1NHPA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 137
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhpA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA02
1DOBA 1LJ1A 1Y0PA 2VVLG 3ISHA 4TLXA 1H83A 2JB3A 4J31A 2OLOA 3VRDB 3VRAA 1RSGA 4UDPA 4M52A 3BI4A 4H4WA 1N4VA 5JCKA 1E1KA 2FJAA 2XFUA 1Y56A 2C73A 4J33A 4TLZA 3P4PA 4REKA 3UOXA 4A99A 2YM2A 4OPDA 1PJ6A 4U8NA 4APNA 2YLZA 4NTDA 1KSUA 2H88A 5M10A 2GH5A 2R4EA 1NDAA 3GYIA 1L9CA 3GMCA 2WPFA 4XWZA 2ZZBA 2GB0A 1JRYA 4YTNA 1H7XA 3CGCA 3F8PA 2WOIA 1PBEA 1Q9IA 1CHUA 2WDQA 3UKQA 1ZMDA 3DK8A 1FCDA 4K22A 3NTDA 2CVJA 4YT0A 2C65A 4USQA 2RABA 2AQJA 1K4QA 2WP5A 1VDCA 3PO7A 5KOXA 2B9YA 3EPTA 1VG0A 4CY6A 3RP7A 2TPRA 4IA6A 2YG6A 1BGNA 1TYTA 1GTEA 1CL0A 1VRQB 2XCGA 2BC1A 1KNPA 1FECA 2C66A 5LV9A 3D8XA 3DK9A 2R4JA 3AEAA 3AECA 4JY3A 3NIXA 1H82A 1D4CA 2WPEA 4B64A 5HY5A 4FDCB 4XXGA 1ZOYA 4U8IA 1UKVG 1E39A 4H2PA 3LOVA 3QFAA 2EQ8A 2WESA 1RYIA 3PS9A 1YQZA 4EMWA 2B7RA 4AOSA 4H4XA 1E6EA 4AP3A 2X3NA 5HXIA 1ZKQA 4ADWA 3UOZA 3UTHA 4UP3A 3SGLA 4Z25A 3UP5A 2YLRA 2QCUA 1BF3A 4FK1C 4AT0A 2BCGG 1D5TA 3AXBA 1EL9A 1QLBA 2ARDA 2PYXA 2OALA 4EIQA 2NVKX 3P4RA 4PAAA 3SFDA 3UKKA 4OCGA 3NRNA 4JQ9A 3ZDNA 2WU5A 4A65A 3NT6A 5HYMA 4JNAA 1GOSA 1MOKA 1GESA 1EL7A 3QSEA 3CGEA 2IVEA 2EQ9A 4K7ZA 1QJDA 1VQWA 3AEBA 2F5ZA 1RP0A 5EB4A 5FS8A 3CPIG 3HZLA 4H7UA 2YR6A 3II4A 1DJNA 5JCMA 2HQMA 1NG3A 2BC0A 2YLSA 3FMWA 4YTMA 1F3PA 2FJDA 4A9WA 1PXAA 4E0VA 2Y6QA 3FBSA 3C4NA 4C77A 3CNDA 1K0IA 1K0LA 3T37A 1GV4A 2JK6A 4B69A 4YKGA 1DOEA 2WP9A 2YQUA 1DODA 1PBFA 2BS4A 4U8KA 3WE0A 1KFYA 4NTEA 4JN9A 3RP6A 2BCPA 3JSKA 4U8LA 1PBCA 2XVIA 2YLWA 2B76A 1KNRA 1GRTA 2GQWA 3OC4A 3P1WA 1B5QA 4IV9A 2Y6RA 2XFNA 1L9EA 3GRSA 1CJ3A 2XVHA 4GUVA 3K7QX 1PBBA 3VRBA 4BK2A 4YSZA 3GD4A 4NEWA 4H4ZA 3ICSA 1N1PA 2GAHB 2GR2A 3GD3A 2C76A 2WU2A 1BKWA 2XVEA 4EM4A 1CJCA 1JNRA 4H2QA 1LPFA 1O94A 1PN0A 2XLSA 4GDPA 5J7XA 3QSSA 4RG4A 5EBKA 4I58A 3ICRA 5CQFA 3ALJA 5U1OA 3C4AA 4A6NB 2VZ2A 1E1LA 1PBDA 1W4XA 5KVHA 4Z26A 5HHFA 1S2QA 4NZHA 3UKFA 3NYCA 3ZYXA 2JBVA 3DGHA 3NNEA 2Q0KA 3CN8A 3BHKA 1NEKA 4IVMB 4DSGA 4K2XA 3UOVA 1S3EA 3IHGA 1IUWA 1ZX9A 2XFQA 4FX9A 3EAOA 2V61A 1KSSA 2CULA 5DBJA 2CFYA 4TM3A 1PDHA 3NYFA 3VR9A 2DKIA 4N9XA 4ZN0A 2WPCA 3KPFA 2YG5A 5IQ4A 3AB1A 4Y4NA 3CNJA 2VQ7A 4P9SA 2CDUA 3VR8A 3AE3A 2C64A 2YVFA 1NHQA 5JCIA 4JNQA 2OLNA 1GTHA 2YG3A 2XLRA 3V3NA 3C96A 1OJCA 4EQXA 2VVLA 1YQ3A 3G5RA 2WOWA 3BNUA 4K8DA 4CCRA 2YM1A 1LQTA 3AD8B 4YWOA 3LZWA 3CNPA 2OAMA 1XANA 2XDOA 3E1TA 4TM1A 4C74A 3QJ4A 3DJEA 3KKJA 1D7LA 1FL2A 2Q0LA 1PJ5A 4U2SA 4YSXA 4NEVA 3Q6JA 3DK4A 3CPJG 3KD9A 3NK0X 3AE2A 1GREA 4U8JA 4CCQA 2YLXA 4O5QA 4PABA 4UDQA 2XVJA 3KU9A 2ACZA 4Y4LA 1MXTA 4B68A 3NGCX 1DXLA 3CTYA 2IVDA 1DNCA 2WP6A 2X99A 3I3LA 3OZ2A 2IIDA 1GXFA 3SM8A 3AD9B 2C3CA 2E1MA 3NN6X 2QAEA 2X50A 3SQPA 1GERA 3DJDA 4H4YA 3AE5A 1TDNA 3CIRA 4KX6A 2YR4A 1OJAA 2ZZCA 1IUSA 1Z6LA 2JKCA 4CBQA 4Z43A 2JB1A 4O5UA 1QO8A 2OA1A 2YG4A 3AWIA 3P9UA 3COXA 5EB5A 4CY8A 3PVCA 3IF9A 3NTAA 2C75A 2NPXA 1AOGA 3LJPA 3NH3X 4EQRA 4DNAA 5JCLA 2A87A 2I0ZA 2YLTA 1GSNA 3IHMA 3NKSA 3IC9A 3KVEA 4YXDA 1REOA 4Z24A 3B3RA 4H50A 4AT2A 1Y56B 3GDPA 1BZLA 2GVCA 5KVIA 3UTFA 1P2HA 1S2YA 1YKJA 1TRBA 2BK4A 1IUUA 4H2RA 1IUTA 3UKHA 5GRTA 1ZY8A 5U25A 1NHSA 2TMDA 1PJ7A 1F8WA 3ATRA 1TDFA 1F8SA 1VG9A 2QA2A 1GRBA 2VRLA 3AE7A 3BNMA 3H8LA 4CRTA 1EL5A 3CGBA 5KWFA 2GQFA 1JNZA 4IA5A 3F8DA 4RSLA 2GV8A 1B37A 3FIMB 3FG2P 4H4TA 4BJZA 1XDIA 2A8XA 2Q6UA 1YQ4A 4A5LA 4YSYA 1H84A 1NENA 3CGDA 3BI5A 4TM4A 1H7WA 2C70A 3UKLA 3V76A 5BUKA 1NPXA 2GMHA 4AP1A 3DJGX 1M64A 4HB9A 2W0HA 3GMBA 5FS9A 1ONFA 2XFPA 2XYOA 2PHHA 3REDA 3AE9A 1JU2A 3CNTA 4OPTA 1F6MA 2AAQA 2BK3A 3ABVA 3QSMA 3O0HA 3AEDA 2V3AA 3RHAA 4XWRA 3ADAB 1M6IA 4LIIA 4K5RA 1PS9A 4OPIA 4GCMA 1O5WA 2APGA 3K30A 3KLJA 4B66A 3GDNA 1MO9A 5U63A 3NHOX 5BULA 2BXSA 1TDEA 2VVMA 1KF6A 1CJ2A 2XFOA 3LADA 1N4UA 2XLPA 2Z5YA 2BXRA 4J36A 5J60A 4H4VA 2Q7VA 4BK3A 4H4RA 4IVOB 2WHDA 5GSNA 2YG7A 3RP8A 1B4VA 1JRZA 2BABA 4UDRA 1LQUA 1ZOVA 4WX1A 3AE6A 4YKFA 2X8HA 4DGKA 1EBDA 2YVJA 5C2TA 3GWFA 2WBAA 2VQBA 3D1CA 3UP4A 1NAAA 1PXBA 3NK2X 1SEZA 2VOUA 5BRTA 5C3JA 2BACA 2R0PA 1CC4A 4OPLA 5IPYA 3URHA 3VQRA 4DSHA 2B7SA 3AEFA 1XPQA 1ELIA 2EQ6A 4RG3A 2VRMA 4X4JA 2X8CA 4X9MA 2WOVA 4X9NA 4EMIA 1OJTA 1GRFA 2GMJA 2R0GA 2V3BA 3UCLA 2V6OA 5M0ZA 1CC2A 1COYA 1D4EA 2UZZA 1JEHA 2V5ZA 2BS3A 4BV6A 2O9ZA 3NG7X 2GRTA 3R9UA 1ZK7A 3K7MX 5L46A 1DJQA 2BA9A 2ZBWA 1N4WA 2XLUA 1L9DA 1GT8A 5BVAA 2X8GA 5KOWA 2DKHA 3DJJA 5CKUA 1XHCA 4Z2RA 1Q1RA 1ZP0A 1BGJA 4JY2A 4H4UA 4OPCA 2GAGB 1IUXA 5TR3A 1GEUA 4GR1A 2WEUA 1TDOA 4D04A 4JDRA 2AR8A 1IUVA 4ZCCA 4A79A 3BHFA 1HYUA 1DOCA 4HA6A 4H4PA 3L1RA 3B6DA 4EIPA 1H6VA 1NHRA 2YAUA 4J2WA 1H86A 4U2LA 2R45A 1PXCA 1GALA 3H4KA 2XVFA 4H2NA 4BK1A 2V60A 2YR5A 4B1BA 2Z5XA 4U8OA 1GNDA 1LV0A 4AOXA 3LZXA 3M13A 3SFEA 4ECHA 3M0OA 4Z2TA 2WETA 4OPUA 1V59A 1ZDLA 4ZCDA 3ICTA 2FJEA 3FPZA 4OVIA 3UKAA 2C7GA 2BK5A 1BWCA 4KPRA 2R46A 1D7YA 2ZZ0A 1H81A 3EANA 3QFBA 3LB8A 4EMJA 3G5QA 2BS2A 4Z2UA 4GDEA 4J34A 2WQYA 4GRTA 1JRXA 2FBWA 4B67A 5FS7A 4USRA 1FEAA 3AYIA 4OPGA 4D03A 1OJ9A 1P2EA 4B65A 3GSIA 1FOHA 2GR0A 2E5VA 3Q9TA 1TDKA 4U2TA 5KRQA 1GRAA 2J3NA 4BJYA 3S61A 2R9ZA 2WDVA 2RGJA 3NN0X 2YVGA 5JCNA 4EM3A 4GF7A 4WCTA 1JOAA 2FJBA 1E7PA 3AE4A 3AYLA 3UKPA 5FS6A 4A6NA 4K5SA 3AEGA 3RNMA 3UOYA 3CPHG 1PHHA 3H8IA 1E1MA 3DH9A 3UTEA 1KDGA 1Q1WA 3ITJA 2GR1A 4U8MA 3DGZA 4EQWA 4Z44A 4ICYA 3NYEA 1GETA 4C3XA 1CC6A 3AE1A 3AD7B 4TM0A 3IWAA 2H89A 2B9XA 1EL8A 3QVRA 2JAEA 1F8RA 1LTXR 3EF6A 3S5WA 1LVLA 1ZMCA 1NHPA 1GPEA 2A89A 1L0VA 3G5SA 4FK1A 4Y4MA 4C5OA 4C3YA 1B8SA 5ER0A 1X31B 3BI2A 1GRGA 2QA1A 1D4DA 3LXDA 4H4SA 1O95A 3I6DA 1YY5A 3V3OA 1CBOA 4LA1A 3NK1X 4J57A 1CF3A 2BYBA 2WS3A 3F8RA 3M12A 5IQ1A 2YWLA 4EQSA 3ALMA 1FEBA 3P4SA 3AE8A 2GEWA 2E4GA 3AEEA 3GYJA 1OJDA 2GR3A 2GF3A 3ATQA 3L8KA 3UTGA 4J56A 2XLTA 3GRTA 3GWDA 4I59A 2EQ7A 1CJ4A 4A7AA 2RGOA 2C72A 4U8PA 1NG4A 5FMHA 1IJHA 4CNKA 5KXJA 4LU6A 2R0CA 5EOWA 3NLCA 2RGHA 2C3DA 1TYPA 3KA7A 4B63A 2C67A 1K0JA 3DMEA 3K7TA 4YSHA 4BURA 3AYJA 3QVPA 1E1NA 4NTCA 2WDRA 4YTPA 1S3BA 1GRHA 3DA1A 3CNSA 4CNJA 3P4QA 4H4QA 2JB2A 4MJWA 3ALLA 2B9WA
chains in the Genus database with same CATH superfamily
