5JRBA

Rad52(1-212) k102a/k133a/e202a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEAARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human DNA-repair protein RAD52 containing surface mutations
doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD52 homolog
total genus 51
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jrbA01
1H2IA 5JRBA 1KN0A
chains in the Genus database with same CATH superfamily
2FKPA 3DK8A 4G8TA 1ZK7A 1FEBA 1EC8A 2HNEA 2OX4A 1V97A 3UXLA 4H4PA 1GRHA 3UJ2A 2PMQA 1JDFA 1ONFA 2HQMA 3IJIA 2W55A 4IZGA 4HNLA 1SJDA 3DESA 2AL2A 1MDLA 1XDIA 2V3BA 4H4ZA 1SB3B 1KD0A 3EANA 3ZVHB 2GRTA 1JEHA 2MNRA 4E5TA 3FV9A 2ZZBA 1N62C 3DG3A 4H83A 1NELA 3ES7A 1P43A 4ZCWA 3TJIA 3OPSA 2FYMA 2TPRA 3OTRA 4FP1A 2YQUA 1T3QC 3D9XA 3EEZA 4H4TA 2WP5A 3DJGX 3S5SA 2AL1A 4KPLA 3R0KA 2HXTA 4GYPA 2EQ6A 3BOXA 3GY1A 4H4RA 1KKOA 1MOKA 3AMZA 2DW7A 1BQGA 3NXLA 3SR6B 3FCPA 4EM4A 5JCMA 4DYEA 3DH9A 3FXGA 4FDCB 2BC1A 3O0HA 4GMEA 4H4QA 1WUEA 5FS7A 2P8BA 2OQYA 2GDQA 3GO2A 3OZMA 1X2GA 1ELSA 4K2SA 2XSXA 4A3RA 4M6UA 5FS9A 1NDAA 2AAQA 2YVJA 4GFIA 2AL2B 2W3SA 2WOWA 3JVAA 2PGWA 3K1GA 3RGTA 1XANA 4A6GA 3U4FA 3SN0A 4Z17A 4HYRA 1MNSA 2OLAA 3CGDA 4HNCA 1EBGA 3TQPA 2A8XA 2OQHA 4GYPC 4J3ZA 2QDDA 3H8AA 3QPEA 5JCKA 1LVLA 3TOYA 4ZA0A 3OP2A 4JQ9A 3UJFA 3NO1A 3V5CA 5FJPA 2XH0A 2E3TA 4HN8A 4KEMA 3ZLGA 3ZLFA 5JCNA 3VC5A 2XH2A 2GGGA 3MQTA 3UXKA 3DK9A 1PDYA 3NS1B 3CGBA 1FECA 4GRTA 1N5WC 4H2HA 3LADA 1NHSA 3VA8A 2EQ9A 2GH5A 4IT1A 3RRAA 3S47A 1TKKA 4K7ZA 3DGHA 3EAOA 1GRAA 5FJOA 2RABA 1X2HA 4H4VA 1V59A 3NZGA 2HXUA 4TVWA 2OVLA 3I6TA 5FS6A 1TZZA 3MSYA 3ZVIA 1F3PA 1VDVA 2WP6A 2P3ZA 3EKGA 3KUMA 1E9IA 3IC9A 3QFBA 4J57A 1W6TA 1H2IA 1S7MA 1ZX9A 3PWGA 3RNMA 4H1ZA 2W0HA 1GRBA 3HRDC 4EMWA 2PA6A 2W54A 2WPEA 3CYJA 2PP0A 2QAEA 3TCSA 5JCLA 2P0IA 2GGJA 4E6MA 2PTZA 1NU5A 1RVKA 3U9IA 3HPFA 1Q1WA 5G5HB 7ENLA 1SJCA 2OG9A 3A7AA 2X8HA 3ENLA 4K8DA 1FHVA 3THUA 5FJTA 2QJJA 1R6WA 1DNCA 3TWAA 4EMIA 1XS2A 4NEWA 4DX3A 2WOVA 5TR3A 1L8PA 4DWDA 2P88A 3IJLA 3TW9A 4MGGA 4YWOA 4EQSA 3NVZB 1ECQA 