 1OBAA 3RK8A 2OT1A 3A7AA 4Q4QA 1XQKA 1RLDA 1P48A 4D6CA 1SR0A 5FJRA 4C6JA 3MUAA 5HBFA 1X98A 3GRIA 1R3YA 3RITA 2GR0A 1X1OA 3IV8A 3EMCA 1V0KA 1EGVA 1BRLA 2HROA 4QR6A 1GEQA 2BWGA 4CVUA 2GWNA 1IR2A 4NILA 2W9MA 5AYIA 3G1SA 1S1PA 4CD8A 1EJTC 5FF7A 1CI1A 1JDCA 3GTNA 2H8ZA 1AJZA 5LA1A 3S4TA 2X0SA 3UBPC 1KC7A 5KITA 3FVMA 4AC7C 1B3OA 4R7WA 3QZ6A 3BAKA 3KCJA 3L4TA 1T6MA 3ENLA 4NX5A 4Z2HA 1R3VA 1EP2A 1BXCA 1KN0A 3FX4A 2WO5A 2A3CA 3LRMA 3KLJA 1FY6A 1J18A 2NV1A 1ZL1A 3SSZA 3C2VA 3V18A 2WKJA 4ROQA 4C6DA 1OX4B 2AKZA 1Z89A 5FIPA 2EEXA 3LV6A 2ZCGA 1A5LC 3KFTA 1R9YA 4K36A 2INEA 4FF5A 1TCMA 1VQTA 3GXPA 2PP3A 1JXJA 3SUVA 3W2LA 4DWSA 3RCNA 3GVQA 2DW6A 1DBTA 1QASA 3URQA 2R94A 5D03A 1XR2A 3AU6A 2C16A 3GFYA 1YLVA 1KCZA 4KWVA 4FEZA 3HJZA 5HR6A 4Z0SA 1W5QA 3A5VA 3G1AA 4QE1A 2YJQA 4L61A 1IYXA 1SSDA 5LNUA 5F4SA 4GJJA 2ZUWA 1MWOA 4EPKA 2QMJA 1KFKA 1FDJA 2NT1A 3BW3A 2ADAA 3L21A 3U5YA 2C8NA 3CZJA 1XHCA 2WC4A 3EDDA 2G96A 3E0IA 3PK7A 3B97A 4S39A 3VAVA 3VX1A 4JX4A 1OFEA 3RNMA 2D0FA 1AMKA 1YPXA 4HU8A 2EXOA 3AC0A 2GGJA 3EPMA 3SAZA 3W70A 1R2TA 1B2YA 3W24A 1MXDA 3ZSTA 4A2SA 1RCXB 4QE5A 5EMJA 3G1VA 2ZA1A 4DI9A 4F0RA 1JNEA 3W7RA 3H23A 3E2SA 5XIMA 3WH7A 2FPTA 4NRRA 3UYCA 4AY8A 3NOEA 4ATDA 2BXZA 2Z1KA 1EFZA 2V3GA 1POKA 5HA7A 1KFCA 4AEOA 4ZQRA 4H50A 1BF2A 4OHQA 1V6XA 2PDMA 1HJUA 4MAZA 3EWYA 4F2TA 1JUBA 3N3TA 3WD3A 3G24A 4IFKA 4IIHA 3BV4A 4RL3A 2KX9A 3A4JA 4DM2A 3QEZA 4CD7A 4H4WA 3I7RA 2CIPA 1PIIA 3VILA 3V0TA 4HNLA 1MNZA 4AMCA 2YCIX 1KM6A 1OD0A 1QVBA 3CUFA 1FFUC 2D20A 1EQCA 2OODA 1GSNA 3M0VA 4V15A 3LDVA 2BODX 3R89A 7ENLA 2E6AA 2I5QA 2VVNA 4Q4PA 3NZQA 2WNQA 3GXNA 4Y90A 4JQ4A 4FS9A 1IV8A 3DESA 4BR1A 4YJ5A 1XYCA 1U33A 4LF2A 1DJYA 2CLPA 2PLCA 1HL8A 3O2LA 