4KPLA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
404
structure length
384
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
rcsb
source organism Chromohalobacter salexigens
total genus 145
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kplA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kplA01
2GGEA 2PPGA 5FJUA 3QKEA 4YWSA 3ZLHA 3JVAA 3R11A 3EKGA 4M6UA 2P0IA 3THUA 3H7VA 1ECQA 3ENLA 2DW6A 1JPMA 4GIRA 2OLAA 3OW1A 3OP2A 3GC2A 2PSNA 4F4RA 4JHMA 2NQLA 4DN1A 4HPNA 3DG3A 2FYMA 3CAWA 3RRAA 4IHCA 3TWAA 3MWCA 3ZVHB 3U9IA 4E8GA 5FJPA 2AKZA 3ZVHA 3OTRA 4H2HA 1ONEA 3FJ4A 4E6MA 3IJLA 4GGHA 3H8AA 1SJAA 1PDZA 2HXUA 5ENLA 3UXKA 2CHRA 3H12A 4HCLA 3PFRA 3ZLFA 3Q4DA 1JDFA 3D46A 2PMQA 2PGEA 2QJNA 2GDQA 3ZLGA 2XH4A 4KWSA 3EEZA 4J1OA 4J3ZA 4X2PA 2GL5A 3DG6A 2HXTA 4MKSA 2O56A 2XGZA 2XH0A 3DERA 2PTXA 3CT2A 3GD6A 3DIPA 2HZGA 3TJIA 5BOFA 3SQSA 1RVKA 2XSXA 3D47A 4DXKA 2QQ6A 2P88A 3IJIA 1P48A 3VC5A 1OEPA 4HCHA 3ZVIA 2ZC8A 1JCTA 1ELSA 2RDXA 2XH2A 4K2SA 4E4FA 4IT1A 2QJMA 1EC9A 3MUCA 2GGGA 2PTZA 1EBGA 2OZ8A 3JZUA 1IYXA 3DEQA 1P43A 3FCPA 1JPDX 5FJOA 3I4KA 1DTNA 4ROPA 3DFHA 3N4FA 1BQGA 4HCDA 1SJCA 4DYEA 3PWGA 2PODA 3NFUA 2GGHA 3JW7A 3PWIA 4E4UA 3VFCA 3TW9A 5J04A 1F9CA 2QJJA 3K1GA 2PU1A 1MDLA 2AL1A 4IZGA 4EWJA 3ES8A 3T9PA 3UGVA 4FP1A 3UJSA 1TZZA 2AL2B 3UCCA 3CXOA 1R6WA 3P93A 1EBHA 4GGBA 1EC7A 4K1WA 4IP5A 4HNCA 2P8BA 1WUEA 3FXGA 2OZ3A 3N6HA 3RO6A 3OPSA 1MDRA 3UJFA 3R25A 3TCSA 2PTWA 4A6GA 3N6JA 1MNSA 3RR1A 2PS2A 2XH7A 3S47A 3SJNA 1W6TA 3VA8A 2GGIA 3PK7A 4M0XA 2ZADA 3UJRA 4A35A 2QDEA 3BSMA 2QGYA 3CB3A 1EC8A 4H1ZA 2GGJA 3Q45A 2OPJA 2PP0A 3MY9A 2PU0A 4GISA 2PP1A 3R0KA 2OFJA 4GYPA 4DWDA 4A3RA 3CYJA 7ENLA 4KT2A 2MNRA 3DFYA 4JN7A 3T6CA 2POZA 3I6TA 3SN4A 2OQYA 3CK5A 3VC6A 1YEYA 4HN8A 3TOYA 2QVHA 3BJSA 1FHVA 1TE6A 2AKMA 4IL2A 1FHUA 2P8CA 3N4EA 3NO1A 2ONEA 1SJDA 2OVLA 3DG7A 3TTEA 3RGTA 5EU9A 3SN0A 4GMEA 1PDYA 3GY1A 3T4WA 2PTYA 3V3WA 2FKPA 3MZNA 4H19A 2OKTA 3QLDA 3SSZA 3IK4A 3V5CA 1KKRA 5FJRA 4FI4A 4KPLA 2MUCA 2OG9A 4ZCWA 3QTPA 1NELA 2AL2A 3UXLA 4GFIA 1TKKA 3B97A 1XS2A 1MUCA 3U4FA 3DGBA 3STPA 3UJEA 3SBFA 3IJQA 3FYYA 2PA6A 1R0MA 3MKCA 3SN1A 4HYRA 3OZMA 1KKOA 4E5TA 1L8PA 3GO2A 3NZGA 4IP4A 3RITA 2P3ZA 4Z17A 1E9IA 3MQTA 3UJ2A 2I5QA 3VDGA 1MRAA 3DESA 6ENLA 1KCZA 3FVDA 4GYPC 3S5SA 4KEMA 3RCYA 1BKHA 1SJBA 2PCEA 3UCDA 3NXLA 3R1ZA 3KUMA 3T8QA 3TQPA 1XPYA 3ES7A 2DW7A 5BOEA 2QDDA 3FV9A 3R0UA 4Z1YA 4MGGA 4K8GA 1WUFA 4JN8A 3BOXA 3VCCA 2PP3A 4MMWA 1KD0A 3I6EA 4DHGA 2PGWA 3OZYA 2HNEA 3HPFA 3QN3A 4G8TA 4G7FA 3V5FA 2OQHA 4HNLA 4DX3A 3P3BA 3P0WA 3V4BA 2GSHA 3R10A 3TWBA 4H83A 2OZTA 2OX4A 1NU5A 5FJTA 3TJ4A 3H70A 3VCNA 5IDZA 3DDMA 4ZA0A 3MSYA 4IL0A 2OO6A 4ENLA 3QPEA
chains in the Genus database with same CATH superfamily
4WSKA 2I9EA 3CMFA 4RE0A 3CIWA 4W86A 2GGEA 4QCFA 2VGGA 3EKLA 2RHGA 1TYTA 1ONXA 4OTKA 4HMEA 3WLLA 3OGRA 1G4PA 1W9XA 4Z42C 5G2IA 4S3FA 1XDJA 4MAZA 2Z29A 3KWSA 3RRAA 4WCJA 4LV9A 3AICA 4Q4RA 4UMAA 3TWAA 3GRTA 4H9TA 3G18A 1MSSA 3MWCA 1GONA 3TTSA 2VI0A 2Z1VA 1B9ZA 3UZYA 5BU6A 3W37A 3C52A 2VDHA 4TV6A 3Q94A 1KBIA 3PM6A 1TSIA 4DBEA 1LCOA 1TCMA 1P7TB 2WPFA 4XSMA 2PC8A 5CAKA 3M4HA 1D9EA 5ENLA 3OG3A 1BWLA 2FZNA 2Z28A 3HF3A 5H1WA 1B2YA 1BKSA 1ECEA 2IXVA 2J66A 4ERAA 1X8FA 1Y65A 2A7RA 1JQVA 2PD9A 4G1NA 4B3ZA 1I75A 1DWGM 4PEEA 1CXLA 5J5DA 3WF3A 3NQ6A 3TFCA 4JTGA 2NVKX 1Q7ZA 1NJJA 3M6YA 4ASTA 4NAEB 2QHAA 2WBGA 5LA2A 3HQNA 4HMNA 3TP4A 3LCGA 5A2BA 4LVAA 3IIVA 1OQFA 4INFA 4X9SA 3IJIA 3CQIA 3KCLA 4AD4A 3EWUA 4UTLA 3I7SA 1EGZA 2R24A 1N61C 3CB8A 2CHNA 1DJWA 4GI4A 1DIEA 4XZWA 3GR4A 1JZ7A 1L6WA 3LHZA 4FOJA 4PGLA 2E5AA 3M07A 2DSKA 1WP6A 1DXLA 3KFTA 2DVUA 3DFHA 2POTA 3RG6A 3N4FA 4FNUA 2Y5JA 4HZMA 3OYZA 1H7NA 3IUHA 5CPSA 1R46A 3SCNA 3UY7A 4NT0A 2PU1A 1MDLA 4FALA 5DANA 1W0MA 3DUGA 1W3JA 3ONCA 3EOSA 4HGXA 4F2UA 4N7QA 4K1WA 1H1NA 3A9BA 1QW9A 2XHYA 4QG8A 2FHBA 3KOZA 1UPPA 5A6MA 4IGSA 4U2ZA 3VIPA 1S2UA 3LN3A 3RJYA 3CGCA 1NP2A 2ATSA 1GRGA 4C1NB 5K9DA 3ARXA 1W9PA 4PMVA 2X09A 2KAUC 3U2OA 4AB4A 4C1KA 2PRLA 2ADAA 3FG2P 1X96A 4H8VA 3HGSA 3RX2A 3AU2A 4GC3A 4JFTA 4KGLA 4TMCA 2WLYA 4OJYA 4ADTA 3AIQA 3VA8A 4P7OA 1ZQ5A 3EA2A 2WJEA 4XO6A 2X16A 4QLJA 1LPFA 5C5YA 1U5VA 1POKA 2C14A 3K5XA 4H04A 3WLPA 1RHCA 2L5HA 4UTJA 2PWHA 2HCVA 3KZSA 5A6KA 1CGWA 3BW4A 2Y6ZA 3W7KA 3WZ0E 4Y7EA 1J96A 2W3RA 1E4LA 5JCNA 4MPKA 1R2RA 1WNOA 1KRMA 4YMZA 5A8MA 2FIQA 1MRQA 1Y0EA 3N15A 3DFQA 2A7PA 3BCDA 3IGUA 1R3TA 1OF6A 3G1DA 2OQYA 3U2ZA 5DMYA 1GQLA 1XIMA 4OZOA 2QVHA 3SECA 3ANUA 2ZZ7A 1Z8AA 2CLEA 4JCMA 1BYBA 1JNDA 2GZXA 3U2EA 3UWVA 3EWBX 1PZ0A 2NT0A 2OEKA 2DQXA 1YPIA 3BOLA 4LF1A 3MYPA 4AZ7A 3POHA 2YA2A 1QPKA 1B4KA 1KW1A 1AA1B 1TTIA 4A4AA 3B8WA 1E0WA 3A4AA 4FSAA 1RD5A 5IBXC 1O5RA 3W38A 1KTBA 2YCIX 4ADSA 3DKLA 2FPYA 2VCAA 1JUEA 2TYSA 1KFEA 4DUWA 3R6IA 1HKMA 3NL2A 2A2IA 4YTQA 4WGHA 1X2HA 4AWUA 4P8UA 3DHPA 1WZAA 3WNLA 3S1VA 2QDGA 2HNHA 4N9DA 3QFBA 1S2WA 2YCLB 3EDDA 1W8SA 1JVNA 4BF9A 2DT3A 4KFPA 2YFNA 4X0NA 4ROQA 4BS0A 4UTMA 4LPCA 2R91A 4PSRA 3EDKA 1AODA 4W5ZA 1E9IA 3AYVA 3NXFA 2I5GA 2GJXA 1JRPA 3IUIA 