5JRBA

Rad52(1-212) k102a/k133a/e202a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEAARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD52 homolog
publication title Structure of the human DNA-repair protein RAD52 containing surface mutations
doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 51
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jrbA01
1KN0A 1H2IA 5JRBA
chains in the Genus database with same CATH superfamily
5FJTA 3FG2P 3CGEA 5JCIA 2AL1A 5JCNA 3BOXA 3IJIA 3R25A 2PODA 3MWCA 4GRTA 4TVYA 2R9ZA 1Q1WA 1SJCA 4H4UA 3ZLFA 5FJOA 1RVKA 2YAUA 3Q4DA 3DERA 3OTRA 1BWCA 2A8XA 1FO4A 1F8WA 4KPLA 3DH9A 4EMIA 5FS7A 2BC1A 1FEAA 2GL5A 4M0XA 1JPMA 2ZZ0A 1BZLA 5ENLA 3EKGA 3LB8A 5KVHA 1ZMCA 1VQZA 2OKTA 1EC7A 1SB3B 2RABA 2ZZBA 3R10A 4H4TA 4ZOHB 1XPYA 1ZK7A 2QJNA 4M52A 1GERA 4Z1YA 4FI4A 1KKRA 4IZGA 3ZLHA 3AM9A 1MDRA 1TYPA 1FFVC 4J57A 2NPXA 3VFCA 4JDRA 3TCSA 5U1OA 2PTXA 3DGHA 3ZLGA 2NVKX 3SR6B 3B9JB 1MRAA 3PK7A 4DN1A 5FS9A 3R0KA 3ES8A 3HW2A 5U25A 4H83A 4EQWA 3KUMA 3N6JA 4IT1A 3BJSA 1NELA 3UXKA 2BCPA 2GQWA 3H4KA 4H4VA 1VDVA 2OQYA 3IJLA 2HXTA 3JVAA 3DGBA 3VA8A 3I4KA 5FS8A 2WP6A 2GSHA 3NVWB 4KWSA 1OJTA 4DX3A 2V6OA 4EMJA 1AOGA 1GREA 3I6TA 1E9IA 3NVZB 1JPDX 1FIQB 2AKMA 4EM3A 2FYMA 2YVGA 4A35A 1ZXIC 3RITA 2QVHA 3SN4A 4K7ZA 4LA1A 3R11A 1EC9A 3DGZA 2ONEA 3OPSA 1ONFA 1R6WA 3UXLA 2W3RA 3TJIA 3SQSA 2QJMA 3MKCA 1XHCA 3D47A 3NRZB 3GRSA 1ZKQA 2FKPA 2PP1A 4GFIA 4H4QA 3TOYA 2WPCA 3UGVA 1ZY8A 3K1GA 3LXDA 4EMWA 2GRTA 1N61C 1N5XA 3VDGA 3CGDA 3GC2A 2OG9A 2C3CA 4H2HA 3UJFA 1NPXA 1JRPA 1EBGA 2AL2A 2GDQA 2DW6A 1MDLA 1KKOA 2EQ8A 3CYJA 3FVDA 4K2SA 2XH2A 5JCMA 2GGJA 2ZC8A 1SJAA 3NZGA 5TR3A 4H4YA 4DYEA 1XS2A 4MKSA 1GRBA 3CGCA 3V4BA 3DESA 3P93A 1MNSA 2PGEA 3NO1A 2V3BA 3Q45A 1GV4A 3OZYA 3NXLA 3PG6A 4YWOA 2GGHA 1SJBA 3H7VA 1V59A 3THUA 3P0WA 2YQUA 4HNCA 3T9PA 3NVYB 1TKKA 3SJNA 3QFAA 2PTYA 4HPNA 5KVIA 4IL0A 3U4FA 3ZVIA 2WPFA 4FDCB 4K1WA 4A3RA 3GY1A 5FMHA 2W3SA 4J56A 2MNRA 2P88A 2PGWA 2XH4A 4ADWA 1N5WC 2GGGA 3EUB3 2CDUA 1EBDA 3CAWA 2J3NA 3GRTA 3OZMA 2X99A 