5JRBA

Rad52(1-212) k102a/k133a/e202a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEAARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human DNA-repair protein RAD52 containing surface mutations
doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD52 homolog
total genus 51
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jrbA01
1H2IA 1KN0A 5JRBA
chains in the Genus database with same CATH superfamily
2PSNA 3OZMA 4J3ZA 4M0XA 2WP5A 2OO6A 2HXUA 2CHRA 3TOYA 2XH4A 4FP1A 1ELSA 4ZCWA 1ZKQA 3OTRA 1TZZA 4K8GA 1JPMA 3QPEA 3URHA 3VFCA 5BOFA 3VCNA 2QGYA 4H4PA 1N61C 1P48A 1GETA 3DGBA 1TYPA 3FYYA 2AKZA 3O0HA 4H2HA 1ZXIC 3SJNA 4IP5A 2EQ9A 1D7YA 2W0HA 1NHQA 4EQRA 3AM9A 1FIQB 2JK6A 3DERA 3R1ZA 2X8GA 3V4BA 3LB8A 1VQZA 1KKRA 1X2HA 2YVJA 3DGZA 3VC5A 1ZMDA 1WYGA 3ETRB 1PDYA 3P3BA 5FJTA 3DFYA 3T8QA 4EMJA 4H50A 3IC9A 1DTNA 4E4UA 1X2GA 3IJIA 1GRAA 2WP6A 4HN8A 3UXLA 3DIPA 4GYPC 3CK5A 1YQZA 1SJBA 4FI4A 4F4RA 3N6HA 3OP2A 2YAUA 4LIIA 3TWAA 3A7AA 1W6TA 2OPJA 3SSZA 3UCCA 1LPFA 5FS6A 3CXOA 1GRFA 1R6WA 1KN0A 3GY1A 2J3NA 2PGWA 3S47A 2P0IA 3GD4A 4K1WA 3Q4DA 2OQYA 2X99A 3JZUA 1ONFA 4IZGA 5EU9A 4EWJA 3QFAA 4H4QA 4IHCA 3SN1A 2OZTA 2BC0A 2F5ZA 4M52A 2GH5A 3QLDA 3B9JB 3BOXA 3MZNA 1DXLA 3A7RA 4MMWA 1NU5A 5IDZA 1GREA 2WOWA 1LVLA 2POZA 3GC2A 3V3WA 1F3PA 2C3CA 4H1ZA 1GESA 3H70A 5ER0A 2W3RA 3IK4A 4ZOHB 3DK8A 3ES8A 3I6TA 3SBFA 2WPFA 3DEQA 4IP4A 3THUA 4APNA 3HPFA 3SR6B 2W3SA 2BC1A 3DK4A 4GRTA 2WPEA 2QDEA 3FXGA 2GGGA 3IJLA 3OC4A 3R0KA 1IYXA 3DDMA 4ENLA 1MDLA 4H83A 4A6GA 3H12A 1H6VA 3EKGA 4H4RA 5G5HB 1M6IA 2OFJA 3CAWA 3RO6A 3D46A 4J56A 2BCPA 2XH2A 1MOKA 2AL2B 3CGDA 2PCEA 2QAEA 2YVGA 3DJGX 4FX9A 1BZLA 1RVKA 3GO2A 3D9XA 3T9PA 5G5GB 3RCYA 1EBGA 1EC9A 4TVYA 1SJCA 2R9ZA 1EC8A 3GD6A 3EAOA 3DESA 2W55A 4J1OA 1GRBA 1T3QC 2P88A 4GGBA 4H4VA 4DHGA 4BURA 4HYRA 5FS9A 2QVHA 1N63C 3P0WA 2GR1A 3A7UA 2WBAA 2PP3A 4GIRA 2C3DA 3RGTA 5U1OA 3Q45A 1FHVA 4E8GA 2PODA 2DW6A 3PWIA 3UJEA 2RABA 1KD0A 2EQ7A 3CYJA 3Q6JA 4KPRA 5BOEA 2OG9A 1GV4A 1R0MA 4DNAA 1MNSA 2MUCA 3CXBA 2ONEA 3R10A 