3FVDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
361
Chain Sequence
SLRITRLTVFHLDLPLAKPFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a member of enolase superfamily from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
rcsb
source organism Roseovarius nubinhibens ism
molecule tags Hydrolase
total genus 117
structure length 361
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fvdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fvdA01
3UJ2A 2HZGA 4G7FA 1JPDX 3OZYA 2OKTA 3OPSA 3R11A 2OFJA 2PTWA 3NFUA 3R0KA 3TWBA 3CYJA 3CXOA 4IL0A 3D46A 2P88A 4FI4A 2ZADA 2XH4A 1E9IA 3UCDA 1RVKA 3DERA 6ENLA 4MKSA 5ENLA 4J1OA 3FJ4A 4K2SA 2DW6A 2XH7A 2PTYA 4DXKA 1ONEA 3N4EA 1WUEA 3EKGA 3MQTA 2OLAA 4GISA 3UXLA 2GGGA 3JVAA 4GYPC 3RRAA 2AL2A 2NQLA 3UJEA 3MY9A 3B97A 3MSYA 4A35A 3UXKA 3T4WA 3QTPA 4GGHA 3GD6A 3ZLGA 3I4KA 3DESA 3MZNA 2PTXA 3FXGA 3Q4DA 1SJAA 3QN3A 2P3ZA 3V4BA 3TWAA 2QDDA 3OTRA 3TOYA 3FVDA 4JN8A 1EBGA 4IP4A 2QJNA 4HNCA 2OZ3A 3CT2A 3ES7A 4K8GA 3PWGA 3R10A 1KKRA 4HCLA 2PMQA 3CK5A 3VCCA 4ZCWA 4M0XA 1EBHA 2AL1A 1P48A 2QJMA 4F4RA 3RGTA 3S5SA 3EEZA 3TTEA 2CHRA 2OQYA 2QVHA 3RO6A 1TE6A 3NO1A 4DHGA 4E5TA 3DFHA 1JDFA 2FKPA 3PWIA 2PTZA 4GFIA 1JCTA 3H12A 1R0MA 2OQHA 2AKZA 2DW7A 1BQGA 2O56A 5FJPA 2P8BA 1PDZA 1EC7A 2OVLA 3ZVHA 5J04A 2HXUA 3SSZA 4HN8A 1XS2A 2PU0A 2AKMA 3JZUA 3UCCA 3SN0A 3CB3A 4H2HA 3FYYA 4E6MA 3S47A 2GGHA 1SJCA 3IJQA 1TKKA 3ZLHA 4HPNA 2QDEA 3OZMA 3U9IA 1XPYA 1ELSA 3VCNA 1FHVA 1BKHA 5BOFA 1L8PA 2PU1A 4H83A 2PA6A 4EWJA 3THUA 3H70A 3TW9A 4IZGA 4Z1YA 3PFRA 2GL5A 4IT1A 3UJRA 1W6TA 2PODA 1KCZA 3DDMA 2PS2A 1EC8A 2GGJA 2RDXA 1P43A 3D47A 4ROPA 3ES8A 4MMWA 3N4FA 3CAWA 4G8TA 3VA8A 2PP1A 3H8AA 2AL2B 2MNRA 3QKEA 1OEPA 2QJJA 2GGEA 2OZ8A 3FV9A 2OPJA 3IJLA 4K1WA 4E8GA 3UJSA 2PSNA 4JHMA 3DG7A 1FHUA 2I5QA 2PGWA 2HNEA 4MGGA 2PGEA 3T9PA 2GDQA 3TCSA 1DTNA 2FYMA 3I6TA 3BSMA 4HYRA 1MDLA 3RR1A 4YWSA 3H7VA 4IP5A 3VDGA 3FCPA 4DX3A 3NXLA 3IJIA 4DYEA 2PP0A 3R1ZA 2POZA 1PDYA 2XGZA 3BOXA 3VC5A 5FJUA 2OX4A 4Z17A 4DWDA 4GIRA 3DFYA 4GGBA 4GMEA 4HNLA 1F9CA 4GYPA 3Q45A 1TZZA 2PCEA 3RITA 4E4UA 4A6GA 7ENLA 3HPFA 3R0UA 3V5CA 3OP2A 4IHCA 3QPEA 3P0WA 3SN4A 3JW7A 4DN1A 3ZVHB 3SJNA 3VFCA 3TJ4A 3VC6A 4A3RA 3K1GA 3PK7A 2GGIA 3RCYA 1JPMA 3MWCA 4ENLA 3ZLFA 2PP3A 4H19A 2MUCA 1ECQA 1IYXA 4M6UA 3NZGA 1NU5A 3QLDA 3ZVIA 3V5FA 5FJOA 1MDRA 1WUFA 3DIPA 3MUCA 4KPLA 2PPGA 4FP1A 5IDZA 3N6HA 5FJTA 1KKOA 4H1ZA 2ONEA 1KD0A 4IL2A 3SN1A 3SQSA 3STPA 2HXTA 3U4FA 2GSHA 3ENLA 1YEYA 2ZC8A 2XH2A 3R25A 3OW1A 3GY1A 3T6CA 1NELA 4J3ZA 3TQPA 3KUMA 5BOEA 4KEMA 3DG3A 2OG9A 1MNSA 2OZTA 3GC2A 3GO2A 3MKCA 4KWSA 3DEQA 4HCHA 4KT2A 2XSXA 2P0IA 2XH0A 3UJFA 2QQ6A 3UGVA 3DG6A 3P3BA 4E4FA 5FJRA 3IK4A 1SJDA 1R6WA 4ZA0A 3T8QA 1SJBA 2QGYA 3N6JA 4HCDA 5EU9A 3SBFA 3BJSA 1EC9A 3TJIA 1MUCA 2OO6A 1MRAA 3V3WA 3DGBA 4JN7A 3P93A 3I6EA 2P8CA 4X2PA
chains in the Genus database with same CATH superfamily
5KVIA 2QHAA 2D2HA 2O9OA 5FF3A 3AIUA 3TWBA 1UA7A 4O54A 3UZXA 1N62C 5AYYA 2A2IA 2C79A 3ARWA 1S39A 4JNMA 3DERA 4UTUA 1MW2A 1J12A 1E3ZA 1EDTA 1EPXA 1OG6A 1UUMA 3TN3A 4DJDD 2W4XA 1YHTA 4JL2A 4HIBA 1BD0A 1K8XA 3PR2A 1SZFA 2OX1A 1OD8A 5JVLA 1LLOA 3LGDA 3UPBA 1B2YA 2WZIA 1BSIA 1LUCA 3V7PA 3PPFA 2NQJA 2E5AA 1R46A 4LUTA 3GFZA 2EJ1A 3CM4A 1FP8A 1N7KA 2R82A 4BEQA 5DMMA 4FNSA 3W82A 4C1KA 5DELA 3C0SA 3AYTA 5DQPA 3PHAA 1EYEA 3DYMA 4CU8A 4EQRA 1GYMA 4Q8VA 4K8EA 2VZTA 1QATA 4ZQRA 2G50A 4OUEA 4GZEA 3WUEA 8A3HA 2G3JA 3BOLA 2PDPA 5AHNA 5CSRA 4QGCA 2WOQA 2WCAA 1T6MA 3CT2A 3R10A 2QCCA 4AF0B 3NVYB 4UOQA 3CK5A 1LG2A 1XIHA 4JIIX 1PBGA 2IKJA 2GPTA 2TPSA 2VZUA 1UR9A 1PTDA 2YR1A 2V2DA 3AALA 2BODX 3DBNA 3AZRA 3H2CA 2QVHA 5C5YA 3NQGA 1GW9A 5HMFA 1REQA 2WP5A 2PTZA 3LB8A 4L64A 1JCTA 3BTNA 5ECUA 3KDNA 2OQHA 4PE8A 2X1IA 2P8BA 1ZKQA 3W87A 1UD3A 5F4XA 2ACQA 5FA5A 1R3YA 3L23A 4F9DA 3AIRA 4F40A 2QZRA 2GSJA 1YRRA 1UWIA 4NZ1A 1AZ1A 4NJGA 1DJXA 1I4NA 3ANUA 3RRXA 1GERA 4LAOA 3VINA 4GA8A 4O1DA 5GRTA 3VOCA 3KW3A 4F48A 2CLIA 4IXHA 1WPCA 1QHZA 3CH0A 4YTTA 4E6MA 3DH9A 3EX3A 4GRSA 1MZHA 1NWRA 3CT7A 2ZRYA 1GEQA 2WMIA 1BXBA 3ZLHA 3OZMA 3L4XA 1UWUA 3LXDA 3OZPA 1NFGA 3QBUA 4QM1A 6REQA 3DFQA 1V97A 4TX9A 1NY1A 2GOUA 1H7OA 4LC8A 4IT1A 4WR3A 1ZMCA 3MI3A 1FDJA 2RFGA 4J27A 1S3HA 4QIUA 5MF5A 1CXHA 4PUNA 2GUBA 3Q2DA 1U5HA 4LUSB 1B3ZA 1YPFA 3ES8A 2LLEA 2DPEA 3BLKA 4EPEC 4LS0A 4U4MA 4MMWA 3ZWTA 4HT3A 2BDQA 1WZKA 1EA9C 3RU6A 3ETRB 3RDKA 1H2JA 4C6CA 3F5JA 1OEPA 3GH7A 2PDMA 1EXBA 6CGTA 2GGEA 1FWEC 3ARRA 3FV9A 3B04A 3NQFA 4K1WA 3DK9A 2QCDB 4MUZA 1SO3A 3MB9A 3TX9A 1PIGA 4DM2A 4PMUA 1TWZA 4J3UA 1KCKA 4AVNA 2X99A 1MWOA 4NNBA 2UY2A 3I7QA 2INFA 4HU3A 4M81A 1RXOB 3VMOA 4FALA 2F2KA 5IOBA 3IJ9A 4DX3A 4QJ3B 4LYRA 1LOLA 1LQAA 3V5OA 2RABA 1GOIA 2I9UA 3W23A 1G9HA 7TAAA 1K1DA 2VX6A 4CD7A 3VKDA 4H7CA 1W1A1 1QOPA 5LIUX 3KFTA 2QF7A 2H90A 3GRIA 5CSUA 1TTJA 1VCFA 4QP0A 4GYPA 2H6RA 5E93A 1HXJA 4LF1A 2NXHA 3INPA 4N42A 1XLHA 2DT0A 3DAQA 3BV4A 1JL8A 4GO8A 4EPBC 1SUXA 3BL3A 3KHJA 4PN2A 7ODCA 2GDVA 4AC1X 2R8WA 2WSPA 1KM3A 4UQDA 3VIGA 4FHAA 4O0ZA 3HN3A 3MUY1 1UW9A 4JIPA 3QF0A 2Z25A 5JMUA 