1NHPA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 137
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhpA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA02
1PJ7A 2PYXA 4IVMB 3FMWA 3VRBA 3QSMA 4AT2A 2V5ZA 4LIIA 4LA1A 1CJ3A 2WESA 3IWAA 5EOWA 2ARDA 3RP7A 2BC1A 3SQPA 3KVEA 1H81A 3LOVA 4H4ZA 3IHMA 1X31B 5ER0A 1QLBA 4U2LA 3F8PA 2X8GA 1PBDA 4CY8A 1M64A 3KD9A 1TYTA 2TPRA 2UZZA 4EMIA 2QA2A 3AE1A 1D4DA 2WS3A 3UP4A 4CY6A 1LPFA 3GRTA 1NAAA 4DGKA 1D4EA 3AECA 2BC0A 4U8NA 1L9EA 2YG6A 4GF7A 1JEHA 1GRFA 1Q1RA 3CNPA 4IVOB 2A8XA 4TM1A 4C77A 3G5RA 4JY2A 3AE5A 2X8CA 4YKFA 3KLJA 1KSSA 4P9SA 1EL9A 4OVIA 1ZP0A 2GMJA 2VOUA 5U25A 3AEBA 2H88A 3UKAA 1O95A 1GTHA 4D04A 1V59A 4JNAA 4K8DA 4ECHA 1DOBA 2BS4A 2GEWA 1NG3A 3BI2A 3AE6A 4EM3A 2GR0A 4FK1A 3AYLA 1F8WA 1FL2A 5IQ4A 5KRQA 1CC2A 4Z2UA 1XANA 3P9UA 4HB9A 3HZLA 2BK3A 2VRMA 1BWCA 3AE4A 3AD7B 1NHRA 4B68A 5J60A 4EQSA 4B1BA 1CJ4A 3DGZA 1K0JA 3FBSA 4B66A 2BCGG 1NHQA 1NHPA 2XCGA 4O5UA 4FX9A 4BV6A 3LB8A 1JRYA 3AXBA 5HY5A 4OCGA 3M0OA 2AAQA 2C67A 3NLCA 1E6EA 4B63A 2WEUA 4N9XA 2CVJA 1ZKQA 1S2QA 1EL5A 2XVIA 2GAHB 3C96A 3L1RA 4ICYA 5EBKA 2XFQA 4K22A 4Z25A 1GT8A 2YM1A 2Q0LA 5JCMA 2C73A 1NEKA 1VDCA 3AB1A 2W0HA 3GDNA 1ZOYA 2GAGB 4JNQA 3UP5A 4H4VA 2FJAA 1TYPA 3RNMA 4GR1A 1IUUA 1OJCA 3UOVA 1O5WA 2Q6UA 2WP9A 2BACA 1JRZA 2OLOA 2NVKX 1PDHA 4I59A 1JU2A 1CBOA 2RABA 4XWRA 4CCQA 2XVJA 2Y6QA 3BHFA 4AOSA 4CCRA 3L8KA 2WU5A 3ICSA 2BYBA 3NG7X 4ZCDA 1K0LA 3RP8A 2VQBA 2JB2A 2XVFA 3AWIA 4YTPA 5HYMA 1IUSA 5DBJA 2BS3A 4NZHA 4OPDA 2HQMA 2WP5A 5C3JA 4Z2TA 4H4XA 4TM0A 4EQRA 4DNAA 1BKWA 1BGNA 1GSNA 4AP3A 2YLRA 4JDRA 3DH9A 3BNMA 1DOEA 4K5RA 4YSHA 3SFDA 4CBQA 4USRA 2Z5YA 1H84A 2GR1A 3BHKA 3GD3A 3QFAA 2FBWA 1FOHA 1ZX9A 3VR8A 2X99A 2WPFA 2YLTA 2X50A 3AEDA 5FS9A 2WP6A 1JOAA 1CL0A 4A65A 1GREA 4EIQA 4GRTA 1OJ9A 1PBBA 2GQFA 3ATQA 1FEAA 2VRLA 3AD8B 3ALLA 3EPTA 3QSSA 4U8KA 3K30A 1IUWA 2YG7A 3ITJA 2V6OA 2FJDA 1FECA 1H6VA 3LZXA 3CNDA 3H4KA 5FMHA 3M12A 1GRTA 1M6IA 2C72A 2WDVA 1KF6A 1S2YA 2JAEA 3BI4A 4OPIA 2QA1A 4U8PA 5IQ1A 2YR5A 4J2WA 2RGJA 3CPHG 1TRBA 3GMBA 5BRTA 2VVLA 2QCUA 5KWFA 1BGJA 4CRTA 1KNRA 1D7LA 1MO9A 2EQ6A 2R4EA 2C3DA 4U8LA 4USQA 3V3NA 3FG2P 1PN0A 4LU6A 4REKA 3UKFA 1PBFA 2WETA 3B3RA 2R4JA 2YVGA 4A9WA 3CGEA 3IC9A 4U2TA 3Q6JA 3EAOA 4JQ9A 1KNPA 2OA1A 2YG5A 4K2XA 2VZ2A 4J34A 3D8XA 2B7RA 1L0VA 3P4QA 1GEUA 3CNSA 3KPFA 5BUKA 5J7XA 1E1NA 2WU2A 3SGLA 2B9YA 3GYIA 3P4RA 3AE9A 1F6MA 1CF3A 3G5QA 4K5SA 2IVDA 2GQWA 3AE3A 3ICRA 4OPLA 2ZBWA 3CTYA 2X8HA 1IUTA 4J56A 1E7PA 1LQUA 3F8RA 1BZLA 2V61A 3QJ4A 4A7AA 5KXJA 2B9XA 2FJBA 5U63A 3RHAA 3SM8A 2WDRA 4AP1A 2ZZBA 3DGHA 3DMEA 3GWDA 5GSNA 1B37A 1LQTA 2XLUA 3I6DA 4EIPA 4H4QA 2JBVA 3UTEA 3UOXA 4GDEA 4H50A 2C70A 2V3AA 1ZY8A 2XDOA 4A99A 3NK2X 4ZCCA 3CN8A 2YR4A 1B5QA 2WDQA 1YQ4A 2AQJA 3DJDA 1NHSA 1EL8A 3NKSA 3CGCA 2E4GA 1NENA 1IUVA 1PXAA 2WOIA 4XWZA 2DKHA 5EB5A 1ZK7A 4XXGA 5FS6A 4YWOA 4NTCA 4WCTA 3NTAA 3QVPA 4FDCB 1O94A 2Y6RA 5FS8A 4RG4A 5EB4A 3BNUA 3IHGA 2BCPA 2C7GA 2BK4A 3K7MX 4U8JA 2C75A 3DA1A 4BK1A 1JNRA 2YLZA 1IJHA 1N4UA 2C76A 3H8LA 2R9ZA 2EQ9A 3FIMB 1IUXA 4KX6A 3NRNA 1ONFA 3AYIA 3UTHA 1E39A 1ZMCA 4TM3A 4H2PA 4E0VA 3F8DA 3II4A 2YLSA 2B76A 4A6NA 2ZZCA 5TR3A 3ICTA 4UDRA 1QJDA 5GRTA 1E1KA 1F8RA 3NYEA 4Z26A 3GWFA 3IF9A 2XLRA 2YQUA 2GMHA 1PBCA 3C4NA 4APNA 1CC6A 2XYOA 2VQ7A 1N1PA 4Z43A 1XDIA 2APGA 1PXBA 1H86A 4B69A 3NHOX 4H2RA 1K0IA 4OPCA 4C3YA 3CGDA 2XLPA 3KA7A 4Z24A 1VRQB 3NGCX 3UTFA 3COXA 3ABVA 1CJCA 3VR9A 2JK6A 3AE7A 3NN6X 1SEZA 4UDQA 1LVLA 1S3EA 1YKJA 2WQYA 1GTEA 3ZYXA 1TDKA 2R0PA 3E1TA 2B9WA 4H2NA 4YXDA 3S61A 4D03A 1PS9A 1GALA 1GETA 3AEGA 3C4AA 1OJDA 3NT6A 2IIDA 4NTEA 1E1LA 4A5LA 3AE2A 3CPJG 2CULA 5BULA 5KOWA 1GRAA 4TLXA 4BK2A 1K4QA 1MXTA 3NNEA 1ZDLA 4IA6A 2R46A 1PHHA 3EF6A 2XLSA 2WOWA 2WPCA 1Y56B 4GDPA 4Y4LA 3NYCA 2ZZ0A 4H4YA 2NPXA 1H7XA 3CGBA 2XFNA 4EQWA 3NK0X 1FCDA 4OPTA 2XFPA 3CPIG 1GERA 2OLNA 5FS7A 3GMCA 3PS9A 4J31A 2YVJA 1RSGA 1Z6LA 2Q0KA 1B4VA 1JNZA 3VRAA 2R0GA 4YT0A 1JRXA 4CNJA 1GXFA 3OZ2A 2YG3A 2EQ8A 1VG0A 3K7QX 2E5VA 3FPZA 1LJ1A 4B64A 4ZN0A 4O5QA 3UKHA 1H83A 1L9CA 3UOYA 3AYJA 1VQWA 2YVFA 1EBDA 2BABA 3RP6A 4GCMA 4J57A 3AE8A 4NEWA 3NN0X 4K7ZA 1UKVG 1MOKA 4IV9A 5JCIA 1DODA 2WPEA 1ZMDA 3NH3X 1CJ2A 3NYFA 4YKGA 2QAEA 2YR6A 3OC4A 1OJAA 5CQFA 3T37A 4AT0A 2ACZA 5JCLA 2Z5XA 3UKKA 1XPQA 3I3LA 3LZWA 1BF3A 4UDPA 4J36A 2GB0A 2X3NA 1YY5A 4OPUA 2BXSA 1DJNA 4X4JA 2XVEA 1P2EA 1YQZA 4TM4A 3KU9A 1Q1WA 2YAUA 2YWLA 3GRSA 4PABA 1REOA 2GR3A 4NEVA 3UKLA 5L46A 3ALMA 3PO7A 2V3BA 3O0HA 2Q7VA 5IPYA 4Z2RA 2E1MA 3KKJA 5KOXA 5U1OA 1B8SA 1GV4A 2H89A 3URHA 1GRGA 1Y0PA 3NK1X 5C2TA 3M13A 3AEEA 4EQXA 3EANA 2J3NA 4JY3A 4BK3A 2C3CA 4BJZA 2GRTA 4H4PA 1CHUA 4YSZA 4BJYA 3GYJA 1TDOA 3LJPA 2GVCA 1GRBA 1D4CA 3UKPA 1ZOVA 4YTMA 4RG3A 2XVHA 1COYA 4U8IA 3SFEA 3WE0A 1TDEA 4X9MA 3VRDB 4A79A 2WBAA 3GSIA 5HXIA 2GF3A 3ISHA 3K7TA 3VQRA 1PJ6A 2B7SA 3V76A 4H4UA 1PBEA 2O9ZA 3CIRA 2GH5A 4U8MA 1NG4A 1QO8A 2YLXA 3AD9B 5JCNA 3NIXA 3P4SA 2I0ZA 5CKUA 3CNJA 1GRHA 4GUVA 2JB1A 1N4VA 2IVEA 3QSEA 4IA5A 3UOZA 4YTNA 4EMJA 4A6NB 1KDGA 2A89A 4KPRA 2EQ7A 4YSYA 1GOSA 1DJQA 1HYUA 2XFOA 1E1MA 1EL7A 2YLWA 3NTDA 5LV9A 2OAMA 4YSXA 2WHDA 4C74A 2A87A 4DSHA 3D1CA 3DJJA 5HHFA 2CDUA 1DNCA 2FJEA 4H4WA 1GPEA 3AEFA 2CFYA 4H7UA 3LXDA 2RGHA 1ELIA 2C66A 1YQ3A 4C3XA 1P2HA 4RSLA 4DSGA 1Q9IA 4X9NA 2RGOA 3UTGA 1F3PA 2DKIA 3H8IA 4EM4A 2JKCA 3ZDNA 2BS2A 3ATRA 2YM2A 3P1WA 1TDNA 5KVIA 3LADA 3AEAA 1NDAA 2C64A 4PAAA 1TDFA 1OJTA 5M0ZA 5JCKA 5KVHA 4H4RA 1Y56A 2BXRA 3DK9A 4MJWA 4ADWA 2BA9A 1FEBA 1D7YA 1H7WA 1KSUA 3ALJA 4AOXA 2VVLG 3G5SA 3REDA 2BK5A 1PXCA 2PHHA 4WX1A 1DXLA 4HA6A 2XLTA 3B6DA 3QFBA 4B65A 2AR8A 2TMDA 1KFYA 4H2QA 1W4XA 1CC4A 2R0CA 4OPGA 3R9UA 3DJGX 4J33A 4JN9A 4C5OA 1F8SA 1D5TA 5M10A 4Z44A 4BURA 3DJEA 1LV0A 2JB3A 4TLZA 5BVAA 3DK8A 2XFUA 4U8OA 2GR2A 2GV8A 1RYIA 1LTXR 3GDPA 4U2SA 4NTDA 3GD4A 3ADAB 2YG4A 4H4SA 1XHCA 1DOCA 2OALA 3S5WA 3DK4A 1L9DA 3V3OA 3Q9TA 3BI5A 2V60A 3CNTA 3JSKA 4EMWA 1AOGA 3P4PA 4M52A 4CNKA 1H82A 1PJ5A 2WOVA 1VG9A 2R45A 4FK1C 1S3BA 3UCLA 2C65A 1RP0A 1N4WA 4B67A 4Y4MA 3QVRA 2VVMA 2F5ZA 3UKQA 4I58A 1NPXA 4UP3A 4Y4NA 3PVCA 1GNDA 1GESA 4H4TA
chains in the Genus database with same CATH superfamily
