4IT1A

Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
426
structure length
426
Chain Sequence
QSMKITRVTVTPIAFRDPPLLNASGIHEPFALRSIIEIESDNGYIGLGESYGDAPALAIQQQVQSQLIGLDPFNLNQLRRIVQTTVAAHKPASLAGAELAPGSHASKAVSNAYSAFEVAFLDLQARYLNVPLVDLLGGAVRDEVPFSAYLFFKYAQHVDSPYKPDNWGEALNEQQIVAQAARMIEAYGFKSIKLKAGTLPPEHEVACIKALKKAFPGYPLRIDPNGNWSLETSIRMAELLGDDLQYYEDPTPGLEGMAELHKRTGLPLATNMVVTDFDEFRRSVAQNSVQIVLADHHYWGGLRDTQTLAKMCDTFGLGVSMHSNSHLGISLMAMAHVAAAVPNLDYACDTHYPWQEPDEEVIKGGKLPIVDGCVKITRAPGLGLELDHDQLGKLHDQYLTCGIRQRDDVRQMQRYKPDWKALKPRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glucarate dehydratase
publication title Crystal Structure of Enolase Pfl01_3283 from Pseudomonas Fluorescens
rcsb
source organism Pseudomonas fluorescens
molecule tags Isomerase
total genus 149
structure length 426
sequence length 426
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4it1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4it1A01
1MDRA 2AL2B 4GIRA 4KPLA 3H12A 3MQTA 4IT1A 3UJSA 4X2PA 3TQPA 4IL2A 2XGZA 1XS2A 4KWSA 4GISA 2GGEA 1KCZA 2XH4A 4FI4A 3P0WA 3ZVIA 3DG7A 4K2SA 2OG9A 3PFRA 3DEQA 1EBGA 3N6JA 4A3RA 3SN4A 2GDQA 3R11A 2GGIA 4M0XA 4Z17A 2PPGA 1TZZA 2GSHA 4G8TA 4HN8A 3ES7A 3NZGA 4H83A 3RO6A 3VDGA 2QJNA 5BOFA 3OTRA 1TKKA 5BOEA 1SJBA 3SN1A 3TWBA 4HCDA 3PK7A 2O56A 4HCLA 3H7VA 3MUCA 2QQ6A 3ZVHA 1MNSA 2PTYA 2QVHA 3UGVA 2PTZA 3MSYA 3QKEA 4GGHA 2PP1A 3UCDA 1R6WA 3BOXA 3VFCA 4E4UA 2QJMA 4J3ZA 1JPMA 1E9IA 4F4RA 3VA8A 2OPJA 3THUA 2QDEA 4E6MA 4E4FA 3I4KA 3ES8A 3V4BA 4DYEA 3S5SA 3V3WA 2AL2A 2OZTA 3H8AA 1WUEA 3MZNA 3DERA 2AKMA 2HNEA 3GD6A 3UXLA 2I5QA 2GGGA 2XH7A 1KKRA 5IDZA 3FV9A 4FP1A 2P8BA 3CK5A 4A35A 3DG6A 2XH2A 5FJRA 3VC5A 4IP4A 3EEZA 3NO1A 1BKHA 6ENLA 1P48A 3MKCA 3PWIA 2DW7A 3STPA 2GGJA 2OLAA 3VC6A 3UJRA 4YWSA 3QPEA 3MY9A 1YEYA 3CB3A 3TOYA 4GFIA 7ENLA 2GGHA 3GC2A 4IHCA 3JVAA 1NELA 5FJPA 3D47A 2QJJA 2P3ZA 2CHRA 3ENLA 3B97A 3DDMA 3FCPA 2PU0A 2PP3A 3T9PA 3RITA 1FHUA 3FYYA 4ENLA 3KUMA 1KD0A 5J04A 4K8GA 1SJCA 3U4FA 3QLDA 1PDYA 3DIPA 3OPSA 3IJLA 3ZLHA 3T6CA 3HPFA 1W6TA 5FJUA 3NXLA 5FJOA 3RRAA 2ZC8A 2PMQA 3Q45A 3TW9A 3QTPA 1NU5A 4GYPC 1L8PA 1MRAA 3V5FA 2PA6A 3CXOA 2P0IA 4A6GA 2PODA 1TE6A 2MUCA 2AL1A 1R0MA 3PWGA 3FJ4A 2QGYA 3MWCA 1KKOA 2MNRA 3QN3A 3TJ4A 2OX4A 3GY1A 2NQLA 3JW7A 4JHMA 4EWJA 3CAWA 2PP0A 3SBFA 4Z1YA 4HPNA 1EC8A 3N6HA 2PU1A 4JN7A 1OEPA 1EC9A 1JCTA 2PCEA 3V5CA 4DHGA 4HYRA 3R10A 5ENLA 2P8CA 3ZLGA 3Q4DA 3RR1A 3RCYA 3BJSA 1BQGA 5FJTA 3RGTA 3ZLFA 2PTXA 3K1GA 4MGGA 3D46A 2XSXA 3N4EA 5EU9A 4GGBA 3DFHA 4KT2A 1SJAA 4H19A 3R25A 1WUFA 1F9CA 1MDLA 2RDXA 2OZ8A 4MKSA 3TCSA 4JN8A 3VCCA 3TTEA 4GMEA 4ZCWA 1XPYA 2PSNA 2OVLA 4HCHA 3DGBA 1ECQA 2OQYA 4DN1A 4ROPA 1P43A 2P88A 3FXGA 3UJFA 3UCCA 3DESA 4DXKA 2OO6A 4H1ZA 2FKPA 1PDZA 2OZ3A 2QDDA 4GYPA 3UJ2A 3SJNA 3IJIA 4IL0A 3S47A 3SN0A 3T4WA 3R0KA 2PGWA 2PTWA 3P93A 3OZMA 4J1OA 4K1WA 3T8QA 3P3BA 4H2HA 4DWDA 3GO2A 2HZGA 1SJDA 3OW1A 2OFJA 2DW6A 2GL5A 4ZA0A 4MMWA 2FYMA 1ELSA 3I6TA 2PGEA 4E5TA 4DX3A 1ONEA 3UJEA 2OQHA 1MUCA 3EKGA 3H70A 1IYXA 2POZA 3U9IA 2ZADA 3SSZA 3VCNA 4E8GA 3SQSA 2PS2A 2AKZA 4HNLA 4IP5A 1DTNA 3I6EA 3R1ZA 3ZVHB 2HXTA 1RVKA 3CYJA 3IK4A 3TWAA 4HNCA 3BSMA 3CT2A 3OP2A 3UXKA 3JZUA 2ONEA 3IJQA 3FVDA 3TJIA 3DG3A 2OKTA 4M6UA 3R0UA 1JPDX 1EBHA 4G7FA 4IZGA 1FHVA 1EC7A 2HXUA 3OZYA 3DFYA 3NFUA 3N4FA 2XH0A 1JDFA 4KEMA
chains in the Genus database with same CATH superfamily
4LALA 5DELA 3V0TA 1VEMA 3VD4A 4AX7A 3B8IA 4M7SA 1NHQA 1I4NA 3EYPA 3GBEA 3WJZA 5A8OA 2OU4A 1J2WA 3UG8A 5HULA 4KEVA 2YVGA 2EG7A 4TVWA 4FO4A 4LUJA 3DFNA 1GEHA 3UYCA 1RM6B 4KBXA 4KRUA 1Q8JA 1L6YA 4JL2A 1YXDA 2CBUA 3TFCA 4H4TA 4IGSA 2GSHA 3WLQA 1RY0A 3CUZA 3L65A 3ES7A 1ONFA 1KBKA 1RD5A 1UMYA 3WF1A 4G1NA 3LQGA 3II4A 4APNA 1ADOA 3W00A 4LFYA 2PZ0A 1DE6A 1SJBA 4MNKA 3F4CA 4M1BA 1DOSA 3KXQA 3CMFA 4GY0A 4ZXLA 4WDXA 1V97A 1QHPA 1SFLA 4PBGA 2REQB 3KTSA 1GKQA 4XQ6A 4I9JA 2ACQA 2Z2BA 1O68A 2ZRUA 4HOXA 3W2MA 4JY8A 3U4AA 1ONRA 2J66A 4BWLA 1GEUA 3CTTA 1TRIA 2OPJA 2QCMA 4RNHA 5I3IA 2QDEA 4RE4A 4E4FA 2AL2A 1XYLA 4BY3A 1EF2A 2V67A 4ZB5A 3AU6A 2AGTA 1JIBA 1I0DA 4H3DA 4M19A 4AEFA 4Q6XA 4F66A 1E5JA 1UBSA 1CECA 2A3LA 1EWDA 5IDZA 1PE1A 4MPKA 1HXJA 1TTIA 3UZYA 1BGGA 1CB2A 2RABA 3E0IA 3FJ6A 1A47A 3OLEA 3AM9A 4F2TA 4CQ8A 2VEPA 2BDQA 3MO4A 5AHFA 1EL3A 1BF6A 1J4EA 3GE7A 1TJ0A 3STPA 2JBMA 4JTCA 2C0HA 3EOOA 3DHPA 1B5TA 4C6LA 1XH1A 2C0AA 2Y7GA 3DBNA 4KEUA 4OKDA 7ENLA 1LWHA 3ATYA 2ZIDA 2FLIA 1KBLA 4XVDA 3U8GA 4M3PA 4ONVA 3UQNA 2VZSA 5K4XA 5A6LA 1VAHA 3VYLA 1CGYA 1GVQA 2D0FA 3MCOA 4M56A 1P0DA 3RLUA 1QNOA 3NQAA 4MFDA 1KFBA 1XLIA 2CITA 3WBEA 4MNLA 4BR1A 4C6KA 1Q63A 2E5CA 4UR9A 3LUTA 3AAMA 2VT0A 4PFMA 4RZBA 3USZA 3U5UA 3NPWA 2XZ7A 1W5OA 1GYMA 2OZ0A 4FPSA 2XDFA 3B8SA 4LBUA 2PDQA 1JF6A 1OG0A 3AHYA 1UD5A 3KHDA 2AL1A 4U5IA 3EDEA 1EF3A 3EOUA 4LIIA 2QUUA 3IIXA 1OGSA 3GC4A 4S3BA 1BYBA 4FNTA 3O63A 3AYRA 3B0UX 2GOKA 4WUIA 1DIOA 3VM5A 2YBUA 2HISA 4PMNA 1BYAA 3VGFA 1ZJHA 1EKOA 4GKTA 1Q1RA 3FSTA 3HO8A 4CKQA 2XFYA 1QI4A 2PU1A 4GRTA 2Q6ZA 2NPXA 2PWUA 3M6DA 3NL2A 1AH0A 3DN5A 1BVWA 5LA1A 4C6EA 5BWAA 4NZFA 3LHUA 3ZLGA 2HRWA 3NYDA 3LXDA 3SZ8A 3BJSA 2JKAA 