2OLOA 2PODA 4UDPA 5JCKA 3P4PA 2XSXA 3R25A 4OPDA 3UCDA 4APNA 4NTDA 1KSUA 1S7MA 3GMCA 1TE6A 2GB0A 3CGCA 3F8PA 3DK8A 3VDGA 2CVJA 4YT0A 3T9PA 2WP5A 1VDCA 2HXUA 2B9YA 3EPTA 2PTXA 2OZ8A 2OG9A 1FECA 3D8XA 4JY3A 2WPEA 5G5GB 4XXGA 1UKVG 2EQ8A 2OPJA 3NVZB 4EMWA 4H4XA 1F9CA 2X3NA 3UOZA 3UTHA 3SGLA 4G7FA 3EEZA 2ARDA 3P4RA 4JQ9A 3SXIA 2WU5A 4A65A 3NT6A 4JNAA 1GOSA 1EL7A 3SN1A 2AKZA 4GAVA 3AEBA 2F5ZA 1RP0A 4IT1A 1ZXIC 3CPIG 2YR6A 2HQMA 1NG3A 2OZTA 1F3PA 1PXAA 1K0LA 3T37A 1DOEA 1PBFA 3WE0A 2BCPA 4U8LA 3OC4A 2Y6RA 1L9EA 2OKTA 6ENLA 3GD4A 4NEWA 5C3JA 3R0KA 2GAHB 4H83A 2GR2A 3CNSA 4FP1A 3HRDC 4I58A 2VZ2A 4Z26A 1S2QA 4NZHA 3DGHA 3GD6A 3RCYA 3NNEA 3CN8A 1NEKA 1IUWA 1ZX9A 3HYWA 5DBJA 4TM3A 3HYVA 3NYFA 4N9XA 4MMWA 3KPFA 3UJFA 3CNJA 4P9SA 5JCIA 2YG3A 2PTYA 3G5RA 3BNUA 1VQZA 2YM1A 4C74A 4NEVA 4UDQA 2XVJA 3KU9A 1MXTA 3V5CA 3OZ2A 3SM8A 2C3CA 2E1MA 2QAEA 2X50A 4H4YA 3D9XA 3CIRA 3FCPA 1OJAA 1IUSA 1N60C 1MUCA 3QLDA 2JB1A 3AWIA 4CY8A 3PVCA 2NPXA 4DNAA 2A87A 3NKSA 3IC9A 3KVEA 3HW2A 3SJNA 1S2YA 3UKHA 1MDRA 4GAPA 1JROA 1GRBA 1KKOA 4GGHA 5IDZA 4IA5A 3A7UA 2GV8A 3FG2P 4H4TA 2A8XA 1YQ4A 3BI5A 3CGDA 3V76A 2PP3A 4DYEA 4AP1A 3DJGX 3T31A 4G73A 3GMBA 3QTPA 2XYOA 3AE9A 1JU2A 3ABVA 3RHAA 3QSMA 3AEDA 1SJBA 2V3AA 4LIIA 4K5RA 1TZZA 4B66A 1N4UA 2Z5YA 4A6GA 4IVOB 5GSNA 2BABA 4UDRA 3AE6A 2AL2A 4DGKA 2GGHA 2VQBA 3RO6A 3NK2X 1SEZA 2VOUA 5BRTA 4NWZA 5IPYA 4DSHA 2PU1A 1SJCA 4IHCA 3UXKA 4EMIA 2GMJA 5M0ZA 3UCCA 2UZZA 4BV6A 2O9ZA 3NG7X 3R9UA 1ZK7A 3P3BA 3K7MX 1DJQA 5BOEA 5KOWA 3DJJA 1XHCA 1X2GA 3DEQA 4GR1A 1IUVA 4ZCCA 2HXTA 3SZ0A 3B6DA 4U2LA 2E3TA 3Q45A 4BK1A 2W3SA 4B1BA 4U8OA 2OZ3A 3FVDA 4KPLA 2GSHA 4ZCDA 3ICTA 3SZFA 4OVIA 2BK5A 4GYPA 2P88A 3EANA 3QFBA 3LB8A 4Z2UA 3FYYA 4GDEA 4B67A 3I6EA 4OPGA 4B65A 3GSIA 1FOHA 2AKMA 3T0KA 1GRAA 3S61A 2R9ZA 3MKCA 2OFJA 4HNCA 3TOYA 3NN0X 1KN0A 1E7PA 3AE4A 4A6NA 3AEGA 4M0XA 3H8IA 1E1MA 3ITJA 4Z44A 4ICYA 3VCCA 2B9XA 1EL8A 3EF6A 1L0VA 1GPEA 3ZLFA 1B8SA 1X31B 3BI2A 1GRGA 4J57A 2WS3A 2YWLA 3ALMA 1OJDA 4K8GA 3GRTA 3GWDA 4I59A 1CJ4A 1ECQA 4U8PA 1NG4A 4CNKA 2C67A 3SX6A 2PSNA 4BURA 3AYJA 4H2HA 2ONEA 3NXLA 2PS2A 4IP4A 4H4QA 2JB2A 3ALLA 1DOBA 1LJ1A 3JW7A 4TLXA 1H83A 2JB3A 3BI4A 1N4VA 1Y56A 4GYPC 3DESA 1PJ6A 2H88A 2GH5A 2R4EA 1N5WC 4HYRA 1KKRA 1P48A 1JRYA 2WOIA 4A3RA 1PBEA 1ZMDA 4ZA0A 1FCDA 4K22A 3PO7A 5KOXA 4CY6A 4IA6A 2YG6A 1CL0A 2PPGA 3UXLA 3NIXA 1D4CA 2DW7A 3CAWA 5G5HB 1ZOYA 3LOVA 3QFAA 1E6EA 4AP3A 3KUMA 5HXIA 2PTWA 1XS2A 2BCGG 1EL9A 2OALA 3NRNA 3U9IA 3MY9A 2EQ9A 1QJDA 1JRPA 3II4A 5JCMA 2BC0A 4EWJA 3FMWA 2C4CA 4A9WA 4E0VA 3FBSA 1BKHA 3C4NA 1GV4A 2WP9A 3D47A 4U8KA 1KFYA 5FJTA 5KMQA 3GRSA 1CJ3A 5KNLA 4YSZA 4H4ZA 1N1PA 3VFCA 3GD3A 2WU2A 4H2QA 1N63C 1LPFA 3ICRA 5CQFA 4A6NB 1PBDA 5HHFA 3V3WA 1EC8A 3NYCA 3ZYXA 4IVMB 3BHKA 3UOVA 3IHGA 3I4KA 1PDYA 1PDHA 2YG5A 5IQ4A 2VQ7A 3VR8A 3AE3A 2AL2B 2OLNA 4J3ZA 4EQXA 4DXKA 3LZWA 2XDOA 3E1TA 3IJLA 3DJEA 2Q0LA 2OQYA 3DK4A 4CCQA 4PABA 2ACZA 3FV9A 4B68A 3NGCX 1DXLA 3CTYA 2WP6A 3I3LA 2IIDA 1GXFA 3AD9B 1T3QC 3NN6X 4JN7A 4G74A 4KX6A 2ZZCA 2JKCA 4Z43A 2OA1A 5EB5A 3COXA 2C75A 4EQRA 5JCLA 4YXDA 1EC9A 1REOA 1Y56B 2XH4A 2GVCA 4ENLA 1YKJA 2QVHA 1WYGA 1IUUA 2BK4A 1IUTA 2P8CA 3ATRA 1TDFA 1VG9A 4ZOHB 3D46A 2VRLA 3BNMA 1EL5A 2GQFA 3F8DA 3ZVIA 4RSLA 4BJZA 1H7WA 2C70A 1M64A 4HB9A 2PHHA 1FFVC 4OPTA 4DN1A 1F6MA 2BK3A 3O0HA 2OLAA 3KLJA 1JDFA 5U63A 5BULA 4A35A 1TDEA 4JN8A 2XFOA 2XLPA 4HPNA 4J36A 5J60A 4BK3A 2YG7A 1B4VA 3SBFA 1ZOVA 4WX1A 1EBDA 3GWFA 3UP4A 3ES7A 4M6UA 2B7SA 1XPYA 2EQ6A 2VRMA 3RR1A 3DGBA 2X8CA 4KWSA 2WOVA 3UCLA 1CC2A 1D4EA 4E8GA 2BS3A 3N4EA 2GRTA 1WUEA 2BA9A 2ZBWA 4HNLA 2XLUA 3H8AA 4Z2RA 1Q1RA 4K1WA 2BRYA 4F4RA 4OPCA 2GAGB 3QN3A 1IUXA 5FJOA 1SJDA 2XGZA 1TDOA 4JDRA 4A79A 3UGVA 1HYUA 4EIPA 3UJSA 2YAUA 1H86A 1GALA 3H4KA 2XVFA 2Z5XA 1KD0A 1LV0A 3ZVHA 2FYMA 3M13A 3SFEA 4OPUA 3P0WA 3IK4A 5FJRA 3FPZA 2C7GA 1BWCA 1D7YA 2ZZ0A 3SZCA 2P3ZA 3TWAA 3PWGA 5KMPA 4GRTA 1JRXA 5FS7A 4USRA 3T2KA 3Q4DA 4D03A 1OJ9A 1OEPA 3TJIA 2E5VA 3Q9TA 1TDKA 3T4WA 2J3NA 2RGJA 3CYJA 3K1GA 4H1ZA 1JOAA 2FJBA 3T8QA 3AYLA 5FS6A 4K5SA 4ROPA 3H7VA 3DG3A 1KCZA 2PCEA 3UTEA 1N61C 3DGZA 4EQWA 1GETA 1CC6A 4E4FA 3AD7B 2H89A 2JAEA 1LTXR 3S5WA 1NHPA 4FK1A 4C3YA 4G6HA 2ZC8A 2QA1A 3LXDA 1O95A 3V3OA 1CBOA 4LA1A 3NK1X 1CF3A 4EQSA 3P4SA 3S5SA 3AE8A 3AEEA 3GYJA 1EBGA 3ATQA 3L8KA 4J56A 2GDQA 3TJ4A 1IJHA 2R0CA 5EOWA 3NLCA 3KA7A 3V4BA 3K7TA 4YSHA 4E6MA 2WDRA 4YTPA 3P4QA 4TVYA 2O56A 2VVLG 3ISHA 4M52A 2FJAA 4TLZA 2XFUA 3UOXA 4A99A 3S47A 4U8NA 4G6GA 3VC5A 5M10A 1PDZA 3GYIA 4XWZA 2ZZBA 4YTNA 1CHUA 3SN0A 3GYXA 4USQA 3QPEA 3EUB3 1VG0A 3RP7A 2TPRA 2OO6A 3PG6A 1GTEA 2XCGA 2BC1A 2C66A 5ENLA 7ENLA 1JPMA 4G8TA 1JPDX 3T6CA 3DK9A 3AECA 4B64A 5JRBA 5HY5A 4FDCB 4U8IA 1E39A 3THUA 2WESA 1RYIA 2B7RA 1IYXA 3RRAA 4UP3A 1FFUC 2GGGA 4MGGA 1BF3A 2PYXA 4PAAA 4OCGA 4KEMA 1EC7A 3QKEA 1MOKA 2IVEA 3SN4A 4K7ZA 5FS8A 3HZLA 4H7UA 3ES8A 4YTMA 2YLSA 1JCTA 3A7AA 3GY1A 3CNDA 1K0IA 4B69A 2JK6A 3FXGA 4YKGA 2YQUA 1DODA 2BS4A 3OPSA 4NTEA 4JN9A 3JSKA 2XVIA 2YLWA 2B76A 1GRTA 1B5QA 3TTEA 2XFNA 2XVHA 4GUVA 1PBBA 4BK2A 3ICSA 2XVEA 2C76A 1CJCA 1PN0A 5J7XA 4RG4A 5EBKA 3ALJA 3MZNA 2Q0KA 4DSGA 4K2XA 3CT2A 1S3EA 2XFQA 4FX9A 2V61A 1KSSA 2CFYA 3VR9A 2ZADA 4E5TA 2WPCA 3AB1A 4Y4NA 4HN8A 2CDUA 3TQPA 2YVFA 1NHQA 4JNQA 1GTHA 3V3NA 2XLRA 2VVLA 4CCRA 3R1ZA 3CNPA 2OAMA 4TM1A 4MKSA 3KKJA 1D7LA 4U2SA 3DFHA 3Q6JA 2XH7A 3NK0X 2XH2A 3AE2A 1GREA 4U8JA 2NQLA 5EU9A 2IVDA 2PGEA 3SQPA 1GERA 4II2A 3AE5A 1TDNA 3MWCA 2YR4A 2YG4A 3P9UA 3IF9A 3P93A 3IHMA 2YLTA 1GSNA 3B3RA 4H50A 1BZLA 1TKKA 3UTFA 2RDXA 1TRBA 5FJUA 5GRTA 3D1CA 2QA2A 3AE7A 4FI4A 3CGBA 5KWFA 1B37A 3NS1B 2Q6UA 3R10A 4A5LA 4TM4A 3UKLA 5BUKA 1RM6B 2GMHA 4K2SA 3VC6A 2W0HA 3DIPA 2XFPA 5BOFA 3CNTA 2AAQA 4XWRA 4JHMA 3PFRA 3PWIA 1M6IA 3FJ4A 4GCMA 1O5WA 3GDNA 1MO9A 2W54A 2BXSA 2VVMA 1CJ2A 1E9IA 4IZGA 4KT2A 4H4VA 1JRZA 4YKFA 2YVJA 2WBAA 4IP5A 3KPKA 1NAAA 1PXBA 4IL0A 1CC4A 3CMMA 3TCSA 3DERA 4X9MA 4X9NA 1OJTA 2GGJA 1FHVA 2V6OA 3TW9A 4ZCWA 3VCNA 2V5ZA 3N6HA 4X2PA 1R0MA 5L46A 4IL2A 1N4WA 3NVWB 1L9DA 1GT8A 5BVAA 3CXBA 2MUCA 3DFYA 2DKHA 2HNEA 3RITA 5CKUA 5FJPA 3UJ2A 1GEUA 2WEUA 3DG6A 3ZLGA 4HA6A 1SJAA 4H4PA 3NVVB 2R45A 1PXCA 1NU5A 2HZGA 4GISA 1GNDA 3LZXA 4ECHA 4Z2TA 1V59A 3OZYA 4DHGA 2FJEA 3UKAA 2R46A 3DDMA 4KPRA 3GC2A 3G5QA 4J34A 2WQYA 2FBWA 1FEAA 3HYXA 1SB3B 5KRQA 1FO4A 4BJYA 2WDVA 1RVKA 2YVGA 4EM3A 4GF7A 3UKPA 1ONEA 3RNMA 3UOYA 4TVWA 1PHHA 1YEYA 3ZVHB 1Q1WA 1MRAA 4U8MA 2E5AA 3NYEA 3AE1A 4TM0A 2PP1A 1R6WA 2OX4A 4H4SA 3I6DA 2BYBA 1FEBA 2GR3A 2GF3A 3NVYB 3UTGA 3BOXA 3TWBA 3A7RA 4A7AA 3BJSA 3BSMA 1NELA 5FMHA 5KXJA 4LU6A 3IJIA 2PU0A 4HCLA 2RGHA 2I5QA 2C3DA 1TYPA 4B63A 3DMEA 3T2ZA 1S3BA 1P43A 4YWSA 1GRHA 2MNRA 3DA1A 3U4FA 4CNJA 3B97A 1ELSA 4MJWA 2B9WA 1FIQB 1Y0PA 4J31A 3VRDB 3VRAA 1RSGA 2CHRA 2AL1A 4H4WA 4J33A 1E1KA 2C73A 4REKA 2YM2A 2YLZA 3SQSA 1NDAA 1L9CA 2WPFA 1H7XA 3NFUA 1Q9IA 3UKQA 2WDQA 2PA6A 4G9KA 3NTDA 2C65A 1V97A 2RABA 2AQJA 1K4QA 3SSZA 1TYTA 1BGNA 4HCDA 1VRQB 1KNPA 5LV9A 3R0UA 3AEAA 2R4JA 1H82A 4H2PA 3SY4A 2PP0A 3OZMA 3PS9A 3N4FA 1YQZA 3N6JA 4AOSA 1ZKQA 4ADWA 2BRAA 3R07C 4Z25A 3UP5A 2YLRA 2QCUA 1STZA 4FK1C 4AT0A 1D5TA 3R11A 3AXBA 