2W3SA 4LV9A 1GK8A 3MJMA 2QPXA 1TIMA 1E72M 1P0BA 2Y4SA 5I03A 1NDZA 4AUBA 4B15A 4JAWA 4C6FA 1XFCA 1GPWA 1IQ8A 1V0LA 2X50A 4XZ9A 2ATSA 3PJUA 2EPOA 1GTHA 2E5DA 5A2AA 1STZA 3WQ5A 2J7GA 2Y7EA 2NWSA 2YDAA 3HA1A 3I6RA 2H3DA 3F4DA 4FZIA 2R1LA 3GXFA 3THQA 3H53A 2J7HA 5AHMA 3STPA 1KTBA 5KMYA 3K4WA 3QZ6A 1VHCA 3GHTA 1ITQA 1HJQA 1YTKA 2X8HA 4JQ9A 3M47A 1UOKA 4QG6A 2WVSA 1NELA 1C8XA 3W6YA 1UROA 4MB3A 4GX8A 2WXDM 1N5XA 3BLLA 5FF2A 3WQPA 5C2CA 3G1VA 3QC0A 4Y9NA 1C8YA 5I7GA 5BMWA 1QPRA 1D3CA 3PB0A 3HMJG 1Q2RA 2WMJA 2Q02A 5HK4A 1L6GA 3WFAA 1UH2A 3EA3A 3W9ZA 1H0GA 1JPHA 5KZEA 1XFBA 5EU9A 3BJSA 4L65A 1MUCA 1E5JA 3WK0A 1TPEA 5ABFA 4CD5A 2C15A 5HQMA 1K8YA 3P93A 4S2BA 4AU0A 3NQ8A 4FNUA 2KAUC 1UMLA 1RA5A 1V0NA 1KV8A 7TIMA 2V3GA 4HJWA 4UFKA 4Q8TA 3VOFA 1FKWA 2QCLA 4IOTA 3MTWA 1GKQA 2VJXA 3BWWA 1J6OA 2BV9A 1HKJA 1V08A 1Q5MA 1XCFA 3GS6A 4YTUA 4S38A 3VNLA 4R5EA 4C90A 2NWRA 2GSEA 1P0NA 4L4MA 3FDKA 3BLPX 4CUCA 1IZKA 4NZ5A 4LVGA 1XCXA 3KVLA 5TR3A 4ZO9A 2VEGA 4AY1A 3JVAA 3WIJA 3A3XA 3HF3A 1V6WA 5DXXA 1LM1A 3ZQ9A 4NZ4A 3CHEA 3LZ3A 1BXNA 2F61A 4CN4A 3VNMA 1RK5A 3QKZA 3QTPA 4TV6A 4QDMA 1FQ0A 4D6EA 5H1WA 1WZLA 5G1MA 1JCXA 1S2VA 1ZCCA 2YL9A 2NV9A 1ZAHA 5DBTA 3WD0A 3PG9A 4LSBA 2P3ZA 1OF6A 4MDOA 5HPOA 1M1BA 1GKRA 3H7RA 1TR1A 2DV0A 2VOTA 1UZHA 1V6TA 4HP5A 3HZ3A 5HUPA 4HU8A 3BAKA 3TW7A 1JYXA 3EWXA 3VDBA 3S8HA 2Z0IA 4AD0A 3LSBA 4LTSA 7XIMA 1QBAA 3FHAA 4KFOA 1RSCA 1FWAC 1J0IA 3UD6A 4GXWA 1SVDA 2WNZA 4OBSA 5CGQA 2WM1A 3VCRA 4A3HA 4IFKB 2CHRA 4Q7BA 2X1UA 1W5MA 4AW7A 1SO4A 1Q1WA 2B81A 3E6EA 1TWIA 1RD6A 2A3CA 3SUTA 3CQHA 3VIMA 3AMDA 4J57A 5H8MA 5D8WA 2E9BA 1Z7AA 2GJRA 2JF7A 1EC7A 2VD8A 2PDYA 2IKHA 4RDWA 3RO8A 4BQ2A 4BY3A 1TB3A 2ZXQA 4HN8A 4FEZA 1QO5A 3KBNA 3NYDA 4RZ5A 4YYCA 1KWGA 2BY0A 3VNJA 4XQ6A 3TTOA 2VVNA 4NXKA 4RK8A 3CWHA 4U10A 3R12A 3IJQA 4J3WA 2CZFA 5D2WA 3WNPA 1FWGC 4HPNA 3GTXA 4PMRA 1LOSA 3UA3A 4PA8A 3NQEA 2DZSA 4NZCA 1TJ2A 4EWJA 2V38A 1PIIA 2P76A 3CGBA 1ISZA 4NX5A 3UT0A 1ZTVA 1IGSA 2Y8KA 4WJEA 2NZLA 4I9AA 4PC8A 4Z42C 1I2RA 2WNQA 1ZFJA 3PZMA 3EB2A 4LUJA 2ANUA 4ROPA 3EX2A 5JRBA 1Q63A 5I3GA 5CSYA 4YHGA 1XYFA 3VGFA 2YDRA 3LM3A 3G6MA 4Y2WA 3NTYA 3AU2A 2O9PA 4RZ6A 3IGHX 4LW7A 2P50A 2WJZA 1MQRA 5AHFA 3GW0A 2BHZA 2C1HA 4O0QA 1RALA 1YDVA 4JXCA 1JGIA 2A1YA 1FVPA 3LQLA 2YYUA 2F38A 5H2ZA 1GVFA 3LHVA 2X0YA 3KS6A 1RBAA 3UR7A 2GDQA 4AIUA 4DVOA 4U5KA 4JQ1A 2O0TA 1MQPA 3RHGA 1AD1A 4EAYA 1W1VA 3PZNA 1CGUA 1TA3B 4XBSA 1FCVA 1XGZA 5EBKA 1PEZA 5LNVA 5DY2A 1MOKA 3P5ZA 5I2UA 3GU2A 1QU4A 2J7BA 1V6VA 3BOXA 3W7DA 2GRTA 1XPGA 3ZZ1A 3AXIA 2NVKX 2HS6A 3W37A 4RZBA 4IUOA 5A5WA 3QH2A 3T0CA 4CQDA 3NQ6A 1X8CA 1W9VA 1RH9A 2I5GA 3AIBA 2JFEX 1XDJA 3GB6A 3W74A 2VD9A 5LHFA 3S9IA 2V8ZA 1W56A 2Z1BA 3QPEA 2Q09A 3MPGA 3VFCA 3C8FA 4DRSA 2TAAA 4QNEA 1OFPA 4B3LA 3U7BA 3TNBA 1R3WA 3PK7A 4WSHA 2NLIA 3HMCA 4L6HA 1XYMA 2ZZ7A 1LZOA 2E8YA 2WM0A 4AQLA 4ENLA 4UNLA 5LNRA 3RJYA 3LG3A 2VEMA 2B7QA 3ME3A 1ZJHA 2VZOA 4WLCA 4D6HA 3WNNA 3KTCA 1F3XA 1Q8AA 4RR4A 1H51A 4JTEA 3OHMB 4FX6M 4ADWA 1F3EA 3LBCA 4LUSA 3WK3A 1B3OA 4HU0A 3R8HA 3T81A 1XM3A 1PIFA 4A8LA 4H01A 4H4YA 1TRDA 1GT8A 3WDQA 1ISWA 3EWZA 4QCEA 2WYSA 3MV11 3SN1A 3W72A 3U4AA 3FK4A 1N8WA 3PBUA 3S1WA 4LC6A 2ZUNA 2QCDA 5LZLA 3WQGA 3OG2A 5DBUA 2B7NA 2XH2A 4RE0A 1AA1B 4O4WA 3NZPA 1LJYA 3SRDA 3QZEA 2QS8A 4JTAA 1GOMA 3BK0A 1OABA 3EBVA 4AX6A 3WJSA 4TX8A 1GJUA 2ZZBA 1TPH1 4TOQA 4OHQA 2PBOA 4V1YA 2FTYA 3MP5A 2HISA 4DBUA 2OTDA 4GWEA 1V51A 2P0IA 2XH0A 5ER0A 3G1SA 4MFDA 3DJGX 3D0CA 1GG0A 1WZAA 4HNOA 2VDHA 2CXGA 4M51A 4EQWA 1B4EA 3WMLA 2XIIA 1TV3A 1TV4A 3UWYA 4US5D 1HIZA 2OO6A 1O68A 1XICA 1WDDA 5EMKA 4JTKA 3F7JA 3K4AA 5D9NA 4ES4A 1R86A 4LS2A 4S3FA 1EJXC 2ZRUA 1ISXA 3NFUA 2VZSA 4X60A 4B4FA 2PLCA 2WOWA 1W32A 2CCRA 4Q4PA 5F1UA 1DNCA 3TP4A 2VOMA 2VUNA 1RVKA 4LRTA 3PWAA 5K2ZA 1DJHA 1ZP3A 1SFTA 1SGJA 5F7UA 4CD8A 4FF7A 4OQVA 3WJZA 1X7IA 2XG9A 4UFLA 3W75A 3M5YA 5D2YA 3WL0A 1H3GA 4RNIA 3C0LA 4GYPC 3RRAA 2BGSA 1VFSA 4DJED 4QTGA 3MY9A 4NJIA 2BHYA 1UHVA 2VFHA 3K4DA 2GR3A 2FTPA 1V6XA 2A3AA 2BLEA 3GVGA 4ATDA 2G4JA 1R7OA 3O0KA 4I5UA 4Y9AA 7PTDA 1ZCOA 1H2IA 5FL0A 1QBBA 2PDJA 4S3JA 1GYLA 3QVQA 1NFBA 4H2CA 4BCEA 3T8LA 1QWKA 4NF7A 2CBIA 1WKYA 1XIJA 3M0JA 4AC7C 4AFYA 5JUVA 4XZNX 3KCJA 1XIFA 4FA3A 2C1IA 3RPTA 4M0XA 2AL1A 3OVGA 3CO8A 1JF5A 2OT1A 5BU9A 2VCAA 4V28A 1FEBA 2WC4A 4GQ0A 4WHBA 4K8HA 2Z1SA 3L5OA 4PFMA 4XBKA 8TIMA 3TAKA 2BC1A 4GK8A 3HG5A 2JGYA 4PMDA 2AKZA 1V7AA 4CNSA 4BJHA 1PDZA 3G1FA 3ZVHA 1KFKA 5CLTA 1F6YA 1B5TA 4G5DA 1IWBA 3QV7A 2R1MA 4AZCB 1X6NA 4UTWA 2Y8VA 5HAOA 4M56A 4MB4A 3TTSA 1P4CA 5FD0A 3ZWSA 1CIUA 4AXKA 1Z89A 4DLFA 3ABOA 4HTYA 2INZA 3OJGA 3OO2A 2OCZA 3C2RA 4N9DA 1RCOB 3M1ZA 3G1RA 3N15A 2EKGA 3CIXA 1A5UA 1R2RA 3MSGA 1EDQA 1ESWA 3B9EA 1TJRA 5D2XA 3UJRA 4YTRA 1QPQA 2PAJA 4EF9A 2PZNA 1LP6A 3UA4A 2PS2A 3ABZA 1DJYA 3QQWA 4R34A 3SJ3A 2NXIA 2UY5A 4MFEA 5DXYA 3D47A 4DPPA 4ZMGA 1M7JA 4B5TA 1CNVA 2XFYA 2W92A 1SSDA 2Z1XA 4W7UA 4B2DA 3DK4A 2DZBA 1SZRA 4D8ZA 5JQ9A 3SCWA 4BS0A 4KCUA 4O28A 3VGHA 1VR6A 1A5AA 1J10A 1QI2A 3HPAA 2QUNA 3REQB 3ARUA 1JPKA 2ZX7A 3W28A 4L9ZA 1VQTA 2P1FA 2PGEA 