3FVDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
361
Chain Sequence
SLRITRLTVFHLDLPLAKPFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a member of enolase superfamily from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
rcsb
source organism Roseovarius nubinhibens ism
molecule tags Hydrolase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 117
structure length 361
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fvdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fvdA01
3VC6A 4EWJA 2XH7A 3THUA 2QVHA 2HXUA 4KEMA 3T9PA 1SJAA 1WUFA 3VCCA 1MUCA 2AL2A 3HPFA 3UJEA 2HXTA 1ONEA 2GGIA 2GL5A 4HCHA 3UJ2A 5J04A 2PTZA 3ZVHB 5FJOA 2FYMA 3QN3A 5FJRA 3JVAA 1ECQA 4JHMA 3SJNA 1KCZA 3ES8A 4E4FA 3RO6A 4IZGA 4A3RA 3H12A 3DFHA 2GGHA 1EC9A 2DW7A 1PDZA 3SBFA 2FKPA 1FHVA 4K2SA 2PU0A 5FJPA 3N4EA 1JPMA 3MUCA 3TOYA 1NU5A 3NXLA 3H7VA 4GGHA 4K1WA 3MQTA 3UCCA 5BOEA 1NELA 4GYPC 2OQHA 4IHCA 4DWDA 3R10A 3I6TA 4MMWA 3MY9A 3VDGA 2PCEA 3RR1A 3QTPA 3STPA 3KUMA 3SQSA 1TE6A 2QDDA 4A35A 3IJIA 3B97A 1PDYA 3OPSA 7ENLA 4MGGA 4DHGA 1MNSA 2PSNA 3RCYA 4ZA0A 1EC8A 3JW7A 4HCDA 2PMQA 1DTNA 2AKMA 3R1ZA 2P8BA 3UXLA 3V4BA 3V5FA 2OFJA 4DN1A 2OZ3A 4HNCA 1XPYA 4A6GA 1SJBA 3ZVIA 3V5CA 4GFIA 4FP1A 3JZUA 3IJQA 2ONEA 3UJSA 2POZA 1L8PA 1R0MA 3TCSA 2GDQA 3DIPA 2MUCA 4JN8A 4YWSA 3TWBA 3QLDA 1P48A 4GMEA 3R0UA 2OVLA 1XS2A 2GSHA 2DW6A 2PS2A 2OPJA 1JPDX 3IJLA 1W6TA 4HYRA 3CAWA 3UCDA 3ZLGA 2CHRA 3UXKA 2GGEA 3H70A 3PK7A 2P3ZA 3TTEA 4KT2A 3TWAA 2GGGA 3P0WA 3GD6A 3OTRA 3I4KA 2AL1A 4MKSA 3FCPA 3BSMA 3EKGA 3K1GA 3DG3A 3V3WA 3Q45A 4HN8A 3FJ4A 1P43A 2OZTA 1YEYA 2QQ6A 2XH0A 3EEZA 3MZNA 3N6JA 4E8GA 2PTWA 2P0IA 3OZMA 6ENLA 2ZADA 4H2HA 3S47A 3P3BA 3VCNA 1WUEA 2XH4A 4GISA 3Q4DA 3DFYA 3VFCA 4IL2A 3DESA 4J1OA 3R11A 3T4WA 3OW1A 3UJFA 4HNLA 1KD0A 4G7FA 2MNRA 3BJSA 3SN0A 2O56A 3QKEA 5EU9A 4DXKA 1JCTA 3ZLFA 3OZYA 1EBGA 3SSZA 4E5TA 2PA6A 3NO1A 4KWSA 1BQGA 3IK4A 3DEQA 1ELSA 1MDLA 3DG7A 3VA8A 1RVKA 2OQYA 2PP3A 4Z1YA 1R6WA 4ZCWA 4IL0A 2PU1A 3U9IA 2AL2B 3SN1A 4H19A 2OKTA 3NZGA 5BOFA 4HPNA 4IP5A 5FJUA 2GGJA 2PP0A 3SN4A 4ROPA 2QJMA 3TJ4A 2QDEA 2OO6A 3ENLA 2QGYA 2PODA 3T8QA 2PGEA 3R25A 2AKZA 2OLAA 2QJNA 2P88A 3ZLHA 3TJIA 3OP2A 3ES7A 2ZC8A 2XSXA 3S5SA 4X2PA 3CK5A 2OG9A 3FXGA 4M0XA 4DYEA 4M6UA 1EBHA 1F9CA 3RITA 4Z17A 2PGWA 1TKKA 3RGTA 3T6CA 5IDZA 2I5QA 3CYJA 4K8GA 4G8TA 3I6EA 3DG6A 2P8CA 3QPEA 2HNEA 2PPGA 3GC2A 3N6HA 1SJCA 3FVDA 3D47A 4GGBA 1IYXA 3CT2A 3UGVA 3DDMA 4ENLA 2XGZA 2HZGA 4H83A 3PWGA 4E4UA 4E6MA 2PTXA 3P93A 3UJRA 4GYPA 5ENLA 5FJTA 3ZVHA 4KPLA 3DERA 4GIRA 3FV9A 1KKOA 2NQLA 3GO2A 2OX4A 3MWCA 2OZ8A 4DX3A 1EC7A 1MRAA 3D46A 3H8AA 4JN7A 3CXOA 3BOXA 4HCLA 3PWIA 2RDXA 3DGBA 1FHUA 4IT1A 3GY1A 2PP1A 3TQPA 1KKRA 1E9IA 2PTYA 4IP4A 4H1ZA 2QJJA 3TW9A 4FI4A 1MDRA 1OEPA 1SJDA 3PFRA 3R0KA 3VC5A 1JDFA 3NFUA 3RRAA 1TZZA 4F4RA 3U4FA 3FYYA 1BKHA 4J3ZA 3MKCA 2XH2A 3N4FA 3CB3A 3MSYA
chains in the Genus database with same CATH superfamily
2YPIA 4LYRA 1F8IA 1DJXA 1QW8A 5EMKA 2XG9A 5A8QA 2RGLA 4A8NA 2Y89A 1CT5A 4WOZA 2WYSA 1AQ0A 1KM5A 2IPJA 2BGSA 4X2RA 1XIMA 1VRXA 4HCHA 5C9UA 1PYFA 3ZT5A 2O9RA 1JGIA 3CUGA 3AXMA 3QSRA 3GH5A 3VABA 4DJFA 3QLLA 3PB0A 1GT8A 1E6ZA 3CWHA 2F2HA 3CZKA 2ZXDA 2R8WA 3KCJA 2XUCA 1ZK7A 4LUJA 2XIJA 3M4HA 1SFSA 2D2GA 3O16A 4IFKB 1OY0A 1OFEA 2G50A 4NZCA 3M0LA 3R6IA 4WJEA 1JPMA 1LVLA 4MY9A 4J2PA 2JALA 2ZA3A 3NXLA 4DAFA 5XIMA 5LYRA 3RLUA 5EL1A 4MG4A 4AZIA 4Q8UA 2PF0A 4TVYA 3AHXA 1UOZA 4QQUA 4L4PA 3I6TA 4BFAA 1VHNA 4HD5A 1QRQA 4IISA 1RJRA 4LS0A 3VU2A 2PBGA 4ADUA 2ODOA 3LCIA 1D3HA 1LP6A 1B3WA 2ZRZA 4NEVA 4Z1CA 1G9HA 3W84A 5A6BD 3WDHA 4AD5A 1W17A 3KUMA 1PWLA 1M04A 4Y9PA 1NF7A 2V5DA 4WGHA 3NVDA 4GXWA 3A12A 2VT0A 2OSYA 3IV8A 3N3TA 4Q8PA 3IGUA 1U1HA 1VP5A 1LQ0A 3AHTA 1UQYA 4ZOCA 4PMJA 3V4BA 2G95A 2VEIA 3VGFA 4A6GA 3STEA 1P0BA 2NV9A 3B0YA 4MDPA 4DO6A 1REQB 3GX9A 3V5CA 4AD2A 1DXFA 3BQ5A 4H9YA 1W2VA 3DGRA 1HL2A 1EA9C 3WD1A 1LQ2A 3MDUA 2GDQA 4NAEA 2CCRA 3V7PA 4UTUA 3O7UA 4RZBA 1C9WA 1X8CA 3EWYA 3CIVA 2CHNA 1GHSA 1TG7A 4YXGA 5A2AA 2E3ZA 1DV7A 3W53A 4QEHA 1UKTA 2CHRA 3GDBA 3TTEA 2OU4A 3VGEA 4EKJA 1N82A 1P0NA 3ITXA 4AX7A 2ALRA 2UY3A 2WM1A 4IPNB 4KESA 3WFAA 4ACYA 4FDCB 3VINA 3CPUA 1R5YA 1IIGA 1BXCA 3AMDA 2QAEA 5LHEA 2ZUNA 1TWDA 1UH3A 4PBFA 1XXXA 1Z8AA 3QC0A 3WEMA 3WX7A 1RK6A 1KB3A 4P8VA 3GNNA 1L6FA 5FL1A 3HGJA 4LUTB 3WQ4A 1HVQA 4WIWA 3FXYA 2VHLA 2VQTA 1N8FA 1LM1A 4LUSB 1GOOA 3U3HA 3QHMA 4JTRA 2ALDA 4JKKA 3REQA 5EBUA 4XISA 3W75A 2ZOXA 3SW6A 4QJ1A 3DESA 4PSRA 3POCA 1KGXA 4U5IA 1GOIA 1GWJA 1PZ0A 4CVUA 1O94A 2X1TA 1UPPA 5D33A 4HMCA 4S23A 4XWUA 2W67A 3JUGA 2INZA 2DQWA 1KBBA 4IH3A 3UVIA 4GABA 3H4WA 2WJFA 3B0UX 1CECA 1H62A 3C5QA 1P6BA 4B91A 3IUIA 4R88A 1W31A 2GPTA 1IR2A 2GZXA 2J7HA 2PWVA 3GHTA 2R1MA 5A2CA 4P7LA 3L66A 5HJYA 5ECUA 2PI6A 5HANA 1MDLA 3DG7A 3TX9A 1VIWA 5F4XA 1V02A 2FHFA 4KGJA 1DWIM 4ZCWA 1A50A 1V3HA 1ZTVA 3XISA 5HWMA 1SZEA 4JTKA 3L21A 6REQA 1HKKA 2YFNA 4XG1A 2XIMA 1VFMA 2D2OA 4ADSA 4QXIA 1R9YA 3QMSA 1P6WA 2XGIA 1TVNA 4ROPA 1A80A 4MF4A 4OGZA 4JTEA 1V51A 3OLEA 4AYSA 1S7MA 1OIFA 3SEPA 3KRBA 4YU1A 