3FVDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
361
Chain Sequence
SLRITRLTVFHLDLPLAKPFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a member of enolase superfamily from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
rcsb
source organism Roseovarius nubinhibens ism
molecule tags Hydrolase
total genus 117
structure length 361
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fvdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fvdA01
3N4FA 3FJ4A 1P43A 3H7VA 2QQ6A 4GGHA 4IZGA 2XSXA 3NFUA 2PMQA 1F9CA 2OQYA 3N6HA 2NQLA 3TWAA 5IDZA 3Q4DA 1PDYA 4ENLA 1L8PA 4IL2A 4E4UA 2ZC8A 2PTYA 3D47A 2OZ8A 4J1OA 1EC7A 3PK7A 3IJQA 2P8CA 3TTEA 3UGVA 3IK4A 2HXUA 5ENLA 3MSYA 3FXGA 2PSNA 3DG3A 3DFHA 3MY9A 3R25A 1ECQA 2XH7A 3H70A 4A35A 4K1WA 3P0WA 3VC6A 2OO6A 4GISA 3GY1A 1EC9A 1MUCA 3P3BA 5FJRA 3ENLA 5FJOA 3QTPA 2POZA 2PCEA 3VCNA 3DIPA 2OZ3A 4DX3A 1MRAA 1E9IA 3QLDA 2PPGA 3BOXA 1JCTA 3EKGA 2OKTA 3R10A 1RVKA 4GMEA 3DFYA 1NU5A 1ELSA 3VCCA 3K1GA 4KPLA 2QJNA 1BQGA 1KKOA 3TJ4A 2RDXA 3CAWA 2XH0A 3UCDA 4DHGA 3OPSA 1ONEA 2AKMA 3GD6A 3KUMA 1FHVA 3NZGA 3R1ZA 1JPMA 4Z17A 2AL2B 1EBHA 1SJBA 3S47A 2XGZA 3VFCA 2GGHA 4DN1A 1XS2A 2PU1A 4HPNA 4M0XA 3JVAA 3I6TA 3T6CA 1EBGA 3ES7A 3TW9A 3MUCA 3B97A 2FKPA 2AL2A 3T8QA 3HPFA 3GO2A 2MUCA 3DG6A 1JDFA 2XH2A 3QKEA 5EU9A 1KKRA 3VA8A 3N6JA 1KD0A 3PWGA 2ZADA 3MZNA 3STPA 2OFJA 1PDZA 3CK5A 4IP5A 4IP4A 2FYMA 3IJLA 3ZVHB 3H12A 3V5FA 4MGGA 2PTWA 4EWJA 2P0IA 2OLAA 3CB3A 3IJIA 2GL5A 3TWBA 2PU0A 1TKKA 4HYRA 2O56A 3ZLGA 1BKHA 4H1ZA 4GFIA 2GGGA 1EC8A 2PS2A 4HCHA 3ZVHA 2P3ZA 1JPDX 3P93A 3OTRA 4H83A 3CT2A 4E6MA 4YWSA 3TOYA 2QJMA 3DGBA 4JN8A 3DERA 2QGYA 4KWSA 3RITA 3OW1A 4A3RA 2OQHA 5FJTA 3UJFA 2PTXA 3CYJA 1FHUA 2OZTA 3UJEA 4IT1A 2QDEA 3UJSA 2QDDA 3SN1A 2QJJA 4HNCA 3TQPA 1P48A 2CHRA 3FV9A 3ZVIA 2ONEA 2OVLA 3ZLHA 4H19A 3QN3A 2DW6A 3OZMA 2PP1A 2PP0A 3I4KA 3U9IA 3D46A 3RR1A 5FJPA 1SJAA 2P88A 3FCPA 4JN7A 4A6GA 4ZA0A 2HXTA 2PGWA 2P8BA 3TJIA 3UXKA 4GIRA 2PA6A 3VC5A 3SBFA 4MKSA 4FI4A 3JZUA 1TZZA 3THUA 3MWCA 2AKZA 3U4FA 3V5CA 1MNSA 1W6TA 3EEZA 4E4FA 3SQSA 3PFRA 4HN8A 4KT2A 4HCDA 3RGTA 7ENLA 2OG9A 2QVHA 4Z1YA 4E5TA 1WUFA 5J04A 3JW7A 2GGIA 3DEQA 3DESA 3DG7A 4M6UA 1XPYA 6ENLA 1SJDA 4GYPC 3NXLA 3MQTA 3VDGA 2GSHA 1R6WA 2HNEA 3UJ2A 3BSMA 3DDMA 3MKCA 3SN0A 3CXOA 3Q45A 3SN4A 3OZYA 3R0KA 2MNRA 4ROPA 3FVDA 3PWIA 1DTNA 1NELA 2DW7A 2GDQA 1YEYA 4JHMA 4DWDA 3UXLA 4G7FA 3UCCA 4F4RA 4IHCA 3TCSA 2PODA 2PGEA 1TE6A 3FYYA 4IL0A 3UJRA 4J3ZA 2I5QA 3SJNA 1WUEA 3S5SA 3R0UA 3OP2A 3GC2A 2AL1A 1SJCA 3ZLFA 1OEPA 4K2SA 2PTZA 1MDLA 4H2HA 3N4EA 3BJSA 2OPJA 2GGEA 4HCLA 3T4WA 1R0MA 3RO6A 4G8TA 5FJUA 2PP3A 3T9PA 5BOEA 1MDRA 2GGJA 4MMWA 4DYEA 3R11A 3I6EA 3ES8A 4KEMA 4E8GA 4GYPA 3RRAA 3QPEA 4FP1A 4HNLA 5BOFA 3V3WA 1KCZA 3H8AA 2OX4A 1IYXA 4K8GA 4DXKA 3SSZA 3V4BA 3RCYA 2HZGA 3NO1A 4X2PA 4ZCWA 4GGBA 2XH4A
chains in the Genus database with same CATH superfamily
4CNOA 5HR7A 3L23A 4JTUA 1LOQA 5I09A 5EMJA 3BOFA 4F0SA 3EB2A 4D6EA 2C14A 2QPSA 1LBFA 3NDZA 1ADSA 4FXJA 5M03A 3A3WA 3VU2A 3VKBA 2HQMA 3EDEA 2QV4A 3IAPA 4PMUA 5EKYA 3CUZA 2NQLA 4LCQA 1KXHA 5TNVA 1C9DA 5EGRA 1XPGA 3ANYA 1OBAA 1NP0A 1KGWA 3NPVA 3NQDA 4G9PA 4UR8A 3CUHA 3KM8A 1VYRA 4QLJA 3H7UA 4MYXA 1HGYA 2NLYA 4R7JA 1DVJA 1JCLA 2YW4A 3GG1A 2X0HA 3B9AA 1SFLA 3H4WA 1EA0A 3CWNA 1EPXA 4CD8A 3KZPA 3SIMA 5ENLA 3MDWA 1T7LA 1HP5A 3VVGA 4YTTA 1J0IA 1EJXC 5D8ZA 4O10A 4D8ZA 2Q02A 1BZLA 2OYMA 3MY9A 2Y70A 1PIFA 4UWMA 1UC4A 4HTYA 3MP4A 3AMLA 2BGSA 4GISA 3LHWA 3UF9A 3HA1A 4MADA 4YVPA 3AU6A 1B3ZA 1VEOA 3N3MA 1I60A 4GQBA 1RQEA 1JPIA 4C1LA 4GK8A 5FJOA 4W8BA 4Q6XA 4AF0A 4KCWA 4I9AA 3B4YA 1A3XA 2E5DA 2YYTA 4DUOA 1E6ZA 2C1GA 1JDDA 1KW1A 3DFQA 3VM5A 5LKYA 5EMLA 1IEVA 1GOWA 4EMIA 1XG3A 1ZL1A 3M47A 4PMQA 1MQPA 3G1HA 1VEPA 3F4DA 1UW9A 1NOFA 3L68A 1E6RA 2POTA 2YXOA 4BQ3A 4OBTA 3BC9A 3IIPA 1OABA 2XYLA 3VIMA 4EMJA 4J3WA 1YE6A 4HQVA 1WE5A 4A22A 4LV9A 5JBDA 1GGOA 3NYDA 3CZLA 3WFLA 1IXQA 2ZZ5A 1ISZA 3BAKA 4XZNX 6XIAA 3HN3A 3CMGA 4WGHA 1C7TA 4Y6GA 1XS2A 3WQWA 3NVTA 2PU1A 4HPNA 5KVHA 2C1IA 3ORWA 1DXLA 4MG4A 1W9PA 4JCLA 3W3OA 3T8QA 2HE5A 4GH3A 1T5AA 1QPQA 2NXGA 4QTGA 1R3YA 3KBNA 3DXIA 2VQUA 1XRVA 3LHZA 2JE8A 4CUCA 1C3FA 3TC7A 4ZXOA 4MZYA 3PBYA 4L1WA 4L7ZA 3W6MA 3JU2A 3P61A 2FDMA 3M43A 4RW5A 2BDQA 1H2IA 1EO7A 1S38A 1FWDC 3IJIA 1OT2A 4CNPA 1B3OA 1Q85A 2V5KA 4S2BA 1G7VA 1V77A 2OTDA 3KHDA 5HULA 1BRLA 2WPGA 3VOIA 1VYPX 5T9BG 3A3XA 5A69A 4H6RA 5CCZA 3RM4A 1XM3A 3HFTA 3R8RA 2Z1BA 4FNSA 3TOYA 3GFZA 3WNNA 3CIVA 4JN8A 4ZTYA 1D2KA 5EFFA 4ZB0A 4XZLX 2P5NA 1TMHA 2WANA 4IFKB 3W01A 2DT0A 2GJXA 4LY8A 3B8WA 2I5IA 4F2UA 1VGAA 5JMUA 5A8NA 4ZOHB 3FKKA 2B7PA 3P14A 1EF3A 1ODZA 1ZSXA 3QFEA 2X7VA 1V3IA 3MP3A 4M81A 4G7EB 3UYIA 4CQAA 4ZA0A 7TAAA 4KWUA 5C9UA 1W3HA 1F3TA 4GC4A 4D8LA 3PN8A 1XC4A 1UR9A 1XIEA 4JTHA 2ALRA 3W72A 1A5LC 3AHYA 4AWUA 1NDYA 3UPBA 2EQ6A 1UKTA 4P2VA 1FWFC 4Z1YA 3UD6A 2HVNA 3R8HA 2O55A 3RM9A 1A0DA 2XM2A 2VEGA 3DG7A 1XPYA 5DMNA 3DENA 2Z1KA 1H50A 2WOIA 4ONVA 1B3XA 2HNEA 3SCNA 4BWLC 3DDMA 3CGCA 1H7XA 1FWNA 2VC9A 2IPGA 2ASHA 2WZTA 4AZHA 2XIMA 2JQXA 