1NHPA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 137
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhpA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA02
2H89A 1GERA 2BA9A 2Q7VA 4CNKA 1JOAA 1ZK7A 2XFQA 2WDVA 5HXIA 2WP6A 3AE1A 3FMWA 3IF9A 4BJYA 1N1PA 3T37A 3K30A 3AE9A 1QLBA 4A99A 3KU9A 5FS9A 1KSUA 4U8IA 3LB8A 4J33A 2JB3A 3RP7A 3EPTA 3AB1A 3G5RA 3B6DA 2EQ9A 4H4PA 3AEDA 2YM2A 4UDQA 5U1OA 2VZ2A 4B69A 1YQZA 4N9XA 5BRTA 2WDRA 4TM3A 3EF6A 1NG4A 4H4YA 1O94A 2APGA 1NHPA 3DGHA 1X31B 1H7WA 1YQ3A 3V76A 2JB1A 3UKAA 5JCNA 1CJCA 3FIMB 5EOWA 2BC1A 1LTXR 1ZOYA 1GXFA 2B76A 1HYUA 4KPRA 4RG4A 1E1NA 2XDOA 1EL7A 1BGNA 1ZMCA 2R46A 4NTDA 4BK2A 3UKQA 1H7XA 2DKHA 1FCDA 3CN8A 4H2RA 1DNCA 1BZLA 2Z5XA 3NN0X 2C73A 2GAHB 4TM0A 3GRSA 2NVKX 3DA1A 4FK1A 4YSXA 1H6VA 1XHCA 4A5LA 2X8CA 2C67A 2WPEA 3C4NA 2YQUA 5IQ4A 2VRLA 2WP9A 1PXCA 3UKKA 1V59A 1KNPA 2GAGB 3ZDNA 3IHMA 1YQ4A 1F8SA 2C3CA 3ATQA 2GMJA 1SEZA 4MJWA 4OPDA 2YLXA 4WCTA 5FMHA 4H7UA 1F6MA 2C70A 1K0JA 1LJ1A 3CTYA 3M13A 3GMBA 1YKJA 2R0CA 4J36A 2QAEA 2PHHA 3DJJA 4K8DA 4H4WA 1BGJA 2A87A 2X3NA 3CIRA 2X8HA 5CQFA 3AD8B 1IUUA 2XVIA 4Z44A 3G5QA 2WOVA 1TDFA 3NNEA 2GV8A 3S5WA 3UTFA 2GR2A 4C3YA 3DJDA 1PS9A 4YT0A 3C96A 1IUWA 3AEBA 3G5SA 5IQ1A 4UP3A 3AE6A 3P9UA 2WETA 2DKIA 2YLZA 3M12A 1TRBA 3CNJA 1GRBA 4YSYA 4NEWA 2BCPA 3NHOX 3QJ4A 2EQ6A 1N4VA 2BACA 3KVEA 4PAAA 1GRFA 1E1LA 4H2NA 3UP5A 2GR3A 3DH9A 4XXGA 4EMWA 1TDKA 3VRDB 4JDRA 3AXBA 3V3NA 2R4EA 4Z43A 4OPUA 1H84A 1E7PA 3UP4A 4B67A 3D8XA 4USRA 3Q9TA 5C2TA 3GD4A 1LQTA 3LXDA 3KPFA 3GWDA 3NT6A 4ICYA 4TM4A 3DK4A 3NLCA 3UKHA 1PJ6A 2CDUA 2ACZA 1GPEA 1NG3A 1E39A 2TPRA 2FJAA 3KD9A 1VG0A 1W4XA 1E1KA 1NDAA 4UDRA 2R0PA 1BKWA 2RGHA 4EMIA 3CNDA 3AE8A 1PBCA 4U2TA 5J7XA 3VRAA 2XYOA 1F3PA 1O5WA 3COXA 4Y4NA 1Q9IA 5KRQA 2B9YA 1GRTA 4USQA 2ZZ0A 5KVIA 3AE4A 2R45A 2YLRA 3EAOA 3AD9B 2H88A 3AD7B 1DOBA 1TDEA 2OAMA 5DBJA 2BYBA 4B63A 5U25A 1DOEA 3SFDA 3ABVA 1TYTA 2C76A 4I58A 1JRZA 2YG5A 2XFOA 3NYFA 5L46A 1S2YA 1PBBA 3SQPA 4GUVA 3NKSA 4U2SA 3RNMA 1D4CA 2C3DA 4H4QA 3P4SA 4U8LA 3ZYXA 3OZ2A 3ALJA 3D1CA 4H4SA 3B3RA 3DJGX 3F8PA 5GRTA 3AWIA 4AT2A 4YKFA 3CPJG 4PABA 1CJ2A 1RSGA 1L9CA 4ZCDA 2ARDA 2VQ7A 3KLJA 3ISHA 4YWOA 1VDCA 2BCGG 4NTEA 4B64A 3K7TA 4E0VA 1FEAA 1IUSA 1JRYA 2WOWA 3CGBA 3AEFA 3BNUA 4GDPA 2C7GA 4TM1A 4YSHA 3GYJA 1F8WA 4EQSA 4WX1A 2Q0LA 4JQ9A 3CPHG 3GYIA 4U8OA 1CHUA 4O5UA 3BHFA 1CC4A 2B7SA 4B65A 2GH5A 2Y6QA 1KSSA 2YG4A 3AYJA 4X4JA 3RHAA 2CULA 2YG3A 1K4QA 1PHHA 4I59A 4UDPA 1N4UA 2WU2A 4YTNA 3NN6X 1MO9A 1B4VA 1GRAA 4JY2A 1IUTA 3LJPA 2X8GA 1GSNA 1PBFA 4LU6A 1VQWA 1GNDA 4JY3A 2E5VA 3EANA 1PDHA 5EB4A 3R9UA 2IIDA 2YR5A 2YLWA 2BABA 3CGDA 1IJHA 2GVCA 4IA6A 1D5TA 2GRTA 3SFEA 2WU5A 4FX9A 4A9WA 1D7YA 4EQRA 1XANA 3SGLA 2AAQA 5CKUA 1FECA 3II4A 4BURA 1H86A 1OJ9A 3KA7A 3NTAA 5JCMA 1TDNA 4GCMA 4IA5A 4U8PA 4H4UA 1D7LA 1DXLA 1CC2A 2BXRA 2VVLA 4B66A 2J3NA 1VG9A 2ZZCA 3OC4A 1S3EA 3AYLA 4FK1C 2WPFA 4LIIA 1BF3A 1IUVA 2BS2A 4K7ZA 3DGZA 2WESA 5M10A 2XLTA 3S61A 4J34A 1Z6LA 3HZLA 2YLSA 1NEKA 2RGOA 4J31A 2BC0A 4O5QA 3RP6A 4H4RA 4DSGA 2ZZBA 1PXBA 2F5ZA 2WS3A 4NZHA 3UOXA 4H4ZA 1K0IA 3UCLA 2BK4A 3URHA 4JNQA 1B37A 1NHQA 1NHSA 5U63A 2XCGA 4U2LA 3AEAA 3CNSA 1GEUA 2VOUA 3H8LA 3WE0A 3P4PA 2B7RA 3GD3A 3VQRA 1Q1RA 3ICTA 3LADA 2WPCA 2WBAA 2VRMA 2FJBA 1GRHA 4YTMA 4D04A 1RYIA 3NK2X 1UKVG 2XVJA 4KX6A 4OPLA 3M0OA 4H2QA 4TLXA 3NYCA 3FBSA 4IVOB 1H83A 1GREA 4A7AA 3QFBA 2JBVA 1LV0A 2VVLG 1CBOA 1KDGA 3NRNA 1IUXA 1PJ7A 3NK1X 5BUKA 5FS8A 1D4DA 1ZOVA 4GR1A 2AR8A 1JNRA 2UZZA 2GR1A 1RP0A 4OVIA 3ICSA 4Y4LA 1DJNA 4LA1A 3L1RA 1GALA 4A6NA 5KOXA 4OPIA 3I3LA 1FL2A 3BHKA 4U8MA 3SM8A 3ATRA 4IVMB 4XWZA 5ER0A 5FS6A 3LZWA 3NIXA 3UOYA 4Z25A 3GDPA 1KF6A 2B9WA 1NHRA 1REOA 2YVJA 2A89A 1JEHA 4EQWA 1E6EA 4YSZA 1TYPA 3LZXA 2X50A 1L9DA 4J57A 4DGKA 1MXTA 3AYIA 3C4AA 3BNMA 4IV9A 3H4KA 2YG7A 3P4QA 4H4VA 2XVEA 4EMJA 2X99A 5TR3A 4U8KA 3NG7X 4EQXA 3Q6JA 4CCRA 2GQWA 1JNZA 1PJ5A 1ZDLA 5BVAA 4OPCA 1NPXA 3V3OA 3CNPA 3NK0X 1K0LA 3KKJA 4H4TA 1OJAA 3AE3A 3BI2A 1O95A 2V61A 2GF3A 4B68A 1H82A 2HQMA 3E1TA 4ZCCA 2BS3A 1B5QA 4AP1A 5EBKA 3AEGA 2YWLA 4K2XA 2BXSA 4Z2UA 3F8DA 1AOGA 5KXJA 2BS4A 4JN9A 1GTEA 4NTCA 2FJDA 4GF7A 1PBEA 1COYA 2EQ7A 1QJDA 2GMHA 1EBDA 2V3BA 3CGCA 1TDOA 4K5SA 4A6NB 4BK1A 1E1MA 3NH3X 4REKA 3PO7A 5J60A 1FOHA 4C77A 4DSHA 2JKCA 2OA1A 3AE5A 3P1WA 3QFAA 3P4RA 2VQBA 1PXAA 5KWFA 4D03A 2WHDA 2C64A 1DOCA 2C72A 2GB0A 3K7QX 4AOXA 4CNJA 4J2WA 1D4EA 2C75A 1LVLA 2V5ZA 3QSSA 4CBQA 2IVDA 3VR8A 2E4GA 4P9SA 2EQ8A 3CGEA 1Q1WA 2JB2A 3NTDA 3IC9A 3DK9A 3AE2A 3BI5A 1OJTA 1BWCA 3FPZA 2R4JA 3ADAB 4OPGA 2QCUA 2FBWA 2JK6A 1CC6A 2V60A 4X9NA 4H4XA 2XVHA 4ADWA 1DODA 1Y56A 2Q6UA 3UTEA 2TMDA 2GEWA 3QSEA 4ZN0A 5BULA 4U8NA 3CPIG 5KOWA 1PBDA 4YKGA 2RGJA 4CY6A 3ICRA 1KFYA 2FJEA 2WP5A 1VRQB 4AP3A 4CRTA 1XPQA 3K7MX 1JRXA 4H50A 3NYEA 4K22A 1L9EA 2E1MA 2C65A 2QA1A 1GTHA 4HB9A 4YXDA 4Z2RA 2WOIA 1CJ3A 1OJDA 4U8JA 4EIQA 1QO8A 2YLTA 5GSNA 2OLOA 3ALMA 2V6OA 1ELIA 4A65A 3ALLA 3H8IA 1ONFA 1EL5A 3QVRA 2WEUA 3PS9A 4CY8A 1GV4A 2Z5YA 2XLUA 1ZP0A 5JCKA 1N4WA 1P2EA 2O9ZA 2AQJA 2ZBWA 3AECA 1OJCA 1GT8A 2YG6A 2WDQA 2QA2A 1ZY8A 2XFPA 2CFYA 4Z24A 5IPYA 5FS7A 1M6IA 4K5RA 5HYMA 3UKLA 4GRTA 2OLNA 3UKFA 2WQYA 2YVGA 4M52A 3AE7A 3AEEA 3VR9A 4B1BA 1LPFA 2PYXA 1FEBA 1F8RA 1DJQA 1NENA 1GOSA 2GQFA 1JU2A 2A8XA 4EM3A 1CL0A 1Y56B 2CVJA 1ZMDA 2R0GA 4GDEA 5EB5A 3PVCA 4Z26A 5KVHA 4APNA 4HA6A 5JCLA 3ITJA 2XLPA 1XDIA 1GRGA 3UKPA 3F8RA 2W0HA 3LOVA 4Y4MA 4NEVA 3GRTA 2YM1A 2B9XA 3IHGA 3L8KA 4JNAA 4RSLA 1ZX9A 3DJEA 1H81A 4TLZA 4X9MA 1KNRA 4Z2TA 3RP8A 3UTGA 4EM4A 1NAAA 5C3JA 3GMCA 4YTPA 1EL9A 2IVEA 2V3AA 2VVMA 4EIPA 2NPXA 4C5OA 2JAEA 2C66A 4FDCB 5HHFA 1P2HA 3UTHA 4ECHA 1Y0PA 2XFUA 4A79A 5HY5A 4BV6A 4XWRA 4CCQA 1ZKQA 1CJ4A 3GWFA 3REDA 2XFNA 2XLRA 3VRBA 4OCGA 4AT0A 1GESA 3FG2P 2RABA 2I0ZA 3QVPA 4C74A 2YR6A 5M0ZA 5JCIA 2YVFA 1B8SA 2BK5A 4J56A 1PN0A 2BK3A 2XVFA 3JSKA 3DK8A 3QSMA 2OALA 4BJZA 3GSIA 4H2PA 2XLSA 1M64A 3UOVA 1GETA 1EL8A 4RG3A 3UOZA 4OPTA 1MOKA 1S3BA 3BI4A 3I6DA 3O0HA 1YY5A 2Q0KA 4DNAA 5LV9A 3NGCX 3CNTA 1L0VA 3IWAA 4C3XA 1S2QA 2Y6RA 4BK3A 3DMEA 1LQUA 3GDNA 2R9ZA 2YAUA 1CF3A 4AOSA 2GR0A 2YR4A
chains in the Genus database with same CATH superfamily