3GD3A 5G5GB 1TE6A 3OC4A 3EF6A 3CGBA 3VC5A 2X8GA 4BURA 3DK8A 3FXGA 3L5OA 3UCDA 1N63C 2P3ZA 3DJGX 3QFBA 2DW7A 3A7AA 2EQ7A 3T4WA 3PWGA 2PSNA 3VCCA 3NVVB 3R1ZA 3MSYA 3JW7A 1W6TA 1OEPA 1XANA 3UCCA 3I6EA 5JCKA 1GRTA 4EM4A 1GRAA 4KEMA 4NEVA 3UJ2A 1ZDLA 2PP3A 3SBFA 1F9CA 3ZVHA 3CK5A 2W55A 4ENLA 3DK4A 3II4A 1PDYA 7ENLA 2PMQA 5FJUA 4H4ZA 3R0UA 3A7UA 3LADA 4JN8A 1SJDA 3AN1A 3TW9A 4YWSA 2YVJA 1FHUA 2P0IA 2AAQA 3GO2A 4E4FA 3VCNA 3ES7A 4EQSA 2I5QA 3MY9A 1KD0A 2EQ6A 1FHVA 2NQLA 4ZA0A 5EU9A 3TQPA 1MUCA 3RRAA 2MUCA 1WUFA 4HCHA 1KCZA 1DNCA 1GRGA 2GH5A 5G5HB 2POZA 3Q6JA 3V3WA 2X8HA 3CXOA 4GGBA 2QDEA 3EEZA 1L8PA 4F4RA 1GSNA 1NHRA 2OZTA 4HCDA 1JEHA 3QKEA 1MO9A 3SSZA 2QAEA 4H50A 2GGIA 4DNAA 3U9IA 4TVWA 2WP5A 3ENLA 3FYYA 2OVLA 2WOWA 4H19A 1K4QA 2ZZCA 4H4XA 2P8BA 4K8DA 1DTNA 2OQHA 3MZNA 3DIPA 2W54A 4E8GA 4HCLA 5BOFA 1ECQA 4FX9A 4JQ9A 4ZCWA 2V3AA 1ZMDA 3N4EA 1PDZA 4ROPA 2F5ZA 1GEUA 3DG6A 2HZGA 2GR0A 3TJ4A 4IHCA 4EWJA 2XH7A 3URHA 2ZADA 1JOAA 4JN7A 3B97A 2PTWA 3L8KA 3IJQA 4HN8A 3N4FA 3PWIA 1R0MA 2XGZA 2PP0A 3P3BA 5BOEA 1FFUC 3S47A 2PTZA 1GXFA 2YVFA 1V97A 4J1OA 3DDMA 4MMWA 2PU1A 1NHQA 1P43A 3PFRA 2C3DA 1X2HA 2WOVA 2GR3A 4H4WA 1N62C 1RM6B 3UJSA 4Z17A 2BC0A 5FJPA 4KT2A 3QLDA 2HQMA 3DFYA 2X50A 3GD6A 3H8AA 1YQZA 1N60C 3CT2A 3O0HA 1JCTA 3DJJA 2OFJA 3DK9A 3RCYA 3CXBA 3CB3A 2OZ3A 4IP5A 4X2PA 1WUEA 1FECA 2GR2A 4DWDA 1XDIA 3SQPA 2AL2B 3NFUA 1H6VA 1ZX9A 5ER0A 5JCLA 3SN0A 3FJ4A 3RGTA 2PS2A 2P8CA 1M6IA 2WPEA 4GISA 3D9XA 4M6UA 3S5SA 3OW1A 1GRHA 3KLJA 3DEQA 3EANA 4HYRA 3STPA 3HPFA 3UJRA 4GMEA 2PA6A 2OLAA 4GYPA 4J3ZA 2EQ9A 2E3TA 2PCEA 3R07C 1MOKA 1STZA 1JDFA 4FP1A 3TWBA 5FJRA 2OX4A 2WOIA 3DFHA 4NEWA 2W0HA 3HRDC 5GRTA 3DG3A 3NS1B 1H2IA 2WBAA 4G8TA 4BV6A 1ONEA 5EBKA 1GESA 1T3QC 3FV9A 2XSXA 2E5AA 6ENLA 2QJJA 2RDXA 1NDAA 1KN0A 2GR1A 2OPJA 4KPRA 3V5FA 5IDZA 2CHRA 4JHMA 3T6CA 4DXKA 3TWAA 1FEBA 4E5TA 1ELSA 1X2GA 3UJEA 3D46A 4H4PA 5FS6A 2O56A 3TTEA 4E6MA 2JK6A 3RNMA 1EC8A 3A7RA 1LVLA 1NHPA 1F3PA 4G7FA 4MGGA 3V5CA 2QDDA 4HNLA 3RR1A 1S7MA 3SN1A 1NU5A 2CFYA 3ETRB 1BKHA 3IC9A 2PU0A 