3K1GA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ser-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
354
structure length
354
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 124
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3k1gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3k1gA01
4IL0A 1MDRA 3RCYA 4J1OA 1L8PA 3SN1A 2QQ6A 3OZMA 6ENLA 4IT1A 3DIPA 3MY9A 3CAWA 1EC7A 1F9CA 3UJFA 4E4FA 4HN8A 3H12A 4DN1A 1XS2A 3TTEA 2HZGA 4F4RA 3U4FA 3ZVHB 3S47A 1TE6A 2POZA 1NU5A 1KD0A 3STPA 3SJNA 4IHCA 1P43A 1PDYA 2DW6A 1MDLA 3PWIA 3QPEA 4MGGA 5EU9A 3ZVHA 4MMWA 4GGHA 1BKHA 3U9IA 1KKOA 3DERA 3EKGA 3K1GA 3ZLHA 4E5TA 3RRAA 3I4KA 1PDZA 3N4FA 3OZYA 2XGZA 4HNCA 2PCEA 4GYPC 3V3WA 4M6UA 3OPSA 3DFHA 1YEYA 3JVAA 1WUFA 3DG3A 4ZA0A 3P3BA 3D46A 4X2PA 3T6CA 2FKPA 4Z1YA 3OP2A 1KKRA 2GGGA 3R1ZA 4M0XA 1R0MA 3UJSA 2XH4A 2QGYA 3TW9A 5J04A 3SN0A 4KEMA 3TQPA 3DFYA 2OPJA 3MUCA 4GGBA 1JPDX 2MNRA 2QDEA 2NQLA 2PODA 3VCCA 7ENLA 1KCZA 2OG9A 1ECQA 3QKEA 4GMEA 2PP3A 1BQGA 1TZZA 3RGTA 2P3ZA 3BOXA 4IP5A 3RITA 3T8QA 2PSNA 3CB3A 4JHMA 2OQYA 3H7VA 2P88A 2QJJA 2ZADA 3FCPA 3S5SA 3FJ4A 4ROPA 3EEZA 2AKZA 4Z17A 3ZLGA 3ES7A 2GDQA 3IK4A 3ES8A 5FJOA 2HXUA 1EC8A 3VC5A 3T4WA 1SJDA 3UXKA 2OZ3A 4DHGA 2XSXA 5FJRA 3IJLA 2OX4A 1DTNA 3UCCA 2PGEA 3SQSA 1ONEA 3GY1A 2O56A 3NO1A 3DG7A 3H8AA 3DG6A 4ZCWA 3PWGA 5ENLA 3QLDA 2AL1A 2P0IA 3IJQA 3VC6A 2GGJA 4H2HA 3DESA 2OQHA 2AKMA 3CT2A 4G8TA 4JN7A 3TCSA 3VCNA 3TOYA 4A35A 3I6EA 5IDZA 2PMQA 2PU0A 2PTZA 4EWJA 1JDFA 4E6MA 3N6HA 3H70A 3VDGA 2AL2B 3UJEA 2PPGA 3I6TA 3IJIA 3GO2A 3MSYA 1MRAA 4HCLA 1ELSA 2GGEA 2RDXA 3FVDA 2MUCA 2PU1A 4A3RA 1SJAA 1FHUA 3OTRA 4GIRA 2AL2A 3QN3A 3R25A 3SN4A 3N4EA 3FYYA 3P0WA 3P93A 3R0KA 4KWSA 5FJUA 5BOFA 4K1WA 3UCDA 2ZC8A 1SJBA 4GISA 1NELA 3R10A 1P48A 3D47A 3Q45A 2QJNA 4HNLA 3THUA 1EBHA 3SBFA 3R0UA 2QDDA 3MWCA 3UJ2A 4E8GA 2PP1A 3V4BA 1OEPA 3TJIA 3ZLFA 2GL5A 1R6WA 3UXLA 4DYEA 1XPYA 3DGBA 1W6TA 2OVLA 3V5FA 2OZ8A 2XH0A 2PTWA 3OW1A 1IYXA 4MKSA 4H19A 2DW7A 4IL2A 3VA8A 4DWDA 4HCDA 4H83A 4KPLA 2ONEA 1E9IA 3HPFA 2PGWA 1EC9A 2PS2A 4FI4A 4E4UA 3JZUA 3NZGA 1MUCA 2XH7A 4K8GA 2PA6A 2OZTA 4GYPA 3DEQA 3JW7A 4DXKA 4KT2A 3PFRA 4YWSA 4ENLA 3MZNA 4HPNA 2OLAA 3V5CA 2OO6A 2GGIA 4K2SA 1WUEA 3R11A 2FYMA 4GFIA 5BOEA 1FHVA 3CXOA 2HXTA 3ZVIA 3DDMA 2OFJA 3CYJA 3TWAA 2QVHA 2I5QA 3Q4DA 1JCTA 1SJCA 2PP0A 3RR1A 3NXLA 1MNSA 1JPMA 1RVKA 3BSMA 3TWBA 2QJMA 3B97A 3SSZA 5FJPA 3KUMA 3MKCA 3PK7A 3UJRA 1TKKA 3GC2A 2CHRA 3BJSA 4IZGA 3ENLA 2OKTA 4FP1A 4DX3A 2P8CA 2P8BA 4IP4A 3RO6A 4HCHA 2PTXA 4HYRA 3GD6A 3NFUA 3FXGA 3T9PA 4JN8A 3N6JA 3TJ4A 1EBGA 2XH2A 4A6GA 4H1ZA 3VFCA 2GSHA 3CK5A 3UGVA 4J3ZA 5FJTA 2HNEA 3FV9A 3QTPA 3MQTA 2PTYA 2GGHA 4G7FA
chains in the Genus database with same CATH superfamily
5ABFA 3NGJA 3O0KA 4QXIA 4PN2A 2NT1A 4FXRA 3SN1A 2VURA 4MM1A 3VCRA 2QQ6A 3OZMA 3DIPA 4Q22A 4MNJA 1YNYA 1V8EA 3SRDA 2WHJA 1WXZA 5IDIA 4DN1A 2QLYA 1BZLA 2I56A 3O15A 4BFAA 5GNXA 3AQUA 2HZGA 3SCSA 2CLFA 3WLRA 1Q6LA 3NZ1A 1C9WA 1J11A 1C7TA 4EPKA 2P76A 4EMIA 1GREA 3TKFA 1JQXA 2IQDA 2RFGA 2XDFA 2C16A 4L61A 1H7NA 1FFVC 4MVAA 3TQVA 3SFWA 3M0XA 1J0IA 3KOZA 4F0SA 1JPIA 4HMNA 3W6MA 1RK5A 2WHKA 3DN5A 1BVWA 1U30A 4F8XA 3ZVHA 2FHCA 1A3HA 1H7PA 3BQ6A 1A5KC 5HAOA 4S23A 5BZAA 3N4FA 1OT1A 1PTAA 2XGZA 2HWGA 2WMIB 3V3WA 1GK8A 1LQ2A 1YEYA 4TTGA 3A47A 3NDOA 3UU0A 4ZA0A 1OVDA 1B4EA 1Z41A 3PTMA 1HVXA 2QF7A 1E1EA 3GDMA 4CQAA 4IIGA 3LRMA 3NPXA 2V5JA 4H6RA 4M0XA 3SGGA 4K3ZA 1GTHA 3TLLA 2GH5A 3QZAA 4J5NA 2FJUB 5HWNA 1OWQA 1WNOA 4AEFA 4S39A 2C91A 3S4TA 3TQPA 4REQB 6TIMA 2ZKMX 3EBVA 1XP3A 1EA9C 4MF4A 1XRFA 4DIAA 2PC8A 4YJ5A 2JKEA 3KL5A 5BU6A 1K8CA 3A9BA 4U10A 3CH0A 4MYXA 2PODA 3DH7A 1E71M 1GQLA 2DZUA 4BR1A 1UA7A 4FLRA 3QC0A 1UWRA 3NR0A 3RITA 3WQOA 3MO7A 3RDKA 1L6YA 2OOFA 6A3HA 1AODA 4NY2A 1EJSC 5M03A 3H7VA 1OYBA 4I7VA 4H4XA 4U5KA 1GORA 3I7RA 1EIBA 1YXCA 4Q4RA 3D5HA 1TPVA 2QJGA 1QHPA 1ADOA 1TPC1 3ES7A 1JZ3A 2I7GA 3IK4A 3SECA 1IXOA 1I8JA 3EXRA 4QM1A 1LRQA 4RZ5A 3NVYB 3O0FA 1KM4A 4IX0A 3AHTA 2R91A 1UD3A 3UFYA 1DP0A 2EKCA 1S2VA 4IGSA 1XANA 2V3AA 4GIAA 3HU7A 3PJWA 4PSRA 4RNJA 4KIEA 3PPFA 4S3AA 1OCQA 3CEPA 2Y8KA 1US3A 5FSEC 3VINA 4E8DA 4BCEA 4MZYA 2A7NA 1ZCCA 3CIWA 1YXYA 4QCEA 1PB0A 2V5DA 1A49A 3RLHA 1AMKA 2OQHA 4EE9A 2Y70A 3VCNA 1T8QA 5DO8A 3W28A 2NPXA 2HVNA 2Z0IA 3ZZ1A 1AD4A 1XI3A 1WKEA 4CD7A 4LVGA 5F2IA 1FA2A 2QUUA 5DQPA 5IM51 4F2UA 3AO0A 4GABA 1OY0A 4CKQA 1W9BM 5DMNA 1ZTVA 1P0BA 4LU0A 1UASA 5HJYA 5LHFA 4PBGA 4QE5A 4H9ZA 4KRTA 1IGSA 3DX5A 5AYXA 1A5NC 3ZFHA 4Q8TA 3LX9A 1PV8A 3QM3A 5AC4A 2ESCA 3S9ZA 5DRCA 4GIRA 4NYUA 3N4EA 4QISA 1G9HA 2DZTA 3HG4A 3UERA 2D2HA 4S3JA 3VUSA 2POTA 2D0HA 5DCBA 3WEZA 1U2YA 1EGVA 3WLNA 3A9IA 1XRSA 1UKQA 2PWDA 3LNPA 1SW3A 2XN0A 4ZBCA 3SCRA 1KM1A 4C1LA 4TVCA 4JFSA 3MKVA 1LZOA 4BKNA 3LQGA 4WLCA 5T9CE 1HJSA 2QIIA 2VFEA 4YVXA 2HMCA 4RDVA 1SYTA 2IS7A 2J7DA 1OABA 2HEJA 3ABRA 3VYLA 2GL5A 4CD4A 1JL8A 3H7UA 4QLJA 2OVLA 2ZE3A 3W7LA 3SJ3A 3WCZA 1XXXA 4DAIA 3B0PA 5G1YA 2YB4A 3TC6A 1ZBWA 4AXNA 4PEKA 1Q4NX 4M82A 1IWPA 1KFJA 1V3JA 2PDNA 3NPUA 3W7IA 