1NHPA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
447
Chain Sequence
b'MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 137
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhpA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA02
2XCGA 4YKFA 2YVGA 2UZZA 3AE8A 4EMIA 3QVRA 1DJNA 5HXIA 3DJEA 4C3YA 1H84A 2XVIA 5KWFA 1CC4A 4B1BA 2APGA 3NK0X 4FDCB 2IVDA 1YQ3A 5J60A 5M10A 1N1PA 1NDAA 1D4DA 2VQ7A 4OPTA 2H88A 3CGDA 1TDOA 2EQ6A 2OAMA 3ATQA 4CNJA 4LU6A 2Q6UA 1RYIA 1MOKA 4PABA 5HHFA 1ZK7A 1ZP0A 1NENA 4CBQA 4H4TA 1VRQB 1QO8A 4C74A 4K5SA 1Z6LA 3KVEA 2WU5A 4KPRA 2XLRA 1LPFA 2AAQA 2R9ZA 1PXAA 4XWZA 1EL8A 2GH5A 2ACZA 2QA2A 2RGOA 2OLOA 4Z24A 3IHMA 4GF7A 5GRTA 3AB1A 3GYIA 4D04A 1GTHA 1BF3A 3RP6A 1TYPA 1H86A 1GXFA 5BUKA 2VQBA 4X9NA 2XFUA 1ONFA 2ZZBA 2B76A 1PHHA 4GDEA 2HQMA 1GERA 1JNZA 3AE2A 4B64A 3KU9A 1ELIA 3QVPA 1CF3A 1H6VA 1K0IA 2XLTA 1PN0A 4J36A 1E1MA 3IWAA 1ZOVA 2WBAA 1LV0A 2X3NA 1BGJA 2BXRA 2YLZA 4WCTA 3UKFA 2X8CA 4H2NA 1E39A 3H4KA 1PXCA 4XXGA 3Q9TA 5IQ1A 4IVOB 1QJDA 4D03A 4H4VA 5ER0A 2Y6RA 5FS7A 2YM1A 3UTHA 4U8PA 1H7WA 1VG0A 4OPDA 3V76A 4GUVA 2A87A 3Q6JA 1CJ3A 3UOYA 2GQFA 3KLJA 1B4VA 2OALA 1BWCA 3EANA 5JCKA 4GRTA 5KXJA 5FMHA 2WHDA 3EF6A 2Q0LA 3P1WA 4XWRA 3CPHG 2B9YA 4O5QA 3AECA 2BS3A 2C76A 3EAOA 2XVJA 2YLWA 2OLNA 3NH3X 3P4RA 3UTFA 3PO7A 2VVLA 3NIXA 3QJ4A 3LADA 4DGKA 1S3EA 2XLSA 1TDNA 2X8HA 3G5SA 1M6IA 4U8MA 4A6NB 4APNA 1KDGA 4K22A 1TRBA 4JNQA 5KRQA 3DJGX 2FJEA 2WS3A 2XYOA 2R0PA 3AEEA 5M0ZA 1PBCA 1PBEA 4EIPA 3CGEA 1H81A 2BYBA 4PAAA 1NG3A 4DSHA 1IJHA 4B65A 2R4JA 3LZXA 4EM3A 3AEGA 2YG4A 5U63A 4YKGA 1ZMDA 3IF9A 4REKA 3DH9A 3NGCX 1TYTA 3UOXA 4OPUA 1B37A 2VRMA 3AD7B 2BABA 5KOWA 2JB3A 3ABVA 2WETA 5U1OA 4TM0A 4U8NA 3AXBA 1VQWA 1TDFA 3NG7X 4P9SA 1CJCA 3PVCA 1F8SA 5EB4A 3RP8A 4M52A 4LA1A 4DNAA 1ZX9A 2JK6A 3ZDNA 4YTPA 1GT8A 3D8XA 4IVMB 1NG4A 2B7RA 3CNTA 1IUSA 4OPLA 2PHHA 3CGBA 2JB2A 4B69A 1B5QA 3NK2X 1K0JA 4TM3A 4YSYA 3GRSA 1F8WA 4BJZA 2I0ZA 3CTYA 3NN6X 3C4NA 3ISHA 1FL2A 4JY2A 4E0VA 1GEUA 1GRHA 2YLSA 4ECHA 3UP4A 5FS9A 1DODA 2CVJA 2DKHA 1Q9IA 2AQJA 4B66A 1LJ1A 2RGJA 4ICYA 4B63A 2GVCA 4K5RA 3DGHA 1BGNA 2O9ZA 4ZCCA 1E1LA 2GEWA 3AE9A 4YWOA 1AOGA 3CNJA 2C3CA 3GMCA 4TLXA 4BV6A 2VOUA 1L0VA 1FEBA 4H4UA 2FJAA 2EQ8A 3VRDB 2YLXA 1GRAA 1CJ2A 1YKJA 1SEZA 3NHOX 1L9DA 1LVLA 3HZLA 4OPCA 3M0OA 3AEFA 3QFAA 3KD9A 4EM4A 2V61A 3AE5A 3ICTA 3FMWA 4TLZA 2C64A 4YSZA 3AEBA 4YTNA 3UTEA 3QSSA 1Q1RA 1ZOYA 3UKPA 2B9XA 3ATRA 4EQRA 4H7UA 1JU2A 2AR8A 3VR9A 4H4RA 3AYIA 2CDUA 4H50A 2XVEA 1GSNA 3BHFA 4NEVA 3H8LA 4UDQA 4BK3A 1DXLA 4OPIA 4Z44A 4AP3A 2BACA 4U2SA 4J56A 1M64A 1OJCA 1D4EA 2YG6A 4RG4A 4U2TA 3R9UA 1FEAA 3UOVA 1GRGA 3SQPA 2YLRA 4BK1A 4C3XA 2C7GA 2R0GA 3FBSA 4GDPA 1NAAA 1QLBA 2J3NA 2R45A 3C96A 2BXSA 3GWDA 2GR2A 2BC0A 1JOAA 1YQZA 3NYCA 1PS9A 3O0HA 1XPQA 2YR6A 4NTCA 1HYUA 3AWIA 4X4JA 4AP1A 4EQXA 3II4A 1CL0A 1Y0PA 3AD8B 4A9WA 2NVKX 4YT0A 4UP3A 2WDVA 2YVJA 3AEDA 4AT0A 3GD4A 4YTMA 1PBDA 4ADWA 4TM1A 4H2QA 2X8GA 2C67A 2V5ZA 5CQFA 3NNEA 1YQ4A 2GR0A 1GNDA 2E5VA 3K7TA 1IUWA 1CJ4A 3NLCA 3GDNA 3BNMA 4JNAA 4HB9A 5CKUA 1DJQA 1GRBA 5KVHA 1O94A 3BI2A 3VRBA 1H7XA 3BHKA 2RGHA 3SGLA 3ALLA 5GSNA 2BCPA 4ZN0A 3CNPA 1EL9A 4EQWA 3RHAA 1PBBA 1NHPA 2A8XA 5TR3A 4Z2RA 3K7MX 4H4YA 4I58A 4U8OA 1IUXA 1X31B 5EB5A 4I59A 4B68A 4K8DA 4OCGA 1CC6A 3UKQA 2JAEA 3DK4A 2YG5A 2GQWA 1LTXR 2YR5A 3P9UA 3NN0X 3SM8A 2ZZ0A 3CNDA 1RP0A 4UDRA 3SFEA 1IUUA 2GR3A 2C75A 4Z2UA 1VDCA 1XDIA 1H82A 3LB8A 2Z5YA 2ZBWA 1K4QA 4BK2A 5EBKA 1TDKA 1YY5A 4NZHA 4ZCDA 2BC1A 1GALA 5IPYA 5KVIA 4YSXA 2WQYA 4J57A 1ZDLA 4U8KA 3P4PA 2RABA 2JBVA 1D4CA 4K7ZA 2YAUA 3F8RA 1XHCA 4H4WA 2WDRA 3FG2P 4NEWA 2IVEA 4Z26A 2VVMA 3URHA 1GRTA 2YQUA 3REDA 4C5OA 1NPXA 1NHRA 2A89A 3BI4A 5BVAA 4YXDA 3OC4A 1S3BA 5J7XA 3RP7A 4A7AA 1DOEA 3UKKA 3GRTA 3K30A 2YWLA 2XFNA 2WDQA 5JCMA 3DJJA 2WOWA 3AE7A 3S5WA 4BJYA 3GMBA 1E1KA 1IUVA 2FJBA 2WPEA 3PS9A 1PDHA 1Y56B 2V3BA 2TPRA 2WEUA 1KSSA 1VG9A 5KOXA 3AE6A 1FECA 2WU2A 4Z2TA 1KNPA 2IIDA 1NEKA 1E1NA 3CPJG 1L9CA 1KSUA 2EQ9A 3UKLA 1ZY8A 2YM2A 4IV9A 2CFYA 3DA1A 1Y56A 3GYJA 4Y4MA 2C66A 3AYJA 4H4SA 1H83A 1UKVG 3QFBA 4USRA 4J2WA 3UKAA 1KFYA 2C72A 2YR4A 3DMEA 1D7LA 2XFOA 3VRAA 1OJTA 2GAHB 1S2YA 5DBJA 2BS2A 2VRLA 1F6MA 4JY3A 3V3OA 4U8IA 5JCIA 4EQSA 3ITJA 2E1MA 3UCLA 1NHQA 1COYA 1P2HA 3AD9B 3QSEA 3B3RA 3RNMA 2CULA 4J34A 3NYFA 1GREA 4NTDA 1MO9A 2NPXA 1OJAA 4A79A 3LXDA 1E6EA 4CCRA 1NHSA 2GV8A 3QSMA 3UP5A 3AYLA 2WP6A 3UOZA 3GWFA 3NRNA 4OVIA 5L46A 2C65A 2GRTA 4N9XA 2GR1A 1REOA 2XVFA 3CIRA 2JB1A 3NTAA 3WE0A 1BKWA 2XVHA 3I6DA 1GTEA 3ADAB 2GAGB 2ZZCA 3L8KA 1PJ5A 2DKIA 4OPGA 5C2TA 1N4WA 1GESA 2C3DA 2BK4A 4CCQA 4CRTA 1EBDA 2JKCA 3NKSA 4U8JA 3AEAA 1GPEA 1D7YA 2R46A 4JN9A 2XFPA 1LQTA 2QA1A 3BI5A 5BRTA 5HYMA 1BZLA 3LZWA 3KKJA 3NK1X 3IHGA 1JRYA 3LJPA 2C70A 3G5QA 4IA6A 1FCDA 1RSGA 1W4XA 2WOIA 2FJDA 3GSIA 3DJDA 1B8SA 1EL5A 3AE1A 1FOHA 4H4ZA 1MXTA 4A5LA 1GV4A 1F8RA 1JNRA 3IC9A 1CC2A 4C77A 2F5ZA 4LIIA 2V6OA 1DOBA 1K0LA 3CGCA 2R0CA 3COXA 2BCGG 4UDPA 2WPCA 5FS8A 4H4QA 4AOXA 5BULA 1GRFA 2XFQA 3ALMA 3NTDA 3H8IA 3ALJA 1GOSA 4AOSA 1L9EA 3DK9A 2H89A 3M13A 4EMJA 1O95A 3OZ2A 3P4SA 3VQRA 2XLUA 1N4UA 4K2XA 4CY8A 3B6DA 1JRZA 1OJDA 2YG3A 2GMHA 4EIQA 1E7PA 4Z43A 4H4PA 4JQ9A 1PJ7A 3D1CA 3L1RA 4EMWA 4AT2A 4GR1A 3SFDA 2C73A 5LV9A 4FK1C 2B9WA 1O5WA 4X9MA 3UKHA 3NT6A 5EOWA 5IQ4A 4O5UA 4TM4A 2V60A 1KNRA 4H4XA 4J33A 3NYEA 3GDPA 2E4GA 3VR8A 1S2QA 2EQ7A 4RSLA 1CHUA 4FX9A 4FK1A 4HA6A 1IUTA 1JRXA 2XLPA 2V3AA 4A99A 1PXBA 3LOVA 4WX1A 2QAEA 2OA1A 3ICSA 1OJ9A 2ARDA 4IA5A 4Y4LA 1DOCA 1TDEA 2WP9A 3V3NA 3FIMB 2YG7A 2GMJA 2W0HA 4GCMA 2Y6QA 1PBFA 4CY6A 2XDOA 3BNUA 5C3JA 3CNSA 3KPFA 3M12A 3S61A 1JEHA 2GF3A 2R4EA 2WESA 4CNKA 1N4VA 2FBWA 3C4AA 3AE3A 4A65A 4A6NA 3DK8A 4NTEA 3ZYXA 4JDRA 4H2PA 4YSHA 5U25A 1Q1WA 2PYXA 1XANA 4U2LA 1F3PA 5HY5A 4BURA 2BK5A 3DGZA 3JSKA 3P4QA 2YVFA 2Z5XA 5FS6A 2QCUA 3ICRA 1EL7A 3F8DA 2BK3A 2X50A 4Z25A 1D5TA 1V59A 1DNCA 2TMDA 1PJ6A 2BA9A 4J31A 1ZKQA 2YLTA 2Q7VA 3EPTA 4MJWA 3T37A 4Y4NA 3FPZA 1P2EA 3KA7A 3UTGA 5JCNA 4DSGA 3CPIG 5JCLA 2VVLG 3G5RA 3CN8A 4RG3A 4KX6A 1LQUA 2Q0KA 2X99A 2WPFA 2WP5A 1GETA 3AE4A 2VZ2A 1KF6A 2WOVA 4U8LA 3E1TA 1ZMCA 2GB0A 2B7SA 1CBOA 3F8PA 4H2RA 2BS4A 3GD3A 3I3LA 3K7QX 4B67A 4USQA
chains in the Genus database with same CATH superfamily
