4KPLA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
404
structure length
384
Chain Sequence
b'SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
total genus 145
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kplA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kplA01
3NXLA 2OO6A 3OTRA 2OX4A 4MMWA 3ENLA 3MKCA 3CYJA 3OZYA 3THUA 3TQPA 3NZGA 3OP2A 4E5TA 3DERA 1P48A 3RO6A 4Z17A 3DG3A 3SBFA 1JPDX 4IL2A 4GMEA 1FHUA 2PTYA 2QVHA 3U9IA 4G7FA 3NFUA 4EWJA 1ELSA 2MNRA 1EC7A 2GGGA 2HXUA 4E8GA 3V5FA 3VC5A 3PFRA 1W6TA 3ZVIA 3UJ2A 4KPLA 3OPSA 3I4KA 3MUCA 3VCCA 5J04A 2QGYA 3GD6A 4DHGA 1R6WA 4GYPC 5IDZA 4DYEA 2HXTA 6ENLA 3CB3A 4DWDA 7ENLA 3FV9A 1MNSA 1MRAA 4A6GA 3DIPA 3VC6A 2OFJA 3R0KA 2AL2A 3ZLHA 3JW7A 2GSHA 3SQSA 3TOYA 2HZGA 1EC9A 3FCPA 3PK7A 3D46A 4FP1A 3H12A 3FYYA 1YEYA 3RGTA 1L8PA 2GGHA 1TE6A 1NU5A 3MY9A 3DFHA 3I6TA 3SN0A 2I5QA 2AKMA 3MWCA 2PTWA 2OZ3A 4DXKA 3OZMA 3TWAA 1BQGA 3QLDA 3VA8A 3UJRA 3QTPA 2OZ8A 2PP1A 2DW7A 4HCLA 2RDXA 3BOXA 2DW6A 3TCSA 5BOEA 3VCNA 3FVDA 1JCTA 4ROPA 3UJSA 2PCEA 3R11A 1XS2A 3TTEA 3ZLFA 3Q45A 4H83A 3K1GA 4GGHA 2OVLA 3NO1A 3T9PA 2NQLA 3IJIA 4ENLA 2GDQA 3STPA 3UGVA 3UJEA 3DESA 2PU0A 3VDGA 4DN1A 2QDEA 3UJFA 3CXOA 4HCDA 1JDFA 1FHVA 4X2PA 4GYPA 3R10A 3RCYA 4ZCWA 1WUEA 3EKGA 3SN1A 3B97A 2QJNA 4KT2A 3R25A 4F4RA 5FJRA 1EBHA 2PP3A 3DGBA 3UCDA 2GGEA 5ENLA 3ES7A 2P0IA 4H19A 3DEQA 2OQHA 2PGEA 3QPEA 4HYRA 2XH2A 5FJUA 2PODA 1SJDA 2ZC8A 2PTXA 5FJOA 3TJIA 2GGIA 2QJJA 3Q4DA 2P3ZA 4K1WA 4A35A 3DG7A 4MKSA 4GIRA 4HNCA 3N6HA 2XH4A 3SJNA 3BJSA 2PU1A 2OG9A 3V3WA 4HNLA 2XH7A 5FJTA 1IYXA 1PDYA 4KEMA 3MZNA 1E9IA 1MDLA 4IHCA 1R0MA 3PWGA 2OLAA 4ZA0A 4E4FA 3N4FA 4IP5A 2O56A 3IK4A 2QQ6A 4MGGA 1OEPA 2OZTA 4A3RA 5EU9A 2XH0A 4J1OA 2MUCA 1KKRA 1KCZA 1KKOA 3S5SA 3SN4A 1MDRA 4JN7A 4M0XA 4IT1A 3T6CA 3P0WA 4KWSA 3UCCA 2OKTA 3D47A 2HNEA 4HN8A 4H2HA 3R0UA 3QN3A 1BKHA 4GFIA 3ZLGA 5BOFA 3HPFA 3S47A 4M6UA 3RRAA 2P8BA 4G8TA 4K2SA 3U4FA 3KUMA 4IZGA 3CT2A 2OQYA 3T8QA 4IL0A 3R1ZA 3P93A 2P88A 1NELA 2PGWA 2CHRA 2ZADA 3VFCA 2PPGA 3FJ4A 3JZUA 3TW9A 3ZVHA 1P43A 2PMQA 3TWBA 4JHMA 3BSMA 4K8GA 3GY1A 4DX3A 1JPMA 3PWIA 2P8CA 2POZA 1WUFA 1ECQA 3IJLA 3MSYA 3V5CA 3ZVHB 2ONEA 3DFYA 3IJQA 3H8AA 3GO2A 3GC2A 4E6MA 3EEZA 3H7VA 3DG6A 2PSNA 2FYMA 1F9CA 3SSZA 1RVKA 4FI4A 2PP0A 1TKKA 1SJAA 2FKPA 1MUCA 3N6JA 4HCHA 2AL1A 3I6EA 4J3ZA 4YWSA 3UXLA 2GL5A 3ES8A 2QJMA 3TJ4A 3RR1A 2OPJA 3OW1A 4HPNA 2XGZA 2QDDA 3JVAA 2GGJA 1TZZA 3CAWA 3QKEA 2PA6A 2AL2B 3DDMA 1ONEA 3N4EA 3CK5A 3T4WA 3V4BA 4IP4A 3FXGA 2PS2A 4Z1YA 2AKZA 4JN8A 3MQTA 4GISA 5FJPA 4E4UA 4H1ZA 1EBGA 1DTNA 1XPYA 1KD0A 1SJBA 4GGBA 3RITA 3UXKA 1SJCA 1PDZA 3P3BA 2XSXA 2PTZA 3H70A 1EC8A
chains in the Genus database with same CATH superfamily
2ESCA 4YN5A 1TJ2A 2Z2AA 2NLYA 1TWIA 3DK4A 3FEQA 8XIAA 2YOCA 1F6YA 3NTYA 3WF4A 4K68A 1WOBA 3PTQA 1PIIA 4P2VA 4GMEA 4UNKA 4GINA 4Q32A 4EWJA 2H8XA 2NUYA 2CW6A 3G0UA 3WCZA 3MU7A 1P6WA 3WEOA 2WC4A 1J5SA 3V7PA 3UYCA 3SZ8A 3A7RA 4ZSTA 1W1TA 1EQPA 2PDWA 3GRSA 1JZ5A 2DSWA 3LTSA 3KLJA 1V6WA 4GKLA 5A6BA 4ZQOA 4UR8A 2Z26A 5JQ9A 5G5IA 1QNRA 3L4YA 1UIOA 2HRWA 4RDWA 3SUVA 1XBXA 5A6AA 1F8MA 4JIIX 2L5HA 1V0MA 2B7OA 4GY1A 3CB8A 3NO3A 1XYLA 3BSHA 4GACA 2E6YA 4ZL1A 3R13A 4MLRA 1Z44A 1IZKA 3CJPA 1DIKA 1VRDA 4OBSA 2VGBA 4GCAA 4EWND 3I3BA 5CPLA 4Z2KA 1H49A 1ZTVA 3TW7A 4TMCA 2DT1A 1RJPA 4MNLA 2QPSA 5AYZA 4S3EA 1NIUA 3MV11 1CCWB 3GH5A 1XR2A 2BHYA 4FNPA 2WP5A 2CU0A 3WH9A 1YNYA 2QR6A 3UJRA 1KFCA 5M17A 3EXSA 3LQLA 5F2MA 2OZ8A 4IMDA 3WO8A 3EWDA 2DW7A 1K7XA 3WBAA 3CGDA 1Y8BA 2C1IA 4U28A 5BOEA 4AIOA 1JCTA 1GETA 3VGFA 1F3EA 2YXXA 4PUEA 2QJHA 2TPSA 3FJLA 3BO9A 4LT9A 4NXKA 5HA7A 4BS0A 3CT7A 2OVLA 1RCQA 5T26A 4XK2A 5CPNA 4W7VA 3FXYA 3OLGA 3WK3A 3VDGA 1S38A 1BVNP 1FXPA 2DQXA 3MCMA 3GYEA 3GTXA 1JFHA 2DZBA 4TU1A 4UB9A 2EHHA 2QAEA 5D2TA 4CNNA 3TTQA 2QW5A 2DT3A 4HTYA 3W72A 1LBLA 4TV5A 2WKLA 4B5TA 1YDNA 4CNUA 1LQ0A 3OHMB 4A2RA 1XI3A 4FNSA 2EJAA 4NAFB 5F1VA 1RM6B 2JK2A 1E9LA 2W62A 2FH6A 4GQQA 3EPMA 4N02A 3R79A 1S2VA 1K7FA 1V5XA 5C55A 3GG0A 1M04A 3HV8A 4ICNA 5CEWA 2FPVA 3QKZA 2DZTA 3PAJA 1BWCA 3HRDC 4AUBA 4XD6A 3BG3A 3VM5A 4QQ3A 4CCDA 1GVIA 4HNLA 2XH7A 4JTSA 5I78A 1V77A 3V18A 1WDDA 3ZQ9A 1PDYA 5IM51 1GYLA 1OQFA 4JQ3A 1QAPA 5DCEA 3WFAA 4C6EA 1PZ2A 1QI2A 3M46A 3BTNA 4IP5A 1OB0A 2BOGX 5KZ6A 2HV5A 2YL8A 3WUEA 1OYAA 3P7YA 4WKAA 1J0JA 4J3XA 3QY6A 4YTRA 3EX1A 3WQEA 4OIFA 2ZE0A 4WD0A 1AH3A 4TVWA 1PPIA 4JN7A 4IFOA 4S3GA 3C0SA 1CB2A 2GJRA 4PMVA 3B9DA 4CU8A 1MI3A 3IGHX 4Q4KA 4RDZA 4JEQA 2Y7DA 3W1PA 4GNJA 3RNMA 1HKIA 4Q7BA 1JDCA 2WWDA 5IHRA 7TIMA 3T2OA 2WK2A 4K2SA 4UOQA 1OWQA 4DAFA 3CLMA 1NPXA 4XZ9A 5KEZA 1B57A 1X98A 4JFWA 3L2IA 5JH1A 4MUPA 3VIOA 2G3FA 3OVQA 1OIMA 4J3UA 3EDKA 3IARA 4DF0A 3EWZA 2ISSA 2ZADA 2PPGA 3FA4A 3H4KA 2Z2BA 1XLMA 1HKJA 3NYDA 4K37A 2QMJA 2CWXA 4BCEA 3W2NA 3TWBA 3WBYA 4QDMA 2EPLX 1C7SA 1JZ4A 3H2OA 3HGSA 5JRBA 1LL6A 1IT0A 1H61A 4XO6A 4L1XA 4JTTA 3NQMA 1JRCA 1CDGA 4HN4A 3V5CA 1E3ZA 4GI6A 1PKYA 3GLCA 3FOKA 1UBSA 3FJ6A 3ITXA 4IQLA 4MOZA 1FUYA 3DG6A 1YHTA 1ZJHA 4A4AA 4N9DA 1R85A 4FI4A 