3E0FA 1XIIA 2O0TA 1B90A 2EG7A 4CQ9A 3CZEA 3CAVA 1GVQA 2VQUA 2HPMA 2PGRA 2ZUVA 1XGEA 3WF1A 1KFJA 4JTUA 4C1LA 2TRSA 3TXZA 2YVJA 4HGXA 3UR7A 3WQVA 4FEZA 3TYBA 3ZR6A 4EACA 4YMZA 5K9DA 5IDZA 4TTUA 4ZOEA 2REQB 5C9ZA 2OO0A 4J27A 3RK8A 4O1FA 1LLZA 3NPWA 2OWCA 4F0MA 4Z2KA 1DIOA 3EWUA 4NJJA 1M68A 4MDOA 4CNPA 3CT2A 4GACA 3WF0A 3GDLA 3GH4A 1QO2A 1T7LA 5U7SA 3QQ1A 2QT3A 2SFPA 1B3ZA 3NYDA 4GYPA 4YHGA 3E0WA 2BHYA 2G41A 4V1YA 3FV9A 2NQLA 3D46A 3MP4A 1E0XA 3HJZA 4CD5A 4JICA 5CG7A 3PTQA 5HQLA 3SCPA 3VZZA 3LG3A 4H6RA 2XYLA 3ARXA 3LXBA 4O53A 3CL7A 4GBDA 3SUTA 2BXVA 3MTWA 4PMUA 3TQPA 1KKRA 1F6KA 2E6FA 5CSRA 1E9IA 4H6KA 1VFFA 3SUWA 2CERA 4CU6A 1A49A 4H8HA 2RHGA 1EBDA 1SSDA 4WGXA 3AMGA 4HA0A 3URBA 4MWAB 2HE5A 2QVNA 3NFUA 5D9MA 4MIMA 2NVCA 2DZTA 1AMYA 1XLLA 5LGXA 4JL2A 4AD0A 1JZ4A 4KCWA 2QCNA 3LX9A 4O1BA 4LF1A 2QLYA 4LY4A 1JNEA 1S39A 1UBPC 1CB7B 3M47A 1UW9A 2XIIA 4IFOA 4Y96A 3A4AA 1US3A 1DHKA 3LXDA 3NYZA 1OGBA 1ONEA 2IXVA 1LL7A 1F4HA 5J04A 3JS3A 1H2JA 2P3EA 2UZ9A 4MHBA 3GD3A 4A22A 2UY2A 4JTQA 2FYMA 2Y8VA 2CESA 3V0SA 5KVHA 1VAHA 2W3SA 2Q8ZA 2WC4A 3S1XA 2VGBA 3WMLA 2I5GA 3SBFA 4HNUA 2WP5A 2ZZ2A 2VC7A 1TPC1 2EPMX 1FKWA 2QCFA 5D04C 1V6VA 5DRCA 3GYCA 1MOKA 3BLPX 3MUCA 5IDIA 3AXHA 5DLCA 4ZSTA 2F84A 3IAPA 4NEWA 3WH5A 4C6NA 4UUIA 1SPQA 1OCQA 3QV6A 1ZENA 2IPWA 3NDOA 1I0DA 1NWUA 1H1ZA 3GU9A 5H8UA 3UP8A 4TO8A 2VCCA 4H7VA 1GOMA 4XZNX 3L4VA 3UESA 4ML9A 1IIHA 1X98A 1VFUA 3ANUA 4FXFA 3NGJA 4S2BA 1PZ2A 3PF3A 5A6BA 3UZJA 2BDQA 3LN3A 2WPEA 3EA1A 3M44A 5I23A 2A5HA 1VENA 3P61A 2F7FA 1YXDA 3RPMA 4HA4A 4D71A 2UY5A 2WNQA 3AO0A 4NXSA 2RJHA 1A5LC 3SQLA 2ZZ7A 3VKCA 2AOSA 4HT3A 5FF3A 4XBJA 2RKXA 4CD8A 3WLMA 4GK8A 1NIUA 4AZHA 4CN4A 1GGOA 3W1TA 3AIEA 3PZGA 5DFAA 1JEHA 3K30A 2BVYA 2R82A 1CLKA 2F2KA 3OU8A 4N4QA 1BWKA 3WLRA 3L5MA 4IQEA 3DAQA 2BC1A 1KA9F 4WD0A 4YVXA 3O05A 3SUVA 3VAVA 3WLLA 4A2SA 2GSHA 3GVQA 1ICSA 3CLWA 5G2WA 3EOSA 3EAUA 2GH5A 4H8VA 2DDXA 9RUBA 1W5PA 2WLZA 2J9ZA 4KT2A 2X7VA 2YYTA 4ZO7A 1ZHAA 2EQ9A 2VM8A 3ANVA 2VX4A 5D37A 5MF5A 1CYGA 5I02A 1CWYA 3GNXA 4UQCA 4N9BA 3PC0A 5C2CA 3DG3A 4JFVA 5C9XA 5I09A 1FECA 1J79A 1FWNA 2Y7DA 1XKJA 2PDHA 2BY2A 1TFVA 1KN0A 4HSHA 4RNHA 2Z2BA 1Y65A 2W54A 1HG3A 2ZTKA 3U2ZA 4XTDA 1XH0A 3CUZA 1EDTA 5AYZA 2X41A 1FDYA 2DIEA 1FIQB 4APNA 2XH4A 4GISA 4Q8MA 4YVPA 3KAOA 2H8ZA 3AFBA 1NJJA 4MAVA 3GRSA 3UJFA 1XM3A 3NA8A 2C3DA 1MEHA 3V1HA 1MO9A 5AC5A 4G7FA 5BNKA 1XL9A 5GJNA 1QJWA 4QAWA 4D6HA 2J78A 4F8XA 3V36A 1HGWA 1FWFC 3O6AA 3A24A 2YW3A 5D2XA 3PZMA 4ZQOA 5E9AA 3IK4A 2W0HA 2QCMA 5I78A 3NSXA 1NM9A 2CBVA 3PJWA 3VOCA 2Z1WA 2DIKA 4IL0A 2Y70A 1V03A 4FPSA 3C0LA 5GNZA 3PZIA 3LPGA 3GAKA 5CLWA 4XKMA 1W1VA 4PUEA 5K7JA 1MEWA 1OYBA 4G2DA 1R85A 2H6RA 4J3UA 2F38A 3C2VA 4AZ5A 4GY7A 4OHQA 3VX1A 4LUTA 3TYZA 4EF9A 3W7HA 1AH4A 5EY5A 4CEXC 5FS8A 3T8QA 3R25A 4DWSC 2V82A 5M5DA 3LCGA 1V3LA 1DXLA 1O60A 2GJXA 3ATZA 4BI7A 3BOLA 4YPJA 2ZC8A 4QISA 3ICJA 1L8NA 1SUXA 2WVSA 4MYXA 1MNZA 5AB3A 4JTLA 2X16A 4M6UA 2I1OA 2PGWA 4O12A 1JGMA 4L7ZA 2BGQA 4HK5A 4QCFA 2CLEA 1IEVA 4G8TA 3LHWA 2CBUA 4GIEA 1XG3A 1QWKA 4HPGA 4LXFA 3FHQA 3OODA 2FGBA 3HPZA 1EOMA 1EJSC 1T8XA 4QG9A 4BI6A 3G0XA 4MNKA 3W02A 4KCUA 3QJAA 4GRTA 1F4AA 1OIMA 3ZVHA 1S2CA 2TAAA 2BXZA 2QUVA 1FWIC 1IGWA 2Y2WA 2B4GA 1RAKA 1O12A 3TYCA 2YVGA 1EC7A 1MRAA 3WD2A 2OYLA 3HIJA 3WELA 3ANYA 3W01A 4LBSA 4GBUA 3BOXA 4G56A 1NH6A 3G3DA 2CLOA 3PWIA 4QITA 5U25A 2ZBTA 3R89A 1KFLA 4EP8C 2WKJA 1X1OA 3WFZA 3W7KA 1B57A 1UD8A 4NYYA 2WLYA 3GFXA 4Z08A 2HSAA 5CH9A 1OT2A 1JCXA 5AECA 5G4WA 2VC9A 2QF7A 4GNKB 1BKHA 2JKEA 1UP0A 3UQNA 4R3UA 4AVNA 1D2KA 2NT1A 2XWEA 3URQA 1MQPA 2HXUA 4XUYA 2Y62A 3PPGA 4H9ZA 5CJNA 2Q01A 3AUOA 1HO1A 3TTOA 4OOUA 4HPHA 1T8QA 1ODZA 4K38A 1AUSL 2V5JA 1EEXA 4PTNA 3QN3A 3JVAA 3EWXA 3O07A 3PULA 4DJDC 3MSRA 4IZGA 3EANA 2VENA 5F4SA 1QASA 1X8FA 3WD4A 3S2LA 4XBSA 3LEPA 3D5HA 2FKPA 3WH6A 1SFLA 1ADSA 3E96A 4ZQMA 4LV4A 5I3HA 4DF0A 4XKYB 3G8EA 1DJHA 3E0IA 1R3VA 4FF7A 4LYQA 3TNBA 1SYTA 2ZRXA 4B5WA 4S3DA 3TMQA 1TWSA 3KS6A 1W2PA 2QCEA 4R53A 1TWWA 1NF0A 3OBEA 1FWGC 3I7RA 1E55A 3S1UA 4DI8A 3D9XA 4UTHA 1KTBA 3R8GA 3CLMA 3OOQA 4XUGA 4NAFB 3EWZA 2CPUA 5HXMA 2R91A 1TE6A 4HK6A 2O4MA 4DWSB 4P8XA 4HOWA 4A35A 1TJ0A 2ESCA 4B9YA 1OFRA 4Z42C 1PDYA 5E0KA 4MB1A 1UWTA 2C6QA 2J27A 1R8LA 4C6QA 2CHOA 1H63A 3GVWA 4LRTA 1AQFA 1JRCA 3MI6A 4UXDA 5DT7A 5I0DA 2V67A 1Y5XA 2CETA 1VCGA 2ZRUA 4HU4A 4RDVA 4O1DA 4HNCA 3CMFA 1UD2A 3NIYA 4IQDA 1ITQA 4UTKA 3WNMA 2R24A 3ZVIA 4B3ZA 3W27A 4PUDA 3W83A 4CN6A 2QKFA 2G0WA 2VRKA 3WBEA 4H3DA 1H11A 5HWJA 2OELA 4IMEA 5K3VA 5C8BB 4GVHA 4MVAA 1UB3A 3R0UA 3PG8A 1GEQA 4ZO9A 1XS2A 3QZ6A 3WUEA 4MSSA 1EGZA 4Y9NA 1XLIA 2YQUA 4L4MA 4AHPA 2ZWYA 3T40A 2P3ZA 4CNNA 2J7CA 2GGGA 4S3AA 5I6SA 1ZS2A 3GD6A 2HK0A 3VNJA 3MMWA 2WANA 3V3WA 1K9FA 4JQ1A 3AIQA 2VP8A 4JNYA 4H8NA 4WSKA 4I9TA 4B5XA 4GH1A 2GVJA 7PTDA 1XIHA 2WSRA 6ENLA 4LEFA 1E0TA 1S2TA 4A8LA 3S47A 3WSUA 1A47A 1WBJA 1BWLA 1CX9A 1VBHA 1Y0EA 4OBTA 1PTDA 1OHLA 2GR3A 1C9DA 1H7PA 2E1DA 1QO5A 4GUGA 5A2BA 2OX1A 1XIFA 1DYSA 1DXEA 4Z2JA 4QDPA 1X2HA 2YVFA 1SR9A 3L8KA 3TOPA 1VBJA 1Q8JA 3LQLA 2EO7A 1JF5A 1ITCA 