3FVDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
370
structure length
361
Chain Sequence
b'SLRITRLTVFHLDLPLAKPFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a member of enolase superfamily from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
rcsb
source organism Roseovarius nubinhibens ism
molecule tags Hydrolase
total genus 117
structure length 361
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fvdA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fvdA01
4ZCWA 3H7VA 3TTEA 5FJRA 4GGBA 2GGIA 3TOYA 4DN1A 3QN3A 3CXOA 2P8CA 1P48A 1E9IA 1NU5A 3ZVHA 2NQLA 4IL0A 3PFRA 2PA6A 4J1OA 1MDLA 1ONEA 3UJ2A 3TWAA 2OQYA 2AKMA 3ES8A 6ENLA 4KT2A 3R0KA 4HCDA 2PTZA 2PGEA 2AL2B 3DG6A 4HNCA 2XSXA 4EWJA 3UJRA 3RO6A 1MUCA 2DW7A 2GSHA 4K1WA 3VC5A 2GGJA 3TQPA 2XGZA 3EEZA 4E5TA 1MDRA 2XH7A 1TKKA 3SN0A 2OVLA 4X2PA 3V3WA 3QTPA 3FVDA 1JDFA 2AL2A 1XPYA 3N4EA 2GGEA 3DIPA 3MQTA 1EC8A 2XH4A 4E6MA 4FP1A 4G7FA 3RRAA 4M6UA 3VC6A 3T6CA 3TJ4A 3B97A 2CHRA 3I4KA 3VFCA 1EC7A 3UJFA 3QPEA 3ZLHA 4JN7A 4KPLA 1JPDX 3BSMA 3HPFA 4IL2A 3IJLA 3CK5A 4IHCA 2OKTA 3UCDA 2QGYA 3NO1A 3JW7A 4F4RA 3K1GA 3P93A 1WUEA 3CYJA 4FI4A 2ONEA 1BQGA 1R6WA 3T9PA 3PWIA 3TWBA 3PWGA 3ZLGA 4HN8A 2DW6A 1PDZA 3OZYA 1TZZA 3MKCA 2QQ6A 3MY9A 3H12A 3FJ4A 3OPSA 3I6EA 2QDDA 3RITA 4HCLA 2OO6A 2PP3A 1P43A 1SJDA 3JVAA 4GGHA 2FKPA 4HPNA 2OZTA 3SSZA 1DTNA 2HXUA 4MMWA 4ZA0A 2PSNA 4IZGA 3IK4A 2PU0A 2MNRA 3CT2A 2PMQA 7ENLA 2ZADA 4DXKA 2OQHA 3MZNA 3IJIA 2PTYA 3CAWA 5EU9A 2AKZA 1MRAA 3N6HA 3R25A 3S5SA 3UCCA 3GY1A 2PS2A 2AL1A 3UJSA 4Z1YA 3R10A 4HNLA 4JHMA 5BOEA 2QJMA 3D47A 3DEQA 3NZGA 1SJBA 4JN8A 3ZVIA 4G8TA 4A6GA 4DX3A 1RVKA 5IDZA 3VCCA 3VDGA 3VCNA 2PPGA 3U4FA 3N6JA 5BOFA 2OX4A 3STPA 3KUMA 1XS2A 2XH0A 1NELA 3ZLFA 2QDEA 3UXKA 3V5FA 2FYMA 4DWDA 1ELSA 4IP5A 2HXTA 3DDMA 3R1ZA 3DGBA 2OG9A 1KKRA 3DG7A 2GDQA 3ES7A 2P0IA 2HZGA 5ENLA 2PCEA 4H1ZA 2GGGA 3FYYA 3FCPA 2PP1A 1W6TA 4J3ZA 5FJOA 4H83A 1EBGA 3TJIA 2PGWA 4K2SA 4ENLA 2GL5A 3SN4A 5FJTA 1BKHA 4GISA 1JPMA 3NFUA 2OZ3A 4ROPA 3MWCA 4E8GA 2QVHA 1L8PA 3GC2A 2QJJA 2PTWA 3SBFA 3D46A 2PU1A 3N4FA 3EKGA 4H2HA 3S47A 4A35A 3P3BA 4HYRA 4GMEA 1FHUA 1FHVA 1SJCA 3RGTA 4M0XA 4HCHA 4E4FA 3OP2A 5FJUA 1KKOA 2XH2A 2GGHA 4DYEA 3NXLA 3OW1A 4E4UA 2QJNA 3OTRA 4GIRA 3TCSA 4KWSA 4K8GA 3UGVA 3RR1A 3MUCA 1OEPA 4MKSA 3UXLA 3R0UA 3THUA 1EC9A 2ZC8A 3Q4DA 1ECQA 1R0MA 4YWSA 3QKEA 3VA8A 3SJNA 2P8BA 3FXGA 4MGGA 4GYPA 3ENLA 4KEMA 1IYXA 2PP0A 3V4BA 2OFJA 4A3RA 3P0WA 3U9IA 3Q45A 2P3ZA 3SQSA 3JZUA 2O56A 3CB3A 3H70A 5FJPA 4IT1A 4GYPC 2POZA 3BJSA 4H19A 1EBHA 1KD0A 1F9CA 2OLAA 2PTXA 3DG3A 1YEYA 3IJQA 3FV9A 3PK7A 2I5QA 3V5CA 3QLDA 3OZMA 2HNEA 2OZ8A 3DFYA 1SJAA 1PDYA 1JCTA 3DERA 3T8QA 3GD6A 3DESA 3H8AA 2PODA 3MSYA 3BOXA 3R11A 4IP4A 1TE6A 2RDXA 3SN1A 3ZVHB 5J04A 4GFIA 3T4WA 3I6TA 1KCZA 2OPJA 2P88A 4DHGA 2MUCA 3UJEA 3RCYA 1MNSA 4Z17A 3DFHA 3TW9A 1WUFA 3GO2A
chains in the Genus database with same CATH superfamily
3TYUA 1IGWA 2D3NA 4CEUC 1SFTA 4TTGA 1ZDLA 1OYBA 1XIIA 4ZOBA 2GVYA 3E2SA 2WW5A 5FSDC 3N6QA 3PG9A 1LM1A 1OYAA 3A3HA 3ZVHA 2NQLA 4Z2LA 4YN5A 5LHFA 2D2JA 4FZIA 3NS1B 4PMZA 3GYCA 3PJTA 5FIPA 3HPXA 3MDUA 1SB3B 3NQGA 2E8ZA 2ZKMX 1I1XA 2ISDA 1ESWA 2O0TA 2YZ5A 3H7RA 4QIUA 1FDZA 8XIMA 5FF3A 2V63A 2VL4A 4IFOA 1WZMA 1HJWA 4C60A 5LYRA 4I8YA 4GQRA 3BCDA 4MLJA 1XANA 1IZKA 2AMGA 3VC5A 2GGJA 3W75A 2RFGA 2BG5A 2ZUVA 5CSUA 5LIKX 1XX1A 1NHPA 1A80A 2J78A 4IX2A 3LX9A 1TTPA 3E0IA 3DOPA 4FX7A 4M24A 2XH4A 4LBRA 3IJ9A 1FWRA 1H1NA 3BZJA 1OGSA 1OZQA 5AYBA 1TWZA 5ABFB 1NF7A 1V3LA 5TQLA 3QF0A 3WG6A 4KPLA 5G5IA 1XM3A 1MW2A 1IEWA 1OX5A 4GLEA 3GIPA 5FL0A 1UWAA 3K4AA 3NVWB 1P0DA 4NIRA 1OG0A 1TUFA 3AHVA 1WUEA 4PEEA 2ONEA 4RDWA 2R9ZA 2YL8A 1JYVA 1BWKA 2HV5A 4OV9A 1RJRA 5CPLA 1B3WA 4C65A 3FGCB 5JH1A 4M5PA 2YL9A 3O0HA 4HOWA 1N62C 1R3WA 2OT1A 1MVYA 3ZM8A 1M6JA 5GJPA 4N0RA 1EXBA 4PB4A 4ATDA 3MB9A 4KGLA 1DIEA 5AYZA 1IWPA 1P7TA 4H6RA 5B7YA 4JNMA 1P43A 4XAYA 1O5KA 3OYZA 1CCWB 2OODA 2X99A 3UETA 1JR1A 4LAKA 3A5FA 3SCOA 1FWDC 5D37A 5IOBA 2E6YA 2C3DA 3A4AA 4F0LA 1FDJA 4MMWA 3IK4A 2MNRA 1YDVA 2X1IA 1UJPA 1OX6A 3GXFA 1PPIA 3WLNA 1K9DA 2R1PA 1JUEA 4Y9OA 4QNWA 3TTOA 3R10A 1NSJA 1RJQA 3ZOAA 3O16A 1AMYA 3FFSA 3GVRA 4JN8A 2QVNA 2VEKA 1KFWA 4ORMA 2V5CA 3TA6A 3VDGA 4QLKA 5FI8A 4KIEA 2XIMA 3MUZ1 1F3XA 3BGAA 4JCMA 2VC6A 5HPOA 3MSGA 3W1PA 3P0XA 1NH6A 3DKLA 1SR9A 2TYSA 3RO8A 1OX4A 2PF0A 4DWDA 2WVVA 1H7PA 1MNZA 3RRXA 4C90A 1K9EA 1C8XA 3ES7A 3EX2A 1JYXA 3W1XA 4NKCA 3D6NA 4DBUA 5K3VA 2QCHA 3TYAA 1B5TA 1ZBVA 3XINA 3WQGA 1V3IA 4Q6JA 7PTDA 3S4TA 4MZ8A 1OK6A 1TPH1 3WQ4A 1X2GA 1LRTA 4BF7A 3CWHA 1KRCC 3SQLA 2PDHA 3N04A 1LL7A 3BE7A 5CPQA 3VK5A 2OJPA 4A29A 3ONBA 1JI1A 3DFNA 1T99A 5C7HA 3WD4A 4K38A 5A6KA 5LGZA 4MKNA 1W3JA 4EVZA 3IV3A 2O4MA 3D46A 3CU2A 2CFYA 2PU1A 5I07A 3GRSA 2ZUWA 1NF0A 3CQKA 2Z1BA 3P3BA 1JDCA 2X0YA 1FCBA 3GC4A 1S5NA 2DIKA 3RGTA 4M0XA 1O1ZA 3IEBA 1H1YA 2R1MA 1XIEA 1Q6OA 2OYMA 3D3FA 1FH7A 1G01A 1VYRA 2EAWA 1OF8A 5HR7A 3DJJA 2RDTA 4O4WA 1UG6A 3S83A 3PANA 4FAMA 2VZSA 3GHSA 4U10A 1EEPA 1RA0A 1XG4A 2XWDA 2OLHA 4IMCA 3IIPA 1AD1A 2VFGA 