1CLVA 1HKVA 3AO0A 1C90A 2WVUA 1WOAA 3RXZA 4RKAA 5D30A 3WF1A 4DF2A 4LU0A 1GTHA 1XL9A 4PUUA 5TD4A 3CLWA 4NASA 3PR2A 1JD7A 3E38A 4AWSA 4LUTB 1D3HA 4XTDA 3CHVA 4ZQCA 4L56A 3UWYA 3FKKA 2HJPA 4DJFA 5CSUA 4NJKA 1DTUA 3STEA 2DZSA 1OYCA 2V0TA 4M3PA 4MG4A 3ZWTA 4LYKA 3NVDA 1KD0A 4ML9A 1WDRA 4L80A 1SW3A 3IK2A 4EF8A 2WB5A 3C2OA 1BGAA 5F2IA 4JYDA 3P0WA 5PTDA 2WBAA 8CGTA 1R86A 1NARA 2AAAA 1Q6QA 4S3EA 2OO6A 1LOLA 3ARZA 2YDQA 3KX6A 4XUYA 2A8XA 3AMLA 4KRZA 3AUOA 3H7UA 4M6UA 1K8ZA 1E1FA 1Z48A 2ZRWA 4P8WA 3GU9A 4OOZA 2QPSA 4AIBA 2YL5A 3EMCA 4PTDA 1HJXA 3LA4A 4UTWA 1W9DM 1UWAA 2OB3A 3WLRA 3G24A 1B54A 2O7QA 1HX0A 1Q6CA 3GRSA 2Z6JA 2DDXA 1V77A 3RK8A 3FGCB 1VB9A 2C19A 3MDUA 2CZ5A 2CEQA 3ARWA 3B0XA 3NR0A 3BSHA 3P80A 4AVNA 3VMOA 3PBGA 3UCQA 5DF0A 1TMHA 5CH9A 4BQ2A 3TQ0A 3DGZA 2PRMA 2WCGA 4ZODA 1FDYA 1NHPA 4G1KA 5GNZA 2CPUA 2QAPA 1ZL1A 2ISFA 3D3AA 2QJNA 2ABBA 4AUBA 3STCA 3E02A 2ICSA 4JQ2A 4FX6M 3SFWA 1FWIC 1VJZA 2FHCA 4D6DA 3APYA 3T05A 3W1PA 3KTXA 1BSIA 1FIQB 1SR0A 1B3ZA 2X0SA 2ZIDA 1XSJA 2TAAA 4LSBA 4N9EA 3NNTA 3P7YA 4GZJA 4Q8PA 1UZ1A 3VIIA 4R27A 5LA1A 1VD6A 1GPWA 1EOMA 3E5BA 4D1IA 3TKFA 3QMRA 3OVRA 1XWYA 3SRDA 4BURA 1V6XA 4HA3A 1ZLPA 2RDXA 3FAXA 4E4FA 3U48A 4A29A 2DORA 1XQLA 1WA3A 3HFTA 1E3ZA 3UXIA 2EKGA 3S1UA 1SO4A 3NOEA 1KWKA 3P84A 6PTDA 1XPGA 4UZUA 3A21A 3GAYA 4L65A 1FKWA 2ZVRA 1T8QA 4C91A 2GRTA 1UWQA 1B90A 3GG1A 1XLMA 3LG3A 3GDBA 1FDJA 3ITCA 3WUFA 4UB9A 5C2GA 1XHGA 2AL1A 3W7CA 3FXYA 4EWJA 2CLHA 1D7KA 2ZRUA 2OODA 2D73A 4QP0A 4DZAA 3NRZB 5K2ZA 3EOEA 1GGOA 2WNWA 4HTYA 2CBUA 2Q3OA 3MJMA 4HNUA 3NQCA 1FWDC 4GR1A 4NJHA 1XCWA 3UF9A 3MBDA 2E68A 1YDYA 2J7FA 3AZSA 5IXEA 4PMOA 3POCA 3BAKA 5JBFA 3OLGA 3SY1A 3AMZA 4WSHA 1E5JA 4NQ1A 4GABA 1K9DA 3GNNA 4FX7A 2ZC1A 3S1GA 2B7PA 1P7TA 3KP0A 3DK4A 1BZLA 3H24A 1Y7VA 2CZFA 4O52A 5EA9A 1M1BA 4J35A 5LIUX 4P5UA 5BRQA 3AIEA 2B81A 3E12A 1DEDA 1HKKA 2PF0A 2PWFA 3D5HA 2NT1A 4GQQA 3B8SA 5C8BB 5EFDA 4OWGA 1B0IA 5DT7A 1PPIA 1MO9A 1J5TA 5KSWA 1XXXA 3MKKA 5BRBA 4MHBA 1GWJA 2PU0A 4W4QA 4EXAA 3BG3A 2Z1SA 1JULA 2VC7A 4NAEA 1QI5A 4QSFA 4HPJA 2V3BA 4K3ZA 1VRDA 4PB4A 2Y63A 3RU6A 1LL6A 3SQLA 1CGUA 1HG3A 3SN4A 1EP2A 3NL3A 3THDA 2VEGA 3WBXA 4YVPA 4YU1A 4PMZA 1YNYA 2A85A 1LQ2A 1GJWA 3A9IA 3BJSA 1TMQA 2RUSA 2QCGA 4O4WA 4QGCA 5BWFA 3BXWA 4FIRA 3SY5A 1WOBA 1ESWA 3ICJA 1SR9A 3B03A 3QQ1A 5D32A 4MF4A 2CLFA 4MTVA 3XINA 3TJXA 2W0HA 4BA0A 1L6SA 4CCCA 4A2SA 1WAWA 3T08A 1EB3A 4GOAA 1HVQA 3D6NA 4CUCA 2Z7KA 3IK4A 3OVPA 3SUVA 5FJRA 4D6CA 1XIFA 1JXJA 4QAWA 1IT8A 3QQ0A 3BH4A 1VIZA 5HA7A 5HQMA 3SURA 3THCA 4EMWA 3NQMA 2OYKA 3PUEA 3AS0A 3TLQA 4XKYB 4N4QA 1BTCA 3UA4A 1ME9A 3M46A 2WP6A 3OGVA 3BJFA 4C1NA 4M56A 1JQXA 1OFEA 3WYZA 3QM3A 1Z41A 3URBA 5CBIA 1S2TA 3BLKA 4IX2A 3FEMA 1PZ2A 3RJXA 1KBKA 3TQVA 1CGYA 1MRAA 3W0KA 4JX6A 3W71A 2A21A 1V6WA 3IJ6A 4UC5A 4DPPA 3UEQA 4F0SA 1FWCC 3TN3A 2R9ZA 3TZFA 3UYIA 3KRZA 1V03A 1GOKA 3V36A 3FYPA 3C0JA 4JDYA 3IJ9A 1DIKA 5FI8A 3CUJA 1T8XA 4NY2A 3TCEA 4ML4A 2BSLA 1J12A 3L65A 2VQUA 3UVAA 2NQ9A 3AIUA 2GVYA 5HWMA 3TSBA 3WDHA 1NF0A 1TJPA 2V9DA 4Z1YA 3LGDA 1YTDA 3LXBA 4K8GA 1BXBA 1NEYA 2GWGA 3GYEA 2HWGA 1FXQA 3UP8A 1O4UA 4AYGA 4GC4A 1P1XA 2FTYA 3KCJA 4YNGA 3BC9A 2OCZA 3V4BA 2GSHA 1F7BA 1T6MA 2UY5A 1V3MA 4A05A 3T0DA 2FPVA 2BGNE 5CBJA 3CUHA 3GHUA 3DHDA 3Q65A 5MF5A 3S1WA 3OHMB 2PPGA 2BWGA 5H8MA 1XBXA 4GNKB 2CESA 1ECQA 2XVNA 1ZZMA 4XD6A 3TAOA 5E6ZA 1W91A 4ES4A 1UC5A 4V33A 3GC2A 3MHFA 4XQ6A 4JHMA 2P53A 1NH6A 2IQTA 4AY1A 3A13A 3MP4A 4HHMA 2ACUA 3DG3A 8TIMA 3EWWA 1K8XA 3SGUA 2O4QA 1E6QM 2GVJA 1XLKA 3W85A 2H3DA 3VD3A 2FGZA 2OXNA 1UZHA 1RXOB 1Q85A 1KB3A 3GLCA 1A47A 4NIRA 5HMSA 1PDZA 9RUBA 5M2FX 2HXUA 4J40A 1H50A 3LTSA 3PFRA 1M5WA 4O54A 4Y6GA 3WK3A 1J0YA 2V38A 4JIHA 2HBXA 1Q45A 5I07A 1Q6RA 4GI6A 3EB4A 1K3UA 3OIXA 1XRTA 4LUTA 1RJQA 4B2DD 3CASA 1K4QA 2Y7EA 2GR3A 4N2YA 4QITA 3GZ3A 3NZPA 4M1BA 4MY9A 2BVWA 2IMRA 1JRBA 5HK4A 2J6XA 1OJTA 2Z00A 3W1RA 4DJEA 2YVGA 1XH0A 1UD4A 3L2IA 2XJ7A 3KBMA 3AYRA 1JYXA 1CLXA 1MXGA 2OZ0A 4R88A 1VJIA 4LCRA 1XYLA 5I23A 3LCXA 3RO8A 3QHNA 1XDLA 2PLCA 4JTTA 2QJMA 3T44A 2PWVA 1TUXA 1WXYA 3U57A 3K8MA 1VAHA 2PTZA 3WMBA 1GK8A 1UIOA 4YTRA 3T40A 3EA3A 3IVSA 4WDWA 3CZJA 2QT3A 4TVWA 3ITOA 2CBVA 4JQ4A 1WO2A 3GU1A 4V15A 3DU0A 1K4HA 2PDYA 5U1OA 3WJYA 4GHRA 2V2DA 1MFUA 1NDVA 2EEXA 1JPHA 1A53A 3IANA 4V27A 2PFHA 1F9CA 4QISA 1L6GA 5AYIA 4MB3A 2QKFA 4IMAA 4US5A 1WPCA 1AJ2A 2WCAA 2WK2A 1VFHA 4LC8A 4CNSA 3W7LA 1KXVA 3LRLA 4U33A 1G4TA 1V8EA 3UZXA 4IP5A 4HNCA 2V30A 3FGCA 3OPSA 3EANA 3NS1B 4EXQA 2ZXBA 2AGKA 3T8LA 3IVUA 2ESCA 3RLHA 4B3KA 5I7GA 4FS9A 3VPLA 2TSYA 3RR1A 1NSJA 3S47A 4GQ0A 1AW1A 1CWYA 1VQTA 3BJTA 1IEVA 4M19A 1U2YA 3GVGA 3WELA 4IG2A 1HT6A 3EXRA 1W5NA 1KV5A 1QNOA 1XIHA 4WDTA 3UU0A 4BCEA 3DHFA 2EG6A 4G9PA 3U7VA 4FNTA 3BLDA 1G4EA 1UR0A 1DE6A 2GUBA 3IRDA 2DT1A 3VKDA 4CNPA 2CLMA 3RPMA 4IX0A 4AQLA 4IOTA 2E6YA 3CPRA 3KHDA 4WX2A 2PP1A 2XPKA 3AXKA 3W74A 5IHSA 1XCFA 2RDUA 4KT2A 3HMJG 3DKJA 4B5TA 1E0VA 4JN7A 4LEQA 2ZTJA 4JICA 3ZXWA 1TZ7A 4MKNA 4IMCA 4EANA 1B3WA 3QR0A 2VEFA 2EQ7A 3TOYA 4MUZA 3KL5A 5CJMA 3MP3A 2NX9A 