3K1GA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ser-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
354
structure length
354
Chain Sequence
b'MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGISH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 124
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3k1gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3k1gA01
3RO6A 1SJAA 4MMWA 5FJRA 3VC5A 3S47A 3NZGA 3CAWA 4IL0A 2QJMA 1PDZA 3TJIA 3R25A 3U9IA 4HNLA 3GO2A 2FKPA 2QDEA 1EC9A 3UCCA 4KEMA 4GIRA 3SQSA 3UXKA 5IDZA 4JHMA 4HCLA 3MZNA 3TOYA 5J04A 3NXLA 2GGGA 3VA8A 2PTWA 3N6JA 4H2HA 1EBHA 3TCSA 2GGJA 3R11A 1RVKA 3FXGA 4G8TA 4GMEA 4J3ZA 3S5SA 5BOEA 5FJTA 4M0XA 1MNSA 3TWBA 3B97A 4IL2A 3DIPA 1PDYA 3UJEA 3VDGA 3OP2A 3PFRA 2OZ3A 1EBGA 1MDLA 3JW7A 4KT2A 3U4FA 5EU9A 3MUCA 3UJ2A 3D47A 2ONEA 2P8CA 3RR1A 2DW6A 3OTRA 2OG9A 2NQLA 3VCCA 4JN8A 2QVHA 3R0UA 1ECQA 1ELSA 2XH4A 1R6WA 3DGBA 3DFHA 4DWDA 1L8PA 4Z1YA 4Z17A 3VFCA 3R10A 3UCDA 4DHGA 1YEYA 3IJLA 2PU1A 4IP4A 3ES7A 3FVDA 2GGIA 3JVAA 3TQPA 3KUMA 3QTPA 4HNCA 3N4FA 3TWAA 4HYRA 2PP1A 2ZADA 4E8GA 3FJ4A 3SN0A 1XS2A 4FI4A 3ES8A 2OVLA 4GYPA 3SJNA 1BKHA 4K1WA 4DXKA 4ENLA 4JN7A 4M6UA 2OX4A 1KCZA 4E6MA 1NU5A 3N6HA 3DDMA 1OEPA 1FHVA 4X2PA 5FJPA 4A3RA 3TW9A 1TKKA 3ZLFA 2GSHA 2OZTA 3V4BA 1JDFA 3DFYA 2OLAA 2OQHA 3MQTA 4DN1A 3NO1A 3Q4DA 3T8QA 2XGZA 1JCTA 3RCYA 2FYMA 1R0MA 1TZZA 2OO6A 1EC8A 2XH2A 3STPA 2QJNA 3HPFA 4G7FA 3R1ZA 1MDRA 3GD6A 3DG3A 2RDXA 2P3ZA 3D46A 4H83A 5ENLA 3N4EA 3MSYA 4GFIA 1ONEA 4GYPC 3UXLA 4KWSA 2GL5A 3Q45A 2PTZA 2ZC8A 3ZLHA 2P0IA 2P8BA 1FHUA 3EKGA 4ZCWA 3V5FA 2XH0A 3GC2A 2GGEA 2PGWA 3CK5A 2XSXA 4E5TA 1SJCA 3IK4A 2QQ6A 2PGEA 3FCPA 2OPJA 3PWIA 3P93A 3SN1A 4MGGA 3T6CA 1MUCA 3FYYA 2OQYA 3H7VA 3P3BA 3UJRA 2PTXA 1XPYA 3UJSA 4H19A 3CYJA 3PWGA 2AL1A 2GGHA 3CB3A 3DESA 3IJQA 2DW7A 3MY9A 5FJOA 3DEQA 3T4WA 3H12A 2PPGA 3K1GA 1F9CA 4IP5A 1MRAA 3QKEA 1JPMA 4HCHA 2AKMA 1DTNA 3THUA 4J1OA 2OFJA 3EEZA 3OPSA 3I6TA 3TTEA 3ZVIA 5FJUA 4FP1A 2MUCA 3T9PA 4F4RA 4HPNA 2PTYA 2QDDA 2PSNA 3ZVHB 3QN3A 2PS2A 3NFUA 2HZGA 4DYEA 3MKCA 3PK7A 3QPEA 4HCDA 3I4KA 3ZVHA 3V3WA 2O56A 3SSZA 2PMQA 3DG7A 1KKRA 4IT1A 1E9IA 3DG6A 4HN8A 2HNEA 2XH7A 4K2SA 2POZA 3RGTA 3OZMA 2I5QA 2PA6A 1P48A 4K8GA 2GDQA 4ZA0A 2CHRA 3ENLA 4GGBA 3BOXA 1BQGA 2PP0A 3H8AA 3TJ4A 1WUEA 2PU0A 3GY1A 4IZGA 2P88A 4YWSA 3BJSA 2MNRA 2AKZA 3DERA 3I6EA 3FV9A 6ENLA 7ENLA 4GGHA 4GISA 1KD0A 4MKSA 3BSMA 3OW1A 3RITA 3VCNA 4A35A 3V5CA 1NELA 4EWJA 3CT2A 4IHCA 4A6GA 2AL2B 1WUFA 2PODA 3H70A 2HXTA 1IYXA 2QJJA 3P0WA 4DX3A 3UGVA 4E4FA 3MWCA 3RRAA 3OZYA 2HXUA 1P43A 3VC6A 1EC7A 4ROPA 2QGYA 3UJFA 3JZUA 4E4UA 2PCEA 2AL2A 3R0KA 1KKOA 3IJIA 4H1ZA 3QLDA 2OKTA 1W6TA 1SJBA 3ZLGA 5BOFA 1JPDX 1SJDA 3CXOA 4KPLA 3SBFA 3SN4A 2PP3A 1TE6A 2OZ8A
chains in the Genus database with same CATH superfamily
1FTXA 4MMWA 3EF6A 4AZCB 3NM1A 3GDMA 3NL6A 2JFEX 2BHUA 4F3HA 1EC9A 3MP4A 1NP2A 1E3XA 2PTWA 4OOUA 2PDWA 5EBAA 2Y5EA 1VKFA 1W2VA 3VU2A 2VP8A 3MYOA 4XAGA 4S3FA 3ARTA 1U22A 3UESA 1OFEA 3WH7A 4RV3A 1Q7MA 2UY2A 4KCVA 1TMHA 4LCQA 3WD0A 3IARA 3WY1A 5FJJA 3VGBA 4Y8FA 3MI3A 3URBA 1IIGA 4QX4A 3GE7A 3CWOX 4ZOAA 1SU5A 3B8SA 4DWDA 2MANA 3OVRA 1QW8A 2CW6A 2X7VA 3KWXA 1VEOA 4P8WA 4OWGA 2INFA 1A5NC 1UWUA 4Q6JA 1BHGA 3GR7A 3QOMA 3BG9A 1HT6A 5FF3A 2VZSA 1UP2A 1EDQA 1XDJA 2QIWA 2BSLA 1XBXA 3EBVA 3FS2A 1M68A 1LLWA 4MFEA 4QQUA 4C7FA 3IGXA 2ZZ2A 3BTNA 4FA3A 2OWCA 2EXOA 4MVAA 2RGLA 2E77A 1QU4A 1AH0A 3V35A 3N73A 3W4RA 1IEWA 3T07A 2XJ7A 2GVYA 1W1ZA 1EGMA 3FNDA 4FNSA 4HHLA 1ZALA 3F4WA 1YX1A 3C8FA 3AUOA 3W7HA 1C8VA 3H6OA 1T6MA 3E02A 1US3A 3KLJA 1VFOA 5JCNA 4ACZA 3MCNA 3R7MA 1A5LC 3W7NA 1GSNA 3QY6A 3PNUA 2V3BA 1KWKA 1D2KA 3ABSA 4UTTC 1SB3B 5DFAA 4UMAA 2DDXA 3ZJ8A 1QVBA 3M47A 2ZA2A 1XRTA 1OC7A 4N42A 1LTDA 4KF1A 3WNMA 3OYZA 5I3FA 3F4NA 4N2YA 1K77A 4DAFA 3V7PA 3DG3A 2FIQA 3D46A 3W71A 1V6VA 1JQXA 1M41A 1GQLA 1RK5A 4RZ4A 1E71M 1R2TA 2E5DA 4X60A 4IIBA 1AQMA 2IQDA 2BDQA 4EE9A 2OR2A 3L4ZA 2EO7A 3TUUA 4KH2A 5GNZA 3CZKA 1V0LA 5JCLA 3C0JA 4GI8A 2PGWA 5HUPA 1WKDA 2RDWA 1FDZA 4PBGA 1XCFA 4XAYA 3EX2A 3LTPA 3S2CA 3CQ0A 3F5LA 3T6CA 3GTHA 5A95A 3LK6A 3MI2A 5DQPA 4PB5A 5ECVA 1QPKA 1LL6A 3RMJA 1SFJA 5DF0A 2PDUA 1UCWA 1E55A 4QCFA 2ABAA 3WLSA 2NW0A 3CYJA 1TA3B 1J6OA 4HZMA 1FWDC 2W5FA 2EQ6A 5CZJA 2JK2A 2X1RA 3W1RA 3VNIA 3DESA 1YLVA 3PAOA 4F66A 2D2GA 3PUDA 1HJXA 2WOIA 1K9EA 2YXGA 3B9AA 2BHYA 4GK8A 3W76A 3AI0A 5CJ5A 4XZWA 1R85A 4RXGA 1NARA 1JRBA 1QCWA 1UA7A 4NF7A 2VUNA 4Z2LA 1L8NA 4R9OA 1FDJA 1ZJIA 2FTYA 3P82A 2W61A 1WPCA 1SM9A 3SGUA 1ADOA 1G6CA 4IJCA 1SZGA 2D0GA 3SFKA 5E09A 3CTLA 2PEVA 4IIEA 4CN6A 1O95A 4YCPA 4HA4A 2DZVA 4OZOA 1T99A 4U5IA 3TZFA 2WPBA 3ZVHA 3BZJA 2VZUA 4PMJA 3CEPA 3ZJ7A 5CXPA 1FWJC 2OU4A 1CPUA 1SO6A 3M0JA 3NGJA 4HU4A 1JCYA 3O63A 3OZMA 4N9DA 4RDVA 3HFYA 4H4PA 5TNVA 3EA3A 4MSSA 2W54A 2JF6A 4BI7A 3ONCA 2DUXA 3QW4B 4OQVA 3AYRA 2CDUA 1S1PA 2YDRA 3W1MA 4MFDA 1S3TC 1DKWA 3NQDA 1EX1A 5E6YA 3V36A 1HQTA 4KBXA 5MHBA 4KWVA 2Z1XA 1YXYA 5K7JA 3RUBL 2WSPA 3R94A 4GISA 1C29A 4XIMA 4GYJA 3BSMA 3WNLA 4LGXA 3RDKA 