3K1GA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ser-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
354
structure length
354
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
molecule keywords Dipeptide Epimerase
total genus 124
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3k1gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3k1gA01
3MZNA 4KT2A 2QJNA 2PTXA 4GGHA 3NO1A 7ENLA 2QVHA 3I4KA 3RO6A 4A3RA 3ZVIA 3GO2A 4YWSA 3VCNA 4F4RA 3JZUA 1YEYA 2OZ8A 3R25A 1SJCA 2GGIA 3H8AA 3CYJA 2GDQA 3DDMA 3GD6A 1TE6A 4GYPA 3N6JA 2HXTA 1JCTA 3SSZA 2PP1A 4GFIA 4JN7A 3R0UA 1ELSA 2PU1A 3JVAA 4HNLA 4ENLA 3UJSA 3QTPA 3IK4A 3B97A 2FKPA 1JPDX 2PU0A 1P43A 5BOEA 1KKOA 3ENLA 3T4WA 3GY1A 2GGEA 2GSHA 3DG7A 3V5CA 3R11A 4IHCA 4ROPA 3TTEA 5IDZA 3I6TA 4K2SA 2AKZA 2I5QA 1WUFA 3CB3A 2OG9A 1PDZA 4EWJA 3TJ4A 3V5FA 4DYEA 2XGZA 3ZLGA 1SJDA 3UXLA 4E4UA 3VCCA 2OVLA 4IZGA 3TCSA 3K1GA 3H7VA 1TZZA 1XPYA 2GGJA 3Q4DA 5FJUA 1JDFA 3RRAA 4DHGA 2P88A 3V3WA 3ZVHB 3U9IA 2PSNA 3S5SA 4ZCWA 1BQGA 3DFYA 3STPA 1R6WA 4G7FA 3QKEA 1MUCA 4IL0A 2HNEA 3TWAA 4Z1YA 3BSMA 4HCHA 3EKGA 2PGEA 3RCYA 4J1OA 2POZA 2GGGA 4DXKA 2PTWA 4A35A 1KCZA 1KD0A 3SQSA 5FJOA 3MUCA 3H70A 3DG3A 3P0WA 3R0KA 1FHUA 1BKHA 2P0IA 1ONEA 4H19A 4H2HA 3DIPA 2PTYA 3UJFA 3DEQA 3PFRA 2DW6A 3TOYA 3NZGA 3PWIA 3ZLHA 2AL2B 1OEPA 1WUEA 3D47A 3SBFA 4A6GA 3UGVA 3ES8A 2OO6A 2HXUA 4E4FA 3VDGA 3IJIA 1EC8A 4G8TA 4M0XA 3RITA 2QDEA 2XH2A 1MRAA 4KPLA 2OZ3A 2QDDA 3TW9A 3DESA 3ES7A 4IL2A 3UJRA 3FYYA 2OQHA 4KWSA 1EBHA 3MY9A 1P48A 3RR1A 3VFCA 1JPMA 4GYPC 4FP1A 2P3ZA 3BOXA 3CT2A 1PDYA 3N4EA 3OPSA 4Z17A 2PTZA 4HN8A 2PP3A 3N4FA 5FJRA 2PCEA 2CHRA 3CAWA 1KKRA 3DGBA 4ZA0A 2PPGA 3R10A 2OFJA 2PODA 6ENLA 1SJBA 3UCCA 1F9CA 3OTRA 2PA6A 3P93A 3P3BA 2PGWA 5EU9A 5ENLA 2XH4A 3H12A 4IT1A 2GGHA 1W6TA 3ZLFA 3FXGA 3HPFA 3QN3A 1XS2A 1ECQA 2FYMA 3QPEA 3PWGA 3T6CA 2XH0A 2OPJA 3OZYA 4GISA 4MKSA 3SN1A 2RDXA 3N6HA 4FI4A 1RVKA 2MNRA 2P8CA 4DN1A 5BOFA 1FHVA 4HCDA 3UXKA 3VC5A 2QJJA 1TKKA 1EBGA 3D46A 3NXLA 4K8GA 2NQLA 3SN0A 2AL2A 4E8GA 3TWBA 2ZC8A 3FV9A 2O56A 3TQPA 2XSXA 4M6UA 3OW1A 1EC7A 5FJPA 5J04A 3SN4A 2AKMA 3THUA 3PK7A 3MSYA 3OZMA 2OZTA 4H1ZA 4HNCA 3MQTA 3UJ2A 3UCDA 3GC2A 5FJTA 3MKCA 4GMEA 1R0MA 3CXOA 3DG6A 3FVDA 4DWDA 3CK5A 4GGBA 4E6MA 1MDRA 2XH7A 4JHMA 3KUMA 1MNSA 4GIRA 1L8PA 3T8QA 1IYXA 3VC6A 3JW7A 3V4BA 2AL1A 3NFUA 3QLDA 2OKTA 2PP0A 2ZADA 3MWCA 4MGGA 1EC9A 3DFHA 1DTNA 4KEMA 3T9PA 3I6EA 3S47A 4J3ZA 3VA8A 4H83A 2MUCA 3ZVHA 2QGYA 3FJ4A 1MDLA 4K1WA 3RGTA 3R1ZA 4HYRA 1NU5A 4E5TA 2PMQA 2OX4A 3Q45A 1E9IA 4IP4A 2QJMA 4MMWA 2QQ6A 3UJEA 4HPNA 4X2PA 1SJAA 2PS2A 1NELA 3DERA 2DW7A 3IJLA 3U4FA 4JN8A 3TJIA 3FCPA 3SJNA 2GL5A 3IJQA 2ONEA 2P8BA 4DX3A 4HCLA 3OP2A 2HZGA 3EEZA 4IP5A 2OQYA 3BJSA 2OLAA
chains in the Genus database with same CATH superfamily
1CZ1A 4I5XA 1EUAA 3WLNA 2VFIA 4D1JA 4RDVA 2ZVIA 4LRTA 2BVDA 7TIMA 4QTGA 2QVHA 4QDWA 4NI8A 5IHRA 4MY8A 3QW4B 2XWDA 3AISA 3OVRA 4NG3A 4X9SA 1TPB1 2R1PA 4C91A 3N2TA 3DYOA 1K9FA 3KM8A 2KZHA 3AIUA 3GUWA 1S5NA 4IGNA 1V02E 1ZXIC 1AJ2A 1B1YA 4S2BA 3K30A 2HSAA 5AHMA 4XZ9A 4BEQA 4WIWA 2ZZ4A 3DI1A 4S38A 4MUPA 3QTPA 4TX9A 1XRSA 1O68A 2GR2A 2FMNA 4AHQA 2XTKA 3ARTA 4M8UA 1T0OA 3B0UX 1FWIC 2GVJA 2VD9A 3P84A 2DIEA 3FW6A 4NASA 3KTSA 3TTEA 1SZRA 2AKZA 2BB0A 3PUDA 3NDOA 4MIMA 3LD5A 1XM3A 2XGZA 2WPGA 1AJ0A 4A21A 2XIBA 2CKRA 2ADAA 4ORIA 6PTDA 2VR2A 3LPOA 1J0KA 5D2WA 2NV9A 4O19A 1JDFA 4C6JA 1POJA 4DHGA 2VFHA 4UTTC 2Z0IA 3ITXA 4H3DA 3TQKA 2DZVA 2BGSA 1NWTA 2V5DA 1W9DM 2G3MA 4ADWA 2ZUTA 5I7GA 4PUKA 2PRLA 3GTHA 2CZDA 3IJ8A 3U5YA 4ZVJA 2VRJA 1GERA 1NJJA 4J1OA 5I02A 4G56A 1X8FA 2VX7A 3H6OA 1KCZA 5AHIA 3N11A 1DVJA 1ADDA 3CAVA 4JTAA 2CEQA 2PCQA 1N5XA 5FEPA 1XPGA 4ROQA 4IPIA 4A05A 4W8AA 1LOQA 3HTWA 1E1FA 5EMUA 1WAWA 2WVVA 3LLDA 4BI7A 3A24A 4LRSA 2QCNA 2AL2B 4BZYA 3CPGA 2E6AA 1PKNA 3SCQA 4LV4A 2WPFA 3UWYA 3F4DA 5HJYA 3PNZA 3VDGA 3IJIA 3RNMA 2GQ9A 3MMDA 2YB4A 1VYPX 1NDAA 4IMDA 3D5HA 4PFMA 1ZNNA 3O0KA 2XH2A 4IISA 3M5VA 2BHZA 1UZHA 1EIXA 2EKGA 2WC7A 3KOFA 4H4QA 4BWLC 4GY7A 5I0DA 1I4NA 3U8GA 2PDNA 4H04A 3SUSA 4K7ZA 4ZFCA 1E1CB 3GNDA 1MQPA 1NDWA 5MKGA 1M03A 3LS9A 1GTEA 1UB3A 2CLIA 2ZTKA 1I60A 3A7AA 4Z17A 1BTCA 3L23A 4U4MA 1WB0A 4QSHA 3GU9A 1ZY8A 1ONXA 3WL1A 5CSSA 3T44A 1TMHA 5JQ9A 2X42A 1JCJA 4LQ1A 4O18A 4US5D 4JTGA 1LF1A 4HZ7A 1MZHA 1E0VA 4YHGA 3H7UA 5H91A 2VEMA 4NF7A 4H4RA 2Y8UA 5HA7A 2BOEX 1OBAA 4EXBA 1I1XA 1MO0A 4NRSA 2GPTA 1C9DA 1PL9A 2WMKA 4L6OA 1BWVA 4KRTA 3O0HA 1D8WA 4AIOA 3STCA 3R79A 2FYMA 4CVWA 3H2NA 3CL7A 4OT7A 4EXQA 1OVDA 4DIAA 4CGTA 4AVFA 3N6HA 2NUWA 3UESA 4LFYA 2WM1A 2CC0A 2V3BA 4XUYA 4QDMA 3GSMA 4CNTA 1TVPA 4ZMGA 3AUJA 1K9TA 2EPMX 2ZRVA 4XZBA 1X1OA 3MSGA 2J7HA 1WKYA 3COTA 1A5CA 1DIKA 1HVXA 3V35A 3VGDA 2D73A 4XB3A 1OIMA 3N73A 4QLKA 3V16A 9XIAA 2ZKMX 1QUMA 1FKXA 5MKGB 4H6KA 2O56A 1T8XA 1NHSA 5EA9A 2HK0A 2VRQA 1CXLA 2NUXA 4AXKA 2BHUA 4WK9A 4Q8OA 4ZODA 2LLEA 3A6OA 3FAWA 3CGTA 5DXXA 2Q09A 4XVDA 3DBNA 4EP8C 3IEBA 2JQXA 3UCDA 3GC2A 1UKTA 1FDYA 3UETA 2YGYA 4GGBA 3BW4A 2RUSA 3E5BA 3SI9A 1K8ZA 2J9ZA 4QX4A 3WDHA 