3K1GA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ser-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
354
structure length
354
Chain Sequence
b'MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGISH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
molecule tags Isomerase
source organism Enterococcus faecalis v583
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
total genus 124
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3k1gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3k1gA01
2QQ6A 2OX4A 4M0XA 4GYPA 5FJTA 4F4RA 4X2PA 1SJBA 3ENLA 1P48A 3R0UA 4IP5A 2QJNA 2AL2A 3MKCA 2PTXA 4KWSA 4HYRA 3T8QA 3UCDA 3NO1A 3SQSA 3T4WA 3R10A 3CAWA 3N6JA 2OLAA 4GYPC 1RVKA 3H12A 4HPNA 1MDLA 3ES8A 4H83A 1KKRA 3DERA 5ENLA 5BOEA 3CT2A 3TWAA 4ROPA 2RDXA 1TE6A 3RCYA 2PTWA 4KPLA 3OP2A 3CXOA 1KKOA 2QDDA 3TTEA 1EC8A 4JHMA 1YEYA 4G8TA 3N4FA 2MUCA 4MMWA 2QDEA 1TKKA 2ONEA 2FYMA 4M6UA 3NFUA 2PA6A 3R0KA 2OZ3A 2QJJA 1SJDA 2GGEA 5FJRA 3DGBA 1KD0A 4A3RA 1SJAA 1OEPA 4ZA0A 3DEQA 2OQHA 3V5FA 2NQLA 4ZCWA 2XGZA 3GC2A 3H70A 4GIRA 2OO6A 2GL5A 2PCEA 2OKTA 1R0MA 4J1OA 2OFJA 5FJOA 2P8BA 2I5QA 3TOYA 2MNRA 5BOFA 2AL1A 3MWCA 3Q45A 1ECQA 2PMQA 3T6CA 2HXUA 1L8PA 3BOXA 1WUFA 3RGTA 3R11A 5J04A 3VC6A 2PPGA 3CK5A 2PTZA 2CHRA 1MRAA 5FJUA 4K8GA 1ONEA 2AL2B 2GGIA 3FV9A 4FP1A 1ELSA 3V5CA 3FCPA 3BSMA 2OZ8A 1SJCA 3UXKA 3UJRA 3R25A 3RR1A 3H7VA 3TWBA 3TJIA 6ENLA 3MY9A 3VDGA 4FI4A 4E6MA 2PGEA 3MUCA 4MGGA 2DW6A 3NZGA 1JDFA 4J3ZA 1JPDX 3THUA 2PU0A 3QN3A 4HCDA 2P88A 3UJ2A 3VFCA 3UJEA 3TCSA 3I6EA 4IP4A 1KCZA 3OTRA 1F9CA 2OPJA 5EU9A 1JCTA 3R1ZA 2AKZA 2XSXA 3NXLA 3FJ4A 3SN0A 4JN8A 3ZLHA 4HNCA 5FJPA 3RRAA 1R6WA 2QGYA 1MUCA 3SN1A 3OW1A 3ZVIA 4KT2A 3TJ4A 1PDYA 3K1GA 4HCHA 3B97A 1XS2A 3SSZA 3KUMA 4G7FA 3HPFA 1BQGA 2OG9A 3VCNA 3PWGA 4Z1YA 2GGJA 3PFRA 3H8AA 4DN1A 3P0WA 4H2HA 3ZVHA 2P3ZA 3U4FA 2PP0A 3T9PA 7ENLA 3BJSA 3DG7A 2GSHA 2XH4A 3PK7A 3S47A 3S5SA 3IK4A 3IJQA 3JVAA 1W6TA 1IYXA 4H19A 3SJNA 3UGVA 3JZUA 3SN4A 2O56A 2PODA 1EBHA 3P3BA 3QLDA 2GGGA 2P0IA 4GMEA 1TZZA 4HNLA 4Z17A 2HNEA 2XH7A 3DESA 3D46A 2PP1A 3VA8A 3UCCA 4KEMA 4HCLA 3V3WA 4K2SA 3CB3A 3VC5A 4E8GA 2POZA 3OZYA 1EBGA 2GDQA 1FHVA 5IDZA 1MNSA 1XPYA 2PU1A 2XH2A 3D47A 3FXGA 3FYYA 4IZGA 3RO6A 1P43A 3GO2A 3OPSA 3IJLA 3UJSA 3Q4DA 4HN8A 3TQPA 1EC7A 4DWDA 3EKGA 3U9IA 4DX3A 4JN7A 3QKEA 2PTYA 3ZVHB 3CYJA 2FKPA 3OZMA 4A35A 2PP3A 4IL2A 3ZLFA 1FHUA 3VCCA 2OQYA 3DG3A 4IT1A 4DXKA 2ZC8A 1EC9A 2ZADA 3TW9A 2DW7A 3SBFA 4H1ZA 2HZGA 4MKSA 4GGHA 2PGWA 3GD6A 3JW7A 1DTNA 1WUEA 2OVLA 3QTPA 1JPMA 3ES7A 3V4BA 3QPEA 4ENLA 3IJIA 3STPA 3DIPA 2OZTA 3EEZA 4IL0A 3ZLGA 4GGBA 2XH0A 4GFIA 2P8CA 3DDMA 3RITA 3N4EA 3DFHA 3N6HA 4K1WA 3DG6A 3FVDA 3I4KA 3UXLA 4DYEA 4E4UA 3DFYA 2QVHA 1MDRA 4IHCA 3GY1A 1BKHA 1E9IA 2PSNA 1NU5A 4EWJA 1NELA 2QJMA 3I6TA 4A6GA 4GISA 3UJFA 2GGHA 3MZNA 2PS2A 4YWSA 3MQTA 3PWIA 4E5TA 1PDZA 3MSYA 4E4FA 2AKMA 2HXTA 3P93A 4DHGA
chains in the Genus database with same CATH superfamily
1NF0A 1ZMCA 2WK2A 1WZAA 1IXNA 2ZDSA 3POHA 2CEQA 4AY7A 4OUEA 4RDZA 3R0UA 4FO4A 2HTMA 5A5WA 4EXAA 1T8XA 3FG2P 3EOEA 4WKAA 3MCNA 2Q09A 4NAFA 3SQSA 3SRDA 3T4WA 1VQTA 4X0NA 1CPUA 4GYPC 1RV8A 1W5OA 1K6WA 4HPNA 2DIEA 4EQRA 2WJDA 3TYCA 1VB9A 3DERA 1AW2A 1HKKA 1T3QC 4RE4A 4IIHA 3VM7A 3AHVA 2ZA2A 5TNVA 4UTWA 3U5UA 6XIMA 1OX5A 1Q66A 2WHLA 1I2RA 4HHHA 3KVLA 1KW1A 1QU4A 2HNHA 3TYDA 3DYOA 3BURA 3BL3A 4NJHA 3ORWA 2GSJA 4PMOA 5EMJA 3NQBA 3WL0A 3UT0A 1TIMA 1T40A 2NT1A 2PRLA 1TKKA 3M5XA 1H7OA 3LPGA 5CC7A 2EQDA 3SZ8A 3FIGA 2GQWA 4UTUA 1GOKA 4N0RA 2J7CA 3H4XA 4RJEA 3GM8A 1UC4A 1UUQA 5DX7A 3DH9A 3C2RA 4HA3A 1ZCOA 3CUHA 5I02A 5L9FA 3WO8A 2GL5A 1R7AA 4ADWA 1SMDA 3VNJA 5IHRA 2Z1VA 3NGFA 4RX0A 1UD3A 2P8BA 3EA1A 4NAFB 3G0UA 3EDKA 5PTDA 4UTJA 1MFVA 3DC8A 3NIYA 4E4PA 4B9YA 2Q3OA 2NLYA 4KS0A 1KFEA 3CEUA 1XH1A 3TX9A 4QQ3A 2V3EA 5EMKA 4PH6A 3CV7A 4LC8A 3QF0A 4E2OA 4FK9A 3WKZA 6TAAA 4WXZA 2GK1A 1DWFM 4NX0A 3LCHA 2R1KA 3WNNA 3ARSA 1VYSX 4V2XA 4BURA 1L0PA 4MFEA 1CCWB 1SSDA 1SJCA 4Q8PA 4S2BA 2ZXBA 3N2OA 2Z1KA 3L0NA 1PBGA 3PSWA 1Q6CA 3II1A 4E6MA 4CCDA 1XDIA 4NAEB 5BXRA 2WANA 3LPFA 5IDIA 4O14A 4GCXA 1JDFA 5GJMA 3N12A 2O9PA 2QCCA 3OC4A 4J3ZA 4Q4SA 5TBOA 1AMKA 4H00A 2ZICA 2OQLA 3P2VA 3R5EA 3C61A 2H8XA 5DMLA 2OX1A 4CN4A 2Z1XA 2F6XA 3O1NA 3WUGA 3U0HA 3BZGA 3S1UA 1TVPA 3VD3A 5FS6A 4LUSB 5FJPA 1JJKA 3EX6A 4UTFA 2ZC1A 2ZUMA 3B8UA 1KBIA 2WMJA 4H8HA 2OT1A 3K1GA 2JALA 1B1YA 2IPGA 3NVWB 4AF0B 1IT8A 2WW5A 5ECUA 3WQ5A 2GK1B 1EJXC 1UZHA 2A7NA 2WHKA 2P1FA 2Z7GA 1ZDLA 1JROA 3PBVA 1V3MA 2YZ5A 3ATYA 1QOQA 4L9YA 5HNNA 3IGSA 4H4XA 3A3HA 1SUXA 2QYGA 1X38A 2AQOA 3LI1A 3L67A 1MO0A 1JZ4A 4WDTA 3PUEA 1GTHA 2QCFA 1VLIA 3GG0A 4OE7A 3T2PA 3G1SA 1ADOA 3UERA 3W7OA 1BSIA 3MSGA 3DK4A 5A2AA 1F8WA 3NQVA 2F61A 3BW2A 4Q4QA 3DI0A 1X2GA 1LF1A 3L5AA 1E9ZB 5FF0A 4H9UA 2ISVA 2FMNA 3MKKA 1KM1A 4RPQA 2DSKA 1JEZA 3CUZA 4K8EA 3RLUA 4V1YA 4DM1A 3BJFA 2ZZ5A 4DZHA 1GV4A 1VJZA 4IJRA 4DBEA 3T7VA 1V0LA 2IPWA 3LZ5A 1Y65A 3GHRA 7XIMA 1JRCA 3LTPA 1O5KA 5I77A 2CNCA 1EHNA 3SUUA 2DY3A 3BW4A 4YCOA 2V0TA 1XYFA 3W7QA 2W62A 2QEZA 5LGXA 2QIWA 