6TIMA 2Y4SA 1TZ9A 2JEQA 4EQWA 2PDKA 1DQXA 2E5AA 3QW4B 3UYIA 3VD5A 3G6LA 3N2MA 3AS2A 3C2RA 4H6QA 4CN6A 3CZ8A 5F4XA 4XO6A 5CLTA 4AX7A 3G3MA 3UZXA 1X6UA 5EGRA 1E4MM 2AAQA 1KO0A 1KXTA 2ZE0A 2WSKA 2ACUA 3P7YA 1P7TA 3O6CA 2I56A 3S5YA 4R7OA 4LUSA 4PTWA 3V1PA 4AISA 2CFFA 3TROA 5EMUA 1MI3A 3IC9A 1IWPA 2VFGA 5A69A 4I7VA 2WMHA 1R0MA 5BWAA 1RR2A 4K8HA 4D1JA 1O1ZA 3SGGA 4DJFC 4LUTA 3K8KA 2EHHA 3TSMA 1MMFA 2CC0A 3VM7A 3KWXA 5JCKA 5BW6A 4XKYA 3QTPA 1UR2A 1H62A 1NHSA 4LV4A 3AZRA 1NM9A 2FHCA 1RY0A 4OIFA 3FEMA 5LHEA 2WZMA 2H90A 1V6VA 1B3WA 2OG9A 3T78A 5GRTA 4DIAA 4Z1BA 4W86A 2PA6A 3RPTA 2WKGA 1A3XA 3SCWA 4N9EA 4NJHA 3LG3A 3IJ7A 4KCWA 4XV0A 3KOZA 4GUIA 3TYBA 3AHTA 4LRTA 1QW8A 5E0FA 3DFTA 3HQNA 2JF7A 3P84A 2R1NA 4J35A 4MUZA 4PMRA 2ESCA 4Q8PA 3LBCA 4LVDA 4EPEC 4RW5A 1NPXA 2D24A 3N4AA 3CL8A 5G1MA 1LZOA 4F0LA 1NOWA 3T40A 1LBMA 1M01A 1LDCA 3VZYA 4DO5A 3AIQA 4ADTA 2V0TA 2UY4A 1WKYA 2I16A 3HFYA 2X1TA 3PG6A 5LGXA 2FYMA 1QBAA 4UQBA 2CETA 3RM4A 1ZJHA 3WD4A 1GRAA 2VYOA 4EPDC 3IJ9A 3WY1A 4MDOA 3KDOA 1PCKA 4MZ8A 3KX6A 4MWAE 2XSXA 1ZGDA 1XQLA 1PWLA 1XBZA 3L0GA 3PUEA 1PAMA 1UC4A 4F0KA 3G0UA 4UNIA 1YTDA 3OGSA 3OLGA 3KLKA 4JFTA 2VEKA 3DX5A 2XGIA 2AKMA 3BLKA 3SUUA 3BJSA 1IXQA 3RDKA 1R3TA 1CPUA 2OO0A 5CSUA 3TCSA 3ZZ1A 5BXSA 4P8WA 3ZT6A 2VX6A 1L6SA 4NXKA 3AO0A 1AH4A 1PTGA 4NZ5A 4X60A 2BFGA 4H9UA 3EAOA 3PWIA 2PUZA 1UZ4A 3RM8A 2PD9A 3QR3A 4WSJA 4QM1A 4DO6A 3VPLA 1BXNA 2VHLA 1GJWA 1M7XA 3T0CA 3OBKA 2XPKA 1HKJA 3JZUA 5D2WA 2YA1A 5GVJA 4AZ7A 5C2XA 2DZVA 4I6KA 1XG4A 1UKOA 7CGTA 4JHMA 3AHZA 3ARTA 2XH7A 2P76A 1VQZA 3R0UA 1SB3B 4FNUA 4WIWA 2W91A 4K38A 3W7GA 4LY8A 4J3ZA 2X8HA 1GOMA 4NEWA 2OSXA 1AD1A 4LWWA 3TJ4A 4DXKA 1K9FA 3WEMA 4DF0A 2VD9A 2JE8A 1AQ0A 