1X38A 3LPFA 2ONEA 1OCJA 2EKGA 4BEQA 2GOUA 1OB0A 3UZJA 1VF8A 2DIKA 2YDRA 1ONRA 1P7TA 3GXIA 4PL2A 1ZZMA 4OJYA 3UG4A 2YKKA 3UNDA 3AC0A 3ERPA 3T0AA 2FZBA 3LI0A 1TZ7A 2FZ9A 2BVDA 1D3CA 3K8KA 5C7VA 2E5DA 3FAXA 1EJUC 2FVLA 2AGKA 4HK7A 4LTSA 4O8RA 3WNNA 2O9RA 2GGIA 4UWMA 3SRFA 3BG3A 2FGBA 4O17A 1QK2A 1KM3A 3W00A 5EMMA 3LERA 3NSMA 4LUJA 1D7FA 3QGVA 5H8PA 1DIDA 2FB3A 2GPTA 1E0VA 2I9EA 2E5AA 1IXQA 1K8ZA 7REQB 4GUGA 1UKOA 1BGGA 3CUGA 3HIJA 4D8LA 3ONCA 4D6CA 2ZXQA 1O1HA 1Q2RA 4W85A 3PZMA 4EIVA 3OVGA 3G8EA 4QJ5B 4BURA 4JQ2A 1W3TA 1M3UA 1P0DA 1EHAA 1FFRA 3TR2A 3GC2A 5BCAA 3BJSA 2Q8ZA 4RV8A 1E0WA 4DX3A 1A5AA 1PEZA 2P8CA 3G1DA 3TJLA 3BPWA 3QZ6A 5I78A 4DI9A 5F4SA 1TYTA 4D8ZA 4KWWA 1TV8A 3GD4A 1OX6A 4L6DA 4DLFA 1AH3A 2PDPA 1UR0A 3B03A 3KRBA 3G8RA 1G6CA 1Q63A 8A3HA 3CHFA 4J4KA 3W22A 3RPMA 4MB5A 3AWOA 1LL4A 3DU0A 5E70A 1RALA 2FHFA 3IV3A 4JIEA 3HFYA 3SQLA 4BEUA 4YYCA 1JF6A 1PO9A 2XFRA 3UA3A 1H3GA 1OGGA 4L56A 5GRTA 2Y5SA 3EPMA 9CGTA 1CECA 5FS7A 5HDRA 2YZ5A 3MUIA 4JYFA 3RLVA 4LW7A 1E0TA 3SIZA 1JZ2A 1RP8A 1UD2A 3GTFA 3U5UA 2HS6A 1PKYA 3AYRA 2FQIA 2PFHA 3UXIA 1KB3A 2OEKA 5D30A 1H2IA 1XF0A 1LP6A 4AC7C 4U5IA 3C52A 4JZ5A 4LVFA 2Q8XA 3MDWA 4DY1A 5FF2A 2QCGA 2EGZA 1XH2A 4HA0A 5AVHA 3EPOA 3C3UA 2ZXAA 1NP2A 1XQKA 4A3QA 2GVJA 4M6UA 4EMWA 3GBEA 3W85A 3ICJA 4JFVA 4CCZA 5AZ1A 3B8IA 4CNNA 5KETA 3GNOA 1US0A 3QQ1A 3AIRA 2ZA1A 3IIPA 3QR1A 2X7VA 2AAMA 3SY1A 3L5LA 3M46A 3VIFA 1GV4A 4B90A 2OKOA 4UXDA 4O12A 3USZA 1XYLA 2WKLA 1M53A 3WNKA 4W4QA 4BV6A 4M56A 1NOFA 1CDGA 1J6OA 4UTTC 2R9RA 1S7MA 2PWEA 5I09A 3DYMA 3EX3A 1GXFA 2WSKA 2J9YA 2WANA 1H41A 3TW7A 4XZHA 3S6TA 1TJ0A 2B7QA 4PRWA 2V63A 4ATDA 4IMGA 4HSOA 5FF3A 2A3BA 3WQEA 1TG7A 4M8UA 4GZ7A 3RX3A 2ON3A 1ZENA 3MHUA 1O1ZA 3AHXA 4Q33A 5C2CA 4QE4A 4QRNA 5A95A 2J78A 5TD4A 2P0OA 5AY7A 1PPIA 1E6RA 2NLYA 3ES8A 3TUUA 3R13A 4E0CA 3P80A 1WAWA 3SI9A 3P67A 4GBDA 4IPIA 4UOZA 1QT1A 4PUJA 3E49A 1J4EA 4Y8FA 2ZFAA 3E5PA 4HMCA 1P0EA 3SQSA 3HGRA 4LYQA 3GHRA 6TAAA 2PDWA 1OFQA 5FS6A 1QVBA 1RY0A 4GHRA 1FVPA 4IGNA 1H5VA 1UB3A 5FCZA 2P0IA 5F1UA 4WVXA 3NJ3A 4JD4A 2C1IA 3N17A 3DAQA 1IWAA 1OSEA 4PC8A 1GUVA 3TCSA 4ES4A 3V35A 5A8MA 1GRHA 4TVYA 1I75A 4MWAC 3HPXA 3OB8A 3SQPA 4LRSA 1BVZA 1SGJA 4HPHA 5CG0A 3U0HA 4PSPA 5D2TA 3HJZA 4HK6A 4IMEA 3W7DA 2IKHA 3H70A 3VIMA 1PZ0A 3G0SA 2YCIX 4UBPC 3GIYA 4L4OA 2DUAA 2BY2A 3NSNA 4XB3A 4IGMA 3W82A 4Z1BA 3KCJA 1UPMB 2VEGA 3UR2A 1SFSA 3L67A 4JNZA 3WQFA 1ODUA 5CSYA 3B8WA 1FWTA 3PB2A 2RDXA 3G1SA 3EAOA 3GS6A 3LXDA 5FJJA 3OC4A 1OGBA 4B5TA 2JK2A 5BNKA 2PTDA 2X1TA 1OX4A 3GXFA 3WBAA 1FCVA 1YE6A 1B3ZA 4UZSA 4DZIA 1YQ2A 3UWYA 4XD6A 3TW6A 2ZX5A 1OFBA 1ESWA 3HG5A 5CC3A 1P0NA 3BVJA 2V38A 2JGYA 4JTAA 3AFBA 1SFTA 5J5RA 3UZYA 4IIEA 2PD5A 1VRDA 4EKJA 2ZCGA 2RAGA 5K7JA 1XLJA 4R85A 1U5JA 2PDXA 4JX6A 2HK1A 4YL2A 2NWRA 1XPYA 1DWIM 3DGBA 3W01A 3UWZA 1E5NA 3L4ZA 2ACRA 4O0KA 3A6OA 1IEXA 1J0HA 1VBUA 3GR4A 2GVYA 3VK5A 4CN4A 1JROA 3RM8A 4IXXA 4ACZA 4QTGA 2WP5A 1J01A 4P7LA 2A4AA 1FHLA 1GOMA 2YSWA 6XIAA 2Z24A 3REQA 5A6TC 3KP0A 1UWAA 2OZ0A 1Z69A 3NZPA 3DXIA 4DBSA 3ZOAA 3LA4A 2Y62A 3LXAA 2QCFA 3FGCB 4KPRA 1QNOA 2WVVA 2DH3A 3TFCA 2OZTA 3MHGA 1G7VA 2ZRVA 2WMJA 4KQNA 1OC6A 4QG8A 4HPNA 4BI6A 4QDPA 5HUOA 1RR2A 1KV5A 5EMJA 2REQA 1JCLA 2W55A 3ZWSA 3CAKA 3LU2A 3CZLA 1JG9A 2QV5A 2VR4A 3TWAA 2GZXA 3NQAA 2QVHA 2ZTJA 3MBFA 3V7PA 3W1LA 3KTXA 3C8NA 1TRIA 1FWHC 3PAJA 4C6BA 1PZ2A 5JRBA 1ZQ5A 1CEOA 1JF5A 5C0QA 2V5BA 2W6RA 2GJRA 2CXEA 1Z7AA 3PK7A 4ZO9A 1TMHA 4ZOHB 3CT7A 3KLLA 4H4QA 3OVQA 3MP4A 3RCNA 4PUMA 2H9AA 5CJMA 4DUXA 7ODCA 3L0NA 3H4XA 2VX6A 2EQ8A 4WGHA 1VPXA 3T7VA 4IMFA 1UP0A 2WPFA 1E9LA 4Y2WA 3RMEA 4QE1A 2VX5A 2J7HA 1JYXA 3HV9A 1VH7A 3UG3A 1BSLA 4KBXA 4XVDA 2WNNA 3WD3A 4ZOAA 3UD6A 1UYQA 3NXFA 5A6AA 1UOKA 3WQWA 3HTWA 1H49A 4YMZA 3LCGA 4XBKA 1ZALA 5I07A 2F6KA 2EPLX 5KZDA 1VFMA 4HN8A 3HFTA 3A4WA 1E9YB 2GVLA 1NFBA 3AIWA 4CGTA 1M04A 2VUNA 1JCNA 3N2CA 1L2UA 4JR5A 3HJEA 1XRTA 4UMAA 2W79A 3ZSSA 1WBJA 5E6ZA 1PZ3A 4L64A 1JZ6A 4M1BA 1Y5WA 3B8UA 3IARA 2AQVA 1E43A 2PI6A 4NKCA 3VKBA 5LXEA 2ZC1A 1REQB 4FPSA 1VFHA 6ALDA 1DXLA 3TMQA 5CBBA 5LSMA 3C0LA 1KGXA 1CNVA 4Y9MA 2A7RA 4UCGA 4DJEA 5FL1A 3WLOA 1EL3A 1NIUA 3UZZA 1R38A 3N2OA 3A5FA 4GQRA 1UWQA 4FK9A 1QI0A 2LLEA 4JTQA 2NXHA 1IT8A 1E72M 2WW5A 1I2PA 1VPQA 4LB4A 4IICA 5DFAA 3TXVA 5LKYA 4JDRA 4PH6A 1V5XA 3S3GA 5U25A 4I9AA 3PZGA 2D1ZA 4OTKA 1XC4A 1GW9A 3DJGX 1TRDA 2OXNA 3PZOA 1DIKA 4C65A 5B7ZA 1FXPA 3E2RA 1NWRA 4FB7A 1EGMA 3PBUA 3TYAA 3BMWA 4OKDA 4TXEA 2NQLA 3R58A 1TPUA 1XG3A 4H3DA 4Q4OA 5JBEA 3W07A 3ITLA 1KRCC 5JCNA 1QPOA 3AM9A 1OQFA 4E2OA 2TPRA 2EPMX 1VQZA 4AFYA 2WYSA 4BZYA 4O52A 1CCWB 2VI0A 3IS4A 4JTLA 3VDHA 1WPCA 3S5SA 2X7WA 5U1OA 1TV5A 4YN5A 1ISVA 4TVUA 4AY8A 5I24A 3KRZA 1OZMA 3ANUA 1R7OA 3WYZA 1KA9F 1EC8A 1ZS2A 1EO7A 3CAVA 1B1YA 3WQ6A 4GY7A 1T99A 1OFOA 3MJMA 2UY2A 1WP6A 5DCDA 1E40A 1R30A 4FOJA 1QOXA 2YA1A 3FYOA 2FB2A 2GJPA 4TVWA 4APNA 3VKCA 4NEWA 3BG9A 1DORA 3FOKA 3GLCA 1KGUA 3VC6A 4C5YA 3AIQA 4WSJA 1SSGA 1DJQA 1S1RA 3RYSA 5LNWA 4YTQA 3S42A 4LF2A 3G5EA 1K70A 3GUGA 5CC6A 4BF7A 3WDRA 1Q6DA 2NW0A 3TZNA 