1QLBA 3OP2A 4EIQA 2NVKX 3UKKA 3SFDA 3ZDNA 5HYMA 3AMZA 1GESA 3QSEA 3CGEA 1VQWA 5EB4A 1DJNA 2P0IA 2FJDA 2Y6QA 4C77A 2P8BA 3RP6A 3MUCA 4DWDA 1PBCA 1KNRA 2GQWA 3P1WA 1L8PA 4IV9A 1N62C 3K7QX 3VRBA 3RP8A 2QGYA 1BKWA 4EM4A 1JNRA 1O94A 2XLSA 4GDPA 4II3A 1H2IA 3V5FA 3QSSA 5U1OA 3C4AA 4J1OA 1E1LA 1W4XA 5KVHA 3UKFA 2JBVA 2PMQA 3EAOA 3RGTA 4HCHA 2CULA 2DKIA 4ZN0A 2C64A 3H70A 3IJQA 2PGWA 3NZGA 3C96A 1OJCA 1YQ3A 2WOWA 4K8DA 1BQGA 2QJJA 1LQTA 3AD8B 4YWOA 2XH0A 1XANA 3STPA 3QJ4A 1FL2A 1PJ5A 2OQHA 4YSXA 3CK5A 3CPJG 3KD9A 2YLXA 4O5QA 3L5OA 4Y4LA 3ZLHA 1WUFA 1DNCA 2X99A 3VA8A 3CB3A 3DJDA 1Z6LA 4CBQA 4O5UA 1QO8A 1FHUA 2GL5A 3LJPA 3NTAA 1AOGA 3NH3X 2I0ZA 4Z24A 1N5XA 2POZA 4AT2A 3GDPA 4E4UA 5KVIA 1P2HA 4H2RA 1ZY8A 5U25A 1NHSA 2TMDA 1PJ7A 1F8WA 1F8SA 3JZUA 3H8LA 2PTZA 4CRTA 1JNZA 3FIMB 3AM9A 1XDIA 4YSYA 1H84A 1NENA 2W3RA 1NPXA 3ENLA 5FS9A 1ONFA 3REDA 2W55A 3ADAB 2QDDA 1PS9A 4OPIA 2APGA 3K30A 5KMRA 3NHOX 2DW6A 1KF6A 3LADA 4GGBA 2BXRA 2Q7VA 4H4RA 2WHDA 1LQUA 3NO1A 2X8HA 1VDVA 3OTRA 5C2TA 3SR6B 2QJNA 3NRZB 3GO2A 1X2HA 2BACA 2R0PA 2GGIA 4OPLA 3URHA 3VQRA 3SYIA 3AEFA 1XPQA 3UJEA 1ELIA 4RG3A 3SZWA 4X4JA 1GRFA 4H19A 2R0GA 2V3BA 3H12A 1COYA 1JEHA 4GIRA 2X8GA 3I6TA 1ZP0A 1BGJA 1MNSA 3MQTA 4JY2A 4H4UA 1MDLA 3ETRB 5TR3A 3AN1A 4D04A 2AR8A 2FKPA 2QJMA 3BHFA 1DOCA 3L1RA 1H6VA 1NHRA 4J2WA 4H2NA 2OVLA 2V60A 2YR5A 4AOXA 3M0OA 3PK7A 2WETA 1ZDLA 1H81A 3T2YA 4EMJA 3DG7A 4GMEA 2BS2A 5KMSA 3AYIA 1P2EA 2GR0A 4U2TA 4NNJA 3UJRA 3OW1A 2QQ6A 5JCNA 1DTNA 4WCTA 2GGEA 4DX3A 3CPHG 3DH9A 3EKGA 2QDEA 1KDGA 2GR1A 3MSYA 4C3XA 3IWAA 5J04A 3QVRA 1F8RA 1LVLA 1ZMCA 2A89A 3G5SA 3B9JB 4Y4MA 4C5OA 5ER0A 4Z17A 1D4DA 3JVAA 1YY5A 3M12A 5IQ1A 3F8RA 2GEWA 2E4GA 3T14A 2XLTA 2EQ7A 4Z1YA 2RGOA 2C72A 1W6TA 4GFIA 1K0JA 3QVPA 1E1NA 4NTCA 1EBHA 3HPFA 3CXOA
chains in the Genus database with same CATH topology
1DOBA 1LJ1A 1Y0PA 2VVLG 3ISHA 4TLXA 1H83A 2JB3A 4J31A 2OLOA 3VRDB 3VRAA 1RSGA 4UDPA 4M52A 3BI4A 4H4WA 1N4VA 5JCKA 1E1KA 2FJAA 2XFUA 1Y56A 2C73A 4J33A 4TLZA 3P4PA 4REKA 3UOXA 4A99A 2YM2A 4OPDA 1PJ6A 4U8NA 4APNA 2YLZA 4G6GA 1KSUA 2H88A 1S7MA 4NTDA 2GH5A 2R4EA 5M10A 1NDAA 3GYIA 1L9CA 3GMCA 2WPFA 4XWZA 2ZZBA 2GB0A 1JRYA 4YTNA 1H7XA 3CGCA 3F8PA 2WOIA 1PBEA 1Q9IA 1CHUA 2WDQA 3UKQA 4G9KA 1ZMDA 3DK8A 1FCDA 4K22A 3NTDA 2CVJA 4YT0A 2C65A 3GYXA 2RABA 4USQA 2AQJA 1K4QA 2WP5A 1VDCA 3PO7A 5KOXA 2B9YA 3EPTA 1VG0A 4CY6A 3RP7A 2TPRA 4IA6A 2YG6A 3PG6A 1TYTA 1BGNA 1GTEA 1CL0A 1VRQB 2XCGA 2BC1A 1KNPA 1FECA 2C66A 5LV9A 3D8XA 3DK9A 2R4JA 3AEAA 3AECA 4JY3A 3NIXA 1H82A 5JRBA 2WPEA 1D4CA 4B64A 5HY5A 4FDCB 4XXGA 1ZOYA 4U8IA 1UKVG 1E39A 4H2PA 3LOVA 3SY4A 3QFAA 2EQ8A 2WESA 1RYIA 3PS9A 1YQZA 4EMWA 2B7RA 4AOSA 4H4XA 1E6EA 4AP3A 2X3NA 5HXIA 1ZKQA 4ADWA 2BRAA 3UOZA 3UTHA 4UP3A 3SGLA 4Z25A 3UP5A 2YLRA 2QCUA 1BF3A 4FK1C 4AT0A 2BCGG 1D5TA 3AXBA 1EL9A 1QLBA 2ARDA 2PYXA 2OALA 4EIQA 2NVKX 3P4RA 4PAAA 3SFDA 3UKKA 4OCGA 3NRNA 4JQ9A 3SXIA 2WU5A 3ZDNA 4A65A 3NT6A 5HYMA 4JNAA 1GOSA 1MOKA 1GESA 1EL7A 3QSEA 3CGEA 2IVEA 2EQ9A 4K7ZA 1QJDA 1VQWA 4GAVA 3AEBA 2F5ZA 1RP0A 5EB4A 5FS8A 3CPIG 3HZLA 4H7UA 2YR6A 3II4A 1DJNA 5JCMA 2HQMA 1NG3A 2BC0A 2YLSA 3FMWA 2C4CA 4YTMA 1F3PA 2FJDA 4A9WA 1PXAA 4E0VA 2Y6QA 3FBSA 3C4NA 4C77A 3CNDA 1K0IA 1K0LA 3T37A 1GV4A 2JK6A 4B69A 4YKGA 1DOEA 2WP9A 2YQUA 1DODA 1PBFA 2BS4A 4U8KA 3WE0A 1KFYA 4NTEA 4JN9A 3RP6A 2BCPA 3JSKA 4U8LA 1PBCA 2XVIA 2YLWA 2B76A 1KNRA 1GRTA 2GQWA 3OC4A 3P1WA 5KMQA 1B5QA 4IV9A 2Y6RA 2XFNA 1L9EA 3GRSA 1CJ3A 2XVHA 4GUVA 3K7QX 1PBBA 5KNLA 3VRBA 4BK2A 4YSZA 3GD4A 4NEWA 4H4ZA 3ICSA 1N1PA 2GAHB 2GR2A 3GD3A 2C76A 2WU2A 1BKWA 2XVEA 4EM4A 1CJCA 1JNRA 4H2QA 1LPFA 1O94A 1PN0A 2XLSA 4GDPA 5J7XA 4II3A 1H2IA 3QSSA 4RG4A 5EBKA 4I58A 3ICRA 5CQFA 3ALJA 5U1OA 3C4AA 4A6NB 2VZ2A 1E1LA 1PBDA 1W4XA 5KVHA 4Z26A 5HHFA 1S2QA 4NZHA 3UKFA 3NYCA 3ZYXA 2JBVA 3DGHA 3NNEA 2Q0KA 3CN8A 3BHKA 1NEKA 4IVMB 4DSGA 4K2XA 3UOVA 1S3EA 3IHGA 1IUWA 1ZX9A 2XFQA 4FX9A 3EAOA 2V61A 1KSSA 3HYWA 2CULA 5DBJA 2CFYA 4TM3A 1PDHA 3HYVA 3NYFA 3VR9A 2DKIA 4N9XA 4ZN0A 2WPCA 3KPFA 2YG5A 5IQ4A 3AB1A 4Y4NA 3CNJA 2VQ7A 4P9SA 2CDUA 3VR8A 3AE3A 2C64A 2YVFA 1NHQA 5JCIA 4JNQA 2OLNA 1GTHA 2YG3A 2XLRA 3V3NA 3C96A 1OJCA 4EQXA 2VVLA 1YQ3A 3G5RA 2WOWA 3BNUA 4K8DA 4CCRA 2YM1A 1LQTA 3AD8B 4YWOA 3LZWA 3CNPA 2OAMA 1XANA 2XDOA 3E1TA 4TM1A 4C74A 3QJ4A 3DJEA 3KKJA 1D7LA 1FL2A 2Q0LA 1PJ5A 4U2SA 4YSXA 4NEVA 3Q6JA 3DK4A 3CPJG 3KD9A 3NK0X 3AE2A 1GREA 4U8JA 4CCQA 2YLXA 4O5QA 4PABA 3L5OA 4UDQA 2XVJA 3KU9A 2ACZA 4Y4LA 1MXTA 4B68A 3NGCX 1DXLA 3CTYA 2IVDA 1DNCA 2WP6A 2X99A 3I3LA 3OZ2A 2IIDA 1GXFA 3SM8A 3AD9B 2C3CA 2E1MA 3NN6X 2QAEA 2X50A 3SQPA 1GERA 4II2A 3DJDA 4H4YA 3D9XA 1TDNA 3AE5A 3CIRA 4G74A 4KX6A 2YR4A 1OJAA 2ZZCA 1IUSA 1Z6LA 2JKCA 4CBQA 4Z43A 2JB1A 4O5UA 1QO8A 2OA1A 2YG4A 3AWIA 3P9UA 3COXA 5EB5A 4CY8A 3PVCA 3IF9A 3NTAA 2C75A 2NPXA 1AOGA 3LJPA 3NH3X 4EQRA 4DNAA 5JCLA 2A87A 2I0ZA 2YLTA 1GSNA 3IHMA 3NKSA 3IC9A 3KVEA 4YXDA 1REOA 4Z24A 3B3RA 4H50A 4AT2A 1Y56B 3GDPA 1BZLA 2GVCA 5KVIA 3UTFA 1P2HA 1S2YA 1YKJA 1TRBA 2BK4A 1IUUA 4H2RA 1IUTA 3UKHA 5GRTA 1ZY8A 5U25A 1NHSA 2TMDA 1PJ7A 1F8WA 3ATRA 1TDFA 1F8SA 1VG9A 4GAPA 2QA2A 1GRBA 2VRLA 3AE7A 3BNMA 3H8LA 4CRTA 1EL5A 3CGBA 5KWFA 2GQFA 1JNZA 4IA5A 3F8DA 4RSLA 2GV8A 1B37A 3FIMB 3FG2P 4H4TA 4BJZA 1XDIA 2A8XA 2Q6UA 1YQ4A 4A5LA 4YSYA 1H84A 1NENA 3CGDA 3BI5A 4TM4A 1H7WA 2C70A 3UKLA 3V76A 5BUKA 1NPXA 2GMHA 4AP1A 3DJGX 1M64A 3T31A 4G73A 4HB9A 2W0HA 3GMBA 5FS9A 1ONFA 2XFPA 2XYOA 2PHHA 3REDA 3AE9A 1JU2A 3CNTA 4OPTA 1F6MA 2AAQA 2BK3A 3ABVA 3QSMA 3O0HA 3AEDA 2V3AA 3RHAA 4XWRA 3ADAB 1M6IA 4LIIA 4K5RA 1PS9A 4OPIA 4GCMA 1O5WA 2APGA 3K30A 3KLJA 4B66A 3GDNA 1MO9A 5KMRA 5U63A 3NHOX 5BULA 2BXSA 1TDEA 2VVMA 1KF6A 1CJ2A 2XFOA 3LADA 1N4UA 2XLPA 2Z5YA 2BXRA 4J36A 5J60A 4H4VA 2Q7VA 4BK3A 4H4RA 4IVOB 2WHDA 5GSNA 2YG7A 3RP8A 1B4VA 1JRZA 2BABA 4UDRA 1LQUA 1ZOVA 4WX1A 3AE6A 4YKFA 2X8HA 4DGKA 1EBDA 2YVJA 5C2TA 3GWFA 2WBAA 2VQBA 3D1CA 3KPKA 1NAAA 3UP4A 1PXBA 3NK2X 1SEZA 2VOUA 5BRTA 5C3JA 2BACA 2R0PA 1CC4A 4NWZA 4OPLA 5IPYA 3URHA 3VQRA 3CMMA 4DSHA 2B7SA 3SYIA 3AEFA 1XPQA 1ELIA 2EQ6A 4RG3A 2VRMA 3SZWA 4X4JA 2X8CA 4X9MA 2WOVA 4X9NA 4EMIA 1OJTA 1GRFA 2GMJA 2R0GA 2V3BA 3UCLA 2V6OA 5M0ZA 1CC2A 1COYA 1D4EA 2UZZA 1JEHA 2V5ZA 2BS3A 4BV6A 2O9ZA 3NG7X 2GRTA 3R9UA 1ZK7A 3K7MX 5L46A 1DJQA 2BA9A 2ZBWA 1N4WA 2XLUA 1L9DA 1GT8A 5BVAA 2X8GA 5KOWA 2DKHA 3DJJA 5CKUA 1XHCA 4Z2RA 1Q1RA 2BRYA 1ZP0A 1BGJA 4JY2A 4H4UA 4OPCA 2GAGB 1IUXA 5TR3A 1GEUA 4GR1A 2WEUA 1TDOA 4D04A 4JDRA 2AR8A 1IUVA 4ZCCA 4A79A 3BHFA 1HYUA 3SZ0A 1DOCA 4HA6A 4H4PA 3L1RA 3B6DA 4EIPA 1H6VA 1NHRA 2YAUA 4J2WA 1H86A 4U2LA 2R45A 1PXCA 1GALA 3H4KA 2XVFA 4H2NA 4BK1A 2V60A 2YR5A 4B1BA 2Z5XA 4U8OA 1GNDA 1LV0A 