1GRAA 1K8ZA 1PV8A 3NR0A 4OOZA 1RD5A 3BG9A 1L9WA 4AIOA 1ITUA 4JTKA 4PUUA 3WMLA 3GNNA 2PC4A 4BQ4A 1P6WA 5CSRA 1W3IA 4J3ZA 4YYFA 3ELFA 3TAKA 4ACZB 1ONXA 3RN6A 1CT5A 2YA1A 3C2VA 3WLHA 3UPMA 3AI0A 1VCVA 1TO3A 3C8FA 3DKLA 3LMYA 5ABTA 1A5MC 5GRTA 2W79A 2YB1A 3R5EA 1Q5MA 4IJCA 2PTZA 3KL0A 3P7YA 4E2BA 2GGEA 1ZALA 2J79A 3GD4A 2VFIA 3RX3A 4TX6A 1VCGA 3QGKC 3VOFA 3BZGA 4JL1A 4QE5A 3CHFA 1XC6A 3W81A 1Y8BA 2I17A 1LROA 3ZJ6A 2QS8A 2CFYA 2XDFA 4KWOA 3ES8A 2Z2AA 2PURA 2WLZA 1Z48A 2OR2A 3QHMA 1ALDA 1KQYA 4FEZA 2RDUA 3AHVA 2F6UA 2DSVA 5CZTA 3PPGA 4YTSA 3QOMA 1SZRA 5ABFA 1NOUA 4BI6A 4FDCB 5HMSA 4QG8A 5D9OA 7CGTA 3DHFA 4ZCWA 3S3GA 1CB2A 5G4WA 4H4TA 1BGGA 5I02A 4QS5A 1H63A 1YNQA 4O13A 1XWYA 4LW7A 3BMWA 3S2NA 3SCOA 4JTJA 4QEEA 1KM4A 3MI6A 2X2GA 1B9BA 2OQYA 3HGJA 5SWUA 2BOEX 1PCKA 1O94A 3NTYA 1Z69A 2QUVA 1ZP3A 4H8UA 5IDZA 3CQJA 1VQZA 4IX2A 3I3EA 3O0HA 3OG3A 3AHZA 4UQEA 1EHNA 3EYPA 3G1FA 1WZLA 3QXBA 1X97A 4JCMA 4XD3A 4D72A 1RLCL 3A22A 4XD4A 3SADA 1IT8A 3GIPA 4L4OA 5D2TA 2A7NA 1IXOA 3WD2A 3TN3A 3BV4A 1K9TA 4FX6M 3L12A 1HZYA 5A2AA 3EZ4A 4LALA 3MB9A 1ZY9A 1ECQA 1R9YA 4MSSA 4CQ8A 5DT7A 4HU3A 3AHTA 1W9XA 3GVWA 3WELA 4KKXA 4JNMA 5CAKA 4XSMA 1NQ6A 1F5ZA 3AXHA 4JFSA 5IXEA 1KCKA 1I6NA 1MVYA 3I10A 1XJBA 5G1YA 3E0LA 3CMJA 3G1RA 4DX3A 3ARRA 3M6YA 2NX9A 4BY3A 1TWWA 3HGSA 4NP7A 1XDLA 1W1B1 3MTWA 3R10A 1KTCA 4IPLA 1NU5A 2G95A 3EKZA 1JUEA 2J7GA 5I23A 1QHZA 4B5UA 4LYQA 1DQWA 4ZXLA 4B3KA 4CQBA 3W6YA 4CU8A 2NX3A 2YDQA 2C3CA 3VE9A 1E15A 3ZWTA 2BVYA 1GQNA 3VINA 2ISWA 3NZGA 4IWWA 3LU2A 2FJKA 3KZSA 3HPXA 3LCWA 2XGZA 4N7QA 2A3BA 4DN1A 3WQDA 3DFTA 3CQHA 4CEXC 3HIJA 4GRTA 5CAHA 3L9CA 4RZ4A 4D8AA 3T6CA 3NSMA 3IGXA 4F48A 4W89A 4OUEA 3KLLA 5IHSA 1HUVA 1UD2A 1JVNA 4JHOA 4O54A 2E3TA 3IUHA 4PGLA 3MP5A 3PF3A 1SQ7A 3TZFA 3ONCA 1UA3A 3N11A 3WX7A 3D3AA 5K4XA 4WXYA 1H61A 1E3ZA 4B90A 1PDZA 2GJLA 3I7SA 4HOWA 1JZ8A 1VBHA 3B0XA 2VFGA 1YNPA 3L2MA 2PBOA 2BODX 5DXYA 4PTNA 3E5BA 3OIXA 3V0UA 1L8NA 1ZJHA 2FB2A 4C6QA 2J27A 4PFMA 2E25A 3SCTA 3ABZA 2I5GA 2O56A 3M44A 3Q67A 3QW4B 1BTMA 4QQUA 4B5TA 4D1JA 2Q3OA 1NHQA 5JQ9A 3N17A 4AD4A 1ENUA 1N8FA 4JFVA 3W4RA 3AJXA 2NWRA 2IXUA 2P3EA 1TRDA 3UVAA 2NSXA 3CHVA 1W1YA 3PZUA 8TIMA 2HPIA 2BTMA 2DH2A 2OZTA 3DC0A 4AHPA 4IT1A 2A3LA 1ME9A 4LWWA 3MT1A 9RUBA 3E02A 5AHMA 4Q8TA 1UR4A 5CC6A 1G9HA 3DGRA 4EF9A 2XFWA 4EK7A 4GRSA 3T05A 1RVGA 2O9TA 5B7ZA 4B9ZA 3E0IA 1V3LA 2HXTA 2F7FA 4DUVA 1J9YA 4S3BA 3DH9A 4CLMA 1E0WA 4PMOA 4CKQA 2D69A 3NAVA 2DPEA 1P0EA 3LHTA 4D6FA 3LV5A 3W1XA 2PDQA 2Z6IA 1WYIA 2NQZA 2EO7A 2FLIA 4HK7A 1Z44A 4HCDA 2ATMA 1TJPA 3QJAA 4ICNA 4NNCA 1DE6A 4UZSA 5FI8A 3DH7A 3RK8A 1QCWA 4LS2A 4CVWA 1YYAA 3WK3A 4AIEA 4MHBA 1EDQA 3CHDA 1JDEA 4JTCA 2BY2A 5A8MA 1FCQA 3PTQA 1XSJA 5A94A 4N9CA 1XGZA 3QYSA 1V6WA 3B0VC 1XD1A 1EB3A 3EPMA 5FKYA 4X0VA 2PAJA 4JX4A 3T44A 3GYCA 3Q45A 4CN1A 2RFGA 2OOGA 1N60C 4HZ8A 1M03A 2PF8A 1WZKA 2TYSA 3THCA 1UUMA 1W17A 4HNTA 3VGBA 3ITXA 2CBVA 1N55A 4NJJA 3AS3A 1VFLA 3SUSA 3F2BA 2X50A 1CI1A 3F5KA 2XIQA 3LNPA 1K03A 2CBIA 3OA3A 3AIRA 4LUIA 1TWZA 1BTCA 1J12A 4WSKA 2QCDB 3LA4A 5A8GA 3MUAA 3GLCA 3MCMA 1MUMA 4LVFA 4ML4A 1OFEA 3ZO9A 4ZQOA 1O5XA 2BASA 3OLEA 4GVGA 2J7FA 4X63A 3N18A 1RXOB 3KCJA 4C6IA 1M7JA 1F74A 2XHYA 1Z41A 3AROA 3G3MA 4JIQA 1R2SA 4IOTA 3W1UA 4X9SA 3ONBA 1QPNA 1VJZA 3KVKA 4AISA 1XFCA 2G0WA 2CITA 1TMQA 1O5QA 1DWAM 2XVPA 2YCLB 1CGTA 2WNWA 2QEZA 3EAUA 4O12A 3L4WA 1UZ1A 2X7WA 4QAWA 3N2OA 3TJLA 2DIKA 1W3JA 3LXCA 1QPOA 1CLKA 3LCLA 2GK1B 3KOYA 4AD0A 4ADTA 1Q66A 3E38A 5HK4A 1QNPA 3NDYA 1D3CA 3RMJA 1RJPA 4EP8C 3IV3A 3NPUA 3LGGA 1ZZMA 3VKJA 1P43A 4IUGA 4H9YA 4WR3A 2EG8A 1IT7A 2PWEA 3OIHA 3SI9A 4NU7A 3CXBA 4PMJA 5EYWA 3CEUA 1PX4A 1GUVA 2VRJA 3TWAA 2B31A 2ZA3A 4AC7C 1K8CA 2RAGA 1HIZA 1HJWA 2YVFA 4J27A 4QSHA 2W0HA 2EPNA 2OZ8A 1U5HA 3W37A 4PTVA 3VNKA 5I00A 3BTNA 4Q6JA 2C13A 6TAAA 5F2GA 3OEXA 3MSYA 4OBRA 3LZ3A 5IOBA 4XISA 1GKQA 2VCAA 2EPLX 1G67A 3S1WA 1MSSA 3H70A 4A35A 3FHQA 4FA3A 3D3FA 3GTFA 4YHEA 2Z28A 4AEEA 5KZ6A 4H9ZA 3W1QA 5DBTA 1GQJA 3AIQA 5F7UA 3HQ1A 1I2QA 2PB1A 2ACUA 3IGSA 3JZEA 5A6KA 5DBUA 1G4EA 1IR1A 1TPH1 1MUCA 2ZX9A 4WDWA 1DORA 1UOZA 2J74A 2J8TA 2J47A 2YPIA 4GNKB 2W67A 3P0XA 4HHPA 3BOXA 2VT0A 4PCSA 5I3DA 8RUCA 1RD6A 1NFBA 1YPXA 3DFYA 3QQ1A 2YA2A 4XWUA 1Q6QA 3EPOA 3VCCA 3K1GA 3DGZA 3NRZB 4H9MA 3NQBA 3GH5A 1DQUA 3P84A 4XZ9A 1F3WA 2ZZ2A 4AD2A 2C91A 3H55A 4H01A 5I3KA 1VPYA 3OPSA 5C2CA 3N29A 2PDBA 3VZYA 5G2WA 2AQVA 3B8UA 5C2XA 1KBJA 2Y2WA 4QDWA 4OQVA 3GXFA 3TROA 3UBPC 3WL0A 1DWJM 3MO7A 1EP2A 3THAA 2GR3A 3M0VA 4F0MA 4S1FA 1NDZA 4S3KA 2DDXA 2TRSA 4IQJA 1S5MA 1XUUA 4O28A 3WUFA 3SJ3A 5BXPA 2C6QA 1JDFA 3VKCA 3PUDA 2J6VA 2XSAA 3SQMA 3N6JA 1GZ1A 3BXWA 1XDMA 4UOZA 3MZNA 3WH7A 4DXXA 4IP5A 3ETRB 1UYQA 4HMEA 1W31A 1NOWA 3TE9A 2HROA 3IJLA 3MS8A 4Y96A 3ZVHB 5CGQA 4UMCA 1FA2A 3UU0A 1QPRA 1TA3B 3HU7A 1C93A 2Y89A 3TLLA 4PB3A 1A4LA 3WUGA 3S1UA 4AEFA 4DNAA 1TPC1 3CQ0A 3WL1A 2VYOA 4Z1DA 4TVYA 3BICA 2ISDA 4E6MA 3NPXA 5F1UA 4E8CA 1V02E 4MDOA 4KWSA 4TV5A 1JDAA 3BSHA 3VIGA 3CPUA 3EX2A 1XRFA 2E68A 4K6AA 3UJSA 3PG9A 3PZQA 3ITVA 1R3SA 3QV6A 1QNOA 2ZWYA 2PDKA 