1JVNA 3UWVA 1VZWA 1AJZA 4IUOA 4XSMA 1LPFA 1KCXA 2YCLA 3H21A 3OA3A 4G2DA 2XGBA 4PULA 3VIIA 2W3SA 2PPGA 4XSLA 3GXNA 3N2BA 3CYVA 3W4RA 1S5MA 4HOWA 4O53A 5IHRA 2C7FA 2Z1VA 4AHQA 3B4YA 1YQZA 4KS0A 1Q6GA 1JZ4A 1FHUA 4PMVA 1JUEA 3NSXA 4DJFC 1LCOA 2UY3A 1ONXA 4C7FA 3PG9A 3EANA 1PKNA 4GISA 1E3ZA 4K38A 5C5YA 1UUMA 5ECUA 1I1XA 3CL8A 2ABAA 4HMEA 1EBHA 1SZFA 2FGLA 4JTCA 4X9SA 3THUA 3STFA 2BOEX 5KEZA 4IX2A 1CGTA 3D3AA 2BHYA 3T2QA 3CUXA 4DWSB 3BLKA 1WAUA 1JD9A 3JS3A 3IAQA 1UHVA 1DWGM 1CZ1A 1VJSA 4LEFA 4ZO8A 1N5WC 1NVMA 3R4IA 4ORMA 5G1MA 2VC7A 4GCXA 2IKGA 1XD0A 4M19A 3MS8A 2DP3A 2BFGA 2OZ8A 4KKXA 1XLGA 5G2WA 2O0TA 2VFHA 2EQDA 1SR0A 4S2BA 2C1GA 1RJQA 3C56A 3FDGA 3LGGA 4B91A 2WSYA 1RM6B 1KTNA 4DWDA 3GU9A 2R6OA 5LIUX 1M41A 5M2FX 3S1UA 4PMUA 8XIMA 3LHUA 2VO5A 1TTQA 2VC9A 3PANA 3H54A 2ZUWA 3IGSA 1ICQA 2Q3RA 1DE6A 3OLGA 3A7AA 3EMQA 3UY7A 3MCMA 2YL8A 4LBSA 1I45A 3IV8A 2JEQA 1LUCA 4ZR8A 1UP2A 4AG0A 4XZLX 3I4EA 2ZUVA 2OO6A 5FEPA 3W71A 2R1PA 3W76A 1GEQA 4MJ4A 4NZFA 5LIYX 1KW1A 3O16A 1RAKA 5A8GA 1DXEA 5JBFA 1YXDA 2Z2UA 1WBHA 3RM4A 1JCTA 1RUSA 1J10A 2A3LA 1BYBA 1CB7B 2PDJA 3NXLA 3HPZA 3WJXA 2CLOA 1OHLA 2PGRA 1MNSA 4PCFA 2PDKA 2YDSA 2EPHA 1VIWA 3CLMA 2QEZA 1EQCA 3FN9A 1UR8A 1I2OA 3DK4A 3B0YA 5HJLA 4ZQOA 3UXAA 1M9HA 4OIFA 1WXJA 5HNRA 3BCFA 4GQGA 4B4FA 1FIQB 1D7KA 1NFPA 1WDPA 3NFUA 4L6OA 2IQTA 3UZXA 1IT0A 4W86A 1BVNP 1VCFA 3ITTA 3SFKA 1JEZA 3E1F1 1W32A 1LT8A 1OK6A 3TJ4A 5DANA 3VKAA 3F4CA 1RD6A 2VOTA 3CK5A 5XINA 4X2RA 3VIGA 2WBAA 3TSMA 4W87A 3ITGA 3DCPA 2OYLA 4KF1A 2J88A 4ZB5A 4KGJA 1IEIA 4J1OA 4A2SA 4XKYB 1E73M 2BGNE 5DF0A 2HPMA 4LAZA 2J7FA 4WY0B 4Q32A 4S3FA 4K7ZA 1H51A 4NJKA 1MWOA 4N4PA 3GXMA 3QR0A 2ZZBA 2ATSA 4H9UA 3B9OA 1O5QA 1UIOA 3BZGA 5JCIA 1XLMA 3HG2A 2X1UA 4DNHA 3CWHA 3TYUA 4ZOEA 5FI8A 1TR9A 4JEQA 3KBWA 4MNKA 4EK7A 1NP0A 4QR6A 3UPMA 4JGDA 1B31A 5DY3A 3KBSA 2ABBA 5GPRA 4JTFA 4AVFA 1FO4A 2BV9A 3Q58A 2PCQA 4YYFA 4OQVA 4ZQPA 4QITA 1POKA 3KZSA 3DERA 3WF1A 3LMYA 4J28A 4GYPC 2WBGA 2I14A 3CZKA 3LHYA 3EDDA 2JKPA 2B0MA 2NX1A 2XWEA 2WBKA 4BWLA 3W23A 1U1JA 1ISXA 4B3KA 5IRPA 3DI0A 3GNXA 3KAOA 1GJUA 3EWXA 1MO0A 3QC3A 3EKZA 4MAZA 3CGDA 1IR1A 4AMCA 4HBKA 5KINA 2QZRA 4JFUA 4FDCB 1R0MA 5M3WA 2ALDA 2BZNA 4PRRA 2PRHA 2YYUA 4H9YA 1J12A 1EX5A 2A6NA 2WM0A 4D6HA 2ISVA 1BTMA 4MUZA 1V3MA 1O94A 5ABFB 3UW6A 3OBKA 5G5HB 4EM3A 3TX9A 1K7FA 5I03A 4U3AA 3MJYA 3PUGA 1SVDA 1ECQA 1KTCA 2YB1A 4JTJA 4AYGA 2VNCA 3W29A 4PBFA 4AZCB 2PC4A 2J25A 3SO7A 1Z48A 2Q3OA 3TTSA 5K9XA 3GUWA 3FJ4A 1LF1A 4OGZA 3QFEA 3FA4A 1NY1A 1YTEA 4BY3A 3P74A 2W92A 4O1AA 1OFAA 4F3HA 4CNSA 3DK9A 2YXXA 1SJDA 4PA8A 1ZX9A 2QUTA 3LXBA 4CQ8A 3LB0A 1DWJM 4LUTA 2DSKA 3DOPA 3N9KA 1KQZA 1JCYA 3ATYA 4ATLA 5A2CA 3I3DA 3CH9A 3WJWA 2O56A 2G3JA 4Z2GA 1OYAA 4Z1AA 1T0OA 3R0DA 3LLDA 4UFHA 4KERA 1JJKA 3M0YA 3VOJA 4YCOA 1QNVA 2YVFA 3VGHA 1GKRA 4GE8A 3W73A 2WO5A 3UWUA 2FDSA 3RR4A 2C1HA 5E6YA 4LCQA 2PMQA 1J5TA 2WB5A 1FP9A 4EWJA 1UA3A 4O1BA 1OG0A 3UGRA 1J8VA 3CB8A 4C6NA 2VVSA 4B15A 4EQSA 2E5BA 4E2DA 2B31A 4TU1A 3NDZA 1CPUA 3QFWA 3GYEA 1ONFA 1RXOB 1B57A 3AIVA 3CPGA 5DY2A 3OYXA 1K6WA 4AD0A 5AECA 2BTMA 4GR1A 1Y65A 2RHGA 1TTPA 2PF0A 1TZ9A 3R25A 3A3HA 2DZAA 1OJXA 2JBMA 5FJUA 2WZEA 2WCSA 3CV6A 1N5XA 2BY0A 4C5ZA 2VEMA 4JQ3A 5J8LA 3PZ9A 3DYPA 4HNLA 1YLVA 4J3UA 4KWOA 4M6PA 3BLEA 2J7GA 1J0YA 3VOFA 3EX4A 4CNOA 2QDDA 3NQGA 1VFUA 1VFOA 1OEPA 1XH0A 1TMQA 1RD5A 3ZLFA 3VKDA 4PCTA 1E6XM 4JTDA 3L21A 3UXLA 3BLPX 4FXFA 3EWCA 1FWIC 4IIHA 1V6XA 2RGMA 1E6SM 1XLCA 4H9TA 3HV8A 1RA0A 1UH4A 3CV1A 1IEQA 2D23A 3W72A 2FPVA 2OOGA 3L2MA 5AHMA 3DBPA 4DVOA 4MKSA 3DHFA 3DKJA 1H09A 4B2DD 2QIWA 3AXKA 4AWSA 5G4HC 5BXPA 1FH8A 3TXZA 4H4PA 3NQCA 5ABTA 2GOKA 5C9WA 5HQLA 1FEBA 1JRPA 1E3XA 5LIXX 4UTFA 2ISWA 4UTHA 5F4XA 1OINA 4EF9A 5C55A 3VE7A 2HRWA 5LGZA 2A8XA 3VD3A 4DXKA 5C9ZA 4QAWA 1K9DA 4JDYA 4DF0A 3PZVA 4HGXA 1TJPA 4ENLA 1R3VA 4IFOA 1SR9A 4DB7A 4I9MA 1Q6RA 4R5EA 1MFVA 1TQJA 2NZLA 2VM8A 1GNXA 3E74A 3WMCA 1DEDA 4H04A 5DCEA 3TVAA 3K8MA 2GR0A 3PPHA 2GJLA 3E2SA 4WDTA 1ICSA 1NDZA 3GDLA 1LWJA 5AYZA 2ACSA 3IJDA 3Q94A 3CHVA 3ARWA 4XV0A 2QJMA 3AHYA 3MKCA 3UJRA 2WMHA 3N2XA 4FR6A 3ENLA 2XVPA 2DQWA 2YYTA 4IP4A 3CMFA 5EFFA 4C6KA 3A4AA 1YDOA 4G7EA 4AHOA 3S0CA 1U33A 2E3TA 5HATA 2Y8UA 5MF5A 1TJRA 3K30A 4X9YA 4WGXA 2FH8A 4Y7EA 4PTXA 4FNQA 1ODZA 1TTJA 1JGIA 4JTHA 4DM2A 4MYAA 2DIJA 1VP5A 1EH9A 2HTMA 5I5RA 3TOPA 1B9BA 1W1YA 3OG2A 4IT1A 4C6EA 4WJXA 5ABGA 1OFEA 3STEA 4AIUA 1HKWA 3FDKA 4D9PA 1TSIA 3A64A 2FFIA 3AYSA 4Z2HA 3H2MA 3BAXA 1TV3A 4PEEA 4MAVA 1BF6A 5M17A 5TNVA 3G0UA 3GBDA 3Q6JA 4XBSA 4N9CA 3HRDC 4S3BA 4LYKA 2X40A 5G5IA 2V3EA 5T8GA 1VD6A 3OBAA 3P82A 1DQUA 3L4WA 4DBWA 2G0WA 3ARXA 4JBRA 4WZHA 1RZMA 3QPEA 4MGGA 2BODX 4JY9A 1EFZA 2WOVA 2O7SA 4IXHA 1BKHA 2PEVA 2NX9A 4S3CA 3KW3A 3ZM8A 4D1JA 1A4LA 3DK8A 1F8WA 3TMLA 2DPEA 3FEMA 4DUOA 4B5SA 5MKGA 3M0IA 3W7GA 3U3HA 3AHZA 1GVRA 2EQ6A 2VGFA 4L7ZA 4LAMA 2GJXA 1BSIA 3APTA 4BQ2A 4B5NA 5I77A 1OBAA 5A69A 4CD6A 5C70A 5H1WA 2HDJA 3NNTA 1PCWA 4MB3A 2E9LA 2P53A 3TYBA 2QUNA 3BURA 3GTIA 3BGJA 2OPJA 4XD4A 2NQJA 3W84A 1FDYA 1H7RA 1PAMA 