3FVDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
361
Chain Sequence
SLRITRLTVFHLDLPLAKPFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a member of enolase superfamily from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
rcsb
source organism Roseovarius nubinhibens ism
molecule tags Hydrolase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 117
structure length 361
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fvdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fvdA01
4GIRA 3S47A 4K2SA 2PCEA 5FJOA 3TWBA 1FHVA 2P0IA 3R0UA 1KKOA 2PP0A 1FHUA 3KUMA 4JHMA 2OG9A 4F4RA 3TCSA 4FP1A 3K1GA 2PTYA 3TJ4A 4KT2A 3OW1A 3N6JA 1JPDX 4HNLA 3VC6A 3OZYA 3QN3A 1BQGA 3UXLA 4HCDA 3DFYA 3TWAA 1TE6A 3QKEA 3OPSA 4E8GA 1MNSA 4MGGA 2P8CA 2DW6A 4X2PA 4ZA0A 3D46A 4K1WA 4JN8A 1KD0A 2HXUA 4H19A 3EKGA 2XH4A 1JCTA 3DG7A 3P3BA 3BJSA 4ENLA 6ENLA 3PWIA 3UJRA 1ELSA 3VFCA 3MQTA 3PK7A 3NZGA 1P48A 1IYXA 4H83A 3PWGA 2GGHA 1SJDA 3TJIA 3QTPA 4IHCA 3GO2A 3CT2A 3IJLA 3DDMA 3ES8A 4Z17A 1P43A 1NELA 1F9CA 3TW9A 4DHGA 4IZGA 2QJJA 3T9PA 1RVKA 2PS2A 2O56A 4ZCWA 2PTWA 3UXKA 2OFJA 3DG6A 4HNCA 2PMQA 3NO1A 4DYEA 3ZLHA 2PTZA 1WUFA 1R0MA 2GDQA 4HCLA 4HN8A 2PPGA 2HNEA 2QVHA 3FV9A 4G7FA 3UGVA 4IP5A 4KWSA 3PFRA 3Q4DA 3P93A 3OP2A 2HZGA 2P3ZA 3HPFA 2PGWA 3JW7A 3GD6A 3MY9A 1TZZA 4E5TA 2ZC8A 3CAWA 4IL0A 4GYPC 1OEPA 2OZTA 3CXOA 2QQ6A 5J04A 3N6HA 2OZ8A 4HYRA 2OQYA 3NXLA 4JN7A 1EC7A 2PGEA 4GYPA 3FCPA 2XGZA 3QLDA 7ENLA 2CHRA 3MWCA 2PU0A 3SSZA 4A3RA 3JVAA 1TKKA 2DW7A 2OVLA 3DEQA 4HCHA 3RCYA 1WUEA 3VCCA 3STPA 2RDXA 4H1ZA 4M0XA 3DG3A 2AL2A 4IL2A 1MDLA 5BOEA 2GGGA 3BOXA 3RR1A 3IK4A 1W6TA 4DWDA 2QDDA 1JDFA 2PTXA 3H12A 1NU5A 3DERA 4K8GA 3UCCA 1MUCA 3RO6A 3TQPA 4DXKA 5FJTA 1XPYA 1L8PA 3Q45A 3UCDA 3D47A 2ONEA 1PDYA 3SN0A 2AKMA 4E4FA 3DFHA 3B97A 3RRAA 3H7VA 4GMEA 3R10A 1DTNA 2ZADA 3R11A 3FYYA 3DESA 4DN1A 2OPJA 4DX3A 2POZA 3MZNA 4FI4A 4G8TA 3T4WA 3UJSA 3THUA 2OZ3A 3H70A 1EC8A 3R1ZA 3R25A 1E9IA 1JPMA 1ONEA 2OO6A 3IJQA 2AL1A 1PDZA 2OLAA 3ZLFA 3MUCA 3BSMA 2P88A 5EU9A 2AKZA 3I6EA 2GGEA 3V3WA 4GGBA 2NQLA 1XS2A 3GY1A 1SJBA 2PA6A 2HXTA 5FJUA 5FJRA 1MRAA 3ZLGA 3ZVIA 3T8QA 1ECQA 2FYMA 2QGYA 4MKSA 3FJ4A 3V5FA 3I4KA 1EBHA 3UJFA 3I6TA 3V5CA 4H2HA 2GGIA 3CYJA 3U4FA 2PSNA 4HPNA 4GISA 2FKPA 3FXGA 3NFUA 3VA8A 4E6MA 4EWJA 3MSYA 3ZVHB 3FVDA 1EBGA 4M6UA 3U9IA 3V4BA 3RITA 3GC2A 3DIPA 3RGTA 1KCZA 5BOFA 4J3ZA 2OKTA 3H8AA 3N4FA 4IP4A 4E4UA 4A6GA 1R6WA 2PP1A 4GGHA 2P8BA 4KEMA 1KKRA 2MNRA 3SN4A 3SJNA 4IT1A 3TTEA 2OQHA 1EC9A 3EEZA 3UJ2A 2XH0A 3MKCA 3S5SA 5IDZA 2AL2B 4KPLA 2PODA 1MDRA 3T6CA 2XSXA 3QPEA 1SJAA 3SBFA 1YEYA 5ENLA 3CB3A 4A35A 3OZMA 2GL5A 3VC5A 2PP3A 3VDGA 4Z1YA 3N4EA 5FJPA 3UJEA 2PU1A 2GSHA 3ZVHA 4J1OA 4GFIA 1SJCA 2I5QA 4YWSA 2QJMA 4MMWA 3DGBA 3SN1A 3OTRA 3P0WA 2MUCA 3JZUA 2GGJA 2QDEA 2XH7A 3TOYA 3VCNA 2XH2A 2QJNA 3CK5A 1BKHA 2OX4A 3ENLA 3SQSA 3ES7A 3IJIA 3R0KA 4ROPA
chains in the Genus database with same CATH superfamily
2WHLA 1Q2SA 2ZE3A 4E8CA 3OQEA 1BF6A 1U33A 4QE1A 4DWSB 4PL2A 1WZLA 5BZAA 9RUBA 2HE5A 1TIMA 1IEQA 2V3FA 2DSKA 1M1BA 3O07A 1M7JA 3G0UA 4X2RA 4J40A 3AXMA 3OBEA 3WDRA 3K8MA 2A79A 2X1IA 3APTA 1AW1A 1WZKA 3O8AA 2QW5A 2ZX9A 3NL5A 3NQMA 1HG3A 1I9CB 3N6JA 4HNLA 3N73A 4JX4A 3DJJA 1PTDA 3NEHA 2WB5A 4OBSA 4TV6A 4CNSA 2WZHA 4UNIA 5BNKA 4RR4A 4AHOA 4C5ZA 5K2ZA 5AFDA 2UY4A 3UXDA 1JGIA 2PI6A 1W1VA 2D1ZA 3AS3A 3CQIA 4IQLA 1OABA 1R30A 2A3HA 2DW6A 1XICA 1Q45A 5A8OA 5EMKA 1D7FA 2OCZA 4LEQA 2EQ8A 3LRKA 2ZUVA 1M3UA 3BMWA 5B80A 4JKKA 1XWYA 4HHPA 1HTIA 1V03A 5FSDC 1CWYA 2J66A 5C71A 3LEPA 4JKMA 4HU0A 1VB9A 4AD0A 5I3DA 1YHTA 3GFXA 4GVIA 4I7UA 4XD4A 3EX2A 2BC0A 3J7HA 2PRMA 1XYFA 3UZXA 4WX2A 1A5KC 1ISYA 1TYTA 3ITOA 2QNEA 1F9CA 5H8PA 3TNOA 3TEVA 1M68A 5JH2A 2EJAA 3GDKA 1NF0A 3QR1A 4QIUA 4K7VA 1UOZA 3ITXA 4C6CA 3VIFA 1OK4A 3DH9A 4LXFA 2VCBA 1A49A 1HW6A 3ARXA 2DDXA 4YVPA 3UYCA 1JROA 1J01A 1K8CA 2OOGA 3E1F1 4MLRA 3KOYA 3PUOA 1B3OA 4D1JA 4A3YA 4R33A 5JU6A 3GD3A 4HKPA 5C54A 2XN1A 1EO7A 1KRAC 3REQA 5AYBA 3ITGA 2VFIA 2GQ8A 1JEHA 4DWSA 3SQLA 2ZX8A 4Z0JA 1XBZA 4DYKA 2EPKX 3L67A 4WDXA 1EX1A 2W6RA 2VTFA 1XDLA 4H9ZA 3TP4A 3W07A 1PUDA 4CVWA 3LGDA 4JTHA 1TYGA 3VOIA 2HDJA 4EXBA 2WVUA 3WFLA 4JR5A 3M6YA 3P5YA 4YJ5A 3DYPA 3JVAA 4GLEA 1CEOA 4DIAA 4QLJA 3FJLA 5CJ5A 1ALDA 3MHUA 1GWJA 3VGBA 4H6QA 4KWWA 3CHCA 5I3IA 5EMJA 3GBDA 3STPA 4K68A 2QCGA 5HWJA 3L8KA 5HMSA 1GKRA 1GOOA 3VD5A 5A8QA 3U4AA 2X8RA 3KL5A 4I90A 4M6PA 5C8BB 1X1OA 4G7EB 4JD4A 1H2JA 1R85A 4ICCX 2GVYA 2DZAA 2GR2A 2RJGA 4XD6A 2DVXA 4AH7A 1QU4A 3WO8A 2D0HA 1XRFA 4PTXA 2IPGA 2OXNA 3MI3A 1MZHA 1TWZA 4ATDA 5BWFA 5D9PA 2HQMA 4O10A 1DEDA 5DANA 1HP5A 1J0YA 4Y7EA 3PUEA 1GJWA 1Q6GA 3AROA 2DVUA 1CXEA 2PLJA 1DOSA 1CT5A 2NX9A 2WOIA 3B03A 1GVIA 1LUCB 1MZRA 1W9PA 2GQ9A 1HF6A 4O1EA 5G2WA 4N02A 3W81A 5DMLA 1O60A 5AECA 4HTYA 3LSBA 3WYZA 3B9EA 2QF8A 5IBXA 1PWMA 3U5YA 1W1IE 4YIWA 3D3AA 3SY5A 1ZNNA 3PPFA 1ICSA 1UZ1A 3B8UA 2W5FA 2NQHA 1JD9A 2XDFA 5C9ZA 3MKKA 4QR6A 4U10A 2D73A 3VTRA 1EDQA 1A0EA 3ARVA 3R94A 2GGIA 3QFWA 1G4EA 4CU6A 4B91A 2NXGA 3M43A 4CUCA 1ISXA 3E0WA 1E6QM 2EKGA 