1KFJA 4MWAA 5CPOA 3ECQA 5C0QA 5D33A 1Q8AA 3IWPA 1OFAA 1PX8A 2Z27A 1AMYA 2H9AB 3E2VA 4PMNA 2GUYA 3UT0A 4NQ1A 3LUTA 1F8WA 1IEWA 3ARUA 3GNRA 3SQLA 4IF2A 2VFHA 4CNNA 4H8HA 5BW6A 1H51A 3IRDA 4QQ3A 4I7UA 2NT1A 1A5BA 1MXGA 4IIBA 2PGFA 2ATSA 3WJYA 4IIDA 4I5UA 4F9DA 1EO5A 5LIYX 1E6PA 3L2LA 3PZMA 1VJIA 7REQA 1Y5WA 1XXXA 4M51A 2I56A 3UG3A 3W1RA 3EDFA 3WLTA 1XL9A 2Z2BA 4TVDA 4GQRA 1WUFA 2I9UA 2Y8UA 4B3LA 3NNTA 1PKNA 4MF4A 1SW7A 3N2CA 3GVQA 5C9ZA 4IFOA 3TSMA 4ATWA 1XLEA 1LL7A 1XYZA 1YPIA 2WK2A 4K38A 4B2DD 4LVDA 1E55A 3CWHA 1A3WA 4D6CA 4UTUA 1UP3A 1GVYA 2FFIA 1HX0A 3ANVA 3OZYA 5G4HC 3VAVA 1EX5A 3MO4A 3ZJKA 3NM3A 1WDRA 2PFHA 3BMXA 4NAFB 2WHKA 5HQEA 3LXDA 1WXYA 4NNAA 2YW3A 1ME7A 2TODA 1WXZA 4WKHA 3B8SA 1OQFA 5C70A 4WGXA 2I5QA 4Z2IA 2CKRA 4TU1A 4M6VA 3GHTA 1THFD 2WP6A 4BZYA 3MV11 3MI3A 4CD5A 1YW1A 1CLXA 4HNNA 2VURA 1MFUA 1BVNP 4AZ5A 2ZX5A 3BJSA 1DJHA 3KOFA 3WLMA 3NUKA 4FR6A 1U1UA 1I75A 2X30A 1DWFM 2FIQA 1E3XA 4HVXA 4REQA 3TEVA 2RDWA 1JYNA 1HJXA 2DT3A 4MMWA 4N02A 4QDMA 1X98A 5BXTA 1MRQA 1EPVA 2EQDA 2EPKX 3PBWA 3OOQA 1NVMA 2BOGX 1EP1A 3NOEA 4HTBA 5LIUX 4HA1A 4NT0A 3OB8A 1Q8JA 4GQGA 2QLYA 1OG0A 3UERA 2FJUB 4GI9A 5LXEA 1Z89A 3NG3A 1GPFA 3EDDA 4NEVA 4JS3A 3CLWA 1XIBA 4QNEA 4LFYA 1K7EA 5DCEA 1RCOB 3OVPA 1E4IA 2FMNA 4TMBA 1TB3A 3B0YA 3H7VA 4D6IA 1Q4WA 5FF0A 1UD8A 1W8GA 3RMEA 2OSWA 4JFUA 3CU2A 4IMDA 1PS9A 3BLPX 4WJ8A 2VC7A 3E6EA 3M9YA 3N9SA 2YDRA 1DIOA 4A3QA 4Y90A 5I3JA 2J7HA 3DZ1A 1QO2A 5AHIA 4HD5A 4FK9A 4NUWA 3UR7A 5I24A 1WBJA 1V5XA 2VJXA 3KRUA 2OGYA 3PK7A 1PX3A 3AUJA 1OC6A 1ZLPA 2GSEA 3SRDA 3IK4A 5BXRA 2HV5A 3AMZA 1IWAA 2VM8A 4WUIA 3A7AA 1GRTA 3DG3A 3DFHA 2GDVA 1H7OA 1LYXA 3QKZA 3R25A 1L2QA 1V08A 2G4FA 2TSYA 2V81A 3EA2A 2Z4GA 3BLDA 3UZWA 1N2VA 3NIYA 5BROA 3BANA 4EANA 1F8MA 3TYDA 2VDIA 4P7OA 4GJIA 1E70M 3GBDA 3A21A 4H04A 2J78A 2ZVIA 3GIYA 5LSMA 4AY1A 4PB4A 2WJDA 2BZNA 2VX6A 3V36A 1Q1RA 3IUDA 4HZ6A 3KTCA 3GAKA 2VVNA 3UESA 1Q6DA 3TAOA 3GXNA 2WVUA 2G50A 2VQTA 5E6ZA 2IKGA 2XH0A 4PH6A 5D9NA 3HGRA 5C9XA 4K39A 5IBXA 3VD4A 1EHAA 3AIVA 3S6TA 4FOKA 4EXBA 4FXSA 3WDIA 5G1MA 4W84A 5I7GA 4LSBA 2V3AA 4WOZA 3R89A 1CIUA 2KX9A 3WLIA 5AHLA 2VC5A 3E0WA 1QJWA 3MANA 4L9XA 3URQA 5KMYA 3I6TA 3NO3A 4Q8UA 4XG1A 3SRKA 3N14A 5BYWA 4UR7A 4RXGA 3H26A 4X9YA 1VLWA 4WDUA 2J62A 2UY5A 1VRDA 2XFRA 5FEXA 3OGVA 3CQKA 2UV8G 2CXGA 3B8TA 4CNSA 4YWOA 1FWEC 2AGTA 1AOGA 3M7WA 4RNFA 3B06A 2WPCA 3CHEA 4UZUA 3RNDA 3L4TA 4XV0A 4DZHA 3AYVA 1BD0A 3W82A 4AF0B 4C6FA 4UNLA 2QJGA 1TV4A 3N2MA 2YIHA 3P93A 4FF7A 1JL8A 3TJXA 1E4NA 1EJTC 2QJMA 3CIXA 1JPKA 1N8IA 2FZBA 2GVGA 1SFTA 2CC0A 3O8AA 4RR4A 1L2UA 1W3KA 1QNRA 2J75A 4H4IA 1KQZA 2CZVA 4XX6A 5JH1A 1TPEA 3MMDA 3DHUA 1GXFA 2WMGA 3EOUA 5HWMA 3LQLA 3VGGA 4O1DA 1ECEA 4M7SA 1EJVC 4GVHA 2DORA 1QI0A 2ZBTA 3RO8A 1GW9A 3VO0A 3DK9A 3F2CA 1X1NA 1AL7A 3D46A 2OX1A 3K46A 4P7NA 4GZEA 2IMRA 2AQWA 1W1VA 4U4MA 5B7YA 1EYWA 1EYEA 4IIHA 5DF0A 1FXPA 4ZOAA 1RM6B 4MB3A 1U2YA 4JQ1A 3E12A 2ACSA 4J5NA 2BHUA 2PA6A 3S2JA 5A8OA 1TYTA 3W1LA 3NS1B 1J0HA 1K70A 3WLPA 1CXHA 4Z2GA 3Q58A 3L4VA 2F5ZA 1R8LA 1FRBA 2GH5A 4AD5A 1ZUAX 3SGUA 3PBGA 4S3AA 3UWEA 1Y7VA 3APTA 3H2FA 2PE4A 3FGCB 2X0YA 3KX6A 2EGZA 2O7QA 2BNJA 3IANA 2QNEA 4PC8A 4WF7A 1QHPA 6ENLA 2Y5EA 2BLEA 2DZSA 3NXLA 1YBQB 3GXMA 2DJXA 1EIBA 1SVDA 3QYQA 4Z1CA 3L4UA 5A8QA 3B40A 3KOWA 5K3VA 1HKIA 2Q3RA 1SR9A 3CV2A 1CCWB 1CXEA 4AY7A 3WDPP 1DNCA 3SN4A 1J6PA 5G2HA 4BK9A 3KRZA 1X2HA 2HISA 3TQKA 4E2VA 5GVJA 2P76A 3IUIA 3FYOA 5JH2A 1FX6A 1AL8A 3UEQA 3VDAA 1J18A 2R82A 1TE6A 1TVPA 1GEQA 4IL0A 3BLEA 4YTUA 2P1FA 4HSNA 4PBFA 1AQHA 3R0DA 1REQA 4GY0A 4HMNA 4CQ9A 1GT8A 2REQB 1KBIA 3I7RA 1ZJAA 3ZLFA 3N2TA 1OEPA 1VIZA 2YYUA 4FX9A 4ZVJA 1LG1A 1O12A 1GSNA 3F5LA 4RV8A 1U5VA 3GIQA 3PB2A 1AJ0A 2VZOA 4PZVA 1VS1A 3PTDA 1TWDA 3AWOA 4PTXA 1HKKA 4Q8OA 1GQKA 2JGQA 3U7VA 3GWQA 3OLDA 1FY6A 5FS9A 2FB3A 1XH2A 3LY0A 2EQ9A 5A6JA 3SRHA 1GZJA 4Q8PA 1DJXA 1YQ2A 1FOBA 4GQQA 2PDWA 3T0BA 1S7MA 1SZNA 1UPPA 2GSJA 6ALDA 4GGBA 2Q01A 2XH4A 2I9EA 1HTIA 1A3HA 4ZB5A 2ZX7A 3N4FA 4C90A 4E8DA 3BLFA 2QT3A 2XU2A 3WQEA 3OU8A 2DVXA 2XSXA 4LCSA 3QGVA 3RLVA 2O9RA 2VEMA 1ITCA 4MLRA 3HF3A 5FS7A 3BCJA 2BGNE 3GD3A 2YLAA 5CXPA 4HZMA 2VEKA 4J3UA 3EANA 2E67A 1ZXIC 3VZXA 3RRXA 3AIEA 3CC1A 4OJYA 4J3TA 1B3VA 3LPFA 1UWAA 5HBFA 1EGVA 2Y7EA 2V3GA 2QCNA 5AN7A 4QCEA 4WD0A 4KMQA 5I3HA 4EMWA 1V6XA 3CTLA 1LTDA 1PIGA 3HPAA 4F8XA 2NVKX 1TTPA 3WQ6A 5EMYA 3TTEA 3BLKA 3OYXA 3PWAA 2YX0A 3ARSA 4V2XA 2NQHA 2YBTA 4UMAA 2PDIA 3GVVA 3CQIA 1QOXA 4JEQA 4LVAA 3GHSA 1EA9C 4JR5A 3RF9A 1K3UA 4LJ3A 6REQA 3XINA 3W1AA 4AXKA 2J9XA 2I7GA 3DX5A 3SECA 4XZIA 3AYTA 2FQIA 3LDVA 4G6CA 1GTHA 1TV5A 4Q7IA 1XYMA 3A4AA 4LYPA 4TMCA 1EC9A 2BCPA 4OZOA 1NPXA 3W28A 2NXHA 2F8QA 1LWHA 4HBKA 3URHA 1QI5A 3DUGA 2OZ3A 2IKIA 4WSJA 2DSKA 4J7RA 3IK2A 3GU2A 1UZ4A 2OKTA 3W6LA 4FLOA 4GMEA 1X6LA 3ZOAA 3BZJA 2QYGA 4ZQRA 2NQJA 3A3HA 5KVIA 4W87A 2ZXDA 2D1ZA 3NZQA 2ZQ0A 3TJ4A 2Y61A 3CJPA 2OODA 3TQ0A 1E4LA 3HG4A 1LOSA 2W3SA 3BLLA 1ESWA 4RZBA 4JTRA 3QMTA 4NKCA 4IISA 4H7VA 3KOXA 3EBVA 3HRDC 3EX6A 2FMOA 2CBUA 2G37A 3EX4A 1W5PA 5IFTA 3WLKX 1Q6EA 1L6FA 3THQA 2WJZA 