4AOXA 3LZXA 3M13A 3SFEA 4ECHA 3M0OA 4Z2TA 2WETA 4OPUA 1V59A 1ZDLA 4ZCDA 3ICTA 2FJEA 3FPZA 3SZFA 4OVIA 3UKAA 2C7GA 2BK5A 1BWCA 4KPRA 2R46A 1D7YA 2ZZ0A 1H81A 3T2YA 3EANA 3QFBA 3LB8A 4EMJA 3G5QA 2BS2A 4Z2UA 4GDEA 4J34A 3SZCA 5KMSA 2WQYA 5KMPA 4GRTA 1JRXA 2FBWA 4B67A 5FS7A 4USRA 1FEAA 3AYIA 4OPGA 3T2KA 4D03A 1OJ9A 3HYXA 1P2EA 4B65A 3GSIA 1FOHA 2GR0A 2E5VA 3Q9TA 1TDKA 3T0KA 4U2TA 5KRQA 1GRAA 2J3NA 4BJYA 4NNJA 3S61A 2R9ZA 2WDVA 2RGJA 3NN0X 2YVGA 5JCNA 4EM3A 4GF7A 4WCTA 1KN0A 1JOAA 2FJBA 1E7PA 3AE4A 3AYLA 3UKPA 5FS6A 4A6NA 4K5SA 3AEGA 3RNMA 3UOYA 3CPHG 1PHHA 3H8IA 1E1MA 3DH9A 3UTEA 1KDGA 1Q1WA 3ITJA 2GR1A 4U8MA 3DGZA 4EQWA 4Z44A 4ICYA 3NYEA 1GETA 4C3XA 1CC6A 3AE1A 3AD7B 4TM0A 3IWAA 2H89A 2B9XA 1EL8A 3QVRA 2JAEA 1F8RA 1LTXR 3EF6A 3S5WA 1LVLA 1ZMCA 1NHPA 1GPEA 2A89A 1L0VA 3G5SA 4FK1A 4Y4MA 4C5OA 4C3YA 1B8SA 5ER0A 1X31B 3BI2A 4G6HA 1GRGA 2QA1A 1D4DA 3LXDA 4H4SA 1O95A 3I6DA 1YY5A 3V3OA 1CBOA 4LA1A 3NK1X 4J57A 1CF3A 2BYBA 2WS3A 3F8RA 3M12A 5IQ1A 2YWLA 4EQSA 3ALMA 1FEBA 3P4SA 3AE8A 2GEWA 2E4GA 3AEEA 3GYJA 3T14A 1OJDA 2GR3A 2GF3A 3ATQA 3L8KA 3UTGA 4J56A 2XLTA 3GRTA 3GWDA 4I59A 2EQ7A 1CJ4A 4A7AA 2RGOA 2C72A 4U8PA 1NG4A 5FMHA 1IJHA 4CNKA 5KXJA 4LU6A 2R0CA 5EOWA 3NLCA 2RGHA 2C3DA 1TYPA 3KA7A 4B63A 2C67A 1K0JA 3DMEA 3SX6A 3K7TA 4YSHA 4BURA 3AYJA 3QVPA 1E1NA 4NTCA 3T2ZA 2WDRA 4YTPA 1S3BA 1GRHA 3DA1A 3CNSA 4CNJA 3P4QA 4H4QA 2JB2A 4MJWA 3ALLA 2B9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOB A;  1LJ1 A;  1Y0P A;  2VVL G;  3ISH A;  4TLX A;  1H83 A;  2JB3 A;  4J31 A;  2OLO A;  3VRD B;  3VRA A;  1RSG A;  4UDP A;  4M52 A;  3BI4 A;  4H4W A;  1N4V A;  5JCK A;  1E1K A;  2FJA A;  2XFU A;  1Y56 A;  2C73 A;  4J33 A;  4TLZ A;  3P4P A;  4REK A;  3UOX A;  4A99 A;  2YM2 A;  4OPD A;  1PJ6 A;  4U8N A;  4APN A;  2YLZ A;  4NTD A;  1KSU A;  2H88 A;  5M10 A;  2GH5 A;  2R4E A;  1NDA A;  3GYI A;  1L9C A;  3GMC A;  2WPF A;  4XWZ A;  2ZZB A;  2GB0 A;  1JRY A;  4YTN A;  1H7X A;  3CGC A;  3F8P A;  2WOI A;  1PBE A;  1Q9I A;  1CHU A;  2WDQ A;  3UKQ A;  1ZMD A;  3DK8 A;  1FCD A;  4K22 A;  3NTD A;  2CVJ A;  4YT0 A;  2C65 A;  4USQ A;  2RAB A;  2AQJ A;  1K4Q A;  2WP5 A;  1VDC A;  3PO7 A;  5KOX A;  2B9Y A;  3EPT A;  1VG0 A;  4CY6 A;  3RP7 A;  2TPR A;  4IA6 A;  2YG6 A;  1BGN A;  1TYT A;  1GTE A;  1CL0 A;  1VRQ B;  2XCG A;  2BC1 A;  1KNP A;  1FEC A;  2C66 A;  5LV9 A;  3D8X A;  3DK9 A;  2R4J A;  3AEA A;  3AEC A;  4JY3 A;  3NIX A;  1H82 A;  1D4C A;  2WPE A;  4B64 A;  5HY5 A;  4FDC B;  4XXG A;  1ZOY A;  4U8I A;  1UKV G;  1E39 A;  4H2P A;  3LOV A;  3QFA A;  2EQ8 A;  2WES A;  1RYI A;  3PS9 A;  1YQZ A;  4EMW A;  2B7R A;  4AOS A;  4H4X A;  1E6E A;  4AP3 A;  2X3N A;  5HXI A;  1ZKQ A;  4ADW A;  3UOZ A;  3UTH A;  4UP3 A;  3SGL A;  4Z25 A;  3UP5 A;  2YLR A;  2QCU A;  1BF3 A;  4FK1 C;  4AT0 A;  2BCG G;  1D5T A;  3AXB A;  1EL9 A;  1QLB A;  2ARD A;  2PYX A;  2OAL A;  4EIQ A;  2NVK X;  3P4R A;  4PAA A;  3SFD A;  3UKK A;  4OCG A;  3NRN A;  4JQ9 A;  3ZDN A;  2WU5 A;  4A65 A;  3NT6 A;  5HYM A;  4JNA A;  1GOS A;  1MOK A;  1GES A;  1EL7 A;  3QSE A;  3CGE A;  2IVE A;  2EQ9 A;  4K7Z A;  1QJD A;  1VQW A;  3AEB A;  2F5Z A;  1RP0 A;  5EB4 A;  5FS8 A;  3CPI G;  3HZL A;  4H7U A;  2YR6 A;  3II4 A;  1DJN A;  5JCM A;  2HQM A;  1NG3 A;  2BC0 A;  2YLS A;  3FMW A;  4YTM A;  1F3P A;  2FJD A;  4A9W A;  1PXA A;  4E0V A;  2Y6Q A;  3FBS A;  3C4N A;  4C77 A;  3CND A;  1K0I A;  1K0L A;  3T37 A;  1GV4 A;  2JK6 A;  4B69 A;  4YKG A;  1DOE A;  2WP9 A;  2YQU A;  1DOD A;  1PBF A;  2BS4 A;  4U8K A;  3WE0 A;  1KFY A;  4NTE A;  4JN9 A;  3RP6 A;  2BCP A;  3JSK A;  4U8L A;  1PBC A;  2XVI A;  2YLW A;  2B76 A;  1KNR A;  1GRT A;  2GQW A;  3OC4 A;  3P1W A;  1B5Q A;  4IV9 A;  2Y6R A;  2XFN A;  1L9E A;  3GRS A;  1CJ3 A;  2XVH A;  4GUV A;  3K7Q X;  1PBB A;  3VRB A;  4BK2 A;  4YSZ A;  3GD4 A;  4NEW A;  4H4Z A;  3ICS A;  1N1P A;  2GAH B;  2GR2 A;  3GD3 A;  2C76 A;  2WU2 A;  1BKW A;  2XVE A;  4EM4 A;  1CJC A;  1JNR A;  4H2Q A;  1LPF A;  1O94 A;  1PN0 A;  2XLS A;  4GDP A;  5J7X A;  3QSS A;  4RG4 A;  5EBK A;  4I58 A;  3ICR A;  5CQF A;  3ALJ A;  5U1O A;  3C4A A;  4A6N B;  2VZ2 A;  1E1L A;  1PBD A;  1W4X A;  5KVH A;  4Z26 A;  5HHF A;  1S2Q A;  4NZH A;  3UKF A;  3NYC A;  3ZYX A;  2JBV A;  3DGH A;  3NNE A;  2Q0K A;  3CN8 A;  3BHK A;  1NEK A;  4IVM B;  4DSG A;  4K2X A;  3UOV A;  1S3E A;  3IHG A;  1IUW A;  1ZX9 A;  2XFQ A;  4FX9 A;  3EAO A;  2V61 A;  1KSS A;  2CUL A;  5DBJ A;  2CFY A;  4TM3 A;  1PDH A;  3NYF A;  3VR9 A;  2DKI A;  4N9X A;  4ZN0 A;  2WPC A;  3KPF A;  2YG5 A;  5IQ4 A;  3AB1 A;  4Y4N A;  3CNJ A;  2VQ7 A;  4P9S A;  2CDU A;  3VR8 A;  3AE3 A;  2C64 A;  2YVF A;  1NHQ A;  5JCI A;  4JNQ A;  2OLN A;  1GTH A;  2YG3 A;  2XLR A;  3V3N A;  3C96 A;  1OJC A;  4EQX A;  2VVL A;  1YQ3 A;  3G5R A;  2WOW A;  3BNU A;  4K8D A;  4CCR A;  2YM1 A;  1LQT A;  3AD8 B;  4YWO A;  3LZW A;  3CNP A;  2OAM A;  1XAN A;  2XDO A;  3E1T A;  4TM1 A;  4C74 A;  3QJ4 A;  3DJE A;  3KKJ A;  1D7L A;  1FL2 A;  2Q0L A;  1PJ5 A;  4U2S A;  4YSX A;  4NEV A;  3Q6J A;  3DK4 A;  3CPJ G;  3KD9 A;  3NK0 X;  3AE2 A;  1GRE A;  4U8J A;  4CCQ A;  2YLX A;  4O5Q A;  4PAB A;  4UDQ A;  2XVJ A;  3KU9 A;  2ACZ A;  4Y4L A;  1MXT A;  4B68 A;  3NGC X;  1DXL A;  3CTY A;  2IVD A;  1DNC A;  2WP6 A;  2X99 A;  3I3L A;  3OZ2 A;  2IID A;  1GXF A;  3SM8 A;  3AD9 B;  2C3C A;  2E1M A;  3NN6 X;  2QAE A;  2X50 A;  3SQP A;  1GER A;  3DJD A;  4H4Y A;  3AE5 A;  1TDN A;  3CIR A;  4KX6 A;  2YR4 A;  1OJA A;  2ZZC A;  1IUS A;  1Z6L A;  2JKC A;  4CBQ A;  4Z43 A;  2JB1 A;  4O5U A;  1QO8 A;  2OA1 A;  2YG4 A;  3AWI A;  3P9U A;  3COX A;  5EB5 A;  4CY8 A;  3PVC A;  3IF9 A;  3NTA A;  2C75 A;  2NPX A;  1AOG A;  3LJP A;  3NH3 X;  4EQR A;  4DNA A;  5JCL A;  2A87 A;  2I0Z A;  2YLT A;  1GSN A;  3IHM A;  3NKS A;  3IC9 A;  3KVE A;  4YXD A;  1REO A;  4Z24 A;  3B3R A;  4H50 A;  4AT2 A;  1Y56 B;  3GDP A;  1BZL A;  2GVC A;  5KVI A;  3UTF A;  1P2H A;  1S2Y A;  1YKJ A;  1TRB A;  2BK4 A;  1IUU A;  4H2R A;  1IUT A;  3UKH A;  5GRT A;  1ZY8 A;  5U25 A;  1NHS A;  2TMD A;  1PJ7 A;  1F8W A;  3ATR A;  1TDF A;  1F8S A;  1VG9 A;  2QA2 A;  1GRB A;  2VRL A;  3AE7 A;  3BNM A;  3H8L A;  4CRT A;  1EL5 A;  3CGB A;  5KWF A;  2GQF A;  1JNZ A;  4IA5 A;  3F8D A;  4RSL A;  2GV8 A;  1B37 A;  3FIM B;  3FG2 P;  4H4T A;  4BJZ A;  1XDI A;  2A8X A;  2Q6U A;  1YQ4 A;  4A5L A;  4YSY A;  1H84 A;  1NEN A;  3CGD A;  3BI5 A;  4TM4 A;  1H7W A;  2C70 A;  3UKL A;  3V76 A;  5BUK A;  1NPX A;  2GMH A;  4AP1 A;  3DJG X;  1M64 A;  4HB9 A;  2W0H A;  3GMB A;  5FS9 A;  1ONF A;  2XFP A;  2XYO A;  2PHH A;  3RED A;  3AE9 A;  1JU2 A;  3CNT A;  4OPT A;  1F6M A;  2AAQ A;  2BK3 A;  3ABV A;  3QSM A;  3O0H A;  3AED A;  2V3A A;  3RHA A;  4XWR A;  3ADA B;  1M6I A;  4LII A;  4K5R A;  1PS9 A;  4OPI A;  4GCM A;  1O5W A;  2APG A;  3K30 A;  3KLJ A;  4B66 A;  3GDN A;  1MO9 A;  5U63 A;  3NHO X;  5BUL A;  2BXS A;  1TDE A;  2VVM A;  1KF6 A;  1CJ2 A;  2XFO A;  3LAD A;  1N4U A;  2XLP A;  2Z5Y A;  2BXR A;  4J36 A;  5J60 A;  4H4V A;  2Q7V A;  4BK3 A;  4H4R A;  4IVO B;  2WHD A;  5GSN A;  2YG7 A;  3RP8 A;  1B4V A;  1JRZ A;  2BAB A;  4UDR A;  1LQU A;  1ZOV A;  4WX1 A;  3AE6 A;  4YKF A;  2X8H A;  4DGK A;  1EBD A;  2YVJ A;  5C2T A;  3GWF A;  2WBA A;  2VQB A;  3D1C A;  3UP4 A;  1NAA A;  1PXB A;  3NK2 X;  1SEZ A;  2VOU A;  5BRT A;  5C3J A;  2BAC A;  2R0P A;  1CC4 A;  4OPL A;  5IPY A;  3URH A;  3VQR A;  4DSH A;  2B7S A;  3AEF A;  1XPQ A;  1ELI A;  2EQ6 A;  4RG3 A;  2VRM A;  4X4J A;  2X8C A;  4X9M A;  2WOV A;  4X9N A;  4EMI A;  1OJT A;  1GRF A;  2GMJ A;  2R0G A;  2V3B A;  3UCL A;  2V6O A;  5M0Z A;  1CC2 A;  1COY A;  1D4E A;  2UZZ A;  1JEH A;  2V5Z A;  2BS3 A;  4BV6 A;  2O9Z A;  3NG7 X;  2GRT A;  3R9U A;  1ZK7 A;  3K7M X;  5L46 A;  1DJQ A;  2BA9 A;  2ZBW A;  1N4W A;  2XLU A;  1L9D A;  1GT8 A;  5BVA A;  2X8G A;  5KOW A;  2DKH A;  3DJJ A;  5CKU A;  1XHC A;  4Z2R A;  1Q1R A;  1ZP0 A;  1BGJ A;  4JY2 A;  4H4U A;  4OPC A;  2GAG B;  1IUX A;  5TR3 A;  1GEU A;  4GR1 A;  2WEU A;  1TDO A;  4D04 A;  4JDR A;  2AR8 A;  1IUV A;  4ZCC A;  4A79 A;  3BHF A;  1HYU A;  1DOC A;  4HA6 A;  4H4P A;  3L1R A;  3B6D A;  4EIP A;  1H6V A;  1NHR A;  2YAU A;  4J2W A;  1H86 A;  4U2L A;  2R45 A;  1PXC A;  1GAL A;  3H4K A;  2XVF A;  4H2N A;  4BK1 A;  2V60 A;  2YR5 A;  4B1B A;  2Z5X A;  4U8O A;  1GND A;  1LV0 A;  4AOX A;  3LZX A;  3M13 A;  3SFE A;  4ECH A;  3M0O A;  4Z2T A;  2WET A;  4OPU A;  1V59 A;  1ZDL A;  4ZCD A;  3ICT A;  2FJE A;  3FPZ A;  4OVI A;  3UKA A;  2C7G A;  2BK5 A;  1BWC A;  4KPR A;  2R46 A;  1D7Y A;  2ZZ0 A;  1H81 A;  3EAN A;  3QFB A;  3LB8 A;  4EMJ A;  3G5Q A;  2BS2 A;  4Z2U A;  4GDE A;  4J34 A;  2WQY A;  4GRT A;  1JRX A;  2FBW A;  4B67 A;  5FS7 A;  4USR A;  1FEA A;  3AYI A;  4OPG A;  4D03 A;  1OJ9 A;  1P2E A;  4B65 A;  3GSI A;  1FOH A;  2GR0 A;  2E5V A;  3Q9T A;  1TDK A;  4U2T A;  5KRQ A;  1GRA A;  2J3N A;  4BJY A;  3S61 A;  2R9Z A;  2WDV A;  2RGJ A;  3NN0 X;  2YVG A;  5JCN A;  4EM3 A;  4GF7 A;  4WCT A;  1JOA A;  2FJB A;  1E7P A;  3AE4 A;  3AYL A;  3UKP A;  5FS6 A;  4A6N A;  4K5S A;  3AEG A;  3RNM A;  3UOY A;  3CPH G;  1PHH A;  3H8I A;  1E1M A;  3DH9 A;  3UTE A;  1KDG A;  1Q1W A;  3ITJ A;  2GR1 A;  4U8M A;  3DGZ A;  4EQW A;  4Z44 A;  4ICY A;  3NYE A;  1GET A;  4C3X A;  1CC6 A;  3AE1 A;  3AD7 B;  4TM0 A;  3IWA A;  2H89 A;  2B9X A;  1EL8 A;  3QVR A;  2JAE A;  1F8R A;  1LTX R;  3EF6 A;  3S5W A;  1LVL A;  1ZMC A;  1NHP A;  1GPE A;  2A89 A;  1L0V A;  3G5S A;  4FK1 A;  4Y4M A;  4C5O A;  4C3Y A;  1B8S A;  5ER0 A;  1X31 B;  3BI2 A;  1GRG A;  2QA1 A;  1D4D A;  3LXD A;  4H4S A;  1O95 A;  3I6D A;  1YY5 A;  3V3O A;  1CBO A;  4LA1 A;  3NK1 X;  4J57 A;  1CF3 A;  2BYB A;  2WS3 A;  3F8R A;  3M12 A;  5IQ1 A;  2YWL A;  4EQS A;  3ALM A;  1FEB A;  3P4S A;  3AE8 A;  2GEW A;  2E4G A;  3AEE A;  3GYJ A;  1OJD A;  2GR3 A;  2GF3 A;  3ATQ A;  3L8K A;  3UTG A;  4J56 A;  2XLT A;  3GRT A;  3GWD A;  4I59 A;  2EQ7 A;  1CJ4 A;  4A7A A;  2RGO A;  2C72 A;  4U8P A;  1NG4 A;  5FMH A;  1IJH A;  4CNK A;  5KXJ A;  4LU6 A;  2R0C A;  5EOW A;  3NLC A;  2RGH A;  2C3D A;  1TYP A;  3KA7 A;  4B63 A;  2C67 A;  1K0J A;  3DME A;  3K7T A;  4YSH A;  4BUR A;  3AYJ A;  3QVP A;  1E1N A;  4NTC A;  2WDR A;  4YTP A;  1S3B A;  1GRH A;  3DA1 A;  3CNS A;  4CNJ A;  3P4Q A;  4H4Q A;  2JB2 A;  4MJW A;  3ALL A;  2B9W A; 
#chains in the Genus database with same CATH topology
 2OLO A;  2POD A;  4UDP A;  5JCK A;  3P4P A;  2XSX A;  3R25 A;  4OPD A;  3UCD A;  4APN A;  4NTD A;  1KSU A;  1S7M A;  3GMC A;  1TE6 A;  2GB0 A;  3CGC A;  3F8P A;  3DK8 A;  3VDG A;  2CVJ A;  4YT0 A;  3T9P A;  2WP5 A;  1VDC A;  2HXU A;  2B9Y A;  3EPT A;  2PTX A;  2OZ8 A;  2OG9 A;  1FEC A;  3D8X A;  4JY3 A;  2WPE A;  5G5G B;  4XXG A;  1UKV G;  2EQ8 A;  2OPJ A;  3NVZ B;  4EMW A;  4H4X A;  1F9C A;  2X3N A;  3UOZ A;  3UTH A;  3SGL A;  4G7F A;  3EEZ A;  2ARD A;  3P4R A;  4JQ9 A;  3SXI A;  2WU5 A;  4A65 A;  3NT6 A;  4JNA A;  1GOS A;  1EL7 A;  3SN1 A;  2AKZ A;  4GAV A;  3AEB A;  2F5Z A;  1RP0 A;  4IT1 A;  1ZXI C;  3CPI G;  2YR6 A;  2HQM A;  1NG3 A;  2OZT A;  1F3P A;  1PXA A;  1K0L A;  3T37 A;  1DOE A;  1PBF A;  3WE0 A;  2BCP A;  4U8L A;  3OC4 A;  2Y6R A;  1L9E A;  2OKT A;  6ENL A;  3GD4 A;  4NEW A;  5C3J A;  3R0K A;  2GAH B;  4H83 A;  2GR2 A;  3CNS A;  4FP1 A;  3HRD C;  4I58 A;  2VZ2 A;  4Z26 A;  1S2Q A;  4NZH A;  3DGH A;  3GD6 A;  3RCY A;  3NNE A;  3CN8 A;  1NEK A;  1IUW A;  1ZX9 A;  3HYW A;  5DBJ A;  4TM3 A;  3HYV A;  3NYF A;  4N9X A;  4MMW A;  3KPF A;  3UJF A;  3CNJ A;  4P9S A;  5JCI A;  2YG3 A;  2PTY A;  3G5R A;  3BNU A;  1VQZ A;  2YM1 A;  4C74 A;  4NEV A;  4UDQ A;  2XVJ A;  3KU9 A;  1MXT A;  3V5C A;  3OZ2 A;  3SM8 A;  2C3C A;  2E1M A;  2QAE A;  2X50 A;  4H4Y A;  3D9X A;  3CIR A;  3FCP A;  1OJA A;  1IUS A;  1N60 C;  1MUC A;  3QLD A;  2JB1 A;  3AWI A;  4CY8 A;  3PVC A;  2NPX A;  4DNA A;  2A87 A;  3NKS A;  3IC9 A;  3KVE A;  3HW2 A;  3SJN A;  1S2Y A;  3UKH A;  1MDR A;  4GAP A;  1JRO A;  1GRB A;  1KKO A;  4GGH A;  5IDZ A;  4IA5 A;  3A7U A;  2GV8 A;  3FG2 P;  4H4T A;  2A8X A;  1YQ4 A;  3BI5 A;  3CGD A;  3V76 A;  2PP3 A;  4DYE A;  4AP1 A;  3DJG X;  3T31 A;  4G73 A;  3GMB A;  3QTP A;  2XYO A;  3AE9 A;  1JU2 A;  3ABV A;  3RHA A;  3QSM A;  3AED A;  1SJB A;  2V3A A;  4LII A;  4K5R A;  1TZZ A;  4B66 A;  1N4U A;  2Z5Y A;  4A6G A;  4IVO B;  5GSN A;  2BAB A;  4UDR A;  3AE6 A;  2AL2 A;  4DGK A;  2GGH A;  2VQB A;  3RO6 A;  3NK2 X;  1SEZ A;  2VOU A;  5BRT A;  4NWZ A;  5IPY A;  4DSH A;  2PU1 A;  1SJC A;  4IHC A;  3UXK A;  4EMI A;  2GMJ A;  5M0Z A;  3UCC A;  2UZZ A;  4BV6 A;  2O9Z A;  3NG7 X;  3R9U A;  1ZK7 A;  3P3B A;  3K7M X;  1DJQ A;  5BOE A;  5KOW A;  3DJJ A;  1XHC A;  1X2G A;  3DEQ A;  4GR1 A;  1IUV A;  4ZCC A;  2HXT A;  3SZ0 A;  3B6D A;  4U2L A;  2E3T A;  3Q45 A;  4BK1 A;  2W3S A;  4B1B A;  4U8O A;  2OZ3 A;  3FVD A;  4KPL A;  2GSH A;  4ZCD A;  3ICT A;  3SZF A;  4OVI A;  2BK5 A;  4GYP A;  2P88 A;  3EAN A;  3QFB A;  3LB8 A;  4Z2U A;  3FYY A;  4GDE A;  4B67 A;  3I6E A;  4OPG A;  4B65 A;  3GSI A;  1FOH A;  2AKM A;  3T0K A;  1GRA A;  3S61 A;  2R9Z A;  3MKC A;  2OFJ A;  4HNC A;  3TOY A;  3NN0 X;  1KN0 A;  1E7P A;  3AE4 A;  4A6N A;  3AEG A;  4M0X A;  3H8I A;  1E1M A;  3ITJ A;  4Z44 A;  4ICY A;  3VCC A;  2B9X A;  