3I6TA 5CZKA 3VDGA 2OT0A 3UZYA 1EDGA 3S2JA 3FCPA 3CMJA 3C8NA 2DSZA 4ZOBA 3VD5A 1JRCA 2J13A 3SUVA 1TQJA 5AC7A 1ICQA 3TC6A 4AZHA 1PHWA 4QE5A 1RCXB 4OZOA 1ZAJA 2EXOA 1OGGA 2C0HA 4LBUA 3R89A 3WLTA 4NEWA 1KM0A 3QFBA 3LENA 3SAZA 4I7UA 1ME7A 4S39A 4EMWA 3MW7A 4WSKA 4C1NA 1D3HA 3UEQA 1TZZA 3GG8A 3PB2A 2E40A 2Y7DA 3GXTA 2CBUA 4HTBA 1JFHA 1KGWA 1V5XA 3PSVA 4GUIA 1PZ0A 4PMJA 4JTHA 2X8RA 3C5QA 1GVIA 3LHUA 1XKYA 3S1UA 5EMYA 4CGTA 3CWNA 1FWNA 1O4UA 4ZE5A 2PC8A 3FA3A 2I9EA 1HZYA 2E9LA 4Y7EA 2IQ0A 4C6KA 1E1CA 3NZGA 3E0IA 3WBXA 3L5MA 4IGMA 2VC6A 5IDIA 4I5RA 2W67A 3EDEA 5FJIA 1KRCC 1LORA 2YSWA 4FP1A 4E38A 3LNMA 1L8NA 1JF6A 1DIKA 4M6QA 4Y8FA 1LL7A 3GZAA 2GVGA 3WBWA 1VDVA 3U4FA 3CHFA 2GSHA 2BGQA 3WLQA 2OYKA 3F5LA 1ZBVA 4W9TA 4I9TA 8XIMA 4PSPA 3O1NA 4LNYA 1E51A 4MAVA 1T0OA 4G7EB 4P8XA 1TA3A 2PBGA 1PKYA 2BY1A 1A5NC 2V3AA 3UBPC 1DHPA 2I57A 1UCWA 2WB5A 4O52A 3IUIA 4XSLA 4KT2A 3NGFA 2XSXA 5LSMA 3L68A 4O8AA 1YDOA 4NZJA 3DG6A 3WQCA 5D4YA 5JIPA 1SJBA 1RQEA 3N19B 4N9EA 3U3HA 3IIXA 1UJQA 3CZEA 1BQCA 3PBGA 4GVHA 4MLRA 1PCWA 2FDSA 4C65A 2DGAA 5FF4A 4LUIA 4G1KA 5JH1A 1KA9F 3B8DA 2AQWA 3Q65A 1NDVA 4E2VA 3TYDA 3WN6A 1FUYA 2HZGA 1QUMA 3RN6A 1VIWA 2BXYA 4R7WA 1JPDX 1IEIA 2OKTA 2OFJA 2E8ZA 3WL1A 3R0KA 5XIAA 4KWVA 4D8AA 2JIEA 2DDXA 3E5PA 3OODA 5HBFA 3TV8A 4PMNA 3H2EA 4S2CA 4YMZA 1AL7A 3IUHA 4H8UA 2EQDA 1XLDA 4ADUA 3M41A 3RJXA 1RQBA 1A5OC 1Q7MA 1JD9A 3W24A 3ZR6A 4H4RA 5CPNA 1NTHA 3BG9A 5CSSA 3LU2A 2XIBA 2R6OA 4BI7A 4TMCA 3O0HA 4O1EA 1RP8A 5ECVA 2FVKA 4H9MA 1M53A 3A7RA 2E1WA 4GYJA 1EJRC 1IXOA 1IEWA 4YXGA 1HL9A 5JU6A 2ZYFA 3B0XA 5LIXX 3CZGA 5TD4A 1JCNA 4GG9A 1IXPA 2EGZA 2RJHA 5K3VA 1VRXA 1W5OA 1VKFA 3DESA 3DYPA 1PX8A 3WKZA 4NI3A 4EPKA 4O1BA 4PRWA 2GZXA 1LPFA 1S3TC 2F6XA 3EXTA 2CBVA 1OIFA 4WXYA 3FSTA 5EB8A 2FJUB 2G37A 1AW5A 3W7JA 3AWNA 1PZ3A 4GI8A 3H24A 3L12A 3C2VA 3EOUA 5FS7A 4NAEA 2OZ3A 3ERPA 2IKGA 1WQ5A 1JYWA 3F5KA 4X9YA 1OINA 2JKPA 4NXSA 4ZCWA 4GH1A 2A4AA 3IIPA 5C8BB 4JCLA 1OT1A 4JIEA 3UZWA 3ARXA 3GKAA 2Y5JA 1HNYA 1LL6A 2EG6A 4IJRA 2W55A 1WDWA 3R2GA 2YB4A 3BLIA 4WDWA 1XG3A 2X0HA 1JDFA 2G3IA 2G4FA 3WBYA 1JCYA 1EP3A 1WBJA 4WVXA 2PB1A 2YOCA 5AC8A 5HMSA 2J62A 4FB7A 3W1AA 3CPUA 2OVLA 2QULA 4TR9A 1G5AA 3FAWA 5K9CA 4ZEPA 1NSJA 4ICNA 4HA0A 4U33A 4KERA 2IXVA 1NAL1 2VYOA 2OZ0A 5I3KA 2GQ8A 4C6EA 3O06A 1OCBA 2FFIA 3CZJA 5HR7A 5A6MA 1E9LA 3N13A 3GVRA 1R8LA 1B0IA 1JZ6A 3STFA 4GJJA 3VK5A 3BAIA 4FOUA 3A22A 2L5HA 2XFWA 5BOFA 4H83A 3LXBA 2VFDA 3OZOA 5H8PA 1N8FA 4PL2A 1SZGA 4G56A 3AUOA 1VEPA 2GVJA 1W6TA 3HURA 1S5NA 1H61A 3LTYA 3HG2A 4OOZA 2QR6A 4JICA 4FPSA 4CNOA 3RM4A 5HOSA 5KEZA 1XRFA 2FLIA 3POCA 5CAKA 1ZB5A 2V5JA 1TX2A 3EXRA 3SCVA 5EBAA 3CUGA 1TMLA 2V68A 1GJWA 1YNYA 4YCPA 1GQKA 3POHA 2VL4A 3EOEA 2EAWA 1KFJA 5KINA 1CXEA 2VRQA 1J0KA 1F6KA 3W27A 1A53A 3BSGA 3B03A 5E0FA 3UQNA 4IMDA 4WQ6A 3BXWA 1UZ4A 4RW5A 1DWFM 3UYIA 4ZGYA 3SIMA 4YWSA 1QR7A 3LCGA 3NQBA 1CGXA 1EB3A 1NOWA 5B7YA 4JTRA 5REQA 3VM5A 3WEZA 1MQQA 2E77A 1W1ZA 1MFUA 1XV8A 1AUSL 4UR7A 3S9YA 1XSJA 3WLNA 3PJTA 4DYEA 2PP0A 4CNTA 5AC4A 5HINA 1FCUA 3B3DA 1BF6A 3VU2A 1NH6A 3R13A 1O7AA 4CQ8A 2F6UA 2EKCA 1S5TA 1ZXIC 3N2MA 2JKEA 3VIPA 2JQXA 4ROQA 5BWAA 1F9CA 3GLCA 3EWCA 5EMUA 5DRIA 2QCGA 2BASA 3PTKA 2EPKX 3SCPA 3AQUA 1KM6A 2GWNA 4IHCA 3W7RA 1OX4B 2OXNA 3VKJA 4N4QA 2GQWA 6XIAA 3GXPA 4AISA 3OYZA 5A6JA 2WKJA 1ITXA 2VC9A 3NAVA 4QRNA 3COTA 4LA1A 3K8LA 2O9TA 3UWVA 4LIIA 3PZVA 4H19A 4B5WA 2PDXA 4NL1A 2WC3A 1XIBA 4F0MA 4E3VA 1RY0A 4IFOA 5FAJA 1BWVA 5KITA 4DYKA 3TNOA 5FJOA 2E6DA 3QYQA 3TXZA 1OFEA 4J28A 2ZZ0A 4UTWC 5IDZA 3FAXA 3UFYA 1EEPA 2J25A 1V59A 3U2OA 4H1ZA 2ONEA 4JNYA 4D9PA 3IJ6A 4GJ1A 3GK0A 1JDEA 4X61A 1GREA 1H5YA 4H04A 3W88A 2YPIA 3H2MA 1IT7A 3L4VA 4CU7A 1SZEA 1OZMA 1R9XA 1NWTA 4M6VA 2CDUA 1YEYA 3DOPA 4UFHA 4NNAA 3HG4A 4CQ9A 3F4NA 3IPWA 5A6BA 1BF2A 3VM7A 2ZICA 4MNKA 4GH3A 3QHMA 1OK4A 1P6WA 4F0RA 1MNSA 1G69A 3CLWA 4GPNA 4ICCX 1F61A 1AD4A 2QPSA 4PRRA 1RPXA 2R1KA 2NUWA 5C0QA 2YW4A 3NQ2A 1EZWA 2POTA 1R6WA 3WO8A 3M7WA 1KFCA 2G3NA 3M46A 3QC3A 1H0IA 2GJLA 1K9FA 3AHXA 4D1IA 3ZJ7A 3GAYA 4LANA 2DVUA 4INFA 3FN9A 2GQ3A 3LTPA 4HKPA 3SCSA 1BXCA 3IANA 3GIYA 2WZTA 2XM1A 3NM1A 2HK0A 4RUBA 2QPUA 3R11A 1KFWA 2ZBTA 3TLLA 2QJHA 1XYCA 2OYMA 3TR2A 3TROA 3WF4A 2BY3A 3BURA 5LNWA 1XF0A 3GNPA 3CAVA 2CETA 3AS2A 1W9XA 1UD4A 2CZEA 4WY0B 2WK2A 2NQ5A 3W1MA 3EKGA 3KBWA 1JXJA 4YN5A 1PYMA 3AYRA 3VILA 1E73M 1XD0A 5C2XA 3VOIA 3PBVA 1GOOA 2W62A 1CXFA 4JTSA 1DXFA 3RM8A 3VMNA 3BMXA 2WC7A 3ZLGA 2PRMA 3M5XA 1DPMA 5TNVA 3BJTA 3A5FA 3I4KA 5CQ1A 1GUVA 2VXNA 2EG8A 1IT0A 1ADOA 4R3UA 2J78A 3UWZA 1TV8A 1A5CA 4MY1A 4JN8A 3FGCB 4ZB2A 4H4XA 4FF5A 2QXWA 4DJFD 2I5IA 1EJSC 4MF4A 4AMCA 3TR9A 5HMEA 3AXXA 2PMQA 2Y5SA 1KRMA 1W3LA 4GNVA 4ERIA 3KRUA 5HNTA 1ONWA 4ZODA 1FHLA 2OQYA 3RPDA 1PKLA 4DHGA 2EQ9A 3A9BA 4ORMA 1FTXA 2HMCA 3L8KA 2YDSA 4AIEA 4C6BA 3M0LA 1TV2A 2HPMA 2ZZ6A 2QCEA 4Q32A 3R94A 4PUMA 2DSUA 3CHVA 4UTMA 4PTDA 2GQ9A 1D3GA 2PZ0A 2YBTA 2ZC1A 3OGVA 4OBRA 4E2OA 3PZGA 3U7VA 3TKFA 4NKCA 3RLHA 1E1FA 2FB3A 4F0KA 1J79A 4XKMA 4DO7A 4WDUA 1T41A 1VLWA 2UV8G 1CEOA 1N2VA 3NL5A 2GWGA 5HMDA 4UMBA 