3AMZA 4APNA 4IL2A 5JRBA 4A6GA 4DHGA 3FCPA 1WYGA 1YEYA 3N6HA 3OP2A 4GGHA 4GYPC 4H4RA 1JROA 1LPFA 2QGYA 1NHSA 2HNEA 1IYXA 4IP4A 1Q1RA 1TZZA 3MUCA 1P48A 1BQGA 1GRFA 2PPGA 4K8GA 1D7YA 2OZ8A 3H70A 3IK4A 3BSMA 4GIRA 3ZVHB 2XH0A 4EQRA 3QTPA 1GETA 4H1ZA 2OO6A 3MQTA 4LIIA 3QN3A 3RO6A 4E4UA 3H12A 3QPEA 2AKZA 3JZUA 2HXUA 3DG7A 1EBHA 3VC6A 1DXLA 3EAOA 3GD4A 2QQ6A 4EQXA 5J04A 2GGEA 4GR1A 4H4SA 2TPRA 3T8QA 2X8CA 1TYTA
chains in the Genus database with same CATH topology
3FG2P 3CGEA 5JCIA 3CGDA 5JCNA 2C3CA 1FECA 2GR2A 2YVJA 1XDIA 3SQPA 2AAQA 4GRTA 1NPXA 1H6VA 4EQSA 2R9ZA 1ZX9A 5ER0A 5JCLA 1Q1WA 2EQ6A 4H4UA 2YAUA 1M6IA 2WPEA 2EQ8A 1BWCA 2A8XA 3D9XA 1F8WA 1GRHA 3KLJA 5JCMA 1DNCA 1GRGA 2GH5A 3DH9A 3EANA 4EMIA 5FS7A 2BC1A 1FEAA 3Q6JA 2X8HA 2EQ9A 5TR3A 2ZZ0A 1MOKA 4H4YA 1BZLA 1GRBA 3CGCA 3LB8A 1GSNA 1NHRA 2WOIA 5KVHA 4NEWA 1ZMCA 2W0HA 2RABA 4H4TA 2ZZBA 2V3BA 1GV4A 1JEHA 1ZK7A 1MO9A 5GRTA 3PG6A 2QAEA 1H2IA 2WBAA 4M52A 1GERA 1V59A 4YWOA 4H50A 4BV6A 5EBKA 1GESA 4DNAA 2YQUA 1TYPA 2WP5A 3QFAA 5KVIA 1NDAA 1KN0A 2GR1A 2NPXA 4J57A 4KPRA 2WOWA 2WPFA 4JDRA 4FDCB 1K4QA 2ZZCA 4H4XA 5U1OA 3DGHA 4K8DA 2NVKX 5FMHA 5FS9A 1FEBA 4J56A 5U25A 4EQWA 4ADWA 4FX9A 4H4PA 4JQ9A 5FS6A 2CDUA 2V3AA 1ZMDA 1EBDA 2BCPA 2GQWA 2J3NA 2F5ZA 1GEUA 3GRTA 3H4KA 2JK6A 3RNMA 2X99A 3GD3A 4H4VA 1LVLA 1NHPA 2GR0A 1F3PA 3OC4A 1S7MA 3URHA 2CFYA 3EF6A 5FS8A 1JOAA 2WP6A 3IC9A 3L8KA 1OJTA 3CGBA 4APNA 5JRBA 2V6OA 2X8GA 4EMJA 4BURA 3DK8A 1GREA 1AOGA 3L5OA 4H4RA 3DJGX 3QFBA 1LPFA 4EM3A 2EQ7A 1NHSA 2YVGA 1GXFA 1Q1RA 2YVFA 1GRFA 4K7ZA 1XANA 1D7YA 4LA1A 1NHQA 5JCKA 1GRTA 3DGZA 2C3DA 1ONFA 4EM4A 1GRAA 4NEVA 2WOVA 2GR3A 1ZDLA 4H4WA 4EQRA 1GETA 1XHCA 4LIIA 3DK4A 2BC0A 3II4A 3GRSA 1ZKQA 2HQMA 4H4QA 2X50A 2WPCA 1DXLA 1YQZA 3EAOA 3GD4A 3O0HA 4H4ZA 4EQXA 1ZY8A 3LXDA 4EMWA 4GR1A 4H4SA 2TPRA 3DJJA 2GRTA 3DK9A 2X8CA 3LADA 1TYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN0 A;  1H2I A;  5JRB A; 
#chains in the Genus database with same CATH topology