1EC8A 2WP6A 3MZNA 3AE9A 1QLBA 3KU9A 5FS9A 2GSHA 4J33A 2JB3A 3SN1A 3EPTA 2PP3A 3AB1A 3G5RA 3B6DA 3EF6A 2XH4A 1NHPA 2OZTA 4FP1A 3S47A 2JB1A 5JCNA 1N63C 1CJCA 3RCYA 1BGNA 4NTDA 4KWSA 1H7XA 1FCDA 4H2RA 1BZLA 3NN0X 2C73A 4FK1A 3C4NA 2YQUA 2VRLA 4K1WA 1FO4A 1BQGA 3ATQA 4GGHA 3EEZA 3H8AA 2YLXA 1F6MA 3VCNA 2W3SA 3M13A 2HZGA 1YKJA 2QAEA 2PTXA 3DJJA 4K8DA 3NS1B 2X8HA 5CQFA 4G8TA 1TDFA 4DWDA 3S5WA 2GR2A 2PMQA 3AEBA 5IQ1A 3SZFA 3AE6A 3P9UA 3M12A 1SJDA 2BCPA 3HPFA 1E1LA 2PP1A 4XXGA 3VRDB 3MSYA 1EC9A 3AXBA 4G9KA 2CHRA 4KT2A 1JDFA 4B67A 3SXIA 3R0UA 4HCLA 3Q9TA 3KPFA 1KKRA 2HXTA 1VG0A 2R0PA 1BKWA 3UJRA 3CNDA 3N6HA 2XYOA 1F3PA 1RVKA 1GRTA 4USQA 5KVIA 2R45A 1DOBA 1TDEA 5DBJA 4B63A 2QVHA 2YG5A 2XFOA 3TJ4A 1S2YA 4GUVA 3NKSA 2AL1A 1D4CA 3V4BA 5J04A 3D1CA 5GRTA 5ENLA 3CPJG 4YWOA 3R07C 4NTEA 4B64A 3ENLA 3K7TA 3NXLA 3AEFA 3CGBA 4TM1A 4YSHA 3GO2A 4WX1A 3CPHG 1CHUA 4IZGA 4O5UA 3BHFA 4HCDA 1CC4A 3AYJA 4X4JA 1N5WC 2YG3A 3N4FA 4JY2A 3NVZB 1VQWA 2YLWA 1KCZA 3CGDA 4NWZA 3T14A 1IJHA 2I5QA 1D5TA 4A9WA 3SGLA 3NVWB 3KA7A 1TDNA 3P93A 1D7LA 1DXLA 4B66A 1VG9A 2ZZCA 4G6HA 2OO6A 2NQLA 5M10A 3SX6A 3RITA 3HZLA 2BC0A 4DSGA 2WS3A 4NZHA 3CAWA 1K0IA 1NHQA 1NHSA 2XCGA 3AEAA 3CNSA 3H8LA 1MNSA 1N61C 2WPCA 2WBAA 3D47A 1KKOA 1L8PA 3M0OA 3NYCA 4IVOB 3JVAA 1KDGA 1IUXA 2BRYA 5FS8A 4OVIA 3ICSA 3TTEA 3L1RA 4A6NA 5KOXA 3ES7A 3I3LA 5ER0A 4GYPA 4GAVA 2P0IA 1REOA 4YSZA 1KD0A 2X50A 1MXTA 3C4AA 2O56A 2XVEA 5TR3A 4U8KA 1PJ5A 3CK5A 1ZDLA 2QJNA 1SJCA 3V3OA 3CNPA 2OQHA 3CT2A 4F4RA 3HRDC 2HQMA 3E1TA 5EBKA 5KXJA 1GTEA 2FJDA 4GF7A 2XH0A 4REKA 3AE5A 3P4RA 1PXAA 4D03A 2POZA 3K7QX 4AOXA 3U4FA 4CBQA 2E4GA 2EQ8A 4IL0A 3AE2A 3B97A 3FPZA 3ADAB 3FYYA 5FJUA 3FCPA 2FBWA 2PS2A 2XVHA 3NO1A 1DODA 3QTPA 1Y56A 3UTEA 2TMDA 2GEWA 3QSEA 3CPIG 3OZMA 5KOWA 4YKGA 4J1OA 3VFCA 3NYEA 2E1MA 5G5HB 5BOEA 1GTHA 4Z2RA 1CJ3A 4HCHA 2OLOA 2V6OA 1R0MA 4A65A 3H8IA 3PS9A 4DN1A 5JCKA 3TJIA 1F9CA 1FHVA 3AECA 1YEYA 2YG6A 4GAPA 5IPYA 4Z24A 3UJFA 5FS7A 1M6IA 4GRTA 2OLNA 3UKFA 2YVGA 3AEEA 2PYXA 1FEBA 1F8RA 3T4WA 4EM3A 2OKTA 2CVJA 4Z1YA 1ZMDA 3RR1A 5EB5A 3PVCA 4HA6A 3ITJA 1ECQA 2GGIA 3UKPA 3LOVA 4RSLA 1ZX9A 1H81A 2GGGA 3SJNA 3EKGA 2V3AA 2VVMA 3SQSA 3UJEA 4ECHA 1P2HA 1Y0PA 1T3QC 4Z17A 2XLRA 3VRBA 4OCGA 3QKEA 3IJQA 1JPDX 2I0ZA 2PTWA 4C74A 5JCIA 2OX4A 2BK5A 2BK3A 3QSMA 2OALA 3GSIA 3UOVA 1GETA 1S7MA 1EL8A 3R1ZA 3BI4A 3ZLHA 3NGCX 2Y6RA 2YAUA 3DGBA 5KMQA 4AOSA 2H89A 1GERA 1ZK7A 2XFQA 4H19A 2WDVA 3NFUA 3AE1A 3FMWA 3IF9A 4BJYA 4A99A 1KSUA 3UCCA 4ROPA 3AEDA 1YQZA 4N9XA 4TM3A 1NG4A 2OZ8A 3DGHA 2W54A 1FHUA 3EUB3 1YQ3A 4G6GA 4E5TA 3FIMB 1ZOYA 1HYUA 1E1NA 2XDOA 1EL7A 2PPGA 4BK2A 4MGGA 2DKHA 3N6JA 4TM0A 3GRSA 2NVKX 1P43A 4YSXA 1H6VA 3H12A 2C67A 5IQ4A 4IP5A 3A7RA 1PXCA 3UKKA 4H83A 3IHMA 4EWJA 2C3CA 2E5AA 3CTYA 1N62C 3A7UA 3GMBA 2PHHA 2A87A 2X3NA 2DW6A 3AD8B 1IUUA 3HYXA 2WOVA 3SN0A 4C3YA 4YT0A 1IUWA 4UP3A 3THUA 3CNJA 2EQ6A 2BACA 4PAAA 2P3ZA 4H2NA 2GR3A 3MQTA 1TZZA 3HW2A 4GMEA 5KMSA 4H2HA 2R4EA 4Z43A 1H84A 1E7PA 3D8XA 2QGYA 3DK4A 3UKHA 4ZA0A 2ACZA 1GPEA 1N60C 1E1KA 1NDAA 4EMIA 4Y4NA 5KRQA 2B9YA 3AMZA 3AD9B 3EAOA 2XGZA 3SFDA 4II3A 1TYTA 2C76A 4I58A 1JRZA 1PBBA 1PDYA 2C3DA 3CXOA 2OZ3A 3OZ2A 3ALJA 3F8PA 3DJGX 3AWIA 4AT2A 3A7AA 4PABA 3STPA 2VQ7A 3ISHA 1VDCA 4E0VA 1FEAA 3BSMA 3TWAA 4EQSA 2B7SA 2W3RA 2GH5A 2Y6QA 1KSSA 2YG4A 3ZLGA 1PHHA 4UDPA 3KPKA 1N4UA 2WU2A 1GRAA 3LJPA 3I6TA 1GNDA 4JY3A 3EANA 5EB4A 2QDDA 2IIDA 3GD6A 2P8CA 1STZA 4IP4A 4IA6A 4FX9A 7ENLA 1XANA 2AAQA 1SJBA 3NTAA 5JCMA 4H4UA 4M6UA 1CC2A 1ONEA 2WPFA 1BF3A 4GISA 4K7ZA 3DGZA 2WESA 2XLTA 3DERA 3V5FA 1NEKA 2YLSA 4J31A 4O5QA 4H4RA 5G5GB 1PXBA 4H4ZA 3UCLA 3URHA 5U63A 4U2LA 3P4PA 3GD3A 3T8QA 3TOYA 3ICTA 2OVLA 2VRMA 2FJBA 4YTMA 3NK2X 4OPLA 3UXLA 1JPMA 1CBOA 1PJ7A 1D4DA 1ZOVA 3PWIA 1JNRA 3BHKA 3UOYA 3GDPA 2B9WA 1NHRA 5IDZA 2YVJA 4EQWA 1E6EA 3PWGA 1TYPA 4J57A 3AYIA 2P8BA 3SSZA 3P4QA 4EMJA 2X99A 4E6MA 3Q6JA 4CCRA 1JNZA 3KKJA 2HXUA 4H4TA 3B9JB 3NRZB 4ZCCA 2BS3A 4II2A 4AP1A 4Z2UA 2BXSA 1MUCA 4NTCA 1PBEA 3CGCA 1TDOA 4K5SA 4FI4A 4A6NB 4BK1A 3NH3X 4C77A 3Q45A 2WHDA 2C72A 1WUFA 3RGTA 4J2WA 5FJOA 1D4EA 2V5ZA 1LVLA 3QSSA 2IVDA 3VR8A 4P9SA 3OPSA 3NTDA 3BI5A 2QJJA 1OJTA 1BWCA 3UJSA 2V60A 4X9NA 4ADWA 2W55A 3V3WA 4ZN0A 5BULA 1PBDA 3ZVIA 2RGJA 4ENLA 2FJEA 3CMMA 2WP5A 4AP3A 1L9EA 2C65A 4YXDA 4EIQA 3CB3A 1QO8A 4TVWA 1EL5A 1VDVA 2ZBWA 2CFYA 3ETRB 1FIQB 3UKLA 2WQYA 3VR9A 1DJQA 1NENA 1Y56B 3GY1A 4E4FA 4GDEA 4Z26A 3SBFA 5KVHA 3T9PA 5JCLA 2XLPA 1XDIA 2OFJA 3F8RA 4Y4MA 2P88A 4NEVA 1NU5A 2YM1A 3IHGA 3DJEA 4TLZA 4Z2TA 3RP8A 1NAAA 3GMCA 4YTPA 2NPXA 4C5OA 1X2GA 5HHFA 2XFUA 3Q4DA 4DYEA 3GWFA 1WYGA 2XFNA 4AT0A 1EBHA 2XH7A 3SR6B 3QVPA 5M0ZA 4J56A 3DK8A 4J3ZA 4BJZA 1M64A 2PGWA 3I6DA 3O0HA 3OP2A 3JW7A 1L0VA 2XVJA 3TWBA 2BA9A 3V5CA 2Q7VA 4CNKA 1N1PA 4U8IA 3NVYB 5U1OA 2VZ2A 4B69A 3FV9A 4ZCWA 1O94A 1TKKA 2PP0A 1X31B 3I6EA 1H7WA 3DDMA 2C4CA 3V76A 1RM6B 3OZYA 2B76A 1EC7A 1ZMCA 3TCSA 3VC5A 1XHCA 4A5LA 2X8CA 2WPEA 4G74A 3UXKA 3P0WA 1V59A 1KNPA 3ZDNA 2GMJA 4MJWA 4OPDA 5FMHA 4H7UA 2C70A 4YWSA 1K0JA 1LJ1A 3ZVHA 2R0CA 4J36A 4H4WA 4KPLA 1BGJA 5FJTA 3KUMA 3CIRA 2XVIA 4Z44A 6ENLA 3DJDA 3C96A 3G5SA 2ONEA 2WETA 1TRBA 1GRBA 4JN7A 4NEWA 3NHOX 1N4VA 4DX3A 3UP5A 3DH9A 2QDEA 1TDKA 4JDRA 3V3NA 4OPUA 5C2TA 3GD4A 1LQTA 3NT6A 5FJRA 3PFRA 4M0XA 3VRAA 3K1GA 1Q9IA 3HYVA 2E3TA 4GGBA 4MMWA 3AD7B 2BYBA 1DOEA 3ABVA 5L46A 1N5XA 3SQPA 2XH2A 4U8LA 3P4SA 3GYXA 4H4SA 3B3RA 4YKFA 1CJ2A 1L9CA 4ZCDA 3KLJA 3NVVB 4HN8A 3BNUA 4GDPA 2WOWA 2C7GA 3GYJA 2Q0LA 1ELSA 3GYIA 5KMRA 4B65A 1K4QA 4YTNA 1MO9A 1B4VA 1IUTA 2X8GA 1PBFA 4LU6A 3FJ4A 3R9UA 1PDHA 2OPJA 2YR5A 3AM9A 3SFEA 2WU5A 1D7YA 4A6GA 2AKZA 5CKUA 2GDQA 1H86A 4BURA 1OJ9A 4GCMA 2BXRA 3D9XA 2VVLA 2J3NA 4FK1C 1S3EA 3AYLA 3PG6A 2BS2A 4KEMA 1V97A 5JRBA 2PTZA 2RGOA 3MWCA 2ZZBA 3QLDA 3UOXA 2BK4A 4JNQA 3T31A 1B37A 1GEUA 2B7RA 1Q1RA 3IJLA 3LADA 2HNEA 4E4UA 4TLXA 1H83A 1GREA 3QFBA 2JBVA 3NRNA 3T6CA 5BUKA 2GR1A 1DJNA 4LA1A 1GALA 4OPIA 1FL2A 4U8MA 3SY4A 3SM8A 3ATRA 4XWZA 3NIXA 4Z25A 1KF6A 3AN1A 3LZXA 3MY9A 4JHMA 1L9DA 4IHCA 1H2IA 3BNMA 4H4VA 3FXGA 3PK7A 1K0LA 1OJAA 3AE3A 3BI2A 2V61A 1H82A 3MUCA 3VDGA 2AL2A 1NELA 4HNLA 3N4EA 3T0KA 3AEGA 4K2XA 2YWLA 4JN9A 2GMHA 2EQ7A 1QJDA 5J60A 1FOHA 2JKCA 3P1WA 2VQBA 5KWFA 2C64A 4JN8A 1P48A 3TW9A 4GIRA 2JK6A 1CC6A 1E9IA 4A3RA 4U8NA 2MUCA 4CY6A 1VRQB 3K7MX 4K22A 4G73A 3DFYA 2WOIA 1WUEA 1OJDA 4U8JA 5GSNA 3ALMA 1ELIA 3ALLA 1ONFA 3QVRA 2WEUA 2Z5YA 1JRPA 2XLUA 3FVDA 2GL5A 2AQJA 1OJCA 1GT8A 5HYMA 3AE7A 4B1BA 2GQFA 1JU2A 1VQZA 4APNA 1SB3B 2W0HA 2B9XA 3T2KA 3P3BA 3SN4A 4JNAA 3UTGA 5C3JA 1EL9A 2IVEA 3H70A 1MRAA 2C66A 3RRAA 4A79A 2ZADA 4BV6A 4CCQA 1ZKQA 1CJ4A 3REDA 3DFHA 3VC6A 2RABA 2YR6A 4GYPC 2YVFA 4HNCA 3JSKA 2GGJA 3T2ZA 3DESA 3L5OA 3UOZA 4OPTA 3CXBA 1YY5A 2Q0KA 4DNAA 3CNTA 1EBGA 3SZCA 3NZGA 3DMEA 3GDNA 2R9ZA 3IJIA 3SZWA 1CF3A 1ZXIC 2XLSA 3DIPA 1JOAA 3BJSA 5HXIA 3T37A 3K30A 4NNJA 3UJ2A 3LB8A 3RP7A 2EQ9A 4H4PA 4UDQA 2YM2A 5BRTA 2WDRA 4H4YA 2APGA 3UKAA 5EOWA 2BC1A 1LTXR 1GXFA 4KPRA 4RG4A 3S5SA 2R46A 3UKQA 3CN8A 1DNCA 2Z5XA 2GAHB 3DG3A 3DA1A 4TVYA 4G7FA 2BRAA 2FYMA 4K8GA 2WP9A 5BOFA 2GAGB 1YQ4A 1F8SA 4HYRA 4H1ZA 1SEZA 4WCTA 2ZC8A 4DHGA 