1V3IA 3WL1A 4Q8WA 2IKIA 3QKEA 2CU0A 1HGWA 2FTYA 1VJSA 1U5JA 1PO9A 4AVNA 3ONBA 2YBTA 2PWFA 5GJNA 2WMFA 5C9XA 1JZ3A 2RH9A 4HOXA 2CYGA 4IPJA 3VUSA 4J2MA 3TW9A 1CECA 4AW7A 3VVGA 1MWOA 4AZ5A 1Y5WA 3F2DA 5JCKA 2YOCA 3C3UA 4JIQA 3VNLA 1Z6KA 1EOKA 5I79A 1DQXA 3B4UA 4IQDA 1R9YA 4QLLA 1JPMA 1E4MM 4ENLA 2W79A 3REQA 3VD7A 4JHOA 4W4QA 1KR1A 1HZYA 1L6GA 3POCA 4I9TA 3WLMA 4LW7A 1ITXA 4LCRA 3MANA 2E4TA 3UQNA 2BGNE 4QCEA 4QDMA 4DJFD 5AC8A 4UXDA 2Z6IA 4RK8A 2E5CA 3QY7A 2V3FA 3GHTA 2OR2A 3WLQA 3UXLA 2VMFA 4DRSA 1I1XA 2WZHA 3NL3A 3DFYA 5MF5A 4PMJA 2W61A 3VIGA 3GY1A 5RUBA 1CLKA 3LRMA 1NU5A 4MWAB 3M7SA 3NZPA 1Q6DA 4A6GA 4UFJA 1GVYA 4A21A 3N2CA 4PTXA 4B5TA 1JD9A 4GJJA 1SW0A 3CQHA 2P3EA 3NAVA 4QFUA 4PN2A 4EOUA 4Z42C 4I7WA 3IJ9A 3ARRA 3ABRA 4GE8A 2A8XA 3AUJA 2CZDA 1XIDA 4RNIA 3F4NA 3E02A 4X61A 1ZJHA 4GQQA 3UZWA 1FCBA 4AFYA 1DYSA 4QEEA 3T0TA 4OGZA 3TYAA 1RVGA 3VM5A 1BRLB 1GW9A 4F0RA 5CEWA 4W8LA 3FXYA 4IICA 4O1DA 2DGAA 4N7QA 1OYAA 4RZ4A 2YBUA 5BXTA 5CZ0A 4D6HA 1JZ7A 3MPGA 4E2VA 4BF9A 4LAOA 4GOAA 1A80A 2VX4A 4AZGA 3MS8A 2WPFA 4EPDC 3WJYA 1E9YB 2G3MA 3KW3A 9XIMA 1VD6A 2J9YA 2J77A 4YCPA 1RQHA 2NSOA 3WQWA 4OTKA 4CN1A 1ZJBA 4JEJA 3PJXA 4D9PA 2PLMA 3A7AA 3IGHX 4M29A 1CXLA 4M6UA 2PA6A 1UKTA 2E09A 1Y7VA 1TE1A 1SJDA 2CFFA 1UA7A 4C6QA 4U28A 3TMLA 3NTYA 1GKQA 4A8NA 3UZXA 1G94A 1AUSL 3R58A 2OQHA 2XIBA 4ZCWA 3NEHA 3LQGA 2A0NA 3SADA 1PZ3A 4C6DA 1OFPA 3GTXA 3V0SA 4MUZA 3FGCA 3BLEA 3PNUA 1FKXA 4JZ5A 2YKKA 1IGSA 1UYQA 4NU7A 4YWOA 1YNPA 2MNRA 1KFBA 4EANA 4JTIA 4MWAC 3L4VA 3MWCA 4HU3A 2C14A 1TWIA 2X2GA 4L64A 1KM6A 2TODA 5DCDA 2HXUA 2RJHA 1TYTA 4BY3A 4QG6A 2BMBA 1XLJA 2I16A 2PWVA 4AMAA 5J04A 4D6FA 3NO3A 2PPGA 3QM3A 1KRAC 4AVFA 3WQPA 4LRTA 2EKCA 1OFBA 2NUWA 4KWUA 3O8AA 1QK0A 1VP5A 1FIQB 1R38A 3FA5A 4PL1A 5HNUA 4DJEC 1QFEA 1W9VA 1JOAA 4KFNA 1RJPA 4D6CA 5JBFA 2ON3A 4ZGYA 1XLDA 3DYMA 1TJRA 3CHFA 2NWRA 3QFEA 4O11A 2DEPA 3RO8A 2EG7A 3MUCA 1LCOA 2XIIA 3A5VA 1ZY8A 3OHMB 2OLSA 1JPDX 1K7EA 2D73A 1F07A 1U1UA 1VFLA 1AW5A 3NL2A 2QPXA 4JTRA 4UTLA 3KLJA 4G1KA 4US6A 4M8UA 5DQPA 3S1VA 4XV0A 1YIXA 1XKYA 4NZ1A 3LI0A 1HL9A 4FSAA 4GKLA 5A6BA 2OCZA 2VEPA 4P7RA 1JCXA 1Q6LA 2HCVA 4MNKA 5JIWA 4CD7A 4K7ZA 2W9MA 4NI8A 4ERIA 3O15A 3JU2A 3NVVB 1A53A 4JTSA 3BCJA 3OBKA 5HJXA 3AHYA 2DQWA 1DXIA 4QM1A 3W70A 3W1NA 2DVUA 3ZVHA 3U4FA 1KN0A 4GVFA 1KLYA 1PWMA 1FOBA 3QYSA 3TMQA 5FIPA 4B3LA 2GWGA 1MW0A 3WF4A 1HJSA 4ZXLA 3XIMA 1UQYA 1ZCCA 3I68A 4OBRA 4PUUA 3M0JA 3MV11 1B5TA 5CGMA 1IXOA 5KVHA 4H50A 1NHSA 4U5IA 3EPNA 2C91A 1OBAA 4QJ5B 1RPKA 1FBAA 1QBBA 4O19A 1BEUA 4JDBA 5CC5A 2RHGA 2I7GA 3LSBA 2FGLA 3ARYA 3GW3A 3JS3A 1EL3A 3VO0A 4IX2A 2YA2A 1RCOB 3I65A 1M6JA 4FXRA 5HA7A 5C7VA 2GOKA 4B92A 4W8AA 5CKSA 1SO3A 1TCMA 3GX9A 4GR1A 1J0KA 1WYGA 3RO6A 1OF6A 4CU8A 3QRHA 2C7FA 4DZ5A 2HBXA 1YDYA 3QC3A 1IGWA 1WKFA 3EKGA 3QFAA 2ISWA 1WOAA 3HPSA 1K8CA 1LBLA 1O4UA 2ZVRA 2PTYA 3ZVHB 4ZQRA 4ATLA 2TPRA 4F40A 4P7NA 4X3ZA 3HIJA 3ABSA 3CYJA 3WLLA 3UVAA 1PXGA 2X1RA 5CZKA 3URNA 4PTWA 2V82A 4H4YA 3VCCA 3VIHA 9XIAA 4MZ8A 5D9NA 3HBLA 3VX1A 5A8PA 3NYDA 4PSRA 2QCDB 1QAPA 2PDWA 4GJIA 1WZKA 3LK6A 3QW3A 5E09A 3QR1A 1EP1A 4YTSA 3U5YA 4S3AA 1Z9AA 1DTNA 1UC5A 1WUEA 2PDQA 4X60A 1F8IA 3ARXA 3GRTA 2CBIA 2DSVA 4ML9A 3QMRA 4GX8A 4U10A 4ZO9A 1C93A 3EDFA 4N2YA 2P53A 3CO8A 3HTWA 2V6OA 4C5YA 3RITA 1OIMA 1BVWA 3DGHA 4P7OA 1ZBCA 2VEKA 3PB2A 2C18A 3I4KA 4QNEA 1TSIA 3F5LA 4FR6A 5A8QA 2D3NA 1BG9A 1C9DA 3L2LA 3KRBA 3NXFA 4XD6A 5LA2A 1DIEA 2I5GA 3P84A 1FXQA 1N82A 2VYOA 2YXXA 4MKVA 4G2DA 3RLHA 1TVNA 5U7SA 3IRSA 1W2VA 1GQNA 1YRRA 3NURA 2Y89A 1AFSA 1LROA 4DJFC 4S3DA 3UZZA 3H21A 4EP8C 2O9OA 2OSWA 2CIPA 3B9NA 1H7NA 4LAMA 3VTRA 5C71A 4M0XA 5ABHA 1KGWA 2EEXA 3HV8A 1HG3A 2BODX 4BI5A 3L68A 4HD5A 3M0LA 3KWXA 3KBNA 1E55A 1TYGA 4BEUA 2Z2BA 1NAL1 1XIIA 3ABOA 3PG6A 1KM0A 3SJ3A 3T8QA 1V03A 2NVDA 1ZX9A 1NHRA 4XZIA 2Y5SA 1HKVA 3S4TA 3TAOA 3A4WA 4R7JA 2I5IA 3B9DA 1UP2A 1FKWA 3W2NA 1S2VA 2VGBA 4BI6A 3IVUA 4MY8A 3GD3A 3MW7A 1UD5A 4Y9PA 3TLLA 5G2WA 4BS0A 4JQ4A 3TC3A 1TE6A 4XWUA 3RCYA 1J12A 8RUCA 1VYPX 2PDLA 4UCFA 2CDUA 1W3NA 3TTEA 2WJFA 1ADDA 4JGDA 3OLDA 4PC8A 2WMGA 1PSCA 2PD5A 3BH4A 4ZFMA 4LXFA 2BGSA 1F3EA 1A0EA 2H3BA 2DP3A 3HV9A 3GXIA 4W84A 3ZO9A 4PULA 2XN2A 1KO0A 4FIRA 3KVJA 1AH4A 1EGZA 3L23A 3WLOA 3AYTA 3E0LA 4Z2GA 3QSRA 1EJUC 3VNDA 3PY2A 2C1HA 5HBFA 1AQHA 2ESCA 2XGZA 3WK1A 4XZMX 4B4FA 4N6FA 2XIQA 2EXOA 4TXEA 3WMCA 2EPKX 1UP0A 1XC6A 4LIIA 3W27A 5CC6A 3U57A 2ZUSA 2E68A 5DT7A 3E2VA 3VOIA 4JNMA 4JKKA 5BOFA 3P0XA 3AMLA 1AD1A 4FXSA 2G0WA 4M24A 1OFEA 3WD1A 1GYMA 3NSNA 1F3XA 1GRGA 2PMQA 4GZ7A 1U1HA 1XLCA 4MWAE 3CO4A 3W24A 3BLOA 1D7FA 7CGTA 1X96A 3VC6A 4CD8A 3I10A 4IP7A 4FLSA 3T4CA 3J7HA 1EDTA 3GDBA 2E0PA 4UTIA 3PWAA 3PNZA 1LT7A 1HT6A 2NT0A 3GNDA 4X22A 4K6AA 2WHMA 4ES4A 1GSNA 2ZZ6A 4J3WA 3N18A 2IMRA 1LRTA 2OXNA 3H7RA 3KBVA 1REQB 4A05A 3NDOA 3VIJA 3E96A 1IEIA 3D0CA 1K1DA 3IEBA 1ZRQA 2PU0A 2VGGA 3UJ2A 1ZFJA 3O9NA 1SZGA 4PTDA 3GNPA 6PTDA 4YYFA 3HOJA 2XHYA 4GNKB 2Y63A 3DHPA 1MW2A 1GEQA 4GQBA 1AJ2A 3AHTA 1IIHA 1BSLA 4NAEA 3WQVA 1UKQA 1GRTA 3FJLA 2PLJA 4LCQA 2V81A 5C8BB 1Q2SA 1P0KA 2G8ZA 4JKLA 