2V6OA 3REQA 1TPUA 1HGWA 2Y63A 1UR3M 3J7HA 4H41A 2LLEA 4GO9A 4PYSA 3MJMA 3N2TA 1RUSA 3S6OA 5F2GA 3BLLA 4IFOA 3LPOA 4NYYA 2IKHA 3WK3A 2W55A 4MM1A 1F8MA 3B9NA 3DFQA 3MUIA 3SCSA 1A5KC 4CCZA 5DXYA 4UFLA 4GBDA 3QYSA 2YAUA 3G77A 1XKYA 2DH3A 5D09A 1H11A 3SRKA 4ZR8A 2DT1A 1AW1A 4ZO6A 2HS6A 3A6OA 4XZ9A 1DIEA 2WQDA 4FPSA 3EOUA 1O94A 3LRLA 4YLWA 4GKLA 1NTHA 1E9ZB 2JK2A 4E2OA 4FAMA 1TREA 1RALA 4RUBA 1HG3A 2PDHA 3WNPA 2GVEA 4JKLA 3WDRA 3WEZA 3LV5A 1XM3A 2QIIA 3NDYA 1QI4A 1Q85A 4Q8UA 2FZ9A 1Z6KA 2QVNA 4XUGA 3L9CA 3B04A 4EM4A 2VZTA 3OQEA 1XIDA 4DWSB 3AYVA 1C8XA 3FW6A 3CIWA 4L4PA 3YPIA 1SZGA 3VX0A 2NVCA 4EAMA 1BTMA 3EX1A 1UR0A 3WZ0E 1DORA 2QAPA 4CQ8A 1ONXA 3BJFA 1UWSA 4TTUA 1QW9A 3MVIA 5D05A 4QDPA 4ZQPA 2O9RA 4W87A 3W2JA 2DEPA 3KRUA 4IMGA 4Q22A 3PBVA 1HL2A 3SB0A 4J7RA 3WFZA 3SUTA 3H70A 1QPNA 4XD5A 3FGCA 2OWWA 4HCDA 1WDPA 4CNPA 4PUNA 1E6SM 2R9RA 1OF8A 1E1EA 4H2CA 3A9BA 2EQ6A 1K6WA 3TP4A 3RU8X 3MHGA 1JR1A 1Z9AA 5I3HA 3M47A 1FH9A 3TR9A 1TVLA 4S3BA 3LGGA 4V1YA 1OGGA 1WUFA 3PVFA 1ONWA 5C9XA 1MRAA 5A6TC 3NZPA 1LT7A 3TJXA 5FS9A 2PDGA 1HJQA 2WSQA 1DJXA 2WVTA 1AUSL 3WK2A 5TAOA 1GERA 1TTQA 3E2QA 2PDIA 2Z4GA 4PRTA 3C3NA 2XIOA 5A8MA 4UIOA 1AJ2A 4XD4A 3EOEA 3NQAA 1HUVA 3DK9A 4E38A 4HPJA 1RBAA 4ICCX 1H60A 4P7NA 4DZIA 3UXDA 4B16A 4GQRA 3CH0A 4DO7A 3A12A 3IANA 1IGWA 2EG7A 5AY7A 5CPLA 1FCUA 1N8IA 3WJSA 5E0CA 4IFKB 3B0VC 4W8LA 1MW3A 1HO1A 1S2AA 2ASHA 4G9PA 1JVNA 1QPKA 2RFGA 3RPDA 1GZ1A 4ML9A 2DSUA 1X2GA 4IMEA 4JEQA 5REQB 3SCPA 4XTIA 3L23A 4NQ1A 3GG1A 2G37A 3L5MA 1VCGA 4PMQA 2A6NA 3E1F1 3A5FA 3UG8A 3ZR4A 4S3CA 2QGYA 2C13A 2CCRA 3LSCA 1NOFA 2OLSA 1ML1A 1EGMA 1V79A 1FIQB 2GJNA 2QV5A 4CQ9A 1NWRA 3OB8A 3PTMA 5CLWA 3NWRA 1V3KA 4PR4A 4W8AA 1DWGM 5HQMA 