1XUZA 4QDPA 1ONWA 3G5EA 4AVOA 4C6JA 2DUXA 2OT0A 6REQB 1TREA 3KW3A 2V5JA 3WEOA 1CXFA 4A8RA 2FHFA 1J2BA 4CGTA 1PDYA 2OKTA 2ZFAA 1A3HA 1IGWA 4H9YA 4GNVA 2XYLA 1FWHC 1VC4A 1CLKA 2E1DA 2EF9A 4N02A 4AD3A 1N5WC 1H09A 4BF7A 4DBDA 4IMGA 3B97A 1I1WA 2UBPC 1XRVA 3OA3A 2PLMA 1BFNA 2A3HA 3MKCA 3MJYA 5A3HA 1ADDA 4LC6A 2OSYA 4BV6A 2Z2BA 1L2QA 2BXZA 1KM2A 2WSKA 1L8PA 3SUSA 2Q02A 3CLMA 3GFXA 5HMDA 3LADA 1FY6A 4UQDA 4L5ZA 3M0XA 2I5QA 2WP5A 2IKGA 1XYFA 4JQ3A 4U5IA 3U0HA 3UFYA 3F2CA 1KR1A 2Y1HA 3A4WA 3NQ7A 2FFIA 3VE7A 2VX5A 1V02E 4WJEA 1KC7A 2H90A 4GK8A 2WSYA 3M7SA 3NSMA 5A8OA 1H0GA 4QJ3B 3G1XA 2OT1A 2DFAA 2IUZA 1ADSA 4H50A 1OT2A 1W5QA 3GG0A 3AWOA 3NURA 3ZJ7A 2CLOA 4ZZ9A 2BXVA 8XIMA 4ZXLA 4H8NA 4CU6A 3CEPA 1OINA 2ZVIA 4YTUA 4YWIA 1XSIA 3CO8A 3WK2A 4AMCA 5I24A 3C8FA 4JTJA 1WKYA 4UNLA 4MYAA 1WX0A 3SR7A 4S2BA 4D6GA 2HVOA 3TTYA 2E6DA 3NEHA 3V5FA 3ISIX 3RYSA 2FJUB 2GSJA 5CPTA 2C3CA 3WDPP 1I2NA 1R3QA 2CKSA 4TMBA 4DYJA 3GSMA 1LF1A 3AC0A 2WKJA 3VCNA 2VX6A 4B91A 3DAQA 5CJNA 5IDZA 3UG8A 1OX6A 2D0FA 1RJPA 5DCDA 4IFOA 1GVRA 4ICCX 2A6NA 3H7VA 2C1IA 3SI9A 3VTRA 1VYSX 3RM9A 5IOBA 2Y88A 3VM7A 3Q2DA 4XKYA 1PTGA 3PBVA 3W1NA 2NQLA 1S39A 4NU7A 3E0VA 2HVNA 3TU9A 3AN1A 1LM1A 1UASA 3LV5A 1UD3A 4UIOA 4LYRA 3V16A 1H11A 2ZZ5A 2XIBA 3AHYA 3TYCA 4LUYA 3G1HA 2J8TA 4AIOA 3LB8A 4BK9A 5F2LA 4IGMA 1ZHAA 3LTPA 2C13A 2CHRA 1FX6A 3F2DA 3ZLFA 4ZQRA 3Q4DA 3VGHA 5LHEA 5EMYA 2E8YA 4QDMA 2PMQA 3CGDA 4WZHA 1UKTA 2RAGA 2J3NA 1Z42A 4Q4OA 3EEZA 2QUVA 3ALGA 3WL1A 4MNJA 4A2RA 3VOIA 1UD5A 3R8HA 4XAGA 3VIHA 1MZHA 1W3LA 3H4WA 7PTDA 3WQPA 5BOFA 2BZNA 4O1EA 4CNTA 2QQ6A 3S1XA 1TWZA 4WJXA 4LAKA 4QS6A 1OHLA 4CVUA 1ELSA 2O9TA 1P0EA 4K2SA 2VEPA 2XH2A 5IHRA 2W6RA 3CMGA 1OX5A 5DMNA 3LCLA 1JAKA 1G69A 4JKLA 4GPNA 4OGZA 4B3LA 2W5FA 1HO4A 3INPA 4DIAA 1UR3M 3DGHA 3W1AA 1ZBCA 5C9XA 1UROA 3PTMA 3LHTA 4H7VA 1EJXC 4QDWA 2QJJA 2PDBA 3K1GA 5J8LA 3T0TA 3V0UA 2WAGA 1LQ0A 1J79A 2PWEA 1O7AA 2E5CA 3G77A 3M5XA 4FMVA 5IFPA 4XAYA 6XIMA 3NZRA 1YMYA 3IGXA 4ZB5A 3ITLA 3GR7A 1LZOA 4JX4A 1S2VA 4RL3A 2GQ8A 2WYSA 3VGGA 4GXWA 4EQRA 5HR6A 1NTHA 4UQBA 2JALA 2Z1BA 2E6AA 4ATWA 3UR2A 3COTA 3TCSA 3G1AA 1IEWA 2ACSA 4KKXA 1J18A 3SQPA 5TR3A 1NWSA 1EO5A 5CLWA 3S2LA 1KXHA 3L4TA 5AECA 2I7GA 1KQYA 1T7LA 3LERA 5FACA 3OA5A 2QXWA 2VT0A 1FEAA 2HE8A 3MUZ1 4IUOA 3EOUA 2EPLX 3S46A 1EWEA 2PP0A 3WQVA 3MY9A 4JS3A 4TUFA 1UMLA 3G2GA 2JGQA 4TXEA 4RDWA 1XDIA 1QTWA 4US6A 1GETA 1JAEA 4C5ZA 2DSZA 3FA5A 5AYYA 4AD0A 3O0KA 1TZ9A 4CQCA 5AC8A 5D02A 4UZSA 4DM1A 1EJVC 5G2HA 3ZYZA 2Z1WA 1RY8A 4O1AA 2FB2A 3T55A 1SW0A 2ZUNA 3VXGA 3DFPA 3GIQA 4CNNA 3NZQA 4K8DA 3PJXA 2H8XA 1AMYA 3QHMA 1FHUA 2P8CA 5XIAA 1K8YA 2Y70A 3W1TA 4MADA 1FP8A 1GORA 5GJNA 2WMJA 4AISA 4TVDA 4FAMA 2VZVA 3LOTA 5C2XA 4H19A 1OZMA 5A8QA 3CT7A 3KBVA 4PUDA 3OYXA 1ZY9A 2J4GA 2MUCA 2VENA 4AD5A 1H7PA 3GZAA 3TV8A 2D3NA 3BAWA 3L0KA 1Z6KA 1XS2A 4GUFA 1MXDA 4ZO7A 1AH4A 2PUZA 4NZCA 3MSRA 1K70A 5A8NA 3GTHA 1JCYA 1K1DA 3VIOA 3LRMA 3T2QA 1OGBA 3ANVA 5AC5A 5LIYX 3CH0A 3OZMA 1RQBA 3L5MA 1EJUC 1S46A 2BODX 4QROA 1J2WA 1TVPA 4LGXA 7TAAA 3RMEA 3FK4A 5I3HA 2ZDSA 1PKMA 2BASA 2RDWA 1Q65A 1S38A 7REQB 2V81A 3N6QA 4LY4A 1U1UA 4ZO8A 1W1A1 1OZQA 3QEZA 2X8GA 2J78A 1BKHA 1I45A 1PTAA 3GIPA 3L4UA 1RVGA 1M7XA 3KVJA 4U28A 4CVWA 2HPIA 1OABA 1OC6A 3C2VA 3MO4A 3HPZA 3GUGA 3ARPA 4TTUA 2EBNA 4HNNA 4JCLA 1EGVA 3EXSA 4A8LA 4Q7IA 4QNWA 1WKDA 2QCCA 5DFAA 4MGGA 5LNUA 4Z2HA 5FF7A 3L21A 5BROA 1I8JA 1AQFA 1WUFA 2A5HA 3OLIA 1DVJA 1C8QA 4R9OA 1UA3A 1XBZA 2HMCA 2WMFA 1NPXA 3D0CA 3MVTA 3G0XA 4JDRA 5LNVA 3DC0A 3EDFA 1U1HA 1JEZA 3AMCA 3CBWA 3P3BA 2Y85A 4UQCA 1U83A 2PDHA 1H7RA 6REQA 5FEWA 4HNTA 4UMBA 3VZZA 3TJ4A 3NM1A 4KPRA 5BZAA 1XYBA 1FH7A 5E0FA 1JROA 3EPNA 3GTIA 3KHJA 2ZX7A 4OFCA 4NZJA 2ZZ1A 3IJ8A 2ZUUA 4I90A 5AVNA 2V67A 1H60A 5FMHA 2XISA 3JR2A 3PTQA 3WBEA 1XFBA 3UQNA 2GVGA 1H7WA 3P14A 5CC5A 2PCQA 3CTTA 4I3GA 4HVXA 3MTWA 4AD2A 4QFUA 4US5D 1H0IA 3LYEA 2R9RA 5CEWA 3ZQ9A 4HNOA 2CC0A 1K9FA 3DH7A 2HS8A 2O0TA 3U9IA 1RBLA 1FKXA 2Z27A 4L6HA 1BLIA 4YS1A 3IJLA 2D24A 5GVJA 1ZAHA 5HUOA 4X3ZA 2EPOA 2F61A 5U7SA 1ZBWA 4R5EA 4YLWA 1K03A 2ATMA 2DPEA 1GVYA 4IIHA 3TNOA 2GDQA 2IKJA 4P7NA 5C0QA 2YAUA 3QBUA 4KESA 4W8LA 4ERIA 3ANYA 4KWSA 3W00A 3AAMA 3AM9A 4L9XA 2GL5A 2X05A 2JKEA 4S38A 4S3CA 4KWUA 4MZ8A 5HQEA 3ARYA 2XGZA 3VX0A 4N6EA 4U3AA 3FLUA 5A94A 2DSVA 1RP8A 3SQSA 4HNVA 3LEPA 1Z9AA 3QQWA 2J9XA 1OEPA 1JGIA 4EMJA 3GB6A 5I78A 1C29A 2NW0A 4ZENA 3R0DA 4XKMA 2FZDA 4KCTA 4U10A 4ZO6A 1TYPA 4PC8A 2PBOA 1XLJA 5CPLA 3JZUA 4MUPA 5D9MA 2VGIA 3WH6A 3KRSA 5AYXA 4EIVA 2BHUA 3DFOA 1QO5A 5EGRA 3I4KA 1WQ5A 1ZJAA 4JY9A 4RDVA 3VNIA 3MV11 1B30A 3FDGA 5GNYA 3E5PA 2PDKA 1LQAA 3PTKA 3WLKX 4C7GA 4N4PA 1XH2A 1KFKA 2ZCGA 1P1MA 1CXHA 3TW9A 1V3KA 3CS2A 5I79A 3Q6JA 1FP9A 3ES8A 3ATYA 2E25A 3AUJA 5C9UA 3TTOA 2B7QA 1TZZA 5BWAA 3DC8A 1FCVA 3FIGA 1QI0A 2WHKA 3UCCA 1R6WA 1SSGA 1AW2A 4MZYA 3OB8A 1IT0A 5IRPA 3EF6A 3PN8A 3E2QA 1LG1A 1RCQA 2FMNA 3EWYA 2P8BA 5IBXA 3M0LA 3WNPA 4X9YA 2OZ3A 1D8WA 1A80A 3VZYA 1YPXA 3TN4A 5LXXA 1ISVA 3K46A 1M41A 1JL8A 3DJJA 3OOQA 1UR4A 4YTSA 2XN1A 3O8AA 5A6LA 