1NHPA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 137
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhpA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhpA02
3H8LA 4OPDA 1LTXR 2E5VA 4H4YA 3AYIA 4AP3A 2BA9A 1GTHA 1ZY8A 4CNKA 5J60A 2GEWA 2GAHB 3GYJA 3UKQA 2YM2A 1FL2A 1X31B 4BURA 2YVGA 1ZMDA 4UDQA 4Z24A 1XDIA 3CNSA 4BV6A 3ABVA 4EIQA 3KLJA 2APGA 1IUSA 3NG7X 1B4VA 5JCNA 1YQZA 3AE3A 1JRXA 5BUKA 3PVCA 3KD9A 5JCLA 2YG4A 1EL8A 2YAUA 2GB0A 4H2QA 4EIPA 3CPJG 4TM0A 1PXBA 1PBFA 3ATRA 4TM4A 2X8HA 3DJGX 5CKUA 5LV9A 1GREA 4YWOA 4DNAA 1FEBA 3IC9A 4JNQA 2JB1A 4Z43A 1KSSA 3LB8A 2XLUA 5GRTA 3C96A 4PAAA 1GSNA 3R9UA 1DXLA 4USQA 1LV0A 1KSUA 2QAEA 3NLCA 5KVHA 1COYA 1D7LA 1DODA 3PO7A 2E4GA 2OALA 3I3LA 4OPLA 1EL5A 3DMEA 2X3NA 5M10A 2BS4A 1CC2A 2XVHA 5KVIA 1H83A 3RNMA 3LXDA 2YM1A 3AE4A 3QSSA 1CJ4A 1RYIA 4OPUA 4B63A 2GQWA 3SGLA 5GSNA 1D4EA 3UTGA 3Q9TA 4Z25A 4PABA 2W0HA 2C3CA 2F5ZA 1CL0A 1EL9A 4Y4LA 4YXDA 3AYLA 3UKKA 2WP6A 1IUWA 3UP5A 1VG0A 4ADWA 1FEAA 2JB2A 2FBWA 2BYBA 2XFOA 3AE5A 3ISHA 2GH5A 3DGHA 2FJAA 2YLSA 4YSYA 2GR0A 1GPEA 1VRQB 3GRSA 2BABA 3RP7A 2A8XA 2BC1A 2C67A 1CJCA 1UKVG 2B9XA 4I58A 3VQRA 4A79A 3NK1X 1NEKA 2OAMA 5FS7A 2TPRA 4U8LA 2NPXA 3O0HA 4CBQA 1MOKA 4GRTA 3ALLA 3SM8A 4BK2A 4K7ZA 3QVPA 1F3PA 3BI4A 4Z2RA 1ONFA 2EQ6A 3NN0X 4Y4NA 4OPCA 2R0GA 4EMJA 4RG3A 4YKFA 2XVEA 1MO9A 5EBKA 2DKHA 2GAGB 2VQBA 4TLXA 2GV8A 3E1TA 3NK0X 1CC4A 5EB4A 1O94A 4CY6A 1GRHA 4NEWA 1DOEA 2WHDA 4IVMB 5BRTA 4H4SA 2TMDA 1LPFA 2R46A 4X4JA 2BXSA 2XFNA 1S2YA 4H2RA 1F8WA 1PBBA 2YLTA 3CNPA 4U8PA 1B8SA 5FS8A 2YVFA 3ATQA 2WPFA 1IUUA 1NG3A 1KNPA 4OPGA 4YTNA 2BS2A 3PS9A 5KOWA 2QCUA 3V3OA 1O5WA 2XVJA 3LOVA 3EANA 3NH3X 4YT0A 2C7GA 1QLBA 4U8MA 3DK4A 2CULA 1BGNA 3AE1A 1VQWA 1NDAA 4AT0A 1H86A 1TRBA 4GDEA 2XVIA 4H4PA 3ADAB 4K22A 4EQSA 2EQ9A 4D03A 4CNJA 1E6EA 2XFQA 2XYOA 3FIMB 1KDGA 1RSGA 2UZZA 3K7QX 3NYFA 1YKJA 1ZOVA 2C72A 3CIRA 1E39A 4MJWA 4OPIA 3URHA 3FBSA 5BULA 1NHSA 2YQUA 4NZHA 5HXIA 1NHQA 5ER0A 4B67A 4BJYA 3DJEA 2ZZBA 3DJDA 4IV9A 4X9MA 3K30A 2Q0LA 1LJ1A 2VOUA 2Q6UA 5C2TA 4C77A 1ZK7A 1KFYA 2Y6RA 4H4WA 2JB3A 4LIIA 4H4UA 4GUVA 4X9NA 1IUXA 5JCKA 2JBVA 1NAAA 1CBOA 2XLSA 3KA7A 3SFDA 3IHGA 3EAOA 4C3XA 2Y6QA 3AECA 3M12A 1K0IA 4FX9A 3CNTA 3M0OA 5TR3A 3BI5A 1TDEA 2XLRA 3D8XA 1E7PA 3F8RA 3ICSA 4A65A 5IPYA 2PYXA 1QJDA 3IF9A 2VZ2A 1S2QA 3AD9B 1PJ6A 1S3EA 4LU6A 4AP1A 3QSMA 4BK3A 2C73A 4TM3A 4H2PA 4K8DA 3GMBA 4XWRA 2R4JA 2CDUA 3FG2P 1ZMCA 3CGBA 3UKAA 3VRDB 3AXBA 4USRA 1XPQA 4A6NB 5C3JA 4JNAA 1PJ5A 2RGHA 1PDHA 2B7RA 3ICRA 1GETA 4O5UA 3KVEA 2EQ8A 3NN6X 4IA5A 1H81A 2BXRA 1QO8A 3DGZA 3NKSA 2YLWA 2YR4A 1NG4A 2YLXA 4JN9A 1TDOA 2I0ZA 3P4QA 2OA1A 2V61A 2WDRA 3VRBA 2CFYA 1JU2A 2GMHA 3DA1A 4J36A 4UP3A 4AT2A 3AE2A 1TDFA 3EPTA 3UOXA 2AR8A 3QFBA 4LA1A 2BS3A 1GESA 2VVMA 5J7XA 2VRMA 3GDNA 5U63A 1NHRA 3I6DA 1GRGA 2GR3A 3QFAA 1FECA 1E1NA 1KNRA 2BK5A 3ITJA 4GR1A 3RHAA 2CVJA 5KWFA 1YQ4A 2A89A 2GQFA 2X8GA 1BGJA 1E1LA 2YR5A 2XLPA 4FK1C 4U8KA 3S61A 2H89A 2WDVA 2XFPA 1ZP0A 1H82A 2IIDA 4NTEA 3UKFA 4EM4A 4CCQA 2WBAA 2C3DA 3D1CA 2WQYA 1FOHA 3AEGA 2C65A 2H88A 2VVLA 1TDNA 3II4A 2WOWA 1PBEA 5KOXA 2GF3A 4A5LA 5FS6A 2WOVA 1F8SA 2C76A 2E1MA 5HYMA 1M64A 2VVLG 2OLNA 2YWLA 3VR9A 4AOXA 2VQ7A 5IQ4A 4H4RA 3IWAA 1TYTA 4GDPA 1D4CA 3BHKA 1TDKA 1REOA 1PHHA 1JEHA 4ECHA 4GCMA 5U1OA 3AD7B 3DK9A 1GRAA 1D4DA 2XCGA 3AB1A 4EM3A 2FJDA 4UDPA 1DJQA 3UOYA 2XFUA 3KPFA 1SEZA 3AEEA 4UDRA 1W4XA 1DOCA 1LVLA 3AE7A 4Z2UA 1E1KA 2GRTA 4H4QA 1O95A 1JOAA 3GRTA 5FS9A 3V3NA 3F8DA 4N9XA 4H4XA 1OJCA 5KXJA 1PBDA 2GMJA 3BNUA 2WU2A 3T37A 2Z5YA 1IJHA 3GDPA 2V3BA 3AEBA 3DJJA 4C3YA 3AE6A 4FDCB 4NTDA 2RABA 4H2NA 4CRTA 4J57A 2BK4A 1Q9IA 3REDA 1GRBA 2BC0A 3B6DA 4A9WA 2WEUA 1V59A 1YQ3A 4YSXA 2YG5A 5BVAA 1NHPA 3ICTA 1K4QA 2YR6A 3VR8A 3CNJA 3P4RA 3SQPA 3JSKA 3DK8A 1CC6A 1L9EA 4J2WA 2V6OA 3AD8B 4HA6A 3P4PA 4Z44A 3AE8A 2B9YA 3AEAA 2YG3A 1Z6LA 2GR2A 2R0CA 3NYCA 4H4ZA 2WETA 4IVOB 3ZDNA 1D7YA 4KX6A 4B1BA 3LADA 4DSHA 4B64A 1IUVA 2WP9A 2RGJA 1DJNA 2X8CA 2BCPA 3LZXA 2YLZA 1BZLA 2JKCA 1JRYA 4EMWA 2A87A 2ARDA 3LJPA 1BWCA 2ACZA 1GRTA 2YVJA 1NENA 3LZWA 3EF6A 1N4WA 2B9WA 2C66A 5JCMA 3GWDA 4Y4MA 3NGCX 3BHFA 4HB9A 4J33A 3GYIA 1PJ7A 1P2HA 2JAEA 4U8NA 1GERA 2C64A 1YY5A 2BCGG 3C4NA 2WOIA 3P1WA 4WX1A 5M0ZA 1AOGA 4REKA 3ZYXA 1L9CA 3FPZA 4JDRA 5U25A 4C74A 4YSZA 3SFEA 1GEUA 3M13A 1M6IA 2WPEA 3OC4A 3AWIA 3GMCA 1F8RA 1K0JA 1ZKQA 4A6NA 2YG6A 3UTEA 1ZOYA 4I59A 2IVDA 4H50A 3IHMA 2HQMA 4U2LA 2B76A 1ZDLA 1OJ9A 1GNDA 2C75A 3UTHA 1XANA 3NRNA 3RP8A 4APNA 1Y0PA 1LQUA 3L1RA 5CQFA 1CHUA 2XDOA 4RG4A 5EOWA 3AEFA 3CGEA 1Y56A 2Q7VA 2R0PA 3RP6A 4FK1A 1TYPA 4JY3A 3G5QA 4H7UA 1GTEA 4U8IA 3F8PA 5FMHA 3CGCA 1Y56B 1B37A 2QA2A 2ZBWA 1GT8A 2XVFA 3GSIA 4BK1A 3NHOX 4OVIA 1PXCA 4KPRA 4NEVA 1GOSA 3NNEA 1GALA 4U2SA 4EQRA 1EL7A 4YTMA 1RP0A 1JRZA 1VDCA 4K5RA 3NYEA 4ICYA 2WDQA 3BI2A 3G5SA 4JY2A 4YSHA 5JCIA 4BJZA 4M52A 1OJTA 3GD4A 2AAQA 1MXTA 3QVRA 4B66A 3UKPA 3AE9A 3B3RA 2GR1A 2J3NA 1JNRA 4P9SA 2IVEA 1OJDA 3P4SA 1Q1WA 1XHCA 1CJ3A 3FMWA 4XXGA 2XLTA 2FJEA 3BNMA 3HZLA 1S3BA 3WE0A 3COXA 3NT6A 3DH9A 3L8KA 1CF3A 1PBCA 2V3AA 1H7WA 1VG9A 2FJBA 3ALMA 4TM1A 5HY5A 4Z26A 2V60A 1N4VA 2ZZCA 4B65A 4J31A 2WS3A 4ZCCA 4YKGA 3NTDA 4K2XA 3H4KA 5KRQA 1EBDA 4D04A 1DOBA 1PXAA 4IA6A 4EQXA 3KKJA 3H8IA 1H84A 3UOZA 3CPIG 4U8JA 3CN8A 4CY8A 2O9ZA 4OPTA 3AYJA 2RGOA 1P2EA 2YG7A 2R9ZA 1DNCA 1E1MA 4ZCDA 2ZZ0A 5IQ1A 4YTPA 3GD3A 4O5QA 4CCRA 3S5WA 3UCLA 5HHFA 4EMIA 1IUTA 4AOSA 1K0LA 3CPHG 3NIXA 3GWFA 2EQ7A 3UTFA 2C70A 4J34A 5DBJA 1L0VA 3QJ4A 2WESA 4B68A 1CJ2A 2X99A 4K5SA 4A99A 4EQWA 2YLRA 3G5RA 4H4TA 4JQ9A 1F6MA 3KU9A 3OZ2A 3UKLA 4B69A 1ZX9A 2V5ZA 1BKWA 1PN0A 3UKHA 4H4VA 4U2TA 1GRFA 1PS9A 4ZN0A 1HYUA 2PHHA 4U8OA 3P9UA 1Q1RA 3NK2X 1N4UA 1FCDA 2WU5A 4OCGA 3QSEA 2JK6A 1KF6A 3C4AA 1BF3A 1NPXA 1GXFA 2WPCA 4E0VA 1L9DA 4DGKA 1ELIA 1H7XA 4WCTA 1JNZA 1B5QA 2OLOA 4TLZA 4A7AA 2R45A 2BACA 4DSGA 3UOVA 3UP4A 2WP5A 1N1PA 3ALJA 3VRAA 3CTYA 3AEDA 1LQTA 3V76A 1GV4A 2B7SA 4NTCA 4XWZA 3CGDA 3CNDA 4Z2TA 2NVKX 2AQJA 2QA1A 2VRLA 5L46A 1D5TA 4RSLA 3NTAA 2BK3A 3K7TA 2X50A 3Q6JA 4J56A 1OJAA 2GVCA 2R4EA 4GF7A 5EB5A 3K7MX 4C5OA 2DKIA 2Q0KA 2Z5XA 1H6VA
chains in the Genus database with same CATH superfamily