2PP0A 4BFAA 4ICCX 1AA1B 2X05A 1W1B1 1GOWA 1VBUA 2Z27A 3EX2A 3MCOA 3BLDA 4A8NA 2V3FA 1OD0A 1MUCA 3I10A 3AHYA 4LC6A 2VZSA 2Z24A 5A6SA 1ITQA 1W5PA 1SO5A 2QV5A 3V0TA 2XFYA 2WCSA 1MYRA 3B0UX 3EWWA 4HZ7A 4J56A 1V93A 3LHUA 3OW1A 2XGZA 1CLVA 2C3ZA 1TTPA 4R9OA 3BCJA 1TZZA 2ODOA 2DPEA 2VOTA 3B8TA 3EAUA 5HPCA 1GJWA 2D2GA 2HISA 3TW6A 3W84A 3GW3A 1JEHA 5FF3A 4IGSA 1K6AA 1FEAA 4DVOA 1GVSA 1ODUA 1OZQA 5FJPA 4WSJA 4BI7A 5EMMA 1A0CA 5LNSA 1KD0A 1DJGA 1ZFJA 1H0GA 3KRUA 3OVGA 1RA5A 4QLLA 1JD9A 1TV4A 4HNUA 9CGTA 1FFUC 1R47A 2XN1A 4AD5A 2NZLA 1GZGA 2J4GA 4J57A 3IVUA 5KINA 2OELA 3QXBA 5LNRA 1KTCA 1T41A 4E5TA 2WHKA 2XVLA 3B8SA 3RMEA 3OOQA 3EAOA 4G56A 4LVDA 3BICA 4IUOA 3VABA 3GW0A 1Q1WA 3W2KA 3THQA 2FVLA 4F0HA 4WXZA 2VQUA 4TOQA 3RO8A 2ZUTA 3U2EA 3ABQA 2AMGA 2CNCA 4B9YA 2PC8A 2WCAA 3N3MA 4QIUA 2PDXA 1T99A 1EKOA 1U5HA 4AX6A 3OYXA 3U6WA 1RY0A 4FLQA 3G22A 1MXDA 1HKMA 4OECA 2QUVA 2QJGA 4IGHA 1A47A 4JY9A 5ABHA 4LS0A 3QV9A 4CLMA 1IZJA 3ZS4A 3LRMA 3A5FA 2WMKA 4J3TA 4W89A 2X2YA 2Y8KA 3QPZA 2A3CA 2NUXA 3N6QA 5C2GA 3O1NA 5I03A 3URAA 3QYQA 4C5YA 4UTWA 2PDUA 1FH7A 1M7OA 1YDOA 3LI1A 3NUKA 3EBVA 1JIBA 3TR9A 3VOCA 4D8LA 5JCNA 5FS7A 1E73M 1EGMA 1LRNA 2W0UA 4Q4QA 4F0SA 1H63A 1IEQA 2P10A 4KGJA 3A23A 4JOMA 3UNDA 3F4DA 1O5XA 2YCJA 2D0FA 1IEIA 5AVHA 2WOWA 1A5UA 2DEPA 3NVDA 4KEUA 3WQGA 1UKTA 3R07C 2TRSA 2BZNA 2DW6A 5C70A 1WKYA 2OO0A 1G69A 3UJSA 1H3GA 3WBXA 1B30A 1VIZA 5CGTA 3MBDA 4QEHA 1B4EA 2PUZA 1OC7A 1TZ7A 3LM7A 3KBSA 3RILA 4S3FA 1MNZA 3PZNA 3QH2A 1MW2A 4LEFA 3VNJA 2V63A 1S46A 4O17A 1W1VA 3IV3A 4O1CA 1JDDA 3GTHA 3UJFA 9XIAA 1RP9A 1TUFA 1UD4A 4KFPA 4R9XA 3WLLA 3DGBA 4YTUA 3UZZA 2GGEA 2INEA 4Q6XA 1S5VA 1GRHA 4NAEB 1DWJM 5M1TA 1BYCA 3MV01 4DM2A 3HG4A 1PTAA 4PFMA 1AZ2A 2XH2A 1UA3A 4V15A 1NFPA 5FJOA 1BVZA 1TB3A 3S2MA 1G1YA 1MW3A 4A35A 5PTDA 3NVVB 3GZ3A 4MKSA 3H7UA 3TONA 3G1FA 3FHAA 4BEQA 1H2IA 1UJQA 3T1GA 3SJNA 1EPVA 1V0KA 4U31A 2WMGA 4LPCA 5C9WA 1SU5A 4JIPA 1ODZA 1E9IA 2W61A 1US2A 1XH1A 4XB3A 1V3LA 1VPXA 2FHFA 4IIBA 4GKTA 2IKJA 3IIZA 4E4FA 3NQAA 3HURA 3T0CA 3H6OA 1NDVA 4MGGA 4BJHA 1LDCA 3PTKA 4LYPA 1ZCOA 3KVJA 1V3HA 3NZQA 4H4YA 4C6LA 1TV7A 4JFSA 2XG9A 1JPKA 2REQA 4CNSA 2WHJA 3E0LA 5FEZA 1JVNA 3MSGA 3WH5A 3BDKA 3VZXA 1E0TA 3FAWA 2JKAA 1E51A 3M0KA 1ZZMA 1PSCA 3MKVA 4KETA 1PCKA 3L68A 1QOPA 4UTTC 3A3XA 1GYNA 2QZRA 3LLDA 4OHQA 3N9KA 4Q6JA 3VOHA 5CPTA 3UVAA 3LLXA 3WDRA 4QJ1A 3S0CA 1FWCC 1JQXA 2IPWA 3V36A 3TU9A 3ARUA 2E0PA 1BVWA 4UZUA 4AZCA 1QXLA 1U2YA 2NSXA 1O94A 5LIUX 4HYWA 4MY8A 3CHFA 3CZ8A 4IICA 1X8FA 3BLIA 3WY1A 3M0IA 2ISDA 3PP7A 1EX5A 4QE1A 3W3OA 4K8GA 4WX2A 4CQ9A 2IPGA 5BRBA 2O9RA 1W91A 1UP3A 3U2OA 1GZ1A 1W9XA 1V4YA 1TPFA 3W07A 5XIAA 3H7RA 5DXYA 1TJPA 2Z1KA 1VFLA 1XWYA 3L4WA 5CBBA 5HXMA 1FWDC 2LLEA 5JCLA 3MMDA 3PTMA 3WLHA 5I79A 3WQCA 2Z1XA 1V0LA 4UFHA 5JVLA 1UR1A 1S3TC 4NRSA 4AF0A 2UY5A 5HNTA 5I23A 4HZ6A 4ZFCA 1VKFA 4C6JA 1A5AA 3GWQA 2FTYA 1VFFA 2J25A 3TROA 2QDHA 1B90A 1EUNA 3W1RA 5BW6A 2GGJA 2PA6A 3TA6A 1E6PA 4DQWA 1CZ1A 1ONEA 2Q8LA 1DQUA 6TAAA 2E6AA 2FJKA 3CPRA 5EBUA 4NX0A 5A8OA 1Q7QA 3GNPA 1EWEA 4AD1A 1X38A 4GISA 5A6TC 5BXRA 2ZZ2A 1DTNA 1XH0A 1XPYA 2OWXA 3I6RA 2P1FA 4PTXA 4YCPA 7REQB 2OWCA 2XU2A 3GTNA 4Y9PA 3RLUA 4ZO8A 1WZKA 1J9YA 2BC1A 3KAOA 1W17A 4CQAA 2GR3A 3EB4A 4WSHA 1AZ1A 1OD8A 1YTKA 1WKDA 1EHNA 5MF5A 1BGGA 1Q7MA 2J7BA 1AQ0A 3OZYA 1TRIA 1K4GA 1W3NA 3W27A 1OINA 1S2UA 3K8KA 1BYAA 4C6BA 4K8HA 5AZ0A 1CXFA 1UROA 4EQXA 1A49A 4JKMA 5A95A 1EX1A 2YA2A 4X61A 2VWTA 4ZQCA 3VC5A 3FDKA 2VCBA 3AZRA 3MUCA 1V02E 5I02A 1AW1A 4AVFA 2BVWA 1E5NA 4ZE5A 3PTDA 1WDRA 3WUBA 4XX6A 4Z42C 3M43A 3E12A 2QXWA 1V59A 4PSPA 1UMYA 1MRAA 4YVPA 1QI0A 2F9RA 3NZ1A 2Z0IA 4AD0A 3RLVA 4RUBA 4B4HA 2CYGA 3ZLHA 4Z0SA 3FX4A 3GSMA 5U4NA 3H22A 3AM9A 2WSPA 1HVQA 3PJTA 4D6GA 2DIJA 1FFRA 4QROA 4C5ZA 1H6VA 1K1DA 3B0VC 2TPRA 5I7GA 3D46A 4FP1A 2B0MA 4I7WA 1FBAA 1EH9A 3VILA 3I3DA 1UWUA 1TE6A 2NQHA 3IGUA 2WVUA 1CXLA 3C56A 3KOFA 4L6HA 2R82A 4KIEA 1G67A 2AKMA 5FS6A 3P5ZA 1R46A 3LV5A 1D9EA 4JTLA 3TFXA 4JHZA 1EJUC 1QDSA 2WPCA 1F8IA 3OZPA 3QTPA 4O52A 3NOYA 4H4IA 2PP1A 4ERIA 2QCCA 4M80A 1XUZA 1A53A 1H09A 2NX3A 4HMNA 3BXWA 3EEGA 1MQQA 2V6AA 1N60C 3CGTA 1UOZA 5D04C 1EJSC 5E09A 2IKGA 2QUTA 1B3VA 1L6GA 5AC6A 2YLAA 2YR1A 3WLNA 5HWNA 3ITCA 5TQLA 1XPGA 1RK6A 4RZBA 3PULA 5JBEA 3CH9A 4GZ7A 3SRFA 3PF3A 3QHNA 2IQ0A 1VBJA 2HPMA 1XC6A 4AEEA 3ONBA 4XD4A 4GQBA 3PZGA 4WZHA 4Q8WA 2PDJA 4HHLA 1NHRA 4F8XA 1GSNA 1TJ0A 3G1YA 2VX6A 1VH7A 4ACZB 1GJPA 2VD8A 4ZFMA 1R5YA 2D73A 2HE5A 2I7GA 3VI2A 3KVKA 3VOGA 3S42A 4LCQA 4IIDA 3GFZA 2IXVA 1O4UA 1X1OA 2VFEA 1H5YA 4OUEA 5KMYA 3N1AA 5A6LA 2WMIA 3K2GA 3WH6A 3LCGA 2TYSA 3QR0A 3WLMA 3PJWA 4NEVA 2X0HA 4NNCA 3L5LA 4XSLA 4RW5A 1GHSA 4GI8A 4JTCA 4H3DA 3SR7A 3BZJA 4FALA 1KCZA 4LTSA 1RQEA 3NQFA 2XVPA 3M41A 4AEOA 4N4PA 5ABFB 3L12A 3SCVA 4ZSUA 2Z4GA 3IJ7A 3T08A 1O6IA 1ZAIA 5C2CA 3LY0A 1SZEA 1V6YA 3AXKA 4PMDA 5D2YA 2H90A 1HJVA 4LRTA 4S3CA 3DGHA 1GRBA 4A3QA 2XWDA 4R27A 3HPFA 3ANUA 1Y65A 5KITA 2JBMA 3QHMA 2R91A 4GY0A 5AY7A 1RLCL 5AHEA 3CT2A 3EXRA 3CL7A 3APYA 4J35A 1Q13A 4MNKA 1KWKA 1E5JA 