2CXEA 1PV8A 5T9BG 1XLEA 1IIHA 4ZBCA 1XLIA 2D2JA 3MCMA 4DYKA 3GVWA 4MKVA 1JYWA 4RXFA 5KZ6A 4TOQA 1C3FA 1O5KA 1U22A 1X38A 2GH5A 2VHLA 2H6RA 5BXPA 4NXSA 1HJSA 1M7JA 2VUYA 4DWDA 3C0QA 4PRWA 3CYJA 5HNTA 3GDMA 3IACA 3R13A 3G8EA 3S2NA 3WLTA 3I4EA 1OFBA 4KETA 3VM5A 4H9MA 1N60C 4GLEA 3I6TA 2PDXA 5G5HB 4DM2A 2B31A 1AL8A 4GX9A 4LUJA 3WLNA 1ME7A 1STZA 2X50A 3VD4A 4PMNA 3QZEA 4JTLA 2O7SA 2ACRA 4O0KA 3UWWA 1ALDA 1FFVC 4L1GA 1TE6A 1OFRA 3M9YA 3TJLA 4NNBA 2GQWA 1I4NA 5DY3A 3VNZA 2RDTA 4EF9A 2ONEA 3GRIA 3D3FA 1VHNA 2BHYA 4UFMA 2FKPA 1LG2A 2CFYA 1Q6EA 1XGDA 4CN6A 5K9XA 2AOSA 2PF8A 3V5CA 1J6PA 1EPXA 3GVVA 3DX5A 1GVIA 1GVOA 2DGAA 3EKZA 2HK0A 5JCMA 2TRSA 2HV5A 3TLLA 3PZUA 2BOEX 4LB4A 1TV5A 1QATA 1OADA 2YB4A 3UJEA 1JZ3A 3SBFA 4AEEA 1WDDA 4LS0A 1W3NA 4TR9A 3PNUA 2G3NA 2ALDA 4HK7A 2CLPA 3KBSA 4JIIX 4F9JA 3AIWA 4RLIA 3GO2A 5HXMA 3BV7A 1V3JA 3RITA 1CECA 4Y8EA 3W27A 5AHFA 3M0MA 4H4SA 2WZMA 4AZHA 5D09A 5TQLA 5G2WA 4C60A 3WH7A 3E2RA 4XZMX 6ENLA 3BAIA 1KWGA 1LT8A 1T5AA 1KCZA 3NTYA 4ZTYA 1A0DA 2WOQA 4NRSA 5F4XA 4Q8WA 2WJDA 4Y9NA 1IV8A 4KEMA 4UOQA 1JZ4A 2XWEA 2WWCA 1H5YA 2VC9A 3PZOA 3FYOA 3ARRA 3FKRA 4L4PA 5DCEA 1FCQA 1O1HA 3CUXA 1E1CB 3CGEA 7CGTA 5CZJA 1PO9A 1Q8AA 4FA3A 3VGEA 1EF2A 4X60A 1XIBA 3NEVA 1QCWA 2F7FA 3JZEA 2XFYA 1OYBA 5JCIA 2YDRA 4ZB2A 1SU5A 5ECVA 1L0PA 3UR8A 3SZ8A 3BOXA 3O6YX 1FWSA 1AVAA 3QMSA 4BQ4A 1B31A 4IPIA 3WNOA 3W23A 1QASA 2ZUWA 4YCPA 1ZS2A 4ZQOA 2D1ZA 2RKXA 2OQHA 4HNLA 2GYIA 1UWIA 3ZR5A 1E43A 1GVSA 1RAKA 3LCIA 4UTTC 3VD9A 1F61A 1E4IA 1OY0A 1Q63A 4KGJA 1HL9A 4ZA0A 4HOXA 2ISWA 1GOMA 2RABA 1XG4A 2Q71A 1PWLA 1XW8A 3P8JA 1Q1WA 3GXPA 3DK9A 5ER0A 2VDGA 4AAJA 4NZ1A 3AXMA 3CC1A 2DV0A 2W91A 2YW3A 1VPYA 3N11A 1W5PA 5U4NA 2D2OA 3H6OA 1KXQA 2BXYA 5CPOA 3WJZA 1W1VA 1CPUA 4DN1A 1FH9A 2Y24A 5CPMA 3O6DA 3W70A 2GR0A 1GVFA 1H41A 1TPUA 3RPTA 3GNXA 4DNAA 1Z44A 4E3VA 3T4CA 2QMJA 1FBAA 2RJHA 3CZ8A 1F74A 1SZEA 4ZB0A 4PRTA 1ONEA 1YTEA 2RH9A 2X8HA 4HT3A 1IZKA 4H9XA 1LP6A 7REQA 3F4CA 3OHIA 2C91A 3DH9A 3QV9A 3NPUA 1UB3A 4CLMA 1H63A 4MAVA 2J24A 2ZWZA 1TPEA 3GW0A 4IJRA 4ADUA 2ZQ0A 4XG1A 4J3ZA 4X2PA 4GIYA 5JQ9A 4M52A 4HIBA 2J77A 1VKFA 2ZZBA 4ERGA 1PIIA 1B1YA 2VUNA 3UWEA 3WH9A 4C1LA 3HV8A 5HNRA 3TVAA 4H8UA 4XZ9A 1H1YA 4F66A 2W66A 2WVTA 5LYRA 3B0YA 1IWAA 2GR2A 1HVXA 4YYFA 3BL3A 3GYCA 4HPHA 4YTTA 1UG6A 1CB2A 4DQWA 1YADA 1BXCA 2XVPA 1J11A 3VNJA 1EBGA 1X98A 1AW5A 3LD5A 1IYXA 3SRFA 1K77A 2A3AA 3NSNA 4FEZA 2X42A 3DOPA 3QW4B 4PMYA 2J9ZA 2NSXA 3UYCA 2DZWA 5F1VA 1E3XA 3W7NA 4F0KA 3A7AA 3GX9A 1XBYA 2C3ZA 3NVTA 4ZOCA 1RCXB 1GKPA 3M16A 3E2VA 1VIWA 2VRKA 5FS9A 3NQBA 6TAAA 3C0SA 2V3AA 1BYDA 2VMFA 3UGVA 4O28A 1I6NA 3TN6A 2X1IA 2AAQA 5GNXA 5JIWA 1BVNP 4UTUA 3IWPA 1XGEA 2G4FA 2E9LA 3W7GA 1EC7A 3W7HA 1S2CA 4H01A 5CGMA 3TXZA 4FLQA 1DBTA 3OZOA 2G8ZA 4ZSTA 2E8ZA 4WY0F 2BY0A 2NV9A 3SCVA 4C5YA 4BJHA 1WAUA 3ARUA 1LL7A 3V7PA 4JTIA 4IM4A 1NP0A 2WW5A 3A47A 2ZX5A 4GJIA 1OT1A 1W6TA 1MW0A 2ZZ4A 2VRJA 1EPVA 5KEZA 3F2BA 1PXGA 3NL5A 1A5BA 4QJ4B 1V3IA 4JXCA 3ORWA 4H9VA 2VZTA 4MZ1A 1IQ8A 4XISA 1ZFJA 4Q8VA 3W7RA 2BX7A 4UTIA 1W5MA 1XC6A 3H4GA 3M0ZA 5I77A 2F2KA 2OFJA 1ZUAX 1NFPA 5FSDC 5I2UA 1EZ2A 3GNPA 2X1SA 3IIXA 1VQZA 3WIJA 3GE7A 3URNA 2CLKA 1TRDA 1SZGA 2DUZA 3TA6A 3KXQA 1MEHA 3CJPA 4MWAB 3EBVA 5HMFA 3MV01 1Q66A 2J7HA 4CCZA 2OKOA 4JKKA 4F8XA 3S2JA 2EJ1A 4DLMA 4AY8A 4HOWA 3A3WA 2QUTA 1SZFA 4OU1A 3H23A 3GHSA 4EAMA 2J13A 2BY1A 3HFYA 1X6UA 2IPGA 4H7CA 4NL1A 4J3UA 1JJKA 3ABSA 2CFFA 3G8RA 1OK6A 1IEXA 3GY1A 1VFLA 4PMUA 4PCNA 1XG3A 4XZLX 4I8YA 4UFJA 2NVAA 1XV8A 1CYGA 2F5ZA 4HA4A 1X1OA 3AJXA 3PWAA 1KM3A 5G4HC 3AS2A 3ARQA 4Z0JA 4OV4A 1MWOA 1W2VA 4OUIA 3J7HA 2V5BA 4W8AA 3MCNA 1MUCA 3MPGA 1SO3A 2BCPA 1WKFA 1QNRA 2P50A 2A79A 3RLUA 5E0CA 4P7LA 3QRHA 1N8WA 3W1LA 4GFSA 5REQB 1HJWA 5CG7A 4Q8QA 2QUUA 1FWJC 1VFUA 3AXHA 1LLWA 1PX8A 4LNYA 2GOUA 2UY4A 3WJWA 4PH6A 5JUVA 3M5ZA 1IXPA 3KZPA 4X61A 2WVVA 1GW1A 3FVDA 1EIBA 2QR6A 4GD0A 4M6VA 4PTNA 2E5DA 2J7GA 1MXSA 3PS7A 1SJBA 3ID7A 4WXYA 4QJ1A 1TJ1A 2PCEA 4GNJA 1VH7A 1KA9F 3PVFA 5DQPA 3TC7A 1P6WA 3BZJA 3GTFA 3WDJA 1W1ZA 2VFIA 2QCEA 3FV9A 1K4GA 3KTSA 3CHCA 4Z2KA 4JAWA 3C56A 1BAGA 4UQEA 4RUBA 3B8TA 3UZJA 3VOHA 5D9NA 2XIQA 4A3HA 4HA0A 2Z1XA 3P0XA 3O0HA 3LZ3A 2X1TA 3DENA 1JYVA 4MIMA 1W1IE 2DT0A 5KZMA 2PLJA 4DX3A 2QV5A 3S42A 3URHA 4JY8A 4H83A 4AMAA 4FXSA 2AQWA 5D2VA 4XB3A 1SM9A 1QNPA 2X7VA 2OGYA 1SYTA 4IIBA 4XZBA 3H2NA 3R11A 4B15A 4GE8A 1DPMA 4UOJA 3THUA 4OIFA 4RE2A 3WCZA 1PX3A 4PCFA 4H4VA 3LM7A 4QM1A 1UWSA 3BMVA 1E15A 4UMCA 3W6LA 1LUCB 3L4WA 3EWZA 4W7VA 3SUUA 2IW0A 3G1SA 1T41A 3VOFA 4DO6A 4EQWA 3CEUA 4WKFA 4MNMA 1F3WA 1LVLA 2X7WA 1ZBVA 4F0MA 4P7RA 1FRBA 4XVEA 5FJPA 4IP7A 3NDYA 4DLFA 2XM1A 1JF6A 4AWEA 4GY1A 3PY2A 1R38A 3I3DA 3DECA 4LJ3A 4AZ5A 2DEPA 1V7AA 1EP1A 3CZEA 1XICA 3HQ1A 3LPOA 4JKMA 4WOQA 2YB1A 1A3WA 4DWSB 2PE4A 4H4PA 4O0QA 4UQ9A 4JIEA 1RR2A 1K9TA 4JYEA 3QGKC 4POCA 2VD8A 1E1CA 2YA0A 1GRFA 4MKSA 1I2PA 1G1YA 1EHAA 4HPGA 4LYPA 3FX4A 2PTXA 3PZVA 3DIPA 1C9WA 3W7DA 5C55A 5D37A 2KZHA 1F6YA 5AYZA 2NVCA 1GZ1A 1JCTA 2FB3A 2YYUA 4EXBA 4XO7A 4KQNA 4FDCB 1FH8A 