2UZZA 5HXIA 3KPKA 1H84A 4C3YA 3NK0X 3SY4A 1D4DA 2VQ7A 5BOFA 2EQ6A 1MOKA 3T4WA 4H4TA 2XLRA 2R9ZA 1PXAA 2XH7A 2ACZA 4Z24A 4GF7A 3SZFA 5BUKA 2VQBA 1XS2A 2XFUA 1IYXA 2ZZBA 2B76A 4GDEA 1ELIA 3QVPA 1CF3A 1H6VA 1K0IA 2XLTA 2X3NA 2YLZA 2X8CA 3TQPA 3H4KA 4HNLA 1PDZA 1FIQB 4U8PA 1TZZA 3V5CA 3RO6A 2A87A 2E5AA 1B4VA 2OALA 3EUB3 4GRTA 3T8QA 3QJ4A 2VVLA 3GY1A 1R0MA 3BJSA 4APNA 2PGWA 1KDGA 4K22A 3PG6A 3DJGX 3R25A 2R0PA 3CGEA 3R1ZA 1NG3A 1STZA 4B65A 3LZXA 3RRAA 4EM3A 4YKGA 1ZMDA 3IF9A 2GGGA 3DH9A 4OPUA 2BABA 3ABVA 4G6GA 3HPFA 1VQWA 3PVCA 1ZX9A 3ZDNA 3D8XA 1EC8A 1N63C 2PHHA 2JB2A 3N4FA 1F8WA 1GRHA 1N61C 1DODA 4II2A 3SYIA 3DGHA 1BGNA 4ZCCA 2GEWA 1V97A 3CNJA 4TLXA 2VOUA 1L0VA 2EQ8A 1CJ2A 1YKJA 1L9DA 3HZLA 3I6EA 3KD9A 4EM4A 3AE5A 4YTNA 3QSSA 1Q1RA 1ZOYA 4H4RA 4H50A 3VCCA 4UDQA 2P8BA 1DXLA 1M64A 4C3XA 3FBSA 4GDPA 1NAAA 2OX4A 2BXSA 1JOAA 1PS9A 3O0HA 1XPQA 4NTCA 3ES7A 1HYUA 1Y0PA 4IHCA 2NVKX 2WDVA 3GD4A 1PBDA 1GNDA 1IUWA 1CJ4A 3ETRB 3BHKA 2RGHA 4GAPA 3SGLA 3OZYA 2OQHA 3TJIA 1PBBA 3DG3A 5TR3A 1IUXA 4FP1A 3TW9A 4K8DA 3CAWA 4UDRA 4ZOHB 2GR3A 3MKCA 2I5QA 1NU5A 4IL0A 1JPDX 4M6UA 3VCNA 4NZHA 2PS2A 1ZDLA 4U8KA 4K7ZA 4H4WA 3FG2P 1EC7A 2OPJA 2VVMA 3REDA 3BI4A 1ONEA 4YXDA 4A7AA 2YWLA 3OP2A 3QLDA 4BJYA 1E1KA 3QN3A 4JN7A 3UKLA 4IV9A 2C66A 3JW7A 1H83A 1EBGA 4USRA 1KFYA 2XH4A 1S2YA 2BS2A 4Z1YA 5IDZA 2XSXA 4H19A 5FJUA 4U8IA 1R6WA 3UCLA 1COYA 1P2HA 4GFIA 2NPXA 1OJAA 2GL5A 3R07C 3SX6A 4GGBA 1NHSA 5L46A 2WP6A 3GWFA 4OVIA 2C65A 2GDQA 3CIRA 2JB1A 3WE0A 1GTEA 1PJ5A 1GESA 4CRTA 2R46A 1TE6A 4JN9A 2QA1A 3PWGA 5BRTA 3P0WA 1JRYA 3CB3A 1MDRA 4G9KA 2XGZA 3BSMA 1CC2A 3AMZA 3CGCA 1L9EA 4IT1A 1O95A 3TCSA 1N4UA 1JRZA 3SQSA 4H4PA 1PJ7A 3RR1A 3SFDA 2C73A 2OVLA 1O5WA 4X9MA 3UKHA 5EOWA 5IQ4A 3D46A 3NYEA 3GDPA 2E4GA 1S2QA 3HYVA 4RSLA 1CHUA 1IUTA 1PXBA 3LOVA 4WX1A 4E4UA 2QAEA 3ICSA 2ARDA 4Y4LA 6ENLA 3V3NA 3HYWA 3L5OA 3FIMB 2W0HA 2Y6QA 3BNUA 3CK5A 3OPSA 2R4EA 2WESA 5KNLA 4H2PA 2PCEA 2BRYA 1ELSA 1F3PA 4BURA 3P4QA 2YVFA 5FS6A 2QCUA 1N5WC 3SZWA 1EL7A 3F8DA 3JZUA 4Z25A 4GIRA 3FJ4A 1V59A 2BA9A 3SN1A 4J31A 3IK4A 1P2EA 3U9IA 4RG3A 3CN8A 3R0KA 1S7MA 2PMQA 1KF6A 4U8LA 2GB0A 2B7SA 2BS4A 3I3LA 4USQA 4YKFA 2YVGA 4ROPA 3AE8A 3QVRA 3VA8A 4B1BA 2APGA 1YQ3A 5M10A 3R11A 4JN8A 1N1PA 4CNJA 1RYIA 1ZP0A 1VRQB 1QO8A 4C74A 1Z6LA 3KVEA 2WU5A 4XWZA 1EL8A 1FFVC 3GYIA 1GTHA 1MRAA 1KKRA 3QPEA 4X9NA 2OG9A 3GD6A 1PHHA 1GERA 1JNZA 3AE2A 3KU9A 3NRZB 1LV0A 2BXRA 4H4VA 5FS7A 3UTHA 3SZCA 1ZXIC 3Q6JA 5G5HB 3UOYA 2GQFA 3EANA 5G5GB 5FMHA 2WHDA 1L8PA 2Q0LA 4XWRA 4O5QA 3AECA 2C76A 3EAOA 2XVJA 3DG6A 5JRBA 1S3EA 5FJRA 2XLSA 2X8HA 1M6IA 3GC2A 2XYOA 3AEEA 5M0ZA 1PBCA 1RM6B 4EWJA 1PBEA 3MY9A 2XH0A 5U63A 4ZA0A 1T3QC 1TYTA 1B37A 3EKGA 2VRMA 3HYXA 3AD7B 5KOWA 2JB3A 2W3SA 3SBFA 3UJRA 3CT2A 3UJ2A 4U8NA 3NG7X 4IZGA 4P9SA 1F8SA 3UCCA 4YTPA 1NG4A 3ZVHB 2B7RA 1IUSA 4H83A 3NK2X 4YSYA 3GRSA 4BJZA 2PTYA 1FL2A 4JY2A 1GEUA 2YLSA 3Q4DA 2CVJA 2AQJA 4ICYA 3STPA 2GVCA 3AE9A 4YWOA 1AOGA 1MUCA 2YLXA 1SEZA 2FKPA 3VC5A 2B9XA 4EQRA 4H7UA 1JU2A 3VR9A 4A6GA 2PODA 1GSNA 4NEVA 3H8LA 4KPLA 1W6TA 4AP3A 2BACA 4U2SA 1OJCA 1D4EA 1FEAA 4HCLA 1P43A 4J1OA 3UOVA 2PU1A 2R45A 3C96A 1EC9A 2GR2A 5KMRA 4YWSA 2YR6A 4X4JA 4AP1A 4UP3A 5CQFA 2X8GA 2V5ZA 1YQ4A 3IJIA 3V5FA 2P0IA 1GRBA 1O94A 3VRBA 3N4EA 2PSNA 3CNPA 4EQWA 3RHAA 2OZ8A 2QDDA 2JAEA 3DK4A 4A3RA 2YG5A 4ZCWA 1LTXR 4II3A 5EU9A 3NN0X 1RP0A 2C75A 1XDIA 1F9CA 3LB8A 2GGIA 3B97A 5EBKA 2BRAA 1TDKA 2BC1A 1GALA 4YSXA 2WQYA 2RABA 1D4CA 3F8RA 4NEWA 5BOEA 4Z26A 5KMPA 1GRTA 2YQUA 4C5OA 2A89A 3ZVIA 5J7XA 1DOEA 3GRTA 3K30A 2XFNA 2WDQA 4GMEA 2WOWA 3AE7A 3NVZB 1IUVA 1X2HA 1PDHA 1Y56B 1KSSA 1FECA 2WU2A 3T9PA 4Z2TA 1NEKA 1KSUA 2CFYA 3DA1A 1SB3B 3AYJA 4J2WA 2YR4A 2C72A 3DMEA 2XFOA 1OJTA 5DBJA 2VRLA 5JCIA 4EQSA 2E1MA 4J34A 2CULA 1GREA 4CCRA 4MMWA 2GV8A 3UP5A 4H1ZA 3AN1A 3NRNA 3BOXA 3A7UA 4N9XA 2XVFA 2XVHA 4TVYA 2GAGB 2ZZCA 3SZ0A 3TJ4A 2C3DA 3K1GA 4CCQA 1EBDA 2JKCA 1GPEA 3SSZA 3H7VA 3V3WA 5HYMA 1BZLA 3OZMA 3T6CA 3NK1X 3IHGA 2WOIA 1EL5A 1MXTA 4A5LA 1GV4A 1JNRA 4DHGA 1DOBA 4H4QA 3H8IA 3ALJA 4AOSA 3M13A 3DK9A 3P4SA 2PTZA 2XLUA 3DG7A 2GGEA 4IP5A 3MQTA 3MSYA 1OJDA 2GMHA 4EIQA 3D1CA 4AT2A 4FK1C 4TVWA 4IP4A 2V60A 1KNRA 3VR8A 2EQ7A 3THUA 4HA6A 1VDVA 4DX3A 3JVAA 4GCMA 1PBFA 3CNSA 3KPFA 1JEHA 2GF3A 1OEPA 1N4VA 2FBWA 3AE3A 4MGGA 2AKMA 4JDRA 5U25A 2ZC8A 4U2LA 3IJLA 3S47A 2DW6A 3JSKA 2Z5XA 2O56A 2W3RA 2X50A 2YLTA 2VVLG 1VQZA 2X99A 2WP5A 2WOVA 3E1TA 1ZMCA 2JBVA 4B67A 2E3TA 2XCGA 4EMIA 1JCTA 1CC4A 2IVDA 2H88A 1TDOA 2OAMA 2HZGA 4LU6A 4H2HA 4PABA 5HHFA 4DXKA 1RVKA 1SJCA 2RGOA 5GRTA 4D04A 1BF3A 3RP6A 1TYPA 2PTWA 3RGTA 1H86A 1GXFA 3R0UA 3FXGA 4HCDA 2HQMA 2AL2B 4B64A 1WYGA 1ZOVA 2WBAA 1BGJA 4H2NA 1E39A 4XXGA 1PXCA 2ONEA 4D03A 5ER0A 1H7WA 1VG0A 3V76A 3SXIA 1CJ3A 3VFCA 5KXJA 3EF6A 3CPHG 2B9YA 2QJJA 3FVDA 2BS3A 3NH3X 3H70A 2YLWA 3P4RA 3NIXA 3LADA 1TDNA 1MDLA 3G5SA 4U8MA 4JNQA 3KUMA 4PAAA 4J3ZA 3CXBA 3FCPA 1IJHA 4DSHA 2POZA 4K2SA 3AEGA 3TOYA 4REKA 2FYMA 3NGCX 3UJFA 2OLAA 2W54A 1KKOA 5U1OA 3AXBA 1TDFA 1CJCA 1ECQA 2JK6A 1GT8A 4IVMB 5KMSA 3T2KA 1B5QA 4TM3A 4DN1A 2I0ZA 3CTYA 3NN6X 3C4NA 4E0VA 5FS9A 4B66A 1LJ1A 2RGJA 1YEYA 4K5RA 2O9ZA 4HCHA 3SN0A 2PA6A 4BV6A 3NVVB 4H4UA 3VRDB 1GRAA 1JRPA 1LVLA 3M0OA 3AEFA 3QFAA 3OW1A 2V61A 4HYRA 3FMWA 4TLZA 4YSZA 3U4FA 3UTEA 2ZADA 1JDFA 1KCZA 3ATRA 3AYIA 2CDUA 2XVEA 5KMQA 3BHFA 4BK3A 4OPIA 4Z44A 4J56A 4U2TA 3R9UA 2PP0A 1GRGA 2R0GA 1QLBA 3GWDA 2BC0A 3NYCA 5FJTA 1DTNA 4EQXA 1P48A 1CL0A 3AD8B 4A9WA 3SN4A 3AEDA 4YTMA 2C67A 4K1WA 3NNEA 3TWBA 2GR0A 2E5VA 2HNEA 3GDNA 3BNMA 4JNAA 5CKUA 5KVHA 3BI2A 1H7XA 3ALLA 2BCPA 1EL9A 3ZLHA 2A8XA 4Z2RA 4H4YA 3H12A 4U8OA 3UCDA 4I59A 4B68A 1CC6A 3AM9A 2GQWA 3P9UA 3OTRA 4GGHA 1JPMA 2ZZ0A 3CNDA 3SFEA 1IUUA 1H82A 2ZBWA 3GO2A 1BQGA 3VDGA 4G7FA 4BK2A 5IPYA 3NO1A 4ZCDA 2CHRA 5KVIA 4J57A 3P4PA 2YAUA 1XHCA 2IVEA 3URHA 1NHRA 4Z17A 5BVAA 1N60C 1S3BA 5JCMA 1FHUA 3PS9A 2V3BA 2TPRA 2WEUA 1WUFA 1H2IA 1VG9A 5KOXA 3AE6A 3QKEA 3Q45A 2HXUA 2EQ9A 2W55A 4Y4MA 4G8TA 2PGEA 4H4SA 1UKVG 3PK7A 2GAHB 3T2ZA 1F6MA 3SJNA 1SJAA 1NHQA 3QSEA 3RNMA 3NYFA 3NFUA 4NTDA 4A79A 3AYLA 2GRTA 2GR1A 3CYJA 3I6DA 1EBHA 3L8KA 2DKIA 4OPGA 2OO6A 2BK4A 3NKSA 4U8JA 3AEAA 4GAVA 2PU0A 2XFPA 3BI5A 3A7AA 3LZWA 3KKJA 3LJPA 2C70A 3G5QA 4IA6A 1FCDA 1RSGA 3H8AA 3GSIA 3AE1A 1F8RA 4C77A 3COXA 4G6HA 2BCGG 5BULA 5FS8A 1GRFA 4K8GA 3NTDA 2OFJA 1GOSA 4EMJA 1JROA 4G74A 2AL2A 2YG3A 3N6JA 4Z43A 2P3ZA 4EMWA 3T31A 3NT6A 2AL1A 4O5UA 4H4XA 3NS1B 4FK1A 2XLPA 1MNSA 1DOCA 2WP9A 2QDEA 2YG7A 4CY6A 2XDOA 5C3JA 2QGYA 2P88A 4GYPC 3C4AA 3DK8A 2PPGA 5HY5A 2BK5A 3DGZA 3IJQA 2PP1A 3RITA 2BK3A 1DNCA 1ZKQA 3EPTA 4MJWA 3T37A 2C4CA 5JCLA 3G5RA 4KX6A 2WPFA 1GETA 3AE4A 2VZ2A 4H2RA 3GD3A 3DGBA 1X2GA 2RDXA 1DJNA 3DJEA 2XVIA 3MWCA 5KWFA 4FDCB 3T0KA 4KEMA 5J60A 1E9IA 1NDAA 4OPTA 2MNRA 3CGDA 3ATQA 4E6MA 1SJDA 2Q6UA 1ZK7A 1NENA 4CBQA 4K5SA 2QJNA 4KPRA 1LPFA 2AAQA 2GH5A 2QA2A 2OLOA 3IHMA 3VC6A 3AB1A 3NVYB 1ONFA 1N62C 3MZNA 3S5SA 4J36A 1PN0A 1E1MA 3IWAA 3UKFA 4WCTA 3HW2A 3A7RA 3Q9TA 5IQ1A 4IVOB 1QJDA 2Y6RA 2YM1A 2OZTA 4OPDA 4GUVA 3KLJA 1BWCA 5JCKA 3P1WA 3UTFA 2OLNA 3PO7A 