4MKSA 3OW1A 4ZOHB 1TE6A 3G5QA 3NNEA 2GV8A 3UTFA 1PS9A 2DKIA 2YLZA 2MNRA 4YSYA 3QJ4A 4E8GA 3KVEA 1GRFA 2QJMA 3ES8A 4EMWA 2DW7A 2PU0A 1KN0A 3UP4A 1PDZA 4USRA 3LXDA 3GWDA 4ICYA 4TM4A 3NLCA 1PJ6A 2CDUA 1MDRA 3ZVHB 1NG3A 1E39A 2TPRA 2PODA 1JROA 2FJAA 3KD9A 1W4XA 4UDRA 3RO6A 2RGHA 3AE8A 1PBCA 4U2TA 5J7XA 3QN3A 1O5WA 4IT1A 3COXA 2RDXA 2ZZ0A 3AE4A 1XS2A 2YLRA 2H88A 2OAMA 1X2HA 5U25A 3NYFA 3BOXA 4U2SA 3RNMA 4H4QA 3OTRA 3ZYXA 2AKMA 1RSGA 3D46A 2ARDA 2BCGG 1IUSA 1JRYA 1MDLA 1JCTA 1F8WA 3GC2A 4JQ9A 4U8OA 1DTNA 1SJAA 3RHAA 2CULA 4I59A 3DG7A 3NN6X 1GSNA 5FJPA 2E5VA 3U9IA 4X2PA 2PCEA 2BABA 2GVCA 2GRTA 3VA8A 3HYWA 4EQRA 2PGEA 1FECA 3II4A 2PU1A 3JZUA 3IK4A 3MKCA 4IA5A 4U8PA 2OG9A 3OC4A 4LIIA 1IUVA 3S61A 4J34A 1Z6LA 2FKPA 3RP6A 2F5ZA 3TQPA 2VOUA 3WE0A 3VQRA 1GRHA 4D04A 1RYIA 1UKVG 4KX6A 3VCCA 4H2QA 3FBSA 4A7AA 3SYIA 1LV0A 2VVLG 1XPYA 3NK1X 2UZZA 2AR8A 4GR1A 1RP0A 4Y4LA 4IVMB 5FS6A 3LZWA 3ZLFA 2A89A 1JEHA 4K2SA 4DGKA 4IV9A 3H4KA 5EU9A 2YG7A 3CYJA 3NG7X 4EQXA 2GQWA 3R0KA 2QQ6A 3QPEA 5BVAA 1R6WA 4OPCA 1NPXA 3NK0X 1O95A 4B68A 2GF3A 1B5QA 3F8DA 1AOGA 2BS4A 5KNLA 1FFUC 2PA6A 1COYA 2PSNA 1EBDA 2V3BA 1E1MA 3PO7A 4DSHA 2OA1A 3QFAA 2GB0A 1DOCA 4CNJA 2C75A 1W6TA 3CGEA 1Q1WA 2JB2A 3IC9A 3DK9A 3DG6A 2R4JA 4OPGA 2QCUA 4H4XA 2Q6UA 3R10A 2PTYA 2OLAA 4HPNA 2AL2B 3UGVA 3ICRA 1KFYA 2GGHA 4CRTA 1XPQA 3UCDA 1JRXA 4H50A 1OEPA 2QA1A 4HB9A 1BKHA 3I4KA 2OQYA 2YLTA 1FFVC 4CY8A 1GV4A 1ZP0A 1N4WA 1P2EA 2O9ZA 4IL2A 2WDQA 2QA2A 1ZY8A 2XFPA 4A35A 3H7VA 4K5RA 4M52A 1LPFA 1GOSA 2A8XA 1CL0A 2R0GA 3T2YA 1GRGA 3SZ0A 2XSXA 3GRTA 3L8KA 4X9MA 1KNRA 4EM4A 1IYXA 4EIPA 2JAEA 4FDCB 3UTHA 5HY5A 4XWRA 3DEQA 1GESA 3FG2P 4GFIA 3R25A 1B8SA 1PN0A 2XVFA 4H2PA 2GGEA 4RG3A 4DXKA 3R11A 1MOKA 1S3BA 5LV9A 3IWAA 4C3XA 1S2QA 5KMPA 4BK3A 1LQUA 2GR0A 2YR4A
chains in the Genus database with same CATH topology
2H89A 1GERA 2BA9A 2Q7VA 4CNKA 1JOAA 1ZK7A 2XFQA 2WDVA 5HXIA 2WP6A 3AE1A 3FMWA 3IF9A 4BJYA 1N1PA 3T37A 3K30A 3AE9A 1QLBA 4A99A 3KU9A 4NNJA 5FS9A 1KSUA 4U8IA 3LB8A 4J33A 2JB3A 3RP7A 3EPTA 3AB1A 3G5RA 3B6DA 2EQ9A 4H4PA 3AEDA 2YM2A 4UDQA 5U1OA 2VZ2A 4B69A 1YQZA 4N9XA 5BRTA 2WDRA 4TM3A 3EF6A 1NG4A 4H4YA 1O94A 2APGA 1NHPA 3DGHA 1X31B 1H7WA 1YQ3A 2C4CA 4G6GA 3V76A 2JB1A 3UKAA 5JCNA 1CJCA 3FIMB 5EOWA 2BC1A 1LTXR 1ZOYA 1GXFA 2B76A 1HYUA 4KPRA 4RG4A 1E1NA 2XDOA 1EL7A 1BGNA 1ZMCA 2R46A 4NTDA 4BK2A 3UKQA 1H7XA 2DKHA 1FCDA 3CN8A 4H2RA 1DNCA 1BZLA 2Z5XA 3NN0X 2C73A 2GAHB 4TM0A 3GRSA 2NVKX 3DA1A 4FK1A 4YSXA 1H6VA 1XHCA 4A5LA 2X8CA 2BRAA 2WPEA 2C67A 2YQUA 3C4NA 4G74A 2VRLA 5IQ4A 2WP9A 1PXCA 3UKKA 1V59A 1KNPA 2GAGB 3ZDNA 3IHMA 1YQ4A 1F8SA 2C3CA 3ATQA 5KMQA 2GMJA 4AOSA 1SEZA 4MJWA 4OPDA 2YLXA 4WCTA 5FMHA 4H7UA 1F6MA 2C70A 1K0JA 1LJ1A 3CTYA 3M13A 3GMBA 1YKJA 2R0CA 4J36A 2QAEA 2PHHA 3DJJA 4K8DA 4H4WA 1BGJA 2A87A 2X3NA 3CIRA 2X8HA 5CQFA 3AD8B 1IUUA 2XVIA 3HYXA 4Z44A 3G5QA 2WOVA 1TDFA 3NNEA 2GV8A 3S5WA 3UTFA 2GR2A 4C3YA 3DJDA 1PS9A 4YT0A 3C96A 1IUWA 3AEBA 3G5SA 5IQ1A 3SZFA 4UP3A 3AE6A 3P9UA 2WETA 2DKIA 2YLZA 3M12A 1TRBA 3CNJA 1GRBA 4YSYA 4NEWA 2BCPA 3NHOX 3QJ4A 2EQ6A 1N4VA 2BACA 3KVEA 4PAAA 1GRFA 1E1LA 4H2NA 3UP5A 2GR3A 3DH9A 4XXGA 4EMWA 1TDKA 3VRDB 4JDRA 3AXBA 3V3NA 5KMSA 2R4EA 1KN0A 4G9KA 4Z43A 4OPUA 1H84A 1E7PA 3UP4A 4B67A 3SXIA 3D8XA 4USRA 3Q9TA 5C2TA 3GD4A 1LQTA 3LXDA 3KPFA 3GWDA 3NT6A 4ICYA 4TM4A 3DK4A 3NLCA 3UKHA 1PJ6A 2CDUA 2ACZA 1GPEA 1NG3A 1E39A 2TPRA 2FJAA 3KD9A 1VG0A 1W4XA 1E1KA 1NDAA 4UDRA 2R0PA 1BKWA 2RGHA 4EMIA 3CNDA 3AE8A 1PBCA 4U2TA 5J7XA 3VRAA 2XYOA 1F3PA 1O5WA 3COXA 4Y4NA 1Q9IA 3HYVA 5KRQA 2B9YA 1GRTA 4USQA 2ZZ0A 5KVIA 3AE4A 2R45A 2YLRA 3EAOA 3AD9B 2H88A 3AD7B 1DOBA 1TDEA 2OAMA 5DBJA 2BYBA 4B63A 5U25A 1DOEA 4II3A 3SFDA 3ABVA 1TYTA 2C76A 4I58A 1JRZA 2YG5A 2XFOA 3NYFA 5L46A 1S2YA 1PBBA 3SQPA 4GUVA 3NKSA 4U2SA 3RNMA 1D4CA 2C3DA 4H4QA 3P4SA 4U8LA 3GYXA 3ZYXA 3OZ2A 3ALJA 3D1CA 4H4SA 3B3RA 3DJGX 3F8PA 5GRTA 3AWIA 4AT2A 4YKFA 3CPJG 4PABA 1CJ2A 1RSGA 1L9CA 4ZCDA 2ARDA 2VQ7A 3KLJA 3ISHA 4YWOA 1VDCA 2BCGG 4NTEA 4B64A 3K7TA 4E0VA 1FEAA 1IUSA 1JRYA 2WOWA 3CGBA 3AEFA 3BNUA 4GDPA 2C7GA 4TM1A 4YSHA 3GYJA 1F8WA 4EQSA 4WX1A 2Q0LA 4JQ9A 3CPHG 3GYIA 4U8OA 1CHUA 5KMRA 4O5UA 3BHFA 1CC4A 2B7SA 4B65A 2GH5A 2Y6QA 1KSSA 2YG4A 3AYJA 4X4JA 3RHAA 2CULA 2YG3A 1K4QA 1PHHA 4I59A 4UDPA 3KPKA 1N4UA 2WU2A 4YTNA 3NN6X 1MO9A 1B4VA 1GRAA 4JY2A 1IUTA 3LJPA 2X8GA 1GSNA 1PBFA 4LU6A 1VQWA 1GNDA 4JY3A 2E5VA 3EANA 1PDHA 5EB4A 3R9UA 2IIDA 2YR5A 2YLWA 2BABA 3CGDA 4NWZA 3T14A 1IJHA 2GVCA 4IA6A 1D5TA 2GRTA 3SFEA 2WU5A 4FX9A 3HYWA 1D7YA 4EQRA 1XANA 3SGLA 4A9WA 2AAQA 5CKUA 1FECA 3II4A 4BURA 1H86A 1OJ9A 3KA7A 3NTAA 5JCMA 1TDNA 4GCMA 4IA5A 4U8PA 4H4UA 1D7LA 1DXLA 1CC2A 3D9XA 2BXRA 2VVLA 4B66A 2J3NA 1VG9A 2ZZCA 3OC4A 1S3EA 3AYLA 3PG6A 4FK1C 2WPFA 4LIIA 1BF3A 4G6HA 1IUVA 2BS2A 4K7ZA 3DGZA 2WESA 5M10A 2XLTA 3SX6A 3S61A 4J34A 5JRBA 1Z6LA 3HZLA 2YLSA 1NEKA 2RGOA 4J31A 2BC0A 4O5QA 3RP6A 4H4RA 4DSGA 2ZZBA 1PXBA 2F5ZA 2WS3A 4NZHA 3UOXA 4H4ZA 1K0IA 3UCLA 2BK4A 3URHA 4JNQA 3T31A 1B37A 1NHQA 1NHSA 5U63A 2XCGA 4U2LA 3AEAA 3CNSA 1GEUA 2VOUA 3H8LA 3WE0A 3P4PA 2B7RA 3GD3A 3VQRA 1Q1RA 3ICTA 3LADA 2WPCA 2WBAA 2VRMA 2FJBA 1GRHA 4YTMA 4D04A 1RYIA 3NK2X 1UKVG 2XVJA 4KX6A 4OPLA 3M0OA 4H2QA 4TLXA 3NYCA 3FBSA 4IVOB 1H83A 1GREA 4A7AA 3QFBA 3SYIA 2JBVA 1LV0A 2VVLG 1CBOA 1KDGA 3NRNA 1IUXA 1PJ7A 2BRYA 3NK1X 5BUKA 5FS8A 1D4DA 1ZOVA 4GR1A 2AR8A 1JNRA 2UZZA 2GR1A 1RP0A 4OVIA 3ICSA 4Y4LA 1DJNA 4LA1A 3L1RA 1GALA 4A6NA 5KOXA 4OPIA 3I3LA 1FL2A 3BHKA 4U8MA 3SY4A 3SM8A 3ATRA 4IVMB 4XWZA 5ER0A 5FS6A 3LZWA 3NIXA 3UOYA 4GAVA 3GDPA 4Z25A 1KF6A 2B9WA 1NHRA 1REOA 2YVJA 2A89A 1JEHA 4EQWA 1E6EA 4YSZA 1TYPA 3LZXA 2X50A 1L9DA 4J57A 4DGKA 1MXTA 3AYIA 1H2IA 3C4AA 3BNMA 4IV9A 3H4KA 2YG7A 3P4QA 4H4VA 2XVEA 4EMJA 2X99A 5TR3A 4U8KA 3NG7X 4EQXA 3Q6JA 4CCRA 2GQWA 1JNZA 1PJ5A 1ZDLA 5BVAA 4OPCA 1NPXA 3V3OA 3CNPA 3NK0X 1K0LA 3KKJA 4H4TA 1OJAA 3AE3A 3BI2A 1O95A 2V61A 2GF3A 4B68A 1H82A 2HQMA 3E1TA 4ZCCA 2BS3A 1B5QA 4II2A 3T0KA 4AP1A 5EBKA 3AEGA 2YWLA 4K2XA 2BXSA 4Z2UA 3F8DA 1AOGA 5KXJA 2BS4A 4JN9A 5KNLA 1GTEA 4NTCA 2FJDA 4GF7A 1PBEA 1COYA 2EQ7A 1QJDA 2GMHA 1EBDA 2V3BA 3CGCA 1TDOA 4K5SA 4A6NB 4BK1A 1E1MA 3NH3X 4REKA 3PO7A 5J60A 1FOHA 4C77A 4DSHA 2JKCA 2OA1A 3AE5A 3P1WA 3QFAA 3P4RA 2VQBA 1PXAA 5KWFA 4D03A 2WHDA 2C64A 1DOCA 2C72A 2GB0A 3K7QX 4AOXA 4CNJA 4J2WA 1D4EA 2C75A 1LVLA 2V5ZA 3QSSA 4CBQA 2IVDA 3VR8A 2E4GA 4P9SA 2EQ8A 3CGEA 1Q1WA 2JB2A 3NTDA 3IC9A 3DK9A 3AE2A 3BI5A 1OJTA 1BWCA 3FPZA 2R4JA 3ADAB 4OPGA 2QCUA 2FBWA 2JK6A 1CC6A 2V60A 4X9NA 4H4XA 2XVHA 4ADWA 1DODA 1Y56A 2Q6UA 3UTEA 2TMDA 2GEWA 3QSEA 4ZN0A 5BULA 4U8NA 3CPIG 5KOWA 1PBDA 4YKGA 2RGJA 4CY6A 3ICRA 1KFYA 2FJEA 3CMMA 2WP5A 1VRQB 