4H83A 4A6GA 4HCHA 3NO1A 1PJ7A 2OG9A 3VRBA 3QSMA 4AT2A 1MDLA 2V5ZA 3HYWA 5BOFA 2BC1A 3QPEA 3ES8A 3F8PA 4CY8A 1H2IA 2UZZA 4EMIA 2QA2A 2E5AA 1D4DA 2WS3A 3UP4A 4CY6A 3NVWB 4DGKA 1D4EA 2BC0A 3MZNA 3I4KA 2YG6A 4C77A 2PCEA 3HPFA 3JVAA 5G5HB 3AEBA 1O95A 1GTHA 3BI2A 1XANA 3AD7B 4B68A 2AKMA 4EQSA 3CYJA 1CJ4A 1K0JA 3FBSA 3JW7A 1NHPA 4FX9A 1JRYA 3VC6A 2RDXA 1ECQA 4N9XA 2CVJA 1S2QA 3FJ4A 4ICYA 2XFQA 4G9KA 5JCMA 1VDCA 2W0HA 1ZOYA 3NRZB 1TYPA 1O5WA 4I59A 1PDHA 2XVJA 2Y6QA 4AOSA 4CCRA 4MKSA 2WU5A 4GIRA 3RP8A 2XVFA 3AWIA 5HYMA 2OZ8A 3VCCA 4OPDA 2HQMA 4F4RA 1GSNA 4AP3A 3PWIA 2OLAA 3BHKA 3GD3A 3QFAA 1WUFA 2WPFA 3AEDA 4JN8A 1JOAA 1OJ9A 3ATQA 4K1WA 3QSSA 3UJFA 1H6VA 3SXIA 3OPSA 3CNDA 3H4KA 5FMHA 3M12A 3VCNA 3B9JB 1GRTA 2WDVA 3BI4A 3CK5A 3ZLFA 3CPHG 3SSZA 3V3NA 3B3RA 4A9WA 3CGEA 3TQPA 3Q6JA 2VZ2A 3SQSA 1N61C 3TWBA 5BUKA 3SGLA 3HYXA 2PP3A 1NELA 1CF3A 2ZADA 2PU1A 2IVDA 3AE3A 3HW2A 4J56A 1LQUA 6ENLA 1BZLA 2FJBA 3SN4A 1YEYA 3RHAA 1TKKA 5GSNA 2XLUA 3I6DA 2JBVA 2V3AA 2XDOA 1ELSA 3UCCA 2YR4A 3DG7A 2WDQA 1YQ4A 2P8BA 1N5XA 2WOIA 4HCDA 2PTXA 3ENLA 1ZK7A 5FS6A 4ENLA 4NTCA 4WCTA 3I6TA 4FDCB 2Y6RA 3MWCA 3QN3A 1TE6A 3K7MX 2C75A 3DA1A 4BK1A 1IJHA 2R9ZA 3FIMB 3NRNA 3R10A 1E39A 4E0VA 3F8DA 3II4A 2YLSA 3ICTA 4UDRA 1E1KA 3AN1A 2VQ7A 4Z43A 3DG3A 1XDIA 3D46A 1PXBA 1H86A 4OPCA 3A7AA 3KA7A 4ZOHB 3UTFA 3AE7A 3NS1B 1SEZA 1TDKA 1L8PA 4IZGA 4YXDA 1PS9A 3L5OA 1GALA 1GETA 3AEGA 3NT6A 4NTEA 2IIDA 2CULA 1GRAA 4TLXA 2I5QA 3N6JA 1MXTA 4KEMA 4IA6A 3EF6A 2XLSA 2ZZ0A 1KCZA 4IP5A 3NK0X 4EQWA 1FCDA 2XFPA 1MDRA 2R0GA 4HYRA 1JRXA 4CNJA 3OZ2A 4KWSA 3FPZA 3TOYA 1LJ1A 4KT2A 3UOYA 2QJMA 5KMRA 4IV9A 3SBFA 5JCIA 3THUA 1ZMDA 2ACZA 3UKKA 1XPQA 3LZWA 1BF3A 4II2A 3K1GA 4YWSA 3RCYA 2XVEA 3SN1A 4PABA 2YWLA 3A7RA 3GRSA 1REOA 2GR3A 5BOEA 4NEVA 3UKLA 3PO7A 3GD6A 3O0HA 2Q7VA 3TJ4A 2H89A 1STZA 2GGGA 3NVZB 2J3NA 4JY3A 4A3RA 1CHUA 4YSZA 4BJYA 4ROPA 3R0KA 4X2PA 1JPMA 2XVHA 3SFEA 3ISHA 3DDMA 1PJ6A 2B7SA 2ZC8A 3CIRA 1NG4A 1QO8A 5JCNA 2I0ZA 4IHCA 3ES7A 3CNJA 2JB1A 3QSEA 4EMJA 4A6NB 2A89A 4KPRA 1GOSA 1DJQA 1HYUA 5LV9A 4J3ZA 5HHFA 4H7UA 1MNSA 2OZTA 1Q9IA 2DKIA 4EM4A 2BS2A 2YM2A 3LADA 3NZGA 5JCKA 2GL5A 3T14A 4AOXA 3G5SA 2BK5A 4WX1A 3T31A 4B65A 2AR8A 3P93A 1D5TA 3RITA 3RGTA 2JB3A 4TLZA 2XFUA 4U8OA 2GR2A 3GDPA 4GYPC 2QGYA 2QDEA 3V3OA 3Q9TA 4EMWA 4CNKA 2FKPA 1VG9A 2R45A 3U9IA 3UCLA 2C65A 4G74A 2PGWA 1JCTA 2P3ZA 3NN6X 4H4RA 3DFHA 2PYXA 4IVMB 3UCDA 4LIIA 5EOWA 3RP7A 2ARDA 1ZXIC 3SQPA 3N4EA 3KVEA 3LOVA 3IHMA 1PBDA 2TPRA 2AKZA 4GGHA 4GGBA 3AECA 2GGHA 3DG6A 4U8NA 1L9EA 2P88A 1GRFA 1FO4A 4TM1A 2W55A 3AE5A 1KSSA 1EL9A 2VOUA 3Q4DA 4D04A 4G7FA 1JROA 3D9XA 2BS4A 2NQLA 1NG3A 4DWDA 4G6HA 1FL2A 5KRQA 3R25A 1CC2A 4IL2A 3P9UA 4HB9A 2VRMA 1BWCA 5J60A 3DGZA 4H19A 4OCGA 2AAQA 1E6EA 4B63A 2WEUA 4K22A 1EL5A 3ZVIA 2XVIA 3L1RA 5EBKA 1GT8A 2YM1A 3AB1A 3GDNA 2GAGB 4H4VA 3RNMA 4GR1A 1IUUA 4DYEA 2WP9A 1JRZA 2OLOA 2NVKX 1CBOA 4XWRA 3PK7A 3BHFA 2BYBA 3B97A 4YTPA 2BS3A 4NZHA 2WP5A 5C3JA 4JDRA 4K5RA 1KKOA 3SFDA 3VA8A 5KMSA 1FOHA 2X99A 2YLTA 1CL0A 4J1OA 3ALLA 4U8KA 3EPTA 1IUWA 3ITJA 3CXOA 2FJDA 3LZXA 3VC5A 2C72A 1KF6A 1TRBA 2VVLA 1N60C 1BGJA 4CRTA 1MO9A 2EQ6A 2R4EA 5JRBA 1PN0A 1PBFA 2YVGA 5ENLA 1EBGA 4U2TA 2OO6A 7ENLA 2YG5A 4K2XA 2B7RA 1GEUA 3KPFA 5J7XA 1E1NA 3GYIA 3AE9A 4K5SA 3PG6A 3F8RA 2HXUA 3SM8A 3DMEA 4H4QA 3UTEA 4GDEA 4H50A 2C70A 4MMWA 3CN8A 1B5QA 3DJDA 1NHSA 3NKSA 2CHRA 3Q45A 1NENA 4HNLA 3DERA 1O94A 5EB4A 2QQ6A 1E9IA 3BNUA 4E4UA 1FFVC 1N5WC 2YLZA 2POZA 2C76A 2OKTA 1SJCA 1IUXA 1ONFA 4TM3A 2B76A 5TR3A 3IF9A 2GSHA 2YQUA 2GMHA 1XS2A 4E6MA 3MUCA 3NHOX 1IYXA 2XLPA 1VRQB 3NGCX 1CJCA 2JK6A 1YKJA 3IK4A 2P0IA 2R0PA 3T4WA 3E1TA 4H2NA 3EUB3 3S61A 4D03A 1FHVA 4A5LA 3T8QA 1ZDLA 3U4FA 3T0KA 5FJOA 1Y56B 4Y4LA 3CGBA 3CPIG 1GERA 3GMCA 3PS9A 4J31A 1Z6LA 3VRAA 1KN0A 1MRAA 2YG3A 2EQ8A 3FCPA 3UGVA 4TVWA 4ZN0A 5FJPA 1EBDA 3CB3A 4NEWA 3NN0X 1WUEA 1DODA 5KMPA 2WPEA 4YKGA 4Z17A 5JCLA 3SZFA 4M0XA 4FI4A 3CT2A 4UDPA 4OPUA 2MNRA 1YQZA 3KU9A 3CXBA 1T3QC 4Z2RA 2E1MA 4IP4A 5U1OA 3OZYA 3A7UA 1GRGA 1SJBA 4EQXA 3ZVHB 2C3CA 2GRTA 3UJEA 3GYJA 3KPKA 1D4CA 1VQZA 2XH2A 2XSXA 4X9MA 3VRDB 2WBAA 3SR6B 4H4UA 2O9ZA 5CKUA 4Z1YA 1GRHA 4GUVA 4IA5A 3TWAA 2XFOA 3IJIA 2YLWA 4C74A 2A87A 3AEFA 1DNCA 2CDUA 4H4WA 1ELIA 2C66A 4C3XA 4X9NA 3UTGA 3BSMA 3ATRA 1NDAA 1OJTA 5KVHA 3SN0A 1Y56A 2BA9A 1D7YA 3ALJA 1KSUA 1PXCA 2PHHA 4HA6A 3QFBA 2TMDA 4OPGA 3V3WA 2R0CA 1CC4A 3R9UA 3QTPA 2PTYA 4Z44A 3DJEA 5BVAA 2GV8A 1RYIA 4U2SA 4NTDA 3GD4A 3V5FA 3ADAB 4H4SA 1XHCA 1DOCA 5FJTA 3H12A 2V60A 4GFIA 3JSKA 2PU0A 1H82A 4G73A 2QJNA 1RP0A 3QVRA 4K2SA 2VVMA 2F5ZA 3UKQA 1NPXA 4UP3A 4H2HA 1GESA 3REDA 4H4TA 3FMWA 3UJ2A 2WESA 1H81A 1X31B 4U2LA 1QLBA 1M64A 1LPFA 3GRTA 3MY9A 1Q1RA 1DTNA 4IVOB 2A8XA 1PDZA 4YKFA 3KLJA 4P9SA 4OVIA 1ZP0A 2GMJA 2H88A 3UKAA 3P0WA 3ZVHA 4JNAA 4K8DA 2GEWA 3AE6A 4FK1A 3T2YA 5IQ4A 4Z2UA 2BK3A 1NHRA 4JN7A 2BCGG 2XCGA 4BV6A 3AXBA 5HY5A 1OEPA 2OPJA 4ZCWA 3M0OA 2C67A 3NLCA 2Q0LA 1NEKA 4IL0A 1OJCA 2Q6UA 2RABA 5J04A 3IJLA 3L8KA 3ICSA 3TW9A 4HCLA 4GAPA 1K0LA 3GO2A 2JB2A 1TZZA 4Z2TA 4H4XA 4TM0A 4DNAA 3TCSA 1BGNA 2FYMA 2YLRA 3DH9A 3BNMA 4YSHA 3MQTA 4HPNA 1ZX9A 2X50A 5FS9A 2WP6A 1GREA 3GC2A 1FEAA 3AD8B 3K30A 2YG7A 1N63C 5FJRA 1S2YA 2JAEA 5BRTA 2RGJA 3GMBA 4GISA 4USQA 3FG2P 4LU6A 2OFJA 2WETA 2PSNA 3IC9A 1KNPA 2OA1A 1W6TA 4J34A 3D8XA 1L0VA 3CNSA 3R1ZA 2B9YA 2GQWA 3ICRA 3CTYA 1IUTA 4A7AA 5KXJA 5KNLA 5U63A 1P48A 2DW7A 4HN8A 1F9CA 4EIPA 4A99A 4ZCCA 2AQJA 3SZCA 2PGEA 4HNCA 4XWZA 2PODA 4XXGA 4YWOA 3NTAA 2BCPA 2C7GA 3T6CA 1N4UA 2EQ9A 4KX6A 3UJRA 5G5GB 3AYIA 3UTHA 1ZMCA 4A6NA 3NYEA 3GWFA 2XLRA 3C4NA 4APNA 2XYOA 1N1PA 4H2RA 4C3YA 3CGDA 3VR9A 3ABVA 3V5CA 1LVLA 1JDFA 2WQYA 1GTEA 1JRPA 3C4AA 1OJDA 1E1LA 3AE2A 5KOWA 5BULA 1K4QA 3NNEA 2R46A 4DN1A 4GDPA 3NYCA 4H4YA 2XFNA 3DESA 4OPTA 3HYVA 3H70A 1RSGA 3H8AA 2Q0KA 3NVVB 1B4VA 4YT0A 1GXFA 2E5VA 3NXLA 4O5QA 2OQYA 1H83A 1L9CA 3AYJA 1FHUA 3VFCA 1VQWA 3RP6A 4GCMA 3AE8A 4K7ZA 3CMMA 3SX6A 2PP0A 1CJ2A 3NYFA 3GYXA 2QAEA 2YR6A 1OJAA 5KMQA 3T37A 2Z5XA 2X3NA 4IT1A 2BXSA 3R07C 4E5TA 4KPLA 1P2EA 1Q1WA 2YAUA 3FV9A 4K8GA 3ALMA 3ETRB 5IPYA 3KKJA 5KOXA 1X2HA 3URHA 3AEEA 3EANA 3DEQA 4E8GA 4BJZA 4E4FA 1X2GA 1TDOA 2GVCA 1GRBA 3BOXA 4RG3A 1PDYA 1COYA 4U8IA 1SB3B 1TDEA 4A79A 3GSIA 3JZUA 5HXIA 3D47A 3VQRA 4G8TA 2GH5A 3AD9B 3NIXA 2IVEA 2GGIA 2GGJA 1KDGA 2XH4A 4YSYA 4TVYA 3T2ZA 1EL7A 3S5SA 3PFRA 2OAMA 4YSXA 2WHDA 4DSHA 2AL2B 1GPEA 2FJEA 2BRAA 3LXDA 2RGHA 3AMZA 4RSLA 1SJDA 2OZ3A 1F3PA 3SZ0A 3H8IA 2JKCA 1BKHA 3TTEA 1TDNA 3AEAA 3DFYA 2C64A 1TDFA 2PPGA 2BXRA 2O56A 3DK9A 4MJWA 4NWZA 1DXLA 3B6DA 4H2QA 1W4XA 3DJGX 5M10A 1F8SA 2PMQA 3S5WA 1L9DA 2QDDA 3P4PA 4M52A 4NNJA 1S3BA 4Y4MA 2BRYA 4I58A 4Y4NA 1GNDA 3SJNA 3NFUA 1EC8A 1VDVA 3RR1A 1CJ3A 4LA1A 3IWAA 3STPA 2XH7A 4H4ZA 3UXKA 4GMEA 2PTWA 5ER0A 2X8GA 2W3SA 3KD9A 1TYTA 1V97A 3AE1A 1NAAA 4M6UA 1NU5A 1EC9A 3R11A 4GF7A 1KD0A 3RRAA 1JEHA 2QJJA 3CNPA 1RVKA 4GYPA 3G5RA 4JY2A 2X8CA 4EWJA 5U25A 3OTRA 1V59A 4ECHA 1DOBA 5FJUA 4EM3A 2GR0A 3AYLA 1F8WA 3IJQA 1SJAA 3HZLA 1P43A 3AE4A 4B1BA 4B66A 1NHQA 4O5UA 2QVHA 3LB8A 1ZKQA 2GAHB 3C96A 3OZMA 4Z25A 1S7MA 2C73A 3UP5A 4JNQA 5IDZA 2DW6A 2FJAA 2HXTA 3UOVA 