5JRBA

Rad52(1-212) k102a/k133a/e202a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEAARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD52 homolog
publication title Structure of the human DNA-repair protein RAD52 containing surface mutations
doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 51
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jrbA01
1H2IA 5JRBA 1KN0A
chains in the Genus database with same CATH superfamily
3R1ZA 3IJIA 1XPYA 4DX3A 2PPGA 3THUA 1ELSA 1GETA 2EQ6A 4K1WA 3DG7A 4GGHA 1ZKQA 3H7VA 5GRTA 4FI4A 5JCMA 1K4QA 3NO1A 4HNCA 2PSNA 3LXDA 3MKCA 3GD6A 3DK9A 4A35A 4KPLA 4HNLA 4JQ9A 3TWAA 2WPFA 3JVAA 3MUCA 1R0MA 3RRAA 4EQSA 1FFVC 1GREA 1FHUA 3DJJA 3D46A 2AL1A 4EM4A 2OX4A 3MSYA 3CB3A 3VC6A 2PODA 2FYMA 3N6JA 3SR6B 4J56A 2PA6A 4K8DA 2OVLA 2OKTA 1R6WA 3FV9A 3N4EA 2J3NA 2X99A 3V5FA 2XH7A 3GY1A 1GV4A 3MZNA 3H4KA 2WPCA 3CGCA 3AN1A 2P88A 4H83A 1MDRA 3DJGX 1RM6B 3SQPA 4H4UA 3H8AA 1AOGA 3PK7A 4H4PA 1OEPA 1BZLA 4JN7A 4IL2A 1FEAA 1NHSA 4GISA 1X2GA 3IJLA 3U9IA 3CGDA 1N62C 3LB8A 4IZGA 3V4BA 4ENLA 3DG3A 4HCLA 5FS9A 1PDZA 1SJBA 5FJUA 1DNCA 3TJIA 2CFYA 1JROA 2W3SA 4EMJA 1F3PA 1H2IA 2RDXA 3CK5A 3HRDC 4K7ZA 4GYPC 4JN8A 4NEVA 3UCDA 3DGBA 4LIIA 2QVHA 4YWSA 4EM3A 4K8GA 1GRTA 3LADA 3VDGA 2OQHA 2DW7A 2P8CA 3L8KA 3NVYB 4APNA 3DDMA 2QDDA 3BOXA 3N4FA 1TYPA 1MUCA 3R0UA 1KKRA 2O56A 2TPRA 2AL2A 1NHQA 2V6OA 2HXUA 3MY9A 1ONEA 2AL2B 2GL5A 1JEHA 3K1GA 4FX9A 3DIPA 1TZZA 2CHRA 3CGEA 4KWSA 3UXLA 3R25A 1GRGA 1JRPA 1OJTA 3NRZB 2XSXA 1STZA 2AAQA 2OQYA 1W6TA 3V5CA 3CGBA 4TVYA 2XH4A 3ES7A 2C3CA 2NQLA 1XS2A 4KT2A 3A7AA 2HNEA 1EBDA 4E4UA 4FP1A 1SB3B 4IT1A 5G5HB 1GRHA 3UJSA 1F8WA 2ZZCA 3ZVHA 3JZUA 3ZVHB 3OC4A 1VDVA 1F9CA 1JDFA 1XHCA 3EAOA 2W54A 1WYGA 3D47A 5FS6A 3ENLA 3N6HA 3UCCA 4MKSA 1GESA 5EU9A 3II4A 3JW7A 3GD3A 2WP6A 3EKGA 4M52A 2GH5A 3A7UA 1IYXA 2OO6A 3OPSA 1BWCA 2GSHA 2GGJA 5JCIA 1E9IA 1LPFA 2W3RA 1PDYA 2HXTA 2QJJA 1FEBA 1DXLA 1M6IA 2P8BA 3AMZA 2POZA 5BOFA 3SJNA 1BQGA 1Q1WA 3EF6A 3SN4A 3FVDA 3KUMA 4E6MA 3Q45A 1ECQA 2PS2A 1ZMDA 2OZTA 1FFUC 