4AP3A 4CRTA 1XPQA 3K7MX 1JRXA 4H50A 3NYEA 4K22A 1L9EA 2E1MA 2C65A 2QA1A 4G73A 1GTHA 4HB9A 4YXDA 4Z2RA 2WOIA 1CJ3A 1OJDA 4U8JA 4EIQA 1QO8A 2YLTA 5GSNA 2OLOA 3ALMA 2V6OA 1ELIA 4A65A 3ALLA 3H8IA 1ONFA 1EL5A 3QVRA 2WEUA 3PS9A 4CY8A 1GV4A 2Z5YA 2XLUA 1ZP0A 5JCKA 1N4WA 1P2EA 2O9ZA 2AQJA 2ZBWA 3AECA 1OJCA 1GT8A 2YG6A 2WDQA 2QA2A 4GAPA 1ZY8A 2XFPA 2CFYA 4Z24A 5IPYA 5FS7A 1M6IA 4K5RA 5HYMA 3UKLA 4GRTA 2OLNA 3UKFA 2WQYA 2YVGA 4M52A 3AE7A 3AEEA 3VR9A 4B1BA 1LPFA 2PYXA 1FEBA 1F8RA 1DJQA 1NENA 1GOSA 2GQFA 1JU2A 2A8XA 4EM3A 1CL0A 1Y56B 2CVJA 1ZMDA 2R0GA 4GDEA 5EB5A 3PVCA 4Z26A 5KVHA 4APNA 4HA6A 3T2YA 5JCLA 3ITJA 2XLPA 1XDIA 1GRGA 3SZ0A 3UKPA 3F8RA 2W0HA 3LOVA 4Y4MA 4NEVA 3GRTA 2YM1A 2B9XA 3IHGA 3L8KA 3T2KA 4JNAA 4RSLA 1ZX9A 3DJEA 1H81A 4TLZA 4X9MA 1KNRA 4Z2TA 3RP8A 3UTGA 4EM4A 1NAAA 5C3JA 3GMCA 4YTPA 1EL9A 2V3AA 2IVEA 2VVMA 4EIPA 2NPXA 4C5OA 2JAEA 2C66A 4FDCB 5HHFA 1P2HA 3UTHA 4ECHA 1Y0PA 2XFUA 4A79A 5HY5A 4BV6A 4XWRA 4CCQA 1ZKQA 1CJ4A 3GWFA 3REDA 2XFNA 2XLRA 3VRBA 4OCGA 4AT0A 1GESA 3FG2P 2RABA 2I0ZA 3QVPA 4C74A 2YR6A 5M0ZA 5JCIA 2YVFA 1B8SA 2BK5A 4J56A 1PN0A 2BK3A 2XVFA 3JSKA 3DK8A 3QSMA 2OALA 3T2ZA 3GSIA 4H2PA 4BJZA 2XLSA 1M64A 3UOVA 1GETA 1S7MA 1EL8A 4RG3A 3L5OA 3UOZA 4OPTA 1MOKA 1S3BA 3BI4A 3I6DA 3O0HA 1YY5A 2Q0KA 4DNAA 5LV9A 3NGCX 3CNTA 1L0VA 3IWAA 4C3XA 1S2QA 2Y6RA 5KMPA 3SZCA 4BK3A 3DMEA 1LQUA 3GDNA 2R9ZA 2YAUA 1CF3A 3SZWA 2GR0A 2YR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H89 A;  1GER A;  2BA9 A;  2Q7V A;  4CNK A;  1JOA A;  1ZK7 A;  2XFQ A;  2WDV A;  5HXI A;  2WP6 A;  3AE1 A;  3FMW A;  3IF9 A;  4BJY A;  1N1P A;  3T37 A;  3K30 A;  3AE9 A;  1QLB A;  4A99 A;  3KU9 A;  5FS9 A;  1KSU A;  4U8I A;  3LB8 A;  4J33 A;  2JB3 A;  3RP7 A;  3EPT A;  3AB1 A;  3G5R A;  3B6D A;  2EQ9 A;  4H4P A;  3AED A;  2YM2 A;  4UDQ A;  5U1O A;  2VZ2 A;  4B69 A;  1YQZ A;  4N9X A;  5BRT A;  2WDR A;  4TM3 A;  3EF6 A;  1NG4 A;  4H4Y A;  1O94 A;  2APG A;  1NHP A;  3DGH A;  1X31 B;  1H7W A;  1YQ3 A;  3V76 A;  2JB1 A;  3UKA A;  5JCN A;  1CJC A;  3FIM B;  5EOW A;  2BC1 A;  1LTX R;  1ZOY A;  1GXF A;  2B76 A;  1HYU A;  4KPR A;  4RG4 A;  1E1N A;  2XDO A;  1EL7 A;  1BGN A;  1ZMC A;  2R46 A;  4NTD A;  4BK2 A;  3UKQ A;  1H7X A;  2DKH A;  1FCD A;  3CN8 A;  4H2R A;  1DNC A;  1BZL A;  2Z5X A;  3NN0 X;  2C73 A;  2GAH B;  4TM0 A;  3GRS A;  2NVK X;  3DA1 A;  4FK1 A;  4YSX A;  1H6V A;  1XHC A;  4A5L A;  2X8C A;  2C67 A;  2WPE A;  3C4N A;  2YQU A;  5IQ4 A;  2VRL A;  2WP9 A;  1PXC A;  3UKK A;  1V59 A;  1KNP A;  2GAG B;  3ZDN A;  3IHM A;  1YQ4 A;  1F8S A;  2C3C A;  3ATQ A;  2GMJ A;  1SEZ A;  4MJW A;  4OPD A;  2YLX A;  4WCT A;  5FMH A;  4H7U A;  1F6M A;  2C70 A;  1K0J A;  1LJ1 A;  3CTY A;  3M13 A;  3GMB A;  1YKJ A;  2R0C A;  4J36 A;  2QAE A;  2PHH A;  3DJJ A;  4K8D A;  4H4W A;  1BGJ A;  2A87 A;  2X3N A;  3CIR A;  2X8H A;  5CQF A;  3AD8 B;  1IUU A;  2XVI A;  4Z44 A;  3G5Q A;  2WOV A;  1TDF A;  3NNE A;  2GV8 A;  3S5W A;  3UTF A;  2GR2 A;  4C3Y A;  3DJD A;  1PS9 A;  4YT0 A;  3C96 A;  1IUW A;  3AEB A;  3G5S A;  5IQ1 A;  4UP3 A;  3AE6 A;  3P9U A;  2WET A;  2DKI A;  2YLZ A;  3M12 A;  1TRB A;  3CNJ A;  1GRB A;  4YSY A;  4NEW A;  2BCP A;  3NHO X;  3QJ4 A;  2EQ6 A;  1N4V A;  2BAC A;  3KVE A;  4PAA A;  1GRF A;  1E1L A;  4H2N A;  3UP5 A;  2GR3 A;  3DH9 A;  4XXG A;  4EMW A;  1TDK A;  3VRD B;  4JDR A;  3AXB A;  3V3N A;  2R4E A;  4Z43 A;  4OPU A;  1H84 A;  1E7P A;  3UP4 A;  4B67 A;  3D8X A;  4USR A;  3Q9T A;  5C2T A;  3GD4 A;  1LQT A;  3LXD A;  3KPF A;  3GWD A;  3NT6 A;  4ICY A;  4TM4 A;  3DK4 A;  3NLC A;  3UKH A;  1PJ6 A;  2CDU A;  2ACZ A;  1GPE A;  1NG3 A;  1E39 A;  2TPR A;  2FJA A;  3KD9 A;  1VG0 A;  1W4X A;  1E1K A;  1NDA A;  4UDR A;  2R0P A;  1BKW A;  2RGH A;  4EMI A;  3CND A;  3AE8 A;  1PBC A;  4U2T A;  5J7X A;  3VRA A;  2XYO A;  1F3P A;  1O5W A;  3COX A;  4Y4N A;  1Q9I A;  5KRQ A;  2B9Y A;  1GRT A;  4USQ A;  2ZZ0 A;  5KVI A;  3AE4 A;  2R45 A;  2YLR A;  3EAO A;  3AD9 B;  2H88 A;  3AD7 B;  1DOB A;  1TDE A;  2OAM A;  5DBJ A;  2BYB A;  4B63 A;  5U25 A;  1DOE A;  3SFD A;  3ABV A;  1TYT A;  2C76 A;  4I58 A;  1JRZ A;  2YG5 A;  2XFO A;  3NYF A;  5L46 A;  1S2Y A;  1PBB A;  3SQP A;  4GUV A;  3NKS A;  4U2S A;  3RNM A;  1D4C A;  2C3D A;  4H4Q A;  3P4S A;  4U8L A;  3ZYX A;  3OZ2 A;  3ALJ A;  3D1C A;  4H4S A;  3B3R A;  3DJG X;  3F8P A;  5GRT A;  3AWI A;  4AT2 A;  4YKF A;  3CPJ G;  4PAB A;  1CJ2 A;  1RSG A;  1L9C A;  4ZCD A;  2ARD A;  2VQ7 A;  3KLJ A;  3ISH A;  4YWO A;  1VDC A;  2BCG G;  4NTE A;  4B64 A;  3K7T A;  4E0V A;  1FEA A;  1IUS A;  1JRY A;  2WOW A;  3CGB A;  3AEF A;  3BNU A;  4GDP A;  2C7G A;  4TM1 A;  4YSH A;  3GYJ A;  1F8W A;  4EQS A;  4WX1 A;  2Q0L A;  4JQ9 A;  3CPH G;  3GYI A;  4U8O A;  1CHU A;  4O5U A;  3BHF A;  1CC4 A;  2B7S A;  4B65 A;  2GH5 A;  2Y6Q A;  1KSS A;  2YG4 A;  3AYJ A;  4X4J A;  3RHA A;  2CUL A;  2YG3 A;  1K4Q A;  1PHH A;  4I59 A;  4UDP A;  1N4U A;  2WU2 A;  4YTN A;  3NN6 X;  1MO9 A;  1B4V A;  1GRA A;  4JY2 A;  1IUT A;  3LJP A;  2X8G A;  1GSN A;  1PBF A;  4LU6 A;  1VQW A;  1GND A;  4JY3 A;  2E5V A;  3EAN A;  1PDH A;  5EB4 A;  3R9U A;  2IID A;  2YR5 A;  2YLW A;  2BAB A;  3CGD A;  1IJH A;  2GVC A;  4IA6 A;  1D5T A;  2GRT A;  3SFE A;  2WU5 A;  4FX9 A;  4A9W A;  1D7Y A;  4EQR A;  1XAN A;  3SGL A;  2AAQ A;  5CKU A;  1FEC A;  3II4 A;  4BUR A;  1H86 A;  1OJ9 A;  3KA7 A;  3NTA A;  5JCM A;  1TDN A;  4GCM A;  4IA5 A;  4U8P A;  4H4U A;  1D7L A;  1DXL A;  1CC2 A;  2BXR A;  2VVL A;  4B66 A;  2J3N A;  1VG9 A;  2ZZC A;  3OC4 A;  1S3E A;  3AYL A;  4FK1 C;  2WPF A;  4LII A;  1BF3 A;  1IUV A;  2BS2 A;  4K7Z A;  3DGZ A;  2WES A;  5M10 A;  2XLT A;  3S61 A;  4J34 A;  1Z6L A;  3HZL A;  2YLS A;  1NEK A;  2RGO A;  4J31 A;  2BC0 A;  4O5Q A;  3RP6 A;  4H4R A;  4DSG A;  2ZZB A;  1PXB A;  2F5Z A;  2WS3 A;  4NZH A;  3UOX A;  4H4Z A;  1K0I A;  3UCL A;  2BK4 A;  3URH A;  4JNQ A;  1B37 A;  1NHQ A;  1NHS A;  5U63 A;  2XCG A;  4U2L A;  3AEA A;  3CNS A;  1GEU A;  2VOU A;  3H8L A;  3WE0 A;  3P4P A;  2B7R A;  3GD3 A;  3VQR A;  1Q1R A;  3ICT A;  3LAD A;  2WPC A;  2WBA A;  2VRM A;  2FJB A;  1GRH A;  4YTM A;  4D04 A;  1RYI A;  3NK2 X;  1UKV G;  2XVJ A;  4KX6 A;  4OPL A;  3M0O A;  4H2Q A;  4TLX A;  3NYC A;  3FBS A;  4IVO B;  1H83 A;  1GRE A;  4A7A A;  3QFB A;  2JBV A;  1LV0 A;  2VVL G;  1CBO A;  1KDG A;  3NRN A;  1IUX A;  1PJ7 A;  3NK1 X;  5BUK A;  5FS8 A;  1D4D A;  1ZOV A;  4GR1 A;  2AR8 A;  1JNR A;  2UZZ A;  2GR1 A;  1RP0 A;  4OVI A;  3ICS A;  4Y4L A;  1DJN A;  4LA1 A;  3L1R A;  1GAL A;  4A6N A;  5KOX A;  4OPI A;  3I3L A;  1FL2 A;  3BHK A;  4U8M A;  3SM8 A;  3ATR A;  4IVM B;  4XWZ A;  5ER0 A;  5FS6 A;  3LZW A;  3NIX A;  3UOY A;  4Z25 A;  3GDP A;  1KF6 A;  2B9W A;  1NHR A;  1REO A;  2YVJ A;  2A89 A;  1JEH A;  4EQW A;  1E6E A;  4YSZ A;  1TYP A;  3LZX A;  2X50 A;  1L9D A;  4J57 A;  4DGK A;  1MXT A;  3AYI A;  3C4A A;  3BNM A;  4IV9 A;  3H4K A;  2YG7 A;  3P4Q A;  4H4V A;  2XVE A;  4EMJ A;  2X99 A;  5TR3 A;  4U8K A;  3NG7 X;  4EQX A;  3Q6J A;  4CCR A;  2GQW A;  1JNZ A;  1PJ5 A;  1ZDL A;  5BVA A;  4OPC A;  1NPX A;  3V3O A;  3CNP A;  3NK0 X;  1K0L A;  3KKJ A;  4H4T A;  1OJA A;  3AE3 A;  3BI2 A;  1O95 A;  2V61 A;  2GF3 A;  4B68 A;  1H82 A;  2HQM A;  3E1T A;  4ZCC A;  2BS3 A;  1B5Q A;  4AP1 A;  5EBK A;  3AEG A;  2YWL A;  4K2X A;  2BXS A;  4Z2U A;  3F8D A;  1AOG A;  5KXJ A;  2BS4 A;  4JN9 A;  1GTE A;  4NTC A;  2FJD A;  4GF7 A;  1PBE A;  1COY A;  2EQ7 A;  1QJD A;  2GMH A;  1EBD A;  2V3B A;  3CGC A;  1TDO A;  4K5S A;  4A6N B;  4BK1 A;  1E1M A;  3NH3 X;  4REK A;  3PO7 A;  5J60 A;  1FOH A;  4C77 A;  4DSH A;  2JKC A;  2OA1 A;  3AE5 A;  3P1W A;  3QFA A;  3P4R A;  2VQB A;  1PXA A;  5KWF A;  4D03 A;  2WHD A;  2C64 A;  1DOC A;  2C72 A;  2GB0 A;  3K7Q X;  4AOX A;  4CNJ A;  4J2W A;  1D4E A;  2C75 A;  1LVL A;  2V5Z A;  3QSS A;  4CBQ A;  2IVD A;  3VR8 A;  2E4G A;  4P9S A;  2EQ8 A;  3CGE A;  1Q1W A;  2JB2 A;  3NTD A;  3IC9 A;  3DK9 A;  3AE2 A;  3BI5 A;  1OJT A;  1BWC A;  3FPZ A;  2R4J A;  3ADA B;  4OPG A;  2QCU A;  2FBW A;  2JK6 A;  1CC6 A;  2V60 A;  4X9N A;  4H4X A;  2XVH A;  4ADW A;  1DOD A;  1Y56 A;  2Q6U A;  3UTE A;  2TMD A;  2GEW A;  3QSE A;  4ZN0 A;  5BUL A;  4U8N A;  3CPI G;  5KOW A;  1PBD A;  4YKG A;  2RGJ A;  4CY6 A;  3ICR A;  1KFY A;  2FJE A;  2WP5 A;  1VRQ B;  4AP3 A;  4CRT A;  1XPQ A;  3K7M X;  1JRX A;  4H50 A;  3NYE A;  4K22 A;  1L9E A;  2E1M A;  2C65 A;  2QA1 A;  1GTH A;  4HB9 A;  4YXD A;  4Z2R A;  2WOI A;  1CJ3 A;  1OJD A;  4U8J A;  4EIQ A;  1QO8 A;  2YLT A;  5GSN A;  2OLO A;  3ALM A;  2V6O A;  1ELI A;  4A65 A;  3ALL A;  3H8I A;  1ONF A;  1EL5 A;  3QVR A;  2WEU A;  3PS9 A;  4CY8 A;  1GV4 A;  2Z5Y A;  2XLU A;  1ZP0 A;  5JCK A;  1N4W A;  1P2E A;  2O9Z A;  2AQJ A;  2ZBW A;  3AEC A;  1OJC A;  1GT8 A;  2YG6 A;  2WDQ A;  2QA2 A;  1ZY8 A;  2XFP A;  2CFY A;  4Z24 A;  5IPY A;  5FS7 A;  1M6I A;  4K5R A;  5HYM A;  3UKL A;  4GRT A;  2OLN A;  3UKF A;  2WQY A;  2YVG A;  4M52 A;  3AE7 A;  3AEE A;  3VR9 A;  4B1B A;  1LPF A;  2PYX A;  1FEB A;  1F8R A;  1DJQ A;  1NEN A;  1GOS A;  2GQF A;  1JU2 A;  2A8X A;  4EM3 A;  1CL0 A;  1Y56 B;  2CVJ A;  1ZMD A;  2R0G A;  4GDE A;  5EB5 A;  3PVC A;  4Z26 A;  5KVH A;  4APN A;  4HA6 A;  5JCL A;  3ITJ A;  2XLP A;  1XDI A;  1GRG A;  3UKP A;  3F8R A;  2W0H A;  3LOV A;  4Y4M A;  4NEV A;  3GRT A;  2YM1 A;  2B9X A;  3IHG A;  3L8K A;  4JNA A;  4RSL A;  1ZX9 A;  3DJE A;  1H81 A;  4TLZ A;  4X9M A;  1KNR A;  4Z2T A;  3RP8 A;  3UTG A;  4EM4 A;  1NAA A;  5C3J A;  3GMC A;  4YTP A;  1EL9 A;  2IVE A;  2V3A A;  2VVM A;  4EIP A;  2NPX A;  4C5O A;  2JAE A;  2C66 A;  4FDC B;  5HHF A;  1P2H A;  3UTH A;  4ECH A;  1Y0P A;  2XFU A;  4A79 A;  5HY5 A;  4BV6 A;  4XWR A;  4CCQ A;  1ZKQ A;  1CJ4 A;  3GWF A;  3RED A;  2XFN A;  2XLR A;  3VRB A;  4OCG A;  4AT0 A;  1GES A;  3FG2 P;  2RAB A;  2I0Z A;  3QVP A;  4C74 A;  2YR6 A;  5M0Z A;  5JCI A;  2YVF A;  1B8S A;  2BK5 A;  4J56 A;  1PN0 A;  2BK3 A;  2XVF A;  3JSK A;  3DK8 A;  3QSM A;  2OAL A;  4BJZ A;  3GSI A;  4H2P A;  2XLS A;  1M64 A;  3UOV A;  1GET A;  1EL8 A;  4RG3 A;  3UOZ A;  4OPT A;  1MOK A;  1S3B A;  3BI4 A;  3I6D A;  3O0H A;  1YY5 A;  2Q0K A;  4DNA A;  5LV9 A;  3NGC X;  3CNT A;  1L0V A;  3IWA A;  4C3X A;  1S2Q A;  2Y6R A;  4BK3 A;  3DME A;  1LQU A;  3GDN A;  2R9Z A;  2YAU A;  1CF3 A;  4AOS A;  2GR0 A;  2YR4 A; 
#chains in the Genus database with same CATH topology
 1EC8 A;  2WP6 A;  3MZN A;  3AE9 A;  1QLB A;  3KU9 A;  5FS9 A;  2GSH A;  4J33 A;  2JB3 A;  3SN1 A;  3EPT A;  2PP3 A;  3AB1 A;  3G5R A;  3B6D A;  3EF6 A;  2XH4 A;  1NHP A;  2OZT A;  4FP1 A;  3S47 A;  2JB1 A;  5JCN A;  1N63 C;  1CJC A;  3RCY A;  1BGN A;  4NTD A;  4KWS A;  1H7X A;  1FCD A;  4H2R A;  1BZL A;  3NN0 X;  2C73 A;  4FK1 A;  3C4N A;  2YQU A;  2VRL A;  4K1W A;  1FO4 A;  1BQG A;  3ATQ A;  4GGH A;  3EEZ A;  3H8A A;  2YLX A;  1F6M A;  3VCN A;  2W3S A;  3M13 A;  2HZG A;  1YKJ A;  2QAE A;  2PTX A;  3DJJ A;  4K8D A;  3NS1 B;  2X8H A;  5CQF A;  4G8T A;  1TDF A;  4DWD A;  3S5W A;  2GR2 A;  2PMQ A;  3AEB A;  5IQ1 A;  3SZF A;  3AE6 A;  3P9U A;  3M12 A;  1SJD A;  2BCP A;  3HPF A;  1E1L A;  2PP1 A;  4XXG A;  3VRD B;  3MSY A;  1EC9 A;  3AXB A;  4G9K A;  2CHR A;  4KT2 A;  1JDF A;  4B67 A;  3SXI A;  3R0U A;  4HCL A;  3Q9T A;  3KPF A;  1KKR A;  2HXT A;  1VG0 A;  2R0P A;  1BKW A;  3UJR A;  3CND A;  3N6H A;  2XYO A;  1F3P A;  1RVK A;  1GRT A;  4USQ A;  5KVI A;  2R45 A;  1DOB A;  1TDE A;  5DBJ A;  4B63 A;  2QVH A;  2YG5 A;  2XFO A;  3TJ4 A;  1S2Y A;  4GUV A;  3NKS A;  2AL1 A;  1D4C A;  3V4B A;  5J04 A;  3D1C A;  5GRT A;  5ENL A;  3CPJ G;  4YWO A;  3R07 C;  4NTE A;  4B64 A;  3ENL A;  3K7T A;  3NXL A;  3AEF A;  3CGB A;  4TM1 A;  4YSH A;  3GO2 A;  4WX1 A;  3CPH G;  1CHU A;  4IZG A;  4O5U A;  3BHF A;  4HCD A;  1CC4 A;  3AYJ A;  4X4J A;  1N5W C;  2YG3 A;  3N4F A;  4JY2 A;  3NVZ B;  1VQW A;  2YLW A;  1KCZ A;  3CGD A;  4NWZ A;  3T14 A;  1IJH A;  2I5Q A;  1D5T A;  4A9W A;  3SGL A;  3NVW B;  3KA7 A;  1TDN A;  3P93 A;  1D7L A;  1DXL A;  4B66 A;  1VG9 A;  2ZZC A;  4G6H A;  2OO6 A;  2NQL A;  5M10 A;  3SX6 A;  3RIT A;  3HZL A;  2BC0 A;  4DSG A;  2WS3 A;  4NZH A;  3CAW A;  1K0I A;  1NHQ A;  1NHS A;  2XCG A;  3AEA A;  3CNS A;  3H8L A;  1MNS A;  1N61 C;  2WPC A;  2WBA A;  3D47 A;  1KKO A;  1L8P A;  3M0O A;  3NYC A;  4IVO B;  3JVA A;  1KDG A;  1IUX A;  2BRY A;  5FS8 A;  4OVI A;  3ICS A;  3TTE A;  3L1R A;  4A6N A;  5KOX A;  3ES7 A;  3I3L A;  5ER0 A;  4GYP A;  4GAV A;  2P0I A;  1REO A;  4YSZ A;  1KD0 A;  2X50 A;  1MXT A;  3C4A A;  2O56 A;  2XVE A;  5TR3 A;  4U8K A;  1PJ5 A;  3CK5 A;  1ZDL A;  2QJN A;  1SJC A;  3V3O A;  3CNP A;  2OQH A;  3CT2 A;  4F4R A;  3HRD C;  2HQM A;  3E1T A;  5EBK A;  5KXJ A;  1GTE A;  2FJD A;  4GF7 A;  2XH0 A;  4REK A;  3AE5 A;  3P4R A;  1PXA A;  4D03 A;  2POZ A;  3K7Q X;  4AOX A;  3U4F A;  4CBQ A;  2E4G A;  2EQ8 A;  4IL0 A;  3AE2 A;  3B97 A;  3FPZ A;  3ADA B;  3FYY A;  5FJU A;  3FCP A;  2FBW A;  2PS2 A;  2XVH A;  3NO1 A;  1DOD A;  3QTP A;  1Y56 A;  3UTE A;  2TMD A;  2GEW A;  3QSE A;  3CPI G;  3OZM A;  5KOW A;  4YKG A;  4J1O A;  3VFC A;  3NYE A;  2E1M A;  5G5H B;  5BOE A;  1GTH A;  4Z2R A;  1CJ3 A;  4HCH A;  2OLO A;  2V6O A;  1R0M A;  4A65 A;  3H8I A;  3PS9 A;  4DN1 A;  5JCK A;  3TJI A;  1F9C A;  