2PGRA 3TONA 2VWSA 3U9IA 4ERAA 4H7ZA 4DBWA 3LLXA 1L8PA 1GPFA 3SB0A 3TN6A 4H9TA 2GUYA 3HQPA 2WJFA 4OUIA 4IZGA 2D1ZA 3O05A 2G8ZA 1GG1A 1ODUA 2X09A 5JCNA 2PDHA 4GACA 3V18A 3CV2A 3DKJA 2VHLA 3BANA 3VA8A 1BPLB 4ZQCA 5GJMA 1GRAA 3AWOA 2C8NA 2BX7A 5A8QA 1J0YA 4TXEA 3HQOA 1FWBC 1RUSA 1JI2A 3EPNA 1GWJA 2NQHA 5I3IA 1VPXA 4WGHA 3HGSA 2Y89A 1BKSA 1MEWA 4OTKA 1UR0A 2PGWA 2HNEA 2YVJA 3MU7A 2VEIA 3BAWA 1WBHA 4JEJA 1SMDA 4H6EA 4BQ5A 1OC7A 2WZHA 3M4HA 1XJBA 2A7RA 1XSIA 1L6YA 4IG2B 1WOBA 1XP3A 4CCEA 3QFWA 1TTQA 5CPOA 4MM1A 2ICSA 2NVDA 2V0TA 1PKMA 1PDYA 3SIZA 3THCA 4ZSUA 3AYVA 4Z17A 1FO4A 1A5LC 3NL3A 4MWAD 3W7LA 4K7YA 1NF7A 3DFYA 3PAOA 1V77A 3C2FA 3GG1A 4FK9A 4PFHA 4Q6XA 4ZL1A 3QQ1A 3AU6A 4UQEA 1GSNA 1EJVC 1GOXA 3BICA 3B05A 3WLLA 1ME9A 2WSRA 3PY2A 5A8NA 5HQLA 3H22A 1TPWA 5M5DA 1ODZA 3BMWA 3LBOA 5D8ZA 5A94A 1G4TA 4C6IA 1W8SA 1B4KA 1YTDA 3DECA 3RIKA 4PEKA 4WOZA 4B5SA 3QOMA 3S2CA 1GETA 3AAMA 3EA2A 3LHTA 4WIWA 3MVIA 5D02A 2XTKA 4FNPA 2GJXA 5FF7A 2FZDA 1LG1A 1W31A 1O6IA 4ZO8A 5FCZA 1W1YA 2PDGA 3AXMA 3VMPA 4UFIA 4CQAA 1F8WA 4LAZA 3VPLA 3ITTA 4DJDA 1I1WA 3AHVA 1E9YB 1GOWA 1UA3A 3PNZA 6TIMA 1EJWC 1XUZA 2IKIA 3NJ3A 3N17A 3BG3A 2ZWYA 2OR2A 3ATZA 1PV8A 4HBKA 1K9EA 4F3HA 1UD6A 1EUAA 1EEXA 2FFCA 1GTEA 3JUGA 5I79A 3AI0A 3W7KA 1NP2A 1ZNNA 1A50A 4NRRA 5DANA 4CNUA 4H8VA 1EOKA 1W9BM 2XVNA 3UESA 2B31A 3KVMA 2ZVRA 5FEXA 2EHHA 4KEMA 3QYSA 4MY8A 4KRUA 1GV4A 1J01A 2PDKA 3GC2A 4NRSA 3CAKA 5A69A 1UP3A 3BAXA 5BW6A 3SQMA 3L4TA 2YDQA 4KF1A 3KHDA 3P3BA 3CLMA 3ARSA 1DJNA 4ZB5A 3G1DA 1O5KA 1RR2A 3T8QA 2OMAA 1S7MA 2ABAA 2CHOA 4JTUA 3NVWB 4AB4A 5U7SA 3TK7A 1MRAA 3UWUA 3DGBA 3MJYA 4KFNA 2OEJA 1OQFA 2XHYA 4ZB0A 1K77A 3PANA 3N18A 3HJEA 1AQ0A 1DE5A 4EXBA 2PTWA 2WBAA 2QVNA 4IL0A 4YTQA 1F8IA 3D46A 2QDGA 2P88A 2OOFA 4GZIA 3NZRA 5CAHA 3CQ0A 4HJFA 3NSNA 2J88A 2CZVA 2O92A 1F05A 3TQVA 2W6RA 4GLEA 2HWGA 3QXBA 3OGRA 4C5YA 1J96A 3JRKA 4MZ8A 4DXKA 1ONEA 3VIIA 1VBJA 3MQTA 2FZMA 2YAUA 3VD3A 4A8NA 3ONCA 4M82A 4QSFA 3UVIA 1B3VA 3PZIA 4UOJA 2ZE0A 5IBXA 3MSYA 4QSHA 4A35A 4XVEA 3KBSA 1U30A 3A64A 3WQOA 3N2TA 2Z26A 3H4KA 1WP6A 3GNXA 4AWTA 5BYWA 4PUDA 1ADDA 3EDFA 2WV8A 3DGRA 2ACSA 4PH6A 6TAAA 3LQGA 1EO7A 3KCOA 5E6ZA 2C6QA 5DEZA 2BVYA 4EK7A 1E6RA 2PDUA 4N7QA 4F2BA 2Y5EA 5CLWA 5F2LA 4YTSA 4WKAA 1V0KA 1V4YA 3PWGA 2VFGA 4HCLA 3B9DA 1CGYA 1JCMP 3TEVA 1S2AA 1L2UA 7REQA 1VBGA 1P48A 2J7FA 3IV3A 4HMEA 2XZ7A 3A24A 3P84A 4L4PA 3M64A 4J3XA 3ZFHA 4AAJA 4HOZA 4E5TA 5GJPA 1I9CB 5AHLA 2PDFA 5F2MA 3K5XA 1OCNA 5FJPA 2J6VA 1A80A 2ZXAA 3HV9A 4LFYA 1SYTA 5E1QA 3KBJA 1L0PA 4AHOA 1YXCA 2OELA 1FFQA 3KL3A 3APTA 1Q85A 3FA5A 3UVAA 1O1ZA 2XSAA 1XBVA 3LPFA 2NV1A 2Z4GA 5HQEA 3BSHA 4W7VA 1YKWA 2FZ8A 2QEZA 5F2IA 1CDGA 1J9YA 3TC3A 5BWFA 4U3AA 1P0EA 4CCDA 3VCNA 1ZX9A 1FHVA 4EQXA 4WUIA 3BUVA 1VFMA 3IRSA 4CLMA 2GVLA 4B5UA 2ZZ5A 3VIHA 4B5XA 5G4EA 1ZJAA 4WGXA 1BG4A 1O94A 1XLJA 5KZ6A 3LI0A 5BRBA 3AZTA 1ISVA 1UP2A 1WDRA 3E12A 1HW6A 1U33A 3LPGA 3R4IA 3N34A 4G8TA 1FECA 3W7NA 2YYTA 2YA0A 2DIKA 1LUCB 1DWIM 3O6YX 1XQKA 4LUTB 1X39A 2QGHA 1TVLA 4IWWA 1AH3A 2IQDA 3A21A 3OLEA 4Q33A 1EP2A 3T09A 2PSNA 2REQB 4LBSA 4DWSD 1OWQA 3WMCA 2BXZA 4MGGA 3NSXA 3GUWA 3MP4A 4DZHA 1EQPA 1ZSXA 3U0HA 4PCTA 3BSMA 1MDLA 1TX0A 1A0CA 1SZNA 4D72A 5F1VA 2RDTA 1EBDA 3OVPA 2R24A 4O14A 3L0KA 2OLSA 2DZVA 3ITXA 3K30A 3B8VA 1E4IA 1Q66A 3O0FA 4MVAA 4OKDA 1IE7C 2XGZA 3ARZA 3W7QA 1S2WA 3NDZA 4H4WA 4GYKA 3EZ4A 3KWXA 4TO8A 3LADA 4P8WA 4QJ1A 4C6LA 2PE4A 5JCKA 4S3EA 1W91A 3PTDA 3VI2A 5A95A 1VLIA 1REQB 2DUXA 1SMAA 2X05A 5CH9A 1IIHA 3LTSA 5ABGA 2ZRVA 4A6GA 4PB4A 3BCDA 2Z6JA 4NQ1A 1T8QA 1H5VA 4LBRA 2OWXA 3SN4A 4PMZA 1J0JA 3GQYA 3CC1A 2CPUA 3D3FA 4A3UA 1VENA 1VS1A 3FSUA 3WFLA 2Z7KA 2NX9A 2WANA 4D2JA 2DZUA 3RCYA 5GQBA 3ITYA 2F9RA 3NOYA 5AFDA 3EMCA 1XD1A 3ZSTA 3H2AA 4TV5A 4B90A 3MWAA 5SWUA 4XZLX 2FGBA 3LD5A 4US6A 3NRZB 1VD6A 2Z1VA 4FX7A 3N11A 2NT0A 2WMIB 3W70A 1JAEA 1FKXA 4E0CA 3FS2A 3NURA 5KTLA 3GDKA 5HDRA 1UC4A 5EA9A 6REQB 2X1SA 5IXEA 2XVPA 4POCA 2Y85A 2CESA 5FJTA 3IV8A 4NNCA 1M6IA 4L6OA 2IPWA 1V6YA 1BG9A 4HK5A 5B7ZA 2VWTA 3BZGA 1EHNA 4XAYA 3VD7A 3CGEA 1EGVA 4L9XA 5F4WA 1QHOA 5C9XA 1M03A 3R25A 1JZ2A 1ZGDA 3ITCA 2NW0A 1AW1A 3F03K 2CWNA 3LM7A 1PCKA 4GQRA 1RM6B 4Q4SA 5BMXA 5I77A 1TV7A 2WMKA 1OSEA 3QGKC 1PHQA 3SCOA 3MHFA 3WCZA 1P6CA 2PUZA 4LEFA 3KL0A 4PGLA 4IUGA 1X6LA 5BXSA 1NDAA 4MJ4A 4QCFA 1CLVA 1ADSA 3DHFA 1OADA 2AMGA 5A6SA 2SFPA 3N6JA 4H8HA 4DZIA 2ZUWA 3W7IA 2WPEA 1ZPTA 1FWFC 1TYPA 1V79A 4LPCA 5CC7A 1XLIA 3VGDA 3WH5A 4ATWA 2G3MA 3QPYA 2F84A 1GOKA 4H7VA 1LVLA 3W22A 2TPRA 3OPSA 2Y88A 5CC5A 4PMYA 1N61C 1KBIA 3H2FA 4ZFCA 5XINA 1QW9A 2BWGA 6ENLA 5AECA 1NF0A 1KGXA 3IGXA 3OYXA 5XIMA 4UQ9A 3R5EA 1OYAA 3MCMA 3MYOA 4JTIA 1AQHA 2QLYA 2BZNA 2VT0A 1KQYA 1BGGA 4ZOAA 3GC4A 2GK1A 1WDSA 3MKVA 2VGGA 2ZE3A 2HV5A 1POJA 3AYSA 4JTDA 1WAUA 3G2GA 3VUSA 3D6NA 3UF9A 2XUCA 3GD6A 4HNTA 4XIAA 4G1NA 5T91A 3BAJA 4HMCA 1K70A 3S2LA 3BOFA 4X63A 3V4BA 4S3CA 2AGKA 1ZJIA 4A05A 3GXIA 4J35A 3RPMA 4KBXA 3RR4A 2XIMA 2WBKA 3VGEA 1Q13A 3MMWA 1FFVC 1UBSA 2GYIA 1FXQA 3GYEA 3G18A 3LRKA 4UTJA 5L9FA 1J5SA 1MUWA 3FIGA 5HWMA 2YXGA 