3N4EA 2E5VA 4H4YA 3AYIA 1GTHA 4CNKA 2GEWA 3GYJA 1ONEA 2YM2A 3DEQA 3CNSA 3KLJA 4GISA 1B4VA 4K2SA 3D46A 3KD9A 3V5CA 1PBFA 5LV9A 4DNAA 1FEBA 2JB1A 3I6EA 3LB8A 1KKOA 3R25A 1DODA 3PO7A 3I3LA 1JPMA 2YM1A 1CJ4A 4OPUA 5GSNA 3UTGA 3CYJA 4Z25A 2W0HA 2C3CA 1CL0A 1EL9A 4YXDA 3AYLA 1VG0A 4ADWA 1FEAA 2JB2A 2FBWA 3AE5A 3V3WA 2FJAA 2BABA 2A8XA 2POZA 2C67A 4K1WA 3VQRA 1ZXIC 1NEKA 5FS7A 2TPRA 2NPXA 3L5OA 3SM8A 3U9IA 3NN0X 4Y4NA 4YKFA 2R0GA 4RG3A 1P43A 1MO9A 2VQBA 3FXGA 2GV8A 1GRHA 5FJUA 4X4JA 1S2YA 3ATQA 5FS8A 1NG3A 4YTNA 1KNPA 3PS9A 3V3OA 3P93A 3EANA 2QDDA 3SBFA 4GDEA 4ZCWA 4H4PA 4EQSA 1E6EA 2XFQA 1KDGA 2UZZA 4EWJA 2PGEA 2NQLA 3CIRA 4MJWA 3URHA 3DESA 1TE6A 4B67A 1L8PA 3DJDA 1NELA 1LJ1A 3BOXA 5C2TA 4C77A 3TW9A 1KFYA 4GUVA 5JCKA 1SJCA 2Y6QA 1MDLA 4FX9A 5TR3A 1E7PA 4A65A 2PYXA 3CMMA 4BK3A 4TM3A 3GMBA 4XWRA 1ZMCA 4E8GA 4USRA 4A6NB 4ZA0A 5C3JA 4HNCA 4JNAA 1PJ5A 3DFHA 4O5UA 1H81A 2BXRA 3NKSA 2CFYA 2PODA 3MWCA 4J36A 4UP3A 3EPTA 4G8TA 2BS3A 2XSXA 5U63A 4GYPA 3QFAA 1E1NA 1KNRA 5KWFA 4GR1A 2A89A 3FCPA 4CCQA 2C3DA 3D1CA 1FOHA 1E9IA 5KOXA 2WOVA 2E1MA 2OLNA 4H4RA 4ECHA 2XCGA 2FJDA 4Z17A 1DJQA 2XFUA 2PSNA 4UDRA 3AE7A 3H7VA 3DFYA 2GRTA 4HYRA 5FS9A 3I4KA 3V3NA 3T37A 1IJHA 3DJJA 1N60C 4FDCB 4H2NA 4CRTA 4J57A 3REDA 4A9WA 5BVAA 3T6CA 3JSKA 4ROPA 3AEAA 2R0CA 4H4ZA 2WETA 4B1BA 4H83A 3LADA 1IUVA 2WP9A 2RGJA 1DJNA 2P8BA 2X8CA 3LZXA 3AMZA 1BZLA 2A87A 1BWCA 2ACZA 4DHGA 2OKTA 3GWDA 3NGCX 4HB9A 4J33A 1PJ7A 1P2HA 4E5TA 2JAEA 1GERA 3C4NA 3PFRA 3P1WA 4REKA 1L9CA 3FPZA 5U25A 4C74A 3M13A 4G6HA 3OC4A 3MY9A 3GMCA 4A6NA 3UTEA 4I59A 4H50A 1TKKA 1OJ9A 2C75A 3NRNA 3RP8A 4APNA 1Y0PA 3A7AA 5CQFA 1CHUA 4RG4A 3RP6A 2Q7VA 4FK1A 4JY3A 1N5WC 2HZGA 3F8PA 1VQZA 1Y56B 1GT8A 4ENLA 3NHOX 3UCCA 4OVIA 4NEVA 3UJFA 1EL7A 1JRZA 1VDCA 4Z1YA 3DG6A 2OZTA 3P4SA 4XXGA 3COXA 3NT6A 3ALMA 2V3AA 1N5XA 3UXLA 2AKZA 3N6HA 5G5GB 5HY5A 2AL2B 4IP5A 2WS3A 4ZCCA 5KRQA 4HCHA 4EQXA 3HYWA 4U8JA 4OPTA 2RGOA 4H2HA 5IQ1A 3SN1A 4O5QA 4CCRA 3S5WA 1FHVA 4K8GA 2XH2A 3GWFA 2ZC8A 5DBJA 2C4CA 2V5ZA 1BKWA 2GGEA 4U2TA 1PS9A 2PHHA 3OZMA 4M6UA 2JK6A 3C4AA 2OLAA 1NPXA 2WPCA 1ELIA 1B5QA 2OFJA 4TLZA 2R45A 2GGIA 3DERA 4DSGA 3UP4A 3VC6A 3V76A 4XWZA 4Z2TA 2NVKX 5L46A 5JRBA 4RSLA 3NTAA 4G7FA 2BK3A 3T2KA 2Q0KA 2Z5XA 4OPDA 1LTXR 4AP3A 3TOYA 2BA9A 5J60A 4UDQA 4BURA 1ZMDA 2AKMA 3PK7A 2I5QA 1PDYA 3IJLA 1YQZA 3AE3A 2YG4A 3SZ0A 4X2PA 1PXBA 3ATRA 4TM4A 3KUMA 2P8CA 3B9JB 3ES8A 1KSSA 5GRTA 4PAAA 3SZWA 1DXLA 3NLCA 5KVHA 1D7LA 2E4GA 1SB3B 2X3NA 3QSSA 3LXDA 3AE4A 2AL2A 3SGLA 4PABA 2BRAA 3P0WA 5IDZA 3BSMA 3QN3A 2BYBA 2XFOA 3R10A 2BC1A 1CJCA 4I58A 4A79A 3SXIA 2OAMA 1VDVA 4CBQA 4U8LA 2PTZA 4GRTA 4GYPC 3T31A 3T0KA 4Z2RA 4EMJA 2DKHA 3FV9A 3NK0X 4CY6A 3OPSA 3A7UA 2BXSA 4H2RA 1F8WA 1PBBA 4M0XA 3DG7A 2YVFA 3FJ4A 2WPFA 2BS2A 2QCUA 4YT0A 3T2YA 3DK4A 1VQWA 3NRZB 4K22A 2EQ9A 3FVDA 1FFVC 3FIMB 1YKJA 1KCZA 3NS1B 1R6WA 2GGJA 1SJAA 4HCLA 1EC8A 5HXIA 2HXUA 1NHQA 5ER0A 4GAPA 1OEPA 3H12A 4BJYA 5BOFA 2ZZBA 1JPDX 1WUEA 3K30A 2Q0LA 1S7MA 2QJNA 2VOUA 3QKEA 1ZK7A 3AN1A 3SN4A 4X9NA 2JB3A 3TTEA 1CBOA 2AL1A 3IHGA 1KKRA 3CAWA 1FFUC 3M0OA 3BI5A 1TDEA 3VA8A 4AP1A 2PA6A 3QSMA 2C73A 4H2PA 4K8DA 3SR6B 3UJEA 3VRDB 3AXBA 1XPQA 3ZLFA 1BKHA 2B7RA 4IZGA 3DGZA 1NG4A 4JN9A 2V61A 1X2HA 1JU2A 4MMWA 1EBHA 1TDFA 3QFBA 4LA1A 2VVMA 3GDNA 3I6DA 2BK5A 3ITJA 3RHAA 2CVJA 5J04A 2GQFA 2YR5A 4U8KA 2X8GA 3MSYA 3NZGA 1BGJA 1E1LA 4FK1C 1H82A 4EM4A 3VDGA 3AEGA 2H88A 2VVLA 2WOWA 4A5LA 2C76A 1M64A 2VVLG 1NU5A 2VQ7A 4HPNA 5IQ4A 1N63C 1TYTA 1TDKA 1PHHA 3DK9A 1GRAA 1D4DA 4EM3A 3UOYA 3GC2A 2GSHA 3AEEA 1DOCA 3HW2A 1E1KA 4H4QA 1O95A 1JOAA 3GRTA 1V97A 1OJCA 2GMJA 3BNUA 1MDRA 2V3BA 4C3YA 4GGHA 4NTDA 1Q9IA 1GRBA 1FHUA 5ENLA 2WEUA 2E5AA 1V59A 1EC7A 2YR6A 3CNJA 1JRPA 5BOEA 3DG3A 1EC9A 4Z44A 2B9YA 4IHCA 2GR2A 4NNJA 4TVYA 2OQHA 4DSHA 4B64A 4GFIA 3R11A 2YLZA 1GRTA 2YVJA 3NO1A 1NENA 2B9WA 4Y4MA 2C66A 5JCMA 3GYIA 4DX3A 4KT2A 5FJPA 1YY5A 2BCGG 5M0ZA 2WOIA 3ZYXA 4JDRA 1M6IA 2WPEA 4A6GA 1F8RA 3R0UA 2HQMA 4U2LA 1ZDLA 3IJIA 2XDOA 3AEFA 3CGEA 3DDMA 3A7RA 2R0PA 4DXKA 2XGZA 1GTEA 4II2A 3GSIA 4BK1A 4KPRA 4EQRA 3QLDA 4YTMA 2OZ8A 4KEMA 2WDQA 4JY2A 2PTXA 4M52A 2AAQA 2PMQA 1JNRA 4P9SA 1Q1WA 2FJEA 2PPGA 3CB3A 2W3SA 1VG9A 4NWZA 3HYVA 5KMPA 4Z26A 1N4VA 2ZZCA 4JN7A 3CPIG 1DNCA 1E1MA 4ZCDA 2O56A 4YTPA 5HHFA 4G9KA 1IUTA 1K0LA 3CPHG 2OO6A 3SSZA 2EQ7A 2C70A 4HCDA 4K5SA 3T2ZA 4EQWA 4H4TA 1F6MA 3OZ2A 3OTRA 4B69A 3UKHA 3S5SA 1HYUA 3RO6A 4OCGA 1N4UA 1KF6A 4MKSA 1L9DA 4DGKA 4E0VA 2BACA 3S47A 3VRAA 3CTYA 1LQTA 1GV4A 4NTCA 2QA1A 3Q6JA 2GVCA 4GF7A 1H6VA 3TJIA 2OPJA 1ZY8A 4KWSA 3UKQA 3QPEA 1FL2A 1X31B 4Z24A 1XDIA 4BV6A 4EIQA 1WYGA 1IUSA 3TJ4A 3U4FA 1JRXA 5JCLA 1EL8A 2YAUA 2GB0A 4EIPA 3ZVIA 4TM0A 3DJGX 5CKUA 4GMEA 4YWOA 3CT2A 4JNQA 4Z43A 4USQA 1KSUA 3SZFA 3ES7A 4OPLA 2XVHA 1CC2A 1H83A 1RYIA 2F5ZA 4Y4LA 3UKKA 3UP5A 2PCEA 3ISHA 3R0KA 2GH5A 3DGHA 1JCTA 2YLSA 2GR0A 1GPEA 1VRQB 3T8QA 2B9XA 2OQYA 2XH4A 3O0HA 3ALLA 4K7ZA 3QVPA 1F3PA 3BI4A 2EQ6A 4OPCA 3UJSA 3FYYA 2XVEA 3B97A 2GAGB 4TLXA 3E1TA 4H19A 1CC4A 1O94A 2WHDA 4IVMB 4H4SA 2TMDA 1LPFA 2R46A 2XFNA 4U8PA 4OPGA 5KOWA 2XVJA 3LOVA 3UXKA 1QLBA 2CULA 1BGNA 4AT0A 1H86A 2PU0A 2XVIA 3ADAB 4D03A 4CNJA 1RSGA 3K7QX 3GYXA 3FBSA 5BULA 1NHSA 4NZHA 2FKPA 3DJEA 4IV9A 4X9MA 3SX6A 2PS2A 2Y6RA 4H4WA 4LIIA 4H4UA 4GIRA 2JBVA 1NAAA 4E4UA 2PP3A 2XLSA 3SFDA 4C3XA 3AECA 3M12A 3D8XA 3ICSA 5IPYA 1QJDA 1N61C 1PJ6A 1XS2A 4FI4A 2R4JA 3FG2P 3D47A 3CGBA 3UKAA 4GAVA 3PWIA 1WUFA 5FJRA 1PDHA 3KVEA 2EQ8A 3STPA 4IA5A 1QO8A 2YLWA 3P4QA 2WDRA 3VRBA 3MUCA 3DA1A 3T4WA 3AE2A 5J7XA 2VRMA 1GRGA 2GR3A 1FECA 1PDZA 3N4FA 1P48A 5KMRA 1ZP0A 2IIDA 4NTEA 1TDNA 1PBEA 2GF3A 5FS6A 5HYMA 4AOXA 3BJSA 1X2GA 2XH0A 1D4CA 4II3A 2FYMA 4GCMA 1YEYA 3AD7B 3AB1A 4UDPA 3HYXA 3KPFA 2GDQA 1W4XA 1SJBA 3VCCA 3SZCA 1ECQA 4N9XA 6ENLA 5KXJA 1MRAA 3HRDC 4A3RA 3AE6A 2QQ6A 7ENLA 3B6DA 4YSXA 2CHRA 3ICTA 3SN0A 3DK8A 1CC6A 1L9EA 3AD8B 4HA6A 3P4PA 3AE8A 2YG3A 1Z6LA 3PWGA 3NYCA 4IVOB 4HNLA 3RGTA 2E3TA 3OZYA 2QJMA 2BCPA 2JKCA 2DW7A 3LZWA 3UCDA 3EF6A 1N4WA 3BHFA 2C64A 1AOGA 1GEUA 3DIPA 2YG6A 2IVDA 3IHMA 2B76A 1GNDA 1XANA 1DTNA 3NVWB 3L1RA 3ETRB 5EOWA 1TYPA 2MNRA 4U8IA 3CGCA 2QA2A 2ZBWA 2XVFA 1EBGA 4YWSA 1GALA 1RP0A 3NYEA 4ICYA 4YSHA 4BJZA 3GD4A 3QVRA 4B66A 3B3RA 2J3NA 2IVEA 3THUA 1XHCA 3FMWA 2XLTA 3JVAA 3DH9A 3L8KA 1JDFA 4ZOHB 3ZLGA 2V60A 4H1ZA 3NTDA 4YKGA 4K2XA 2PU1A 1EBDA 2QJJA 4D04A 1DOBA 4IA6A 3KKJA 4CY8A 3Q4DA 2O9ZA 3AYJA 2R9ZA 1JROA 2ZZ0A 2OX4A 3NXLA 4EMIA 4AOSA 3UGVA 3NVYB 4J34A 1L0VA 3QJ4A 1CJ2A 3HPFA 2X99A 4A99A 3G5RA 4JQ9A 3KU9A 3UKLA 1ZX9A 3MZNA 4ZN0A 4U8OA 2PTWA 1Q1RA 3NK2X 3UJRA 3ENLA 2WU5A 1FCDA 3MQTA 1BF3A 4WCTA 1JNZA 2OLOA 4A7AA 2ONEA 3UOVA 3CGDA 3OP2A 4MGGA 5EB5A 4C5OA 2GGHA 2DKIA 3H8LA 4TVWA 3TQPA 3H8AA 2GAHB 2QVHA 2YVGA 4KPLA 2DW6A 3ABVA 2APGA 3NG7X 5JCNA 1MNSA 3GD6A 5BUKA 3PVCA 3PG6A 4H2QA 3CPJG 4HN8A 3UJ2A 2X8HA 1GREA 3IC9A 2XLUA 3K1GA 3C96A 1GSNA 3R9UA 1LV0A 2QAEA 1COYA 3MKCA 2OALA 1EL5A 3DMEA 5M10A 2BS4A 5KVIA 3RR1A 3RNMA 4B63A 2GQWA 1D4EA 3Q9TA 2WP6A 1IUWA 3OW1A 3D9XA 1IYXA 3KPKA 3EEZA 4F4RA 4DYEA 5EU9A 4YSYA 3GRSA 3RP7A 1UKVG 3SYIA 3NK1X 1KD0A 1MOKA 4BK2A 2P88A 1ONFA 3V5FA 4DN1A 3AM9A 