1XIHA 4WKFA 1OZMA 3T1GA 3MKVA 3TJ4A 1A5MC 2W91A 2OLHA 1H51A 3HG2A 2HVOA 1ZB5A 1LRQA 4IIBA 4N9CA 3W1XA 1TJ0A 2CHNA 3GYCA 3IJ8A 2UBPC 3HPFA 1BQGA 2JK2A 5A2CA 3EPOA 3E6EA 1VFOA 4JTFA 5HPCA 2C0HA 3IANA 1KTBA 2FVMA 4WR3A 3EWCA 1V7YA 4UOJA 1YDNA 1KGUA 1F4HA 2XN0A 1G1YA 2DSUA 4NNBA 4DO7A 2VM8A 1NQKA 3BK0A 2A3HA 1LYXA 4MB3A 3IVSA 3VZYA 2V3AA 3RM4A 4M6PA 1B90A 3HQ1A 1EDQA 4RZBA 2BC1A 4G1NA 2D0FA 4B16A 5DMMA 3H2EA 3W01A 4Z17A 1MEWA 3C4UA 3MO4A 3L0GA 1EZWA 4UTMA 3H54A 1MFUA 3DESA 1X39A 3WBWA 5DELA 5M03A 2INZA 3G0XA 3VC5A 3PHAA 4A4AA 4CLMA 1PTAA 1OC7A 3IARA 1ZBKA 4ZTXA 2VFHA 3QQWA 3S9ZA 4B4HA 4HK6A 4IMFA 1IQ8A 3OPSA 5E1QA 1TPWA 1UWRA 1YYAA 3BLPX 5CBBA 4IUOA 1ZTVA 5B80A 1AVAA 4F0MA 1QPKA 4Q3MA 2ABAA 3KVMA 3W6LA 1B30A 1LLWA 4MIMA 1PKLA 1E9LA 3NPXA 4OQVA 3DBPA 4NJGA 4DYJA 2VHLA 1RHCA 3EDDA 1DP0A 3VZXA 3VDAA 5LSMA 4UR7A 2JKPA 4PCPA 1TPUA 2PUZA 4IMEA 2CLHA 5GPRA 2PZNA 4FNSA 5K9CA 5A6KA 1PKNA 3REQB 4CUCA 1EBDA 2PWGA 1MW3A 3R8GA 1FH9A 3GBEA 1E40A 3E0WA 3TXZA 3V4BA 3GXDA 4XKYB 3DIPA 1QNQA 2F9RA 3N1AA 2OWXA 2XH0A 1J93A 4OOZA 3LD5A 3FSUA 3IV8A 4UQBA 3N4EA 3EMQA 1XRSA 4MWAA 1VHCA 4MOZA 8A3HA 3B4YA 3CC1A 3W1AA 4IHCA 4AYGA 2PDJA 4PSPA 4I7UA 2GJRA 4EWJA 3WD3A 2GR3A 4M19A 2F7FA 7TIMA 1Q1RA 2PS2A 3BGAA 1ZXIC 1W91A 1BFNA 1ODZA 4J4KA 1VRDA 4N6EA 4WSJA 3WZ0E 1I45A 2R24A 4GJ1A 4ZVJA 1NWSA 1AODA 2VR2A 1N5XA 5JQ9A 2WZEA 1H1YA 2ZRVA 5EYWA 4K3ZA 5AYXA 1LQ0A 5BCAA 3MO7A 2QAEA 1FEAA 2IXUA 3H2NA 2VC5A 3M0ZA 4M51A 4GPNA 2Q8ZA 3NO1A 1JCNA 3OGRA 3MJMA 1E3XA 3IAQA 3W7KA 1RVKA 4JS3A 2ZX9A 3SCOA 3W75A 4WGHA 1UP3A 1A49A 3O63A 2Q6ZA 4UOZA 5BOEA 3DFSA 3WDHA 1B4EA 4G6CA 1E4LA 2DIJA 3LHUA 1KKOA 4WLCA 5I03A 1GGOA 4I6VA 3B8IA 3VAVA 1E71M 3DKJA 4RNFA 5CPOA 2WCAA 3IIPA 1WKDA 2NXIA 4MSSA 4IIGA 5FAJA 3EAOA 4J9JA 3NFUA 1A5UA 4EM3A 2G3JA 1OGSA 1D8CA 3RJYA 5D8ZA 3ZSSA 3BANA 1KD0A 1O68A 4Q4MA 1N63C 2V5KA 4PB4A 4JL1A 4XVEA 5C9UA 4K8HA 1OGGA 4PCFA 1JI2A 2PDHA 4JFUA 4R9XA 1JXJA 4GIAA 5TD4A 1XICA 3KFTA 2D0GA 4B5UA 1UBSA 5D4YA 4O0ZA 2QGHA 2PE4A 3P82A 1OINA 1EWDA 2C3DA 3ZZ1A 3GK0A 1BLIA 2B4GA 1PIIA 3DGZA 1RPXA 4HMDA 3TQKA 4HJFA 4WCJA 1K8YA 4L80A 3GDLA 4MADA 1FWBC 1A5BA 3D5HA 1VF8A 3GTFA 1SPQA 1DHKA 5HDRA 3XINA 1EEXA 5LKYA 2XU2A 1O6IA 5LGZA 1CWYA 3C52A 3NVZB 1Q45A 1YMYA 5BXPA 1DVJA 3W00A 4C90A 2DPEA 2PDBA 3RFAA 1YADA 3GHUA 2A21A 4MFDA 4I5UA 1E5JA 4ZBCA 3EUB3 4UTTC 3UR7A 4GC3A 2Y2WA 4PMQA 1A0CA 5ABEA 3LGGA 1E4IA 4TR9A 4I7VA 2OMAA 3TDFA 3RR1A 2GVEA 4NZCA 3VDGA 4JQ2A 2I57A 1I60A 2J79A 2FGBA 2AQWA 4H8NA 2Y6ZA 3QV6A 4OU1A 3M0VA 2GUBA 4XG1A 2R9ZA 3A23A 2ZZ0A 2Z1SA 3L65A 1D8WA 3AMGA 1ONRA 1CEOA 4LCSA 1F9CA 5LHFA 2OPJA 2WMIA 3TW6A 5EU9A 4XD4A 1J5SA 2IQTA 1WKEA 2WKGA 5LA0A 3M64A 3QZ6A 3WF1A 3WH8A 1EA9C 3K30A 3I3DA 4M1RA 2WNNA 1W32A 4FX8A 4FAMA 4LUYA 2POTA 3CH0A 4JIHA 3SEPA 2FIQA 3B8VA 3BZJA 1QW8A 1H0GA 3O0KA 3DK9A 3B97A 1WKYA 5L6UA 4AIUA 3PPHA 1XLKA 3N14A 3WBAA 2QF7A 1B9ZA 4F9DA 4G7FA 2REQA 5D32A 3ARZA 4HU0A 2ZWYA 3LGDA 1RA5A 5MHBA 1K9DA 2DZBA 1POKA 2XINA 3VGFA 4QE1A 1Q6FA 3L9CA 3N15A 4AD4A 3BTNA 4XAZA 2BTMA 3NZQA 3U8GA 4NZ3A 2QUNA 3IJQA 1XGZA 3JVAA 3QJAA 3NDZA 2V3DA 1M5WA 3ECQA 4HSOA 5CXPA 4K1GA 2C13A 2O56A 3E74A 4DUOA 3M9YA 3AIBA 4U33A 4Q8QA 3FDGA 1NARA 4PFMA 3R12A 2GGGA 2QMKA 4LYPA 1Q4NX 3TJXA 4OZOA 2QUMA 4LOCA 3VIPA 1KCXA 1ZSXA 2QUTA 3HFTA 1J10A 3GYEA 4XO6A 4Q8TA 4W8BA 3RIKA 2E28A 1XSKA 4JYEA 3VGBA 4KETA 2J27A 1FHVA 1JUEA 3S46A 3OG2A 1MYRA 3NR0A 3D47A 3VGEA 3P8JA 3KZPA 1JGIA 2NQHA 1ZALA 1P43A 2HE5A 5I09A 4NYYA 3UYIA 3H24A 4AHQA 5HNTA 2FZ8A 3ABZA 2E5AA 1VLWA 1H50A 3P61A 2NV1A 3GB6A 2ZZ7A 5F4WA 1KBJA 3H2CA 2YYTA 4O8RA 2Q02A 3W84A 1FHUA 3NQCA 3OG3A 1UKOA 3PUGA 4MAZA 2BHZA 2X42A 4WHBA 3VDBA 1M7XA 2YYUA 4MZ1A 5IM51 2P5NA 3PZGA 1K4GA 3N19B 5JH2A 1C91A 2GJLA 1K4HA 1KCKA 4UFLA 1CZ1A 5AY7A 4TO8A 1MQPA 4U3CA 4GI4A 3ES7A 1M1BA 2W54A 3SRHA 4DNAA 3PTKA 2RFGA 3S1GA 2P76A 4HYVA 3SCTA 3AO0A 4IUGA 3W26A 4BF7A 1RJQA 5T9CE 1LWIA 1WXZA 4IIDA 3MA8A 3ZMRA 2J6XA 4HTYA 4Z0SA 3AAMA 4W87A 4CD5A 2I1OA 4FEZA 2X99A 2DZUA 2WVVB 3UY7A 2DZXA 1R3TA 1BKHA 1W56A 2GRTA 1VFSA 4GNJA 4LJ3A 2OELA 2C15A 3CL8A 2FPVA 3HGRA 3I6TA 1VQZA 3GH7A 4QDPA 3SGUA 3H22A 1WV2A 1MXDA 4IFRA 1K03A 4C1KA 2FVKA 4WY0F 3UYCA 2YVFA 4QXIA 1O60A 4PRRA 3EB4A 4HA4A 3M5VA 3MP4A 2ZX7A 1HKWA 1JULA 2ZZ4A 4K68A 4RV8A 1GOQA 4ZR8A 3MI6A 4XO7A 4LUIA 1OY0A 1F73A 4U2YA 1Z41A 4AZCA 3CUGA 2G4FA 3WLHA 2UY4A 4L7ZA 5D05A 1FECA 3UZ5A 1P6BA 1XIGA 4KMQA 3N9KA 2BHYA 4C5ZA 2ZX8A 3FGCB 2GJXA 4K8DA 1GESA 2VFEA 4QISA 5HMDA 3NQGA 4H83A 1QCWA 3VKBA 4JX4A 4M1BA 2BCPA 1HUVA 4UQCA 3VGGA 1YTDA 4QBXA 1K9EA 2AAMA 1V0MA 5REQA 1EJSC 4HMCA 2QDDA 2R1NA 3ME3A 4AEFA 3LEPA 3SCNA 3RU6A 1TR9A 4UMCA 1CGXA 4MMWA 3H2AA 5HAOA 4O12A 1I6NA 1TV5A 3QY8A 2L5HA 1N60C 4PRTA 3RN6A 1YQZA 3C0JA 4D6GA 4TOQA 3OA5A 2PDUA 4KRTA 1JCJA 1I2PA 3CU2A 1XWYA 1I4NA 1D3GA 5I00A 1H7RA 5EL1A 3P14A 1FCVA 4CEUC 4QG9A 2XVLA 3BAJA 3A3WA 4DNMA 1TVLA 1KV5A 4GIRA 1VFHA 3LTSA 3MWAA 1XFBA 2VCCA 1JFHA 4UR9A 2EQ9A 3IJDA 4NSBA 1T99A 2I5QA 3TOYA 3I7RA 1G67A 1QW7A 2PRMA 5LXEA 4QGCA 4RPPA 4A2RA 1Z42A 3Q45A 3S2JA 3OQ8A 2AMGA 3MVTA 1Q6EA 