5JRBA

Rad52(1-212) k102a/k133a/e202a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEAARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD52 homolog
publication title Structure of the human DNA-repair protein RAD52 containing surface mutations
doi rcsb
source organism Homo sapiens
total genus 51
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jrbA01
1H2IA 5JRBA 1KN0A
chains in the Genus database with same CATH superfamily
1SJBA 3TW9A 2FKPA 1GEUA 2QJMA 2QAEA 3P3BA 1JDFA 1GETA 1TZZA 2NPXA 3CGDA 2AKMA 1RM6B 1STZA 1XHCA 2WPCA 3DGZA 3FXGA 1N62C 1LVLA 3ZLGA 2AAQA 2RDXA 4H4TA 3PFRA 3VFCA 1X2HA 1ZDLA 4JHMA 3UJRA 3CXBA 1KKOA 1Q1WA 3S47A 3H4KA 3CT2A 3PG6A 3V5FA 3ZLFA 3OZYA 4JDRA 2J3NA 3GC2A 1ZY8A 4FP1A 3IJLA 4H4WA 2W55A 3HRDC 4IHCA 3SJNA 2PTYA 3IJQA 1PDYA 2EQ7A 2PP3A 1NU5A 1MRAA 3SN1A 3U9IA 3GD3A 4A3RA 4KT2A 3NO1A 2W54A 1GXFA 2I5QA 3EANA 4HPNA 1T3QC 2QDDA 4H4XA 3QKEA 1TE6A 3UXKA 4J3ZA 2X8GA 1GERA 1SJCA 3A7RA 1WUEA 2GR1A 1FO4A 3T6CA 3VCNA 2OO6A 4E4FA 3BOXA 3OPSA 4H4ZA 2V3BA 3SSZA 2HXUA 3RGTA 3NVZB 2OLAA 4DHGA 2YVGA 3D9XA 3FV9A 1M6IA 2WP5A 3II4A 3FVDA 4MMWA 2WOWA 5FS8A 2POZA 1KN0A 2PS2A 1DTNA 1NELA 2GL5A 2ZADA 1SJDA 3IK4A 3DK4A 5TR3A 1JPDX 3DJJA 3ETRB 1RVKA 2GGHA 5ENLA 4H4SA 4DN1A 1NDAA 2OX4A 2AL2B 5FS6A 1GRBA 2OQHA 3DERA 4Z1YA 5FJPA 3R11A 3DDMA 1GRHA 2NVKX 3CAWA 3Q45A 4LIIA 4GFIA 4ZOHB 2HNEA 3OZMA 1NHRA 1WYGA 4GISA 1BKHA 1LPFA 4EM3A 1YEYA 1VDVA 4X2PA 4F4RA 4ENLA 5JCNA 4ZA0A 3H70A 3BJSA 1ZK7A 2RABA 1KCZA 3N4FA 1DNCA 3A7AA 1FFVC 1FHUA 1P48A 2GQWA 3OP2A 5JCIA 3H7VA 2EQ6A 3FYYA 4E8GA 4A35A 1NHPA 1VQZA 2V3AA 2OG9A 3STPA 2PTZA 3QFBA 3RRAA 1AOGA 2PGWA 1FFUC 5JRBA 3FJ4A 4KEMA 1IYXA 5G5HB 2P88A 3ZVIA 2GR2A 4H4VA 1WUFA 1D7YA 1EBGA 1EC8A 1FIQB 2QJNA 3GO2A 2OPJA 4HCDA 4J57A 4K8DA 3L5OA 2XGZA 4HCLA 2OKTA 5FJRA 4K2SA 4IL0A 3R10A 3DK9A 1S7MA 3OTRA 3SN0A 1BQGA 2XSXA 2XH7A 3P93A 2GGEA 4EM4A 3OW1A 7ENLA 1GESA 2BC0A 2GH5A 2PP1A 2CHRA 3QLDA 3CGBA 2AL1A 3EF6A 2OVLA 3UJFA 1EC7A 1BWCA 2YVJA 1JPMA 3TJIA 4M0XA 3HPFA 5EBKA 3IJIA 3MSYA 3FCPA 4IZGA 3MWCA 