4IFRA 3WLQA 2D69A 1J79A 3SUWA 4D8ZA 3DGRA 4Q4QA 1MZRA 1SZEA 4OBTA 3W3OA 4G6CA 1T3QC 1TWDA 5CJMA 3THAA 3N34A 3U9IA 5I6SA 1Q7QA 3CPUA 3H70A 3KBVA 4GYPC 1THFD 4TU1A 3WJZA 2B7PA 3ARVA 1CGVA 9RUBA 1H62A 3CT7A 1IEIA 1NWRA 3WH9A 1DJNA 4XWUA 1YEYA 5K9DA 1DVJA 4YCPA 3AOFA 1GKPA 2PDQA 3AXMA 4HU3A 4TIMA 5IBXA 3H2FA 3EA1A 3ARQA 1RY0A 4YMZA 4XD4A 1O5RA 2ZRVA 3KS5A 5HPCA 1UKOA 4MUPA 2ABAA 3WJWA 3NYZA 3BOXA 1UR8A 4YJ5A 4L4LA 2VZUA 3E74A 1RCOB 4LFYA 3E12A 2A6NA 4GFIA 4L4MA 3IIXA 3H2CA 1A50A 4JKLA 1I9CB 1ZRQA 1PX3A 3TLLA 1E3XA 1GQJA 1XWYA 2DPEA 1TV5A 4I6VA 4DQWA 4ZCWA 4S3DA 2I56A 4GGBA 4ZOAA 4BV6A 3C0QA 4F8XA 1WXJA 1E6QM 4D6IA 4GCXA 3TWAA 4ZO9A 4XZBA 3WFAA 1N60C 4B3ZA 2PTZA 2V3AA 5DCDA 3FHQA 4M6QA 4A2SA 5HNUA 1U83A 1V79A 1TYTA 4HTBA 1BYCA 5DMNA 1AZ1A 4FX8A 1TRIA 2X30A 4PFMA 1MUCA 3SGZA 3AIEA 5KMYA 4B2DA 4W84A 1KTNA 4EE9A 3L68A 1V3HA 3RUBL 2J6VA 1FWHC 4EF9A 4FNQA 1JDFA 2XGBA 1VS1A 2GJXB 1UP2A 1WZLA 3CO8A 1XISA 3MBDA 4B15A 1B31A 1IF2A 3GU1A 3LQLA 4YHEA 5FF4A 4EACA 1E56A 2YR1A 1GYMA 3B97A 4OUEA 1DJGA 1F8MA 4AY8A 1WCGA 1E6RA 1Z42A 2AGTA 1R2TA 1RJPA 1E0WA 2VYOA 5HQEA 2QCNA 4I6KA 2XN1A 1IZCA 1W8SA 1C8VA 5TBOA 5SWUA 2CKRA 2R94A 3E5PA 1K02A 2VR2A 4FOJA 1VBRA 2DJLA 2D2HA 4D6DA 1KBBA 3MCNA 3VTRA 1P0NA 1Z48A 2J62A 4TVWA 2EPKX 4EM4A 4W8BA 3FG2P 3LS9A 4LU0A 3GXTA 1ZQ5A 1M7OA 4L61A 2DFAA 1W0MA 2QDHA 3DXIA 3KP1A 3WUGA 1E6ZA 3H12A 3AALA 2WZTA 4HMDA 5HXMA 1PBGA 3QR3A 4KF1A 2IPGA 2REQB 4CD4A 4K36A 4H4ZA 1UUQA 1V6TA 1BWLA 5D2YA 1BFNA 2NQZA 3TR9A 1GRAA 1B3ZA 2IPJA 1RV8A 5MF5A 5DANA 1ZGDA 1HZYA 3ZWSA 5EBUA 4GD0A 3CEUA 4PMOA 2WHMA 2PU0A 3QRHA 1XIMA 2OB3A 4LRTA 5AHEA 4DO5A 1GRTA 3GNRA 2VX6A 4INFA 3QQWA 3B05A 3CAWA 1NJJA 4AWTA 1K8ZA 2GOUA 1F05A 4J3WA 4LRSA 3ID7A 1VCGA 5HA7A 4WJEA 2VMFA 1DTUA 4DWSC 3RM9A 1XGZA 5G2WA 3M16A 3C0LA 1V7YA 3S2MA 4DZ5A 3IANA 2SFPA 1WQ5A 3STPA 5CBBA 1E1CB 3QSRA 1ADDA 3VE7A 1W37A 1DIKA 4S23A 1V0NA 4K8EA 4DBEA 7REQA 2HWGA 5M1TA 3UZJA 1R9XA 3DCPA 4J57A 2GWNA 3V1HA 2P0IA 4DO7A 3M0LA 4KRUA 5A1AA 4LALA 4O8RA 2UY4A 3NZQA 2FZ9A 1HNYA 3EEGA 2GK1B 4IGMA 4IFKB 4JX6A 3OHIA 3D9XA 1KFKA 1LBFA 1ZAJA 4W86A 3RK8A 4Q8UA 3KBMA 1N5XA 1BRLA 5D9MA 4TX8A 2B7QA 4AMAA 1K9TA 1KTCA 3GXPA 1XPGA 4GXWA 4PUMA 2G96A 3B8DA 5D04C 1TMQA 5KETA 5H8UA 2QVHA 3GXMA 4ZO7A 4Z42C 3QLLA 3C2OA 3W2KA 1A3HA 1V3KA 3GC2A 1K8YA 2JF6A 3WLJA 2WO5A 3IJ8A 3REQB 2ZRZA 4P8WA 1FIQB 1R86A 1L2QA 4J28A 4LEFA 2V69A 3KZPA 3T0TA 4GFSA 4HA1A 1TV3A 4FMVA 3W83A 2GJNA 1VC4A 1MWOA 4WGHA 3RLHA 2WPFA 2Z7KA 3VILA 5EBAA 4EF8A 1IXOA 3LHTA 8TIMA 1HL8A 2J9YA 4DAIA 3SCSA 4LNYA 4R7JA 4GIEA 4MWAE 4YVPA 4QDWA 3MKVA 3WLKX 1V3JA 1DJWA 5LA0A 4Q4PA 2RJHA 4BCEA 4Q4MA 1B4EA 1IT0A 5JVLA 3ARWA 4PB5A 4O28A 3Q4DA 1MFUA 3WZ0E 3CLWA 2GWGA 4FS9A 1W9DM 3U2CA 2WNNA 3DH9A 4Q4SA 3UNTA 3NQEA 1OFPA 3AHZA 3UVIA 5ECUA 3TA9A 3L0NA 4PTXA 2CLOA 2QW5A 3Q45A 4AHOA 2TRSA 2UY5A 3GUGA 1MMFA 4I7UA 4C6CA 4WK9A 4YTSA 1UUMA 3AIVA 3EWUA 3GDLA 4WZHA 4CKQA 4QNEA 2IXVA 4ZFMA 4W9TA 1B0IA 2O92A 2BODX 3QYSA 5HWJA 2XIOA 3DG3A 3E5BA 4TMCA 3MC5A 9XIMA 3BQ6A 3AZTA 1W5NA 4ZE4A 1UKTA 3II4A 3WNNA 4KGJA 4QJ3B 1YBQB 4KWOA 3KX6A 1ISZA 5CGMA 2HNEA 1KM2A 1GVRA 3Q58A 5HUPA 2BOFX 1T8QA 5CG0A 3ATZA 3BCFA 3T42A 3OLEA 4C6IA 1MZHA 3OGRA 1PIFA 4NI8A 5J8LA 2YCEA 3GUWA 4AEFA 2OEJA 5A6JA 4X63A 5EYWA 2Z00A 1W5PA 4ZOEA 2WMIA 4KWWA 2PDXA 3INPA 1KCZA 3MS8A 4B5WA 3PF3A 4KCWA 1F2JA 3LM3A 4KCTA 1WUFA 5LHEA 4O0ZA 3CV7A 3L12A 5M2FX 2QLYA 2TAAA 3LY0A 3ABSA 3QSTA 3LLXA 2OGYA 4YIWA 2ZUTA 1PVNA 5TD4A 4YYCA 2XHYA 3AXXA 3AXKA 3QM3A 4B91A 3VKBA 2ZZ7A 4GQ0A 4IL0A 3MYPA 4CLMA 4MYAA 4XUYA 1MDLA 1HG3A 1UR4A 3UJ2A 3FEMA 3P6LA 4TVDA 3BLEA 4JXCA 2V3BA 1OFQA 1CI1A 4HU0A 1GOQA 1XGDA 1H7OA 4X22A 1GRGA 2ZOXA 3T81A 3S46A 2J8GA 3LXCA 4H9TA 1FFQA 2GUBA 4FALA 4GJJA 3UJRA 1F74A 3AYVA 3CTTA 2GR1A 4HMNA 3MTWA 1WZAA 1JOAA 4NAEB 3P82A 2NLYA 3A12A 3VPLA 4FIQA 3EEZA 2XH7A 4US5D 5FA5A 2Y0FA 1XLHA 3CGEA 3UW6A 3W6YA 4LV4A 3TEVA 4FP1A 4U2YA 4BEUA 2ZXQA 5F7UA 4DJEC 2EQ9A 4EM3A 3T6CA 3WQDA 1TVPA 3FYPA 5JCLA 4F2TA 3UG8A 5HQMA 3NZRA 1EC7A 1BAGA 4BQ2A 2D0GA 2XIJA 3HPZA 2CLMA 2X1RA 5H8PA 4U31A 4RV3A 1LWHA 2QJIA 1TPDA 3E2VA 4ICCX 3NDZA 1M7XA 5LXXA 1W1IE 3MO4A 4C6JA 1EA9C 1JVNA 3V36A 4LNCA 5A6BD 4PTDA 2J6XA 3U2EA 4DEFA 4D2JA 5A8OA 1MQQA 1FWAC 4EMJA 4NNBA 1J0YA 3OJGA 1DXLA 3MDWA 1AH4A 4ZFCA 3SO7A 1AW5A 1ZP3A 4FX9A 1POJA 4LY4A 2V6AA 2FZ8A 5JBEA 3M0KA 5K2ZA 3NSNA 2GQAA 2FLIA 1X38A 4GGHA 1J96A 1ZTVA 1QBBA 2WP5A 3B0PA 2CPUA 1HN1A 2AAMA 4IZGA 2ATMA 3AJXA 1D7KA 1ICSA 1J6OA 2WLZA 2EHHA 4OIFA 4C6QA 3USBA 5LA2A 4ES4A 2PZNA 2ISWA 3AHXA 3GTNA 3WMBA 3RCNA 2XTKA 1SW3A 3W82A 2VC7A 3CV2A 3DFTA 2ZE3A 2WB5A 4BJHA 1SJBA 2GR2A 3CZGA 4G8TA 3NNTA 1HVXA 1LBLA 2WV8A 3QV8A 3O9NA 4O57A 4KEZA 3HQPA 2C71A 3OEXA 3ZLFA 2ZX9A 1GQKA 1PKYA 2EQ7A 1YW1A 3LQGA 3UPWA 2OLSA 1Z32X 2Y70A 1KFBA 1JDEA 2J7FA 1S1RA 1PKLA 4W5UA 1EGVA 2CLLA 3PZ9A 2Q3RA 4J2PA 2G3FA 3SCUA 3U48A 2X1TA 4H7CA 1T6MA 3RJYA 3M7WA 1XW8A 1UWTA 3QFEA 1O68A 4J3ZA 3T7VA 5AC4A 4N7QA 4A8IA 3WLTA 1XJBA 1LVLA 1Q6FA 1TJPA 4JTFA 1ZP4A 3N9RA 2GJLA 1KRAC 1WDSA 2W67A 4HJFA 1DE5A 2YVFA 7A3HA 5FEXA 4V15A 