3TUUA 3SECA 2EPHA 3DECA 3R43A 1F3PA 4GQGA 3E5BA 2WYSA 4F66A 4LUTA 3RGTA 4MYAA 3R11A 3EANA 3GC5A 3W2MA 3RLGA 2BVWA 3M0IA 1LPFA 2VFFA 3WN6A 3U2EA 2QV4A 4C91A 5U1OA 1VBRA 5AFDA 3TFCA 2PWHA 3IVTA 4V33A 3V5CA 3CHCA 4LEFA 2V8ZA 4O1AA 2FFCA 1DHPA 5HXMA 2BXZA 3FY1A 4EVZA 4IFKA 3H7VA 2NLIA 4TMCA 2WPCA 2QR6A 4XISA 1HP4A 3SDOA 2VGFA 3ARWA 1GVSA 2QZRA 1KFJA 3W81A 1H7WA 2VTFA 2XJ7A 2I9UA 1E72M 1OX6A 4LUSA 1LP6A 2J7EA 3L7RA 3ALGA 3VNKA 1N5WC 3GDRA 3OTRA 2EPMX 2WSPA 3UA3A 4Z0JA 1JCTA 3KTCA 3R1ZA 4BWLC 4PTVA 3KRUA 1DBTA 2PGRA 1F6YA 1NWTA 1BYBA 5K2ZA 1UBPC 3M43A 5AYYA 4O4VA 4DI8A 2QF8A 1S38A 4RLIA 4DLMA 1ZGDA 4HPGA 3O6YX 3TQVA 3W2LA 1XF0A 2Q3RA 4X0VA 1W1TA 1TV7A 1ZL1A 5JH1A 2WLYA 1OX4B 1UMLA 1EWEA 1ZKQA 2XVKA 1RJRA 4H2HA 2P3ZA 3EDEA 1SR9A 4REQB 1H4PA 3V16A 4ATWA 1CX9A 4CQ8A 3L5LA 2Y7EA 3K8LA 1OJTA 3IJ6A 1IR1A 2PGFA 4DF2A 5A3HA 3F03K 4QRNA 4H7CA 3AOFA 4WRHA 2GQ8A 2W67A 4QJ1A 3V75A 3RPTA 2OWCA 1VEPA 3JZUA 5DCBA 3RX2A 2O92A 4IF2A 3TAKA 3OIHA 1VZWA 5AOUA 3JUGA 4H9VA 3KOFA 2BY0A 4PUNA 3QLDA 5CCZA 5CSYA 7REQB 4UTKA 1FCQA 3L8KA 4BHYA 4ACZA 4M81A 4GZJA 1GREA 2HNEA 2NX3A 3CNYA 1RSCA 4HVXA 3UWZA 1QUMA 1QWGA 3UCCA 3V3WA 4CQCA 7PTDA 3CB3A 2GSEA 3H2OA 4HPJA 2W55A 2YLAA 3EA3A 5TAOA 3NYZA 5AHFA 4LYRA 2X8CA 1MNSA 3EOSA 1G9HA 2XH2A 4UOQA 2ACQA 4AYSA 3INPA 1Z3NA 4O15A 1DWHM 1JCYA 1FCUA 1ZS2A 2DZAA 1QPNA 1Q2RA 2NQZA 1G01A 3CLMA 2CERA 3HA1A 2WB5A 3QEZA 2QW5A 3TLQA 5LNUA 4JY9A 4WSKA 1T41A 3LHVA 1FXPA 4J3XA 4C6NA 4DJDA 2TRSA 1UUMA 4GY0A 1CXFA 3NVDA 2Y0FA 3W2JA 3WNKA 2UY2A 4AIEA 3LXBA 2H8ZA 4DNHA 3RX4A 3MSDA 4KW2A 4YHGA 2V68A 2ZZ3A 2LLEA 2O7QA 5M3WA 1OCQA 4P2VA 4RXFA 3W2UA 2ISDA 3WELA 3UZJA 1L6SA 2J24A 4B5SA 4HT3A 1JQXA 4PL2A 1JNDA 2INEA 3JW7A 1LG1A 2OZ0A 5D02A 3CLWA 3E2SA 3I7SA 2C19A 2WLZA 2ZDRA 4DELA 1XIJA 3QPEA 4ZENA 2BC0A 4I9AA 2Y7FA 1KR0A 1W2PA 3ZLGA 4AZHA 4F0KA 2Y7DA 4BK9A 3CS2A 4W86A 1FWRA 3CZJA 4IWWA 1E3ZA 2NV2A 3QMSA 1E6PA 4UNIA 5BRBA 5FOOA 5I07A 5JCLA 2YW3A 4PCTA 3IUIA 1P7TA 4AMCA 1TJPA 4HYWA 4IJCA 4J57A 5JUVA 2E25A 2DVXA 1JDAA 5HMEA 2VUNA 3EWUA 1TRIA 2FB2A 3PJTA 3PWIA 1BWCA 3F2BA 4LV4A 4JDYA 3AUOA 2AKMA 3N73A 3KOXA 3QZEA 1K6AA 4CNTA 4PCSA 4A8IA 4F4RA 4QLJA 3VIIA 2IQDA 4IGSA 2J7HA 3GSMA 1P48A 3JRKA 1NFGA 3M0KA 1YDOA 4IH3A 2QJNA 1J11A 1QNRA 3CL7A 1QI0A 4J28A 4Y9OA 5H8MA 3BQ5A 5FI8A 3GNXA 1R3VA 1V77A 3MMDA 2VEMA 3SR7A 5HMFA 3ES8A 4ADUA 3ABXA 3FHQA 4KCTA 4WZHA 1F6PA 3GNOA 3KVKA 1YNQA 3IV3A 5E5CA 1E5NA 3CV1A 3BARA 4LBUA 3GH4A 3WEZA 1Q65A 3CMJA 1SMAA 4QS6A 4AY1A 2C0AA 3MBDA 3WQDA 1YEYA 3S5OA 3LBCA 4JCMA 3OEXA 1TPC1 4WY0B 1GG1A 1X2HA 2ZTKA 4UZUA 1T5AA 1VGAA 4M5PA 1H3GA 3EXTA 4O1EA 4LB3A 4LVGA 2QAFA 2NWSA 1Y5XA 2VVNA 3AQUA 4AVOA 2V5CA 2WM1A 2Z24A 3V5FA 2Y5JA 1C8VA 1TPFA 4QTGA 4N9DA 1R46A 3A9IA 2PCEA 3MSRA 3PZQA 1F74A 2OWWA 3RAOA 1SU5A 4BJHA 3CIVA 4O16A 3GZ3A 1I75A 2EPNA 2RDUA 3B05A 3MP5A 3SURA 2PFHA 2QAPA 2VUYA 1F5ZA 3CL6A 4GYKA 4O54A 1EUAA 4S3CA 1UR1A 3CGDA 1E0VA 4YTUA 4Y6GA 4LNYA 1HN1A 3LXAA 2DIKA 2PTZA 4ACZB 2CBVA 3ZYZA 4NZFA 3VXGA 3EB2A 2HV5A 4EMJA 2PEVA 2OZ8A 4JNZA 4EMWA 3TSMA 1TX0A 1E1CB 2XFWA 3KLLA 3TN5A 5BNKA 3GVGA 4G5DA 5FL1A 4AD5A 1X7IA 5D2XA 5I3KA 5DXXA 3G3DA 2V6AA 5I24A 3ZR4A 1DJIA 3ZS4A 4H4PA 4MB5A 4LRSA 3OVQA 2J3NA 4IP4A 5T9BG 4UB9A 2ZRZA 3WMLA 5AHNA 2OGYA 4FOJA 2AKZA 5LIXX 3NO5A 1YDVA 3O2LA 1NP2A 3SN0A 3ZLHA 1HXJA 2YW4A 4ZB2A 1ME8A 1UA3A 4TMBA 1S2CA 1ZZMA 4JEQA 5A8GA 3O3RA 4KIRA 4B2DD 4TX6A 1MUCA 4MB1A 3CBWA 1GVIA 2GFTA 1UR9A 4LY4A 3MZ2A 5ER0A 1O7AA 3EX1A 4DO6A 2VI0A 2V2CA 4IMDA 3T09A 4P8XA 1V6WA 2OG9A 3TCEA 3CQJA 2CLEA 1JCMP 4ZE4A 3O7UA 5A1AA 1K4QA 1UD4A 2PDIA 3VDCA 3AYSA 1XR2A 4H4ZA 2WO5A 2ZXQA 2BVYA 1F76A 5E9AA 1E6ZA 2GJNA 2VD8A 2E77A 3LMZA 3ZWSA 2E40A 2CZVA 2FH6A 2E8ZA 3NZRA 4LAZA 2ZZ2A 2CHOA 3SJNA 5F1VA 3BVJA 2Z1WA 1QHOA 1FHDA 5T8GA 1P6CA 3QPYA 4I3GA 2GUUA 3S9IA 3CHEA 4KFOA 3W28A 4YU1A 2ZZBA 1WP6A 3YPIA 1DKWA 1TUXA 3DAQA 4WX2A 4C1NA 1PJ9A 1NHPA 4E3VA 3NUKA 1TA3A 1M41A 1JFXA 3N2TA 1GG0A 3T81A 3NG3A 4K2SA 5KITA 3MBFA 4JQ9A 3OZYA 1K9TA 4LFYA 4EPKA 2GYIA 3Q94A 5EMUA 2YL9A 3WQ4A 2NQJA 4MHBA 2HJPA 1ZUAX 3UCQA 3DFQA 2A3CA 1EC7A 1DEDA 4JN7A 1ITCA 1NIUA 3VKKA 4QLKA 3ZIZA 1GVRA 2F6KA 4ERGA 3C0SA 2E6AA 4ML4A 4BQ3A 4EXQA 4W9TA 2PP3A 3SUTA 3AFBA 1TG7A 1XPGA 1UOZA 1RP9A 1LVLA 3RDKA 2NX9A 3FN9A 1O1HA 4O0QA 3W7RA 2HZGA 5F2LA 1AZ2A 4M7SA 3WD4A 4UTTA 3T2OA 2YL6A 4G9PA 4QSFA 3PZIA 1AH3A 3HQPA 2GVJA 2FHCA 4B90A 2ZXAA 4F2BA 2FH8A 1W31A 4GGBA 1JAEA 4XBSA 3SQPA 3CUXA 3K2GA 5DT5A 1IR2A 3HGOA 2YDRA 1BYAA 4RW5A 1XBZA 1I2NA 5DY3A 3R8HA 2G3NA 3AALA 2FDMA 3DG6A 4JTEA 3DN5A 3KS6A 2WXDM 3LY0A 3GTIA 1JPIA 1BKSA 3BAWA 1S5NA 1WCGA 3WJZA 3PUDA 3VNYA 1W1VA 2YIHA 3G5EA 1KRMA 1KFLA 1GTEA 3ITYA 3HGSA 3M6YA 3B9JB 4BQ2A 2GOUA 3AHXA 5C54A 3NJ3A 3LMYA 2BASA 3TN6A 1YTEA 5F4SA 1TV8A 3CPRA 1WAUA 1CW2A 1PL9A 3GDTA 3W7LA 1GOWA 1GUVA 4ZOHB 2ZIDA 3HQNA 2C16A 4Y8EA 5DN1A 4NRRA 3G1DA 3S2LA 4D71A 3DGRA 1E1FA 5B7ZA 2CITA 1TQJA 3I3BA 3OVRA 3UR8A 1LOQA 3H53A 4MPKA 1R3QA 5KSWA 3GG1A 3E0IA 1I0DA 2Y62A 2OSYA 4KWSA 4PRWA 3RCNA 3UCDA 3LCGA 3KS5A 5HATA 1MQQA 4Y90A 2ZOXA 1R7OA 4C6PA 3FDKA 3H12A 2X1UA 