2WVUA 3OQ8A 1OFPA 3WQPA 4V2XA 4FNRA 4H4IA 2VGGA 4F9DA 1H7XA 3OGVA 2QHAA 3ANYA 3W7CA 2I17A 3CQIA 3D3FA 2C18A 3QR3A 1S3TC 5AHIA 3CV7A 3POHA 2QJJA 1QPNA 3FSTA 2G3NA 5DN1A 4GBUA 3G6MA 1ME7A 2NSOA 4AF0A 4JIQA 2ACUA 1HP4A 4AD1A 2FZNA 2HXUA 3CNYA 1DOSA 4PMJA 4J57A 4NZ4A 3LYEA 1FCUA 3NVZB 1C3FA 2X1SA 4C1KA 2WVTA 3IWPA 2XSXA 5A8NA 1FCQA 4IQJA 3PNUA 3LCXA 1V97A 3MMUA 4FF5A 3RX4A 4J40A 4MWAA 5GVJA 1GETA 3BV4A 2QW5A 4DQWA 1MQRA 1EP2A 4EMJA 3KVKA 4LF1A 2CBVA 1XICA 4ZO6A 3MUAA 5A2BA 1TB3A 3BGAA 2D22A 4G8TA 4LAUA 2GDVA 4N9EA 3AMGA 2XHYA 4O11A 3MV01 3HBLA 3F1QA 5D02A 1Q8JA 1MI3A 4UTWA 1X6UA 3ZT7A 4IPPA 3N3MA 4H00A 3QY7A 4YPJA 1H0GA 2IXUA 4Q8NA 1EDGA 2VC5A 2NXIA 2R1MA 3ECQA 2ZWZA 5CLTA 3TNOA 4N7QA 4UTMA 1JPHA 3NQVA 2CDUA 3WH8A 2E5CA 3GO2A 5D2WA 2QXWA 3N3TA 3XIMA 1QMLA 3G18A 3U8GA 1Z42A 5C9UA 2IPFA 1ELSA 1A4MA 4PFMA 3IUIA 2D2OA 4A3RA 5CGMA 1UROA 4UQ9A 4RNIA 1RCQA 3F5JA 5CH9A 4C6OA 4IMAA 4N9BA 3R0KA 4RR4A 1A3WA 3E0IA 4BI5A 7CGTA 3VABA 4WY0F 3WEOA 4K1WA 1GONA 4ICCX 2ALRA 3T0TA 1C8XA 1KCLA 3KTCA 5D2XA 5CBJA 3OA5A 1FWDC 2V6AA 4GPNA 3G1RA 2XIOA 4E8GA 4XAPA 2VKZG 5EMLA 2GQ9A 3WBEA 1IE7C 4GO8A 3N9RA 4HPGA 3E38A 1P1MA 3EEGA 3AS2A 5G5GB 3GK0A 3TN5A 1D3HA 3VD4A 1M7XA 1AK5A 2XU2A 4LEQA 4QLKA 3EDKA 2CXGA 5BYWA 3PBWA 5E09A 2V3BA 2VQTA 3TQKA 1GOQA 1QK0A 3WD1A 2D73A 5K3VA 1M68A 1B54A 2V81A 1EUAA 2A3EA 5I3JA 3S5YA 1LORA 3WLPA 2C19A 1LBMA 2FZMA 3W7HA 3M47A 2W0UA 1MXDA 4PB3A 1AL7A 3UA4A 3HPAA 1AA1B 3OHIA 3IAPA 4MOZA 1HKVA 1PKMA 2OB3A 4Q8WA 3GH7A 2PDQA 1XYFA 4ZQNA 1R2RA 2NVAA 3QV8A 3A21A 2V8ZA 3M5ZA 2R94A 3OHMB 3BMVA 2WM1A 1WX0A 3TC3A 2FYMA 4HJWA 3GHTA 3H26A 4GXWA 2IQ0A 1KR1A 1HN1A 3GH5A 1J79A 1OCNA 3B8DA 5CG7A 1OD0A 1O68A 3WQVA 5JQ9A 3C0JA 3FEQA 3VD5A 4FLSA 4FR1A 4QNEA 4PMDA 3FJ6A 1BWVA 4FEZA 3RMJA 3FK4A 1GVFA 4M29A 3G1FA 3A4JA 3TWBA 4GH3A 5KITA 3JUGA 4AD3A 3A4XA 2WLYA 1AJ0A 1TKKA 4R88A 2PLMA 4OFCA 4MJZA 4HZMA 5TF0A 1QU4A 3G1XA 1DXIA 2VRKA 3MA8A 3WH6A 1UW9A 1GW1A 3ZS4A 5GNYA 4O1CA 2Y8VA 4NP7A 5JXQA 1YNQA 2JKAA 1UIPA 1QTWA 1A0DA 2VC6A 3UP8A 3ARRA 3QQ0A 4H4VA 4XD5A 3VGDA 4JKMA 1LQ0A 1F3XA 1ICPA 2BY1A 1SO4A 2P50A 4R3UA 3QMSA 3NQ7A 1MDRA 4D6DA 1KFBA 1RQEA 3B8TA 3WLJA 2GYIA 3WK3A 3FVMA 2WVVB 1HX0A 1GVOA 2P1FA 4MKVA 1F9CA 3EOSA 4HKPA 3GTNA 5L9FA 4US5D 1ZJBA 4QQUA 4F4RA 4C1NB 3VAVA 3NVTA 1LTDA 4HU8A 2A3AA 1OD8A 2HNHA 4GNVA 1WCGA 2GQ8A 2V67A 3TA6A 3EOLA 1PDYA 4W8AA 1R47A 2G4FA 1PTGA 3GG0A 3MDUA 3OVPA 4P2VA 4K39A 5GJMA 1UWSA 1FH9A 2JE8A 4HU4A 1XIJA 4NYYA 4PCNA 1SO5A 4W8BA 2EG7A 4L1WA 3VZYA 3OZYA 4HSHA 1GRGA 4UB9A 3DC0A 4LWWA 3N13A 1EDTA 3I10A 4YLWA 3AZRA 1R5YA 3IGUA 1QW9A 3NL2A 5CPQA 1BFNA 2VYOA 2XJ7A 3T6CA 4QDWA 4JQ9A 3FX4A 1W1A1 2DIEA 4XTIA 1D7YA 1KKRA 3H6OA 2VZUA 4ADWA 4GVIA 2E6FA 3Q67A 1KBKA 1JYNA 1JRBA 1OIFA 1RVGA 3CGBA 1Z9AA 2ATMA 1EYEA 2Z29A 3LM7A 3MP5A 3B8VA 2QR6A 5FSDC 3M0JA 4IIDA 3NG3A 5CSSA 2BVYA 1KCZA 2OG9A 1XLAA 5EGRA 1P6BA 2FLIA 3FFSA 3QKEA 4NI8A 4P8VA 1YKWA 1UQZA 3AUOA 3QFBA 3CB3A 1X96A 2E67A 2E0PA 4N9DA 1XIEA 3B9DA 3OVRA 4ECLA 3ABZA 3E3HA 1M1BA 1CGVA 1G5AA 2FHBA 2EJAA 3EWUA 5FS8A 2WZTA 2CHOA 4JIHA 4Z17A 4PUKA 2Y2WA 1F7BA 1YBQB 4EX4A 1BHGA 2ODOA 1GZ1A 5CGTA 2VCAA 4LB3A 1VFTA 4DWSD 4LRTA 4GD0A 4GZJA 4OHQA 2OSWA 5HNUA 3L5AA 5JH1A 3MSDA 1EJWC 2C14A 1ONEA 3VTRA 1KM0A 3DG6A 2J77A 3CIVA 1MXGA 5AYIA 1VS1A 3A7UA 1S1PA 1AH0A 1HJVA 3NGFA 1EXPA 2Q8LA 4WF7A 1W5OA 3W7OA 4AD4A 1O5KA 4HZ8A 2I9UA 2ZX9A 2Z27A 3BAIA 3DESA 4M6VA 2GR3A 3TOYA 3ISIX 1LT7A 2X30A 2IPGA 1VIZA 3TTOA 1XLIA 5KZ6A 1NF7A 3VE9A 1NDWA 2JIWA 2WHMA 3GFXA 1DJYA 3BICA 3NCOA 3GSMA 3UEQA 1C93A 1P4CA 5A6MA 1GPFA 3NL5A 1C29A 4YNGA 3VKKA 1GKQA 3M41A 4PFHA 2YLLA 1DL3A 1GG1A 3N19B 2GDUA 4YHEA 2F38A 2WSPA 5SWUA 3HQPA 1MRAA 7TAAA 2Y7FA 3BG5A 1XGEA 2E1DA 1ZJHA 5AHLA 3UF9A 4A8NA 2AL2A 1X2HA 5D8WA 2MANA 1FXQA 3B0UX 3IACA 2QJHA 3VOGA 1XL9A 2ISFA 4WXYA 1ALDA 2OSXA 1WKDA 1GHRA 2ZUNA 1GG0A 3G0XA 4JIRA 4Q6JA 4RUBA 4GO9A 4O0QA 3UETA 5K4XA 3EOEA 4KEZA 4I8YA 1SO3A 4RKAA 4H4SA 2XFFA 3NQ8A 2WPCA 1SSDA 3GKFA 1RJPA 4JKLA 5HMSA 3AMKA 1FWCC 4ZENA 3LNMA 1EO5A 4HT3A 4DF1A 1E1FA 4CN1A 3GU1A 4MPKA 5CZTA 2TPSA 2L5HA 2DT3A 4TTUA 1LQAA 4C60A 4JNYA 4BQ4A 5HUPA 2WNQA 1E0XA 3GVGA 2X42A 1ZP3A 4GKLA 3C2RA 4HCDA 4H83A 1HKMA 1VKFA 5IBXC 1TV4A 3TIMA 3NL3A 1NWSA 2CCRA 4GC3A 3SR6B 3WNOA 4Z1DA 2X8HA 2E25A 4DZ5A 1RPXA 3N14A 2RKXA 2YW4A 4MY8A 4FI4A 1T96A 4UR8A 3ARVA 1XDLA 4NUWA 2ZYFA 2FTYA 2XH7A 2QAEA 5AC8A 4C6FA 3IVUA 4JL1A 4MUPA 3DEQA 3TR9A 4YWSA 1LOSA 2OLAA 4MFEA 1W54A 1ZGDA 4KEVA 2YA2A 1MW2A 4UNIA 1WOBA 5AHEA 2I1OA 4O1FA 4AEOA 1NQKA 3QZEA 5FF4A 3SCWA 2V3DA 2X0SA 4ROQA 2WPGA 1RLCL 2ASHA 3HB9A 2RJHA 2I5QA 3QLLA 1CLKA 1WZKA 4HZ7A 2VRJA 1CWYA 3E0WA 1ISZA 2ISSA 1JPMA 3VD9A 1KM5A 1XR2A 1RBAA 3TN3A 3UPWA 2XTKA 5AC6A 4HU3A 3BW2A 3KHDA 5FJPA 3PTQA 4NILA 5AKQA 4ADTA 5DXXA 3SGZA 4XIAA 4NSBA 4FX9A 4DNAA 3N1AA 2HQAA 3IVTA 4U3CA 3WKZA 2C71A 4A8IA 2PD9A 4NEVA 1JULA 2AGTA 4LSBA 5HMEA 1Q6OA 2X09A 1SW7A 3GVQA 3UGVA 4UTIA 1P5BA 5IXEA 3PBMA 1GYMA 4WRHA 1DJZA 3MQTA 4L80A 3C0SA 2Z2AA 4LUSA 2XFYA 4CCEA 2OLSA 1UD4A 1XIMA 2H8ZA 5REQA 4Z2LA 