1EL8 A;  3EF6 A;  1L0V A;  1GPE A;  3ZLF A;  1B8S A;  1X31 B;  3BI2 A;  1GRG A;  4J57 A;  2WS3 A;  2YWL A;  3ALM A;  1OJD A;  4K8G A;  3GRT A;  3GWD A;  4I59 A;  1CJ4 A;  1ECQ A;  4U8P A;  1NG4 A;  4CNK A;  2C67 A;  3SX6 A;  2PSN A;  4BUR A;  3AYJ A;  4H2H A;  2ONE A;  3NXL A;  2PS2 A;  4IP4 A;  4H4Q A;  2JB2 A;  3ALL A;  1DOB A;  1LJ1 A;  3JW7 A;  4TLX A;  1H83 A;  2JB3 A;  3BI4 A;  1N4V A;  1Y56 A;  4GYP C;  3DES A;  1PJ6 A;  2H88 A;  2GH5 A;  2R4E A;  1N5W C;  4HYR A;  1KKR A;  1P48 A;  1JRY A;  2WOI A;  4A3R A;  1PBE A;  1ZMD A;  4ZA0 A;  1FCD A;  4K22 A;  3PO7 A;  5KOX A;  4CY6 A;  4IA6 A;  2YG6 A;  1CL0 A;  2PPG A;  3UXL A;  3NIX A;  1D4C A;  2DW7 A;  3CAW A;  5G5H B;  1ZOY A;  3LOV A;  3QFA A;  1E6E A;  4AP3 A;  3KUM A;  5HXI A;  2PTW A;  1XS2 A;  2BCG G;  1EL9 A;  2OAL A;  3NRN A;  3U9I A;  3MY9 A;  2EQ9 A;  1QJD A;  1JRP A;  3II4 A;  5JCM A;  2BC0 A;  4EWJ A;  3FMW A;  2C4C A;  4A9W A;  4E0V A;  3FBS A;  1BKH A;  3C4N A;  1GV4 A;  2WP9 A;  3D47 A;  4U8K A;  1KFY A;  5FJT A;  5KMQ A;  3GRS A;  1CJ3 A;  5KNL A;  4YSZ A;  4H4Z A;  1N1P A;  3VFC A;  3GD3 A;  2WU2 A;  4H2Q A;  1N63 C;  1LPF A;  3ICR A;  5CQF A;  4A6N B;  1PBD A;  5HHF A;  3V3W A;  1EC8 A;  3NYC A;  3ZYX A;  4IVM B;  3BHK A;  3UOV A;  3IHG A;  3I4K A;  1PDY A;  1PDH A;  2YG5 A;  5IQ4 A;  2VQ7 A;  3VR8 A;  3AE3 A;  2AL2 B;  2OLN A;  4J3Z A;  4EQX A;  4DXK A;  3LZW A;  2XDO A;  3E1T A;  3IJL A;  3DJE A;  2Q0L A;  2OQY A;  3DK4 A;  4CCQ A;  4PAB A;  2ACZ A;  3FV9 A;  4B68 A;  3NGC X;  1DXL A;  3CTY A;  2WP6 A;  3I3L A;  2IID A;  1GXF A;  3AD9 B;  1T3Q C;  3NN6 X;  4JN7 A;  4G74 A;  4KX6 A;  2ZZC A;  2JKC A;  4Z43 A;  2OA1 A;  5EB5 A;  3COX A;  2C75 A;  4EQR A;  5JCL A;  4YXD A;  1EC9 A;  1REO A;  1Y56 B;  2XH4 A;  2GVC A;  4ENL A;  1YKJ A;  2QVH A;  1WYG A;  1IUU A;  2BK4 A;  1IUT A;  2P8C A;  3ATR A;  1TDF A;  1VG9 A;  4ZOH B;  3D46 A;  2VRL A;  3BNM A;  1EL5 A;  2GQF A;  3F8D A;  3ZVI A;  4RSL A;  4BJZ A;  1H7W A;  2C70 A;  1M64 A;  4HB9 A;  2PHH A;  1FFV C;  4OPT A;  4DN1 A;  1F6M A;  2BK3 A;  3O0H A;  2OLA A;  3KLJ A;  1JDF A;  5U63 A;  5BUL A;  4A35 A;  1TDE A;  4JN8 A;  2XFO A;  2XLP A;  4HPN A;  4J36 A;  5J60 A;  4BK3 A;  2YG7 A;  1B4V A;  3SBF A;  1ZOV A;  4WX1 A;  1EBD A;  3GWF A;  3UP4 A;  3ES7 A;  4M6U A;  2B7S A;  1XPY A;  2EQ6 A;  2VRM A;  3RR1 A;  3DGB A;  2X8C A;  4KWS A;  2WOV A;  3UCL A;  1CC2 A;  1D4E A;  4E8G A;  2BS3 A;  3N4E A;  2GRT A;  1WUE A;  2BA9 A;  2ZBW A;  4HNL A;  2XLU A;  3H8A A;  4Z2R A;  1Q1R A;  4K1W A;  2BRY A;  4F4R A;  4OPC A;  2GAG B;  3QN3 A;  1IUX A;  5FJO A;  1SJD A;  2XGZ A;  1TDO A;  4JDR A;  4A79 A;  3UGV A;  1HYU A;  4EIP A;  3UJS A;  2YAU A;  1H86 A;  1GAL A;  3H4K A;  2XVF A;  2Z5X A;  1KD0 A;  1LV0 A;  3ZVH A;  2FYM A;  3M13 A;  3SFE A;  4OPU A;  3P0W A;  3IK4 A;  5FJR A;  3FPZ A;  2C7G A;  1BWC A;  1D7Y A;  2ZZ0 A;  3SZC A;  2P3Z A;  3TWA A;  3PWG A;  5KMP A;  4GRT A;  1JRX A;  5FS7 A;  4USR A;  3T2K A;  3Q4D A;  4D03 A;  1OJ9 A;  1OEP A;  3TJI A;  2E5V A;  3Q9T A;  1TDK A;  3T4W A;  2J3N A;  2RGJ A;  3CYJ A;  3K1G A;  4H1Z A;  1JOA A;  2FJB A;  3T8Q A;  3AYL A;  5FS6 A;  4K5S A;  4ROP A;  3H7V A;  3DG3 A;  1KCZ A;  2PCE A;  3UTE A;  1N61 C;  3DGZ A;  4EQW A;  1GET A;  1CC6 A;  4E4F A;  3AD7 B;  2H89 A;  2JAE A;  1LTX R;  3S5W A;  1NHP A;  4FK1 A;  4C3Y A;  4G6H A;  2ZC8 A;  2QA1 A;  3LXD A;  1O95 A;  3V3O A;  1CBO A;  4LA1 A;  3NK1 X;  1CF3 A;  4EQS A;  3P4S A;  3S5S A;  3AE8 A;  3AEE A;  3GYJ A;  1EBG A;  3ATQ A;  3L8K A;  4J56 A;  2GDQ A;  3TJ4 A;  1IJH A;  2R0C A;  5EOW A;  3NLC A;  3KA7 A;  3V4B A;  3K7T A;  4YSH A;  4E6M A;  2WDR A;  4YTP A;  3P4Q A;  4TVY A;  2O56 A;  2VVL G;  3ISH A;  4M52 A;  2FJA A;  4TLZ A;  2XFU A;  3UOX A;  4A99 A;  3S47 A;  4U8N A;  4G6G A;  3VC5 A;  5M10 A;  1PDZ A;  3GYI A;  4XWZ A;  2ZZB A;  4YTN A;  1CHU A;  3SN0 A;  3GYX A;  4USQ A;  3QPE A;  3EUB 3;  1VG0 A;  3RP7 A;  2TPR A;  2OO6 A;  3PG6 A;  1GTE A;  2XCG A;  2BC1 A;  2C66 A;  5ENL A;  7ENL A;  1JPM A;  4G8T A;  1JPD X;  3T6C A;  3DK9 A;  3AEC A;  4B64 A;  5JRB A;  5HY5 A;  4FDC B;  4U8I A;  1E39 A;  3THU A;  2WES A;  1RYI A;  2B7R A;  1IYX A;  3RRA A;  4UP3 A;  1FFU C;  2GGG A;  4MGG A;  1BF3 A;  2PYX A;  4PAA A;  4OCG A;  4KEM A;  1EC7 A;  3QKE A;  1MOK A;  2IVE A;  3SN4 A;  4K7Z A;  5FS8 A;  3HZL A;  4H7U A;  3ES8 A;  4YTM A;  2YLS A;  1JCT A;  3A7A A;  3GY1 A;  3CND A;  1K0I A;  4B69 A;  2JK6 A;  3FXG A;  4YKG A;  2YQU A;  1DOD A;  2BS4 A;  3OPS A;  4NTE A;  4JN9 A;  3JSK A;  2XVI A;  2YLW A;  2B76 A;  1GRT A;  1B5Q A;  3TTE A;  2XFN A;  2XVH A;  4GUV A;  1PBB A;  4BK2 A;  3ICS A;  2XVE A;  2C76 A;  1CJC A;  1PN0 A;  5J7X A;  4RG4 A;  5EBK A;  3ALJ A;  3MZN A;  2Q0K A;  4DSG A;  4K2X A;  3CT2 A;  1S3E A;  2XFQ A;  4FX9 A;  2V61 A;  1KSS A;  2CFY A;  3VR9 A;  2ZAD A;  4E5T A;  2WPC A;  3AB1 A;  4Y4N A;  4HN8 A;  2CDU A;  3TQP A;  2YVF A;  1NHQ A;  4JNQ A;  1GTH A;  3V3N A;  2XLR A;  2VVL A;  4CCR A;  3R1Z A;  3CNP A;  2OAM A;  4TM1 A;  4MKS A;  3KKJ A;  1D7L A;  4U2S A;  3DFH A;  3Q6J A;  2XH7 A;  3NK0 X;  2XH2 A;  3AE2 A;  1GRE A;  4U8J A;  2NQL A;  5EU9 A;  2IVD A;  2PGE A;  3SQP A;  1GER A;  4II2 A;  3AE5 A;  1TDN A;  3MWC A;  2YR4 A;  2YG4 A;  3P9U A;  3IF9 A;  3P93 A;  3IHM A;  2YLT A;  1GSN A;  3B3R A;  4H50 A;  1BZL A;  1TKK A;  3UTF A;  2RDX A;  1TRB A;  5FJU A;  5GRT A;  3D1C A;  2QA2 A;  3AE7 A;  4FI4 A;  3CGB A;  5KWF A;  1B37 A;  3NS1 B;  2Q6U A;  3R10 A;  4A5L A;  4TM4 A;  3UKL A;  5BUK A;  1RM6 B;  2GMH A;  4K2S A;  3VC6 A;  2W0H A;  3DIP A;  2XFP A;  5BOF A;  3CNT A;  2AAQ A;  4XWR A;  4JHM A;  3PFR A;  3PWI A;  1M6I A;  3FJ4 A;  4GCM A;  1O5W A;  3GDN A;  1MO9 A;  2W54 A;  2BXS A;  2VVM A;  1CJ2 A;  1E9I A;  4IZG A;  4KT2 A;  4H4V A;  1JRZ A;  4YKF A;  2YVJ A;  2WBA A;  4IP5 A;  3KPK A;  1NAA A;  1PXB A;  4IL0 A;  1CC4 A;  3CMM A;  3TCS A;  3DER A;  4X9M A;  4X9N A;  1OJT A;  2GGJ A;  1FHV A;  2V6O A;  3TW9 A;  4ZCW A;  3VCN A;  2V5Z A;  3N6H A;  4X2P A;  1R0M A;  5L46 A;  4IL2 A;  1N4W A;  3NVW B;  1L9D A;  1GT8 A;  5BVA A;  3CXB A;  2MUC A;  3DFY A;  2DKH A;  2HNE A;  3RIT A;  5CKU A;  5FJP A;  3UJ2 A;  1GEU A;  2WEU A;  3DG6 A;  3ZLG A;  4HA6 A;  1SJA A;  4H4P A;  3NVV B;  2R45 A;  1PXC A;  1NU5 A;  2HZG A;  4GIS A;  1GND A;  3LZX A;  4ECH A;  4Z2T A;  1V59 A;  3OZY A;  4DHG A;  2FJE A;  3UKA A;  2R46 A;  3DDM A;  4KPR A;  3GC2 A;  3G5Q A;  4J34 A;  2WQY A;  2FBW A;  1FEA A;  3HYX A;  1SB3 B;  5KRQ A;  1FO4 A;  4BJY A;  2WDV A;  1RVK A;  2YVG A;  4EM3 A;  4GF7 A;  3UKP A;  