3TCSA 2QVHA 3SQSA 4IP5A 4LA1A 3N6HA 1NHSA 2QGYA 3KLJA 5KVIA 1FEAA 3VA8A 3MY9A 3GY1A 2P8CA 4GRTA 5JCKA 3R1ZA 3L8KA 3EUB3 2YQUA 3H12A 3RITA 4BURA 2DW7A 3AMZA 3JZUA 1N60C 1XPYA 2PPGA 2GDQA 3O0HA 4NEVA 4BV6A 4DXKA 3LXDA 2W3RA 1L8PA 3JW7A 4H4RA 2PP0A 1N61C 3LB8A 4DYEA 1ECQA 1FEBA 5FJOA 1F9CA 1PDZA 3LADA 2C3DA 3A7UA 2PODA 3NRZB 5G5GB 3BSMA 1ONEA 3DFYA 2CFYA 1V97A 2JK6A 1EC9A 1P43A 4M52A 4EMIA 1JROA 3DEQA 3NZGA 1TYPA 2XH2A 3MKCA 4GYPA 4KPRA 5FJUA 2ONEA 3FG2P 1GREA 1OEPA 2BC1A 2NQLA 3V4BA 4E6MA 2OFJA 3SR6B 2ZC8A 4H1ZA 4GIRA 4IL2A 1NHQA 4HNLA 2DW6A 3ENLA 3TQPA 3CYJA 2GR0A 3T8QA 3R0KA 1KD0A 3GRTA 2P0IA 4IT1A 3VCCA 3PWIA 1FHVA 4JN7A 2HXTA 3Q6JA 1N63C 3UJ2A 4EMWA 3PWGA 3DGBA 2X50A 4H4QA 3U4FA 1H6VA 3UXLA 4GGHA 3CGCA 3GD4A 5GRTA 2F5ZA 1V59A 2WBAA 4K8GA 1K4QA 3UCCA 5BOEA 3SQPA 2CDUA 5KVHA 1ZX9A 2E3TA 4YWSA 3P0WA 4H19A 6ENLA 3I6TA 2X8HA 5FMHA 1MNSA 4HNCA 2ZZBA 3NS1B 3GRSA 4J1OA 3R25A 1JOAA 2OQYA 4K7ZA 3PK7A 1GRGA 2AKZA 2GSHA 1JRPA 2E5AA 3MZNA 1KKRA 5JCLA 1ZMDA 2PCEA 2YAUA 3VDGA 3URHA 2YVFA 2HZGA 1H2IA 3SN4A 1XANA 4GMEA 1XDIA 4GGBA 3UGVA 2GR3A 3QTPA 1MDLA 1EBHA 3R07C 4K1WA 3UJEA 2OZTA 4GYPC 3VC5A 1ZXIC 1W6TA 4HCHA 2A8XA 2GGJA 5FS7A 3V5CA 4YWOA 4EQXA 1JEHA 3D46A 4M6UA 3RR1A 1ZMCA 2W3SA 2ZZCA 4TVYA 4FI4A 3S5SA 2PTWA 1GV4A 4H4PA 5FJTA 2WPEA 3NVWB 3ZVHA 2PSNA 1OJTA 3JVAA 2TPRA 5U25A 1FECA 2OZ3A 2PTXA 2PA6A 2QQ6A 4HN8A 4ZCWA 3H8AA 4EMJA 3NVVB 2P8BA 1DXLA 2PU0A 2XH0A 2GRTA 4NEWA 4TVWA 3OC4A 2PMQA 2EQ9A 2XH4A 4FX9A 4ROPA 1SJAA 3SBFA 3KUMA 1NPXA 3ZLHA 2MNRA 3B97A 1MOKA 1YQZA 1XS2A 2QDEA 4JQ9A 4APNA 3I4KA 2QJJA 3D47A 2X8CA 3RNMA 2FYMA 3QPEA 3R0UA 3TWAA 3RO6A 3CGEA 4KPLA 2PU1A 1Q1RA 4Z17A 2WP6A 3GD6A 3NVYB 1EBDA 3DJGX 3B9JB 3CK5A 3ES7A 5U1OA 3T9PA 3T4WA 4DNAA 3UJSA 2W0HA 4KWSA 1N5WC 4J56A 4EQSA 1F8WA 2X99A 2WOIA 4EQWA 3AN1A 4DX3A 3EKGA 3AM9A 1R0MA 1SB3B 5ER0A 2MUCA 3DGHA 3EAOA 3UCDA 4E5TA 3TJ4A 3IC9A 3N4EA 1ZKQA 1E9IA 1MUCA 3DESA 4MKSA 2EQ8A 1N5XA 1X2GA 3ES8A 4HYRA 2P3ZA 4A6GA 3CXOA 5BOFA 1BZLA 5J04A 3DG3A 3TOYA 3MQTA 5FS9A 2ZZ0A 1MDRA 3TWBA 1TYTA 3DH9A 