2PWEA 5LNUA 1FFQA 3BL3A 4FNSA 4Q4RA 4GIRA 3CUXA 3VC6A 1E0XA 4LBUA 3AUOA 3PSVA 3NXFA 5BROA 1RH9A 3PJWA 3VINA 5C2CA 3U3HA 1EC9A 2INZA 2CERA 1B3OA 1JCXA 3NVTA 2QPUA 1E40A 3G8RA 4YNGA 1XLIA 1EOKA 4QDPA 3GG8A 1KNWA 3GNOA 3W23A 1C7TA 3HZ3A 1FTXA 1OGGA 2J47A 2YLLA 3A4XA 3Q45A 3KL3A 2NVAA 1LJYA 3LGDA 1UP0A 1OFRA 3W37A 1F3EA 4UNIA 2XINA 1ISVA 3WJWA 3H4XA 2PS2A 3HF3A 3KE0A 1YPIA 5HWNA 3TN3A 4AY1A 4JIPA 2FHCA 3RLGA 3W1QA 2DU2A 4EIVA 2ZFAA 1HZYA 1L6YA 3VM7A 4D2JA 3N6QA 1QBAA 4BS0A 2P8BA 1W0MA 4LEQA 1GHSA 1ONWA 3A9IA 4YJ5A 3OP2A 5J5RA 3WLRA 4CU8A 1QATA 1QI0A 3WMSA 2J24A 4P8XA 3VDCA 1V8EA 1AD1A 1QR7A 4IX2A 1PTDA 3TYAA 2QJNA 4CQDA 3TJXA 3E12A 1SMAA 1AL8A 4ZQNA 2QCGA 4JQAA 4JR5A 4JQ1A 3NZ1A 1HKJA 1Q45A 4MM1A 4H4ZA 2QKFA 3AYSA 1JRBA 5KZ6A 2GK1A 3OGSA 2FVLA 3FGCB 4RZBA 2D3NA 1OX4A 5IXEA 4MKNA 3BCJA 5E09A 3PZOA 1HJUA 3H54A 1IR2A 1IIGA 4OIFA 5K9XA 4J7RA 3ATZA 3MSRA 5FL1A 4PCSA 4MAVA 1J96A 1DJQA 2FDSA 3T2PA 3UU0A 3GE7A 4G5DA 1KBKA 2YVFA 3TN5A 3UR2A 2HVMA 3B9DA 4I8YA 4PC8A 1U33A 1QOQA 2ZDRA 3GY1A 3W85A 1M04A 1A5UA 3V5CA 1PVNA 2QCDB 2MANA 5DT7A 3KBVA 1KFJA 1UZDA 3MI6A 1GESA 2CWXA 4WDTA 1LROA 5ABHA 4M82A 4NJJA 2OX1A 3KVMA 3WK3A 3PTDA 5E0KA 3QV9A 4ZQOA 3LTPA 3UXLA 1O5QA 2Y5EA 2ZVRA 2QDHA 3CWHA 1UOZA 1W5NA 4MAZA 2ZRYA 4QP0A 5AY7A 3TLQA 1C29A 2V2HA 1Y7VA 4AZGA 1V0NA 5GNYA 1NSJA 2O9OA 3VZYA 3L5MA 2F6UA 2EG8A 3O3RA 4JNMA 3DHFA 2J13A 1IEWA 4WGXA 3EKGA 4LUYA 5E9AA 2ESCA 1H11A 2J9YA 4AIBA 2GOUA 5FL0A 4BI6A 1BXBA 2PGFA 5FSDC 1WKDA 3WDQA 1RCOB 3HQPA 1ZPTA 1ITUA 3DG3A 4R9OA 2HQAA 4MNKA 1LQ0A 1N55A 1FX6A 2H9AA 4H19A 2C7FA 5D32A 1JRCA 1EFZA 3NL3A 4L56A 1OY0A 1VF8A 3RG6A 2WSKA 1V3IA 5C5YA 4DBUA 3CGEA 1XDLA 3UG8A 4QLLA 3OB8A 1BSLA 1H5YA 5K7JA 5GPRA 4U3CA 2NQ5A 4HPJA 5FACA 3U0HA 3G3DA 2HXUA 2QT3A 3ZR5A 4FNUA 4JFUA 3VIHA 4C7FA 4JFVA 4IIHA 2D2OA 1Z69A 1XIHA 1Q65A 2W63A 3LB0A 5AHNA 5JCKA 5AVNA 4MJMA 3S83A 4MWAB 1OC7A 3QMRA 1FFUC 4J27A 3BAJA 1TPC1 1YPXA 3O05A 1ZZMA 4JL2A 3M5ZA 3PB2A 1CDGA 3PZUA 1QOXA 4GE8A 2DZTA 1YTDA 1C8YA 5ABGA 1E9LA 4LCSA 4S3JA 1KV8A 4XSMA 2WNNA 2A4AA 1HNYA 1QRQA 2I7GA 2IS7A 4QXIA 4Q3MA 3DK8A 3LMZA 4KBXA 4WSJA 5KSWA 3MI2A 8XIAA 1EA9C 3LXAA 3UPBA 1J01A 4AMAA 5IOBA 3S46A 2YA2A 1O1ZA 5LNRA 2EBNA 2H9AB 2KAUC 4FIQA 2ZYFA 2R6OA 3EWBX 2RGMA 3HPAA 3KLLA 1J0HA 3OU8A 4GA8A 1J12A 4K8HA 3KVLA 1HJQA 3I6RA 3ZOAA 3AHTA 3RJXA 4MZ8A 2Z1KA 1WO2A 1LDCA 3P3BA 3HGSA 3E5PA 4O8AA 1ONRA 1CT5A 3WNPA 3SRHA 1ZRQA 3Q67A 3GNPA 3SY8A 1NHPA 1HKKA 1KXHA 4C7DA 3A4JA 1PX8A 5FS9A 1OADA 3T6CA 1FWAC 2YR1A 4E4PA 1WYIA 1U2YA 2D2JA 1TYGA 5G2IA 3CZJA 4HSHA 1VENA 4UCGA 2MNRA 3V75A 5BOFA 3G18A 1E73M 3SQPA 2FGBA 1JR1A 1GNXA 1YW1A 3GRTA 4AISA 2J7EA 2YKKA 5LNWA 1XIJA 2QCDA 3T42A 4K8EA 5DX7A 4X0NA 5DY3A 2WJFA 1E6PA 4WD0A 2C3ZA 4GZJA 2YYUA 2OT1A 4AIEA 4UZSA 3NQ8A 2NQ9A 4GQBA 4JFTA 2JGQA 1TFVA 5I00A 3QHOA 3NO5A 1LWIA 2OZTA 1GOKA 4V33A 3G0UA 1CYGA 3B9JB 4E2BA 2DV0A 3CV6A 3QOKA 2C91A 5M5DA 1HP4A 1O4UA 5CBBA 1IYXA 2QUTA 1VBRA 2O0TA 2XJ7A 5AC8A 3PUEA 3LM7A 4RPQA 3D0CA 3BGJA 2QS8A 8CGTA 3DFHA 4F2TA 1DP0A 1LL4A 2GK1B 3LN3A 4JD4A 4IWWA 2QGYA 3FJ4A 4UUIA 2C6QA 4J3VA 3N25A 1TR1A 1TTQA 1NU5A 2OX4A 3KVKA 3ARRA 1WOAA 2ZRXA 2PDLA 4ZGYA 3CV7A 3MYPA 4A3HA 4ZOHB 2J8TA 1G7UA 1FCBA 3WQ4A 4UQEA 5C6MA 2V5JA 1HL8A 2VVNA 3L4UA 1A50A 5FKYA 2V69A 1S1RA 2PF8A 3VOGA 4B91A 4GYFA 4KIRA 1YE4A 3G1RA 4GH3A 4D6JA 3HO8A 1BTMA 3SSJA 3ELFA 4TVDA 4S3KA 3WF4A 2W27A 5GNZA 4NILA 4ONVA 4ML4A 1LOLA 1HVQA 1KB3A 1Q6LA 3RRXA 6XIAA 4LH8A 2UBPC 1KCKA 4Z0JA 1UP2A 1OIFA 4P7OA 3UVAA 4MSSA 3RO6A 4Q4MA 1SM9A 3EOUA 3WCZA 3SGUA 2Y2WA 3KHJA 2Y7EA 3L5AA 1ZL1A 1XFCA 3S5YA 2L5HA 4Q8UA 1VPYA 3F7JA 4L65A 1JG9A 3LYEA 1Q8AA 2FPVA 4LSBA 2DFAA 2F5ZA 3V0SA 5M3WA 1V7YA 3E02A 1Q6OA 3IK4A 2A3LA 2P3EA 3B97A 4DZIA 3H4GA 1V03A 3I4EA 1DHKA 1QBBA 1B31A 4GHRA 1W8SA 3DCPA 3VX0A 4F2UA 3M0MA 5LIXX 2ZUUA 1X97A 1JYXA 3DG7A 3AN1A 3HRDC 2ICSA 2CHOA 3F4CA 2INEA 1B2YA 1XGDA 2I5QA 4L9YA 3T05A 1NF0A 3GKAA 1EGMA 4Z42C 4O1CA 2X8CA 4R7OA 2Z2BA 1BHGA 4B3ZA 1BVZA 1V3HA 4UTFA 3U4AA 1H1NA 3ZLGA 5CBJA 3VKCA 5BRBA 2R14A 3TUUA 1UD2A 3P0XA 3G1FA 4QG6A 4BQ3A 1D3HA 2CZFA 4EAMA 3V3WA 2V82A 1EZWA 4RCXA 4KQNA 1RCQA 1XD0A 4JTQA 4L61A 3GDMA 3WDIA 3GR4A 3GXIA 1PPIA 4IG2A 4CU6A 3P7YA 1KR0A 3CMJA 3RN6A 3B8IA 3SCOA 1FFVC 2GJXB 3VZZA 1FA2A 4D6EA 4F40A 4CQAA 3NM3A 1EOMA 3JRKA 2QCMA 4PUUA 3TVAA 2FJKA 4QRNA 1ZALA 3FKKA 1XLKA 3M07A 3GFYA 2E09A 3LA4A 3EWZA 3TA6A 2DVXA 1TCDA 1VFLA 1XCFA 2AQWA 4HK5A 3QYQA 2DW6A 3PY2A 3W6YA 3VU2A 3WMLA 4DI8A 4XD5A 1KFCA 3IJ6A 2ZXQA 2Z29A 2XIJA 3UR5A 3NQFA 4KH2A 1ZFJA 1GVSA 3W72A 3VD7A 3RM8A 1LUCA 3U2EA 3TA9A 3WQEA 3UT0A 1R3SA 4F0RA 1CGYA 2FGLA 1FWCC 1XP3A 2QDEA 3IRSA 4K3ZA 4RW3A 3NL2A 3W7LA 4DO7A 2Z7GA 1TRDA 3A23A 2QDDA 4IUGA 4JTHA 3DESA 2CLKA 3BTNA 2FZNA 2XIQA 3ZSSA 3K1DA 1EO7A 2O7SA 2EO7A 4D6IA 4R7JA 2XDFA 4OVXA 4TR9A 1NWSA 2J78A 4M6VA 3B9OA 1LRTA 4QHRA 4AF0B 3BOXA 4EKJA 1WX0A 1Q63A 1JCMP 4UNKA 2EQ9A 4RNJA 3ITCA 4LWWA 1XYAA 2VRKA 4GWEA 1UR3M 4UTKA 4EMJA 4HB7A 2A5HA 1GK8A 1KWKA 2PPGA 1XH0A 4NUWA 1MFVA 3MZ2A 4OBRA 4QJ1A 3VO0A 4PUNA 2ANUA 1R3WA 4DWSC 