3JZUA 2A0NA 3NDYA 1QCWA 3CPUA 3UY7A 1IEXA 2W3SA 2WVVB 3WMSA 3CV1A 2ZX7A 4Y96A 3CIWA 2XM1A 1XRVA 3AHXA 4O15A 3LNMA 4NIRA 1H2JA 2ZICA 4AMAA 3B3DA 4LA1A 2CKRA 5EBKA 4WUIA 3U57A 4DBDA 1QWKA 5ABTA 4GJ1A 2A2IA 3IJQA 4RK8A 2QS8A 3CO8A 4HU8A 1ZK7A 1NF7A 4IUGA 2A5HA 3EB3A 4QNEA 4C91A 4O18A 2XYLA 2VELA 3CQIA 1SYTA 1KRMA 3TYZA 4AZ6A 4DO4A 2EPNA 2E9LA 4CQ8A 2NVAA 1K02A 4MFEA 5HAOA 1Q6DA 1XSIA 2WMFA 1PX3A 4QLKA 4UIOA 3GFYA 1S2WA 3UXLA 3GB6A 3ALGA 1JI1A 1H7OA 5CBIA 1ZAJA 1R9ZA 1TCDA 3LXBA 4H2CA 4FF5A 1XIEA 2DUAA 1I4NA 3TV8A 3DDMA 5DMNA 1U5JA 3DC8A 3CZLA 4AAJA 3CHEA 4TV6A 3VIIA 4OBTA 3THDA 2X41A 1TFVA 1OFPA 1SFSA 4DPPA 4XISA 3GDKA 5HMDA 3VOJA 4K8EA 1H11A 4RE0A 1PIFA 3IPWA 2IPFA 1PDZA 1C29A 3P3BA 4W87A 2V3BA 2POTA 2FMOA 3BLLA 3H70A 1KBKA 3PUEA 3NQ6A 4F0LA 2QCGA 3D6NA 3TYUA 4F3HA 2A6NA 2TODA 2XTKA 1EXBA 4IPLA 1EGZA 4C65A 4DBUA 3TC3A 2VEFA 4DJEA 1MOKA 1VEOA 3W7KA 1K9FA 2GUUA 1P6CA 5TF0A 4RJEA 3M9YA 4CUCA 4JIHA 3PR2A 1MQPA 5C5YA 1HT6A 4G9PA 3CTTA 2O9OA 5BCAA 3VZZA 3S1VA 1QT1A 4AYGA 5I77A 3LHVA 4JQ9A 4Q8NA 4LCSA 3AYTA 3VCCA 1OC5A 4NJHA 4UTJA 2HBXA 3E2QA 1AJ0A 1FWAC 5AYIA 1AJ2A 1PZ0A 4I9AA 4OBRA 3W7CA 2ACSA 4C6MA 3BE7A 4Z2JA 2CBJA 3UPBA 3LBCA 2NQJA 1OCBA 4D8ZA 4L1WA 3AMDA 4WGXA 4OJYA 1DEDA 3P62A 1SZFA 4FF7A 1F3XA 3OODA 4ZGYA 1S5MA 3F2BA 3PBUA 2OXNA 3ARZA 4EMWA 4BQ2A 3ARTA 3ITVA 5D4YA 1QOXA 2ZIDA 3URQA 2IKHA 3PZUA 2Y24A 3QMSA 4PTNA 5EBAA 1YEYA 1G5AA 2P5NA 5A6JA 4EM4A 2VEKA 1XIHA 3GHUA 3R43A 2F61A 2WM1A 2ZWZA 3VGBA 2PTWA 1SPQA 2X50A 4KESA 3BWWA 1JCJA 4M19A 1W9UA 1W5NA 4BZYA 4D6CA 1Z3NA 3EYPA 3E02A 3RG6A 3O0HA 2Z1BA 1T6MA 2PLCA 3AS1A 3WMCA 1R2SA 1XS2A 3TTEA 3Q45A 2V3AA 1US3A 2NLIA 5A2AA 3T9PA 1LT7A 1PL9A 3D3AA 1NJJA 1D7YA 2YCKX 1MVYA 3KRBA 3L65A 3UEQA 1PYMA 1OBAA 3W4RA 5I07A 3EOLA 5REQA 1ZRQA 5G4HC 4CD4A 1P0KA 1ZU8A 3WF1A 5FJIA 1W2VA 2WNNA 4NAFA 4DIAA 1FDYA 4ZCWA 3Q65A 3EKGA 3CIXA 3DFTA 1XFCA 4NY2A 2G0WA 3MS8A 2OT0A 2FH8A 4ZOCA 3MYPA 1C8VA 4L4LA 1N8WA 2P0IA 4H19A 4X9SA 1DJXA 3C86A 3O07A 2KAUC 3U2ZA 1VPYA 1BG9A 3GHTA 2I9UA 1B4KA 3C0LA 1IXPA 3WK0A 2QJJA 2YCLB 3UETA 1XDLA 2E9BA 3UZYA 4M24A 4HA3A 4QCFA 3QFAA 4ML9A 3KS5A 2ZZ6A 5E70A 1G9HA 5CZSA 3II1A 1JAKA 4ORIA 1R3TA 4RDVA 1GOKA 1BXBA 4LUSB 2UY2A 1C90A 5I3DA 4F2UA 1GKQA 3WN6A 1Z32X 3IK4A 3QY7A 4RKAA 3S5NA 4M52A 3GD4A 1PHQA 5EU9A 4CNOA 6XIAA 1SZRA 3FFSA 2VEMA 3WF0A 2V67A 3VKJA 4Y6GA 3S5SA 4A21A 2QNEA 1GESA 1I0DA 3DAQA 5C0QA 2X16A 4YL2A 1XXXA 2DUZA 3GFXA 4IFKB 2FVKA 4AC7C 1H5VA 4L4MA 5FIPA 4HKPA 4FPSA 3BH4A 1OX6A 1W9BM 3WQPA 2Y70A 3FA5A 5JBDA 3KL5A 3WF2A 2ZXQA 2AGTA 5TNVA 3LM3A 1CXKA 2DH3A 4GFIA 3UWEA 4Z2IA 1KFLA 5BOFA 1NHQA 4E2DA 3BAYA 2D2HA 4HPXA 3IK2A 2BB0A 4E3VA 1G4EA 1NHSA 2PF0A 2ZTJA 4W4QA 3SUUA 5A5WA 1G4SA 3VDCA 1R9XA 1EEPA 1RV8A 1PV8A 2ZX9A 4XSMA 3LCLA 2YZRA 4RXFA 3MC5A 1OFAA 4GYJA 4C6IA 4MKVA 3O6YX 3REQA 1JPMA 1L6WA 1EDQA 3VIMA 2EPHA 3F5JA 1XIGA 1GTHA 4NL1A 1JEZA 1P7TB 4RE2A 1E0WA 1Q3NA 1EP3A 1EF3A 3OBKA 5U25A 4EE9A 4XAZA 1GVOA 3NEVA 2JEQA 1ZBCA 4LU0A 4ATDA 5EGRA 3SCOA 4LUIA 1SO6A 2CLLA 1R3VA 2FIQA 4JXCA 2YDSA 3B9EA 3O6CA 3FA3A 4NZ4A 1NAL1 4IGMA 4PMUA 4GUGA 2WPFA 3V0UA 1SJAA 1DWHM 1TQXA 5G5HB 3V35A 2WNZA 1B2YA 3ZM8A 2W55A 3HF3A 1NARA 2CZEA 3STGA 3CXBA 1B9BA 3NJ3A 5FF2A 4QDPA 1ISYA 4GUHA 4LXFA 2JQXA 4FXSA 5CSSA 1TV5A 2QDDA 1AODA 3BC9A 5KVHA 3PJUA 2CEQA 1KGUA 1HN1A 3UG3A 1UYQA 2CHOA 5K7JA 5F4WA 4ZTXA 3G1RA 4PTDA 2Z1SA 1VQTA 2Z7GA 2EXOA 4JTRA 1IIHA 3FYOA 4JN8A 4WY0F 1P5BA 4GH3A 1QPRA 1V6UA 5H8PA 3WDHA 4QXIA 1UP2A 3RM4A 4PRTA 2BGSA 4PUNA 2QCFA 1QO2A 3UR2A 3PHAA 3W73A 3PZQA 2IQTA 3ABOA 4CQBA 3RHGA 3ELFA 2PGRA 2Z00A 3NZGA 5HATA 4O54A 5EL1A 1JYXA 3LCFA 1H7NA 3W74A 1W3TA 2NV9A 3SW6A 2QVHA 4BWLC 2NV1A 2D23A 2A85A 3H4GA 3HG2A 2Q09A 3L66A 3PZTA 2ACQA 1IR2A 1Q65A 1TVPA 2OOGA 4IMGA 2D3LA 1O60A 3N2TA 3P6LA 5M2FX 1OFRA 4HNOA 3PAOA 2XDFA 3GH7A 3H26A 4HB7A 3RUBL 4HU4A 1NDAA 4LF1A 3G1XA 4PMZA 1C9WA 1JNDA 1E1EA 3NPWA 4LH8A 4Q7NA 3RM8A 4JTKA 4PEKA 2NW0A 1G01A 2HXTA 1TRDA 2P76A 5HPOA 3HN3A 1TTQA 1MNSA 5K9DA 4DRSA 3HA1A 3DIPA 3L7RA 1W32A 2X0SA 3K8LA 4K6AA 4PSRA 4G6CA 5A3HA 3HTWA 4EF9A 1RJQA 3BMWA 2BY3A 1POKA 4Z1AA 3PK7A 3H12A 1UC4A 1Z42A 1L8PA 1JGIA 2X1RA 1ZJAA 3HW2A 4RCXA 3S3GA 3EKZA 2EQ7A 5AECA 3NPVA 3VKDA 2BXVA 3C8FA 3VOFA 3SADA 4GUFA 1EYWA 2TSYA 1YTEA 1XCXA 2IKIA 5LZLA 4RZ6A 3PB0A 4X0VA 1OFBA 2J24A 4MAVA 3DU0A 2C0AA 1RD6A 1EA9C 1V3JA 3WLOA 4UWMA 4P8WA 2FPYA 4PE8A 2E8YA 2WSRA 3CLWA 3LYEA 5C9ZA 3MP5A 2Z25A 4C1KA 4XD3A 4PUKA 2X7WA 1QI5A 1J96A 4ALDA 4OFCA 3TYCA 1XLLA 1WBJA 1FCQA 2J7EA 4L1GA 2QVNA 5FL0A 2GQ9A 4B5VA 3I7QA 5E0FA 2GR1A 4H9UA 4INFA 1KBBA 2QHAA 4F2BA 4QE4A 2YXOA 2HVOA 4PCSA 3WQFA 5E9XA 1YQZA 5M5DA 3W28A 3ES7A 2HVNA 4IIHA 2E4TA 4V2XA 4D6EA 2Y5EA 4WDWA 1BTMA 1GKRA 3Q2DA 1ITCA 3VIKA 5IOBA 4ZMGA 1SJDA 3SCRA 4AWSA 5D30A 3GXPA 3PZ9A 3Q4DA 2EG7A 3LUTA 4UFMA 1XYBA 4H7VA 1XD0A 5BXSA 3E0WA 2YXGA 1DJWA 1XIIA 1US0A 3RCNA 5EFFA 4NP7A 3WBWA 4HPHA 3JU2A 1ONRA 2FZMA 3UA4A 1V97A 2AGKA 1O12A 3VD5A 3ITOA 1TX0A 3IJ6A 2BOFX 2OLAA 4C7GA 4Y9NA 4HZ8A 4N2YA 4Q3MA 2OZTA 1IQ8A 3PBYA 3QFWA 4FX6M 4QQUA 