4IXHA 1MDLA 1DJGA 3NDYA 2ATSA 4JL2A 2VD9A 4C6BA 1V0NA 4S3GA 3AIUA 1W3JA 4PUJA 2ATMA 1OCNA 5C9WA 3GXMA 4CNSA 5LHEA 4H4WA 4X63A 1MI3A 4LVAA 1ZAIA 4ICMA 4JFSA 3WK2A 3WSUA 1TUFA 8CGTA 1EO7A 1V3KA 3N4FA 1HP5A 1E0XA 1VBHA 4IPLA 1O5XA 4ZSTA 3HJEA 1WA3A 3DU0A 1XG3A 4HNUA 4Q7NA 3AZRA 1A4LA 1Q13A 4E0CA 3MDUA 1DIKA 3BJTA 1BXBA 4FOUA 4N9BA 3ITVA 2V2DA 1M7PA 3EMZA 1BYCA 4MF4A 2RABA 3PB0A 2VC7A 5CPLA 5G4EA 1FFQA 1AQ0A 2OO6A 4A3YA 1P5BA 1QW9A 4D1IA 1V6UA 3GWQA 4H4IA 5JXQA 2NX1A 5CBJA 4QAIA 4QDWA 3E2RA 1J8VA 4RDYA 4Q8UA 2W66A 3NQ8A 2X09A 2BGQA 3ARUA 1V0KA 4E8DA 1H2IA 5KZ6A 1BZLA 3OGVA 3WF3A 3W73A 4UTHA 1AL7A 4XZHA 2V5BA 1I0BA 1CXEA 4DY1A 1FVPA 3EWXA 4JTCA 5KETA 5CJ5A 3ZT5A 1ZY9A 4P5UA 3H23A 2CHRA 3C2YA 5LIYX 4C1NB 3ZFHA 4RE0A 2YB4A 5E0KA 4XSLA 1W5QA 4NI3A 5CG7A 2HK0A 4H2CA 2EKGA 3MB9A 5I3IA 2O9RA 5C70A 3T40A 4A3UA 3UJRA 1WAWA 4P7QA 3T8LA 2F2KA 3KWSA 3FJNA 4PEEA 1EJTC 1KFWA 4QROA 2BY3A 6A3HA 3UNTA 3NZGA 1W5PA 4FDCB 3TR9A 3PZOA 1POJA 2NV9A 4S38A 1PWLA 1WX0A 2Z4GA 3VU2A 4XSMA 1MXSA 3CZKA 1SGJA 4GXMA 1DWAM 4CNOA 2IKGA 1PZ2A 4OV9A 4IX0A 1UROA 5D03A 4GH3A 1UD2A 2D2OA 3FHAA 1YBQA 1E6QM 1HKIA 4US5D 3W74A 4C7FA 3W7IA 2QCDA 3NOEA 4RW3A 1GZGA 3G1YA 2ANUA 3MI2A 1XG4A 4JCLA 3VOCA 3TYBA 5ABTA 3PWGA 4OBTA 3A64A 5FF7A 2NQ5A 1OFQA 4JD4A 2B0MA 1VPQA 3EB3A 4WGXA 2WMIB 3DG7A 1Z7AA 4NP7A 1RY8A 1TX2A 1NFPA 3OU8A 4PTNA 4FALA 2PDGA 3WNLA 4DWSA 4V28A 3OZPA 3LBMA 3RYSA 3LHTA 2ZUUA 3VYLA 1HO1A 4QJ3B 2PODA 4LS1A 4W89A 1WXJA 5D37A 2QCNA 4REQA 2DDXA 3LV6A 3G1XA 3ZWTA 1A47A 5KMYA 3VGHA 1TWZA 4H3DA 4GMEA 4LVFA 3RXZA 5BXSA 1AQFA 2FHBA 4ZOEA 3IGXA 1I2OA 1CGVA 5DANA 3IK2A 2CLOA 3CV6A 2O7SA 4R9OA 2PWUA 2PP1A 4J7RA 3ANUA 4O53A 1V79A 4HCLA 3U4AA 1DNCA 4R34A 3O6DA 5F4XA 1GT8A 1NEYA 2BSLA 2Y8UA 1EBGA 3RNMA 3CUJA 3DBNA 1YXDA 3WLRA 5C7HA 1TWWA 1DXEA 1LM1A 5AC4A 1QR7A 2J47A 2WKLA 3SM0A 1PUDA 2ZCGA 4MNJA 3UA4A 1EPXA 3LHYA 1VCFA 5BW6A 5FKYA 5AVNA 2FKPA 5DLCA 1XLIA 1JF6A 3C3NA 4JIEA 2ZC8A 3T0DA 3GUWA 3WMSA 1T8QA 3ITGA 2ZRWA 4FZIA 4I6KA 4C7DA 3VE9A 4H1ZA 1CXIA 3M5ZA 3ITTA 3PP7A 4J40A 1UH3A 1SZFA 4YWIA 3QY6A 4EF9A 3QZAA 4NZ5A 2JQXA 1GYLA 1CLVA 4NRSA 1E0UA 5AHMA 2BBFA 3G0SA 5IRPA 1XQKA 3T08A 5FMHA 3DI1A 4KEUA 4Z1BA 3BMVA 5G5GB 3LCLA 1D9EA 3A7UA 1QNVA 4LVBA 2NVKX 4DBSA 3NQDA 2XSBA 3A22A 2Z2UA 4KWWA 3FVDA 5G4HC 1UUOA 5FEWA 3UD6A 1DIOA 3E9AA 1KTCA 5AECA 1XBXA 2QVHA 4LAKA 2QCMA 3MMUA 1UZ1A 4B2DA 5GJPA 2DZPA 3QGKC 2C71A 3MU7A 1N62C 2MANA 2WM0A 3NVTA 1G7VA 3MZNA 4F0SA 1XYLA 1FFVC 4EX4A 2WSRA 3RUBL 2BNJA 3RF9A 1L9WA 1KFKA 3FK4A 3FLUA 3AWNA 1BF6A 1ZLPA 4H4UA 2CETA 3NM1A 4MY1A 1TMQA 2GDUA 3GRSA 1VFTA 4X2PA 3C8FA 5DRIA 2P0OA 3ENLA 3WJSA 2A6NA 5E6ZA 4C6OA 1EP3A 3LLFA 3GR4A 4J2PA 1OK4A 4W5ZA 2PTXA 3T55A 1LL7A 1EJVC 4D72A 4O1BA 2NVAA 4L9XA 2X05A 3G77A 2WBAA 1XD0A 3KRSA 3CQIA 2C1GA 3LB0A 3KOZA 5IXEA 1VPXA 1MEIA 1TR1A 2RDXA 1GRHA 3GNNA 3PBGA 3ARTA 4XAYA 4HHMA 4AU0A 1QO2A 1NDVA 1EXBA 1IF2A 3T2QA 5CBIA 3K46A 1X1OA 3WCZA 1EF3A 2XFRA 4JY8A 3UWQA 1ME9A 3PG8A 3QFBA 1B3OA 1C3FA 2R1MA 4WIWA 3TNOA 3VD4A 3CM4A 1R2SA 4M56A 1NQ6A 4LEQA 2R6OA 3MCMA 1LUCA 3GIQA 4DUVA 4G56A 4IPPA 3DEQA 5JVLA 4FIQA 3ZSTA 2INFA 5A8NA 4O18A 1XIBA 1RXOB 4MY9A 3UXAA 1ISZA 1KNWA 3NEVA 4V15A 4HK7A 4TIMA 4DYKA 3B0UX 5REQB 3VOGA 2WMHA 3GQYA 5F2MA 2PF0A 1S5WA 1ECQA 4F48A 3M0YA 1TV4A 2EAWA 1L8PA 2PDFA 1PHWA 2RGLA 3SY8A 1GKPA 2CBUA 1EB3A 2H3DA 2QVNA 4FLRA 3WUEA 2PDKA 3WQOA 3AZSA 1J0IA 1MZHA 3NSMA 2DSWA 1NJJA 1R85A 2GGIA 1UH4A 3TA9A 9RUBA 3USZA 4DBWA 1OB0A 3RLVA 4JQAA 3D3AA 3TTQA 4H7ZA 5I3DA 2BY1A 3S0CA 3BAXA 5XINA 4NQ1A 3N6QA 1XYAA 4NEWA 2DW6A 3W87A 1E56A 4HNTA 2EJAA 1BG4A 4WVXA 3QN3A 4AXNA 2P88A 4ZE5A 5A94A 1KCZA 2YVJA 2VX6A 1YNYA 4ZFCA 3LA4A 1ICSA 3F5JA 1XYCA 5FEXA 2J88A 1GORA 3BAYA 3BWWA 3VCRA 4WOQA 1UHVA 4WJEA 3FJ4A 1GVOA 4WSHA 4TV6A 4DEFA 4Q6JA 4NG3A 2REQB 4GNVA 4IGNA 4QITA 3MTWA 2GQ9A 3OBEA 4P61A 5CSSA 1EEPA 1AW1A 4LS0A 1QVBA 3OW1A 2VEIA 4YS1A 1ISVA 2PC4A 5IFPA 1JXKA 4UFKA 1DE6A 2PB1A 2ZTJA 4IMCA 1VRXA 4LYKA 1JF5A 3KUMA 3OJGA 4M52A 1FDZA 4MPQA 3AS1A 9CGTA 4H6KA 1IWBA 3AXMA 1PX3A 3S3GA 1HIZA 3O06A 3SUVA 1FY6A 4I90A 3SQLA 4XZNX 3DXIA 2PP0A 1FFRA 4A22A 2VFIA 2VR4A 3I6RA 2W6RA 3V7PA 4NJJA 4LX4A 3SI9A 2WC3A 4FHAA 2PDXA 4JTLA 4EQSA 4BA0A 3DUGA 1XINA 3DX5A 3CMFA 1OCBA 1HGYA 1SFSA 4YVPA 1DQWA 3VOHA 1LOSA 4GC4A 2G50A 1X6LA 2PI6A 1WQ5A 4MB4A 1KC7A 3SW6A 1V93A 2V5DA 2EG6A 4OHQA 2F38A 4PGLA 1V3LA 1KQYA 4HZ8A 1DJZA 4DI9A 4F9JA 3AU6A 1NTHA 1OT2A 4DM2A 2GDQA 2FB3A 2PU1A 4L4OA 3FXGA 1RUSA 1M3UA 5EKYA 5G5HB 3RILA 3GO2A 4DJEA 3BLLA 2I14A 2W3RA 1QT1A 4DVOA 2X50A 4Q4OA 4AHOA 1V51A 1GXFA 4JFWA 4H4VA 1WBJA 1XQLA 4B5NA 3WDJA 2ACSA 1PX4A 3OZMA 2VWSA 1ZBVA 1EP2A 3LBOA 1UR0A 3GKAA 2GR2A 1MZRA 4FLOA 3W7PA 3MC5A 4ZO7A 2ZZCA 4LBRA 5E93A 3AS0A 3S6TA 3N3TA 1MMFA 1AA1B 1PEZA 5F2IA 2BX7A 4ADSA 1NSJA 2JF6A 1RD6A 3NQFA 2X30A 3QW4B 4H6RA 2OVLA 1CGTA 4H8VA 3KP0A 1XYMA 5MKGB 4K7VA 2VZVA 4DZIA 3OZOA 2H9AB 5DFAA 3EXRA 4I8DA 3MHGA 3HO8A 3EKZA 3VX0A 4DJFA 4QQUA 1EFZA 1RR2A 4HNNA 5F1UA 5I3GA 3WEMA 1W9PA 2HISA 3TW7A 2B7PA 1NWUA 2YX0A 2DH3A 1DV7A 1S1PA 2V5LA 4TX9A 3TEVA 1UKPA 4Q8MA 