1ZXIC 1GV4A 4TVYA 2WOIA 4H4YA 1GXFA 2X99A 2NQLA 1SJAA 1NHQA 1FEAA 2OO6A 2GGEA 2O56A 1N60C 2ONEA 3ETRB 2OZTA 2C3CA 1OEPA 3DGZA 3ES8A 3NRZB 1GERA 1EBHA 1MUCA 2YVFA 1BWCA 1EC9A 2OPJA 1SJBA 2F5ZA 5KVIA 1RM6B 3DDMA 3PFRA 2XH4A 3MKCA 3GRSA 3L8KA 1MRAA 3STPA 3TJ4A 1K4QA 2GL5A 2QDEA 1WUFA 2V3AA 5JCIA 4Z1YA 4IP4A 3QLDA 5FMHA 5BOEA 2DW6A 3SQSA 3N4FA 4BURA 3B9JB 1M6IA 2QQ6A 2CFYA 2ZZCA 3UJRA 1TE6A 1XHCA 3DEQA 1DTNA 3QFAA 3N4EA 3CGEA 5U25A 3Q45A 4M52A 2PTYA 3I6EA 4H4XA 2GGHA 2PTWA 5BOFA 2WPFA 1N61C 4LIIA 3MZNA 3V5FA 4LA1A 2EQ7A 3P93A 1FFVC 3H4KA 2CHRA 3CT2A 4NEVA 3Q4DA 1YEYA 3FVDA 3OW1A 3SQPA 3DFYA 4H4SA 4HCHA 3H12A 1JPMA 4K1WA 5FS8A 3CXBA 4EMJA 3N6HA 2PP3A 2R9ZA 3MY9A 3NVWB 4EQWA 1KN0A 3PK7A 1KCZA 1YQZA 4JHMA 3D47A 1MO9A 1FFUC 3UCCA 2BCPA 2PTXA 4H50A 4HCLA 3DGBA 4ADWA 2OZ3A 1Q1RA 4A35A 2YAUA 4GGHA 1TYPA 2WPCA 3L5OA 3VCCA 3GD3A 2X50A 3SN1A 2RDXA 1GSNA 3Q6JA 5U1OA 3VFCA 1ZMCA 4E8GA 3UJSA 1NPXA 1GRFA 3UJEA 2J3NA 3QTPA 3LB8A 4FI4A 4EQXA 2PGEA 3AM9A 3P3BA 2GGIA 2AKMA 1F8WA 3RITA 2WBAA 3LXDA 2V6OA 4M0XA 3HW2A 1MDRA 4IHCA 2ZADA 4GISA 2X8GA 1ZMDA 1D7YA 5EU9A 4JN8A 2OZ8A 3IJQA 4ZOHB 2PSNA 1OJTA 1TYTA 2GQWA 3SN4A 4HPNA 4H4UA 6ENLA 3DFHA 3CK5A 3DIPA 1JROA 2MUCA 3VC6A 4FX9A 3FYYA 1BZLA 4APNA 3P0WA 3NVYB 1STZA 2P8CA 3DG7A 4IL2A 5J04A 3MWCA 4JDRA 1KKRA 5ENLA 1JOAA 1GEUA 1PDZA 3UGVA 1AOGA 4EQRA 2PS2A 5ER0A 4EM3A 1XPYA 3OZYA 3T6CA 2BC0A 1P48A 1FHUA 5IDZA 4DXKA 4G7FA 1DXLA 1IYXA 2AKZA 2PP1A 2XH7A 3VCNA 1F9CA 4EWJA 3OC4A 2I5QA 3DK4A 1GETA 1NHRA 2GR2A 2QJNA 2PODA 4K8GA 3PWIA 1H6VA 3IK4A 4GR1A 1EBDA 3GD4A 1ONEA 2QGYA 4IP5A 4F4RA 2GR0A 2X8CA 1N5XA 1GESA 3QN3A 3ZLHA 3SJNA 3EF6A 3V4BA 2PU1A 3CB3A 3SSZA 3FJ4A 5JRBA 3N6JA 3GD6A 1JRPA 4GIRA 2GR3A 3PG6A 3DG6A 3H70A 3AN1A 2GSHA 3II4A 3RR1A 4KPRA 1JCTA 2YVGA 3DJJA 3GRTA 3UCDA 4H4WA 3DERA 3MUCA 3I4KA 3NFUA 2E5AA 4X2PA 3R10A 2GR1A 3TTEA 2EQ8A 2HZGA 4ROPA 4J56A 3T8QA 1GRGA 3B97A 3EUB3 1FIQB 3FG2P 1R0MA 2ZZ0A 2NVKX 4IL0A 5G5GB 1GRTA 3SBFA 1JPDX 5FJUA 4E4UA 3QKEA 3A7RA 3GC2A 2CDUA 1ZDLA 4JN7A 1ZY8A 5GRTA 3TWBA 4E4FA 3T4WA 