5EBKA 5EB4A 4IT1A 4NEWA 3ZVHB 1DOEA 5BRTA 1FIQB 3Q45A 2YLTA 3CNPA 1B8SA 1IUUA 2W54A 1O5WA 3NH3X 3SJNA 2C7GA 2XH7A 4U8MA 3AE1A 1NDAA 1TRBA 1STZA 2XYOA 3NYFA 2PTYA 1ZOVA 2C72A 1E39A 4OPIA 3GO2A 3T9PA 4G73A 2YQUA 3T14A 4E6MA 2OG9A 2Q6UA 1R0MA 1IUXA 3KA7A 3EAOA 1K0IA 1XPYA 3VC5A 3CNTA 2GGGA 2XLRA 3IJQA 3F8RA 3IF9A 2VZ2A 1S2QA 3AD9B 1S3EA 4LU6A 2CDUA 4G74A 3RRAA 5KMSA 3SQSA 2RGHA 1KN0A 3ICRA 1GETA 3NN6X 3IK4A 2YR4A 2YLXA 1TDOA 2I0ZA 2OA1A 2GMHA 3JZUA 4AT2A 3UOXA 2AR8A 1GESA 2P3ZA 1NHRA 5KMQA 1YQ4A 3VCNA 2XLPA 3S61A 2H89A 2WDVA 2XFPA 3UKFA 2WBAA 3EKGA 2WQYA 2C65A 3II4A 5FJOA 1F8SA 2YWLA 3VR9A 3CXBA 3CK5A 3IWAA 1MUCA 4GDPA 2QGYA 3BHKA 1REOA 1JEHA 5U1OA 3ZVHA 3ZLHA 1SEZA 1LVLA 4Z2UA 3NVZB 5FJTA 3VFCA 3F8DA 4H4XA 2QDEA 1PBDA 2WU2A 2Z5YA 2PP1A 3GDPA 3AEBA 2RABA 2BK4A 2BC0A 2MUCA 2PGWA 3JW7A 1YQ3A 2YG5A 4A35A 1NHPA 1K4QA 3TWAA 3VR8A 3P4RA 4J1OA 3SQPA 4J2WA 2P0IA 2V6OA 2GL5A 5G5HB 1W6TA 2ZADA 3ZDNA 1D7YA 4KX6A 3H70A 1F9CA 1JRYA 4EMWA 3LJPA 2ARDA 4IL0A 1BQGA 4U8NA 4WX1A 3NFUA 1FO4A 3EUB3 4GGBA 4YSZA 3SFEA 4G6GA 3RCYA 3NVVB 3AWIA 4J3ZA 1K0JA 1ZKQA 2HXTA 1ZOYA 1TZZA 3UTHA 3RITA 1LQUA 3GY1A 1Y56A 2PP0A 3G5QA 4FP1A 4H7UA 5FMHA 1B37A 1ELSA 3QTPA 3DGBA 1PXCA 3NNEA 1GOSA 4U2SA 4IL2A 4K5RA 3BI2A 3G5SA 5JCIA 1OJTA 1MXTA 3UKPA 3AE9A 4DWDA 2GR1A 3R1ZA 1OJDA 1CJ3A 3BNMA 3HZLA 1S3BA 3WE0A 3V4BA 5KNLA 1CF3A 1PBCA 1H7WA 2FJBA 4TM1A 3N6JA 2W55A 3TCSA 4B65A 4J31A 1N62C 2HNEA 3H4KA 3P3BA 1PXAA 3H8IA 1H84A 3UOZA 4E4FA 3CN8A 2BRYA 1P2EA 2YG7A 4JHMA 3GD3A 3UCLA 1H2IA 3NIXA 3R07C 3UTFA 1SJDA 2WESA 4B68A 2YLRA 1T3QC 4IP4A 2RDXA 1PN0A 4H4VA 1RVKA 1GRFA 3P9UA 3QSEA 1GXFA 1H7XA 1RM6B 3I6TA 2OZ3A 2WP5A 2OVLA 1N1PA 3ALJA 2W3RA 3AEDA 2B7SA 3CNDA 2AQJA 4JN8A 3SY4A 2VRLA 1D5TA 3K7TA 3TWBA 2X50A 4J56A 1OJAA 2R4EA 3CXOA 3K7MX
chains in the Genus database with same CATH topology
3H8LA 4OPDA 1LTXR 2E5VA 4H4YA 3AYIA 4AP3A 2BA9A 1GTHA 1ZY8A 4CNKA 5J60A 2GEWA 2GAHB 3GYJA 3UKQA 2YM2A 1FL2A 1X31B 4BURA 2YVGA 1ZMDA 4UDQA 4Z24A 1XDIA 3CNSA 4BV6A 3ABVA 4EIQA 3KLJA 2APGA 1IUSA 3NG7X 1B4VA 5JCNA 1YQZA 3AE3A 1JRXA 5BUKA 3PVCA 3PG6A 3KD9A 5JCLA 2YG4A 1EL8A 3SZ0A 2YAUA 2GB0A 4H2QA 4EIPA 3CPJG 4TM0A 1PXBA 1PBFA 3ATRA 4TM4A 2X8HA 3DJGX 5CKUA 5LV9A 1GREA 4YWOA 4DNAA 1FEBA 3IC9A 4JNQA 2JB1A 4Z43A 1KSSA 3LB8A 2XLUA 5GRTA 3C96A 4PAAA 1GSNA 3R9UA 3SZWA 1DXLA 4USQA 1LV0A 1KSUA 2QAEA 3NLCA 3SZFA 5KVHA 1COYA 1D7LA 1DODA 3PO7A 2E4GA 2OALA 3I3LA 4OPLA 1EL5A 3DMEA 2X3NA 5M10A 2BS4A 1CC2A 2XVHA 5KVIA 1H83A 3RNMA 3LXDA 2YM1A 3AE4A 3QSSA 1CJ4A 1RYIA 4OPUA 4B63A 2GQWA 3SGLA 5GSNA 1D4EA 3UTGA 3Q9TA 4Z25A 4PABA 2BRAA 2W0HA 2C3CA 2F5ZA 1CL0A 1EL9A 4Y4LA 4YXDA 3AYLA 3UKKA 2WP6A 1IUWA 3UP5A 1VG0A 4ADWA 1FEAA 2JB2A 2FBWA 3D9XA 2BYBA 2XFOA 3AE5A 3ISHA 3KPKA 2GH5A 3DGHA 2FJAA 2YLSA 4YSYA 2GR0A 1GPEA 1VRQB 3GRSA 2BABA 3RP7A 2A8XA 2BC1A 2C67A 1CJCA 1UKVG 2B9XA 4I58A 3VQRA 3SYIA 4A79A 3NK1X 1NEKA 3SXIA 2OAMA 5FS7A 2TPRA 4U8LA 2NPXA 3O0HA 4CBQA 1MOKA 3L5OA 4GRTA 3ALLA 3SM8A 3T31A 3T0KA 4K7ZA 3QVPA 4BK2A 1F3PA 3BI4A 4Z2RA 1ONFA 2EQ6A 3NN0X 4Y4NA 4OPCA 2R0GA 4EMJA 4RG3A 4YKFA 2XVEA 1MO9A 5EBKA 2DKHA 2GAGB 2VQBA 4TLXA 2GV8A 3E1TA 3NK0X 1CC4A 5EB4A 1O94A 4CY6A 1GRHA 4NEWA 1DOEA 2WHDA 4IVMB 5BRTA 4H4SA 2TMDA 1LPFA 2R46A 4X4JA 2BXSA 2XFNA 1S2YA 4H2RA 1F8WA 1PBBA 2YLTA 3CNPA 4U8PA 1B8SA 5FS8A 2YVFA 3ATQA 2WPFA 1IUUA 1NG3A 1KNPA 4OPGA 4YTNA 2BS2A 3PS9A 5KOWA 2QCUA 3V3OA 1O5WA 2XVJA 3LOVA 3EANA 3NH3X 4YT0A 2C7GA 3T2YA 1QLBA 4U8MA 3DK4A 2CULA 1BGNA 3AE1A 1VQWA 1NDAA 4AT0A 1H86A 1TRBA 4GDEA 2XVIA 4H4PA 3ADAB 4K22A 4EQSA 2EQ9A 4D03A 4CNJA 1E6EA 2XFQA 2XYOA 3FIMB 1KDGA 1RSGA 2UZZA 3K7QX 3NYFA 1YKJA 1ZOVA 2C72A 3CIRA 1E39A 4MJWA 3GYXA 4OPIA 3URHA 3FBSA 4G73A 5BULA 1NHSA 2YQUA 4NZHA 3T14A 5HXIA 1NHQA 5ER0A 4GAPA 4B67A 4BJYA 3DJEA 2ZZBA 3DJDA 4IV9A 4X9MA 3K30A 3SX6A 2Q0LA 1LJ1A 1S7MA 2VOUA 2Q6UA 5C2TA 4C77A 1ZK7A 1KFYA 2Y6RA 4H4WA 2JB3A 4LIIA 4H4UA 4GUVA 4X9NA 1IUXA 5JCKA 2JBVA 1NAAA 1CBOA 2XLSA 3KA7A 3SFDA 3IHGA 3EAOA 4C3XA 2Y6QA 3AECA 3M12A 1K0IA 4FX9A 3CNTA 3M0OA 5TR3A 3BI5A 1TDEA 2XLRA 3D8XA 1E7PA 3F8RA 3ICSA 4A65A 5IPYA 2PYXA 3CMMA 1QJDA 3IF9A 2VZ2A 1S2QA 3AD9B 1PJ6A 1S3EA 4LU6A 4AP1A 3QSMA 4BK3A 2C73A 4TM3A 4H2PA 4K8DA 3GMBA 4XWRA 2R4JA 2CDUA 3FG2P 1ZMCA 4G74A 3CGBA 3UKAA 4GAVA 3VRDB 5KMSA 3AXBA 4USRA 1XPQA 4A6NB 5C3JA 4JNAA 1PJ5A 2RGHA 1KN0A 1PDHA 2B7RA 3ICRA 1GETA 4O5UA 3KVEA 2EQ8A 3NN6X 4IA5A 1H81A 2BXRA 1QO8A 3DGZA 3NKSA 2YLWA 2YR4A 1NG4A 2YLXA 4JN9A 1TDOA 2I0ZA 3P4QA 2OA1A 2V61A 2WDRA 3VRBA 2CFYA 1JU2A 2GMHA 3DA1A 4J36A 4UP3A 4AT2A 3AE2A 1TDFA 3EPTA 3UOXA 2AR8A 3QFBA 4LA1A 2BS3A 1GESA 2VVMA 5J7XA 2VRMA 3GDNA 5U63A 1NHRA 3I6DA 1GRGA 2GR3A 3QFAA 1FECA 1E1NA 1KNRA 2BK5A 3ITJA 4GR1A 5KMQA 2CVJA 3RHAA 5KWFA 1YQ4A 2A89A 2GQFA 2X8GA 1BGJA 1E1LA 2YR5A 2XLPA 4FK1C 4U8KA 3S61A 2H89A 5KMRA 2WDVA 2XFPA 1ZP0A 1H82A 2IIDA 4NTEA 3UKFA 4EM4A 4CCQA 2WBAA 2C3DA 3D1CA 2WQYA 1FOHA 3AEGA 2C65A 2H88A 2VVLA 1TDNA 3II4A 2WOWA 1PBEA 5KOXA 2GF3A 4A5LA 5FS6A 2WOVA 1F8SA 2C76A 2E1MA 5HYMA 1M64A 2VVLG 2OLNA 2YWLA 3VR9A 4AOXA 2VQ7A 5IQ4A 4H4RA 3IWAA 1TYTA 4GDPA 1D4CA 3BHKA 1TDKA 4II3A 1REOA 1PHHA 1JEHA 4ECHA 4GCMA 5U1OA 3AD7B 3DK9A 1GRAA 1D4DA 2XCGA 3AB1A 4EM3A 2FJDA 3HYXA 1DJQA 4UDPA 2XFUA 3UOYA 3KPFA 1SEZA 3AEEA 4UDRA 1W4XA 1DOCA 1LVLA 3AE7A 4Z2UA 1E1KA 2GRTA 4H4QA 1O95A 1JOAA 3GRTA 5FS9A 3SZCA 3V3NA 3F8DA 4N9XA 4H4XA 1OJCA 5KXJA 1PBDA 2GMJA 3BNUA 2WU2A 3T37A 2Z5YA 1IJHA 3GDPA 2V3BA 3AEBA 3DJJA 4C3YA 3AE6A 4FDCB 4NTDA 2RABA 4H2NA 4CRTA 4J57A 2BK4A 1Q9IA 3REDA 1GRBA 2BC0A 3B6DA 4A9WA 2WEUA 1V59A 1YQ3A 4YSXA 2YG5A 5BVAA 1NHPA 3ICTA 1K4QA 2YR6A 3VR8A 3CNJA 3P4RA 3SQPA 3JSKA 3DK8A 1CC6A 1L9EA 4J2WA 2V6OA 3AD8B 4HA6A 3P4PA 4Z44A 3AE8A 2B9YA 3AEAA 2YG3A 1Z6LA 2GR2A 2R0CA 3NYCA 4H4ZA 2WETA 4IVOB 3ZDNA 4NNJA 1D7YA 4KX6A 4B1BA 3LADA 4DSHA 4B64A 1IUVA 2WP9A 2RGJA 1DJNA 2X8CA 2BCPA 3LZXA 2YLZA 1BZLA 2JKCA 1JRYA 4EMWA 2A87A 2ARDA 3LJPA 1BWCA 2ACZA 1GRTA 2YVJA 1NENA 3LZWA 3EF6A 1N4WA 2B9WA 2C66A 5JCMA 3GWDA 4Y4MA 3NGCX 3BHFA 4HB9A 4J33A 3GYIA 1PJ7A 1P2HA 2JAEA 4U8NA 1GERA 2C64A 1YY5A 2BCGG 3C4NA 2WOIA 3P1WA 4WX1A 5M0ZA 1AOGA 4REKA 3ZYXA 1L9CA 3FPZA 4JDRA 5U25A 4C74A 4YSZA 3SFEA 1GEUA 3M13A 1M6IA 4G6GA 2WPEA 4G6HA 3OC4A 3AWIA 3GMCA 1F8RA 1K0JA 1ZKQA 4A6NA 2YG6A 3UTEA 1ZOYA 4I59A 2IVDA 4H50A 3IHMA 2HQMA 4U2LA 2B76A 1ZDLA 1OJ9A 1GNDA 2C75A 3UTHA 1XANA 3NRNA 3RP8A 4APNA 1Y0PA 1LQUA 3L1RA 5CQFA 1CHUA 2XDOA 4RG4A 5EOWA 3AEFA 3CGEA 1Y56A 2Q7VA 2R0PA 3RP6A 4FK1A 1TYPA 4JY3A 3G5QA 4H7UA 1GTEA 4U8IA 4II2A 3F8PA 5FMHA 3CGCA 1Y56B 1B37A 2QA2A 2ZBWA 1GT8A 2XVFA 3GSIA 4BK1A 3NHOX 4OVIA 1PXCA 4KPRA 4NEVA 1GOSA 3NNEA 1GALA 4U2SA 4EQRA 1EL7A 4YTMA 