4CCCA 1VYSX 1SSGA 3KBJA 5DY2A 2IPFA 1FCUA 4E2OA 1U1UA 4HA0A 2Y85A 4PUKA 4QITA 3W1AA 3KP0A 1KXQA 3LD5A 4ZSTA 2ZWZA 3P67A 1WX0A 3L67A 4JFVA 1A0EA 2YGYA 3BXWA 1CB2A 3CIWA 4BI6A 2UY2A 5BWFA 3ARPA 4G56A 5MKGA 4FXFA 2KZHA 4JZ5A 1G69A 3NQ2A 3MI6A 2XH2A 2GGHA 1C8QA 1KQYA 3G77A 1KGWA 1FRBA 3EMQA 1WYGA 3TN6A 4FX6M 2QCDB 3MZ2A 3II1A 3UXLA 5K9XA 3VNJA 1CLKA 2BBFA 1JQVA 2EQ6A 3W2NA 1GSNA 4DUXA 5AZ0A 4ZO6A 4N4PA 5C71A 1TX0A 5AECA 2F8QA 5EBKA 3LADA 2RHGA 3R7MA 1P1MA 4XZMX 4CQDA 2X2YA 1R46A 2POZA 1VLIA 4A3HA 3M44A 4IX0A 2V3EA 3OIHA 4MDPA 3A4WA 1XSIA 3N4AA 3M5ZA 1FUYA 1RD6A 3EWBX 4GYFA 4HA3A 3P61A 2Z1XA 3NUKA 2WHKA 1VZWA 2YYUA 3PZNA 2ZDRA 3HQNA 1BSIA 1ONXA 1WV2A 3CTLA 4HD5A 4NX0A 1CXLA 5DMMA 3DFYA 3DERA 3M0MA 3BMWA 3MANA 5A6MA 2QV5A 2RDXA 1H0GA 7ODCA 4W89A 2KX9A 2VX5A 3W81A 4H04A 4YWOA 2EJ1A 4OWGA 1HL9A 2FVKA 3M7SA 3Q6JA 3UZXA 3DFHA 4PBGA 1LOLA 4HK5A 3W7OA 3VIFA 1UD2A 4W7UA 3ZJ6A 3E9AA 4KW2A 5JCMA 1EO5A 2HMCA 2A4AA 3K46A 1OINA 3UCQA 4YL2A 4H6KA 4LUTB 5A8QA 5CPOA 1W2VA 3B9OA 1U1HA 3PNZA 4PTWA 4WDUA 1B3VA 4EQXA 4DB7A 3N2CA 4N9CA 4RJEA 3T44A 2YDRA 4GJ1A 3DJGX 4PMQA 4O53A 3PZVA 4LS2A 2FVLA 4HNCA 3WENA 3QC0A 2V67A 3QOMA 2WNZA 1YTEA 3FS2A 5FF7A 3RFAA 2Q71A 4F0KA 2DW7A 3F03K 4MZYA 1CW2A 3TQPA 1XYBA 3WQ5A 4JEQA 3GNXA 3O15A 3RYSA 3FVDA 1MUMA 1U30A 4DJDA 3B8UA 3EWZA 3K1DA 5JIWA 4KBXA 1CGYA 1KN0A 3DIPA 1EC8A 1VD6A 2X0HA 3IVUA 3KRUA 2CXGA 3RRAA 3S6OA 4PUNA 3QW4B 1BYBA 3FIGA 4F0HA 2RKXA 4G9PA 5CZSA 4L6OA 1J0KA 1ZMDA 5G2IA 1H5YA 2FTPA 3A24A 4JN7A 2PDMA 1JPDX 3E0WA 3EWDA 4EXAA 4L65A 1AQ0A 3W6MA 2ZZBA 5EKYA 3ZSSA 2V3FA 3QGAC 4HP5A 1EGMA 1HO1A 3SI9A 1FWIC 1N2VA 4ASTA 1CENA 1E0UA 1JFHA 1LTDA 1OC5A 4BWLC 1E5JA 1KM5A 2YPIA 3OVQA 5CPNA 2QMJA 4URIA 1BQGA 1T5AA 1OHLA 3KLJA 1FQ0A 4AWSA 3L7RA 3TWBA 5DRIA 3VOGA 4WVXA 1JRCA 1GJUA 3EKLA 4BF5A 3SRFA 2VT0A 3HIJA 3IJ6A 1TZZA 1ISWA 3RJXA 5G1MA 3W2JA 4RR4A 2D24A 5T91A 1EJUC 2PDKA 4AW7A 3AUOA 2FZBA 5AY7A 4HNNA 3I10A 3IUIA 4ZL1A 5GVJA 4M7SA 1IXNA 3G1XA 3SR6B 2C0AA 4ADSA 5IDIA 4RE3A 3CH9A 3EXRA 4DYJA 4CUCA 4OOZA 4Q6XA 1XINA 4M56A 4OGZA 3K30A 3H54A 3W70A 2EGZA 1GOOA 4RE2A 1MXGA 4JTIA 1ME7A 5E0KA 2Z4GA 1V0KA 3TQVA 4O1FA 3C6CA 4MWAB 3TK7A 4ECLA 3UCCA 3AM9A 4HU8A 2E1WA 3H2OA 4JDYA 2NUWA 4I90A 3T0AA 3TZNA 4MOZA 3PZQA 1O5QA 5G4WA 1C9DA 1UUOA 1U5JA 3NZGA 2PLJA 5BYWA 3LHWA 2YIHA 3USZA 2A7RA 2A3HA 3WQ6A 3VCCA 4UR9A 5KVHA 1TIMA 3GRTA 4NZ3A 4L1GA 2JBMA 3FAXA 5T26A 4D6GA 3ORWA 3KUMA 1TRDA 2YBTA 1NELA 5LZLA 1R3SA 2DIJA 3UXKA 2O9OA 3OYXA 4NXKA 2HXTA 3ELFA 2JKPA 5E9XA 4UR7A 4AZGA 2A7PA 4LV9A 1KKRA 3PUOA 2J7EA 4D6EA 3D5HA 2YAUA 2Z28A 2H9AB 2V81A 4WSJA 3GIYA 3KOFA 1PYFA 3BC9A 4OFCA 1GNXA 2O7QA 1K03A 5H91A 1V6VA 2Z1SA 3FCPA 1X1OA 1F07A 2HE8A 3PN8A 3AMCA 4AU0A 3EOOA 4MWAD 2EPHA 3N19B 4UR8A 1UA7A 1QNRA 3CHEA 3GG8A 1J18A 4GISA 4CD7A 1LG1A 2VGIA 3VOHA 2WQPA 2R9RA 4NZJA 4E8GA 2PI6A 4A3QA 1N63C 2A3CA 5B7ZA 2G97A 3PR2A 3WJXA 3G1SA 8CGTA 1QRQA 4JQ9A 3NGJA 3WBAA 1XBXA 3R89A 3GKAA 1XFBA 3WUEA 3R94A 4H2HA 1Q4WA 1T0OA 1A0CA 3TSBA 4PZVA 3HV9A 2EJAA 1K7XA 3W71A 2E5CA 3JR2A 4RL3A 1HGYA 4CEXC 2DVXA 3ZJ8A 6TIMA 1U22A 5FKYA 4DYEA 2E77A 1J0JA 1Q13A 4YNGA 4QQ3A 2HBXA 3GW3A 1TJRA 1RBOB 1OCJA 1PZ2A 3G1AA 1FX6A 1PIGA 2E6FA 1E6XM 5HOSA 1KGXA 2F6XA 1F8IA 3RIKA 2XUCA 2NVDA 5K4XA 1LWJA 3W7EA 1I75A 3TQKA 1R87A 2ZXBA 1M3UA 1QI3A 5U4NA 4DYKA 1XLGA 1DORA 1UWQA 1XIFA 3TN4A 3IJ7A 4RDVA 4UQCA 3CAKA 4Q8OA 1F3WA 2INEA 1XICA 5C9XA 1KV5A 1ZKQA 2BXZA 4DNMA 1H4PA 5D2XA 5TR3A 3H2MA 4RE4A 2PDJA 2WLYA 2E40A 5PTDA 1JZ8A 2E8YA 3TLQA 3DGHA 3B03A 3A13A 5CLWA 1NFPA 3VGGA 1RLDA 3N2XA 1JCTA 2IPWA 1YMYA 1MYRA 4Z1BA 3PHAA 3GD6A 4QGCA 2W0UA 3SGGA 1XLJA 3ISIX 2AAQA 4UBPC 1BEUA 4IP4A 4AEEA 3ZVHB 3SW6A 3NM1A 3PB0A 3EZ4A 1OGBA 2Y24A 3PP7A 4XTDA 3AYSA 1FXPA 2YDSA 4JQ1A 2BVWA 3ALGA 5FESA 3FN9A 3QHNA 4JTDA 2BGNE 4QJ5B 1TTIA 2J7DA 3VUPA 3EDJA 2YDAA 1NFGA 1QI0A 3ZQ9A 2Z6IA 4GZIA 2OGJA 1QW7A 4JX5A 5AN7A 4MY9A 3CUFA 4MF4A 2AMXA 3CYVA 5FJRA 2IXUA 2BZNA 3BSGA 4AWEA 5GNXA 4PEKA 3S6TA 1W1YA 3F4VA 1N8IA 5LNUA 5HQLA 5C9ZA 3Q67A 6CGTA 2PA6A 3WMLA 1VLWA 1BVZA 1JUKA 4GBUA 2DZSA 4S3JA 3MYOA 4IIGA 4JTSA 2WCAA 2NUXA 4OBSA 5CLTA 2B0MA 2J74A 5I3IA 3KE0A 3Q65A 1WPCA 2J24A 1DIDA 3VVGA 1ONRA 3LPGA 3F4WA 1TJ0A 4AUBA 3QY7A 3BV7A 3DFOA 4AD0A 4UQDA 1E9YB 2RABA 3VMNA 1R85A 3IS4A 3LDVA 2YXOA 5I3GA 1XP3A 1Q45A 2OKOA 3O05A 1NDZA 1JF6A 3FHAA 2AL2A 1GZ1A 4GABA 3LHUA 1OFRA 4CCDA 1S5TA 1JAEA 2ZXDA 4F79A 3SY1A 1KBIA 1C7TA 3QHOA 2P5NA 5HJXA 2C3ZA 1W1A1 2W61A 4KH2A 1V77A 3CBWA 1XBYA 3HO8A 2E67A 1SFLA 2NSXA 4IJBA 4YVXA 1GTHA 3G1VA 2C7FA 5GPRA 1XUZA 3WDPP 3VIPA 3TIMA 1PTGA 4Q33A 3IK2A 3GX9A 3CUZA 4Q8PA 3F5LA 3LRKA 4R9OA 5L6UA 2Z26A 3ECQA 4LAUA 2BGSA 4XZIA 3DK4A 2Z1VA 1Q1RA 4F4RA 2WVUA 1X6LA 3PTMA 1OWQA 3ITLA 3ZXWA 1XLBA 4NJJA 2OEKA 3GM8A 3W7DA 3NL3A 1OF6A 1QHOA 1SZGA 4H7VA 4BQ4A 4JKMA 3SIZA 2E5AA 1OBAA 2QV4A 1XYAA 3MY9A 3FJ4A 3IRDA 4YCOA 1JXJA 3N12A 4LYPA 5T9BG 3HFYA 4RKAA 4K7ZA 3AAMA 4OTKA 5BMWA 2A3AA 1V4YA 1ZCCA 1B4KA 4QCFA 4H4YA 2G95A 1QBAA 4EWND 5CCZA 2ZADA 4UTIA 4PL1A 1OX4B 1P6BA 4JKKA 4UUIA 2WVVB 3BK0A 3LGEA 3PG6A 4NILA 3NDOA 4XVDA 