2X8HA 1SJDA 2GQWA 4Z17A 5GRTA 2ZZCA 1P43A 1NPXA 4GR1A 1VDVA 1EBDA 2V3BA 4X2PA 3FCPA 2AL1A 1V97A 2OZ3A 2MNRA 4K7ZA 3CT2A 4G7FA 1NHPA 3L8KA 2P8CA 4TVWA 3RRAA 2PGEA 4EMIA 5JCKA 2EQ6A 3TQPA 2I5QA 3JW7A 4GISA 4K2SA 1Q1RA 3UXKA 3UGVA 4H4TA 4KT2A 4M6UA 3QN3A 2WOVA 7ENLA 2YQUA 3PWGA 3V5CA 3MWCA 3T6CA 4E4FA 1KCZA 3SN0A 4KWSA 1JPDX 3OPSA 1S7MA 4YWSA 4G8TA 4EMWA 5EBKA 1JRPA 3TCSA 1TYTA 3DGHA 2PTWA 3NS1B 2CDUA 4DWDA 1F9CA 3N4EA 2GR2A 1GRTA 2GL5A 3V5FA 2GGIA 4LA1A 2P8BA 2WOIA 1FO4A 4DX3A 2GGJA 3NXLA 3NFUA 3DG6A 3T4WA 3IJQA 3UJ2A 4HNLA 2QJJA 2NPXA 3QKEA 2FKPA 1N60C 5FJUA 2HXTA 3OZYA 3TJ4A 3ZLHA 4A3RA 5JRBA 4GYPA 1FFVC 3R11A 3UJRA 3U4FA 1GXFA 2XSXA 3H8AA 5KVIA 1NHRA 1BKHA 2X50A 2ZADA 1L8PA 3LADA 3HRDC 1SB3B 1MUCA 3NZGA 3PG6A 4FDCB 3R0UA 3KUMA 2QQ6A 2GGHA 3CGCA 2ZZBA 4A35A 5JCLA 2PA6A 1ZY8A 3PFRA 2PS2A 3VDGA 4BV6A 3SN4A 1WUFA 2GRTA 2HZGA 2XH0A 1Q1WA 3DJJA 1FFUC 5ENLA 2AL2A 1GEUA 3N4FA 1AOGA 4ZA0A 2W54A 3UJFA 1OEPA 3CGEA 1JOAA 2PTYA 2PP1A 2P3ZA 2PTZA 3B97A 4J57A 3OW1A 1V59A 1ZX9A 2E3TA 4H4XA 6ENLA 1MRAA 2V3AA 2QDDA 1OJTA 1JCTA 4DYEA 4EQSA 1GSNA 1N5XA 1GRGA 2YVFA 3I4KA 1NHSA 3QTPA 3EUB3 2GR0A 1TE6A 2OX4A 2CFYA 4GGHA 1STZA 4JHMA 2FYMA 2O56A 4IT1A 2OLAA 1JDFA 3FV9A 3S5SA 2E5AA 2QJNA 2PPGA 3DK9A 3AN1A 3UJSA 2A8XA 1FHUA 5JCIA 3H7VA 4NEVA 1ZDLA 4E6MA 3TW9A 1FECA 4EM4A 1EBHA 3EANA 3QFBA 4ADWA 4Z1YA 1GERA 2OQHA 4EQWA 1XDIA 2PU0A 4DXKA 1XHCA 3PK7A 2AAQA 3GRTA 3II4A 3NO1A 4MGGA 3FJ4A 4KEMA 3L5OA 3TWBA 3NVVB 4NEWA 5U25A 3BSMA 4GMEA 1KKOA 3LXDA 3TTEA 3RNMA 2XH7A 3MKCA 4H4ZA 1E9IA 1ZMCA 3DG7A 3KLJA 1H2IA 2X8CA 3JVAA 2NVKX 3TJIA 5FJRA 1FEAA 1NDAA 3R07C 3UCDA 2ZC8A 3FG2P 4H4YA 4EQXA 1MDRA 1BQGA 3EF6A 3BJSA 3CB3A 3FVDA 3DFHA 3GD3A 4JN8A 1TKKA 2AKMA 3EEZA 3RITA 3STPA 3AMZA 3P93A 2RDXA 2GR3A 1NELA 2PTXA 2ZZ0A 3VCCA 3ENLA 3MUCA 5FJOA 3H4KA 3U9IA 4IL0A 4GFIA 4YWOA 3ZVHA 3VC6A 5JCNA 3GRSA 3DH9A 2OKTA 2GGEA 4HCLA 4IL2A 3RR1A 4HCDA 2TPRA 2PU1A 1XANA 2NQLA 3SQPA 2OVLA 1SJAA 3ZLFA 4HCHA 1RM6B 2QJMA 1DNCA 2PP0A 4JQ9A 3NVYB 1BWCA 3K1GA 4JDRA 1XS2A 3MSYA 1F8WA 1ZK7A 2OZ8A 