3K1GA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ser-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
354
structure length
354
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
total genus 124
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3k1gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3k1gA01
2PPGA 5FJOA 3P93A 3VDGA 3JW7A 3OZYA 2P8BA 3STPA 4MGGA 3VC5A 3GC2A 3R1ZA 2PA6A 4A3RA 2GGIA 2OPJA 5FJRA 3PK7A 3N6HA 1MRAA 3ZVIA 1R0MA 3TTEA 4FI4A 4JN7A 2QDDA 1MUCA 3T8QA 4A35A 4IT1A 1P48A 3RGTA 1NU5A 4H1ZA 3I6EA 4HCHA 4MMWA 2PTZA 2OFJA 2PTYA 3OW1A 3MUCA 4IL0A 2XH2A 2FYMA 1KD0A 2P8CA 3V4BA 3QLDA 1EC7A 2FKPA 3NZGA 4JHMA 2OX4A 3CK5A 2XH0A 3ENLA 1TKKA 2PGWA 5FJTA 3DG3A 4DXKA 3CB3A 4HNCA 2OO6A 3SJNA 1W6TA 3CAWA 3SN1A 2PP1A 1EBHA 4HN8A 3ZVHB 1SJAA 2AKMA 1TE6A 3UGVA 3SN0A 2PS2A 2XSXA 3VCCA 2HXTA 1KKRA 5EU9A 4K1WA 2PODA 4ZA0A 2O56A 2PP0A 4E4FA 3CYJA 4E4UA 2OZ8A 3S5SA 2PMQA 3R0UA 3UXKA 3MWCA 2XGZA 2PU1A 3CXOA 2MUCA 2RDXA 1EBGA 1KCZA 4HYRA 4IP5A 3U4FA 1WUFA 3R25A 3D46A 3DG7A 3N6JA 3MZNA 3UCCA 2OZ3A 4YWSA 2AL1A 2XH4A 2ONEA 2P0IA 1BQGA 3ES8A 4J3ZA 3MSYA 3EEZA 2OG9A 1BKHA 4MKSA 1R6WA 4M6UA 3DEQA 4IZGA 3T9PA 3TOYA 3QN3A 5ENLA 3TCSA 3ZLGA 4H2HA 4KWSA 3V3WA 4GIRA 2QJJA 2ZADA 2AL2B 2GGGA 3H7VA 3FXGA 3UJEA 2DW6A 5IDZA 3FYYA 3TWBA 1KKOA 3UJFA 1XS2A 3FV9A 3SN4A 3P0WA 1JCTA 1RVKA 2GSHA 2PP3A 1IYXA 3SQSA 4E6MA 1JDFA 3QKEA 4GYPA 3DERA 3DDMA 3THUA 3RO6A 3DESA 3NO1A 4A6GA 2QJNA 3ZLHA 4G7FA 3FVDA 3ZVHA 2OVLA 2GGHA 1MNSA 4HPNA 3N4FA 3GO2A 4K2SA 4GGHA 2PSNA 4K8GA 4E5TA 2AKZA 3UXLA 3SBFA 4Z17A 2PTWA 4Z1YA 3K1GA 1F9CA 4G8TA 5J04A 4HCLA 3DG6A 6ENLA 1JPMA 3N4EA 3KUMA 1SJDA 4HCDA 1ECQA 4DN1A 2OZTA 3MY9A 4KEMA 3R10A 3BOXA 3U9IA 5BOFA 4EWJA 3I6TA 3IJIA 3VCNA 2HXUA 2PGEA 3PWIA 5FJUA 4GGBA 4E8GA 3MQTA 3TQPA 3T4WA 1MDRA 3SSZA 3FCPA 2OQHA 3P3BA 3QPEA 4X2PA 3TWAA 1JPDX 3H12A 3TJ4A 3PWGA 4JN8A 4M0XA 3VA8A 3I4KA 2AL2A 2PTXA 3PFRA 3HPFA 2MNRA 1EC8A 2QGYA 2HZGA 3JVAA 2OLAA 3UJ2A 3S47A 1L8PA 4KPLA 3B97A 3Q4DA 3RITA 1ONEA 5BOEA 2CHRA 3R11A 3ES7A 3IJQA 1WUEA 2PCEA 3VFCA 1NELA 3EKGA 1SJBA 2ZC8A 3DFHA 2GGEA 4ENLA 1OEPA 2NQLA 1SJCA 3BSMA 3OZMA 2DW7A 3NXLA 3TW9A 4DX3A 4IHCA 3H70A 4H19A 3V5FA 2OKTA 4ROPA 3ZLFA 2POZA 3GY1A 3UJSA 3D47A 4GISA 1ELSA 3OTRA 1E9IA 4DWDA 4IP4A 3DIPA 4F4RA 3QTPA 4DHGA 3NFUA 3DGBA 4KT2A 4GYPC 3T6CA 4H83A 3VC6A 3OPSA 3RRAA 1FHUA 3IJLA 3FJ4A 2GL5A 4IL2A 2OQYA 3MKCA 3Q45A 2GDQA 2QQ6A 1MDLA 1EC9A 1FHVA 3H8AA 3CT2A 1TZZA 1PDYA 1YEYA 3JZUA 4HNLA 3RR1A 3UCDA 3TJIA 1XPYA 4GFIA 2QVHA 2GGJA 3BJSA 3V5CA 2HNEA 3DFYA 2QJMA 3UJRA 3R0KA 3GD6A 3RCYA 2PU0A 1DTNA 7ENLA 3IK4A 4ZCWA 2XH7A 2P88A 2P3ZA 4DYEA 1PDZA 1P43A 4J1OA 2I5QA 2QDEA 4GMEA 3OP2A 5FJPA 4FP1A
chains in the Genus database with same CATH superfamily
4E8DA 2QDGA 2W54A 1PPIA 2FB2A 2OT0A 1AZ2A 1ZAHA 3CWHA 3UBPC 3VDGA 3W70A 2OOGA 3FA3A 3NNTA 2C8NA 3OZYA 4GUGA 4MHBA 1GOWA 4GH1A 2VQUA 1NDZA 1IT0A 2PA6A 3E49A 4M1BA 1ISYA 1TWDA 2WNZA 3TTEA 1XX1A 2C0HA 1AD4A 1V7YA 2ZZ5A 2A3CA 5LKYA 5C2XA 4IIEA 1GVRA 3MP4A 2WWDA 2CZEA 3L68A 3IJDA 4KRTA 2YL9A 2O9PA 4OQVA 4ZQNA 4XSLA 4WZHA 3KAOA 1HKJA 2YYTA 3GHUA 2Y7GA 2C1HA 4WF7A 3LDVA 2DT0A 4GWEA 1UZ4A 4Q8VA 4UOQA 3TN6A 2IS7A 2VCAA 3W07A 4GVHA 4D6CA 1T5AA 2PDBA 4DZ5A 1KTCA 2YXOA 1PJ9A 4EM4A 1B1YA 4DWSB 4HMDA 2AKMA 4U2YA 3B8DA 3SN0A 5B80A 2CITA 2PS2A 4Q8QA 2ZDSA 4PB4A 3VCCA 3PM6A 5I09A 4PR4A 1VS1A 3SZ8A 2A79A 3IUDA 1QBBA 2NVDA 3T0DA 3U2CA 6XIMA 5AHMA 3LQLA 4E4FA 3F5KA 3UWUA 5FF0A 2RDTA 3QMRA 1M6JA 2ZYFA 3UXKA 3HN3A 3CXOA 4RW3A 1CWYA 3WJYA 4H9MA 5EKYA 5I2UA 3H2EA 2HDJA 4I7UA 2ZUSA 5HK4A 3DG7A 4GLEA 1BRLA 4O11A 4ZODA 4B5TA 1B4KA 1RH9A 1PKYA 4IXHA 3M41A 4OU1A 5BRPA 3RNMA 3MVTA 2QW5A 3WF0A 1AQ0A 2YW4A 3W2JA 1DWGM 3ARYA 3TYCA 3ZLGA 3S2MA 2Y8KA 1FH9A 2CLKA 3QVQA 1C29A 3OHIA 3W29A 4EX4A 1J6OA 2IPJA 1WAUA 1MQPA 4XZLX 4U33A 3UW6A 4PTVA 4JTAA 3KCJA 1JRBA 1J2WA 1U1UA 2IKHA 1VJZA 3PG6A 4NP7A 3OU8A 2OJPA 2GSHA 1FWBC 3OQ8A 3C52A 1QNQA 2ZA3A 3B0VC 1KGUA 2BDQA 3NVYB 4GYPA 2R14A 1YPIA 1N7KA 3AYSA 3EZ4A 3VKCA 4PN2A 2YVFA 1POKA 3MCNA 3OG3A 3OHMB 4DJFA 2HMCA 4QQUA 1OK6A 4ZQPA 1KM0A 1DV7A 5I77A 2NQHA 4Y2WA 3CXBA 1R47A 4LALA 2QCGA 3CO8A 4PSPA 2AQWA 1XH0A 4B5XA 1GGOA 3C4UA 4BF9A 3F2CA 1X38A 2Y24A 1MO0A 3CNYA 1B9ZA 5BWFA 1A0CA 4DJEA 3TVAA 4K1GA 2BNJA 3ZZ1A 5C9WA 4QE5A 1C8YA 3W2MA 2NT0A 2ZX5A 3EX1A 3QHOA 3W00A 4HD5A 3GX9A 2Y7DA 1OFDA 2WYSA 1XBXA 3GKAA 3SGUA 7TIMA 4ZO6A 5HAOA 4IJCA 4NU7A 4E8GA 2YCLA 3UY8A 5CKSA 4H7VA 2D3NA 1F61A 5CZJA 3TQPA 4RCXA 1Q7ZA 1NFGA 3TH6A 3IGXA 4GYKA 2RAGA 5EPDA 1BF6A 4R9OA 4GIYA 2ZX8A 4WKHA 3JR2A 1XIGA 1MZRA 2ZUVA 1NM9A 2IXVA 3ZFHA 3RG6A 2YDQA 4AZCB 1ECEA 1I75A 2QGYA 1HUVA 4PSRA 4C6PA 3EOSA 2O9TA 1YPFA 4XK2A 5D02A 5HNRA 5D9MA 2EXOA 2GQAA 2ZRWA 1Q4NX 4MDOA 5FF2A 4MOZA 4H9XA 3ARTA 1XRSA 2J77A 2CFYA 3AIWA 5K3VA 1UOZA 1S2AA 1EXPA 3JU2A 4PA8A 1M3UA 3OGVA 3DFHA 1UQZA 1XFCA 1EX5A 1CIUA 4JFUA 1O60A 2RGLA 4UFIA 4DX3A 4CQDA 1JOAA 3I3BA 3WQOA 3H70A 3B4YA 3WQWA 2GUUA 5HOSA 2XINA 3ITLA 2YXGA 4J2PA 2OKTA 3GNRA 2RABA 4Q8PA 3LQGA 4O53A 4ROPA 1VB9A 