2BACA 2AL2A 1JU2A 1RM6B 4CCQA 3H7VA 3S47A 3DGBA 3NG7X 4ZCDA 2VQBA 3FVDA 1IUSA 5DBJA 4DX3A 3PWGA 3N4FA 3SZWA 4EQRA 3QLDA 1BKWA 1ONEA 1DOEA 4CBQA 4USRA 2Z5YA 3EKGA 1H84A 2GR1A 2FBWA 3VR8A 2W54A 3V4BA 4A65A 4EIQA 3EEZA 4GRTA 1PBBA 2GQFA 4DXKA 2VRLA 3I6EA 1MUCA 1EBHA 3ZLGA 2V6OA 1FECA 1M6IA 5IQ1A 4OPIA 2QA1A 4U8PA 2YR5A 4J2WA 1WYGA 2QCUA 5KWFA 1KNRA 1D7LA 2C3DA 4U8LA 4REKA 3UKFA 2XGZA 2R4JA 3EAOA 4JQ9A 3P4QA 2WU2A 2PP1A 3P4RA 1F6MA 3G5QA 4OPLA 4MGGA 2ZBWA 2X8HA 1E7PA 2V61A 3QJ4A 2B9XA 2PS2A 2WDRA 4AP1A 2ZZBA 3DGHA 3GWDA 4II3A 1B37A 1LQTA 3OP2A 3UOXA 1ZY8A 3NK2X 3UJSA 3SY4A 1EL8A 3CGCA 2E4GA 1IUVA 2GDQA 1PXAA 2DKHA 5EB5A 2E3TA 3T2KA 3BJSA 3QKEA 3QVPA 4RG4A 3TJIA 5FS8A 1R6WA 3IHGA 2BK4A 4U8JA 1JNRA 3H8LA 4H2PA 3SYIA 2ZZCA 1QJDA 5GRTA 1F8RA 4Z26A 3ZLHA 1PBCA 1CC6A 3VDGA 3UXLA 2APGA 4B69A 1K0IA 4JHMA 4Z24A 3COXA 4UDQA 3NVYB 1S3EA 3R0UA 3ZYXA 3DIPA 2B9WA 5L46A 3CPJG 4BK2A 1JPDX 1PHHA 2WOWA 2WPCA 3GY1A 4A35A 2NPXA 1H7XA 2OLNA 1BQGA 5FS7A 2YVJA 1JNZA 2OVLA 2XH0A 2AL1A 1VG0A 3K7QX 4B64A 4H1ZA 2PTZA 3UKHA 4GAVA 1KKRA 2YVFA 2P8CA 2BABA 4FP1A 4J57A 2OX4A 1UKVG 1MOKA 2ONEA 1FIQB 3NH3X 3FYYA 5CQFA 3OC4A 3RO6A 4AT0A 2OQHA 3I3LA 3FXGA 4J36A 2GB0A 1YY5A 1DJNA 4X4JA 4TM4A 3OW1A 2MUCA 2V3BA 1B8SA 1GV4A 3NK1X 1Y0PA 1R0MA 3MSYA 3M13A 5C2TA 4BK3A 3HRDC 1XPYA 4H4PA 3LJPA 3UKPA 1ZOVA 4YTMA 3WE0A 2GF3A 3K7TA 3V76A 1PBEA 1N62C 4U8MA 2HZGA 2YLXA 3P4SA 3MKCA 1N4VA 1FFUC 3UOZA 4YTNA 2EQ7A 1E1MA 4G6GA 3NTDA 3N6HA 3D1CA 3DJJA 2CFYA 1YQ3A 1P2HA 2C4CA 4DSGA 2RGOA 3ZDNA 3P1WA 5KVIA 4PAAA 2PA6A 5M0ZA 4ADWA 1FEBA 1H7WA 2GGEA 2VVLG 3P3BA 2XLTA 3KUMA 1KFYA 4J33A 4JN9A 4C5OA 4BURA 2W3RA 1LV0A 2HNEA 4ZA0A 5EU9A 4DHGA 3DK8A 1LTXR 1EC7A 2YG4A 2OALA 3CAWA 3DK4A 3BI5A 3CNTA 1AOGA 3AM9A 1PJ5A 2WOVA 4FK1C 1N4WA 4B67A 3T9PA 3PVCA
chains in the Genus database with same CATH topology
1PJ7A 2PYXA 4IVMB 3FMWA 3VRBA 3QSMA 4AT2A 2V5ZA 3HYWA 4LIIA 4LA1A 1CJ3A 2WESA 3IWAA 5EOWA 2ARDA 3RP7A 2BC1A 3SQPA 3KVEA 1H81A 3LOVA 4H4ZA 3IHMA 1X31B 5ER0A 1QLBA 4U2LA 3F8PA 2X8GA 1PBDA 4CY8A 1M64A 3KD9A 1TYTA 1H2IA 2TPRA 2UZZA 4EMIA 2QA2A 3AE1A 1D4DA 2WS3A 3UP4A 4CY6A 1LPFA 3GRTA 1NAAA 4DGKA 1D4EA 3AECA 2BC0A 4U8NA 1L9EA 2YG6A 4GF7A 1JEHA 1GRFA 1Q1RA 3CNPA 4IVOB 2A8XA 4TM1A 4C77A 3G5RA 4JY2A 3AE5A 2X8CA 4YKFA 3KLJA 1KSSA 4P9SA 1EL9A 4OVIA 1ZP0A 2GMJA 2VOUA 5U25A 3AEBA 2H88A 3UKAA 1O95A 1GTHA 4D04A 1V59A 4JNAA 3D9XA 4K8DA 4ECHA 1DOBA 2BS4A 2GEWA 1NG3A 3BI2A 3AE6A 4EM3A 2GR0A 4FK1A 4G6HA 3T2YA 3AYLA 1F8WA 1FL2A 5IQ4A 5KRQA 1CC2A 4Z2UA 1XANA 3P9UA 4HB9A 3HZLA 2BK3A 2VRMA 1BWCA 3AE4A 3AD7B 1NHRA 4B68A 5J60A 4EQSA 4B1BA 1CJ4A 3DGZA 1K0JA 3FBSA 4B66A 2BCGG 1NHQA 1NHPA 2XCGA 4O5UA 4FX9A 4BV6A 3LB8A 1JRYA 3AXBA 5HY5A 4OCGA 3M0OA 2AAQA 2C67A 3NLCA 1E6EA 4B63A 2WEUA 4N9XA 2CVJA 1ZKQA 1S2QA 1EL5A 2XVIA 2GAHB 3C96A 3L1RA 4ICYA 1S7MA 5EBKA 2XFQA 4Z25A 1GT8A 2YM1A 4G9KA 2Q0LA 5JCMA 2C73A 1NEKA 1VDCA 3AB1A 2W0HA 3GDNA 1ZOYA 2GAGB 4JNQA 3UP5A 4H4VA 2FJAA 1TYPA 3RNMA 4GR1A 1IUUA 1OJCA 3UOVA 1O5WA 2Q6UA 2WP9A 2BACA 1JRZA 2OLOA 2NVKX 1PDHA 4I59A 1JU2A 1CBOA 2RABA 4XWRA 4CCQA 2XVJA 2Y6QA 3BHFA 4AOSA 4CCRA 3L8KA 2WU5A 3ICSA 2BYBA 3NG7X 4ZCDA 4GAPA 1K0LA 3RP8A 2VQBA 2JB2A 2XVFA 3AWIA 4YTPA 5HYMA 1IUSA 5DBJA 2BS3A 4NZHA 4OPDA 2HQMA 2WP5A 3SZWA 4Z2TA 4H4XA 5C3JA 4TM0A 4EQRA 4DNAA 1BKWA 1BGNA 1GSNA 4AP3A 2YLRA 4JDRA 3DH9A 3BNMA 1DOEA 4K5RA 4YSHA 3SFDA 4CBQA 4USRA 2Z5YA 1H84A 2GR1A 3BHKA 3GD3A 3QFAA 2FBWA 1FOHA 1ZX9A 3VR8A 2X99A 5KMSA 2WPFA 2YLTA 2X50A 3AEDA 5FS9A 2WP6A 1JOAA 1CL0A 4A65A 1GREA 4EIQA 4GRTA 1OJ9A 1PBBA 2GQFA 3ATQA 1FEAA 2VRLA 3AD8B 3ALLA 3EPTA 3QSSA 4U8KA 3K30A 1IUWA 2YG7A 3ITJA 2V6OA 2FJDA 1FECA 1H6VA 3LZXA 3SXIA 3CNDA 3H4KA 5FMHA 3M12A 1GRTA 1M6IA 2C72A 2WDVA 1KF6A 1S2YA 2JAEA 3BI4A 4OPIA 2QA1A 4U8PA 5IQ1A 2YR5A 4J2WA 2RGJA 3CPHG 1TRBA 3GMBA 5BRTA 2VVLA 2QCUA 5KWFA 1BGJA 4CRTA 1KNRA 1D7LA 1MO9A 2EQ6A 2R4EA 2C3DA 5JRBA 4U8LA 4USQA 3V3NA 3FG2P 1PN0A 4LU6A 4REKA 3UKFA 1PBFA 2WETA 3B3RA 2R4JA 2YVGA 4A9WA 3CGEA 3IC9A 4U2TA 3Q6JA 3EAOA 4JQ9A 1KNPA 2OA1A 2YG5A 4K2XA 2VZ2A 4J34A 3D8XA 2B7RA 1L0VA 3P4QA 1GEUA 3CNSA 3KPFA 5BUKA 5J7XA 1E1NA 2WU2A 3SGLA 2B9YA 3GYIA 3HYXA 3P4RA 3AE9A 1F6MA 1CF3A 3G5QA 4K5SA 2IVDA 2GQWA 3AE3A 3ICRA 4OPLA 2ZBWA 3CTYA 2X8HA 3PG6A 4J56A 1IUTA 1E7PA 1LQUA 1BZLA 2V61A 3F8RA 3QJ4A 4A7AA 5KXJA 5KNLA 2B9XA 2FJBA 5U63A 3RHAA 3SM8A 2WDRA 4AP1A 2ZZBA 3DGHA 3DMEA 3GWDA 4II3A 5GSNA 1B37A 1LQTA 2XLUA 3I6DA 4EIPA 4H4QA 2JBVA 3UTEA 3UOXA 4GDEA 4H50A 2V3AA 2C70A 1ZY8A 2XDOA 4A99A 3NK2X 4ZCCA 3CN8A 2YR4A 1B5QA 2WDQA 1YQ4A 2AQJA 3DJDA 1NHSA 3SY4A 1EL8A 3NKSA 3CGCA 3SZCA 2E4GA 1NENA 1IUVA 1PXAA 2WOIA 4XWZA 2DKHA 5EB5A 3T2KA 1ZK7A 4XXGA 5FS6A 4YWOA 4NTCA 4WCTA 3NTAA 3QVPA 4FDCB 1O94A 2Y6RA 5FS8A 4RG4A 5EB4A 3BNUA 3IHGA 2BCPA 2C7GA 2BK4A 3K7MX 4U8JA 2C75A 3DA1A 4BK1A 1JNRA 2YLZA 1IJHA 1N4UA 2C76A 3H8LA 2R9ZA 2EQ9A 3FIMB 1IUXA 4KX6A 3NRNA 1ONFA 3AYIA 3UTHA 1E39A 1ZMCA 4TM3A 4H2PA 4E0VA 3F8DA 3SYIA 3II4A 2YLSA 2B76A 4A6NA 2ZZCA 5TR3A 3ICTA 4UDRA 1QJDA 5GRTA 1E1KA 1F8RA 3NYEA 4Z26A 3GWFA 3IF9A 2XLRA 2YQUA 2GMHA 1PBCA 3C4NA 4APNA 1CC6A 2XYOA 2VQ7A 1N1PA 4Z43A 1XDIA 2APGA 1PXBA 1H86A 4B69A 3NHOX 4H2RA 1K0IA 4OPCA 4C3YA 3CGDA 2XLPA 3KA7A 4Z24A 1VRQB 3NGCX 3UTFA 3COXA 3ABVA 1CJCA 3VR9A 2JK6A 3AE7A 3NN6X 1SEZA 4UDQA 1LVLA 1S3EA 1YKJA 2WQYA 1GTEA 3ZYXA 1TDKA 2R0PA 3E1TA 2B9WA 4H2NA 4YXDA 3S61A 4D03A 1PS9A 3L5OA 1GALA 1GETA 3AEGA 3C4AA 1OJDA 3NT6A 2IIDA 4NTEA 1E1LA 4A5LA 3AE2A 3CPJG 2CULA 5BULA 5KOWA 1GRAA 4TLXA 4BK2A 1K4QA 1MXTA 3NNEA 1ZDLA 4IA6A 2R46A 1PHHA 3EF6A 3T0KA 2XLSA 2WOWA 2WPCA 1Y56B 4GDPA 4Y4LA 3NYCA 2ZZ0A 4H4YA 2NPXA 1H7XA 3CGBA 2XFNA 4EQWA 3NK0X 1FCDA 4OPTA 2XFPA 3CPIG 1GERA 3HYVA 2OLNA 5FS7A 3GMCA 3PS9A 4J31A 2YVJA 1RSGA 1Z6LA 2Q0KA 1B4VA 1JNZA 3VRAA 2R0GA 4YT0A 1JRXA 4CNJA 1KN0A 1GXFA 3OZ2A 2YG3A 2EQ8A 1VG0A 3K7QX 2E5VA 3FPZA 1LJ1A 4B64A 4ZN0A 4O5QA 3UKHA 1H83A 1L9CA 3UOYA 4GAVA 3AYJA 5KMRA 1VQWA 2YVFA 1EBDA 2BABA 3RP6A 4GCMA 4J57A 3AE8A 4NEWA 3NN0X 4K7ZA 3CMMA 1UKVG 1MOKA 3SX6A 4IV9A 5JCIA 1DODA 5KMPA 2WPEA 1ZMDA 3NH3X 1CJ2A 3NYFA 3GYXA 4YKGA 2QAEA 2YR6A 3OC4A 1OJAA 5CQFA 5KMQA 3T37A 4AT0A 2ACZA 5JCLA 3SZFA 2Z5XA 3UKKA 1XPQA 3I3LA 3LZWA 1BF3A 4UDPA 4II2A 4J36A 2GB0A 2X3NA 1YY5A 4OPUA 2BXSA 1DJNA 4X4JA 2XVEA 1P2EA 1YQZA 4TM4A 3KU9A 1Q1WA 2YAUA 2YWLA 3GRSA 4PABA 1REOA 2GR3A 4NEVA 3UKLA 5L46A 3ALMA 3PO7A 2V3BA 3O0HA 2Q7VA 5IPYA 4Z2RA 2E1MA 3KKJA 5KOXA 5U1OA 1B8SA 1GV4A 2H89A 3URHA 1GRGA 1Y0PA 3NK1X 5C2TA 3M13A 3AEEA 4EQXA 3EANA 2J3NA 4JY3A 4BK3A 2C3CA 4BJZA 2GRTA 4H4PA 1CHUA 4YSZA 4BJYA 3GYJA 3KPKA 1TDOA 3LJPA 2GVCA 1GRBA 1D4CA 3UKPA 1ZOVA 4YTMA 4RG3A 2XVHA 1COYA 4U8IA 3SFEA 3WE0A 