3FVDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
361
Chain Sequence
SLRITRLTVFHLDLPLAKPFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a member of enolase superfamily from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
rcsb
source organism Roseovarius nubinhibens ism
total genus 117
structure length 361
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fvdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fvdA01
2DW7A 2AKMA 1WUEA 3DERA 3MWCA 3PWIA 3RITA 6ENLA 2FYMA 4HCDA 5FJOA 3P0WA 3NZGA 4IZGA 2AL1A 2HXUA 4M0XA 2PPGA 3EEZA 1SJAA 3KUMA 1JPDX 2PU1A 2XH2A 2XH7A 3U4FA 1EBHA 3SN4A 2XH4A 4IP4A 3DFHA 4JHMA 2MUCA 2HZGA 4J3ZA 4KT2A 4MMWA 2QJNA 3R0KA 3T9PA 1SJCA 2PSNA 4DYEA 1ONEA 4DXKA 5IDZA 1PDYA 4GGBA 4KPLA 1MUCA 2P3ZA 4GGHA 2ONEA 4X2PA 1TZZA 2OZTA 3GD6A 4J1OA 2AL2A 1MNSA 3NO1A 4A6GA 3H70A 3RO6A 3S5SA 3I6EA 3HPFA 4H2HA 2OQYA 3TWBA 3N6HA 3QKEA 3D47A 1ECQA 3DESA 3IJQA 3CAWA 3N4FA 4IP5A 4DHGA 3N6JA 3R11A 3H8AA 4ENLA 1EC9A 3OPSA 3V5CA 2PTWA 4Z1YA 3BJSA 1OEPA 4HCHA 3DG3A 3PFRA 3ZLFA 3DDMA 4GYPA 3R25A 2PP1A 3TWAA 4Z17A 3QN3A 3TQPA 1XPYA 4JN7A 3MQTA 2AL2B 1FHVA 3UJ2A 4F4RA 1KD0A 3DFYA 3CYJA 5BOFA 2OQHA 3BSMA 2OZ3A 3JZUA 1F9CA 2QQ6A 4H83A 1PDZA 2ZC8A 2XSXA 3SN1A 1R0MA 3RR1A 4HYRA 1DTNA 1TKKA 3TJ4A 3P93A 3EKGA 3MSYA 3ZLGA 2QVHA 3DGBA 3UXLA 4K8GA 2RDXA 4HN8A 3ES8A 3R1ZA 3VC5A 4IL2A 3THUA 4GISA 2CHRA 4GFIA 3V3WA 3UJRA 2XGZA 3R0UA 3V5FA 3TJIA 1NU5A 2GGJA 2GGEA 3RGTA 4A3RA 2GSHA 3UCCA 3CT2A 2XH0A 3ES7A 1P48A 3SN0A 3VA8A 4FP1A 3V4BA 3QLDA 1MRAA 4DWDA 2PMQA 4IHCA 5J04A 2GL5A 3VC6A 2NQLA 2PU0A 3CB3A 3N4EA 2GGIA 1TE6A 1ELSA 2I5QA 3JVAA 4E8GA 3DG6A 4G8TA 4JN8A 3D46A 3UJEA 4EWJA 3DG7A 3K1GA 4K1WA 3R10A 2OLAA 4E5TA 3GC2A 2HXTA 1SJDA 4HNCA 5EU9A 3TTEA 3ZLHA 4YWSA 2AKZA 1JDFA 5BOEA 2POZA 2O56A 3UGVA 3STPA 4IL0A 4GYPC 5FJTA 1JCTA 3UCDA 3OW1A 4IT1A 3SJNA 3OZYA 3SSZA 4HPNA 3DEQA 1KKRA 1EBGA 3OZMA 1KCZA 3FYYA 3GY1A 3VCNA 2PTXA 1L8PA 3Q45A 4H1ZA 3U9IA 2PODA 3IK4A 2ZADA 4G7FA 1MDLA 3TCSA 1WUFA 1EC7A 1JPMA 1NELA 2GGHA 2PCEA 1MDRA 2QDEA 1P43A 3RCYA 3IJIA 2FKPA 3TOYA 3PWGA 2QJMA 1W6TA 4HCLA 3CXOA 4GMEA 3GO2A 5FJPA 3FJ4A 3P3BA 2QDDA 1SJBA 3H12A 3MZNA 1BKHA 1R6WA 3DIPA 4H19A 1XS2A 2PGWA 2HNEA 3S47A 4ZCWA 2OPJA 4MGGA 2OZ8A 2P8BA 3RRAA 3B97A 4DN1A 4FI4A 3ZVHA 3ENLA 3NXLA 3UJSA 2OG9A 1IYXA 3FCPA 3QTPA 4E6MA 1YEYA 3ZVIA 1RVKA 4ZA0A 2PS2A 2MNRA 2QJJA 2OVLA 3OP2A 4E4UA 3PK7A 3TW9A 2OO6A 3Q4DA 3MKCA 2OX4A 3JW7A 2PP0A 5FJRA 3VCCA 2PA6A 3QPEA 3OTRA 3FVDA 2P0IA 4GIRA 4HNLA 3T8QA 2PTYA 4M6UA 3SQSA 3CK5A 5FJUA 1EC8A 3FV9A 3I4KA 3H7VA 2P88A 3T4WA 3ZVHB 3NFUA 2OKTA 3MY9A 3IJLA 3T6CA 3SBFA 4A35A 3FXGA 3MUCA 5ENLA 4KEMA 4KWSA 3UXKA 4E4FA 2PTZA 1BQGA 1FHUA 2OFJA 3I6TA 4DX3A 2PP3A 3UJFA 2DW6A 7ENLA 3BOXA 1KKOA 3VFCA 4ROPA 4MKSA 2PGEA 2GGGA 2QGYA 4K2SA 1E9IA 2P8CA 3VDGA 2GDQA
chains in the Genus database with same CATH superfamily
1E15A 4A2RA 1J5SA 3DERA 1EEPA 1FWCC 5C9WA 3GDMA 3MMDA 2WM0A 4MFEA 5KTLA 3JS3A 1K7XA 1JDAA 3BGAA 4NZ4A 1FKXA 1RAKA 1CPUA 4HA1A 4E4PA 1OY0A 4C6KA 3IJ9A 2AL1A 5H1WA 5IRPA 4AQLA 3OVQA 1JYXA 3M0KA 3PUGA 3CNYA 3GHSA 1GG1A 4JIRA 2QCFA 1EXPA 1JPDX 1YPXA 4BR1A 3BLFA 3LSCA 3P84A 1VGAA 5DLCA 4Z2HA 2FZMA 3KCJA 4FZIA 1YTDA 4NZCA 4DJDD 1KCXA 4YJ5A 3AS0A 4QJ4B 3C56A 5FCZA 5EYWA 4HNOA 1JPHA 3NYDA 1ONEA 4B2DA 1J18A 4RW5A 3IIZA 3LY0A 1T3QC 1H5VA 2X8GA 2Z1BA 3W53A 3TYZA 3LI0A 2ALRA 3DYMA 1XICA 3S2JA 3M0ZA 4YVVA 2GDUA 4PB5A 4B3KA 3D3FA 4JTUA 3GX9A 3KX6A 3GNOA 3KRUA 2WAGA 2DIKA 4DYJA 2YAUA 3LB0A 3WH6A 2Q3OA 1GUVA 2TYSA 4J2MA 3WJZA 1XG4A 4LCRA 4UTWA 2ZXAA 1TV4A 1XSKA 4Z1DA 1EQCA 1LWJA 3DXIA 4KERA 1VJZA 3MQTA 1XWYA 1FHVA 1XIHA 3NQCA 5DY3A 3VO0A 1MXGA 3EKZA 3N2MA 3D9XA 1NDAA 1F9CA 4FNSA 2O7SA 5FF2A 4H9MA 3URBA 4Y8FA 3E6EA 5D9NA 3FA5A 2V3AA 3K1DA 3T0CA 3GRSA 4FX9A 3DYOA 4M82A 8CGTA 2DU2A 1MQPA 5DCEA 4UFJA 1QI3A 3CIVA 5KINA 3K46A 3WF1A 4EXBA 4IL2A 4K6AA 4PCPA 3TSDA 5CLTA 5IM51 1OGBA 2PDBA 4RV3A 4LAOA 3IACA 1N5WC 1A5LC 1GESA 3VKAA 4C5ZA 1JZ8A 1A4LA 4Q22A 1GRBA 1ITQA 3KWXA 5DANA 5DN1A 2QMJA 3FN9A 3QLDA 2EQDA 4R33A 5J04A 1O60A 3GHUA 1PTAA 1XI3A 5FEZA 1WKEA 5HINA 3LPFA 1GVQA 3M47A 3DG6A 1BKSA 1F5ZA 4JN8A 1QCWA 1FWJC 3OG2A 3E0WA 2CW6A 3RX3A 2PDPA 2QUUA 5E09A 4E5TA 3EX2A 3DFOA 4RNJA 2A6LA 3A5FA 5I6SA 4NUWA 1MXDA 2ZZ3A 5FACA 1TIMA 1UC5A 3UCDA 3W82A 2OSXA 1U2YA 4CU7A 2NSOA 4UQ9A 3QR1A 3GVWA 3K8LA 1WOAA 1DJYA 1UWIA 4RPQA 3WNNA 5CPSA 1OG0A 2VOMA 2DZPA 4ZB2A 2C7FA 3M5YA 1IWBA 3KXQA 1L8PA 2V38A 2VC6A 1XV8A 3WQEA 4Y6GA 1E9YB 3L66A 1R7OA 3C2YA 1LJYA 4S3BA 1B3YA 3TLLA 2QZRA 1AODA 3VDHA 4CQ9A 2HK0A 3W28A 2GQAA 1GPWA 1G4TA 4MDPA 1FDJA 2ZRYA 1YRRA 4K38A 1GRHA 2QKFA 2YBVA 1PZ2A 3LTPA 3DX5A 1UZ4A 4J27A 3MP3A 3FJ4A 3TU9A 3O8AA 4JQAA 1P0KA 3AUJA 4AAJA 4H8NA 3H12A 3REQA 1HO4A 4M24A 4TMCA 1I1XA 1DJGA 1SZGA 3GDBA 1XS2A 1RD5A 3RMEA 1V3HA 3W25A 2DFAA 1ENUA 3H55A 1V97A 1UOZA 5DXYA 3WKZA 3CXBA 4R7WA 5HJXA 5G2HA 5DQPA 4AY1A 2ZUNA 2D22A 4DBUA 1QATA 5BYWA 1HP4A 3SUSA 1V79A 3P80A 1GK8A 4JYFA 5E0KA 1CWYA 1C91A 2YZRA 3QV8A 3REQB 4MY1A 4K7YA 1GWJA 4Z2LA 3SCOA 2BMBA 4TVYA 3ITVA 