3MCNA 3TC7A 4DJDC 2TODA 1TE6A 4R27A 4Q8UA 5AVNA 3SY5A 3KP0A 2EQ7A 5JCMA 1MMFA 3C6CA 1HJSA 2ZXBA 4MJMA 3AZSA 4UFJA 1JG9A 4OT7A 4QG9A 3GH4A 3ISIX 1C90A 1RA0A 1RD5A 3A4AA 1XH0A 4I7VA 3U57A 1W5PA 4NY2A 5CJMA 2E6FA 2WCSA 1YX1A 1UG6A 2WSKA 2VP8A 1DL3A 3GTNA 2Y0FA 5ABHA 3DN5A 4GQGA 3WENA 3WDJA 1HT6A 1MUMA 3JR2A 1VFLA 4D6FA 2Z27A 2W91A 2TRSA 2AKMA 4X0VA 2V2CA 3KOZA 5ABFB 4IM4A 5GJNA 3SN0A 4TVDA 4CCCA 3GX9A 2Q8LA 1JZ5A 4JQ4A 1R3TA 1SR9A 1H62A 3S47A 5J5RA 1XRTA 1TQXA 5GNXA 5I5RA 5GNYA 1SQ7A 3EAUA 3CL8A 3THAA 2VEKA 2Z2BA 3N3MA 4AZ5A 4GC3A 1DXEA 3QHNA 3LZ5A 2PU1A 1Z9AA 2CLLA 3H70A 3T42A 3A3WA 1BRLA 2Y8UA 4MJZA 3DDMA 2NQ9A 1EC8A 1FWIC 4O10A 2UY3A 1LYXA 3LN3A 4Q4QA 1G0CA 2A6LA 1A3WA 5LHEA 2WPBA 2VC7A 3LV5A 5AZ0A 3BW3A 1B1YA 1DTUA 4R9OA 1HGWA 2YA1A 3T2OA 4EX4A 5HPCA 5H8UA 1JDCA 5D30A 1QDSA 4L1GA 3P60A 2IMRA 4JQ3A 4UOZA 3QSRA 2PF0A 2BVDA 3S46A 4O0KA 3WQVA 4IJCA 2Q01A 1Y7VA 2CWXA 1UD2A 3SR6B 4MPQA 1QI5A 1S5VA 2X1TA 1UP0A 1NQ6A 1P1MA 1HJXA 3MBDA 5IBXC 4QAIA 4Q8QA 5JCIA 4FNRA 2DSKA 2R1PA 5FJUA 2J4GA 3URBA 3B9OA 1DWGM 1LT8A 1WYGA 5M03A 4K39A 2CC0A 1A3HA 1TE1A 3GU9A 4IIBA 1X96A 2VQTA 1KBBA 3O16A 1WDQA 1R47A 1NARA 4JFTA 3E0WA 1FH7A 3A7AA 2WSQA 1TUXA 3G0XA 1DJQA 2E3ZA 4FR1A 4HMDA 3EUB3 3KCLA 3PJXA 1UR1A 4Y90A 4A3RA 1G01A 1PXGA 2O4QA 3L5LA 4US5A 1OX6A 3GDTA 2GGIA 4ALDA 3LCFA 3VUPA 3LMZA 2DJLA 1JYNA 4C6QA 3NO3A 4RPQA 1WB0A 3W00A 1Q3NA 2QJIA 3P61A 1GRGA 4XAFA 1Q7QA 2WVVA 3RNMA 3WJYA 4XZHA 1TR9A 3M0HA 4OV4A 1H1NA 1KQZA 1E6SM 4LT9A 3NDOA 5C70A 1W2VA 3KP1A 4GI6A 3UY7A 2G41A 2EG7A 1ONFA 3IJ7A 4JTCA 1GCYA 3CBWA 1US2A 3DU0A 2X42A 3C2EA 3VGGA 1I6NA 2REQA 5FS9A 4NJJA 4F0SA 4H6QA 1HO1A 4XBJA 4C91A 5JXQA 4GD0A 2WJEA 2DUAA 3SEPA 3PZTA 3ZT7A 2X41A 3NGJA 4DJEA 1HVQA 3BGAA 2PLJA 2QCFA 3HQNA 2ZZ3A 4ACZA 3VKCA 4NJHA 3TQPA 1J0HA 4HK7A 1K6AA 5HUOA 3TMQA 5EY5A 1D2KA 1XLGA 1DVJA 3R0DA 3URAA 4Z1CA 5BOOA 3UJFA 4DEFA 4J3SA 1GORA 1P6BA 4LF2A 5C9RA 1I45A 4X0NA 2W9MA 4L61A 1C7TA 3LCIA 3MV01 4QR6A 3LGGA 4HMNA 1TCMA 2AQVA 3E0VA 1QK0A 4I3GA 3TJIA 4Z2KA 4DF0A 1TPUA 3QEZA 1TMQA 1OFOA 4DPQA 1KLYA 4HYVA 2PDCA 3UGRA 1KW1A 1EKOA 3WNMA 1GZ1A 2VFIA 3PS7A 1DBTA 3NQVA 5D04C 5DCBA 2FPYA 2XU2A 5AB3A 2GDUA 1M04A 1QTWA 3WLMA 2PD9A 3ZMRA 1UWSA 4Z2IA 1PTAA 2H8XA 4REQA 1T5AA 3L9CA 5CEWA 3N9SA 1C93A 1B9ZA 5E0KA 3M0IA 4D71A 1PB0A 1E4MM 3FJ4A 4WZHA 1DIOA 1LLWA 3A9IA 4XAPA 5U4NA 2VM8A 2VENA 1EF3A 2BSLA 3GNOA 2OYLA 3AJ7A 1B9BA 4WDTA 3S1XA 1IEQA 2AL2A 3V36A 5M17A 1CGWA 4KGJA 3WBAA 3U2CA 4QS5A 1Q8JA 3DZ1A 4AD4A 1XYAA 3CHCA 3V0UA 1QVBA 4UNIA 4XISA 2GVEA 1AFSA 1FWRA 1KO0A 3DC8A 3W2MA 1R7AA 1K3UA 2X7VA 3F4CA 4RE2A 4PTMA 1ZALA 2QW5A 1W8GA 3L4UA 3UG3A 3RILA 2O7QA 3OTRA 5FEPA 1I60A 3TOYA 1AMKA 3SRKA 1V03A 4J2PA 5D32A 1H7WA 3EX4A 5I3HA 4IQJA 1CENA 2DH3A 4MKNA 4P61A 4CCZA 3ELFA 3S1GA 1JDAA 1QT1A 1TPDA 2G3FA 5HJYA 3AROA 4C6NA 2I14A 3MI6A 2A8XA 2ZQ0A 4PMOA 1VFOA 3WQ6A 1F2JA 1OB0A 3WNOA 2CBJA 2R1NA 4WEVX 3VDCA 4PUWA 1KM4A 3O15A 4JTJA 4NZ3A 5AC5A 3W76A 4F79A 4HNVA 3WLRA 5HWJA 3DFOA 4UR9A 1WYIA 2BY2A 3TN5A 1QXLA 4UR8A 2YLAA 3FHQA 4DXVA 4RLIA 5J04A 3CUXA 1EF2A 3MSRA 4LEQA 2UZ9A 1NDWA 1KCLA 2I17A 1DIDA 1D7FA 2TSYA 4JHZA 3NZ1A 2ZKMX 3MC5A 4DXXA 4C6DA 4JKMA 4DI9A 4QJ4B 3M0KA 3DFTA 1OIMA 3KTSA 3WBEA 3OHIA 2DT2A 1TKKA 4E2DA 4MPKA 5EGRA 4UNKA 3URQA 4JTTA 3P81A 3VTRA 2WMHA 2C13A 2VNCA 1GKPA 2XJ7A 4IICA 4Z1YA 3RYSA 1T3QC 3HOJA 4F2UA 1LBLA 1KFBA 5D2VA 3APYA 1MNZA 1P43A 5H6HA 4PBGA 1NDYA 3AXHA 1H49A 1L6WA 1NVMA 1YPIA 3H8AA 1LL4A 4XKYA 2YVFA 2PEVA 1P1XA 5FF0A 1T7LA 1OHLA 4PRTA 5D37A 3URHA 3WH8A 4I7WA 4KPRA 1DEDA 1DP0A 3LGEA 3U48A 3UJSA 3S0CA 2AAAA 5ABEA 5IFPA 2OQLA 4I8YA 4HYWA 4W89A 4HNUA 4FSAA 4D6CA 4AZBA 1E43A 2Z6IA 3KVJA 3T0TA 4X2RA 1ALDA 9XIMA 2XGIA 4LCRA 2D0GA 3CNYA 2W66A 4IPIA 1S2TA 1JQVA 1YLVA 3BQ6A 1Y65A 3A13A 3VIOA 4AX7A 4IMAA 2PDIA 3A7UA 1N5WC 2EEXA 3L2MA 4QXIA 4HNLA 5LIWX 3VYLA 1X6UA 3U5UA 4H4VA 5D33A 4O57A 3CGTA 4ZBCA 2F5ZA 2E7FA 3R0UA 1WNOA 5FS8A 4L1XA 4B4HA 1F73A 3EPOA 3ZVHB 3LUTA 1TYGA 2FDMA 2JE8A 2ZRXA 2V5BA 4O50A 3USBA 3NDYA 4TQTA 3C3UA 4B9ZA 4HSHA 3R6IA 2O7SA 1ZAIA 3I3EA 2YFOA 4ZZ9A 4RDZA 4AWUA 1E70M 1M6JA 4GKLA 4Y9PA 1R30A 1ECQA 3TVAA 3U5YA 1RCQA 1B3XA 1N82A 4H41A 4H4UA 1HN1A 1JUKA 1FP9A 4XX6A 4C60A 3WY1A 5HXMA 2XISA 3MUCA 2PPGA 3BCJA 3O8AA 3T0AA 4KS0A 4RDYA 1XLCA 1AH0A 3FXYA 1PVNA 3C56A 2ISVA 3R79A 1ME8A 5TQLA 1EWEA 2CXEA 4AZIA 3PP7A 1E71M 2XZ9A 1XGDA 3S2MA 3C86A 3N2CA 3U8GA 3VD9A 1CGVA 3ITLA 1Q6OA 4OBTA 4QROA 2V3BA 3WYZA 3BDKA 4EE9A 2WQPA 4L6DA 1KC7A 4DBSA 3URNA 1VJZA 2XVGA 5BOEA 4K68A 1J0ZA 3CQJA 2J9ZA 4WK9A 1NOUA 3B0VC 2Z1WA 3CH9A 4D6IA 4IPPA 1M7XA 1KV5A 3MP3A 1C7SA 3HGOA 1HL2A 1C29A 1Y8BA 3BPWA 3VNDA 4W4QA 1H7XA 3W7MA 4XZIA 1ECEA 5A6LA 3AS3A 4IQLA 4TTGA 4CQBA 2J9XA 4OFCA 3SCUA 2E09A 1K03A 2PWGA 3E96A 5RUBA 1XIEA 3A6OA 3BARA 1Z44A 3C2OA 3PF3A 1XX1A 3UCQA 1E6XM 4S3GA 3T7VA 1EC9A 4GUHA 1ICSA 3HFYA 3PBWA 4O17A 1A4MA 3NA8A 3W1TA 2P8CA 1YBQA 3D5HA 5AN7A 1E56A 3MUIA 1OFQA 4C7FA 3EB4A 3RUBL 2WHMA 5I24A 4C1NB 3CIWA 2DFAA 2OEMA 4GXPA 4JQ2A 3B8IA 4A29A 1HO4A 4XTIA 3CB8A 1K7XA 3UWEA 1HKWA 5A8GA 3TLQA 2J3NA 