2IMRA 2Q3OA 4H04A 3T2QA 5KZ6A 4DZAA 2J7GA 2WBAA 4IMFA 5DRIA 3V16A 3EGJA 1UH4A 3UXIA 5M2FX 3ARQA 4FLRA 2GYIA 1FQ0A 3T55A 1F6YA 5HMDA 3R0KA 4HSHA 4GZ7A 5FEXA 1CGUA 2OMAA 4GBDA 1F3TA 1FHLA 4LF2A 3T08A 1VZWA 1S1RA 2ZRZA 5KITA 3KS6A 4HU0A 1FWIC 2YQUA 3UVIA 3LMZA 1XANA 2WSRA 4I5RA 2XIBA 3W25A 1FWGC 1REQB 3S2LA 4LNCA 2QDEA 4OBTA 1EKOA 2G3FA 3GXMA 1ITUA 5BWAA 2IS7A 1EIBA 1XH2A 3GDLA 3VD4A 1UKTA 4OBSA 3C3NA 1H5VA 3N6JA 3WLPA 1IZKA 1UJPA 4D1IA 4PR4A 1FWFC 4FOJA 2R1MA 1OF6A 1UR3M 2YPIA 1R3YA 2J9YA 3VD3A 3B97A 3DK8A 1PDYA 1UKOA 3LXAA 4JTJA 3THDA 1MDLA 3WLLA 5HNTA 2QCHA 1RBLA 2CITA 4RPPA 1PV8A 1W8GA 4JTQA 3WDJA 3R07C 5BU9A 2NT1A 3KP0A 1LT8A 4WSHA 1UR4A 4MNLA 4F0RA 1P7TB 2HVMA 2X1TA 3DFHA 2X1UA 3EWBX 5HULA 2HBVA 2H9AB 5E6ZA 5HR6A 2HCVA 3HMJG 2WSQA 4QM1A 4TX9A 2P0OA 4UTTA 2VC9A 1IEQA 2VZTA 3ES7A 4IWWA 1S5WA 1P6WA 1KXQA 5ECUA 4ZBCA 3CHFA 3SZ8A 4BY3A 4H4SA 3QTPA 2G3MA 3CHVA 2VEFA 1RA5A 3SO7A 2FLIA 1XGEA 4C6JA 3VIJA 5LIUX 1HL8A 3JRKA 1V7AA 4KIRA 3BCFA 4ZO7A 3WNKA 4IIFA 1M6IA 1V3IA 4F0LA 2VFIA 4IISA 3TU9A 2PBGA 2VEKA 2J4GA 4PMRA 1FCUA 4G5DA 1ZB5A 3MMTA 4AYGA 4QJ5B 1TV8A 1VP5A 1IXOA 3B0UX 4HNUA 5A6LA 3TQVA 3EAOA 1ZAJA 3ITLA 3E0FA 2DH3A 3KCJA 2BY2A 1K9FA 3UFYA 4PGLA 3MUY1 5A8MA 3ECQA 2E9LA 4JTLA 4JHZA 1Z89A 3T44A 8XIMA 3G6LA 3MO7A 2EAWA 3ARYA 4QDWA 1H1YA 3ABRA 4FNTA 4F2BA 2GSEA 4JL2A 3B0VC 1OM0A 3P14A 3R2GA 1RLCL 4MHBA 4O14A 3VFLA 1UD5A 2A0NA 3SRDA 2Y6ZA 3ITCA 3PPCA 3MHUA 3N04A 3P6LA 4J4KA 5EMKA 5EMLA 3M46A 2ZKMX 3QV8A 3KBSA 4BQ5A 4NVTA 1W1IE 3H2CA 4DBDA 1JAEA 1V7YA 3QM3A 1SFLA 5HBFA 2NWSA 1VJIA 4DO6A 3KHDA 4GWEA 1GG1A 3W86A 1XH1A 1NHPA 1FDYA 3WJZA 2ZRWA 2GOKA 1MI3A 1ME7A 1GESA 1B9BA 3O3RA 4X9YA 3OLEA 3IACA 4Y7EA 2IXUA 4XSMA 3P62A 3NQEA 4JTUA 3GYCA 9CGTA 2QDHA 2NXIA 1FH7A 5FSDC 4IF2A 2E09A 1FWAC 4NJGA 1VCGA 3VOFA 3LERA 1AOGA 1NOFA 1HKJA 3S2JA 4PUNA 3QC3A 4UOJA 3P3BA 3WD2A 3BLOA 4C6PA 4PMNA 3CASA 3UEQA 5D8WA 1XYZA 5K9DA 3APTA 4GE8A 1HZYA 1OX4A 4Q4KA 5D4YA 1HKWA 4EXQA 2Y5JA 2X16A 1MEHA 3M43A 4UFIA 4K68A 5DELA 5CQ1A 1DJGA 1PEZA 2NSOA 3T2PA 3FHAA 2PAJA 2QW5A 3S6OA 2P3EA 1ESWA 3DJGX 4UR7A 3UG4A 1EQPA 4MJ2A 1E3ZA 1UZDA 3E0LA 3ZR6A 2NQ9A 2V5BA 2PFHA 3IRDA 1VQTA 2CFFA 4LBSA 3RJYA 3VIMA 4DB7A 1E72M 1PWMA 2P10A 1SVDA 1V6UA 4R7WA 1UOKA 1J5SA 2JQXA 1M7OA 3NQAA 3UR2A 3FKKA 4Q7IA 3BH4A 3GC4A 4C6FA 4Q4MA 2VX6A 5B7ZA 5D09A 4J3XA 4DF0A 1XIBA 4NZ5A 1OIMA 5I6SA 2A8XA 4HCDA 4RE2A 1OFQA 1KFWA 2EQ9A 4CQ8A 1RAKA 4JEQA 4HPGA 3O1NA 2DVUA 2YOCA 2WCAA 1EHNA 1VQZA 1K8ZA 4DF1A 1ADSA 4ZL1A 5FEWA 3S46A 5CPOA 2F5ZA 1OT1A 1BXCA 5JIWA 2NQHA 3D3FA 4Q3MA 1QNPA 4MLJA 2CHRA 3M64A 4R7OA 1AL7A 3JUGA 4NSBA 5JRBA 3PJTA 4IQDA 4WDTA 3IJ7A 1OD8A 2CHOA 4PUUA 1XIIA 1JFHA 4WF7A 4IFKB 4IZGA 1JXJA 4LALA 2QAPA 1O68A 1HP4A 2DZBA 6ENLA 2FMOA 1FXPA 3A22A 4OIFA 1NSJA 1XLLA 3VCNA 4S3CA 2YCIX 2HV5A 1WOBA 1O4UA 4A6GA 2BFGA 1B31A 3UZ5A 3A47A 4QE5A 1B9ZA 1UBPC 4OTKA 3WF3A 1QO5A 2HXUA 1UUOA 2BOEX 1MQRA 4JYFA 4UFHA 1A3HA 1O5KA 3L66A 3VI2A 4DBUA 3E0WA 1VFUA 2W79A 1GOQA 3BW2A 3PM6A 1H7NA 2L5HA 1S2CA 3NQ6A 4IG2A 3CV2A 3EXTA 1Z48A 2OJPA 5AHEA 1W3IA 3S1WA 4LAMA 4QAIA 3SBFA 3COTA 1DPMA 4JY9A 1R3TA 2OZ8A 5EFDA 3G8EA 2O9TA 2RUSA 1WXYA 2R82A 3A9IA 4O8AA 1YXCA 1B3WA 3VC5A 1QOQA 1AW5A 5CPMA 1P6CA 4HPJA 3VAVA 3NNTA 5DN1A 3F1QA 4IL0A 1W9BM 2RDTA 3BC9A 3RPDA 1FCBA 3DZ1A 2R9RA 2Q8ZA 4LUTB 4ADSA 3C61A 4L9ZA 5H6HA 3NVTA 1OFBA 1TPEA 2ZUVA 4XISA 4ASTA 2I7GA 2OODA 3MANA 1SR0A 2J47A 3B0XA 1VLIA 4ADUA 4B2DA 3SCNA 3PB2A 2INEA 3GXIA 1OX6A 1H3GA 3PANA 4C6KA 2FGZA 4ES4A 4WOQA 4XX6A 3EB3A 1Q4NX 1PZ2A 3DIPA 4US6A 5AYBA 1R38A 1WOAA 1E5JA 2PCQA 3MUCA 4HOZA 3IJ8A 1SZEA 1XSKA 1X2HA 4W89A 4W7UA 3E1F1 4JFWA 4AEOA 2FFCA 3VDCA 5K9CA 4I7WA 4PBEA 4LC6A 1GONA 4AF0B 1VD6A 1XFBA 4KMQA 5I0DA 1D7FA 1VH7A 4AC7C 1GVQA 3O16A 4JTEA 4Z1YA 4IMDA 1OFPA 2F6UA 3FGCA 1W3KA 4NZ1A 2B0MA 3QMTA 4UQ9A 3CL7A 4AZIA 4DHGA 1YEYA 1EJUC 3V0SA 3VINA 2QCMA 4Q8NA 3VM5A 5BWFA 2WVUA 4EQWA 3B9JB 2XVNA 1BRLB 4PB3A 3FIGA 2QCLA 5HJXA 1U5HA 3S5ZA 3EYPA 3UETA 4JL1A 2D1ZA 3OVQA 3S3GA 4GY1A 2VVNA 2DVTA 3IIZA 4M82A 2ZADA 1XIFA 4PCSA 3VIOA 4HMCA 1DJQA 3GXPA 3SUUA 3OJGA 3EDFA 1X1NA 2YCJA 4R88A 3DECA 1UP0A 2W92A 3A64A 4K7YA 4WJXA 5ABHA 3TC7A 3CH9A 4CNSA 2BVDA 4LAKA 3FA4A 3NSNA 4E6MA 4QSFA 3BL3A 1FHVA 1G4SA 3ZZ1A 3UWZA 3R8HA 1W5PA 2WBKA 3C5QA 4BQ4A 3CZ8A 1NEYA 1GQKA 4H00A 3RHGA 1ICQA 5AC4A 3LHVA 3DFYA 5CPLA 5REQB 1Q7ZA 4RNFA 1J96A 2J9ZA 2WC4A 3VK5A 3EXSA 2V5DA 1JAKA 4A29A 1EXBA 1TSIA 3DC8A 3P2VA 3W7RA 4TV6A 5EMYA 2QJNA 1YXDA 1R2SA 4AWEA 4W7VA 4GXMA 1QI3A 3BOFA 2XFWA 2TYSA 3N34A 1QOXA 1XWYA 4K39A 1C8QA 2I9UA 3UXAA 3IEBA 1UPMB 1W54A 4KWWA 3H21A 3NVYB 3RN6A 1VPXA 2VFDA 4GFIA 1PIFA 3MO4A 1OBAA 3V0UA 1P1MA 2ABBA 4WVXA 3RRXA 3EOLA 1GOMA 3ZLHA 1XKJA 1YKWA 3O0FA 1N7KA 4RE4A 2Y5SA 1NPXA 4MWAE 2E6AA 3BUVA 4PL1A 4O0ZA 5DRCA 4G7EB 3IK4A 1E73M 1W17A 1W3TA 2PGEA 4MM1A 1TYPA 3FG2P 1A4MA 4GCAA 1HKVA 2E9MA 2W55A 3WFAA 1XLBA 4AD4A 4MGGA 3IIPA 3M0ZA 4J27A 1ZGDA 2XIJA 3PNZA 1PYFA 3NQVA 1UR8A 3VIPA 3WLJA 3ZT6A 1H7OA 5H1WA 1NHRA 2EPNA 1TJRA 1Z41A 2A3AA 1TJ2A 4Q4OA 5LIKX 4ZQCA 4Z1DA 4HZ6A 