4C1LA 2FKPA 3NGJA 5DT5A 4EF9A 5AVNA 3LERA 1O1HA 2FZMA 1XIGA 5FEWA 5ABHA 1SGJA 4J56A 3NS1B 1GK8A 2YL5A 1M7PA 1GKRA 2XISA 3GNDA 1M68A 3B9JB 4BK9A 5EBAA 4E8DA 2PRLA 1LJYA 2P3ZA 2DUZA 1P5BA 4PMOA 4PUJA 3WQ4A 2QVHA 5ABTA 4LAOA 1W0MA 1P1MA 3CMFA 3Q67A 3A3WA 2EPOA 2X0YA 3SGZA 1RJQA 1TV7A 1P7TB 1QATA 3OVPA 1QU4A 1Q6QA 3GZ3A 1J12A 2CZ5A 2GQAA 4LUSB 4L5ZA 4NNBA 1Q8JA 1E6PA 1WDQA 1EC9A 1W3TA 3AWNA 4OVXA 3TOPA 2CLIA 1RLCL 3I4EA 5LA2A 4RZ5A 2CZVA 3MKCA 3GNRA 2BGSA 3WN6A 1W1IE 4WXZA 1UR9A 3ITGA 4HNUA 1PX4A 1KWKA 4FMVA 4LUTB 1W6TA 3LYEA 2VQUA 3ES8A 4XKYB 3VC5A 1TV3A 3CMJA 2E5CA 1WCGA 1SUXA 4S2CA 2OB3A 1XGDA 4FNPA 1F6KA 2WB5A 1XX1A 2OKOA 1WO2A 1DVJA 1GQIA 1T40A 2DDXA 4HP5A 2FH8A 2VQTA 4M24A 1S2VA 1EO7A 3PBGA 1DEDA 4LNYA 1LG1A 3T4CA 4DF1A 1X8FA 3ZJKA 4LUYA 2FHFA 4A3RA 3GUWA 1CCWB 3T2QA 4UTTA 1HVQA 2J74A 3NTYA 4ZOBA 1Z44A 1JCMP 5K9CA 5U4NA 1DKWA 4JIHA 1ZY9A 3GD4A 2WSRA 5T8GA 4YYCA 3MA8A 4O0QA 5EMMA 1GPFA 1YTKA 4TMBA 5BXPA 1JOAA 2TRSA 3UETA 3OTRA 4MKVA 3ZR5A 4M6PA 3DFSA 3I3DA 4ZENA 4AEFA 3VGEA 2PEVA 3INPA 4JIQA 1XDIA 2ZZBA 3OBAA 3UNDA 4KEVA 3SADA 2H8XA 3ITTA 1DOSA 1N60C 3LHUA 3B4YA 4DRSA 3K8MA 1BZLA 3AIRA 3AS3A 4ZOCA 1OCNA 1XRVA 4CU7A 1Q7ZA 1RP9A 5DF0A 3RJYA 4DYEA 2W3SA 5ECUA 5EL1A 4QSFA 2J88A 4EQSA 2BVWA 2NX9A 4DNAA 2CESA 3PZ9A 3FAWA 1XUUA 2Y6ZA 3CL7A 4K3ZA 4AWSA 3MI3A 4AW7A 5SWUA 3EDFA 2QHAA 3UW6A 1Y5XA 1Z42A 1JNDA 1HJSA 2NV2A 1QJWA 3RLUA 3CYVA 8CGTA 1PKNA 1S2UA 1BSIA 2Q8ZA 3GD6A 2YCJA 2QAFA 3NL2A 3SM0A 2DSKA 2WMKA 3L0KA 1D2KA 1XINA 4HPHA 5G5HB 4XQ6A 2VDHA 1KV8A 3BMVA 3CQIA 4AXNA 4ALDA 5I03A 5K9DA 1J93A 4X2PA 3CB3A 1RHCA 1NDZA 2FLIA 1H61A 2IKIA 1F5ZA 1TPEA 1TWZA 2PWVA 4N9CA 4EIVA 4JDYA 2B7PA 2XH2A 5CPSA 3B3DA 3M0ZA 4RLIA 