1RQEA 3KCOA 1RPXA 1YXDA 4KGLA 4K8EA 4IPLA 3F5JA 1RP8A 5BOFA 4J3ZA 2XIQA 4HGXA 1F61A 3A7AA 1V0KA 1XC6A 1A5UA 5CPOA 2P8BA 1R3VA 1E73M 1OFBA 4F2BA 3TTEA 1FKXA 1YYAA 4QGCA 5D9NA 4POCA 3WNNA 1TFVA 3UW6A 4ZOHB 3NO3A 3SRHA 4I5UA 2Y63A 3B8DA 4NZFA 3GRTA 1TG7A 2PODA 4RNFA 1JYVA 3E49A 4R88A 1F7BA 3N9KA 3W7GA 2QAPA 4DXXA 3NJ3A 3LM3A 4XBSA 3M9YA 4GUIA 3NR0A 3BLOA 4EM3A 3HPAA 3WD3A 4AF0A 2G50A 2BB0A 2F7FA 4MMWA 3NURA 1F3TA 5G1TA 2PRLA 1ENUA 1RA0A 5FEZA 1U1JA 3WLRA 2FQIA 2B7NA 1H3GA 4Q4SA 2O92A 2YB4A 2PD5A 2XH7A 2KAUC 2NQZA 2X0HA 4V33A 3BQ5A 3B40A 2EGZA 3DFQA 8A3HA 3QSRA 4XQ6A 4FNTA 4DI9A 2V68A 4BR1A 3NGJA 3CZ8A 1VEPA 4LCQA 4O8AA 3ZR5A 3Q65A 1UKTA 8RUCA 2ZVRA 4G6CA 3PZIA 3C3UA 3L12A 2A2IA 1IEWA 3ARRA 3WDPP 1VAHA 3R13A 4UTUA 5KSWA 1JJKA 4UOJA 1WX0A 1WKEA 2J9ZA 3NSNA 4DYJA 1RR2A 3MBFA 4ZQMA 1HJUA 1OD0A 1GRBA 2RJHA 3QGKC 3SM0A 1IEIA 1ZK7A 3NTYA 1K9EA 2HEJA 2W66A 3BMXA 5FEWA 3VC6A 4WOZA 1PX4A 1NVMA 4WKAA 1DJNA 3UWZA 4A8IA 1LLZA 1QPNA 4W93A 1X7FA 1XC4A 1EJXC 4HQVA 3HG4A 5F2LA 1PWLA 1TPFA 3DHFA 3CGTA 1ODZA 4JTFA 3YPIA 4GKLA 3CZLA 3LZ3A 1JCTA 5CKSA 3WMCA 4HZ8A 4D6FA 4HU3A 3BW3A 4NYYA 4OBRA 1XHGA 1L2UA 1HUVA 3N14A 3UR5A 3N17A 5A3HA 1MO0A 4QJ4B 2DT0A 5C9WA 2DT3A 3BV4A 3CT2A 4JFSA 4PBEA 4URIA 5I24A 1JCJA 3H2OA 3O9NA 2HS6A 4F40A 2PS2A 4MKVA 1LOLA 3RX2A 3T9PA 3VK5A 4ZCWA 4IMCA 4H8UA 1WQ5A 3PSVA 2FZ9A 3MU7A 2X0SA 3VIJA 4MWAC 1OFQA 4W89A 1G4PA 5I06A 3G77A 4YN5A 3SJ3A 4W8AA 2V3DA 1A5NC 4PMNA 1EOKA 3BLKA 3W85A 1NTHA 1VJSA 1HJQA 3L2IA 4OHQA 2DJLA 3UF9A 1TZ9A 2C0AA 4WJXA 1ME8A 2NX1A 4NJJA 1XLFA 2A6LA 4JTLA 1UMYA 3W2JA 1LF1A 2R9ZA 3ANVA 2CDUA 2G3FA 1Q4WA 3K8LA 2V9DA 1WDDA 5XIMA 1EWEA 4GO8A 1JZ3A 3VNIA 5C2XA 1VEOA 4IG2B 3BTNA 1DXIA 4XAYA 2NQJA 3LN3A 1E4NA 3HG3A 1OYBA 1OC7A 2YQUA 5D02A 1L6GA 2R8WA 3GW3A 4IMDA 2Z6JA 4PMXA 4KWUA 3WH5A 2PU0A 3RYSA 3URHA 1OCQA 3MP3A 4H9TA 1X1NA 3B0PA 2WSKA 4E4PA 2PDLA 2NV9A 3DK9A 1T3QC 1AL7A 2BXZA 2DUAA 2QEZA 9XIAA 4MAVA 1F3EA 3TAKA 3NQFA 1WDWA 3USZA 4GCXA 3FAWA 3EAOA 1NFPA 3M0VA 1Z8AA 3UD6A 4B5UA 5FL1A 1K9FA 4E3VA 2NPXA 1XLEA 1S2CA 4UTTA 4UTWA 4DXKA 4X3ZA 4LX4A 4WD0A 2R14A 1EFZA 1RA5A 5H2ZA 2O9RA 2PDBA 1OFRA 4AZ6A 2IPWA 1AD4A 2AAQA 4TVUA 2CYGA 3M7WA 5C0QA 3S6TA 2POZA 5EMMA 2E6FA 3BLIA 1WBJA 1TYPA 1FP8A 3QMRA 2DORA 3LV5A 2NW0A 1TWIA 1V7YA 3K2GA 3EB2A 5CZ0A 3BQ6A 3SCPA 1AJZA 3L4UA 4QXIA 2ZZ1A 5CBBA 3GE7A 3WNLA 5CJNA 1FH7A 4AQLA 3W74A 4H41A 4BV6A 2GGEA 1YTDA 5FD0A 4IX2A 2YCLA 2YBVA 3M46A 4R7OA 3PTDA 1QHZA 2HBXA 4J9JA 4IUGA 2GJLA 3L23A 3HG5A 3OA3A 4W84A 5TF0A 2J8TA 3HF3A 3IJ8A 3GDTA 2DFAA 2J47A 1S2UA 3NVYB 2YCJA 3TTSA 5CLWA 3TC7A 1PZ1A 4X60A 1VF8A 1TPC1 1LRTA 1IF2A 4WEVX 2YL5A 3CHVA 3MVTA 4GO9A 5GJNA 3BZGA 3DIPA 2V5CA 5CBIA 4GRTA 1TPEA 3ABRA 2VDIA 3MHFA 3MSDA 3HURA 1SQ7A 2ZC1A 4PUNA 4MPKA 2G3IA 2YL8A 3N19B 2I57A 4HD5A 5ABFA 4LJ3A 2V5LA 4WCJA 3CGBA 4UQBA 2C13A 2OZ0A 2PF8A 1QXLA 1QI0A 1NDWA 1CGXA 1R9YA 1VIWA 2P0OA 1T0OA 5CG7A 5K7JA 3O16A 4AF0B 3U7BA 1BF2A 3K4WA 4S2CA 3RLHA 2EQ9A 4ATLA 5ENLA 1TX2A 1IHIA 2XJ7A 5IRPA 2FPTA 3HW2A 4PMDA 2GL5A 2MANA 1LOSA 1C7SA 3QHMA 5CC3A 5DQPA 4PTVA 4JTQA 4C7DA 1V0LA 1H7XA 3GDBA 3C0QA 4MFDA 3DGBA 3DHPA 3U48A 3P0WA 8CGTA 1JXJA 3G1FA 3N2CA 1W5OA 4H7VA 1LP6A 4LAMA 2CESA 3E2QA 4HA4A 2YSWA 2ZRWA 1GVRA 3CASA 4JX5A 4AG0A 4XKYB 4DVOA 4E2DA 3ATZA 3T05A 5BXRA 2WJFA 3B9DA 3W1PA 1THFD 1WNOA 3SFWA 2EQ7A 4M56A 2V5DA 1UMLA 3C52A 5C7HA 3PZTA 7XIMA 3P2VA 3N3TA 4LU0A 3KWSA 3O05A 2YLAA 2VRJA 1T5AA 3OHMB 1B4KA 1R7OA 1EF3A 4AIUA 4QISA 3R0UA 3M5VA 3ONBA 1H41A 2AOSA 1MW1A 3KTCA 3MMTA 1DJYA 5A6MA 4PL1A 4F4RA 3TCSA 3AMLA 4UNKA 4LS1A 2AAMA 1EO5A 4U31A 5AHIA 5GRTA 3WFZA 4GXPA 1A5LC 4FX7A 1XX1A 3S1WA 2XISA 4CQDA 1I4NA 2WOQA 2P8CA 4J2MA 2YXOA 2FB2A 1V77A 4JN8A 3CEUA 4RUBA 3SUUA 4GVHA 1DQWA 5MF5A 1DWGM 1UR2A 4KIRA 2OU4A 4RW5A 7REQB 2G4FA 1FVPA 4NQ1A 6ENLA 2JALA 4J56A 4X9SA 1LWJA 3MQTA 4GCAA 4PMJA 4GZEA 4GINA 3BLEA 2VUNA 4HMEA 3HBLA 3HGOA 5JCNA 4F9DA 1OBAA 2PLCA 3NEVA 3H6OA 2XWDA 3TX9A 4GYFA 4ZBCA 3OVPA 2XVLA 2D69A 3O6AA 1SSGA 2O56A 1QK2A 3M4HA 1MOKA 3MO4A 3FDGA 3LHUA 5C2GA 3AALA 4DEFA 4FA3A 4BY3A 1VLWA 3N9SA 4Q8TA 1XLJA 4QG6A 1DVJA 1GYLA 3ZLHA 3WJZA 1QBBA 3H55A 2QUTA 4UFLA 4WVXA 4CNOA 5FF0A 1B31A 4FPSA 5DMYA 1ZBCA 2R91A 3APGA 3CUGA 1X7IA 4UFMA 4DBEA 1G9HA 1JYXA 2NX3A 3M47A 4HBKA 3P93A 2CNCA 4E3TA 2OSYA 3CZGA 3AOFA 4DJDC 3I3EA 1XLLA 4YTUA 1EP1A 3VZYA 3LLDA 2PF0A 3CHFA 3H2NA 4DB7A 3IV8A 3P8IA 1FFRA 1KCKA 1WP6A 1JD7A 3KP0A 3AMZA 3BGAA 2OTDA 4A2RA 2VEGA 4HZMA 4EMWA 1EC7A 1LL7A 3WDHA 2VFDA 3IJ7A 2XGZA 3W01A 1XYBA 4WXYA 3W1RA 4Q33A 5M2FX 3W7RA 4A3RA 4H4TA 4UOZA 3NZ1A 3TROA 1E0VA 1BYBA 3THCA 1MFUA 3IWPA 3VNJA 4EIVA 1AQHA 3ZR4A 2E1DA 2VDGA 4S23A 2QJGA 5H1WA 3ARQA 4WK9A 4WDUA 4NIRA 1AW5A 2ZKMX 2WSQA 3HJZA 4UB9A 1QR7A 2BY3A 3UG4A 2REQA 1V3HA 2A0NA 3HV9A 2R9RA 3SGUA 2X40A 3EF6A 3S6OA 2BOFX 1KBJA 1QBAA 1DKWA 1PKLA 3TV8A 1NU5A 3LXBA 3FY1A 1T8XA 2RH9A 4L80A 3TYAA 3O6YX 4IFKA 3WQVA 2V6AA 2FDMA 2XM1A 2X09A 2AKMA 5DBTA 3NDZA 3UG3A 1M9HA 4GMEA 3PNZA 2P3EA 4PMVA 2CLHA 4Y8EA 3PZNA 3RRXA 5LGXA 3SCNA 1YNPA 4CD6A 1U22A 4GR1A 3T4WA 3GFZA 5CLTA 3B4YA 