3ZO9A 3W7MA 2J27A 6A3HA 2XH0A 1XIDA 3KTXA 4L6OA 4OUIA 4HBKA 1ZSXA 4YIWA 5E0CA 2B31A 4X63A 2OU4A 4H8UA 4LS1A 1CEOA 1MWOA 4JQ4A 4PTWA 2FFCA 1W8SA 2HQMA 1CXEA 1LL4A 3UZXA 2FZNA 4JBRA 5K9CA 5CPQA 4NHVA 1MO9A 2I1OA 4IIFA 4GG9A 2QCMA 3NVZB 4KIRA 1ZS2A 4UQCA 1CECA 2QAPA 4I5XA 3P93A 2PGWA 3VFCA 1E40A 5D9PA 4C6CA 1XCWA 1TMLA 4S23A 4JCLA 4CN4A 3DYMA 1CGUA 2Y7FA 4H50A 2GR2A 2Y1HA 2FGLA 1OFDA 2NXIA 1QBBA 3GU9A 2RH9A 4KF1A 4E2OA 1R86A 1E6RA 3IJLA 3CZGA 3JUGA 4JTAA 3PN8A 3SY8A 1SR9A 5HQLA 1EOKA 1Q66A 3MHFA 2X42A 3M0MA 4JX6A 1CNVA 2JEPA 2HK0A 4FZIA 1JYVA 5G1TA 3B9JB 2TMDA 1M5WA 5DXXA 1RH9A 5HINA 4XBSA 2Z28A 1E0XA 4JY8A 3KDOA 1JCLA 2W4XA 1UR2A 2WVSA 5C7HA 1DIEA 4H8NA 1I1XA 1P1MA 2HQAA 3N73A 1P6BA 2CIPA 4KFNA 3AISA 1A80A 3ARRA 3FK4A 1NH6A 3JVAA 3PBGA 2VQTA 3B06A 4M82A 1E70M 5HANA 3NSXA 2VFFA 2WJZA 1UWRA 4EACA 1XANA 1ZDLA 5BMXA 5DRIA 3WQWA 1EJXC 1QATA 2XUCA 3E2RA 1ZLPA 2HPIA 4Y90A 2DDXA 2R1MA 3M07A 2OLHA 3G8EA 3IVSA 4H1ZA 3WLJA 2ABBA 1E6NA 4EPBC 4REQA 2DVUA 3W7OA 1W0MA 2RUSA 5LNWA 3WEZA 2ZC1A 1EC8A 2C16A 4IX2A 2Q8ZA 3MKCA 3CYJA 1AG1O 2MANA 4MZYA 5FJJA 3TTOA 3W81A 4MB1A 3FW6A 2WZTA 1I2NA 4IL2A 3K46A 1VPQA 1AFSA 5LA2A 2WLZA 1WOAA 1VFHA 4F40A 2G96A 3AALA 5IRPA 3QFEA 1H7PA 4DEFA 5K4ZA 4Y8FA 3M5VA 1N82A 1X96A 4JNZA 4S3BA 5AC5A 4O16A 3A4AA 2R24A 3SUSA 3VNKA 1E1FA 3AJXA 3PFRA 4YYCA 3CHCA 1V03A 1PS9A 3IS4A 4J2PA 2X8RA 4D9PA 3QEZA 4OT7A 4ERGA 4DHGA 2YQUA 3QPYA 5E6ZA 3H21A 3GHSA 3QGVA 2VR2A 2CKSA 1GVYA 1PXGA 3AU2A 3GXFA 4FK9A 1ISZA 4PCFA 1BHGA 3LBMA 3GG1A 4YTTA 1DTUA 2FHCA 4IQDA 1BRLA 4TTUA 4LAZA 1QNVA 3JW7A 5FESA 4LV4A 3RR4A 3OB8A 1K8ZA 2Z6JA 4PMNA 2CERA 1YPIA 4MB3A 4ACYA 1BYDA 1A3HA 1GT8A 4HK7A 3SQSA 5DQPA 1EO7A 4FNRA 4WF7A 1UCWA 1BF2A 1WXZA 2X09A 1NDYA 4K7ZA 5ECUA 5D05A 2ZX6A 4JIEA 1E9YB 1TCMA 2XGBA 3ZR4A 4EXQA 1X6LA 3SN0A 1VYPX 3UP8A 2A3LA 3MWCA 4H7CA 3KHJA 4JTDA 3I65A 5AHMA 3BARA 2REQB 1F76A 4I8YA 3ITTA 2OODA 1R2RA 3SURA 2VZUA 4XV0A 3VCNA 1JXJA 4HPGA 5I00A 2PCEA 5FF4A 1K77A 3O0FA 3VNLA 1ISVA 4B90A 4H83A 2EBNA 5G4WA 4PUWA 4AZIA 1K3UA 2O7SA 1O5RA 2ZXBA 2VC7A 3NM3A 4IG2A 3E6EA 3S46A 4GABA 3QZ6A 3LCWA 1G4TA 4GRTA 1TIMA 4C7FA 4LY4A 2F6XA 1J11A 3Q6JA 2E40A 3G77A 3B40A 5TIMA 4ACZA 3MI2A 4RDYA 1EBHA 4AIUA 2YYUA 4NRRA 4A8LA 2CCRA 3RU6A 5C9XA 4EM3A 2ASHA 3A64A 4QNWA 3WL0A 1GERA 3NO5A 2PODA 3AS0A 4JTGA 4IX0A 3IJDA 4MWAE 3GH4A 4UOJA 1XGZA 2P3ZA 4W5UA 4K1WA 2V5DA 4GIRA 3QV8A 4MB5A 4Q22A 2DVXA 3QW3A 4TVDA 3TOPA 1XHCA 3TN5A 4V33A 1XUUA 4KEMA 3F2DA 3MW7A 1R87A 2G37A 1GORA 3KVLA 4IHCA 4JQ2A 1KQZA 3AHVA 4MNJA 1SSGA 1RZMA 4RZ4A 3AO0A 1HJQA 3W7JA 1WDWA 3QR3A 2ZZ5A 3EA1A 3T81A 4IXHA 3U2CA 4AF0B 2PDFA 3MB9A 6PTDA 4FX9A 4RX0A 3SB0A 1KKOA 5FMHA 1GVRA 1WZLA 3WD2A 4JYEA 1XYFA 3AIWA 4QJ3B 4JN6A 2UY4A 2WPGA 3TAKA 4CNTA 4WOZA 3WJYA 1NDWA 5A8MA 3QF0A 3E38A 1ADSA 2PLJA 4HN8A 3VDAA 4LX4A 3C6CA 3QN3A 2OWWA 1ADDA 3VKBA 2DT2A 3W1AA 2ZZBA 2WM0A 3HQNA 4UNIA 4M6UA 3CMFA 4G8TA 1LP6A 3AYRA 5CZJA 7ODCA 2BNJA 4WK9A 3RMJA 2YDRA 2YKKA 4AZ5A 3K4AA 1GPFA 3GS6A 3BAXA 2D20A 3VGHA 3B03A 1N8IA 1DNCA 2O55A 1ZUAX 1QNOA 3Q58A 2JF6A 2BGNE 1TPB1 3WLSA 3OIXA 3NQDA 3PZOA 2CWNA 3EA3A 4E2VA 2E77A 1Q63A 2BODX 1UWSA 4UFLA 1M53A 1L6SA 3SQMA 1JPHA 4B15A 1R3QA 4UFIA 3VO0A 1L8NA 3H2EA 3NPXA 3CUHA 1WUFA 5FACA 3MSYA 3W25A 3B0YA 5AHIA 4U10A 1UH3A 3OA3A 1RXOB 1GW1A 3ZT7A 5EMUA 4QRNA 4DZAA 1DHKA 1BLIA 2GLKA 4PRWA 4GCXA 5L6UA 5FOOA 4RNIA 3H2AA 3FHQA 3UWZA 2VX5A 4W8LA 1TWWA 3URBA 1LOQA 1V3IA 1K7EA 4HA4A 1XGDA 1ENUA 2JALA 4KRTA 4DYKA 3VM7A 1TTIA 1S2TA 5DELA 1RR2A 1HP4A 3RU8X 4JR5A 2ADAA 3A3WA 2KZHA 2QJIA 2W27A 3RLGA 3RR1A 4FEZA 4Q33A 1J0HA 1I2QA 1GJUA 1OGSA 1A3XA 3EWCA 4H9TA 3KCJA 1R38A 3WDQA 3H4XA 1W5QA 4HJWA 1FHLA 3T7VA 7A3HA 2R9ZA 3LGDA 4URIA 4Z1YA 5I3GA 1OADA 4O19A 4XZWA 2J47A 1G4PA 4I6KA 4PZVA 4PH6A 2QF7A 3T4CA 1EBGA 4F9DA 5H91A 3EZ4A 3GDLA 3GTIA 2ZZ7A 5HNUA 2G3JA 4Q8UA 3LXDA 4F0KA 3JS3A 4TUFA 3W00A 2J62A 1KCKA 1FQ0A 3WQOA 1TELA 3NXLA 3IV8A 5JCMA 1QUMA 2OX4A 1D8WA 3TTYA 2V2DA 3LGGA 2VUYA 3KP1A 1A5CA 3B05A 4F2TA 3B9NA 3OP2A 4QSFA 4BKNA 4UR9A 1V0NA 1N61C 1D3HA 1GRGA 3A9BA 3VGGA 1JPDX 2G3NA 2WVTA 1XBVA 1XYZA 3UGRA 2YVJA 4HNTA 4LAMA 3TIMA 4YYFA 3EWXA 1UZHA 1NHPA 3PG8A 3EMQA 3VD3A 2ZZCA 1NWTA 4AG0A 3G2GA 1WQ5A 4OV9A 3DN5A 3ITYA 2BC0A 2GGGA 5FA5A 4QG6A 5AYBA 1KW1A 2QCHA 4C7DA 3P60A 1W6TA 1NOUA 3KWXA 4D6DA 4LRSA 2VI0A 2GVJA 2C71A 3KCLA 2BBFA 4GRSA 3HMCA 2V30A 3VDBA 1EJ7L 1PTGA 3UPWA 1JULA 4A6GA 2VWSA 2XIBA 5DF0A 1LWIA 4AD2A 4WVXA 5DCDA 4HIBA 3NVYB 1FY6A 3C2YA 1YPXA 4NI8A 5LIWX 5FF0A 3KLKA 2CLFA 3W87A 4GI9A 4FS9A 1KFJA 1U83A 2I16A 2EQ8A 2CBIA 3GRTA 3AWOA 3G0SA 1PAMA 3WDJA 3AMKA 4RE3A 2C18A 3PZIA 3AXIA 1CXHA 2UBPC 2PZ0A 2WO5A 4CQDA 1LOLA 3QOKA 2F6UA 5TBOA 4N6FA 3W1UA 4XTIA 1XSJA 2VEGA 4RE4A 1DWIM 2OSYA 1J0ZA 2VVSA 5BNKA 4W7WA 3WSUA 2XGIA 3IACA 1RA0A 5EKYA 4H4TA 2EPMX 1SW7A 3LDVA 3HB9A 3VOIA 2PDNA 3I7RA 4QP0A 4NZJA 4WJEA 1XRSA 3CQKA 1G94A 4D2JA 3KP0A 3CEUA 3K1GA 3ONCA 3T07A 3CHVA 3MP4A 1UR9A 4LNYA 3NQ2A 4QJ4B 1UZ1A 3DESA 1YNPA 1UIPA 2GDUA 3CQJA 5CC6A 1UR0A 2AAQA 2OCZA 4HMEA 3P84A 1KV8A 3MI6A 