4FPSA 3QF0A 3R8RA 4DYKA 2WMKA 2ZX8A 1SFJA 4HN4A 1B9ZA 1ISWA 4AF0A 1T41A 3LS9A 1QOXA 3OTRA 4JN6A 4MWAD 1H60A 3AWNA 1EXBA 5TR3A 4MAZA 2GH5A 3CK5A 4KMQA 5FJUA 3CV2A 4J3TA 1XX1A 2P88A 5KZMA 4B5VA 3I3DA 4MNJA 1GETA 3WMCA 1XYCA 1S7MA 1Z69A 3MUCA 4PB3A 4BZYA 5A6JA 3DYPA 1C8YA 4KW2A 4H4QA 1XYFA 2W5FA 1BVWA 2PTZA 1UH2A 4GQRA 1PX4A 3UW6A 1VEPA 3K8MA 2VWTA 1WP6A 4AF0B 4I9AA 4LVFA 1FQ0A 4PSPA 3DJJA 5I78A 1TR1A 2VHLA 4PEKA 4Z0JA 1XD0A 3P7YA 1KR0A 3MI6A 3CM4A 2RHGA 3LB8A 4H4PA 3QC0A 3R0DA 1K9EA 4C1NA 3AALA 5G4WA 3AMDA 3EMQA 1BXCA 1W1B1 3MWCA 2FIQA 1CGTA 1X97A 3ORWA 5C9XA 2FZ8A 4HTBA 3LV6A 1BYBA 5I3IA 2R1MA 1V02A 1KRAC 2P76A 3HQ1A 3T2QA 1K4QA 4ZO7A 3AHYA 3OZOA 2QPXA 1DXEA 3VD7A 5BCAA 2W4XA 3MBDA 2V30A 3ZWSA 1AZ2A 1GGOA 2WWCA 4YL2A 4R7JA 5C9ZA 2IKIA 3Q2DA 3NCOA 4XVEA 5CBIA 4LSBA 5GRTA 2WZMA 1NHPA 1F3XA 4UB9A 1UD6A 3KL3A 1O1HA 3DK4A 3BICA 1H49A 5M1TA 3WNOA 3WBAA 4GGBA 1XLHA 3R58A 1B3XA 3F4DA 1CTNA 3W38A 2AL2A 1FHLA 1XIJA 3NQEA 4TX6A 4R88A 1W5OA 1ZJHA 3T55A 3LYEA 2QAFA 3PG8A 3M5VA 4A3QA 4DNHA 5GJPA 4IIBA 4N02A 3DESA 3EDKA 3I6RA 3N4FA 4UNLA 4US6A 4Y90A 4WVXA 1UKOA 3W71A 4K7ZA 4RW3A 4ENLA 5HDRA 3SCVA 3V5CA 2DJLA 3CHFA 4TR9A 1O12A 4US5A 3SADA 1EB3A 1IR1A 1W8GA 2QCNA 3H7RA 3FJNA 4RE0A 3TQPA 4ZOBA 2JEQA 4N4PA 2AL2B 1A3HA 3UJ2A 4F4RA 4CQBA 4RNIA 4GVHA 3H2AA 1MO9A 1NQKA 4HJWA 2PC8A 3BSMA 4HZ7A 5HA7A 1Q4WA 1UR8A 2WVVB 3SEPA 3GXIA 3WQ4A 4JTLA 3PPGA 2ZC8A 1R86A 1DTNA 3R43A 3MCNA 1KFJA 4JQ2A 3T0BA 2I5GA 3ZLGA 2FDMA 4K8GA 1AD4A 1HUVA 3W7KA 2Q6ZA 1EGVA 3L65A 1D8CA 1JCYA 4ZO6A 1J9YA 1V3LA 2XGZA 3LZ3A 4RJEA 1KW1A 5LNRA 3TR9A 2ZA2A 3KEHA 4I9JA 4TU1A 3GRTA 2R1LA 4EPKA 2WKLA 2C0HA 2ODOA 2KX9A 3BSGA 5TD4A 1UUOA 3H2FA 2PMQA 4J35A 4IHCA 1JZ5A 1PWMA 4GBUA 2WMGA 2E6FA 1M7OA 5KITA 3VINA 3BSHA 4XISA 2YJQA 1TTQA 3WLKX 2FZDA 2A5HA 1PS9A 3LHUA 3FSUA 5A8NA 2P0OA 2CPUA 2Q3RA 3H4GA 2VVNA 5EGRA 3MS8A 4O4VA 4S3DA 2Z1SA 4G2DA 3EX4A 3N6QA 2GPTA 3BJFA 3ITYA 5BWFA 4ZXOA 3DI1A 3VNIA 2AKZA 2QIIA 2DZVA 1LL4A 3H23A 4OBRA 1V59A 2VFIA 4IL0A 2GVLA 4AZHA 2C1GA 4WOZA 4CD8A 3M64A 1W2PA 4HHMA 3U7BA 3W7HA 1GERA 2I7GA 1XLKA 5LIWX 5HQEA 1HF6A 4JIIX 2PTXA 1ITXA 2OWXA 3BH4A 3IK4A 2ZADA 1XQKA 1YNQA 4Q7BA 1MDLA 4LVBA 5C7VA 1TPEA 3IJ8A 2XVLA 1JPKA 1PKYA 2NPXA 1E70M 5EMYA 4O0KA 4U5IA 2QDHA 4F0LA 3B8DA 1KXHA 3PBWA 4GIEA 3EOUA 1D2KA 4JQ4A 3T81A 1WQ5A 3NG3A 3GVQA 1FP9A 1ZJIA 4C7FA 3W1RA 1E0TA 1NOUA 4IIFA 2HISA 4W4QA 2GYIA 3PN8A 3LADA 3CZLA 4IGSA 2WLYA 4ZCWA 4UIOA 1EJRC 4NHVA 1M5WA 5FEPA 4UCGA 3W00A 2OZ8A 4FB7A 1S2UA 5D02A 3RNMA 3PM6A 3KTSA 4K39A 1EEXA 3FYOA 1OT2A 3OLEA 1C8XA 4L9YA 1XKYA 3RX2A 1JROA 1O94A 1M53A 2HROA 4A8NA 1OVDA 3MO7A 4PMOA 3RIKA 2XG9A 2OVLA 2G97A 3ZMRA 3ETRB 1XIFA 4ADSA 3JW7A 3A3HA 3N11A 5JQ9A 3SFKA 4ORMA 2Y0FA 2GRTA 2PP0A 4Y9MA 2HVNA 4QRNA 4YVXA 1XDLA 2WZEA 3ZYZA 4D6EA 1AK5A 3VOCA 3A4AA 3H7VA 1LBLA 3LX9A 4D8LA 2BB0A 2OKTA 3TP4A 1G94A 1Z48A 4HP5A 3UZYA 3NO5A 3WSUA 1AQ0A 1E6NA 4RLIA 3HOJA 4CQCA 3THCA 1P0BA 4HK6A 3FK4A 4B4HA 1HJSA 4KFOA 1XKJA 3RCNA 2DW6A 4C6DA 2G37A 4IPJA 1SSDA 4KEUA 1IZJA 3GDKA 2A8XA 5BRQA 1HNYA 2C13A 3GAKA 2ZUTA 3BUVA 4JPGA 5H8MA 2V5DA 1HQTA 4PBFA 1CGYA 3TZFA 3MKVA 5I0DA 5JUVA 4QQUA 2XIQA 3T2OA 3B0YA 4MB4A 1LCOA 2J7CA 2CCRA 1N5XA 2BC0A 3T4CA 1QBBA 5D30A 1IWAA 4GI9A 1UROA 1V8EA 1ME9A 5DBUA 4GVIA 4CVWA 3B9JB 3VDCA 1UZDA 4LEFA 4GKTA 1HL9A 3SN4A 4H9UA 3HMJG 2HPIA 3U48A 4DIAA 4JY8A 1ESWA 4ZQCA 3PP7A 1FKWA 1KB3A 3G22A 5A5WA 4XB3A 2NLIA 2HZGA 2CZDA 3BQ5A 1W1VA 4DWSD 3W2UA 1FEBA 3K4DA 2PEVA 2VFDA 4L80A 4QLLA 4OHQA 4DRSA 2R9RA 1FVPA 3DOPA 3I10A 5FI8A 2PLCA 1G5AA 3VYLA 4GZIA 2ZA1A 3K5XA 1NFBA 3WLSA 1DWFM 3UWWA 1BGGA 1CBGA 1EX5A 4H8VA 1BWKA 2BZNA 4H2HA 1JXJA 4HKPA 4WR3A 4O11A 2EEXA 1OX5A 2WC4A 3BCJA 1Y8BA 1V3MA 1VQZA 3E0VA 5ABGA 1EC9A 4YIWA 3BLEA 1W2VA 1AW1A 4DUOA 2XN2A 1UB3A 1ZY9A 4O17A 1ZP3A 1W1YA 1AMKA 2C1IA 1THFD 3R25A 3QN3A 4WSJA 1XPYA 1LYXA 4KGJA 1IQ8A 4TV5A 4F8XA 3NM1A 1DPMA 2WNWA 4XZHA 3OJGA 4WZHA 2NX1A 3KE0A 3AIBA 2WJZA 3EWYA 3O3RA 3LRKA 4ZB5A 1F7BA 2PAJA 2X99A 2NUYA 1NIUA 5FS9A 2VURA 3WLQA 1R0MA 4I8YA 1EX1A 1Q2SA 4JCLA 5LKYA 3HW2A 4A05A 2GQ9A 3P93A 5HR7A 4WGXA 4YCOA 2YCLB 5I79A 3FKKA 2ZUMA 3KZPA 1X96A 4DZAA 3MDUA 4ZQMA 2OR2A 1BSIA 2IKJA 1DXIA 3LENA 4FNQA 3SJ3A 4V33A 4W8AA 1QPQA 4EXAA 4MPKA 4I7VA 1F2JA 4HJFA 4YTUA 2J7FA 4IGMA 3WEMA 4UNIA 3TEVA 4UZSA 5AKQA 4IJBA 2ZDSA 3MP5A 4OJYA 1J6PA 4UQDA 4FP1A 3NVZB 1J0HA 4EPDC 4LALA 1TPVA 1O5KA 2R9ZA 1XH2A 1S1RA 2EPNA 1Q7QA 3WNLA 4A4AA 4DVOA 1KXQA 1Z32X 4GG9A 1I8JA 3P61A 5G1MA 2YCJA 3OIXA 1HKJA 4XD6A 1XLBA 1GKQA 3W4RA 4IMGA 4WDUA 4EWJA 1E0VA 1R3VA 3B9EA 1QJWA 5REQA 4JTGA 2HQAA 2VFFA 3EB4A 1E6RA 1S5NA 1L6WA 3CHVA 3GC2A 1AD1A 2WOQA 3STGA 1XCXA 1W3HA 4Q33A 5BZAA 3VGDA 4TIMA 1LLWA 1XLIA 5XIAA 4PGLA 1B3WA 2POZA 3UGVA 3UA3A 3STPA 3I7RA 3U5UA 4JKKA 1ITUA 4GQQA 3G2GA 4D9PA 3B40A 5C2GA 3UZXA 1UWUA 4KFNA 3OZMA 5LXEA 4J3SA 4W5ZA 3PAOA 2Y24A 4X3ZA 5REQB 4A8IA 2ZA3A 1Q1WA 2EQ7A 2BHYA 1Y5XA 4JTSA 2BG5A 4NQ1A 3QFEA 3EPNA 1P43A 3XINA 3CYVA 4NEVA 1EO5A 2BNJA 4AC1X 1RLCL 4QSHA 3VIFA 5GVJA 2RDWA 1ZUAX 2Z2AA 2VDIA 3DGRA 5BRBA 5HANA 2PUZA 