 5FJT A;  3FG2 P;  3CGE A;  5JCI A;  2AL1 A;  5JCN A;  3BOX A;  3IJI A;  3R25 A;  2POD A;  3MWC A;  4GRT A;  4TVY A;  2R9Z A;  1Q1W A;  1SJC A;  4H4U A;  3ZLF A;  5FJO A;  1RVK A;  2YAU A;  3Q4D A;  3DER A;  3OTR A;  1BWC A;  2A8X A;  1FO4 A;  1F8W A;  4KPL A;  3DH9 A;  4EMI A;  5FS7 A;  2BC1 A;  1FEA A;  2GL5 A;  4M0X A;  1JPM A;  2ZZ0 A;  1BZL A;  5ENL A;  3EKG A;  3LB8 A;  5KVH A;  1ZMC A;  1VQZ A;  2OKT A;  1EC7 A;  1SB3 B;  2RAB A;  2ZZB A;  3R10 A;  4H4T A;  4ZOH B;  1XPY A;  1ZK7 A;  2QJN A;  4M52 A;  1GER A;  4Z1Y A;  4FI4 A;  1KKR A;  4IZG A;  3ZLH A;  3AM9 A;  1MDR A;  1TYP A;  1FFV C;  4J57 A;  2NPX A;  3VFC A;  4JDR A;  3TCS A;  5U1O A;  2PTX A;  3DGH A;  3ZLG A;  2NVK X;  3SR6 B;  3B9J B;  1MRA A;  3PK7 A;  4DN1 A;  5FS9 A;  3R0K A;  3ES8 A;  3HW2 A;  5U25 A;  4H83 A;  4EQW A;  3KUM A;  3N6J A;  4IT1 A;  3BJS A;  1NEL A;  3UXK A;  2BCP A;  2GQW A;  3H4K A;  4H4V A;  1VDV A;  2OQY A;  3IJL A;  2HXT A;  3JVA A;  3DGB A;  3VA8 A;  3I4K A;  5FS8 A;  2WP6 A;  2GSH A;  3NVW B;  4KWS A;  1OJT A;  4DX3 A;  2V6O A;  4EMJ A;  1AOG A;  1GRE A;  3I6T A;  1E9I A;  3NVZ B;  1JPD X;  1FIQ B;  2AKM A;  4EM3 A;  2FYM A;  2YVG A;  4A35 A;  1ZXI C;  3RIT A;  2QVH A;  3SN4 A;  4K7Z A;  4LA1 A;  3R11 A;  1EC9 A;  3DGZ A;  2ONE A;  3OPS A;  1ONF A;  1R6W A;  3UXL A;  2W3R A;  3TJI A;  3SQS A;  2QJM A;  3MKC A;  1XHC A;  3D47 A;  3NRZ B;  3GRS A;  1ZKQ A;  2FKP A;  2PP1 A;  4GFI A;  4H4Q A;  3TOY A;  2WPC A;  3UGV A;  1ZY8 A;  3K1G A;  3LXD A;  4EMW A;  2GRT A;  1N61 C;  1N5X A;  3VDG A;  3CGD A;  3GC2 A;  2OG9 A;  2C3C A;  4H2H A;  3UJF A;  1NPX A;  1JRP A;  1EBG A;  2AL2 A;  2GDQ A;  2DW6 A;  1MDL A;  1KKO A;  2EQ8 A;  3CYJ A;  3FVD A;  4K2S A;  2XH2 A;  5JCM A;  2GGJ A;  2ZC8 A;  1SJA A;  3NZG A;  5TR3 A;  4H4Y A;  4DYE A;  1XS2 A;  4MKS A;  1GRB A;  3CGC A;  3V4B A;  3DES A;  3P93 A;  1MNS A;  2PGE A;  3NO1 A;  2V3B A;  3Q45 A;  1GV4 A;  3OZY A;  3NXL A;  3PG6 A;  4YWO A;  2GGH A;  1SJB A;  3H7V A;  1V59 A;  3THU A;  3P0W A;  2YQU A;  4HNC A;  3T9P A;  3NVY B;  1TKK A;  3SJN A;  3QFA A;  2PTY