1EIXA 4L65A 3GU1A 5DMMA 5GNXA 4PMYA 4B5NA 1FX6A 2PGEA 2RKXA 3NAVA 2J77A 3HBLA 1E4IA 4PR4A 1TV2A 3DBNA 3JRKA 4XTDA 4BQ3A 2WB5A 2BHUA 1OFEA 3H2MA 2QPXA 2A4AA 2P53A 4PL1A 1Q4NX 2VHLA 1XBYA 3N6HA 3SEPA 2VM8A 4R7JA 3WD1A 2OG9A 4JGDA 3V3WA 3MI3A 3VMOA 3WNOA 4ROQA 1IV8A 1SO4A 2HDJA 3OLDA 3VGDA 1MDLA 4HVXA 4MYXA 3DGZA 1BQCA 1H41A 1FWSA 2ZUNA 1X2HA 1L2QA 4X22A 2BP1A 3NIYA 4CVUA 4C6DA 2X2GA 5KVIA 4DI8A 2YJQA 4H00A 2PE4A 3QQWA 4IMEA 2YCEA 4PBEA 3HPXA 1LROA 2GUYA 4CD8A 3DYPA 8XIMA 3A24A 3WKZA 3FKRA 4IT1A 2ZRUA 3NQCA 4NSBA 4Z2LA 2PDQA 3UZWA 5G5GB 1EZ2A 2VO5A 4V27A 1F4HA 5K4XA 4HA1A 2RABA 3EDDA 3O9NA 3VIPA 1RP8A 3HIJA 1U30A 2X40A 2BG5A 1XLHA 3TC7A 1Q6RA 2PF8A 1ITXA 3WF3A 3MO7A 3VIHA 3F4CA 4LW7A 3G1HA 3SI9A 3SQLA 3CS2A 1L6YA 1N8FA 1OG0A 3E74A 4LSBA 3O2LA 3LADA 3UXIA 3AYSA 3H23A 1JCYA 3Q67A 1NELA 2J7FA 1XM3A 5FS8A 2EJ1A 4GJJA 2G4FA 4JTJA 1GEQA 1P43A 1IR1A 3V5OA 1P7TA 1XLJA 1HF6A 4IMAA 3VMNA 2VDGA 5F1UA 1E1CB 2BXYA 1OYBA 1AJZA 4GD0A 1IWPA 2IXUA 4A2SA 3WLPA 1HP5A 3MUIA 4D1JA 1X6NA 3ITLA 1EJRC 4H8HA 2F8QA 1B1YA 2Y8UA 4AHPA 1ADOA 4GY7A 5E6YA 1BXCA 2NVDA 1PX8A 3D0CA 4J4KA 3JZEA 4XBKA 1E4MM 3ZMRA 1UR8A 2XVGA 4LBSA 1VF8A 4DJFC 4W8BA 1VC4A 2WPBA 3CAVA 4U3AA 1Q6EA 3O15A 4CU6A 1S1PA 5ER0A 2GL5A 3BLPX 2ACUA 4DNAA 4HPNA 1QPKA 4GYKA 3BW4A 4UTTA 5F4XA 3FG2P 1QR7A 3S4TA 5KSWA 3MDUA 2Y63A 3B4YA 4X3ZA 1TPWA 3HQPA 1AMKA 4NX5A 4DNMA 1S39A 3UU0A 5GNYA 3G5EA 1JNEA 3H24A 3NPUA 3C3NA 5CSYA 2DV0A 2X7VA 1UHVA 2I56A 5CPOA 3UT0A 5CGQA 4QEEA 3RITA 3MP3A 2XVKA 4C6FA 3PB2A 4GJIA 2OX1A 1JF5A 5ECVA 3W9ZA 2ZRYA 3FN9A 1XC4A 5D8WA 5DY2A 3THUA 5CG0A 2PD5A 4O1BA 4DI9A 3O63A 3VIJA 1VENA 5AC8A 1UKPA 1P48A 1RPXA 1YQ2A 1FHUA 3LHTA 3CAKA 3WLIA 1O1HA 4RR4A 1XDMA 3GKAA 3CGBA 4HMCA 5U1OA 1NQKA 4AX7A 1DE5A 3FVMA 3WNPA 5HMFA 1R30A 5K3VA 4W7UA 1KM3A 3MUAA 2VFHA 4KMQA 3A21A 5REQB 3PZMA 3IRSA 2GQAA 4HPJA 2XINA 4DLFA 3PFMA 5KZEA 4MKNA 2HNHA 5AFDA 3E2SA 2JGQA 2X99A 1H7XA 1UA7A 3ITGA 1X7IA 1Z69A 4H6KA 1GQKA 5BYWA 3FSTA 1O7AA 3VC6A 1DWFM 1XLCA 3CGCA 7PTDA 3PG9A 3TSMA 1P0NA 2GSHA 2UY3A 3G3MA 4L6DA 1HTIA 4NQ1A 4KRZA 2PDYA 5E9AA 2GH5A 4LY8A 4TVCA 3GU2A 1NY1A 1WZAA 1WV2A 1GEUA 2PDKA 4N4QA 3TTSA 1J12A 1D3GA 1EC9A 1LYXA 2VX7A 4GXWA 4XKYB 1C9DA 1E9ZB 1ECEA 4M81A 5FKYA 3ISIX 5CLTA 3S2JA 2WYSA 3MTWA 2BLEA 1KBJA 2FMNA 2DZVA 4QCEA 6CGTA 1E0VA 4HT3A 1H50A 3P61A 2CXEA 5B7ZA 2AAAA 1OG6A 1KRBC 1JJKA 4HSHA 1X1ZA 2ZZ4A 1W1IE 2WJDA 1HO1A 2QMKA 1XIJA 3ZIZA 4QITA 2NV2A 5HDRA 2EKCA 3O6DA 4DJFD 3SCSA 3CL6A 5BXTA 4QX4A 2R1PA 3TKFA 4U2ZA 1QI4A 5D9NA 3RM9A 2C19A 2NQ5A 3CUGA 2HS8A 1TWZA 1B3WA 1EWDA 4BV6A 1DXIA 3VX1A 2A21A 2QDEA 5TR3A 1XV8A 1K03A 1KFKA 3OGRA 4JD4A 1BYBA 5XINA 3M5YA 1M03A 5D2XA 1FDJA 3CUZA 3W2UA 4D1IA 5FJRA 4LOCA 2E67A 4GYFA 3VXGA 2VJXA 4D6HA 4IMFA 4WHBA 3NNTA 2F38A 2PCQA 4PMXA 3GQYA 2DUXA 3RRXA 1S7MA 1JCNA 5FJUA 3PY2A 3VGEA 3BW3A 5LXEA 2A1YA 2PWGA 2YIHA 3HMJG 1LRTA 1MUWA 2PURA 3REQB 1V7AA 3CC1A 4GC3A 4ECLA 4UZSA 1XBZA 2XH4A 4GQGA 3LHYA 1TX2A 2PU1A 3STFA 1MXGA 1XIMA 3H53A 1PYFA 1VCVA 3FAXA 2WZEA 4H4WA 2ZCGA 3RCMA 3GIPA 1R0MA 1I75A 1LOSA 3R89A 1GEHA 1YRRA 3AZTA 4GO9A 1Z8AA 4NZ3A 3O16A 3ARXA 2QQ6A 3QZAA 3VD7A 2QCLA 3CO4A 1OGBA 3ABRA 1AOGA 3TLLA 4B5XA 1KKRA 1NWSA 4O8RA 1L0PA 2WQPA 3P80A 4UQEA 3OO2A 2HK1A 2BTMA 3TE9A 2HBVA 3VAVA 4APNA 2GRTA 4BY3A 1GOIA 3T0BA 4US6A 1BWKA 3L21A 2YX0A 3UCCA 3V1HA 4PB3A 4P7RA 3D47A 3PPCA 1K4QA 3WD0A 1S2CA 3N2CA 2DZAA 1HJSA 2OKOA 3KOZA 5CG7A 3UW6A 1VQZA 4UUIA 1ZP4A 3ZLGA 3UPMA 4FR1A 1D2KA 1R2TA 4MHBA 4PMRA 5A8PA 3B8IA 3NWRA 1XSKA 4E8DA 1OFOA 4ZOBA 2VGIA 4I5RA 4CD5A 1M7PA 3GVGA 5M03A 2OQYA 2VEIA 1FCUA 4GZJA 3KBWA 3LPGA 3R1ZA 4FXJA 3L4UA 4F79A 4LBUA 1VYSX 3SRHA 3W7DA 3N2BA 2C14A 4JTHA 4ZOAA 4EPDC 3UXAA 1B0IA 2WKJA 4AHQA 5I3FA 3M64A 2AMXA 3LPFA 4DX3A 1X8CA 1XLFA 1SVDA 3KLLA 2HVMA 1F3PA 1FWWA 1BGAA 4IWWA 3LV6A 3G0XA 4WKFA 5H8UA 3OVPA 5RUBA 3T78A 1F07A 4AIBA 4XD5A 3KRSA 3OA5A 3WJSA 1IXOA 1ALDA 3P8JA 1V6VA 3WNLA 3TXVA 4ZO7A 3EB2A 3PPHA 4A8RA 3L23A 3WNMA 1RBAA 1ONWA 4GVHA 1J18A 1QHOA 2YLLA 2E25A 4E3TA 4XZNX 2XN2A 4D8AA 1FWEC 3VZYA 5JIWA 1ESWA 1ZALA 1CLXA 4S39A 2A3EA 3GIYA 3TYDA 3QW4B 3GBEA 1MW1A 2E1DA 2YL5A 3M5XA 3TJ4A 4EXAA 4CU7A 1B54A 3R7MA 4J3WA 2J6VA 1QOQA 3L2MA 1OM0A 3LPPA 1EGVA 3MUY1 4WDUA 4NZCA 1YADA 1PWLA 3CK5A 2VC6A 4M6QA 5AHFA 4FX7A 2WPEA 4B5SA 3RPMA 3P8IA 4CKQA 1FEBA 4C6NA 2B4GA 3K13A 1H1NA 4JPGA 1Q6CA 4WCJA 4E4PA 4OVXA 4LAKA 4QDWA 4QS6A 4MAZA 5DEZA 1HJWA 3TQVA 5EMYA 5MKGB 1JPIA 1LJYA 3WL1A 4GFSA 5JMUA 1PCWA 4Q8QA 4JFVA 1KM2A 3OTRA 4L4PA 4GBDA 3B8VA 3GNDA 3KOWA 1FWBC 3VU2A 1C93A 3SIZA 1FXQA 4A05A 3WQVA 2PBOA 2QCDA 3DERA 4GR1A 2XVNA 3L5AA 4FAMA 4AWEA 1V3MA 1FWIC 1Z6KA 1ZBKA 3U9IA 2BHZA 3LSBA 4PYSA 1TR9A 3E1F1 4IM4A 1ELSA 1IE7C 2VURA 5BU9A 3CUJA 1RBOB 4W5ZA 3ZR6A 3R5EA 2Z7KA 4KPLA 4TVYA 3OPSA 1S2AA 4LUJA 5E0KA 1THFD 1QK2A 1JZ8A 3ARQA 4Z2GA 1HVXA 1TV3A 3WQ4A 3CAQA 2E28A 5CJMA 3GRIA 1ZX9A 2WBAA 2DIKA 1DJNA 2YFNA 4DF1A 4FO4A 1FRBA 4QSHA 3QMTA 1R3WA 4GH1A 2NXHA 4GVGA 1J0YA 3I4EA 2AL2A 3AHTA 4B91A 3BVJA 4W88A 4HQVA 1RQHA 3W83A 2VRJA 2GDVA 1OX4A 