3HOJA 3UWQA 1MO9A 3ERPA 2O9RA 1H50A 1RK5A 3NDYA 3NXFA 1SM9A 5I5RA 3TOPA 3U5UA 1OCBA 3RN6A 4JTEA 5DXXA 3P74A 1FWWA 3AJ7A 3IARA 4GR1A 3VFLA 4H8NA 3C0SA 1AUSL 2GQ9A 2ZZ4A 4LPCA 9CGTA 2PF8A 1V6XA 2HPIA 3U7BA 2ON3A 2FZNA 4JY9A 1XDJA 1TSIA 4RX0A 2WMKA 1VRXA 1MOKA 3DG7A 1RY8A 3LHZA 3PY2A 4RW3A 4UCFA 1RVGA 1GVIA 1UOKA 1WBJA 3XISA 1GONA 1E43A 1OG6A 5K7JA 1VEMA 3BLIA 1T41A 2F6KA 3URHA 1PS9A 3CV6A 3S9YA 5AC5A 3FKRA 3S0CA 2ZZ1A 2XVPA 1WNOA 2WJDA 5CGQA 1DWIM 3EWCA 3WD0A 3RX3A 3VNLA 2IKIA 2NUYA 2FTWA 4UTTA 1IWAA 1L8PA 4LBUA 1QU4A 1G1YA 3SBFA 3UWUA 1YBQA 3N4FA 1XLIA 4XSMA 3EX3A 4AFYA 1GVQA 2AOSA 2IQ0A 3WIJA 3FY1A 5I3JA 1NPXA 2CLIA 3B9EA 1RQHA 4MM1A 3VIOA 3TV8A 3W29A 3KOWA 3NVVB 3QZ6A 3NXLA 3OO2A 3WN6A 4MNKA 8RUCA 1CGWA 3NURA 4PBFA 4UNIA 4UQEA 4US5A 4UXDA 3WQOA 4K8GA 3UGVA 3RR1A 3KDOA 2ODOA 3UR2A 1EYWA 4HTYA 3P7YA 3A7AA 1KCXA 4ZZ9A 5CZ0A 1HKKA 3GC5A 1TQJA 4J7RA 1C91A 4JTLA 4R5EA 4H4RA 2E4TA 1F6KA 1H7WA 3NL6A 2JALA 3R2GA 4AIOA 2P3ZA 3SRDA 2PWHA 3LLDA 2P1FA 1W5OA 4JHOA 4ZXOA 4B5SA 3MI2A 1J0IA 1Z7AA 3ARTA 3KVKA 5I09A 4B9YA 4GQBA 2OLAA 4JFTA 1I2RA 2W9MA 1GZJA 1X7FA 1FECA 4AD5A 4CVWA 5A94A 3FV9A 3NM3A 5JBFA 2CHOA 2WP6A 3C0JA 5C70A 5EMJA 3EYPA 3POHA 4L64A 4B90A 1K7FA 1I8JA 3E02A 3EDDA 3EX4A 1TPWA 1VCFA 1P4CA 4PCFA 1I2PA 5BNKA 2JGYA 1E9LA 3ZR5A 3QV9A 1QPNA 4JR5A 3EDFA 1ZUAX 3SY5A 3GVVA 1TE1A 3WNLA 3NIYA 2BS9A 1GW9A 2YSWA 1RP9A 2P88A 4JIPA 3RM4A 2BC0A 4Q4RA 3VDHA 3LLFA 4RDYA 4MTVA 2CXEA 3AO0A 4P8VA 3UWZA 1A4MA 2AGKA 3VCRA 1XC6A 3BANA 1WXZA 4RZ5A 4E3TA 3H7VA 3W85A 3BW4A 2A3EA 2OOGA 2QAFA 2PC4A 4C6OA 2V2HA 1OY0A 3UD6A 3WQPA 3C3UA 3LCIA 2PDNA 3WLLA 1MUWA 4IM4A 4PN2A 4MNMA 3IVSA 1BG9A 4U3CA 1GOKA 3TUUA 2ABBA 1H51A 3A23A 1RHCA 1OT2A 3YPIA 4U5KA 8A3HA 4WXZA 1W9PA 4PYSA 3TJLA 3VM7A 4P7NA 4PGLA 1QNVA 4R88A 2VVNA 4R85A 1JRBA 4PR4A 4G5DA 5I3FA 3SCWA 1CT5A 1OFOA 1UIOA 4K7VA 2CEQA 3IIVA 2JF7A 1PAMA 3M5XA 4GG9A 2EPLX 4JX4A 1R9ZA 4K1WA 1A5BA 1L9WA 1YNQA 1EDGA 3LCFA 5BRQA 5HATA 2F2KA 3RHGA 1XYZA 4GZJA 4JTAA 3T0CA 3DAQA 1XPYA 1GGOA 2E09A 4S1FA 2XJ7A 2RDUA 3MMTA 3MQTA 1OB0A 4QRNA 3K8MA 3B8VA 4XBKA 1XRTA 3ZYZA 1WA3A 4KCUA 3LM7A 3WK3A 1V59A 3SQPA 4LSBA 2DZVA 2DZUA 1FWFC 2E6AA 5E6YA 1YTDA 2ZCGA 3PPHA 4ZVJA 1TCDA 2J7HA 4AD2A 2HTMA 4DLFA 3OA3A 2BHZA 4XAFA 2Q02A 3H53A 3JW7A 4DLMA 2QCEA 1U5VA 3BICA 4AEOA 1ISVA 5EMUA 4LVDA 3FX4A 4K8HA 3ZT5A 2OSYA 1DXFA 1JXKA 3EPMA 4P7LA 3WLRA 1I6NA 2FGZA 4B5VA 2Y61A 1HKIA 1H7RA 4UTHA 1UR9A 1NWUA 4NP7A 1FWEC 2XISA 3LEPA 3KOZA 3V0SA 1W2PA 2VZOA 1EIXA 5AHFA 4JL1A 3IWPA 2HK1A 1TV2A 1KCLA 1ZPTA 3R6IA 3TSDA 1UKPA 2PGRA 2IMRA 1YDNA 1FWGC 4G1NA 5DELA 2VRJA 1HGWA 1XLEA 4HPGA 5LNRA 4ZA0A 4H4QA 1W31A 1TWWA 3IIZA 4DXKA 5DT7A 5CAKA 3Q37A 1S46A 3WUBA 3N17A 3SRHA 3OZOA 1MRAA 4QS6A 2VCCA 4I9JA 4GYKA 4O52A 4Y6GA 4OBRA 3WD3A 1XI3A 1S7MA 3U2OA 4E2DA 2DORA 4YTUA 1CNVA 4HSHA 3CUHA 5JXQA 4QX4A 3JRKA 3P62A 1UR2A 4ML4A 4A6GA 3T05A 4HSOA 2NV9A 5CKSA 2ZZ5A 1XLDA 1DJXA 2OOFA 1WKDA 3WLSA 3F2CA 4PMYA 1L0PA 3O6CA 3G3MA 4IP5A 1QHZA 3DK8A 4H9VA 4XKYA 1Q6CA 1JZ3A 1TO3A 5T9CE 3O8AA 1CDGA 1UC5A 3NOYA 1FOBA 4J5NA 2J7GA 1F5ZA 3LSCA 5AC7A 1D9EA 3V1PA 3AXHA 2PP1A 4L6DA 4M1RA 1Q63A 4AVOA 4ENLA 3GSMA 2GL5A 4WDXA 2L5HA 3KZSA 3CGDA 3CGTA 1DE6A 2NT1A 3WQWA 1FH9A 1SUXA 1K1DA 4WKAA 1PZ0A 3NFUA 2WZMA 1TA3A 1RBAA 2XIBA 2GVJA 3AIBA 4J9JA 2DH3A 3LPFA 4IPIA 3HF3A 4LOCA 4IPLA 4TOQA 2WOIA 4K7YA 4JHZA 3DYOA 2TSYA 3W6LA 3SJ3A 3GTHA 3W7RA 1FFRA 2Z1WA 3SQMA 1W3NA 2BNJA 1YE4A 1EP1A 4O10A 1UA3A 2IKJA 3NCOA 1J01A 2WCSA 1EL3A 4MB4A 1TR1A 3VYLA 1ENUA 2F9RA 5DY3A 5TIMA 5IFTA 1WO2A 3LRLA 3EXSA 5B80A 4E0CA 3OG3A 1RXOB 4GYJA 4Q8TA 4MY1A 3W24A 4MYXA 4E8DA 3PBYA 1OEPA 1MEWA 2CWXA 3STCA 4DJFC 4TUFA 1ICQA 1OFBA 2ZC8A 5F4WA 4AZHA 3HRDC 3O63A 1TQXA 4P7OA 3CH0A 3P8IA 4ORIA 1YQZA 4F2UA 2W92A 1E70M 1OCQA 1B57A 3MMWA 3QFWA 2P53A 3M5YA 1EIBA 3ZZ1A 2O56A 3BAWA 1QI4A 1B2YA 1LDCA 3HGOA 2WKGA 3C56A 3NZ1A 1EBHA 4MB5A 3TROA 2BOEX 3OG2A 2WMIB 4NEWA 1EHAA 3LOTA 2QDGA 2WM1A 1EJVC 3UVAA 2I5QA 2BX7A 2C79A 3NL5A 1AQHA 4H4IA 4HYWA 1TFVA 3TJXA 4LUJA 2OZ8A 3EWXA 2VJXA 1MW0A 3B06A 3BARA 1TUXA 4L56A 1QR7A 3TN5A 1PHWA 4K37A 3N2OA 3BQ5A 1E0XA 3I6TA 3V7PA 3T09A 3BG3A 4O1AA 9XIAA 2Q8XA 1J6PA 1VFSA 5EGRA 4JQ4A 2VFDA 3TW6A 2WKJA 3KCOA 4UOZA 1F76A 4F66A 1VR6A 1UMYA 3NL2A 1I45A 3C61A 3EOUA 3LBOA 3LCLA 2GOKA 3TTEA 1ZS2A 3WUFA 2VRKA 3QN3A 2YLLA 5I24A 1N61C 4IG2A 5A95A 3MBFA 3SGUA 3L0KA 4M3PA 2NWSA 2VGGA 3PUDA 1TTJA 2F84A 4CQCA 3S1VA 3R0KA 3U3HA 4XISA 3UR8A 1OADA 3TC7A 1EUNA 1VQTA 3WDJA 5EMYA 5RUBA 2DUZA 4UFJA 4PMVA 3AZSA 4LT9A 2XPKA 4UFMA 4FA3A 1CTNA 5HMFA 4UWMA 3CHVA 2OVLA 4UOJA 4TXEA 3UFYA 1GOXA 3GG7A 3THDA 1NWSA 1SO6A 2YOCA 1G0CA 3NG3A 2DQXA 5D03A 3UGRA 3APGA 4GVGA 2DUAA 1SO3A 1EPVA 1LL6A 1VKFA 1ZL1A 4BKNA 1JYNA 3SCRA 2YKKA 3WDIA 3VX0A 3URNA 1U1JA 2VHLA 5JRBA 4E38A 3WNMA 1RUSA 2CHRA 3UEQA 4ZEPA 4AYGA 5DBUA 3EANA 3O6YX 4Q8WA 2W6RA 2VQTA 3QPEA 1F6YA 1KXTA 4XV0A 2WC4A 1YPFA 3IRSA 3HPFA 1RSCA 3DHPA 3KOYA 3PAOA 4NU7A 2OELA 4PTVA 2WK2A 1H63A 2YA0A 3BOLA 5HK4A 1GRBA 4O1CA 2QPUA 4KFNA 3N25A 4FNPA 4QP0A 1YRRA 5A8GA 3NQ7A 5CG7A 3SSJA 4EMIA 