1TDEA 4X9MA 3VRDB 4A79A 2WBAA 3GSIA 5HXIA 2GF3A 3ISHA 3K7TA 3VQRA 1PJ6A 2B7SA 3V76A 4H4UA 1PBEA 2O9ZA 3CIRA 2GH5A 4U8MA 1NG4A 1QO8A 2YLXA 3AD9B 5JCNA 3NIXA 3P4SA 2I0ZA 5CKUA 3CNJA 1GRHA 4GUVA 2JB1A 1N4VA 2IVEA 3QSEA 4IA5A 3UOZA 4YTNA 4EMJA 4A6NB 1KDGA 2A89A 4KPRA 2EQ7A 4YSYA 1GOSA 1DJQA 1HYUA 2XFOA 1E1MA 3T2ZA 4G6GA 1EL7A 2YLWA 3NTDA 5LV9A 2OAMA 4YSXA 2WHDA 4C74A 2A87A 4DSHA 3D1CA 3DJJA 5HHFA 2CDUA 1DNCA 2FJEA 4H4WA 1GPEA 3AEFA 2CFYA 2BRAA 4H7UA 3LXDA 2RGHA 1ELIA 2C66A 1YQ3A 4C3XA 1P2HA 4RSLA 2C4CA 4DSGA 1Q9IA 4X9NA 2RGOA 3UTGA 1F3PA 2DKIA 3SZ0A 3H8IA 4EM4A 2JKCA 3ZDNA 2BS2A 3ATRA 2YM2A 3P1WA 1TDNA 5KVIA 3LADA 3AEAA 1NDAA 2C64A 4PAAA 1TDFA 1OJTA 5M0ZA 5JCKA 5KVHA 4H4RA 1Y56A 2BXRA 3DK9A 4MJWA 4ADWA 2BA9A 3T14A 1FEBA 1D7YA 1H7WA 1KSUA 3ALJA 4AOXA 2VVLG 3G5SA 3REDA 2BK5A 1PXCA 4NWZA 2PHHA 4WX1A 3T31A 1DXLA 4HA6A 2XLTA 3B6DA 3QFBA 4B65A 2AR8A 2TMDA 1KFYA 4H2QA 1W4XA 1CC4A 2R0CA 4OPGA 3R9UA 3DJGX 4J33A 4JN9A 4C5OA 1F8SA 1D5TA 5M10A 4Z44A 4BURA 3DJEA 1LV0A 2JB3A 4TLZA 5BVAA 4K22A 3DK8A 2XFUA 4U8OA 2GR2A 2GV8A 1RYIA 1LTXR 3GDPA 4U2SA 4NTDA 3GD4A 3ADAB 2YG4A 4H4SA 1XHCA 1DOCA 2OALA 3S5WA 3DK4A 1L9DA 3V3OA 3Q9TA 3BI5A 2V60A 3CNTA 3JSKA 4EMWA 1AOGA 3P4PA 4M52A 4CNKA 4NNJA 1H82A 1PJ5A 4G73A 2WOVA 1VG9A 2R45A 4FK1C 1S3BA 3UCLA 2C65A 1RP0A 1N4WA 4B67A 4G74A 4Y4MA 3QVRA 2VVMA 2F5ZA 3UKQA 2BRYA 4I58A 1NPXA 4UP3A 4Y4NA 3PVCA 1GNDA 1GESA 4H4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJ7 A;  2PYX A;  4IVM B;  3FMW A;  3VRB A;  3QSM A;  4AT2 A;  2V5Z A;  4LII A;  4LA1 A;  1CJ3 A;  2WES A;  3IWA A;  5EOW A;  2ARD A;  3RP7 A;  2BC1 A;  3SQP A;  3KVE A;  1H81 A;  3LOV A;  4H4Z A;  3IHM A;  1X31 B;  5ER0 A;  1QLB A;  4U2L A;  3F8P A;  2X8G A;  1PBD A;  4CY8 A;  1M64 A;  3KD9 A;  1TYT A;  2TPR A;  2UZZ A;  4EMI A;  2QA2 A;  3AE1 A;  1D4D A;  2WS3 A;  3UP4 A;  4CY6 A;  1LPF A;  3GRT A;  1NAA A;  4DGK A;  1D4E A;  3AEC A;  2BC0 A;  4U8N A;  1L9E A;  2YG6 A;  4GF7 A;  1JEH A;  1GRF A;  1Q1R A;  3CNP A;  4IVO B;  2A8X A;  4TM1 A;  4C77 A;  3G5R A;  4JY2 A;  3AE5 A;  2X8C A;  4YKF A;  3KLJ A;  1KSS A;  4P9S A;  1EL9 A;  4OVI A;  1ZP0 A;  2GMJ A;  2VOU A;  5U25 A;  3AEB A;  2H88 A;  3UKA A;  1O95 A;  1GTH A;  4D04 A;  1V59 A;  4JNA A;  4K8D A;  4ECH A;  1DOB A;  2BS4 A;  2GEW A;  1NG3 A;  3BI2 A;  3AE6 A;  4EM3 A;  2GR0 A;  4FK1 A;  3AYL A;  1F8W A;  1FL2 A;  5IQ4 A;  5KRQ A;  1CC2 A;  4Z2U A;  1XAN A;  3P9U A;  4HB9 A;  3HZL A;  2BK3 A;  2VRM A;  1BWC A;  3AE4 A;  3AD7 B;  1NHR A;  4B68 A;  5J60 A;  4EQS A;  4B1B A;  1CJ4 A;  3DGZ A;  1K0J A;  3FBS A;  4B66 A;  2BCG G;  1NHQ A;  1NHP A;  2XCG A;  4O5U A;  4FX9 A;  4BV6 A;  3LB8 A;  1JRY A;  3AXB A;  5HY5 A;  4OCG A;  3M0O A;  2AAQ A;  2C67 A;  3NLC A;  1E6E A;  4B63 A;  2WEU A;  4N9X A;  2CVJ A;  1ZKQ A;  1S2Q A;  1EL5 A;  2XVI A;  2GAH B;  3C96 A;  3L1R A;  4ICY A;  5EBK A;  2XFQ A;  4K22 A;  4Z25 A;  1GT8 A;  2YM1 A;  2Q0L A;  5JCM A;  2C73 A;  1NEK A;  1VDC A;  3AB1 A;  2W0H A;  3GDN A;  1ZOY A;  2GAG B;  4JNQ A;  3UP5 A;  4H4V A;  2FJA A;  1TYP A;  3RNM A;  4GR1 A;  1IUU A;  1OJC A;  3UOV A;  1O5W A;  2Q6U A;  2WP9 A;  2BAC A;  1JRZ A;  2OLO A;  2NVK X;  1PDH A;  4I59 A;  1JU2 A;  1CBO A;  2RAB A;  4XWR A;  4CCQ A;  2XVJ A;  2Y6Q A;  3BHF A;  4AOS A;  4CCR A;  3L8K A;  2WU5 A;  3ICS A;  2BYB A;  3NG7 X;  4ZCD A;  1K0L A;  3RP8 A;  2VQB A;  2JB2 A;  2XVF A;  3AWI A;  4YTP A;  5HYM A;  1IUS A;  5DBJ A;  2BS3 A;  4NZH A;  4OPD A;  2HQM A;  2WP5 A;  5C3J A;  4Z2T A;  4H4X A;  4TM0 A;  4EQR A;  4DNA A;  1BKW A;  1BGN A;  1GSN A;  4AP3 A;  2YLR A;  4JDR A;  3DH9 A;  3BNM A;  1DOE A;  4K5R A;  4YSH A;  3SFD A;  4CBQ A;  4USR A;  2Z5Y A;  1H84 A;  2GR1 A;  3BHK A;  3GD3 A;  3QFA A;  2FBW A;  1FOH A;  1ZX9 A;  3VR8 A;  2X99 A;  2WPF A;  2YLT A;  2X50 A;  3AED A;  5FS9 A;  2WP6 A;  1JOA A;  1CL0 A;  4A65 A;  1GRE A;  4EIQ A;  4GRT A;  1OJ9 A;  1PBB A;  2GQF A;  3ATQ A;  1FEA A;  2VRL A;  3AD8 B;  3ALL A;  3EPT A;  3QSS A;  4U8K A;  3K30 A;  1IUW A;  2YG7 A;  3ITJ A;  2V6O A;  2FJD A;  1FEC A;  1H6V A;  3LZX A;  3CND A;  3H4K A;  5FMH A;  3M12 A;  1GRT A;  1M6I A;  2C72 A;  2WDV A;  1KF6 A;  1S2Y A;  2JAE A;  3BI4 A;  4OPI A;  2QA1 A;  4U8P A;  5IQ1 A;  2YR5 A;  4J2W A;  2RGJ A;  3CPH G;  1TRB A;  3GMB A;  5BRT A;  2VVL A;  2QCU A;  5KWF A;  1BGJ A;  4CRT A;  1KNR A;  1D7L A;  1MO9 A;  2EQ6 A;  2R4E A;  2C3D A;  4U8L A;  4USQ A;  3V3N A;  3FG2 P;  1PN0 A;  4LU6 A;  4REK A;  3UKF A;  1PBF A;  2WET A;  3B3R A;  2R4J A;  2YVG A;  4A9W A;  3CGE A;  3IC9 A;  4U2T A;  3Q6J A;  3EAO A;  4JQ9 A;  1KNP A;  2OA1 A;  2YG5 A;  4K2X A;  2VZ2 A;  4J34 A;  3D8X A;  2B7R A;  1L0V A;  3P4Q A;  1GEU A;  3CNS A;  3KPF A;  5BUK A;  5J7X A;  1E1N A;  2WU2 A;  3SGL A;  2B9Y A;  3GYI A;  3P4R A;  3AE9 A;  1F6M A;  1CF3 A;  3G5Q A;  4K5S A;  2IVD A;  2GQW A;  3AE3 A;  3ICR A;  4OPL A;  2ZBW A;  3CTY A;  2X8H A;  1IUT A;  4J56 A;  1E7P A;  1LQU A;  3F8R A;  1BZL A;  2V61 A;  3QJ4 A;  4A7A A;  5KXJ A;  2B9X A;  2FJB A;  5U63 A;  3RHA A;  3SM8 A;  2WDR A;  4AP1 A;  2ZZB A;  3DGH A;  3DME A;  3GWD A;  5GSN A;  1B37 A;  1LQT A;  2XLU A;  3I6D A;  4EIP A;  4H4Q A;  2JBV A;  3UTE A;  3UOX A;  4GDE A;  4H50 A;  2C70 A;  2V3A A;  1ZY8 A;  2XDO A;  4A99 A;  3NK2 X;  4ZCC A;  3CN8 A;  2YR4 A;  1B5Q A;  2WDQ A;  1YQ4 A;  2AQJ A;  3DJD A;  1NHS A;  1EL8 A;  3NKS A;  3CGC A;  2E4G A;  1NEN A;  1IUV A;  1PXA A;  2WOI A;  4XWZ A;  2DKH A;  5EB5 A;  1ZK7 A;  4XXG A;  5FS6 A;  4YWO A;  4NTC A;  4WCT A;  3NTA A;  3QVP A;  4FDC B;  1O94 A;  2Y6R A;  5FS8 A;  4RG4 A;  5EB4 A;  3BNU A;  3IHG A;  2BCP A;  2C7G A;  2BK4 A;  3K7M X;  4U8J A;  2C75 A;  3DA1 A;  4BK1 A;  1JNR A;  2YLZ A;  1IJH A;  1N4U A;  2C76 A;  3H8L A;  2R9Z A;  2EQ9 A;  3FIM B;  1IUX A;  4KX6 A;  3NRN A;  1ONF A;  3AYI A;  3UTH A;  1E39 A;  1ZMC A;  4TM3 A;  4H2P A;  4E0V A;  3F8D A;  3II4 A;  2YLS A;  2B76 A;  4A6N A;  2ZZC A;  5TR3 A;  3ICT A;  4UDR A;  1QJD A;  5GRT A;  1E1K A;  1F8R A;  3NYE A;  4Z26 A;  3GWF A;  3IF9 A;  2XLR A;  2YQU A;  2GMH A;  1PBC A;  3C4N A;  4APN A;  1CC6 A;  2XYO A;  2VQ7 A;  1N1P A;  4Z43 A;  1XDI A;  2APG A;  1PXB A;  1H86 A;  4B69 A;  3NHO X;  4H2R A;  1K0I A;  4OPC A;  4C3Y A;  3CGD A;  2XLP A;  3KA7 A;  4Z24 A;  1VRQ B;  3NGC X;  3UTF A;  3COX A;  3ABV A;  1CJC A;  3VR9 A;  2JK6 A;  3AE7 A;  3NN6 X;  1SEZ A;  4UDQ A;  1LVL A;  1S3E A;  1YKJ A;  2WQY A;  1GTE A;  3ZYX A;  1TDK A;  2R0P A;  3E1T A;  2B9W A;  4H2N A;  4YXD A;  3S61 A;  4D03 A;  1PS9 A;  1GAL A;  1GET A;  3AEG A;  3C4A A;  1OJD A;  3NT6 A;  2IID A;  4NTE