1EC9A 4FXRA 1EUNA 1NDZA 3WD4A 3ALFA 3UG4A 1J0ZA 1E0UA 3F5KA 4HSNA 3UW6A 2VEMA 4KW2A 1CGXA 1EBDA 5FEPA 4H7ZA 3R94A 3AHVA 3IIPA 4KIRA 5EBUA 3OC4A 5LIXX 3OBKA 4Q8MA 4DYEA 3SO7A 3LBMA 2R14A 1QMLA 2REQB 3TYAA 2JBMA 4ZXOA 3VU2A 1US2A 1ZXIC 3T9PA 1AD4A 1XFCA 1YQZA 5ABHA 2A7NA 4REQB 4GGBA 1IR1A 1VBJA 2QS8A 4EOUA 4XUGA 3ZO9A 1NVMA 2EPMX 3SSJA 1HGWA 3FXGA 2QIIA 5H8UA 1QFEA 3PBWA 1T96A 5JMUA 4O4VA 1VLIA 4LUIA 1XF0A 3C4UA 3UETA 1Z69A 3BQ5A 4L9ZA 4JTHA 2HSAA 4ZQMA 4LBUA 1ITQA 1LJYA 3BUVA 2XH7A 2WMGA 3QGVA 3R43A 4I6VA 4S23A 3SJNA 1VCFA 5I5RA 1TJ2A 3PZ9A 5I0DA 4JTKA 3CNYA 3NO5A 4GG9A 4A3QA 2EQ8A 3TIMA 1FWWA 2J47A 3IV8A 3ABOA 3O1NA 3UPBA 2WNQA 1OJXA 3CAVA 1HXJA 4MOZA 2YBUA 5T9CE 5F2MA 1BD0A 1XINA 3N2BA 4N9CA 4EKJA 2E67A 3VMPA 2VFFA 4RR4A 2YZRA 1LWHA 3PC0A 3II4A 1I2QA 3UERA 4K7YA 4R7WA 3W01A 3RAOA 1TTPA 2A3EA 3T07A 3EX3A 2V6AA 3IRSA 3UBPC 2XG9A 4M6QA 3UGRA 1H62A 3ZT5A 5T91A 4B4HA 3K4DA 3AISA 4RZ5A 4HP5A 3WNNA 3B8DA 2A0NA 1OIFA 1E5NA 3KL3A 5K7JA 1HGYA 7ODCA 1NHSA 4UTWC 5H6HA 2WPBA 3PG6A 1GOOA 5EU9A 4LALA 1GG1A 3V3WA 3VX1A 3M44A 5CZKA 3UR5A 4B5SA 4EMIA 4GCXA 3LMZA 2OOGA 4F9DA 2ZRVA 3Q67A 2INZA 3TOPA 3M0VA 4GIEA 4DO7A 2OG9A 1Q6LA 3C2RA 4HHPA 2NUYA 4ZCWA 1VEMA 3CZGA 3F4DA 4Q7NA 1BF2A 4RE4A 1B3VA 4HSHA 5JH1A 4UBPC 1MI3A 4MNKA 1OBAA 4GUGA 1TE1A 1YW1A 2E6FA 1QPNA 3TYEA 3ITGA 1JOAA 1ONFA 3SB0A 1RLCL 1XLAA 1FWBC 3DI0A 1UUQA 4WIWA 2WXDM 3ATZA 4FHAA 2G3JA 3ZT6A 4PL1A 4AYSA 1GEUA 1MUWA 4HYRA 3WK1A 1RK5A 2DZTA 1FTXA 1K7XA 1FHDA 1KRAC 1KKOA 3GG8A 2YKKA 3BSGA 1EHNA 1RM6B 3H2OA 2VJXA 3VGBA 2C16A 2W4XA 1OFQA 2D2HA 1PEZA 1DHKA 5B80A 2R1NA 3ABRA 2G3MA 3JS3A 4MJ4A 5A69A 5CQ1A 3R8GA 4UNIA 1ICSA 1C93A 3G0SA 4PUEA 3AI0A 3HPSA 4O11A 2WMIB 5C2CA 2B7OA 1EF3A 3KBWA 4UFKA 1AZ1A 5C7HA 3NXLA 3B9DA 3BG9A 4AVFA 1TA3B 4G5DA 3UZZA 2C0HA 1A50A 1CXIA 4H9ZA 2AQOA 5LIKX 3P62A 3TQKA 1UWTA 1FHLA 3IIZA 4MWAA 4ORIA 4TX6A 3G1RA 3ONBA 3CV6A 1XLHA 1YE6A 3VKAA 5CXPA 4XD3A 1UH4A 1UIPA 1FFRA 3AOFA 3P82A 1C7TA 1ISYA 1F4HA 3MUIA 1OCQA 1VGAA 1KCKA 1SFJA 1BPLB 2PDCA 4MYXA 5FJTA 1QUMA 1AJZA 4Y2WA 3AIRA 3M5YA 4BR1A 1SMDA 2BP1A 3A7RA 3FNDA 5JVLA 1ME8A 2WSQA 1FCBA 4U2YA 4YWSA 3OBAA 1EO7A 1JUKA 5FF0A 2CXGA 1X1ZA 3SRKA 4GIRA 2I1OA 3ZJ6A 2EO7A 2ASHA 3HMCA 3ZIZA 2Y61A 4UUIA 3K2GA 1G94A 5FAGA 3DYPA 2QEZA 3AHZA 1V5XA 2OU4A 4I8DA 3KLKA 5REQA 1T0OA 1H7OA 4NRRA 1D2KA 1CBGA 3S5NA 4CN4A 1W3HA 3UWUA 3U5YA 5DXYA 3DCPA 4PUJA 3ZVHB 1G4SA 3T81A 2AKZA 4H2HA 3DFNA 3AMDA 3NAVA 1MO0A 2VZOA 3NM3A 4EQSA 3OIHA 3OLDA 3ZFHA 1TRIA 4HCLA 1QWKA 3RCMA 2QMKA 4WOZA 3W1MA 1L6YA 1X39A 1UP3A 3BLOA 4H4XA 3YPIA 5CLTA 4H2CA 3AJ7A 1PBGA 2GJLA 1CEOA 1TUFA 2HXTA 3CL7A 4ZMGA 5CSSA 3E1F1 4H9UA 1T3QC 1DL3A 3QOKA 3SY8A 1A5KC 3WQOA 2NV2A 3D47A 3GDKA 2GLKA 4LH8A 3C61A 1P48A 4PTVA 1KM6A 2VVNA 2YSWA 1E73M 1VJSA 2BDQA 1S5NA 3N29A 4UFLA 1CI1A 1GERA 4M24A 2GJRA 2Q09A 3ZSSA 3N2XA 5DX7A 2D20A 4R3UA 3GM8A 4Y8FA 2J7CA 4FF7A 1GUVA 4IPNB 1UA7A 2PC4A 4TX9A 3I68A 3H4XA 4D6HA 3PJWA 1I1XA 1KCXA 3T2OA 1EDQA 2GQAA 2BV9A 4B92A 2A1YA 1NHRA 4IQDA 3WKZA 4BQ3A 5ABTA 4C65A 1OVDA 1RQEA 1TV2A 1ISXA 2I56A 3KRUA 3UJSA 3L0GA 5M3WA 4CD8A 1SO5A 4DO4A 1UQZA 1LUCA 1QPQA 3CXOA 5D2XA 3WQWA 1XCXA 4PEKA 4A8NA 2I17A 4GACA 4Z2GA 2Z1KA 3O63A 3WQCA 1YKWA 1JCXA 3P6LA 3WF2A 2OLHA 2QCHA 1LWJA 1KBBA 2ZUTA 3MVIA 3VIJA 4RPQA 3LCHA 4XX6A 5G5IA 3NVZB 1V6TA 3KL0A 3RM4A 5F2GA 2W79A 3UESA 1NDAA 2V3DA 2R82A 3MHUA 4UQAA 1LYXA 5XIMA 2VXNA 4F40A 4Z1AA 1ADOA 3PZMA 4QS5A 1ZENA 3LK6A 4C6BA 3S6OA 3SCOA 3M7WA 4TX8A 4DWSA 2V82A 2OPJA 4RNHA 3SCUA 3OQEA 5L9FA 1SO6A 4UNKA 3WQ8A 4DBUA 3BAJA 3KVKA 4J7RA 4ZO9A 2EPNA 2X30A 4QJ5B 5HJLA 1JDAA 2YLAA 3PB0A 3VD7A 1XISA 2ISDA 4AU0A 3T6CA 1TIWA 1UKSA 4EPBC 4I7WA 5CC6A 2NZLA 4UXDA 4KFNA 1YEYA 1OIMA 4HYWA 3LCFA 4WEVX 3QV6A 1FHVA 4LS2A 4PMQA 1CT5A 1EJTC 2V3FA 4GYJA 1CB7B 5CBBA 3VOGA 4R33A 3LNMA 4PTWA 2ZRXA 4Q4MA 2REQA 4I9AA 2EKCA 4S3DA 5G1MA 5EMUA 1GRAA 1UOKA 1NM9A 3F1QA 1P0KA 1PIFA 3QTPA 1K9EA 1H5VA 4REQA 4DVOA 2WZTA 3LQLA 2Q6ZA 2NUXA 3U4FA 3W2NA 4AHQA 2C1GA 2PZ0A 3FYYA 1R0MA 3SN1A 4DB7A 1O5XA 3EX1A 2ZXQA 2V6OA 1RV8A 1TTQA 5FKYA 3HA1A 1AG1O 4BF5A 8RUCA 4HTBA 3WLSA 2A3CA 2C18A 1H2IA 1BYCA 3CGBA 2OELA 3NGFA 1PE1A 2WQDA 1LLZA 4C6LA 2OLSA 1XD1A 3C3NA 2IQDA 4C7DA 4CD7A 4DJEC 3EAOA 3S5SA 3E6EA 1OGGA 1SVDA 5RUBA 3LXCA 4ATDA 3AHTA 1FOBA 1EX5A 2ACQA 4FIQA 2BC1A 2XVKA 3WFLA 4NZFA 1UUMA 4MVAA 5BMWA 3FHAA 1PZ1A 3SAZA 4RDYA 5I3KA 3R8RA 3B8VA 1YDVA 2P1FA 3NG3A 4Q4PA 3VCCA 2DH3A 4IIGA 4JTEA 4QXIA 1R30A 3S5ZA 4D72A 3PAOA 1A5UA 1VYRA 4C90A 4PN2A 3OZYA 5DN1A 4LXFA 5HJXA 1KM1A 3W86A 2GFTA 3KDNA 1LWIA 2R6OA 1R3SA 4KMQA 3DZ1A 4AC7C 4GZ7A 1EX1A 1AUSL 2ZA2A 1GYLA 2DZXA 2VNCA 1E51A 4PB3A 3V75A 3VE9A 3MSYA 1IXOA 3UPMA 4B5VA 4I6KA 3ZLHA 2XGIA 3W53A 4FX9A 3S4TA 1O60A 2NXIA 3ENLA 1EP3A 4NNAA 4BEQA 1DJYA 4P61A 4LOCA 3B06A 1GESA 5KVHA 4QX4A 3CZLA 3W1UA 3B9AA 3BGJA 4XIMA 1BWVA 5C6MA 1QRQA 4H3DA 1Q7MA 1VLWA 2VQTA 1DP0A 2QIWA 4HN4A 1PKLA 2E40A 4JNZA 1W1YA 2VEIA 1CENA 3QFAA 1JZ5A 1G7UA 1OD0A 2DUAA 3WMLA 2DJLA 3C3UA 4JTDA 2QAEA 3FJ4A 2CITA 4OT7A 1W37A 4LEFA 1F73A 1HO1A 4WQ6A 