2CLMA 1M6IA 1BAGA 5E0FA 1M6JA 3ZMRA 3F5KA 3EMCA 2ZRUA 4MDOA 3L5OA 1CXFA 3EWWA 4AXKA 5FESA 2QCDB 3B04A 3DECA 3C2EA 2R9ZA 1W5MA 2JF7A 1DHKA 3B0VC 4M52A 5KVIA 5GNZA 4O54A 4C7GA 4FMVA 1QATA 3ABSA 4TIMA 5FKYA 1T7LA 1TWIA 3LZ5A 1PIGA 1ZAHA 2ZE0A 3U9IA 1KKOA 4H9XA 1UWIA 1MXSA 2BY3A 3MWAA 4HNCA 4Y9NA 4XAZA 4JEJA 4PTNA 3EMZA 5JU6A 3H7RA 5LYRA 4O0ZA 5KTLA 3CHCA 2WSRA 3WDQA 3C2OA 3RLUA 3UR7A 1GOIA 2QUMA 3QV9A 3VUPA 1X7IA 4FNTA 2WMIA 1W91A 4S38A 3VZZA 2ZVRA 3PVFA 5IFTA 4IQLA 1VHCA 3PZUA 4NZ5A 4E2VA 3DFYA 2Q02A 4DAFA 2FMOA 1MO9A 4DJDD 2UZ9A 4LVAA 5CGQA 2ZZ1A 1DWHM 5JCLA 1V77A 3M07A 1NH6A 2DZVA 1J6PA 1Z89A 4NRSA 4O4VA 1ISYA 3ITYA 3WUFA 1VYPX 3THCA 4HNNA 1I4NA 3W1RA 5BXSA 1DXFA 2PB1A 1HJUA 1SO6A 5BWAA 4ZOCA 3GAYA 1F6KA 4L4MA 3T07A 4HD5A 4ROPA 2J8TA 3K4WA 4J27A 2ZUMA 5FOOA 1GYNA 3ZLGA 4XZBA 4HTYA 3OIXA 2E77A 3T4WA 1X6NA 1E6NA 1NQ6A 3W2UA 2E6DA 2O9PA 5CKSA 4F79A 1KWGA 3MPGA 3IJLA 3MV11 2IW0A 1E9ZB 5I3HA 2G8ZA 4Q8UA 5EA9A 4HA3A 1Q45A 1N62C 4QLLA 1X8CA 1SW0A 1QHZA 3TTYA 3QLDA 3THQA 2NQHA 4RK8A 1VEMA 3FHQA 1W8SA 4C6JA 1HJQA 1H0IA 3GNPA 1DVJA 3LPOA 2HROA 2VMFA 1K9EA 4O14A 5CZJA 1XBYA 5XIAA 3N6HA 1QBAA 3EOOA 3BAKA 1BD0A 1B3VA 1JDAA 4JY8A 3II1A 4UTLA 1GVSA 2UY5A 4QIUA 2IKIA 3UQNA 3MUZ1 1RP9A 2XN1A 3F5LA 2C13A 5A8QA 4CU7A 4JTTA 3SDOA 3PG6A 2FTPA 1K4GA 3CQHA 4Q4SA 1V7AA 1WZAA 2HE8A 4HCLA 1TTIA 3TZFA 5LA0A 2J62A 2PU1A 2R1LA 3WH5A 5ABEA 1H1NA 1W8GA 1QASA 3M16A 3NQMA 4U2YA 1E56A 3EXSA 2E7FA 5G1TA 2VD8A 4XUYA 5EMYA 3P0WA 4N4QA 3QHMA 3P8JA 2WNZA 5BOFA 3PM6A 3F2CA 4MJ2A 3LXCA 1HP5A 3GG1A 4LNYA 1GVIA 3IJ9A 3IIXA 1G4PA 2CETA 1A3XA 3FJNA 2XPKA 3YPIA 3AHVA 1EEPA 3KBJA 3IIOA 4LS0A 4LUTB 1B9ZA 1XBVA 2GWGA 4J2MA 1W9DM 1GKPA 1L2QA 4A3UA 1GJWA 1MUMA 2OWXA 2VRQA 4DELA 3V5FA 4PRTA 4PMQA 1H60A 1K03A 2VZTA 2YXOA 2R14A 2ZZ4A 1GERA 3VA8A 3M0KA 1LWHA 4EVZA 1ZDLA 3T2OA 1FTXA 3UG5A 2QDHA 1XLEA 3P62A 1XYBA 4RJEA 5AHNA 3FLUA 1ZJIA 4AYSA 3D9XA 4XO7A 1AW1A 4ZFMA 4L9XA 2D69A 2YL6A 2OWCA 3GZ3A 1JDDA 1XBXA 2PWGA 1Q7MA 4JIIX 4TV6A 3LBCA 5I79A 3VMNA 3VFLA 4KT2A 4ZB2A 3EX6A 4GINA 3LENA 1KFLA 1U5HA 4I8DA 4ML9A 4NRRA 2D3LA 8XIAA 4B5UA 1CYGA 1VQTA 4P7NA 1TWWA 1ZMDA 1EBDA 2OFJA 3VU2A 1Q6FA 1V3KA 3WLTA 3OU8A 3M5VA 3M0HA 1AZ2A 1Y0EA 4EAMA 5I3IA 2Y6ZA 1ZBVA 2QVNA 2WQDA 3THAA 4ML4A 1W37A 4OBRA 1O66A 2Z26A 3R8GA 4AX7A 3ID7A 5CPNA 1EZWA 1ADSA 1I1WA 4ZVJA 5FD0A 2BX7A 5LNRA 2VP8A 2TSYA 1PKLA 2RDWA 1YTDA 2EF9A 3NEVA 2E09A 2QUVA 3CXBA 1JIBA 2NV1A 3RO6A 2EG8A 1D2KA 1C7SA 2OYKA 1AQMA 1SFJA 1UH3A 3RCMA 1L9WA 3RFAA 5E1QA 1VCGA 2PWVA 4H1ZA 2V9DA 3SSJA 5D09A 1HNYA 4BQ5A 3OJGA 3ABOA 3V36A 5DMMA 1GQNA 3AALA 4O10A 4K36A 1H5YA 5I23A 1G67A 4KFOA 3CZJA 2CZDA 5CAHA 2ZICA 1XYAA 3EA2A 1BRLB 3T09A 4OECA 3EOUA 1B4KA 1QW7A 4W88A 3RN6A 3MY9A 3R89A 4MB1A 4F40A 3V18A 5AC5A 2F7FA 4LUYA 3KVJA 3H2EA 4B2DA 3O05A 1KTBA 3LBOA 1TPB1 3BH4A 3EB2A 3CMGA 1RY8A 1PCKA 4HZ6A 5FAJA 3TC7A 5EB8A 4ZQCA 3CLWA 3WLKX 1LM1A 4UCFA 3RX2A 4WKAA 1X39A 1S2WA 4N02A 3O1NA 3R8HA 4CCDA 1TWDA 3NOEA 1RK6A 1R8LA 2CYGA 4ZMGA 1DE5A 4MMWA 5JCKA 5U4NA 1IR2A 2WV8A 4NJJA 3S46A 3GM8A 3W7QA 2PCEA 1FWNA 4ZE5A 3FJLA 4LALA 2NQ9A 3CTLA 4CEXC 3ZT5A 3VDBA 2BXVA 3T81A 2ZQ0A 2WPEA 3QBUA 2WPBA 3HA1A 4WEVX 1FY6A 1MEIA 1HJWA 1EJVC 4NVTA 1RQHA 2KZHA 4WSHA 3GHSA 4ATWA 2QULA 4J56A 4YWIA 3VM5A 3UR5A 1DTUA 1TX2A 2XH4A 2D0GA 3POCA 1KBJA 4AH7A 3XISA 4PR4A 4M51A 4MLRA 3R5EA 1LBLA 3PG8A 5AVNA 3AUJA 4R7WA 1YADA 4FA3A 1MW3A 1RPKA 1Q7QA 2UWFA 3AS3A 5F7UA 4B92A 3WH9A 4XK2A 1XSIA 2GUBA 1XKJA 1TA3A 3QOKA 2PP3A 3CWOX 4JHMA 1MQPA 4O13A 1KBIA 5HPOA 2PDFA 3EB4A 3CHEA 1UWUA 2NT0A 1GEHA 3S5OA 3PY2A 4AWTA 2P88A 3AJ7A 1JAEA 3WF3A 3FY1A 3A3WA 4QSHA 4AY7A 3P14A 3LPGA 4H6QA 3EDEA 1T5AA 4GUFA 1PTDA 3NA8A 1XIFA 2IPWA 5HR7A 1M65A 1ZUAX 1TVPA 1QOPA 5FJRA 1NAL1 4KCWA 1TQXA 3TYCA 3M43A 2B7NA 4I5UA 4AZ5A 1TJ2A 2FZDA 4U33A 2HBXA 2D2JA 2CBIA 2QKFA 4WJ8A 4GUJA 1RV8A 1UD8A 1MYRA 4GKTA 4ZODA 5A8OA 4JQ4A 5A6SA 4H2HA 1X97A 3OGRA 2JALA 1QNQA 1JUKA 3IUDA 2GJXB 2QCCA 1VEPA 1M5WA 5BU9A 3PZIA 4EP8C 2VZVA 2GQWA 1JQVA 1A5BA 3N6QA 1JDFA 4E6MA 1XCXA 3PBVA 2C79A 1ZMCA 2E6AA 4NJIA 4LS2A 2HQMA 3G1VA 4IFKB 1EJ7L 4CEUC 3W1TA 1IIGA 3CIXA 3SGUA 4A21A 2O7QA 2QCHA 4GWEA 3KRUA 4O8AA 5C7HA 3MTWA 4Z42C 4POCA 3WLHA 3H2FA 2ZX6A 3F7JA 4A4AA 3C6CA 4HQVA 3DUGA 4TO8A 4WUIA 3BOFA 2P3EA 3EA3A 5C6MA 3WQGA 2GGEA 1FECA 4HA4A 3KBMA 2ZVIA 5CXPA 3WQ4A 4ORIA 2OTDA 3SUWA 3B40A 1FUYA 3FYYA 4XZIA 4Y6GA 3GWQA 2PDBA 4TMBA 4C91A 3FNDA 3A5VA 4QJ3B 4D6JA 3PJTA 4AX6A 5TBOA 1UPPA 4QG9A 2CBUA 1NELA 4X3ZA 4L1GA 1WYGA 4GYFA 3BMXA 4TOQA 4LY4A 3DFPA 4KWUA 2J66A 2CLKA 2CEQA 3NUKA 2DY3A 4Q3MA 2DH2A 3TJIA 1WKFA 1DYSA 2AQWA 2VGIA 2SFPA 5HXMA 2JIEA 3SW6A 3BWWA 3KVMA 1CXLA 2XH0A 2PTWA 3BAWA 3VDAA 4I6KA 3NZRA 1TYPA 4V33A 1F74A 4ZTXA 1TUXA 5F2GA 2DW7A 3BGGA 1LLWA 3I7QA 4H2CA 3PC0A 5C8BB 4OU1A 4CU6A 4KEUA 1E9IA 3DHUA 1GWJA 3VZXA 3E9AA 3HPFA 1E70M 3BJFA 5BMWA 2Y89A 2PS2A 3GDTA 4LY8A 2XZ9A 2FZ8A 4E4UA 2RABA 1EF2A 3TN6A 3W38A 4MWAD 3NZGA 1S39A 4K8GA 4KETA 4W84A 2F2HA 1W3NA 1PZ1A 3JW7A 4F0LA 2NWSA 4Z08A 2NXGA 4F66A 3K4DA 1RLDA 1WA3A 3N11A 4IOTA 