1RP0A 1JRZA 1VDCA 4K5RA 3NYEA 4ICYA 2WDQA 3BI2A 3G5SA 4JY2A 4YSHA 5JCIA 4BJZA 4M52A 1OJTA 3GD4A 2AAQA 1MXTA 3QVRA 4B66A 3UKPA 3AE9A 3B3RA 2GR1A 2J3NA 1JNRA 4P9SA 2IVEA 1OJDA 3P4SA 1Q1WA 1XHCA 1CJ3A 3FMWA 4XXGA 2XLTA 2FJEA 3BNMA 3HZLA 1S3BA 3WE0A 3COXA 3NT6A 3DH9A 5KNLA 3L8KA 1CF3A 2V3AA 1PBCA 1H7WA 1VG9A 2FJBA 3ALMA 4NWZA 3HYVA 4TM1A 5HY5A 5KMPA 4Z26A 2V60A 1N4VA 2ZZCA 4B65A 4J31A 2WS3A 4ZCCA 4YKGA 3NTDA 4K2XA 3H4KA 5KRQA 1EBDA 4D04A 1DOBA 1PXAA 4IA6A 4EQXA 3KKJA 3H8IA 3HYWA 1H84A 3UOZA 3CPIG 4U8JA 3CN8A 4CY8A 2O9ZA 4OPTA 3AYJA 2RGOA 2BRYA 1P2EA 2YG7A 2R9ZA 1DNCA 1E1MA 4ZCDA 2ZZ0A 5IQ1A 4YTPA 3GD3A 4O5QA 4CCRA 3S5WA 3UCLA 1H2IA 5HHFA 4EMIA 4G9KA 1IUTA 4AOSA 1K0LA 3CPHG 3NIXA 3GWFA 2EQ7A 3UTFA 2C70A 4J34A 5DBJA 1L0VA 3QJ4A 2WESA 4B68A 1CJ2A 2X99A 4K5SA 3T2ZA 4A99A 4EQWA 2YLRA 2C4CA 4H4TA 3G5RA 4JQ9A 1F6MA 3KU9A 3OZ2A 3UKLA 4B69A 1ZX9A 2V5ZA 1BKWA 1PN0A 3UKHA 4H4VA 4U2TA 1GRFA 1PS9A 4ZN0A 1HYUA 2PHHA 4U8OA 3P9UA 1Q1RA 3NK2X 1N4UA 1FCDA 2WU5A 4OCGA 3QSEA 2JK6A 1KF6A 3C4AA 1BF3A 1NPXA 1GXFA 2WPCA 4E0VA 1L9DA 4DGKA 1ELIA 1H7XA 4WCTA 1JNZA 1B5QA 2OLOA 4TLZA 4A7AA 2R45A 2BACA 4DSGA 3UOVA 3UP4A 2WP5A 1N1PA 3ALJA 3VRAA 3CTYA 3AEDA 1LQTA 3V76A 1GV4A 2B7SA 4NTCA 4XWZA 3CGDA 3CNDA 4Z2TA 2NVKX 2AQJA 2QA1A 3SY4A 2VRLA 5L46A 1D5TA 5JRBA 4RSLA 3NTAA 2BK3A 3K7TA 2X50A 3Q6JA 4J56A 1OJAA 2GVCA 2R4EA 4GF7A 5EB5A 3T2KA 3K7MX 4C5OA 2DKIA 2Q0KA 2Z5XA 1H6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8L A;  4OPD A;  1LTX R;  2E5V A;  4H4Y A;  3AYI A;  4AP3 A;  2BA9 A;  1GTH A;  1ZY8 A;  4CNK A;  5J60 A;  2GEW A;  2GAH B;  3GYJ A;  3UKQ A;  2YM2 A;  1FL2 A;  1X31 B;  4BUR A;  2YVG A;  1ZMD A;  4UDQ A;  4Z24 A;  1XDI A;  3CNS A;  4BV6 A;  3ABV A;  4EIQ A;  3KLJ A;  2APG A;  1IUS A;  3NG7 X;  1B4V A;  5JCN A;  1YQZ A;  3AE3 A;  1JRX A;  5BUK A;  3PVC A;  3KD9 A;  5JCL A;  2YG4 A;  1EL8 A;  2YAU A;  2GB0 A;  4H2Q A;  4EIP A;  3CPJ G;  4TM0 A;  1PXB A;  1PBF A;  3ATR A;  4TM4 A;  2X8H A;  3DJG X;  5CKU A;  5LV9 A;  1GRE A;  4YWO A;  4DNA A;  1FEB A;  3IC9 A;  4JNQ A;  2JB1 A;  4Z43 A;  1KSS A;  3LB8 A;  2XLU A;  5GRT A;  3C96 A;  4PAA A;  1GSN A;  3R9U A;  1DXL A;  4USQ A;  1LV0 A;  1KSU A;  2QAE A;  3NLC A;  5KVH A;  1COY A;  1D7L A;  1DOD A;  3PO7 A;  2E4G A;  2OAL A;  3I3L A;  4OPL A;  1EL5 A;  3DME A;  2X3N A;  5M10 A;  2BS4 A;  1CC2 A;  2XVH A;  5KVI A;  1H83 A;  3RNM A;  3LXD A;  2YM1 A;  3AE4 A;  3QSS A;  1CJ4 A;  1RYI A;  4OPU A;  4B63 A;  2GQW A;  3SGL A;  5GSN A;  1D4E A;  3UTG A;  3Q9T A;  4Z25 A;  4PAB A;  2W0H A;  2C3C A;  2F5Z A;  1CL0 A;  1EL9 A;  4Y4L A;  4YXD A;  3AYL A;  3UKK A;  2WP6 A;  1IUW A;  3UP5 A;  1VG0 A;  4ADW A;  1FEA A;  2JB2 A;  2FBW A;  2BYB A;  2XFO A;  3AE5 A;  3ISH A;  2GH5 A;  3DGH A;  2FJA A;  2YLS A;  4YSY A;  2GR0 A;  1GPE A;  1VRQ B;  3GRS A;  2BAB A;  3RP7 A;  2A8X A;  2BC1 A;  2C67 A;  1CJC A;  1UKV G;  2B9X A;  4I58 A;  3VQR A;  4A79 A;  3NK1 X;  1NEK A;  2OAM A;  5FS7 A;  2TPR A;  4U8L A;  2NPX A;  3O0H A;  4CBQ A;  1MOK A;  4GRT A;  3ALL A;  3SM8 A;  4BK2 A;  4K7Z A;  3QVP A;  1F3P A;  3BI4 A;  4Z2R A;  1ONF A;  2EQ6 A;  3NN0 X;  4Y4N A;  4OPC A;  2R0G A;  4EMJ A;  4RG3 A;  4YKF A;  2XVE A;  1MO9 A;  5EBK A;  2DKH A;  2GAG B;  2VQB A;  4TLX A;  2GV8 A;  3E1T A;  3NK0 X;  1CC4 A;  5EB4 A;  1O94 A;  4CY6 A;  1GRH A;  4NEW A;  1DOE A;  2WHD A;  4IVM B;  5BRT A;  4H4S A;  2TMD A;  1LPF A;  2R46 A;  4X4J A;  2BXS A;  2XFN A;  1S2Y A;  4H2R A;  1F8W A;  1PBB A;  2YLT A;  3CNP A;  4U8P A;  1B8S A;  5FS8 A;  2YVF A;  3ATQ A;  2WPF A;  1IUU A;  1NG3 A;  1KNP A;  4OPG A;  4YTN A;  2BS2 A;  3PS9 A;  5KOW A;  2QCU A;  3V3O A;  1O5W A;  2XVJ A;  3LOV A;  3EAN A;  3NH3 X;  4YT0 A;  2C7G A;  1QLB A;  4U8M A;  3DK4 A;  2CUL A;  1BGN A;  3AE1 A;  1VQW A;  1NDA A;  4AT0 A;  1H86 A;  1TRB A;  4GDE A;  2XVI A;  4H4P A;  3ADA B;  4K22 A;  4EQS A;  2EQ9 A;  4D03 A;  4CNJ A;  1E6E A;  2XFQ A;  2XYO A;  3FIM B;  1KDG A;  1RSG A;  2UZZ A;  3K7Q X;  3NYF A;  1YKJ A;  1ZOV A;  2C72 A;  3CIR A;  1E39 A;  4MJW A;  4OPI A;  3URH A;  3FBS A;  5BUL A;  1NHS A;  2YQU A;  4NZH A;  5HXI A;  1NHQ A;  5ER0 A;  4B67 A;  4BJY A;  3DJE A;  2ZZB A;  3DJD A;  4IV9 A;  4X9M A;  3K30 A;  2Q0L A;  1LJ1 A;  2VOU A;  2Q6U A;  5C2T A;  4C77 A;  1ZK7 A;  1KFY A;  2Y6R A;  4H4W A;  2JB3 A;  4LII A;  4H4U A;  4GUV A;  4X9N A;  1IUX A;  5JCK A;  2JBV A;  1NAA A;  1CBO A;  2XLS A;  3KA7 A;  3SFD A;  3IHG A;  3EAO A;  4C3X A;  2Y6Q A;  3AEC A;  3M12 A;  1K0I A;  4FX9 A;  3CNT A;  3M0O A;  5TR3 A;  3BI5 A;  1TDE A;  2XLR A;  3D8X A;  1E7P A;  3F8R A;  3ICS A;  4A65 A;  5IPY A;  2PYX A;  1QJD A;  3IF9 A;  2VZ2 A;  1S2Q A;  3AD9 B;  1PJ6 A;  1S3E A;  4LU6 A;  4AP1 A;  3QSM A;  4BK3 A;  2C73 A;  4TM3 A;  4H2P A;  4K8D A;  3GMB A;  4XWR A;  2R4J A;  2CDU A;  3FG2 P;  1ZMC A;  3CGB A;  3UKA A;  3VRD B;  3AXB A;  4USR A;  1XPQ A;  4A6N B;  5C3J A;  4JNA A;  1PJ5 A;  2RGH A;  1PDH A;  2B7R A;  3ICR A;  1GET A;  4O5U A;  3KVE A;  2EQ8 A;  3NN6 X;  4IA5 A;  1H81 A;  2BXR A;  1QO8 A;  3DGZ A;  3NKS A;  2YLW A;  2YR4 A;  1NG4 A;  2YLX A;  4JN9 A;  1TDO A;  2I0Z A;  3P4Q A;  2OA1 A;  2V61 A;  2WDR A;  3VRB A;  2CFY A;  1JU2 A;  2GMH A;  3DA1 A;  4J36 A;  4UP3 A;  4AT2 A;  3AE2 A;  1TDF A;  3EPT A;  3UOX A;  2AR8 A;  3QFB A;  4LA1 A;  2BS3 A;  1GES A;  2VVM A;  5J7X A;  2VRM A;  3GDN A;  5U63 A;  1NHR A;  3I6D A;  1GRG A;  2GR3 A;  3QFA A;  1FEC A;  1E1N A;  1KNR A;  2BK5 A;  3ITJ A;  4GR1 A;  3RHA A;  2CVJ A;  5KWF A;  1YQ4 A;  2A89 A;  2GQF A;  2X8G A;  1BGJ A;  1E1L A;  2YR5 A;  2XLP A;  4FK1 C;  4U8K A;  3S61 A;  2H89 A;  2WDV A;  2XFP A;  1ZP0 A;  1H82 A;  2IID A;  4NTE A;  3UKF A;  4EM4 A;  4CCQ A;  2WBA A;  2C3D A;  3D1C A;  2WQY A;  1FOH A;  3AEG A;  2C65 A;  2H88 A;  2VVL A;  1TDN A;  3II4 A;  2WOW A;  1PBE A;  5KOX A;  2GF3 A;  4A5L A;  5FS6 A;  2WOV A;  1F8S A;  2C76 A;  2E1M A;  5HYM A;  1M64 A;  2VVL G;  2OLN A;  2YWL A;  3VR9 A;  4AOX A;  2VQ7 A;  5IQ4 A;  4H4R A;  3IWA A;  1TYT A;  4GDP A;  1D4C A;  3BHK A;  1TDK A;  1REO A;  1PHH A;  1JEH A;  4ECH A;  4GCM A;  5U1O A;  3AD7 B;  3DK9 A;  1GRA A;  1D4D A;  2XCG A;  3AB1 A;  4EM3 A;  2FJD A;  4UDP A;  1DJQ A;  3UOY A;  2XFU A;  3KPF A;  1SEZ A;  3AEE A;  4UDR A;  1W4X A;  1DOC A;  1LVL A;  3AE7 A;  4Z2U A;  1E1K A;  2GRT A;  4H4Q A;  1O95 A;  1JOA A;  3GRT A;  5FS9 A;  3V3N A;  3F8D A;  4N9X A;  4H4X A;  1OJC A;  5KXJ A;  1PBD A;  2GMJ A;  3BNU A;  2WU2 A;  3T37 A;  2Z5Y A;  1IJH A;  3GDP A;  2V3B A;  3AEB A;  3DJJ A;  4C3Y A;  3AE6 A;  4FDC B;  4NTD A;  2RAB A;  4H2N A;  4CRT A;  4J57 