3E2QA 1UASA 2CLEA 2VDIA 2FZ9A 3UWYA 3NYDA 3E74A 4EMWA 2YIHA 2V9DA 1SFSA 1UWAA 4ZQRA 1DJHA 4WY0B 1GRTA 3CGCA 1A3WA 2WVVB 2A7NA 2XU2A 2WMIA 3W7OA 1GOOA 3C0LA 4MKNA 5AHIA 5A69A 3G1RA 4C6NA 5M03A 3B4YA 1EOKA 1P0DA 2E8YA 2VR2A 4NEWA 3U0HA 3V3WA 2WLYA 3ABOA 4GHRA 1G5AA 4PYSA 5HNUA 2ODOA 2VR5A 3LUTA 3VGFA 2HNEA 3W3OA 4TMBA 2XTKA 2I5QA 1X6UA 1XGZA 4LYQA 4CU6A 3PAJA 4JIHA 3C2RA 4GY0A 3MCMA 2R91A 1DJNA 4V27A 4DZHA 3A4WA 1OHLA 4O53A 4ZO8A 3UA3A 3G24A 4ZSUA 3BOXA 4X2RA 1JGMA 2YCEA 3TJ4A 4EMIA 3UWEA 5CC5A 3NSMA 1V3MA 3II4A 2DUAA 2MNRA 2VXNA 3W9ZA 2J7CA 3OYXA 4Y9NA 3AFBA 1BPLB 3WN6A 5C7VA 4UFKA 4FIRA 3RITA 2C14A 4Q4RA 2DZXA 2IKHA 5F2LA 1WZMA 4CQ9A 2GUYA 4HTBA 4IQLA 3DYPA 4XWUA 2HXTA 3PZMA 5CSYA 1Q1WA 1C9WA 1K03A 3E2VA 1Q66A 2NUYA 1LL7A 1JZ5A 5C8BB 1H6VA 3JZUA 4KRZA 4L9YA 2WOVA 4D6IA 1TJPA 4JFTA 2OKTA 2D22A 4IUOA 1BYAA 2VD9A 2ZC1A 1T8QA 3OBEA 4WKFA 4JHOA 1BF6A 3EKLA 4ZSTA 2VM8A 1GG0A 5F2GA 2PDGA 1ZJBA 2QS8A 1J0HA 2C3CA 1PKNA 3M5ZA 4MB5A 3CTTA 4H6KA 1GVOA 5FJRA 1GZJA 3GXTA 4DUWA 1DNCA 1R9YA 3ME3A 3OVPA 4OV4A 2ZXDA 3VZZA 2QJMA 1VPQA 1I2QA 4X63A 4S2BA 1TYGA 5FA5A 2G4JA 4M29A 2WB5A 1PL9A 4AEEA 4NY2A 1J10A 3MSGA 2A6NA 3UNDA 3UXKA 2NVKX 1XIGA 3QXBA 4AZCA 3WO8A 4JX4A 1CGVA 2A6LA 2A4AA 2RKXA 1TV5A 4WXYA 1UMLA 3UWWA 4N02A 3FN9A 1NDZA 1VF8A 2D73A 3GVQA 4GMEA 2BTMA 4UC5A 1OSEA 1QHPA 4WLCA 4GJ1A 1ALDA 1V02E 5JUVA 3LX9A 3L4UA 5FSEC 4XZNX 2Z4GA 1OT2A 5D2VA 4B9ZA 4Q7BA 2OX1A 2ZZ6A 4F8XA 1D8CA 4ZENA 1JCJA 1SSGA 1KA9F 3WF1A 4UNKA 3RF9A 2DW6A 1D3HA 4QE1A 5HDRA 1GOIA 2DZAA 1A5SA 4XIAA 1YQ2A 4A3YA 3GHTA 3N3MA 1NDYA 1I75A 2VGBA 5DCEA 3M0IA 3VUSA 4GACA 1VS1A 4J7RA 4BJHA 5FCZA 1FBAA 2WHMA 4U10A 3L4VA 3VUPA 4KEVA 5E0KA 1KGWA 4WUIA 3MS8A 4H01A 3RCNA 3B9OA 3TYZA 1XLMA 3R4IA 3ZO9A 4NAEB 3ORWA 4WGXA 3SB0A 1NWUA 4ACYA 1ZZMA 4ICNA 6PTDA 1VAHA 2A3HA 3SCVA 3KUMA 5CCZA 2GVJA 3OLIA 4JNZA 1A5KC 1X7IA 4US5A 4IGMA 1X98A 2V30A 4DNHA 1EYEA 3W24A 1MO9A 3RJXA 1ITQA 2CLPA 2PTDA 4B2DD 3M0VA 2WNWA 4K37A 1VFTA 1CNVA 5LA2A 3WH5A 2QV5A 1ENUA 3DDMA 3K5XA 2WZEA 2FTWA 1ZLPA 1NIUA 5CZ0A 4XB3A 4UQAA 5E9AA 3QQ0A 1VFFA 5JIPA 4DN1A 5FMHA 2WV8A 2EG6A 4W8AA 1Y8BA 3A6OA 2QEZA 4UBPC 1CWYA 1UROA 3TR2A 2RABA 1HW6A 5T9CE 1N2VA 3BANA 1MW1A 3CGBA 1TX2A 2YXOA 1MQPA 2FGBA 5A2BA 1DWJM 3R1ZA 3GC5A 2DSZA 4CKQA 3EAUA 2RDXA 4GA8A 1ITXA 4J2MA 4HNNA 3PTQA 3H4WA 4Z1AA 4GYPC 5BXTA 2ZUMA 3ZSTA 3RU8X 1PJ9A 2YR1A 2ZZCA 4YXGA 4IGNA 3BGJA 2G41A 3DCPA 3EX4A 2YLAA 1M65A 2OYLA 3WLQA 2BXYA 3FCPA 3HTWA 4LYKA 3KTXA 5AN7A 1OGBA 2V0TA 5FL1A 1ZY8A 2W0UA 2X30A 1KTNA 1XPYA 1EZ2A 1XCWA 1B1YA 1AQ0A 1GCYA 1KXTA 4YVVA 2ICSA 4E38A 3V75A 1LBFA 4CCEA 2GUBA 5FD0A 3TYBA 4LCSA 5CSRA 5AFDA 4A8NA 2EG7A 4AD2A 2ZXBA 1ONRA 5U25A 1LORA 4GXWA 1RK6A 2XGBA 2GDUA 4IP5A 1TA3A 3BQ6A 4GNKB 1MRAA 2ZZ1A 1W1YA 1MVYA 2VWSA 3H55A 4HU3A 3DK9A 3CQKA 2OFJA 1A5AA 4M81A 1SO5A 3WDPP 4DUOA 4C1NB 5AC7A 3NWRA 1HGYA 1ECEA 1E6XM 1W5OA 3C3UA 1FP8A 2QULA 3BDKA 3VILA 1E5NA 3EWZA 3WF4A 3A12A 5C55A 4IGSA 4JYDA 3WG6A 4QLLA 1CGTA 4H4WA 1ADDA 2VFHA 2F7FA 2CETA 3O6DA 4ZGYA 4EOUA 4WQ6A 3ANUA 4ILSA 1XYAA 4TVCA 2I17A 1HVXA 2UY3A 4QDPA 2NWRA 3GKAA 5TR3A 1RQEA 3ISIX 4I9TA 2CZDA 4JNMA 5BYWA 3LEPA 4LYPA 3CNYA 1GJPA 3SUTA 1YBQB 2GR3A 1HGWA 3CB8A 4IQJA 3WQPA 4K8HA 2OYMA 2HQMA 4IMCA 1LRTA 1YPFA 2XFFA 1E6ZA 4YVXA 1XF0A 3DH9A 4QJ3B 2BVTA 3PBUA 2DT0A 2P88A 1TPC1 3R6IA 5FS6A 4ROQA 2XSBA 7ENLA 1IGWA 5JBEA 2CC0A 4OE7A 5FF4A 1UD3A 2ZOXA 4D8AA 3NUKA 3MDWA 3ZIZA 1DYSA 2JIEA 3NQGA 3SI9A 4A35A 3SCPA 2EG8A 4NNAA 1GKQA 3HURA 1E0WA 4CVUA 1KRAC 3P0WA 2HQAA 3JS3A 2DPEA 4ZEPA 3UGVA 1AQHA 2A5HA 2Z29A 2Q6ZA 1P43A 5CH9A 3O06A 2J7HA 2PCEA 2WPCA 2FH6A 4KGLA 3STGA 4QXIA 4ORMA 4H1ZA 1GVYA 1Z3NA 3ARWA 1YHTA 4QS6A 2E8ZA 1SJBA 3L5LA 1SJDA 5SWUA 3CXOA 3ETRB 2A2IA 5HMFA 5F7UA 3RU6A 4B3ZA 4L9XA 4D6HA 3LNMA 1ZNNA 2Q3RA 3A24A 3VVGA 3DYMA 3ALFA 3RLGA 4PEEA 1DJIA 1XINA 4OVXA 3NQFA 2X8HA 5D9NA 4IFRA 4H7ZA 1U33A 1DHKA 3VIGA 4M24A 1ZPTA 3DFQA 2GDVA 3EEGA 5E0FA 3GNDA 2WC7A 1REQA 4UTHA 2J74A 1LJYA 4H2HA 3U7BA 3THAA 3UZYA 3UGRA 2D0FA 1Q7QA 1JNEA 1UG6A 4PRTA 7TIMA 5CPTA 1Q6CA 2DT1A 4F0SA 1RV8A 3LRKA 1GETA 1MXDA 1JD9A 2ESCA 3U2CA 3G0UA 4DI9A 5A94A 1C8XA 1OYBA 4TMCA 1GOXA 2QAFA 2P8CA 1ZCOA 3NZRA 1UR2A 4JTGA 3MU7A 1ZSXA 1IWBA 3WLNA 5CBIA 2XVLA 2QCGA 4HHHA 3PZVA 1HJSA 2J8TA 3CUHA 4Z17A 2VFEA 2VRKA 5A6KA 1P1XA 4PSPA 1K3UA 2ASHA 4Q33A 1QI2A 2X0YA 4L7ZA 4S3DA 3UCDA 1OJXA 3TA9A 1P7TA 4Y2WA 2PU1A 4G1KA 2BXVA 3H54A 4JQAA 1GZ1A 2H9AA 1UQYA 2GGIA 3QLLA 2RH9A 3J7HA 2OWWA 2J75A 1UWTA 1Q6OA 2C7FA 5I79A 1NDVA 1Y5WA 5DT5A 1Q5MA 3TVAA 3W02A 3C2YA 4FR1A 1JI1A 2EF9A 1FEAA 1QPNA 2YGYA 2B31A 5DXXA 1S5TA 4GYPA 4RPQA 3BGGA 2R9ZA 3L21A 1UKQA 3VNMA 1S2TA 3W7IA 1K6AA 2XIMA 3BZGA 3MCOA 2Z1SA 1BKHA 2B7OA 1RJQA 5E5CA 3W85A 3E12A 1JGIA 1V79A 3U3HA 1B4KA 3HG5A 4HMDA 5A6TC 4HOWA 4H9VA 4PMXA 2H8ZA 4FR6A 4O8RA 4X2PA 2POTA 2A3LA 1F05A 4NAFB 1GRAA 1FHDA 1MFVA 3TW9A 1AH3A 5KVHA 4GO8A 3V4BA 1AFSA 3H7UA 3HB9A 3NOEA 5G4HC 1SW3A 3FK4A 3WH6A 2FYMA 4LX4A 2HRWA 3N1AA 4W8LA 2OT1A 1VRXA 4ZZ9A 4JIPA 3FYOA 4WRHA 1A5MC 3S5OA 3LI1A 2AQOA 5FF7A 4JD4A 1FUYA 