1MI3A 1ZDLA 1X2HA 4Y9NA 4O0QA 2A7PA 1VFHA 2JKAA 3VKDA 2CFFA 3BL3A 3H21A 4ZSUA 3W75A 1MW2A 2J7CA 4KWVA 1MEHA 3KOWA 3PAJA 1XS2A 4ZO6A 2PA6A 2PDNA 1BWLA 3ZLGA 4YS1A 1UD5A 2FJUB 3OO2A 3LADA 1Q13A 4PRTA 3ZYZA 3LOTA 5CPNA 1DNCA 3T09A 1L0PA 4BJHA 1J4EA 4DBSA 4U2ZA 3TZFA 2GUUA 4W5UA 1V79A 1FDZA 1YW1A 3KL3A 1GOXA 4P8UA 4E6MA 3ZS4A 4RNHA 1W31A 3A12A 5KVHA 1GXFA 5A6TC 1N8IA 3ANYA 2C1GA 1Q6FA 4ERAA 3WUEA 4D71A 3G1HA 4M7SA 3H2MA 3KHDA 3LCXA 5K4ZA 3GLCA 2VKZG 1EUNA 3WENA 2JEPA 3M16A 4KFNA 4PFHA 2ZICA 4KFOA 1BQCA 1W5MA 2V5BA 4RW3A 1VKFA 5AY7A 4IT1A 3MUZ1 3FFSA 2VQTA 3L0KA 3I10A 1K7XA 5EMYA 2R1KA 3OZPA 1BEUA 3OBKA 4GFSA 1F6YA 4I3GA 4I5RA 3QV7A 3AHVA 4O28A 4K6AA 3PBYA 1YMYA 5JIWA 1GZGA 3VDCA 3RMJA 1JNEA 1VPYA 4YTTA 1UYQA 2VC5A 1O6IA 4A35A 3UR7A 4H04A 1J8VA 3T7VA 3S83A 1DXEA 3BVJA 5IOBA 2CZVA 1PAMA 2GSHA 1K77A 5LHEA 5LIYX 3DH7A 2E77A 4S38A 4TV5A 1GEQA 1R87A 2I5GA 4YHEA 4GC4A 4CQ9A 4QCEA 3NQAA 3VOGA 4AVFA 1R3RA 5IBXC 4Q8WA 2HPMA 3HN3A 1GRFA 1BGAA 1OG6A 2O55A 3DKJA 3TH6A 3VIGA 4RPQA 2YA0A 4PMZA 3A6OA 2B4GA 1W54A 3W1TA 4AISA 3W37A 3DC0A 4CNPA 4JIRA 1MMFA 3AICA 1NQKA 1NOFA 4XD5A 3FEMA 1WOBA 1Q7MA 3G22A 2OYKA 2F84A 1E5JA 4A4AA 3QQ1A 4M19A 4QAWA 2ZUWA 1KKOA 3CL8A 3CZJA 2PP0A 1TJ2A 5ABFB 1VBGA 2XVNA 2H3DA 2DVTA 2Y88A 5C9RA 3NPVA 4Q7BA 2PDKA 2TPSA 5E9XA 2PDQA 2TSYA 3OJGA 1GUVA 4X0NA 4LYPA 4KIEA 4E8DA 2JKEA 3OZYA 3GC4A 1M01A 1CENA 1F76A 1CECA 1CZ1A 2Q8XA 3A24A 3MS8A 1MEIA 3TWAA 1TE6A 7REQA 3OPSA 4MWAA 1BYDA 3W2UA 2QPUA 4YU1A 2J8GA 1I0DA 4QSFA 2HXUA 4ZQPA 3AO0A 4P8WA 3EKGA 3EOUA 1EQPA 4P61A 1YXYA 1BRLB 3LG3A 5I77A 3UJRA 1TWSA 1JDAA 4N9CA 3P14A 4NVTA 1SMDA 4Z2JA 1XGEA 2D3LA 4Y9OA 1UC5A 2W0HA 3KW3A 1MW3A 1R47A 1SFLA 2C3CA 4CD7A 3L4WA 1EOMA 2QLYA 3U5UA 1E1CA 4QSHA 4Z17A 1RVGA 3HJEA 1XANA 4GNKB 2BY0A 3DFPA 4MB3A 3SI9A 5LXEA 4Z1DA 5DY2A 5L6UA 1KTBA 4FIQA 1ZTVA 2J9YA 2Z00A 4UZUA 1J9YA 2ZX5A 3NO1A 1C93A 1DXLA 2QVNA 3PR2A 4B4FA 3RF9A 1GVFA 2CC0A 3PTQA 2HNEA 3GHRA 2VEIA 2QVHA 3WUFA 5HJLA 3T2PA 1E6XM 3ABSA 1JQXA 5I02A 1K4QA 2EG8A 4OTKA 2BZNA 4HU8A 3TKFA 2YFOA 3MUY1 3QHNA 4DWSC 2ZUTA 3S9ZA 2C15A 1VBJA 2BVYA 3NSXA 4Z2GA 3RU6A 1W3JA 4IH3A 1GOKA 1F5ZA 1UR1A 2UV8G 3CUIA 4B5TA 4GX9A 4MWAD 1YKWA 3A4JA 1WE5A 4V2XA 4M24A 1J2WA 1P0EA 3EAUA 3M0LA 2CETA 2VELA 4H6KA 4DO5A 1XLKA 3EXTA 2HRWA 3EDFA 4XVDA 3WBAA 4WY0A 1XLHA 4B16A 1VP5A 5J8LA 4C7FA 3GIPA 2JF6A 1W3HA 1TRIA 4C6BA 4ZB2A 4MJ4A 4HCHA 2DIKA 2QS8A 4IMFA 5FS9A 1F4AA 3DG3A 1B54A 4YWOA 2PDMA 3NSMA 4PRRA 1KRMA 4TTGA 4V1XA 4P7LA 4Q6JA 4XWUA 4DWDA 4D6CA 1XYMA 3RO6A 1E0XA 4ORIA 2J6VA 2OLHA 2YXGA 5E6ZA 4M3PA 1QO2A 2BS9A 3QYQA 1GG0A 4AEOA 4C6DA 2FVKA 1F3PA 3SN0A 4CKQA 4GIYA 4E4FA 2ZADA 3M5ZA 2YYTA 3DCPA 3URNA 2OPJA 5D30A 3VVGA 3IUIA 4GJIA 2PLKA 3K5XA 2Y8UA 1XIFA 3TIMA 2FGZA 1E9IA 3M44A 4ZO8A 5LIWX 1ONEA 1OSEA 3IJ9A 3OLEA 1UH4A 3GYCA 3VM5A 2XSBA 5BXTA 3E0FA 2BWGA 2VFEA 4BKNA 4QNEA 5CPSA 3WH8A 4EMJA 2DZVA 5HUPA 3GXFA 4PUDA 3W26A 2F6XA 1ECQA 1DJZA 4GY0A 2KZHA 1AODA 3TN3A 3BK0A 3RU8X 3CV1A 3KS6A 1PJ9A 2VOMA 1FWBC 1TVPA 1HKWA 4WSKA 4GE8A 4BI5A 1LT8A 5AHNA 1YQ2A 5A6BD 1XSIA 1X1ZA 1AA1B 1UH3A 4C6QA 2FTWA 1N5WC 3VIKA 4HOXA 3AS1A 2RAGA 1XH0A 2PFHA 4ICMA 1ZFJA 4ZOCA 1KKRA 4AIBA 2VRKA 2QXWA 3VM7A 1FOBA 2CLPA 3JS3A 3PC0A 1ZMCA 4C1NB 4IUOA 1FTXA 2PWHA 4F0HA 3BJFA 3GUGA 1CXHA 4LBUA 2EPHA 1DTUA 5C6MA 1GG1A 5JBDA 1JF5A 1W56A 4FSAA 1OHLA 3O1NA 3VKBA 3A3WA 1DIEA 3T2OA 1EIBA 5DMNA 1JZ8A 1XV8A 1RJPA 1TV3A 4ADWA 1WYGA 3IGSA 3EA1A 5D37A 2LLEA 5BYWA 3SGGA 1V6WA 3AIEA 2FH8A 3TOYA 1N8FA 1CXIA 1R3SA 2OJPA 4YVVA 3CK5A 3GNNA 1BKHA 3N2OA 4KEZA 2YL6A 3VNDA 1JQVA 1B0IA 3R43A 4YTQA 1ITXA 2GQ3A 5EKYA 4K2SA 2PCEA 4DO4A 3FGCB 4EF9A 2IUZA 4B9ZA 4DLFA 1FCBA 3TWBA 3W1XA 1XQKA 1HN1A 4OECA 1XH1A 3IIXA 2HWGA 1W5PA 4OVXA 3ZQ9A 4ALDA 3CC1A 1IIHA 2BGNE 4PSRA 4O18A 1UA3A 1S2TA 2R24A 4QAIA 2BY2A 4H9UA 1XL9A 5F1UA 4C6FA 1TJ0A 4ZGYA 3KFTA 5I3FA 5HMFA 5I3GA 2BOGX 2GYIA 3OW1A 1R5YA 3A21A 3TW6A 4QDWA 4XK2A 3QN3A 3QM3A 2QCHA 2BHZA 1EJ7L 1O66A 2DJXA 3QTGA 4H00A 4JTSA 3LYEA 3VIPA 1Y0EA 3BO9A 1V5XA 3BURA 2OO0A 1FDYA 4XAZA 2G97A 2FHBA 4I8YA 1E6SM 5D8WA 3A5VA 3W25A 3G3DA 2WOWA 5FF4A 1EYWA 1JFHA 1SYTA 1GORA 4H19A 5HPCA 2XH4A 2WJDA 1PIGA 2OGJA 5U7SA 1F6KA 3TK7A 1WDPA 1ZCOA 3GR8A 4H8HA 3WEOA 2TMDA 4IMAA 3KAOA 3GO2A 3EDJA 1LQ2A 1LJYA 3IJLA 4LTSA 3S5ZA 3TLLA 4BEUA 4W85A 3WNOA 2BNJA 2XVPA 3TYUA 3CH0A 2WMIB 4MZ8A 2W3SA 1UHVA 1ZHAA 5CSSA 3ZJ7A 3BDKA 5C5YA 3BXWA 6REQB 4EQWA 3MO7A 4EWND 2QMKA 2PDYA 3RNMA 3GR4A 4IX0A 2QMJA 3TN6A 4PTMA 3K13A 2KX9A 3UGVA 4CN4A 3B0UX 3W9ZA 1KBKA 1US0A 3LK6A 2Y85A 2YVJA 1XSKA 4L9YA 4IJBA 1YDVA 2POTA 4LY8A 3CO4A 6TAAA 2XYLA 2BGSA 1YADA 4XIMA 2CWNA 4AY8A 3N1AA 3FEQA 5CPQA 4IIEA 2QDHA 3B8VA 3O6CA 1B3WA 4LH8A 4IL0A 2V8ZA 4MWAB 3B9OA 3SZ8A 3UWWA 2JGYA 5J04A 3UA3A 1E0WA 4HPJA 3LV6A 3SURA 1G7VA 1TA3A 3ABXA 1N55A 5XIAA 5KTLA 1RY0A 3GWQA 3PZUA 1IXPA 2WPFA 3C0JA 3W7EA 1Q8JA 4Q8NA 3V75A 1E4IA 4YTRA 3EOLA 3SSZA 5FS6A 3ME3A 4QQUA 4PMRA 1JPHA 3VOCA 3SUWA 1XW8A 4M29A 3CHDA 4P2VA 1GRGA 3N4AA 3COTA 2AL2A 3FA5A 1A5BA 1UQZA 1VHNA 4JQ3A 3W1NA 1HKMA 5BOEA 5DCEA 1K7EA 2FMNA 3RR1A 3TTOA 