A;  4HPN A;  5KVI A;  4IL0 A;  3U4F A;  3ZVI A;  2WPF A;  4FDC B;  4K1W A;  4A3R A;  3GY1 A;  5FMH A;  2W3S A;  4J56 A;  2MNR A;  2P88 A;  2PGW A;  2XH4 A;  4ADW A;  1N5W C;  2GGG A;  3EUB 3;  2CDU A;  1EBD A;  3CAW A;  2J3N A;  3GRT A;  3OZM A;  2X99 A;  3GD3 A;  5G5G B;  1TE6 A;  3OC4 A;  3EF6 A;  3CGB A;  3VC5 A;  2X8G A;  4BUR A;  3DK8 A;  3FXG A;  3L5O A;  3UCD A;  1N63 C;  2P3Z A;  3DJG X;  3QFB A;  2DW7 A;  3A7A A;  2EQ7 A;  3T4W A;  3PWG A;  2PSN A;  3VCC A;  3NVV B;  3R1Z A;  3MSY A;  3JW7 A;  1W6T A;  1OEP A;  1XAN A;  3UCC A;  3I6E A;  5JCK A;  1GRT A;  4EM4 A;  1GRA A;  4KEM A;  4NEV A;  3UJ2 A;  1ZDL A;  2PP3 A;  3SBF A;  1F9C A;  3ZVH A;  3CK5 A;  2W55 A;  4ENL A;  3DK4 A;  3II4 A;  1PDY A;  7ENL A;  2PMQ A;  5FJU A;  4H4Z A;  3R0U A;  3A7U A;  3LAD A;  4JN8 A;  1SJD A;  3AN1 A;  3TW9 A;  4YWS A;  2YVJ A;  1FHU A;  2P0I A;  2AAQ A;  3GO2 A;  4E4F A;  3VCN A;  3ES7 A;  4EQS A;  2I5Q A;  3MY9 A;  1KD0 A;  2EQ6 A;  1FHV A;  2NQL A;  4ZA0 A;  5EU9 A;  3TQP A;  1MUC A;  3RRA A;  2MUC A;  1WUF A;  4HCH A;  1KCZ A;  1DNC A;  1GRG A;  2GH5 A;  5G5H B;  2POZ A;  3Q6J A;  3V3W A;  2X8H A;  3CXO A;  4GGB A;  2QDE A;  3EEZ A;  1L8P A;  4F4R A;  1GSN A;  1NHR A;  2OZT A;  4HCD A;  1JEH A;  3QKE A;  1MO9 A;  3SSZ A;  2QAE A;  4H50 A;  2GGI A;  4DNA A;  3U9I A;  4TVW A;  2WP5 A;  3ENL A;  3FYY A;  2OVL A;  2WOW A;  4H19 A;  1K4Q A;  2ZZC A;  4H4X A;  2P8B A;  4K8D A;  1DTN A;  2OQH A;  3MZN A;  3DIP A;  2W54 A;  4E8G A;  4HCL A;  5BOF A;  1ECQ A;  4FX9 A;  4JQ9 A;  4ZCW A;  2V3A A;  1ZMD A;  3N4E A;  1PDZ A;  4ROP A;  2F5Z A;  1GEU A;  3DG6 A;  2HZG A;  2GR0 A;  3TJ4 A;  4IHC A;  4EWJ A;  2XH7 A;  3URH A;  2ZAD A;  1JOA A;  4JN7 A;  3B97 A;  2PTW A;  3L8K A;  3IJQ A;  4HN8 A;  3N4F A;  3PWI A;  1R0M A;  2XGZ A;  2PP0 A;  3P3B A;  5BOE A;  1FFU C;  3S47 A;  2PTZ A;  1GXF A;  2YVF A;  1V97 A;  4J1O A;  3DDM A;  4MMW A;  2PU1 A;  1NHQ A;  1P43 A;  3PFR A;  2C3D A;  1X2H A;  2WOV A;  2GR3 A;  4H4W A;  1N62 C;  1RM6 B;  3UJS A;  4Z17 