4HPNA 4DGKA 4A6NB 1WUEA 1TRBA 5KRQA 2WS3A 2FJEA 3D47A 4EIPA 1H81A 2AKZA 2BYBA 2R4JA 2YG4A 2OZ3A 1TKKA 3UOXA 3QTPA 3DIPA 3B9JB 4E4FA 2WETA 4TM0A 3RP8A 5EB4A 4LA1A 4M52A 4DNAA 1SJBA 3TWAA 3CNTA 3T14A 4OPLA 3CGBA 4B69A 1K0JA 4FI4A 4ENLA 3ISHA 4ECHA 4JHMA 3UP4A 3I6TA 2DKHA 1Q9IA 4B63A 3ZVHA 3ZLGA 1E1LA 3R10A 3CMMA 3GMCA 2C3CA 1FEBA 4KWSA 2FJAA 2QQ6A 3NHOX 4OPCA 3GYXA 3ICTA 2C64A 3AEBA 3P93A 3UKPA 2AR8A 2MUCA 1NELA 3PWIA 2YG6A 4RG4A 3MUCA 1BKHA 3SQPA 3UXLA 2YLRA 4BK1A 2C7GA 2J3NA 2OQYA 1YQZA 3DDMA 3AWIA 3II4A 3D9XA 2PTXA 3EEZA 4YT0A 2YVJA 1FFUC 5ENLA 4AT0A 4TM1A 4ADWA 4H2QA 3DFHA 2QJMA 3K7TA 3NLCA 4HB9A 1DJQA 3DEQA 1FHVA 5GSNA 4ZN0A 1NHPA 3K7MX 1KN0A 4E8GA 4I58A 1X31B 5EB5A 4OCGA 3UKQA 4NNJA 4DYEA 5FJOA 3SR6B 2YR5A 2HXTA 3ZLFA 4HNCA 3SM8A 1FO4A 3UXKA 4Z2UA 1VDCA 3I4KA 2Z5YA 3DESA 1K4QA 2GSHA 1YY5A 2WDRA 1NPXA 3OC4A 4NWZA 3RP7A 3UKKA 4HN8A 3DJJA 3S5WA 3GMBA 2FJBA 2WPEA 3UJSA 1XPYA 4M0XA 1KNPA 2IIDA 1E1NA 3CPJG 1L9CA 4G73A 1ZY8A 2YM2A 1Y56A 3GYJA 3QFBA 3UKAA 1D7LA 3VRAA 4A35A 4JY3A 3V3OA 3ITJA 3UGVA 5J04A 3AD9B 3B3RA 1MO9A 3LXDA 1KD0A 1E6EA 3QSMA 3UOZA 3T2YA 1REOA 3NTAA 1BKWA 3DFYA 4E5TA 3FV9A 3ADAB 3DERA 5C2TA 1N4WA 3FYYA 4MKSA 1D7YA 1LQTA 2GGHA 4X2PA 3N6HA 1W4XA 2FJDA 3DJDA 1B8SA 2PP3A 1FOHA 4H4ZA 2GGJA 2QVHA 3IC9A 3NZGA 4DWDA 4GISA 2F5ZA 4LIIA 2V6OA 1K0LA 2R0CA 4UDPA 2WPCA 4AOXA 2NQLA 2XFQA 3ALMA 4KT2A 3VQRA 2H89A 2OKTA 3OZ2A 4K2XA 4CY8A 3B6DA 1E7PA 4JQ9A 3ENLA 3L1RA 4GR1A 5LV9A 2B9WA 4TM4A 4J33A 3V4BA 7ENLA 5FJPA 4FX9A 3RCYA 1JRXA 2V3AA 4A99A 1PDYA 2OA1A 4IA5A 1OJ9A 3CXOA 3PFRA 2DW7A 1TDEA 2GMJA 3HRDC 3M12A 3S61A 4CNKA 4A65A 4A6NA 3ZYXA 4NTEA 3TTEA 4YSHA 2P8CA 1Q1WA 2PYXA 1XANA 4GYPA 3ICRA 3P3BA 3NVWB 1N5XA 1D5TA 3ES8A 4F4RA 2TMDA 1PJ6A 2Q7VA 3UJEA 4Y4NA 3FPZA 3UTGA 3KA7A 5JCNA 4DSGA 3CPIG 3NXLA 1LQUA 2Q0KA 1CBOA 3F8PA 4IL2A 3K7QX 2XH2A
chains in the Genus database with same CATH topology
2XCGA 4YKFA 2YVGA 2UZZA 3AE8A 4EMIA 3QVRA 1DJNA 5HXIA 3DJEA 3KPKA 1H84A 2XVIA 4C3YA 1CC4A 4B1BA 2APGA 3NK0X 5KWFA 4FDCB 2IVDA 1YQ3A 3T0KA 5J60A 5M10A 1N1PA 1NDAA 1D4DA 2VQ7A 4OPTA 3SY4A 2H88A 3CGDA 1TDOA 2EQ6A 2OAMA 3ATQA 4CNJA 4LU6A 2Q6UA 1RYIA 1MOKA 4PABA 5HHFA 1ZK7A 1ZP0A 1NENA 4CBQA 4H4TA 1VRQB 1QO8A 4C74A 4K5SA 1Z6LA 3KVEA 2WU5A 4KPRA 2XLRA 1LPFA 2AAQA 2R9ZA 1PXAA 4XWZA 1EL8A 2GH5A 2ACZA 2QA2A 2RGOA 2OLOA 4Z24A 3IHMA 4GF7A 3SZFA 5GRTA 3AB1A 3GYIA 4D04A 1GTHA 1BF3A 3RP6A 1TYPA 1H86A 1GXFA 5BUKA 2VQBA 4X9NA 2XFUA 1ONFA 2ZZBA 2B76A 1PHHA 4GDEA 2HQMA 1GERA 1JNZA 3AE2A 4B64A 3KU9A 1ELIA 3QVPA 1CF3A 1H6VA 1K0IA 2XLTA 1PN0A 4J36A 1E1MA 3IWAA 1ZOVA 2WBAA 1LV0A 2X3NA 1BGJA 2BXRA 2YLZA 4WCTA 3UKFA 2X8CA 4H2NA 1E39A 3H4KA 1PXCA 4XXGA 3Q9TA 5IQ1A 4IVOB 1QJDA 4D03A 4H4VA 5ER0A 2Y6RA 5FS7A 2YM1A 3UTHA 4U8PA 3SZCA 1H7WA 1VG0A 4OPDA 3V76A 4GUVA 3SXIA 2A87A 3Q6JA 1CJ3A 3UOYA 2GQFA 3KLJA 1B4VA 2OALA 1BWCA 3EANA 5JCKA 4GRTA 5KXJA 5FMHA 2WHDA 3EF6A 2Q0LA 3P1WA 4XWRA 3CPHG 2B9YA 4O5QA 3AECA 2BS3A 2C76A 3EAOA 2XVJA 2YLWA 2OLNA 3NH3X 3P4RA 3UTFA 3PO7A 2VVLA 3NIXA 3QJ4A 3LADA 5JRBA 4DGKA 1S3EA 2XLSA 1TDNA 2X8HA 3G5SA 1M6IA 4U8MA 4A6NB 4APNA 1KDGA 4K22A 1TRBA 4JNQA 3PG6A 5KRQA 3DJGX 2FJEA 2WS3A 2XYOA 2R0PA 3AEEA 5M0ZA 1PBCA 1PBEA 4EIPA 3CGEA 1H81A 2BYBA 4PAAA 1NG3A 4DSHA 1IJHA 4B65A 2R4JA 3LZXA 4EM3A 3AEGA 2YG4A 5U63A 4YKGA 1ZMDA 3IF9A 4REKA 3DH9A 3NGCX 1TYTA 3UOXA 4OPUA 1B37A 2VRMA 3HYXA 3AD7B 2BABA 5KOWA 2JB3A 3ABVA 2WETA 5U1OA 4G6GA 4TM0A 4U8NA 3AXBA 1VQWA 1TDFA 3NG7X 4P9SA 1CJCA 3PVCA 1F8SA 5EB4A 3RP8A 4M52A 4LA1A 4DNAA 1ZX9A 2JK6A 3ZDNA 4YTPA 1GT8A 3D8XA 4IVMB 1NG4A 5KMSA 2B7RA 3CNTA 3T14A 3T2KA 1IUSA 4OPLA 2PHHA 3CGBA 2JB2A 4B69A 1B5QA 3NK2X 1K0JA 4TM3A 4YSYA 3GRSA 1F8WA 4BJZA 2I0ZA 3CTYA 3NN6X 3C4NA 3ISHA 1FL2A 4JY2A 4E0VA 1GEUA 1GRHA 2YLSA 4ECHA 3UP4A 5FS9A 1DODA 2CVJA 4II2A 2DKHA 1Q9IA 2AQJA 4B66A 1LJ1A 2RGJA 4ICYA 4B63A 2GVCA 4K5RA 3SYIA 3DGHA 1BGNA 2O9ZA 4ZCCA 1E1LA 2GEWA 3AE9A 4YWOA 1AOGA 3CMMA 3CNJA 2C3CA 3GMCA 4TLXA 4BV6A 2VOUA 1L0VA 1FEBA 4H4UA 2FJAA 2EQ8A 3VRDB 2YLXA 1GRAA 1CJ2A 1YKJA 1SEZA 3NHOX 1L9DA 1LVLA 3HZLA 4OPCA 3M0OA 3AEFA 3QFAA 3GYXA 3KD9A 4EM4A 2V61A 3AE5A 3ICTA 3FMWA 4TLZA 2C64A 4YSZA 3AEBA 4YTNA 3UTEA 3QSSA 1Q1RA 1ZOYA 3UKPA 2B9XA 3ATRA 4EQRA 4H7UA 1JU2A 2AR8A 3VR9A 4H4RA 3AYIA 2CDUA 4H50A 2XVEA 5KMQA 1GSNA 3BHFA 4NEVA 3H8LA 4UDQA 4BK3A 1DXLA 4OPIA 4Z44A 4AP3A 2BACA 4U2SA 4J56A 1M64A 1OJCA 1D4EA 2YG6A 4RG4A 4U2TA 3R9UA 1FEAA 3UOVA 1GRGA 3SQPA 2YLRA 4BK1A 4C3XA 2C7GA 2R0GA 3FBSA 4GDPA 1NAAA 1QLBA 2J3NA 2R45A 3C96A 2BXSA 3GWDA 2GR2A 2BC0A 1JOAA 1YQZA 5KMRA 3NYCA 1PS9A 3O0HA 1XPQA 2YR6A 4NTCA 1HYUA 3AWIA 4X4JA 4AP1A 4EQXA 3II4A 1CL0A 1Y0PA 3AD8B 3D9XA 4A9WA 2NVKX 4YT0A 4UP3A 2WDVA 2YVJA 3AEDA 4AT0A 3GD4A 4YTMA 1PBDA 4ADWA 4TM1A 4H2QA 2X8GA 2C67A 2V5ZA 5CQFA 3NNEA 1YQ4A 2GR0A 1GNDA 2E5VA 3K7TA 1IUWA 1CJ4A 3NLCA 3GDNA 3BNMA 4JNAA 4HB9A 5CKUA 1DJQA 1GRBA 5KVHA 1O94A 3BI2A 3VRBA 1H7XA 3BHKA 2RGHA 4GAPA 3SGLA 3ALLA 5GSNA 2BCPA 4ZN0A 3CNPA 1EL9A 4EQWA 3RHAA 1PBBA 1NHPA 2A8XA 5TR3A 4Z2RA 3K7MX 4H4YA 1KN0A 4I58A 4U8OA 1IUXA 1X31B 5EB5A 4I59A 4B68A 4K8DA 4OCGA 1CC6A 3UKQA 2JAEA 4NNJA 3DK4A 2YG5A 2GQWA 1LTXR 2YR5A 3P9UA 4II3A 3NN0X 3SM8A 2ZZ0A 3CNDA 1RP0A 4UDRA 3SFEA 1IUUA 2GR3A 2C75A 4Z2UA 1VDCA 1XDIA 1H82A 3LB8A 2Z5YA 2ZBWA 1K4QA 4BK2A 5EBKA 2BRAA 1TDKA 1YY5A 4NZHA 4ZCDA 2BC1A 1GALA 5IPYA 5KVIA 4YSXA 2WQYA 4J57A 1ZDLA 4U8KA 3P4PA 2RABA 2JBVA 1D4CA 4K7ZA 2YAUA 3F8RA 1XHCA 4H4WA 2WDRA 3FG2P 4NEWA 2IVEA 4Z26A 2VVMA 3URHA 1GRTA 2YQUA 3REDA 5KMPA 4C5OA 1NPXA 1NHRA 2A89A 3BI4A 5BVAA 4YXDA 3OC4A 1S3BA 4NWZA 5J7XA 3RP7A 4A7AA 1DOEA 3UKKA 3GRTA 3K30A 2YWLA 2XFNA 2WDQA 5JCMA 3DJJA 2WOWA 3AE7A 3S5WA 4BJYA 3GMBA 1E1KA 1IUVA 2FJBA 2WPEA 3PS9A 1PDHA 1Y56B 2V3BA 2TPRA 2WEUA 1KSSA 1H2IA 1VG9A 5KOXA 3AE6A 1FECA 2WU2A 4Z2TA 1KNPA 2IIDA 1NEKA 1E1NA 3CPJG 1L9CA 4G73A 1KSUA 2EQ9A 3UKLA 1ZY8A 2YM2A 4IV9A 2CFYA 3DA1A 1Y56A 3GYJA 4Y4MA 2C66A 3AYJA 4H4SA 1H83A 1UKVG 3QFBA 4USRA 4J2WA 3UKAA 1KFYA 2C72A 2YR4A 3DMEA 1D7LA 2XFOA 3VRAA 1OJTA 2GAHB 3T2ZA 1S2YA 5DBJA 2BS2A 2VRLA 1F6MA 4JY3A 3V3OA 4U8IA 5JCIA 4EQSA 3ITJA 2E1MA 3UCLA 1NHQA 1COYA 1P2HA 3AD9B 3QSEA 3B3RA 3RNMA 2CULA 4J34A 3NYFA 1GREA 4NTDA 1MO9A 2NPXA 1OJAA 4A79A 3LXDA 3SX6A 1E6EA 4CCRA 1NHSA 2GV8A 3QSMA 3UP5A 3AYLA 2WP6A 3UOZA 3GWFA 3NRNA 4OVIA 3T2YA 5L46A 2C65A 2GRTA 4N9XA 2GR1A 1REOA 2XVFA 3CIRA 2JB1A 3NTAA 3WE0A 1BKWA 2XVHA 3I6DA 1GTEA 3ADAB 2GAGB 2ZZCA 3L8KA 1PJ5A 2DKIA 4OPGA 5C2TA 3SZ0A 1N4WA 1GESA 2C3DA 2BK4A 4CCQA 4CRTA 1EBDA 2JKCA 3NKSA 4U8JA 3AEAA 4GAVA 1GPEA 1D7YA 2R46A 4JN9A 2XFPA 1LQTA 2QA1A 3BI5A 5BRTA 5HYMA 1BZLA 3LZWA 3KKJA 3NK1X 3IHGA 1JRYA 3LJPA 2C70A 3G5QA 4IA6A 1FCDA 1RSGA 1W4XA 