2YXGA 1EWEA 3C5QA 2V6OA 2X7WA 1I0BA 2W27A 4AYSA 4UFLA 1A3WA 2PD5A 1DQXA 1CPUA 2R1LA 3QHMA 1N8WA 4N6FA 1W9VA 1EP2A 4H9MA 3CHDA 2ZBTA 2P76A 2CZVA 4HPNA 3ARRA 2GVLA 2C13A 2J79A 3BPWA 4S3AA 1VBUA 2IUZA 5CAHA 4XVEA 4ICMA 4DNAA 2PC8A 2DJXA 3M1ZA 3H21A 2Q3OA 3MHGA 3MV01 5FD0A 2BVDA 2J8TA 4I8DA 4WR3A 3R25A 1PJ9A 3S5SA 1ADSA 2V9DA 4H6EA 2QR6A 1QHPA 4PB3A 1NHSA 1HKVA 4QLJA 2XG9A 5FS6A 2FPVA 3FXYA 1S5MA 5KTLA 4E8CA 3E0FA 1EQPA 3ZVIA 4ACYA 2Y6ZA 3NOEA 4JBRA 3UYCA 2VCAA 2DZTA 3KTXA 4AY1A 3VCNA 4BY3A 4IMDA 1JZ2A 1HVQA 4NHVA 2WANA 4PE8A 2XH0A 2Z24A 5K9CA 2Z27A 4UB9A 4WY0F 1QUMA 2CLPA 4Y96A 4CU8A 1JULA 2GDQA 5XIAA 4KCVA 3GH5A 4C5ZA 5D05A 3DI0A 2J3NA 3GTIA 4PUEA 4QS5A 4DI9A 1VF8A 1GVEA 5DBTA 1U2YA 4LW7A 4MZ1A 4GE8A 4WEVX 1VFHA 3OHMB 4HA4A 1CLVA 1SPQA 4LB4A 2VUYA 4K8DA 1E3ZA 4PCPA 2RGMA 2VC9A 1XLCA 3DH7A 3GE7A 4LC6A 4CU7A 3QZAA 5MKGB 3UA4A 4O16A 3UY8A 1N8FA 5A8PA 1VFLA 3F4NA 3TAOA 5FMHA 4A4AA 1L6FA 2VEMA 4HK6A 2E3ZA 1GTEA 2PTWA 4EANA 1KBJA 3CAVA 3MP4A 4DWSB 1T96A 3TYEA 1LPFA 2VD9A 3CPGA 1UH2A 2D2GA 1FHVA 3PBVA 1JIBA 2FJKA 3UU0A 2G50A 3UWYA 3QR1A 4NY2A 3GH7A 1KRMA 1G4TA 4GI9A 4I5XA 3VOFA 2DIEA 3OP2A 4QHRA 2R1KA 5M03A 4JQAA 4ROQA 4E4UA 2XSBA 1X39A 1I4NA 3S42A 3HJEA 3T2QA 3C2FA 4DAFA 4XAPA 4ERAA 2JIEA 3GH4A 1ME8A 4ZODA 3RILA 4OJYA 4TVCA 2VOTA 1DHKA 2NV1A 1ICPA 5I03A 3H26A 4KS0A 2P8BA 4GNVA 1AL7A 2GR0A 3TZFA 1DWHM 4AISA 3MO7A 4GINA 4UMAA 4HNUA 1QPOA 3I6RA 3S1XA 2FZDA 4DWSD 4KWVA 3P81A 4XIAA 4DIAA 1N55A 3LBCA 5C7VA 3GZ3A 1B9ZA 4OQVA 2VVSA 4JNZA 4NJKA 2EEXA 2WBAA 2XFWA 3LMZA 2HEJA 1XLKA 3BJTA 4GC4A 2WZIA 4J4KA 4DBSA 1YDYA 4GNKB 1XUUA 1REQA 3W27A 1TWSA 2WMJA 3MI3A 1J93A 2TODA 1LUCA 2X42A 1KGUA 1FKWA 3V5CA 2YVJA 5FJJA 1EZ2A 1EQCA 3OA5A 5BXRA 1SJAA 3TX9A 1GVSA 4NX5A 3T8QA 1OCNA 3NVTA 4C6BA 1KV8A 3K4WA 4GIAA 3SECA 2J13A 2WZEA 1BTCA 3NO3A 3BUVA 2VXNA 1KM1A 1VBJA 3WK0A 3AMGA 2YCIX 3VGDA 2YCLB 1HW6A 2OPJA 4CNPA 2UZ9A 3C3NA 1V02E 4HOXA 1PUDA 4ILSA 4MNJA 2J75A 2HQMA 4GC3A 3JUGA 3BURA 1R8LA 1EFZA 1XLLA 5AB3A 1POKA 3TOYA 4HQVA 2FFIA 3ARUA 4LEQA 2NQ9A 1V0LA 3B04A 2VUNA 1AK5A 5KVIA 1K7EA 1LQ2A 1CGTA 4PCNA 4DJFA 3SUVA 4J1OA 2OQYA 4AMCA 3ES8A 2CNCA 1VCVA 3H2AA 2FJUB 3EPNA 4K39A 5D8WA 3AU2A 3B9JB 3PJXA 1E1FA 4GWEA 3W84A 1ZZMA 4XZNX 3LUTA 3V0TA 3AI0A 2QZRA 1EJSC 3HFTA 4KWUA 3VZZA 1Y7VA 3TMLA 4TV5A 5EA9A 2IS7A 3T78A 1YXYA 3AQUA 1FFVC 3SCQA 2PDWA 3DHDA 2V82A 1WDWA 2RJGA 3O2LA 5HAOA 1OC6A 1EWDA 5HJLA 2ZZ3A 3P8JA 1MDRA 1BGGA 3L2MA 1WBHA 2ISVA 2PLKA 2CFFA 2CBVA 4B3KA 2XVNA 5C55A 1BD0A 1ONWA 4G7FA 1GEUA 3VOIA 2UBPC 4JD4A 2YBVA 1CXHA 5C5YA 4YWIA 2UWFA 4ADUA 1HX0A 1L6YA 4GRSA 1UJQA 3ARSA 2ZC1A 3MUXA 4XUGA 4O1DA 1IGSA 3QVQA 3UJFA 4LA1A 1J2BA 1QOQA 4DJDD 3MW7A 5CSRA 1KC7A 3LTYA 1DXIA 1G9HA 2ZYFA 1XQKA 3NQFA 2J47A 4JL2A 3NO1A 3I3EA 3GKFA 1E9ZB 2VWSA 1BZLA 3PS7A 2O4QA 2DSUA 4A3YA 1Z89A 3EMZA 5BMXA 1FWCC 3QBUA 3K8KA 3W4RA 5J5DA 2BY3A 3L0GA 3T9PA 4ADTA 4CD6A 4XIMA 3VIIA 3BGJA 3ZR6A 3AWNA 4YTQA 2CITA 4Z2HA 1XV8A 1A5NC 1GESA 4BR1A 3OPSA 4NAFB 2ATSA 1Q6EA 3SFWA 1KCKA 4OECA 1VIWA 3CZEA 1BLIA 3IGXA 3KRBA 1UD6A 5FAJA 5IRPA 4H2CA 1SJDA 3GNDA 2FIQA 1S2AA 2CERA 3C2EA 3DU0A 5JIPA 3PBWA 1DJIA 2HXUA 2R82A 2ISFA 2HVMA 1DWFM 1O60A 2YXXA 4EQRA 3MZNA 2V5LA 5C9UA 2C3CA 4XZHA 5ABHA 2VEGA 3WQEA 1FH8A 2E68A 2PUZA 1UCWA 2AL1A 3L2IA 4UTWA 3IAQA 3VKDA 5AHIA 3EA2A 5JU6A 4Y2WA 2WPGA 5LNSA 4KPRA 1LQ0A 2QHAA 3N29A 2QT3A 4MDOA 3JZEA 1BHGA 1UQYA 2CBUA 1EDQA 1YX1A 1K9FA 1XDMA 4U2ZA 4L4PA 4F9DA 1OIFA 4R27A 1JL8A 3W26A 1AZ2A 5KZMA 4B5UA 5C6MA 2NT0A 4ZOHB 3L4VA 4GO8A 1FKXA 1FHDA 3DGBA 5CBJA 1Z6KA 3PC0A 2HZGA 3GR7A 3G2GA 4DJED 1Q3NA 2VR4A 1WB0A 1XFCA 1F73A 4MWAC 1LWIA 5AYYA 1RD5A 4V1YA 4AZIA 1WZKA 2A6LA 1ZCOA 2BASA 3CGCA 4WJXA 1UD8A 3W7KA 2NPXA 3PBGA 1ZAHA 1G94A 3M41A 4GXPA 1XC4A 4RNHA 1HJXA 4AIEA 2WMFA 5CSYA 3CLMA 4D8LA 1FY6A 2W3ZA 3CUJA 5CPMA 1EJ7L 2HVNA 4RZ6A 1RPXA 1X7IA 4Z08A 3FJLA 5FAGA 2QJJA 3M0HA 1PL9A 3TH6A 1UWRA 1VYPX 3VI2A 3BW2A 3LU2A 1QT1A 3C8NA 1AODA 1FHUA 2GH5A 3KHJA 4L80A 1A5CA 4HCHA 1E0VA 3AS3A 4RE0A 4US6A 4GOAA 1TWIA 1VH7A 2WZHA 2ACRA 4MB1A 3M9YA 1HQTA 2PCQA 1ML1A 4JIIX 1E5NA 2FH8A 2YFOA 3OTRA 2QUTA 4Z2KA 1E4NA 2BY2A 2O7SA 4DXXA 5E9AA 4FLOA 5BU9A 1J12A 4O13A 1JCXA 5G1YA 2FHFA 1QPKA 1M65A 1BSLA 1IR1A 1VBHA 1F7BA 3VA8A 3SCTA 1XIJA 1W91A 3VGBA 4OVXA 1RP8A 4FPSA 3G1RA 4WLCA 3P0WA 5I3DA 4I5UA 4ZGYA 2JK6A 5FS7A 4N2YA 5C2GA 3W9ZA 1DXEA 4H19A 1M53A 1LF1A 1F9CA 3QKZA 1KRBC 3N18A 4MADA 4U33A 2GJPA 3LSBA 1TVLA 3MSRA 5D9OA 3PTDA 4IGHA 4TQTA 5DF0A 1H7XA 4H4VA 4D6JA 3H22A 2ZVIA 2NXGA 4QDPA 1Y5WA 4UMCA 2Y5SA 4M82A 2PODA 3SUSA 2Q09A 4XO6A 1XCWA 3GDMA 3DK9A 1B1YA 5D32A 3H6OA 2I14A 4M81A 4XSLA 2WQDA 1MNSA 5GJMA 1XR2A 2ESCA 3VIJA 5ABEA 1SMDA 1JQXA 4I7VA 4JYEA 3WF4A 2Z6JA 4UZSA 4WX2A 3PZTA 4PMNA 1VHCA 2VGBA 1KLZA 4H4UA 2XINA 3NQCA 3URAA 3OBAA 4KMQA 3CMGA 4YYFA 2CLHA 1PZ3A 3M64A 1T8XA 1VENA 3B8WA 3U5YA 3KRZA 2QJHA 4J27A 3CUGA 2QPXA 3PFRA 3S1GA 3GU9A 2PAJA 4GY0A 1GRHA 3C4UA 3RU6A 2HPMA 3GB6A 3LG3A 5F4SA 3STFA 3G3DA 2AL2B 4HYVA 1E6PA 5C9RA 5JCNA 1JYWA 3UZWA 2C1HA 3K4DA 3N2BA 2B81A 4X0VA 3TVAA 3UZYA 2NX9A 1F61A 