A;  2BK4 A;  1Q9I A;  3RED A;  1GRB A;  2BC0 A;  3B6D A;  4A9W A;  2WEU A;  1V59 A;  1YQ3 A;  4YSX A;  2YG5 A;  5BVA A;  1NHP A;  3ICT A;  1K4Q A;  2YR6 A;  3VR8 A;  3CNJ A;  3P4R A;  3SQP A;  3JSK A;  3DK8 A;  1CC6 A;  1L9E A;  4J2W A;  2V6O A;  3AD8 B;  4HA6 A;  3P4P A;  4Z44 A;  3AE8 A;  2B9Y A;  3AEA A;  2YG3 A;  1Z6L A;  2GR2 A;  2R0C A;  3NYC A;  4H4Z A;  2WET A;  4IVO B;  3ZDN A;  1D7Y A;  4KX6 A;  4B1B A;  3LAD A;  4DSH A;  4B64 A;  1IUV A;  2WP9 A;  2RGJ A;  1DJN A;  2X8C A;  2BCP A;  3LZX A;  2YLZ A;  1BZL A;  2JKC A;  1JRY A;  4EMW A;  2A87 A;  2ARD A;  3LJP A;  1BWC A;  2ACZ A;  1GRT A;  2YVJ A;  1NEN A;  3LZW A;  3EF6 A;  1N4W A;  2B9W A;  2C66 A;  5JCM A;  3GWD A;  4Y4M A;  3NGC X;  3BHF A;  4HB9 A;  4J33 A;  3GYI A;  1PJ7 A;  1P2H A;  2JAE A;  4U8N A;  1GER A;  2C64 A;  1YY5 A;  2BCG G;  3C4N A;  2WOI A;  3P1W A;  4WX1 A;  5M0Z A;  1AOG A;  4REK A;  3ZYX A;  1L9C A;  3FPZ A;  4JDR A;  5U25 A;  4C74 A;  4YSZ A;  3SFE A;  1GEU A;  3M13 A;  1M6I A;  2WPE A;  3OC4 A;  3AWI A;  3GMC A;  1F8R A;  1K0J A;  1ZKQ A;  4A6N A;  2YG6 A;  3UTE A;  1ZOY A;  4I59 A;  2IVD A;  4H50 A;  3IHM A;  2HQM A;  4U2L A;  2B76 A;  1ZDL A;  1OJ9 A;  1GND A;  2C75 A;  3UTH A;  1XAN A;  3NRN A;  3RP8 A;  4APN A;  1Y0P A;  1LQU A;  3L1R A;  5CQF A;  1CHU A;  2XDO A;  4RG4 A;  5EOW A;  3AEF A;  3CGE A;  1Y56 A;  2Q7V A;  2R0P A;  3RP6 A;  4FK1 A;  1TYP A;  4JY3 A;  3G5Q A;  4H7U A;  1GTE A;  4U8I A;  3F8P A;  5FMH A;  3CGC A;  1Y56 B;  1B37 A;  2QA2 A;  2ZBW A;  1GT8 A;  2XVF A;  3GSI A;  4BK1 A;  3NHO X;  4OVI A;  1PXC A;  4KPR A;  4NEV A;  1GOS A;  3NNE A;  1GAL A;  4U2S A;  4EQR A;  1EL7 A;  4YTM A;  1RP0 A;  1JRZ A;  1VDC A;  4K5R A;  3NYE A;  4ICY A;  2WDQ A;  3BI2 A;  3G5S A;  4JY2 A;  4YSH A;  5JCI A;  4BJZ A;  4M52 A;  1OJT A;  3GD4 A;  2AAQ A;  1MXT A;  3QVR A;  4B66 A;  3UKP A;  3AE9 A;  3B3R A;  2GR1 A;  2J3N A;  1JNR A;  4P9S A;  2IVE A;  1OJD A;  3P4S A;  1Q1W A;  1XHC A;  1CJ3 A;  3FMW A;  4XXG A;  2XLT A;  2FJE A;  3BNM A;  3HZL A;  1S3B A;  3WE0 A;  3COX A;  3NT6 A;  3DH9 A;  3L8K A;  1CF3 A;  1PBC A;  2V3A A;  1H7W A;  1VG9 A;  2FJB A;  3ALM A;  4TM1 A;  5HY5 A;  4Z26 A;  2V60 A;  1N4V A;  2ZZC A;  4B65 A;  4J31 A;  2WS3 A;  4ZCC A;  4YKG A;  3NTD A;  4K2X A;  3H4K A;  5KRQ A;  1EBD A;  4D04 A;  1DOB A;  1PXA A;  4IA6 A;  4EQX A;  3KKJ A;  3H8I A;  1H84 A;  3UOZ A;  3CPI G;  4U8J A;  3CN8 A;  4CY8 A;  2O9Z A;  4OPT A;  3AYJ A;  2RGO A;  1P2E A;  2YG7 A;  2R9Z A;  1DNC A;  1E1M A;  4ZCD A;  2ZZ0 A;  5IQ1 A;  4YTP A;  3GD3 A;  4O5Q A;  4CCR A;  3S5W A;  3UCL A;  5HHF A;  4EMI A;  1IUT A;  4AOS A;  1K0L A;  3CPH G;  3NIX A;  3GWF A;  2EQ7 A;  3UTF A;  2C70 A;  4J34 A;  5DBJ A;  1L0V A;  3QJ4 A;  2WES A;  4B68 A;  1CJ2 A;  2X99 A;  4K5S A;  4A99 A;  4EQW A;  2YLR A;  3G5R A;  4H4T A;  4JQ9 A;  1F6M A;  3KU9 A;  3OZ2 A;  3UKL A;  4B69 A;  1ZX9 A;  2V5Z A;  1BKW A;  1PN0 A;  3UKH A;  4H4V A;  4U2T A;  1GRF A;  1PS9 A;  4ZN0 A;  1HYU A;  2PHH A;  4U8O A;  3P9U A;  1Q1R A;  3NK2 X;  1N4U A;  1FCD A;  2WU5 A;  4OCG A;  3QSE A;  2JK6 A;  1KF6 A;  3C4A A;  1BF3 A;  1NPX A;  1GXF A;  2WPC A;  4E0V A;  1L9D A;  4DGK A;  1ELI A;  1H7X A;  4WCT A;  1JNZ A;  1B5Q A;  2OLO A;  4TLZ A;  4A7A A;  2R45 A;  2BAC A;  4DSG A;  3UOV A;  3UP4 A;  2WP5 A;  1N1P A;  3ALJ A;  3VRA A;  3CTY A;  3AED A;  1LQT A;  3V76 A;  1GV4 A;  2B7S A;  4NTC A;  4XWZ A;  3CGD A;  3CND A;  4Z2T A;  2NVK X;  2AQJ A;  2QA1 A;  2VRL A;  5L46 A;  1D5T A;  4RSL A;  3NTA A;  2BK3 A;  3K7T A;  2X50 A;  3Q6J A;  4J56 A;  1OJA A;  2GVC A;  2R4E A;  4GF7 A;  5EB5 A;  3K7M X;  4C5O A;  2DKI A;  2Q0K A;  2Z5X A;  1H6V A; 
#chains in the Genus database with same CATH topology
 3N4E A;  2E5V A;  4H4Y A;  3AYI A;  1GTH A;  4CNK A;  2GEW A;  3GYJ A;  1ONE A;  2YM2 A;  3DEQ A;  3CNS A;  3KLJ A;  4GIS A;  1B4V A;  4K2S A;  3D46 A;  3KD9 A;  3V5C A;  1PBF A;  5LV9 A;  4DNA A;  1FEB A;  2JB1 A;  3I6E A;  3LB8 A;  1KKO A;  3R25 A;  1DOD A;  3PO7 A;  3I3L A;  1JPM A;  2YM1 A;  1CJ4 A;  4OPU A;  5GSN A;  3UTG A;  3CYJ A;  4Z25 A;  2W0H A;  2C3C A;  1CL0 A;  1EL9 A;  4YXD A;  3AYL A;  1VG0 A;  4ADW A;  1FEA A;  2JB2 A;  2FBW A;  3AE5 A;  3V3W A;  2FJA A;  2BAB A;  2A8X A;  2POZ A;  2C67 A;  4K1W A;  3VQR A;  1ZXI C;  1NEK A;  5FS7 A;  2TPR A;  2NPX A;  3L5O A;  3SM8 A;  3U9I A;  3NN0 X;  4Y4N A;  4YKF A;  2R0G A;  4RG3 A;  1P43 A;  1MO9 A;  2VQB A;  3FXG A;  2GV8 A;  1GRH A;  5FJU A;  4X4J A;  1S2Y A;  3ATQ A;  5FS8 A;  1NG3 A;  4YTN A;  1KNP A;  3PS9 A;  3V3O A;  3P93 A;  3EAN A;  2QDD A;  3SBF A;  4GDE A;  4ZCW A;  4H4P A;  4EQS A;  1E6E A;  2XFQ A;  1KDG A;  2UZZ A;  4EWJ A;  2PGE A;  2NQL A;  3CIR A;  4MJW A;  3URH A;  3DES A;  1TE6 A;  4B67 A;  1L8P A;  3DJD A;  1NEL A;  1LJ1 A;  3BOX A;  5C2T A;  4C77 A;  3TW9 A;  1KFY A;  4GUV A;  5JCK A;  1SJC A;  2Y6Q A;  1MDL A;  4FX9 A;  5TR3 A;  1E7P A;  4A65 A;  2PYX A;  3CMM A;  4BK3 A;  4TM3 A;  3GMB A;  4XWR A;  1ZMC A;  4E8G A;  4USR A;  4A6N B;  4ZA0 A;  5C3J A;  4HNC A;  4JNA A;  1PJ5 A;  3DFH A;  4O5U A;  1H81 A;  2BXR A;  3NKS A;  2CFY A;  2POD A;  3MWC A;  4J36 A;  4UP3 A;  3EPT A;  4G8T A;  2BS3 A;  2XSX A;  5U63 A;  4GYP A;  3QFA A;  1E1N A;  1KNR A;  5KWF A;  4GR1 A;  2A89 A;  3FCP A;  4CCQ A;  2C3D A;  3D1C A;  1FOH A;  1E9I A;  5KOX A;  2WOV A;  2E1M A;  2OLN A;  4H4R A;  4ECH A;  2XCG A;  2FJD A;  4Z17 A;  1DJQ A;  2XFU A;  2PSN A;  4UDR A;  3AE7 A;  3H7V A;  3DFY A;  2GRT A;  4HYR A;  5FS9 A;  3I4K A;  3V3N A;  3T37 A;  1IJH A;  3DJJ A;  1N60 C;  4FDC B;  4H2N A;  4CRT A;  4J57 A;  3RED A;  4A9W A;  5BVA A;  3T6C A;  3JSK A;  4ROP A;  3AEA A;  2R0C A;  4H4Z A;  2WET A;  4B1B A;  4H83 A;  3LAD A;  1IUV A;  2WP9 A;  2RGJ A;  1DJN A;  2P8B A;  2X8C A;  3LZX A;  3AMZ A;  1BZL A;  2A87 A;  1BWC A;  2ACZ A;  4DHG A;  2OKT A;  3GWD A;  3NGC X;  4HB9 A;  4J33 A;  1PJ7 A;  1P2H A;  4E5T A;  2JAE A;  1GER A;  3C4N A;  3PFR A;  3P1W A;  4REK A;  1L9C A;  3FPZ A;  5U25 A;  4C74 A;  3M13 A;  4G6H A;  3OC4 A;  3MY9 A;  3GMC A;  4A6N A;  3UTE A;  4I59 A;  4H50 A;  1TKK A;  1OJ9 A;  2C75 A;  3NRN A;  3RP8 A;  4APN A;  1Y0P A;  3A7A A;  5CQF A;  1CHU A;  4RG4 A;  3RP6 A;  2Q7V A;  4FK1 A;  4JY3 A;  1N5W C;  2HZG A;  3F8P A;  1VQZ A;  1Y56 B;  1GT8 A;  4ENL A;  3NHO X;  3UCC A;  4OVI A;  4NEV A;  3UJF A;  1EL7 A;  1JRZ A;  1VDC A;  4Z1Y A;  3DG6 A;  2OZT A;  3P4S A;  4XXG A;  3COX A;  3NT6 A;  3ALM A;  2V3A A;  1N5X A;  3UXL A;  2AKZ A;  3N6H A;  5G5G B;  5HY5 A;  2AL2 B;  4IP5 A;  2WS3 A;  4ZCC A;  5KRQ A;  4HCH A;  4EQX A;  