1RBOB 3F4DA 5GNXA 1LOLA 3GKFA 2CLKA 2E6DA 1CDGA 5DMNA 4TVWA 4XD3A 1TTJA 1OWQA 2R82A 2BP1A 4WDUA 3URBA 1NHQA 3EWYA 1M03A 3M0MA 4D6IA 1GVFA 3LHZA 2WQDA 4DZAA 1GWJA 4QIUA 3P93A 1GQJA 2YCJA 2X8GA 1LZOA 3B0XA 5ABFA 1UB3A 2OX4A 3CTLA 3BQ6A 2CXEA 3C2VA 2Y5EA 1SJBA 4CN6A 1W5MA 3W1PA 3ZT7A 2QXWA 3UVIA 1IT7A 2EG8A 1V3JA 5TR3A 2PTDA 2E3ZA 3MKCA 3Q37A 3C0LA 3CGCA 2TPSA 3GXFA 2Y88A 3CTTA 5C2XA 1R86A 2Z1BA 4IQLA 3VUPA 2FMOA 1CB7B 1AG1O 3KBMA 2PDNA 3ZT6A 3G1FA 3WLNA 3MMTA 2GQ3A 1SZRA 3HZ3A 1S5MA 3CT2A 1MRQA 5C9RA 1JGMA 3P62A 2WNZA 3KRZA 1QATA 4X2RA 5AYIA 2W63A 2PF8A 2RGMA 4B5XA 1UH2A 2QJHA 2V63A 1GCYA 1PZ0A 2QDEA 1EJWC 1V6TA 1XUUA 2AMXA 3MMWA 5KZDA 3QV9A 2RJGA 1W1IE 4L4MA 2QJJA 4H8UA 3QV7A 4IISA 1ZBWA 1A5AA 1I2QA 1SJAA 1H09A 3FJ6A 1BF2A 1WNOA 3WIJA 3S1WA 1KBKA 4GUFA 2PD9A 2ASHA 3EF6A 5JIPA 2OKTA 3LOTA 2HQAA 1H61A 1UG6A 3ITOA 1UKSA 2WKJA 5FJOA 2ZE3A 5D09A 3C8NA 3DENA 3GHSA 4GUJA 2AL1A 5HULA 5FS9A 5M5DA 1C92A 1VFUA 4CQBA 2BOGX 4ZEPA 3MYPA 1SZEA 1PZ1A 3BDKA 3BOXA 3WNOA 2J7DA 1WUFA 2IS7A 3BLIA 4HPHA 1R30A 1M04A 3S2CA 4HZMA 2VVSA 5FS8A 3M7WA 4A8LA 2PRHA 2Y24A 2RAGA 3NZ1A 2V5JA 1BHGA 3CIXA 3BOFA 4H9ZA 2Z26A 3TZFA 2ZUNA 3AXHA 2A1YA 4DUXA 4HSHA 3VD9A 4UNKA 1WDRA 5FAGA 3FAWA 1R9XA 3WNMA 1CENA 3TYUA 3U7BA 1N8FA 2RDTA 4JDRA 3KBJA 3B8DA 3M44A 4JTQA 5HANA 1DJYA 1E15A 4TVDA 4PYSA 3N9RA 1OK6A 2BS9A 4H41A 2YBVA 1A5OC 3SGZA 1GETA 3U2ZA 3I4EA 3WFAA 3R07C 4B5VA 2JIEA 2X2YA 1E6NA 4JN8A 5A6BD 4HK5A 4QEHA 4D6DA 2IXVA 1Q8AA 2GR0A 5KZEA 3MI3A 1E6RA 1W17A 3WNPA 5E0CA 2JBMA 4RUBA 3NQAA 1ZP4A 4N4QA 5U4NA 4QE5A 3K13A 3BMWA 4Z1YA 5E6YA 1Z48A 2EO7A 2FDSA 5BRPA 5KZMA 1Q6RA 2VX7A 3OO2A 4YYCA 4XIMA 3WK3A 3LENA 5FL0A 4AISA 2ZA1A 3ZJ7A 3PJUA 1XLEA 3IK4A 5FF4A 1W6TA 2DUZA 4C1LA 1IYXA 5TIMA 1V6YA 4H19A 3PTQA 5EFFA 3ELFA 4LYQA 3B9EA 2CLPA 1XRFA 1GJPA 4W7WA 4CD4A 2VQTA 3P3BA 2WZMA 4QCFA 4NUWA 4P7LA 4MDOA 2IPFA 3U6WA 1TZZA 3W82A 3RU8X 1RLCL 1EOMA 3S2NA 2VRJA 4EM4A 2HMCA 3C56A 2Q01A 2R8WA 3L4UA 2XDFA 1ONWA 3VPLA 2PWEA 3O05A 1WDWA 3A21A 4AUBA 3AICA 3KDNA 4MZYA 4S3JA 1JPHA 4FMVA 3T44A 1TV2A 2WV8A 2Q8LA 2QUUA 5A95A 4BI7A 2IKJA 2NSXA 1J0JA 4HZ7A 1NWRA 4C60A 2XM2A 5C5YA 5I06A 3HPXA 4HQVA 3DHFA 1AD4A 3ERPA 4JR5A 1UQZA 4GACA 1FP9A 2WZIA 4DXVA 3CAKA 3N9SA 4A35A 5FESA 1VBGA 1US0A 1GJUA 4IL2A 3OA3A 2Z00A 4IFKB 2ZXDA 4IT1A 4XZWA 4DJDC 4DXKA 3QBUA 2VO5A 2ZADA 3LADA 1WE5A 2DW7A 2J9ZA 1N55A 3QMTA 3AXKA 1Z8AA 1XLHA 4ORIA 1L6FA 3DCPA 3SY5A 4AZBA 3PAOA 3GD6A 5FJJA 1U1JA 3KE0A 1ML1A 5F2GA 1WYIA 1QK2A 3JZEA 1E70M 3GW0A 4EACA 1IIGA 1GERA 4GRTA 3DC0A 4M6QA 3LU2A 1C8QA 1KRCC 4V1XA 3RJXA 3THQA 1UZ4A 2YA1A 3G1HA 4ZB0A 5LNSA 4PBFA 3EX3A 5CPTA 1O66A 2VFGA 3DDMA 1J96A 4DF1A 3B8SA 5DBTA 1UD8A 5BU6A 3UXIA 1MDRA 3G3MA 3BG9A 2PSNA 1OFAA 5JCMA 1U33A 1PPIA 1EYWA 4KCUA 4Q8NA 2FZNA 2J75A 1CXHA 4I9MA 1S3HA 3VKJA 6REQB 4IOTA 4UQDA 4ORMA 1HKMA 2VP8A 1NDAA 3MQTA 5BMXA 1X1ZA 2W27A 3MSYA 4E4FA 1ZAHA 1PKMA 3NQ7A 1PCWA 3BXWA 5CPQA 3VZZA 4GYPA 1UWAA 1LDCA 1GW1A 2A7RA 3L0KA 2A2IA 1FWSA 3S8HA 4HHPA 4IP5A 3KXQA 4JIRA 3PS7A 3S83A 2QMJA 3S1XA 1SM9A 1YLVA 4N4PA 1CLXA 1JI1A 2HQMA 3UR2A 4R33A 1XH2A 3LUTA 3CUIA 2J9XA 1YPIA 8XIAA 1C29A 1EF2A 3LLXA 3LSCA 1MSSA 1AH0A 4XAFA 4H9YA 4UMAA 2UV8G 3HN3A 3W23A 3CEPA 4JX6A 1C7SA 3FOKA 3IPWA 2QV5A 3GIPA 5E70A 2X0YA 2A3LA 2O9TA 3FX4A 3GVVA 1W37A 1V6VA 4HB7A 1GHRA 2YLLA 1H60A 3OP2A 5D9OA 5T91A 1I9CB 4L1XA 3W1UA 5D2YA 1J2BA 1EC8A 3LM7A 2X8HA 2YXGA 4GQ0A 3G1AA 2VCBA 3DJJA 4L5ZA 1AMYA 2FVLA 5AHIA 2D2HA 1R2TA 1JUKA 4PUKA 4TVYA 3AWOA 5DEZA 4EAMA 3UBPC 4IIFA 3QGVA 4NNCA 2OKOA 4Z1AA 1A3HA 1YQ2A 2H6RA 4ZA0A 3ISIX 1Z69A 1W8GA 3NNTA 3G1RA 1DWJM 1ITUA 4B9ZA 1U22A 1B3XA 3FAXA 1LORA 4C6KA 5D2TA 3EWBX 5I23A 3LDVA 3CMGA 3N29A 5FEPA 5DF0A 2EPLX 4H01A 4JFTA 1MNZA 1U83A 5A69A 5BZAA 7TAAA 3APYA 1HJQA 4W88A 2W0HA 4WK9A 4NKCA 1OHLA 5HQEA 1WDDA 4CNPA 3T6CA 2ISSA 1HF6A 1YW1A 1OYCA 1OQFA 3T42A 3CK5A 3G24A 2W3SA 2PZ0A 2HSAA 4D8ZA 4FB7A 4AZCB 3B0YA 3EAUA 3QGAC 1W1A1 2F8QA 3LG3A 4UCGA 3K4WA 2JIWA 5DXYA 1W1ZA 3SR6B 2A3EA 5I3HA 4W93A 2XISA 2G97A 3UNDA 3NM3A 1JG9A 2R91A 4U5KA 1Q3NA 3WQ8A 4KWVA 1ZJAA 3M6DA 5EBAA 3THUA 2DT2A 3UY8A 2DT3A 4CEXC 3IWPA 3CIWA 1A5KC 1EGMA 2E1WA 4JYFA 2X7VA 4F0LA 1STZA 4XBJA 2OO0A 2J78A 4JICA 3SCRA 2XSXA 1ZENA 1UR8A 1JYXA 4GH1A 5HWMA 1L6YA 4UIOA 2TYSA 4LA1A 4NXKA 2NVCA 2CZ5A 3BO9A 5LNVA 4V27A 1F6KA 4MLRA 4O17A 3N2BA 3OB8A 5E9XA 4E38A 1TPEA 4FX9A 3SGGA 3HG3A 1P1XA 4E2DA 4A3QA 3R79A 1GQLA 4A29A 4FPSA 3G2GA 3QVQA 1KXVA 3GZAA 4KEZA 2Z27A 1GZJA 3E2QA 4H6EA 4CNUA 2HS8A 3E38A 1J2WA 3FS2A 3IIVA 3VKCA 1HX0A 2ISFA 4IXXA 1ECEA 4L4LA 3N2MA 1V08A 3S47A 3S5SA 4YHEA 1HJUA 2DH2A 4GQRA 4RXGA 1ISYA 3KEHA 3NGJA 4AAJA 3V35A 3APTA 3H55A 3SUSA 2VQUA 5CSUA 5J8LA 4PMYA 1LLOA 5G1MA 4L6HA 2HROA 3UP8A 2WPBA 3EGJA 3NWRA 4AD2A 2YCIX 1R2RA 4UUIA 3K5XA 1FWEC 5IOBA 1PHQA 3UG4A 1W1B1 4JIPA 3R7MA 1DPMA 1AZ1A 2ABBA 5DBUA 2HPIA 2W0UA 3GC4A 2HBVA 4M82A 3R8RA 1JZ5A 1OF8A 1DE5A 1ZHAA 1QI5A 3LQLA 4JQ1A 4NT0A 1KCLA 4ZB5A 4BZYA 4KCWA 4HMEA 1K77A 2Z0IA 1RQBA 3BPWA 2BVTA 2J62A 2E67A 2PDCA 3WH9A 2OOFA 4HBKA 4GUGA 4OVXA 1KV8A 4J3UA 1QPRA 4ZQOA 