4KT2A 4DHGA 1WYGA 1EC7A 2PPGA 4DN1A 1VQZA 1NHPA 3BSMA 4ENLA 2W3RA 4YWSA 1N63C 4H19A 1GREA 3KLJA 3JW7A 2PCEA 1ZKQA 5EBKA 5FJRA 3ZVHA 3JZUA 3R25A 3RCYA 4MKSA 2QVHA 3R07C 3R11A 2JK6A 3URHA 4J1OA 4GGBA 3CXOA 2XGZA 3BJSA 3D46A 1BKHA 2POZA 4BV6A 2OFJA 3CAWA 4KWSA 3A7UA 3RO6A 3R0UA 2QJMA 4DNAA 4HCDA 2ZC8A 2C3DA 3VDGA 3V3WA 2OKTA 3CGCA 3R1ZA 2PU0A 3T9PA 3H7VA 1LPFA 3NVVB 1FO4A 2NPXA 4MMWA 5KVHA
chains in the Genus database with same CATH topology
3DGHA 3DK8A 3QFAA 1ZK7A 1DXLA 1FEBA 3CGEA 1GRAA 3EAOA 2RABA 5U25A 4M52A 4H4VA 1V59A 4H4XA 4H4PA 1GRHA 2WPFA 4LIIA 1ONFA 2HQMA 5FS6A 3OC4A 3DK4A 1F3PA 1GETA 1NHRA 2GR2A 2WP6A 1XDIA 3QFBA 3IC9A 4LA1A 2EQ7A 2V3BA 1H6VA 4H4ZA 3H4KA 1EBDA 4GR1A 3EANA 4J57A 4NEVA 1H2IA 1S7MA 1ZX9A 3GD4A 2GRTA 1JEHA 3RNMA 2W0HA 1GRBA 2GR0A 3SQPA 2X8CA 2ZZBA 4H4SA 1GESA 5FS8A 4EMJA 3EF6A 4EMWA 2WPEA 2TPRA 5JRBA 2YQUA 2R9ZA 2QAEA 2GR3A 3PG6A 5JCLA 3D9XA 4H4TA 2WP5A 4EQWA 3DJGX 1KN0A 1Q1WA 1YQZA 3II4A 1MO9A 2X8HA 4KPRA 4K8DA 2BCPA 2EQ6A 2YVGA 4H50A 4H4RA 4ADWA 3DJJA 3GRTA 1MOKA 4H4WA 1Q1RA 4EM4A 2YAUA 5JCMA 3DH9A 1TYPA 1DNCA 2WPCA 3L5OA 4FDCB 2BC1A 4EMIA 3GD3A 3O0HA 2X50A 4H4QA 5FS7A 4NEWA 2GR1A 2EQ8A 1GSNA 3Q6JA 5U1OA 4K7ZA 1ZMCA 2WOVA 4J56A 1GRGA 1NPXA 5TR3A 1GRFA 3FG2P 2J3NA 3LB8A 4EQXA 2ZZ0A 2NVKX 5FS9A 1NDAA 2AAQA 2YVJA 4YWOA 1GRTA 2WOWA 4EQSA 1F8WA 1GV4A 2WOIA 4H4YA 1XANA 1GXFA 2X99A 2WBAA 2CDUA 2V6OA 1ZDLA 1NHQA 3LXDA 1FEAA 1ZY8A 5GRTA 3CGDA 2A8XA 2X8GA 1ZMDA 1NHPA 1D7YA 2C3CA 5JCKA 1LVLA 3DGZA 1GREA 1OJTA 4JQ9A 1TYTA 2GQWA 3KLJA 1GERA 1ZKQA 5EBKA 4H4UA 2JK6A 3URHA 2YVFA 1BWCA 4FX9A 2F5ZA 1BZLA 5KVIA 4APNA 5JCNA 4BV6A 3GRSA 3L8KA 4JDRA 1K4QA 2V3AA 3DK9A 5JCIA 1JOAA 1GEUA 4DNAA 5FMHA 1AOGA 2C3DA 4EQRA 3CGBA 1FECA 4GRTA 3CGCA 4BURA 5ER0A 1M6IA 3LADA 1NHSA 1LPFA 2CFYA 2ZZCA 4EM3A 2EQ9A 2GH5A 2BC0A 2NPXA 1XHCA 5KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2I A;  5JRB A;  1KN0 A; 
#chains in the Genus database with same CATH topology