3UCCA 5TNVA 3ZMRA 4GJJA 3SRKA 2V0TA 1X7FA 3VGHA 1NY1A 1TQJA 4YTTA 2X30A 2FDMA 3QMSA 4PUDA 2FZ8A 3M6DA 1H60A 3IAPA 1XCWA 2X7VA 3FXGA 5H8UA 3O8AA 5CPMA 1ZAIA 5F2IA 3LI1A 3GVVA 3EXRA 4OUIA 5FMHA 2OPJA 3OZYA 2YVGA 1QCWA 3B04A 4WR3A 3IUHA 1EF3A 1FECA 4NX0A 3QVQA 3S2NA 4GLEA 2VEFA 3W2LA 1GOXA 3VC5A 3PFMA 2F84A 1T3QC 3PF3A 1EF2A 5IDIA 2I1OA 3APTA 4KWWA 5A8OA 3VGFA 4CN1A 1FP9A 3MTWA 1FCUA 3TAOA 3E9AA 3EMZA 2Y6ZA 1TZ7A 1MOKA 2W5FA 1NDZA 3SN4A 3LLFA 4LVGA 3URAA 3LXBA 5DF0A 4HNCA 3S1XA 3GYCA 3O6AA 2VYOA 2C71A 1XC6A 3IANA 3S5NA 5AFDA 3SEPA 3H22A 1PIIA 1GREA 1H61A 2EG7A 4PMRA 4DWDA 2PTDA 1M7OA 3CK5A 4J56A 2B7OA 3GNNA 1WE5A 4FNPA 1UWRA 1L8PA 3CHEA 5EBKA 1ICPA 5A6SA 1SSDA 2PP0A 1FWNA 4H8NA 4Q6XA 4S2CA 1K6AA 1EGZA 4DJDD 3S1VA 5AC5A 1PEZA 3VA8A 5CC6A 5DELA 1GSNA 1HN1A 5F2MA 2PMQA 4E3TA 4H9ZA 2YXGA 4ES4A 1OT1A 4J3XA 3TJLA 1GJUA 3NYZA 3T0AA 3BH4A 2HBXA 3TROA 3KS6A 3UYIA 4JNYA 1W1ZA 1Z42A 3WNNA 3C4UA 2V8ZA 4X3ZA 4E2DA 3B8SA 1RQHA 4KESA 1OCJA 2F7FA 2PDCA 5L9FA 5FI8A 5K2ZA 1RA0A 1E56A 1LL6A 3SIZA 3PBWA 3BLFA 4IQEA 1PTAA 1P1MA 1BWLA 1VHCA 1EYEA 5E1QA 3PUGA 4URIA 1C9WA 1V4YA 4Y2WA 3R43A 4R33A 3BO9A 4H2CA 3FX4A 4BCEA 1FBAA 3SB0A 1JXKA 4HTBA 4RDYA 1ZGDA 3Q58A 1AH0A 2BY0A 2Z2UA 3F1QA 4AVOA 4AWEA 3K46A 3AOFA 3MVTA 1FWDC 1HIZA 1KTNA 1KBJA 4M6QA 3BLLA 1OYAA 3W7RA 1KFWA 5FS6A 1WKFA 3R25A 4H6EA 4GXWA 1ECEA 3UPWA 2GGIA 4IMFA 4QITA 1EDGA 1MW2A 1HQTA 3N6JA 1E71M 3GW0A 3MKVA 2OSXA 5G4HC 2WJEA 3G1XA 4HU8A 1CGXA 1Q13A 3GXMA 4WJ8A 2P10A 3WH7A 1JULA 1A5LC 2CDUA 1LORA 4A8LA 2ZA3A 4I7WA 3W7MA 4ZOBA 1LQ2A 3WF3A 4PRRA 2JKPA 3FSTA 3OGRA 1LZOA 1LG2A 5C7VA 1RY0A 4Q8TA 2HTMA 4FB7A 1TJ2A 5LSMA 3Q65A 5CZSA 1XIIA 5E70A 4JKLA 4LIIA 3WENA 1SJDA 2Y61A 4D8AA 1XQLA 2OVLA 1SFJA 3W81A 5EMMA 2W3ZA 2QUVA 2I5GA 5AYBA 3K1GA 4MUZA 4BI5A 3BAIA 3O6DA 1Q6FA 4ZXOA 1FWRA 4Q6JA 2ODOA 4GVHA 3LB8A 2V63A 1ZK7A 3WO8A 1DWIM 3GC4A 4ZR8A 3S5SA 4ZO6A 5FF3A 3NPWA 2HNEA 4AZIA 3VE9A 5E0CA 3CBWA 4YHEA 3LCFA 3IVSA 3LUTA 2J77A 1VDVA 1JEZA 3AXKA 3CM4A 1EYWA 1H62A 5JUVA 1V6WA 3C2EA 3LNMA 2OKOA 5I3FA 3FSUA 5FJOA 2I17A 4HHPA 2HNHA 3H70A 3R0KA 4P8WA 3GKFA 3ZXWA 1BKHA 5TIMA 2P0IA 2A85A 1GV4A 2ZTJA 2PTYA 2OWCA 3W07A 3PWIA 3CIWA 3QV8A 1RHCA 5EPDA 1UWQA 5KVIA 1EP3A 3EOSA 4E3VA 4X2RA 1C93A 2A3BA 3KOWA 3EKLA 1CLVA 4JQ4A 2BY1A 5TR3A 4BURA 4EE9A 4NRRA 4J3TA 2DZUA 1G69A 1W1IE 3RITA 4RR4A 2ZWYA 1N8IA 3E3HA 3WSUA 1AFSA 1OWQA 3L65A 1VYRA 2EG6A 1UASA 2Y88A 3SUTA 1B3XA 3C0JA 4L5ZA 3MA8A 3FYYA 4PTMA 2OQHA 4GZIA 4QIUA 3QHNA 1YTKA 4XKMA 4UTIA 2YXOA 1KM3A 4C6LA 2HDJA 1KBLA 4S1FA 2NWRA 2J66A 2RAGA 2NQZA 3ECQA 3TQ0A 5JH1A 3TTQA 3EYPA 2DSKA 2EXOA 3LU2A 4U2ZA 3WLIA 1V97A 1BVNP 1OQFA 1QAPA 4ECLA 4KCTA 4KKXA 3WLPA 4UMAA 2ISWA 4ZTXA 3ZM8A 5I78A 1Q4WA 2YCJA 2H6RA 3R10A 4DZHA 4EOUA 2TAAA 3AIQA 3DFPA 1UWTA 3FLUA 1P0NA 3L8KA 4HHMA 4BA0A 3IAQA 1LCOA 4GQ0A 4KFOA 3GAYA 3W7KA 1YBQA 4H9TA 1IGWA 3NAVA 1UW9A 3RDKA 4DB7A 5HMSA 4ATWA 4CLMA 1W9VA 3LCIA 3B8DA 5ENLA 4IT1A 1W5PA 2QIWA 2W62A 4FX9A 2WZTA 3ZWTA 5A6BD 4PTWA 3A12A 1I75A 4GR1A 3NQ7A 3AXMA 3PM6A 4GJ1A 4XVEA 3I10A 3RNDA 5HJXA 4DUWA 4MADA 2G3JA 2HRWA 4R3UA 3HQOA 3QR1A 2D23A 3AXHA 1QO2A 4G9PA 3W2NA 3OHIA 1A3WA 1GOOA 2J4GA 2JEPA 3WD3A 4B2DD 1TV5A 1EBGA 2BGNE 4RKAA 3EF6A 3RLUA 4QEHA 1PXGA 1O5XA 1JZ7A 3SN0A 1C8VA 4WOZA 3AIBA 2V6OA 3EXSA 1HW6A 3CZ8A 1YBQB 4MYAA 1DQUA 3W1TA 3T09A 3VD5A 1GQJA 1DJWA 4NNAA 4IJBA 2J27A 2VENA 1UWSA 3NQ2A 5GRTA 4XWUA 1FXPA 4H1ZA 3A3WA 1IWAA 2A1YA 1R0MA 2BY3A 4GZEA 5I3HA 2OXNA 4QLJA 3A4AA 4JX5A 1V77A 1M1BA 4AZCB 2BTMA 5CJ5A 4P7QA 3M41A 4HA4A 1HO4A 3NDYA 3PZIA 1D2KA 3RLVA 3SM0A 3KZSA 2CCRA 3NVVB 3L0KA 5I77A 2HWGA 4EM3A 1Q1WA 1JAEA 3R94A 3V7PA 3R1ZA 1S2WA 3PZTA 1W3IA 3EOEA 4LJ3A 3WD4A 5F4SA 5AZ1A 2F6KA 1J5SA 3UZYA 1TIWA 1KTCA 2VELA 3RPDA 2E6FA 2WK2A 2VFEA 1IZKA 1OK6A 3QXBA 3LNPA 4EPKA 5E6ZA 1PCKA 1LOSA 1EPVA 1KRBC 5M03A 3TJIA 2PDMA 1JYVA 3K2GA 2YAUA 3PG6A 4LYKA 1UIOA 4NEWA 2XVKA 4YIWA 4WOQA 4V15A 2ALDA 1EP2A 3TC6A 1WZKA 4U28A 2OLAA 4DWSA 3K8LA 2G5WA 3NO3A 3TMLA 1DEDA 3CQIA 4LNCA 3OEXA 1NDVA 2DQWA 3HJEA 3VE7A 2V2CA 2FQIA 5G4WA 3RM9A 3HV9A 5A6TC 3BQ5A 1J0YA 1IWBA 1F8WA 2D20A 3APYA 4J5NA 2DZXA 4FK9A 5AC6A 3S2LA 3B9NA 4N4QA 1HGWA 1J6OA 4R9XA 4DYKA 2V6AA 4H8UA 1ZLPA 3IGHX 1QNQA 3WLSA 8TIMA 1JCTA 2C18A 2YX0A 4JIHA 3R4IA 1JFXA 1S5WA 3WLOA 2HPIA 2Z2AA 1YNQA 3AALA 1GONA 2YZRA 3O63A 3ZS4A 2AOSA 2VURA 3SCRA 1JPDX 1KTBA 2PGRA 1DXLA 3W75A 4RXFA 2WO5A 2DQXA 3UWVA 2VM8A 1H1YA 1ZBVA 4ILSA 9RUBA 4RV3A 4GX9A 2R1KA 2VX6A 3I6TA 1ZDLA 3OLEA 4H9XA 3CJPA 1Z41A 1LBFA 1NVMA 1IXNA 1X1ZA 3H2FA 4ZENA 3UYCA 2WZMA 3UFYA 4HJWA 2ZE0A 1PWLA 4HNVA 4JGDA 3QR0A 1K9EA 3RAOA 5FJUA 3BLPX 3MJMA 3RRAA 4FXJA 3NSXA 1G5AA 4XX6A 5CC3A 1D8CA 2EPKX 4QE5A 5B7ZA 3DFYA 5CG7A 4ZOEA 4ML9A 5LHFA 3UY7A 1MUCA 1TX0A 2QNEA 1RD5A 2GVLA 3C5QA 3AIEA 1REQB 4CD5A 3B06A 5K3VA 2XFRA 1NF7A 5LGZA 2I14A 2VQUA 1BYDA 3RCYA 3WNLA 1M7XA 3M4HA 2GGGA 1B57A 4UCFA 2YBUA 1JYNA 1XG3A 1B3WA 4D6FA 4N0RA 3DHDA 4FOJA 3QJAA 4PE8A 2XIIA 2NWSA 1CCWB 1YDVA 2FIQA 1J79A 1RZMA 4LNYA 1NWRA 1E6QM 3I3DA 1ZJBA 1QNRA 4LYQA 1KCXA 5TBOA 1YQZA 4OUEA 