1ONE A;  3RNM A;  3UOY A;  4TVW A;  1PHH A;  1YEY A;  3ZVH B;  1Q1W A;  1MRA A;  4U8M A;  2E5A A;  3NYE A;  3AE1 A;  4TM0 A;  2PP1 A;  1R6W A;  2OX4 A;  4H4S A;  3I6D A;  2BYB A;  1FEB A;  2GR3 A;  2GF3 A;  3NVY B;  3UTG A;  3BOX A;  3TWB A;  3A7R A;  4A7A A;  3BJS A;  3BSM A;  1NEL A;  5FMH A;  5KXJ A;  4LU6 A;  3IJI A;  2PU0 A;  4HCL A;  2RGH A;  2I5Q A;  2C3D A;  1TYP A;  4B63 A;  3DME A;  3T2Z A;  1S3B A;  1P43 A;  4YWS A;  1GRH A;  2MNR A;  3DA1 A;  3U4F A;  4CNJ A;  3B97 A;  1ELS A;  4MJW A;  2B9W A;  1FIQ B;  1Y0P A;  4J31 A;  3VRD B;  3VRA A;  1RSG A;  2CHR A;  2AL1 A;  4H4W A;  4J33 A;  1E1K A;  2C73 A;  4REK A;  2YM2 A;  2YLZ A;  3SQS A;  1NDA A;  1L9C A;  2WPF A;  1H7X A;  3NFU A;  1Q9I A;  3UKQ A;  2WDQ A;  2PA6 A;  4G9K A;  3NTD A;  2C65 A;  1V97 A;  2RAB A;  2AQJ A;  1K4Q A;  3SSZ A;  1TYT A;  1BGN A;  4HCD A;  1VRQ B;  1KNP A;  5LV9 A;  3R0U A;  3AEA A;  2R4J A;  1H82 A;  4H2P A;  3SY4 A;  2PP0 A;  3OZM A;  3PS9 A;  3N4F A;  1YQZ A;  3N6J A;  4AOS A;  1ZKQ A;  4ADW A;  2BRA A;  3R07 C;  4Z25 A;  3UP5 A;  2YLR A;  2QCU A;  1STZ A;  4FK1 C;  4AT0 A;  1D5T A;  3R11 A;  3AXB A;  1QLB A;  3OP2 A;  4EIQ A;  2NVK X;  3UKK A;  3SFD A;  3ZDN A;  5HYM A;  3AMZ A;  1GES A;  3QSE A;  3CGE A;  1VQW A;  5EB4 A;  1DJN A;  2P0I A;  2FJD A;  2Y6Q A;  4C77 A;  2P8B A;  3RP6 A;  3MUC A;  4DWD A;  1PBC A;  1KNR A;  2GQW A;  3P1W A;  1L8P A;  4IV9 A;  1N62 C;  3K7Q X;  3VRB A;  3RP8 A;  2QGY A;  1BKW A;  4EM4 A;  1JNR A;  1O94 A;  2XLS A;  4GDP A;  4II3 A;  1H2I A;  3V5F A;  3QSS A;  5U1O A;  3C4A A;  4J1O A;  1E1L A;  1W4X A;  5KVH A;  3UKF A;  2JBV A;  2PMQ A;  3EAO A;  3RGT A;  4HCH A;  2CUL A;  2DKI A;  4ZN0 A;  2C64 A;  3H70 A;  3IJQ A;  2PGW A;  3NZG A;  3C96 A;  1OJC A;  1YQ3 A;  2WOW A;  4K8D A;  1BQG A;  2QJJ A;  1LQT A;  3AD8 B;  4YWO A;  2XH0 A;  1XAN A;  3STP A;  3QJ4 A;  1FL2 A;  1PJ5 A;  2OQH A;  4YSX A;  3CK5 A;  3CPJ G;  3KD9 A;  2YLX A;  4O5Q A;  3L5O A;  4Y4L A;  3ZLH A;  1WUF A;  1DNC A;  2X99 A;  3VA8 A;  3CB3 A;  3DJD A;  1Z6L A;  4CBQ A;  4O5U A;  1QO8 A;  1FHU A;  2GL5 A;  3LJP A;  3NTA A;  1AOG A;  3NH3 X;  2I0Z A;  4Z24 A;  1N5X A;  2POZ A;  4AT2 A;  3GDP A;  4E4U A;  5KVI A;  1P2H A;  4H2R A;  1ZY8 A;  5U25 A;  1NHS A;  2TMD A;  1PJ7 A;  1F8W A;  1F8S A;  3JZU A;  3H8L A;  2PTZ A;  4CRT A;  1JNZ A;  3FIM B;  3AM9 A;  1XDI A;  4YSY A;  1H84 A;  1NEN A;  2W3R A;  1NPX A;  3ENL A;  5FS9 A;  1ONF A;  3RED A;  2W55 A;  3ADA B;  2QDD A;  1PS9 A;  4OPI A;  2APG A;  3K30 A;  5KMR A;  3NHO X;  2DW6 A;  1KF6 A;  3LAD A;  4GGB A;  2BXR A;  2Q7V A;  4H4R A;  2WHD A;  1LQU A;  3NO1 A;  2X8H A;  1VDV A;  3OTR A;  5C2T A;  3SR6 B;  2QJN A;  3NRZ B;  3GO2 A;  1X2H A;  2BAC A;  2R0P A;  2GGI A;  4OPL A;  3URH A;  3VQR A;  3SYI A;  3AEF A;  1XPQ A;  3UJE A;  1ELI A;  4RG3 A;  3SZW A;  4X4J A;  1GRF A;  4H19 A;  2R0G A;  2V3B A;  3H12 A;  1COY A;  1JEH A;  4GIR A;  2X8G A;  3I6T A;  1ZP0 A;  1BGJ A;  1MNS A;  3MQT A;  4JY2 A;  4H4U A;  1MDL A;  3ETR B;  5TR3 A;  3AN1 A;  4D04 A;  2AR8 A;  2FKP A;  2QJM A;  3BHF A;  1DOC A;  3L1R A;  1H6V A;  1NHR A;  4J2W A;  4H2N A;  2OVL A;  2V60 A;  2YR5 A;  4AOX A;  3M0O A;  3PK7 A;  2WET A;  1ZDL A;  1H81 A;  3T2Y A;  4EMJ A;  3DG7 A;  4GME A;  2BS2 A;  5KMS A;  3AYI A;  1P2E A;  2GR0 A;  4U2T A;  4NNJ A;  3UJR A;  3OW1 A;  2QQ6 A;  5JCN A;  1DTN A;  4WCT A;  2GGE A;  4DX3 A;  3CPH G;  3DH9 A;  3EKG A;  2QDE A;  1KDG A;  2GR1 A;  3MSY A;  4C3X A;  3IWA A;  5J04 A;  3QVR A;  1F8R A;  1LVL A;  1ZMC A;  2A89 A;  3G5S A;  3B9J B;  4Y4M A;  4C5O A;  5ER0 A;  4Z17 A;  1D4D A;  3JVA A;  1YY5 A;  3M12 A;  5IQ1 A;  3F8R A;  2GEW A;  2E4G A;  3T14 A;  2XLT A;  2EQ7 A;  4Z1Y A;  2RGO A;  2C72 A;  1W6T A;  4GFI A;  1K0J A;  3QVP A;  1E1N A;  4NTC A;  1EBH A;  3HPF A;  3CXO A; 
#chains in the Genus database with same CATH homology
 1DOB A;  1LJ1 A;  1Y0P A;  2VVL G;  3ISH A;  4TLX A;  1H83 A;  2JB3 A;  4J31 A;  2OLO A;  3VRD B;  3VRA A;  1RSG A;  4UDP A;  4M52 A;  3BI4 A;  4H4W A;  1N4V A;  5JCK A;  1E1K A;  2FJA A;  2XFU A;  1Y56 A;  2C73 A;  4J33 A;  4TLZ A;  3P4P A;  4REK A;  3UOX A;  4A99 A;  2YM2 A;  4OPD A;  1PJ6 A;  4U8N A;  4APN A;  2YLZ A;  4G6G A;  1KSU A;  2H88 A;  1S7M A;  4NTD A;  2GH5 A;  2R4E A;  5M10 A;  1NDA A;  3GYI A;  1L9C A;  3GMC A;  2WPF A;  4XWZ A;  2ZZB A;  2GB0 A;  1JRY A;  4YTN A;  1H7X A;  3CGC A;  3F8P A;  2WOI A;  1PBE A;  1Q9I A;  1CHU A;  2WDQ A;  3UKQ A;  4G9K A;  1ZMD A;  3DK8 A;  1FCD A;  4K22 A;  3NTD A;  2CVJ A;  4YT0 A;  2C65 A;  3GYX A;  2RAB A;  4USQ A;  2AQJ A;  1K4Q A;  2WP5 A;  1VDC A;  3PO7 A;  5KOX A;  2B9Y A;  3EPT A;  1VG0 A;  4CY6 A;  3RP7 A;  2TPR A;  4IA6 A;  2YG6 A;  3PG6 A;  1TYT A;  1BGN A;  1GTE A;  1CL0 A;  1VRQ B;  2XCG A;  2BC1 A;  1KNP A;  1FEC A;  2C66 A;  5LV9 A;  3D8X A;  3DK9 A;  2R4J A;  3AEA A;  3AEC A;  4JY3 A;  3NIX A;  1H82 A;  5JRB A;  2WPE A;  1D4C A;  4B64 A;  5HY5 A;  4FDC B;  4XXG A;  1ZOY A;  4U8I A;  1UKV G;  1E39 A;  4H2P A;  3LOV A;  3SY4 A;  3QFA A;  2EQ8 A;  2WES A;  1RYI A;  3PS9 A;  1YQZ A;  4EMW A;  2B7R A;  4AOS A;  4H4X A;  1E6E A;  4AP3 A;  2X3N A;  5HXI A;  1ZKQ A;  4ADW A;  2BRA A;  3UOZ A;  3UTH A;  4UP3 A;  3SGL A;  4Z25 A;  3UP5 A;  2YLR A;  2QCU A;  1BF3 A;  4FK1 C;  4AT0 A;  2BCG G;  1D5T A;  3AXB A;  1EL9 A;  1QLB A;  2ARD A;  2PYX A;  2OAL A;  4EIQ A;  2NVK X;  3P4R A;  4PAA A;  3SFD A;  3UKK A;  4OCG A;  3NRN A;  4JQ9 A;  3SXI A;  2WU5 A;  3ZDN A;  4A65 A;  3NT6 A;  5HYM A;  4JNA A;  1GOS A;  1MOK A;  1GES A;  1EL7 A;  3QSE A;  3CGE A;  2IVE A;  2EQ9 A;  4K7Z A;  1QJD A;  1VQW A;  4GAV A;  3AEB A;  2F5Z A;  1RP0 A;  5EB4 A;  5FS8 A;  3CPI G;  3HZL A;  4H7U A;  2YR6 A;  3II4 A;  1DJN A;  5JCM A;  2HQM A;  1NG3 A;  2BC0 A;  2YLS A;  3FMW A;  2C4C A;  4YTM A;  1F3P A;  2FJD A;  4A9W A;  1PXA A;  4E0V A;  2Y6Q A;  3FBS A;  3C4N A;  4C77 A;  3CND A;  1K0I A;  1K0L A;  3T37 A;  1GV4 A;  2JK6 A;  4B69 A;  4YKG A;  1DOE A;  2WP9 A;  2YQU A;  1DOD A;  1PBF A;  2BS4 A;  4U8K A;  3WE0 A;  1KFY A;  4NTE A;  4JN9 A;  3RP6 A;  2BCP A;  3JSK A;  4U8L A;  1PBC A;  2XVI A;  2YLW A;  2B76 A;  1KNR A;  1GRT A;  2GQW A;  3OC4 A;  3P1W A;  5KMQ A;  1B5Q A;  4IV9 A;  2Y6R A;  2XFN A;  1L9E A;  3GRS A;  1CJ3 A;  2XVH A;  4GUV A;  3K7Q X;  1PBB A;  5KNL A;  3VRB A;  4BK2 A;  4YSZ A;  3GD4 A;  4NEW A;  4H4Z A;  3ICS A;  1N1P A;  2GAH B;  2GR2 A;  3GD3 A;  2C76 A;  2WU2 A;  1BKW A;  2XVE A;  4EM4 A;  1CJC A;  1JNR A;  4H2Q A;  1LPF A;  1O94 A;  1PN0 A;  2XLS A;  4GDP A;  5J7X A;  4II3 A;  1H2I A;  3QSS A;  4RG4 