1FHV A;  3AEC A;  1YEY A;  2YG6 A;  4GAP A;  5IPY A;  4Z24 A;  3UJF A;  5FS7 A;  1M6I A;  4GRT A;  2OLN A;  3UKF A;  2YVG A;  3AEE A;  2PYX A;  1FEB A;  1F8R A;  3T4W A;  4EM3 A;  2OKT A;  2CVJ A;  4Z1Y A;  1ZMD A;  3RR1 A;  5EB5 A;  3PVC A;  4HA6 A;  3ITJ A;  1ECQ A;  2GGI A;  3UKP A;  3LOV A;  4RSL A;  1ZX9 A;  1H81 A;  2GGG A;  3SJN A;  3EKG A;  2V3A A;  2VVM A;  3SQS A;  3UJE A;  4ECH A;  1P2H A;  1Y0P A;  1T3Q C;  4Z17 A;  2XLR A;  3VRB A;  4OCG A;  3QKE A;  3IJQ A;  1JPD X;  2I0Z A;  2PTW A;  4C74 A;  5JCI A;  2OX4 A;  2BK5 A;  2BK3 A;  3QSM A;  2OAL A;  3GSI A;  3UOV A;  1GET A;  1S7M A;  1EL8 A;  3R1Z A;  3BI4 A;  3ZLH A;  3NGC X;  2Y6R A;  2YAU A;  3DGB A;  5KMQ A;  4AOS A;  2H89 A;  1GER A;  1ZK7 A;  2XFQ A;  4H19 A;  2WDV A;  3NFU A;  3AE1 A;  3FMW A;  3IF9 A;  4BJY A;  4A99 A;  1KSU A;  3UCC A;  4ROP A;  3AED A;  1YQZ A;  4N9X A;  4TM3 A;  1NG4 A;  2OZ8 A;  3DGH A;  2W54 A;  1FHU A;  3EUB 3;  1YQ3 A;  4G6G A;  4E5T A;  3FIM B;  1ZOY A;  1HYU A;  1E1N A;  2XDO A;  1EL7 A;  2PPG A;  4BK2 A;  4MGG A;  2DKH A;  3N6J A;  4TM0 A;  3GRS A;  2NVK X;  1P43 A;  4YSX A;  1H6V A;  3H12 A;  2C67 A;  5IQ4 A;  4IP5 A;  3A7R A;  1PXC A;  3UKK A;  4H83 A;  3IHM A;  4EWJ A;  2C3C A;  2E5A A;  3CTY A;  1N62 C;  3A7U A;  3GMB A;  2PHH A;  2A87 A;  2X3N A;  2DW6 A;  3AD8 B;  1IUU A;  3HYX A;  2WOV A;  3SN0 A;  4C3Y A;  4YT0 A;  1IUW A;  4UP3 A;  3THU A;  3CNJ A;  2EQ6 A;  2BAC A;  4PAA A;  2P3Z A;  4H2N A;  2GR3 A;  3MQT A;  1TZZ A;  3HW2 A;  4GME A;  5KMS A;  4H2H A;  2R4E A;  4Z43 A;  1H84 A;  1E7P A;  3D8X A;  2QGY A;  3DK4 A;  3UKH A;  4ZA0 A;  2ACZ A;  1GPE A;  1N60 C;  1E1K A;  1NDA A;  4EMI A;  4Y4N A;  5KRQ A;  2B9Y A;  3AMZ A;  3AD9 B;  3EAO A;  2XGZ A;  3SFD A;  4II3 A;  1TYT A;  2C76 A;  4I58 A;  1JRZ A;  1PBB A;  1PDY A;  2C3D A;  3CXO A;  2OZ3 A;  3OZ2 A;  3ALJ A;  3F8P A;  3DJG X;  3AWI A;  4AT2 A;  3A7A A;  4PAB A;  3STP A;  2VQ7 A;  3ISH A;  1VDC A;  4E0V A;  1FEA A;  3BSM A;  3TWA A;  4EQS A;  2B7S A;  2W3R A;  2GH5 A;  2Y6Q A;  1KSS A;  2YG4 A;  3ZLG A;  1PHH A;  4UDP A;  3KPK A;  1N4U A;  2WU2 A;  1GRA A;  3LJP A;  3I6T A;  1GND A;  4JY3 A;  3EAN A;  5EB4 A;  2QDD A;  2IID A;  3GD6 A;  2P8C A;  1STZ A;  4IP4 A;  4IA6 A;  4FX9 A;  7ENL A;  1XAN A;  2AAQ A;  1SJB A;  3NTA A;  5JCM A;  4H4U A;  4M6U A;  1CC2 A;  1ONE A;  2WPF A;  1BF3 A;  4GIS A;  4K7Z A;  3DGZ A;  2WES A;  2XLT A;  3DER A;  3V5F A;  1NEK A;  2YLS A;  4J31 A;  4O5Q A;  4H4R A;  5G5G B;  1PXB A;  4H4Z A;  3UCL A;  3URH A;  5U63 A;  4U2L A;  3P4P A;  3GD3 A;  3T8Q A;  3TOY A;  3ICT A;  2OVL A;  2VRM A;  2FJB A;  4YTM A;  3NK2 X;  4OPL A;  3UXL A;  1JPM A;  1CBO A;  1PJ7 A;  1D4D A;  1ZOV A;  3PWI A;  1JNR A;  3BHK A;  3UOY A;  3GDP A;  2B9W A;  1NHR A;  5IDZ A;  2YVJ A;  4EQW A;  1E6E A;  3PWG A;  1TYP A;  4J57 A;  3AYI A;  2P8B A;  3SSZ A;  3P4Q A;  4EMJ A;  2X99 A;  4E6M A;  3Q6J A;  4CCR A;  1JNZ A;  3KKJ A;  2HXU A;  4H4T A;  3B9J B;  3NRZ B;  4ZCC A;  2BS3 A;  4II2 A;  4AP1 A;  4Z2U A;  2BXS A;  1MUC A;  4NTC A;  1PBE A;  3CGC A;  1TDO A;  4K5S A;  4FI4 A;  4A6N B;  4BK1 A;  3NH3 X;  4C77 A;  3Q45 A;  2WHD A;  2C72 A;  1WUF A;  3RGT A;  4J2W A;  5FJO A;  1D4E A;  2V5Z A;  1LVL A;  3QSS A;  2IVD A;  3VR8 A;  4P9S A;  3OPS A;  3NTD A;  3BI5 A;  2QJJ A;  1OJT A;  1BWC A;  3UJS A;  2V60 A;  4X9N A;  4ADW A;  2W55 A;  3V3W A;  4ZN0 A;  5BUL A;  1PBD A;  3ZVI A;  2RGJ A;  4ENL A;  2FJE A;  3CMM A;  2WP5 A;  4AP3 A;  1L9E A;  2C65 A;  4YXD A;  4EIQ A;  3CB3 A;  1QO8 A;  4TVW A;  1EL5 A;  1VDV A;  2ZBW A;  2CFY A;  3ETR B;  1FIQ B;  3UKL A;  2WQY A;  3VR9 A;  1DJQ A;  1NEN A;  1Y56 B;  3GY1 A;  4E4F A;  4GDE A;  4Z26 A;  3SBF A;  5KVH A;  3T9P A;  5JCL A;  2XLP A;  1XDI A;  2OFJ A;  3F8R A;  4Y4M A;  2P88 A;  4NEV A;  1NU5 A;  2YM1 A;  3IHG A;  3DJE A;  4TLZ A;  4Z2T A;  3RP8 A;  1NAA A;  3GMC A;  4YTP A;  2NPX A;  4C5O A;  1X2G A;  5HHF A;  2XFU A;  3Q4D A;  4DYE A;  3GWF A;  1WYG A;  2XFN A;  4AT0 A;  1EBH A;  2XH7 A;  3SR6 B;  3QVP A;  5M0Z A;  4J56 A;  3DK8 A;  4J3Z A;  4BJZ A;  1M64 A;  2PGW A;  3I6D A;  3O0H A;  3OP2 A;  3JW7 A;  1L0V A;  2XVJ A;  3TWB A;  2BA9 A;  3V5C A;  2Q7V A;  4CNK A;  1N1P A;  4U8I A;  3NVY B;  5U1O A;  2VZ2 A;  4B69 A;  3FV9 A;  4ZCW A;  1O94 A;  1TKK A;  2PP0 A;  1X31 B;  3I6E A;  1H7W A;  3DDM A;  2C4C A;  3V76 A;  1RM6 B;  3OZY A;  2B76 A;  1EC7 A;  1ZMC A;  3TCS A;  3VC5 A;  1XHC A;  4A5L A;  2X8C A;  2WPE A;  4G74 A;  3UXK A;  3P0W A;  1V59 A;  1KNP A;  3ZDN A;  2GMJ A;  4MJW A;  4OPD A;  5FMH A;  4H7U A;  2C70 A;  4YWS A;  1K0J A;  1LJ1 A;  3ZVH A;  2R0C A;  4J36 A;  4H4W A;  4KPL A;  1BGJ A;  5FJT A;  3KUM A;  3CIR A;  2XVI A;  4Z44 A;  6ENL A;  3DJD A;  3C96 A;  3G5S A;  2ONE A;  2WET A;  1TRB A;  1GRB A;  4JN7 A;  4NEW A;  3NHO X;  1N4V A;  4DX3 A;  3UP5 A;  3DH9 A;  2QDE A;  1TDK A;  4JDR A;  3V3N A;  4OPU A;  5C2T A;  3GD4 A;  1LQT A;  3NT6 A;  5FJR A;  3PFR A;  4M0X A;  3VRA A;  3K1G A;  1Q9I A;  3HYV A;  2E3T A;  4GGB A;  4MMW A;  3AD7 B;  2BYB A;  1DOE A;  3ABV A;  5L46 A;  1N5X A;  3SQP A;  2XH2 A;  4U8L A;  3P4S A;  3GYX A;  4H4S A;  3B3R A;  4YKF A;  1CJ2 A;  1L9C A;  4ZCD A;  3KLJ A;  3NVV B;  4HN8 A;  3BNU A;  4GDP A;  2WOW A;  2C7G A;  3GYJ A;  2Q0L A;  1ELS A;  3GYI A;  5KMR A;  4B65 A;  1K4Q A;  4YTN A;  1MO9 A;  1B4V A;  1IUT A;  2X8G A;  1PBF A;  4LU6 A;  3FJ4 A;  3R9U A;  1PDH A;  2OPJ A;  2YR5 A;  3AM9 A;  3SFE A;  2WU5 A;  1D7Y A;  4A6G A;  2AKZ A;  5CKU A;  2GDQ A;  1H86 A;  4BUR A;  1OJ9 A;  4GCM A;  2BXR A;  3D9X A;  2VVL A;  2J3N A;  4FK1 C;  1S3E A;  3AYL A;  3PG6 A;  2BS2 A;  4KEM A;  1V97 A;  5JRB A;  2PTZ A;  2RGO A;  3MWC A;  2ZZB A;  3QLD A;  3UOX A;  2BK4 A;  4JNQ A;  3T31 A;  1B37 A;  1GEU A;  2B7R A;  1Q1R A;  3IJL A;  3LAD A;  2HNE A;  4E4U A;  4TLX A;  1H83 A;  1GRE A;  3QFB A;  2JBV A;  3NRN A;  3T6C A;  5BUK A;  2GR1 A;  1DJN A;  4LA1 A;  1GAL A;  4OPI A;  1FL2 A;  4U8M A;  3SY4 A;  3SM8 A;  3ATR A;  4XWZ A;  3NIX A;  4Z25 A;  1KF6 A;  3AN1 A;  3LZX A;  3MY9 A;  4JHM A;  1L9D A;  4IHC A;  1H2I A;  3BNM A;  4H4V A;  3FXG A;  3PK7 A;  1K0L A;  1OJA A;  3AE3 A;  3BI2 A;  2V61 A;  1H82 A;  3MUC A;  3VDG A;  2AL2 A;  1NEL A;  4HNL A;  3N4E A;  3T0K A;  3AEG A;  4K2X A;  2YWL A;  4JN9 A;  2GMH A;  2EQ7 A;  1QJD A;  5J60 A;  1FOH A;  2JKC A;  3P1W A;  2VQB A;  5KWF A;  2C64 A;  4JN8 A;  1P48 A;  3TW9 A;  4GIR A;  2JK6 A;  1CC6 A;  1E9I A;  4A3R A;  4U8N A;  2MUC A;  4CY6 A;  1VRQ B;  3K7M X;  4K22 A;  4G73 A;  3DFY A;  2WOI A;  1WUE A;  1OJD A;  4U8J A;  5GSN A;  