2V6AA 2DQXA 1XANA 1UD8A 3WZ0E 3ZFHA 2XFFA 2GUYA 3KVJA 3UPWA 4EXAA 1EJTC 3L4ZA 4L7ZA 1I60A 3P67A 1MQPA 1QI3A 4GUHA 1G67A 1GYNA 3QGKC 2WB5A 1TA3A 3GTNA 2OVLA 7TIMA 3O07A 4O1CA 3TSDA 3NEVA 1TCMA 3EDFA 1FECA 1K9EA 1JXJA 1RQHA 2KAUC 3F5LA 3IVUA 4IJRA 2ZZ2A 4L4LA 2R9ZA 1D9EA 2Z29A 2NXGA 3QV6A 2H9AB 2OWCA 3W7KA 2WPBA 3LRMA 1S5TA 4KRZA 3SM0A 3UYIA 3KLKA 1UWAA 3QC0A 3LB0A 3CL7A 4ADWA 1ZCCA 1TMHA 3TE9A 3NEHA 5DMNA 1TQJA 2ABAA 4KF1A 2DDXA 4K1WA 5B7ZA 4W5UA 1JCMP 5DF0A 5HMEA 1G9HA 1EFZA 4GRSA 3VNDA 1W1TA 3AN1A 2OEMA 1NJJA 3QYQA 1ZY8A 4H9TA 2QR6A 2VC9A 1OSEA 1ZQ5A 3ICJA 3S2MA 1E3XA 4HNUA 2OELA 4BI7A 2J79A 2B0MA 2VWTA 3BZGA 3EKGA 5CC3A 3EA3A 4E8GA 1QW7A 1H63A 5FA5A 3KCOA 5RUBA 3NQ7A 2WZEA 2EF9A 5A8QA 5ABFA 1DTNA 1DBTA 1XLDA 2RDUA 4ROQA 1G1YA 4XIMA 2TPRA 4FXFA 3B8VA 1KA9F 3BW3A 4LWWA 1NFPA 1HJSA 3SECA 3MJYA 2CLMA 4K37A 3FVDA 3V18A 1JPHA 3C2RA 2VC5A 1E0VA 3ONBA 5JIPA 1YE4A 2EGZA 3MSDA 4KERA 1P5BA 2A79A 3KP0A 3VOIA 1IEVA 4JYFA 1E0UA 2DIKA 1JOAA 4GH3A 2DU2A 1BEUA 2QCLA 3KTCA 3FYOA 1QK0A 3MQTA 1DJXA 1CNVA 3TQPA 3W71A 4W84A 4HJWA 2VGBA 5CPNA 1WQ5A 2Y85A 1NY1A 3H6OA 4KWSA 3M0KA 3PP7A 4QS6A 3AMKA 3C3NA 1ZAJA 4ZE4A 4LUYA 4PUWA 4TO8A 4I6VA 1Q6QA 3QC3A 3TP4A 5C71A 1QCWA 4Q4SA 3BLKA 4GI9A 3ONCA 1KM4A 4M0XA 2WMIA 1ADSA 2X41A 1OVDA 1TJPA 1BTCA 3W82A 4JN6A 4Y96A 4HMNA 4WSJA 1QPOA 4AF0B 1JZ7A 1XUZA 2A21A 4M5PA 3MI6A 2QJNA 5BOFA 4O12A 2X2GA 4OOUA 5G1TA 2FJKA 2GR3A 4GXWA 3MB9A 1PTDA 1FWAC 1VF8A 2EPMX 4UTIA 5A6MA 4PE8A 5HNNA 1FWRA 1RPKA 2I9EA 4JDBA 1US3A 1XYFA 1ZK7A 3LM7A 1PWLA 2O0TA 2ZX9A 6TIMA 4EQXA 3BMVA 1H2JA 1TUFA 4QLKA 4W8AA 1R46A 4RKAA 4XAYA 3AUOA 1E9IA 2O9RA 1ISXA 4FLSA 3ANVA 3GM8A 1S1PA 1V5XA 1GHSA 1MW3A 2R9RA 3QOMA 3NURA 2B7PA 5C7HA 1YADA 3U2ZA 3MZNA 3VABA 3VZXA 3TYEA 2ZZ6A 2J7FA 2WVVB 1CI1A 3PUEA 1FHLA 2QDGA 2WBKA 3V0SA 4ZE5A 3CQJA 3MVIA 4MY1A 1PZ2A 3CK5A 3PZVA 2ZTJA 4IMDA 3WNMA 2DH2A 2CZVA 2L5HA 3M5XA 1J8VA 1XRVA 4LA1A 5G5GB 2DZTA 2NV1A 2Q01A 1XJBA 3PWIA 1BWLA 3K8KA 3VC6A 4O18A 4B3KA 4GJJA 2W92A 4Q8VA 4YWSA 1ZB5A 3NQ2A 3WO8A 4ML9A 5BNKA 1W5PA 3CIVA 1GZJA 1KFJA 2OQLA 3WDJA 3LQLA 2PRHA 4GQQA 3TYZA 2VOMA 2TRSA 3MCMA 4FX9A 5HNRA 3C52A 3FCPA 3G0XA 4KEZA 1SMDA 2DPEA 3VIFA 4B90A 2O55A 3O0KA 1MQRA 4ENLA 4O4WA 3BZJA 2FMNA 1DHPA 1EOKA 1VYPX 4C6PA 2BVYA 3F2CA 3AIVA 3LCWA 1RCOB 1DXIA 1BVNP 4DBUA 4TVYA 3RRAA 2VMFA 5HAOA 3Q45A 5D09A 1QPKA 2DFAA 1NU5A 2BZNA 4ZENA 4ZFMA 4PA8A 2Z26A 1GVIA 3DFQA 3KVKA 3AZTA 1NH6A 3A5VA 5AHIA 3W7OA 2ZBTA 4YHGA 2BVTA 2PDMA 2IKIA 3SRFA 2QUNA 2V3GA 4PBEA 5TIMA 1H4PA 1V0KA 4HPJA 1JG9A 3SCSA 3FJ4A 1TPVA 4X2RA 5JXQA 5AHMA 4J3TA 1P1XA 3RXZA 4AWUA 4LRTA 1FDYA 5AYZA 1W9UA 4IFOA 5D2XA 1H5VA 3FGCB 5B7YA 4H6RA 2WO5A 4N9CA 3T4CA 3CZ8A 4LY4A 1UD4A 2WSYA 1AW2A 3N6HA 5M2FX 4IG2B 1KV8A 4AY8A 4N9EA 2VD9A 2QMKA 2XJ7A 1QPRA 3ITOA 4LUTA 3W4RA 4DBWA 1X6UA 3IEBA 4O52A 3ZR6A 4FXRA 3MKKA 4MGGA 2ZXQA 2E8YA 3AQUA 3CHCA 1WDRA 2VDIA 1SJAA 5BXTA 1CCWB 5D2VA 1F9CA 5I09A 3GIQA 3L66A 2VJXA 4RW5A 4GPNA 3VIJA 1PHWA 2D73A 4JTEA 1JVNA 4Y7EA 3F2DA 3CUJA 3UFYA 1WZAA 4A2SA 4F9DA 4GD0A 1HGYA 5E0CA 1DWHM 4I8YA 2FZ8A 3N25A 1AZ2A 4A3UA 3BXWA 4S3CA 1EJVC 2WWDA 4LJ3A 4GXPA 3UJ2A 1MW0A 2J47A 1TPC1 1QWGA 3R0DA 4HTBA 4N0RA 4HKPA 1W9XA 4DM1A 4MB4A 1NQKA 4HTYA 1RY8A 1OG6A 3L21A 1BGAA 4GUIA 3U57A 2X40A 2YX0A 3TYAA 1JD7A 2YL6A 3VIGA 2QIWA 3AXHA 3S1XA 5AHEA 3A4WA 4BQ4A 3FG2P 1SJDA 1VJSA 3OHIA 1KFKA 3GK0A 1LF1A 4C1NB 1K70A 2FPYA 3PZQA 5FKYA 3VDCA 3OYXA 3W2KA 4P7NA 1VYRA 4O8RA 4M6PA 1JQVA 2C8NA 3WQWA 1PIIA 2D3LA 1D8WA 2DIEA 1FWJC 1H2IA 4NI8A 4UCGA 1B2YA 1NP0A 4XAZA 4K36A 4CN4A 3ITYA 3ITCA 1GQKA 3I6EA 3R1ZA 3ZVHB 4DJDC 5CC6A 2PGRA 1GTHA 3E12A 1VP5A 2YOCA 4OUIA 1XSJA 1FTXA 1KW1A 1S5WA 1F3XA 3NQ8A 1TR9A 4FB7A 1N63C 3Q58A 4G7FA 3T1GA 4UTTA 4XO7A 2HXUA 4Q7BA 1JDFA 3GVVA 1I75A 5B80A 3AMZA 4QG9A 1OINA 2OWWA 3RHGA 2IXVA 2JK2A 2VENA 4WY0F 5LNWA 1RJQA 4C6FA 3BOFA 1XLJA 2OO0A 5LIXX 4GE8A 4GOAA 2YCLA 5D04C 4DXVA 5D38A 1QAPA 2XVPA 1L6GA 1AQHA 1LROA 1DJZA 1ICPA 1KCZA 1XSIA 5E9AA 3ALFA 3DU0A 1O66A 5D30A 5L9FA 1OFAA 3HPSA 4AFYA 3PTQA 3QQ1A 1FDJA 4PYSA 1V6YA 3H24A 4HNNA 3V75A 3HFTA 2R82A 1GOOA 5KZMA 5IM51 1FEBA 4Q8NA 3ZIZA 1OFEA 4E2DA 4FA3A 4KCVA 3VUPA 2VCBA 4H8HA 4JTSA 4EP8C 2WNQA 1CLKA 3HOJA 3W7RA 4KFNA 8TIMA 3GDBA 4FOUA 1QNVA 1JD9A 3UETA 2OSWA 1K6WA 4YL2A 2AOSA 1OIMA 3MC5A 2QCGA 2YL5A 1ZBKA 4NEVA 1T8XA 1S2UA 2PWFA 3DGZA 5FI8A 1BHGA 2E1WA 3LOTA 1A50A 4D6DA 4AEEA 1JPMA 2D23A 3THAA 3O15A 1FWSA 1C9DA 3THQA 4GZEA 3WYZA 1T40A 4B5NA 3AU2A 3WD3A 4YTRA 5D33A 5HMDA 3W76A 1E9ZB 2CLIA 5CJNA 2HNEA 2J8GA 1G6CA 4M8UA 2X7VA 2ZZ0A 2C16A 3WBWA 3W6LA 2GGGA 4MKVA 4AD1A 1LTDA 1R3TA 4XD3A 4AEOA 1M01A 2ABBA 4HSHA 4DI8A 1Q45A 2QYGA 1CXIA 2I56A 1R7OA 5EA9A 1BF2A 3VC5A 1TQXA 4QTGA 4XX6A 4PTDA 1TMLA 3T0AA 1XQLA 4LVDA 5A2AA 4K7ZA 1GVSA 1JULA 3QH2A 4EF9A 4DQWA 3C2FA 2V0TA 2TODA 1VFOA 2XVNA 4J27A 3I3DA 1IEIA 4H7CA 4OE7A 4EX4A 4ZQPA 2X1RA 2QAFA 3GVRA 1YPXA 2E40A 3MMUA 5F2LA 2ADAA 3SY1A 3GDLA 4ZBCA 4GFSA 1QO5A 3UVIA 1Q65A 1Q7QA 4OECA 5HMFA 3SGUA 4CQ9A 4IJCA 4HHLA 3ERPA 3LPFA 4Q3MA 1E0WA 5C8BB 4NNCA 2V2DA 5JCKA 2GR0A 3B9AA 1E1EA 3EWYA 2JKEA 5LIYX 3BDKA 4R88A 1VFMA 4Z2LA 4UQAA 