4JN7A 4MKSA 2EQ8A 3R25A 2V6OA 5TR3A 4H4SA 4DN1A 1MO9A 3SQSA 4EM3A 5FS7A 2PMQA 1N62C 1N5WC 4HNCA 1EC7A 1WUEA 4K8DA 2DW7A 1PDZA 1K4QA 2GDQA 3NVZB 4KPLA 3ZVIA 1FEBA 5J04A 4H19A 2HNEA 4H4UA 4ROPA 5JCMA 3HW2A 3MQTA 1YEYA 3N6JA 3VA8A 1XPYA 3NRZB 4H4WA 3DG3A 2WPCA 3ES7A 3I6EA 3ZLGA 5FS8A 2XGZA 3ZVHB 4HPNA 2HQMA 1ONEA 1JEHA 5FMHA 1ECQA 2GSHA 3NVWB 5KVHA 3CGBA 1GRHA 4E5TA 5FJPA 3MY9A 3D47A 1JROA
chains in the Genus database with same CATH topology
3L5OA 3OC4A 2GR2A 4NEWA 1GRTA 5U25A 2WP5A 1H6VA 3LXDA 4H4RA 2WOIA 4LA1A 1M6IA 3RNMA 4H4ZA 1ZMCA 3KLJA 1ZKQA 1H2IA 4J56A 2X8CA 2BCPA 2NVKX 3URHA 2NPXA 1MOKA 3CGDA 4H4PA 3DJGX 1FEAA 2QAEA 1NDAA 1GETA 2YVGA 4FX9A 1BZLA 5JRBA 1TYPA 3FG2P 4H4YA 4EQXA 3D9XA 3EF6A 1GXFA 3O0HA 5KVIA 1NHRA 3GD3A 2X50A 2EQ9A 2R9ZA 1D7YA 2W0HA 1NHQA 4EQRA 3EAOA 3LADA 2GR3A 1GRBA 2JK6A 3PG6A 4H4VA 4FDCB 4BURA 2X8GA 5FS9A 2ZZ0A 3LB8A 3CGCA 2ZZBA 5JCLA 2GR1A 2YVJA 3DGZA 1ZMDA 1ZY8A 3H4KA 4YWOA 4BV6A 2WBAA 4EMJA 5JCNA 3GRSA 3IC9A 4H50A 2GRTA 3DH9A 1Q1WA 2C3DA 3DJJA 2TPRA 5U1OA 1GRAA 2WP6A 1XANA 3SQPA 1GEUA 2RABA 1AOGA 1YQZA 2EQ7A 3CGEA 1JOAA 3Q6JA 4KPRA 1DNCA 2YAUA 4LIIA 4JQ9A 1GV4A 4DNAA 1BWCA 4JDRA 1LPFA 2X8HA 5FS6A 1F8WA 1ZK7A 2GQWA 1GRFA 1KN0A 4J57A 2EQ8A 5GRTA 1V59A 1ZX9A 2ZZCA 1NPXA 4GR1A 2J3NA 4H4XA 2V3AA 1EBDA 2V3BA 1OJTA 3GD4A 2V6OA 5TR3A 2X99A 1GSNA 2YVFA 1GRGA 4H4SA 4EQSA 1MO9A 1NHSA 1ONFA 5FS7A 4K7ZA 4EM3A 3QFAA 4H4QA 2BC0A 1NHPA 2F5ZA 3L8KA 4K8DA 2GR0A 2CFYA 1K4QA 4M52A 4EMIA 2GH5A 2EQ6A 5JCKA 1FEBA 1Q1RA 1DXLA 4H4UA 3DK9A 4H4TA 1GREA 2WOWA 1LVLA 2A8XA 5JCMA 1F3PA 2C3CA 2WOVA 1GESA 5JCIA 2YQUA 5ER0A 4H4WA 4NEVA 1ZDLA 2WPCA 3DK8A 1FECA 4EM4A 3EANA 3QFBA 4ADWA 5FS8A 1GERA 4EQWA 1S7MA 1XDIA 2WPFA 4APNA 4EMWA 5EBKA 2HQMA 1JEHA 1TYTA 1XHCA 5FMHA 2AAQA 3GRTA 2BC1A 3DGHA 3DK4A 3II4A 4GRTA 3CGBA 1GRHA 2CDUA 2WPEA 5KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2I A;  1KN0 A;  5JRB A; 
#chains in the Genus database with same CATH topology