A;  2BC0 A;  5FJP A;  4KT2 A;  3QLD A;  2HQM A;  3DFY A;  2X50 A;  3GD6 A;  3H8A A;  1YQZ A;  1N60 C;  3CT2 A;  3O0H A;  1JCT A;  3DJJ A;  2OFJ A;  3DK9 A;  3RCY A;  3CXB A;  3CB3 A;  2OZ3 A;  4IP5 A;  4X2P A;  1WUE A;  1FEC A;  2GR2 A;  4DWD A;  1XDI A;  3SQP A;  2AL2 B;  3NFU A;  1H6V A;  1ZX9 A;  5ER0 A;  5JCL A;  3SN0 A;  3FJ4 A;  3RGT A;  2PS2 A;  2P8C A;  1M6I A;  2WPE A;  4GIS A;  3D9X A;  4M6U A;  3S5S A;  3OW1 A;  1GRH A;  3KLJ A;  3DEQ A;  3EAN A;  4HYR A;  3STP A;  3HPF A;  3UJR A;  4GME A;  2PA6 A;  2OLA A;  4GYP A;  4J3Z A;  2EQ9 A;  2E3T A;  2PCE A;  3R07 C;  1MOK A;  1STZ A;  1JDF A;  4FP1 A;  3TWB A;  5FJR A;  2OX4 A;  2WOI A;  3DFH A;  4NEW A;  2W0H A;  3HRD C;  5GRT A;  3DG3 A;  3NS1 B;  1H2I A;  2WBA A;  4G8T A;  4BV6 A;  1ONE A;  5EBK A;  1GES A;  1T3Q C;  3FV9 A;  2XSX A;  2E5A A;  6ENL A;  2QJJ A;  2RDX A;  1NDA A;  1KN0 A;  2GR1 A;  2OPJ A;  4KPR A;  3V5F A;  5IDZ A;  2CHR A;  4JHM A;  3T6C A;  4DXK A;  3TWA A;  1FEB A;  4E5T A;  1ELS A;  1X2G A;  3UJE A;  3D46 A;  4H4P A;  5FS6 A;  2O56 A;  3TTE A;  4E6M A;  2JK6 A;  3RNM A;  1EC8 A;  3A7R A;  1LVL A;  1NHP A;  1F3P A;  4G7F A;  4MGG A;  3V5C A;  2QDD A;  4HNL A;  3RR1 A;  1S7M A;  3SN1 A;  1NU5 A;  2CFY A;  3ETR B;  1BKH A;  3IC9 A;  2PU0 A;  3AMZ A;  4APN A;  4IL2 A;  5JRB A;  4A6G A;  4DHG A;  3FCP A;  1WYG A;  1YEY A;  3N6H A;  3OP2 A;  4GGH A;  4GYP C;  4H4R A;  1JRO A;  1LPF A;  2QGY A;  1NHS A;  2HNE A;  1IYX A;  4IP4 A;  1Q1R A;  1TZZ A;  3MUC A;  1P48 A;  1BQG A;  1GRF A;  2PPG A;  4K8G A;  1D7Y A;  2OZ8 A;  3H70 A;  3IK4 A;  3BSM A;  4GIR A;  3ZVH B;  2XH0 A;  4EQR A;  3QTP A;  1GET A;  4H1Z A;  2OO6 A;  3MQT A;  4LII A;  3QN3 A;  3RO6 A;  4E4U A;  3H12 A;  3QPE A;  2AKZ A;  3JZU A;  2HXU A;  3DG7 A;  1EBH A;  3VC6 A;  1DXL A;  3EAO A;  3GD4 A;  2QQ6 A;  4EQX A;  5J04 A;  2GGE A;  4GR1 A;  4H4S A;  2TPR A;  3T8Q A;  2X8C A;  1TYT A; 
#chains in the Genus database with same CATH homology