4J3ZA 3U4FA 3DEQA 1TE6A 5IDZA 4GR1A 3RGTA 4GRTA 3CT2A 4MGGA 1T3QC 2R9ZA 5ER0A 1N5XA 2QDEA 2OFJA 1NU5A 2CDUA 3DGZA 2P3ZA 3RITA 2YVJA 3RR1A 5J04A 2OLAA 3DK8A 4IL0A 4HCDA 3RO6A 3UGVA 2FKPA 3UXKA 3P0WA 5JCKA 1NELA 2C3DA 4YWOA 3NFUA 3B97A 4FDCB 3SN1A 3VA8A 3UJ2A 3NS1B 3SSZA 3SBFA 1KCZA 4EQRA 3VFCA 2PP0A 2QGYA 2E5AA 3NZGA 3EEZA 4NEWA 2AKMA 2AKZA 3T9PA 4GIRA 4H4SA 4F4RA 2WOVA 1N63C 3PFRA 3STPA 3DG6A 4H1ZA 4ROPA 1JPMA 4H4VA 1EC8A 3MWCA 4MMWA 3TTEA 3S47A 1RVKA 3QFAA 1JOAA 3TQPA 1LVLA 2PTZA 3H70A 7ENLA 1FO4A 3ZLFA 1EBHA 4HCHA 2X50A 3QLDA 4KPRA 2PGWA 3NXLA 3QKEA 3AM9A 4EQXA 2XH0A 3FJ4A 2QAEA 2WP5A 3HW2A 1DTNA 4DNAA 1FECA 2WOIA 3MQTA 2X8HA 1YQZA 1EC7A 3TJ4A 3V3WA 1MRAA 5FJOA 4M6UA 3B9JB 2PMQA 1GEUA 1ZMCA 4DXKA 3ZVIA 3FG2P 4A6GA 1MOKA 4H4TA 4DYEA 2V3AA 4ADWA 1JPDX 3D9XA 5JRBA 1NHPA 2X8CA 2V3BA 3VCCA 3FXGA 1P48A 3I6EA 3BJSA 5G5GB 1ONFA 4H4QA 1H6VA 3UJFA 1FIQB 2ZZ0A 1KN0A 3BSMA 3RNMA 1XANA 3T6CA 5U25A 5FJTA 3CYJA 3P93A 2X8GA 3DK4A 3IJQA 4BURA 1SJAA 3OZYA 4J1OA 4TVWA 3A7RA 6ENLA 4E5TA 4GFIA 2PU1A 5FMHA 3S5SA 3DERA 3CXOA 5FJPA 3OTRA 2QJNA 3QPEA 2BC1A 1ZXIC 1SJCA 3ES8A 2W0HA 4LA1A 3Q6JA 1S7MA 3I4KA 4K2SA 2OG9A 3R0KA 2GRTA 2GQWA 3EANA 3ETRB 4DN1A 3Q4DA 3R07C 1ZK7A 1TKKA 2EQ7A 5FS8A 2YVFA 4JDRA 2ZC8A 2XH2A 1GXFA 2WPEA 3QTPA 1N61C 2MUCA 4J57A 5FJRA 3NVWB 1Q1RA 3OZMA 1MDLA 1GRBA 4EMWA 4M0XA 2HZGA 4DWDA 3FYYA 5KVIA 4H4WA 3O0HA 3DESA 2PGEA 1WUFA 4Z1YA 3GO2A 2PTXA 3CXBA 2PCEA 3ZLHA 1D7YA 1MNSA 5JCLA 1NPXA 3DFYA 2GGEA 2YQUA 2GGIA 4H4YA 3TWBA 2GR3A 3IC9A 1P43A 1NHRA 2EQ9A 3IK4A 4GYPA 4G8TA 5TR3A 2GR1A 4H2HA 5JCNA 3URHA 2PTYA 2ONEA 5BOEA 1BKHA 5ENLA 4EMIA 1N5WC 4DHGA 2WBAA 1GRFA 3QN3A 1V59A 3SQSA 3T4WA 2QQ6A 3H12A 2GGHA 4BV6A 3FCPA 4ZA0A 1GERA 3TOYA 2PU0A 3QFBA 2BC0A 3OW1A 4KEMA 3I6TA 1SJDA 2OZ8A 2JK6A 5FS7A 3VC5A 2BCPA 2HQMA 3RCYA 2A8XA 2YAUA 3GD4A 2NVKX 1N60C 3VCNA 1WUEA 1XDIA 3TCSA 3GC2A 4IP5A 2RABA 2GR0A 3GRTA 2EQ8A 3OP2A 2MNRA 1V97A 3NVVB 2DW6A 3DFHA 3GRSA 3P3BA 4H4RA 1VQZA 1TYTA 4Z17A 4HPNA 3DH9A 4HYRA 2ZZBA 2WOWA 3UJRA 2GGGA 4JHMA 2W55A 3DGHA 4H4ZA 