3ELFA 3SW6A 1JZ5A 1ESWA 1S2CA 5DXYA 2Z7GA 3AFBA 1Y0EA 1ME7A 2ZX6A 4E4PA 2A6LA 1EHAA 4AISA 1AJ0A 1HKIA 5JCMA 3TOPA 3PPFA 1AW1A 4AD3A 2VFDA 5EMYA 4P7LA 1R7AA 3GU2A 4ZQMA 4UQ9A 5A8PA 4DWSB 3DKJA 1UKQA 1TE6A 1HW6A 3NSXA 5D02A 3O6AA 3LGEA 3VILA 5LXEA 3V1PA 7XIMA 2G8ZA 1PKNA 4RLIA 3A3XA 1UUQA 3TJ4A 4WY0A 1EJRC 4MWAD 4NNAA 1DWIM 1W17A 1MO0A 3CL8A 1FXPA 1GVFA 3CHFA 3O16A 1MI3A 2W67A 4HZMA 1KM3A 3NTYA 5A5WA 4HPNA 5JVLA 1PV8A 4GJ1A 3RPDA 1UROA 3OA5A 1LUCA 2Y4SA 4FHAA 3MVTA 1YXCA 2DUXA 2DIJA 2ON3A 5PTDA 3CM4A 3IS4A 3TQKA 1ZXIC 1ZJAA 3BWWA 1B1YA 4LW7A 1GQNA 5HPCA 2ATSA 3FAWA 4HP5A 5H8UA 3FJLA 5C55A 3N4EA 3FY1A 5MKGA 2V5CA 1ZTVA 2VUYA 1DTUA 3R25A 5BCAA 4PTXA 4C1KA 1MDLA 2CLLA 2BBFA 3D3AA 1AK5A 4FEZA 5AC5A 2WMJA 3ZSSA 1EZ2A 5K9CA 1S46A 4HJFA 4Z0JA 4HVXA 4YU1A 2PDNA 2X30A 3GH4A 1MOKA 3TU9A 3N2BA 3VX1A 3GXNA 5FD0A 3LCIA 5IHRA 1NHPA 1SB3B 2CXEA 1IGWA 2YXOA 1EBDA 2BY0A 1JNDA 1OFRA 1PKMA 5J5RA 4KWUA 2C1GA 2PGWA 2E6FA 1MSSA 3WLKX 2J6VA 3IVTA 3RLVA 2P10A 3KBVA 1V59A 3LG3A 2YVFA 3PB2A 3UR7A 2VHLA 3IUIA 2YB1A 3ARVA 3KVLA 4RDZA 3SCNA 3EKZA 1B4KA 1TPWA 4IM4A 5ECVA 2X0HA 4ZXOA 1DJIA 3DH7A 1H60A 1EX1A 4FZIA 1Q7ZA 4BI5A 4DELA 3I68A 1K4HA 1DWJM 1Q8AA 3KDOA 1NSJA 4Z0SA 3BW2A 2WZMA 4DYKA 1CX9A 1GOXA 5JIWA 3DFOA 3TQ0A 3RM9A 4C7FA 4R7WA 1R5YA 4GO8A 1PAMA 4R33A 1Q2SA 2X1IA 3C8FA 6REQA 3C2OA 1MQQA 3TJIA 4HA0A 3H23A 1NDWA 1A5OC 3ZJ6A 5M17A 1Q2RA 4LGXA 3OZYA 1Y7VA 5JRBA 3ZOAA 1WKYA 2XH0A 1FFVC 3C5QA 1L6FA 3OLIA 1N60C 1OX5A 1TTJA 4AX6A 3EWZA 4HK7A 1JNEA 1HX0A 3DCPA 3LV6A 1CBGA 1DIKA 2VUNA 1XS2A 4ILSA 5DCBA 3D0CA 1VPXA 5F2IA 2GGEA 3T81A 2QJGA 3WDPP 1PX4A 1RAKA 4DZ5A 3W73A 5HQLA 4IIGA 1J9YA 3HMCA 3UXDA 1GTEA 3PBWA 2GQAA 1W1ZA 1TZZA 3CJPA 3BCJA 2Q71A 1UR2A 1H0GA 4X0VA 4RPQA 3S46A 2E77A 2CLOA 4A05A 2CU0A 4U10A 2ISDA 2Y7EA 1H1NA 5EMUA 3CC1A 4ZQOA 2ASHA 4Q6JA 2C19A 1O5XA 1J0KA 2G3NA 2GDVA 4Y9OA 4U33A 4AZCB 3QKEA 3KRZA 5FEWA 2DSUA 5HINA 1R6WA 3E02A 1OK6A 4LB3A 1H7RA 3CAKA 1VBJA 4RPPA 3P14A 1H5YA 3SUWA 1N5WC 4OUEA 3CIWA 3H8AA 1WUEA 2FFCA 5HANA 3BLOA 3IAQA 3O6YX 3U2CA 3UT0A 4HNOA 1MZRA 1F6PA 2PDYA 4XAPA 3P84A 1I2OA 3K46A 5TQLA 3VZZA 3U48A 3UWQA 3C8NA 3CIXA 9XIAA 1WDQA 2DGAA 2DZXA 2A3EA 1M5WA 2XH2A 5FJRA 3TZFA 3IJ8A 5EBUA 4EF8A 4E8DA 4I6KA 4J3XA 3THDA 1P6CA 3GH5A 3T08A 4Y2WA 2D0HA 1CPUA 2GR1A 3LI0A 3LMYA 2WNWA 1ZLPA 2V38A 2W4XA 4NU7A 1VZWA 3RYSA 3Q37A 3A4JA 3HPAA 3NUKA 2O4QA 2OB3A 3LBMA 3B40A 1XLMA 4PZVA 1JDDA 1OABA 3S3GA 2BY1A 4PUJA 5FAGA 3II1A 4PTVA 4MG4A 4Z1DA 2RAGA 5F1VA 2IPFA 4JX6A 3WFZA 1JZ4A 2F2KA 1NQ6A 2X8CA 4N9DA 1GUVA 4O4VA 2IPJA 1CT5A 2NXHA 4D1JA 3T2QA 4CGTA 5A2BA 1R3YA 1RJRA 3SCOA 2QZRA 5AN7A 4YTUA 4EIVA 1W1IE 3LCGA 2ZA3A 2A7NA 1SR0A 3VINA 3TUUA 1IR2A 2C1IA 1Q4WA 4O0QA 4HOZA 3GNPA 4AYGA 1XYMA 3UP8A 1S3TC 4XKYA 2MUCA 4PSRA 3ZZ1A 1DKWA 1Q1WA 3NQ6A 3VI2A 1MZHA 2X0SA 1XIIA 3NCOA 3K13A 3HFYA 4QROA 2EXOA 3L5OA 2HK0A 4TUFA 4WJXA 3TW7A 1IXPA 3CGDA 3HJEA 3NZRA 1L0PA 3BCFA 3GY1A 3DXIA 2QULA 4XV0A 2C91A 4JTIA 4Y8FA 3IJ7A 4GQGA 1UW9A 1DP0A 1Z89A 1TV2A 4ZO8A 4NRSA 4MZ1A 1C7SA 1ZP3A 3VNJA 2X8HA 3VUSA 3GS6A 4H4WA 2D20A 3EX6A 4CCDA 2CDUA 2P5NA 4KWVA 1UA3A 2HEJA 3EDKA 1CB7B 3B4UA 1WKEA 1GEQA 3AISA 3A7RA 4QCEA 4O1FA 4GYFA 4GMEA 2A3CA 3F4DA 3S42A 3W27A 2PWEA 2OQYA 1RA0A 1V3JA 3NOEA 4JFVA 2VZTA 4M82A 2UWFA 3OG3A 4AY7A 3BLIA 1KFLA 1L8NA 2W91A 5C2XA 5JBEA 3ME3A 4P8VA 1VENA 2OXNA 4YIWA 3PZGA 1HKVA 4UR7A 4EKJA 1GHRA 3NQEA 1LL6A 4XUGA 3G1AA 1RVGA 2C6QA 2IKHA 2PAJA 3PZUA 1W3LA 2HE8A 2BTMA 1YNYA 1ZX9A 2Y2WA 3LPPA 2HQAA 4B9ZA 1TYPA 3AWOA 3WLIA 4ZOBA 4A3HA 3EMZA 4LF2A 4ALDA 3GIPA 3MP3A 4LB4A 2HZGA 4C6CA 2F9RA 3VOFA 2FZ9A 3S1GA 3UERA 5F2MA 5A6KA 4LUIA 3G24A 3GXPA 3KOYA 4C6QA 4L1XA 5LXXA 2GUUA 5FSDC 5EPDA 5MHBA 2ZADA 1A5MC 3YPIA 1LVLA 2ZZ5A 4FNSA 2YZ5A 3DYMA 4REQB 2FHCA 2HXTA 4O10A 5FSEC 3WSUA 5KITA 4UR8A 2POTA 3SQMA 1X8CA 2BASA 3LS9A 1TELA 2ONEA 3IJQA 1UH4A 1JYVA 2WBGA 1CYGA 1E5NA 5IBXC 3MMDA 2D22A 2R1NA 3S2JA 2YXGA 5EMLA 2C18A 4O16A 4C6DA 4Y8EA 1EXPA 4EQSA 4XD4A 3A22A 4IP7A 4CNSA 3SRDA 3BAWA 3G77A 2QNEA 3T0CA 1F6YA 2J7HA 3E5BA 4I9TA 1VJIA 4RDYA 2WBAA 1A0EA 2X2YA 3GX9A 1KFEA 5XINA 2XH4A 4MDOA 5FL1A 2A7PA 5JH2A 2V82A 2Y63A 3KDNA 1GESA 1GNXA 2X1TA 4XTDA 3N6JA 2GUBA 4HGXA 3IWPA 1KCXA 3TK7A 1V0LA 1XLAA 4F9JA 3QY8A 1H7XA 4ERIA 5A6JA 4O0KA 4HN8A 3TSMA 5FEXA 1ME8A 3I4EA 5M3WA 1F3WA 2QT3A 3UPMA 1XLGA 1LWJA 1TVPA 4JIIX 3TQVA 1Z42A 4R53A 4NAFB 4LS2A 1GRFA 2J75A 4OIFA 4HCLA 5HWJA 4XD6A 1MNSA 2A0NA 1YDYA 4PEEA 2FVMA 3I7SA 1HUVA 2WPGA 3Q65A 1T41A 3LCLA 1NDAA 4AAJA 4WK9A 1OIFA 4LYKA 4NT0A 1FHDA 2AGKA 3I4KA 1RA5A 2Z1XA 4DYEA 1ZDLA 3OA3A 1JZ2A 4EMIA 3P74A 2HTMA 3URBA 1EJWC 3CAQA 4L4MA 1H7OA 1TREA 1HTIA 1A0DA 4H9UA 3WD4A 5DMYA 1IT7A 4PMJA 3UG4A 4I9AA 1SMAA 2I5QA 1YNQA 3RMEA 3SCRA 2XFRA 3M0XA 3TTQA 3VIKA 1ZP4A 3E2QA 2WHKA 1B3XA 3QSRA 2WKLA 1GT8A 1JCNA 2QEZA 3ZQ9A 2WLZA 2YFNA 1J0JA 1FH8A 3ARRA 1LBMA 2X0YA 3QVQA 1XX1A 1PTGA 3R79A 4UTWA 3VIMA 3LX9A 3M4HA 1P48A 2VC6A 1UZDA 5CCZA 3WEMA 5LKYA 2DW7A 1N5XA 4KCTA 1S5VA 1R86A 1QOPA 4AHOA 2GWGA 4YMZA 3PZOA 3QGVA 4BHYA 3L68A 3OZOA 4RW3A 4J28A 4RCXA 1GONA 2BNJA 2BXYA 2WZHA 4IMEA 3DJJA 2BGNE 2REQA 2PBOA 4WCJA 4ICCX 1DJYA 