3WQDA 4V28A 4YVXA 5D2WA 4O17A 4UR7A 1DWJM 4J2PA 3PG9A 4JPGA 3NPWA 3VCRA 3W2MA 2XH4A 1HUVA 1I0BA 2V8ZA 1WV2A 2WMIA 4K7ZA 1CCWB 4W7UA 4L4OA 4W8BA 3DXIA 2R1MA 3UT0A 4AW7A 2OQLA 1L8NA 1IR2A 2VGBA 1XLCA 1TA3A 2XN2A 1RBOB 1G67A 1QO2A 3TYUA 1XP3A 3GK0A 5LNSA 3DBPA 4B5XA 3GXNA 4ZTXA 1ZK7A 3CHDA 3O06A 1BTMA 3KS6A 3WQFA 1V6VA 1Z7AA 4EP8C 3PUDA 2XDFA 2YVJA 1GYMA 5I3GA 2PDPA 4A21A 4F0HA 2DJXA 1NDWA 2GGGA 4M80A 7TIMA 5D38A 1VCGA 3QSTA 4Q22A 3W02A 2QAFA 4ROPA 1ONRA 1FA2A 1QAPA 3AZTA 1D7FA 4MDOA 3MANA 1GRTA 5HNNA 1LRQA 4DJDD 4PSPA 3R12A 3V1PA 1JF5A 4J28A 1OC7A 3WEZA 5BW6A 1OFAA 1CGTA 4IZGA 3KDOA 3OQ8A 1EUAA 4KWOA 3B8IA 1GNXA 2VOMA 3CV7A 4GRSA 3JU2A 2XIJA 1CGVA 2VX4A 4WKHA 3NA8A 3BICA 3P93A 2FZBA 4IUGA 3O16A 1WYGA 2AGTA 2NXGA 2VC5A 4KIEA 3RO6A 2DSWA 2ISSA 5D8WA 3MMWA 3H2AA 4CNOA 4I5UA 4NI3A 3P5YA 1V3LA 2CZVA 3W29A 3LSBA 1GZGA 4XIAA 2VRQA 4H4ZA 4I7UA 2CDUA 4ORMA 1F07A 4OVXA 5FS7A 4JNMA 1OWQA 4IXXA 1PSCA 4QR6A 1E0XA 4DELA 1SZRA 1ITXA 1EC8A 1BYAA 1YPFA 1JZ8A 1B3XA 5G1TA 2QCLA 1XSKA 3MDWA 4GO9A 4EAYA 2GK1B 4QRNA 4W84A 3T0AA 4LB3A 1YBQB 3EWXA 5FF2A 4D8ZA 3T7VA 4PUMA 4DZHA 3QF0A 3TE9A 3DFYA 1EQCA 2HE5A 4LIIA 4NJJA 4FX8A 3VC6A 3MC5A 3O0FA 1GZJA 2YIHA 3EOLA 2FVMA 4EK7A 3AHXA 2QJIA 3R4IA 4UR8A 4URIA 4B9ZA 2JK2A 4MWAD 3CGTA 1TMLA 4J3WA 1GJPA 4XAFA 5T8GA 3TSMA 4DI9A 5AFDA 4MY1A 3V1HA 3N4EA 4S3GA 2OVLA 3TTEA 3CV1A 1IEIA 3L68A 2ZUVA 4Z1CA 4GBUA 3PJTA 3WNKA 5DY2A 3U2CA 3K30A 2HS6A 1S5TA 1DXFA 1KR0A 3R07C 1JPKA 4GRTA 2WNNA 2VCBA 3FS2A 2PGRA 5EMLA 4FLSA 3TZNA 4JTAA 2ZZ6A 4UTTA 2PDMA 3GWQA 1I2RA 4NHVA 3N4AA 1GOQA 4GFIA 2O92A 3C2YA 3SADA 3AU6A 3E74A 2ZX8A 1HKJA 1XIIA 5EBKA 1O95A 4KCUA 1YYAA 1F05A 4D9PA 3H2CA 2NWSA 3LHUA 3GKAA 2D3LA 2YCLA 4RW3A 5CPNA 3QXBA 5E1QA 1QR7A 4HU0A 3NPVA 1KBLA 1TTJA 2VZSA 3TONA 3K4WA 2OJPA 3PJUA 4TVCA 3DESA 1N63C 1ZP3A 3ME3A 2PI6A 3THQA 4RNIA 1F8IA 3Q37A 3PP7A 4DZ5A 1QT1A 3BAXA 2GR1A 3F5LA 4Y96A 3KWXA 2WHMA 4F48A 1EL3A 6TIMA 2PAJA 1GSNA 6CGTA 1PX4A 3DI1A 5AC7A 1HIZA 3WD2A 3CWHA 3VO0A 1Q3NA 1PJ9A 1OCNA 3KUMA 4PBEA 3ES7A 3W2LA 4BQ5A 4K38A 2E9MA 3O9NA 3M43A 4QE4A 1W3KA 4GA8A 2IXUA 4ICNA 5KMYA 4Q4SA 3H4KA 4FPSA 4FB7A 4KEVA 3WBYA 4JN8A 1ISWA 2NWRA 2W62A 1SFTA 3H2EA 2HNEA 3IV3A 1LL4A 3ABZA 1OFOA 2J7EA 1UR1A 2PDGA 3W75A 2OZTA 2W27A 3SCTA 2OX4A 2NQ5A 1KTNA 1QK0A 1Q5MA 1ODUA 4IL0A 1T40A 1S2AA 1W9BM 1GYNA 3GQYA 2YVFA 1XBVA 1D8CA 2QNEA 1ENUA 2ZZ2A 4GVFA 4XD4A 3W7EA 3B05A 4H6QA 3EKGA 2XM2A 1JDEA 4JHZA 1BF6A 2QCDB 4L4MA 2DW6A 4MM1A 3SCRA 4EX4A 4MPQA 1JD9A 3T0BA 3CUZA 1NOUA 2NQZA 3OP2A 4A8IA 3DHUA 1TPH1 4O50A 2BY3A 3KLLA 1E9LA 2Y2WA 4H6EA 4DY1A 1UR2A 1ZCOA 4FNSA 4RV8A 3VKCA 1TG7A 3URQA 4LT9A 1GW9A 3GD4A 2QLYA 1YXDA 3H7RA 4E8GA 4I5RA 2INEA 3OTRA 3W6MA 1CTNA 4P2VA 5CPQA 3QGAC 3H8AA 1DE5A 1T99A 4AX7A 2DY3A 1XYMA 2R94A 3M6DA 2Y62A 1TV7A 3QLLA 1QK2A 3RFAA 4L61A 3U3HA 5DXXA 1EWDA 2VM8A 3ZLGA 1ZP4A 1LLOA 1C7SA 1LTDA 1DNCA 5ABGA 3LBCA 3DYMA 2BTMA 3A12A 1A5OC 3HW2A 4RW5A 2CETA 5ABFB 1GCYA 3QY6A 1GT8A 3CT2A 4PTMA 2EJAA 1W1B1 2FPTA 4CEXC 3NDOA 4O16A 3W6YA 1XYCA 2FVLA 3AROA 3CU2A 4RZ6A 1A49A 3LI1A 2VFGA 1KFWA 2PDLA 4WLCA 1HKWA 2EQ6A 3VDAA 1W3TA 3M1ZA 3KP1A 5FS6A 4KRUA 4CQ9A 4DJFD 4O12A 1RQHA 5AY7A 1FO4A 5FOOA 4JDBA 1UQYA 1M53A 1QHPA 1CXKA 3UPWA 1V0KA 5CZ0A 3FN9A 2QULA 2PGFA 3HG4A 1UBSA 4LTSA 2BY2A 3ITXA 4F79A 4M7SA 2VYOA 1XKYA 3FEQA 1FUYA 1E0TA 4B4FA 1XH1A 4PFMA 4MLJA 3TFXA 3LPFA 1JDDA 3UNDA 4WKAA 1Q6FA 5C9ZA 3W76A 2FDMA 1DWIM 2GGHA 1N7KA 1JXKA 3IVTA 1E56A 3ABXA 1RPXA 1V6YA 1K6WA 1YNPA 3TYZA 5JRBA 5I00A 3C5QA 4KWWA 2CCRA 1WZLA 4IF2A 1Q4NX 3AXIA 5C9WA 3W7QA 3L12A 4Q6JA 4PBGA 5I6SA 2V63A 3A3HA 3B9NA 3EXTA 5EFFA 4APNA 1R8LA 6A3HA 1JCMP 1U30A 5I3FA 3CMJA 1WUEA 3V0TA 3VFLA 1H3GA 2VFEA 2PTWA 3M0KA 2GWNA 2D0GA 3S8HA 4D6FA 1YE4A 2QF8A 2G3IA 1PYMA 3S2MA 4RNFA 3R7MA 3O2LA 4HOZA 3RRXA 3A7UA 3WH5A 4GUHA 1DJZA 1IWBA 2DVTA 1W56A 3AMKA 4NP7A 4GJ1A 5DT5A 5K4ZA 2P5NA 2X40A 3KOXA 4FOKA 1E71M 3H2MA 2JKPA 4L6DA 2O9OA 1XM3A 3WUGA 1ZKQA 3HURA 1ZJIA 4AZCB 1W54A 3MWAA 3PSVA 2CLIA 3F4NA 5EYWA 1HFBA 1WZMA 2YJQA 1PHWA 3REQB 2ZWYA 2UY3A 5DBTA 1TJRA 1SZNA 1N82A 4NEVA 1GPFA 4I9TA 4MY8A 3QHOA 1MW1A 3WJXA 4D6IA 3CUGA 3MSDA 3W88A 1LT7A 2BVTA 3SCSA 1OGSA 1V51A 1Q6DA 2OTDA 4E38A 2RJGA 3NVWB 2OX1A 3NO1A 4MB5A 4GH3A 4JBRA 3CWNA 1V7YA 1DIOA 3VUPA 1VF8A 2BVDA 1FCUA 2G37A 4C6PA 3QLDA 1J5SA 3P61A 4D8LA 4DZIA 4ATLA 3M0YA 1N2VA 1UCWA 3U7BA 4BI5A 2BGSA 4AHPA 5BU9A 1MFVA 2ZYFA 2ZTKA 5E9AA 1N62C 2XFFA 1EXPA 2E3ZA 4IQEA 3IJQA 3NWRA 4J5NA 3JUGA 4FLOA 2Z2UA 3BG5A 3SM0A 4J27A 2VC6A 1MQQA 2CYGA 1GHSA 2ZOXA 4PB5A 4QEHA 3UJ2A 3VAVA 5CJ5A 4B2DA 3APGA 1LDCA 2ON3A 3BPWA 4L4LA 1OX4B 3ECQA 4GYPC 1QBAA 4WY0B 5HWJA 1DXEA 1E4MM 3B0UX 1AJ0A 1JI2A 1PVNA 3L66A 3C0LA 1V08A 5D04C 3HG3A 1JZ2A 2GK1A 1RY0A 3NVVB 2WPGA 4WR3A 1PWMA 4Z2LA 1EA0A 2IQ0A 3T8QA 1TPB1 1YBQA 4OBTA 2DW7A 3WD3A 2G3FA 3BV4A 4WDUA 3PPGA 3I3BA 3MS8A 3SRHA 1EGMA 3WQ5A 3HQOA 1RZMA 1ZDLA 5T26A 3LV6A 3GC5A 3HJEA 2BC0A 4AZGA 1Y5WA 4MMWA 3I6EA 3KVMA 3ZS4A 2PGWA 4W89A 4NEWA 2XIMA 4G7FA 4C7FA 5HQLA 3MHGA 3N2MA 3W25A 3QY7A 5CZSA 2HQMA 