2NX3A 1KFBA 5HPOA 5EU9A 4WVXA 1WKDA 2Y85A 3M1ZA 5JMUA 3FIGA 4U2YA 1HKVA 3T81A 5AOUA 4AEEA 1I9CB 2VZOA 2PDPA 3S1GA 2OQYA 2PRMA 1IF2A 2B7PA 2CYGA 3HA1A 3SGUA 3SM0A 1HL8A 1R6WA 4WJXA 4WQ6A 2CC0A 3PBMA 1YX1A 2JKPA 3SCTA 1KXVA 4NVTA 4O13A 1KLYA 2OKTA 1LL6A 3WQEA 4HPNA 1RD6A 1M7JA 1G1YA 4F40A 3IK2A 2GDVA 3FGCA 3EDKA 3RPTA 4ZXOA 4UCGA 4LBUA 3U5UA 3F7JA 1T0OA 1R2TA 3HPXA 2CIPA 2QDEA 4Q8OA 2WMIA 2NXIA 5CZ0A 4JYEA 3DHUA 2QJGA 3AIRA 4PMRA 5FEPA 4W4QA 4E2OA 4BQ3A 3H4GA 3QY7A 1C8VA 3RLVA 4V28A 4A2RA 1J2BA 4QSFA 2ZZ0A 2HVNA 3E2VA 3M5XA 5FEWA 3VNMA 4X2PA 2EPLX 4JEQA 4PTVA 4C6BA 4LS2A 2MANA 4L65A 4GINA 1J11A 3USBA 3HM7A 1ZPTA 1J6PA 1MW1A 3B9OA 3ARSA 3W2MA 1OB0A 5AYBA 2E25A 3M0IA 5KTLA 2Y63A 3KHDA 2PDYA 1FWDC 3G6MA 3RYSA 1R7OA 3CHFA 2W5FA 4JQ2A 1RBOB 3L0KA 5DEZA 3MUAA 5LXXA 1K02A 1A5KC 2I56A 2J47A 1DIEA 4GI8A 1PX4A 2WBGA 2VVNA 3TV8A 3G77A 4H4VA 4H9MA 4CCEA 4FNRA 4JN7A 1FFQA 2I57A 3UZXA 1LDCA 1XYBA 3WMSA 4R7OA 3VKKA 3GZAA 5FSEC 3GB6A 3HG5A 4TX6A 2G4FA 2ISWA 1YLVA 2VMFA 3E9AA 1UOKA 1B31A 1G7UA 4NNAA 2BS9A 5AFDA 4C6PA 3MU7A 3KTXA 3ARTA 3GUGA 4DI9A 4F48A 2QS8A 2DH3A 3W7LA 3AYSA 2QV5A 2NQHA 2INFA 1JDFA 3VC5A 1QHPA 2Y5JA 5D05A 2WZMA 4S3GA 1XHCA 2OSXA 4WF7A 5JCMA 1XD1A 4F4RA 2Q02A 3PUOA 4QX4A 3W86A 1YQZA 4JX6A 2VL4A 3T7VA 2VEFA 3GKFA 2WAGA 2YCJA 1DJNA 3S46A 3FSTA 1EWDA 3A9IA 1TE1A 3UXDA 4F0LA 1RZMA 3W4RA 1EH9A 4AG0A 2QVHA 3THDA 1TO3A 3L5AA 1N5XA 1HXJA 1DHPA 3PJTA 1KWKA 1AW5A 3TSDA 4DLFA 2RDTA 3BCJA 3UWZA 3MMTA 1RR2A 4NI3A 2GGIA 3SCVA 4L61A 3W82A 5D9OA 1OSEA 2DZXA 2YDAA 3NL2A 4LVFA 3OQEA 1BRLA 3VM7A 4LVBA 1E6XM 3G0SA 1O6IA 3TZNA 1XCFA 3VIKA 3VVGA 3GTHA 2WNZA 4BEUA 1BG9A 1C93A 3ITCA 2GLKA 3B06A 3IPWA 3EB2A 1BHGA 4KGLA 3H7VA 1KCXA 1Z3NA 1MUWA 2V5KA 1UIOA 2PDUA 4IICA 2WW5A 1IZKA 4FB7A 4UTWC 1MWOA 3P74A 4Q8TA 3TXVA 3GBDA 1JCLA 5BZAA 3SY8A 2ZE3A 1Y8BA 4DUVA 3TYAA 1B5TA 2PCEA 4BF9A 1NDZA 2Z6JA 4HTYA 3S6DA 1A3WA 1O5RA 1EXPA 2DSZA 4PR4A 1OC6A 3DI0A 2DZPA 2PWGA 3IRDA 4DWSD 2Z27A 4MGGA 4DHGA 4P2VA 4ERGA 1GRGA 3N1AA 1O1HA 3H23A 3IARA 4Z2HA 1EC8A 3QYSA 5DRIA 3K8LA 4LVDA 3GRTA 2XSAA 3VFLA 1G4TA 3R1ZA 5HUOA 1ZKQA 3WF4A 2RDUA 2PWEA 2WCSA 3V5FA 3MMUA 1YDYA 4PCPA 3GTIA 1H7RA 2WMIB 4V15A 1AH3A 2Z29A 3P82A 4US5A 4ZQRA 4NKCA 3CQIA 4I7UA 1J5SA 1YTKA 2DUXA 2WOWA 4AZ6A 3MB9A 1UPMB 4M56A 1TJPA 4XVDA 1LOLA 2OOGA 4GMEA 3CB8A 1S2AA 4RK8A 2P0OA 4UQAA 1CPUA 3HU7A 2D0GA 4DXXA 3PK7A 3ITVA 2WNNA 1W3TA 4K8EA 2NV2A 1HUVA 2PDFA 3B0XA 2WM0A 1OZMA 2ZUWA 3W71A 3IANA 3OHIA 4L80A 1B3YA 4BK9A 3BAYA 3AIVA 2QUUA 3DENA 1C7SA 1W9DM 2X8GA 3YPIA 1CNVA 3MP3A 5AYYA 3PBWA 4Y8FA 2XM2A 1GVIA 3CV7A 3VM5A 2BV9A 1M41A 2XH0A 4GQQA 3FYPA 3L12A 4ZR8A 4ZVJA 2OJPA 5G2IA 2XWDA 1LOSA 3F4WA 4WK9A 3CQKA 2Q6ZA 3VX0A 2ZRYA 3ARUA 3Q4DA 3VIMA 5JBDA 4RE3A 2WJEA 1NAL1 5T9CE 3S83A 2ZYFA 3D6NA 1W3JA 4LPCA 3EPMA 4GI9A 4WUIA 1I4NA 1OX4A 3G8RA 3S1VA 1SW0A 1RLDA 2J25A 3AI0A 1ICQA 1XLGA 3O6CA 4W8LA 3AOFA 3OZYA 4RR4A 2NSXA 1ZGDA 4K36A 3U2EA 3GUWA 3QR3A 5FS9A 5CZSA 4OECA 4LCQA 1HIZA 2VX6A 3Q94A 3E74A 3MHGA 4C1KA 1UIPA 3HQNA 4FXSA 2BASA 4EMIA 3LBOA 1ZMDA 4KBXA 4TXEA 4EE9A 4X9YA 4HOZA 4DJFD 2D1ZA 2W0UA 4H19A 4KRTA 3FDGA 4ZOHB 2W66A 1IWAA 5FJUA 4IUGA 1XFBA 1CGVA 3AQUA 5XIAA 4D6EA 3U0HA 4Y9MA 4DIAA 2YIHA 4C5YA 3WQOA 4GUFA 4HZ7A 2OO6A 1BWCA 2QGYA 3DBNA 1R3TA 3KVLA 2QCDB 2G3NA 2DT1A 1X7FA 2WSKA 2P88A 1RA0A 1NEYA 5A1AA 3PSVA 2VC6A 5TBOA 2X30A 2V0TA 4L64A 4EXQA 3OVPA 4ZQNA 4GVGA 3N2OA 4AWSA 1ME9A 1VFHA 3FJLA 2QUNA 4W87A 3V0TA 4Z17A 2GR0A 2RGMA 4LSBA 2V3DA 4BF7A 4C6IA 2EEXA 1OC5A 1AZ1A 2O4QA 1IGSA 3GC2A 3VMNA 4DNMA 1OF8A 3E0LA 1K8ZA 4O0KA 1LUCA 1H6VA 3PBVA 1J0IA 3LHYA 4XV0A 4D8AA 4IXXA 1JD7A 5CJ5A 4JTHA 3TN6A 1TRIA 1XSKA 3P93A 3ID7A 3UJRA 1Z7AA 4RDYA 1YDOA 2ISDA 1B9BA 3PJXA 3GC5A 3VNYA 4ILSA 1KV8A 1OABA 3WQ6A 5JBFA 2FH8A 1M5WA 2BBFA 2Q3OA 2OODA 1P6CA 4FNQA 1US0A 4IG2B 1Z89A 2VEMA 4O14A 3S6OA 4I5XA 4RE2A 5AHFA 2PP1A 4UZUA 1EA0A 2D69A 2NXGA 2E40A 4XAYA 5I3DA 3BGGA 1NDAA 4K3ZA 4QBXA 1UJPA 3EX4A 3SJ3A 2P10A 2PTDA 2EQDA 4CLMA 3HF3A 3AU6A 1KCLA 1IT8A 1RA5A 2EQ6A 1DP0A 1EJVC 1H61A 3V1PA 3LB8A 3NQFA 7REQA 2X0HA 4P7NA 4DEFA 1SZGA 4Q7IA 3KWXA 3O1NA 3MSYA 3WBWA 4TX9A 3S9YA 1VJSA 1WUFA 1NWRA 2VFFA 2BMBA 3LRLA 2XGBA 3WJZA 2YKKA 4M1BA 2HVMA 2XDFA 4RKAA 2NT0A 2I17A 4Q8NA 2ZRWA 1VQTA 4DUWA 1FP8A 3TLLA 5D30A 5U4NA 4ES4A 3OLIA 4GJ1A 1ITXA 4QS6A 4DM1A 2J6VA 3ES8A 3RO6A 4KFNA 3T1GA 2DJXA 2FTYA 3KX6A 5HK4A 3EDFA 5KZEA 1PDZA 3W1AA 5I77A 5C71A 4HHHA 2YX0A 2RUSA 5DBTA 4CCDA 3PZTA 4O15A 5CPNA 2VCBA 1E6PA 1JZ5A 2F5ZA 2DT3A 1GOKA 2VYOA 3U48A 3W7IA 5AC8A 2PWUA 2Z2AA 1B3VA 1NU5A 3ZM8A 3CV6A 5G5GB 3WN6A 3DK4A 1KRAC 3QM3A 4GYPC 4IHCA 4K6AA 1PHQA 3BG9A 4FLSA 2FPTA 4XD4A 1FA2A 3TTYA 1BPLB 3Q2DA 2HVOA 3C52A 1HN1A 3GE7A 4QJ5B 4F3HA 3PTDA 3UPWA 2I14A 3PM6A 1RSCA 3DC0A 3BJFA 1T40A 3DJJA 2Y61A 1Q7ZA 3PBYA 2GJRA 1OM0A 1MW0A 1ONWA 3W2KA 2PZ0A 2V2HA 2V81A 3UZZA 1GQLA 4OT7A 1QFEA 3STFA 3AC0A 3W6MA 3L2IA 4LAZA 5AYXA 2FFCA 2Y88A 2R1PA 1W5QA 4IIHA 3BG5A 4HNVA 1K9TA 2GSJA 4YLWA 3F4CA 4U10A 4IJBA 1SJBA 5BRQA 3G3MA 2YFOA 1NPXA 1ZJBA 4I9JA 3VE7A 4CUCA 4F0SA 2J24A 5JQ9A 3LB0A 1QOXA 