1TFVA 4XVDA 1QVBA 3C61A 2ZYFA 5A3HA 3ICJA 1GPWA 1YXDA 4UTFA 4H6KA 4ORMA 3PFMA 4TIMA 3QLLA 1Z7AA 2QW5A 4DY1A 1V0NA 2V63A 2AL2A 2E8ZA 1HO1A 1C8VA 5I6SA 4RW3A 2WKGA 4I5XA 3G0SA 4LB3A 1R86A 3OBAA 3B05A 4MFEA 2H8ZA 3IRSA 1HJVA 2ZUUA 4FLSA 2FYMA 1FWHC 1WYGA 3T1GA 2XN2A 4JQAA 3CUXA 4B5VA 2Z7GA 1SO5A 5T9CE 4C91A 4NI3A 4DJED 4DXVA 2YAUA 4NZ1A 3L21A 5AC6A 4HCHA 5E0KA 5FJIA 1MZHA 3AICA 4HSOA 1GKPA 4PEEA 4JNZA 3VM7A 4YWSA 1WPCA 3DGBA 2F61A 3WQOA 4JTSA 2CW6A 4GA8A 4CVUA 5C2GA 1W1TA 2WMJA 1FHUA 3M0LA 4LCRA 3BW4A 3VFLA 1R2RA 2W5FA 4AQLA 1W5MA 1RSCA 4FAMA 3RU6A 1AH4A 1XGEA 4NRSA 2WOWA 3QW3A 3VMOA 3C0LA 1YE4A 2PZ0A 2XGIA 3U2EA 1FEBA 1GHRA 4GO9A 5HMDA 4RZ5A 2XIJA 4ZO9A 1YLVA 4GX9A 3A4XA 1F3PA 1I0DA 1WDQA 2XISA 1MW0A 1KCXA 5U25A 5AYYA 1KB3A 2BY0A 1UJPA 3M16A 3I6RA 4DAFA 3GM8A 3RFAA 5LXXA 1F73A 2E9MA 4R27A 1LWIA 1TR1A 3SCRA 3GC4A 4YIWA 2FPVA 2Y62A 1R9ZA 4FNQA 3WBWA 2X1IA 1SMAA 3NZRA 1W5OA 1MNSA 1DQXA 1VB9A 4AZCA 1E1FA 2OSYA 2H6RA 4UCFA 4FPSA 4NIRA 1D8WA 3GQYA 4L1XA 2GLKA 2I57A 4UCGA 3NGFA 2FZ8A 2ESCA 1DIEA 3S0CA 1QBAA 1ZCCA 1MW2A 3LX9A 3V16A 1POJA 1HKVA 5MKGB 3O63A 1PPIA 2O7SA 2PD9A 2PLJA 1EWDA 3FJ6A 2FZNA 2V68A 5AOUA 3LBOA 1UA7A 1ZAJA 1H1NA 1XLJA 3BQ5A 2EQ8A 1A80A 3QR1A 4OIFA 2P10A 2X0SA 3CPRA 3CXOA 4E3VA 5JVLA 1T96A 3VD5A 2OLSA 3S2CA 1YDVA 4GR1A 4XK2A 4AHOA 2D24A 3VDCA 2A4AA 1SW0A 1TPVA 2BWGA 3SEPA 1AQ0A 4DELA 2WVVA 5I3FA 3L5LA 3M0ZA 2BXVA 4XBSA 3FYYA 3A4JA 4KGJA 4O1AA 4DBEA 2VX7A 3N2BA 5I79A 3WJXA 2NSOA 4MNJA 5LNUA 2AL1A 4S3FA 4QG6A 1W54A 2YXGA 1FWCC 4V15A 5AYBA 3IV8A 3BV7A 1YPFA 3CV1A 1ML1A 3GG7A 3VUSA 3QSRA 4DM2A 3BLOA 2VGGA 4E3TA 1TE1A 2EPOA 3T9PA 1XG4A 3KVLA 1MDRA 4DO4A 4I7WA 1E51A 2FZDA 4KCUA 4MUPA 1H7NA 3NQ2A 2V3DA 4DYEA 3C2EA 1T40A 3WQVA 3H4KA 3C3UA 3OC4A 4PMYA 2O9PA 4BFAA 3QHOA 3BDKA 1PHQA 1IGSA 3VPLA 3OO2A 3EXTA 1YRRA 1VCFA 1ZBKA 4QSFA 2DQXA 4HNUA 4XBKA 4GVIA 1K9FA 4TXEA 1H60A 3QY7A 4JIEA 3TN6A 1BYCA 3UZJA 2CYGA 1QHOA 3P60A 4W85A 1UB3A 3CZJA 5BCAA 2FPTA 2BC0A 4EQXA 1K8YA 5C5YA 2DVTA 1XH0A 1SZGA 1V6UA 1IEIA 4GC3A 3MPGA 4CN6A 3DAQA 2AQOA 5FESA 4C6NA 3GU9A 1UD4A 2J9YA 2NQ9A 4NZCA 3HO8A 3ABOA 3R7MA 2BY1A 2DZPA 4IP7A 2E4TA 3GW0A 5DT5A 4D6HA 1QK0A 2R24A 2YQUA 2XGBA 2WPEA 4UFLA 1I1XA 4LNYA 2P8CA 3MHFA 4W7VA 3REQB 2CKSA 1RAKA 4QJ5B 1XISA 5D2XA 3E5PA 1Z8AA 3UGVA 2VDHA 4TX9A 4E2OA 3CAKA 3KLKA 3PR2A 3AMGA 3IJ8A 1XBZA 3CGTA 3EMCA 4LF2A 1GZGA 1B2YA 3B8DA 1IQ8A 4AB4A 4X2RA 2BBFA 4JDYA 4UTTA 4HK5A 1FKXA 4R9XA 4QDPA 4I8YA 3SQPA 2PCEA 2RH9A 3MUY1 2IQ0A 1MRAA 4DIAA 2PF0A 4V33A 4LU0A 3HPSA 5MHBA 1BF2A 3PM6A 1ZDLA 1G94A 1IWBA 4YNGA 5CEWA 4JIHA 5A6AA 1PCWA 5J8LA 1F6YA 1TJ1A 4ZFMA 4J4KA 3U5UA 4EE9A 3WD4A 4XZBA 3EPNA 3UWQA 4EM3A 3ZR4A 1Q6GA 3KWXA 3VIIA 1G4PA 3GD6A 5AHNA 1S5NA 5FL1A 2PLKA 4DJDD 1PZ1A 4D71A 2WBAA 1CW2A 5LIKX 3QBUA 1WZAA 4Y9AA 1TUFA 5REQB 1KGXA 5CGTA 2L5HA 2VP8A 3GDRA 3LD5A 1P4CA 1TYGA 4L1GA 4HPXA 3STFA 2DUXA 3SUTA 1JYVA 1CGVA 4MB5A 1I2RA 1UWQA 3UWUA 1KM3A 4ACYA 3GO2A 3HMCA 4FNUA 3PB0A 1NARA 3OQEA 3UXDA 2UZ9A 3R58A 3WF3A 1UR2A 3H22A 4PUWA 3U0HA 3I3BA 1SSDA 1KD0A 2XSBA 2P53A 2QUUA 2LLEA 2FHBA 5IFPA 4PRWA 3N73A 3V5FA 3QY8A 3SFKA 3T81A 4WDXA 3VIFA 2E5CA 3W38A 4MOZA 3WBAA 3CUFA 7TIMA 5FF7A 2YXXA 3KTXA 3STEA 1EC8A 1GYLA 1GCYA 3QGAC 3NVYB 2C3ZA 1QR7A 4QX4A 2ZUTA 1VRXA 3LXBA 2EKCA 3FS2A 4PUNA 3W02A 4DJEC 3BURA 4Z2LA 4Q7NA 3GR4A 4ADUA 3BG5A 3UR5A 1M6JA 5KETA 4RJEA 3UXAA 3EWCA 4HGXA 3EDKA 4ZSUA 4NAEA 4CCDA 6TIMA 2QDDA 3QVQA 3VXGA 3A5FA 2QJJA 2JIEA 3LQGA 3W7PA 1J0KA 4DF2A 2O4QA 3QN3A 3T0AA 2DW6A 4O52A 2GVLA 1ISXA 5FJPA 5TAOA 3C0SA 3V18A 1G0CA 4ZQPA 1S1PA 1M53A 4UTMA 2XFFA 3MZ2A 1YX1A 1NHPA 5K2ZA 1PWMA 4ZQMA 3PVFA 4O19A 1PE1A 1TJRA 2ZX6A 2X05A 1RZMA 2PDJA 3YPIA 4W86A 1VFFA 3K1DA 4GI4A 2NUWA 4FI4A 4XKYB 3THUA 3MWCA 3CHCA 3URBA 1XDJA 1IGWA 4ZOEA 4ZGYA 3VD3A 2Z1XA 1A5OC 4PA8A 3WH8A 4LH8A 3A24A 3C4UA 1JCNA 2JKAA 2OEKA 2E77A 4LBSA 4EXQA 4NY2A 1VZWA 3GVGA 3VMNA 4NRRA 3AAMA 4EWND 5E9XA 1UMYA 2GSHA 2WZIA 2QAPA 3FAWA 3SUVA 4ECLA 2ABBA 2E40A 3WF0A 1VFTA 1XSIA 4A21A 4KCVA 5K9CA 3VZZA 2WSQA 4MFDA 1OFDA 1M41A 3C2FA 8CGTA 1J0ZA 1GESA 3ARYA 3S2LA 2TPSA 2FHCA 1PXGA 1GNXA 5JXQA 2PODA 4M6QA 1UJQA 4XAFA 1OJXA 2V3EA 1AW5A 5I06A 2W92A 5T8GA 5L9FA 4M56A 5BNKA 5G5IA 2NVAA 1EUNA 4O1FA 1KV8A 2QCCA 4NF7A 2VRKA 1HG3A 4K2SA 3RUBL 4FNTA 2D23A 3NZ1A 3UXIA 3N4EA 3TXZA 3M6DA 1OD0A 6PTDA 4A8NA 4UBPC 2HSAA 4JYFA 1YDOA 5I78A 1EOMA 1XX1A 4C1NA 3H23A 3NA8A 4C6KA 1E0UA 5CZJA 4CQDA 4DO5A 3SM0A 3ALFA 3INPA 3A12A 4DWSA 5A95A 1ISYA 1E1CB 3O6YX 1F2JA 2V0TA 3L4XA 1HF6A 3WJWA 1RBLA 5BOFA 2VCCA 4JNYA 1B30A 3ZS4A 2VVSA 3L66A 4O4VA 4LUJA 3WEMA 2G3NA 1TV3A 1Q7MA 2IUZA 4O18A 1TQXA 4X2PA 1CGYA 3QZEA 3VOJA 2VGBA 2X1TA 3AS1A 1NDVA 3FJ4A 2OWCA 2V3BA 2QQ6A 1XRSA 3EWZA 3NFUA 2QPXA 4WY0B 1GRBA 3AYSA 1MYRA 4IM4A 3E0FA 5ABGA 1PTGA 5B80A 1IT0A 3ARQA 3KBSA 1PTAA 1I4NA 2GQ8A 3OLGA 2IQTA 4Q8NA 2GJNA 3B3DA 5I03A 3PC0A 1Y5XA 2A3CA 4QROA 4H9TA 3S83A 3WZ0E 1SYTA 1IE7C 4PMRA 2YFOA 4AYGA 4I6VA 3AALA 4JKLA 1N5XA 1S2TA 4G1KA 4K3ZA 4LNCA 1TREA 3TYEA 3VNJA 4REQB 4U10A 2PLMA 3IIOA 4EM4A 1NQKA 5M17A 4OTKA 4EAYA 3F4NA 