2VGIA 1DXEA 1F3TA 2ISVA 2PDIA 2Z1SA 2CXEA 1NM9A 1P6CA 3C0QA 2DJLA 2VC6A 2CLMA 1RJPA 1B3ZA 4RLIA 3LRLA 1SW7A 3MT1A 5HNRA 4CCZA 1L9WA 3W1UA 1EQPA 2O55A 1W1TA 2VUNA 2I9EA 1AD4A 4KW2A 4AEOA 1RBLA 4Y9AA 1QW8A 3P5ZA 4H8VA 2D1ZA 2PDJA 1UD4A 4PL1A 2WVTA 3G1VA 1K70A 3KP1A 4ZE4A 1A0EA 4DZAA 4N6FA 1XWYA 3WUEA 3W71A 4OWGA 3APGA 4XKYB 1AW5A 1GORA 3N1AA 1NP0A 3MY9A 1Q3NA 5D02A 3LXDA 2AMXA 2B7NA 4TU1A 3W88A 1WDWA 3WFAA 4C6FA 2QZRA 2GQAA 3CGBA 3MS8A 4L4PA 3N2OA 2H90A 2XHYA 3GS6A 1S2TA 1A5OC 1OYCA 2ZUSA 3OZPA 4N6EA 3CZKA 1TWSA 1GOQA 4AEEA 2ZICA 4LTSA 2A3CA 2R24A 4PUEA 1XLDA 4O4WA 4H4VA 3F03K 2QMKA 1YLVA 4HBKA 3BSHA 3BLKA 3M5YA 4S39A 2G50A 1JDDA 4JDRA 2QAFA 1LVLA 3MJYA 5DXYA 3W7OA 4Q4SA 1XLHA 4XTDA 3P8IA 3T55A 2CLOA 4AD3A 1RA5A 4ZQCA 1A5MC 1L2UA 5EU9A 3HURA 1XYMA 4MPQA 3O6YX 1H41A 3T0BA 1WBJA 1ZJIA 2PLCA 3RHGA 4HSOA 3MMTA 1G4SA 4DBWA 3FJ6A 3W38A 1EHNA 3KP0A 3BW3A 3R8HA 4D6GA 1S5TA 3ZT5A 4AZCA 1XLBA 2QJJA 1W31A 2YFOA 1ZJAA 4MZYA 1R46A 4EQWA 3DYPA 4D9PA 1H1ZA 2WVUA 3VFLA 2PD9A 3GZAA 4C60A 3HPZA 2W91A 1F4AA 2F38A 1MZRA 1NAL1 2VNCA 5JBDA 4KEUA 4AAJA 4B5SA 2FPYA 3TQPA 1OCNA 4PCNA 3GZ3A 1TELA 5J04A 3MBDA 3HBLA 5D4YA 4DJFD 4MG4A 1OC6A 2I56A 4FX8A 4PTVA 3A3XA 1ISWA 3TFCA 3FJLA 3L4TA 3STGA 1WPCA 1NIUA 3ITLA 2QEZA 3CXOA 3MCOA 1UKPA 1PCWA 2J74A 4FXFA 4C6NA 2RGLA 3URNA 1A5BA 3TNOA 1TYTA 1V7AA 3T07A 2ISDA 5EBAA 3NZRA 3QLDA 3VIKA 4A3QA 5CXPA 3NSMA 2BV9A 4DVOA 4HSNA 3E6EA 4EF9A 4A4AA 2GZXA 2EHHA 2A2IA 1WZMA 4UQDA 3P67A 3H24A 4LOCA 2EJ1A 4Z2GA 2QPXA 3LEPA 3AICA 2QQ6A 4Q33A 5I3IA 1EJSC 3MV01 5FAJA 1Q6DA 3DH7A 1SO3A 2YOCA 1OZMA 3QSTA 3MSDA 4X2PA 2WHLA 5AYXA 4EMIA 4PEEA 2QGHA 4GIAA 2C3CA 3L5LA 3IJLA 2HROA 2G97A 4JN8A 4LBRA 3FN9A 3VKKA 4R5EA 5T8GA 4AWSA 4KWVA 1XQKA 6TIMA 5D38A 3TZFA 3C3NA 5KZDA 3GIYA 1Q6QA 3EEZA 1GW1A 4NZ3A 5LZLA 3J7HA 1DKWA 4AUBA 3DKJA 2ZA2A 5T26A 2IKGA 1A5SA 4W5ZA 3RX3A 4FMVA 1H49A 2RJHA 5I23A 1MO9A 4XZIA 2Y8VA 2OLHA 3R8GA 1XGEA 3SCWA 3EZ4A 4U2YA 3O1NA 1JZ6A 1P1XA 4F4RA 4QCFA 3VD9A 4LUJA 4X22A 4WJEA 3SDOA 4IPNB 2AGKA 5HNNA 2VWTA 2WKGA 3KS5A 2DZWA 3KBJA 1X6LA 5A6BA 3RMEA 3S2MA 4IIGA 1T5AA 2R82A 2ZX6A 4D72A 3S6OA 1XW8A 3ZSTA 2WOVA 1FFRA 1EJRC 4WDXA 1JZ5A 1VIWA 2E5AA 1DWGM 1B9BA 3I7SA 1PZ2A 3MP3A 1S3HA 2ZZ6A 4MF4A 3CYVA 4O1DA 2BG5A 3PP7A 1P0KA 1PHWA 2FZBA 1NHQA 4XK2A 2C0AA 4NXKA 3FOKA 4BEUA 5JIWA 2XYLA 1XHGA 4O50A 2NW0A 1R30A 4XTIA 1X8CA 1VIZA 1FWEC 1EEPA 3N4AA 5C70A 3HV8A 1JGIA 7ODCA 4RUBA 5BXTA 3STPA 1R38A 2PC4A 3V1HA 1THFD 1V6XA 4LANA 3TR2A 5E93A 1Y5WA 2PGEA 1TB3A 4M7TA 4IOTA 1OD8A 5FF2A 1L2QA 1JDAA 5AECA 1SFTA 1HX0A 3XISA 5D04C 4DJDA 1NPXA 2QDGA 5D9NA 1A80A 2C16A 3FYOA 3SADA 1Y5VA 1X2HA 3N15A 2VL4A 4I8DA 4ICNA 5I24A 4Z1AA 4NJKA 1B4EA 3BJFA 4UTJA 2W4XA 1UA3A 1YE6A 3PBUA 5KMYA 3JU2A 2EQ6A 5JCLA 3JZEA 1XLLA 5BWAA 4KFNA 1PKLA 1OG6A 3VIPA 3H4WA 4A8RA 3EMCA 3MP4A 2WQPA 3TYEA 3W27A 2XZ9A 2ACSA 4UTWC 4LS1A 1P5BA 1M53A 3G6LA 1V6VA 3E0FA 2BX7A 3N2XA 1JQVA 4M0XA 5HQMA 3KZPA 3H2AA 3NGFA 3TU9A 4ORMA 4PGLA 3BGAA 1F74A 4PULA 1LT7A 2PAJA 4ICCX 4S3DA 3WEZA 3P2VA 1QPNA 1UR2A 3FS2A 1O12A 1JVNA 4B5WA 4JL1A 4H9VA 2YCIX 3MUZ1 1GVOA 1E1EA 4PUWA 1UR1A 2WNQA 2CXGA 1DJNA 1TV4A 2ZBTA 1E1CA 2DT3A 4HN8A 3G1SA 4C6QA 5F1UA 1ZCOA 2A3EA 3OBEA 1K6WA 4XBKA 3MANA 2Y85A 4FR6A 3WBYA 1GVQA 1WDQA 1SJBA 1SZEA 1GWJA 9XIMA 4Q8QA 2E7FA 2WZIA 1IWPA 4N02A 1EJUC 3CHFA 1D3CA 4HPXA 3AS2A 1H7XA 5D05A 4DPPA 3UNDA 1GVFA 2E6YA 4PBFA 1F3WA 5DBTA 1GETA 4AZ7A 1KWGA 1P0EA 4GO8A 4UTWA 1H2JA 3R07C 3VKJA 3ZZ1A 3WLLA 5D2TA 3QQ1A 3VNYA 1F05A 1M68A 1ZQ5A 2WV8A 3CEUA 5MF5A 4G7EA 6A3HA 3A21A 4JPGA 2EEXA 3PJXA 5AHLA 3D46A 1OCBA 4PH6A 3BQ6A 4S3CA 4WQ6A 3ALFA 3OZOA 3UWWA 1V0KA 2PDFA 2Y8KA 4PN2A 1EA0A 4GI6A 5JCIA 3MSYA 5DBUA 1W3LA 3PULA 1KGWA 5GQBA 2DSUA 2HK1A 4Y9MA 2GQ8A 3HIJA 1MDRA 4LVFA 3CB8A 1E4NA 4M81A 3JW7A 1UKSA 2VFGA 3SAZA 2YA0A 1TV3A 3GRIA 5SWUA 5BRPA 3BANA 1HF6A 1DIEA 1G4TA 1P0DA 3PZGA 3B0VC 5FOOA 2YIHA 2UY4A 4GQGA 3ZVHA 3MP5A 3URHA 3EOOA 3BUVA 3BC9A 2QJMA 4AFYA 3REQB 4XISA 3W1MA 2QAEA 2NXIA 3THDA 3VIMA 1U5JA 3AU2A 4H6QA 2DIJA 3K8KA 5DFAA 1RJQA 2FZ9A 5LXEA 1FVPA 5AYZA 3LSCA 1BG9A 1E70M 1GUVA 3IGUA 1VHNA 5FEXA 4Z2JA 1FH8A 2NV2A 3QV7A 4APNA 1UOKA 3C0LA 2G95A 3VNIA 1KRAC 2VEPA 4GY0A 5G5GB 4DEFA 3WDPP 2QF8A 4XO7A 2XN0A 3WF0A 1JAKA 4WVXA 5DMYA 2BVWA 3CQHA 4JTCA 1H50A 3U57A 1GXFA 3REQA 3DGRA 3UA3A 3W53A 1J6PA 2RDUA 4QE1A 1ZP3A 5CZJA 3U2ZA 3W2UA 2W54A 3H4KA 2YFNA 4CNUA 5LXXA 1ZSXA 3M0YA 3HU7A 4GKLA 4XAPA 2WLYA 4CNSA 2XVLA 1BXNA 2AAQA 2TSYA 4Q4OA 3W25A 3SSZA 3WMCA 2DP3A 2Y5SA 5A6JA 1GPWA 1VD6A 3CUJA 1O60A 4N9EA 4WUIA 1BWKA 2G3FA 1UUQA 4OU1A 3LENA 4RW5A 4G6CA 4JTEA 2OSYA 1JCYA 4F9JA 1H5VA 5K9CA 5C9RA 2IW0A 3U48A 3VD3A 1W54A 4R85A 4YPJA 4NJIA 3DGHA 4RE4A 1EL3A 5IDZA 4K2SA 3VGEA 4GX8A 4UXDA 5HMEA 1PDZA 5K9DA 2J7DA 2ZZ7A 4C5ZA 1ZAJA 4DYEA 2DSVA 4HOZA 1GYLA 5HWMA 1W3JA 1Z7AA 4IZGA 3K4DA 3G1HA 2OLSA 3TYBA 5BW6A 5HDRA 3TC3A 2VX5A 4OZOA 3UZ5A 3NA8A 3P80A 4QISA 1ZX9A 4WKFA 3ZVHB 4N7QA 4FX7A 5LA0A 4J9JA 1ICQA 1YDYA 4W89A 1TPDA 1R6WA 2J25A 4GC3A 4IXXA 3ONBA 1QI3A 3W02A 3MC5A 5KITA 1WYGA 3PJTA 