4PMYA 1J96A 1YRRA 1PYMA 1VYRA 4XZWA 4PUJA 5CAHA 2DW6A 1JPDX 3IIPA 1K6AA 3CAWA 1I2NA 1BVNP 3WQCA 4LAOA 4ZTYA 5I3KA 2ZUUA 3UR8A 4AIOA 3Q37A 1DQUA 1HX0A 1UQZA 5D2TA 3L2LA 2ACUA 4Z2LA 2PRHA 3D3AA 3FHAA 3P8IA 2Z1KA 3I68A 3F4VA 3VD4A 2R9RA 1PBGA 3UY8A 1R3RA 3C86A 5ABFA 5G4HC 1J8VA 3NQCA 1DQWA 4R5EA 3MA8A 2POTA 4YNGA 3GDKA 4UFLA 4MB3A 1WBHA 2BZNA 3OYXA 1S1RA 3LLXA 4LUSA 3LLFA 2VKZG 1IXOA 2ZX6A 2V3GA 5ABTA 1OCNA 1E4LA 4U28A 3U6WA 4J3TA 1PE1A 1JCYA 3CWNA 1GQNA 3NQMA 3T78A 1TV5A 4GQ0A 1L6YA 4MNMA 3G1SA 3LM7A 4GQGA 1QHOA 5ABGA 3C6CA 1UR8A 1A0DA 3WIJA 3ARWA 4LAMA 2CBJA 2C18A 4F2TA 5C55A 1HP4A 3W73A 2NVAA 1JDAA 2FHBA 4H00A 2QCLA 1V97A 1XLKA 3BSGA 1EO5A 2YYUA 2C1IA 4J2MA 4OUIA 1OGSA 3LGDA 5IFPA 4P61A 3MCMA 1H41A 3LCFA 3CZJA 2VFHA 3GQYA 1OGGA 4TOQA 1BAGA 1I1WA 2Z1VA 4C6MA 2FZDA 2VD9A 4JIEA 5AVNA 1MZHA 2VX5A 1UWIA 4B9ZA 5ABHA 3WF2A 2NUYA 4M19A 2X42A 4M81A 1K70A 3SN4A 3AIWA 4ZB2A 2CLKA 2QJMA 1DBTA 3AIUA 1LBLA 2YXXA 3MV11 3VE9A 1HJUA 4MLJA 4AEOA 3R8RA 3QFWA 2XSBA 1R46A 3BOFA 2PODA 3NJ3A 1PTAA 5A69A 3U5YA 1F6YA 4BF5A 3UT0A 2B31A 3OVGA 3WQDA 5CC6A 3RPDA 2PRLA 4AZGA 3GXDA 4EX4A 2C1GA 3TDFA 2J4GA 4MFDA 5AYIA 4WEVX 1JZ6A 3MO4A 4QE1A 4DJFC 3T6CA 1NFPA 1Q65A 1VS1A 1J93A 1VBUA 4QJ3B 1EHAA 1WKYA 2OZ0A 2GQ8A 5TQLA 1GKPA 3N6HA 4CGTA 5FAJA 3V16A 4ORMA 1UMLA 4DLMA 4J7RA 4X0VA 1KR0A 3QVQA 3DDMA 5H91A 3M0XA 4GKLA 4FNPA 2RH9A 3GNOA 4PC8A 3BLLA 1PTGA 4AD4A 4EWND 1W8SA 1KKOA 3G1RA 4CU7A 1TYPA 4LW7A 3E12A 1XRTA 1VBRA 3LXCA 4MWAA 3F2BA 1W3HA 1VQZA 4DO5A 1JPHA 1ZCOA 3M6DA 5I06A 1ONRA 2PLCA 4NZJA 1AQHA 4TV5A 4YTTA 3L7RA 1EPXA 3G5EA 3GW3A 3C56A 3QMTA 4YJ5A 4H1ZA 1FUYA 3BCFA 4WOQA 1MDRA 1Q6EA 2NUWA 3BW4A 1EZ2A 3TTSA 3ZJ8A 2ZRVA 3CGDA 5MKGA 4QCEA 5DCDA 1W32A 4Q3MA 3TNOA 4ZE5A 4BR1A 1JD9A 3QFAA 1A3HA 2WNWA 1OYCA 1GNXA 1KR1A 4Q4RA 4LRSA 2YDSA 3CB3A 3RR4A 2E3TA 3GIYA 4NHVA 1L6GA 3TR9A 5A6MA 3SAZA 1VDVA 1E1FA 1E1CB 2J79A 4EPDC 4YTRA 2Z4GA 1J0JA 2OEKA 4HBKA 4R34A 5EKYA 4ZSUA 3CO8A 1NQKA 5DY3A 4DBWA 2BY0A 3B9NA 3ABZA 3N2XA 4Q8QA 3LK6A 4Q4SA 1FY6A 3M0HA 2PTZA 3EDJA 4O11A 2J77A 3DCPA 3EKZA 5FJOA 2Z24A 3BLKA 4OVXA 4FX9A 3LGEA 4OIFA 3Q6JA 2VZVA 1G7VA 1Q63A 1GHRA 4LQ1A 3FG2P 3LU2A 2HPIA 3IGSA 1JCNA 4H7CA 6TAAA 2WQPA 2V3EA 1FHVA 1EJWC 3RU8X 3M64A 4QS5A 2Z00A 4HU3A 4GCXA 4GHRA 1DWAM 4PRRA 3OVQA 1SR0A 1V6TA 1CXEA 3WDQA 3VD7A 2DVUA 3N9RA 4WDWA 3GKAA 4P5UA 4TVDA 1U5HA 3H55A 1UKSA 4QP0A 1V6WA 5CZKA 3EXRA 1XX1A 3THQA 1YMYA 3P14A 3TROA 3LERA 2X50A 3UD6A 4DBUA 3B97A 3SRKA 5IM51 3SRDA 1CGTA 1ZJIA 5F2MA 2VEKA 1XD0A 2JGYA 1E9LA 2PSNA 3UR2A 2WHMA 1GRBA 1OJXA 2AAQA 2Z7KA 2QR6A 5F1UA 1TVLA 3LBMA 3JW7A 4Z2IA 5F1VA 1KM2A 4J3SA 4IFRA 1VGAA 2DSVA 3RUBL 5CPTA 3INPA 1A4LA 1HJWA 5LIYX 3WY1A 1OFDA 3LXAA 4UMAA 3ZOAA 9CGTA 1UR1A 3LZ3A 2VELA 3BAWA 3UEQA 4M6VA 2DZBA 3NVWB 3GW0A 3PNZA 5EMJA 4HHPA 4JPGA 4GVFA 3W7DA 1PZ1A 5DXXA 5HUPA 4DZIA 3VXGA 2C16A 3G24A 2JIEA 5CZJA 4W7VA 4F2UA 1XRVA 1W6TA 3B8IA 3TN4A 1UD5A 3P62A 1B4KA 4GZEA 4LTSA 2W3RA 4CD4A 3WEOA 3N18A 1SZFA 5B80A 2WVVA 2PDGA 5IXEA 3CUJA 1QW7A 3TAKA 1DKWA 5KETA 2J88A 4K39A 3WDRA 3MCOA 2V2DA 1XICA 3Q45A 1TTJA 1ZAHA 4KMQA 1V0NA 2DIJA 4CQ8A 1J10A 2VC5A 1EYWA 1XPGA 1N8WA 3KLLA 1TSIA 5L9FA 5KITA 1SFJA 2QAPA 4BY3A 1P7TB 3WYZA 5M03A 1EX5A 1L6WA 1Q8AA 3ORWA 4Y2WA 1Q6CA 5AVHA 4ZB5A 2BVDA 4TVUA 1KM6A 3CGCA 4IL2A 2JFEX 1QI0A 3WNLA 3KLJA 1GG1A 3O0KA 5LIKX 4FR6A 1MXGA 4ZBCA 3E0VA 1YDVA 1KD0A 4AD1A 5B7ZA 2XN1A 2E09A 3RO8A 4NXKA 1WAWA 2PDWA 1JUKA 1F3XA 1H1NA 1PVNA 2J8GA 4IMAA 3W9ZA 4BQ2A 1OK4A 2Y7FA 2IKIA 2HBVA 2Y6ZA 3H2EA 4WRHA 4EM4A 1ELSA 4M82A 4EPBC 2ZDRA 5CEWA 4S3CA 3QXBA 4QE4A 5C5YA 3G2GA 4W5ZA 2D73A 3NEVA 2E0PA 2DSKA 4I6KA 1GVSA 4D6GA 3U9IA 1PO9A 9XIMA 1GQKA 1NOUA 1W91A 2J62A 2O7SA 3SN1A 4JFTA 3LSCA 3PBUA 4WSJA 1F3PA 3WQ5A 1E73M 4JDYA 3AS3A 4JXCA 2PP0A 4W89A 5H8PA 1V7AA 4C6CA 3THAA 3AMCA 2ISFA 3HG2A 5IRPA 4EPEC 5A8PA 1FCBA 3AIBA 1SZRA 2PGEA 2FIQA 3WNOA 3NOEA 4E4PA 3WMBA 1O66A 1UZ1A 1HP5A 1XGZA 4F2BA 4LUYA 2V5LA 4M3PA 2OLHA 1Z9AA 3NG3A 3OG3A 3CU2A 2OG9A 4B2DA 5JVLA 1QK2A 4WDXA 5CBJA 2C3CA 1NFGA 1MXSA 1TV8A 2NSOA 4IIFA 4GCAA 4QJ4B 4H4XA 1PSCA 3K1DA 1V3MA 3CUFA 4V1XA 1W3NA 1JVNA 3QQWA 2CLPA 2OB3A 3W26A 4M24A 2CZ5A 2OGYA 3VNIA 4MAZA 4ENLA 3M9YA 1SU5A 3OG2A 3DFTA 1XDMA 2JGQA 3I4EA 5ENLA 5BCAA 1DJZA 4B5NA 5HMDA 1W9BM 3CGBA 2OX4A 4EXBA 1JXKA 2HDJA 4J3XA 4DX3A 3A3XA 1HQTA 3GG7A 4GUHA 3UERA 4ICMA 1FXPA 5C2XA 1VFSA 5KEZA 3VIPA 1ZX9A 3CUIA 4JX5A 2VVSA 4D1JA 2RDXA 4C90A 2D0FA 5E70A 1W3KA 2V8ZA 4UB9A 1IZJA 1DL3A 1R3SA 2XVLA 3RCNA 1XYLA 1B1YA 2E1WA 1U83A 2Y5EA 3BANA 4RXFA 3W1MA 1TCDA 3IJ9A 3PFRA 3R0KA 4GIAA 3RRAA 3OVRA 1OWQA 3QW3A 3KBSA 1TZZA 4BA0A 1YE4A 3M5VA 3ABSA 2NQZA 4QTGA 4XBKA 3LS9A 3MKCA 3ARVA 1OT1A 2BCPA 3GVRA 4GX9A 1GKRA 1JQXA 9XIAA 4PCTA 4X60A 4FIRA 3O6DA 5KINA 3M7SA 2GOKA 2EXOA 3W6LA 5AHMA 4PUUA 1AQMA 4PB4A 1JG9A 1UWAA 4GOAA 3VZYA 1MUCA 3NURA 1QI4A 2HK1A 3BWWA 4GXMA 3KZSA 2HXTA 4HU0A 3MZ2A 1UH4A 5D03A 4O16A 1PPIA 2OWWA 4NF7A 4NIRA 3SY5A 5FJRA 1V77A 3K2GA 1VEPA 2CLMA 1Q13A 2C1HA 2XFFA 1V8EA 1U5VA 1QU4A 4A3RA 4D6DA 2QGHA 4JDRA 1WKFA 2YXOA 1TA3A 4O0ZA 1ALDA 3BK0A 