3N04A 4PMRA 4JFWA 1C8VA 4DUXA 3MO7A 1JGMA 2BMBA 3V0SA 1Y5VA 2UZ9A 4B16A 4ENLA 3STGA 2E28A 4FZIA 3ZWSA 4NUWA 3QC0A 2YL8A 3RCNA 1PB0A 1V59A 3LTYA 3HGRA 4JIPA 1DIDA 1YIXA 2VL4A 1H4PA 4WF7A 1D3CA 5F7UA 4YCOA 5CGQA 3U6WA 3G0UA 3CHFA 2ZZCA 2OLAA 4KEUA 1TQJA 5LHFA 4IJCA 3TMQA 5CCZA 5KZDA 3KRBA 1JEHA 4GVGA 3L5OA 4XAPA 1VEOA 4C6NA 4EM4A 2D69A 4H4TA 1MMFA 2PB1A 1PAMA 3W2KA 4FR1A 4J3TA 1TX0A 1K7FA 1HNYA 1KQZA 3IGHX 3SEPA 4NJIA 1GJUA 2F8QA 5DEZA 1A5AA 3BDKA 1MW3A 1HKIA 4E6MA 4RV3A 2CZDA 4C6QA 2VWTA 5D33A 2VR5A 4KERA 5C71A 4B5WA 3LHVA 5M03A 1VYPX 1UC4A 3GDTA 1F8WA 1JDFA 4FNQA 4BZYA 5HOSA 2DH2A 3WSUA 5I06A 3EPOA 5A95A 4XZHA 1SFLA 1V02A 3FW6A 1A0CA 4HU3A 4PYSA 1EQPA 3L7RA 4W7WA 2E0PA 1Q7QA 4IPPA 3B9EA 3B0PA 6XIAA 2QV4A 2XH0A 3WMSA 1F3PA 3N25A 4J9JA 3O6CA 1GOWA 3QMTA 4UWMA 2VELA 1RVKA 5C70A 4HHLA 1ZCCA 1KLZA 1PCKA 3P60A 2HPMA 4QG9A 3IJ7A 2FH6A 1JUBA 3QKZA 2VKZG 1DWHM 1MEIA 2GDUA 4BI6A 4CU7A 3GTNA 1GREA 1WDQA 3GAKA 3GU2A 1F3TA 5CSRA 5EMJA 3MUCA 3QR1A 1ISZA 5KTLA 3IEBA 2G0WA 3PPFA 4HKPA 2YZ5A 1LRTA 1UJQA 4XBKA 4LNCA 3W28A 4F3HA 3CIVA 4XSLA 2E5BA 4PUWA 4XWUA 4F0LA 2QCMA 2OEJA 5HBFA 3KS5A 4L6OA 1FQ0A 3VABA 1J4EA 3SJ3A 4RK8A 4E4UA 2V69A 3VFCA 1S5WA 2QCDA 5AC6A 3B4UA 2J88A 1TELA 1J0HA 3WEMA 5AHIA 1TWDA 2FGLA 4ZOAA 4NX0A 1NWRA 4GVHA 3PBMA 1B4EA 4F2TA 3BWWA 2AL2B 3GR8A 5D03A 3M41A 4YHGA 3A3XA 1W9UA 2PDFA 1EBHA 1S1RA 1V79A 1KLYA 3W7OA 2J7DA 2IKIA 2H3BA 3LDVA 1RPKA 7XIMA 5FCZA 4Q3MA 3E9AA 4Y9AA 4L1WA 3L4XA 4G7EB 1A5MC 3W7IA 1R47A 3FY1A 3T42A 1VBRA 5FSEC 3II1A 1NOWA 2I16A 1THFD 5G4EA 2NQHA 1WDWA 1MNSA 2VFDA 3BE7A 5CAHA 4O8AA 1DKWA 1G6CA 3G6MA 4NYYA 4GI9A 3N2TA 3WN6A 5BXRA 4IG2B 2BVYA 1S3TC 5L6UA 4JTRA 1R5YA 3BSMA 2J27A 1NDYA 1OFPA 5I09A 1R87A 2R1LA 3GTXA 1VHCA 3RHGA 4O57A 1B9BA 3TAKA 5CKSA 1KN0A 4GKTA 3KOFA 5ABFA 1YLVA 1UH3A 3N34A 4QQUA 3R0KA 3EAUA 1HP4A 1QI3A 2CIPA 2HBVA 3TTQA 4LV4A 4QBXA 4AX6A 1EH9A 2QZRA 3QZAA 1HW6A 3WJSA 1SPQA 2JIEA 1C8YA 1DQWA 2A3LA 4Q6XA 3VGDA 3CL8A 1VBUA 2WVSA 5A8PA 3CK5A 3E0IA 4GCAA 2G4JA 3IS4A 5BCAA 3PSWA 3FSUA 1XLDA 3OEXA 4TVUA 2YDSA 3DBNA 5BNKA 1PKYA 2PEVA 4DJED 3N1AA 2AKMA 2DIJA 1GVEA 1ML1A 4NX5A 3O3RA 3FJ6A 4GXMA 1O5QA 4C6EA 1UD8A 4JL2A 4LBSA 3DK8A 2J9YA 3FA4A 4H4YA 2XSBA 2IKHA 1GEHA 4BWLC 2CZEA 4KFOA 4JTUA 5H91A 2ZX6A 4LVBA 4GO8A 3UR7A 4PFHA 1NIUA 1TPC1 2XVGA 2BHZA 1DHPA 3QFWA 3QOMA 4GXPA 4R7OA 1Q2SA 1BVZA 2PDWA 2XUCA 5HR7A 4FK9A 2FH8A 4TVYA 4WXZA 1V0MA 1BSLA 3BGAA 3B0VC 3N14A 3GHTA 1W9VA 1UWUA 3VDHA 1UWRA 5FA5A 3P2VA 2SFPA 1REQB 3RLVA 2V3GA 2E7FA 3BZGA 3QZ6A 3GNDA 4FNPA 1CDGA 1GG0A 1EJ7L 1FWGC 4LQ1A 2YX0A 1AL7A 2Y7GA 2FDSA 3EB3A 1M3UA 4B90A 2OWWA 4C6CA 3EZ4A 4KH2A 2JF7A 3MKVA 5H2ZA 5A6BA 3WQEA 1O1ZA 2NV1A 4K7VA 3QJAA 3BW3A 3OLEA 3W22A 5BXSA 2BOFX 1WE5A 4E2OA 5KZEA 4J4KA 4S2CA 3LGEA 3KTCA 4DO5A 3WY1A 5D4YA 1XLGA 2JE8A 1VDVA 4PE8A 1OG6A 1MQPA 2E09A 4AZCA 2WJFA 1UKOA 1RJRA 5E09A 3T1GA 1IXQA 4PZVA 2PBGA 4Y9OA 4CCDA 3CPGA 1N8FA 2QPXA 2UY2A 3R58A 3REQA 4MFEA 4EWND 1VBGA 3WDIA 2ZZ0A 9XIMA 1W1PA 3R2GA 4KCVA 4UCFA 2A6LA 4Y9MA 4G8TA 1TVLA 1V6UA 4OV9A 5IDIA 1EDTA 2J75A 5FL0A 2BB0A 3TWBA 5C9RA 5K4XA 4R53A 3ARVA 1GEQA 3GXTA 3FAWA 1JFHA 1VBHA 3GXDA 3ZT7A 5JBDA 3QKEA 3W82A 1ZB5A 2QDHA 4RNJA 1KRCC 1E55A 4AF0B 1BQCA 4O13A 5IFTA 4DEFA 1KM0A 1UD2A 4S3AA 2YCJA 4BHYA 3T2PA 1VRXA 2YBTA 2AMXA 2Z4GA 2HEJA 2OWCA 2YQUA 3MI6A 2YA1A 1MEWA 4JR5A 2V2CA 3OVGA 5AZ0A 4QTGA 3N9KA 4K6AA 5MKGB 3CAWA 3NQ8A 4CQDA 1TQXA 1R3WA 4ZGYA 5KETA 1V0NA 3VUSA 3W83A 1W3IA 3PZNA 2XFWA 3BOFA 4NZ3A 3OGSA 1XIGA 3N19B 1FECA 3AIBA 4ZQPA 5JU6A 4GGHA 1RP9A 1H6VA 1OX4A 4JTCA 1M6JA 3GW3A 4J3VA 4WY0A 1TV3A 3LS9A 4NVTA 3DN5A 5BYWA 3IAPA 4CKQA 1EOKA 1QI4A 1D7YA 3GFZA 2V68A 3TC6A 2PLKA 2QVNA 2DQWA 1XANA 4M82A 4H4RA 1BXNA 4NILA 5AN7A 4RZ4A 3W73A 3LPPA 4LRTA 4W88A 3I7QA 4D71A 1HJVA 1V3HA 1TX2A 4GJJA 1DXIA 1QW8A 5TNVA 1IF2A 3PPHA 1HJQA 1E9ZB 1Q6GA 3GXMA 3CQJA 4KF1A 3OBEA 5HJYA 3URAA 3NYZA 2XIOA 3WNMA 4GVIA 3BTNA 4CD4A 4DXVA 4H4QA 2Y7FA 3LLXA 4GIAA 3FCPA 2E4TA 3HJZA 5FJOA 1DTNA 2CW6A 3C2EA 3K8LA 1MQRA 4IMEA 1GHRA 1J0KA 1OSEA 4O0ZA 1SJCA 2NQJA 1A5NC 1IIGA 4E2VA 4IQJA 3SQMA 5J04A 3N9SA 1C91A 2W0UA 2O9PA 1V4YA 2GOKA 3CAKA 3HV9A 4GWEA 5DLCA 3LPGA 2KX9A 3ITYA 4OBRA 2V5DA 3PTDA 3MU7A 4UTHA 1EJRC 1DWFM 1DJNA 4W9TA 2OYLA 3A4XA 4I7VA 4AXNA 3UJFA 1TPDA 3R25A 4B9YA 1KTCA 3MCOA 3ZSTA 1IE7C 2EGZA 4A6GA 4C6KA 3N6JA 1PUDA 3ARSA 3NOYA 4CQBA 2X0YA 5HMEA 1ITUA 1E6XM 2C7FA 2RGLA 5CG0A 2ZX9A 3GXFA 4A22A 2R1KA 3AQUA 2JGYA 1TR9A 4JX5A 1UBPC 4RX0A 3LXDA 1DJXA 1XIEA 5D05A 5C54A 4A35A 1SQ7A 1XJBA 1GRBA 1UW9A 2OWXA 2J79A 2QGYA 3JRKA 4W85A 5DRCA 1ZAIA 4PODA 4PCSA 1KM5A 1LBFA 4CD6A 4NNCA 4H41A 3E3HA 1ITCA 1GOIA 5F4SA 3KLJA 3LSCA 4WJ8A 1DWAM 3I3EA 2WOWA 2NSOA 1Z32X 3KAOA 4JIRA 4OHQA 1KFLA 9XIAA 3CQHA 1EJWC 2Q8LA 1JRCA 4ECLA 1MUMA 4K37A 4V1YA 1TR1A 5EB8A 4JL1A 4GKLA 1W17A 8XIAA 2WWDA 4LY8A 3L4YA 3T09A 1IWPA 1A5LC 4HK5A 3MB9A 5AKQA 3NQVA 2WOVA 3NJ3A 2ZDRA 2EG8A 2JKAA 2XFRA 3RGTA 2ZXAA 3NPXA 2PZNA 2Y89A 1KKRA 4PCPA 1EYEA 3EX6A 1AMKA 1O6IA 3OVQA 2WPEA 1UOZA 3CPUA 4NJGA 2GUUA 5CSYA 3NQEA 