 3FG2 P;  3CGE A;  5JCI A;  3CGD A;  5JCN A;  2C3C A;  1FEC A;  2GR2 A;  2YVJ A;  1XDI A;  3SQP A;  2AAQ A;  4GRT A;  1NPX A;  1H6V A;  4EQS A;  2R9Z A;  1ZX9 A;  5ER0 A;  5JCL A;  1Q1W A;  2EQ6 A;  4H4U A;  2YAU A;  1M6I A;  2WPE A;  2EQ8 A;  1BWC A;  2A8X A;  3D9X A;  1F8W A;  1GRH A;  3KLJ A;  5JCM A;  1DNC A;  1GRG A;  2GH5 A;  3DH9 A;  3EAN A;  4EMI A;  5FS7 A;  2BC1 A;  1FEA A;  3Q6J A;  2X8H A;  2EQ9 A;  5TR3 A;  2ZZ0 A;  1MOK A;  4H4Y A;  1BZL A;  1GRB A;  3CGC A;  3LB8 A;  1GSN A;  1NHR A;  2WOI A;  5KVH A;  4NEW A;  1ZMC A;  2W0H A;  2RAB A;  4H4T A;  2ZZB A;  2V3B A;  1GV4 A;  1JEH A;  1ZK7 A;  1MO9 A;  5GRT A;  3PG6 A;  2QAE A;  1H2I A;  2WBA A;  4M52 A;  1GER A;  1V59 A;  4YWO A;  4H50 A;  4BV6 A;  5EBK A;  1GES A;  4DNA A;  2YQU A;  1TYP A;  2WP5 A;  3QFA A;  5KVI A;  1NDA A;  1KN0 A;  2GR1 A;  2NPX A;  4J57 A;  4KPR A;  2WOW A;  2WPF A;  4JDR A;  4FDC B;  1K4Q A;  2ZZC A;  4H4X A;  5U1O A;  3DGH A;  4K8D A;  2NVK X;  5FMH A;  5FS9 A;  1FEB A;  4J56 A;  5U25 A;  4EQW A;  4ADW A;  4FX9 A;  4H4P A;  4JQ9 A;  5FS6 A;  2CDU A;  2V3A A;  1ZMD A;  1EBD A;  2BCP A;  2GQW A;  2J3N A;  2F5Z A;  1GEU A;  3GRT A;  3H4K A;  2JK6 A;  3RNM A;  2X99 A;  3GD3 A;  4H4V A;  1LVL A;  1NHP A;  2GR0 A;  1F3P A;  3OC4 A;  1S7M A;  3URH A;  2CFY A;  3EF6 A;  5FS8 A;  1JOA A;  2WP6 A;  3IC9 A;  3L8K A;  1OJT A;  3CGB A;  4APN A;  5JRB A;  2V6O A;  2X8G A;  4EMJ A;  4BUR A;  3DK8 A;  1GRE A;  1AOG A;  3L5O A;  4H4R A;  3DJG X;  3QFB A;  1LPF A;  4EM3 A;  2EQ7 A;  1NHS A;  2YVG A;  1GXF A;  1Q1R A;  2YVF A;  1GRF A;  4K7Z A;  1XAN A;  1D7Y A;  4LA1 A;  1NHQ A;  5JCK A;  1GRT A;  3DGZ A;  2C3D A;  1ONF A;  4EM4 A;  1GRA A;  4NEV A;  2WOV A;  2GR3 A;  1ZDL A;  4H4W A;  4EQR A;  1GET A;  1XHC A;  4LII A;  3DK4 A;  2BC0 A;  3II4 A;  3GRS A;  1ZKQ A;  2HQM A;  4H4Q A;  2X50 A;  2WPC A;  1DXL A;  1YQZ A;  3EAO A;  3GD4 A;  3O0H A;  4H4Z A;  4EQX A;  1ZY8 A;  3LXD A;  4EMW A;  4GR1 A;  4H4S A;  2TPR A;  3DJJ A;  2GRT A;  3DK9 A;  2X8C A;  3LAD A;  1TYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...