3ZLFA 4AG0A 4WDTA 3TMLA 1EJUC 1IXPA 1R2SA 3G77A 3OTRA 3B8IA 3QTPA 2UZ9A 3O1NA 1NWRA 4KT2A 3UESA 1TPWA 4F8XA 1G0CA 3VC6A 1YDVA 3K8KA 1A0EA 4D2JA 1TJ0A 1H2JA 4L4MA 1FFQA 1BVNP 1X97A 3IGSA 3VE9A 1JYNA 1QU4A 3H53A 5FA5A 3CV1A 4UC5A 4NAEB 3WQ6A 1UH3A 1E4IA 4D8AA 4Z0SA 4JFVA 4HK5A 8A3HA 3IVTA 1YEYA 2YR1A 5BZAA 1SW3A 1YADA 4UWMA 1FFRA 3HGRA 3C2YA 4FS9A 3V5CA 4PTDA 1WYIA 2YXXA 3ITXA 3W7QA 3LI1A 2PLJA 4TTGA 5U1OA 2HPIA 4O12A 3FAXA 2FFIA 3BAJA 1Q6DA 4IUOA 2DV0A 2QJHA 1GZ1A 1PS9A 2VRJA 4YU1A 3QV7A 5FF3A 4K3ZA 1YXDA 4AF0A 4IICA 2D3LA 4F2BA 1WDQA 1OK4A 1L6FA 1J01A 2QPSA 4P7RA 4UR7A 1QPOA 2P8BA 2E5BA 3FSTA 1RUSA 3GC2A 3SIMA 1BG9A 4MPKA 5K4XA 4CVWA 3UR2A 2BY1A 1E55A 1LOSA 1IE7C 3EOEA 4JBRA 3LSBA 4C6BA 3REQB 4Q3MA 3MJMA 3KBNA 4ES4A 1SO4A 3IV8A 2PUZA 3AHYA 3BCJA 2AMXA 3TSBA 3TYEA 3O9NA 4REQA 1V77A 5XIAA 1E5JA 3OW1A 1UWAA 3HFYA 2GJPA 4OFCA 1YX1A 4KW2A 5M03A 4AD0A 2A21A 5AVNA 3O3RA 3F5LA 3FIGA 4BWLC 3GXTA 1ZJAA 2CXEA 3W83A 2VC9A 1L6GA 2XFFA 1BQCA 2WCGA 4DO7A 3E12A 4V28A 1V0KA 5CAHA 4WOQA 3WNOA 4QLKA 1PX8A 3S1UA 4O18A 3LLXA 2ZRYA 4DZHA 4M7TA 3IVSA 3F2BA 3WH5A 2WNQA 3LS9A 2G50A 2EKCA 1W5NA 2J24A 1XCFA 3SDOA 1WX0A 3W27A 3OJGA 3WQCA 2E9BA 1UKSA 2CZ5A 3KBJA 5HATA 4NZ5A 2VEMA 4AC7C 2P3EA 1KA9F 1US0A 5JCLA 2VTFA 5C2GA 4YMZA 5HANA 4DLFA 4JOMA 1FQ0A 4UTJA 3NTYA 1WE5A 2EPMX 3SFWA 2J25A 2GUBA 3W75A 2YX0A 3MZNA 1NAL1 4H7ZA 1JZ7A 3FJLA 2VOMA 4TV5A 4ERIA 3VIIA 1AVAA 3FXYA 2NXHA 3TOYA 3VOGA 1MRQA 2OQLA 3N2BA 3WNLA 1YKWA 1NP2A 3W26A 4JICA 3WLPA 3AHTA 2OLSA 3T0TA 3PWAA 3QKZA 2WNNA 1E71M 2GDVA 1VCGA 5D9PA 1JZ4A 3B0XA 3FYYA 1K9TA 1KKOA 2OWXA 4LAMA 4X61A 1JCTA 3AMCA 4HTYA 4HA0A 2QGHA 3RLVA 3TJXA 1LLWA 4MY8A 1ZLPA 2ACSA 1RBOB 2DT2A 3GVGA 3L5MA 3C8FA 1XGEA 3CHDA 1SR0A 3BGGA 4XUGA 1JUEA 2H6RA 3CHFA 5KMYA 2PRMA 3BSHA 4DNMA 3GC5A 4H4SA 3S8HA 4ZOHB 1FRBA 2I56A 4MZYA 2E67A 1XBYA 1K7FA 2X0HA 1XLBA 1XLKA 2XU2A 5I3GA 4OE7A 3AMZA 5K9CA 5JBFA 4C6CA 3SRHA 1QCWA 1Q6QA 2XGBA 2VRKA 4F0SA 1UOKA 1E0XA 1LBFA 4L7ZA 1LG2A 1OF8A 3SUSA 1GPFA 3W7HA 2WMJA 1W1TA 1OFQA 3KTCA 5KZ6A 1S7MA 4UMCA 3NQDA 3BOFA 5CCZA 3I3EA 4Q4MA 3H2AA 2REQB 2DU2A 2FGBA 4Y8EA 1S3TC 3F1QA 3SIZA 2YAUA 3IACA 4U28A 1NVMA 3P2VA 3FCPA 3TWAA 5CAKA 4RV8A 3W24A 5A6MA 1TWZA 1GRFA 2DPEA 2V5CA 1PHWA 3TFCA 2GJNA 3LSCA 3SCRA 2HBVA 1FWGC 1HO4A 2QUUA 2BWGA 1RQBA 2WSKA 1KFLA 1XIFA 3II4A 4CU7A 1E0VA 5F7UA 2VM8A 5I3HA 4FX8A 1SO5A 2WAGA 2FHBA 3NYZA 3W81A 1PHQA 1UKOA 3LTSA 3G8EA 4Q8OA 4J57A 5IHSA 2DVUA 5PTDA 3VGBA 5I78A 1XIDA 3HRDC 1T8QA 1SFJA 2YB1A 3EB3A 4DBDA 4JTEA 4UUIA 3CM4A 4EXBA 4IJRA 2YBTA 1Z41A 4YIWA 2ZUMA 3MHFA 2D23A 3TW9A 3LM3A 4HGXA 2FLIA 2Z0IA 3LGDA 2AMGA 4JTKA 2HVMA 1KV5A 1XLFA 3E74A 5EGRA 5D32A 4JDBA 1H61A 3NZ1A 2QNEA 3LPOA 1GG1A 3UU0A 2P76A 4CQCA 4UCGA 4KIRA 4UZUA 3Q67A 4DWDA 2O55A 3HBLA 3U3HA 3BE7A 4IMAA 1BSLA 3WH9A 1XIMA 2H9AA 2ZVRA 3E0VA 3T07A 3B8UA 4H9VA 4A3QA 4TX6A 2CU0A 2ZWYA 1DJNA 4N4QA 5E0CA 1JGIA 4G1KA 4BK9A 2ISDA 4G7EA 1JUKA 2FB3A 2VZVA 4MB1A 1GVQA 1AL8A 3CWOX 4LUYA 1YIXA 4BEQA 3QQ0A 3AHVA 3NG3A 4Q6XA 4P8VA 4PCSA 3RR1A 1ZK7A 5EBKA 2JALA 1UIOA 1YDNA 1IHIA 3PPFA 3BW3A 4YJ5A 3VDBA 3S2CA 3VIFA 4S3JA 3ZT6A 2BCPA 1EA9C 2PURA 3S6TA 4GH3A 3P0XA 5FEZA 7ENLA 2FMOA 5CBJA 1E4NA 4XISA 4QGCA 4IMFA 1VR6A 3FDKA 4J1OA 1LDCA 1S5VA 1OSEA 4HU4A 1BRLB 2TMDA 3HPZA 2JEQA 3N17A 3RX2A 2NPXA 1J5TA 1SW0A 5K7JA 1KFWA 1RQEA 2HE8A 1PYMA 4IXXA 4GNVA 3VC5A 4DPPA 3EA3A 2YFNA 1Z7AA 2GGIA 3WEMA 2J7BA 4K8HA 5D2TA 4X0NA 3ZR5A 4KEZA 3TN4A 4E8CA 5BXPA 2JIEA 2PLMA 4J3SA 4EK7A 1UPPA 1QO5A 4H1ZA 2ZRUA 1UZ1A 4AW7A 1A5CA 4PMUA 1KM5A 2XH2A 1E51A 1X1OA 1QK2A 3V4BA 4UTMA 3W02A 3F4CA 1N55A 2VC6A 4L1WA 1ZP4A 2OX4A 3GKFA 2JKPA 2X16A 1MSSA 2XIQA 4ZQRA 3DG3A 3F4WA 2WPBA 3APTA 2C91A 3MDWA 4HQVA 3TROA 4GY0A 3U5UA 5C9XA 3AXMA 4JXCA 2BOEX 1KCXA 3ZJ8A 3KOWA 4R7WA 3VCRA 2OGYA 2XG9A 4WDXA 3R6IA 1JZ8A 4NKCA 1LVLA 2O4QA 2DDXA 2AQOA 5CC3A 2DT3A 5IDIA 2A7NA 4DBSA 4W7VA 1ZTVA 3ARVA 3G24A 1N8IA 1KC7A 2Z24A 1NY1A 1TVNA 3D9XA 2UY3A 3AYTA 4KIEA 4PMDA 1V6YA 3MUY1 4XBKA 5FD0A 2E5AA 2MUCA 2VO5A 1EBGA 1KCZA 3QJAA 1EJXC 1RCOB 4HK6A 2IKJA 5GJPA 3F03K 3PS7A 1A5SA 3SCWA 4FALA 4C6QA 2AL1A 2YCLB 3ZO9A 2HE5A 1XH2A 4GOAA 3CZEA 4XG1A 2GVJA 5AHEA 1A47A 3SUUA 5AY7A 5HMDA 2WMKA 4LNCA 2XGIA 3H2FA 1E9YB 4XTDA 2EQ6A 3W73A 3HMCA 3R5EA 5H2ZA 1CI1A 3BZGA 4XAPA 3T0AA 1DE5A 3H7VA 2NLIA 4O1DA 3GNXA 3P84A 1PO9A 4C1LA 9XIAA 4BQ5A 3VGGA 1TELA 4K36A 1ZZMA 1OT2A 4AZGA 3SN4A 3V0SA 2PC8A 2PP3A 1QRQA 4E6MA 1JDFA 1BGAA 2E7FA 3PJXA 2EJ1A 4YWIA 2WHJA 3DDMA 1IV8A 2R82A 4N9BA 3SM0A 3ZVHA 1MW0A 2J6VA 3T2OA 3GW0A 1M7OA 1VFSA 2BVYA 2H90A 5GPRA 5I00A 3LXBA 4L6DA 5F4XA 3LB0A 3T1GA 1UJQA 2Z1XA 3MKKA 3B9AA 4C5YA 2Y70A 1ZKQA 4HCLA 1H49A 3GG7A 3SADA 3FLUA 1K8CA 4AH7A 1UWUA 2VCCA 2X7WA 3EB2A 2C7FA 3EAUA 4A22A 2NW0A 1SO3A 5LNRA 1EB3A 1GJPA 4Z2KA 3O7UA 4EWJA 2X8GA 2WCAA 4PFMA 2IPGA 1UR4A 1O5XA 3CUIA 3MMUA 3TIMA 3PWIA 3TW6A 1UD4A 4WOZA 2E5DA 3K30A 4XVEA 5DY3A 3LU2A 3OG2A 1JNDA 4XD4A 1KM3A 3H4WA 2QIWA 4V2XA 4EPDC 3LCGA 3M0VA 1SFTA 3WNMA 4RW5A 1XLCA 4JNMA 4JN8A 4WGHA 3AXXA 7A3HA 2ZQ0A 1YRRA 6PTDA 1KTBA 