2O56A 4MGGA 2V6OA 3VC6A 3DG6A 3QN3A 3V3WA 4DWDA 4GR1A 2BCPA 2WOVA 4E4UA 3DIPA 3HW2A 3MUCA 3THUA 1JCTA 3DFHA 1GRFA 4H4UA 3ZVHB 4ADWA 1MO9A 4JN8A 3CB3A 3NXLA 4H2HA 2GGIA 2HQMA 4H83A 4G8TA 1F3PA 4G7FA 5JCMA 4EWJA 3Q4DA 1GSNA 3K1GA 3DK8A 1TKKA 3I6EA 3NFUA 1GRAA 4FDCB 3DG7A 4EQRA 3TTEA 1GRTA 2GGGA 3EEZA 3QFAA 1R6WA 2PGEA 4H50A 2AL2A 1ONFA 2WPFA 4IP4A 3N6JA 2R9ZA 4H4YA 2C3CA 5EU9A 3RCYA 1ELSA 5IDZA 2OZ8A
chains in the Genus database with same CATH topology
4NEWA 2GRTA 1DNCA 3OC4A 1TYPA 1GEUA 4KPRA 2EQ9A 2QAEA 3FG2P 4FX9A 1GETA 2GQWA 2NPXA 1GREA 1NPXA 2BC1A 5JCIA 3CGDA 1MOKA 2EQ6A 1YQZA 1XHCA 2WPCA 1NHPA 3DGZA 2V3AA 1NHQA 4JQ9A 4APNA 1LVLA 2AAQA 2GR0A 3QFBA 4H4TA 2X8CA 3RNMA 1ZDLA 1AOGA 3GRTA 3CGEA 5JRBA 1Q1RA 2WP6A 1EBDA 3DJGX 4DNAA 5U1OA 3Q6JA 2GR2A 4H4VA 1Q1WA 4EMWA 2W0HA 3H4KA 2X50A 4H4QA 1D7YA 3PG6A 1H6VA 4J56A 4EQSA 1F8WA 2X99A 2WOIA 3CGCA 2J3NA 4JDRA 1ZY8A 4EQWA 3GD4A 5GRTA 4H4WA 2F5ZA 1V59A 2WBAA 1K4QA 5ER0A 2CDUA 4J57A 4K8DA 3SQPA 3L5OA 1ZX9A 5KVHA 2EQ7A 3DGHA 3EAOA 3IC9A 1ZKQA 2X8HA 3GD3A 5FMHA 3DK9A 1GXFA 1S7MA 2ZZBA 3GRSA 3EANA 1JOAA 4H4XA 2EQ8A 4K7ZA 1GRGA 2X8GA 1GERA 2GR1A 5JCLA 1ZMDA 1BZLA 4EM4A 4H4ZA 2YAUA 5FS9A 1GESA 2V3BA 3URHA 2YVFA 2ZZ0A 1H2IA 2BC0A 2GH5A 1TYTA 3CGBA 1XANA 3DH9A 3EF6A 2V6OA 1XDIA 2YVGA 3D9XA 1M6IA 2GR3A 2BCPA 2WOVA 2WP5A 3II4A 4GR1A 4M52A 1BWCA 2WOWA 1GRFA 2YVJA 5FS8A 1KN0A 2A8XA 4H4UA 4ADWA 1MO9A 5EBKA 5FS7A 4YWOA 4EQXA 1JEHA 3DK4A 5TR3A 2HQMA 3DJJA 4LA1A 1F3PA 5JCMA 4H4SA 1NDAA 1NHSA 3KLJA 1GSNA 5FS6A 1GRBA 1FEAA 1ZMCA 3DK8A 5KVIA 2ZZCA 4GRTA 1GRHA 2NVKX 5JCKA 3L8KA 1GV4A 4H4PA 4LIIA 2YQUA 2WPEA 1GRAA 4BURA 3O0HA 4NEVA 4FDCB 4BV6A 4EQRA 1OJTA 1NHRA 3LXDA 1GRTA 2TPRA 4EM3A 1LPFA 1FECA 5U25A 4H4RA 3QFAA 3LB8A 4H50A 1FEBA 1ONFA 2WPFA 3LADA 5JCNA 2C3DA 2R9ZA 4H4YA 2C3CA 4EMJA 2CFYA 1DXLA 2JK6A 4EMIA 1ZK7A 2RABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2I A;  5JRB A;  1KN0 A; 
#chains in the Genus database with same CATH topology