1TA3B 5I7GA 4O4WA 1G6CA 1Z32X 3L2MA 3SCRA 4K2SA 3BLOA 3MDWA 1CLXA 5FEXA 1JF6A 2VFDA 1XBVA 4ZEPA 1KBLA 1NWSA 1VH7A 3AYTA 1KXQA 3RM9A 4PMVA 3W38A 1ZJAA 2A2IA 4O57A 5DELA 2FVLA 3M41A 1LT8A 1POJA 1RPXA 1V4YA 2WJDA 3ABOA 4HZMA 3RX3A 1LBFA 4NAFA 2QHAA 3LNPA 3MP5A 1JYNA 2J7GA 4NRSA 2YAUA 1H5YA 4IX2A 3P8JA 3BJTA 4QAIA 3KRSA 1LOQA 3GDRA 1HJSA 3V0UA 4LGXA 4JCLA 1K7EA 2DVTA 4QFUA 3TKFA 3VPLA 4FIQA 5IHRA 1MW3A 3WQGA 4D6IA 1KQZA 2ZA1A 3WNNA 3HMCA 3L23A 4MJ4A 3W37A 4ACZB 1W1B1 1DE6A 2DJLA 3RLHA 3SO7A 4DJDD 1JROA 2ONEA 2PE4A 4NJIA 1IQ8A 2EKGA 3EA3A 3IIOA 3MSDA 2OCZA 1QOPA 3M0KA 1P48A 2BLEA 5A6KA 2KZHA 3EF6A 5G1MA 3DI1A 3W22A 5CJMA 2XTKA 3A47A 4FSAA 5DY2A 3NCOA 2INEA 1NVMA 3UCDA 4JOMA 5J8LA 5CC5A 4C7DA 3PZQA 3H70A 3TWAA 1B4EA 1H50A 5BYWA 1O7AA 1WOBA 3R4IA 3VO0A 1MZRA 2QJHA 4IMGA 4RNIA 4CKQA 3I4KA 3ZMRA 1C29A 1LORA 3K1GA 3POHA 4Q4QA 1P0DA 4I90A 2DUZA 1BFNA 5M17A 1XYAA 4MJ2A 4UFKA 3P0XA 3PAJA 2X0YA 3K5XA 2HS6A 3R0DA 2BHZA 5JCNA 5I00A 1D8CA 1NP2A 1GVEA 1WXJA 5BROA 5I03A 1TR9A 1W1YA 2BOFX 3N6JA 1H0IA 1F74A 3W1QA 3ERPA 4BV6A 7ODCA 1K03A 1LL4A 5A8MA 1V0LA 3FAXA 4DZAA 1BXBA 1XDJA 1KTNA 4W88A 1Q4NX 5JUVA 3L5OA 3SURA 2XVGA 4QLLA 1X1NA 1H51A 4KEUA 2XJ7A 4BS0A 3DKJA 1R3QA 1CZ1A 2FGLA 5EMMA 3T55A 3B4UA 2UBPC 5CQ1A 3EMQA 2PURA 3QKEA 3FK4A 4Y9AA 4N6FA 3CZGA 1EBGA 1EHNA 1LCOA 3BZJA 3MPGA 3HQPA 4X3ZA 1G4SA 3DEQA 3N9KA 3R94A 1UBSA 1SMAA 5HNNA 5E0FA 3PTKA 2PP3A 5A8OA 1VCFA 2WBAA 4O1CA 1H7NA 4PTMA 2YJQA 1AG1O 2FDMA 4H4IA 4JX4A 3ITTA 3GC4A 2ZTJA 1YPIA 1XLJA 4Q22A 4IP5A 4JYDA 3WH9A 4LALA 4L1WA 4JD4A 2PC8A 2I7GA 1XFCA 3TC6A 8RUCA 3LZ5A 2A3CA 3AMKA 5JBEA 3P6LA 3W1RA 1KM1A 3OIXA 4KQNA 4YCPA 4K37A 5E5CA 1AFSA 3WJYA 3QV7A 3SRFA 1GCYA 3UXAA 4PMOA 1LBMA 2XSXA 4NYUA 1XANA 3CK5A 2NQJA 3B40A 2BOGX 3ZO9A 3WLJA 3FYOA 2RABA 1P4CA 3RJXA 3RITA 2GFTA 1H49A 1UHVA 4KWWA 2G3MA 1FOBA 3WQPA 4ERAA 2PC4A 4DBDA 1WDQA 4WLCA 2P8CA 4D6JA 1VFTA 5H2ZA 3AXIA 4ATLA 1OX6A 1UJQA 4JKLA 3W7MA 1WKEA 2DORA 4L9ZA 3VMOA 5HNRA 2YBUA 5K4XA 2J7DA 2PDCA 2J9YA 3IV3A 3FDKA 1V5XA 4JIQA 1EYEA 4YWIA 3R8HA 1FWRA 2TMDA 4KH2A 2JEQA 2WVTA 3OBAA 2JF7A 3W00A 1EKOA 4KEZA 3TFCA 2Y1HA 4C6DA 4BI5A 4TMBA 5G5HB 4NT0A 3L9CA 5C6MA 1YDNA 4PCFA 3HB9A 4GA8A 3NZQA 4DO4A 1WYGA 5KZ6A 4QM1A 3QTGA 4AH7A 3Q67A 3KBWA 4KRUA 3VD9A 1ISXA 1NSJA 2C7FA 2G3JA 3EPNA 3TC3A 1R47A 4XZHA 1BD0A 3GIPA 4FI4A 5C70A 1W5NA 4I5RA 3PNUA 3FKKA 2ON3A 3GXMA 2VGIA 1VLIA 4MKVA 5I3GA 3MYOA 3VKAA 2Y24A 1S3HA 2O9PA 1WOAA 3VNDA 4IFKA 1KFEA 3W7NA 4JZ5A 4LC8A 3O6YX 4QDMA 4PFHA 2VGGA 3HOJA 1I6NA 3FEQA 5A5WA 2WPGA 3A3WA 4EMJA 2BHUA 3BC9A 1UWUA 5HR6A 4RZ4A 5A6AA 1SJAA 2YL6A 4CNTA 3K4AA 4H4PA 1UZHA 3IEBA 3DUGA 2WHJA 4EPKA 1KRCC 1GVFA 1ME7A 4IM4A 2CXGA 1E6QM 4J9JA 4RPQA 1SVDA 4O52A 2JF6A 2WP6A 1V79A 1E0UA 1TJ1A 1VYPX 4MFEA 4CCZA 1KRMA 3NPVA 1WP6A 3BAKA 1IT7A 4K7VA 3V18A 2DW7A 3HW2A 3EKLA 3CASA 1Y7VA 1FTXA 3FS2A 4TX8A 2E6DA 4XAGA 1HL9A 3DFPA 1T99A 5F2GA 1Z48A 1WXYA 1UMYA 5BOEA 2D2HA 3KCLA 4PL2A 5CAKA 3RNMA 4DWDA 1FWHC 2WK2A 5FF7A 1JXJA 5G1TA 3MCNA 3GG0A 3W88A 3LM3A 3UWVA 4M6PA 1I1XA 3EEGA 4Z0JA 3H2OA 3LCWA 4AB4A 3KCOA 2PLJA 1UR2A 2FHCA 3TAOA 3URNA 2VUNA 1GRTA 3M7WA 5I3JA 1XP3A 2F6KA 1QNQA 4B5VA 1D8WA 2ZXQA 3C2FA 1DTNA 3H2FA 3GD4A 2O9OA 1DQXA 3W3OA 1NFBA 3LSBA 2OFJA 4RPPA 1KW1A 3HV9A 4MNJA 1VZWA 4O17A 5C7VA 1C8YA 5C2GA 2VFGA 3L0GA 1HO4A 3IJQA 2YZ5A 4LT9A 3AS1A 4FX7A 4PULA 1E3XA 1UZ4A 2XFWA 2IS7A 1ZUAX 1FDJA 1TX0A 3QW4B 3WK1A 2PDJA 3UETA 3WBXA 1XUUA 4AZCB 1XLDA 1W9PA 3TYDA 4LY8A 4D8LA 1RCQA 1BVWA 2CLLA 3BLFA 3T0DA 1O5KA 1GXFA 1K8XA 1XWYA 1U33A 4UZSA 3KL3A 1UC4A 1DJWA 4BJHA 2YW4A 1GKQA 1DOSA 1RP8A 1TYGA 3UWQA 2A7PA 3BSMA 4DJDA 2VTFA 3R7MA 4AY1A 1KQYA 4G5DA 1TPB1 3GZ3A 1MSSA 3UU0A 2A4AA 3LI1A 1QATA 3GRIA 3KP0A 1S5NA 3CGEA 2F8QA 1RH9A 3T2QA 1O5QA 4GQRA 1EJUC 5G1YA 3E2QA 3WUFA 1Q1RA 1B2YA 2PCQA 1EP3A 4BZYA 4AD3A 4RDZA 2GUUA 1AK5A 3U8GA 1E71M 2VFIA 2WWDA 4DJEA 1S38A 2E8YA 5JH1A 1FKXA 1V7YA 4HNLA 3O0HA 3WL1A 1PX8A 3O8AA 2O56A 4B5UA 1OK6A 3CQJA 4LBRA 4DXKA 4ADWA 2OXNA 3ZLFA 1W1A1 1IEWA 1VPYA 4IJRA 1K8YA 4ZQCA 3OB8A 1NARA 1OQFA 2JEPA 3W87A 4GYJA 1PX3A 2FZNA 1QW9A 3KBMA 4S3BA 2AL2B 1T3QC 1PAMA 2RDWA 5KMYA 3BG3A 2RAGA 1WZAA 2GGJA 2XN0A 1BG4A 5F2IA 4LOCA 3GFYA 1N5WC 3RFAA 3SQPA 1IXNA 1EJRC 4J57A 4Q33A 1W9UA 5IBXA 3T8LA 2GVGA 4IQLA 3IJ8A 2BTMA 5D8ZA 1BTCA 2NUXA 1EQPA 1JAEA 3ENLA 2Z1XA 2OMAA 3APGA 4UNLA 2EAWA 5FS7A 1XCXA 2HRWA 3I3EA 2OT0A 4HK7A 4B90A 4XZMX 3CT7A 3QHNA 3C3NA 1NP0A 3I10A 2GWNA 3T2PA 4M8UA 1QK0A 3ES7A 4XQ6A 3S5SA 2Z1SA 2Z2UA 3FXGA 4P7QA 1MFUA 3TCEA 2ZUTA 1FX6A 4X22A 2VDGA 1EBHA 3QYQA 1OFOA 4Q4MA 1YNYA 1MVYA 5I07A 1BZLA 3NQ8A 4DUXA 1OFPA 3T0BA 2D0HA 1GRAA 2I9EA 1V08A 4FALA 4PE8A 3DGHA 4GNJA 4RZ6A 3A23A 3CHVA 1XLFA 3LHZA 4UFIA 3TQVA 3UZWA 3HFYA 1LRNA 1PKMA 1GERA 3NPXA 3UW6A 4US6A 2W91A 3C2YA 1ZBCA 4NRRA 1EPVA 1UP2A 3BV7A 5BWAA 4AMCA 4JYFA 3B05A 4RV8A 3PVFA 2VOTA 1H4PA 3N4AA 3M6YA 4Y6GA 3BDKA 5FAGA 3NSNA 3S8HA 3OHMB 3RX4A 4ALDA 3O06A 4PGLA 2ISVA 5U1OA 2E4TA 4AXNA 4CNSA 4CNUA 3LCHA 3TW9A 1ENUA 1Y5WA 2FMOA 5LZLA 1QPKA 5CGTA 2G5WA 3NM3A 4O10A 4PZVA 1A53A 1PHWA 3CEUA 