2WM0A 4Q8UA 2OLHA 5DT5A 3GG0A 1ONWA 2MNRA 3L4XA 2HZGA 3UPMA 3CZKA 3UXAA 2NLYA 3WH8A 4RZ5A 2E4TA 4WXZA 4G5DA 3W6LA 4GVFA 3GM8A 5AZ1A 1PAMA 4V27A 4H8HA 1Q45A 2QYGA 2PCEA 2VKZG 1E6QM 5HWMA 4AF0B 1NWUA 1SJBA 3WMCA 1TRDA 4DBEA 2YLAA 3VD5A 2Y61A 3VIHA 4S23A 1NHPA 1S5WA 4DXVA 4DUWA 1OX5A 4RDWA 1DWFM 3LYEA 1IWPA 4PRRA 4V1YA 1CBGA 4P5UA 4FOUA 3GNPA 3A7AA 2DGAA 2BLEA 1OC6A 5BWAA 3TW7A 3LZ5A 4P2VA 1W1YA 3AICA 4ZXLA 1E9LA 3UY7A 2POZA 4M81A 3QZEA 4REQB 1GQLA 4EWND 3G0SA 1HGWA 1GRGA 2FH8A 1E9IA 1A5LC 1NH6A 1E9ZB 2A6NA 3AOFA 9RUBA 3MHGA 1WDRA 1EF2A 2XFWA 5B7YA 1W31A 3ZIZA 4HMCA 5KETA 3CQ0A 4KF1A 2JK2A 1LTDA 2Y8VA 4NZ4A 4V33A 5AC6A 2E1DA 3VNJA 4DWSC 2ICSA 4GI8A 3SI9A 3QF0A 5A8QA 1KM6A 3NXFA 1SSGA 5CGQA 4ZO7A 3DAQA 3SCVA 1TZZA 4ZE5A 1I2PA 4M7SA 6XIAA 1W3KA 3CZGA 1QHPA 1FXPA 3MA8A 3LHZA 4CEXC 3PNUA 1IXNA 5G4WA 5LA0A 1YDOA 4HA3A 4B3KA 3TCEA 2PB1A 4DUVA 3DKJA 4A29A 3F4DA 1MWOA 2P3ZA 3W22A 1SMDA 1HJWA 3AXHA 3V0TA 2I17A 5CZTA 1UWTA 1BKSA 1AQMA 3U6WA 1EDTA 2A1YA 4Y96A 1HG3A 3TR2A 1KRBC 2INZA 3IJ8A 3W85A 1JPKA 1O66A 1FUYA 5AYBA 3POCA 3ERPA 1GOMA 3R1ZA 2G3IA 3TXVA 1D7YA 3OLGA 1TR9A 2CLEA 4WJ8A 2GJLA 3VIMA 3LCHA 3VGFA 1MXDA 5FEWA 3ALGA 3B04A 4O1BA 4FA3A 2CKRA 2WM1A 1H50A 3GFZA 1S2TA 1K7EA 2FYMA 1ME8A 2DQXA 3MI6A 4MJ2A 2TPSA 1TIMA 4PMQA 4QNWA 4QG6A 4MNLA 4FR1A 1TWSA 3ARXA 2PGWA 4DXKA 3ITGA 5I0DA 1W6TA 2XFYA 2INFA 5EYWA 4LS1A 3P5ZA 3OVRA 4Q8NA 3UVAA 1EH9A 3B06A 4DZIA 3RXZA 3A7UA 4AC1X 3UFYA 4URIA 4UTWC 5G2IA 2F38A 4QSFA 5D38A 1HGYA 1OFEA 4UNIA 5EMMA 4ZA0A 4V1XA 2V3GA 4MB4A 5D04C 3VK5A 1GERA 3L9CA 4MVAA 3WSUA 3GVVA 2EQ8A 4PMXA 4UQBA 3TU9A 3BO9A 3LGEA 3RMEA 2W67A 5E6YA 3DGRA 3U4FA 3NQBA 4DQWA 1BHGA 3BANA 3BLEA 3MP5A 4PMJA 2FHFA 5EY5A 3QC3A 3AU6A 3CUXA 3AIUA 1BQGA 1TUXA 1X1ZA 3EX6A 1SZGA 1GSNA 4CD8A 4BF7A 4IMCA 3WFLA 3N9KA 1YTDA 4JTLA 4CCCA 2WP6A 5D2XA 3CBWA 4W88A 4IFOA 3L12A 4GX8A 3OBKA 2ALRA 4QE4A 3GNDA 2W66A 3M0HA 4NYYA 3W7LA 1Q6RA 4KPRA 2OSYA 1P6WA 4XAYA 4W89A 3AIBA 3DERA 1TA3A 4NZFA 3WJZA 2VGGA 2YDAA 5LHFA 3N29A 1LLZA 3GYEA 3NO1A 2ALDA 5CPTA 4X9YA 3IIXA 2QAFA 3USBA 3N18A 5LIUX 1KRMA 1XANA 3C2EA 4HOXA 1UD5A 1WDPA 1MFUA 4N7QA 2W63A 2WZMA 1OC5A 2YGYA 1I2RA 4GZEA 4CUCA 1US3A 2AKZA 3UXLA 1UD6A 4BV6A 1W5QA 5TAOA 2E28A 4JTJA 3DBPA 3CJPA 2G97A 3W72A 1OB0A 1KQZA 3P7YA 2X1IA 2PDPA 1AMYA 5D03A 1UA7A 4EXQA 3DK9A 5FACA 1DNCA 4XAZA 2VP8A 3M7WA 4Z2IA 3BOXA 3W1AA 4G7EB 3LZ3A 4W8AA 3C86A 1FWRA 2HXUA 1A3XA 3M4HA 3W7RA 4MF4A 2J74A 1JYXA 4LEQA 2RUSA 3T05A 5DELA 3DI0A 3MP3A 3SSZA 1Q4WA 5A6SA 4HK7A 1JPIA 1SGJA 3W1NA 4XB3A 1TV2A 1DQXA 2A7PA 2V5KA 3BC9A 3NM1A 1V79A 3NQVA 4C6IA 4TVWA 4AFYA 2BVWA 3VNDA 4H4WA 3WLLA 5JQ9A 1VC4A 2BVTA 1U1JA 1GHSA 2YA2A 1TV8A 4S3FA 2PTXA 3AALA 3WUBA 1SVDA 1BXBA 1IXOA 3H23A 2AGTA 4JTTA 4KBXA 5AHIA 3GIQA 1EQPA 1ONEA 1C90A 3R11A 3VUPA 2VYOA 5AHLA 4ZEPA 1MEWA 3EKGA 5A8MA 4GRTA 3TQKA 3URAA 4FMVA 4S39A 4LAZA 3W53A 3KZPA 3G3MA 4TU1A 2EKGA 1QW7A 4DIAA 1NDWA 1B31A 3RK8A 4BS0A 5BMXA 3WQGA 1OX4A 1XXXA 4NILA 4Z1CA 3B3DA 3VPLA 1CX9A 1JQVA 4JEQA 2BTMA 3CPRA 1FBAA 1GYNA 3GXFA 3H4XA 1TV3A 2ESCA 3MUAA 1GW9A 3IAQA 2ZIDA 3CHEA 4ZL1A 1PKNA 2G3FA 4UTLA 1ONRA 1UZHA 3T7VA 4HZ6A 1XD0A 2C3CA 2ATSA 1MUMA 2I9EA 4JTFA 1BVWA 2QQ6A 3CU2A 3RX4A 1QPQA 4WSKA 2PDFA 3UCDA 1K4GA 4MLJA 4JIPA 1QNVA 4S3GA 1KM4A 1FFVC 4U3AA 1CXHA 2BODX 2C13A 3GDRA 3XISA 1AJ0A 4OOUA 4U2ZA 2GZXA 3LRLA 1NWSA 5CPNA 2VX7A 3ZJ7A 4LB3A 1GK8A 2FZ9A 2DUXA 1W1PA 1CGVA 3UWEA 1R3RA 4B2DD 5FS9A 3I7RA 3AZTA 4U10A 1LOQA 4B3ZA 1FWWA 1Q8JA 2ASHA 1NDYA 1PYFA 3UR5A 3C6CA 5FJOA 3C0QA 3E0IA 3EMCA 3HOJA 1N60C 3STPA 3URBA 1T99A 2OPJA 5FJRA 1J2BA 1W37A 1G67A 4NL1A 3VNMA 5DLCA 3GG8A 2G4JA 3VAVA 1C3FA 3WYZA 4A35A 4IT1A 1WZAA 5A2CA 1X8FA 4MJ4A 1E6ZA 1DXIA 4IOTA 4QQ3A 2X09A 1RA0A 3LPPA 5CPLA 4B5WA 5DBTA 4JNZA 1L6SA 4NF7A 2FPTA 2HQAA 4J56A 4EIVA 2NZLA 3PZMA 1IEIA 4HNCA 3W87A 2ABBA 4M24A 2GR2A 3W6MA 1K9FA 2ZXQA 3H54A 3ZVHB 2J7GA 2I14A 1GVEA 2XM1A 3NVZB 4W86A 3NQ7A 3TC3A 5K9XA 1HIZA 1PCKA 4FO4A 2V63A 3BV4A 2VFFA 2PODA 3R89A 2VZOA 3B0PA 3DU0A 3A21A 5JCMA 1HP4A 2NWRA 4KWVA 1HJQA 2G3MA 2RDUA 1NQ6A 2Z1SA 3KOXA 4H8NA 2PMQA 4CCZA 3M46A 2PU1A 2QR6A 2RDXA 4HYRA 3IUHA 3OZOA 1F6PA 1XLEA 3IPWA 1V0LA 1QOPA 4WX2A 3GG1A 3NUKA 3UCCA 4HPHA 1GZGA 3FNDA 2W91A 2WK2A 2WXDM 3FA4A 3M0KA 1MXSA 1VIZA 4MKSA 3PTDA 4MUZA 3NL5A 3QFWA 4GI9A 2VEPA 1QXLA 4JFSA 3WJWA 3TTOA 4A4AA 1MOKA 2DZAA 1EEPA 1UKQA 1H09A 4ADUA 2QJJA 3B9NA 5C6MA 3NZQA 3PUOA 2GQ9A 2V9DA 3HJZA 5FSEC 1T40A 5BMWA 4KEUA 1V6XA 3MO4A 2Z25A 4GCAA 5FEXA 4UNLA 1SZFA 5IDZA 1TB3A 1U5JA 3MPGA 4HNUA 4Y9NA 1QPRA 2CHOA 2D0HA 3F7JA 3GD4A 1AJZA 3GHRA 3NQ2A 1SYTA 1UZDA 4E2BA 2DZWA 2X2YA 2BXZA 3LERA 1ZBCA 2VXNA 5LHEA 2O7SA 4IIBA 4AUBA 3DN5A 2CBVA 3H2CA 4GUFA 5JCNA 1YHTA 2DZBA 2IMRA 1TFVA 2Q8LA 4HPNA 2RFGA 4K2SA 1HX0A 5DCEA 1H60A 3V5OA 5MF5A 4QJ3B 4M29A 1S39A 4LNYA 3SBFA 3NWRA 5I6SA 4Z1YA 3M64A 1F9CA 3QFEA 1W3HA 2B31A 2NT1A 1TVPA 4BCEA 3KUMA 4GJJA 5D2YA 1FKXA 5HDRA 4PBEA 2R6OA 1ZBVA 3IAPA 4AZIA 4LGXA 3WQVA 4H9UA 2G95A 3GAYA 4GBUA 1IWBA 1V03A 4KRZA 3BDKA 3BTNA 3T2QA 4POCA 2WVSA 1GPWA 3H22A 