2WOIA 4G9KA 2FJDA 3GSIA 3DJDA 1B8SA 1EL5A 3AE1A 1FOHA 4H4ZA 1MXTA 4A5LA 1GV4A 1F8RA 1JNRA 3IC9A 1CC2A 4C77A 2F5ZA 4LIIA 2V6OA 1DOBA 1K0LA 3CGCA 2R0CA 3COXA 4G6HA 2BCGG 4UDPA 2WPCA 5FS8A 4H4QA 4AOXA 5BULA 1GRFA 2XFQA 3ALMA 3NTDA 3H8IA 3ALJA 1GOSA 4AOSA 1L9EA 3DK9A 2H89A 3M13A 4EMJA 1O95A 3OZ2A 3P4SA 3VQRA 2XLUA 4G74A 1N4UA 4K2XA 4CY8A 3B6DA 1JRZA 1OJDA 2YG3A 2GMHA 4EIQA 1E7PA 4Z43A 4H4PA 4JQ9A 1PJ7A 3D1CA 3L1RA 4EMWA 4AT2A 4GR1A 3SFDA 2C73A 5LV9A 4FK1C 3T31A 2B9WA 1O5WA 4X9MA 3UKHA 3NT6A 5EOWA 5IQ4A 4O5UA 4TM4A 2V60A 1KNRA 4H4XA 4J33A 3NYEA 3GDPA 2E4GA 3VR8A 1S2QA 3HYVA 2EQ7A 4RSLA 1CHUA 4FX9A 4FK1A 4HA6A 1IUTA 1JRXA 2XLPA 2V3AA 4A99A 1PXBA 3LOVA 4WX1A 2QAEA 2OA1A 3ICSA 1OJ9A 2ARDA 4IA5A 4Y4LA 1DOCA 1TDEA 2WP9A 3V3NA 3HYWA 3L5OA 2YG7A 3FIMB 2GMJA 2W0HA 4GCMA 2Y6QA 1PBFA 4CY6A 2XDOA 3BNUA 5C3JA 3CNSA 3KPFA 3M12A 3S61A 1JEHA 2GF3A 2R4EA 2WESA 4CNKA 1N4VA 2FBWA 3C4AA 3AE3A 4A65A 4A6NA 3DK8A 4NTEA 3ZYXA 5KNLA 4JDRA 4H2PA 4YSHA 2BRYA 5U25A 1Q1WA 2PYXA 1XANA 4U2LA 1F3PA 5HY5A 4BURA 2BK5A 3DGZA 3JSKA 3P4QA 2YVFA 2Z5XA 5FS6A 2QCUA 3SZWA 3ICRA 1EL7A 3F8DA 2BK3A 2X50A 4Z25A 1D5TA 1V59A 1DNCA 2TMDA 1PJ6A 2BA9A 4J31A 1ZKQA 2YLTA 2Q7VA 3EPTA 4MJWA 3T37A 4Y4NA 3FPZA 1P2EA 3KA7A 3UTGA 5JCNA 4DSGA 2C4CA 3CPIG 5JCLA 2VVLG 3G5RA 3CN8A 4RG3A 4KX6A 1S7MA 1LQUA 2Q0KA 2X99A 2WPFA 2WP5A 1GETA 3AE4A 2VZ2A 1KF6A 2WOVA 4U8LA 3E1TA 1ZMCA 2GB0A 2B7SA 1CBOA 3F8PA 4H2RA 2BS4A 3GD3A 3I3LA 3K7QX 4B67A 4USQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCG A;  4YKF A;  2YVG A;  2UZZ A;  3AE8 A;  4EMI A;  3QVR A;  1DJN A;  5HXI A;  3DJE A;  4C3Y A;  1H84 A;  2XVI A;  5KWF A;  1CC4 A;  4B1B A;  2APG A;  3NK0 X;  4FDC B;  2IVD A;  1YQ3 A;  5J60 A;  5M10 A;  1N1P A;  1NDA A;  1D4D A;  2VQ7 A;  4OPT A;  2H88 A;  3CGD A;  1TDO A;  2EQ6 A;  2OAM A;  3ATQ A;  4CNJ A;  4LU6 A;  2Q6U A;  1RYI A;  1MOK A;  4PAB A;  5HHF A;  1ZK7 A;  1ZP0 A;  1NEN A;  4CBQ A;  4H4T A;  1VRQ B;  1QO8 A;  4C74 A;  4K5S A;  1Z6L A;  3KVE A;  2WU5 A;  4KPR A;  2XLR A;  1LPF A;  2AAQ A;  2R9Z A;  1PXA A;  4XWZ A;  1EL8 A;  2GH5 A;  2ACZ A;  2QA2 A;  2RGO A;  2OLO A;  4Z24 A;  3IHM A;  4GF7 A;  5GRT A;  3AB1 A;  3GYI A;  4D04 A;  1GTH A;  1BF3 A;  3RP6 A;  1TYP A;  1H86 A;  1GXF A;  5BUK A;  2VQB A;  4X9N A;  2XFU A;  1ONF A;  2ZZB A;  2B76 A;  1PHH A;  4GDE A;  2HQM A;  1GER A;  1JNZ A;  3AE2 A;  4B64 A;  3KU9 A;  1ELI A;  3QVP A;  1CF3 A;  1H6V A;  1K0I A;  2XLT A;  1PN0 A;  4J36 A;  1E1M A;  3IWA A;  1ZOV A;  2WBA A;  1LV0 A;  2X3N A;  1BGJ A;  2BXR A;  2YLZ A;  4WCT A;  3UKF A;  2X8C A;  4H2N A;  1E39 A;  3H4K A;  1PXC A;  4XXG A;  3Q9T A;  5IQ1 A;  4IVO B;  1QJD A;  4D03 A;  4H4V A;  5ER0 A;  2Y6R A;  5FS7 A;  2YM1 A;  3UTH A;  4U8P A;  1H7W A;  1VG0 A;  4OPD A;  3V76 A;  4GUV A;  2A87 A;  3Q6J A;  1CJ3 A;  3UOY A;  2GQF A;  3KLJ A;  1B4V A;  2OAL A;  1BWC A;  3EAN A;  5JCK A;  4GRT A;  5KXJ A;  5FMH A;  2WHD A;  3EF6 A;  2Q0L A;  3P1W A;  4XWR A;  3CPH G;  2B9Y A;  4O5Q A;  3AEC A;  2BS3 A;  2C76 A;  3EAO A;  2XVJ A;  2YLW A;  2OLN A;  3NH3 X;  3P4R A;  3UTF A;  3PO7 A;  2VVL A;  3NIX A;  3QJ4 A;  3LAD A;  4DGK A;  1S3E A;  2XLS A;  1TDN A;  2X8H A;  3G5S A;  1M6I A;  4U8M A;  4A6N B;  4APN A;  1KDG A;  4K22 A;  1TRB A;  4JNQ A;  5KRQ A;  3DJG X;  2FJE A;  2WS3 A;  2XYO A;  2R0P A;  3AEE A;  5M0Z A;  1PBC A;  1PBE A;  4EIP A;  3CGE A;  1H81 A;  2BYB A;  4PAA A;  1NG3 A;  4DSH A;  1IJH A;  4B65 A;  2R4J A;  3LZX A;  4EM3 A;  3AEG A;  2YG4 A;  5U63 A;  4YKG A;  1ZMD A;  3IF9 A;  4REK A;  3DH9 A;  3NGC X;  1TYT A;  3UOX A;  4OPU A;  1B37 A;  2VRM A;  3AD7 B;  2BAB A;  5KOW A;  2JB3 A;  3ABV A;  2WET A;  5U1O A;  4TM0 A;  4U8N A;  3AXB A;  1VQW A;  1TDF A;  3NG7 X;  4P9S A;  1CJC A;  3PVC A;  1F8S A;  5EB4 A;  3RP8 A;  4M52 A;  4LA1 A;  4DNA A;  1ZX9 A;  2JK6 A;  3ZDN A;  4YTP A;  1GT8 A;  3D8X A;  4IVM B;  1NG4 A;  2B7R A;  3CNT A;  1IUS A;  4OPL A;  2PHH A;  3CGB A;  2JB2 A;  4B69 A;  1B5Q A;  3NK2 X;  1K0J A;  4TM3 A;  4YSY A;  3GRS A;  1F8W A;  4BJZ A;  2I0Z A;  3CTY A;  3NN6 X;  3C4N A;  3ISH A;  1FL2 A;  4JY2 A;  4E0V A;  1GEU A;  1GRH A;  2YLS A;  4ECH A;  3UP4 A;  5FS9 A;  1DOD A;  2CVJ A;  2DKH A;  1Q9I A;  2AQJ A;  4B66 A;  1LJ1 A;  2RGJ A;  4ICY A;  4B63 A;  2GVC A;  4K5R A;  3DGH A;  1BGN A;  2O9Z A;  4ZCC A;  1E1L A;  2GEW A;  3AE9 A;  4YWO A;  1AOG A;  3CNJ A;  2C3C A;  3GMC A;  4TLX A;  4BV6 A;  2VOU A;  1L0V A;  1FEB A;  4H4U A;  2FJA A;  2EQ8 A;  3VRD B;  2YLX A;  1GRA A;  1CJ2 A;  1YKJ A;  1SEZ A;  3NHO X;  1L9D A;  1LVL A;  3HZL A;  4OPC A;  3M0O A;  3AEF A;  3QFA A;  3KD9 A;  4EM4 A;  2V61 A;  3AE5 A;  3ICT A;  3FMW A;  4TLZ A;  2C64 A;  4YSZ A;  3AEB A;  4YTN A;  3UTE A;  3QSS A;  1Q1R A;  1ZOY A;  3UKP A;  2B9X A;  3ATR A;  4EQR A;  4H7U A;  1JU2 A;  2AR8 A;  3VR9 A;  4H4R A;  3AYI A;  2CDU A;  4H50 A;  2XVE A;  1GSN A;  3BHF A;  4NEV A;  3H8L A;  4UDQ A;  4BK3 A;  1DXL A;  4OPI A;  4Z44 A;  4AP3 A;  2BAC A;  4U2S A;  4J56 A;  1M64 A;  1OJC A;  1D4E A;  2YG6 A;  4RG4 A;  4U2T A;  3R9U A;  1FEA A;  3UOV A;  1GRG A;  3SQP A;  2YLR A;  4BK1 A;  4C3X A;  2C7G A;  2R0G A;  3FBS A;  4GDP A;  1NAA A;  1QLB A;  2J3N A;  2R45 A;  3C96 A;  2BXS A;  3GWD A;  2GR2 A;  2BC0 A;  1JOA A;  1YQZ A;  3NYC A;  1PS9 A;  3O0H A;  1XPQ A;  2YR6 A;  4NTC A;  1HYU A;  3AWI A;  4X4J A;  4AP1 A;  4EQX A;  3II4 A;  1CL0 A;  1Y0P A;  3AD8 B;  4A9W A;  2NVK X;  4YT0 A;  4UP3 A;  2WDV A;  2YVJ A;  3AED A;  4AT0 A;  3GD4 A;  4YTM A;  1PBD A;  4ADW A;  4TM1 A;  4H2Q A;  2X8G A;  2C67 A;  2V5Z A;  5CQF A;  3NNE A;  1YQ4 A;  2GR0 A;  1GND A;  2E5V A;  3K7T A;  1IUW A;  1CJ4 A;  3NLC A;  3GDN A;  3BNM A;  4JNA A;  4HB9 A;  5CKU A;  1DJQ A;  1GRB A;  5KVH A;  1O94 A;  3BI2 A;  3VRB A;  1H7X A;  3BHK A;  2RGH A;  3SGL A;  3ALL A;  5GSN A;  2BCP A;  4ZN0 A;  3CNP A;  1EL9 A;  4EQW A;  3RHA A;  1PBB A;  1NHP A;  2A8X A;  5TR3 A;  4Z2R A;  3K7M X;  4H4Y A;  4I58 A;  4U8O A;  1IUX A;  1X31 B;  5EB5 A;  4I59 A;  4B68 A;  4K8D A;  4OCG A;  1CC6 A;  3UKQ A;  2JAE A;  3DK4 A;  2YG5 A;  2GQW A;  1LTX R;  2YR5 A;  3P9U A;  3NN0 X;  3SM8 A;  2ZZ0 A;  3CND A;  1RP0 A;  4UDR A;  3SFE A;  1IUU A;  2GR3 A;  2C75 A;  4Z2U A;  1VDC A;  1XDI A;  1H82 A;  3LB8 A;  2Z5Y A;  2ZBW A;  1K4Q A;  4BK2 A;  5EBK A;  1TDK A;  1YY5 A;  4NZH A;  4ZCD A;  2BC1 A;  1GAL A;  5IPY A;  5KVI A;  4YSX A;  2WQY A;  4J57 A;  1ZDL A;  4U8K A;  3P4P A;  2RAB A;  2JBV A;  1D4C A;  4K7Z A;  2YAU A;  3F8R A;  1XHC A;  4H4W A;  2WDR A;  3FG2 P;  4NEW A;  2IVE A;  4Z26 A;  2VVM A;  3URH A;  1GRT A;  2YQU A;  3RED A;  4C5O A;  1NPX