2ZADA 4EQWA 2GR2A 4E4FA 5U1OA 4H19A 3R11A 2YVGA 2E3TA 2XGZA 1YEYA 2I5QA 4H4XA 1GRAA 4HN8A 2OZ3A 3PG6A 2PP3A 4E8GA 4A3RA 2F5ZA 4H50A 4EWJA 3EUB3 2QJMA 3CAWA 2P0IA 1ZX9A 3L5OA 2OPJA 3ZLGA 2PTWA 1EBGA 2NPXA 4GMEA 3PWIA 3SN0A 3HPFA 3PWGA 3NVZB 4X2PA 2GDQA 3R10A 2PP1A 5KVHA 1FHVA 1KKOA 3KLJA 4ZOHB 1ZDLA 5EBKA 1ZY8A 1X2HA 4ZCWA 4GGBA 3UJEA 1KD0A 3T8QA 1GSNA 4IP4A 1NDAA 1MO9A 3TW9A 4IHCA 1EC9A 4G7FA 1JCTA 1L8PA
chains in the Genus database with same CATH topology
1NHRA 2EQ9A 3QFAA 1JOAA 1GETA 1EBDA 1LVLA 2EQ6A 5TR3A 2GR1A 1ZKQA 5JCNA 1GRHA 5GRTA 4KPRA 2X50A 1F8WA 1K4QA 2ZZCA 3URHA 5JCMA 3LXDA 3DK9A 4EQXA 4EMIA 2WBAA 1GRFA 3OC4A 4JQ9A 1V59A 2QAEA 2WP5A 4BV6A 1XHCA 3EAOA 4DNAA 2WPFA 1FECA 2WOIA 1GERA 2X8HA 5FS6A 3QFBA 4EQSA 1YQZA 1GREA 2BC0A 3DJJA 4EM4A 5FS7A 2JK6A 1GESA 1GEUA 1ZMCA 2BCPA 3II4A 4M52A 3GD3A 2WP6A 2GH5A 3FG2P 1MOKA 4H4TA 2HQMA 4J56A 2A8XA 4K8DA 2YAUA 3GD4A 2V3AA 2NVKX 4ADWA 3D9XA 5JRBA 1BWCA 1NHPA 1XDIA 2X8CA 2V3BA 5JCIA 2RABA 2J3NA 2X99A 1ONFA 1LPFA 2GR0A 3GRTA 4H4QA 1H6VA 1FEBA 1DXLA 1GV4A 2ZZ0A 1KN0A 3RNMA 1XANA 2EQ8A 1M6IA 2WPCA 3CGCA 3H4KA 5U25A 2X8GA 3DJGX 3DK4A 3SQPA 4H4UA 3GRSA 4H4RA 4BURA 1AOGA 1Q1WA 3EF6A 1TYTA 4H4PA 1BZLA 3DH9A 1NHSA 1FEAA 1ZMDA 2WOWA 2ZZBA 5FMHA 3CGDA 3LB8A 4GR1A 3DGHA 4H4ZA 4GRTA 5FS9A 4EQWA 2BC1A 2GR2A 1DNCA 2R9ZA 2CFYA 4EMJA 5U1OA 1F3PA 5ER0A 2YVGA 2W0HA 4LA1A 3Q6JA 1H2IA 1S7MA 2CDUA 4H4XA 3DGZA 1GRAA 2YVJA 2GRTA 3PG6A 2GQWA 3EANA 4K7ZA 4NEVA 4LIIA 3DK8A 2F5ZA 4H50A 4EM3A 1ZK7A 1GRTA 2EQ7A 3LADA 5FS8A 5JCKA 3L8KA 2C3DA 2YVFA 4JDRA 4APNA 3L5OA 1ZX9A 1GXFA 2WPEA 4YWOA 1TYPA 2NPXA 4FDCB 4J57A 1Q1RA 1GRBA 4EMWA 2TPRA 1NHQA 2V6OA 4EQRA 5KVIA 4H4WA 4NEWA 1JEHA 5KVHA 3O0HA 3KLJA 4FX9A 1ZDLA 4H4SA 5EBKA 3CGEA 1ZY8A 1GRGA 1OJTA 2AAQA 2WOVA 1GSNA 1NDAA 1MO9A 1D7YA 5JCLA 1NPXA 2YQUA 3CGBA 4H4YA 4H4VA 2GR3A 3IC9A 2C3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2I A;  5JRB A;  1KN0 A; 
#chains in the Genus database with same CATH topology