4R34A 4OGZA 4DJFC 3E5PA 4JNMA 4LX4A 5D2YA 5H6HA 2YKKA 1LOSA 3H2EA 3HTWA 3MMWA 3FDKA 1CEOA 4URIA 1V3LA 3P62A 3AIEA 4NJKA 4H4ZA 2R1KA 3BAIA 4WXZA 1E6PA 4DEFA 3CAVA 2PDXA 1B0IA 2JEQA 1KM6A 3C2YA 2HROA 1K9FA 1QATA 3D5HA 2OYLA 4JIPA 2J7DA 3NXLA 1KBIA 3E6EA 5FJOA 1KFWA 3TDFA 3TW9A 3NVZB 4HMEA 1UASA 3H2FA 4NZCA 3DYOA 5FF4A 2B81A 2QUVA 3PPGA 4GYPC 1R47A 1W37A 3IC9A 4LV4A 1HVXA 4MWAC 2VEKA 2YJQA 1GOQA 3MHUA 2NX9A 1FCBA 4A22A 4NG3A 1G7UA 2NLIA 4O14A 2Y5JA 1FH9A 3VE7A 2EKGA 2MNRA 1DJNA 4YYFA 5A95A 4H9XA 4XBJA 3GNRA 3P5YA 5ER0A 2WOWA 4HBKA 4LNCA 2R94A 3GVWA 1FWHC 4JN7A 3QR1A 3HURA 1EEPA 4HYRA 1CLVA 3G22A 4IPLA 3W37A 2ZA1A 3L8KA 3TMLA 1S7MA 2F7FA 4Q8TA 5TR3A 3KCLA 2XIIA 1DEDA 3TMQA 3F2BA 2PTXA 3MYPA 1P7TB 1T0OA 1LLWA 4GGBA 2FVKA 4DO7A 3H21A 1H11A 4H19A 2XHYA 3RAOA 4ZCWA 1JXKA 3EKLA 3GG7A 3FN9A 1BAGA 3FIGA 5E09A 3U7BA 1M7XA 3TN4A 1XYZA 4WZHA 3BICA 4J5NA 3IVSA 3UCCA 2WKGA 4K3ZA 3BCDA 4I5RA 2C3DA 4PTWA 1CZ1A 3EB2A 4W85A 1UJQA 3PTKA 4JYDA 3DFSA 1G4TA 1GOMA 3GAKA 3QMSA 1RUSA 5H8MA 5XIMA 1HNYA 2WOIA 4MNJA 2Y5SA 3T4WA 3PZMA 4Y90A 1W3HA 4JX5A 2VX6A 5FF2A 4DLMA 6XIMA 3P93A 5HOSA 4LBSA 3WQGA 4C6NA 3OZMA 5DRCA 2Y62A 1Y8BA 4DWDA 2ZVIA 3GO2A 5CEWA 5JBDA 2IPGA 3CUXA 1UWQA 3HPZA 4FF7A 4W87A 3VK5A 5GNZA 2J9YA 5A6BD 1HT6A 4UNIA 3W7IA 3VCNA 3CNYA 4G2DA 3EANA 5I3GA 2F5ZA 3CQHA 1X1OA 2PDGA 3DKLA 1OBAA 1MEHA 3GDTA 3W86A 3KLLA 1QHZA 3CPGA 1D3CA 5HMSA 7REQB 5FS6A 3ZS4A 4IGNA 4JDYA 4QJ1A 4L1WA 1JDCA 4AIEA 3G1SA 2ACRA 4LRSA 2J8TA 1J18A 4B5SA 2DY3A 2JF6A 4GIYA 1VYSX 3AHVA 3E2VA 5CG0A 1KM5A 5CLWA 2G5WA 5DBTA 1XBYA 2DZBA 3BG5A 1ZALA 1UR0A 3VMNA 5FAJA 1IXNA 1KM2A 3EX2A 4X3ZA 3HQ1A 1QWKA 3GRIA 4GIRA 2A5HA 1W3TA 4M29A 1VBHA 4MIMA 1BG9A 3VGGA 2WPFA 1XDLA 2H9AA 4QNWA 4ZL1A 2VQTA 5ECUA 2GZXA 3GHTA 1UR1A 4JTKA 5LNSA 5J5DA 1Y5WA 3DEQA 2PEVA 4UTFA 8RUCA 5A94A 2GGIA 3AS1A 3FA4A 4XO6A 3OU8A 2ZKMX 4BEQA 3RN6A 3G1XA 3W1LA 3CUIA 3DI0A 1C93A 1TV8A 1N7KA 1FXQA 2CERA 4H83A 3RO6A 3VOGA 3FXYA 3VXGA 3UXIA 3EWXA 1N8IA 4F48A 1HL9A 2XM2A 2CKSA 1CGUA 2VEFA 3GKAA 1UOKA 1R85A 3CB8A 1AW5A 3O06A 4Q8UA 3UGVA 3MV11 3W26A 3KFTA 1LLOA 3FKKA 1L2UA 2PUZA 3VZYA 1YBQB 1ITXA 4C6MA 2VDGA 1RXOB 4JTGA 3W7DA 3PBVA 3ABRA 3PBYA 4Q4PA 3C4UA 4H4QA 4IFKB 4PMQA 1K9TA 1FH7A 3UG3A 4MUZA 1PPIA 4CD4A 1QDSA 4QM1A 3V4BA 1O5QA 4RL3A 5CPQA 3TROA 4LAZA 3WLRA 4W88A 1X38A 2Y8VA 1ZRQA 3V0UA 1P0BA 1V4YA 3NZ1A 1JF5A 3OHMB 2XSAA 2CWNA 1PHQA 3MDWA 3ISIX 2QCEA 4FX6M 4R3UA 2D2OA 2OKOA 4UQEA 1XDMA 2IMRA 1D8CA 1QR7A 4X22A 2EG6A 3KWXA 5T26A 3MCNA 3O8AA 3VNIA 1FWBC 2C7FA 4AMAA 1TX0A 4PUKA 4AF0A 2QKFA 3GNNA 3UWYA 1PSCA 3MBFA 5AZ0A 2QS8A 2F2HA 2P53A 4FLOA 3SQPA 2PTDA 2W0HA 4GVGA 3POCA 4FNUA 1WXJA 4Y9NA 3WH7A 1GK8A 5HQEA 1YKWA 4EE9A 3D47A 3C0QA 3N13A 2CFFA 1SPQA 3NYZA 1GYLA 4ZTYA 1UC5A 3DGHA 2P3ZA 4QLLA 1XQKA 4S3FA 2VFFA 4WIWA 4LV9A 3DDMA 3K4DA 4P5UA 1W32A 4G5DA 4XD5A 1DNCA 4W8BA 4H4VA 1FKXA 1BLIA 3RITA 3CUFA 3KWSA 1B9BA 3AJXA 4KKXA 4WOZA 2WC7A 4AWTA 3CPUA 1E55A 2V2HA 2BGSA 1JFHA 4V27A 3T05A 4E3VA 1H7PA 2AQOA 2AAAA 2NZLA 1BXCA 1RP9A 2WVVA 2AMGA 4ATWA 4FLRA 7A3HA 4JEJA 2V5KA 3EPOA 3C6CA 1VCFA 1PIFA 5TNVA 3V7PA 4BKNA 1XPGA 3L0KA 3GC5A 3VKAA 3Q6JA 2YXXA 2BOGX 4WKHA 3H2CA 1ALDA 2Y1HA 4B5TA 5CSSA 2XYLA 1M9HA 2BCPA 3HGSA 1RQEA 3UZXA 4M51A 1AUSL 4EM3A 5CZKA 3L2MA 1W1VA 5CBIA 5C9RA 1JPKA 4XAGA 3M0YA 3EWCA 3XISA 5AC4A 3T55A 3O9NA 3KLJA 4MB5A 1PYMA 3DBPA 1UH2A 4A4AA 5AECA 3M64A 2IQ0A 4BQ2A 1NTHA 2WCAA 3WH5A 4QCFA 1KTNA 3WY1A 3QMTA 3NAVA 3CUGA 1HL2A 1HKMA 3HF3A 1JQXA 2VVSA 4B92A 2G3JA 2OZ8A 3NR0A 5IOBA 4O0ZA 4PFHA 5HUPA 5LGXA 1TIMA 1XPYA 2PSNA 2Z00A 4ROPA 5IHSA 3F4NA 3WBYA 5TD4A 2E6YA 1RSCA 1KR1A 1V3IA 2QCHA 3PUOA 3B0XA 2OEKA 4H1ZA 2MANA 5D9NA 2CFYA 4GY7A 3MZ2A 1V6TA 2QUTA 1Q6DA 2ZFAA 4AIBA 3LNMA 3RO8A 2BS9A 1THFD 3S47A 3P8JA 1J6PA 5I3HA 1Q6OA 3B8WA 4AB4A 3HM7A 3TTYA 1I2NA 3W1TA 1J0ZA 4YTQA 4MJZA 3FS2A 1N55A 2IXUA 2OFJA 3QHMA 4PRWA 2CBIA 4EWND 3PPCA 3FGCA 1TRDA 2W9MA 3EAUA 2FYMA 1XGZA 1BWVA 3N18A 1O7AA 2PGEA 2G0WA 4DX3A 1EJUC 1S2TA 4LY8A 2NSXA 1P1MA 1UPMB 1JZ3A 3MU7A 2UZ9A 1GCYA 4U28A 3RPTA 3SQSA 3CV7A 5C9XA 2AKZA 2E5DA 2H6RA 2W54A 5FS8A 4HNLA 3N1AA 2W5FA 3P60A 3P82A 1TPEA 3FSUA 2QV4A 3CYJA 3QF0A 1K8XA 5FEPA 5BYWA 3FHAA 4IIBA 3OP2A 3KZSA 3WQPA 4WOQA 4JNYA 1UKTA 1XD0A 1BPLB 3DG3A 3TN6A 3A47A 3WX7A 1PCWA 3BV7A 1XFBA 1YTKA 1R2SA 1M1BA 3BGGA 1WE5A 3TJXA 1UJPA 1KRCC 3UA3A 4KEMA 3VKBA 1W2PA 4E3TA 1RH9A 4JYEA 4TVUA 5EYWA 4DJFA 3RIKA 4AIUA 1FEAA 2FHBA 1W3JA 1NWTA 5JCLA 3W53A 3PBMA 1SR9A 1F8IA 3OIHA 4D1IA 3AIWA 5HA7A 1IT0A 3VPLA 4Q33A 3E38A 1VS1A 1IF2A 4GISA 3HJZA 2BOFX 3LNPA 4QAWA 1W9DM 3AIUA 3A3WA 5AYBA 2OG9A 4H6KA 1XYAA 3KOFA 1EJSC 2GDQA 1WBHA 5AB3A 2E9MA 5BZAA 1DPMA 1W2VA 3TONA 1TPUA 4C1NA 1O1HA 5LIUX 3WQFA 1ZAHA 3O6DA 4LUSB 2Y0FA 2CETA 1OB0A 3M1ZA 1QT1A 2E9BA 2Z1VA 4JZ5A 3TC6A 4AW7A 4AWEA 5C5YA 1ZJBA 4J4KA 4D8ZA 2X1UA 1U5JA 3N2MA 3SQLA 1DWFM 9RUBA 1H62A 2QDHA 3BO9A 4BQ3A 5IRPA 5HNUA 3EDJA 2X42A 2W62A 3M41A 1UKPA 3SSJA 2CZ5A 3ZVHA 4JTAA 2QVHA 2DVXA 4AZIA 3WD2A 1A3HA 3ARYA 1CGXA 4KWOA 2Y7DA 1IZKA 4LCQA 4WDUA 2HNHA 1UR3M 1V3HA 1LT7A 1SZRA 4ICMA 3MBDA 4ZO7A 4E4UA 2W0UA 4FK9A 2NXIA 4CNPA 5C6MA 3GWQA 