5DO8A 2BOGX 4HCHA 4LAOA 1E4LA 4YS1A 1F5ZA 3B40A 4PMVA 5IHSA 5G1TA 1VBUA 1KXQA 1I9CB 1U5HA 2NT1A 3N18A 3MUCA 3LM3A 1A53A 1EO5A 2J8GA 3N2CA 4DO4A 3P0WA 1XHCA 3L9CA 1IT7A 2BFGA 3W82A 4B5UA 4Q8VA 4YCOA 3FDKA 1OB0A 5F4XA 1EGVA 1HKIA 3M0IA 1M7JA 4LW7A 1IEIA 5DMMA 2VCBA 3TFXA 2I16A 3GTXA 4ZEPA 3IV3A 1JGMA 3KWSA 4O1BA 3QGKC 5BXPA 3W70A 3CASA 4RDWA 3LZ3A 4LC6A 1CGTA 1EJWC 3FK4A 1SO4A 2YL8A 2O9TA 3QQWA 2Q8ZA 3FIGA 4QS6A 4C1LA 3GRSA 2OEKA 3R5EA 1ZBCA 1MUWA 2CBJA 2D69A 2FVMA 4AH7A 3FA5A 4O14A 2XISA 1TWWA 3EX1A 2GUBA 3M64A 1FQ0A 5CSYA 1RUSA 3F4VA 1P48A 2CLFA 4XZMX 3KBWA 2VZOA 1TPUA 4NZJA 3W4RA 2P3ZA 3LX9A 1A3XA 4O13A 3LGEA 1IXOA 3M47A 3NWRA 4AIUA 1BQCA 2W0UA 2CNCA 3AWNA 2D2HA 2PCEA 4HOWA 2WNZA 4K8DA 3CAWA 1KKRA 2Q3RA 4Z1BA 1G1YA 3ARYA 1BRLB 1Z32X 1HTIA 1TMQA 2WHMA 3E0WA 2CYGA 4H7ZA 2QJHA 3EDFA 3GTFA 1ZBKA 3RO8A 2EPNA 4MZ1A 4D8LA 3OTRA 3GIQA 3CQ0A 3SFKA 1GVIA 3LPGA 3WQFA 3P62A 1R8LA 1UQYA 4JQ9A 5ECVA 1XH2A 3SIMA 4Q8WA 1ZY9A 2WCSA 1HUVA 3A64A 4NAFB 3QN3A 2V67A 1QFEA 2X1TA 4UFLA 2WCAA 2WMIB 2E77A 4GISA 4AD4A 1DWHM 4M1RA 2G3NA 3WUFA 3BMWA 3SGZA 1A47A 4YVPA 4L4OA 4JIRA 1WP6A 1L0PA 4DN1A 1XGZA 4J57A 1JF5A 3OVGA 5F2GA 4WSKA 4GUHA 1VGAA 1TKKA 2AQOA 3NPUA 3LHUA 4JKKA 4Y8FA 3BCDA 4HZMA 3PBGA 1C91A 1I2NA 3PBMA 4GXPA 4JTUA 5LA1A 4WLCA 3R0DA 3DGZA 1PZ1A 4AC7C 1UPMB 3O9NA 4M6UA 4UBPC 1CXFA 3RLHA 2GDVA 3KDNA 4FXSA 2Y7GA 4QJ4B 5HWJA 1NARA 3THUA 1PUDA 1Z8AA 4FF5A 2Z7KA 3ITYA 5AZ0A 1A5NC 1DNCA 4GMEA 2B0MA 2BXZA 3GUGA 4B2DA 2WCGA 1M6JA 2VO5A 3MHGA 1RP9A 4F9DA 3GDLA 2DUAA 3C6CA 1QO5A 3KOYA 4HJFA 3T8QA 3SUVA 3W7HA 1QHZA 3WKZA 3WF2A 1VBGA 4UZUA 1GVRA 4KEMA 1H7OA 3S47A 4J3ZA 1RLCL 3PZ9A 4ZOAA 5DT5A 4DBDA 5D2XA 3FHQA 5I07A 1WXJA 2ZCGA 3AYVA 1JROA 5BOOA 1W3KA 3C8NA 4S3AA 4EQRA 4RE3A 4JNZA 3N9SA 3WEOA 3S9ZA 2WOIA 4JFWA 5CPOA 4AG0A 5GJPA 5TD4A 1MVYA 3NQVA 5C9UA 4AD1A 1XX1A 3AIVA 5K4ZA 3HQNA 7REQA 1R2TA 3EX6A 4ADSA 2DH3A 1TPWA 2JIEA 4S3BA 1GTHA 3IVUA 3MUXA 1AQFA 3GDTA 3VOHA 1OINA 3W7JA 3RUBL 4CNPA 1T8QA 1R3VA 2VC9A 3NQBA 3M0XA 1V59A 3QRHA 2RH9A 1Q4NX 2GL5A 3R2GA 1TA3B 3IJQA 1S2VA 2XGIA 2G3IA 2J3NA 1J9YA 4QM1A 1ITQA 2B7QA 3OLDA 1LG1A 2CLHA 4IP5A 1RXOB 1CLKA 1RD6A 1CIUA 2W61A 4TO8A 4UQCA 2X41A 1VRXA 2BCPA 3W2MA 3T1GA 5HBFA 3VNLA 2W66A 1BFNA 4LX4A 3MCNA 3VVGA 3UXIA 2W3RA 1M6IA 1Y0EA 3GYEA 3W3OA 1DJZA 4LA1A 3GHTA 4HMEA 2GVYA 3TE9A 2W55A 2QXWA 1TUFA 3HA1A 4WKAA 1JI2A 1SPQA 1US3A 2DIKA 4GKTA 1QOPA 4MKVA 1T6MA 3OQ8A 6XIMA 1IE7C 1UMLA 3RU8X 1KFKA 3GX9A 1TE6A 3BE7A 4HU0A 4PUMA 5CC5A 3WK2A 2BS9A 4JIIX 4KCWA 4GFIA 3ABSA 3R0UA 5KETA 3JVAA 4B92A 2Q71A 4UTHA 1ZTVA 3GVQA 1J0ZA 1AQ0A 3PZVA 2QF7A 1OX5A 4CCEA 3T4WA 4F0HA 3QM3A 4PA8A 3GBEA 2E5CA 4K39A 5FCZA 3GFZA 3VI2A 1VCFA 3LHTA 4JCLA 1P6WA 1HP5A 3KL0A 4N9DA 2AMGA 5EBUA 2OYLA 2OG9A 4EAYA 5XINA 2PZNA 5FESA 3DJJA 1U30A 3TEVA 2WMHA 4JTIA 1TWZA 1NOWA 3TCSA 4FOUA 5JCNA 3QY7A 4BK9A 1TZZA 5CLTA 4YL2A 1BPLB 4RZ4A 4HP5A 4DBEA 3D3FA 4IH3A 4YYFA 5REQB 1GG0A 5FSEC 2WP5A 1HJVA 5U7SA 2C1IA 5U25A 3NQDA 4CCCA 5A8QA 1WBHA 3GR8A 1LWJA 2E3ZA 4F66A 3N19B 4AX7A 4KETA 3BAKA 2WZEA 4HU4A 4Q8PA 2E3TA 4NZ4A 3MU7A 2ZDSA 3PB0A 4JIQA 1QNPA 3T8LA 3W1PA 3OG2A 1L8NA 1RBOB 5EMYA 1DWAM 2PTWA 3IS4A 4LVDA 4NX5A 2ZXBA 3GXNA 4ZO7A 1W1A1 2YL6A 2IPWA 3QOMA 2YA1A 1REQA 1TJ1A 1VB9A 2XM1A 5FF4A 1XI3A 2OTDA 4IQLA 1RV8A 2XIMA 3WQCA 2VQTA 4M56A 1XBZA 1FWGC 3TOYA 1F73A 4IMCA 2CFFA 1UIPA 3ATYA 3L2IA 1UKOA 1ONFA 1WUEA 4N2YA 3HG4A 5CJNA 1RBAA 3RIKA 3NSNA 3AHYA 1TV8A 3UGVA 5I2UA 2A8XA 4NQ1A 3UWQA 3TK7A 4MTVA 1CB2A 3WY1A 1NHRA 1SUXA 2JBMA 3BZGA 4G8TA 4CQBA 1LTDA 2PC8A 3AROA 2CFYA 3E49A 2PI6A 1XLAA 3TSMA 1H7WA 1CECA 3WF1A 3KBSA 1PX3A 3MKKA 3TW9A 1RK5A 3E2QA 3M9YA 2VD8A 3PVFA 3ZYZA 1KC7A 2D24A 3BPWA 4W9TA 1ML1A 1XLCA 1D7FA 1VBJA 1YQ2A 2JFEX 2I57A 2WAGA 1WXYA 3LG3A 2YW4A 3OA5A 1HKVA 2V3DA 4FP1A 5M17A 1BRLA 1K7XA 3NIYA 4MLJA 4WCJA 3MYOA 1GVEA 3WLQA 1OHLA 1KLZA 4PB4A 1P0BA 1UUOA 2J6XA 2TYSA 1JPHA 3TZNA 2X8RA 2XU2A 3I3BA 1CGWA 4KWOA 1ITXA 5LIYX 3KCJA 1TV7A 1M7PA 2XGBA 4I9TA 4LCRA 4W88A 1SZNA 1V51A 3EX3A 5HJLA 3DBPA 3SQLA 4PBEA 1A49A 2V5KA 3CO4A 1W8GA 2QCCA 5I3JA 1X38A 2DZSA 1J10A 1ADOA 4IMGA 1OG0A 2PGWA 3QFBA 4M51A 1XR2A 4V28A 1MI3A 3CLWA 1YXDA 1UZ1A 3ALGA 3N3MA 4DUVA 1XS2A 4ZQRA 5A6MA 2X0SA 3WDJA 3SJ3A 4UQBA 3AIWA 5A8NA 1C3FA 3PG9A 2RDXA 2CLEA 4XIAA 2PWHA 1UBPC 1E43A 3CIVA 1C8QA 2P8CA 2GUUA 4UR9A 2VR5A 7PTDA 2V30A 3CNYA 3BW2A 2F6XA 2O92A 4MOZA 4ZQMA 2WJZA 3U7BA 1DIDA 3E1F1 4H50A 2CETA 1YHTA 4K8GA 5HATA 1KXVA 4FA3A 4ZO8A 3W22A 3C56A 4A22A 2WBGA 3S2JA 1JUBA 1EC7A 1GQIA 1WKEA 4MB5A 1TWIA 2W79A 1SZFA 1O6IA 1P4CA 1E9YB 1K8YA 1EEXA 1IF2A 2VUYA 2BBFA 1ADSA 4R34A 3SW6A 1TJRA 5A1AA 1DJYA 5L6UA 1VBHA 1U22A 2E4TA 2VXNA 3PZQA 2XH7A 4W7WA 1WNOA 1P6BA 5XIAA 3V4BA 3NFUA 2FB2A 4US6A 4F0LA 1UR0A 3QY6A 2OKTA 1DOSA 1DPMA 1QPQA 1F7BA 4NY2A 3T9PA 3L4VA 3ZT6A 3TCEA 4YYCA 3C8FA 3OG3A 4H83A 4H9MA 4H4XA 2NUYA 1AJZA 3BK0A 3S9IA 5LIUX 4CCDA 1JXJA 4Z2LA 3A3HA 1HXJA 3T08A 3RGTA 1Q6EA 1DWFM 1FWHC 5I06A 4GVIA 1D7YA 1K4QA 3RX4A 3PSWA 1B3YA 1ME8A 3AU6A 1G0CA 3TQVA 3WDRA 1MW1A 3PBYA 4JS3A 1AZ2A 4NAEA 