3P74A 3UR5A 3NQMA 4AIOA 4B16A 2WPFA 4CD7A 3LXDA 3H4XA 3A5FA 1TTQA 3TLLA 1H41A 1I2NA 2QJIA 4HSNA 2F61A 1LYXA 5IM51 4KWSA 5A8PA 1XRSA 1OCJA 1KRCC 2GL5A 1H7WA 2PTZA 2C3DA 4US5D 1K7EA 1GRGA 2Q8LA 2WHKA 4EPBC 3EKGA 3V5FA 1MW3A 1OGSA 1SZNA 2PF8A 3ZJKA 3D5HA 1R5YA 1LQ2A 3VMPA 3N2CA 1D7KA 2CERA 2EGZA 5FEZA 1OFDA 1HO1A 1XUZA 1TCMA 1XIDA 1JYNA 2IXVA 1ZBWA 4LT9A 4FZIA 4O1DA 1QNSA 1L6WA 3LLXA 4P8VA 3TKFA 3ARUA 1PO9A 4A3UA 4S38A 2IW0A 1JR1A 4H19A 2WHLA 4DI8A 2V3AA 4LEQA 1E6SM 3VOHA 1W9DM 1HKIA 1V59A 3KOWA 2IUZA 4H41A 5GRTA 3W00A 1XHCA 1VC4A 1GOWA 3MY9A 1BXNA 1PHQA 4JGDA 3OODA 3G1VA 3KOXA 2XIQA 2X2GA 4U3AA 2E5CA 4PZVA 3NS1B 1W56A 4G1NA 2R24A 4O16A 3YPIA 4FIQA 3W26A 3TTEA 4FOKA 4UTLA 2JK6A 1K7FA 3F4DA 2VT0A 2PTYA 4J56A 1WZAA 3ITYA 4GI9A 2CXGA 1TX0A 1A50A 1KGXA 1XLGA 2O55A 2BVWA 1UKPA 5HATA 4BFAA 2NSXA 3N29A 4L4OA 2A3BA 3EWWA 3FW6A 3SSZA 3A3HA 3GWQA 2PD5A 3NVVB 1H49A 3QJAA 2UBPC 1OCNA 4GY7A 4JPGA 3WF0A 4RE0A 4ZO6A 3TTQA 3SUVA 1UC5A 2XWEA 1MEIA 4ZB0A 1BVZA 3WMLA 3UY8A 5K9XA 3G2GA 2J66A 4NZ4A 1QNOA 5AC8A 1TPWA 3BK0A 1PWLA 3B40A 5AYYA 5M1TA 1QHZA 2GDQA 3Q58A 1L9WA 3SEPA 2VGGA 2YA2A 2YYTA 4DZ5A 5JXQA 4OGZA 2OWXA 3SR7A 2WM0A 3TSDA 1FKWA 2W63A 4GVGA 3IUDA 1WNOA 4O0QA 3DK4A 1KM3A 4YU1A 3GU2A 2O7QA 2ZVRA 3TTOA 3CIXA 2PB1A 3LG3A 1G67A 2V6AA 6XIAA 4ONVA 3G1DA 3M6DA 4MZYA 3VGDA 3AAMA 1BYDA 2DZSA 2QJHA 2AGTA 5CZTA 4IFKA 3KCOA 4J28A 4DZIA 3B9DA 4LVBA 1IXPA 3UT0A 1Q8AA 4H7VA 1TUXA 4JTRA 3L4XA 2CLIA 3MKKA 3HN3A 4REQB 4KCUA 2VDGA 3GNNA 3LB8A 3VC6A 1EC7A 4IMAA 1FWHC 3GW0A 3H23A 4E4UA 4KCWA 3VDBA 4XZBA 3VD5A 2FZNA 3L9CA 1XGDA 2RGMA 4UMBA 4GQGA 3AHXA 3PSVA 1VHCA 1AVAA 3NTYA 4AAJA 5I06A 4WJEA 2DT3A 3V1PA 4GD0A 2KAUC 1M5WA 3PG9A 3KP1A 1R86A 1C92A 3VTRA 2VD8A 3H4KA 3S47A 4GZIA 3TCEA 3I10A 3THQA 4BF5A 4H4UA 3BMVA 4LFYA 4EMJA 3R13A 3S4TA 2AOSA 1ZRQA 2J88A 4WZHA 3UCCA 4QDMA 4JIIX 2VEIA 4HK5A 4LS0A 5JBFA 1OG6A 3T0BA 5HXMA 3VKKA 4WY0F 3BMXA 1AJ0A 4UQBA 1Q6LA 4JTHA 3FXGA 3WH8A 4NT0A 4HK6A 4LUTA 4WDXA 3TAOA 3ZXWA 1YDNA 3DFSA 1T7LA 3LBOA 3PC0A 1AG1O 1MZRA 4N4QA 3HFTA 3IUIA 3HA1A 3QQWA 4PN2A 1G4PA 3VYLA 2B7QA 2YJQA 3RK8A 2GQWA 4WXZA 3VIIA 1UPPA 1I4NA 1ZP4A 2V2CA 1KBJA 1JD7A 2ONEA 3AOFA 3RR1A 3KCLA 3VIKA 4WK9A 2GQ8A 4QHRA 4KKXA 3B8IA 1H61A 3GVWA 1KQZA 1ELSA 2H6RA 1UB3A 4FO4A 3TMQA 3Q37A 3R43A 3W7LA 3EMQA 1G7UA 1BZLA 4BF9A 4IFOA 4FK9A 4N7QA 3WMSA 1TIWA 1T3QC 4PMYA 3MSRA 4AF0A 1K7XA 1UUQA 5CEWA 4GNJA 1VPYA 2X99A 4Y9PA 4D6FA 1ITCA 5D05A 3KHJA 2QPXA 1ZTVA 1YTDA 2F2HA 1O1ZA 1KBIA 1TPDA 4Q8QA 3PSWA 3MBFA 3AHZA 1UWSA 1R9XA 3TYDA 2EJAA 4JQ3A 4NZJA 4OV9A 1FOBA 4R7JA 3JU2A 4YWOA 1XS2A 1BRLA 3HZ3A 2W91A 5EBUA 2OVLA 2OYKA 3LTYA 4AD5A 2I5GA 2V67A 1KXVA 4ENLA 4NZCA 1Q2SA 3U5YA 4MKVA 1SMDA 3EPOA 3WLRA 3ANYA 4H7CA 2E5BA 3DFNA 3UCQA 2CBVA 2ZZ7A 3QVQA 3IAQA 1JDFA 2PWHA 3W73A 4CUCA 3URNA 2Z0IA 2ZE3A 1I6NA 1TJ1A 4C90A 4PUKA 1RH9A 2NVCA 4DIAA 4E2BA 1G01A 1NF7A 1P4CA 3GH5A 1I0DA 3ZYZA 3ITTA 3B9NA 2Y89A 4ATLA 2WJDA 3LHYA 3TQ0A 2XH2A 1G4EA 5REQA 3EX3A 3K4DA 3AWOA 1CLKA 1EH9A 2QNEA 2D3NA 1BXBA 2ZZ4A 4DWSB 1JRCA 3GVGA 4L4LA 4HQVA 5LA1A 1ICPA 3SJ3A 5C2XA 3LS9A 3MJMA 4RLIA 3LCWA 2WKJA 1JZ8A 1V97A 4WDWA 4ZOBA 5EL1A 5G2IA 2GGEA 1I2OA 4HA0A 4Y8EA 4FNQA 1PX4A 2FDMA 4B15A 2QF8A 4LJ3A 4HA3A 1DTUA 3C86A 4BZYA 4ZQMA 3B9EA 1KR1A 5EY5A 3POCA 1W0MA 5IDIA 1XDLA 4CNNA 3V0TA 1XDIA 3LM7A 1PCKA 3WNNA 2OQYA 3KL0A 3NOYA 4EKJA 2PWGA 4G7EA 3H7RA 4S3EA 2QLYA 2PTXA 4YYCA 2DZTA 2KX9A 2HS8A 5HJYA 4H4QA 1NOUA 3PTKA 2XVGA 4I5XA 3CB3A 1OK6A 4RW5A 3BVJA 3KOZA 5FJOA 2F6XA 1LT7A 3I3BA 2ZA1A 1QNRA 1NHQA 2FJKA 3CIVA 5IXEA 2IKIA 4GVHA 2AKMA 5JQ9A 4GJIA 3M0HA 3BO9A 2DGAA 5AYXA 3L7RA 1M03A 5CZKA 5DBTA 2W9MA 4M7SA 3G1SA 1G4TA 2PS2A 4P5UA 1RP9A 4BHYA 2XYLA 2X41A 3N2BA 3O07A 2REQB 5JMUA 4LBUA 2CKSA 4NJJA 4WY0A 2XFRA 2PC8A 3TA6A 5BMXA 4H4RA 1UBSA 2WVVA 3FOKA 1I45A 3M6YA 2A3EA 2VC6A 1ZHAA 1KM1A 1SW0A 1WZKA 2FB2A 4JNYA 4P7OA 1Z32X 2E3TA 1N55A 3G18A 3QOKA 3IANA 2YSWA 4F40A 1ZJAA 1GYMA 3W23A 1VCFA 3M0MA 5D2XA 2F6KA 1ISWA 3WJYA 2YZRA 2HNHA 2PDKA 1H5YA 2X1SA 3ITVA 1TWZA 5BROA 2C91A 4A2SA 1F8MA 4NXSA 1KTBA 4GIEA 3HJZA 3DERA 1PKLA 4PMQA 5DMNA 1KD0A 3PPGA 1CTNA 4FS9A 4YPJA 1UW9A 1RCQA 1E56A 2XN2A 5CPSA 4EWJA 3PFMA 4L4PA 1JFXA 1WUFA 4TUFA 3U4AA 1AA1B 2PLJA 1ZMCA 1FIQB 2NUWA 4E4FA 1JZ4A 3VDAA 3MWCA 4JZ5A 3GSMA 2BGSA 4Z42C 2QPUA 2BODX 4CD6A 1TO3A 5I07A 4YJ5A 2VRJA 1FWEC 3CGDA 2V5LA 2HBXA 2Y7EA 1DWFM 2ISWA 1NWRA 2BMBA 4S3BA 3T1GA 2Z2BA 5KTLA 1YNQA 3TH6A 2JGQA 3M0YA 3W38A 2BOGX 1PUDA 3HF3A 5FF2A 1YPXA 3GZAA 4XAFA 2FVMA 3CHDA 3KRBA 1W1B1 4ML4A 1MWOA 3QZEA 4M6VA 4ZXOA 3HMCA 2WCGA 4BURA 4ZMGA 3DGRA 3QW3A 3I3EA 3DBNA 1KCXA 2TRSA 4XD5A 2JIWA 1GOKA 4EQSA 1YE4A 2JEQA 5BOEA 2RDUA 3QY7A 4HA1A 1JCNA 3TYEA 4ZR8A 3GG1A 3APGA 2CWNA 4F0HA 4JN6A 1XISA 3OP2A 4CD5A 2V69A 5EMJA 4KT2A 1JEZA 5BRPA 4IX0A 5BZAA 1EJ7L 2AAAA 1ZKQA 1I1WA 3RIKA 4KEUA 3AC0A 5TAOA 2NQLA 4U2ZA 4BI6A 3WLKX 1QK2A 4PUWA 1SPQA 2TODA 2JE8A 5JVLA 1H7XA 3W2NA 3PHAA 4TX8A 5I77A 3AMLA 2BNJA 1LRQA 4O10A 3TLQA 1W1TA 3W70A 4GO9A 3P81A 1DEDA 3CQJA 4GRTA 1HL2A 4C6MA 4WCJA 4RR4A 4BF7A 5GNYA 