A;  1E1L A;  4A5L A;  3AE2 A;  3CPJ G;  2CUL A;  5BUL A;  5KOW A;  1GRA A;  4TLX A;  4BK2 A;  1K4Q A;  1MXT A;  3NNE A;  1ZDL A;  4IA6 A;  2R46 A;  1PHH A;  3EF6 A;  2XLS A;  2WOW A;  2WPC A;  1Y56 B;  4GDP A;  4Y4L A;  3NYC A;  2ZZ0 A;  4H4Y A;  2NPX A;  1H7X A;  3CGB A;  2XFN A;  4EQW A;  3NK0 X;  1FCD A;  4OPT A;  2XFP A;  3CPI G;  1GER A;  2OLN A;  5FS7 A;  3GMC A;  3PS9 A;  4J31 A;  2YVJ A;  1RSG A;  1Z6L A;  2Q0K A;  1B4V A;  1JNZ A;  3VRA A;  2R0G A;  4YT0 A;  1JRX A;  4CNJ A;  1GXF A;  3OZ2 A;  2YG3 A;  2EQ8 A;  1VG0 A;  3K7Q X;  2E5V A;  3FPZ A;  1LJ1 A;  4B64 A;  4ZN0 A;  4O5Q A;  3UKH A;  1H83 A;  1L9C A;  3UOY A;  3AYJ A;  1VQW A;  2YVF A;  1EBD A;  2BAB A;  3RP6 A;  4GCM A;  4J57 A;  3AE8 A;  4NEW A;  3NN0 X;  4K7Z A;  1UKV G;  1MOK A;  4IV9 A;  5JCI A;  1DOD A;  2WPE A;  1ZMD A;  3NH3 X;  1CJ2 A;  3NYF A;  4YKG A;  2QAE A;  2YR6 A;  3OC4 A;  1OJA A;  5CQF A;  3T37 A;  4AT0 A;  2ACZ A;  5JCL A;  2Z5X A;  3UKK A;  1XPQ A;  3I3L A;  3LZW A;  1BF3 A;  4UDP A;  4J36 A;  2GB0 A;  2X3N A;  1YY5 A;  4OPU A;  2BXS A;  1DJN A;  4X4J A;  2XVE A;  1P2E A;  1YQZ A;  4TM4 A;  3KU9 A;  1Q1W A;  2YAU A;  2YWL A;  3GRS A;  4PAB A;  1REO A;  2GR3 A;  4NEV A;  3UKL A;  5L46 A;  3ALM A;  3PO7 A;  2V3B A;  3O0H A;  2Q7V A;  5IPY A;  4Z2R A;  2E1M A;  3KKJ A;  5KOX A;  5U1O A;  1B8S A;  1GV4 A;  2H89 A;  3URH A;  1GRG A;  1Y0P A;  3NK1 X;  5C2T A;  3M13 A;  3AEE A;  4EQX A;  3EAN A;  2J3N A;  4JY3 A;  4BK3 A;  2C3C A;  4BJZ A;  2GRT A;  4H4P A;  1CHU A;  4YSZ A;  4BJY A;  3GYJ A;  1TDO A;  3LJP A;  2GVC A;  1GRB A;  1D4C A;  3UKP A;  1ZOV A;  4YTM A;  4RG3 A;  2XVH A;  1COY A;  4U8I A;  3SFE A;  3WE0 A;  1TDE A;  4X9M A;  3VRD B;  4A79 A;  2WBA A;  3GSI A;  5HXI A;  2GF3 A;  3ISH A;  3K7T A;  3VQR A;  1PJ6 A;  2B7S A;  3V76 A;  4H4U A;  1PBE A;  2O9Z A;  3CIR A;  2GH5 A;  4U8M A;  1NG4 A;  1QO8 A;  2YLX A;  3AD9 B;  5JCN A;  3NIX A;  3P4S A;  2I0Z A;  5CKU A;  3CNJ A;  1GRH A;  4GUV A;  2JB1 A;  1N4V A;  2IVE A;  3QSE A;  4IA5 A;  3UOZ A;  4YTN A;  4EMJ A;  4A6N B;  1KDG A;  2A89 A;  4KPR A;  2EQ7 A;  4YSY A;  1GOS A;  1DJQ A;  1HYU A;  2XFO A;  1E1M A;  1EL7 A;  2YLW A;  3NTD A;  5LV9 A;  2OAM A;  4YSX A;  2WHD A;  4C74 A;  2A87 A;  4DSH A;  3D1C A;  3DJJ A;  5HHF A;  2CDU A;  1DNC A;  2FJE A;  4H4W A;  1GPE A;  3AEF A;  2CFY A;  4H7U A;  3LXD A;  2RGH A;  1ELI A;  2C66 A;  1YQ3 A;  4C3X A;  1P2H A;  4RSL A;  4DSG A;  1Q9I A;  4X9N A;  2RGO A;  3UTG A;  1F3P A;  2DKI A;  3H8I A;  4EM4 A;  2JKC A;  3ZDN A;  2BS2 A;  3ATR A;  2YM2 A;  3P1W A;  1TDN A;  5KVI A;  3LAD A;  3AEA A;  1NDA A;  2C64 A;  4PAA A;  1TDF A;  1OJT A;  5M0Z A;  5JCK A;  5KVH A;  4H4R A;  1Y56 A;  2BXR A;  3DK9 A;  4MJW A;  4ADW A;  2BA9 A;  1FEB A;  1D7Y A;  1H7W A;  1KSU A;  3ALJ A;  4AOX A;  2VVL G;  3G5S A;  3RED A;  2BK5 A;  1PXC A;  2PHH A;  4WX1 A;  1DXL A;  4HA6 A;  2XLT A;  3B6D A;  3QFB A;  4B65 A;  2AR8 A;  2TMD A;  1KFY A;  4H2Q A;  1W4X A;  1CC4 A;  2R0C A;  4OPG A;  3R9U A;  3DJG X;  4J33 A;  4JN9 A;  4C5O A;  1F8S A;  1D5T A;  5M10 A;  4Z44 A;  4BUR A;  3DJE A;  1LV0 A;  2JB3 A;  4TLZ A;  5BVA A;  3DK8 A;  2XFU A;  4U8O A;  2GR2 A;  2GV8 A;  1RYI A;  1LTX R;  3GDP A;  4U2S A;  4NTD A;  3GD4 A;  3ADA B;  2YG4 A;  4H4S A;  1XHC A;  1DOC A;  2OAL A;  3S5W A;  3DK4 A;  1L9D A;  3V3O A;  3Q9T A;  3BI5 A;  2V60 A;  3CNT A;  3JSK A;  4EMW A;  1AOG A;  3P4P A;  4M52 A;  4CNK A;  1H82 A;  1PJ5 A;  2WOV A;  1VG9 A;  2R45 A;  4FK1 C;  1S3B A;  3UCL A;  2C65 A;  1RP0 A;  1N4W A;  4B67 A;  4Y4M A;  3QVR A;  2VVM A;  2F5Z A;  3UKQ A;  4I58 A;  1NPX A;  4UP3 A;  4Y4N A;  3PVC A;  1GND A;  1GES A;  4H4T A; 
#chains in the Genus database with same CATH topology
 4H83 A;  4A6G A;  4HCH A;  3NO1 A;  1PJ7 A;  2OG9 A;  3VRB A;  3QSM A;  4AT2 A;  1MDL A;  2V5Z A;  3HYW A;  5BOF A;  2BC1 A;  3QPE A;  3ES8 A;  3F8P A;  4CY8 A;  1H2I A;  2UZZ A;  4EMI A;  2QA2 A;  2E5A A;  1D4D A;  2WS3 A;  3UP4 A;  4CY6 A;  3NVW B;  4DGK A;  1D4E A;  2BC0 A;  3MZN A;  3I4K A;  2YG6 A;  4C77 A;  2PCE A;  3HPF A;  3JVA A;  5G5H B;  3AEB A;  1O95 A;  1GTH A;  3BI2 A;  1XAN A;  3AD7 B;  4B68 A;  2AKM A;  4EQS A;  3CYJ A;  1CJ4 A;  1K0J A;  3FBS A;  3JW7 A;  1NHP A;  4FX9 A;  1JRY A;  3VC6 A;  2RDX A;  1ECQ A;  4N9X A;  2CVJ A;  1S2Q A;  3FJ4 A;  4ICY A;  2XFQ A;  4G9K A;  5JCM A;  1VDC A;  2W0H A;  1ZOY A;  3NRZ B;  1TYP A;  1O5W A;  4I59 A;  1PDH A;  2XVJ A;  2Y6Q A;  4AOS A;  4CCR A;  4MKS A;  2WU5 A;  4GIR A;  3RP8 A;  2XVF A;  3AWI A;  5HYM A;  2OZ8 A;  3VCC A;  4OPD A;  2HQM A;  4F4R A;  1GSN A;  4AP3 A;  3PWI A;  2OLA A;  3BHK A;  3GD3 A;  3QFA A;  1WUF A;  2WPF A;  3AED A;  4JN8 A;  1JOA A;  1OJ9 A;  3ATQ A;  4K1W A;  3QSS A;  3UJF A;  1H6V A;  3SXI A;  3OPS A;  3CND A;  3H4K A;  5FMH A;  3M12 A;  3VCN A;  3B9J B;  1GRT A;  2WDV A;  3BI4 A;  3CK5 A;  3ZLF A;  3CPH G;  3SSZ A;  3V3N A;  3B3R A;  4A9W A;  3CGE A;  3TQP A;  3Q6J A;  2VZ2 A;  3SQS A;  1N61 C;  3TWB A;  5BUK A;  3SGL A;  3HYX A;  2PP3 A;  1NEL A;  1CF3 A;  2ZAD A;  2PU1 A;  2IVD A;  3AE3 A;  3HW2 A;  4J56 A;  1LQU A;  6ENL A;  1BZL A;  2FJB A;  3SN4 A;  1YEY A;  3RHA A;  1TKK A;  5GSN A;  2XLU A;  3I6D A;  2JBV A;  2V3A A;  2XDO A;  1ELS A;  3UCC A;  2YR4 A;  3DG7 A;  2WDQ A;  1YQ4 A;  2P8B A;  1N5X A;  2WOI A;  4HCD A;  2PTX A;  3ENL A;  1ZK7 A;  5FS6 A;  4ENL A;  4NTC A;  4WCT A;  3I6T A;  4FDC B;  2Y6R A;  3MWC A;  3QN3 A;  1TE6 A;  3K7M X;  2C75 A;  3DA1 A;  4BK1 A;  1IJH A;  2R9Z A;  3FIM B;  3NRN A;  3R10 A;  1E39 A;  4E0V A;  3F8D A;  3II4 A;  2YLS A;  3ICT A;  4UDR A;  1E1K A;  3AN1 A;  2VQ7 A;  4Z43 A;  3DG3 A;  1XDI A;  3D46 A;  1PXB A;  1H86 A;  4OPC A;  3A7A A;  3KA7 A;  4ZOH B;  3UTF A;  3AE7 A;  3NS1 B;  1SEZ A;  1TDK A;  1L8P A;  4IZG A;  4YXD A;  1PS9 A;  3L5O A;  1GAL A;  1GET A;  3AEG A;  3NT6 A;  4NTE A;  2IID A;  2CUL A;  1GRA A;  4TLX A;  2I5Q A;  3N6J A;  1MXT A;  4KEM A;  4IA6 A;  3EF6 A;  2XLS A;  2ZZ0 A;  1KCZ A;  4IP5 A;  3NK0 X;  4EQW A;  1FCD A;  2XFP A;  1MDR A;  2R0G A;  4HYR A;  1JRX A;  4CNJ A;  3OZ2 A;  4KWS A;  3FPZ A;  3TOY A;  1LJ1 A;  4KT2 A;  3UOY A;  2QJM A;  5KMR A;  4IV9 A;  3SBF A;  5JCI A;  3THU A;  1ZMD A;  2ACZ A;  3UKK A;  1XPQ A;  3LZW A;  1BF3 A;  4II2 A;  3K1G A;  4YWS A;  3RCY A;  2XVE A;  3SN1 A;  4PAB A;  2YWL A;  3A7R A;  3GRS A;  1REO A;  2GR3 A;  5BOE A;  4NEV A;  3UKL A;  3PO7 A;  3GD6 A;  3O0H A;  2Q7V A;  3TJ4 A;  2H89 A;  1STZ A;  2GGG A;  3NVZ B;  2J3N A;  4JY3 A;  4A3R A;  1CHU A;  4YSZ A;  4BJY A;  4ROP A;  3R0K A;  4X2P A;  1JPM A;  2XVH A;  3SFE A;  3ISH A;  3DDM A;  1PJ6 A;  2B7S A;  2ZC8 A;  3CIR A;  1NG4 A;  1QO8 A;  5JCN A;  2I0Z A;  4IHC A;  3ES7 A;  3CNJ A;  2JB1 A;  3QSE A;  4EMJ A;  4A6N B;  2A89 A;  4KPR A;  1GOS A;  1DJQ A;  1HYU A;  5LV9 A;  4J3Z A;  5HHF A;  4H7U A;  1MNS A;  2OZT A;  1Q9I A;  2DKI A;  4EM4 A;  2BS2 A;  2YM2 A;  3LAD A;  3NZG A;  5JCK A;  2GL5 A;  3T14 A;  4AOX A;  3G5S A;  2BK5 A;  4WX1 A;  3T31 A;  4B65 A;  2AR8 A;  3P93 A;  1D5T A;  3RIT A;  3RGT A;  2JB3 A;  4TLZ A;  2XFU A;  4U8O A;  2GR2 A;  3GDP A;  4GYP C;  2QGY A;  2QDE A;  3V3O A;  3Q9T A;  4EMW A;  4CNK A;  2FKP A;  1VG9 A;  2R45 A;  3U9I A;  3UCL A;  2C65 A;  4G74 A;  2PGW A;  1JCT A;  2P3Z A;  3NN6 X;  4H4R A;  3DFH A;  2PYX A;  4IVM B;  3UCD A;  4LII A;  5EOW A;  3RP7 A;  2ARD A;  1ZXI C;  3SQP A;  3N4E A;  3KVE A;  3LOV A;  3IHM A;  1PBD A;  2TPR A;  2AKZ A;  4GGH A;  4GGB A;  3AEC A;  2GGH A;  3DG6 A;  4U8N A;  1L9E A;  2P88 A;  1GRF A;  1FO4 A;  4TM1 A;  2W55 A;  3AE5 A;  1KSS A;  1EL9 A;  2VOU A;  3Q4D A;  4D04 A;  4G7F A;  1JRO A;  3D9X A;  2BS4 A;  2NQL A;  1NG3 A;  4DWD A;  4G6H A;  1FL2 A;  5KRQ A;  3R25 A;  1CC2 A;  4IL2 A;  3P9U A;  4HB9 A;  2VRM A;  1BWC A;  5J60 A;  3DGZ A;  4H19 A;  4OCG A;  2AAQ A;  1E6E A;  4B63 A;  2WEU A;  4K22 A;  1EL5 A;  3ZVI A;  2XVI A;  3L1R A;  5EBK A;  1GT8 A;  2YM1 A;  3AB1 A;  3GDN A;  2GAG B;  4H4V A;  3RNM A;  4GR1 A;  1IUU A;  4DYE A;  2WP9 A;  1JRZ A;  2OLO A;  2NVK X;  1CBO A;  4XWR A;  3PK7 A;  3BHF A;  2BYB A;  3B97 A;  4YTP A;  2BS3 A;  4NZH A;  2WP5 A;  5C3J A;  4JDR A;  4K5R A;  1KKO A;  3SFD A;  3VA8 A;  5KMS A;  1FOH A;  2X99 A;  2YLT A;  1CL0 A;  4J1O A;  3ALL A;  4U8K A;  3EPT A;  1IUW A;  3ITJ A;  3CXO A;  2FJD A;  3LZX A;  3VC5 A;  2C72 A;  1KF6 A;  1TRB A;  2VVL A;  1N60 C;  1BGJ A;  4CRT A;  1MO9 A;  2EQ6 A;  2R4E A;  5JRB A;  1PN0 A;  1PBF A;  2YVG A;  5ENL A;  1EBG A;  4U2T A;  2OO6 A;  7ENL A;  2YG5 A;  4K2X A;  2B7R A;  1GEU A;  3KPF A;  5J7X A;  1E1N A;  3GYI A;  3AE9 A;  4K5S A;  3PG6 A;  3F8R A;  2HXU A;  3SM8 A;  3DME A;  4H4Q A;  3UTE A;  4GDE A;  4H50 A;  2C70 A;  4MMW A;  3CN8 A;  1B5Q A;  3DJD A;  1NHS A;  3NKS A;  2CHR A;  3Q45 A;  1NEN A;  4HNL A;  3DER A;  1O94 A;  5EB4 A;  2QQ6 A;  1E9I A;  3BNU A;  4E4U A;  1FFV C;  1N5W C;  2YLZ A;  2POZ A;  2C76 A;  2OKT A;  1SJC A;  1IUX A;  1ONF A;  4TM3 A;  2B76 A;  5TR3 A;  3IF9 A;  2GSH A;  2YQU A;  2GMH A;  1XS2 A;  4E6M A;  3MUC A;  3NHO X;  1IYX A;  2XLP A;  1VRQ B;  3NGC X;  1CJC A;  2JK6 A;  1YKJ A;  3IK4 A;  2P0I A;  2R0P A;  3T4W A;  3E1T A;  4H2N A;  3EUB 3;  3S61 A;  4D03 A;  1FHV A;  4A5L A;  3T8Q A;  1ZDL A;  3U4F A;  3T0K A;  5FJO A;  1Y56 B;  4Y4L A;  3CGB A;  3CPI G;  1GER A;  3GMC A;  3PS9 A;  4J31 A;  1Z6L A;  3VRA A;  1KN0 A;  1MRA A;  2YG3 A;  2EQ8 A;  3FCP A;  3UGV A;  4TVW A;  4ZN0 A;  5FJP A;  1EBD A;  3CB3 A;  4NEW A;  3NN0 X;  1WUE A;  1DOD A;  5KMP A;  2WPE A;  4YKG A;  4Z17 A;  5JCL A;  3SZF A;  4M0X A;  4FI4 A;  3CT2 A;  4UDP A;  4OPU A;  2MNR A;  1YQZ A;  3KU9 A;  3CXB A;  1T3Q C;  4Z2R A;  2E1M A;  4IP4 A;  5U1O A;  3OZY A;  3A7U A;  1GRG A;  1SJB A;  4EQX A;  3ZVH B;  2C3C A;  2GRT A;  3UJE A;  3GYJ A;  3KPK A;  1D4C A;  1VQZ A;  2XH2 A;  2XSX A;  4X9M A;  3VRD B;  2WBA A;  3SR6 B;  4H4U A;  2O9Z A;  5CKU A;  4Z1Y A;  1GRH A;  4GUV A;  4IA5 A;  3TWA A;  2XFO A;  3IJI A;  2YLW A;  4C74 A;  2A87 A;  3AEF A;  1DNC A;  2CDU A;  4H4W A;  1ELI A;  2C66 A;  4C3X A;  4X9N A;  3UTG A;  3BSM A;  3ATR A;  1NDA A;  1OJT A;  5KVH A;  3SN0 A;  1Y56 A;  2BA9 A;  1D7Y A;  3ALJ A;  1KSU A;  1PXC A;  2PHH A;  4HA6 A;  3QFB A;  2TMD A;  4OPG A;  3V3W A;  2R0C A;  1CC4 A;  3R9U A;  3QTP A;  2PTY A;  4Z44 A;  3DJE A;  5BVA A;  2GV8 A;  1RYI A;  4U2S A;  4NTD A;  3GD4 A;  3V5F A;  3ADA B;  4H4S A;  1XHC A;  1DOC A;  5FJT A;  3H12 A;  2V60 A;  4GFI A;  3JSK A;  2PU0 A;  1H82 A;  4G73 A;  2QJN A;  1RP0 A;  3QVR A;  4K2S A;  2VVM A;  2F5Z A;  3UKQ A;  1NPX A;  4UP3 A;  4H2H A;  1GES A;  3RED A;  4H4T A;  3FMW A;  3UJ2 A;  2WES A;  1H81 A;  1X31 B;  4U2L A;  1QLB A;  1M64 A;  1LPF A;  3GRT A;  3MY9 A;  1Q1R A;  1DTN A;  4IVO B;  2A8X A;  1PDZ A;  4YKF A;  3KLJ A;  4P9S A;  4OVI A;  1ZP0 A;  2GMJ A;  2H88 A;  3UKA A;  3P0W A;  3ZVH A;  4JNA A;  4K8D A;  2GEW A;  3AE6 A;  4FK1 A;  3T2Y A;  5IQ4 A;  4Z2U A;  2BK3 A;  1NHR A;  4JN7 A;  2BCG G;  2XCG A;  4BV6 A;  3AXB A;  5HY5 A;  1OEP A;  2OPJ A;  4ZCW A;  3M0O A;  2C67 A;  3NLC A;  2Q0L A;  1NEK A;  4IL0 A;  1OJC A;  2Q6U A;  2RAB A;  5J04 A;  3IJL A;  3L8K A;  3ICS A;  3TW9 A;  4HCL A;  4GAP A;  1K0L A;  3GO2 A;  2JB2 A;  1TZZ A;  4Z2T A;  4H4X A;  4TM0 A;  4DNA A;  3TCS A;  1BGN A;  2FYM A;  2YLR A;  3DH9 A;  3BNM A;  4YSH A;  3MQT A;  4HPN A;  1ZX9 A;  2X50 A;  5FS9 A;  2WP6 A;  1GRE A;  3GC2 A;  1FEA A;  3AD8 B;  3K30 A;  2YG7 A;  1N63 C;  5FJR A;  1S2Y A;  2JAE A;  5BRT A;  2RGJ A;  3GMB A;  4GIS A;  4USQ A;  3FG2 P;  4LU6 A;  2OFJ A;  2WET A;  2PSN A;  3IC9 A;  1KNP A;  2OA1 A;  1W6T A;  4J34 A;  3D8X A;  1L0V A;  3CNS A;  3R1Z A;  2B9Y A;  2GQW A;  3ICR A;  3CTY A;  1IUT A;  4A7A A;  5KXJ A;  5KNL A;  5U63 A;  1P48 A;  2DW7 A;  4HN8 A;  1F9C A;  4EIP A;  4A99 A;  4ZCC A;  2AQJ A;  3SZC A;  2PGE A;  4HNC A;  4XWZ A;  2POD A;  4XXG A;  4YWO A;  3NTA A;  2BCP A;  2C7G A;  3T6C A;  1N4U A;  2EQ9 A;  4KX6 A;  3UJR A;  5G5G B;  3AYI A;  3UTH A;  1ZMC A;  4A6N A;  3NYE A;  3GWF A;  2XLR A;  3C4N A;  4APN A;  2XYO A;  1N1P A;  4H2R A;  4C3Y A;  3CGD A;  3VR9 A;  3ABV A;  3V5C A;  1LVL A;  1JDF A;  2WQY A;  1GTE A;  1JRP A;  3C4A A;  1OJD A;  1E1L A;  3AE2 A;  5KOW A;  5BUL A;  1K4Q A;  3NNE A;  2R46 A;  4DN1 A;  4GDP A;  3NYC A;  4H4Y A;  2XFN A;  3DES A;  4OPT A;  3HYV A;  3H70 A;  1RSG A;  3H8A A;  2Q0K A;  3NVV B;  1B4V A;  4YT0 A;  1GXF A;  2E5V A;  3NXL A;  4O5Q A;  2OQY A;  1H83 A;  1L9C A;  3AYJ A;  1FHU A;  3VFC A;  1VQW A;  3RP6 A;  4GCM A;  3AE8 A;  4K7Z A;  3CMM A;  3SX6 A;  2PP0 A;  1CJ2 A;  3NYF A;  3GYX A;  2QAE A;  2YR6 A;  1OJA A;  5KMQ A;  3T37 A;  2Z5X A;  2X3N A;  4IT1 A;  2BXS A;  3R07 C;  4E5T A;  4KPL A;  1P2E A;  1Q1W A;  2YAU A;  3FV9 A;  4K8G A;  3ALM A;  3ETR B;  5IPY A;  3KKJ A;  5KOX A;  1X2H A;  3URH A;  3AEE A;  3EAN A;  3DEQ A;  4E8G A;  4BJZ A;  4E4F A;  1X2G A;  1TDO A;  2GVC A;  1GRB A;  3BOX A;  4RG3 A;  1PDY A;  1COY A;  4U8I A;  1SB3 B;  1TDE A;  4A79 A;  3GSI A;  3JZU A;  5HXI A;  3D47 A;  3VQR A;  4G8T A;  2GH5 A;  3AD9 B;  3NIX A;  2IVE A;  2GGI A;  2GGJ A;  1KDG A;  2XH4 A;  4YSY A;  4TVY A;  3T2Z A;  1EL7 A;  3S5S A;  3PFR A;  2OAM A;  