3L2LA 3C2VA 4N02A 1P5BA 4HJWA 1B9BA 2Q3RA 2GPTA 1E6SM 5LIXX 1WBHA 3TC7A 3IJ7A 4NSBA 1Y5WA 3H12A 2ZUWA 1QWKA 3VUSA 2F8QA 3THQA 3GHTA 2VL4A 4C1KA 2VR4A 4DB7A 1K9DA 3A6OA 4YHGA 4UNKA 3S1WA 3SGZA 2JE8A 2ZVIA 3A3WA 4ASTA 1RK6A 4QRNA 1M53A 5HWJA 4XAFA 1KXVA 3T55A 1L8PA 4QJ1A 2O4MA 3PTMA 3UNDA 4IQDA 1A53A 1FOBA 1W3IA 2VX6A 4Z1AA 1ZBKA 5BOEA 3S4TA 3ANYA 4DZAA 4XBJA 5K2ZA 2Q71A 2DEPA 3U57A 3W2NA 2DP3A 1OEPA 2XISA 4L6OA 3CAQA 4DM1A 4MDPA 1GKQA 1XKJA 4MJZA 1XIIA 4PUWA 4R34A 5FS7A 1AD1A 2JBMA 4IHCA 4EOUA 4H19A 1UP0A 4Q4KA 4BY3A 1A5AA 1VBGA 5E70A 4FXRA 3VFLA 3WH7A 3DOPA 2X1TA 2ZRXA 4GUHA 2VD9A 5D9OA 1NDAA 4TVCA 4IGNA 3OOQA 2X0YA 1DVJA 1XLHA 3QHNA 4MJMA 1Z48A 3DJJA 5T9BG 3HPAA 4GYPC 4PUMA 3FVMA 1MXGA 4HZ7A 3DUGA 3RRAA 4TO8A 5HR7A 3IJLA 3FJ4A 2W55A 3R58A 5FJIA 4DPQA 3STEA 4DJFC 3S1VA 1SFLA 2ZUNA 4G2DA 5AC4A 5FMHA 3O0FA 3PVFA 3FYPA 1TZ9A 2DSKA 2B7QA 1C9DA 2X40A 3NQFA 2P1FA 4D6GA 1WAWA 3OIHA 2PD9A 3D5HA 3HG4A 3C2FA 5G4HC 3IC9A 3T81A 4JIQA 4AB4A 2ZOXA 1V3HA 1BTCA 2ZBTA 4LY8A 1UR2A 3SRFA 3M43A 3TYDA 2YLLA 4PUEA 2E6YA 2YBVA 3BW2A 4DJEC 1OABA 4FX6M 2CDUA 1E0WA 4FXJA 3DFQA 3UG3A 4AXNA 3O6AA 3TN5A 3MV01 4FK9A 1TG7A 1KRCC 1E5NA 2J8TA 3A9BA 4M6VA 1EGMA 5CPSA 3APYA 1A80A 3GTXA 2QMKA 3HQ1A 4RR4A 2BV9A 1PTGA 3WZ0E 3A4JA 4O10A 3WQ5A 2J7FA 3GU2A 3QR3A 1EUNA 3BCDA 3CMGA 2OWCA 1RCXB 2ZZ7A 1UWRA 2BGQA 3VD3A 2YBUA 4C65A 4APNA 1OT1A 4IMEA 1JIBA 2TSYA 5IRPA 3LNPA 1E4MM 1XSKA 3CQIA 4RXGA 4RJEA 3U5YA 4E38A 1EJTC 3C0LA 2FVLA 4A2RA 3KP0A 2WLZA 5EBAA 4UQDA 4AX6A 1ZCOA 3EWYA 1PIGA 2WSYA 4Q8MA 3I6EA 3WD0A 5A8OA 4RE0A 1R7OA 3SCOA 3RJXA 4GRSA 3BURA 2QS8A 4KWOA 5HXMA 4OUEA 3LI0A 1S2UA 3PZTA 2NQZA 1EF3A 4Z2HA 1JAEA 3WQDA 4PCFA 3MS8A 4ZFCA 2V5LA 5AECA 1AFSA 1EBDA 3M7SA 5LXXA 1HVQA 3RILA 3HQNA 2J27A 3IGUA 1EBHA 4JGDA 3QXBA 3EDFA 2DVTA 3NL3A 5DBUA 2CZDA 1VDVA 2E1WA 4BI6A 4S3KA 1GVIA 3N73A 1FH7A 4A8NA 1FWTA 2OB3A 3QOKA 3KW3A 4DWSD 2Y62A 3QH2A 3TTYA 2KX9A 3LCWA 3H2OA 1WKYA 3AHXA 4IX2A 2YB4A 1RPXA 1WDDA 1KWKA 1G94A 3JZEA 2R1NA 4FEZA 1Q6FA 3UVIA 1SR9A 1G4SA 3BQ6A 1G4PA 2J8GA 3GH4A 4JQ4A 3GXIA 1POJA 1Q8AA 1AQFA 4LUSA 5FSDC 3P74A 3CO4A 2ONEA 1BVZA 2R1KA 5J8LA 3UQNA 5LIKX 3ME3A 1JCMP 1XIBA 2BMBA 3WENA 5LGZA 3WMSA 3I3DA 3S83A 3RR4A 3V3WA 1JNEA 4GIRA 2WJDA 1HZYA 2DY3A 2PBOA 3EXSA 3NVDA 1QATA 3VVGA 1D7KA 1XDIA 2BASA 1P6BA 2OEKA 4ZFMA 1B3ZA 4WVXA 1DBTA 4NNCA 3LN3A 4QE1A 5I3DA 1QI3A 2D22A 1JI1A 1RVKA 2V5BA 3NQ6A 1B2YA 3QR0A 2FHCA 5D05A 4YYFA 4Z0JA 1FTXA 1F7BA 3PSWA 3HQOA 2H8ZA 2E8ZA 1PKMA 3DESA 2WC4A 3UPBA 3TK7A 4QR6A 1V0NA 4W5ZA 2QJNA 3ZLHA 2ACUA 3FVDA 4DAFA 1ZQ5A 2G4FA 5E09A 1MNSA 3WX7A 3N4FA 4W8BA 3KL5A 4GGHA 2Y88A 3AXKA 1ZJIA 3EDJA 1OX4B 4RXFA 3AJXA 2CWXA 4U3CA 1XH1A 2C16A 2WCSA 1VYPX 1U5VA 4LVDA 2NXGA 4TUFA 4PUUA 1VEOA 1TPC1 1OG6A 3M0JA 3EDEA 1V0MA 3WKZA 1QWGA 1UKPA 2WSRA 4WRHA 3FHQA 3L4ZA 4PCTA 4UTHA 1KBKA 1VFMA 4YVVA 3OVGA 3U9IA 3A22A 2DUAA 4QHRA 4ECLA 2WPEA 3VE7A 1WCGA 1PWLA 5CEWA 4HSHA 4TMBA 3M44A 4PH6A 3LPFA 5DT7A 3TMQA 2PGEA 3DK4A 2XSBA 2VC5A 4YLWA 4ZOEA 1F3EA 4DVOA 4IQEA 4QDPA 2G3JA 4EMWA 5A6BD 3XINA 1DJXA 1KFKA 1XLMA 1PKLA 2WKGA 3MMTA 3W1TA 3P3BA 4YVPA 3TJ4A 5ABFA 1X2HA 3NSNA 5E9XA 4G1NA 3HV9A 1WV2A 4M0XA 2E6AA 3E2QA 3LTYA 3KLLA 3V1PA 4EAYA 1GESA 3QMTA 4R5EA 2GVLA 3I7SA 4OUIA 3QGAC 1F4HA 1P1XA 3S9ZA 3BLOA 1DWJM 3KTXA 1E1CA 2Y4SA 3KVKA 3SAZA 1YE6A 1UR9A 5E93A 4AISA 3LBOA 4JYFA 1XICA 3NQCA 2CLLA 2GVGA 3GW3A 1NPXA 3EOOA 3SFKA 1EWDA 3SGGA 1OX6A 4JFWA 5HULA 2VCBA 3WNKA 3A3HA 3KLKA 3TDFA 5MKGA 2TODA 2VGFA 1GT8A 4C6KA 3EXRA 3MSDA 3R12A 1M65A 3QGKC 2HQMA 3D47A 1F8WA 3AJ7A 5LGXA 3HB9A 3PAOA 3CC1A 2VVNA 3DIPA 1BWCA 2E77A 2D2HA 3IV3A 3G1YA 2PZ0A 3Q2DA 1K3UA 1JQXA 3DFPA 2GSEA 2YVJA 3PJWA 5GNZA 1CXFA 2GJRA 4HPGA 3IIVA 3W1LA 4JIEA 5I5RA 5CLWA 1VEPA 1A49A 2ZA2A 5A2BA 1R9ZA 4JX4A 7ODCA 4GG9A 3AS1A 3B9EA 4IL2A 3MKCA 3UD6A 4MWAD 2WBAA 4HB7A 5FAJA 3U0HA 2X1RA 4W8LA 3WIJA 5H8UA 1WKEA 2V3BA 4EPEC 1RALA 3KRUA 4P61A 3H8AA 1BGGA 2V81A 5DMLA 1M04A 4Z1DA 2E6FA 3QV8A 3PBVA 4WD0A 1H7RA 1I60A 1J0IA 1XUZA 1QW8A 4U4MA 5AOUA 1TJPA 4EXAA 1NWTA 2ZZ4A 1TTQA 1YPXA 3W76A 1VBRA 4XBSA 5EL1A 5DXXA 4L80A 1RHCA 2V3AA 2WWCA 1DTNA 4LBRA 5TD4A 3TYUA 1NOWA 4HP5A 3OGRA 4MG4A 3WLMA 1J8VA 1L8NA 4GHRA 1GXFA 4Z42C 1T41A 1VFOA 1IIGA 1HJUA 4O1CA 3P62A 2QCLA 2Z1WA 2DUZA 4QS6A 1CENA 3OVQA 1MUWA 4HTBA 4IMGA 2PF8A 1CB2A 3P93A 3AMLA 4LJ3A 3JW7A 3ABZA 4XZIA 1OGSA 1P6CA 1TPDA 2XVKA 2HSAA 3ZVIA 4PYSA 1LYXA 4S3EA 1KXQA 1OM0A 3BCFA 1A5KC 1WP6A 1LG1A 4YTQA 1Y8BA 4HA4A 4HVXA 3G5EA 4PCPA 1E43A 1DPMA 3O6CA 3WQFA 1Q63A 4F3HA 5CLTA 1LL6A 2PDWA 3S5NA 5HWNA 5DXYA 4ZVJA 3WY1A 3GUWA 4K7ZA 1TR1A 1U33A 1XHGA 3BG5A 2OU4A 2E9MA 3R79A 4LUJA 2GRTA 1TSIA 1DJQA 2CFFA 1GYLA 4E3VA 2YKKA 2ZXDA 1EP2A 1WB0A 2B7NA 3M1ZA 3ARPA 2BHUA 3A64A 2W5FA 1JFHA 1N63C 3B0YA 5GNXA 5C9UA 3NYDA 4JS3A 4JY9A 1AW2A 5EU9A 3N11A 1EIXA 4NZ3A 4NJKA 4OVXA 1EKOA 3R43A 1EGVA 1JCXA 4ZQOA 3M5XA 3RLHA 4CVUA 4FF7A 2Y1HA 3HGOA 1S5TA 3OLIA 2YCEA 1EJSC 2A3BA 3LEPA 1W2PA 2AAAA 1P7TA 3CHCA 1B3OA 1HJXA 4ICCX 5FIPA 3D46A 4JTQA 1VBJA 1VKFA 1KLZA 3M0MA 4A3HA 3QTGA 