 2PSN A;  3OZM A;  4J3Z A;  4M0X A;  2WP5 A;  2OO6 A;  2HXU A;  2CHR A;  3TOY A;  2XH4 A;  4FP1 A;  1ELS A;  4ZCW A;  1ZKQ A;  3OTR A;  1TZZ A;  4K8G A;  1JPM A;  3QPE A;  3URH A;  3VFC A;  5BOF A;  3VCN A;  2QGY A;  4H4P A;  1N61 C;  1P48 A;  1GET A;  3DGB A;  1TYP A;  3FYY A;  2AKZ A;  3O0H A;  4H2H A;  1ZXI C;  3SJN A;  4IP5 A;  2EQ9 A;  1D7Y A;  2W0H A;  1NHQ A;  4EQR A;  3AM9 A;  1FIQ B;  2JK6 A;  3DER A;  3R1Z A;  2X8G A;  3V4B A;  3LB8 A;  1VQZ A;  1KKR A;  1X2H A;  2YVJ A;  3DGZ A;  3VC5 A;  1ZMD A;  1WYG A;  3ETR B;  1PDY A;  3P3B A;  5FJT A;  3DFY A;  3T8Q A;  4EMJ A;  4H50 A;  3IC9 A;  1DTN A;  4E4U A;  1X2G A;  3IJI A;  1GRA A;  2WP6 A;  4HN8 A;  3UXL A;  3DIP A;  4GYP C;  3CK5 A;  1YQZ A;  1SJB A;  4FI4 A;  4F4R A;  3N6H A;  3OP2 A;  2YAU A;  4LII A;  3TWA A;  3A7A A;  1W6T A;  2OPJ A;  3SSZ A;  3UCC A;  1LPF A;  5FS6 A;  3CXO A;  1GRF A;  1R6W A;  1KN0 A;  3GY1 A;  2J3N A;  2PGW A;  3S47 A;  2P0I A;  3GD4 A;  4K1W A;  3Q4D A;  2OQY A;  2X99 A;  3JZU A;  1ONF A;  4IZG A;  5EU9 A;  4EWJ A;  3QFA A;  4H4Q A;  4IHC A;  3SN1 A;  2OZT A;  2BC0 A;  2F5Z A;  4M52 A;  2GH5 A;  3QLD A;  3B9J B;  3BOX A;  3MZN A;  1DXL A;  3A7R A;  4MMW A;  1NU5 A;  5IDZ A;  1GRE A;  2WOW A;  1LVL A;  2POZ A;  3GC2 A;  3V3W A;  1F3P A;  2C3C A;  4H1Z A;  1GES A;  3H70 A;  5ER0 A;  2W3R A;  3IK4 A;  4ZOH B;  3DK8 A;  3ES8 A;  3I6T A;  3SBF A;  2WPF A;  3DEQ A;  4IP4 A;  3THU A;  4APN A;  3HPF A;  3SR6 B;  2W3S A;  2BC1 A;  3DK4 A;  4GRT A;  2WPE A;  2QDE A;  3FXG A;  2GGG A;  3IJL A;  3OC4 A;  3R0K A;  1IYX A;  3DDM A;  4ENL A;  1MDL A;  4H83 A;  4A6G A;  3H12 A;  1H6V A;  3EKG A;  4H4R A;  5G5H B;  1M6I A;  2OFJ A;  3CAW A;  3RO6 A;  3D46 A;  4J56 A;  2BCP A;  2XH2 A;  1MOK A;  2AL2 B;  3CGD A;  2PCE A;  2QAE A;  2YVG A;  3DJG X;  4FX9 A;  1BZL A;  1RVK A;  3GO2 A;  3D9X A;  3T9P A;  5G5G B;  3RCY A;  1EBG A;  1EC9 A;  4TVY A;  1SJC A;  2R9Z A;  1EC8 A;  3GD6 A;  3EAO A;  3DES A;  2W55 A;  4J1O A;  1GRB A;  1T3Q C;  2P88 A;  4GGB A;  4H4V A;  4DHG A;  4BUR A;  4HYR A;  5FS9 A;  2QVH A;  1N63 C;  3P0W A;  2GR1 