 2FKP A;  3DK8 A;  4G8T A;  1ZK7 A;  1FEB A;  1EC8 A;  2HNE A;  2OX4 A;  1V97 A;  3UXL A;  4H4P A;  1GRH A;  3UJ2 A;  2PMQ A;  1JDF A;  1ONF A;  2HQM A;  3IJI A;  2W55 A;  4IZG A;  4HNL A;  1SJD A;  3DES A;  2AL2 A;  1MDL A;  1XDI A;  2V3B A;  4H4Z A;  1SB3 B;  1KD0 A;  3EAN A;  3ZVH B;  2GRT A;  1JEH A;  2MNR A;  4E5T A;  3FV9 A;  2ZZB A;  1N62 C;  3DG3 A;  4H83 A;  1NEL A;  3ES7 A;  1P43 A;  4ZCW A;  3TJI A;  3OPS A;  2FYM A;  2TPR A;  3OTR A;  4FP1 A;  2YQU A;  1T3Q C;  3D9X A;  3EEZ A;  4H4T A;  2WP5 A;  3DJG X;  3S5S A;  2AL1 A;  4KPL A;  3R0K A;  2HXT A;  4GYP A;  2EQ6 A;  3BOX A;  3GY1 A;  4H4R A;  1KKO A;  1MOK A;  3AMZ A;  2DW7 A;  1BQG A;  3NXL A;  3SR6 B;  3FCP A;  4EM4 A;  5JCM A;  4DYE A;  3DH9 A;  3FXG A;  4FDC B;  2BC1 A;  3O0H A;  4GME A;  4H4Q A;  1WUE A;  5FS7 A;  2P8B A;  2OQY A;  2GDQ A;  3GO2 A;  3OZM A;  1X2G A;  1ELS A;  4K2S A;  2XSX A;  4A3R A;  4M6U A;  5FS9 A;  1NDA A;  2AAQ A;  2YVJ A;  4GFI A;  2AL2 B;  2W3S A;  2WOW A;  3JVA A;  2PGW A;  3K1G A;  3RGT A;  1XAN A;  4A6G A;  3U4F A;  3SN0 A;  4Z17 A;  4HYR A;  1MNS A;  2OLA A;  3CGD A;  4HNC A;  1EBG A;  3TQP A;  2A8X A;  2OQH A;  4GYP C;  4J3Z A;  2QDD A;  3H8A A;  3QPE A;  5JCK A;  1LVL A;  3TOY A;  4ZA0 A;  3OP2 A;  4JQ9 A;  3UJF A;  3NO1 A;  3V5C A;  5FJP A;  2XH0 A;  2E3T A;  4HN8 A;  4KEM A;  3ZLG A;  3ZLF A;  5JCN A;  3VC5 A;  2XH2 A;  2GGG A;  3MQT A;  3UXK A;  3DK9 A;  1PDY A;  3NS1 B;  3CGB A;  1FEC A;  4GRT A;  1N5W C;  4H2H A;  3LAD A;  1NHS A;  3VA8 A;  2EQ9 A;  2GH5 A;  4IT1 A;  3RRA A;  3S47 A;  1TKK A;  4K7Z A;  3DGH A;  3EAO A;  1GRA A;  5FJO A;  2RAB A;  1X2H A;  4H4V A;  1V59 A;  3NZG A;  2HXU A;  4TVW A;  2OVL A;  3I6T A;  5FS6 A;  1TZZ A;  3MSY A;  3ZVI A;  1F3P A;  1VDV A;  2WP6 A;  2P3Z A;  3EKG A;  3KUM A;  1E9I A;  3IC9 A;  3QFB A;  4J57 A;  1W6T A;  1H2I A;  1S7M A;  1ZX9 A;  3PWG A;  3RNM A;  4H1Z A;  2W0H A;  1GRB A;  3HRD C;  4EMW A;  2PA6 A;  2W54 A;  2WPE A;  3CYJ A;  2PP0 A;  2QAE A;  3TCS A;  5JCL A;  2P0I A;  2GGJ A;  4E6M A;  2PTZ A;  1NU5 A;  1RVK A;  3U9I A;  3HPF A;  1Q1W A;  5G5H