5KZDA 1GHSA 3TWAA 3NDZA 2WJEA 3FJ4A 4NAEA 3O0HA 2E6YA 5ER0A 1NJJA 2W6RA 4RCXA 1AZ2A 2A21A 2YBUA 3WUGA 4Z2JA 2XFYA 1ZQ5A 2PDQA 4K1WA 2OX4A 3LENA 1XBYA 3EANA 2VTFA 3N6HA 3L0KA 3S0CA 3ZOAA 1FP9A 3T0DA 1TPVA 1T40A 1OIFA 2FDSA 4TV5A 5LNSA 3WBEA 2ZZ3A 2Z24A 2E6DA 1GGOA 3IWPA 4U2YA 3NR0A 3D9XA 5DX7A 3OG2A 1PIIA 1UA3A 2OB3A 4NI8A 1TZZA 5I3JA 4Z08A 2IQTA 2OO6A 4QR6A 1OWQA 3PP7A 1K1DA 3H53A 3USZA 4NILA 4ML9A 1GK8A 4MIMA 3STPA 1GRHA 3OOQA 5KSWA 4PUEA 1UD2A 3I7RA 5C9UA 2VC7A 2P3ZA 4AXNA 2JKPA 3UF9A 3UW6A 4F9DA 4RDYA 3HQNA 4XZLX 2DSUA 4PTXA 3B8DA 1H2IA 4PTNA 1VIZA 1IR2A 5HR7A 1NFGA 3KDOA 4MZ1A 4M3PA 3WNPA 4DBSA 3I7QA 3CQIA 4ZFCA 1E1EA 4RNIA 5K2ZA 4ATDA 4JQ9A 1MYRA 1F8IA 2CBIA 2BP1A 2WP6A 5A6JA 2NV9A 1E0TA 1QT1A 1GUVA 2VEMA 5HANA 4LRSA 3LCGA 2VCCA 1FFQA 3PR2A 4ORIA 1UP3A 1RBOB 2YB4A 4C6QA 3PWGA 2J3NA 4XO6A 3OVGA 4W5UA 2J77A 2CFYA 4W84A 5C7HA 3N9RA 3TX9A 1Q6RA 4F9JA 3SCTA 1F9CA 2JF7A 3TAKA 3G3MA 3H2OA 1PAMA 3WNOA 1M7PA 4OUEA 3BLDA 4FMVA 1A5BA 4CGTA 5L6UA 3BICA 3PBYA 2YW3A 5CSSA 4HPNA 3NDYA 1VEMA 1LLOA 3CUFA 4B5SA 4GH3A 1JDAA 1NOWA 4IPPA 1WO2A 3EB4A 3HQPA 2C1GA 4C1NA 3MSDA 1VGAA 4JQ4A 5TQLA 3B0YA 2XVKA 1CI1A 2ZX6A 3U57A 1E1CB 2PDMA 2C79A 3LHZA 1AJZA 2XN0A 3KW3A 3MVTA 2HSAA 3KBWA 3W81A 2FJUB 1DE5A 3P61A 1VLWA 1GEQA 2CLOA 2DQXA 5FAGA 4H8NA 3B0PA 2ZFAA 3B8TA 5FEPA 1DL3A 1RD5A 1W3LA 5MKGB 2R94A 3O7UA 1PBGA 3LGDA 4ZQOA 3T0TA 2BS9A 2ZXQA 4P7LA 3GDKA 1EF2A 4URIA 1XV8A 1UZHA 1YBQA 3VD9A 1KCLA 3FV9A 1NQ6A 1XRVA 3PZ9A 3T7VA 4OKDA 1V08A 2WVTA 3E96A 1LVLA 4AY8A 3WDIA 5L9FA 3QRHA 2CLMA 3QPZA 5A8QA 2HTMA 4O28A 2JKAA 4GUHA 3VKDA 2R8WA 2G4FA 3QC0A 3BE7A 1VHNA 4MPQA 1EHAA 4ERIA 4KERA 3TEVA 3GR4A 4G9PA 1G9HA 1HJUA 3WBXA 3L2LA 3REQB 5EA9A 1NVMA 2RFGA 4DBWA 3S1UA 4MY1A 3HGRA 5CG7A 3WQCA 2QDGA 5G5IA 1W2PA 4Z2IA 2TPRA 1W6TA 3ZLGA 1IEXA 3OG3A 4A8RA 3T81A 1E70M 3AISA 4AX6A 3BQ5A 1EO7A 2Y0FA 5A6MA 4QLJA 4KPLA 3W7EA 3GIQA 5HOSA 3HGOA 1WBJA 4LUSB 3FX4A 4FDCB 1PSCA 1L6SA 1SGJA 2XZ9A 1FWNA 3KS5A 1ZS2A 3O6CA 2CZEA 3LU2A 1GHRA 4AIEA 2X0SA 1B4EA 2C0AA 5LNWA 1LG2A 4LIIA 1G69A 2OSYA 4MAVA 5I78A 3CHEA 3MZNA 1HO4A 4XKMA 4KFOA 3NXLA 3NQ7A 4RKAA 4C5ZA 3UR7A 3H24A 3JZEA 1M1BA 2GGJA 4C1LA 4JICA 4UFMA 5J5DA 8CGTA 2PDFA 2CLKA 1YIXA 4ECLA 2X50A 1MNSA 3W22A 1K9TA 5IFTA 1TVPA 2ALDA 1H60A 4I90A 1DXLA 2OZ3A 4A22A 4L64A 4AWTA 1DIDA 1EJRC 3W7CA 4QEHA 3CLWA 2VEPA 4TO8A 3BG3A 4IIDA 3DHPA 1OZQA 4JTDA 4H2CA 2JEPA 4JDRA 1JNDA 3SADA 3WL0A 3EX6A 3EZ4A 5AYZA 2PWUA 1QBBA 3WQWA 4MOZA 1P5BA 3LYEA 5CLTA 3S1VA 2GJXB 3DXIA 2ZX7A 4W9TA 2WMGA 4KW2A 1ZAHA 4U31A 4C91A 4I9MA 1JZ3A 2VMFA 1WP6A 3UNTA 1HF6A 3Q6JA 1J93A 3UZJA 4LY4A 3OEXA 3SURA 3M0KA 1YPIA 4XAPA 1AW2A 2Z1VA 5EFFA 3OGVA 3GQYA 3KZPA 1ZMDA 5AC6A 4NU7A 5LIYX 1KN0A 2EPMX 2BLEA 8XIAA 4LS2A 3QSRA 1W31A 1YADA 1XBZA 1Z69A 1RY0A 5U1OA 5AHNA 1MUMA 1GNXA 3SY8A 5A6SA 4CNTA 2DSKA 2E1WA 2GSJA 4DLFA 1O1HA 3LHWA 1XICA 1VJZA 2C13A 2A7PA 3GTIA 4S3JA 3L4WA 1E43A 1GEUA 1PE1A 2EJ1A 1JVNA 4FNRA 4NAFA 1VFLA 3KBMA 4UZUA 3NPWA 4TU1A 4PMOA 1QI0A 1YYAA 4WD0A 5DY2A 4HB7A 5XINA 3AMDA 1DWAM 1QAPA 4LS1A 1JUEA 2AQWA 3ARPA 3KAOA 4DXVA 4DO4A 3H22A 4G7FA 2Q8XA 4C5YA 2X8CA 4NL1A 3GD6A 3S9ZA 3N14A 4GIYA 3VZXA 1EFZA 1QI4A 4O4WA 2Z1BA 2X09A 3MSYA 1Z44A 3VXGA 4CD4A 3AU6A 5LYRA 3A7RA 1IXQA 3LCFA 2G37A 1WDRA 4D9PA 1J11A 2P0IA 2WPEA 4MLRA 3VM7A 4ZCWA 1ML1A 4B5TA 3W7GA 3KBNA 4EPEC 4TX6A 2GZXA 1KW1A 1ISYA 1S2UA 5FS8A 1TVNA 3FJ6A 3LSCA 3TFXA 3K1DA 1XM3A 1PKMA 4Y6GA 1OVDA 1TFVA 4OOZA 2WVSA 4RJEA 2ZICA 4RUBA 1QASA 2CU0A 3PWAA 2HISA 1I2PA 4EF8A 4PUMA 4S2CA 3KVKA 5XIAA 4PTVA 1GW9A 1F6PA 1LRNA 1OCBA 4U28A 1EOMA 3IJQA 3SRHA 3AS3A 4EK7A 3H12A 3CLMA 4X3ZA 2PPGA 1TMLA 2GJPA 3ICJA 2ZTKA 1WKEA 1K4HA 4W93A 5I02A 5IBXC 1UZ1A 1F5ZA 3W27A 4S23A 1JPMA 4LVDA 4AIBA 4X0VA 5LZLA 3CUXA 1RPKA 1V93A 1XW8A 3KOFA 3PS7A 4DLMA 5KMYA 3T9PA 2VENA 4DWSC 2QDDA 1ZBKA 5DO8A 3SGGA 3RLVA 3PZNA 4K7ZA 3OQ8A 5GJNA 3GUGA 1ZCCA 5JH2A 4DYEA 3WBAA 3ZJ6A 3AIQA 3LXBA 3P60A 4HPHA 4PE8A 3VGHA 5LIWX 4W4QA 5T9BG 5CPNA 4YHEA 3DFOA 3WD1A 1J8VA 2OLSA 2PLKA 1VYSX 4N4PA 4BEUA 5LXXA 3G8RA 4DYJA 3GG7A 4MWAB 3UD6A 1BKSA 3UYCA 4R34A 3NZ1A 1VFMA 3URQA 3PG8A 4QISA 4BI5A 4MZ8A 3ENLA 4DJFC 4H4TA 7REQB 3VE7A 1EWDA 5EMUA 1PIGA 2J79A 5HQEA 1HJVA 1TV2A 5ABTA 3AIUA 2V3EA 4OT7A 3PBMA 2PU0A 3DFTA 1TV4A 3KTCA 4JX6A 3W07A 1FWBC 1EJSC 4J3TA 3TW6A 1XLJA 3WQ6A 2QUNA 4MKSA 1CENA 3BJFA 4O57A 1QUMA 3F7JA 3S9IA 3PZGA 1EPVA 4U4MA 4NJIA 2A85A 1S5VA 1V0KA 3R0DA 5H91A 3F4VA 3GDTA 3WFLA 2NX9A 4GZEA 3ZR4A 1XYCA 2XWDA 3HGJA 1R30A 3WH9A 3W82A 4ERAA 3UJFA 2ZE0A 1I60A 4P2VA 5BRBA 3AMKA 3G5EA 3QV7A 5HAOA 5ABFB 3S5YA 4WDUA 3OB8A 4REQA 2DZWA 3EB2A 4IMEA 3TXVA 1QOPA 3OGSA 3UWVA 1H50A 5FS7A 4LAUA 4Q8VA 3BAYA 1KR0A 4IX2A 5PTDA 4D1JA 1KRMA 4MDPA 4HMEA 4PCNA 5G4WA 3VDHA 2VWTA 4WR3A 4MAZA 3GNRA 3GVVA 4JDYA 1SO4A 3ZWSA 3BMWA 2VYOA 3RX3A 5LXEA 3SQSA 5D38A 3BCJA 1W9UA 2WBGA 1U1JA 4LCRA 2R1LA 5HA7A 2XGIA 2GK1B 4PSRA 3PTMA 3IIXA 2ZXAA 1CCWB 3S5SA 4V33A 1C3FA 1QW7A 3E2RA 5FJTA 3PUEA 4IPNB 1UH2A 2I1OA 1XLCA 5HNNA 3S42A 3QHOA 2YDAA 4AC1X 1UWRA 3TWBA 2B4GA 3GTXA 4BR1A 3VDGA 