5D4YA 1UP2A 4TVUA 4Q3MA 2Y8UA 3VGDA 2ZTKA 4CCDA 3TQKA 2IQ0A 4HHPA 2X99A 4MFDA 4GJIA 4M81A 4PBGA 2V38A 4PL1A 3RO6A 3FLUA 1QTWA 2WANA 4AZHA 3MUCA 1AL7A 4GD0A 4IP5A 4O4VA 4FIQA 5F2MA 1J0ZA 4QFUA 1VKFA 1LL4A 4PEEA 3PFRA 3MT1A 3PBUA 1UHVA 3N15A 5RUBA 2F9RA 1WDDA 4J1OA 1IEXA 4MPKA 3AMKA 1S5TA 4FLSA 3EPOA 3TN3A 3H8AA 1GJUA 1E56A 4UTFA 4AH7A 5JUVA 2A8XA 3CQJA 4AX6A 1S39A 1I2RA 1E0VA 1M41A 3ANYA 4NHVA 2NT0A 1DHPA 4F9DA 2CFYA 4AIEA 4JTRA 3V36A 2CLFA 1XPYA 2XZ9A 2OXNA 4WGHA 5FI8A 5FA5A 1A5SA 5M17A 3AMDA 4N0RA 4Q6XA 3EKGA 2YR1A 3QXBA 1JDAA 2QDGA 3QV6A 3ARWA 1ICSA 1CGTA 3JR2A 3HGSA 2HBXA 3BGGA 3W38A 1FWJC 4O0ZA 4JQ2A 3DHUA 2ACRA 2GVLA 1MXSA 3DFHA 4GIEA 4X0NA 1OFQA 1U1UA 2OEKA 4ICMA 4E4PA 5CC3A 3BH4A 3CZLA 3CLWA 1ZS2A 4AG0A 5LHFA 1GZGA 5HMDA 2OJPA 3TA9A 3UWWA 2ABBA 3T8LA 1TJ0A 3I3EA 2QT3A 4F4RA 1PXGA 4KKXA 4XG1A 5EPDA 4HPXA 1KCLA 1XG3A 4B5SA 3OA5A 4X61A 4Z17A 4WJXA 1BGGA 1QBBA 1DJZA 1BWKA 3SEPA 3GHTA 1LWHA 2Q3OA 2XJ7A 4BI7A 2W62A 4GACA 1IEWA 3VINA 4H9ZA 3RPMA 3IGXA 1AD4A 1EBDA 3FGCB 5FJOA 3UJFA 1A0CA 2QCDA 2QUVA 1NQKA 1D7FA 1SFLA 1UWAA 3OU8A 5KZEA 4X3ZA 4H9XA 4LBRA 3G8RA 3LCIA 3IEBA 3UXAA 1GQLA 1AW5A 3MV01 2BHUA 3MMUA 3O0HA 4WDXA 3GC4A 2IXUA 2VO5A 2VZSA 2PDUA 3T8QA 2WLYA 5FCZA 3LQLA 3AMZA 2EG8A 3ITYA 1KGUA 2OVLA 3C2EA 3KS5A 2PBOA 3LS9A 1ISXA 1F05A 4S3KA 2V6AA 4A05A 4M82A 2VZUA 2GH5A 1XLHA 5A6BD 5MKGB 1V02A 4ZFCA 4XZNX 5AKQA 1RH9A 1TUXA 4OUEA 4X9SA 4YNGA 3VZZA 3HJEA 5HUOA 3HBLA 3TQVA 4ZCWA 3EPNA 1GHRA 4AZIA 4KWWA 2CLKA 1H7RA 5CJNA 2NLIA 2FIQA 2EO7A 5BU6A 2OSWA 2V67A 3C86A 4LS2A 1V0NA 2ISWA 1XSJA 3R1ZA 4NXSA 4WZHA 5CJMA 2VX4A 2ZUMA 2VT0A 1EBHA 4HK5A 4C90A 2L5HA 3T0BA 1GRTA 4WUIA 4LAMA 3ZQ9A 4MPQA 1JYVA 3SGUA 4CKQA 5GNXA 