A;  3A7U A;  2WBA A;  2PP3 A;  4GIR A;  2C3D A;  3RGT A;  5U1O A;  3Q45 A;  1FHV A;  4E8G A;  2POD A;  2DW6 A;  3PWI A;  3UJE A;  2RAB A;  1KD0 A;  2EQ7 A;  3CYJ A;  3Q6J A;  4KPR A;  5BOE A;  2OG9 A;  1GV4 A;  1R0M A;  4DNA A;  1MNS A;  2MUC A;  3CXB A;  2ONE A;  3R10 A;  2X8H A;  1SJD A;  2GQW A;  4Z17 A;  5GRT A;  2ZZC A;  1P43 A;  1NPX A;  4GR1 A;  1VDV A;  1EBD A;  2V3B A;  4X2P A;  3FCP A;  2AL1 A;  1V97 A;  2OZ3 A;  2MNR A;  4K7Z A;  3CT2 A;  4G7F A;  1NHP A;  3L8K A;  2P8C A;  4TVW A;  3RRA A;  2PGE A;  4EMI A;  5JCK A;  2EQ6 A;  3TQP A;  2I5Q A;  3JW7 A;  4GIS A;  4K2S A;  1Q1R A;  3UXK A;  3UGV A;  4H4T A;  4KT2 A;  4M6U A;  3QN3 A;  2WOV A;  7ENL A;  2YQU A;  3PWG A;  3V5C A;  3MWC A;  3T6C A;  4E4F A;  1KCZ A;  3SN0 A;  4KWS A;  1JPD X;  3OPS A;  1S7M A;  4YWS A;  4G8T A;  4EMW A;  5EBK A;  1JRP A;  3TCS A;  1TYT A;  3DGH A;  2PTW A;  3NS1 B;  2CDU A;  4DWD A;  1F9C A;  3N4E A;  2GR2 A;  1GRT A;  2GL5 A;  3V5F A;  2GGI A;  4LA1 A;  2P8B A;  2WOI A;  1FO4 A;  4DX3 A;  2GGJ A;  3NXL A;  3NFU A;  3DG6 A;  3T4W A;  3IJQ A;  3UJ2 A;  4HNL A;  2QJJ A;  2NPX A;  3QKE A;  2FKP A;  1N60 C;  5FJU A;  2HXT A;  3OZY A;  3TJ4 A;  3ZLH A;  4A3R A;  5JRB A;  4GYP A;  1FFV C;  3R11 A;  3UJR A;  3U4F A;  1GXF A;  2XSX A;  3H8A A;  5KVI A;  1NHR A;  1BKH A;  2X50 A;  2ZAD A;  1L8P A;  3LAD A;  3HRD C;  1SB3 B;  1MUC A;  3NZG A;  3PG6 A;  4FDC B;  3R0U A;  3KUM A;  2QQ6 A;  2GGH A;  3CGC A;  2ZZB A;  4A35 A;  5JCL A;  2PA6 A;  1ZY8 A;  3PFR A;  2PS2 A;  3VDG A;  4BV6 A;  3SN4 A;  1WUF A;  2GRT A;  2HZG A;  2XH0 A;  1Q1W A;  3DJJ A;  1FFU C;  5ENL A;  2AL2 A;  1GEU A;  3N4F A;  1AOG A;  4ZA0 A;  2W54 A;  3UJF A;  1OEP A;  3CGE A;  1JOA A;  2PTY A;  2PP1 A;  2P3Z A;  2PTZ A;  3B97 A;  4J57 A;  3OW1 A;  1V59 A;  1ZX9 A;  2E3T A;  4H4X A;  6ENL A;  1MRA A;  2V3A A;  2QDD A;  1OJT A;  1JCT A;  4DYE A;  4EQS A;  1GSN A;  1N5X A;  1GRG A;  2YVF A;  3I4K A;  1NHS A;  3QTP A;  3EUB 3;  2GR0 A;  1TE6 A;  2OX4 A;  2CFY A;  4GGH A;  1STZ A;  