1ITCA 1GZJA 2DZWA 3A23A 1BHGA 2JGYA 2QEZA 1JAKA 4IISA 4HNUA 1P6CA 3L4UA 2X05A 4BF9A 5CZTA 1EKOA 2WZIA 2PGWA 4HMEA 3MVIA 2AAQA 4PUNA 4KKXA 1J6OA 1MO0A 2GJRA 4QCEA 2ABBA 5FOOA 2O0TA 2IQ0A 5DRIA 3O6DA 3B97A 1QNPA 1JCXA 4OE7A 5AC6A 3AYSA 1RJRA 2ZWYA 2YPIA 1A5KC 3W2JA 2D2JA 1CLKA 2NVCA 1YDNA 3N18A 1M9HA 4J40A 1IYXA 1KM5A 2Z28A 5M17A 1BYDA 2XWDA 1W5QA 2NQHA 2W61A 4KWOA 4ZBCA 5E0CA 3BLIA 5U7SA 3GSMA 3EWDA 2PS2A 3CGDA 3EEGA 4ACYA 1SU5A 2VM8A 3NQFA 3WLNA 2BVDA 1RP9A 4LUTB 4UXDA 4P8WA 2IPJA 2P0IA 5CPOA 1ZJBA 3UXIA 4DNMA 2CLOA 4L1WA 2GZXA 1OBAA 3RR4A 2A7NA 1F8IA 7REQA 3FV9A 3ABZA 1ZTVA 2DIEA 2XINA 1IEVA 2X0SA 4N0RA 3F5LA 4GI8A 3T6CA 1DIKA 4PL1A 4GC3A 3CTTA 4ICCX 2YL8A 4QGCA 3B05A 1FOBA 2I14A 3ZOAA 4QDWA 1E73M 2TSYA 3LBMA 5XIMA 4GQBA 3AC0A 5HMSA 4TTUA 1X7IA 1IIHA 1PX8A 2PDKA 5JCMA 3BE7A 1QR7A 1NP0A 2QGYA 3LHTA 5HNTA 7REQB 1F3PA 1IF2A 1QHPA 1RBLA 3LMYA 5JCNA 1JULA 1KQZA 4IQEA 3WDQA 5D37A 3F03K 5CH9A 3MWAA 9RUBA 3RF9A 1JFHA 4JX5A 4H3DA 1XQLA 3H2CA 5I77A 5H8PA 1TJPA 3PWIA 1LROA 4YTQA 6ENLA 3DECA 1M68A 3AXXA 4I90A 4DF0A 2R91A 5ABEA 4PTWA 5G4HC 4X0NA 3W7MA 4O0ZA 1VQTA 1B30A 3CHDA 3EWBX 4N42A 1W32A 4AISA 4RXFA 4N4QA 2Z6JA 1IXQA 4NG3A 2A85A 1BWLA 5D38A 2ZX9A 3EAOA 3BURA 3UR7A 1H41A 1N55A 3LERA 4TUFA 3NVVB 1GVSA 2ZC1A 3LN3A 1R2TA 1UR3M 4AXNA 4LY8A 5FF4A 1TIWA 1JNEA 3MKKA 2AQOA 4KCTA 2W0UA 5FS6A 2NW0A 4P8UA 4IX0A 4MMWA 4R85A 1XIMA 2WM1A 3G8RA 3W7PA 3MTWA 4CCCA 2P3ZA 4QE4A 3QW3A 3ICJA 3GK0A 3NO1A 2CBIA 3VKBA 4ALDA 3C4UA 4RV8A 3BAYA 5CKSA 4GX9A 1JZ6A 3FSTA 4QX4A 5AZ1A 1MUMA 1W9DM 3MSDA 4NNAA 3ARVA 3DHDA 3STCA 4OOZA 3H53A 3NUKA 1K03A 2WSYA 3WZ0E 2OELA 4S3AA 3R7MA 3TAOA 3QOKA 2BY0A 3GH7A 4Z1YA 1P5BA 1TPFA 3BJSA 5U1OA 2O4QA 3GIQA 2J4GA 3TOPA 1TYPA 3F5KA 3OVGA 4DZIA 4JICA 4PMXA 4ZOAA 4LC6A 4YTTA 1X38A 4ZQOA 4XX6A 2BVTA 1KM6A 4J3VA 3OB8A 1EJTC 3MUIA 2WJDA 3E0FA 1OFOA 4AFYA 3RAOA 3DFYA 3ALFA 4NT0A 1S46A 4ERAA 1RR2A 2D0FA 3DBPA 2CU0A 2OWWA 2GVEA 1NEYA 1DNCA 1PDZA 1GREA 3TJXA 1AVAA 3HB9A 1YQZA 1F6KA 4QJ3B 1XDJA 5EL1A 2X1TA 2Z2UA 1E6PA 2DT2A 3QSTA 4AEOA 2PRLA 1P0NA 5CJ5A 1MWOA 5D9OA 2V2HA 2WHLA 1XLJA 5HATA 2Y7GA 4JX4A 3N3TA 1VP5A 1D7FA 4MY8A 5U4NA 1XPGA 2GGJA 3T07A 3DFTA 4LBUA 5AHNA 3RPDA 1FEAA 2PDQA 4MZ1A 1F4AA 4XO7A 4MWAE 3IGUA 4XD5A 3GNNA 4MNMA 1H4PA 2HVOA 3NSMA 4KETA 1RVGA 3CIWA 4E8CA 4QE5A 1E5JA 1Q6GA 2C3DA 2X16A 2O55A 2Y5EA 1SR0A 3BG3A 2AAMA 3B9DA 5D2WA 1D8WA 1NWTA 1DE6A 3DG7A 4PULA 1XH0A 3HN3A 4FO4A 1V3IA 1MEHA 4FXRA 2WBAA 1XCFA 2VVSA 1XLMA 4C6EA 1MOKA 3M7SA 3O63A 3ZLHA 4CVUA 3A7UA 3W26A 4MFDA 1XFCA 4HBKA 2QCCA 2E8ZA 3SIMA 1ZMDA 3CH0A 5FAJA 1UD3A 1VZWA 2WK2A 1I2RA 1KWGA 3O06A 2F6XA 2NX9A 3B4UA 4RZ5A 2JKEA 2WMIA 1E72M 4ATWA 3T40A 4B5XA 3HFTA 3VCNA 1YYAA 2I9UA 2DUXA 4MLJA 4ZQNA 3WJSA 4P8XA 5JCKA 3TCSA 3TSMA 1EC7A 1KM1A 1HL2A 2QV4A 3W7OA 3CPUA 5G5IA 3TQ0A 4E0CA 4PMUA 4AH7A 2Y61A 2W0HA 1Y5WA 1AOGA 2VZTA 3CL8A 3DKJA 4R27A 3ZFHA 5I24A 3R89A 3KBNA 3A13A 3UXDA 4GHRA 2WPEA 4Q8NA 3AMGA 5CG7A 2PZNA 4MF4A 5C6MA 1SO4A 3FHQA 1CGWA 1Z3NA 1FO4A 2WMIB 2D69A 3NPXA 3QV6A 2XFYA 3NM3A 3MB9A 2WWDA 3WG6A 1OIFA 4ZZ9A 1I2NA 2VEPA 1J0KA 2ACSA 3ARPA 2A2IA 2B7NA 3LM7A 5A6BA 1ALDA 3EX3A 4XAYA 2XIJA 3FGCA 1TELA 3QTPA 3KHDA 3LV5A 4LVAA 1ZZMA 3BZJA 4GA8A 4YNGA 3U2ZA 4S39A 4O50A 2MNRA 3TW9A 3TNBA 2BX7A 2VO5A 3AI0A 2EXOA 4Z2IA 2XVKA 3DCPA 3GKFA 3ZQ9A 1VC4A 2WKGA 3LU2A 1O95A 2VEIA 5G2IA 1OCBA 2PDUA 4LBRA 1CECA 3SQSA 2GLKA 3VABA 5MHBA 4QHRA 1UZ1A 1GYLA 4A8LA 3HZ3A 4YN5A 1CXLA 3SUTA 5D2XA 4A35A 4MYXA 3FXGA 3IRDA 2PWGA 3SZ8A 3FGCB 1BVNP 1TCMA 1YE4A 3AHVA 2W67A 1V0NA 1QI5A 1LQAA 3AUOA 4PMZA 4GJ1A 5CJNA 1QNOA 3ARYA 2Z1KA 3N4AA 4ZL1A 4NEWA 1M04A 4DNAA 5TBOA 1EDTA 3W83A 3ARXA 2F9RA 5IOBA 5C7HA 3E9AA 3KVKA 3TYEA 4H01A 1HKMA 3K4AA 4IIEA 3FIGA 5J5DA 3BARA 4KIRA 5C9UA 1ZB5A 2HPMA 3APTA 5IFTA 1OYAA 3Q65A 3GC4A 3WO8A 2J66A 1QUMA 3OOQA 1NVMA 2WV8A 4F0HA 4G1KA 1LUCA 2F61A 4WY0B 1T0OA 4ICNA 4MJ4A 1EF2A 1O7AA 3CPRA 3UZJA 1SMDA 1GQLA 3WYZA 3KOYA 1DJXA 4B5NA 1SZEA 4FHAA 4NJHA 2YQUA 3BGGA 2A3LA 1PL9A 2R8WA 3URAA 2PWVA 2WNNA 4NL1A 1JYVA 4NXSA 4NYUA 2PWHA 3U4FA 2E3ZA 1DIEA 2VCBA 4IP4A 1RXOB 4QFUA 1BVZA 4HPXA 3QY8A 1DJHA 3Q58A 4MB3A 4QITA 1LUCB 3AZRA 2ATSA 3I7QA 3AS1A 4JNMA 1H1NA 4U28A 1H51A 3PZOA 4QDMA 1E4LA 4D8AA 4DXKA 3AJ7A 2X8CA 1XISA 4JTIA 1JDCA 2REQA 2NV9A 3WLLA 1WDSA 4NY2A 1JUKA 4LGXA 3SO7A 1V77A 4WF7A 4J1OA 2J7HA 4JXCA 1EWDA 4EPEC 1K7EA 1FCVA 2XSAA 4D6FA 3G1AA 1O68A 1DHKA 5AC8A 5MKGA 3NZRA 3QY7A 9CGTA 3PY2A 1FIQB 2PFHA 4P7LA 3CAWA 1RA0A 3ZSSA 5D09A 3WNKA 4IP5A 1WAWA 3HGJA 4C7DA 4EQWA 3GNXA 4KH2A 3WEOA 3RJXA 3VKDA 3NXFA 1F8WA 2XIBA 3BLKA 3G1XA 2YZ5A 3A9BA 4LVGA 2REQB 1IWPA 5DMLA 2E5DA 4NJKA 1SW3A 1SZRA 4ZTYA 1VYPX 1HIZA 2CESA 3OIHA 1CXHA 1NARA 2BVWA 3URNA 3GC5A 1NFGA 5MKGB 1PIIA 1MUWA 3DFPA 1V6TA 3ECQA 1Z9AA 5T26A 2VQUA 4ERIA 3GTFA 2FMNA 4H6KA 1TYTA 3DK9A 2IKGA 3XIMA 2G4FA 3ES8A 1RBOB 1YHTA 3BAKA 1GVYA 1D9EA 3EA3A 2DV0A 3EOLA 4Q4KA 3WLOA 1K4HA 1F3EA 4QSFA 1SQ7A 2J9ZA 4QTGA 3RGTA 4GC4A 2DIJA 4PMYA 2NV2A 4TXEA 2FTYA 1X7FA 4LBSA 5AVHA 1UKSA 2PDNA 1QW8A 4HYWA 5GQBA 2W92A 1K6WA 3FOKA 2RAGA 3SY5A 