4I7VA 1R7OA 3W7LA 2Y7GA 2OJPA 3BJFA 2E28A 2I1OA 3Q94A 3SCPA 4HN4A 1OFRA 1SO3A 3TYCA 3S46A 1GQIA 3PSVA 3SURA 4LPCA 1Q63A 1W37A 1TR9A 5A5WA 3T09A 4L61A 2WC3A 3MI2A 1F4HA 3TH6A 1OCQA 3EMZA 4GWEA 4S2CA 1ZRQA 5G2IA 3WNLA 3A23A 2WNQA 1DBTA 2BVTA 2QJNA 3G77A 1KKOA 3W1NA 3PULA 1MW3A 2NVCA 4H00A 3RJXA 3QMRA 1VH7A 3EB4A 3L5MA 2DZUA 1UWIA 3KCOA 4JTDA 2PDHA 4GYJA 1SZEA 3NQ7A 3WEZA 1LL4A 1LWJA 3GNDA 3W1PA 1E6XM 3MDUA 3DECA 1J6OA 3W7DA 1S46A 3WMBA 1SPQA 3PY2A 5H6HA 1IIHA 4V1XA 4DJDC 1DJNA 3HQPA 1KCLA 2R9RA 2D73A 3GXDA 4R7WA 1PKLA 4C6BA 3WK2A 5AY7A 1I2OA 1GONA 1PBGA 3I65A 1QMLA 4H4XA 1F8IA 2Z1VA 3VGFA 4XQ6A 1KR0A 3LN3A 1TYPA 2EEXA 1JCXA 1EXPA 3EDJA 3STPA 3GNXA 2V5CA 4GZIA 5AC4A 4IIFA 2OWWA 2ZZ1A 1QXLA 1TZ9A 1X7IA 5HUPA 1LBMA 5KINA 1XGDA 4QGCA 1S5VA 3TC3A 3URNA 3SFWA 3ISIX 3C0QA 4IICA 4H41A 4I6KA 3PANA 3XISA 3AHXA 2QDHA 3QR3A 1D7KA 4YJ5A 3USBA 4Q8WA 4PB5A 4Z0JA 1ZGDA 4LVGA 2OQHA 3PBVA 2QDGA 3W71A 4K7ZA 2G4JA 4EKJA 2OMAA 4RPPA 4JKMA 1SSGA 3G1XA 1ZHAA 3W7RA 2A7PA 4S3JA 2WBKA 4FXFA 3MBFA 1RLDA 2ZUNA 4R53A 4WRHA 3NVDA 2VEPA 1JRBA 3P80A 4FR1A 3ZZ1A 1EXBA 1M68A 2V82A 1GOXA 3BG3A 3NQEA 4IFKA 1FHLA 4LVBA 2JK6A 1KNWA 1SO4A 1DV7A 2AGKA 1J11A 5D2YA 1W32A 4QCFA 4AX7A 4K8DA 4BF7A 3CZ8A 2JK2A 3VC5A 3FFSA 4G7EA 3M41A 3FDKA 3LPPA 4O1CA 3L4YA 4E4FA 5F2MA 2DZAA 2V5JA 4FX8A 3VGEA 3JUGA 1EEXA 1ZMDA 4AD1A 1BYBA 3FDGA 3VGHA 1J8VA 2INEA 4GX8A 3O16A 5FSDC 4JAWA 1NHRA 1UMLA 4AG0A 3IJDA 2ZICA 3AZTA 2YL6A 3S1XA 1HKJA 4B91A 4HJWA 5CZKA 3KTSA 3USZA 1BXBA 3DCPA 4WJEA 4IMCA 1N63C 3GR7A 1K8XA 4NSBA 2WNZA 2YZRA 4QITA 2X8HA 3BAJA 1GWJA 2XVGA 3W00A 1CNVA 3SN0A 3ITYA 3FVDA 3CL6A 4HMDA 1DTNA 3PJXA 3LXAA 2Y88A 5BU9A 1AD1A 2GQAA 4UIOA 3KP1A 1IHIA 4YU1A 1NF7A 4N42A 4J3XA 3HURA 4CNTA 1XQKA 2PGEA 2X41A 4GUJA 3DK8A 2GOUA 2Y85A 5AB3A 1TJ2A 5GJPA 4Q3MA 1E43A 1XINA 4TVWA 4KFOA 4HMCA 1JZ4A 2QF7A 4GI6A 1J01A 4OGZA 3OP2A 1J5TA 1KM2A 4Q22A 1HQTA 3T40A 2RDTA 2E8YA 1C8YA 2QV5A 2XVNA 1MDLA 3A6OA 4H2HA 3P8IA 5FAJA 4JQ4A 3LHVA 1X96A 2J3NA 4ACZA 4S38A 2HRWA 5IDIA 3W73A 4H4WA 3NVZB 1UUQA 4NILA 3A64A 3W85A 4BA0A 1EKOA 3P2VA 3WF1A 2X42A 3MW7A 1R87A 3U2CA 2B0MA 2AMXA 1PTDA 1WQ5A 4C6OA 1GW1A 3CH0A 2XVKA 3RRAA 3LCGA 3EWBX 4TTGA 2DEPA 3S5OA 2J25A 2OELA 4NJGA 4M3PA 3URAA 4E0CA 2CERA 4K8GA 4UFIA 5FEWA 1W8SA 3C0JA 1KTBA 3W74A 4EIVA 1J2WA 3QHNA 4FHAA 5A6BA 1BF6A 2XIIA 3LCHA 4ZB2A 4PE8A 2PWDA 3FEQA 5LA0A 1ZAIA 5DY2A 4A8IA 5F1VA 4YXGA 3B04A 4HHHA 1LOLA 2ZUVA 1DE5A 4R85A 1UG6A 8A3HA 2CZ5A 3IACA 4XB3A 4F3HA 1V97A 1EL3A 2VELA 3CZEA 1LLZA 4KESA 4UOJA 1TTJA 1TMLA 2XN1A 1YMYA 3LHUA 3MMTA 4AAJA 2QCEA 5AHFA 2GR0A 3WNOA 2BGQA 4W4QA 2QXWA 2TAAA 4WZHA 2PTYA 3TFXA 3D9XA 4DJFA 1I9CB 1KFKA 4KCTA 5D4YA 2ZDSA 2BMBA 3H2NA 1FFRA 3MKKA 3B9JB 1GYMA 3SAZA 1P1XA 1RCXB 3CH9A 2YBUA 3SGZA 3ZT6A 3J7HA 5AVHA 1J0JA 2PSNA 4ALDA 5D38A 4PL1A 2C1HA 2DT2A 4K1WA 2QMJA 1NSJA 1JF5A 3LRLA 1V3HA 4A8RA 4R3UA 3TYAA 1LRNA 5L6UA 2HK1A 4M8UA 1OD8A 3DI0A 4EVZA 1JFHA 1LP6A 2V2CA 1QUMA 3GY1A 2QKFA 1KRBC 3DHDA 3AMCA 3P3BA 1NWUA 2PWGA 4GKLA 4RE2A 3M5XA 1H4PA 1HNYA 1ITXA 3EA3A 4US5A 1N82A 1X1OA 1W9BM 5EPDA 1RVKA 3LZ5A 4G2DA 3PZ9A 3VNYA 5I3IA 4QR6A 3O07A 2OLHA 1AJZA 4DBDA 4F0RA 4KPLA 2WO5A 4FZIA 3CPGA 3W76A 3WD3A 3R2GA 3UCDA 1JULA 3TX9A 4HSHA 5J5RA 1FH9A 5CPLA 1VYSX 4JL2A 3S1GA 1M6IA 3HJEA 3WNPA 1VD6A 2QAEA 3MUIA 1YTDA 2PRHA 3P62A 1XLIA 5A6TC 3EX1A 4QXIA 3E0VA 5E09A 4LQ1A 4YMZA 4ZOCA 2VC6A 2WW5A 2EHHA 1XR2A 3O1NA 1ODUA 2QAFA 4LAKA 1GERA 1JG9A 1FWTA 3ES7A 3N1AA 5FJJA 3UR8A 1EQPA 3GG8A 4FO4A 2ABAA 4IG2B 4B9YA 2MUCA 2OXNA 3NJ3A 1T3QC 3FA3A 1QU4A 4JZ5A 1OM0A 2ZKMX 3ABQA 1U1HA 5EU9A 2WSKA 3OZOA 2VR4A 1W3TA 2QCMA 1E73M 2YBVA 2B7QA 3CZGA 1KWGA 1VP5A 1P0BA 1MI3A 4DQWA 1E1EA 4IQEA 3E96A 2C0HA 1MXDA 4UUIA 5AZ1A 3FYPA 2Y8KA 2W0UA 4K1GA 2E6YA 2Z7KA 3W2KA 1SB3B 4IXXA 3C86A 2VO5A 4ZO8A 2J6XA 3TR9A 1FH8A 2I16A 1E6QM 4DF0A 5CGMA 3WH6A 4R33A 1Q7QA 3UNTA 3S9ZA 2ZCGA 4QE4A 4LF1A 4H83A 1TV2A 5KZDA 3TSBA 3I4EA 4K68A 1KTNA 4WXZA 3RITA 4DNMA 3ID7A 4NHVA 5DCDA 4RDYA 3K2GA 4NASA 2HMCA 4LXFA 3QQ0A 5LHEA 1Z6KA 3UJEA 1O5RA 4ERIA 2QDEA 4LUTB 3C2YA 2E09A 5DANA 3TW7A 2CHRA 5AKQA 3FKRA 1CGWA 3O2LA 3I4KA 5H2ZA 3C52A 1M9HA 3BUVA 2P88A 4OOUA 4Y2WA 1AH3A 2JFEX 4GXWA 2A8XA 1OFPA 3EOOA 3UG4A 1Q4NX 2CXEA 1XKJA 4GY1A 4C65A 3T07A 3M0JA 1UR0A 4XO6A 1HKMA 2AKZA 3LGDA 4A3UA 3NL3A 3U4FA 3NL2A 5K9XA 4HK6A 2G3IA 3EEZA 4O11A 1KLYA 4YYCA 1FKWA 3VNLA 1UOKA 1F3EA 4O14A 4C6MA 4W5UA 4DBSA 4KH2A 4JIRA 2Z2UA 2QVHA 3EWDA 4YVVA 1LBLA 4DO7A 1GTEA 4EXAA 4B4HA 4JDBA 4H6EA 5C9WA 2J8FA 3BLIA 5EFDA 3VDGA 3KBMA 3NQAA 5HPOA 2PLCA 5GPRA 3DGHA 2WCAA 3POHA 1JPHA 2BVDA 3FJNA 5F4SA 4D9PA 4RXFA 3PPFA 1UKPA 1FWRA 4U5IA 3N25A 4CN4A 4PUKA 2MNRA 1GQLA 1G4SA 1YEYA 1IZCA 4DWDA 1ONFA 4O8AA 2UWFA 3TV8A 1US2A 3AISA 1K9DA 4ZFCA 4PL2A 2VGFA 4Q4RA 1B31A 2PDCA 4H9VA 1B9ZA 5AVNA 3AZSA 3ZSTA 5CBJA 5KITA 3BARA 2R1KA 4WSHA 4TTUA 2YL9A 3UR2A 2RABA 4J3VA 3EWXA 2OSXA 1GOMA 3MYOA 5ER0A 5A2BA 1G1YA 2FVLA 1ZMCA 2E9LA 1YADA 5H1WA 2OPJA 1EQCA 3QZAA 2YSWA 4AMAA 1C7SA 4OVXA 2PRLA 3LCIA 5CZ0A 1FO4A 4XVEA 5FJUA 2ZE0A 4BR1A 2KAUC 3RLGA 2HCVA 3HGOA 