1QNSA 1X6NA 4PMXA 3VK5A 3GW3A 1CX9A 1FH9A 4LVBA 3VNDA 1W1VA 3A9BA 2FTYA 2PDWA 3NR0A 2OOFA 4TX8A 1VQZA 2QULA 4JKMA 4O4VA 2ONEA 2BVTA 1DE5A 1TTIA 3CPUA 5KINA 5CCZA 4N9CA 1PAMA 2NX3A 3RYSA 2D22A 4WDUA 5FA5A 3ID7A 3WLMA 5REQA 5FF7A 1KM1A 3FKRA 1K4HA 4IFRA 1ODUA 3OBAA 2IKHA 4PTDA 1XYLA 4BQ4A 2C1GA 3DX5A 3S42A 2ACRA 2Z27A 3TSBA 1TUXA 1WDDA 4F79A 1UH4A 3CZLA 1K1DA 4FALA 4B9YA 4D1IA 4B90A 2GWGA 2FB3A 4IPPA 5A2AA 4V1YA 2ZIDA 5RUBA 3RMJA 2ZX9A 3C2VA 3FA4A 4L9ZA 3AC0A 4IPJA 5G5HB 2OGJA 3WQ8A 4O1EA 3TYUA 3UXAA 4UOZA 3G6MA 1PKMA 3VOCA 3KTCA 2HXTA 4Q7BA 5ECUA 2V68A 4JN7A 2CW6A 4P8VA 2C14A 4AF0A 2GR3A 4YTQA 4BFAA 1HJWA 3PNUA 1TO3A 5IBXA 3SFWA 2PU0A 1P43A 2PWDA 3RXZA 4PMNA 1RCXB 4L80A 2GSHA 2V3EA 4HPHA 3UERA 3AHXA 4XD4A 4EVZA 3CC1A 4ROPA 1H7NA 3ANYA 4NEVA 3POHA 1KM4A 2QIIA 2C8NA 1KGXA 1SB3B 3G1DA 4NIRA 1J93A 4HKPA 3PZNA 3E0VA 4CD7A 5ABFB 4DF0A 2Y0FA 2I9UA 2XIOA 4E4UA 3U5UA 1UHVA 4LUTB 3PAOA 4MNJA 4KGJA 4O1AA 4XZHA 5T9BG 5DY2A 4XD3A 1E5JA 4PCTA 4HU3A 5G2HA 4WY0A 5T91A 3U9IA 3M7WA 5AVHA 3INPA 4WSHA 4IL0A 1TA3A 3R7MA 3TWAA 4H9UA 3UY8A 1U1HA 1TR9A 3KLKA 2POTA 1AH4A 1XC4A 3ZJKA 1JUKA 2YBTA 1QVBA 3F5KA 3IJ7A 5LGXA 2A3AA 4NP7A 1RAKA 3BLOA 3NQMA 3EANA 3SQSA 3LDVA 1XXXA 4H41A 1M3UA 1VPQA 3EWCA 2CKSA 3GAKA 4L4LA 4Q22A 1IQ8A 1DQWA 1MFUA 3BAYA 3F4WA 1UA7A 4PR4A 4GPNA 2OB3A 4KCVA 4I3GA 3I68A 3A47A 1KM2A 2OOGA 3GLCA 3UD6A 2Y5JA 3N9KA 2FHFA 1HJXA 2X1UA 3GU2A 4AW7A 4FZIA 2CHNA 1T96A 3AMZA 2IKJA 1RVGA 3FXYA 3VDHA 4XAYA 1OFQA 5FIPA 4V2XA 4G7EB 1VP5A 4JX6A 4ZSTA 1SR0A 2EAWA 3C52A 4CKQA 3WX7A 4LVAA 1OT2A 2X1IA 1AW2A 1XSJA 4GFSA 3LHZA 4NZ5A 3PJUA 4O1FA 4Z2HA 3H21A 3VCRA 3SGGA 1BEUA 5LA2A 1KGUA 2WQDA 1XIBA 3FFSA 4ZB5A 4LUSA 5HINA 3HOJA 3CQJA 4HK7A 5D33A 1UD8A 1JDEA 3TN6A 5C54A 1JJKA 5A69A 2P76A 4TQTA 1JD7A 3M0HA 4K37A 3B05A 3GDBA 1CGUA 3VXGA 4KRUA 1XKJA 9CGTA 2V3AA 4QNEA 3HW2A 2X0YA 3W76A 3FY1A 1X2GA 4ZZ9A 1EZ2A 2QUUA 3USZA 3LV5A 1ZU8A 3RM4A 2WOQA 2QMJA 3TXZA 4YN5A 1XDIA 3LOTA 3QF0A 4DLFA 1SVDA 1YADA 4DWSB 1YNPA 4JN6A 4DF2A 2WSRA 4AB4A 4PMYA 5D2YA 3AI0A 1G67A 3O15A 4GUIA 3WK0A 1MQRA 4GBDA 1XYFA 3GXTA 4O11A 2J7FA 2F8QA 4MKSA 1UWUA 1IZJA 4DJEA 4MHBA 3TR9A 1UP3A 4PMZA 1QWGA 1UYQA 1R9YA 3NQ6A 2HJPA 4XD6A 3GXFA 4ATLA 2CBUA 3GHUA 2IPGA 4FR1A 3UNTA 3UXKA 3F5JA 4JHZA 4YTUA 1CXKA 1VZWA 3URBA 4HNOA 1XIGA 4YTSA 4CN4A 4IICA 4AD0A 3IARA 2NQLA 5MHBA 5M1TA 1E9ZB 1XLFA 2X40A 4BJHA 3E0LA 4JTDA 2XSXA 2HVOA 1K02A 3V18A 3GFXA 3QH2A 5DRCA 1I45A 2PDXA 3MV11 3WELA 4WZHA 1NQ6A 5CSUA 4O12A 2QV4A 1JL8A 1VFOA 1VCVA 2J79A 3DG6A 1KO0A 2TMDA 2GUYA 2CLPA 2J8FA 3KUMA 2EKCA 4GXMA 3LHYA 4AY8A 2BDQA 3HFTA 4ZL1A 3ARZA 3JR2A 3LI0A 1SW0A 2VWSA 3M0KA 1HKWA 5C55A 3NCOA 3NG3A 1SFSA 1VLWA 3HB9A 3V0TA 3GTIA 1BAGA 1CW2A 1GYNA 3HG5A 4ERGA 1GRAA 2C13A 4DNHA 1NWUA 4ZFMA 1OYBA 3IJ9A 4G1KA 4OV4A 2Z1BA 4O0QA 3W24A 2VZUA 4QAIA 4WHBA 1K8CA 1US2A 4L1WA 5G1YA 1K03A 1NELA 3AMCA 4K7VA 3CMFA 4MB3A 4PB5A 5HAOA 3CL8A 2OYKA 3NEHA 1BG4A 3H23A 1DXFA 2VC7A 4DX3A 2P53A 3W86A 4NSBA 2HZGA 3TH6A 3KVJA 1PZ3A 4MNLA 1F2JA 2ATSA 4GOAA 1OD0A 4AX6A 1TG7A 3TONA 4Q32A 1E6XM 2ZUNA 3GHSA 3NO1A 1EX5A 1GRTA 1C8XA 1K8XA 1R9XA 5CZKA 2NQJA 3EPMA 2Y24A 4OJYA 4A3RA 2XZ7A 1XL9A 4JDYA 4J3SA 2E9BA 4QJ5B 1DJIA 1TVNA 4OQVA 4KGLA 2GR1A 1F4HA 3QV6A 3EPNA 1Q7ZA 4Y9NA 1EJVC 5AYYA 1BKSA 1UD5A 2WSPA 4FLQA 1XLEA 3S4TA 1XLJA 4KERA 1YPFA 3L4ZA 3CHVA 1TPH1 3G1AA 4PL2A 2IPFA 5D37A 4W4QA 3ORWA 3L2LA 2ABBA 4TVUA 2JEQA 5EKYA 3IIOA 3RX2A 4I9JA 1SSGA 4WY0B 1PBGA 3LQGA 3PPCA 1LP6A 5CGMA 3F4NA 1VKFA 3RK8A 1GGOA 3OC4A 4F48A 3TDFA 4H4WA 3ITTA 3C3UA 3NQCA 5B80A 3BARA 3W9ZA 3BDKA 4QS5A 1DJXA 4HPGA 1MYRA 4JTFA 1ZKQA 1JCLA 3B8UA 3Q4DA 6REQB 3IC9A 3VILA 4H4IA 3IRDA 5M2FX 4UFMA 2Q3OA 1V3LA 1L6GA 4PCFA 4DZ5A 1AUSL 2WPBA 3S2CA 1OX6A 3MMWA 3GVRA 4J2MA 1EJXC 3T2OA 3SRFA 1TJ0A 1CXEA 4ZB2A 5KEZA 1CENA 3EWXA 4NAEB 1R7OA 2R1MA 3EA2A 1MEWA 2E5BA 3WNKA 2PFHA 3LTYA 3A7RA 1ONEA 3W7QA 1FWBC 4B9ZA 4FEZA 3E2RA 1AODA 3R8RA 3UZWA 3WNOA 2ZZBA 1AZ1A 2Q8LA 1FCVA 1FWWA 1JRPA 4M52A 2E67A 3KBMA 3GHRA 3IWPA 1ZENA 4W93A 1BZLA 5CZTA 3ABXA 3UG5A 5AHFA 5HK4A 2EJAA 5LNSA 2C19A 3EA3A 1FIQB 1FY6A 4RE2A 3WJZA 1HFBA 1V6TA 7A3HA 3QW3A 1W3TA 2ZUVA 5JXQA 4QQ3A 3CTLA 4R7WA 4XSLA 3H2OA 2ZOXA 3L4WA 3ME3A 3BICA 1CGVA 2E1DA 4FHAA 3KAOA 5DEZA 3VIJA 3BV4A 4Q8NA 3IUDA 4IPLA 3W6MA 3EDDA 3RR1A 2Z00A 5BZAA 4EQXA 4CD6A 2VDIA 3PC0A 3KCLA 4P61A 2QHAA 1C92A 3N4EA 5CPTA 1XINA 5I3DA 1W9XA 4FIRA 4C1KA 4FNRA 3WQDA 3VDBA 1MW0A 3N4FA 3M1ZA 1QW7A 3ZJ7A 1TCMA 3KOXA 6ALDA 3DGBA 1OJXA 3U6WA 3VIFA 4JCMA 3G2GA 3SR6B 2OFJA 3NM1A 4EXAA 3WFLA 2PODA 6ENLA 2E8ZA 3PPFA 3OLGA 3T2QA 2Z1VA 2V9DA 1X98A 4DXXA 3R89A 1PS9A 2GVEA 5A5WA 1OFAA 4Q4PA 1V0LA 3WD2A 1MQQA 4ZTYA 1UQZA 2HV5A 2CZEA 1ZUAX 4HZ6A 2GGHA 4M19A 2G4FA 7TAAA 4GQRA 3L0NA 2PLMA 1VH7A 1W3HA 3IPWA 3KBNA 4O10A 1S2CA 3W7GA 4RV8A 3VPLA 4FI4A 2Y62A 3ZWSA 3BJTA 5XIMA 1EWEA 4WXZA 2IPJA 3TC7A 1O66A 1HL9A 3GU1A 1L6WA 3EGJA 1MXDA 1NFPA 4DAFA 1ESWA 3QTGA 2ZZCA 4E8GA 3DN5A 3EOLA 3USBA 2ZC8A 1FCQA 1N7KA 1YRRA 5G1MA 4KS0A 1E0WA 3QSRA 3IIXA 2HVNA 1JNDA 5FJPA 4TTUA 5TQLA 1OABA 