1JXKA 4MG4A 4WLCA 3CMJA 5LXXA 4M1RA 3GC4A 1AL7A 2BVDA 3N29A 3HPSA 3GNNA 4DWSC 1EIBA 2D22A 2PRMA 3UVIA 4EF8A 1OJXA 5A2BA 4DXKA 4M7TA 3M7WA 1LPFA 3GR7A 3LXAA 2DY3A 2JGYA 4FHAA 1HXJA 4OOUA 5LA0A 3J7HA 3CWOX 2J7HA 4XZMX 4WR3A 5CH9A 2W79A 4W85A 4C6PA 3S5YA 2G8ZA 2O4QA 4TX6A 2QUUA 2W91A 4ICMA 1QW9A 4N42A 2PDLA 1LUCA 3GM8A 1WDPA 4PA8A 3LG3A 1Y5WA 2CZFA 1ZQ5A 1E6SM 2WJEA 1M6IA 3LTPA 2VUNA 1VS1A 5LA1A 4YNGA 4X2RA 3CWNA 4D6FA 4ZB5A 5HJLA 4A29A 4GPNA 4F4RA 3TJXA 3P2VA 4BURA 1FKXA 3G18A 3T2QA 1CB7B 1EZWA 4C6QA 4JX4A 4DUWA 3W1NA 1DKWA 4LB4A 1Q5MA 4B3ZA 1QASA 2C13A 5BROA 3PZVA 2X1TA 4HYVA 5BRQA 1TA3A 3IIXA 3KDNA 4WQ6A 5A2CA 4XBJA 2QKFA 4UTUA 3QQ0A 1UD6A 1KLYA 3A4JA 3OGSA 4AXKA 3E96A 3BJSA 1UWQA 4EMJA 3AMGA 3C52A 2CC0A 4KFOA 2I14A 1XD1A 4YTQA 3UR5A 4BHYA 1GG1A 3SY1A 3W82A 3EKLA 1WP6A 2BFGA 1AL8A 1U1JA 3QSRA 5CKSA 3NSMA 3F4NA 4JAWA 4Y9MA 3VNYA 2IMRA 3TUUA 4O1DA 3W71A 1LZOA 1RY8A 3BW2A 3KFTA 1YXYA 2VFDA 2PRLA 3MHGA 2MUCA 1UQYA 4QE5A 1JL8A 3CZKA 5D9OA 3O05A 3TP4A 3I68A 4QFUA 1IT7A 2VDIA 5J5DA 2CLIA 4UC5A 3F5KA 3S9YA 4O28A 3N4AA 1OY0A 1SFJA 1OT1A 1XLEA 1UC5A 1FWFC 1NM9A 2HNEA 2J8GA 1B3YA 1UBPC 2QAFA 4P7NA 4IP7A 2VX4A 3OBAA 3POHA 2HTMA 3VX0A 1T3QC 4Y9OA 4RNFA 4B5UA 1FFQA 1UKQA 1SSDA 3BSGA 4IZGA 2OEJA 1P0DA 2H3DA 3OHIA 4UTKA 3VE7A 4GUJA 3AUJA 4H4XA 4KWVA 3HM7A 4REQB 1S5WA 3KX6A 5HMEA 2CLPA 3CHDA 5CCZA 3O06A 4DWSD 1IHIA 3WD3A 4B92A 2DORA 3H2NA 2BGQA 4R7WA 5CSUA 1M68A 2H9AA 3BSMA 3GYCA 1F74A 4EXBA 1N7KA 1KXHA 4JTQA 2PFHA 3IC9A 1OABA 4ERAA 1JUBA 4B9ZA 2BDQA 2VYOA 1N55A 3RLHA 3K4DA 3E0FA 4O4VA 1WB0A 1S5NA 3YPIA 5H2ZA 1EDGA 3LTYA 1A5OC 1NWUA 1EEXA 4ZO9A 3MHUA 1SO3A 2YVFA 1SMDA 5AHLA 4ATWA 3GR4A 2WWCA 1AVAA 4W8AA 1F6KA 4UQ9A 3BCFA 1QNSA 3GIQA 2GJXA 3RK8A 5E1QA 4H6QA 8CGTA 5B7YA 2ZUSA 1AQFA 4JL2A 5A8QA 3URNA 4B2DA 1VHCA 4I7UA 4J3ZA 5CZKA 4PB4A 1XYAA 1U22A 5J5RA 3R6IA 1EFZA 3C8NA 4FXFA 1ZB5A 1K8XA 4XZBA 3U0HA 3WJXA 2INZA 1KM5A 4MIMA 2FZ8A 4DO7A 1V02A 2J79A 5H1WA 4I5UA 1BRLB 1TTJA 4H7ZA 2VZTA 3N4EA 5IBXA 3V4BA 3N19B 5BZAA 1PWMA 2ZTKA 4R85A 4HMDA 2V68A 1YLVA 2RFGA 1GVQA 1HUVA 4DXVA 1P4CA 1Q2SA 1WBHA 1SJBA 3U48A 3W6YA 1QU4A 1OYCA 5IXEA 4K1GA 2J9YA 3B9OA 1OFQA 1Q6FA 2WNQA 4IIEA 3SUWA 2INFA 2XWEA 5M3WA 3OQEA 5JXQA 3MO4A 4CEXC 2ZZ3A 3SGGA 1NFBA 3MWAA 3W23A 4MYAA 3TQPA 1UB3A 5EMKA 2HCVA 3LZ3A 4QG8A 3A12A 1Q7ZA 4YS1A 1W1A1 1R8LA 3DG3A 1UZDA 3COTA 2ZRVA 2O9PA 3AICA 2Z6IA 2V9DA 2Y61A 4QISA 3NFUA 3SUTA 3SCPA 5AN7A 1HKKA 2JE8A 5CLWA 3HV9A 1HGWA 4U2YA 3QTGA 3PS7A 3UXDA 1DJQA 3KVMA 1AUSL 1X1NA 2E5DA 1KFWA 4IG2B 3M47A 1RD5A 3MVIA 4PUMA 4NUWA 1BWVA 5FI8A 3WLQA 3AOFA 5LGXA 3P0XA 3UZJA 2NUWA 4D6IA 4G1NA 2ZZ1A 3N2MA 2XIOA 4U4MA 1OCQA 2WZIA 5D33A 6ENLA 1FDZA 4W86A 1F05A 1ITUA 1GNXA 1FIQB 4JX5A 1VLWA 1J0IA 1LM1A 3DENA 5AC7A 1JCMP 4ZXLA 3BAWA 1UH2A 4DYJA 1G7VA 1PJ9A 1YBQA 3WK1A 3OG2A 3N25A 2PWUA 4MFDA 4QTGA 2DQWA 1VP5A 3FCPA 5LYRA 4AMCA 2GGHA 4BI5A 3WFLA 3NURA 2NWRA 1SM9A 2PDMA 2X1IA 5HJYA 5JIPA 1EXPA 2RDWA 4MJMA 1QVBA 3FDGA 3F1QA 1TPVA 2DSVA 2Q3RA 4F66A 4QM1A 3ATYA 4H4VA 3MSDA 4HGXA 2J74A 1HJUA 1O95A 4DO5A 5A6KA 3W53A 3BV7A 3DI1A 3GVQA 1FFVC 3K8MA 4WSKA 4BWLA 1KGWA 4ZBCA 3C2EA 3IUIA 4LBRA 3S1GA 1D7FA 3KE0A 6XIMA 1C8XA 4YCOA 4S3DA 1WKFA 1R9YA 1GHRA 2GDQA 4AZ7A 5IFPA 4LJ3A 4Z1BA 3NOEA 1MW0A 2G3IA 1DYSA 2PU0A 1WAWA 3C5QA 1V51A 3H2FA 4LC8A 1FHVA 4TX8A 4FMVA 1LQAA 1LCOA 1M41A 1R7OA 2J9ZA 4Q8MA 2FDSA 3NXFA 4S1FA 2RHGA 2VENA 5ENLA 3W02A 1ZHAA 2I17A 2E5AA 3V0SA 1CYGA 1Q85A 2QYGA 1HKWA 3TH6A 1YKWA 1IF2A 1UR3M 1G6CA 3RYSA 1UWTA 2ZKMX 5B80A 1K8YA 1GOXA 3TJIA 5C9UA 4NZ5A 1IT8A 4RV3A 1KGXA 4ADSA 3NDOA 5FSEC 3DH9A 2ACRA 3G1DA 1OF8A 1OJTA 1VEMA 1UKSA 4YTSA 2CXGA 2G3MA 3XISA 3MZNA 2W3RA 2BV9A 2H3BA 4U5IA 5D37A 3T55A 1SMAA 4K39A 2C3CA 5A6MA 3TN3A 5D03A 3QV6A 3AAMA 4NJGA 4MDOA 3VCRA 3GDTA 2ZFAA 2AQVA 2EQ9A 3A47A 1RCXB 4M5PA 4ZVJA 1GVFA 4XWUA 2EGZA 2E5CA 4DLMA 4HHHA 2OEKA 4FXRA 1I1WA 3EPOA 1WAUA 1BKHA 3W26A 3PBWA 3W7HA 2GWGA 3U4FA 3USZA 3ZZ1A 4IJCA 1J4EA 2QULA 3ZT5A 1F4AA 3GK0A 4I7VA 1LWJA 3B04A 1JDAA 2ISWA 1Z9AA 1BD0A 2NVKX 3R2GA 1ISWA 4O4WA 1LORA 4IL0A 3AI0A 1HQTA 1UH4A 5LGZA 1E1CA 3FJ4A 1LWHA 1TJRA 5D38A 1KV5A 4ADWA 5FAJA 3VFLA 3WQ5A 2O7QA 1W1ZA 1PKNA 2ZRXA 3V16A 1KM6A 2YDAA 4FOUA 5C7VA 3HZ3A 4ZR8A 2HWGA 2EPOA 2FLIA 3L8KA 6REQA 4YHEA 1YPFA 5BRPA 2POZA 4K8DA 3ZVHB 2ONEA 4N6EA 3SRDA 1JYNA 4EQSA 3QMRA 4AVNA 3ABSA 2GVEA 4PUUA 3HFYA 7TAAA 3IIOA 4EAYA 3SSZA 2FDMA 2GJPA 2DP3A 2ZX5A 3U5YA 3M0ZA 5CJNA 3BL3A 3HG5A 1GRFA 2Y62A 4G7EA 1AW5A 2C1GA 4JTUA 5DN1A 2XIIA 4MVAA 3KCOA 1M9HA 4S2CA 1BFNA 3N3TA 2NPXA 2BMBA 5FD0A 3N6JA 1NF0A 3CWHA 4GE8A 3CGEA 4NILA 4J7RA 3ES8A 3DZ1A 3B8DA 3D9XA 5D2WA 4JTIA 2CFFA 2YA0A 3NGJA 3BK0A 1PZ3A 4BI6A 4UTFA 3RAOA 2C0HA 4EK7A 4AY7A 1H51A 1HL8A 3QGKC 5G1YA 1H1YA 2EQDA 4L9XA 2QEZA 5LIYX 1SW3A 5G2IA 3TAOA 4LVGA 2GVLA 3BLFA 4UQAA 3URHA 1Z41A 2Z2UA 3MQTA 3R8HA 2YZ5A 3PPGA 4Q8PA 1XRFA 3LQGA 2ZBTA 1CW2A 2FPTA 3UXKA 3BLOA 3L5OA 4DJDC 3W7NA 3AIVA 1VZWA 1EB3A 3R8RA 3U7VA 1PZ1A 1JR1A 3ENLA 1KTBA 1Y5VA 1HW6A 4O0KA 4BA0A 4DZIA 2R8WA 4MSSA 3INPA 3GAKA 2D24A 