4MLJA 4ZZ9A 1VB9A 3MI2A 1JGIA 1ZKQA 3R8GA 1V93A 4M52A 3R7MA 2VEGA 2VURA 2YA1A 4UFMA 4CU7A 4XG1A 3M7WA 3AROA 3M0JA 2GJLA 1A0CA 3DERA 4UNLA 4D8AA 4UWMA 1LRNA 3CGBA 1DL3A 1VJZA 3S5NA 1GSNA 2ZZ4A 4FNQA 4MY8A 3ZT6A 1M03A 5D4YA 4XK2A 2EQ8A 5EB8A 3PTDA 2PDCA 4NKCA 4L64A 3WQ8A 3LRLA 1JPIA 1HVQA 2ICSA 5JBFA 1LM1A 5GPRA 2Z6IA 6ENLA 4E2BA 1FKWA 4RNFA 1HJWA 3WCZA 4HA3A 2O7QA 2WLYA 4LS1A 1D3GA 3A64A 3BC9A 3OO2A 1ML1A 2YLLA 4N42A 1YEYA 1CGTA 1J2BA 2WHLA 1VDVA 1I8JA 1UP3A 4UIOA 3ZO9A 3S1VA 2HPMA 2YDSA 2A3AA 3SEPA 3OYZA 3B0PA 3H55A 1CGVA 4IX0A 4CNOA 1V8EA 2ACSA 2I1OA 3KL0A 4JTQA 4ZTXA 1VFLA 1MO9A 2PU0A 1H7WA 3TYBA 2GWNA 1FOBA 4ICNA 4UMBA 1EO7A 1QNQA 1V0MA 4TV5A 1M6JA 3VD5A 3RM8A 3LLDA 4AD5A 3MJMA 3ARXA 1CLXA 3COTA 2GLKA 3UWVA 4LF1A 3KBMA 3IJLA 2VRJA 4BF9A 3F03K 1U2YA 1KGUA 2DH3A 1EIXA 1LZOA 1MMFA 1F6KA 3HPFA 1J0YA 1R9ZA 2QPSA 4C60A 3KS6A 4D6FA 4NAEB 1OJXA 1IXOA 1QNSA 3OBEA 1US0A 4MB1A 2DZVA 4US5A 2VQUA 3V5FA 2ZUSA 2RHGA 2J7EA 2QUMA 3CXOA 2A2IA 4JPGA 2PODA 1GRGA 5LNVA 5F4SA 1RZMA 2QGYA 3H7RA 3IRDA 4AIOA 2CBJA 1W54A 3UA4A 2NSOA 3DFTA 5JMUA 3POHA 3ZSTA 5A3HA 3VU2A 1H09A 1DIDA 4HSNA 3WK3A 1VBGA 3C86A 1QNPA 3W1NA 1V7AA 2EPHA 1YQZA 2JE8A 4MADA 3W7GA 4DZHA 1M3UA 3RG6A 4TOQA 1OT2A 5EFFA 5GJPA 2P0OA 4DBEA 2W3SA 2ZQ0A 3T0BA 3RR1A 1O60A 2ZUNA 2ZUVA 4CUCA 1BQGA 2C14A 1EYWA 4JS3A 4DY1A 2OJPA 1Q13A 4F0LA 5EU9A 1SO3A 2VVNA 3H4KA 2X09A 2BC1A 1FWTA 3QW4B 2WVSA 2CESA 3EWWA 5AYYA 1X8FA 1JDAA 4BCEA 3DH9A 3R07C 4TTGA 3W88A 3ARQA 4K8HA 1WKDA 1ZMCA 1YDVA 2BVWA 4PCSA 2PRMA 1US2A 8XIAA 3JRKA 6ALDA 1AOGA 3RCMA 5G5IA 3BK0A 3GW3A 2QDDA 1JZ8A 2EEXA 3WUEA 4DWSA 4XB3A 3WQVA 3GRSA 1I0BA 1U1UA 1K4GA 4D6IA 2YAUA 3AHXA 1XIGA 4FAMA 4GNVA 1YDNA 5M03A 3G3MA 1EDQA 1JR1A 3BAYA 1LL4A 3ECQA 5T8GA 5CGQA 1VFFA 3PC0A 3ZXWA 1IWAA 2RH9A 4UQDA 2DJXA 4LCSA 3WUGA 2YGYA 3AI0A 1UWTA 4QAIA 2R1LA 4Q4OA 1UBPC 3N9SA 4QJ3B 2G4JA 3VIIA 3M46A 4FX7A 3ARSA 4Z42C 4IQLA 3N3MA 2ALRA 1G7VA 1RBAA 1GXFA 4NILA 1CXFA 2POZA 3LHYA 5AYIA 2VCCA 2V5DA 3KRUA 2IS7A 2H3DA 7CGTA 4EMWA 1FWDC 1WZLA 4MB3A 5DT5A 4O53A 5CKSA 3BV4A 3WDRA 4JFTA 2ZE0A 1VKFA 3TWAA 1G94A 3BSMA 4LAMA 3GXTA 4O54A 2W79A 1U5VA 3PJUA 4GWEA 3CLWA 5KINA 3LZ5A 3TSBA 3RX4A 1JPDX 1PIGA 2A3BA 3MANA 3FFSA 3KEHA 4ZQNA 3ATZA 3MT1A 3OQEA 3UY7A 1QOXA 1X1NA 5AC8A 5FJJA 3LA4A 2Q02A 4H4UA 4GABA 3R6IA 2ZRVA 4F2UA 4PUUA 5KEZA 4EXBA 2VRQA 3AICA 1UHVA 5LHFA 1GJWA 2PDBA 3MKVA 1QBBA 3ZVIA 2F6UA 3PZTA 1WB0A 1XIJA 1FIQB 3W24A 1J12A 4BFAA 1S2AA 5FF7A 2FFIA 4UFIA 3N6QA 2WHMA 1EX5A 5CXPA 3W7EA 1M41A 3W2UA 1XCWA 1K8ZA 3GXMA 4D2JA 4UMAA 1TUXA 4IMCA 3LU2A 1EUAA 4FIRA 3L9CA 5A1AA 1QO2A 1FWCC 4GVIA 1TKKA 2CIPA 4ZGYA 2VR5A 2NX1A 1JRCA 2OWXA 4MPQA 3ARPA 3TC7A 1SVDA 1MYRA 4HCDA 4POCA 4OBTA 5G4EA 1TWIA 3SUVA 4C6BA 1BRLB 3S2CA 1DJQA 4LOCA 2FZDA 3MUCA 1OZQA 3R94A 2HCVA 3OEXA 3UCQA 3G1RA 2WKJA 3WLSA 1K9DA 3OLGA 4GXMA 5D9OA 3BOXA 3QR0A 1ZBWA 1AQMA 3W70A 3WG6A 4F4RA 1FWGC 2BFGA 1O1ZA 3IGHX 3LCHA 3TV8A 2WCGA 2PD9A 3T07A 2GJPA 1HG3A 2Z2UA 2O9OA 3VE9A 3UF9A 2QCFA 4KGLA 4HHHA 1KCKA 2AKMA 1CIUA 3NQDA 1XHCA 1GZGA 3GFYA 1OC5A 1C91A 3LXAA 3FV9A 4GI6A 1OX4B 1LOQA 1XL9A 5FIPA 4FP1A 2ANUA 3MPGA 3DG6A 5EKYA 3L5MA 4UCFA 2NV9A 4OBSA 2R91A 2OSYA 3EEZA 5I77A 2XM1A 4M6QA 4UTHA 2J74A 2B7QA 4GZJA 4GJIA 1EPXA 5LA0A 4WVXA 2WPCA 1DV7A 1V7YA 1JL8A 5CGMA 5D2TA 1TCDA 2EPLX 5I00A 3GQYA 3QPEA 2YA0A 2YZRA 4GK8A 5AY7A 4QSFA 4GFIA 3IIPA 4ZOEA 1SZGA 2H8XA 3W7MA 4E2VA 4MNMA 3LHTA 1YHTA 1NP2A 2ZZCA 1YPFA 1YW1A 3EOSA 1NELA 1KB3A 3JVAA 5GRTA 4EAMA 1IT8A 4ZO6A 1WDSA 2QJJA 2GK1A 1REQB 4RZ5A 1E6RA 2RDTA 4AZCA 4DJEA 1XIHA 2XTKA 1ODZA 3SCVA 1ISZA 1G5AA 1V02E 1J93A 1OJTA 2BV9A 3QY7A 5A8GA 4X0NA 3SRHA 4Q4QA 3EF6A 4E0CA 2A6NA 1K03A 3T0TA 1SJCA 1D7YA 1OD8A 4MOZA 3RU6A 1EEXA 4Z2IA 4QR6A 2PMQA 2NWRA 2XIQA 3QTPA 2P50A 1YYAA 3L0GA 3D6NA 2BG5A 5CSRA 2Q8XA 3WBXA 4HYVA 4J2PA 3BVJA 3QOKA 1DXEA 3W7LA 5MF5A 2Z1SA 2D1ZA 3IIOA 3BSHA 2BXVA 4MJ4A 3NO3A 4UMCA 3LEPA 5H2ZA 3AS3A 3KRBA 3GLCA 4IIHA 4KCWA 1GOWA 1KKOA 3GDKA 2PFHA 5E5CA 3PVFA 2QJHA 2PDIA 2ZZ7A 3TAKA 3LY0A 4JHMA 3GXFA 4LYRA 4IXXA 2ZUUA 3RX3A 1N61C 1A5CA 4W93A 4H4YA 1TPDA 1MUWA 3B03A 5E0KA 4L4OA 1XIEA 1GOIA 2D2JA 2QXWA 3BOLA 1KM0A 2A3HA 4J3UA 3B8UA 4FF5A 3RLHA 3DHDA 4LBRA 1A3XA 1YIXA 2WSQA 1FCUA 4I8DA 1O6IA 4PCFA 2P8CA 1HJXA 3CXBA 4UC5A 3FA3A 5FJTA 4D72A 4PRTA 3APGA 1IXQA 3GDMA 1WP6A 2XSXA 1LWIA 1F61A 1ITUA 3KW3A 3DFHA 5DCEA 4A2RA 2J9ZA 3WD0A 2W27A 2Y88A 4UZUA 3AYVA 2NVDA 2RDXA 4R9XA 2B7OA 1FFUC 1R3RA 2FB3A 3V5OA 3I10A 1T99A 4QE5A 2J25A 4ZB0A 1OF6A 3WLTA 1C8XA 4HA4A 4PTNA 2RKXA 2VX5A 3VIPA 1W0MA 2JGYA 1VH7A 1QRQA 2TSYA 1SFSA 4WXYA 5I3DA 3VDBA 5G5HB 4DLFA 4HIBA 5D32A 1NEYA 2FH8A 1T96A 2VZUA 4N9BA 1FUYA 3CZEA 3V36A 2JQXA 3QFAA 3B05A 4GQBA 1I2QA 2QCNA 3C0SA 5AHNA 3W28A 3CWHA 4GO9A 1F8WA 1HN1A 3WNOA 1ZZMA 4WJEA 4O11A 3O6CA 4UOJA 1UR8A 3H2AA 4LEQA 1SM9A 4XBKA 2VR2A 1BYCA 5JCNA 1KXVA 1JYNA 1JUKA 1XDJA 5CBJA 1CW2A 2V5JA 2A1YA 1BKSA 3KBJA 2YBTA 4Z08A 3G1YA 4NZ4A 4PB5A 2HE5A 3G1DA 3NL3A 4JX4A 4ZEPA 3W25A 2I17A 2D2GA 3W1XA 1U22A 4C5YA 2Y6ZA 1STZA 5IXEA 3EXTA 1E40A 2J88A 4NJGA 4CNTA 1B31A 5HJXA 2JIEA 2C3ZA 4EPEC 2IKJA 4IXHA 2UY3A 4S3AA 4BWLC 1XGEA 