1F61A 1W0MA 4NJHA 5AC8A 1H11A 4Z0SA 1FHDA 5KEZA 1QFEA 2FPYA 1M01A 3W7GA 3L65A 2WWDA 3B0PA 2CLPA 3U57A 3DFNA 1U22A 2W61A 1Q65A 3TOPA 2ZRUA 4JPGA 3TXVA 5JU6A 1UC5A 3M4HA 1UD6A 3ZQ9A 5HNTA 1W1PA 4F66A 1W9VA 1ZP4A 4MWAD 1MUWA 2YCLA 1XSKA 2ICSA 1R3QA 4ZQCA 2GK1A 1HXJA 5DRCA 4HA4A 1XYBA 2BX7A 5HJLA 1M5WA 5CJNA 4LY4A 1NHSA 2WKLA 4FX7A 4IL2A 3QV8A 4HB7A 1A5CA 1J79A 3L5AA 3P5YA 1QNVA 1US3A 4AX6A 3CM4A 3IJ7A 4J1OA 3CO4A 4D1IA 1KXQA 2G5WA 3CTTA 2PDFA 4TVUA 3UG5A 3P8JA 5A6LA 2Z0IA 4IIEA 4P7LA 4EAMA 2PWFA 1A5SA 4BEUA 4OFCA 4W7UA 3R43A 3MMWA 3BH4A 3ZR6A 1KC7A 1BWKA 2VZTA 1QW7A 2D2OA 1PWLA 2J7CA 3WQCA 2PI6A 3EXRA 5U7SA 2SFPA 1JXKA 4K8EA 2IPJA 4UTHA 2HDJA 1UKSA 5E5CA 3AM9A 2POZA 2CLMA 1K4HA 2PTDA 1XYFA 3GS6A 1EOKA 2CLKA 1Q6FA 3BCDA 4JFWA 4FOUA 4B16A 1UROA 3NQ8A 1S39A 3IIVA 2ZC1A 5FS6A 5BZAA 4MAVA 2WOQA 2VX4A 3GG0A 1S3HA 3K8KA 4B5NA 3TTSA 3CAWA 4RNHA 4MTVA 5HJXA 4DBWA 1AA1B 1EFZA 5BOOA 3R1ZA 3TYUA 3AO0A 4Z17A 1I2PA 1L0PA 4U2YA 3WBXA 1WX0A 2BFGA 1GETA 2GQWA 1E40A 1NWSA 4UTIA 3CGBA 1BQCA 1HT6A 3F03K 1UP0A 5ECUA 1BFNA 2A85A 1MO0A 4HU0A 3ZM8A 3HG5A 2G97A 3GRIA 4KEUA 5GNYA 2FKPA 3VIPA 1GOIA 4GFSA 2DGAA 2Q6ZA 1AQMA 1DYSA 4AUBA 4B3ZA 2V8ZA 3VA8A 3OVQA 2ZADA 2AOSA 1W1ZA 2BXZA 1I2NA 1R3RA 4AWSA 4F0HA 1NM9A 1YXYA 1JROA 3HV8A 4N2YA 4Q4SA 2YZ5A 2FFCA 2Y7FA 4MZ8A 1AW1A 4UC5A 5KZMA 3IIZA 4EWJA 1V79A 1KRAC 3EKLA 2P0IA 1E9YB 1QBBA 2OQLA 3CB3A 3OYZA 3TMQA 2WJEA 4JIIX 4HYRA 1OJTA 3A47A 4ZOBA 2GGGA 2WHJA 5HXMA 1WNOA 3ZVHA 1H5VA 3TK7A 1EJWC 1Q6LA 3IVTA 1OX4B 5CPNA 4JBRA 1QI2A 1TA3A 1JZ3A 2QGYA 1RP8A 4UQDA 4JQ3A 5H91A 4WCJA 4BI7A 3SZ8A 3P6LA 4H4SA 1S3TC 4CU7A 1OSEA 3TUUA 3IC9A 4HNCA 5HPCA 2A3EA 3TQPA 1ICSA 4S3EA 3UNDA 4H4QA 2EKGA 2ONEA 4GI8A 5BXSA 3KS6A 3H2EA 2V38A 4EPEC 2W3RA 3RR1A 1ZPTA 4PRTA 3QPZA 4A6GA 3M64A 3QM3A 5FIPA 3NWRA 1CGUA 1D8CA 5CC5A 3WENA 5M5DA 3AFBA 4JHZA 1B3WA 4PUMA 2PGRA 1IR2A 1YIXA 1N61C 3L0KA 1A5NC 4N6EA 4H4PA 3PHAA 2X99A 3GRSA 3B9OA 4RZ6A 1QOQA 2H3BA 2O92A 1HJSA 2WVTA 3MCOA 4H9UA 3SR6B 4JTAA 3RGTA 2JEPA 1UQZA 1HL9A 4IX0A 5JBFA 1W56A 4Q8QA 2ZUMA 4HZ7A 5HANA 3SCVA 2NLIA 2G3MA 5DELA 4F2BA 1SJDA 5CLWA 1LUCB 4UOQA 3MQTA 4A29A 3AYRA 1O1HA 3R13A 2Y0FA 5BWFA 3UJ2A 1OCBA 4NX5A 3E9AA 4K37A 5BRQA 2VENA 2WMFA 1VHNA 2HQAA 4Q33A 3W25A 3VDHA 2Z24A 1LJYA 1FIQB 1LCOA 5A8PA 3KFTA 3V5OA 1E5NA 2NV2A 1QATA 3N12A 2YGYA 2QCLA 2A21A 5EA9A 1V6VA 1U33A 4ZENA 4LEQA 3C8NA 2HNHA 1K02A 3NVVB 4F79A 1U83A 3OGRA 3GK0A 4NAFA 3LLXA 4YVXA 1XIJA 2WCSA 2J88A 4ERAA 1E9ZB 4GIEA 3VX0A 3AOFA 4QP0A 4Q32A 2B7NA 1CECA 3ZMRA 1GVEA 3KL3A 3BCFA 4LX4A 5M1TA 4MM1A 3QFBA 1ZBWA 5HMEA 2PP3A 3SCQA 3TZNA 2QCHA 4UFJA 2BHYA 1AD4A 1TPDA 3G6LA 2EJ1A 4AWEA 3GKAA 4F0KA 1UQYA 1J0YA 3G1DA 4NEWA 2YCJA 1GEHA 1V0LA 3Q6JA 4GXPA 4M1BA 2GQ3A 1ISWA 5I07A 2WYSA 4G56A 3GDLA 3WNMA 3WQ5A 1GVRA 3V4BA 5IRPA 4UQCA 1N5WC 3ERPA 3RX2A 3KE0A 2VRQA 2WKJA 4ROQA 4FMVA 2A5HA 1P7TB 1WKDA 1V59A 4K36A 1TJ0A 3W7IA 1JQVA 3N15A 3VILA 1FEAA 1AMKA 2YR1A 4ZSTA 3PBUA 3ITGA 1TCDA 3N6HA 4MWAC 6XIMA 1D3GA 2R94A 1XLLA 3OBKA 1PDYA 1A49A 1XCWA 1Y5VA 3W84A 2OB3A 1R46A 4UQBA 3M7SA 4D6GA 3IJQA 4R88A 1TX0A 1PYMA 5FA5A 1MWOA 1H7RA 2VOTA 3R79A 2C8NA 1V6TA 1GRGA 3HM7A 4EQSA 3SDOA 3RAOA 2E6FA 1P6BA 4GNVA 4JEJA 4TOQA 2FDSA 2XH7A 5H8UA 3TDFA 2GUUA 4FS9A 4YWIA 2IPWA 1AK5A 2OO6A 1BHGA 4ERGA 3IARA 2QCGA 1IIGA 1DWHM 4YL2A 1WO2A 2GJRA 4L4PA 4ZBCA 3E3HA 5PTDA 4MJZA 4AW7A 6A3HA 4XBJA 3JRKA 4GCXA 1FXQA 1L6GA 4V1YA 1B3YA 2X8CA 1MEIA 4HU8A 3QLDA 2PPGA 1KV5A 2VFEA 1Q6CA 1A47A 1G5AA 3KL5A 2F2HA 1FWJC 1XLBA 4RK8A 3GTXA 3RPMA 1XHGA 2ZUSA 5XIMA 3VNDA 4W88A 1X8FA 4URIA 3BAWA 1F76A 2OCZA 4UFKA 3GKFA 4M5PA 1M04A 3L67A 4L4LA 2JEQA 1K6AA 2W63A 2WOVA 1FHVA 2FVMA 1MZRA 1RQBA 3VD7A 1WV2A 2ANUA 3VFCA 3LCFA 2GGHA 3LADA 4JQ2A 4Y8FA 2HTMA 1OZQA 2R9ZA 4IMFA 5LA2A 4DUXA 2DFAA 1UR8A 1V3MA 4DZ5A 2Y63A 4LAUA 3MUCA 1OF8A 3B97A 4DPPA 1AG1O 4YTRA 3PG8A 5LNSA 1W5QA 5FEPA 3DG6A 3R12A 2YDAA 3APGA 3W2JA 5DCBA 5C9RA 4QLLA 2QZRA 2OYLA 4IP4A 4IGHA 4OV9A 5TD4A 8XIMA 1UZHA 2QJIA 3LI0A 1X6NA 4BI5A 1DOSA 5KTLA 4MZ1A 1KM1A 3TWBA 1WDWA 1VFUA 1JEZA 4FF5A 9XIAA 3WDRA 3OA5A 5CG7A 1WDDA 4MKNA 2PS2A 3HZ3A 2DQWA 4NNBA 5E0FA 4UTWA 3RDKA 1JZ5A 3V1HA 2GR1A 2WQDA 5E9AA 5A6MA 3BGAA 4OKDA 5AFDA 2RJHA 3SIZA 1RK6A 5D37A 3KXQA 2ISSA 4C6EA 1MQRA 5FJTA 3T0TA 4S39A 2FGLA 4IPIA 4M24A 4AFYA 1LLOA 3C56A 1KA9F 4AZ6A 3O06A 1JJKA 1WCGA 3C6CA 3GXIA 3F4WA 3TYBA 1HL2A 5G1TA 2IKJA 4XZWA 4JTQA 4H19A 1M7PA 2WBGA 3MSDA 2PP1A 3JR2A 3G1SA 4LT9A 4A3YA 4BKNA 2FTPA 3WUEA 2CHNA 2E5BA 3GNOA 4JN7A 2B4GA 3MC5A 3UZXA 3ZIZA 1W1IE 4XTDA 5LNWA 9XIMA 2XJ7A 3TJIA 4GIRA 1YTKA 5I3GA 3WG6A 3MWAA 2WMIB 1TTQA 2WM0A 3S6DA 3SBFA 2D22A 2GOKA 1O68A 4NZFA 1G69A 1NH6A 3GUGA 1T8QA 3UYCA 5E1QA 5EBKA 2UBPC 2J66A 1JRPA 1ZCOA 3U2ZA 3M5ZA 1V93A 3O6DA 5FOOA 3VOHA 1GREA 4U5KA 3V7PA 3V1PA 2HS8A 4Q4OA 2W55A 4UQ9A 4M6UA 3ZJ7A 3CO8A 3HW2A 2P0OA 4H6QA 3W86A 2YCKX 1LRQA 5D32A 5IBXC 3FGCA 3CIWA 3WFZA 1BAGA 1JI1A 1FWBC 3BSGA 4IQDA 2DP3A 4JHMA 3I68A 1ZX9A 5D05A 4BEQA 4AIUA 4G1NA 1YBQA 3MVIA 2WZMA 1E71M 3WLSA 4DI9A 1GHSA 1Z9AA 4V28A 5DMYA 1ZENA 4CGTA 3EOSA 