2WVUA 1DIKA 1Q6EA 4OV4A 3AUOA 3VMNA 2V63A 3HG4A 1EF3A 4CD6A 4DLFA 1UOZA 1MUMA 5K4ZA 4RXFA 2YBVA 1DV7A 3FJLA 3QC0A 1DJHA 4ZVJA 2P88A 3W4RA 1FWHC 3THDA 4P7LA 3QY8A 1N82A 2VM8A 5CSYA 5U7SA 4QJ4B 3TDFA 3LCLA 1B30A 3WF0A 1WOBA 4JN7A 1ZPTA 5CGMA 1VLWA 2YA0A 3E5BA 3LMZA 1G6CA 3DEQA 4RR4A 1VEMA 4U2ZA 3TMQA 3PZGA 2H9AA 3OW1A 2X1RA 1E15A 2G3MA 4ZO7A 2NWSA 4H19A 1V6UA 4HNVA 5DBTA 1R46A 1XYBA 1E0WA 3WDJA 3UY8A 1G4EA 2XH0A 4HU0A 1R38A 1UW9A 2PZ0A 4RDYA 4CNUA 4O17A 3NO3A 3B03A 1DXEA 1FHUA 2QXWA 2TPRA 3GX9A 1VYSX 1I2OA 4UNLA 4GE8A 2CZFA 3QC3A 4YVXA 4Z2JA 4ZTYA 4DNMA 3W2UA 3MKKA 3I10A 4NT0A 1HF6A 4O1AA 4E3TA 1XIHA 1KRAC 2ZVIA 2CLHA 4HMEA 3NJ3A 1K03A 2ISDA 2O4QA 1IGSA 4GYPC 1KCKA 2I9UA 2XWEA 4N2YA 3UQNA 3M5YA 1UIPA 1EPVA 5I7GA 3VTRA 1XF0A 3WH9A 3U8GA 2DT3A 3USBA 4GK8A 1E1FA 4US6A 2Z00A 1W1YA 1YNQA 1YQ2A 3OG2A 2YXXA 1G1YA 1MXGA 1UIOA 2DORA 3CUXA 2B0MA 6CGTA 2DY3A 1M1BA 3JVAA 4NASA 5T9CE 5IBXC 4ORIA 3QLLA 3THQA 1R5YA 5DCDA 3NXFA 1UROA 5BU9A 4I9AA 3M0HA 1EJXC 1QR7A 3I3BA 4RDWA 1P1XA 2PLKA 3P14A 4I9TA 5B7YA 4INFA 5HWMA 4JTKA 4UXDA 4MJZA 1IWAA 5AHNA 4PH6A 4PMJA 1FCVA 3WX7A 1CXKA 1GG0A 4GCAA 1GORA 1WX0A 1TYTA 1X39A 1A5MC 3W00A 2YYUA 4O8RA 2DIJA 3SN4A 3WL1A 3ARRA 4M5PA 1TCDA 3WLRA 4JN8A 2W63A 4C6KA 3CNYA 3LCFA 1GXFA 3O0FA 3CEUA 2R8WA 3BCFA 4HCLA 4WGXA 3QKZA 5IFTA 4YWIA 3M43A 2NQJA 5FS8A 4ZB5A 1P0BA 4QG6A 5CPOA 4GFIA 2PB1A 3NPUA 1M7OA 3A7UA 4WHBA 1QPOA 2CZDA 1G94A 2Z7KA 5KVHA 1ZU8A 1XLEA 2BVYA 3OZOA 3SIMA 1GREA 1CGVA 1MQRA 1OX5A 4H1ZA 1ZJIA 1C9DA 1U1HA 3UERA 1TPFA 3L65A 1ZBVA 1P4CA 1PIGA 2FVMA 4H4TA 2YA2A 1CW2A 3PZUA 3FCPA 4MG4A 3TIMA 4JIPA 3PHAA 3W7LA 1VJSA 2CLOA 3PAJA 4GZ7A 3QFBA 3BAJA 3MI2A 1WBJA 2IPJA 2V3EA 3R2GA 4HK7A 2XM2A 