3GHTA 5BXRA 4B5TA 2WP5A 3MVTA 3SURA 1JEHA 1G4SA 2E6YA 3L8KA 1FWNA 5IHRA 4GYJA 2QXWA 4PBGA 2PF0A 1WDQA 1YXDA 1O5RA 5JVLA 1TE6A 4DLMA 3HIJA 1RCQA 3WFAA 1XIEA 3W7IA 3E49A 3OG3A 3QFWA 4UTJA 2ZUWA 4FF5A 1TPUA 4GIAA 4DXXA 3O6AA 3BCDA 3MZ2A 4MUPA 2ZBTA 4MOZA 5CZKA 5CPNA 3QJAA 2ZTJA 1LT7A 4NI3A 2YFNA 2Z7KA 3L4XA 4UMCA 3IJ7A 3CQIA 2J6VA 4HPJA 5FKYA 2H9AB 1V0MA 3OW1A 3HM7A 5CCZA 1NHSA 3SJNA 1DOSA 3CQKA 5JBEA 2DVTA 4WLCA 2C18A 4KCWA 2OZ0A 2PB1A 3HG3A 3TR2A 1BF2A 1QU4A 1PXGA 3CASA 1C3FA 4G7EA 1XUUA 4WQ6A 4GD0A 2EG6A 2H6RA 2OSYA 4JQ3A 1KTNA 3TX9A 3B0PA 4G7FA 2O9OA 3GTNA 3HO8A 6ALDA 2PURA 4DPQA 3N19B 1KRMA 2ASHA 3FJ6A 4KBXA 1OINA 3S1GA 5FEXA 4AX6A 3GR4A 2NV1A 1YNPA 3QEZA 1AH0A 3M4HA 4AIOA 2NXHA 6CGTA 3EX6A 2YR1A 3T7VA 3W6YA 2QJMA 5I3KA 4BF5A 3O0HA 3UT0A 4O16A 5E5CA 3WBYA 2BGNE 1AA1B 4J4KA 3D5HA 3VIKA 2OTDA 3NEHA 1V51A 3QR0A 4G7EB 5HNUA 1UWSA 1PKLA 4AVOA 5JBDA 2J8GA 2ACQA 4AXKA 4JYEA 2OLSA 1ZL1A 3BOFA 3RRAA 1LORA 1QI2A 3C52A 5HWNA 5DO8A 5I7GA 4M56A 2DSVA 3NS1B 3BLPX 4J3WA 1UWRA 4IH3A 3T78A 1UBPC 3IVUA 4FDCB 2X1SA 4IUGA 4C6PA 3IIXA 4HU0A 1TYGA 1W17A 2XFRA 1RQHA 1NOWA 3OLIA 4G9PA 1LG1A 3GNRA 1J96A 3V0SA 3BV4A 4BI6A 3EX1A 1XLGA 4E4UA 5D2YA 3TAKA 4YPJA 1V02E 2P53A 4KWVA 4MB5A 2PDCA 3PNUA 3TJLA 4GVGA 1PSCA 2C15A 4POCA 3RMJA 1JJKA 1AJZA 2G96A 4H4XA 1DORA 3HPAA 3RLGA 1R7AA 4OGZA 1Q65A 8XIAA 3SBFA 4HYVA 2PDXA 2P50A 3UERA 1RA5A 4TVUA 3VOFA 4L5ZA 5AHIA 3TTQA 3AQUA 1POKA 5CPQA 4ZFMA 2Y85A 1W8SA 2ACUA 1DXLA 5H91A 2OGJA 1E0XA 3RXZA 1KRBC 5A8PA 1K9TA 5GJNA 4PRWA 2NUXA 3TV8A 2JKAA 1GEUA 2Z6IA 4EMJA 1BEUA 1B5TA 1K9FA 1YPIA 4AYSA 1TV2A 3CMJA 3W23A 4P2VA 4WGHA 1UD4A 1V7YA 1IT8A 3NYZA 4IWWA 1CXKA 3G6LA 3LBOA 4XAFA 3MI3A 3AAMA 2AGKA 4EQRA 4DY1A 2FGZA 4ADTA 4B3ZA 4HU3A 3QRHA 3F7JA 4KS0A 4LY4A 3FEQA 2VGBA 4IZGA 5G5GB 3KL5A 3OVRA 3TVAA 4N6EA 2PRMA 1DWJM 1M3UA 2YA1A 1H7OA 4H00A 1PAMA 3KRBA 1PPIA 4EAMA 1XC4A 2E9LA 4ONVA 3LQGA 1X1OA 4INFA 5HUPA 2A3BA 5AC4A 2YL9A 2NQJA 4I3GA 1F74A 5I3FA 1XSJA 5KZ6A 2WSQA 4AD3A 5I3HA 1ISYA 1ZPTA 2QCDA 4RNHA 5F2LA 3MP4A 5FESA 4LYPA 4R9OA 4HSOA 2BWGA 2FVMA 1OCQA 4GYKA 4KCUA 1UWTA 2OQYA 4BI5A 4HA0A 5D05A 3QKEA 1Q7ZA 4ZQRA 4KESA 4DHGA 3BG5A 1A3WA 1TTJA 4AVNA 4L64A 3H8AA 3ZJKA 1EOKA 1ICSA 4Z1AA 3VD9A 4O1CA 1C92A 2QT3A 4Q3MA 3C6CA 4RE4A 3GNPA 1YKWA 1SB3B 4M1BA 3KOZA 2QCDB 1B31A 1MFVA 4LUSB 1L8NA 3RK8A 1PHWA 2PP1A 4LRSA 4WDTA 1TV3A 1J12A 3GW3A 4AZCA 3MO4A 4LQ1A 1SM9A 1XFBA 3W1NA 2NT1A 4HGXA 2WMFA 3DH9A 2VR5A 2Z27A 3PPHA 3CH9A 3IRSA 4L7ZA 2OZ3A 1FDZA 4FR6A 1UP2A 2E9MA 2VZOA 1A53A 3CUHA 2BOGX 1JCJA 4C6OA 4D71A 4EQXA 1K7FA 1U5JA 3BTNA 3N9SA 3HURA 3MSYA 2R6OA 3PAJA 1W1A1 2WCSA 2ZZ6A 2ISSA 3FEMA 4TVWA 4DJFC 4S3FA 4PUWA 4DJEC 1I2QA 4AZCB 5LIXX 1RPKA 3NQ8A 4GUIA 1PV8A 4TO8A 4M7TA 3GBEA 3SRHA 5EMLA 4FNUA 4PMVA 4V1XA 3A12A 3GNDA 4H6QA 4IMAA 4DWDA 4PUJA 3QQWA 2W6RA 2DQWA 3P5YA 4GZ7A 3SQMA 3QYQA 3BMVA 4JDBA 1ZFJA 3II1A 4R3UA 1E43A 2DZSA 1Q6OA 1H63A 2BOFX 3G3DA 1FWGC 2PI6A 3H54A 3U4AA 4LOCA 4DAIA 3AYTA 2JF6A 4M3PA 4HOXA 1SJDA 2VNCA 4RDZA 2PGFA 2IPWA 2B81A 2X0YA 4UTTC 1FCQA 3CUXA 3WK1A 1WYIA 5HBFA 4IT1A 2J88A 1J93A 2VEMA 3DEQA 1V6UA 1M7PA 2C71A 3NQBA 1EPVA 3GY1A 4C7GA 1XP3A 1MZHA 5M3WA 1JPMA 3AM9A 1M1BA 4UMBA 2INFA 3O0KA 1OZQA 1W9XA 1LBMA 3AYRA 1EIXA 2QLYA 2QPUA 4YHGA 4Q6XA 4YMZA 3QVQA 5KSWA 1FWEC 3MU7A 5HULA 1ICPA 4QIUA 2O4MA 5I02A 2W3ZA 5C55A 1VEOA 2D0GA 3S1VA 5AZ0A 2VFHA 3PBVA 3SAZA 4JIPA 3K4WA 3LHVA 3QR3A 1ZP4A 2PBGA 3S47A 3DAQA 2O9PA 2OOFA 3EWUA 3LGEA 4OKDA 3RFAA 5ABTA 3HPZA 1DWAM 1QFEA 4MHBA 1KTCA 2XPKA 3AHZA 3N9RA 1B4EA 2ACRA 5CC7A 1S39A 3TXZA 3PZVA 2PLJA 5CPMA 1V4YA 4ATLA 4HZ6A 3ABRA 2LLEA 1U30A 5FS7A 5H8UA 3NOYA 3BAIA 1KM4A 2OO6A 5CSSA 3KBWA 4FNRA 5T8GA 1JDDA 3MKCA 2Y5SA 2OX4A 1TWDA 3DKLA 1UD5A 3NSNA 3HGSA 4GIRA 4QJ5B 2GSEA 2VC7A 1DJZA 3TFCA 2BASA 5CGTA 4CNUA 2ZE0A 5CQ1A 3OA3A 4ATDA 2FZ9A 4IUOA 3RG6A 3HFYA 2XM1A 3N73A 3QW4B 4AHPA 5F7UA 5CGQA 1DTUA 4EM4A 3UXKA 3BCFA 5H6HA 5F1UA 2Y89A 7TIMA 4MZ8A 3ONCA 2OFJA 2ZXQA 5FF0A 1VBJA 1I0BA 3LLXA 4L65A 3CEUA 1HO1A 1ZXIC 3EKLA 1SO3A 2YDSA 3NVWB 3L2MA 1N63C 3ELFA 1RZMA 3LXAA 2A4AA 3VDGA 2YB1A 4NZFA 2VWSA 3VKJA 3VOGA 4QAIA 1E1FA 1IEWA 1MW1A 5CG0A 4N7QA 3OYZA 1C9WA 3SCPA 2V3GA 1UQYA 2HBXA 3KOWA 3R4IA 3GIPA 2Z1WA 1HKIA 1NM9A 2GJLA 1OT1A 5I3DA 3VK5A 1KLZA 5E70A 3B8SA 5I5RA 1GSNA 2E3TA 3H4KA 4PMQA 4PUMA 1BFNA 1KXVA 3GZ3A 3VGHA 3B8VA 4L9XA 5D04C 4Q8PA 4RXGA 4EF9A 4XV0A 3WF2A 3WQDA 1PX3A 4DJFA 1ZAIA 5HMEA 3MSRA 2BFGA 4DJEA 3CV6A 3ZM8A 4JHMA 1GXFA 1AG1O 1UBSA 1DVJA 4GX8A 3MW7A 1XBXA 4M6QA 4XZMX 2YXOA 3TDFA 2QJNA 3CQJA 3WD3A 4YCPA 4QS5A 4IOTA 4GACA 3U8GA 5IDZA 2OT1A 3TMLA 4XD3A 4DZ5A 1MUCA 4GUFA 1TZZA 4XZNX 3ZJ7A 1R8LA 3WNMA 1J2WA 2F6KA 1E40A 4FR1A 4NJGA 5BMXA 1N7KA 1G0CA 1ZCCA 5FJIA 3I6EA 1E4MM 3WY1A 3RDKA 1ECQA 4MJ2A 1TMQA 4N2YA 3G1VA 3GR8A 2E7FA 1FTXA 3TW7A 4EQSA 3G1FA 4MKVA 3GLCA 3SR7A 3W84A 4QP0A 2ZIDA 1LOSA 4OBTA 4ERGA 3MUY1 4XG1A 5A2AA 4UTTA 3EPMA 2XIOA 4G6CA 2ZZ4A 4EXQA 4WEVX 2OEMA 2ZX7A 3NQAA 5D9MA 1P0EA 1O5XA 4FOKA 4GWEA 4C1KA 1JRBA 2B7PA 1KV8A 1XIGA 4CD4A 1GQJA 1C29A 4D6JA 3WH8A 4LJ3A 1DJQA 