3HYW A;  4U8J A;  4OPT A;  2RGO A;  4H2H A;  5IQ1 A;  3SN1 A;  4O5Q A;  4CCR A;  3S5W A;  1FHV A;  4K8G A;  2XH2 A;  3GWF A;  2ZC8 A;  5DBJ A;  2C4C A;  2V5Z A;  1BKW A;  2GGE A;  4U2T A;  1PS9 A;  2PHH A;  3OZM A;  4M6U A;  2JK6 A;  3C4A A;  2OLA A;  1NPX A;  2WPC A;  1ELI A;  1B5Q A;  2OFJ A;  4TLZ A;  2R45 A;  2GGI A;  3DER A;  4DSG A;  3UP4 A;  3VC6 A;  3V76 A;  4XWZ A;  4Z2T A;  2NVK X;  5L46 A;  5JRB A;  4RSL A;  3NTA A;  4G7F A;  2BK3 A;  3T2K A;  2Q0K A;  2Z5X A;  4OPD A;  1LTX R;  4AP3 A;  3TOY A;  2BA9 A;  5J60 A;  4UDQ A;  4BUR A;  1ZMD A;  2AKM A;  3PK7 A;  2I5Q A;  1PDY A;  3IJL A;  1YQZ A;  3AE3 A;  2YG4 A;  3SZ0 A;  4X2P A;  1PXB A;  3ATR A;  4TM4 A;  3KUM A;  2P8C A;  3B9J B;  3ES8 A;  1KSS A;  5GRT A;  4PAA A;  3SZW A;  1DXL A;  3NLC A;  5KVH A;  1D7L A;  2E4G A;  1SB3 B;  2X3N A;  3QSS A;  3LXD A;  3AE4 A;  2AL2 A;  3SGL A;  4PAB A;  2BRA A;  3P0W A;  5IDZ A;  3BSM A;  3QN3 A;  2BYB A;  2XFO A;  3R10 A;  2BC1 A;  1CJC A;  4I58 A;  4A79 A;  3SXI A;  2OAM A;  1VDV A;  4CBQ A;  4U8L A;  2PTZ A;  4GRT A;  4GYP C;  3T31 A;  3T0K A;  4Z2R A;  4EMJ A;  2DKH A;  3FV9 A;  3NK0 X;  4CY6 A;  3OPS A;  3A7U A;  2BXS A;  4H2R A;  1F8W A;  1PBB A;  4M0X A;  3DG7 A;  2YVF A;  3FJ4 A;  2WPF A;  2BS2 A;  2QCU A;  4YT0 A;  3T2Y A;  3DK4 A;  1VQW A;  3NRZ B;  4K22 A;  2EQ9 A;  3FVD A;  1FFV C;  3FIM B;  1YKJ A;  1KCZ A;  3NS1 B;  1R6W A;  2GGJ A;  1SJA A;  4HCL A;  1EC8 A;  5HXI A;  2HXU A;  1NHQ A;  5ER0 A;  4GAP A;  1OEP A;  3H12 A;  4BJY A;  5BOF A;  2ZZB A;  1JPD X;  1WUE A;  3K30 A;  2Q0L A;  1S7M A;  2QJN A;  2VOU A;  3QKE A;  1ZK7 A;  3AN1 A;  3SN4 A;  4X9N A;  2JB3 A;  3TTE A;  1CBO A;  2AL1 A;  3IHG A;  1KKR A;  3CAW A;  1FFU C;  3M0O A;  3BI5 A;  1TDE A;  3VA8 A;  4AP1 A;  2PA6 A;  3QSM A;  2C73 A;  4H2P A;  4K8D A;  3SR6 B;  3UJE A;  3VRD B;  3AXB A;  1XPQ A;  3ZLF A;  1BKH A;  2B7R A;  4IZG A;  3DGZ A;  1NG4 A;  4JN9 A;  2V61 A;  1X2H A;  1JU2 A;  4MMW A;  1EBH A;  1TDF A;  3QFB A;  4LA1 A;  2VVM A;  3GDN A;  3I6D A;  2BK5 A;  3ITJ A;  3RHA A;  2CVJ A;  5J04 A;  2GQF A;  2YR5 A;  4U8K A;  2X8G A;  3MSY A;  3NZG A;  1BGJ A;  1E1L A;  4FK1 C;  1H82 A;  4EM4 A;  3VDG A;  3AEG A;  2H88 A;  2VVL A;  2WOW A;  4A5L A;  2C76 A;  1M64 A;  2VVL G;  1NU5 A;  2VQ7 A;  4HPN A;  5IQ4 A;  1N63 C;  1TYT A;  1TDK A;  1PHH A;  3DK9 A;  1GRA A;  1D4D A;  4EM3 A;  3UOY A;  3GC2 A;  2GSH A;  3AEE A;  1DOC A;  3HW2 A;  1E1K A;  4H4Q A;  1O95 A;  1JOA A;  3GRT A;  1V97 A;  1OJC A;  2GMJ A;  3BNU A;  1MDR A;  2V3B A;  4C3Y A;  4GGH A;  4NTD A;  1Q9I A;  1GRB A;  1FHU A;  5ENL A;  2WEU A;  2E5A A;  1V59 A;  1EC7 A;  2YR6 A;  3CNJ A;  1JRP A;  5BOE A;  3DG3 A;  1EC9 A;  4Z44 A;  2B9Y A;  4IHC A;  2GR2 A;  4NNJ A;  4TVY A;  2OQH A;  4DSH A;  4B64 A;  4GFI A;  3R11 A;  2YLZ A;  1GRT A;  2YVJ A;  3NO1 A;  1NEN A;  2B9W A;  4Y4M A;  2C66 A;  5JCM A;  3GYI A;  4DX3 A;  4KT2 A;  5FJP A;  1YY5 A;  2BCG G;  5M0Z A;  2WOI A;  3ZYX A;  4JDR A;  1M6I A;  2WPE A;  4A6G A;  1F8R A;  3R0U A;  2HQM A;  4U2L A;  1ZDL A;  3IJI A;  2XDO A;  3AEF A;  3CGE A;  3DDM A;  3A7R A;  2R0P A;  4DXK A;  2XGZ A;  1GTE A;  4II2 A;  3GSI A;  4BK1 A;  4KPR A;  4EQR A;  3QLD A;  4YTM A;  2OZ8 A;  4KEM A;  2WDQ A;  4JY2 A;  2PTX A;  4M52 A;  2AAQ A;  2PMQ A;  1JNR A;  4P9S A;  1Q1W A;  2FJE A;  2PPG A;  3CB3 A;  2W3S A;  1VG9 A;  4NWZ A;  3HYV A;  5KMP A;  4Z26 A;  1N4V A;  2ZZC A;  4JN7 A;  3CPI G;  1DNC A;  1E1M A;  4ZCD A;  2O56 A;  4YTP A;  5HHF A;  4G9K A;  1IUT A;  1K0L A;  3CPH G;  2OO6 A;  3SSZ A;  2EQ7 A;  2C70 A;  4HCD A;  4K5S A;  3T2Z A;  4EQW A;  4H4T A;  1F6M A;  3OZ2 A;  3OTR A;  4B69 A;  3UKH A;  3S5S A;  1HYU A;  3RO6 A;  4OCG A;  1N4U A;  1KF6 A;  4MKS A;  1L9D A;  4DGK A;  4E0V A;  2BAC A;  3S47 A;  3VRA A;  3CTY A;  1LQT A;  1GV4 A;  4NTC A;  2QA1 A;  3Q6J A;  2GVC A;  4GF7 A;  1H6V A;  3TJI A;  2OPJ A;  1ZY8 A;  4KWS A;  3UKQ A;  3QPE A;  1FL2 A;  1X31 B;  4Z24 A;  1XDI A;  4BV6 A;  4EIQ A;  1WYG A;  1IUS A;  3TJ4 A;  3U4F A;  1JRX A;  5JCL A;  1EL8 A;  2YAU A;  2GB0 A;  4EIP A;  3ZVI A;  4TM0 A;  3DJG X;  5CKU A;  4GME A;  4YWO A;  3CT2 A;  4JNQ A;  4Z43 A;  4USQ A;  1KSU A;  3SZF A;  3ES7 A;  4OPL A;  2XVH A;  1CC2 A;  1H83 A;  1RYI A;  2F5Z A;  4Y4L A;  3UKK A;  3UP5 A;  2PCE A;  3ISH A;  3R0K A;  2GH5 A;  3DGH A;  1JCT A;  2YLS A;  2GR0 A;  1GPE A;  1VRQ B;  3T8Q A;  2B9X A;  2OQY A;  2XH4 A;  3O0H A;  3ALL A;  4K7Z A;  3QVP A;  1F3P A;  3BI4 A;  2EQ6 A;  4OPC A;  3UJS A;  3FYY A;  2XVE A;  3B97 A;  2GAG B;  4TLX A;  3E1T A;  4H19 A;  1CC4 A;  1O94 A;  2WHD A;  4IVM B;  4H4S A;  2TMD A;  1LPF A;  2R46 A;  2XFN A;  4U8P A;  4OPG A;  5KOW A;  2XVJ A;  3LOV A;  3UXK A;  1QLB A;  2CUL A;  1BGN A;  4AT0 A;  1H86 A;  2PU0 A;  2XVI A;  3ADA B;  4D03 A;  4CNJ A;  1RSG A;  3K7Q X;  3GYX A;  3FBS A;  5BUL A;  1NHS A;  4NZH A;  2FKP A;  3DJE A;  4IV9 A;  4X9M A;  3SX6 A;  2PS2 A;  2Y6R A;  4H4W A;  4LII A;  4H4U A;  4GIR A;  2JBV A;  1NAA A;  4E4U A;  2PP3 A;  2XLS A;  3SFD A;  4C3X A;  3AEC A;  3M12 A;  3D8X A;  3ICS A;  5IPY A;  1QJD A;  1N61 C;  1PJ6 A;  1XS2 A;  4FI4 A;  2R4J A;  3FG2 P;  3D47 A;  3CGB A;  3UKA A;  4GAV A;  3PWI A;  1WUF A;  5FJR A;  1PDH A;  3KVE A;  2EQ8 A;  3STP A;  4IA5 A;  1QO8 A;  2YLW A;  3P4Q A;  2WDR A;  3VRB A;  3MUC A;  3DA1 A;  3T4W A;  3AE2 A;  5J7X A;  2VRM A;  1GRG A;  2GR3 A;  1FEC A;  1PDZ A;  3N4F A;  1P48 A;  5KMR A;  1ZP0 A;  2IID A;  4NTE A;  1TDN A;  1PBE A;  2GF3 A;  5FS6 A;  5HYM A;  4AOX A;  3BJS A;  1X2G A;  2XH0 A;  1D4C A;  4II3 A;  2FYM A;  4GCM A;  1YEY A;  3AD7 B;  3AB1 A;  4UDP A;  3HYX A;  3KPF A;  2GDQ A;  1W4X A;  1SJB A;  3VCC A;  3SZC A;  1ECQ A;  4N9X A;  6ENL A;  5KXJ A;  1MRA A;  3HRD C;  4A3R A;  3AE6 A;  2QQ6 A;  7ENL A;  3B6D A;  4YSX A;  2CHR A;  3ICT A;  3SN0 A;  3DK8 A;  1CC6 A;  1L9E A;  3AD8 B;  4HA6 A;  3P4P A;  3AE8 A;  2YG3 A;  1Z6L A;  3PWG A;  3NYC A;  4IVO B;  4HNL A;  3RGT A;  2E3T A;  3OZY A;  2QJM A;  2BCP A;  2JKC A;  2DW7 A;  3LZW A;  3UCD A;  3EF6 A;  1N4W A;  3BHF A;  2C64 A;  1AOG A;  1GEU A;  3DIP A;  2YG6 A;  2IVD A;  3IHM A;  2B76 A;  1GND A;  1XAN A;  1DTN A;  3NVW B;  3L1R A;  3ETR B;  5EOW A;  1TYP A;  2MNR A;  4U8I A;  3CGC A;  2QA2 A;  2ZBW A;  2XVF A;  1EBG A;  4YWS A;  1GAL A;  1RP0 A;  3NYE A;  4ICY A;  4YSH A;  4BJZ A;  3GD4 A;  3QVR A;  4B66 A;  3B3R A;  2J3N A;  2IVE A;  3THU A;  1XHC A;  3FMW A;  2XLT A;  3JVA A;  3DH9 A;  3L8K A;  1JDF A;  4ZOH B;  3ZLG A;  2V60 A;  4H1Z A;  3NTD A;  4YKG A;  4K2X A;  2PU1 A;  1EBD A;  2QJJ A;  4D04 A;  