4JHM A;  2FYM A;  2O56 A;  4IT1 A;  2OLA A;  1JDF A;  3FV9 A;  3S5S A;  2E5A A;  2QJN A;  2PPG A;  3DK9 A;  3AN1 A;  3UJS A;  2A8X A;  1FHU A;  5JCI A;  3H7V A;  4NEV A;  1ZDL A;  4E6M A;  3TW9 A;  1FEC A;  4EM4 A;  1EBH A;  3EAN A;  3QFB A;  4ADW A;  4Z1Y A;  1GER A;  2OQH A;  4EQW A;  1XDI A;  2PU0 A;  4DXK A;  1XHC A;  3PK7 A;  2AAQ A;  3GRT A;  3II4 A;  3NO1 A;  4MGG A;  3FJ4 A;  4KEM A;  3L5O A;  3TWB A;  3NVV B;  4NEW A;  5U25 A;  3BSM A;  4GME A;  1KKO A;  3LXD A;  3TTE A;  3RNM A;  2XH7 A;  3MKC A;  4H4Z A;  1E9I A;  1ZMC A;  3DG7 A;  3KLJ A;  1H2I A;  2X8C A;  3JVA A;  2NVK X;  3TJI A;  5FJR A;  1FEA A;  1NDA A;  3R07 C;  3UCD A;  2ZC8 A;  3FG2 P;  4H4Y A;  4EQX A;  1MDR A;  1BQG A;  3EF6 A;  3BJS A;  3CB3 A;  3FVD A;  3DFH A;  3GD3 A;  4JN8 A;  1TKK A;  2AKM A;  3EEZ A;  3RIT A;  3STP A;  3AMZ A;  3P93 A;  2RDX A;  2GR3 A;  1NEL A;  2PTX A;  2ZZ0 A;  3VCC A;  3ENL A;  3MUC A;  5FJO A;  3H4K A;  3U9I A;  4IL0 A;  4GFI A;  4YWO A;  3ZVH A;  3VC6 A;  5JCN A;  3GRS A;  3DH9 A;  2OKT A;  2GGE A;  4HCL A;  4IL2 A;  3RR1 A;  4HCD A;  2TPR A;  2PU1 A;  1XAN A;  2NQL A;  3SQP A;  2OVL A;  1SJA A;  3ZLF A;  4HCH A;  1RM6 B;  2QJM A;  1DNC A;  2PP0 A;  4JQ9 A;  3NVY B;  1BWC A;  3K1G A;  4JDR A;  1XS2 A;  3MSY A;  1F8W A;  1ZK7 A;  2OZ8 A;  4JN7 A;  4MKS A;  2EQ8 A;  3R25 A;  2V6O A;  5TR3 A;  4H4S A;  4DN1 A;  1MO9 A;  3SQS A;  4EM3 A;  5FS7 A;  2PMQ A;  1N62 C;  1N5W C;  4HNC A;  1EC7 A;  1WUE A;  4K8D A;  2DW7 A;  1PDZ A;  1K4Q A;  2GDQ A;  3NVZ B;  4KPL A;  3ZVI A;  1FEB A;  5J04 A;  4H19 A;  2HNE A;  4H4U A;  4ROP A;  5JCM A;  3HW2 A;  3MQT A;  1YEY A;  3N6J A;  3VA8 A;  1XPY A;  3NRZ B;  4H4W A;  3DG3 A;  2WPC A;  3ES7 A;  3I6E A;  3ZLG A;  5FS8 A;  2XGZ A;  3ZVH B;  4HPN A;  2HQM A;  1ONE A;  1JEH A;  5FMH A;  1ECQ A;  2GSH A;  3NVW B;  5KVH A;  3CGB A;  1GRH A;  4E5T A;  5FJP A;  3MY9 A;  3D47 A;  1JRO A; 
#chains in the Genus database with same CATH homology