3II4A 2QCEA 1UJPA 2SFPA 4JKMA 1TIWA 3LLDA 5GQBA 2I17A 2J13A 3P7YA 1UWTA 2VRQA 1K7FA 1QI4A 1UIPA 4C6IA 4NY2A 1Q8JA 4QSHA 3ETRB 1V5XA 3FEMA 4Z2IA 1FWWA 4LVDA 3T78A 1RA0A 1H63A 3TONA 1LG2A 4Y7EA 3A47A 4TX8A 1L8NA 3A12A 1BTCA 5JBEA 4CQ9A 1S5VA 3U3HA 3BOLA 4OFCA 4R53A 1FWCC 1XBVA 4UBPC 3WDRA 2BOFX 2PLCA 1DWIM 2H90A 4S23A 4EWND 4HU4A 1K9FA 4E2BA 1DJHA 3EWZA 2ZBTA 4LT9A 2A3BA 4PB5A 4CU7A 2WZTA 3ARQA 2DV0A 1QWKA 1KB3A 1EZ2A 1HL8A 4DPQA 2JEPA 1D7YA 4XTIA 1TYPA 1PDZA 3THAA 5LNRA 2RDWA 2ZFAA 4DHGA 4N42A 3G6MA 4AZ7A 3HW2A 3PBMA 3WFZA 2X1IA 2DORA 5DO8A 3WBYA 4NIRA 2CC0A 5J5RA 5AVHA 2YCKX 2AGKA 2AL2A 3FA4A 5AZ1A 1T7LA 4PMZA 3R89A 3GXPA 3PPGA 1HVQA 3VNMA 2CZEA 2FHFA 3L21A 1KM3A 5J5DA 2XVNA 3PULA 4NEVA 4PMUA 4O13A 2XGBA 1A5SA 1QASA 4ROPA 2WOIA 3EYPA 3EWDA 2PTWA 5IFTA 2WNWA 1EA0A 1W5NA 3CXOA 2XTKA 2VNCA 1X8FA 4BWLA 2XWEA 2GQAA 3BUVA 3QHMA 1T0OA 4YL2A 3MUXA 5C9ZA 1NOFA 5FF3A 2O0TA 4NASA 2MUCA 3WQ6A 4WY0A 5FACA 1QO5A 5HR6A 2Z25A 1YE6A 1Z89A 3OLGA 1WPCA 4LS2A 5HQLA 4UQ9A 4DBUA 3W1LA 3AMDA 3P8IA 3SCPA 4R88A 2WHJA 4YN5A 1W9BM 3WMBA 4FNRA 3A7RA 4UQEA 1GZ1A 4HHLA 1UZDA 2NZLA 3H2MA 1AQMA 5JMUA 5I3FA 3XISA 4PA8A 1ZJIA 3P5ZA 3F4CA 1N8WA 2G3FA 5EPDA 1XDJA 4KKXA 3VMOA 4HA1A 2VR5A 4JTDA 2CXGA 4FF5A 4Q32A 1Q7QA 1G5AA 1GOXA 3F7JA 4UTWC 5HOSA 1BWLA 4KPRA 3N2XA 1CGWA 3RR4A 1TTPA 2ACRA 7A3HA 1OFOA 3C2EA 3W4RA 1Q1WA 2FLIA 5H2ZA 1QI3A 3QHOA 4PB3A 1H62A 1C9WA 2Z28A 2YCLB 3T0AA 3A5FA 3MT1A 2ZYFA 4O1CA 1YKWA 3TOPA 1MRAA 1W9XA 1K3UA 2E8YA 3FKKA 4ECLA 4HOZA 4UWMA 4DO5A 1XI3A 3OYXA 1OIFA 4UQAA 3GXTA 2A5HA 4DO4A 2PBGA 1BAGA 1D7KA 2JKEA 2Y85A 3NQEA 1LBMA 2CESA 4R27A 2DUAA 4EXBA 4HNOA 4OT7A 2X8RA 3Q58A 1QNPA 3K1DA 4LBSA 1E1EA 3TN4A 4WDXA 5K3VA 4A3HA 1QNSA 3BAIA 3C0QA 3TU9A 2D0HA 1FDYA 5TQLA 4EQWA 1G4PA 2PDYA 3OQEA 5HK4A 1KQZA 1JYNA 5CZTA 3SFWA 4XVDA 3WLTA 1BD0A 4ZQMA 3G8EA 2HWGA 4YJ5A 1TELA 3QFWA 1XDLA 2D24A 3M16A 1XISA 3M0HA 1ZK7A 4H6QA 5C55A 1KM4A 3GAKA 6ALDA 1QJWA 3ABQA 1GKRA 2FZMA 1S39A 1OC5A 4HA0A 2HE8A 4GI9A 4I9JA 5K9DA 4OBSA 4INFA 3B8WA 3NQ2A 2A85A 3IIZA 2WOWA 2CZFA 2QIIA 2JEQA 2VOTA 2QT3A 3C2FA 4LUJA 1MVYA 2GH5A 3NCOA 4URIA 4GBUA 2VC6A 3WJWA 3GTHA 7ENLA 3WUFA 3M46A 4GK8A 3USBA 3ZM8A 4LGXA 2XFYA 3UGVA 1IZJA 1W3IA 4MLJA 2QDGA 1RALA 3W6YA 5EGRA 2O4MA 3WH5A 5AZ0A 1V6XA 1TPVA 1P0EA 3SCWA 3WEOA 5C6MA 3TTYA 1C90A 5HR7A 2IUZA 2HPMA 1XLGA 3W71A 3F4VA 3BG5A 3SCSA 3KTXA 3W2KA 1XL9A 3VA8A 2BZNA 4L6DA 4KEMA 5F7UA 1EX5A 2VZTA 4GG9A 4ZODA 4A8RA 3SB0A 2YCLA 3CQ0A 2V3GA 4XUYA 4Z1CA 2WOVA 4TUFA 3WLJA 4IZGA 3OVPA 3MUIA 2VELA 1JCLA 3UETA 3ONCA 1MW1A 3A6OA 4MNMA 1L2QA 1PKYA 3TV8A 2HRWA 3C86A 4HU8A 1BQCA 4OV4A 1DXFA 3PTDA 3PG9A 1XC4A 1TMHA 5CLTA 1SFLA 3HU7A 3NL6A 2ZRYA 4EMIA 4GIEA 1VIZA 2VOMA 3LERA 4GIYA 4HSNA 3HF3A 1EDGA 3WF0A 4LB4A 4AEOA 4Y8FA 1UJQA 2YA0A 1QRQA 1SQ7A 2PGWA 1ICPA 1TJ1A 2YXOA 4GRSA 2WPEA 2XZ9A 1C8YA 4IG2B 5H6HA 3QXBA 2ZKMX 4BEQA 4I5XA 1SZNA 3TXVA 1XKJA 3IJIA 1R87A 1EQPA 1FWIC 5AYBA 2B7NA 1TZ9A 3ZXWA 2VDHA 4GFIA 3Q2DA 2JFEX 4AIOA 4PUEA 4CCZA 4DAFA 2D3LA 2G96A 3N6HA 3ZQ9A 3V0UA 1YX1A 4DYEA 3AHZA 1J6OA 1YXCA 1JZ8A 5A2BA 3GU9A 1FWDC 1NELA 4QHRA 4JAWA 1P0BA 4BQ5A 3M47A 1HVXA 3NPVA 4BFAA 4YWSA 3I3EA 1FDJA 1YPFA 4LANA 2NUYA 3BGGA 1WOBA 1XIFA 5C2CA 4GY1A 5BROA 4O28A 4ZSUA 2NW0A 2Y4SA 4JNYA 5FJTA 3T0CA 3CZLA 3SO7A 3TSDA 2Q71A 1XANA 3TTOA 4JX5A 5JBDA 1Z32X 1IEQA 1DOSA 4H9MA 4PMNA 1IZCA 3U7VA 1Y8BA 1TRDA 1G69A 3W76A 1Q4WA 4FOKA 3TC7A 1VJIA 3HG4A 4Q8OA 1FTXA 4OECA 1LBFA 4NNAA 1UCWA 2FTPA 3QPZA 5I7GA 2OT0A 3SRFA 1BPLB 4FNPA 1H7PA 3P5YA 4GO9A 1PIFA 2Y8KA 4B91A 3W1QA 4DAIA 1J4EA 4EK7A 2D1ZA 4M80A 2ALRA 1DXLA 4TV5A 4C6FA 1B3WA 3W72A 3UU0A 2D69A 3VABA 5HWJA 3L2IA 1R3WA 4U2ZA 5D9MA 3R0KA 1J01A 1KXHA 4XX6A 3U48A 4PZVA 4PEKA 4YLWA 2ZUWA 3KAOA 3G6LA 1K7XA 1VCVA 1JYVA 5FSEC 4K38A 3EMCA 1SSGA 1PAMA 1TPB1 1YE4A 1DJWA 5HWNA 1DJNA 3RHGA 3B9AA 3K8KA 2GJXB 4ICCX 2YDSA 1KM5A 3LNMA 2AAQA 1PE1A 3VNIA 4UFIA 2GLKA 3WDQA 3GD4A 1RQEA 3BGJA 3DFTA 1R8LA 5LIUX 1XLLA 4LC6A 5D33A 4WEVX 4DWSC 3RPDA 3VIKA 2GJPA 2NQ9A 1EHAA 1S3TC 3AC0A 1W9DM 4NYUA 3MUZ1 4MDPA 4AZ6A 4X9YA 2QNEA 1XSIA 2E5DA 3PZVA 5G4WA 1OFRA 2X0HA 2EQ8A 1LUCB 4MKNA 2BWGA 3W0KA 5FJUA 2G5WA 3R13A 3ARVA 2DZWA 1JAKA 4AXKA 3AYRA 1ELSA 4KF1A 2D22A 1GNXA 2PURA 1RBAA 3UXKA 2QDHA 2V9DA 3EZ4A 1P4CA 5SWUA 2WC7A 2YQUA 4RL3A 3ARPA 1H6VA 4AEEA 2J25A 4GY7A 2J4GA 4L6OA 1LL6A 4K37A 4AIBA 3M41A 3PZUA 2A79A 4HCDA 1DTUA 2IW0A 1F2JA 2VDGA 3TCSA 5H8UA 3LNPA 3IJ7A 4GZEA 4CQAA 8TIMA 1GPWA 4HMNA 3HGJA 3P60A 3LCWA 5M1TA 3VIMA 4MTVA 5CPMA 1NDWA 3S42A 4OKDA 2R94A 1WDQA 4GFSA 1QMLA 4PTMA 4FNUA 1IEXA 3W88A 3ZJKA 3N13A 4AB4A 1OG6A 2TMDA 5LNWA 5K9XA 3WDPP 4AF0A 5HUPA 1YHTA 3FYOA 3WBXA 4W7VA 2OYKA 4PODA 3VKAA 1XSJA 1E0WA 3AROA 3QOMA 1J5TA 2OEJA 2ZRUA 2XM1A 4O50A 3DK8A 1PV8A 4LUTB 2GSHA 5CH9A 2YZRA 4YTTA 2ZWZA 4PUDA 1NPXA 1SVDA 2QJIA 2QPSA 4WJ8A 2NXHA 5XIAA 1S7MA 4OJYA 5HPOA 4UFHA 1BXCA 3GVRA 3CV2A 2WWCA 3TYEA 3RRXA 3WQCA 1H0IA 3G1VA 1X97A 4MJ2A 3ZJ8A 3B0PA 1AJZA 5AKQA 1GEUA 3HG5A 5A6TC 1FH7A 2PAJA 4OOUA 3W07A 2CPUA 5BYWA 4HOWA 1KWGA 4AY8A 5GNZA 1XLMA 3DFNA 1R9ZA 3PBWA 