1DOB A;  4IA6 A;  3KKJ A;  4CY8 A;  3Q4D A;  2O9Z A;  3AYJ A;  2R9Z A;  1JRO A;  2ZZ0 A;  2OX4 A;  3NXL A;  4EMI A;  4AOS A;  3UGV A;  3NVY B;  4J34 A;  1L0V A;  3QJ4 A;  1CJ2 A;  3HPF A;  2X99 A;  4A99 A;  3G5R A;  4JQ9 A;  3KU9 A;  3UKL A;  1ZX9 A;  3MZN A;  4ZN0 A;  4U8O A;  2PTW A;  1Q1R A;  3NK2 X;  3UJR A;  3ENL A;  2WU5 A;  1FCD A;  3MQT A;  1BF3 A;  4WCT A;  1JNZ A;  2OLO A;  4A7A A;  2ONE A;  3UOV A;  3CGD A;  3OP2 A;  4MGG A;  5EB5 A;  4C5O A;  2GGH A;  2DKI A;  3H8L A;  4TVW A;  3TQP A;  3H8A A;  2GAH B;  2QVH A;  2YVG A;  4KPL A;  2DW6 A;  3ABV A;  2APG A;  3NG7 X;  5JCN A;  1MNS A;  3GD6 A;  5BUK A;  3PVC A;  3PG6 A;  4H2Q A;  3CPJ G;  4HN8 A;  3UJ2 A;  2X8H A;  1GRE A;  3IC9 A;  2XLU A;  3K1G A;  3C96 A;  1GSN A;  3R9U A;  1LV0 A;  2QAE A;  1COY A;  3MKC A;  2OAL A;  1EL5 A;  3DME A;  5M10 A;  2BS4 A;  5KVI A;  3RR1 A;  3RNM A;  4B63 A;  2GQW A;  1D4E A;  3Q9T A;  2WP6 A;  1IUW A;  3OW1 A;  3D9X A;  1IYX A;  3KPK A;  3EEZ A;  4F4R A;  4DYE A;  5EU9 A;  4YSY A;  3GRS A;  3RP7 A;  1UKV G;  3SYI A;  3NK1 X;  1KD0 A;  1MOK A;  4BK2 A;  2P88 A;  1ONF A;  3V5F A;  4DN1 A;  3AM9 A;  5EBK A;  5EB4 A;  4IT1 A;  4NEW A;  3ZVH B;  1DOE A;  5BRT A;  1FIQ B;  3Q45 A;  2YLT A;  3CNP A;  1B8S A;  1IUU A;  2W54 A;  1O5W A;  3NH3 X;  3SJN A;  2C7G A;  2XH7 A;  4U8M A;  3AE1 A;  1NDA A;  1TRB A;  1STZ A;  2XYO A;  3NYF A;  2PTY A;  1ZOV A;  2C72 A;  1E39 A;  4OPI A;  3GO2 A;  3T9P A;  4G73 A;  2YQU A;  3T14 A;  4E6M A;  2OG9 A;  2Q6U A;  1R0M A;  1IUX A;  3KA7 A;  3EAO A;  1K0I A;  1XPY A;  3VC5 A;  3CNT A;  2GGG A;  2XLR A;  3IJQ A;  3F8R A;  3IF9 A;  2VZ2 A;  1S2Q A;  3AD9 B;  1S3E A;  4LU6 A;  2CDU A;  4G74 A;  3RRA A;  5KMS A;  3SQS A;  2RGH A;  1KN0 A;  3ICR A;  1GET A;  3NN6 X;  3IK4 A;  2YR4 A;  2YLX A;  1TDO A;  2I0Z A;  2OA1 A;  2GMH A;  3JZU A;  4AT2 A;  3UOX A;  2AR8 A;  1GES A;  2P3Z A;  1NHR A;  5KMQ A;  1YQ4 A;  3VCN A;  2XLP A;  3S61 A;  2H89 A;  2WDV A;  2XFP A;  3UKF A;  2WBA A;  3EKG A;  2WQY A;  2C65 A;  3II4 A;  5FJO A;  1F8S A;  2YWL A;  3VR9 A;  3CXB A;  3CK5 A;  3IWA A;  1MUC A;  4GDP A;  2QGY A;  3BHK A;  1REO A;  1JEH A;  5U1O A;  3ZVH A;  3ZLH A;  1SEZ A;  1LVL A;  4Z2U A;  3NVZ B;  5FJT A;  3VFC A;  3F8D A;  4H4X A;  2QDE A;  1PBD A;  2WU2 A;  2Z5Y A;  2PP1 A;  3GDP A;  3AEB A;  2RAB A;  2BK4 A;  2BC0 A;  2MUC A;  2PGW A;  3JW7 A;  1YQ3 A;  2YG5 A;  4A35 A;  1NHP A;  1K4Q A;  3TWA A;  3VR8 A;  3P4R A;  4J1O A;  3SQP A;  4J2W A;  2P0I A;  2V6O A;  2GL5 A;  5G5H B;  1W6T A;  2ZAD A;  3ZDN A;  1D7Y A;  4KX6 A;  3H70 A;  1F9C A;  1JRY A;  4EMW A;  3LJP A;  2ARD A;  4IL0 A;  1BQG A;  4U8N A;  4WX1 A;  3NFU A;  1FO4 A;  3EUB 3;  4GGB A;  4YSZ A;  3SFE A;  4G6G A;  3RCY A;  3NVV B;  3AWI A;  4J3Z A;  1K0J A;  1ZKQ A;  2HXT A;  1ZOY A;  1TZZ A;  3UTH A;  3RIT A;  1LQU A;  3GY1 A;  1Y56 A;  2PP0 A;  3G5Q A;  4FP1 A;  4H7U A;  5FMH A;  1B37 A;  1ELS A;  3QTP A;  3DGB A;  1PXC A;  3NNE A;  1GOS A;  4U2S A;  4IL2 A;  4K5R A;  3BI2 A;  3G5S A;  5JCI A;  1OJT A;  1MXT A;  3UKP A;  3AE9 A;  4DWD A;  2GR1 A;  3R1Z A;  1OJD A;  1CJ3 A;  3BNM A;  3HZL A;  1S3B A;  3WE0 A;  3V4B A;  5KNL A;  1CF3 A;  1PBC A;  1H7W A;  2FJB A;  4TM1 A;  3N6J A;  2W55 A;  3TCS A;  4B65 A;  4J31 A;  1N62 C;  2HNE A;  3H4K A;  3P3B A;  1PXA A;  3H8I A;  1H84 A;  3UOZ A;  4E4F A;  3CN8 A;  2BRY A;  1P2E A;  2YG7 A;  4JHM A;  3GD3 A;  3UCL A;  1H2I A;  3NIX A;  3R07 C;  3UTF A;  1SJD A;  2WES A;  4B68 A;  2YLR A;  1T3Q C;  4IP4 A;  2RDX A;  1PN0 A;  4H4V A;  1RVK A;  1GRF A;  3P9U A;  3QSE A;  1GXF A;  1H7X A;  1RM6 B;  3I6T A;  2OZ3 A;  2WP5 A;  2OVL A;  1N1P A;  3ALJ A;  2W3R A;  3AED A;  2B7S A;  3CND A;  2AQJ A;  4JN8 A;  3SY4 A;  2VRL A;  1D5T A;  3K7T A;  3TWB A;  2X50 A;  4J56 A;  1OJA A;  2R4E A;  3CXO A;  3K7M X; 
#chains in the Genus database with same CATH homology
 3H8L A;  4OPD A;  1LTX R;  2E5V A;  4H4Y A;  3AYI A;  4AP3 A;  2BA9 A;  1GTH A;  1ZY8 A;  4CNK A;  5J60 A;  2GEW A;  2GAH B;  3GYJ A;  3UKQ A;  2YM2 A;  1FL2 A;  1X31 B;  4BUR A;  2YVG A;  1ZMD A;  4UDQ A;  4Z24 A;  1XDI A;  3CNS A;  4BV6 A;  3ABV A;  4EIQ A;  3KLJ A;  2APG A;  1IUS A;  3NG7 X;  1B4V A;  5JCN A;  1YQZ A;  3AE3 A;  1JRX A;  5BUK A;  3PVC A;  3PG6 A;  3KD9 A;  5JCL A;  2YG4 A;  1EL8 A;  3SZ0 A;  2YAU A;  2GB0 A;  4H2Q A;  4EIP A;  3CPJ G;  4TM0 A;  1PXB A;  1PBF A;  3ATR A;  4TM4 A;  2X8H A;  3DJG X;  5CKU A;  5LV9 A;  1GRE A;  4YWO A;  4DNA A;  1FEB A;  3IC9 A;  4JNQ A;  2JB1 A;  4Z43 A;  1KSS A;  3LB8 A;  2XLU A;  5GRT A;  3C96 A;  4PAA A;  1GSN A;  3R9U A;  3SZW A;  1DXL A;  4USQ A;  1LV0 A;  1KSU A;  2QAE A;  3NLC A;  3SZF A;  5KVH A;  1COY A;  1D7L A;  1DOD A;  3PO7 A;  2E4G A;  2OAL A;  3I3L A;  4OPL A;  1EL5 A;  3DME A;  2X3N A;  5M10 A;  2BS4 A;  1CC2 A;  2XVH A;  5KVI A;  1H83 A;  3RNM A;  3LXD A;  2YM1 A;  3AE4 A;  3QSS A;  1CJ4 A;  1RYI A;  4OPU A;  4B63 A;  2GQW A;  3SGL A;  5GSN A;  1D4E A;  3UTG A;  3Q9T A;  4Z25 A;  4PAB A;  2BRA A;  2W0H A;  2C3C A;  2F5Z A;  1CL0 A;  1EL9 A;  4Y4L A;  4YXD A;  3AYL A;  3UKK A;  2WP6 A;  1IUW A;  3UP5 A;  1VG0 A;  4ADW A;  1FEA A;  2JB2 A;  2FBW A;  3D9X A;  2BYB A;  2XFO A;  3AE5 A;  3ISH A;  3KPK A;  2GH5 A;  3DGH A;  2FJA A;  2YLS A;  4YSY A;  2GR0 A;  1GPE A;  1VRQ B;  3GRS A;  2BAB A;  3RP7 A;  2A8X A;  2BC1 A;  2C67 A;  1CJC A;  1UKV G;  2B9X A;  4I58 A;  3VQR A;  3SYI A;  4A79 A;  3NK1 X;  1NEK A;  3SXI A;  2OAM A;  5FS7 A;  2TPR A;  4U8L A;  2NPX A;  3O0H A;  4CBQ A;  1MOK A;  3L5O A;  4GRT A;  3ALL A;  3SM8 A;  3T31 A;  3T0K A;  4K7Z A;  3QVP A;  4BK2 A;  1F3P A;  3BI4 A;  4Z2R A;  1ONF A;  2EQ6 A;  3NN0 X;  4Y4N A;  4OPC A;  2R0G A;  4EMJ A;  4RG3 A;  4YKF A;  2XVE A;  1MO9 A;  5EBK A;  2DKH A;  2GAG B;  2VQB A;  4TLX A;  2GV8 A;  3E1T A;  3NK0 X;  1CC4 A;  5EB4 A;  1O94 A;  4CY6 A;  1GRH A;  4NEW A;  1DOE A;  2WHD A;  4IVM B;  5BRT A;  4H4S A;  2TMD A;  1LPF A;  2R46 A;  4X4J A;  2BXS A;  2XFN A;  1S2Y A;  4H2R A;  1F8W A;  1PBB A;  2YLT A;  3CNP A;  4U8P A;  1B8S A;  5FS8 A;  2YVF A;  3ATQ A;  2WPF A;  1IUU A;  1NG3 A;  1KNP A;  4OPG A;  4YTN A;  2BS2 A;  3PS9 A;  5KOW A;  2QCU A;  3V3O A;  1O5W A;  2XVJ A;  3LOV A;  3EAN A;  3NH3 X;  4YT0 A;  2C7G A;  3T2Y A;  1QLB A;  4U8M A;  3DK4 A;  2CUL A;  1BGN A;  3AE1 A;  1VQW A;  1NDA A;  4AT0 A;  1H86 A;  1TRB A;  4GDE A;  2XVI A;  4H4P A;  3ADA B;  4K22 A;  4EQS A;  2EQ9 A;  4D03 A;  4CNJ A;  1E6E A;  2XFQ A;  2XYO A;  3FIM B;  1KDG A;  1RSG A;  2UZZ A;  3K7Q X;  3NYF A;  1YKJ A;  1ZOV A;  2C72 A;  3CIR A;  1E39 A;  4MJW A;  