3F5LA 4GFSA 3EWDA 3IIZA 3EA2A 4GG9A 2HROA 7REQB 3NQBA 3WD3A 4B2DD 1TJ2A 1KNWA 4M7TA 3AXXA 1GZGA 1PIIA 3GU1A 5K4ZA 2ZDSA 2WMGA 3E6EA 3U2CA 2X8HA 4OOZA 2YCIX 2AL2A 3VOIA 2G3IA 1XYCA 1XGDA 4AFYA 3L4WA 1BGGA 1F05A 2QMJA 4ATWA 4MWAE 3TW7A 3EWCA 3DYPA 4B5TA 2FB3A 3KL5A 2TYSA 3G6LA 3O0FA 1E1EA 4A8RA 1QR7A 3L65A 3SCUA 6CGTA 1L2UA 5EFFA 1QXLA 4UFHA 3GXIA 3QSTA 1KCZA 4C1NA 4L56A 1M7PA 3RRXA 4U33A 3BMWA 2B7QA 2FZBA 2E8ZA 3AS2A 4A21A 4YWOA 3OYZA 1AL8A 2E9MA 5LA2A 1EF2A 5HDRA 2V3BA 2GJPA 1KFCA 2QW5A 6A3HA 4N2YA 1EXBA 2WWCA 2JK6A 2ACQA 3TLQA 4REQB 1X6UA 2X2YA 4A05A 4GGHA 2AQVA 4M7SA 3TZFA 4POCA 3N2BA 4C6JA 2CDUA 1Q7QA 4UTMA 1WXZA 4F79A 3DH9A 3T07A 4D9PA 5HQEA 2WSYA 1UKQA 4J28A 3NQ7A 4XAPA 3HQ1A 1JULA 2X09A 3VYLA 1BSIA 3QTPA 1ZBWA 2GJNA 3AZRA 4PEKA 3NVVB 1QPNA 3UPBA 1FWSA 1V6XA 4ZA0A 5D09A 2ZX9A 4JIRA 2NW0A 1O5XA 1F3EA 3W7QA 4C7GA 3G22A 4G1KA 1J12A 2IPFA 1A5MC 2AKMA 4UFMA 4HVXA 4I9AA 3R12A 3REQB 1S46A 1WYIA 2D20A 4ADTA 5BXTA 1DE5A 1TPDA 3L5LA 1XBXA 5BMWA 1Q5MA 3TR2A 1XC4A 1X2GA 4UQDA 3QOKA 4FP1A 2BC0A 1VCVA 2DSWA 2W6RA 3LNMA 2C0AA 1I45A 3S9IA 4WR3A 1ICPA 1H5VA 1RCOB 1TVPA 6XIAA 1FCQA 1TPH1 3IVSA 2YGYA 4BHYA 2DPEA 4LV9A 2VXNA 1YYAA 1BLIA 3KEHA 1RQBA 2GUBA 5AKQA 3PZOA 1TRDA 4PEEA 1F07A 1E9ZB 2BXYA 1WNOA 3QPZA 2WSPA 3QFEA 4E8CA 1TV7A 1I75A 3EKGA 3NO3A 2WMHA 3QQ0A 3QY6A 2WO5A 2J7EA 1IXPA 3N2CA 7TAAA 3UVAA 2ZA2A 2VFEA 5E6ZA 4EM3A 3ZFHA 1CGYA 2XPKA 3TA6A 1LJYA 2X05A 1MQQA 4IJCA 1XH1A 2BWGA 3BVJA 2PDBA 2OLSA 1EIBA 3W72A 4UR7A 2P0IA 1U2YA 1VKFA 1WZKA 4KF1A 4H2HA 1J5TA 1MW2A 5H1WA 5DANA 1KTCA 2VEPA 3SZ8A 4J40A 4W8BA 2EPNA 1OD8A 1VEMA 3F1QA 2VOMA 1UD3A 2XZ9A 3ALGA 2P1FA 1A4MA 3IS4A 3T0AA 1F76A 1CCWB 3VZXA 4GWEA 2EBNA 2GUYA 1JOAA 2ICSA 2KAUC 1KXHA 4QG8A 4GE8A 5H6HA 1GSNA 4LUIA 2R9ZA 3ITGA 4PTXA 1UUOA 4UOJA 1UD4A 1V6YA 3PB2A 1Q2SA 3A5FA 1ZLPA 2P50A 1GYMA 2W62A 3B9DA 4IMFA 1YBQA 2QYGA 4NQ1A 4MJZA 3IVTA 1UYQA 5D2YA 1QNVA 2W92A 3DYMA 1GVOA 3WH8A 3OEXA 4U3CA 7XIMA 3P5ZA 4BKNA 1UASA 1XKYA 1RM6B 3BMXA 1HGYA 1K7XA 1PUDA 3SFKA 4XIMA 2ZIDA 1MRQA 3UCQA 3TQKA 1UR9A 2VURA 4MNLA 1LTDA 3L4UA 4JCMA 2YL8A 3ZLHA 5GVJA 2AAMA 4GO9A 3T08A 3ZJKA 1AVAA 1P0KA 1V6UA 1VBGA 4YHEA 3PPCA 3FY1A 4V2XA 2OT1A 3VI2A 3NOYA 1QUMA 4CEUC 1MI3A 1NHSA 1R2RA 4K8GA 3EOEA 1I0BA 3QPEA 5LNSA 3W25A 4A3UA 4ZFMA 5KZDA 5JRBA 2UY4A 5HINA 1XV8A 3UNDA 4MADA 2EPHA 4DBSA 4H4QA 2J8FA 1I2RA 5LNUA 1BWVA 1VEOA 2FJKA 1XIJA 1Q6QA 3WJWA 3MBDA 1KGUA 1GESA 3PN8A 3CAQA 1BVZA 4XVEA 3EX3A 2E67A 4GUIA 3U7BA 1WZMA 3H8AA 4Q6JA 1IEXA 1QTWA 1QNRA 3H54A 4YL2A 3ATYA 4S39A 2H3DA 1XC6A 5E09A 4IT1A 4B3LA 1E0VA 3JZEA 1R2SA 1M3UA 5DCBA 4MJMA 2QCHA 4W86A 2XIBA 3GM8A 1WZLA 4HP5A 3JU2A 3RILA 5LA1A 1RV8A 4H4YA 2EQ7A 3UG3A 1M6JA 1G69A 1PKYA 2PWFA 3CXBA 3LQGA 3DECA 4FOUA 3W23A 2Y5SA 3C4UA 3UG8A 3QY8A 3FYYA 5L6UA 1EFZA 2NQ9A 4AZ7A 4EQWA 4EXAA 1LLWA 2I5QA 3WUBA 4Z1DA 2W61A 3W7OA 4GLEA 1QPQA 1K1DA 4TUFA 4QNEA 1X7IA 5BU6A 2OEJA 1BKSA 3T9PA 3VNZA 3STGA 1XBZA 2PDKA 2DZSA 2D23A 3AU2A 2FTPA 3W1NA 5FL0A 5T9BG 3L4TA 5JIWA 3KE0A 1SW3A 2A7NA 1J01A 3DXIA 3APTA 1N60C 3NNTA 1XINA 3WKZA 1E0WA 1P7TA 4EMWA 5LNVA 2J8TA 3BMVA 4OTKA 1EC9A 3VDCA 1DVJA 2EPKX 5DMYA 5HOSA 6PTDA 1SQ7A 3VD5A 3EXTA 5G4EA 3AAMA 4DO7A 1GORA 4PUMA 3LTPA 5FJPA 5DBUA 3QF0A 3OLDA 3E38A 1YXCA 2CLFA 5T26A 3Q58A 4K1WA 5HMFA 4QG6A 7A3HA 2DVXA 4F0RA 2QMKA 1J4EA 3KRZA 3MI2A 1BYDA 2PUZA 4MPKA 1WDWA 2WVVB 3UR5A 2ZUMA 3W70A 3ZWSA 3B4YA 4IIGA 2JKAA 4AWUA 3BUVA 4MMWA 2ZKMX 3MY9A 3A7AA 5FKYA 4H6QA 1XDIA 4IGSA 4PTWA 1FDZA 3SQSA 1Q6OA 2BGNE 5FF4A 2V69A 1UR3M 1W9VA 4K68A 3OPSA 1EQCA 4JTTA 3CIXA 4HJWA 3LGGA 1J0YA 1AW1A 3XINA 1VF8A 2NQ5A 1ZJHA 3EPOA 2X1SA 4EQSA 4HCDA 4HNTA 1ZAIA 3VUPA 3RF9A 2PD9A 2BY1A 1ZRQA 2RFGA 2IKJA 4DN1A 1LG1A 2VEGA 2FZ8A 2ZZCA 2J7FA 2B7OA 2HMCA 3QH2A 1W1IE 2E68A 4N6EA 1SO3A 4K8HA 4N9EA 4QDWA 2POZA 2VWSA 4PBGA 4NP7A 1A5OC 1QI2A 1GZ1A 2NX9A 3QLDA 2DZUA 2ZICA 5SWUA 1Q6FA 4GYFA 2DFAA 1YIXA 1Q3NA 4S3EA 4EANA 2PAJA 3FA3A 4HZ8A 2GQ9A 3GXNA 2GGEA 3VMPA 3GK0A 1AJ2A 1NDVA 3WEZA 3A5VA 2GRTA 1MUMA 3FEMA 3S6TA 2DT0A 5TR3A 1FH8A 3CTTA 1H7OA 3L68A 1QBBA 3AALA 4N9CA 1MMFA 2IUZA 3DFQA 5HBFA 3BLDA 4E0CA 1GTHA 4XAZA 1T41A 4IMCA 2XM1A 4OBSA 2CNCA 4I8YA 1S3TC 2QJIA 2G4JA 1UKPA 4NU7A 3URAA 4DRSA 1XCWA 4L9XA 1V3IA 3BLEA 4OKDA 4PL1A 1H2IA 3RHGA 4HYVA 4NI8A 3KVJA 2QZRA 2ABBA 4MB5A 4JBRA 1DWJM 3LHVA 2R1KA 1DNCA 3DJGX 1B3OA 1TPEA 3H53A 3UWUA 5AC4A 3NDYA 1ZSXA 1E6NA 2ABAA 3EYPA 4JHOA 1XSJA 1KV5A 3T4CA 1E1CA 1JPKA 2CITA 1YTEA 1JI1A 4MM1A 2E9BA 1JCTA 3FW6A 1HKMA 1LT7A 4PRTA 3B8WA 3MI3A 4HSOA 4E5TA 1EEPA 4IWWA 3SSJA 3IRSA 1T6MA 2YCEA 1BF6A 3CHDA 1U1UA 5TAOA 3W7RA 4G9PA 1XRFA 4CU8A 3LYEA 1GOWA 2PWHA 1DWFM 3WF3A 1PV8A 1E72M 3SR6B 1AJZA 1OJTA 4ZB0A 3GLCA 2QIWA 2WC3A 3M46A 3KXQA 5JCLA 3O15A 2X8CA 4UWMA 3IWPA 2VR2A 1E51A 2A6NA 1MO0A 2HISA 2Z6IA 1TYTA 1TWIA 4K7YA 2Z1BA 3A22A 3G18A 2PDIA 3C2EA 5AN7A 1HKJA 3OBKA 3WQWA 2WPCA 4FHAA 2DP3A 3LBCA 3AWNA 4Z1AA 3P5YA 3P60A 2OLAA 3S1WA 1ZY8A 3LPFA 3GXTA 5T8GA 2VR4A 1ZNNA 4AY8A 1X39A 3A9BA 3DH7A 1A5SA 2QNEA 2VRJA 2X0SA 2RJGA 5CC3A 2W63A 4KEVA 5C9RA 5C7HA 4AIUA 1EUAA 3GNPA 