A;  1NHR A;  2A89 A;  3BI4 A;  5BVA A;  4YXD A;  3OC4 A;  1S3B A;  5J7X A;  3RP7 A;  4A7A A;  1DOE A;  3UKK A;  3GRT A;  3K30 A;  2YWL A;  2XFN A;  2WDQ A;  5JCM A;  3DJJ A;  2WOW A;  3AE7 A;  3S5W A;  4BJY A;  3GMB A;  1E1K A;  1IUV A;  2FJB A;  2WPE A;  3PS9 A;  1PDH A;  1Y56 B;  2V3B A;  2TPR A;  2WEU A;  1KSS A;  1VG9 A;  5KOX A;  3AE6 A;  1FEC A;  2WU2 A;  4Z2T A;  1KNP A;  2IID A;  1NEK A;  1E1N A;  3CPJ G;  1L9C A;  1KSU A;  2EQ9 A;  3UKL A;  1ZY8 A;  2YM2 A;  4IV9 A;  2CFY A;  3DA1 A;  1Y56 A;  3GYJ A;  4Y4M A;  2C66 A;  3AYJ A;  4H4S A;  1H83 A;  1UKV G;  3QFB A;  4USR A;  4J2W A;  3UKA A;  1KFY A;  2C72 A;  2YR4 A;  3DME A;  1D7L A;  2XFO A;  3VRA A;  1OJT A;  2GAH B;  1S2Y A;  5DBJ A;  2BS2 A;  2VRL A;  1F6M A;  4JY3 A;  3V3O A;  4U8I A;  5JCI A;  4EQS A;  3ITJ A;  2E1M A;  3UCL A;  1NHQ A;  1COY A;  1P2H A;  3AD9 B;  3QSE A;  3B3R A;  3RNM A;  2CUL A;  4J34 A;  3NYF A;  1GRE A;  4NTD A;  1MO9 A;  2NPX A;  1OJA A;  4A79 A;  3LXD A;  1E6E A;  4CCR A;  1NHS A;  2GV8 A;  3QSM A;  3UP5 A;  3AYL A;  2WP6 A;  3UOZ A;  3GWF A;  3NRN A;  4OVI A;  5L46 A;  2C65 A;  2GRT A;  4N9X A;  2GR1 A;  1REO A;  2XVF A;  3CIR A;  2JB1 A;  3NTA A;  3WE0 A;  1BKW A;  2XVH A;  3I6D A;  1GTE A;  3ADA B;  2GAG B;  2ZZC A;  3L8K A;  1PJ5 A;  2DKI A;  4OPG A;  5C2T A;  1N4W A;  1GES A;  2C3D A;  2BK4 A;  4CCQ A;  4CRT A;  1EBD A;  2JKC A;  3NKS A;  4U8J A;  3AEA A;  1GPE A;  1D7Y A;  2R46 A;  4JN9 A;  2XFP A;  1LQT A;  2QA1 A;  3BI5 A;  5BRT A;  5HYM A;  1BZL A;  3LZW A;  3KKJ A;  3NK1 X;  3IHG A;  1JRY A;  3LJP A;  2C70 A;  3G5Q A;  4IA6 A;  1FCD A;  1RSG A;  1W4X A;  2WOI A;  2FJD A;  3GSI A;  3DJD A;  1B8S A;  1EL5 A;  3AE1 A;  1FOH A;  4H4Z A;  1MXT A;  4A5L A;  1GV4 A;  1F8R A;  1JNR A;  3IC9 A;  1CC2 A;  4C77 A;  2F5Z A;  4LII A;  2V6O A;  1DOB A;  1K0L A;  3CGC A;  2R0C A;  3COX A;  2BCG G;  4UDP A;  2WPC A;  5FS8 A;  4H4Q A;  4AOX A;  5BUL A;  1GRF A;  2XFQ A;  3ALM A;  3NTD A;  3H8I A;  3ALJ A;  1GOS A;  4AOS A;  1L9E A;  3DK9 A;  2H89 A;  3M13 A;  4EMJ A;  1O95 A;  3OZ2 A;  3P4S A;  3VQR A;  2XLU A;  1N4U A;  4K2X A;  4CY8 A;  3B6D A;  1JRZ A;  1OJD A;  2YG3 A;  2GMH A;  4EIQ A;  1E7P A;  4Z43 A;  4H4P A;  4JQ9 A;  1PJ7 A;  3D1C A;  3L1R A;  4EMW A;  4AT2 A;  4GR1 A;  3SFD A;  2C73 A;  5LV9 A;  4FK1 C;  2B9W A;  1O5W A;  4X9M A;  3UKH A;  3NT6 A;  5EOW A;  5IQ4 A;  4O5U A;  4TM4 A;  2V60 A;  1KNR A;  4H4X A;  4J33 A;  3NYE A;  3GDP A;  2E4G A;  3VR8 A;  1S2Q A;  2EQ7 A;  4RSL A;  1CHU A;  4FX9 A;  4FK1 A;  4HA6 A;  1IUT A;  1JRX A;  2XLP A;  2V3A A;  4A99 A;  1PXB A;  3LOV A;  4WX1 A;  2QAE A;  2OA1 A;  3ICS A;  1OJ9 A;  2ARD A;  4IA5 A;  4Y4L A;  1DOC A;  1TDE A;  2WP9 A;  3V3N A;  3FIM B;  2YG7 A;  2GMJ A;  2W0H A;  4GCM A;  2Y6Q A;  1PBF A;  4CY6 A;  2XDO A;  3BNU A;  5C3J A;  3CNS A;  3KPF A;  3M12 A;  3S61 A;  1JEH A;  2GF3 A;  2R4E A;  2WES A;  4CNK A;  1N4V A;  2FBW A;  3C4A A;  3AE3 A;  4A65 A;  4A6N A;  3DK8 A;  4NTE A;  3ZYX A;  4JDR A;  4H2P A;  4YSH A;  5U25 A;  1Q1W A;  2PYX A;  1XAN A;  4U2L A;  1F3P A;  5HY5 A;  4BUR A;  2BK5 A;  3DGZ A;  3JSK A;  3P4Q A;  2YVF A;  2Z5X A;  5FS6 A;  2QCU A;  3ICR A;  1EL7 A;  3F8D A;  2BK3 A;  2X50 A;  4Z25 A;  1D5T A;  1V59 A;  1DNC A;  2TMD A;  1PJ6 A;  2BA9 A;  4J31 A;  1ZKQ A;  2YLT A;  2Q7V A;  3EPT A;  4MJW A;  3T37 A;  4Y4N A;  3FPZ A;  1P2E A;  3KA7 A;  3UTG A;  5JCN A;  4DSG A;  3CPI G;  5JCL A;  2VVL G;  3G5R A;  3CN8 A;  4RG3 A;  4KX6 A;  1LQU A;  2Q0K A;  2X99 A;  2WPF A;  2WP5 A;  1GET A;  3AE4 A;  2VZ2 A;  1KF6 A;  2WOV A;  4U8L A;  3E1T A;  1ZMC A;  2GB0 A;  2B7S A;  1CBO A;  3F8P A;  4H2R A;  2BS4 A;  3GD3 A;  3I3L A;  3K7Q X;  4B67 A;  4USQ A; 
#chains in the Genus database with same CATH topology
 2UZZ A;  5HXI A;  3KPK A;  1H84 A;  4C3Y A;  3NK0 X;  3SY4 A;  1D4D A;  2VQ7 A;  5BOF A;  2EQ6 A;  1MOK A;  3T4W A;  4H4T A;  2XLR A;  2R9Z A;  1PXA A;  2XH7 A;  2ACZ A;  4Z24 A;  4GF7 A;  3SZF A;  5BUK A;  2VQB A;  1XS2 A;  2XFU A;  1IYX A;  2ZZB A;  2B76 A;  4GDE A;  1ELI A;  3QVP A;  1CF3 A;  1H6V A;  1K0I A;  2XLT A;  2X3N A;  2YLZ A;  2X8C A;  3TQP A;  3H4K A;  4HNL A;  1PDZ A;  1FIQ B;  4U8P A;  1TZZ A;  3V5C A;  3RO6 A;  2A87 A;  2E5A A;  1B4V A;  2OAL A;  3EUB 3;  4GRT A;  3T8Q A;  3QJ4 A;  2VVL A;  3GY1 A;  1R0M A;  3BJS A;  4APN A;  2PGW A;  1KDG A;  4K22 A;  3PG6 A;  3DJG X;  3R25 A;  2R0P A;  3CGE A;  3R1Z A;  1NG3 A;  1STZ A;  4B65 A;  3LZX A;  3RRA A;  4EM3 A;  4YKG A;  1ZMD A;  3IF9 A;  2GGG A;  3DH9 A;  4OPU A;  2BAB A;  3ABV A;  4G6G A;  3HPF A;  1VQW A;  3PVC A;  1ZX9 A;  3ZDN A;  3D8X A;  1EC8 A;  1N63 C;  2PHH A;  2JB2 A;  3N4F A;  1F8W A;  1GRH A;  1N61 C;  1DOD A;  4II2 A;  3SYI A;  3DGH A;  1BGN A;  4ZCC A;  2GEW A;  1V97 A;  3CNJ A;  4TLX A;  2VOU A;  1L0V A;  2EQ8 A;  1CJ2 A;  1YKJ A;  1L9D A;  3HZL A;  3I6E A;  3KD9 A;  4EM4 A;  3AE5 A;  4YTN A;  3QSS A;  1Q1R A;  1ZOY A;  4H4R A;  4H50 A;  3VCC A;  4UDQ A;  2P8B A;  1DXL A;  1M64 A;  4C3X A;  3FBS A;  4GDP A;  1NAA A;  2OX4 A;  2BXS A;  1JOA A;  1PS9 A;  3O0H A;  1XPQ A;  4NTC A;  3ES7 A;  1HYU A;  1Y0P A;  4IHC A;  2NVK X;  2WDV A;  3GD4 A;  1PBD A;  1GND A;  1IUW A;  1CJ4 A;  3ETR B;  3BHK A;  2RGH A;  4GAP A;  3SGL A;  3OZY A;  2OQH A;  3TJI A;  1PBB A;  3DG3 A;  5TR3 A;  1IUX A;  4FP1 A;  3TW9 A;  4K8D A;  3CAW A;  4UDR A;  4ZOH B;  2GR3 A;  3MKC A;  2I5Q A;  1NU5 A;  4IL0 A;  1JPD X;  4M6U A;  3VCN A;  4NZH A;  2PS2 A;  1ZDL A;  4U8K A;  4K7Z A;  4H4W A;  3FG2 P;  1EC7 A;  2OPJ A;  2VVM A;  3RED A;  3BI4 A;  1ONE A;  4YXD A;  4A7A A;  2YWL A;  3OP2 A;  3QLD A;  4BJY A;  1E1K A;  3QN3 A;  4JN7 A;  3UKL A;  4IV9 A;  2C66 A;  3JW7 A;  1H83 A;  1EBG A;  4USR A;  1KFY A;  2XH4 A;  1S2Y A;  2BS2 A;  4Z1Y A;  5IDZ A;  2XSX A;  4H19 A;  5FJU A;  4U8I A;  1R6W A;  3UCL A;  1COY A;  1P2H A;  4GFI A;  2NPX A;  1OJA A;  2GL5 A;  3R07 C;  3SX6 A;  4GGB A;  1NHS A;  5L46 A;  2WP6 A;  3GWF A;  4OVI A;  2C65 A;  2GDQ A;  3CIR A;  2JB1 A;  3WE0 A;  1GTE A;  1PJ5 A;  1GES A;  4CRT A;  2R46 A;  1TE6 A;  4JN9 A;  2QA1 A;  3PWG A;  5BRT A;  3P0W A;  1JRY A;  3CB3 A;  1MDR A;  4G9K A;  2XGZ A;  3BSM A;  1CC2 A;  3AMZ A;  3CGC A;  1L9E A;  4IT1 A;  1O95 A;  3TCS A;  1N4U A;  1JRZ A;  3SQS A;  4H4P A;  1PJ7 A;  3RR1 A;  3SFD A;  2C73 A;  2OVL A;  1O5W A;  4X9M A;  3UKH A;  5EOW A;  5IQ4 A;  3D46 A;  3NYE A;  3GDP A;  2E4G A;  1S2Q A;  3HYV A;  4RSL A;  1CHU A;  1IUT A;  1PXB A;  3LOV A;  4WX1 A;  4E4U A;  2QAE A;  3ICS A;  2ARD A;  4Y4L A;  6ENL A;  3V3N A;  3HYW A;  3L5O A;  3FIM B;  2W0H A;  2Y6Q