4WJXA 4J3VA 5AFDA 3UG4A 2P0IA 4J3ZA 1K7XA 3VKJA 4GA8A 4S38A 2NWSA 3GRIA 5D37A 3GYCA 3Q58A 4JQ2A 5DMNA 3QMSA 1NJJA 3WLRA 1R2RA 4JTIA 3AMKA 1XSIA 3WH6A 4KWSA 1QK0A 4P8WA 2ZADA 1K77A 1EGZA 3NA8A 4ZOBA 2NQJA 3BAXA 2HPMA 1I2QA 1Q3NA 4JR5A 4A05A 4BHYA 5JVLA 1H7WA 2YDSA 1XS2A 2WZTA 3AYVA 3W7MA 3S46A 1C8XA 3WELA 1XSJA 2EAWA 1OFOA 4D6JA 1WA3A 3CQHA 1OIFA 2C3DA 2RJHA 1H7XA 5DO8A 4HNNA 4BQ2A 1WOBA 4O14A 3DC8A 3UYIA 4BA0A 1FDZA 2HJPA 4NX0A 3DCPA 3VDCA 1Z3NA 5CBIA 1LORA 4L4OA 1GV4A 3B03A 3BMWA 2CLFA 1R8LA 2CLMA 1UMYA 1NFPA 5DMYA 1ZALA 1J10A 2DT1A 2FTWA 2JEPA 4MY9A 3PBUA 1N5WC 2GYIA 2WP5A 2WNWA 3MV11 1C7TA 3KM8A 3R8GA 4BI5A 4HCDA 4DN1A 1TX0A 3G1SA 3H4KA 4GIEA 3R10A 4B2DA 3L2MA 1JCJA 3VKDA 1TUFA 4NNBA 4IMDA 1XYLA 2P0OA 4BR1A 1KRAC 3OZPA 1H0IA 1R5YA 3CQJA 3NQMA 4IX0A 1QI5A 4MY1A 2D73A 3M07A 1UW9A 4HPXA 4G56A 3PWGA 4KGJA 2ZTJA 4TR9A 3APGA 2D0GA 3EEGA 1RCQA 1HO1A 4UBPC 1YE4A 1W54A 2P53A 2Y63A 2VWTA 1EC8A 3R07C 3GDKA 1J18A 4L1GA 1RAKA 4FLRA 1E3XA 1HF6A 2QF8A 3VD7A 3VNKA 2PI6A 3RF9A 1I6NA 2DZUA 3U2EA 4O57A 2GR3A 2NQ9A 1AH3A 3G0XA 1JR1A 3CLWA 3BOLA 2FPYA 4Q7BA 4GXPA 3W2KA 4XD3A 3PHAA 4M51A 3GD3A 3H4GA 4LSBA 4EKJA 2A6LA 1TQJA 4NRSA 1OFRA 4M5PA 4LAOA 3P80A 2Y2WA 4ATLA 5IFTA 3LV6A 3KS5A 3WQEA 5D9NA 4K8DA 5M2FX 5IHRA 1NHSA 1ENUA 3RYSA 3ZWSA 2A2IA 4X63A 5AYYA 2C3ZA 3N25A 3MU7A 1C8VA 5A8NA 4NNAA 4XO6A 1KBIA 5EMLA 3RRXA 3VOIA 2DORA 3AU2A 2VUYA 4C5ZA 2AAQA 4H4VA 4FF5A 3A4WA 3OPSA 5A3HA 3LRMA 3CWNA 5FI8A 3NVWB 3M5YA 3L5OA 8TIMA 4L4LA 1YW1A 3Q45A 3VGHA 4DY1A 1S2CA 4B16A 2FTPA 3G1XA 1S3HA 1FHVA 3P67A 1HKVA 3CT2A 1MZHA 1PDYA 1VD6A 1Z69A 2QLYA 3POHA 1DXFA 1UR0A 2EBNA 3NIYA 2GJXA 4GK8A 2C1IA 2NXIA 3SUVA 1IZCA 1RBLA 1MYRA 1LL4A 1TQXA 4DYJA 2QUMA 3R0KA 3FKRA 1EYWA 3LXAA 3G3DA 1OCJA 5FOOA 2FFCA 1O7AA 3DGHA 1HNYA 1IT8A 1GZJA 4EF9A 4BEUA 2ZUUA 4GYJA 2ANUA 4GO8A 3T09A 3CH0A 3T0CA 3LG3A 4QDMA 3OLDA 4LUSB 3UCQA 5FJPA 4C6NA 5BYWA 1TWWA 5DQPA 2W9MA 4ZZ9A 4FOKA 5EMJA 3UR7A 3AM9A 3KVJA 2XIMA 5JCIA 2WQPA 3WLSA 3GS6A 2EG8A 1TIWA 4B15A 4M52A 2P10A 3DYMA 5D2VA 4A3UA 3MI3A 3PUDA 1Z9AA 4I5RA 4IH3A 4W84A 4EACA 4FAMA 3QLLA 1W5MA 3RFAA 3WK0A 1XI3A 2PWVA 2C18A 3GR7A 3HPXA 4C1NA 3OC4A 1Y7VA 2PTZA 2BY2A 1AZ1A 2OFJA 1YBQA 3G22A 3K1DA 5XIMA 3N04A 3SRDA 4PE8A 4AD5A 1XJBA 1TO3A 2P8CA 2LLEA 2QCMA 3NL6A 1RJPA 3N9RA 1ISZA 3W1UA 1B90A 2KAUC 4O1FA 1Q1RA 1VAHA 5CSUA 4JL1A 2ZZBA 3F4NA 1PX3A 1OZQA 1JGMA 3NS1B 3NQEA 4FB7A 4YCOA 3NCOA 4I7WA 3HMJG 1TCMA 4H41A 1PUDA 3GH7A 1TMHA 1AH4A 4QIUA 5A1AA 1JEHA 1FIQB 3A4AA 3GLCA 4I9AA 1QPKA 2V6OA 3S9YA 1Q6GA 5IBXA 2ISVA 1A5UA 4H4QA 3P6LA 5CC5A 1BTMA 3W38A 1LRNA 4JTHA 3SQLA 4YYCA 3TUUA 3KLJA 1CGYA 1J0HA 1N8FA 1X96A 4PRWA 2PLKA 3VILA 3DC0A 5LNSA 1SZRA 3FW6A 5T8GA 2QV5A 4H9YA 4LYRA 3RM9A 3KRSA 3K4WA 3NSXA 5HPOA 3BLLA 5I3IA 2OWWA 2QCNA 1RSCA 3WK2A 4GE8A 1TJ1A 4WLCA 1FCUA 1KTNA 1XLJA 4Y9AA 3TNBA 1RLCL 2W92A 4NZ1A 4PUNA 3MSYA 3FFSA 4JIIX 2WVVB 3NGJA 3DEQA 3UEQA 1PXGA 1XIHA 2A4AA 1JD7A 5TR3A 3ARZA 1JUBA 1XISA 1XUUA 3ZT7A 1J0YA 4Q7IA 3BW4A 3R13A 1ZXIC 4AU0A 3QW4B 4O1AA 4WY0A 1XLLA 4LAKA 4AWSA 3BLDA 2PDMA 4JX5A 3MYOA 4IFKA 5ABEA 3LLFA 1A4LA 4JIHA 3PC0A 3TZNA 3QY7A 2ZCGA 1VQZA 3ORWA 5CGMA 2Y0FA 1XIJA 4A6GA 5CG0A 4AIUA 1UASA 3E1F1 5KEZA 2Z1KA 2JGYA 4RE2A 5AHFA 2DVXA 4UOZA 1F3TA 1F8MA 3PJTA 5MKGB 3B8WA 4QNEA 3WUGA 4XQ6A 1KR0A 4Y8FA 3MTWA 3QFBA 5F1UA 1QPNA 1H5YA 5LSMA 2P50A 4I90A 1F76A 5J04A 2QCDB 3ONBA 4UFLA 1IZJA 2ZZCA 4CLMA 3GZAA 4EMJA 4J3XA 4GC4A 2X05A 3O0HA 1UR1A 4EMIA 4R88A 3H26A 2F9RA 3G1VA 1YNPA 1UYQA 4JDRA 1KBBA 4HU0A 3VKKA 3IRSA 2Z6IA 2NUXA 3OLEA 3JUGA 1YXCA 5FJUA 2GK1A 1NTHA 4XWUA 2RHGA 2YCJA 4YTRA 2OOFA 5DX7A 2GQ3A 3RNDA 2A8XA 4YS1A 3ZJKA 5KITA 3B9OA 9CGTA 4AZHA 3BLPX 3VKAA 5BOOA 3MYPA 5D8WA 1LL7A 4V15A 1ODUA 1YYAA 1IEVA 3RAOA 5CGTA 2TAAA 2Z7KA 2E3ZA 4J3WA 3VOFA 3I4KA 2PDIA 2OEJA 2OXNA 4YWOA 3E2SA 1V93A 2ZWZA 2XN1A 3VXGA 5JBDA 1ZJHA 3N3MA 4KPLA 1OFAA 1JFXA 1XYBA 5CSSA 4NEWA 1P0BA 3V0UA 3CGCA 2WC3A 4QITA 3RITA 4QX4A 4DF0A 1QAPA 1CGWA 2ISSA 4NI3A 3C3NA 3VFCA 1W3TA 4QEEA 2D24A 5XINA 1WBJA 1CXLA 3DENA 2X42A 5TF0A 3IRDA 3UWQA 1RY8A 2PZNA 4J27A 3SUWA 4E2DA 3O8AA 3LCXA 1LBMA 4D8LA 1QOXA 3S5OA 2VT0A 4AD1A 1WYGA 1MEIA 1V8EA 1RBAA 4DWSA 4C91A 4Y9MA 1UD3A 1HKKA 3WCZA 3GDLA 4MKVA 1H11A 1R46A 3EAOA 1DKWA 2IW0A 4L9ZA 4LS0A 1VZWA 5HNTA 1TV4A 7CGTA 3WLTA 2F6KA 3FHAA 3OB8A 1V3IA 4NXSA 3K46A 3UZJA 4GVIA 3CL8A 1S46A 1BYCA 4O0ZA 4XKYA 1L0PA 4LV9A 3Q65A 4TTUA 2W3ZA 5KSWA 5LYRA 4F0MA 1EJRC 1W9DM 1TPFA 3ARUA 2HK1A 2AGKA 1V3MA 4BI7A 1GG0A 2L5HA 1M6IA 1NOFA 3EWWA 5HJYA 4INFA 1EA0A 3G6LA 1QASA 2GR1A 4H6EA 3KFTA 4GYFA 1TCDA 1ZS2A 3EF6A 5ER0A 5FEPA 1OFPA 1LOLA 5A95A 1XCWA 5EMYA 2HNEA 4LY4A 3ABRA 1W1B1 3AZRA 2DZPA 3C3UA 3W23A 4AIBA 1UB3A 5F2IA 2Z26A 4FX7A 1R3QA 2CEQA 4UZSA 4WKFA 4Q8WA 2F5ZA 4MZ8A 4AXKA 4E2VA 3PZQA 2XVGA 2ZX7A 4I5UA 3S3GA 1ZSXA 3CZJA 4LCSA 1LWHA 3HA1A 1XCXA 1FECA 1XL9A 3R0UA 1FEBA 4JQ9A 4WDUA 1VGAA 4HMNA 4CU8A 3KP1A 3TE9A 3SY1A 1K4HA 1V6TA 4JHZA 4MGGA 4N9EA 4KFOA 2ZZ2A 2GWGA 3WEZA 4NUWA 2CERA 4IUGA 1MRAA 7TAAA 3R4IA 3LADA 4QS5A 4H50A 3HZ3A 4M6QA 