5F4WA 4C1KA 3BH4A 4JIIX 2X2GA 3B0VC 2OX1A 2PTXA 3ECQA 2PEVA 1NWUA 2WM0A 1P6BA 2QUVA 1SFTA 1B9BA 2CKSA 2ZA1A 4K8GA 3UCCA 1A4MA 4JNYA 1E0TA 1VYSX 1C9DA 3UCDA 1I0BA 2GVEA 5U4NA 2C8NA 1ONXA 1U30A 4TTUA 3O0FA 3BWWA 4JFVA 1U1UA 1WDSA 1ZAHA 4CNNA 2W63A 1KM5A 2NQ9A 2AQOA 1KV8A 2AQVA 4FR1A 2DH3A 3CGEA 4EQXA 1FH8A 1XBYA 3G5EA 4OUEA 4A8RA 3VNZA 3IUDA 1QNVA 3N3MA 4H4VA 3G1RA 1DORA 1ZB5A 3WEZA 3LHWA 4JY8A 4AWSA 4ZSTA 3S2CA 3BSMA 2E09A 5F7UA 1VYRA 4GGBA 2X1TA 1SJBA 4FX8A 1RD6A 2ESCA 2ICSA 2R94A 4DJFD 1QI2A 4C1LA 2V69A 4EPBC 1A50A 3RMEA 1NHPA 3V5CA 1TA3B 4FXJA 3WLNA 5A94A 4I7VA 1AK5A 1N62C 3II4A 2QIWA 1BZLA 3FXGA 1I45A 2V3BA 1BXNA 1OZMA 1WO2A 3LTYA 3TQKA 3LLFA 2WPEA 1V7AA 3DGHA 4W4QA 3QOKA 5IHSA 2ZRYA 4GGHA 4GXWA 4OJYA 4GI6A 3C4UA 3RCMA 3UPMA 4J35A 4RNIA 3W84A 1ZU8A 5E09A 1BAGA 1W9VA 3FHAA 4L65A 1VJIA 3UJ2A 1OCBA 2XGBA 4ACZB 1BYAA 4KW2A 2QKFA 2ON3A 4FXFA 2IXVA 1ADOA 4LOCA 3MKCA 3W38A 3ITLA 2AL2B 1D8WA 3DBNA 1KV5A 2VR4A 3AC0A 3PSWA 4MJZA 5JH1A 2E5DA 1GVOA 1Z41A 3KX6A 1X6UA 4B90A 2QHAA 3UZZA 1GCYA 5HNNA 4DF2A 4AVOA 1OT2A 1NSJA 1G69A 1EIXA 1VDVA 1Q4NX 1DQUA 1KGUA 3I6RA 4C6MA 2BG5A 5EMLA 4FDCB 4Z1YA 4JTDA 2Y61A 4A8LA 1KTNA 2IKIA 5TR3A 4LV4A 3SY8A 3SCVA 3E12A 3EXRA 5A2AA 4YWSA 1POJA 1OB0A 1SZEA 2HPIA 1XBXA 3LRMA 1Q3NA 3S5OA 3C2FA 3W82A 3H2EA 1ZUAX 2PB1A 1SO6A 1D8CA 3NQEA 1V6UA 4CQCA 3R0KA 2PDPA 5BW6A 1W8GA 4US6A 4XSMA 1M41A 3WLLA 3BAKA 4I9AA 1VFMA 3PB0A 2Y7GA 3WLQA 1FHVA 4D6HA 1R3WA 3W2MA 4EPDC 2A85A 1XFCA 3DYMA 3C0SA 3H4GA 4DWSD 3QMSA 4NU7A 3PULA 4FLOA 1HT6A 1OJTA 3K1GA 2WZEA 4C1NA 4OZOA 4KT2A 1TQXA 3RUBL 2Y89A 7PTDA 3TOPA 2XTKA 3PG8A 5KZDA 4B2DD 1QNRA 3ICJA 3UXLA 1E15A 3TAOA 1VRDA 1ZX9A 1VFLA 1XFBA 1SPQA 4Q7IA 2O7QA 2W79A 5FEPA 4K8DA 4X2PA 1K03A 3VI2A 3KM8A 3QOMA 1PL9A 1JF6A 2XG9A 4LNYA 3QC3A 3PZOA 5EBAA 5F2GA 1D3GA 1S1PA 2Y2WA 2ALDA 1V3IA 3TMQA 4CGTA 1SR9A 5KVIA 2GJXA 3PPGA 1V6TA 1FCVA 3PS7A 3DGZA 4HA3A 1CGTA 4QE4A 3T0DA 1J6OA 3QTPA 4YHGA 4Y9AA 2GWGA 3GTXA 2X99A 3E0LA 2DSWA 3MUAA 3PZQA 1G01A 4PCTA 2JFEX 2DT2A 2EBNA 2WLZA 1V02A 1L9WA 1MXSA 4IZGA 4HN4A 4NL1A 3CZEA 4LC6A 3CV2A 3W6LA 1O5KA 4AU0A 1NWRA 1RBLA 1CPUA 3OGSA 4G1NA 4TVYA 2PGRA 2OFJA 5A69A 4X22A 4FF7A 1WOAA 1WB0A 5D2XA 2ZOXA 4DLMA 3OIXA 2PPGA 1OWQA 4R7WA 3WQ6A 2W27A 3LBMA 4AC7C 4REQB 1ZBVA 1KO0A 1BWCA 3Q2DA 4KEVA 3PM6A 3H22A 2WPCA 3IUHA 2RDWA 3I3BA 2XHYA 3W7LA 5EPDA 1XYAA 4Q8MA 1JXKA 2XUCA 3GG0A 3A7RA 3STFA 4OGZA 3Q37A 2CBUA 3CWNA 1JRCA 2ZZCA 5AC4A 4MUPA 1V3JA 1Y5WA 3STGA 3CYVA 2QGHA 4F48A 2IQ0A 1XDMA 2NLIA 2VOTA 4AFYA 2ZXBA 1WAWA 5JQ9A 1H5YA 4M8UA 1TCDA 3W2NA 2I1OA 1U5VA 3WH9A 1NHRA 1EXBA 1H7RA 1CGWA 3FCPA 1IR2A 4IM4A 5DO8A 3PP7A 3MW7A 4L7ZA 3MCMA 5HWMA 4HNUA 3DI0A 4LRSA 4V27A 2OVLA 2GDUA 2E40A 3VILA 4HHLA 5D2TA 4GXMA 3GNDA 2AGKA 2GJXB 4RX0A 4J3SA 2WKGA 3M1ZA 1UWQA 4LAKA 2GVLA 4UCFA 4PCNA 3QHOA 3MC5A 3N9RA 3NWRA 3NGFA 2FMOA 4PMQA 4QLLA 1ADDA 2VEKA 3HPSA 1ZAJA 4JYFA 1IT7A 1XPYA 1YPXA 1ZAIA 2C3ZA 4JQ4A 5SWUA 4LEFA 4C5YA 1NQ6A 4ML4A 4UTJA 2ZVIA 4O52A 5JIPA 4RXGA 1XM3A 3HA1A 4Y8FA 1E3XA 3S6DA 3CGDA 3ITTA 3DFHA 2O9OA 2NXIA 3D0CA 4MWAE 3G1SA 3SCQA 3LB0A 2DUZA 1I8JA 3CT7A 3AIRA 4L64A 2WM1A 1VYPX 2A3BA 4G8TA 4CNTA 3IS4A 2NV1A 4JFWA 4Z2IA 3ITCA 1JPMA 3NPXA 3S5NA 1NF7A 4PBGA 4FLQA 1ONRA 5AVNA 1FXQA 4JCMA 1W91A 1PXGA 2GFTA 1UA7A 5AYZA 4GQQA 3AFBA 3GY1A 4EKJA 3M64A 3QQWA 3VIOA 4MFEA 3AXKA 3MB9A 4HTBA 2E9BA 3DYOA 4MKSA 1XDJA 4L6OA 1BVWA 2ZUNA 3QZAA 2HV5A 4BZYA 3CYJA 4MUZA 3U4FA 5CPMA 2ACSA 4LFYA 3G6MA 1K9DA 2E8YA 1JUKA 3VIHA 2E9LA 5FF7A 3RITA 1JRBA 1EL3A 5HR7A 4EP8C 4QEEA 2R1LA 3RO8A 1T96A 3KCJA 1XIEA 1UG6A 4GBDA 5M03A 4E4UA 4DJDA 2PP1A 4IGSA 2WC7A 4UR8A 4DRSA 3K30A 3SJNA 1JZ7A 1VBHA 2EPNA 4EACA 4CN1A 1ITCA 4BK9A 4NZ3A 2D2HA 3PWAA 4PUKA 3W4RA 4MAZA 1AD1A 1W2VA 5F4XA 1BD0A 1VD6A 5BXSA 3SCTA 1DWHM 3AYTA 4NT0A 4O1FA 1PV8A 1UJQA 4QDPA 1LUCA 1ICPA 4EAMA 1P0KA 5HQMA 3P8JA 1IXNA 3MDWA 2YDAA 4IMEA 3EANA 2VI0A 4KMQA 1E71M 2J8FA 4XAFA 4PUWA 2FB3A 4JBRA 1FRBA 1SJCA 2ISDA 3WDIA 2A7NA 3WG6A 3SFKA 3WIJA 1XINA 3WDJA 1JDCA 4BA0A 3SGZA 1K70A 2GGJA 4XZHA 4IISA 2RKXA 1JYNA 3M0XA 4JTTA 3CPRA 1HGWA 1HL9A 3LU2A 4W86A 2P76A 3E2VA 4KPRA 1ZY9A 4JL2A 1QPQA 4GIRA 1TCMA 2X41A 1A80A 3TA9A 3UY7A 3L4TA 1HJSA 4FF5A 1KM6A 3GTHA 4HSOA 4D2JA 4K3ZA 2CITA 4UQ9A 1JGMA 3I7QA 3C2YA 4KERA 4KF1A 3PZVA 2A3LA 1BGGA 3ZR6A 1GRAA 5C7VA 1OCJA 1HO1A 3M0YA 3RILA 3WD1A 1WXYA 2PTYA 1V59A 4EVZA 2X7WA 3APYA 3D5HA 5AC5A 1LQ0A 2H3BA 1J79A 4H6RA 3S4TA 2B7QA 5FL0A 1OK6A 4IIDA 4TX6A 2W91A 2BY1A 3G0SA 4ZOEA 5K4XA 4MGGA 4EE9A 2Q02A 4IIGA 3MMWA 4LC8A 3W1AA 4K1WA 4Q6XA 1SM9A 5I0DA 2UY5A 5BRPA 3QPZA 1Q8AA 3TR9A 3ZT7A 5JCIA 1DHKA 2QPSA 1FWRA 2QYGA 3DG7A 3CBWA 4TVCA 1GERA 3CO8A 3EKZA 3SY1A 4G1KA 1TJ1A 1XDIA 4AXNA 4WUIA 3Q6JA 2Q8LA 4JFTA 4Q7NA 3LRLA 1TMLA 1UR3M 2AGTA 2WCGA 3UU0A 4IHCA 3RCNA 1KXTA 2NQ5A 1XHCA 4JEQA 3RLGA 3WFAA 1T99A 2E6AA 4Y9MA 4ADSA 1VIZA 3SEPA 3AXIA 1MWOA 1Z9AA 1OVDA 5A6AA 2QV4A 4HNCA 1IZKA 2WMGA 1GJPA 4P7RA 4DYEA 4WSHA 4QG9A 4HCLA 3EOOA 4HN8A 3WK2A 2G8ZA 3B3DA 1W3TA 2NWRA 3CPGA 4OBTA 5I3KA 3GU9A 2WVVA 3MMUA 3CUXA 2DPEA 1EJWC 4XO7A 5E1QA 2W67A 