A;  3BNU A;  3CK5 A;  3OPS A;  2R4E A;  2WES A;  5KNL A;  4H2P A;  2PCE A;  2BRY A;  1ELS A;  1F3P A;  4BUR A;  3P4Q A;  2YVF A;  5FS6 A;  2QCU A;  1N5W C;  3SZW A;  1EL7 A;  3F8D A;  3JZU A;  4Z25 A;  4GIR A;  3FJ4 A;  1V59 A;  2BA9 A;  3SN1 A;  4J31 A;  3IK4 A;  1P2E A;  3U9I A;  4RG3 A;  3CN8 A;  3R0K A;  1S7M A;  2PMQ A;  1KF6 A;  4U8L A;  2GB0 A;  2B7S A;  2BS4 A;  3I3L A;  4USQ A;  4YKF A;  2YVG A;  4ROP A;  3AE8 A;  3QVR A;  3VA8 A;  4B1B A;  2APG A;  1YQ3 A;  5M10 A;  3R11 A;  4JN8 A;  1N1P A;  4CNJ A;  1RYI A;  1ZP0 A;  1VRQ B;  1QO8 A;  4C74 A;  1Z6L A;  3KVE A;  2WU5 A;  4XWZ A;  1EL8 A;  1FFV C;  3GYI A;  1GTH A;  1MRA A;  1KKR A;  3QPE A;  4X9N A;  2OG9 A;  3GD6 A;  1PHH A;  1GER A;  1JNZ A;  3AE2 A;  3KU9 A;  3NRZ B;  1LV0 A;  2BXR A;  4H4V A;  5FS7 A;  3UTH A;  3SZC A;  1ZXI C;  3Q6J A;  5G5H B;  3UOY A;  2GQF A;  3EAN A;  5G5G B;  5FMH A;  2WHD A;  1L8P A;  2Q0L A;  4XWR A;  4O5Q A;  3AEC A;  2C76 A;  3EAO A;  2XVJ A;  3DG6 A;  5JRB A;  1S3E A;  5FJR A;  2XLS A;  2X8H A;  1M6I A;  3GC2 A;  2XYO A;  3AEE A;  5M0Z A;  1PBC A;  1RM6 B;  4EWJ A;  1PBE A;  3MY9 A;  2XH0 A;  5U63 A;  4ZA0 A;  1T3Q C;  1TYT A;  1B37 A;  3EKG A;  2VRM A;  3HYX A;  3AD7 B;  5KOW A;  2JB3 A;  2W3S A;  3SBF A;  3UJR A;  3CT2 A;  3UJ2 A;  4U8N A;  3NG7 X;  4IZG A;  4P9S A;  1F8S A;  3UCC A;  4YTP A;  1NG4 A;  3ZVH B;  2B7R A;  1IUS A;  4H83 A;  3NK2 X;  4YSY A;  3GRS A;  4BJZ A;  2PTY A;  1FL2 A;  4JY2 A;  1GEU A;  2YLS A;  3Q4D A;  2CVJ A;  2AQJ A;  4ICY A;  3STP A;  2GVC A;  3AE9 A;  4YWO A;  1AOG A;  1MUC A;  2YLX A;  1SEZ A;  2FKP A;  3VC5 A;  2B9X A;  4EQR A;  4H7U A;  1JU2 A;  3VR9 A;  4A6G A;  2POD A;  1GSN A;  4NEV A;  3H8L A;  4KPL A;  1W6T A;  4AP3 A;  2BAC A;  4U2S A;  1OJC A;  1D4E A;  1FEA A;  4HCL A;  1P43 A;  4J1O A;  3UOV A;  2PU1 A;  2R45 A;  3C96 A;  1EC9 A;  2GR2 A;  5KMR A;  4YWS A;  2YR6 A;  4X4J A;  4AP1 A;  4UP3 A;  5CQF A;  2X8G A;  2V5Z A;  1YQ4 A;  3IJI A;  3V5F A;  2P0I A;  1GRB A;  1O94 A;  3VRB A;  3N4E A;  2PSN A;  3CNP A;  4EQW A;  3RHA A;  2OZ8 A;  2QDD A;  2JAE A;  3DK4 A;  4A3R A;  2YG5 A;  4ZCW A;  1LTX R;  4II3 A;  5EU9 A;  3NN0 X;  1RP0 A;  2C75 A;  1XDI A;  1F9C A;  3LB8 A;  2GGI A;  3B97 A;  5EBK A;  2BRA A;  1TDK A;  2BC1 A;  1GAL A;  4YSX A;  2WQY A;  2RAB A;  1D4C A;  3F8R A;  4NEW A;  5BOE A;  4Z26 A;  5KMP A;  1GRT A;  2YQU A;  4C5O A;  2A89 A;  3ZVI A;  5J7X A;  1DOE A;  3GRT A;  3K30 A;  2XFN A;  2WDQ A;  4GME A;  2WOW A;  3AE7 A;  3NVZ B;  1IUV A;  1X2H A;  1PDH A;  1Y56 B;  1KSS A;  1FEC A;  2WU2 A;  3T9P A;  4Z2T A;  1NEK A;  1KSU A;  2CFY A;  3DA1 A;  1SB3 B;  3AYJ A;  4J2W A;  2YR4 A;  2C72 A;  3DME A;  2XFO A;  1OJT A;  5DBJ A;  2VRL A;  5JCI A;  4EQS A;  2E1M A;  4J34 A;  2CUL A;  1GRE A;  4CCR A;  4MMW A;  2GV8 A;  3UP5 A;  4H1Z A;  3AN1 A;  3NRN A;  3BOX A;  3A7U A;  4N9X A;  2XVF A;  2XVH A;  4TVY A;  2GAG B;  2ZZC A;  3SZ0 A;  3TJ4 A;  2C3D A;  3K1G A;  4CCQ A;  1EBD A;  2JKC A;  1GPE A;  3SSZ A;  3H7V A;  3V3W A;  5HYM A;  1BZL A;  3OZM A;  3T6C A;  3NK1 X;  3IHG A;  2WOI A;  1EL5 A;  1MXT A;  4A5L A;  1GV4 A;  1JNR A;  4DHG A;  1DOB A;  4H4Q A;  3H8I A;  3ALJ A;  4AOS A;  3M13 A;  3DK9 A;  3P4S A;  2PTZ A;  2XLU A;  3DG7 A;  2GGE A;  4IP5 A;  3MQT A;  3MSY A;  1OJD A;  2GMH A;  4EIQ A;  3D1C A;  4AT2 A;  4FK1 C;  4TVW A;  4IP4 A;  2V60 A;  1KNR A;  3VR8 A;  2EQ7 A;  3THU A;  4HA6 A;  1VDV A;  4DX3 A;  3JVA A;  4GCM A;  1PBF A;  3CNS A;  3KPF A;  1JEH A;  2GF3 A;  1OEP A;  1N4V A;  2FBW A;  3AE3 A;  4MGG A;  2AKM A;  4JDR A;  5U25 A;  2ZC8 A;  4U2L A;  3IJL A;  3S47 A;  2DW6 A;  3JSK A;  2Z5X A;  2O56 A;  2W3R A;  2X50 A;  2YLT A;  2VVL G;  1VQZ A;  2X99 A;  2WP5 A;  2WOV A;  3E1T A;  1ZMC A;  2JBV A;  4B67 A;  2E3T A;  2XCG A;  4EMI A;  1JCT A;  1CC4 A;  2IVD A;  2H88 A;  1TDO A;  2OAM A;  2HZG A;  4LU6 A;  4H2H A;  4PAB A;  5HHF A;  4DXK A;  1RVK A;  1SJC A;  2RGO A;  5GRT A;  4D04 A;  1BF3 A;  3RP6 A;  1TYP A;  2PTW A;  3RGT A;  1H86 A;  1GXF A;  3R0U A;  3FXG A;  4HCD A;  2HQM A;  2AL2 B;  4B64 A;  1WYG A;  1ZOV A;  2WBA A;  1BGJ A;  4H2N A;  1E39 A;  4XXG A;  1PXC A;  2ONE A;  4D03 A;  5ER0 A;  1H7W A;  1VG0 A;  3V76 A;  3SXI A;  1CJ3 A;  3VFC A;  5KXJ A;  3EF6 A;  3CPH G;  2B9Y A;  2QJJ A;  3FVD A;  2BS3 A;  3NH3 X;  3H70 A;  2YLW A;  3P4R A;  3NIX A;  3LAD A;  1TDN A;  1MDL A;  3G5S A;  4U8M A;  4JNQ A;  3KUM A;  4PAA A;  4J3Z A;  3CXB A;  3FCP A;  1IJH A;  4DSH A;  2POZ A;  4K2S A;  3AEG A;  3TOY A;  4REK A;  2FYM A;  3NGC X;  3UJF A;  2OLA A;  2W54 A;  1KKO A;  5U1O A;  3AXB A;  1TDF A;  1CJC A;  1ECQ A;  2JK6 A;  1GT8 A;  4IVM B;  5KMS A;  3T2K A;  1B5Q A;  4TM3 A;  4DN1 A;  2I0Z A;  3CTY A;  3NN6 X;  3C4N A;  4E0V A;  5FS9 A;  4B66 A;  1LJ1 A;  2RGJ A;  1YEY A;  4K5R A;  2O9Z A;  4HCH A;  3SN0 A;  2PA6 A;  4BV6 A;  3NVV B;  4H4U A;  3VRD B;  1GRA A;  1JRP A;  1LVL A;  3M0O A;  3AEF A;  3QFA A;  3OW1 A;  2V61 A;  4HYR A;  3FMW A;  4TLZ A;  4YSZ A;  3U4F A;  3UTE A;  2ZAD A;  1JDF A;  1KCZ A;  3ATR A;  3AYI A;  2CDU A;  2XVE A;  5KMQ A;  3BHF A;  4BK3 A;  4OPI A;  4Z44 A;  4J56 A;  4U2T A;  3R9U A;  2PP0 A;  1GRG A;  2R0G A;  1QLB A;  3GWD A;  2BC0 A;  3NYC A;  5FJT A;  1DTN A;  4EQX A;  1P48 A;  1CL0 A;  3AD8 B;  4A9W A;  3SN4 A;  3AED A;  4YTM A;  2C67 A;  4K1W A;  3NNE A;  3TWB A;  2GR0 A;  2E5V A;  2HNE A;  3GDN A;  3BNM A;  4JNA A;  5CKU A;  5KVH A;  3BI2 A;  1H7X A;  3ALL A;  2BCP A;  1EL9 A;  3ZLH A;  2A8X A;  4Z2R A;  4H4Y A;  3H12 A;  4U8O A;  3UCD A;  4I59 A;  4B68 A;  1CC6 A;  3AM9 A;  2GQW A;  3P9U A;  3OTR A;  4GGH A;  1JPM A;  2ZZ0 A;  3CND A;  3SFE A;  1IUU A;  1H82 A;  2ZBW A;  3GO2 A;  1BQG A;  3VDG A;  4G7F A;  4BK2 A;  5IPY A;  3NO1 A;  4ZCD A;  2CHR A;  5KVI A;  4J57 A;  3P4P A;  2YAU A;  1XHC A;  2IVE A;  3URH A;  1NHR A;  4Z17 A;  5BVA A;  1N60 C;  1S3B A;  5JCM A;  1FHU A;  3PS9 A;  2V3B A;  2TPR A;  2WEU A;  1WUF A;  1H2I A;  1VG9 A;  5KOX A;  3AE6 A;  3QKE A;  3Q45 A;  2HXU A;  2EQ9 A;  2W55 A;  4Y4M A;  4G8T A;  2PGE A;  4H4S A;  1UKV G;  3PK7 A;  2GAH B;  3T2Z A;  1F6M A;  3SJN A;  1SJA A;  1NHQ A;  3QSE A;  3RNM A;  3NYF A;  3NFU A;  4NTD A;  4A79 A;  3AYL A;  2GRT A;  2GR1 A;  3CYJ A;  3I6D A;  1EBH A;  3L8K A;  2DKI A;  4OPG A;  2OO6 A;  2BK4 A;  3NKS A;  4U8J A;  3AEA A;  4GAV A;  2PU0 A;  2XFP A;  3BI5 A;  3A7A A;  3LZW A;  3KKJ A;  3LJP A;  2C70 A;  3G5Q A;  4IA6 A;  1FCD A;  1RSG A;  3H8A A;  3GSI A;  3AE1 A;  1F8R A;  4C77 A;  3COX A;  4G6H A;  2BCG G;  5BUL A;  5FS8 A;  1GRF A;  4K8G A;  3NTD A;  2OFJ A;  1GOS A;  4EMJ A;  