1GVSA 5BXSA 4ERGA 1EZ2A 1VPYA 3S2JA 1UUQA 4AMAA 5EMUA 2YL5A 4KEVA 3GFXA 4H4PA 4IL0A 4IJBA 3TX9A 1ZMDA 4AD3A 4GY1A 2E68A 3QR1A 5E1QA 1ICPA 2VGIA 5REQA 1LRQA 3VM5A 3MO7A 1EFZA 3LD5A 5B7ZA 3E38A 3N4AA 3KXQA 4LVFA 1BEUA 2HRWA 3SJNA 4ATDA 3TAOA 1I1XA 3CAWA 1A4MA 5A6BA 1XRFA 1Q2RA 1M7XA 3UGVA 4AVNA 2FDMA 4JD4A 3VNLA 1KKRA 4DO6A 1FHLA 3NZRA 1V59A 2FPVA 3M6DA 1J12A 1DE6A 5AC8A 1F6KA 1PZ0A 1LRTA 3BXWA 4WK9A 3NJ3A 5EFDA 3LRKA 2QXWA 4E4UA 4W93A 2J7HA 5CC7A 2QUNA 3PB2A 1TRIA 4LC8A 1H1YA 1R3WA 4GKLA 4IPJA 3C61A 4WR3A 1YNYA 4GVGA 1AMKA 3LOTA 3QV6A 3CL7A 3NZPA 2F84A 1DWAM 2B81A 3NDZA 3HGSA 3PBYA 3LMZA 3W7DA 3AISA 2ODOA 4WIWA 1FXQA 2YOCA 5E9AA 1R86A 1BWKA 3RLGA 1XQKA 1XYCA 2XIBA 5HMEA 4HNTA 4Z1BA 1DJGA 1W9VA 1HTIA 4H7CA 3TLQA 4CGTA 1X6NA 3FXGA 3SRKA 3KOYA 5JBEA 1XW8A 1VFUA 3UJFA 3T44A 2J9YA 4A2SA 3LHWA 4ATWA 1HL2A 3W37A 1N2VA 4Y7EA 1KLYA 1GUVA 1RV8A 4D6HA 3NDYA 4MWAA 4E3TA 2XPKA 3QV9A 2CLOA 4D1JA 1ITQA 3WLIA 3OYXA 1ZPTA 4GXMA 2J66A 1B3VA 1GKPA 2OVLA 2OZ0A 5AN7A 4M8UA 2BX7A 3UERA 2PSNA 4AZ5A 3B9DA 5AVHA 3PJUA 3TKFA 2WHMA 3RPMA 1E4LA 4GACA 1EL3A 3PNZA 3P81A 1K70A 2HROA 1OCQA 2WOIA 1KBLA 1VLIA 3R8HA 4L9XA 2VDIA 2WQDA 3CUJA 3UT0A 3BLIA 4XIAA 3WMLA 4JQ1A 1KFJA 2A3AA 3UF9A 3JS3A 4P7QA 5HA7A 3RO8A 3AIEA 1XRVA 2YCKX 3E2VA 1KGXA 4R3UA 1PZ1A 4JTCA 1D9EA 4MB3A 3UGRA 3VCNA 1REQA 2V2DA 4M3PA 4KCUA 2W4XA 3PPCA 2OR2A 5C5YA 1ONXA 1GEQA 3LHVA 4PZVA 1V7AA 3EWXA 1FDJA 1Q85A 1WNOA 3B40A 1CW2A 4X2PA 1W8SA 1JPDX 2XZ9A 2C6QA 2GJXB 1PBGA 4AWUA 1F8IA 1A0DA 1I0DA 4I3GA 4UB9A 3VGDA 1J9YA 1O5QA 2DZXA 4Q4QA 2AL2A 3KCLA 1UHVA 3REQA 2PGRA 4RKAA 3L4YA 3B97A 4NRRA 5DCDA 2WJEA 4QCEA 1ODZA 2QHAA 1ZGDA 3LHTA 2FZ8A 4AHPA 2IUZA 3HIJA 2G96A 3NRZB 4X22A 1XP3A 4FIRA 4B90A 3DBNA 3WN6A 4QJ4B 1LUCA 4B5NA 1ZB5A 3CTLA 4RDZA 1NFBA 1W0MA 1JF5A 2OTDA 2YA0A 3G1HA 4ZO9A 1JYVA 3ETRB 4ENLA 1CEOA 1X1NA 3OZMA 1VLWA 1ZRQA 4B9ZA 2WANA 2P5NA 3CIVA 4XV0A 3CMJA 1N82A 1EJ7L 3P8IA 1I0BA 4TXEA 3ARWA 4IPIA 3QGVA 4C1NB 4I9TA 4H00A 3T2PA 1H7OA 3S6DA 1YBQB 3DYPA 4X60A 1H0GA 4H6RA 1FWAC 2GLKA 4RPQA 1V02A 3VX1A 4QCFA 4MZ1A 4K7VA 1TJRA 4Z2LA 4AY8A 4IIGA 1R3SA 4ZENA 4JZ5A 5CPMA 3MI2A 1GQNA 1VIWA 1N61C 1UBPC 4CQAA 4LA1A 1LQ2A 5LNWA 1LQ0A 5C7VA 4QLLA 1UQYA 2E0PA 3EWBX 3M5ZA 2OGJA 1RJRA 1CCWB 3GAKA 3MHUA 1EPXA 3BICA 1ZMCA 3U4AA 4H9ZA 4ONVA 5D30A 3JZUA 1W91A 1R85A 1BF2A 4O4WA 1FWFC 3CS2A 4WSHA 1AH0A 4UQEA 3WQPA 3CT7A 1ME9A 5LXEA 4F40A 3DZ1A 3L7RA 4D9PA 2YQUA 4YCPA 5KZEA 3IIOA 3A4XA 4RZBA 3UR8A 3R8RA 2PU0A 4RK8A 3U2ZA 1PWMA 2W79A 3CYVA 5G1MA 4DNHA 4DJDD 1HKMA 3COTA 4FLSA 4EQRA 2OO0A 3SUTA 1Q7QA 4LAUA 4MNJA 1VH7A 2HVNA 3TFXA 4ML4A 1X6UA 4Q8TA 3UWZA 2PPGA 2JFEX 1E15A 1L6WA 2PDCA 5I03A 2VGBA 1KXHA 2TYSA 1FA2A 1HN1A 4A3RA 1VHNA 2WHKA 4CNSA 5C70A 4DO4A 3UETA 3RGTA 3ZSSA 5GNYA 3A7RA 9XIMA 1EWEA 4HCHA 3K13A 3VNYA 1ZDLA 4WY0B 2PTYA 2J4GA 2I16A 4AYSA 3LTPA 1XV8A 1KD0A 2IQTA 2G41A 3M16A 3BK0A 2WOVA 2VEFA 4IFKB 3LY0A 2JF6A 5BU6A 4KESA 4JHMA 2QDHA 1R7AA 4H6KA 4S3CA 5F4SA 3GWQA 1BSIA 4S3AA 1MNZA 4AEFA 2YA1A 4LANA 4AY1A 2WMGA 3PZNA 3T40A 2PP1A 5J5RA 3DFNA 4JAWA 5A94A 1TE6A 1KN0A 1O5KA 1XKYA 3ZYZA 4YVXA 2EPLX 1S2VA 2HXTA 1QMLA 3BLFA 2O9RA 1GNXA 3TR9A 4K1WA 4UTUA 3CYJA 1NQKA 3UWWA 1WDWA 1JZ6A 6ALDA 1Y5XA 4NZJA 2VUNA 3B8TA 2Y5EA 1VFHA 4W5UA 4J7RA 4FSAA 1I2NA 4J9JA 1JAKA 3GIYA 2PFHA 4AYGA 1LWJA 2J7EA 4JYEA 2PLCA 4IFRA 4RNJA 5CSRA 1GVFA 4EM3A 2GK1B 4HHHA 3W1PA 1T0OA 3PZIA 1P0NA 2XJ7A 4N42A 4LXFA 3ES8A 1DWHM 4CNUA 5FESA 3CEPA 4JYDA 3SQPA 1Q13A 1T6MA 4H6QA 1GOQA 1UH2A 2A7RA 4HU8A 5LIWX 3MVIA 2UWFA 3HG5A 4AIOA 4XZWA 5JIPA 3L21A 3TLLA 3PTKA 3W7OA 3TXZA 5GRTA 2XWDA 3BMXA 3SO7A 4BZYA 4FIQA 4DYKA 3ITTA 3KBVA 4UTTA 4S3DA 3LGGA 1QNOA 5CXPA 1J79A 4UIOA 2WSQA 4Q32A 4F66A 4I7VA 3IVUA 3G1AA 2GSJA 1O1HA 2BB0A 4JFTA 4OBSA 4GI6A 1X7FA 2NVKX 1TZ7A 5H6HA 4Z08A 2QVNA 3WBXA 2Z1BA 3E0WA 3U48A 3LK6A 4K39A 1OBAA 5G5GB 5A6KA 4UXDA 4UCFA 4GNKB 4OBRA 3EDKA 3GVWA 5T91A 2XM2A 1EP3A 2VURA 2CBUA 5JXQA 4S3BA 3SCNA 1FFUC 3TV8A 3W7EA 1PIFA 2EEXA 2UY5A 2IXUA 4HHPA 3ARQA 2J3NA 1F05A 4NT0A 3VD4A 1N8WA 4GPNA 4HZ8A 3PBWA 3QY6A 1V6UA 1JG9A 3L4VA 5IOBA 6ENLA 5LIYX 1OHLA 3N4EA 1M01A 3SCUA 1XG4A 4QROA 3Q37A 1SJDA 1KB3A 3JRKA 3GTFA 3MY9A 4XKYB 5DRCA 3BG9A 5DMMA 1MW2A 2NV9A 3WG6A 5BOFA 2W0HA 2DJLA 5KZDA 4AEOA 3WL1A 1Z8AA 1SB3B 4Q33A 2QJGA 4DRSA 8CGTA 3VYLA 4DELA 2CLHA 3IANA 4HYWA 3WQ4A 4AHQA 3AS3A 4PL2A 3PZGA 3STCA 2XVPA 3LNMA 3UA4A 2B0MA 2I5GA 3HU7A 1EIBA 1K4QA 1H1NA 2QV4A 1AOGA 3TTSA 3OBAA 3ANUA 2J7CA 5FKYA 1G1YA 3L0NA 4LBSA 5FL0A 1FWIC 2XN2A 1RM6B 3S47A 3A3XA 4HOZA 1W1A1 1D8CA 5G5IA 1HW6A 2WLYA 1K03A 4Y90A 3AO0A 3Q4DA 3TC6A 3W1QA 2CC0A 3OA3A 3VIPA 1IEQA 1SO6A 4W7UA 3IJQA 4G6CA 4PBFA 1LLOA 3ZSTA 3L0KA 2ZC8A 1DJIA 3GE7A 3AN1A 5I24A 1P1MA 3N2MA 1JDDA 5H1WA 1XIEA 2FMNA 1E6NA 4JL2A 4EPKA 3IWPA 1C91A 3IIPA 1FCBA 3VNZA 3FEMA 1H41A 4BQ3A 1ZU8A 2C19A 3GZ3A 5D33A 3GXNA 3KHDA 1CLXA 3WNPA 3BAKA 1UWIA 1W3NA 1FWJC 1B30A 2YPIA 4IGHA 4UTIA 4C7DA 2HS6A 3BSGA 2PDLA 2Q02A 3SW6A 4Q7NA 1UR3M 4HNOA 3ARSA 4ZB0A 4DEFA 2I1OA 3N2OA 5REQB 2XIOA 3NDOA 1DTUA 4H83A 4RL3A 4D6IA 