3HB9A 4DPPA 4LW7A 4B3LA 2C18A 4M81A 2RDTA 4BQ2A 1P6CA 4DJFC 3OB8A 3AZSA 2ZWYA 4XZ9A 5A6KA 4K38A 3R5EA 3LCFA 1BVNP 5AHFA 3QXBA 1DJHA 5G1YA 1I60A 4B5VA 3MJMA 3DU0A 3EX6A 1QOXA 3PZ9A 3BZJA 2VUYA 3HGRA 4HNVA 2D3NA 2Z1BA 5DELA 1FWWA 2OT1A 3RAOA 1Z7AA 3TA6A 1QI5A 2QF7A 2GUBA 3F4NA 1I2QA 3DN5A 5CBJA 2WZTA 1B57A 4I6VA 2DU2A 3W2LA 3LGGA 1KFKA 4E0CA 1OYAA 3LA4A 4ZZ9A 5A6SA 3UZJA 1UWRA 1TKKA 2XFRA 3F4CA 4HNTA 4ZB5A 3N6QA 3B06A 4ZTYA 1FWNA 3C56A 3REQB 4GI8A 4OUIA 5CSUA 1V08A 3LX9A 5AN7A 4NRRA 4IL2A 1KWGA 4UTHA 3CWOX 2GJPA 3BPWA 2J79A 3KBMA 4K1GA 1BWVA 1W6TA 1VPQA 3UNTA 2DGAA 2VZUA 5HAOA 5JCLA 1R2SA 3IEBA 1UIOA 1XQLA 3C61A 1IWPA 4W7WA 5FJTA 3MVIA 2QUUA 1R2TA 1EP3A 2YX0A 4C7GA 3WH7A 3KL0A 1Y5XA 3UGRA 1D7YA 4MLJA 4FX6M 3RRAA 3MCNA 4XZIA 1AQ0A 2XIIA 1TPDA 4NZCA 1LORA 3ZSTA 3BW2A 1WBHA 5DXXA 1EXPA 5MHBA 1KCLA 4CD8A 3IARA 5M1TA 1YXCA 3S2LA 1EC8A 2FZNA 2CLMA 5D2YA 2BC1A 1J93A 1LRNA 1STZA 1N63C 1CXLA 3E5PA 5FJJA 2XINA 9CGTA 3FSTA 3C3NA 1QAPA 1UUQA 2NVCA 3V0UA 3A3XA 4JGDA 4RDZA 2OLAA 4AZBA 4BHYA 1GVSA 3CEPA 3IJDA 4FNPA 1KBBA 2P88A 1NARA 4LPCA 1B30A 1UBPC 3VDHA 5FJUA 2FDSA 2OEKA 3E5BA 3BLFA 2QGYA 2ZIDA 3FJ4A 4LB4A 4MDPA 3I4KA 4H2HA 1SO4A 1QW9A 2XWEA 3U8GA 1GJUA 4UQEA 3L5MA 2ABAA 3GS6A 4UIOA 4UWMA 2NLYA 3NXFA 5C55A 3IC9A 2HS8A 2JK6A 3C6CA 3SQPA 3DXIA 2X1RA 3MSYA 2B7PA 1NEYA 3ZVHB 2Y8VA 4ZFMA 1XLIA 5FS7A 4IIFA 2F5ZA 1W1YA 1ZL1A 1MXGA 1E4LA 3NRZB 3VIIA 4Y90A 1MNZA 4RZBA 2ZZBA 1HKVA 1OGBA 4DAFA 2YFNA 4ZOAA 3RFAA 4WHBA 4US5A 4CCCA 1J11A 1KN0A 4QX4A 4KEMA 4LIIA 1EHAA 3USBA 3KVKA 2VWSA 5E93A 1EC9A 3KHJA 5FMHA 2DT1A 4IJCA 3HZ3A 2Q01A 4H4PA 3A13A 4C91A 1NH6A 1WAUA 2JIWA 1N7KA 2XM2A 4JN6A 4JAWA 4WGXA 1G4SA 2VFFA 4ZE5A 4YYFA 4I7WA 1DJWA 1QNSA 1EQCA 1C92A 4JL1A 2GJNA 5M3WA 1DJQA 2ISFA 5RUBA 3HQ1A 3CB3A 4PUUA 1U83A 3OZMA 3NG3A 3VC5A 3F03K 1SW7A 2VZSA 4H4XA 4IGHA 3UQNA 4GABA 1H4PA 4XKYA 2EXOA 1XGZA 1HJVA 2PDHA 4Z08A 4D6JA 3TYDA 4FEZA 3M5XA 2NV2A 2BVTA 2I56A 1V3LA 2QR6A 4Z42C 2Z1XA 4NZ1A 5LYRA 1US2A 4NJKA 1Q6DA 1IEVA 1Q85A 3NVDA 3F4VA 3THQA 1W3IA 4LAUA 5DXYA 2PRHA 4GVFA 3R7MA 1XD1A 3CAVA 2Z6IA 2ZXQA 4ZFCA 3U57A 3N2MA 1OX4A 2YL9A 4HOWA 5JBFA 1PHWA 3HMCA 3RX4A 3PB2A 2VDHA 3T0BA 1PCWA 4AHQA 1NHQA 3TONA 1R86A 4IXHA 4QS6A 3URQA 1AG1O 1JCLA 1QHPA 2OG9A 4IFOA 5CQ1A 2BCPA 3VUSA 3WD2A 3U2OA 1QRQA 3STCA 3TJ4A 2DV0A 4H9YA 1L6SA 4P7OA 4UQDA 2AAAA 1KBIA 3VPLA 2CU0A 4A2SA 3DUGA 5H8MA 5BOOA 2DQWA 4WY0B 4XZBA 2FIQA 5AYIA 4LVFA 3EGJA 3WKZA 1BVZA 1IGSA 7ODCA 3EX3A 3HOJA 3KRSA 2DZWA 1R7AA 3D46A 1UD4A 3GG8A 1KD0A 3G24A 1W1A1 1FWAC 3OOQA 4XX6A 3ABZA 3GYEA 3URAA 3W7MA 2CFYA 4ENLA 2FH6A 3QV8A 1CB2A 3HGJA 3ARTA 2I7GA 2PC4A 2VX7A 1DPMA 4LUYA 3PK7A 4OOZA 4C6NA 3TZNA 3VOHA 3AXXA 4C6KA 2GR0A 2VXNA 3GXDA 5LIXX 5GNXA 4Q4KA 1H6VA 3LLXA 1SR0A 4PUMA 1J10A 1P43A 3W0KA 3ZO9A 1CLKA 1NELA 1RBAA 4IG2A 2WMHA 1KFCA 2PTWA 2IPFA 5K3VA 2WVVB 3ITVA 4RE4A 3NQGA 3AMGA 3DBPA 1ITQA 2ZDRA 2PTZA 3EB3A 3GG7A 2YVGA 1FCUA 4BQ5A 2OODA 3EWCA 4DBUA 4DELA 1VLIA 1H60A 2EPOA 1YLVA 3T44A 2VURA 1RZMA 1GOIA 1SMAA 1XUZA 4K8HA 3MJYA 1XD0A 5KITA 4A22A 1GW1A 1JAEA 4GI9A 2A5HA 5D4YA 3KVMA 2H8ZA 4LALA 4D6EA 4U3AA 3QY6A 2VR2A 3W00A 3SUVA 1S5VA 3CAWA 3S5YA 1W8SA 3WF4A 1YNQA 4M51A 2XZ9A 2QQ6A 4MB1A 4HJWA 2FZDA 4H9XA 1IXQA 3A64A 3EPOA 4AZ5A 2EG7A 3L4VA 4S3EA 5DMMA 1XCWA 4JCLA 3UERA 1VHCA 4HIBA 2ZZ3A 1DHPA 1EJTC 3TNBA 4LBRA 5KMYA 2DUXA 2J9XA 2WHJA 5JMUA 3RHGA 3MKVA 5G4HC 2YIHA 3IVUA 1C3FA 4J4KA 1XLCA 3O7UA 3ANUA 4O12A 2XIBA 1DWAM 5M17A 3WQDA 1QHOA 3FJ6A 3NYDA 2DW7A 1XR2A 3PBWA 4JTUA 2VP8A 4JYEA 2H6RA 1OIMA 1Q5MA 3BAWA 1KA9F 4C6LA 1UD8A 3MUIA 2NVKX 5D9OA 1OGSA 1FWCC 1GPFA 5CC7A 4F8XA 4LT9A 2SFPA 1WA3A 4Z0SA 1DL3A 2E5CA 3A4AA 4FO4A 2VEPA 1BSLA 4WJ8A 4AY1A 3Q67A 4ZE4A 4HMCA 2WV8A 3OLGA 1FECA 1RQBA 2DQXA 1EJVC 2YR1A 4XZWA 3UWUA 2VZTA 3R11A 1GVEA 4DJFA 5JXQA 4H9VA 5TAOA 1VQZA 4KRTA 3ZIZA 2IMRA 2C91A 3WSUA 3UPBA 3TQVA 3QFEA 4YPJA 3GDLA 1CXKA 4N0RA 1I75A 3NVVB 1EUAA 3SRKA 3ID7A 4RCXA 1IZCA 1RXOB 3AU2A 4ORMA 4TVWA 1E0UA 1RALA 2AL1A 2GOKA 2EHHA 3TYEA 1W9BM 1ME7A 3TJLA 1F8MA 3CB8A 1XCFA 4HK7A 3EWXA 4BFAA 3WLKX 1EJRC 3OG2A 5E0CA 4QM1A 1PB0A 4IPIA 3MZ2A 5IDIA 5HR6A 1FCQA 1KWKA 3PPCA 4GWEA 2PZ0A 2J3NA 4DNAA 1D3CA 4JNZA 1GW9A 2WHMA 4RE0A 4H7ZA 5D09A 3QR3A 4HPNA 4GISA 2BODX 1UWAA 3RIKA 2FTPA 2FKPA 1ZBKA 4V1YA 1NDZA 4O54A 4TX8A 4NX0A 1A5SA 1NDYA 4K36A 3PG9A 3B0XA 2IKJA 3KBVA 3WX7A 3KLJA 5EBUA 2A8XA 3GH4A 1AL8A 3VNKA 3VXGA 1IXOA 3MPGA 5F2MA 1VBRA 4AXKA 3EMZA 3GXNA 3AHTA 2A7RA 3F2DA 2PAJA 5HPOA 2ZUSA 4XISA 2G3NA 3RXZA 5A6LA 3ZT6A 3W87A 3BV7A 2CIPA 1JUBA 3LHVA 1TELA 3AMKA 5I6SA 1PIFA 4RLIA 2TAAA 2A21A 1W9DM 4XIAA 1N60C 3V7PA 2YCLB 4WF7A 1AFSA 1V97A 4NNCA 3NVWB 1H61A 5I2UA 3C8NA 4O8RA 2UWFA 3M41A 3SBFA 1YEYA 3QGVA 3K8KA 3ELFA 1CGVA 2UY2A 4ERIA 1UWTA 1BHGA 3F7JA 4UQAA 2R82A 2E9MA 2G4JA 2XIJA 3HQPA 4HPHA 4N42A 1TPH1 1EEPA 4W7UA 4GFIA 3V1HA 2DSUA 3CWHA 4JTCA 4QE5A 1UBSA 1CB7B 3QLLA 4EMIA 1PZ2A 1TUFA 1NY1A 4U33A 1OIFA 2X42A 4EM4A 2FFIA 4FNSA 3GC5A 1H7OA 2ZRZA 4CN6A 3W73A 3OVGA 4PE8A 2J7BA 4MJ2A 2OSWA 4GJ1A 5CPLA 2GK1A 4HNNA 4LB3A 4L6HA 3S9IA 5FJOA 