 1SJB A;  3TW9 A;  2FKP A;  1GEU A;  2QJM A;  2QAE A;  3P3B A;  1JDF A;  1GET A;  1TZZ A;  2NPX A;  3CGD A;  2AKM A;  1RM6 B;  1STZ A;  1XHC A;  2WPC A;  3DGZ A;  3FXG A;  1N62 C;  1LVL A;  3ZLG A;  2AAQ A;  2RDX A;  4H4T A;  3PFR A;  3VFC A;  1X2H A;  1ZDL A;  4JHM A;  3UJR A;  3CXB A;  1KKO A;  1Q1W A;  3S47 A;  3H4K A;  3CT2 A;  3PG6 A;  3V5F A;  3ZLF A;  3OZY A;  4JDR A;  2J3N A;  3GC2 A;  1ZY8 A;  4FP1 A;  3IJL A;  4H4W A;  2W55 A;  3HRD C;  4IHC A;  3SJN A;  2PTY A;  3IJQ A;  1PDY A;  2EQ7 A;  2PP3 A;  1NU5 A;  1MRA A;  3SN1 A;  3U9I A;  3GD3 A;  4A3R A;  4KT2 A;  3NO1 A;  2W54 A;  1GXF A;  2I5Q A;  3EAN A;  4HPN A;  1T3Q C;  2QDD A;  4H4X A;  3QKE A;  1TE6 A;  3UXK A;  4J3Z A;  2X8G A;  1GER A;  1SJC A;  3A7R A;  1WUE A;  2GR1 A;  1FO4 A;  3T6C A;  3VCN A;  2OO6 A;  4E4F A;  3BOX A;  3OPS A;  4H4Z A;  2V3B A;  3SSZ A;  2HXU A;  3RGT A;  3NVZ B;  2OLA A;  4DHG A;  2YVG A;  3D9X A;  3FV9 A;  1M6I A;  2WP5 A;  3II4 A;  3FVD A;  4MMW A;  2WOW A;  5FS8 A;  2POZ A;  1KN0 A;  2PS2 A;  1DTN A;  1NEL A;  2GL5 A;  2ZAD A;  1SJD A;  3IK4 A;  3DK4 A;  5TR3 A;  1JPD X;  3DJJ A;  3ETR B;  1RVK A;  2GGH A;  5ENL A;  4H4S A;  4DN1 A;  1NDA A;  2OX4 A;  2AL2 B;  5FS6 A;  1GRB A;  2OQH A;  3DER A;  4Z1Y A;  5FJP A;  3R11 A;  3DDM A;  1GRH A;  2NVK X;  3CAW A;  3Q45 A;  4LII A;  4GFI A;  4ZOH B;  2HNE A;  3OZM A;  1NHR A;  1WYG A;  4GIS A;  1BKH A;  1LPF A;  4EM3 A;  1YEY A;  1VDV A;  4X2P A;  4F4R A;  4ENL A;  5JCN A;  4ZA0 A;  3H70 A;  3BJS A;  1ZK7 A;  2RAB A;  1KCZ A;  3N4F A;  1DNC A;  3A7A A;  1FFV C;  1FHU A;  1P48 A;  2GQW A;  3OP2 A;  5JCI A;  3H7V A;  2EQ6 A;  3FYY A;  4E8G A;  4A35 A;  1NHP A;  1VQZ A;  2V3A A;  2OG9 A;  3STP A;  2PTZ A;  3QFB A;  3RRA A;  1AOG A;  2PGW A;  1FFU C;  5JRB A;  3FJ4 A;  4KEM A;  1IYX A;  5G5H B;  2P88 A;  3ZVI A;  2GR2 A;  4H4V A;  1WUF A;  1D7Y A;  1EBG A;  1EC8 A;  1FIQ B;  2QJN A;  3GO2 A;  2OPJ A;  4HCD A;  4J57 A;  4K8D A;  3L5O A;  2XGZ A;  4HCL A;  2OKT A;  5FJR A;  4K2S A;  4IL0 A;  3R10 A;  3DK9 A;  1S7M A;  3OTR A;  3SN0 A;  1BQG A;  2XSX A;  2XH7 