2VZOA 1QJWA 2I9UA 4LAKA 2GSEA 4TVDA 3LTSA 5REQB 3NNTA 2EJAA 2G96A 1G4SA 2YVJA 1XLEA 1NDYA 4UTJA 1JUBA 3DK4A 4ZMGA 2OODA 4OFCA 3RLGA 4AD0A 1FFQA 2P76A 3T2PA 2G95A 3LHWA 4WKAA 2CKRA 1IR1A 2XG9A 3NSMA 1Z69A 6A3HA 4GC3A 1KXQA 3STCA 2EPNA 2E0PA 3CWOX 1X96A 2PWGA 2O92A 3TYUA 3U2EA 4NL1A 2JEPA 1Q7MA 1TR1A 1GZ1A 3LBOA 1GVOA 4PMDA 1UWSA 5HJYA 1DWGM 4GX9A 4QE4A 2IUZA 3W22A 5GJMA 5I7GA 4RJEA 3QW3A 5I06A 3CZKA 3NZGA 2NX3A 3N2CA 1VEPA 3OOQA 3S5ZA 4KH2A 3RILA 4UB9A 2NW0A 3SN1A 8A3HA 2FVLA 4REQA 3E0FA 2WP5A 3OLDA 4YWOA 3W87A 3WJXA 1W9PA 2VELA 1WXZA 1LRTA 4L80A 3R43A 3NRZB 2E4TA 3WF2A 1EO5A 2PC4A 3RNDA 2BC0A 3L67A 5DLCA 1T7LA 3GU1A 3OGSA 5F1UA 4RR4A 4NX5A 3VMOA 2ZZ3A 3KBWA 1V3KA 4Q4RA 3BJFA 1E1CB 1KR0A 1ICSA 1OM0A 2PI6A 4PUEA 2INEA 2IQTA 2ZRXA 1SO5A 4ZSUA 1H41A 1E6NA 4BV6A 3CT7A 5K9DA 1J01A 3WFLA 4AXNA 2J7CA 4B5XA 1RPXA 2WSRA 1GQLA 4CN1A 2Z27A 3W1MA 4LS0A 1PWMA 1X39A 1ZUAX 4CQCA 3K8LA 3EX4A 4IIDA 4L6DA 2P8BA 2PGFA 3M7SA 4UQBA 1KWGA 3VD7A 4ZVJA 4TTUA 3BQ5A 2E67A 4LC6A 1VIWA 3PSWA 1VBRA 3A3HA 2GQ8A 3VNZA 3QFBA 1LG1A 3MP4A 2WM0A 4KGJA 2OOGA 4H8NA 3PHAA 3UXAA 3OVQA 3BUVA 5JUVA 1PXGA 3T44A 1OCNA 1F2JA 3NVYB 5C7VA 1KQYA 3PNZA 1VLIA 4NAFA 2F6KA 2FZNA 4RE3A 1W9VA 4EVZA 2XSBA 5DO8A 4B2DA 4UTUA 3T0DA 1HFBA 3QY6A 5LYRA 3WLNA 2ZXBA 4MJMA 4B5VA 3TLLA 4PULA 4TQTA 1BXBA 1OT1A 4K7VA 4CCZA 1C8VA 2E25A 3FYYA 1W3KA 4JY9A 4NZJA 3PN8A 3LENA 4EK7A 3T8LA 1U1HA 3V16A 2E5BA 3E74A 1PDYA 5A8NA 3EX3A 2DZPA 3BE7A 3TFXA 2EG8A 2OCZA 3UGRA 2VO5A 3DAQA 1J96A 3S8HA 2G3MA 1MVYA 2X7WA 1C90A 1CTNA 1L8PA 4B3ZA 1X2GA 3VD3A 3AXIA 3W6MA 2OYKA 1OFPA 1VC4A 5HWMA 1WV2A 4XWUA 3UBPC 1LG2A 5FF3A 4MWAB 3B9JB 1R0MA 3W1AA 3TYDA 2V3BA 2Z28A 2QV5A 1DQXA 1YDOA 4UOQA 4J9JA 2QAEA 1IIGA 2F38A 1HGWA 4NYYA 1QU4A 2V8ZA 3CH0A 3JW7A 4AZ5A 1POKA 3WDIA 1TWSA 2WSPA 4U3CA 1UC4A 2NUXA 1FBAA 2GVGA 3GUGA 4D6GA 5DN1A 2FGLA 4JTJA 4L65A 2GH5A 3LLXA 1SSGA 1E71M 1XC4A 1EC8A 1HIZA 1RR2A 4PUMA 2E8ZA 4XZ9A 4O1BA 4HSOA 3EEGA 4GCXA 3W6YA 1AZ1A 1VLWA 1WNOA 5ENLA 2YCEA 3C0LA 1VQZA 1SQ7A 4B5UA 3WH9A 5BRQA 3RGTA 4OQVA 3BMWA 3K1GA 2NVKX 1QVBA 4IQEA 3TTSA 3C2VA 4OVXA 5I3JA 2E3ZA 1F8MA 3FX4A 4JOMA 3L7RA 3F7JA 3SUUA 3P7YA 2DJLA 4HCHA 3B04A 2R1MA 3OB8A 1OGGA 1WO2A 4LVGA 3I3EA 1GRHA 3W7QA 3SI9A 2P88A 3PANA 3LZ3A 3DESA 3NSNA 5KVIA 3A9IA 4K68A 1BTMA 4N6FA 4YN5A 5A6SA 1CENA 4IMAA 5C2CA 2BGQA 1FWFC 4H41A 3CMGA 2VWSA 2VNCA 4BEUA 1Q3NA 4QISA 1QASA 3BGJA 1RCXB 2Q8ZA 3VOHA 3WMCA 3G18A 4CD7A 3BJTA 5IDIA 1NWSA 1R3QA 2AAMA 3VKCA 2CZDA 2YDAA 2E1DA 4A8LA 4Y9MA 2Q3OA 4ZA0A 1SFJA 5ABEA 1ELSA 4RZ4A 4JTFA 4YLWA 3A7AA 4L9ZA 4S3KA 5G2HA 1GPWA 1XLBA 5G4HC 4UBPC 1I2PA 2YR1A 1CXHA 4LQ1A 3QQ0A 1XSKA 4IPJA 3D3FA 1E43A 1J0HA 3F5KA 3IUDA 3CH9A 1SYTA 4JKMA 1W8GA 3PG6A 1EQCA 5J8LA 1DORA 3GNOA 1P7TA 1TWDA 3AZSA 4LCRA 1OZMA 4X61A 3A6OA 4HMCA 4JIHA 4D9PA 2J62A 2E68A 4H4RA 4DBSA 1R9XA 5A6TC 3NPXA 2Z25A 3WDQA 3IRSA 3LV5A 1P0EA 3KBNA 4IUOA 2OGYA 3AMGA 1SW0A 1CXLA 2CXGA 1C8QA 3SIMA 1A3WA 3H12A 4O1DA 4M6VA 3ZM8A 3WQEA 3SURA 1XR2A 1WCGA 4O1AA 1F3PA 1RBOB 2CEQA 3FEQA 4KS0A 2YYTA 4PUDA 4XBSA 4LYQA 4GZIA 2PB1A 4PUNA 1XINA 2CWXA 3F5JA 5CGTA 3W01A 1K7XA 1HP4A 3GNDA 3TA6A 4S23A 1X98A 2WMGA 2JALA 1XG4A 1M7PA 4U2YA 1AL8A 4KRTA 4EPBC 1XLKA 2XIBA 1W5NA 5D9PA 3S0CA 1POJA 5AHLA 4V2XA 3PZ9A 4IQDA 1LBLA 1MXSA 2Z0IA 3VMPA 2DV0A 1D7KA 3SFKA 1IIHA 3WF0A 1TV5A 1TB3A 2FGZA 1PKYA 1SO4A 3H7VA 4DNAA 3LN3A 2QQ6A 3L4YA 4JDRA 3TEVA 3QKZA 7REQA 1QBAA 1N8FA 3UY8A 1QHOA 3PUGA 2EQ6A 2H3BA 5BOOA 2PP1A 3TX9A 4V1YA 3M43A 4GA8A 4RE0A 3VFCA 3UZZA 3P8IA 3NL5A 5AVHA 3VA8A 1VGAA 4CEXC 3NM3A 1E6SM 3DOPA 4LEFA 3I3BA 3KCJA 2OMAA 5T9BG 3HG4A 2GVJA 2WOVA 3GAYA 3IJ6A 4N02A 3UZ5A 4J2MA 1PS9A 2ZDRA 3MUAA 1H1ZA 1QI5A 3AXKA 2XIMA 3S4TA 3T78A 3U2OA 4ZOAA 4F0SA 2DT0A 1NFGA 1Q85A 2ZWZA 4RE2A 1W91A 3NL6A 3SCWA 1WDPA 3NPUA 4JQ2A 2NQ5A 5FACA 2AMXA 3G0SA 5C9WA 3L12A 4A35A 1NVMA 1QOQA 3W74A 4IP4A 3HB9A 1XG3A 3NZPA 2BHZA 2ISVA 4FALA 4LVFA 3RFAA 3TXVA 3L0NA 1G69A 3UJRA 1T3QC 3OZPA 4H50A 2GQ3A 5HBFA 1ZS2A 3W0KA 4NI3A 1DQWA 2GGHA 4P61A 1BZLA 2Y5EA 1C7TA 3QV9A 5TF0A 1GWJA 4C90A 2J7BA 3K4WA 4D6HA 3R2GA 3NWRA 1IEWA 1XCXA 3PB0A 2CHRA 2YCKX 4NQ1A 4IICA 4MM1A 4S39A 4WQ6A 1YBQA 3M16A 1XRTA 2HBXA 1LDCA 1H50A 3WNNA 1HJQA 4IFKA 3S9ZA 3ARWA 4IMFA 3KUMA 2ZX7A 5BMWA 3R5EA 3OVGA 2FJUB 4ZQCA 2WOQA 3TCEA 2UY4A 1WBJA 1K7EA 1E3ZA 1OWQA 2ALDA 1P6WA 1VFSA 2E9LA 1K4QA 1OGBA 1TG7A 3MSGA 4X9YA 1I1WA 5LNRA 4ADSA 2FMOA 3MUXA 1RLDA 3GIYA 4BA0A 4A6GA 1RK6A 1S5MA 3MYOA 3Q94A 1IWPA 3LDVA 2CYGA 3WLLA 4C91A 2ZUTA 5TAOA 4G7EB 2J24A 4NSBA 1AD4A 1QTWA 2QGHA 4C7GA 3WMSA 3P2VA 4NXKA 4JL1A 3I7QA 4DNMA 4LNYA 3TH6A 2PP0A 2WCSA 3MUZ1 2OX1A 1E56A 4H6EA 1EA0A 4JNZA 1TO3A 4K1GA 3JU2A 1E6ZA 5KTLA 1Z32X 5GNXA 1GRTA 3M9YA 3VNMA 4J3VA 3LXBA 4TX9A 1RK5A 4R85A 4DHGA 4PBFA 3D9XA 4QJ5B 5AOUA 1M04A 3C0JA 3NQMA 1FCVA 5C0QA 1K3UA 2HVOA 4R7JA 3A5FA 1XYCA 2J8FA 1XI3A 4ZSTA 2CCRA 2PDLA 1M7OA 3QHOA 3KL5A 1UP2A 1PBGA 1LORA 2YCJA 4GY1A 2QF8A 3ARZA 3RU8X 1VCGA 4UTTC 3DGBA 4KIEA 1ECQA 4WDWA 1EP3A 2B7NA 1P43A 3L4UA 1B3OA 1VRDA 5ABHA 2ZX8A 2OOFA 2G41A 2VGGA 3JZEA 4CVUA 1TVLA 4BQ5A 5GVJA 4XIAA 1QMLA 4AD2A 2WV8A 1QK2A 1Y5VA 2HK1A 