4M5PA 5IM51 4H00A 4PYSA 2E28A 3W4RA 5AZ1A 1QCWA 2RKXA 3NXFA 3GVQA 3OIHA 1GHRA 1L6SA 4JZ5A 3SCNA 4H4PA 3UJEA 1TPFA 3LDVA 1QPKA 2YX0A 1O12A 1TUFA 1DJGA 1E1CB 5C7HA 3GC5A 3KOXA 2IPGA 1UR8A 5ABTA 5JBDA 3GTHA 1V3MA 3SDOA 2PTXA 3PPHA 3UR2A 2XN1A 2PF8A 4MSSA 2QDDA 1W1PA 3MDUA 4UZSA 4O53A 3W7EA 3NWRA 4HPJA 4JYEA 4Z1AA 2J7CA 5BRPA 2F7FA 3GRSA 2DVTA 3BCFA 5HNNA 1EGZA 5MHBA 1LCOA 2C0AA 2YQUA 4A3YA 1EBHA 3ANYA 3W6LA 4M52A 1I0DA 4J2MA 4ZVJA 4IP7A 3TTEA 3RO6A 1K02A 3NO1A 1LROA 5AVHA 5FSDC 3BW2A 4TMBA 4OVXA 3TYBA 2W61A 1CB7B 3MYPA 2FKPA 3MKKA 4FNTA 2Y62A 4Z2GA 3H12A 3HPSA 1UH3A 3GXNA 1V3KA 3O63A 4QE1A 4QX4A 1PWMA 4MWAE 3BQ5A 2AAQA 4DJEC 2C16A 4M7TA 3WQ8A 2PFHA 4AD5A 2RH9A 4O12A 3N12A 4N9BA 1L2QA 1C92A 4ONVA 5EFFA 3OLDA 1SFLA 4I6KA 1B54A 3VAVA 4NASA 2EF9A 1OG0A 1ZBKA 1VEOA 4B5VA 4J3VA 4GO9A 1QPOA 2D24A 1JDDA 4DI8A 4R88A 1SJCA 3KEHA 3RNDA 1EFZA 3F4WA 1CW2A 4GHRA 1DQWA 1RLDA 3CASA 1KLZA 1UKOA 4GRTA 3MI2A 2X2YA 4P8UA 1RBLA 3P74A 1CT5A 4K38A 4KESA 4JX5A 5CZSA 2D0FA 4BI5A 3KAOA 2X40A 1YXYA 5CPQA 3XINA 4P7OA 3L0NA 2J47A 3QY7A 1O5QA 3G3MA 3MUZ1 4LU0A 4HNNA 1A0EA 4EOUA 4IFRA 1U2YA 3EOLA 4JX6A 2I56A 4IIFA 2YL5A 1AL8A 3VNYA 2ZZCA 1PYFA 1E6QM 4RNHA 2FMNA 4MAZA 5LYRA 1FCBA 4IQDA 4RKAA 1G7VA 4E8GA 3BMVA 3IIVA 5AHIA 3NQCA 3DG7A 3NQDA 3LPPA 3KOWA 5AOUA 1VEMA 1BVWA 2ZCGA 1UYQA 3B0YA 3AUJA 4GE8A 4XD3A 1MSSA 1GHSA 3KBVA 2YVGA 1Y5WA 3TYUA 3Q67A 5HANA 1UASA 3CUIA 4JFVA 4I6VA 3TYZA 2HBXA 4W5ZA 5LNUA 1KB3A 4NAEB 3DYOA 4GFSA 1NIUA 3EKLA 4N9CA 4CNPA 3CQIA 3WD3A 3QMRA 3IEBA 3GUGA 3PPGA 4K36A 5CXPA 2JIWA 1D8CA 1F76A 4N6FA 4NT0A 4PBFA 4U5IA 3BLFA 4H3DA 4MLJA 1ZRQA 2V5KA 1V3LA 3GG7A 4JGDA 4ZENA 3Q45A 5CKSA 3ARTA 3KL5A 4BFAA 1XYZA 2BOFX 3SRHA 3O6CA 5C6MA 3C0JA 1M65A 2ADAA 1ZJBA 3LXAA 1N8IA 1TRIA 1ZS2A 1DJIA 1Z3NA 2OEKA 1TVPA 3GXDA 3HPXA 4JR5A 3D9XA 1KR1A 2RGMA 4JFUA 4N0RA 1QI0A 1QAPA 3P62A 1Q6CA 4GQQA 1UC5A 4R7OA 1FRBA 4AY7A 4O15A 4DUOA 1LWIA 4B9YA 3VDAA 3CV6A 1GNXA 2JBMA 1EHAA 1GESA 1BGAA 4F0LA 2BHUA 4GY7A 1IXQA 1V02E 3DKLA 2ZXDA 3W81A 2D69A 4O11A 2QV4A 5U25A 2V3EA 3T55A 1MDRA 3SR7A 4EM4A 5LA0A 1T99A 2ZTKA 4EXAA 2WOVA 3GDBA 3ORWA 4HGXA 4HK6A 2OGJA 3OOQA 4D6GA 5M2FX 5FACA 1EX5A 5D03A 3LOTA 3T1GA 1FFUC 1GOQA 4JOMA 4GVIA 1RAKA 4AZ7A 4EACA 3WLOA 2GH5A 3R43A 2HJPA 5CZTA 3W26A 2W0UA 2ZRZA 4HHMA 3QOKA 2W79A 2R91A 2VGIA 1EGMA 1M7OA 2ACRA 1ZU8A 4Z0SA 1PKNA 3VZYA 3H23A 5CZJA 1FDYA 1AJ2A 3FVMA 4FS9A 2QJGA 4C6PA 5G4HC 5REQB 4XG1A 4DJFA 2QIIA 2RJGA 1R38A 4ZXLA 3W1QA 1K4HA 4H8NA 1HJWA 5B80A 4ACYA 2WZMA 2ZX6A 5FI8A 4M24A 3S9ZA 4QS6A 1CECA 1QPNA 4YL2A 4BQ3A 2BBFA 4WXZA 5FJJA 2Z1KA 1FH8A 4DNAA 3IIZA 5LXEA 1F8MA 5FKYA 4IQEA 3OZYA 1KXTA 4KETA 4QJ5B 2W0HA 5BROA 1X97A 4W7WA 1VIZA 4XZBA 1C9WA 3NNTA 3GNNA 3EXSA 3LRMA 3UERA 2VCBA 3NPWA 2C3DA 4Q4RA 3ABXA 4J1OA 4JBRA 3W2JA 1L9WA 3GYCA 6A3HA 4GUFA 3W2NA 2J77A 2HPIA 3KRBA 2BS9A 4FX9A 3NG3A 2OOGA 2IS7A 1TWDA 4DNHA 2DW6A 1BTCA 1MW3A 2VRKA 3HRDC 1HFBA 1WOAA 3KZPA 2ZUSA 3KTXA 4A8RA 2OB3A 3H6OA 4KCTA 3UP8A 4GISA 3UXLA 1TVNA 8CGTA 4AYGA 3P82A 4DQWA 2ZX5A 1OCJA 1F4HA 3O6DA 1GRHA 3UU0A 2EQ6A 2G5WA 1U5VA 3DENA 4TIMA 1OJXA 1S38A 1HP4A 3L0GA 3WDPP 5T9BG 2QAPA 4K6AA 4IPLA 5FL1A 3RLGA 2QV5A 3P2VA 3LS9A 4XVDA 2KX9A 4PODA 3RLUA 3GRTA 4H4QA 2Z24A 3C3NA 3EAOA 1FWCC 1CZ1A 1RPKA 1EBGA 1KTNA 3CWOX 5HA7A 1ZZMA 4CEUC 1FH9A 2ALDA 3OQEA 4LY4A 3GR4A 3CUZA 1KKRA 2VVSA 4QQUA 3VIFA 3WEMA 3ZJKA 1LRNA 1EPVA 2A3EA 3FG2P 1V93A 3O7UA 3II4A 1SU5A 2OWWA 1D7YA 1HGYA 3P5YA 5CBJA 3CEPA 3NVDA 3ECQA 1G7UA 1RJRA 3DFNA 3T0DA 4WDXA 4HOXA 3DFHA 3DBPA 2DORA 2AAMA 1MVYA 1HL8A 4UTKA 2O56A 1JJKA 3L2IA 2Y24A 4DBEA 4PUKA 2WKLA 3W2LA 3EWYA 4MNLA 2VZVA 3SSZA 2UY4A 2VX5A 9RUBA 2GJPA 3H4XA 1VHNA 2CIPA 4GI9A 3QHOA 2WPCA 3JZUA 1DJWA 3CB3A 3GG0A 3QR3A 4W85A 4MWAA 1NFPA 1HG3A 5LGXA 1ZY8A 3PG8A 2HK1A 5I3FA 2GJNA 3LB0A 1CBGA 4IJBA 5G2HA 2ZWZA 1S5WA 4QDPA 2VGFA 5FS6A 5AYIA 2XYLA 4ZTYA 3GFXA 3V16A 3R8RA 1BKHA 5J5DA 1OD0A 3NM3A 2VCCA 3A4JA 4GVFA 3PFRA 2F2HA 5JH2A 1AMYA 2PODA 3NS1B 3AISA 1JUBA 3EWUA 5I09A 3WK1A 1QNOA 1VPQA 1IZCA 1XISA 3MUAA 1TJ0A 3W1PA 3G1AA 2KZHA 2P3EA 1ITCA 4L9YA 3EX1A 3AM9A 1ZL1A 2GQAA 3A5VA 4YWOA 1HTIA 3ID7A 1ZUAX 1MXSA 1JZ8A 3ONBA 4KGLA 3ZO9A 1K8ZA 3QW3A 3B8WA 3SRFA 1BWLA 1E6PA 1XSKA 2Q6ZA 1V3JA 2FYMA 4FLOA 4HHLA 5A6AA 3TTYA 2NSXA 1VAHA 2YCEA 2VR2A 1NEYA 2VR5A 1GVRA 4H6KA 1XHCA 2V69A 2NUYA 5MKGA 3DK8A 5KVHA 5C71A 3FYPA 2POZA 3V0SA 4Y9MA 3VC5A 3ZM8A 1MO0A 4B3ZA 1MFVA 1JUEA 4EM3A 3TQ0A 2QT3A 4GGBA 3I65A 1CXIA 4DUVA 4GIYA 4TVCA 4NYYA 1UR2A 4XIMA 1W3NA 4LVAA 4LCSA 2DSVA 3V5CA 5C2GA 5FAGA 2J24A 1X1OA 3OBEA 1VJSA 2C7FA 2XPKA 4KRZA 2BNJA 3QJAA 5TBOA 4KCVA 1Z69A 3BZJA 3JU2A 4JPGA 2PDQA 4YCOA 4XK2A 1VJIA 4DAIA 3TIMA 2HROA 2PWUA 2NX1A 2AOSA 1W9PA 4IIDA 1QASA 1JEZA 1BYCA 3PZOA 1JI1A 1IYXA 4L7ZA 2IPFA 1LQ0A 4NAFA 1QW7A 3G5EA 4FR6A 4UUIA 5DCDA 3LMYA 4HZMA 3KOYA 4AH7A 1KKOA 5I06A 1KD0A 4B91A 3FFSA 1M01A 4JIRA 4IH3A 4LRSA 3CL7A 1V02A 1J2BA 4CQCA 1B30A 3GHSA 4GBUA 3LLFA 1R87A 3WF0A 1U1JA 4M6PA 1P7TA 1YXDA 8XIAA 3WF3A 4HD5A 4J3ZA 3EGJA 1DV7A 1WA3A 1Q2SA 2OG9A 2CKSA 1GRFA 5DX7A 4N2YA 2H9AA 