4YSX A;  2WHD A;  4DSH A;  2AL2 B;  1GPE A;  2FJE A;  2BRA A;  3LXD A;  2RGH A;  3AMZ A;  4RSL A;  1SJD A;  2OZ3 A;  1F3P A;  3SZ0 A;  3H8I A;  2JKC A;  1BKH A;  3TTE A;  1TDN A;  3AEA A;  3DFY A;  2C64 A;  1TDF A;  2PPG A;  2BXR A;  2O56 A;  3DK9 A;  4MJW A;  4NWZ A;  1DXL A;  3B6D A;  4H2Q A;  1W4X A;  3DJG X;  5M10 A;  1F8S A;  2PMQ A;  3S5W A;  1L9D A;  2QDD A;  3P4P A;  4M52 A;  4NNJ A;  1S3B A;  4Y4M A;  2BRY A;  4I58 A;  4Y4N A;  1GND A;  3SJN A;  3NFU A;  1EC8 A;  1VDV A;  3RR1 A;  1CJ3 A;  4LA1 A;  3IWA A;  3STP A;  2XH7 A;  4H4Z A;  3UXK A;  4GME A;  2PTW A;  5ER0 A;  2X8G A;  2W3S A;  3KD9 A;  1TYT A;  1V97 A;  3AE1 A;  1NAA A;  4M6U A;  1NU5 A;  1EC9 A;  3R11 A;  4GF7 A;  1KD0 A;  3RRA A;  1JEH A;  2QJJ A;  3CNP A;  1RVK A;  4GYP A;  3G5R A;  4JY2 A;  2X8C A;  4EWJ A;  5U25 A;  3OTR A;  1V59 A;  4ECH A;  1DOB A;  5FJU A;  4EM3 A;  2GR0 A;  3AYL A;  1F8W A;  3IJQ A;  1SJA A;  3HZL A;  1P43 A;  3AE4 A;  4B1B A;  4B66 A;  1NHQ A;  4O5U A;  2QVH A;  3LB8 A;  1ZKQ A;  2GAH B;  3C96 A;  3OZM A;  4Z25 A;  1S7M A;  2C73 A;  3UP5 A;  4JNQ A;  5IDZ A;  2DW6 A;  2FJA A;  2HXT A;  3UOV A;  2BAC A;  2AL2 A;  1JU2 A;  1RM6 B;  4CCQ A;  3H7V A;  3S47 A;  3DGB A;  3NG7 X;  4ZCD A;  2VQB A;  3FVD A;  1IUS A;  5DBJ A;  4DX3 A;  3PWG A;  3N4F A;  3SZW A;  4EQR A;  3QLD A;  1BKW A;  1ONE A;  1DOE A;  4CBQ A;  4USR A;  2Z5Y A;  3EKG A;  1H84 A;  2GR1 A;  2FBW A;  3VR8 A;  2W54 A;  3V4B A;  4A65 A;  4EIQ A;  3EEZ A;  4GRT A;  1PBB A;  2GQF A;  4DXK A;  2VRL A;  3I6E A;  1MUC A;  1EBH A;  3ZLG A;  2V6O A;  1FEC A;  1M6I A;  5IQ1 A;  4OPI A;  2QA1 A;  4U8P A;  2YR5 A;  4J2W A;  1WYG A;  2QCU A;  5KWF A;  1KNR A;  1D7L A;  2C3D A;  4U8L A;  4REK A;  3UKF A;  2XGZ A;  2R4J A;  3EAO A;  4JQ9 A;  3P4Q A;  2WU2 A;  2PP1 A;  3P4R A;  1F6M A;  3G5Q A;  4OPL A;  4MGG A;  2ZBW A;  2X8H A;  1E7P A;  2V61 A;  3QJ4 A;  2B9X A;  2PS2 A;  2WDR A;  4AP1 A;  2ZZB A;  3DGH A;  3GWD A;  4II3 A;  1B37 A;  1LQT A;  3OP2 A;  3UOX A;  1ZY8 A;  3NK2 X;  3UJS A;  3SY4 A;  1EL8 A;  3CGC A;  2E4G A;  1IUV A;  2GDQ A;  1PXA A;  2DKH A;  5EB5 A;  2E3T A;  3T2K A;  3BJS A;  3QKE A;  3QVP A;  4RG4 A;  3TJI A;  5FS8 A;  1R6W A;  3IHG A;  2BK4 A;  4U8J A;  1JNR A;  3H8L A;  4H2P A;  3SYI A;  2ZZC A;  1QJD A;  5GRT A;  1F8R A;  4Z26 A;  3ZLH A;  1PBC A;  1CC6 A;  3VDG A;  3UXL A;  2APG A;  4B69 A;  1K0I A;  4JHM A;  4Z24 A;  3COX A;  4UDQ A;  3NVY B;  1S3E A;  3R0U A;  3ZYX A;  3DIP A;  2B9W A;  5L46 A;  3CPJ G;  4BK2 A;  1JPD X;  1PHH A;  2WOW A;  2WPC A;  3GY1 A;  4A35 A;  2NPX A;  1H7X A;  2OLN A;  1BQG A;  5FS7 A;  2YVJ A;  1JNZ A;  2OVL A;  2XH0 A;  2AL1 A;  1VG0 A;  3K7Q X;  4B64 A;  4H1Z A;  2PTZ A;  3UKH A;  4GAV A;  1KKR A;  2YVF A;  2P8C A;  2BAB A;  4FP1 A;  4J57 A;  2OX4 A;  1UKV G;  1MOK A;  2ONE A;  1FIQ B;  3NH3 X;  3FYY A;  5CQF A;  3OC4 A;  3RO6 A;  4AT0 A;  2OQH A;  3I3L A;  3FXG A;  4J36 A;  2GB0 A;  1YY5 A;  1DJN A;  4X4J A;  4TM4 A;  3OW1 A;  2MUC A;  2V3B A;  1B8S A;  1GV4 A;  3NK1 X;  1Y0P A;  1R0M A;  3MSY A;  3M13 A;  5C2T A;  4BK3 A;  3HRD C;  1XPY A;  4H4P A;  3LJP A;  3UKP A;  1ZOV A;  4YTM A;  3WE0 A;  2GF3 A;  3K7T A;  3V76 A;  1PBE A;  1N62 C;  4U8M A;  2HZG A;  2YLX A;  3P4S A;  3MKC A;  1N4V A;  1FFU C;  3UOZ A;  4YTN A;  2EQ7 A;  1E1M A;  4G6G A;  3NTD A;  3N6H A;  3D1C A;  3DJJ A;  2CFY A;  1YQ3 A;  1P2H A;  2C4C A;  4DSG A;  2RGO A;  3ZDN A;  3P1W A;  5KVI A;  4PAA A;  2PA6 A;  5M0Z A;  4ADW A;  1FEB A;  1H7W A;  2GGE A;  2VVL G;  3P3B A;  2XLT A;  3KUM A;  1KFY A;  4J33 A;  4JN9 A;  4C5O A;  4BUR A;  2W3R A;  1LV0 A;  2HNE A;  4ZA0 A;  5EU9 A;  4DHG A;  3DK8 A;  1LTX R;  1EC7 A;  2YG4 A;  2OAL A;  3CAW A;  3DK4 A;  3BI5 A;  3CNT A;  1AOG A;  3AM9 A;  1PJ5 A;  2WOV A;  4FK1 C;  1N4W A;  4B67 A;  3T9P A;  3PVC A; 
#chains in the Genus database with same CATH homology
 1PJ7 A;  2PYX A;  4IVM B;  3FMW A;  3VRB A;  3QSM A;  4AT2 A;  2V5Z A;  3HYW A;  4LII A;  4LA1 A;  1CJ3 A;  2WES A;  3IWA A;  5EOW A;  2ARD A;  3RP7 A;  2BC1 A;  3SQP A;  3KVE A;  1H81 A;  3LOV A;  4H4Z A;  3IHM A;  1X31 B;  5ER0 A;  1QLB A;  4U2L A;  3F8P A;  2X8G A;  1PBD A;  4CY8 A;  1M64 A;  3KD9 A;  1TYT A;  1H2I A;  2TPR A;  2UZZ A;  4EMI A;  2QA2 A;  3AE1 A;  1D4D A;  2WS3 A;  3UP4 A;  4CY6 A;  1LPF A;  3GRT A;  1NAA A;  4DGK A;  1D4E A;  3AEC A;  2BC0 A;  4U8N A;  1L9E A;  2YG6 A;  4GF7 A;  1JEH A;  1GRF A;  1Q1R A;  3CNP A;  4IVO B;  2A8X A;  4TM1 A;  4C77 A;  3G5R A;  4JY2 A;  3AE5 A;  2X8C A;  4YKF A;  3KLJ A;  1KSS A;  4P9S A;  1EL9 A;  4OVI A;  1ZP0 A;  2GMJ A;  2VOU A;  5U25 A;  3AEB A;  2H88 A;  3UKA A;  1O95 A;  1GTH A;  4D04 A;  1V59 A;  4JNA A;  3D9X A;  4K8D A;  4ECH A;  1DOB A;  2BS4 A;  2GEW A;  1NG3 A;  3BI2 A;  3AE6 A;  4EM3 A;  2GR0 A;  4FK1 A;  4G6H A;  3T2Y A;  3AYL A;  1F8W A;  1FL2 A;  5IQ4 A;  5KRQ A;  1CC2 A;  4Z2U A;  1XAN A;  3P9U A;  4HB9 A;  3HZL A;  2BK3 A;  2VRM A;  1BWC A;  3AE4 A;  3AD7 B;  1NHR A;  4B68 A;  5J60 A;  4EQS A;  4B1B A;  1CJ4 A;  3DGZ A;  1K0J A;  3FBS A;  4B66 A;  2BCG G;  1NHQ A;  1NHP A;  2XCG A;  4O5U A;  4FX9 A;  4BV6 A;  3LB8 A;  1JRY A;  3AXB A;  5HY5 A;  4OCG A;  3M0O A;  2AAQ A;  2C67 A;  3NLC A;  1E6E A;  4B63 A;  2WEU A;  4N9X A;  2CVJ A;  1ZKQ A;  1S2Q A;  1EL5 A;  2XVI A;  2GAH B;  3C96 A;  3L1R A;  4ICY A;  1S7M A;  5EBK A;  2XFQ A;  4Z25 A;  1GT8 A;  2YM1 A;  4G9K A;  2Q0L A;  5JCM A;  2C73 A;  1NEK A;  1VDC A;  3AB1 A;  2W0H A;  3GDN A;  1ZOY A;  2GAG B;  4JNQ A;  3UP5 A;  4H4V A;  2FJA A;  1TYP A;  3RNM A;  4GR1 A;  1IUU A;  1OJC A;  3UOV A;  1O5W A;  2Q6U A;  2WP9 A;  2BAC A;  1JRZ A;  2OLO A;  2NVK X;  1PDH A;  4I59 A;  1JU2 A;  1CBO A;  2RAB A;  4XWR A;  4CCQ A;  2XVJ A;  2Y6Q A;  3BHF A;  4AOS A;  4CCR A;  3L8K A;  2WU5 A;  3ICS A;  2BYB A;  3NG7 X;  4ZCD A;  4GAP A;  1K0L A;  3RP8 A;  2VQB A;  2JB2 A;  2XVF A;  3AWI A;  4YTP A;  5HYM A;  1IUS A;  5DBJ A;  2BS3 A;  4NZH A;  4OPD A;  2HQM A;  2WP5 A;  3SZW A;  4Z2T A;  4H4X A;  5C3J A;  4TM0 A;  4EQR A;  4DNA A;  1BKW A;  1BGN A;  1GSN A;  4AP3 A;  2YLR A;  4JDR A;  3DH9 A;  3BNM A;  1DOE A;  4K5R A;  4YSH A;  3SFD A;  4CBQ A;  4USR A;  2Z5Y A;  1H84 A;  2GR1 A;  3BHK A;  3GD3 A;  3QFA A;  2FBW A;  1FOH A;  1ZX9 A;  3VR8 A;  2X99 A;  5KMS A;  2WPF A;  2YLT A;  2X50 A;  3AED A;  5FS9 A;  2WP6 A;  1JOA A;  1CL0 A;  4A65 A;  1GRE A;  4EIQ A;  4GRT A;  1OJ9 A;  1PBB A;  2GQF A;  3ATQ A;  1FEA A;  2VRL A;  3AD8 B;  3ALL A;  3EPT A;  3QSS A;  4U8K A;  3K30 A;  1IUW A;  2YG7 A;  3ITJ A;  2V6O A;  2FJD A;  1FEC A;  1H6V A;  3LZX A;  3SXI