3HG2A 1L6SA 4HHMA 1H41A 3VMOA 1YIXA 2GSHA 4X61A 1J5TA 1ODZA 1ISYA 2R8WA 1KFCA 1CX9A 2OSXA 2XGZA 4FLSA 2ZA3A 2VC5A 4FSAA 2WOWA 2GVGA 1M41A 2DV0A 4LQ1A 2W4XA 3QTPA 2C0HA 1RH9A 1H1ZA 3CMJA 2BSLA 1TZ7A 3BDKA 4MSSA 1W5MA 2HSAA 4POCA 2VX4A 4S2BA 4F0SA 4QAIA 1ZSXA 2DH2A 4D71A 3TJ4A 1OSEA 1XIHA 3NVDA 2VFFA 3ZJ7A 4GZ7A 3M0ZA 4HOZA 1KXVA 4ZO8A 3UYIA 1R47A 2ZRXA 2Z2AA 1PHQA 1KB3A 4E2BA 2A3BA 3LPOA 3QV6A 4PFHA 2OKTA 3B8IA 4AX7A 3VZXA 3K1GA 5E0FA 2Q01A 4LUIA 2FDSA 4QFUA 1TV8A 2D73A 4U3AA 3HMCA 5E1QA 2BTMA 3V18A 1S2VA 1AJZA 4D6CA 2VOMA 4JDBA 3GNPA 4M6VA 3PWGA 1JZ4A 3ZLGA 2TPSA 3BLLA 4CNSA 1FA2A 4IQLA 1KM0A 1XYMA 1P6CA 1W5QA 3LV6A 3VNZA 3T8LA 3FSTA 3P5ZA 2PLCA 4A22A 2RAGA 4GA8A 2PWUA 1C8YA 3FJ6A 2VWTA 5BROA 5F4XA 2VFEA 2PB1A 2NW0A 4OKDA 1KXHA 1VFTA 3WBWA 3RPTA 2H90A 1GZGA 3P2VA 3ZR4A 2OZTA 1UROA 3OVPA 4FF7A 1E72M 2IKGA 1W9UA 3HA1A 4LWWA 1LL4A 2HDJA 4Y9MA 2WM0A 4REQA 5FL1A 2PMQA 3NQDA 3V75A 7ENLA 4J3XA 2RGLA 3MWAA 5DN1A 4Z0JA 2H3DA 4KKXA 2A5HA 2PRMA 4GO9A 5CC7A 3AMDA 3AYTA 3HG3A 3BLKA 1EGZA 2PDLA 3GY1A 4AZCA 1Y5XA 2PS2A 2FH6A 3UJSA 1VDVA 5I02A 4GI6A 3WK1A 5FF0A 2YB1A 3A3XA 3QY6A 5GRTA 1J10A 3EGJA 4HPJA 2DZBA 2OWWA 1MEIA 1PE1A 1WAUA 4FXSA 3U4FA 2CWNA 2Z29A 1W32A 4IMEA 4B16A 7CGTA 1XIBA 3H23A 4FNSA 3FAWA 2QYGA 1XH0A 1NP0A 1CWYA 3VX1A 4AZ5A 1Y8BA 3P80A 1GWJA 1S5WA 5CSSA 4F0RA 1UKSA 5KSWA 2NQJA 1QDSA 3DYPA 3TTQA 3WFLA 3CL7A 3BCJA 3NPUA 4PUWA 4LYQA 1GPFA 2VELA 2CZDA 2CZEA 4I7WA 1VJIA 3HQ1A 3WF1A 2XSAA 2ANUA 3WLOA 4HN4A 2J8FA 4F2BA 3GTXA 1UPMB 4H50A 1QCWA 4HNOA 2X8CA 2ZZ2A 2X09A 4UIOA 4H4WA 2NQHA 1XLAA 2Y89A 2WPEA 1C7SA 3B8TA 4D1IA 3N15A 1ECEA 3ZWTA 5FACA 1GT8A 3W25A 4C91A 4B9ZA 4G7EA 4GPNA 3RR4A 4JTCA 3G0XA 2QS8A 3H24A 1FWBC 1TR9A 2G3JA 2FGLA 3F7JA 2DT3A 4FHAA 2J25A 3S47A 4WXYA 4W8LA 6REQA 1WKFA 3VDCA 3PUGA 5I78A 2ASHA 3W1MA 3SCVA 1ZJIA 4D6HA 2BV9A 3H7UA 4BEQA 3U6WA 4HHPA 2ZA1A 3CZ8A 1H5VA 4W85A 4HHHA 3OW1A 2BXYA 2VR5A 1Q6GA 2B31A 4JDRA 3PZMA 1E40A 3TCSA 5BXTA 3QFAA 4MKSA 4ERIA 3R0UA 1DQUA 3BV4A 3IAPA 4KERA 4Z0SA 3THUA 1F3EA 3RF9A 3G1YA 2QIWA 4BA0A 3QKEA 2QAPA 5IHSA 3E2RA 3AS1A 4GYPA 1GVOA 5M17A 4ACZA 5CZKA 2TPRA 3V4BA 2RH9A 3ABXA 4A3RA 4EQSA 2PDUA 4GX9A 4LS1A 3JU2A 1U33A 4I5RA 3UNDA 4DELA 4MJ4A 3SQSA 3GAYA 3JZUA 4GUHA 3CB3A 4M29A 1Q65A 4KFOA 2WVTA 2WWDA 3N1AA 2GR3A 4IT1A 1Q4NX 3UXDA 1EKOA 4W7WA 5F1VA 2PTXA 4QE5A 3GG0A 4S3EA 5KZDA 2PDIA 1S3HA 3K5XA 1XKYA 3HW2A 3ABZA 1B90A 1ZALA 3MCOA 5KZEA 5C0QA 4JFWA 4NT0A 5KZ6A 3RG6A 2BY1A 3SCPA 2XVKA 1DV7A 2E0PA 5IBXC 3WLIA 3CB8A 5I2UA 2F61A 2VP8A 3FLUA 3LENA 4QBXA 3MU7A 4D1JA 1HXJA 2G37A 4J3VA 4XZWA 1ZY8A 1D3HA 3RCYA 3HURA 4RCXA 1AVAA 1EZWA 4ZB5A 1BXNA 1XRVA 4EXQA 4W93A 2XU2A 4L9XA 3CZJA 4QSFA 1JJKA 1GJPA 1R7OA 3FK4A 2XFYA 2E1DA 1SMAA 3W7QA 2I17A 3O0KA 1QO5A 1P0BA 3HU7A 1LORA 3T07A 4HIBA 4E3VA 3VKAA 1DWGM 3GFYA 6ENLA 2DSVA 3VIGA 5XIMA 3GR4A 1K6AA 4WKHA 2OX1A 3NYDA 4IMGA 4QAWA 3VU2A 3B0UX 3G1HA 5I3HA 3KLLA 5KITA 5I23A 4XD6A 1MRQA 3VE9A 1XKJA 5FS8A 1JCMP 4Z2GA 4M1BA 4GVIA 1SU5A 3KXQA 1KQZA 2HS8A 3KVJA 2V38A 1WAWA 3G24A 2V5JA 3CQHA 4M7TA 1HJQA 2QKFA 3V3WA 3W38A 4TVYA 1SZNA 3N73A 1A47A 4FEZA 1HT6A 3CPRA 5BOOA 2ZZ6A 4IP7A 2QF7A 4JICA 3TAKA 4E6MA 4PULA 2HS6A 1S2WA 2X1SA 3GTFA 4AH7A 4FOKA 4WIWA 2CKSA 3F5JA 4UTFA 2WWCA 2AAAA 4HGXA 4Y9PA 5KINA 2E28A 1JD9A 4ONVA 2GDUA 3VFCA 1XDIA 1PWMA 2I1OA 3MJYA 1I0DA 2X16A 2YYTA 3CQ0A 1Q7MA 3B3DA 3UWWA 1FVPA 3CK5A 2E5BA 1NOUA 6A3HA 1A5UA 5D30A 4H3DA 1TELA 3SURA 3TTSA 2HRWA 1F6PA 3W7MA 5G1TA 3ABRA 1Z9AA 2WYSA 4QJ1A 2XVLA 3NGFA 3HG5A 5I77A 2VZTA 2ALDA 3DUGA 3PWIA 1KWKA 1EF2A 2GLKA 2CBJA 3QC3A 2Q8ZA 1UR3M 2QCCA 1TIWA 3OZYA 2PLMA 4YS1A 2QQ6A 4NJIA 3RMEA 3M0YA 4S3GA 3F1QA 2Q6ZA 3FA4A 3M4HA 3WQVA 1J5SA 1QO2A 2OO6A 1VIZA 1ZB5A 1HJSA 2ICSA 2WPCA 3VD4A 3VDAA 3SSZA 4BF9A 4PTNA 2O9PA 4JYFA 1J4EA 2V5BA 1Q6RA 4Q4KA 3PZGA 2E9LA 2EKCA 1CXEA 1FWJC 4X3ZA 5A69A 1SVDA 3BAKA 1BF2A 3SY8A 1QI2A 3RCMA 1TJ1A 3V35A 3T1GA 2PTYA 2V3DA 1KFJA 2FHCA 4V2XA 3EDEA 5HMDA 2XFRA 1ME9A 4DWSA 2CBIA 5DRCA 1JG9A 3EAUA 4IOTA 4BZYA 3KOXA 3M46A 1Q8JA 2EPMX 4XKYB 3WELA 1IXPA 3GU2A 1EBDA 4UTUA 4HNLA 1XRSA 3CM4A 1V6YA 3EUB3 1WYIA 4GUGA 1ZAIA 2FMNA 3PG8A 3BAIA 3EB4A 3CUXA 1XS2A 3GW0A 5LKYA 4H00A 1O4UA 1W3HA 3COTA 1ELSA 3S1UA 4CQ8A 1KM6A 5AHNA 3GDTA 3I68A 3WLHA 1TA3B 4GH1A 3G18A 2C18A 3GQYA 4AXKA 3FYYA 3ITYA 3MCMA 4JTRA 4H83A 4NZ4A 4RK8A 3AMLA 2JFEX 4MFDA 3ITCA 3W07A 1O7AA 3ANUA 1RALA 3BZGA 2ZUNA 4B4FA 3NPXA 2CCRA 1V6WA 4LUYA 1BKHA 5BXPA 2BHUA 3SM0A 2P0OA 3SUUA 3EA3A 3EF6A 1QI5A 3ZS4A 3PPGA 2V5KA 3MWCA 1JCNA 5REQB 3UA3A 4RXFA 3ICJA 4RDZA 4A8LA 1D7YA 3IPWA 3QQ0A 3PUEA 3DKJA 3FDGA 1FCVA 2ZTKA 1UASA 4JEJA 1XGEA 3K2GA 1HKJA 2VDHA 1HJUA 4HK7A 4ERGA 1WXYA 4F0MA 3SRKA 3M5VA 2WMGA 1P0KA 3WDQA 2Y1HA 1W3TA 2HQAA 1D3GA 1ZXIC 2E9BA 5IFPA 2FDMA 2V2CA 3XIMA 2YCLA 3CXBA 3VIHA 2QJNA 1MQRA 5AFDA 1TV4A 2W63A 3WBXA 3FA5A 4L7ZA 4KWSA 1JI2A 3MUCA 1W8GA 4V27A 3MSDA 3H4KA 3NVYB 4FOUA 1TPUA 1IWBA 4ZR8A 4KEVA 3EXTA 3B4UA 4MHBA 2CZ5A 2AQOA 4IPJA 4CQAA 4AZ7A 1XH2A 4JN6A 1Q6DA 1XD1A 2YA2A 3R79A 1R3RA 3ALFA 4NF7A 4M52A 2WSYA 1K4QA 3W72A 4PMJA 3APTA 