3UJRA 3VX1A 4KFPA 1EJRC 3VYLA 4Q4PA 2V5LA 3SJNA 2Z1WA 4GJ1A 3A9BA 3PTKA 1CZ1A 1XF0A 4Q4KA 3GUWA 1VLIA 1M3UA 2W62A 1OCNA 5TR3A 1XHCA 1X8CA 3E1F1 3GDTA 4YN5A 3HBLA 2JF6A 2VR5A 4RPQA 5GJMA 4ADWA 1K4GA 4MVAA 3LK6A 3WH9A 1YNYA 3QZ6A 5CSUA 3IS4A 2Y7DA 3H4GA 2REQA 4O16A 5D30A 4H7CA 1OFBA 1OGBA 4KIRA 1BPLB 3QMSA 2A6NA 2GGJA 3BO9A 1M7OA 4IJBA 3WK0A 3WLQA 5FF4A 1FUYA 1KM6A 1YKWA 4OV4A 4KEMA 4C5YA 3EMQA 2HPMA 3QF0A 4FP1A 5BMXA 3SY5A 2J13A 4LRSA 3WDJA 1KCZA 1IEQA 1LG2A 1ZAHA 3EWWA 1V51A 4JKKA 1ZK7A 5LIWX 4KETA 1F7BA 1UWRA 1Z32X 1GOOA 4R34A 4Z42C 3RCMA 4H4YA 1F6KA 4FNPA 5F2IA 4FXRA 3RG6A 4J40A 1TWSA 1DHPA 2QR6A 1EP3A 2D20A 4H2CA 3CGEA 3WD1A 3OHIA 1XBYA 1GJUA 4XAZA 2PDNA 4UR9A 4IZGA 4QIUA 3QFWA 2DUZA 1DJZA 2E3ZA 3T0DA 1XLKA 1SMDA 1TUXA 4ZMGA 1FWGC 2R14A 2ADAA 3BMVA 2GRTA 1VBRA 5BWAA 1W2PA 1FVPA 3VNMA 1C90A 2PEVA 5K4ZA 1XLAA 1JGMA 1OB0A 4C6LA 1H49A 1H0IA 3NSNA 4PUEA 3OVGA 3LI1A 4GNJA 4CCCA 2Y8VA 3TONA 3W2LA 4C6CA 1OYAA 3FXGA 1R47A 4ZE5A 4O53A 1V02A 5CC3A 3VMPA 4UB9A 4AEOA 5C71A 2RGMA 5DMLA 1ZBCA 1RY8A 1RA5A 5JRBA 2E0PA 3T0CA 3ENLA 3QTPA 3E2RA 2ACRA 5AYXA 3SY8A 4GBUA 1FWIC 3S9IA 3TTYA 1WBHA 3QRHA 4MY9A 3STGA 3KW3A 4PRRA 1TRIA 4C7DA 1ELSA 4NXSA 1B1YA 3LBCA 4PTWA 3M0HA 1SGJA 4O8RA 4PR4A 4QFUA 1IXPA 3V35A 4BWLA 2DU2A 1UBPC 2CCRA 5BMWA 1SFJA 5EMMA 2Q8ZA 4DO6A 3LG3A 3TMLA 3PZNA 2DJLA 2J7EA 3AZRA 1JPMA 2PZNA 4TV6A 4AC1X 4IPPA 4XD6A 1DTUA 3Q37A 1PJ9A 3EAOA 1KXVA 1UR1A 3R8GA 4S23A 1DL3A 2RGLA 3OODA 1XICA 1E72M 1I0BA 1W1A1 2ON3A 3LRMA 5FAGA 3GE7A 4NZ3A 4ZODA 3VGDA 1TQJA 4XTIA 2V67A 3G5EA 1GRHA 2D2JA 5GNXA 5HA7A 1ICPA 2PDYA 1W3LA 1WA3A 1R3VA 2Y5JA 4P8WA 1STZA 4Q4QA 1P6CA 1XIIA 3WUBA 3DI1A 4POCA 4EPDC 2VMFA 2ZUWA 2VFFA 4LUSA 3WKZA 1BRLB 3AS2A 3PZOA 4BQ2A 3RJYA 1VKFA 3ANUA 3PUEA 5K7JA 2GR2A 4MGGA 4JTEA 4MYAA 3W27A 1TKKA 3S8HA 5EMKA 1DWGM 2V5BA 4XIAA 1KM0A 2X8RA 1Q13A 1I45A 1KFBA 4TX8A 1GK8A 4APNA 3UY8A 3LENA 4L6OA 4PUDA 2GJXB 4A4AA 2ZFAA 2B7OA 2HVOA 3G8RA 2ZZ4A 4C6PA 1TZ7A 4D6JA 2QIIA 1RBAA 4HP5A 4N6FA 3DERA 5DN1A 1WKEA 4EPBC 4OECA 3UJFA 1B57A 3PTMA 1XYAA 3WSUA 1H7WA 1OF6A 4H9XA 2WM1A 4PTMA 2YDSA 2V2HA 4WJXA 3W2UA 2BHZA 4M82A 3HMJG 2WZEA 2ZWZA 3CT7A 3P82A 1Q45A 3W70A 3S42A 3O6CA 4PCFA 1V0MA 1JIBA 3U8GA 5HWNA 2GVJA 3HJZA 1JAKA 4ES4A 2EG7A 1PKYA 3U9IA 1ZS2A 4DLMA 2FGZA 4WKFA 3U2OA 2E6DA 4GE8A 4XKMA 2A6LA 1DIKA 2H8XA 3B9DA 4GACA 3EOLA 4P8VA 1WP6A 2AMGA 5TBOA 4B5SA 4LV4A 4HHMA 5CSSA 4L6HA 4GQ0A 1TG7A 2GPTA 3GYEA 2PDXA 4HJFA 5F2LA 1U5JA 1DHKA 3PS7A 2WCGA 1NEYA 5JUVA 3ITLA 2R1MA 4P7QA 2VDGA 4GPNA 1FDYA 1W5NA 3AQUA 4MNKA 4NI8A 1YHTA 4DNHA 3ABRA 3DESA 1G01A 4WVXA 1E9LA 4QJ4B 3CYVA 1W91A 5T91A 4NXKA 1LT7A 4XD5A 5CPTA 5CJMA 1GJPA 3F2DA 3F7JA 2UY4A 3DJGX 3N3TA 1JRCA 3R0KA 5C7HA 4ROPA 3FEMA 1QK2A 2GDQA 3ZT7A 5MKGA 4L5ZA 3RNMA 1O4UA 3NZPA 3QV9A 4G7FA 2C71A 1QO5A 2GYIA 8XIAA 4K8HA 5H8PA 1VC4A 4PMVA 1MOKA 5HQMA 2ZXQA 5LYRA 3SUUA 1WUEA 1XIGA 3R0UA 1UIPA 3I7QA 4DB7A 3UVIA 3QFAA 3H2MA 1KXTA 3PNUA 3TA9A 2YKKA 2WMHA 3GB6A 1DJYA 3OLIA 3PZIA 3QEZA 2X8GA 4JX6A 3KOZA 1BVWA 4HCLA 3MCNA 3WQ4A 3T4WA 1SM9A 2BOFX 4OBSA 2V3FA 2TMDA 3NEVA 1UCWA 3KWSA 1BLIA 2DZWA 3T7VA 2DIEA 3SGGA 3DFSA 3E49A 3IJ9A 5ABFB 2E1DA 1NDWA 5A2CA 3WQGA 3QC0A 3R11A 2E1WA 1BG4A 1LDCA 2ZA1A 1GOKA 2VL4A 4MWAE 2HK0A 3PUOA 5CPMA 4KWWA 3DFPA 3M46A 3S2MA 2ZZ7A 3F4CA 4MUZA 4RE0A 3JS3A 5GNZA 3U7BA 1IYXA 1AH0A 3P81A 2HWGA 1J4EA 2C79A 1E6SM 3T8LA 1AVAA 1TSIA 2ZA2A 2VEIA 3P5ZA 1JFXA 4AVOA 1UD5A 7A3HA 1OGGA 3L8KA 5FCZA 1QWKA 4H7ZA 4TVCA 4MPQA 5CKSA 2R91A 3FA5A 3LOTA 5C55A 3FSTA 3LB0A 3H2AA 2IPFA 4Z1AA 5F4WA 1XLCA 2XIBA 2BVWA 2ODOA 1JEHA 4MY8A 2J77A 1MW1A 1S5TA 2RKXA 2TPRA 3W7NA 4H3DA 3T78A 1UZDA 3FIGA 4L9YA 1HJUA 5E6YA 3VKDA 2W4XA 4F2TA 5E0CA 2QF8A 2C7FA 1NWRA 2PDGA 3ZFHA 4JTGA 1TIWA 1QT1A 2PDLA 3REQA 1P0NA 5FF3A 4B4FA 4QS6A 3K4AA 4IMAA 4ZZ9A 2WSRA 5LA1A 1FECA 4AVNA 4GO8A 5ABHA 2V6AA 3TN4A 2OWXA 1TIMA 1TPB1 1HW6A 1FFUC 2PWHA 3QH2A 3LBMA 3DIPA 5U4NA 3O15A 3IGHX 1ZU8A 1P0KA 2VKZG 1BYDA 3GTNA 3ABXA 2V69A 4MLJA 1X7FA 4C1KA 4KPRA 1KRCC 3SCUA 2CLHA 3AIBA 2Y4SA 1KFLA 3LS9A 3LM3A 2OZ0A 2BG5A 2D0FA 2YCIX 4AY8A 1MEHA 1ONEA 4MIMA 2AKMA 2Y6ZA 1AZ1A 2ZIDA 1A53A 4CQCA 4ATDA 3HOJA 1KFWA 3GDMA 3NEHA 1UH2A 3M0IA 4GCAA 1NF0A 1SJBA 3M0KA 4E4PA 2HS6A 1OC7A 2CBJA 2G96A 2V9DA 4DPQA 4IFRA 1RV8A 3LMZA 5HUOA 4DWSD 2VD8A 1WAWA 1K9EA 4BF9A 5XIAA 4Q7BA 1MXSA 4N4PA 5I77A 5RUBA 1MQQA 1FCVA 5REQA 3VTRA 1EWEA 5T26A 1RJQA 2XH2A 4GBDA 5LGXA 2D3LA 2P50A 1KKRA 3ARTA 4Y9NA 2Y1HA 1ADOA 1V4YA 4X22A 2BXYA 3BL3A 3OQ8A 1Q6RA 1OWQA 3ITTA 2NQ5A 3BWWA 3W24A 1EIXA 3T2QA 1TTIA 2JIWA 1M1BA 3KAOA 1Q2SA 3ZLGA 2GDUA 4IMEA 7PTDA 2OOFA 1JPDX 1AFSA 2CLIA 1PKMA 3WMSA 4UXDA 2XN0A 2GZXA 1NDAA 1PEZA 3DYOA 1QASA 3OGSA 4M52A 2NW0A 1BSIA 3G0UA 4H4ZA 4YTQA 1GKRA 3MUZ1 2WVSA 1RUSA 3M07A 4ASTA 3SN1A 2ZTKA 1TV8A 5C8BB 1P48A 4UMBA 4DLFA 1X6UA 1VPQA 4I5RA 5DMMA 4W5ZA 3VCRA 2A2IA 2E5AA 4YCOA 4O0ZA 1EZWA 1V7AA 2E7FA 2CETA 4B15A 3UA4A 3FCPA 4FLRA 1RA0A 2EJAA 5HQLA 5AZ0A 5TIMA 3W7OA 2BY3A 3RPTA 4CU6A 2INFA 3L4ZA 3D0CA 3GX9A 2VUNA 4BF5A 4MKSA 3FOKA 2WPBA 4UTTC 2IQDA 1YDNA 5C54A 1VDVA 