3IJIA 1X6NA 4ZOCA 1NHRA 1O5KA 1A80A 4PTMA 1WDDA 1JZ6A 4XISA 5CPTA 5CJ5A 2JF7A 4JKLA 3R0KA 2X16A 5EMKA 3S5OA 4UTLA 3AXMA 1GETA 2PDKA 1ISVA 1SO6A 2NT1A 1WOBA 3LGDA 3DENA 1NF0A 1A5BA 1PJ9A 3QPZA 3LD5A 3BQ6A 2WXDM 3IANA 2GK1B 3H7UA 3L23A 2PLJA 5C2GA 3I6TA 3K8MA 4GUFA 3TIMA 4GYJA 5TBOA 3H70A 1GQIA 2ZXDA 3U9IA 3M0LA 4UOZA 2VRKA 3K5XA 2V3DA 1WPCA 2PWDA 2NQHA 1SSDA 4QDMA 2FZBA 4PC8A 2KX9A 4S1FA 1AJZA 1RVKA 4M24A 3MDUA 2XVGA 4YJ5A 1XFCA 2BB0A 3NXFA 4OV9A 2OKTA 3JR2A 3N14A 2HVNA 1KXHA 1EBHA 4HU3A 3TA9A 1WOAA 3M0HA 1DWAM 2QCCA 1F73A 3QLLA 2C79A 3M47A 4O15A 3M5YA 4CQAA 4KESA 1LL7A 1ZY9A 1BQCA 3WH8A 3ARTA 2GDUA 3LHZA 4NP7A 2NV2A 3P0WA 3UR8A 3RDKA 4QIUA 5M5DA 3GR7A 1LOLA 3A24A 5CSUA 1S3HA 4A3RA 4JTHA 2GFTA 6TAAA 3UPBA 3UWZA 1BG4A 1O12A 3XINA 3NQBA 3I7RA 1N2VA 4LH8A 4HZ8A 2NLYA 1DXFA 1EDGA 1ONWA 4NZ3A 1NOUA 3FKRA 3W3OA 4Q7NA 2Z7KA 1XKJA 4QG6A 5E6ZA 2YL9A 4YXGA 4HZ7A 4MAZA 2VFGA 3PK7A 4RDWA 1CWYA 2J6XA 3WQOA 1UWUA 2DSVA 3VTRA 1YNPA 1TV3A 5FF0A 3STGA 2CC0A 5BU9A 4OTKA 4L6HA 1E73M 4DJDA 1OC6A 4AZHA 2XPKA 1S5NA 4UFKA 1TPH1 4YVVA 1KXTA 3U5YA 3HQPA 1HL8A 1KRAC 1EGZA 3CGTA 3A4AA 1ISWA 1UIOA 1V79A 5CSYA 3ANYA 4XZHA 3U3HA 3QZEA 1IZCA 2E28A 1VHCA 3AUJA 2DVUA 1XIMA 2W61A 4DVOA 3UNDA 2YCIX 3W2NA 5BXRA 2NVCA 3H2NA 5IFPA 2I57A 4FOKA 1AH4A 1NWRA 4WD0A 3EWUA 5FEZA 2TYSA 1YPIA 5CPLA 4HU0A 1EXBA 3CL6A 3QPYA 3NDZA 4HHMA 4PMUA 3RJXA 4GC4A 1VPQA 1MUMA 1AFSA 1YTEA 1Z44A 1K02A 2ZUWA 4XZLX 1W31A 3B0VC 4LUSA 1U5HA 4U2ZA 1WX0A 3KZPA 1QI2A 2R14A 4YYCA 4AVOA 4PGLA 4OT7A 3IJ9A 3AO0A 3LK6A 1PL9A 3H4WA 2HV5A 4HK6A 3E49A 5FJPA 2VGIA 3DUGA 2PD5A 4TR9A 3QXBA 3KX6A 1ODUA 3T9PA 1GRAA 3PPHA 2OT0A 4HPGA 2GJXB 2VOTA 3ABSA 1GVEA 3CQKA 1C92A 2JKPA 1ECEA 3R13A 1XC6A 5C9ZA 4AU0A 3NA8A 3G2GA 2TAAA 2WAGA 4IFRA 4GNJA 1RBLA 4GBDA 3SCTA 5FS9A 2PBGA 3DI1A 4ORMA 1AQ0A 2SFPA 1V6UA 3ZYZA 4NUWA 1D7FA 1PO9A 1VQTA 1PUDA 3BAKA 1TE1A 4F0RA 1YXYA 2Z1BA 3WK2A 5JCIA 3GNXA 3WNPA 3ITLA 1VFUA 3S2LA 3QEZA 1WDWA 4DZAA 3AZRA 4UUIA 1ICQA 4CLMA 4GR1A 1E1FA 2OX4A 1E4MM 3L5AA 5DFAA 3AS2A 4HA1A 3W02A 4V33A 3E3HA 4Q8QA 3N29A 3WN6A 1M68A 4D6JA 1EP1A 5ABGA 4DPQA 4OU1A 5A2CA 2RDWA 3HMJG 2YQUA 1UWRA 1GOKA 3WD1A 3AIRA 1RHCA 2PCEA 2W55A 3V5CA 2VR4A 3A9BA 3NDOA 1WZKA 3VKJA 2AQWA 1K8CA 3HGRA 4GYKA 5U1OA 4JQ4A 1D2KA 2VC7A 3N73A 1I6NA 3GTFA 4W8LA 4AZGA 1XYBA 2E6AA 5I3KA 1UCWA 4CCCA 4QS5A 1YX1A 3GZ3A 5GNYA 2ACUA 2JK6A 4NVTA 4MZYA 1MW2A 3TTEA 2YW4A 3PBUA 4EAYA 1EDTA 4YCPA 1XBZA 5HDRA 4ATLA 4L4PA 2EJ1A 3L4TA 1Z9AA 3UWEA 2DUZA 4R9OA 3HGOA 4NAEA 1XISA 3VOCA 3GD4A 3A23A 3CYVA 3EBVA 4B5WA 4XZMX 4MAVA 3W84A 3PJTA 1MXDA 2D69A 1PDZA 2OZ3A 3P61A 3CHEA 4G56A 1G01A 3R8HA 4I90A 1PKLA 1Z8AA 4AQLA 4EPKA 3NQVA 5T9CE 4RX0A 1HO4A 4J56A 4AVNA 3GSMA 2QCDB 4B4HA 1QW9A 4AXKA 4W5ZA 3CV6A 3LBCA 3M44A 5LNUA 1GRBA 3KE0A 5I07A 4JQ9A 2GVLA 3EMQA 3MA8A 4U31A 2DORA 4RXFA 2Y89A 4LAUA 5D03A 1A5AA 4LXFA 1LP6A 3P6LA 4IGHA 2R8WA 1GG0A 1F4AA 3EB4A 4CEUC 3LCXA 3O3RA 5CG7A 2IPWA 1PTAA 5G1MA 5CAHA 3UWWA 1ADDA 5HWNA 3E0LA 4IP5A 5FOOA 3N3TA 4OBRA 4KFOA 4W4QA 4KIRA 1P4CA 4WKFA 4Z2HA 2GRTA 4JGDA 5A8MA 3AMCA 1AMKA 2OR2A 4GH1A 4C5ZA 4XZWA 1RV8A 3H2MA 4FXSA 5XIAA 3KL3A 4E2OA 5HK4A 2XN2A 4AG0A 2DZAA 2AAQA 3GD3A 3CZJA 4H7VA 4IIFA 4AZ7A 1H49A 1J6OA 5LZLA 4ZODA 2V6OA 1JCYA 4FR6A 5I2UA 3BW4A 3WLHA 3GDRA 4I7WA 4IL2A 2XGZA 5I02A 2BWGA 3P0XA 3LADA 4DF2A 4CD5A 2WJEA 4CQBA 1UUMA 2PF8A 1XRFA 5DEZA 2EHHA 3PFRA 3VGEA 5HNTA 5KZEA 2BY3A 3AYSA 4H2CA 1NM9A 2NVAA 3M5ZA 4XSMA 3UU0A 3IIZA 2V69A 2PPGA 4WGXA 4NYUA 5T91A 3HZ3A 1OCBA 2IW0A 5E1QA 3O0HA 1TPB1 4Q7IA 4HNVA 5L6UA 2H8ZA 2WNZA 1J79A 1ZGDA 3NPVA 3WMLA 2D0GA 2EQ9A 4O50A 4RK8A 5IFTA 2PE4A 3ABZA 4DB7A 2PTYA 3TZNA 4Q8PA 1TFVA 3AMLA 2ISWA 1XHGA 1CDGA 3TLQA 3W7HA 3W81A 4GGHA 3UCDA 1IGSA 1X1ZA 4ML4A 4FS9A 3Q67A 5CZTA 1X97A 1KTBA 1WYIA 3REQB 3G3DA 2WJZA 4E6MA 2LLEA 3VGBA 1WAWA 4W9TA 5AYXA 3OIXA 2ZRZA 1WYGA 1Q6FA 1EUNA 2W63A 4UTMA 3GRTA 1M7JA 3GD6A 4ACZB 4Z2JA 3R89A 7PTDA 3BH4A 4ZOHB 1E0XA 1KKRA 1UIPA 4QBXA 2HQMA 1IV8A 1V6XA 1ZCOA 4PMVA 4FDCB 3PG9A 4GNKB 4XVEA 4LTSA 4WSKA 5LIKX 4IX2A 3NO1A 1EPVA 3EB3A 2V2CA 2NQJA 1J5SA 1U83A 2WPEA 3O05A 5CC7A 3ITGA 1HKWA 1SZFA 4JHZA 4MFEA 2VEIA 1ZJIA 3WQDA 3KS5A 3WEOA 3CPRA 3VDAA 4BS0A 4DI9A 2P1FA 4BF5A 4FMVA 1BRLA 3BLLA 2YSWA 1HO1A 2YIHA 2YB4A 2XVLA 3TTOA 3B97A 4F2BA 1NFBA 2V68A 3FW6A 2CLHA 1PCKA 4G9PA 1OADA 5DCDA 4AC1X 2DZSA 4QE1A 2CLPA 3VD9A 1BWKA 5I3FA 1KGWA 4ZB2A 4ORIA 5J04A 4K8GA 4LVBA 4IPIA 3U4FA 4A8IA 3QLDA 2B31A 3WLPA 3B06A 3T6CA 4Q22A 3CV1A 2ZCGA 5FJUA 5E93A 1W1PA 2CBVA 4GZ7A 1JAEA 2VP8A 4JIQA 5U7SA 5HPOA 1MRAA 3O2LA 4JQAA 5DMMA 3PULA 4B3LA 3MTWA 4OOZA 1FWNA 2CW6A 1OX4A 4JTRA 4EPDC 3Q2DA 2RGLA 3GHRA 5EMJA 4GKLA 3EMCA 2XZ9A 1TV7A 5K9XA 4MVAA 3ETRB 1H61A 2VX7A 4C6IA 3JS3A 4N4PA 3S1UA 1E9YB 4H4IA 4KFPA 1GGOA 1V77A 3EPMA 1H51A 4O19A 4N6EA 3SBFA 3L4VA 4Z1YA 4C65A 1LJYA 2D24A 1AQFA 1OEPA 1AJ2A 2ZX5A 3USBA 2XISA 3K30A 1JRBA 3R10A 3NS1B 2A85A 1QNRA 3M07A 2Z6JA 1OFOA 1REQA 1N82A 2DT2A 1TZ7A 2BLEA 1XLCA 5E6YA 1KQZA 3QBUA 3CU2A 2VDHA 3C2EA 4YHEA 3WF4A 1IZJA 2EKCA 1XIBA 4FNRA 2D3NA 5EGRA 3P5ZA 4L61A 3M0MA 2ZWYA 3CWNA 3DGRA 4OHQA 4GIEA 1UP0A 2X8RA 1B4EA 