B;  7ENL A;  1SJC A;  2OG9 A;  3A7A A;  2X8H A;  3ENL A;  4K8D A;  1FHV A;  3THU A;  5FJT A;  2QJJ A;  1R6W A;  1DNC A;  3TWA A;  4EMI A;  1XS2 A;  4NEW A;  4DX3 A;  2WOV A;  5TR3 A;  1L8P A;  4DWD A;  2P88 A;  3IJL A;  3TW9 A;  4MGG A;  4YWO A;  4EQS A;  3NVZ B;  1ECQ A;  1ZXI C;  1GV4 A;  4TVY A;  2WOI A;  4H4Y A;  1GXF A;  2X99 A;  2NQL A;  1SJA A;  1NHQ A;  1FEA A;  2OO6 A;  2GGE A;  2O56 A;  1N60 C;  2ONE A;  3ETR B;  2OZT A;  2C3C A;  1OEP A;  3DGZ A;  3ES8 A;  3NRZ B;  1GER A;  1EBH A;  1MUC A;  2YVF A;  1BWC A;  1EC9 A;  2OPJ A;  1SJB A;  2F5Z A;  5KVI A;  1RM6 B;  3DDM A;  3PFR A;  2XH4 A;  3MKC A;  3GRS A;  3L8K A;  1MRA A;  3STP A;  3TJ4 A;  1K4Q A;  2GL5 A;  2QDE A;  1WUF A;  2V3A A;  5JCI A;  4Z1Y A;  4IP4 A;  3QLD A;  5FMH A;  5BOE A;  2DW6 A;  3SQS A;  3N4F A;  4BUR A;  3B9J B;  1M6I A;  2QQ6 A;  2CFY A;  2ZZC A;  3UJR A;  1TE6 A;  1XHC A;  3DEQ A;  1DTN A;  3QFA A;  3N4E A;  3CGE A;  5U25 A;  3Q45 A;  4M52 A;  2PTY A;  3I6E A;  4H4X A;  2GGH A;  2PTW A;  5BOF A;  2WPF A;  1N61 C;  4LII A;  3MZN A;  3V5F A;  4LA1 A;  2EQ7 A;  3P93 A;  1FFV C;  3H4K A;  2CHR A;  3CT2 A;  4NEV A;  3Q4D A;  1YEY A;  3FVD A;  3OW1 A;  3SQP A;  3DFY A;  4H4S A;  4HCH A;  3H12 A;  1JPM A;  4K1W A;  5FS8 A;  3CXB A;  4EMJ A;  3N6H A;  2PP3 A;  2R9Z A;  3MY9 A;  3NVW B;  4EQW A;  1KN0 A;  3PK7 A;  1KCZ A;  1YQZ A;  4JHM A;  3D47 A;  1MO9 A;  1FFU C;  3UCC A;  2BCP A;  2PTX A;  4H50 A;  4HCL A;  3DGB A;  4ADW A;  2OZ3 A;  1Q1R A;  4A35 A;  2YAU A;  4GGH A;  1TYP A;  2WPC A;  3L5O A;  3VCC A;  3GD3 A;  2X50 A;  3SN1 A;  2RDX A;  1GSN A;  3Q6J A;  5U1O A;  3VFC A;  1ZMC A;  4E8G A;  3UJS A;  1NPX A;  1GRF A;  3UJE A;  2J3N A;  3QTP A;  3LB8 A;  4FI4 A;  4EQX A;  2PGE A;  3AM9 A;  3P3B A;  2GGI A;  2AKM A;  1F8W A;  3RIT A;  2WBA A;  3LXD A;  2V6O A;  4M0X A;  3HW2 A;  1MDR A;  4IHC A;  2ZAD A;  4GIS A;  2X8G A;  1ZMD A;  1D7Y A;  5EU9 A;  4JN8 A;  2OZ8 A;  3IJQ A;  4ZOH B;  2PSN A;  1OJT A;  1TYT A;  2GQW A;  3SN4 A;  4HPN A;  4H4U A;  