 3R1Z A;  3IJI A;  1XPY A;  4DX3 A;  2PPG A;  3THU A;  1ELS A;  1GET A;  2EQ6 A;  4K1W A;  3DG7 A;  4GGH A;  1ZKQ A;  3H7V A;  5GRT A;  4FI4 A;  5JCM A;  1K4Q A;  3NO1 A;  4HNC A;  2PSN A;  3LXD A;  3MKC A;  3GD6 A;  3DK9 A;  4A35 A;  4KPL A;  4HNL A;  4JQ9 A;  3TWA A;  2WPF A;  3JVA A;  3MUC A;  1R0M A;  3RRA A;  4EQS A;  1FFV C;  1GRE A;  1FHU A;  3DJJ A;  3D46 A;  2AL1 A;  4EM4 A;  2OX4 A;  3MSY A;  3CB3 A;  3VC6 A;  2POD A;  2FYM A;  3N6J A;  3SR6 B;  4J56 A;  2PA6 A;  4K8D A;  2OVL A;  2OKT A;  1R6W A;  3FV9 A;  3N4E A;  2J3N A;  2X99 A;  3V5F A;  2XH7 A;  3GY1 A;  1GV4 A;  3MZN A;  3H4K A;  2WPC A;  3CGC A;  3AN1 A;  2P88 A;  4H83 A;  1MDR A;  3DJG X;  1RM6 B;  3SQP A;  4H4U A;  3H8A A;  1AOG A;  3PK7 A;  4H4P A;  1OEP A;  1BZL A;  4JN7 A;  4IL2 A;  1FEA A;  1NHS A;  4GIS A;  1X2G A;  3IJL A;  3U9I A;  3CGD A;  1N62 C;  3LB8 A;  4IZG A;  3V4B A;  4ENL A;  3DG3 A;  4HCL A;  5FS9 A;  1PDZ A;  1SJB A;  5FJU A;  1DNC A;  3TJI A;  2CFY A;  1JRO A;  2W3S A;  4EMJ A;  1F3P A;  1H2I A;  2RDX A;  3CK5 A;  3HRD C;  4K7Z A;  4GYP C;  4JN8 A;  4NEV A;  3UCD A;  3DGB A;  4LII A;  2QVH A;  4YWS A;  4EM3 A;  4K8G A;  1GRT A;  3LAD A;  3VDG A;  2OQH A;  2DW7 A;  2P8C A;  3L8K A;  3NVY B;  4APN A;  3DDM A;  2QDD A;  3BOX A;  3N4F A;  1TYP A;  1MUC A;  3R0U A;  1KKR A;  2O56 A;  2TPR A;  2AL2 A;  1NHQ A;  2V6O A;  2HXU A;  3MY9 A;  1ONE A;  2AL2 B;  2GL5 A;  1JEH A;  3K1G A;  4FX9 A;  3DIP A;  1TZZ A;  2CHR A;  3CGE A;  4KWS A;  3UXL A;  3R25 A;  1GRG A;  1JRP A;  1OJT A;  3NRZ B;  2XSX A;  1STZ A;  2AAQ A;  2OQY A;  1W6T A;  3V5C A;  3CGB A;  4TVY A;  2XH4 A;  3ES7 A;  2C3C A;  2NQL A;  1XS2 A;  4KT2 A;  3A7A A;  2HNE A;  1EBD A;  4E4U A;  4FP1 A;  1SB3 B;  4IT1 A;  5G5H B;  1GRH A;  3UJS A;  1F8W A;  2ZZC A;  3ZVH A;  3JZU A;  3ZVH B;  3OC4 A;  1VDV A;  1F9C A;  1JDF A;  1XHC A;  3EAO A;  2W54 A;  1WYG A;  3D47 A;  5FS6 A;  3ENL A;  3N6H A;  3UCC A;  4MKS A;  1GES A;  5EU9 A;  3II4 A;  3JW7 A;  3GD3 A;  2WP6 A;  3EKG A;  4M52 A;  2GH5 A;  3A7U A;  1IYX A;  2OO6 A;  3OPS A;  1BWC A;  2GSH A;  2GGJ A;  5JCI A;  1E9I A;  1LPF A;  2W3R A;  1PDY A;  2HXT A;  2QJJ A;  1FEB A;  1DXL A;  1M6I A;  2P8B A;  3AMZ A;  2POZ A;  5BOF A;  3SJN A;  1BQG A;  1Q1W A;  3EF6 A;  3SN4 A;  3FVD A;  3KUM A;  4E6M A;  3Q45 A;  1ECQ A;  2PS2 A;  1ZMD A;  2OZT A;  1FFU C;  4J3Z A;  3U4F A;  3DEQ A;  1TE6 A;  5IDZ A;  4GR1 A;  3RGT A;  4GRT A;  3CT2 A;  4MGG A;  1T3Q C;  2R9Z A;  5ER0 A;  1N5X A;  2QDE A;  2OFJ A;  1NU5 A;  2CDU A;  3DGZ A;  2P3Z A;  3RIT A;  2YVJ A;  3RR1 A;  5J04 A;  2OLA A;  3DK8 A;  4IL0 A;  4HCD A;  3RO6 A;  3UGV A;  2FKP A;  3UXK A;  3P0W A;  5JCK A;  1NEL A;  2C3D A;  4YWO A;  3NFU A;  3B97 A;  4FDC B;  3SN1 A;  3VA8 A;  3UJ2 A;  3NS1 B;  3SSZ A;  3SBF A;  1KCZ A;  4EQR A;  3VFC A;  2PP0 A;  2QGY A;  2E5A A;  3NZG A;  3EEZ A;  4NEW A;  2AKM A;  2AKZ A;  3T9P A;  4GIR A;  4H4S A;  4F4R A;  2WOV A;  1N63 C;  3PFR A;  3STP A;  3DG6 A;  4H1Z A;  4ROP A;  1JPM A;  4H4V A;  1EC8 A;  3MWC A;  4MMW A;  3TTE A;  3S47 A;  1RVK A;  3QFA A;  1JOA A;  3TQP A;  1LVL A;  2PTZ A;  3H70 A;  7ENL A;  1FO4 A;  3ZLF A;  1EBH A;  4HCH A;  2X50 A;  3QLD A;  4KPR A;  2PGW A;  3NXL A;  3QKE A;  3AM9 A;  4EQX A;  2XH0 A;  3FJ4 A;  2QAE A;  2WP5 A;  3HW2 A;  1DTN A;  4DNA A;  1FEC A;  2WOI A;  3MQT A;  2X8H A;  1YQZ A;  1EC7 A;  3TJ4 A;  3V3W A;  1MRA A;  5FJO A;  4M6U A;  3B9J B;  2PMQ A;  1GEU A;  1ZMC A;  4DXK A;  3ZVI A;  3FG2 P;  4A6G A;  1MOK A;  4H4T A;  4DYE A;  2V3A A;  4ADW A;  1JPD X;  3D9X A;  5JRB A;  1NHP A;  2X8C A;  2V3B A;  3VCC A;  3FXG A;  1P48 A;  3I6E A;  3BJS A;  5G5G B;  1ONF A;  4H4Q A;  1H6V A;  3UJF A;  1FIQ B;  2ZZ0 A;  1KN0 A;  3BSM A;  3RNM A;  1XAN A;  3T6C A;  5U25 A;  5FJT A;  3CYJ A;  3P93 A;  2X8G A;  3DK4 A;  3IJQ A;  4BUR A;  1SJA A;  3OZY A;  4J1O A;  4TVW A;  3A7R A;  6ENL A;  4E5T A;  4GFI A;  2PU1 A;  5FMH A;  3S5S A;  3DER A;  3CXO A;  5FJP A;  3OTR A;  2QJN A;  3QPE A;  2BC1 A;  1ZXI C;  1SJC A;  3ES8 A;  2W0H A;  4LA1 A;  3Q6J A;  1S7M A;  3I4K A;  4K2S A;  2OG9 A;  3R0K A;  2GRT A;  2GQW A;  3EAN A;  3ETR