3A4XA 4P7OA 1JUEA 1Q1RA 2YA1A 3F2CA 1YXDA 3N12A 1H62A 2EG6A 2XFFA 1EQCA 1UJPA 3ZJ7A 2C3DA 2WMHA 4YLWA 1EC7A 4OGZA 2WNWA 4FIQA 3A6OA 5HWJA 4GNKB 4F9JA 4FNQA 3LBOA 1MSSA 3UJ2A 3VNZA 4K7YA 3E2VA 3M7SA 3WLTA 3H54A 2ZYFA 5JCIA 3CMGA 4FNTA 4MJ4A 2PLMA 3R94A 4G1KA 2EKGA 4GYPC 2WJFA 4ZXOA 4JHOA 1LLOA 4QLJA 1J6OA 2ZX8A 1OCJA 4GA8A 2R94A 4GIAA 3A5VA 3HO8A 2Y6ZA 2DIEA 3FV9A 4MY9A 1RBLA 2FZDA 2W5FA 2IQDA 3KOXA 3M44A 4Q4MA 3R0KA 1YNQA 3VPLA 5BWAA 4XKYA 4NNBA 3BMXA 2RGLA 4LNCA 4M7SA 5U7SA 1TWSA 1GG0A 2J3NA 1EP1A 1UOKA 3SIMA 2CDUA 4LFYA 2J88A 4CNPA 3LMYA 4CVWA 1ME9A 2R1NA 4LB3A 1VJZA 1XLDA 1OC6A 4ILSA 4X0NA 5HMSA 3CUXA 1AD1A 5FEPA 3LNPA 3MJYA 3WUFA 1KM4A 4ES4A 3WIJA 4UTIA 2W9MA 3MMUA 1VR6A 5FF7A 4H9XA 4JDBA 4B4FA 3PSWA 2Z29A 3SCQA 4JYFA 4V1XA 4GQRA 4HCLA 4JS3A 5CAKA 1L2UA 1DQWA 2GOUA 4ROPA 1TE1A 1QHZA 3WZ0E 1M01A 2XJ7A 2YCIX 5IFTA 1TVLA 1ICPA 5IBXC 5AVNA 2J7DA 4P7QA 3M0LA 1V08A 3THCA 3C2FA 3C4UA 3CXOA 1F3WA 3BJTA 1WPCA 2DZPA 4I9TA 4JQ1A 4YXGA 1GKPA 1RAKA 5GNZA 2P3EA 4FB7A 3BOLA 1IIGA 3CM4A 3EUB3 2GVYA 4EP8C 4KT2A 3H2CA 4HOZA 2BXZA 2PZNA 3DEQA 2ZA2A 1PVNA 2QUNA 4R34A 3QY8A 1FCVA 4ZENA 1M1BA 1UPMB 1PTDA 2ZC8A 4DJDD 4QG9A 2GGIA 4UCFA 1YMYA 4CCCA 3OC4A 3DCPA 4P8VA 2DSZA 2YVGA 4HNCA 3SFKA 2VOMA 3NRZB 4EX4A 2ON3A 3F03K 2WAGA 2XN0A 2EO7A 4ADTA 3W76A 3IUHA 3PWAA 4P8XA 4PRRA 4KERA 2AQOA 4ZA0A 4DWSB 2GUBA 3IVTA 2O56A 2QCEA 5DBUA 3SDOA 4JKKA 1DHPA 5EA9A 5D9MA 4QJ5B 2OGJA 2C79A 3AZSA 1QK0A 1DORA 4J1OA 3MPGA 1JRBA 3H4WA 4AHOA 4K36A 4TMBA 3SRKA 1JZ6A 1REQA 4M0XA 1UD5A 2V5KA 4LUTA 5E93A 3TFCA 2FHBA 4NEWA 4L9YA 4N9BA 3RDKA 2F7FA 5HJXA 3EA2A 3TYBA 1W37A 3EOUA 4HK6A 1I2OA 3NQVA 1SZNA 3TK7A 4H9MA 2P8BA 3RRAA 3W1LA 3N04A 4GWEA 3AXHA 1OHLA 2WW5A 1GOOA 2HE8A 1DWAM 5TAOA 5F2GA 4H9ZA 2ISVA 4TQTA 3RNDA 1A3WA 4CN6A 3O6AA 2NQ9A 4N9EA 5GPRA 1MO0A 3DFSA 1T0OA 3RX2A 2XIMA 1UUMA 1M3UA 1NSJA 3BGJA 4Q8VA 3UR8A 4O1AA 3SY5A 3QR1A 3M0XA 4B2DD 5E5CA 3APGA 1QBAA 3LOTA 3UERA 5ABEA 2QGHA 1UPPA 1XJBA 3M6DA 4E6MA 4UNLA 5I3HA 3RFAA 1BXNA 1F9CA 3NQ8A 3KZPA 2X0YA 3PUDA 1EA0A 1OZMA 1UR4A 3LLFA 1TKKA 1RALA 3AIUA 3F7JA 4YPJA 1XKYA 3UR7A 4IGNA 4GX8A 2FFIA 2WOQA 3HGJA 3P74A 3LMZA 4EANA 1W3LA 4EQRA 4IXXA 2B7NA 5CC5A 1VBGA 1J0KA 2XPKA 1DE6A 4O50A 3W7IA 4YWIA 3FIGA 3DXIA 4HZMA 4WGHA 1BAGA 1MEWA 1IEVA 1ME7A 1Q8JA 5KZDA 3GXIA 2Z1WA 1ZCCA 1DXLA 2E9MA 1N5XA 1C91A 2H6RA 2YPIA 3DFQA 2CLKA 1UD3A 3S2CA 3UESA 5MKGA 2X1SA 1KLZA 1DJZA 4KEZA 3A3HA 1CLKA 1KCLA 3KBNA 3SM0A 2Y89A 5H8MA 1TPC1 4G2DA 3C3UA 8RUCA 2V0TA 4TXEA 3GXMA 1Q6OA 3SSJA 4GXPA 5CPSA 4GGBA 2YYTA 3G8RA 4H9VA 3R4IA 4GI4A 3PBVA 2Q6ZA 1I6NA 1YE4A 4DUOA 3W22A 4FLRA 3O3RA 5GJNA 4MMWA 1CX9A 3EX3A 3NQBA 4YVVA 1AMYA 4QAIA 3BG5A 3RO6A 3LK6A 1JZ2A 4L56A 3MJMA 3T40A 4BK9A 5HWMA 4H41A 2A6LA 2C1HA 2W3ZA 4UTLA 2E3ZA 2MNRA 1CGWA 5G1MA 2EQ6A 1ICSA 4I90A 2VGFA 3VMPA 3TMQA 3A7UA 4KCUA 4AZBA 1QTWA 4UMCA 1CGYA 4UQBA 1PB0A 2G5WA 4IPPA 4WXYA 4KCWA 4BQ5A 3AQUA 1J8VA 1FCBA 4NYUA 2ISFA 1LG2A 4XZHA 1PKMA 3W7PA 4DYEA 2VDHA 3OEXA 4JIQA 3CTLA 1KNWA 7ENLA 2OGYA 3UBPC 1S1RA 2X8GA 2PWVA 5GJPA 3EX4A 3UYIA 2CFYA 3HQ1A 3OIHA 1WX0A 3TYAA 1Y0EA 3BUVA 5C8BB 1GRAA 3QQ1A 1AW2A 1RQBA 3KM8A 3R12A 5DMLA 1YX1A 1TZ9A 3B0XA 3IUDA 1O1ZA 1QNPA 4AEFA 4CD6A 4D71A 2W54A 2DSKA 1KRAC 2BCPA 5F2LA 2J9XA 3TLQA 4UOZA 4IFRA 2H8ZA 1IWAA 2RGMA 3RGTA 1GV4A 3M0HA 1XDIA 3BG9A 4B5WA 3GUGA 6ALDA 4NKCA 3FKKA 3LENA 2ATSA 1DIDA 2ZRZA 1VGAA 4GXMA 1ISXA 3VA8A 3ZWSA 1QW7A 3T0DA 4OOZA 3WEMA 4JCMA 4TR9A 1U1HA 1GREA 2X30A 1JAEA 2RDXA 3OLIA 2QCNA 3FVDA 1FO4A 3V1PA 2A8XA 3M0YA 2QT3A 5J8LA 1V7YA 3ZLFA 5A6BD 4JL1A 4LVAA 1D7KA 1RHCA 3KZSA 3NO1A 2P0OA 2GOKA 3DOPA 2V3GA 4WDXA 5DX7A 1Q4WA 1X97A 2V5LA 3UWQA 3TZFA 3UJEA 3G6LA 1VCGA 1MRQA 1GWJA 4WDTA 2GK1B 1JGMA 3VK5A 3CV7A 3WMBA 4I3GA 4X2PA 3VNMA 3LX9A 4LQ1A 4Q4OA 4C6KA 4R33A 1QO5A 4HTBA 4N9CA 3NCOA 3N2OA 2BY0A 1WE5A 4GHRA 3HPZA 4HYRA 2YGYA 4WY0A 4WOQA 1FH8A 1EBDA 3T0AA 1F2JA 5LKYA 2WBGA 2XHYA 2F2HA 3VE9A 3RJYA 1HGYA 4ZOHB 1EJVC 1OSEA 2XSBA 3HGRA 1JG9A 4NZ1A 4OTKA 4JQAA 2XZ9A 2E7FA 1RJRA 1IYXA 4DO6A 3I3EA 1OVDA 2DU2A 4CQCA 1V8EA 5EMJA 2PDCA 4GK8A 3W37A 1BF6A 3CV2A 1OEPA 4J3SA 3S5OA 1XYMA 4TVUA 3NVWB 1EPXA 5LIXX 2G95A 1VFSA 3F5LA 3QVQA 4EOUA 1U5VA 3NVTA 3AFBA 4HHMA 1KM1A 4GC4A 3M0JA 4XO7A 1JFXA 3AC0A 4DXXA 4YVXA 4M3PA 1JQVA 1GCYA 1W3KA 1H4PA 3S6OA 4EKJA 4CEUC 4O57A 3P0WA 4KWSA 2EF9A 2D1ZA 2OKTA 4NU7A 5F7UA 3HJEA 3IWPA 2J7CA 1T7LA 1M6JA 5AYXA 3JR2A 4ORMA 2O9TA 1KWGA 1ICQA 2VKZG 3PUOA 3W85A 3WFZA 2NT0A 2XIJA 1TVNA 4M51A 1BKSA 5D2VA 1YYAA 4C90A 4Z1CA 1K6WA 1X39A 1EL3A 2AAMA 3DC0A 4P61A 4DAIA 2A3AA 1YXCA 4QGCA 2D69A 4IPNB 1IWBA 1OF6A 1VHNA 5C71A 1M7XA 2O92A 2G4JA 2Y7EA 4NVTA 3T8QA 3ZFHA 4A22A 4AZHA 4ZQRA 3LU2A 1O66A 4JYDA 2ZUMA 3NS1B 1F6PA 1Q8AA 3QHOA 2A79A 2C7FA 2YL6A 5CSRA 5DCBA 1J79A 1QWGA 2I9EA 1IGWA 3C2VA 2ZXAA 1I9CB 1LVLA 4LVFA 5T9BG 3GHRA 1W2PA 2QCDB 4GNVA 3DHUA 4UFKA 2PDGA 4AC1X 2E09A 3APTA 3MA8A 4JNYA 3WDPP 1HO4A 3AMLA 4I8DA 4DPQA 2V81A 1FOBA 1XLBA 5G2WA 1KO0A 2FYMA 1GYMA 3BQ6A 1KXVA 5XIMA 3KBJA 4LGXA 3WK2A 3LPOA 3WLKX 1UKOA 1ONFA 3SR6B 