2YZRA 4EMWA 1E73M 1EHNA 2GJRA 2Y7EA 1NDWA 4AIBA 3VGFA 1ITCA 4BQ3A 2XIQA 3C8FA 3GWQA 1PYMA 2OZ0A 4GY7A 3KCJA 3O07A 2A0NA 4UTMA 3LCGA 3L4YA 2QMKA 3DFPA 2A79A 1XRFA 1GG0A 1JCJA 3W53A 4DPQA 3HZ3A 1OK4A 2IQTA 2QJGA 4L6HA 3CEPA 4NL1A 4NZFA 4IIDA 3WK2A 4K3ZA 1VFFA 3W87A 3N13A 4A21A 3MSYA 2QULA 3KBSA 1Y5VA 3R11A 3B9NA 3S9ZA 4IG2B 4JY8A 3MMDA 4LAZA 3T4WA 3NPWA 1VFOA 4DHGA 5C9WA 3HM7A 2OYKA 2YCJA 1NM9A 2XGIA 3GR8A 2X05A 3E49A 5DX7A 2XVGA 5HULA 1EJRC 1LT7A 1Q66A 4DO6A 5BW6A 4GXMA 2QAEA 4AIUA 4IUOA 5ECVA 1GOMA 1X2HA 6XIMA 1MXDA 3DN5A 5GQBA 2XN0A 3LB0A 4PBEA 3U8GA 3MUY1 1A5LC 3S5YA 5HANA 4HZ7A 3A47A 4ZBCA 1SYTA 1UQZA 2E3TA 2VCBA 1IR2A 2PGEA 5A3HA 3A9IA 1BVWA 2W62A 3OODA 3WEOA 4DF1A 3PVFA 4BI5A 3S5ZA 2XSXA 1AQFA 1CEOA 5JUVA 4HBKA 1GG1A 4R53A 1YADA 4NAFA 3RU8X 4H4XA 4L9YA 1JAKA 3WEZA 2ZFAA 1PWLA 5CEWA 3WCZA 4UTKA 1H09A 2ZX5A 4GHRA 1HJVA 3GXNA 5MHBA 4DJEA 2HVOA 3BLFA 3AN1A 1RPKA 3F2DA 3NQVA 3D3AA 4EAYA 1A5AA 1HP5A 1M6IA 4M6UA 1EUAA 5J5RA 4OE7A 2Z7GA 1L2UA 3LV5A 1QWGA 3KTSA 3VNMA 4R9XA 1B30A 5LIUX 5A6AA 3KTCA 4EXBA 4Q32A 4BI7A 3WF0A 1GHRA 3KHDA 3CIVA 4AC7C 2VDGA 3QZEA 4EOUA 3UR5A 3KL0A 1I1WA 2WMHA 3UCDA 3CWNA 3V5OA 3OC4A 2DZXA 4YTTA 4X9YA 1JFXA 1RLCL 4I9MA 4IIFA 4LF1A 1JCYA 3OBEA 1JRPA 4WSHA 4FI4A 1OJTA 4TVUA 4X60A 2E9MA 3A21A 3LZ5A 3MKCA 4R34A 1UKQA 2DGAA 3V16A 4H41A 2X40A 1BKSA 5F2MA 1ITUA 4AVFA 4Q8QA 4S2CA 1BYDA 1UD3A 3OU8A 2PP3A 1PZ1A 2FFCA 3W00A 4C7DA 3A22A 1KFLA 3WFZA 4KQNA 1DTNA 2PEVA 3E2QA 1FXQA 2PSNA 7XIMA 3CT2A 5CJNA 5AKQA 4NZ5A 3H2EA 4DZIA 5DLCA 3CNYA 3O6AA 4CN1A 3EOSA 3IJIA 5LXEA 1DHPA 1IXQA 2DUXA 4XB3A 1R30A 3GHRA 3SAZA 4ATLA 5DFAA 1X8CA 2PWGA 1YPXA 1EXPA 1EX5A 1GEQA 4LH8A 1XF0A 1UZDA 3PZOA 2ZZCA 4NRSA 4NI3A 1E55A 4LCRA 1SFSA 3QJAA 2H8ZA 1HTIA 7TAAA 1RVKA 4XAZA 2ZE0A 2JKEA 2G0WA 2ZICA 1GVFA 2PGFA 5CJ5A 4RLIA 1GK8A 2INZA 2GVEA 1A5MC 4Z1CA 4J3SA 5U7SA 5M3WA 1GYNA 1I2NA 4RNIA 3N14A 3LCHA 4CVUA 4MPQA 2OG9A 3ITOA 5G5GB 1A5OC 3E3HA 3W7GA 2BHYA 2WXDM 2A21A 5ENLA 5HNTA 1N5WC 1YQ2A 1NARA 2WSPA 1JGMA 3W76A 3VNIA 3UF9A 1VRDA 4CNNA 3A7RA 2F2HA 1Z69A 4U28A 5HNNA 5LNVA 2NX3A 1VPQA 3STEA 1KLYA 4ZB2A 5FJOA 3TJIA 4GUJA 4GACA 4Z2JA 5K4ZA 4NNAA 3SEPA 1LJYA 1H6VA 3WNOA 4LY8A 1EP3A 2X8HA 1GCYA 1JPMA 4NXSA 1HIZA 2EXOA 4HB7A 2Y2WA 4AC1X 3UERA 3LCWA 8XIAA 2PBGA 2ZA2A 2NVAA 5JBDA 4Q8NA 2MANA 1GVYA 3KW3A 3ARXA 3AIQA 3ZMRA 3THQA 3LHVA 3MA8A 3Q94A 1IEXA 4JIRA 4EPEC 1UWSA 2GUYA 4B3LA 4C6LA 1YNYA 4BHYA 3LI0A 2I5GA 3GDBA 2PBOA 1XXXA 1FEAA 4O50A 2W5FA 1LRQA 1PCWA 1M01A 2NZLA 5FCZA 3MVTA 1Q6QA 4Z1AA 3PWAA 4IJRA 2PRHA 4B5XA 1XH1A 2HK0A 2DT1A 1DBTA 3DHFA 1EX1A 3TC3A 5JCIA 3U7VA 2GQ3A 2HCVA 4TR9A 3QMRA 4ZB0A 4IQJA 3LB8A 1EC9A 4JTTA 3ANYA 4WOQA 1REQB 4AB4A 3W7IA 5CC6A 1H61A 5LIYX 3AC0A 2Y5JA 1LUCB 2Y5EA 4ZTYA 1S3TC 2VD8A 1V97A 4WY0A 2QUNA 5H6HA 3AICA 2IW0A 3GAKA 1B3YA 3QY8A 1K70A 5HNRA 2FGBA 4IWWA 4CNOA 4UQBA 3NSMA 4B5NA 4AZBA 3QEZA 4ZMGA 4XZ9A 4H7ZA 5GNZA 3EB2A 1XCXA 1KM3A 4IH3A 3MHUA 3UESA 1DJQA 1WDDA 1Q8AA 2CESA 4XQ6A 5D2TA 1ZJHA 5A2CA 4W8AA 3C86A 4YPJA 3RXZA 2J66A 3E1F1 1C92A 3S1WA 1W1VA 1H3GA 2VTFA 4NASA 4DVOA 3TSMA 2AQWA 3QGVA 1VP5A 3W7JA 4KFPA 2AQVA 3WNKA 3URQA 4FB7A 5G4HC 1RCXB 3SN1A 4JQ3A 4EPBC 4WRHA 2JGQA 1GOIA 5EMMA 5J04A 3WY1A 3ZFHA 1JUBA 1UIPA 1WOAA 3AMZA 1K8XA 1PTAA 4ATWA 4IMFA 1XHCA 4Z17A 3P14A 1DJHA 2QEZA 4G2DA 4FNRA 4H8HA 4GJIA 5IM51 3LXBA 1C29A 3VM5A 1W17A 4NRRA 4AHPA 2NVKX 4LBSA 4IQDA 4QR6A 4F3HA 4WQ6A 1XSKA 1A0DA 3UQNA 3A5VA 4Y9AA 4MY8A 1GHSA 2OR2A 3CHCA 3ITXA 4RW5A 2OEMA 1RR2A 4JAWA 3IUHA 2NSOA 1W56A 2GSEA 1FO4A 3UZZA 2BB0A 1ONEA 4AY7A 2AKMA 3PFMA 4M8UA 3HG4A 2XWEA 3EWWA 4HCDA 4B4HA 3OLDA 2D2OA 5BZAA 4C5YA 1V7AA 2QCLA 2XZ9A 4Q8MA 1LOQA 4QCEA 4HZMA 3EDKA 4AZ6A 2CHNA 1C9WA 3LNPA 3URBA 4XD3A 5EFDA 4DJFD 1MW1A 3NQBA 4O14A 3W1QA 1V0MA 1UP0A 2CLFA 5IXEA 1CBGA 2VENA 5AYXA 3EPOA 4X0NA 1M04A 2VGFA 3ATYA 3G6MA 3CZKA 1T40A 2EQDA 4JQ2A 2Q8LA 4DJDC 1V08A 4C6DA 4UOQA 4CGTA 3KBNA 5A2BA 3W2UA 2DVTA 3MKKA 1ISXA 4CNUA 5AHLA 1C93A 1Z8AA 2VKZG 3U4AA 4DUWA 5CC3A 2G8ZA 3PSVA 2WBKA 3BAJA 3Q2DA 4BWLA 1QAPA 1EEXA 3WQ8A 4O11A 4CU6A 1FEBA 3VINA 4H9UA 1VFUA 4IHCA 2P10A 2VEPA 3HMJG 4EPDC 1EF3A 2X41A 1TB3A 1GREA 2A85A 1GORA 3W1LA 2WVSA 3ANVA 5D9NA 3GD4A 3P93A 3UXIA 3LPPA 3QGKC 4QG6A 5DEZA 1W3IA 3M0XA 4AAJA 5CBIA 3KWSA 3H4WA 4E4PA 2YFNA 1NTHA 4IUGA 2V30A 2FPYA 4OOUA 2OSWA 1NWTA 3TNBA 3UPMA 5LIWX 2DSWA 3G5EA 3HN3A 3VUSA 3LBMA 1Y65A 3CL6A 2NWRA 2QGHA 2VX7A 3W22A 5XINA 3RNMA 3JS3A 4LYRA 4YLWA 3NA8A 1Q6LA 2XM2A 2FKPA 1IQ8A 1MXSA 4AF0A 2ZTJA 4GNJA 1XDLA 2FVMA 2JEPA 3PAJA 1WP6A 4L9ZA 3WH7A 3E0LA 1OVDA 1F4HA 2OQHA 3S5NA 3A9BA 1TREA 2DZPA 4LUSB 3IIOA 1V02A 3E38A 3W73A 2X7VA 4Q4OA 3H55A 1IIHA 1B9BA 3NQMA 5E93A 4D72A 1V93A 2ZUMA 3UXAA 2PE4A 1KR0A 1QVBA 1YPIA 4JFUA 2O9TA 3OQ8A 3SB0A 4NVTA 2GFTA 3RPDA 5FEZA 3TFXA 2QDEA 3GYEA 5AVNA 2FYMA 4Y8FA 5U1OA 4Z2IA 2H8XA 2PDYA 2JIWA 2R24A 3I7QA 3K8LA 1UB3A 1KR1A 3GS6A 5FS9A 4PODA 1JPIA 4OZOA 4D6FA 1KW1A 1OC7A 3R8RA 4PTMA 2A2IA 4ZQNA 3WF2A 2FTYA 1N82A 5F1UA 2C14A 1UR1A 1XYLA 5I7GA 1RM6B 1WDRA 2P3EA 3SFKA 1XYFA 5HWNA 4LJ3A 1QOXA 2Y7DA 1H49A 3PBUA 