4QCEA 1I2OA 4UFJA 4RNHA 1AVAA 2OCZA 4D6CA 4C65A 4S3EA 3AYTA 3VUSA 4G2DA 4LV9A 3SUUA 3N2BA 1W1YA 1J0JA 1N82A 4PYSA 4EPEC 4Q7NA 5TF0A 3G3MA 3PN8A 4W87A 1AH3A 2EGZA 5H8MA 3EB2A 3Q2DA 4NYUA 1C90A 4N4PA 2ZADA 2V5BA 4OTKA 3WBEA 4O8RA 3NGJA 1NOFA 5HULA 2XUCA 4DRSA 3H26A 4O53A 2MUCA 3LRKA 3ZR4A 2Y1HA 4HHLA 2O4QA 3ISIX 3IIPA 4BR1A 4AD5A 1TPVA 2QUMA 2ZWZA 5CAKA 2WLZA 3AMGA 2G37A 1RPKA 3OOQA 4I6KA 5BXSA 3PPGA 3S1WA 3QR3A 2E1WA 2YPIA 4HPNA 4P7NA 5FJIA 2JF7A 4NHVA 3XINA 3BV7A 4L4MA 4L64A 2HBVA 4BY3A 2HEJA 3BZJA 3N29A 2VKZG 4NJGA 3IIZA 4XBSA 3M43A 1JD9A 2YCLA 1R87A 4C6MA 4LAKA 1YXYA 3MHFA 4J2PA 3NEVA 4C6IA 3M7SA 4JEJA 5BU9A 1FRBA 1I8JA 2CITA 5JU6A 4H4SA 3CWNA 1FKWA 3VMPA 1GYMA 4TIMA 3ZVIA 1RK6A 1EDQA 3VKBA 2FZMA 2VI0A 1TJPA 3TP4A 2NVKX 3P60A 1J5TA 2OR2A 5HMDA 2OZ8A 1ZAHA 3MDUA 3UZZA 2BLEA 3WJSA 2V3GA 2UY5A 3DK9A 1OCQA 3BAWA 3GD6A 1OGSA 1UD3A 3H2EA 1G01A 1E4IA 4GYPA 4DWSD 4KWUA 1R2RA 3VIOA 2PP1A 2BASA 4LB4A 1ELSA 4DXVA 3S5OA 1DORA 1E5NA 1PX4A 3PHAA 2VDGA 1W91A 4RDZA 3UPMA 4S3FA 4EPBC 3EDKA 5A2BA 3TNBA 5DCBA 2GGEA 4FF7A 2IXUA 4OHQA 1MXSA 1Y65A 3QQ0A 4D6HA 3KDOA 1U1UA 4LY4A 3CB3A 2OEMA 5A6AA 2FTWA 1X1NA 1N5WC 4DJED 4GIYA 3T81A 5K4XA 5F1VA 1DJGA 3FHAA 1VYSX 3VUPA 2R94A 3IVTA 1KLYA 4AYGA 1HO1A 1OGBA 1RQBA 2I5IA 4KMQA 3AQUA 1QI5A 1KRMA 1W17A 5D03A 4BQ5A 1H09A 1IEQA 2UY2A 5F2LA 4DO6A 4MWAC 1SO6A 3SCVA 4IF2A 3F2DA 4AD2A 2GQWA 4K38A 1R85A 4A35A 1IR1A 2R9RA 6CGTA 3P8JA 7REQB 4R88A 4XQ6A 2IUZA 2UWFA 3VYLA 2ZZ1A 4O52A 4AYSA 4C7GA 2JKEA 2WSQA 2ZRWA 4I7VA 3O07A 4B4HA 1VFHA 3P74A 3PFRA 3NUKA 2E0PA 4PTXA 3AZSA 1H3GA 4JX4A 1EWDA 1GEHA 4A6GA 4DNAA 4LALA 1VEPA 2XN2A 3MB9A 2J7CA 4Z0SA 2H3BA 4OOUA 4JBRA 1IEXA 2YVJA 2HQMA 1YTEA 5FEWA 3BSGA 3NYDA 1BYCA 3BGGA 3UJRA 5AB3A 3PWAA 4GVGA 2PD5A 5HXMA 5CG0A 2PWGA 2NSOA 3K8MA 2Z6IA 1JZ2A 4ICMA 3M6YA 2QCEA 2PURA 4S3GA 3S3GA 3CUIA 4CU7A 3UWUA 3OPSA 4I9AA 1HJSA 2CPUA 2PTZA 4EMWA 1YXCA 2WMGA 3L68A 1KXTA 1FHLA 2X1RA 2GRTA 1TWDA 2YCEA 4EF8A 1S5VA 5FJRA 1L6FA 3AXXA 3DXIA 4X63A 3PTQA 3V5OA 4ZA0A 4DELA 4KFPA 2O4MA 3GD3A 4WKHA 4UMBA 4B15A 4HGXA 3OBKA 2FJUB 3F5LA 5C9WA 1H0IA 3DAQA 1J2BA 5C8BB 2F2KA 5BCAA 4QFUA 5FS7A 4QGCA 3W73A 3TXVA 4PB3A 3LSBA 1ALDA 1EX1A 1M5WA 5CAHA 2Z1XA 2BODX 1S1PA 2ZX8A 3ARXA 3VNKA 3OYXA 2ZZ0A 1E51A 1QJWA 2VP8A 5BMXA 1J11A 4IXHA 4LAUA 2EPHA 1VFTA 4CVUA 3SN1A 1F3XA 2EPLX 2GWNA 3GBDA 3WUGA 3NTYA 3C86A 3MVIA 4F8XA 3H2CA 3DKLA 2YDSA 3LZ5A 4MB1A 5HR7A 2OU4A 2Z26A 1JZ4A 2A6LA 3GVGA 4BV6A 2QVNA 3AXIA 3WQ5A 3NXLA 5FAGA 4H8HA 1S7MA 1IT8A 4K1GA 2C3DA 3N17A 4GYJA 1OFEA 4FLOA 1GRHA 1Q5MA 2W0HA 5CEWA 1RM6B 2AKMA 3O0FA 4NI3A 1XBXA 1BF6A 2JK2A 2VVSA 3DK4A 5FJTA 1VJZA 5DRIA 3MKCA 3VX1A 2E40A 3FVDA 3A5VA 3VAVA 4A8NA 5I5RA 1MRQA 2GSEA 3UA4A 4AHOA 4H4YA 4J3WA 1VFUA 2WHJA 3NVZB 2CU0A 3G1YA 3I65A 1EBDA 3UF9A 1LWHA 3OO2A 3BVJA 1PB0A 4Y8EA 3NQGA 3KFTA 1EKOA 1XSKA 1DBTA 2NX9A 2GR0A 4HA1A 2QLYA 1A5AA 4I5UA 4KF1A 2Z6JA 4B3KA 4FLRA 1KM5A 4AU0A 1JNEA 5BWFA 3R58A 1IXPA 3WQPA 3WQOA 5CPNA 3B0XA 3FGCA 4NYYA 2PUZA 3N13A 1N8WA 4Z2KA 3N9RA 3PS7A 3WD1A 4XIMA 1O1HA 2PDGA 2ZRUA 4QG8A 3WJXA 4IM4A 4MWAE 1W9BM 2ON3A 5CGTA 2A3HA 2WWDA 2HISA 3FCPA 4P2VA 3MWAA 1OF8A 1JYWA 5LKYA 1Q2RA 2DDXA 2A0NA 3BG3A 4HCLA 5EY5A 2QPSA 4Q4QA 1TYPA 3M44A 2PDYA 2OZ0A 3EEGA 1V5XA 3SY1A 4PMJA 3T0TA 3TIMA 3OA3A 3RCMA 3DZ1A 1XD1A 3WBXA 5EYWA 2ZA1A 4RZ5A 2Z28A 7ENLA 4KIEA 3CEPA 2YJQA 2D0GA 3AMKA 3GO2A 4GY1A 4YWSA 4X9YA 3VCNA 5A3HA 3NVYB 3CXBA 4Y9PA 4XAGA 3RPMA 4ASTA 1VEMA 3BXWA 1FEBA 3MO7A 2WMJA 5HQLA 2Z4GA 1GEUA 4WY0F 2OODA 4UFKA 1GJWA 1XV8A 1DYSA 1KM6A 5HANA 1H2IA 3THAA 2IQDA 2PU1A 3W2KA 2PWVA 1MWOA 1SW3A 4FAMA 1CLXA 1UD6A 4W86A 4JEQA 4BKNA 2FKPA 3QPYA 2VTFA 2X7WA 3SCUA 4GCAA 3EXTA 4A2SA 5JMUA 2TRSA 1S3TC 5AOUA 4H4PA 1GKRA 1J4EA 3FVMA 3VTRA 5IFPA 1IHIA 3GK0A 3Q6JA 1WUFA 2VFDA 1VAHA 3KEHA 3W1RA 1XANA 4HA3A 2YQUA 4HZ8A 2C79A 1E72M 3KLJA 3V5FA 1EJTC 5HPOA 3LPFA 4LYPA 4GO9A 3BCFA 1DIOA 4UWMA 2W9MA 2CLLA 4JZ5A 4W8BA 4DI9A 1QPOA 3DFSA 4MY9A 3WYZA 3GXPA 3LGGA 3PANA 1QHOA 4W8LA 1ISYA 2PSNA 3VGGA 1JUEA 4DM1A 1W1B1 1SMDA 1XSIA 4Z1YA 3W7NA 2F2HA 2VMFA 2OWWA 4HMCA 1CPUA 4IGMA 4A8IA 4DYJA 4NT0A 4W84A 2EQ7A 3OLIA 3FEMA 5D9PA 3FAXA 3UVIA 4ATDA 1FHUA 4DUOA 4IP7A 2RFGA 3OYZA 5G5IA 3E74A 5AYIA 1TPFA 3ANUA 4PZVA 1GG1A 3DEQA 3WIJA 1WA3A 2WOWA 2B31A 1XFBA 3G77A 3HJZA 4Z2IA 3SZ8A 3KOZA 3ZJ8A 2W3SA 3AZRA 1JCNA 5KZMA 3QKZA 1VS1A 2BMBA 1PIGA 1Q1RA 1I0DA 1WV2A 3GD4A 1STZA 1XYCA 1JEHA 2F9RA 3L7RA 1L6SA 2V81A 1ISZA 3I7QA 3DECA 1Q8JA 1RP8A 4TVWA 3CLMA 1EJ7L 5FD0A 1YIXA 1WQ5A 1CXHA 1X39A 3ICJA 1XUUA 3QBUA 3W7EA 4IUOA 5C2GA 1HGYA 2J7BA 3W01A 5C71A 1W5MA 1PKYA 2WPCA 4B5XA 2DH2A 4PCPA 3TKFA 3THCA 3LV6A 5CJMA 4NNCA 4W85A 2O7QA 4O57A 1FOBA 1R47A 3WZ0E 2NPXA 3VFCA 3VIIA 2GOKA 3E38A 3WQWA 4B16A 3CT2A 1N2VA 4IJCA 3SO7A 2ISSA 1O5RA 4GI4A 1FXQA 3UGRA 1V93A 4OFCA 4REQB 3WBAA 1M9HA 3QMTA 2PP3A 3CV1A 3F2CA 2PDBA 4UFIA 3ABZA 3L67A 1Q6CA 1W3NA 4E8DA 2DZPA 2BVYA 4L1GA 5DMLA 1J2WA 1GRBA 4ZO9A 3E96A 4QJ3B 1A3HA 3UP8A 4U10A 4FNQA 2P50A 4JOMA 4Z08A 1H51A 2VJXA 1AL7A 2X2GA 4I6VA 5CBIA 2IXVA 1HG3A 