2WNQA 3W72A 1CGWA 3KZSA 1E4NA 3A7UA 3BW4A 3U2OA 1KO0A 5ABEA 4PCPA 1KFLA 2D24A 3NZPA 4XD6A 3BG5A 2YL5A 1F3XA 3I68A 5IFPA 5D8ZA 4LANA 4XG1A 3I6RA 1B90A 4FEZA 5I3IA 2XZ7A 3A3WA 4FAMA 3GRTA 4B5VA 4M1RA 4CU8A 3IS4A 4XSLA 3PJUA 1J0IA 1N8WA 4NUWA 1GVSA 3WQVA 1H11A 3GNOA 5B7YA 1UJQA 1DWIM 3S2NA 3A5VA 2C8NA 3W01A 3S2MA 3HPAA 1PPIA 2VEGA 3ABXA 5MF5A 3JVAA 3TQPA 1TWIA 5G2WA 4LEFA 1JUKA 2GH5A 3FSUA 4HKPA 4CVWA 2BBFA 1N8FA 4QROA 4AZBA 3OLGA 4D2JA 4YTRA 2PDPA 2BB0A 4HP5A 1OYAA 1UD8A 4FI4A 2HPMA 3FKRA 2UWFA 3Q2DA 1A49A 1T5AA 1EX5A 2R1KA 1V3KA 1LCOA 4EM3A 3M5XA 3LV5A 3VPLA 3KL3A 2OQLA 3NO3A 4EWND 4UZSA 4JOMA 3R8RA 4AB4A 4Y9OA 2V6OA 3UPWA 1BSLA 4ZE5A 3C2FA 4ZB5A 2YW4A 3Q4DA 4RDWA 2WAGA 1EWEA 4E2OA 1VJSA 4Q8PA 3PY2A 1JCTA 3MYPA 2OEKA 2BC0A 1Q63A 1MUWA 3P84A 4UTWC 1VDVA 3TYUA 1MEWA 4IJBA 2YLLA 2ACUA 4IPJA 4GIAA 1RQHA 3A21A 1TPH1 3WD4A 1N60C 1UHVA 1AD4A 5A8NA 2V3DA 1R87A 4M80A 2WWCA 2Z1WA 3LI0A 2PRLA 4NG3A 3NJ3A 3STFA 2O7SA 3ZSSA 4QG6A 1AODA 2DVXA 5IBXA 3HPSA 5RUBA 1IGSA 4N0RA 3LZ5A 1QJWA 4XVEA 1VR6A 3LHUA 1RM6B 3S6DA 4WHBA 3LDVA 1KXHA 3HOJA 3G0SA 4DWSA 3GUWA 2YL8A 2D2OA 4R33A 4AZGA 3LV6A 3UP8A 1E6PA 3M5VA 4XTDA 2XSXA 3EWUA 4HSOA 3B8WA 3WEMA 3VKCA 3CQHA 3NGFA 2D2JA 3KFTA 2DU2A 4S3KA 5FF0A 1BWKA 3R8GA 2OEJA 4UTIA 2YVJA 4N6FA 3ZWTA 3EWDA 3H7VA 4JTCA 4TR9A 1FRBA 1EJWC 4QGCA 3JR2A 3KRSA 1BGAA 2ZX5A 1Q6GA 2WK2A 3AZTA 1HKKA 2J62A 3P80A 4GYKA 1SMAA 3W83A 2Z27A 5I3KA 1H1ZA 2PF0A 4JR5A 4F79A 2E1DA 4DJFA 3K1GA 3DHUA 1WYGA 1ZP3A 4HCHA 1LBMA 3GBEA 1W3JA 3HG2A 3PB0A 2AQVA 1Q6QA 1R47A 3EEZA 5U7SA 3WQFA 1S2VA 4PH6A 4HZ8A 2MUCA 2CHNA 2QVNA 3IVUA 5C9XA 3GNPA 4N6EA 1PX8A 6ALDA 2YCLB 4B90A 2DV0A 3N9SA 1PZ3A 1LOLA 2WPGA 3PZOA 5D30A 1WYIA 5I23A 2WZMA 2O56A 5A6BA 2PMQA 1MFUA 5FS9A 1BG9A 4HU8A 1XYMA 1UWIA 3DG7A 1XPGA 3ERPA 2REQA 4RNJA 1RY8A 1I0BA 2HVNA 4RZ5A 1EUAA 1RLDA 1TVLA 3DGZA 1VEPA 3GR8A 4IXXA 1P48A 2XPKA 4B5NA 1BGGA 3EA1A 1FFUC 4CEUC 4J9JA 4E3TA 1KBLA 5HPCA 1TQXA 3GLCA 1A5OC 2FVLA 1WUEA 4D8LA 1OD0A 3FLUA 2VO5A 3PUGA 5C2GA 1AMYA 2Y8KA 2Z28A 5BRQA 3OQEA 4NP7A 3BV4A 3NPVA 1GPWA 4LB3A 4RZBA 4JYEA 4U33A 3RM9A 4AD1A 2WJZA 2EKCA 2QMKA 3QH2A 3SRKA 4O54A 3V5CA 1OCQA 4V1XA 3TP4A 1W9VA 1AK5A 3CMJA 3TSMA 2QJJA 2C1IA 3E38A 4BCEA 1VRDA 5EPDA 3VKAA 1JQVA 3A9BA 4S39A 4ROPA 5I24A 4EIVA 1W32A 1O6IA 3BLLA 1UKSA 3LA4A 4UFJA 2ZTJA 4YWIA 3F03K 5EGRA 3CIWA 5CKSA 4H50A 3C4UA 2PGFA 4XV0A 5XIMA 2FFIA 3W75A 4DPQA 2GWGA 5DXYA 1W5QA 2NV1A 3LZ3A 1K8YA 3NSXA 3WMBA 5LNUA 1NFPA 3TJIA 2VDHA 4QS5A 1ONXA 1R3RA 1N61C 3WJWA 1Y0EA 3WK2A 2FKPA 3PBVA 4XZIA 2VI0A 4QJ1A 1MXSA 3RLUA 4GIRA 2V8ZA 4LA1A 1QPQA 1DP0A 3S9YA 2X8RA 1W3HA 3F2DA 2W3SA 1S2AA 3WZ0E 1A47A 1MNZA 2UY4A 5D9OA 3UWUA 1RVKA 3CUJA 2NX1A 3HQ1A 4GXPA 5C9WA 4UTUA 1EJTC 2NT0A 4A3HA 1EF3A 2BGNE 3NL5A 2GLKA 1KBKA 1KFKA 3KM8A 4GOAA 1A0EA 1RP8A 1M04A 3AXKA 3K8MA 1F61A 3UJ2A 3EMCA 1LQ0A 3D6NA 1ONWA 4BQ3A 4FB7A 1EZWA 2O9PA 1T96A 3LM3A 4MJ4A 1HL9A 4JXCA 2CLLA 1F73A 3BCDA 1IR1A 3AXMA 1E6NA 3G77A 3KRUA 2PDNA 1I2RA 3DN5A 3XISA 2GR1A 4LVAA 3AIWA 5EBKA 5KEZA 1I9CB 2V2DA 1QI5A 1KFJA 1GVRA 4B4FA 1S38A 4UTWA 2Z00A 4RV8A 4JQ2A 1GYLA 7PTDA 8RUCA 3Q65A 3N11A 3WBYA 2I9EA 4YN5A 1DQXA 3MUAA 1TE1A 1ISVA 1FECA 3DC0A 3P67A 3SIZA 3W84A 4E8CA 4ZVJA 1C9DA 3RO8A 3GM8A 4IMGA 5AVNA 4A21A 5CGMA 4ZOCA 4B3KA 5KZMA 3ZMRA 4Q8WA 1UWQA 1DQUA 4C60A 5CPQA 4HNVA 1O7AA 1B5TA 1Z42A 4KGJA 3D0CA 1JUBA 4LUYA 4O50A 1UR9A 1NY1A 4UIOA 4JCLA 1NU5A 4IICA 4LVFA 2Y24A 1AJ2A 2OT0A 1XXXA 4H4VA 3SIMA 3QY8A 4LB4A 4ICCX 4H4ZA 1VBHA 1DOSA 5GQBA 5BXSA 5LGXA 4GKTA 3HW2A 3C2VA 3OA5A 1P0KA 3DOPA 4EP8C 1JYVA 3KLKA 1GRFA 2D0HA 3T8QA 4PA8A 3G1FA 2GJNA 3LNPA 4NQ1A 3GHSA 4Q4SA 3E3HA 1R0MA 1W91A 1IV8A 1V6TA 4J3SA 2YB1A 1H51A 4KCTA 1QNQA 3IVTA 1NP0A 1YTEA 3WBWA 2J13A 3E0IA 1O5XA 4E2VA 2DIEA 1XRFA 1Y7VA 4KEZA 5GNXA 1JRPA 4GQRA 4DXXA 2BASA 1JPHA 4AMAA 3UZXA 2EBNA 1IT0A 4D72A 3URHA 3UXLA 5CAHA 3LCLA 3RFAA 2CBJA 2Y7DA 3WF2A 4JTIA 2Z26A 3AHTA 4C65A 1IF2A 2PDXA 3LHTA 3HBLA 1U1UA 3MVIA 3KX6A 3KTSA 3R58A 4DJEC 4S3AA 3S1GA 3MV01 4UTFA 2GQAA 1Q8JA 2GPTA 3P8JA 2VUYA 1TWDA 3M5YA 1GXFA 2I5IA 2V82A 5CLWA 1J6PA 3N12A 2VHLA 1QTWA 3FYYA 4MYXA 4RZ6A 3MW7A 3CO8A 3QGKC 4H8VA 3NVDA 2WKLA 2QGHA 2DH2A 2Y61A 1LDCA 1MXGA 3GHRA 2VRQA 3GD4A 1OYCA 2IPGA 3TE9A 2GGHA 3P7YA 5I03A 1Q6FA 3CUGA 4WEVX 4L65A 3OIHA 3W1PA 1VYRA 1D9EA 4L1WA 4ZODA 4HPXA 1V0NA 3WDHA 4CCZA 2DFAA 1JDCA 4XO7A 3GIPA 4G6CA 2PDBA 1B30A 2PLMA 1U5JA 5JCMA 1GKPA 2PUZA 3OPSA 4H6RA 4X61A 1J01A 1SZFA 3N19B 1X8CA 3O6AA 1BQCA 2E28A 2QZRA 3E0VA 3AO0A 3I4EA 4GVIA 2G50A 1J0ZA 1K02A 3FDKA 1KM6A 1TPUA 3LCXA 4UQEA 4YLWA 3E6EA 3WK3A 1WDQA 1AD1A 4WKAA 3TDFA 2PDCA 3PPFA 4NJHA 4DWSD 1HKMA 1V6YA 2UY5A 2QCDB 1OC6A 2GFTA 1KKRA 5D9PA 1U83A 4NASA 3Q67A 1H63A 4CU7A 4H9UA 1LZOA 3UWQA 1RJPA 1ME9A 4K2SA 3M41A 1G7VA 4HJWA 5AVHA 1BTMA 2X40A 4YTQA 4P61A 1J79A 2PWEA 3HJEA 3U6WA 1H7PA 1E1CA 1JL8A 1D7YA 4PMZA 1BQGA 1VYPX 1XKYA 5F1UA 4E0CA 2WQPA 4NI3A 5HK4A 1M7XA 2YDSA 1E9YB 2F8QA 4QJ4B 1V3HA 3NIYA 1PYMA 2D3LA 2QV4A 3IJDA 4DJFD 5MKGA 5C5YA 4GGHA 4LW7A 1GTHA 4XVDA 2X1IA 4JQ1A 5D2WA 1HJWA 