3ALM A;  1ELI A;  3ALL A;  1ONF A;  3QVR A;  2WEU A;  2Z5Y A;  1JRP A;  2XLU A;  3FVD A;  2GL5 A;  2AQJ A;  1OJC A;  1GT8 A;  5HYM A;  3AE7 A;  4B1B A;  2GQF A;  1JU2 A;  1VQZ A;  4APN A;  1SB3 B;  2W0H A;  2B9X A;  3T2K A;  3P3B A;  3SN4 A;  4JNA A;  3UTG A;  5C3J A;  1EL9 A;  2IVE A;  3H70 A;  1MRA A;  2C66 A;  3RRA A;  4A79 A;  2ZAD A;  4BV6 A;  4CCQ A;  1ZKQ A;  1CJ4 A;  3RED A;  3DFH A;  3VC6 A;  2RAB A;  2YR6 A;  4GYP C;  2YVF A;  4HNC A;  3JSK A;  2GGJ A;  3T2Z A;  3DES A;  3L5O A;  3UOZ A;  4OPT A;  3CXB A;  1YY5 A;  2Q0K A;  4DNA A;  3CNT A;  1EBG A;  3SZC A;  3NZG A;  3DME A;  3GDN A;  2R9Z A;  3IJI A;  3SZW A;  1CF3 A;  1ZXI C;  2XLS A;  3DIP A;  1JOA A;  3BJS A;  5HXI A;  3T37 A;  3K30 A;  4NNJ A;  3UJ2 A;  3LB8 A;  3RP7 A;  2EQ9 A;  4H4P A;  4UDQ A;  2YM2 A;  5BRT A;  2WDR A;  4H4Y A;  2APG A;  3UKA A;  5EOW A;  2BC1 A;  1LTX R;  1GXF A;  4KPR A;  4RG4 A;  3S5S A;  2R46 A;  3UKQ A;  3CN8 A;  1DNC A;  2Z5X A;  2GAH B;  3DG3 A;  3DA1 A;  4TVY A;  4G7F A;  2BRA A;  2FYM A;  4K8G A;  2WP9 A;  5BOF A;  2GAG B;  1YQ4 A;  1F8S A;  4HYR A;  4H1Z A;  1SEZ A;  4WCT A;  2ZC8 A;  4DHG A;  4MKS A;  3OW1 A;  4ZOH B;  1TE6 A;  3G5Q A;  3NNE A;  2GV8 A;  3UTF A;  1PS9 A;  2DKI A;  2YLZ A;  2MNR A;  4YSY A;  3QJ4 A;  4E8G A;  3KVE A;  1GRF A;  2QJM A;  3ES8 A;  4EMW A;  2DW7 A;  2PU0 A;  1KN0 A;  3UP4 A;  1PDZ A;  4USR A;  3LXD A;  3GWD A;  4ICY A;  4TM4 A;  3NLC A;  1PJ6 A;  2CDU A;  1MDR A;  3ZVH B;  1NG3 A;  1E39 A;  2TPR A;  2POD A;  1JRO A;  2FJA A;  3KD9 A;  1W4X A;  4UDR A;  3RO6 A;  2RGH A;  3AE8 A;  1PBC A;  4U2T A;  5J7X A;  3QN3 A;  1O5W A;  4IT1 A;  3COX A;  2RDX A;  2ZZ0 A;  3AE4 A;  1XS2 A;  2YLR A;  2H88 A;  2OAM A;  1X2H A;  5U25 A;  3NYF A;  3BOX A;  4U2S A;  3RNM A;  4H4Q A;  3OTR A;  3ZYX A;  2AKM A;  1RSG A;  3D46 A;  2ARD A;  2BCG G;  1IUS A;  1JRY A;  1MDL A;  1JCT A;  1F8W A;  3GC2 A;  4JQ9 A;  4U8O A;  1DTN A;  1SJA A;  3RHA A;  2CUL A;  4I59 A;  3DG7 A;  3NN6 X;  1GSN A;  5FJP A;  2E5V A;  3U9I A;  4X2P A;  2PCE A;  2BAB A;  2GVC A;  2GRT A;  3VA8 A;  3HYW A;  4EQR A;  2PGE A;  1FEC A;  3II4 A;  2PU1 A;  3JZU A;  3IK4 A;  3MKC A;  4IA5 A;  4U8P A;  2OG9 A;  3OC4 A;  4LII A;  1IUV A;  3S61 A;  4J34 A;  1Z6L A;  2FKP A;  3RP6 A;  2F5Z A;  3TQP A;  2VOU A;  3WE0 A;  3VQR A;  1GRH A;  4D04 A;  1RYI A;  1UKV G;  4KX6 A;  3VCC A;  4H2Q A;  3FBS A;  4A7A A;  3SYI A;  1LV0 A;  2VVL G;  1XPY A;  3NK1 X;  2UZZ A;  2AR8 A;  4GR1 A;  1RP0 A;  4Y4L A;  4IVM B;  5FS6 A;  3LZW A;  3ZLF A;  2A89 A;  1JEH A;  4K2S A;  4DGK A;  4IV9 A;  3H4K A;  5EU9 A;  2YG7 A;  3CYJ A;  3NG7 X;  4EQX A;  2GQW A;  3R0K A;  2QQ6 A;  3QPE A;  5BVA A;  1R6W A;  4OPC A;  1NPX A;  3NK0 X;  1O95 A;  4B68 A;  2GF3 A;  1B5Q A;  3F8D A;  1AOG A;  2BS4 A;  5KNL A;  1FFU C;  2PA6 A;  1COY A;  2PSN A;  1EBD A;  2V3B A;  1E1M A;  3PO7 A;  4DSH A;  2OA1 A;  3QFA A;  2GB0 A;  1DOC A;  4CNJ A;  2C75 A;  1W6T A;  3CGE A;  1Q1W A;  2JB2 A;  3IC9 A;  3DK9 A;  3DG6 A;  2R4J A;  4OPG A;  2QCU A;  4H4X A;  2Q6U A;  3R10 A;  2PTY A;  2OLA A;  4HPN A;  2AL2 B;  3UGV A;  3ICR A;  1KFY A;  2GGH A;  4CRT A;  1XPQ A;  3UCD A;  1JRX A;  4H50 A;  1OEP A;  2QA1 A;  4HB9 A;  1BKH A;  3I4K A;  2OQY A;  2YLT A;  1FFV C;  4CY8 A;  1GV4 A;  1ZP0 A;  1N4W A;  1P2E A;  2O9Z A;  4IL2 A;  2WDQ A;  2QA2 A;  1ZY8 A;  2XFP A;  4A35 A;  3H7V A;  4K5R A;  4M52 A;  1LPF A;  1GOS A;  2A8X A;  1CL0 A;  2R0G A;  3T2Y A;  1GRG A;  3SZ0 A;  2XSX A;  3GRT A;  3L8K A;  4X9M A;  1KNR A;  4EM4 A;  1IYX A;  4EIP A;  2JAE A;  4FDC B;  3UTH A;  5HY5 A;  4XWR A;  3DEQ A;  1GES A;  3FG2 P;  4GFI A;  3R25 A;  1B8S A;  1PN0 A;  2XVF A;  4H2P A;  2GGE A;  4RG3 A;  4DXK A;  3R11 A;  1MOK A;  1S3B A;  5LV9 A;  3IWA A;  4C3X A;  1S2Q A;  5KMP A;  4BK3 A;  1LQU A;  2GR0 A;  2YR4 A; 
#chains in the Genus database with same CATH homology
 2H89 A;  1GER A;  2BA9 A;  2Q7V A;  4CNK A;  1JOA A;  1ZK7 A;  2XFQ A;  2WDV A;  5HXI A;  2WP6 A;  3AE1 A;  3FMW A;  3IF9 A;  4BJY A;  1N1P A;  3T37 A;  3K30 A;  3AE9 A;  1QLB A;  4A99 A;  3KU9 A;  4NNJ A;  5FS9 A;  1KSU A;  4U8I A;  3LB8 A;  4J33 A;  2JB3 A;  3RP7 A;  3EPT A;  3AB1 A;  3G5R A;  3B6D A;  2EQ9 A;  4H4P A;  3AED A;  2YM2 A;  4UDQ A;  5U1O A;  2VZ2 A;  4B69 A;  1YQZ A;  4N9X A;  5BRT A;  2WDR A;  4TM3 A;  3EF6 A;  1NG4 A;  4H4Y A;  1O94 A;  2APG A;  1NHP A;  3DGH A;  1X31 B;  1H7W A;  1YQ3 A;  2C4C A;  4G6G A;  3V76 A;  2JB1 A;  3UKA A;  5JCN A;  1CJC A;  3FIM B;  5EOW A;  2BC1 A;  1LTX R;  1ZOY A;  1GXF A;  2B76 A;  1HYU A;  4KPR A;  4RG4 A;  1E1N A;  2XDO A;  1EL7 A;  1BGN A;  1ZMC A;  2R46 A;  4NTD A;  4BK2 A;  3UKQ A;  1H7X A;  2DKH A;  1FCD A;  3CN8 A;  4H2R A;  1DNC A;  1BZL A;  2Z5X A;  3NN0 X;  2C73 A;  2GAH B;  4TM0 A;  3GRS A;  2NVK X;  3DA1 A;  4FK1 A;  4YSX A;  1H6V A;  1XHC A;  4A5L A;  2X8C A;  2BRA A;  2WPE A;  2C67 A;  2YQU A;  3C4N A;  4G74 A;  2VRL A;  5IQ4 A;  2WP9 A;  1PXC A;  3UKK A;  1V59 A;  1KNP A;  2GAG B;  3ZDN A;  3IHM A;  1YQ4 A;  1F8S A;  2C3C A;  3ATQ A;  5KMQ A;  2GMJ A;  4AOS A;  1SEZ A;  4MJW A;  4OPD A;  2YLX A;  4WCT A;  5FMH A;  4H7U A;  1F6M A;  2C70 A;  1K0J A;  1LJ1 A;  3CTY A;  3M13 A;  3GMB A;  1YKJ A;  2R0C A;  4J36 A;  2QAE A;  2PHH A;  3DJJ A;  4K8D A;  4H4W A;  1BGJ A;  2A87 A;  2X3N A;  3CIR A;  2X8H A;  5CQF A;  3AD8 B;  1IUU A;  2XVI A;  3HYX A;  4Z44 A;  3G5Q A;  2WOV A;  1TDF A;  3NNE A;  2GV8 A;  3S5W A;  3UTF A;  2GR2 A;  4C3Y A;  3DJD A;  1PS9 A;  4YT0 A;  3C96 A;  1IUW A;  3AEB A;  3G5S A;  5IQ1 A;  3SZF A;  4UP3 A;  3AE6 A;  3P9U A;  2WET A;  2DKI A;  2YLZ A;  3M12 A;  1TRB A;  3CNJ A;  1GRB A;  4YSY A;  4NEW A;  2BCP A;  3NHO X;  3QJ4 A;  2EQ6 A;  1N4V A;  2BAC A;  3KVE A;  4PAA A;  1GRF A;  1E1L A;  4H2N A;  3UP5 A;  2GR3 A;  3DH9 A;  4XXG A;  4EMW A;  1TDK A;  3VRD B;  4JDR A;  3AXB A;  3V3N A;  5KMS A;  2R4E A;  1KN0 A;  4G9K A;  4Z43 A;  4OPU A;  1H84 A;  1E7P A;  3UP4 A;  4B67 A;  3SXI A;  3D8X A;  4USR A;  3Q9T A;  5C2T A;  3GD4 A;  1LQT A;  3LXD A;  3KPF A;  3GWD A;  3NT6 A;  4ICY A;  4TM4 A;  3DK4 A;  3NLC A;  3UKH A;  1PJ6 A;  2CDU A;  2ACZ A;  1GPE A;  1NG3 A;  1E39 A;  2TPR A;  2FJA A;  3KD9 A;  1VG0 A;  1W4X A;  1E1K A;  1NDA A;  4UDR A;  2R0P A;  1BKW A;  2RGH A;  4EMI A;  3CND A;  3AE8 A;  1PBC A;  4U2T A;  5J7X A;  3VRA A;  2XYO A;  1F3P A;  1O5W A;  3COX A;  4Y4N A;  1Q9I A;  3HYV A;  5KRQ A;  2B9Y A;  1GRT A;  4USQ A;  2ZZ0 A;  5KVI A;  3AE4 A;  2R45 A;  2YLR A;  3EAO A;  3AD9 B;  2H88 A;  3AD7 B;  1DOB A;  1TDE A;  2OAM A;  5DBJ A;  2BYB A;  4B63 A;  5U25 A;  