1W37A 1W1TA 2WNZA 5I3HA 1C8XA 1RCQA 1UROA 2ATMA 4D6GA 2BOEX 4UTFA 1J0KA 2I14A 4M80A 3CM4A 4JIPA 1NFGA 1E72M 4EQRA 2WWCA 3PUDA 1X97A 3CS2A 2W3RA 4GUHA 3BANA 2GDVA 3UVAA 1MW0A 2C1IA 3OG3A 4GRSA 2WQPA 4KKXA 3U0HA 3U6WA 1C8VA 2E7FA 4G2DA 1BQGA 1CI1A 5AC6A 3MYOA 4HCDA 3WQ8A 1V3MA 3W1QA 1H62A 1GEUA 3LGEA 3TW7A 1BRLA 3WJWA 3EWUA 1CLXA 4KCVA 4J57A 3OA5A 3MANA 3GXTA 3KTXA 2F2KA 4S3KA 4GZJA 4BF5A 1T41A 3NUKA 1XYLA 1LROA 3V0TA 2BXVA 1ELSA 3UZ5A 3GKAA 4DUWA 1ZKQA 4WXZA 5LIKX 3TJIA 5DT5A 4ZMGA 4P7QA 5EMUA 2ZZ7A 2E3TA 1RK6A 2WBAA 4LUSB 3DGRA 1HKIA 4UOQA 3TR2A 1RQHA 3BCDA 4JY9A 1GVQA 4MNLA 3KOZA 4XBKA 3QC0A 1KQZA 1M03A 1KB3A 1SSDA 1W0MA 3NVZB 1J12A 2Z7KA 5E0KA 4H4IA 3VKJA 1MXDA 3TLQA 4J28A 2HROA 4HOZA 2O9TA 2BP1A 1QWKA 4EK7A 2YCIX 4ZOBA 1PCKA 2YLLA 1FWGC 2ZFAA 3KRUA 1B3ZA 1L6YA 1KXHA 3LCIA 3B04A 4WIWA 3ZZ1A 3VDAA 2Z7GA 2ZX7A 4AHPA 1ZP3A 3LI1A 4E5TA 1IQ8A 4J3TA 1S2WA 1H50A 3CXOA 1XUUA 2WSPA 3GHTA 4JTJA 4L4OA 1UC4A 4ONVA 3IIPA 4PCFA 1MO9A 4LVBA 4NASA 2DP3A 3GU2A 3FVMA 3VDBA 1N82A 2HVMA 1MUMA 5G1MA 1AW2A 4CD4A 1G67A 3M0IA 2DZBA 1VEMA 3QLDA 1ONFA 1J5SA 4RDVA 1C29A 5HA7A 5ABEA 2DZUA 4H6EA 1I2NA 2BVDA 1KM4A 2QT3A 2W4XA 1FWDC 1A5OC 3ARZA 4RXFA 4HVXA 1K4GA 4TMBA 1Z69A 4WJEA 4RZ4A 1XLDA 3B05A 3O2LA 4IJRA 2ZRVA 1JI2A 4PTNA 2DH2A 3QMTA 1WUEA 2EG6A 1H0IA 1H1ZA 4QCFA 5TQLA 3MSGA 3RM8A 3SRDA 1O5XA 1UZDA 1FXPA 3GKFA 1JDFA 4LANA 4MTVA 3BOLA 1K02A 3V1PA 1JZ2A 2CZEA 4AZIA 3NQCA 5GJPA 2PWVA 1J0ZA 4H4WA 3QV6A 3HFYA 5C9XA 4BF9A 1NAL1 4JXCA 2QCNA 2ISVA 3CJPA 3WQ5A 6XIMA 4LUSA 3D9XA 2Z1KA 4E2VA 3AWOA 3U2CA 3PTMA 4HK6A 3A22A 3FYYA 4G56A 1FX6A 4TO8A 1UW9A 1EZWA 3RLVA 4GJJA 1E1EA 3RNDA 1LYXA 4PB3A 1KW1A 3GFYA 3T78A 3MZNA 2B31A 4CU7A 4KESA 1B3YA 3KTSA 3NZRA 1I1WA 1JUEA 2C71A 4QTGA 2XN2A 4LUJA 1TV5A 1ZLPA 3THUA 3H70A 4CNUA 1GPWA 4GH3A 1LWHA 3I7RA 2V63A 1H11A 2INFA 4G9PA 4F79A 3IJQA 1TR1A 3AMDA 1PKYA 1BSIA 2REQB 4NNAA 5A6BA 3UXAA 3GG1A 3AZRA 2WJEA 3WLHA 2NQLA 2ZZ6A 4ZL1A 1L6FA 1R3TA 1FHDA 3S8HA 1TTQA 4GD0A 2BGQA 4FOKA 2WP5A 3V5FA 3CLMA 4I9TA 3MP4A 5CPTA 2CLFA 4KWOA 5EYWA 5I00A 3GH5A 4R34A 2BHYA 3KBWA 3LPFA 3CUHA 2QZRA 4NY2A 3GXPA 2VD8A 3ZXWA 3W2KA 4DUXA 3TSBA 1IWAA 4JOMA 1M5WA 2A1YA 2PLMA 2F38A 6ALDA 4MYAA 2YKKA 4UTTC 1PIIA 2GR3A 3GC2A 2J24A 3EA2A 3CTLA 3IGHX 4NZJA 1ML1A 1XIMA 3CQKA 4QP0A 1DJGA 3W1MA 4ZENA 2XSAA 1ISVA 3VD7A 3HPXA 4RL3A 5FCZA 2ATSA 1NFBA 3UWYA 2OQHA 3UETA 2VENA 2XH0A 1XPGA 1OC6A 1OJXA 2J7FA 1ZJAA 4Q4QA 3L66A 4UTWC 3R6IA 2ZE0A 4LYQA 4KRZA 4F0SA 3FG2P 4BF7A 4Q8UA 3LB8A 1R3QA 3AYSA 1Y7VA 3MV11 1G0CA 4W7VA 1ZENA 4APNA 1ZQ5A 2R1PA 3WLOA 4JIQA 3R12A 4PCSA 3G8EA 4L5ZA 2QJHA 3WBEA 1ZRQA 3QFAA 2ZXAA 1Z48A 3FJNA 1XBVA 1PTAA 5T91A 2G0WA 3FXYA 3RJXA 5HATA 3F2BA 3GZ3A 1GHRA 3S1GA 3CQHA 1KCXA 3DAQA 3LNPA 3EDDA 4FXRA 4MNJA 3RX3A 3CLWA 5IM51 2XVGA 1YBQA 3OVRA 3VCNA 1FP9A 4YYCA 2ZXDA 2XH2A 2WPGA 1V93A 3NYZA 2Z27A 3FAXA 4LV9A 5AZ0A 4AWUA 3CQ0A 3H2CA 3ARUA 3P67A 4TVDA 5HMDA 3WQOA 4LA1A 1EA9C 1DIOA 3TYCA 2Q8ZA 3SO7A 1XG3A 3H4KA 3DX5A 3EX1A 1V4YA 2QCLA 3MT1A 2ZTKA 4CCZA 1MQQA 3B8WA 1XRSA 2YCEA 2P1FA 4K7YA 4WKFA 3A5FA 3T0AA 1E3ZA 2Z29A 2PDJA 4LVDA 4CU8A 1RHCA 4Z1BA 3OLDA 3LI0A 3LCWA 3QW3A 3DFSA 1R9ZA 3NIYA 4JQ9A 1NDVA 3M07A 3R8HA 4PGLA 4TXEA 3S2JA 1OY0A 2QCEA 1BXBA 4LRTA 3TC3A 3TVAA 1MSSA 3P82A 3SW6A 1VFUA 1UR0A 5CEWA 1SUXA 3HIJA 1LDCA 3EUB3 3I3DA 1UUOA 4X61A 4PN2A 2OB3A 2B0MA 3FKKA 1V02E 3P3BA 1XLBA 4NJIA 3EXSA 2Y7FA 2C0HA 4Q32A 3CIWA 4L6DA 2DSVA 3QFBA 3PJUA 2FPYA 3EOEA 3NM1A 1S5WA 2ACUA 3NVTA 4HSNA 5FOOA 4NXKA 5REQB 2ALRA 3DDMA 3ES8A 1JEZA 2H9AA 5EGRA 1JVNA 4JDRA 2QJJA 1RVKA 1O5RA 1AJ0A 1BPLB 4DF0A 2E8ZA 2VVNA 1EP2A 1DWIM 2INZA 2VR5A 3W7HA 1W3LA 5K9CA 4GI4A 2INEA 1FFUC 4OE7A 4KWSA 3H23A 4MSSA 2C3DA 1HVQA 4MADA 4LF2A 1XP3A 2R1NA 3OP2A 1FWFC 3E96A 3M0HA 4MM1A 3JW7A 5JCKA 4FMVA 4R9OA 1JCXA 3S2NA 3OVQA 4L61A 2GSJA 4J3UA 4GYPC 2Z2AA 5HANA 2DZTA 2OZTA 2NVAA 4AX7A 3N18A 4OT7A 1XIJA 1Q6LA 3N6HA 4DBDA 4J5NA 3KVLA 5FIPA 3NZPA 4Y96A 1XGDA 1PTGA 2Z2BA 4YWIA 7TAAA 1T6MA 3VX0A 3II1A 3LXDA 3XISA 2YW4A 5ABGA 2PDWA 4GY7A 4QRNA 4R9XA 4UTIA 1OADA 4FIRA 1N8WA 4AY7A 3CU2A 3SDOA 2WO5A 4KQNA 2FZ8A 2O4QA 3ARYA 1M6JA 3ISIX 1YDYA 1ICQA 3NO5A 4WLCA 1QNPA 3GTFA 3AISA 5A8GA 1OINA 3VNYA 2FLIA 3L5OA 3POCA 2FHFA 1AUSL 4M0XA 3NDYA 1I6NA 3PUGA 2GQAA 2J74A 3WUGA 2DY3A 1WCGA 3KP1A 3BMVA 5TIMA 2DIEA 4TQTA 3DHUA 1XLMA 4RE2A 2O4MA 3ATYA 4M82A 1EGMA 5DF0A 1P0NA 4K7ZA 3THAA 1R3YA 4HYWA 4W8LA 1PSCA 1Y8BA 2JGQA 1QOPA 3TMLA 1DXFA 2J88A 1RSCA 3FDKA 5PTDA 3W1LA 3IJ6A 1XRTA 2FZMA 1TJRA 1LM1A 4L1GA 1GYNA 4GA8A 2PURA 4H01A 4A8NA 2EAWA 1EB3A 4IF2A 4JTEA 4HPXA 3EPMA 4FS9A 3PJTA 1ODUA 3G1VA 3HPZA 4GH1A 4FI4A 4NILA 3AIUA 1A0CA 2FGLA 1FO4A 2FJKA 1W3NA 2Z4GA 4RZ6A 5A8PA 1NWTA 3DC8A 3ZLFA 2ZUMA 3KRBA 3INPA 2AKZA 3FN9A 1QASA 2HXTA 3I7SA 3DFTA 4Z2HA 5HNUA 4HZ6A 1S5MA 1FY6A 2HJPA 1B1YA 5LNUA 1FHLA 3AHYA 3GAYA 4MOZA 2PSNA 1VCVA 3GQYA 3GNOA 4OKDA 4LYRA 7TIMA 3NFUA 4R53A 1S2AA 3BG3A 4IOTA 3EPNA 4P8VA 1EBGA 3U9IA 3NL2A 5BXPA 1TTIA 4H4QA 3NQ8A 4DQWA 1MUWA 4C65A 4DY1A 1J96A 4F0KA 3SIMA 1Z32X 3N4FA 1RD5A 3V16A 3OBAA 4BQ4A 4DM2A 3MCOA 