A;  3P93 A;  2GGE A;  4EM4 A;  3OW1 A;  7ENL A;  1GES A;  2BC0 A;  2GH5 A;  2PP1 A;  2CHR A;  3QLD A;  3CGB A;  2AL1 A;  3EF6 A;  2OVL A;  3UJF A;  1EC7 A;  1BWC A;  2YVJ A;  1JPM A;  3TJI A;  4M0X A;  3HPF A;  5EBK A;  3IJI A;  3MSY A;  3FCP A;  4IZG A;  3MWC A;  3TCS A;  2QVH A;  3SQS A;  4IP5 A;  4LA1 A;  3N6H A;  1NHS A;  2QGY A;  3KLJ A;  5KVI A;  1FEA A;  3VA8 A;  3MY9 A;  3GY1 A;  2P8C A;  4GRT A;  5JCK A;  3R1Z A;  3L8K A;  3EUB 3;  2YQU A;  3H12 A;  3RIT A;  4BUR A;  2DW7 A;  3AMZ A;  3JZU A;  1N60 C;  1XPY A;  2PPG A;  2GDQ A;  3O0H A;  4NEV A;  4BV6 A;  4DXK A;  3LXD A;  2W3R A;  1L8P A;  3JW7 A;  4H4R A;  2PP0 A;  1N61 C;  3LB8 A;  4DYE A;  1ECQ A;  1FEB A;  5FJO A;  1F9C A;  1PDZ A;  3LAD A;  2C3D A;  3A7U A;  2POD A;  3NRZ B;  5G5G B;  3BSM A;  1ONE A;  3DFY A;  2CFY A;  1V97 A;  2JK6 A;  1EC9 A;  1P43 A;  4M52 A;  4EMI A;  1JRO A;  3DEQ A;  3NZG A;  1TYP A;  2XH2 A;  3MKC A;  4GYP A;  4KPR A;  5FJU A;  2ONE A;  3FG2 P;  1GRE A;  1OEP A;  2BC1 A;  2NQL A;  3V4B A;  4E6M A;  2OFJ A;  3SR6 B;  2ZC8 A;  4H1Z A;  4GIR A;  4IL2 A;  1NHQ A;  4HNL A;  2DW6 A;  3ENL A;  3TQP A;  3CYJ A;  2GR0 A;  3T8Q A;  3R0K A;  1KD0 A;  3GRT A;  2P0I A;  4IT1 A;  3VCC A;  3PWI A;  1FHV A;  4JN7 A;  2HXT A;  3Q6J A;  1N63 C;  3UJ2 A;  4EMW A;  3PWG A;  3DGB A;  2X50 A;  4H4Q A;  3U4F A;  1H6V A;  3UXL A;  4GGH A;  3CGC A;  3GD4 A;  5GRT A;  2F5Z A;  1V59 A;  2WBA A;  4K8G A;  1K4Q A;  3UCC A;  5BOE A;  3SQP A;  2CDU A;  5KVH A;  1ZX9 A;  2E3T A;  4YWS A;  3P0W A;  4H19 A;  6ENL A;  3I6T A;  2X8H A;  5FMH A;  1MNS A;  4HNC A;  2ZZB A;  3NS1 B;  3GRS A;  4J1O A;  3R25 A;  1JOA A;  2OQY A;  4K7Z A;  3PK7 A;  1GRG A;  2AKZ A;  2GSH A;  1JRP A;  2E5A A;  3MZN A;  1KKR A;  5JCL A;  1ZMD A;  2PCE A;  2YAU A;  3VDG A;  3URH A;  2YVF A;  2HZG A;  1H2I A;  3SN4 A;  1XAN A;  4GME A;  1XDI A;  4GGB A;  3UGV A;  2GR3 A;  3QTP A;  1MDL A;  1EBH A;  3R07 C;  4K1W A;  3UJE A;  2OZT A;  4GYP C;  3VC5 A;  1ZXI C;  1W6T A;  4HCH A;  2A8X A;  2GGJ A;  5FS7 