B;  4DN1 A;  3Q4D A;  3R07 C;  1ZK7 A;  1TKK A;  2EQ7 A;  5FS8 A;  2YVF A;  4JDR A;  2ZC8 A;  2XH2 A;  1GXF A;  2WPE A;  3QTP A;  1N61 C;  2MUC A;  4J57 A;  5FJR A;  3NVW B;  1Q1R A;  3OZM A;  1MDL A;  1GRB A;  4EMW A;  4M0X A;  2HZG A;  4DWD A;  3FYY A;  5KVI A;  4H4W A;  3O0H A;  3DES A;  2PGE A;  1WUF A;  4Z1Y A;  3GO2 A;  2PTX A;  3CXB A;  2PCE A;  3ZLH A;  1D7Y A;  1MNS A;  5JCL A;  1NPX A;  3DFY A;  2GGE A;  2YQU A;  2GGI A;  4H4Y A;  3TWB A;  2GR3 A;  3IC9 A;  1P43 A;  1NHR A;  2EQ9 A;  3IK4 A;  4GYP A;  4G8T A;  5TR3 A;  2GR1 A;  4H2H A;  5JCN A;  3URH A;  2PTY A;  2ONE A;  5BOE A;  1BKH A;  5ENL A;  4EMI A;  1N5W C;  4DHG A;  2WBA A;  1GRF A;  3QN3 A;  1V59 A;  3SQS A;  3T4W A;  2QQ6 A;  3H12 A;  2GGH A;  4BV6 A;  3FCP A;  4ZA0 A;  1GER A;  3TOY A;  2PU0 A;  3QFB A;  2BC0 A;  3OW1 A;  4KEM A;  3I6T A;  1SJD A;  2OZ8 A;  2JK6 A;  5FS7 A;  3VC5 A;  2BCP A;  2HQM A;  3RCY A;  2A8X A;  2YAU A;  3GD4 A;  2NVK X;  1N60 C;  3VCN A;  1WUE A;  1XDI A;  3TCS A;  3GC2 A;  4IP5 A;  2RAB A;  2GR0 A;  3GRT A;  2EQ8 A;  3OP2 A;  2MNR A;  1V97 A;  3NVV B;  2DW6 A;  3DFH A;  3GRS A;  3P3B A;  4H4R A;  1VQZ A;  1TYT A;  4Z17 A;  4HPN A;  3DH9 A;  4HYR A;  2ZZB A;  2WOW A;  3UJR A;  2GGG A;  4JHM A;  2W55 A;  3DGH A;  4H4Z A;  2ZAD A;  4EQW A;  2GR2 A;  4E4F A;  5U1O A;  4H19 A;  3R11 A;  2YVG A;  2E3T A;  2XGZ A;  1YEY A;  2I5Q A;  4H4X A;  1GRA A;  4HN8 A;  2OZ3 A;  3PG6 A;  2PP3 A;  4E8G A;  4A3R A;  2F5Z A;  4H50 A;  4EWJ A;  3EUB 3;  2QJM A;  3CAW A;  2P0I A;  1ZX9 A;  3L5O A;  2OPJ A;  3ZLG A;  2PTW A;  1EBG A;  2NPX A;  4GME A;  3PWI A;  3SN0 A;  3HPF A;  3PWG A;  3NVZ B;  4X2P A;  2GDQ A;  3R10 A;  2PP1 A;  5KVH A;  1FHV A;  1KKO A;  3KLJ A;  4ZOH B;  1ZDL A;  5EBK A;  1ZY8 A;  1X2H A;  4ZCW A;  4GGB A;  3UJE A;  1KD0 A;  3T8Q A;  1GSN A;  4IP4 A;  1NDA A;  1MO9 A;  3TW9 A;  4IHC A;  1EC9 A;  4G7F A;  1JCT A;  1L8P A; 
#chains in the Genus database with same CATH homology