2YCKX 2RAGA 3MKCA 3ABRA 1EUNA 3DEQA 1F3PA 2XWEA 1YNQA 4LCQA 3CHDA 4AD3A 3U2EA 2E6AA 2FGLA 3W07A 4B92A 2R14A 4AVFA 4OU1A 2YCIX 1XIDA 2D2GA 2Z29A 4AIBA 1KFLA 2ZX9A 2GR0A 2DP3A 3Q58A 2WJDA 2XDFA 3H2NA 3WH7A 4C7GA 4HPXA 4TVUA 4A8IA 3LBMA 4LYQA 3U6WA 3DGZA 3T07A 2E25A 4K37A 5FESA 4ZR8A 3A47A 1WX0A 1UBPC 1W5QA 5C54A 4AYSA 3CYJA 4IIEA 3FYOA 1O66A 1XLKA 4MNMA 3FKKA 1FWJC 3UCDA 1E0VA 3A23A 2EPLX 3CPRA 3LV6A 3WMBA 1IR2A 2D23A 3W71A 4K2SA 1XC4A 4P8VA 2PGFA 1Q6DA 3K1DA 1POKA 2XH7A 1YDYA 2ISDA 4RXFA 3PUOA 3WDRA 1FX6A 4H6RA 3WD2A 2GGGA 3AIVA 1PE1A 3NCOA 3FEQA 4H50A 2NQLA 2ZZ2A 4LVFA 5DLCA 6PTDA 3B97A 4JY8A 4QAWA 3SURA 2GJXB 2D22A 1FY6A 4F2TA 5KETA 1S1RA 1UD8A 3H7UA 2J8GA 3PJWA 3B40A 1W9UA 3AIWA 5E6YA 4LAMA 3W2KA 2HVNA 3W7GA 4GNJA 3LY0A 1DQUA 3GDLA 2WO5A 4KRTA 3FVDA 3AN1A 1ML1A 1AJ0A 4E3TA 3H4WA 2ZUTA 5JIWA 2V81A 3V1HA 1GQLA 4IP4A 1B3YA 1JRBA 1GGOA 3OG3A 2E9MA 1TJ1A 1FHDA 2VX7A 3PNUA 3CUFA 5G2IA 3BH4A 1X8FA 1OF8A 3EOOA 1RP9A 4FX8A 3RGTA 4E4PA 3B8TA 3S5SA 3WELA 4WCJA 1PWLA 1GVEA 4HU4A 4BF5A 3BAYA 5FSEC 1T8XA 1RQHA 2BVTA 1CXKA 1SFJA 5DT7A 4DWSA 1DJZA 4OOUA 2PDLA 3WFZA 3Q37A 1E3XA 3KLKA 1XYBA 4OECA 3VKBA 4DAFA 4Q22A 2DW7A 2ZA1A 3GNRA 1K9TA 1A5BA 4YVPA 5LA1A 4FDCB 4WOQA 2EQ8A 3DH7A 4IIHA 3WZ0E 3LHZA 2YW3A 1SW0A 4A21A 3HO8A 1CLXA 4JD4A 2CLEA 3PTMA 4GBDA 3SW6A 2YCLA 4CU6A 4QQ3A 2WMGA 2VR4A 4Q8WA 1DYSA 3ZT5A 4DJFC 1ELSA 3IGSA 3OVRA 5CPLA 3I7RA 5BXPA 3M9YA 1JRPA 4XB3A 3PTQA 3FJ6A 1CTNA 2WLZA 1OZQA 4J56A 4IMCA 5EPDA 2Z2UA 3PFMA 1Q6GA 4GOAA 4ECLA 4DF2A 3K2GA 3RX3A 3TDFA 1BTMA 7CGTA 3WDHA 4X3ZA 4CVUA 2MNRA 1TREA 4AZ6A 3QKEA 3GDMA 2QNEA 2OO0A 3B06A 3NVZB 1GONA 3W86A 5JBFA 1H4PA 1E4NA 2DZAA 1HQTA 2OZ8A 1DWAM 1Z32X 2OPJA 2R9ZA 4YU1A 1TG7A 3IJLA 3RX4A 1GRTA 1U5JA 3M7SA 3QY6A 3C52A 5KZMA 1FHUA 1T40A 1KR0A 1J93A 3DXIA 4JNZA 3R58A 3T9PA 2IW0A 3TCSA 3RR1A 1UWRA 2HVOA 5K7JA 3ITGA 3DJJA 4O1AA 3IVTA 1OFRA 4ZE4A 3DHPA 3MUXA 1CXLA 4YPJA 3E2VA 1ONRA 1E9ZB 3QFEA 1K7FA 3PBMA 3FJNA 7REQB 2Y2WA 1OVDA 1LOQA 1KXQA 3TFCA 1KXHA 1G4PA 3VNZA 1US3A 4JDBA 3DHDA 5H91A 1GZJA 5AYXA 1RHCA 3WF1A 4S23A 4EMJA 3DI0A 3M6YA 3WJXA 3CU2A 4E4UA 2PRHA 3W7HA 1JXKA 4IISA 3P14A 2VELA 3AHTA 3VC6A 3SCRA 3AC0A 3UNTA 2W3ZA 4C1LA 3DCPA 3W7CA 1PS9A 4MIMA 2FPTA 2Z2AA 4RX0A 3SZ8A 2OLHA 5BNKA 2PRLA 1JPMA 4RPPA 1TPB1 4ZOHB 1HUVA 1RV8A 2UWFA 3LNPA 2ZDSA 3AMGA 1TIWA 4N02A 4DB7A 2GFTA 2VEFA 1JCLA 3GZ3A 4Q4OA 4BV6A 2OU4A 2NUXA 1GVYA 4M6UA 3SUSA 1DWJM 2XWDA 1BWKA 1M68A 2WAGA 4Q8NA 4FXFA 2CLMA 3W02A 3E9AA 3AIQA 3W83A 2DVXA 4KEZA 1AH4A 2E0PA 3ARQA 4XSMA 2RDWA 3T78A 2FJKA 4U2YA 5LXXA 4UQCA 3IC9A 4IMFA 3E74A 2QUVA 3GWQA 4GC4A 4MWAC 4D1JA 1UZ1A 3QFAA 3FDGA 4K7ZA 1IT8A 1E55A 1J8VA 5F4SA 3OBKA 5AHEA 4AF0A 4W93A 1PJ9A 4ZTXA 1WZMA 2NPXA 3OW1A 3AS1A 4GY0A 2ZVIA 5DO8A 3LERA 3CEUA 1A5SA 3Q6JA 1DOSA 4V2XA 4MJ2A 1B57A 5CPSA 5T8GA 2WPFA 4UCGA 3NYZA 1J5TA 1TTPA 2CLKA 1IIGA 1XINA 2OZTA 1FWSA 3P8IA 4DYJA 2GOKA 4H4ZA 3G24A 5DT5A 3H2OA 4R9XA 1E6ZA 5E9XA 3AOFA 5AC6A 2QQ6A 4LY8A 3UGVA 4AY8A 3NR0A 4XZWA 4E4FA 3QRHA 1F6PA 3CIVA 1HKVA 1V6UA 1EA0A 1R5YA 2DUZA 4HCDA 2V5CA 3PN8A 5M3WA 4P7LA 2PCQA 3TTQA 4JHOA 4JEQA 1YW1A 4Z2HA 3NUKA 1PSCA 3SQPA 2X2GA 1XDMA 2WMFA 4HA1A 3GVWA 4ICMA 2FGZA 3E1F1 3XIMA 1IWPA 1V7YA 3PM6A 4PCSA 3UZZA 1WKDA 5JCLA 4AIOA 3V1PA 3WJWA 2V67A 5LGZA 4NHVA 2C1GA 2QAFA 2XM2A 3NL6A 1YQ2A 3BLDA 4PCPA 2YZRA 3RMEA 5IHRA 1QNSA 2XVLA 2BVWA 5A2CA 5FEWA 1IHIA 5LIYX 3S5ZA 5C9WA 3E2SA 2V3DA 3WDIA 2WVTA 5FIPA 2FZNA 1CLKA 1F3TA 3BGGA 2OLAA 4WD0A 5CCZA 4S3AA 3TFXA 5D9PA 2PI6A 5G2WA 4ADSA 2YJQA 2EPHA 2IXUA 1GQIA 4LNCA 5DMYA 3A4WA 4PB5A 4XD6A 1W0MA 2OJPA 4AEOA 5IHSA 2E1DA 3WLHA 2HTMA 3MCOA 1E6NA 4I9MA 4WF7A 1VBRA 1SM9A 4UIOA 4HVXA 1NHQA 2BTMA 3GR8A 3WQEA 4DF1A 1NHRA 2A7PA 5HR6A 3HM7A 2ABBA 4BA0A 3E2QA 4PTXA 4Z2LA 4EANA 1YMYA 1PPIA 3RX2A 4GIAA 4MUPA 5HULA 4CN1A 4XUYA 1EO5A 3VD4A 4EIVA 3VCCA 2C14A 3S83A 3W0KA 1VZWA 3T2QA 1TZ7A 1XIIA 3CTTA 2PWDA 5JBEA 1KXVA 1JNDA 2V6OA 2A3BA 3EEZA 3P6LA 3CL6A 1AQMA 4MKVA 3GTIA 5IRPA 3GVVA 4DUXA 5LNSA 3HV8A 2DZWA 2OSXA 1XLMA 2QUUA 3F2DA 3ALFA 4O16A 3P0XA 2CITA 1BQGA 2AMXA 1M5WA 3E38A 2QYGA 4TVWA 1K9DA 4LALA 4IGNA 3FLUA 1XWYA 2CLPA 2C3CA 4OWGA 2GR1A 4MHBA 4O19A 4C6OA 4ZQMA 1G4EA 4KCWA 3LSCA 4MZYA 3AIEA 3CV1A 1ZBCA 1VH7A 4NUWA 4UTTA 3MZ2A 4GXMA 3IK2A 4K8DA 5D38A 3N6QA 4ZQNA 1W1B1 3EWWA 1NQKA 1EJTC 4J4KA 3BG5A 3UG8A 4HQVA 3F4VA 3LX9A 3TSBA 3QMSA 4AWSA 4GYFA 1A4LA 2XFFA 3N73A 1I2OA 2CZ5A 4IF2A 1UQYA 3HTWA 4PMQA 3M43A 2J7EA 4RNFA 5LKYA 2YXOA 1UZDA 4W5UA 1VYSX 3S3GA 1J11A 1K4QA 1G6CA 2GK1B 5KZDA 1IF2A 4XO7A 4MOZA 4O8RA 8RUCA 3CMGA 3HG3A 1E4LA 2TMDA 4TX6A 4J7RA 3C2YA 3PUEA 4QFUA 5C55A 3SADA 2NSOA 1JVNA 1GQNA 1ZBWA 2BOEX 1XW8A 2I1OA 2IUZA 2A85A 3I10A 5G5HB 4NSBA 3A4XA 3IVSA 3WH6A 2B7OA 2I5QA 3EDJA 4MYXA 3H4GA 2CLOA 3O2LA 4AEEA 2HQMA 5HWNA 1TELA 1OC6A 3PPCA 1DTNA 4M19A 1NWSA 5EYWA 4KEUA 1NOFA 3EEGA 2AGTA 2R94A 4UZUA 3E0FA 3M0XA 2ISWA 3SUWA 3IJIA 4R33A 5BU6A 4ZQPA 3PVFA 3WK2A 1PL9A 4EXQA 4S1FA 2HE8A 3PBYA 4GABA 1SSGA 4KIEA 4QLKA 4BWLA 2H8ZA 3RFAA 1CX9A 5DMLA 4O4VA 2P0OA 5CBBA 3UWWA 1GVOA 3M0YA 3P8JA 1EJUC 