3ITCA 3W7NA 1MEWA 1JIBA 2EPMX 4HNTA 1RLDA 2Z24A 1OCJA 3TLQA 2YBUA 4IM4A 2XSXA 2HV5A 4WHBA 5CSYA 3A4JA 5DT7A 3WUBA 4F0RA 4A22A 4HYRA 1VCGA 4QROA 3DFNA 2RDXA 2PDGA 3M6DA 4LNCA 3CWHA 2HE8A 3WLHA 2CHRA 2Q71A 3L4YA 4MG4A 4QAWA 3W7RA 1TCDA 3OA5A 4DBSA 3KOXA 2GGEA 2J75A 3HBLA 2VOTA 3EPOA 1U83A 4IIHA 3VA8A 3M6YA 2C79A 4H4RA 2BDQA 1TB3A 3MPGA 3DGZA 1TVLA 1KC7A 4W7VA 3EDJA 3LTSA 3N34A 1F76A 1E6ZA 3UNTA 4GUGA 3VUSA 1ADOA 1H7NA 1NP2A 2A79A 5FL0A 1J0YA 3CGTA 3FDKA 1B0IA 3LI1A 2AOSA 1X6UA 1CGUA 2RABA 2VEKA 4HHHA 3VDAA 1HZYA 4O19A 5FL1A 2GR1A 4HK7A 1H6VA 2Q02A 3G0UA 2INZA 1DHPA 1JYNA 1DJWA 2R1KA 3M7WA 5FJTA 3WJWA 2X2GA 1QNRA 3ZO9A 2RDTA 3SSZA 3R07C 4GINA 3WQPA 2QHAA 1LP6A 3IAPA 5HOSA 4AZIA 4HOWA 3AXIA 4H1ZA 5U25A 3W88A 1T8QA 4Q7IA 2B31A 4X63A 3V36A 3OBKA 5E9AA 3QBUA 3CZGA 4QQ3A 3M5XA 2ZKMX 1MDRA 4WUIA 4UTIA 6TIMA 1OGGA 3WMBA 2BXZA 3RM9A 3T42A 1JG9A 2G3MA 5CLWA 3PUDA 3ITOA 4RKAA 4MNKA 4GMEA 2YLAA 5EBKA 1JFXA 3W1TA 2XIIA 4BK9A 3R8GA 1VHCA 5HK4A 1W9UA 5CBJA 2VC5A 3KWSA 4E2BA 1RV8A 3TQVA 3WK3A 2PE4A 1W1TA 2HRWA 5A8GA 3NQGA 4MGGA 4S3JA 2W3RA 3I3BA 4CQDA 1ONFA 1EDGA 4P7NA 1E1EA 3VE9A 1V6YA 4FX6M 4KRTA 1W1PA 1MMFA 2DP3A 3EXRA 1A0EA 3W76A 4LRTA 1CXFA 3L9CA 5CSUA 3U5YA 3NL6A 3KFTA 1R3TA 5JIPA 5RUBA 4LF2A 3NJ3A 1H5YA 4B9ZA 4MVAA 5C54A 1B54A 4XUYA 3FJLA 3T09A 3FVDA 3MI2A 1GW9A 2DDXA 1JGMA 1KCLA 4LNYA 4H9YA 3GQYA 3PG9A 5AHLA 5I00A 4YWOA 1U5HA 2VC9A 3NFUA 1NDZA 1NWUA 3IJLA 3BAJA 3L7RA 5K9XA 1F61A 4IFKA 5CXPA 4UBPC 3S5YA 4BCEA 4FXSA 3AIRA 4LCSA 3SCNA 4EVZA 1OFBA 4E8DA 4F48A 4FAMA 4IGHA 3I6TA 1FHDA 5LZLA 1OCNA 5E9XA 5DF0A 3O1NA 3K8KA 2VCCA 3LPGA 1P6BA 2PGEA 1QO5A 3G0SA 3LPPA 1KBIA 3CLMA 2CBJA 4LS0A 2XN1A 1GCYA 1UR2A 4IMFA 4OTKA 3U2CA 3SRFA 4BQ5A 4IFKB 1V6VA 5A1AA 1VPQA 4UQEA 1WUEA 3WQ5A 1YTKA 3LMZA 4AZGA 3QMSA 3GBDA 3L0KA 3V35A 1ZRQA 3WH5A 1TMLA 4TV6A 3II4A 3M9YA 3S5OA 2BV9A 2JF7A 2VP8A 3OC4A 1XBYA 4P61A 1PEZA 3FA4A 4PYSA 1FWBC 2XH2A 1JCMP 3S5ZA 3W02A 4A8RA 1IZCA 1MYRA 8XIMA 4GCXA 3VNMA 3DFHA 1YLVA 1X8CA 4BFAA 4OUIA 1EUNA 2EGZA 4J3ZA 1OM0A 2VX7A 3MMUA 4K7VA 1FWIC 1H7XA 3AS2A 1QOQA 4BKNA 1E6XM 1TTPA 3TK7A 3F2BA 1XHCA 3PJXA 3MMWA 2V67A 3QYSA 1I4NA 1PDYA 1QNVA 2O92A 2XWEA 1EYEA 3VX1A 1P7TB 3IGSA 2EKCA 3LBCA 4GVFA 4PA8A 2FH6A 4O54A 4IPNB 1VBHA 2TODA 2WLZA 3EA2A 1MW3A 1R30A 2E77A 4ZVJA 1V5XA 5ECUA 2OCZA 1FH7A 4MDOA 3QMTA 4NI8A 3A64A 1RY8A 3NVYB 2CFYA 2WVSA 3BJTA 4Q8OA 4LEQA 4YYCA 4PUEA 3N6JA 1GYMA 3TN3A 3AJXA 4BY3A 4IG2B 4JTTA 1UW9A 2PTWA 4EMIA 1D7KA 4M6PA 1CNVA 1J10A 2Y8KA 4L6DA 3PNZA 3ZLFA 2W62A 3CAQA 4RK8A 4HPHA 4MIMA 5DCBA 4QJ1A 4Z17A 4JN7A 3UG4A 2G8ZA 3S2MA 3EF6A 1KV5A 4NYYA 3A21A 4HSNA 5L9FA 2QUVA 3KM8A 2A0NA 1VR6A 3ANYA 3SCTA 4MSSA 5G1TA 3SY8A 1KGXA 4H83A 1RJQA 4H4SA 4AZ6A 4HSHA 4MM1A 4AHQA 1BD0A 3U7VA 4JGDA 2YCEA 1SMAA 3DGBA 2WCGA 3UXLA 5LNSA 1M01A 3VVGA 3N2BA 3GFYA 4AX7A 2C3ZA 2GVYA 1KGUA 3THUA 1G69A 2VGIA 2BY1A 1T96A 7CGTA 1ME7A 1JYWA 1WKDA 3GM8A 3TJIA 3FHAA 3OHIA 3LCHA 3BMWA 1FCBA 2E4TA 3UR2A 4A3RA 1HP5A 4L6HA 2GOKA 4GRSA 4X0VA 3B03A 4LAZA 1F4HA 4HVXA 1A5NC 1OGSA 1IXNA 3CAVA 1FWAC 4NKCA 4NRSA 4N9DA 3LCWA 4JDRA 2HTMA 4AEFA 4ZXLA 1TRIA 1GG0A 2V81A 3VGEA 1FWRA 3NO3A 4NRRA 4AZBA 1U33A 3JVAA 1Q4NX 4E8GA 1GT8A 3GVVA 1HG3A 1FH9A 1X8FA 3IGHX 1P1XA 3HV8A 2QDGA 4H7ZA 3CZJA 5ABHA 4JTQA 1FECA 3UPMA 2W66A 4DO4A 2HXTA 1OJTA 1J0ZA 1E4NA 2FQIA 1KM3A 4DJDC 4H4IA 2G41A 2OO0A 2GFTA 1MFUA 1ADDA 1TRDA 3PG6A 4U5KA 1JDFA 3E02A 3VFLA 3WQCA 3UZWA 2UY3A 4GYPC 2FPTA 1R47A 1R5YA 2OQLA 4HHLA 5AC7A 2J9XA 3F5JA 3P2VA 3WLTA 4FXFA 1PCKA 1IZKA 6XIAA 4ZR8A 4KRUA 3SCSA 3T44A 3Q45A 3BC9A 3IARA 5EFFA 4BEUA 1PKMA 1US0A 1G6CA 2A7PA 1UR4A 2PCEA 4H9ZA 4BEQA 3N15A 4IXHA 3UR5A 4FX8A 2HQMA 4AUBA 1MQQA 1HGWA 2C6QA 1F3TA 3M0MA 3BMXA 2FKPA 4JEJA 1US2A 5J5RA 3SB0A 2ON3A 4GRTA 2Z25A 3CXOA 3GO2A 3IJDA 4KQNA 1JRCA 3KOFA 3RLHA 4AY8A 4IGNA 5D2TA 4IMDA 1K8CA 4MKNA 1ZDLA 3SECA 8TIMA 2B0MA 3GVGA 1W5NA 4OECA 5DMYA 4GPNA 2GOUA 1J0JA 4MNLA 4YVPA 1GRFA 4H9TA 4XTDA 5E1QA 3LPOA 2ZRZA 2FHBA 3K2GA 5D2VA 3I7SA 2GR0A 2OSWA 1E5NA 3ZVHA 1EZ2A 2VGGA 3QFBA 2OJPA 3CO4A 1TQJA 1R85A 5TAOA 4DEFA 4C90A 2G0WA 4DBEA 3TYAA 1S2CA 1H2JA 3SSJA 3MANA 1RVKA 1XD1A 3MJYA 1W0MA 3LDVA 3RU6A 1SVDA 3W07A 3SUVA 4YU1A 3G1YA 4AWUA 3JRKA 1OZMA 1XLDA 1BXNA 2PA6A 5K4XA 1A5MC 1J01A 3I68A 3F4NA 3T8QA 2HE5A 4YHEA 1CEOA 1X1ZA 4EAYA 4C6LA 1LWIA 1RSCA 3I4KA 4D6CA 3WQVA 2XGIA 1SR9A 1A5AA 3ZVHB 5AECA 1QW7A 3BG9A 3ARZA 4UTLA 1QPNA 2F38A 2WVVA 3VOJA 2G4JA 1Q2RA 3MBFA 5D32A 4DO6A 3TUUA 4KEMA 3SI9A 5B7YA 2FTWA 3W7GA 3XISA 1JI1A 1GZGA 4XZLX 1TPC1 1ZBCA 4S3GA 1XYLA 2W91A 3PZGA 4C6NA 4NJJA 1H11A 7ENLA 1G4PA 2DORA 3LHZA 2QVNA 1VS1A 2PWUA 3L67A 4BQ3A 4IX2A 4M6VA 3GTHA 2IXVA 3WK2A 4PTXA 2QV5A 3PTKA 1AUSL 2YDRA 4JL1A 5LA1A 1KRCC 1TZ7A 1B3ZA 5IHSA 1TUFA 5HMDA 3POCA 1L2QA 1BYAA 3PZ9A 4Q4MA 1SUXA 1EP3A 5JRBA 1CXEA 3VNLA 1UD8A 3WDHA 3A7RA 4R53A 2PCQA 2W9MA 4PUUA 5E6YA 3UFYA 3AU2A 1WXYA 4B2DD 3M0HA 1B3VA 3SW6A 4JTKA 3QGVA 1XL9A 1K77A 3S8HA 2FGLA 1R2SA 2XZ7A 3G1HA 1T6MA 3PB2A 4AW7A 4E2OA 1E9ZB 1C9DA 3AMZA 2KAUC 3I3EA 4H4WA 3PTDA 4PC8A 1KQYA 3V0TA 5I3GA 