4XIAA 1X6LA 1KBKA 2DIKA 3TV8A 4QS5A 3CT2A 1MEHA 3WFLA 5AC4A 4XO7A 1T7LA 4US5D 3IUIA 4WY0A 1WP6A 3G0XA 1TMLA 3KBJA 1ZCOA 4HTBA 4CGTA 4GI8A 3R8GA 5EY5A 4NI3A 2YYTA 3UPBA 4Q7BA 1C90A 4YVPA 4D8AA 1NDWA 1GVRA 4DYJA 4ES4A 1H0GA 2SFPA 1QHZA 3MPGA 3BW2A 3GNPA 1R85A 1FDZA 4XIMA 4RJEA 3NVYB 1OSEA 3L5OA 2PAJA 2Z28A 1JDDA 1F7BA 1QT1A 4LF1A 4J28A 4ZQOA 3MCMA 5JXQA 3PJTA 3LQGA 4C6NA 3SURA 5C7HA 4PN2A 3NZRA 4WDWA 2PZNA 1R47A 2RDXA 2BCPA 1WUEA 2W79A 5CGQA 3VK5A 2BOEX 4O1DA 4OJYA 1HZYA 1KM3A 3BC9A 3F5KA 3V3WA 2PWEA 2QDDA 3ECQA 1R7AA 1J2WA 2CITA 2QCCA 4GVGA 2GJXB 3PG9A 4KRUA 5H8MA 4KWSA 2C1HA 3O6AA 3RX4A 4LS0A 3P61A 3B0YA 3NQCA 4FI4A 1LUCA 3QGAC 3W2NA 3ZVHB 4BI5A 1BWCA 3LZ5A 1G4TA 4QTGA 1Q5MA 1ZAJA 3NR0A 4FA3A 3GFXA 3G1DA 4ZE4A 3KZPA 4CU8A 4DWDA 3O3RA 1V97A 3G1XA 3UCCA 4ACZA 4GA8A 3UWUA 2FQIA 1DXLA 2VWSA 3BAIA 3T2OA 5LXXA 5B80A 5DXXA 1HKMA 4KH2A 3HRDC 5CC5A 1UBSA 1H7WA 3UZWA 4H00A 1B9ZA 4DELA 1JDFA 3LADA 4LS1A 4PB3A 2PWHA 2AMXA 3MJYA 1BLIA 2WOWA 4GNJA 4KIEA 1UOKA 2YSWA 3S46A 4DB7A 3BLEA 3UXLA 1UA7A 1F3XA 2QDEA 1VFOA 4I8YA 4ZB2A 1B31A 2WOVA 3U6WA 2G95A 3OOQA 2WZTA 3WQVA 2Q6ZA 3SIZA 2G0WA 2HNHA 4BURA 3HV9A 4O10A 3PPFA 4BWLA 4MNJA 5I3GA 3F5LA 2ZX7A 1DTUA 2RGMA 3MZNA 4M29A 3W02A 1W9UA 2PF8A 2G3NA 3EDEA 3EF6A 1S3HA 4MGGA 2XFWA 4DJDC 2HRWA 2RHGA 1SU5A 3HTWA 5L9FA 4MOZA 2WVVA 4LX4A 3WDIA 5F2LA 3W7OA 4MB1A 1W9BM 2WM1A 3VA8A 3MDUA 4L1GA 2YL8A 4UTJA 3EMZA 2DU2A 2DUAA 5DMLA 1LQ0A 4O53A 2REQB 8TIMA 3WBEA 2E7FA 5I3DA 2PWGA 4MLJA 3LI1A 4DX3A 4C6IA 2EQ7A 3MSYA 2HS8A 2R91A 2XZ7A 4OGZA 5BXRA 2E3TA 4FP1A 1TJRA 1UWRA 4QAWA 3GVWA 5IFPA 4GI6A 3URNA 1YIXA 5CEWA 2YGYA 2P5NA 3NDZA 4AY7A 4UCFA 2QMKA 4Y9NA 1QDSA 2NVDA 3UWEA 1C3FA 1OGSA 1R9ZA 1E0UA 3UD6A 