1F6PA 2NWSA 2PWEA 2MNRA 3KBNA 2E3ZA 3MSRA 4PH6A 3UA4A 2OMAA 2RFGA 3DK8A 1XSJA 4FALA 3F5LA 3CMJA 4YCPA 4S3BA 2CEQA 3HFTA 4MNKA 4AZCB 4PA8A 1SJAA 2GQWA 3MBDA 1QFEA 4OFCA 3MYPA 4DPQA 1PX8A 1J18A 3S46A 4LBSA 3NQ2A 4MKNA 5B7ZA 1GV4A 5G2IA 4HHMA 1L8NA 3L2LA 3UJEA 4XVEA 3NAVA 4O1BA 1XF0A 5G5IA 1H1NA 1XI3A 2Y7DA 4AMCA 3AUOA 3SN1A 1OFPA 1SZFA 5G4WA 1LQAA 2YPIA 4IMGA 1ADSA 2NXHA 2W3ZA 2YDSA 4WDWA 2W9MA 2Z1WA 3MP5A 3STEA 4B4HA 1FFVC 3K1DA 4O15A 1FEBA 2E4TA 3R58A 3SQSA 2HCVA 1VFFA 1K8XA 4FOJA 1CIUA 4IP4A 2G5WA 4WRHA 1XKYA 3S47A 2X2YA 2XZ7A 3TYBA 2YCKX 3G3MA 2RGLA 1Q7QA 4CEXC 4XTDA 3PNUA 1Q63A 3LDVA 4U2YA 3G8RA 3RPMA 3TDFA 1B2YA 3XIMA 3PY2A 1M65A 3VKKA 2VVSA 4DI8A 3HG2A 1GTEA 3CL7A 2Z2UA 3MWAA 3LBOA 4FHAA 4ES4A 3NQDA 4LUTB 3LTSA 3IRDA 3IAPA 5LHFA 2TRSA 2CBJA 3CNYA 1UZ4A 1JPDX 2HMCA 4O14A 1LVLA 4HMNA 4JX6A 3L21A 3P6LA 1E70M 2DEPA 4CLMA 1ESWA 5LA0A 2Y4SA 1OFDA 2V3GA 3QKEA 3C2VA 4E8GA 1MNSA 3CV7A 6REQA 3RN6A 5D03A 2G96A 4QLKA 3KZSA 3O0KA 3UFYA 4IQJA 2ZYFA 4CCDA 4GUFA 3UCQA 4UXDA 2VHLA 2GRTA 3ZJKA 1BG4A 1A53A 2QDGA 4U4MA 4KS0A 5D8ZA 3PWIA 1HJXA 3W3OA 4IGMA 2JQXA 1LCOA 3WLSA 1DP0A 2GVJA 4DNHA 1XLGA 3G2GA 3G0XA 1KFWA 4IIBA 3EYPA 4HYVA 1YPIA 3BGGA 4JZ5A 1TJPA 4AD3A 3WLPA 5A2CA 1WDQA 1OZQA 4QFUA 3TFXA 1N61C 4REQA 3W6MA 1KRBC 3CIVA 1K7FA 4YTSA 1E51A 1E5NA 2PMQA 2YGYA 2OQLA 2WZIA 3TXZA 2GDQA 4JHOA 4PYSA 3BJTA 3FV9A 3T2QA 3L9CA 2C79A 5D32A 1HX0A 3WQFA 2C19A 1DE5A 3UZWA 3DFOA 3QY8A 1LRQA 3W1UA 1C9WA 3WMSA 1F8WA 2I17A 2VX6A 2BLEA 4M6QA 1GOQA 3ZSSA 1H7PA 4HA1A 3IV3A 2WNNA 8TIMA 1I2OA 2C6QA 2ZWZA 4B15A 3S42A 7CGTA 4S3FA 5LNRA 3GH7A 2O7SA 1ZZMA 4ERGA 5BRBA 5HWNA 4JTIA 2DZXA 3RPDA 3LPGA 3VKCA 3AIBA 2WMIA 1U5HA 2Y1HA 1TSIA 1R2RA 3V5OA 3T81A 3NXLA 2PDFA 1OFEA 3N04A 3PVFA 3UY8A 1RM6B 2PBGA 3BARA 5I79A 1F05A 2YAUA 2ZZ5A 3LMYA 1BG9A 3FA4A 3RJYA 1MRQA 2XIOA 1XCXA 5A1AA 3GHSA 1JDDA 1JDEA 1P4CA 1JRPA 1UKOA 4PB4A 5AYXA 2WVSA 3LTPA 3W27A 4ZVJA 1PPIA 5FAJA 2H9AB 2BX7A 3AIQA 4H1ZA 5A5WA 3VZXA 4O16A 3PBUA 4YCOA 2Y8KA 4UCGA 4XUGA 3GBEA 3C2OA 1MYRA 2QAEA 3M0ZA 1SO3A 1TUXA 2C1HA 4G5DA 1KTCA 3FIGA 4L56A 4PTDA 3DERA 2VC7A 2CXGA 1S3TC 3GVVA 3CAQA 3MMDA 1V6VA 3WL1A 1ZPTA 4GC3A 2I9UA 2OWXA 4LS2A 4NAEB 2V30A 3D47A 2ONEA 3WLIA 4XAPA 1PDYA 3NQ6A 2WZMA 2E5AA 4D9PA 3AJ7A 4L4MA 1DTNA 2J25A 5DY3A 3GDRA 4H2CA 5FKYA 5FJIA 2Y70A 4XD3A 2V6OA 2BASA 4N9DA 1HVXA 1SW0A 3GIYA 4BWLA 3ZFHA 2OZ3A 3GZAA 2FVMA 1VH7A 4N6FA 2RABA 1X38A 5JVLA 1S39A 4ASTA 1IE7C 1PDZA 1HGYA 1REQA 4U5KA 5C2CA 2PBOA 3OZOA 2E67A 4MNMA 2CHOA 3HTWA 4GACA 4S3CA 4CQ8A 3PHAA 3V3WA 3N11A 1A3XA 1HKJA 3T8QA 5BU6A 2FYMA 1ECEA 3BC9A 2D22A 3VGDA 4DF1A 1O12A 3SCRA 2NUYA 3TU9A 2VT0A 1EBDA 3UJFA 3I6TA 3IK2A 4GY1A 4X0VA 3UWVA 1XXXA 1K1DA 1EGZA 5C70A 5LGZA 4X9YA 1T7LA 5CJMA 1HP4A 1AQFA 4YXGA 1GETA 1UB3A 1XIIA 1VENA 2D0FA 3FYPA 5I7GA 1CTNA 2HTMA 3SECA 3RGTA 4WR3A 1QCWA 5KZMA 2OKTA 2EQDA 3H8AA 1KXQA 3KLLA 4NI8A 4FAMA 1JOAA 3QSTA 1R6WA 4O11A 2XPKA 1TTJA 4UTLA 1E6RA 3EEZA 1A47A 2YZRA 3TUUA 3VE7A 3S1XA 4JPGA 1VR6A 1UR8A 2J7DA 3C86A 1HO4A 1TPWA 1MDRA 2OEMA 2HQAA 1K6WA 3T6CA 3DJGX 2XSXA 3T42A 5ABHA 3S0CA 1H2IA 2JE8A 2PC8A 5AHMA 1BTCA 5IFTA 1I1XA 2W54A 1F4HA 4PB5A 4GQ0A 5I5RA 3POHA 4OQVA 3VDGA 1KM0A 4X63A 3SADA 1F2JA 2XGIA 2V0TA 1YE4A 1SW3A 4J1OA 1H09A 2O9PA 4QG8A 2WC3A 2FTYA 4MPQA 3VZZA 2A3EA 2QUMA 3SR7A 4HB7A 2GZXA 2PWGA 4O1DA 2CZ5A 4LAZA 3OTRA 1V0MA 4DZ5A 3FSUA 2MUCA 4JHZA 2X7VA 2R1MA 3T55A 4B92A 4UTKA 2QDEA 4TUFA 3QF0A 4UMAA 4LVGA 3FW6A 2ACRA 2VCAA 3WQPA 5KEZA 3ES7A 1LPFA 4PMOA 4RV3A 1Q6OA 4XTIA 3PANA 4V28A 3WDQA 4HJFA 5TNVA 1IV8A 3MDUA 1LL6A 1PVNA 3E6EA 1QPKA 1KLYA 3MI6A 4ML9A 2WMJA 5T8GA 3WL0A 1S2VA 1UH2A 1XYCA 4B3ZA 1KR0A 1RP9A 1TTPA 1TMHA 4Q8VA 1OYCA 4ADUA 1PKNA 3WLTA 1ZGDA 4FP1A 5AHLA 4EAYA 4EF8A 4N7QA 1JR1A 3IACA 2WOVA 4F9JA 4IQDA 4AZCA 1FKWA 4O19A 3LCHA 1V8EA 4PCPA 5IXEA 9XIMA 3UZYA 4EX4A 4JS3A 1FWEC 3W86A 4D8AA 4DUVA 4Z1CA 3L4YA 3OC4A 1ITUA 3EX4A 4GK8A 3H2FA 1S38A 4A29A 1Q6RA 4W9TA 1C90A 1K9TA 4JTRA 1QMLA 3BG9A 1R9XA 1J6PA 3BJSA 3EMCA 2GH5A 3CUZA 2ZCGA 5HJYA 3NZGA 1P48A 4NHVA 1BKSA 2BSLA 2WAGA 2OGYA 2XVKA 1Q2RA 1V6YA 4F0RA 1Q65A 2VCCA 4PRWA 3B9AA 3B8SA 4PEKA 4TR9A 3GNPA 1H5VA 3EWWA 5A95A 1TR9A 3ARSA 4JIEA 3UXKA 3DG6A 3N15A 3IVTA 1GQKA 1X2GA 2VX5A 2QIIA 1DWJM 4B5SA 1QK0A 1E4MM 4G7FA 4MJMA 4AD2A 4UFJA 4D72A 2QV5A 1N5XA 5JCMA 4KFPA 4HU4A 1GZJA 1F8IA 3W7QA 5A6JA 3Q4DA 3ZJ6A 3LBCA 1P0DA 5DCDA 8XIAA 3GD6A 3WY1A 1UD3A 3MY9A 4GKTA 5CZTA 3BE7A 3NL3A 4MB5A 1KM2A 2Z1VA 5CGMA 2ZRUA 3O3RA 4UFIA 5CG0A 3KRZA 1G6CA 1TV7A 3EWZA 2OEJA 4Q4RA 3EOSA 4DBWA 2CCRA 1TPUA 3EWBX 2PTDA 2V2HA 2JF7A 1HNYA 4FNQA 2VFHA 3E9AA 3O6DA 1LG2A 5JRBA 4RV8A 3M5YA 3W7KA 4OV4A 4IPJA 1YRRA 3ERPA 1OCNA 3LXAA 3QR0A 4YNGA 5K9DA 1XIHA 1CXFA 4ECLA 3MI2A 1H7NA 1PEZA 2F61A 4O4WA 1KR1A 3L0GA 4NRSA 1OF8A 1EEXA 4FR6A 3DFNA 3RCYA 4H7CA 1LT7A 1NIUA 1UIPA 3VCCA 4A3UA 2ZA3A 3H2AA 1Q66A 5FESA 5HJXA 4CQBA 3PZMA 1R8LA 5E6YA 2FVLA 1M53A 1UKSA 1HZYA 3WD4A 2GGGA 1W1B1 1S7MA 3S1VA 3ZWTA 3IK4A 5CZKA 4EQSA 1TMQA 1V51A 4EPEC 1FWSA 1G5AA 3OEXA 1K4HA 2CHNA 2EEXA 5GVJA 2ZX6A 4NAFA 4TMCA 1ISWA 3P74A 