1R3WA 2V30A 4WQ6A 3NRZB 4NAEB 3D6NA 3W75A 1GRFA 1E1CA 5I3FA 3WN6A 3GXPA 4B5WA 3CUZA 2HXTA 4H7VA 3QSTA 3FGCA 3P2VA 2Z28A 2A3CA 4MZ8A 3C5QA 3L4UA 1Q65A 3Q4DA 1R3YA 3CWNA 5D05A 4LUIA 3M44A 4HOXA 3IGHX 3SUUA 1LROA 3O6YX 4W5ZA 2J24A 4IH3A 1RVKA 1CW2A 2WZIA 3VIKA 3W74A 4AZ6A 1OYCA 1V59A 3R07C 3PFMA 2HK0A 3MKKA 4LV9A 3T2PA 3TU9A 4D2JA 3GD6A 1LVLA 4Q8MA 3P7YA 3WD2A 2OR2A 4JN8A 3TTQA 3LTSA 1EUNA 3I65A 3RJYA 1PIFA 3FIGA 3QPYA 2XWDA 3AMDA 3R7MA 4RPPA 3FV9A 5A5WA 4J7RA 2DSUA 3NEHA 4I3GA 4JNMA 1KR0A 1A5SA 4W7UA 1E6QM 4NJGA 3ITCA 4M24A 1BQCA 2JF6A 2ZRZA 2BVWA 3K5XA 3UJFA 3PUDA 2GVEA 1UMLA 4CD5A 3VX1A 3PPGA 4GNJA 3G1YA 1DBTA 4XBJA 4LBRA 3VVGA 3KVLA 4MWAE 4K68A 1EKOA 1XG4A 1NU5A 1IXPA 1KD0A 2V3FA 1XCFA 1N7KA 5B80A 1OF6A 3WLIA 4DNMA 3LQLA 4JXCA 3S6DA 4IHCA 1MDLA 3H2NA 3NQ6A 1UUQA 2GLKA 4P8XA 1FWGC 1YTKA 4B16A 2Y4SA 4FX8A 4QBXA 9RUBA 3ABQA 3E02A 4IP7A 2X8CA 1UMYA 1AFSA 2J79A 4K7YA 1TPEA 2J7BA 1Y7VA 1PBGA 1YRRA 3CUFA 4JFWA 4P61A 3KLJA 1PYMA 3T4CA 4R7OA 1CLVA 3WLLA 2EAWA 4WD0A 3TW9A 3NQ2A 4J3XA 2PF8A 3LTYA 3CQ0A 3VIPA 1FWRA 2WOQA 4IWWA 4I9TA 3MUCA 4IPLA 4DEFA 3OLEA 2YFOA 1F3PA 6XIMA 4FHAA 2YBVA 3USBA 4GRSA 5LNVA 1XIHA 2PSNA 3HO8A 5H91A 4LCSA 5E5CA 2BCPA 3RILA 3NDYA 4MJMA 4AW7A 3OQEA 2DZWA 2Y7GA 3QGAC 5FJOA 2IPJA 1W0MA 4CQ9A 3BLLA 2ZUUA 2Z1SA 3GFYA 7TIMA 4US5A 1JDEA 1X98A 3UXKA 3LDVA 4XIMA 1KO0A 3GY1A 3H55A 1PJ9A 5AYBA 1SZNA 3EF6A 3WBWA 4E4PA 4GY1A 3L0GA 2VOMA 4JTSA 1Q5MA 1VYRA 4GK8A 3BCDA 5CSUA 2A21A 4KW2A 4AD2A 4H4ZA 4QQ3A 1HJXA 4H4YA 1BGAA 2NV2A 1RQBA 3T0CA 1Y5VA 3BJTA 1EJRC 1ZNNA 2OGYA 2VCBA 4J3TA 1ZAJA 4KFNA 1E4LA 2BG5A 2R8WA 3TA9A 1QPRA 3MMWA 2G3IA 3HPSA 4RV3A 1QRQA 4TVDA 1DJGA 3E6EA 3S9YA 4DJEC 1ME8A 2CHNA 4JQ1A 3MSYA 4IFRA 3GAKA 3L66A 3WIJA 3BW3A 5DRIA 4F0MA 3WMSA 1T6MA 1E0UA 1PL9A 2Y5JA 3FVDA 3O0HA 3GE7A 2VHLA 1A5OC 1HVQA 4HPXA 3IRDA 4BJHA 1M7JA 4R9OA 5I7GA 4QAIA 3HQNA 3MBDA 5I3GA 4UZUA 4LGXA 5DBTA 5D37A 2X16A 2QJNA 3R6IA 3IIVA 2NSXA 1LOQA 7XIMA 3SBFA 2J6VA 2DUZA 1THFD 1ENUA 2E8YA 3GB6A 3BTNA 1DJHA 5AOUA 5DELA 3T0DA 3QMTA 1L6GA 1Z3NA 1N63C 4CD8A 1ADDA 5CPLA 1TIWA 2GWNA 4XAYA 1YPFA 4R34A 2DZXA 1W6TA 4C6IA 3M7SA 4R53A 3CMJA 3SCUA 3H4KA 4NQ1A 2WNWA 3I6RA 4DWSA 2FTWA 1Q6EA 2EJ1A 5K2ZA 4P5UA 1VFLA 3G24A 4Y8EA 2X41A 4EPBC 2G96A 3S5NA 4FZIA 4KPLA 5FIPA 1K6AA 3LCIA 1S2AA 2GUUA 2FPTA 2NQ5A 3G3MA 4R7JA 3OBEA 3DYOA 3CL6A 5E9XA 1PHQA 3W24A 4JTIA 4QX4A 1LL6A 1F4HA 3PB0A 4G1NA 4JTEA 4MLJA 1H1ZA 5DMYA 2V2HA 4ZO7A 3QPZA 1Q2SA 4S3GA 1CB2A 1SZGA 1JGMA 2WOIA 3BARA 4W7VA 1MEHA 3DKLA 4QFUA 5HANA 3RJXA 3HGJA 4BF9A 3GTHA 4Z2IA 2NVKX 3VXGA 4DO7A 4WSKA 3QMRA 1V3LA 1WUEA 1X6LA 5G4EA 3MU7A 5BOEA 2J27A 3WQDA 4Y9AA 1O95A 1QJWA 3GRTA 2QF8A 2BDQA 4ZSUA 4A3YA 1MW0A 2NUXA 3LCLA 4FIQA 3FA3A 4Y90A 1VPYA 4H01A 1X1OA 2XIJA 2WC3A 4DUVA 1DWAM 4LVDA 4DJFD 3CQJA 3EA1A 3EX2A 1F3EA 3LV5A 2VELA 3SSZA 2CZEA 2BHZA 2ZZ5A 3RK8A 3O9NA 1TELA 1OFDA 2OKTA 1O5RA 4L65A 4ZFCA 1LRNA 4HYRA 2CPUA 2VX4A 1W9XA 2RJGA 1DJIA 3IGXA 2V2CA 2DORA 4PMZA 3A24A 5H2ZA 2QCEA 1JZ8A 2NUYA 2X1IA 4YHGA 2J74A 4Y9PA 3LPPA 2A3HA 2PTYA 1V0NA 4KWVA 2YAUA 1PVNA 3LADA 2VVNA 3OODA 4AZHA 1TJ1A 4MPQA 3WELA 1FQ0A 2YIHA 2PAJA 4H4UA 4PUNA 3LRKA 4QSFA 5AFDA 3WX7A 4LYPA 4JTGA 3SCNA 2UBPC 5D32A 5EPDA 4AWEA 1GEUA 3WK0A 1EOKA 5I0DA 3U4FA 4XAGA 2PDCA 3CZ8A 1TE6A 2DUXA 3W9ZA 1H11A 4HP5A 5IFPA 5TIMA 1EP1A 4WY0A 1BG9A 5ABHA 3LD5A 1UKPA 2Y7DA 3W83A 1PHWA 4H4WA 2DW6A 4MTVA 3BLIA 4LYRA 3CUJA 1R46A 1YMYA 1DPMA 3NTYA 1FDZA 2GFTA 1QW8A 4L9YA 1AW5A 2Q71A 3QHNA 1RA5A 2OJPA 3K1GA 3E12A 3PUOA 1AUSL 4K6AA 1BWKA 5EMUA 3UESA 4YVPA 3V1PA 2BP1A 3JVAA 2DT2A 1HW6A 1WYIA 1JAKA 2INFA 1T8XA 4FNSA 3QW3A 2HISA 2R82A 1V0MA 3AI0A 1WO2A 2ZZ3A 1XLBA 3R1ZA 1FWAC 3NURA 8CGTA 5A6LA 1ISWA 3NPWA 2XVNA 3ZT6A 3CO8A 4XKMA 5BOOA 4KEMA 1UG6A 3HGSA 3SM0A 1W1B1 3AZSA 3M5XA 4QDMA 4DBEA 5KZEA 4PE8A 4X22A 2DV0A 4AIBA 2WCAA 4RZ4A 2W67A 3S1XA 5K9DA 3SIMA 3RM9A 1I9CB 1PIIA 4RW3A 1QDSA 1FWWA 3BOXA 3LEPA 5B7YA 5KSWA 1UR9A 1IQ8A 5FMHA 2W9MA 2WKJA 3HN3A 2E28A 2P10A 3SURA 1GZGA 2CZFA 2JEPA 1EOMA 2Z1BA 3W1PA 3MMTA 3WH7A 1SZRA 1W5QA 5EKYA 1G01A 3SUSA 3SCPA 3QYQA 3S5ZA 4AZCA 4GA8A 4US6A 2XZ7A 3WL1A 1F8IA 1CX9A 1CGUA 3APGA 5FEXA 3WLSA 3W7JA 4YU1A 2EG6A 3NO1A 5EBKA 1KQYA 1NHQA 2QS8A 1MNZA 3ELFA 8TIMA 3IC9A 1X1NA 5HMFA 3QFAA 4Q8PA 2O55A 3EDFA 2F8QA 5EYWA 1L0PA 1V6YA 4WX2A 3OOQA 3SZ8A 1WDRA 4GVGA 4HMDA 1HG3A 3PULA 4ZZ9A 4GI6A 2PU0A 4MB4A 1IF2A 1WE5A 4H50A 4YTUA 3N04A 3P81A 3DFSA 3J7HA 3C0QA 1Q6CA 3W70A 4B5VA 1XQLA 3RHGA 2YBTA 4NU7A 3KBNA 1VJIA 3I6TA 6REQB 4I5RA 1F8MA 1HZYA 1UR1A 1V02A 3PZQA 3VI2A 3ARPA 2YOCA 2RH9A 4ZEPA 1LWIA 4JCLA 2BBFA 2VZOA 4HYWA 2Z6IA 2CIPA 4BWLC 1TV2A 3OG3A 1AVAA 1HO1A 4TQTA 3GVWA 4H7CA 4S1FA 3MB9A 4IGHA 4DJDA 1Y8BA 4RZ6A 3TJXA 1D8WA 3UCDA 1GRAA 1OJTA 4S3DA 3VMOA 3KZPA 3EWZA 3OO2A 1F61A 3N9SA 1NPXA 1G4SA 4J9JA 1TWZA 1VYSX 2F5ZA 4M7TA 4V1XA 5HK4A 3V4BA 2PWFA 3GU2A 1UKTA 2WC4A 3PWAA 3V75A 2BXYA 4DYEA 1QI3A 3BSHA 2Z6JA 5HWJA 3OYZA 1WZMA 1UD5A 2CKSA 1IYXA 2QAFA 4OVXA 3W2JA 2YBUA 4IJBA 4U4MA 4D72A 3G22A 1JFHA 3GIQA 1ZY9A 5KVHA 1KLZA 3DGRA 