1V6YA 3WN6A 3BG9A 3VOJA 1Q85A 2WBAA 2EQ8A 2P0OA 1UH2A 2RDWA 2XH4A 5GNXA 2QCFA 4LUIA 5KVHA 2E25A 3ZLFA 1CI1A 1A0DA 3QGVA 2PRHA 2OGYA 1OC5A 3ARVA 4RE0A 1GW9A 4K68A 3C0SA 2A7RA 2XH0A 5F7UA 3HQ1A 4H6RA 2RDTA 3WQVA 3B3DA 2YYTA 3EAUA 3GR7A 2VFFA 1KW1A 4IX0A 1UPPA 3ABOA 1T41A 4B5NA 1YDNA 3GG1A 4JTSA 1V02A 4N42A 1IZCA 2DZBA 1GQKA 4Y90A 1N61C 3ETRB 2PLKA 1XKYA 4ERAA 4GYKA 2G8ZA 3TWBA 3F2BA 3TX9A 4S23A 4FNTA 1V3JA 2DY3A 8RUCA 4M5PA 4YWOA 2B4GA 5E0FA 2GJXA 1B30A 4NNBA 4BHYA 5CGQA 3MQTA 3H53A 1LRQA 1D3GA 2RKXA 4IG2B 4YCPA 3LCHA 2JKAA 4M1BA 2XSBA 3UG3A 1XIMA 4IGSA 3EDEA 1VLIA 2VGGA 4WJXA 5D9OA 1MNSA 2HCVA 1V0MA 2AL1A 1MNZA 4FO4A 4M3PA 3MWCA 4MGGA 1XBYA 1CXIA 3BLEA 2ABAA 2QCHA 3GDKA 4W7VA 3W1AA 2VGBA 1KR1A 2FFCA 2CIPA 3EB4A 3CWOX 3ZR6A 3CU2A 3ARQA 1AG1O 5HPCA 3O7UA 2OEJA 5BRQA 5I09A 1S2UA 2YDAA 1ENUA 5CLWA 5F4WA 1JDCA 3GM8A 4C1NB 2UV8G 1E9IA 1QPKA 4UB9A 3V0UA 3QZEA 2ZUMA 4L6HA 3UWZA 1MUMA 3ONCA 4A29A 4IIDA 1NDYA 3W7CA 3QFEA 4F0MA 3KHDA 1U83A 2WKLA 2DGAA 5BXRA 2DT1A 4HNNA 4NKCA 2GJNA 3UR8A 3L5OA 1D7KA 2GH5A 1OFOA 1UUMA 3O6CA 4P8UA 3TW6A 4OOZA 2OJPA 1EUNA 4J4KA 4RX0A 3WH5A 1FWSA 5J5DA 4UOQA 1UMYA 1XF0A 2PE4A 2QJGA 4B3LA 1UROA 3CHDA 1LQAA 2Q02A 4Q8MA 3C2FA 4C6DA 1SQ7A 4QE4A 3RF9A 4Z1CA 2DPEA 2O9PA 1QASA 2TPSA 4PUJA 5CKSA 4Q7IA 1Q6RA 3W26A 3ZQ9A 3MZNA 5CSRA 2P5NA 5I03A 1OFDA 4AY7A 1I1WA 3BOLA 1XIEA 2X2YA 1VC4A 3WLJA 3B03A 3M0JA 2BP1A 3ARWA 3VNZA 3S6DA 3KXQA 4L9XA 2AAAA 1X7IA 2Q6ZA 4PRTA 4LF2A 3NPVA 3JZUA 1YEYA 3RR4A 3TYDA 2HS6A 1SJCA 1XG4A 5HMFA 1QMLA 5JRBA 2VC5A 5LHEA 3CYJA 1W9UA 1H6VA 1O7AA 2ZQ0A 1W5OA 2DSWA 1R5YA 2ZX7A 3E2VA 3R13A 2BXVA 3HGOA 4JYDA 4HNLA 5EL1A 3EKZA 3Q37A 5EGRA 3TAKA 4HVXA 1Z3NA 4W5UA 4PMQA 4PMDA 5A2CA 1TX2A 3LXCA 1EB3A 4XAZA 2PRMA 1Q7QA 4ZBCA 4IHCA 2JK6A 3NVDA 5JVLA 5D30A 2VDHA 2BOFX 4NU7A 1RY8A 3IV8A 3M0LA 3GNXA 5JH2A 1KRCC 1GJPA 1ME7A 3NJ3A 4PTNA 5D9MA 1XJBA 1RLDA 5CPLA 2X50A 4LXFA 3MO4A 4D8ZA 1VCGA 2GGJA 1B54A 2PDQA 3YPIA 1J0IA 2B7PA 2WMIA 1CB7B 3QC0A 3LCWA 4NVTA 2FPTA 2REQB 3DFOA 2OMAA 3G0XA 4FOKA 4D71A 1PYFA 2Q8XA 4JHOA 3SCTA 4HK6A 4WF7A 4ERIA 4GQQA 3W2JA 4M80A 3TW7A 2X05A 2POZA 1R3QA 4DXKA 1GQLA 1JF6A 3UR7A 5BYWA 4MWAA 1RR2A 3UXDA 1H0GA 4PODA 3NPXA 4OE7A 3LERA 4FSAA 1S5MA 1AQHA 3ZIZA 1UKQA 3WEMA 4HA0A 4OKDA 4GUFA 4EPDC 1XRTA 4C6PA 2NSXA 3WNMA 2DZAA 3M5XA 3NZGA 1QDSA 3WJYA 3H2MA 4DY1A 1QW9A 1E6SM 5B7YA 1TV2A 1Y5XA 4GK8A 1BYBA 1FP8A 3AM9A 2DVTA 3SR7A 5TAOA 3ES8A 3GNRA 4ZB0A 2OO6A 4RNFA 1VPXA 3ZFHA 3D9XA 4QROA 4LC8A 1WDRA 5DN1A 3AFBA 2XN1A 3CAKA 1NOUA 4C6KA 2R91A 1MRAA 4KPLA 1YMYA 3PPHA 3HMCA 1UJPA 4TMCA 4QEEA 2E68A 2NVDA 4CQ8A 1R86A 2Q01A 4LAZA 4GNJA 2YLAA 1HL2A 5A95A 1E3ZA 1JIBA 1NQKA 1Z9AA 5HNTA 3SUWA 2DT2A 3GIPA 3GDRA 3N12A 1C7SA 1QU4A 4E2OA 1E55A 3IK2A 2WKJA 1IGSA 3VIGA 2J9XA 4PMUA 1UWAA 1XIFA 2PBGA 1MSSA 4XAFA 3GH7A 2CHRA 3WQGA 2Z25A 1LBLA 1PYMA 1R3RA 3MUAA 3V36A 4NJHA 1GCYA 1NH6A 2WC3A 3E0IA 3M0ZA 3TOPA 2PA6A 2YDRA 4ALDA 3LMYA 4HNUA 1OFBA 4UMCA 4JQ2A 1PSCA 1A4MA 2NQHA 2AGTA 1G94A 3PTMA 4WDWA 4LUTA 4MJZA 4FLSA 2RABA 4WRHA 4UQAA 3S5ZA 1F6YA 2GVGA 3PWGA 4LS2A 3NZPA 2V2DA 3T78A 3MI3A 1S46A 3MCMA 3DFNA 4IMAA 1XRFA 4OV9A 3NS1B 4P7RA 1B9ZA 4RK8A 3VM5A 3QC3A 1VR6A 3NDZA 5A8MA 2AL2A 3R6IA 1UG6A 4QG9A 4GC4A 2WZHA 5I6SA 2WVVB 2JE8A 1XLGA 1Q6GA 3C2RA 4HYWA 2NXHA 2V38A 2GSJA 3W87A 3VMOA 1G4PA 3SURA 1BVWA 4M24A 2TODA 4YVVA 4AWTA 1E0UA 3BLDA 3O06A 1NTHA 3HGJA 1LUCB 2A7PA 5IRPA 1S38A 3CUFA 1G4EA 4EM4A 1FO4A 1O5KA 2WC4A 2X1SA 1V08A 3OVPA 1U1JA 1BF2A 4M6PA 4IIBA 3SCNA 3B4YA 2UY3A 5KZEA 5DCEA 3EWUA 2ZRZA 3L4YA 4TXEA 4AQLA 1CWYA 3LPPA 2C0HA 1LPFA 2WHKA 3VMNA 2CESA 5G4EA 3ARUA 5D2VA 4IP4A 3LHWA 3FJNA 3UJEA 2OWXA 3TV8A 5AC7A 2PWFA 4JQ3A 1OK4A 3DOPA 3STEA 2NXGA 5H1WA 1F3PA 1UR9A 3N2MA 2DW7A 4MNMA 2W92A 2X0HA 2DSZA 1Z44A 1KCLA 1W32A 1R3TA 3HM7A 3L21A 1ZMCA 1GZ1A 1VFMA 2QV5A 3L66A 3DUGA 2GLKA 1F76A 2OQYA 4JDBA 2HE5A 3MHUA 1CNVA 1XBVA 4PBGA 4XZNX 2E28A 4J3UA 3S0CA 3B8TA 2YCLB 3SECA 3PR2A 1UR8A 2R1LA 5T9CE 4DLMA 2YSWA 1XDJA 1ITCA 3PZMA 4H9YA 4RXGA 1OSEA 4GD0A 4P7LA 3S8HA 4WXYA 2YL5A 1GKPA 4U3AA 2SFPA 8A3HA 3ARSA 1D9EA 4MJ4A 2V5CA 3EMQA 4TX6A 1BGGA 2GDQA 3NQEA 1K7EA 2QAPA 1FWFC 3DDMA 1W9PA 3EPOA 1TE1A 4TTGA 1U5VA 1S39A 3S1UA 1XRVA 3JUGA 1UCWA 4YLWA 2W67A 5LIWX 3UJSA 1BXCA 4LYRA 1FWJC 3K13A 3UG4A 4CN6A 4LGXA 3ITGA 1R2SA 4JY8A 4PMOA 1I0BA 2UZ9A 1I6NA 4AWUA 3AJ7A 5DANA 2ZC1A 4I90A 1GQNA 3R11A 2PLJA 1JZ8A 1MMFA 3K4WA 3L2MA 3GWQA 1ISXA 2FH6A 3M46A 3LCXA 5H6HA 1BSIA 2REQA 2XSAA 2QYGA 1QK2A 4RPPA 2NLYA 4EANA 1RPXA 3H7VA 3B9EA 1XDMA 4H00A 2PBOA 1LYXA 3OQEA 3IGSA 4WEVX 3EWDA 1QI2A 3DHPA 3UWEA 3P6LA 1K77A 4ACYA 4G7FA 3QKEA 2WXDM 4Q4KA 4AXNA 5FS8A 1N8FA 4L7ZA 3PG8A 1XICA 4N9BA 1IXQA 3BG5A 1H4PA 3CUZA 2G41A 2OQLA 4RJEA 4B5VA 3DH9A 4Y96A 4HMDA 2VHLA 2O9RA 1UBSA 3CZEA 1PO9A 4GUJA 2VX4A 3LY0A 1TVLA 1QPRA 3G24A 1XYBA 1AOGA 4LF1A 3PUOA 4MFDA 3EAOA 2RHGA 3OIHA 1KQYA 4WGHA 3ITVA 4MVAA 4H2HA 1OF6A 4ZE5A 1GZGA 2J62A 1OZQA 3S1GA 1XLMA 4DO5A 3GXDA 4CEXC 3KWXA 3MUIA 1QK0A 3CH0A 3KL5A 3WFZA 2QJIA 4C5YA 4UTUA 1M01A 5DQPA 4J40A 3FDGA 4DJFC 1NP2A