3WF1A 1TYPA 1DJZA 3OGSA 4H2CA 4ZTXA 1HJVA 3RLUA 3K8MA 3KRBA 3W1XA 4UFMA 2QMJA 5AC7A 3L5AA 3IARA 1O1ZA 3QPZA 4QAWA 1TV5A 1Q6CA 3WMBA 1U5HA 3CHVA 3GNOA 1MQRA 2WVTA 4DF2A 3O16A 4HNLA 3EA1A 3SEPA 2ZA1A 3RPDA 2ZRVA 3WNNA 4PMVA 1XPYA 3V7PA 1E1FA 3VX0A 1BYBA 3WEOA 3MKVA 4LBUA 3AI0A 1XLDA 1OYBA 4AWEA 3U7VA 4O8RA 4DBWA 3LLDA 1M7JA 5DRIA 4N4PA 1DIOA 1VENA 1EDGA 2FVKA 5M3WA 4BJHA 2Y8UA 2R1PA 1W9XA 3Q94A 1PDZA 3NAVA 3MC5A 1GJWA 4NAFA 2WPFA 4JTSA 3STFA 3QFAA 4GMEA 3OP2A 2Y5SA 3VO0A 1DQUA 2TRSA 1L2UA 3O05A 1SFSA 1V08A 3WUEA 2CNCA 2CXGA 3D3AA 1LT7A 1I2OA 4CD6A 3UZXA 2R9RA 3PZVA 4DO5A 4WKAA 1R0MA 3BVJA 2XIJA 4N6FA 3MCOA 3RX3A 4DI8A 3GDBA 2OKOA 5H91A 1CPUA 3I65A 4MTVA 1CLVA 3UG5A 1DJYA 4IM4A 2OEMA 4GINA 1ADOA 3WO8A 2XYLA 3HURA 4UTKA 4H8UA 2JKAA 4L65A 4MWAB 4B5VA 2FGLA 2PD5A 2XTKA 1QR7A 2QT3A 5CJ5A 2W3RA 4US5D 3L4UA 3GU1A 4O19A 3S5YA 1LPFA 1GOIA 3TP4A 2H3BA 3WLKX 4OT7A 1GREA 5EB8A 3VOJA 1UD8A 4W85A 4F0RA 4L61A 1B0IA 3GB6A 2YL6A 1LROA 4DLMA 1I1WA 4D72A 2XSXA 2HTMA 3S9IA 1QVBA 2G0WA 2ABAA 2VELA 2WJFA 3RIKA 2WBGA 2H9AB 1C93A 4CQBA 1KV8A 2O56A 4ICMA 1JDAA 4QG8A 2XUCA 3EANA 4IF2A 2R24A 1R9XA 2W62A 1XRTA 1OADA 4OJYA 3CGBA 3FYOA 4HYVA 3M0ZA 8RUCA 1VBUA 1JI2A 1TMLA 3KDNA 4NJJA 4D1IA 2VFDA 4H4IA 1AA1B 1REQB 3RHGA 3WF3A 2D0FA 4ICNA 1GW1A 5D2WA 1OG0A 2DZTA 3W2UA 3V1HA 2PDXA 5AYIA 4M6UA 3NQAA 4RE4A 3T9PA 3QY8A 2INEA 4L64A 3QN3A 1EJVC 3CV7A 4GJIA 1AJ2A 2OSWA 2Z1VA 1UC5A 1E1EA 1XQLA 1YMYA 4H2HA 3FKKA 3A5FA 2AL2B 2OX1A 1D2KA 1T3QC 4C6LA 1GRBA 3UJEA 3M0XA 1N62C 4M56A 3RM4A 3HV8A 1GCYA 2QJIA 3SR6B 4MB5A 3FV9A 3PB0A 3NQGA 3SQSA 3WUFA 4FX9A 2X2GA 5C55A 2X41A 1LUCB 4CD4A 1CDGA 3SSJA 1ESWA 4RZ6A 2IQ0A 1KO0A 3OIXA 1V3KA 1VPQA 4CN1A 3BGJA 5A6JA 4CN4A 4G7FA 4KGLA 1US2A 5C9RA 3BQ5A 3H55A 1BWVA 2Z4GA 4LOCA 3PANA 3D3FA 3CL6A 5G4EA 4K8GA 2V6AA 1K02A 1ZBWA 1X6LA 2PTWA 4PEKA 3K1GA 3FAWA 5GJNA 2YYUA 1W5OA 4GR1A 4EP8C 4K7YA 4CU6A 5CZSA 2PDNA 3AS2A 3HF3A 2OZTA 3TQVA 1IR1A 3W86A 4J28A 4XZBA 2J75A 3FDGA 1IR2A 4XTIA 2KZHA 4JHOA 3QPYA 4US6A 3CPGA 4R85A 5LZLA 4FXFA 1UPMB 3DFOA 3T4WA 1AW1A 3AZSA 1P0DA 2W27A 1XC4A 3RJYA 1EP1A 4C60A 3HM7A 5FAGA 3PUGA 3CV6A 4NEVA 1JVNA 4U5KA 4TVDA 2VDHA 5HUPA 2ISFA 1ICQA 1H7NA 3ITCA 5AZ0A 4DXXA 2V3EA 1GORA 1FCVA 3S1XA 3MUIA 4RDVA 3STGA 1VHCA 4WGXA 4X3ZA 2QCEA 1WUEA 2WB5A 4EQSA 3KVLA 1NELA 1TX2A 4CKQA 1Z32X 3BARA 5CPQA 2NX1A 4Q4SA 5F1VA 1RP8A 2ZRZA 2I9UA 3MBFA 2F7FA 4DM2A 1W17A 3TEVA 4ADWA 1SJCA 1HFBA 4C6FA 3RUBL 4TX9A 3GUGA 3BSMA 3I4EA 4UTFA 3MZ2A 1BPLB 1GRHA 4C7FA 2AQVA 4M19A 2NV2A 1VFTA 2XVNA 3WLJA 1LQAA 2FIQA 2FH6A 4MIMA 3W4RA 1MMFA 2FGZA 1XHCA 3UJSA 4MPQA 3HPSA 1ELSA 4FXSA 3XIMA 1H62A 2RKXA 3PULA 3EGJA 3QQWA 5HPCA 3NVVB 4I9JA 5CZKA 5ABGA 3NFUA 2HCVA 3LUTA 3ZS4A 4C90A 3ATYA 4KWUA 3S6OA 5JH1A 2A3HA 3H7RA 3N1AA 5ABTA 2OQYA 1UP3A 2B4GA 1E56A 4P7NA 4BF5A 5HNNA 3INPA 3HJEA 3S42A 2YCIX 5EBUA 2FZBA 2Z27A 5G1TA 1ZX9A 2EPNA 2ISWA 4GY7A 4J3UA 4ADSA 4A8RA 3AHZA 4C6JA 2QJMA 3SECA 4BURA 3ZWTA 3PPGA 2OSXA 4MWAE 2HVOA 3L8KA 2VEIA 5HQMA 3RCYA 2HWGA 3BV7A 3EWUA 2BVDA 2GWNA 4PMNA 2J6XA 2WMIA 1P43A 1XLAA 4NY2A 4HOWA 2I5QA 1B3YA 1PSCA 3T08A 4S2BA 3EPOA 3VIOA 4OIFA 1OQFA 1WZKA 1J0JA 3GHSA 4UQCA 4JTGA 4IISA 2DSVA 2PWHA 2CYGA 1CGUA 2QCCA 3VZYA 3WDRA 2IPWA 3CMFA 5F2GA 2CBJA 2J13A 1FWSA 2POTA 4FI4A 3F2DA 2BC0A 3T8QA 4DUXA 1NU5A 1PTAA 2OYKA 4HSNA 2WVUA 4HMEA 1XYAA 1JDEA 3BGAA 2GQWA 3MCMA 2YSWA 1XR2A 3ZT5A 3DK8A 1RK5A 1GOXA 3FK4A 4MNKA 5C54A 4YHEA 3QYSA 1RPKA 4QBXA 1XGDA 1XBVA 4GZJA 7REQA 3HGJA 1G01A 1IZKA 4Q22A 3EX4A 4TVUA 3DHFA 2ZZ1A 2CW6A 1TPB1 4JN6A 1NF0A 2PE4A 1CLKA 4GIAA 3VMPA 3EB4A 3WLHA 4LYKA 3B8VA 4MSSA 4GNJA 1HKIA 4F0HA 3GXMA 4ZQCA 4J40A 3E5PA 4MFDA 1RJQA 1DXLA 3VGEA 1GYMA 3ZM8A 1TREA 1ITCA 4IGSA 4K68A 3C5QA 2QEZA 1K8ZA 5MHBA 3MDUA 2V3DA 2EO7A 3KCOA 4XIMA 6TAAA 3RU6A 1Y5VA 5C9ZA 1QO2A 3FJ6A 2OCZA 1WXZA 4XSMA 2QAEA 2FQIA 3M5VA 3K5XA 2ON3A 1I8JA 2YDRA 2XGZA 3FGCA 2V30A 3NOYA 1OJXA 2HV5A 1ISXA 1O5RA 4JKLA 4GC3A 4CNNA 2PCQA 1S1RA 2WKLA 3BL3A 2C1GA 1A5BA 2PWEA 2QF7A 3M0LA 4FOJA 5K9DA 4OV4A 3S2LA 3IJ9A 2ZE0A 2OG9A 3EEZA 3LXCA 1R6WA 4E0CA 1BAGA 2WHLA 1JZ5A 1DYSA 2VX5A 1V02E 5ENLA 1WKFA 1Q6LA 5HNUA 2X8HA 5DEZA 2XZ7A 4CNPA 3KTSA 1CXEA 1DJWA 3S2NA 5BXTA 3BLKA 1HQTA 3ABOA 2PDQA 4GFSA 1B4EA 3CIXA 4CNTA 2DW6A 3OO2A 1JRPA 1OCNA 2WSPA 1QNSA 1FP8A 5D4YA 3VMOA 4UR9A 2R1MA 3GK0A 2XIIA 2G37A 4O52A 3CIWA 3SY5A 3ISIX 3FS2A 3A23A 3TSDA 4KCTA 3EYPA 4JTUA 4ZQMA 4KMQA 3THUA 4QP0A 2WOQA 3RO6A 4GZIA 1QNPA 3GVQA 3AIRA 4W9TA 2EG6A 1KQYA 1OJTA 2HBXA 3WK3A 3URNA 2ZZ3A 3N6QA 4PMRA 2CZVA 4ZTYA 3WJXA 2V82A 2YFOA 3RU8X 4WEVX 1VF8A 3CUZA 3BG3A 4R27A 4Z17A 3BMVA 3ECQA 1YTKA 4HA1A 4H4TA 3UXIA 2EPOA 4ZE4A 1JULA 4D6EA 1LBLA 3TYAA 2X0SA 4LFYA 1JPMA 2J7DA 4B4HA 1A3WA 4DJDA 8XIAA 4JKMA 3KX6A 1FY6A 1EHAA 1G9HA 3CV2A 1FCQA 1D7FA 4I9MA 4MADA 1TVLA 8XIMA 3PFMA 4LU0A 3HTWA 2DSWA 3TNOA 1MW3A 4IQLA 1XF0A 1R30A 3LB8A 4UFHA 4PTXA 3N2CA 2R8WA 4I5XA 5IBXC 1GONA 4ZO8A 2XN0A 2ZXBA 4MAZA 3CGDA 2Y6ZA 1MFVA 3SB0A 1FX6A 5C8BB 5LNUA 2O9OA 1EQCA 2C79A 4B5SA 2D1ZA 4XUYA 3O6YX 2OYMA 1ITUA 2ACQA 