 3L5O A;  3OC4 A;  2GR2 A;  4NEW A;  1GRT A;  5U25 A;  2WP5 A;  1H6V A;  3LXD A;  4H4R A;  2WOI A;  4LA1 A;  1M6I A;  3RNM A;  4H4Z A;  1ZMC A;  3KLJ A;  1ZKQ A;  1H2I A;  4J56 A;  2X8C A;  2BCP A;  2NVK X;  3URH A;  2NPX A;  1MOK A;  3CGD A;  4H4P A;  3DJG X;  1FEA A;  2QAE A;  1NDA A;  1GET A;  2YVG A;  4FX9 A;  1BZL A;  5JRB A;  1TYP A;  3FG2 P;  4H4Y A;  4EQX A;  3D9X A;  3EF6 A;  1GXF A;  3O0H A;  5KVI A;  1NHR A;  3GD3 A;  2X50 A;  2EQ9 A;  2R9Z A;  1D7Y A;  2W0H A;  1NHQ A;  4EQR A;  3EAO A;  3LAD A;  2GR3 A;  1GRB A;  2JK6 A;  3PG6 A;  4H4V A;  4FDC B;  4BUR A;  2X8G A;  5FS9 A;  2ZZ0 A;  3LB8 A;  3CGC A;  2ZZB A;  5JCL A;  2GR1 A;  2YVJ A;  3DGZ A;  1ZMD A;  1ZY8 A;  3H4K A;  4YWO A;  4BV6 A;  2WBA A;  4EMJ A;  5JCN A;  3GRS A;  3IC9 A;  4H50 A;  2GRT A;  3DH9 A;  1Q1W A;  2C3D A;  3DJJ A;  2TPR A;  5U1O A;  1GRA A;  2WP6 A;  1XAN A;  3SQP A;  1GEU A;  2RAB A;  1AOG A;  1YQZ A;  2EQ7 A;  3CGE A;  1JOA A;  3Q6J A;  4KPR A;  1DNC A;  2YAU A;  4LII A;  4JQ9 A;  1GV4 A;  4DNA A;  1BWC A;  4JDR A;  1LPF A;  2X8H A;  5FS6 A;  1F8W A;  1ZK7 A;  2GQW A;  1GRF A;  1KN0 A;  4J57 A;  2EQ8 A;  5GRT A;  1V59 A;  1ZX9 A;  2ZZC A;  1NPX A;  4GR1 A;  2J3N A;  4H4X A;  2V3A A;  1EBD A;  2V3B A;  1OJT A;  3GD4 A;  2V6O A;  5TR3 A;  2X99 A;  1GSN A;  2YVF A;  1GRG A;  4H4S A;  4EQS A;  1MO9 A;  1NHS A;  1ONF A;  5FS7 A;  4K7Z A;  4EM3 A;  3QFA A;  4H4Q A;  2BC0 A;  1NHP A;  2F5Z A;  3L8K A;  4K8D A;  2GR0 A;  2CFY A;  1K4Q A;  4M52 A;  4EMI A;  2GH5 A;  2EQ6 A;  5JCK A;  1FEB A;  1Q1R A;  1DXL A;  4H4U A;  3DK9 A;  4H4T A;  1GRE A;  2WOW A;  1LVL A;  2A8X A;  5JCM A;  1F3P A;  2C3C A;  2WOV A;  1GES A;  5JCI A;  2YQU A;  5ER0 A;  4H4W A;  4NEV A;  1ZDL A;  2WPC A;  3DK8 A;  1FEC A;  4EM4 A;  3EAN A;  3QFB A;  4ADW A;  5FS8 A;  1GER A;  4EQW A;  1S7M A;  1XDI A;  2WPF A;  4APN A;  4EMW A;  5EBK A;  2HQM A;  1JEH A;  1TYT A;  1XHC A;  5FMH A;  2AAQ A;  3GRT A;  2BC1 A;  3DGH A;  3DK4 A;  3II4 A;  4GRT A;  3CGB A;  1GRH A;  2CDU A;  2WPE A;  5KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...