6ENL A;  3DFH A;  3CK5 A;  3DIP A;  1JRO A;  2MUC A;  3VC6 A;  4FX9 A;  3FYY A;  1BZL A;  4APN A;  3P0W A;  3NVY B;  1STZ A;  2P8C A;  3DG7 A;  4IL2 A;  5J04 A;  3MWC A;  4JDR A;  1KKR A;  5ENL A;  1JOA A;  1GEU A;  1PDZ A;  3UGV A;  1AOG A;  4EQR A;  2PS2 A;  5ER0 A;  4EM3 A;  1XPY A;  3OZY A;  3T6C A;  2BC0 A;  1P48 A;  1FHU A;  5IDZ A;  4DXK A;  4G7F A;  1DXL A;  1IYX A;  2AKZ A;  2PP1 A;  2XH7 A;  3VCN A;  1F9C A;  4EWJ A;  3OC4 A;  2I5Q A;  3DK4 A;  1GET A;  1NHR A;  2GR2 A;  2QJN A;  2POD A;  4K8G A;  3PWI A;  1H6V A;  3IK4 A;  4GR1 A;  1EBD A;  3GD4 A;  1ONE A;  2QGY A;  4IP5 A;  4F4R A;  2GR0 A;  2X8C A;  1N5X A;  1GES A;  3QN3 A;  3ZLH A;  3SJN A;  3EF6 A;  3V4B A;  2PU1 A;  3CB3 A;  3SSZ A;  3FJ4 A;  5JRB A;  3N6J A;  3GD6 A;  1JRP A;  4GIR A;  2GR3 A;  3PG6 A;  3DG6 A;  3H70 A;  3AN1 A;  2GSH A;  3II4 A;  3RR1 A;  4KPR A;  1JCT A;  2YVG A;  3DJJ A;  3GRT A;  3UCD A;  4H4W A;  3DER A;  3MUC A;  3I4K A;  3NFU A;  2E5A A;  4X2P A;  3R10 A;  2GR1 A;  3TTE A;  2EQ8 A;  2HZG A;  4ROP A;  4J56 A;  3T8Q A;  1GRG A;  3B97 A;  3EUB 3;  1FIQ B;  3FG2 P;  1R0M A;  2ZZ0 A;  2NVK X;  4IL0 A;  5G5G B;  1GRT A;  3SBF A;  1JPD X;  5FJU A;  4E4U A;  3QKE A;  3A7R A;  3GC2 A;  2CDU A;  1ZDL A;  4JN7 A;  1ZY8 A;  5GRT A;  3TWB A;  4E4F A;  3T4W A;  4KT2 A;  4DHG A;  1WYG A;  1EC7 A;  2PPG A;  4DN1 A;  1VQZ A;  1NHP A;  3BSM A;  4ENL A;  2W3R A;  4YWS A;  1N63 C;  4H19 A;  1GRE A;  3KLJ A;  3JW7 A;  2PCE A;  1ZKQ A;  5EBK A;  5FJR A;  3ZVH A;  3JZU A;  3R25 A;  3RCY A;  4MKS A;  2QVH A;  3R07 C;  3R11 A;  2JK6 A;  3URH A;  4J1O A;  4GGB A;  3CXO A;  2XGZ A;  3BJS A;  3D46 A;  1BKH A;  2POZ A;  4BV6 A;  2OFJ A;  3CAW A;  4KWS A;  3A7U A;  3RO6 A;  3R0U A;  2QJM A;  4DNA A;  4HCD A;  2ZC8 A;  2C3D A;  3VDG A;  3V3W A;  2OKT A;  3CGC A;  3R1Z A;  2PU0 A;  3T9P A;  3H7V A;  1LPF A;  3NVV B;  1FO4 A;  2NPX A;  4MMW A;  5KVH A; 
#chains in the Genus database with same CATH homology