5CGTA 2VGBA 1X2GA 3KDOA 1ZP4A 4HHHA 2CLHA 1YE6A 4P7NA 3DUGA 4AWEA 3BLOA 1OCQA 2XIQA 1CCWB 4EQSA 4W87A 5I3DA 2QMJA 2A3HA 3W38A 3HGRA 3S6DA 1GEHA 3TJ4A 3EOSA 1FA2A 3G1XA 1OYCA 1TSIA 1S46A 3UR5A 4UXDA 2ZZ4A 1DE6A 1X2HA 3S2NA 3L4ZA 2V2HA 4KMQA 4EWND 4H9YA 3G77A 4DWSC 3RCNA 4FOKA 4JCMA 2PTDA 4JFWA 3EKZA 1KN0A 4D6JA 3GSMA 5EL1A 1NJJA 1HX0A 4ZOCA 4P5UA 3UXDA 2JF6A 3EMQA 2FVLA 3LPOA 1PX4A 2PDBA 4W84A 3ICJA 4Q7NA 2HDJA 1FXPA 2HNHA 2PC4A 5A1AA 1BRLB 1OX5A 4RV3A 4IL2A 1MW0A 3SQSA 1KM2A 3STGA 3GBEA 2A7NA 1UKPA 1IWAA 1AQFA 3G8RA 1MYRA 5C7VA 2BFGA 5E0CA 4ZO7A 2W54A 3TAOA 1KM5A 4RJEA 3ZJ8A 4IFKA 4LJ3A 1CWYA 1MXDA 3NEHA 3RM9A 3TN4A 1ZENA 1ZHAA 5DY3A 3CZLA 3TZNA 2CERA 1M41A 3H26A 1VC4A 5I78A 3GH5A 5G1YA 3ZOAA 4J40A 2ZZ1A 3DX5A 1SFSA 1OY0A 2JEQA 5A8OA 2JKAA 4GUJA 3E49A 5AYZA 5EMMA 4AHQA 1UIPA 3DHUA 4Y96A 3L21A 6XIMA 4U31A 3AHYA 1W17A 2QCMA 1ZLPA 1O1HA 4Z1BA 1RVGA 3V3WA 3SCTA 2E4TA 2C71A 4JN7A 4EKJA 4M8UA 3TA9A 3UJ2A 1HVXA 4PBEA 1XI3A 1KBLA 4LGXA 4RXGA 2F8QA 2HS8A 1M7PA 3MANA 5DMNA 2V9DA 4LYPA 2BGNE 2XH4A 3O6AA 3H21A 2CNCA 4U28A 4C7DA 2XN0A 1W2PA 4ZQOA 1GRBA 1VB9A 4DO5A 3N25A 1TCDA 1UR4A 1Y5VA 4Q8PA 1Z48A 1F4AA 4PZVA 3VE7A 3J7HA 2NVCA 3M44A 5HJXA 1SR0A 2NQZA 5J8LA 1ZK7A 4CEXC 3CS2A 1S1PA 4JTQA 5CPTA 2OSWA 3L65A 4UTIA 2W3RA 4OGZA 4GGHA 5AYBA 2WVVB 3SFKA 3TQKA 1DXLA 4QITA 3WQ4A 4WJ8A 2CLFA 2V30A 4LUYA 1E15A 4R7JA 1V3IA 1EOMA 3Q4DA 1TJPA 4BF7A 4A3QA 3PUDA 2YKKA 1Q6EA 2ZTJA 1PZ2A 1UR3M 3FOKA 1Z42A 3PG6A 4PEEA 3UG5A 4KWUA 4GVGA 3YPIA 4HNCA 3ES7A 1ZY9A 2BB0A 4X22A 4KQNA 3P7YA 4PTNA 4CD6A 4UQBA 2BXVA 5BZAA 5BCAA 1TPVA 1QNRA 1XIGA 2DZXA 4ACZB 1SO6A 4L4OA 3B9JB 3LK6A 2WHKA 3V75A 3I3BA 1K6WA 4FO4A 2O4MA 1OFDA 2V3FA 4UC5A 1OK6A 4UTFA 2H3BA 5K4XA 1I2QA 1UWAA 1QNVA 2CU0A 4HOWA 5A6KA 1F5ZA 3S5OA 3HPZA 3QMTA 5EKYA 4Q7IA 2AQOA 4NI8A 5HJLA 3ZXWA 2ZUMA 3UXIA 4H4SA 2O55A 1OBAA 1Q7ZA 1GEUA 1R85A 1MW1A 1EWDA 3HJZA 3O9NA 2PU0A 3K8KA 3G22A 1I75A 4AG0A 3CGDA 1SPQA 5E5CA 1UUOA 5GPRA 4H2HA 4IPJA 3CAQA 1XIMA 3N9KA 3WQFA 2PD5A 5K9DA 4R53A 2BMBA 2CFYA 4REQB 5K4ZA 3PZQA 1XPYA 3S6OA 1J4EA 1FWTA 3AMKA 5BXRA 5T26A 4S3BA 4D6DA 5A8PA 4XAGA 5I0DA 3T0BA 3QZAA 4RCXA 3HBLA 1LRTA 1JEHA 4DUWA 1QWGA 2RDXA 2ATMA 1W3JA 1XRVA 4BKNA 3ZJ6A 1XR2A 1O5RA 4E8CA 2QCHA 1IXNA 1TTIA 4E8DA 3RLVA 3N14A 3N4FA 3VDHA 2PP1A 4XWUA 2AL2B 5I02A 2HRWA 2J75A 1XQLA 2HQAA 1D9EA 1NHPA 3UPMA 3APGA 4HSOA 3G0SA 2WKGA 1XBYA 3ZIZA 3KM8A 4HZ6A 4NEVA 4IP5A 3QGVA 4R85A 3GR7A 1S2UA 3OBAA 3Q94A 4ZO6A 4YJ5A 2B0MA 2W5FA 4M7SA 2OKOA 1TWSA 4FIQA 1XBZA 4EMIA 4PSRA 1G4SA 4FMVA 4LVDA 3RAOA 2IPJA 1EP1A 1ZMDA 1JYVA 3PSWA 3VABA 3N4AA 4RNJA 4GIRA 4UBPC 4FAMA 4P7RA 4IGHA 1SW3A 3W7OA 2ALRA 4HPHA 5L6UA 4GMEA 3CJPA 3C4UA 2EBNA 3GFYA 3IARA 3ZSSA 1ITUA 2JEPA 4AHPA 4TTUA 2Y7GA 2JK6A 4JKKA 1A5MC 1KRAC 4DZ5A 2RGLA 2CZDA 4DN1A 4B16A 4UTLA 1OGSA 5CGMA 4JYDA 3G6LA 2HVMA 3NOEA 2Q8ZA 4ML4A 2V6AA 3GTFA 4LB4A 1E40A 2VI0A 4JX4A 1JD7A 4MYAA 1WXJA 1W5NA 3VXGA 4BURA 4JN6A 4LX4A 2DEPA 2WHLA 3EMZA 2C19A 4JTFA 1CYGA 2QUMA 4PUEA 4J5NA 1VP5A 3KE0A 3E02A 3BGJA 1V3HA 1HF6A 5DFAA 2E5BA 1NU5A 3EANA 3QV8A 3V5FA 4MNJA 1LF1A 3P80A 1P0DA 1UB3A 4BQ4A 4ZSTA 3AHZA 3STCA 4FLQA 4JTLA 2QAEA 3NZQA 4LQ1A 3F1QA 1K8CA 3VNIA 4V33A 4UTTC 3LCWA 4IMGA 3UZ5A 3GKFA 5CJNA 5HNRA 3M5VA 1FEAA 3ENLA 2ZC8A 3ALGA 4CD4A 4XKYB 1VYPX 2QCNA 1BAGA 1JGMA 7A3HA 3QQ0A 3KUMA 4AEFA 2ODOA 4L56A 1D7KA 3DG3A 1N60C 3S5NA 4L80A 5D9OA 5D9MA 2ZA2A 5HATA 3CYVA 3VVGA 4V15A 4HA3A 1BLIA 4CKQA 4KWSA 4NVTA 1JAKA 4M29A 4HCHA 2V63A 1C91A 2YXXA 1IGWA 1ICPA 2PDWA 2DQWA 4C6JA 5AY7A 3IK4A 5I6SA 1H7PA 4PMVA 3NEVA 1R2SA 2QGYA 3G8EA 3OQ8A 4AZCA 1QW8A 3HQ1A 3IWPA 3CPGA 3TH6A 3SBFA 3CZ8A 3QM3A 3FW6A 2XINA 5A3HA 4JTGA 2DU2A 3ARVA 4F66A 1DORA 1FWHC 1E1EA 2GUUA 4RE4A 4NIRA 1E0WA 4AD2A 3BVJA 2CFFA 2Y7FA 4DLMA 1UUQA 1YYAA 4FI4A 1A47A 3B0UX 1E9IA 3E2RA 5E9AA 3WUGA 4NJKA 1XH1A 4I8DA 3SFWA 5ENLA 2XIOA 2EPMX 4NZFA 4BWLC 3DI1A 1I2NA 1TMHA 4FXSA 1EZ2A 3N04A 4S3DA 3V35A 4EAMA 1FFRA 4WY0F 3M07A 1VBUA 3N4EA 1WUEA 1RZMA 4WX2A 4C6MA 1OYBA 3IACA 3S42A 3UYCA 4I5XA 1H50A 3A12A 4DY1A 1QRQA 2WWDA 3DFSA 3UXKA 3LHYA 1M3UA 3REQA 5CPMA 3CGCA 4OV9A 1KNWA 2VFFA 4JDYA 2PLKA 3S4TA 1L6FA 1QI3A 4HSNA 3FXGA 1WE5A 2ZUVA 1SJAA 3QN3A 2FZ9A 3W1UA 1DIEA 1MZRA 2A6NA 1PX3A 3NQ7A 3TOPA 1V8EA 2E3TA 3UZJA 3NO5A 1LBMA 5I3JA 1FIQB 1XDIA 2FZBA 1X7FA 4AVOA 3QV9A 4DO6A 1W3KA 3GIQA 3E3HA 1PZ1A 4OIFA 3BO9A 4BEUA 4Q3MA 1IEXA 4B5NA 1C3FA 5I23A 4YVVA 3WH9A 2E6YA 2FHFA 3OGSA 3SUUA 3TW6A 1XUUA 2FHCA 1ISYA 2D3NA 3ITVA 4KH2A 3LEPA 3VOGA 1AVAA 3PWIA 4L5ZA 4GFIA 3KZSA 4NILA 3MVTA 2BCPA 1I8JA 4UMAA 4RDVA 4KFPA 5I00A 2PURA 4WKHA 4K1GA 1UKSA 5G4WA 3XISA 1XLEA 2XIJA 3KLJA 1N63C 1YADA 4BZYA 3W73A 3ATYA 3LCXA 4KWWA 1XRSA 3QV6A 3KVKA 3JS3A 1NHSA 1XS2A 4QISA 2WVUA 1KWKA 3GD3A 1W3HA 3UCCA 1YBQB 5EBUA 4QEEA 5DN1A 2PDNA 3FYYA 4NYUA 4FXRA 1XL9A 3T44A 3GU1A 3CXBA 3B0PA 2J8TA 1H11A 1HKKA 3HB9A 2QDEA 2WCGA 4XTDA 4NX0A 5LIKX 3EDDA 1WXZA 5F2GA 1EL3A 2Y63A 2HEJA 1B31A 3WQWA 3WMSA 1UIOA 2XGBA 2GL5A 2FB2A 2WZEA 4QBXA 3EYPA 5CJ5A 1YIXA 2GGJA 4Q4MA 4M80A 3EWDA 2BG5A 2D3LA 2UBPC 1EIXA 3UETA