1K3UA 2NZLA 2D24A 5CPOA 1THFD 5FS6A 3W28A 3PUDA 2UV8G 2IQTA 1BSLA 4DYJA 3II4A 1DJQA 3VIOA 1SO5A 3TVAA 3SRHA 1IYXA 3ZZ1A 4L4LA 4UTTA 2ZZ6A 1ONFA 1ITUA 1CI1A 4QHRA 4C6FA 5I24A 3T42A 4U2ZA 4RXGA 3SDOA 1QPOA 5A3HA 2A6LA 2PGFA 5JH2A 1CBGA 3M0VA 3N29A 2OZ8A 4AXKA 1CB2A 1F61A 1CGUA 1RP9A 2AGTA 1LWJA 5LIXX 5GJPA 3ZSSA 1GOXA 3TN5A 5LIUX 1VPQA 4IF2A 5HNUA 3IC9A 2J75A 3GY1A 4HMDA 2V6OA 3HJEA 1UUQA 3S42A 2PF8A 5LXEA 2NXHA 3QV9A 4IP4A 3GFZA 2FH6A 2QJJA 3S2MA 3L4ZA 4LAKA 5E9XA 4Q4OA 2JE8A 4AMAA 1KCKA 4GZIA 3W6YA 3N9SA 4GUJA 1E6RA 4QIUA 5DXYA 1LZOA 3W7PA 3VK5A 2C13A 3VILA 4EWJA 2XH7A 1U30A 3QZAA 3ZJ6A 3TE9A 3W29A 1BEUA 3VCCA 2C3ZA 3WLOA 3PSWA 3HRDC 3VUSA 1TX2A 3DFSA 3C2RA 5MHBA 4PMDA 4I3GA 3LTYA 1V0MA 4WKHA 2TSYA 4F0KA 4CN1A 4RJEA 2GL5A 3UJ2A 2WBKA 5H8MA 2CZVA 3PFMA 3VIFA 1W5MA 4J56A 1ECQA 3MHUA 1EUNA 2NVDA 3SFWA 2CXEA 3SCNA 4O1EA 4FA3A 3SI9A 4JQAA 2WHKA 4R85A 1R9ZA 1I60A 3N15A 3N04A 2IMRA 4J3WA 2Y0FA 2HNHA 6ALDA 3FJNA 1FWEC 4JQ9A 3TOYA 4XO7A 1TUFA 3UCCA 3F4NA 5ER0A 3KBNA 3SCWA 2BVWA 3GDTA 1GPWA 1XLHA 3KVMA 5LGZA 4FO4A 5BXPA 4X9SA 4MWAC 4XB3A 4Q6XA 3FFSA 4UTJA 3FN9A 3OLGA 3ECQA 1QBAA 4RE0A 3ARYA 2QDDA 5D9NA 2DY3A 2A3AA 3NR0A 5E93A 8CGTA 2NV1A 2F9RA 2VZTA 4R33A 3R07C 1OCJA 1GOQA 1G0CA 1QNSA 2PMQA 2E5AA 4GIYA 4I5UA 3I3BA 3UYIA 1EOKA 4R9OA 5D8WA 1SMDA 5LNRA 3RIKA 1I8JA 1GTEA 3D0CA 3PUGA 4MLRA 3K4DA 4GFIA 4LWWA 4B4HA 1LYXA 2ACSA 4NSBA 1EF3A 1EL3A 4O28A 3NL5A 3E3HA 3TCSA 2G3FA 5DQPA 2MUCA 5DT5A 3SADA 2QULA 4O4VA 4RZ5A 3NZRA 2Y8KA 3TMLA 1JFXA 3EX6A 1M6IA 1TZ9A 2GSEA 2OPJA 4JN6A 3IJLA 2PDXA 3AYVA 5CXPA 1JUBA 3MSGA 3HMJG 3OTRA 3PY2A 5ABEA 2V68A 1KBJA 3TONA 4X63A 3S5NA 1X97A 4NJGA 4W5UA 2PFHA 1ZBKA 1HJQA 3LY0A 5GRTA 3GHRA 4Y90A 3VGBA 5I3IA 2WCAA 3B8SA 1H7WA 1JDDA 3U4AA 1JI2A 1QI3A 1XW8A 3WLKX 3AM9A 4JTIA 4WY0F 3S2CA 4ZZ9A 3AZTA 2QQ6A 2WVUA 3WLPA 3KL0A 4HPJA 1F3TA 3DHPA 3P3BA 1DIDA 3A4XA 3WJSA 3AWOA 4M51A 2X99A 1JNDA 2GJLA 5CSSA 4AQLA 2V9DA 2CBIA 4KPRA 1L0PA 4FF5A 4TIMA 3SB0A 3OW1A 3KBVA 2PB1A 4FS9A 3B9JB 1VFLA 2E6AA 4C1NB 3N34A 2OSWA 3MKKA 1H0GA 1CXHA 2MNRA 4NUWA 3SN0A 4JDBA 4AC1X 4PN2A 3EDEA 1TV4A 1PCWA 1AH0A 1CXFA 3R13A 2FZ9A 1O68A 1TZ7A 1XIBA 2GVEA 4KWSA 1A0CA 1BQGA 1Q45A 1W9XA 2BSLA 1EP1A 4PMNA 2AGKA 3GTFA 4NNCA 5EFDA 5EMUA 4URIA 1N63C 5EMLA 4GC4A 4MKNA 4FLOA 1BYAA 3EZ4A 2YB4A 2HS8A 1GQJA 4U4MA 4ZMGA 4JR5A 4NZ4A 1JYXA 3KVKA 1A5AA 1QOQA 3WLHA 4BQ5A 4HU8A 1TTQA 3UA3A 1C92A 2QCCA 4C65A 5EPDA 2J74A 3A13A 1C8XA 4B16A 1FWTA 2A3LA 3ABRA 4NL1A 3II1A 3H2CA 3AJXA 3KOXA 4M0XA 1EJ7L 1YE6A 2HJPA 4NZ3A 4BWLA 4KCVA 1TKKA 1W5OA 3RGTA 3CWOX 1ESWA 3CMJA 3LOTA 2WPBA 4H41A 4IIEA 4L4OA 2ZC1A 1HNYA 4LCRA 3A4WA 4M5PA 4F0HA 3GHUA 3LCXA 2CWXA 5CBBA 3BURA 3LADA 1JDCA 3SECA 1O1ZA 4EAYA 2ZFAA 5FI8A 2W55A 1E4IA 1HFBA 4IIBA 4E2VA 3UGVA 3CL8A 1GJPA 4M6QA 4C6KA 1TIWA 4E4UA 4ACZA 4E6MA 2PTXA 3NDZA 4AY7A 3EWBX 3HGRA 1ODUA 2OGJA 4P8UA 5EB8A 4DJEC 5EMYA 1Z6KA 3MVTA 2PEVA 4WJ8A 3TYUA 1RVGA 2GVLA 4IPJA 1K7FA 3VIHA 4HCLA 3LV5A 3B0VC 1F8MA 4TVWA 2FJUB 4JKMA 5F2LA 4H8UA 1AMKA 2OR2A 3OIHA 1TUXA 3KDOA 2PTYA 3B9EA 3GVGA 4MZ8A 1X96A 4UR9A 1OEPA 4BQ4A 1LF1A 4AVFA 2QDHA 1B54A 1Q7MA 3KOFA 3HPAA 2GR1A 3NO5A 3CGTA 2XZ7A 3G1VA 5BWFA 4XD6A 1ME8A 2GDUA 3QGKC 3ZXWA 2PBOA 2GOUA 1I2OA 1ZP3A 2H8XA 3BPWA 4RNJA 1E9YB 4C91A 3T2OA 4I8DA 4GVIA 4LNCA 3O2LA 3WENA 4DNAA 3CS2A 1EGMA 2A8XA 4LH8A 1AODA 5FOOA 3GYEA 4KWVA 3HPFA 4B3KA 5CG0A 3TYEA 3VNLA 3UFYA 4DZHA 4ML4A 3ZT6A 2OKOA 3S2JA 4M80A 4JTGA 3BSHA 4GY0A 1GZJA 3WLTA 4WKFA 1J0ZA 2Q8XA 3G0UA 3IUHA 4JHZA 4XTIA 2WZTA 1OG0A 4Y9OA 1GVRA 3SJNA 1QNOA 1LPFA 3MUY1 3HGSA 4Z1BA 5D38A 1D3GA 2YR1A 2A3EA 5GNYA 4MB4A 4DXVA 1W3IA 4N4PA 2DUAA 1XISA 5CPLA 2YXGA 1W56A 3P7YA 3N4EA 3W07A 3PP7A 5BOOA 1A3XA 2FPVA 2WOVA 3TN3A 3SQMA 3VNKA 1FCVA 2X2GA 4IPLA 4H4WA 3TQ0A 4KKXA 3LMYA 2Q8LA 1PKNA 7TIMA 2GQ3A 1Y5VA 3VDGA 4YYCA 3GS6A 4C6OA 3WUGA 5IBXC 3EAOA 3QEZA 3DHDA 3ZT7A 3KW3A 3W1UA 4C6LA 1H60A 4LJ3A 4Q4KA 3TSBA 1R38A 2BNJA 5K9XA 2H3BA 2REQA 1E6SM 2CLIA 4L6DA 4HPXA 3SGGA 3DGZA 1MFVA 3H6OA 1L6SA 3TC7A 1BYBA 4S3KA 2VI0A 5D9PA 5FMHA 1EIXA 3OJGA 1FP9A 4UNKA 3S4TA 4W93A 1KBKA 4AZCA 1W8GA 1FWAC 5A94A 4GNVA 3CPRA 3T05A 3VIIA 2ZX7A 7CGTA 1VJIA 3UJSA 4D72A 1L8PA 1TPUA 1C3FA 3S0CA 2ZUSA 1X6NA 3S2NA 1EJXC 4YWSA 2V5BA 5GPRA 5HMEA 2F6UA 4JNZA 1V3JA 1FHDA 4V33A 2FB2A 3B8VA 2TODA 2ZWZA 1PWMA 1KO0A 1K9DA 1OG6A 1XUZA 4XKYA 4FR1A 1DJIA 1OFAA 3WBAA 4WY0B 3BARA 4D6CA 3CUHA 3VOJA 3M5ZA 3GR8A 3AXKA 1WCGA 3DU0A 3FCPA 3W24A 4HSNA 5A6SA 5CGQA 3FOKA 3QFBA 4IX0A 5LA0A 1POKA 3M0ZA 1K4QA 4OUEA 4KS0A 2B7NA 1STZA 2PTWA 3ZS4A 3ZYZA 8XIAA 1JEZA 1Q6GA 4NASA 1NTHA 3HV8A 3GU2A 1WUEA 3H7UA 3H2AA 3ZR4A 4MUPA 4AIEA 1IT0A 2ADAA 4YYFA 2I9UA 4DVOA 3BL3A 4QQ3A 3NVZB 1ZAJA 3WNPA 4LEQA 4M52A 4EQRA 1UR0A 3WDJA 4I9MA 4BEQA 3C0SA 3AJ7A 5KZMA 5CSYA 3EMZA 3C8NA 3TW6A 1AD4A 4A3YA 1JIBA 1WQ5A 4CQAA 4OV9A 1CW2A 4FXRA 2GJXB 3K46A 2AAAA 3SSZA 4HJFA 2AQWA 3WQFA 5HULA 3M0YA 4NY2A 2Y4SA 1RVKA 4JS3A 3CV1A 4AYGA 4Z1YA 2H9AA 5HWNA 1A5NC 1CENA 1KBIA 3PG6A 1N8IA 3C61A 4E3TA 4V27A 4ZO8A 2DH2A 2A85A 2CZEA 1X38A 3AUJA 3IJ6A 2OOFA 1BYCA 3HGOA 3RNDA 