3GYX A;  4OPI A;  3URH A;  3FBS A;  4G73 A;  5BUL A;  1NHS A;  2YQU A;  4NZH A;  3T14 A;  5HXI A;  1NHQ A;  5ER0 A;  4GAP A;  4B67 A;  4BJY A;  3DJE A;  2ZZB A;  3DJD A;  4IV9 A;  4X9M A;  3K30 A;  3SX6 A;  2Q0L A;  1LJ1 A;  1S7M A;  2VOU A;  2Q6U A;  5C2T A;  4C77 A;  1ZK7 A;  1KFY A;  2Y6R A;  4H4W A;  2JB3 A;  4LII A;  4H4U A;  4GUV A;  4X9N A;  1IUX A;  5JCK A;  2JBV A;  1NAA A;  1CBO A;  2XLS A;  3KA7 A;  3SFD A;  3IHG A;  3EAO A;  4C3X A;  2Y6Q A;  3AEC A;  3M12 A;  1K0I A;  4FX9 A;  3CNT A;  3M0O A;  5TR3 A;  3BI5 A;  1TDE A;  2XLR A;  3D8X A;  1E7P A;  3F8R A;  3ICS A;  4A65 A;  5IPY A;  2PYX A;  3CMM A;  1QJD A;  3IF9 A;  2VZ2 A;  1S2Q A;  3AD9 B;  1PJ6 A;  1S3E A;  4LU6 A;  4AP1 A;  3QSM A;  4BK3 A;  2C73 A;  4TM3 A;  4H2P A;  4K8D A;  3GMB A;  4XWR A;  2R4J A;  2CDU A;  3FG2 P;  1ZMC A;  4G74 A;  3CGB A;  3UKA A;  4GAV A;  3VRD B;  5KMS A;  3AXB A;  4USR A;  1XPQ A;  4A6N B;  5C3J A;  4JNA A;  1PJ5 A;  2RGH A;  1KN0 A;  1PDH A;  2B7R A;  3ICR A;  1GET A;  4O5U A;  3KVE A;  2EQ8 A;  3NN6 X;  4IA5 A;  1H81 A;  2BXR A;  1QO8 A;  3DGZ A;  3NKS A;  2YLW A;  2YR4 A;  1NG4 A;  2YLX A;  4JN9 A;  1TDO A;  2I0Z A;  3P4Q A;  2OA1 A;  2V61 A;  2WDR A;  3VRB A;  2CFY A;  1JU2 A;  2GMH A;  3DA1 A;  4J36 A;  4UP3 A;  4AT2 A;  3AE2 A;  1TDF A;  3EPT A;  3UOX A;  2AR8 A;  3QFB A;  4LA1 A;  2BS3 A;  1GES A;  2VVM A;  5J7X A;  2VRM A;  3GDN A;  5U63 A;  1NHR A;  3I6D A;  1GRG A;  2GR3 A;  3QFA A;  1FEC A;  1E1N A;  1KNR A;  2BK5 A;  3ITJ A;  4GR1 A;  5KMQ A;  2CVJ A;  3RHA A;  5KWF A;  1YQ4 A;  2A89 A;  2GQF A;  2X8G A;  1BGJ A;  1E1L A;  2YR5 A;  2XLP A;  4FK1 C;  4U8K A;  3S61 A;  2H89 A;  5KMR A;  2WDV A;  2XFP A;  1ZP0 A;  1H82 A;  2IID A;  4NTE A;  3UKF A;  4EM4 A;  4CCQ A;  2WBA A;  2C3D A;  3D1C A;  2WQY A;  1FOH A;  3AEG A;  2C65 A;  2H88 A;  2VVL A;  1TDN A;  3II4 A;  2WOW A;  1PBE A;  5KOX A;  2GF3 A;  4A5L A;  5FS6 A;  2WOV A;  1F8S A;  2C76 A;  2E1M A;  5HYM A;  1M64 A;  2VVL G;  2OLN A;  2YWL A;  3VR9 A;  4AOX A;  2VQ7 A;  5IQ4 A;  4H4R A;  3IWA A;  1TYT A;  4GDP A;  1D4C A;  3BHK A;  1TDK A;  4II3 A;  1REO A;  1PHH A;  1JEH A;  4ECH A;  4GCM A;  5U1O A;  3AD7 B;  3DK9 A;  1GRA A;  1D4D A;  2XCG A;  3AB1 A;  4EM3 A;  2FJD A;  3HYX A;  1DJQ A;  4UDP A;  2XFU A;  3UOY A;  3KPF A;  1SEZ A;  3AEE A;  4UDR A;  1W4X A;  1DOC A;  1LVL A;  3AE7 A;  4Z2U A;  1E1K A;  2GRT A;  4H4Q A;  1O95 A;  1JOA A;  3GRT A;  5FS9 A;  3SZC A;  3V3N A;  3F8D A;  4N9X A;  4H4X A;  1OJC A;  5KXJ A;  1PBD A;  2GMJ A;  3BNU A;  2WU2 A;  3T37 A;  2Z5Y A;  1IJH A;  3GDP A;  2V3B A;  3AEB A;  3DJJ A;  4C3Y A;  3AE6 A;  4FDC B;  4NTD A;  2RAB A;  4H2N A;  4CRT A;  4J57 A;  2BK4 A;  1Q9I A;  3RED A;  1GRB A;  2BC0 A;  3B6D A;  4A9W A;  2WEU A;  1V59 A;  1YQ3 A;  4YSX A;  2YG5 A;  5BVA A;  1NHP A;  3ICT A;  1K4Q A;  2YR6 A;  3VR8 A;  3CNJ A;  3P4R A;  3SQP A;  3JSK A;  3DK8 A;  1CC6 A;  1L9E A;  4J2W A;  2V6O A;  3AD8 B;  4HA6 A;  3P4P A;  4Z44 A;  3AE8 A;  2B9Y A;  3AEA A;  2YG3 A;  1Z6L A;  2GR2 A;  2R0C A;  3NYC A;  4H4Z A;  2WET A;  4IVO B;  3ZDN A;  4NNJ A;  1D7Y A;  4KX6 A;  4B1B A;  3LAD A;  4DSH A;  4B64 A;  1IUV A;  2WP9 A;  2RGJ A;  1DJN A;  2X8C A;  2BCP A;  3LZX A;  2YLZ A;  1BZL A;  2JKC A;  1JRY A;  4EMW A;  2A87 A;  2ARD A;  3LJP A;  1BWC A;  2ACZ A;  1GRT A;  2YVJ A;  1NEN A;  3LZW A;  3EF6 A;  1N4W A;  2B9W A;  2C66 A;  5JCM A;  3GWD A;  4Y4M A;  3NGC X;  3BHF A;  4HB9 A;  4J33 A;  3GYI A;  1PJ7 A;  1P2H A;  2JAE A;  4U8N A;  1GER A;  2C64 A;  1YY5 A;  2BCG G;  3C4N A;  2WOI A;  3P1W A;  4WX1 A;  5M0Z A;  1AOG A;  4REK A;  3ZYX A;  1L9C A;  3FPZ A;  4JDR A;  5U25 A;  4C74 A;  4YSZ A;  3SFE A;  1GEU A;  3M13 A;  1M6I A;  4G6G A;  2WPE A;  4G6H A;  3OC4 A;  3AWI A;  3GMC A;  1F8R A;  1K0J A;  1ZKQ A;  4A6N A;  2YG6 A;  3UTE A;  1ZOY A;  4I59 A;  2IVD A;  4H50 A;  3IHM A;  2HQM A;  4U2L A;  2B76 A;  1ZDL A;  1OJ9 A;  1GND A;  2C75 A;  3UTH A;  1XAN A;  3NRN A;  3RP8 A;  4APN A;  1Y0P A;  1LQU A;  3L1R A;  5CQF A;  1CHU A;  2XDO A;  4RG4 A;  5EOW A;  3AEF A;  3CGE A;  1Y56 A;  2Q7V A;  2R0P A;  3RP6 A;  4FK1 A;  1TYP A;  4JY3 A;  3G5Q A;  4H7U A;  1GTE A;  4U8I A;  4II2 A;  3F8P A;  5FMH A;  3CGC A;  1Y56 B;  1B37 A;  2QA2 A;  2ZBW A;  1GT8 A;  2XVF A;  3GSI A;  4BK1 A;  3NHO X;  4OVI A;  1PXC A;  4KPR A;  4NEV A;  1GOS A;  3NNE A;  1GAL A;  4U2S A;  4EQR A;  1EL7 A;  4YTM A;  1RP0 A;  1JRZ A;  1VDC A;  4K5R A;  3NYE A;  4ICY A;  2WDQ A;  3BI2 A;  3G5S A;  4JY2 A;  4YSH A;  5JCI A;  4BJZ A;  4M52 A;  1OJT A;  3GD4 A;  2AAQ A;  1MXT A;  3QVR A;  4B66 A;  3UKP A;  3AE9 A;  3B3R A;  2GR1 A;  2J3N A;  1JNR A;  4P9S A;  2IVE A;  1OJD A;  3P4S A;  1Q1W A;  1XHC A;  1CJ3 A;  3FMW A;  4XXG A;  2XLT A;  2FJE A;  3BNM A;  3HZL A;  1S3B A;  3WE0 A;  3COX A;  3NT6 A;  3DH9 A;  5KNL A;  3L8K A;  1CF3 A;  2V3A A;  1PBC A;  1H7W A;  1VG9 A;  2FJB A;  3ALM A;  4NWZ A;  3HYV A;  4TM1 A;  5HY5 A;  5KMP A;  4Z26 A;  2V60 A;  1N4V A;  2ZZC A;  4B65 A;  4J31 A;  2WS3 A;  4ZCC A;  4YKG A;  3NTD A;  4K2X A;  3H4K A;  5KRQ A;  1EBD A;  4D04 A;  1DOB A;  1PXA A;  4IA6 A;  4EQX A;  3KKJ A;  3H8I A;  3HYW A;  1H84 A;  3UOZ A;  3CPI G;  4U8J A;  3CN8 A;  4CY8 A;  2O9Z A;  4OPT A;  3AYJ A;  2RGO A;  2BRY A;  1P2E A;  2YG7 A;  2R9Z A;  1DNC A;  1E1M A;  4ZCD A;  2ZZ0 A;  5IQ1 A;  4YTP A;  3GD3 A;  4O5Q A;  4CCR A;  3S5W A;  3UCL A;  1H2I A;  5HHF A;  4EMI A;  4G9K A;  1IUT A;  4AOS A;  1K0L A;  3CPH G;  3NIX A;  3GWF A;  2EQ7 A;  3UTF A;  2C70 A;  4J34 A;  5DBJ A;  1L0V A;  3QJ4 A;  2WES A;  4B68 A;  1CJ2 A;  2X99 A;  4K5S A;  3T2Z A;  4A99 A;  4EQW A;  2YLR A;  2C4C A;  4H4T A;  3G5R A;  4JQ9 A;  1F6M A;  3KU9 A;  3OZ2 A;  3UKL A;  4B69 A;  1ZX9 A;  2V5Z A;  1BKW A;  1PN0 A;  3UKH A;  4H4V A;  4U2T A;  1GRF A;  1PS9 A;  4ZN0 A;  1HYU A;  2PHH A;  4U8O A;  3P9U A;  1Q1R A;  3NK2 X;  1N4U A;  1FCD A;  2WU5 A;  4OCG A;  3QSE A;  2JK6 A;  1KF6 A;  3C4A A;  1BF3 A;  1NPX A;  1GXF A;  2WPC A;  4E0V A;  1L9D A;  4DGK A;  1ELI A;  1H7X A;  4WCT A;  1JNZ A;  1B5Q A;  2OLO A;  4TLZ A;  4A7A A;  2R45 A;  2BAC A;  4DSG A;  3UOV A;  3UP4 A;  2WP5 A;  1N1P A;  3ALJ A;  3VRA A;  3CTY A;  3AED A;  1LQT A;  3V76 A;  1GV4 A;  2B7S A;  4NTC A;  4XWZ A;  3CGD A;  3CND A;  4Z2T A;  2NVK X;  2AQJ A;  2QA1 A;  3SY4 A;  2VRL A;  5L46 A;  1D5T A;  5JRB A;  4RSL A;  3NTA A;  2BK3 A;  3K7T A;  2X50 A;  3Q6J A;  4J56 A;  1OJA A;  2GVC A;  2R4E A;  4GF7 A;  5EB5 A;  3T2K A;  3K7M X;  4C5O A;  2DKI A;  2Q0K A;  2Z5X A;  1H6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...