 1NHR A;  2EQ9 A;  3QFA A;  1JOA A;  1GET A;  1EBD A;  1LVL A;  2EQ6 A;  5TR3 A;  2GR1 A;  1ZKQ A;  5JCN A;  1GRH A;  5GRT A;  4KPR A;  2X50 A;  1F8W A;  1K4Q A;  2ZZC A;  3URH A;  5JCM A;  3LXD A;  3DK9 A;  4EQX A;  4EMI A;  2WBA A;  1GRF A;  3OC4 A;  4JQ9 A;  1V59 A;  2QAE A;  2WP5 A;  4BV6 A;  1XHC A;  3EAO A;  4DNA A;  2WPF A;  1FEC A;  2WOI A;  1GER A;  2X8H A;  5FS6 A;  3QFB A;  4EQS A;  1YQZ A;  1GRE A;  2BC0 A;  3DJJ A;  4EM4 A;  5FS7 A;  2JK6 A;  1GES A;  1GEU A;  1ZMC A;  2BCP A;  3II4 A;  4M52 A;  3GD3 A;  2WP6 A;  2GH5 A;  3FG2 P;  1MOK A;  4H4T A;  2HQM A;  4J56 A;  2A8X A;  4K8D A;  2YAU A;  3GD4 A;  2V3A A;  2NVK X;  4ADW A;  3D9X A;  5JRB A;  1BWC A;  1NHP A;  1XDI A;  2X8C A;  2V3B A;  5JCI A;  2RAB A;  2J3N A;  2X99 A;  1ONF A;  1LPF A;  2GR0 A;  3GRT A;  4H4Q A;  1H6V A;  1FEB A;  1DXL A;  1GV4 A;  2ZZ0 A;  1KN0 A;  3RNM A;  1XAN A;  2EQ8 A;  1M6I A;  2WPC A;  3CGC A;  3H4K A;  5U25 A;  2X8G A;  3DJG X;  3DK4 A;  3SQP A;  4H4U A;  3GRS A;  4H4R A;  4BUR A;  1AOG A;  1Q1W A;  3EF6 A;  1TYT A;  4H4P A;  1BZL A;  3DH9 A;  1NHS A;  1FEA A;  1ZMD A;  2WOW A;  2ZZB A;  5FMH A;  3CGD A;  3LB8 A;  4GR1 A;  3DGH A;  4H4Z A;  4GRT A;  5FS9 A;  4EQW A;  2BC1 A;  2GR2 A;  1DNC A;  2R9Z A;  2CFY A;  4EMJ A;  5U1O A;  1F3P A;  5ER0 A;  2YVG A;  2W0H A;  4LA1 A;  3Q6J A;  1H2I A;  1S7M A;  2CDU A;  4H4X A;  3DGZ A;  1GRA A;  2YVJ A;  2GRT A;  3PG6 A;  2GQW A;  3EAN A;  4K7Z A;  4NEV A;  4LII A;  3DK8 A;  2F5Z A;  4H50 A;  4EM3 A;  1ZK7 A;  1GRT A;  2EQ7 A;  3LAD A;  5FS8 A;  5JCK A;  3L8K A;  2C3D A;  2YVF A;  4JDR A;  4APN A;  3L5O A;  1ZX9 A;  1GXF A;  2WPE A;  4YWO A;  1TYP A;  2NPX A;  4FDC B;  4J57 A;  1Q1R A;  1GRB A;  4EMW A;  2TPR A;  1NHQ A;  2V6O A;  4EQR A;  5KVI A;  4H4W A;  4NEW A;  1JEH A;  5KVH A;  3O0H A;  3KLJ A;  4FX9 A;  1ZDL A;  4H4S A;  5EBK A;  3CGE A;  1ZY8 A;  1GRG A;  1OJT A;  2AAQ A;  2WOV A;  1GSN A;  1NDA A;  1MO9 A;  1D7Y A;  5JCL A;  1NPX A;  2YQU A;  3CGB A;  4H4Y A;  4H4V A;  2GR3 A;  3IC9 A;  2C3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...