2AL2A 1A5CA 2TPSA 3UXLA 2EHHA 3APTA 3WQ6A 1W1TA 5HNUA 3RR4A 4S39A 3UA3A 1OCJA 3RDKA 5LGXA 4L7ZA 3P67A 1F3EA 1X97A 3M0JA 4HA1A 4LUSB 4NXKA 3F4VA 4G7EA 1JZ6A 5SWUA 1UYQA 4K8EA 3PZIA 2AMGA 1UKPA 1GKRA 4KRTA 3IUDA 1FDZA 4HU4A 4Z17A 4AG0A 1G9HA 3OZPA 2F38A 1OF8A 4Q8OA 1JG9A 1QXLA 4CD5A 3ARTA 1M01A 1QWGA 3TYDA 2FLIA 4M51A 4LAZA 2Y5EA 3SGGA 2WZIA 1XRSA 3NL6A 1W8GA 3EX4A 4JTQA 7A3HA 2V5KA 3CZKA 5MHBA 1YDOA 5A5WA 3NVYB 3FFSA 4J57A 5CC3A 4L1XA 1X7IA 2CWXA 4BEUA 3RM8A 5BOEA 5HDRA 1QDSA 1XX1A 2RGMA 2WCSA 1J0JA 3QVQA 3VZXA 2VTFA 1GTEA 2C79A 2OYMA 4IQLA 2PP3A 3OODA 3AS1A 4GQRA 5HANA 3HPFA 2W54A 3BANA 2GQ9A 4JQAA 2X2YA 3NGJA 5ECUA 1ZALA 3OU8A 2X8CA 3ZR4A 2D0HA 1RBAA 3CXBA 3N13A 4HJFA 2G95A 5HPCA 1LOSA 4DNHA 3QPEA 3VIMA 1GV4A 1H61A 5FJUA 3TSDA 1NF7A 3MYOA 1ODZA 3LHWA 1IHIA 3LI0A 3N9RA 3DFTA 2X41A 1JPMA 3L23A 3F03K 3VOCA 2C3DA 1YHTA 3TW6A 5E6YA 5A6AA 4TQTA 3B4YA 5AYBA 4XVDA 3HRDC 1REQA 1BWCA 4JNYA 3P8IA 3K8KA 2FYMA 4TIMA 1KGWA 2X99A 4GYKA 1XRFA 2I9UA 4AFYA 4H6KA 1GQNA 4ACZB 1D3GA 4KCWA 3TNBA 1TFVA 3BW2A 1L9WA 5JBEA 4Z2IA 3WMCA 3BCFA 1FWNA 3ITVA 3W9ZA 2J7BA 1VZWA 4O53A 1JCLA 3CUIA 4EVZA 3H12A 3P74A 4DRSA 4WVXA 3UXAA 3EPMA 4GY7A 3N18A 3VIFA 2WLZA 1XIJA 2R1PA 4GZIA 3B9JB 2WBKA 4AC1X 3C8NA 1AOGA 1TPFA 1E6RA 1YNQA 2JFEX 3O6AA 2E1WA 4XV0A 3GUWA 2MANA 1WXZA 3NIYA 4DJDC 1E9YB 2DZVA 4JIQA 2EPHA 3UY8A 2VO5A 3GVRA 1P0BA 4GYFA 3VNMA 3SCWA 2Q3RA 2D22A 4C6IA 4TU1A 1PCWA 2WC7A 4ZSUA 3LGGA 6ALDA 3P5ZA 5D2TA 3HM7A 3USZA 2WSPA 4WSJA 5AHLA 3MSGA 3UG3A 1MVYA 5FIPA 3EDEA 1A4MA 3W7JA 3UD6A 4XTIA 1ICPA 5FJJA 1L2UA 3AZRA 3TW7A 1UZDA 3VIKA 3U8GA 3GDRA 1TWSA 3WFAA 3BARA 3JW7A 3C6CA 4AF0A 3STFA 2VDIA 4M6PA 3NCOA 4WRHA 1XLFA 4AIUA 3HZ3A 1J9YA 3G3MA 3BLPX 4Z1DA 5JXQA 4N0RA 4FP1A 4LFYA 2Z24A 5GJPA 1RA5A 1BHGA 3O05A 4XK2A 5MKGA 1PYFA 2YBVA 4ZE5A 3QH2A 5BRPA 1OM0A 2YCKX 1QJWA 2OOFA 1V93A 3VDCA 1TYGA 2WQPA 3WFZA 2EQDA 3FSTA 5FEXA 1H2JA 2HDJA 2V5LA 3E96A 3GS6A 1MDRA 1X1NA 5AC4A 4LCSA 3PHAA 1BWKA 4KS0A 1M7PA 2F2HA 5AOUA 4XBSA 3EA1A 1I2OA 3W87A 4MSSA 2JIWA 5BMXA 2VP8A 1SSDA 2QCNA 3R89A 2VZUA 4E3TA 5E70A 3NQDA 1W2PA 2DVXA 5FJIA 2FFCA 4LAMA 4N42A 1RD6A 5A6BD 3UJRA 4ZQNA 2QDEA 2E9BA 4RE3A 2WHJA 2W92A 4MWAC 5G1YA 5LXEA 3QTGA 4MLRA 2INFA 3S6TA 2WJZA 3NO3A 3ABQA 3H53A 1RCOB 3LBOA 3LUTA 4HZ8A 1YDNA 1Q6OA 1UR8A 4GBDA 4A3RA 4NYUA 1E6SM 1EJSC 4IWWA 4ZVJA 5M5DA 3USBA 1W32A 3DYOA 4DPQA 2CWNA 3QFEA 2R8WA 4S3KA 5AB3A 2VFHA 4HN8A 1WYIA 3WENA 1S1PA 3I7RA 1BVWA 2PDNA 4ZOBA 2EPKX 3HG5A 5FS8A 2IS7A 2XZ7A 1JIBA 4LBRA 4I9MA 4HQVA 2C71A 4FXFA 3A24A 4S1FA 3FJLA 4WD0A 2CNCA 3TYBA 4GMEA 4GQBA 3IAQA 4E2DA 1R7AA 2ZBTA 1QNQA 3MZNA 4XZIA 2E3TA 1FWFC 3DJGX 4CQ8A 2VWSA 3NSXA 4J2MA 3H54A 4IISA 1Z89A 1ZPTA 3RMJA 1EEXA 1HN1A 2WC4A 1TKKA 3FA3A 1I60A 1VS1A 4NAFB 4JFUA 5CZTA 3RNDA 1X2GA 4NF7A 3MMTA 5KINA 1AFSA 5B7YA 1HQTA 3B40A 1MZRA 2FJKA 3CHEA 5I3DA 2EXOA 3KM8A 1MOKA 5TBOA 2VX7A 2DZAA 3WLQA 3BGGA 2J6VA 3EGJA 4E5TA 3PANA 1TJ0A 1AZ2A 2LLEA 2G50A 1AK5A 1RSCA 3LY0A 2I14A 3VNDA 3OG2A 3L9CA 2WPCA 1I0DA 4ZFCA 1F4AA 4AZ6A 2FMOA 2P10A 4PMJA 3UG5A 4H4UA 1UR9A 3WH8A 2PWGA 4V1XA 2YOCA 1P0NA 5I03A 1JNEA 3VIGA 2O4MA 3PUGA 3WQGA 2I57A 3TQPA 3V5OA 1O94A 2Y8UA 1I9CB 1G0CA 1TCDA 1JCNA 2YYTA 4QE5A 2IPWA 1EYWA 4MDPA 2RFGA 1DV7A 3RF9A 3L2MA 1A4LA 4LRSA 1KBJA 2ZXDA 3TR2A 3CV2A 3U5UA 3MUXA 2C8NA 1Q8JA 3G1FA 4DF0A 1XLBA 4IXHA 3G3DA 3HU7A 4HU8A 3W2JA 3K1DA 1FFUC 3ETRB 3S5YA 3R10A 3QY8A 3W1QA 3L2LA 1NU5A 3PZGA 4AZBA 3CQKA 2X1RA 5G5GB 4JOMA 3PUOA 3H70A 2V5CA 3IIOA 1YRRA 5C7VA 2VGFA 2QDDA 4K36A 3AXXA 5LNWA 1JDCA 1KFCA 1QOQA 1M6IA 3GIYA 4RPPA 3A6OA 1LBMA 1C8XA 4OUEA 3KCOA 2C0AA 1B3YA 4DAFA 1E1EA 2WOIA 2PWDA 3L4ZA 1VR6A 4Q33A 3LQGA 4F4RA 2WHLA 5AHMA 1XI3A 4LUSA 2G5WA 1LORA 5HINA 1FVPA 1KGXA 4D1JA 1POJA 3ZJKA 4IHCA 1RH9A 4DWSC 3GKFA 4JD4A 3AIVA 1A0EA 1M68A 1YQ2A 4ZL1A 5EPDA 3PG8A 4P8XA 5LA0A 5DMLA 5JIPA 1SB3B 3MA8A 1N5XA 4MJMA 2AQVA 3N73A 2OO0A 3UXKA 3PF3A 2WMHA 3TN5A 4DJFC 1J0IA 4YXGA 1OB0A 2ZUMA 3GDLA 1H7XA 3T78A 2UV8G 1WDSA 3R5EA 4Q4KA 1CIUA 1J01A 4PMDA 4ZOEA 4GX8A 2FTWA 5HWNA 4LW7A 3GH5A 4O14A 4UTKA 2O56A 1BG4A 1QPRA 4JN6A 1ZMDA 2HRWA 1B5TA 4EE9A 5XINA 4K8HA 4Z1BA 4PBFA 4DXKA 1OYAA 2P88A 4DUVA 2PDJA 2Y8VA 4HCHA 4IICA 3H55A 2Z0IA 5BOOA 2HVMA 3VI2A 1N55A 2YCEA 3VKBA 4YPJA 1X6LA 1SUXA 1DQUA 4O18A 4QHRA 3PB2A 5EKYA 1S5VA 1R9ZA 3HN3A 3BVJA 3MP5A 1ZTVA 1V0LA 4HCDA 1QNSA 1YXCA 5D9OA 3VILA 1OG0A 5AHEA 3BO9A 3FOKA 1EA9C 2Z2AA 2H9AB 4LF2A 1O68A 3KBNA 1F6PA 1ZSXA 4Q8TA 4DAIA 2D23A 1QI2A 4MB1A 4H00A 3CYVA 3LHYA 3I65A 3VGFA 5LZLA 3LCWA 4HMDA 1QOXA 1S7MA 1U5HA 3ZJ8A 4ALDA 3LX9A 1AQMA 4J56A 1SGJA 4ACZA 1Q1RA 2F84A 3K4AA 1IZCA 5D8ZA 1YXYA 1P6CA 1HL2A 3RILA 4BI7A 1ZMCA 4NG3A 4ADWA 3WF0A 2QJGA 2XN0A 2YGYA 4AIEA 3LRKA 4LS1A 5DO8A 1GKQA 4ILSA 1ZAJA 4CQAA 2PDQA 4IMDA 1JPIA 3F4WA 4CCEA 1UMYA 3H21A 4MNLA 1BGGA 4MFDA 3CAQA 2WKGA 4M7TA 4PTXA 1XR2A 1XDMA 4HBKA 5TF0A 4ZOHB 3NQFA 3L67A 3N2CA 1AQ0A 5D2YA 2CHOA 4FXJA 4GYPA 1OFDA 3W3OA 4PCTA 4BKNA 3W81A 1F8MA 1UHVA 4IPLA 3GH4A 3VDBA 4P8VA 1UH2A 1DYSA 1PHQA 1LBLA 4N6FA 5FL1A 2OR2A 4IJBA 3BAYA