1RD6A 1GV4A 1KBBA 1F7BA 3E9AA 2VGFA 4QX4A 3HN3A 2PDFA 3BL3A 2JFEX 2ZE3A 3SADA 3TN5A 4JEQA 4BI6A 3KTXA 3GTHA 5HR7A 1UD3A 4PMOA 1XXXA 4MDPA 4U3AA 1MW1A 3B4YA 3WIJA 4DBDA 2RGMA 4EM4A 4AHQA 5E9XA 8XIMA 4DJFD 4GQRA 2Z24A 4B9YA 3OJGA 3CZGA 4D6CA 5BROA 3HA1A 3UWUA 2PTWA 3HIJA 4YCOA 3TVAA 1KFCA 1NWUA 3WKZA 1Q4NX 4KPRA 1W8SA 3AHZA 3F4VA 5D05A 2XIOA 2HWGA 1GKPA 3SAZA 2GL5A 3N15A 5SWUA 3VGDA 4I5UA 1T5AA 1V6WA 3VGHA 4ZFCA 3M6YA 5DY2A 1DYSA 4P8WA 1ONEA 1HKJA 1DJWA 4GBUA 4W7UA 2WC4A 1GVYA 1OK4A 3GG8A 4Z1AA 5AVNA 2E5AA 3LRKA 5KMYA 5G1YA 4MYAA 4UZSA 1LQ2A 1RALA 3RRXA 1HP5A 3CO8A 3FAXA 2HPIA 1CGWA 3B8DA 2ODOA 3H54A 4BJHA 3QFWA 2WYSA 1B3VA 3OBAA 2BXZA 1JROA 4Q8WA 4TIMA 3DHUA 3FEMA 2J77A 3NZQA 2ZVRA 3G6LA 5I79A 4K6AA 4MLRA 2O9PA 1EC7A 4J57A 3NFUA 2Z1WA 1GREA 3HQNA 4M80A 4JFUA 1IHIA 5DMLA 4L5ZA 2WNNA 3CHVA 5AC6A 1AG1O 3MHGA 1MDRA 3URNA 3DK8A 3CEPA 2AL2B 4MYXA 2GQWA 4CQDA 5FS7A 4PH6A 2G3IA 2OYMA 4IGMA 4NJJA 5U4NA 3INPA 1EZWA 4V28A 1UZ1A 4HYWA 3EXRA 1DJHA 1GW1A 2V81A 2YW3A 3DG7A 3MS8A 1JDEA 4RNIA 3SDOA 3SN4A 4PB3A 3PWAA 4UTWC 3T7VA 3N9KA 3TR9A 1UKOA 5EBAA 5DT7A 4TX6A 2INZA 2OLSA 3PAJA 2PDJA 1SZNA 2V5LA 4QFUA 2G97A 1Z48A 4JXCA 3P81A 3DECA 2HSAA 3EX1A 3A7UA 1G0CA 5BOEA 3TXZA 3WNKA 4B15A 3K2GA 3VIHA 2GSJA 2O56A 1KGXA 3AIBA 3SGZA 4HB7A 2YDRA 3HG5A 1QXLA 1UB3A 4O8AA 4PB4A 4LU0A 2BY2A 1G4PA 3PZIA 1KM1A 2HDJA 2PWHA 2EPKX 4EMJA 3GB6A 3TKFA 1VCVA 1EGMA 1FA2A 1A53A 4B4FA 4U5KA 3SUTA 4EXQA 5REQA 4J3ZA 2C1HA 2J7GA 2R1PA 4GHRA 2BP1A 3LSCA 4F0MA 3HBLA 3CHDA 5IBXA 4BZYA 5DQPA 5DY3A 2PWVA 3S5SA 3RK8A 4QEEA 4G1KA 3VNYA 4W86A 1NAL1 5DANA 3A13A 1FQ0A 3ZWTA 1Y65A 3WLJA 3B9NA 1X2HA 1OC7A 1S2WA 1V6VA 4WEVX 2J78A 1MWOA 1L6WA 4XKMA 1XGDA 2G3FA 1Q6LA 1UZ4A 3ZJ7A 2X50A 3ALGA 1F3EA 4US5D 2X8GA 4TV6A 3GG0A 4YNGA 3S6TA 4XUYA 4V1XA 5F7UA 3W1QA 1XM3A 1ZBVA 1V02A 1AA1B 4AMCA 4DUOA 3ARUA 2DZWA 5CQ1A 3SUSA 4QLJA 4BF7A 1UYQA 3HGJA 4ACYA 4OWGA 3L2IA 5F4XA 3MY9A 1VPYA 1UPPA 3ITVA 3RJYA 2EPOA 3VO0A 4PMZA 4YS1A 2VI0A 5K7JA 3GC2A 2PLKA 1DIEA 2CZFA 2V3AA 5G4WA 1H1YA 1BSIA 4H8VA 5CPMA 2I5GA 1OFQA 4QQ3A 1UOZA 1NHSA 1W3NA 2EQ7A 4RNJA 4US6A 3HW2A 2ZXAA 3BTNA 3RPMA 2Q3RA 3B0YA 1XWYA 4WSHA 1GW9A 2EQDA 4PCPA 4H00A 2XGIA 4J40A 1TA3B 1B9ZA 1E1CA 1AMYA 2FB2A 3NIYA 1XRSA 3GVGA 1EA9C 4S3GA 4XZIA 3AMDA 1I2RA 4HU4A 5I78A 3E1F1 4DM2A 3GU9A 3S5YA 4DUVA 1H7NA 2F6XA 3K1DA 1XDIA 4MY9A 1RCQA 2VX4A 5D8ZA 2X99A 2XVKA 1UZHA 4QEHA 5BWFA 4DAFA 3GG1A 5GJNA 2X05A 2TPSA 2XWEA 1JCXA 4PCNA 3LI1A 3ABXA 2ZOXA 4UNKA 3T40A 4DWSD 1EB3A 2VD8A 3MWCA 4QGCA 2V3EA 1DVJA 4Z1BA 3F4WA 1W5QA 2E09A 2ZZBA 2NQLA 1IEXA 4PSPA 2VYOA 1ISYA 1BFNA 1TJ2A 1ZSXA 4WJ8A 1SW7A 4JCLA 3ID7A 1TIWA 3SY5A 4HNTA 4AHPA 1VEOA 3MI3A 3PAOA 1XH2A 4XTIA 1EJXC 3DC8A 4K8EA 1TJRA 3TW6A 4WLCA 5ABFB 7ODCA 3UVAA 3HV8A 1OYCA 1E4IA 1S39A 4Q4MA 4MF4A 4DYJA 3RUBL 4B16A 4IJBA 4KT2A 1KO0A 1OYAA 3A21A 1WUFA 1KLZA 2J9XA 1LYXA 1TJ1A 2DSZA 4JN8A 3W38A 2QVNA 3W1UA 1S2VA 1ZBCA 1P0NA 1GPFA 3OC4A 2J4GA 3APYA 2BVDA 1YTDA 4H4PA 4ZO9A 3PF3A 1KRMA 5BRPA 1JUEA 1QPQA 2FKPA 1VR6A 1RJPA 2WVTA 4GYPA 4JHOA 1ZFJA 3O0FA 2QMJA 3N4AA 2WW5A 4XAFA 4MWAA 1PZ3A 3N34A 3KAOA 3WJWA 3T09A 2Q8LA 4H7ZA 4S38A 1BVZA 3CV2A 3HG3A 3QV8A 4YTTA 4J1OA 1UWIA 2V3FA 1C8YA 3P3BA 5G2IA 1XIFA 3WL0A 2XINA 3RMJA 2C3CA 4V15A 1NARA 1CXEA 3G6MA 2WMIB 4S3DA 5CH9A 3WJSA 2NQ9A 6CGTA 1MRQA 3GH7A 2QJIA 3TJLA 3NDYA 1NIUA 4K8DA 3S2NA 1H0IA 1MUCA 2I7GA 1XBXA 4G6CA 4IIEA 1P0KA 1TYTA 3W9ZA 4S3EA 3PFMA 2UY2A 1E4LA 4H01A 3PR2A 3W23A 2WANA 3PS7A 4WRHA 1PB0A 4PMRA 4GI4A 4QITA 1ZHAA 4D8LA 4QG8A 1HJUA 3MHFA 3WMBA 4I9MA 4HNCA 3QZ6A 3BG9A 3CT2A 4QRNA 3UXKA 2BODX 3OVRA 2W3ZA 3BPWA 1WKFA 1VHNA 4P7QA 5BMXA 3PG8A 3WLMA 4MJ2A 3DFYA 1R9YA 3H53A 1QFEA 1OX6A 4IPPA 2V9DA 1N62C 3NQCA 5HXMA 1P6BA 4KPLA 5C9UA 3WEZA 3UJSA 4OV4A 2VM8A 2ZUMA 3AALA 4JKKA 5BU6A 3WUFA 7TAAA 1PVNA 3UR5A 1IQ8A 3NM1A 2ZC1A 3OGVA 4HU8A 3C56A 3KBSA 1VRXA 4QJ4B 3GTIA 2GJRA 4K2SA 3WJYA 3CGEA 2ZDSA 5BRBA 3NVWB 1EBGA 2PZNA 3IV8A 4JR5A 1R3WA 4PR4A 2RJGA 4Q4KA 1PX3A 4M1RA 3H26A 4G8TA 3RCNA 2PDWA 2ZTKA 1J11A 1TYGA 1I9CB 3VKDA 1W9BM 3UESA 3VDGA 4JBRA 3RX2A 2QPUA 1FY6A 2CLEA 3FOKA 2BMBA 2PDPA 3T2OA 2FH6A 1SW3A 3WENA 4HMDA 2WZIA 3URHA 1FRBA 2X1SA 2FTWA 3O1NA 4JAWA 4QXIA 3CUHA 3LM3A 1XKYA 2YFOA 5G2WA 4NNBA 2NQZA 4P7RA 4TX8A 4NZ1A 4L9YA 1QW8A 3AIQA 3G1VA 4QSHA 3S9IA 3L4XA 3AXXA 2W6RA 4J3WA 3MSYA 1Q66A 2FPTA 1KNWA 3GYCA 2BSLA 3PBGA 2V63A 3W29A 4FIQA 2KZHA 1UMLA 1XLFA 4Q8OA 2XIJA 1C9WA 2DSKA 4DJED 3DK9A 1R8LA 1Q6CA 2UV8G 4F79A 4UFJA 2ATMA 3UZJA 2YDQA 2XWDA 3CZLA 3N2XA 1OYBA 3NO5A 4LC8A 3TAOA 1EWEA 1HJVA 2B4GA 3P80A 1FP9A 4GX8A 1E6XM 4C1LA 1TVNA 3CS2A 3H2OA 4OZOA 2NWSA 1A49A 3UXLA 3G8RA 2VTFA 3QQWA 5CAKA 1KV5A 3GUWA 3W7NA 5HQMA 1EHNA 4JQ3A 1EP2A 1MEWA 2Y24A 3S1WA 2QF7A 4WGHA 2GYIA 2P3EA 2HS6A 2GVEA 1LLZA 1KTCA 1XD1A 3ZR5A 2Y70A 2XUCA 4WF7A 1ENUA 1JI1A 4S2CA 2GGJA 1X7IA 4WX2A 1E72M 1ZL1A 4Q8MA 3MW7A 1LQAA 5CJMA 1UR4A 2CPUA 3TOYA 3FLUA 3PY2A 2DT3A 3AYTA 4OJYA 4IHCA 4LUTB 1TPFA 1MXGA 3WH6A 1E15A 3DX5A 4AYSA 3CLMA 3OQ8A 2YLAA 3E96A 3SCQA 2DUAA 4CNUA 3GZAA 3ENLA 4ASTA 5CLTA 3NJ3A 3IV3A 5A6AA 3SO7A 3W7CA 3PM6A 1FHUA 3SR6B 2CHOA 4NHVA 4GCAA 1F07A