3R43A 3MW7A 4H8VA 4DM1A 1ZFJA 1XUUA 3W2LA 4YTSA 1SUXA 4AY1A 5JUVA 3QXBA 2DQXA 3A7RA 1DIEA 4P8WA 2X50A 2PA6A 2GSEA 1AH4A 2VEFA 3LZ3A 3PPCA 2QMKA 1O5XA 1QBBA 4D8AA 1V6UA 3SUTA 4A29A 1ZXIC 2HVOA 3ZSTA 1LYXA 1POJA 1JR1A 2R1KA 3IJ8A 1KXVA 4PTMA 1HXJA 4AUBA 3N73A 3QY6A 2VCCA 1KFCA 4MDPA 4EXAA 3MI3A 3SUVA 1XGDA 2C0HA 1YW1A 5BROA 2HPIA 4CNPA 1G4TA 4M7SA 2VFIA 3HQOA 3RR1A 4W5UA 4AEEA 4AVNA 4PCPA 1XIGA 2DJXA 3WNLA 2GK1B 1BXBA 4K1GA 3MYPA 1UR3M 5T26A 3ZO9A 4YIWA 4QJ4B 2E9MA 3W2MA 3SB0A 4FS9A 4R9XA 4EXBA 3LB8A 3N34A 1IIHA 4O50A 1Z6KA 3U2OA 4OOZA 1W17A 3QRHA 2PTXA 4WK9A 4AU0A 1EIXA 3LOTA 3S2CA 1E55A 2W3ZA 4O4WA 3VNZA 5D8ZA 2EQ9A 3C8FA 3U4AA 2YCEA 1FWEC 4LXFA 2XM1A 5F2MA 3TSDA 4NZ3A 1E15A 1N61C 4RDWA 1IV8A 1I0BA 3AN1A 3PUEA 1SPQA 2WWCA 4GY0A 3CASA 1VCVA 1TCMA 4K37A 1EC7A 1I0DA 4JCMA 1FKXA 3B8SA 4ICNA 3R94A 4FOUA 3GG8A 4HTBA 5I2UA 4Z0JA 3TTEA 3K2GA 3TYEA 1C90A 3ZVHB 3UVAA 3W7KA 5IOBA 2DVTA 2PDMA 3LUTA 3NYZA 3PNZA 1C91A 3VNIA 2NUWA 1L6WA 3UZWA 4PUDA 4AVOA 1ZKQA 3W86A 4FXJA 4CU8A 1LBFA 4NX0A 4GGHA 5CC7A 2J9ZA 4XWUA 3V5OA 4W7WA 3M0ZA 2DVUA 4QGCA 1I2NA 3KP1A 1S5TA 2PZ0A 4NNBA 1GVEA 3M5YA 3VKJA 4DI8A 4LS1A 2CW6A 1NJJA 4FIRA 3M6YA 4LNCA 4FLOA 1EX1A 1XLKA 3DBNA 1RHCA 1W2VA 2BOGX 1DHPA 4X60A 3RRXA 1RSCA 4Q8OA 4HHHA 4ZOBA 3UG8A 1GQJA 4E3VA 1W1TA 1V4YA 4GVFA 3BCJA 2NVCA 1HGWA 1Q3NA 1ZJAA 3LTPA 3VNJA 1R86A 1XC6A 3TONA 1CXKA 4E8CA 2X05A 1EF3A 3HGOA 1R3RA 3BDKA 1BYCA 3B9AA 4D6EA 3R79A 2C8NA 3TDFA 3VOIA 3P5YA 2ZADA 2ZZ0A 3S2MA 1N8IA 3HM7A 5HINA 1DJXA 3FKRA 3GD3A 3IVSA 3URBA 4XUGA 2CLHA 3WD0A 2Z25A 1VR6A 2C0AA 4M5PA 4WOQA 3T55A 1J2WA 5HQMA 1KFKA 1AOGA 1NHSA 1Q4WA 1F6PA 2CBJA 3DH9A 4GYJA 3G1AA 3H8AA 1O12A 3VILA 5CPSA 2F2KA 2ZDRA 1CGXA 4OBSA 1R85A 2VEPA 4MHBA 3CBWA 4O1DA 1P6WA 4CQDA 4RXFA 3CPUA 2Z00A 3KOXA 3IRSA 3O6AA 5EL1A 1SMAA 5IDZA 4JIPA 3LHVA 1QNPA 3NVDA 3L12A 5CZSA 3BK0A 1JCXA 1TV7A 4IQDA 3VDGA 2GQAA 2DT1A 2F84A 2G37A 1SZEA 4G5DA 2PDGA 4K8DA 2OT0A 4C6CA 3CUHA 1JPKA 1WQ5A 4F2BA 3WDIA 1XDMA 4YVVA 1GCYA 2XIQA 1EZ2A 4EPDC 1FEAA 1KXTA 1M7PA 3P61A 2C6QA 1TA3B 3DHPA 1X7FA 1IHIA 2VGBA 3W0KA 4M3PA 3B05A 2OEMA 1AD1A 3TYDA 1B90A 1H2JA 3W7RA 5FF0A 4F9JA 5U7SA 2RUSA 2CZVA 3RNMA 2ZC8A 2J8FA 2YLAA 3NOYA 3KX6A 3N2MA 1P1XA 1J0ZA 3QW4B 4PTWA 4HSNA 3BAYA 5D9PA 5A2AA 5JCMA 1Q6QA 3GC5A 2IKJA 3R0UA 3KS5A 3PSWA 4F48A 1TO3A 3CGTA 3CUIA 5JVLA 4NNAA 3WF0A 4GACA 3N12A 1JOAA 1VBRA 9XIMA 1OT2A 2WLZA 1H62A 2G50A 1AW2A 1XRVA 1R3TA 4QHRA 3OW1A 4MNLA 3H2AA 3FHAA 1P7TB 2XISA 4HJFA 2A7PA 1B0IA 4IG2A 3TLQA 3B06A 4FXSA 3RNDA 3AMZA 1JYVA 1EQPA 3L9CA 3GRIA 2PGWA 1EDQA 3N18A 3S6OA 1RCOB 2PE4A 2W4XA 3AOFA 3CS2A 2C3DA 4O18A 5BRQA 5H8MA 1H63A 3TEVA 4KRZA 4A3HA 2YX0A 1KCKA 4LAKA 3DGZA 3I68A 3PFRA 1H7OA 1E4NA 3Q37A 1E6PA 4O15A 3APYA 2V6OA 4JTUA 4K2SA 2WMFA 3T78A 1IEWA 1FHVA 4NF7A 4H6KA 3DJJA 4PODA 2WVSA 3ZVIA 1BKSA 1XSJA 3WMBA 1FDJA 3ITVA 4Q7NA 4UTWC 3WG6A 3ETRB 3V1HA 1MFUA 4DXVA 7PTDA 3TNBA 5T91A 4UNKA 1GOXA 4B4HA 1FCBA 4JKKA 1PE1A 3DZ1A 3CU2A 4UTTA 3CZGA 1ZCOA 2G3MA 4MADA 4RX0A 2BNJA 1XCWA 3LSBA 4AZBA 1JI1A 2YZRA 5BWFA 4HHLA 3GXDA 4H4TA 1Q1RA 2V5CA 3KXQA 4KCUA 4P7RA 1JD7A 1EEXA 3V0TA 3I3BA 1AQFA 4HCHA 4G1KA 4X61A 1TREA 2BSLA 2WC7A 3LM3A 2ZUSA 3GR8A 2ANUA 2GSHA 1A0CA 3GNRA 3PHAA 4LANA 4TX9A 4NAFA 5D9OA 3UNTA 5HWMA 4FOKA 4L4LA 2INEA 1C9DA 3S1VA 3VGBA 3LG3A 2VEIA 1FWSA 1TMLA 3GDKA 3GHUA 1MVYA 1L8PA 2QNEA 1BTCA 4UQEA 4AISA 1FWJC 3NYDA 4QS5A 5AYYA 3VDCA 2V68A 4XZWA 5AHFA 1WKYA 2XUCA 4V27A 1V0KA 3L65A 5JMUA 4AHPA 1NSJA 3WNPA 3NO3A 2EHHA 4PUEA 3P0XA 1E1CB 2YGYA 4PB4A 3QGKC 2AOSA 3NIYA 2AAAA 3STPA 1GPWA 4TMCA 3SJNA 4JL2A 1ITQA 3EYPA 3PN8A 1P43A 4WKFA 4UNLA 3GC4A 2OYMA 3MI2A 2XIBA 4C1NA 4XG1A 1EP3A 2BWGA 4QEEA 5DXYA 3C4UA 1ZRQA 2FJKA 3LI1A 4E5TA 3U2ZA 4XZNX 1K9FA 2WCGA 2AMGA 3Q65A 1K4QA 2FIQA 3B4UA 4PMOA 3OPSA 3DFHA 1JI2A 3WBYA 1DV7A 3DG3A 2VT0A 5L6UA 3W81A 2YCJA 4B5XA 3ZR6A 3M4HA 4OWGA 2GUYA 3ALFA 1FBAA 3OP2A 3BAJA 1V03A 1NFGA 2XIMA 3C86A 3UWEA 1VGAA 1K1DA 1N8FA 4PMXA 1Z32X 3ARYA 3O06A 4UQBA 2CNCA 3E2QA 1UBSA 4RXGA 3IJ6A 4S2CA 1HKKA 1EWEA 3VCCA 3LCWA 3TN4A 1ZBKA 2ZA3A 4DO6A 3O7UA 2VDIA 3H53A 1DJNA 1JNDA 2WJEA 2VR5A 2PBGA 1BPLB 4NIRA 9XIAA 1XYMA 1GZJA 1XLFA 2OQYA 3LV6A 2J3NA 2ISDA 1Z44A 3ATZA 3W1AA 2YJQA 1YHTA 1NHRA 1M03A 3GXTA 4GI9A 2AKZA 2GDQA 2HVMA 4HK5A 3CEUA 3IEBA 1B3YA 1DWFM 1MSSA 4AB4A 5A94A 1XSKA 1RCXB 1UC5A 4GXPA 3ZJ8A 3UWQA 1B3WA 3L4YA 1BWCA 4INFA 3AWNA 1JRCA 1X2GA 3VNMA 2WSQA 2ZXBA 4KH2A 3BZJA 5A6JA 3OEXA 4ZCWA 5HR6A 1A5LC 4FNPA 4XZ9A 1YBQA 1H6VA 1QNSA 3QH2A 2AL1A 4K8HA 2JQXA 4H41A 1L6SA 1TR1A 4DUWA 2XN2A 3NQEA 3WQCA 4PBEA 3KL3A 1SB3B 1MMFA 2YVGA 3GRSA 3I6EA 1XYCA 4I7UA 3AS1A 2PTZA 5EBUA 3O8AA 2J7CA 3F4WA 2J75A 2W66A 4ONVA 3URAA 3QYSA 1F73A 4UFKA 3ZXWA 1UOZA 1XHGA 2PBOA 3QV6A 2ZZ6A 1PSCA 1UR2A 1R3SA 3GNDA 1OX4B 5BXRA 2EBNA 4H6EA 4C90A 4NJHA 1XKYA 4L4PA 4P7QA 4D1IA 2MUCA 4GUIA 3NM1A 3WUBA 4NASA 1SJAA 2DSZA 3QY8A 3HQ1A 4ZB0A 4XZMX 4RDYA 4ZTYA 5FJIA 1MRQA 1PWLA 3W88A 3PF3A 3LN3A 4V15A 5A6BD 3BANA 5D4YA 1XX1A 4O19A 3BUVA 4LFYA 4GQ0A 4UFIA 1ZLPA 4FF7A 4UUIA 1OFRA 