3EPNA 2FZ9A 3KTCA 4LYKA 1ONXA 4PULA 4ASTA 5EFDA 3DKJA 3LRKA 3UY8A 4NI3A 1GVEA 3O7UA 4MM1A 1P1XA 2UZ9A 3AS2A 2WC3A 3I6EA 3HG3A 2OMAA 1NFGA 1RUSA 2V5JA 3TJLA 2QJMA 4Q8OA 4JKLA 4HOXA 1YTDA 4JIRA 1QFEA 2NXGA 3QV7A 4ZOEA 4CCZA 1RSCA 4N0RA 3RIKA 2XZ7A 2AL2B 5I2UA 4JFUA 4DUXA 3G1VA 3MANA 1XLIA 4Y7EA 4GX9A 3ZT6A 4LIIA 4LYQA 1ZAHA 1OX4B 1LBFA 2AKZA 3XIMA 2F2KA 2VXNA 4UTWC 2PBGA 5CC3A 3MMWA 3IIVA 3IJ8A 2VD9A 3EANA 2ZA3A 4O0ZA 1K4HA 2PDHA 2J78A 1CENA 5FS9A 4V28A 1DIOA 1KR1A 2JK6A 4XIMA 1G0CA 1A5SA 1UW9A 1WDQA 1SJCA 1XIFA 3UG5A 4YU1A 3EWYA 2XSXA 2RJGA 1ME8A 1TMHA 3CH0A 3VIGA 3RXZA 2J66A 4NJIA 3EX6A 2DSUA 3NL5A 4AIEA 2VMFA 4J2MA 3LZ5A 2YW4A 5KTLA 3B8UA 1A5BA 4P5UA 2NSOA 1KN0A 4TTGA 1Q45A 4TX9A 4HJFA 2YBVA 1J2BA 4S3AA 4C1NA 1EHAA 1MXSA 2BVYA 4H8VA 4BF5A 4DY1A 4OU1A 1GQLA 4RXGA 4GQ0A 4UMAA 4HSOA 1EP2A 1LUCB 1AD4A 2DZWA 2HXUA 2UV8G 3GKFA 4KEVA 3BANA 3OBEA 4DELA 4DJFA 2OOFA 2WP6A 4F48A 3HGOA 1VAHA 3M6YA 4PFHA 4RNHA 2G41A 1GW9A 4ONVA 5J04A 1VEPA 2BY1A 2QGYA 1R6WA 4AISA 2JKEA 1ML1A 3XINA 4ZZ9A 2NWSA 5DMYA 1UQZA 4L9ZA 3P81A 2D0GA 2PRHA 1ZBVA 4A3HA 3SCWA 3U4AA 2XFWA 1GRTA 5A69A 4H4UA 1XDJA 4A3YA 1FA2A 1J6PA 1NOWA 3W88A 3W7EA 3FGCA 2CLHA 1HL2A 4UXDA 1TA3B 2NX1A 3N9SA 3WBEA 1EUAA 4ZQNA 3TOYA 4AWTA 3LSCA 3VTRA 1T96A 2PDIA 1DVJA 2HEJA 4M56A 4H9YA 3OU8A 3LA4A 5G2HA 1JZ3A 4MWAA 2W6RA 3QFBA 4JDYA 4JDRA 3NSNA 5CJ5A 2V69A 4EPKA 1MZRA 2OZ3A 2C6QA 1NP2A 4WEVX 2V5CA 1U33A 5GQBA 4XQ6A 5I3KA 3AIRA 3ID7A 2WZHA 5LNVA 1NDZA 1Q6LA 2JIWA 3R11A 4LALA 1UZ4A 2A7PA 1N5WC 4ZODA 2A3HA 2YBUA 4GGHA 1XICA 2UWFA 4GIEA 2CHNA 4BEUA 3UQNA 4WIWA 1DWGM 1Y7VA 1J10A 3LI0A 3EGJA 2ANUA 4EAMA 2WSKA 4H4PA 1TQJA 3GBDA 1Y5XA 5I24A 1O5QA 3ZSSA 1OX5A 3FNDA 2DZSA 3VNIA 3RCYA 1HKVA 2E68A 1WKEA 3M0VA 3E3HA 2QJNA 1I60A 3N13A 3R25A 1VYRA 3B9AA 3UCDA 1GOQA 4H4SA 2VEPA 3DUGA 2FVMA 1LG1A 2ZA1A 3AUOA 4U33A 1P0BA 1CGVA 2CLMA 4O11A 1KRCC 1DP0A 4N7QA 1O5KA 2H9AB 5LHEA 3W70A 2PTXA 1DBTA 1ZBWA 4AH7A 2BASA 3N14A 3DG7A 4XAGA 3RPDA 3AMZA 3PBMA 1V3KA 2OSWA 3BAJA 2FGBA 1E6ZA 3HQOA 1XFBA 5FJTA 3AU6A 4Q8TA 1I2PA 1GQJA 2YBTA 1HL9A 4WRHA 3H55A 4LUYA 3SQPA 3PWGA 1W3HA 3LGEA 3MMTA 3USBA 4TIMA 5FCZA 1ZXIC 3GVVA 3STCA 4PCNA 4NF7A 5FAGA 1LL7A 2GJXB 3WG6A 4NJKA 3W24A 1XINA 4H6RA 2W63A 1VIWA 3W1QA 3K1DA 1U1UA 3GDRA 5I06A 3C2OA 3T6CA 1KBLA 3AN1A 3GXNA 4M6PA 3MDWA 4MDPA 4O13A 3BGAA 2PD9A 7XIMA 1MFVA 1W1YA 1WNOA 3ABZA 2VC9A 3ARSA 1KA9F 4FIRA 3TCEA 4US5A 2IUZA 3UG4A 3LERA 4OQVA 3OLEA 3EF6A 4O12A 4S3JA 2BVTA 2EPKX 1WA3A 1KM0A 2V2HA 3PNZA 4V1YA 1RPKA 2VVNA 1TWDA 4IIGA 4A3UA 1IEWA 5HUOA 5BMWA 1S3HA 1CXIA 3S2NA 1HNYA 4IMCA 2CHRA 2WC7A 4K38A 3AJ7A 1SFLA 4R53A 4LAUA 3ZVHA 4DF2A 2DGAA 3PG6A 1O68A 4HSNA 2NX9A 1SQ7A 3B0PA 4PBFA 4DM1A 5CGMA 3GY1A 4KWWA 4PODA 5I5RA 9RUBA 3LCHA 1GPWA 3A22A 3T0TA 1N63C 1F61A 1E71M 3DHFA 3VUPA 3GO2A 5F2IA 4GIYA 4B3LA 4ZB0A 2VL4A 4MJ2A 4MADA 4NZFA 1XGEA 1UASA 3EOEA 2CPUA 1A0EA 7CGTA 3TVAA 3ZJKA 2PLKA 3ARWA 4DUVA 4MLJA 3AYVA 2AL1A 4GZIA 2OLSA 3UF9A 1YDYA 5FEXA 2WANA 4MPQA 2V8ZA 4BF7A 4E8CA 5I3IA 1I2RA 3KTSA 3SFWA 3OQ8A 3CASA 1ZMCA 5BOOA 1DJIA 2NVCA 3GE7A 4M1BA 2GQ3A 3KOYA 3W75A 1YBQB 1QPQA 1VCFA 4EIVA 2OT1A 8TIMA 3WH8A 1UD2A 4RV8A 4AY1A 3S9ZA 3EWUA 2I5GA 4ML4A 2GR0A 1A4MA 1H7RA 3CIVA 1LTDA 2WQDA 3QSTA 2QPUA 1EJWC 4ATLA 1EJTC 1TO3A 3GNXA 3IIPA 1FHDA 1LQ2A 3QBUA 4J9JA 2RDUA 5KETA 3ME3A 3OJGA 3DBPA 4YWOA 1C92A 3CL8A 3DKLA 3U7BA 4Z17A 1XRTA 3PUGA 3WELA 1OGGA 3ECQA 4C6OA 2VRQA 5HQMA 4PEEA 3TDFA 3M5ZA 5EB8A 4W9TA 2NQZA 2Y5JA 4E8GA 4AY8A 3A13A 4RLIA 3BLKA 4Z0JA 1ZENA 1T5AA 1LT8A 1TPH1 4IOTA 3ANVA 1JOAA 4LYRA 3NYZA 1HZYA 1I45A 5DY3A 2WXDM 1NP0A 3C0QA 1DQXA 4PCPA 3VD9A 1W9VA 4DWDA 1F8WA 2AQWA 4G5DA 2OFJA 1UUOA 1QMLA 1KC7A 2CESA 3GAYA 3QJAA 3LCXA 1CI1A 3GNRA 4BQ4A 4POCA 2GVGA 2B7QA 4B16A 3KBMA 3NR0A 5K9XA 1WO2A 4AXNA 2Q01A 2V2CA 3BAIA 1T8QA 3BPWA 5D32A 2V5BA 3L0KA 2DH2A 3F4VA 3UCQA 4ZE4A 4AQLA 2OSXA 3BAKA 1RVGA 3MY9A 3AIEA 5CAHA 3GVRA 2DVTA 3ARVA 3WLRA 1ZKQA 1H60A 3OZMA 1CIUA 1CPUA 3VDHA 3WNKA 1IXNA 1BQGA 3TWAA 1NEYA 1SUXA 4HP5A 4RPPA 3BGGA 4QBXA 3UNTA 3MVTA 1OK4A 1DV7A 1B3XA 1KCXA 4FOKA 3D3FA 1BWLA 4EMIA 3BOXA 3TCSA 3KS6A 4LCRA 3AXXA 2D2OA 4F0RA 2WKGA 5CQ1A 1DJYA 2CZDA 5D09A 5TD4A 3KL0A 3ZR5A 1UMLA 3V75A 4IH3A 1VFMA 2V38A 3ZYZA 3SCNA 5A1AA 3STPA 4LVBA 4XAFA 3C61A 1UP0A 2YW3A 4H4ZA 4DN1A 4I9MA 4Z1DA 4X9YA 2YAUA 3II4A 3MZ2A 2PAJA 2ZDSA 3ICJA 3SAZA 1CGXA 3ABXA 3PJXA 5LHFA 3KRZA 3WMLA 1UWIA 5HOSA 4K7VA 3QPEA 4PBGA 2VCAA 4PC8A 4HNVA 1LBMA 2YDQA 3EMCA 1YE6A 2EAWA 1XCFA 3HFTA 3UWVA 3KL3A 3IJ9A 2FB2A 4GO8A 4UQDA 6REQB 2HJPA 5AHNA 1W9DM 2FTPA 1PUDA 2J8FA 4DWSA 5LNUA 3PC0A 3W2LA 2ZZ0A 2RDTA 4O14A 1X6UA 1E6QM 3F4WA 1JF6A 3W1TA 5A94A 4HU0A 3N9RA 1KTNA 1UUQA 2J6XA 2C15A 3C0JA 1D3CA 4G7EB 4DZ5A 4IJBA 4XAPA 3FSUA 4MPKA 5DT5A 3P82A 3DHPA 3A7AA 1G7UA 3AROA 1RK5A 2QLYA 3AMCA 1JRPA 2E1WA 1S5TA 1QI3A 1FECA 3VYLA 5JU6A 1E4NA 2Y8VA 1A5NC 1CWYA 1HIZA 3HJZA 2OZ0A 1KB3A 1KR0A 1R7AA 3WDIA 1MDRA 4JTEA 1E3XA 1PO9A 2KX9A 4TO8A 1ZL1A 4F0MA 3L67A 1J2WA 3LHZA 1HFBA 3E49A 3GNOA 1DOSA 1F5ZA 4PMOA 4IF2A 3BQ5A 1E6XM