1DOE A;  4II3 A;  3SFD A;  3ABV A;  1TYT A;  2C76 A;  4I58 A;  1JRZ A;  2YG5 A;  2XFO A;  3NYF A;  5L46 A;  1S2Y A;  1PBB A;  3SQP A;  4GUV A;  3NKS A;  4U2S A;  3RNM A;  1D4C A;  2C3D A;  4H4Q A;  3P4S A;  4U8L A;  3GYX A;  3ZYX A;  3OZ2 A;  3ALJ A;  3D1C A;  4H4S A;  3B3R A;  3DJG X;  3F8P A;  5GRT A;  3AWI A;  4AT2 A;  4YKF A;  3CPJ G;  4PAB A;  1CJ2 A;  1RSG A;  1L9C A;  4ZCD A;  2ARD A;  2VQ7 A;  3KLJ A;  3ISH A;  4YWO A;  1VDC A;  2BCG G;  4NTE A;  4B64 A;  3K7T A;  4E0V A;  1FEA A;  1IUS A;  1JRY A;  2WOW A;  3CGB A;  3AEF A;  3BNU A;  4GDP A;  2C7G A;  4TM1 A;  4YSH A;  3GYJ A;  1F8W A;  4EQS A;  4WX1 A;  2Q0L A;  4JQ9 A;  3CPH G;  3GYI A;  4U8O A;  1CHU A;  5KMR A;  4O5U A;  3BHF A;  1CC4 A;  2B7S A;  4B65 A;  2GH5 A;  2Y6Q A;  1KSS A;  2YG4 A;  3AYJ A;  4X4J A;  3RHA A;  2CUL A;  2YG3 A;  1K4Q A;  1PHH A;  4I59 A;  4UDP A;  3KPK A;  1N4U A;  2WU2 A;  4YTN A;  3NN6 X;  1MO9 A;  1B4V A;  1GRA A;  4JY2 A;  1IUT A;  3LJP A;  2X8G A;  1GSN A;  1PBF A;  4LU6 A;  1VQW A;  1GND A;  4JY3 A;  2E5V A;  3EAN A;  1PDH A;  5EB4 A;  3R9U A;  2IID A;  2YR5 A;  2YLW A;  2BAB A;  3CGD A;  4NWZ A;  3T14 A;  1IJH A;  2GVC A;  4IA6 A;  1D5T A;  2GRT A;  3SFE A;  2WU5 A;  4FX9 A;  3HYW A;  1D7Y A;  4EQR A;  1XAN A;  3SGL A;  4A9W A;  2AAQ A;  5CKU A;  1FEC A;  3II4 A;  4BUR A;  1H86 A;  1OJ9 A;  3KA7 A;  3NTA A;  5JCM A;  1TDN A;  4GCM A;  4IA5 A;  4U8P A;  4H4U A;  1D7L A;  1DXL A;  1CC2 A;  3D9X A;  2BXR A;  2VVL A;  4B66 A;  2J3N A;  1VG9 A;  2ZZC A;  3OC4 A;  1S3E A;  3AYL A;  3PG6 A;  4FK1 C;  2WPF A;  4LII A;  1BF3 A;  4G6H A;  1IUV A;  2BS2 A;  4K7Z A;  3DGZ A;  2WES A;  5M10 A;  2XLT A;  3SX6 A;  3S61 A;  4J34 A;  5JRB A;  1Z6L A;  3HZL A;  2YLS A;  1NEK A;  2RGO A;  4J31 A;  2BC0 A;  4O5Q A;  3RP6 A;  4H4R A;  4DSG A;  2ZZB A;  1PXB A;  2F5Z A;  2WS3 A;  4NZH A;  3UOX A;  4H4Z A;  1K0I A;  3UCL A;  2BK4 A;  3URH A;  4JNQ A;  3T31 A;  1B37 A;  1NHQ A;  1NHS A;  5U63 A;  2XCG A;  4U2L A;  3AEA A;  3CNS A;  1GEU A;  2VOU A;  3H8L A;  3WE0 A;  3P4P A;  2B7R A;  3GD3 A;  3VQR A;  1Q1R A;  3ICT A;  3LAD A;  2WPC A;  2WBA A;  2VRM A;  2FJB A;  1GRH A;  4YTM A;  4D04 A;  1RYI A;  3NK2 X;  1UKV G;  2XVJ A;  4KX6 A;  4OPL A;  3M0O A;  4H2Q A;  4TLX A;  3NYC A;  3FBS A;  4IVO B;  1H83 A;  1GRE A;  4A7A A;  3QFB A;  3SYI A;  2JBV A;  1LV0 A;  2VVL G;  1CBO A;  1KDG A;  3NRN A;  1IUX A;  1PJ7 A;  2BRY A;  3NK1 X;  5BUK A;  5FS8 A;  1D4D A;  1ZOV A;  4GR1 A;  2AR8 A;  1JNR A;  2UZZ A;  2GR1 A;  1RP0 A;  4OVI A;  3ICS A;  4Y4L A;  1DJN A;  4LA1 A;  3L1R A;  1GAL A;  4A6N A;  5KOX A;  4OPI A;  3I3L A;  1FL2 A;  3BHK A;  4U8M A;  3SY4 A;  3SM8 A;  3ATR A;  4IVM B;  4XWZ A;  5ER0 A;  5FS6 A;  3LZW A;  3NIX A;  3UOY A;  4GAV A;  3GDP A;  4Z25 A;  1KF6 A;  2B9W A;  1NHR A;  1REO A;  2YVJ A;  2A89 A;  1JEH A;  4EQW A;  1E6E A;  4YSZ A;  1TYP A;  3LZX A;  2X50 A;  1L9D A;  4J57 A;  4DGK A;  1MXT A;  3AYI A;  1H2I A;  3C4A A;  3BNM A;  4IV9 A;  3H4K A;  2YG7 A;  3P4Q A;  4H4V A;  2XVE A;  4EMJ A;  2X99 A;  5TR3 A;  4U8K A;  3NG7 X;  4EQX A;  3Q6J A;  4CCR A;  2GQW A;  1JNZ A;  1PJ5 A;  1ZDL A;  5BVA A;  4OPC A;  1NPX A;  3V3O A;  3CNP A;  3NK0 X;  1K0L A;  3KKJ A;  4H4T A;  1OJA A;  3AE3 A;  3BI2 A;  1O95 A;  2V61 A;  2GF3 A;  4B68 A;  1H82 A;  2HQM A;  3E1T A;  4ZCC A;  2BS3 A;  1B5Q A;  4II2 A;  3T0K A;  4AP1 A;  5EBK A;  3AEG A;  2YWL A;  4K2X A;  2BXS A;  4Z2U A;  3F8D A;  1AOG A;  5KXJ A;  2BS4 A;  4JN9 A;  5KNL A;  1GTE A;  4NTC A;  2FJD A;  4GF7 A;  1PBE A;  1COY A;  2EQ7 A;  1QJD A;  2GMH A;  1EBD A;  2V3B A;  3CGC A;  1TDO A;  4K5S A;  4A6N B;  4BK1 A;  1E1M A;  3NH3 X;  4REK A;  3PO7 A;  5J60 A;  1FOH A;  4C77 A;  4DSH A;  2JKC A;  2OA1 A;  3AE5 A;  3P1W A;  3QFA A;  3P4R A;  2VQB A;  1PXA A;  5KWF A;  4D03 A;  2WHD A;  2C64 A;  1DOC A;  2C72 A;  2GB0 A;  3K7Q X;  4AOX A;  4CNJ A;  4J2W A;  1D4E A;  2C75 A;  1LVL A;  2V5Z A;  3QSS A;  4CBQ A;  2IVD A;  3VR8 A;  2E4G A;  4P9S A;  2EQ8 A;  3CGE A;  1Q1W A;  2JB2 A;  3NTD A;  3IC9 A;  3DK9 A;  3AE2 A;  3BI5 A;  1OJT A;  1BWC A;  3FPZ A;  2R4J A;  3ADA B;  4OPG A;  2QCU A;  2FBW A;  2JK6 A;  1CC6 A;  2V60 A;  4X9N A;  4H4X A;  2XVH A;  4ADW A;  1DOD A;  1Y56 A;  2Q6U A;  3UTE A;  2TMD A;  2GEW A;  3QSE A;  4ZN0 A;  5BUL A;  4U8N A;  3CPI G;  5KOW A;  1PBD A;  4YKG A;  2RGJ A;  4CY6 A;  3ICR A;  1KFY A;  2FJE A;  3CMM A;  2WP5 A;  1VRQ B;  4AP3 A;  4CRT A;  1XPQ A;  3K7M X;  1JRX A;  4H50 A;  3NYE A;  4K22 A;  1L9E A;  2E1M A;  2C65 A;  2QA1 A;  4G73 A;  1GTH A;  4HB9 A;  4YXD A;  4Z2R A;  2WOI A;  1CJ3 A;  1OJD A;  4U8J A;  4EIQ A;  1QO8 A;  2YLT A;  5GSN A;  2OLO A;  3ALM A;  2V6O A;  1ELI A;  4A65 A;  3ALL A;  3H8I A;  1ONF A;  1EL5 A;  3QVR A;  2WEU A;  3PS9 A;  4CY8 A;  1GV4 A;  2Z5Y A;  2XLU A;  1ZP0 A;  5JCK A;  1N4W A;  1P2E A;  2O9Z A;  2AQJ A;  2ZBW A;  3AEC A;  1OJC A;  1GT8 A;  2YG6 A;  2WDQ A;  2QA2 A;  4GAP A;  1ZY8 A;  2XFP A;  2CFY A;  4Z24 A;  5IPY A;  5FS7 A;  1M6I A;  4K5R A;  5HYM A;  3UKL A;  4GRT A;  2OLN A;  3UKF A;  2WQY A;  2YVG A;  4M52 A;  3AE7 A;  3AEE A;  3VR9 A;  4B1B A;  1LPF A;  2PYX A;  1FEB A;  1F8R A;  1DJQ A;  1NEN A;  1GOS A;  2GQF A;  1JU2 A;  2A8X A;  4EM3 A;  1CL0 A;  1Y56 B;  2CVJ A;  1ZMD A;  2R0G A;  4GDE A;  5EB5 A;  3PVC A;  4Z26 A;  5KVH A;  4APN A;  4HA6 A;  3T2Y A;  5JCL A;  3ITJ A;  2XLP A;  1XDI A;  1GRG A;  3SZ0 A;  3UKP A;  3F8R A;  2W0H A;  3LOV A;  4Y4M A;  4NEV A;  3GRT A;  2YM1 A;  2B9X A;  3IHG A;  3L8K A;  3T2K A;  4JNA A;  4RSL A;  1ZX9 A;  3DJE A;  1H81 A;  4TLZ A;  4X9M A;  1KNR A;  4Z2T A;  3RP8 A;  3UTG A;  4EM4 A;  1NAA A;  5C3J A;  3GMC A;  4YTP A;  1EL9 A;  2V3A A;  2IVE A;  2VVM A;  4EIP A;  2NPX A;  4C5O A;  2JAE A;  2C66 A;  4FDC B;  5HHF A;  1P2H A;  3UTH A;  4ECH A;  1Y0P A;  2XFU A;  4A79 A;  5HY5 A;  4BV6 A;  4XWR A;  4CCQ A;  1ZKQ A;  1CJ4 A;  3GWF A;  3RED A;  2XFN A;  2XLR A;  3VRB A;  4OCG A;  4AT0 A;  1GES A;  3FG2 P;  2RAB A;  2I0Z A;  3QVP A;  4C74 A;  2YR6 A;  5M0Z A;  5JCI A;  2YVF A;  1B8S A;  2BK5 A;  4J56 A;  1PN0 A;  2BK3 A;  2XVF A;  3JSK A;  3DK8 A;  3QSM A;  2OAL A;  3T2Z A;  3GSI A;  4H2P A;  4BJZ A;  2XLS A;  1M64 A;  3UOV A;  1GET A;  1S7M A;  1EL8 A;  4RG3 A;  3L5O A;  3UOZ A;  4OPT A;  1MOK A;  1S3B A;  3BI4 A;  3I6D A;  3O0H A;  1YY5 A;  2Q0K A;  4DNA A;  5LV9 A;  3NGC X;  3CNT A;  1L0V A;  3IWA A;  4C3X A;  1S2Q A;  2Y6R A;  5KMP A;  3SZC A;  4BK3 A;  3DME A;  1LQU A;  3GDN A;  2R9Z A;  2YAU A;  1CF3 A;  3SZW A;  2GR0 A;  2YR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...