2PZ0A 3VZZA 5CZ0A 4QE1A 3FVMA 4JTFA 4PMNA 1UH4A 2MUCA 3B8WA 3NL5A 4ZSUA 5LNWA 2H90A 4W93A 2C91A 4XZ9A 1X98A 2DSKA 1IGWA 1RY0A 4F2UA 3GG8A 5BU9A 1FWHC 2GVJA 2POTA 2PSNA 3FAWA 2XVPA 3WH9A 3KS5A 2DZTA 4KFPA 4RDWA 4GGHA 5D03A 1HJUA 3QKZA 3C2FA 1XG3A 5K3VA 1TMHA 2GR3A 3UWYA 3AYVA 3V7PA 3G24A 3S5SA 1MVYA 2BBFA 4Z08A 3DFSA 3T2PA 3TTSA 5K4ZA 4A2SA 2HK1A 3RN6A 1W1IE 1UASA 4AEEA 4F79A 2FPYA 4LFYA 3UYCA 4PN2A 4DJDA 3UWQA 1PE1A 3TYDA 3W1QA 5XINA 1ZJAA 4XK2A 4K68A 3VIPA 3PF3A 2DPEA 1XANA 7PTDA 3GDTA 3DG3A 4PTMA 3A6OA 4GJIA 3C2VA 4GYPA 3STFA 2UY2A 4F66A 1JRPA 3NGJA 4M7SA 1GONA 2GUYA 3NQMA 4R34A 3S1WA 2QCHA 4JIEA 5BMWA 3QFAA 5C71A 3ID7A 2NWSA 2FH8A 4X61A 4P5UA 3H2NA 4L1XA 1N82A 1VBGA 3ALGA 4WY0F 1J11A 1NDWA 2CLHA 3VKCA 1YXCA 4TX8A 3PBUA 2CLLA 2QVHA 8A3HA 4X60A 4U4MA 1EH9A 1XLAA 4J28A 1ZALA 4CD7A 1P6WA 2TPRA 1K70A 1EPXA 2BGQA 3N2XA 3ARUA 3V3WA 1PYMA 2WQPA 3QQ1A 1GRAA 4NIRA 4HK5A 5FAGA 1NU5A 2D20A 2GJPA 1TZ9A 4F0KA 1YXYA 4GY1A 5LGXA 2E1DA 1GOXA 1UWAA 3KS6A 3W86A 4L56A 4BWLA 2PDFA 3IC9A 4HZ8A 1M7JA 4LA1A 3BV7A 4Y8EA 2YVJA 2GJXA 3UVAA 1EL3A 1H2IA 3S42A 3KTCA 3ZJ8A 3MUAA 2BGSA 1TWIA 4F40A 4LV4A 5HWMA 2I5QA 3P81A 2W63A 2QPSA 3UJEA 1PB0A 5KZDA 3OLDA 4K1WA 2Z1VA 3R10A 2BLEA 5JMUA 1JR1A 3DJGX 3ZJ6A 3ITTA 1KN0A 2WC3A 1G7UA 4BI7A 5LYRA 2NWRA 3TTEA 2IPGA 3AXHA 2OEKA 3SM0A 4YWSA 2J7BA 2R24A 2E68A 1H3GA 2QUTA 5CAKA 3LRMA 4GH3A 2VDGA 2YXXA 3K13A 3RM8A 4D72A 2GJXB 1OD8A 2E40A 4UOZA 3IVSA 4J56A 1M7XA 2DZAA 4D6DA 2Z00A 4UQBA 1FXPA 5KVIA 3MYPA 4PH6A 4ZE4A 4WRHA 5K9DA 1RCXB 2EPOA 5A8QA 2VDHA 4S3EA 4XBSA 1A50A 2H8XA 2Q8XA 1W3JA 3VMPA 1BG4A 3R12A 4JS3A 2YYTA 3V0UA 4UTKA 1LLOA 3VCRA 1F6PA 1A5BA 1YDOA 3W1MA 3GFZA 1W37A 3S2CA 1IT7A 3W3OA 2E9BA 1ZX9A 3W2KA 3P3BA 3PVFA 3UQNA 1OHLA 3M46A 3CTLA 1WZKA 3BLOA 2X30A 5A95A 4W84A 4GO9A 1W5MA 3WEZA 2B7QA 3W73A 4U2YA 5EFDA 4H19A 3A3WA 2WVUA 3L21A 4UWMA 4JHOA 1LT8A 1Q7MA 4RR4A 3MCMA 1SYTA 4JL2A 4IF2A 2WPBA 5BRPA 4K8HA 4ZO9A 3V5OA 3ENLA 3MV11 2OYLA 3O2LA 3D3AA 5FSDC 3EMCA 4PUKA 3NIYA 3E0IA 4PE8A 4ZENA 3BDKA 3UD6A 3HU7A 1UA3A 1TVPA 4ES4A 5A8OA 3B06A 4ZA0A 1P0DA 4C6MA 2QS8A 3PK7A 1EHNA 4EX4A 3Q4DA 2QCLA 1KBKA 4LT9A 4JIQA 1IGSA 5AYBA 2G95A 1WAUA 2F2HA 3WELA 1XRSA 1O6IA 2F8QA 1TG7A 2WVTA 4PCTA 5CC5A 4MY9A 1V6WA 4X22A 3MHUA 1Z6KA 1ZENA 3MV01 5FMHA 3M41A 1ML1A 4JIHA 3MA8A 3AIWA 2V3EA 4MAVA 1N8FA 3PFMA 1REQA 2VUNA 4FLRA 5EBAA 4Z2GA 1HJQA 5EY5A 2XVGA 1PTDA 4UFKA 2ZRUA 4ZOHB 2YCLA 2UZ9A 3N2OA 3TIMA 3UZ5A 1OYBA 5A6TC 1N8WA 3A4XA 3UWZA 4DBWA 1E6QM 1HT6A 4DXVA 4K3ZA 3VNZA 4IJRA 1DE5A 4O28A 1E9IA 2P8CA 4TTGA 2DH2A 2YCKX 3WFLA 2DUZA 5LNVA 3R6IA 1BSLA 3BK0A 2E67A 4DUVA 1QHOA 1PO9A 4UCFA 1HFBA 5DFAA 1HVXA 2BY2A 3ZR6A 1JAEA 3AHTA 3UU0A 5EBUA 1REQB 4L4MA 1Q6QA 2NVDA 3CPGA 2JIEA 4LX4A 3NZGA 2RJHA 4OWGA 3UY7A 2V6AA 3IK2A 2HXUA 4MWAB 1SFLA 4KGLA 1G7VA 4UUIA 4PRRA 1AZ1A 4LH8A 2I57A 2DZUA 3OGSA 4Q32A 2HSAA 1E0UA 1EBHA 2XM2A 4KCVA 5FJJA 5HUOA 4WCJA 2NT0A 3W6MA 1HKWA 2XU2A 1V0KA 1W5PA 4OBSA 2VI0A 5DCDA 2Z29A 3IVTA 4JFUA 4AD1A 1QOPA 3P62A 1KO0A 1E4IA 4N9EA 3HTWA 4US5D 1KBBA 3T9PA 2EHHA 3W7CA 3V1PA 2PWFA 3RLUA 3UY8A 3B0XA 3NQ2A 4S2BA 4S3CA 2ONEA 3APGA 4OV9A 3FX4A 3WIJA 1W9VA 4XZWA 1V93A 1OC6A 4V27A 3CHEA 4IIGA 3VDBA 3NQVA 4HA3A 3G77A 4ZEPA 2ZQ0A 4LUJA 3WLIA 2PDYA 2FFIA 3H4WA 4BA0A 3CL6A 2ZE3A 2G5WA 2I56A 4HU8A 2J7EA 1LF1A 1CLVA 3OQ8A 3GIYA 3VD5A 4LCQA 2OU4A 1R38A 4I8DA 4F2BA 3CGCA 3VD4A 1E56A 4I7WA 3QHOA 3SCQA 4S3KA 2QMKA 2ISWA 4FK9A 1S5VA 4AZ7A 4I5UA 1VFOA 4I5RA 4AWEA 3ZSTA 3GU9A 1TV5A 3S4TA 1AFSA 3GRIA 1A4MA 3VGBA 3PPFA 2JKPA 3CYJA 3LA4A 3S83A 4NX5A 3GD4A 1L6FA 1OG6A 2PRHA 2P1FA 3USZA 4GY0A 3RRXA 2YL6A 3THAA 5A2CA 3SN1A 3BQ6A 3RR1A 1FCUA 3LOTA 1K8ZA 2VFEA 3FA3A 2BHUA 3PBGA 1JD7A 3PZNA 1E55A 4JTCA 5HJLA 1EJXC 4ADWA 3KCLA 3VC5A 3TMQA 2WBGA 1SO6A 2EG7A 5HNNA 4CEUC 2YLLA 3PZUA 3RPMA 4MJZA 4LUTA 1GTEA 4XSMA 4S2CA 1T40A 1V3JA 3CT2A 3H26A 4QNEA 1I2PA 3T0TA 2WBKA 3V4BA 4MLRA 1UR9A 3LXCA 4E2DA 5A8MA 4O1FA 3VU2A 2PBOA 1N61C 2C8NA 4B3LA 1V7AA 5BOOA 2HWGA 2VEFA 3TZNA 3T1GA 1AMYA 4JTEA 1RUSA 3N14A 3W22A 3N9KA 1EP2A 1ZBVA 1TWSA 1XC6A 2DH3A 3DHPA 3EGJA 1C93A 2OLAA 1WPCA 1ZHAA 1GRGA 3WL0A 3AS3A 3FY1A 1GOMA 3WBWA 4DWSC 4H41A 4HMNA 3STEA 4EANA 4D2JA 1RPXA 1V3KA 1LG2A 3ME3A 3P74A 1BTCA 1LPFA 3IANA 1JCTA 2X09A 1S3TC 1ZGDA 2YL5A 5G1YA 3GU2A 4HTYA 2QR6A 5SWUA 3HGRA 1UUQA 1VRDA 3RHGA 1TJ2A 1XLFA 2V9DA 4PSRA 1BQCA 3DUGA 3WUFA 3P5ZA 2DSZA 3V1HA 4PODA 2I1OA 2ZRVA 3NQ7A 4I6VA 2EQ9A 1J79A 3SCWA 3KVJA 4RPPA 2ZWZA 3LHWA 4AD0A 5B80A 3M07A 3W2LA 3ANUA 3RCYA 2YVFA 2ZZ5A 1R9YA 4O13A 4KWUA 5F2IA 4H4TA 5D4YA 4H04A 3R8HA 3TC6A 4L4OA 4HCLA 1PBGA 1DIDA 2GSJA 1SJBA 1TJ1A 4AMAA 2J74A 3KVMA 1QI0A 2E25A 1MQRA 1UOKA 1GOQA 4CN6A 1NQ6A 1P4CA 2AQVA 2Z7GA 2GQWA 1GQNA 1QVBA 4TVDA 3NDZA 1OYCA 1Q66A 2Y8UA 5TIMA 4MTVA 4BHYA 4EACA 1EDQA 2HS6A 3NXLA 2GUBA 3L2IA 2A7RA 1DYSA 1GHRA 4GQ0A 4FXJA 3S2LA 1DBTA 1IXOA 3ZVIA 3W81A 1U22A 2PC4A 4I7UA 3P0XA 4EIVA 3WDRA 4EKJA 4ZSTA 3UBPC 3PUOA 5LNUA 5DX7A 4HOZA 3ABOA 1NWSA 4ZODA 1IIGA 4LANA 1K9DA 3HQOA 7XIMA 2FLIA 2H3DA 2Q8LA 1G67A 3BWWA 3BGJA 1NDYA 4MJMA 