2VGFA 3KOYA 4O54A 3FAWA 3NQVA 5A8GA 3W7JA 2VCAA 1FXQA 3N3MA 2NVKX 4IIDA 4LCSA 5FIPA 1HT6A 2IKHA 3MANA 3FKRA 5G2HA 1RJPA 1TQXA 1ZDLA 3QBUA 3HZ3A 2WSQA 1FFVC 3UBPC 5REQA 3UPMA 1ZQ5A 5LKYA 4LX4A 3NQ2A 4ZXLA 3AISA 3CL6A 3E5BA 4DYEA 5AHEA 4IPIA 4TTGA 1AA1B 3BLIA 3C2OA 2Z7GA 2C19A 2CKSA 4ICNA 1KXTA 1A0EA 4ORIA 1YADA 1PJ9A 1XI3A 3DBPA 4GH3A 3DG6A 2XVPA 3VOFA 3AHVA 4N7QA 4UMBA 4LFYA 5IHSA 1TIMA 1SJCA 1U1JA 2BOEX 2Z0IA 3MYPA 4CQBA 4LB3A 2F6XA 1W3LA 2YL9A 3FVDA 5AHLA 3SIZA 4A4AA 4F66A 3UY7A 1LUCB 3USZA 3GXFA 4TQTA 5TD4A 6TIMA 4YIWA 2EHHA 3G1XA 2B81A 4QRNA 3AZSA 3GO2A 2FTWA 1TMHA 1G01A 1DEDA 4NX5A 3M16A 4BCEA 3CXOA 4MYAA 3W7CA 3ALFA 4G7EA 4XZIA 1JDEA 3UYCA 3QMRA 3FGCB 2OYKA 3NQAA 1KLZA 4A29A 1PS9A 1ZZMA 1J18A 1US2A 1S5TA 4L6HA 5CBIA 3O3RA 1P0EA 4O50A 1FBAA 5HNTA 4EQXA 3LI0A 5MKGB 3RG6A 3A7UA 1EB3A 4JY8A 4IQJA 1LROA 1TV3A 5FEZA 1GONA 4AWTA 5M2FX 1EP2A 4O18A 3EUB3 1VJZA 3F5KA 5K2ZA 3N4FA 3ARRA 4Y8EA 1D7FA 3KBJA 4AF0B 3KOWA 3IAQA 4P8WA 1W54A 3BGAA 1PIGA 5FJIA 4LYPA 3VDHA 2Z25A 4JEJA 1U5JA 4ASTA 4Y7EA 3EWWA 3SCQA 4FX6M 4JIPA 1GPFA 4O8AA 3ZIZA 3AMZA 2J7BA 4L1XA 4X61A 1RJQA 1XIGA 5GJMA 4E4FA 2W3ZA 4QE5A 1C8QA 3DFHA 1YBQB 2FVKA 3N14A 4NAEB 5M3WA 5TF0A 1XDLA 3GG1A 1NHRA 3WNKA 3UWEA 4ZOBA 1OFQA 2GR2A 4KW2A 2WZIA 2OEMA 2V6AA 4FNTA 4MTVA 3OA3A 2WJZA 3EBVA 1JZ7A 2D3NA 4B15A 3ISIX 3LLDA 3NZ1A 1EDQA 1FHLA 1GW1A 2FMNA 2YA1A 4PSPA 1M7XA 1QVBA 2PDMA 1ISYA 5FACA 2JBMA 5LHFA 1J0HA 3QZEA 4RV3A 5J5RA 4W7WA 1XIEA 1H7XA 2X8RA 1FEBA 3H4XA 3BW2A 4QNWA 1KM4A 1SO6A 4PODA 3STPA 5HJLA 1WO2A 3SCSA 1FFRA 4ZE4A 4N0RA 5E6YA 4JIIX 1XLEA 2HE8A 4AEFA 4DBEA 3VGGA 3UNTA 1MNSA 2YOCA 1ML1A 4FOJA 3EMCA 3KS5A 3PBGA 5GQBA 4M29A 3KZPA 3APYA 3WK3A 2YCLA 4D1IA 1EJTC 4W84A 3IIVA 3MUXA 3UXLA 1BTMA 3TP4A 3LRMA 2WZHA 3OA5A 4JFWA 5C54A 4AAJA 1YPXA 1N2VA 4H4SA 1AW2A 3JZUA 1FQ0A 2QCDA 2ATMA 2QF8A 3B8TA 3DIPA 3MVIA 4DPQA 2HQAA 3DZ1A 8A3HA 3NVYB 1D7YA 5PTDA 4H9TA 4OU1A 3ZWTA 3FSUA 1ZXIC 2A3HA 1IWBA 4DF2A 1T96A 3GXPA 1TPVA 3W1PA 4DWSA 4XX6A 2O7QA 1H1YA 4NJKA 3LUTA 5BW6A 3PANA 1NHPA 3DC8A 1ZALA 1XRSA 4DJED 3FX4A 4S38A 1W1PA 3E49A 4MKSA 1DJGA 1CIUA 3F2DA 4I7VA 1I2PA 3LHUA 4LAUA 4L5ZA 3HO8A 3S5OA 1LWIA 4PRWA 2CLHA 3WFLA 3LDVA 4QEEA 3RMJA 5ABFB 1D7KA 4Q8VA 1AZ2A 3NEHA 3FJ6A 4GRSA 5HATA 2BB0A 1EX1A 3CO4A 1OYAA 3SUUA 2ZADA 2ZZ1A 1HW6A 1WDRA 5LIWX 3VCNA 2ASHA 4FLQA 4H01A 2IXUA 4PUWA 3C8FA 3DFYA 4H50A 1R3YA 2R14A 3NS1B 3ITOA 1V0KA 4J1OA 3T4WA 4RE4A 3EGJA 1JZ8A 4XZLX 3EB3A 2A0NA 2V3FA 4H4UA 1S1PA 1KM0A 3VIGA 3OQ8A 1OX4B 2A7RA 4GKTA 3CC1A 2GYIA 1E4NA 4TV6A 1GQIA 1S5MA 3A4JA 3BAXA 3GTXA 4HNOA 3PUEA 5C0QA 2XFRA 4XO6A 2ISSA 2PZNA 5GNXA 1S5WA 1RQHA 4PUNA 2V5CA 4AHQA 3KP1A 4LS1A 5AY7A 1E56A 1Z44A 4PTDA 4NZ1A 1PZ3A 1XQKA 3OGSA 5HA7A 1EO7A 1YQ2A 1YW1A 1QNPA 1V3KA 1UCWA 1RXOB 4Z2GA 1XQLA 6REQB 3AN1A 3H2MA 1D3CA 3NZGA 3AHYA 3WK0A 1IEIA 4MOZA 3GBEA 1ZFJA 4UIOA 1XIDA 1VD6A 3SCOA 3VD3A 4NJHA 4KCTA 5M1TA 3LENA 4WX2A 4OZOA 1F5ZA 1RPKA 1ZY9A 4DNHA 2IKGA 2IPGA 1KWGA 2GK1B 3HG4A 1K6WA 4UTFA 4YTSA 5HJXA 1OF6A 2QJNA 1JRPA 3ONCA 1TWZA 3RM4A 5EBKA 1LRTA 5DMLA 2ZVRA 3F03K 4XZ9A 4K7ZA 1H3GA 3W74A 3BH4A 1TCMA 4K1GA 3EDDA 1F9CA 2DSUA 2ZXBA 3CMGA 3T44A 4GX8A 3CHEA 5AHNA 3CYJA 5I3FA 3GHSA 8TIMA 3NSMA 3C3UA 1GJUA 4UOZA 1OZQA 3EX1A 2P5NA 4G1NA 4UFJA 3MUZ1 4U5KA 2E28A 3XIMA 1D9EA 1SW7A 2XGZA 3ABXA 4E3VA 2ZVIA 4WDUA 1Q4WA 3UA4A 3VGDA 4O1AA 2DZAA 4GJJA 4KPLA 3DERA 3UG5A 3CIWA 3G1HA 3E2RA 4N02A 3MWCA 4E38A 3DHFA 2WOQA 4W85A 1Q6LA 4H4ZA 2CFYA 3N12A 4A3QA 5REQB 4ZODA 1TMLA 8XIMA 5AC6A 2FLIA 5CZTA 1UA3A 4PMQA 3LMZA 3HQOA 2PLMA 5HQMA 1TMQA 1CLVA 3QR0A 4JTFA 1PKLA 3PZNA 4QROA 2P53A 1ZP4A 5FESA 3DK9A 2YLLA 5A95A 4HYWA 1SJDA 3T0CA 3BAJA 3W2UA 2AMXA 5D02A 1P1MA 1F3WA 3CV2A 3NM1A 5J5DA 3LTSA 4J5NA 3R5EA 3RU6A 3WLIA 3H22A 3DN5A 4HZ6A 4WHBA 4U31A 2G8ZA 2Z28A 3NZPA 4HIBA 4WDTA 1GUVA 2XH2A 1E5JA 2C0HA 4PUKA 1J9YA 2X7WA 3VC6A 3QC3A 3THUA 2EJ1A 4KEMA 1A5UA 1S2WA 3UG4A 2YDRA 5CKSA 3A3HA 4Q8WA 3OGVA 1R86A 4MWAD 4W7UA 5T91A 3H26A 1DPMA 3AROA 1N62C 4LU0A 3LD5A 1Q2RA 4Z0SA 3G1AA 4JTDA 4JHMA 2ZQ0A 3FVMA 1DIKA 1G4EA 4HN4A 5FJJA 1M53A 2UWFA 2HBXA 1IZCA 1GYNA 3K8MA 1PCKA 4PH6A 4QLJA 4TVCA 3CQ0A 1G67A 2J9XA 4QR6A 2XIOA 3BCDA 3H7RA 1LQAA 2CEQA 3OZPA 4XK2A 1Z69A 3A64A 1VC4A 2C79A 2XVNA 3NQ6A 1CXLA 2E6YA 3PG9A 3T09A 1SZNA 3CUXA 3WDPP 3WO8A 5A6TC 3TA9A 1EGVA 1XSIA 2WCGA 1KM3A 1WV2A 2NLIA 4B92A 1DORA 5FF0A 3RR1A 1TJRA 3CAKA 2PWDA 2WHLA 2HCVA 4CQDA 4PCSA 2D22A 2V63A 5IOBA 1VR6A 4WY0A 4IMDA 1ADOA 4OQVA 1GVYA 1HZYA 1UG6A 2V2CA 1XLMA 3CQHA 3OZOA 4B4FA 5CCZA 2C14A 4W9TA 1E15A 2DV0A 1JFHA 3RJYA 3PPHA 3WH7A 3TH6A 3GH7A 3FNDA 5CC7A 4DPPA 1HJXA 1ZCCA 2ANUA 2D3LA 1YNPA 1IE7C 1ZU8A 3NTYA 4UBPC 2CFFA 1VB9A 3C0JA 3VKJA 3TFXA 3B0PA 4DAIA 3IIXA 4GPNA 4CNOA 4JGDA 2QV4A 2O92A 3I7QA 3MUIA 3FLUA 2J66A 1HTIA 1TELA 3GDMA 1K4GA 2TPRA 4DB7A 1R0MA 2VWTA 4J4KA 4N42A 2Q71A 4LF2A 1JQVA 1J0KA 1W1TA 4L9YA 5DF0A 5BRBA 3WL0A 4IGMA 2OVLA 2GWGA 3QPYA 3W2JA 1ZBVA 1M65A 3LPPA 3ZLGA 4GXPA 2DZVA 4RW5A 2A1YA 4WZHA 4AZBA 4NG3A 3ITYA 3BO9A 1R30A 4HKPA 1W1ZA 3CYVA 2FFIA 3ZQ9A 3S5YA 3STCA 2BX7A 5