A;  3CND A;  3H4K A;  5FMH A;  3M12 A;  1GRT A;  1M6I A;  2C72 A;  2WDV A;  1KF6 A;  1S2Y A;  2JAE A;  3BI4 A;  4OPI A;  2QA1 A;  4U8P A;  5IQ1 A;  2YR5 A;  4J2W A;  2RGJ A;  3CPH G;  1TRB A;  3GMB A;  5BRT A;  2VVL A;  2QCU A;  5KWF A;  1BGJ A;  4CRT A;  1KNR A;  1D7L A;  1MO9 A;  2EQ6 A;  2R4E A;  2C3D A;  5JRB A;  4U8L A;  4USQ A;  3V3N A;  3FG2 P;  1PN0 A;  4LU6 A;  4REK A;  3UKF A;  1PBF A;  2WET A;  3B3R A;  2R4J A;  2YVG A;  4A9W A;  3CGE A;  3IC9 A;  4U2T A;  3Q6J A;  3EAO A;  4JQ9 A;  1KNP A;  2OA1 A;  2YG5 A;  4K2X A;  2VZ2 A;  4J34 A;  3D8X A;  2B7R A;  1L0V A;  3P4Q A;  1GEU A;  3CNS A;  3KPF A;  5BUK A;  5J7X A;  1E1N A;  2WU2 A;  3SGL A;  2B9Y A;  3GYI A;  3HYX A;  3P4R A;  3AE9 A;  1F6M A;  1CF3 A;  3G5Q A;  4K5S A;  2IVD A;  2GQW A;  3AE3 A;  3ICR A;  4OPL A;  2ZBW A;  3CTY A;  2X8H A;  3PG6 A;  4J56 A;  1IUT A;  1E7P A;  1LQU A;  1BZL A;  2V61 A;  3F8R A;  3QJ4 A;  4A7A A;  5KXJ A;  5KNL A;  2B9X A;  2FJB A;  5U63 A;  3RHA A;  3SM8 A;  2WDR A;  4AP1 A;  2ZZB A;  3DGH A;  3DME A;  3GWD A;  4II3 A;  5GSN A;  1B37 A;  1LQT A;  2XLU A;  3I6D A;  4EIP A;  4H4Q A;  2JBV A;  3UTE A;  3UOX A;  4GDE A;  4H50 A;  2V3A A;  2C70 A;  1ZY8 A;  2XDO A;  4A99 A;  3NK2 X;  4ZCC A;  3CN8 A;  2YR4 A;  1B5Q A;  2WDQ A;  1YQ4 A;  2AQJ A;  3DJD A;  1NHS A;  3SY4 A;  1EL8 A;  3NKS A;  3CGC A;  3SZC A;  2E4G A;  1NEN A;  1IUV A;  1PXA A;  2WOI A;  4XWZ A;  2DKH A;  5EB5 A;  3T2K A;  1ZK7 A;  4XXG A;  5FS6 A;  4YWO A;  4NTC A;  4WCT A;  3NTA A;  3QVP A;  4FDC B;  1O94 A;  2Y6R A;  5FS8 A;  4RG4 A;  5EB4 A;  3BNU A;  3IHG A;  2BCP A;  2C7G A;  2BK4 A;  3K7M X;  4U8J A;  2C75 A;  3DA1 A;  4BK1 A;  1JNR A;  2YLZ A;  1IJH A;  1N4U A;  2C76 A;  3H8L A;  2R9Z A;  2EQ9 A;  3FIM B;  1IUX A;  4KX6 A;  3NRN A;  1ONF A;  3AYI A;  3UTH A;  1E39 A;  1ZMC A;  4TM3 A;  4H2P A;  4E0V A;  3F8D A;  3SYI A;  3II4 A;  2YLS A;  2B76 A;  4A6N A;  2ZZC A;  5TR3 A;  3ICT A;  4UDR A;  1QJD A;  5GRT A;  1E1K A;  1F8R A;  3NYE A;  4Z26 A;  3GWF A;  3IF9 A;  2XLR A;  2YQU A;  2GMH A;  1PBC A;  3C4N A;  4APN A;  1CC6 A;  2XYO A;  2VQ7 A;  1N1P A;  4Z43 A;  1XDI A;  2APG A;  1PXB A;  1H86 A;  4B69 A;  3NHO X;  4H2R A;  1K0I A;  4OPC A;  4C3Y A;  3CGD A;  2XLP A;  3KA7 A;  4Z24 A;  1VRQ B;  3NGC X;  3UTF A;  3COX A;  3ABV A;  1CJC A;  3VR9 A;  2JK6 A;  3AE7 A;  3NN6 X;  1SEZ A;  4UDQ A;  1LVL A;  1S3E A;  1YKJ A;  2WQY A;  1GTE A;  3ZYX A;  1TDK A;  2R0P A;  3E1T A;  2B9W A;  4H2N A;  4YXD A;  3S61 A;  4D03 A;  1PS9 A;  3L5O A;  1GAL A;  1GET A;  3AEG A;  3C4A A;  1OJD A;  3NT6 A;  2IID A;  4NTE A;  1E1L A;  4A5L A;  3AE2 A;  3CPJ G;  2CUL A;  5BUL A;  5KOW A;  1GRA A;  4TLX A;  4BK2 A;  1K4Q A;  1MXT A;  3NNE A;  1ZDL A;  4IA6 A;  2R46 A;  1PHH A;  3EF6 A;  3T0K A;  2XLS A;  2WOW A;  2WPC A;  1Y56 B;  4GDP A;  4Y4L A;  3NYC A;  2ZZ0 A;  4H4Y A;  2NPX A;  1H7X A;  3CGB A;  2XFN A;  4EQW A;  3NK0 X;  1FCD A;  4OPT A;  2XFP A;  3CPI G;  1GER A;  3HYV A;  2OLN A;  5FS7 A;  3GMC A;  3PS9 A;  4J31 A;  2YVJ A;  1RSG A;  1Z6L A;  2Q0K A;  1B4V A;  1JNZ A;  3VRA A;  2R0G A;  4YT0 A;  1JRX A;  4CNJ A;  1KN0 A;  1GXF A;  3OZ2 A;  2YG3 A;  2EQ8 A;  1VG0 A;  3K7Q X;  2E5V A;  3FPZ A;  1LJ1 A;  4B64 A;  4ZN0 A;  4O5Q A;  3UKH A;  1H83 A;  1L9C A;  3UOY A;  4GAV A;  3AYJ A;  5KMR A;  1VQW A;  2YVF A;  1EBD A;  2BAB A;  3RP6 A;  4GCM A;  4J57 A;  3AE8 A;  4NEW A;  3NN0 X;  4K7Z A;  3CMM A;  1UKV G;  1MOK A;  3SX6 A;  4IV9 A;  5JCI A;  1DOD A;  5KMP A;  2WPE A;  1ZMD A;  3NH3 X;  1CJ2 A;  3NYF A;  3GYX A;  4YKG A;  2QAE A;  2YR6 A;  3OC4 A;  1OJA A;  5CQF A;  5KMQ A;  3T37 A;  4AT0 A;  2ACZ A;  5JCL A;  3SZF A;  2Z5X A;  3UKK A;  1XPQ A;  3I3L A;  3LZW A;  1BF3 A;  4UDP A;  4II2 A;  4J36 A;  2GB0 A;  2X3N A;  1YY5 A;  4OPU A;  2BXS A;  1DJN A;  4X4J A;  2XVE A;  1P2E A;  1YQZ A;  4TM4 A;  3KU9 A;  1Q1W A;  2YAU A;  2YWL A;  3GRS A;  4PAB A;  1REO A;  2GR3 A;  4NEV A;  3UKL A;  5L46 A;  3ALM A;  3PO7 A;  2V3B A;  3O0H A;  2Q7V A;  5IPY A;  4Z2R A;  2E1M A;  3KKJ A;  5KOX A;  5U1O A;  1B8S A;  1GV4 A;  2H89 A;  3URH A;  1GRG A;  1Y0P A;  3NK1 X;  5C2T A;  3M13 A;  3AEE A;  4EQX A;  3EAN A;  2J3N A;  4JY3 A;  4BK3 A;  2C3C A;  4BJZ A;  2GRT A;  4H4P A;  1CHU A;  4YSZ A;  4BJY A;  3GYJ A;  3KPK A;  1TDO A;  3LJP A;  2GVC A;  1GRB A;  1D4C A;  3UKP A;  1ZOV A;  4YTM A;  4RG3 A;  2XVH A;  1COY A;  4U8I A;  3SFE A;  3WE0 A;  1TDE A;  4X9M A;  3VRD B;  4A79 A;  2WBA A;  3GSI A;  5HXI A;  2GF3 A;  3ISH A;  3K7T A;  3VQR A;  1PJ6 A;  2B7S A;  3V76 A;  4H4U A;  1PBE A;  2O9Z A;  3CIR A;  2GH5 A;  4U8M A;  1NG4 A;  1QO8 A;  2YLX A;  3AD9 B;  5JCN A;  3NIX A;  3P4S A;  2I0Z A;  5CKU A;  3CNJ A;  1GRH A;  4GUV A;  2JB1 A;  1N4V A;  2IVE A;  3QSE A;  4IA5 A;  3UOZ A;  4YTN A;  4EMJ A;  4A6N B;  1KDG A;  2A89 A;  4KPR A;  2EQ7 A;  4YSY A;  1GOS A;  1DJQ A;  1HYU A;  2XFO A;  1E1M A;  3T2Z A;  4G6G A;  1EL7 A;  2YLW A;  3NTD A;  5LV9 A;  2OAM A;  4YSX A;  2WHD A;  4C74 A;  2A87 A;  4DSH A;  3D1C A;  3DJJ A;  5HHF A;  2CDU A;  1DNC A;  2FJE A;  4H4W A;  1GPE A;  3AEF A;  2CFY A;  2BRA A;  4H7U A;  3LXD A;  2RGH A;  1ELI A;  2C66 A;  1YQ3 A;  4C3X A;  1P2H A;  4RSL A;  2C4C A;  4DSG A;  1Q9I A;  4X9N A;  2RGO A;  3UTG A;  1F3P A;  2DKI A;  3SZ0 A;  3H8I A;  4EM4 A;  2JKC A;  3ZDN A;  2BS2 A;  3ATR A;  2YM2 A;  3P1W A;  1TDN A;  5KVI A;  3LAD A;  3AEA A;  1NDA A;  2C64 A;  4PAA A;  1TDF A;  1OJT A;  5M0Z A;  5JCK A;  5KVH A;  4H4R A;  1Y56 A;  2BXR A;  3DK9 A;  4MJW A;  4ADW A;  2BA9 A;  3T14 A;  1FEB A;  1D7Y A;  1H7W A;  1KSU A;  3ALJ A;  4AOX A;  2VVL G;  3G5S A;  3RED A;  2BK5 A;  1PXC A;  4NWZ A;  2PHH A;  4WX1 A;  3T31 A;  1DXL A;  4HA6 A;  2XLT A;  3B6D A;  3QFB A;  4B65 A;  2AR8 A;  2TMD A;  1KFY A;  4H2Q A;  1W4X A;  1CC4 A;  2R0C A;  4OPG A;  3R9U A;  3DJG X;  4J33 A;  4JN9 A;  4C5O A;  1F8S A;  1D5T A;  5M10 A;  4Z44 A;  4BUR A;  3DJE A;  1LV0 A;  2JB3 A;  4TLZ A;  5BVA A;  4K22 A;  3DK8 A;  2XFU A;  4U8O A;  2GR2 A;  2GV8 A;  1RYI A;  1LTX R;  3GDP A;  4U2S A;  4NTD A;  3GD4 A;  3ADA B;  2YG4 A;  4H4S A;  1XHC A;  1DOC A;  2OAL A;  3S5W A;  3DK4 A;  1L9D A;  3V3O A;  3Q9T A;  3BI5 A;  2V60 A;  3CNT A;  3JSK A;  4EMW A;  1AOG A;  3P4P A;  4M52 A;  4CNK A;  4NNJ A;  1H82 A;  1PJ5 A;  4G73 A;  2WOV A;  1VG9 A;  2R45 A;  4FK1 C;  1S3B A;  3UCL A;  2C65 A;  1RP0 A;  1N4W A;  4B67 A;  4G74 A;  4Y4M A;  3QVR A;  2VVM A;  2F5Z A;  3UKQ A;  2BRY A;  4I58 A;  1NPX A;  4UP3 A;  4Y4N A;  3PVC A;  1GND A;  1GES A;  4H4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...