1JRO A;  4G74 A;  2AL2 A;  2YG3 A;  3N6J A;  4Z43 A;  2P3Z A;  4EMW A;  3T31 A;  3NT6 A;  2AL1 A;  4O5U A;  4H4X A;  3NS1 B;  4FK1 A;  2XLP A;  1MNS A;  1DOC A;  2WP9 A;  2QDE A;  2YG7 A;  4CY6 A;  2XDO A;  5C3J A;  2QGY A;  2P88 A;  4GYP C;  3C4A A;  3DK8 A;  2PPG A;  5HY5 A;  2BK5 A;  3DGZ A;  3IJQ A;  2PP1 A;  3RIT A;  2BK3 A;  1DNC A;  1ZKQ A;  3EPT A;  4MJW A;  3T37 A;  2C4C A;  5JCL A;  3G5R A;  4KX6 A;  2WPF A;  1GET A;  3AE4 A;  2VZ2 A;  4H2R A;  3GD3 A;  3DGB A;  1X2G A;  2RDX A;  1DJN A;  3DJE A;  2XVI A;  3MWC A;  5KWF A;  4FDC B;  3T0K A;  4KEM A;  5J60 A;  1E9I A;  1NDA A;  4OPT A;  2MNR A;  3CGD A;  3ATQ A;  4E6M A;  1SJD A;  2Q6U A;  1ZK7 A;  1NEN A;  4CBQ A;  4K5S A;  2QJN A;  4KPR A;  1LPF A;  2AAQ A;  2GH5 A;  2QA2 A;  2OLO A;  3IHM A;  3VC6 A;  3AB1 A;  3NVY B;  1ONF A;  1N62 C;  3MZN A;  3S5S A;  4J36 A;  1PN0 A;  1E1M A;  3IWA A;  3UKF A;  4WCT A;  3HW2 A;  3A7R A;  3Q9T A;  5IQ1 A;  4IVO B;  1QJD A;  2Y6R A;  2YM1 A;  2OZT A;  4OPD A;  4GUV A;  3KLJ A;  1BWC A;  5JCK A;  3P1W A;  3UTF A;  2OLN A;  3PO7 A;  4HPN A;  4DGK A;  4A6N B;  1WUE A;  1TRB A;  5KRQ A;  2WS3 A;  2FJE A;  3D47 A;  4EIP A;  1H81 A;  2AKZ A;  2BYB A;  2R4J A;  2YG4 A;  2OZ3 A;  1TKK A;  3UOX A;  3QTP A;  3DIP A;  3B9J B;  4E4F A;  2WET A;  4TM0 A;  3RP8 A;  5EB4 A;  4LA1 A;  4M52 A;  4DNA A;  1SJB A;  3TWA A;  3CNT A;  3T14 A;  4OPL A;  3CGB A;  4B69 A;  1K0J A;  4FI4 A;  4ENL A;  3ISH A;  4ECH A;  4JHM A;  3UP4 A;  3I6T A;  2DKH A;  1Q9I A;  4B63 A;  3ZVH A;  3ZLG A;  1E1L A;  3R10 A;  3CMM A;  3GMC A;  2C3C A;  1FEB A;  4KWS A;  2FJA A;  2QQ6 A;  3NHO X;  4OPC A;  3GYX A;  3ICT A;  2C64 A;  3AEB A;  3P93 A;  3UKP A;  2AR8 A;  2MUC A;  1NEL A;  3PWI A;  2YG6 A;  4RG4 A;  3MUC A;  1BKH A;  3SQP A;  3UXL A;  2YLR A;  4BK1 A;  2C7G A;  2J3N A;  2OQY A;  1YQZ A;  3DDM A;  3AWI A;  3II4 A;  3D9X A;  2PTX A;  3EEZ A;  4YT0 A;  2YVJ A;  1FFU C;  5ENL A;  4AT0 A;  4TM1 A;  4ADW A;  4H2Q A;  3DFH A;  2QJM A;  3K7T A;  3NLC A;  4HB9 A;  1DJQ A;  3DEQ A;  1FHV A;  5GSN A;  4ZN0 A;  1NHP A;  3K7M X;  1KN0 A;  4E8G A;  4I58 A;  1X31 B;  5EB5 A;  4OCG A;  3UKQ A;  4NNJ A;  4DYE A;  5FJO A;  3SR6 B;  2YR5 A;  2HXT A;  3ZLF A;  4HNC A;  3SM8 A;  1FO4 A;  3UXK A;  4Z2U A;  1VDC A;  3I4K A;  2Z5Y A;  3DES A;  1K4Q A;  2GSH A;  1YY5 A;  2WDR A;  1NPX A;  3OC4 A;  4NWZ A;  3RP7 A;  3UKK A;  4HN8 A;  3DJJ A;  3S5W A;  3GMB A;  2FJB A;  2WPE A;  3UJS A;  1XPY A;  4M0X A;  1KNP A;  2IID A;  1E1N A;  3CPJ G;  1L9C A;  4G73 A;  1ZY8 A;  2YM2 A;  1Y56 A;  3GYJ A;  3QFB A;  3UKA A;  1D7L A;  3VRA A;  4A35 A;  4JY3 A;  3V3O A;  3ITJ A;  3UGV A;  5J04 A;  3AD9 B;  3B3R A;  1MO9 A;  3LXD A;  1KD0 A;  1E6E A;  3QSM A;  3UOZ A;  3T2Y A;  1REO A;  3NTA A;  1BKW A;  3DFY A;  4E5T A;  3FV9 A;  3ADA B;  3DER A;  5C2T A;  1N4W A;  3FYY A;  4MKS A;  1D7Y A;  1LQT A;  2GGH A;  4X2P A;  3N6H A;  1W4X A;  2FJD A;  3DJD A;  1B8S A;  2PP3 A;  1FOH A;  4H4Z A;  2GGJ A;  2QVH A;  3IC9 A;  3NZG A;  4DWD A;  4GIS A;  2F5Z A;  4LII A;  2V6O A;  1K0L A;  2R0C A;  4UDP A;  2WPC A;  4AOX A;  2NQL A;  2XFQ A;  3ALM A;  4KT2 A;  3VQR A;  2H89 A;  2OKT A;  3OZ2 A;  4K2X A;  4CY8 A;  3B6D A;  1E7P A;  4JQ9 A;  3ENL A;  3L1R A;  4GR1 A;  5LV9 A;  2B9W A;  4TM4 A;  4J33 A;  3V4B A;  7ENL A;  5FJP A;  4FX9 A;  3RCY A;  1JRX A;  2V3A A;  4A99 A;  1PDY A;  2OA1 A;  4IA5 A;  1OJ9 A;  3CXO A;  3PFR A;  2DW7 A;  1TDE A;  2GMJ A;  3HRD C;  3M12 A;  3S61 A;  4CNK A;  4A65 A;  4A6N A;  3ZYX A;  4NTE A;  3TTE A;  4YSH A;  2P8C A;  1Q1W A;  2PYX A;  1XAN A;  4GYP A;  3ICR A;  3P3B A;  3NVW B;  1N5X A;  1D5T A;  3ES8 A;  4F4R A;  2TMD A;  1PJ6 A;  2Q7V A;  3UJE A;  4Y4N A;  3FPZ A;  3UTG A;  3KA7 A;  5JCN A;  4DSG A;  3CPI G;  3NXL A;  1LQU A;  2Q0K A;  1CBO A;  3F8P A;  4IL2 A;  3K7Q X;  2XH2 A; 
#chains in the Genus database with same CATH homology
 2XCG A;  4YKF A;  2YVG A;  2UZZ A;  3AE8 A;  4EMI A;  3QVR A;  1DJN A;  5HXI A;  3DJE A;  3KPK A;  1H84 A;  2XVI A;  4C3Y A;  1CC4 A;  4B1B A;  2APG A;  3NK0 X;  5KWF A;  4FDC B;  2IVD A;  1YQ3 A;  3T0K A;  5J60 A;  5M10 A;  1N1P A;  1NDA A;  1D4D A;  2VQ7 A;  4OPT A;  3SY4 A;  2H88 A;  3CGD A;  1TDO A;  2EQ6 A;  2OAM A;  3ATQ A;  4CNJ A;  4LU6 A;  2Q6U A;  1RYI A;  1MOK A;  4PAB A;  5HHF A;  1ZK7 A;  1ZP0 A;  1NEN A;  4CBQ A;  4H4T A;  1VRQ B;  1QO8 A;  4C74 A;  4K5S A;  1Z6L A;  3KVE A;  2WU5 A;  4KPR A;  2XLR A;  1LPF A;  2AAQ A;  2R9Z A;  1PXA A;  4XWZ A;  1EL8 A;  2GH5 A;  2ACZ A;  2QA2 A;  2RGO A;  2OLO A;  4Z24 A;  3IHM A;  4GF7 A;  3SZF A;  5GRT A;  3AB1 A;  3GYI A;  4D04 A;  1GTH A;  1BF3 A;  3RP6 A;  1TYP A;  1H86 A;  1GXF A;  5BUK A;  2VQB A;  4X9N A;  2XFU A;  1ONF A;  2ZZB A;  2B76 A;  1PHH A;  4GDE A;  2HQM A;  1GER A;  1JNZ A;  3AE2 A;  4B64 A;  3KU9 A;  1ELI A;  3QVP A;  1CF3 A;  1H6V A;  1K0I A;  2XLT A;  1PN0 A;  4J36 A;  1E1M A;  3IWA A;  1ZOV A;  2WBA A;  1LV0 A;  2X3N A;  1BGJ A;  2BXR A;  2YLZ A;  4WCT A;  3UKF A;  2X8C A;  4H2N A;  1E39 A;  3H4K A;  1PXC A;  4XXG A;  3Q9T A;  5IQ1 A;  4IVO B;  1QJD A;  4D03 A;  4H4V A;  5ER0 A;  2Y6R A;  5FS7 A;  2YM1 A;  3UTH A;  4U8P A;  3SZC A;  1H7W A;  1VG0 A;  4OPD A;  3V76 A;  4GUV A;  3SXI A;  2A87 A;  3Q6J A;  1CJ3 A;  3UOY A;  2GQF A;  3KLJ A;  1B4V A;  2OAL A;  1BWC A;  3EAN A;  5JCK A;  4GRT A;  5KXJ A;  5FMH A;  2WHD A;  3EF6 A;  2Q0L A;  3P1W A;  4XWR A;  3CPH G;  2B9Y A;  4O5Q A;  3AEC A;  2BS3 A;  2C76 A;  3EAO A;  2XVJ A;  2YLW A;  2OLN A;  3NH3 X;  3P4R A;  3UTF A;  3PO7 A;  2VVL A;  3NIX A;  3QJ4 A;  3LAD A;  5JRB A;  4DGK A;  1S3E A;  2XLS A;  1TDN A;  2X8H A;  3G5S A;  1M6I A;  4U8M A;  4A6N B;  4APN A;  1KDG A;  4K22 A;  1TRB A;  4JNQ A;  3PG6 A;  5KRQ A;  3DJG X;  2FJE A;  2WS3 A;  2XYO A;  2R0P A;  3AEE A;  5M0Z A;  1PBC A;  1PBE A;  4EIP A;  3CGE A;  1H81 A;  2BYB A;  4PAA A;  1NG3 A;  4DSH A;  1IJH A;  4B65 A;  2R4J A;  3LZX A;  4EM3 A;  3AEG A;  2YG4 A;  5U63 A;  4YKG A;  1ZMD A;  3IF9 A;  4REK A;  3DH9 A;  3NGC X;  1TYT A;  3UOX A;  4OPU A;  1B37 A;  2VRM A;  3HYX A;  3AD7 B;  2BAB A;  5KOW A;  2JB3 A;  3ABV A;  2WET A;  5U1O A;  4G6G A;  4TM0 A;  4U8N A;  3AXB A;  1VQW A;  1TDF A;  3NG7 X;  4P9S A;  1CJC A;  3PVC A;  1F8S A;  5EB4 A;  3RP8 A;  4M52 A;  4LA1 A;  4DNA A;  1ZX9 A;  2JK6 A;  3ZDN A;  4YTP A;  1GT8 A;  3D8X A;  4IVM B;  1NG4 A;  5KMS A;  2B7R A;  3CNT A;  3T14 A;  3T2K A;  1IUS A;  4OPL A;  2PHH A;  3CGB A;  2JB2 A;  4B69 A;  1B5Q A;  3NK2 X;  1K0J A;  4TM3 A;  4YSY A;  3GRS A;  1F8W A;  4BJZ A;  2I0Z A;  3CTY A;  3NN6 X;  3C4N A;  3ISH A;  1FL2 