4N2YA 2J7HA 3HU7A 3WF1A 3AZTA 3Q45A 5H91A 2IPJA 4G7EA 4NSBA 3I65A 3QYSA 1OC5A 2X8HA 2BHUA 1J0JA 4XUYA 3O06A 3VNLA 3B97A 4R3UA 1H51A 3GUWA 2Q6ZA 3HQOA 4ATWA 3OQ8A 1TX0A 1MFVA 2HK1A 4LUIA 1PZ3A 4DUOA 1YPFA 3WN6A 3W7OA 3ZOAA 1O68A 3UJSA 3OODA 4ZXLA 2BBFA 3H26A 4UQCA 4MZ1A 1RBOB 3FKRA 4IQEA 2O0TA 4AUBA 3ARPA 4LYKA 3I6EA 4Z1AA 1LZOA 1NHSA 4UMCA 4QBXA 5J5DA 3FOKA 4DZHA 4UR7A 3SCOA 1A5AA 4AWTA 2DIJA 1UKPA 3A4XA 1TQJA 3R4IA 4CVUA 4NNBA 3CPUA 4LY4A 2FZBA 4A3QA 2CBIA 4AD5A 2WWDA 3V36A 2YYUA 3BCJA 2YDRA 4GX8A 4HSHA 5BCAA 3V4BA 4GPNA 5MKGB 3GVQA 3QPYA 4LF1A 1FEAA 3QH2A 1XLAA 5I09A 4Q4PA 4AWEA 3URBA 4W8BA 3L65A 4J3WA 4KBXA 2H8XA 1US3A 4B2DA 1YNYA 1AZ2A 2E68A 2VC9A 4BURA 4IP7A 2VZOA 3P60A 4L4PA 4AVNA 1SZGA 2AMGA 1B3VA 2CLEA 5GNYA 3A47A 4QHRA 4P5UA 1Z3NA 2VL4A 3C2RA 2D24A 2RDUA 3TE9A 3VABA 1NWSA 2YDQA 2J62A 2ISWA 2QCCA 2G95A 4H8NA 1REQB 2GJRA 4FXSA 1CGYA 4ZO9A 3NQ7A 1F3WA 1FH9A 2NSXA 1LBLA 3AXHA 3S9YA 2X8GA 3L5LA 4AZ7A 1QPRA 1RLDA 5TBOA 5E70A 4OOUA 2WHKA 4NX5A 3UEQA 4JFUA 1ZY8A 1BTMA 3KE0A 2HSAA 3I68A 3N2TA 1VZWA 4WZHA 3QZ6A 1JZ5A 1GHSA 1TWWA 3NQBA 1EWDA 3KCLA 4F2UA 2P50A 1NP2A 2ABBA 1W3KA 4XAGA 1GTHA 4B5WA 2QULA 2V82A 4OIFA 1NM9A 1ZCCA 1AH0A 2CERA 1K3UA 2CLIA 4KH2A 1FFQA 3L4ZA 1EPXA 4QQ3A 1JZ6A 2PWDA 4Q8QA 1JNDA 3WZ0E 2WKLA 3PF3A 5DLCA 1NOUA 4P8XA 1FHUA 4H3DA 1SZNA 4PR4A 3VGGA 1W1ZA 4WKHA 1S5TA 3SAZA 1UWSA 1O4UA 1RK5A 2PGFA 2Y24A 1JI1A 1RV8A 1DBTA 3MV01 2PE4A 3O63A 1TREA 2WC4A 1WPCA 1DE6A 1MQPA 4C60A 5MKGA 5JBEA 5U1OA 3AHZA 3L2MA 3KS5A 1JULA 3UR8A 3OHIA 2VGFA 4RZ5A 4Q22A 2Q09A 1YQZA 3SR6B 5HOSA 1OQFA 3R2GA 3TSDA 3HGSA 3AU6A 4IWWA 4J2PA 3WNMA 1NP0A 4N9EA 3VMPA 1CLVA 3QQ0A 2Z28A 3GIQA 2XN0A 3VFCA 4Q8OA 4NF7A 1ZS2A 3OYXA 1IWBA 1MVYA 2PWFA 1JL8A 3CGCA 1QOQA 3CL6A 2NSOA 3TTQA 5HULA 4Z2LA 4M6VA 4AB4A 3JRKA 4FNRA 1V3KA 1CX9A 4XG1A 3WCZA 3W53A 3EDKA 3CHEA 5ECUA 1OX4B 4DNMA 4ZODA 5D9MA 3Q94A 2YVFA 3WD0A 1PYMA 1T8QA 1P6WA 3F4DA 1AZ1A 1H0GA 3E74A 3DKLA 2IQDA 3KWXA 4LVAA 2V3EA 4FNUA 2BXYA 5LNSA 1IT8A 3BW4A 1WXZA 4O50A 4IP5A 1JG9A 4Q8PA 3SRFA 3PFRA 3CMFA 2ISSA 2HBVA 2CLKA 1GNXA 4Z2KA 4NJHA 4KCTA 3HPFA 1U1HA 2PGWA 4BEQA 5FEXA 1IR1A 5CGQA 4S3AA 2ZC8A 3EDEA 3IGXA 3IIZA 2V3AA 5FSEC 2GOUA 1FWJC 4RE3A 1E6ZA 4ACYA 3E3HA 2VGBA 2ODOA 5A8MA 3HM7A 3WQEA 2HNHA 1QNOA 5IFPA 1JPKA 3PTKA 3WELA 1P7TA 4GYPA 1GQNA 1GK8A 1EKOA 3BLPX 3ONCA 1TVNA 3W7CA 7ENLA 4LWWA 4LNCA 3MWCA 5ER0A 3UESA 5HMEA 2JK2A 4D1IA 1KM1A 1E9ZB 5DBUA 1O7AA 3RDKA 4KCWA 3UVIA 2AMXA 3TSMA 3CZKA 3CTTA 3P80A 1R38A 4B9YA 2JKPA 2RDXA 4Q4MA 2D23A 1Q6CA 3GTNA 4ZO7A 3OU8A 3TN4A 3WBWA 5L9FA 3W7IA 3W7PA 5XINA 1RH9A 2Y5SA 4O53A 3IGUA 1RPKA 1YTEA 1OG0A 3H12A 1OX5A 4PC8A 3TQPA 4S3DA 4XV0A 1OM0A 1GRTA 5H6HA 4GZ7A 4C6JA 5HNTA 4KRUA 4GHRA 3SIZA 4MY8A 3AJXA 3WLJA 3VGEA 2F9RA 3DESA 3VD3A 1K6AA 2CW6A 3N29A 3BAJA 1GT8A 1GVYA 1AH4A 1GRHA 2J27A 4UMBA 4PFMA 3MHGA 3UBPC 5FA5A 1NDAA 3GVRA 2OWWA 2CLOA 4CEUC 1EDGA 4DZAA 4GOAA 5AHEA 1DJIA 2IW0A 3UXIA 4AYGA 4AEFA 3E02A 4AW7A 2RHGA 1BXCA 1VFSA 1O94A 1W32A 5FJRA 3ZVIA 3B4UA 3FK4A 1J0IA 2FGBA 1GQIA 3TC6A 4OV9A 4MY1A 4BCEA 3VKAA 1CYGA 3HMJG 4PUEA 1D7KA 3KXQA 4C6EA 2VMFA 1FIQB 1FWHC 1KQYA 1IIGA 2Q71A 1P7TB 4F66A 5HNRA 2V5KA 4ZB0A 3T1GA 3P0XA 2HE8A 4MVAA 3RG6A 1W5NA 4MYXA 1J5TA 1SFSA 5AC7A 4DO7A 2BV9A 3BOFA 1F74A 2I9EA 1MQRA 1LLOA 4IFRA 3XINA 4ZQRA 3PAOA 3NOEA 2Y0FA 3RR4A 1QPOA 1JCNA 1P1MA 3JU2A 2E25A 1T40A 3R89A 4KPLA 3UR2A 4H4YA 5DRIA 1Z44A 1W2PA 3JUGA 5F2IA 1Y65A 3KEHA 5AYYA 1Q1RA 1TO3A 3A4WA 3KBJA 1KFJA 3W28A 5E9AA 1B9ZA 5REQA 3DENA 2PP3A 5FJPA 3SCSA 3ZVHA 3AI0A 3IRSA 3UT0A 3VO0A 4O1AA 2Y6ZA 1LLWA 1UP0A 2CPUA 4MIMA 1EJSC 2A4AA 1Z89A 3CV6A 2V2CA 4A05A 4F0MA 3BICA 5GPRA 4JQ1A 2V2DA 1UR9A 1VS1A 3ABQA 3U7VA 1EDTA 2F8QA 2Z1SA 2OT0A 3KBSA 1VC4A 1W9UA 2QJNA 1WKDA 3KVJA 1C8YA 4F3HA 4PTWA 4ROPA 4AX6A 1KLZA 1JAKA 5EFDA 3NPUA 3DZ1A 1TPB1 5GJMA 2NT1A 4Y6GA 2IS7A 5I78A 2PWUA 4B5XA 1QT1A 1OFOA 1MEWA 3S1UA 4S39A 5AZ1A 3DHDA 5BU9A 3BSHA 1F3XA 4GZIA 3C2EA 3KUMA 4JHMA 5AKQA 4J27A 1ZXIC 3AUJA 1GONA 4H4RA 1G7UA 2Y62A 2EJ1A 3W76A 1E1CB 3V18A 2OR2A 4US5D 4GYKA 1GOWA 3M0MA 4AZGA 2A3AA 1QATA 4UR9A 2XIMA 1UD6A 4Y9PA 4QROA 4RK8A 1KFLA 1Y5VA 4UFHA 2VGIA 3G1YA 4ZQOA 5A8NA 2GWNA 3EMQA 3NDOA 5D05A 4S3JA 3NPWA 3VMNA 4ZA0A 1WV2A 3WF2A 2VEMA 2WMFA 5E0FA 2QAFA 4L4LA 3VYLA 3P84A 4QEHA 4W5ZA 4HT3A 1AOGA 3GW0A 2VNCA 4NZ5A 3ZMRA 4O0ZA 1ZMDA 2B7OA 3AQUA 1O1ZA 4FLRA 2GGHA 4UTMA 2J77A 2ZBTA 3BCFA 4GUJA 2D2OA 3NOYA 3E0VA 3P81A 3TW9A 4DHGA 1AVAA 1OT1A 1HXJA 1EF2A 4H4ZA 4ZTXA 2Z26A 1LBFA 1FDJA 3KZPA 4C6OA 1KGWA 5CAHA 4LCSA 3H7UA 1ISZA 1A5MC 1ONWA 2HVOA 4QNWA 3GVWA 1RCXB 1VGAA 8XIMA 2J6XA 1KC7A 5LXXA 1JZ4A 1VCFA 4IFKB 1PO9A 4HPGA 5KETA 3BAXA 4JDBA 2HZGA 4GIAA 3CUJA 3B8IA 4NJGA 1U2YA 1U5JA 4RKAA 1X39A 1BLIA 1Z42A 4TIMA 3SCWA 2TODA 4JKLA 3W29A 3ALFA 3N13A 1XJBA 4QS5A 2G41A 4IPPA 1PHQA 4GQRA 4JN7A 4KCUA 1XYZA 4AMAA 3MUXA 2VM8A 1PYFA 2I16A 4U5IA 2PGEA 1Q6EA 4JNMA 5H8UA 3TCEA 2HK0A 2UZ9A 3SCUA 4N4QA 1E9LA 2R6OA 2X0YA 5FAGA 4LS0A 4LGXA 3VINA 3QVQA 1SFJA 4FB7A 1M6IA 4O17A 2FFCA 5D38A 2WNQA 4B3KA 1VBUA 4NEWA 2ADAA 2NT0A 2OOFA 6