4QRNA 5M3WA 3SCTA 5A6LA 4H4XA 1UPPA 4MIMA 2ZQ0A 5JCNA 5LGZA 1G7UA 3CASA 1Q66A 4KRZA 5IOBA 4DAFA 2YBTA 1H51A 4XBJA 3GW3A 4M6VA 5D33A 1Y7VA 3T44A 3CHVA 1DYSA 1K9TA 2C19A 3BOFA 3TEVA 4MNMA 1GVSA 1FHLA 3N11A 5DT7A 2YDSA 1GOXA 1PHQA 2O9PA 4LT9A 1ZTVA 2Z2AA 2J24A 3NQDA 2A5HA 4OQVA 3UJRA 1UD5A 5D9NA 1ADSA 2EJ1A 2BGQA 2J77A 3W1NA 2H9AB 5BMWA 4M1BA 1LYXA 3NQ2A 2A0NA 2Y88A 4PRWA 3BZJA 3RO8A 4GX8A 2ZXBA 1OQFA 2I5IA 3QGKC 3NEVA 2ZZ7A 3I68A 2JALA 2VI0A 3QN3A 4IH3A 3MW7A 3DG6A 3M7SA 1UJPA 2YW3A 5DRCA 3NQVA 4RKAA 1DWIM 3AIBA 1CTNA 2XTKA 4IP4A 4S3GA 2GUUA 2X40A 5CBBA 2FTPA 5JBDA 1UP3A 3H2CA 2XIBA 1MFUA 4IFRA 1NHPA 3VCRA 4FXFA 4AY1A 3STGA 4FLRA 2ZUVA 4HYWA 1EC7A 1OHLA 2O9TA 2AAAA 3N9RA 1X1ZA 2Q3RA 3R8HA 4YL2A 1OVDA 2CEQA 3HN3A 1PVNA 1K9DA 5FAJA 1NELA 4M7TA 1GONA 3S2NA 1I8JA 2BSLA 2XFRA 5CJ5A 4LV9A 1VFUA 2C79A 3S83A 3HU7A 1QK2A 2PTZA 3QF0A 4OKDA 5T91A 4P7RA 2A1YA 4PA8A 1QRQA 5CC6A 2PI6A 3LBMA 4OBSA 4O4WA 1SO5A 3S3GA 3B0XA 2RDTA 3IACA 5KZDA 4W89A 2WPCA 5CZSA 2FTWA 1TIWA 4EP8C 1O5XA 2YLLA 2GGGA 2HSAA 4WDTA 1XPGA 5TIMA 1EXBA 4E4FA 2NPXA 5E09A 3H12A 4JGDA 2W0UA 3L66A 4JHZA 4UFIA 1OFBA 3RXZA 4IMDA 2ZA2A 2PLMA 4JTSA 3VZXA 2A3BA 4UQAA 4L9ZA 4JFUA 3GE7A 3F4NA 2G3JA 4QLKA 3OJGA 1R9XA 2JQXA 1OT1A 4H8NA 2BP1A 4RZ4A 5I00A 1E0XA 3K4WA 5AZ1A 2QPXA 1XIFA 2CLLA 1ELSA 1GV4A 3MSDA 1VPXA 1ITCA 5U1OA 4MSSA 3SN1A 3WDQA 1C29A 5ECVA 2OX4A 3CPRA 4IMFA 3WNOA 4DBUA 1EKOA 4ZO8A 4B4FA 4R34A 3RMJA 4D6EA 3SR6B 4Z08A 3TSBA 4FX6M 4W5ZA 1RVGA 4IGNA 4FR6A 8XIAA 3MANA 1W3NA 1LOLA 2PWUA 3KM8A 3LHZA 5CPMA 3NM3A 5FS6A 5AC7A 5KMYA 2OGJA 2J7FA 3G1HA 4K1WA 3RILA 3P0XA 3HPZA 2YKKA 3FJNA 4R9OA 2C3ZA 2Z26A 4GVHA 5FOOA 4Q8OA 4EWJA 1KWGA 3VIMA 2ALDA 1U22A 1ZBKA 3B05A