2Q09A 5E70A 3T55A 1NP2A 4JX5A 4HN8A 4AU0A 2NUYA 3POCA 2BS9A 3MHUA 3MVTA 5FS8A 3BGJA 4XKYA 4M80A 1WOBA 3SO7A 1BYAA 2DT1A 1RHCA 3VK5A 3W7HA 3W7KA 4BURA 1C8QA 2ACQA 1PZ3A 5CPQA 3WYZA 4KIEA 5HNNA 4H4UA 4JTLA 3PPHA 1V6YA 3OHMB 3TA6A 2ZX8A 4XAYA 5GQBA 3NVWB 1R6WA 3NQFA 4O17A 5JBEA 3BSMA 2V2DA 3WJZA 3ABSA 1A5KC 1DWIM 4MDPA 2Z26A 2ZZ0A 3PWIA 4IGSA 2DW7A 2XPKA 3KEHA 1XBVA 3W2MA 2VX5A 2F2KA 3ZXWA 1FQ0A 1UP2A 2WMKA 3W2NA 3E2QA 3B0UX 1LQ0A 5HDRA 1UKQA 3TCSA 3CUIA 3KP0A 4M1RA 2Q71A 4AMCA 2QMKA 3DKJA 4O1EA 4O1BA 3T42A 4LGXA 4IXHA 1GYNA 5M2FX 4JYDA 3GBEA 1KFEA 3CEPA 5CJ5A 1XCFA 1EJSC 3M0MA 4R5EA 4HPGA 4PUJA 1X2GA 2AAMA 1S5WA 4G8TA 4KS0A 1EZ2A 1TPUA 1SW3A 1IF2A 5F4XA 3EUB3 2BSLA 1CENA 3WF4A 1JDCA 1XQLA 4LAOA 4QAIA 3CZKA 2EAWA 2G8ZA 1CYGA 4QG9A 4GXMA 2H3DA 1KR1A 1WKFA 3AXKA 3GDKA 3L0NA 3LGEA 3RLUA 3QC3A 3FVMA 1BEUA 2R8WA 1E0XA 2OT1A 3VABA 1O95A 1HN1A 1A0CA 1HKWA 4DZAA 1GG1A 1Y65A 1E1CA 1CGXA 3WLNA 1KBBA 4TO8A 3MJMA 5HR6A 2Y5SA 2WHLA 1LVLA 3K30A 2R6OA 3B03A 1XH1A 4GGHA 1XYLA 2GFTA 1E6NA 1GVOA 3L7RA 2PMQA 7XIMA 2MANA 2ZXAA 3VKKA 1R85A 1LZOA 2VFDA 4OWGA 4PCTA 4J56A 5FF2A 3RR4A 1ZTVA 2CIPA 2WPFA 3LLDA 4JDRA 2O4MA 3MUXA 4WY0A 3D47A 4ICMA 5CG0A 1EC7A 2FVKA 2PWVA 3NQ6A 5E93A 5D04C 2WAGA 3LTSA 3HB9A 3NL6A 3N13A 4GHRA 5G5HB 1M65A 3FLUA 4JICA 3DU0A 5IM51 3WBYA 2JGYA 1PZ2A 5EBUA 3S5ZA 5BRBA 1B4EA 5BRPA 3WQFA 3MJYA 1ME8A 4ZL1A 1H62A 4DAIA 1S2CA 3P0WA 4CD4A 3CASA 3G1VA 1XLMA 2H90A 1XANA 4J3SA 1P5BA 3WH5A 2UY2A 3MA8A 3NOYA 2C19A 4U3CA 2QUMA 4EF8A 5D2VA 4LBUA 3CUGA 3GVRA 2WHMA 2ZZ6A 2Z1SA 4FLQA 3T2OA 3WFAA 3WD0A 1V7YA 2R1NA 2PUZA 3H2CA 1EEPA 3ARXA 1GORA 3PJWA 1RQHA 4KF1A 1XKYA 4TQTA 1C8XA 4NVTA 4EQWA 2GVEA 1EH9A 2DVUA 4CCZA 4S3GA 3F4VA 4LRTA 1V3KA 1UIOA 3TNOA 3ZYZA 3AIWA 1XLDA 3UZYA 2WC7A 4OE7A 2DIJA 4JTTA 5A1AA 4A2RA 3H4XA 1PSCA 1WDSA 4AZ7A 1JUBA 3IVSA 4C5ZA 3NGJA 2WLYA 4M0XA 3S5YA 1DJQA 4J57A 1XP3A 4HHLA 3TN5A 2GWNA 4RE4A 1F6PA 2VXNA 4Z08A 5DQPA 1KRMA 4M7TA 2EXOA 3FXYA 2NVDA 4BV6A 1HP4A 1W9UA 4J2MA 1GVIA 2CLLA 2AAAA 4TR9A 3UZZA 4H4VA 5A6SA 2X1SA 4LUYA 4DWSC 5D9MA 2XZ9A 1O6IA 4LEFA 4HOZA 3RM8A 2NX1A 4N0RA 1K7XA 5A6BD 5CC7A 2KZHA 3O7UA 1H1YA 3H12A 2HJPA 1OFQA 2PTWA 3IGUA 3MBDA 4X0NA 4GIAA 3N9KA 3U5YA 1OT1A 1Q2RA 3ITOA 1RPKA 1OX6A 4KRZA 4WKAA 2WP5A 3EOEA 3T2PA 3B8VA 3IEBA 3CT2A 3ITCA 3Q65A 4KWVA 4DJFD 4MAZA 2R1LA 4LC8A 2HE8A 3OW1A 2EPHA 4MWAB 1B54A 2PTXA 2O9OA 1CB7B 1RY0A 1E56A 5CBIA 3UWYA 2W9MA 3N6QA 3LSCA 3G22A 1S1RA 1IXNA 4N4QA 2D3NA 2ZOXA 1FWAC 3AWNA 3TIMA 2OVLA 5D2WA 4GVFA 3O6AA 3VDBA 1WOAA 1R3WA 3KHJA 4CCEA 3O9NA 4MJ4A 1LL6A 4HNVA 3R07C 1ZNNA 3ATZA 2QUNA 1U1JA 4LYKA 1FP8A 7REQB 5DRIA 1DJGA 1FWSA 1XIDA 1OHLA 4E38A 2YLLA 2QIWA 1JD9A 4NJIA 2CWXA 1VFSA 4US5D 3VIJA 4RNIA 4NG3A 2DUAA 4DUWA 3R4IA 3EWUA 4WK9A 4RDVA 4KT2A 1ONRA 3APYA 3AJ7A 4AXNA 1RALA 4M19A 1JAEA 1OGSA 2EG6A 3JW7A 2ZRWA 4KERA 4ZTXA 1SR0A 3OG2A 1FWWA 3U48A 2VZSA 3A5VA 4KGLA 3TKFA 3WLOA 5AC7A 3CAQA 4KRTA 3P67A 1QAPA 4LC6A 4PTDA 3CNYA 1BWCA 1N7KA 2QVNA 2WXDM 3RILA 1FTXA 3PSWA 1S2UA 1T99A 1S2AA 4NYUA 3R94A 3V0SA 1VBJA 2QULA 5HNUA 3GDBA 2WC4A 1XW8A 3LSBA 3NQGA 3TP4A 2J9ZA 4TUFA 3H6OA 4PBGA 3HQNA 3GC2A 4Y9OA 3FG2P 1CBGA 4Y8EA 3C2OA 3G6MA 1LT8A 1MFVA 3G1YA 3RO6A 1JR1A 1VPXA 2ALDA 4HOXA 2C16A 4LS1A 5BOEA 5EBAA 3LEPA 5D09A 4WIWA 3WLLA 1RP9A 2DZVA 2Y24A 3A7RA 1G6CA 3I6EA 5HOSA 1VF8A 3G3DA 4NYYA 1T8XA 4HU4A 3EEGA 4HNLA 1O7AA 4QEHA 2VZVA 1ZJIA 1QW8A 2OU4A 1QNSA 3SSZA 3KBVA 3RCYA 3TU9A 2HZGA 1JQXA 3TFCA 1U30A 5HMFA 4PODA 4DVOA 4C7GA 4R7OA 1QI3A 1XCXA 4JY9A 3GAYA 4UTLA 1FDJA 3CV7A 2UY3A 4WDTA 1TELA 3ARWA 2NT0A 1XLFA 3AMDA 3VIOA 5EB8A 3WY1A 4WOQA 4FNRA 3Q4DA 1L8PA 4AZGA 4UQAA 2ZC8A 2BB0A 4JTIA 2PCQA 3U4AA 3VD9A 4IMGA 3KVMA 3B4UA 2F6XA 3QY6A 1LF1A 5U1OA 2OKOA 3CLMA 1Y0EA 4IGMA 3O3RA 3PUGA 3EWYA 1E0VA 2VTFA 4W8AA 5FACA 4L65A 4RLIA 1XRTA 3CB8A 3W88A 5I5RA 1MMFA 1GVSA 3AXMA 4ADSA 1OFOA 4Z2KA 3WLJA 3H54A 1EF2A 3GHUA 3VC6A 3B9NA 4FOJA 3TQVA 1AJ2A 3UETA 1H0GA 4DZIA 3QV7A 3FA4A 3FY1A 3TSDA 3LB8A 5FJRA 1NY1A 2CEQA 3T4CA 3VCNA 5HWJA 5D03A 3MMUA 1FDZA 1E9IA 1PL9A 4S3CA 1JCTA 1JD7A 4XSLA 5J5DA 1E4MM 3L2IA 2XWDA 4DF1A 4CD7A 1XLGA 4AIBA 3WMCA 5KSWA 1CDGA 4Z1BA 3ARZA 3G18A 1UH4A 1WKYA 2Z25A 1US0A 1Z42A 1S2VA 2XZ7A 2WQPA 1EDTA 3HFYA 4I9JA 5C7VA 1HO4A 4KFNA 4O0KA 4XIMA 1QRQA 1QDSA 1TPFA 1JCMP 2XIOA 4QNWA 2WB5A 5XINA 5JCIA 4RDWA 1AQFA 1NAL1 3S47A 4B2DA 1L6SA 3N2XA 3GZ3A 1T0OA 5DXXA 1GG0A 1HJQA 5TF0A 4IPNB 3S9YA 4O0QA 1N62C 4Y9MA 1B4KA 1BXCA 4L64A 1JI2A 3EGJA 2HVMA 4EX4A 3TNBA 5KZEA 3CL8A 4Q8MA 3TYZA 1H09A 4KQNA 1JCYA 4GUGA 5AYIA 5EMUA 5FL0A 2YCEA 2BP1A 3KRBA 1IWPA 1H2JA 1H5YA 4H50A 1K1DA 1GVQA 3RLHA 1QI4A 2A3HA 3V0TA 4IG2A 3W1MA 1LM1A 1PAMA 4L80A 1GEUA 2QJHA 2PDPA 2OLAA 2VZUA 4DBUA 4QBXA 2HBXA 2PU0A 2YJQA 4N9BA 1VQTA 1T41A 2AAQA 4N9EA 1ONWA 3LERA 2NPXA 1EX1A 4GIYA 1BKHA 4H1ZA 1CXIA 5ECVA 2DSZA 4L4MA 2CZDA 4JY8A 2FTWA 4YLWA 5MF5A 4DEFA 4Z2JA 3OBEA 4PSRA 3OTRA 3ARVA 1P1MA 3FK4A 3O0KA 2XM1A 4UTKA 2QGHA 4DYKA 4LBRA 4PMZA 2VHLA 2ZE3A 3P74A 3CYJA 1CWYA 4EQRA 1KFCA 3W75A 3EF6A 3U6WA 3QQWA 3W7JA 2NV9A 2ISVA 3WQ8A 4DJFC 1HFBA