A;  5EBK A;  4I58 A;  3ICR A;  5CQF A;  3ALJ A;  5U1O A;  3C4A A;  4A6N B;  2VZ2 A;  1E1L A;  1PBD A;  1W4X A;  5KVH A;  4Z26 A;  5HHF A;  1S2Q A;  4NZH A;  3UKF A;  3NYC A;  3ZYX A;  2JBV A;  3DGH A;  3NNE A;  2Q0K A;  3CN8 A;  3BHK A;  1NEK A;  4IVM B;  4DSG A;  4K2X A;  3UOV A;  1S3E A;  3IHG A;  1IUW A;  1ZX9 A;  2XFQ A;  4FX9 A;  3EAO A;  2V61 A;  1KSS A;  3HYW A;  2CUL A;  5DBJ A;  2CFY A;  4TM3 A;  1PDH A;  3HYV A;  3NYF A;  3VR9 A;  2DKI A;  4N9X A;  4ZN0 A;  2WPC A;  3KPF A;  2YG5 A;  5IQ4 A;  3AB1 A;  4Y4N A;  3CNJ A;  2VQ7 A;  4P9S A;  2CDU A;  3VR8 A;  3AE3 A;  2C64 A;  2YVF A;  1NHQ A;  5JCI A;  4JNQ A;  2OLN A;  1GTH A;  2YG3 A;  2XLR A;  3V3N A;  3C96 A;  1OJC A;  4EQX A;  2VVL A;  1YQ3 A;  3G5R A;  2WOW A;  3BNU A;  4K8D A;  4CCR A;  2YM1 A;  1LQT A;  3AD8 B;  4YWO A;  3LZW A;  3CNP A;  2OAM A;  1XAN A;  2XDO A;  3E1T A;  4TM1 A;  4C74 A;  3QJ4 A;  3DJE A;  3KKJ A;  1D7L A;  1FL2 A;  2Q0L A;  1PJ5 A;  4U2S A;  4YSX A;  4NEV A;  3Q6J A;  3DK4 A;  3CPJ G;  3KD9 A;  3NK0 X;  3AE2 A;  1GRE A;  4U8J A;  4CCQ A;  2YLX A;  4O5Q A;  4PAB A;  3L5O A;  4UDQ A;  2XVJ A;  3KU9 A;  2ACZ A;  4Y4L A;  1MXT A;  4B68 A;  3NGC X;  1DXL A;  3CTY A;  2IVD A;  1DNC A;  2WP6 A;  2X99 A;  3I3L A;  3OZ2 A;  2IID A;  1GXF A;  3SM8 A;  3AD9 B;  2C3C A;  2E1M A;  3NN6 X;  2QAE A;  2X50 A;  3SQP A;  1GER A;  4II2 A;  3DJD A;  4H4Y A;  3D9X A;  1TDN A;  3AE5 A;  3CIR A;  4G74 A;  4KX6 A;  2YR4 A;  1OJA A;  2ZZC A;  1IUS A;  1Z6L A;  2JKC A;  4CBQ A;  4Z43 A;  2JB1 A;  4O5U A;  1QO8 A;  2OA1 A;  2YG4 A;  3AWI A;  3P9U A;  3COX A;  5EB5 A;  4CY8 A;  3PVC A;  3IF9 A;  3NTA A;  2C75 A;  2NPX A;  1AOG A;  3LJP A;  3NH3 X;  4EQR A;  4DNA A;  5JCL A;  2A87 A;  2I0Z A;  2YLT A;  1GSN A;  3IHM A;  3NKS A;  3IC9 A;  3KVE A;  4YXD A;  1REO A;  4Z24 A;  3B3R A;  4H50 A;  4AT2 A;  1Y56 B;  3GDP A;  1BZL A;  2GVC A;  5KVI A;  3UTF A;  1P2H A;  1S2Y A;  1YKJ A;  1TRB A;  2BK4 A;  1IUU A;  4H2R A;  1IUT A;  3UKH A;  5GRT A;  1ZY8 A;  5U25 A;  1NHS A;  2TMD A;  1PJ7 A;  1F8W A;  3ATR A;  1TDF A;  1F8S A;  1VG9 A;  4GAP A;  2QA2 A;  1GRB A;  2VRL A;  3AE7 A;  3BNM A;  3H8L A;  4CRT A;  1EL5 A;  3CGB A;  5KWF A;  2GQF A;  1JNZ A;  4IA5 A;  3F8D A;  4RSL A;  2GV8 A;  1B37 A;  3FIM B;  3FG2 P;  4H4T A;  4BJZ A;  1XDI A;  2A8X A;  2Q6U A;  1YQ4 A;  4A5L A;  4YSY A;  1H84 A;  1NEN A;  3CGD A;  3BI5 A;  4TM4 A;  1H7W A;  2C70 A;  3UKL A;  3V76 A;  5BUK A;  1NPX A;  2GMH A;  4AP1 A;  3DJG X;  1M64 A;  3T31 A;  4G73 A;  4HB9 A;  2W0H A;  3GMB A;  5FS9 A;  1ONF A;  2XFP A;  2XYO A;  2PHH A;  3RED A;  3AE9 A;  1JU2 A;  3CNT A;  4OPT A;  1F6M A;  2AAQ A;  2BK3 A;  3ABV A;  3QSM A;  3O0H A;  3AED A;  2V3A A;  3RHA A;  4XWR A;  3ADA B;  1M6I A;  4LII A;  4K5R A;  1PS9 A;  4OPI A;  4GCM A;  1O5W A;  2APG A;  3K30 A;  3KLJ A;  4B66 A;  3GDN A;  1MO9 A;  5KMR A;  5U63 A;  3NHO X;  5BUL A;  2BXS A;  1TDE A;  2VVM A;  1KF6 A;  1CJ2 A;  2XFO A;  3LAD A;  1N4U A;  2XLP A;  2Z5Y A;  2BXR A;  4J36 A;  5J60 A;  4H4V A;  2Q7V A;  4BK3 A;  4H4R A;  4IVO B;  2WHD A;  5GSN A;  2YG7 A;  3RP8 A;  1B4V A;  1JRZ A;  2BAB A;  4UDR A;  1LQU A;  1ZOV A;  4WX1 A;  3AE6 A;  4YKF A;  2X8H A;  4DGK A;  1EBD A;  2YVJ A;  5C2T A;  3GWF A;  2WBA A;  2VQB A;  3D1C A;  3KPK A;  1NAA A;  3UP4 A;  1PXB A;  3NK2 X;  1SEZ A;  2VOU A;  5BRT A;  5C3J A;  2BAC A;  2R0P A;  1CC4 A;  4NWZ A;  4OPL A;  5IPY A;  3URH A;  3VQR A;  3CMM A;  4DSH A;  2B7S A;  3SYI A;  3AEF A;  1XPQ A;  1ELI A;  2EQ6 A;  4RG3 A;  2VRM A;  3SZW A;  4X4J A;  2X8C A;  4X9M A;  2WOV A;  4X9N A;  4EMI A;  1OJT A;  1GRF A;  2GMJ A;  2R0G A;  2V3B A;  3UCL A;  2V6O A;  5M0Z A;  1CC2 A;  1COY A;  1D4E A;  2UZZ A;  1JEH A;  2V5Z A;  2BS3 A;  4BV6 A;  2O9Z A;  3NG7 X;  2GRT A;  3R9U A;  1ZK7 A;  3K7M X;  5L46 A;  1DJQ A;  2BA9 A;  2ZBW A;  1N4W A;  2XLU A;  1L9D A;  1GT8 A;  5BVA A;  2X8G A;  5KOW A;  2DKH A;  3DJJ A;  5CKU A;  1XHC A;  4Z2R A;  1Q1R A;  2BRY A;  1ZP0 A;  1BGJ A;  4JY2 A;  4H4U A;  4OPC A;  2GAG B;  1IUX A;  5TR3 A;  1GEU A;  4GR1 A;  2WEU A;  1TDO A;  4D04 A;  4JDR A;  2AR8 A;  1IUV A;  4ZCC A;  4A79 A;  3BHF A;  1HYU A;  3SZ0 A;  1DOC A;  4HA6 A;  4H4P A;  3L1R A;  3B6D A;  4EIP A;  1H6V A;  1NHR A;  2YAU A;  4J2W A;  1H86 A;  4U2L A;  2R45 A;  1PXC A;  1GAL A;  3H4K A;  2XVF A;  4H2N A;  4BK1 A;  2V60 A;  2YR5 A;  4B1B A;  2Z5X A;  4U8O A;  1GND A;  1LV0 A;  4AOX A;  3LZX A;  3M13 A;  3SFE A;  4ECH A;  3M0O A;  4Z2T A;  2WET A;  4OPU A;  1V59 A;  1ZDL A;  4ZCD A;  3ICT A;  2FJE A;  3FPZ A;  3SZF A;  4OVI A;  3UKA A;  2C7G A;  2BK5 A;  1BWC A;  4KPR A;  2R46 A;  1D7Y A;  2ZZ0 A;  1H81 A;  3T2Y A;  3EAN A;  3QFB A;  3LB8 A;  4EMJ A;  3G5Q A;  2BS2 A;  4Z2U A;  4GDE A;  4J34 A;  3SZC A;  5KMS A;  2WQY A;  5KMP A;  4GRT A;  1JRX A;  2FBW A;  4B67 A;  5FS7 A;  4USR A;  1FEA A;  3AYI A;  4OPG A;  3T2K A;  4D03 A;  1OJ9 A;  3HYX A;  1P2E A;  4B65 A;  3GSI A;  1FOH A;  2GR0 A;  2E5V A;  3Q9T A;  1TDK A;  3T0K A;  4U2T A;  5KRQ A;  1GRA A;  2J3N A;  4BJY A;  4NNJ A;  3S61 A;  2R9Z A;  2WDV A;  2RGJ A;  3NN0 X;  2YVG A;  5JCN A;  4EM3 A;  4GF7 A;  4WCT A;  1KN0 A;  1JOA A;  2FJB A;  1E7P A;  3AE4 A;  3AYL A;  3UKP A;  5FS6 A;  4A6N A;  4K5S A;  3AEG A;  3RNM A;  3UOY A;  3CPH G;  1PHH A;  3H8I A;  1E1M A;  3DH9 A;  3UTE A;  1KDG A;  1Q1W A;  3ITJ A;  2GR1 A;  4U8M A;  3DGZ A;  4EQW A;  4Z44 A;  4ICY A;  3NYE A;  1GET A;  4C3X A;  1CC6 A;  3AE1 A;  3AD7 B;  4TM0 A;  3IWA A;  2H89 A;  2B9X A;  1EL8 A;  3QVR A;  2JAE A;  1F8R A;  1LTX R;  3EF6 A;  3S5W A;  1LVL A;  1ZMC A;  1NHP A;  1GPE A;  2A89 A;  1L0V A;  3G5S A;  4FK1 A;  4Y4M A;  4C5O A;  4C3Y A;  1B8S A;  5ER0 A;  1X31 B;  3BI2 A;  4G6H A;  1GRG A;  2QA1 A;  1D4D A;  3LXD A;  4H4S A;  1O95 A;  3I6D A;  1YY5 A;  3V3O A;  1CBO A;  4LA1 A;  3NK1 X;  4J57 A;  1CF3 A;  2BYB A;  2WS3 A;  3F8R A;  3M12 A;  5IQ1 A;  2YWL A;  4EQS A;  3ALM A;  1FEB A;  3P4S A;  3AE8 A;  2GEW A;  2E4G A;  3AEE A;  3GYJ A;  3T14 A;  1OJD A;  2GR3 A;  2GF3 A;  3ATQ A;  3L8K A;  3UTG A;  4J56 A;  2XLT A;  3GRT A;  3GWD A;  4I59 A;  2EQ7 A;  1CJ4 A;  4A7A A;  2RGO A;  2C72 A;  4U8P A;  1NG4 A;  5FMH A;  1IJH A;  4CNK A;  5KXJ A;  4LU6 A;  2R0C A;  5EOW A;  3NLC A;  2RGH A;  2C3D A;  1TYP A;  3KA7 A;  4B63 A;  2C67 A;  1K0J A;  3DME A;  3SX6 A;  3K7T A;  4YSH A;  4BUR A;  3AYJ A;  3QVP A;  1E1N A;  4NTC A;  3T2Z A;  2WDR A;  4YTP A;  1S3B A;  1GRH A;  3DA1 A;  3CNS A;  4CNJ A;  3P4Q A;  4H4Q A;  2JB2 A;  4MJW A;  3ALL A;  2B9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...