A;  3V5C A;  4YWO A;  4EQX A;  1JEH A;  3D46 A;  4M6U A;  3RR1 A;  1ZMC A;  2W3S A;  2ZZC A;  4TVY A;  4FI4 A;  3S5S A;  2PTW A;  1GV4 A;  4H4P A;  5FJT A;  2WPE A;  3NVW B;  3ZVH A;  2PSN A;  1OJT A;  3JVA A;  2TPR A;  5U25 A;  1FEC A;  2OZ3 A;  2PTX A;  2PA6 A;  2QQ6 A;  4HN8 A;  4ZCW A;  3H8A A;  4EMJ A;  3NVV B;  2P8B A;  1DXL A;  2PU0 A;  2XH0 A;  2GRT A;  4NEW A;  4TVW A;  3OC4 A;  2PMQ A;  2EQ9 A;  2XH4 A;  4FX9 A;  4ROP A;  1SJA A;  3SBF A;  3KUM A;  1NPX A;  3ZLH A;  2MNR A;  3B97 A;  1MOK A;  1YQZ A;  1XS2 A;  2QDE A;  4JQ9 A;  4APN A;  3I4K A;  2QJJ A;  3D47 A;  2X8C A;  3RNM A;  2FYM A;  3QPE A;  3R0U A;  3TWA A;  3RO6 A;  3CGE A;  4KPL A;  2PU1 A;  1Q1R A;  4Z17 A;  2WP6 A;  3GD6 A;  3NVY B;  1EBD A;  3DJG X;  3B9J B;  3CK5 A;  3ES7 A;  5U1O A;  3T9P A;  3T4W A;  4DNA A;  3UJS A;  2W0H A;  4KWS A;  1N5W C;  4J56 A;  4EQS A;  1F8W A;  2X99 A;  2WOI A;  4EQW A;  3AN1 A;  4DX3 A;  3EKG A;  3AM9 A;  1R0M A;  1SB3 B;  5ER0 A;  2MUC A;  3DGH A;  3EAO A;  3UCD A;  4E5T A;  3TJ4 A;  3IC9 A;  3N4E A;  1ZKQ A;  1E9I A;  1MUC A;  3DES A;  4MKS A;  2EQ8 A;  1N5X A;  1X2G A;  3ES8 A;  4HYR A;  2P3Z A;  4A6G A;  3CXO A;  5BOF A;  1BZL A;  5J04 A;  3DG3 A;  3TOY A;  3MQT A;  5FS9 A;  2ZZ0 A;  1MDR A;  3TWB A;  1TYT A;  3DH9 A;  2O56 A;  4MGG A;  2V6O A;  3VC6 A;  3DG6 A;  3QN3 A;  3V3W A;  4DWD A;  4GR1 A;  2BCP A;  2WOV A;  4E4U A;  3DIP A;  3HW2 A;  3MUC A;  3THU A;  1JCT A;  3DFH A;  1GRF A;  4H4U A;  3ZVH B;  4ADW A;  1MO9 A;  4JN8 A;  3CB3 A;  3NXL A;  4H2H A;  2GGI A;  2HQM A;  4H83 A;  4G8T A;  1F3P A;  4G7F A;  5JCM A;  4EWJ A;  3Q4D A;  1GSN A;  3K1G A;  3DK8 A;  1TKK A;  3I6E A;  3NFU A;  1GRA A;  4FDC B;  3DG7 A;  4EQR A;  3TTE A;  1GRT A;  2GGG A;  3EEZ A;  3QFA A;  1R6W A;  2PGE A;  4H50 A;  2AL2 A;  1ONF A;  2WPF A;  4IP4 A;  3N6J A;  2R9Z A;  4H4Y A;  2C3C A;  5EU9 A;  3RCY A;  1ELS A;  5IDZ A;  2OZ8 A; 
#chains in the Genus database with same CATH homology