A;  4JY2 A;  4E0V A;  1GEU A;  1GRH A;  2YLS A;  4ECH A;  3UP4 A;  5FS9 A;  1DOD A;  2CVJ A;  4II2 A;  2DKH A;  1Q9I A;  2AQJ A;  4B66 A;  1LJ1 A;  2RGJ A;  4ICY A;  4B63 A;  2GVC A;  4K5R A;  3SYI A;  3DGH A;  1BGN A;  2O9Z A;  4ZCC A;  1E1L A;  2GEW A;  3AE9 A;  4YWO A;  1AOG A;  3CMM A;  3CNJ A;  2C3C A;  3GMC A;  4TLX A;  4BV6 A;  2VOU A;  1L0V A;  1FEB A;  4H4U A;  2FJA A;  2EQ8 A;  3VRD B;  2YLX A;  1GRA A;  1CJ2 A;  1YKJ A;  1SEZ A;  3NHO X;  1L9D A;  1LVL A;  3HZL A;  4OPC A;  3M0O A;  3AEF A;  3QFA A;  3GYX A;  3KD9 A;  4EM4 A;  2V61 A;  3AE5 A;  3ICT A;  3FMW A;  4TLZ A;  2C64 A;  4YSZ A;  3AEB A;  4YTN A;  3UTE A;  3QSS A;  1Q1R A;  1ZOY A;  3UKP A;  2B9X A;  3ATR A;  4EQR A;  4H7U A;  1JU2 A;  2AR8 A;  3VR9 A;  4H4R A;  3AYI A;  2CDU A;  4H50 A;  2XVE A;  5KMQ A;  1GSN A;  3BHF A;  4NEV A;  3H8L A;  4UDQ A;  4BK3 A;  1DXL A;  4OPI A;  4Z44 A;  4AP3 A;  2BAC A;  4U2S A;  4J56 A;  1M64 A;  1OJC A;  1D4E A;  2YG6 A;  4RG4 A;  4U2T A;  3R9U A;  1FEA A;  3UOV A;  1GRG A;  3SQP A;  2YLR A;  4BK1 A;  4C3X A;  2C7G A;  2R0G A;  3FBS A;  4GDP A;  1NAA A;  1QLB A;  2J3N A;  2R45 A;  3C96 A;  2BXS A;  3GWD A;  2GR2 A;  2BC0 A;  1JOA A;  1YQZ A;  5KMR A;  3NYC A;  1PS9 A;  3O0H A;  1XPQ A;  2YR6 A;  4NTC A;  1HYU A;  3AWI A;  4X4J A;  4AP1 A;  4EQX A;  3II4 A;  1CL0 A;  1Y0P A;  3AD8 B;  3D9X A;  4A9W A;  2NVK X;  4YT0 A;  4UP3 A;  2WDV A;  2YVJ A;  3AED A;  4AT0 A;  3GD4 A;  4YTM A;  1PBD A;  4ADW A;  4TM1 A;  4H2Q A;  2X8G A;  2C67 A;  2V5Z A;  5CQF A;  3NNE A;  1YQ4 A;  2GR0 A;  1GND A;  2E5V A;  3K7T A;  1IUW A;  1CJ4 A;  3NLC A;  3GDN A;  3BNM A;  4JNA A;  4HB9 A;  5CKU A;  1DJQ A;  1GRB A;  5KVH A;  1O94 A;  3BI2 A;  3VRB A;  1H7X A;  3BHK A;  2RGH A;  4GAP A;  3SGL A;  3ALL A;  5GSN A;  2BCP A;  4ZN0 A;  3CNP A;  1EL9 A;  4EQW A;  3RHA A;  1PBB A;  1NHP A;  2A8X A;  5TR3 A;  4Z2R A;  3K7M X;  4H4Y A;  1KN0 A;  4I58 A;  4U8O A;  1IUX A;  1X31 B;  5EB5 A;  4I59 A;  4B68 A;  4K8D A;  4OCG A;  1CC6 A;  3UKQ A;  2JAE A;  4NNJ A;  3DK4 A;  2YG5 A;  2GQW A;  1LTX R;  2YR5 A;  3P9U A;  4II3 A;  3NN0 X;  3SM8 A;  2ZZ0 A;  3CND A;  1RP0 A;  4UDR A;  3SFE A;  1IUU A;  2GR3 A;  2C75 A;  4Z2U A;  1VDC A;  1XDI A;  1H82 A;  3LB8 A;  2Z5Y A;  2ZBW A;  1K4Q A;  4BK2 A;  5EBK A;  2BRA A;  1TDK A;  1YY5 A;  4NZH A;  4ZCD A;  2BC1 A;  1GAL A;  5IPY A;  5KVI A;  4YSX A;  2WQY A;  4J57 A;  1ZDL A;  4U8K A;  3P4P A;  2RAB A;  2JBV A;  1D4C A;  4K7Z A;  2YAU A;  3F8R A;  1XHC A;  4H4W A;  2WDR A;  3FG2 P;  4NEW A;  2IVE A;  4Z26 A;  2VVM A;  3URH A;  1GRT A;  2YQU A;  3RED A;  5KMP A;  4C5O A;  1NPX A;  1NHR A;  2A89 A;  3BI4 A;  5BVA A;  4YXD A;  3OC4 A;  1S3B A;  4NWZ A;  5J7X A;  3RP7 A;  4A7A A;  1DOE A;  3UKK A;  3GRT A;  3K30 A;  2YWL A;  2XFN A;  2WDQ A;  5JCM A;  3DJJ A;  2WOW A;  3AE7 A;  3S5W A;  4BJY A;  3GMB A;  1E1K A;  1IUV A;  2FJB A;  2WPE A;  3PS9 A;  1PDH A;  1Y56 B;  2V3B A;  2TPR A;  2WEU A;  1KSS A;  1H2I A;  1VG9 A;  5KOX A;  3AE6 A;  1FEC A;  2WU2 A;  4Z2T A;  1KNP A;  2IID A;  1NEK A;  1E1N A;  3CPJ G;  1L9C A;  4G73 A;  1KSU A;  2EQ9 A;  3UKL A;  1ZY8 A;  2YM2 A;  4IV9 A;  2CFY A;  3DA1 A;  1Y56 A;  3GYJ A;  4Y4M A;  2C66 A;  3AYJ A;  4H4S A;  1H83 A;  1UKV G;  3QFB A;  4USR A;  4J2W A;  3UKA A;  1KFY A;  2C72 A;  2YR4 A;  3DME A;  1D7L A;  2XFO A;  3VRA A;  1OJT A;  2GAH B;  3T2Z A;  1S2Y A;  5DBJ A;  2BS2 A;  2VRL A;  1F6M A;  4JY3 A;  3V3O A;  4U8I A;  5JCI A;  4EQS A;  3ITJ A;  2E1M A;  3UCL A;  1NHQ A;  1COY A;  1P2H A;  3AD9 B;  3QSE A;  3B3R A;  3RNM A;  2CUL A;  4J34 A;  3NYF A;  1GRE A;  4NTD A;  1MO9 A;  2NPX A;  1OJA A;  4A79 A;  3LXD A;  3SX6 A;  1E6E A;  4CCR A;  1NHS A;  2GV8 A;  3QSM A;  3UP5 A;  3AYL A;  2WP6 A;  3UOZ A;  3GWF A;  3NRN A;  4OVI A;  3T2Y A;  5L46 A;  2C65 A;  2GRT A;  4N9X A;  2GR1 A;  1REO A;  2XVF A;  3CIR A;  2JB1 A;  3NTA A;  3WE0 A;  1BKW A;  2XVH A;  3I6D A;  1GTE A;  3ADA B;  2GAG B;  2ZZC A;  3L8K A;  1PJ5 A;  2DKI A;  4OPG A;  5C2T A;  3SZ0 A;  1N4W A;  1GES A;  2C3D A;  2BK4 A;  4CCQ A;  4CRT A;  1EBD A;  2JKC A;  3NKS A;  4U8J A;  3AEA A;  4GAV A;  1GPE A;  1D7Y A;  2R46 A;  4JN9 A;  2XFP A;  1LQT A;  2QA1 A;  3BI5 A;  5BRT A;  5HYM A;  1BZL A;  3LZW A;  3KKJ A;  3NK1 X;  3IHG A;  1JRY A;  3LJP A;  2C70 A;  3G5Q A;  4IA6 A;  1FCD A;  1RSG A;  1W4X A;  2WOI A;  4G9K A;  2FJD A;  3GSI A;  3DJD A;  1B8S A;  1EL5 A;  3AE1 A;  1FOH A;  4H4Z A;  1MXT A;  4A5L A;  1GV4 A;  1F8R A;  1JNR A;  3IC9 A;  1CC2 A;  4C77 A;  2F5Z A;  4LII A;  2V6O A;  1DOB A;  1K0L A;  3CGC A;  2R0C A;  3COX A;  4G6H A;  2BCG G;  4UDP A;  2WPC A;  5FS8 A;  4H4Q A;  4AOX A;  5BUL A;  1GRF A;  2XFQ A;  3ALM A;  3NTD A;  3H8I A;  3ALJ A;  1GOS A;  4AOS A;  1L9E A;  3DK9 A;  2H89 A;  3M13 A;  4EMJ A;  1O95 A;  3OZ2 A;  3P4S A;  3VQR A;  2XLU A;  4G74 A;  1N4U A;  4K2X A;  4CY8 A;  3B6D A;  1JRZ A;  1OJD A;  2YG3 A;  2GMH A;  4EIQ A;  1E7P A;  4Z43 A;  4H4P A;  4JQ9 A;  1PJ7 A;  3D1C A;  3L1R A;  4EMW A;  4AT2 A;  4GR1 A;  3SFD A;  2C73 A;  5LV9 A;  4FK1 C;  3T31 A;  2B9W A;  1O5W A;  4X9M A;  3UKH A;  3NT6 A;  5EOW A;  5IQ4 A;  4O5U A;  4TM4 A;  2V60 A;  1KNR A;  4H4X A;  4J33 A;  3NYE A;  3GDP A;  2E4G A;  3VR8 A;  1S2Q A;  3HYV A;  2EQ7 A;  4RSL A;  1CHU A;  4FX9 A;  4FK1 A;  4HA6 A;  1IUT A;  1JRX A;  2XLP A;  2V3A A;  4A99 A;  1PXB A;  3LOV A;  4WX1 A;  2QAE A;  2OA1 A;  3ICS A;  1OJ9 A;  2ARD A;  4IA5 A;  4Y4L A;  1DOC A;  1TDE A;  2WP9 A;  3V3N A;  3HYW A;  3L5O A;  2YG7 A;  3FIM B;  2GMJ A;  2W0H A;  4GCM A;  2Y6Q A;  1PBF A;  4CY6 A;  2XDO A;  3BNU A;  5C3J A;  3CNS A;  3KPF A;  3M12 A;  3S61 A;  1JEH A;  2GF3 A;  2R4E A;  2WES A;  4CNK A;  1N4V A;  2FBW A;  3C4A A;  3AE3 A;  4A65 A;  4A6N A;  3DK8 A;  4NTE A;  3ZYX A;  5KNL A;  4JDR A;  4H2P A;  4YSH A;  2BRY A;  5U25 A;  1Q1W A;  2PYX A;  1XAN A;  4U2L A;  1F3P A;  5HY5 A;  4BUR A;  2BK5 A;  3DGZ A;  3JSK A;  3P4Q A;  2YVF A;  2Z5X A;  5FS6 A;  2QCU A;  3SZW A;  3ICR A;  1EL7 A;  3F8D A;  2BK3 A;  2X50 A;  4Z25 A;  1D5T A;  1V59 A;  1DNC A;  2TMD A;  1PJ6 A;  2BA9 A;  4J31 A;  1ZKQ A;  2YLT A;  2Q7V A;  3EPT A;  4MJW A;  3T37 A;  4Y4N A;  3FPZ A;  1P2E A;  3KA7 A;  3UTG A;  5JCN A;  4DSG A;  2C4C A;  3CPI G;  5JCL A;  2VVL G;  3G5R A;  3CN8 A;  4RG3 A;  4KX6 A;  1S7M A;  1LQU A;  2Q0K A;  2X99 A;  2WPF A;  2WP5 A;  1GET A;  3AE4 A;  2VZ2 A;  1KF6 A;  2WOV A;  4U8L A;  3E1T A;  1ZMC A;  2GB0 A;  2B7S A;  1CBO A;  3F8P A;  4H2R A;  2BS4 A;  3GD3 A;  3I3L A;  3K7Q X;  4B67 A;  4USQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...