3T4WA 1A0CA 2YIHA 2UY5A 2NSXA 1N2VA 4H7CA 3VZXA 2D24A 1HX0A 1DL3A 4AVFA 1VHNA 2IMRA 4PMJA 3WQ6A 3CMGA 2FHFA 1VDVA 1CB2A 1S2TA 3CUJA 4S23A 3NPUA 4CNSA 3N3MA 4UTFA 3DC0A 3R79A 1FRBA 3BOXA 2DQXA 5HNRA 1GW1A 1QBAA 3VAVA 1L9WA 3CBWA 1F6YA 3TYBA 1SZNA 1TJRA 1TWWA 3T0AA 4FOUA 5M5DA 2XUCA 1GOWA 1OC7A 2BODX 2QGHA 2B4GA 2ATMA 4XKYA 1KR1A 4QLJA 2C14A 4F3HA 4JTAA 1XLEA 1GKPA 3TQKA 3PBYA 2PD5A 4F0SA 1V0LA 3LCGA 4IFRA 3B3DA 2FYMA 1DQWA 3WQGA 2OYMA 4W8BA 5FJOA 4HT3A 2WPGA 3PS7A 1LDCA 1EA0A 4DQWA 3WCZA 2J79A 3ZT5A 4EK7A 5IBXC 4O1BA 1XDIA 1H7RA 4BF7A 3EB3A 4DF1A 3CV7A 1DWGM 5C8BB 3S5NA 4XKYB 1B3OA 3B8TA 3W27A 3WK0A 4IPIA 1VCVA 2Q8ZA 3VIHA 2P5NA 5F4SA 1PWLA 1Z42A 1QWKA 4KT2A 2PDHA 3KL0A 1CGXA 3L5OA 5T9CE 2F84A 1U1JA 2ZYFA 2V3FA 1IR2A 1SJCA 2G3IA 3L0NA 4V1YA 4JR5A 3C2OA 4KPLA 3KCOA 1SSGA 3PZTA 1UJPA 2A21A 4DAFA 3ARWA 5JIWA 2CKSA 1NJJA 5HAOA 3KBVA 2CC0A 3L2LA 3CO8A 2E28A 3PZIA 3IJQA 1AL7A 2TRSA 3WDPP 1H1YA 1RCOB 1XF0A 2Y5JA 1LOQA 5F2GA 4W87A 3URHA 4DWSA 1XYBA 5GPRA 1TPH1 2Y8VA 1RD6A 3VILA 1HGYA 4FALA 1JUEA 1V08A 4IQLA 2WNQA 3W75A 4R5EA 1UWQA 2XVNA 4HD5A 5LHFA 2WZTA 5FD0A 2CFFA 3WENA 1MW2A 2CLIA 1QK2A 1ZCOA 4JNZA 1B9BA 1JZ4A 3JZUA 3NPWA 3N04A 2QQ6A 2PLKA 3R5EA 1U5VA 2IQTA 1QAPA 4CQAA 4RZ4A 1R2RA 3KW3A 3W85A 3CLWA 4DWSB 2V0TA 1JZ2A 3E5BA 3WUGA 4L4LA 1XBZA 1E1CA 3HPSA 3W7QA 2O7QA 3R1ZA 4P7RA 5HXMA 3WD4A 1QPKA 3C3NA 4GO8A 1H7WA 3M0LA 1OX4A 4KF1A 4O18A 5G5HB 2Y63A 4EF8A 3S46A 3GH5A 3QMRA 5F4XA 5BW6A 4GNVA 3INPA 3D6NA 2VELA 5M03A 4C1NB 1OF6A 3AOFA 2O9TA 3EANA 5CAHA 1P48A 4JDYA 3SN0A 3SR6B 2JIWA 4BURA 3GUWA 1FWDC 2G50A 4PBEA 4Q4SA 2V5JA 4O1DA 1BGAA 4F9DA 1TR9A 2ZCGA 4DO5A 3VC6A 4H8HA 1E1CB 1HTIA 1EJ7L 4N9BA 4CGTA 2GGIA 2NZLA 1PYFA 1XYMA 2H8ZA 4R9XA 3WN6A 1TPWA 1OX4B 3LNPA 4Y9OA 4EOUA 3VXGA 4C91A 1R46A 1I1WA 1NF0A 4PTVA 3WL1A 2FZBA 4E3TA 2Y88A 1WKYA 3B04A 2WO5A 3NNTA 2ISFA 3L4TA 2XSBA 3T05A 1WZAA 1FY6A 4Q7NA 1FP8A 5AOUA 3W2MA 3R13A 1XGDA 1RJPA 3ABXA 4FLOA 3OGVA 3VOHA 4WY0A 2RDUA 3KTXA 1KBJA 3TC7A 1QO2A 1WOBA 2EPHA 3W2NA 7TAAA 4C65A 3DN5A 3MSGA 4O4WA 5ER0A 1XDMA 3HGOA 4AIUA 1KCZA 3E2SA 2D1ZA 3S9YA 3H2EA 2PODA 2XYLA 3L68A 5CSRA 4U33A 1IT0A 1S2VA 2BVYA 2OYKA 2GGHA 2GWNA 2DSWA 3W87A 2C16A 1A5CA 3RYSA 5T9BG 1I9CB 5A6KA 1NSJA 3VE7A 3SGUA 3KLKA 4GNKB 4NZ5A 1US3A 3U6WA 4B4FA 1OX6A 2QDDA 5JBFA 4UFIA 3AZSA 3ZT6A 4XUGA 2CLKA 1LL6A 2CNCA 2PGRA 4GI4A 3NVTA 4M8UA 3TH6A 1R6WA 1X1NA 3GUGA 4A3UA 3A5VA 4CNTA 1KWKA 3RCMA 2VZSA 4JKLA 1F8MA 3WLMA 3PJTA 4YXGA 4HQVA 3UVIA 2WB5A 3WQWA 4XBJA 1XRTA 2AMXA 2AMGA 2CLFA 4XAZA 3W7LA 2ZUSA 4FI4A 3KP0A 2ZOXA 4OFCA 3L4ZA 5KVHA 2OG9A 5IBXA 2QUMA 2YOCA 2WJEA 3FCPA 3A4WA 1TA3A 1OFEA 3EWXA 2WHJA 3ERPA 1PIFA 3KRSA 4GH1A 2OX1A 3E1F1 4D8ZA 1ONXA 2EPLX 3GWQA 1VBUA 4NSBA 1QI4A 1KA9F 1ZQ5A 4PMRA 3TONA 4XWUA 3WF4A 2FVLA 3QPEA 1W31A 2XN0A 4JHZA 4O10A 3IIOA 1HKKA 4HNLA 5DXXA 1RM6B 1W9BM 2GDVA 2YW4A 5KMYA 1RBAA 4APNA 1J0IA 4ZQPA 1UR1A 1YE6A 4BQ2A 3MY9A 4RZ6A 4QDPA 4JBRA 4NF7A 3VM7A 1KFEA 1U1UA 3M0IA 1TA3B 1L2UA 4KWSA 1BWCA 3O15A 1BQGA 4NZ1A 1PZ0A 1ZS2A 2GQ8A 2GQ3A 1WZLA 2VRKA 3NWRA 1EO7A 3RPTA 5KETA 3TROA 1KKOA 2C1HA 4WSHA 4IICA 3VFCA 1BRLA 4ROPA 2HDJA 2D3LA 2A3AA 4UZUA 3GTXA 2GGGA 2ICSA 3O7UA 3K30A 3TXVA 2C0AA 3NDYA 4C1LA 4IPPA 1D3HA 2PDMA 3EDFA 1DIOA 2DGAA 4GXMA 1SZFA 1UUMA 2BP1A 2YA2A 1OF8A 4UQAA 4O1EA 4H4ZA 1GPFA 1Q8JA 3HQNA 1LQ0A 3M0YA 3CMFA 3LSBA 2BSLA 2R1NA 5EMMA 4Q8TA 4PCFA 2DUAA 4B16A 3FXYA 3TTYA 4O8RA 3T0DA 3ZWTA 1BRLB 2PPGA 2P10A 1EJVC 4H6RA 4JFTA 4LB4A 2PLMA 5PTDA 3O6CA 2GUUA 4GCAA 3TN5A 2NQZA 3P60A 1LLZA 3W9ZA 5HPOA 4H4YA 4Q8MA 2JBMA 1DJNA 3LLDA 4LF1A 4RZBA 4GNJA 3SCRA 4Y9PA 4KEZA 4PFHA 3TN4A 1VPYA 5DEZA 3KDNA 3VGFA 2F2KA 5D9PA 4EWND 4JFVA 3S1XA 5LA0A 3R94A 2WKJA 4H9XA 1JL8A 1R3YA 4K37A 1Q13A 3TC3A 3WQOA 1GRTA 3R0KA 3WDIA 2H9AA 3W7DA 5A6SA 1XXXA 1KFLA 3I4EA 1OFPA 1NTHA 1Q6CA 2CXEA 3F1QA 1OABA 3GD6A 3S3GA 1W3TA 2DSUA 4X9SA 4A6GA 1MRQA 3H70A 1UG6A 1S2AA 3W72A 3WNPA 1AH4A 3BOLA 5AYYA 3WUEA 1R87A 3P8JA 3N6HA 4OQVA 1W91A 3D47A 3OBEA 3ZXWA 3VGGA 2X1IA 1EBDA 4QS6A 1UP3A 3R11A 1OJXA 2JGQA 1E3ZA 3ARRA 3O07A 1IXPA 3FDGA 2DVXA 4P8VA 1XW8A 4RE3A 3LCFA 4HCHA 1I6NA 1TX2A 5A6LA 5A6AA 4D6HA 4J9JA 3TWAA 3HG5A 3FLUA 2NLYA 3IAQA 2HJPA 3O05A 4QNWA 4RUBA 1H09A 3ZR5A 2RH9A 1WYGA 4Y7EA 3BW2A 1GHSA 1TQXA 1BXBA 1XLLA 4Q8WA 3GHRA 5C2XA 1SW7A 3LCIA 4MB1A 2ZUUA 4NJIA 4WKAA 1BF6A 3C0QA 4AYGA 3UEQA 3BXWA 2Y4SA 4YWIA 1XIIA 3AZTA 1HJWA 3QPZA 4UR8A 4CCDA 2VRJA 3HV9A 4I6KA 2HMCA 4XSLA 4FIRA 1O5QA 3IEBA 3LQLA 4M52A 2HCVA 5AVNA 2E8YA 4GXWA 1AW2A 1GJUA 3E12A 4HU4A 1K1DA 4WK9A 3DK8A 1AJ2A 4F9JA 3R0UA 2EPKX 1Z41A 1JUBA 1CDGA 3ARQA 2VXNA 1JZ3A 1X39A 4M5PA 4AWSA 1S5MA 4XAPA 2X2YA 4CNNA 3WQFA 2WCAA 2E6DA 3GTIA 1V03A 1TV7A 5D33A 1HJXA 3A9IA 3E3HA 5I09A 3G3MA 3ATYA 3HG2A 3NVDA 4TQTA 3EYPA 1S5TA 3CQHA 3LXBA 1Q63A 3GVRA 1G01A 1YIXA 5GNYA 1LBFA 1SO5A 2W54A 1B4KA 4ZMGA 3K1GA 1SPQA 4YYFA 5TQLA 5A94A 5AHEA 1H0GA 3LGDA 5MF5A 2XJ7A 1RQEA 1NF7A 1HKVA 1FFQA 4XD4A 3USBA 5LA2A 2H3BA 2Z2BA 3VPLA 4DUWA 3MYOA 1ZSXA 3EDDA 3GB6A 5JU6A 3GXNA 3JR2A 2D0HA 2D73A 2IQDA 4PZVA 1L6GA 4V28A 2V5LA 