1HTIA 4JTFA 2GR0A 1FX6A 4KESA 3L4YA 2AL2B 2J78A 3H70A 3SQLA 1MW0A 2ZWYA 4RW3A 1QWKA 4OJYA 4UNLA 3SY5A 1CIUA 4R53A 3C2EA 4MJMA 3CGEA 1XP3A 4BS0A 1BVNP 2PDHA 4J3UA 2OELA 2VCAA 3WL1A 4GC4A 1OQFA 5D2YA 2ISFA 5BOFA 3WELA 5A6BD 2Y70A 3EDKA 5AY7A 1UIPA 3DU0A 3BLIA 1F2JA 4V2XA 1O5QA 3NRZB 1PCWA 2BOFX 2ZX8A 3FFSA 3REQA 2WXDM 3SQPA 1KFBA 1V6XA 4C6CA 2PWVA 3RO6A 4LH8A 3MP5A 1W5MA 2FPVA 4MWAC 3NQ2A 4EXAA 1H2JA 2W3ZA 4IPLA 2W67A 3A7AA 1FWCC 1CBGA 2NQJA 1OFAA 4DO7A 3CH0A 3GO2A 3AIEA 5C71A 3APYA 4LUSA 1GT8A 1CEOA 4MADA 4I6VA 1O94A 1DE6A 2ZRVA 1RD6A 5IDZA 4JHMA 2DT2A 1UR1A 1OJTA 5J04A 3QYSA 1QPRA 3T2OA 3R11A 1O66A 1O12A 4GUFA 3AXIA 3M7WA 3B4UA 1RZMA 4ZB2A 3W2UA 1D3CA 2C1HA 4IL2A 2INZA 5CSUA 3A3XA 3BAIA 3MUIA 1ZENA 1G0CA 5H8UA 4UXDA 1ZK7A 5G4EA 1IZJA 5B80A 1GQNA 3CL6A 1J18A 5D02A 1J5TA 1GVIA 1CT5A 3FEMA 3EOSA 1SYTA 4UQDA 3L5MA 4RE3A 4EPKA 1CGYA 5H8PA 3PZIA 2NVDA 3WQOA 4YNGA 3N4AA 1WXZA 4JDBA 4I3GA 1OF8A 3RM8A 5H2ZA 2EQ8A 2QAEA 4RK8A 3V18A 4GH1A 1EJXC 3VNLA 4O13A 1UR0A 2QHAA 3TR9A 2VELA 3TONA 1F3WA 5F2IA 3W53A 3LPPA 2WMKA 2UZ9A 3TTSA 2I56A 4XK2A 4Z2GA 2XM2A 2ZX9A 3IGUA 2Q01A 4FPSA 4JY8A 1XR2A 4GNVA 2GJXA 4NNBA 1E9LA 4Y9AA 5BMWA 2ANUA 1Q4WA 1JIBA 4HYRA 1Y5VA 4CN4A 1JOAA 4Z0SA 2PP1A 3SN0A 1ZBCA 5G2HA 1GJWA 3KBJA 4LVGA 1K6WA 1KM0A 1B3YA 4NYYA 3F5KA 1Q13A 3C56A 3B8VA 4DXKA 3SSJA 3NEVA 3S1XA 3IV8A 1VBGA 3CZJA 4DJEA 4IJRA 4AVNA 4D6CA 4IUGA 4LUIA 3NEHA 5FJPA 2ZVIA 2BG5A 5T91A 2QUMA 5A2AA 1PHWA 3QR0A 2QJGA 4GYFA 2FTPA 2GSHA 4O11A 3WYZA 1T8XA 2CKRA 1LUCB 1US0A 2OQHA 3C0SA 2VJXA 3N3TA 3MZ2A 3TZNA 1KV8A 2XGZA 1ZU8A 2GVGA 1FKXA 5C54A 4O1EA 2VZOA 5CAKA 5IHSA 3EX1A 3DKJA 2BVYA 3RMEA 4AZ6A 3NA8A 1TMQA 3HPFA 1JZ7A 1K4GA 1IZCA 3STEA 2QCNA 2AAQA 1J9YA 5DMLA 3SW6A 2W3RA 1V6WA 1M7JA 2DJXA 4L6OA 3W7JA 3GVRA 1DORA 4AY7A 3W7DA 4D6DA 4ICMA 2ZZ5A 2E7FA 5D04C 5F4XA 4JAWA 3GAKA 2QYGA 4MDOA 5KZEA 3ABQA 2IPFA 5IRPA 5IHRA 3OIXA 3U8GA 3G3DA 4M7TA 4EAMA 4BA0A 1MQQA 3GFXA 2QQ6A 3H2FA 4FXJA 2ADAA 4F48A 4WIWA 2H3DA 4J35A 3PWIA 5HNRA 3QEZA 1HNYA 4R9XA 4W86A 1V03A 1DXEA 4BV6A 3NM3A 3H4GA 2VX7A 3OBAA 3HQOA 3GTFA 3FJNA 5F2MA 1NHSA 1P0EA 1IQ8A 2FMNA 4Q8MA 4HD5A 2AL1A 2GQ3A 5FKYA 1QFEA 2F9RA 4Q4QA 3I7SA 2EPOA 2P1FA 2C19A 3VO0A 2HK1A 4FLOA 4JEJA 2DUZA 3W37A 3VE9A 3VNZA 3ARRA 2O4MA 4QNWA 4C7DA 3W7MA 4LPCA 4J1OA 4Q6XA 4GKLA 3BWWA 3GTNA 5LGZA 2ZRXA 3ARXA 2JKEA 4HTYA 1UYQA 5U4NA 5LSMA 4AW7A 3DHFA 2PZ0A 3O05A 1VCVA 2ZUWA 3MBDA 3B06A 5JU6A 3MKCA 4QITA 1GYNA 3PK7A 3ARVA 4CQBA 5M17A 1OFOA 2Z7GA 3AMCA 1CLVA 3UA4A 3N18A 1XLKA 1EA9C 1FEBA 2RJHA 1JDEA 3MPGA 2V63A 5AYIA 2NXGA 4MG4A 5HMEA 4INFA 1QO2A 4IH3A 2POZA 1EGZA 3EDEA 4HYVA 3W1LA 2PZNA 3I65A 3WENA 3AN1A 2FQIA 1E4IA 1YDOA 2OGJA 1GORA 1FA2A 1EP2A 2NX3A 4DEFA 4C6EA 4R3UA 5CGQA 3WD3A 1XYBA 4MWAA 2AGKA 4PCTA 1Z9AA 1BWLA 1V5XA 3GH4A 3SCOA 1H7RA 4NKCA 5D32A 3QMSA 4I7UA 3LLFA 4LC8A 4O18A 4D6JA 2HMCA 4K38A 7REQA 3I6EA 3PZTA 1VBRA 1LOSA 1RHCA 1M6JA 3EWCA 2ZIDA 4LSBA 5CBBA 2PDYA 3NQ8A 2ATMA 2Z25A 3G6MA 1RSCA 2V5KA 5BXRA 5KVIA 4J2PA 4XZMX 5A8GA 2XVPA 3L67A 1IYXA 5C6MA 2VGIA 1GREA 1GTEA 2IPWA 3RILA 4PTWA 1CXFA 1Q6DA 3RRAA 4D6EA 4HMNA 3WUBA 6REQB 3CAQA 3ZR5A 3NCOA 3IJIA 4DUVA 1VB9A 4IPIA 3BARA 2YVGA 2CESA 2Z2UA 4LUJA 3I3DA 3GRSA 4POCA 3WQDA 1LROA 5K3VA 4B91A 3CWHA 1IT8A 2ZYFA 2PP3A 5I3DA 5JBDA 4FX7A 4FHAA 5F4SA 2GRTA 4A8IA 2XDFA 2WW5A 2ACQA 5ABFA 2J24A 3HO8A 2VKZG 1AZ1A 3QV9A 2YAUA 4UNIA 3NZGA 3L23A 3TJLA 2CIPA 1I8JA 1XD0A 3HG3A 2G3NA 1E4MM 2QCFA 5DCBA 2OTDA 2J7DA 3UERA 1HJQA 1YE6A 1R3SA 4HGXA 4KEMA 4HCLA 3OZOA 3KVMA 5A1AA 2E4TA 1PX3A 1XD1A 3EDJA 1YNYA 1HXJA 4YL2A 5M3WA 3OC4A 3LMYA 3MC5A 3HIJA 2KZHA 1P6BA 2Z2AA 1S3HA 3UJEA 1TRIA 5CJNA 2GK1A 1SFTA 3S8HA 1Z6KA 1M53A 1EBGA 3OA3A 4W8BA 2YCKX 2QXWA 3LPGA 3EOEA 3KE0A 2O9RA 4P8XA 1MMFA 1TR9A 3PPHA 1G94A 1SR9A 5HINA 3VX0A 2OG9A 4NJKA 1GW1A 2GVLA 4ALDA 2VQUA 3W74A 2EEXA 3RM4A 3R0UA 1ODUA 3AYTA 3A4XA 3DGBA 2D23A 1XI3A 1YTKA 4CNUA 3LLDA 2Z7KA 3WLOA 3CUZA 1OZMA 3RCMA 2LLEA 5I00A 4C6LA 2HE5A 3LRMA 5CJMA 1LP6A 2NQZA 3W88A 1HVQA 4DRSA 3W1XA 1BAGA 2CBUA 4KWOA 3CU2A 1BEUA 4XBSA 3T0CA 1NF0A 3L65A 3FVDA 1XUUA 1LOQA 3ZS4A 4G56A 4LAOA 4UOZA 3RPTA 4DM1A 2ATSA 1DV7A 3TYAA 4MYAA 2JBMA 4E8GA 3H26A 4AHQA 1R7OA 3E2SA 3DGHA 3ES8A 1FFRA 1AQFA 4JKLA 2V81A 1XG4A 1K8CA 3W1AA 3D3AA 4M6UA 5DY3A 4GCXA 2QCEA 1TRDA 4UTMA 1SSDA 1IT7A 2QMJA 4QE4A 3ITGA 2V2HA 3KVLA 3ZLFA 4E3VA 1DJZA 3KWSA 4UOQA 1BF2A 4QFUA 1LPFA 3LTSA 4X9SA 1RPXA 3E9AA 1FWWA 1SW7A 4J40A 5A8OA 3RG6A 2PRHA 3TC6A 4XKYB 4JFSA 2FPYA 3SM0A 1GZGA 3UPBA 1V02A 2NV2A 3W2JA 5LA0A 5G1YA 1U5VA 1UZ4A 2J27A 4HHMA 1NDWA 4N9BA 2ZZBA 3IRSA 1FO4A 1XC4A 3GNXA 1S5NA 4FNPA 1M01A 5D33A 1KWGA 1AH4A 3UYIA 4OU1A 4WOZA 1PZ0A 3VOCA 2X42A 3F4CA 1TQJA 5K4ZA 3QFBA 5I5RA 1XLAA 4CD8A 2P8BA 4O0KA 5HWJA 4I9AA 1J0YA 4NIRA 1JG9A 3DAQA 5FACA 1J12A 1TB3A 5TBOA 4HNTA 3T0AA 3T4CA 6A3HA 4ZQNA 4GQ0A 4DJED 1CXEA 2R1NA 3UJRA 3CPGA 3DI0A 3WJSA 2NXHA 2ALRA 1RUSA 3RNMA 1W37A 4P7RA 3P0XA 3G22A 3F5JA 1WKYA 5HQLA 1L6YA 3H2NA 3M0XA 1WDWA 1MW2A 4WKHA 1XX1A 3PBGA 4JIRA 3VCRA 5CC6A 3M4HA 2VX5A 4PULA 3K30A 4CQDA 