 3DGH A;  3DK8 A;  3QFA A;  1ZK7 A;  1DXL A;  1FEB A;  3CGE A;  1GRA A;  3EAO A;  2RAB A;  5U25 A;  4M52 A;  4H4V A;  1V59 A;  4H4X A;  4H4P A;  1GRH A;  2WPF A;  4LII A;  1ONF A;  2HQM A;  5FS6 A;  3OC4 A;  3DK4 A;  1F3P A;  1GET A;  1NHR A;  2GR2 A;  2WP6 A;  1XDI A;  3QFB A;  3IC9 A;  4LA1 A;  2EQ7 A;  2V3B A;  1H6V A;  4H4Z A;  3H4K A;  1EBD A;  4GR1 A;  3EAN A;  4J57 A;  4NEV A;  1H2I A;  1S7M A;  1ZX9 A;  3GD4 A;  2GRT A;  1JEH A;  3RNM A;  2W0H A;  1GRB A;  2GR0 A;  3SQP A;  2X8C A;  2ZZB A;  4H4S A;  1GES A;  5FS8 A;  4EMJ A;  3EF6 A;  4EMW A;  2WPE A;  2TPR A;  5JRB A;  2YQU A;  2R9Z A;  2QAE A;  2GR3 A;  3PG6 A;  5JCL A;  3D9X A;  4H4T A;  2WP5 A;  4EQW A;  3DJG X;  1KN0 A;  1Q1W A;  1YQZ A;  3II4 A;  1MO9 A;  2X8H A;  4KPR A;  4K8D A;  2BCP A;  2EQ6 A;  2YVG A;  4H50 A;  4H4R A;  4ADW A;  3DJJ A;  3GRT A;  1MOK A;  4H4W A;  1Q1R A;  4EM4 A;  2YAU A;  5JCM A;  3DH9 A;  1TYP A;  1DNC A;  2WPC A;  3L5O A;  4FDC B;  2BC1 A;  4EMI A;  3GD3 A;  3O0H A;  2X50 A;  4H4Q A;  5FS7 A;  4NEW A;  2GR1 A;  2EQ8 A;  1GSN A;  3Q6J A;  5U1O A;  4K7Z A;  1ZMC A;  2WOV A;  4J56 A;  1GRG A;  1NPX A;  5TR3 A;  1GRF A;  3FG2 P;  2J3N A;  3LB8 A;  4EQX A;  2ZZ0 A;  2NVK X;  5FS9 A;  1NDA A;  2AAQ A;  2YVJ A;  4YWO A;  1GRT A;  2WOW A;  4EQS A;  1F8W A;  1GV4 A;  2WOI A;  4H4Y A;  1XAN A;  1GXF A;  2X99 A;  2WBA A;  2CDU A;  2V6O A;  1ZDL A;  1NHQ A;  3LXD A;  1FEA A;  1ZY8 A;  5GRT A;  3CGD A;  2A8X A;  2X8G A;  1ZMD A;  1NHP A;  1D7Y A;  2C3C A;  5JCK A;  1LVL A;  3DGZ A;  1GRE A;  1OJT A;  4JQ9 A;  1TYT A;  2GQW A;  3KLJ A;  1GER A;  1ZKQ A;  5EBK A;  4H4U A;  2JK6 A;  3URH A;  2YVF A;  1BWC A;  4FX9 A;  2F5Z A;  1BZL A;  5KVI A;  4APN A;  5JCN A;  4BV6 A;  3GRS A;  3L8K A;  4JDR A;  1K4Q A;  2V3A A;  3DK9 A;  5JCI A;  1JOA A;  1GEU A;  4DNA A;  5FMH A;  1AOG A;  2C3D A;  4EQR A;  3CGB A;  1FEC A;  4GRT A;  3CGC A;  4BUR A;  5ER0 A;  1M6I A;  3LAD A;  1NHS A;  1LPF A;  2CFY A;  2ZZC A;  4EM3 A;  2EQ9 A;  2GH5 A;  2BC0 A;  2NPX A;  1XHC A;  5KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...