2C1IA 3BV7A 1ZP3A 2Y70A 3O07A 3MP3A 4Z1DA 3NSXA 2V3BA 3IGUA 3W6MA 1XFCA 1VHNA 1IXQA 3S5NA 3TZNA 3AIRA 5CZSA 4AWUA 2XVGA 1ZAJA 4DPPA 3L4ZA 2B31A 1E73M 5E0FA 3CT7A 3RX3A 3UJSA 3LX9A 2YDAA 4L61A 2BDQA 4DWDA 3TTSA 3L2MA 1S46A 1WB0A 3SCQA 2UY5A 4PE8A 1SR0A 5FEZA 3DFOA 2VZOA 4UZSA 1GRAA 2E6FA 3GDKA 5I6SA 1GRBA 1FWHC 4IQJA 1G4SA 4LTSA 5B7YA 2VENA 2XG9A 1XXXA 2X41A 3S9YA 1R5YA 2BY2A 2XN1A 3HB9A 4LF1A 2F84A 1ICQA 1ITQA 1X1NA 4O4WA 1J18A 4JTTA 3UPBA 3UXDA 1I8JA 3HQOA 2XZ7A 1WZLA 4AX6A 3B06A 2CLFA 2V69A 3STPA 1UR4A 2OZTA 3LPOA 1QPQA 3MUY1 4MYXA 2Z2AA 3GU1A 3O16A 5D38A 1AK5A 4S3KA 3GAYA 4J3TA 4LY8A 1RH9A 1W1PA 1R3SA 2OOGA 3VGDA 5CQ1A 5H1WA 2W5FA 1X98A 4E4UA 5EBUA 4NJKA 3UF9A 2VDIA 2D20A 3AMKA 3COTA 1QI2A 1KA9F 2A3AA 4MM1A 1E9IA 5EY5A 1CNVA 3W53A 3A13A 2QJMA 3KCOA 4XQ6A 4NF7A 3QOKA 3ANVA 1SFJA 1B3YA 4K36A 2Z29A 4CQDA 2C79A 5MKGA 2XWDA 4GWEA 4YIWA 4AG0A 5CJMA 1YTKA 2QCLA 4TQTA 2JK6A 3NRZB 3KM8A 4GO8A 4C6LA 3URQA 2VZSA 5M2FX 1N2VA 3K4AA 3AXXA 1EJ7L 4MG4A 3WQFA 4XKMA 1UWSA 2D23A 3PZ9A 2C3ZA 5U25A 2WWDA 1TZ7A 3R2GA 1NY1A 1JL8A 1XHCA 2WCSA 3W22A 1VAHA 1IXPA 1TCDA 1V59A 1G4EA 4B3ZA 4NILA 3R10A 4AWTA 3FA3A 1X6UA 3CAWA 3N6JA 3WQGA 1RY0A 1TV3A 5IHSA 5EA9A 3STFA 3GG8A 4GI6A 4C6CA 2VX5A 1G7UA 3OLIA 3UEQA 5I0DA 1H1ZA 3PN8A 4RR4A 1XGEA 1UMYA 2OB3A 4Z2JA 3T0BA 4L1WA 3WG6A 3RPMA 4IFOA 3RK8A 3Q6JA 3BC9A 4C6MA 3IIXA 3TNBA 4Q8VA 1W3LA 3H26A 2DZVA 3F4WA 4G8TA 2B7OA 3OGSA 1LWJA 1FEBA 3UW6A 1FFUC 3N17A 1ISXA 4HPXA 1B2YA 2WSKA 1KXQA 2NUXA 4R85A 4GXWA 4WOZA 1S2TA 4C6EA 4XKYA 3ALFA 3AMZA 1OG0A 3LGEA 5EMMA 5BU9A 2GGEA 5KTLA 3L5OA 4A3RA 5D8WA 5CG0A 2FJKA 3VE7A 2XIJA 2FJUB 3OBAA 4XBKA 1AL8A 1LL4A 2WSYA 3ICJA 1L6WA 1KTNA 4GLEA 1PIGA 1R47A 3HMCA 1CI1A 1XP3A 1DJXA 2WCGA 3CHVA 4IPNB 4XZBA 1HQTA 1OFDA 1QTWA 2YL5A 3O0FA 1XD1A 2DJLA 3PFMA 1T96A 3ITXA 3BV4A 3E3HA 1EYEA 3O6CA 3S6OA 2WVTA 1VBJA 2VT0A 4LF2A 3WBEA 2O4QA 1NVMA 1B4KA 3MDWA 1QHPA 4HNVA 4C7GA 4FLQA 4MJ4A 1DWGM 4HIBA 3TR2A 1ALDA 3IACA 4S2CA 1TWDA 4DB7A 1QOPA 3WUBA 4DWSD 3TFXA 4MWAD 2IQ0A 3FCPA 3W7HA 3BSMA 3EOLA 3R6IA 2X1TA 3U2CA 3K4DA 1IT0A 3TWBA 1WXYA 3TJIA 1VBUA 4FX7A 1QDSA 2QCHA 4XZLX 3WFLA 1OJXA 1R3RA 4HP5A 5HJYA 2XIOA 3S5ZA 3N25A 3GFXA 4W85A 4JTGA 3VFCA 3ID7A 1S2UA 1SFTA 4DJED 4IGMA 4JN6A 2VCAA 3W7NA 3EOOA 1OABA 3KDOA 1LJYA 1QOXA 3DH7A 1SO5A 1JVNA 3OLEA 3MHUA 4B5WA 3Q65A 5D2VA 3UG5A 4KCVA 3LCFA 3ITCA 3VOFA 3OOQA 2V67A 1GQIA 3KZSA 3R4IA 2GVYA 1BTMA 3UG8A 4FX6M 1FHLA 5CZJA 1CB2A 5CPNA 1GK8A 2HVMA 6CGTA 2P50A 4K7YA 1RCXB 4IM4A 2CKRA 2QUVA 4ZL1A 1HL2A 2GGJA 3H8AA 3CWNA 2YDQA 2VXNA 5CC3A 3BJSA 4DIAA 4QG8A 3BCFA 3OHIA 4MJMA 1J9YA 1TQXA 4YVVA 1ZU8A 4AC7C 2YFOA 2YVGA 3RG6A 3L5MA 3H4KA 1Q85A 2QLYA 1U5VA 4QP0A 2WBGA 3MCOA 3CAQA 3HJZA 1XDMA 1VYRA 1UWQA 3EXSA 5EB8A 3D46A 3AZTA 2PDPA 3UPWA 1EO5A 5K4XA 2UWFA 1N7KA 2ACUA 3W7EA 4FS9A 4UMBA 3U2OA 2QPUA 4UNLA 4JTKA 1C8XA 1GRFA 2PLKA 1T6MA 2WP6A 5D30A 3MV01 2E6YA 3CYVA 3AS2A 3CB8A 3N3MA 4HN4A 3TKFA 5JRBA 2G37A 2ZE0A 2VRKA 1IEVA 4XZ9A 5LZLA 4XTDA 3GU2A 4HN8A 2DZTA 3TROA 3W38A 2C3CA 1PB0A 5G2HA 1JDEA 2OEKA 4HZ6A 3V1HA 5HNRA 1HJWA 4E3TA 4LALA 3OIXA 2WC4A 3HRDC 1CT5A 3GFYA 2DJXA 3EKLA 4J56A 1NDZA 2WVUA 1ZQ5A 4N02A 4PMRA 4IG2A 2F5ZA 2OTDA 3TH6A 5A6JA 3PBYA 3GVWA 4DXXA 3L4TA 3M4HA 2PCQA 1E0TA 1NF7A 1N8IA 3C5QA 4CGTA 1GVQA 3C2OA 1P0DA 1V7AA 3VIOA 1E51A 1HJVA 1LWHA 2J7BA 3KCLA 4EKJA 3WD0A 1P6WA 4KGJA 4DLFA 1B0IA 2VKZG 4J5NA 3PZNA 2E5BA 2QS8A 3ZJ6A 3P74A 1QHZA 3KHJA 1HTIA 1VDVA 2NPXA 1KM2A 4IQEA 4CCEA 4AWEA 4CKQA 3KX6A 5KEZA 2BXYA 3W83A 2FFIA 1W3HA 3M0XA 3MJYA 2A6LA 1W3KA 4WD0A 3ZOAA 4RV3A 1OADA 4KWOA 2J8FA 3PC0A 3ANYA 1PVNA 3HURA 4ZQNA 4L56A 1IWPA 1L2UA 2ZX5A 3UJFA 4RDVA 1IHIA 4TTGA 4KH2A 3AJ7A 4FA3A 1MXGA 2HDJA 2FPTA 1LLZA 3WDIA 5AB3A 5CGQA 1G6CA 1EX1A 1ISWA 3T05A 1I1WA 1TWSA 3PPFA 3QQ1A 4F8XA 3IC9A 4XAPA 3SCUA 5ABFB 1F05A 3W85A 3AI0A 3WENA 3LHWA 4PFHA 1JRPA 2E3TA 3TYZA 4F3HA 4Q4PA 1RK6A 2QULA 4S1FA 3V5OA 2CWNA 1PYMA 5BOOA 1PX8A 4JTJA 3VNZA 4AD0A 1CGYA 3W86A 1IE7C 1HNYA 4D1JA 3AIVA 3GH5A 3W37A 3PM6A 6REQA 3UPMA 7ODCA 4TVCA 4XD5A 2DUXA 4HKPA 2WOQA 4RZ5A 4MJZA 3BSGA 3V0TA 1MO9A 1TFVA 1REQA 4KGLA 3QSTA 4KPLA 2W3ZA 5FA5A 4GABA 3MUAA 3VMNA 1GOOA 1XBYA 4JHMA 2G3IA 4FF7A 3D9XA 3CUFA 4BKNA 2CCRA 4HTBA 3CPGA 2Z7KA 1BWVA 4K39A 3SAZA 4JIIX 2AQVA 4Z2LA 4RE2A 2OZ3A 1CYGA 1X8CA 4R5EA 5TF0A 3HMJG 1UOKA 2X40A 4G7EA 2WJZA 3W1TA 4ONVA 2DT0A 1OM0A 2NQLA 3L4YA 1J0HA 3GC2A 3H70A 2VZUA 1XCXA 4QX4A 4U4MA 2Y1HA 2FZBA 1J0ZA 3KBSA 3NQ6A 2X0SA 4C65A 2WVVA 3CGBA 2OFJA 2WQPA 5A6LA 1QXLA 1DIDA 1GOIA 3NPWA 1OC6A 2WSQA 1LTDA 2HS6A 3WH7A 2VL4A 1BYDA 2OYLA 5EMLA 1DQUA 1H5VA 2VEGA 3IUDA 1JRBA 3O6AA 4H9XA 3HM7A 1N61C 3GR8A 1VKFA 4F79A 3NPUA 1RM6B 4CCCA 2ADAA 4LSBA 4H4RA 4Y9NA 2HVNA 4WKHA 5T26A 3EPMA 1V3HA 5AC6A 3WYZA 1AJ0A 1FX6A 2PBOA 3SIMA 4FP1A 2WNQA 1YBQB 3GBDA 4D8LA 3VK5A 5CLWA 1D2KA 2BLEA 3PTMA 2GWNA 7REQA 1M6IA 3B8TA 2YAUA 1IV8A 1OT1A 4H4QA 3URHA 4FXJA 1E6XM 4YTQA 4FI4A 4EQXA 2ZUVA 4BCEA 2GVLA 5G5IA 4WJXA 1V4YA 3LV5A 1PTDA 2E1DA 4H04A 3E0FA 2QKFA 2WP5A 1CTNA 1BWKA 1JQVA 1ESWA 1EIBA 2EBNA 4O0KA 3H4WA 4BQ4A 3IRDA<