4M56A 3THUA 3LCIA 4TIMA 1QBAA 1ONFA 4S1FA 2WHJA 2PSNA 2DIKA 3NFUA 3VNJA 1XYFA 1CB7B 4X0NA 1DWGM 4BWLC 2FB3A 5FI8A 3LPFA 4Q32A 3AMZA 3QPEA 3STCA 1TREA 3FA5A 5G1MA 5K4XA 2B7PA 4H3DA 1C7SA 4Q7NA 4GVFA 2YDQA 4JBRA 2YCLA 4IQEA 4AH7A 4EAYA 3DG6A 3CEUA 2PURA 1STZA 4J3WA 2Z6JA 3SRFA 3BXWA 5J5RA 3VX1A 4XAZA 1R2RA 2E68A 5G1TA 3N9KA 5AOUA 4ZA0A 3K13A 2C18A 1RALA 3GXFA 3RR4A 1GKRA 1KGUA 3WDRA 2G8ZA 1XQKA 2YBTA 2WOWA 2O0TA 3LXCA 2BV9A 2G95A 4L1XA 1NDAA 3N2MA 3GY1A 1XYLA 3IPWA 3C0QA 2OKOA 4UQCA 4YWSA 3BJSA 4QLKA 5A2CA 1CXKA 1N62C 5DEZA 4G2DA 2GQ9A 3RLHA 4CN1A 3N6QA 3OU8A 4PUJA 4HHPA 3VOIA 4C1KA 4FOUA 3SDOA 2C6QA 3TN6A 3KOYA 1TV3A 1WKFA 5AB3A 4WJ8A 4Q8UA 3R12A 1BYCA 3TN4A 4AU0A 3W7QA 3QLDA 3BGAA 4U5KA 4H4IA 2YZ5A 4IIGA 5DBUA 4PEKA 3W6YA 1IWPA 2Z1KA 4L61A 3TJXA 5CBJA 2WM1A 3WMCA 1KV5A 4K8DA 2YFOA 2WMHA 2WJFA 3B03A 4WSKA 4AEFA 4K1GA 1SJAA 4DAIA 4CCCA 3P5ZA 9XIAA 3N25A 4NHVA 7ODCA 1QPOA 1OG0A 1A5UA 2PE4A 2PI6A 4AQLA 3TV8A 1BSIA 4QAWA 3CAWA 1N5WC 1JPIA 3BJTA 1BVWA 1GVFA 1LG1A 3PVFA 3U9IA 2Y8UA 3DJJA 4MWAD 4GC3A 4J5NA 1S2WA 4V1YA 2V68A 4YCOA 3VA8A 2WQDA 2FZBA 3E5PA 3W2LA 3TCSA 1ZY9A 1FY6A 3CV7A 3LGEA 1R7AA 3CZLA 2FHCA 3AXXA 3QKZA 3W1QA 1XBVA 1YNPA 4KQNA 3H2AA 1F76A 3FJLA 2DQWA 4OBRA 4Q4PA 2I14A 1PZ1A 3QZAA 3AZRA 3LN3A 2BHZA 5GPRA 3WFZA 4AVFA 3D47A 1KFCA 2BGQA 1UD4A 1HG3A 4QBXA 2J6XA 1JROA 2G3JA 3OTRA 4B5XA 3VCCA 1GQJA 4NNCA 3U7VA 2QIIA 1LM1A 4JS3A 1FCVA 4JN8A 3UZZA 1U1HA 4UUIA 4KWUA 5HWMA 1P0NA 2WZHA 1R6WA 4KRTA 1GVEA 4O1FA 2X2YA 4IIHA 3VOGA 5AKQA 3SQMA 2YKKA 1RA0A 3TFCA 5HWNA 1HN1A 4TQTA 1PVNA 3VFCA 1A0CA 1B54A 4L5ZA 7TAAA 3WDQA 4HN4A 3CPUA 3S6TA 1S46A 2E40A 2VX4A 3NURA 3RAOA 5GVJA 1XIMA 5CC3A 5C70A 3VOJA 3O2LA 3ABZA 3AM9A 4MB3A 4MNMA 4XQ6A 4GQQA 4OECA 4HNCA 2WWDA 3BLEA 3CL8A 1N82A 3VD7A 2ON3A 2XIOA 3W6LA 3OZPA 3IGSA 4I8DA 4IP7A 3E5BA 5LNRA 3A4JA 1E0UA 2CXEA 1W9XA 3VNYA 3F2BA 2D20A 3HU7A 2H90A 3WEOA 3GFZA 1N8IA 1SZRA 4M1BA 4D71A 2XG9A 1D8WA 1EA0A 3IAPA 3SCRA 4BKNA 3IK2A 4PMDA 1EGVA 3WLTA 3T05A 4GX9A 3CMFA 2DP3A 1VFSA 2VCBA 3CPRA 1F74A 4QIUA 3WSUA 4JTKA 1GWJA 3O0KA 3QHNA 1TCDA 1O5RA 3ALGA 3HGSA 4YTTA 3NO1A 4UMCA 2NQ5A 2PRMA 4JFUA 3O15A 1YDYA 4DQWA 4XBJA 1CB2A 3KEHA 1MSSA 2RJGA 5E0CA 3SFWA 3B8UA 1WXJA 1Q65A 1DBTA 3L12A 2HJPA 4ZO9A 7CGTA 1TTPA 2FZ8A 3T42A 3M07A 3DBPA 1QW9A 3QFWA 1X97A 1Y65A 3ONBA 2YFNA 1FWRA 3BSGA 2EQ7A 1GQIA 3N4EA 2WMJA 3R89A 1H09A 1WA3A 1IHIA 3DH7A 4UB9A 2ZQ0A 2DSVA 1OADA 3OHIA 5FAJA 1K9DA 5CC7A 5H8MA 1QXLA 3GC2A 1VFHA 3TN3A 4YYFA 3EWXA 1TG7A 3GXDA 3THCA 1E0XA 4EACA 4GG9A 3U2EA 1SJCA 4J57A 1OABA 4BWLA 4H8HA 3AALA 2DSWA 3MJYA 2OPJA 3SN1A 5FESA 4RNHA 1DHPA 4GZJA 3TQKA 1R8LA 2OOFA 1CECA 2YA1A 2GVEA 5ABGA 3L8KA 1B0IA 3S5NA 1X6LA 4JTTA 4KPRA 5FL0A 3GDBA 3BAJA 3R5EA 1DJWA 5BNKA 4QNEA 3GD3A 3INPA 4GLEA 3L0NA 4YIWA 3L4TA 5KETA 1N63C 1HFBA 2DORA 4WX2A 1Q6EA 3GZ3A 3DEQA 3LB0A 2X0HA 3UZWA 3HM7A 1S5MA 2J8GA 4C7GA 3L2MA 3ELFA 1H4PA 1THFD 3PZUA 1B3ZA 4GABA 2W27A 4UCFA 5T26A 1F3PA 4RL3A 2J9XA 3I6TA 3S83A 3ZVIA 5BOOA 1TWSA 3ZQ9A 4FP1A 2J7EA 3GFYA 2YBVA 4M6PA 4HVXA 2V3FA 3OO2A 5DANA 2V3GA 1CW2A 4H9XA 7A3HA 3WLIA 1E51A 3BOLA 1WDDA 1DXFA 1M9HA 1V0MA 1ZUAX 3AUJA 3RYSA 5EMMA 3LPOA 2A1YA 1TPB1 4FF7A 3I4KA 1XJBA 1VIWA 1I1XA 2PD9A 3VKBA 4R27A 2R1PA 1JPKA 5JH1A 3ZFHA 4S3GA 2XH7A 3OHMB 4FLQA 2HWGA 4BEQA 2TSYA 4A4AA 2BY3A 4HK7A 2QCDA 4DF2A 4IOTA 3V5OA 1D3GA 1XLIA 1R3WA 3KXQA 4LOCA 1MOKA 3O8AA 4EPDC 3GG0A 1ISZA 2TPSA 1W9PA 3RPMA 2BX7A 3MI6A 2Y2WA 2HEJA 3M9YA 5LNVA 1A0DA 4A3QA 1XSJA 1CLXA 3AICA 1XLFA 4GI4A 2A7RA 3LD5A 2EHHA 3BPWA 1DIOA 4ZOEA 3RNDA 4DPPA 4LV4A 3GG8A 4GR1A 8TIMA 5AC5A 2WANA 4PTDA 1A80A 4E8DA 2PDLA 6XIMA 5JCKA 2C0HA 2F84A 1LLZA 4LF1A 3OZYA 3MDUA 4UTJA 1EB3A 1GRBA 4J3VA 5F1VA 2AL2A 1C91A 1KKOA 3A4AA 4QQ3A 4GINA 2E67A 4EVZA 1LQAA 3ITOA 2Y63A 2XN1A 1W8SA 2Y7GA 4NX5A 1BFNA 1XG3A 2BY0A 4N9EA 5D2TA 2VOTA 1TE6A 2AMXA 1L6FA 3W7PA 4YMZA 2XISA 2Y88A 1L0PA 3E49A 4Q8OA 1L2UA 1DXIA 1ICSA 4QCEA 1KFEA 1NTHA 1R3QA 2EPHA 3TMLA 3OBKA 4HNLA 1UIOA 2SFPA 4AWUA 5HPOA 2WLZA 4O1CA 4PRRA 1WDSA 3MHFA 1RVGA 4ADTA 1PXGA 2V5JA 4JIEA 1GPFA 3USBA 1CGXA 1PTGA 4JTSA 4UCGA 3QYQA 1M3UA 4GX8A 3TOYA 1WZLA 2J6VA 2W0HA 9RUBA 3SUSA 5TIMA 2VQTA 4B5WA 2XUCA 3DX5A 4G8TA 3LBCA 1KBBA 4J3ZA 2V38A 3M0LA 2ZCGA 3UU0A 3MUZ1 1K70A 4GUIA 3SGZA 4ATWA 3NVZB 4DJDC 3U4FA 1F4HA 2YA0A 3CHCA 3NQBA 3SCQA 3EOOA 1JYXA 4LXFA 1H0GA 3EA2A 4E4PA 1A4LA 3AJXA 4M8UA 1LWHA 2Y62A 4NX0A 3II1A 3GXNA 4M6QA 4Z2KA 4K6AA 5A5WA 3UG3A 3KL5A 1TZ9A 5T8GA 4I6KA 2EKGA 2WKGA 2VGFA 1QHOA 2EPKX 4AMCA 1NAL1 1MO0A 1TR1A 2G5WA 4Q22A 5F4WA 2C71A 1YW1A 3ITXA 1EEPA 2O4QA 3N4FA 2AAMA 2I16A 2P5NA 3KDNA 1SQ7A 1UUMA 1JCXA 4N9CA 1BG4A 4W88A 3AU2A 2ZUNA 3M44A 1JZ6A 4M19A 3KVJA 1VBJA 1F7BA 3AMGA 4GI6A 5IOBA 4ACZB 3AWNA 1QR7A 1S7MA 2B7NA 3XIMA 1V8EA 3VABA 1KM2A 3EDDA 3CV1A 3GS6A 3ARSA 4EM4A 3W0KA 2IKJA 4PODA 4F2UA 1OEPA 4WGHA 3QPYA 1C8YA 4HJFA 1JZ2A 3K8LA 4AZHA 2Y7FA 5HQMA 4CQAA 1TZ7A 3QR3A 5AHLA 3K4AA 1DVJA 2VNCA 3MP3A 3NQCA 3MQTA 3WQ5A 4I8YA 4ZTXA 3B05A 3PN8A 3QMRA 2YVFA 3ZT7A 3UVAA 3RCYA 4M51A 2QCCA 2WOQA 1QDSA 3IJ9A<