4PL1A 2EF9A 4ACYA 2GDUA 3WBYA 3GH5A 3ITVA 3B0UX 3N2XA 3NOEA 2OODA 1FDYA 4MNMA 5J5DA 2WV8A 4NAFB 3PSVA 3E0FA 1PX4A 3W3OA 3ES7A 3C0SA 3NEHA 3VM7A 1PB0A 3C8NA 2V68A 4LPCA 1UWSA 1MQQA 5A6LA 1HP5A 3LXDA 3W6YA 3WL0A 1RLDA 4PMYA 3AUJA 4XZHA 3NPVA 1JYWA 2A85A 4ML9A 1IWAA 3R2GA 2YW3A 3GY1A 5IM51 4LC6A 1BLIA 1XLIA 4RZ4A 5TNVA 1U83A 4UMAA 4FNSA 5LA2A 5I3KA 1ZP3A 2DH3A 4KRUA 1TA3B 1DORA 5KZMA 3DGBA 1YQZA 5JUVA 4ZB5A 1PE1A 1ZENA 2VR2A 1Q1WA 2GL5A 2O0TA 2PC4A 1E6RA 1R38A 5L6UA 5D09A 1A5OC 4LWWA 1DP0A 4ZSUA 2A5HA 4RLIA 2EGZA 1MDLA 3KS6A 3DI1A 3DKLA 4WCJA 1P0KA 3GU9A 5CC6A 1ZL1A 3C2OA 4OECA 2VX4A 4FLQA 1LF1A 2VNCA 3BJSA 4LV4A 3DH9A 4ZOAA 4M80A 4AZ6A 3QRHA 3UJRA 3O63A 4QG9A 1ADSA 3QEZA 3NL2A 1K1DA 3LPGA 3PG9A 1TPUA 2Q01A 3GR4A 2OT1A 1GHRA 1H63A 1IGWA 1OWQA 4PUKA 4QM1A 4DYEA 3HO8A 1OYCA 1WDSA 3KVMA 3BAWA 4PC8A 4YL2A 1UA3A 1GEUA 4CN6A 4GI4A 1EOKA 2E9LA 1K8XA 3QBUA 3NSMA 3W84A 1UH4A 4WXYA 1K9EA 4S2CA 3RM8A 1W1IE 4HT3A 3KEHA 3PR2A 2GOKA 2PWDA 1Q6OA 2UV8G 2O7QA 3AWNA 4JN7A 5I3FA 3VIJA 2V5DA 5ECVA 1B5TA 4CCEA 2IQDA 4MAVA 3F4VA 3GQYA 1F07A 4ALDA 4MMWA 4E4PA 1MI3A 3F5JA 3SQMA 3MUCA 3GFYA 5G1YA 2ZDRA 4UFJA 1G7UA 2JKEA 4ACZA 1JF6A 1EC7A 3IUIA 1Q7MA 4DF1A 2DIEA 5KTLA 4HN4A 2WZEA 3CK5A 3NVTA 5LA1A 3CUHA 3VINA 3N34A 3UXDA 3ZQ9A 1OFBA 3H21A 4HNVA 1GRAA 2PEVA 3EMQA 4PTMA 3CB3A 5CSYA 4TVYA 1FEAA 3SN1A 4Q6JA 1ICSA 3WDQA 2VC7A 2W6RA 5I3JA 1SJAA 4RUBA 1M41A 1CYGA 4NJHA 6REQA 1X98A 1NF7A 3FEQA 2VFEA 3K4AA 1J11A 1TTPA 1VEMA 2X99A 4IPNB 1OYAA 1NSJA 1F4AA 2FDSA 2Q09A 3FA5A 1H3GA 4UFKA 4YN5A 1TPEA 4JX6A 4F2UA 3BZJA 4PTNA 4J2MA 3SURA 1JRCA 4P8UA 4MUPA 3NO3A 3LHYA 1H5VA 2BC1A 2F2HA 1TMQA 4J35A 4O13A 3AS0A 4OGZA 3DXIA 2CIPA 2F6UA 1H2IA 3RPTA 3N6JA 4CD7A 4AWTA 1F6YA 4H4UA 3B4UA 3VTRA 3NGFA 1VP5A 5HQLA 3CUGA 5AC5A 2NX3A 2PDGA 4PTWA 4R7JA 4RDYA 1IF2A 2J47A 3VZXA 4LVGA 4IZGA 1D3GA 2V3FA 4ADTA 4GQQA 1ISWA 3W28A 3OYZA 1X7IA 5HJLA 4C6DA 3H24A 2R94A 5GJMA 3TA6A 1X39A 2QZRA 1D3HA 1M03A 7XIMA 4K38A 1UD2A 3VIGA 1R9YA 1NEYA 1TV7A 3TWBA 1NHRA 3LV5A 1ZY8A 2CETA 4QLJA 3QZAA 1J0ZA 1XWYA 1IYXA 3LBCA 2EQ7A 4CQ8A 1G4EA 3PG8A 3ITOA 5HMSA 1G6CA 1W32A 1RXOB 3E9AA 2Y89A 1ALDA 2EPKX 5TBOA 3J7HA 2ZXAA 3UNTA 1F3PA 2XVLA 3A12A 4LUTA 1XG3A 1GRTA 1I9CB 4PODA 4C6OA 1ME7A 3VI2A 3DHPA 5DY2A 4L6HA 2R1LA 3GO2A 3L5LA 2VZSA 2Z2UA 3T8LA 1M7PA 3AAMA 5AB3A 1RP9A 1YQ2A 1QNRA 5DN1A 5G2WA 3USZA 3EWCA 2BHZA 3TSMA 3ID7A 2ZFAA 4H04A 3VDHA 3GXDA 4PB5A 5EMKA 1OZMA 1CNVA 3L4TA 4IGMA 2BXVA 1VPXA 1ECQA 1G7VA 1V4YA 3KBSA 2ADAA 1E73M 1UG6A 3NPXA 4R9XA 2XWEA 1W9BM 5BXRA 1OGGA 4QTGA 1QT1A 2C0AA 3THCA 3WF4A 3N12A 1FKWA 2E25A 4WY0F 2BGNE 3C2RA 1O95A 2BZNA 1QUMA 1GOKA 3ZOAA 4GQRA 1EZWA 3G18A 1QDSA 3AMDA 2OQHA 1UUMA 4JTDA 1WQ5A 5IXEA 4XO7A 3LBMA 3EWZA 3TZFA 1JDCA 2VVSA 3G8RA 1QW9A 4PMOA 3PZOA 4A3YA 1JPHA 4OHQA 2A0NA 3AXIA 4AZ7A 1E6XM 3FJNA 1XINA 2QCHA 3KRZA 5AYXA 1UUOA 1M5WA 5IFPA 2WMIB 1SZNA 3N15A 1LCOA 1TPH1 2Y85A 3EXTA 3UWVA 2PBGA 4BWLA 3AFBA 3ALFA 4FR6A 2BSLA 4WJEA 1ML1A 1W3LA 1ZCCA 4US5A 2GGEA 3V36A 3UG8A 2YL8A 4HSOA 6A3HA 3P61A 2DW7A 1Z42A 4LQ1A 2J62A 3I7QA 4TOQA 2CWNA 1E3ZA 5A69A 5K4ZA 3V5FA 2WO5A 2CZFA 1A5NC 2V8ZA 2BP1A 4KWWA 2UY4A 4OWGA 3W71A 3UYCA 4NIRA 3PP7A 3EPMA 2PWFA 3ATZA 3WFAA 2J78A 2VJXA 4U5IA 1DIDA 1IT7A 2DJXA 3BJTA 4MYAA 2FZDA 7REQB 5KINA 2OMAA 2DFAA 2PWUA 3WD3A 4MWAC 1A5MC 5AYZA 1D3CA 3RCMA 2I7GA 3R7MA 1EX1A 3IEBA 1DJHA 2WZIA 3PZUA 4ZXOA 2DSZA 4OTKA 5BW6A 2A3LA 1NP0A 4F79A 3VD9A 3V35A 4O0QA 2D69A 1EC9A 1S38A 1XM3A 3O15A 4IIDA 4O16A 1PV8A 3CAKA 4O54A 4OBTA 1KWGA 1NIUA 4IG2A 4I6KA 3ITYA 3QC0A 4KS0A 1TJ2A 4OOZA 5ABHA 2AAMA 3SCSA 1ZFJA 2I5IA 3OEXA 3GNNA 4ZCWA 2XH7A 4ORMA 3P60A 5H8PA 3FGCB 2OYLA 2J88A 3ABQA 3LM7A 4GD0A 5HBFA 1DL3A 1T8XA 2VR5A 3W9ZA 3UWYA 5CG7A 4LVAA 5HQEA 1VRXA 1E6PA 4B9YA 4FNPA 1HKWA 4YNGA 4JY8A 4X9SA 5JIWA 1XDJA 1S2WA 4F48A 5E6ZA 5KVHA 3QM3A 4B92A 3N2TA 3U2OA 1KFEA 2CLPA 1YTEA 4QFUA 4BKNA 1SZEA 3N6HA 3PK7A 2G8ZA 2ZZ0A 3ELFA 2RGMA 1P48A 1R3VA 2Z29A 1E0TA 1F74A 2V2CA 2XHYA 1WZMA 1HT6A 3PF3A 2PDJA 4FNUA 2X8RA 2QUTA 5EFFA 1KXTA 3EX2A 3WBEA 1PCWA 1VQTA 5A8PA 4KETA 4LYPA 2X8CA 1TKKA 3PAJA 3Q6JA 3UZ5A 1HVXA 2NQ5A 1UR8A 1MEHA 4HN8A 1X2GA 2HK0A 4FNRA 3WD1A 2Z2AA 3THDA 4C7GA 4B4FA 3ZJ6A 3GRTA 3URQA 2X1UA 3FOKA 4WDWA 1KFBA 4M6PA 3L67A 6CGTA 3CGTA 5D8ZA 1W2VA 2EQ9A 1Z44A 4FNQA 4OV9A 5HJXA 5JRBA 4ZBCA 2WJZA 1ITXA 1Q5MA 1FWCC 2J9XA 3S5SA 4O0KA 2E40A 4N2YA 3NR0A 3ZR4A 1DIKA 4H4RA 5A5WA 4OKDA 3MUXA 3RMJA 3MANA 4YWSA 3DGZA 2BHYA 1OINA 1A3HA 3CUFA 4CCDA 5H8MA 4H4ZA 5FS8A 4DBUA 2GH5A 1EHNA 2WPGA 4MM1A 2PF0A 1UJPA 3OVPA 2V67A 3TCSA 1IEWA 3W74A 2V38A 2FZNA 1L6YA 4HHMA 1QHOA 2Q3OA 2Y7EA 3V75A 2GGGA 3NURA 3KOZA 4GBDA 5AKQA 4HHLA 3KOFA 4I8YA 4J5NA 4FDCB 3QW3A 3U8GA 1DEDA 4LCRA 1BXCA 1PEZA 1G4TA 3G1FA 1PIIA 5U7SA 4H9TA 3MJYA 4PBGA 1UKTA 4IPLA 1WKDA 1SPQA 5BU9A 5A2AA 2QULA 3EMZA 4GO9A 1C92A 3I10A 4XZ9A 5FCZA 2VRQA 5A6AA 1J96A 1VRDA 2GOUA 4NZCA 2CLIA 4DNAA 2CBIA 1B3WA 1EPVA 1J6PA 1EYEA 1I4NA 4WUIA 4A8IA 5M1TA 2GQ8A 1RD5A 4E5TA 3M0IA 3AQUA 4EE9A 1JXKA 3URHA 4G8TA 3O6DA 5U25A 5F2MA 1UP2A 2X30A</