3PPCA 4JX6A 2CXGA 2V5CA 1GKRA 3C61A 1MW0A 1NWRA 2GVGA 1TSIA 5IFPA 3P14A 4JAWA 1JCLA 3FS2A 1WUFA 2WNZA 4MYAA 4LAMA 1MEIA 5A6BD 1OK6A 4CU8A 2WHKA 3FFSA 3DHFA 3POHA 2QJIA 3TOYA 1EP1A 1Q45A 3UPBA 3RLVA 2Z26A 3AROA 3C0LA 4ZB0A 1GEQA 3IUHA 4C5YA 1WXJA 3ABSA 4CKQA 3DIPA 5LXXA 4AD2A 2HNEA 3EXSA 3WLPA 1XM3A 2WHMA 4XIAA 1ZMCA 1MNZA 4O57A 1AW5A 3BZGA 4Q8UA 1VF8A 3AIUA 2A3HA 2WSKA 1BAGA 1A47A 1AQFA 1B57A 4Z2JA 2WSRA 2I17A 5CGMA 1TO3A 2PD9A 1JEZA 4FIQA 4B90A 1VYSX 1OQFA 4KWWA 4WOQA 2E09A 5DBTA 1N62C 4UTMA 3QGAC 1I2OA 3GXDA 1ODZA 3OBAA 4GE8A 2QJJA 3EZ4A 3EWZA 2D2HA 1OWQA 1PJ9A 1S3HA 4LVDA 3VCCA 4D1JA 1ZU8A 4LUSA 2PTYA 3HPXA 5BROA 2QCMA 2RGLA 1EC8A 3QPYA 2Y1HA 4PMDA 2EO7A 3G1DA 2UBPC 2YX0A 2ZICA 2RJGA 3C0SA 3ARTA 4UTUA 1RALA 2X7WA 4YLWA 3B0VC 3QGKC 1OFAA 3IGXA 1C8VA 2ZFAA 4RE2A 1QMLA 3PTMA 1V6XA 4IPLA 1I0DA 2NXGA 1Z44A 1E71M 2CDUA 4E4FA 2G3JA 2IS7A 1GVRA 1K8XA 3I65A 3QOMA 4DX3A 3B8UA 1IEIA 2UY4A 4GZJA 1KXTA 2PP3A 4TMBA 2VZUA 1OSEA 5B7ZA 1QWGA 1UJQA 1Q6LA 5GJMA 4IJCA 2QCGA 1OFRA 1Q6EA 4FA3A 3LD5A 5L6UA 3JZEA 1A3XA 4DB7A 5BXTA 4FNPA 1QASA 4H7VA 3TW6A 5CC6A 2D2GA 3GXFA 2DW7A 2VMFA 1W9PA 2AKMA 4DLFA 1GV4A 2R1PA 4AB4A 3RITA 2ZTKA 2CEQA 3WD0A 1R9XA 3WF0A 3KZSA 1ZBKA 3C2EA 2Y70A 1HL8A 4HCDA 3WMLA 1A49A 1XGEA 2WOVA 1LRNA 1GYNA 2HEJA 1XIDA 3COTA 3UG8A 5A69A 3M1ZA 3LTYA 3IV8A 1WDPA 2BXYA 1A5SA 2YDAA 1B90A 2XH7A 4LWWA 4WKHA 4PB4A 4M80A 2QNEA 5AYIA 4WSKA 1FWWA 1JNDA 1VJSA 1UIOA 4N9CA 1WCGA 3H7UA 5LHEA 1GNXA 2OODA 3OHMB 5CPTA 5HMFA 3S6TA 3BLLA 2VJXA 1OK4A 1T7LA 1QT1A 3E2QA 5E0FA 5FF7A 1CI1A 1BG9A 3C5QA 1H61A 6XIMA 2ZXBA 1ONRA 2OZTA 4DI8A 3C8FA 3G6MA 4BS0A 1VH7A 5C70A 1JVNA 1BYCA 1XR2A 1MNSA 2WMJA 3Q37A 1ISVA 2VZVA 2SFPA 1HJVA 3ISIX 3KVLA 1CYGA 3CAKA 4GFSA 3HPFA 1ZY8A 5G2WA 2EJAA 1X2GA 5F1VA 1TJ0A 2GJNA 4DM1A 4QG9A 3U3HA 4H50A 1IHIA 1EWEA 1CENA 3PB0A 4B9YA 3PJUA 5AHFA 5AY7A 5E93A 5DY2A 4XZIA 3NL3A 2ZVRA 3N2TA 1EUAA 4M19A 1H50A 1OEPA 1JF6A 1G1YA 1QNQA 4Z42C 4AD4A 3PFRA 3LRLA 3IUIA 1DXFA 1UP0A 4U10A 3CUGA 4FS9A 1NHRA 3RO8A 1KD0A 5BOFA 2ZX6A 5LSMA 2X8HA 4NVTA 2YGYA 2WSPA 1CXIA 1TREA 7A3HA 1EYWA 2J7DA 3HG4A 5EA9A 1RP8A 2TPSA 5HQLA 4NILA 3W7EA 1TKKA 1P1MA 4JTJA 1XRFA 3UYIA 3CQ0A 1BLIA 2ABAA 1CT5A 2F7FA 3LHYA 1I60A 4CN4A 2Z1XA 1VFFA 4C6JA 1M6JA 2RKXA 5FS8A 2ZRWA 2QJHA 4LV9A 4X2RA 3AHXA 3EDEA 3H22A 1DV7A 4OIFA 1OB0A 5IDIA 3N2CA 1GTHA 2WXDM 3SRKA 2XFFA 5HWJA 1Y5VA 3EMZA 3CGBA 2KZHA 2GL5A 5A6MA 3MHGA 3BW4A 2V82A 3WBXA 3WMSA 3S9IA 5K9CA 1UH3A 4TVCA 2Y62A 3IWPA 5BXPA 3D46A 3O9NA 1STZA 1QPRA 4A3YA 1G9HA 3LK6A 2J7GA 2FZNA 2EJ1A 2QCEA 5FA5A 4QM1A 5JXQA 4GABA 4UFMA 4GOAA 1J2BA 2VD9A 2HS8A 1UYQA 3V18A 4PUDA 3NQ6A 1T5AA 2ISDA 1Q8AA 3WX7A 1BZLA 2WPCA 1K3UA 2Y7DA 2IXUA 4WDXA 3PULA 3SQLA 1ICQA 2CHNA 4ASTA 2GK1A 3F2CA 2FB2A 1C90A 3ABQA 3U9IA 3OQEA 2WJFA 3GYEA 2CZVA 1TPDA 3DZ1A 2ZZCA 3NQDA 4JCMA 1M6IA 4GUJA 4QCFA 1GZ1A 1PZ3A 3A3XA 3WLJA 1KGWA 3IJIA 1NPXA 1KM0A 1FFUC 2CHOA 1DWIM 2YVGA 3WDJA 3AMKA 1VIZA 2MANA 1JZ7A 4ILSA 1VPXA 3AISA 2WOIA 2FDSA 4O1AA 3L23A 2BTMA 4L9ZA 2ZZ2A 1GOKA 3W1LA 1NHQA 3LG3A 5H2ZA 2GK1B 1TX0A 2ZZBA 4HA4A 1XBVA 2OPJA 2J27A 5A3HA 1O1ZA 2XZ9A 4B5UA 1L0PA 3GYCA 2IW0A 5EB8A 1ADSA 4P7QA 3VIJA 2CZFA 1A5UA 1HVQA 2YSWA 3N17A 4W9TA 2CBUA 1Z7AA 1G4EA 1LRQA 2YW3A 4E6MA 4OU1A 2Q01A 3LUTA 3H2MA 2C3CA 1WXZA 3HJZA 1VAHA 4CN1A 1FBAA 4RL3A 3OP2A 1TUXA 4S38A 3UR8A 3WD2A 3FKRA 1UIPA 4GQGA 5FJRA 1Z89A 3H4XA 3BO9A 1UD2A 3P8IA 1ME8A 4L4PA 4GUHA 1JD9A 4B91A 5BXSA 4FMVA 5C9RA 2CLEA 3RILA 3MT1A 2YXGA 3AXMA 4H2CA 1OC5A 1F3WA 3VZYA 2ZX5A 1CCWB 2F6UA 2IUZA 3GXTA 1VFLA 1H1ZA 2CZ5A 2V69A 4Q6JA 3NTYA 3M16A 3CWOX 4FNTA 3N25A 5C0QA 4DUXA 3LXDA 2PWDA 3BL3A 1XYZA 4S1FA 1DP0A 2QAPA 1E0WA 2A6NA 3PR2A 2PDWA 3SGZA 2CLPA 2J13A 3TTOA 3PANA 5F2MA 2F5ZA 2OMAA 2NXIA 4FX7A 2QAEA 3QZEA 1FDYA 2CITA 1FA2A 3VI2A 3OLGA 4AG0A 1ECEA 1WE5A 3BW3A 1S1PA 2FVKA 4AY7A 1VCFA 5G4EA 4FLQA 2EKGA 1K8YA 4JQ1A 3WLRA 4FSAA 4GYFA 4W7UA 5CZSA 4LUYA 3FNDA 4R7OA 4H9VA 1HW6A 3AMLA 4M0XA 3EEZA 4M29A 1UA7A 4F0MA 1SJAA 2W27A 4PTDA 3KUMA 1UKQA 2DY3A 4FF7A 3WH7A 3CT7A 3PZMA 4K1GA 2G3FA 4QG8A 3M0VA 2J3NA 1R3SA 1YADA 3E38A 4DYEA 4WX2A 1YTEA 4GXPA 1EJSC 1CGVA 3S2NA 1N60C 4X2PA 3GG0A 1W3LA 2J6XA 2OGYA 4Q4PA 1HN1A 3TKFA 4GKLA 1Q85A 2BS9A 4AIEA 4O52A 3TWBA 3FAXA 1KTBA 1IE7C 4UNKA 5TNVA 1XIBA 1GQKA 3ITXA 2VR2A 5LIKX 3E96A 1KM2A 3UZZA 9XIAA 4Z0SA 4ORIA 4B15A 5LGZA 2JEPA 5ABFA 1ZK7A 1ODUA 2O9RA 1QW9A 1E51A 2V5KA 3OPSA 3FG2P 4ZFCA 3AIEA 2V6OA 1JQVA 4AHOA 3L5AA 4Z1CA 3VX0A 1A80A 4W7WA 3DENA 3VIIA 1OADA 1FWFC 4LUIA 1VFUA 1SFSA 2J77A 1HXJA 4URIA 3Q67A 3JUGA 4JTHA 1YX1A 3MUZ1 3KBSA 3A7AA 3VIMA 5AYZA 2EQ8A 2VFGA 3OZPA 4XKMA 2D2OA 4ADUA 1XRVA 4AIBA 2A3EA 3QH2A 3CEPA 3T8LA 4JEQA 1WV2A 1K6AA 3W70A 5ABFB 1WDDA 2VT0A 3GDRA 3LCLA 5I06A 4ZO8A 3PSVA 3R2GA 2DT3A 1Q6DA 4DELA 2V68A 3A24A 4CLMA 4HN8A 3W74A 2WANA 3QM3A 3E74A 3HMCA 4GISA 1QPOA 5GNZA 4YTSA 1EJWC 3UJRA 2FPVA 2NX3A 2JK2A 2WC7A 3AXKA 4UFLA 1NDVA 3THQA 4EMWA 4W5UA 2QYGA 4IMEA 3UNDA 1QXLA 1B2YA 2J78A 2GSHA 5EMUA 1VD6A 1R9ZA 5K7JA 5CZJA 4XTIA 1TVNA 2YKKA 2JFEX 4FEZA 4O15A 1GEHA 1L6YA