4BS0A 4ACZB 2YW3A 4S3KA 4YXGA 1F76A 3BO9A 3EWYA 1W9UA 3ARQA 1QUMA 4EM4A 3WUEA 5EBAA 4U28A 4LH8A 3REQB 5LHEA 1M7OA 1SMDA 3MCOA 4PB5A 4EQXA 4Q7BA 5H6HA 2TAAA 4JTRA 3VOCA 5LXXA 4HYVA 2EEXA 1H1YA 4Q4KA 1JCJA 3GVRA 3II4A 3BQ5A 3QEZA 1LOLA 3F4NA 3W2NA 1ONWA 3Q2DA 2REQB 1OK4A 3ZIZA 2TMDA 1US2A 1Q7ZA 3T1GA 1TWSA 4GNKB 1HL2A 3JZUA 3IK2A 1S2UA 2DVXA 4ACYA 3C61A 3SEPA 3QQWA 1UCWA 4IPNB 5FAGA 3VOHA 3V16A 3W1NA 1JCMP 1CGWA 2PUZA 3G1HA 4MKNA 1OADA 4P7OA 2PGFA 4QNWA 3KOFA 5EFDA 1AJ2A 2X0HA 4OBTA 3LY0A 1L6FA 2Q01A 2QCLA 3KS6A 3GFZA 2WK2A 2A1YA 2P5NA 2E40A 3AXHA 2TRSA 2GR1A 2Z7GA 4NNCA 2DGAA 3L68A 3N2TA 1WOAA 1A47A 1QPKA 2H9AB 1ZSXA 4DF2A 1ZB5A 3WF2A 3OZOA 2E3ZA 4ALDA 4XO6A 3W3OA 1NM9A 1EJTC 4GX8A 4FP1A 1HFBA 3VNLA 4HIBA 1HT6A 1RJRA 4O16A 1W1IE 4HNTA 2Y7EA 3EGJA 3T9PA 1KM6A 3KL0A 3NVWB 4A6GA 1VFSA 3GYCA 2QPSA 3VFCA 1LG1A 1QNRA 4M80A 5FS9A 3VIHA 1GESA 3UY8A 4IF2A 3OIHA 4NX5A 1NEYA 2GGHA 1B5TA 4NZ1A 2GQ3A 3RCYA 3WMLA 3RO8A 1CI1A 4D6FA 4GVHA 3UVIA 1G7UA 3ARZA 3K1DA 3M0MA 3N15A 3H12A 2X8RA 3MHFA 2Z4GA 3C2VA 3ITOA 4KCVA 3CTTA 3S47A 1XLLA 2YL9A 1A50A 2BHUA 3FA5A 1CTNA 4HPJA 2E1WA 3GVVA 3LRLA 3WDHA 1S38A 3NL6A 3BV7A 3PWIA 3WQ8A 3COTA 2I16A 3UWWA 1BEUA 2VD9A 4MG4A 1K7XA 4CVWA 3W87A 4ERGA 5BXTA 2KX9A 5I3DA 1KFWA 2QCDA 4DBDA 4WHBA 5FF7A 1EHNA 5CEWA 1EPVA 3EDJA 1WDQA 1ZHAA 1AL8A 3FSUA 2E9BA 1PYFA 5DX7A 3WF4A 1WUFA 1SFLA 2ZX8A 3P3BA 4CNUA 2ZX7A 4BA0A 2O4MA 4W8LA 4DJFA 2DSWA 2F9RA 2VTFA 4UFJA 1W1PA 1ML1A 4GLEA 1KV8A 4LAOA 3A12A 1R9YA 2WXDM 2QPUA 1B3OA 2YDQA 1OC7A 1QR7A 4LVBA 2PDIA 1BWLA 4GGBA 1JPDX 4MZ1A 2MNRA 3W7PA 4JX4A 3U7VA 4HA1A 2X2YA 3P8IA 5HMDA 2OLHA 4QS6A 4JPGA 3CQKA 4UQCA 5DT7A 1GQIA 4J3VA 1IGWA 1TX0A 4GMEA 4JOMA 1BQGA 1GVYA 1TZZA 4C6MA 4FNUA 4Q4QA 2P3ZA 3LS9A 2DZBA 3O63A 5JH2A 5CJ5A 3UYIA 3PBYA 4UOQA 3HMCA 3M9YA 4BI7A 3KOYA 4OV9A 3LHTA 1NDYA 4QP0A 1G0CA 2D2GA 2INZA 1OIMA 3AXMA 2YA0A 4OUEA 5LNSA 1VLWA 4R27A 4EQWA 5LGXA 2RGLA 1XBZA 4HN4A 4XTDA 4N6FA 2TYSA 1MW1A 3NZQA 3RU8X 1PX3A 2G3FA 3LCFA 3CPRA 2OZ3A 4WR3A 1R7AA 4E2BA 1QAPA 2QJIA 1DTNA 4GCAA 4OV4A 2WMKA 4BF5A 1MOKA 5DLCA 3PWGA 2ADAA 4KIRA 4H9MA 4MSSA 4IIBA 3TCEA 3ZR5A 1KLYA 2YCLB 3GR7A 2W5FA 4B9YA 2AMXA 2PLKA 2AKMA 3WO8A 1JXJA 1NF0A 4OE7A 4AD5A 3KM8A 3H2OA 3MANA 3SADA 1HL9A 2V5LA 3GTXA 4WKHA 1WDWA 2HBVA 3L7RA 1UH2A 2W0HA 2Z7KA 1GOOA 1TIMA 5DBUA 2XIIA 3S8HA 1S5VA 5DMLA 1TPH1 2QGHA 3WEMA 2WOWA 4UFLA 1QHOA 3W25A 2RDUA 4ERAA 1CBGA 3IJIA 4F0HA 3KCLA 3BOLA 2ZIDA 3BC9A 2E6YA 1VBHA 2FPYA 2XM2A 4Z0SA 2ICSA 3U2EA 2JFEX 1PX4A 2FVMA 1P0KA 2ZA2A 4JN6A 2XYLA 3S9IA 3RIKA 4LT9A 2ZWYA 4A2RA 3TQ0A 3MMDA 1A80A 3AZTA 2Z1KA 3AU2A 1H50A 4FSAA 3TK7A 3RG6A 1A5UA 2CWXA 3Q45A 3LGDA 4E3TA 4UFMA 1ZK7A 3HG3A 1XPGA 2W54A 2WHLA 2OEJA 4HHPA 1YX1A 5LIKX 2GSJA 1KN0A 2A79A 1VRXA 3TV8A 5JIWA 1J96A 3M7WA 2PP1A 3LK6A 3GH4A 2Y85A 3WSUA 4DXXA 3KE0A 1NHPA 3WJYA 1F3WA 2CERA 3UCQA 3E96A 2BMBA 1UQYA 4DYKA 3CM4A 4LQ1A 3F4DA 5E0KA 2J6XA 1YIXA 1Q13A 1GRTA 3QOMA 2H6RA 2X2GA 4H19A 1PWMA 2DDXA 3WJZA 4IL2A 2C3CA 5EY5A 3CO4A 4FALA 8RUCA 4B3LA 2ZTKA 1CXEA 1LUCB 3A3XA 2DEPA 1XGZA 5D38A 1XH1A 4QJ1A 1RH9A 1J0KA 3L8KA 4IMCA 1F4AA 1DKWA 4EF8A 4KCTA 1MEWA 5AB3A 1AZ1A 3TAKA 3O6CA 3CGEA 1D3GA 4WDUA 3NS1B 3DFNA 1XLDA 3JRKA 4WIWA 2PDLA 4OT7A 2H90A 4QEHA 2OODA 4GYPA 1STZA 1A53A 1M01A 1QWKA 1MZRA 1PUDA 2XINA 4W93A 2F61A 5DT5A 3WQ5A 1KWKA 4H7ZA 3VNDA 4AZGA 4E38A 3CXOA 1Q85A 2X99A 1SQ7A 1ZP4A 4BK9A 2NQZA 2EPNA 3NAVA 1KFEA 3ZWTA 4LV4A 3DDMA 3MSGA 1LL7A 2PLJA 4JX5A 1Q1WA 4CVUA 1W1ZA 3QTGA 2PP0A 3U6WA 4L1XA 1WV2A 3L4VA 2CZ5A 3O6DA 1HF6A 2DU2A 3DHDA 4O1EA 3EUB3 3P5ZA 5HNNA 2B7OA 2XGIA 3BSMA 3EZ4A 3G6LA 5HBFA 1YPIA 4GQQA 1NDAA 4ICMA 1NWUA 2QMJA 2OMAA 4JQAA 3FXGA 4UTJA 5C9RA 3EWDA 1DIOA 3A13A 4AMAA 3G77A 1EBGA 1U1HA 2KAUC 4H8NA 4NG3A 2XH2A 3G3DA 3L23A 2W3RA 3CL7A 1U83A 2CLEA 1TCDA 4REQA 2HNEA 3VX0A 3QTPA 2W27A 1O7AA 3IJ7A 4IL0A 1EWDA 3K46A 6ENLA 1AG1O 1NWTA 2YQUA 2WWDA 4HOZA 2BS9A 4I5XA 1S3HA 2NV9A 5RUBA 2DJLA 2JGQA 3SCTA 3VMPA 2OWWA 2CFFA 3AROA 2H3BA 2Y24A 1OF8A 3U7BA 2HS8A 3BSGA 3MUXA 2O9TA 3SAZA 3N4AA 1BRLA 5LA2A 3NQDA 3O07A 2NVDA 5AN7A 3I7SA 2XSAA 3TP4A 1TUFA 1ZBCA 3KBVA 5MHBA 2YR1A 2HSAA 4LIIA 4RL3A 2A6LA 1HL8A 3MZ2A 3ZLHA 5C2GA 3I4KA 4FO4A 3NQBA 4EXQA 5FL0A 4D71A 2IXVA 4CLMA 3JZEA 1V02E 2FH6A 1EPXA 1B3XA 3W2KA 1K7EA 1OGSA 2FKPA 4Z1YA 2ZZCA 5M5DA 2GGGA 5CBIA 4W9TA 3UJSA 1XD1A 4EANA 5J04A 1C92A 2VDHA 2D20A 4M81A 1V3HA 3WFZA 3W6LA 1BXNA 2QDEA 1R9XA 1BF2A 1TPWA 4EAYA 5TQLA 4ILSA 4Z1CA 1AQ0A 3NWRA 1UJQA 3PAOA 2CLIA 2YCKX 3SCQA 1YNPA 3T8QA 1JEHA 4YTTA 3JU2A 4Q8QA 1J93A 2JK6A 1UBPC 3MI6A 4DPQA 3FCPA 5FEWA 2X8GA 1YYAA 3EEZA 3TROA 2RDTA 3NPVA 4P8UA 3ITXA 4DZAA 2Q09A 4LBUA 4NZCA 5E9AA 1B2YA 4DRSA 2ZDSA 3M64A 1FP8A 1UZ1A 3U57A 1AQHA 1W31A 3FAWA 4LCRA 2GR2A 3FXYA 3LCHA 1W3IA 3UCCA 2PWUA 1N55A 2BLEA 4NT0A 1KM2A 3DG7A 1T41A 1ITUA 3KWSA 2YFNA 4LOCA 4RPQA 5ENLA 3W1QA 4UIOA 4Q8VA 4DO5A 1HO4A 1MZHA 2FFCA 4UQDA 2WJZA 4I7WA 1H4PA 3HURA 1DQWA 4PYSA 1LG2A 1GVQA 3CT2A 3WK2A 3PTDA 1WXYA 1KC7A 1JFXA 1O4UA 2J47A 4Q6XA 3RPTA 2X1RA 5CZKA 1F3TA 4RE0A 1XM3A 5LA1A