 4NEW A;  2GRT A;  1DNC A;  3OC4 A;  1TYP A;  1GEU A;  4KPR A;  2EQ9 A;  2QAE A;  3FG2 P;  4FX9 A;  1GET A;  2GQW A;  2NPX A;  1GRE A;  1NPX A;  2BC1 A;  5JCI A;  3CGD A;  1MOK A;  2EQ6 A;  1YQZ A;  1XHC A;  2WPC A;  1NHP A;  3DGZ A;  2V3A A;  1NHQ A;  4JQ9 A;  4APN A;  1LVL A;  2AAQ A;  2GR0 A;  3QFB A;  4H4T A;  2X8C A;  3RNM A;  1ZDL A;  1AOG A;  3GRT A;  3CGE A;  5JRB A;  1Q1R A;  2WP6 A;  1EBD A;  3DJG X;  4DNA A;  5U1O A;  3Q6J A;  2GR2 A;  4H4V A;  1Q1W A;  4EMW A;  2W0H A;  3H4K A;  2X50 A;  4H4Q A;  1D7Y A;  3PG6 A;  1H6V A;  4J56 A;  4EQS A;  1F8W A;  2X99 A;  2WOI A;  3CGC A;  2J3N A;  4JDR A;  1ZY8 A;  4EQW A;  3GD4 A;  5GRT A;  4H4W A;  2F5Z A;  1V59 A;  2WBA A;  1K4Q A;  5ER0 A;  2CDU A;  4J57 A;  4K8D A;  3SQP A;  3L5O A;  1ZX9 A;  5KVH A;  2EQ7 A;  3DGH A;  3EAO A;  3IC9 A;  1ZKQ A;  2X8H A;  3GD3 A;  5FMH A;  3DK9 A;  1GXF A;  1S7M A;  2ZZB A;  3GRS A;  3EAN A;  1JOA A;  4H4X A;  2EQ8 A;  4K7Z A;  1GRG A;  2X8G A;  1GER A;  2GR1 A;  5JCL A;  1ZMD A;  1BZL A;  4EM4 A;  4H4Z A;  2YAU A;  5FS9 A;  1GES A;  2V3B A;  3URH A;  2YVF A;  2ZZ0 A;  1H2I A;  2BC0 A;  2GH5 A;  1TYT A;  3CGB A;  1XAN A;  3DH9 A;  3EF6 A;  2V6O A;  1XDI A;  2YVG A;  3D9X A;  1M6I A;  2GR3 A;  2BCP A;  2WOV A;  2WP5 A;  3II4 A;  4GR1 A;  4M52 A;  1BWC A;  2WOW A;  1GRF A;  2YVJ A;  5FS8 A;  1KN0 A;  2A8X A;  4H4U A;  4ADW A;  1MO9 A;  5EBK A;  5FS7 A;  4YWO A;  4EQX A;  1JEH A;  3DK4 A;  5TR3 A;  2HQM A;  3DJJ A;  4LA1 A;  1F3P A;  5JCM A;  4H4S A;  1NDA A;  1NHS A;  3KLJ A;  1GSN A;  5FS6 A;  1GRB A;  1FEA A;  1ZMC A;  3DK8 A;  5KVI A;  2ZZC A;  4GRT A;  1GRH A;  2NVK X;  5JCK A;  3L8K A;  1GV4 A;  4H4P A;  4LII A;  2YQU A;  2WPE A;  1GRA A;  4BUR A;  3O0H A;  4NEV A;  4FDC B;  4BV6 A;  4EQR A;  1OJT A;  1NHR A;  3LXD A;  1GRT A;  2TPR A;  4EM3 A;  1LPF A;  1FEC A;  5U25 A;  4H4R A;  3QFA A;  3LB8 A;  4H50 A;  1FEB A;  1ONF A;  2WPF A;  3LAD A;  5JCN A;  2C3D A;  2R9Z A;  4H4Y A;  2C3C A;  4EMJ A;  2CFY A;  1DXL A;  2JK6 A;  4EMI A;  1ZK7 A;  2RAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...