3VD5A 1R3VA 3ARZA 4QDMA 3QOKA 3IGSA 1A5KC 1MSSA 4PMUA 5HUOA 3CQIA 5LIXX 4YXGA 1UMLA 2Y8VA 4C6EA 2F5ZA 2R1NA 1W1B1 4JTHA 3VO0A 1P0EA 3M07A 4OU1A 1E6SM 1GPWA 4BQ5A 1CGXA 1A53A 4HU4A 3N9KA 1DEDA 4YHGA 4C1NA 3TYBA 1QPRA 3S2LA 3GK0A 1AFSA 3ZO9A 1EJWC 3AWOA 1KNWA 1M9HA 1SW7A 2WPBA 1KBLA 4KEUA 1PCKA 1TPFA 4WSKA 4PRWA 1AW2A 1JNEA 1JNDA 5TNVA 5BCAA 3QR0A 3O1NA 1XG3A 2ZVRA 4U4MA 4LVBA 1JPKA 4KRZA 1W3KA 3DBPA 3CMFA 3GFXA 2IQDA 3ITGA 3L23A 1JF5A 4H4SA 3PJUA 3TYDA 2YDQA 3CV1A 5H8MA 4LGXA 3TDFA 1BGAA 1IT8A 3LERA 1SZRA 4JIEA 1UZHA 4DF0A 1QK0A 4M80A 1AL8A 2HJPA 3GBDA 2VNCA 4JTGA 4KRTA 1TCMA 1TG7A 4MG4A 3L66A 5FJPA 4QROA 3GXDA 4Y7EA 1W9XA 3BJSA 1UR0A 2J7BA 2B7NA 1CECA 4UTJA 5U25A 4TX6A 2QCFA 1R2RA 3KM8A 3TYCA 3PTKA 5CC5A 3CJPA 3TNOA 1G5AA 2PDGA 2Y8UA 1EOMA 4FO4A 2NLIA 3AIWA 2FMOA 4QG9A 1R2SA 2BC1A 4XAGA 1RQBA 3KL3A 3P60A 5D33A 5TF0A 1LZOA 4RZ4A 4YTRA 3U2ZA 4LYKA 3O0FA 3G8EA 4GKLA 2R91A 5JQ9A 1LLWA 4HNTA 3UJEA 3TW9A 3W7PA 2VRQA 3L5LA 2OXNA 1LYXA 4ZOCA 1A5SA 1YE6A 1FCQA 1JCLA 4AHQA 1JGIA 5E5CA 1R38A 1TVNA 2IKHA 3RX4A 3RMJA 3TW7A 2GGIA 2J4GA 4K1GA 2WKLA 1P48A 2CU0A 3HGSA 4R3UA 1GEHA 4N4QA 3EB3A 4KETA 4FK9A 4HVXA 5F2GA 1QK2A 3CZLA 4PUJA 3IGUA 5G2HA 1PSCA 4UFIA 2BXVA 4Q8VA 2EQ8A 3BJFA 3HQOA 4UCGA 2PDPA 3O06A 4C1LA 4ZQPA 3OZPA 3WDRA 1YXDA 3SUTA 4PA8A 2EF9A 1UD5A 1B54A 1AMKA 4EQWA 2BFGA 3PPFA 1NAL1 2A7NA 4E5TA 3NO5A 2XN2A 1O94A 4LCQA 3R0DA 3B40A 4K68A 4MPKA 1UWIA 2V2DA 1JDDA 2TMDA 4C7FA 1QWKA 5FF2A 4DM1A 4IQEA 4DZAA 2DU2A 4L1XA 2FB2A 5E70A 1RA5A 1LCOA 4H8UA 6XIAA 3ZLHA 1F4AA 1VGAA 3M43A 3EOEA 3GRIA 1PTDA 1RCQA 4PC8A 4IL2A 3AIUA 4GCAA 3UBPC 3ITVA 4N42A 1FP9A 2QGYA 1MEHA 4X9SA 4XG1A 1P1XA 2E5DA 3KRSA 1QNSA 1J0HA 1GW1A 3CYJA 2GQWA 5ABFA 3L8KA 2J77A 5FJIA 4GH3A 3DYMA 1GXFA 2Z2UA 3GBEA 3GHUA 3IACA 4HPHA 3KWXA 3M0JA 4UZUA 1US3A 4REQB 2WJZA 1KWGA 3FW6A 5LSMA 1VPYA 4MAVA 1E0TA 2EPOA 1TPC1 4O1EA 3VAVA 3L4ZA 4W7VA 4XTIA 2Z25A 3RITA 2WNWA 3KFTA 4HCLA 3TP4A 3CC1A 4AZCB 1F3PA 4JS3A 4PUUA 2WOQA 2C19A 1US2A 1S5VA 4XO7A 4DXVA 4J3UA 2WOVA 3FYOA 1AA1B 1Z3NA 1XD0A 4O1BA 3GG1A 1BTMA 1AH3A 5G5HB 3FKKA 1A4LA 4DUOA 2I57A 4CD8A 3ABQA 1X6NA 3FGCA 3SCNA 4C6PA 2JEQA 1DIOA 5REQA 4MFEA 5CZJA 4ZXLA 3H4XA 2XZ7A 5D2VA 4CN6A 4FXJA 2WSRA 2DQWA 3SR7A 1MO0A 4JIHA 3NEVA 4PCSA 5LNWA 3SZ8A 4P2VA 2JKAA 5BOEA 5D4YA 5CQ1A 2CW6A 1KM4A 3V0UA 4DX3A 1YLVA 5C2CA 2A8XA 4IMAA 3WKZA 4WF7A 2QNEA 5HWMA 2OYLA 2X1UA 2H6RA 2Y63A 3O7UA 3LGGA 4PMXA 3VIMA 3KEHA 1DKWA 4LB3A 1VEOA 3EX1A 3LN3A 1R5YA 1P6WA 4EK7A 3W28A 4G7EB 1NDAA 5AYIA 3B8SA 4XBJA 4IIBA 3NJ3A 2GGGA 3PULA 1PV8A 5EPDA 5L9FA 2WHJA 1EOKA 4UMBA 3UWEA 6REQB 3N2MA 1EJTC 2DZAA 5AZ1A 2DVUA 3T40A 4HZ8A 4JFSA 3ZT6A 5EB8A 1IHIA 2OCZA 3AXIA 1YDOA 3TE9A 1LQAA 2PWFA 2WHLA 1AH0A 3N11A 1J11A 3WH6A 4DO4A 4DRSA 4J3TA 3MMUA 3MV11 3EKGA 3W2MA 1GKQA 3IV8A 2GSJA 2NXHA 3O6DA 1I2QA 4UTTC 2DSKA 1TJ2A 2D20A 1B3OA 4UNLA 4QQUA 1SW0A 2Y62A 3NQAA 1NFBA 5D8ZA 3PBMA 4M6PA 2DT0A 5FEWA 3WJSA 2DP3A 4ACZB 5FJUA 4S3FA 1CLXA 3QV7A 4XZLX 1RBLA 3UY7A 4GIYA 2NQ5A 4CQ9A 4GIRA 5AVHA 3S8HA 1JEHA 3W1RA 5HINA 4H4TA 3CQJA 3VKKA 4BK9A 2G3MA 2QUUA 3F4DA 1DJZA 4WOZA 1QNPA 2W55A 3F5KA 3ABOA 1ECQA 4YWSA 1GOWA 3BL3A 3FXGA 4IPNB 1Q2RA 4MVAA 3LA4A 4KEMA 1HKMA 3G8RA 2W3RA 1KBKA 4MKVA 3BG5A 1M5WA 3W0KA 2W79A 4LVFA 3EMCA 3A64A 3MP3A 2VEIA 3RLGA 1D2KA 1WE5A 3VOJA 1I60A 4FR6A 1GQLA 3WLPA 1KD0A 3TU9A 3QPZA 5DMLA 3AIRA 2EG6A 1RQEA 3I7SA 1AQMA 2VFHA 4O54A 4ZTXA 5CXPA 3PK7A 1M7PA 1NDVA 5DT5A 2DDXA 4GQQA 3UT0A 5H1WA 3A7UA 3QLDA 4EKJA 1QMLA 5DQPA 2C1IA 4W87A 4EX4A 2EG7A 4HNVA 1PDYA 2A3LA 2FHBA 2F7FA 4IIEA 2J88A 3OB8A 4DBDA 1XLFA 1CYGA 3I7RA 4WGXA 3HPAA 3DI1A 3LRMA 2ZX8A 4ADWA 3D0CA 3BAYA 4Z1DA 4JPGA 2OU4A 3LYEA 3NRZB 1YKWA 4RV8A 3AZRA 4M51A 1KA9F 2YCKX 3GO2A 2BLEA 3ZT7A 1QOPA 3W7CA 4ZENA 5KEZA 2GZXA 2VO5A 4NQ1A 2WCGA 4DBWA 5LA1A 4HMCA 1DWAM 1PIIA 2VDIA 3WBEA 4DN1A 4A3UA 4CQBA 1YTKA 2WBGA 1ZBKA 3RDKA 1E9IA 5AC8A 3KAOA 4HSNA 5HDRA 1WOBA 2VFIA 3DHUA 4FLQA 3EKZA 4QJ4B 3PB2A 3WL0A 2BMBA 2HE5A 5M5DA 1LRNA 4RXGA 4LF2A 1AJ2A 2YQUA 4WCJA 1HFBA 3R43A 3R07C 1CZ1A 1H7NA 3DENA 3L2LA 2YBUA 1UWUA 4HHLA 1XIDA 4GI4A 2G4FA 2J27A 4QEHA 3GHTA 3W01A 3CASA 3CUIA 5GJNA 1UZ1A 1ZY9A 1J9YA 3FVMA 4Y8EA 3QYQA 2X8RA 2E25A 3SN0A 4MJZA 2CYGA 1TV7A 4X2PA 2PFHA 4MUZA 2YB4A 4NJHA 4EAMA 3H4GA 1ZHAA 2GGEA 1XSJA 4JNYA 3OGVA 1OIMA 3TFCA 3QTGA 2DT2A 4ZQMA 3UG4A 4LAMA 1BWCA 3DFQA 2GDVA 4N9EA 4K6AA 4WKFA 3TYZA 4LTSA 2Y7FA 4C6MA 3BO9A 2NV2A 3TXZA 1TPEA 5BU6A 2BDQA 5JH2A 4H6QA 3MJMA 5I0DA 2PD9A 3BSMA 3THCA 3HB9A 1SZFA 1LOSA 1L6WA 2GPTA 3WJYA 3T08A 3VZYA 4LXFA 1CXKA 3BVJA 2GJXA 4KIRA 1ZFJA 2OTDA 2R6OA 2BCPA 3W2LA 1N7KA 3G6LA 1DJYA 2VURA 2D0HA 1XIGA 4A8NA 6ALDA 1XL9A 4P7RA 1V3MA 2CC0A 1A49A 3KBWA 4UTLA 2EG8A 3NWRA 1O12A 2Y4SA 1ZX9A 3NEHA 1XLMA 5FSEC 6PTDA 1DWJM 1QW8A 1UC4A 2BGQA 3W1NA 3T2PA 2I9EA 3LHYA 4H4PA 3G1DA 4V28A 1J2WA 3M6DA 3WSUA 5TAOA 2ZRYA 1M1BA 4GVFA 1GRFA 4UQAA 5EMKA 4TX9A 1UH4A 3VD9A 5ER0A 1Q1WA 1UOZA 3DX5A 1NOFA 5EL1A 3VNDA 4V1XA 3DGZA 1GYLA 2EKGA 2ZRWA 3WQFA 3GVQA 3FJNA 4P7QA 5EU9A 2REQA 2AKZA 4JOMA 2V5DA 5DCEA 1CIUA 4RUBA 4NNCA